2Y20A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
TITRPIIELSNTIDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UNCHARACTERIZED PROTEIN
publication title The Mechanisms of Hamp-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y20A00
2Y0TA 2L7HA 4I5SA 2Y20A 2Y0QA 2L7IA 2Y21A
chains in the Genus database with same CATH superfamily
2X4AA 1N75A 2DHYA 4MH0E 4I8OA 3CGWA 3E4RA 1MU5A 1KSFX 1HQCA 5DFLA 2E5LM 2ZAMA 4AZFA 3LCUA 3LCVB 3W68A 1QYRA 2R65A 3QYBA 5ITYA 4KT0F 1XC8A 1QAOA 3BBZA 1IY2A 1TH2A 4D81A 1G59A 4JI1M 4DV0M 4NXMM 2L09A 1E9RA 3DZDA 3KVWA 4LRSA 2RGOA 4AG6A 3GO8A 3LVVA 4B3MM 3M7GA 2R4EA 4LGYA 3ZCBB 4I5SA 1NNJA 2BJWA 3FUVA 4IBFA 1F4IA 3U5ZA 1OIZA 2R45A 5GKNA 2C5RA 4L8RC 2GNOA 1N33M 3HHZA 5EP3A 1K82A 4JI7M 1NSFA 4M0DA 4IIWA 4BBAA 4G4RA 2G5GX 5FTJA 4Z6YA 2QBYA 3K1JA 3SAVA 4FVMA 2KA6B 3U61A 4JYAM 4LJ8A 2DAMA 3M0EA 2APLA 1QZEA 1JR3D 1MX0A 2GQFA 1HT1E 2YR0A 3EIHA 5EP1A 5EXPA 1YUBA 3SHGB 5A2QS 1G3IA 5ITXA 1QANA 4A3VB 4AW4A 2UXBM 1UFZA 4M9ZA 2LVOC 3RFWA 1C7YA 2LBCA 2LHGA 3B7QA 3PNYA 2O01F 1HNZM 3HU2A 2EUCA 4PD2A 2CRUA 5KPZA 2UU9M 3DFZA 4RNAA 4DR7M 3VFDA 1P3QQ 1LTMA 3L25A 2MR9A 1GLNA 4W5WA 5EXSA 3TQSA 2Y21A 2CV2A 3SATA 2ZM6M 1WJ7A 4DV4M 4MGHA 7CATA 2F5QA 4DBGB 2EKKA 1D0MA 3K92A 2FFJA 3NBIA 1NVMA 3U6SA 3C3DA 3T38A 3LVWA 4JXJA 2HWJA 2H1RA 1Z6TA 3VK7A 4OW0A 1IQPA 4JI4M 1WHCA 4LY6A 1KFVA 2XSZA 4QNMA 1AUAA 3A45A 2I7PA 3HY5A 1NNUC 4KODA 2ZANA 3U60B 2UUCM 2D7HA 2AHMA 5KPRA 4LZZA 1JB0F 2H5XA 2J7OA 2XFSA 4X65M 2WSCF 3FTDA 3PFIA 1RU3A 4M9SA 1XWIA 1IXZA 1FJGM 1XB2B 4JI6M 1OAIA 1GO5A 2JZ1A 5EXTA 4FCTA 1TH3A 3HHWA 2DZNB 4XK8F 1D0LA 4NSOB 3A98B 1YSYA 2DAKA 1IN7A 3KP1E 4G6ZA 2KXEA 5FTNA 4CGYB 5F3WA 3GQ3A 5KO3A 2JA2A 3KXEC 4WURA 3LW5F 1IN5A 1XNRM 1HQYE 4AKIA 3SYLA 1N78A 3I04M 4GH9A 3VK8A 1TGUA 4D80A 3U6QA 1IXRC 3AOEC 2DZLA 1TR8A 4DV5M 4EIWA 3W0FA 3FRIA 2KNZA 4G4NA 2C98A 1ZV1A 3DOAA 3AKZA 2CHVA 3BOSA 2CV0A 3TWLA 3RGSA 2Y0QA 5ITRA 2JY8A 5IZ7D 2QNJA 3E21A 2L6OA 5EXXA 2JWSA 5FTKA 1J09A 4HL4A 3MJ5A 4OVZB 2CHQA 3T15A 3JR5A 3SAWA 2KHHA 4RF0A 2Z7JA 1KYIA 3GRVA 1I94M 3KDSE 3I4YA 2V1CA 4GEWA 1WR1B 2R44A 1ZAEA 5EJCA 1EIJA 5EQTA 5H37D 3J27B 4IBBA 4DUZM 1HT2E 3FUWA 4PDGA 3KS4A 2FH0A 1L2CA 4LJ9A 1VDLA 3FUXA 3GPUA 1OFHA 2R46A 2L2DA 2RKOA 3HHXA 4IBKA 3HU1A 3BXWA 4L78A 1JR3E 3GLHB 2EKFA 3JAMS 3DA1A 5LMUM 1SXJB 3ZC7B 1IN6A 4CIZA 1OJLA 1MN3A 3GLHE 1T6OA 1N32M 4B7HA 1CUKA 4L16A 3VDUA 1SXJE 3ILKA 4MB7A 2YFQA 3MMPA 4FCVA 1OFIA 1E32A 1Z5BA 1JQJC 1S3SA 2BNKA 2CV1A 3OTOM 3SAUA 4PCZA 1Y8GA 4DUYM 1HNXM 4FD2A 3TWKA 2KW0A 4I81A 1W5TA 3FRHA 4LJ7A 3LQQA 1IN4A 1H6UA 4DR2M 1QDRA 4NL4H 1VQ1A 2EJSA 3ZH9B 1WGLA 2DHRA 2I7NA 3E46A 1K3WA 2BWBA 4MM3B 1N77A 1NY6A 3LMMA 3TPZA 3AOGA 4IBDA 2C9CA 3GP1A 2VIIA 2LH0A 4M9XA 1D0KA 2KEBA 4KO8A 4HEOA 4QOZC 4HLQA 1IBLM 3GRUA 3L29A 1R7RA 4PT5A 3FTFA 1IY1A 1V34A 1YE9A 2ZAOA 3VKGA 4NXNM 1GJSA 4WW0A 3C9PA 2C99A 1A5TA 3PVSA 2F5OA 2LNHC 2WSEF 1Z5CA 2QBYB 3UMMA 2BJVA 4DR6M 3GLGB 2OOBA 1SXJD 5FTMA 1TF0B 1DO0A 2XF3A 1ZQ9A 2CHGA 3HJQA 4PDIA 1Q39A 1VG5A 3GLGE 2KZUA 2HCBA 4XGIA 4DV3M 2L4FA 1SXJC 2CE7A 5JI2E 4G3OA 2JP7A 3GPXA 2OO9A 2R62A 3U6DA 3VKHA 3HGIA 3CF0A 4QOSA 2DENA 5KQ8A 2F4VM 3GLFB 3T6PA 4LF6M 3AOEA 4DR4M 1TTEA 2JY5A 4KHPM 1K3XA 3FYDA 3I01M 3GLFE 3T1YM 1G8PA 3CTWB 4X62M 2Z3XA 1XMQM 1DGHB 1PJTA 2ZTDA 2FOIC 2K9DA 2DAGA 2DZOB 2YNMD 1TDZA 5ITQA 3I4VA 2D7EA 2RRUA 3RE8A 1AIPC 2O25A 2D7GA 3R8FA 4FWGA 2F5NA 2XH9A 3SHFA 1OQYA 1NHWC 3MHVC 2XEPA 5IREB 4MGIE 2CUZA 1QUTA 3I51A 2XLJA 3GRRA 4DR3M 2JUJA 4LF4M 3VDPA 4GIPA 3AV0A 2KZSA 3R9XB 4JI0M 4GKJM 3K8ZA 2UUAM 1VDDA 2ZBKB 4LCBA 4X64M 1ORYB 3U6MA 3L28A 4REZA 1LV7A 1BVSA 1V92A 1QUSA 4UN2B 3SARA 2QCUA 2F5PA 2KRKA 2LHCA 3HWSA 4LG2A 4M0WA 2KDLA 3HHYA 4LFAM 2DWNA 4FWHA 1NJGA 4GC9A 3C58A 3B7ZA 4B3SM 4QNRA 3GQ4A 1SG9A 3B9PA 3KOXE 3GPPA 2L7HA 1E9SA 4AI6A 3RGPA 2JXNA 1MJGM 1NHGC 4MGZE 4AQYM 2HL7A 1UM8A 1XXHB 1T3TA 3KP0E 3HJSA 4X66M 2Y0TA 2EO2A 5IWAM 4G4QA 5DYGA 1OKSA 1XXHE 2HKJA 4IBIA 4LZJA 2DAEA 4JI3M 3Q8GA 2X49A 4LGMA 4JV5M 1C1KA 3J80S 3FTEA 2MH8A 4IJFA 4R3DA 4R71A 2WZJA 1R2YA 2JZ0A 2M60A 5FTLA 1L1TA 4ITQA 3D8LA 4OVZA 3AJIB 4R7GA 1DGGA 3EIEA 3VLFB 2RGHA 1GL7A 1TDHA 4ANRA 3U6CA 1L2BA 5BPVA 4OU7A 1IN8A 3B74A 4P16A 4OX9M 2MROB 4B3TM 4NOOB 3UK6A 2DI0A 3TL4X 3NBXX 3CF6E 1IXSB 1G4AE 2L7IA 5E6JA 1PM5A 1X37A 1JR3A 3SMPA 1GJTA 1IFYA 3J7BA 3GLIB 4AKGA 4LJ4A 2VF8A 4CJ6A 2KRUA 3GLHA 2XFTA 1Q3CA 1PGYA 4IBCA 3GLIE 1SXJA 3HZJA 4BLCA 2C96A 1N34M 1NV9A 4MGYE 4F2LA 3PNVA 2Z4SA 4AG5A 3U6OA 4II7A 1D2NA 1VEJA 1G71A 2LVQD 4GITA 1R4GA 3HJ8A 1Z5AA 2QPAA 1IBMM 1EFUB 3E9SA 1NO1A 1L2DA 2J5YA 4IJEA 5IT9S 3MK6A 5LMNM 1WXQA 2QZ4A 1E94E 3B7NA 1ZMUA 3W67A 4LFCM 2LVPC 3QYEA 2MGWA 5FSWA 3U5ZB 2X8AA 1PJQA 5KPTA 4GHAA 1DV0A 3FTCA 3FUTA 3C3EA 3K2LA 2HAKA 2Q2EB 5L8RF 1Q02A 2G3QA 2R18A 4L15A 3THGA 2FS1A 2LVAA 2KNVA 2G8LA 3U61B 2Z4RA 4CISA 4GHLA 3QAUA 2VDBB 1QAMA 2B3TA 2V1UA 4DV1M 2CP8A 4GC5A 5DYIA 3SMSA 1R6BX 2WSFF 2LVNC 3KW6A 4P17A 3TE6A 1IBKM 4B08A 2LWXA 1HR0M 2EA0A 2OPFA 5ITXE 1T43A 1VEGA 3UGJA 2XZUA 3K9OA 4NRVA 3L27A 3FYCA 3A42A 2VQFM 2K6BA 3GLGA 1QDTA 4I4LA 5EP4A 1FNNA 1DGBA 2QP9X 2R6FA 2QQ8A 3KOZE 2NQ8C 4KLNA 2CFOA 3WHLA 2FE8A 2DXIA 1OIPA 1PJSA 2OOAA 4F1IA 3SBJA 1YLAA 4DV7M 1ZMVA 3A46A 2M5ZA 4DR1M 2JY6B 2UXDM 3GLFA 5EP2A 2DVWB 1J5EM 8CATA 3ZQJA 4WP2A 2XGNA 1WIVA 3FKEA 4L4UA 4L6V6 5FLXS 2C9OA 1DGHA 2JY7A 1PRBA 4LJAA 2W82A 3V76A 3KSJA 1QAQA 2A5YB 2R4JA 4YY3M 1NV8A 2R0IA 3U60A 1PJJA 4JI8M 3IG5A 1J7KA 2LTUA 3TWMA 4RKUF 1IY0A 1QVRA 4AKHA 2QHOB 1GKIA 1W5SA 1R5LA 2K0BX 1ZMWA 5C1BA 1N36M 3UZUA 4LF5M 2DAIA 1L8QA 2P5TA 3B89A 2VQEM 1L1ZA 2ERCA 4Y28F 1Q3BA 1NY5A 4JI5M 1DGFA 1DO2A 1QQWA 4LF7M 4Q7JA 5ITUA 1GL6A 1Z59A 3GRYA 2QENA 4D82A 2DWMA 2ZTCA 2DWZB 3QWLA 4GKKM 2LXEA 1XNQM 2CEAA 4NSRA 3AL0C 4QHSA 3SYKA 4LJ6A 4XBOA 3HKPA 3SASA 4Z8XA 2L4EA 3T1HM 4FCWA 3NWLA 3AFHA 5BR8M 4LRTA 1I4WA 1VEKA 1EE8A 2HHHM 3KSXA 4B3RM 1R2ZA 4ZPXA 2BWEA 2N35A 2XZFA 3W0LB 4K0KM 1V33A 4GRIA 3M6AA 3LQRA 3GQ5A 4LJ5A 1OAOC 2Y20A 2XSZD 4QHTA 2JNHA 2O5RA 3KFUG 1G41A 1XXHA 3GPYA 3CF2A 3SFZA 4DV2M 2V6ZM 4IBGA 2VF7A 4S12A 2DNAA 2FNAA 3PXGA 4BB9A 2UXCM 5JI3E 1XHBA 4TUWA 3FE3A 5KQDA 4DR5M 4B7GA 4JI2M 3H4MA 2Z8YM 3J81S 4NC6A 3U6LA 3U6EA 3JR4A 4FW9A 3J7AS 1OTRA 4DV6M 2MJ5B 2UUBM 3SC3A 1IM2A 4FWDA 1GABA 3L2AA 5C18A 3K9PA 1TH4A 4B7FA 3H4JA 4GMQA 3FD9A 3HX3A 1QZMA 3WHKA 2DWLA 3HU3A 4MGKE 4YHHM 3IHPA 1IXSA 4LF9M 1HJPA 4CHTB 1NJFA 4LFBM 2J7NA 1GVNA 5DNYA 2YQZA 3F92A 3KOWE 3KOYE 2QSFX 3IECA 3FUUA 2OQ4A 4IBJA 3U6PA 2F5SA 3Q8XA 2K47A 3GLIA 5E26A 4G4OA 1XMOM 1PJIA 2KNAA 4IBEA 3D8BA 3IG8A 1HNWM 4RF1A 3L26A 4NRWA 3KS8A 5ITTA 2CWBA 1WGNA 4JN6A 3UJNA 3J2PB 4LF8M 2DKLA
chains in the Genus database with same CATH topology
2X4AA 1N75A 4MH0E 2E5LM 4I8OA 4AKGA 3E4RA 1MU5A 1KSFX 1HQCA 2ZAMA 4AZFA 1QYRA 2R65A 5ITYA 1XC8A 1QAOA 4D81A 1IY2A 1TH2A 1G59A 4JI1M 4DV0M 4NXMM 2L09A 1E9RA 3DZDA 3KVWA 4LRSA 2RGOA 4AG6A 3GO8A 3LVVA 4B3MM 3M7GA 2R4EA 4LGYA 3ZCBB 4I5SA 1NNJA 2BJWA 3FUVA 4IBFA 3U5ZA 2R45A 5GKNA 2C5RA 4L8RC 1N33M 3HHZA 5EP3A 1K82A 4JI7M 1NSFA 4M0DA 4IIWA 4BBAA 4G4RA 2G5GX 5FTJA 4Z6YA 2QBYA 3K1JA 3SAVA 4FVMA 2KA6B 3U61A 4JYAM 4LJ8A 3M0EA 1JR3D 1MX0A 2YR0A 1HT1E 3EIHA 5EP1A 5EXPA 1YUBA 3SHGB 5A2QS 1G3IA 5ITXA 1QANA 4A3VB 4AW4A 2UXBM 4M9ZA 3RFWA 3PNYA 1HNZM 3HU2A 2EUCA 4PD2A 5KPZA 2UU9M 4DR7M 3DFZA 4RNAA 3L25A 3VFDA 4W5WA 1GLNA 3TQSA 5EXSA 2Y21A 2CV2A 3SATA 2ZM6M 4DV4M 4MGHA 7CATA 2F5QA 3K92A 2FFJA 3NBIA 1NVMA 3U6SA 3T38A 3LVWA 4JXJA 2H1RA 1Z6TA 3VK7A 4OW0A 1IQPA 4JI4M 4LY6A 1KFVA 2XSZA 4QNMA 3A45A 2I7PA 3U60B 1NNUC 4KODA 2ZANA 2UUCM 2D7HA 2AHMA 5KPRA 4LZZA 2J7OA 2XFSA 4X65M 3FTDA 3PFIA 1FJGM 4M9SA 1XWIA 1IXZA 4JI6M 5EXTA 4FCTA 1TH3A 3HHWA 2DZNB 4NSOB 3A98B 1YSYA 3KP1E 1IN7A 4G6ZA 2KXEA 5FTNA 4CGYB 5F3WA 3GQ3A 5KO3A 2JA2A 3KXEC 4WURA 1IN5A 1XNRM 1HQYE 4AKIA 3SYLA 1N78A 4GH9A 3VK8A 1TGUA 4D80A 3U6QA 1IXRC 3AOEC 4DV5M 4EIWA 3W0FA 4G4NA 2C98A 3DOAA 3AKZA 2CHVA 3BOSA 2CV0A 3TWLA 3RGSA 2Y0QA 5ITRA 5IZ7D 2L6OA 5EXXA 5FTKA 1J09A 4HL4A 3MJ5A 4OVZB 2CHQA 3T15A 3JR5A 3SAWA 4RF0A 2Z7JA 1KYIA 3GRVA 1I94M 3KDSE 3I4YA 2V1CA 5EJCA 1ZAEA 5EQTA 5H37D 3J27B 4IBBA 4DUZM 1HT2E 3FUWA 4PDGA 3KS4A 1L2CA 4LJ9A 3FUXA 3GPUA 1OFHA 2R46A 3HHXA 2RKOA 4IBKA 3HU1A 4L78A 3GLHB 3JAMS 3DA1A 5LMUM 1SXJB 3ZC7B 1IN6A 1OJLA 1N32M 4B7HA 4L16A 3VDUA 1SXJE 3ILKA 4MB7A 2YFQA 4FCVA 1OFIA 1E32A 1Z5BA 1JQJC 1S3SA 2BNKA 2CV1A 3OTOM 3SAUA 4PCZA 4DUYM 1HNXM 4FD2A 3TWKA 2KW0A 4I81A 1W5TA 4LJ7A 3LQQA 1IN4A 1H6UA 4DR2M 4NL4H 3ZH9B 2DHRA 2I7NA 1K3WA 4MM3B 1N77A 1NY6A 3LMMA 3TPZA 3AOGA 4IBDA 2C9CA 3GP1A 2VIIA 2LH0A 4M9XA 2KEBA 4KO8A 4QOZC 4HLQA 1IBLM 3GRUA 3L29A 1R7RA 4PT5A 3FTFA 1IY1A 1YE9A 2ZAOA 3VKGA 4NXNM 4WW0A 2C99A 3PVSA 2F5OA 2LNHC 1Z5CA 2QBYB 3UMMA 2BJVA 4DR6M 3GLGB 1SXJD 5FTMA 1DO0A 2XF3A 1ZQ9A 2CHGA 3HJQA 4PDIA 1Q39A 2KZUA 2HCBA 4XGIA 4DV3M 1SXJC 2CE7A 5JI2E 3GPXA 2R62A 3U6DA 3VKHA 3HGIA 3CF0A 4QOSA 5KQ8A 4DR4M 2F4VM 3GLFB 4LF6M 3AOEA 4KHPM 1K3XA 3FYDA 3T1YM 1G8PA 3CTWB 4X62M 2Z3XA 1XMQM 1DGHB 2FOIC 2DZOB 2YNMD 1TDZA 5ITQA 3I4VA 2D7EA 3RE8A 2D7GA 3R8FA 4FWGA 2F5NA 2XH9A 3SHFA 1NHWC 3MHVC 2XEPA 5IREB 4MGIE 3I51A 2CUZA 2XLJA 3GRRA 4DR3M 4LF4M 3VDPA 4GIPA 3AV0A 2KZSA 3R9XB 4JI0M 4GKJM 3K8ZA 2UUAM 1VDDA 2ZBKB 4LCBA 4X64M 1ORYB 3U6MA 3L28A 4REZA 1LV7A 3SARA 2QCUA 2F5PA 2KRKA 3HWSA 4LG2A 4M0WA 3HHYA 4LFAM 2DWNA 4FWHA 1NJGA 4GC9A 3C58A 4B3SM 4QNRA 3GQ4A 3B9PA 3KOXE 3GPPA 2L7HA 1E9SA 4AI6A 3RGPA 1NHGC 4MGZE 4AQYM 2HL7A 1UM8A 1XXHB 1T3TA 3KP0E 3HJSA 4X66M 2Y0TA 2EO2A 5IWAM 4G4QA 5DYGA 2HKJA 4IBIA 4LZJA 4JI3M 4LGMA 2X49A 4JV5M 1C1KA 3J80S 3FTEA 4IJFA 4R3DA 1R2YA 2M60A 5FTLA 1L1TA 4ITQA 3D8LA 4OVZA 3AJIB 4R7GA 1DGGA 3EIEA 3VLFB 2RGHA 1GL7A 1TDHA 3U6CA 1L2BA 5BPVA 4OU7A 1IN8A 4P16A 4OX9M 4B3TM 4NOOB 3UK6A 3TL4X 3CF6E 1IXSB 1G4AE 2L7IA 5E6JA 1PM5A 1X37A 1JR3A 3SMPA 3J7BA 3GLIB 4LJ4A 2KRUA 3GLHA 2XFTA 1Q3CA 4IBCA 1SXJA 4BLCA 2C96A 1N34M 4MGYE 3PNVA 2Z4SA 4AG5A 3U6OA 4II7A 1D2NA 4GITA 3HJ8A 1Z5AA 2QPAA 1IBMM 3E9SA 1L2DA 4IJEA 5IT9S 3MK6A 5LMNM 1WXQA 2QZ4A 1E94E 4LFCM 5FSWA 3U5ZB 2X8AA 5KPTA 4GHAA 3FTCA 3FUTA 3K2LA 2Q2EB 2R18A 4L15A 3THGA 2G8LA 3U61B 2Z4RA 4CISA 4GHLA 3QAUA 1QAMA 2V1UA 4DV1M 4GC5A 5DYIA 3SMSA 1R6BX 3KW6A 3TE6A 1IBKM 4B08A 2LWXA 1HR0M 2EA0A 2OPFA 5ITXE 3UGJA 2XZUA 4NRVA 3L27A 3FYCA 3A42A 2VQFM 3GLGA 4I4LA 5EP4A 1FNNA 1DGBA 2QP9X 3KOZE 2NQ8C 4KLNA 2CFOA 3WHLA 2FE8A 2DXIA 3SBJA 4DV7M 3A46A 2M5ZA 4DR1M 2UXDM 3GLFA 5EP2A 2DVWB 1J5EM 8CATA 2XGNA 3FKEA 4L4UA 5FLXS 2C9OA 1DGHA 4LJAA 2W82A 3KSJA 1QAQA 2A5YB 2R4JA 4YY3M 3U60A 1PJJA 4JI8M 3IG5A 1J7KA 3TWMA 1IY0A 1QVRA 4AKHA 1GKIA 1W5SA 5C1BA 1N36M 3UZUA 4LF5M 1L8QA 2P5TA 2VQEM 1L1ZA 2ERCA 1Q3BA 1NY5A 4JI5M 1DGFA 1DO2A 1QQWA 4LF7M 5ITUA 1GL6A 1Z59A 3GRYA 2QENA 4D82A 2DWMA 2DWZB 3QWLA 4GKKM 2LXEA 1XNQM 2CEAA 4NSRA 3AL0C 3SYKA 4LJ6A 4XBOA 3HKPA 3SASA 4Z8XA 3T1HM 4FCWA 3NWLA 3AFHA 5BR8M 4LRTA 1I4WA 2HHHM 1EE8A 4B3RM 3KSXA 1R2ZA 4ZPXA 2XZFA 3W0LB 4K0KM 4GRIA 3M6AA 3LQRA 3GQ5A 4LJ5A 2Y20A 2XSZD 4QHTA 2O5RA 3KFUG 1G41A 1XXHA 3GPYA 3CF2A 3SFZA 4DV2M 2V6ZM 4IBGA 4S12A 2FNAA 3PXGA 2UXCM 4BB9A 5JI3E 1XHBA 4TUWA 5KQDA 4DR5M 4B7GA 4JI2M 3H4MA 3J81S 3U6LA 3U6EA 3JR4A 4FW9A 3J7AS 4DV6M 2UUBM 3SC3A 1IM2A 4FWDA 3L2AA 5C18A 1TH4A 4B7FA 4GMQA 3FD9A 3WHKA 1QZMA 2DWLA 3HU3A 4MGKE 4YHHM 4LF9M 4CHTB 4LFBM 1NJFA 2J7NA 1GVNA 5DNYA 2YQZA 3KOWE 3KOYE 2F5SA 3FUUA 2OQ4A 4IBJA 3U6PA 3Q8XA 2K47A 3GLIA 5E26A 4G4OA 1XMOM 1PJIA 4IBEA 3D8BA 3IG8A 1HNWM 4RF1A 3L26A 4NRWA 3KS8A 5ITTA 4JN6A 3UJNA 3J2PB 4LF8M 4QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  2L7H A;  4I5S A;  2Y20 A;  2Y0Q A;  2L7I A;  2Y21 A; 
#chains in the Genus database with same CATH topology
 2X4A A;  1N75 A;  2DHY A;  4MH0 E;  4I8O A;  3CGW A;  3E4R A;  1MU5 A;  1KSF X;  1HQC A;  5DFL A;  2E5L M;  2ZAM A;  4AZF A;  3LCU A;  3LCV B;  3W68 A;  1QYR A;  2R65 A;  3QYB A;  5ITY A;  4KT0 F;  1XC8 A;  1QAO A;  3BBZ A;  1IY2 A;  1TH2 A;  4D81 A;  1G59 A;  4JI1 M;  4DV0 M;  4NXM M;  2L09 A;  1E9R A;  3DZD A;  3KVW A;  4LRS A;  2RGO A;  4AG6 A;  3GO8 A;  3LVV A;  4B3M M;  3M7G A;  2R4E A;  4LGY A;  3ZCB B;  4I5S A;  1NNJ A;  2BJW A;  3FUV A;  4IBF A;  1F4I A;  3U5Z A;  1OIZ A;  2R45 A;  5GKN A;  2C5R A;  4L8R C;  2GNO A;  1N33 M;  3HHZ A;  5EP3 A;  1K82 A;  4JI7 M;  1NSF A;  4M0D A;  4IIW A;  4BBA A;  4G4R A;  2G5G X;  5FTJ A;  4Z6Y A;  2QBY A;  3K1J A;  3SAV A;  4FVM A;  2KA6 B;  3U61 A;  4JYA M;  4LJ8 A;  2DAM A;  3M0E A;  2APL A;  1QZE A;  1JR3 D;  1MX0 A;  2GQF A;  1HT1 E;  2YR0 A;  3EIH A;  5EP1 A;  5EXP A;  1YUB A;  3SHG B;  5A2Q S;  1G3I A;  5ITX A;  1QAN A;  4A3V B;  4AW4 A;  2UXB M;  1UFZ A;  4M9Z A;  2LVO C;  3RFW A;  1C7Y A;  2LBC A;  2LHG A;  3B7Q A;  3PNY A;  2O01 F;  1HNZ M;  3HU2 A;  2EUC A;  4PD2 A;  2CRU A;  5KPZ A;  2UU9 M;  3DFZ A;  4RNA A;  4DR7 M;  3VFD A;  1P3Q Q;  1LTM A;  3L25 A;  2MR9 A;  1GLN A;  4W5W A;  5EXS A;  3TQS A;  2Y21 A;  2CV2 A;  3SAT A;  2ZM6 M;  1WJ7 A;  4DV4 M;  4MGH A;  7CAT A;  2F5Q A;  4DBG B;  2EKK A;  1D0M A;  3K92 A;  2FFJ A;  3NBI A;  1NVM A;  3U6S A;  3C3D A;  3T38 A;  3LVW A;  4JXJ A;  2HWJ A;  2H1R A;  1Z6T A;  3VK7 A;  4OW0 A;  1IQP A;  4JI4 M;  1WHC A;  4LY6 A;  1KFV A;  2XSZ A;  4QNM A;  1AUA A;  3A45 A;  2I7P A;  3HY5 A;  1NNU C;  4KOD A;  2ZAN A;  3U60 B;  2UUC M;  2D7H A;  2AHM A;  5KPR A;  4LZZ A;  1JB0 F;  2H5X A;  2J7O A;  2XFS A;  4X65 M;  2WSC F;  3FTD A;  3PFI A;  1RU3 A;  4M9S A;  1XWI A;  1IXZ A;  1FJG M;  1XB2 B;  4JI6 M;  1OAI A;  1GO5 A;  2JZ1 A;  5EXT A;  4FCT A;  1TH3 A;  3HHW A;  2DZN B;  4XK8 F;  1D0L A;  4NSO B;  3A98 B;  1YSY A;  2DAK A;  1IN7 A;  3KP1 E;  4G6Z A;  2KXE A;  5FTN A;  4CGY B;  5F3W A;  3GQ3 A;  5KO3 A;  2JA2 A;  3KXE C;  4WUR A;  3LW5 F;  1IN5 A;  1XNR M;  1HQY E;  4AKI A;  3SYL A;  1N78 A;  3I04 M;  4GH9 A;  3VK8 A;  1TGU A;  4D80 A;  3U6Q A;  1IXR C;  3AOE C;  2DZL A;  1TR8 A;  4DV5 M;  4EIW A;  3W0F A;  3FRI A;  2KNZ A;  4G4N A;  2C98 A;  1ZV1 A;  3DOA A;  3AKZ A;  2CHV A;  3BOS A;  2CV0 A;  3TWL A;  3RGS A;  2Y0Q A;  5ITR A;  2JY8 A;  5IZ7 D;  2QNJ A;  3E21 A;  2L6O A;  5EXX A;  2JWS A;  5FTK A;  1J09 A;  4HL4 A;  3MJ5 A;  4OVZ B;  2CHQ A;  3T15 A;  3JR5 A;  3SAW A;  2KHH A;  4RF0 A;  2Z7J A;  1KYI A;  3GRV A;  1I94 M;  3KDS E;  3I4Y A;  2V1C A;  4GEW A;  1WR1 B;  2R44 A;  1ZAE A;  5EJC A;  1EIJ A;  5EQT A;  5H37 D;  3J27 B;  4IBB A;  4DUZ M;  1HT2 E;  3FUW A;  4PDG A;  3KS4 A;  2FH0 A;  1L2C A;  4LJ9 A;  1VDL A;  3FUX A;  3GPU A;  1OFH A;  2R46 A;  2L2D A;  2RKO A;  3HHX A;  4IBK A;  3HU1 A;  3BXW A;  4L78 A;  1JR3 E;  3GLH B;  2EKF A;  3JAM S;  3DA1 A;  5LMU M;  1SXJ B;  3ZC7 B;  1IN6 A;  4CIZ A;  1OJL A;  1MN3 A;  3GLH E;  1T6O A;  1N32 M;  4B7H A;  1CUK A;  4L16 A;  3VDU A;  1SXJ E;  3ILK A;  4MB7 A;  2YFQ A;  3MMP A;  4FCV A;  1OFI A;  1E32 A;  1Z5B A;  1JQJ C;  1S3S A;  2BNK A;  2CV1 A;  3OTO M;  3SAU A;  4PCZ A;  1Y8G A;  4DUY M;  1HNX M;  4FD2 A;  3TWK A;  2KW0 A;  4I81 A;  1W5T A;  3FRH A;  4LJ7 A;  3LQQ A;  1IN4 A;  1H6U A;  4DR2 M;  1QDR A;  4NL4 H;  1VQ1 A;  2EJS A;  3ZH9 B;  1WGL A;  2DHR A;  2I7N A;  3E46 A;  1K3W A;  2BWB A;  4MM3 B;  1N77 A;  1NY6 A;  3LMM A;  3TPZ A;  3AOG A;  4IBD A;  2C9C A;  3GP1 A;  2VII A;  2LH0 A;  4M9X A;  1D0K A;  2KEB A;  4KO8 A;  4HEO A;  4QOZ C;  4HLQ A;  1IBL M;  3GRU A;  3L29 A;  1R7R A;  4PT5 A;  3FTF A;  1IY1 A;  1V34 A;  1YE9 A;  2ZAO A;  3VKG A;  4NXN M;  1GJS A;  4WW0 A;  3C9P A;  2C99 A;  1A5T A;  3PVS A;  2F5O A;  2LNH C;  2WSE F;  1Z5C A;  2QBY B;  3UMM A;  2BJV A;  4DR6 M;  3GLG B;  2OOB A;  1SXJ D;  5FTM A;  1TF0 B;  1DO0 A;  2XF3 A;  1ZQ9 A;  2CHG A;  3HJQ A;  4PDI A;  1Q39 A;  1VG5 A;  3GLG E;  2KZU A;  2HCB A;  4XGI A;  4DV3 M;  2L4F A;  1SXJ C;  2CE7 A;  5JI2 E;  4G3O A;  2JP7 A;  3GPX A;  2OO9 A;  2R62 A;  3U6D A;  3VKH A;  3HGI A;  3CF0 A;  4QOS A;  2DEN A;  5KQ8 A;  2F4V M;  3GLF B;  3T6P A;  4LF6 M;  3AOE A;  4DR4 M;  1TTE A;  2JY5 A;  4KHP M;  1K3X A;  3FYD A;  3I01 M;  3GLF E;  3T1Y M;  1G8P A;  3CTW B;  4X62 M;  2Z3X A;  1XMQ M;  1DGH B;  1PJT A;  2ZTD A;  2FOI C;  2K9D A;  2DAG A;  2DZO B;  2YNM D;  1TDZ A;  5ITQ A;  3I4V A;  2D7E A;  2RRU A;  3RE8 A;  1AIP C;  2O25 A;  2D7G A;  3R8F A;  4FWG A;  2F5N A;  2XH9 A;  3SHF A;  1OQY A;  1NHW C;  3MHV C;  2XEP A;  5IRE B;  4MGI E;  2CUZ A;  1QUT A;  3I51 A;  2XLJ A;  3GRR A;  4DR3 M;  2JUJ A;  4LF4 M;  3VDP A;  4GIP A;  3AV0 A;  2KZS A;  3R9X B;  4JI0 M;  4GKJ M;  3K8Z A;  2UUA M;  1VDD A;  2ZBK B;  4LCB A;  4X64 M;  1ORY B;  3U6M A;  3L28 A;  4REZ A;  1LV7 A;  1BVS A;  1V92 A;  1QUS A;  4UN2 B;  3SAR A;  2QCU A;  2F5P A;  2KRK A;  2LHC A;  3HWS A;  4LG2 A;  4M0W A;  2KDL A;  3HHY A;  4LFA M;  2DWN A;  4FWH A;  1NJG A;  4GC9 A;  3C58 A;  3B7Z A;  4B3S M;  4QNR A;  3GQ4 A;  1SG9 A;  3B9P A;  3KOX E;  3GPP A;  2L7H A;  1E9S A;  4AI6 A;  3RGP A;  2JXN A;  1MJG M;  1NHG C;  4MGZ E;  4AQY M;  2HL7 A;  1UM8 A;  1XXH B;  1T3T A;  3KP0 E;  3HJS A;  4X66 M;  2Y0T A;  2EO2 A;  5IWA M;  4G4Q A;  5DYG A;  1OKS A;  1XXH E;  2HKJ A;  4IBI A;  4LZJ A;  2DAE A;  4JI3 M;  3Q8G A;  2X49 A;  4LGM A;  4JV5 M;  1C1K A;  3J80 S;  3FTE A;  2MH8 A;  4IJF A;  4R3D A;  4R71 A;  2WZJ A;  1R2Y A;  2JZ0 A;  2M60 A;  5FTL A;  1L1T A;  4ITQ A;  3D8L A;  4OVZ A;  3AJI B;  4R7G A;  1DGG A;  3EIE A;  3VLF B;  2RGH A;  1GL7 A;  1TDH A;  4ANR A;  3U6C A;  1L2B A;  5BPV A;  4OU7 A;  1IN8 A;  3B74 A;  4P16 A;  4OX9 M;  2MRO B;  4B3T M;  4NOO B;  3UK6 A;  2DI0 A;  3TL4 X;  3NBX X;  3CF6 E;  1IXS B;  1G4A E;  2L7I A;  5E6J A;  1PM5 A;  1X37 A;  1JR3 A;  3SMP A;  1GJT A;  1IFY A;  3J7B A;  3GLI B;  4AKG A;  4LJ4 A;  2VF8 A;  4CJ6 A;  2KRU A;  3GLH A;  2XFT A;  1Q3C A;  1PGY A;  4IBC A;  3GLI E;  1SXJ A;  3HZJ A;  4BLC A;  2C96 A;  1N34 M;  1NV9 A;  4MGY E;  4F2L A;  3PNV A;  2Z4S A;  4AG5 A;  3U6O A;  4II7 A;  1D2N A;  1VEJ A;  1G71 A;  2LVQ D;  4GIT A;  1R4G A;  3HJ8 A;  1Z5A A;  2QPA A;  1IBM M;  1EFU B;  3E9S A;  1NO1 A;  1L2D A;  2J5Y A;  4IJE A;  5IT9 S;  3MK6 A;  5LMN M;  1WXQ A;  2QZ4 A;  1E94 E;  3B7N A;  1ZMU A;  3W67 A;  4LFC M;  2LVP C;  3QYE A;  2MGW A;  5FSW A;  3U5Z B;  2X8A A;  1PJQ A;  5KPT A;  4GHA A;  1DV0 A;  3FTC A;  3FUT A;  3C3E A;  3K2L A;  2HAK A;  2Q2E B;  5L8R F;  1Q02 A;  2G3Q A;  2R18 A;  4L15 A;  3THG A;  2FS1 A;  2LVA A;  2KNV A;  2G8L A;  3U61 B;  2Z4R A;  4CIS A;  4GHL A;  3QAU A;  2VDB B;  1QAM A;  2B3T A;  2V1U A;  4DV1 M;  2CP8 A;  4GC5 A;  5DYI A;  3SMS A;  1R6B X;  2WSF F;  2LVN C;  3KW6 A;  4P17 A;  3TE6 A;  1IBK M;  4B08 A;  2LWX A;  1HR0 M;  2EA0 A;  2OPF A;  5ITX E;  1T43 A;  1VEG A;  3UGJ A;  2XZU A;  3K9O A;  4NRV A;  3L27 A;  3FYC A;  3A42 A;  2VQF M;  2K6B A;  3GLG A;  1QDT A;  4I4L A;  5EP4 A;  1FNN A;  1DGB A;  2QP9 X;  2R6F A;  2QQ8 A;  3KOZ E;  2NQ8 C;  4KLN A;  2CFO A;  3WHL A;  2FE8 A;  2DXI A;  1OIP A;  1PJS A;  2OOA A;  4F1I A;  3SBJ A;  1YLA A;  4DV7 M;  1ZMV A;  3A46 A;  2M5Z A;  4DR1 M;  2JY6 B;  2UXD M;  3GLF A;  5EP2 A;  2DVW B;  1J5E M;  8CAT A;  3ZQJ A;  4WP2 A;  2XGN A;  1WIV A;  3FKE A;  4L4U A;  4L6V 6;  5FLX S;  2C9O A;  1DGH A;  2JY7 A;  1PRB A;  4LJA A;  2W82 A;  3V76 A;  3KSJ A;  1QAQ A;  2A5Y B;  2R4J A;  4YY3 M;  1NV8 A;  2R0I A;  3U60 A;  1PJJ A;  4JI8 M;  3IG5 A;  1J7K A;  2LTU A;  3TWM A;  4RKU F;  1IY0 A;  1QVR A;  4AKH A;  2QHO B;  1GKI A;  1W5S A;  1R5L A;  2K0B X;  1ZMW A;  5C1B A;  1N36 M;  3UZU A;  4LF5 M;  2DAI A;  1L8Q A;  2P5T A;  3B89 A;  2VQE M;  1L1Z A;  2ERC A;  4Y28 F;  1Q3B A;  1NY5 A;  4JI5 M;  1DGF A;  1DO2 A;  1QQW A;  4LF7 M;  4Q7J A;  5ITU A;  1GL6 A;  1Z59 A;  3GRY A;  2QEN A;  4D82 A;  2DWM A;  2ZTC A;  2DWZ B;  3QWL A;  4GKK M;  2LXE A;  1XNQ M;  2CEA A;  4NSR A;  3AL0 C;  4QHS A;  3SYK A;  4LJ6 A;  4XBO A;  3HKP A;  3SAS A;  4Z8X A;  2L4E A;  3T1H M;  4FCW A;  3NWL A;  3AFH A;  5BR8 M;  4LRT A;  1I4W A;  1VEK A;  1EE8 A;  2HHH M;  3KSX A;  4B3R M;  1R2Z A;  4ZPX A;  2BWE A;  2N35 A;  2XZF A;  3W0L B;  4K0K M;  1V33 A;  4GRI A;  3M6A A;  3LQR A;  3GQ5 A;  4LJ5 A;  1OAO C;  2Y20 A;  2XSZ D;  4QHT A;  2JNH A;  2O5R A;  3KFU G;  1G41 A;  1XXH A;  3GPY A;  3CF2 A;  3SFZ A;  4DV2 M;  2V6Z M;  4IBG A;  2VF7 A;  4S12 A;  2DNA A;  2FNA A;  3PXG A;  4BB9 A;  2UXC M;  5JI3 E;  1XHB A;  4TUW A;  3FE3 A;  5KQD A;  4DR5 M;  4B7G A;  4JI2 M;  3H4M A;  2Z8Y M;  3J81 S;  4NC6 A;  3U6L A;  3U6E A;  3JR4 A;  4FW9 A;  3J7A S;  1OTR A;  4DV6 M;  2MJ5 B;  2UUB M;  3SC3 A;  1IM2 A;  4FWD A;  1GAB A;  3L2A A;  5C18 A;  3K9P A;  1TH4 A;  4B7F A;  3H4J A;  4GMQ A;  3FD9 A;  3HX3 A;  1QZM A;  3WHK A;  2DWL A;  3HU3 A;  4MGK E;  4YHH M;  3IHP A;  1IXS A;  4LF9 M;  1HJP A;  4CHT B;  1NJF A;  4LFB M;  2J7N A;  1GVN A;  5DNY A;  2YQZ A;  3F92 A;  3KOW E;  3KOY E;  2QSF X;  3IEC A;  3FUU A;  2OQ4 A;  4IBJ A;  3U6P A;  2F5S A;  3Q8X A;  2K47 A;  3GLI A;  5E26 A;  4G4O A;  1XMO M;  1PJI A;  2KNA A;  4IBE A;  3D8B A;  3IG8 A;  1HNW M;  4RF1 A;  3L26 A;  4NRW A;  3KS8 A;  5ITT A;  2CWB A;  1WGN A;  4JN6 A;  3UJN A;  3J2P B;  4LF8 M;  2DKL A; 
#chains in the Genus database with same CATH homology
 2X4A A;  1N75 A;  4MH0 E;  2E5L M;  4I8O A;  4AKG A;  3E4R A;  1MU5 A;  1KSF X;  1HQC A;  2ZAM A;  4AZF A;  1QYR A;  2R65 A;  5ITY A;  1XC8 A;  1QAO A;  4D81 A;  1IY2 A;  1TH2 A;  1G59 A;  4JI1 M;  4DV0 M;  4NXM M;  2L09 A;  1E9R A;  3DZD A;  3KVW A;  4LRS A;  2RGO A;  4AG6 A;  3GO8 A;  3LVV A;  4B3M M;  3M7G A;  2R4E A;  4LGY A;  3ZCB B;  4I5S A;  1NNJ A;  2BJW A;  3FUV A;  4IBF A;  3U5Z A;  2R45 A;  5GKN A;  2C5R A;  4L8R C;  1N33 M;  3HHZ A;  5EP3 A;  1K82 A;  4JI7 M;  1NSF A;  4M0D A;  4IIW A;  4BBA A;  4G4R A;  2G5G X;  5FTJ A;  4Z6Y A;  2QBY A;  3K1J A;  3SAV A;  4FVM A;  2KA6 B;  3U61 A;  4JYA M;  4LJ8 A;  3M0E A;  1JR3 D;  1MX0 A;  2YR0 A;  1HT1 E;  3EIH A;  5EP1 A;  5EXP A;  1YUB A;  3SHG B;  5A2Q S;  1G3I A;  5ITX A;  1QAN A;  4A3V B;  4AW4 A;  2UXB M;  4M9Z A;  3RFW A;  3PNY A;  1HNZ M;  3HU2 A;  2EUC A;  4PD2 A;  5KPZ A;  2UU9 M;  4DR7 M;  3DFZ A;  4RNA A;  3L25 A;  3VFD A;  4W5W A;  1GLN A;  3TQS A;  5EXS A;  2Y21 A;  2CV2 A;  3SAT A;  2ZM6 M;  4DV4 M;  4MGH A;  7CAT A;  2F5Q A;  3K92 A;  2FFJ A;  3NBI A;  1NVM A;  3U6S A;  3T38 A;  3LVW A;  4JXJ A;  2H1R A;  1Z6T A;  3VK7 A;  4OW0 A;  1IQP A;  4JI4 M;  4LY6 A;  1KFV A;  2XSZ A;  4QNM A;  3A45 A;  2I7P A;  3U60 B;  1NNU C;  4KOD A;  2ZAN A;  2UUC M;  2D7H A;  2AHM A;  5KPR A;  4LZZ A;  2J7O A;  2XFS A;  4X65 M;  3FTD A;  3PFI A;  1FJG M;  4M9S A;  1XWI A;  1IXZ A;  4JI6 M;  5EXT A;  4FCT A;  1TH3 A;  3HHW A;  2DZN B;  4NSO B;  3A98 B;  1YSY A;  3KP1 E;  1IN7 A;  4G6Z A;  2KXE A;  5FTN A;  4CGY B;  5F3W A;  3GQ3 A;  5KO3 A;  2JA2 A;  3KXE C;  4WUR A;  1IN5 A;  1XNR M;  1HQY E;  4AKI A;  3SYL A;  1N78 A;  4GH9 A;  3VK8 A;  1TGU A;  4D80 A;  3U6Q A;  1IXR C;  3AOE C;  4DV5 M;  4EIW A;  3W0F A;  4G4N A;  2C98 A;  3DOA A;  3AKZ A;  2CHV A;  3BOS A;  2CV0 A;  3TWL A;  3RGS A;  2Y0Q A;  5ITR A;  5IZ7 D;  2L6O A;  5EXX A;  5FTK A;  1J09 A;  4HL4 A;  3MJ5 A;  4OVZ B;  2CHQ A;  3T15 A;  3JR5 A;  3SAW A;  4RF0 A;  2Z7J A;  1KYI A;  3GRV A;  1I94 M;  3KDS E;  3I4Y A;  2V1C A;  5EJC A;  1ZAE A;  5EQT A;  5H37 D;  3J27 B;  4IBB A;  4DUZ M;  1HT2 E;  3FUW A;  4PDG A;  3KS4 A;  1L2C A;  4LJ9 A;  3FUX A;  3GPU A;  1OFH A;  2R46 A;  3HHX A;  2RKO A;  4IBK A;  3HU1 A;  4L78 A;  3GLH B;  3JAM S;  3DA1 A;  5LMU M;  1SXJ B;  3ZC7 B;  1IN6 A;  1OJL A;  1N32 M;  4B7H A;  4L16 A;  3VDU A;  1SXJ E;  3ILK A;  4MB7 A;  2YFQ A;  4FCV A;  1OFI A;  1E32 A;  1Z5B A;  1JQJ C;  1S3S A;  2BNK A;  2CV1 A;  3OTO M;  3SAU A;  4PCZ A;  4DUY M;  1HNX M;  4FD2 A;  3TWK A;  2KW0 A;  4I81 A;  1W5T A;  4LJ7 A;  3LQQ A;  1IN4 A;  1H6U A;  4DR2 M;  4NL4 H;  3ZH9 B;  2DHR A;  2I7N A;  1K3W A;  4MM3 B;  1N77 A;  1NY6 A;  3LMM A;  3TPZ A;  3AOG A;  4IBD A;  2C9C A;  3GP1 A;  2VII A;  2LH0 A;  4M9X A;  2KEB A;  4KO8 A;  4QOZ C;  4HLQ A;  1IBL M;  3GRU A;  3L29 A;  1R7R A;  4PT5 A;  3FTF A;  1IY1 A;  1YE9 A;  2ZAO A;  3VKG A;  4NXN M;  4WW0 A;  2C99 A;  3PVS A;  2F5O A;  2LNH C;  1Z5C A;  2QBY B;  3UMM A;  2BJV A;  4DR6 M;  3GLG B;  1SXJ D;  5FTM A;  1DO0 A;  2XF3 A;  1ZQ9 A;  2CHG A;  3HJQ A;  4PDI A;  1Q39 A;  2KZU A;  2HCB A;  4XGI A;  4DV3 M;  1SXJ C;  2CE7 A;  5JI2 E;  3GPX A;  2R62 A;  3U6D A;  3VKH A;  3HGI A;  3CF0 A;  4QOS A;  5KQ8 A;  4DR4 M;  2F4V M;  3GLF B;  4LF6 M;  3AOE A;  4KHP M;  1K3X A;  3FYD A;  3T1Y M;  1G8P A;  3CTW B;  4X62 M;  2Z3X A;  1XMQ M;  1DGH B;  2FOI C;  2DZO B;  2YNM D;  1TDZ A;  5ITQ A;  3I4V A;  2D7E A;  3RE8 A;  2D7G A;  3R8F A;  4FWG A;  2F5N A;  2XH9 A;  3SHF A;  1NHW C;  3MHV C;  2XEP A;  5IRE B;  4MGI E;  3I51 A;  2CUZ A;  2XLJ A;  3GRR A;  4DR3 M;  4LF4 M;  3VDP A;  4GIP A;  3AV0 A;  2KZS A;  3R9X B;  4JI0 M;  4GKJ M;  3K8Z A;  2UUA M;  1VDD A;  2ZBK B;  4LCB A;  4X64 M;  1ORY B;  3U6M A;  3L28 A;  4REZ A;  1LV7 A;  3SAR A;  2QCU A;  2F5P A;  2KRK A;  3HWS A;  4LG2 A;  4M0W A;  3HHY A;  4LFA M;  2DWN A;  4FWH A;  1NJG A;  4GC9 A;  3C58 A;  4B3S M;  4QNR A;  3GQ4 A;  3B9P A;  3KOX E;  3GPP A;  2L7H A;  1E9S A;  4AI6 A;  3RGP A;  1NHG C;  4MGZ E;  4AQY M;  2HL7 A;  1UM8 A;  1XXH B;  1T3T A;  3KP0 E;  3HJS A;  4X66 M;  2Y0T A;  2EO2 A;  5IWA M;  4G4Q A;  5DYG A;  2HKJ A;  4IBI A;  4LZJ A;  4JI3 M;  4LGM A;  2X49 A;  4JV5 M;  1C1K A;  3J80 S;  3FTE A;  4IJF A;  4R3D A;  1R2Y A;  2M60 A;  5FTL A;  1L1T A;  4ITQ A;  3D8L A;  4OVZ A;  3AJI B;  4R7G A;  1DGG A;  3EIE A;  3VLF B;  2RGH A;  1GL7 A;  1TDH A;  3U6C A;  1L2B A;  5BPV A;  4OU7 A;  1IN8 A;  4P16 A;  4OX9 M;  4B3T M;  4NOO B;  3UK6 A;  3TL4 X;  3CF6 E;  1IXS B;  1G4A E;  2L7I A;  5E6J A;  1PM5 A;  1X37 A;  1JR3 A;  3SMP A;  3J7B A;  3GLI B;  4LJ4 A;  2KRU A;  3GLH A;  2XFT A;  1Q3C A;  4IBC A;  1SXJ A;  4BLC A;  2C96 A;  1N34 M;  4MGY E;  3PNV A;  2Z4S A;  4AG5 A;  3U6O A;  4II7 A;  1D2N A;  4GIT A;  3HJ8 A;  1Z5A A;  2QPA A;  1IBM M;  3E9S A;  1L2D A;  4IJE A;  5IT9 S;  3MK6 A;  5LMN M;  1WXQ A;  2QZ4 A;  1E94 E;  4LFC M;  5FSW A;  3U5Z B;  2X8A A;  5KPT A;  4GHA A;  3FTC A;  3FUT A;  3K2L A;  2Q2E B;  2R18 A;  4L15 A;  3THG A;  2G8L A;  3U61 B;  2Z4R A;  4CIS A;  4GHL A;  3QAU A;  1QAM A;  2V1U A;  4DV1 M;  4GC5 A;  5DYI A;  3SMS A;  1R6B X;  3KW6 A;  3TE6 A;  1IBK M;  4B08 A;  2LWX A;  1HR0 M;  2EA0 A;  2OPF A;  5ITX E;  3UGJ A;  2XZU A;  4NRV A;  3L27 A;  3FYC A;  3A42 A;  2VQF M;  3GLG A;  4I4L A;  5EP4 A;  1FNN A;  1DGB A;  2QP9 X;  3KOZ E;  2NQ8 C;  4KLN A;  2CFO A;  3WHL A;  2FE8 A;  2DXI A;  3SBJ A;  4DV7 M;  3A46 A;  2M5Z A;  4DR1 M;  2UXD M;  3GLF A;  5EP2 A;  2DVW B;  1J5E M;  8CAT A;  2XGN A;  3FKE A;  4L4U A;  5FLX S;  2C9O A;  1DGH A;  4LJA A;  2W82 A;  3KSJ A;  1QAQ A;  2A5Y B;  2R4J A;  4YY3 M;  3U60 A;  1PJJ A;  4JI8 M;  3IG5 A;  1J7K A;  3TWM A;  1IY0 A;  1QVR A;  4AKH A;  1GKI A;  1W5S A;  5C1B A;  1N36 M;  3UZU A;  4LF5 M;  1L8Q A;  2P5T A;  2VQE M;  1L1Z A;  2ERC A;  1Q3B A;  1NY5 A;  4JI5 M;  1DGF A;  1DO2 A;  1QQW A;  4LF7 M;  5ITU A;  1GL6 A;  1Z59 A;  3GRY A;  2QEN A;  4D82 A;  2DWM A;  2DWZ B;  3QWL A;  4GKK M;  2LXE A;  1XNQ M;  2CEA A;  4NSR A;  3AL0 C;  3SYK A;  4LJ6 A;  4XBO A;  3HKP A;  3SAS A;  4Z8X A;  3T1H M;  4FCW A;  3NWL A;  3AFH A;  5BR8 M;  4LRT A;  1I4W A;  2HHH M;  1EE8 A;  4B3R M;  3KSX A;  1R2Z A;  4ZPX A;  2XZF A;  3W0L B;  4K0K M;  4GRI A;  3M6A A;  3LQR A;  3GQ5 A;  4LJ5 A;  2Y20 A;  2XSZ D;  4QHT A;  2O5R A;  3KFU G;  1G41 A;  1XXH A;  3GPY A;  3CF2 A;  3SFZ A;  4DV2 M;  2V6Z M;  4IBG A;  4S12 A;  2FNA A;  3PXG A;  2UXC M;  4BB9 A;  5JI3 E;  1XHB A;  4TUW A;  5KQD A;  4DR5 M;  4B7G A;  4JI2 M;  3H4M A;  3J81 S;  3U6L A;  3U6E A;  3JR4 A;  4FW9 A;  3J7A S;  4DV6 M;  2UUB M;  3SC3 A;  1IM2 A;  4FWD A;  3L2A A;  5C18 A;  1TH4 A;  4B7F A;  4GMQ A;  3FD9 A;  3WHK A;  1QZM A;  2DWL A;  3HU3 A;  4MGK E;  4YHH M;  4LF9 M;  4CHT B;  4LFB M;  1NJF A;  2J7N A;  1GVN A;  5DNY A;  2YQZ A;  3KOW E;  3KOY E;  2F5S A;  3FUU A;  2OQ4 A;  4IBJ A;  3U6P A;  3Q8X A;  2K47 A;  3GLI A;  5E26 A;  4G4O A;  1XMO M;  1PJI A;  4IBE A;  3D8B A;  3IG8 A;  1HNW M;  4RF1 A;  3L26 A;  4NRW A;  3KS8 A;  5ITT A;  4JN6 A;  3UJN A;  3J2P B;  4LF8 M;  4QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...