2Y20A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
TITRPIIELSNTIDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UNCHARACTERIZED PROTEIN
publication title The Mechanisms of Hamp-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y20A00
2Y0QA 2L7HA 2Y20A 2Y21A 4I5SA 2Y0TA 2L7IA
chains in the Genus database with same CATH superfamily
3LVWA 2UXCM 1CUKA 4F1IA 2G8LA 4DV1M 1PM5A 2DAMA 4F2LA 2JY5A 4FCVA 3IHPA 4XK8F 1L2BA 1T3TA 1Q3BA 2ZTCA 3E46A 3KW6A 4X65M 4M9SA 3J27B 1KYIA 4S12A 3QWLA 2I7NA 7CATA 3J7AS 3VFDA 1D0KA 2KW0A 2R18A 1Q39A 2LHGA 5H37D 3DA1A 2BJWA 4LRTA 3GLHB 3C58A 3Q8XA 3FD9A 3U6CA 3U6PA 1NVMA 2JY7A 3OTOM 1WHCA 1L1TA 1SG9A 2DZNB 1D0LA 2C96A 1L1ZA 3SAUA 5A2QS 3FTDA 1J7KA 3TL4X 3UZUA 4II7A 4JI3M 4CISA 3HJ8A 1RU3A 3AOEC 2F5QA 1OJLA 2L7HA 3KDSE 1TDHA 3C9PA 4KLNA 1JR3E 3J2PB 2UU9M 2WSEF 3I4VA 5ITRA 2OOBA 3ZC7B 1GKIA 2EKKA 2P5TA 5DYIA 2DKLA 3AOEA 3HHXA 2R45A 1NHGC 3J7BA 4HL4A 3HHZA 3I04M 3TWKA 5FTKA 1ZV1A 2XGNA 3CTWB 3T15A 1Z5CA 1GO5A 2YFQA 2K0BX 4WP2A 1XNRM 3SYKA 1SXJE 2CV1A 3T38A 1OIZA 2CEAA 1EFUB 1HQCA 2GQFA 2XZFA 1HNXM 1T6OA 5KPTA 2C99A 2DWMA 2DWNA 3HHWA 1OAOC 2GNOA 1VDDA 2L4EA 1PRBA 4NXMM 4AKGA 5ITXA 2LH0A 4M0WA 4CIZA 1DGBA 4LGYA 1SXJB 2DZLA 3AJIB 2H5XA 3ZH9B 4D80A 1XXHB 4AZFA 4JYAM 4FW9A 1GJSA 1XWIA 4NXNM 2D7EA 3KS4A 1NJFA 3SHGB 1JB0F 2EJSA 2J5YA 4QOSA 3RGSA 3GPPA 1NHWC 2QNJA 1IY2A 3U6QA 4P16A 3LCVB 4DV4M 4DV3M 4IBBA 1R4GA 4QOZC 3SASA 1L2CA 4OVZB 2QENA 4GIPA 4Z6YA 4JI7M 4LRSA 4B3SM 4IBJA 1PJIA 1DO2A 2KRKA 2FH0A 1TDZA 4AKHA 1G41A 2ZANA 4B3MM 2ZAOA 3IG5A 4MGZE 3FTFA 1A5TA 5E26A 3E4RA 3L2AA 1YUBA 2KZSA 3B74A 2YR0A 4M9ZA 4Y28F 2Z4RA 2Y21A 2RGHA 3DFZA 2CE7A 3LMMA 3VKGA 5GKNA 1E9RA 2LVOC 1JQJC 1ZQ9A 2R0IA 4R7GA 3RGPA 5EP1A 3TPZA 3B7QA 1G4AE 1VG5A 3U6LA 3E21A 2QZ4A 3Q8GA 3TE6A 4R71A 2XZUA 3KFUG 3EIEA 2LNHC 1Z6TA 3I4YA 3KOWE 3AV0A 2JY6B 2QP9X 3W68A 1IN6A 1MU5A 1X37A 4G3OA 4JI8M 2DHRA 5EP4A 3UK6A 4FWGA 4G4QA 5EXPA 3AKZA 3GRRA 4NC6A 2HL7A 4AG6A 2CHGA 1Z5BA 2NQ8C 3LCUA 3SYLA 3L26A 4OU7A 3FKEA 4LJAA 1EIJA 1IN8A 3WHLA 2DVWB 1NJGA 1OIPA 2HWJA 2DI0A 1PJJA 4PDGA 2KDLA 4IBCA 2F5PA 3E9SA 4FCWA 3M7GA 3CGWA 4DUZM 4DV7M 2KNZA 2Z4SA 3GLGE 3HWSA 1V33A 1UFZA 4G6ZA 4RNAA 1N34M 2J7NA 4IBIA 3FUUA 4L16A 4B08A 3HY5A 4UN2B 3K2LA 3VDUA 1Y8GA 4RKUF 3U61B 1TR8A 3CF6E 3FYDA 4MB7A 3U6MA 3JR4A 3GLHE 1N77A 3GLGB 2QCUA 2XFTA 2Z3XA 1P3QQ 3L27A 2LVPC 3U6SA 4CGYB 4ANRA 4B7FA 2F5NA 1D0MA 5EXSA 1OKSA 1UM8A 2L7IA 3AOGA 4GC9A 5FTNA 3IG8A 1XNQM 5FTLA 2X4AA 1R5LA 1VEGA 2EKFA 2Y20A 1K82A 2DAIA 1TH2A 5FTJA 2KZUA 3JAMS 2OPFA 1HT2E 1VQ1A 2R4JA 4I81A 1JR3A 3T6PA 1V34A 1GLNA 1YLAA 1OAIA 3K1JA 2E5LM 1V92A 5EJCA 3GP1A 4LJ8A 2N35A 3J80S 3SBJA 3RE8A 4G4OA 4LF8M 1KSFX 4LF7M 2L09A 4RF0A 4I5SA 5L8RF 5ITQA 3LVVA 1TGUA 2Q2EB 4MGYE 1K3XA 1NV8A 3T1HM 1AIPC 1DGFA 4QHSA 5ITTA 1IBKM 1OQYA 3EIHA 2FNAA 2V6ZM 4HEOA 4P17A 3BOSA 4GKKM 1DGHB 3D8LA 4YY3M 4Q7JA 4BB9A 3GLIA 1HNZM 4JI1M 4LFCM 1XHBA 3GRUA 2QQ8A 3U5ZA 3M6AA 4RF1A 2XEPA 3FUWA 4IIWA 4B7GA 1TF0B 1WJ7A 4FD2A 1XXHE 4FVMA 3K9OA 4GHAA 1MN3A 4MGHA 3ILKA 3TWMA 1TTEA 4X62M 1W5SA 4R3DA 1OFHA 3T1YM 3GLFA 1HQYE 1Q02A 3H4JA 4NRWA 3AFHA 4LZJA 2UXBM 3FUVA 3TWLA 1GL6A 2XF3A 3KOZE 2R62A 3SMPA 2LBCA 3UGJA 1XMOM 2UUBM 2ERCA 2QPAA 4A3VB 5C18A 1GABA 1E32A 2CHVA 3U60A 1HT1E 3RFWA 3C3EA 4LCBA 2WSCF 1FNNA 1IY0A 3HU3A 2CV2A 3SAWA 1HJPA 2JXNA 4JXJA 4DUYM 1VEJA 1IQPA 4LFAM 1R2ZA 2CP8A 2KXEA 3FUXA 5JI2E 1W5TA 2BWBA 3B7NA 3R9XB 2Y0TA 3I51A 2J7OA 1Z5AA 2CFOA 2VF7A 3B9PA 5DYGA 2JUJA 2DWLA 1FJGM 4JI2M 1WXQA 3W0FA 1QUSA 2VIIA 2QBYA 3VLFB 2LXEA 5ITXE 4L78A 1IFYA 1XB2B 3KP1E 4OW0A 4LF6M 1C1KA 2EO2A 2KNVA 3FRIA 5FSWA 2BNKA 2LVNC 2K9DA 3IECA 3PXGA 1YE9A 2UUAM 2L6OA 4X64M 1R7RA 2KRUA 4XBOA 2F4VM 2AHMA 3F92A 4GH9A 2X8AA 3MHVC 4CHTB 1XC8A 1T43A 1PGYA 3PVSA 4M0DA 1IXSB 4LF5M 1PJSA 4AKIA 5KQ8A 3VDPA 2XSZA 3A46A 1IN4A 2QHOB 3K8ZA 2I7PA 1F4IA 4DBGB 1PJTA 2R65A 2JWSA 2ZAMA 4LGMA 4MM3B 4YHHM 3THGA 1JR3D 1KFVA 3QAUA 3NBIA 1PJQA 4B7HA 4EIWA 3GLGA 5LMNM 4DR5M 3HU1A 3SARA 1IBMM 4OX9M 2G3QA 2DNAA 4LY6A 1J5EM 1QYRA 3DOAA 4WURA 3LW5F 1N33M 5IT9S 2LVAA 2W82A 4ITQA 2VF8A 4LG2A 3FTEA 1HNWM 3KP0E 3SHFA 5BR8M 5IWAM 3GQ3A 3GLHA 4KHPM 4BLCA 3HKPA 4LJ4A 2HAKA 3FE3A 2LTUA 3C3DA 2DXIA 5LMUM 2CV0A 3UMMA 3L29A 1ZMVA 1NY5A 4PDIA 4AG5A 2C9CA 3V76A 3SFZA 3UJNA 2LHCA 1OTRA 1LTMA 2BWEA 2QSFX 2KHHA 2RRUA 3QYEA 1HR0M 2F5OA 3CF0A 1DGGA 3KVWA 1QANA 3A98B 1N75A 4IJEA 3WHKA 2MROB 4LF4M 3VKHA 3A45A 5KPRA 4DR4M 1QVRA 3FTCA 4MH0E 5ITUA 3H4MA 3L28A 1GJTA 1R6BX 2VQFM 2C5RA 1DGHA 4NSRA 1VEKA 1N36M 1WGNA 3KOXE 3BBZA 1ZMWA 2ZBKB 1WR1B 2R44A 3KOYE 4NSOB 1WGLA 3BXWA 1GVNA 4IJFA 1C7YA 2UUCM 1SXJC 2JA2A 3TQSA 1NY6A 4FCTA 1EE8A 2C98A 4KT0F 1G59A 2FS1A 4IBDA 4DR7M 1I4WA 3M0EA 5FLXS 1N78A 1TH3A 2MGWA 1R2YA 4KODA 1SXJA 2OOAA 1NV9A 4B3RM 4M9XA 1XXHA 2X49A 4LJ6A 4LJ7A 2FOIC 3LQQA 2Z7JA 2DWZB 1K3WA 2F5SA 3KSJA 2K47A 1YSYA 4QHTA 4FWHA 3HJSA 3GPXA 2V1CA 3HGIA 2KEBA 3U6EA 4AI6A 4REZA 2R6FA 1BVSA 5EXXA 2EA0A 2JZ0A 4KO8A 2M5ZA 1TH4A 3KSXA 1VDLA 2YNMD 3SMSA 3R8FA 2H1RA 4QNMA 2V1UA 3HJQA 4OVZA 4MGIE 1NSFA 2R4EA 4GITA 4GRIA 4D81A 4I4LA 1L2DA 1ORYB 1QZMA 4L8RC 2ZTDA 1DO0A 2K6BA 4FWDA 2RKOA 4GKJM 2HHHM 4CJ6A 2XSZD 2C9OA 3NWLA 1Q3CA 5IREB 4DV2M 4IBFA 2XLJA 3B7ZA 1ZAEA 4NRVA 4JV5M 4LZZA 4NOOB 3U6DA 4GHLA 3GRYA 1IM2A 3I01M 4IBKA 1NNJA 4PD2A 2VQEM 3CF2A 1G3IA 5EP3A 3HHYA 2BJVA 3W0LB 1XMQM 2A5YB 3GRVA 3KXEC 5EP2A 3K92A 3GLIE 1QAMA 4GC5A 1E9SA 4WW0A 1IXSA 1D2NA 4JI0M 1I94M 4BBAA 1J09A 4D82A 1Z59A 2MR9A 1DV0A 2R46A 1E94E 1IY1A 2OO9A 2FFJA 4JI4M 2CHQA 2O5RA 5IZ7D 4DR1M 2Z8YM 2D7HA 2JY8A 3GLIB 2UXDM 3GLFE 4W5WA 3U6OA 4NL4H 3U5ZB 2G5GX 2O01F 2DAGA 3B89A 5FTMA 4DV6M 2FE8A 3QYBA 2RGOA 1MJGM 4LF9M 2EUCA 2VDBB 4X66M 1NNUC 2JNHA 4GEWA 1MX0A 3MJ5A 4ZPXA 3GLFB 4XGIA 2YQZA 8CATA 3PNVA 4DR2M 1N32M 3D8BA 2D7GA 4L15A 2LVQD 2MJ5B 4Z8XA 3FUTA 3GPUA 2DAEA 1GL7A 4JI6M 2XFSA 3K9PA 1QQWA 2JZ1A 4LJ9A 1L8QA 1ZMUA 3U60B 1NO1A 4DV5M 4TUWA 1IN7A 2OQ4A 2DZOB 4L6V6 4LJ5A 3SC3A 3GQ5A 2LWXA 4MGKE 4G4RA 1QAQA 3U61A 3VK7A 2WSFF 1IXZA 4GMQA 3VK8A 5ITYA 1IBLM 3KS8A 4DR6M 3FYCA 3HX3A 4I8OA 3ZQJA 3HU2A 2DAKA 3DZDA 4QNRA 1IN5A 2B3TA 4DR3M 5BPVA 3SAVA 5DNYA 1AUAA 3J81S 4B3TM 3HZJA 1OFIA 2CUZA 5EXTA 5E6JA 2KA6B 3SATA 4K0KM 2HCBA 3GPYA 3GO8A 1SXJD 2CWBA 3ZCBB 3GQ4A 2KNAA 3MMPA 4PT5A 3W67A 4HLQA 5EQTA 4AW4A 4PCZA 2QBYB 2XH9A 1QZEA 5KPZA 1S3SA 3PNYA 3A42A 1QDRA 4G4NA 4IBGA 5F3WA 1LV7A 2MH8A 3PFIA 2JP7A 3JR5A 4DV0M 1H6UA 2CRUA 3NBXX 4AQYM 5KO3A 3AL0C 3L25A 1QUTA 2ZM6M 2HKJA 4L4UA 2L2DA 4IBEA 1G8PA 1G71A 3LQRA 4JI5M 2DENA 4JN6A 1IXRC 1WIVA 2DHYA 4LFBM 2APLA 2Y0QA 3MK6A 1QAOA 1QDTA 5KQDA 2M60A 2L4FA 5C1BA 5JI3E 2O25A 2WZJA 3FRHA 5DFLA
chains in the Genus database with same CATH topology
3LVWA 2UXCM 2G8LA 4DV1M 1PM5A 4FCVA 1L2BA 1T3TA 1Q3BA 3KW6A 4X65M 4M9SA 3J27B 1KYIA 4S12A 3QWLA 2I7NA 7CATA 3J7AS 3VFDA 2R18A 2KW0A 1Q39A 5H37D 3DA1A 2BJWA 4LRTA 3GLHB 3C58A 3Q8XA 3FD9A 3U6CA 3U6PA 1NVMA 3OTOM 1L1TA 2DZNB 2C96A 1L1ZA 3SAUA 5A2QS 3FTDA 1J7KA 3TL4X 3UZUA 4II7A 4JI3M 4CISA 3HJ8A 3AOEC 2F5QA 1OJLA 2L7HA 3KDSE 1TDHA 4KLNA 3J2PB 2UU9M 3I4VA 5ITRA 3ZC7B 1GKIA 2P5TA 5DYIA 3AOEA 3HHXA 3J7BA 2R45A 1NHGC 4HL4A 3HHZA 3TWKA 5FTKA 2XGNA 3CTWB 3T15A 1Z5CA 2YFQA 1XNRM 3SYKA 1SXJE 2CV1A 3T38A 2CEAA 1HQCA 2XZFA 1HNXM 2DWMA 5KPTA 2C99A 2DWNA 3HHWA 1VDDA 4NXMM 4AKGA 5ITXA 2LH0A 4M0WA 1DGBA 4LGYA 1SXJB 3AJIB 3ZH9B 4D80A 1XXHB 4AZFA 4JYAM 4FW9A 1XWIA 4NXNM 2D7EA 3KS4A 1NJFA 3SHGB 4QOSA 3RGSA 3GPPA 1NHWC 1IY2A 3U6QA 4P16A 4DV4M 4IBBA 4QOZC 3SASA 1L2CA 4OVZB 2QENA 4GIPA 4Z6YA 4JI7M 4LRSA 4B3SM 4IBJA 1PJIA 1DO2A 2KRKA 1TDZA 4AKHA 1G41A 2ZANA 4B3MM 2ZAOA 3IG5A 4MGZE 3FTFA 5E26A 3E4RA 3L2AA 1YUBA 2KZSA 4M9ZA 2YR0A 2Z4RA 2Y21A 2RGHA 3DFZA 2CE7A 3LMMA 3VKGA 5GKNA 1E9RA 1JQJC 1ZQ9A 4R7GA 3RGPA 5EP1A 3TPZA 3U6LA 1G4AE 2QZ4A 3TE6A 2XZUA 3KFUG 3I4YA 3KOWE 3EIEA 2LNHC 1Z6TA 3AV0A 2QP9X 1IN6A 1MU5A 1X37A 4JI8M 2DHRA 5EP4A 3UK6A 4FWGA 4G4QA 5EXPA 3AKZA 3GRRA 2HL7A 4AG6A 2CHGA 1Z5BA 2NQ8C 3SYLA 3L26A 4OU7A 3FKEA 4LJAA 1IN8A 3WHLA 2DVWB 1NJGA 1PJJA 4PDGA 2F5PA 4IBCA 3E9SA 4FCWA 3M7GA 4DUZM 4DV7M 2Z4SA 3HWSA 4G6ZA 4RNAA 1N34M 2J7NA 4IBIA 3FUUA 4L16A 4B08A 3K2LA 3VDUA 3U61B 3CF6E 1N77A 3FYDA 4MB7A 3U6MA 3JR4A 3GLGB 2QCUA 2XFTA 2Z3XA 3L27A 3U6SA 4CGYB 4B7FA 2F5NA 5EXSA 1UM8A 2L7IA 3AOGA 4GC9A 5FTNA 3IG8A 1XNQM 5FTLA 2X4AA 2Y20A 1K82A 1TH2A 5FTJA 2KZUA 3JAMS 2OPFA 1HT2E 2R4JA 4I81A 1JR3A 1GLNA 3K1JA 2E5LM 5EJCA 3GP1A 4LJ8A 3J80S 3SBJA 3RE8A 4G4OA 4LF8M 1KSFX 4LF7M 2L09A 4RF0A 4I5SA 5ITQA 3LVVA 1TGUA 2Q2EB 4MGYE 1K3XA 3T1HM 1DGFA 4QHSA 5ITTA 1IBKM 3EIHA 2FNAA 2V6ZM 3BOSA 4GKKM 1DGHB 3D8LA 4YY3M 4BB9A 3GLIA 1HNZM 4JI1M 4LFCM 1XHBA 3GRUA 3U5ZA 3M6AA 4RF1A 2XEPA 3FUWA 4IIWA 4B7GA 4FD2A 4FVMA 4GHAA 4MGHA 3ILKA 3TWMA 4X62M 1W5SA 4R3DA 1OFHA 3T1YM 3GLFA 1HQYE 4NRWA 3AFHA 4LZJA 2UXBM 3FUVA 3TWLA 1GL6A 2XF3A 3KOZE 2R62A 3SMPA 1XMOM 3UGJA 2UUBM 2ERCA 2QPAA 4A3VB 5C18A 1E32A 2CHVA 3U60A 1HT1E 3RFWA 4LCBA 1FNNA 1IY0A 3HU3A 2CV2A 3SAWA 4JXJA 4DUYM 1IQPA 4LFAM 1R2ZA 2KXEA 3FUXA 5JI2E 1W5TA 3R9XB 2Y0TA 3I51A 2J7OA 1Z5AA 2CFOA 5DYGA 3B9PA 2DWLA 1FJGM 4JI2M 1WXQA 3W0FA 2QBYA 2VIIA 3VLFB 2LXEA 5ITXE 4L78A 3KP1E 4OW0A 4LF6M 1C1KA 2EO2A 5FSWA 2BNKA 2UUAM 3PXGA 1YE9A 2L6OA 4X64M 1R7RA 2KRUA 4XBOA 2F4VM 2AHMA 4GH9A 2X8AA 3MHVC 4CHTB 1XC8A 3PVSA 4M0DA 1IXSB 4LF5M 4AKIA 5KQ8A 3VDPA 2XSZA 3A46A 1IN4A 3K8ZA 2I7PA 2R65A 2ZAMA 4LGMA 4MM3B 4YHHM 3THGA 1JR3D 1KFVA 3QAUA 3NBIA 4B7HA 4EIWA 3GLGA 5LMNM 4DR5M 3HU1A 3SARA 1IBMM 4OX9M 4LY6A 1J5EM 1QYRA 3DOAA 4WURA 1N33M 5IT9S 2W82A 4ITQA 4LG2A 3FTEA 1HNWM 3KP0E 3SHFA 5BR8M 5IWAM 3GQ3A 3GLHA 4KHPM 4BLCA 3HKPA 4LJ4A 2DXIA 5LMUM 2CV0A 3UMMA 3L29A 1NY5A 4PDIA 4AG5A 2C9CA 3SFZA 3UJNA 1HR0M 2F5OA 3CF0A 1DGGA 3KVWA 1QANA 3A98B 1N75A 4IJEA 3WHKA 4LF4M 3VKHA 3A45A 5KPRA 4DR4M 1QVRA 3FTCA 4MH0E 5ITUA 3H4MA 3L28A 1R6BX 2VQFM 2C5RA 1DGHA 4NSRA 1N36M 3KOXE 2ZBKB 3KOYE 4NSOB 4IJFA 1GVNA 2UUCM 1SXJC 2JA2A 3TQSA 1NY6A 4FCTA 1EE8A 2C98A 1G59A 4IBDA 4DR7M 1I4WA 3M0EA 5FLXS 1N78A 1TH3A 1R2YA 4KODA 1SXJA 4B3RM 4M9XA 1XXHA 2X49A 4LJ6A 4LJ7A 2FOIC 3LQQA 2Z7JA 2DWZB 1K3WA 2F5SA 3KSJA 2K47A 1YSYA 4QHTA 4FWHA 3HJSA 3GPXA 2V1CA 3HGIA 2KEBA 3U6EA 4AI6A 4REZA 5EXXA 2EA0A 4KO8A 2M5ZA 1TH4A 3KSXA 2YNMD 3SMSA 3R8FA 2V1UA 2H1RA 4QNMA 3HJQA 4OVZA 4MGIE 1NSFA 2R4EA 4GITA 4GRIA 4D81A 4I4LA 1L2DA 1ORYB 1QZMA 4L8RC 1DO0A 4FWDA 2RKOA 4GKJM 2HHHM 2XSZD 2C9OA 3NWLA 1Q3CA 5IREB 4DV2M 4IBFA 2XLJA 4JV5M 1ZAEA 4NRVA 4LZZA 4NOOB 3U6DA 4GHLA 3GRYA 1IM2A 4IBKA 1NNJA 4PD2A 2VQEM 3CF2A 1G3IA 5EP3A 3HHYA 2BJVA 3W0LB 1XMQM 2A5YB 3GRVA 3KXEC 5EP2A 3K92A 1QAMA 4GC5A 1E9SA 4WW0A 1D2NA 4JI0M 1I94M 4BBAA 1J09A 4D82A 1Z59A 2R46A 1E94E 1IY1A 2FFJA 4JI4M 2CHQA 2O5RA 5IZ7D 4DR1M 2D7HA 3GLIB 2UXDM 3U6OA 4W5WA 4NL4H 3U5ZB 2G5GX 5FTMA 4DV6M 2FE8A 2RGOA 4LF9M 2EUCA 4X66M 1NNUC 4ZPXA 1MX0A 3MJ5A 3GLFB 4XGIA 2YQZA 8CATA 3PNVA 4DR2M 1N32M 3D8BA 2D7GA 4L15A 4Z8XA 3FUTA 3GPUA 1GL7A 4JI6M 2XFSA 1QQWA 4LJ9A 1L8QA 3U60B 4DV5M 4TUWA 1IN7A 2OQ4A 2DZOB 3SC3A 4LJ5A 3U61A 3GQ5A 2LWXA 4MGKE 4G4RA 1QAQA 3VK7A 4GMQA 1IXZA 3VK8A 5ITYA 1IBLM 3KS8A 4DR6M 3FYCA 4I8OA 3HU2A 3DZDA 4QNRA 1IN5A 4DR3M 5BPVA 3SAVA 5DNYA 3J81S 4B3TM 4K0KM 1OFIA 2CUZA 5EXTA 5E6JA 2KA6B 3SATA 2HCBA 3GPYA 3GO8A 1SXJD 3ZCBB 3GQ4A 4PCZA 4PT5A 2QBYB 4HLQA 5EQTA 4AW4A 2XH9A 5KPZA 1S3SA 3PNYA 3A42A 4G4NA 4IBGA 5F3WA 1LV7A 3PFIA 3JR5A 4DV0M 4AQYM 1H6UA 5KO3A 3AL0C 3L25A 2ZM6M 2HKJA 4L4UA 4IBEA 1G8PA 4JI5M 3LQRA 4JN6A 1IXRC 4LFBM 2Y0QA 3MK6A 1QAOA 5KQDA 2M60A 5C1BA 5JI3E 4DV3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0Q A;  2L7H A;  2Y20 A;  2Y21 A;  4I5S A;  2Y0T A;  2L7I A; 
#chains in the Genus database with same CATH topology
 3LVW A;  2UXC M;  1CUK A;  4F1I A;  2G8L A;  4DV1 M;  1PM5 A;  2DAM A;  4F2L A;  2JY5 A;  4FCV A;  3IHP A;  4XK8 F;  1L2B A;  1T3T A;  1Q3B A;  2ZTC A;  3E46 A;  3KW6 A;  4X65 M;  4M9S A;  3J27 B;  1KYI A;  4S12 A;  3QWL A;  2I7N A;  7CAT A;  3J7A S;  3VFD A;  1D0K A;  2KW0 A;  2R18 A;  1Q39 A;  2LHG A;  5H37 D;  3DA1 A;  2BJW A;  4LRT A;  3GLH B;  3C58 A;  3Q8X A;  3FD9 A;  3U6C A;  3U6P A;  1NVM A;  2JY7 A;  3OTO M;  1WHC A;  1L1T A;  1SG9 A;  2DZN B;  1D0L A;  2C96 A;  1L1Z A;  3SAU A;  5A2Q S;  3FTD A;  1J7K A;  3TL4 X;  3UZU A;  4II7 A;  4JI3 M;  4CIS A;  3HJ8 A;  1RU3 A;  3AOE C;  2F5Q A;  1OJL A;  2L7H A;  3KDS E;  1TDH A;  3C9P A;  4KLN A;  1JR3 E;  3J2P B;  2UU9 M;  2WSE F;  3I4V A;  5ITR A;  2OOB A;  3ZC7 B;  1GKI A;  2EKK A;  2P5T A;  5DYI A;  2DKL A;  3AOE A;  3HHX A;  2R45 A;  1NHG C;  3J7B A;  4HL4 A;  3HHZ A;  3I04 M;  3TWK A;  5FTK A;  1ZV1 A;  2XGN A;  3CTW B;  3T15 A;  1Z5C A;  1GO5 A;  2YFQ A;  2K0B X;  4WP2 A;  1XNR M;  3SYK A;  1SXJ E;  2CV1 A;  3T38 A;  1OIZ A;  2CEA A;  1EFU B;  1HQC A;  2GQF A;  2XZF A;  1HNX M;  1T6O A;  5KPT A;  2C99 A;  2DWM A;  2DWN A;  3HHW A;  1OAO C;  2GNO A;  1VDD A;  2L4E A;  1PRB A;  4NXM M;  4AKG A;  5ITX A;  2LH0 A;  4M0W A;  4CIZ A;  1DGB A;  4LGY A;  1SXJ B;  2DZL A;  3AJI B;  2H5X A;  3ZH9 B;  4D80 A;  1XXH B;  4AZF A;  4JYA M;  4FW9 A;  1GJS A;  1XWI A;  4NXN M;  2D7E A;  3KS4 A;  1NJF A;  3SHG B;  1JB0 F;  2EJS A;  2J5Y A;  4QOS A;  3RGS A;  3GPP A;  1NHW C;  2QNJ A;  1IY2 A;  3U6Q A;  4P16 A;  3LCV B;  4DV4 M;  4DV3 M;  4IBB A;  1R4G A;  4QOZ C;  3SAS A;  1L2C A;  4OVZ B;  2QEN A;  4GIP A;  4Z6Y A;  4JI7 M;  4LRS A;  4B3S M;  4IBJ A;  1PJI A;  1DO2 A;  2KRK A;  2FH0 A;  1TDZ A;  4AKH A;  1G41 A;  2ZAN A;  4B3M M;  2ZAO A;  3IG5 A;  4MGZ E;  3FTF A;  1A5T A;  5E26 A;  3E4R A;  3L2A A;  1YUB A;  2KZS A;  3B74 A;  2YR0 A;  4M9Z A;  4Y28 F;  2Z4R A;  2Y21 A;  2RGH A;  3DFZ A;  2CE7 A;  3LMM A;  3VKG A;  5GKN A;  1E9R A;  2LVO C;  1JQJ C;  1ZQ9 A;  2R0I A;  4R7G A;  3RGP A;  5EP1 A;  3TPZ A;  3B7Q A;  1G4A E;  1VG5 A;  3U6L A;  3E21 A;  2QZ4 A;  3Q8G A;  3TE6 A;  4R71 A;  2XZU A;  3KFU G;  3EIE A;  2LNH C;  1Z6T A;  3I4Y A;  3KOW E;  3AV0 A;  2JY6 B;  2QP9 X;  3W68 A;  1IN6 A;  1MU5 A;  1X37 A;  4G3O A;  4JI8 M;  2DHR A;  5EP4 A;  3UK6 A;  4FWG A;  4G4Q A;  5EXP A;  3AKZ A;  3GRR A;  4NC6 A;  2HL7 A;  4AG6 A;  2CHG A;  1Z5B A;  2NQ8 C;  3LCU A;  3SYL A;  3L26 A;  4OU7 A;  3FKE A;  4LJA A;  1EIJ A;  1IN8 A;  3WHL A;  2DVW B;  1NJG A;  1OIP A;  2HWJ A;  2DI0 A;  1PJJ A;  4PDG A;  2KDL A;  4IBC A;  2F5P A;  3E9S A;  4FCW A;  3M7G A;  3CGW A;  4DUZ M;  4DV7 M;  2KNZ A;  2Z4S A;  3GLG E;  3HWS A;  1V33 A;  1UFZ A;  4G6Z A;  4RNA A;  1N34 M;  2J7N A;  4IBI A;  3FUU A;  4L16 A;  4B08 A;  3HY5 A;  4UN2 B;  3K2L A;  3VDU A;  1Y8G A;  4RKU F;  3U61 B;  1TR8 A;  3CF6 E;  3FYD A;  4MB7 A;  3U6M A;  3JR4 A;  3GLH E;  1N77 A;  3GLG B;  2QCU A;  2XFT A;  2Z3X A;  1P3Q Q;  3L27 A;  2LVP C;  3U6S A;  4CGY B;  4ANR A;  4B7F A;  2F5N A;  1D0M A;  5EXS A;  1OKS A;  1UM8 A;  2L7I A;  3AOG A;  4GC9 A;  5FTN A;  3IG8 A;  1XNQ M;  5FTL A;  2X4A A;  1R5L A;  1VEG A;  2EKF A;  2Y20 A;  1K82 A;  2DAI A;  1TH2 A;  5FTJ A;  2KZU A;  3JAM S;  2OPF A;  1HT2 E;  1VQ1 A;  2R4J A;  4I81 A;  1JR3 A;  3T6P A;  1V34 A;  1GLN A;  1YLA A;  1OAI A;  3K1J A;  2E5L M;  1V92 A;  5EJC A;  3GP1 A;  4LJ8 A;  2N35 A;  3J80 S;  3SBJ A;  3RE8 A;  4G4O A;  4LF8 M;  1KSF X;  4LF7 M;  2L09 A;  4RF0 A;  4I5S A;  5L8R F;  5ITQ A;  3LVV A;  1TGU A;  2Q2E B;  4MGY E;  1K3X A;  1NV8 A;  3T1H M;  1AIP C;  1DGF A;  4QHS A;  5ITT A;  1IBK M;  1OQY A;  3EIH A;  2FNA A;  2V6Z M;  4HEO A;  4P17 A;  3BOS A;  4GKK M;  1DGH B;  3D8L A;  4YY3 M;  4Q7J A;  4BB9 A;  3GLI A;  1HNZ M;  4JI1 M;  4LFC M;  1XHB A;  3GRU A;  2QQ8 A;  3U5Z A;  3M6A A;  4RF1 A;  2XEP A;  3FUW A;  4IIW A;  4B7G A;  1TF0 B;  1WJ7 A;  4FD2 A;  1XXH E;  4FVM A;  3K9O A;  4GHA A;  1MN3 A;  4MGH A;  3ILK A;  3TWM A;  1TTE A;  4X62 M;  1W5S A;  4R3D A;  1OFH A;  3T1Y M;  3GLF A;  1HQY E;  1Q02 A;  3H4J A;  4NRW A;  3AFH A;  4LZJ A;  2UXB M;  3FUV A;  3TWL A;  1GL6 A;  2XF3 A;  3KOZ E;  2R62 A;  3SMP A;  2LBC A;  3UGJ A;  1XMO M;  2UUB M;  2ERC A;  2QPA A;  4A3V B;  5C18 A;  1GAB A;  1E32 A;  2CHV A;  3U60 A;  1HT1 E;  3RFW A;  3C3E A;  4LCB A;  2WSC F;  1FNN A;  1IY0 A;  3HU3 A;  2CV2 A;  3SAW A;  1HJP A;  2JXN A;  4JXJ A;  4DUY M;  1VEJ A;  1IQP A;  4LFA M;  1R2Z A;  2CP8 A;  2KXE A;  3FUX A;  5JI2 E;  1W5T A;  2BWB A;  3B7N A;  3R9X B;  2Y0T A;  3I51 A;  2J7O A;  1Z5A A;  2CFO A;  2VF7 A;  3B9P A;  5DYG A;  2JUJ A;  2DWL A;  1FJG M;  4JI2 M;  1WXQ A;  3W0F A;  1QUS A;  2VII A;  2QBY A;  3VLF B;  2LXE A;  5ITX E;  4L78 A;  1IFY A;  1XB2 B;  3KP1 E;  4OW0 A;  4LF6 M;  1C1K A;  2EO2 A;  2KNV A;  3FRI A;  5FSW A;  2BNK A;  2LVN C;  2K9D A;  3IEC A;  3PXG A;  1YE9 A;  2UUA M;  2L6O A;  4X64 M;  1R7R A;  2KRU A;  4XBO A;  2F4V M;  2AHM A;  3F92 A;  4GH9 A;  2X8A A;  3MHV C;  4CHT B;  1XC8 A;  1T43 A;  1PGY A;  3PVS A;  4M0D A;  1IXS B;  4LF5 M;  1PJS A;  4AKI A;  5KQ8 A;  3VDP A;  2XSZ A;  3A46 A;  1IN4 A;  2QHO B;  3K8Z A;  2I7P A;  1F4I A;  4DBG B;  1PJT A;  2R65 A;  2JWS A;  2ZAM A;  4LGM A;  4MM3 B;  4YHH M;  3THG A;  1JR3 D;  1KFV A;  3QAU A;  3NBI A;  1PJQ A;  4B7H A;  4EIW A;  3GLG A;  5LMN M;  4DR5 M;  3HU1 A;  3SAR A;  1IBM M;  4OX9 M;  2G3Q A;  2DNA A;  4LY6 A;  1J5E M;  1QYR A;  3DOA A;  4WUR A;  3LW5 F;  1N33 M;  5IT9 S;  2LVA A;  2W82 A;  4ITQ A;  2VF8 A;  4LG2 A;  3FTE A;  1HNW M;  3KP0 E;  3SHF A;  5BR8 M;  5IWA M;  3GQ3 A;  3GLH A;  4KHP M;  4BLC A;  3HKP A;  4LJ4 A;  2HAK A;  3FE3 A;  2LTU A;  3C3D A;  2DXI A;  5LMU M;  2CV0 A;  3UMM A;  3L29 A;  1ZMV A;  1NY5 A;  4PDI A;  4AG5 A;  2C9C A;  3V76 A;  3SFZ A;  3UJN A;  2LHC A;  1OTR A;  1LTM A;  2BWE A;  2QSF X;  2KHH A;  2RRU A;  3QYE A;  1HR0 M;  2F5O A;  3CF0 A;  1DGG A;  3KVW A;  1QAN A;  3A98 B;  1N75 A;  4IJE A;  3WHK A;  2MRO B;  4LF4 M;  3VKH A;  3A45 A;  5KPR A;  4DR4 M;  1QVR A;  3FTC A;  4MH0 E;  5ITU A;  3H4M A;  3L28 A;  1GJT A;  1R6B X;  2VQF M;  2C5R A;  1DGH A;  4NSR A;  1VEK A;  1N36 M;  1WGN A;  3KOX E;  3BBZ A;  1ZMW A;  2ZBK B;  1WR1 B;  2R44 A;  3KOY E;  4NSO B;  1WGL A;  3BXW A;  1GVN A;  4IJF A;  1C7Y A;  2UUC M;  1SXJ C;  2JA2 A;  3TQS A;  1NY6 A;  4FCT A;  1EE8 A;  2C98 A;  4KT0 F;  1G59 A;  2FS1 A;  4IBD A;  4DR7 M;  1I4W A;  3M0E A;  5FLX S;  1N78 A;  1TH3 A;  2MGW A;  1R2Y A;  4KOD A;  1SXJ A;  2OOA A;  1NV9 A;  4B3R M;  4M9X A;  1XXH A;  2X49 A;  4LJ6 A;  4LJ7 A;  2FOI C;  3LQQ A;  2Z7J A;  2DWZ B;  1K3W A;  2F5S A;  3KSJ A;  2K47 A;  1YSY A;  4QHT A;  4FWH A;  3HJS A;  3GPX A;  2V1C A;  3HGI A;  2KEB A;  3U6E A;  4AI6 A;  4REZ A;  2R6F A;  1BVS A;  5EXX A;  2EA0 A;  2JZ0 A;  4KO8 A;  2M5Z A;  1TH4 A;  3KSX A;  1VDL A;  2YNM D;  3SMS A;  3R8F A;  2H1R A;  4QNM A;  2V1U A;  3HJQ A;  4OVZ A;  4MGI E;  1NSF A;  2R4E A;  4GIT A;  4GRI A;  4D81 A;  4I4L A;  1L2D A;  1ORY B;  1QZM A;  4L8R C;  2ZTD A;  1DO0 A;  2K6B A;  4FWD A;  2RKO A;  4GKJ M;  2HHH M;  4CJ6 A;  2XSZ D;  2C9O A;  3NWL A;  1Q3C A;  5IRE B;  4DV2 M;  4IBF A;  2XLJ A;  3B7Z A;  1ZAE A;  4NRV A;  4JV5 M;  4LZZ A;  4NOO B;  3U6D A;  4GHL A;  3GRY A;  1IM2 A;  3I01 M;  4IBK A;  1NNJ A;  4PD2 A;  2VQE M;  3CF2 A;  1G3I A;  5EP3 A;  3HHY A;  2BJV A;  3W0L B;  1XMQ M;  2A5Y B;  3GRV A;  3KXE C;  5EP2 A;  3K92 A;  3GLI E;  1QAM A;  4GC5 A;  1E9S A;  4WW0 A;  1IXS A;  1D2N A;  4JI0 M;  1I94 M;  4BBA A;  1J09 A;  4D82 A;  1Z59 A;  2MR9 A;  1DV0 A;  2R46 A;  1E94 E;  1IY1 A;  2OO9 A;  2FFJ A;  4JI4 M;  2CHQ A;  2O5R A;  5IZ7 D;  4DR1 M;  2Z8Y M;  2D7H A;  2JY8 A;  3GLI B;  2UXD M;  3GLF E;  4W5W A;  3U6O A;  4NL4 H;  3U5Z B;  2G5G X;  2O01 F;  2DAG A;  3B89 A;  5FTM A;  4DV6 M;  2FE8 A;  3QYB A;  2RGO A;  1MJG M;  4LF9 M;  2EUC A;  2VDB B;  4X66 M;  1NNU C;  2JNH A;  4GEW A;  1MX0 A;  3MJ5 A;  4ZPX A;  3GLF B;  4XGI A;  2YQZ A;  8CAT A;  3PNV A;  4DR2 M;  1N32 M;  3D8B A;  2D7G A;  4L15 A;  2LVQ D;  2MJ5 B;  4Z8X A;  3FUT A;  3GPU A;  2DAE A;  1GL7 A;  4JI6 M;  2XFS A;  3K9P A;  1QQW A;  2JZ1 A;  4LJ9 A;  1L8Q A;  1ZMU A;  3U60 B;  1NO1 A;  4DV5 M;  4TUW A;  1IN7 A;  2OQ4 A;  2DZO B;  4L6V 6;  4LJ5 A;  3SC3 A;  3GQ5 A;  2LWX A;  4MGK E;  4G4R A;  1QAQ A;  3U61 A;  3VK7 A;  2WSF F;  1IXZ A;  4GMQ A;  3VK8 A;  5ITY A;  1IBL M;  3KS8 A;  4DR6 M;  3FYC A;  3HX3 A;  4I8O A;  3ZQJ A;  3HU2 A;  2DAK A;  3DZD A;  4QNR A;  1IN5 A;  2B3T A;  4DR3 M;  5BPV A;  3SAV A;  5DNY A;  1AUA A;  3J81 S;  4B3T M;  3HZJ A;  1OFI A;  2CUZ A;  5EXT A;  5E6J A;  2KA6 B;  3SAT A;  4K0K M;  2HCB A;  3GPY A;  3GO8 A;  1SXJ D;  2CWB A;  3ZCB B;  3GQ4 A;  2KNA A;  3MMP A;  4PT5 A;  3W67 A;  4HLQ A;  5EQT A;  4AW4 A;  4PCZ A;  2QBY B;  2XH9 A;  1QZE A;  5KPZ A;  1S3S A;  3PNY A;  3A42 A;  1QDR A;  4G4N A;  4IBG A;  5F3W A;  1LV7 A;  2MH8 A;  3PFI A;  2JP7 A;  3JR5 A;  4DV0 M;  1H6U A;  2CRU A;  3NBX X;  4AQY M;  5KO3 A;  3AL0 C;  3L25 A;  1QUT A;  2ZM6 M;  2HKJ A;  4L4U A;  2L2D A;  4IBE A;  1G8P A;  1G71 A;  3LQR A;  4JI5 M;  2DEN A;  4JN6 A;  1IXR C;  1WIV A;  2DHY A;  4LFB M;  2APL A;  2Y0Q A;  3MK6 A;  1QAO A;  1QDT A;  5KQD A;  2M60 A;  2L4F A;  5C1B A;  5JI3 E;  2O25 A;  2WZJ A;  3FRH A;  5DFL A; 
#chains in the Genus database with same CATH homology
 3LVW A;  2UXC M;  2G8L A;  4DV1 M;  1PM5 A;  4FCV A;  1L2B A;  1T3T A;  1Q3B A;  3KW6 A;  4X65 M;  4M9S A;  3J27 B;  1KYI A;  4S12 A;  3QWL A;  2I7N A;  7CAT A;  3J7A S;  3VFD A;  2R18 A;  2KW0 A;  1Q39 A;  5H37 D;  3DA1 A;  2BJW A;  4LRT A;  3GLH B;  3C58 A;  3Q8X A;  3FD9 A;  3U6C A;  3U6P A;  1NVM A;  3OTO M;  1L1T A;  2DZN B;  2C96 A;  1L1Z A;  3SAU A;  5A2Q S;  3FTD A;  1J7K A;  3TL4 X;  3UZU A;  4II7 A;  4JI3 M;  4CIS A;  3HJ8 A;  3AOE C;  2F5Q A;  1OJL A;  2L7H A;  3KDS E;  1TDH A;  4KLN A;  3J2P B;  2UU9 M;  3I4V A;  5ITR A;  3ZC7 B;  1GKI A;  2P5T A;  5DYI A;  3AOE A;  3HHX A;  3J7B A;  2R45 A;  1NHG C;  4HL4 A;  3HHZ A;  3TWK A;  5FTK A;  2XGN A;  3CTW B;  3T15 A;  1Z5C A;  2YFQ A;  1XNR M;  3SYK A;  1SXJ E;  2CV1 A;  3T38 A;  2CEA A;  1HQC A;  2XZF A;  1HNX M;  2DWM A;  5KPT A;  2C99 A;  2DWN A;  3HHW A;  1VDD A;  4NXM M;  4AKG A;  5ITX A;  2LH0 A;  4M0W A;  1DGB A;  4LGY A;  1SXJ B;  3AJI B;  3ZH9 B;  4D80 A;  1XXH B;  4AZF A;  4JYA M;  4FW9 A;  1XWI A;  4NXN M;  2D7E A;  3KS4 A;  1NJF A;  3SHG B;  4QOS A;  3RGS A;  3GPP A;  1NHW C;  1IY2 A;  3U6Q A;  4P16 A;  4DV4 M;  4IBB A;  4QOZ C;  3SAS A;  1L2C A;  4OVZ B;  2QEN A;  4GIP A;  4Z6Y A;  4JI7 M;  4LRS A;  4B3S M;  4IBJ A;  1PJI A;  1DO2 A;  2KRK A;  1TDZ A;  4AKH A;  1G41 A;  2ZAN A;  4B3M M;  2ZAO A;  3IG5 A;  4MGZ E;  3FTF A;  5E26 A;  3E4R A;  3L2A A;  1YUB A;  2KZS A;  4M9Z A;  2YR0 A;  2Z4R A;  2Y21 A;  2RGH A;  3DFZ A;  2CE7 A;  3LMM A;  3VKG A;  5GKN A;  1E9R A;  1JQJ C;  1ZQ9 A;  4R7G A;  3RGP A;  5EP1 A;  3TPZ A;  3U6L A;  1G4A E;  2QZ4 A;  3TE6 A;  2XZU A;  3KFU G;  3I4Y A;  3KOW E;  3EIE A;  2LNH C;  1Z6T A;  3AV0 A;  2QP9 X;  1IN6 A;  1MU5 A;  1X37 A;  4JI8 M;  2DHR A;  5EP4 A;  3UK6 A;  4FWG A;  4G4Q A;  5EXP A;  3AKZ A;  3GRR A;  2HL7 A;  4AG6 A;  2CHG A;  1Z5B A;  2NQ8 C;  3SYL A;  3L26 A;  4OU7 A;  3FKE A;  4LJA A;  1IN8 A;  3WHL A;  2DVW B;  1NJG A;  1PJJ A;  4PDG A;  2F5P A;  4IBC A;  3E9S A;  4FCW A;  3M7G A;  4DUZ M;  4DV7 M;  2Z4S A;  3HWS A;  4G6Z A;  4RNA A;  1N34 M;  2J7N A;  4IBI A;  3FUU A;  4L16 A;  4B08 A;  3K2L A;  3VDU A;  3U61 B;  3CF6 E;  1N77 A;  3FYD A;  4MB7 A;  3U6M A;  3JR4 A;  3GLG B;  2QCU A;  2XFT A;  2Z3X A;  3L27 A;  3U6S A;  4CGY B;  4B7F A;  2F5N A;  5EXS A;  1UM8 A;  2L7I A;  3AOG A;  4GC9 A;  5FTN A;  3IG8 A;  1XNQ M;  5FTL A;  2X4A A;  2Y20 A;  1K82 A;  1TH2 A;  5FTJ A;  2KZU A;  3JAM S;  2OPF A;  1HT2 E;  2R4J A;  4I81 A;  1JR3 A;  1GLN A;  3K1J A;  2E5L M;  5EJC A;  3GP1 A;  4LJ8 A;  3J80 S;  3SBJ A;  3RE8 A;  4G4O A;  4LF8 M;  1KSF X;  4LF7 M;  2L09 A;  4RF0 A;  4I5S A;  5ITQ A;  3LVV A;  1TGU A;  2Q2E B;  4MGY E;  1K3X A;  3T1H M;  1DGF A;  4QHS A;  5ITT A;  1IBK M;  3EIH A;  2FNA A;  2V6Z M;  3BOS A;  4GKK M;  1DGH B;  3D8L A;  4YY3 M;  4BB9 A;  3GLI A;  1HNZ M;  4JI1 M;  4LFC M;  1XHB A;  3GRU A;  3U5Z A;  3M6A A;  4RF1 A;  2XEP A;  3FUW A;  4IIW A;  4B7G A;  4FD2 A;  4FVM A;  4GHA A;  4MGH A;  3ILK A;  3TWM A;  4X62 M;  1W5S A;  4R3D A;  1OFH A;  3T1Y M;  3GLF A;  1HQY E;  4NRW A;  3AFH A;  4LZJ A;  2UXB M;  3FUV A;  3TWL A;  1GL6 A;  2XF3 A;  3KOZ E;  2R62 A;  3SMP A;  1XMO M;  3UGJ A;  2UUB M;  2ERC A;  2QPA A;  4A3V B;  5C18 A;  1E32 A;  2CHV A;  3U60 A;  1HT1 E;  3RFW A;  4LCB A;  1FNN A;  1IY0 A;  3HU3 A;  2CV2 A;  3SAW A;  4JXJ A;  4DUY M;  1IQP A;  4LFA M;  1R2Z A;  2KXE A;  3FUX A;  5JI2 E;  1W5T A;  3R9X B;  2Y0T A;  3I51 A;  2J7O A;  1Z5A A;  2CFO A;  5DYG A;  3B9P A;  2DWL A;  1FJG M;  4JI2 M;  1WXQ A;  3W0F A;  2QBY A;  2VII A;  3VLF B;  2LXE A;  5ITX E;  4L78 A;  3KP1 E;  4OW0 A;  4LF6 M;  1C1K A;  2EO2 A;  5FSW A;  2BNK A;  2UUA M;  3PXG A;  1YE9 A;  2L6O A;  4X64 M;  1R7R A;  2KRU A;  4XBO A;  2F4V M;  2AHM A;  4GH9 A;  2X8A A;  3MHV C;  4CHT B;  1XC8 A;  3PVS A;  4M0D A;  1IXS B;  4LF5 M;  4AKI A;  5KQ8 A;  3VDP A;  2XSZ A;  3A46 A;  1IN4 A;  3K8Z A;  2I7P A;  2R65 A;  2ZAM A;  4LGM A;  4MM3 B;  4YHH M;  3THG A;  1JR3 D;  1KFV A;  3QAU A;  3NBI A;  4B7H A;  4EIW A;  3GLG A;  5LMN M;  4DR5 M;  3HU1 A;  3SAR A;  1IBM M;  4OX9 M;  4LY6 A;  1J5E M;  1QYR A;  3DOA A;  4WUR A;  1N33 M;  5IT9 S;  2W82 A;  4ITQ A;  4LG2 A;  3FTE A;  1HNW M;  3KP0 E;  3SHF A;  5BR8 M;  5IWA M;  3GQ3 A;  3GLH A;  4KHP M;  4BLC A;  3HKP A;  4LJ4 A;  2DXI A;  5LMU M;  2CV0 A;  3UMM A;  3L29 A;  1NY5 A;  4PDI A;  4AG5 A;  2C9C A;  3SFZ A;  3UJN A;  1HR0 M;  2F5O A;  3CF0 A;  1DGG A;  3KVW A;  1QAN A;  3A98 B;  1N75 A;  4IJE A;  3WHK A;  4LF4 M;  3VKH A;  3A45 A;  5KPR A;  4DR4 M;  1QVR A;  3FTC A;  4MH0 E;  5ITU A;  3H4M A;  3L28 A;  1R6B X;  2VQF M;  2C5R A;  1DGH A;  4NSR A;  1N36 M;  3KOX E;  2ZBK B;  3KOY E;  4NSO B;  4IJF A;  1GVN A;  2UUC M;  1SXJ C;  2JA2 A;  3TQS A;  1NY6 A;  4FCT A;  1EE8 A;  2C98 A;  1G59 A;  4IBD A;  4DR7 M;  1I4W A;  3M0E A;  5FLX S;  1N78 A;  1TH3 A;  1R2Y A;  4KOD A;  1SXJ A;  4B3R M;  4M9X A;  1XXH A;  2X49 A;  4LJ6 A;  4LJ7 A;  2FOI C;  3LQQ A;  2Z7J A;  2DWZ B;  1K3W A;  2F5S A;  3KSJ A;  2K47 A;  1YSY A;  4QHT A;  4FWH A;  3HJS A;  3GPX A;  2V1C A;  3HGI A;  2KEB A;  3U6E A;  4AI6 A;  4REZ A;  5EXX A;  2EA0 A;  4KO8 A;  2M5Z A;  1TH4 A;  3KSX A;  2YNM D;  3SMS A;  3R8F A;  2V1U A;  2H1R A;  4QNM A;  3HJQ A;  4OVZ A;  4MGI E;  1NSF A;  2R4E A;  4GIT A;  4GRI A;  4D81 A;  4I4L A;  1L2D A;  1ORY B;  1QZM A;  4L8R C;  1DO0 A;  4FWD A;  2RKO A;  4GKJ M;  2HHH M;  2XSZ D;  2C9O A;  3NWL A;  1Q3C A;  5IRE B;  4DV2 M;  4IBF A;  2XLJ A;  4JV5 M;  1ZAE A;  4NRV A;  4LZZ A;  4NOO B;  3U6D A;  4GHL A;  3GRY A;  1IM2 A;  4IBK A;  1NNJ A;  4PD2 A;  2VQE M;  3CF2 A;  1G3I A;  5EP3 A;  3HHY A;  2BJV A;  3W0L B;  1XMQ M;  2A5Y B;  3GRV A;  3KXE C;  5EP2 A;  3K92 A;  1QAM A;  4GC5 A;  1E9S A;  4WW0 A;  1D2N A;  4JI0 M;  1I94 M;  4BBA A;  1J09 A;  4D82 A;  1Z59 A;  2R46 A;  1E94 E;  1IY1 A;  2FFJ A;  4JI4 M;  2CHQ A;  2O5R A;  5IZ7 D;  4DR1 M;  2D7H A;  3GLI B;  2UXD M;  3U6O A;  4W5W A;  4NL4 H;  3U5Z B;  2G5G X;  5FTM A;  4DV6 M;  2FE8 A;  2RGO A;  4LF9 M;  2EUC A;  4X66 M;  1NNU C;  4ZPX A;  1MX0 A;  3MJ5 A;  3GLF B;  4XGI A;  2YQZ A;  8CAT A;  3PNV A;  4DR2 M;  1N32 M;  3D8B A;  2D7G A;  4L15 A;  4Z8X A;  3FUT A;  3GPU A;  1GL7 A;  4JI6 M;  2XFS A;  1QQW A;  4LJ9 A;  1L8Q A;  3U60 B;  4DV5 M;  4TUW A;  1IN7 A;  2OQ4 A;  2DZO B;  3SC3 A;  4LJ5 A;  3U61 A;  3GQ5 A;  2LWX A;  4MGK E;  4G4R A;  1QAQ A;  3VK7 A;  4GMQ A;  1IXZ A;  3VK8 A;  5ITY A;  1IBL M;  3KS8 A;  4DR6 M;  3FYC A;  4I8O A;  3HU2 A;  3DZD A;  4QNR A;  1IN5 A;  4DR3 M;  5BPV A;  3SAV A;  5DNY A;  3J81 S;  4B3T M;  4K0K M;  1OFI A;  2CUZ A;  5EXT A;  5E6J A;  2KA6 B;  3SAT A;  2HCB A;  3GPY A;  3GO8 A;  1SXJ D;  3ZCB B;  3GQ4 A;  4PCZ A;  4PT5 A;  2QBY B;  4HLQ A;  5EQT A;  4AW4 A;  2XH9 A;  5KPZ A;  1S3S A;  3PNY A;  3A42 A;  4G4N A;  4IBG A;  5F3W A;  1LV7 A;  3PFI A;  3JR5 A;  4DV0 M;  4AQY M;  1H6U A;  5KO3 A;  3AL0 C;  3L25 A;  2ZM6 M;  2HKJ A;  4L4U A;  4IBE A;  1G8P A;  4JI5 M;  3LQR A;  4JN6 A;  1IXR C;  4LFB M;  2Y0Q A;  3MK6 A;  1QAO A;  5KQD A;  2M60 A;  5C1B A;  5JI3 E;  4DV3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...