2Y20A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
TITRPIIELSNTIDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords UNCHARACTERIZED PROTEIN
publication title The Mechanisms of Hamp-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y20A00
2Y0TA 4I5SA 2Y21A 2Y0QA 2L7IA 2Y20A 2L7HA
chains in the Genus database with same CATH superfamily
4LGYA 3SMSA 4DV7M 3GRVA 3U61B 1DV0A 2H1RA 3E4RA 2LVPC 1NNJA 3J7AS 4I5SA 3AV0A 2J7NA 2WZJA 3QYBA 4IJFA 2DKLA 3KOYE 3U6MA 4PCZA 1JQJC 2KZUA 3ILKA 1NV9A 5EP2A 5LMUM 1IY2A 1QDRA 2GQFA 2VDBB 3LMMA 4FW9A 3V76A 1QAQA 1T43A 3I4YA 2DWMA 2F5SA 4GMQA 1Z5AA 4PDGA 4AG6A 4FCVA 4KT0F 3IG8A 1QQWA 4LF9M 7CATA 1QAOA 2VF7A 4P16A 1TGUA 4AQYM 1OFHA 2DAEA 1TTEA 3U6DA 4FVMA 1QUSA 5ITRA 4IBBA 3ZCBB 4X62M 2KA6B 1Q02A 2MROB 4LF4M 2CHGA 4LCBA 4B7FA 1N33M 1BVSA 3EIEA 2D7EA 4FCTA 2UUAM 4BLCA 1QYRA 2CHVA 4X65M 2VF8A 3W68A 3KXEC 1IN8A 4II7A 2C5RA 4FWGA 1NV8A 1IBMM 2XGNA 4PD2A 4EIWA 3L26A 2JZ0A 2Y0TA 1G59A 1N32M 2DI0A 3ZC7B 1WHCA 4WP2A 3SASA 4G6ZA 1XXHB 4M9XA 1HNZM 4LGMA 4MH0E 2KRKA 1NJGA 4NC6A 1SG9A 1G41A 1Q3CA 2R18A 4RF0A 3FUUA 2M5ZA 4LJ5A 1N77A 5EXPA 3GLFE 1XMQM 1DGHB 1J7KA 4JXJA 4IBIA 4RNAA 1VDLA 4XK8F 4GKKM 3U6OA 4REZA 5ITQA 2I7NA 4B3SM 3FYCA 2BNKA 5DNYA 1XNRM 1Z59A 1XB2B 2FOIC 1ZAEA 1R4GA 2Y20A 5DFLA 3GLFB 4DR4M 3C58A 4DBGB 2DWNA 2F4VM 4JYAM 3MK6A 4QOSA 1PJQA 3PNYA 2FNAA 2KNAA 3GLFA 1IN5A 2UUBM 2OO9A 1EFUB 4MM3B 1IXRC 5C18A 3GPXA 4LG2A 4FWHA 1IXSB 5KQ8A 2XFTA 2HWJA 3L29A 3K1JA 3SFZA 4S12A 4B7GA 2XF3A 4CISA 2LHCA 4LJ8A 1IXSA 3J7BA 2Y0QA 3E46A 2XSZD 3L2AA 4DUYM 3TWLA 4G4OA 1IN4A 2ZAMA 1F4IA 2JA2A 3GLIA 2CV1A 2AHMA 3M0EA 2QHOB 4LJAA 4NXNM 2R45A 3HJ8A 4FD2A 3SAUA 1GJTA 2KW0A 3C9PA 4WW0A 2LVQD 3LQQA 3R8FA 1S3SA 2F5NA 5IREB 3TE6A 3W67A 3GPPA 2JY7A 3TL4X 1PJIA 3RGSA 1HNXM 2V1UA 3KOXE 2FS1A 4QHTA 3UZUA 1WXQA 1N34M 2V1CA 3Q8GA 4I81A 1AIPC 1WGLA 1DGFA 1JB0F 2X49A 1NJFA 2K9DA 2G8LA 4HEOA 4IBKA 4AI6A 4AKGA 2C96A 4NRVA 3R9XB 2XSZA 3HZJA 1VEJA 2K6BA 2YR0A 4LY6A 2C98A 2CHQA 4KLNA 1TDZA 4KO8A 3GO8A 4JI8M 3KW6A 2X4AA 4L15A 3KS8A 1IN7A 1NVMA 3B74A 2QSFX 4DR6M 3UMMA 4GRIA 3GQ4A 2WSCF 1HT2E 2HKJA 3HJQA 1QUTA 4M0WA 3FTEA 4L8RC 1Z6TA 1ZV1A 3WHKA 3VK7A 1V34A 2HL7A 3HU1A 4IBJA 4LZZA 2DZNB 5EJCA 2ZAOA 3FTCA 4HL4A 4F1IA 3J81S 4CGYB 1HT1E 4CHTB 3SATA 1WIVA 4DV4M 2D7GA 2YQZA 5A2QS 4DR3M 3GRYA 3Q8XA 3UK6A 3U6SA 1XMOM 2J7OA 4WURA 3L28A 2DENA 3CF0A 1J09A 1ZMUA 3HU3A 1G4AE 1CUKA 1D0LA 2CEAA 2QP9X 4OVZB 2DAIA 3T38A 3KOWE 3THGA 2ZANA 4QHSA 1R2YA 2UU9M 4LF8M 1XNQM 1MN3A 2XFSA 2KHHA 4PDIA 3FRHA 4XGIA 4OVZA 4DUZM 1OQYA 2Z4SA 2F5OA 4MGIE 3A42A 2K0BX 4LF7M 3TPZA 1GLNA 1PRBA 4OX9M 4HLQA 2EO2A 5EP3A 4GC9A 1QZEA 1X37A 2KRUA 1IBKM 3U5ZA 4AG5A 3GQ5A 2RGOA 3PVSA 2DHRA 4I8OA 5JI2E 1DGGA 1P3QQ 3T6PA 4DR5M 1G8PA 3B7QA 5BPVA 4ITQA 2MR9A 4M9ZA 2YNMD 5IWAM 4B7HA 3OTOM 3KFUG 1K82A 2LTUA 4IJEA 3J2PB 5ITYA 2B3TA 3JR4A 4YY3M 1NO1A 1I4WA 1R6BX 4ANRA 1QZMA 4P17A 2HAKA 4DV3M 4DV5M 4D80A 2Z7JA 4IBEA 3U60A 3DFZA 3IECA 2R0IA 4AKHA 2D7HA 1OKSA 1OJLA 3MMPA 2O25A 5EXTA 2L6OA 4AZFA 1GO5A 2CUZA 1ZMWA 2LXEA 2JZ1A 2YFQA 3A45A 3A98B 2HCBA 4OW0A 3PXGA 2JY8A 2KDLA 3HWSA 4ZPXA 4BB9A 1UFZA 3AOGA 4JI4M 4L6V6 2CFOA 3LW5F 3HGIA 1YE9A 3SHFA 3QAUA 2R65A 3IG5A 3KVWA 2LH0A 5E6JA 4LFAM 1PM5A 2Q2EB 3RE8A 3JR5A 1FNNA 3D8BA 1TH3A 4LJ7A 4CJ6A 3CF2A 2ZTDA 3U6PA 4K0KM 4X64M 4B3RM 2JWSA 3VDPA 1HQCA 4DR2M 1MU5A 2WSEF 2F5PA 4JI5M 4AKIA 2X8AA 3I01M 4JI6M 2OPFA 4G3OA 2XZUA 2JUJA 2G3QA 1I94M 2DWLA 2LWXA 2Z8YM 3FUWA 2RGHA 1NY5A 2CV0A 3B89A 3GLIE 1QANA 2OOAA 1TDHA 1EIJA 4AW4A 2L4FA 4B3MM 4QNRA 1IY1A 1IBLM 4LF5M 4JV5M 3FTFA 2DAGA 3LVWA 2VQEM 3B9PA 3E21A 4XBOA 3VKHA 2DHYA 1RU3A 2BWEA 2CWBA 3GLIB 4IBDA 4MGKE 3HY5A 2VIIA 4MGZE 3SHGB 1AUAA 2FE8A 4DR7M 1SXJD 3K92A 2DAMA 4F2LA 1IXZA 1KFVA 4RF1A 3WHLA 2KEBA 5KPTA 3SARA 3FUVA 3RGPA 4M0DA 4B3TM 4I4LA 1L8QA 2MH8A 5FTKA 3HHYA 5JI3E 3GLGA 2Z3XA 1XC8A 3NBIA 2QQ8A 4GHLA 1E94E 1SXJE 2JP7A 2Z4RA 2W82A 4W5WA 2RKOA 2LVAA 2L7HA 2KNZA 3L27A 3GRUA 4IBGA 1NSFA 2MGWA 4GC5A 4NOOB 3LVVA 1QVRA 1SXJB 3NWLA 4R3DA 4DV6M 5ITTA 1NHWC 1DGBA 5EQTA 3CGWA 2EUCA 1SXJA 2UXDM 2KZSA 1QAMA 2FH0A 3BOSA 5F3WA 1PGYA 5DYGA 1NNUC 1Y8GA 1N78A 2C9CA 3SAVA 4JI3M 3I04M 2OQ4A 1JR3D 3DOAA 3HU2A 2KNVA 1D0MA 2C99A 2MJ5B 3FUTA 4LJ4A 5ITXE 2ZM6M 3GPUA 5H37D 1HJPA 4L16A 2QCUA 1OAIA 1E9RA 1QDTA 3UJNA 4JI1M 1TH4A 4OU7A 2R44A 1JR3E 4JI7M 1E32A 1OAOC 1TR8A 2EJSA 2APLA 2CRUA 4B08A 4LFBM 1KYIA 3AKZA 2LNHC 1K3XA 2L09A 1L1ZA 2R6FA 3KSXA 2BJWA 3CTWB 5ITXA 3ZH9B 3BBZA 3SYKA 2GNOA 1V33A 1SXJC 2BJVA 3I4VA 4R7GA 1OFIA 1VG5A 2P5TA 1JR3A 2JY6B 4X66M 2ERCA 4NSRA 4IBFA 2QBYA 5FTMA 1R5LA 3U5ZB 2L4EA 2DNAA 1NHGC 1HNWM 1VEGA 1IM2A 3C3DA 3NBXX 4KHPM 4LJ9A 3D8LA 2EKFA 1LTMA 4JI2M 3U6EA 2LVNC 3TWMA 1MX0A 3VKGA 3U61A 3VFDA 1E9SA 4LRSA 1HR0M 5ITUA 1DO0A 3M6AA 1KSFX 1WJ7A 3GRRA 3H4MA 2K47A 4Z8XA 4G4QA 3U60B 1A5TA 3W0LB 3FTDA 4GIPA 3FUXA 1WR1B 2RRUA 5DYIA 1T3TA 1YUBA 4PT5A 4L78A 1Z5CA 1NY6A 4Y28F 4G4RA 3T15A 1W5TA 3H4JA 4GHAA 4D82A 2XEPA 3AFHA 3K8ZA 4TUWA 5IZ7D 4MGYE 3SYLA 3LCUA 4DV2M 4YHHM 2HHHM 4NL4H 4QNMA 3W0FA 2OOBA 5FTNA 3I51A 5GKNA 2ZBKB 2BWBA 4G4NA 3VLFB 1T6OA 3A46A 1WGNA 2V6ZM 1Z5BA 3U6LA 3EIHA 3HJSA 3QYEA 1OIPA 5EP1A 4R71A 1XXHE 4DV0M 2UUCM 5EP4A 3ZQJA 1GKIA 1XWIA 2DAKA 1R7RA 5LMNM 2I7PA 4GKJM 2O01F 4JI0M 5BR8M 2G5GX 3LQRA 3UGJA 4LFCM 1GL7A 3JAMS 1HQYE 2A5YB 2LHGA 1Q39A 3SBJA 3K2LA 3L25A 5IT9S 1IN6A 4JN6A 2M60A 4NRWA 3FKEA 3AL0C 4RKUF 3T1YM 1OTRA 3FE3A 2DWZB 4DV1M 3M7GA 3FRIA 4FCWA 1GJSA 1PJJA 1XXHA 4A3VB 1H6UA 1L2DA 4KODA 5KQDA 2XZFA 2DZLA 4M9SA 2JNHA 1G3IA 3KP1E 3SAWA 4MB7A 3GLGE 1YSYA 3DZDA 4LRTA 4MGHA 3RFWA 2F5QA 1VQ1A 3HKPA 2DZOB 2DXIA 1DGHA 1UM8A 3GQ3A 4Z6YA 1XHBA 4UN2B 2CE7A 4BBAA 1G71A 2QPAA 3GLGB 3CF6E 1YLAA 3HHZA 3VK8A 1N36M 1DO2A 4FWDA 3K9OA 4IIWA 3T1HM 2ZTCA 3GPYA 1IQPA 1MJGM 3GLHE 1D2NA 3B7ZA 1C1KA 5E26A 2NQ8C 3AOEA 5EXXA 5L8RF 2J5YA 1LV7A 3MJ5A 4LZJA 2Y21A 1L2CA 5EXSA 1N75A 1VDDA 3GLHB 3KP0E 1TF0B 3QWLA 4Q7JA 5KPZA 5FLXS 3AJIB 1ZMVA 3KSJA 1ZQ9A 3TWKA 4IBCA 5C1BA 1W5SA 5FSWA 1EE8A 2WSFF 3GLHA 4GEWA 2UXBM 5KPRA 1Q3BA 3KDSE 3C3EA 2UXCM 3E9SA 1L2BA 1PJTA 3HX3A 1D0KA 2N35A 2QNJA 1R2ZA 3U6CA 3HHWA 4QOZC 2JXNA 2R4JA 3IHPA 1J5EM 2R62A 3PNVA 3J27B 5FTLA 5KO3A 3FD9A 1V92A 4D81A 3KOZE 2LBCA 4L4UA 3TQSA 4DR1M 4LF6M 2VQFM 2JY5A 3LCVB 1OIZA 1ORYB 2R4EA 3AOEC 3F92A 2C9OA 1GABA 3K9PA 4NSOB 2O5RA 2EKKA 3SMPA 3J80S 2E5LM 5FTJA 3GP1A 3B7NA 1TH2A 3KS4A 2L2DA 4LJ6A 2EA0A 3U6QA 1VEKA 2H5XA 4GITA 1GL6A 3PFIA 3SC3A 3BXWA 8CATA 2QBYB 2CP8A 1L1TA 3DA1A 3HHXA 3VDUA 3MHVC 4CIZA 2KXEA 1IY0A 1C7YA 2QENA 2FFJA 2XH9A 1PJSA 2R46A 1GVNA 3FYDA 4GH9A 1K3WA 2CV2A 1IFYA 2XLJA 2QZ4A 4NXMM 2L7IA 1FJGM 2DVWB 2LVOC
chains in the Genus database with same CATH topology
4LGYA 3SMSA 4DV7M 3GRVA 3U61B 2H1RA 3E4RA 1NNJA 3J7AS 4I5SA 3AV0A 2J7NA 4IJFA 3KOYE 3U6MA 4PCZA 1JQJC 2KZUA 3ILKA 5EP2A 5LMUM 1IY2A 3LMMA 4FW9A 1QAQA 3I4YA 2DWMA 2F5SA 4GMQA 1Z5AA 4PDGA 4AG6A 4FCVA 3IG8A 1QQWA 4LF9M 7CATA 1QAOA 4P16A 1TGUA 4AQYM 1OFHA 3U6DA 4FVMA 5ITRA 4X62M 4IBBA 3ZCBB 2KA6B 4LF4M 2CHGA 4LCBA 4B7FA 1N33M 3EIEA 2D7EA 4FCTA 2UUAM 4BLCA 1QYRA 2CHVA 4X65M 3KXEC 1IN8A 4II7A 2C5RA 4FWGA 1IBMM 2XGNA 4PD2A 4EIWA 3L26A 2Y0TA 1G59A 1N32M 3ZC7B 3SASA 4G6ZA 1XXHB 4M9XA 1HNZM 4LGMA 4MH0E 2KRKA 1NJGA 1G41A 1Q3CA 2R18A 4RF0A 3FUUA 2M5ZA 4LJ5A 1N77A 5EXPA 1XMQM 1DGHB 1J7KA 4JXJA 4IBIA 4RNAA 4GKKM 3U6OA 4REZA 5ITQA 2I7NA 4B3SM 3FYCA 2BNKA 5DNYA 1XNRM 1Z59A 2Y20A 2FOIC 1ZAEA 3GLFB 4DR4M 3C58A 2F4VM 2DWNA 4JYAM 3MK6A 4QOSA 3PNYA 2FNAA 3GLFA 1IN5A 2UUBM 4MM3B 1IXRC 5C18A 3GPXA 4LG2A 4FWHA 1IXSB 5KQ8A 2XFTA 3L29A 3K1JA 3SFZA 4S12A 4B7GA 2XF3A 4CISA 4LJ8A 3J7BA 2Y0QA 3L2AA 2XSZD 4DUYM 3TWLA 4G4OA 1IN4A 2ZAMA 2JA2A 3GLIA 2CV1A 2AHMA 3M0EA 4NXNM 4LJAA 2R45A 3HJ8A 4FD2A 3SAUA 2KW0A 4WW0A 3LQQA 3R8FA 1S3SA 2F5NA 5IREB 3TE6A 3GPPA 3TL4X 1PJIA 3RGSA 1HNXM 2V1UA 3KOXE 4QHTA 3UZUA 1WXQA 1N34M 2V1CA 4I81A 1DGFA 2X49A 1NJFA 2G8LA 4IBKA 4AI6A 4AKGA 2C96A 4NRVA 3R9XB 2XSZA 2YR0A 4LY6A 2C98A 2CHQA 4KLNA 1TDZA 4KO8A 3GO8A 4JI8M 3KW6A 2X4AA 4L15A 3KS8A 1IN7A 1NVMA 4DR6M 3UMMA 4GRIA 3GQ4A 1HT2E 2HKJA 3HJQA 4M0WA 3FTEA 4L8RC 1Z6TA 3WHKA 3VK7A 2HL7A 3HU1A 4IBJA 4LZZA 2DZNB 5EJCA 2ZAOA 3FTCA 4HL4A 3J81S 4CGYB 1HT1E 4CHTB 3SATA 4DV4M 2D7GA 2YQZA 5A2QS 4DR3M 3GRYA 3Q8XA 3UK6A 3U6SA 1XMOM 2J7OA 4WURA 3L28A 3CF0A 1J09A 3HU3A 1G4AE 2CEAA 2QP9X 4OVZB 3T38A 1R2YA 3KOWE 3THGA 2ZANA 4QHSA 2UU9M 4LF8M 1XNQM 2XFSA 4PDIA 4XGIA 4OVZA 4DUZM 2Z4SA 2F5OA 4MGIE 3A42A 4LF7M 3TPZA 1GLNA 4OX9M 4HLQA 2EO2A 5EP3A 4GC9A 1X37A 2KRUA 1IBKM 3U5ZA 4AG5A 3GQ5A 2RGOA 3PVSA 2DHRA 4I8OA 5JI2E 1DGGA 4DR5M 1G8PA 5BPVA 4ITQA 4M9ZA 2YNMD 5IWAM 4B7HA 3OTOM 3KFUG 1K82A 4IJEA 3J2PB 5ITYA 3JR4A 4YY3M 1I4WA 1R6BX 1QZMA 4DV3M 4DV5M 4D80A 2Z7JA 4IBEA 3U60A 3DFZA 4AKHA 2D7HA 1OJLA 5EXTA 2L6OA 4AZFA 2CUZA 2LXEA 2YFQA 3A45A 3A98B 2HCBA 4OW0A 3PXGA 4BB9A 3HWSA 4JI4M 4ZPXA 3AOGA 2CFOA 3HGIA 1YE9A 3SHFA 3QAUA 2R65A 3IG5A 3KVWA 2LH0A 5E6JA 4LFAM 1PM5A 2Q2EB 3RE8A 3JR5A 1FNNA 3D8BA 1TH3A 4LJ7A 3CF2A 3U6PA 4K0KM 4X64M 4B3RM 3VDPA 1HQCA 4DR2M 1MU5A 2F5PA 4JI5M 4AKIA 2X8AA 4JI6M 2OPFA 2XZUA 1I94M 2DWLA 2LWXA 3FUWA 2RGHA 1NY5A 2CV0A 1QANA 1TDHA 4AW4A 4B3MM 4QNRA 1IY1A 1IBLM 4LF5M 4JV5M 3FTFA 3LVWA 2VQEM 3B9PA 4XBOA 3VKHA 3GLIB 4IBDA 4MGKE 4MGZE 2VIIA 3SHGB 2FE8A 4DR7M 1SXJD 3K92A 1IXZA 1KFVA 4RF1A 3WHLA 2KEBA 5KPTA 3SARA 3FUVA 3RGPA 4M0DA 4B3TM 4I4LA 1L8QA 5FTKA 3HHYA 5JI3E 3GLGA 2Z3XA 1XC8A 3NBIA 4GHLA 1E94E 1SXJE 2Z4RA 2W82A 4W5WA 2RKOA 2L7HA 3L27A 3GRUA 4IBGA 1NSFA 4GC5A 4R3DA 4NOOB 3LVVA 1QVRA 1SXJB 3NWLA 4DV6M 5ITTA 1NHWC 1DGBA 5EQTA 2EUCA 1SXJA 2UXDM 2KZSA 1QAMA 3BOSA 5F3WA 5DYGA 1NNUC 1N78A 2C9CA 3SAVA 4JI3M 2OQ4A 1JR3D 3DOAA 3HU2A 2C99A 3FUTA 5ITXE 4LJ4A 2ZM6M 3GPUA 5H37D 4L16A 2QCUA 1E9RA 3UJNA 4JI1M 1TH4A 4OU7A 4JI7M 1E32A 4B08A 4LFBM 1KYIA 3AKZA 2LNHC 1K3XA 2L09A 1L1ZA 3KSXA 2BJWA 3CTWB 5ITXA 3ZH9B 3SYKA 1SXJC 2BJVA 3I4VA 4R7GA 1OFIA 2P5TA 1JR3A 4X66M 2ERCA 4NSRA 4IBFA 2QBYA 5FTMA 3U5ZB 1NHGC 1HNWM 4KHPM 1IM2A 4LJ9A 3D8LA 4JI2M 3U6EA 3TWMA 1MX0A 3VKGA 3U61A 3VFDA 1E9SA 4LRSA 1HR0M 5ITUA 1DO0A 3M6AA 1KSFX 4Z8XA 3GRRA 3H4MA 2K47A 4G4QA 3U60B 3W0LB 3FTDA 4GIPA 3FUXA 5DYIA 1T3TA 1YUBA 4PT5A 4L78A 1Z5CA 1NY6A 4G4RA 3T15A 1W5TA 4GHAA 4D82A 2XEPA 3AFHA 3K8ZA 4TUWA 5IZ7D 4MGYE 3SYLA 4DV2M 4YHHM 2HHHM 4NL4H 4QNMA 3W0FA 5FTNA 3I51A 5GKNA 2ZBKB 4G4NA 3VLFB 3A46A 2V6ZM 1Z5BA 3U6LA 3EIHA 3HJSA 5EP1A 4DV0M 2UUCM 5EP4A 1GKIA 1XWIA 1R7RA 5LMNM 2I7PA 4GKJM 4JI0M 5BR8M 2G5GX 3LQRA 3UGJA 4LFCM 1GL7A 3JAMS 1HQYE 2A5YB 5IT9S 1Q39A 3SBJA 3K2LA 3L25A 1IN6A 4JN6A 2M60A 4NRWA 3FKEA 3AL0C 3T1YM 2DWZB 4DV1M 3M7GA 4FCWA 1PJJA 1XXHA 4A3VB 1H6UA 1L2DA 4KODA 5KQDA 2XZFA 4M9SA 1G3IA 3KP1E 3SAWA 4MB7A 1YSYA 3DZDA 4LRTA 4MGHA 3RFWA 2F5QA 3HKPA 2DZOB 2DXIA 1DGHA 1UM8A 3GQ3A 4Z6YA 1XHBA 2CE7A 4BBAA 3GLGB 2QPAA 3HHZA 3CF6E 3VK8A 1N36M 1DO2A 4FWDA 4IIWA 3T1HM 3GPYA 1IQPA 1D2NA 1C1KA 5E26A 2NQ8C 3AOEA 5EXXA 1LV7A 3MJ5A 4LZJA 2Y21A 1L2CA 5EXSA 1N75A 1VDDA 3GLHB 3KP0E 3QWLA 5KPZA 5FLXS 3AJIB 3KSJA 1ZQ9A 3TWKA 4IBCA 5C1BA 1W5SA 5FSWA 1EE8A 3GLHA 2UXBM 5KPRA 1Q3BA 3KDSE 2UXCM 3E9SA 1L2BA 1R2ZA 3U6CA 3HHWA 4QOZC 2R4JA 1J5EM 2R62A 3PNVA 3J27B 5FTLA 5KO3A 3FD9A 4D81A 3KOZE 4L4UA 4DR1M 3TQSA 4LF6M 2VQFM 1ORYB 2R4EA 3AOEC 2C9OA 4NSOB 2O5RA 3SMPA 3J80S 2E5LM 5FTJA 3GP1A 1TH2A 3KS4A 4LJ6A 2EA0A 3U6QA 8CATA 4GITA 1GL6A 3PFIA 3SC3A 2QBYB 1L1TA 3DA1A 3HHXA 3VDUA 3MHVC 2KXEA 1IY0A 2QENA 2FFJA 2XH9A 2R46A 1GVNA 3FYDA 4GH9A 1K3WA 2CV2A 2XLJA 2QZ4A 4NXMM 2L7IA 1FJGM 2DVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  4I5S A;  2Y21 A;  2Y0Q A;  2L7I A;  2Y20 A;  2L7H A; 
#chains in the Genus database with same CATH topology
 4LGY A;  3SMS A;  4DV7 M;  3GRV A;  3U61 B;  1DV0 A;  2H1R A;  3E4R A;  2LVP C;  1NNJ A;  3J7A S;  4I5S A;  3AV0 A;  2J7N A;  2WZJ A;  3QYB A;  4IJF A;  2DKL A;  3KOY E;  3U6M A;  4PCZ A;  1JQJ C;  2KZU A;  3ILK A;  1NV9 A;  5EP2 A;  5LMU M;  1IY2 A;  1QDR A;  2GQF A;  2VDB B;  3LMM A;  4FW9 A;  3V76 A;  1QAQ A;  1T43 A;  3I4Y A;  2DWM A;  2F5S A;  4GMQ A;  1Z5A A;  4PDG A;  4AG6 A;  4FCV A;  4KT0 F;  3IG8 A;  1QQW A;  4LF9 M;  7CAT A;  1QAO A;  2VF7 A;  4P16 A;  1TGU A;  4AQY M;  1OFH A;  2DAE A;  1TTE A;  3U6D A;  4FVM A;  1QUS A;  5ITR A;  4IBB A;  3ZCB B;  4X62 M;  2KA6 B;  1Q02 A;  2MRO B;  4LF4 M;  2CHG A;  4LCB A;  4B7F A;  1N33 M;  1BVS A;  3EIE A;  2D7E A;  4FCT A;  2UUA M;  4BLC A;  1QYR A;  2CHV A;  4X65 M;  2VF8 A;  3W68 A;  3KXE C;  1IN8 A;  4II7 A;  2C5R A;  4FWG A;  1NV8 A;  1IBM M;  2XGN A;  4PD2 A;  4EIW A;  3L26 A;  2JZ0 A;  2Y0T A;  1G59 A;  1N32 M;  2DI0 A;  3ZC7 B;  1WHC A;  4WP2 A;  3SAS A;  4G6Z A;  1XXH B;  4M9X A;  1HNZ M;  4LGM A;  4MH0 E;  2KRK A;  1NJG A;  4NC6 A;  1SG9 A;  1G41 A;  1Q3C A;  2R18 A;  4RF0 A;  3FUU A;  2M5Z A;  4LJ5 A;  1N77 A;  5EXP A;  3GLF E;  1XMQ M;  1DGH B;  1J7K A;  4JXJ A;  4IBI A;  4RNA A;  1VDL A;  4XK8 F;  4GKK M;  3U6O A;  4REZ A;  5ITQ A;  2I7N A;  4B3S M;  3FYC A;  2BNK A;  5DNY A;  1XNR M;  1Z59 A;  1XB2 B;  2FOI C;  1ZAE A;  1R4G A;  2Y20 A;  5DFL A;  3GLF B;  4DR4 M;  3C58 A;  4DBG B;  2DWN A;  2F4V M;  4JYA M;  3MK6 A;  4QOS A;  1PJQ A;  3PNY A;  2FNA A;  2KNA A;  3GLF A;  1IN5 A;  2UUB M;  2OO9 A;  1EFU B;  4MM3 B;  1IXR C;  5C18 A;  3GPX A;  4LG2 A;  4FWH A;  1IXS B;  5KQ8 A;  2XFT A;  2HWJ A;  3L29 A;  3K1J A;  3SFZ A;  4S12 A;  4B7G A;  2XF3 A;  4CIS A;  2LHC A;  4LJ8 A;  1IXS A;  3J7B A;  2Y0Q A;  3E46 A;  2XSZ D;  3L2A A;  4DUY M;  3TWL A;  4G4O A;  1IN4 A;  2ZAM A;  1F4I A;  2JA2 A;  3GLI A;  2CV1 A;  2AHM A;  3M0E A;  2QHO B;  4LJA A;  4NXN M;  2R45 A;  3HJ8 A;  4FD2 A;  3SAU A;  1GJT A;  2KW0 A;  3C9P A;  4WW0 A;  2LVQ D;  3LQQ A;  3R8F A;  1S3S A;  2F5N A;  5IRE B;  3TE6 A;  3W67 A;  3GPP A;  2JY7 A;  3TL4 X;  1PJI A;  3RGS A;  1HNX M;  2V1U A;  3KOX E;  2FS1 A;  4QHT A;  3UZU A;  1WXQ A;  1N34 M;  2V1C A;  3Q8G A;  4I81 A;  1AIP C;  1WGL A;  1DGF A;  1JB0 F;  2X49 A;  1NJF A;  2K9D A;  2G8L A;  4HEO A;  4IBK A;  4AI6 A;  4AKG A;  2C96 A;  4NRV A;  3R9X B;  2XSZ A;  3HZJ A;  1VEJ A;  2K6B A;  2YR0 A;  4LY6 A;  2C98 A;  2CHQ A;  4KLN A;  1TDZ A;  4KO8 A;  3GO8 A;  4JI8 M;  3KW6 A;  2X4A A;  4L15 A;  3KS8 A;  1IN7 A;  1NVM A;  3B74 A;  2QSF X;  4DR6 M;  3UMM A;  4GRI A;  3GQ4 A;  2WSC F;  1HT2 E;  2HKJ A;  3HJQ A;  1QUT A;  4M0W A;  3FTE A;  4L8R C;  1Z6T A;  1ZV1 A;  3WHK A;  3VK7 A;  1V34 A;  2HL7 A;  3HU1 A;  4IBJ A;  4LZZ A;  2DZN B;  5EJC A;  2ZAO A;  3FTC A;  4HL4 A;  4F1I A;  3J81 S;  4CGY B;  1HT1 E;  4CHT B;  3SAT A;  1WIV A;  4DV4 M;  2D7G A;  2YQZ A;  5A2Q S;  4DR3 M;  3GRY A;  3Q8X A;  3UK6 A;  3U6S A;  1XMO M;  2J7O A;  4WUR A;  3L28 A;  2DEN A;  3CF0 A;  1J09 A;  1ZMU A;  3HU3 A;  1G4A E;  1CUK A;  1D0L A;  2CEA A;  2QP9 X;  4OVZ B;  2DAI A;  3T38 A;  3KOW E;  3THG A;  2ZAN A;  4QHS A;  1R2Y A;  2UU9 M;  4LF8 M;  1XNQ M;  1MN3 A;  2XFS A;  2KHH A;  4PDI A;  3FRH A;  4XGI A;  4OVZ A;  4DUZ M;  1OQY A;  2Z4S A;  2F5O A;  4MGI E;  3A42 A;  2K0B X;  4LF7 M;  3TPZ A;  1GLN A;  1PRB A;  4OX9 M;  4HLQ A;  2EO2 A;  5EP3 A;  4GC9 A;  1QZE A;  1X37 A;  2KRU A;  1IBK M;  3U5Z A;  4AG5 A;  3GQ5 A;  2RGO A;  3PVS A;  2DHR A;  4I8O A;  5JI2 E;  1DGG A;  1P3Q Q;  3T6P A;  4DR5 M;  1G8P A;  3B7Q A;  5BPV A;  4ITQ A;  2MR9 A;  4M9Z A;  2YNM D;  5IWA M;  4B7H A;  3OTO M;  3KFU G;  1K82 A;  2LTU A;  4IJE A;  3J2P B;  5ITY A;  2B3T A;  3JR4 A;  4YY3 M;  1NO1 A;  1I4W A;  1R6B X;  4ANR A;  1QZM A;  4P17 A;  2HAK A;  4DV3 M;  4DV5 M;  4D80 A;  2Z7J A;  4IBE A;  3U60 A;  3DFZ A;  3IEC A;  2R0I A;  4AKH A;  2D7H A;  1OKS A;  1OJL A;  3MMP A;  2O25 A;  5EXT A;  2L6O A;  4AZF A;  1GO5 A;  2CUZ A;  1ZMW A;  2LXE A;  2JZ1 A;  2YFQ A;  3A45 A;  3A98 B;  2HCB A;  4OW0 A;  3PXG A;  2JY8 A;  2KDL A;  3HWS A;  4ZPX A;  4BB9 A;  1UFZ A;  3AOG A;  4JI4 M;  4L6V 6;  2CFO A;  3LW5 F;  3HGI A;  1YE9 A;  3SHF A;  3QAU A;  2R65 A;  3IG5 A;  3KVW A;  2LH0 A;  5E6J A;  4LFA M;  1PM5 A;  2Q2E B;  3RE8 A;  3JR5 A;  1FNN A;  3D8B A;  1TH3 A;  4LJ7 A;  4CJ6 A;  3CF2 A;  2ZTD A;  3U6P A;  4K0K M;  4X64 M;  4B3R M;  2JWS A;  3VDP A;  1HQC A;  4DR2 M;  1MU5 A;  2WSE F;  2F5P A;  4JI5 M;  4AKI A;  2X8A A;  3I01 M;  4JI6 M;  2OPF A;  4G3O A;  2XZU A;  2JUJ A;  2G3Q A;  1I94 M;  2DWL A;  2LWX A;  2Z8Y M;  3FUW A;  2RGH A;  1NY5 A;  2CV0 A;  3B89 A;  3GLI E;  1QAN A;  2OOA A;  1TDH A;  1EIJ A;  4AW4 A;  2L4F A;  4B3M M;  4QNR A;  1IY1 A;  1IBL M;  4LF5 M;  4JV5 M;  3FTF A;  2DAG A;  3LVW A;  2VQE M;  3B9P A;  3E21 A;  4XBO A;  3VKH A;  2DHY A;  1RU3 A;  2BWE A;  2CWB A;  3GLI B;  4IBD A;  4MGK E;  3HY5 A;  2VII A;  4MGZ E;  3SHG B;  1AUA A;  2FE8 A;  4DR7 M;  1SXJ D;  3K92 A;  2DAM A;  4F2L A;  1IXZ A;  1KFV A;  4RF1 A;  3WHL A;  2KEB A;  5KPT A;  3SAR A;  3FUV A;  3RGP A;  4M0D A;  4B3T M;  4I4L A;  1L8Q A;  2MH8 A;  5FTK A;  3HHY A;  5JI3 E;  3GLG A;  2Z3X A;  1XC8 A;  3NBI A;  2QQ8 A;  4GHL A;  1E94 E;  1SXJ E;  2JP7 A;  2Z4R A;  2W82 A;  4W5W A;  2RKO A;  2LVA A;  2L7H A;  2KNZ A;  3L27 A;  3GRU A;  4IBG A;  1NSF A;  2MGW A;  4GC5 A;  4NOO B;  3LVV A;  1QVR A;  1SXJ B;  3NWL A;  4R3D A;  4DV6 M;  5ITT A;  1NHW C;  1DGB A;  5EQT A;  3CGW A;  2EUC A;  1SXJ A;  2UXD M;  2KZS A;  1QAM A;  2FH0 A;  3BOS A;  5F3W A;  1PGY A;  5DYG A;  1NNU C;  1Y8G A;  1N78 A;  2C9C A;  3SAV A;  4JI3 M;  3I04 M;  2OQ4 A;  1JR3 D;  3DOA A;  3HU2 A;  2KNV A;  1D0M A;  2C99 A;  2MJ5 B;  3FUT A;  4LJ4 A;  5ITX E;  2ZM6 M;  3GPU A;  5H37 D;  1HJP A;  4L16 A;  2QCU A;  1OAI A;  1E9R A;  1QDT A;  3UJN A;  4JI1 M;  1TH4 A;  4OU7 A;  2R44 A;  1JR3 E;  4JI7 M;  1E32 A;  1OAO C;  1TR8 A;  2EJS A;  2APL A;  2CRU A;  4B08 A;  4LFB M;  1KYI A;  3AKZ A;  2LNH C;  1K3X A;  2L09 A;  1L1Z A;  2R6F A;  3KSX A;  2BJW A;  3CTW B;  5ITX A;  3ZH9 B;  3BBZ A;  3SYK A;  2GNO A;  1V33 A;  1SXJ C;  2BJV A;  3I4V A;  4R7G A;  1OFI A;  1VG5 A;  2P5T A;  1JR3 A;  2JY6 B;  4X66 M;  2ERC A;  4NSR A;  4IBF A;  2QBY A;  5FTM A;  1R5L A;  3U5Z B;  2L4E A;  2DNA A;  1NHG C;  1HNW M;  1VEG A;  1IM2 A;  3C3D A;  3NBX X;  4KHP M;  4LJ9 A;  3D8L A;  2EKF A;  1LTM A;  4JI2 M;  3U6E A;  2LVN C;  3TWM A;  1MX0 A;  3VKG A;  3U61 A;  3VFD A;  1E9S A;  4LRS A;  1HR0 M;  5ITU A;  1DO0 A;  3M6A A;  1KSF X;  1WJ7 A;  3GRR A;  3H4M A;  2K47 A;  4Z8X A;  4G4Q A;  3U60 B;  1A5T A;  3W0L B;  3FTD A;  4GIP A;  3FUX A;  1WR1 B;  2RRU A;  5DYI A;  1T3T A;  1YUB A;  4PT5 A;  4L78 A;  1Z5C A;  1NY6 A;  4Y28 F;  4G4R A;  3T15 A;  1W5T A;  3H4J A;  4GHA A;  4D82 A;  2XEP A;  3AFH A;  3K8Z A;  4TUW A;  5IZ7 D;  4MGY E;  3SYL A;  3LCU A;  4DV2 M;  4YHH M;  2HHH M;  4NL4 H;  4QNM A;  3W0F A;  2OOB A;  5FTN A;  3I51 A;  5GKN A;  2ZBK B;  2BWB A;  4G4N A;  3VLF B;  1T6O A;  3A46 A;  1WGN A;  2V6Z M;  1Z5B A;  3U6L A;  3EIH A;  3HJS A;  3QYE A;  1OIP A;  5EP1 A;  4R71 A;  1XXH E;  4DV0 M;  2UUC M;  5EP4 A;  3ZQJ A;  1GKI A;  1XWI A;  2DAK A;  1R7R A;  5LMN M;  2I7P A;  4GKJ M;  2O01 F;  4JI0 M;  5BR8 M;  2G5G X;  3LQR A;  3UGJ A;  4LFC M;  1GL7 A;  3JAM S;  1HQY E;  2A5Y B;  2LHG A;  1Q39 A;  3SBJ A;  3K2L A;  3L25 A;  5IT9 S;  1IN6 A;  4JN6 A;  2M60 A;  4NRW A;  3FKE A;  3AL0 C;  4RKU F;  3T1Y M;  1OTR A;  3FE3 A;  2DWZ B;  4DV1 M;  3M7G A;  3FRI A;  4FCW A;  1GJS A;  1PJJ A;  1XXH A;  4A3V B;  1H6U A;  1L2D A;  4KOD A;  5KQD A;  2XZF A;  2DZL A;  4M9S A;  2JNH A;  1G3I A;  3KP1 E;  3SAW A;  4MB7 A;  3GLG E;  1YSY A;  3DZD A;  4LRT A;  4MGH A;  3RFW A;  2F5Q A;  1VQ1 A;  3HKP A;  2DZO B;  2DXI A;  1DGH A;  1UM8 A;  3GQ3 A;  4Z6Y A;  1XHB A;  4UN2 B;  2CE7 A;  4BBA A;  1G71 A;  2QPA A;  3GLG B;  3CF6 E;  1YLA A;  3HHZ A;  3VK8 A;  1N36 M;  1DO2 A;  4FWD A;  3K9O A;  4IIW A;  3T1H M;  2ZTC A;  3GPY A;  1IQP A;  1MJG M;  3GLH E;  1D2N A;  3B7Z A;  1C1K A;  5E26 A;  2NQ8 C;  3AOE A;  5EXX A;  5L8R F;  2J5Y A;  1LV7 A;  3MJ5 A;  4LZJ A;  2Y21 A;  1L2C A;  5EXS A;  1N75 A;  1VDD A;  3GLH B;  3KP0 E;  1TF0 B;  3QWL A;  4Q7J A;  5KPZ A;  5FLX S;  3AJI B;  1ZMV A;  3KSJ A;  1ZQ9 A;  3TWK A;  4IBC A;  5C1B A;  1W5S A;  5FSW A;  1EE8 A;  2WSF F;  3GLH A;  4GEW A;  2UXB M;  5KPR A;  1Q3B A;  3KDS E;  3C3E A;  2UXC M;  3E9S A;  1L2B A;  1PJT A;  3HX3 A;  1D0K A;  2N35 A;  2QNJ A;  1R2Z A;  3U6C A;  3HHW A;  4QOZ C;  2JXN A;  2R4J A;  3IHP A;  1J5E M;  2R62 A;  3PNV A;  3J27 B;  5FTL A;  5KO3 A;  3FD9 A;  1V92 A;  4D81 A;  3KOZ E;  2LBC A;  4L4U A;  3TQS A;  4DR1 M;  4LF6 M;  2VQF M;  2JY5 A;  3LCV B;  1OIZ A;  1ORY B;  2R4E A;  3AOE C;  3F92 A;  2C9O A;  1GAB A;  3K9P A;  4NSO B;  2O5R A;  2EKK A;  3SMP A;  3J80 S;  2E5L M;  5FTJ A;  3GP1 A;  3B7N A;  1TH2 A;  3KS4 A;  2L2D A;  4LJ6 A;  2EA0 A;  3U6Q A;  1VEK A;  2H5X A;  4GIT A;  1GL6 A;  3PFI A;  3SC3 A;  3BXW A;  8CAT A;  2QBY B;  2CP8 A;  1L1T A;  3DA1 A;  3HHX A;  3VDU A;  3MHV C;  4CIZ A;  2KXE A;  1IY0 A;  1C7Y A;  2QEN A;  2FFJ A;  2XH9 A;  1PJS A;  2R46 A;  1GVN A;  3FYD A;  4GH9 A;  1K3W A;  2CV2 A;  1IFY A;  2XLJ A;  2QZ4 A;  4NXM M;  2L7I A;  1FJG M;  2DVW B;  2LVO C; 
#chains in the Genus database with same CATH homology
 4LGY A;  3SMS A;  4DV7 M;  3GRV A;  3U61 B;  2H1R A;  3E4R A;  1NNJ A;  3J7A S;  4I5S A;  3AV0 A;  2J7N A;  4IJF A;  3KOY E;  3U6M A;  4PCZ A;  1JQJ C;  2KZU A;  3ILK A;  5EP2 A;  5LMU M;  1IY2 A;  3LMM A;  4FW9 A;  1QAQ A;  3I4Y A;  2DWM A;  2F5S A;  4GMQ A;  1Z5A A;  4PDG A;  4AG6 A;  4FCV A;  3IG8 A;  1QQW A;  4LF9 M;  7CAT A;  1QAO A;  4P16 A;  1TGU A;  4AQY M;  1OFH A;  3U6D A;  4FVM A;  5ITR A;  4X62 M;  4IBB A;  3ZCB B;  2KA6 B;  4LF4 M;  2CHG A;  4LCB A;  4B7F A;  1N33 M;  3EIE A;  2D7E A;  4FCT A;  2UUA M;  4BLC A;  1QYR A;  2CHV A;  4X65 M;  3KXE C;  1IN8 A;  4II7 A;  2C5R A;  4FWG A;  1IBM M;  2XGN A;  4PD2 A;  4EIW A;  3L26 A;  2Y0T A;  1G59 A;  1N32 M;  3ZC7 B;  3SAS A;  4G6Z A;  1XXH B;  4M9X A;  1HNZ M;  4LGM A;  4MH0 E;  2KRK A;  1NJG A;  1G41 A;  1Q3C A;  2R18 A;  4RF0 A;  3FUU A;  2M5Z A;  4LJ5 A;  1N77 A;  5EXP A;  1XMQ M;  1DGH B;  1J7K A;  4JXJ A;  4IBI A;  4RNA A;  4GKK M;  3U6O A;  4REZ A;  5ITQ A;  2I7N A;  4B3S M;  3FYC A;  2BNK A;  5DNY A;  1XNR M;  1Z59 A;  2Y20 A;  2FOI C;  1ZAE A;  3GLF B;  4DR4 M;  3C58 A;  2F4V M;  2DWN A;  4JYA M;  3MK6 A;  4QOS A;  3PNY A;  2FNA A;  3GLF A;  1IN5 A;  2UUB M;  4MM3 B;  1IXR C;  5C18 A;  3GPX A;  4LG2 A;  4FWH A;  1IXS B;  5KQ8 A;  2XFT A;  3L29 A;  3K1J A;  3SFZ A;  4S12 A;  4B7G A;  2XF3 A;  4CIS A;  4LJ8 A;  3J7B A;  2Y0Q A;  3L2A A;  2XSZ D;  4DUY M;  3TWL A;  4G4O A;  1IN4 A;  2ZAM A;  2JA2 A;  3GLI A;  2CV1 A;  2AHM A;  3M0E A;  4NXN M;  4LJA A;  2R45 A;  3HJ8 A;  4FD2 A;  3SAU A;  2KW0 A;  4WW0 A;  3LQQ A;  3R8F A;  1S3S A;  2F5N A;  5IRE B;  3TE6 A;  3GPP A;  3TL4 X;  1PJI A;  3RGS A;  1HNX M;  2V1U A;  3KOX E;  4QHT A;  3UZU A;  1WXQ A;  1N34 M;  2V1C A;  4I81 A;  1DGF A;  2X49 A;  1NJF A;  2G8L A;  4IBK A;  4AI6 A;  4AKG A;  2C96 A;  4NRV A;  3R9X B;  2XSZ A;  2YR0 A;  4LY6 A;  2C98 A;  2CHQ A;  4KLN A;  1TDZ A;  4KO8 A;  3GO8 A;  4JI8 M;  3KW6 A;  2X4A A;  4L15 A;  3KS8 A;  1IN7 A;  1NVM A;  4DR6 M;  3UMM A;  4GRI A;  3GQ4 A;  1HT2 E;  2HKJ A;  3HJQ A;  4M0W A;  3FTE A;  4L8R C;  1Z6T A;  3WHK A;  3VK7 A;  2HL7 A;  3HU1 A;  4IBJ A;  4LZZ A;  2DZN B;  5EJC A;  2ZAO A;  3FTC A;  4HL4 A;  3J81 S;  4CGY B;  1HT1 E;  4CHT B;  3SAT A;  4DV4 M;  2D7G A;  2YQZ A;  5A2Q S;  4DR3 M;  3GRY A;  3Q8X A;  3UK6 A;  3U6S A;  1XMO M;  2J7O A;  4WUR A;  3L28 A;  3CF0 A;  1J09 A;  3HU3 A;  1G4A E;  2CEA A;  2QP9 X;  4OVZ B;  3T38 A;  1R2Y A;  3KOW E;  3THG A;  2ZAN A;  4QHS A;  2UU9 M;  4LF8 M;  1XNQ M;  2XFS A;  4PDI A;  4XGI A;  4OVZ A;  4DUZ M;  2Z4S A;  2F5O A;  4MGI E;  3A42 A;  4LF7 M;  3TPZ A;  1GLN A;  4OX9 M;  4HLQ A;  2EO2 A;  5EP3 A;  4GC9 A;  1X37 A;  2KRU A;  1IBK M;  3U5Z A;  4AG5 A;  3GQ5 A;  2RGO A;  3PVS A;  2DHR A;  4I8O A;  5JI2 E;  1DGG A;  4DR5 M;  1G8P A;  5BPV A;  4ITQ A;  4M9Z A;  2YNM D;  5IWA M;  4B7H A;  3OTO M;  3KFU G;  1K82 A;  4IJE A;  3J2P B;  5ITY A;  3JR4 A;  4YY3 M;  1I4W A;  1R6B X;  1QZM A;  4DV3 M;  4DV5 M;  4D80 A;  2Z7J A;  4IBE A;  3U60 A;  3DFZ A;  4AKH A;  2D7H A;  1OJL A;  5EXT A;  2L6O A;  4AZF A;  2CUZ A;  2LXE A;  2YFQ A;  3A45 A;  3A98 B;  2HCB A;  4OW0 A;  3PXG A;  4BB9 A;  3HWS A;  4JI4 M;  4ZPX A;  3AOG A;  2CFO A;  3HGI A;  1YE9 A;  3SHF A;  3QAU A;  2R65 A;  3IG5 A;  3KVW A;  2LH0 A;  5E6J A;  4LFA M;  1PM5 A;  2Q2E B;  3RE8 A;  3JR5 A;  1FNN A;  3D8B A;  1TH3 A;  4LJ7 A;  3CF2 A;  3U6P A;  4K0K M;  4X64 M;  4B3R M;  3VDP A;  1HQC A;  4DR2 M;  1MU5 A;  2F5P A;  4JI5 M;  4AKI A;  2X8A A;  4JI6 M;  2OPF A;  2XZU A;  1I94 M;  2DWL A;  2LWX A;  3FUW A;  2RGH A;  1NY5 A;  2CV0 A;  1QAN A;  1TDH A;  4AW4 A;  4B3M M;  4QNR A;  1IY1 A;  1IBL M;  4LF5 M;  4JV5 M;  3FTF A;  3LVW A;  2VQE M;  3B9P A;  4XBO A;  3VKH A;  3GLI B;  4IBD A;  4MGK E;  4MGZ E;  2VII A;  3SHG B;  2FE8 A;  4DR7 M;  1SXJ D;  3K92 A;  1IXZ A;  1KFV A;  4RF1 A;  3WHL A;  2KEB A;  5KPT A;  3SAR A;  3FUV A;  3RGP A;  4M0D A;  4B3T M;  4I4L A;  1L8Q A;  5FTK A;  3HHY A;  5JI3 E;  3GLG A;  2Z3X A;  1XC8 A;  3NBI A;  4GHL A;  1E94 E;  1SXJ E;  2Z4R A;  2W82 A;  4W5W A;  2RKO A;  2L7H A;  3L27 A;  3GRU A;  4IBG A;  1NSF A;  4GC5 A;  4R3D A;  4NOO B;  3LVV A;  1QVR A;  1SXJ B;  3NWL A;  4DV6 M;  5ITT A;  1NHW C;  1DGB A;  5EQT A;  2EUC A;  1SXJ A;  2UXD M;  2KZS A;  1QAM A;  3BOS A;  5F3W A;  5DYG A;  1NNU C;  1N78 A;  2C9C A;  3SAV A;  4JI3 M;  2OQ4 A;  1JR3 D;  3DOA A;  3HU2 A;  2C99 A;  3FUT A;  5ITX E;  4LJ4 A;  2ZM6 M;  3GPU A;  5H37 D;  4L16 A;  2QCU A;  1E9R A;  3UJN A;  4JI1 M;  1TH4 A;  4OU7 A;  4JI7 M;  1E32 A;  4B08 A;  4LFB M;  1KYI A;  3AKZ A;  2LNH C;  1K3X A;  2L09 A;  1L1Z A;  3KSX A;  2BJW A;  3CTW B;  5ITX A;  3ZH9 B;  3SYK A;  1SXJ C;  2BJV A;  3I4V A;  4R7G A;  1OFI A;  2P5T A;  1JR3 A;  4X66 M;  2ERC A;  4NSR A;  4IBF A;  2QBY A;  5FTM A;  3U5Z B;  1NHG C;  1HNW M;  4KHP M;  1IM2 A;  4LJ9 A;  3D8L A;  4JI2 M;  3U6E A;  3TWM A;  1MX0 A;  3VKG A;  3U61 A;  3VFD A;  1E9S A;  4LRS A;  1HR0 M;  5ITU A;  1DO0 A;  3M6A A;  1KSF X;  4Z8X A;  3GRR A;  3H4M A;  2K47 A;  4G4Q A;  3U60 B;  3W0L B;  3FTD A;  4GIP A;  3FUX A;  5DYI A;  1T3T A;  1YUB A;  4PT5 A;  4L78 A;  1Z5C A;  1NY6 A;  4G4R A;  3T15 A;  1W5T A;  4GHA A;  4D82 A;  2XEP A;  3AFH A;  3K8Z A;  4TUW A;  5IZ7 D;  4MGY E;  3SYL A;  4DV2 M;  4YHH M;  2HHH M;  4NL4 H;  4QNM A;  3W0F A;  5FTN A;  3I51 A;  5GKN A;  2ZBK B;  4G4N A;  3VLF B;  3A46 A;  2V6Z M;  1Z5B A;  3U6L A;  3EIH A;  3HJS A;  5EP1 A;  4DV0 M;  2UUC M;  5EP4 A;  1GKI A;  1XWI A;  1R7R A;  5LMN M;  2I7P A;  4GKJ M;  4JI0 M;  5BR8 M;  2G5G X;  3LQR A;  3UGJ A;  4LFC M;  1GL7 A;  3JAM S;  1HQY E;  2A5Y B;  5IT9 S;  1Q39 A;  3SBJ A;  3K2L A;  3L25 A;  1IN6 A;  4JN6 A;  2M60 A;  4NRW A;  3FKE A;  3AL0 C;  3T1Y M;  2DWZ B;  4DV1 M;  3M7G A;  4FCW A;  1PJJ A;  1XXH A;  4A3V B;  1H6U A;  1L2D A;  4KOD A;  5KQD A;  2XZF A;  4M9S A;  1G3I A;  3KP1 E;  3SAW A;  4MB7 A;  1YSY A;  3DZD A;  4LRT A;  4MGH A;  3RFW A;  2F5Q A;  3HKP A;  2DZO B;  2DXI A;  1DGH A;  1UM8 A;  3GQ3 A;  4Z6Y A;  1XHB A;  2CE7 A;  4BBA A;  3GLG B;  2QPA A;  3HHZ A;  3CF6 E;  3VK8 A;  1N36 M;  1DO2 A;  4FWD A;  4IIW A;  3T1H M;  3GPY A;  1IQP A;  1D2N A;  1C1K A;  5E26 A;  2NQ8 C;  3AOE A;  5EXX A;  1LV7 A;  3MJ5 A;  4LZJ A;  2Y21 A;  1L2C A;  5EXS A;  1N75 A;  1VDD A;  3GLH B;  3KP0 E;  3QWL A;  5KPZ A;  5FLX S;  3AJI B;  3KSJ A;  1ZQ9 A;  3TWK A;  4IBC A;  5C1B A;  1W5S A;  5FSW A;  1EE8 A;  3GLH A;  2UXB M;  5KPR A;  1Q3B A;  3KDS E;  2UXC M;  3E9S A;  1L2B A;  1R2Z A;  3U6C A;  3HHW A;  4QOZ C;  2R4J A;  1J5E M;  2R62 A;  3PNV A;  3J27 B;  5FTL A;  5KO3 A;  3FD9 A;  4D81 A;  3KOZ E;  4L4U A;  4DR1 M;  3TQS A;  4LF6 M;  2VQF M;  1ORY B;  2R4E A;  3AOE C;  2C9O A;  4NSO B;  2O5R A;  3SMP A;  3J80 S;  2E5L M;  5FTJ A;  3GP1 A;  1TH2 A;  3KS4 A;  4LJ6 A;  2EA0 A;  3U6Q A;  8CAT A;  4GIT A;  1GL6 A;  3PFI A;  3SC3 A;  2QBY B;  1L1T A;  3DA1 A;  3HHX A;  3VDU A;  3MHV C;  2KXE A;  1IY0 A;  2QEN A;  2FFJ A;  2XH9 A;  2R46 A;  1GVN A;  3FYD A;  4GH9 A;  1K3W A;  2CV2 A;  2XLJ A;  2QZ4 A;  4NXM M;  2L7I A;  1FJG M;  2DVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...