2Y20A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291i mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
b'TITRPIIELSNTIDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UNCHARACTERIZED PROTEIN
publication title The Mechanisms of Hamp-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y20A00
2Y21A 2Y0TA 2Y20A 2Y0QA 2L7IA 2L7HA 4I5SA
chains in the Genus database with same CATH superfamily
4L15A 1IFYA 1SXJB 1XC8A 3PFIA 4AZFA 3C58A 2MH8A 1V92A 1NNJA 4M9SA 2M60A 4QNMA 1TH3A 3JR5A 1DGHB 3RFWA 2DHYA 3U6LA 2J7OA 1L1TA 1OFIA 3FTEA 4L78A 3KS4A 2X4AA 3J7AS 2YNMD 3LQQA 2K6BA 4HL4A 3GLHB 4G6ZA 4DR2M 5ITRA 2QBYA 3HU2A 3J7BA 3HU3A 2DWZB 4LJ4A 2KDLA 2JWSA 3MJ5A 3I51A 3HY5A 3GPYA 3T1HM 3GRVA 1XWIA 1Y8GA 2DWNA 5ITYA 3SAUA 1XMOM 2MROB 3GLIB 3K92A 2LVAA 1TF0B 2J5YA 2L6OA 3HKPA 3SBJA 4GITA 1NHWC 3E21A 1XB2B 4B3SM 1VG5A 1DGBA 2DZOB 4LFAM 1R2ZA 3KVWA 1DGHA 1GJSA 2JY8A 2DVWB 2XEPA 4JXJA 2V1UA 4YY3M 2JY6B 1IXZA 1N36M 4GHAA 2UXBM 3C3EA 3ILKA 1VEKA 3W68A 3SMSA 1G59A 3C9PA 1XNRM 3NWLA 3TQSA 4RNAA 4GEWA 1OKSA 4IBKA 1HT2E 4IJEA 4LGYA 4LFCM 1DGFA 4CGYB 4OVZB 3FRIA 1IBMM 1OFHA 3L2AA 1E9RA 5EP2A 1IXRC 4NC6A 3AOEC 3U6EA 4B3RM 2JXNA 3SHGB 2LVOC 2KRKA 2JY5A 2O5RA 3AOGA 5FTLA 3FTCA 3FYCA 4CISA 4AKHA 1KFVA 2YQZA 2LHCA 4NRWA 4F1IA 2CRUA 3ZQJA 1QZEA 5ITQA 2OO9A 4LJ9A 3GLGE 2E5LM 2R0IA 1KYIA 2DHRA 1IY0A 3D8LA 2F5QA 2R44A 4JI2M 3U5ZA 2UUCM 2BJWA 2ERCA 4B08A 3A45A 2Z8YM 2KNZA 1ZAEA 1Q02A 2JY7A 3IG5A 2KRUA 1F4IA 2EKFA 1GO5A 3FKEA 3GQ4A 4BBAA 5KO3A 2DAKA 1TTEA 2R62A 5IT9S 1HNWM 2CFOA 1NY6A 1Q3BA 2R18A 1TH4A 1PJQA 4CJ6A 4ANRA 1GL7A 1GVNA 3RGSA 3CF2A 4FVMA 1EIJA 3QYEA 4JI1M 4NL4H 3PXGA 4I5SA 3V76A 3WHLA 2JNHA 3FTFA 3B7NA 3GRUA 4JI8M 2QPAA 1JQJC 3UZUA 3GPPA 4DR7M 1OQYA 2BWEA 2KW0A 2DAIA 4NSOB 3THGA 1UM8A 1Z59A 1N32M 2EO2A 3T1YM 4BB9A 3U60B 1AIPC 4JV5M 2ZTDA 1KSFX 2JA2A 3E4RA 3KP1E 2VQFM 3U6PA 4JYAM 2HKJA 1UFZA 3LCVB 5EXPA 7CATA 1GABA 2CV2A 4MB7A 3GO8A 2L4EA 1NY5A 3SFZA 2EJSA 2NQ8C 4G4QA 3U6SA 1XNQM 1CUKA 1ORYB 2CE7A 3LVWA 3K8ZA 1EFUB 4X64M 1IXSA 1RU3A 2KEBA 3HHXA 1L2BA 4RF1A 2F5PA 4GKJM 3UK6A 1YE9A 3H4MA 3LMMA 4AW4A 4FWHA 4IBFA 1QAMA 1JR3D 2LVNC 3FUUA 3WHKA 1PJIA 1T43A 3BBZA 4CHTB 2B3TA 2X8AA 4LZZA 2MGWA 2QNJA 4OU7A 2OQ4A 4DR4M 2L09A 2L7HA 1J7KA 3VKHA 1XXHA 5DYIA 2K0BX 1L2CA 3HJ8A 4HEOA 4JI0M 2DNAA 2D7HA 2CEAA 3M6AA 4LJAA 1QZMA 1TH2A 5EXTA 1P3QQ 4AKGA 3DOAA 4GIPA 4MGZE 1IM2A 3KOWE 2Y0TA 4IBDA 2FNAA 4B3MM 1J5EM 2WSEF 2RKOA 2G5GX 2LHGA 2XSZA 1EE8A 4W5WA 4D82A 3UGJA 2H5XA 3U6QA 4G4NA 2FOIC 1MU5A 1WGNA 4LRSA 4R3DA 3GLFB 1FNNA 4DBGB 4LF4M 4GH9A 4REZA 1PJSA 2VIIA 1HJPA 3NBIA 5A2QS 3TWLA 1LV7A 3SARA 1TDZA 4LRTA 3FUVA 3GLIE 2XGNA 3EIHA 3LVVA 4NXNM 1IN4A 4LF9M 4AG6A 3SAVA 3L27A 3B74A 1YUBA 3FTDA 2HHHM 3TPZA 5KPTA 2XZUA 4LJ8A 3JR4A 1L1ZA 1GJTA 2CWBA 4GRIA 4MH0E 4QHSA 2OOAA 3M7GA 4RF0A 3W0LB 4DR3M 4GKKM 2C98A 1SXJA 4LJ6A 3HHWA 3W0FA 1ZMUA 2V1CA 3A98B 3E46A 4P17A 3UMMA 1BVSA 1E32A 4K0KM 2C5RA 1ZMWA 4QHTA 2I7PA 4GMQA 3SHFA 2ZAMA 4FWDA 4IBIA 1TR8A 3GLHA 1DO0A 4M9XA 4FW9A 4IBGA 4DV2M 3J81S 1Q39A 2AHMA 3LCUA 5KQ8A 1VEJA 4A3VB 2D7GA 2VQEM 1QUTA 1TGUA 4KODA 1NVMA 2C9OA 3DZDA 4DV0M 3AL0C 1R5LA 3T15A 2LBCA 3GLIA 3J2PB 1T3TA 3FUWA 3VLFB 2M5ZA 2XF3A 3ZCBB 3CTWB 2F5OA 1YLAA 2YFQA 1R7RA 2O25A 3HHZA 4DV7M 3FRHA 1V34A 2QSFX 1IN6A 3KOXE 1MJGM 5FTJA 3TE6A 1DV0A 1JB0F 1VEGA 2VF7A 1OJLA 2CUZA 5L8RF 4DV3M 4LF8M 3HJQA 4OVZA 3KDSE 5EP3A 1NO1A 3QWLA 3ZC7B 5ITUA 4TUWA 1T6OA 3MK6A 5IWAM 1G41A 3MHVC 1OIPA 1WGLA 2ZAOA 4IBJA 3SYKA 1VQ1A 5F3WA 2G3QA 2GNOA 5DFLA 3U61B 1YSYA 2APLA 1PM5A 4KHPM 4B3TM 4ITQA 2Q2EB 2I7NA 2FS1A 2LXEA 2DAMA 2KHHA 1I4WA 4AQYM 1IN7A 4LF5M 1TDHA 4X62M 3SMPA 1W5SA 2DZNB 3Q8GA 1IBLM 1XXHE 4WURA 3GLGB 1K3WA 4X65M 4I4LA 3RE8A 2EUCA 3FE3A 3SAWA 5BR8M 5FLXS 1W5TA 1IN5A 4DUZM 1OAIA 3D8BA 2V6ZM 1A5TA 1D0LA 4XGIA 3AOEA 3ZH9B 4DR1M 2G8LA 2Z7JA 2VF8A 2W82A 4QNRA 3KXEC 2KZSA 3KOZE 4PD2A 1PJJA 1FJGM 1OTRA 2LTUA 3LQRA 2LWXA 2KZUA 4JI7M 4P16A 5FTNA 8CATA 1NJGA 3VDUA 2DAGA 2UUAM 3T6PA 1HQYE 3B9PA 4GC5A 3U6OA 4GHLA 2LH0A 2DENA 3B7QA 5FSWA 3U60A 1E94E 4XK8F 1IN8A 3K2LA 4PDGA 2R6FA 1IBKM 4X66M 3VK7A 2WSFF 3TWKA 3HX3A 4LFBM 4ZPXA 3IECA 3IHPA 4YHHM 4DR6M 1PRBA 1WXQA 1LTMA 4PCZA 2QQ8A 4QOSA 3FD9A 5EQTA 2D7EA 2Z4RA 4G3OA 3K9PA 3BXWA 4MGYE 1QDRA 2DZLA 1ZV1A 5JI2E 1SXJE 4KO8A 3L26A 3TWMA 1K3XA 3HJSA 1C1KA 2X49A 1PGYA 2ZM6M 3J27B 4Y28F 5IZ7D 4JI3M 4OX9M 1X37A 3I04M 3GPXA 2N35A 1WJ7A 2C96A 2ZTCA 3GLHE 2UUBM 4AG5A 2Z3XA 4M0WA 2F5NA 1G8PA 1D0MA 4DUYM 2CP8A 4MGIE 3KS8A 3FUXA 4M0DA 1QQWA 4IJFA 2BWBA 4OW0A 4JI4M 1QYRA 4EIWA 3HZJA 1D2NA 4DR5M 1OAOC 5JI3E 1Z5BA 2K9DA 2OOBA 3DA1A 1WIVA 2QCUA 2HL7A 1NSFA 2QBYB 5ITTA 3A46A 4Z8XA 5LMNM 1MX0A 3BOSA 2R4EA 4LCBA 4NXMM 2RGOA 3IG8A 4KLNA 2XLJA 4LF7M 4S12A 1L2DA 2ZANA 1R6BX 2CHQA 1VDLA 4NRVA 5LMUM 2R4JA 4PDIA 3KW6A 1K82A 3R9XB 3DFZA 3A42A 3U6MA 1D0KA 3L25A 4L4UA 2JZ1A 2WSCF 3KSJA 3GLFA 3PVSA 4IIWA 4JI6M 2HAKA 5EJCA 2XFTA 3F92A 2YR0A 1QANA 4M9ZA 4LZJA 1IY1A 2KXEA 1I94M 4I81A 2KA6B 3QAUA 1HNXM 3K1JA 3SC3A 5ITXA 3GQ5A 4XBOA 2R65A 2XSZD 2DWLA 3KOYE 3AJIB 1G3IA 3L28A 3T38A 1QAOA 4D81A 2UU9M 1E9SA 4GC9A 2L4FA 4JN6A 1WHCA 4MM3B 4LG2A 2ZBKB 1L8QA 1N75A 2DXIA 1GL6A 3M0EA 4B7FA 2L2DA 5BPVA 1N78A 4G4OA 3R8FA 3JAMS 1NNUC 4AKIA 4DV6M 4L16A 4I8OA 1JR3E 2EA0A 2UXCM 3NBXX 4WW0A 1VDDA 2FH0A 3U5ZB 3HU1A 3MMPA 2QZ4A 4NOOB 2CV0A 2F5SA 1Z5CA 4MGKE 1GKIA 3PNYA 1QDTA 2LVPC 2DAEA 3J80S 5C18A 3E9SA 3L29A 4PT5A 4AI6A 3HHYA 2H1RA 3SASA 1WR1B 3AKZA 4IBEA 3W67A 1N77A 1SXJD 2CHGA 4RKUF 1S3SA 1R4GA 4R7GA 4B7GA 3GRRA 1ZMVA 1Q3CA 2KNVA 3PNVA 2Y21A 5E26A 2CV1A 1DGGA 1NV9A 4UN2B 1HT1E 1XMQM 2R46A 2L7IA 4IBCA 2RRUA 4D80A 1QUSA 1NJFA 4II7A 2BNKA 4LGMA 1XHBA 2HCBA 1JR3A 4NSRA 2JUJA 1QAQA 1QVRA 4DV5M 4FCVA 5EXXA 1AUAA 1J09A 2A5YB 3I4YA 3GPUA 3U61A 1H6UA 3RGPA 3CGWA 2XFSA 3VFDA 2WZJA 4CIZA 3VK8A 2DKLA 2QHOB 4Q7JA 3B7ZA 4JI5M 3SYLA 2F4VM 2XZFA 2FE8A 4DV1M 1IXSB 2LVQD 2JZ0A 3EIEA 4KT0F 4WP2A 2QENA 5KPRA 5DYGA 1HNZM 4DV4M 3GLGA 1V33A 2OPFA 3KP0E 3AV0A 3SATA 3KFUG 2Y20A 2HWJA 4FCWA 4L8RC 1N33M 3B89A 3CF0A 2JP7A 5KPZA 1NHGC 4FWGA 3U6DA 5EP1A 4IBBA 3U6CA 3GRYA 5IREB 3I01M 2RGHA 1XXHB 3HWSA 3KSXA 1N34M 4QOZC 3Q8XA 1SG9A 4LJ5A 5EP4A 3C3DA 1GLNA 2O01F 1IY2A 4Z6YA 1Z6TA 2QP9X 2MR9A 2VDBB 5FTKA 4F2LA 1PJTA 4G4RA 5E6JA 1IQPA 3GLFE 2P5TA 1HR0M 4LJ7A 2C99A 5FTMA 1SXJC 1Z5AA 2K47A 3VDPA 3UJNA 2Z4SA 1G71A 4FCTA 2Y0QA 3OTOM 2DWMA 4L6V6 5C1BA 1MN3A 5KQDA 3I4VA 5EXSA 4LF6M 4HLQA 5ITXE 5DNYA 5GKNA 3GP1A 3LW5F 1NV8A 4B7HA 4BLCA 3FYDA 2J7NA 3HGIA 2KNAA 3QYBA 2R45A 4MGHA 3TL4X 2C9CA 2CHVA 4R71A 2MJ5B 3GQ3A 3VKGA 2DI0A 1R2YA 3H4JA 1ZQ9A 1G4AE 2EKKA 3AFHA 4LY6A 1C7YA 1OIZA 2GQFA 2LNHC 3K9OA 4FD2A 5H37D 3FUTA 1HQCA 3CF6E 1DO2A 2FFJA 2XH9A 2BJVA 2UXDM
chains in the Genus database with same CATH topology
4L15A 1SXJB 1XC8A 3PFIA 4AZFA 3C58A 1NNJA 4M9SA 2M60A 4QNMA 1TH3A 3JR5A 1DGHB 3RFWA 1L1TA 3U6LA 2J7OA 1OFIA 3FTEA 4L78A 3KS4A 2X4AA 3J7AS 2YNMD 3LQQA 4HL4A 3GLHB 4G6ZA 4DR2M 5ITRA 2QBYA 3HU2A 3J7BA 3HU3A 2DWZB 4LJ4A 3MJ5A 3I51A 3GPYA 3T1HM 3GRVA 1XWIA 2DWNA 5ITYA 3SAUA 1XMOM 3GLIB 3K92A 2L6OA 3SBJA 3HKPA 4GITA 1NHWC 4B3SM 2DZOB 1DGBA 4LFAM 1R2ZA 3KVWA 1DGHA 2DVWB 2XEPA 4JXJA 2V1UA 4YY3M 2UXBM 1IXZA 1N36M 4GHAA 3ILKA 1G59A 3SMSA 1XNRM 3NWLA 3TQSA 4RNAA 4LGYA 4IBKA 1HT2E 4IJEA 4LFCM 1DGFA 4CGYB 4OVZB 1IBMM 1OFHA 3L2AA 1E9RA 5EP2A 1IXRC 3U6EA 3AOEC 4B3RM 3SHGB 3AOGA 2KRKA 2O5RA 5FTLA 3FTCA 3FYCA 4CISA 4AKHA 1KFVA 2YQZA 4NRWA 5ITQA 2E5LM 4LJ9A 1KYIA 2DHRA 1IY0A 3D8LA 2F5QA 4JI2M 3U5ZA 2UUCM 2BJWA 2ERCA 4B08A 3A45A 1ZAEA 3IG5A 2KRUA 3FKEA 3GQ4A 4BBAA 5KO3A 2R62A 5IT9S 1HNWM 2CFOA 1NY6A 1Q3BA 2R18A 1TH4A 1GL7A 1GVNA 3RGSA 3CF2A 4FVMA 4JI1M 4NL4H 3PXGA 4I5SA 3WHLA 3FTFA 3GRUA 4JI8M 2QPAA 1JQJC 3UZUA 3GPPA 4DR7M 2KW0A 4NSOB 3THGA 1UM8A 1Z59A 1N32M 2EO2A 3T1YM 4BB9A 3U60B 4JV5M 1KSFX 2JA2A 3E4RA 3KP1E 2VQFM 3U6PA 4JYAM 2HKJA 7CATA 5EXPA 2CV2A 4MB7A 3GO8A 1NY5A 3SFZA 3U6SA 2NQ8C 4G4QA 1XNQM 1ORYB 2CE7A 3LVWA 3K8ZA 4X64M 1L2BA 2KEBA 3HHXA 2F5PA 4RF1A 4GKJM 3UK6A 1YE9A 3H4MA 3LMMA 4AW4A 4FWHA 4IBFA 1QAMA 1JR3D 3FUUA 3WHKA 1PJIA 4CHTB 2X8AA 4LZZA 2OQ4A 4DR4M 4OU7A 2L09A 2L7HA 1J7KA 3VKHA 1XXHA 5DYIA 1L2CA 3HJ8A 4JI0M 2D7HA 2CEAA 3M6AA 4LJAA 1QZMA 1TH2A 5EXTA 4AKGA 3DOAA 4GIPA 4MGZE 1IM2A 3KOWE 2Y0TA 4IBDA 2FNAA 4B3MM 1J5EM 2RKOA 2G5GX 2XSZA 1EE8A 4W5WA 4D82A 3UGJA 3U6QA 4G4NA 2FOIC 1MU5A 4LRSA 4R3DA 3GLFB 1FNNA 4LF4M 4GH9A 4REZA 2VIIA 3NBIA 5A2QS 3TWLA 1LV7A 3SARA 1TDZA 4LRTA 3FUVA 2XGNA 3EIHA 3LVVA 4NXNM 1IN4A 4LF9M 4AG6A 3SAVA 3L27A 3FTDA 1YUBA 2HHHM 3TPZA 5KPTA 2XZUA 4LJ8A 3JR4A 1L1ZA 4GRIA 4MH0E 4QHSA 4RF0A 3M7GA 3W0LB 4DR3M 4GKKM 2C98A 1SXJA 4LJ6A 3HHWA 3W0FA 2V1CA 3A98B 3UMMA 1E32A 4K0KM 2C5RA 4QHTA 2I7PA 4GMQA 3SHFA 2ZAMA 4FWDA 4IBIA 3GLHA 1DO0A 4M9XA 4FW9A 4IBGA 4DV2M 3J81S 1Q39A 2AHMA 5KQ8A 4A3VB 2D7GA 2VQEM 1TGUA 4KODA 1NVMA 2C9OA 3DZDA 4DV0M 3AL0C 3T15A 3GLIA 3J2PB 1T3TA 3FUWA 3VLFB 2M5ZA 2XF3A 3ZCBB 3CTWB 2F5OA 2YFQA 1R7RA 3HHZA 4DV7M 1IN6A 3KOXE 5FTJA 3TE6A 1OJLA 2CUZA 4DV3M 4LF8M 3HJQA 4OVZA 3KDSE 5EP3A 5ITUA 3QWLA 3ZC7B 4TUWA 3MK6A 5IWAM 1G41A 3MHVC 2ZAOA 4IBJA 3SYKA 5F3WA 3U61B 1PM5A 4KHPM 1YSYA 4B3TM 4ITQA 2Q2EB 2I7NA 2LXEA 1I4WA 4AQYM 1IN7A 4LF5M 1TDHA 4X62M 3SMPA 1W5SA 2DZNB 1IBLM 4WURA 3GLGB 1K3WA 4X65M 4I4LA 3RE8A 2EUCA 3SAWA 5BR8M 5FLXS 1W5TA 1IN5A 4DUZM 3D8BA 2V6ZM 4XGIA 3AOEA 3ZH9B 4DR1M 2G8LA 2Z7JA 4QNRA 2W82A 4PD2A 3KXEC 2KZSA 3KOZE 1PJJA 1FJGM 3LQRA 2LWXA 2KZUA 4JI7M 4P16A 5FTNA 8CATA 1NJGA 3VDUA 2UUAM 1HQYE 3B9PA 4GC5A 3U6OA 4GHLA 2LH0A 5FSWA 3U60A 1E94E 1IN8A 3K2LA 4PDGA 1IBKM 4X66M 3VK7A 3TWKA 4LFBM 4ZPXA 4DR6M 4YHHM 1WXQA 4PCZA 4QOSA 3FD9A 5EQTA 2D7EA 2Z4RA 4MGYE 5JI2E 1SXJE 4KO8A 3L26A 3TWMA 1K3XA 3HJSA 1C1KA 2X49A 2ZM6M 3J27B 5IZ7D 4JI3M 4OX9M 1X37A 3GPXA 2C96A 2UUBM 4AG5A 2Z3XA 4M0WA 2F5NA 1G8PA 4DUYM 3KS8A 4MGIE 3FUXA 4M0DA 1QQWA 4IJFA 4OW0A 4JI4M 1QYRA 4EIWA 1D2NA 4DR5M 5JI3E 1Z5BA 3DA1A 2QCUA 2HL7A 1NSFA 2QBYB 5ITTA 3A46A 4Z8XA 5LMNM 1MX0A 3BOSA 2R4EA 4LCBA 4NXMM 2RGOA 3IG8A 4KLNA 2XLJA 4LF7M 4S12A 1L2DA 2ZANA 1R6BX 2CHQA 5LMUM 4NRVA 2R4JA 4PDIA 3KW6A 1K82A 3R9XB 3DFZA 3A42A 3U6MA 3L25A 4L4UA 3KSJA 3GLFA 3PVSA 4IIWA 4JI6M 5EJCA 2XFTA 2YR0A 1QANA 4M9ZA 4LZJA 1IY1A 2KXEA 1I94M 4I81A 2KA6B 3QAUA 1HNXM 3K1JA 3SC3A 5ITXA 3GQ5A 4XBOA 2R65A 2XSZD 2DWLA 3KOYE 3AJIB 1G3IA 3L28A 3T38A 1QAOA 4D81A 2UU9M 1E9SA 4GC9A 4MM3B 4JN6A 4LG2A 2ZBKB 1L8QA 1N75A 2DXIA 1GL6A 3M0EA 4B7FA 5BPVA 1N78A 4G4OA 3R8FA 3JAMS 1NNUC 4AKIA 4DV6M 4L16A 4I8OA 2EA0A 2UXCM 4WW0A 1VDDA 3U5ZB 2CV0A 3HU1A 2QZ4A 4NOOB 2F5SA 1Z5CA 4MGKE 1GKIA 3PNYA 5C18A 3J80S 3E9SA 3L29A 4PT5A 4AI6A 3HHYA 2H1RA 3SASA 3AKZA 4IBEA 1N77A 1SXJD 2CHGA 1S3SA 4R7GA 4B7GA 3GRRA 1Q3CA 3PNVA 2Y21A 5E26A 2CV1A 1DGGA 1HT1E 1XMQM 2R46A 2L7IA 4IBCA 4D80A 4II7A 1NJFA 2BNKA 4LGMA 1XHBA 2HCBA 1JR3A 4NSRA 1QAQA 1QVRA 4DV5M 4FCVA 5EXXA 2A5YB 1J09A 3I4YA 3GPUA 3U61A 1H6UA 3RGPA 2XFSA 3VFDA 3VK8A 4JI5M 3SYLA 2F4VM 2XZFA 2FE8A 4DV1M 1IXSB 3EIEA 2QENA 5KPRA 5DYGA 1HNZM 4DV4M 3GLGA 2OPFA 3KP0E 3AV0A 3SATA 3KFUG 2Y20A 4FCWA 4L8RC 1N33M 3CF0A 5KPZA 1NHGC 4FWGA 3U6DA 5EP1A 4IBBA 3U6CA 3GRYA 5IREB 3KSXA 2RGHA 1XXHB 3HWSA 4QOZC 1N34M 3Q8XA 4LJ5A 5EP4A 1GLNA 1IY2A 4Z6YA 1Z6TA 2QP9X 5FTKA 4G4RA 5E6JA 1IQPA 2P5TA 1HR0M 4LJ7A 2C99A 5FTMA 1SXJC 1Z5AA 2K47A 3VDPA 3UJNA 2Z4SA 4FCTA 3OTOM 2Y0QA 2DWMA 5C1BA 5KQDA 3I4VA 5EXSA 4LF6M 4HLQA 5ITXE 5DNYA 5GKNA 3GP1A 4B7HA 4BLCA 3FYDA 2J7NA 3HGIA 3TL4X 2R45A 4MGHA 2C9CA 2CHVA 3GQ3A 3VKGA 1R2YA 1ZQ9A 1G4AE 3AFHA 4LY6A 2LNHC 5H37D 4FD2A 3FUTA 1HQCA 3CF6E 1DO2A 2FFJA 2XH9A 2BJVA 2UXDM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y21 A;  2Y0T A;  2Y20 A;  2Y0Q A;  2L7I A;  2L7H A;  4I5S A; 
#chains in the Genus database with same CATH topology
 4L15 A;  1IFY A;  1SXJ B;  1XC8 A;  3PFI A;  4AZF A;  3C58 A;  2MH8 A;  1V92 A;  1NNJ A;  4M9S A;  2M60 A;  4QNM A;  1TH3 A;  3JR5 A;  1DGH B;  3RFW A;  2DHY A;  3U6L A;  2J7O A;  1L1T A;  1OFI A;  3FTE A;  4L78 A;  3KS4 A;  2X4A A;  3J7A S;  2YNM D;  3LQQ A;  2K6B A;  4HL4 A;  3GLH B;  4G6Z A;  4DR2 M;  5ITR A;  2QBY A;  3HU2 A;  3J7B A;  3HU3 A;  2DWZ B;  4LJ4 A;  2KDL A;  2JWS A;  3MJ5 A;  3I51 A;  3HY5 A;  3GPY A;  3T1H M;  3GRV A;  1XWI A;  1Y8G A;  2DWN A;  5ITY A;  3SAU A;  1XMO M;  2MRO B;  3GLI B;  3K92 A;  2LVA A;  1TF0 B;  2J5Y A;  2L6O A;  3HKP A;  3SBJ A;  4GIT A;  1NHW C;  3E21 A;  1XB2 B;  4B3S M;  1VG5 A;  1DGB A;  2DZO B;  4LFA M;  1R2Z A;  3KVW A;  1DGH A;  1GJS A;  2JY8 A;  2DVW B;  2XEP A;  4JXJ A;  2V1U A;  4YY3 M;  2JY6 B;  1IXZ A;  1N36 M;  4GHA A;  2UXB M;  3C3E A;  3ILK A;  1VEK A;  3W68 A;  3SMS A;  1G59 A;  3C9P A;  1XNR M;  3NWL A;  3TQS A;  4RNA A;  4GEW A;  1OKS A;  4IBK A;  1HT2 E;  4IJE A;  4LGY A;  4LFC M;  1DGF A;  4CGY B;  4OVZ B;  3FRI A;  1IBM M;  1OFH A;  3L2A A;  1E9R A;  5EP2 A;  1IXR C;  4NC6 A;  3AOE C;  3U6E A;  4B3R M;  2JXN A;  3SHG B;  2LVO C;  2KRK A;  2JY5 A;  2O5R A;  3AOG A;  5FTL A;  3FTC A;  3FYC A;  4CIS A;  4AKH A;  1KFV A;  2YQZ A;  2LHC A;  4NRW A;  4F1I A;  2CRU A;  3ZQJ A;  1QZE A;  5ITQ A;  2OO9 A;  4LJ9 A;  3GLG E;  2E5L M;  2R0I A;  1KYI A;  2DHR A;  1IY0 A;  3D8L A;  2F5Q A;  2R44 A;  4JI2 M;  3U5Z A;  2UUC M;  2BJW A;  2ERC A;  4B08 A;  3A45 A;  2Z8Y M;  2KNZ A;  1ZAE A;  1Q02 A;  2JY7 A;  3IG5 A;  2KRU A;  1F4I A;  2EKF A;  1GO5 A;  3FKE A;  3GQ4 A;  4BBA A;  5KO3 A;  2DAK A;  1TTE A;  2R62 A;  5IT9 S;  1HNW M;  2CFO A;  1NY6 A;  1Q3B A;  2R18 A;  1TH4 A;  1PJQ A;  4CJ6 A;  4ANR A;  1GL7 A;  1GVN A;  3RGS A;  3CF2 A;  4FVM A;  1EIJ A;  3QYE A;  4JI1 M;  4NL4 H;  3PXG A;  4I5S A;  3V76 A;  3WHL A;  2JNH A;  3FTF A;  3B7N A;  3GRU A;  4JI8 M;  2QPA A;  1JQJ C;  3UZU A;  3GPP A;  4DR7 M;  1OQY A;  2BWE A;  2KW0 A;  2DAI A;  4NSO B;  3THG A;  1UM8 A;  1Z59 A;  1N32 M;  2EO2 A;  3T1Y M;  4BB9 A;  3U60 B;  1AIP C;  4JV5 M;  2ZTD A;  1KSF X;  2JA2 A;  3E4R A;  3KP1 E;  2VQF M;  3U6P A;  4JYA M;  2HKJ A;  1UFZ A;  3LCV B;  5EXP A;  7CAT A;  1GAB A;  2CV2 A;  4MB7 A;  3GO8 A;  2L4E A;  1NY5 A;  3SFZ A;  2EJS A;  2NQ8 C;  4G4Q A;  3U6S A;  1XNQ M;  1CUK A;  1ORY B;  2CE7 A;  3LVW A;  3K8Z A;  1EFU B;  4X64 M;  1IXS A;  1RU3 A;  2KEB A;  3HHX A;  1L2B A;  4RF1 A;  2F5P A;  4GKJ M;  3UK6 A;  1YE9 A;  3H4M A;  3LMM A;  4AW4 A;  4FWH A;  4IBF A;  1QAM A;  1JR3 D;  2LVN C;  3FUU A;  3WHK A;  1PJI A;  1T43 A;  3BBZ A;  4CHT B;  2B3T A;  2X8A A;  4LZZ A;  2MGW A;  2QNJ A;  4OU7 A;  2OQ4 A;  4DR4 M;  2L09 A;  2L7H A;  1J7K A;  3VKH A;  1XXH A;  5DYI A;  2K0B X;  1L2C A;  3HJ8 A;  4HEO A;  4JI0 M;  2DNA A;  2D7H A;  2CEA A;  3M6A A;  4LJA A;  1QZM A;  1TH2 A;  5EXT A;  1P3Q Q;  4AKG A;  3DOA A;  4GIP A;  4MGZ E;  1IM2 A;  3KOW E;  2Y0T A;  4IBD A;  2FNA A;  4B3M M;  1J5E M;  2WSE F;  2RKO A;  2G5G X;  2LHG A;  2XSZ A;  1EE8 A;  4W5W A;  4D82 A;  3UGJ A;  2H5X A;  3U6Q A;  4G4N A;  2FOI C;  1MU5 A;  1WGN A;  4LRS A;  4R3D A;  3GLF B;  1FNN A;  4DBG B;  4LF4 M;  4GH9 A;  4REZ A;  1PJS A;  2VII A;  1HJP A;  3NBI A;  5A2Q S;  3TWL A;  1LV7 A;  3SAR A;  1TDZ A;  4LRT A;  3FUV A;  3GLI E;  2XGN A;  3EIH A;  3LVV A;  4NXN M;  1IN4 A;  4LF9 M;  4AG6 A;  3SAV A;  3L27 A;  3B74 A;  1YUB A;  3FTD A;  2HHH M;  3TPZ A;  5KPT A;  2XZU A;  4LJ8 A;  3JR4 A;  1L1Z A;  1GJT A;  2CWB A;  4GRI A;  4MH0 E;  4QHS A;  2OOA A;  3M7G A;  4RF0 A;  3W0L B;  4DR3 M;  4GKK M;  2C98 A;  1SXJ A;  4LJ6 A;  3HHW A;  3W0F A;  1ZMU A;  2V1C A;  3A98 B;  3E46 A;  4P17 A;  3UMM A;  1BVS A;  1E32 A;  4K0K M;  2C5R A;  1ZMW A;  4QHT A;  2I7P A;  4GMQ A;  3SHF A;  2ZAM A;  4FWD A;  4IBI A;  1TR8 A;  3GLH A;  1DO0 A;  4M9X A;  4FW9 A;  4IBG A;  4DV2 M;  3J81 S;  1Q39 A;  2AHM A;  3LCU A;  5KQ8 A;  1VEJ A;  4A3V B;  2D7G A;  2VQE M;  1QUT A;  1TGU A;  4KOD A;  1NVM A;  2C9O A;  3DZD A;  4DV0 M;  3AL0 C;  1R5L A;  3T15 A;  2LBC A;  3GLI A;  3J2P B;  1T3T A;  3FUW A;  3VLF B;  2M5Z A;  2XF3 A;  3ZCB B;  3CTW B;  2F5O A;  1YLA A;  2YFQ A;  1R7R A;  2O25 A;  3HHZ A;  4DV7 M;  3FRH A;  1V34 A;  2QSF X;  1IN6 A;  3KOX E;  1MJG M;  5FTJ A;  3TE6 A;  1DV0 A;  1JB0 F;  1VEG A;  2VF7 A;  1OJL A;  2CUZ A;  5L8R F;  4DV3 M;  4LF8 M;  3HJQ A;  4OVZ A;  3KDS E;  5EP3 A;  1NO1 A;  3QWL A;  3ZC7 B;  5ITU A;  4TUW A;  1T6O A;  3MK6 A;  5IWA M;  1G41 A;  3MHV C;  1OIP A;  1WGL A;  2ZAO A;  4IBJ A;  3SYK A;  1VQ1 A;  5F3W A;  2G3Q A;  2GNO A;  5DFL A;  3U61 B;  1YSY A;  2APL A;  1PM5 A;  4KHP M;  4B3T M;  4ITQ A;  2Q2E B;  2I7N A;  2FS1 A;  2LXE A;  2DAM A;  2KHH A;  1I4W A;  4AQY M;  1IN7 A;  4LF5 M;  1TDH A;  4X62 M;  3SMP A;  1W5S A;  2DZN B;  3Q8G A;  1IBL M;  1XXH E;  4WUR A;  3GLG B;  1K3W A;  4X65 M;  4I4L A;  3RE8 A;  2EUC A;  3FE3 A;  3SAW A;  5BR8 M;  5FLX S;  1W5T A;  1IN5 A;  4DUZ M;  1OAI A;  3D8B A;  2V6Z M;  1A5T A;  1D0L A;  4XGI A;  3AOE A;  3ZH9 B;  4DR1 M;  2G8L A;  2Z7J A;  2VF8 A;  2W82 A;  4QNR A;  3KXE C;  2KZS A;  3KOZ E;  4PD2 A;  1PJJ A;  1FJG M;  1OTR A;  2LTU A;  3LQR A;  2LWX A;  2KZU A;  4JI7 M;  4P16 A;  5FTN A;  8CAT A;  1NJG A;  3VDU A;  2DAG A;  2UUA M;  3T6P A;  1HQY E;  3B9P A;  4GC5 A;  3U6O A;  4GHL A;  2LH0 A;  2DEN A;  3B7Q A;  5FSW A;  3U60 A;  1E94 E;  4XK8 F;  1IN8 A;  3K2L A;  4PDG A;  2R6F A;  1IBK M;  4X66 M;  3VK7 A;  2WSF F;  3TWK A;  3HX3 A;  4LFB M;  4ZPX A;  3IEC A;  3IHP A;  4YHH M;  4DR6 M;  1PRB A;  1WXQ A;  1LTM A;  4PCZ A;  2QQ8 A;  4QOS A;  3FD9 A;  5EQT A;  2D7E A;  2Z4R A;  4G3O A;  3K9P A;  3BXW A;  4MGY E;  1QDR A;  2DZL A;  1ZV1 A;  5JI2 E;  1SXJ E;  4KO8 A;  3L26 A;  3TWM A;  1K3X A;  3HJS A;  1C1K A;  2X49 A;  1PGY A;  2ZM6 M;  3J27 B;  4Y28 F;  5IZ7 D;  4JI3 M;  4OX9 M;  1X37 A;  3I04 M;  3GPX A;  2N35 A;  1WJ7 A;  2C96 A;  2ZTC A;  3GLH E;  2UUB M;  4AG5 A;  2Z3X A;  4M0W A;  2F5N A;  1G8P A;  1D0M A;  4DUY M;  2CP8 A;  4MGI E;  3KS8 A;  3FUX A;  4M0D A;  1QQW A;  4IJF A;  2BWB A;  4OW0 A;  4JI4 M;  1QYR A;  4EIW A;  3HZJ A;  1D2N A;  4DR5 M;  1OAO C;  5JI3 E;  1Z5B A;  2K9D A;  2OOB A;  3DA1 A;  1WIV A;  2QCU A;  2HL7 A;  1NSF A;  2QBY B;  5ITT A;  3A46 A;  4Z8X A;  5LMN M;  1MX0 A;  3BOS A;  2R4E A;  4LCB A;  4NXM M;  2RGO A;  3IG8 A;  4KLN A;  2XLJ A;  4LF7 M;  4S12 A;  1L2D A;  2ZAN A;  1R6B X;  2CHQ A;  1VDL A;  4NRV A;  5LMU M;  2R4J A;  4PDI A;  3KW6 A;  1K82 A;  3R9X B;  3DFZ A;  3A42 A;  3U6M A;  1D0K A;  3L25 A;  4L4U A;  2JZ1 A;  2WSC F;  3KSJ A;  3GLF A;  3PVS A;  4IIW A;  4JI6 M;  2HAK A;  5EJC A;  2XFT A;  3F92 A;  2YR0 A;  1QAN A;  4M9Z A;  4LZJ A;  1IY1 A;  2KXE A;  1I94 M;  4I81 A;  2KA6 B;  3QAU A;  1HNX M;  3K1J A;  3SC3 A;  5ITX A;  3GQ5 A;  4XBO A;  2R65 A;  2XSZ D;  2DWL A;  3KOY E;  3AJI B;  1G3I A;  3L28 A;  3T38 A;  1QAO A;  4D81 A;  2UU9 M;  1E9S A;  4GC9 A;  2L4F A;  4JN6 A;  1WHC A;  4MM3 B;  4LG2 A;  2ZBK B;  1L8Q A;  1N75 A;  2DXI A;  1GL6 A;  3M0E A;  4B7F A;  2L2D A;  5BPV A;  1N78 A;  4G4O A;  3R8F A;  3JAM S;  1NNU C;  4AKI A;  4DV6 M;  4L16 A;  4I8O A;  1JR3 E;  2EA0 A;  2UXC M;  3NBX X;  4WW0 A;  1VDD A;  2FH0 A;  3U5Z B;  3HU1 A;  3MMP A;  2QZ4 A;  4NOO B;  2CV0 A;  2F5S A;  1Z5C A;  4MGK E;  1GKI A;  3PNY A;  1QDT A;  2LVP C;  2DAE A;  3J80 S;  5C18 A;  3E9S A;  3L29 A;  4PT5 A;  4AI6 A;  3HHY A;  2H1R A;  3SAS A;  1WR1 B;  3AKZ A;  4IBE A;  3W67 A;  1N77 A;  1SXJ D;  2CHG A;  4RKU F;  1S3S A;  1R4G A;  4R7G A;  4B7G A;  3GRR A;  1ZMV A;  1Q3C A;  2KNV A;  3PNV A;  2Y21 A;  5E26 A;  2CV1 A;  1DGG A;  1NV9 A;  4UN2 B;  1HT1 E;  1XMQ M;  2R46 A;  2L7I A;  4IBC A;  2RRU A;  4D80 A;  1QUS A;  1NJF A;  4II7 A;  2BNK A;  4LGM A;  1XHB A;  2HCB A;  1JR3 A;  4NSR A;  2JUJ A;  1QAQ A;  1QVR A;  4DV5 M;  4FCV A;  5EXX A;  1AUA A;  1J09 A;  2A5Y B;  3I4Y A;  3GPU A;  3U61 A;  1H6U A;  3RGP A;  3CGW A;  2XFS A;  3VFD A;  2WZJ A;  4CIZ A;  3VK8 A;  2DKL A;  2QHO B;  4Q7J A;  3B7Z A;  4JI5 M;  3SYL A;  2F4V M;  2XZF A;  2FE8 A;  4DV1 M;  1IXS B;  2LVQ D;  2JZ0 A;  3EIE A;  4KT0 F;  4WP2 A;  2QEN A;  5KPR A;  5DYG A;  1HNZ M;  4DV4 M;  3GLG A;  1V33 A;  2OPF A;  3KP0 E;  3AV0 A;  3SAT A;  3KFU G;  2Y20 A;  2HWJ A;  4FCW A;  4L8R C;  1N33 M;  3B89 A;  3CF0 A;  2JP7 A;  5KPZ A;  1NHG C;  4FWG A;  3U6D A;  5EP1 A;  4IBB A;  3U6C A;  3GRY A;  5IRE B;  3I01 M;  2RGH A;  1XXH B;  3HWS A;  3KSX A;  1N34 M;  4QOZ C;  3Q8X A;  1SG9 A;  4LJ5 A;  5EP4 A;  3C3D A;  1GLN A;  2O01 F;  1IY2 A;  4Z6Y A;  1Z6T A;  2QP9 X;  2MR9 A;  2VDB B;  5FTK A;  4F2L A;  1PJT A;  4G4R A;  5E6J A;  1IQP A;  3GLF E;  2P5T A;  1HR0 M;  4LJ7 A;  2C99 A;  5FTM A;  1SXJ C;  1Z5A A;  2K47 A;  3VDP A;  3UJN A;  2Z4S A;  1G71 A;  4FCT A;  2Y0Q A;  3OTO M;  2DWM A;  4L6V 6;  5C1B A;  1MN3 A;  5KQD A;  3I4V A;  5EXS A;  4LF6 M;  4HLQ A;  5ITX E;  5DNY A;  5GKN A;  3GP1 A;  3LW5 F;  1NV8 A;  4B7H A;  4BLC A;  3FYD A;  2J7N A;  3HGI A;  2KNA A;  3QYB A;  2R45 A;  4MGH A;  3TL4 X;  2C9C A;  2CHV A;  4R71 A;  2MJ5 B;  3GQ3 A;  3VKG A;  2DI0 A;  1R2Y A;  3H4J A;  1ZQ9 A;  1G4A E;  2EKK A;  3AFH A;  4LY6 A;  1C7Y A;  1OIZ A;  2GQF A;  2LNH C;  3K9O A;  4FD2 A;  5H37 D;  3FUT A;  1HQC A;  3CF6 E;  1DO2 A;  2FFJ A;  2XH9 A;  2BJV A;  2UXD M; 
#chains in the Genus database with same CATH homology
 4L15 A;  1SXJ B;  1XC8 A;  3PFI A;  4AZF A;  3C58 A;  1NNJ A;  4M9S A;  2M60 A;  4QNM A;  1TH3 A;  3JR5 A;  1DGH B;  3RFW A;  1L1T A;  3U6L A;  2J7O A;  1OFI A;  3FTE A;  4L78 A;  3KS4 A;  2X4A A;  3J7A S;  2YNM D;  3LQQ A;  4HL4 A;  3GLH B;  4G6Z A;  4DR2 M;  5ITR A;  2QBY A;  3HU2 A;  3J7B A;  3HU3 A;  2DWZ B;  4LJ4 A;  3MJ5 A;  3I51 A;  3GPY A;  3T1H M;  3GRV A;  1XWI A;  2DWN A;  5ITY A;  3SAU A;  1XMO M;  3GLI B;  3K92 A;  2L6O A;  3SBJ A;  3HKP A;  4GIT A;  1NHW C;  4B3S M;  2DZO B;  1DGB A;  4LFA M;  1R2Z A;  3KVW A;  1DGH A;  2DVW B;  2XEP A;  4JXJ A;  2V1U A;  4YY3 M;  2UXB M;  1IXZ A;  1N36 M;  4GHA A;  3ILK A;  1G59 A;  3SMS A;  1XNR M;  3NWL A;  3TQS A;  4RNA A;  4LGY A;  4IBK A;  1HT2 E;  4IJE A;  4LFC M;  1DGF A;  4CGY B;  4OVZ B;  1IBM M;  1OFH A;  3L2A A;  1E9R A;  5EP2 A;  1IXR C;  3U6E A;  3AOE C;  4B3R M;  3SHG B;  3AOG A;  2KRK A;  2O5R A;  5FTL A;  3FTC A;  3FYC A;  4CIS A;  4AKH A;  1KFV A;  2YQZ A;  4NRW A;  5ITQ A;  2E5L M;  4LJ9 A;  1KYI A;  2DHR A;  1IY0 A;  3D8L A;  2F5Q A;  4JI2 M;  3U5Z A;  2UUC M;  2BJW A;  2ERC A;  4B08 A;  3A45 A;  1ZAE A;  3IG5 A;  2KRU A;  3FKE A;  3GQ4 A;  4BBA A;  5KO3 A;  2R62 A;  5IT9 S;  1HNW M;  2CFO A;  1NY6 A;  1Q3B A;  2R18 A;  1TH4 A;  1GL7 A;  1GVN A;  3RGS A;  3CF2 A;  4FVM A;  4JI1 M;  4NL4 H;  3PXG A;  4I5S A;  3WHL A;  3FTF A;  3GRU A;  4JI8 M;  2QPA A;  1JQJ C;  3UZU A;  3GPP A;  4DR7 M;  2KW0 A;  4NSO B;  3THG A;  1UM8 A;  1Z59 A;  1N32 M;  2EO2 A;  3T1Y M;  4BB9 A;  3U60 B;  4JV5 M;  1KSF X;  2JA2 A;  3E4R A;  3KP1 E;  2VQF M;  3U6P A;  4JYA M;  2HKJ A;  7CAT A;  5EXP A;  2CV2 A;  4MB7 A;  3GO8 A;  1NY5 A;  3SFZ A;  3U6S A;  2NQ8 C;  4G4Q A;  1XNQ M;  1ORY B;  2CE7 A;  3LVW A;  3K8Z A;  4X64 M;  1L2B A;  2KEB A;  3HHX A;  2F5P A;  4RF1 A;  4GKJ M;  3UK6 A;  1YE9 A;  3H4M A;  3LMM A;  4AW4 A;  4FWH A;  4IBF A;  1QAM A;  1JR3 D;  3FUU A;  3WHK A;  1PJI A;  4CHT B;  2X8A A;  4LZZ A;  2OQ4 A;  4DR4 M;  4OU7 A;  2L09 A;  2L7H A;  1J7K A;  3VKH A;  1XXH A;  5DYI A;  1L2C A;  3HJ8 A;  4JI0 M;  2D7H A;  2CEA A;  3M6A A;  4LJA A;  1QZM A;  1TH2 A;  5EXT A;  4AKG A;  3DOA A;  4GIP A;  4MGZ E;  1IM2 A;  3KOW E;  2Y0T A;  4IBD A;  2FNA A;  4B3M M;  1J5E M;  2RKO A;  2G5G X;  2XSZ A;  1EE8 A;  4W5W A;  4D82 A;  3UGJ A;  3U6Q A;  4G4N A;  2FOI C;  1MU5 A;  4LRS A;  4R3D A;  3GLF B;  1FNN A;  4LF4 M;  4GH9 A;  4REZ A;  2VII A;  3NBI A;  5A2Q S;  3TWL A;  1LV7 A;  3SAR A;  1TDZ A;  4LRT A;  3FUV A;  2XGN A;  3EIH A;  3LVV A;  4NXN M;  1IN4 A;  4LF9 M;  4AG6 A;  3SAV A;  3L27 A;  3FTD A;  1YUB A;  2HHH M;  3TPZ A;  5KPT A;  2XZU A;  4LJ8 A;  3JR4 A;  1L1Z A;  4GRI A;  4MH0 E;  4QHS A;  4RF0 A;  3M7G A;  3W0L B;  4DR3 M;  4GKK M;  2C98 A;  1SXJ A;  4LJ6 A;  3HHW A;  3W0F A;  2V1C A;  3A98 B;  3UMM A;  1E32 A;  4K0K M;  2C5R A;  4QHT A;  2I7P A;  4GMQ A;  3SHF A;  2ZAM A;  4FWD A;  4IBI A;  3GLH A;  1DO0 A;  4M9X A;  4FW9 A;  4IBG A;  4DV2 M;  3J81 S;  1Q39 A;  2AHM A;  5KQ8 A;  4A3V B;  2D7G A;  2VQE M;  1TGU A;  4KOD A;  1NVM A;  2C9O A;  3DZD A;  4DV0 M;  3AL0 C;  3T15 A;  3GLI A;  3J2P B;  1T3T A;  3FUW A;  3VLF B;  2M5Z A;  2XF3 A;  3ZCB B;  3CTW B;  2F5O A;  2YFQ A;  1R7R A;  3HHZ A;  4DV7 M;  1IN6 A;  3KOX E;  5FTJ A;  3TE6 A;  1OJL A;  2CUZ A;  4DV3 M;  4LF8 M;  3HJQ A;  4OVZ A;  3KDS E;  5EP3 A;  5ITU A;  3QWL A;  3ZC7 B;  4TUW A;  3MK6 A;  5IWA M;  1G41 A;  3MHV C;  2ZAO A;  4IBJ A;  3SYK A;  5F3W A;  3U61 B;  1PM5 A;  4KHP M;  1YSY A;  4B3T M;  4ITQ A;  2Q2E B;  2I7N A;  2LXE A;  1I4W A;  4AQY M;  1IN7 A;  4LF5 M;  1TDH A;  4X62 M;  3SMP A;  1W5S A;  2DZN B;  1IBL M;  4WUR A;  3GLG B;  1K3W A;  4X65 M;  4I4L A;  3RE8 A;  2EUC A;  3SAW A;  5BR8 M;  5FLX S;  1W5T A;  1IN5 A;  4DUZ M;  3D8B A;  2V6Z M;  4XGI A;  3AOE A;  3ZH9 B;  4DR1 M;  2G8L A;  2Z7J A;  4QNR A;  2W82 A;  4PD2 A;  3KXE C;  2KZS A;  3KOZ E;  1PJJ A;  1FJG M;  3LQR A;  2LWX A;  2KZU A;  4JI7 M;  4P16 A;  5FTN A;  8CAT A;  1NJG A;  3VDU A;  2UUA M;  1HQY E;  3B9P A;  4GC5 A;  3U6O A;  4GHL A;  2LH0 A;  5FSW A;  3U60 A;  1E94 E;  1IN8 A;  3K2L A;  4PDG A;  1IBK M;  4X66 M;  3VK7 A;  3TWK A;  4LFB M;  4ZPX A;  4DR6 M;  4YHH M;  1WXQ A;  4PCZ A;  4QOS A;  3FD9 A;  5EQT A;  2D7E A;  2Z4R A;  4MGY E;  5JI2 E;  1SXJ E;  4KO8 A;  3L26 A;  3TWM A;  1K3X A;  3HJS A;  1C1K A;  2X49 A;  2ZM6 M;  3J27 B;  5IZ7 D;  4JI3 M;  4OX9 M;  1X37 A;  3GPX A;  2C96 A;  2UUB M;  4AG5 A;  2Z3X A;  4M0W A;  2F5N A;  1G8P A;  4DUY M;  3KS8 A;  4MGI E;  3FUX A;  4M0D A;  1QQW A;  4IJF A;  4OW0 A;  4JI4 M;  1QYR A;  4EIW A;  1D2N A;  4DR5 M;  5JI3 E;  1Z5B A;  3DA1 A;  2QCU A;  2HL7 A;  1NSF A;  2QBY B;  5ITT A;  3A46 A;  4Z8X A;  5LMN M;  1MX0 A;  3BOS A;  2R4E A;  4LCB A;  4NXM M;  2RGO A;  3IG8 A;  4KLN A;  2XLJ A;  4LF7 M;  4S12 A;  1L2D A;  2ZAN A;  1R6B X;  2CHQ A;  5LMU M;  4NRV A;  2R4J A;  4PDI A;  3KW6 A;  1K82 A;  3R9X B;  3DFZ A;  3A42 A;  3U6M A;  3L25 A;  4L4U A;  3KSJ A;  3GLF A;  3PVS A;  4IIW A;  4JI6 M;  5EJC A;  2XFT A;  2YR0 A;  1QAN A;  4M9Z A;  4LZJ A;  1IY1 A;  2KXE A;  1I94 M;  4I81 A;  2KA6 B;  3QAU A;  1HNX M;  3K1J A;  3SC3 A;  5ITX A;  3GQ5 A;  4XBO A;  2R65 A;  2XSZ D;  2DWL A;  3KOY E;  3AJI B;  1G3I A;  3L28 A;  3T38 A;  1QAO A;  4D81 A;  2UU9 M;  1E9S A;  4GC9 A;  4MM3 B;  4JN6 A;  4LG2 A;  2ZBK B;  1L8Q A;  1N75 A;  2DXI A;  1GL6 A;  3M0E A;  4B7F A;  5BPV A;  1N78 A;  4G4O A;  3R8F A;  3JAM S;  1NNU C;  4AKI A;  4DV6 M;  4L16 A;  4I8O A;  2EA0 A;  2UXC M;  4WW0 A;  1VDD A;  3U5Z B;  2CV0 A;  3HU1 A;  2QZ4 A;  4NOO B;  2F5S A;  1Z5C A;  4MGK E;  1GKI A;  3PNY A;  5C18 A;  3J80 S;  3E9S A;  3L29 A;  4PT5 A;  4AI6 A;  3HHY A;  2H1R A;  3SAS A;  3AKZ A;  4IBE A;  1N77 A;  1SXJ D;  2CHG A;  1S3S A;  4R7G A;  4B7G A;  3GRR A;  1Q3C A;  3PNV A;  2Y21 A;  5E26 A;  2CV1 A;  1DGG A;  1HT1 E;  1XMQ M;  2R46 A;  2L7I A;  4IBC A;  4D80 A;  4II7 A;  1NJF A;  2BNK A;  4LGM A;  1XHB A;  2HCB A;  1JR3 A;  4NSR A;  1QAQ A;  1QVR A;  4DV5 M;  4FCV A;  5EXX A;  2A5Y B;  1J09 A;  3I4Y A;  3GPU A;  3U61 A;  1H6U A;  3RGP A;  2XFS A;  3VFD A;  3VK8 A;  4JI5 M;  3SYL A;  2F4V M;  2XZF A;  2FE8 A;  4DV1 M;  1IXS B;  3EIE A;  2QEN A;  5KPR A;  5DYG A;  1HNZ M;  4DV4 M;  3GLG A;  2OPF A;  3KP0 E;  3AV0 A;  3SAT A;  3KFU G;  2Y20 A;  4FCW A;  4L8R C;  1N33 M;  3CF0 A;  5KPZ A;  1NHG C;  4FWG A;  3U6D A;  5EP1 A;  4IBB A;  3U6C A;  3GRY A;  5IRE B;  3KSX A;  2RGH A;  1XXH B;  3HWS A;  4QOZ C;  1N34 M;  3Q8X A;  4LJ5 A;  5EP4 A;  1GLN A;  1IY2 A;  4Z6Y A;  1Z6T A;  2QP9 X;  5FTK A;  4G4R A;  5E6J A;  1IQP A;  2P5T A;  1HR0 M;  4LJ7 A;  2C99 A;  5FTM A;  1SXJ C;  1Z5A A;  2K47 A;  3VDP A;  3UJN A;  2Z4S A;  4FCT A;  3OTO M;  2Y0Q A;  2DWM A;  5C1B A;  5KQD A;  3I4V A;  5EXS A;  4LF6 M;  4HLQ A;  5ITX E;  5DNY A;  5GKN A;  3GP1 A;  4B7H A;  4BLC A;  3FYD A;  2J7N A;  3HGI A;  3TL4 X;  2R45 A;  4MGH A;  2C9C A;  2CHV A;  3GQ3 A;  3VKG A;  1R2Y A;  1ZQ9 A;  1G4A E;  3AFH A;  4LY6 A;  2LNH C;  5H37 D;  4FD2 A;  3FUT A;  1HQC A;  3CF6 E;  1DO2 A;  2FFJ A;  2XH9 A;  2BJV A;  2UXD M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...