2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase 1
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
5BRHA 2P9NB 3CETA 3QBWA 4BRDA 3A5NC 4H5RA 3HZ6A 2GEMA 1NGHA 4BG9A 3WEEB 2FSJA 4YDUA 5AQIA 4JAXA 3UKRB 3VENA 4K25A 3ZEUA 1ZXOA 3BF1A 4FWMA 3ZX2A 3WQTA 4H5VA 2D0OA 2FF3B 3S41A 4BR5A 4FWKA 5EVZA 4BRHA 4ISEA 4NB4A 5AQHA 5AZIA 1BU6O 1IJJA 4H0VB 4BRCA 3L4IA 3WXLA 3W3DA 4FWPA 3FZHA 4B1VA 1ESVA 1DGKN 4FOIA 4XH5A 2QM1A 4IXCA 5BREA 3GDQA 4H0YB 3U8XA 3A5LC 3QFPA 1ATRA 2V7YA 2BTFA 2VCPA 3UKUA 3WUHA 2Q31A 2P9LB 3I8BA 1T6DA 4L3QA 2HOEA 2W40A 2FSKA 3FZFA 2E2OA 1RDWX 2FLOA 3ATVA 5FPEA 1K8KB 3H6EA 4A2AA 2OANA 4QS7A 2IVOA 4BG8A 4MLHA 1NWKA 2CH5A 3GG4A 4BRQA 2E88A 3VEYA 3MN5A 3VF2A 4NO7A 3GOIA 5BRFA 4AM6A 4BR9A 5AQYA 3JS6A 1NGDA 3ZX0A 1HLUA 3IFRA 4DCHA 1X3MA 3JXUA 1V4TA 3GBTA 1YUWA 3FR0A 3FZKA 1ZBSA 1HJOA 2KHOA 4BGAA 1QQNA 2CGKA 3CI5A 2Q36A 4ISFA 1SZ2A 3MCPA 1WUAA 5AQQA 2E2PA 3HTVA 4FWRA 2YCHA 3L0QA 1J6ZA 3M3ZA 4EAHD 5AQWA 4EFHA 1EQYA 1U2VB 2P9SB 2DPNA 3VGKA 3FE1A 3VGLA 3ULEA 1NGJA 2P9UB 3SK3A 3ZETB 1D4XA 4CZIA 3R9PA 2YJFA 4BVOA 1SAZA 1KAYA 3M6GA 5JMVA 1SQKA 4BRMA 2BUPA 2IIRA 5AQGA 5AFUH 2P9PB 4O5FA 2AA4A 1DKGD 3CJCA 4KBOA 3LDOA 4BRPA 1P8ZA 4WQ4A 4CZFA 5AFUA 1TUYA 4BC4A 5BR9A 3DXKA 3P4IA 3BP8A 2PAVA 4GNIA 5KPRA 1RGIA 4WYBA 3FFKB 3CJ1A 3FZLA 3VEOA 1U6ZA 2HF4A 4CI6A 1GLBG 3D2FA 2A40A 2Q97A 3I33A 3RSEA 5TKYA 2A6AA 5FPNA 4FSVA 1S22A 3L6QA 5AQUA 2D0PA 2VYPA 3D2EA 4HWIA 1IG8A 4IZ9A 3C0BA 4H0TB 3H3NO 1NMDA 4HTLA 4CZGA 4BR0A 4BRNA 4BRGA 3IUCA 1RFQA 3EZWA 4FWSA 4PKHA 4I6MB 1GLDG 5BN9A 1GLCG 2W41A 3EN9A 4JD2A 1ZC6A 1TYQA 2ZGZA 5AQSA 5EXWA 3AAQA 3C7NA 3UB5A 4FWOA 5E84A 2Q0UA 1MWKA 2A5XA 4B1XB 3FGUA 2GWJA 4DHYA 4BRIA 2HMPA 2CGJA 2IVPA 1NLVA 1QQOA 5FPMA 3VEZA 4EHTA 1C0FA 5BRDA 2QWRA 3LDLA 3VEVA 3MN7A 2V51B 2E2QA 3VEWA 2P9NA 1NGGA 5F2RA 3CJ7A 1NGIA 1HX1A 3WEEA 3VF6A 2P9IB 3AY9A 1E4GT 3QB0A 4BC3A 3SJHA 5KQDA 3U9DA 3UKRA 2ITMA 2NLXA 3LDPA 5KQ8A 3M1FA 4FPBA 5KPTA 2QXLA 4CD3A 3LM2A 2H3GX 2YI1A 3EO3A 3MMVA 1XC3A 2A3ZA 1TUUA 4C23A 4BR7A 4Z94A 4B1UB 3ID8A 4FO0A 1XQSC 3LL3A 4BRFA 3B8AX 4BRLA 4B1WB 4MO4A 2A41A 4RCHA 5ADXH 3O8MA 2FF6A 3R8EA 4EIAA 4F9OA 4BGBA 4FWNA 3QICA 4CBWA 5ADXA 2P9LA 4H5WA 1HUXA 4JN4A 4CZKA 3A0IX 5F0XA 5AZJB 3IMXA 3U9ZA 5AQTA 1NGBA 3WQUA 4FL9A 1K8KA 3CHWA 2YHYA 4CZMA 4PL8A 2QWQA 1DEJA 4H03B 1YXQA 2GUPA 4CZHA 4BC2A 3DXMB 5LJVA 4B1YB 4QS9A 4BR2A 1WOQA 2ZWHA 3A5OC 4K41A 3TPQA 2FSNA 3MN9A 4BQZA 4MLEA 3MN6A 3VERA 1KXPA 4JHDB 1GLEG 4CZEA 4WQ4C 1BO5O 3WXIA 3D7EO 2P9KB 1BG3A 5KPZA 5AR0A 4CJ7A 2NRHA 2I7NA 2QWPA 2E1YA 5FPDA 4MO5A 1E4FT 4FPAA 3VETA 1JCGA 1HPMA 4K43A 4RTFD 3W0LA 3HI0A 4BVPA 1NGAA 1BA0A 2E2NA 1KAZA 4B1ZA 5LY3A 2CH6A 2GELA 3ZEUB 2FXUA 2NZTA 1HKGA 5EOYA 1U2VA 2GWKA 4IJAA 2ZF5O 2PBDA 4A61A 2D1KA 2UYTA 4YDUC 1YVNA 3CERA 4LC9B 2P9UA 4WQ5A 5AQVA 3ZETA 5AZIB 5AQRA 4XH4A 4H0OA 3LM9A 3H1VX 2E1ZA 1NGEA 3H45C 2P9PA 4IO8A 1Q18A 3ZX3A 1JCFA 4XEIA 3SLCA 3KVGA 4XH1A 3BUZB 4B9QA 1H1VA 2YHWA 4A2BA 4O8KA 4CZLA 4PKIA 3VF4A 2CGLA 4H0PA 3F9MA 3UKUB 1LCUA 1GLLO 2GTDA 5AQZA 4E1JA 3J8AA 1T44A 4H5TA 4FWQA 4J8FA 3O4WA 2I7PA 1G99A 1QZ5A 3QBXA 4IJNA 5AQNA 4BROA 3H1QA 2HF3A 3LDQA 1GLAG 3BF3A 4CBUA 5B8HA 2E20A 3R6MA 2ASMA 3O5BA 1MA9B 4DB3A 4BRKA 4EHUA 1R59O 1NGFA 1NGCA 4QS8A 5JICA 5AQPA 2IVNA 4Y0WA 1GLFO 3KZBA 2F9WA 2QWOA 3CJ9A 3CQXA 3HBTA 1MDUB 3HM8A 4I6MA 5AQXA 2YHXA 2Q0RA 1HKBA 4PL7A 2ZGYA 2EWSA 3G25A 3MDQA 1BUPA 4CD1A 2V52B 5EX5A 4M7YA 2Q1NA 1GLJO 3CJAA 3WT0A 1ATNA 1S3XA 1BDGA 3EKUA 3U4LA 4BREA 5JLFA 3TU5A 2D4WA 3O1WA 3H3OB 4BQLA 4BR4A 2VWBA 1OKJA 3DJCA 5BPNA 3A8YA 3QMLA 4M63C 1NBWA 3FZMA 3O08A 1HKCA 3IDHA 2Q2RA 3QDKA 3ULEB 3CJBA 2P9IA 3LDNA 4RWTA 4CBXA 3FLCO 5LJWA 1Z05A 2QWMA 3O1BA 2E8AA 3ENOA 5I9EB 3ENHA 1X9JA 5F1XA 3VPZA 1BWFO 5AQMA 3GE1A 3OHRA 3VGMA 3SMPA 2QWLA 3DXKB 3SMSA 2YJEA 3GL1A 3QFUA 1CZAN 3VESA 5E26A 2ASOA 3WXJA 3WXKA 1NM1A 5JLHA 3BEXA 3MK6A 2QW9A 4ISGA 4AM7A 5BPMA 4DQ8A 2F9TA 5CE3A 3D2FB 1JCEA 1MWMA 3VOVA 3RSEB 2V7ZA 1XUPO 3AARA 3KHYA 5AQJA 1BOTO 3CQYA 3D2EB 3EL2A 1QHAA 2J4RA 5BN8A 4GY2B 1BA1A 4JNEA 5EY4A 3VEXA 4K42A 3ATUA 3A5MC 5AZJA 4M7XA 1V4SA 1T6CA 5AQKA 3DWLA 4BC5A 1X3NA 3H46O 1Y64A 5BPLA 2A42A 2P9SA 4IWVA 1KAXA 3AAPA 1QQMA 4JD2B 4WQ5C 4A62A 1TYQB 2WUSA 4BRAA 4FWLA 5AQOA 3DXMA 3DAWA 2ASPA 1C0GA 3C7NB 1Z6RA 4H5NA 5ELZA 1LOTB 3UE5A 2QWNA 3EKSA 5AQFA 4JHDA 5AQLA 4H0XB 1QZ6A 3HSCA 1YAGA 2AP1A 3CIPA 4FOEA 3O6WA 2P9KA 1ATSA 4PKGA 3O80A 4CZJA
chains in the Genus database with same CATH superfamily
1PJSA 4B9SA 2P9NB 3CETA 3QBWA 3LP0A 5HROA 4WP2A 4H5RA 2BWBA 3VK7A 2P51A 3WEEB 4YOVA 1XHBA 2XSZD 4ZTJA 4CK2A 2YQZA 4BE1A 3KTQA 3VENA 3UKRB 5CR4A 4RF1A 4Q7JA 3ZSQA 1REVA 3I0RA 5EP1A 3QO9A 3U6QA 3AVMA 3AOEC 2ERCA 3CG7A 4NRWA 4HTUA 2X6NA 1P90A 1Y97A 4BRHA 4FJ8A 1VRTA 2DWLA 3V4IA 5AZIA 3B6OA 1JLFA 2UUAM 1BU6O 4H0VB 3AA4A 3L4IA 3VTHA 2Z4SA 3BOSA 3JAMO 1VQ6N 3OBYA 3WXLA 1OH7A 3W3DA 3GRUA 4ILHA 4QOZC 5CYQA 4B8AB 4LJ6A 4ANRA 2V6ZM 4DUYM 1HNVA 3U6DA 2DAEA 5GKNA 4IXCA 4WE1A 5BREA 3HHZA 1DO2A 4H0YB 1X9SA 2DY4A 4I2PA 3THWB 3G0ZA 1ATRA 2KNAA 2ZJPL 2J7NA 1QSSA 2JLEA 3QINA 4M3UA 1T6DA 3AFHA 2WTUA 4LRTA 2XH9A 3Q7BA 1N32M 1BHLA 3DLEA 1BI4A 4F3TA 3HX3A 4DSEA 3H6EA 2Q2EB 4JI6M 3NE6A 3SZ2A 1X1PA 4MLHA 1QZMA 1T43A 4MDBA 4UY8O 4O4GA 3HHWA 1RDBA 4CFBA 3EEQA 1TK0A 4E1NA 2BH1A 1G8PA 2ZQBA 1TKXA 3C6AA 3GO8A 4GEWA 3GOIA 1Z25A 3ZCMA 3ZX0A 3AO3A 4DU3A 4IBFA 2X74A 1V4TA 1IY1A 3HOSA 4DTUA 4Z6YA 1ZBSA 2WZJA 3KW6A 3AGRA 4B3SM 4ISFA 3FUWA 5DYGA 3AVBA 1T05A 4PQUA 1WUAA 3E66A 3PX6A 1J5EK 1NO1A 3VQAA 3QEVA 1WB9A 2YCHA 3L0QA 1R4GA 4EFHA 2KA6B 2P9SB 4LY7A 2DPNA 4B08A 2YFQA 1VSMA 4JKGA 1Q82O 3FE1A 4PY5A 4BE2A 4PDGA 1KQSM 4X65M 4DQPA 3SK3A 1D4XA 3CMEN 5E41A 4M45A 2KZUA 5HLFA 2YJFA 1DTQA 3O4NA 1TKTA 1SAZA 5LMNM 2N35A 3FKEA 3M6GA 4BVOA 4JI2K 4Z4FA 4BRMA 3K5OA 3LAKA 1VSFA 4CGYB 2C5RA 4ZPXA 2P9PB 4O5FA 4N47A 1P8ZA 1BCMA 1KVAA 4G3OA 1PM5A 3DXKA 5HBMA 1RDCA 3BP8A 4GNIA 4EP5A 4W5OA 3HJSA 1RGIA 3OYGA 1NK4A 3CJ1A 3RMAA 4LJ9A 1K8AO 2O4IA 2BNKA 4DMNA 3J7AP 4YOTA 2FBYA 4B9UA 4ELUA 4G6ZA 3B9PA 4OU7A 3IRXA 1HNXM 2DAKA 3TWLA 3AVKA 3L2RA 2WC9A 2YKMA 1IG8A 3C0BA 2CV0A 3H3NO 3K9KA 4DTNA 4CZGA 4BRNA 4FJ7A 1NY5A 3P39A 3OYEA 3IUCA 4L16A 4PKHA 1C1BA 4EZ9A 4BWMA 4FJ5A 4JI8K 2Y1IA 2YNIA 4XGIA 3M6AA 4LRSA 3ISNC 4II7A 3IHPA 1JQJC 4ID5A 4JV5K 2F96A 2JWLA 3HPOA 5AQSA 3HO1A 2JWSA 3AAQA 1PRBA 4NXMK 1ZQ9A 4IG0A 2Q0UA 3V81A 2A5XA 3MEGA 2KW0A 3FGUA 4OGCA 1S1WA 3NAEA 1VQMN 2GWJA 4B3SK 3THXB 2A5YB 2R4EA 3U6EA 1QDRA 2CGJA 3O9TA 3PSIA 1QQOA 3J80O 1C7YA 1XNQK 3TWHA 3GLHE 4CECA 3SC3A 3O3HA 3MN7A 1C1KA 3U6CA 3K5MA 1OFHA 3HXMA 1RTJA 5F2RA 1JLCA 4CGIA 3EE8A 4GV3A 3B7NA 1HX1A 2QQ8A 2VF7A 2P9IB 4BC3A 1TTEA 1RDAA 4FLWA 1GJTA 2J7OA 1YLAA 2KZMA 2BJVA 1UWBA 1OFIA 3AVAA 3WXMB 4R3DA 3C65A 3J81O 4CD3A 2EHGA 3VQPA 4O0JA 2HNDA 4B7HA 4HL4A 3L8BA 3AKZA 1NKEA 3LM2A 2H3GX 5FLXO 2HBLA 2NRTA 2JUJA 5H1SQ 3GLGA 1XC3A 7CATA 3UZUA 1HNWK 3NWLA 1SXJB 3DOLA 4IFEA 4N56A 1KFVA 2JY8A 3LL3A 4BRLA 3CC4N 3HGIA 3DYAA 4B8CA 2G8HA 4FW2A 4E0DA 2A41A 4RCHA 3F73A 3AVJA 1UA1A 3ZT3A 1J5OA 3R8EA 4F9OA 1Q9YA 4FWNA 1NKCA 5ADXA 3LP1A 2LVNC 4IEEA 4CJTA 1TH2A 4IFVA 1GOCA 3HZJA 1QANA 3I51A 1HUXA 4JN4A 1S1XA 4DG1A 4L8RC 4X66K 4KHUA 4M0WA 4KAZA 3G4SN 4CERA 1QAQA 3CHWA 1N77A 3R1XA 5CHIA 2CFOA 4PL8A 1DEJA 4IBBA 3CQ8A 1XWIA 1OH6A 2FH0A 4L15A 1IKYA 3DXMB 4JI4K 3NCIA 1VQ8N 2O8DA 4OX9M 3CCLN 1DGHA 2LWXA 3RR8A 2FSNA 3A46A 3MN9A 4E3SA 4MLEA 1WNSA 2GX9A 1XXHB 2Z1IA 1CXQA 3ZSXA 1NJWA 3I04M 3G71N 4MQ3A 1BISA 1BG3A 3R3LA 4IO9L 3PO4A 1NG9A 4FJXA 2LVQD 5BPVA 4AF1A 2NRHA 3GPXA 2NRRA 2HBKA 2I7NA 4ITQA 3E9LA 3V9UA 2E1YA 1NJFA 3VETA 1E4FT 4CEAA 1IXZA 3K0SA 2KRUA 4K43A 4RTFD 2J5YA 4KH4A 5TKWA 3HI0A 1NHWC 4FLYA 2XZFA 3QETA 4KH5A 5GADP 4B1ZA 2CH6A 2GELA 1B9DA 3LVWA 3FUUA 3GPUA 4FLZA 4BBAA 2JP7A 1U2VA 5JI3E 5M1KA 1YTAA 3AVIA 1ZBFA 5A2QO 3CERA 4LC9B 5HRSA 4DV7M 5AQVA 4X62M 2OZSA 4XH4A 3GQ4A 3GLFB 5EXTA 3AO4A 4IO8A 1NOZA 3T1HK 1VSDA 4XH1A 1ZMWA 3FTFA 4CHZA 4B3RM 2QPAA 4LF9M 4CJKA 2A1SA 4CIZA 3W68A 3SCXA 1XHXA 1WGNA 1VHXA 1IY2A 1TGUA 2GTDA 3U6SA 3TTFA 1IBMM 5FRMA 5AQZA 2QHOB 4E1JA 2F4VK 1T44A 4G9ZA 4FWQA 1FNNA 4IKFA 3J27B 3SQ4A 1EETA 2ZJQL 2I7PA 1G99A 1XMQM 4D80A 2D0CA 2RGHA 4DV3K 2WFBA 4GKKK 4PHTX 3FYDA 4CBUA 3KD1E 4GH9A 4DF4A 3FRIA 4AG6A 3Q7CA 4HEOA 3O5BA 1MA9B 1RT7A 3J7BA 1WAFA 3L3VA 4BRKA 4JI5M 4DB3A 4M9XA 1CZ9A 3JAMS 4QS8A 2E5LM 4Y0WA 4OX9K 5ITUA 3WNEA 4LFAM 2KDLA 3ZT4A 1QSYA 5AQXA 2YHXA 3ZCBB 4FM0A 2X8AA 2B6AA 4PL7A 1K9MO 2O4GA 1OIZA 4LGMA 4KV8A 2C96A 3RE8A 3W67A 3HYFA 5EX5A 4G4QA 4DUZK 3LP2A 4J2BA 1WR1B 4KH6A 2IOCA 3EYZA 4F4KA 3U6MA 3O1WA 3DLHA 2JZ1A 4ID1A 1OKJA 1ASUA 3ZSVA 1I3AA 5BPNA 1TKDA 3OYMA 4B9TA 4DTRA 1NBWA 3FZMA 3OS2A 3SATA 3OJUA 1YJ9N 1VAZA 4RF0A 2BDPA 2KNVA 3PO5A 4FD2A 1L3VA 3LDNA 4CBXA 3T15A 4NL4H 4B3TM 1K73O 2F8TA 3RGPA 3KS4A 2E8AA 3SBGA 2ZM6K 3VN5A 4LJ4A 5I9EB 3F2KA 4CIGA 1WBDA 3C3DA 1LAVA 3AJIB 3GE1A 1YSYA 3SMPA 4BLCA 2QWLA 5DK5A 4HUFA 3KSXA 3SMSA 3QNNA 3EIEA 2YJEA 1HNZM 3GL1A 3QFUA 1QS4A 4LF9K 2F8SA 2ASOA 3D6RA 1GKIA 5DMRA 5BPMA 4CIEA 4EZ6A 3D2FB 1JCEA 3BZKA 1XWLA 3VOVA 4JKHA 4RW9A 1RU3A 3HVTA 1RBRA 1XUPO 2LNHC 4CHTB 2VG7A 3AARA 2Y21A 2PFUA 3KHYA 1BOTO 2AHMA 4WW0A 2FE8A 3I4YA 3GQ3A 4O8UA 4Z0UA 2J4RA 1D9DA 4FJGA 4JNEA 2L6OA 3ATUA 4CEDA 2DWNA 1NNUC 3LCVB 3A5MC 4M7XA 1V4SA 3TABA 5IZ7D 4JI5K 3UGJA 4BC5A 1JLEA 1X3NA 5FDLA 2L4FA 1HMVA 3NMUA 4CW7B 4LSNA 5GAEP 1XI1A 1W5SA 2P1JA 1IKXA 1QQMA 3AAPA 3HVRA 4CF2A 1TYQB 1H6UA 5AQOA 4NXNM 1JXBA 3VKHA 3C7NB 3FUVA 5IWAM 3FE3A 1LOTB 4GMQA 1XNRM 2XZUA 4OKJA 4CESA 4FOEA 2CHGA 4FWDA 5EP3A 4MGYE 1ATSA 3ZSRA 1TAQA 2E6MA 4JI3K 3O80A 2C9CA 1IKWA 2VQEK 4IOAL 4DR4M 2QXFA 4IEIA 5GIPA 2QKKA 5CY4A 1MX0A 1ZV1A 3U6OA 3E46A 3VQCA 1ZYQA 2V1CA 1DV0A 2G8IA 1VSEA 1NV8A 5AQIA 2APLA 3ZEUA 4W5TA 1ZXOA 4FWMA 4NC6A 3ASMA 2D0OA 4F2LA 3KIOA 1MN3A 5L8RF 4M0DA 1ORYB 4MGIE 4FWKA 4OPAA 3TAPA 5M1FA 4G4OA 3CPEA 4LF4M 4NB4A 5AQHA 3E9SA 3T1YM 2D7GA 3M7GA 3MX5A 1IJJA 3EE9A 4CFDA 4DV2K 3THGA 1WHCA 4BRCA 3SBJA 3T38A 3OS0A 2RRUA 2KZZA 2O25A 3J80S 4CGGA 4B1VA 3CM6A 2ZD1A 3ZSYA 2HWJA 1Y8GA 2UUCM 4CGDA 3QWLA 3HU2A 5FTKA 3NVMA 4DLEA 4DR6M 3QFPA 4YOYA 2E6LA 2GUIA 4KHQA 2L09A 3N4QA 2OPQA 2BTFA 2VCPA 3DOAA 1WSGA 1OAIA 2NRZA 1T6OA 5EQTA 1CZBA 1XC9A 4L3QA 4LZZA 2F5SA 4CHOA 3VQBA 1NNEA 2QZ4A 2FSKA 4FW1A 1RDWX 3IG5A 5KRTA 4JK9A 2FLOA 3KJVA 4N41A 3J81S 4DWIA 4FJMA 5H37D 4NCGA 1CXUA 5F3WA 1KFSA 4DSLA 2LVAA 1YT3A 2C99A 1WSFA 4PA1A 5FLXS 3GG4A 3VQ6A 3VDUA 4LF7K 3QIPA 2F7TA 1T3TA 4OLBA 3CCSN 3L25A 2ZJRL 4NXNK 1HT1E 3ZC7B 4MB7A 3TL4X 1NK8A 2OPFA 3U5ZB 4O0IA 4CEEA 4JI0M 4A5BA 2XLJA 3AV0A 3EY1A 4BR9A 5BR8M 4OGEA 1HLUA 3GLIB 2UU9M 4E7JA 5FTLA 1X3MA 3GBTA 5SWMA 4FCYA 4NYFA 3LALA 1IH7A 1T3VA 2KFZA 1V33A 1ZBUA 1NY6A 4H4OA 1SZ2A 4J2EA 3F9KA 5LL6Z 3DLGA 3VA0A 1NJIO 3AVCA 4DV0K 4LFBK 4RKUF 2RE2A 2B5JA 4HVJA 1D2NA 1J6ZA 2YNGA 3M3ZA 2L4EA 5AQWA 4CHQA 3KS8A 1BQMA 1VQ4N 4IBDA 2O8CB 2KW4A 3VGKA 3KLGA 4GV6A 3KP0E 4G4RA 2DHRA 3SAHA 3SI6A 2P9UB 1A5XA 3AA5X 3ZETB 5LMUK 4CF1A 4GRIA 4GV9A 2LTUA 3FYCA 1KAYA 1SQKA 1FW6A 5AQGA 4DV6K 4OKEA 5KTQA 2AA4A 5HRNA 2OO9A 1EIJA 1DKGD 2WOMA 3LDOA 4FW9A 2D0AA 4WQ4A 2UUCK 3LAMA 5C0YA 1SXJD 4LF8K 3P4IA 2IAJA 4FVMA 2PAVA 3TTCA 5KPRA 4LH5A 4WYBA 1IXSA 1C0UA 4I5SA 1NOYA 1RT2A 3VEOA 2HF4A 3V9XA 3GLHA 1UM8A 3O9SA 2ZE2A 4JLHA 3SAGA 4ILGB 4JYAK 1K82A 3I33A 3U3YA 4X64M 5TKYA 4NRVA 5FPNA 4FLXA 2DTUA 3KK7A 4FSVA 3HJFA 3L6QA 3DRSA 4OO1J 5AQUA 2VQFM 1QDTA 4JS4A 5DM7L 3V1QA 5A2QS 3D2EA 4IZ9A 3TSUA 1RBUA 5CZ1A 3WNFA 2G8KA 3GPPA 3OTOM 3S3NA 1N34M 2BJWA 4N5SA 4DR2K 4AHRA 1S6PA 2HB5A 5EJCA 1JR3D 1VQ7N 4B9MA 1TF0B 4FWSA 3LZJA 2UXCM 4I6MB 3KK1A 4BDZA 4L78A 4JI1K 5HRPA 4JKCA 2LHGA 2Y1JA 2W41A 3CYMA 4JI0K 1QYRA 2GBZA 3MEDA 3L2AA 3SV4A 1ZC6A 2HHXA 3K8ZA 2K9DA 3IAYA 5EXWA 3V6DA 2F5OA 3AV9A 3CCEN 2YKNA 5M1QA 1VQLN 2CP8A 4B1XB 1NKBA 2A1RA 4LF6K 3CF0A 2F5NA 1FKOA 4BRIA 4GIPA 1LWEA 1NLVA 1V92A 4CE9A 3CFOA 5BRDA 2QWRA 2VF8A 3LDLA 4GKJM 3VEWA 4CF0A 3ZSOA 3RMBA 3SUPA 3CJ7A 1NGIA 3T6PA 4KKOA 1TH3A 2E4LA 4AKHA 2UXDK 4GMJB 1GL6A 3O9UA 3O3FA 5KQDA 1N78A 2G8FA 3K5LA 3T3FA 2DWZB 3VA3A 1TVRA 2NLXA 4RW6A 2ITMA 4FPBA 5KPTA 2X6SA 1J09A 4IOXA 4IFYA 3VQEA 4K8XA 4H8KA 3W0FA 2DZLA 3ZT0A 2YI1A 3PIPL 4LJ5A 4DU4A 2HHQA 1A5TA 3MXMA 1WIVA 1T03A 4BR7A 4Z94A 3SAWA 3KLIA 2XF3A 1S5JA 2O8BA 1HJPA 4CJ5A 3SQ0A 2WSFF 3KP1E 4B1WB 3ULDA 1Q86O 4QHTA 3QEWA 4C8KA 1VEGA 5ADXH 4X64K 4JKAA 3VQ4A 1IN6A 5EXPA 4FK0A 1N75A 3HY5A 4Z8XA 2P9LA 3NGIA 3CCQN 1WSIA 3A0IX 1N34K 3IMXA 3U9ZA 1WLJA 1W97L 2FBTA 5C42A 1K8KA 4MDAA 1GOBA 4LCBA 2MJ5B 1RBTA 3A98B 1GABA 4I9LA 2GUPA 1IBKM 4AHTA 1L5UA 1AUAA 4OJRA 4B1YB 4E7HA 2ZWHA 3A5OC 2RHKA 4BQZA 4KHPM 2PY5A 3MN6A 4REZA 2UUAK 1KXPA 4KHYA 3WXIA 1Q9XA 1QVGM 2P9KB 4HUEA 3OYFA 1Z5CA 2KTQA 4DUYK 1NMNA 4CHNA 2XFTA 2EJSA 4MO5A 3KOWE 4FPAA 1JCGA 2OPSA 4R5PA 4R79A 3W0LA 4IBGA 4C8OA 5J2MA 1BA0A 1RT5A 2E2NA 2Y0QA 3I8DA 1QUSA 4LF5M 3MJ5A 2FXUA 2NZTA 1N32K 2XSZA 4OPHA 2CHQA 1L3SA 4FZYA 3S9HA 2ZF5O 4KO0A 2JWKA 4JI6K 4KODA 4LSLA 4FJJA 1C1CA 4YDUC 2HHSA 3OYKA 4Z4IA 3VQ5A 4Z4EA 5AZIB 1NJZA 4J2AA 3H1VX 1NGEA 3HWSA 3UK6A 4AQYM 1UOCA 4IDKA 1S72N 3KLEA 3DRPA 3H45C 2DAGA 4JEPA 4F8RA 3PNVA 1I39A 2X4AA 4QCLA 4XEIA 3KVGA 4ELVA 4MGKE 4PKIA 3VF4A 4NCAA 3L2UA 3F9MA 1OKSA 2RGOA 1KLMA 3DLBA 1GLLO 2IS3A 3IG8A 5C10A 1VG5A 4YY3M 1BIUA 1QVFM 1R5LA 1JL2A 4J8FA 4DR3M 3LCUA 1BI4B 2VGMA 3SPYA 4WCEL 1CUKA 2QNJA 1QQCA 2ETJA 3AOGA 3BF3A 2O8FA 3HPGA 2XEPA 1G59A 1W5TA 1PJTA 3AOEA 2GQFA 4HLQA 3NBXX 5JICA 4CFAA 4X65K 5AQPA 4E7LA 4IIWA 3KZBA 4CGFA 2F9WA 2QWOA 3HBTA 5HP1A 5LMNK 4F1IA 1J7KA 4IBKA 2VG5A 3HL8A 3PIOL 4YFUA 2EKKA 4LJ7A 1PGYA 2EWSA 1B9FA 1BUPA 4DR7M 2DAMA 4M7YA 1W9HA 1VSKA 3WT0A 3U4LA 3LPUA 4BREA 5JLFA 3G10A 1Q3CA 3TU5A 3L3UA 2HHUA 5FTNA 2KRKA 4BR4A 3A8YA 3OYIA 4FJIA 3QMLA 4GW6A 4YNQA 2QA4N 4M63C 4JKDA 1NHGC 3V1RA 2KXEA 1DLOA 2EA0A 1HKCA 3WHKA 1HNXK 1FK9A 2R45A 3QDKA 4JKGB 3V9WA 1EO1A 3NH0A 1QE1A 1RT4A 5JI2E 3HM9A 3SARA 4DSKA 2Z4RA 5ITTA 5SZTA 1Z05A 2QWMA 2CRUA 5HOOA 3ENOA 3U6LA 1WN7A 4FJHA 1LAWA 4A57A 3L2QA 1X9JA 3VPZA 1BWFO 5AQMA 2L7IA 1U4BA 3SQ2A 3ITHA 3DXKB 4Z4HA 1XC8A 3HP6A 4Q0BA 3RVCA 1Z59A 2R4JA 3GRVA 3VESA 1Q3BA 5JLHA 3TQSA 3MK6A 2QW9A 3AVNA 4ISGA 3WNGA 3IECA 3SAUA 4AM7A 4DQ8A 5IT9O 3AVLA 2FBVA 1G71A 2ZTDA 4YY3K 2V7ZA 1ZMUA 5AQJA 3SUQA 2UXBM 4FXDA 3RTVA 5BN8A 1QHAA 3MCAB 2IC3A 3O3GA 3K92A 3VEXA 2Y0TA 4C8NA 3UJNA 3AO1A 5AZJA 5MLCQ 4FZXC 1IQPA 3DWLA 3U60A 4CJ6A 3NF7A 3VQ7A 2NRVA 5BPLA 3M8RA 2R6FA 3HKPA 3DMJA 3M0EA 4AKIA 2Q3SA 4WQ5C 1XHZA 4AHCA 3DAWA 4CIFA 2ASPA 3QESA 4KRFA 1Z6RA 1OVQA 1RCHA 2WBNA 3BXWA 4CJQA 4AW4A 1U45A 3CD6N 4JHDA 5AQLA 3MWPA 3HSCA 4W5QA 4FM1A 4BE0A 4R7GA 1YAGA 3CIPA 3O6WA 4RG8A 3VTIA 4CJLA 1SXJE 4WFBL 5C2DA 2BE2A 3TSPA 1A5VA 2EX3A 4CZJA 2W82A 5BRHA 4BRDA 1VSHA 2RN2A 3A5NC 3HZ6A 1W7AA 1OH8A 3MX2A 1NGHA 5EP4A 3B7ZA 2FSJA 2NNWA 1IN7A 3J7AS 4YDUA 3LDSA 4KB1A 2FC0A 4K25A 3QEPA 4OVZA 4YOUA 1IBLM 4DBGB 2JZ0A 3ZX2A 3DLLL 2IDOA 3A2FA 3NFAA 3DZDA 2XO7A 3SHGB 2FF3B 3S41A 2WSEF 2HKJA 4B9LA 4M3WA 3KOZE 1JR3E 4ISEA 4FLUA 3GLGB 3PX4A 2BWEA 2MH8A 3FRHA 1TDHA 1IN4A 4DV4M 3U61A 4CEQA 1IFYA 1NJGA 2M5ZA 4A59A 1NK6A 4XH5A 5J2PA 2R44A 1FJGM 3QNOA 3L2WA 2HHHM 1KCFA 2I5JA 3A5LC 1XXHE 2LVPC 3UKUA 3WUHA 2DFHA 4MH0E 2Q31A 3AL0C 5EXXA 1XMOM 4LH4A 3JR5A 3D0PA 3I8BA 3TSQA 3JSMA 4PT5A 4CGJA 3TAGA 1IN5A 4HCBA 3FZFA 3ZYYX 4GVMA 4W5RA 4TSXA 4GC9A 1QQWA 3VQ9A 1J53A 1OTRA 1UA0A 5KGXA 1LV7A 2HCBA 1BIZA 4IOCL 1R0AA 1K3WA 4A2AA 2CEAA 1VQ5N 4JS5A 2XY7A 2OANA 3MMPA 3OYNA 1JJ2M 2HSTA 4Q5VA 2QK9A 2IVOA 3OYHA 4KT0F 1SS6A 1YUBA 2JXNA 3Q8XA 2YV0X 4U67L 3SQ1A 1X9MA 2CH5A 3TAFA 1W2BM 2O8DB 4BRQA 2E88A 2H5XA 1DGHB 2Z1HA 3VEYA 4DV7K 5KO3A 4L4UA 2YNMD 4X62K 2O8EA 1CLQA 4JI7M 4DSFA 3VF2A 4NO7A 4RW8A 2ZAOA 2MGWA 5BRFA 4AM6A 1OVYA 3JS6A 3MHVC 1NGDA 2CWBA 4OKKA 4CHYA 4DQSA 4DCHA 3IFRA 4ILJA 1KC8O 2W42A 3GLFE 1RTDA 3JXUA 4I9QA 3KOYE 3FR0A 1HJOA 1IV0A 4WURA 4B3RK 1L2CA 2KHOA 1QQNA 2CGKA 2Q36A 3DOKA 4M3XA 1N36M 3V76A 3MCPA 4CJSA 2E2PA 1IBMK 4JKEA 1NSFA 5JVGL 1EQYA 1U2VB 4Y28F 2DI0A 3T69A 1XMQK 1HYZA 3TE6A 4MM3B 3ULEA 2UUBM 4IG3A 3D8BA 3IS9A 3VKGA 3LMMA 3TWKA 4CZIA 1XB2B 4AZFA 5M1NA 1TH4A 1DO0A 1VEJA 1VSJA 1K6YA 2E5LK 4MGHA 3OYLA 1LW2A 4LFAK 3CJCA 4DR5M 2HBMA 4BRPA 3C6UA 2ZAMA 4GVEA 4CJ3A 4JKFA 4CZFA 1L1ZA 2WSCF 5AFUA 1BGXT 4BC4A 3OYBA 2QBYA 5C12A 1HQCA 3FFKB 3NDKA 1C1AA 3H4MA 4KHSA 5ITXE 4DTXA 3WNHA 2KHHA 5ITYA 1GLBG 1QAMA 2G8WA 2DENA 3NF6A 3RSEA 4K0KM 4KB0A 1GLNA 2IGIA 2KKZA 2D0PA 4AHSA 1EX4A 5M1OA 1G3IA 2Z3XA 4KPYA 3CC2N 3B7QA 3FUTA 1NMDA 1TV6A 2XHBA 4BRGA 1ASWA 1QVRA 1RFQA 3VQ8A 1YITN 3EZWA 5AJ3K 1GLDG 1VRUA 5BN9A 1SKRA 1GLCG 4B3TK 4LJAA 4IBJA 3ZLJA 1J9AA 4MGZE 4JD2A 1C6VA 1HR0M 2KZSA 4OW0A 4Y1CA 2ZGZA 4F2SA 4CHPA 4CVNE 3UB5A 1N8RO 1VQ9N 4KI4A 2XRIA 3K5NA 3C58A 4O55A 1HNZK 1Q8IA 4PD2A 1JLQA 3TARA 2HMPA 3P38A 3VEZA 2IVPA 1VK0A 2X78A 2FFJA 2OOBA 4EHTA 1OAOC 3HOTA 3GRRA 1C0FA 3BZCA 3VEVA 2ATQA 4FLVA 1N33M 3RWUA 2P9NA 4DV1M 2C98A 1NGGA 3RFWA 2RPIA 2YR0A 2R18A 2OPPA 3VF6A 1L2DA 3WEEA 3KKSA 3U6FA 4QNMA 3AY9A 3QB0A 5FRNA 3SJHA 4KTZA 3U9DA 3UKRA 4CEFA 3OYDA 5HL7L 1LWFA 3LDPA 5KQ8A 3FTEA 1WAJA 4JK8A 1L8QA 2QXLA 1SL2A 2KNZA 5JVHL 3OYJA 3TR8A 4Y1DA 2WONA 3MMVA 2LSNA 1IXRC 4I2QA 3E4RA 3AO2A 4C23A 4NLBA 2KFNA 4ZHRA 1I4WA 1N6QA 4M41A 5IWAK 1KD1O 3QIOA 2Z8YM 1F21A 4DFMA 3B8AX 3FD9A 5C18A 3JYTA 1XNRK 1S1UA 5D3GA 3M8SA 2PYLA 3TWMA 2LXEA 3P1GA 2FF6A 3THWA 3B89A 4EIAA 1PJJA 1SXJC 3GPYA 4DTJA 1KYIA 3QICA 2W6KA 4CBWA 4XIUA 1E9RA 3E9PA 3E01A 4DR4K 4H5WA 1SKSA 3PFIA 4IJEA 4KTQA 4JN6A 3M8PA 2G8UA 3VQDA 2YHYA 2K47A 2VDBB 2QWQA 4W5NA 3OY9A 1YTUA 1RDUA 3MXIA 4KHNA 3I0SA 1WJ7A 5ITQA 3NH2A 3Q8GA 4DTOA 1HR0K 4M3TA 4QS9A 3TI0A 4LF4K 3VK8A 5IT9S 3T1YK 2BGGA 4CZEA 2VWKA 3MWTA 4O5BA 3J7YP 4S12A 4CJ7A 4QHSA 4C1NK 3R8FA 4FM2A 4AHUA 5GIOA 2QWPA 2P5OA 4DR6K 3AVGA 2CE7A 5FPDA 1DTTA 3C3EA 3CFPA 2G8LA 3K58A 1KFDA 2XY8A 1I94M 1R6BX 1KAZA 2HNZA 5LY3A 3ZT1A 4CK1A 3ZEUB 1HJRA 1HKGA 4LY6A 4KTWA 2DNAA 2GWKA 2PYJA 2XY5A 4IJAA 3NBIA 4A61A 4IBIA 2D1KA 3VMFB 4DSIA 3SYZA 1C0MA 3EIHA 3KVWA 2KQ2A 1ZMVA 3LQQA 3JR4A 4Z4GA 3LM9A 4CJUA 4QAGA 3ZH9B 1BQNA 1FXXA 4NLCA 3K9OA 5K14A 2OQ4A 3DLRA 2P9PA 2G8VA 3ZX3A 1JCFA 3SLCA 5JS2A 4E7KA 3C6TA 4J2DA 2V1UA 3BUZB 3HP9A 4B9QA 5C15A 5BR8K 2YHWA 3MXJA 4CJ4A 3CC7N 4FK4A 4JKBA 2CGLA 1LTMA 5GAGP 3V9ZA 2LVOC 3PNYA 2DFFA 2ITGA 2UU9K 1SL0A 1LCUA 4Z4CA 4YOXA 5M1PA 3GLIE 1IM2A 1J5EM 2DZNB 4XK8F 3TPZA 3J8AA 5I42A 3LQRA 1DT9A 1TAUA 1VQKN 3NGYA 4IJNA 4BROA 1LW0A 2HF3A 3K2PA 3LDQA 1GLAG 4FCTA 1RT3A 5B8HA 1VDLA 4E19A 4EHUA 5HRRA 4NYNA 1NGFA 4JI2M 3E1YA 3HRGA 2OTLN 2CUZA 4BB9A 2G5GX 1UAXA 4DV5M 3CJ9A 3O9RA 3KD5E 2Q0RA 3OVNA 2R46A 4GHAA 3OYCA 3UMMA 1WSHA 2ZGYA 3G25A 2O01F 3K59A 4DTMA 3A42A 1JKHA 5DYIA 4CD1A 3I4VA 2AJQA 4P17A 4HUGA 3VLFB 1P3QQ 3CJAA 1TK5A 1ATNA 3N4PA 1BDGA 1RTIA 4HCCA 3THXA 3I55N 2D4WA 4BQLA 2H1RA 2VWBA 1I94K 3FTCA 1G15A 4B3OA 3HJ8A 4I4LA 3F92A 1JLGA 2Q2RA 3IDHA 3RR7A 2VQFK 2ZTCA 1YI2N 3CMAN 3SV3A 3TAEA 1V34A 3U6PA 4B3MM 2P9IA 3CJBA 3OTOK 1YJWN 2YX6A 4RWTA 3HT3A 3VDPA 4FCVA 4JI8M 3FLCO 4JRQA 4C8LA 4FJKA 1S1TA 1NK5A 2CHVA 2UXCK 1L3TA 4FCWA 4JV5M 5F1XA 4V19S 4KO8A 3VGMA 3KLFA 2HHTA 4ICLA 1WGLA 4NXMM 2CV2A 4ZTFA 1IXSB 3T7ZA 5DM6L 3WXJA 3TANA 2P5TA 1SXJA 3BEXA 3NVKA 3GLHB 1XNQM 4IBNA 4RNAA 4AI6A 5CE3A 3UIQA 1L1TA 4DKWA 4KFBA 4FJLA 1Z5AA 5J2QA 3QERA 1S6QA 4CJPA 3ZSZA 1NVMA 3LZIA 5I3UA 2ZBKB 2YNFA 3D2EB 3SBTA 4GY2B 4K8ZA 1NK7A 1NJXA 1BA1A 5EY4A 1OH5A 4GKJK 4FJNA 1D0KA 5AQKA 4DFJA 1QZEA 1HPZA 3D45A 1Y64A 2A42A 4DV5K 1JR3A 4LGYA 3CF2A 4WFAL 3H08A 4A62A 4BRAA 2WUSA 4FWLA 3DXMA 1HNWM 3T19A 5FSWA 1D9FA 2YNHA 4H5NA 5ELZA 2JY7A 3P83D 3UE5A 4PCZA 4I81A 5AQFA 1XXHA 4H0XB 2FNAA 1QZ6A 1Q81O 2AP1A 5CZ2A 1QUTA 4CISA 3V9SA 3KK3A 4RW4A 3J7ZO 4PKGA 1GJSA 3HU1A 2HHWA 3C6HA 2D7EA 4X66M 3CGWA 2HL7A 3K1JA 2GEMA 1ZAEA 3KWGA 4BG9A 1X9WA 1EP4A 2QENA 5EU7A 1K3XA 4B3MK 4JAXA 3H4JA 3BF1A 3RGSA 4OVLA 4LZJA 2F5PA 3WQTA 4H5VA 3F5TA 3E21A 3PSFA 4JI4M 2D0BA 4A5AA 4BR5A 2XY6A 4DSJA 4BDYA 5EP2A 3SFZA 5EVZA 1HQEA 1DGFA 1IBKK 4NOOB 5FTMA 5FROA 1WSJA 1NK0A 3GLFA 1PJIA 3E9OA 4CJFA 3SPZA 3SAVA 2OA8A 2R65A 2O8BB 3CCUN 3SASA 4FWPA 4L6V6 3FZHA 3P5JA 4KHPK 1ESVA 1DGKN 2DFEA 4FOIA 3NGZA 1E3MA 3MECA 2QM1A 2FOIC 2JY5A 1GOAA 3GDQA 3U8XA 1HYVA 4F2RA 3QYBA 1NNJA 2V7YA 1X37A 1ZBIA 1TGOA 4CCHA 2P9LB 2HMIA 2L7HA 1NU0A 1Q39A 1HNIA 2HOEA 1EE8A 1KVCA 2W40A 3S3MA 2HNYA 2E2OA 1LV5A 4M3YA 4IBCA 3ATVA 3ID6A 1K8KB 5FPEA 2KEBA 3RMDA 1T7PA 4B9NA 4LF5K 2RF2A 1HQUA 2OYQA 3PLAA 1GVNA 3DFZA 3SAFA 4QS7A 3HHXA 4BG8A 1VQNN 1NWKA 2VGNA 1OJLA 1RBVA 2JNHA 2YHBA 1ZBHA 2RKOA 1GO5A 2KLAA 4FWHA 5KGWA 4FVUA 1DGGA 3CCJN 4XBOA 3MN5A 2MR9A 1KTQA 4DS4A 1KRPA 5C2FA 3T1HM 4AQYK 2OCEA 4AILC 5AQYA 2JY6B 2QCUA 2R0IA 1U49A 5IREB 5ITXA 1YUWA 3FZKA 4M3ZA 1S1VA 3L27A 2F4VM 4BGAA 4DF8A 3CI5A 2BANA 3W0LB 5CYMA 1MJGM 3RRGA 5AQQA 4AHVA 4DV3M 3HTVA 3LANA 3CCMN 4GKKM 4FWGA 4FWRA 4G4NA 4EAHD 2FS1A 4DR3K 1NK9A 3OS1A 3LWMA 2RKIA 1KLNA 1EFUB 3PVSA 4CJWA 2OTJN 4JK7A 4BACA 4YHHM 3FUXA 4KHWA 3VGLA 4AH9A 1NGJA 1L3UA 1KSFX 1R7RA 3CTWB 3KFUG 1A5WA 3R9PA 5JMVA 3SYLA 3IG1A 3B6PA 2BUPA 2IIRA 3THYA 5AFUH 2F5QA 2XFSA 4KBOA 2QTDA 4W5WA 2G3QA 1S9GA 2QKBA 4NCBA 4CEZA 1PJQA 2DVWB 4DUZM 1TUYA 3NF8A 1HQYE 5BR9A 2DZOB 1HRHA 3J2PB 4DR7K 3FZLA 3ILKA 3A45A 2NQ8C 1KVBA 1U6ZA 4CI6A 3SNNA 5DFLA 3D2FA 2K0BX 1EWQA 2A40A 2Q97A 1T8EA 2A6AA 1S22A 4PWDA 2HAKA 3KDSE 3QEIA 2VYPA 4HWIA 2O8FB 4NSOB 8CATA 4H0TB 3KWIA 4ELTA 4CF8A 1QSLA 4HTLA 4BR0A 4FJ9A 3CPWM 4RW7A 3CXCM 1QAOA 1FKPA 1RBSA 4IBEA 4A3VB 2ZM6M 1S3SA 3U3GA 2O5RA 1G4AE 4C1NI 1QHTA 1RILA 3EN9A 4QOZB 4EP4A 1JLBA 1JL1A 4TUWA 1TYQA 3V1OA 3LPTA 4F3OA 2OZMA 4IJFA 3C7NA 1TKZA 4FWOA 5E84A 1BVSA 5C25A 1AIPC 1VQ1A 1MWKA 3G6EN 1E32A 3CCVN 3T1AA 4DHYA 3K2LA 3M8QA 4QNRA 4NSRA 1RTHA 5FPMA 1IO2A 4LFCM 2X49A 1E9SA 4DFPA 3DLKA 3HPHA 2V51B 2E2QA 3NBPA 5E6JA 1Z5BA 5KRSA 2UXBK 4D82A 3PV8A 4YHHK 2DAIA 2Z7JA 1QTMA 2HW3A 1E4GT 1ASVA 3KOXE 2NRWA 3OBWA 4DR1M 1Z26A 4DS5A 3KXEC 4DTSA 4O44A 3VFDA 3QAUA 4E7IA 3M1FA 1O1WA 3K9JA 3L2VA 1JB0F 2NRXA 1B92A 4E1MA 3WHLA 2VIIA 1TL1A 2EUCA 1RDDA 3EO3A 3C94A 4DTPA 3M5RA 3QYEA 4LG2A 3DM2A 2DWMA 2A3ZA 1TUUA 1BCOA 3RRHA 4B1UB 3ID8A 4CJEA 2EKFA 4FO0A 5ITRA 1SV5A 1XQSC 2GNOA 1L2BA 4BRFA 1WXQA 5GINA 2R62A 4JI3M 3AVHA 4MO4A 3I56N 5JS1A 2VQEM 3O8MA 4BWJA 4JXJA 4QOSA 4WFNL 4BGBA 3ZSWA 2DKLA 4N76A 4CZKA 3B74A 1GL7A 4CJRA 5AZJB 5F0XA 1RT6A 5AQTA 2QP9X 3U60B 2EO2A 3TAQA 1NGBA 3WQUA 4FL9A 1IN8A 4UN2B 3THYB 2LHCA 2L2DA 4CZMA 1TL3A 1IBLK 5KI6A 4H03B 4DQQA 1YXQA 4GHLA 4HHTA 3L28A 3L26A 4CZHA 3GQ5A 4BC2A 1JLAA 4OLAA 2HHVA 5LJVA 2DHYA 4DV2M 3HU3A 4BR2A 1WOQA 4K41A 3TPQA 1M1KO 1YVUA 3U5ZA 1YE9A 3VERA 4JHDB 3ALYA 2M60A 1GLEG 1ZBLA 3GLGE 1BO5O 4WQ4C 4DV4K 3KKRA 3D7EO 4I7FA 5KPZA 1IKVA 5AR0A 3GLIA 4DLGA 4GITA 4LJ8A 1YIJN 4M42A 1FJGK 4LFCK 2HHHK 1D0MA 2Z1GA 3LWLA 2XGNA 3IKMA 1F4IA 1NJYA 2QEXN 1EKEA 1VQON 1HPMA 3R9XB 1Z6TA 4P16A 4BVPA 2JA2A 1NGAA 2D5RA 2B4JA 3OW2M 1XMOK 4BY9C 1YHQN 4FK2A 1OQYA 1HYSA 4OVZB 4DR1K 1VSLA 1R2YA 3OYAA 5EOYA 2PBDA 3SJJA 2O8CA 4CEBA 2UYTA 2QSFX 4LF7M 2FBXA 1U48A 1N5YA 1YVNA 2JGUA 3K9PA 2P9UA 1JXEA 4WQ5A 3ZETA 3THVA 1IG9A 4R71A 5AQRA 3ZT2A 4H0OA 5J2NA 2E1ZA 3U61B 3C95A 1D8YA 1S9EA 4B9VA 4JI7K 3DRRA 1ILYA 4KREA 2C9OA 1Q18A 3CM5A 4FLTA 1H1VA 1EXQA 4A2BA 4O8KA 4CZLA 1VDDA 3BBZA 4H0PA 3UKUB 3LW5F 4IDHA 3KSJA 4PUOA 3I01M 3AGKA 4LFBM 1OIPA 4DV0M 2YHAA 3OA9A 1U04A 1KSPA 4YOWA 4H5TA 2HBJA 1ITGA 1D5AA 4DFKA 3SUNA 3O4QA 1YJNN 1N36K 3PX0A 3O4WA 1QZ5A 2W6LA 3L4QA 3QBXA 5AQNA 3K57A 3H1QA 4UQGA 3CF6E 1WBBA 3HK2A 3L29A 2OPRA 1SKWA 5DNYA 2VWJA 2E20A 3MAQA 3R6MA 5LMUM 1Q02A 2NUBA 2ASMA 1R2ZA 4U7BA 1MU2A 1R59O 1NGCA 1LWCA 4OPKA 3LVVA 2IVNA 2UUBK 1SL1A 4DV6M 2O8EB 4I8OA 1GLFO 4I6MA 3CQXA 3HM8A 3O9QA 1MDUB 2D7HA 1E94E 3C9PA 1HKBA 3NHGA 1Q7YO 3HJQA 3AA2A 2HVIA 4LF8M 3VQQA 3CFRA 3MDQA 3BDPA 3QLHA 4KI6A 3AA3A 1IY0A 4DQIA 1BL3A 4DR5K 3KK2A 3TAMA 4PDIA 2V52B 2HVHA 2P5GA 4C8MA 2Q1NA 4FZZA 1GLJO 1S3XA 4JYAM 3EKUA 5T7BA 4BDPA 1DGBA 3DA1A 3H3OB 3PXGA 2LBCA 3DJCA 2ZANA 4L8RB 1UFZA 3GP1A 3SYKA 2VG6A 3FFIA 1SUQA 3SUOA 4K0KK 3O08A 3ENBA 1TR8A 3TTDA 3OJSA 1W0HA 4DR2M 4G1QA 4JRPA 2CV1A 4D81A 1O13A 3ULEB 4OPJA 1EWRA 3FTDA 5C24A 1TDZA 1YF5L 4JI1M 1D0LA 5LJWA 4KLNA 3O1BA 3GRYA 3SHFA 4CFCA 3MEEA 3ENHA 2LH0A 2MROB 3HSTB 5J1EA 3ZQJA 3OHRA 4AG5A 3EZ5A 2DXIA 2QBYB 1VEKA 5GAHP 1VQPN 1SG9A 1RNHA 1CZAN 4LF6M 5E26A 3BGRA 1NV9A 1C0TA 4M3RA 1NM1A 3PUFA 3WXKA 4CGHA 3QEXA 2OOAA 1M90O 4E89A 2F9TA 2R7YA 1U47A 1MWMA 4B7FA 3RSEB 2K6BA 3CCRN 1RT1A 1VSIA 3CQYA 3CF5L 3EL2A 4LD0A 1N33K 2UXDM 3NH1A 4DV1K 4K42A 1TK8A 1HT2E 4DQRA 1T6CA 4AKGA 2QI2A 3S3OA 3PY8A 3H46O 4B7GA 2Z1JA 4H4MA 4MFBA 4DU1A 2GV9A 4CF9A 3KLHA 2P9SA 4IWVA 4M9SA 4FYDA 3DI6A 1KAXA 1WSEA 4JD2B 4WF9L 3AO5A 2B3TA 2Y20A 1C0GA 4CEOA 1J54A 3HHYA 4CJVA 3D8LA 4YORA 3BY5A 2QWNA 3EKSA 3AVFA 3RMCA 2PZSA 5EXSA 4CK3A 3LP3A 2P9KA 1MU5A 1G41A 4EIWA 3P31A 5FTJA 5C1BA 3NF9A 4M9ZA 4GC5A
chains in the Genus database with same CATH topology
2P9NB 3CETA 3QBWA 4H5RA 3VK7A 3WEEB 4YOVA 1XHBA 2XSZD 2YQZA 3VENA 3UKRB 5CR4A 4RF1A 5EP1A 3U6QA 3AOEC 2ERCA 4NRWA 1P90A 4BRHA 2DWLA 5AZIA 2UUAM 1BU6O 4H0VB 3L4IA 3VTHA 2Z4SA 3BOSA 1VQ6N 3OBYA 3WXLA 3W3DA 3GRUA 4ILHA 4QOZC 4LJ6A 2V6ZM 4DUYM 3U6DA 5GKNA 4IXCA 5BREA 3HHZA 1DO2A 4H0YB 1ATRA 2ZJPL 2J7NA 1T6DA 3AFHA 4LRTA 2XH9A 3Q7BA 1N32M 3H6EA 2Q2EB 4JI6M 4MLHA 1QZMA 4MDBA 4UY8O 3HHWA 2BH1A 1G8PA 3C6AA 3GO8A 3GOIA 3ZX0A 4IBFA 1V4TA 1IY1A 3HOSA 4Z6YA 1ZBSA 3KW6A 3AGRA 4B3SM 4ISFA 3FUWA 5DYGA 1WUAA 3E66A 2YCHA 3L0QA 4EFHA 2KA6B 2P9SB 2DPNA 4B08A 2YFQA 4JKGA 1Q82O 3FE1A 4PDGA 1KQSM 4X65M 3SK3A 1D4XA 3CMEN 2KZUA 2YJFA 4BVOA 1SAZA 5LMNM 3FKEA 3M6GA 4BRMA 4CGYB 2C5RA 4ZPXA 2P9PB 4O5FA 1P8ZA 1PM5A 3DXKA 3BP8A 4GNIA 3HJSA 1RGIA 3CJ1A 4LJ9A 1K8AO 2BNKA 4YOTA 4G6ZA 3B9PA 4OU7A 1HNXM 3TWLA 2WC9A 1IG8A 3C0BA 2CV0A 3H3NO 3K9KA 4CZGA 4BRNA 1NY5A 3P39A 3IUCA 4L16A 4PKHA 4XGIA 3M6AA 4LRSA 4II7A 1JQJC 2JWLA 5AQSA 3AAQA 1ZQ9A 2Q0UA 2A5XA 2KW0A 3FGUA 1VQMN 2GWJA 2A5YB 2R4EA 3U6EA 2CGJA 3O9TA 1QQOA 3SC3A 3MN7A 1C1KA 3U6CA 1OFHA 5F2RA 3EE8A 4GV3A 1HX1A 2P9IB 4BC3A 2J7OA 2BJVA 1OFIA 3WXMB 4R3DA 3C65A 4CD3A 4B7HA 4HL4A 3AKZA 3LM2A 2H3GX 2HBLA 2NRTA 5H1SQ 3GLGA 1XC3A 7CATA 3UZUA 3NWLA 1SXJB 4IFEA 1KFVA 3LL3A 4BRLA 3CC4N 3HGIA 2A41A 4RCHA 3R8EA 4F9OA 4FWNA 5ADXA 4IEEA 1TH2A 1QANA 3I51A 1HUXA 4JN4A 4L8RC 4M0WA 3G4SN 1QAQA 3CHWA 1N77A 3R1XA 5CHIA 2CFOA 4PL8A 1DEJA 4IBBA 1XWIA 4L15A 3DXMB 1VQ8N 4OX9M 3CCLN 1DGHA 2LWXA 2FSNA 3A46A 3MN9A 4MLEA 2GX9A 1XXHB 3G71N 1BG3A 3R3LA 4IO9L 5BPVA 4AF1A 2NRHA 3GPXA 2NRRA 2HBKA 2I7NA 4ITQA 3E9LA 2E1YA 1NJFA 3VETA 1E4FT 1IXZA 2KRUA 4K43A 4RTFD 4KH4A 5TKWA 3HI0A 1NHWC 2XZFA 4KH5A 5GADP 4B1ZA 2CH6A 2GELA 3LVWA 3FUUA 3GPUA 4BBAA 1U2VA 5JI3E 5M1KA 3CERA 4LC9B 4DV7M 5AQVA 4X62M 4XH4A 3GQ4A 3GLFB 5EXTA 4IO8A 4XH1A 3FTFA 4B3RM 2QPAA 4LF9M 1IY2A 2GTDA 1TGUA 3U6SA 3TTFA 1IBMM 5AQZA 4E1JA 1T44A 4G9ZA 4FWQA 1FNNA 3J27B 2ZJQL 2I7PA 1G99A 1XMQM 4D80A 2RGHA 2WFBA 4PHTX 3FYDA 4CBUA 4GH9A 4AG6A 3Q7CA 3O5BA 1MA9B 3J7BA 4DB3A 4BRKA 4JI5M 4M9XA 3JAMS 4QS8A 2E5LM 4Y0WA 5ITUA 4LFAM 5AQXA 2YHXA 3ZCBB 2X8AA 4PL7A 1K9MO 4LGMA 2C96A 3RE8A 5EX5A 4G4QA 4KH6A 3U6MA 3O1WA 5BPNA 1OKJA 1NBWA 3FZMA 3SATA 1YJ9N 1VAZA 4RF0A 4FD2A 3LDNA 4CBXA 3T15A 4NL4H 4B3TM 1K73O 3RGPA 3KS4A 2E8AA 3SBGA 5I9EB 4LJ4A 3F2KA 3AJIB 3GE1A 1YSYA 3SMPA 4BLCA 2QWLA 3KSXA 3SMSA 3EIEA 2YJEA 1HNZM 3GL1A 3QFUA 2ASOA 3D6RA 1GKIA 5BPMA 3D2FB 1JCEA 3VOVA 4JKHA 1XUPO 3AARA 2LNHC 4CHTB 2Y21A 2PFUA 3KHYA 1BOTO 2AHMA 4WW0A 2FE8A 3I4YA 3GQ3A 4O8UA 2J4RA 4JNEA 2L6OA 3ATUA 2DWNA 1NNUC 3A5MC 4M7XA 1V4SA 5IZ7D 3UGJA 4BC5A 1X3NA 3NMUA 5GAEP 1W5SA 3AAPA 1QQMA 1TYQB 1H6UA 5AQOA 4NXNM 3VKHA 3C7NB 3FUVA 5IWAM 1LOTB 4GMQA 1XNRM 2XZUA 4FOEA 2CHGA 4FWDA 5EP3A 4MGYE 1ATSA 3O80A 2C9CA 4IOAL 4DR4M 4IEIA 5GIPA 1MX0A 3U6OA 2V1CA 5AQIA 3ZEUA 1ZXOA 4FWMA 2D0OA 4M0DA 1ORYB 4MGIE 4FWKA 4OPAA 5M1FA 4G4OA 3CPEA 4LF4M 4NB4A 5AQHA 3E9SA 3T1YM 2D7GA 3M7GA 3MX5A 1IJJA 3EE9A 3THGA 4BRCA 3SBJA 3T38A 3J80S 4B1VA 2UUCM 3QWLA 3HU2A 5FTKA 3NVMA 4DR6M 3QFPA 4YOYA 2L09A 3N4QA 2BTFA 2VCPA 3DOAA 2NRZA 5EQTA 4L3QA 4LZZA 2F5SA 2QZ4A 2FSKA 1RDWX 3IG5A 4JK9A 2FLOA 3J81S 5H37D 5F3WA 2C99A 5FLXS 3GG4A 3VDUA 2F7TA 1T3TA 3CCSN 3L25A 2ZJRL 1HT1E 3ZC7B 4MB7A 3TL4X 2OPFA 3U5ZB 4JI0M 4A5BA 2XLJA 3AV0A 4BR9A 5BR8M 1HLUA 3GLIB 2UU9M 5FTLA 1X3MA 3GBTA 1T3VA 1NY6A 1SZ2A 1NJIO 2RE2A 1D2NA 1J6ZA 3M3ZA 5AQWA 3KS8A 1VQ4N 4IBDA 3VGKA 4GV6A 3KP0E 4G4RA 2DHRA 3SAHA 2P9UB 3ZETB 4GRIA 4GV9A 3FYCA 1KAYA 1SQKA 5AQGA 2AA4A 1DKGD 3LDOA 4FW9A 4WQ4A 5C0YA 1SXJD 3P4IA 2PAVA 4FVMA 3TTCA 5KPRA 4WYBA 4I5SA 3VEOA 2HF4A 3GLHA 1UM8A 3O9SA 3SAGA 4ILGB 1K82A 3I33A 4X64M 5TKYA 4NRVA 5FPNA 3KK7A 4FSVA 3L6QA 4OO1J 5AQUA 2VQFM 5DM7L 5A2QS 3D2EA 4IZ9A 3TSUA 3GPPA 3OTOM 1N34M 2BJWA 5EJCA 1JR3D 1VQ7N 4FWSA 2UXCM 4I6MB 4L78A 4JKCA 2W41A 1QYRA 3L2AA 1ZC6A 3K8ZA 5EXWA 2F5OA 3CCEN 5M1QA 1VQLN 4B1XB 3CF0A 2F5NA 4BRIA 4GIPA 1NLVA 5BRDA 2QWRA 3LDLA 4GKJM 3VEWA 3CJ7A 1NGIA 1TH3A 4AKHA 1GL6A 3O9UA 5KQDA 1N78A 2DWZB 2ITMA 2NLXA 4FPBA 5KPTA 4IOXA 1J09A 3W0FA 2YI1A 3PIPL 4LJ5A 4BR7A 4Z94A 3SAWA 2XF3A 3KP1E 4B1WB 1Q86O 4QHTA 5ADXH 4JKAA 1IN6A 5EXPA 1N75A 4Z8XA 2P9LA 3CCQN 3A0IX 3IMXA 3U9ZA 1W97L 1K8KA 4MDAA 4LCBA 3A98B 2GUPA 1IBKM 4B1YB 2ZWHA 3A5OC 2RHKA 4BQZA 4KHPM 3MN6A 4REZA 1KXPA 3WXIA 1QVGM 2P9KB 1Z5CA 2XFTA 4MO5A 3KOWE 4FPAA 1JCGA 4R79A 3W0LA 4IBGA 1BA0A 2E2NA 2Y0QA 4LF5M 3MJ5A 2FXUA 2NZTA 2XSZA 4OPHA 2CHQA 2ZF5O 2JWKA 4KODA 4YDUC 5AZIB 3H1VX 1NGEA 3HWSA 3UK6A 4AQYM 1S72N 3H45C 4JEPA 3PNVA 2X4AA 4XEIA 3KVGA 4MGKE 4PKIA 3VF4A 3F9MA 2RGOA 1GLLO 3IG8A 5C10A 4YY3M 1QVFM 4J8FA 4DR3M 2VGMA 4WCEL 3AOGA 3BF3A 2XEPA 1G59A 1W5TA 3AOEA 4HLQA 5JICA 5AQPA 4IIWA 3KZBA 2F9WA 2QWOA 3HBTA 1J7KA 4IBKA 3PIOL 4LJ7A 2EWSA 1BUPA 4DR7M 4M7YA 3WT0A 3U4LA 4BREA 5JLFA 1Q3CA 3TU5A 5FTNA 2KRKA 4BR4A 3A8YA 3QMLA 2QA4N 4M63C 4JKDA 1NHGC 2KXEA 2EA0A 1HKCA 3WHKA 2R45A 3QDKA 4JKGB 1EO1A 5JI2E 3SARA 2Z4RA 5ITTA 1Z05A 2QWMA 5HOOA 3ENOA 3U6LA 4A57A 1X9JA 3VPZA 1BWFO 5AQMA 2L7IA 3DXKB 1XC8A 3RVCA 1Z59A 2R4JA 3GRVA 3VESA 1Q3BA 5JLHA 3TQSA 3MK6A 2QW9A 4ISGA 4AM7A 3SAUA 4DQ8A 2V7ZA 5AQJA 2UXBM 5BN8A 1QHAA 3MCAB 3K92A 3VEXA 2Y0TA 3UJNA 5AZJA 5MLCQ 1IQPA 3DWLA 3U60A 2NRVA 5BPLA 3HKPA 3M0EA 4AKIA 4WQ5C 3DAWA 2ASPA 1Z6RA 2WBNA 4AW4A 3CD6N 4JHDA 5AQLA 3MWPA 3HSCA 4R7GA 1YAGA 3CIPA 3O6WA 3VTIA 1SXJE 4WFBL 5C2DA 3TSPA 4CZJA 2W82A 5BRHA 4BRDA 3A5NC 3HZ6A 3MX2A 1NGHA 5EP4A 2FSJA 2NNWA 1IN7A 3J7AS 4YDUA 4K25A 4OVZA 4YOUA 1IBLM 3ZX2A 3DLLL 3DZDA 3SHGB 2FF3B 3S41A 2HKJA 3KOZE 4ISEA 3GLGB 1TDHA 1IN4A 4DV4M 3U61A 1NJGA 2M5ZA 4A59A 4XH5A 1FJGM 2HHHM 3A5LC 3UKUA 3WUHA 4MH0E 2Q31A 3AL0C 5EXXA 1XMOM 3JR5A 3I8BA 3TSQA 4PT5A 1IN5A 3FZFA 3ZYYX 4GC9A 1QQWA 1LV7A 2HCBA 4IOCL 1K3WA 4A2AA 2CEAA 1VQ5N 2OANA 1JJ2M 2HSTA 2IVOA 1SS6A 1YUBA 4U67L 3Q8XA 2CH5A 1W2BM 4BRQA 2E88A 3VEYA 1DGHB 5KO3A 4L4UA 2YNMD 4JI7M 3VF2A 4NO7A 2ZAOA 5BRFA 4AM6A 1OVYA 3JS6A 3MHVC 1NGDA 1KC8O 4DCHA 3IFRA 4ILJA 3JXUA 3KOYE 3FR0A 1HJOA 4WURA 1L2CA 2KHOA 1QQNA 2CGKA 2Q36A 1N36M 3MCPA 2E2PA 4JKEA 1NSFA 5JVGL 1EQYA 1U2VB 3T69A 3TE6A 4MM3B 3ULEA 2UUBM 3D8BA 3VKGA 3LMMA 3TWKA 4CZIA 5M1NA 4AZFA 1TH4A 1DO0A 4MGHA 3CJCA 4DR5M 2HBMA 4BRPA 2ZAMA 4GVEA 4JKFA 4CZFA 1L1ZA 5AFUA 4BC4A 2QBYA 5C12A 1HQCA 3FFKB 3H4MA 5ITXE 5ITYA 1GLBG 1QAMA 3RSEA 4K0KM 1GLNA 2KKZA 2D0PA 5M1OA 1G3IA 2Z3XA 3CC2N 3FUTA 1NMDA 4BRGA 1QVRA 1RFQA 1YITN 3EZWA 1GLDG 5BN9A 1GLCG 4LJAA 4IBJA 4MGZE 4JD2A 1HR0M 2KZSA 4OW0A 2ZGZA 3UB5A 1N8RO 1VQ9N 3C58A 4PD2A 2HMPA 3P38A 3VEZA 2IVPA 2FFJA 4EHTA 3HOTA 3GRRA 1C0FA 3VEVA 1N33M 2P9NA 4DV1M 2C98A 1NGGA 3RFWA 2YR0A 2R18A 3WEEA 3VF6A 1L2DA 4QNMA 3AY9A 3QB0A 3SJHA 3U9DA 3UKRA 5HL7L 3LDPA 5KQ8A 3FTEA 4JK8A 1L8QA 2QXLA 5JVHL 3MMVA 1IXRC 3E4RA 4C23A 4NLBA 1I4WA 1KD1O 3B8AX 3FD9A 5C18A 3TWMA 2LXEA 2FF6A 4EIAA 1PJJA 1SXJC 3GPYA 1KYIA 3QICA 4CBWA 1E9RA 3E9PA 4H5WA 3PFIA 4IJEA 4JN6A 2YHYA 2K47A 2QWQA 1RDUA 5ITQA 4QS9A 3VK8A 5IT9S 4CZEA 3MWTA 4S12A 4CJ7A 4QHSA 4C1NK 3R8FA 5GIOA 2QWPA 2CE7A 5FPDA 2G8LA 1I94M 1R6BX 1KAZA 5LY3A 3ZEUB 1HKGA 4LY6A 2GWKA 4IJAA 3NBIA 4A61A 4IBIA 2D1KA 3VMFB 3EIHA 3KVWA 3JR4A 3LQQA 3LM9A 3ZH9B 4NLCA 2OQ4A 2P9PA 3ZX3A 1JCFA 3SLCA 2V1UA 3BUZB 4B9QA 5C15A 2YHWA 3CC7N 4JKBA 2CGLA 5GAGP 3PNYA 1LCUA 4YOXA 5M1PA 1IM2A 1J5EM 2DZNB 3TPZA 3J8AA 3LQRA 1DT9A 1VQKN 4IJNA 4BROA 2HF3A 3LDQA 1GLAG 4FCTA 5B8HA 4EHUA 1NGFA 4JI2M 3E1YA 3HRGA 2OTLN 2CUZA 4BB9A 2G5GX 4DV5M 3CJ9A 3O9RA 2Q0RA 2R46A 4GHAA 3UMMA 2ZGYA 3G25A 3A42A 5DYIA 4CD1A 3I4VA 3VLFB 3CJAA 1ATNA 3N4PA 1BDGA 3I55N 2D4WA 4BQLA 2H1RA 2VWBA 3FTCA 3HJ8A 4I4LA 3IDHA 2Q2RA 1YI2N 3CMAN 3U6PA 4B3MM 2P9IA 3CJBA 1YJWN 2YX6A 4RWTA 3VDPA 4FCVA 4JI8M 3FLCO 2CHVA 4FCWA 4JV5M 5F1XA 4KO8A 3VGMA 4NXMM 2CV2A 1IXSB 3T7ZA 5DM6L 3WXJA 2P5TA 1SXJA 3BEXA 3NVKA 3GLHB 1XNQM 4RNAA 4AI6A 5CE3A 1L1TA 4DKWA 1Z5AA 1NVMA 2ZBKB 3D2EB 3SBTA 4GY2B 1BA1A 5EY4A 5AQKA 1Y64A 2A42A 1JR3A 4LGYA 3CF2A 4WFAL 4A62A 4BRAA 2WUSA 4FWLA 3DXMA 1HNWM 5FSWA 4H5NA 5ELZA 3UE5A 4PCZA 4I81A 5AQFA 1XXHA 4H0XB 2FNAA 1QZ6A 1Q81O 2AP1A 4CISA 3J7ZO 4PKGA 3HU1A 3C6HA 2D7EA 4X66M 3KWGA 2HL7A 3K1JA 2GEMA 1ZAEA 4BG9A 2QENA 1K3XA 4JAXA 3BF1A 3RGSA 4LZJA 2F5PA 3WQTA 4H5VA 3F5TA 4JI4M 4A5AA 4BR5A 5EP2A 3SFZA 5EVZA 1DGFA 4NOOB 5FTMA 3GLFA 1PJIA 3E9OA 3SAVA 2R65A 3CCUN 3SASA 4FWPA 3FZHA 1ESVA 1DGKN 4FOIA 2QM1A 2FOIC 3GDQA 3U8XA 1NNJA 2V7YA 1X37A 2P9LB 2L7HA 2HOEA 1Q39A 1EE8A 2W40A 2E2OA 4IBCA 3ATVA 3ID6A 1K8KB 5FPEA 2KEBA 3PLAA 1GVNA 3DFZA 3SAFA 4QS7A 3HHXA 4BG8A 1VQNN 1NWKA 2VGNA 1OJLA 2RKOA 2KLAA 4FWHA 4FVUA 1DGGA 3CCJN 4XBOA 3MN5A 5C2FA 3T1HM 5AQYA 2QCUA 5IREB 5ITXA 1YUWA 3FZKA 3L27A 2F4VM 4BGAA 3CI5A 3W0LB 5AQQA 4DV3M 3HTVA 3CCMN 4GKKM 4FWGA 4FWRA 4G4NA 4EAHD 3PVSA 2OTJN 4JK7A 4YHHM 3FUXA 3VGLA 1NGJA 1KSFX 1R7RA 3CTWB 3KFUG 3R9PA 5JMVA 3SYLA 2BUPA 2IIRA 5AFUH 2F5QA 2XFSA 4KBOA 2QTDA 4W5WA 2DVWB 4DUZM 1TUYA 1HQYE 5BR9A 2DZOB 3J2PB 3FZLA 3ILKA 3A45A 2NQ8C 1U6ZA 4CI6A 3D2FA 2A40A 2Q97A 2A6AA 1S22A 3KDSE 2VYPA 4HWIA 4NSOB 8CATA 4H0TB 3KWIA 4HTLA 4BR0A 3CPWM 3CXCM 1QAOA 4IBEA 4A3VB 2ZM6M 1S3SA 2O5RA 1G4AE 4C1NI 3EN9A 1TYQA 4TUWA 4IJFA 3C7NA 4FWOA 5E84A 1MWKA 3G6EN 1E32A 3CCVN 4DHYA 3K2LA 4QNRA 4NSRA 5FPMA 4LFCM 2X49A 1E9SA 2V51B 2E2QA 5E6JA 1Z5BA 4D82A 2Z7JA 1E4GT 2NRWA 3KOXE 3OBWA 4DR1M 3KXEC 3VFDA 3QAUA 3M1FA 3K9JA 2NRXA 3WHLA 2VIIA 2EUCA 3EO3A 3M5RA 4LG2A 2DWMA 2A3ZA 1TUUA 4B1UB 3ID8A 4FO0A 5ITRA 1XQSC 1L2BA 4BRFA 1WXQA 5GINA 2R62A 4JI3M 4MO4A 3I56N 2VQEM 3O8MA 4JXJA 4QOSA 4WFNL 4BGBA 4CZKA 1GL7A 5F0XA 5AZJB 5AQTA 2QP9X 3U60B 2EO2A 1NGBA 3WQUA 4FL9A 1IN8A 4CZMA 4H03B 1YXQA 4GHLA 3L28A 3L26A 4CZHA 3GQ5A 4BC2A 5LJVA 4DV2M 3HU3A 4BR2A 1WOQA 4K41A 3TPQA 1M1KO 3U5ZA 1YE9A 3VERA 4JHDB 2M60A 1GLEG 4WQ4C 1BO5O 3D7EO 5KPZA 5AR0A 3GLIA 4GITA 4LJ8A 1YIJN 2XGNA 3IKMA 2QEXN 1VQON 1HPMA 3R9XB 1Z6TA 4P16A 4BVPA 2JA2A 1NGAA 3OW2M 4BY9C 1YHQN 4OVZB 1R2YA 5EOYA 2PBDA 2UYTA 4LF7M 1YVNA 2P9UA 4WQ5A 3ZETA 5AQRA 4H0OA 2E1ZA 3U61B 1ILYA 2C9OA 1Q18A 1H1VA 4A2BA 4CZLA 4O8KA 1VDDA 4H0PA 3UKUB 4IDHA 3KSJA 3AGKA 4DV0M 4LFBM 3OA9A 4YOWA 4H5TA 2HBJA 1YJNN 3O4WA 1QZ5A 3L4QA 3QBXA 5AQNA 3H1QA 3CF6E 3L29A 5DNYA 2E20A 3R6MA 5LMUM 2ASMA 1R2ZA 4U7BA 1R59O 1NGCA 3LVVA 2IVNA 4DV6M 4I8OA 1GLFO 4I6MA 3CQXA 3HM8A 3O9QA 1MDUB 2D7HA 1E94E 1HKBA 1Q7YO 3HJQA 4LF8M 3MDQA 1IY0A 4PDIA 2V52B 2Q1NA 1GLJO 1S3XA 4JYAM 3EKUA 1DGBA 3DA1A 3H3OB 3PXGA 3DJCA 2ZANA 3GP1A 3SYKA 3O08A 3ENBA 3TTDA 4DR2M 2CV1A 4D81A 1O13A 3ULEB 3FTDA 1TDZA 1YF5L 4JI1M 5LJWA 4KLNA 3O1BA 3GRYA 3SHFA 3ENHA 2LH0A 3OHRA 4AG5A 2DXIA 2QBYB 5GAHP 1VQPN 1CZAN 4LF6M 5E26A 3WXKA 1NM1A 1M90O 2F9TA 1MWMA 4B7FA 3RSEB 3CCRN 3CQYA 3CF5L 3EL2A 2UXDM 4K42A 1HT2E 1T6CA 4AKGA 2QI2A 3H46O 4B7GA 2P9SA 4IWVA 4M9SA 1KAXA 4JD2B 4WF9L 2Y20A 1C0GA 3HHYA 3D8LA 4YORA 2QWNA 3EKSA 5EXSA 2P9KA 1MU5A 1G41A 4EIWA 3P31A 5FTJA 5C1BA 4M9ZA 4GC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRH A;  2P9N B;  3CET A;  3QBW A;  4BRD A;  3A5N C;  4H5R A;  3HZ6 A;  2GEM A;  1NGH A;  4BG9 A;  3WEE B;  2FSJ A;  4YDU A;  5AQI A;  4JAX A;  3UKR B;  3VEN A;  4K25 A;  3ZEU A;  1ZXO A;  3BF1 A;  4FWM A;  3ZX2 A;  3WQT A;  4H5V A;  2D0O A;  2FF3 B;  3S41 A;  4BR5 A;  4FWK A;  5EVZ A;  4BRH A;  4ISE A;  4NB4 A;  5AQH A;  5AZI A;  1BU6 O;  1IJJ A;  4H0V B;  4BRC A;  3L4I A;  3WXL A;  3W3D A;  4FWP A;  3FZH A;  4B1V A;  1ESV A;  1DGK N;  4FOI A;  4XH5 A;  2QM1 A;  4IXC A;  5BRE A;  3GDQ A;  4H0Y B;  3U8X A;  3A5L C;  3QFP A;  1ATR A;  2V7Y A;  2BTF A;  2VCP A;  3UKU A;  3WUH A;  2Q31 A;  2P9L B;  3I8B A;  1T6D A;  4L3Q A;  2HOE A;  2W40 A;  2FSK A;  3FZF A;  2E2O A;  1RDW X;  2FLO A;  3ATV A;  5FPE A;  1K8K B;  3H6E A;  4A2A A;  2OAN A;  4QS7 A;  2IVO A;  4BG8 A;  4MLH A;  1NWK A;  2CH5 A;  3GG4 A;  4BRQ A;  2E88 A;  3VEY A;  3MN5 A;  3VF2 A;  4NO7 A;  3GOI A;  5BRF A;  4AM6 A;  4BR9 A;  5AQY A;  3JS6 A;  1NGD A;  3ZX0 A;  1HLU A;  3IFR A;  4DCH A;  1X3M A;  3JXU A;  1V4T A;  3GBT A;  1YUW A;  3FR0 A;  3FZK A;  1ZBS A;  1HJO A;  2KHO A;  4BGA A;  1QQN A;  2CGK A;  3CI5 A;  2Q36 A;  4ISF A;  1SZ2 A;  3MCP A;  1WUA A;  5AQQ A;  2E2P A;  3HTV A;  4FWR A;  2YCH A;  3L0Q A;  1J6Z A;  3M3Z A;  4EAH D;  5AQW A;  4EFH A;  1EQY A;  1U2V B;  2P9S B;  2DPN A;  3VGK A;  3FE1 A;  3VGL A;  3ULE A;  1NGJ A;  2P9U B;  3SK3 A;  3ZET B;  1D4X A;  4CZI A;  3R9P A;  2YJF A;  4BVO A;  1SAZ A;  1KAY A;  3M6G A;  5JMV A;  1SQK A;  4BRM A;  2BUP A;  2IIR A;  5AQG A;  5AFU H;  2P9P B;  4O5F A;  2AA4 A;  1DKG D;  3CJC A;  4KBO A;  3LDO A;  4BRP A;  1P8Z A;  4WQ4 A;  4CZF A;  5AFU A;  1TUY A;  4BC4 A;  5BR9 A;  3DXK A;  3P4I A;  3BP8 A;  2PAV A;  4GNI A;  5KPR A;  1RGI A;  4WYB A;  3FFK B;  3CJ1 A;  3FZL A;  3VEO A;  1U6Z A;  2HF4 A;  4CI6 A;  1GLB G;  3D2F A;  2A40 A;  2Q97 A;  3I33 A;  3RSE A;  5TKY A;  2A6A A;  5FPN A;  4FSV A;  1S22 A;  3L6Q A;  5AQU A;  2D0P A;  2VYP A;  3D2E A;  4HWI A;  1IG8 A;  4IZ9 A;  3C0B A;  4H0T B;  3H3N O;  1NMD A;  4HTL A;  4CZG A;  4BR0 A;  4BRN A;  4BRG A;  3IUC A;  1RFQ A;  3EZW A;  4FWS A;  4PKH A;  4I6M B;  1GLD G;  5BN9 A;  1GLC G;  2W41 A;  3EN9 A;  4JD2 A;  1ZC6 A;  1TYQ A;  2ZGZ A;  5AQS A;  5EXW A;  3AAQ A;  3C7N A;  3UB5 A;  4FWO A;  5E84 A;  2Q0U A;  1MWK A;  2A5X A;  4B1X B;  3FGU A;  2GWJ A;  4DHY A;  4BRI A;  2HMP A;  2CGJ A;  2IVP A;  1NLV A;  1QQO A;  5FPM A;  3VEZ A;  4EHT A;  1C0F A;  5BRD A;  2QWR A;  3LDL A;  3VEV A;  3MN7 A;  2V51 B;  2E2Q A;  3VEW A;  2P9N A;  1NGG A;  5F2R A;  3CJ7 A;  1NGI A;  1HX1 A;  3WEE A;  3VF6 A;  2P9I B;  3AY9 A;  1E4G T;  3QB0 A;  4BC3 A;  3SJH A;  5KQD A;  3U9D A;  3UKR A;  2ITM A;  2NLX A;  3LDP A;  5KQ8 A;  3M1F A;  4FPB A;  5KPT A;  2QXL A;  4CD3 A;  3LM2 A;  2H3G X;  2YI1 A;  3EO3 A;  3MMV A;  1XC3 A;  2A3Z A;  1TUU A;  4C23 A;  4BR7 A;  4Z94 A;  4B1U B;  3ID8 A;  4FO0 A;  1XQS C;  3LL3 A;  4BRF A;  3B8A X;  4BRL A;  4B1W B;  4MO4 A;  2A41 A;  4RCH A;  5ADX H;  3O8M A;  2FF6 A;  3R8E A;  4EIA A;  4F9O A;  4BGB A;  4FWN A;  3QIC A;  4CBW A;  5ADX A;  2P9L A;  4H5W A;  1HUX A;  4JN4 A;  4CZK A;  3A0I X;  5F0X A;  5AZJ B;  3IMX A;  3U9Z A;  5AQT A;  1NGB A;  3WQU A;  4FL9 A;  1K8K A;  3CHW A;  2YHY A;  4CZM A;  4PL8 A;  2QWQ A;  1DEJ A;  4H03 B;  1YXQ A;  2GUP A;  4CZH A;  4BC2 A;  3DXM B;  5LJV A;  4B1Y B;  4QS9 A;  4BR2 A;  1WOQ A;  2ZWH A;  3A5O C;  4K41 A;  3TPQ A;  2FSN A;  3MN9 A;  4BQZ A;  4MLE A;  3MN6 A;  3VER A;  1KXP A;  4JHD B;  1GLE G;  4CZE A;  4WQ4 C;  1BO5 O;  3WXI A;  3D7E O;  2P9K B;  1BG3 A;  5KPZ A;  5AR0 A;  4CJ7 A;  2NRH A;  2I7N A;  2QWP A;  2E1Y A;  5FPD A;  4MO5 A;  1E4F T;  4FPA A;  3VET A;  1JCG A;  1HPM A;  4K43 A;  4RTF D;  3W0L A;  3HI0 A;  4BVP A;  1NGA A;  1BA0 A;  2E2N A;  1KAZ A;  4B1Z A;  5LY3 A;  2CH6 A;  2GEL A;  3ZEU B;  2FXU A;  2NZT A;  1HKG A;  5EOY A;  1U2V A;  2GWK A;  4IJA A;  2ZF5 O;  2PBD A;  4A61 A;  2D1K A;  2UYT A;  4YDU C;  1YVN A;  3CER A;  4LC9 B;  2P9U A;  4WQ5 A;  5AQV A;  3ZET A;  5AZI B;  5AQR A;  4XH4 A;  4H0O A;  3LM9 A;  3H1V X;  2E1Z A;  1NGE A;  3H45 C;  2P9P A;  4IO8 A;  1Q18 A;  3ZX3 A;  1JCF A;  4XEI A;  3SLC A;  3KVG A;  4XH1 A;  3BUZ B;  4B9Q A;  1H1V A;  2YHW A;  4A2B A;  4O8K A;  4CZL A;  4PKI A;  3VF4 A;  2CGL A;  4H0P A;  3F9M A;  3UKU B;  1LCU A;  1GLL O;  2GTD A;  5AQZ A;  4E1J A;  3J8A A;  1T44 A;  4H5T A;  4FWQ A;  4J8F A;  3O4W A;  2I7P A;  1G99 A;  1QZ5 A;  3QBX A;  4IJN A;  5AQN A;  4BRO A;  3H1Q A;  2HF3 A;  3LDQ A;  1GLA G;  3BF3 A;  4CBU A;  5B8H A;  2E20 A;  3R6M A;  2ASM A;  3O5B A;  1MA9 B;  4DB3 A;  4BRK A;  4EHU A;  1R59 O;  1NGF A;  1NGC A;  4QS8 A;  5JIC A;  5AQP A;  2IVN A;  4Y0W A;  1GLF O;  3KZB A;  2F9W A;  2QWO A;  3CJ9 A;  3CQX A;  3HBT A;  1MDU B;  3HM8 A;  4I6M A;  5AQX A;  2YHX A;  2Q0R A;  1HKB A;  4PL7 A;  2ZGY A;  2EWS A;  3G25 A;  3MDQ A;  1BUP A;  4CD1 A;  2V52 B;  5EX5 A;  4M7Y A;  2Q1N A;  1GLJ O;  3CJA A;  3WT0 A;  1ATN A;  1S3X A;  1BDG A;  3EKU A;  3U4L A;  4BRE A;  5JLF A;  3TU5 A;  2D4W A;  3O1W A;  3H3O B;  4BQL A;  4BR4 A;  2VWB A;  1OKJ A;  3DJC A;  5BPN A;  3A8Y A;  3QML A;  4M63 C;  1NBW A;  3FZM A;  3O08 A;  1HKC A;  3IDH A;  2Q2R A;  3QDK A;  3ULE B;  3CJB A;  2P9I A;  3LDN A;  4RWT A;  4CBX A;  3FLC O;  5LJW A;  1Z05 A;  2QWM A;  3O1B A;  2E8A A;  3ENO A;  5I9E B;  3ENH A;  1X9J A;  5F1X A;  3VPZ A;  1BWF O;  5AQM A;  3GE1 A;  3OHR A;  3VGM A;  3SMP A;  2QWL A;  3DXK B;  3SMS A;  2YJE A;  3GL1 A;  3QFU A;  1CZA N;  3VES A;  5E26 A;  2ASO A;  3WXJ A;  3WXK A;  1NM1 A;  5JLH A;  3BEX A;  3MK6 A;  2QW9 A;  4ISG A;  4AM7 A;  5BPM A;  4DQ8 A;  2F9T A;  5CE3 A;  3D2F B;  1JCE A;  1MWM A;  3VOV A;  3RSE B;  2V7Z A;  1XUP O;  3AAR A;  3KHY A;  5AQJ A;  1BOT O;  3CQY A;  3D2E B;  3EL2 A;  1QHA A;  2J4R A;  5BN8 A;  4GY2 B;  1BA1 A;  4JNE A;  5EY4 A;  3VEX A;  4K42 A;  3ATU A;  3A5M C;  5AZJ A;  4M7X A;  1V4S A;  1T6C A;  5AQK A;  3DWL A;  4BC5 A;  1X3N A;  3H46 O;  1Y64 A;  5BPL A;  2A42 A;  2P9S A;  4IWV A;  1KAX A;  3AAP A;  1QQM A;  4JD2 B;  4WQ5 C;  4A62 A;  1TYQ B;  2WUS A;  4BRA A;  4FWL A;  5AQO A;  3DXM A;  3DAW A;  2ASP A;  1C0G A;  3C7N B;  1Z6R A;  4H5N A;  5ELZ A;  1LOT B;  3UE5 A;  2QWN A;  3EKS A;  5AQF A;  4JHD A;  5AQL A;  4H0X B;  1QZ6 A;  3HSC A;  1YAG A;  2AP1 A;  3CIP A;  4FOE A;  3O6W A;  2P9K A;  1ATS A;  4PKG A;  3O80 A;  4CZJ A; 
#chains in the Genus database with same CATH topology
 1PJS A;  4B9S A;  2P9N B;  3CET A;  3QBW A;  3LP0 A;  5HRO A;  4WP2 A;  4H5R A;  2BWB A;  3VK7 A;  2P51 A;  3WEE B;  4YOV A;  1XHB A;  2XSZ D;  4ZTJ A;  4CK2 A;  2YQZ A;  4BE1 A;  3KTQ A;  3VEN A;  3UKR B;  5CR4 A;  4RF1 A;  4Q7J A;  3ZSQ A;  1REV A;  3I0R A;  5EP1 A;  3QO9 A;  3U6Q A;  3AVM A;  3AOE C;  2ERC A;  3CG7 A;  4NRW A;  4HTU A;  2X6N A;  1P90 A;  1Y97 A;  4BRH A;  4FJ8 A;  1VRT A;  2DWL A;  3V4I A;  5AZI A;  3B6O A;  1JLF A;  2UUA M;  1BU6 O;  4H0V B;  3AA4 A;  3L4I A;  3VTH A;  2Z4S A;  3BOS A;  3JAM O;  1VQ6 N;  3OBY A;  3WXL A;  1OH7 A;  3W3D A;  3GRU A;  4ILH A;  4QOZ C;  5CYQ A;  4B8A B;  4LJ6 A;  4ANR A;  2V6Z M;  4DUY M;  1HNV A;  3U6D A;  2DAE A;  5GKN A;  4IXC A;  4WE1 A;  5BRE A;  3HHZ A;  1DO2 A;  4H0Y B;  1X9S A;  2DY4 A;  4I2P A;  3THW B;  3G0Z A;  1ATR A;  2KNA A;  2ZJP L;  2J7N A;  1QSS A;  2JLE A;  3QIN A;  4M3U A;  1T6D A;  3AFH A;  2WTU A;  4LRT A;  2XH9 A;  3Q7B A;  1N32 M;  1BHL A;  3DLE A;  1BI4 A;  4F3T A;  3HX3 A;  4DSE A;  3H6E A;  2Q2E B;  4JI6 M;  3NE6 A;  3SZ2 A;  1X1P A;  4MLH A;  1QZM A;  1T43 A;  4MDB A;  4UY8 O;  4O4G A;  3HHW A;  1RDB A;  4CFB A;  3EEQ A;  1TK0 A;  4E1N A;  2BH1 A;  1G8P A;  2ZQB A;  1TKX A;  3C6A A;  3GO8 A;  4GEW A;  3GOI A;  1Z25 A;  3ZCM A;  3ZX0 A;  3AO3 A;  4DU3 A;  4IBF A;  2X74 A;  1V4T A;  1IY1 A;  3HOS A;  4DTU A;  4Z6Y A;  1ZBS A;  2WZJ A;  3KW6 A;  3AGR A;  4B3S M;  4ISF A;  3FUW A;  5DYG A;  3AVB A;  1T05 A;  4PQU A;  1WUA A;  3E66 A;  3PX6 A;  1J5E K;  1NO1 A;  3VQA A;  3QEV A;  1WB9 A;  2YCH A;  3L0Q A;  1R4G A;  4EFH A;  2KA6 B;  2P9S B;  4LY7 A;  2DPN A;  4B08 A;  2YFQ A;  1VSM A;  4JKG A;  1Q82 O;  3FE1 A;  4PY5 A;  4BE2 A;  4PDG A;  1KQS M;  4X65 M;  4DQP A;  3SK3 A;  1D4X A;  3CME N;  5E41 A;  4M45 A;  2KZU A;  5HLF A;  2YJF A;  1DTQ A;  3O4N A;  1TKT A;  1SAZ A;  5LMN M;  2N35 A;  3FKE A;  3M6G A;  4BVO A;  4JI2 K;  4Z4F A;  4BRM A;  3K5O A;  3LAK A;  1VSF A;  4CGY B;  2C5R A;  4ZPX A;  2P9P B;  4O5F A;  4N47 A;  1P8Z A;  1BCM A;  1KVA A;  4G3O A;  1PM5 A;  3DXK A;  5HBM A;  1RDC A;  3BP8 A;  4GNI A;  4EP5 A;  4W5O A;  3HJS A;  1RGI A;  3OYG A;  1NK4 A;  3CJ1 A;  3RMA A;  4LJ9 A;  1K8A O;  2O4I A;  2BNK A;  4DMN A;  3J7A P;  4YOT A;  2FBY A;  4B9U A;  4ELU A;  4G6Z A;  3B9P A;  4OU7 A;  3IRX A;  1HNX M;  2DAK A;  3TWL A;  3AVK A;  3L2R A;  2WC9 A;  2YKM A;  1IG8 A;  3C0B A;  2CV0 A;  3H3N O;  3K9K A;  4DTN A;  4CZG A;  4BRN A;  4FJ7 A;  1NY5 A;  3P39 A;  3OYE A;  3IUC A;  4L16 A;  4PKH A;  1C1B A;  4EZ9 A;  4BWM A;  4FJ5 A;  4JI8 K;  2Y1I A;  2YNI A;  4XGI A;  3M6A A;  4LRS A;  3ISN C;  4II7 A;  3IHP A;  1JQJ C;  4ID5 A;  4JV5 K;  2F96 A;  2JWL A;  3HPO A;  5AQS A;  3HO1 A;  2JWS A;  3AAQ A;  1PRB A;  4NXM K;  1ZQ9 A;  4IG0 A;  2Q0U A;  3V81 A;  2A5X A;  3MEG A;  2KW0 A;  3FGU A;  4OGC A;  1S1W A;  3NAE A;  1VQM N;  2GWJ A;  4B3S K;  3THX B;  2A5Y B;  2R4E A;  3U6E A;  1QDR A;  2CGJ A;  3O9T A;  3PSI A;  1QQO A;  3J80 O;  1C7Y A;  1XNQ K;  3TWH A;  3GLH E;  4CEC A;  3SC3 A;  3O3H A;  3MN7 A;  1C1K A;  3U6C A;  3K5M A;  1OFH A;  3HXM A;  1RTJ A;  5F2R A;  1JLC A;  4CGI A;  3EE8 A;  4GV3 A;  3B7N A;  1HX1 A;  2QQ8 A;  2VF7 A;  2P9I B;  4BC3 A;  1TTE A;  1RDA A;  4FLW A;  1GJT A;  2J7O A;  1YLA A;  2KZM A;  2BJV A;  1UWB A;  1OFI A;  3AVA A;  3WXM B;  4R3D A;  3C65 A;  3J81 O;  4CD3 A;  2EHG A;  3VQP A;  4O0J A;  2HND A;  4B7H A;  4HL4 A;  3L8B A;  3AKZ A;  1NKE A;  3LM2 A;  2H3G X;  5FLX O;  2HBL A;  2NRT A;  2JUJ A;  5H1S Q;  3GLG A;  1XC3 A;  7CAT A;  3UZU A;  1HNW K;  3NWL A;  1SXJ B;  3DOL A;  4IFE A;  4N56 A;  1KFV A;  2JY8 A;  3LL3 A;  4BRL A;  3CC4 N;  3HGI A;  3DYA A;  4B8C A;  2G8H A;  4FW2 A;  4E0D A;  2A41 A;  4RCH A;  3F73 A;  3AVJ A;  1UA1 A;  3ZT3 A;  1J5O A;  3R8E A;  4F9O A;  1Q9Y A;  4FWN A;  1NKC A;  5ADX A;  3LP1 A;  2LVN C;  4IEE A;  4CJT A;  1TH2 A;  4IFV A;  1GOC A;  3HZJ A;  1QAN A;  3I51 A;  1HUX A;  4JN4 A;  1S1X A;  4DG1 A;  4L8R C;  4X66 K;  4KHU A;  4M0W A;  4KAZ A;  3G4S N;  4CER A;  1QAQ A;  3CHW A;  1N77 A;  3R1X A;  5CHI A;  2CFO A;  4PL8 A;  1DEJ A;  4IBB A;  3CQ8 A;  1XWI A;  1OH6 A;  2FH0 A;  4L15 A;  1IKY A;  3DXM B;  4JI4 K;  3NCI A;  1VQ8 N;  2O8D A;  4OX9 M;  3CCL N;  1DGH A;  2LWX A;  3RR8 A;  2FSN A;  3A46 A;  3MN9 A;  4E3S A;  4MLE A;  1WNS A;  2GX9 A;  1XXH B;  2Z1I A;  1CXQ A;  3ZSX A;  1NJW A;  3I04 M;  3G71 N;  4MQ3 A;  1BIS A;  1BG3 A;  3R3L A;  4IO9 L;  3PO4 A;  1NG9 A;  4FJX A;  2LVQ D;  5BPV A;  4AF1 A;  2NRH A;  3GPX A;  2NRR A;  2HBK A;  2I7N A;  4ITQ A;  3E9L A;  3V9U A;  2E1Y A;  1NJF A;  3VET A;  1E4F T;  4CEA A;  1IXZ A;  3K0S A;  2KRU A;  4K43 A;  4RTF D;  2J5Y A;  4KH4 A;  5TKW A;  3HI0 A;  1NHW C;  4FLY A;  2XZF A;  3QET A;  4KH5 A;  5GAD P;  4B1Z A;  2CH6 A;  2GEL A;  1B9D A;  3LVW A;  3FUU A;  3GPU A;  4FLZ A;  4BBA A;  2JP7 A;  1U2V A;  5JI3 E;  5M1K A;  1YTA A;  3AVI A;  1ZBF A;  5A2Q O;  3CER A;  4LC9 B;  5HRS A;  4DV7 M;  5AQV A;  4X62 M;  2OZS A;  4XH4 A;  3GQ4 A;  3GLF B;  5EXT A;  3AO4 A;  4IO8 A;  1NOZ A;  3T1H K;  1VSD A;  4XH1 A;  1ZMW A;  3FTF A;  4CHZ A;  4B3R M;  2QPA A;  4LF9 M;  4CJK A;  2A1S A;  4CIZ A;  3W68 A;  3SCX A;  1XHX A;  1WGN A;  1VHX A;  1IY2 A;  1TGU A;  2GTD A;  3U6S A;  3TTF A;  1IBM M;  5FRM A;  5AQZ A;  2QHO B;  4E1J A;  2F4V K;  1T44 A;  4G9Z A;  4FWQ A;  1FNN A;  4IKF A;  3J27 B;  3SQ4 A;  1EET A;  2ZJQ L;  2I7P A;  1G99 A;  1XMQ M;  4D80 A;  2D0C A;  2RGH A;  4DV3 K;  2WFB A;  4GKK K;  4PHT X;  3FYD A;  4CBU A;  3KD1 E;  4GH9 A;  4DF4 A;  3FRI A;  4AG6 A;  3Q7C A;  4HEO A;  3O5B A;  1MA9 B;  1RT7 A;  3J7B A;  1WAF A;  3L3V A;  4BRK A;  4JI5 M;  4DB3 A;  4M9X A;  1CZ9 A;  3JAM S;  4QS8 A;  2E5L M;  4Y0W A;  4OX9 K;  5ITU A;  3WNE A;  4LFA M;  2KDL A;  3ZT4 A;  1QSY A;  5AQX A;  2YHX A;  3ZCB B;  4FM0 A;  2X8A A;  2B6A A;  4PL7 A;  1K9M O;  2O4G A;  1OIZ A;  4LGM A;  4KV8 A;  2C96 A;  3RE8 A;  3W67 A;  3HYF A;  5EX5 A;  4G4Q A;  4DUZ K;  3LP2 A;  4J2B A;  1WR1 B;  4KH6 A;  2IOC A;  3EYZ A;  4F4K A;  3U6M A;  3O1W A;  3DLH A;  2JZ1 A;  4ID1 A;  1OKJ A;  1ASU A;  3ZSV A;  1I3A A;  5BPN A;  1TKD A;  3OYM A;  4B9T A;  4DTR A;  1NBW A;  3FZM A;  3OS2 A;  3SAT A;  3OJU A;  1YJ9 N;  1VAZ A;  4RF0 A;  2BDP A;  2KNV A;  3PO5 A;  4FD2 A;  1L3V A;  3LDN A;  4CBX A;  3T15 A;  4NL4 H;  4B3T M;  1K73 O;  2F8T A;  3RGP A;  3KS4 A;  2E8A A;  3SBG A;  2ZM6 K;  3VN5 A;  4LJ4 A;  5I9E B;  3F2K A;  4CIG A;  1WBD A;  3C3D A;  1LAV A;  3AJI B;  3GE1 A;  1YSY A;  3SMP A;  4BLC A;  2QWL A;  5DK5 A;  4HUF A;  3KSX A;  3SMS A;  3QNN A;  3EIE A;  2YJE A;  1HNZ M;  3GL1 A;  3QFU A;  1QS4 A;  4LF9 K;  2F8S A;  2ASO A;  3D6R A;  1GKI A;  5DMR A;  5BPM A;  4CIE A;  4EZ6 A;  3D2F B;  1JCE A;  3BZK A;  1XWL A;  3VOV A;  4JKH A;  4RW9 A;  1RU3 A;  3HVT A;  1RBR A;  1XUP O;  2LNH C;  4CHT B;  2VG7 A;  3AAR A;  2Y21 A;  2PFU A;  3KHY A;  1BOT O;  2AHM A;  4WW0 A;  2FE8 A;  3I4Y A;  3GQ3 A;  4O8U A;  4Z0U A;  2J4R A;  1D9D A;  4FJG A;  4JNE A;  2L6O A;  3ATU A;  4CED A;  2DWN A;  1NNU C;  3LCV B;  3A5M C;  4M7X A;  1V4S A;  3TAB A;  5IZ7 D;  4JI5 K;  3UGJ A;  4BC5 A;  1JLE A;  1X3N A;  5FDL A;  2L4F A;  1HMV A;  3NMU A;  4CW7 B;  4LSN A;  5GAE P;  1XI1 A;  1W5S A;  2P1J A;  1IKX A;  1QQM A;  3AAP A;  3HVR A;  4CF2 A;  1TYQ B;  1H6U A;  5AQO A;  4NXN M;  1JXB A;  3VKH A;  3C7N B;  3FUV A;  5IWA M;  3FE3 A;  1LOT B;  4GMQ A;  1XNR M;  2XZU A;  4OKJ A;  4CES A;  4FOE A;  2CHG A;  4FWD A;  5EP3 A;  4MGY E;  1ATS A;  3ZSR A;  1TAQ A;  2E6M A;  4JI3 K;  3O80 A;  2C9C A;  1IKW A;  2VQE K;  4IOA L;  4DR4 M;  2QXF A;  4IEI A;  5GIP A;  2QKK A;  5CY4 A;  1MX0 A;  1ZV1 A;  3U6O A;  3E46 A;  3VQC A;  1ZYQ A;  2V1C A;  1DV0 A;  2G8I A;  1VSE A;  1NV8 A;  5AQI A;  2APL A;  3ZEU A;  4W5T A;  1ZXO A;  4FWM A;  4NC6 A;  3ASM A;  2D0O A;  4F2L A;  3KIO A;  1MN3 A;  5L8R F;  4M0D A;  1ORY B;  4MGI E;  4FWK A;  4OPA A;  3TAP A;  5M1F A;  4G4O A;  3CPE A;  4LF4 M;  4NB4 A;  5AQH A;  3E9S A;  3T1Y M;  2D7G A;  3M7G A;  3MX5 A;  1IJJ A;  3EE9 A;  4CFD A;  4DV2 K;  3THG A;  1WHC A;  4BRC A;  3SBJ A;  3T38 A;  3OS0 A;  2RRU A;  2KZZ A;  2O25 A;  3J80 S;  4CGG A;  4B1V A;  3CM6 A;  2ZD1 A;  3ZSY A;  2HWJ A;  1Y8G A;  2UUC M;  4CGD A;  3QWL A;  3HU2 A;  5FTK A;  3NVM A;  4DLE A;  4DR6 M;  3QFP A;  4YOY A;  2E6L A;  2GUI A;  4KHQ A;  2L09 A;  3N4Q A;  2OPQ A;  2BTF A;  2VCP A;  3DOA A;  1WSG A;  1OAI A;  2NRZ A;  1T6O A;  5EQT A;  1CZB A;  1XC9 A;  4L3Q A;  4LZZ A;  2F5S A;  4CHO A;  3VQB A;  1NNE A;  2QZ4 A;  2FSK A;  4FW1 A;  1RDW X;  3IG5 A;  5KRT A;  4JK9 A;  2FLO A;  3KJV A;  4N41 A;  3J81 S;  4DWI A;  4FJM A;  5H37 D;  4NCG A;  1CXU A;  5F3W A;  1KFS A;  4DSL A;  2LVA A;  1YT3 A;  2C99 A;  1WSF A;  4PA1 A;  5FLX S;  3GG4 A;  3VQ6 A;  3VDU A;  4LF7 K;  3QIP A;  2F7T A;  1T3T A;  4OLB A;  3CCS N;  3L25 A;  2ZJR L;  4NXN K;  1HT1 E;  3ZC7 B;  4MB7 A;  3TL4 X;  1NK8 A;  2OPF A;  3U5Z B;  4O0I A;  4CEE A;  4JI0 M;  4A5B A;  2XLJ A;  3AV0 A;  3EY1 A;  4BR9 A;  5BR8 M;  4OGE A;  1HLU A;  3GLI B;  2UU9 M;  4E7J A;  5FTL A;  1X3M A;  3GBT A;  5SWM A;  4FCY A;  4NYF A;  3LAL A;  1IH7 A;  1T3V A;  2KFZ A;  1V33 A;  1ZBU A;  1NY6 A;  4H4O A;  1SZ2 A;  4J2E A;  3F9K A;  5LL6 Z;  3DLG A;  3VA0 A;  1NJI O;  3AVC A;  4DV0 K;  4LFB K;  4RKU F;  2RE2 A;  2B5J A;  4HVJ A;  1D2N A;  1J6Z A;  2YNG A;  3M3Z A;  2L4E A;  5AQW A;  4CHQ A;  3KS8 A;  1BQM A;  1VQ4 N;  4IBD A;  2O8C B;  2KW4 A;  3VGK A;  3KLG A;  4GV6 A;  3KP0 E;  4G4R A;  2DHR A;  3SAH A;  3SI6 A;  2P9U B;  1A5X A;  3AA5 X;  3ZET B;  5LMU K;  4CF1 A;  4GRI A;  4GV9 A;  2LTU A;  3FYC A;  1KAY A;  1SQK A;  1FW6 A;  5AQG A;  4DV6 K;  4OKE A;  5KTQ A;  2AA4 A;  5HRN A;  2OO9 A;  1EIJ A;  1DKG D;  2WOM A;  3LDO A;  4FW9 A;  2D0A A;  4WQ4 A;  2UUC K;  3LAM A;  5C0Y A;  1SXJ D;  4LF8 K;  3P4I A;  2IAJ A;  4FVM A;  2PAV A;  3TTC A;  5KPR A;  4LH5 A;  4WYB A;  1IXS A;  1C0U A;  4I5S A;  1NOY A;  1RT2 A;  3VEO A;  2HF4 A;  3V9X A;  3GLH A;  1UM8 A;  3O9S A;  2ZE2 A;  4JLH A;  3SAG A;  4ILG B;  4JYA K;  1K82 A;  3I33 A;  3U3Y A;  4X64 M;  5TKY A;  4NRV A;  5FPN A;  4FLX A;  2DTU A;  3KK7 A;  4FSV A;  3HJF A;  3L6Q A;  3DRS A;  4OO1 J;  5AQU A;  2VQF M;  1QDT A;  4JS4 A;  5DM7 L;  3V1Q A;  5A2Q S;  3D2E A;  4IZ9 A;  3TSU A;  1RBU A;  5CZ1 A;  3WNF A;  2G8K A;  3GPP A;  3OTO M;  3S3N A;  1N34 M;  2BJW A;  4N5S A;  4DR2 K;  4AHR A;  1S6P A;  2HB5 A;  5EJC A;  1JR3 D;  1VQ7 N;  4B9M A;  1TF0 B;  4FWS A;  3LZJ A;  2UXC M;  4I6M B;  3KK1 A;  4BDZ A;  4L78 A;  4JI1 K;  5HRP A;  4JKC A;  2LHG A;  2Y1J A;  2W41 A;  3CYM A;  4JI0 K;  1QYR A;  2GBZ A;  3MED A;  3L2A A;  3SV4 A;  1ZC6 A;  2HHX A;  3K8Z A;  2K9D A;  3IAY A;  5EXW A;  3V6D A;  2F5O A;  3AV9 A;  3CCE N;  2YKN A;  5M1Q A;  1VQL N;  2CP8 A;  4B1X B;  1NKB A;  2A1R A;  4LF6 K;  3CF0 A;  2F5N A;  1FKO A;  4BRI A;  4GIP A;  1LWE A;  1NLV A;  1V92 A;  4CE9 A;  3CFO A;  5BRD A;  2QWR A;  2VF8 A;  3LDL A;  4GKJ M;  3VEW A;  4CF0 A;  3ZSO A;  3RMB A;  3SUP A;  3CJ7 A;  1NGI A;  3T6P A;  4KKO A;  1TH3 A;  2E4L A;  4AKH A;  2UXD K;  4GMJ B;  1GL6 A;  3O9U A;  3O3F A;  5KQD A;  1N78 A;  2G8F A;  3K5L A;  3T3F A;  2DWZ B;  3VA3 A;  1TVR A;  2NLX A;  4RW6 A;  2ITM A;  4FPB A;  5KPT A;  2X6S A;  1J09 A;  4IOX A;  4IFY A;  3VQE A;  4K8X A;  4H8K A;  3W0F A;  2DZL A;  3ZT0 A;  2YI1 A;  3PIP L;  4LJ5 A;  4DU4 A;  2HHQ A;  1A5T A;  3MXM A;  1WIV A;  1T03 A;  4BR7 A;  4Z94 A;  3SAW A;  3KLI A;  2XF3 A;  1S5J A;  2O8B A;  1HJP A;  4CJ5 A;  3SQ0 A;  2WSF F;  3KP1 E;  4B1W B;  3ULD A;  1Q86 O;  4QHT A;  3QEW A;  4C8K A;  1VEG A;  5ADX H;  4X64 K;  4JKA A;  3VQ4 A;  1IN6 A;  5EXP A;  4FK0 A;  1N75 A;  3HY5 A;  4Z8X A;  2P9L A;  3NGI A;  3CCQ N;  1WSI A;  3A0I X;  1N34 K;  3IMX A;  3U9Z A;  1WLJ A;  1W97 L;  2FBT A;  5C42 A;  1K8K A;  4MDA A;  1GOB A;  4LCB A;  2MJ5 B;  1RBT A;  3A98 B;  1GAB A;  4I9L A;  2GUP A;  1IBK M;  4AHT A;  1L5U A;  1AUA A;  4OJR A;  4B1Y B;  4E7H A;  2ZWH A;  3A5O C;  2RHK A;  4BQZ A;  4KHP M;  2PY5 A;  3MN6 A;  4REZ A;  2UUA K;  1KXP A;  4KHY A;  3WXI A;  1Q9X A;  1QVG M;  2P9K B;  4HUE A;  3OYF A;  1Z5C A;  2KTQ A;  4DUY K;  1NMN A;  4CHN A;  2XFT A;  2EJS A;  4MO5 A;  3KOW E;  4FPA A;  1JCG A;  2OPS A;  4R5P A;  4R79 A;  3W0L A;  4IBG A;  4C8O A;  5J2M A;  1BA0 A;  1RT5 A;  2E2N A;  2Y0Q A;  3I8D A;  1QUS A;  4LF5 M;  3MJ5 A;  2FXU A;  2NZT A;  1N32 K;  2XSZ A;  4OPH A;  2CHQ A;  1L3S A;  4FZY A;  3S9H A;  2ZF5 O;  4KO0 A;  2JWK A;  4JI6 K;  4KOD A;  4LSL A;  4FJJ A;  1C1C A;  4YDU C;  2HHS A;  3OYK A;  4Z4I A;  3VQ5 A;  4Z4E A;  5AZI B;  1NJZ A;  4J2A A;  3H1V X;  1NGE A;  3HWS A;  3UK6 A;  4AQY M;  1UOC A;  4IDK A;  1S72 N;  3KLE A;  3DRP A;  3H45 C;  2DAG A;  4JEP A;  4F8R A;  3PNV A;  1I39 A;  2X4A A;  4QCL A;  4XEI A;  3KVG A;  4ELV A;  4MGK E;  4PKI A;  3VF4 A;  4NCA A;  3L2U A;  3F9M A;  1OKS A;  2RGO A;  1KLM A;  3DLB A;  1GLL O;  2IS3 A;  3IG8 A;  5C10 A;  1VG5 A;  4YY3 M;  1BIU A;  1QVF M;  1R5L A;  1JL2 A;  4J8F A;  4DR3 M;  3LCU A;  1BI4 B;  2VGM A;  3SPY A;  4WCE L;  1CUK A;  2QNJ A;  1QQC A;  2ETJ A;  3AOG A;  3BF3 A;  2O8F A;  3HPG A;  2XEP A;  1G59 A;  1W5T A;  1PJT A;  3AOE A;  2GQF A;  4HLQ A;  3NBX X;  5JIC A;  4CFA A;  4X65 K;  5AQP A;  4E7L A;  4IIW A;  3KZB A;  4CGF A;  2F9W A;  2QWO A;  3HBT A;  5HP1 A;  5LMN K;  4F1I A;  1J7K A;  4IBK A;  2VG5 A;  3HL8 A;  3PIO L;  4YFU A;  2EKK A;  4LJ7 A;  1PGY A;  2EWS A;  1B9F A;  1BUP A;  4DR7 M;  2DAM A;  4M7Y A;  1W9H A;  1VSK A;  3WT0 A;  3U4L A;  3LPU A;  4BRE A;  5JLF A;  3G10 A;  1Q3C A;  3TU5 A;  3L3U A;  2HHU A;  5FTN A;  2KRK A;  4BR4 A;  3A8Y A;  3OYI A;  4FJI A;  3QML A;  4GW6 A;  4YNQ A;  2QA4 N;  4M63 C;  4JKD A;  1NHG C;  3V1R A;  2KXE A;  1DLO A;  2EA0 A;  1HKC A;  3WHK A;  1HNX K;  1FK9 A;  2R45 A;  3QDK A;  4JKG B;  3V9W A;  1EO1 A;  3NH0 A;  1QE1 A;  1RT4 A;  5JI2 E;  3HM9 A;  3SAR A;  4DSK A;  2Z4R A;  5ITT A;  5SZT A;  1Z05 A;  2QWM A;  2CRU A;  5HOO A;  3ENO A;  3U6L A;  1WN7 A;  4FJH A;  1LAW A;  4A57 A;  3L2Q A;  1X9J A;  3VPZ A;  1BWF O;  5AQM A;  2L7I A;  1U4B A;  3SQ2 A;  3ITH A;  3DXK B;  4Z4H A;  1XC8 A;  3HP6 A;  4Q0B A;  3RVC A;  1Z59 A;  2R4J A;  3GRV A;  3VES A;  1Q3B A;  5JLH A;  3TQS A;  3MK6 A;  2QW9 A;  3AVN A;  4ISG A;  3WNG A;  3IEC A;  3SAU A;  4AM7 A;  4DQ8 A;  5IT9 O;  3AVL A;  2FBV A;  1G71 A;  2ZTD A;  4YY3 K;  2V7Z A;  1ZMU A;  5AQJ A;  3SUQ A;  2UXB M;  4FXD A;  3RTV A;  5BN8 A;  1QHA A;  3MCA B;  2IC3 A;  3O3G A;  3K92 A;  3VEX A;  2Y0T A;  4C8N A;  3UJN A;  3AO1 A;  5AZJ A;  5MLC Q;  4FZX C;  1IQP A;  3DWL A;  3U60 A;  4CJ6 A;  3NF7 A;  3VQ7 A;  2NRV A;  5BPL A;  3M8R A;  2R6F A;  3HKP A;  3DMJ A;  3M0E A;  4AKI A;  2Q3S A;  4WQ5 C;  1XHZ A;  4AHC A;  3DAW A;  4CIF A;  2ASP A;  3QES A;  4KRF A;  1Z6R A;  1OVQ A;  1RCH A;  2WBN A;  3BXW A;  4CJQ A;  4AW4 A;  1U45 A;  3CD6 N;  4JHD A;  5AQL A;  3MWP A;  3HSC A;  4W5Q A;  4FM1 A;  4BE0 A;  4R7G A;  1YAG A;  3CIP A;  3O6W A;  4RG8 A;  3VTI A;  4CJL A;  1SXJ E;  4WFB L;  5C2D A;  2BE2 A;  3TSP A;  1A5V A;  2EX3 A;  4CZJ A;  2W82 A;  5BRH A;  4BRD A;  1VSH A;  2RN2 A;  3A5N C;  3HZ6 A;  1W7A A;  1OH8 A;  3MX2 A;  1NGH A;  5EP4 A;  3B7Z A;  2FSJ A;  2NNW A;  1IN7 A;  3J7A S;  4YDU A;  3LDS A;  4KB1 A;  2FC0 A;  4K25 A;  3QEP A;  4OVZ A;  4YOU A;  1IBL M;  4DBG B;  2JZ0 A;  3ZX2 A;  3DLL L;  2IDO A;  3A2F A;  3NFA A;  3DZD A;  2XO7 A;  3SHG B;  2FF3 B;  3S41 A;  2WSE F;  2HKJ A;  4B9L A;  4M3W A;  3KOZ E;  1JR3 E;  4ISE A;  4FLU A;  3GLG B;  3PX4 A;  2BWE A;  2MH8 A;  3FRH A;  1TDH A;  1IN4 A;  4DV4 M;  3U61 A;  4CEQ A;  1IFY A;  1NJG A;  2M5Z A;  4A59 A;  1NK6 A;  4XH5 A;  5J2P A;  2R44 A;  1FJG M;  3QNO A;  3L2W A;  2HHH M;  1KCF A;  2I5J A;  3A5L C;  1XXH E;  2LVP C;  3UKU A;  3WUH A;  2DFH A;  4MH0 E;  2Q31 A;  3AL0 C;  5EXX A;  1XMO M;  4LH4 A;  3JR5 A;  3D0P A;  3I8B A;  3TSQ A;  3JSM A;  4PT5 A;  4CGJ A;  3TAG A;  1IN5 A;  4HCB A;  3FZF A;  3ZYY X;  4GVM A;  4W5R A;  4TSX A;  4GC9 A;  1QQW A;  3VQ9 A;  1J53 A;  1OTR A;  1UA0 A;  5KGX A;  1LV7 A;  2HCB A;  1BIZ A;  4IOC L;  1R0A A;  1K3W A;  4A2A A;  2CEA A;  1VQ5 N;  4JS5 A;  2XY7 A;  2OAN A;  3MMP A;  3OYN A;  1JJ2 M;  2HST A;  4Q5V A;  2QK9 A;  2IVO A;  3OYH A;  4KT0 F;  1SS6 A;  1YUB A;  2JXN A;  3Q8X A;  2YV0 X;  4U67 L;  3SQ1 A;  1X9M A;  2CH5 A;  3TAF A;  1W2B M;  2O8D B;  4BRQ A;  2E88 A;  2H5X A;  1DGH B;  2Z1H A;  3VEY A;  4DV7 K;  5KO3 A;  4L4U A;  2YNM D;  4X62 K;  2O8E A;  1CLQ A;  4JI7 M;  4DSF A;  3VF2 A;  4NO7 A;  4RW8 A;  2ZAO A;  2MGW A;  5BRF A;  4AM6 A;  1OVY A;  3JS6 A;  3MHV C;  1NGD A;  2CWB A;  4OKK A;  4CHY A;  4DQS A;  4DCH A;  3IFR A;  4ILJ A;  1KC8 O;  2W42 A;  3GLF E;  1RTD A;  3JXU A;  4I9Q A;  3KOY E;  3FR0 A;  1HJO A;  1IV0 A;  4WUR A;  4B3R K;  1L2C A;  2KHO A;  1QQN A;  2CGK A;  2Q36 A;  3DOK A;  4M3X A;  1N36 M;  3V76 A;  3MCP A;  4CJS A;  2E2P A;  1IBM K;  4JKE A;  1NSF A;  5JVG L;  1EQY A;  1U2V B;  4Y28 F;  2DI0 A;  3T69 A;  1XMQ K;  1HYZ A;  3TE6 A;  4MM3 B;  3ULE A;  2UUB M;  4IG3 A;  3D8B A;  3IS9 A;  3VKG A;  3LMM A;  3TWK A;  4CZI A;  1XB2 B;  4AZF A;  5M1N A;  1TH4 A;  1DO0 A;  1VEJ A;  1VSJ A;  1K6Y A;  2E5L K;  4MGH A;  3OYL A;  1LW2 A;  4LFA K;  3CJC A;  4DR5 M;  2HBM A;  4BRP A;  3C6U A;  2ZAM A;  4GVE A;  4CJ3 A;  4JKF A;  4CZF A;  1L1Z A;  2WSC F;  5AFU A;  1BGX T;  4BC4 A;  3OYB A;  2QBY A;  5C12 A;  1HQC A;  3FFK B;  3NDK A;  1C1A A;  3H4M A;  4KHS A;  5ITX E;  4DTX A;  3WNH A;  2KHH A;  5ITY A;  1GLB G;  1QAM A;  2G8W A;  2DEN A;  3NF6 A;  3RSE A;  4K0K M;  4KB0 A;  1GLN A;  2IGI A;  2KKZ A;  2D0P A;  4AHS A;  1EX4 A;  5M1O A;  1G3I A;  2Z3X A;  4KPY A;  3CC2 N;  3B7Q A;  3FUT A;  1NMD A;  1TV6 A;  2XHB A;  4BRG A;  1ASW A;  1QVR A;  1RFQ A;  3VQ8 A;  1YIT N;  3EZW A;  5AJ3 K;  1GLD G;  1VRU A;  5BN9 A;  1SKR A;  1GLC G;  4B3T K;  4LJA A;  4IBJ A;  3ZLJ A;  1J9A A;  4MGZ E;  4JD2 A;  1C6V A;  1HR0 M;  2KZS A;  4OW0 A;  4Y1C A;  2ZGZ A;  4F2S A;  4CHP A;  4CVN E;  3UB5 A;  1N8R O;  1VQ9 N;  4KI4 A;  2XRI A;  3K5N A;  3C58 A;  4O55 A;  1HNZ K;  1Q8I A;  4PD2 A;  1JLQ A;  3TAR A;  2HMP A;  3P38 A;  3VEZ A;  2IVP A;  1VK0 A;  2X78 A;  2FFJ A;  2OOB A;  4EHT A;  1OAO C;  3HOT A;  3GRR A;  1C0F A;  3BZC A;  3VEV A;  2ATQ A;  4FLV A;  1N33 M;  3RWU A;  2P9N A;  4DV1 M;  2C98 A;  1NGG A;  3RFW A;  2RPI A;  2YR0 A;  2R18 A;  2OPP A;  3VF6 A;  1L2D A;  3WEE A;  3KKS A;  3U6F A;  4QNM A;  3AY9 A;  3QB0 A;  5FRN A;  3SJH A;  4KTZ A;  3U9D A;  3UKR A;  4CEF A;  3OYD A;  5HL7 L;  1LWF A;  3LDP A;  5KQ8 A;  3FTE A;  1WAJ A;  4JK8 A;  1L8Q A;  2QXL A;  1SL2 A;  2KNZ A;  5JVH L;  3OYJ A;  3TR8 A;  4Y1D A;  2WON A;  3MMV A;  2LSN A;  1IXR C;  4I2Q A;  3E4R A;  3AO2 A;  4C23 A;  4NLB A;  2KFN A;  4ZHR A;  1I4W A;  1N6Q A;  4M41 A;  5IWA K;  1KD1 O;  3QIO A;  2Z8Y M;  1F21 A;  4DFM A;  3B8A X;  3FD9 A;  5C18 A;  3JYT A;  1XNR K;  1S1U A;  5D3G A;  3M8S A;  2PYL A;  3TWM A;  2LXE A;  3P1G A;  2FF6 A;  3THW A;  3B89 A;  4EIA A;  1PJJ A;  1SXJ C;  3GPY A;  4DTJ A;  1KYI A;  3QIC A;  2W6K A;  4CBW A;  4XIU A;  1E9R A;  3E9P A;  3E01 A;  4DR4 K;  4H5W A;  1SKS A;  3PFI A;  4IJE A;  4KTQ A;  4JN6 A;  3M8P A;  2G8U A;  3VQD A;  2YHY A;  2K47 A;  2VDB B;  2QWQ A;  4W5N A;  3OY9 A;  1YTU A;  1RDU A;  3MXI A;  4KHN A;  3I0S A;  1WJ7 A;  5ITQ A;  3NH2 A;  3Q8G A;  4DTO A;  1HR0 K;  4M3T A;  4QS9 A;  3TI0 A;  4LF4 K;  3VK8 A;  5IT9 S;  3T1Y K;  2BGG A;  4CZE A;  2VWK A;  3MWT A;  4O5B A;  3J7Y P;  4S12 A;  4CJ7 A;  4QHS A;  4C1N K;  3R8F A;  4FM2 A;  4AHU A;  5GIO A;  2QWP A;  2P5O A;  4DR6 K;  3AVG A;  2CE7 A;  5FPD A;  1DTT A;  3C3E A;  3CFP A;  2G8L A;  3K58 A;  1KFD A;  2XY8 A;  1I94 M;  1R6B X;  1KAZ A;  2HNZ A;  5LY3 A;  3ZT1 A;  4CK1 A;  3ZEU B;  1HJR A;  1HKG A;  4LY6 A;  4KTW A;  2DNA A;  2GWK A;  2PYJ A;  2XY5 A;  4IJA A;  3NBI A;  4A61 A;  4IBI A;  2D1K A;  3VMF B;  4DSI A;  3SYZ A;  1C0M A;  3EIH A;  3KVW A;  2KQ2 A;  1ZMV A;  3LQQ A;  3JR4 A;  4Z4G A;  3LM9 A;  4CJU A;  4QAG A;  3ZH9 B;  1BQN A;  1FXX A;  4NLC A;  3K9O A;  5K14 A;  2OQ4 A;  3DLR A;  2P9P A;  2G8V A;  3ZX3 A;  1JCF A;  3SLC A;  5JS2 A;  4E7K A;  3C6T A;  4J2D A;  2V1U A;  3BUZ B;  3HP9 A;  4B9Q A;  5C15 A;  5BR8 K;  2YHW A;  3MXJ A;  4CJ4 A;  3CC7 N;  4FK4 A;  4JKB A;  2CGL A;  1LTM A;  5GAG P;  3V9Z A;  2LVO C;  3PNY A;  2DFF A;  2ITG A;  2UU9 K;  1SL0 A;  1LCU A;  4Z4C A;  4YOX A;  5M1P A;  3GLI E;  1IM2 A;  1J5E M;  2DZN B;  4XK8 F;  3TPZ A;  3J8A A;  5I42 A;  3LQR A;  1DT9 A;  1TAU A;  1VQK N;  3NGY A;  4IJN A;  4BRO A;  1LW0 A;  2HF3 A;  3K2P A;  3LDQ A;  1GLA G;  4FCT A;  1RT3 A;  5B8H A;  1VDL A;  4E19 A;  4EHU A;  5HRR A;  4NYN A;  1NGF A;  4JI2 M;  3E1Y A;  3HRG A;  2OTL N;  2CUZ A;  4BB9 A;  2G5G X;  1UAX A;  4DV5 M;  3CJ9 A;  3O9R A;  3KD5 E;  2Q0R A;  3OVN A;  2R46 A;  4GHA A;  3OYC A;  3UMM A;  1WSH A;  2ZGY A;  3G25 A;  2O01 F;  3K59 A;  4DTM A;  3A42 A;  1JKH A;  5DYI A;  4CD1 A;  3I4V A;  2AJQ A;  4P17 A;  4HUG A;  3VLF B;  1P3Q Q;  3CJA A;  1TK5 A;  1ATN A;  3N4P A;  1BDG A;  1RTI A;  4HCC A;  3THX A;  3I55 N;  2D4W A;  4BQL A;  2H1R A;  2VWB A;  1I94 K;  3FTC A;  1G15 A;  4B3O A;  3HJ8 A;  4I4L A;  3F92 A;  1JLG A;  2Q2R A;  3IDH A;  3RR7 A;  2VQF K;  2ZTC A;  1YI2 N;  3CMA N;  3SV3 A;  3TAE A;  1V34 A;  3U6P A;  4B3M M;  2P9I A;  3CJB A;  3OTO K;  1YJW N;  2YX6 A;  4RWT A;  3HT3 A;  3VDP A;  4FCV A;  4JI8 M;  3FLC O;  4JRQ A;  4C8L A;  4FJK A;  1S1T A;  1NK5 A;  2CHV A;  2UXC K;  1L3T A;  4FCW A;  4JV5 M;  5F1X A;  4V19 S;  4KO8 A;  3VGM A;  3KLF A;  2HHT A;  4ICL A;  1WGL A;  4NXM M;  2CV2 A;  4ZTF A;  1IXS B;  3T7Z A;  5DM6 L;  3WXJ A;  3TAN A;  2P5T A;  1SXJ A;  3BEX A;  3NVK A;  3GLH B;  1XNQ M;  4IBN A;  4RNA A;  4AI6 A;  5CE3 A;  3UIQ A;  1L1T A;  4DKW A;  4KFB A;  4FJL A;  1Z5A A;  5J2Q A;  3QER A;  1S6Q A;  4CJP A;  3ZSZ A;  1NVM A;  3LZI A;  5I3U A;  2ZBK B;  2YNF A;  3D2E B;  3SBT A;  4GY2 B;  4K8Z A;  1NK7 A;  1NJX A;  1BA1 A;  5EY4 A;  1OH5 A;  4GKJ K;  4FJN A;  1D0K A;  5AQK A;  4DFJ A;  1QZE A;  1HPZ A;  3D45 A;  1Y64 A;  2A42 A;  4DV5 K;  1JR3 A;  4LGY A;  3CF2 A;  4WFA L;  3H08 A;  4A62 A;  4BRA A;  2WUS A;  4FWL A;  3DXM A;  1HNW M;  3T19 A;  5FSW A;  1D9F A;  2YNH A;  4H5N A;  5ELZ A;  2JY7 A;  3P83 D;  3UE5 A;  4PCZ A;  4I81 A;  5AQF A;  1XXH A;  4H0X B;  2FNA A;  1QZ6 A;  1Q81 O;  2AP1 A;  5CZ2 A;  1QUT A;  4CIS A;  3V9S A;  3KK3 A;  4RW4 A;  3J7Z O;  4PKG A;  1GJS A;  3HU1 A;  2HHW A;  3C6H A;  2D7E A;  4X66 M;  3CGW A;  2HL7 A;  3K1J A;  2GEM A;  1ZAE A;  3KWG A;  4BG9 A;  1X9W A;  1EP4 A;  2QEN A;  5EU7 A;  1K3X A;  4B3M K;  4JAX A;  3H4J A;  3BF1 A;  3RGS A;  4OVL A;  4LZJ A;  2F5P A;  3WQT A;  4H5V A;  3F5T A;  3E21 A;  3PSF A;  4JI4 M;  2D0B A;  4A5A A;  4BR5 A;  2XY6 A;  4DSJ A;  4BDY A;  5EP2 A;  3SFZ A;  5EVZ A;  1HQE A;  1DGF A;  1IBK K;  4NOO B;  5FTM A;  5FRO A;  1WSJ A;  1NK0 A;  3GLF A;  1PJI A;  3E9O A;  4CJF A;  3SPZ A;  3SAV A;  2OA8 A;  2R65 A;  2O8B B;  3CCU N;  3SAS A;  4FWP A;  4L6V 6;  3FZH A;  3P5J A;  4KHP K;  1ESV A;  1DGK N;  2DFE A;  4FOI A;  3NGZ A;  1E3M A;  3MEC A;  2QM1 A;  2FOI C;  2JY5 A;  1GOA A;  3GDQ A;  3U8X A;  1HYV A;  4F2R A;  3QYB A;  1NNJ A;  2V7Y A;  1X37 A;  1ZBI A;  1TGO A;  4CCH A;  2P9L B;  2HMI A;  2L7H A;  1NU0 A;  1Q39 A;  1HNI A;  2HOE A;  1EE8 A;  1KVC A;  2W40 A;  3S3M A;  2HNY A;  2E2O A;  1LV5 A;  4M3Y A;  4IBC A;  3ATV A;  3ID6 A;  1K8K B;  5FPE A;  2KEB A;  3RMD A;  1T7P A;  4B9N A;  4LF5 K;  2RF2 A;  1HQU A;  2OYQ A;  3PLA A;  1GVN A;  3DFZ A;  3SAF A;  4QS7 A;  3HHX A;  4BG8 A;  1VQN N;  1NWK A;  2VGN A;  1OJL A;  1RBV A;  2JNH A;  2YHB A;  1ZBH A;  2RKO A;  1GO5 A;  2KLA A;  4FWH A;  5KGW A;  4FVU A;  1DGG A;  3CCJ N;  4XBO A;  3MN5 A;  2MR9 A;  1KTQ A;  4DS4 A;  1KRP A;  5C2F A;  3T1H M;  4AQY K;  2OCE A;  4AIL C;  5AQY A;  2JY6 B;  2QCU A;  2R0I A;  1U49 A;  5IRE B;  5ITX A;  1YUW A;  3FZK A;  4M3Z A;  1S1V A;  3L27 A;  2F4V M;  4BGA A;  4DF8 A;  3CI5 A;  2BAN A;  3W0L B;  5CYM A;  1MJG M;  3RRG A;  5AQQ A;  4AHV A;  4DV3 M;  3HTV A;  3LAN A;  3CCM N;  4GKK M;  4FWG A;  4FWR A;  4G4N A;  4EAH D;  2FS1 A;  4DR3 K;  1NK9 A;  3OS1 A;  3LWM A;  2RKI A;  1KLN A;  1EFU B;  3PVS A;  4CJW A;  2OTJ N;  4JK7 A;  4BAC A;  4YHH M;  3FUX A;  4KHW A;  3VGL A;  4AH9 A;  1NGJ A;  1L3U A;  1KSF X;  1R7R A;  3CTW B;  3KFU G;  1A5W A;  3R9P A;  5JMV A;  3SYL A;  3IG1 A;  3B6P A;  2BUP A;  2IIR A;  3THY A;  5AFU H;  2F5Q A;  2XFS A;  4KBO A;  2QTD A;  4W5W A;  2G3Q A;  1S9G A;  2QKB A;  4NCB A;  4CEZ A;  1PJQ A;  2DVW B;  4DUZ M;  1TUY A;  3NF8 A;  1HQY E;  5BR9 A;  2DZO B;  1HRH A;  3J2P B;  4DR7 K;  3FZL A;  3ILK A;  3A45 A;  2NQ8 C;  1KVB A;  1U6Z A;  4CI6 A;  3SNN A;  5DFL A;  3D2F A;  2K0B X;  1EWQ A;  2A40 A;  2Q97 A;  1T8E A;  2A6A A;  1S22 A;  4PWD A;  2HAK A;  3KDS E;  3QEI A;  2VYP A;  4HWI A;  2O8F B;  4NSO B;  8CAT A;  4H0T B;  3KWI A;  4ELT A;  4CF8 A;  1QSL A;  4HTL A;  4BR0 A;  4FJ9 A;  3CPW M;  4RW7 A;  3CXC M;  1QAO A;  1FKP A;  1RBS A;  4IBE A;  4A3V B;  2ZM6 M;  1S3S A;  3U3G A;  2O5R A;  1G4A E;  4C1N I;  1QHT A;  1RIL A;  3EN9 A;  4QOZ B;  4EP4 A;  1JLB A;  1JL1 A;  4TUW A;  1TYQ A;  3V1O A;  3LPT A;  4F3O A;  2OZM A;  4IJF A;  3C7N A;  1TKZ A;  4FWO A;  5E84 A;  1BVS A;  5C25 A;  1AIP C;  1VQ1 A;  1MWK A;  3G6E N;  1E32 A;  3CCV N;  3T1A A;  4DHY A;  3K2L A;  3M8Q A;  4QNR A;  4NSR A;  1RTH A;  5FPM A;  1IO2 A;  4LFC M;  2X49 A;  1E9S A;  4DFP A;  3DLK A;  3HPH A;  2V51 B;  2E2Q A;  3NBP A;  5E6J A;  1Z5B A;  5KRS A;  2UXB K;  4D82 A;  3PV8 A;  4YHH K;  2DAI A;  2Z7J A;  1QTM A;  2HW3 A;  1E4G T;  1ASV A;  3KOX E;  2NRW A;  3OBW A;  4DR1 M;  1Z26 A;  4DS5 A;  3KXE C;  4DTS A;  4O44 A;  3VFD A;  3QAU A;  4E7I A;  3M1F A;  1O1W A;  3K9J A;  3L2V A;  1JB0 F;  2NRX A;  1B92 A;  4E1M A;  3WHL A;  2VII A;  1TL1 A;  2EUC A;  1RDD A;  3EO3 A;  3C94 A;  4DTP A;  3M5R A;  3QYE A;  4LG2 A;  3DM2 A;  2DWM A;  2A3Z A;  1TUU A;  1BCO A;  3RRH A;  4B1U B;  3ID8 A;  4CJE A;  2EKF A;  4FO0 A;  5ITR A;  1SV5 A;  1XQS C;  2GNO A;  1L2B A;  4BRF A;  1WXQ A;  5GIN A;  2R62 A;  4JI3 M;  3AVH A;  4MO4 A;  3I56 N;  5JS1 A;  2VQE M;  3O8M A;  4BWJ A;  4JXJ A;  4QOS A;  4WFN L;  4BGB A;  3ZSW A;  2DKL A;  4N76 A;  4CZK A;  3B74 A;  1GL7 A;  4CJR A;  5AZJ B;  5F0X A;  1RT6 A;  5AQT A;  2QP9 X;  3U60 B;  2EO2 A;  3TAQ A;  1NGB A;  3WQU A;  4FL9 A;  1IN8 A;  4UN2 B;  3THY B;  2LHC A;  2L2D A;  4CZM A;  1TL3 A;  1IBL K;  5KI6 A;  4H03 B;  4DQQ A;  1YXQ A;  4GHL A;  4HHT A;  3L28 A;  3L26 A;  4CZH A;  3GQ5 A;  4BC2 A;  1JLA A;  4OLA A;  2HHV A;  5LJV A;  2DHY A;  4DV2 M;  3HU3 A;  4BR2 A;  1WOQ A;  4K41 A;  3TPQ A;  1M1K O;  1YVU A;  3U5Z A;  1YE9 A;  3VER A;  4JHD B;  3ALY A;  2M60 A;  1GLE G;  1ZBL A;  3GLG E;  1BO5 O;  4WQ4 C;  4DV4 K;  3KKR A;  3D7E O;  4I7F A;  5KPZ A;  1IKV A;  5AR0 A;  3GLI A;  4DLG A;  4GIT A;  4LJ8 A;  1YIJ N;  4M42 A;  1FJG K;  4LFC K;  2HHH K;  1D0M A;  2Z1G A;  3LWL A;  2XGN A;  3IKM A;  1F4I A;  1NJY A;  2QEX N;  1EKE A;  1VQO N;  1HPM A;  3R9X B;  1Z6T A;  4P16 A;  4BVP A;  2JA2 A;  1NGA A;  2D5R A;  2B4J A;  3OW2 M;  1XMO K;  4BY9 C;  1YHQ N;  4FK2 A;  1OQY A;  1HYS A;  4OVZ B;  4DR1 K;  1VSL A;  1R2Y A;  3OYA A;  5EOY A;  2PBD A;  3SJJ A;  2O8C A;  4CEB A;  2UYT A;  2QSF X;  4LF7 M;  2FBX A;  1U48 A;  1N5Y A;  1YVN A;  2JGU A;  3K9P A;  2P9U A;  1JXE A;  4WQ5 A;  3ZET A;  3THV A;  1IG9 A;  4R71 A;  5AQR A;  3ZT2 A;  4H0O A;  5J2N A;  2E1Z A;  3U61 B;  3C95 A;  1D8Y A;  1S9E A;  4B9V A;  4JI7 K;  3DRR A;  1ILY A;  4KRE A;  2C9O A;  1Q18 A;  3CM5 A;  4FLT A;  1H1V A;  1EXQ A;  4A2B A;  4O8K A;  4CZL A;  1VDD A;  3BBZ A;  4H0P A;  3UKU B;  3LW5 F;  4IDH A;  3KSJ A;  4PUO A;  3I01 M;  3AGK A;  4LFB M;  1OIP A;  4DV0 M;  2YHA A;  3OA9 A;  1U04 A;  1KSP A;  4YOW A;  4H5T A;  2HBJ A;  1ITG A;  1D5A A;  4DFK A;  3SUN A;  3O4Q A;  1YJN N;  1N36 K;  3PX0 A;  3O4W A;  1QZ5 A;  2W6L A;  3L4Q A;  3QBX A;  5AQN A;  3K57 A;  3H1Q A;  4UQG A;  3CF6 E;  1WBB A;  3HK2 A;  3L29 A;  2OPR A;  1SKW A;  5DNY A;  2VWJ A;  2E20 A;  3MAQ A;  3R6M A;  5LMU M;  1Q02 A;  2NUB A;  2ASM A;  1R2Z A;  4U7B A;  1MU2 A;  1R59 O;  1NGC A;  1LWC A;  4OPK A;  3LVV A;  2IVN A;  2UUB K;  1SL1 A;  4DV6 M;  2O8E B;  4I8O A;  1GLF O;  4I6M A;  3CQX A;  3HM8 A;  3O9Q A;  1MDU B;  2D7H A;  1E94 E;  3C9P A;  1HKB A;  3NHG A;  1Q7Y O;  3HJQ A;  3AA2 A;  2HVI A;  4LF8 M;  3VQQ A;  3CFR A;  3MDQ A;  3BDP A;  3QLH A;  4KI6 A;  3AA3 A;  1IY0 A;  4DQI A;  1BL3 A;  4DR5 K;  3KK2 A;  3TAM A;  4PDI A;  2V52 B;  2HVH A;  2P5G A;  4C8M A;  2Q1N A;  4FZZ A;  1GLJ O;  1S3X A;  4JYA M;  3EKU A;  5T7B A;  4BDP A;  1DGB A;  3DA1 A;  3H3O B;  3PXG A;  2LBC A;  3DJC A;  2ZAN A;  4L8R B;  1UFZ A;  3GP1 A;  3SYK A;  2VG6 A;  3FFI A;  1SUQ A;  3SUO A;  4K0K K;  3O08 A;  3ENB A;  1TR8 A;  3TTD A;  3OJS A;  1W0H A;  4DR2 M;  4G1Q A;  4JRP A;  2CV1 A;  4D81 A;  1O13 A;  3ULE B;  4OPJ A;  1EWR A;  3FTD A;  5C24 A;  1TDZ A;  1YF5 L;  4JI1 M;  1D0L A;  5LJW A;  4KLN A;  3O1B A;  3GRY A;  3SHF A;  4CFC A;  3MEE A;  3ENH A;  2LH0 A;  2MRO B;  3HST B;  5J1E A;  3ZQJ A;  3OHR A;  4AG5 A;  3EZ5 A;  2DXI A;  2QBY B;  1VEK A;  5GAH P;  1VQP N;  1SG9 A;  1RNH A;  1CZA N;  4LF6 M;  5E26 A;  3BGR A;  1NV9 A;  1C0T A;  4M3R A;  1NM1 A;  3PUF A;  3WXK A;  4CGH A;  3QEX A;  2OOA A;  1M90 O;  4E89 A;  2F9T A;  2R7Y A;  1U47 A;  1MWM A;  4B7F A;  3RSE B;  2K6B A;  3CCR N;  1RT1 A;  1VSI A;  3CQY A;  3CF5 L;  3EL2 A;  4LD0 A;  1N33 K;  2UXD M;  3NH1 A;  4DV1 K;  4K42 A;  1TK8 A;  1HT2 E;  4DQR A;  1T6C A;  4AKG A;  2QI2 A;  3S3O A;  3PY8 A;  3H46 O;  4B7G A;  2Z1J A;  4H4M A;  4MFB A;  4DU1 A;  2GV9 A;  4CF9 A;  3KLH A;  2P9S A;  4IWV A;  4M9S A;  4FYD A;  3DI6 A;  1KAX A;  1WSE A;  4JD2 B;  4WF9 L;  3AO5 A;  2B3T A;  2Y20 A;  1C0G A;  4CEO A;  1J54 A;  3HHY A;  4CJV A;  3D8L A;  4YOR A;  3BY5 A;  2QWN A;  3EKS A;  3AVF A;  3RMC A;  2PZS A;  5EXS A;  4CK3 A;  3LP3 A;  2P9K A;  1MU5 A;  1G41 A;  4EIW A;  3P31 A;  5FTJ A;  5C1B A;  3NF9 A;  4M9Z A;  4GC5 A; 
#chains in the Genus database with same CATH homology
 2P9N B;  3CET A;  3QBW A;  4H5R A;  3VK7 A;  3WEE B;  4YOV A;  1XHB A;  2XSZ D;  2YQZ A;  3VEN A;  3UKR B;  5CR4 A;  4RF1 A;  5EP1 A;  3U6Q A;  3AOE C;  2ERC A;  4NRW A;  1P90 A;  4BRH A;  2DWL A;  5AZI A;  2UUA M;  1BU6 O;  4H0V B;  3L4I A;  3VTH A;  2Z4S A;  3BOS A;  1VQ6 N;  3OBY A;  3WXL A;  3W3D A;  3GRU A;  4ILH A;  4QOZ C;  4LJ6 A;  2V6Z M;  4DUY M;  3U6D A;  5GKN A;  4IXC A;  5BRE A;  3HHZ A;  1DO2 A;  4H0Y B;  1ATR A;  2ZJP L;  2J7N A;  1T6D A;  3AFH A;  4LRT A;  2XH9 A;  3Q7B A;  1N32 M;  3H6E A;  2Q2E B;  4JI6 M;  4MLH A;  1QZM A;  4MDB A;  4UY8 O;  3HHW A;  2BH1 A;  1G8P A;  3C6A A;  3GO8 A;  3GOI A;  3ZX0 A;  4IBF A;  1V4T A;  1IY1 A;  3HOS A;  4Z6Y A;  1ZBS A;  3KW6 A;  3AGR A;  4B3S M;  4ISF A;  3FUW A;  5DYG A;  1WUA A;  3E66 A;  2YCH A;  3L0Q A;  4EFH A;  2KA6 B;  2P9S B;  2DPN A;  4B08 A;  2YFQ A;  4JKG A;  1Q82 O;  3FE1 A;  4PDG A;  1KQS M;  4X65 M;  3SK3 A;  1D4X A;  3CME N;  2KZU A;  2YJF A;  4BVO A;  1SAZ A;  5LMN M;  3FKE A;  3M6G A;  4BRM A;  4CGY B;  2C5R A;  4ZPX A;  2P9P B;  4O5F A;  1P8Z A;  1PM5 A;  3DXK A;  3BP8 A;  4GNI A;  3HJS A;  1RGI A;  3CJ1 A;  4LJ9 A;  1K8A O;  2BNK A;  4YOT A;  4G6Z A;  3B9P A;  4OU7 A;  1HNX M;  3TWL A;  2WC9 A;  1IG8 A;  3C0B A;  2CV0 A;  3H3N O;  3K9K A;  4CZG A;  4BRN A;  1NY5 A;  3P39 A;  3IUC A;  4L16 A;  4PKH A;  4XGI A;  3M6A A;  4LRS A;  4II7 A;  1JQJ C;  2JWL A;  5AQS A;  3AAQ A;  1ZQ9 A;  2Q0U A;  2A5X A;  2KW0 A;  3FGU A;  1VQM N;  2GWJ A;  2A5Y B;  2R4E A;  3U6E A;  2CGJ A;  3O9T A;  1QQO A;  3SC3 A;  3MN7 A;  1C1K A;  3U6C A;  1OFH A;  5F2R A;  3EE8 A;  4GV3 A;  1HX1 A;  2P9I B;  4BC3 A;  2J7O A;  2BJV A;  1OFI A;  3WXM B;  4R3D A;  3C65 A;  4CD3 A;  4B7H A;  4HL4 A;  3AKZ A;  3LM2 A;  2H3G X;  2HBL A;  2NRT A;  5H1S Q;  3GLG A;  1XC3 A;  7CAT A;  3UZU A;  3NWL A;  1SXJ B;  4IFE A;  1KFV A;  3LL3 A;  4BRL A;  3CC4 N;  3HGI A;  2A41 A;  4RCH A;  3R8E A;  4F9O A;  4FWN A;  5ADX A;  4IEE A;  1TH2 A;  1QAN A;  3I51 A;  1HUX A;  4JN4 A;  4L8R C;  4M0W A;  3G4S N;  1QAQ A;  3CHW A;  1N77 A;  3R1X A;  5CHI A;  2CFO A;  4PL8 A;  1DEJ A;  4IBB A;  1XWI A;  4L15 A;  3DXM B;  1VQ8 N;  4OX9 M;  3CCL N;  1DGH A;  2LWX A;  2FSN A;  3A46 A;  3MN9 A;  4MLE A;  2GX9 A;  1XXH B;  3G71 N;  1BG3 A;  3R3L A;  4IO9 L;  5BPV A;  4AF1 A;  2NRH A;  3GPX A;  2NRR A;  2HBK A;  2I7N A;  4ITQ A;  3E9L A;  2E1Y A;  1NJF A;  3VET A;  1E4F T;  1IXZ A;  2KRU A;  4K43 A;  4RTF D;  4KH4 A;  5TKW A;  3HI0 A;  1NHW C;  2XZF A;  4KH5 A;  5GAD P;  4B1Z A;  2CH6 A;  2GEL A;  3LVW A;  3FUU A;  3GPU A;  4BBA A;  1U2V A;  5JI3 E;  5M1K A;  3CER A;  4LC9 B;  4DV7 M;  5AQV A;  4X62 M;  4XH4 A;  3GQ4 A;  3GLF B;  5EXT A;  4IO8 A;  4XH1 A;  3FTF A;  4B3R M;  2QPA A;  4LF9 M;  1IY2 A;  2GTD A;  1TGU A;  3U6S A;  3TTF A;  1IBM M;  5AQZ A;  4E1J A;  1T44 A;  4G9Z A;  4FWQ A;  1FNN A;  3J27 B;  2ZJQ L;  2I7P A;  1G99 A;  1XMQ M;  4D80 A;  2RGH A;  2WFB A;  4PHT X;  3FYD A;  4CBU A;  4GH9 A;  4AG6 A;  3Q7C A;  3O5B A;  1MA9 B;  3J7B A;  4DB3 A;  4BRK A;  4JI5 M;  4M9X A;  3JAM S;  4QS8 A;  2E5L M;  4Y0W A;  5ITU A;  4LFA M;  5AQX A;  2YHX A;  3ZCB B;  2X8A A;  4PL7 A;  1K9M O;  4LGM A;  2C96 A;  3RE8 A;  5EX5 A;  4G4Q A;  4KH6 A;  3U6M A;  3O1W A;  5BPN A;  1OKJ A;  1NBW A;  3FZM A;  3SAT A;  1YJ9 N;  1VAZ A;  4RF0 A;  4FD2 A;  3LDN A;  4CBX A;  3T15 A;  4NL4 H;  4B3T M;  1K73 O;  3RGP A;  3KS4 A;  2E8A A;  3SBG A;  5I9E B;  4LJ4 A;  3F2K A;  3AJI B;  3GE1 A;  1YSY A;  3SMP A;  4BLC A;  2QWL A;  3KSX A;  3SMS A;  3EIE A;  2YJE A;  1HNZ M;  3GL1 A;  3QFU A;  2ASO A;  3D6R A;  1GKI A;  5BPM A;  3D2F B;  1JCE A;  3VOV A;  4JKH A;  1XUP O;  3AAR A;  2LNH C;  4CHT B;  2Y21 A;  2PFU A;  3KHY A;  1BOT O;  2AHM A;  4WW0 A;  2FE8 A;  3I4Y A;  3GQ3 A;  4O8U A;  2J4R A;  4JNE A;  2L6O A;  3ATU A;  2DWN A;  1NNU C;  3A5M C;  4M7X A;  1V4S A;  5IZ7 D;  3UGJ A;  4BC5 A;  1X3N A;  3NMU A;  5GAE P;  1W5S A;  3AAP A;  1QQM A;  1TYQ B;  1H6U A;  5AQO A;  4NXN M;  3VKH A;  3C7N B;  3FUV A;  5IWA M;  1LOT B;  4GMQ A;  1XNR M;  2XZU A;  4FOE A;  2CHG A;  4FWD A;  5EP3 A;  4MGY E;  1ATS A;  3O80 A;  2C9C A;  4IOA L;  4DR4 M;  4IEI A;  5GIP A;  1MX0 A;  3U6O A;  2V1C A;  5AQI A;  3ZEU A;  1ZXO A;  4FWM A;  2D0O A;  4M0D A;  1ORY B;  4MGI E;  4FWK A;  4OPA A;  5M1F A;  4G4O A;  3CPE A;  4LF4 M;  4NB4 A;  5AQH A;  3E9S A;  3T1Y M;  2D7G A;  3M7G A;  3MX5 A;  1IJJ A;  3EE9 A;  3THG A;  4BRC A;  3SBJ A;  3T38 A;  3J80 S;  4B1V A;  2UUC M;  3QWL A;  3HU2 A;  5FTK A;  3NVM A;  4DR6 M;  3QFP A;  4YOY A;  2L09 A;  3N4Q A;  2BTF A;  2VCP A;  3DOA A;  2NRZ A;  5EQT A;  4L3Q A;  4LZZ A;  2F5S A;  2QZ4 A;  2FSK A;  1RDW X;  3IG5 A;  4JK9 A;  2FLO A;  3J81 S;  5H37 D;  5F3W A;  2C99 A;  5FLX S;  3GG4 A;  3VDU A;  2F7T A;  1T3T A;  3CCS N;  3L25 A;  2ZJR L;  1HT1 E;  3ZC7 B;  4MB7 A;  3TL4 X;  2OPF A;  3U5Z B;  4JI0 M;  4A5B A;  2XLJ A;  3AV0 A;  4BR9 A;  5BR8 M;  1HLU A;  3GLI B;  2UU9 M;  5FTL A;  1X3M A;  3GBT A;  1T3V A;  1NY6 A;  1SZ2 A;  1NJI O;  2RE2 A;  1D2N A;  1J6Z A;  3M3Z A;  5AQW A;  3KS8 A;  1VQ4 N;  4IBD A;  3VGK A;  4GV6 A;  3KP0 E;  4G4R A;  2DHR A;  3SAH A;  2P9U B;  3ZET B;  4GRI A;  4GV9 A;  3FYC A;  1KAY A;  1SQK A;  5AQG A;  2AA4 A;  1DKG D;  3LDO A;  4FW9 A;  4WQ4 A;  5C0Y A;  1SXJ D;  3P4I A;  2PAV A;  4FVM A;  3TTC A;  5KPR A;  4WYB A;  4I5S A;  3VEO A;  2HF4 A;  3GLH A;  1UM8 A;  3O9S A;  3SAG A;  4ILG B;  1K82 A;  3I33 A;  4X64 M;  5TKY A;  4NRV A;  5FPN A;  3KK7 A;  4FSV A;  3L6Q A;  4OO1 J;  5AQU A;  2VQF M;  5DM7 L;  5A2Q S;  3D2E A;  4IZ9 A;  3TSU A;  3GPP A;  3OTO M;  1N34 M;  2BJW A;  5EJC A;  1JR3 D;  1VQ7 N;  4FWS A;  2UXC M;  4I6M B;  4L78 A;  4JKC A;  2W41 A;  1QYR A;  3L2A A;  1ZC6 A;  3K8Z A;  5EXW A;  2F5O A;  3CCE N;  5M1Q A;  1VQL N;  4B1X B;  3CF0 A;  2F5N A;  4BRI A;  4GIP A;  1NLV A;  5BRD A;  2QWR A;  3LDL A;  4GKJ M;  3VEW A;  3CJ7 A;  1NGI A;  1TH3 A;  4AKH A;  1GL6 A;  3O9U A;  5KQD A;  1N78 A;  2DWZ B;  2ITM A;  2NLX A;  4FPB A;  5KPT A;  4IOX A;  1J09 A;  3W0F A;  2YI1 A;  3PIP L;  4LJ5 A;  4BR7 A;  4Z94 A;  3SAW A;  2XF3 A;  3KP1 E;  4B1W B;  1Q86 O;  4QHT A;  5ADX H;  4JKA A;  1IN6 A;  5EXP A;  1N75 A;  4Z8X A;  2P9L A;  3CCQ N;  3A0I X;  3IMX A;  3U9Z A;  1W97 L;  1K8K A;  4MDA A;  4LCB A;  3A98 B;  2GUP A;  1IBK M;  4B1Y B;  2ZWH A;  3A5O C;  2RHK A;  4BQZ A;  4KHP M;  3MN6 A;  4REZ A;  1KXP A;  3WXI A;  1QVG M;  2P9K B;  1Z5C A;  2XFT A;  4MO5 A;  3KOW E;  4FPA A;  1JCG A;  4R79 A;  3W0L A;  4IBG A;  1BA0 A;  2E2N A;  2Y0Q A;  4LF5 M;  3MJ5 A;  2FXU A;  2NZT A;  2XSZ A;  4OPH A;  2CHQ A;  2ZF5 O;  2JWK A;  4KOD A;  4YDU C;  5AZI B;  3H1V X;  1NGE A;  3HWS A;  3UK6 A;  4AQY M;  1S72 N;  3H45 C;  4JEP A;  3PNV A;  2X4A A;  4XEI A;  3KVG A;  4MGK E;  4PKI A;  3VF4 A;  3F9M A;  2RGO A;  1GLL O;  3IG8 A;  5C10 A;  4YY3 M;  1QVF M;  4J8F A;  4DR3 M;  2VGM A;  4WCE L;  3AOG A;  3BF3 A;  2XEP A;  1G59 A;  1W5T A;  3AOE A;  4HLQ A;  5JIC A;  5AQP A;  4IIW A;  3KZB A;  2F9W A;  2QWO A;  3HBT A;  1J7K A;  4IBK A;  3PIO L;  4LJ7 A;  2EWS A;  1BUP A;  4DR7 M;  4M7Y A;  3WT0 A;  3U4L A;  4BRE A;  5JLF A;  1Q3C A;  3TU5 A;  5FTN A;  2KRK A;  4BR4 A;  3A8Y A;  3QML A;  2QA4 N;  4M63 C;  4JKD A;  1NHG C;  2KXE A;  2EA0 A;  1HKC A;  3WHK A;  2R45 A;  3QDK A;  4JKG B;  1EO1 A;  5JI2 E;  3SAR A;  2Z4R A;  5ITT A;  1Z05 A;  2QWM A;  5HOO A;  3ENO A;  3U6L A;  4A57 A;  1X9J A;  3VPZ A;  1BWF O;  5AQM A;  2L7I A;  3DXK B;  1XC8 A;  3RVC A;  1Z59 A;  2R4J A;  3GRV A;  3VES A;  1Q3B A;  5JLH A;  3TQS A;  3MK6 A;  2QW9 A;  4ISG A;  4AM7 A;  3SAU A;  4DQ8 A;  2V7Z A;  5AQJ A;  2UXB M;  5BN8 A;  1QHA A;  3MCA B;  3K92 A;  3VEX A;  2Y0T A;  3UJN A;  5AZJ A;  5MLC Q;  1IQP A;  3DWL A;  3U60 A;  2NRV A;  5BPL A;  3HKP A;  3M0E A;  4AKI A;  4WQ5 C;  3DAW A;  2ASP A;  1Z6R A;  2WBN A;  4AW4 A;  3CD6 N;  4JHD A;  5AQL A;  3MWP A;  3HSC A;  4R7G A;  1YAG A;  3CIP A;  3O6W A;  3VTI A;  1SXJ E;  4WFB L;  5C2D A;  3TSP A;  4CZJ A;  2W82 A;  5BRH A;  4BRD A;  3A5N C;  3HZ6 A;  3MX2 A;  1NGH A;  5EP4 A;  2FSJ A;  2NNW A;  1IN7 A;  3J7A S;  4YDU A;  4K25 A;  4OVZ A;  4YOU A;  1IBL M;  3ZX2 A;  3DLL L;  3DZD A;  3SHG B;  2FF3 B;  3S41 A;  2HKJ A;  3KOZ E;  4ISE A;  3GLG B;  1TDH A;  1IN4 A;  4DV4 M;  3U61 A;  1NJG A;  2M5Z A;  4A59 A;  4XH5 A;  1FJG M;  2HHH M;  3A5L C;  3UKU A;  3WUH A;  4MH0 E;  2Q31 A;  3AL0 C;  5EXX A;  1XMO M;  3JR5 A;  3I8B A;  3TSQ A;  4PT5 A;  1IN5 A;  3FZF A;  3ZYY X;  4GC9 A;  1QQW A;  1LV7 A;  2HCB A;  4IOC L;  1K3W A;  4A2A A;  2CEA A;  1VQ5 N;  2OAN A;  1JJ2 M;  2HST A;  2IVO A;  1SS6 A;  1YUB A;  4U67 L;  3Q8X A;  2CH5 A;  1W2B M;  4BRQ A;  2E88 A;  3VEY A;  1DGH B;  5KO3 A;  4L4U A;  2YNM D;  4JI7 M;  3VF2 A;  4NO7 A;  2ZAO A;  5BRF A;  4AM6 A;  1OVY A;  3JS6 A;  3MHV C;  1NGD A;  1KC8 O;  4DCH A;  3IFR A;  4ILJ A;  3JXU A;  3KOY E;  3FR0 A;  1HJO A;  4WUR A;  1L2C A;  2KHO A;  1QQN A;  2CGK A;  2Q36 A;  1N36 M;  3MCP A;  2E2P A;  4JKE A;  1NSF A;  5JVG L;  1EQY A;  1U2V B;  3T69 A;  3TE6 A;  4MM3 B;  3ULE A;  2UUB M;  3D8B A;  3VKG A;  3LMM A;  3TWK A;  4CZI A;  5M1N A;  4AZF A;  1TH4 A;  1DO0 A;  4MGH A;  3CJC A;  4DR5 M;  2HBM A;  4BRP A;  2ZAM A;  4GVE A;  4JKF A;  4CZF A;  1L1Z A;  5AFU A;  4BC4 A;  2QBY A;  5C12 A;  1HQC A;  3FFK B;  3H4M A;  5ITX E;  5ITY A;  1GLB G;  1QAM A;  3RSE A;  4K0K M;  1GLN A;  2KKZ A;  2D0P A;  5M1O A;  1G3I A;  2Z3X A;  3CC2 N;  3FUT A;  1NMD A;  4BRG A;  1QVR A;  1RFQ A;  1YIT N;  3EZW A;  1GLD G;  5BN9 A;  1GLC G;  4LJA A;  4IBJ A;  4MGZ E;  4JD2 A;  1HR0 M;  2KZS A;  4OW0 A;  2ZGZ A;  3UB5 A;  1N8R O;  1VQ9 N;  3C58 A;  4PD2 A;  2HMP A;  3P38 A;  3VEZ A;  2IVP A;  2FFJ A;  4EHT A;  3HOT A;  3GRR A;  1C0F A;  3VEV A;  1N33 M;  2P9N A;  4DV1 M;  2C98 A;  1NGG A;  3RFW A;  2YR0 A;  2R18 A;  3WEE A;  3VF6 A;  1L2D A;  4QNM A;  3AY9 A;  3QB0 A;  3SJH A;  3U9D A;  3UKR A;  5HL7 L;  3LDP A;  5KQ8 A;  3FTE A;  4JK8 A;  1L8Q A;  2QXL A;  5JVH L;  3MMV A;  1IXR C;  3E4R A;  4C23 A;  4NLB A;  1I4W A;  1KD1 O;  3B8A X;  3FD9 A;  5C18 A;  3TWM A;  2LXE A;  2FF6 A;  4EIA A;  1PJJ A;  1SXJ C;  3GPY A;  1KYI A;  3QIC A;  4CBW A;  1E9R A;  3E9P A;  4H5W A;  3PFI A;  4IJE A;  4JN6 A;  2YHY A;  2K47 A;  2QWQ A;  1RDU A;  5ITQ A;  4QS9 A;  3VK8 A;  5IT9 S;  4CZE A;  3MWT A;  4S12 A;  4CJ7 A;  4QHS A;  4C1N K;  3R8F A;  5GIO A;  2QWP A;  2CE7 A;  5FPD A;  2G8L A;  1I94 M;  1R6B X;  1KAZ A;  5LY3 A;  3ZEU B;  1HKG A;  4LY6 A;  2GWK A;  4IJA A;  3NBI A;  4A61 A;  4IBI A;  2D1K A;  3VMF B;  3EIH A;  3KVW A;  3JR4 A;  3LQQ A;  3LM9 A;  3ZH9 B;  4NLC A;  2OQ4 A;  2P9P A;  3ZX3 A;  1JCF A;  3SLC A;  2V1U A;  3BUZ B;  4B9Q A;  5C15 A;  2YHW A;  3CC7 N;  4JKB A;  2CGL A;  5GAG P;  3PNY A;  1LCU A;  4YOX A;  5M1P A;  1IM2 A;  1J5E M;  2DZN B;  3TPZ A;  3J8A A;  3LQR A;  1DT9 A;  1VQK N;  4IJN A;  4BRO A;  2HF3 A;  3LDQ A;  1GLA G;  4FCT A;  5B8H A;  4EHU A;  1NGF A;  4JI2 M;  3E1Y A;  3HRG A;  2OTL N;  2CUZ A;  4BB9 A;  2G5G X;  4DV5 M;  3CJ9 A;  3O9R A;  2Q0R A;  2R46 A;  4GHA A;  3UMM A;  2ZGY A;  3G25 A;  3A42 A;  5DYI A;  4CD1 A;  3I4V A;  3VLF B;  3CJA A;  1ATN A;  3N4P A;  1BDG A;  3I55 N;  2D4W A;  4BQL A;  2H1R A;  2VWB A;  3FTC A;  3HJ8 A;  4I4L A;  3IDH A;  2Q2R A;  1YI2 N;  3CMA N;  3U6P A;  4B3M M;  2P9I A;  3CJB A;  1YJW N;  2YX6 A;  4RWT A;  3VDP A;  4FCV A;  4JI8 M;  3FLC O;  2CHV A;  4FCW A;  4JV5 M;  5F1X A;  4KO8 A;  3VGM A;  4NXM M;  2CV2 A;  1IXS B;  3T7Z A;  5DM6 L;  3WXJ A;  2P5T A;  1SXJ A;  3BEX A;  3NVK A;  3GLH B;  1XNQ M;  4RNA A;  4AI6 A;  5CE3 A;  1L1T A;  4DKW A;  1Z5A A;  1NVM A;  2ZBK B;  3D2E B;  3SBT A;  4GY2 B;  1BA1 A;  5EY4 A;  5AQK A;  1Y64 A;  2A42 A;  1JR3 A;  4LGY A;  3CF2 A;  4WFA L;  4A62 A;  4BRA A;  2WUS A;  4FWL A;  3DXM A;  1HNW M;  5FSW A;  4H5N A;  5ELZ A;  3UE5 A;  4PCZ A;  4I81 A;  5AQF A;  1XXH A;  4H0X B;  2FNA A;  1QZ6 A;  1Q81 O;  2AP1 A;  4CIS A;  3J7Z O;  4PKG A;  3HU1 A;  3C6H A;  2D7E A;  4X66 M;  3KWG A;  2HL7 A;  3K1J A;  2GEM A;  1ZAE A;  4BG9 A;  2QEN A;  1K3X A;  4JAX A;  3BF1 A;  3RGS A;  4LZJ A;  2F5P A;  3WQT A;  4H5V A;  3F5T A;  4JI4 M;  4A5A A;  4BR5 A;  5EP2 A;  3SFZ A;  5EVZ A;  1DGF A;  4NOO B;  5FTM A;  3GLF A;  1PJI A;  3E9O A;  3SAV A;  2R65 A;  3CCU N;  3SAS A;  4FWP A;  3FZH A;  1ESV A;  1DGK N;  4FOI A;  2QM1 A;  2FOI C;  3GDQ A;  3U8X A;  1NNJ A;  2V7Y A;  1X37 A;  2P9L B;  2L7H A;  2HOE A;  1Q39 A;  1EE8 A;  2W40 A;  2E2O A;  4IBC A;  3ATV A;  3ID6 A;  1K8K B;  5FPE A;  2KEB A;  3PLA A;  1GVN A;  3DFZ A;  3SAF A;  4QS7 A;  3HHX A;  4BG8 A;  1VQN N;  1NWK A;  2VGN A;  1OJL A;  2RKO A;  2KLA A;  4FWH A;  4FVU A;  1DGG A;  3CCJ N;  4XBO A;  3MN5 A;  5C2F A;  3T1H M;  5AQY A;  2QCU A;  5IRE B;  5ITX A;  1YUW A;  3FZK A;  3L27 A;  2F4V M;  4BGA A;  3CI5 A;  3W0L B;  5AQQ A;  4DV3 M;  3HTV A;  3CCM N;  4GKK M;  4FWG A;  4FWR A;  4G4N A;  4EAH D;  3PVS A;  2OTJ N;  4JK7 A;  4YHH M;  3FUX A;  3VGL A;  1NGJ A;  1KSF X;  1R7R A;  3CTW B;  3KFU G;  3R9P A;  5JMV A;  3SYL A;  2BUP A;  2IIR A;  5AFU H;  2F5Q A;  2XFS A;  4KBO A;  2QTD A;  4W5W A;  2DVW B;  4DUZ M;  1TUY A;  1HQY E;  5BR9 A;  2DZO B;  3J2P B;  3FZL A;  3ILK A;  3A45 A;  2NQ8 C;  1U6Z A;  4CI6 A;  3D2F A;  2A40 A;  2Q97 A;  2A6A A;  1S22 A;  3KDS E;  2VYP A;  4HWI A;  4NSO B;  8CAT A;  4H0T B;  3KWI A;  4HTL A;  4BR0 A;  3CPW M;  3CXC M;  1QAO A;  4IBE A;  4A3V B;  2ZM6 M;  1S3S A;  2O5R A;  1G4A E;  4C1N I;  3EN9 A;  1TYQ A;  4TUW A;  4IJF A;  3C7N A;  4FWO A;  5E84 A;  1MWK A;  3G6E N;  1E32 A;  3CCV N;  4DHY A;  3K2L A;  4QNR A;  4NSR A;  5FPM A;  4LFC M;  2X49 A;  1E9S A;  2V51 B;  2E2Q A;  5E6J A;  1Z5B A;  4D82 A;  2Z7J A;  1E4G T;  2NRW A;  3KOX E;  3OBW A;  4DR1 M;  3KXE C;  3VFD A;  3QAU A;  3M1F A;  3K9J A;  2NRX A;  3WHL A;  2VII A;  2EUC A;  3EO3 A;  3M5R A;  4LG2 A;  2DWM A;  2A3Z A;  1TUU A;  4B1U B;  3ID8 A;  4FO0 A;  5ITR A;  1XQS C;  1L2B A;  4BRF A;  1WXQ A;  5GIN A;  2R62 A;  4JI3 M;  4MO4 A;  3I56 N;  2VQE M;  3O8M A;  4JXJ A;  4QOS A;  4WFN L;  4BGB A;  4CZK A;  1GL7 A;  5F0X A;  5AZJ B;  5AQT A;  2QP9 X;  3U60 B;  2EO2 A;  1NGB A;  3WQU A;  4FL9 A;  1IN8 A;  4CZM A;  4H03 B;  1YXQ A;  4GHL A;  3L28 A;  3L26 A;  4CZH A;  3GQ5 A;  4BC2 A;  5LJV A;  4DV2 M;  3HU3 A;  4BR2 A;  1WOQ A;  4K41 A;  3TPQ A;  1M1K O;  3U5Z A;  1YE9 A;  3VER A;  4JHD B;  2M60 A;  1GLE G;  4WQ4 C;  1BO5 O;  3D7E O;  5KPZ A;  5AR0 A;  3GLI A;  4GIT A;  4LJ8 A;  1YIJ N;  2XGN A;  3IKM A;  2QEX N;  1VQO N;  1HPM A;  3R9X B;  1Z6T A;  4P16 A;  4BVP A;  2JA2 A;  1NGA A;  3OW2 M;  4BY9 C;  1YHQ N;  4OVZ B;  1R2Y A;  5EOY A;  2PBD A;  2UYT A;  4LF7 M;  1YVN A;  2P9U A;  4WQ5 A;  3ZET A;  5AQR A;  4H0O A;  2E1Z A;  3U61 B;  1ILY A;  2C9O A;  1Q18 A;  1H1V A;  4A2B A;  4CZL A;  4O8K A;  1VDD A;  4H0P A;  3UKU B;  4IDH A;  3KSJ A;  3AGK A;  4DV0 M;  4LFB M;  3OA9 A;  4YOW A;  4H5T A;  2HBJ A;  1YJN N;  3O4W A;  1QZ5 A;  3L4Q A;  3QBX A;  5AQN A;  3H1Q A;  3CF6 E;  3L29 A;  5DNY A;  2E20 A;  3R6M A;  5LMU M;  2ASM A;  1R2Z A;  4U7B A;  1R59 O;  1NGC A;  3LVV A;  2IVN A;  4DV6 M;  4I8O A;  1GLF O;  4I6M A;  3CQX A;  3HM8 A;  3O9Q A;  1MDU B;  2D7H A;  1E94 E;  1HKB A;  1Q7Y O;  3HJQ A;  4LF8 M;  3MDQ A;  1IY0 A;  4PDI A;  2V52 B;  2Q1N A;  1GLJ O;  1S3X A;  4JYA M;  3EKU A;  1DGB A;  3DA1 A;  3H3O B;  3PXG A;  3DJC A;  2ZAN A;  3GP1 A;  3SYK A;  3O08 A;  3ENB A;  3TTD A;  4DR2 M;  2CV1 A;  4D81 A;  1O13 A;  3ULE B;  3FTD A;  1TDZ A;  1YF5 L;  4JI1 M;  5LJW A;  4KLN A;  3O1B A;  3GRY A;  3SHF A;  3ENH A;  2LH0 A;  3OHR A;  4AG5 A;  2DXI A;  2QBY B;  5GAH P;  1VQP N;  1CZA N;  4LF6 M;  5E26 A;  3WXK A;  1NM1 A;  1M90 O;  2F9T A;  1MWM A;  4B7F A;  3RSE B;  3CCR N;  3CQY A;  3CF5 L;  3EL2 A;  2UXD M;  4K42 A;  1HT2 E;  1T6C A;  4AKG A;  2QI2 A;  3H46 O;  4B7G A;  2P9S A;  4IWV A;  4M9S A;  1KAX A;  4JD2 B;  4WF9 L;  2Y20 A;  1C0G A;  3HHY A;  3D8L A;  4YOR A;  2QWN A;  3EKS A;  5EXS A;  2P9K A;  1MU5 A;  1G41 A;  4EIW A;  3P31 A;  5FTJ A;  5C1B A;  4M9Z A;  4GC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...