2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase 1
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
2ZGYA 1DKGD 4I6MA 3R8EA 2HF4A 3A5MC 1S22A 5BRDA 3W0LA 2FLOA 4A2AA 3A5NC 4QS8A 5KQDA 2A40A 4BROA 3BEXA 1KAZA 2H3GX 1D4XA 4BR4A 3SMSA 4I6MB 1GLCG 3BP8A 1GLFO 5AQVA 2P9UB 3BF1A 5AQWA 3FGUA 1V4TA 3HM8A 5AFUA 3D2EA 4BR7A 4CZJA 4H0YB 1ATNA 3UKRB 1T44A 3QFPA 5FPEA 1X9JA 4LC9B 1QHAA 2D1KA 3U4LA 4B1VA 4NO7A 5AQOA 1MA9B 3VESA 2VYPA 3HTVA 1C0FA 1GLBG 4YDUA 3A5LC 1HUXA 3LDNA 1QZ5A 3BUZB 3GG4A 4FWSA 1NWKA 3C0BA 4XEIA 2P9SB 3EN9A 4GY2B 3FZLA 4CZFA 5AQHA 4FL9A 4FWMA 2Q2RA 1YVNA 2E20A 4DB3A 5EOYA 5ADXA 4A2BA 4Z94A 1BA0A 5TKYA 3ZEUA 2ZGZA 4B9QA 5AQLA 5AR0A 3TPQA 4C23A 3D2FA 1GLLO 3MN7A 2I7PA 2BTFA 5AZJA 2QXLA 4CZKA 3VGMA 1X3NA 4H0XB 4FWOA 1TYQA 2HF3A 3ID8A 4K42A 1WOQA 1ATRA 2NLXA 1SQKA 4CJ7A 4M7XA 2CGLA 1BDGA 2E2NA 5AQGA 1ZXOA 4XH5A 3TU5A 3U9DA 4BG8A 2IVNA 2EWSA 2ASMA 1NGCA 2YI1A 5AQKA 1HLUA 4JNEA 2F9TA 3ZETB 5BRFA 1MDUB 5AQRA 3DJCA 4BVPA 1DGKN 1HPMA 3WXIA 2PBDA 2V7YA 3ZX3A 1QQMA 1MWMA 3MDQA 5JICA 4JD2A 2QWOA 2Q31A 1EQYA 2P9NA 4JN4A 4PKIA 1LOTB 4FOEA 4ISFA 3FZMA 3ZX2A 3H45C 3MN6A 4BGBA 5EXWA 5LY3A 1NGHA 3VEOA 2QWQA 2A42A 1BUPA 1BA1A 5F0XA 2FSKA 2YHWA 2P9NB 4RTFD 4O8KA 3CHWA 2GWKA 1OKJA 4PL8A 2IVOA 5AZIB 4BRIA 1HKCA 4WQ5C 3CJCA 3KHYA 3CETA 3VEZA 1RGIA 4CZIA 2YCHA 1T6DA 2YJFA 4PL7A 5B8HA 3QBXA 4KBOA 1U6ZA 2ASPA 3MN5A 1IJJA 2OANA 4RWTA 3ATVA 2IVPA 2ASOA 3L6QA 5AQQA 1HJOA 3L4IA 1NGGA 5LJWA 3LDQA 2FF3B 4B1XB 5F1XA 3CIPA 1C0GA 4H03B 4JAXA 4WQ4C 3IFRA 1TUUA 3RSEB 3WQUA 4CBXA 1GLAG 1RFQA 1YAGA 1J6ZA 4H0PA 4JHDA 4H0TB 2WUSA 2QWMA 2CGKA 3MN9A 3O4WA 2CH5A 4A61A 1K8KA 2E2QA 3KVGA 1HX1A 5JLFA 2F9WA 1JCGA 3FZKA 4IXCA 5AQXA 4CZMA 1SZ2A 4H5TA 3QBWA 4BG9A 4EFHA 2FSNA 1BOTO 4K41A 2NZTA 1YUWA 3FFKB 2E2PA 3D2EB 2PAVA 3H1VX 4BRQA 3CJ9A 2A3ZA 5FPDA 4K43A 3AARA 2E1YA 4BRKA 1GLEG 3QDKA 3VF4A 3I8BA 2GUPA 4ISGA 3QB0A 3WQTA 3H46O 4NB4A 2GEMA 3VGLA 1NGJA 2A5XA 3C7NA 3DAWA 3O6WA 5AQZA 4BQLA 1U2VA 5KQ8A 2ZF5O 3MCPA 3FLCO 1GLJO 2GWJA 3AAPA 1BWFO 5JMVA 2QWLA 3LL3A 5AQPA 2Q97A 2HOEA 3ZEUB 1GLDG 4BREA 4FOIA 1U2VB 2P9LA 3D2FB 2FF6A 2YJEA 3EO3A 4B1YB 2I7NA 1DEJA 5AZJB 5AQTA 4RCHA 1TYQB 4BR5A 1NBWA 5E26A 4PKHA 4EAHD 2Q1NA 4FWRA 2P9IA 1ZC6A 1WUAA 3AAQA 3WUHA 2P9LB 1JCFA 1NGAA 2FXUA 2P9PA 4IWVA 3H1QA 3IDHA 5AQYA 4FWKA 4CD1A 4AM7A 3O80A 1NGBA 1R59O 1Z6RA 3CJ1A 1YXQA 3QICA 4J8FA 3CERA 2ITMA 2D0OA 4FPAA 4HTLA 4CZGA 3A8YA 3MMVA 5FPNA 2W40A 1KXPA 3O1BA 4BRLA 4BQZA 4MLEA 2NRHA 5BPLA 2P9KA 4HWIA 3U8XA 5CE3A 4JD2B 3VF2A 4FSVA 5ELZA 2GTDA 4A62A 4CI6A 3WXLA 3W3DA 4H5RA 4MO4A 3B8AX 1HKGA 4H0VB 3BF3A 4FWLA 5E84A 4WYBA 1NGFA 4B1UB 4CBUA 3VPZA 4BRHA 4BRPA 1E4GT 3R9PA 3F9MA 3UKUA 4BC3A 3GOIA 1BU6O 1RDWX 3O5BA 5BPNA 5ADXH 3LM2A 2AA4A 5KPRA 3CQYA 4BR0A 3FR0A 3U9ZA 5EX5A 2E2OA 3M1FA 5KPTA 4MLHA 4Y0WA 5JLHA 1NGDA 3KZBA 5AQUA 2GELA 5AQMA 1ESVA 5EY4A 5BPMA 1X3MA 1KAYA 2CH6A 3JS6A 1KAXA 1NGIA 2Q36A 3QMLA 3H3OB 3A0IX 1CZAN 3H3NO 5AQNA 2FSJA 1JCEA 4EHTA 3VEXA 1QQNA 4FPBA 4PKGA 4XH4A 3DWLA 3SLCA 1V4SA 4JHDB 2QWNA 4BRGA 3O1WA 2D0PA 3VENA 1K8KB 3FE1A 2E1ZA 1BG3A 2P9UA 4BVOA 1NGEA 4BRCA 3D7EO 3H6EA 4FWQA 3UKRA 4IO8A 4QS7A 4CZHA 4BRMA 3HI0A 3I33A 2ZWHA 3VETA 4BR2A 3ENOA 3HZ6A 3GE1A 1P8ZA 2VCPA 1HKBA 4WQ5A 4EHUA 3IMXA 2QWPA 3S41A 4EIAA 5BRHA 4FWNA 2QW9A 2UYTA 2V52B 4XH1A 2YHYA 4QS9A 1ZBSA 4BGAA 2KHOA 4ISEA 3ZX0A 2QM1A 3M3ZA 3CJAA 3JXUA 3L0QA 3WT0A 3HBTA 2P9SA 3M6GA 4CZLA 3GBTA 3FZHA 4CD3A 1NLVA 2HMPA 3IUCA 3FZFA 1Q18A 2CGJA 4WQ4A 3C7NB 1Z05A 5AQSA 5KPZA 1LCUA 2V7ZA 4CBWA 2E88A 4IJNA 3GDQA 3UE5A 3G25A 4H5NA 3LDLA 3VEVA 3WXJA 3VF6A 3DXMA 3CQXA 3P4IA 3SK3A 3SMPA 2V51B 4IZ9A 2AP1A 3WEEA 5BN8A 3MK6A 5AQFA 1NMDA 4FO0A 3ULEA 3R6MA 5F2RA 5AQIA 1T6CA 3LDPA 3ATUA 3WXKA 3DXMB 3VEWA 4K25A 3A5OC 2P9IB 3WEEB 2IIRA 2J4RA 5BN9A 3EZWA 3ULEB 5AFUH 2DPNA 3ZETA 1SAZA 1H1VA 3LM9A 5AQJA 2P9PB 2W41A 2A6AA 4DCHA 3DXKA 4BR9A 4O5FA 4BC2A 2Q0UA 1ATSA 1QQOA 4FWPA 4M7YA 3VEYA 3O08A 3VGKA 3HSCA 4IJAA 5FPMA 2E8AA 3DXKB 3VERA 4H0OA 2BUPA 1IG8A 2QWRA 2P9KB 4BC4A 1G99A 5LJVA 5BREA 2VWBA 4E1JA 4M63C 1NM1A 4BRNA 4CZEA 3LDOA 3CI5A 5AZIA 3CJ7A 4F9OA 3GL1A 3AY9A 3SJHA 4DHYA 3UKUB 5EVZA 4MO5A 4GNIA 4BC5A 5I9EB 4L3QA 5BR9A 1QZ6A 4BRAA 1MWKA 3QFUA 4YDUC 2YHXA 1Y64A 3ENHA 4BRFA 4AM6A 3EKSA 1TUYA 3CJBA 3VOVA 3EL2A 2A41A 3UB5A 4DQ8A 3O8MA 4BRDA 2Q0RA 4B1ZA 3J8AA 1XC3A 3OHRA 1E4FT 3RSEA 2D4WA 3EKUA 1XQSC 1BO5O 4H5VA 1XUPO 4B1WB 4H5WA 1S3XA
chains in the Genus database with same CATH superfamily
2ZGYA 4I6MA 5C42A 3L27A 3MAQA 3LANA 2HF4A 3DLBA 3A5MC 5BRDA 3AVAA 3A5NC 1RT2A 3HJ8A 3AVIA 4BROA 1HQCA 2WSEF 2XSZD 3QESA 1RBUA 4OGCA 1D4XA 3TAQA 2HW3A 3SMSA 4ID5A 2WONA 1NJZA 1GLCG 2W82A 4IBGA 1GLFO 4M42A 1VQ6N 4DV7M 2EHGA 3L2AA 3HZJA 3TSQA 4JK8A 5GIOA 4EZ6A 1V4TA 4BR7A 4CZJA 4G1QA 1ATNA 2L6OA 3UKRB 4N47A 2OYQA 1VEGA 3CCMN 2RRUA 5CR4A 2JWKA 3V1RA 3PO4A 3SBGA 2D1KA 3KWGA 3U4LA 2R0IA 2F4VM 4NSOB 4NL4H 3RRHA 2P1JA 1BQMA 3O9RA 2MH8A 4JKEA 5GAGP 1DV0A 3ZSZA 1PRBA 1DGHB 1C0MA 3ZT4A 1QYRA 4FWSA 2DENA 4JI0M 3G71N 1QSSA 4X62M 4HL4A 4FWMA 3E21A 2E20A 4DB3A 5EOYA 4JI7K 4Z94A 3HPGA 4W5WA 4F2RA 4R71A 3J7BA 4I4LA 5ITXA 4JI4M 3K2LA 3VQ5A 4JYAM 2JY5A 2HKJA 4RW4A 4M3TA 1NK8A 1YT3A 5AZJA 1UOCA 2QXLA 2UUAK 4FWOA 1OH6A 3ID8A 1WOQA 3MHVC 1ATRA 3FFIA 1SQKA 3T3FA 1BDGA 1Y97A 2E2NA 3PSIA 3OYLA 3ULDA 5AQGA 4CK1A 3CYMA 4KRFA 1ZXOA 3LPTA 4JKGB 3J80O 4XH5A 1LAWA 1N77A 2DZOB 3VQAA 3KS4A 4RG8A 2IC3A 1N34K 2R65A 3KSJA 4Z4GA 4GKKM 2IVNA 4LG2A 3FYCA 1NMNA 2EWSA 5AQKA 3I0SA 1IY1A 2F9TA 4JNEA 2RHKA 4PDGA 4DTMA 1MDUB 5AQRA 1NK0A 1HT2E 1Q86O 4IBEA 1N75A 3K1JA 4B3MM 1EX4A 1PJSA 3JSMA 4LRSA 1DTQA 3RRGA 4E89A 4IIWA 3LCVB 2NRRA 3WXIA 3LMMA 1RBSA 3PLAA 4LFBK 2HHHK 1B9DA 4ELTA 2LVQD 4JD2A 1VQ4N 2P9NA 4FOEA 4ISFA 3OYFA 3FZMA 3ZX2A 4WFBL 1K6YA 1NGHA 1J7KA 2Z1HA 2KHHA 2A42A 3E66A 2LVNC 3ZSVA 4FD2A 1O1WA 5F0XA 2L09A 2QKKA 3SYKA 2YHWA 4RTFD 3L28A 2D5RA 3VTHA 3CHWA 1G4AE 1OKJA 2GWKA 4B9VA 5DNYA 2VGNA 1NU0A 2IVOA 5AZIB 4BDZA 3SPZA 3O3GA 4WQ5C 3VDPA 3SBTA 3CETA 4E0DA 1BVSA 1AUAA 1XC9A 3BGRA 4PL7A 2O8EA 2LTUA 3J81S 5B8HA 4IG0A 4Z4IA 1N6QA 2YFQA 4NXMK 1IXSA 3HSTB 2APLA 1RTHA 5DYIA 2IVPA 3L6QA 3HM9A 5AQQA 4DSEA 3PVSA 4CW7B 4R5PA 1N36K 3HU3A 4M3RA 3S3NA 1R7RA 3WHLA 5JS2A 5LJWA 3LDQA 3ZT0A 1PGYA 4Z8XA 3SQ1A 3KW6A 1GOCA 4DV4K 4Z4FA 3SQ4A 3K5NA 3WQUA 4CBXA 1NJYA 3AVMA 2YKMA 1GLAG 2HHSA 2IAJA 1J6ZA 2QZ4A 2QWMA 2RE2A 2KNAA 1GJTA 3IECA 3MN9A 3F92A 1FXXA 3U6OA 3OS1A 4KHYA 2E2QA 4CK3A 4II7A 5SZTA 2Z1GA 4CFCA 4JI5K 4LJ4A 4IDKA 4IXCA 1K73O 2HNDA 3KOWE 1RDUA 4ILJA 2E4LA 2KKZA 3CC4N 1UM8A 1JB0F 2YQZA 2JA2A 1VSDA 1KSPA 1BOTO 3C6TA 3HOTA 3HJQA 1YUWA 4HCCA 2E2PA 4PY5A 1E9RA 1HPZA 2MR9A 4FW2A 1VSHA 2D7EA 1RTJA 2PAVA 3P1GA 5HLFA 4BRQA 4J2DA 5DM6L 5FTKA 3DLGA 4K43A 3LVVA 3FRHA 3E1YA 1XMQK 1FJGK 2CP8A 1TF0B 4BE2A 1MN3A 3RWUA 2X4AA 2CHQA 3QDKA 1T7PA 5C15A 2VIIA 4OPHA 3CM6A 3TE6A 4DTSA 1JJ2M 2FFJA 4KO8A 3HOSA 2UU9K 1LV5A 4NYFA 3ALYA 1C0UA 1QS4A 4MDAA 2VF7A 1QQWA 2IGIA 2QK9A 4DUYK 4OU7A 3GLIE 1TTEA 2ZF5O 2F5PA 2VQEM 4AKGA 3MCPA 3V9XA 2UUCK 1TVRA 3OYJA 1IBMM 4B9MA 4IJFA 3AO3A 2PFUA 2QQ8A 1LWEA 2C99A 3ZH9B 5HRNA 2Z4RA 3J27B 4CIZA 1HNVA 4DR5K 4M45A 3KWIA 5I42A 1W5SA 2P9LA 5E41A 4KTZA 5KRSA 2KA6B 3LVWA 5AZJB 5AQTA 3FUTA 1VQNN 3AOGA 1WAFA 2NRWA 4FYDA 4LD0A 3DYAA 2O4IA 5E26A 3TQSA 3BY5A 3U6EA 4FWRA 4NOOB 4FLYA 3L25A 1JLFA 1JCFA 4FCVA 1NGAA 2FXUA 3G0ZA 4DR7K 3D8BA 1SKWA 4IWVA 4RW6A 1BI4B 3H1QA 3IDHA 3P5JA 5EQTA 3T7ZA 1TKDA 4GV3A 1NGBA 5EJCA 1TH2A 4J8FA 1YXQA 4KHWA 1NVMA 1RT5A 1GABA 3OYBA 4DSLA 4LJ6A 4CJPA 2D0OA 5FROA 3RMAA 2W40A 1NK4A 4CJLA 2OPRA 1E9SA 3OYNA 4MLEA 2MJ5B 3M8PA 1VSJA 4M0DA 4DV2K 2DFEA 1U4BA 1NKEA 1RDDA 4B3TK 2P9KA 1C1BA 2OTJN 4JD2B 1JKHA 4LFAK 5ELZA 4AHRA 3WXLA 1QVGM 1HKGA 3R8FA 4LF6M 3AVJA 3OYAA 5E84A 3MWPA 2QTDA 1OJLA 3J81O 3F9MA 3K59A 2RPIA 3UZUA 5LL6Z 1Q3BA 4LFCM 5ADXH 2AA4A 1R4GA 2DVWB 4OKEA 3SAHA 4LF8M 3FR0A 3K9JA 1SL1A 4DSKA 5EXXA 5EX5A 4H4MA 4MGYE 3DLHA 4Y0WA 3KZBA 2O8EB 2EO2A 1TL1A 3KLIA 2YNFA 3G4SN 1WBDA 3IRXA 1LTMA 3SV3A 3HHZA 2JNHA 4DV7K 3I8DA 1SV5A 1W97L 5EY4A 1IXSB 3AVGA 2CH6A 3GLGA 4FJJA 1OQYA 1ILYA 5HRRA 3H3OB 5IREB 3DFZA 3MEGA 3J7YP 1ASVA 4J2AA 2ZE2A 5CYQA 2XGNA 5GIPA 4CJ3A 5HOOA 3HJFA 4NRVA 2F4VK 1VQ1A 2HHQA 2PYJA 4KLNA 3OYKA 1TK8A 2QWNA 3S3MA 1MU5A 1XNRM 3U6FA 3AVFA 2D0PA 1QUTA 1SXJD 2P9UA 1IQPA 4BRCA 4JLHA 4JI0K 4FWQA 2BWEA 4X62K 1KVAA 4QS7A 4B3SM 3SPYA 4IBCA 1IM2A 2ZWHA 3VETA 4CJTA 2F5SA 3VQ8A 4CF1A 3HRGA 4XIUA 4CHOA 1HKBA 4WQ5A 5EP2A 2QWPA 3O9QA 4JI4K 2G8KA 3HYFA 2D0AA 4JYAK 1DGGA 4XGIA 1L3TA 3H08A 4JI8M 2W6KA 3ISNC 1QDTA 2UXBM 3GLHB 1ZBSA 4BGAA 3Q8XA 4F1IA 1RDCA 4ISEA 3THGA 1JLGA 3SAVA 3M3ZA 4WP2A 3JR4A 3HPOA 1BIUA 3FZHA 1GL6A 3CC7N 4CJKA 3AV0A 2BE2A 3QEXA 3OVNA 2OCEA 4ILGB 2G8LA 4BLCA 3OYMA 1Q18A 3O9UA 5FRMA 2DY4A 1Z05A 5L8RF 3QIOA 2C9CA 4R3DA 5KPZA 1LCUA 2V7ZA 1ZBIA 4DFKA 3FTDA 4DU3A 4AKIA 3G25A 4B3MK 2B3TA 2NRXA 4KPYA 2DFFA 3S3OA 2J7OA 4KHQA 4UY8O 4B3OA 4IZ9A 2AP1A 2DZLA 3A46A 5AQFA 1C1AA 3R6MA 3FUUA 3V4IA 1HYZA 3OBWA 3NGIA 3LDPA 4CJWA 3ATUA 3KKSA 2VG7A 3WXKA 4GV9A 3D8LA 5C0YA 5C1BA 3SARA 3ZYYX 1KVCA 2ZANA 1XWIA 3SCXA 1TH3A 2X6SA 3V76A 2IIRA 2LHGA 2J4RA 3EZWA 1QAQA 3MEEA 3KVWA 3ZETA 3IG5A 3KK7A 4KH5A 4CHYA 4MGIE 4GIPA 4IFYA 4JV5M 4L4UA 4DBGB 1WLJA 4MH0E 4F3OA 3KK2A 3DXKA 3OBYA 4O5FA 1N5YA 4FJ5A 4DV6M 1ATSA 2ZJQL 1M1KO 3DLKA 2O8FA 1YLAA 3GPUA 1HQEA 2HNYA 1G41A 3B7QA 2L2DA 4Z6YA 4QNMA 4OGEA 3VERA 3C3EA 2BUPA 4KAZA 2C5RA 1IG8A 2CV0A 2P9KB 3CFPA 3R1XA 4BC4A 3KD5E 3GPPA 5BREA 4OX9M 4Z4CA 1NM1A 3GLHE 1HJPA 4M41A 4BRNA 1VQKN 3NWLA 2JGUA 1T05A 2CHGA 4F9OA 5GINA 5H37D 4GMQA 3PFIA 3SJHA 1IBLM 2HHTA 5I9EB 4TSXA 1NY5A 3OYEA 2VQFM 4L6V6 5BR9A 4RNAA 2O8DA 5DYGA 4KB0A 4IFVA 4JKAA 2FBYA 4LF4M 1TKZA 3ENHA 1TUYA 4FJXA 3SQ0A 2CV2A 1GOAA 3EL2A 3VQ6A 2A41A 5EXPA 4LH5A 4B7GA 1BISA 3V1QA 3AGKA 4AHSA 3OYHA 3NMUA 1WB9A 4B1ZA 1J5EK 2Q2EB 1XC3A 5DK5A 3OHRA 1NNJA 3EKUA 1OH7A 3GLGB 4M3YA 1SL2A 1E32A 3FUVA 2ITGA 3VQDA 4B1WB 4H5WA 3A2FA 1DKGD 4GHAA 3R8EA 4DFPA 1X9SA 4M3XA 4A3VB 4XK8F 5IT9S 1S6PA 4PUOA 4QS8A 3SAGA 2A40A 3PXGA 4HTUA 3NBIA 3BEXA 2BWBA 5C2DA 4K0KK 4C1NI 3MXJA 4U7BA 2QA4N 1N78A 1VQPN 4IOXA 3I51A 2P9UB 5AFUA 1SXJE 3FGUA 4NLBA 4KI6A 3QAUA 4YOXA 4CEBA 3CTWB 1S9EA 2VQEK 4Q0BA 1IBMK 1TAQA 3QFPA 5FPEA 1NKBA 1Q9XA 2UUBM 1DGHA 4NO7A 4O8UA 1MX0A 3GQ5A 3ZC7B 1U45A 2CUZA 1RDAA 2VYPA 3HTVA 1D0KA 1JLAA 1BGXT 4QOSA 3DOAA 3IKMA 2WZJA 3THVA 1L2BA 1IO2A 4KV8A 2QI2A 2M60A 3LDNA 4NXNM 1QE1A 1QZ5A 4Q7JA 1NWKA 3C0BA 1EP4A 1DTTA 3FZLA 5AQHA 2O01F 2LH0A 4PD2A 5J2MA 1DLOA 5ADXA 3V9ZA 1XMOM 3VQEA 3SI6A 3ZSOA 2RKOA 7CATA 3SASA 1MU2A 3ZEUA 4B9QA 3TPQA 2XY7A 1OFIA 2KXEA 3HT3A 4TUWA 5KO3A 1GLLO 3VQQA 2GUIA 1WGNA 3RGPA 2KTQA 2ZM6K 3TAPA 3VK7A 2CRUA 5CZ1A 2WTUA 3U6CA 4M9XA 4DQSA 4DUYM 3J7AS 4CJ7A 4YOTA 5EP3A 4FK2A 2V6ZM 2F7TA 2UUCM 4YOVA 2XSZA 3HP9A 4O0IA 3RR7A 4CHTB 3KOZE 4LF6K 3HVRA 4HUEA 2ASMA 2A1RA 3ZETB 5BRFA 2P5TA 3HP6A 4BVPA 2FNAA 1P3QQ 3RMCA 4DTOA 2P51A 4LFCK 1HPMA 3IHPA 1KLMA 5GAEP 2PZSA 2PBDA 1IH7A 4OVLA 4LJ5A 3HGIA 2V7YA 1XWLA 3TTDA 3MDQA 4HLQA 2Q31A 4E7KA 2O8FB 4PKIA 1LOTB 3CPEA 3H45C 3C6HA 5EXWA 1NY6A 3CCLN 1VRUA 3I55N 1LAVA 1I4WA 1WAJA 2BH1A 2JY8A 3KLHA 1T43A 5KGXA 3WNEA 2KW0A 3NAEA 1YIJN 2O8CB 1QAOA 4B9SA 4BRIA 1HKCA 2KZZA 1QUSA 1KSFX 4EP5A 3KHYA 3TR8A 1TH4A 1WR1B 4B3TM 1NKCA 1T6DA 2F5OA 4DLGA 2XO7A 4WFAL 2LHCA 3LQRA 3L3VA 3NGZA 2O8DB 4CEQA 2ZTCA 3QBXA 3WNGA 2XLJA 1U6ZA 4FJLA 3MN5A 3AGRA 1NJGA 3ATVA 4B3SK 5FRNA 4CEFA 5IT9O 5SWMA 2DKLA 5A2QS 1I39A 4DR2M 1NGGA 5LMNM 4B1XB 3L2QA 4IDHA 3BZCA 1XXHE 4CJUA 4EP4A 2R4JA 3IFRA 1S1XA 4CJ4A 4YY3M 3OJUA 1RFQA 3ZSYA 4DTPA 4H0PA 2JZ1A 3GRRA 4JI8K 2UXBK 1R6BX 3K5LA 3SV4A 3SUNA 4DG1A 4A61A 1K8KA 3LQQA 1JLBA 4GMJB 4M3ZA 1Y8GA 2OO9A 5JLFA 1JCGA 3ILKA 3B89A 4DUZM 2G8UA 4X66M 3D45A 4UQGA 2OOBA 4C1NK 4CZMA 1SZ2A 3QBWA 3DLEA 4KREA 5J2NA 3R3LA 3RMBA 1FNNA 4FWDA 4YOUA 4GVEA 1OFHA 1IFYA 3CJ9A 3QLHA 4W5RA 3E01A 3KLEA 3ITHA 3M5RA 5FPDA 4AKHA 1QQCA 3J7AP 2E1YA 5FTMA 2HBJA 4BRKA 3KP0E 2YKNA 3LAKA 5C12A 1XNQM 3VF4A 1OVYA 4LJ7A 3LDSA 1QSLA 3F9KA 4JRQA 4JI2M 1K9MO 1UA1A 3K92A 1L5UA 3P39A 4JS4A 4H8KA 3MJ5A 3NH2A 4JEPA 3DAWA 3FTFA 1BQNA 1YUBA 1RT4A 2OZMA 2GWJA 2M5ZA 1KRPA 2E6MA 5JMVA 4JV5K 1KQSM 4JKFA 1VSIA 2YHAA 3ZEUB 3E9LA 4I2PA 4J2BA 2HHWA 4FOIA 1U2VB 4NC6A 4DV6K 4C8LA 1TGOA 4B1YB 1ZBFA 1NK9A 1HNXM 2I7NA 3OS2A 1L3UA 5KTQA 3TWHA 5HP1A 1BI4A 4PKHA 5FLXS 1ZC6A 3HPHA 4CHZA 3B6OA 1P90A 4OX9K 2RN2A 4GC5A 2JWSA 5AQYA 3WXMB 4IBIA 1E94E 1C0TA 1IBLK 3CERA 2ITMA 4CZGA 3A8YA 3MMVA 1RT6A 4LF5M 3HVTA 2VQFK 3S9HA 1KXPA 3O1BA 4K8XA 1D0LA 3DRPA 2D7HA 3WHKA 4FLUA 3GRUA 2O25A 4BQZA 3NDKA 4LF4K 1WSJA 5EU7A 2NRHA 5BPLA 3C6AA 1SS6A 2B5JA 5CE3A 4FSVA 3ZSRA 1A5WA 1GKIA 4IKFA 4AG6A 4DLEA 4H5RA 4MO4A 5J2QA 3O4QA 1T6OA 3K2PA 4H0VB 1DO2A 3C58A 3BF3A 1NV8A 1Z5BA 1NGFA 4B1UB 2YNMD 4CBUA 1WSFA 4BRPA 1JLQA 3GLIB 3UKUA 2P5OA 5EXTA 1TK0A 3GOIA 1BU6O 2DWZB 1RDWX 5BPNA 4CHNA 4F8RA 3LM2A 4A59A 3CQYA 1RBVA 4BR0A 5ITUA 2UXDK 1VAZA 2QCUA 3KOYE 1U04A 4BWJA 4DWIA 1YJWN 5A2QO 3DI6A 1JQJC 3TL4X 2GELA 3NHGA 1DGBA 2DAIA 3PSFA 3EYZA 1RILA 4AF1A 2OPFA 3GLFE 1CXUA 2QXFA 5BPMA 4GV6A 1QVFM 5T7BA 2G8IA 3PIPL 2XRIA 3JS6A 3SHGB 3DMJA 3QMLA 1HNIA 1OAOC 3A0IX 4KHPM 1N33M 1QAMA 2UUBK 1V33A 1KYIA 4OW0A 1QQNA 4FPBA 4XH4A 3D0PA 2FS1A 3DWLA 3PNVA 4S12A 3VTIA 2N35A 1VQ5N 4BRGA 2ZD1A 3K5OA 2HL7A 4CECA 3VENA 3HWSA 1K8KB 4NXNK 4KHNA 2E1ZA 1J5EM 1BG3A 4HUGA 4RF0A 4KH4A 2NQ8C 4MGZE 4CJSA 4IO8A 2HMIA 4CZHA 4BRMA 4FVUA 3SHFA 4CFDA 4FM1A 2NRZA 1XMOK 3AOEC 3HZ6A 3GLHA 1P8ZA 2VCPA 4DTNA 3IMXA 5BRHA 4WF9L 4XH1A 4YHHM 3KK3A 4CGFA 3SAWA 2KFNA 4K0KM 4QS9A 2R62A 4WURA 1RDBA 2KHOA 3K57A 4O0JA 3ZX0A 4BY9C 1X37A 3BXWA 1RCHA 4JI6K 3HBTA 2P9SA 3OA9A 2JP7A 1RBTA 3ZCBB 3B74A 4CCHA 4FK0A 1N32M 3BDPA 1BHLA 3FZFA 4UN2B 4RKUF 4X64M 2OZSA 3I04M 1J53A 1GLNA 5C10A 2E88A 3EE8A 2Z8YM 4H5NA 1SKRA 5FLXO 4G4RA 1EETA 1KFSA 4M9SA 2BANA 2ATQA 4L8RB 2V51B 2IDOA 1NJWA 3K9KA 2QHOB 3MK6A 4FO0A 5F2RA 1LW0A 5AQIA 2X8AA 4BBAA 4KB1A 3DXMB 4E7IA 3KP1E 4NSRA 3L2WA 3RMDA 3A5OC 3L8BA 3CCQN 1SXJA 1B92A 3ULEB 5AFUH 2DPNA 2X74A 1KVBA 3NBPA 4FJKA 4Z4EA 4FJNA 1K8AO 3KIOA 4IBBA 2ZM6M 1PJIA 1XI1A 4F2LA 4N56A 3TAGA 1UWBA 1YJNN 2DAEA 4Z4HA 3CF0A 3SNNA 1A5TA 3QYBA 5BPVA 2O4GA 2FC0A 1QQOA 2Q0UA 4JKCA 3OW2M 4OLBA 1CZ9A 4DR4M 4DR6M 4G3OA 2FBTA 2WOMA 3HSCA 4CE9A 2E8AA 4JXJA 1M90O 4H0OA 1S9GA 2KRKA 4N5SA 2QWRA 4GHLA 2DWNA 1WN7A 2V1CA 3M0EA 4E1JA 3GRYA 3AJIB 2WSFF 3NH1A 3PUFA 4L78A 4D82A 1Q02A 3LDOA 3CI5A 4DR2K 5LMNK 3QIPA 3T38A 3AY9A 4KFBA 2R45A 4YY3K 4PA1A 2EUCA 2GX9A 2JZ0A 3UKUB 2DHRA 4DV1M 4GNIA 1KFVA 4HCBA 2ZJPL 5GKNA 1G3IA 1GO5A 1JLCA 2V1UA 4FW1A 1Y64A 4BRFA 1G15A 2Q3SA 4DUZK 1ZMWA 3DLRA 2OA8A 2HVHA 2JXNA 1IN8A 3VOVA 4FCTA 3SAFA 4X66K 1FK9A 2JWLA 3T1AA 3LCUA 2G8HA 4BRDA 3RVCA 1HT1E 5C25A 2DI0A 5I3UA 1KCFA 3N4PA 1NJXA 3RSEA 2D4WA 5HROA 2QKBA 8CATA 1XQSC 1CXQA 4H5VA 2DFHA 4AHVA 1TV6A 4OLAA 4LJ8A 2C96A 3NFAA 1S22A 3CM5A 5FSWA 4F2SA 4QHSA 5KQDA 1WSGA 2QP9X 1XNQK 1YJ9N 4IBKA 1VSEA 3M8SA 4BR4A 1NG9A 4JI2K 1IBKM 3R9XB 1WSHA 3T1HM 3W0LB 2BDPA 3WNFA 3U6MA 1PJJA 5AQVA 5AQWA 4FWHA 1HRHA 3D2EA 5J1EA 1B9FA 4H0YB 1ZBUA 4WCEL 4GKJM 2FH0A 1T44A 3E46A 4AH9A 4LZJA 1EKEA 3KLFA 3AA3A 3OYDA 2KEBA 3NE6A 3O9TA 4QCLA 1X9JA 4LC9B 4B1VA 4KT0F 1KC8O 4DTJA 1CZBA 1X1PA 2RF2A 3T69A 2QSFX 3SC3A 1HNXK 2HHUA 1ZV1A 1C0FA 4CJEA 4QHTA 1CLQA 3A5LC 2HB5A 2Z1JA 3BUZB 3AA5X 5M1OA 2P9SB 3EN9A 3LP3A 4CGHA 2XF3A 2HWJA 1WGLA 3FKEA 2CV1A 4FL9A 2Q2RA 1YVNA 4N76A 2QEXN 3SYLA 1NHGC 4A2BA 3EZ5A 2D7GA 4AZFA 1BA0A 1WJ7A 4DR3M 2ZGZA 2HCBA 2HBLA 1VRTA 5AQLA 1TGUA 1XXHA 5AR0A 1HJRA 4C23A 4CF8A 3KK1A 1BIZA 3MN7A 4DQPA 1UFZA 2BTFA 1GL7A 2Z7JA 4CZKA 1MJGM 4LF5K 1X3NA 3DLLL 4G9ZA 4CGIA 1TYQA 2D0BA 3MWTA 1VSMA 4GEWA 4CESA 4CERA 3IG8A 3LZIA 1VHXA 2CGLA 3DRSA 3C3DA 1HR0M 2R46A 3AOEA 1VK0A 2CE7A 4KODA 1OH8A 1V92A 1NK7A 4CHPA 4FJ8A 4BG8A 4MFBA 2YI1A 3M7GA 1SXJB 4FZYA 2ZAOA 1HLUA 3DJCA 1YSYA 4IOCL 1L2DA 1DGKN 1RT1A 4D81A 3VLFB 3PX4A 3T19A 3CF5L 4FJGA 1E3MA 4FJ7A 5JICA 4KTWA 5EXSA 3CGWA 2QWOA 1QZMA 4JN4A 4DR1K 4E7JA 4BB9A 3MN6A 3Q7CA 4BGBA 5M1NA 3PY8A 5LY3A 2FE8A 3VEOA 2O8CA 2QWQA 3ZSQA 3UIQA 1XB2B 1BUPA 2WBNA 4AHTA 1BA1A 2K47A 5E6JA 4O8KA 5FTJA 1VEKA 4PL8A 4AW4A 4KHPK 4KKOA 1N33K 3TPZA 4H4OA 4DV3K 1AIPC 3VEZA 3OYGA 4BE1A 4DSIA 2YCHA 5D3GA 3A42A 2YJFA 3AVLA 4LGYA 3L2VA 4DTXA 1IN6A 4ZPXA 3LP1A 2KZSA 1NHWC 3ZLJA 1LV7A 1Q8IA 3A45A 3PX0A 2OANA 4RWTA 2OQ4A 3VQPA 4W5NA 1YHQN 1JL1A 4LZZA 4ICLA 4E1NA 1IKVA 1HJOA 3TANA 4CJFA 4O55A 2FF3B 5F1XA 3CIPA 4B9UA 2F96A 2HHXA 2UXDM 3RSEB 4U67L 1H6UA 4YHHK 4L8RC 2MROB 4FCWA 3KTQA 4H0TB 3C9PA 4IJEA 3SAUA 2WUSA 1S1TA 3AL0C 3AVKA 2CGKA 1Q81O 3O4WA 1K3XA 2LWXA 2CH5A 3KXEC 1W7AA 1HYVA 4FJ9A 4AHCA 3HX3A 1L8QA 1HX1A 4I7FA 2F9WA 3FZKA 4Q5VA 3KSXA 5KI6A 4CEZA 2HVIA 1V34A 1HNWK 5AQXA 4ANRA 1G8PA 1QANA 4EFHA 1N32K 3KKRA 1K3WA 4K41A 2VF8A 2NZTA 4X64K 3QETA 1R0AA 3FFKB 2AHMA 3D2EB 3H1VX 3ZT2A 1NNEA 1N8RO 3JAMS 5K14A 4LF9M 3AVBA 3HL8A 1VQON 4B3RM 1L2CA 5BR8M 2OPSA 1GLEG 4RF1A 1TAUA 2NRVA 4BDYA 2KNVA 4ISGA 3WQTA 1Z59A 3H46O 1WXQA 3L2RA 2R44A 1NGJA 2XFSA 3C65A 1ORYB 1RBRA 3AO5A 3GLFA 2FBXA 1U2VA 1T3VA 4BQLA 1IXZA 3HY5A 3AAPA 3FLCO 4GVMA 1REVA 3LWMA 4LY6A 4L16A 2QWLA 3LL3A 1L1ZA 4HEOA 5AQPA 1A5XA 1YTAA 4DFJA 3PNYA 1XXHB 4JI6M 4BREA 4DF8A 4PWDA 3FUWA 3LP2A 4DS5A 3TAMA 2FF6A 2YJEA 1NK6A 5FDLA 3C94A 2O8BA 3K5MA 1TYQB 3AA4A 5H1SQ 3SJJA 4BR5A 4DR4K 4DR6K 2R4EA 5C24A 3CQ8A 1YI2N 4EAHD 2Q1NA 1ZQ9A 2P9IA 4LF7M 1WUAA 3LPUA 3AAQA 3KD1E 2OPQA 4OKJA 3J2PB 1OAIA 3SYZA 2P9PA 3TWKA 2HNZA 1O13A 1PJQA 1VG5A 1LWFA 4AM7A 4GRIA 1NJIO 1R59O 4L15A 3CJ1A 4LJAA 4YFUA 3V9UA 3ZQJA 4CJ6A 3ZSWA 4B7FA 5JS1A 2ZQBA 3T15A 4YOYA 4DV1K 4EIWA 2BJVA 4BDPA 4O5BA 4OPKA 1XC8A 4IOAL 4HWIA 3U8XA 5FTNA 5M1PA 3GLIA 1EWQA 4CI6A 2GTDA 3PO5A 3RGSA 3W3DA 1C7YA 3CXCM 2G5GX 3LWLA 4CF9A 2YNHA 2IS3A 3KLGA 4ELVA 3N4QA 4B7HA 1E4GT 3R9PA 5KRTA 4BC3A 3K8ZA 4AQYM 5M1QA 2G8VA 2OOAA 3O5BA 1IXRC 5KPRA 1C1CA 1JR3D 3HU1A 3K9OA 3U9ZA 2E2OA 2F8TA 3LW5F 5KPTA 4MLHA 4CF2A 1NSFA 1NGDA 5JLHA 1WSIA 5AQUA 3KDSE 4IEEA 1YITN 1IBKK 5AQMA 1HNZK 3T1HK 2X78A 1QVRA 2F5QA 4LY7A 3U6QA 1ASUA 3GQ4A 3H4JA 4CGDA 4DSFA 4G4QA 1KAXA 4GKJK 2Q36A 5MLCQ 2ETJA 4QOZB 2BJWA 2BGGA 3H3NO 5AQNA 3C6UA 1JCEA 3SLCA 4OO1J 1TKXA 3KS8A 1V4SA 4JKDA 3L2UA 3THWB 1IN5A 2EJSA 2ZBKB 4D80A 4AI6A 3MCAB 3SZ2A 3O1WA 1YTUA 1VQ8N 3SBJA 1D5AA 3AVCA 4BVOA 1NGEA 4PDIA 4I9QA 3D7EO 4ZHRA 3H6EA 3JAMO 3QNOA 2XY5A 4MB7A 1VDDA 4FK4A 1SXJC 2RGHA 2ZJRL 2LVAA 2UXCK 3K9PA 4BR2A 3GE1A 5EP4A 4EHUA 4DR3K 3V9WA 4FWNA 4PT5A 2XH9A 2QW9A 2UYTA 2V52B 3T1YM 4PHTX 2Y0TA 2DXIA 1JXBA 1VEJA 3VKHA 2RGOA 1ASWA 3VN5A 4BACA 2HSTA 3GO8A 5DFLA 4C8NA 4FLXA 3I0RA 3L0QA 4ELUA 3OYIA 3W67A 3U5ZA 1EXQA 4CD3A 4I2QA 4B8AB 3NH0A 5C18A 3TSPA 1NLVA 1HR0K 2HMPA 3IUCA 2JY7A 4FW9A 3MECA 3CFOA 3SFZA 5AQSA 3GLFB 4CBWA 4HUFA 4IJNA 3GDQA 4ID1A 3UE5A 4CJQA 4JN6A 5F3WA 3LDLA 3SUQA 3WXJA 3AO4A 3VF6A 4Y28F 3DXMA 3P4IA 3GQ3A 1F21A 3HXMA 1X9MA 3GRVA 4FLWA 1D9DA 3CCVN 1RT7A 3ULEA 1NK5A 3M8RA 2O8BB 4CJ5A 1S1WA 1L3SA 4K25A 4DSJA 3EIEA 1S6QA 2QBYB 3HHWA 2P9IB 2Y20A 3WEEB 3HHYA 1SG9A 3FYDA 1Z6TA 4IFEA 1DO0A 4IBFA 1H1VA 3F5TA 2P9PB 4LGMA 4LH4A 2YX6A 4DTUA 4FZXC 4GH9A 2B6AA 4DCHA 2PY5A 2EA0A 1Z25A 4BR9A 2YV0X 5J2PA 3TAFA 4CFBA 4W5OA 3AKZA 3U60A 4CGYB 3QEWA 3M8QA 4DFMA 2Y1IA 2LBCA 1ZMUA 3VEYA 3L29A 3O08A 2XFTA 3THXA 3E9PA 2K6BA 3CMAN 1KLNA 2DZNB 2P5GA 2KDLA 3IS9A 1L3VA 4KHSA 3CCJN 1OTRA 3JR5A 2E5LM 5GAHP 4V19S 3ZSXA 3QEVA 1RNHA 4M63C 3CF6E 3M6AA 2H1RA 1NV9A 3BBZA 4CZEA 4GW6A 5ITTA 5CHIA 1ITGA 3CJ7A 3GL1A 3DM2A 1G59A 4KI4A 2OTLN 3THYA 4FLTA 3MMPA 3O3HA 1PM5A 4MO5A 4PQUA 4BC5A 1UAXA 4B9LA 4DR1M 4L3QA 3FTEA 1QZ6A 1VQ9N 4NCBA 5CYMA 4CHQA 1W5TA 5LMUM 5IWAM 2YHXA 1JR3E 4AM6A 4RW8A 4CJVA 1W0HA 3QYEA 4JI1M 1XHXA 4DQ8A 1DT9A 2BNKA 4DV0M 2QNJA 4DV3M 2ERCA 2K9DA 3J8AA 3K0SA 1Q9YA 1Q39A 1HMVA 3TWLA 1E4FT 4B9TA 2KFZA 4B8CA 3B7ZA 1BO5O 4CEOA 2CFOA 5IZ7D 4LF9K 1U48A 4NCGA 1WSEA 4B3RK 2YNGA 5M1FA 5BR8K 3W0LA 4JI3M 2FLOA 1EWRA 4A2AA 3I01M 3NCIA 4N41A 4QNRA 1KAZA 2H3GX 3DOLA 3OYCA 2GNOA 2PYLA 3G10A 4I6MB 1U47A 3BP8A 2O5RA 4BE0A 3NF7A 3BF1A 1RTIA 3HM8A 2R18A 4M0WA 2E6LA 2XEPA 5JVGL 1ZBLA 3V6DA 2FBVA 4CISA 4FJHA 3E9OA 1QHAA 3B7NA 3TI0A 5AQOA 1MA9B 3FD9A 3CCEN 3VESA 5HRPA 4J2EA 4AG5A 1GLBG 2KQ2A 1HNWM 4CK2A 1ZYQA 4NRWA 4YDUA 5CY4A 1HUXA 2VWKA 3TARA 2XZFA 3GG4A 5JVHL 3O9SA 4XEIA 3OTOM 4CEDA 4LF7K 4QAGA 4CFAA 2WSCF 3TAEA 4GY2B 4CZFA 3U5ZB 2G3QA 1WHCA 5DMRA 4CEEA 1R2ZA 3AA2A 3GP1A 3ASMA 5TKYA 3NVMA 1IN7A 1GOBA 5EP1A 4YNQA 3HO1A 4G4OA 1WIVA 4AILC 4LSLA 3D2FA 2KZMA 2I7PA 3BZKA 4I8OA 3O3FA 3VGMA 4H0XB 2Y0QA 2VWJA 2Y21A 3EE9A 4DKWA 3A98B 3VA0A 3QINA 4X65M 1KFDA 2HF3A 3I56N 1UA0A 4K42A 2X6NA 4FJMA 2NLXA 3BOSA 3GPXA 3FUXA 4M7XA 1XHZA 4PCZA 1W9HA 1F4IA 4DMNA 4I9LA 2YHBA 3TU5A 4DU1A 4O4GA 4FLVA 4QOZC 3U9DA 5CZ2A 1NGCA 3W0FA 1K82A 5JI2E 2G8FA 2G8WA 4CEAA 1JXEA 3D6RA 4LJ9A 1D8YA 4JKHA 4AQYK 1S3SA 4CGJA 1HQYE 1QDRA 1R5LA 1VDLA 4C8OA 3CFRA 1TK5A 3HJSA 4CVNE 1J09A 2KW4A 4YOWA 1NNUC 3ZX3A 2A1SA 1GJSA 3DA1A 3U60B 1MWMA 1QQMA 4DF4A 4MM3B 3HU2A 3QWLA 1EQYA 3NBXX 4O44A 4W5TA 1RT3A 3THXB 1Q3CA 1T8EA 4FVMA 3VQ9A 4G6ZA 1YF5L 2J7NA 4DTRA 3QEPA 3MEDA 2Z3XA 2W42A 2FSKA 5FTLA 2P9NB 1SL0A 4E3SA 3IAYA 2AJQA 1VQ7N 1W2BM 5ITQA 4FXDA 4DV5M 4Y1DA 2F8SA 2HBMA 4WW0A 2L7HA 3CJCA 1BCMA 1RGIA 2K0BX 4CZIA 3THYB 2L7IA 3HKPA 2KRUA 3V9SA 3UJNA 3QO9A 4NCAA 4KBOA 2ASPA 3UMMA 1IJJA 3EEQA 1OVQA 2ASOA 4JS5A 4E7LA 1JLEA 3VFDA 3OS0A 1HYSA 3L4IA 3LZJA 5ITXE 3G6EN 3U6LA 1C0GA 4H03B 4JAXA 4WQ4C 1SUQA 4KO0A 1TUUA 3T1YK 1YAGA 3DZDA 4JHDA 4FCYA 4FWGA 1QTMA 3NF8A 1FKOA 2VG5A 1HNZM 4F3TA 3VKGA 4DU4A 3KVGA 4K8ZA 4CIGA 4LRTA 4A57A 3UGJA 2NRTA 3MXMA 1VQLN 1Z5CA 1TDHA 4A5AA 4B9NA 3C95A 4H5TA 4BG9A 4I5SA 2FSNA 1VSKA 1TR8A 3P83D 3TTFA 1I94M 2ZAMA 4LCBA 1QSYA 1VSLA 4OVZA 2A3ZA 2A5YB 3MX5A 3RFWA 2NUBA 3F2KA 3CCRN 2IOCA 4AHUA 3AARA 1CUKA 3QEIA 4OPAA 4CJRA 4JRPA 1L1TA 4IBNA 4DQIA 4FM0A 2F5NA 3I8BA 2GUPA 3V81A 3QB0A 3ZCMA 4WFNL 3IG1A 4NB4A 2UXCM 2GEMA 3VGLA 3Q7BA 2R7YA 5DM7L 1TL3A 1S1VA 2A5XA 2LVPC 3C7NA 1YE9A 3O6WA 4F4KA 5AQZA 2DWMA 3ENBA 2RKIA 5KQ8A 1GLJO 3EIHA 3OY9A 1I3AA 2JLEA 1S5JA 1BWFO 3KOXE 4EZ9A 2Q97A 2DHYA 1LW2A 4P17A 2HOEA 3QNNA 1GLDG 1IG9A 1FW6A 4GKKK 3AFHA 3GPYA 3U6DA 3D2FB 3EO3A 4JKBA 4ZTFA 3CMEN 1DEJA 1T03A 4RCHA 3NVKA 1GVNA 4DS4A 1OIPA 1NBWA 4OPJA 3JYTA 2KZUA 3WUHA 2P9LB 1DGFA 2J5YA 1BL3A 1Q82O 2E5LK 3VMFB 3U6PA 2DNAA 4JI7M 3U61A 3SUPA 4XBOA 3CPWM 4CD1A 1IKYA 4FWKA 2L4EA 2YR0A 1YVUA 3O80A 1X9WA 2XZUA 2B4JA 3VQBA 1Z6RA 1PJTA 3QICA 4MQ3A 2MGWA 1D0MA 4FPAA 4HTLA 2UUAM 5FPNA 1OIZA 3NF6A 4BRLA 1EFUB 5JI3E 5LMUK 2C98A 1IY0A 2LSNA 5IWAK 4KH6A 1EO1A 3VF2A 1FKPA 3TABA 4A62A 4JI1K 1C1KA 2KLAA 4Y1CA 3B8AX 2CWBA 4DV0K 3VDUA 4FM2A 4CIFA 1N34M 3V1OA 1NOYA 3LP0A 4FWLA 4WYBA 2VDBB 3VPZA 5TKWA 4C8MA 4BRHA 1RTDA 1ZBHA 3P31A 1VQMN 4OJRA 3ZT3A 4B08A 1ZMVA 3L3UA 4BWMA 4MGHA 2EKFA 5C2FA 4JI3K 5HL7L 4LFBM 3FRIA 4IG3A 2HHHM 4NLCA 2JUJA 3RTVA 2XY6A 1ZAEA 3M1FA 1U49A 1IY2A 2I5JA 3FE3A 4OKKA 2GQFA 4YORA 1NO1A 4E7HA 1ESVA 3HK2A 2CHVA 3VQ7A 1X3MA 3TSUA 1KAYA 3CD6N 1EIJA 4GC9A 1NGIA 3THWA 3CC2N 3MXIA 1QHTA 4ILHA 3NF9A 3DOKA 4W5QA 1CZAN 2HAKA 1Z26A 2XY8A 2FSJA 4EHTA 3K58A 3E4RA 3VEXA 3WNHA 4PKGA 1T3TA 3PV8A 1S72N 1OH5A 4E1MA 5GADP 2WC9A 5AJ3K 1S1UA 4JHDB 2LVOC 4CIEA 1RU3A 3AVHA 1IKXA 4G4NA 3H4MA 3FE1A 3AVNA 1WBBA 4KTQA 1QZEA 1XHBA 3ZT1A 3OTOK 4NXMM 3UK6A 4DQRA 1KD1O 2DAGA 1A5VA 3UKRA 5HBMA 3HI0A 3CF2A 3I33A 1N36M 3QERA 2JY6B 3LALA 3ENOA 3CCUN 3J7ZO 3OJSA 2QPAA 2XHBA 4E19A 1LWCA 4EIAA 3S41A 4DV4M 3Q8GA 4GITA 2YHYA 4OVZB 2EX3A 4M9ZA 5KGWA 3KJVA 3RE8A 3VQ4A 2C9OA 3CG7A 2X49A 2HBKA 4X65K 1D2NA 2QM1A 2WFBA 4HHTA 3CJAA 1WNSA 3JXUA 2HHVA 4IBDA 3WT0A 3M6GA 1OKSA 1JR3A 4JI5M 2OPPA 2W6LA 2LNHC 1J9AA 3GBTA 4CZLA 3TWMA 1C6VA 3VA3A 3W68A 3AO2A 4FLZA 3SQ2A 2CGJA 4WQ4A 3C7NB 2DAMA 4FZZA 4JK7A 4MDBA 3O4NA 2NNWA 2ZTDA 3U6SA 1KTQA 2H5XA 2QENA 4C8KA 3I4YA 3VEVA 1TKTA 2L4FA 1XMQM 3CQXA 4KHUA 1IV0A 1FJGM 1G71A 3SK3A 3SMPA 1Z5AA 2QBYA 2DWLA 3CCSN 4FJIA 3AV9A 3WEEA 5BN8A 5HRSA 1NMDA 4Z0UA 3B9PA 2Z4SA 1T6CA 5ITRA 2UU9M 1TDZA 2LXEA 1IKWA 4JKGA 3VEWA 4RW7A 4IBJA 3U3YA 3L26A 3VQCA 3GLGE 5BN9A 2FOIC 4REZA 1SAZA 3MX2A 3LM9A 4LSNA 5AQJA 3U3GA 5M1KA 3P38A 3ID6A 3U61B 2W41A 2VGMA 4DV5K 3AO1A 4DR5M 2A6AA 3L4QA 3J80S 4IEIA 4BC2A 1J5OA 4MGKE 4DQQA 4FWPA 3FTCA 4WE1A 4M7YA 1R2YA 2VG6A 3F73A 4A5BA 3VGKA 4IO9L 3RR8A 1HQUA 4IJAA 4R7GA 5FPMA 3DXKB 1JL2A 3PIOL 1IN4A 4LF8K 2D0CA 1SKSA 2CEAA 4I81A 5LJVA 1G99A 2Z1IA 1Q7YO 2VWBA 3HHXA 4ITQA 4DR7M 1NJFA 2EKKA 5ITYA 1EE8A 3TTCA 2GBZA 3LAMA 5AZIA 4HVJA 1J54A 4CF0A 3B6PA 4DHYA 1VSFA 5EVZA 3T6PA 2R6FA 3DRRA 3KFUG 4BRAA 3SATA 1MWKA 3QFUA 4RW9A 4YDUC 4P16A 4DV2M 3I4VA 3EKSA 3PX6A 4JK9A 4NYNA 3CJBA 2DAKA 4LFAM 4ZTJA 4CGGA 1XNRK 3UB5A 4M3UA 3O8MA 3VK8A 2YNIA 3NGYA 2Q0RA 4R79A 2DTUA 2GV9A 4M3WA 1NOZA 1D9FA 3SUOA 2Y1JA 1I94K 2KNZA 3EY1A 1XUPO 3E9SA 1BCOA 1S3XA
chains in the Genus database with same CATH topology
2ZGYA 4I6MA 3L27A 2HF4A 3A5MC 5BRDA 3A5NC 3HJ8A 4BROA 1HQCA 2XSZD 1D4XA 3SMSA 1GLCG 2W82A 4IBGA 1GLFO 1VQ6N 4DV7M 3L2AA 3TSQA 4JK8A 5GIOA 1V4TA 4BR7A 4CZJA 3UKRB 1ATNA 2L6OA 3CCMN 5CR4A 2JWKA 3SBGA 2D1KA 3KWGA 3U4LA 2F4VM 4NSOB 4NL4H 3O9RA 4JKEA 5GAGP 1DGHB 1QYRA 4FWSA 4JI0M 3G71N 4X62M 4HL4A 4FWMA 2E20A 4DB3A 5EOYA 4Z94A 4W5WA 3J7BA 4I4LA 5ITXA 4JI4M 3K2LA 4JYAM 2HKJA 5AZJA 2QXLA 4FWOA 3ID8A 1WOQA 3MHVC 1ATRA 1SQKA 1BDGA 2E2NA 5AQGA 1ZXOA 4JKGB 4XH5A 1N77A 2DZOB 3KS4A 2R65A 3KSJA 4GKKM 2IVNA 4LG2A 3FYCA 2EWSA 5AQKA 1IY1A 2F9TA 4JNEA 2RHKA 4PDGA 1MDUB 5AQRA 1Q86O 1HT2E 4IBEA 1N75A 3K1JA 4B3MM 4LRSA 4IIWA 3WXIA 2NRRA 3LMMA 3PLAA 4JD2A 1VQ4N 2P9NA 4FOEA 4ISFA 3FZMA 3ZX2A 4WFBL 1NGHA 1J7KA 2A42A 3E66A 4FD2A 5F0XA 2L09A 3SYKA 2YHWA 4RTFD 3L28A 3VTHA 3CHWA 1G4AE 1OKJA 2GWKA 5DNYA 2VGNA 2IVOA 5AZIB 4WQ5C 3VDPA 3SBTA 3CETA 4PL7A 3J81S 5B8HA 2YFQA 2IVPA 3L6QA 5DYIA 5AQQA 3PVSA 3HU3A 1R7RA 3WHLA 5LJWA 3LDQA 4Z8XA 3KW6A 3WQUA 4CBXA 1GLAG 1J6ZA 2QZ4A 2QWMA 2RE2A 3MN9A 3U6OA 2E2QA 4II7A 4LJ4A 4IXCA 1K73O 3KOWE 1RDUA 4ILJA 2KKZA 3CC4N 1UM8A 2YQZA 2JA2A 1BOTO 3HOTA 3HJQA 1YUWA 2E2PA 1E9RA 2D7EA 2PAVA 4BRQA 5DM6L 5FTKA 4K43A 3LVVA 3E1YA 2X4AA 2CHQA 3QDKA 5C15A 2VIIA 4OPHA 3TE6A 1JJ2M 2FFJA 4KO8A 3HOSA 4MDAA 1QQWA 4OU7A 2ZF5O 3MCPA 2F5PA 2VQEM 4AKGA 1IBMM 4IJFA 2PFUA 2C99A 3ZH9B 2Z4RA 3J27B 3KWIA 1W5SA 2P9LA 2KA6B 3LVWA 5AZJB 5AQTA 3FUTA 1VQNN 3AOGA 2NRWA 5E26A 3TQSA 3U6EA 4FWRA 4NOOB 3L25A 1JCFA 4FCVA 1NGAA 2FXUA 3D8BA 4IWVA 3H1QA 3IDHA 5EQTA 3T7ZA 4GV3A 1NGBA 5EJCA 1TH2A 4J8FA 1YXQA 1NVMA 4LJ6A 2D0OA 2W40A 1E9SA 4MLEA 4M0DA 2OTJN 2P9KA 4JD2B 5ELZA 3WXLA 1QVGM 1HKGA 3R8FA 4LF6M 5E84A 3MWPA 2QTDA 1OJLA 3F9MA 3UZUA 1Q3BA 4LFCM 5ADXH 2AA4A 2DVWB 3SAHA 4LF8M 3FR0A 3K9JA 5EXXA 5EX5A 4MGYE 4Y0WA 3KZBA 2EO2A 3G4SN 3HHZA 1W97L 5EY4A 1IXSB 2CH6A 3GLGA 1ILYA 3H3OB 5IREB 3DFZA 2XGNA 5GIPA 5HOOA 4NRVA 4KLNA 2QWNA 1MU5A 1XNRM 2D0PA 1SXJD 2P9UA 1IQPA 4BRCA 4FWQA 4QS7A 4B3SM 4IBCA 1IM2A 2ZWHA 3VETA 2F5SA 3HRGA 1HKBA 4WQ5A 5EP2A 2QWPA 3O9QA 1DGGA 4XGIA 4JI8M 2UXBM 3GLHB 1ZBSA 4BGAA 3Q8XA 4ISEA 3THGA 3SAVA 3M3ZA 3JR4A 3FZHA 1GL6A 3CC7N 3AV0A 4ILGB 2G8LA 4BLCA 1Q18A 3O9UA 1Z05A 2C9CA 4R3DA 5KPZA 1LCUA 2V7ZA 3FTDA 4AKIA 3G25A 2NRXA 2J7OA 4UY8O 4IZ9A 2AP1A 3A46A 5AQFA 3R6MA 3FUUA 3OBWA 3LDPA 3ATUA 3WXKA 4GV9A 3D8LA 5C0YA 5C1BA 3SARA 3ZYYX 2ZANA 1XWIA 1TH3A 2IIRA 2J4RA 3EZWA 1QAQA 3KVWA 3ZETA 3IG5A 3KK7A 4KH5A 4MGIE 4GIPA 4JV5M 4L4UA 4MH0E 3DXKA 3OBYA 4O5FA 4DV6M 1ATSA 2ZJQL 1M1KO 3GPUA 1G41A 4Z6YA 4QNMA 3VERA 2BUPA 2C5RA 1IG8A 2CV0A 2P9KB 3R1XA 4BC4A 3GPPA 5BREA 4OX9M 1NM1A 4BRNA 1VQKN 3NWLA 2CHGA 4F9OA 5GINA 5H37D 4GMQA 3PFIA 3SJHA 1IBLM 5I9EB 1NY5A 2VQFM 5BR9A 4RNAA 5DYGA 4JKAA 4LF4M 3ENHA 1TUYA 2CV2A 3EL2A 2A41A 5EXPA 4B7GA 3AGKA 3NMUA 4B1ZA 2Q2EB 1XC3A 3OHRA 1NNJA 3EKUA 3GLGB 1E32A 3FUVA 4B1WB 4H5WA 1DKGD 4GHAA 3R8EA 4A3VB 5IT9S 4QS8A 3SAGA 2A40A 3PXGA 3NBIA 3BEXA 5C2DA 4C1NI 4U7BA 2QA4N 1N78A 1VQPN 4IOXA 3I51A 2P9UB 5AFUA 1SXJE 3FGUA 4NLBA 3QAUA 4YOXA 3CTWB 3QFPA 5FPEA 2UUBM 1DGHA 4NO7A 4O8UA 1MX0A 3GQ5A 3ZC7B 2CUZA 2VYPA 3HTVA 4QOSA 3DOAA 3IKMA 1L2BA 2QI2A 2M60A 3LDNA 4NXNM 1QZ5A 1NWKA 3C0BA 3FZLA 5AQHA 2LH0A 4PD2A 5ADXA 1XMOM 2RKOA 7CATA 3SASA 3ZEUA 4B9QA 3TPQA 1OFIA 2KXEA 4TUWA 5KO3A 1GLLO 3RGPA 3VK7A 3U6CA 4M9XA 4DUYM 3J7AS 4CJ7A 4YOTA 5EP3A 2V6ZM 2F7TA 2UUCM 4YOVA 2XSZA 4CHTB 3KOZE 2ASMA 3ZETB 5BRFA 2P5TA 4BVPA 2FNAA 1HPMA 5GAEP 2PBDA 4LJ5A 3HGIA 2V7YA 3TTDA 3MDQA 4HLQA 2Q31A 4PKIA 1LOTB 3CPEA 3H45C 3C6HA 5EXWA 1NY6A 3CCLN 3I55N 1I4WA 2BH1A 2KW0A 1YIJN 1QAOA 4BRIA 1HKCA 1KSFX 3KHYA 1TH4A 4B3TM 1T6DA 2F5OA 4WFAL 3LQRA 3QBXA 2XLJA 1U6ZA 3MN5A 3AGRA 1NJGA 3ATVA 5A2QS 1NGGA 4DR2M 5LMNM 4B1XB 4IDHA 2R4JA 3IFRA 4YY3M 1RFQA 4H0PA 3GRRA 1R6BX 4A61A 1K8KA 3LQQA 5JLFA 1JCGA 3ILKA 4DUZM 4X66M 4C1NK 4CZMA 1SZ2A 3QBWA 3R3LA 1FNNA 4FWDA 4YOUA 4GVEA 1OFHA 3CJ9A 3M5RA 5FPDA 4AKHA 2E1YA 5FTMA 2HBJA 4BRKA 3KP0E 5C12A 1XNQM 3VF4A 1OVYA 4LJ7A 4JI2M 1K9MO 3K92A 3P39A 3MJ5A 4JEPA 3DAWA 3FTFA 1YUBA 2GWJA 2M5ZA 5JMVA 1KQSM 4JKFA 3ZEUB 3E9LA 4FOIA 1U2VB 4B1YB 1HNXM 2I7NA 4PKHA 5FLXS 1ZC6A 1P90A 4GC5A 5AQYA 3WXMB 4IBIA 1E94E 3CERA 2ITMA 4CZGA 3A8YA 3MMVA 4LF5M 1KXPA 3O1BA 2D7HA 3WHKA 3GRUA 4BQZA 2NRHA 5BPLA 3C6AA 1SS6A 5CE3A 4FSVA 1GKIA 4AG6A 4H5RA 4MO4A 4H0VB 1DO2A 3C58A 3BF3A 1Z5BA 1NGFA 4B1UB 2YNMD 4CBUA 4BRPA 3GLIB 3UKUA 5EXTA 3GOIA 1BU6O 2DWZB 1RDWX 5BPNA 3LM2A 4A59A 3CQYA 4BR0A 5ITUA 1VAZA 2QCUA 3KOYE 1YJWN 1JQJC 3TL4X 2GELA 1DGBA 4AF1A 2OPFA 5BPMA 4GV6A 1QVFM 3PIPL 3JS6A 3SHGB 3QMLA 3A0IX 4KHPM 1N33M 1QAMA 1QQNA 1KYIA 4OW0A 4FPBA 4XH4A 3DWLA 3PNVA 4S12A 3VTIA 1VQ5N 4BRGA 2HL7A 3VENA 3HWSA 1K8KB 2E1ZA 1J5EM 1BG3A 4RF0A 4KH4A 2NQ8C 4MGZE 4IO8A 4CZHA 4BRMA 4FVUA 3SHFA 2NRZA 3AOEC 3HZ6A 3GLHA 1P8ZA 2VCPA 3IMXA 5BRHA 4WF9L 4XH1A 4YHHM 3SAWA 4K0KM 4QS9A 2R62A 4WURA 2KHOA 3ZX0A 4BY9C 1X37A 3HBTA 2P9SA 3OA9A 3ZCBB 1N32M 3FZFA 4X64M 1GLNA 5C10A 2E88A 3EE8A 4H5NA 4G4RA 4M9SA 2V51B 3K9KA 3MK6A 4FO0A 5F2RA 5AQIA 2X8AA 4BBAA 3DXMB 3KP1E 4NSRA 3A5OC 3CCQN 1SXJA 3ULEB 5AFUH 2DPNA 1K8AO 4IBBA 2ZM6M 1PJIA 1YJNN 3CF0A 5BPVA 2Q0UA 1QQOA 4JKCA 3OW2M 4DR4M 4DR6M 3HSCA 2E8AA 4JXJA 1M90O 4H0OA 2KRKA 2QWRA 4GHLA 2DWNA 2V1CA 3M0EA 4E1JA 3GRYA 3AJIB 4L78A 4D82A 3LDOA 3CI5A 3T38A 3AY9A 2R45A 2EUCA 2GX9A 3UKUB 2DHRA 4DV1M 4GNIA 1KFVA 2ZJPL 5GKNA 1G3IA 2V1UA 1Y64A 4BRFA 1IN8A 3VOVA 4FCTA 3SAFA 2JWLA 4BRDA 3RVCA 1HT1E 3N4PA 3RSEA 2D4WA 8CATA 1XQSC 4H5VA 4LJ8A 2C96A 1S22A 5FSWA 4QHSA 5KQDA 2QP9X 1YJ9N 4IBKA 4BR4A 1IBKM 3R9XB 3T1HM 3W0LB 3U6MA 1PJJA 5AQVA 5AQWA 4FWHA 3D2EA 4H0YB 4WCEL 4GKJM 1T44A 4LZJA 2KEBA 3O9TA 1X9JA 4LC9B 4B1VA 1KC8O 3T69A 3SC3A 1C0FA 4QHTA 3A5LC 3BUZB 5M1OA 2P9SB 3EN9A 2XF3A 3FKEA 2CV1A 4FL9A 2Q2RA 1YVNA 2QEXN 3SYLA 1NHGC 4A2BA 2D7GA 4AZFA 1BA0A 4DR3M 2ZGZA 2HCBA 2HBLA 5AQLA 5AR0A 1TGUA 1XXHA 4C23A 3MN7A 2BTFA 1GL7A 2Z7JA 4CZKA 1X3NA 3DLLL 4G9ZA 1TYQA 3MWTA 3IG8A 2CGLA 1HR0M 2R46A 3AOEA 2CE7A 4KODA 4BG8A 2YI1A 3M7GA 1SXJB 2ZAOA 1HLUA 3DJCA 1YSYA 4IOCL 1L2DA 1DGKN 4D81A 3VLFB 3CF5L 5JICA 5EXSA 2QWOA 1QZMA 4JN4A 4BB9A 3MN6A 3Q7CA 4BGBA 5M1NA 5LY3A 2FE8A 3VEOA 2QWQA 1BUPA 2WBNA 1BA1A 2K47A 5E6JA 4O8KA 5FTJA 4PL8A 4AW4A 3TPZA 3VEZA 2YCHA 3A42A 2YJFA 4LGYA 1IN6A 4ZPXA 2KZSA 1NHWC 1LV7A 3A45A 2OANA 4RWTA 2OQ4A 1YHQN 4LZZA 1HJOA 2FF3B 5F1XA 3CIPA 2UXDM 3RSEB 4U67L 1H6UA 4L8RC 4FCWA 4H0TB 4IJEA 2WUSA 3SAUA 3AL0C 2CGKA 1Q81O 3O4WA 1K3XA 2LWXA 2CH5A 3KXEC 1L8QA 1HX1A 2F9WA 3FZKA 3KSXA 5AQXA 1G8PA 1QANA 4EFHA 1K3WA 4K41A 2NZTA 3FFKB 2AHMA 3D2EB 3H1VX 1N8RO 3JAMS 4LF9M 1VQON 4B3RM 1L2CA 5BR8M 1GLEG 4RF1A 2NRVA 4ISGA 3WQTA 1Z59A 3H46O 1WXQA 1NGJA 2XFSA 3C65A 1ORYB 3GLFA 4BQLA 1U2VA 1T3VA 1IXZA 3FLCO 3AAPA 4LY6A 4L16A 2QWLA 3LL3A 1L1ZA 5AQPA 3PNYA 1XXHB 4JI6M 4BREA 3FUWA 2FF6A 2YJEA 1TYQB 5H1SQ 4BR5A 2R4EA 1YI2N 4EAHD 2Q1NA 1ZQ9A 2P9IA 4LF7M 1WUAA 3AAQA 3J2PB 2P9PA 3TWKA 1O13A 4AM7A 4GRIA 1NJIO 1R59O 4L15A 3CJ1A 4LJAA 4B7FA 3T15A 4YOYA 4EIWA 2BJVA 1XC8A 4IOAL 4HWIA 3U8XA 5FTNA 5M1PA 3GLIA 4CI6A 2GTDA 3RGSA 3W3DA 3CXCM 2G5GX 3N4QA 4B7HA 1E4GT 3R9PA 4BC3A 3K8ZA 4AQYM 5M1QA 3O5BA 1IXRC 5KPRA 1JR3D 3HU1A 3U9ZA 2E2OA 4MLHA 5KPTA 1NSFA 1NGDA 5JLHA 5AQUA 3KDSE 4IEEA 1YITN 5AQMA 1QVRA 2F5QA 3U6QA 3GQ4A 4G4QA 1KAXA 2Q36A 5MLCQ 2BJWA 3H3NO 5AQNA 1JCEA 3SLCA 4OO1J 3KS8A 1V4SA 4JKDA 1IN5A 2ZBKB 4D80A 4AI6A 3MCAB 3O1WA 1VQ8N 3SBJA 4BVOA 1NGEA 4PDIA 3D7EO 3H6EA 4MB7A 1VDDA 1SXJC 2RGHA 2ZJRL 4BR2A 3GE1A 5EP4A 4EHUA 4FWNA 4PT5A 2XH9A 2QW9A 2UYTA 2V52B 3T1YM 4PHTX 2Y0TA 2DXIA 3VKHA 2RGOA 2HSTA 3GO8A 3L0QA 3U5ZA 4CD3A 5C18A 3TSPA 1NLVA 2HMPA 3IUCA 4FW9A 3SFZA 5AQSA 3GLFB 4CBWA 4IJNA 3GDQA 3UE5A 4JN6A 5F3WA 3LDLA 3WXJA 3VF6A 3DXMA 3P4IA 3GQ3A 3GRVA 3CCVN 3ULEA 4K25A 3EIEA 2QBYB 3HHWA 2P9IB 2Y20A 3WEEB 3HHYA 3FYDA 1Z6TA 4IFEA 1DO0A 4IBFA 1H1VA 3F5TA 2P9PB 4LGMA 2YX6A 4GH9A 4DCHA 2EA0A 4BR9A 3AKZA 3U60A 4CGYB 3VEYA 3L29A 3O08A 2XFTA 3E9PA 3CMAN 2DZNB 3CCJN 3JR5A 2E5LM 5GAHP 4M63C 3CF6E 3M6AA 2H1RA 4CZEA 5ITTA 5CHIA 3CJ7A 3GL1A 1G59A 2OTLN 1PM5A 4MO5A 4BC5A 4DR1M 4L3QA 3FTEA 1QZ6A 1VQ9N 1W5TA 5LMUM 5IWAM 2YHXA 4AM6A 4JI1M 4DQ8A 1DT9A 2BNKA 4DV0M 4DV3M 2ERCA 3J8AA 1Q39A 3TWLA 1E4FT 1BO5O 2CFOA 5IZ7D 5M1FA 3W0LA 4JI3M 2FLOA 4A2AA 4QNRA 1KAZA 2H3GX 4I6MB 3BP8A 2O5RA 3BF1A 3HM8A 2R18A 4M0WA 5JVGL 2XEPA 4CISA 3E9OA 1QHAA 5AQOA 1MA9B 3FD9A 3CCEN 3VESA 4AG5A 1GLBG 1HNWM 4NRWA 4YDUA 1HUXA 2XZFA 3GG4A 5JVHL 3O9SA 4XEIA 3OTOM 4GY2B 4CZFA 3U5ZB 1R2ZA 3GP1A 5TKYA 3NVMA 1IN7A 5EP1A 4G4OA 3D2FA 2I7PA 4I8OA 3VGMA 4H0XB 2Y0QA 2Y21A 3EE9A 4DKWA 3A98B 4X65M 2HF3A 3I56N 4K42A 2NLXA 3BOSA 3GPXA 3FUXA 4M7XA 4PCZA 3TU5A 4QOZC 3U9DA 1NGCA 3W0FA 1K82A 5JI2E 3D6RA 4LJ9A 4JKHA 1S3SA 1HQYE 3HJSA 1J09A 4YOWA 1NNUC 3ZX3A 3DA1A 3U60B 1MWMA 1QQMA 4MM3B 3HU2A 3QWLA 1EQYA 1Q3CA 4FVMA 4G6ZA 1YF5L 2J7NA 2Z3XA 2FSKA 5FTLA 2P9NB 1VQ7N 1W2BM 5ITQA 4DV5M 2HBMA 4WW0A 2L7HA 3CJCA 1RGIA 4CZIA 2L7IA 3HKPA 2KRUA 3UJNA 4KBOA 2ASPA 3UMMA 1IJJA 2ASOA 3VFDA 3L4IA 5ITXE 3G6EN 3U6LA 1C0GA 4H03B 4JAXA 4WQ4C 1TUUA 1YAGA 3DZDA 4JHDA 4FWGA 1HNZM 3VKGA 3KVGA 4LRTA 4A57A 3UGJA 2NRTA 1VQLN 1Z5CA 1TDHA 4A5AA 4H5TA 4BG9A 4I5SA 2FSNA 3TTFA 1I94M 2ZAMA 4LCBA 4OVZA 2A3ZA 2A5YB 3MX5A 3RFWA 3F2KA 3CCRN 3AARA 4OPAA 1L1TA 2F5NA 3I8BA 2GUPA 3QB0A 4WFNL 4NB4A 2UXCM 2GEMA 3VGLA 3Q7BA 5DM7L 2A5XA 3C7NA 1YE9A 3O6WA 5AQZA 2DWMA 3ENBA 5KQ8A 1GLJO 3EIHA 1BWFO 3KOXE 2Q97A 2HOEA 1GLDG 3AFHA 3GPYA 3U6DA 3D2FB 3EO3A 4JKBA 3CMEN 1DEJA 4RCHA 3NVKA 1GVNA 1NBWA 2KZUA 3WUHA 2P9LB 1DGFA 1Q82O 3VMFB 3U6PA 4JI7M 3U61A 4XBOA 3CPWM 4CD1A 4FWKA 2YR0A 3O80A 2XZUA 1Z6RA 3QICA 4FPAA 4HTLA 2UUAM 5FPNA 4BRLA 5JI3E 2C98A 1IY0A 4KH6A 1EO1A 3VF2A 4A62A 1C1KA 2KLAA 3B8AX 3VDUA 1N34M 4FWLA 4WYBA 3VPZA 4BRHA 5TKWA 3P31A 1VQMN 4B08A 4MGHA 5C2FA 5HL7L 4LFBM 2HHHM 4NLCA 1ZAEA 3M1FA 1IY2A 4YORA 1ESVA 2CHVA 1X3MA 3TSUA 1KAYA 3CD6N 4GC9A 1NGIA 3CC2N 4ILHA 1CZAN 2FSJA 4EHTA 3E4RA 3VEXA 4PKGA 1T3TA 1S72N 5GADP 2WC9A 4JHDB 4G4NA 3H4MA 3FE1A 1XHBA 1KD1O 4NXMM 3UK6A 3UKRA 3HI0A 3CF2A 3I33A 1N36M 3ENOA 3CCUN 3J7ZO 2QPAA 4EIAA 3S41A 4DV4M 4GITA 2YHYA 4OVZB 4M9ZA 3RE8A 2C9OA 2X49A 2HBKA 1D2NA 2QM1A 2WFBA 3CJAA 3JXUA 4IBDA 3WT0A 3M6GA 4JI5M 1JR3A 4CZLA 3GBTA 2LNHC 3TWMA 2CGJA 4WQ4A 3C7NB 4JK7A 4MDBA 2NNWA 3U6SA 2QENA 3I4YA 3VEVA 1XMQM 3CQXA 1FJGM 3SK3A 3SMPA 1Z5AA 2QBYA 2DWLA 3CCSN 3WEEA 5BN8A 1NMDA 3B9PA 2Z4SA 1T6CA 5ITRA 2UU9M 1TDZA 2LXEA 4JKGA 3VEWA 4IBJA 3L26A 5BN9A 2FOIC 4REZA 1SAZA 3MX2A 3LM9A 5AQJA 5M1KA 3P38A 3ID6A 3U61B 2W41A 2VGMA 4DR5M 2A6AA 3L4QA 3J80S 4IEIA 4BC2A 4MGKE 4FWPA 3FTCA 4M7YA 1R2YA 4A5BA 3VGKA 4IO9L 4IJAA 4R7GA 5FPMA 3DXKB 3PIOL 1IN4A 2CEAA 4I81A 5LJVA 1G99A 1Q7YO 2VWBA 3HHXA 4ITQA 4DR7M 1NJFA 1EE8A 5ITYA 3TTCA 5AZIA 4DHYA 5EVZA 3KFUG 4BRAA 3SATA 1MWKA 3QFUA 4YDUC 4P16A 4DV2M 3I4VA 3EKSA 4JK9A 3CJBA 4LFAM 3UB5A 3O8MA 3VK8A 2Q0RA 4R79A 1XUPO 3E9SA 1S3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGY A;  1DKG D;  4I6M A;  3R8E A;  2HF4 A;  3A5M C;  1S22 A;  5BRD A;  3W0L A;  2FLO A;  4A2A A;  3A5N C;  4QS8 A;  5KQD A;  2A40 A;  4BRO A;  3BEX A;  1KAZ A;  2H3G X;  1D4X A;  4BR4 A;  3SMS A;  4I6M B;  1GLC G;  3BP8 A;  1GLF O;  5AQV A;  2P9U B;  3BF1 A;  5AQW A;  3FGU A;  1V4T A;  3HM8 A;  5AFU A;  3D2E A;  4BR7 A;  4CZJ A;  4H0Y B;  1ATN A;  3UKR B;  1T44 A;  3QFP A;  5FPE A;  1X9J A;  4LC9 B;  1QHA A;  2D1K A;  3U4L A;  4B1V A;  4NO7 A;  5AQO A;  1MA9 B;  3VES A;  2VYP A;  3HTV A;  1C0F A;  1GLB G;  4YDU A;  3A5L C;  1HUX A;  3LDN A;  1QZ5 A;  3BUZ B;  3GG4 A;  4FWS A;  1NWK A;  3C0B A;  4XEI A;  2P9S B;  3EN9 A;  4GY2 B;  3FZL A;  4CZF A;  5AQH A;  4FL9 A;  4FWM A;  2Q2R A;  1YVN A;  2E20 A;  4DB3 A;  5EOY A;  5ADX A;  4A2B A;  4Z94 A;  1BA0 A;  5TKY A;  3ZEU A;  2ZGZ A;  4B9Q A;  5AQL A;  5AR0 A;  3TPQ A;  4C23 A;  3D2F A;  1GLL O;  3MN7 A;  2I7P A;  2BTF A;  5AZJ A;  2QXL A;  4CZK A;  3VGM A;  1X3N A;  4H0X B;  4FWO A;  1TYQ A;  2HF3 A;  3ID8 A;  4K42 A;  1WOQ A;  1ATR A;  2NLX A;  1SQK A;  4CJ7 A;  4M7X A;  2CGL A;  1BDG A;  2E2N A;  5AQG A;  1ZXO A;  4XH5 A;  3TU5 A;  3U9D A;  4BG8 A;  2IVN A;  2EWS A;  2ASM A;  1NGC A;  2YI1 A;  5AQK A;  1HLU A;  4JNE A;  2F9T A;  3ZET B;  5BRF A;  1MDU B;  5AQR A;  3DJC A;  4BVP A;  1DGK N;  1HPM A;  3WXI A;  2PBD A;  2V7Y A;  3ZX3 A;  1QQM A;  1MWM A;  3MDQ A;  5JIC A;  4JD2 A;  2QWO A;  2Q31 A;  1EQY A;  2P9N A;  4JN4 A;  4PKI A;  1LOT B;  4FOE A;  4ISF A;  3FZM A;  3ZX2 A;  3H45 C;  3MN6 A;  4BGB A;  5EXW A;  5LY3 A;  1NGH A;  3VEO A;  2QWQ A;  2A42 A;  1BUP A;  1BA1 A;  5F0X A;  2FSK A;  2YHW A;  2P9N B;  4RTF D;  4O8K A;  3CHW A;  2GWK A;  1OKJ A;  4PL8 A;  2IVO A;  5AZI B;  4BRI A;  1HKC A;  4WQ5 C;  3CJC A;  3KHY A;  3CET A;  3VEZ A;  1RGI A;  4CZI A;  2YCH A;  1T6D A;  2YJF A;  4PL7 A;  5B8H A;  3QBX A;  4KBO A;  1U6Z A;  2ASP A;  3MN5 A;  1IJJ A;  2OAN A;  4RWT A;  3ATV A;  2IVP A;  2ASO A;  3L6Q A;  5AQQ A;  1HJO A;  3L4I A;  1NGG A;  5LJW A;  3LDQ A;  2FF3 B;  4B1X B;  5F1X A;  3CIP A;  1C0G A;  4H03 B;  4JAX A;  4WQ4 C;  3IFR A;  1TUU A;  3RSE B;  3WQU A;  4CBX A;  1GLA G;  1RFQ A;  1YAG A;  1J6Z A;  4H0P A;  4JHD A;  4H0T B;  2WUS A;  2QWM A;  2CGK A;  3MN9 A;  3O4W A;  2CH5 A;  4A61 A;  1K8K A;  2E2Q A;  3KVG A;  1HX1 A;  5JLF A;  2F9W A;  1JCG A;  3FZK A;  4IXC A;  5AQX A;  4CZM A;  1SZ2 A;  4H5T A;  3QBW A;  4BG9 A;  4EFH A;  2FSN A;  1BOT O;  4K41 A;  2NZT A;  1YUW A;  3FFK B;  2E2P A;  3D2E B;  2PAV A;  3H1V X;  4BRQ A;  3CJ9 A;  2A3Z A;  5FPD A;  4K43 A;  3AAR A;  2E1Y A;  4BRK A;  1GLE G;  3QDK A;  3VF4 A;  3I8B A;  2GUP A;  4ISG A;  3QB0 A;  3WQT A;  3H46 O;  4NB4 A;  2GEM A;  3VGL A;  1NGJ A;  2A5X A;  3C7N A;  3DAW A;  3O6W A;  5AQZ A;  4BQL A;  1U2V A;  5KQ8 A;  2ZF5 O;  3MCP A;  3FLC O;  1GLJ O;  2GWJ A;  3AAP A;  1BWF O;  5JMV A;  2QWL A;  3LL3 A;  5AQP A;  2Q97 A;  2HOE A;  3ZEU B;  1GLD G;  4BRE A;  4FOI A;  1U2V B;  2P9L A;  3D2F B;  2FF6 A;  2YJE A;  3EO3 A;  4B1Y B;  2I7N A;  1DEJ A;  5AZJ B;  5AQT A;  4RCH A;  1TYQ B;  4BR5 A;  1NBW A;  5E26 A;  4PKH A;  4EAH D;  2Q1N A;  4FWR A;  2P9I A;  1ZC6 A;  1WUA A;  3AAQ A;  3WUH A;  2P9L B;  1JCF A;  1NGA A;  2FXU A;  2P9P A;  4IWV A;  3H1Q A;  3IDH A;  5AQY A;  4FWK A;  4CD1 A;  4AM7 A;  3O80 A;  1NGB A;  1R59 O;  1Z6R A;  3CJ1 A;  1YXQ A;  3QIC A;  4J8F A;  3CER A;  2ITM A;  2D0O A;  4FPA A;  4HTL A;  4CZG A;  3A8Y A;  3MMV A;  5FPN A;  2W40 A;  1KXP A;  3O1B A;  4BRL A;  4BQZ A;  4MLE A;  2NRH A;  5BPL A;  2P9K A;  4HWI A;  3U8X A;  5CE3 A;  4JD2 B;  3VF2 A;  4FSV A;  5ELZ A;  2GTD A;  4A62 A;  4CI6 A;  3WXL A;  3W3D A;  4H5R A;  4MO4 A;  3B8A X;  1HKG A;  4H0V B;  3BF3 A;  4FWL A;  5E84 A;  4WYB A;  1NGF A;  4B1U B;  4CBU A;  3VPZ A;  4BRH A;  4BRP A;  1E4G T;  3R9P A;  3F9M A;  3UKU A;  4BC3 A;  3GOI A;  1BU6 O;  1RDW X;  3O5B A;  5BPN A;  5ADX H;  3LM2 A;  2AA4 A;  5KPR A;  3CQY A;  4BR0 A;  3FR0 A;  3U9Z A;  5EX5 A;  2E2O A;  3M1F A;  5KPT A;  4MLH A;  4Y0W A;  5JLH A;  1NGD A;  3KZB A;  5AQU A;  2GEL A;  5AQM A;  1ESV A;  5EY4 A;  5BPM A;  1X3M A;  1KAY A;  2CH6 A;  3JS6 A;  1KAX A;  1NGI A;  2Q36 A;  3QML A;  3H3O B;  3A0I X;  1CZA N;  3H3N O;  5AQN A;  2FSJ A;  1JCE A;  4EHT A;  3VEX A;  1QQN A;  4FPB A;  4PKG A;  4XH4 A;  3DWL A;  3SLC A;  1V4S A;  4JHD B;  2QWN A;  4BRG A;  3O1W A;  2D0P A;  3VEN A;  1K8K B;  3FE1 A;  2E1Z A;  1BG3 A;  2P9U A;  4BVO A;  1NGE A;  4BRC A;  3D7E O;  3H6E A;  4FWQ A;  3UKR A;  4IO8 A;  4QS7 A;  4CZH A;  4BRM A;  3HI0 A;  3I33 A;  2ZWH A;  3VET A;  4BR2 A;  3ENO A;  3HZ6 A;  3GE1 A;  1P8Z A;  2VCP A;  1HKB A;  4WQ5 A;  4EHU A;  3IMX A;  2QWP A;  3S41 A;  4EIA A;  5BRH A;  4FWN A;  2QW9 A;  2UYT A;  2V52 B;  4XH1 A;  2YHY A;  4QS9 A;  1ZBS A;  4BGA A;  2KHO A;  4ISE A;  3ZX0 A;  2QM1 A;  3M3Z A;  3CJA A;  3JXU A;  3L0Q A;  3WT0 A;  3HBT A;  2P9S A;  3M6G A;  4CZL A;  3GBT A;  3FZH A;  4CD3 A;  1NLV A;  2HMP A;  3IUC A;  3FZF A;  1Q18 A;  2CGJ A;  4WQ4 A;  3C7N B;  1Z05 A;  5AQS A;  5KPZ A;  1LCU A;  2V7Z A;  4CBW A;  2E88 A;  4IJN A;  3GDQ A;  3UE5 A;  3G25 A;  4H5N A;  3LDL A;  3VEV A;  3WXJ A;  3VF6 A;  3DXM A;  3CQX A;  3P4I A;  3SK3 A;  3SMP A;  2V51 B;  4IZ9 A;  2AP1 A;  3WEE A;  5BN8 A;  3MK6 A;  5AQF A;  1NMD A;  4FO0 A;  3ULE A;  3R6M A;  5F2R A;  5AQI A;  1T6C A;  3LDP A;  3ATU A;  3WXK A;  3DXM B;  3VEW A;  4K25 A;  3A5O C;  2P9I B;  3WEE B;  2IIR A;  2J4R A;  5BN9 A;  3EZW A;  3ULE B;  5AFU H;  2DPN A;  3ZET A;  1SAZ A;  1H1V A;  3LM9 A;  5AQJ A;  2P9P B;  2W41 A;  2A6A A;  4DCH A;  3DXK A;  4BR9 A;  4O5F A;  4BC2 A;  2Q0U A;  1ATS A;  1QQO A;  4FWP A;  4M7Y A;  3VEY A;  3O08 A;  3VGK A;  3HSC A;  4IJA A;  5FPM A;  2E8A A;  3DXK B;  3VER A;  4H0O A;  2BUP A;  1IG8 A;  2QWR A;  2P9K B;  4BC4 A;  1G99 A;  5LJV A;  5BRE A;  2VWB A;  4E1J A;  4M63 C;  1NM1 A;  4BRN A;  4CZE A;  3LDO A;  3CI5 A;  5AZI A;  3CJ7 A;  4F9O A;  3GL1 A;  3AY9 A;  3SJH A;  4DHY A;  3UKU B;  5EVZ A;  4MO5 A;  4GNI A;  4BC5 A;  5I9E B;  4L3Q A;  5BR9 A;  1QZ6 A;  4BRA A;  1MWK A;  3QFU A;  4YDU C;  2YHX A;  1Y64 A;  3ENH A;  4BRF A;  4AM6 A;  3EKS A;  1TUY A;  3CJB A;  3VOV A;  3EL2 A;  2A41 A;  3UB5 A;  4DQ8 A;  3O8M A;  4BRD A;  2Q0R A;  4B1Z A;  3J8A A;  1XC3 A;  3OHR A;  1E4F T;  3RSE A;  2D4W A;  3EKU A;  1XQS C;  1BO5 O;  4H5V A;  1XUP O;  4B1W B;  4H5W A;  1S3X A; 
#chains in the Genus database with same CATH topology
 2ZGY A;  4I6M A;  5C42 A;  3L27 A;  3MAQ A;  3LAN A;  2HF4 A;  3DLB A;  3A5M C;  5BRD A;  3AVA A;  3A5N C;  1RT2 A;  3HJ8 A;  3AVI A;  4BRO A;  1HQC A;  2WSE F;  2XSZ D;  3QES A;  1RBU A;  4OGC A;  1D4X A;  3TAQ A;  2HW3 A;  3SMS A;  4ID5 A;  2WON A;  1NJZ A;  1GLC G;  2W82 A;  4IBG A;  1GLF O;  4M42 A;  1VQ6 N;  4DV7 M;  2EHG A;  3L2A A;  3HZJ A;  3TSQ A;  4JK8 A;  5GIO A;  4EZ6 A;  1V4T A;  4BR7 A;  4CZJ A;  4G1Q A;  1ATN A;  2L6O A;  3UKR B;  4N47 A;  2OYQ A;  1VEG A;  3CCM N;  2RRU A;  5CR4 A;  2JWK A;  3V1R A;  3PO4 A;  3SBG A;  2D1K A;  3KWG A;  3U4L A;  2R0I A;  2F4V M;  4NSO B;  4NL4 H;  3RRH A;  2P1J A;  1BQM A;  3O9R A;  2MH8 A;  4JKE A;  5GAG P;  1DV0 A;  3ZSZ A;  1PRB A;  1DGH B;  1C0M A;  3ZT4 A;  1QYR A;  4FWS A;  2DEN A;  4JI0 M;  3G71 N;  1QSS A;  4X62 M;  4HL4 A;  4FWM A;  3E21 A;  2E20 A;  4DB3 A;  5EOY A;  4JI7 K;  4Z94 A;  3HPG A;  4W5W A;  4F2R A;  4R71 A;  3J7B A;  4I4L A;  5ITX A;  4JI4 M;  3K2L A;  3VQ5 A;  4JYA M;  2JY5 A;  2HKJ A;  4RW4 A;  4M3T A;  1NK8 A;  1YT3 A;  5AZJ A;  1UOC A;  2QXL A;  2UUA K;  4FWO A;  1OH6 A;  3ID8 A;  1WOQ A;  3MHV C;  1ATR A;  3FFI A;  1SQK A;  3T3F A;  1BDG A;  1Y97 A;  2E2N A;  3PSI A;  3OYL A;  3ULD A;  5AQG A;  4CK1 A;  3CYM A;  4KRF A;  1ZXO A;  3LPT A;  4JKG B;  3J80 O;  4XH5 A;  1LAW A;  1N77 A;  2DZO B;  3VQA A;  3KS4 A;  4RG8 A;  2IC3 A;  1N34 K;  2R65 A;  3KSJ A;  4Z4G A;  4GKK M;  2IVN A;  4LG2 A;  3FYC A;  1NMN A;  2EWS A;  5AQK A;  3I0S A;  1IY1 A;  2F9T A;  4JNE A;  2RHK A;  4PDG A;  4DTM A;  1MDU B;  5AQR A;  1NK0 A;  1HT2 E;  1Q86 O;  4IBE A;  1N75 A;  3K1J A;  4B3M M;  1EX4 A;  1PJS A;  3JSM A;  4LRS A;  1DTQ A;  3RRG A;  4E89 A;  4IIW A;  3LCV B;  2NRR A;  3WXI A;  3LMM A;  1RBS A;  3PLA A;  4LFB K;  2HHH K;  1B9D A;  4ELT A;  2LVQ D;  4JD2 A;  1VQ4 N;  2P9N A;  4FOE A;  4ISF A;  3OYF A;  3FZM A;  3ZX2 A;  4WFB L;  1K6Y A;  1NGH A;  1J7K A;  2Z1H A;  2KHH A;  2A42 A;  3E66 A;  2LVN C;  3ZSV A;  4FD2 A;  1O1W A;  5F0X A;  2L09 A;  2QKK A;  3SYK A;  2YHW A;  4RTF D;  3L28 A;  2D5R A;  3VTH A;  3CHW A;  1G4A E;  1OKJ A;  2GWK A;  4B9V A;  5DNY A;  2VGN A;  1NU0 A;  2IVO A;  5AZI B;  4BDZ A;  3SPZ A;  3O3G A;  4WQ5 C;  3VDP A;  3SBT A;  3CET A;  4E0D A;  1BVS A;  1AUA A;  1XC9 A;  3BGR A;  4PL7 A;  2O8E A;  2LTU A;  3J81 S;  5B8H A;  4IG0 A;  4Z4I A;  1N6Q A;  2YFQ A;  4NXM K;  1IXS A;  3HST B;  2APL A;  1RTH A;  5DYI A;  2IVP A;  3L6Q A;  3HM9 A;  5AQQ A;  4DSE A;  3PVS A;  4CW7 B;  4R5P A;  1N36 K;  3HU3 A;  4M3R A;  3S3N A;  1R7R A;  3WHL A;  5JS2 A;  5LJW A;  3LDQ A;  3ZT0 A;  1PGY A;  4Z8X A;  3SQ1 A;  3KW6 A;  1GOC A;  4DV4 K;  4Z4F A;  3SQ4 A;  3K5N A;  3WQU A;  4CBX A;  1NJY A;  3AVM A;  2YKM A;  1GLA G;  2HHS A;  2IAJ A;  1J6Z A;  2QZ4 A;  2QWM A;  2RE2 A;  2KNA A;  1GJT A;  3IEC A;  3MN9 A;  3F92 A;  1FXX A;  3U6O A;  3OS1 A;  4KHY A;  2E2Q A;  4CK3 A;  4II7 A;  5SZT A;  2Z1G A;  4CFC A;  4JI5 K;  4LJ4 A;  4IDK A;  4IXC A;  1K73 O;  2HND A;  3KOW E;  1RDU A;  4ILJ A;  2E4L A;  2KKZ A;  3CC4 N;  1UM8 A;  1JB0 F;  2YQZ A;  2JA2 A;  1VSD A;  1KSP A;  1BOT O;  3C6T A;  3HOT A;  3HJQ A;  1YUW A;  4HCC A;  2E2P A;  4PY5 A;  1E9R A;  1HPZ A;  2MR9 A;  4FW2 A;  1VSH A;  2D7E A;  1RTJ A;  2PAV A;  3P1G A;  5HLF A;  4BRQ A;  4J2D A;  5DM6 L;  5FTK A;  3DLG A;  4K43 A;  3LVV A;  3FRH A;  3E1Y A;  1XMQ K;  1FJG K;  2CP8 A;  1TF0 B;  4BE2 A;  1MN3 A;  3RWU A;  2X4A A;  2CHQ A;  3QDK A;  1T7P A;  5C15 A;  2VII A;  4OPH A;  3CM6 A;  3TE6 A;  4DTS A;  1JJ2 M;  2FFJ A;  4KO8 A;  3HOS A;  2UU9 K;  1LV5 A;  4NYF A;  3ALY A;  1C0U A;  1QS4 A;  4MDA A;  2VF7 A;  1QQW A;  2IGI A;  2QK9 A;  4DUY K;  4OU7 A;  3GLI E;  1TTE A;  2ZF5 O;  2F5P A;  2VQE M;  4AKG A;  3MCP A;  3V9X A;  2UUC K;  1TVR A;  3OYJ A;  1IBM M;  4B9M A;  4IJF A;  3AO3 A;  2PFU A;  2QQ8 A;  1LWE A;  2C99 A;  3ZH9 B;  5HRN A;  2Z4R A;  3J27 B;  4CIZ A;  1HNV A;  4DR5 K;  4M45 A;  3KWI A;  5I42 A;  1W5S A;  2P9L A;  5E41 A;  4KTZ A;  5KRS A;  2KA6 B;  3LVW A;  5AZJ B;  5AQT A;  3FUT A;  1VQN N;  3AOG A;  1WAF A;  2NRW A;  4FYD A;  4LD0 A;  3DYA A;  2O4I A;  5E26 A;  3TQS A;  3BY5 A;  3U6E A;  4FWR A;  4NOO B;  4FLY A;  3L25 A;  1JLF A;  1JCF A;  4FCV A;  1NGA A;  2FXU A;  3G0Z A;  4DR7 K;  3D8B A;  1SKW A;  4IWV A;  4RW6 A;  1BI4 B;  3H1Q A;  3IDH A;  3P5J A;  5EQT A;  3T7Z A;  1TKD A;  4GV3 A;  1NGB A;  5EJC A;  1TH2 A;  4J8F A;  1YXQ A;  4KHW A;  1NVM A;  1RT5 A;  1GAB A;  3OYB A;  4DSL A;  4LJ6 A;  4CJP A;  2D0O A;  5FRO A;  3RMA A;  2W40 A;  1NK4 A;  4CJL A;  2OPR A;  1E9S A;  3OYN A;  4MLE A;  2MJ5 B;  3M8P A;  1VSJ A;  4M0D A;  4DV2 K;  2DFE A;  1U4B A;  1NKE A;  1RDD A;  4B3T K;  2P9K A;  1C1B A;  2OTJ N;  4JD2 B;  1JKH A;  4LFA K;  5ELZ A;  4AHR A;  3WXL A;  1QVG M;  1HKG A;  3R8F A;  4LF6 M;  3AVJ A;  3OYA A;  5E84 A;  3MWP A;  2QTD A;  1OJL A;  3J81 O;  3F9M A;  3K59 A;  2RPI A;  3UZU A;  5LL6 Z;  1Q3B A;  4LFC M;  5ADX H;  2AA4 A;  1R4G A;  2DVW B;  4OKE A;  3SAH A;  4LF8 M;  3FR0 A;  3K9J A;  1SL1 A;  4DSK A;  5EXX A;  5EX5 A;  4H4M A;  4MGY E;  3DLH A;  4Y0W A;  3KZB A;  2O8E B;  2EO2 A;  1TL1 A;  3KLI A;  2YNF A;  3G4S N;  1WBD A;  3IRX A;  1LTM A;  3SV3 A;  3HHZ A;  2JNH A;  4DV7 K;  3I8D A;  1SV5 A;  1W97 L;  5EY4 A;  1IXS B;  3AVG A;  2CH6 A;  3GLG A;  4FJJ A;  1OQY A;  1ILY A;  5HRR A;  3H3O B;  5IRE B;  3DFZ A;  3MEG A;  3J7Y P;  1ASV A;  4J2A A;  2ZE2 A;  5CYQ A;  2XGN A;  5GIP A;  4CJ3 A;  5HOO A;  3HJF A;  4NRV A;  2F4V K;  1VQ1 A;  2HHQ A;  2PYJ A;  4KLN A;  3OYK A;  1TK8 A;  2QWN A;  3S3M A;  1MU5 A;  1XNR M;  3U6F A;  3AVF A;  2D0P A;  1QUT A;  1SXJ D;  2P9U A;  1IQP A;  4BRC A;  4JLH A;  4JI0 K;  4FWQ A;  2BWE A;  4X62 K;  1KVA A;  4QS7 A;  4B3S M;  3SPY A;  4IBC A;  1IM2 A;  2ZWH A;  3VET A;  4CJT A;  2F5S A;  3VQ8 A;  4CF1 A;  3HRG A;  4XIU A;  4CHO A;  1HKB A;  4WQ5 A;  5EP2 A;  2QWP A;  3O9Q A;  4JI4 K;  2G8K A;  3HYF A;  2D0A A;  4JYA K;  1DGG A;  4XGI A;  1L3T A;  3H08 A;  4JI8 M;  2W6K A;  3ISN C;  1QDT A;  2UXB M;  3GLH B;  1ZBS A;  4BGA A;  3Q8X A;  4F1I A;  1RDC A;  4ISE A;  3THG A;  1JLG A;  3SAV A;  3M3Z A;  4WP2 A;  3JR4 A;  3HPO A;  1BIU A;  3FZH A;  1GL6 A;  3CC7 N;  4CJK A;  3AV0 A;  2BE2 A;  3QEX A;  3OVN A;  2OCE A;  4ILG B;  2G8L A;  4BLC A;  3OYM A;  1Q18 A;  3O9U A;  5FRM A;  2DY4 A;  1Z05 A;  5L8R F;  3QIO A;  2C9C A;  4R3D A;  5KPZ A;  1LCU A;  2V7Z A;  1ZBI A;  4DFK A;  3FTD A;  4DU3 A;  4AKI A;  3G25 A;  4B3M K;  2B3T A;  2NRX A;  4KPY A;  2DFF A;  3S3O A;  2J7O A;  4KHQ A;  4UY8 O;  4B3O A;  4IZ9 A;  2AP1 A;  2DZL A;  3A46 A;  5AQF A;  1C1A A;  3R6M A;  3FUU A;  3V4I A;  1HYZ A;  3OBW A;  3NGI A;  3LDP A;  4CJW A;  3ATU A;  3KKS A;  2VG7 A;  3WXK A;  4GV9 A;  3D8L A;  5C0Y A;  5C1B A;  3SAR A;  3ZYY X;  1KVC A;  2ZAN A;  1XWI A;  3SCX A;  1TH3 A;  2X6S A;  3V76 A;  2IIR A;  2LHG A;  2J4R A;  3EZW A;  1QAQ A;  3MEE A;  3KVW A;  3ZET A;  3IG5 A;  3KK7 A;  4KH5 A;  4CHY A;  4MGI E;  4GIP A;  4IFY A;  4JV5 M;  4L4U A;  4DBG B;  1WLJ A;  4MH0 E;  4F3O A;  3KK2 A;  3DXK A;  3OBY A;  4O5F A;  1N5Y A;  4FJ5 A;  4DV6 M;  1ATS A;  2ZJQ L;  1M1K O;  3DLK A;  2O8F A;  1YLA A;  3GPU A;  1HQE A;  2HNY A;  1G41 A;  3B7Q A;  2L2D A;  4Z6Y A;  4QNM A;  4OGE A;  3VER A;  3C3E A;  2BUP A;  4KAZ A;  2C5R A;  1IG8 A;  2CV0 A;  2P9K B;  3CFP A;  3R1X A;  4BC4 A;  3KD5 E;  3GPP A;  5BRE A;  4OX9 M;  4Z4C A;  1NM1 A;  3GLH E;  1HJP A;  4M41 A;  4BRN A;  1VQK N;  3NWL A;  2JGU A;  1T05 A;  2CHG A;  4F9O A;  5GIN A;  5H37 D;  4GMQ A;  3PFI A;  3SJH A;  1IBL M;  2HHT A;  5I9E B;  4TSX A;  1NY5 A;  3OYE A;  2VQF M;  4L6V 6;  5BR9 A;  4RNA A;  2O8D A;  5DYG A;  4KB0 A;  4IFV A;  4JKA A;  2FBY A;  4LF4 M;  1TKZ A;  3ENH A;  1TUY A;  4FJX A;  3SQ0 A;  2CV2 A;  1GOA A;  3EL2 A;  3VQ6 A;  2A41 A;  5EXP A;  4LH5 A;  4B7G A;  1BIS A;  3V1Q A;  3AGK A;  4AHS A;  3OYH A;  3NMU A;  1WB9 A;  4B1Z A;  1J5E K;  2Q2E B;  1XC3 A;  5DK5 A;  3OHR A;  1NNJ A;  3EKU A;  1OH7 A;  3GLG B;  4M3Y A;  1SL2 A;  1E32 A;  3FUV A;  2ITG A;  3VQD A;  4B1W B;  4H5W A;  3A2F A;  1DKG D;  4GHA A;  3R8E A;  4DFP A;  1X9S A;  4M3X A;  4A3V B;  4XK8 F;  5IT9 S;  1S6P A;  4PUO A;  4QS8 A;  3SAG A;  2A40 A;  3PXG A;  4HTU A;  3NBI A;  3BEX A;  2BWB A;  5C2D A;  4K0K K;  4C1N I;  3MXJ A;  4U7B A;  2QA4 N;  1N78 A;  1VQP N;  4IOX A;  3I51 A;  2P9U B;  5AFU A;  1SXJ E;  3FGU A;  4NLB A;  4KI6 A;  3QAU A;  4YOX A;  4CEB A;  3CTW B;  1S9E A;  2VQE K;  4Q0B A;  1IBM K;  1TAQ A;  3QFP A;  5FPE A;  1NKB A;  1Q9X A;  2UUB M;  1DGH A;  4NO7 A;  4O8U A;  1MX0 A;  3GQ5 A;  3ZC7 B;  1U45 A;  2CUZ A;  1RDA A;  2VYP A;  3HTV A;  1D0K A;  1JLA A;  1BGX T;  4QOS A;  3DOA A;  3IKM A;  2WZJ A;  3THV A;  1L2B A;  1IO2 A;  4KV8 A;  2QI2 A;  2M60 A;  3LDN A;  4NXN M;  1QE1 A;  1QZ5 A;  4Q7J A;  1NWK A;  3C0B A;  1EP4 A;  1DTT A;  3FZL A;  5AQH A;  2O01 F;  2LH0 A;  4PD2 A;  5J2M A;  1DLO A;  5ADX A;  3V9Z A;  1XMO M;  3VQE A;  3SI6 A;  3ZSO A;  2RKO A;  7CAT A;  3SAS A;  1MU2 A;  3ZEU A;  4B9Q A;  3TPQ A;  2XY7 A;  1OFI A;  2KXE A;  3HT3 A;  4TUW A;  5KO3 A;  1GLL O;  3VQQ A;  2GUI A;  1WGN A;  3RGP A;  2KTQ A;  2ZM6 K;  3TAP A;  3VK7 A;  2CRU A;  5CZ1 A;  2WTU A;  3U6C A;  4M9X A;  4DQS A;  4DUY M;  3J7A S;  4CJ7 A;  4YOT A;  5EP3 A;  4FK2 A;  2V6Z M;  2F7T A;  2UUC M;  4YOV A;  2XSZ A;  3HP9 A;  4O0I A;  3RR7 A;  4CHT B;  3KOZ E;  4LF6 K;  3HVR A;  4HUE A;  2ASM A;  2A1R A;  3ZET B;  5BRF A;  2P5T A;  3HP6 A;  4BVP A;  2FNA A;  1P3Q Q;  3RMC A;  4DTO A;  2P51 A;  4LFC K;  1HPM A;  3IHP A;  1KLM A;  5GAE P;  2PZS A;  2PBD A;  1IH7 A;  4OVL A;  4LJ5 A;  3HGI A;  2V7Y A;  1XWL A;  3TTD A;  3MDQ A;  4HLQ A;  2Q31 A;  4E7K A;  2O8F B;  4PKI A;  1LOT B;  3CPE A;  3H45 C;  3C6H A;  5EXW A;  1NY6 A;  3CCL N;  1VRU A;  3I55 N;  1LAV A;  1I4W A;  1WAJ A;  2BH1 A;  2JY8 A;  3KLH A;  1T43 A;  5KGX A;  3WNE A;  2KW0 A;  3NAE A;  1YIJ N;  2O8C B;  1QAO A;  4B9S A;  4BRI A;  1HKC A;  2KZZ A;  1QUS A;  1KSF X;  4EP5 A;  3KHY A;  3TR8 A;  1TH4 A;  1WR1 B;  4B3T M;  1NKC A;  1T6D A;  2F5O A;  4DLG A;  2XO7 A;  4WFA L;  2LHC A;  3LQR A;  3L3V A;  3NGZ A;  2O8D B;  4CEQ A;  2ZTC A;  3QBX A;  3WNG A;  2XLJ A;  1U6Z A;  4FJL A;  3MN5 A;  3AGR A;  1NJG A;  3ATV A;  4B3S K;  5FRN A;  4CEF A;  5IT9 O;  5SWM A;  2DKL A;  5A2Q S;  1I39 A;  4DR2 M;  1NGG A;  5LMN M;  4B1X B;  3L2Q A;  4IDH A;  3BZC A;  1XXH E;  4CJU A;  4EP4 A;  2R4J A;  3IFR A;  1S1X A;  4CJ4 A;  4YY3 M;  3OJU A;  1RFQ A;  3ZSY A;  4DTP A;  4H0P A;  2JZ1 A;  3GRR A;  4JI8 K;  2UXB K;  1R6B X;  3K5L A;  3SV4 A;  3SUN A;  4DG1 A;  4A61 A;  1K8K A;  3LQQ A;  1JLB A;  4GMJ B;  4M3Z A;  1Y8G A;  2OO9 A;  5JLF A;  1JCG A;  3ILK A;  3B89 A;  4DUZ M;  2G8U A;  4X66 M;  3D45 A;  4UQG A;  2OOB A;  4C1N K;  4CZM A;  1SZ2 A;  3QBW A;  3DLE A;  4KRE A;  5J2N A;  3R3L A;  3RMB A;  1FNN A;  4FWD A;  4YOU A;  4GVE A;  1OFH A;  1IFY A;  3CJ9 A;  3QLH A;  4W5R A;  3E01 A;  3KLE A;  3ITH A;  3M5R A;  5FPD A;  4AKH A;  1QQC A;  3J7A P;  2E1Y A;  5FTM A;  2HBJ A;  4BRK A;  3KP0 E;  2YKN A;  3LAK A;  5C12 A;  1XNQ M;  3VF4 A;  1OVY A;  4LJ7 A;  3LDS A;  1QSL A;  3F9K A;  4JRQ A;  4JI2 M;  1K9M O;  1UA1 A;  3K92 A;  1L5U A;  3P39 A;  4JS4 A;  4H8K A;  3MJ5 A;  3NH2 A;  4JEP A;  3DAW A;  3FTF A;  1BQN A;  1YUB A;  1RT4 A;  2OZM A;  2GWJ A;  2M5Z A;  1KRP A;  2E6M A;  5JMV A;  4JV5 K;  1KQS M;  4JKF A;  1VSI A;  2YHA A;  3ZEU B;  3E9L A;  4I2P A;  4J2B A;  2HHW A;  4FOI A;  1U2V B;  4NC6 A;  4DV6 K;  4C8L A;  1TGO A;  4B1Y B;  1ZBF A;  1NK9 A;  1HNX M;  2I7N A;  3OS2 A;  1L3U A;  5KTQ A;  3TWH A;  5HP1 A;  1BI4 A;  4PKH A;  5FLX S;  1ZC6 A;  3HPH A;  4CHZ A;  3B6O A;  1P90 A;  4OX9 K;  2RN2 A;  4GC5 A;  2JWS A;  5AQY A;  3WXM B;  4IBI A;  1E94 E;  1C0T A;  1IBL K;  3CER A;  2ITM A;  4CZG A;  3A8Y A;  3MMV A;  1RT6 A;  4LF5 M;  3HVT A;  2VQF K;  3S9H A;  1KXP A;  3O1B A;  4K8X A;  1D0L A;  3DRP A;  2D7H A;  3WHK A;  4FLU A;  3GRU A;  2O25 A;  4BQZ A;  3NDK A;  4LF4 K;  1WSJ A;  5EU7 A;  2NRH A;  5BPL A;  3C6A A;  1SS6 A;  2B5J A;  5CE3 A;  4FSV A;  3ZSR A;  1A5W A;  1GKI A;  4IKF A;  4AG6 A;  4DLE A;  4H5R A;  4MO4 A;  5J2Q A;  3O4Q A;  1T6O A;  3K2P A;  4H0V B;  1DO2 A;  3C58 A;  3BF3 A;  1NV8 A;  1Z5B A;  1NGF A;  4B1U B;  2YNM D;  4CBU A;  1WSF A;  4BRP A;  1JLQ A;  3GLI B;  3UKU A;  2P5O A;  5EXT A;  1TK0 A;  3GOI A;  1BU6 O;  2DWZ B;  1RDW X;  5BPN A;  4CHN A;  4F8R A;  3LM2 A;  4A59 A;  3CQY A;  1RBV A;  4BR0 A;  5ITU A;  2UXD K;  1VAZ A;  2QCU A;  3KOY E;  1U04 A;  4BWJ A;  4DWI A;  1YJW N;  5A2Q O;  3DI6 A;  1JQJ C;  3TL4 X;  2GEL A;  3NHG A;  1DGB A;  2DAI A;  3PSF A;  3EYZ A;  1RIL A;  4AF1 A;  2OPF A;  3GLF E;  1CXU A;  2QXF A;  5BPM A;  4GV6 A;  1QVF M;  5T7B A;  2G8I A;  3PIP L;  2XRI A;  3JS6 A;  3SHG B;  3DMJ A;  3QML A;  1HNI A;  1OAO C;  3A0I X;  4KHP M;  1N33 M;  1QAM A;  2UUB K;  1V33 A;  1KYI A;  4OW0 A;  1QQN A;  4FPB A;  4XH4 A;  3D0P A;  2FS1 A;  3DWL A;  3PNV A;  4S12 A;  3VTI A;  2N35 A;  1VQ5 N;  4BRG A;  2ZD1 A;  3K5O A;  2HL7 A;  4CEC A;  3VEN A;  3HWS A;  1K8K B;  4NXN K;  4KHN A;  2E1Z A;  1J5E M;  1BG3 A;  4HUG A;  4RF0 A;  4KH4 A;  2NQ8 C;  4MGZ E;  4CJS A;  4IO8 A;  2HMI A;  4CZH A;  4BRM A;  4FVU A;  3SHF A;  4CFD A;  4FM1 A;  2NRZ A;  1XMO K;  3AOE C;  3HZ6 A;  3GLH A;  1P8Z A;  2VCP A;  4DTN A;  3IMX A;  5BRH A;  4WF9 L;  4XH1 A;  4YHH M;  3KK3 A;  4CGF A;  3SAW A;  2KFN A;  4K0K M;  4QS9 A;  2R62 A;  4WUR A;  1RDB A;  2KHO A;  3K57 A;  4O0J A;  3ZX0 A;  4BY9 C;  1X37 A;  3BXW A;  1RCH A;  4JI6 K;  3HBT A;  2P9S A;  3OA9 A;  2JP7 A;  1RBT A;  3ZCB B;  3B74 A;  4CCH A;  4FK0 A;  1N32 M;  3BDP A;  1BHL A;  3FZF A;  4UN2 B;  4RKU F;  4X64 M;  2OZS A;  3I04 M;  1J53 A;  1GLN A;  5C10 A;  2E88 A;  3EE8 A;  2Z8Y M;  4H5N A;  1SKR A;  5FLX O;  4G4R A;  1EET A;  1KFS A;  4M9S A;  2BAN A;  2ATQ A;  4L8R B;  2V51 B;  2IDO A;  1NJW A;  3K9K A;  2QHO B;  3MK6 A;  4FO0 A;  5F2R A;  1LW0 A;  5AQI A;  2X8A A;  4BBA A;  4KB1 A;  3DXM B;  4E7I A;  3KP1 E;  4NSR A;  3L2W A;  3RMD A;  3A5O C;  3L8B A;  3CCQ N;  1SXJ A;  1B92 A;  3ULE B;  5AFU H;  2DPN A;  2X74 A;  1KVB A;  3NBP A;  4FJK A;  4Z4E A;  4FJN A;  1K8A O;  3KIO A;  4IBB A;  2ZM6 M;  1PJI A;  1XI1 A;  4F2L A;  4N56 A;  3TAG A;  1UWB A;  1YJN N;  2DAE A;  4Z4H A;  3CF0 A;  3SNN A;  1A5T A;  3QYB A;  5BPV A;  2O4G A;  2FC0 A;  1QQO A;  2Q0U A;  4JKC A;  3OW2 M;  4OLB A;  1CZ9 A;  4DR4 M;  4DR6 M;  4G3O A;  2FBT A;  2WOM A;  3HSC A;  4CE9 A;  2E8A A;  4JXJ A;  1M90 O;  4H0O A;  1S9G A;  2KRK A;  4N5S A;  2QWR A;  4GHL A;  2DWN A;  1WN7 A;  2V1C A;  3M0E A;  4E1J A;  3GRY A;  3AJI B;  2WSF F;  3NH1 A;  3PUF A;  4L78 A;  4D82 A;  1Q02 A;  3LDO A;  3CI5 A;  4DR2 K;  5LMN K;  3QIP A;  3T38 A;  3AY9 A;  4KFB A;  2R45 A;  4YY3 K;  4PA1 A;  2EUC A;  2GX9 A;  2JZ0 A;  3UKU B;  2DHR A;  4DV1 M;  4GNI A;  1KFV A;  4HCB A;  2ZJP L;  5GKN A;  1G3I A;  1GO5 A;  1JLC A;  2V1U A;  4FW1 A;  1Y64 A;  4BRF A;  1G15 A;  2Q3S A;  4DUZ K;  1ZMW A;  3DLR A;  2OA8 A;  2HVH A;  2JXN A;  1IN8 A;  3VOV A;  4FCT A;  3SAF A;  4X66 K;  1FK9 A;  2JWL A;  3T1A A;  3LCU A;  2G8H A;  4BRD A;  3RVC A;  1HT1 E;  5C25 A;  2DI0 A;  5I3U A;  1KCF A;  3N4P A;  1NJX A;  3RSE A;  2D4W A;  5HRO A;  2QKB A;  8CAT A;  1XQS C;  1CXQ A;  4H5V A;  2DFH A;  4AHV A;  1TV6 A;  4OLA A;  4LJ8 A;  2C96 A;  3NFA A;  1S22 A;  3CM5 A;  5FSW A;  4F2S A;  4QHS A;  5KQD A;  1WSG A;  2QP9 X;  1XNQ K;  1YJ9 N;  4IBK A;  1VSE A;  3M8S A;  4BR4 A;  1NG9 A;  4JI2 K;  1IBK M;  3R9X B;  1WSH A;  3T1H M;  3W0L B;  2BDP A;  3WNF A;  3U6M A;  1PJJ A;  5AQV A;  5AQW A;  4FWH A;  1HRH A;  3D2E A;  5J1E A;  1B9F A;  4H0Y B;  1ZBU A;  4WCE L;  4GKJ M;  2FH0 A;  1T44 A;  3E46 A;  4AH9 A;  4LZJ A;  1EKE A;  3KLF A;  3AA3 A;  3OYD A;  2KEB A;  3NE6 A;  3O9T A;  4QCL A;  1X9J A;  4LC9 B;  4B1V A;  4KT0 F;  1KC8 O;  4DTJ A;  1CZB A;  1X1P A;  2RF2 A;  3T69 A;  2QSF X;  3SC3 A;  1HNX K;  2HHU A;  1ZV1 A;  1C0F A;  4CJE A;  4QHT A;  1CLQ A;  3A5L C;  2HB5 A;  2Z1J A;  3BUZ B;  3AA5 X;  5M1O A;  2P9S B;  3EN9 A;  3LP3 A;  4CGH A;  2XF3 A;  2HWJ A;  1WGL A;  3FKE A;  2CV1 A;  4FL9 A;  2Q2R A;  1YVN A;  4N76 A;  2QEX N;  3SYL A;  1NHG C;  4A2B A;  3EZ5 A;  2D7G A;  4AZF A;  1BA0 A;  1WJ7 A;  4DR3 M;  2ZGZ A;  2HCB A;  2HBL A;  1VRT A;  5AQL A;  1TGU A;  1XXH A;  5AR0 A;  1HJR A;  4C23 A;  4CF8 A;  3KK1 A;  1BIZ A;  3MN7 A;  4DQP A;  1UFZ A;  2BTF A;  1GL7 A;  2Z7J A;  4CZK A;  1MJG M;  4LF5 K;  1X3N A;  3DLL L;  4G9Z A;  4CGI A;  1TYQ A;  2D0B A;  3MWT A;  1VSM A;  4GEW A;  4CES A;  4CER A;  3IG8 A;  3LZI A;  1VHX A;  2CGL A;  3DRS A;  3C3D A;  1HR0 M;  2R46 A;  3AOE A;  1VK0 A;  2CE7 A;  4KOD A;  1OH8 A;  1V92 A;  1NK7 A;  4CHP A;  4FJ8 A;  4BG8 A;  4MFB A;  2YI1 A;  3M7G A;  1SXJ B;  4FZY A;  2ZAO A;  1HLU A;  3DJC A;  1YSY A;  4IOC L;  1L2D A;  1DGK N;  1RT1 A;  4D81 A;  3VLF B;  3PX4 A;  3T19 A;  3CF5 L;  4FJG A;  1E3M A;  4FJ7 A;  5JIC A;  4KTW A;  5EXS A;  3CGW A;  2QWO A;  1QZM A;  4JN4 A;  4DR1 K;  4E7J A;  4BB9 A;  3MN6 A;  3Q7C A;  4BGB A;  5M1N A;  3PY8 A;  5LY3 A;  2FE8 A;  3VEO A;  2O8C A;  2QWQ A;  3ZSQ A;  3UIQ A;  1XB2 B;  1BUP A;  2WBN A;  4AHT A;  1BA1 A;  2K47 A;  5E6J A;  4O8K A;  5FTJ A;  1VEK A;  4PL8 A;  4AW4 A;  4KHP K;  4KKO A;  1N33 K;  3TPZ A;  4H4O A;  4DV3 K;  1AIP C;  3VEZ A;  3OYG A;  4BE1 A;  4DSI A;  2YCH A;  5D3G A;  3A42 A;  2YJF A;  3AVL A;  4LGY A;  3L2V A;  4DTX A;  1IN6 A;  4ZPX A;  3LP1 A;  2KZS A;  1NHW C;  3ZLJ A;  1LV7 A;  1Q8I A;  3A45 A;  3PX0 A;  2OAN A;  4RWT A;  2OQ4 A;  3VQP A;  4W5N A;  1YHQ N;  1JL1 A;  4LZZ A;  4ICL A;  4E1N A;  1IKV A;  1HJO A;  3TAN A;  4CJF A;  4O55 A;  2FF3 B;  5F1X A;  3CIP A;  4B9U A;  2F96 A;  2HHX A;  2UXD M;  3RSE B;  4U67 L;  1H6U A;  4YHH K;  4L8R C;  2MRO B;  4FCW A;  3KTQ A;  4H0T B;  3C9P A;  4IJE A;  3SAU A;  2WUS A;  1S1T A;  3AL0 C;  3AVK A;  2CGK A;  1Q81 O;  3O4W A;  1K3X A;  2LWX A;  2CH5 A;  3KXE C;  1W7A A;  1HYV A;  4FJ9 A;  4AHC A;  3HX3 A;  1L8Q A;  1HX1 A;  4I7F A;  2F9W A;  3FZK A;  4Q5V A;  3KSX A;  5KI6 A;  4CEZ A;  2HVI A;  1V34 A;  1HNW K;  5AQX A;  4ANR A;  1G8P A;  1QAN A;  4EFH A;  1N32 K;  3KKR A;  1K3W A;  4K41 A;  2VF8 A;  2NZT A;  4X64 K;  3QET A;  1R0A A;  3FFK B;  2AHM A;  3D2E B;  3H1V X;  3ZT2 A;  1NNE A;  1N8R O;  3JAM S;  5K14 A;  4LF9 M;  3AVB A;  3HL8 A;  1VQO N;  4B3R M;  1L2C A;  5BR8 M;  2OPS A;  1GLE G;  4RF1 A;  1TAU A;  2NRV A;  4BDY A;  2KNV A;  4ISG A;  3WQT A;  1Z59 A;  3H46 O;  1WXQ A;  3L2R A;  2R44 A;  1NGJ A;  2XFS A;  3C65 A;  1ORY B;  1RBR A;  3AO5 A;  3GLF A;  2FBX A;  1U2V A;  1T3V A;  4BQL A;  1IXZ A;  3HY5 A;  3AAP A;  3FLC O;  4GVM A;  1REV A;  3LWM A;  4LY6 A;  4L16 A;  2QWL A;  3LL3 A;  1L1Z A;  4HEO A;  5AQP A;  1A5X A;  1YTA A;  4DFJ A;  3PNY A;  1XXH B;  4JI6 M;  4BRE A;  4DF8 A;  4PWD A;  3FUW A;  3LP2 A;  4DS5 A;  3TAM A;  2FF6 A;  2YJE A;  1NK6 A;  5FDL A;  3C94 A;  2O8B A;  3K5M A;  1TYQ B;  3AA4 A;  5H1S Q;  3SJJ A;  4BR5 A;  4DR4 K;  4DR6 K;  2R4E A;  5C24 A;  3CQ8 A;  1YI2 N;  4EAH D;  2Q1N A;  1ZQ9 A;  2P9I A;  4LF7 M;  1WUA A;  3LPU A;  3AAQ A;  3KD1 E;  2OPQ A;  4OKJ A;  3J2P B;  1OAI A;  3SYZ A;  2P9P A;  3TWK A;  2HNZ A;  1O13 A;  1PJQ A;  1VG5 A;  1LWF A;  4AM7 A;  4GRI A;  1NJI O;  1R59 O;  4L15 A;  3CJ1 A;  4LJA A;  4YFU A;  3V9U A;  3ZQJ A;  4CJ6 A;  3ZSW A;  4B7F A;  5JS1 A;  2ZQB A;  3T15 A;  4YOY A;  4DV1 K;  4EIW A;  2BJV A;  4BDP A;  4O5B A;  4OPK A;  1XC8 A;  4IOA L;  4HWI A;  3U8X A;  5FTN A;  5M1P A;  3GLI A;  1EWQ A;  4CI6 A;  2GTD A;  3PO5 A;  3RGS A;  3W3D A;  1C7Y A;  3CXC M;  2G5G X;  3LWL A;  4CF9 A;  2YNH A;  2IS3 A;  3KLG A;  4ELV A;  3N4Q A;  4B7H A;  1E4G T;  3R9P A;  5KRT A;  4BC3 A;  3K8Z A;  4AQY M;  5M1Q A;  2G8V A;  2OOA A;  3O5B A;  1IXR C;  5KPR A;  1C1C A;  1JR3 D;  3HU1 A;  3K9O A;  3U9Z A;  2E2O A;  2F8T A;  3LW5 F;  5KPT A;  4MLH A;  4CF2 A;  1NSF A;  1NGD A;  5JLH A;  1WSI A;  5AQU A;  3KDS E;  4IEE A;  1YIT N;  1IBK K;  5AQM A;  1HNZ K;  3T1H K;  2X78 A;  1QVR A;  2F5Q A;  4LY7 A;  3U6Q A;  1ASU A;  3GQ4 A;  3H4J A;  4CGD A;  4DSF A;  4G4Q A;  1KAX A;  4GKJ K;  2Q36 A;  5MLC Q;  2ETJ A;  4QOZ B;  2BJW A;  2BGG A;  3H3N O;  5AQN A;  3C6U A;  1JCE A;  3SLC A;  4OO1 J;  1TKX A;  3KS8 A;  1V4S A;  4JKD A;  3L2U A;  3THW B;  1IN5 A;  2EJS A;  2ZBK B;  4D80 A;  4AI6 A;  3MCA B;  3SZ2 A;  3O1W A;  1YTU A;  1VQ8 N;  3SBJ A;  1D5A A;  3AVC A;  4BVO A;  1NGE A;  4PDI A;  4I9Q A;  3D7E O;  4ZHR A;  3H6E A;  3JAM O;  3QNO A;  2XY5 A;  4MB7 A;  1VDD A;  4FK4 A;  1SXJ C;  2RGH A;  2ZJR L;  2LVA A;  2UXC K;  3K9P A;  4BR2 A;  3GE1 A;  5EP4 A;  4EHU A;  4DR3 K;  3V9W A;  4FWN A;  4PT5 A;  2XH9 A;  2QW9 A;  2UYT A;  2V52 B;  3T1Y M;  4PHT X;  2Y0T A;  2DXI A;  1JXB A;  1VEJ A;  3VKH A;  2RGO A;  1ASW A;  3VN5 A;  4BAC A;  2HST A;  3GO8 A;  5DFL A;  4C8N A;  4FLX A;  3I0R A;  3L0Q A;  4ELU A;  3OYI A;  3W67 A;  3U5Z A;  1EXQ A;  4CD3 A;  4I2Q A;  4B8A B;  3NH0 A;  5C18 A;  3TSP A;  1NLV A;  1HR0 K;  2HMP A;  3IUC A;  2JY7 A;  4FW9 A;  3MEC A;  3CFO A;  3SFZ A;  5AQS A;  3GLF B;  4CBW A;  4HUF A;  4IJN A;  3GDQ A;  4ID1 A;  3UE5 A;  4CJQ A;  4JN6 A;  5F3W A;  3LDL A;  3SUQ A;  3WXJ A;  3AO4 A;  3VF6 A;  4Y28 F;  3DXM A;  3P4I A;  3GQ3 A;  1F21 A;  3HXM A;  1X9M A;  3GRV A;  4FLW A;  1D9D A;  3CCV N;  1RT7 A;  3ULE A;  1NK5 A;  3M8R A;  2O8B B;  4CJ5 A;  1S1W A;  1L3S A;  4K25 A;  4DSJ A;  3EIE A;  1S6Q A;  2QBY B;  3HHW A;  2P9I B;  2Y20 A;  3WEE B;  3HHY A;  1SG9 A;  3FYD A;  1Z6T A;  4IFE A;  1DO0 A;  4IBF A;  1H1V A;  3F5T A;  2P9P B;  4LGM A;  4LH4 A;  2YX6 A;  4DTU A;  4FZX C;  4GH9 A;  2B6A A;  4DCH A;  2PY5 A;  2EA0 A;  1Z25 A;  4BR9 A;  2YV0 X;  5J2P A;  3TAF A;  4CFB A;  4W5O A;  3AKZ A;  3U60 A;  4CGY B;  3QEW A;  3M8Q A;  4DFM A;  2Y1I A;  2LBC A;  1ZMU A;  3VEY A;  3L29 A;  3O08 A;  2XFT A;  3THX A;  3E9P A;  2K6B A;  3CMA N;  1KLN A;  2DZN B;  2P5G A;  2KDL A;  3IS9 A;  1L3V A;  4KHS A;  3CCJ N;  1OTR A;  3JR5 A;  2E5L M;  5GAH P;  4V19 S;  3ZSX A;  3QEV A;  1RNH A;  4M63 C;  3CF6 E;  3M6A A;  2H1R A;  1NV9 A;  3BBZ A;  4CZE A;  4GW6 A;  5ITT A;  5CHI A;  1ITG A;  3CJ7 A;  3GL1 A;  3DM2 A;  1G59 A;  4KI4 A;  2OTL N;  3THY A;  4FLT A;  3MMP A;  3O3H A;  1PM5 A;  4MO5 A;  4PQU A;  4BC5 A;  1UAX A;  4B9L A;  4DR1 M;  4L3Q A;  3FTE A;  1QZ6 A;  1VQ9 N;  4NCB A;  5CYM A;  4CHQ A;  1W5T A;  5LMU M;  5IWA M;  2YHX A;  1JR3 E;  4AM6 A;  4RW8 A;  4CJV A;  1W0H A;  3QYE A;  4JI1 M;  1XHX A;  4DQ8 A;  1DT9 A;  2BNK A;  4DV0 M;  2QNJ A;  4DV3 M;  2ERC A;  2K9D A;  3J8A A;  3K0S A;  1Q9Y A;  1Q39 A;  1HMV A;  3TWL A;  1E4F T;  4B9T A;  2KFZ A;  4B8C A;  3B7Z A;  1BO5 O;  4CEO A;  2CFO A;  5IZ7 D;  4LF9 K;  1U48 A;  4NCG A;  1WSE A;  4B3R K;  2YNG A;  5M1F A;  5BR8 K;  3W0L A;  4JI3 M;  2FLO A;  1EWR A;  4A2A A;  3I01 M;  3NCI A;  4N41 A;  4QNR A;  1KAZ A;  2H3G X;  3DOL A;  3OYC A;  2GNO A;  2PYL A;  3G10 A;  4I6M B;  1U47 A;  3BP8 A;  2O5R A;  4BE0 A;  3NF7 A;  3BF1 A;  1RTI A;  3HM8 A;  2R18 A;  4M0W A;  2E6L A;  2XEP A;  5JVG L;  1ZBL A;  3V6D A;  2FBV A;  4CIS A;  4FJH A;  3E9O A;  1QHA A;  3B7N A;  3TI0 A;  5AQO A;  1MA9 B;  3FD9 A;  3CCE N;  3VES A;  5HRP A;  4J2E A;  4AG5 A;  1GLB G;  2KQ2 A;  1HNW M;  4CK2 A;  1ZYQ A;  4NRW A;  4YDU A;  5CY4 A;  1HUX A;  2VWK A;  3TAR A;  2XZF A;  3GG4 A;  5JVH L;  3O9S A;  4XEI A;  3OTO M;  4CED A;  4LF7 K;  4QAG A;  4CFA A;  2WSC F;  3TAE A;  4GY2 B;  4CZF A;  3U5Z B;  2G3Q A;  1WHC A;  5DMR A;  4CEE A;  1R2Z A;  3AA2 A;  3GP1 A;  3ASM A;  5TKY A;  3NVM A;  1IN7 A;  1GOB A;  5EP1 A;  4YNQ A;  3HO1 A;  4G4O A;  1WIV A;  4AIL C;  4LSL A;  3D2F A;  2KZM A;  2I7P A;  3BZK A;  4I8O A;  3O3F A;  3VGM A;  4H0X B;  2Y0Q A;  2VWJ A;  2Y21 A;  3EE9 A;  4DKW A;  3A98 B;  3VA0 A;  3QIN A;  4X65 M;  1KFD A;  2HF3 A;  3I56 N;  1UA0 A;  4K42 A;  2X6N A;  4FJM A;  2NLX A;  3BOS A;  3GPX A;  3FUX A;  4M7X A;  1XHZ A;  4PCZ A;  1W9H A;  1F4I A;  4DMN A;  4I9L A;  2YHB A;  3TU5 A;  4DU1 A;  4O4G A;  4FLV A;  4QOZ C;  3U9D A;  5CZ2 A;  1NGC A;  3W0F A;  1K82 A;  5JI2 E;  2G8F A;  2G8W A;  4CEA A;  1JXE A;  3D6R A;  4LJ9 A;  1D8Y A;  4JKH A;  4AQY K;  1S3S A;  4CGJ A;  1HQY E;  1QDR A;  1R5L A;  1VDL A;  4C8O A;  3CFR A;  1TK5 A;  3HJS A;  4CVN E;  1J09 A;  2KW4 A;  4YOW A;  1NNU C;  3ZX3 A;  2A1S A;  1GJS A;  3DA1 A;  3U60 B;  1MWM A;  1QQM A;  4DF4 A;  4MM3 B;  3HU2 A;  3QWL A;  1EQY A;  3NBX X;  4O44 A;  4W5T A;  1RT3 A;  3THX B;  1Q3C A;  1T8E A;  4FVM A;  3VQ9 A;  4G6Z A;  1YF5 L;  2J7N A;  4DTR A;  3QEP A;  3MED A;  2Z3X A;  2W42 A;  2FSK A;  5FTL A;  2P9N B;  1SL0 A;  4E3S A;  3IAY A;  2AJQ A;  1VQ7 N;  1W2B M;  5ITQ A;  4FXD A;  4DV5 M;  4Y1D A;  2F8S A;  2HBM A;  4WW0 A;  2L7H A;  3CJC A;  1BCM A;  1RGI A;  2K0B X;  4CZI A;  3THY B;  2L7I A;  3HKP A;  2KRU A;  3V9S A;  3UJN A;  3QO9 A;  4NCA A;  4KBO A;  2ASP A;  3UMM A;  1IJJ A;  3EEQ A;  1OVQ A;  2ASO A;  4JS5 A;  4E7L A;  1JLE A;  3VFD A;  3OS0 A;  1HYS A;  3L4I A;  3LZJ A;  5ITX E;  3G6E N;  3U6L A;  1C0G A;  4H03 B;  4JAX A;  4WQ4 C;  1SUQ A;  4KO0 A;  1TUU A;  3T1Y K;  1YAG A;  3DZD A;  4JHD A;  4FCY A;  4FWG A;  1QTM A;  3NF8 A;  1FKO A;  2VG5 A;  1HNZ M;  4F3T A;  3VKG A;  4DU4 A;  3KVG A;  4K8Z A;  4CIG A;  4LRT A;  4A57 A;  3UGJ A;  2NRT A;  3MXM A;  1VQL N;  1Z5C A;  1TDH A;  4A5A A;  4B9N A;  3C95 A;  4H5T A;  4BG9 A;  4I5S A;  2FSN A;  1VSK A;  1TR8 A;  3P83 D;  3TTF A;  1I94 M;  2ZAM A;  4LCB A;  1QSY A;  1VSL A;  4OVZ A;  2A3Z A;  2A5Y B;  3MX5 A;  3RFW A;  2NUB A;  3F2K A;  3CCR N;  2IOC A;  4AHU A;  3AAR A;  1CUK A;  3QEI A;  4OPA A;  4CJR A;  4JRP A;  1L1T A;  4IBN A;  4DQI A;  4FM0 A;  2F5N A;  3I8B A;  2GUP A;  3V81 A;  3QB0 A;  3ZCM A;  4WFN L;  3IG1 A;  4NB4 A;  2UXC M;  2GEM A;  3VGL A;  3Q7B A;  2R7Y A;  5DM7 L;  1TL3 A;  1S1V A;  2A5X A;  2LVP C;  3C7N A;  1YE9 A;  3O6W A;  4F4K A;  5AQZ A;  2DWM A;  3ENB A;  2RKI A;  5KQ8 A;  1GLJ O;  3EIH A;  3OY9 A;  1I3A A;  2JLE A;  1S5J A;  1BWF O;  3KOX E;  4EZ9 A;  2Q97 A;  2DHY A;  1LW2 A;  4P17 A;  2HOE A;  3QNN A;  1GLD G;  1IG9 A;  1FW6 A;  4GKK K;  3AFH A;  3GPY A;  3U6D A;  3D2F B;  3EO3 A;  4JKB A;  4ZTF A;  3CME N;  1DEJ A;  1T03 A;  4RCH A;  3NVK A;  1GVN A;  4DS4 A;  1OIP A;  1NBW A;  4OPJ A;  3JYT A;  2KZU A;  3WUH A;  2P9L B;  1DGF A;  2J5Y A;  1BL3 A;  1Q82 O;  2E5L K;  3VMF B;  3U6P A;  2DNA A;  4JI7 M;  3U61 A;  3SUP A;  4XBO A;  3CPW M;  4CD1 A;  1IKY A;  4FWK A;  2L4E A;  2YR0 A;  1YVU A;  3O80 A;  1X9W A;  2XZU A;  2B4J A;  3VQB A;  1Z6R A;  1PJT A;  3QIC A;  4MQ3 A;  2MGW A;  1D0M A;  4FPA A;  4HTL A;  2UUA M;  5FPN A;  1OIZ A;  3NF6 A;  4BRL A;  1EFU B;  5JI3 E;  5LMU K;  2C98 A;  1IY0 A;  2LSN A;  5IWA K;  4KH6 A;  1EO1 A;  3VF2 A;  1FKP A;  3TAB A;  4A62 A;  4JI1 K;  1C1K A;  2KLA A;  4Y1C A;  3B8A X;  2CWB A;  4DV0 K;  3VDU A;  4FM2 A;  4CIF A;  1N34 M;  3V1O A;  1NOY A;  3LP0 A;  4FWL A;  4WYB A;  2VDB B;  3VPZ A;  5TKW A;  4C8M A;  4BRH A;  1RTD A;  1ZBH A;  3P31 A;  1VQM N;  4OJR A;  3ZT3 A;  4B08 A;  1ZMV A;  3L3U A;  4BWM A;  4MGH A;  2EKF A;  5C2F A;  4JI3 K;  5HL7 L;  4LFB M;  3FRI A;  4IG3 A;  2HHH M;  4NLC A;  2JUJ A;  3RTV A;  2XY6 A;  1ZAE A;  3M1F A;  1U49 A;  1IY2 A;  2I5J A;  3FE3 A;  4OKK A;  2GQF A;  4YOR A;  1NO1 A;  4E7H A;  1ESV A;  3HK2 A;  2CHV A;  3VQ7 A;  1X3M A;  3TSU A;  1KAY A;  3CD6 N;  1EIJ A;  4GC9 A;  1NGI A;  3THW A;  3CC2 N;  3MXI A;  1QHT A;  4ILH A;  3NF9 A;  3DOK A;  4W5Q A;  1CZA N;  2HAK A;  1Z26 A;  2XY8 A;  2FSJ A;  4EHT A;  3K58 A;  3E4R A;  3VEX A;  3WNH A;  4PKG A;  1T3T A;  3PV8 A;  1S72 N;  1OH5 A;  4E1M A;  5GAD P;  2WC9 A;  5AJ3 K;  1S1U A;  4JHD B;  2LVO C;  4CIE A;  1RU3 A;  3AVH A;  1IKX A;  4G4N A;  3H4M A;  3FE1 A;  3AVN A;  1WBB A;  4KTQ A;  1QZE A;  1XHB A;  3ZT1 A;  3OTO K;  4NXM M;  3UK6 A;  4DQR A;  1KD1 O;  2DAG A;  1A5V A;  3UKR A;  5HBM A;  3HI0 A;  3CF2 A;  3I33 A;  1N36 M;  3QER A;  2JY6 B;  3LAL A;  3ENO A;  3CCU N;  3J7Z O;  3OJS A;  2QPA A;  2XHB A;  4E19 A;  1LWC A;  4EIA A;  3S41 A;  4DV4 M;  3Q8G A;  4GIT A;  2YHY A;  4OVZ B;  2EX3 A;  4M9Z A;  5KGW A;  3KJV A;  3RE8 A;  3VQ4 A;  2C9O A;  3CG7 A;  2X49 A;  2HBK A;  4X65 K;  1D2N A;  2QM1 A;  2WFB A;  4HHT A;  3CJA A;  1WNS A;  3JXU A;  2HHV A;  4IBD A;  3WT0 A;  3M6G A;  1OKS A;  1JR3 A;  4JI5 M;  2OPP A;  2W6L A;  2LNH C;  1J9A A;  3GBT A;  4CZL A;  3TWM A;  1C6V A;  3VA3 A;  3W68 A;  3AO2 A;  4FLZ A;  3SQ2 A;  2CGJ A;  4WQ4 A;  3C7N B;  2DAM A;  4FZZ A;  4JK7 A;  4MDB A;  3O4N A;  2NNW A;  2ZTD A;  3U6S A;  1KTQ A;  2H5X A;  2QEN A;  4C8K A;  3I4Y A;  3VEV A;  1TKT A;  2L4F A;  1XMQ M;  3CQX A;  4KHU A;  1IV0 A;  1FJG M;  1G71 A;  3SK3 A;  3SMP A;  1Z5A A;  2QBY A;  2DWL A;  3CCS N;  4FJI A;  3AV9 A;  3WEE A;  5BN8 A;  5HRS A;  1NMD A;  4Z0U A;  3B9P A;  2Z4S A;  1T6C A;  5ITR A;  2UU9 M;  1TDZ A;  2LXE A;  1IKW A;  4JKG A;  3VEW A;  4RW7 A;  4IBJ A;  3U3Y A;  3L26 A;  3VQC A;  3GLG E;  5BN9 A;  2FOI C;  4REZ A;  1SAZ A;  3MX2 A;  3LM9 A;  4LSN A;  5AQJ A;  3U3G A;  5M1K A;  3P38 A;  3ID6 A;  3U61 B;  2W41 A;  2VGM A;  4DV5 K;  3AO1 A;  4DR5 M;  2A6A A;  3L4Q A;  3J80 S;  4IEI A;  4BC2 A;  1J5O A;  4MGK E;  4DQQ A;  4FWP A;  3FTC A;  4WE1 A;  4M7Y A;  1R2Y A;  2VG6 A;  3F73 A;  4A5B A;  3VGK A;  4IO9 L;  3RR8 A;  1HQU A;  4IJA A;  4R7G A;  5FPM A;  3DXK B;  1JL2 A;  3PIO L;  1IN4 A;  4LF8 K;  2D0C A;  1SKS A;  2CEA A;  4I81 A;  5LJV A;  1G99 A;  2Z1I A;  1Q7Y O;  2VWB A;  3HHX A;  4ITQ A;  4DR7 M;  1NJF A;  2EKK A;  5ITY A;  1EE8 A;  3TTC A;  2GBZ A;  3LAM A;  5AZI A;  4HVJ A;  1J54 A;  4CF0 A;  3B6P A;  4DHY A;  1VSF A;  5EVZ A;  3T6P A;  2R6F A;  3DRR A;  3KFU G;  4BRA A;  3SAT A;  1MWK A;  3QFU A;  4RW9 A;  4YDU C;  4P16 A;  4DV2 M;  3I4V A;  3EKS A;  3PX6 A;  4JK9 A;  4NYN A;  3CJB A;  2DAK A;  4LFA M;  4ZTJ A;  4CGG A;  1XNR K;  3UB5 A;  4M3U A;  3O8M A;  3VK8 A;  2YNI A;  3NGY A;  2Q0R A;  4R79 A;  2DTU A;  2GV9 A;  4M3W A;  1NOZ A;  1D9F A;  3SUO A;  2Y1J A;  1I94 K;  2KNZ A;  3EY1 A;  1XUP O;  3E9S A;  1BCO A;  1S3X A; 
#chains in the Genus database with same CATH homology
 2ZGY A;  4I6M A;  3L27 A;  2HF4 A;  3A5M C;  5BRD A;  3A5N C;  3HJ8 A;  4BRO A;  1HQC A;  2XSZ D;  1D4X A;  3SMS A;  1GLC G;  2W82 A;  4IBG A;  1GLF O;  1VQ6 N;  4DV7 M;  3L2A A;  3TSQ A;  4JK8 A;  5GIO A;  1V4T A;  4BR7 A;  4CZJ A;  3UKR B;  1ATN A;  2L6O A;  3CCM N;  5CR4 A;  2JWK A;  3SBG A;  2D1K A;  3KWG A;  3U4L A;  2F4V M;  4NSO B;  4NL4 H;  3O9R A;  4JKE A;  5GAG P;  1DGH B;  1QYR A;  4FWS A;  4JI0 M;  3G71 N;  4X62 M;  4HL4 A;  4FWM A;  2E20 A;  4DB3 A;  5EOY A;  4Z94 A;  4W5W A;  3J7B A;  4I4L A;  5ITX A;  4JI4 M;  3K2L A;  4JYA M;  2HKJ A;  5AZJ A;  2QXL A;  4FWO A;  3ID8 A;  1WOQ A;  3MHV C;  1ATR A;  1SQK A;  1BDG A;  2E2N A;  5AQG A;  1ZXO A;  4JKG B;  4XH5 A;  1N77 A;  2DZO B;  3KS4 A;  2R65 A;  3KSJ A;  4GKK M;  2IVN A;  4LG2 A;  3FYC A;  2EWS A;  5AQK A;  1IY1 A;  2F9T A;  4JNE A;  2RHK A;  4PDG A;  1MDU B;  5AQR A;  1Q86 O;  1HT2 E;  4IBE A;  1N75 A;  3K1J A;  4B3M M;  4LRS A;  4IIW A;  3WXI A;  2NRR A;  3LMM A;  3PLA A;  4JD2 A;  1VQ4 N;  2P9N A;  4FOE A;  4ISF A;  3FZM A;  3ZX2 A;  4WFB L;  1NGH A;  1J7K A;  2A42 A;  3E66 A;  4FD2 A;  5F0X A;  2L09 A;  3SYK A;  2YHW A;  4RTF D;  3L28 A;  3VTH A;  3CHW A;  1G4A E;  1OKJ A;  2GWK A;  5DNY A;  2VGN A;  2IVO A;  5AZI B;  4WQ5 C;  3VDP A;  3SBT A;  3CET A;  4PL7 A;  3J81 S;  5B8H A;  2YFQ A;  2IVP A;  3L6Q A;  5DYI A;  5AQQ A;  3PVS A;  3HU3 A;  1R7R A;  3WHL A;  5LJW A;  3LDQ A;  4Z8X A;  3KW6 A;  3WQU A;  4CBX A;  1GLA G;  1J6Z A;  2QZ4 A;  2QWM A;  2RE2 A;  3MN9 A;  3U6O A;  2E2Q A;  4II7 A;  4LJ4 A;  4IXC A;  1K73 O;  3KOW E;  1RDU A;  4ILJ A;  2KKZ A;  3CC4 N;  1UM8 A;  2YQZ A;  2JA2 A;  1BOT O;  3HOT A;  3HJQ A;  1YUW A;  2E2P A;  1E9R A;  2D7E A;  2PAV A;  4BRQ A;  5DM6 L;  5FTK A;  4K43 A;  3LVV A;  3E1Y A;  2X4A A;  2CHQ A;  3QDK A;  5C15 A;  2VII A;  4OPH A;  3TE6 A;  1JJ2 M;  2FFJ A;  4KO8 A;  3HOS A;  4MDA A;  1QQW A;  4OU7 A;  2ZF5 O;  3MCP A;  2F5P A;  2VQE M;  4AKG A;  1IBM M;  4IJF A;  2PFU A;  2C99 A;  3ZH9 B;  2Z4R A;  3J27 B;  3KWI A;  1W5S A;  2P9L A;  2KA6 B;  3LVW A;  5AZJ B;  5AQT A;  3FUT A;  1VQN N;  3AOG A;  2NRW A;  5E26 A;  3TQS A;  3U6E A;  4FWR A;  4NOO B;  3L25 A;  1JCF A;  4FCV A;  1NGA A;  2FXU A;  3D8B A;  4IWV A;  3H1Q A;  3IDH A;  5EQT A;  3T7Z A;  4GV3 A;  1NGB A;  5EJC A;  1TH2 A;  4J8F A;  1YXQ A;  1NVM A;  4LJ6 A;  2D0O A;  2W40 A;  1E9S A;  4MLE A;  4M0D A;  2OTJ N;  2P9K A;  4JD2 B;  5ELZ A;  3WXL A;  1QVG M;  1HKG A;  3R8F A;  4LF6 M;  5E84 A;  3MWP A;  2QTD A;  1OJL A;  3F9M A;  3UZU A;  1Q3B A;  4LFC M;  5ADX H;  2AA4 A;  2DVW B;  3SAH A;  4LF8 M;  3FR0 A;  3K9J A;  5EXX A;  5EX5 A;  4MGY E;  4Y0W A;  3KZB A;  2EO2 A;  3G4S N;  3HHZ A;  1W97 L;  5EY4 A;  1IXS B;  2CH6 A;  3GLG A;  1ILY A;  3H3O B;  5IRE B;  3DFZ A;  2XGN A;  5GIP A;  5HOO A;  4NRV A;  4KLN A;  2QWN A;  1MU5 A;  1XNR M;  2D0P A;  1SXJ D;  2P9U A;  1IQP A;  4BRC A;  4FWQ A;  4QS7 A;  4B3S M;  4IBC A;  1IM2 A;  2ZWH A;  3VET A;  2F5S A;  3HRG A;  1HKB A;  4WQ5 A;  5EP2 A;  2QWP A;  3O9Q A;  1DGG A;  4XGI A;  4JI8 M;  2UXB M;  3GLH B;  1ZBS A;  4BGA A;  3Q8X A;  4ISE A;  3THG A;  3SAV A;  3M3Z A;  3JR4 A;  3FZH A;  1GL6 A;  3CC7 N;  3AV0 A;  4ILG B;  2G8L A;  4BLC A;  1Q18 A;  3O9U A;  1Z05 A;  2C9C A;  4R3D A;  5KPZ A;  1LCU A;  2V7Z A;  3FTD A;  4AKI A;  3G25 A;  2NRX A;  2J7O A;  4UY8 O;  4IZ9 A;  2AP1 A;  3A46 A;  5AQF A;  3R6M A;  3FUU A;  3OBW A;  3LDP A;  3ATU A;  3WXK A;  4GV9 A;  3D8L A;  5C0Y A;  5C1B A;  3SAR A;  3ZYY X;  2ZAN A;  1XWI A;  1TH3 A;  2IIR A;  2J4R A;  3EZW A;  1QAQ A;  3KVW A;  3ZET A;  3IG5 A;  3KK7 A;  4KH5 A;  4MGI E;  4GIP A;  4JV5 M;  4L4U A;  4MH0 E;  3DXK A;  3OBY A;  4O5F A;  4DV6 M;  1ATS A;  2ZJQ L;  1M1K O;  3GPU A;  1G41 A;  4Z6Y A;  4QNM A;  3VER A;  2BUP A;  2C5R A;  1IG8 A;  2CV0 A;  2P9K B;  3R1X A;  4BC4 A;  3GPP A;  5BRE A;  4OX9 M;  1NM1 A;  4BRN A;  1VQK N;  3NWL A;  2CHG A;  4F9O A;  5GIN A;  5H37 D;  4GMQ A;  3PFI A;  3SJH A;  1IBL M;  5I9E B;  1NY5 A;  2VQF M;  5BR9 A;  4RNA A;  5DYG A;  4JKA A;  4LF4 M;  3ENH A;  1TUY A;  2CV2 A;  3EL2 A;  2A41 A;  5EXP A;  4B7G A;  3AGK A;  3NMU A;  4B1Z A;  2Q2E B;  1XC3 A;  3OHR A;  1NNJ A;  3EKU A;  3GLG B;  1E32 A;  3FUV A;  4B1W B;  4H5W A;  1DKG D;  4GHA A;  3R8E A;  4A3V B;  5IT9 S;  4QS8 A;  3SAG A;  2A40 A;  3PXG A;  3NBI A;  3BEX A;  5C2D A;  4C1N I;  4U7B A;  2QA4 N;  1N78 A;  1VQP N;  4IOX A;  3I51 A;  2P9U B;  5AFU A;  1SXJ E;  3FGU A;  4NLB A;  3QAU A;  4YOX A;  3CTW B;  3QFP A;  5FPE A;  2UUB M;  1DGH A;  4NO7 A;  4O8U A;  1MX0 A;  3GQ5 A;  3ZC7 B;  2CUZ A;  2VYP A;  3HTV A;  4QOS A;  3DOA A;  3IKM A;  1L2B A;  2QI2 A;  2M60 A;  3LDN A;  4NXN M;  1QZ5 A;  1NWK A;  3C0B A;  3FZL A;  5AQH A;  2LH0 A;  4PD2 A;  5ADX A;  1XMO M;  2RKO A;  7CAT A;  3SAS A;  3ZEU A;  4B9Q A;  3TPQ A;  1OFI A;  2KXE A;  4TUW A;  5KO3 A;  1GLL O;  3RGP A;  3VK7 A;  3U6C A;  4M9X A;  4DUY M;  3J7A S;  4CJ7 A;  4YOT A;  5EP3 A;  2V6Z M;  2F7T A;  2UUC M;  4YOV A;  2XSZ A;  4CHT B;  3KOZ E;  2ASM A;  3ZET B;  5BRF A;  2P5T A;  4BVP A;  2FNA A;  1HPM A;  5GAE P;  2PBD A;  4LJ5 A;  3HGI A;  2V7Y A;  3TTD A;  3MDQ A;  4HLQ A;  2Q31 A;  4PKI A;  1LOT B;  3CPE A;  3H45 C;  3C6H A;  5EXW A;  1NY6 A;  3CCL N;  3I55 N;  1I4W A;  2BH1 A;  2KW0 A;  1YIJ N;  1QAO A;  4BRI A;  1HKC A;  1KSF X;  3KHY A;  1TH4 A;  4B3T M;  1T6D A;  2F5O A;  4WFA L;  3LQR A;  3QBX A;  2XLJ A;  1U6Z A;  3MN5 A;  3AGR A;  1NJG A;  3ATV A;  5A2Q S;  1NGG A;  4DR2 M;  5LMN M;  4B1X B;  4IDH A;  2R4J A;  3IFR A;  4YY3 M;  1RFQ A;  4H0P A;  3GRR A;  1R6B X;  4A61 A;  1K8K A;  3LQQ A;  5JLF A;  1JCG A;  3ILK A;  4DUZ M;  4X66 M;  4C1N K;  4CZM A;  1SZ2 A;  3QBW A;  3R3L A;  1FNN A;  4FWD A;  4YOU A;  4GVE A;  1OFH A;  3CJ9 A;  3M5R A;  5FPD A;  4AKH A;  2E1Y A;  5FTM A;  2HBJ A;  4BRK A;  3KP0 E;  5C12 A;  1XNQ M;  3VF4 A;  1OVY A;  4LJ7 A;  4JI2 M;  1K9M O;  3K92 A;  3P39 A;  3MJ5 A;  4JEP A;  3DAW A;  3FTF A;  1YUB A;  2GWJ A;  2M5Z A;  5JMV A;  1KQS M;  4JKF A;  3ZEU B;  3E9L A;  4FOI A;  1U2V B;  4B1Y B;  1HNX M;  2I7N A;  4PKH A;  5FLX S;  1ZC6 A;  1P90 A;  4GC5 A;  5AQY A;  3WXM B;  4IBI A;  1E94 E;  3CER A;  2ITM A;  4CZG A;  3A8Y A;  3MMV A;  4LF5 M;  1KXP A;  3O1B A;  2D7H A;  3WHK A;  3GRU A;  4BQZ A;  2NRH A;  5BPL A;  3C6A A;  1SS6 A;  5CE3 A;  4FSV A;  1GKI A;  4AG6 A;  4H5R A;  4MO4 A;  4H0V B;  1DO2 A;  3C58 A;  3BF3 A;  1Z5B A;  1NGF A;  4B1U B;  2YNM D;  4CBU A;  4BRP A;  3GLI B;  3UKU A;  5EXT A;  3GOI A;  1BU6 O;  2DWZ B;  1RDW X;  5BPN A;  3LM2 A;  4A59 A;  3CQY A;  4BR0 A;  5ITU A;  1VAZ A;  2QCU A;  3KOY E;  1YJW N;  1JQJ C;  3TL4 X;  2GEL A;  1DGB A;  4AF1 A;  2OPF A;  5BPM A;  4GV6 A;  1QVF M;  3PIP L;  3JS6 A;  3SHG B;  3QML A;  3A0I X;  4KHP M;  1N33 M;  1QAM A;  1QQN A;  1KYI A;  4OW0 A;  4FPB A;  4XH4 A;  3DWL A;  3PNV A;  4S12 A;  3VTI A;  1VQ5 N;  4BRG A;  2HL7 A;  3VEN A;  3HWS A;  1K8K B;  2E1Z A;  1J5E M;  1BG3 A;  4RF0 A;  4KH4 A;  2NQ8 C;  4MGZ E;  4IO8 A;  4CZH A;  4BRM A;  4FVU A;  3SHF A;  2NRZ A;  3AOE C;  3HZ6 A;  3GLH A;  1P8Z A;  2VCP A;  3IMX A;  5BRH A;  4WF9 L;  4XH1 A;  4YHH M;  3SAW A;  4K0K M;  4QS9 A;  2R62 A;  4WUR A;  2KHO A;  3ZX0 A;  4BY9 C;  1X37 A;  3HBT A;  2P9S A;  3OA9 A;  3ZCB B;  1N32 M;  3FZF A;  4X64 M;  1GLN A;  5C10 A;  2E88 A;  3EE8 A;  4H5N A;  4G4R A;  4M9S A;  2V51 B;  3K9K A;  3MK6 A;  4FO0 A;  5F2R A;  5AQI A;  2X8A A;  4BBA A;  3DXM B;  3KP1 E;  4NSR A;  3A5O C;  3CCQ N;  1SXJ A;  3ULE B;  5AFU H;  2DPN A;  1K8A O;  4IBB A;  2ZM6 M;  1PJI A;  1YJN N;  3CF0 A;  5BPV A;  2Q0U A;  1QQO A;  4JKC A;  3OW2 M;  4DR4 M;  4DR6 M;  3HSC A;  2E8A A;  4JXJ A;  1M90 O;  4H0O A;  2KRK A;  2QWR A;  4GHL A;  2DWN A;  2V1C A;  3M0E A;  4E1J A;  3GRY A;  3AJI B;  4L78 A;  4D82 A;  3LDO A;  3CI5 A;  3T38 A;  3AY9 A;  2R45 A;  2EUC A;  2GX9 A;  3UKU B;  2DHR A;  4DV1 M;  4GNI A;  1KFV A;  2ZJP L;  5GKN A;  1G3I A;  2V1U A;  1Y64 A;  4BRF A;  1IN8 A;  3VOV A;  4FCT A;  3SAF A;  2JWL A;  4BRD A;  3RVC A;  1HT1 E;  3N4P A;  3RSE A;  2D4W A;  8CAT A;  1XQS C;  4H5V A;  4LJ8 A;  2C96 A;  1S22 A;  5FSW A;  4QHS A;  5KQD A;  2QP9 X;  1YJ9 N;  4IBK A;  4BR4 A;  1IBK M;  3R9X B;  3T1H M;  3W0L B;  3U6M A;  1PJJ A;  5AQV A;  5AQW A;  4FWH A;  3D2E A;  4H0Y B;  4WCE L;  4GKJ M;  1T44 A;  4LZJ A;  2KEB A;  3O9T A;  1X9J A;  4LC9 B;  4B1V A;  1KC8 O;  3T69 A;  3SC3 A;  1C0F A;  4QHT A;  3A5L C;  3BUZ B;  5M1O A;  2P9S B;  3EN9 A;  2XF3 A;  3FKE A;  2CV1 A;  4FL9 A;  2Q2R A;  1YVN A;  2QEX N;  3SYL A;  1NHG C;  4A2B A;  2D7G A;  4AZF A;  1BA0 A;  4DR3 M;  2ZGZ A;  2HCB A;  2HBL A;  5AQL A;  5AR0 A;  1TGU A;  1XXH A;  4C23 A;  3MN7 A;  2BTF A;  1GL7 A;  2Z7J A;  4CZK A;  1X3N A;  3DLL L;  4G9Z A;  1TYQ A;  3MWT A;  3IG8 A;  2CGL A;  1HR0 M;  2R46 A;  3AOE A;  2CE7 A;  4KOD A;  4BG8 A;  2YI1 A;  3M7G A;  1SXJ B;  2ZAO A;  1HLU A;  3DJC A;  1YSY A;  4IOC L;  1L2D A;  1DGK N;  4D81 A;  3VLF B;  3CF5 L;  5JIC A;  5EXS A;  2QWO A;  1QZM A;  4JN4 A;  4BB9 A;  3MN6 A;  3Q7C A;  4BGB A;  5M1N A;  5LY3 A;  2FE8 A;  3VEO A;  2QWQ A;  1BUP A;  2WBN A;  1BA1 A;  2K47 A;  5E6J A;  4O8K A;  5FTJ A;  4PL8 A;  4AW4 A;  3TPZ A;  3VEZ A;  2YCH A;  3A42 A;  2YJF A;  4LGY A;  1IN6 A;  4ZPX A;  2KZS A;  1NHW C;  1LV7 A;  3A45 A;  2OAN A;  4RWT A;  2OQ4 A;  1YHQ N;  4LZZ A;  1HJO A;  2FF3 B;  5F1X A;  3CIP A;  2UXD M;  3RSE B;  4U67 L;  1H6U A;  4L8R C;  4FCW A;  4H0T B;  4IJE A;  2WUS A;  3SAU A;  3AL0 C;  2CGK A;  1Q81 O;  3O4W A;  1K3X A;  2LWX A;  2CH5 A;  3KXE C;  1L8Q A;  1HX1 A;  2F9W A;  3FZK A;  3KSX A;  5AQX A;  1G8P A;  1QAN A;  4EFH A;  1K3W A;  4K41 A;  2NZT A;  3FFK B;  2AHM A;  3D2E B;  3H1V X;  1N8R O;  3JAM S;  4LF9 M;  1VQO N;  4B3R M;  1L2C A;  5BR8 M;  1GLE G;  4RF1 A;  2NRV A;  4ISG A;  3WQT A;  1Z59 A;  3H46 O;  1WXQ A;  1NGJ A;  2XFS A;  3C65 A;  1ORY B;  3GLF A;  4BQL A;  1U2V A;  1T3V A;  1IXZ A;  3FLC O;  3AAP A;  4LY6 A;  4L16 A;  2QWL A;  3LL3 A;  1L1Z A;  5AQP A;  3PNY A;  1XXH B;  4JI6 M;  4BRE A;  3FUW A;  2FF6 A;  2YJE A;  1TYQ B;  5H1S Q;  4BR5 A;  2R4E A;  1YI2 N;  4EAH D;  2Q1N A;  1ZQ9 A;  2P9I A;  4LF7 M;  1WUA A;  3AAQ A;  3J2P B;  2P9P A;  3TWK A;  1O13 A;  4AM7 A;  4GRI A;  1NJI O;  1R59 O;  4L15 A;  3CJ1 A;  4LJA A;  4B7F A;  3T15 A;  4YOY A;  4EIW A;  2BJV A;  1XC8 A;  4IOA L;  4HWI A;  3U8X A;  5FTN A;  5M1P A;  3GLI A;  4CI6 A;  2GTD A;  3RGS A;  3W3D A;  3CXC M;  2G5G X;  3N4Q A;  4B7H A;  1E4G T;  3R9P A;  4BC3 A;  3K8Z A;  4AQY M;  5M1Q A;  3O5B A;  1IXR C;  5KPR A;  1JR3 D;  3HU1 A;  3U9Z A;  2E2O A;  4MLH A;  5KPT A;  1NSF A;  1NGD A;  5JLH A;  5AQU A;  3KDS E;  4IEE A;  1YIT N;  5AQM A;  1QVR A;  2F5Q A;  3U6Q A;  3GQ4 A;  4G4Q A;  1KAX A;  2Q36 A;  5MLC Q;  2BJW A;  3H3N O;  5AQN A;  1JCE A;  3SLC A;  4OO1 J;  3KS8 A;  1V4S A;  4JKD A;  1IN5 A;  2ZBK B;  4D80 A;  4AI6 A;  3MCA B;  3O1W A;  1VQ8 N;  3SBJ A;  4BVO A;  1NGE A;  4PDI A;  3D7E O;  3H6E A;  4MB7 A;  1VDD A;  1SXJ C;  2RGH A;  2ZJR L;  4BR2 A;  3GE1 A;  5EP4 A;  4EHU A;  4FWN A;  4PT5 A;  2XH9 A;  2QW9 A;  2UYT A;  2V52 B;  3T1Y M;  4PHT X;  2Y0T A;  2DXI A;  3VKH A;  2RGO A;  2HST A;  3GO8 A;  3L0Q A;  3U5Z A;  4CD3 A;  5C18 A;  3TSP A;  1NLV A;  2HMP A;  3IUC A;  4FW9 A;  3SFZ A;  5AQS A;  3GLF B;  4CBW A;  4IJN A;  3GDQ A;  3UE5 A;  4JN6 A;  5F3W A;  3LDL A;  3WXJ A;  3VF6 A;  3DXM A;  3P4I A;  3GQ3 A;  3GRV A;  3CCV N;  3ULE A;  4K25 A;  3EIE A;  2QBY B;  3HHW A;  2P9I B;  2Y20 A;  3WEE B;  3HHY A;  3FYD A;  1Z6T A;  4IFE A;  1DO0 A;  4IBF A;  1H1V A;  3F5T A;  2P9P B;  4LGM A;  2YX6 A;  4GH9 A;  4DCH A;  2EA0 A;  4BR9 A;  3AKZ A;  3U60 A;  4CGY B;  3VEY A;  3L29 A;  3O08 A;  2XFT A;  3E9P A;  3CMA N;  2DZN B;  3CCJ N;  3JR5 A;  2E5L M;  5GAH P;  4M63 C;  3CF6 E;  3M6A A;  2H1R A;  4CZE A;  5ITT A;  5CHI A;  3CJ7 A;  3GL1 A;  1G59 A;  2OTL N;  1PM5 A;  4MO5 A;  4BC5 A;  4DR1 M;  4L3Q A;  3FTE A;  1QZ6 A;  1VQ9 N;  1W5T A;  5LMU M;  5IWA M;  2YHX A;  4AM6 A;  4JI1 M;  4DQ8 A;  1DT9 A;  2BNK A;  4DV0 M;  4DV3 M;  2ERC A;  3J8A A;  1Q39 A;  3TWL A;  1E4F T;  1BO5 O;  2CFO A;  5IZ7 D;  5M1F A;  3W0L A;  4JI3 M;  2FLO A;  4A2A A;  4QNR A;  1KAZ A;  2H3G X;  4I6M B;  3BP8 A;  2O5R A;  3BF1 A;  3HM8 A;  2R18 A;  4M0W A;  5JVG L;  2XEP A;  4CIS A;  3E9O A;  1QHA A;  5AQO A;  1MA9 B;  3FD9 A;  3CCE N;  3VES A;  4AG5 A;  1GLB G;  1HNW M;  4NRW A;  4YDU A;  1HUX A;  2XZF A;  3GG4 A;  5JVH L;  3O9S A;  4XEI A;  3OTO M;  4GY2 B;  4CZF A;  3U5Z B;  1R2Z A;  3GP1 A;  5TKY A;  3NVM A;  1IN7 A;  5EP1 A;  4G4O A;  3D2F A;  2I7P A;  4I8O A;  3VGM A;  4H0X B;  2Y0Q A;  2Y21 A;  3EE9 A;  4DKW A;  3A98 B;  4X65 M;  2HF3 A;  3I56 N;  4K42 A;  2NLX A;  3BOS A;  3GPX A;  3FUX A;  4M7X A;  4PCZ A;  3TU5 A;  4QOZ C;  3U9D A;  1NGC A;  3W0F A;  1K82 A;  5JI2 E;  3D6R A;  4LJ9 A;  4JKH A;  1S3S A;  1HQY E;  3HJS A;  1J09 A;  4YOW A;  1NNU C;  3ZX3 A;  3DA1 A;  3U60 B;  1MWM A;  1QQM A;  4MM3 B;  3HU2 A;  3QWL A;  1EQY A;  1Q3C A;  4FVM A;  4G6Z A;  1YF5 L;  2J7N A;  2Z3X A;  2FSK A;  5FTL A;  2P9N B;  1VQ7 N;  1W2B M;  5ITQ A;  4DV5 M;  2HBM A;  4WW0 A;  2L7H A;  3CJC A;  1RGI A;  4CZI A;  2L7I A;  3HKP A;  2KRU A;  3UJN A;  4KBO A;  2ASP A;  3UMM A;  1IJJ A;  2ASO A;  3VFD A;  3L4I A;  5ITX E;  3G6E N;  3U6L A;  1C0G A;  4H03 B;  4JAX A;  4WQ4 C;  1TUU A;  1YAG A;  3DZD A;  4JHD A;  4FWG A;  1HNZ M;  3VKG A;  3KVG A;  4LRT A;  4A57 A;  3UGJ A;  2NRT A;  1VQL N;  1Z5C A;  1TDH A;  4A5A A;  4H5T A;  4BG9 A;  4I5S A;  2FSN A;  3TTF A;  1I94 M;  2ZAM A;  4LCB A;  4OVZ A;  2A3Z A;  2A5Y B;  3MX5 A;  3RFW A;  3F2K A;  3CCR N;  3AAR A;  4OPA A;  1L1T A;  2F5N A;  3I8B A;  2GUP A;  3QB0 A;  4WFN L;  4NB4 A;  2UXC M;  2GEM A;  3VGL A;  3Q7B A;  5DM7 L;  2A5X A;  3C7N A;  1YE9 A;  3O6W A;  5AQZ A;  2DWM A;  3ENB A;  5KQ8 A;  1GLJ O;  3EIH A;  1BWF O;  3KOX E;  2Q97 A;  2HOE A;  1GLD G;  3AFH A;  3GPY A;  3U6D A;  3D2F B;  3EO3 A;  4JKB A;  3CME N;  1DEJ A;  4RCH A;  3NVK A;  1GVN A;  1NBW A;  2KZU A;  3WUH A;  2P9L B;  1DGF A;  1Q82 O;  3VMF B;  3U6P A;  4JI7 M;  3U61 A;  4XBO A;  3CPW M;  4CD1 A;  4FWK A;  2YR0 A;  3O80 A;  2XZU A;  1Z6R A;  3QIC A;  4FPA A;  4HTL A;  2UUA M;  5FPN A;  4BRL A;  5JI3 E;  2C98 A;  1IY0 A;  4KH6 A;  1EO1 A;  3VF2 A;  4A62 A;  1C1K A;  2KLA A;  3B8A X;  3VDU A;  1N34 M;  4FWL A;  4WYB A;  3VPZ A;  4BRH A;  5TKW A;  3P31 A;  1VQM N;  4B08 A;  4MGH A;  5C2F A;  5HL7 L;  4LFB M;  2HHH M;  4NLC A;  1ZAE A;  3M1F A;  1IY2 A;  4YOR A;  1ESV A;  2CHV A;  1X3M A;  3TSU A;  1KAY A;  3CD6 N;  4GC9 A;  1NGI A;  3CC2 N;  4ILH A;  1CZA N;  2FSJ A;  4EHT A;  3E4R A;  3VEX A;  4PKG A;  1T3T A;  1S72 N;  5GAD P;  2WC9 A;  4JHD B;  4G4N A;  3H4M A;  3FE1 A;  1XHB A;  1KD1 O;  4NXM M;  3UK6 A;  3UKR A;  3HI0 A;  3CF2 A;  3I33 A;  1N36 M;  3ENO A;  3CCU N;  3J7Z O;  2QPA A;  4EIA A;  3S41 A;  4DV4 M;  4GIT A;  2YHY A;  4OVZ B;  4M9Z A;  3RE8 A;  2C9O A;  2X49 A;  2HBK A;  1D2N A;  2QM1 A;  2WFB A;  3CJA A;  3JXU A;  4IBD A;  3WT0 A;  3M6G A;  4JI5 M;  1JR3 A;  4CZL A;  3GBT A;  2LNH C;  3TWM A;  2CGJ A;  4WQ4 A;  3C7N B;  4JK7 A;  4MDB A;  2NNW A;  3U6S A;  2QEN A;  3I4Y A;  3VEV A;  1XMQ M;  3CQX A;  1FJG M;  3SK3 A;  3SMP A;  1Z5A A;  2QBY A;  2DWL A;  3CCS N;  3WEE A;  5BN8 A;  1NMD A;  3B9P A;  2Z4S A;  1T6C A;  5ITR A;  2UU9 M;  1TDZ A;  2LXE A;  4JKG A;  3VEW A;  4IBJ A;  3L26 A;  5BN9 A;  2FOI C;  4REZ A;  1SAZ A;  3MX2 A;  3LM9 A;  5AQJ A;  5M1K A;  3P38 A;  3ID6 A;  3U61 B;  2W41 A;  2VGM A;  4DR5 M;  2A6A A;  3L4Q A;  3J80 S;  4IEI A;  4BC2 A;  4MGK E;  4FWP A;  3FTC A;  4M7Y A;  1R2Y A;  4A5B A;  3VGK A;  4IO9 L;  4IJA A;  4R7G A;  5FPM A;  3DXK B;  3PIO L;  1IN4 A;  2CEA A;  4I81 A;  5LJV A;  1G99 A;  1Q7Y O;  2VWB A;  3HHX A;  4ITQ A;  4DR7 M;  1NJF A;  1EE8 A;  5ITY A;  3TTC A;  5AZI A;  4DHY A;  5EVZ A;  3KFU G;  4BRA A;  3SAT A;  1MWK A;  3QFU A;  4YDU C;  4P16 A;  4DV2 M;  3I4V A;  3EKS A;  4JK9 A;  3CJB A;  4LFA M;  3UB5 A;  3O8M A;  3VK8 A;  2Q0R A;  4R79 A;  1XUP O;  3E9S A;  1S3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...