2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pantothenate kinase 1
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
1HKCA 1H1VA 3IDHA 3H6EA 4FPBA 3ZEUA 2GUPA 2Q36A 3ENOA 1C0FA 4H0OA 1G99A 5AQNA 2Q1NA 2FSKA 3L4IA 5AQXA 3EKUA 4FPAA 4BC2A 5AFUH 2NZTA 3CJCA 2YCHA 5EXWA 3MN7A 2QXLA 3CJAA 4B1WB 1NGHA 5AZIB 3VEVA 4B1ZA 4MO5A 3H46O 2FF6A 2QW9A 4I6MB 3A0IX 4I6MA 2A40A 2KHOA 2IVPA 3JS6A 3QBXA 4QS9A 1D4XA 2YHXA 3KZBA 4A2AA 4BR5A 5B8HA 1LOTB 5BN8A 4XH1A 4K43A 2EWSA 3GOIA 3BP8A 2ASMA 3D2FA 3EN9A 3C0BA 3O08A 3ATVA 4BQLA 3RSEB 1NGCA 3RSEA 4QS8A 4DQ8A 2E8AA 2P9UB 4CBWA 2P9KB 4HWIA 3U4LA 2HMPA 3HM8A 2P9KA 3WXLA 2V7YA 3CJ7A 4FWOA 3H45C 1X9JA 2FSJA 4HTLA 3LDQA 4BRLA 3LDOA 4PKIA 1MA9B 3DXMA 4FWMA 4A61A 3BF3A 2J4RA 5F2RA 3KVGA 4CJ7A 3HI0A 2BUPA 2P9SA 4BRMA 3P4IA 4BQZA 1BU6O 3QMLA 4IJAA 4IO8A 1IG8A 1DEJA 2HF4A 2QWNA 2QWPA 3KHYA 3R9PA 4BRAA 1QZ6A 3VEXA 4FWNA 4BRQA 1NGJA 4XEIA 3CHWA 2QM1A 3I33A 4XH4A 2A42A 2AP1A 1X3MA 4JAXA 3U9ZA 4L3QA 1RFQA 2W41A 3R8EA 3FE1A 3W3DA 3WEEA 4H0YB 4CZIA 1NGAA 4CZKA 2IVOA 3FZKA 3BF1A 4ISFA 4JD2B 3B8AX 4K42A 4CZLA 5CE3A 3W0LA 2CH6A 3MN9A 1J6ZA 4WQ4C 5I9EB 4FOEA 4O5FA 3G25A 3L6QA 3VENA 4K41A 1HJOA 3MN6A 1KAXA 5AQHA 4M7XA 2F9TA 4FWRA 3GBTA 3EZWA 1GLJO 1T6DA 2A5XA 1QQMA 4BREA 2PAVA 1YUWA 3C7NA 4MLEA 4EIAA 2W40A 3QFPA 1S3XA 3EO3A 5BPMA 4BRCA 3FZMA 1R59O 3LDNA 4QS7A 3ZX2A 5F0XA 4BVPA 1MWMA 2AA4A 3JXUA 1BWFO 4YDUA 3GDQA 3VESA 2YHYA 3VEZA 5AQIA 3F9MA 5AZJA 5TKYA 2QWOA 4H5TA 4B1UB 1Y64A 3H3NO 5AQOA 3S41A 2YI1A 1IJJA 2A6AA 3H3OB 1U6ZA 5ELZA 3ZEUB 1QHAA 4BG9A 4BVOA 1BO5O 2D0PA 3ZX0A 4BR0A 2YJFA 4FWKA 4H5VA 5AQTA 5FPDA 4CBXA 3EL2A 1U2VA 3A5OC 5ADXA 1GLCG 2IVNA 5AR0A 3VEWA 1QQNA 2FXUA 4IWVA 4CZJA 3VF2A 3LDLA 3O5BA 1NGFA 1CZAN 2ZGYA 5JLHA 4IJNA 2CGJA 3M6GA 2NLXA 1T6CA 2A3ZA 4PL7A 5LJWA 1BDGA 5AQMA 1SZ2A 2HF3A 4RWTA 4H0TB 3AAQA 1BA1A 2ZGZA 1BUPA 4A62A 3CQXA 1KXPA 2Q0RA 4BC5A 3AARA 5AQYA 2QWQA 3IMXA 4PL8A 3D2FB 3VOVA 3HBTA 4BC3A 1EQYA 4BRHA 3CIPA 1E4GT 1OKJA 5ADXH 4ISGA 3O4WA 3CI5A 2E88A 3FR0A 1MDUB 1XC3A 5LY3A 4BRNA 3SK3A 3CERA 4PKGA 3VEOA 5FPNA 1NLVA 3GL1A 5BRHA 3DXMB 4BRDA 4IXCA 3QBWA 3QDKA 3DAWA 4ISEA 2P9NB 2P9SB 4RCHA 1MWKA 2P9NA 2V52B 2P9LA 3FZHA 3UE5A 4K25A 3HSCA 2Q2RA 4H0VB 1C0GA 2Q97A 1HUXA 4JHDA 4XH5A 4E1JA 1SQKA 5AQUA 2E20A 4EHTA 3OHRA 3GG4A 1XQSC 2UYTA 3ZETB 1YAGA 3MMVA 1V4SA 3ZETA 4H5WA 3ENHA 5AQWA 5FPMA 3LL3A 1Q18A 4M7YA 4LC9B 4EFHA 3WEEB 3CJ1A 1YVNA 5AQSA 2I7NA 2GTDA 4NO7A 2ZWHA 3O6WA 4MLHA 3VGLA 3GE1A 3SLCA 1TYQB 1DGKN 1TYQA 1TUUA 4CZMA 5KPTA 1ZXOA 3UKUA 2QWRA 2ITMA 4H5NA 1NM1A 4EAHD 3C7NB 3WXKA 1NGBA 3EKSA 4B1XB 2E2QA 2PBDA 1LCUA 1HKGA 4BR4A 2VCPA 4CI6A 1NGGA 2YHWA 4J8FA 5EOYA 5KPZA 1NGIA 4WQ4A 2GEMA 3ID8A 5BR9A 1JCEA 1BA0A 3SMPA 5EY4A 3UKRB 2FSNA 2E2PA 4WYBA 1KAZA 3IFRA 3UKRA 3U9DA 4CD1A 1GLFO 4FWQA 4WQ5C 5AZJB 4MO4A 1V4TA 4Y0WA 4AM6A 2NRHA 1BG3A 3MCPA 5EVZA 2VYPA 4O8KA 2QWLA 3HTVA 2P9IB 4B1VA 3U8XA 2P9IA 3WXIA 4BG8A 4EHUA 5AFUA 1U2VB 1GLLO 1X3NA 5AQRA 1QQOA 5AQJA 5AQQA 5E84A 4H03B 3D7EO 3FZLA 3VEYA 3A5MC 1NMDA 5F1XA 5KPRA 1NGDA 2OANA 5LJVA 3M3ZA 5AQFA 3WXJA 2V7ZA 1QZ5A 1HPMA 1ATRA 3O8MA 1K8KB 3FGUA 1K8KA 1GLDG 3A5NC 3TU5A 3QB0A 2Q0UA 5AQPA 3LM2A 1Z05A 5AQGA 3BUZB 4BR7A 4NB4A 1E4FT 1TUYA 3J8AA 1NWKA 4AM7A 2HOEA 2FF3B 4BRFA 5AQVA 2CGKA 3IUCA 5BREA 1ESVA 4BR9A 1GLBG 5AZIA 1YXQA 1NGEA 1RGIA 1JCGA 3VETA 3VF4A 3LM9A 4JNEA 1GLAG 4FO0A 3QICA 2ASOA 4M63C 2CH5A 4CZFA 3WT0A 1HX1A 3QFUA 2D4WA 2WUSA 3UB5A 4BC4A 2P9LB 3CJ9A 2P9PB 1ATNA 1DKGD 2P9PA 3DWLA 4FOIA 2E2OA 1Z6RA 4JHDB 1ZC6A 3FFKB 1ATSA 1WOQA 2E2NA 3CJBA 2P9UA 1T44A 5E26A 2YJEA 1SAZA 3MDQA 5EX5A 3VPZA 4CZGA 2Q31A 3L0QA 3I8BA 5KQ8A 1KAYA 4IZ9A 4BGBA 4BRKA 2D1KA 1XUPO 3MK6A 2VWBA 2A41A 3O80A 3O1WA 2F9WA 3AY9A 3M1FA 3O1BA 3SMSA 4BRGA 2ZF5O 3ZX3A 1ZBSA 3CETA 2E1ZA 2IIRA 4C23A 3DJCA 1BOTO 5BPLA 3VGKA 3D2EB 3TPQA 4A2BA 4CZEA 3WUHA 3D2EA 1P8ZA 3WQTA 2ASPA 3UKUB 3WQUA 4GNIA 1HLUA 3H1VX 2D0OA 1RDWX 4FWPA 1JCFA 3VERA 4B1YB 3VF6A 2I7PA 3ULEB 5JMVA 3VGMA 5JLFA 3ULEA 5JICA 1WUAA 3HZ6A 4H0XB 5BRFA 2CGLA 4JD2A 4FWSA 4H0PA 4JN4A 4FSVA 3FZFA 4FL9A 4FWLA 4BROA 3BEXA 4DCHA 4CD3A 4F9OA 1S22A 3ATUA 3AAPA 2E1YA 3DXKB 3R6MA 1GLEG 4YDUC 4BRIA 2QWMA 3DXKA 3A8YA 5AQKA 3SJHA 4BRPA 4RTFD 2H3GX 4H5RA 4KBOA 3CQYA 2GWJA 3H1QA 2V51B 4GY2B 1HKBA 4BR2A 4CBUA 5AQLA 3LDPA 1NBWA 4Z94A 5BRDA 2BTFA 3FLCO 5BN9A 4WQ5A 4DHYA 5FPEA 4PKHA 3MN5A 4CZHA 5AQZA 2GWKA 5BPNA 5KQDA 2DPNA 3A5LC 4B9QA 2FLOA 2GELA 4BGAA 4DB3A
chains in the Genus database with same CATH superfamily
1HKCA 3H6EA 4FPBA 1L2DA 2Y20A 4FK2A 3TPZA 3NGZA 4DV5K 2OO9A 2Q36A 1IN8A 1N5YA 3EE8A 3ENOA 5AQNA 2O4GA 2FSKA 4J2AA 4KV8A 5AQXA 4DFPA 1OIZA 2QZ4A 3K0SA 4CGIA 3KP1E 2GBZA 5AFUH 1ORYB 4QCLA 2DY4A 4KPYA 3SAGA 3HOSA 3CCLN 3ZT3A 2YKNA 5AZIB 1HNZM 3B7ZA 1DGBA 1RDBA 2UUCM 1TK8A 4ILJA 2LVNC 4LJ6A 4MO5A 3H46O 4NXMM 2FF6A 2KHHA 3THXA 1XNRK 3GPYA 4I6MA 2KHOA 4JK8A 2IVPA 2JZ1A 2M5ZA 4BACA 1TK5A 4KRFA 1SS6A 3VMFB 4Z6YA 2QBYB 2YHXA 2VWKA 5C0YA 1LOTB 3EIEA 2EWSA 2NNWA 3NVKA 4FLUA 3U60A 2X8AA 1W2BM 3O08A 2QCUA 4BQLA 3S9HA 3RSEB 4JYAK 4CFAA 3D45A 2XF3A 1AUAA 1GOBA 4QS8A 4R79A 3FFIA 3SCXA 2F5PA 1P3QQ 2E8AA 1RBTA 3P38A 4JI0M 4JKBA 4OX9M 1GOCA 2P9KA 4KHPM 3CJ7A 3D8LA 3I0RA 3H45C 1L2BA 4HTLA 1E9SA 2WOMA 3KVWA 5F3WA 3CF5L 2UXBK 1MA9B 3PFIA 4FWMA 5F2RA 3HJFA 3ZH9B 3HI0A 4B3MM 2K0BX 2KZSA 4IJAA 1V33A 2L4FA 1IFYA 1VSKA 2L2DA 3KHYA 2PYLA 1WSHA 1QZ6A 3EZ5A 1G41A 3AVAA 3IS9A 3U61B 4BRQA 4YHHM 4CW7B 1D0KA 2WFBA 4L3QA 2W41A 3R8EA 4LJ7A 2EO2A 3CPEA 3W3DA 3V4IA 1KQSM 4FLYA 1BL3A 4JD2B 2HSTA 2CH6A 3C6AA 4DTRA 1TL3A 3QYEA 4O5FA 2A5YB 2GNOA 1RDCA 3ZSQA 3HHWA 4GIPA 1N36M 3VENA 4JI7K 1HJOA 3SAFA 2CV2A 4Z4EA 1ILYA 3V9SA 1A5TA 1QANA 5JI3E 3GBTA 4FCTA 3THGA 1OH5A 4QAGA 5IZ7D 1TR8A 2Y21A 4M0DA 3C7NA 3T38A 4FWDA 1E3MA 1M1KO 3AVLA 3M8SA 1HNXM 4DR3M 1S3XA 3JSMA 4I81A 1VQ7N 1NJXA 5J2NA 5M1KA 3ZX2A 3GLGE 4L15A 3B74A 2NRRA 3K5OA 3QEWA 4M42A 4BVPA 3IECA 3DYAA 1YSYA 4CFCA 2G5GX 2G8UA 1YI2N 2D7EA 2RE2A 1I4WA 2ZE2A 1QVRA 1IM2A 4RW4A 3PVSA 2A6AA 2B3TA 1U6ZA 5ELZA 1ZV1A 2D0CA 3ZEUB 5SZTA 2YHAA 4BG9A 4IFYA 4CIGA 4FJXA 1A5WA 1NVMA 4W5RA 1CUKA 2CFOA 4H5VA 3QLHA 2EJSA 3EL2A 2ZD1A 3A5OC 3RR7A 4M0WA 1IXRC 3K8ZA 3J7YP 3HX3A 2Y1IA 5AR0A 2F96A 4OW0A 4AHSA 2FXUA 3VF2A 2O8DB 3L27A 3BOSA 1CZAN 2ZGYA 4GMJB 5JLHA 1F21A 3HVRA 2CE7A 4IJNA 2UU9K 2ZTDA 2NLXA 1T6OA 4A5AA 2NRXA 1TKTA 3DOKA 1LW2A 2XSZA 3K58A 1BDGA 3DLRA 2HF3A 4RWTA 2RF2A 1VQLN 5I42A 4DSIA 1PGYA 1C1AA 4LGMA 3NF7A 2QENA 4AHVA 3NF9A 1BA1A 2VQFM 3OYFA 4ZTFA 2P5OA 3U6SA 1O1WA 2QXFA 1IXZA 4KH5A 2LHGA 3HBTA 5M1QA 3AVBA 4BRHA 4V19S 4I7FA 4FJ7A 4DR5K 1ZBUA 2HVIA 1WSJA 3O4WA 1RBRA 1RILA 3CI5A 3SZ2A 2E88A 4F2SA 4B3TM 1TDZA 4ILHA 2DFEA 4WFAL 4IBGA 1TAQA 2F5NA 5KGWA 3VEOA 4FW1A 4AKHA 4MQ3A 3AVJA 3T7ZA 1VG5A 1BCMA 3WNHA 1YIJN 3MXMA 1KFDA 1N75A 2P9NB 1Z5CA 3AO2A 2F8TA 2VG6A 4R71A 3SAWA 2QP9X 2V52B 1XWIA 2ZAMA 2P9LA 3RGSA 3FZHA 4E7LA 2DWMA 4OPJA 3CFRA 4H0VB 1KVCA 4U7BA 4E1MA 3VK8A 2Q97A 4E1JA 2DAEA 1QSSA 4GMQA 4DTPA 1HT2E 1VK0A 4BB9A 2V1UA 2XHBA 1ZAEA 4LY7A 3K9KA 4LSNA 4L8RB 2DHRA 1XQSC 2VWJA 1V4SA 4DSKA 3MX2A 4G4OA 5AQWA 4LD0A 1Q18A 3AVNA 1Q86O 1C1CA 1RCHA 2I7NA 1GJTA 3LQRA 1XXHA 1CLQA 4E7JA 2GTDA 3VTIA 4EP5A 2ZWHA 4CF1A 1R6BX 1S9GA 1VDLA 3GE1A 2F5QA 3HPGA 3SLCA 3AVKA 1DGKN 4JI6M 1WSIA 5C25A 1G4AE 1TUUA 3ZSRA 2NUBA 4CZMA 4XGIA 5KPTA 3FTCA 3VQAA 2QWRA 2HHSA 4F8RA 2DWZB 2YFQA 4HHTA 3JAMS 1NGBA 3CFPA 1IKWA 4GV3A 4FZXC 3Q7BA 2E2QA 2BJVA 3ALYA 1EFUB 4DV5M 2PBDA 1LCUA 4BR4A 3T1HK 3OJUA 1WIVA 1NGGA 4O4GA 3SQ0A 3FE3A 2X78A 2F4VK 5LMUM 1N78A 1U4BA 4F3TA 5LMNM 2GEMA 1FKOA 3IAYA 1D0LA 3SJJA 3SMPA 1BA0A 5EY4A 4CEBA 3UKRB 3OW2M 1X1PA 4WYBA 3VQ4A 1U48A 4FWQA 3SHFA 4MO4A 1V4TA 5H37D 3QO9A 1S1XA 3B6PA 1BG3A 5EVZA 3CC4N 2ZM6K 5FTLA 5FDLA 1JL1A 3NCIA 3HTVA 3THYB 3CMEN 2KTQA 3KD5E 3SATA 2PYJA 1VQ8N 3U8XA 3HJ8A 4LF6K 4DV0K 4EHUA 3PX0A 3U6MA 2GUIA 3ISNC 1VQ6N 2Z4SA 1UFZA 4DTJA 2VG7A 3FZLA 4NYNA 4JYAM 3KSXA 3A5MC 3HHZA 1NMDA 3J80S 3ILKA 1NNUC 2OANA 5LJVA 3THWA 2JUJA 2V7ZA 2HAKA 1SUQA 1QZ5A 1U45A 1TTEA 3O8MA 1R0AA 4DQIA 4B9SA 4RW9A 3AA3A 3ZQJA 3K5MA 4GVMA 4Z4CA 4DV6K 4F3OA 3W68A 1OQYA 2R4EA 3A45A 2DFFA 1NWKA 4AM7A 5FTNA 1D9FA 2A1RA 1Q9YA 2BWEA 3FUWA 2O4IA 5GIPA 3KW6A 4DUYK 1ESVA 5AZIA 4CHOA 3CMAN 1NGEA 3LM9A 5FRNA 4NCGA 1F4IA 4M3WA 4FJMA 2E5LK 5J2MA 2DENA 3QICA 3DA1A 2ASOA 3VQPA 1WHCA 2HBJA 3LALA 3B6OA 4CZFA 2PY5A 1MU5A 3KFUG 3LQQA 4EIWA 2QBYA 4DR6M 3KK2A 1HX1A 2R4JA 2D4WA 1RDUA 4OGEA 2QTDA 1LW0A 3CJ9A 1GL7A 1DKGD 4LF5M 4QHTA 3VKGA 3BZCA 4CJLA 2P9PA 3T1AA 4AG5A 2E2OA 2DZLA 4DLGA 4JHDB 4XBOA 2O5RA 3AL0C 1NY5A 2E2NA 3CG7A 1BGXT 3P31A 1BCOA 3OYHA 1HNZK 1Q39A 1NOYA 2YJEA 2UUCK 4NXMK 4CZGA 3L0QA 3UIQA 1DV0A 3ASMA 3R8FA 4E0DA 4DFJA 5CHIA 3F73A 3U6CA 4BGBA 1X9WA 3QNOA 3O80A 2CEAA 3O1WA 1GABA 3AY9A 3C58A 2K47A 2LNHC 4DR2M 2ZF5O 3ZX3A 1XWLA 1ZBSA 2IIRA 2LVOC 1VHXA 5BPLA 1IY2A 2O01F 3VGKA 3TPQA 1ASVA 5EP1A 1BISA 3U61A 4JI0K 4IFVA 1JR3D 3U6LA 4OX9K 1UWBA 1HLUA 3H1VX 4KHPK 1RDWX 1GVNA 1QQCA 4FWPA 4CJSA 3FUXA 3VERA 3SAHA 3C94A 3HY5A 3IHPA 3VGMA 5JICA 3HZ6A 1OH7A 4H0XB 2LVQD 4TUWA 4JD2A 4B3MK 3FRIA 4H0PA 2KFNA 4FSVA 3H4MA 3FZFA 3AVFA 4FWLA 4PWDA 2QKBA 3BEXA 4KREA 3AAPA 2DXIA 1YLAA 5K14A 2Z1IA 1RT4A 1VQ5N 3AA4A 4M3UA 4YDUC 1QAQA 2QWMA 5HL7L 3MWTA 3ZSXA 1LTMA 3WNEA 4YHHK 1UA0A 4C8MA 3EE9A 3FUVA 1OVYA 1SV5A 4W5NA 2GWJA 3H1QA 2XZUA 4GY2B 1C1BA 5AQLA 1S6QA 1Q82O 1WBDA 3E4RA 3VQBA 1YITN 4G4NA 3K2PA 2BNKA 4Z94A 4IG3A 1WSFA 1W5TA 5BRDA 4GV9A 3FLCO 3FUUA 4RF1A 4XK8F 3L8BA 1X37A 4DV2M 1N36K 3PO5A 1OAIA 1QUTA 1TH4A 4JEPA 3L2WA 4CZHA 1N33M 5AQZA 4OLAA 3KK7A 2GWKA 3HSTB 2DPNA 1WAJA 3LCVB 2KLAA 4O44A 3VQ5A 4BGAA 4D80A 4ZPXA 3K9JA 2F5SA 3IDHA 3ZEUA 4X66M 3DLHA 3LAMA 3TAEA 3HM9A 4DR3K 3HJSA 2Q1NA 3NH1A 3L4IA 3EKUA 1KFSA 1NSFA 4FPAA 4BC2A 2D0AA 4LG2A 2RHKA 3GLIE 4PA1A 1N34K 4FJGA 1HNIA 3I4VA 3LVWA 2YCHA 3CJCA 5EXWA 1HNWM 1Q9XA 3ZC7B 2O8DA 3VEVA 1PJIA 3QEPA 3ZCMA 1VQKN 1YJ9N 1D9DA 1CXUA 3KWGA 4IBNA 1NKBA 3OYNA 1KLNA 1MX0A 2A40A 2LWXA 4JKAA 1IY0A 3QEXA 2W6LA 3BBZA 4QS9A 2EA0A 2UXCM 4BR5A 2CUZA 3PSFA 1RBUA 4GV6A 3LPUA 3L2QA 3BP8A 1NHGC 1QAOA 4GKKM 3RRHA 4M3RA 3ATVA 4JI1M 1U47A 1NGCA 4R5PA 3MECA 1PJJA 2DTUA 1W9HA 4DF8A 3NWLA 3WXLA 4OPKA 3TARA 3SV4A 4DV4M 2DAGA 4B3SM 1L3VA 3U3GA 2FSJA 1D8YA 4Z4FA 3SQ4A 5HBMA 2CHQA 5BPVA 1ZBLA 1U49A 1FXXA 3BF3A 2J4RA 4YY3M 4LY6A 2VQFK 2G8LA 1ZBFA 4MDBA 1VSIA 3TANA 4CEZA 1ZMUA 2HHQA 1IBKM 2OZSA 4O0JA 3GLIA 4IO8A 2QWPA 1EE8A 1VEKA 2WSCF 2YNFA 2YX6A 3UJNA 5EXPA 3B7QA 4DBGB 1D5AA 2C98A 4BLCA 3AO1A 4B3TK 3TAMA 1FNNA 4DTNA 4JN6A 4FM1A 2AP1A 4LZZA 2Z1HA 3U9ZA 4F4KA 1RFQA 2BH1A 1KCFA 3FE1A 2LSNA 4CZIA 4H0YB 4GKJM 2Z8YM 1TH2A 2BE2A 3FZKA 2XFSA 2FH0A 1XNQM 4LF6M 3B8AX 4K42A 5C10A 1QSYA 2VDBB 4KH4A 4WQ4C 5I9EB 4CK3A 1T43A 3HKPA 2HBKA 4R3DA 3HZJA 5ITRA 1NK8A 5AQHA 1KAXA 1D2NA 5CYMA 3V1OA 4CEAA 4DSEA 3MEEA 5KO3A 2F9TA 4CHYA 3SBJA 1GLJO 1L3UA 1OH6A 3ZT4A 3PO4A 3OY9A 1YUWA 1ZYQA 5EP2A 2I5JA 2W40A 1TKDA 5KRSA 1NU0A 3EO3A 5BPMA 3I01M 2R45A 1YJNN 3FZMA 3KLFA 3U5ZB 4FLWA 3GO8A 4QS7A 3ZSOA 1EIJA 4QNRA 3ZSZA 5F0XA 3OS2A 2YR0A 4G4RA 1HYVA 1MWMA 3CC2N 4KFBA 1BWFO 4YDUA 3J7ZO 4LRTA 4W5OA 3VEZA 1NHWC 4JI6K 3CQ8A 4AI6A 4JKGB 3H3NO 1XB2B 3QYBA 3J7BA 3SYKA 3LP0A 2F7TA 3THYA 1QHAA 5C18A 2B4JA 3S3NA 1IN4A 4HUEA 3LCUA 1JLBA 1NV8A 3DLBA 5AQTA 4JS4A 5GADP 4CBXA 1C7YA 2KRUA 4L4UA 3DM2A 3L3UA 5LMNK 5LMUK 5J2QA 4JV5M 1VQON 4KH6A 4CGFA 3PLAA 2XRIA 3LDLA 3TAQA 3GLHE 3NE6A 4OO1J 1T6CA 4H4MA 4PL7A 4OPHA 2HHXA 5AQMA 4K0KM 4B3OA 4YOUA 3OYDA 3QNNA 3GQ5A 1T3VA 2QPAA 3F9KA 4IKFA 2RKIA 2Z1JA 4KTZA 3AAQA 4RW7A 4FVUA 4Z8XA 3WHLA 3OJSA 4FLXA 1KXPA 5ITQA 2Q0RA 3AARA 3CCMN 4ZTJA 1L5UA 2ZJRL 3FD9A 3V9UA 1TL1A 4FM0A 4L16A 2JGUA 4PL8A 4MDAA 3CIPA 4DU1A 4J2EA 1E4GT 2DWNA 4DUZM 3UGJA 3AVMA 2C99A 1FJGM 1JLGA 3H08A 2NRVA 4BWMA 4PUOA 1DGGA 4B3RM 3SK3A 1SXJB 2XGNA 4CJUA 3CERA 4PKGA 5GIOA 5FPNA 2G8VA 1WGNA 4CJRA 1NLVA 3T15A 4X64M 3KWIA 5BRHA 5I3UA 2DKLA 3QBWA 4DR4M 3DAWA 4J2BA 4JI4M 3DLEA 4ELUA 2LVAA 2G8WA 3K5NA 3HSCA 3E66A 4IBBA 1B9DA 1VQNN 3SBGA 4JHDA 1T7PA 3GLHA 3Q8XA 1GOAA 2E20A 4H4OA 3LMMA 4IEIA 3GG4A 2O8EB 3GLFE 1YVUA 5FRMA 3K9OA 3KDSE 3CM5A 3HO1A 3ZETA 4H5WA 4DF4A 1QDTA 3LL3A 4LF9M 4O8UA 4LC9B 4RKUF 4BWJA 4DR6K 4GC9A 3VQCA 2JNHA 3W0LB 2X74A 4LF5K 3KKRA 4DG1A 3TWLA 3CTWB 1P90A 1TYQA 2Z1GA 4WFBL 4CHNA 3KLGA 4DWIA 1W0HA 1ZXOA 2EKFA 2FBTA 4EAHD 1ASWA 5DYGA 5DYIA 3WXKA 4A59A 4FLTA 1HR0K 4FJ9A 2AJQA 1GJSA 1XC9A 1JB0F 4IBJA 4ZHRA 1N77A 4DTSA 2ITGA 2YHWA 4FLZA 3I0SA 4AHRA 4WQ4A 3ID8A 3LANA 1N34M 4MGYE 1WSEA 3T1YM 5JVHL 3A2FA 4DR2K 4YOVA 1GL6A 1KAZA 1GLNA 1SXJD 1GLFO 3VQ9A 5AZJB 1PJTA 3GLFA 2HBMA 4NRWA 1NK4A 4GEWA 2NRHA 1VRUA 1RTJA 1H6UA 4O8KA 3O3HA 1ZBIA 1E94E 1SL1A 3AJIB 3ZT2A 2P9IB 4CFDA 5E41A 5GAEP 1QAMA 3TSQA 1GLLO 2GQFA 4GW6A 1RBSA 4D81A 5AQJA 5AQQA 5E84A 1VSLA 3QWLA 4WE1A 5HOOA 1RT2A 4CVNE 4JKEA 3VA3A 2WC9A 4JKFA 3C6HA 4AHCA 1V34A 4CJ4A 4CESA 4YOWA 2Y1JA 3TAFA 4IJFA 2BANA 4J2DA 1IH7A 1J5EM 1IKXA 1UM8A 5EXTA 1LWFA 1K8KA 3A5NC 1VQ9N 3PNYA 2Q3SA 2WSFF 4BR7A 1TF0B 5AQPA 5AQGA 1NJFA 3ITHA 2C96A 2HB5A 2CRUA 3DOLA 5CZ2A 4LF7M 4IO9L 1XXHE 3ZT1A 4BRFA 3CF0A 3K2LA 3HK2A 3RMBA 2AHMA 2IC3A 3WNFA 5T7BA 3P1GA 1QSLA 2P5TA 4II7A 1LWCA 5BREA 4DV2K 1MU2A 3Q8GA 4L6V6 1GLBG 4OPAA 4E19A 3VETA 1N33K 1GLAG 5FROA 1FKPA 3PXGA 4H8KA 2LHCA 3E01A 4FJ5A 2CHGA 1YUBA 4IJEA 4M63C 2HVHA 4ANRA 3AFHA 1KYIA 1IBLM 2HMIA 1IY1A 1EX4A 2R44A 4X66K 3AGRA 1C1KA 3P5JA 2WUSA 4W5QA 4HEOA 4BC4A 4KHSA 2FBYA 2VG5A 2L4EA 1NJYA 1ATNA 3HU2A 4PDGA 1BVSA 2B6AA 3OBWA 3R1XA 3DWLA 2ZAOA 4FOIA 1TV6A 1NK5A 3M0EA 1KC8O 4CHZA 1HNWK 5GKNA 1OH8A 3FFKB 1ATSA 1XMQK 1JQJC 4B9MA 5EP4A 1T44A 3P39A 3HOTA 3QEIA 1LV7A 3NAEA 3OYKA 5EX5A 3SYLA 2Q31A 3I8BA 3VQ6A 3SYZA 4MH0E 4WFNL 3GPPA 1QZEA 4IZ9A 1G15A 3CD6N 3OYEA 4BRKA 4RNAA 4IOAL 1EXQA 2ERCA 4ELTA 3AO3A 4DFMA 1XUPO 3VQ7A 2UXCK 2A41A 1L3TA 1JL2A 1BI4B 2F9WA 3P83D 4A3VB 2P51A 1YTUA 4GKKK 2L09A 2E1ZA 1IXSA 3DMJA 3DJCA 4JI1K 4JKHA 4Y1DA 2HHUA 2KFZA 4IBKA 1HQYE 3DRPA 5C2DA 3D2EA 4W5WA 3HYFA 3WQUA 4A57A 3TWKA 1YE9A 2DNAA 3AO4A 4IBEA 2O8FB 2D0OA 3K5LA 3CCEN 4DV4K 4B3SK 4B1YB 3J81O 4KB0A 3KOYE 5A2QO 3ULEB 4ELVA 4K8ZA 2KNZA 4YY3K 4DV1M 4DMNA 2FBVA 2CGLA 5L8RF 4FWSA 4JN4A 2CV0A 3JR5A 3SV3A 1IKYA 1IBKK 4BROA 4CEEA 3GQ3A 4F2LA 4GHAA 4CD3A 2JLEA 4FZZA 1HYZA 3GRRA 2E1YA 2LXEA 2QHOB 2RGHA 3J27B 3R9XB 3R6MA 4X65M 3DXKA 3KP0E 4BRPA 3GQ4A 3FKEA 3B9PA 3DLLL 2D5RA 2H3GX 3VQQA 4KBOA 3CQYA 1UAXA 3E46A 3SUPA 4OKKA 4CHQA 2R46A 1I39A 4CBUA 3M8PA 3LDPA 5IWAM 2R62A 4GRIA 3U5ZA 1LWEA 1NBWA 4KKOA 1NK0A 1PJQA 3CYMA 4GKJK 1XNQK 2NQ8C 3FUTA 4YOTA 1NJZA 1DGFA 1XI1A 2HWJA 3HXMA 5BN9A 4AKIA 4JKDA 2B5JA 5HROA 4DHYA 1W7AA 2DAKA 4PKHA 2V6ZM 3J7AS 1DO2A 5HRSA 3RR8A 2VGNA 3IG8A 1WAFA 3A5LC 4B9QA 3E1YA 2FLOA 3SPZA 3NBIA 2JY7A 1JXBA 2DI0A 4PD2A 1ZMVA 4DB3A 1H1VA 1JLFA 4JRPA 4E7IA 1K3WA 3TAPA 7CATA 4YNQA 2R18A 1IN7A 3A46A 3KK3A 4N47A 2GUPA 3AOEA 1G99A 2YNGA 3TTFA 4B9NA 1ZQ9A 3TTCA 4REZA 2NZTA 5JVGL 1EO1A 1WLJA 3ZSVA 4FD2A 2C9CA 2QXLA 3CJAA 4DS4A 3UK6A 4B1WB 1NGHA 3U6QA 4CJPA 1ASUA 4JK9A 3CGWA 4HVJA 3J2PB 3THXB 3BZKA 4BBAA 4I6MB 4I2PA 5FLXO 3I04M 1TKZA 4KI4A 2OOBA 3EYZA 2VF8A 1Z26A 4DTUA 3QBXA 4KO0A 4FJHA 4M3TA 3HT3A 2WTUA 4RW6A 2G8FA 5DFLA 4XH1A 3MCAB 4PDIA 4K43A 3NH0A 3U60B 3OTOK 1TK0A 2ASMA 3MHVC 2X6NA 3EN9A 3T19A 4E3SA 4JV5K 3L2AA 3L26A 3RSEA 2VQEM 2FC0A 4DQ8A 2P9KB 4HWIA 4LF8K 3VQEA 1DGHB 2QEXN 4C8OA 1VQ4N 2Q2EB 4OVZB 4K0KK 4FWOA 1X9JA 1QVFM 1HR0M 1NO1A 2VIIA 4UY8O 4L8RC 4EZ6A 3LDOA 2MH8A 4PKIA 4LJ9A 3V1RA 3M5RA 4FCWA 4KT0F 3VDPA 3LWMA 2OA8A 5HRRA 1J09A 2DHYA 3V9ZA 4BQZA 2RN2A 1BHLA 1IG8A 3NMUA 2ZQBA 3R9PA 4QOSA 4BRAA 1NK6A 4PT5A 4C8KA 4DUZK 3VEXA 4FWNA 3F2KA 1NGJA 4XEIA 2YV0X 3CHWA 1FJGK 3DLGA 4C8NA 4DR7M 4LJAA 1IG9A 4XH4A 1B9FA 1REVA 4IOXA 3LPTA 4B3RK 5FTKA 2R65A 1KVBA 2A42A 3O3FA 4X62M 1X3MA 2XEPA 2G8HA 4X64K 4ID5A 4YORA 4CEQA 4JRQA 2DVWB 1NGAA 2CP8A 3D6RA 4GHLA 3BF1A 4DR4K 3V81A 5CE3A 3RGPA 3W0LA 4JI4K 4CEFA 3MN9A 3SAVA 4LGYA 4KLNA 3G25A 3C3EA 2G3QA 3L6QA 4W5TA 4K41A 3MN6A 4CGDA 2K6BA 4M7XA 4ITQA 3TR8A 1KLMA 4DFKA 3BDPA 3EEQA 3L28A 4DSFA 4DTMA 1QQMA 2PAVA 4MLEA 3C9PA 3A42A 3CF6E 4JI2M 3MXJA 2EX3A 3QFPA 2OQ4A 8CATA 3QIPA 1S72N 1NJIO 4I5SA 4LF9K 4ID1A 3OYIA 1MN3A 3HPHA 3OYGA 1JLAA 4AG6A 5AJ3K 2V1CA 1Q02A 4AH9A 3JYTA 3LWLA 3LP3A 3MX5A 2AA4A 2E6LA 3GDQA 3MWPA 1S1TA 3VKHA 4AZFA 2YHYA 2JZ0A 1T05A 3KSJA 5EXSA 5AZJA 2XY5A 4E1NA 4PY5A 4CISA 4KO8A 4H5TA 4B1UB 3OYLA 2BGGA 3I51A 1QYRA 3S41A 2YI1A 1IJJA 1HYSA 4FW9A 4LJ5A 3K9PA 4MGIE 1O13A 3O3GA 4BVOA 1BIZA 4Y28F 4LFBM 1S9EA 2D0PA 5H1SQ 4BR0A 5DNYA 2YJFA 3SC3A 3IG1A 3RE8A 4FLVA 5C1BA 2IDOA 3Q7CA 5ADXA 4E7KA 2F8SA 3S3OA 3T1YK 1VEGA 3VEWA 5C42A 1QQNA 4KHYA 3RTVA 4CK1A 3O5BA 4YOYA 1NGFA 1XMQM 3D8BA 4I9QA 2LH0A 3HGIA 3M6GA 2A3ZA 4FW2A 4PQUA 5LJWA 3OYMA 3GRYA 3IG5A 1WGLA 3DLKA 4H0TB 2OYQA 4JI3K 1W97L 2KDLA 2CWBA 4A62A 2ZGZA 1DLOA 5CYQA 3CQXA 4BC5A 3GLGB 2F5OA 3KKSA 4DQSA 1VQPN 5AQYA 1L3SA 4MGHA 2QWQA 3IMXA 1U04A 2J7NA 3L2RA 1DT9A 3D2FB 3VOVA 1NJWA 1EQYA 3ENBA 5ADXH 3L2UA 3UMMA 3ZSYA 1S5JA 2HNYA 5CR4A 3G0ZA 2OOAA 2DZNB 4NSRA 1MDUB 1XC3A 1VSJA 3EY1A 2Z3XA 1A5VA 4LJ4A 1YHQN 2OPPA 1SL0A 2FOIC 1J5EK 3VA0A 4HCBA 3DXMB 4BRDA 3A98B 4IXCA 5ITTA 3T6PA 2P9SB 3KXEC 1G8PA 4FK0A 4RCHA 4LF7K 1MWKA 2P9NA 4K25A 3TL4X 4CGYB 2Q2RA 2W6KA 1YF5L 1CZ9A 2IAJA 4XH5A 4CE9A 4FYDA 1KVAA 4CJFA 4LH5A 2UYTA 2JY8A 3LW5F 1YAGA 3MMVA 1UA1A 1PRBA 2BJWA 1RT5A 3VQDA 3AVCA 5FPMA 2GX9A 2O8BB 1IBLK 3KOWE 1OTRA 3WEEB 1YVNA 3HU3A 3N4QA 5M1OA 2ZBKB 1WR1B 4DV3M 1RDDA 4Z4IA 1RBVA 2XFTA 1S6PA 4MLHA 2XH9A 3LDSA 2XSZD 4CK2A 4NL4H 3TWHA 2NRZA 3F5TA 5C12A 2JA2A 3IKMA 1KRPA 1HPZA 3EIHA 3GRVA 4H5NA 3O9SA 4IDHA 1XHZA 2O8FA 4B1XB 4JI8M 4XIUA 1NK9A 3H4JA 2QI2A 1JR3E 4I4LA 1IBMM 2VCPA 4CI6A 4J8FA 5EOYA 2KZMA 1C0UA 3E9SA 4S12A 5CY4A 4G6ZA 2XO7A 5BR9A 4JI5M 3W67A 1JCEA 1L1TA 3OS0A 2E2PA 3UKRA 3IFRA 1NG9A 3L4QA 4DTXA 4CEOA 2HBLA 1TVRA 4QNMA 3U6OA 3QINA 3U3YA 5TKWA 4AHTA 2VYPA 5SWMA 1FK9A 2QWLA 3V1QA 3NVMA 1UOCA 4B1VA 5HP1A 3G6EN 2HCBA 3DI6A 4N5SA 2DFHA 4NLCA 4BG8A 4DV1K 1YJWN 3OTOM 5AFUA 1U2VB 2P5GA 2WSEF 5AQRA 3VDUA 2JWKA 2R6FA 4H03B 3D7EO 4MFBA 5LL6Z 3GPXA 1WN7A 1J54A 1NGDA 4L78A 3M3ZA 3LZIA 3OYAA 3AV0A 1RDAA 1LAWA 3WXJA 4LF8M 3FYDA 4X65K 1HPMA 1ATRA 1S1UA 3L2VA 2IS3A 4CJ3A 4IIWA 3J81S 3TU5A 1QTMA 3G10A 4B7HA 5A2QS 3I4YA 1K82A 1JXEA 3F92A 1JR3A 2D7GA 3BUZB 4NB4A 1Z6TA 1E4FT 3C3DA 1TUYA 5IWAK 4B9UA 4M3XA 2FF3B 2ZJQL 4LCBA 2Z7JA 1NKCA 4O55A 3LAKA 3O4QA 4JXJA 1QUSA 4BR9A 3RMAA 1YXQA 4I9LA 2DAMA 1RGIA 1JCGA 3VF4A 3OYBA 4JNEA 3HL8A 3C6UA 4P16A 3MXIA 3ZLJA 5C24A 3DZDA 3OVNA 2LBCA 3DRRA 3JR4A 2CH5A 4NRVA 1ITGA 2NRWA 4JS5A 1AIPC 3RMDA 4KODA 5DM7L 1Q8IA 4B9LA 4Q5VA 3UB5A 4DSLA 4KHWA 4GH9A 4FJIA 2EKKA 3HHXA 2P9PB 1IKVA 1KTQA 3OYJA 3ZCBB 2Z4RA 3TSPA 1TGUA 2W42A 2JXNA 2QQ8A 1IV0A 3VQ8A 2R7YA 3O9TA 2OZMA 5GINA 5E26A 1SAZA 1DGHA 4G4QA 3V9WA 4OVZA 3VPZA 3DRSA 4DR1M 4M9ZA 4NXNM 5JI2E 1KAYA 4CF8A 5ITYA 1VSFA 4PHTX 1OKSA 2L7HA 2X49A 3HVTA 1V92A 1VSEA 3SPYA 2HKJA 1JLQA 3CPWM 2OPQA 3MK6A 1LV5A 2KRKA 3M1FA 3O1BA 2KA6B 4B7FA 1J7KA 5JS2A 4FJJA 4BRGA 3U6DA 4DQQA 3CETA 4C8LA 2KW0A 2C5RA 2HW3A 5C15A 2LVPC 1QE1A 3LP2A 3O9UA 4A2BA 4CZEA 4OGCA 3GPUA 4LSLA 3I56N 2VQEK 4FM2A 2HHVA 3NGYA 1OFHA 2N35A 1P8ZA 3UKUB 4WURA 4LH4A 2UUBM 4GNIA 5FLXS 4AF1A 3OYCA 2KQ2A 1JCFA 1I3AA 1K9MO 2I7PA 1C0TA 3ULDA 1IN5A 1RT6A 1EWRA 4B08A 2UUAM 5JLFA 1WUAA 2KNVA 5EP3A 2HHHM 1HJPA 3V76A 3R3LA 4FL9A 4NOOB 4DV7M 1XMOM 5DMRA 1S22A 2P1JA 3M8RA 4HUGA 1T8EA 1MJGM 4I8OA 2YKMA 3TWMA 4KI6A 1QHTA 4BRIA 1E32A 3A8YA 2YQZA 5AQKA 3SJHA 4YFUA 5FTMA 5CZ1A 4TSXA 5IT9O 4F1IA 4DR7K 4CJVA 1Q3CA 1R5LA 4NLBA 4KHQA 1G59A 3OS1A 2KNAA 2EUCA 4JI3M 1ZMWA 1Z25A 4B8AB 2V51B 4X62K 2KXEA 1HKBA 1KD1O 3E9OA 3PX4A 2JWLA 3NHGA 5KRTA 3KD1E 2BTFA 3AOEC 1KSPA 2UXDK 3K1JA 2KKZA 4FWHA 3RRGA 5D3GA 4B8CA 4WP2A 4CHTB 1B92A 2J5YA 2HHTA 1SKSA 1N32M 3PNVA 1Y97A 4GVEA 3SUQA 3PV8A 4Q0BA 5C2FA 5KQDA 3U6PA 5EJCA 4DKWA 2ZJPL 3TQSA 3MEGA 3L25A 2PFUA 4JI2K 2GV9A 4AQYM 1C0FA 2HNDA 4H0OA 4B7GA 1D0MA 4LF4M 1NNEA 3KLIA 4OLBA 2BWBA 2O8CB 3MN7A 2EHGA 4CGGA 1HQCA 3QEVA 1HQEA 3TTDA 4B1ZA 3HU1A 2XY8A 2L7IA 4CGHA 2FS1A 2QW9A 3E21A 1OIPA 3A0IX 1OFIA 3JS6A 1D4XA 1SXJC 3KZBA 1OVQA 4A2AA 5B8HA 2RRUA 1I94M 3QIOA 4LFBK 4G1QA 3GLGA 5BN8A 1R2ZA 3GOIA 3BY5A 3L29A 3D2FA 2CHVA 4NYFA 1HJRA 4LFCK 3C0BA 4F2RA 1TGOA 1DO0A 3FTEA 4IBIA 3NF6A 2RKOA 2Y0TA 4JK7A 4E7HA 2NRTA 4MB7A 2P9UB 2HHWA 4CBWA 3U4LA 2HMPA 1RTDA 3HM8A 1S3SA 3T69A 3SI6A 2V7YA 4MGZE 1G71A 1QDRA 3G4SN 1ZBHA 2R0IA 4HTUA 3LDQA 4QOZB 4BRLA 1HQUA 5E6JA 3DXMA 4A61A 3DOAA 1J9AA 3PIOL 2IOCA 3KVGA 4ICLA 4CJ7A 2BUPA 2P9SA 4BRMA 3P4IA 2JY6B 1SL2A 2M60A 3GLIB 1BU6O 3QMLA 1Z59A 1NMNA 2QA4N 2Y0QA 2HF4A 4LFAM 1DEJA 2H1RA 2QWNA 4ILGB 1G3IA 1JLCA 3HJQA 1VAZA 3WHKA 3CM6A 5ITXE 3U6FA 2QM1A 2HL7A 3I33A 3CF2A 3K59A 4FJLA 3PUFA 3GRUA 2X4AA 3NGIA 4NC6A 2E6MA 4RG8A 4JAXA 2OPSA 3VK7A 1WB9A 1HRHA 3O9RA 2O8BA 3WEEA 4AHUA 1RNHA 4CZKA 2IVOA 4I2QA 5BR8M 4ISFA 3RWUA 4CZLA 2ZANA 4FCYA 1A5XA 4R7GA 4DU3A 1J6ZA 2LTUA 4G9ZA 4FOEA 2QNJA 4BE0A 1DTQA 3RFWA 1C0MA 4N76A 4OVLA 4NCBA 4HUFA 4Z4GA 1K3XA 4FWRA 3EZWA 1T6DA 5KGXA 2A5XA 4C1NK 2KZUA 3G71N 1SG9A 4BREA 3AO5A 3CCUN 4EIAA 1JJ2M 2DWLA 3V9XA 2HNZA 2OPFA 3KLHA 2L6OA 4BRCA 3OBYA 1OAOC 1R59O 3LDNA 5KI6A 3VTHA 4A5BA 2G8IA 3ID6A 3KTQA 2FE8A 3MJ5A 3SASA 3B7NA 2MJ5B 4DV3K 3RMCA 4O5BA 4BE2A 1NJGA 1BIUA 4C1NI 1E9RA 1QZMA 2DZOB 3VLFB 3JXUA 3VESA 2BDPA 1VSHA 3O9QA 4UQGA 1VRTA 5AQIA 3SAUA 3F9MA 4LZJA 4CJQA 5ITXA 4EZ9A 5TKYA 2QWOA 3M8QA 1XNRM 4CJ6A 4JKGA 1X9MA 3AGKA 1PJSA 1Y64A 5AQOA 4BY9C 1SXJE 3H3OB 3PX6A 1YTAA 4JI8K 3RVCA 3AA2A 4CCHA 1N8RO 5HRNA 1BO5O 3HWSA 1EP4A 3VN5A 3ZX0A 2OCEA 3TABA 3C65A 1X9SA 4NSOB 5HRPA 4FWKA 1IBMK 5FPDA 3CC7N 1CZBA 1TKXA 3AKZA 1U2VA 2FBXA 4JI5K 1GLCG 2IVNA 4M9XA 4Z4HA 1VDDA 4IWVA 4CZJA 3C6TA 4MGKE 1Z5AA 4FJ8A 2D7HA 2CGJA 4FK4A 1XHBA 2K9DA 4CJWA 1HNVA 1SZ2A 5GAHP 1VQ1A 1S1VA 2QSFX 2UXBM 5GAGP 3TI0A 1BUPA 4KTWA 1L2CA 2WONA 1NV9A 3AV9A 4BC3A 3KIOA 1RT3A 3QERA 1OKJA 1Q3BA 4Q7JA 3NF8A 5HLFA 3KK1A 1EETA 1IN6A 3B89A 1R4GA 4ISGA 3J7AP 2KEBA 3FR0A 3IRXA 2OTJN 3CCRN 4OKEA 5LY3A 4IOCL 4BRNA 3I8DA 4DSJA 5M1NA 3TAGA 1SXJA 3TE6A 5FSWA 1JLEA 3GL1A 4CF2A 3NH2A 4KHNA 2QKKA 2O25A 3QDKA 4QOZC 4P17A 4ISEA 2KZZA 2CV1A 2A1SA 5FTJA 4CECA 3UE5A 4IEEA 1WSGA 2MR9A 4FJNA 3PSIA 3WXMB 2WBNA 4B9TA 1NK7A 1C0GA 3QAUA 4JI7M 3GLHB 1HUXA 4CF9A 1SQKA 5AQUA 5DM6L 1Q7YO 4EHTA 3OHRA 4LRSA 4E89A 2OPRA 3ZETB 1QVGM 1SKWA 5DK5A 3ENHA 3ZSWA 4DQRA 1RU3A 4CIFA 1N6QA 4CERA 4HCCA 4M7YA 4BDPA 4EFHA 4IBFA 3HP6A 3AVIA 3CJ1A 5AQSA 2IGIA 1KSFX 2W82A 1L8QA 4M3YA 1QS4A 2UXDM 4NO7A 3O6WA 1C6VA 3VGLA 1Z5BA 1L1ZA 1TYQB 2YNIA 1GKIA 4AKGA 2O8EA 1RT7A 4OU7A 4CHPA 3UKUA 3NBPA 1W5SA 2ITMA 1NKEA 1NM1A 3MMPA 1NNJA 3C7NB 3EKSA 4DR1K 4NXNK 4U67L 3KS4A 1HKGA 4FZYA 1K8AO 5KPZA 4G3OA 1CXQA 1NGIA 1T03A 4GC5A 2MROB 4K8XA 3ZT0A 2FSNA 4BDYA 4CD1A 1WJ7A 3U9DA 2UU9M 4WQ5C 2RPIA 1K6YA 3GLFB 1JKHA 4Y0WA 3MAQA 4AM6A 3FTFA 2YHBA 2FFJA 1NY6A 3MCPA 3SNNA 2UUBK 3M6AA 2G8KA 4Y1CA 4QHSA 4KB1A 1J5OA 1YT3A 3CCSN 4LJ8A 1J53A 3L3VA 2H5XA 4YOXA 3WNGA 4N56A 2P9IA 4CJKA 1BQNA 3WXIA 2UUAK 3O4NA 1EWQA 1XC8A 4CEDA 5EQTA 1X3NA 4IDKA 2HHHK 3OA9A 1QQOA 4LFCM 4DR5M 1WBBA 3VEYA 5F1XA 4M9SA 4DV7K 3FRHA 3CXCM 3FYCA 1XMOK 3DFZA 3SUNA 5KPRA 2ETJA 1T3TA 5AQFA 4CFBA 2ATQA 2DAIA 4CIEA 4HL4A 4JLHA 1FW6A 1K8KB 3FGUA 1GLDG 3HP9A 3QESA 1LAVA 3AA5X 4WCEL 3QB0A 5JS1A 1RTIA 1HNXK 2Q0UA 4IBCA 3LM2A 1Z05A 5EU7A 3N4PA 3KS8A 1PM5A 3J8AA 2HOEA 4DLEA 3NBXX 2X6SA 5AQVA 2VF7A 4WW0A 3PIPL 2CGKA 3TSUA 3LZJA 2O8CA 4WF9L 4CJ5A 3IUCA 4PCZA 3AVGA 3NDKA 3KOZE 4NCAA 3LVVA 1TDHA 1N32K 3MEDA 3HHYA 1IQPA 5IT9S 4Z0UA 3UZUA 3SBTA 2JWSA 1Y8GA 1VSMA 3BXWA 4FO0A 2XZFA 4CF0A 2OTLN 2KW4A 1RTHA 3JAMO 4IBDA 1QQWA 3WT0A 4UN2B 4RF0A 4O0IA 1BQMA 3M7GA 3QFUA 4AQYK 4CIZA 4CJTA 5J1EA 2XY6A 1WXQA 4DS5A 1NOZA 2P9LB 3D0PA 4N41A 2MGWA 4LF4K 1HMVA 4B9VA 3SARA 1Z6RA 2YNHA 4FXDA 1ZC6A 1VEJA 1WOQA 3CJBA 2P9UA 4CGJA 4KHUA 1DTTA 1HT1E 5MLCQ 3MDQA 4JKCA 4BE1A 4DQPA 5M1PA 5J2PA 1WNSA 3GP1A 5KQ8A 3T1HM 2ZTCA 2J7OA 2D1KA 4M41A 2VWBA 4D82A 1XXHB 3K92A 2F4VM 1I94K 1TAUA 3V6DA 1Q81O 1GO5A 1R7RA 4HLQA 3SMSA 1BI4A 1IXSB 3HRGA 2QK9A 4C23A 3SHGB 1BOTO 2YNMD 3J80O 5EXXA 3D2EB 5M1FA 3PY8A 3WUHA 3SFZA 2VGMA 3KOXE 3FTDA 3WQTA 2ASPA 3C95A 3THVA 2WZJA 2ZM6M 2E4LA 1VQMN 4OJRA 1EKEA 2JY5A 4GITA 2JP7A 3VF6A 5JMVA 2XY7A 5ITUA 3ULEA 4FCVA 3AOGA 4DV0M 4EP4A 3U6EA 3LP1A 5BRFA 4FVMA 1M90O 3HPOA 4DCHA 1TH3A 1XHXA 3AVHA 4LFAK 4F9OA 3QETA 3ATUA 3DXKB 4KTQA 1GLEG 5IREB 4DTOA 2APLA 3W0FA 3BGRA 4IG0A 2RGOA 4AW4A 4RW8A 2PZSA 4RTFD 3ZYYX 4AILC 5KTQA 4H5RA 3I55N 4DV6M 4MM3B 1IO2A 1OJLA 4BR2A 3CFOA 3K57A 4BDZA 3KLEA 3VFDA 1VSDA 3SQ1A 1RT1A 3NFAA 4M45A 3CCJN 3SUOA 5BR8K 4OKJA 4M3ZA 3E9PA 4KAZA 1K73O 1S1WA 1SKRA 2D0BA 1KFVA 4WQ5A 4DUYM 5FPEA 4FJKA 3KJVA 3T3FA 1R2YA 3SQ2A 3MN5A 4DU4A 3THWB 3E9LA 4CJEA 2C9OA 2XLJA 5BPNA 4IFEA 4FWGA 2E5LM 2GELA 3CCQN 2FNAA 3S3MA 3CCVN
chains in the Genus database with same CATH topology
1HKCA 3H6EA 4FPBA 1L2DA 2Y20A 3TPZA 2Q36A 1IN8A 3EE8A 3ENOA 5AQNA 2FSKA 5AQXA 2QZ4A 3KP1E 5AFUH 1ORYB 3SAGA 3HOSA 3CCLN 5AZIB 1HNZM 1DGBA 2UUCM 4ILJA 4LJ6A 4MO5A 3H46O 4NXMM 2FF6A 3GPYA 4I6MA 2KHOA 4JK8A 2IVPA 2M5ZA 1SS6A 3VMFB 4Z6YA 2QBYB 2YHXA 5C0YA 1LOTB 3EIEA 2EWSA 2NNWA 3NVKA 3U60A 2X8AA 1W2BM 3O08A 2QCUA 4BQLA 3RSEB 2XF3A 4QS8A 4R79A 2F5PA 2E8AA 3P38A 4JI0M 4JKBA 4OX9M 2P9KA 4KHPM 3CJ7A 3D8LA 3H45C 1L2BA 4HTLA 1E9SA 3KVWA 5F3WA 3CF5L 1MA9B 3PFIA 4FWMA 5F2RA 3ZH9B 3HI0A 4B3MM 2KZSA 4IJAA 3KHYA 1QZ6A 1G41A 3U61B 4BRQA 4YHHM 2WFBA 4L3QA 2W41A 3R8EA 4LJ7A 2EO2A 3CPEA 3W3DA 1KQSM 4JD2B 2HSTA 2CH6A 3C6AA 4O5FA 2A5YB 3HHWA 4GIPA 1N36M 3VENA 1HJOA 3SAFA 2CV2A 1ILYA 1QANA 5JI3E 3GBTA 4FCTA 3THGA 5IZ7D 2Y21A 4M0DA 3C7NA 3T38A 4FWDA 1M1KO 1HNXM 4DR3M 1S3XA 4I81A 1VQ7N 5M1KA 3ZX2A 4L15A 2NRRA 4BVPA 1YSYA 2G5GX 1YI2N 2D7EA 2RE2A 1I4WA 1QVRA 1IM2A 3PVSA 2A6AA 1U6ZA 5ELZA 3ZEUB 4BG9A 1NVMA 2CFOA 4H5VA 3EL2A 3A5OC 4M0WA 1IXRC 3K8ZA 5AR0A 4OW0A 2FXUA 3VF2A 3L27A 3BOSA 1CZAN 2ZGYA 5JLHA 2CE7A 4IJNA 2NLXA 4A5AA 2NRXA 2XSZA 1BDGA 2HF3A 4RWTA 1VQLN 4LGMA 2QENA 1BA1A 2VQFM 3U6SA 1IXZA 4KH5A 5M1QA 3HBTA 4BRHA 3O4WA 3CI5A 2E88A 4B3TM 1TDZA 4ILHA 4WFAL 4IBGA 2F5NA 3VEOA 4AKHA 3T7ZA 1YIJN 1N75A 2P9NB 1Z5CA 3SAWA 2QP9X 2V52B 1XWIA 2ZAMA 2P9LA 3RGSA 3FZHA 2DWMA 4H0VB 4U7BA 3VK8A 2Q97A 4E1JA 4GMQA 1HT2E 4BB9A 2V1UA 1ZAEA 3K9KA 2DHRA 1XQSC 1V4SA 3MX2A 4G4OA 5AQWA 1Q18A 1Q86O 2I7NA 3LQRA 1XXHA 2GTDA 3VTIA 2ZWHA 1R6BX 3GE1A 2F5QA 3SLCA 1DGKN 4JI6M 1G4AE 1TUUA 4CZMA 4XGIA 5KPTA 3FTCA 2QWRA 2DWZB 2YFQA 3JAMS 1NGBA 4GV3A 3Q7BA 2E2QA 2BJVA 4DV5M 2PBDA 1LCUA 4BR4A 1NGGA 5LMUM 1N78A 5LMNM 2GEMA 3SMPA 1BA0A 5EY4A 3UKRB 3OW2M 4WYBA 4FWQA 3SHFA 4MO4A 1V4TA 5H37D 1BG3A 5EVZA 3CC4N 5FTLA 3HTVA 3CMEN 3SATA 1VQ8N 3U8XA 3HJ8A 4EHUA 3U6MA 1VQ6N 2Z4SA 3FZLA 4JYAM 3KSXA 3A5MC 3HHZA 1NMDA 3J80S 3ILKA 1NNUC 2OANA 5LJVA 2V7ZA 1QZ5A 3O8MA 2R4EA 3A45A 1NWKA 4AM7A 5FTNA 3FUWA 5GIPA 3KW6A 1ESVA 5AZIA 3CMAN 1NGEA 3LM9A 3QICA 3DA1A 2ASOA 2HBJA 4CZFA 1MU5A 3KFUG 3LQQA 4EIWA 2QBYA 4DR6M 1HX1A 2R4JA 2D4WA 1RDUA 2QTDA 3CJ9A 1GL7A 1DKGD 4LF5M 4QHTA 3VKGA 2P9PA 4AG5A 2E2OA 4JHDB 4XBOA 2O5RA 3AL0C 1NY5A 2E2NA 3P31A 1Q39A 2YJEA 4CZGA 3L0QA 3R8FA 5CHIA 3U6CA 4BGBA 3O80A 2CEAA 3O1WA 3AY9A 3C58A 2K47A 2LNHC 4DR2M 2ZF5O 3ZX3A 1ZBSA 2IIRA 5BPLA 1IY2A 3VGKA 3TPQA 5EP1A 3U61A 1JR3D 3U6LA 1HLUA 3H1VX 1RDWX 1GVNA 4FWPA 3FUXA 3VERA 3SAHA 3VGMA 5JICA 3HZ6A 4H0XB 4TUWA 4JD2A 4H0PA 4FSVA 3H4MA 3FZFA 4FWLA 3BEXA 3AAPA 2DXIA 1VQ5N 4YDUC 1QAQA 2QWMA 5HL7L 3MWTA 3EE9A 3FUVA 1OVYA 2GWJA 3H1QA 2XZUA 4GY2B 5AQLA 1Q82O 3E4RA 1YITN 4G4NA 2BNKA 4Z94A 1W5TA 5BRDA 4GV9A 3FLCO 3FUUA 4RF1A 1X37A 4DV2M 1TH4A 4JEPA 4CZHA 1N33M 5AQZA 3KK7A 2GWKA 2DPNA 2KLAA 4BGAA 4D80A 4ZPXA 3K9JA 2F5SA 3IDHA 3ZEUA 4X66M 3HJSA 2Q1NA 3L4IA 3EKUA 1NSFA 4FPAA 4BC2A 4LG2A 2RHKA 3I4VA 3LVWA 2YCHA 3CJCA 5EXWA 1HNWM 3ZC7B 3VEVA 1PJIA 1VQKN 1YJ9N 3KWGA 1MX0A 2A40A 2LWXA 4JKAA 1IY0A 4QS9A 2EA0A 2UXCM 4BR5A 2CUZA 4GV6A 3BP8A 1NHGC 1QAOA 4GKKM 3ATVA 4JI1M 1NGCA 1PJJA 3NWLA 3WXLA 4DV4M 4B3SM 2FSJA 2CHQA 5BPVA 3BF3A 2J4RA 4YY3M 4LY6A 2G8LA 4MDBA 1IBKM 3GLIA 4IO8A 2QWPA 1EE8A 2YX6A 3UJNA 5EXPA 2C98A 4BLCA 1FNNA 4JN6A 2AP1A 4LZZA 3U9ZA 1RFQA 2BH1A 3FE1A 4CZIA 4H0YB 4GKJM 1TH2A 3FZKA 2XFSA 1XNQM 4K42A 4LF6M 3B8AX 5C10A 4KH4A 4WQ4C 5I9EB 3HKPA 2HBKA 4R3DA 5ITRA 5AQHA 1KAXA 1D2NA 5KO3A 2F9TA 3SBJA 1GLJO 1YUWA 5EP2A 2W40A 3EO3A 5BPMA 2R45A 1YJNN 3FZMA 3U5ZB 3GO8A 4QS7A 4QNRA 5F0XA 2YR0A 4G4RA 1MWMA 3CC2N 1BWFO 4YDUA 3J7ZO 4LRTA 3VEZA 1NHWC 4AI6A 4JKGB 3H3NO 3J7BA 3SYKA 2F7TA 1QHAA 5C18A 1IN4A 5AQTA 5GADP 4CBXA 2KRUA 4L4UA 4JV5M 1VQON 4KH6A 3PLAA 3LDLA 4OO1J 1T6CA 4PL7A 4OPHA 5AQMA 4K0KM 4YOUA 3GQ5A 1T3VA 2QPAA 3AAQA 4FVUA 4Z8XA 3WHLA 1KXPA 5ITQA 2Q0RA 3AARA 3CCMN 2ZJRL 3FD9A 4L16A 4PL8A 4MDAA 3CIPA 1E4GT 2DWNA 4DUZM 3UGJA 2C99A 1FJGM 2NRVA 1DGGA 4B3RM 3SK3A 1SXJB 2XGNA 3CERA 4PKGA 5GIOA 5FPNA 1NLVA 3T15A 4X64M 3KWIA 5BRHA 3QBWA 4DR4M 3DAWA 4JI4M 3HSCA 3E66A 4IBBA 1VQNN 3SBGA 4JHDA 3GLHA 3Q8XA 2E20A 3LMMA 4IEIA 3GG4A 3KDSE 3ZETA 4H5WA 3LL3A 4LF9M 4O8UA 4LC9B 4GC9A 3W0LB 3TWLA 3CTWB 1P90A 1TYQA 4WFBL 1ZXOA 4EAHD 5DYGA 5DYIA 3WXKA 4A59A 4IBJA 1N77A 2YHWA 4WQ4A 3ID8A 1N34M 4MGYE 5JVHL 3T1YM 4YOVA 1GL6A 1KAZA 1GLNA 1SXJD 1GLFO 5AZJB 3GLFA 2HBMA 4NRWA 2NRHA 1H6UA 4O8KA 1E94E 3AJIB 2P9IB 5GAEP 1QAMA 3TSQA 1GLLO 4D81A 5AQJA 5AQQA 5E84A 5HOOA 3QWLA 4JKEA 2WC9A 4JKFA 3C6HA 4YOWA 4IJFA 1J5EM 1UM8A 5EXTA 1K8KA 3A5NC 1VQ9N 3PNYA 4BR7A 5AQPA 5AQGA 1NJFA 2C96A 4LF7M 4IO9L 4BRFA 3CF0A 3K2LA 2AHMA 2P5TA 4II7A 5BREA 1GLBG 4OPAA 3VETA 1GLAG 3PXGA 2CHGA 1YUBA 4IJEA 4M63C 3AFHA 1KYIA 1IBLM 1IY1A 3AGRA 1C1KA 2WUSA 4BC4A 3HU2A 4PDGA 1ATNA 3R1XA 3OBWA 3DWLA 2ZAOA 4FOIA 3M0EA 1KC8O 5GKNA 3FFKB 1ATSA 1JQJC 5EP4A 1T44A 3P39A 3HOTA 1LV7A 5EX5A 3SYLA 2Q31A 3I8BA 4MH0E 4WFNL 3GPPA 4IZ9A 3CD6N 4BRKA 4RNAA 4IOAL 2ERCA 1XUPO 2A41A 2F9WA 4A3VB 2L09A 2E1ZA 3DJCA 4JKHA 4IBKA 1HQYE 5C2DA 3D2EA 4W5WA 3WQUA 4A57A 3TWKA 1YE9A 4IBEA 2D0OA 3CCEN 4B1YB 3KOYE 3ULEB 4DV1M 2CGLA 4FWSA 4JN4A 2CV0A 3JR5A 4BROA 3GQ3A 4GHAA 4CD3A 3GRRA 2E1YA 2LXEA 2RGHA 3J27B 3R9XB 3R6MA 4X65M 3DXKA 3KP0E 4BRPA 3GQ4A 3FKEA 3B9PA 3DLLL 2H3GX 4KBOA 3CQYA 2R46A 4CBUA 3LDPA 5IWAM 2R62A 4GRIA 3U5ZA 1NBWA 2NQ8C 3FUTA 4YOTA 1DGFA 5BN9A 4AKIA 4JKDA 4DHYA 4PKHA 2V6ZM 3J7AS 1DO2A 2VGNA 3IG8A 3A5LC 4B9QA 3E1YA 2FLOA 3NBIA 4PD2A 4DB3A 1H1VA 1K3WA 7CATA 2R18A 1IN7A 3A46A 2GUPA 3AOEA 1G99A 3TTFA 1ZQ9A 3TTCA 4REZA 2NZTA 5JVGL 1EO1A 4FD2A 2C9CA 2QXLA 3CJAA 3UK6A 4B1WB 1NGHA 3U6QA 4JK9A 3J2PB 4BBAA 4I6MB 3QBXA 4XH1A 3MCAB 4PDIA 4K43A 3U60B 2ASMA 3MHVC 3EN9A 3L2AA 3L26A 3RSEA 2VQEM 4DQ8A 2P9KB 4HWIA 1DGHB 2QEXN 1VQ4N 2Q2EB 4OVZB 4FWOA 1X9JA 1QVFM 1HR0M 2VIIA 4UY8O 4L8RC 3LDOA 4PKIA 4LJ9A 3M5RA 4FCWA 3VDPA 1J09A 4BQZA 1IG8A 3NMUA 3R9PA 4QOSA 4BRAA 4PT5A 3VEXA 4FWNA 3F2KA 1NGJA 4XEIA 3CHWA 4DR7M 4LJAA 4XH4A 4IOXA 5FTKA 2R65A 2A42A 4X62M 1X3MA 2XEPA 4YORA 2DVWB 1NGAA 3D6RA 4GHLA 3BF1A 5CE3A 3RGPA 3W0LA 3MN9A 3SAVA 4LGYA 4KLNA 3G25A 3L6QA 4K41A 3MN6A 4M7XA 4ITQA 3L28A 1QQMA 2PAVA 4MLEA 3A42A 3CF6E 4JI2M 1S72N 3QFPA 2OQ4A 8CATA 1NJIO 4I5SA 4AG6A 2V1CA 3MX5A 2AA4A 3GDQA 3MWPA 3VKHA 4AZFA 2YHYA 3KSJA 5EXSA 5AZJA 4CISA 4KO8A 4H5TA 4B1UB 3I51A 1QYRA 3S41A 2YI1A 1IJJA 4FW9A 4LJ5A 4MGIE 1O13A 4BVOA 4LFBM 2D0PA 5H1SQ 4BR0A 5DNYA 2YJFA 3SC3A 3RE8A 5C1BA 3Q7CA 5ADXA 3VEWA 1QQNA 3O5BA 4YOYA 1NGFA 1XMQM 3D8BA 2LH0A 3HGIA 3M6GA 2A3ZA 5LJWA 3GRYA 3IG5A 4H0TB 1W97L 4A62A 2ZGZA 3CQXA 4BC5A 3GLGB 2F5OA 1VQPN 5AQYA 4MGHA 2QWQA 3IMXA 2J7NA 1DT9A 3D2FB 3VOVA 1EQYA 3ENBA 5ADXH 3UMMA 5CR4A 4NSRA 2DZNB 1MDUB 1XC3A 2Z3XA 4LJ4A 1YHQN 2FOIC 3DXMB 4BRDA 3A98B 4IXCA 5ITTA 2P9SB 3KXEC 1G8PA 4RCHA 1MWKA 2P9NA 4K25A 3TL4X 4CGYB 2Q2RA 1YF5L 4XH5A 2UYTA 1YAGA 3MMVA 2BJWA 5FPMA 2GX9A 3KOWE 3WEEB 1YVNA 3HU3A 3N4QA 5M1OA 2ZBKB 4DV3M 2XFTA 4MLHA 2XH9A 2XSZD 4NL4H 2NRZA 3F5TA 5C12A 2JA2A 3IKMA 3EIHA 3GRVA 4H5NA 3O9SA 4IDHA 4B1XB 4JI8M 2QI2A 4I4LA 1IBMM 2VCPA 4CI6A 4J8FA 5EOYA 3E9SA 4S12A 4G6ZA 5BR9A 4JI5M 1JCEA 1L1TA 2E2PA 3UKRA 3IFRA 3L4QA 2HBLA 4QNMA 3U6OA 5TKWA 2VYPA 2QWLA 3NVMA 4B1VA 3G6EN 2HCBA 4NLCA 4BG8A 1YJWN 3OTOM 5AFUA 1U2VB 5AQRA 3VDUA 2JWKA 4H03B 3D7EO 3GPXA 1NGDA 4L78A 3M3ZA 3AV0A 3WXJA 4LF8M 3FYDA 1HPMA 1ATRA 4IIWA 3J81S 3TU5A 4B7HA 5A2QS 3I4YA 1K82A 1JR3A 2D7GA 3BUZB 4NB4A 1Z6TA 1E4FT 1TUYA 2FF3B 2ZJQL 4LCBA 2Z7JA 4JXJA 4BR9A 1YXQA 1RGIA 1JCGA 3VF4A 4JNEA 4P16A 3DZDA 3JR4A 2CH5A 4NRVA 2NRWA 4KODA 5DM7L 3UB5A 4GH9A 3HHXA 2P9PB 3ZCBB 2Z4RA 3TSPA 1TGUA 3O9TA 5GINA 5E26A 1SAZA 1DGHA 4G4QA 4OVZA 3VPZA 4DR1M 4M9ZA 4NXNM 5JI2E 1KAYA 5ITYA 4PHTX 2X49A 2L7HA 2HKJA 3CPWM 3MK6A 2KRKA 3O1BA 3M1FA 2KA6B 4B7FA 1J7KA 4BRGA 3U6DA 3CETA 2KW0A 2C5RA 5C15A 4CZEA 3O9UA 4A2BA 3I56N 3GPUA 1OFHA 1P8ZA 3UKUB 4WURA 2UUBM 4GNIA 5FLXS 4AF1A 1JCFA 1K9MO 2I7PA 1IN5A 5JLFA 4B08A 2UUAM 1WUAA 5EP3A 2HHHM 4FL9A 3R3LA 4NOOB 4DV7M 1XMOM 1S22A 4I8OA 3TWMA 4BRIA 1E32A 3A8YA 2YQZA 5AQKA 3SJHA 5FTMA 1Q3CA 4NLBA 1G59A 2EUCA 4JI3M 2V51B 2KXEA 1HKBA 1KD1O 3E9OA 2JWLA 2BTFA 3AOEC 3K1JA 2KKZA 4FWHA 4CHTB 1N32M 3PNVA 4GVEA 5C2FA 5KQDA 3U6PA 5EJCA 4DKWA 2ZJPL 3TQSA 3L25A 2PFUA 4AQYM 1C0FA 4H0OA 4B7GA 4LF4M 3MN7A 1HQCA 3TTDA 4B1ZA 3HU1A 2L7IA 2QW9A 3A0IX 1OFIA 3JS6A 1D4XA 1SXJC 3KZBA 4A2AA 5B8HA 1I94M 5BN8A 3GLGA 1R2ZA 3GOIA 3L29A 3D2FA 2CHVA 3C0BA 1DO0A 3FTEA 4IBIA 2RKOA 2Y0TA 4JK7A 2NRTA 4MB7A 2P9UB 4CBWA 3U4LA 2HMPA 3HM8A 1S3SA 3T69A 2V7YA 4MGZE 3G4SN 3LDQA 4BRLA 5E6JA 3DXMA 4A61A 3DOAA 3PIOL 3KVGA 4CJ7A 2BUPA 2P9SA 4BRMA 3P4IA 2M60A 3GLIB 1BU6O 3QMLA 1Z59A 2QA4N 2Y0QA 2HF4A 4LFAM 1DEJA 2H1RA 2QWNA 4ILGB 1G3IA 3HJQA 1VAZA 3WHKA 5ITXE 2QM1A 2HL7A 3I33A 3CF2A 3GRUA 2X4AA 4JAXA 3VK7A 3O9RA 3WEEA 4CZKA 2IVOA 4ISFA 5BR8M 4CZLA 2ZANA 4R7GA 1J6ZA 4G9ZA 4FOEA 3RFWA 1K3XA 4FWRA 3EZWA 1T6DA 2A5XA 4C1NK 2KZUA 3G71N 4BREA 3CCUN 4EIAA 1JJ2M 2DWLA 2OPFA 2L6OA 4BRCA 3OBYA 1R59O 3LDNA 3VTHA 4A5BA 3ID6A 2FE8A 3MJ5A 3SASA 1NJGA 4C1NI 1E9RA 1QZMA 2DZOB 3VLFB 3JXUA 3VESA 3O9QA 5AQIA 3SAUA 3F9MA 4LZJA 5ITXA 5TKYA 2QWOA 4BY9C 1XNRM 4JKGA 3AGKA 1Y64A 5AQOA 1SXJE 3H3OB 3RVCA 1N8RO 1BO5O 3HWSA 3ZX0A 3C65A 4NSOB 4FWKA 5FPDA 3CC7N 3AKZA 1U2VA 1GLCG 2IVNA 4M9XA 1VDDA 4IWVA 4CZJA 4MGKE 1Z5AA 2D7HA 2CGJA 1XHBA 1SZ2A 5GAHP 2UXBM 5GAGP 1BUPA 1L2CA 4BC3A 1OKJA 1Q3BA 1IN6A 4ISGA 2KEBA 3FR0A 2OTJN 3CCRN 5LY3A 4IOCL 4BRNA 5M1NA 1SXJA 3TE6A 5FSWA 3GL1A 3QDKA 4QOZC 4ISEA 2CV1A 5FTJA 3UE5A 4IEEA 3WXMB 2WBNA 1C0GA 3QAUA 4JI7M 3GLHB 1HUXA 1SQKA 5AQUA 5DM6L 1Q7YO 4EHTA 3OHRA 4LRSA 3ZETB 1QVGM 3ENHA 4M7YA 4EFHA 4IBFA 3CJ1A 5AQSA 1KSFX 2W82A 1L8QA 2UXDM 4NO7A 3O6WA 3VGLA 1Z5BA 1L1ZA 1TYQB 1GKIA 4AKGA 4OU7A 3UKUA 1W5SA 2ITMA 1NM1A 1NNJA 3C7NB 3EKSA 4U67L 3KS4A 1HKGA 1K8AO 5KPZA 1NGIA 4GC5A 2FSNA 4CD1A 3U9DA 2UU9M 4WQ5C 3GLFB 4Y0WA 4AM6A 3FTFA 2FFJA 1NY6A 3MCPA 3M6AA 4QHSA 3CCSN 4LJ8A 4YOXA 2P9IA 3WXIA 1XC8A 5EQTA 1X3NA 3OA9A 1QQOA 4LFCM 4DR5M 3VEYA 5F1XA 4M9SA 3CXCM 3FYCA 3DFZA 5KPRA 1T3TA 5AQFA 4HL4A 1K8KB 3FGUA 1GLDG 4WCEL 3QB0A 2Q0UA 4IBCA 3LM2A 1Z05A 3N4PA 3KS8A 1PM5A 3J8AA 2HOEA 5AQVA 4WW0A 3PIPL 2CGKA 3TSUA 4WF9L 3IUCA 4PCZA 3KOZE 3LVVA 1TDHA 3HHYA 1IQPA 5IT9S 3UZUA 3SBTA 4FO0A 2XZFA 2OTLN 4IBDA 1QQWA 3WT0A 4RF0A 3QFUA 3M7GA 1WXQA 2P9LB 3SARA 1Z6RA 1ZC6A 1WOQA 3CJBA 2P9UA 1HT1E 5MLCQ 3MDQA 4JKCA 5M1PA 3GP1A 5KQ8A 3T1HM 2J7OA 2D1KA 2VWBA 4D82A 1XXHB 3K92A 2F4VM 1Q81O 1R7RA 4HLQA 3SMSA 1IXSB 3HRGA 4C23A 3SHGB 1BOTO 2YNMD 5EXXA 3D2EB 5M1FA 3WUHA 3SFZA 2VGMA 3KOXE 3FTDA 3WQTA 2ASPA 2ZM6M 1VQMN 3VF6A 4GITA 5JMVA 5ITUA 3ULEA 4FCVA 3AOGA 4DV0M 3U6EA 5BRFA 4FVMA 1M90O 4DCHA 1TH3A 4F9OA 3ATUA 3DXKB 1GLEG 5IREB 3W0FA 2RGOA 4AW4A 4RTFD 3ZYYX 4H5RA 3I55N 4DV6M 4MM3B 1OJLA 4BR2A 3VFDA 3CCJN 3E9PA 1K73O 1KFVA 4WQ5A 4DUYM 5FPEA 1R2YA 3MN5A 3E9LA 2C9OA 2XLJA 5BPNA 4IFEA 4FWGA 2E5LM 2GELA 3CCQN 2FNAA 3CCVN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKC A;  1H1V A;  3IDH A;  3H6E A;  4FPB A;  3ZEU A;  2GUP A;  2Q36 A;  3ENO A;  1C0F A;  4H0O A;  1G99 A;  5AQN A;  2Q1N A;  2FSK A;  3L4I A;  5AQX A;  3EKU A;  4FPA A;  4BC2 A;  5AFU H;  2NZT A;  3CJC A;  2YCH A;  5EXW A;  3MN7 A;  2QXL A;  3CJA A;  4B1W B;  1NGH A;  5AZI B;  3VEV A;  4B1Z A;  4MO5 A;  3H46 O;  2FF6 A;  2QW9 A;  4I6M B;  3A0I X;  4I6M A;  2A40 A;  2KHO A;  2IVP A;  3JS6 A;  3QBX A;  4QS9 A;  1D4X A;  2YHX A;  3KZB A;  4A2A A;  4BR5 A;  5B8H A;  1LOT B;  5BN8 A;  4XH1 A;  4K43 A;  2EWS A;  3GOI A;  3BP8 A;  2ASM A;  3D2F A;  3EN9 A;  3C0B A;  3O08 A;  3ATV A;  4BQL A;  3RSE B;  1NGC A;  3RSE A;  4QS8 A;  4DQ8 A;  2E8A A;  2P9U B;  4CBW A;  2P9K B;  4HWI A;  3U4L A;  2HMP A;  3HM8 A;  2P9K A;  3WXL A;  2V7Y A;  3CJ7 A;  4FWO A;  3H45 C;  1X9J A;  2FSJ A;  4HTL A;  3LDQ A;  4BRL A;  3LDO A;  4PKI A;  1MA9 B;  3DXM A;  4FWM A;  4A61 A;  3BF3 A;  2J4R A;  5F2R A;  3KVG A;  4CJ7 A;  3HI0 A;  2BUP A;  2P9S A;  4BRM A;  3P4I A;  4BQZ A;  1BU6 O;  3QML A;  4IJA A;  4IO8 A;  1IG8 A;  1DEJ A;  2HF4 A;  2QWN A;  2QWP A;  3KHY A;  3R9P A;  4BRA A;  1QZ6 A;  3VEX A;  4FWN A;  4BRQ A;  1NGJ A;  4XEI A;  3CHW A;  2QM1 A;  3I33 A;  4XH4 A;  2A42 A;  2AP1 A;  1X3M A;  4JAX A;  3U9Z A;  4L3Q A;  1RFQ A;  2W41 A;  3R8E A;  3FE1 A;  3W3D A;  3WEE A;  4H0Y B;  4CZI A;  1NGA A;  4CZK A;  2IVO A;  3FZK A;  3BF1 A;  4ISF A;  4JD2 B;  3B8A X;  4K42 A;  4CZL A;  5CE3 A;  3W0L A;  2CH6 A;  3MN9 A;  1J6Z A;  4WQ4 C;  5I9E B;  4FOE A;  4O5F A;  3G25 A;  3L6Q A;  3VEN A;  4K41 A;  1HJO A;  3MN6 A;  1KAX A;  5AQH A;  4M7X A;  2F9T A;  4FWR A;  3GBT A;  3EZW A;  1GLJ O;  1T6D A;  2A5X A;  1QQM A;  4BRE A;  2PAV A;  1YUW A;  3C7N A;  4MLE A;  4EIA A;  2W40 A;  3QFP A;  1S3X A;  3EO3 A;  5BPM A;  4BRC A;  3FZM A;  1R59 O;  3LDN A;  4QS7 A;  3ZX2 A;  5F0X A;  4BVP A;  1MWM A;  2AA4 A;  3JXU A;  1BWF O;  4YDU A;  3GDQ A;  3VES A;  2YHY A;  3VEZ A;  5AQI A;  3F9M A;  5AZJ A;  5TKY A;  2QWO A;  4H5T A;  4B1U B;  1Y64 A;  3H3N O;  5AQO A;  3S41 A;  2YI1 A;  1IJJ A;  2A6A A;  3H3O B;  1U6Z A;  5ELZ A;  3ZEU B;  1QHA A;  4BG9 A;  4BVO A;  1BO5 O;  2D0P A;  3ZX0 A;  4BR0 A;  2YJF A;  4FWK A;  4H5V A;  5AQT A;  5FPD A;  4CBX A;  3EL2 A;  1U2V A;  3A5O C;  5ADX A;  1GLC G;  2IVN A;  5AR0 A;  3VEW A;  1QQN A;  2FXU A;  4IWV A;  4CZJ A;  3VF2 A;  3LDL A;  3O5B A;  1NGF A;  1CZA N;  2ZGY A;  5JLH A;  4IJN A;  2CGJ A;  3M6G A;  2NLX A;  1T6C A;  2A3Z A;  4PL7 A;  5LJW A;  1BDG A;  5AQM A;  1SZ2 A;  2HF3 A;  4RWT A;  4H0T B;  3AAQ A;  1BA1 A;  2ZGZ A;  1BUP A;  4A62 A;  3CQX A;  1KXP A;  2Q0R A;  4BC5 A;  3AAR A;  5AQY A;  2QWQ A;  3IMX A;  4PL8 A;  3D2F B;  3VOV A;  3HBT A;  4BC3 A;  1EQY A;  4BRH A;  3CIP A;  1E4G T;  1OKJ A;  5ADX H;  4ISG A;  3O4W A;  3CI5 A;  2E88 A;  3FR0 A;  1MDU B;  1XC3 A;  5LY3 A;  4BRN A;  3SK3 A;  3CER A;  4PKG A;  3VEO A;  5FPN A;  1NLV A;  3GL1 A;  5BRH A;  3DXM B;  4BRD A;  4IXC A;  3QBW A;  3QDK A;  3DAW A;  4ISE A;  2P9N B;  2P9S B;  4RCH A;  1MWK A;  2P9N A;  2V52 B;  2P9L A;  3FZH A;  3UE5 A;  4K25 A;  3HSC A;  2Q2R A;  4H0V B;  1C0G A;  2Q97 A;  1HUX A;  4JHD A;  4XH5 A;  4E1J A;  1SQK A;  5AQU A;  2E20 A;  4EHT A;  3OHR A;  3GG4 A;  1XQS C;  2UYT A;  3ZET B;  1YAG A;  3MMV A;  1V4S A;  3ZET A;  4H5W A;  3ENH A;  5AQW A;  5FPM A;  3LL3 A;  1Q18 A;  4M7Y A;  4LC9 B;  4EFH A;  3WEE B;  3CJ1 A;  1YVN A;  5AQS A;  2I7N A;  2GTD A;  4NO7 A;  2ZWH A;  3O6W A;  4MLH A;  3VGL A;  3GE1 A;  3SLC A;  1TYQ B;  1DGK N;  1TYQ A;  1TUU A;  4CZM A;  5KPT A;  1ZXO A;  3UKU A;  2QWR A;  2ITM A;  4H5N A;  1NM1 A;  4EAH D;  3C7N B;  3WXK A;  1NGB A;  3EKS A;  4B1X B;  2E2Q A;  2PBD A;  1LCU A;  1HKG A;  4BR4 A;  2VCP A;  4CI6 A;  1NGG A;  2YHW A;  4J8F A;  5EOY A;  5KPZ A;  1NGI A;  4WQ4 A;  2GEM A;  3ID8 A;  5BR9 A;  1JCE A;  1BA0 A;  3SMP A;  5EY4 A;  3UKR B;  2FSN A;  2E2P A;  4WYB A;  1KAZ A;  3IFR A;  3UKR A;  3U9D A;  4CD1 A;  1GLF O;  4FWQ A;  4WQ5 C;  5AZJ B;  4MO4 A;  1V4T A;  4Y0W A;  4AM6 A;  2NRH A;  1BG3 A;  3MCP A;  5EVZ A;  2VYP A;  4O8K A;  2QWL A;  3HTV A;  2P9I B;  4B1V A;  3U8X A;  2P9I A;  3WXI A;  4BG8 A;  4EHU A;  5AFU A;  1U2V B;  1GLL O;  1X3N A;  5AQR A;  1QQO A;  5AQJ A;  5AQQ A;  5E84 A;  4H03 B;  3D7E O;  3FZL A;  3VEY A;  3A5M C;  1NMD A;  5F1X A;  5KPR A;  1NGD A;  2OAN A;  5LJV A;  3M3Z A;  5AQF A;  3WXJ A;  2V7Z A;  1QZ5 A;  1HPM A;  1ATR A;  3O8M A;  1K8K B;  3FGU A;  1K8K A;  1GLD G;  3A5N C;  3TU5 A;  3QB0 A;  2Q0U A;  5AQP A;  3LM2 A;  1Z05 A;  5AQG A;  3BUZ B;  4BR7 A;  4NB4 A;  1E4F T;  1TUY A;  3J8A A;  1NWK A;  4AM7 A;  2HOE A;  2FF3 B;  4BRF A;  5AQV A;  2CGK A;  3IUC A;  5BRE A;  1ESV A;  4BR9 A;  1GLB G;  5AZI A;  1YXQ A;  1NGE A;  1RGI A;  1JCG A;  3VET A;  3VF4 A;  3LM9 A;  4JNE A;  1GLA G;  4FO0 A;  3QIC A;  2ASO A;  4M63 C;  2CH5 A;  4CZF A;  3WT0 A;  1HX1 A;  3QFU A;  2D4W A;  2WUS A;  3UB5 A;  4BC4 A;  2P9L B;  3CJ9 A;  2P9P B;  1ATN A;  1DKG D;  2P9P A;  3DWL A;  4FOI A;  2E2O A;  1Z6R A;  4JHD B;  1ZC6 A;  3FFK B;  1ATS A;  1WOQ A;  2E2N A;  3CJB A;  2P9U A;  1T44 A;  5E26 A;  2YJE A;  1SAZ A;  3MDQ A;  5EX5 A;  3VPZ A;  4CZG A;  2Q31 A;  3L0Q A;  3I8B A;  5KQ8 A;  1KAY A;  4IZ9 A;  4BGB A;  4BRK A;  2D1K A;  1XUP O;  3MK6 A;  2VWB A;  2A41 A;  3O80 A;  3O1W A;  2F9W A;  3AY9 A;  3M1F A;  3O1B A;  3SMS A;  4BRG A;  2ZF5 O;  3ZX3 A;  1ZBS A;  3CET A;  2E1Z A;  2IIR A;  4C23 A;  3DJC A;  1BOT O;  5BPL A;  3VGK A;  3D2E B;  3TPQ A;  4A2B A;  4CZE A;  3WUH A;  3D2E A;  1P8Z A;  3WQT A;  2ASP A;  3UKU B;  3WQU A;  4GNI A;  1HLU A;  3H1V X;  2D0O A;  1RDW X;  4FWP A;  1JCF A;  3VER A;  4B1Y B;  3VF6 A;  2I7P A;  3ULE B;  5JMV A;  3VGM A;  5JLF A;  3ULE A;  5JIC A;  1WUA A;  3HZ6 A;  4H0X B;  5BRF A;  2CGL A;  4JD2 A;  4FWS A;  4H0P A;  4JN4 A;  4FSV A;  3FZF A;  4FL9 A;  4FWL A;  4BRO A;  3BEX A;  4DCH A;  4CD3 A;  4F9O A;  1S22 A;  3ATU A;  3AAP A;  2E1Y A;  3DXK B;  3R6M A;  1GLE G;  4YDU C;  4BRI A;  2QWM A;  3DXK A;  3A8Y A;  5AQK A;  3SJH A;  4BRP A;  4RTF D;  2H3G X;  4H5R A;  4KBO A;  3CQY A;  2GWJ A;  3H1Q A;  2V51 B;  4GY2 B;  1HKB A;  4BR2 A;  4CBU A;  5AQL A;  3LDP A;  1NBW A;  4Z94 A;  5BRD A;  2BTF A;  3FLC O;  5BN9 A;  4WQ5 A;  4DHY A;  5FPE A;  4PKH A;  3MN5 A;  4CZH A;  5AQZ A;  2GWK A;  5BPN A;  5KQD A;  2DPN A;  3A5L C;  4B9Q A;  2FLO A;  2GEL A;  4BGA A;  4DB3 A; 
#chains in the Genus database with same CATH topology
 1HKC A;  3H6E A;  4FPB A;  1L2D A;  2Y20 A;  4FK2 A;  3TPZ A;  3NGZ A;  4DV5 K;  2OO9 A;  2Q36 A;  1IN8 A;  1N5Y A;  3EE8 A;  3ENO A;  5AQN A;  2O4G A;  2FSK A;  4J2A A;  4KV8 A;  5AQX A;  4DFP A;  1OIZ A;  2QZ4 A;  3K0S A;  4CGI A;  3KP1 E;  2GBZ A;  5AFU H;  1ORY B;  4QCL A;  2DY4 A;  4KPY A;  3SAG A;  3HOS A;  3CCL N;  3ZT3 A;  2YKN A;  5AZI B;  1HNZ M;  3B7Z A;  1DGB A;  1RDB A;  2UUC M;  1TK8 A;  4ILJ A;  2LVN C;  4LJ6 A;  4MO5 A;  3H46 O;  4NXM M;  2FF6 A;  2KHH A;  3THX A;  1XNR K;  3GPY A;  4I6M A;  2KHO A;  4JK8 A;  2IVP A;  2JZ1 A;  2M5Z A;  4BAC A;  1TK5 A;  4KRF A;  1SS6 A;  3VMF B;  4Z6Y A;  2QBY B;  2YHX A;  2VWK A;  5C0Y A;  1LOT B;  3EIE A;  2EWS A;  2NNW A;  3NVK A;  4FLU A;  3U60 A;  2X8A A;  1W2B M;  3O08 A;  2QCU A;  4BQL A;  3S9H A;  3RSE B;  4JYA K;  4CFA A;  3D45 A;  2XF3 A;  1AUA A;  1GOB A;  4QS8 A;  4R79 A;  3FFI A;  3SCX A;  2F5P A;  1P3Q Q;  2E8A A;  1RBT A;  3P38 A;  4JI0 M;  4JKB A;  4OX9 M;  1GOC A;  2P9K A;  4KHP M;  3CJ7 A;  3D8L A;  3I0R A;  3H45 C;  1L2B A;  4HTL A;  1E9S A;  2WOM A;  3KVW A;  5F3W A;  3CF5 L;  2UXB K;  1MA9 B;  3PFI A;  4FWM A;  5F2R A;  3HJF A;  3ZH9 B;  3HI0 A;  4B3M M;  2K0B X;  2KZS A;  4IJA A;  1V33 A;  2L4F A;  1IFY A;  1VSK A;  2L2D A;  3KHY A;  2PYL A;  1WSH A;  1QZ6 A;  3EZ5 A;  1G41 A;  3AVA A;  3IS9 A;  3U61 B;  4BRQ A;  4YHH M;  4CW7 B;  1D0K A;  2WFB A;  4L3Q A;  2W41 A;  3R8E A;  4LJ7 A;  2EO2 A;  3CPE A;  3W3D A;  3V4I A;  1KQS M;  4FLY A;  1BL3 A;  4JD2 B;  2HST A;  2CH6 A;  3C6A A;  4DTR A;  1TL3 A;  3QYE A;  4O5F A;  2A5Y B;  2GNO A;  1RDC A;  3ZSQ A;  3HHW A;  4GIP A;  1N36 M;  3VEN A;  4JI7 K;  1HJO A;  3SAF A;  2CV2 A;  4Z4E A;  1ILY A;  3V9S A;  1A5T A;  1QAN A;  5JI3 E;  3GBT A;  4FCT A;  3THG A;  1OH5 A;  4QAG A;  5IZ7 D;  1TR8 A;  2Y21 A;  4M0D A;  3C7N A;  3T38 A;  4FWD A;  1E3M A;  1M1K O;  3AVL A;  3M8S A;  1HNX M;  4DR3 M;  1S3X A;  3JSM A;  4I81 A;  1VQ7 N;  1NJX A;  5J2N A;  5M1K A;  3ZX2 A;  3GLG E;  4L15 A;  3B74 A;  2NRR A;  3K5O A;  3QEW A;  4M42 A;  4BVP A;  3IEC A;  3DYA A;  1YSY A;  4CFC A;  2G5G X;  2G8U A;  1YI2 N;  2D7E A;  2RE2 A;  1I4W A;  2ZE2 A;  1QVR A;  1IM2 A;  4RW4 A;  3PVS A;  2A6A A;  2B3T A;  1U6Z A;  5ELZ A;  1ZV1 A;  2D0C A;  3ZEU B;  5SZT A;  2YHA A;  4BG9 A;  4IFY A;  4CIG A;  4FJX A;  1A5W A;  1NVM A;  4W5R A;  1CUK A;  2CFO A;  4H5V A;  3QLH A;  2EJS A;  3EL2 A;  2ZD1 A;  3A5O C;  3RR7 A;  4M0W A;  1IXR C;  3K8Z A;  3J7Y P;  3HX3 A;  2Y1I A;  5AR0 A;  2F96 A;  4OW0 A;  4AHS A;  2FXU A;  3VF2 A;  2O8D B;  3L27 A;  3BOS A;  1CZA N;  2ZGY A;  4GMJ B;  5JLH A;  1F21 A;  3HVR A;  2CE7 A;  4IJN A;  2UU9 K;  2ZTD A;  2NLX A;  1T6O A;  4A5A A;  2NRX A;  1TKT A;  3DOK A;  1LW2 A;  2XSZ A;  3K58 A;  1BDG A;  3DLR A;  2HF3 A;  4RWT A;  2RF2 A;  1VQL N;  5I42 A;  4DSI A;  1PGY A;  1C1A A;  4LGM A;  3NF7 A;  2QEN A;  4AHV A;  3NF9 A;  1BA1 A;  2VQF M;  3OYF A;  4ZTF A;  2P5O A;  3U6S A;  1O1W A;  2QXF A;  1IXZ A;  4KH5 A;  2LHG A;  3HBT A;  5M1Q A;  3AVB A;  4BRH A;  4V19 S;  4I7F A;  4FJ7 A;  4DR5 K;  1ZBU A;  2HVI A;  1WSJ A;  3O4W A;  1RBR A;  1RIL A;  3CI5 A;  3SZ2 A;  2E88 A;  4F2S A;  4B3T M;  1TDZ A;  4ILH A;  2DFE A;  4WFA L;  4IBG A;  1TAQ A;  2F5N A;  5KGW A;  3VEO A;  4FW1 A;  4AKH A;  4MQ3 A;  3AVJ A;  3T7Z A;  1VG5 A;  1BCM A;  3WNH A;  1YIJ N;  3MXM A;  1KFD A;  1N75 A;  2P9N B;  1Z5C A;  3AO2 A;  2F8T A;  2VG6 A;  4R71 A;  3SAW A;  2QP9 X;  2V52 B;  1XWI A;  2ZAM A;  2P9L A;  3RGS A;  3FZH A;  4E7L A;  2DWM A;  4OPJ A;  3CFR A;  4H0V B;  1KVC A;  4U7B A;  4E1M A;  3VK8 A;  2Q97 A;  4E1J A;  2DAE A;  1QSS A;  4GMQ A;  4DTP A;  1HT2 E;  1VK0 A;  4BB9 A;  2V1U A;  2XHB A;  1ZAE A;  4LY7 A;  3K9K A;  4LSN A;  4L8R B;  2DHR A;  1XQS C;  2VWJ A;  1V4S A;  4DSK A;  3MX2 A;  4G4O A;  5AQW A;  4LD0 A;  1Q18 A;  3AVN A;  1Q86 O;  1C1C A;  1RCH A;  2I7N A;  1GJT A;  3LQR A;  1XXH A;  1CLQ A;  4E7J A;  2GTD A;  3VTI A;  4EP5 A;  2ZWH A;  4CF1 A;  1R6B X;  1S9G A;  1VDL A;  3GE1 A;  2F5Q A;  3HPG A;  3SLC A;  3AVK A;  1DGK N;  4JI6 M;  1WSI A;  5C25 A;  1G4A E;  1TUU A;  3ZSR A;  2NUB A;  4CZM A;  4XGI A;  5KPT A;  3FTC A;  3VQA A;  2QWR A;  2HHS A;  4F8R A;  2DWZ B;  2YFQ A;  4HHT A;  3JAM S;  1NGB A;  3CFP A;  1IKW A;  4GV3 A;  4FZX C;  3Q7B A;  2E2Q A;  2BJV A;  3ALY A;  1EFU B;  4DV5 M;  2PBD A;  1LCU A;  4BR4 A;  3T1H K;  3OJU A;  1WIV A;  1NGG A;  4O4G A;  3SQ0 A;  3FE3 A;  2X78 A;  2F4V K;  5LMU M;  1N78 A;  1U4B A;  4F3T A;  5LMN M;  2GEM A;  1FKO A;  3IAY A;  1D0L A;  3SJJ A;  3SMP A;  1BA0 A;  5EY4 A;  4CEB A;  3UKR B;  3OW2 M;  1X1P A;  4WYB A;  3VQ4 A;  1U48 A;  4FWQ A;  3SHF A;  4MO4 A;  1V4T A;  5H37 D;  3QO9 A;  1S1X A;  3B6P A;  1BG3 A;  5EVZ A;  3CC4 N;  2ZM6 K;  5FTL A;  5FDL A;  1JL1 A;  3NCI A;  3HTV A;  3THY B;  3CME N;  2KTQ A;  3KD5 E;  3SAT A;  2PYJ A;  1VQ8 N;  3U8X A;  3HJ8 A;  4LF6 K;  4DV0 K;  4EHU A;  3PX0 A;  3U6M A;  2GUI A;  3ISN C;  1VQ6 N;  2Z4S A;  1UFZ A;  4DTJ A;  2VG7 A;  3FZL A;  4NYN A;  4JYA M;  3KSX A;  3A5M C;  3HHZ A;  1NMD A;  3J80 S;  3ILK A;  1NNU C;  2OAN A;  5LJV A;  3THW A;  2JUJ A;  2V7Z A;  2HAK A;  1SUQ A;  1QZ5 A;  1U45 A;  1TTE A;  3O8M A;  1R0A A;  4DQI A;  4B9S A;  4RW9 A;  3AA3 A;  3ZQJ A;  3K5M A;  4GVM A;  4Z4C A;  4DV6 K;  4F3O A;  3W68 A;  1OQY A;  2R4E A;  3A45 A;  2DFF A;  1NWK A;  4AM7 A;  5FTN A;  1D9F A;  2A1R A;  1Q9Y A;  2BWE A;  3FUW A;  2O4I A;  5GIP A;  3KW6 A;  4DUY K;  1ESV A;  5AZI A;  4CHO A;  3CMA N;  1NGE A;  3LM9 A;  5FRN A;  4NCG A;  1F4I A;  4M3W A;  4FJM A;  2E5L K;  5J2M A;  2DEN A;  3QIC A;  3DA1 A;  2ASO A;  3VQP A;  1WHC A;  2HBJ A;  3LAL A;  3B6O A;  4CZF A;  2PY5 A;  1MU5 A;  3KFU G;  3LQQ A;  4EIW A;  2QBY A;  4DR6 M;  3KK2 A;  1HX1 A;  2R4J A;  2D4W A;  1RDU A;  4OGE A;  2QTD A;  1LW0 A;  3CJ9 A;  1GL7 A;  1DKG D;  4LF5 M;  4QHT A;  3VKG A;  3BZC A;  4CJL A;  2P9P A;  3T1A A;  4AG5 A;  2E2O A;  2DZL A;  4DLG A;  4JHD B;  4XBO A;  2O5R A;  3AL0 C;  1NY5 A;  2E2N A;  3CG7 A;  1BGX T;  3P31 A;  1BCO A;  3OYH A;  1HNZ K;  1Q39 A;  1NOY A;  2YJE A;  2UUC K;  4NXM K;  4CZG A;  3L0Q A;  3UIQ A;  1DV0 A;  3ASM A;  3R8F A;  4E0D A;  4DFJ A;  5CHI A;  3F73 A;  3U6C A;  4BGB A;  1X9W A;  3QNO A;  3O80 A;  2CEA A;  3O1W A;  1GAB A;  3AY9 A;  3C58 A;  2K47 A;  2LNH C;  4DR2 M;  2ZF5 O;  3ZX3 A;  1XWL A;  1ZBS A;  2IIR A;  2LVO C;  1VHX A;  5BPL A;  1IY2 A;  2O01 F;  3VGK A;  3TPQ A;  1ASV A;  5EP1 A;  1BIS A;  3U61 A;  4JI0 K;  4IFV A;  1JR3 D;  3U6L A;  4OX9 K;  1UWB A;  1HLU A;  3H1V X;  4KHP K;  1RDW X;  1GVN A;  1QQC A;  4FWP A;  4CJS A;  3FUX A;  3VER A;  3SAH A;  3C94 A;  3HY5 A;  3IHP A;  3VGM A;  5JIC A;  3HZ6 A;  1OH7 A;  4H0X B;  2LVQ D;  4TUW A;  4JD2 A;  4B3M K;  3FRI A;  4H0P A;  2KFN A;  4FSV A;  3H4M A;  3FZF A;  3AVF A;  4FWL A;  4PWD A;  2QKB A;  3BEX A;  4KRE A;  3AAP A;  2DXI A;  1YLA A;  5K14 A;  2Z1I A;  1RT4 A;  1VQ5 N;  3AA4 A;  4M3U A;  4YDU C;  1QAQ A;  2QWM A;  5HL7 L;  3MWT A;  3ZSX A;  1LTM A;  3WNE A;  4YHH K;  1UA0 A;  4C8M A;  3EE9 A;  3FUV A;  1OVY A;  1SV5 A;  4W5N A;  2GWJ A;  3H1Q A;  2XZU A;  4GY2 B;  1C1B A;  5AQL A;  1S6Q A;  1Q82 O;  1WBD A;  3E4R A;  3VQB A;  1YIT N;  4G4N A;  3K2P A;  2BNK A;  4Z94 A;  4IG3 A;  1WSF A;  1W5T A;  5BRD A;  4GV9 A;  3FLC O;  3FUU A;  4RF1 A;  4XK8 F;  3L8B A;  1X37 A;  4DV2 M;  1N36 K;  3PO5 A;  1OAI A;  1QUT A;  1TH4 A;  4JEP A;  3L2W A;  4CZH A;  1N33 M;  5AQZ A;  4OLA A;  3KK7 A;  2GWK A;  3HST B;  2DPN A;  1WAJ A;  3LCV B;  2KLA A;  4O44 A;  3VQ5 A;  4BGA A;  4D80 A;  4ZPX A;  3K9J A;  2F5S A;  3IDH A;  3ZEU A;  4X66 M;  3DLH A;  3LAM A;  3TAE A;  3HM9 A;  4DR3 K;  3HJS A;  2Q1N A;  3NH1 A;  3L4I A;  3EKU A;  1KFS A;  1NSF A;  4FPA A;  4BC2 A;  2D0A A;  4LG2 A;  2RHK A;  3GLI E;  4PA1 A;  1N34 K;  4FJG A;  1HNI A;  3I4V A;  3LVW A;  2YCH A;  3CJC A;  5EXW A;  1HNW M;  1Q9X A;  3ZC7 B;  2O8D A;  3VEV A;  1PJI A;  3QEP A;  3ZCM A;  1VQK N;  1YJ9 N;  1D9D A;  1CXU A;  3KWG A;  4IBN A;  1NKB A;  3OYN A;  1KLN A;  1MX0 A;  2A40 A;  2LWX A;  4JKA A;  1IY0 A;  3QEX A;  2W6L A;  3BBZ A;  4QS9 A;  2EA0 A;  2UXC M;  4BR5 A;  2CUZ A;  3PSF A;  1RBU A;  4GV6 A;  3LPU A;  3L2Q A;  3BP8 A;  1NHG C;  1QAO A;  4GKK M;  3RRH A;  4M3R A;  3ATV A;  4JI1 M;  1U47 A;  1NGC A;  4R5P A;  3MEC A;  1PJJ A;  2DTU A;  1W9H A;  4DF8 A;  3NWL A;  3WXL A;  4OPK A;  3TAR A;  3SV4 A;  4DV4 M;  2DAG A;  4B3S M;  1L3V A;  3U3G A;  2FSJ A;  1D8Y A;  4Z4F A;  3SQ4 A;  5HBM A;  2CHQ A;  5BPV A;  1ZBL A;  1U49 A;  1FXX A;  3BF3 A;  2J4R A;  4YY3 M;  4LY6 A;  2VQF K;  2G8L A;  1ZBF A;  4MDB A;  1VSI A;  3TAN A;  4CEZ A;  1ZMU A;  2HHQ A;  1IBK M;  2OZS A;  4O0J A;  3GLI A;  4IO8 A;  2QWP A;  1EE8 A;  1VEK A;  2WSC F;  2YNF A;  2YX6 A;  3UJN A;  5EXP A;  3B7Q A;  4DBG B;  1D5A A;  2C98 A;  4BLC A;  3AO1 A;  4B3T K;  3TAM A;  1FNN A;  4DTN A;  4JN6 A;  4FM1 A;  2AP1 A;  4LZZ A;  2Z1H A;  3U9Z A;  4F4K A;  1RFQ A;  2BH1 A;  1KCF A;  3FE1 A;  2LSN A;  4CZI A;  4H0Y B;  4GKJ M;  2Z8Y M;  1TH2 A;  2BE2 A;  3FZK A;  2XFS A;  2FH0 A;  1XNQ M;  4LF6 M;  3B8A X;  4K42 A;  5C10 A;  1QSY A;  2VDB B;  4KH4 A;  4WQ4 C;  5I9E B;  4CK3 A;  1T43 A;  3HKP A;  2HBK A;  4R3D A;  3HZJ A;  5ITR A;  1NK8 A;  5AQH A;  1KAX A;  1D2N A;  5CYM A;  3V1O A;  4CEA A;  4DSE A;  3MEE A;  5KO3 A;  2F9T A;  4CHY A;  3SBJ A;  1GLJ O;  1L3U A;  1OH6 A;  3ZT4 A;  3PO4 A;  3OY9 A;  1YUW A;  1ZYQ A;  5EP2 A;  2I5J A;  2W40 A;  1TKD A;  5KRS A;  1NU0 A;  3EO3 A;  5BPM A;  3I01 M;  2R45 A;  1YJN N;  3FZM A;  3KLF A;  3U5Z B;  4FLW A;  3GO8 A;  4QS7 A;  3ZSO A;  1EIJ A;  4QNR A;  3ZSZ A;  5F0X A;  3OS2 A;  2YR0 A;  4G4R A;  1HYV A;  1MWM A;  3CC2 N;  4KFB A;  1BWF O;  4YDU A;  3J7Z O;  4LRT A;  4W5O A;  3VEZ A;  1NHW C;  4JI6 K;  3CQ8 A;  4AI6 A;  4JKG B;  3H3N O;  1XB2 B;  3QYB A;  3J7B A;  3SYK A;  3LP0 A;  2F7T A;  3THY A;  1QHA A;  5C18 A;  2B4J A;  3S3N A;  1IN4 A;  4HUE A;  3LCU A;  1JLB A;  1NV8 A;  3DLB A;  5AQT A;  4JS4 A;  5GAD P;  4CBX A;  1C7Y A;  2KRU A;  4L4U A;  3DM2 A;  3L3U A;  5LMN K;  5LMU K;  5J2Q A;  4JV5 M;  1VQO N;  4KH6 A;  4CGF A;  3PLA A;  2XRI A;  3LDL A;  3TAQ A;  3GLH E;  3NE6 A;  4OO1 J;  1T6C A;  4H4M A;  4PL7 A;  4OPH A;  2HHX A;  5AQM A;  4K0K M;  4B3O A;  4YOU A;  3OYD A;  3QNN A;  3GQ5 A;  1T3V A;  2QPA A;  3F9K A;  4IKF A;  2RKI A;  2Z1J A;  4KTZ A;  3AAQ A;  4RW7 A;  4FVU A;  4Z8X A;  3WHL A;  3OJS A;  4FLX A;  1KXP A;  5ITQ A;  2Q0R A;  3AAR A;  3CCM N;  4ZTJ A;  1L5U A;  2ZJR L;  3FD9 A;  3V9U A;  1TL1 A;  4FM0 A;  4L16 A;  2JGU A;  4PL8 A;  4MDA A;  3CIP A;  4DU1 A;  4J2E A;  1E4G T;  2DWN A;  4DUZ M;  3UGJ A;  3AVM A;  2C99 A;  1FJG M;  1JLG A;  3H08 A;  2NRV A;  4BWM A;  4PUO A;  1DGG A;  4B3R M;  3SK3 A;  1SXJ B;  2XGN A;  4CJU A;  3CER A;  4PKG A;  5GIO A;  5FPN A;  2G8V A;  1WGN A;  4CJR A;  1NLV A;  3T15 A;  4X64 M;  3KWI A;  5BRH A;  5I3U A;  2DKL A;  3QBW A;  4DR4 M;  3DAW A;  4J2B A;  4JI4 M;  3DLE A;  4ELU A;  2LVA A;  2G8W A;  3K5N A;  3HSC A;  3E66 A;  4IBB A;  1B9D A;  1VQN N;  3SBG A;  4JHD A;  1T7P A;  3GLH A;  3Q8X A;  1GOA A;  2E20 A;  4H4O A;  3LMM A;  4IEI A;  3GG4 A;  2O8E B;  3GLF E;  1YVU A;  5FRM A;  3K9O A;  3KDS E;  3CM5 A;  3HO1 A;  3ZET A;  4H5W A;  4DF4 A;  1QDT A;  3LL3 A;  4LF9 M;  4O8U A;  4LC9 B;  4RKU F;  4BWJ A;  4DR6 K;  4GC9 A;  3VQC A;  2JNH A;  3W0L B;  2X74 A;  4LF5 K;  3KKR A;  4DG1 A;  3TWL A;  3CTW B;  1P90 A;  1TYQ A;  2Z1G A;  4WFB L;  4CHN A;  3KLG A;  4DWI A;  1W0H A;  1ZXO A;  2EKF A;  2FBT A;  4EAH D;  1ASW A;  5DYG A;  5DYI A;  3WXK A;  4A59 A;  4FLT A;  1HR0 K;  4FJ9 A;  2AJQ A;  1GJS A;  1XC9 A;  1JB0 F;  4IBJ A;  4ZHR A;  1N77 A;  4DTS A;  2ITG A;  2YHW A;  4FLZ A;  3I0S A;  4AHR A;  4WQ4 A;  3ID8 A;  3LAN A;  1N34 M;  4MGY E;  1WSE A;  3T1Y M;  5JVH L;  3A2F A;  4DR2 K;  4YOV A;  1GL6 A;  1KAZ A;  1GLN A;  1SXJ D;  1GLF O;  3VQ9 A;  5AZJ B;  1PJT A;  3GLF A;  2HBM A;  4NRW A;  1NK4 A;  4GEW A;  2NRH A;  1VRU A;  1RTJ A;  1H6U A;  4O8K A;  3O3H A;  1ZBI A;  1E94 E;  1SL1 A;  3AJI B;  3ZT2 A;  2P9I B;  4CFD A;  5E41 A;  5GAE P;  1QAM A;  3TSQ A;  1GLL O;  2GQF A;  4GW6 A;  1RBS A;  4D81 A;  5AQJ A;  5AQQ A;  5E84 A;  1VSL A;  3QWL A;  4WE1 A;  5HOO A;  1RT2 A;  4CVN E;  4JKE A;  3VA3 A;  2WC9 A;  4JKF A;  3C6H A;  4AHC A;  1V34 A;  4CJ4 A;  4CES A;  4YOW A;  2Y1J A;  3TAF A;  4IJF A;  2BAN A;  4J2D A;  1IH7 A;  1J5E M;  1IKX A;  1UM8 A;  5EXT A;  1LWF A;  1K8K A;  3A5N C;  1VQ9 N;  3PNY A;  2Q3S A;  2WSF F;  4BR7 A;  1TF0 B;  5AQP A;  5AQG A;  1NJF A;  3ITH A;  2C96 A;  2HB5 A;  2CRU A;  3DOL A;  5CZ2 A;  4LF7 M;  4IO9 L;  1XXH E;  3ZT1 A;  4BRF A;  3CF0 A;  3K2L A;  3HK2 A;  3RMB A;  2AHM A;  2IC3 A;  3WNF A;  5T7B A;  3P1G A;  1QSL A;  2P5T A;  4II7 A;  1LWC A;  5BRE A;  4DV2 K;  1MU2 A;  3Q8G A;  4L6V 6;  1GLB G;  4OPA A;  4E19 A;  3VET A;  1N33 K;  1GLA G;  5FRO A;  1FKP A;  3PXG A;  4H8K A;  2LHC A;  3E01 A;  4FJ5 A;  2CHG A;  1YUB A;  4IJE A;  4M63 C;  2HVH A;  4ANR A;  3AFH A;  1KYI A;  1IBL M;  2HMI A;  1IY1 A;  1EX4 A;  2R44 A;  4X66 K;  3AGR A;  1C1K A;  3P5J A;  2WUS A;  4W5Q A;  4HEO A;  4BC4 A;  4KHS A;  2FBY A;  2VG5 A;  2L4E A;  1NJY A;  1ATN A;  3HU2 A;  4PDG A;  1BVS A;  2B6A A;  3OBW A;  3R1X A;  3DWL A;  2ZAO A;  4FOI A;  1TV6 A;  1NK5 A;  3M0E A;  1KC8 O;  4CHZ A;  1HNW K;  5GKN A;  1OH8 A;  3FFK B;  1ATS A;  1XMQ K;  1JQJ C;  4B9M A;  5EP4 A;  1T44 A;  3P39 A;  3HOT A;  3QEI A;  1LV7 A;  3NAE A;  3OYK A;  5EX5 A;  3SYL A;  2Q31 A;  3I8B A;  3VQ6 A;  3SYZ A;  4MH0 E;  4WFN L;  3GPP A;  1QZE A;  4IZ9 A;  1G15 A;  3CD6 N;  3OYE A;  4BRK A;  4RNA A;  4IOA L;  1EXQ A;  2ERC A;  4ELT A;  3AO3 A;  4DFM A;  1XUP O;  3VQ7 A;  2UXC K;  2A41 A;  1L3T A;  1JL2 A;  1BI4 B;  2F9W A;  3P83 D;  4A3V B;  2P51 A;  1YTU A;  4GKK K;  2L09 A;  2E1Z A;  1IXS A;  3DMJ A;  3DJC A;  4JI1 K;  4JKH A;  4Y1D A;  2HHU A;  2KFZ A;  4IBK A;  1HQY E;  3DRP A;  5C2D A;  3D2E A;  4W5W A;  3HYF A;  3WQU A;  4A57 A;  3TWK A;  1YE9 A;  2DNA A;  3AO4 A;  4IBE A;  2O8F B;  2D0O A;  3K5L A;  3CCE N;  4DV4 K;  4B3S K;  4B1Y B;  3J81 O;  4KB0 A;  3KOY E;  5A2Q O;  3ULE B;  4ELV A;  4K8Z A;  2KNZ A;  4YY3 K;  4DV1 M;  4DMN A;  2FBV A;  2CGL A;  5L8R F;  4FWS A;  4JN4 A;  2CV0 A;  3JR5 A;  3SV3 A;  1IKY A;  1IBK K;  4BRO A;  4CEE A;  3GQ3 A;  4F2L A;  4GHA A;  4CD3 A;  2JLE A;  4FZZ A;  1HYZ A;  3GRR A;  2E1Y A;  2LXE A;  2QHO B;  2RGH A;  3J27 B;  3R9X B;  3R6M A;  4X65 M;  3DXK A;  3KP0 E;  4BRP A;  3GQ4 A;  3FKE A;  3B9P A;  3DLL L;  2D5R A;  2H3G X;  3VQQ A;  4KBO A;  3CQY A;  1UAX A;  3E46 A;  3SUP A;  4OKK A;  4CHQ A;  2R46 A;  1I39 A;  4CBU A;  3M8P A;  3LDP A;  5IWA M;  2R62 A;  4GRI A;  3U5Z A;  1LWE A;  1NBW A;  4KKO A;  1NK0 A;  1PJQ A;  3CYM A;  4GKJ K;  1XNQ K;  2NQ8 C;  3FUT A;  4YOT A;  1NJZ A;  1DGF A;  1XI1 A;  2HWJ A;  3HXM A;  5BN9 A;  4AKI A;  4JKD A;  2B5J A;  5HRO A;  4DHY A;  1W7A A;  2DAK A;  4PKH A;  2V6Z M;  3J7A S;  1DO2 A;  5HRS A;  3RR8 A;  2VGN A;  3IG8 A;  1WAF A;  3A5L C;  4B9Q A;  3E1Y A;  2FLO A;  3SPZ A;  3NBI A;  2JY7 A;  1JXB A;  2DI0 A;  4PD2 A;  1ZMV A;  4DB3 A;  1H1V A;  1JLF A;  4JRP A;  4E7I A;  1K3W A;  3TAP A;  7CAT A;  4YNQ A;  2R18 A;  1IN7 A;  3A46 A;  3KK3 A;  4N47 A;  2GUP A;  3AOE A;  1G99 A;  2YNG A;  3TTF A;  4B9N A;  1ZQ9 A;  3TTC A;  4REZ A;  2NZT A;  5JVG L;  1EO1 A;  1WLJ A;  3ZSV A;  4FD2 A;  2C9C A;  2QXL A;  3CJA A;  4DS4 A;  3UK6 A;  4B1W B;  1NGH A;  3U6Q A;  4CJP A;  1ASU A;  4JK9 A;  3CGW A;  4HVJ A;  3J2P B;  3THX B;  3BZK A;  4BBA A;  4I6M B;  4I2P A;  5FLX O;  3I04 M;  1TKZ A;  4KI4 A;  2OOB A;  3EYZ A;  2VF8 A;  1Z26 A;  4DTU A;  3QBX A;  4KO0 A;  4FJH A;  4M3T A;  3HT3 A;  2WTU A;  4RW6 A;  2G8F A;  5DFL A;  4XH1 A;  3MCA B;  4PDI A;  4K43 A;  3NH0 A;  3U60 B;  3OTO K;  1TK0 A;  2ASM A;  3MHV C;  2X6N A;  3EN9 A;  3T19 A;  4E3S A;  4JV5 K;  3L2A A;  3L26 A;  3RSE A;  2VQE M;  2FC0 A;  4DQ8 A;  2P9K B;  4HWI A;  4LF8 K;  3VQE A;  1DGH B;  2QEX N;  4C8O A;  1VQ4 N;  2Q2E B;  4OVZ B;  4K0K K;  4FWO A;  1X9J A;  1QVF M;  1HR0 M;  1NO1 A;  2VII A;  4UY8 O;  4L8R C;  4EZ6 A;  3LDO A;  2MH8 A;  4PKI A;  4LJ9 A;  3V1R A;  3M5R A;  4FCW A;  4KT0 F;  3VDP A;  3LWM A;  2OA8 A;  5HRR A;  1J09 A;  2DHY A;  3V9Z A;  4BQZ A;  2RN2 A;  1BHL A;  1IG8 A;  3NMU A;  2ZQB A;  3R9P A;  4QOS A;  4BRA A;  1NK6 A;  4PT5 A;  4C8K A;  4DUZ K;  3VEX A;  4FWN A;  3F2K A;  1NGJ A;  4XEI A;  2YV0 X;  3CHW A;  1FJG K;  3DLG A;  4C8N A;  4DR7 M;  4LJA A;  1IG9 A;  4XH4 A;  1B9F A;  1REV A;  4IOX A;  3LPT A;  4B3R K;  5FTK A;  2R65 A;  1KVB A;  2A42 A;  3O3F A;  4X62 M;  1X3M A;  2XEP A;  2G8H A;  4X64 K;  4ID5 A;  4YOR A;  4CEQ A;  4JRQ A;  2DVW B;  1NGA A;  2CP8 A;  3D6R A;  4GHL A;  3BF1 A;  4DR4 K;  3V81 A;  5CE3 A;  3RGP A;  3W0L A;  4JI4 K;  4CEF A;  3MN9 A;  3SAV A;  4LGY A;  4KLN A;  3G25 A;  3C3E A;  2G3Q A;  3L6Q A;  4W5T A;  4K41 A;  3MN6 A;  4CGD A;  2K6B A;  4M7X A;  4ITQ A;  3TR8 A;  1KLM A;  4DFK A;  3BDP A;  3EEQ A;  3L28 A;  4DSF A;  4DTM A;  1QQM A;  2PAV A;  4MLE A;  3C9P A;  3A42 A;  3CF6 E;  4JI2 M;  3MXJ A;  2EX3 A;  3QFP A;  2OQ4 A;  8CAT A;  3QIP A;  1S72 N;  1NJI O;  4I5S A;  4LF9 K;  4ID1 A;  3OYI A;  1MN3 A;  3HPH A;  3OYG A;  1JLA A;  4AG6 A;  5AJ3 K;  2V1C A;  1Q02 A;  4AH9 A;  3JYT A;  3LWL A;  3LP3 A;  3MX5 A;  2AA4 A;  2E6L A;  3GDQ A;  3MWP A;  1S1T A;  3VKH A;  4AZF A;  2YHY A;  2JZ0 A;  1T05 A;  3KSJ A;  5EXS A;  5AZJ A;  2XY5 A;  4E1N A;  4PY5 A;  4CIS A;  4KO8 A;  4H5T A;  4B1U B;  3OYL A;  2BGG A;  3I51 A;  1QYR A;  3S41 A;  2YI1 A;  1IJJ A;  1HYS A;  4FW9 A;  4LJ5 A;  3K9P A;  4MGI E;  1O13 A;  3O3G A;  4BVO A;  1BIZ A;  4Y28 F;  4LFB M;  1S9E A;  2D0P A;  5H1S Q;  4BR0 A;  5DNY A;  2YJF A;  3SC3 A;  3IG1 A;  3RE8 A;  4FLV A;  5C1B A;  2IDO A;  3Q7C A;  5ADX A;  4E7K A;  2F8S A;  3S3O A;  3T1Y K;  1VEG A;  3VEW A;  5C42 A;  1QQN A;  4KHY A;  3RTV A;  4CK1 A;  3O5B A;  4YOY A;  1NGF A;  1XMQ M;  3D8B A;  4I9Q A;  2LH0 A;  3HGI A;  3M6G A;  2A3Z A;  4FW2 A;  4PQU A;  5LJW A;  3OYM A;  3GRY A;  3IG5 A;  1WGL A;  3DLK A;  4H0T B;  2OYQ A;  4JI3 K;  1W97 L;  2KDL A;  2CWB A;  4A62 A;  2ZGZ A;  1DLO A;  5CYQ A;  3CQX A;  4BC5 A;  3GLG B;  2F5O A;  3KKS A;  4DQS A;  1VQP N;  5AQY A;  1L3S A;  4MGH A;  2QWQ A;  3IMX A;  1U04 A;  2J7N A;  3L2R A;  1DT9 A;  3D2F B;  3VOV A;  1NJW A;  1EQY A;  3ENB A;  5ADX H;  3L2U A;  3UMM A;  3ZSY A;  1S5J A;  2HNY A;  5CR4 A;  3G0Z A;  2OOA A;  2DZN B;  4NSR A;  1MDU B;  1XC3 A;  1VSJ A;  3EY1 A;  2Z3X A;  1A5V A;  4LJ4 A;  1YHQ N;  2OPP A;  1SL0 A;  2FOI C;  1J5E K;  3VA0 A;  4HCB A;  3DXM B;  4BRD A;  3A98 B;  4IXC A;  5ITT A;  3T6P A;  2P9S B;  3KXE C;  1G8P A;  4FK0 A;  4RCH A;  4LF7 K;  1MWK A;  2P9N A;  4K25 A;  3TL4 X;  4CGY B;  2Q2R A;  2W6K A;  1YF5 L;  1CZ9 A;  2IAJ A;  4XH5 A;  4CE9 A;  4FYD A;  1KVA A;  4CJF A;  4LH5 A;  2UYT A;  2JY8 A;  3LW5 F;  1YAG A;  3MMV A;  1UA1 A;  1PRB A;  2BJW A;  1RT5 A;  3VQD A;  3AVC A;  5FPM A;  2GX9 A;  2O8B B;  1IBL K;  3KOW E;  1OTR A;  3WEE B;  1YVN A;  3HU3 A;  3N4Q A;  5M1O A;  2ZBK B;  1WR1 B;  4DV3 M;  1RDD A;  4Z4I A;  1RBV A;  2XFT A;  1S6P A;  4MLH A;  2XH9 A;  3LDS A;  2XSZ D;  4CK2 A;  4NL4 H;  3TWH A;  2NRZ A;  3F5T A;  5C12 A;  2JA2 A;  3IKM A;  1KRP A;  1HPZ A;  3EIH A;  3GRV A;  4H5N A;  3O9S A;  4IDH A;  1XHZ A;  2O8F A;  4B1X B;  4JI8 M;  4XIU A;  1NK9 A;  3H4J A;  2QI2 A;  1JR3 E;  4I4L A;  1IBM M;  2VCP A;  4CI6 A;  4J8F A;  5EOY A;  2KZM A;  1C0U A;  3E9S A;  4S12 A;  5CY4 A;  4G6Z A;  2XO7 A;  5BR9 A;  4JI5 M;  3W67 A;  1JCE A;  1L1T A;  3OS0 A;  2E2P A;  3UKR A;  3IFR A;  1NG9 A;  3L4Q A;  4DTX A;  4CEO A;  2HBL A;  1TVR A;  4QNM A;  3U6O A;  3QIN A;  3U3Y A;  5TKW A;  4AHT A;  2VYP A;  5SWM A;  1FK9 A;  2QWL A;  3V1Q A;  3NVM A;  1UOC A;  4B1V A;  5HP1 A;  3G6E N;  2HCB A;  3DI6 A;  4N5S A;  2DFH A;  4NLC A;  4BG8 A;  4DV1 K;  1YJW N;  3OTO M;  5AFU A;  1U2V B;  2P5G A;  2WSE F;  5AQR A;  3VDU A;  2JWK A;  2R6F A;  4H03 B;  3D7E O;  4MFB A;  5LL6 Z;  3GPX A;  1WN7 A;  1J54 A;  1NGD A;  4L78 A;  3M3Z A;  3LZI A;  3OYA A;  3AV0 A;  1RDA A;  1LAW A;  3WXJ A;  4LF8 M;  3FYD A;  4X65 K;  1HPM A;  1ATR A;  1S1U A;  3L2V A;  2IS3 A;  4CJ3 A;  4IIW A;  3J81 S;  3TU5 A;  1QTM A;  3G10 A;  4B7H A;  5A2Q S;  3I4Y A;  1K82 A;  1JXE A;  3F92 A;  1JR3 A;  2D7G A;  3BUZ B;  4NB4 A;  1Z6T A;  1E4F T;  3C3D A;  1TUY A;  5IWA K;  4B9U A;  4M3X A;  2FF3 B;  2ZJQ L;  4LCB A;  2Z7J A;  1NKC A;  4O55 A;  3LAK A;  3O4Q A;  4JXJ A;  1QUS A;  4BR9 A;  3RMA A;  1YXQ A;  4I9L A;  2DAM A;  1RGI A;  1JCG A;  3VF4 A;  3OYB A;  4JNE A;  3HL8 A;  3C6U A;  4P16 A;  3MXI A;  3ZLJ A;  5C24 A;  3DZD A;  3OVN A;  2LBC A;  3DRR A;  3JR4 A;  2CH5 A;  4NRV A;  1ITG A;  2NRW A;  4JS5 A;  1AIP C;  3RMD A;  4KOD A;  5DM7 L;  1Q8I A;  4B9L A;  4Q5V A;  3UB5 A;  4DSL A;  4KHW A;  4GH9 A;  4FJI A;  2EKK A;  3HHX A;  2P9P B;  1IKV A;  1KTQ A;  3OYJ A;  3ZCB B;  2Z4R A;  3TSP A;  1TGU A;  2W42 A;  2JXN A;  2QQ8 A;  1IV0 A;  3VQ8 A;  2R7Y A;  3O9T A;  2OZM A;  5GIN A;  5E26 A;  1SAZ A;  1DGH A;  4G4Q A;  3V9W A;  4OVZ A;  3VPZ A;  3DRS A;  4DR1 M;  4M9Z A;  4NXN M;  5JI2 E;  1KAY A;  4CF8 A;  5ITY A;  1VSF A;  4PHT X;  1OKS A;  2L7H A;  2X49 A;  3HVT A;  1V92 A;  1VSE A;  3SPY A;  2HKJ A;  1JLQ A;  3CPW M;  2OPQ A;  3MK6 A;  1LV5 A;  2KRK A;  3M1F A;  3O1B A;  2KA6 B;  4B7F A;  1J7K A;  5JS2 A;  4FJJ A;  4BRG A;  3U6D A;  4DQQ A;  3CET A;  4C8L A;  2KW0 A;  2C5R A;  2HW3 A;  5C15 A;  2LVP C;  1QE1 A;  3LP2 A;  3O9U A;  4A2B A;  4CZE A;  4OGC A;  3GPU A;  4LSL A;  3I56 N;  2VQE K;  4FM2 A;  2HHV A;  3NGY A;  1OFH A;  2N35 A;  1P8Z A;  3UKU B;  4WUR A;  4LH4 A;  2UUB M;  4GNI A;  5FLX S;  4AF1 A;  3OYC A;  2KQ2 A;  1JCF A;  1I3A A;  1K9M O;  2I7P A;  1C0T A;  3ULD A;  1IN5 A;  1RT6 A;  1EWR A;  4B08 A;  2UUA M;  5JLF A;  1WUA A;  2KNV A;  5EP3 A;  2HHH M;  1HJP A;  3V76 A;  3R3L A;  4FL9 A;  4NOO B;  4DV7 M;  1XMO M;  5DMR A;  1S22 A;  2P1J A;  3M8R A;  4HUG A;  1T8E A;  1MJG M;  4I8O A;  2YKM A;  3TWM A;  4KI6 A;  1QHT A;  4BRI A;  1E32 A;  3A8Y A;  2YQZ A;  5AQK A;  3SJH A;  4YFU A;  5FTM A;  5CZ1 A;  4TSX A;  5IT9 O;  4F1I A;  4DR7 K;  4CJV A;  1Q3C A;  1R5L A;  4NLB A;  4KHQ A;  1G59 A;  3OS1 A;  2KNA A;  2EUC A;  4JI3 M;  1ZMW A;  1Z25 A;  4B8A B;  2V51 B;  4X62 K;  2KXE A;  1HKB A;  1KD1 O;  3E9O A;  3PX4 A;  2JWL A;  3NHG A;  5KRT A;  3KD1 E;  2BTF A;  3AOE C;  1KSP A;  2UXD K;  3K1J A;  2KKZ A;  4FWH A;  3RRG A;  5D3G A;  4B8C A;  4WP2 A;  4CHT B;  1B92 A;  2J5Y A;  2HHT A;  1SKS A;  1N32 M;  3PNV A;  1Y97 A;  4GVE A;  3SUQ A;  3PV8 A;  4Q0B A;  5C2F A;  5KQD A;  3U6P A;  5EJC A;  4DKW A;  2ZJP L;  3TQS A;  3MEG A;  3L25 A;  2PFU A;  4JI2 K;  2GV9 A;  4AQY M;  1C0F A;  2HND A;  4H0O A;  4B7G A;  1D0M A;  4LF4 M;  1NNE A;  3KLI A;  4OLB A;  2BWB A;  2O8C B;  3MN7 A;  2EHG A;  4CGG A;  1HQC A;  3QEV A;  1HQE A;  3TTD A;  4B1Z A;  3HU1 A;  2XY8 A;  2L7I A;  4CGH A;  2FS1 A;  2QW9 A;  3E21 A;  1OIP A;  3A0I X;  1OFI A;  3JS6 A;  1D4X A;  1SXJ C;  3KZB A;  1OVQ A;  4A2A A;  5B8H A;  2RRU A;  1I94 M;  3QIO A;  4LFB K;  4G1Q A;  3GLG A;  5BN8 A;  1R2Z A;  3GOI A;  3BY5 A;  3L29 A;  3D2F A;  2CHV A;  4NYF A;  1HJR A;  4LFC K;  3C0B A;  4F2R A;  1TGO A;  1DO0 A;  3FTE A;  4IBI A;  3NF6 A;  2RKO A;  2Y0T A;  4JK7 A;  4E7H A;  2NRT A;  4MB7 A;  2P9U B;  2HHW A;  4CBW A;  3U4L A;  2HMP A;  1RTD A;  3HM8 A;  1S3S A;  3T69 A;  3SI6 A;  2V7Y A;  4MGZ E;  1G71 A;  1QDR A;  3G4S N;  1ZBH A;  2R0I A;  4HTU A;  3LDQ A;  4QOZ B;  4BRL A;  1HQU A;  5E6J A;  3DXM A;  4A61 A;  3DOA A;  1J9A A;  3PIO L;  2IOC A;  3KVG A;  4ICL A;  4CJ7 A;  2BUP A;  2P9S A;  4BRM A;  3P4I A;  2JY6 B;  1SL2 A;  2M60 A;  3GLI B;  1BU6 O;  3QML A;  1Z59 A;  1NMN A;  2QA4 N;  2Y0Q A;  2HF4 A;  4LFA M;  1DEJ A;  2H1R A;  2QWN A;  4ILG B;  1G3I A;  1JLC A;  3HJQ A;  1VAZ A;  3WHK A;  3CM6 A;  5ITX E;  3U6F A;  2QM1 A;  2HL7 A;  3I33 A;  3CF2 A;  3K59 A;  4FJL A;  3PUF A;  3GRU A;  2X4A A;  3NGI A;  4NC6 A;  2E6M A;  4RG8 A;  4JAX A;  2OPS A;  3VK7 A;  1WB9 A;  1HRH A;  3O9R A;  2O8B A;  3WEE A;  4AHU A;  1RNH A;  4CZK A;  2IVO A;  4I2Q A;  5BR8 M;  4ISF A;  3RWU A;  4CZL A;  2ZAN A;  4FCY A;  1A5X A;  4R7G A;  4DU3 A;  1J6Z A;  2LTU A;  4G9Z A;  4FOE A;  2QNJ A;  4BE0 A;  1DTQ A;  3RFW A;  1C0M A;  4N76 A;  4OVL A;  4NCB A;  4HUF A;  4Z4G A;  1K3X A;  4FWR A;  3EZW A;  1T6D A;  5KGX A;  2A5X A;  4C1N K;  2KZU A;  3G71 N;  1SG9 A;  4BRE A;  3AO5 A;  3CCU N;  4EIA A;  1JJ2 M;  2DWL A;  3V9X A;  2HNZ A;  2OPF A;  3KLH A;  2L6O A;  4BRC A;  3OBY A;  1OAO C;  1R59 O;  3LDN A;  5KI6 A;  3VTH A;  4A5B A;  2G8I A;  3ID6 A;  3KTQ A;  2FE8 A;  3MJ5 A;  3SAS A;  3B7N A;  2MJ5 B;  4DV3 K;  3RMC A;  4O5B A;  4BE2 A;  1NJG A;  1BIU A;  4C1N I;  1E9R A;  1QZM A;  2DZO B;  3VLF B;  3JXU A;  3VES A;  2BDP A;  1VSH A;  3O9Q A;  4UQG A;  1VRT A;  5AQI A;  3SAU A;  3F9M A;  4LZJ A;  4CJQ A;  5ITX A;  4EZ9 A;  5TKY A;  2QWO A;  3M8Q A;  1XNR M;  4CJ6 A;  4JKG A;  1X9M A;  3AGK A;  1PJS A;  1Y64 A;  5AQO A;  4BY9 C;  1SXJ E;  3H3O B;  3PX6 A;  1YTA A;  4JI8 K;  3RVC A;  3AA2 A;  4CCH A;  1N8R O;  5HRN A;  1BO5 O;  3HWS A;  1EP4 A;  3VN5 A;  3ZX0 A;  2OCE A;  3TAB A;  3C65 A;  1X9S A;  4NSO B;  5HRP A;  4FWK A;  1IBM K;  5FPD A;  3CC7 N;  1CZB A;  1TKX A;  3AKZ A;  1U2V A;  2FBX A;  4JI5 K;  1GLC G;  2IVN A;  4M9X A;  4Z4H A;  1VDD A;  4IWV A;  4CZJ A;  3C6T A;  4MGK E;  1Z5A A;  4FJ8 A;  2D7H A;  2CGJ A;  4FK4 A;  1XHB A;  2K9D A;  4CJW A;  1HNV A;  1SZ2 A;  5GAH P;  1VQ1 A;  1S1V A;  2QSF X;  2UXB M;  5GAG P;  3TI0 A;  1BUP A;  4KTW A;  1L2C A;  2WON A;  1NV9 A;  3AV9 A;  4BC3 A;  3KIO A;  1RT3 A;  3QER A;  1OKJ A;  1Q3B A;  4Q7J A;  3NF8 A;  5HLF A;  3KK1 A;  1EET A;  1IN6 A;  3B89 A;  1R4G A;  4ISG A;  3J7A P;  2KEB A;  3FR0 A;  3IRX A;  2OTJ N;  3CCR N;  4OKE A;  5LY3 A;  4IOC L;  4BRN A;  3I8D A;  4DSJ A;  5M1N A;  3TAG A;  1SXJ A;  3TE6 A;  5FSW A;  1JLE A;  3GL1 A;  4CF2 A;  3NH2 A;  4KHN A;  2QKK A;  2O25 A;  3QDK A;  4QOZ C;  4P17 A;  4ISE A;  2KZZ A;  2CV1 A;  2A1S A;  5FTJ A;  4CEC A;  3UE5 A;  4IEE A;  1WSG A;  2MR9 A;  4FJN A;  3PSI A;  3WXM B;  2WBN A;  4B9T A;  1NK7 A;  1C0G A;  3QAU A;  4JI7 M;  3GLH B;  1HUX A;  4CF9 A;  1SQK A;  5AQU A;  5DM6 L;  1Q7Y O;  4EHT A;  3OHR A;  4LRS A;  4E89 A;  2OPR A;  3ZET B;  1QVG M;  1SKW A;  5DK5 A;  3ENH A;  3ZSW A;  4DQR A;  1RU3 A;  4CIF A;  1N6Q A;  4CER A;  4HCC A;  4M7Y A;  4BDP A;  4EFH A;  4IBF A;  3HP6 A;  3AVI A;  3CJ1 A;  5AQS A;  2IGI A;  1KSF X;  2W82 A;  1L8Q A;  4M3Y A;  1QS4 A;  2UXD M;  4NO7 A;  3O6W A;  1C6V A;  3VGL A;  1Z5B A;  1L1Z A;  1TYQ B;  2YNI A;  1GKI A;  4AKG A;  2O8E A;  1RT7 A;  4OU7 A;  4CHP A;  3UKU A;  3NBP A;  1W5S A;  2ITM A;  1NKE A;  1NM1 A;  3MMP A;  1NNJ A;  3C7N B;  3EKS A;  4DR1 K;  4NXN K;  4U67 L;  3KS4 A;  1HKG A;  4FZY A;  1K8A O;  5KPZ A;  4G3O A;  1CXQ A;  1NGI A;  1T03 A;  4GC5 A;  2MRO B;  4K8X A;  3ZT0 A;  2FSN A;  4BDY A;  4CD1 A;  1WJ7 A;  3U9D A;  2UU9 M;  4WQ5 C;  2RPI A;  1K6Y A;  3GLF B;  1JKH A;  4Y0W A;  3MAQ A;  4AM6 A;  3FTF A;  2YHB A;  2FFJ A;  1NY6 A;  3MCP A;  3SNN A;  2UUB K;  3M6A A;  2G8K A;  4Y1C A;  4QHS A;  4KB1 A;  1J5O A;  1YT3 A;  3CCS N;  4LJ8 A;  1J53 A;  3L3V A;  2H5X A;  4YOX A;  3WNG A;  4N56 A;  2P9I A;  4CJK A;  1BQN A;  3WXI A;  2UUA K;  3O4N A;  1EWQ A;  1XC8 A;  4CED A;  5EQT A;  1X3N A;  4IDK A;  2HHH K;  3OA9 A;  1QQO A;  4LFC M;  4DR5 M;  1WBB A;  3VEY A;  5F1X A;  4M9S A;  4DV7 K;  3FRH A;  3CXC M;  3FYC A;  1XMO K;  3DFZ A;  3SUN A;  5KPR A;  2ETJ A;  1T3T A;  5AQF A;  4CFB A;  2ATQ A;  2DAI A;  4CIE A;  4HL4 A;  4JLH A;  1FW6 A;  1K8K B;  3FGU A;  1GLD G;  3HP9 A;  3QES A;  1LAV A;  3AA5 X;  4WCE L;  3QB0 A;  5JS1 A;  1RTI A;  1HNX K;  2Q0U A;  4IBC A;  3LM2 A;  1Z05 A;  5EU7 A;  3N4P A;  3KS8 A;  1PM5 A;  3J8A A;  2HOE A;  4DLE A;  3NBX X;  2X6S A;  5AQV A;  2VF7 A;  4WW0 A;  3PIP L;  2CGK A;  3TSU A;  3LZJ A;  2O8C A;  4WF9 L;  4CJ5 A;  3IUC A;  4PCZ A;  3AVG A;  3NDK A;  3KOZ E;  4NCA A;  3LVV A;  1TDH A;  1N32 K;  3MED A;  3HHY A;  1IQP A;  5IT9 S;  4Z0U A;  3UZU A;  3SBT A;  2JWS A;  1Y8G A;  1VSM A;  3BXW A;  4FO0 A;  2XZF A;  4CF0 A;  2OTL N;  2KW4 A;  1RTH A;  3JAM O;  4IBD A;  1QQW A;  3WT0 A;  4UN2 B;  4RF0 A;  4O0I A;  1BQM A;  3M7G A;  3QFU A;  4AQY K;  4CIZ A;  4CJT A;  5J1E A;  2XY6 A;  1WXQ A;  4DS5 A;  1NOZ A;  2P9L B;  3D0P A;  4N41 A;  2MGW A;  4LF4 K;  1HMV A;  4B9V A;  3SAR A;  1Z6R A;  2YNH A;  4FXD A;  1ZC6 A;  1VEJ A;  1WOQ A;  3CJB A;  2P9U A;  4CGJ A;  4KHU A;  1DTT A;  1HT1 E;  5MLC Q;  3MDQ A;  4JKC A;  4BE1 A;  4DQP A;  5M1P A;  5J2P A;  1WNS A;  3GP1 A;  5KQ8 A;  3T1H M;  2ZTC A;  2J7O A;  2D1K A;  4M41 A;  2VWB A;  4D82 A;  1XXH B;  3K92 A;  2F4V M;  1I94 K;  1TAU A;  3V6D A;  1Q81 O;  1GO5 A;  1R7R A;  4HLQ A;  3SMS A;  1BI4 A;  1IXS B;  3HRG A;  2QK9 A;  4C23 A;  3SHG B;  1BOT O;  2YNM D;  3J80 O;  5EXX A;  3D2E B;  5M1F A;  3PY8 A;  3WUH A;  3SFZ A;  2VGM A;  3KOX E;  3FTD A;  3WQT A;  2ASP A;  3C95 A;  3THV A;  2WZJ A;  2ZM6 M;  2E4L A;  1VQM N;  4OJR A;  1EKE A;  2JY5 A;  4GIT A;  2JP7 A;  3VF6 A;  5JMV A;  2XY7 A;  5ITU A;  3ULE A;  4FCV A;  3AOG A;  4DV0 M;  4EP4 A;  3U6E A;  3LP1 A;  5BRF A;  4FVM A;  1M90 O;  3HPO A;  4DCH A;  1TH3 A;  1XHX A;  3AVH A;  4LFA K;  4F9O A;  3QET A;  3ATU A;  3DXK B;  4KTQ A;  1GLE G;  5IRE B;  4DTO A;  2APL A;  3W0F A;  3BGR A;  4IG0 A;  2RGO A;  4AW4 A;  4RW8 A;  2PZS A;  4RTF D;  3ZYY X;  4AIL C;  5KTQ A;  4H5R A;  3I55 N;  4DV6 M;  4MM3 B;  1IO2 A;  1OJL A;  4BR2 A;  3CFO A;  3K57 A;  4BDZ A;  3KLE A;  3VFD A;  1VSD A;  3SQ1 A;  1RT1 A;  3NFA A;  4M45 A;  3CCJ N;  3SUO A;  5BR8 K;  4OKJ A;  4M3Z A;  3E9P A;  4KAZ A;  1K73 O;  1S1W A;  1SKR A;  2D0B A;  1KFV A;  4WQ5 A;  4DUY M;  5FPE A;  4FJK A;  3KJV A;  3T3F A;  1R2Y A;  3SQ2 A;  3MN5 A;  4DU4 A;  3THW B;  3E9L A;  4CJE A;  2C9O A;  2XLJ A;  5BPN A;  4IFE A;  4FWG A;  2E5L M;  2GEL A;  3CCQ N;  2FNA A;  3S3M A;  3CCV N; 
#chains in the Genus database with same CATH homology
 1HKC A;  3H6E A;  4FPB A;  1L2D A;  2Y20 A;  3TPZ A;  2Q36 A;  1IN8 A;  3EE8 A;  3ENO A;  5AQN A;  2FSK A;  5AQX A;  2QZ4 A;  3KP1 E;  5AFU H;  1ORY B;  3SAG A;  3HOS A;  3CCL N;  5AZI B;  1HNZ M;  1DGB A;  2UUC M;  4ILJ A;  4LJ6 A;  4MO5 A;  3H46 O;  4NXM M;  2FF6 A;  3GPY A;  4I6M A;  2KHO A;  4JK8 A;  2IVP A;  2M5Z A;  1SS6 A;  3VMF B;  4Z6Y A;  2QBY B;  2YHX A;  5C0Y A;  1LOT B;  3EIE A;  2EWS A;  2NNW A;  3NVK A;  3U60 A;  2X8A A;  1W2B M;  3O08 A;  2QCU A;  4BQL A;  3RSE B;  2XF3 A;  4QS8 A;  4R79 A;  2F5P A;  2E8A A;  3P38 A;  4JI0 M;  4JKB A;  4OX9 M;  2P9K A;  4KHP M;  3CJ7 A;  3D8L A;  3H45 C;  1L2B A;  4HTL A;  1E9S A;  3KVW A;  5F3W A;  3CF5 L;  1MA9 B;  3PFI A;  4FWM A;  5F2R A;  3ZH9 B;  3HI0 A;  4B3M M;  2KZS A;  4IJA A;  3KHY A;  1QZ6 A;  1G41 A;  3U61 B;  4BRQ A;  4YHH M;  2WFB A;  4L3Q A;  2W41 A;  3R8E A;  4LJ7 A;  2EO2 A;  3CPE A;  3W3D A;  1KQS M;  4JD2 B;  2HST A;  2CH6 A;  3C6A A;  4O5F A;  2A5Y B;  3HHW A;  4GIP A;  1N36 M;  3VEN A;  1HJO A;  3SAF A;  2CV2 A;  1ILY A;  1QAN A;  5JI3 E;  3GBT A;  4FCT A;  3THG A;  5IZ7 D;  2Y21 A;  4M0D A;  3C7N A;  3T38 A;  4FWD A;  1M1K O;  1HNX M;  4DR3 M;  1S3X A;  4I81 A;  1VQ7 N;  5M1K A;  3ZX2 A;  4L15 A;  2NRR A;  4BVP A;  1YSY A;  2G5G X;  1YI2 N;  2D7E A;  2RE2 A;  1I4W A;  1QVR A;  1IM2 A;  3PVS A;  2A6A A;  1U6Z A;  5ELZ A;  3ZEU B;  4BG9 A;  1NVM A;  2CFO A;  4H5V A;  3EL2 A;  3A5O C;  4M0W A;  1IXR C;  3K8Z A;  5AR0 A;  4OW0 A;  2FXU A;  3VF2 A;  3L27 A;  3BOS A;  1CZA N;  2ZGY A;  5JLH A;  2CE7 A;  4IJN A;  2NLX A;  4A5A A;  2NRX A;  2XSZ A;  1BDG A;  2HF3 A;  4RWT A;  1VQL N;  4LGM A;  2QEN A;  1BA1 A;  2VQF M;  3U6S A;  1IXZ A;  4KH5 A;  5M1Q A;  3HBT A;  4BRH A;  3O4W A;  3CI5 A;  2E88 A;  4B3T M;  1TDZ A;  4ILH A;  4WFA L;  4IBG A;  2F5N A;  3VEO A;  4AKH A;  3T7Z A;  1YIJ N;  1N75 A;  2P9N B;  1Z5C A;  3SAW A;  2QP9 X;  2V52 B;  1XWI A;  2ZAM A;  2P9L A;  3RGS A;  3FZH A;  2DWM A;  4H0V B;  4U7B A;  3VK8 A;  2Q97 A;  4E1J A;  4GMQ A;  1HT2 E;  4BB9 A;  2V1U A;  1ZAE A;  3K9K A;  2DHR A;  1XQS C;  1V4S A;  3MX2 A;  4G4O A;  5AQW A;  1Q18 A;  1Q86 O;  2I7N A;  3LQR A;  1XXH A;  2GTD A;  3VTI A;  2ZWH A;  1R6B X;  3GE1 A;  2F5Q A;  3SLC A;  1DGK N;  4JI6 M;  1G4A E;  1TUU A;  4CZM A;  4XGI A;  5KPT A;  3FTC A;  2QWR A;  2DWZ B;  2YFQ A;  3JAM S;  1NGB A;  4GV3 A;  3Q7B A;  2E2Q A;  2BJV A;  4DV5 M;  2PBD A;  1LCU A;  4BR4 A;  1NGG A;  5LMU M;  1N78 A;  5LMN M;  2GEM A;  3SMP A;  1BA0 A;  5EY4 A;  3UKR B;  3OW2 M;  4WYB A;  4FWQ A;  3SHF A;  4MO4 A;  1V4T A;  5H37 D;  1BG3 A;  5EVZ A;  3CC4 N;  5FTL A;  3HTV A;  3CME N;  3SAT A;  1VQ8 N;  3U8X A;  3HJ8 A;  4EHU A;  3U6M A;  1VQ6 N;  2Z4S A;  3FZL A;  4JYA M;  3KSX A;  3A5M C;  3HHZ A;  1NMD A;  3J80 S;  3ILK A;  1NNU C;  2OAN A;  5LJV A;  2V7Z A;  1QZ5 A;  3O8M A;  2R4E A;  3A45 A;  1NWK A;  4AM7 A;  5FTN A;  3FUW A;  5GIP A;  3KW6 A;  1ESV A;  5AZI A;  3CMA N;  1NGE A;  3LM9 A;  3QIC A;  3DA1 A;  2ASO A;  2HBJ A;  4CZF A;  1MU5 A;  3KFU G;  3LQQ A;  4EIW A;  2QBY A;  4DR6 M;  1HX1 A;  2R4J A;  2D4W A;  1RDU A;  2QTD A;  3CJ9 A;  1GL7 A;  1DKG D;  4LF5 M;  4QHT A;  3VKG A;  2P9P A;  4AG5 A;  2E2O A;  4JHD B;  4XBO A;  2O5R A;  3AL0 C;  1NY5 A;  2E2N A;  3P31 A;  1Q39 A;  2YJE A;  4CZG A;  3L0Q A;  3R8F A;  5CHI A;  3U6C A;  4BGB A;  3O80 A;  2CEA A;  3O1W A;  3AY9 A;  3C58 A;  2K47 A;  2LNH C;  4DR2 M;  2ZF5 O;  3ZX3 A;  1ZBS A;  2IIR A;  5BPL A;  1IY2 A;  3VGK A;  3TPQ A;  5EP1 A;  3U61 A;  1JR3 D;  3U6L A;  1HLU A;  3H1V X;  1RDW X;  1GVN A;  4FWP A;  3FUX A;  3VER A;  3SAH A;  3VGM A;  5JIC A;  3HZ6 A;  4H0X B;  4TUW A;  4JD2 A;  4H0P A;  4FSV A;  3H4M A;  3FZF A;  4FWL A;  3BEX A;  3AAP A;  2DXI A;  1VQ5 N;  4YDU C;  1QAQ A;  2QWM A;  5HL7 L;  3MWT A;  3EE9 A;  3FUV A;  1OVY A;  2GWJ A;  3H1Q A;  2XZU A;  4GY2 B;  5AQL A;  1Q82 O;  3E4R A;  1YIT N;  4G4N A;  2BNK A;  4Z94 A;  1W5T A;  5BRD A;  4GV9 A;  3FLC O;  3FUU A;  4RF1 A;  1X37 A;  4DV2 M;  1TH4 A;  4JEP A;  4CZH A;  1N33 M;  5AQZ A;  3KK7 A;  2GWK A;  2DPN A;  2KLA A;  4BGA A;  4D80 A;  4ZPX A;  3K9J A;  2F5S A;  3IDH A;  3ZEU A;  4X66 M;  3HJS A;  2Q1N A;  3L4I A;  3EKU A;  1NSF A;  4FPA A;  4BC2 A;  4LG2 A;  2RHK A;  3I4V A;  3LVW A;  2YCH A;  3CJC A;  5EXW A;  1HNW M;  3ZC7 B;  3VEV A;  1PJI A;  1VQK N;  1YJ9 N;  3KWG A;  1MX0 A;  2A40 A;  2LWX A;  4JKA A;  1IY0 A;  4QS9 A;  2EA0 A;  2UXC M;  4BR5 A;  2CUZ A;  4GV6 A;  3BP8 A;  1NHG C;  1QAO A;  4GKK M;  3ATV A;  4JI1 M;  1NGC A;  1PJJ A;  3NWL A;  3WXL A;  4DV4 M;  4B3S M;  2FSJ A;  2CHQ A;  5BPV A;  3BF3 A;  2J4R A;  4YY3 M;  4LY6 A;  2G8L A;  4MDB A;  1IBK M;  3GLI A;  4IO8 A;  2QWP A;  1EE8 A;  2YX6 A;  3UJN A;  5EXP A;  2C98 A;  4BLC A;  1FNN A;  4JN6 A;  2AP1 A;  4LZZ A;  3U9Z A;  1RFQ A;  2BH1 A;  3FE1 A;  4CZI A;  4H0Y B;  4GKJ M;  1TH2 A;  3FZK A;  2XFS A;  1XNQ M;  4K42 A;  4LF6 M;  3B8A X;  5C10 A;  4KH4 A;  4WQ4 C;  5I9E B;  3HKP A;  2HBK A;  4R3D A;  5ITR A;  5AQH A;  1KAX A;  1D2N A;  5KO3 A;  2F9T A;  3SBJ A;  1GLJ O;  1YUW A;  5EP2 A;  2W40 A;  3EO3 A;  5BPM A;  2R45 A;  1YJN N;  3FZM A;  3U5Z B;  3GO8 A;  4QS7 A;  4QNR A;  5F0X A;  2YR0 A;  4G4R A;  1MWM A;  3CC2 N;  1BWF O;  4YDU A;  3J7Z O;  4LRT A;  3VEZ A;  1NHW C;  4AI6 A;  4JKG B;  3H3N O;  3J7B A;  3SYK A;  2F7T A;  1QHA A;  5C18 A;  1IN4 A;  5AQT A;  5GAD P;  4CBX A;  2KRU A;  4L4U A;  4JV5 M;  1VQO N;  4KH6 A;  3PLA A;  3LDL A;  4OO1 J;  1T6C A;  4PL7 A;  4OPH A;  5AQM A;  4K0K M;  4YOU A;  3GQ5 A;  1T3V A;  2QPA A;  3AAQ A;  4FVU A;  4Z8X A;  3WHL A;  1KXP A;  5ITQ A;  2Q0R A;  3AAR A;  3CCM N;  2ZJR L;  3FD9 A;  4L16 A;  4PL8 A;  4MDA A;  3CIP A;  1E4G T;  2DWN A;  4DUZ M;  3UGJ A;  2C99 A;  1FJG M;  2NRV A;  1DGG A;  4B3R M;  3SK3 A;  1SXJ B;  2XGN A;  3CER A;  4PKG A;  5GIO A;  5FPN A;  1NLV A;  3T15 A;  4X64 M;  3KWI A;  5BRH A;  3QBW A;  4DR4 M;  3DAW A;  4JI4 M;  3HSC A;  3E66 A;  4IBB A;  1VQN N;  3SBG A;  4JHD A;  3GLH A;  3Q8X A;  2E20 A;  3LMM A;  4IEI A;  3GG4 A;  3KDS E;  3ZET A;  4H5W A;  3LL3 A;  4LF9 M;  4O8U A;  4LC9 B;  4GC9 A;  3W0L B;  3TWL A;  3CTW B;  1P90 A;  1TYQ A;  4WFB L;  1ZXO A;  4EAH D;  5DYG A;  5DYI A;  3WXK A;  4A59 A;  4IBJ A;  1N77 A;  2YHW A;  4WQ4 A;  3ID8 A;  1N34 M;  4MGY E;  5JVH L;  3T1Y M;  4YOV A;  1GL6 A;  1KAZ A;  1GLN A;  1SXJ D;  1GLF O;  5AZJ B;  3GLF A;  2HBM A;  4NRW A;  2NRH A;  1H6U A;  4O8K A;  1E94 E;  3AJI B;  2P9I B;  5GAE P;  1QAM A;  3TSQ A;  1GLL O;  4D81 A;  5AQJ A;  5AQQ A;  5E84 A;  5HOO A;  3QWL A;  4JKE A;  2WC9 A;  4JKF A;  3C6H A;  4YOW A;  4IJF A;  1J5E M;  1UM8 A;  5EXT A;  1K8K A;  3A5N C;  1VQ9 N;  3PNY A;  4BR7 A;  5AQP A;  5AQG A;  1NJF A;  2C96 A;  4LF7 M;  4IO9 L;  4BRF A;  3CF0 A;  3K2L A;  2AHM A;  2P5T A;  4II7 A;  5BRE A;  1GLB G;  4OPA A;  3VET A;  1GLA G;  3PXG A;  2CHG A;  1YUB A;  4IJE A;  4M63 C;  3AFH A;  1KYI A;  1IBL M;  1IY1 A;  3AGR A;  1C1K A;  2WUS A;  4BC4 A;  3HU2 A;  4PDG A;  1ATN A;  3R1X A;  3OBW A;  3DWL A;  2ZAO A;  4FOI A;  3M0E A;  1KC8 O;  5GKN A;  3FFK B;  1ATS A;  1JQJ C;  5EP4 A;  1T44 A;  3P39 A;  3HOT A;  1LV7 A;  5EX5 A;  3SYL A;  2Q31 A;  3I8B A;  4MH0 E;  4WFN L;  3GPP A;  4IZ9 A;  3CD6 N;  4BRK A;  4RNA A;  4IOA L;  2ERC A;  1XUP O;  2A41 A;  2F9W A;  4A3V B;  2L09 A;  2E1Z A;  3DJC A;  4JKH A;  4IBK A;  1HQY E;  5C2D A;  3D2E A;  4W5W A;  3WQU A;  4A57 A;  3TWK A;  1YE9 A;  4IBE A;  2D0O A;  3CCE N;  4B1Y B;  3KOY E;  3ULE B;  4DV1 M;  2CGL A;  4FWS A;  4JN4 A;  2CV0 A;  3JR5 A;  4BRO A;  3GQ3 A;  4GHA A;  4CD3 A;  3GRR A;  2E1Y A;  2LXE A;  2RGH A;  3J27 B;  3R9X B;  3R6M A;  4X65 M;  3DXK A;  3KP0 E;  4BRP A;  3GQ4 A;  3FKE A;  3B9P A;  3DLL L;  2H3G X;  4KBO A;  3CQY A;  2R46 A;  4CBU A;  3LDP A;  5IWA M;  2R62 A;  4GRI A;  3U5Z A;  1NBW A;  2NQ8 C;  3FUT A;  4YOT A;  1DGF A;  5BN9 A;  4AKI A;  4JKD A;  4DHY A;  4PKH A;  2V6Z M;  3J7A S;  1DO2 A;  2VGN A;  3IG8 A;  3A5L C;  4B9Q A;  3E1Y A;  2FLO A;  3NBI A;  4PD2 A;  4DB3 A;  1H1V A;  1K3W A;  7CAT A;  2R18 A;  1IN7 A;  3A46 A;  2GUP A;  3AOE A;  1G99 A;  3TTF A;  1ZQ9 A;  3TTC A;  4REZ A;  2NZT A;  5JVG L;  1EO1 A;  4FD2 A;  2C9C A;  2QXL A;  3CJA A;  3UK6 A;  4B1W B;  1NGH A;  3U6Q A;  4JK9 A;  3J2P B;  4BBA A;  4I6M B;  3QBX A;  4XH1 A;  3MCA B;  4PDI A;  4K43 A;  3U60 B;  2ASM A;  3MHV C;  3EN9 A;  3L2A A;  3L26 A;  3RSE A;  2VQE M;  4DQ8 A;  2P9K B;  4HWI A;  1DGH B;  2QEX N;  1VQ4 N;  2Q2E B;  4OVZ B;  4FWO A;  1X9J A;  1QVF M;  1HR0 M;  2VII A;  4UY8 O;  4L8R C;  3LDO A;  4PKI A;  4LJ9 A;  3M5R A;  4FCW A;  3VDP A;  1J09 A;  4BQZ A;  1IG8 A;  3NMU A;  3R9P A;  4QOS A;  4BRA A;  4PT5 A;  3VEX A;  4FWN A;  3F2K A;  1NGJ A;  4XEI A;  3CHW A;  4DR7 M;  4LJA A;  4XH4 A;  4IOX A;  5FTK A;  2R65 A;  2A42 A;  4X62 M;  1X3M A;  2XEP A;  4YOR A;  2DVW B;  1NGA A;  3D6R A;  4GHL A;  3BF1 A;  5CE3 A;  3RGP A;  3W0L A;  3MN9 A;  3SAV A;  4LGY A;  4KLN A;  3G25 A;  3L6Q A;  4K41 A;  3MN6 A;  4M7X A;  4ITQ A;  3L28 A;  1QQM A;  2PAV A;  4MLE A;  3A42 A;  3CF6 E;  4JI2 M;  1S72 N;  3QFP A;  2OQ4 A;  8CAT A;  1NJI O;  4I5S A;  4AG6 A;  2V1C A;  3MX5 A;  2AA4 A;  3GDQ A;  3MWP A;  3VKH A;  4AZF A;  2YHY A;  3KSJ A;  5EXS A;  5AZJ A;  4CIS A;  4KO8 A;  4H5T A;  4B1U B;  3I51 A;  1QYR A;  3S41 A;  2YI1 A;  1IJJ A;  4FW9 A;  4LJ5 A;  4MGI E;  1O13 A;  4BVO A;  4LFB M;  2D0P A;  5H1S Q;  4BR0 A;  5DNY A;  2YJF A;  3SC3 A;  3RE8 A;  5C1B A;  3Q7C A;  5ADX A;  3VEW A;  1QQN A;  3O5B A;  4YOY A;  1NGF A;  1XMQ M;  3D8B A;  2LH0 A;  3HGI A;  3M6G A;  2A3Z A;  5LJW A;  3GRY A;  3IG5 A;  4H0T B;  1W97 L;  4A62 A;  2ZGZ A;  3CQX A;  4BC5 A;  3GLG B;  2F5O A;  1VQP N;  5AQY A;  4MGH A;  2QWQ A;  3IMX A;  2J7N A;  1DT9 A;  3D2F B;  3VOV A;  1EQY A;  3ENB A;  5ADX H;  3UMM A;  5CR4 A;  4NSR A;  2DZN B;  1MDU B;  1XC3 A;  2Z3X A;  4LJ4 A;  1YHQ N;  2FOI C;  3DXM B;  4BRD A;  3A98 B;  4IXC A;  5ITT A;  2P9S B;  3KXE C;  1G8P A;  4RCH A;  1MWK A;  2P9N A;  4K25 A;  3TL4 X;  4CGY B;  2Q2R A;  1YF5 L;  4XH5 A;  2UYT A;  1YAG A;  3MMV A;  2BJW A;  5FPM A;  2GX9 A;  3KOW E;  3WEE B;  1YVN A;  3HU3 A;  3N4Q A;  5M1O A;  2ZBK B;  4DV3 M;  2XFT A;  4MLH A;  2XH9 A;  2XSZ D;  4NL4 H;  2NRZ A;  3F5T A;  5C12 A;  2JA2 A;  3IKM A;  3EIH A;  3GRV A;  4H5N A;  3O9S A;  4IDH A;  4B1X B;  4JI8 M;  2QI2 A;  4I4L A;  1IBM M;  2VCP A;  4CI6 A;  4J8F A;  5EOY A;  3E9S A;  4S12 A;  4G6Z A;  5BR9 A;  4JI5 M;  1JCE A;  1L1T A;  2E2P A;  3UKR A;  3IFR A;  3L4Q A;  2HBL A;  4QNM A;  3U6O A;  5TKW A;  2VYP A;  2QWL A;  3NVM A;  4B1V A;  3G6E N;  2HCB A;  4NLC A;  4BG8 A;  1YJW N;  3OTO M;  5AFU A;  1U2V B;  5AQR A;  3VDU A;  2JWK A;  4H03 B;  3D7E O;  3GPX A;  1NGD A;  4L78 A;  3M3Z A;  3AV0 A;  3WXJ A;  4LF8 M;  3FYD A;  1HPM A;  1ATR A;  4IIW A;  3J81 S;  3TU5 A;  4B7H A;  5A2Q S;  3I4Y A;  1K82 A;  1JR3 A;  2D7G A;  3BUZ B;  4NB4 A;  1Z6T A;  1E4F T;  1TUY A;  2FF3 B;  2ZJQ L;  4LCB A;  2Z7J A;  4JXJ A;  4BR9 A;  1YXQ A;  1RGI A;  1JCG A;  3VF4 A;  4JNE A;  4P16 A;  3DZD A;  3JR4 A;  2CH5 A;  4NRV A;  2NRW A;  4KOD A;  5DM7 L;  3UB5 A;  4GH9 A;  3HHX A;  2P9P B;  3ZCB B;  2Z4R A;  3TSP A;  1TGU A;  3O9T A;  5GIN A;  5E26 A;  1SAZ A;  1DGH A;  4G4Q A;  4OVZ A;  3VPZ A;  4DR1 M;  4M9Z A;  4NXN M;  5JI2 E;  1KAY A;  5ITY A;  4PHT X;  2X49 A;  2L7H A;  2HKJ A;  3CPW M;  3MK6 A;  2KRK A;  3O1B A;  3M1F A;  2KA6 B;  4B7F A;  1J7K A;  4BRG A;  3U6D A;  3CET A;  2KW0 A;  2C5R A;  5C15 A;  4CZE A;  3O9U A;  4A2B A;  3I56 N;  3GPU A;  1OFH A;  1P8Z A;  3UKU B;  4WUR A;  2UUB M;  4GNI A;  5FLX S;  4AF1 A;  1JCF A;  1K9M O;  2I7P A;  1IN5 A;  5JLF A;  4B08 A;  2UUA M;  1WUA A;  5EP3 A;  2HHH M;  4FL9 A;  3R3L A;  4NOO B;  4DV7 M;  1XMO M;  1S22 A;  4I8O A;  3TWM A;  4BRI A;  1E32 A;  3A8Y A;  2YQZ A;  5AQK A;  3SJH A;  5FTM A;  1Q3C A;  4NLB A;  1G59 A;  2EUC A;  4JI3 M;  2V51 B;  2KXE A;  1HKB A;  1KD1 O;  3E9O A;  2JWL A;  2BTF A;  3AOE C;  3K1J A;  2KKZ A;  4FWH A;  4CHT B;  1N32 M;  3PNV A;  4GVE A;  5C2F A;  5KQD A;  3U6P A;  5EJC A;  4DKW A;  2ZJP L;  3TQS A;  3L25 A;  2PFU A;  4AQY M;  1C0F A;  4H0O A;  4B7G A;  4LF4 M;  3MN7 A;  1HQC A;  3TTD A;  4B1Z A;  3HU1 A;  2L7I A;  2QW9 A;  3A0I X;  1OFI A;  3JS6 A;  1D4X A;  1SXJ C;  3KZB A;  4A2A A;  5B8H A;  1I94 M;  5BN8 A;  3GLG A;  1R2Z A;  3GOI A;  3L29 A;  3D2F A;  2CHV A;  3C0B A;  1DO0 A;  3FTE A;  4IBI A;  2RKO A;  2Y0T A;  4JK7 A;  2NRT A;  4MB7 A;  2P9U B;  4CBW A;  3U4L A;  2HMP A;  3HM8 A;  1S3S A;  3T69 A;  2V7Y A;  4MGZ E;  3G4S N;  3LDQ A;  4BRL A;  5E6J A;  3DXM A;  4A61 A;  3DOA A;  3PIO L;  3KVG A;  4CJ7 A;  2BUP A;  2P9S A;  4BRM A;  3P4I A;  2M60 A;  3GLI B;  1BU6 O;  3QML A;  1Z59 A;  2QA4 N;  2Y0Q A;  2HF4 A;  4LFA M;  1DEJ A;  2H1R A;  2QWN A;  4ILG B;  1G3I A;  3HJQ A;  1VAZ A;  3WHK A;  5ITX E;  2QM1 A;  2HL7 A;  3I33 A;  3CF2 A;  3GRU A;  2X4A A;  4JAX A;  3VK7 A;  3O9R A;  3WEE A;  4CZK A;  2IVO A;  4ISF A;  5BR8 M;  4CZL A;  2ZAN A;  4R7G A;  1J6Z A;  4G9Z A;  4FOE A;  3RFW A;  1K3X A;  4FWR A;  3EZW A;  1T6D A;  2A5X A;  4C1N K;  2KZU A;  3G71 N;  4BRE A;  3CCU N;  4EIA A;  1JJ2 M;  2DWL A;  2OPF A;  2L6O A;  4BRC A;  3OBY A;  1R59 O;  3LDN A;  3VTH A;  4A5B A;  3ID6 A;  2FE8 A;  3MJ5 A;  3SAS A;  1NJG A;  4C1N I;  1E9R A;  1QZM A;  2DZO B;  3VLF B;  3JXU A;  3VES A;  3O9Q A;  5AQI A;  3SAU A;  3F9M A;  4LZJ A;  5ITX A;  5TKY A;  2QWO A;  4BY9 C;  1XNR M;  4JKG A;  3AGK A;  1Y64 A;  5AQO A;  1SXJ E;  3H3O B;  3RVC A;  1N8R O;  1BO5 O;  3HWS A;  3ZX0 A;  3C65 A;  4NSO B;  4FWK A;  5FPD A;  3CC7 N;  3AKZ A;  1U2V A;  1GLC G;  2IVN A;  4M9X A;  1VDD A;  4IWV A;  4CZJ A;  4MGK E;  1Z5A A;  2D7H A;  2CGJ A;  1XHB A;  1SZ2 A;  5GAH P;  2UXB M;  5GAG P;  1BUP A;  1L2C A;  4BC3 A;  1OKJ A;  1Q3B A;  1IN6 A;  4ISG A;  2KEB A;  3FR0 A;  2OTJ N;  3CCR N;  5LY3 A;  4IOC L;  4BRN A;  5M1N A;  1SXJ A;  3TE6 A;  5FSW A;  3GL1 A;  3QDK A;  4QOZ C;  4ISE A;  2CV1 A;  5FTJ A;  3UE5 A;  4IEE A;  3WXM B;  2WBN A;  1C0G A;  3QAU A;  4JI7 M;  3GLH B;  1HUX A;  1SQK A;  5AQU A;  5DM6 L;  1Q7Y O;  4EHT A;  3OHR A;  4LRS A;  3ZET B;  1QVG M;  3ENH A;  4M7Y A;  4EFH A;  4IBF A;  3CJ1 A;  5AQS A;  1KSF X;  2W82 A;  1L8Q A;  2UXD M;  4NO7 A;  3O6W A;  3VGL A;  1Z5B A;  1L1Z A;  1TYQ B;  1GKI A;  4AKG A;  4OU7 A;  3UKU A;  1W5S A;  2ITM A;  1NM1 A;  1NNJ A;  3C7N B;  3EKS A;  4U67 L;  3KS4 A;  1HKG A;  1K8A O;  5KPZ A;  1NGI A;  4GC5 A;  2FSN A;  4CD1 A;  3U9D A;  2UU9 M;  4WQ5 C;  3GLF B;  4Y0W A;  4AM6 A;  3FTF A;  2FFJ A;  1NY6 A;  3MCP A;  3M6A A;  4QHS A;  3CCS N;  4LJ8 A;  4YOX A;  2P9I A;  3WXI A;  1XC8 A;  5EQT A;  1X3N A;  3OA9 A;  1QQO A;  4LFC M;  4DR5 M;  3VEY A;  5F1X A;  4M9S A;  3CXC M;  3FYC A;  3DFZ A;  5KPR A;  1T3T A;  5AQF A;  4HL4 A;  1K8K B;  3FGU A;  1GLD G;  4WCE L;  3QB0 A;  2Q0U A;  4IBC A;  3LM2 A;  1Z05 A;  3N4P A;  3KS8 A;  1PM5 A;  3J8A A;  2HOE A;  5AQV A;  4WW0 A;  3PIP L;  2CGK A;  3TSU A;  4WF9 L;  3IUC A;  4PCZ A;  3KOZ E;  3LVV A;  1TDH A;  3HHY A;  1IQP A;  5IT9 S;  3UZU A;  3SBT A;  4FO0 A;  2XZF A;  2OTL N;  4IBD A;  1QQW A;  3WT0 A;  4RF0 A;  3QFU A;  3M7G A;  1WXQ A;  2P9L B;  3SAR A;  1Z6R A;  1ZC6 A;  1WOQ A;  3CJB A;  2P9U A;  1HT1 E;  5MLC Q;  3MDQ A;  4JKC A;  5M1P A;  3GP1 A;  5KQ8 A;  3T1H M;  2J7O A;  2D1K A;  2VWB A;  4D82 A;  1XXH B;  3K92 A;  2F4V M;  1Q81 O;  1R7R A;  4HLQ A;  3SMS A;  1IXS B;  3HRG A;  4C23 A;  3SHG B;  1BOT O;  2YNM D;  5EXX A;  3D2E B;  5M1F A;  3WUH A;  3SFZ A;  2VGM A;  3KOX E;  3FTD A;  3WQT A;  2ASP A;  2ZM6 M;  1VQM N;  3VF6 A;  4GIT A;  5JMV A;  5ITU A;  3ULE A;  4FCV A;  3AOG A;  4DV0 M;  3U6E A;  5BRF A;  4FVM A;  1M90 O;  4DCH A;  1TH3 A;  4F9O A;  3ATU A;  3DXK B;  1GLE G;  5IRE B;  3W0F A;  2RGO A;  4AW4 A;  4RTF D;  3ZYY X;  4H5R A;  3I55 N;  4DV6 M;  4MM3 B;  1OJL A;  4BR2 A;  3VFD A;  3CCJ N;  3E9P A;  1K73 O;  1KFV A;  4WQ5 A;  4DUY M;  5FPE A;  1R2Y A;  3MN5 A;  3E9L A;  2C9O A;  2XLJ A;  5BPN A;  4IFE A;  4FWG A;  2E5L M;  2GEL A;  3CCQ N;  2FNA A;  3CCV N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...