2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
b'FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase 1
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
1RFQA 4QS9A 3H6EA 3HSCA 1T6DA 5KQ8A 1BU6O 4A62A 4FWQA 3FR0A 2QM1A 2NZTA 2F9WA 2NLXA 1BA1A 1OKJA 4K25A 5AQKA 5AQJA 2QWNA 5BN8A 2CGJA 2E2QA 2E1ZA 1RDWX 4CZKA 2YHWA 5TKYA 2QXLA 4DCHA 2A42A 4XEIA 2P9IB 4PKGA 2IIRA 3FLCO 3FZHA 3VGLA 1HKBA 2AA4A 3VEZA 4FWNA 4BGBA 3C7NB 4HTLA 1IJJA 2J4RA 2Q0RA 4EIAA 4AM7A 3WQUA 4BR5A 1HUXA 1NGHA 1GLFO 2HOEA 3LDNA 3C0BA 4QS7A 3O4WA 3ULEB 4A2AA 1BOTO 3ZX0A 3DXMA 5KPZA 3H1QA 3D2EB 2AP1A 4WYBA 3VGKA 4FWMA 3H3OB 3CHWA 3IDHA 2D0PA 1TUYA 3LDLA 3AARA 5LJWA 1MWMA 4GY2B 2FSNA 2YJEA 3CJCA 3FZLA 1Z05A 5AFUA 5JLHA 5BRHA 3S41A 1NGBA 2CH5A 4H0YB 1TYQB 4BVOA 2GWJA 4CZFA 3LDPA 3M1FA 1NBWA 3DJCA 4CBXA 1JCFA 5AQTA 4JN4A 4XH5A 3O1WA 5KPRA 3SK3A 1NGFA 1KAZA 4F9OA 3CQYA 2E2NA 3A5MC 4MLEA 3A8YA 5KPTA 4EFHA 2D1KA 3EO3A 3CJAA 3L6QA 4IXCA 2YCHA 4K42A 4CI6A 4JD2A 2QWMA 3FZKA 3GDQA 3SMSA 1MDUB 1S22A 4H5TA 5AQPA 1NGCA 4BRHA 2QWOA 2FSJA 2E20A 2E88A 3LM2A 3RSEA 3H3NO 4YDUA 1XUPO 2HF4A 3LM9A 1BO5O 3MMVA 1SQKA 2A41A 1QQOA 4H0VB 4NB4A 2A6AA 2A5XA 4YDUC 4BRPA 1BA0A 3H46O 5AQVA 2Q0UA 4L3QA 4H5RA 3LL3A 4BR0A 2A3ZA 2CH6A 1HKGA 2GWKA 4CZLA 4CZJA 3DXMB 1G99A 2GELA 4CBWA 3CJ9A 2D4WA 2VCPA 1XC3A 5E84A 3ID8A 3EZWA 3WXJA 4IZ9A 2H3GX 3WUHA 1NGDA 3M6GA 3GG4A 3R8EA 3ENHA 3H45C 4WQ4A 4H0TB 2ZGYA 3BF3A 3ZETA 1QZ5A 1MA9B 2ZF5O 5FPNA 3TPQA 5F0XA 4CZIA 4WQ4C 4JHDA 2CGLA 2PBDA 4MO5A 5AQMA 1ATSA 3D2FA 4H0XB 1X3NA 3UKUA 1GLCG 4BQLA 5B8HA 4H5WA 3JS6A 3TU5A 2Q2RA 4B1UB 4A2BA 1QQNA 3QICA 4XH4A 1C0FA 3A5LC 4JD2B 5AQWA 1U6ZA 4CZEA 3MN6A 4BR9A 3U8XA 2Q36A 3VF2A 3ZX3A 4GNIA 4CD3A 1BUPA 3O5BA 4XH1A 3RSEB 2ZGZA 2FLOA 3FZMA 4IWVA 1LOTB 3HM8A 3AY9A 3OHRA 4B1ZA 4BRIA 1HKCA 2IVNA 5CE3A 5BPLA 5AQUA 5AQSA 1J6ZA 1R59O 4A61A 2P9SA 3O08A 5AQGA 3VF6A 1NGJA 3LDQA 1ZXOA 4DB3A 1U2VA 3MDQA 2Q1NA 4FPBA 3A0IX 3F9MA 4H03B 4AM6A 3DXKA 3KVGA 3WXIA 3ATUA 2P9PA 2P9KA 4BR2A 1YAGA 3UE5A 5AQHA 4B9QA 3MK6A 3FFKB 5BN9A 3KZBA 4FWRA 2V52B 4BRNA 5EY4A 4FL9A 4I6MB 3IMXA 3CETA 3L4IA 3QBWA 4JAXA 3VETA 4BR7A 1HLUA 4H0OA 1Q18A 1V4SA 1ZBSA 4IJNA 5BPMA 3EKSA 4H5NA 3ZETB 2ASOA 1QZ6A 3HTVA 3B8AX 3QDKA 3J8AA 1SZ2A 5FPMA 3H1VX 3R9PA 4H0PA 3GOIA 2FXUA 4CBUA 4JHDB 3DAWA 1SAZA 4BC3A 3EL2A 5LY3A 5AQLA 4IO8A 2GTDA 3VEXA 3D2FB 3U4LA 3UKUB 3WT0A 4MLHA 1NGIA 4E1JA 1S3XA 1KAYA 2E2PA 2ZWHA 5EVZA 4BRLA 3BF1A 4ISEA 1BDGA 2V7YA 5FPEA 3VPZA 4BG8A 3CI5A 5AQYA 3U9ZA 4EHTA 4K43A 2WUSA 1GLBG 3QFPA 2W41A 1JCEA 1D4XA 1BWFO 4KBOA 4BREA 5AZIA 3UB5A 4BROA 5BREA 3AAQA 4FPAA 2BTFA 3GE1A 1LCUA 3IUCA 1NGEA 4WQ5A 2YJFA 2P9UA 2ASMA 3KHYA 5BPNA 4BC4A 2YHXA 1X9JA 3ATVA 3U9DA 1V4TA 2P9SB 2I7NA 1NGAA 2Q31A 1U2VB 2V51B 4PKHA 5AQIA 3SJHA 4RWTA 3VEYA 2W40A 2YI1A 3JXUA 3DXKB 1ATRA 3I33A 3BP8A 1GLAG 4RCHA 4EAHD 3WXKA 2F9TA 2P9KB 2P9PB 4PL8A 3UKRA 5AZJA 3HI0A 1HJOA 4B1YB 2I7PA 3WEEA 3VESA 4C23A 5ADXH 2P9LA 5LJVA 2GEMA 2QWLA 4M63C 4MO4A 1XQSC 4PKIA 1MWKA 4B1WB 4CZHA 2EWSA 3VEOA 2PAVA 5AQOA 3CJBA 4BGAA 3FZFA 3HBTA 3MN7A 4FWPA 4CD1A 5BRDA 2FF3B 5ELZA 1GLJO 3DWLA 3G25A 4CJ7A 3ZEUA 4FWSA 4O8KA 3FE1A 5JMVA 4BQZA 1KXPA 4NO7A 4BR4A 1T44A 2BUPA 1H1VA 1YXQA 4FWOA 5JICA 4FOEA 4M7YA 1GLLO 3WXLA 2HMPA 1P8ZA 1ZC6A 1K8KA 2CGKA 3M3ZA 3O80A 3EKUA 5KQDA 3O8MA 2E1YA 1RGIA 4O5FA 4QS8A 4BRAA 5AZIB 5I9EB 4FWKA 5F2RA 3ENOA 1T6CA 2VYPA 3A5OC 1HPMA 2P9UB 3QFUA 1NM1A 5JLFA 4BRCA 4DQ8A 4CZGA 1ATNA 2V7ZA 3SLCA 4JNEA 2VWBA 1E4GT 3EN9A 3BEXA 2P9NA 4ISGA 4J8FA 3AAPA 4RTFD 5EOYA 2Q97A 4BRGA 5AQXA 1HX1A 5F1XA 3VF4A 3GBTA 1GLEG 3P4IA 2QW9A 1NLVA 3CERA 5AFUH 4B1VA 3UKRB 5AZJB 4BRMA 4EHUA 5AR0A 1DGKN 4Z94A 2QWPA 2FSKA 3HZ6A 3WEEB 4FSVA 2A40A 2IVPA 3A5NC 4PL7A 2P9LB 3MN9A 3I8BA 2HF3A 4B1XB 4HWIA 1QQMA 5BRFA 3W0LA 5AQQA 3VEVA 4CZMA 1X3MA 1DKGD 3FGUA 2YHYA 1NMDA 3CJ1A 3W3DA 3O6WA 2QWRA 4BG9A 1NWKA 3BUZB 2OANA 4FWLA 2IVOA 3ZEUB 3SMPA 1Y64A 5AQNA 5AQZA 5FPDA 4DHYA 1QHAA 2E8AA 4M7XA 3VOVA 3D7EO 4BVPA 2P9IA 1KAXA 4BC2A 3CIPA 1C0GA 1CZAN 1YUWA 2ITMA 1K8KB 3C7NA 2DPNA 3VERA 1DEJA 1TUUA 4LC9B 4IJAA 1NGGA 3IFRA 3MN5A 1YVNA 5AQFA 5E26A 4WQ5C 1WUAA 2UYTA 3CQXA 2QWQA 3ULEA 3VEWA 4BRFA 5AQRA 1JCGA 4FO0A 3ZX2A 3QMLA 2D0OA 1E4FT 2GUPA 3D2EA 3O1BA 5EX5A 2FF6A 1GLDG 1ESVA 1EQYA 2P9NB 3GL1A 3R6MA 5EXWA 1IG8A 3QB0A 4BRKA 3QBXA 4H5VA 2E2OA 4K41A 3VENA 2NRHA 1WOQA 5BR9A 2KHOA 2ASPA 1TYQA 3MCPA 3CJ7A 4ISFA 1BG3A 1Z6RA 3L0QA 4BRQA 5ADXA 4BRDA 4Y0WA 4BC5A 4FOIA 4I6MA 3VGMA 3LDOA 3WQTA
chains in the Genus database with same CATH superfamily
4DR6K 4DS5A 4JI7M 2UUBK 2D0CA 5KI6A 3G71N 1T6DA 1RT6A 1BIZA 3OY9A 1BU6O 4FWQA 2QM1A 2NZTA 2FBYA 4B7GA 2NLXA 4DV6K 2KNZA 4AW4A 3TAGA 3NVMA 4CF1A 1G71A 5AQKA 2B3TA 3KKRA 4GC9A 4AHUA 5BN8A 2E2QA 4LF7M 1NJFA 3BOSA 1OFIA 2KNAA 4CZKA 3JYTA 2LH0A 4CGGA 5EXSA 2QXLA 4KO0A 3I0SA 3ZT0A 1VQ4N 4AZFA 1VQ1A 1I94M 2C9CA 1HKBA 1GOCA 3SYKA 3ZCBB 1WBBA 4A59A 3C7NB 4FVUA 3OYDA 5HRPA 3K1JA 2ZJRL 1EFUB 1Y8GA 1C1BA 2ITGA 4F3TA 1HNWM 5LMNM 1TGOA 1HUXA 2HW3A 4I4LA 4I81A 2XFSA 3LDNA 5BPVA 3VQDA 5L8RF 5CR4A 4NL4H 3L27A 4A2AA 4N47A 3KLEA 3KLGA 3DXMA 5KPZA 4WE1A 3U6LA 4Y1CA 4FWMA 1T8EA 4IBJA 4OPJA 2KRKA 3SC3A 3SQ0A 4PCZA 1NNJA 1F4IA 5M1OA 3ITHA 5LJWA 4G4QA 4RNAA 3FZLA 5J1EA 1Z05A 4DWIA 3BZCA 3RGPA 4HEOA 3U61A 1D2NA 2GWJA 2JA2A 2WFBA 3M1FA 4ILJA 3HOTA 2ZJPL 3WNGA 4CBXA 4L8RC 2HHQA 1KFDA 4CHYA 2W82A 5KPRA 2A1SA 4N41A 1YTUA 1VSFA 4BB9A 4N56A 1QDTA 3UK6A 5DMRA 3CQYA 2E2NA 4NXNK 4YOWA 5FRMA 3LANA 3A8YA 2X8AA 2QHOB 2D1KA 3CJAA 3EE9A 3EO3A 3KXEC 3L6QA 5J2QA 4B9TA 3IKMA 4IXCA 4CGDA 1NHWC 3KWIA 2G8UA 4CGYB 1IBKM 3VK7A 4DUYM 2HAKA 1GL7A 3GDQA 4GIPA 4LF5M 4BDYA 4BE1A 3SMSA 2UUAM 4M3TA 2KFNA 4FJ8A 1S22A 4H5TA 4NSOB 3K2PA 1NGCA 4KTWA 3N4QA 4WURA 1R6BX 2FSJA 2E20A 1WBDA 4ZTJA 4DQSA 2JXNA 3RSEA 3HHYA 4YDUA 3QINA 2OPSA 2Y20A 3HWSA 1XUPO 4MGHA 1BO5O 3HRGA 3OYHA 1VDDA 4H0VB 4NB4A 4HUGA 4HUFA 1YUBA 4YDUC 4BRPA 1EE8A 2RRUA 3LP1A 3LP0A 8CATA 4IBBA 3O3GA 1R4GA 4H5RA 4DV2K 3V81A 3W68A 4M3XA 3LL3A 1TTEA 2GBZA 4M3UA 2GWKA 1HKGA 3KVWA 2IAJA 2NRVA 1L3SA 3VQPA 3CJ9A 4F2LA 3FFIA 1QTMA 4K8XA 1XWLA 2KNVA 4B3SK 1YJ9N 4RF0A 4AHCA 3CXCM 2KQ2A 4F1IA 3OYLA 3TABA 3GRVA 3HU2A 3DRPA 4CFBA 3VQAA 3QEWA 2F8SA 5C42A 1BL3A 4GHLA 3AA4A 2LWXA 4GKJM 5FPNA 1QUTA 2JY6B 3PNVA 5EXTA 4OPHA 5HROA 1KSPA 2C9OA 3AJIB 1KRPA 4IDHA 4LFAK 3QEPA 1TV6A 2QZ4A 3RMAA 3M8RA 4JEPA 3UKUA 4JYAK 4BQLA 1F21A 3KOWE 2UXDM 3TU5A 1TKXA 4KODA 3GLIE 4CVNE 1HR0M 2DHYA 4O0IA 3HJ8A 2CHGA 1BCOA 3MN6A 4Q5VA 3CCSN 3AVKA 4JI2K 3QEVA 4PY5A 3QAUA 4DR2K 1NSFA 2YNMD 3JR4A 1VEGA 3T15A 5EP2A 4W5WA 1GL6A 3TAMA 1BUPA 4GRIA 1E9RA 3FUWA 3O5BA 3WXMB 4LJ9A 3HY5A 3ZH9B 3LP3A 1KLNA 3QYBA 3HHWA 1NK6A 3HM8A 3AY9A 2QCUA 4R79A 4IOXA 4LY7A 4IEEA 4ICLA 4BY9C 4JK9A 4JI1M 4KAZA 4LH5A 1WJ7A 5ITXE 3SARA 3VF6A 4B9SA 4GEWA 1NGJA 4L4UA 3LDQA 1ZXOA 3CPEA 4YFUA 1TAUA 4KHSA 3U3GA 2OPQA 2VWJA 5FLXO 1OAIA 3VQ6A 1TKTA 1DGFA 4DF4A 1HRHA 3OS2A 3KVGA 2WSCF 4BE2A 1HQYE 3DRSA 1NK8A 2O4IA 2YR0A 2J5YA 3L2RA 2DTUA 1NJYA 1YAGA 3HVTA 3PX0A 4E7IA 4FK4A 3K0SA 2OPPA 1N75A 2V52B 5C10A 4FL9A 1TK5A 1FJGK 2DZLA 2FBVA 1VSEA 4BR7A 3VETA 3PY8A 1Q18A 1N32K 5BPMA 3EKSA 1ZBHA 3HO1A 2G8KA 2F5QA 3KS8A 3L4QA 3KWGA 5F3WA 2V1UA 4R71A 4CBUA 4LFCK 1VQ7N 3J80S 3OYEA 4NOOB 1NK9A 2LVQD 4KI6A 4JXJA 3J7YP 2C98A 3WT0A 4X66M 1ZMWA 3EE8A 4DR5K 2XY5A 4E1JA 1J7KA 2WOMA 1S3XA 5EVZA 3NBXX 2JUJA 3QWLA 3NMUA 3IAYA 1BDGA 2X49A 2YNIA 3ZSZA 4F3OA 3FTFA 1R0AA 3HU1A 1S1UA 4JK7A 4KH5A 3U9ZA 3HU3A 1O1WA 2WUSA 1N34M 1NMNA 1VQLN 2ZE2A 3PXGA 3E46A 3NF9A 3CC4N 3DM2A 3M7GA 3GLIB 2CV1A 3A98B 4A5BA 4BROA 3AAQA 2BTFA 1LCUA 4JLHA 1NY6A 3J7AS 2P9UA 4JRQA 4CEFA 1YLAA 3ATVA 5M1QA 5MLCQ 2F5OA 1B92A 1C1AA 4O44A 2R0IA 4RWTA 4WFNL 1TH2A 4QOZB 2ERCA 2QKKA 2BWBA 3U6OA 3I33A 3P1GA 3SZ2A 2MROB 4M45A 4RCHA 4FWDA 2MGWA 2HHXA 5DYIA 2VQFK 1QHTA 2E6LA 1NNUC 1X9WA 5AZJA 3SUNA 2LVPC 4OVZB 3I51A 3THXB 4KHPM 5HRRA 4HCCA 3U6DA 4JI8M 5FTNA 4C23A 3OYNA 1TL3A 1LV5A 2YQZA 3VKGA 1RTDA 2P9LA 3K9PA 3NCIA 1Q9YA 5KTQA 3SASA 2GEMA 2H5XA 1XWIA 4M63C 3D0PA 5EQTA 1RBUA 4PKIA 1D0LA 2OOBA 3U6PA 3ZSRA 4CZHA 5D3GA 1E32A 1BHLA 1RBTA 3CJBA 4DV3K 3RRHA 3FZFA 3HBTA 3RFWA 3MN7A 2CUZA 4BDZA 5BRDA 2FF3B 1Q81O 1IY2A 1GLJO 3DWLA 3K9JA 3UMMA 4O8KA 4CGJA 3FE1A 4KB0A 1QE1A 3H4MA 1JL1A 1KXPA 4R3DA 2WTUA 3ZT4A 4NO7A 1XNRM 1T44A 3E01A 1WAJA 4RW7A 1NJZA 2L7HA 1L5UA 1H1VA 4CEOA 2OZMA 3RWUA 4FJ5A 4FOEA 3NWLA 3WXLA 4KO8A 1VEKA 2KKZA 1K8KA 2CGKA 3O80A 1RT3A 1HT2E 3EKUA 1D5AA 3DLHA 2FNAA 3I04M 1GO5A 4CEQA 3CYMA 4AQYK 2NRRA 3GLHB 4OJRA 1N6QA 1REVA 4LCBA 4X65M 4QS8A 2Z1HA 4JKAA 5AZIB 4BRAA 5FTLA 4AH9A 4CJ6A 3KK7A 3GRUA 1XNQM 3ENOA 3MCAB 1Q7YO 2QBYA 4PDGA 1PJIA 3CF6E 4JKEA 3Q8XA 4KH4A 1VSMA 4DV1M 1BI4B 1TH4A 3ZSVA 1UOCA 4BWMA 2HHUA 1ATNA 3P5JA 4DV4M 2YKNA 4IO9L 3E9OA 4FJIA 4NYNA 2P9NA 5GIPA 1RBVA 1W5TA 1PJQA 3VF4A 4C8LA 3GBTA 4DFKA 1GLEG 4JV5K 3K5LA 4LJ4A 4AI6A 2VGMA 1D9DA 4KHWA 3IG8A 3DLLL 4Z0UA 4MM3B 1DT9A 3HOSA 4DUZK 3LMMA 5C1BA 3MECA 3O9TA 3Q8GA 4Z94A 1G15A 4LF6M 1W5SA 4FZZA 4IOAL 4FSVA 2IVPA 3NVKA 2LNHC 4Y28F 1WSJA 3BGRA 4AKHA 1N5YA 5IT9S 2H1RA 2HF3A 2ZANA 3QETA 4Q0BA 1N36K 2UXCK 3THGA 3GPPA 2Y1JA 3BBZA 3VEVA 4G1QA 1X3MA 3B74A 3B7QA 4EZ9A 3AOEC 1TVRA 4CHOA 4JI0M 3WNFA 3PSFA 3T1AA 1Y64A 5AQNA 1Z5CA 5FPDA 5C0YA 4DHYA 4FM1A 1LWFA 1IY0A 5CY4A 1BGXT 4HCBA 2CWBA 4UY8O 3CD6N 3AVBA 1K73O 3RE8A 1YUWA 4FD2A 3KDSE 5A2QS 2F96A 3C7NA 3D6RA 2ITMA 5C2DA 3OTOK 3KLFA 4DTOA 4FW1A 3GRRA 1DEJA 2F5PA 2DY4A 2JY5A 3IFRA 1RTHA 3NH1A 1YVNA 1YVUA 3P39A 2DWMA 3L28A 5E26A 4E7KA 4WQ5C 2E5LK 2UYTA 2VF8A 1S1XA 2YNGA 4BRFA 1JCGA 4W5TA 1A5WA 1ORYB 3QMLA 4CGHA 3O1BA 3O4QA 2LTUA 4LD0A 4GITA 2FF6A 1GLDG 3TTCA 3FD9A 1ESVA 3EY1A 1GVNA 3QIOA 3R6MA 5EXWA 4BRKA 1IG8A 5EXXA 5J2NA 3TAQA 1ZBLA 2P5OA 1QZMA 4CHPA 1TKZA 2EUCA 4HL4A 3VENA 1CLQA 3P38A 4LSLA 4H8KA 4CISA 1UFZA 1G59A 5DM6L 4G4OA 4ISFA 3M0EA 1BG3A 4QNMA 1E9SA 1MN3A 3V6DA 3T7ZA 3I01M 4PDIA 1YF5L 3T1HM 1FXXA 5FRNA 2O8FB 3HM9A 3VGMA 4IO8A 4B7HA 3G6EN 1SV5A 3M8PA 4K8ZA 3H6EA 1BQNA 3I55N 3HSCA 1HYSA 3K5MA 3ZQJA 4DF8A 3PNYA 1Q39A 4A62A 3FR0A 2DZNB 2F9WA 2HBJA 3W0LB 1BISA 1AUAA 2IS3A 3NFAA 1OKJA 3QEIA 2QWNA 3FE3A 3LVVA 3SAWA 4DFJA 4CJFA 1IM2A 3V76A 2ZM6M 1G41A 3CFOA 4ZHRA 1VSKA 1K82A 4CJTA 3D8LA 3C3DA 1XXHE 4CHNA 4J2AA 1CZBA 1L1ZA 4DLGA 1RDBA 2QXFA 3ZSOA 2P9IB 4PKGA 3VGLA 3OYJA 2VIIA 2HBMA 4CJRA 1L2BA 2J4RA 2Q0RA 4EIAA 4LZJA 3OYMA 3R3LA 4BR5A 1RTJA 3SPYA 1NGHA 2K47A 3FTEA 2HOEA 4DTNA 4X64K 3ULEB 1OH8A 3ZX0A 1HPZA 3H1QA 3TWHA 1ITGA 1OJLA 1QUSA 3ZSXA 3D2EB 1X1PA 1TH3A 3TL4X 1PJTA 5CYMA 3VGKA 4DTJA 3NE6A 4DV0K 2D0PA 3A42A 2BDPA 3HKPA 4GY2B 2FSNA 2YJEA 3CJCA 4FZXC 5AFUA 1DGHB 5JLHA 5BRHA 1NKEA 5FDLA 3TE6A 2CH5A 1TYQB 3TI0A 4OU7A 4D82A 3THYB 3KK3A 1B9DA 2QK9A 4F2RA 2HVHA 3I0RA 4DU3A 5AQTA 4QCLA 4KFBA 2ZTCA 1NGFA 4CEBA 2XLJA 1T05A 3C94A 1WSIA 1FKPA 4BWJA 1MU2A 3SNNA 2AJQA 2XY8A 1L3TA 2WSFF 5HOOA 1NOZA 3LZJA 1IKWA 3MWTA 3NH2A 3SAFA 4OPKA 4KTZA 2G8LA 1H6UA 4IBIA 5FTJA 4CFCA 2DKLA 2KW0A 1C1KA 3A45A 5AQPA 3U5ZB 4E1NA 4BRHA 3CC7N 2KZSA 2HNZA 3OS0A 1VRTA 3LM2A 3MXIA 4IBFA 2G8VA 3J27B 3FTCA 3BY5A 3CFRA 3LM9A 1I3AA 1VQ8N 1K9MO 5ITQA 4YY3M 4LY6A 2A41A 1C0TA 1WNSA 4AF1A 3TANA 1BA0A 2OQ4A 4QAGA 3CCEN 3AKZA 1TGUA 2Q0UA 3KP1E 4L3QA 1NKCA 1XXHB 3V1OA 1WGNA 4RKUF 3VQEA 2ZAMA 1TF0B 1J54A 4CZLA 4FWGA 4IFEA 2GELA 4CBWA 3T1YM 1YHQN 2HSTA 4DSKA 3AVLA 4AHSA 1IBLK 1QAQA 3HHZA 1ZBUA 2VCPA 4DV7M 1XC3A 2DI0A 3JAMS 4FK2A 4FWHA 2R18A 5E84A 1JKHA 3WXJA 4OKJA 2VQEM 4QNRA 1NGDA 4FM2A 1WIVA 1IN5A 1S9GA 3GG4A 3AVGA 3EYZA 3ENHA 4JI4K 1IH7A 2BGGA 2LVAA 4NCGA 3THVA 3VQQA 5F0XA 2B5JA 4CESA 1XHBA 4D81A 4LF4K 4XIUA 2DHRA 4MO5A 1KVBA 2OA8A 1ATSA 1ZQ9A 1WAFA 4H0XB 3GQ4A 1X3NA 1IO2A 4B1UB 1G8PA 4A2BA 1QQNA 4CJKA 3C3EA 4XH4A 4JD2B 5IWAK 4LSNA 1Z59A 1U6ZA 5DK5A 5AQWA 4CZEA 4DQPA 1VAZA 4B8CA 2RKIA 3AV0A 3AVJA 1NG9A 1T43A 3K57A 4C8OA 2LVOC 2F4VM 1RNHA 4I8OA 1EX4A 1OTRA 2MR9A 4GC5A 4M9ZA 4M9XA 3GLIA 3AVAA 3FZMA 1LOTB 1LWEA 1X9SA 3VDUA 2R46A 4B1ZA 2UU9K 3KJVA 1Q82O 5BPLA 4CIZA 1J6ZA 3ZLJA 1LTMA 2JY8A 3O08A 3CF2A 5T7BA 4DB3A 1QSLA 3B7NA 4LF8M 3MDQA 1BVSA 3AVMA 3KIOA 1M90O 4FPBA 4LG2A 1XMQM 3A0IX 4W5QA 1SXJD 3VK8A 1L3VA 3PV8A 1X9MA 4AILC 3E9PA 3ATUA 4BR2A 4QOZC 2D7GA 3THXA 4OVZA 3F92A 3FFKB 4B08A 5ITXA 1HNXM 3KZBA 4FWRA 4KI4A 2KTQA 1LW2A 4W5RA 4CEEA 3QBWA 4JAXA 4JKDA 1RDUA 4KHUA 2HL7A 1IXRC 4H5NA 3ZETB 4UN2B 2ASOA 1QZ6A 5M1KA 1SZ2A 4GV9A 4X62M 3TWMA 4G4NA 1RT4A 4JHDB 1SAZA 4BC3A 1U45A 2DWLA 4ID5A 5AQLA 4N5SA 2GTDA 1FKOA 3TAEA 3SQ1A 1BQMA 2M5ZA 5FTKA 2HMIA 4OX9K 2G8HA 3VQ4A 4CJWA 2ZWHA 1KAYA 3M8QA 3VQ5A 4BRLA 1XNRK 3TQSA 4C8NA 3MXJA 4FLTA 3KD5E 5GAGP 3K9KA 3J7AP 2VG6A 2GUIA 5JS2A 5FROA 5EP1A 1I39A 4EHTA 5GAEP 3NDKA 3ZSYA 3G10A 1W9HA 2XO7A 1GLBG 3QFPA 4JI6K 2RN2A 2W41A 1BWFO 1LAVA 4LFBK 3GLHA 4BREA 2JWLA 3SCXA 5AZIA 2G8WA 1XNQK 2FBXA 1JJ2M 3J81S 4FXDA 5BREA 4B3RK 2DAIA 4FJLA 3GE1A 1Z5BA 1NGEA 1KSFX 3NGIA 3FRHA 2QI2A 2ASMA 2E4LA 5BPNA 3OW2M 1BI4A 4DV4K 3FUUA 2YHXA 4B3TK 1L2CA 1X9JA 4M42A 4BBAA 3U9DA 2WBNA 1ZBFA 2P9SB 2Y0QA 3HK2A 2I5JA 2I7NA 1U2VB 4CJQA 4CGIA 1Z5AA 3V9XA 3CPWM 3VEYA 4JI5M 1OQYA 1Q3CA 5CHIA 1KQSM 3LPTA 2WSEF 1KD1O 3N4PA 1GLAG 3GLFE 1C6VA 2BH1A 2P9KB 2P9PB 4PL8A 3HJFA 1HJOA 4B1YB 2I7PA 3CMAN 1D8YA 3VESA 4DR3K 1SL1A 3J7BA 1SS6A 5AJ3K 3HSTB 3LP2A 5EP4A 2PZSA 3DOAA 3O9SA 4B1WB 1VSHA 1HQUA 3IHPA 3VEOA 4NXMM 2QKBA 3DRRA 2VGNA 1S6PA 4CD1A 4P17A 2K6BA 4FJKA 5JS1A 3KKSA 4OVLA 1V34A 4KRFA 3CCVN 5ELZA 4CJ7A 3HL8A 1K8AO 3JSMA 4FLXA 3SI6A 1JLAA 3M5RA 1NK0A 1J5OA 4CGFA 1S3SA 1N33M 5JMVA 3S9HA 2EKFA 2Z3XA 4WW0A 2JGUA 4B9NA 5M1FA 1P8ZA 5H1SQ 1EIJA 2KZUA 4JKHA 4CJ3A 3THWB 3RRGA 4GVMA 4DFMA 1NKBA 3O8MA 2G8FA 4CERA 1IN4A 3B9PA 4WP2A 1NK4A 3RR7A 5I9EB 2BWEA 4S12A 4FWKA 4KPYA 5HBMA 4C1NI 3MAQA 1T6CA 1FW6A 2VYPA 4GHAA 5BR8K 4LGMA 2R4EA 3QFUA 1VDLA 1NM1A 1TKDA 4DQ8A 3H4JA 4JNEA 2VWBA 1E4GT 3AA3A 4FCWA 2EKKA 1J5EM 3BEXA 2MH8A 3EN9A 3AGRA 3LZIA 1HYZA 3T19A 3IG5A 4DR1M 2PFUA 5GAHP 4NCAA 4RF1A 5JVHL 3RR8A 2X4AA 2X6NA 1NLVA 2C99A 1XMOM 1GJSA 4O4GA 5AFUH 3UKRB 3DLGA 3T6PA 3WNEA 4EHUA 4CJ4A 1D0KA 5AR0A 3SUPA 1DGKN 2FSKA 3SBGA 2O8FA 1ZMVA 5E6JA 3OYFA 2A40A 3A46A 4DR4M 4YOYA 2LXEA 3L2QA 4DTXA 1PM5A 4L78A 3I8BA 3L2VA 4JI3M 1SG9A 3LCVB 4IEIA 2R45A 4OPAA 4HWIA 3GLFB 3AO4A 3W0LA 5AQQA 7CATA 3DOKA 1LAWA 1DKGD 1A5VA 1QS4A 2YHYA 2KHHA 2R7YA 1W2BM 2YHAA 3O6WA 3W3DA 3U3YA 2UUBM 1NWKA 3BUZB 3KOXE 4FWLA 3ZEUB 2O5RA 3SMPA 2ZD1A 1U48A 2KZZA 4DV6M 3S3NA 2P9IA 3IECA 1KAXA 1A5TA 4H4OA 3J80O 4J2EA 1KVAA 4CJPA 3B89A 1CZAN 2YV0X 1PGYA 2G3QA 3NBIA 1RT2A 4B3MK 1L1TA 3F5TA 1NNEA 1S1TA 1TUUA 4TUWA 4LC9B 4G3OA 2X6SA 5C24A 1SXJE 4ELUA 2YNHA 3ULEA 1T3TA 3VEWA 3GO8A 4FO0A 3B7ZA 4FW9A 3SYZA 1R5LA 4MH0E 5ITTA 1J53A 1E4FT 3D2EA 4HTUA 1U04A 3Q7CA 1P3QQ 5EU7A 5C18A 2UUCK 3GPYA 2QTDA 3AO3A 4YHHK 3E9SA 1IN7A 3FYDA 1A5XA 1EQYA 2W42A 3QB0A 1YSYA 2M60A 1VSLA 3QBXA 1S1WA 3ASMA 2BNKA 3V9SA 3FUXA 1QANA 3AVNA 2E2OA 3TTFA 1DGHA 4K41A 3KS4A 1WOQA 4PQUA 2KHOA 1TYQA 4RW6A 2HNYA 3CJ7A 3SQ4A 3THYA 1Z6RA 1SKSA 2KW4A 5ADXA 4Y0WA 4FOIA 4R7GA 4I6MA 2O8DB 1RFQA 4G6ZA 5I3UA 4L8RB 2XSZD 4ZTFA 2YHBA 5M1NA 2XHBA 4BACA 4E0DA 4GKKM 4FLYA 1ILYA 4ELTA 1DTQA 1BA1A 2KZMA 2KRUA 3PVSA 4K25A 4B9MA 1EETA 4IJFA 4KLNA 4H4MA 3ZYYX 2CGJA 3AV9A 2HHHK 1V33A 4NXNM 2E1ZA 4CK3A 1JB0F 5GIOA 3LWMA 1RDWX 3U5ZA 2ZJQL 2YHWA 3KK1A 4XBOA 2XEPA 5TKYA 4C8KA 1C7YA 4DCHA 2A42A 1E3MA 1VQMN 4IBKA 1NU0A 4LF9K 2XY6A 1FK9A 3LCUA 2CE7A 3FLCO 3FZHA 4DV5K 4DLEA 2QQ8A 3DMJA 2AA4A 3VEZA 1IFYA 4MGZE 3CM6A 4FWNA 2Z7JA 1IJJA 5DFLA 3R9XB 1ASVA 4LH4A 4E3SA 3WQUA 4W5NA 4E89A 1PJJA 4IKFA 3FKEA 1UAXA 1YJNN 1XXHA 3O4WA 3C65A 2LHGA 3KTQA 3BDPA 3PIPL 4K0KM 3AVIA 3LALA 3ILKA 2DAKA 2AP1A 3OYIA 2KFZA 3FUTA 4TSXA 4OW0A 3CHWA 3IDHA 4IBEA 3LDLA 3AARA 1GOAA 4DV2M 1MWMA 2QENA 2Z4RA 1IN8A 1UA0A 2Y0TA 4LGYA 1SXJB 3GLGE 5FTMA 4M41A 4N76A 4JI7K 3K5NA 4V19S 3S41A 4BVOA 4H0YB 1Q8IA 4I2PA 4O55A 3DLBA 2QA4N 3QIPA 3K9OA 3IG1A 5GADP 2G8IA 2O8EB 1NBWA 3HJQA 3DJCA 2DZOB 1J9AA 4BDPA 4B3SM 5JI3E 1EP4A 1AIPC 3SK3A 1VQ6N 3AOGA 1KAZA 3C6AA 3DLRA 4F9OA 4LF7K 3KSXA 1VSIA 3A5MC 2F8TA 4MLEA 4DFPA 2WONA 1C0UA 3AVFA 3VQ9A 1NJIO 2APLA 4D80A 3ZT3A 3VQ8A 4K42A 1I94K 3EIEA 2GX9A 4JD2A 4CI6A 1VSDA 4XK8F 2QWMA 5IT9O 4Z4GA 4LFAM 5KRTA 4BLCA 5IZ7D 3QERA 3GRYA 2F4VK 4JYAM 1QZEA 1Z26A 1HNWK 2QWOA 5LMNK 1NY5A 3SUQA 2ZAOA 3H3NO 1KTQA 2OPRA 2PYJA 2HF4A 2HKJA 4O8UA 4GMJB 1OKSA 4CF2A 1S1VA 2EHGA 1SQKA 2HHTA 4CJ5A 4DR2M 3T3FA 2A6AA 2A5XA 1L8QA 1NHGC 2J7OA 3MJ5A 3L3VA 4FLUA 2RF2A 2YX6A 5JI2E 3W67A 5CYQA 3PO4A 3FUVA 2DWNA 4U67L 3HPGA 2CH6A 4DR7M 4CZJA 4J2DA 3T69A 5A2QO 3TSUA 1G99A 2Y1IA 4MB7A 2D4WA 4MDAA 4DQRA 4F4KA 4LJ8A 1IG9A 1N77A 1CZ9A 1HNXK 4IZ9A 2H3GX 3WUHA 3VQ7A 3OYCA 3L26A 4IIWA 4DS4A 3R8EA 2Q3SA 2VG5A 3OA9A 1OVQA 2JZ0A 3HJSA 4WQ4A 5LL6Z 3ZETA 1DO2A 2GNOA 1LWCA 4X62K 1MA9B 4WF9L 2ZF5O 3U60B 3DLEA 3KW6A 1IKVA 3TPQA 2OTJN 4BE0A 4CZIA 4JKBA 4WQ4C 4JHDA 1IBKK 4JKGB 1FJGM 2PBDA 1DLOA 4DUYK 3GLGB 4RW9A 4CW7B 3GP1A 4LF5K 3SQ2A 2UUAK 1OIZA 4IBDA 1QVGM 1N32M 1DGGA 1GLCG 1QQWA 5B8HA 3UJNA 4DSJA 1WSFA 3DFZA 4H5WA 1KLMA 2Q2RA 3PFIA 3SBJA 1Y97A 3LW5F 4LFCM 1JXBA 3NHGA 4FJNA 1E94E 4BR9A 2Q36A 2DAGA 1NOYA 3CFPA 5SWMA 4U7BA 2O4GA 1J09A 3LWLA 4GNIA 3IRXA 3RMBA 1VQON 1JLEA 4QHSA 4G9ZA 1VHXA 4G4RA 4KREA 4CCHA 3QYEA 2FLOA 2P5TA 4I9QA 3SV4A 4CHQA 1VRUA 3OHRA 2O8CB 1WXQA 4BRIA 4OLAA 1OAOC 3LQQA 3VDPA 3C6UA 2K9DA 2BANA 4A5AA 2RGOA 3U6QA 5CE3A 1RU3A 5AQUA 3SV3A 4A61A 1R59O 5J2PA 2P9SA 5AQGA 3C6TA 1U2VA 2NRZA 4HHTA 3F9MA 4H03B 5JVGL 2FFJA 3CC2N 3MEEA 1OH6A 4B7FA 1OH7A 4FVMA 3WHKA 3E9LA 2QPAA 3O9RA 1VQPN 2P9KA 2P9PA 4GKJK 3K2LA 5AQHA 2LHCA 1DO0A 4B9QA 3MK6A 4EZ6A 3QEXA 4EIWA 3AL0C 1MX0A 5EY4A 4C1NK 4I6MB 3IMXA 1U47A 3U6FA 3HT3A 3CETA 3CCJN 1K6YA 1ZBSA 4IJNA 2VQFM 2UXDK 3AVCA 4DU4A 3B8AX 4NXMK 3J8AA 1HR0K 3LPUA 5FPMA 4H0PA 2FXUA 2Z1IA 3DAWA 2JWKA 3EEQA 4KT0F 1IY1A 2XRIA 3EL2A 4NYFA 3D2FB 1OH5A 4MLHA 3UIQA 2B4JA 2G5GX 4GMQA 1Q02A 5EXPA 3BF1A 3NAEA 1WSGA 1JLGA 3DYAA 2O8BB 1JR3E 4ANRA 1VQ5N 4GV3A 4DV3M 4ZPXA 2CEAA 1C0MA 5FPEA 4ILGB 4CE9A 3VPZA 4BG8A 2NQ8C 1VK0A 3AFHA 2F5SA 3L25A 2XGNA 5AQYA 4NLCA 4AHVA 2WZJA 3PIOL 3THWA 1SL2A 4K43A 1XI1A 3AA2A 1JXEA 4JI1K 3VTHA 4IG3A 2DFHA 4M0WA 4JKCA 1BCMA 4KV8A 3UB5A 3A2FA 2PYLA 2ZTDA 4PHTX 3I8DA 1QSYA 3SHGB 1XC8A 4BC4A 1J5EK 3TAFA 4AQYM 1KCFA 1V4TA 4E1MA 4DQQA 1MU5A 1GJTA 2B6AA 4FW2A 4PKHA 3J7ZO 5AQIA 4A3VB 3SJHA 2W40A 3JR5A 1L2DA 2YI1A 3JXUA 2RPIA 4REZA 3DXKB 1ATRA 4OGEA 4FLWA 2IGIA 4E19A 4EAHD 5C12A 3C9PA 4AG5A 2F9TA 3UKRA 4B3OA 3FYCA 3O9UA 1IV0A 1QQCA 4DTMA 1NJWA 4LZZA 1TR8A 1WSEA 4DR4K 1SKRA 2DNAA 5ADXH 1RT5A 5HL7L 3U6MA 4JV5M 2HVIA 2NUBA 5TKWA 2QWLA 3E21A 2D5RA 3ALYA 4X66K 1XQSC 3R1XA 3JAMO 1N8RO 1MWKA 1IN6A 4DUZM 1N78A 3GLFA 3CCLN 1TDZA 3TR8A 2C96A 1HNZM 2PAVA 3MEGA 5AQOA 4BGAA 3KSJA 4FWPA 1UA1A 3ZT2A 3WHLA 3NBPA 3PX6A 4CFDA 1TK8A 4IBCA 2R44A 5KRSA 3M8SA 3ZEUA 4FWSA 1QVFM 3D45A 4KTQA 1N34K 1N36M 1HNIA 3B6PA 2UXCM 4BQZA 1XHXA 4BR4A 2BUPA 1EKEA 5JICA 4FWOA 4IFVA 4M7YA 2N35A 4FZYA 1G3IA 2FH0A 5EP3A 2HMPA 4MDBA 1QVRA 3O4NA 4YOUA 2E1YA 1RGIA 4O5FA 2LBCA 3VA3A 2FE8A 4GH9A 1RDCA 5F2RA 2OYQA 1XHZA 2CHQA 5HRNA 3A5OC 3QLHA 5JLFA 2P1JA 3OTOM 4CK2A 1LW0A 4BRCA 4CZGA 1Q3BA 2HWJA 3VN5A 2RHKA 2V7ZA 1D9FA 1RBSA 3K92A 3OBYA 3SAVA 2P51A 4NCBA 2OO9A 4KHPK 2E5LM 1YE9A 3AAPA 1KYIA 4RTFD 2Q97A 3G4SN 5AQXA 1HX1A 4LJAA 3DLKA 4JI8K 1HT1E 3WNHA 1NK5A 3J2PB 1JL2A 1T3VA 1ZAEA 4L15A 3F2KA 3P4IA 1C1CA 3LDSA 5DYGA 3CERA 2P5GA 1WLJA 3SYLA 3SAUA 1W0HA 2EA0A 4B1VA 3CCUN 4KHQA 1LV7A 4EP5A 2PY5A 3CF0A 2QWPA 3WEEB 1YI2N 2O8DA 3A5NC 1VQ9N 3HYFA 3LVWA 3RVCA 1CXQA 4GKKK 3KOYE 4M3RA 2HHSA 1OIPA 2ATQA 4CZMA 3SAGA 1NMDA 3CJ1A 5KGWA 2FOIC 4BG9A 4HVJA 1UWBA 3SATA 2OANA 1KC8O 2IVOA 4M9SA 2IC3A 4FJ7A 5ITUA 5AQZA 3GQ5A 1QHAA 5KGXA 1EWRA 2E8AA 2F5NA 4YOXA 3QNOA 4KKOA 4UQGA 2NRTA 4JS5A 3CM5A 4X65K 4GV6A 2GV9A 4BC2A 2VF7A 3CIPA 4LJ5A 2NNWA 3KOZE 1RT1A 5ITYA 4DV1K 4P16A 2DPNA 2CFOA 4JRPA 3SJJA 1TK0A 3VERA 1ASUA 2YKMA 4IJAA 4DKWA 3MN5A 1EO1A 3CCRN 1WUAA 3CQXA 3VLFB 3L29A 4OKKA 3PX4A 4K0KK 5CZ1A 2KEBA 5FSWA 1S6QA 3QO9A 2CHVA 2L6OA 1FNNA 2D0OA 1MJGM 2GUPA 4KH6A 3OJSA 1IBMM 3L8BA 2FC0A 3U6SA 5I42A 1HYVA 2VG7A 3GL1A 3J81O 3VKHA 1VQKN 4X64M 4CFAA 2QSFX 3HP9A 4LF6K 2L7IA 4Y1DA 1SXJA 4H5VA 3S3MA 3BZKA 4CIFA 2NRHA 1XB2B 2OPFA 5BR9A 2ASPA 3KP0E 3MCPA 2OZSA 3MX5A 2O8EA 1SXJC 4DV0M 3L0QA 2WC9A 3NF7A 4BRDA 3B6OA 4BC5A 5LMUM 3LDOA 4QS9A 2X74A 4Z6YA 3V4IA 3RTVA 1VEJA 4JI0K 5KQ8A 1JLFA 2HCBA 3AO1A 4CF9A 1Z6TA 4Z4IA 1IXSB 2JWSA 4CF0A 2DENA 2OCEA 5M1PA 3NGYA 4CJLA 5AQJA 4WFAL 1NO1A 3OYGA 4FLZA 4DQIA 4FJ9A 4ID1A 1T7PA 2D0AA 3VQBA 4M3YA 5C2FA 4XEIA 1NJGA 2IIRA 1ASWA 2UXBM 5HLFA 1WSHA 2YFQA 4HLQA 5FLXS 4BGBA 2CRUA 5DNYA 4HTLA 3UZUA 2KA6B 5H37D 3IS9A 4AM7A 3PO5A 1KVCA 1YIJN 3ZC7B 1P90A 2NRXA 4OLBA 4CJUA 4FJMA 1GLFO 3VQCA 2W6KA 3C0BA 4JS4A 5HP1A 4DR7K 1YJWN 4QS7A 1BOTO 4NRWA 2NRWA 3S3OA 1ZYQA 2D7EA 4NC6A 2J7NA 4WYBA 4CECA 3H3OB 2EX3A 2XH9A 1GLNA 1S72N 2L4EA 1TUYA 3VA0A 4CEDA 4OGCA 3T1HK 3V9WA 3H08A 4DSLA 3SBTA 4IDKA 3OYBA 1NGBA 4CZFA 1IBLM 3V9ZA 3LDPA 3VMFB 3QESA 1Q9XA 3VTIA 3U60A 2ETJA 2CV2A 1JCFA 4JN4A 4XH5A 3CMEN 2OOAA 3FRIA 3O1WA 2OTLN 3RMDA 4JKGA 4FCTA 4DR6M 4FCVA 3K8ZA 3GLGA 1DV0A 2ZM6K 3V9UA 4JI4M 3CTWB 5KPTA 4EFHA 2Y21A 4FK0A 1S5JA 3LQRA 3EZ5A 1IQPA 2YCHA 2IDOA 2JY7A 3KFUG 4LF4M 2R6FA 3MMPA 1EWQA 3HVRA 3FZKA 1R2ZA 3GLHE 1MDUB 1ZMUA 1VQNN 3F73A 3MEDA 2D7HA 1G4AE 2E88A 2DFEA 4PT5A 1T6OA 1K3XA 4CK1A 5HRSA 3O3HA 3CF5L 1UM8A 2R4JA 1TAQA 2RGHA 5IWAM 3AGKA 3ZT1A 3MMVA 1U4BA 2O8CA 1WGLA 2DWZB 1QQOA 4ITQA 1VSJA 2F7TA 4HUEA 3GQ3A 3H46O 3HHXA 3M6AA 5AQVA 4EP4A 1QAOA 2MJ5B 3TWKA 3TSPA 3OS1A 1I4WA 1T03A 2A1RA 4BR0A 2A3ZA 4M3ZA 3DXMB 2UU9M 1HMVA 4AHRA 3MX2A 3ISNC 3HX3A 4MFBA 4IBGA 5E41A 4O5BA 1X37A 3ID8A 1JLBA 2HB5A 3E1YA 4QHTA 1O13A 3EZWA 3Q7BA 4DTUA 3L2WA 3M6GA 2XZFA 3U61B 1RBRA 4IOCL 5IREB 3PSIA 3V1QA 1NV9A 4A57A 3H45C 4H0TB 3W0FA 2ZGYA 3BF3A 2CV0A 1QZ5A 4RW8A 1WN7A 4B9VA 2DAEA 3LAMA 2CGLA 5AQMA 1SKWA 2DXIA 3E4RA 5K14A 4LRTA 1NV8A 1WHCA 4B9UA 4I7FA 3D2FA 1R7RA 3ID6A 3JS6A 2O01F 2W6LA 4ILHA 1DTTA 4F2SA 2QNJA 1KFSA 3FTDA 4ELVA 2O8BA 1R2YA 3QICA 1C0FA 3A5LC 1U49A 1ZBIA 1QAMA 3HZJA 3U8XA 4M0DA 4AKIA 3VF2A 2BJWA 4YY3K 4OX9M 3ZX3A 4CD3A 1JR3D 3AO2A 4FLVA 2DFFA 3MXMA 3E66A 4XH1A 3RSEB 2V1CA 2ZGZA 4DSIA 2O25A 4IWVA 3SHFA 3P31A 3T1YK 4DBGB 5SZTA 4E7HA 1HKCA 2IVNA 4NLBA 4DV7K 4RW4A 4JI6M 5AQSA 4MGIE 4LFBM 2IOCA 4JKFA 1TDHA 2VQEK 1YITN 4Z4HA 3HPHA 4CIEA 2A5YB 4B3RM 4E7LA 2Q1NA 4AM6A 3F9KA 3DXKA 3RMCA 4LJ6A 5C15A 4B3TM 3WXIA 3DOLA 4Z4EA 1IXZA 3HXMA 2HHWA 3UE5A 4AKGA 2HNDA 5BN9A 4DMNA 1NVMA 4BRNA 1Q86O 1HQEA 3EIHA 3HGIA 3L4IA 2QP9X 4YORA 4KHNA 1HLUA 4H0OA 1V4SA 4DTSA 4C8MA 1KFVA 3HTVA 2JNHA 1HNZK 3QDKA 2D0BA 3H1VX 4YNQA 3NGZA 2EO2A 3R9PA 3SUOA 3GOIA 5EJCA 1RCHA 2XSZA 3DZDA 3P83D 4YOTA 3ZSQA 1L3UA 4DR3M 1PRBA 2BE2A 4PUOA 4WFBL 1WR1B 5LY3A 4W5OA 4CEAA 3AOEA 3SFZA 3VEXA 4LRSA 3U4LA 3UKUB 3GPXA 3D8BA 2C5RA 1NGIA 4Z8XA 2AHMA 5ITRA 2E2PA 3AO5A 1QYRA 4ISEA 4NSRA 3K58A 2V7YA 3CCMN 1OFHA 3CI5A 1ZV1A 3AVHA 4FJGA 2DVWB 4JI2M 4R5PA 3KLHA 1JCEA 1D4XA 4KBOA 4E7JA 3I56N 4I9LA 4DU1A 4LF8K 4FPAA 3U6CA 1W97L 3L3UA 3IUCA 4WQ5A 1XMQK 1JR3A 2YJFA 1QDRA 3KHYA 3NH0A 2Z1JA 1CUKA 1S9EA 1W7AA 4B8AB 1V92A 1HJPA 2DAMA 3OVNA 2L2DA 1SUQA 3TAPA 1NGAA 2Q31A 2V51B 3OJUA 4CHTB 2YNFA 4Z4CA 2V6ZM 5CZ2A 1RILA 5BR8M 4FJXA 2LVNC 4DSFA 3BP8A 2JLEA 3O9QA 1SL0A 1TL1A 1JLQA 3WXKA 4FJHA 1B9FA 3OYKA 3PLAA 3U6EA 3HI0A 3SPZA 3WEEA 3I4YA 1NJXA 1IKYA 3NF8A 3UGJA 5LJVA 1D0MA 4QOSA 1GABA 2Z1GA 5J2MA 3KD1E 2VDBB 4MO4A 2HBKA 1XC9A 1HJRA 4OKEA 2XF3A 2K0BX 2EWSA 3CGWA 3TTDA 2GQFA 1RDAA 4YOVA 2Z4SA 2JP7A 1IKXA 3G25A 2X78A 4FCYA 2JZ1A 4KB1A 4CJSA 4DR5M 3SAHA 3TWLA 2HHVA 2E6MA 3HP6A 2EJSA 1YXQA 3ZCMA 1GLLO 2XZUA 1ZC6A 1RDDA 3OBWA 3M3ZA 4FM0A 5KQDA 3CG7A 4CIGA 3GPUA 4MGKE 4I5SA 3C6HA 3V1RA 3O3FA 4JI5K 3QNNA 1HPMA 2P9UB 1IBMK 2LSNA 4FYDA 4B3MM 2ZBKB 3KLIA 3AA5X 4OO1J 3C95A 2Q2EB 1GKIA 3SLCA 4PWDA 2ZQBA 3MHVC 2L09A 1M1KO 1BIUA 2RE2A 3L2UA 4ISGA 1OVYA 4J8FA 3DA1A 5EOYA 4BRGA 4CEZA 3PUFA 5F1XA 4XGIA 2QW9A 4PD2A 2L4FA 3TPZA 2UUCM 4JK8A 4PA1A 4CJVA 3TARA 4CHZA 5DM7L 5AZJB 4BRMA 4YHHM 1QSSA 1JQJC 5C25A 5LMUK 4Z4FA 3HPOA 3ZSWA 3HZ6A 2Z8YM 4IG0A 3R8FA 4PL7A 2P9LB 3ULDA 3MN9A 4AG6A 4B1XB 5GINA 3K59A 4LJ7A 1RT7A 2KLAA 1QQMA 1N33K 5BRFA 3C58A 3CCQN 1RTIA 1WB9A 3MWPA 4AHTA 3KK2A 1IXSA 3FGUA 2QWRA 3G0ZA 3NF6A 1PJSA 1DGBA 4M7XA 3I4VA 4JN6A 3VOVA 2XFTA 3D7EO 4DSEA 2UXBK 1EXQA 4IBNA 4BVPA 4GW6A 4GVEA 4WCEL 2XY7A 1C0GA 1HQCA 2HHHM 1K8KB 2RKOA 1CXUA 4FJJA 3OYAA 3L2AA 3RGSA 1NGGA 2R62A 4II7A 4MGYE 1HNVA 3BXWA 4DTRA 5AQFA 4NRVA 4L6V6 4LF9M 2QWQA 4CF8A 4F8RA 4DR1K 4DV5M 4I2QA 4IFYA 3T38A 2QBYB 1GOBA 5AQRA 3VFDA 3ZX2A 1YTAA 3LAKA 1XMOK 3DI6A 5EX5A 2QEXN 4O0JA 1K3WA 2P9NB 4DG1A 3ENBA 4MQ3A 4B9LA 4RG8A 2HBLA 2KDLA 2FS1A 2FBTA 2CP8A 4DTPA 2BJVA 2KXEA 1YT3A 3TSQA 4JI3K 1JLCA 1Z25A 4M3WA 4BRQA 4CJEA 4L16A 3CQ8A 1NK7A 5KO3A 1VG5A 5GKNA 4J2BA 4KHYA 4IJEA 4Q7JA 2VWKA 3K5OA 2R65A 3WQTA
chains in the Genus database with same CATH topology
4JI7M 3G71N 1T6DA 1BU6O 4FWQA 2QM1A 2NZTA 4B7GA 2NLXA 4AW4A 3NVMA 5AQKA 4GC9A 5BN8A 2E2QA 4LF7M 1NJFA 3BOSA 1OFIA 4CZKA 2LH0A 5EXSA 2QXLA 1VQ4N 4AZFA 1I94M 2C9CA 1HKBA 3SYKA 3ZCBB 4A59A 3C7NB 4FVUA 3K1JA 2ZJRL 1HNWM 5LMNM 1HUXA 4I4LA 4I81A 2XFSA 3LDNA 5BPVA 5CR4A 4NL4H 3L27A 4A2AA 3DXMA 5KPZA 3U6LA 4FWMA 4IBJA 2KRKA 3SC3A 4PCZA 1NNJA 5M1OA 5LJWA 4G4QA 4RNAA 3FZLA 1Z05A 3RGPA 3U61A 1D2NA 2GWJA 2JA2A 2WFBA 3M1FA 4ILJA 3HOTA 2ZJPL 4CBXA 4L8RC 2W82A 5KPRA 4BB9A 3UK6A 3CQYA 2E2NA 4YOWA 3A8YA 2X8AA 2D1KA 3EO3A 3CJAA 3EE9A 3L6QA 3KXEC 3IKMA 4IXCA 1NHWC 3KWIA 4CGYB 1IBKM 3VK7A 4DUYM 1GL7A 3GDQA 4GIPA 4LF5M 3SMSA 2UUAM 1S22A 4H5TA 4NSOB 1NGCA 3N4QA 4WURA 1R6BX 2FSJA 2E20A 3RSEA 3HHYA 4YDUA 2Y20A 3HWSA 1XUPO 4MGHA 1BO5O 3HRGA 1VDDA 4H0VB 4NB4A 1YUBA 4YDUC 4BRPA 1EE8A 8CATA 4IBBA 4H5RA 3LL3A 2GWKA 1HKGA 3KVWA 2NRVA 3CJ9A 1YJ9N 4RF0A 3CXCM 3GRVA 3HU2A 4GHLA 2LWXA 4GKJM 5FPNA 3PNVA 5EXTA 4OPHA 2C9OA 3AJIB 4IDHA 2QZ4A 4JEPA 3UKUA 4BQLA 3KOWE 2UXDM 3TU5A 4KODA 1HR0M 3HJ8A 2CHGA 3MN6A 3CCSN 3QAUA 1NSFA 2YNMD 3JR4A 3T15A 5EP2A 4W5WA 1GL6A 1BUPA 4GRIA 1E9RA 3FUWA 3O5BA 3WXMB 4LJ9A 3ZH9B 3HHWA 3HM8A 3AY9A 2QCUA 4R79A 4IOXA 4IEEA 4BY9C 4JK9A 4JI1M 5ITXE 3SARA 3VF6A 1NGJA 4L4UA 3LDQA 1ZXOA 3CPEA 1DGFA 3KVGA 1HQYE 2YR0A 1YAGA 1N75A 2V52B 5C10A 4FL9A 4BR7A 3VETA 1Q18A 5BPMA 3EKSA 2F5QA 3KS8A 3L4QA 3KWGA 5F3WA 2V1UA 4CBUA 1VQ7N 3J80S 4NOOB 4JXJA 2C98A 3WT0A 4X66M 3EE8A 4E1JA 1J7KA 1S3XA 5EVZA 3NMUA 3QWLA 1BDGA 2X49A 3FTFA 3HU1A 4JK7A 4KH5A 3U9ZA 3HU3A 2WUSA 1N34M 1VQLN 3PXGA 3CC4N 4BROA 3M7GA 3GLIB 2CV1A 3A98B 4A5BA 3AAQA 2BTFA 1LCUA 1NY6A 3J7AS 2P9UA 3ATVA 5M1QA 5MLCQ 2F5OA 4RWTA 4WFNL 1TH2A 2ERCA 3U6OA 3I33A 4RCHA 4FWDA 5DYIA 1NNUC 5AZJA 4OVZB 3I51A 4KHPM 3U6DA 4JI8M 5FTNA 4C23A 2YQZA 3VKGA 2P9LA 3SASA 2GEMA 4M63C 1XWIA 5EQTA 4PKIA 3U6PA 4CZHA 1E32A 3CJBA 3FZFA 3HBTA 3RFWA 3MN7A 2CUZA 5BRDA 2FF3B 1Q81O 1IY2A 1GLJO 3DWLA 3K9JA 3UMMA 4O8KA 3FE1A 3H4MA 1KXPA 4R3DA 4NO7A 1XNRM 1T44A 2L7HA 1H1VA 4FOEA 3NWLA 3WXLA 4KO8A 2KKZA 1K8KA 2CGKA 3O80A 1HT2E 3EKUA 2FNAA 2NRRA 3GLHB 4LCBA 4X65M 4QS8A 4JKAA 5AZIB 4BRAA 5FTLA 3KK7A 3GRUA 1XNQM 3MCAB 3ENOA 1Q7YO 2QBYA 4PDGA 1PJIA 3CF6E 4JKEA 3Q8XA 4KH4A 4DV1M 1TH4A 1ATNA 4DV4M 4IO9L 3E9OA 5GIPA 2P9NA 1W5TA 3VF4A 3GBTA 1GLEG 4LJ4A 4AI6A 2VGMA 3IG8A 3DLLL 4MM3B 1DT9A 3HOSA 3LMMA 5C1BA 3O9TA 4Z94A 4IOAL 4LF6M 1W5SA 4FSVA 2IVPA 3NVKA 2LNHC 4AKHA 5IT9S 2H1RA 2HF3A 2ZANA 3THGA 3GPPA 3VEVA 1X3MA 3AOEC 4JI0M 1Y64A 5AQNA 1Z5CA 5FPDA 5C0YA 4DHYA 1IY0A 4UY8O 3CD6N 1K73O 3RE8A 1YUWA 4FD2A 3KDSE 5A2QS 2ITMA 3C7NA 3D6RA 5C2DA 3GRRA 1DEJA 2F5PA 3IFRA 1YVNA 3P39A 2DWMA 3L28A 5E26A 4WQ5C 2UYTA 4BRFA 1JCGA 1ORYB 3QMLA 3O1BA 4GITA 2FF6A 1GLDG 3TTCA 3FD9A 1ESVA 1GVNA 3R6MA 5EXWA 4BRKA 1IG8A 5EXXA 1QZMA 2EUCA 4HL4A 3VENA 3P38A 4CISA 1G59A 5DM6L 4G4OA 4ISFA 3M0EA 1BG3A 4QNMA 1E9SA 3T7ZA 4PDIA 1YF5L 3T1HM 3VGMA 4IO8A 4B7HA 3G6EN 3H6EA 3I55N 3HSCA 3PNYA 1Q39A 4A62A 3FR0A 2DZNB 2F9WA 2HBJA 3W0LB 1OKJA 2QWNA 3LVVA 3SAWA 1IM2A 2ZM6M 1G41A 1K82A 3D8LA 1L1ZA 2P9IB 4PKGA 3VGLA 2VIIA 2HBMA 1L2BA 2J4RA 2Q0RA 4EIAA 4LZJA 3R3LA 4BR5A 1NGHA 2K47A 3FTEA 2HOEA 3ULEB 3ZX0A 3H1QA 1OJLA 3D2EB 1TH3A 3TL4X 3VGKA 2D0PA 3A42A 3HKPA 4GY2B 2FSNA 2YJEA 3CJCA 5AFUA 1DGHB 5JLHA 5BRHA 3TE6A 2CH5A 1TYQB 4OU7A 4D82A 5AQTA 1NGFA 2XLJA 5HOOA 3MWTA 3SAFA 2G8LA 1H6UA 4IBIA 5FTJA 2KW0A 1C1KA 3A45A 5AQPA 3U5ZB 4BRHA 3CC7N 2KZSA 3LM2A 4IBFA 3J27B 3FTCA 3LM9A 1VQ8N 1K9MO 5ITQA 4YY3M 4LY6A 2A41A 4AF1A 2OQ4A 1BA0A 3CCEN 3AKZA 1TGUA 2Q0UA 3KP1E 4L3QA 1XXHB 2ZAMA 4CZLA 4FWGA 4IFEA 2GELA 4CBWA 3T1YM 1YHQN 2HSTA 1QAQA 3HHZA 2VCPA 4DV7M 1XC3A 3JAMS 4FWHA 2R18A 5E84A 3WXJA 2VQEM 4QNRA 1NGDA 1IN5A 3GG4A 3ENHA 5F0XA 1XHBA 4D81A 2DHRA 4MO5A 1ATSA 1ZQ9A 4H0XB 3GQ4A 1X3NA 4B1UB 1G8PA 4A2BA 1QQNA 4XH4A 4JD2B 5AQWA 1Z59A 1U6ZA 4CZEA 1VAZA 3AV0A 2F4VM 4I8OA 4GC5A 4M9ZA 4M9XA 3GLIA 3FZMA 1LOTB 3VDUA 2R46A 4B1ZA 1Q82O 5BPLA 1J6ZA 3O08A 3CF2A 4DB3A 3MDQA 4LF8M 1M90O 4FPBA 4LG2A 1XMQM 3A0IX 1SXJD 3VK8A 3E9PA 3ATUA 4BR2A 4QOZC 2D7GA 4OVZA 3FFKB 4B08A 5ITXA 1HNXM 3KZBA 4FWRA 3QBWA 4JAXA 4JKDA 1RDUA 2HL7A 1IXRC 4H5NA 3ZETB 2ASOA 1QZ6A 5M1KA 1SZ2A 4GV9A 4X62M 3TWMA 4G4NA 4JHDB 1SAZA 4BC3A 2DWLA 5AQLA 2GTDA 2M5ZA 5FTKA 2ZWHA 1KAYA 4BRLA 3TQSA 5GAGP 3K9KA 5EP1A 4EHTA 5GAEP 1GLBG 3QFPA 2W41A 1BWFO 3GLHA 4BREA 2JWLA 5AZIA 1JJ2M 3J81S 5BREA 3GE1A 1Z5BA 1NGEA 1KSFX 2QI2A 2ASMA 5BPNA 3OW2M 3FUUA 2YHXA 1L2CA 1X9JA 4BBAA 3U9DA 2WBNA 2P9SB 2Y0QA 2I7NA 1U2VB 1Z5AA 3CPWM 3VEYA 4JI5M 5CHIA 1Q3CA 1KQSM 1KD1O 3N4PA 1GLAG 2BH1A 2P9KB 2P9PB 4PL8A 1HJOA 4B1YB 2I7PA 3CMAN 3VESA 3J7BA 1SS6A 5EP4A 3DOAA 3O9SA 4B1WB 3VEOA 4NXMM 2VGNA 4CD1A 3CCVN 5ELZA 4CJ7A 1K8AO 3M5RA 1S3SA 1N33M 5JMVA 2Z3XA 4WW0A 5M1FA 1P8ZA 5H1SQ 2KZUA 4JKHA 3O8MA 1IN4A 3B9PA 5I9EB 4S12A 4FWKA 4C1NI 1T6CA 2VYPA 4GHAA 4LGMA 2R4EA 3QFUA 1NM1A 4DQ8A 4JNEA 2VWBA 1E4GT 3EN9A 4FCWA 1J5EM 3BEXA 3AGRA 3IG5A 4DR1M 2PFUA 5GAHP 4RF1A 5JVHL 2X4AA 1NLVA 2C99A 1XMOM 5AFUH 3UKRB 4EHUA 5AR0A 1DGKN 2FSKA 3SBGA 5E6JA 2A40A 3A46A 4DR4M 4YOYA 2LXEA 1PM5A 4L78A 3I8BA 4JI3M 4IEIA 2R45A 4OPAA 4HWIA 3GLFB 3W0LA 5AQQA 7CATA 1DKGD 2YHYA 1W2BM 3W3DA 3O6WA 2UUBM 1NWKA 3BUZB 3KOXE 4FWLA 3ZEUB 2O5RA 3SMPA 4DV6M 2P9IA 1KAXA 1CZAN 3NBIA 1L1TA 3F5TA 1TUUA 4TUWA 4LC9B 1SXJE 3ULEA 1T3TA 3VEWA 3GO8A 4FO0A 4FW9A 4MH0E 5ITTA 1E4FT 3D2EA 3Q7CA 5C18A 3GPYA 2QTDA 3E9SA 1IN7A 3FYDA 1EQYA 3QB0A 1YSYA 2M60A 3QBXA 2BNKA 3FUXA 1QANA 2E2OA 3TTFA 1DGHA 4K41A 3KS4A 1WOQA 2KHOA 1TYQA 3CJ7A 1Z6RA 5ADXA 4Y0WA 4FOIA 4R7GA 4I6MA 1RFQA 4G6ZA 2XSZD 5M1NA 4GKKM 1ILYA 1BA1A 2KRUA 3PVSA 4K25A 4IJFA 4KLNA 3ZYYX 2CGJA 4NXNM 2E1ZA 5GIOA 1RDWX 3U5ZA 2ZJQL 2YHWA 4XBOA 2XEPA 5TKYA 4DCHA 2A42A 1VQMN 4IBKA 3FLCO 2CE7A 3FZHA 2AA4A 3VEZA 4MGZE 4FWNA 2Z7JA 1IJJA 3R9XB 3WQUA 1PJJA 3FKEA 1YJNN 1XXHA 3O4WA 3C65A 3PIPL 4K0KM 3ILKA 2AP1A 3FUTA 4OW0A 3CHWA 3IDHA 4IBEA 3LDLA 3AARA 4DV2M 1MWMA 2QENA 2Z4RA 1IN8A 2Y0TA 4LGYA 1SXJB 5FTMA 3S41A 4BVOA 4H0YB 2QA4N 5GADP 1NBWA 3HJQA 3DJCA 2DZOB 4B3SM 5JI3E 3SK3A 1VQ6N 3AOGA 1KAZA 3C6AA 4F9OA 3KSXA 3A5MC 4MLEA 1NJIO 4D80A 4K42A 3EIEA 2GX9A 4JD2A 4CI6A 2QWMA 4LFAM 4BLCA 5IZ7D 3GRYA 4JYAM 2QWOA 1NY5A 2ZAOA 3H3NO 2HF4A 2HKJA 4O8UA 1SQKA 4DR2M 2A6AA 2A5XA 1L8QA 1NHGC 2J7OA 3MJ5A 2YX6A 5JI2E 3FUVA 2DWNA 4U67L 2CH6A 4DR7M 4CZJA 3T69A 3TSUA 1G99A 4MB7A 2D4WA 4MDAA 4LJ8A 1N77A 4IZ9A 2H3GX 3WUHA 3L26A 4IIWA 3R8EA 3OA9A 3HJSA 4WQ4A 3ZETA 1DO2A 4WF9L 1MA9B 2ZF5O 3U60B 3KW6A 3TPQA 2OTJN 4CZIA 4JKBA 4WQ4C 4JHDA 4JKGB 1FJGM 2PBDA 3GLGB 3GP1A 4IBDA 1QVGM 1N32M 1DGGA 1GLCG 1QQWA 5B8HA 3UJNA 4H5WA 3DFZA 2Q2RA 3PFIA 3SBJA 4LFCM 1E94E 4BR9A 2Q36A 4U7BA 1J09A 4GNIA 4G9ZA 1VQON 4QHSA 4G4RA 2FLOA 2P5TA 3OHRA 1WXQA 4BRIA 3LQQA 3VDPA 4A5AA 2RGOA 3U6QA 5CE3A 5AQUA 4A61A 1R59O 2P9SA 5AQGA 1U2VA 2NRZA 3F9MA 4H03B 5JVGL 2FFJA 3CC2N 4B7FA 4FVMA 3WHKA 3E9LA 2QPAA 3O9RA 1VQPN 2P9KA 2P9PA 3K2LA 5AQHA 4B9QA 1DO0A 3MK6A 4EIWA 3AL0C 1MX0A 5EY4A 4C1NK 4I6MB 3IMXA 3CCJN 3CETA 1ZBSA 4IJNA 2VQFM 3B8AX 3J8AA 5FPMA 4H0PA 2FXUA 3DAWA 2JWKA 1IY1A 3EL2A 3D2FB 4MLHA 2G5GX 4GMQA 5EXPA 3BF1A 1VQ5N 4GV3A 4DV3M 4ZPXA 2CEAA 5FPEA 4ILGB 3VPZA 4BG8A 2NQ8C 5AQYA 3AFHA 2F5SA 3L25A 2XGNA 4NLCA 3PIOL 4K43A 3VTHA 4M0WA 4JKCA 3UB5A 4PHTX 3SHGB 1XC8A 4BC4A 4AQYM 1V4TA 1MU5A 4PKHA 3J7ZO 5AQIA 4A3VB 3SJHA 2W40A 3JR5A 1L2DA 2YI1A 3JXUA 4REZA 3DXKB 1ATRA 4EAHD 5C12A 4AG5A 2F9TA 3UKRA 3FYCA 3O9UA 4LZZA 5ADXH 5HL7L 3U6MA 4JV5M 5TKWA 2QWLA 1XQSC 3R1XA 1N8RO 1MWKA 1IN6A 4DUZM 1N78A 3GLFA 3CCLN 1TDZA 2C96A 1HNZM 2PAVA 5AQOA 4BGAA 3KSJA 4FWPA 3WHLA 4IBCA 3ZEUA 4FWSA 1QVFM 1N36M 2UXCM 4BQZA 4BR4A 2BUPA 5JICA 4FWOA 4M7YA 1G3IA 5EP3A 2HMPA 4MDBA 1QVRA 4YOUA 2E1YA 1RGIA 4O5FA 2FE8A 4GH9A 5F2RA 2CHQA 3A5OC 5JLFA 3OTOM 4BRCA 4CZGA 1Q3BA 2RHKA 2V7ZA 3K92A 3OBYA 3SAVA 2E5LM 1YE9A 3AAPA 1KYIA 4RTFD 2Q97A 3G4SN 5AQXA 1HX1A 4LJAA 1HT1E 3J2PB 1T3VA 1ZAEA 4L15A 3F2KA 3P4IA 5DYGA 3CERA 3SYLA 3SAUA 4B1VA 2EA0A 3CCUN 1LV7A 3CF0A 2QWPA 3WEEB 1YI2N 3A5NC 1VQ9N 3LVWA 3RVCA 3KOYE 4CZMA 3SAGA 1NMDA 3CJ1A 2FOIC 4BG9A 3SATA 2OANA 1KC8O 2IVOA 4M9SA 5ITUA 5AQZA 3GQ5A 1QHAA 2E8AA 2F5NA 4YOXA 2NRTA 4GV6A 4BC2A 3CIPA 4LJ5A 2NNWA 3KOZE 5ITYA 4P16A 2DPNA 2CFOA 3VERA 4IJAA 4DKWA 3MN5A 1EO1A 3CCRN 1WUAA 3CQXA 3VLFB 3L29A 2KEBA 5FSWA 2CHVA 2L6OA 1FNNA 2D0OA 2GUPA 4KH6A 1IBMM 3U6SA 3GL1A 3VKHA 1VQKN 4X64M 2L7IA 1SXJA 4H5VA 2NRHA 2OPFA 5BR9A 2ASPA 3KP0E 3MCPA 3MX5A 1SXJC 4DV0M 3L0QA 2WC9A 4BRDA 4BC5A 5LMUM 3LDOA 4QS9A 4Z6YA 5KQ8A 2HCBA 1Z6TA 1IXSB 5M1PA 5AQJA 4WFAL 5C2FA 4XEIA 1NJGA 2IIRA 2UXBM 2YFQA 4HLQA 5FLXS 4BGBA 5DNYA 4HTLA 3UZUA 2KA6B 5H37D 4AM7A 1YIJN 3ZC7B 1P90A 2NRXA 1GLFO 3C0BA 1YJWN 4QS7A 1BOTO 4NRWA 2NRWA 2D7EA 2J7NA 4WYBA 3H3OB 2XH9A 1GLNA 1S72N 1TUYA 3SBTA 1NGBA 4CZFA 1IBLM 3LDPA 3VMFB 3VTIA 3U60A 2CV2A 1JCFA 4JN4A 4XH5A 3CMEN 3O1WA 2OTLN 4JKGA 4FCTA 4DR6M 4FCVA 3K8ZA 3GLGA 4JI4M 3CTWB 5KPTA 4EFHA 2Y21A 3LQRA 1IQPA 2YCHA 3KFUG 4LF4M 3FZKA 1R2ZA 1MDUB 1VQNN 2D7HA 1G4AE 2E88A 4PT5A 1K3XA 3CF5L 1UM8A 2R4JA 2RGHA 5IWAM 3AGKA 3MMVA 2DWZB 1QQOA 4ITQA 2F7TA 3GQ3A 3H46O 3HHXA 3M6AA 5AQVA 1QAOA 3TWKA 3TSPA 1I4WA 4BR0A 2A3ZA 3DXMB 2UU9M 3MX2A 4IBGA 1X37A 3ID8A 3E1YA 3EZWA 4QHTA 1O13A 3Q7BA 3M6GA 2XZFA 3U61B 4IOCL 5IREB 4A57A 3H45C 4H0TB 3W0FA 2ZGYA 3BF3A 2CV0A 1QZ5A 2CGLA 5AQMA 2DXIA 3E4RA 4LRTA 3D2FA 1R7RA 3ID6A 3JS6A 4ILHA 3FTDA 1R2YA 3QICA 1C0FA 3A5LC 1QAMA 3U8XA 4M0DA 4AKIA 3VF2A 2BJWA 4OX9M 3ZX3A 4CD3A 1JR3D 3E66A 4XH1A 3RSEB 2V1CA 2ZGZA 4IWVA 3SHFA 3P31A 1HKCA 2IVNA 4NLBA 4JI6M 5AQSA 4MGIE 4LFBM 4JKFA 1TDHA 1YITN 2A5YB 4B3RM 2Q1NA 4AM6A 3DXKA 4LJ6A 5C15A 4B3TM 3WXIA 1IXZA 3UE5A 4AKGA 5BN9A 1NVMA 4BRNA 1Q86O 3EIHA 3HGIA 3L4IA 2QP9X 4YORA 1HLUA 4H0OA 1V4SA 1KFVA 3HTVA 3QDKA 3H1VX 2EO2A 3R9PA 3GOIA 5EJCA 2XSZA 3DZDA 4YOTA 4DR3M 4WFBL 5LY3A 3AOEA 3SFZA 3VEXA 4LRSA 3U4LA 3UKUB 3GPXA 3D8BA 2C5RA 1NGIA 4Z8XA 2AHMA 5ITRA 2E2PA 1QYRA 4ISEA 4NSRA 2V7YA 3CCMN 1OFHA 3CI5A 2DVWB 4JI2M 1JCEA 1D4XA 4KBOA 3I56N 4FPAA 3U6CA 1W97L 3IUCA 4WQ5A 1JR3A 2YJFA 3KHYA 1NGAA 2Q31A 2V51B 4CHTB 2V6ZM 5BR8M 3BP8A 3O9QA 3WXKA 3PLAA 3U6EA 3HI0A 3WEEA 3I4YA 3UGJA 5LJVA 4QOSA 4MO4A 2HBKA 2XF3A 2EWSA 3TTDA 4YOVA 2Z4SA 3G25A 4DR5M 3SAHA 3TWLA 1YXQA 1GLLO 2XZUA 1ZC6A 3OBWA 3M3ZA 5KQDA 3GPUA 4MGKE 4I5SA 3C6HA 1HPMA 2P9UB 4B3MM 2ZBKB 4OO1J 2Q2EB 1GKIA 3SLCA 3MHVC 2L09A 1M1KO 2RE2A 4ISGA 1OVYA 4J8FA 3DA1A 5EOYA 4BRGA 5F1XA 4XGIA 2QW9A 4PD2A 3TPZA 2UUCM 4JK8A 5DM7L 5AZJB 4BRMA 4YHHM 1JQJC 3HZ6A 3R8FA 4PL7A 2P9LB 3MN9A 4AG6A 4B1XB 5GINA 4LJ7A 2KLAA 1QQMA 5BRFA 3C58A 3CCQN 3MWPA 3FGUA 2QWRA 1DGBA 4M7XA 3I4VA 4JN6A 3VOVA 2XFTA 3D7EO 4BVPA 4GVEA 4WCEL 1C0GA 1HQCA 2HHHM 1K8KB 2RKOA 3L2AA 3RGSA 1NGGA 2R62A 4II7A 4MGYE 5AQFA 4NRVA 4LF9M 2QWQA 4DV5M 3T38A 2QBYB 5AQRA 3VFDA 3ZX2A 5EX5A 2QEXN 1K3WA 2P9NB 3ENBA 2HBLA 2BJVA 2KXEA 3TSQA 4BRQA 4L16A 5KO3A 5GKNA 4IJEA 2R65A 3WQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFQ A;  4QS9 A;  3H6E A;  3HSC A;  1T6D A;  5KQ8 A;  1BU6 O;  4A62 A;  4FWQ A;  3FR0 A;  2QM1 A;  2NZT A;  2F9W A;  2NLX A;  1BA1 A;  1OKJ A;  4K25 A;  5AQK A;  5AQJ A;  2QWN A;  5BN8 A;  2CGJ A;  2E2Q A;  2E1Z A;  1RDW X;  4CZK A;  2YHW A;  5TKY A;  2QXL A;  4DCH A;  2A42 A;  4XEI A;  2P9I B;  4PKG A;  2IIR A;  3FLC O;  3FZH A;  3VGL A;  1HKB A;  2AA4 A;  3VEZ A;  4FWN A;  4BGB A;  3C7N B;  4HTL A;  1IJJ A;  2J4R A;  2Q0R A;  4EIA A;  4AM7 A;  3WQU A;  4BR5 A;  1HUX A;  1NGH A;  1GLF O;  2HOE A;  3LDN A;  3C0B A;  4QS7 A;  3O4W A;  3ULE B;  4A2A A;  1BOT O;  3ZX0 A;  3DXM A;  5KPZ A;  3H1Q A;  3D2E B;  2AP1 A;  4WYB A;  3VGK A;  4FWM A;  3H3O B;  3CHW A;  3IDH A;  2D0P A;  1TUY A;  3LDL A;  3AAR A;  5LJW A;  1MWM A;  4GY2 B;  2FSN A;  2YJE A;  3CJC A;  3FZL A;  1Z05 A;  5AFU A;  5JLH A;  5BRH A;  3S41 A;  1NGB A;  2CH5 A;  4H0Y B;  1TYQ B;  4BVO A;  2GWJ A;  4CZF A;  3LDP A;  3M1F A;  1NBW A;  3DJC A;  4CBX A;  1JCF A;  5AQT A;  4JN4 A;  4XH5 A;  3O1W A;  5KPR A;  3SK3 A;  1NGF A;  1KAZ A;  4F9O A;  3CQY A;  2E2N A;  3A5M C;  4MLE A;  3A8Y A;  5KPT A;  4EFH A;  2D1K A;  3EO3 A;  3CJA A;  3L6Q A;  4IXC A;  2YCH A;  4K42 A;  4CI6 A;  4JD2 A;  2QWM A;  3FZK A;  3GDQ A;  3SMS A;  1MDU B;  1S22 A;  4H5T A;  5AQP A;  1NGC A;  4BRH A;  2QWO A;  2FSJ A;  2E20 A;  2E88 A;  3LM2 A;  3RSE A;  3H3N O;  4YDU A;  1XUP O;  2HF4 A;  3LM9 A;  1BO5 O;  3MMV A;  1SQK A;  2A41 A;  1QQO A;  4H0V B;  4NB4 A;  2A6A A;  2A5X A;  4YDU C;  4BRP A;  1BA0 A;  3H46 O;  5AQV A;  2Q0U A;  4L3Q A;  4H5R A;  3LL3 A;  4BR0 A;  2A3Z A;  2CH6 A;  1HKG A;  2GWK A;  4CZL A;  4CZJ A;  3DXM B;  1G99 A;  2GEL A;  4CBW A;  3CJ9 A;  2D4W A;  2VCP A;  1XC3 A;  5E84 A;  3ID8 A;  3EZW A;  3WXJ A;  4IZ9 A;  2H3G X;  3WUH A;  1NGD A;  3M6G A;  3GG4 A;  3R8E A;  3ENH A;  3H45 C;  4WQ4 A;  4H0T B;  2ZGY A;  3BF3 A;  3ZET A;  1QZ5 A;  1MA9 B;  2ZF5 O;  5FPN A;  3TPQ A;  5F0X A;  4CZI A;  4WQ4 C;  4JHD A;  2CGL A;  2PBD A;  4MO5 A;  5AQM A;  1ATS A;  3D2F A;  4H0X B;  1X3N A;  3UKU A;  1GLC G;  4BQL A;  5B8H A;  4H5W A;  3JS6 A;  3TU5 A;  2Q2R A;  4B1U B;  4A2B A;  1QQN A;  3QIC A;  4XH4 A;  1C0F A;  3A5L C;  4JD2 B;  5AQW A;  1U6Z A;  4CZE A;  3MN6 A;  4BR9 A;  3U8X A;  2Q36 A;  3VF2 A;  3ZX3 A;  4GNI A;  4CD3 A;  1BUP A;  3O5B A;  4XH1 A;  3RSE B;  2ZGZ A;  2FLO A;  3FZM A;  4IWV A;  1LOT B;  3HM8 A;  3AY9 A;  3OHR A;  4B1Z A;  4BRI A;  1HKC A;  2IVN A;  5CE3 A;  5BPL A;  5AQU A;  5AQS A;  1J6Z A;  1R59 O;  4A61 A;  2P9S A;  3O08 A;  5AQG A;  3VF6 A;  1NGJ A;  3LDQ A;  1ZXO A;  4DB3 A;  1U2V A;  3MDQ A;  2Q1N A;  4FPB A;  3A0I X;  3F9M A;  4H03 B;  4AM6 A;  3DXK A;  3KVG A;  3WXI A;  3ATU A;  2P9P A;  2P9K A;  4BR2 A;  1YAG A;  3UE5 A;  5AQH A;  4B9Q A;  3MK6 A;  3FFK B;  5BN9 A;  3KZB A;  4FWR A;  2V52 B;  4BRN A;  5EY4 A;  4FL9 A;  4I6M B;  3IMX A;  3CET A;  3L4I A;  3QBW A;  4JAX A;  3VET A;  4BR7 A;  1HLU A;  4H0O A;  1Q18 A;  1V4S A;  1ZBS A;  4IJN A;  5BPM A;  3EKS A;  4H5N A;  3ZET B;  2ASO A;  1QZ6 A;  3HTV A;  3B8A X;  3QDK A;  3J8A A;  1SZ2 A;  5FPM A;  3H1V X;  3R9P A;  4H0P A;  3GOI A;  2FXU A;  4CBU A;  4JHD B;  3DAW A;  1SAZ A;  4BC3 A;  3EL2 A;  5LY3 A;  5AQL A;  4IO8 A;  2GTD A;  3VEX A;  3D2F B;  3U4L A;  3UKU B;  3WT0 A;  4MLH A;  1NGI A;  4E1J A;  1S3X A;  1KAY A;  2E2P A;  2ZWH A;  5EVZ A;  4BRL A;  3BF1 A;  4ISE A;  1BDG A;  2V7Y A;  5FPE A;  3VPZ A;  4BG8 A;  3CI5 A;  5AQY A;  3U9Z A;  4EHT A;  4K43 A;  2WUS A;  1GLB G;  3QFP A;  2W41 A;  1JCE A;  1D4X A;  1BWF O;  4KBO A;  4BRE A;  5AZI A;  3UB5 A;  4BRO A;  5BRE A;  3AAQ A;  4FPA A;  2BTF A;  3GE1 A;  1LCU A;  3IUC A;  1NGE A;  4WQ5 A;  2YJF A;  2P9U A;  2ASM A;  3KHY A;  5BPN A;  4BC4 A;  2YHX A;  1X9J A;  3ATV A;  3U9D A;  1V4T A;  2P9S B;  2I7N A;  1NGA A;  2Q31 A;  1U2V B;  2V51 B;  4PKH A;  5AQI A;  3SJH A;  4RWT A;  3VEY A;  2W40 A;  2YI1 A;  3JXU A;  3DXK B;  1ATR A;  3I33 A;  3BP8 A;  1GLA G;  4RCH A;  4EAH D;  3WXK A;  2F9T A;  2P9K B;  2P9P B;  4PL8 A;  3UKR A;  5AZJ A;  3HI0 A;  1HJO A;  4B1Y B;  2I7P A;  3WEE A;  3VES A;  4C23 A;  5ADX H;  2P9L A;  5LJV A;  2GEM A;  2QWL A;  4M63 C;  4MO4 A;  1XQS C;  4PKI A;  1MWK A;  4B1W B;  4CZH A;  2EWS A;  3VEO A;  2PAV A;  5AQO A;  3CJB A;  4BGA A;  3FZF A;  3HBT A;  3MN7 A;  4FWP A;  4CD1 A;  5BRD A;  2FF3 B;  5ELZ A;  1GLJ O;  3DWL A;  3G25 A;  4CJ7 A;  3ZEU A;  4FWS A;  4O8K A;  3FE1 A;  5JMV A;  4BQZ A;  1KXP A;  4NO7 A;  4BR4 A;  1T44 A;  2BUP A;  1H1V A;  1YXQ A;  4FWO A;  5JIC A;  4FOE A;  4M7Y A;  1GLL O;  3WXL A;  2HMP A;  1P8Z A;  1ZC6 A;  1K8K A;  2CGK A;  3M3Z A;  3O80 A;  3EKU A;  5KQD A;  3O8M A;  2E1Y A;  1RGI A;  4O5F A;  4QS8 A;  4BRA A;  5AZI B;  5I9E B;  4FWK A;  5F2R A;  3ENO A;  1T6C A;  2VYP A;  3A5O C;  1HPM A;  2P9U B;  3QFU A;  1NM1 A;  5JLF A;  4BRC A;  4DQ8 A;  4CZG A;  1ATN A;  2V7Z A;  3SLC A;  4JNE A;  2VWB A;  1E4G T;  3EN9 A;  3BEX A;  2P9N A;  4ISG A;  4J8F A;  3AAP A;  4RTF D;  5EOY A;  2Q97 A;  4BRG A;  5AQX A;  1HX1 A;  5F1X A;  3VF4 A;  3GBT A;  1GLE G;  3P4I A;  2QW9 A;  1NLV A;  3CER A;  5AFU H;  4B1V A;  3UKR B;  5AZJ B;  4BRM A;  4EHU A;  5AR0 A;  1DGK N;  4Z94 A;  2QWP A;  2FSK A;  3HZ6 A;  3WEE B;  4FSV A;  2A40 A;  2IVP A;  3A5N C;  4PL7 A;  2P9L B;  3MN9 A;  3I8B A;  2HF3 A;  4B1X B;  4HWI A;  1QQM A;  5BRF A;  3W0L A;  5AQQ A;  3VEV A;  4CZM A;  1X3M A;  1DKG D;  3FGU A;  2YHY A;  1NMD A;  3CJ1 A;  3W3D A;  3O6W A;  2QWR A;  4BG9 A;  1NWK A;  3BUZ B;  2OAN A;  4FWL A;  2IVO A;  3ZEU B;  3SMP A;  1Y64 A;  5AQN A;  5AQZ A;  5FPD A;  4DHY A;  1QHA A;  2E8A A;  4M7X A;  3VOV A;  3D7E O;  4BVP A;  2P9I A;  1KAX A;  4BC2 A;  3CIP A;  1C0G A;  1CZA N;  1YUW A;  2ITM A;  1K8K B;  3C7N A;  2DPN A;  3VER A;  1DEJ A;  1TUU A;  4LC9 B;  4IJA A;  1NGG A;  3IFR A;  3MN5 A;  1YVN A;  5AQF A;  5E26 A;  4WQ5 C;  1WUA A;  2UYT A;  3CQX A;  2QWQ A;  3ULE A;  3VEW A;  4BRF A;  5AQR A;  1JCG A;  4FO0 A;  3ZX2 A;  3QML A;  2D0O A;  1E4F T;  2GUP A;  3D2E A;  3O1B A;  5EX5 A;  2FF6 A;  1GLD G;  1ESV A;  1EQY A;  2P9N B;  3GL1 A;  3R6M A;  5EXW A;  1IG8 A;  3QB0 A;  4BRK A;  3QBX A;  4H5V A;  2E2O A;  4K41 A;  3VEN A;  2NRH A;  1WOQ A;  5BR9 A;  2KHO A;  2ASP A;  1TYQ A;  3MCP A;  3CJ7 A;  4ISF A;  1BG3 A;  1Z6R A;  3L0Q A;  4BRQ A;  5ADX A;  4BRD A;  4Y0W A;  4BC5 A;  4FOI A;  4I6M A;  3VGM A;  3LDO A;  3WQT A; 
#chains in the Genus database with same CATH topology
 4DR6 K;  4DS5 A;  4JI7 M;  2UUB K;  2D0C A;  5KI6 A;  3G71 N;  1T6D A;  1RT6 A;  1BIZ A;  3OY9 A;  1BU6 O;  4FWQ A;  2QM1 A;  2NZT A;  2FBY A;  4B7G A;  2NLX A;  4DV6 K;  2KNZ A;  4AW4 A;  3TAG A;  3NVM A;  4CF1 A;  1G71 A;  5AQK A;  2B3T A;  3KKR A;  4GC9 A;  4AHU A;  5BN8 A;  2E2Q A;  4LF7 M;  1NJF A;  3BOS A;  1OFI A;  2KNA A;  4CZK A;  3JYT A;  2LH0 A;  4CGG A;  5EXS A;  2QXL A;  4KO0 A;  3I0S A;  3ZT0 A;  1VQ4 N;  4AZF A;  1VQ1 A;  1I94 M;  2C9C A;  1HKB A;  1GOC A;  3SYK A;  3ZCB B;  1WBB A;  4A59 A;  3C7N B;  4FVU A;  3OYD A;  5HRP A;  3K1J A;  2ZJR L;  1EFU B;  1Y8G A;  1C1B A;  2ITG A;  4F3T A;  1HNW M;  5LMN M;  1TGO A;  1HUX A;  2HW3 A;  4I4L A;  4I81 A;  2XFS A;  3LDN A;  5BPV A;  3VQD A;  5L8R F;  5CR4 A;  4NL4 H;  3L27 A;  4A2A A;  4N47 A;  3KLE A;  3KLG A;  3DXM A;  5KPZ A;  4WE1 A;  3U6L A;  4Y1C A;  4FWM A;  1T8E A;  4IBJ A;  4OPJ A;  2KRK A;  3SC3 A;  3SQ0 A;  4PCZ A;  1NNJ A;  1F4I A;  5M1O A;  3ITH A;  5LJW A;  4G4Q A;  4RNA A;  3FZL A;  5J1E A;  1Z05 A;  4DWI A;  3BZC A;  3RGP A;  4HEO A;  3U61 A;  1D2N A;  2GWJ A;  2JA2 A;  2WFB A;  3M1F A;  4ILJ A;  3HOT A;  2ZJP L;  3WNG A;  4CBX A;  4L8R C;  2HHQ A;  1KFD A;  4CHY A;  2W82 A;  5KPR A;  2A1S A;  4N41 A;  1YTU A;  1VSF A;  4BB9 A;  4N56 A;  1QDT A;  3UK6 A;  5DMR A;  3CQY A;  2E2N A;  4NXN K;  4YOW A;  5FRM A;  3LAN A;  3A8Y A;  2X8A A;  2QHO B;  2D1K A;  3CJA A;  3EE9 A;  3EO3 A;  3KXE C;  3L6Q A;  5J2Q A;  4B9T A;  3IKM A;  4IXC A;  4CGD A;  1NHW C;  3KWI A;  2G8U A;  4CGY B;  1IBK M;  3VK7 A;  4DUY M;  2HAK A;  1GL7 A;  3GDQ A;  4GIP A;  4LF5 M;  4BDY A;  4BE1 A;  3SMS A;  2UUA M;  4M3T A;  2KFN A;  4FJ8 A;  1S22 A;  4H5T A;  4NSO B;  3K2P A;  1NGC A;  4KTW A;  3N4Q A;  4WUR A;  1R6B X;  2FSJ A;  2E20 A;  1WBD A;  4ZTJ A;  4DQS A;  2JXN A;  3RSE A;  3HHY A;  4YDU A;  3QIN A;  2OPS A;  2Y20 A;  3HWS A;  1XUP O;  4MGH A;  1BO5 O;  3HRG A;  3OYH A;  1VDD A;  4H0V B;  4NB4 A;  4HUG A;  4HUF A;  1YUB A;  4YDU C;  4BRP A;  1EE8 A;  2RRU A;  3LP1 A;  3LP0 A;  8CAT A;  4IBB A;  3O3G A;  1R4G A;  4H5R A;  4DV2 K;  3V81 A;  3W68 A;  4M3X A;  3LL3 A;  1TTE A;  2GBZ A;  4M3U A;  2GWK A;  1HKG A;  3KVW A;  2IAJ A;  2NRV A;  1L3S A;  3VQP A;  3CJ9 A;  4F2L A;  3FFI A;  1QTM A;  4K8X A;  1XWL A;  2KNV A;  4B3S K;  1YJ9 N;  4RF0 A;  4AHC A;  3CXC M;  2KQ2 A;  4F1I A;  3OYL A;  3TAB A;  3GRV A;  3HU2 A;  3DRP A;  4CFB A;  3VQA A;  3QEW A;  2F8S A;  5C42 A;  1BL3 A;  4GHL A;  3AA4 A;  2LWX A;  4GKJ M;  5FPN A;  1QUT A;  2JY6 B;  3PNV A;  5EXT A;  4OPH A;  5HRO A;  1KSP A;  2C9O A;  3AJI B;  1KRP A;  4IDH A;  4LFA K;  3QEP A;  1TV6 A;  2QZ4 A;  3RMA A;  3M8R A;  4JEP A;  3UKU A;  4JYA K;  4BQL A;  1F21 A;  3KOW E;  2UXD M;  3TU5 A;  1TKX A;  4KOD A;  3GLI E;  4CVN E;  1HR0 M;  2DHY A;  4O0I A;  3HJ8 A;  2CHG A;  1BCO A;  3MN6 A;  4Q5V A;  3CCS N;  3AVK A;  4JI2 K;  3QEV A;  4PY5 A;  3QAU A;  4DR2 K;  1NSF A;  2YNM D;  3JR4 A;  1VEG A;  3T15 A;  5EP2 A;  4W5W A;  1GL6 A;  3TAM A;  1BUP A;  4GRI A;  1E9R A;  3FUW A;  3O5B A;  3WXM B;  4LJ9 A;  3HY5 A;  3ZH9 B;  3LP3 A;  1KLN A;  3QYB A;  3HHW A;  1NK6 A;  3HM8 A;  3AY9 A;  2QCU A;  4R79 A;  4IOX A;  4LY7 A;  4IEE A;  4ICL A;  4BY9 C;  4JK9 A;  4JI1 M;  4KAZ A;  4LH5 A;  1WJ7 A;  5ITX E;  3SAR A;  3VF6 A;  4B9S A;  4GEW A;  1NGJ A;  4L4U A;  3LDQ A;  1ZXO A;  3CPE A;  4YFU A;  1TAU A;  4KHS A;  3U3G A;  2OPQ A;  2VWJ A;  5FLX O;  1OAI A;  3VQ6 A;  1TKT A;  1DGF A;  4DF4 A;  1HRH A;  3OS2 A;  3KVG A;  2WSC F;  4BE2 A;  1HQY E;  3DRS A;  1NK8 A;  2O4I A;  2YR0 A;  2J5Y A;  3L2R A;  2DTU A;  1NJY A;  1YAG A;  3HVT A;  3PX0 A;  4E7I A;  4FK4 A;  3K0S A;  2OPP A;  1N75 A;  2V52 B;  5C10 A;  4FL9 A;  1TK5 A;  1FJG K;  2DZL A;  2FBV A;  1VSE A;  4BR7 A;  3VET A;  3PY8 A;  1Q18 A;  1N32 K;  5BPM A;  3EKS A;  1ZBH A;  3HO1 A;  2G8K A;  2F5Q A;  3KS8 A;  3L4Q A;  3KWG A;  5F3W A;  2V1U A;  4R71 A;  4CBU A;  4LFC K;  1VQ7 N;  3J80 S;  3OYE A;  4NOO B;  1NK9 A;  2LVQ D;  4KI6 A;  4JXJ A;  3J7Y P;  2C98 A;  3WT0 A;  4X66 M;  1ZMW A;  3EE8 A;  4DR5 K;  2XY5 A;  4E1J A;  1J7K A;  2WOM A;  1S3X A;  5EVZ A;  3NBX X;  2JUJ A;  3QWL A;  3NMU A;  3IAY A;  1BDG A;  2X49 A;  2YNI A;  3ZSZ A;  4F3O A;  3FTF A;  1R0A A;  3HU1 A;  1S1U A;  4JK7 A;  4KH5 A;  3U9Z A;  3HU3 A;  1O1W A;  2WUS A;  1N34 M;  1NMN A;  1VQL N;  2ZE2 A;  3PXG A;  3E46 A;  3NF9 A;  3CC4 N;  3DM2 A;  3M7G A;  3GLI B;  2CV1 A;  3A98 B;  4A5B A;  4BRO A;  3AAQ A;  2BTF A;  1LCU A;  4JLH A;  1NY6 A;  3J7A S;  2P9U A;  4JRQ A;  4CEF A;  1YLA A;  3ATV A;  5M1Q A;  5MLC Q;  2F5O A;  1B92 A;  1C1A A;  4O44 A;  2R0I A;  4RWT A;  4WFN L;  1TH2 A;  4QOZ B;  2ERC A;  2QKK A;  2BWB A;  3U6O A;  3I33 A;  3P1G A;  3SZ2 A;  2MRO B;  4M45 A;  4RCH A;  4FWD A;  2MGW A;  2HHX A;  5DYI A;  2VQF K;  1QHT A;  2E6L A;  1NNU C;  1X9W A;  5AZJ A;  3SUN A;  2LVP C;  4OVZ B;  3I51 A;  3THX B;  4KHP M;  5HRR A;  4HCC A;  3U6D A;  4JI8 M;  5FTN A;  4C23 A;  3OYN A;  1TL3 A;  1LV5 A;  2YQZ A;  3VKG A;  1RTD A;  2P9L A;  3K9P A;  3NCI A;  1Q9Y A;  5KTQ A;  3SAS A;  2GEM A;  2H5X A;  1XWI A;  4M63 C;  3D0P A;  5EQT A;  1RBU A;  4PKI A;  1D0L A;  2OOB A;  3U6P A;  3ZSR A;  4CZH A;  5D3G A;  1E32 A;  1BHL A;  1RBT A;  3CJB A;  4DV3 K;  3RRH A;  3FZF A;  3HBT A;  3RFW A;  3MN7 A;  2CUZ A;  4BDZ A;  5BRD A;  2FF3 B;  1Q81 O;  1IY2 A;  1GLJ O;  3DWL A;  3K9J A;  3UMM A;  4O8K A;  4CGJ A;  3FE1 A;  4KB0 A;  1QE1 A;  3H4M A;  1JL1 A;  1KXP A;  4R3D A;  2WTU A;  3ZT4 A;  4NO7 A;  1XNR M;  1T44 A;  3E01 A;  1WAJ A;  4RW7 A;  1NJZ A;  2L7H A;  1L5U A;  1H1V A;  4CEO A;  2OZM A;  3RWU A;  4FJ5 A;  4FOE A;  3NWL A;  3WXL A;  4KO8 A;  1VEK A;  2KKZ A;  1K8K A;  2CGK A;  3O80 A;  1RT3 A;  1HT2 E;  3EKU A;  1D5A A;  3DLH A;  2FNA A;  3I04 M;  1GO5 A;  4CEQ A;  3CYM A;  4AQY K;  2NRR A;  3GLH B;  4OJR A;  1N6Q A;  1REV A;  4LCB A;  4X65 M;  4QS8 A;  2Z1H A;  4JKA A;  5AZI B;  4BRA A;  5FTL A;  4AH9 A;  4CJ6 A;  3KK7 A;  3GRU A;  1XNQ M;  3ENO A;  3MCA B;  1Q7Y O;  2QBY A;  4PDG A;  1PJI A;  3CF6 E;  4JKE A;  3Q8X A;  4KH4 A;  1VSM A;  4DV1 M;  1BI4 B;  1TH4 A;  3ZSV A;  1UOC A;  4BWM A;  2HHU A;  1ATN A;  3P5J A;  4DV4 M;  2YKN A;  4IO9 L;  3E9O A;  4FJI A;  4NYN A;  2P9N A;  5GIP A;  1RBV A;  1W5T A;  1PJQ A;  3VF4 A;  4C8L A;  3GBT A;  4DFK A;  1GLE G;  4JV5 K;  3K5L A;  4LJ4 A;  4AI6 A;  2VGM A;  1D9D A;  4KHW A;  3IG8 A;  3DLL L;  4Z0U A;  4MM3 B;  1DT9 A;  3HOS A;  4DUZ K;  3LMM A;  5C1B A;  3MEC A;  3O9T A;  3Q8G A;  4Z94 A;  1G15 A;  4LF6 M;  1W5S A;  4FZZ A;  4IOA L;  4FSV A;  2IVP A;  3NVK A;  2LNH C;  4Y28 F;  1WSJ A;  3BGR A;  4AKH A;  1N5Y A;  5IT9 S;  2H1R A;  2HF3 A;  2ZAN A;  3QET A;  4Q0B A;  1N36 K;  2UXC K;  3THG A;  3GPP A;  2Y1J A;  3BBZ A;  3VEV A;  4G1Q A;  1X3M A;  3B74 A;  3B7Q A;  4EZ9 A;  3AOE C;  1TVR A;  4CHO A;  4JI0 M;  3WNF A;  3PSF A;  3T1A A;  1Y64 A;  5AQN A;  1Z5C A;  5FPD A;  5C0Y A;  4DHY A;  4FM1 A;  1LWF A;  1IY0 A;  5CY4 A;  1BGX T;  4HCB A;  2CWB A;  4UY8 O;  3CD6 N;  3AVB A;  1K73 O;  3RE8 A;  1YUW A;  4FD2 A;  3KDS E;  5A2Q S;  2F96 A;  3C7N A;  3D6R A;  2ITM A;  5C2D A;  3OTO K;  3KLF A;  4DTO A;  4FW1 A;  3GRR A;  1DEJ A;  2F5P A;  2DY4 A;  2JY5 A;  3IFR A;  1RTH A;  3NH1 A;  1YVN A;  1YVU A;  3P39 A;  2DWM A;  3L28 A;  5E26 A;  4E7K A;  4WQ5 C;  2E5L K;  2UYT A;  2VF8 A;  1S1X A;  2YNG A;  4BRF A;  1JCG A;  4W5T A;  1A5W A;  1ORY B;  3QML A;  4CGH A;  3O1B A;  3O4Q A;  2LTU A;  4LD0 A;  4GIT A;  2FF6 A;  1GLD G;  3TTC A;  3FD9 A;  1ESV A;  3EY1 A;  1GVN A;  3QIO A;  3R6M A;  5EXW A;  4BRK A;  1IG8 A;  5EXX A;  5J2N A;  3TAQ A;  1ZBL A;  2P5O A;  1QZM A;  4CHP A;  1TKZ A;  2EUC A;  4HL4 A;  3VEN A;  1CLQ A;  3P38 A;  4LSL A;  4H8K A;  4CIS A;  1UFZ A;  1G59 A;  5DM6 L;  4G4O A;  4ISF A;  3M0E A;  1BG3 A;  4QNM A;  1E9S A;  1MN3 A;  3V6D A;  3T7Z A;  3I01 M;  4PDI A;  1YF5 L;  3T1H M;  1FXX A;  5FRN A;  2O8F B;  3HM9 A;  3VGM A;  4IO8 A;  4B7H A;  3G6E N;  1SV5 A;  3M8P A;  4K8Z A;  3H6E A;  1BQN A;  3I55 N;  3HSC A;  1HYS A;  3K5M A;  3ZQJ A;  4DF8 A;  3PNY A;  1Q39 A;  4A62 A;  3FR0 A;  2DZN B;  2F9W A;  2HBJ A;  3W0L B;  1BIS A;  1AUA A;  2IS3 A;  3NFA A;  1OKJ A;  3QEI A;  2QWN A;  3FE3 A;  3LVV A;  3SAW A;  4DFJ A;  4CJF A;  1IM2 A;  3V76 A;  2ZM6 M;  1G41 A;  3CFO A;  4ZHR A;  1VSK A;  1K82 A;  4CJT A;  3D8L A;  3C3D A;  1XXH E;  4CHN A;  4J2A A;  1CZB A;  1L1Z A;  4DLG A;  1RDB A;  2QXF A;  3ZSO A;  2P9I B;  4PKG A;  3VGL A;  3OYJ A;  2VII A;  2HBM A;  4CJR A;  1L2B A;  2J4R A;  2Q0R A;  4EIA A;  4LZJ A;  3OYM A;  3R3L A;  4BR5 A;  1RTJ A;  3SPY A;  1NGH A;  2K47 A;  3FTE A;  2HOE A;  4DTN A;  4X64 K;  3ULE B;  1OH8 A;  3ZX0 A;  1HPZ A;  3H1Q A;  3TWH A;  1ITG A;  1OJL A;  1QUS A;  3ZSX A;  3D2E B;  1X1P A;  1TH3 A;  3TL4 X;  1PJT A;  5CYM A;  3VGK A;  4DTJ A;  3NE6 A;  4DV0 K;  2D0P A;  3A42 A;  2BDP A;  3HKP A;  4GY2 B;  2FSN A;  2YJE A;  3CJC A;  4FZX C;  5AFU A;  1DGH B;  5JLH A;  5BRH A;  1NKE A;  5FDL A;  3TE6 A;  2CH5 A;  1TYQ B;  3TI0 A;  4OU7 A;  4D82 A;  3THY B;  3KK3 A;  1B9D A;  2QK9 A;  4F2R A;  2HVH A;  3I0R A;  4DU3 A;  5AQT A;  4QCL A;  4KFB A;  2ZTC A;  1NGF A;  4CEB A;  2XLJ A;  1T05 A;  3C94 A;  1WSI A;  1FKP A;  4BWJ A;  1MU2 A;  3SNN A;  2AJQ A;  2XY8 A;  1L3T A;  2WSF F;  5HOO A;  1NOZ A;  3LZJ A;  1IKW A;  3MWT A;  3NH2 A;  3SAF A;  4OPK A;  4KTZ A;  2G8L A;  1H6U A;  4IBI A;  5FTJ A;  4CFC A;  2DKL A;  2KW0 A;  1C1K A;  3A45 A;  5AQP A;  3U5Z B;  4E1N A;  4BRH A;  3CC7 N;  2KZS A;  2HNZ A;  3OS0 A;  1VRT A;  3LM2 A;  3MXI A;  4IBF A;  2G8V A;  3J27 B;  3FTC A;  3BY5 A;  3CFR A;  3LM9 A;  1I3A A;  1VQ8 N;  1K9M O;  5ITQ A;  4YY3 M;  4LY6 A;  2A41 A;  1C0T A;  1WNS A;  4AF1 A;  3TAN A;  1BA0 A;  2OQ4 A;  4QAG A;  3CCE N;  3AKZ A;  1TGU A;  2Q0U A;  3KP1 E;  4L3Q A;  1NKC A;  1XXH B;  3V1O A;  1WGN A;  4RKU F;  3VQE A;  2ZAM A;  1TF0 B;  1J54 A;  4CZL A;  4FWG A;  4IFE A;  2GEL A;  4CBW A;  3T1Y M;  1YHQ N;  2HST A;  4DSK A;  3AVL A;  4AHS A;  1IBL K;  1QAQ A;  3HHZ A;  1ZBU A;  2VCP A;  4DV7 M;  1XC3 A;  2DI0 A;  3JAM S;  4FK2 A;  4FWH A;  2R18 A;  5E84 A;  1JKH A;  3WXJ A;  4OKJ A;  2VQE M;  4QNR A;  1NGD A;  4FM2 A;  1WIV A;  1IN5 A;  1S9G A;  3GG4 A;  3AVG A;  3EYZ A;  3ENH A;  4JI4 K;  1IH7 A;  2BGG A;  2LVA A;  4NCG A;  3THV A;  3VQQ A;  5F0X A;  2B5J A;  4CES A;  1XHB A;  4D81 A;  4LF4 K;  4XIU A;  2DHR A;  4MO5 A;  1KVB A;  2OA8 A;  1ATS A;  1ZQ9 A;  1WAF A;  4H0X B;  3GQ4 A;  1X3N A;  1IO2 A;  4B1U B;  1G8P A;  4A2B A;  1QQN A;  4CJK A;  3C3E A;  4XH4 A;  4JD2 B;  5IWA K;  4LSN A;  1Z59 A;  1U6Z A;  5DK5 A;  5AQW A;  4CZE A;  4DQP A;  1VAZ A;  4B8C A;  2RKI A;  3AV0 A;  3AVJ A;  1NG9 A;  1T43 A;  3K57 A;  4C8O A;  2LVO C;  2F4V M;  1RNH A;  4I8O A;  1EX4 A;  1OTR A;  2MR9 A;  4GC5 A;  4M9Z A;  4M9X A;  3GLI A;  3AVA A;  3FZM A;  1LOT B;  1LWE A;  1X9S A;  3VDU A;  2R46 A;  4B1Z A;  2UU9 K;  3KJV A;  1Q82 O;  5BPL A;  4CIZ A;  1J6Z A;  3ZLJ A;  1LTM A;  2JY8 A;  3O08 A;  3CF2 A;  5T7B A;  4DB3 A;  1QSL A;  3B7N A;  4LF8 M;  3MDQ A;  1BVS A;  3AVM A;  3KIO A;  1M90 O;  4FPB A;  4LG2 A;  1XMQ M;  3A0I X;  4W5Q A;  1SXJ D;  3VK8 A;  1L3V A;  3PV8 A;  1X9M A;  4AIL C;  3E9P A;  3ATU A;  4BR2 A;  4QOZ C;  2D7G A;  3THX A;  4OVZ A;  3F92 A;  3FFK B;  4B08 A;  5ITX A;  1HNX M;  3KZB A;  4FWR A;  4KI4 A;  2KTQ A;  1LW2 A;  4W5R A;  4CEE A;  3QBW A;  4JAX A;  4JKD A;  1RDU A;  4KHU A;  2HL7 A;  1IXR C;  4H5N A;  3ZET B;  4UN2 B;  2ASO A;  1QZ6 A;  5M1K A;  1SZ2 A;  4GV9 A;  4X62 M;  3TWM A;  4G4N A;  1RT4 A;  4JHD B;  1SAZ A;  4BC3 A;  1U45 A;  2DWL A;  4ID5 A;  5AQL A;  4N5S A;  2GTD A;  1FKO A;  3TAE A;  3SQ1 A;  1BQM A;  2M5Z A;  5FTK A;  2HMI A;  4OX9 K;  2G8H A;  3VQ4 A;  4CJW A;  2ZWH A;  1KAY A;  3M8Q A;  3VQ5 A;  4BRL A;  1XNR K;  3TQS A;  4C8N A;  3MXJ A;  4FLT A;  3KD5 E;  5GAG P;  3K9K A;  3J7A P;  2VG6 A;  2GUI A;  5JS2 A;  5FRO A;  5EP1 A;  1I39 A;  4EHT A;  5GAE P;  3NDK A;  3ZSY A;  3G10 A;  1W9H A;  2XO7 A;  1GLB G;  3QFP A;  4JI6 K;  2RN2 A;  2W41 A;  1BWF O;  1LAV A;  4LFB K;  3GLH A;  4BRE A;  2JWL A;  3SCX A;  5AZI A;  2G8W A;  1XNQ K;  2FBX A;  1JJ2 M;  3J81 S;  4FXD A;  5BRE A;  4B3R K;  2DAI A;  4FJL A;  3GE1 A;  1Z5B A;  1NGE A;  1KSF X;  3NGI A;  3FRH A;  2QI2 A;  2ASM A;  2E4L A;  5BPN A;  3OW2 M;  1BI4 A;  4DV4 K;  3FUU A;  2YHX A;  4B3T K;  1L2C A;  1X9J A;  4M42 A;  4BBA A;  3U9D A;  2WBN A;  1ZBF A;  2P9S B;  2Y0Q A;  3HK2 A;  2I5J A;  2I7N A;  1U2V B;  4CJQ A;  4CGI A;  1Z5A A;  3V9X A;  3CPW M;  3VEY A;  4JI5 M;  1OQY A;  1Q3C A;  5CHI A;  1KQS M;  3LPT A;  2WSE F;  1KD1 O;  3N4P A;  1GLA G;  3GLF E;  1C6V A;  2BH1 A;  2P9K B;  2P9P B;  4PL8 A;  3HJF A;  1HJO A;  4B1Y B;  2I7P A;  3CMA N;  1D8Y A;  3VES A;  4DR3 K;  1SL1 A;  3J7B A;  1SS6 A;  5AJ3 K;  3HST B;  3LP2 A;  5EP4 A;  2PZS A;  3DOA A;  3O9S A;  4B1W B;  1VSH A;  1HQU A;  3IHP A;  3VEO A;  4NXM M;  2QKB A;  3DRR A;  2VGN A;  1S6P A;  4CD1 A;  4P17 A;  2K6B A;  4FJK A;  5JS1 A;  3KKS A;  4OVL A;  1V34 A;  4KRF A;  3CCV N;  5ELZ A;  4CJ7 A;  3HL8 A;  1K8A O;  3JSM A;  4FLX A;  3SI6 A;  1JLA A;  3M5R A;  1NK0 A;  1J5O A;  4CGF A;  1S3S A;  1N33 M;  5JMV A;  3S9H A;  2EKF A;  2Z3X A;  4WW0 A;  2JGU A;  4B9N A;  5M1F A;  1P8Z A;  5H1S Q;  1EIJ A;  2KZU A;  4JKH A;  4CJ3 A;  3THW B;  3RRG A;  4GVM A;  4DFM A;  1NKB A;  3O8M A;  2G8F A;  4CER A;  1IN4 A;  3B9P A;  4WP2 A;  1NK4 A;  3RR7 A;  5I9E B;  2BWE A;  4S12 A;  4FWK A;  4KPY A;  5HBM A;  4C1N I;  3MAQ A;  1T6C A;  1FW6 A;  2VYP A;  4GHA A;  5BR8 K;  4LGM A;  2R4E A;  3QFU A;  1VDL A;  1NM1 A;  1TKD A;  4DQ8 A;  3H4J A;  4JNE A;  2VWB A;  1E4G T;  3AA3 A;  4FCW A;  2EKK A;  1J5E M;  3BEX A;  2MH8 A;  3EN9 A;  3AGR A;  3LZI A;  1HYZ A;  3T19 A;  3IG5 A;  4DR1 M;  2PFU A;  5GAH P;  4NCA A;  4RF1 A;  5JVH L;  3RR8 A;  2X4A A;  2X6N A;  1NLV A;  2C99 A;  1XMO M;  1GJS A;  4O4G A;  5AFU H;  3UKR B;  3DLG A;  3T6P A;  3WNE A;  4EHU A;  4CJ4 A;  1D0K A;  5AR0 A;  3SUP A;  1DGK N;  2FSK A;  3SBG A;  2O8F A;  1ZMV A;  5E6J A;  3OYF A;  2A40 A;  3A46 A;  4DR4 M;  4YOY A;  2LXE A;  3L2Q A;  4DTX A;  1PM5 A;  4L78 A;  3I8B A;  3L2V A;  4JI3 M;  1SG9 A;  3LCV B;  4IEI A;  2R45 A;  4OPA A;  4HWI A;  3GLF B;  3AO4 A;  3W0L A;  5AQQ A;  7CAT A;  3DOK A;  1LAW A;  1DKG D;  1A5V A;  1QS4 A;  2YHY A;  2KHH A;  2R7Y A;  1W2B M;  2YHA A;  3O6W A;  3W3D A;  3U3Y A;  2UUB M;  1NWK A;  3BUZ B;  3KOX E;  4FWL A;  3ZEU B;  2O5R A;  3SMP A;  2ZD1 A;  1U48 A;  2KZZ A;  4DV6 M;  3S3N A;  2P9I A;  3IEC A;  1KAX A;  1A5T A;  4H4O A;  3J80 O;  4J2E A;  1KVA A;  4CJP A;  3B89 A;  1CZA N;  2YV0 X;  1PGY A;  2G3Q A;  3NBI A;  1RT2 A;  4B3M K;  1L1T A;  3F5T A;  1NNE A;  1S1T A;  1TUU A;  4TUW A;  4LC9 B;  4G3O A;  2X6S A;  5C24 A;  1SXJ E;  4ELU A;  2YNH A;  3ULE A;  1T3T A;  3VEW A;  3GO8 A;  4FO0 A;  3B7Z A;  4FW9 A;  3SYZ A;  1R5L A;  4MH0 E;  5ITT A;  1J53 A;  1E4F T;  3D2E A;  4HTU A;  1U04 A;  3Q7C A;  1P3Q Q;  5EU7 A;  5C18 A;  2UUC K;  3GPY A;  2QTD A;  3AO3 A;  4YHH K;  3E9S A;  1IN7 A;  3FYD A;  1A5X A;  1EQY A;  2W42 A;  3QB0 A;  1YSY A;  2M60 A;  1VSL A;  3QBX A;  1S1W A;  3ASM A;  2BNK A;  3V9S A;  3FUX A;  1QAN A;  3AVN A;  2E2O A;  3TTF A;  1DGH A;  4K41 A;  3KS4 A;  1WOQ A;  4PQU A;  2KHO A;  1TYQ A;  4RW6 A;  2HNY A;  3CJ7 A;  3SQ4 A;  3THY A;  1Z6R A;  1SKS A;  2KW4 A;  5ADX A;  4Y0W A;  4FOI A;  4R7G A;  4I6M A;  2O8D B;  1RFQ A;  4G6Z A;  5I3U A;  4L8R B;  2XSZ D;  4ZTF A;  2YHB A;  5M1N A;  2XHB A;  4BAC A;  4E0D A;  4GKK M;  4FLY A;  1ILY A;  4ELT A;  1DTQ A;  1BA1 A;  2KZM A;  2KRU A;  3PVS A;  4K25 A;  4B9M A;  1EET A;  4IJF A;  4KLN A;  4H4M A;  3ZYY X;  2CGJ A;  3AV9 A;  2HHH K;  1V33 A;  4NXN M;  2E1Z A;  4CK3 A;  1JB0 F;  5GIO A;  3LWM A;  1RDW X;  3U5Z A;  2ZJQ L;  2YHW A;  3KK1 A;  4XBO A;  2XEP A;  5TKY A;  4C8K A;  1C7Y A;  4DCH A;  2A42 A;  1E3M A;  1VQM N;  4IBK A;  1NU0 A;  4LF9 K;  2XY6 A;  1FK9 A;  3LCU A;  2CE7 A;  3FLC O;  3FZH A;  4DV5 K;  4DLE A;  2QQ8 A;  3DMJ A;  2AA4 A;  3VEZ A;  1IFY A;  4MGZ E;  3CM6 A;  4FWN A;  2Z7J A;  1IJJ A;  5DFL A;  3R9X B;  1ASV A;  4LH4 A;  4E3S A;  3WQU A;  4W5N A;  4E89 A;  1PJJ A;  4IKF A;  3FKE A;  1UAX A;  1YJN N;  1XXH A;  3O4W A;  3C65 A;  2LHG A;  3KTQ A;  3BDP A;  3PIP L;  4K0K M;  3AVI A;  3LAL A;  3ILK A;  2DAK A;  2AP1 A;  3OYI A;  2KFZ A;  3FUT A;  4TSX A;  4OW0 A;  3CHW A;  3IDH A;  4IBE A;  3LDL A;  3AAR A;  1GOA A;  4DV2 M;  1MWM A;  2QEN A;  2Z4R A;  1IN8 A;  1UA0 A;  2Y0T A;  4LGY A;  1SXJ B;  3GLG E;  5FTM A;  4M41 A;  4N76 A;  4JI7 K;  3K5N A;  4V19 S;  3S41 A;  4BVO A;  4H0Y B;  1Q8I A;  4I2P A;  4O55 A;  3DLB A;  2QA4 N;  3QIP A;  3K9O A;  3IG1 A;  5GAD P;  2G8I A;  2O8E B;  1NBW A;  3HJQ A;  3DJC A;  2DZO B;  1J9A A;  4BDP A;  4B3S M;  5JI3 E;  1EP4 A;  1AIP C;  3SK3 A;  1VQ6 N;  3AOG A;  1KAZ A;  3C6A A;  3DLR A;  4F9O A;  4LF7 K;  3KSX A;  1VSI A;  3A5M C;  2F8T A;  4MLE A;  4DFP A;  2WON A;  1C0U A;  3AVF A;  3VQ9 A;  1NJI O;  2APL A;  4D80 A;  3ZT3 A;  3VQ8 A;  4K42 A;  1I94 K;  3EIE A;  2GX9 A;  4JD2 A;  4CI6 A;  1VSD A;  4XK8 F;  2QWM A;  5IT9 O;  4Z4G A;  4LFA M;  5KRT A;  4BLC A;  5IZ7 D;  3QER A;  3GRY A;  2F4V K;  4JYA M;  1QZE A;  1Z26 A;  1HNW K;  2QWO A;  5LMN K;  1NY5 A;  3SUQ A;  2ZAO A;  3H3N O;  1KTQ A;  2OPR A;  2PYJ A;  2HF4 A;  2HKJ A;  4O8U A;  4GMJ B;  1OKS A;  4CF2 A;  1S1V A;  2EHG A;  1SQK A;  2HHT A;  4CJ5 A;  4DR2 M;  3T3F A;  2A6A A;  2A5X A;  1L8Q A;  1NHG C;  2J7O A;  3MJ5 A;  3L3V A;  4FLU A;  2RF2 A;  2YX6 A;  5JI2 E;  3W67 A;  5CYQ A;  3PO4 A;  3FUV A;  2DWN A;  4U67 L;  3HPG A;  2CH6 A;  4DR7 M;  4CZJ A;  4J2D A;  3T69 A;  5A2Q O;  3TSU A;  1G99 A;  2Y1I A;  4MB7 A;  2D4W A;  4MDA A;  4DQR A;  4F4K A;  4LJ8 A;  1IG9 A;  1N77 A;  1CZ9 A;  1HNX K;  4IZ9 A;  2H3G X;  3WUH A;  3VQ7 A;  3OYC A;  3L26 A;  4IIW A;  4DS4 A;  3R8E A;  2Q3S A;  2VG5 A;  3OA9 A;  1OVQ A;  2JZ0 A;  3HJS A;  4WQ4 A;  5LL6 Z;  3ZET A;  1DO2 A;  2GNO A;  1LWC A;  4X62 K;  1MA9 B;  4WF9 L;  2ZF5 O;  3U60 B;  3DLE A;  3KW6 A;  1IKV A;  3TPQ A;  2OTJ N;  4BE0 A;  4CZI A;  4JKB A;  4WQ4 C;  4JHD A;  1IBK K;  4JKG B;  1FJG M;  2PBD A;  1DLO A;  4DUY K;  3GLG B;  4RW9 A;  4CW7 B;  3GP1 A;  4LF5 K;  3SQ2 A;  2UUA K;  1OIZ A;  4IBD A;  1QVG M;  1N32 M;  1DGG A;  1GLC G;  1QQW A;  5B8H A;  3UJN A;  4DSJ A;  1WSF A;  3DFZ A;  4H5W A;  1KLM A;  2Q2R A;  3PFI A;  3SBJ A;  1Y97 A;  3LW5 F;  4LFC M;  1JXB A;  3NHG A;  4FJN A;  1E94 E;  4BR9 A;  2Q36 A;  2DAG A;  1NOY A;  3CFP A;  5SWM A;  4U7B A;  2O4G A;  1J09 A;  3LWL A;  4GNI A;  3IRX A;  3RMB A;  1VQO N;  1JLE A;  4QHS A;  4G9Z A;  1VHX A;  4G4R A;  4KRE A;  4CCH A;  3QYE A;  2FLO A;  2P5T A;  4I9Q A;  3SV4 A;  4CHQ A;  1VRU A;  3OHR A;  2O8C B;  1WXQ A;  4BRI A;  4OLA A;  1OAO C;  3LQQ A;  3VDP A;  3C6U A;  2K9D A;  2BAN A;  4A5A A;  2RGO A;  3U6Q A;  5CE3 A;  1RU3 A;  5AQU A;  3SV3 A;  4A61 A;  1R59 O;  5J2P A;  2P9S A;  5AQG A;  3C6T A;  1U2V A;  2NRZ A;  4HHT A;  3F9M A;  4H03 B;  5JVG L;  2FFJ A;  3CC2 N;  3MEE A;  1OH6 A;  4B7F A;  1OH7 A;  4FVM A;  3WHK A;  3E9L A;  2QPA A;  3O9R A;  1VQP N;  2P9K A;  2P9P A;  4GKJ K;  3K2L A;  5AQH A;  2LHC A;  1DO0 A;  4B9Q A;  3MK6 A;  4EZ6 A;  3QEX A;  4EIW A;  3AL0 C;  1MX0 A;  5EY4 A;  4C1N K;  4I6M B;  3IMX A;  1U47 A;  3U6F A;  3HT3 A;  3CET A;  3CCJ N;  1K6Y A;  1ZBS A;  4IJN A;  2VQF M;  2UXD K;  3AVC A;  4DU4 A;  3B8A X;  4NXM K;  3J8A A;  1HR0 K;  3LPU A;  5FPM A;  4H0P A;  2FXU A;  2Z1I A;  3DAW A;  2JWK A;  3EEQ A;  4KT0 F;  1IY1 A;  2XRI A;  3EL2 A;  4NYF A;  3D2F B;  1OH5 A;  4MLH A;  3UIQ A;  2B4J A;  2G5G X;  4GMQ A;  1Q02 A;  5EXP A;  3BF1 A;  3NAE A;  1WSG A;  1JLG A;  3DYA A;  2O8B B;  1JR3 E;  4ANR A;  1VQ5 N;  4GV3 A;  4DV3 M;  4ZPX A;  2CEA A;  1C0M A;  5FPE A;  4ILG B;  4CE9 A;  3VPZ A;  4BG8 A;  2NQ8 C;  1VK0 A;  3AFH A;  2F5S A;  3L25 A;  2XGN A;  5AQY A;  4NLC A;  4AHV A;  2WZJ A;  3PIO L;  3THW A;  1SL2 A;  4K43 A;  1XI1 A;  3AA2 A;  1JXE A;  4JI1 K;  3VTH A;  4IG3 A;  2DFH A;  4M0W A;  4JKC A;  1BCM A;  4KV8 A;  3UB5 A;  3A2F A;  2PYL A;  2ZTD A;  4PHT X;  3I8D A;  1QSY A;  3SHG B;  1XC8 A;  4BC4 A;  1J5E K;  3TAF A;  4AQY M;  1KCF A;  1V4T A;  4E1M A;  4DQQ A;  1MU5 A;  1GJT A;  2B6A A;  4FW2 A;  4PKH A;  3J7Z O;  5AQI A;  4A3V B;  3SJH A;  2W40 A;  3JR5 A;  1L2D A;  2YI1 A;  3JXU A;  2RPI A;  4REZ A;  3DXK B;  1ATR A;  4OGE A;  4FLW A;  2IGI A;  4E19 A;  4EAH D;  5C12 A;  3C9P A;  4AG5 A;  2F9T A;  3UKR A;  4B3O A;  3FYC A;  3O9U A;  1IV0 A;  1QQC A;  4DTM A;  1NJW A;  4LZZ A;  1TR8 A;  1WSE A;  4DR4 K;  1SKR A;  2DNA A;  5ADX H;  1RT5 A;  5HL7 L;  3U6M A;  4JV5 M;  2HVI A;  2NUB A;  5TKW A;  2QWL A;  3E21 A;  2D5R A;  3ALY A;  4X66 K;  1XQS C;  3R1X A;  3JAM O;  1N8R O;  1MWK A;  1IN6 A;  4DUZ M;  1N78 A;  3GLF A;  3CCL N;  1TDZ A;  3TR8 A;  2C96 A;  1HNZ M;  2PAV A;  3MEG A;  5AQO A;  4BGA A;  3KSJ A;  4FWP A;  1UA1 A;  3ZT2 A;  3WHL A;  3NBP A;  3PX6 A;  4CFD A;  1TK8 A;  4IBC A;  2R44 A;  5KRS A;  3M8S A;  3ZEU A;  4FWS A;  1QVF M;  3D45 A;  4KTQ A;  1N34 K;  1N36 M;  1HNI A;  3B6P A;  2UXC M;  4BQZ A;  1XHX A;  4BR4 A;  2BUP A;  1EKE A;  5JIC A;  4FWO A;  4IFV A;  4M7Y A;  2N35 A;  4FZY A;  1G3I A;  2FH0 A;  5EP3 A;  2HMP A;  4MDB A;  1QVR A;  3O4N A;  4YOU A;  2E1Y A;  1RGI A;  4O5F A;  2LBC A;  3VA3 A;  2FE8 A;  4GH9 A;  1RDC A;  5F2R A;  2OYQ A;  1XHZ A;  2CHQ A;  5HRN A;  3A5O C;  3QLH A;  5JLF A;  2P1J A;  3OTO M;  4CK2 A;  1LW0 A;  4BRC A;  4CZG A;  1Q3B A;  2HWJ A;  3VN5 A;  2RHK A;  2V7Z A;  1D9F A;  1RBS A;  3K92 A;  3OBY A;  3SAV A;  2P51 A;  4NCB A;  2OO9 A;  4KHP K;  2E5L M;  1YE9 A;  3AAP A;  1KYI A;  4RTF D;  2Q97 A;  3G4S N;  5AQX A;  1HX1 A;  4LJA A;  3DLK A;  4JI8 K;  1HT1 E;  3WNH A;  1NK5 A;  3J2P B;  1JL2 A;  1T3V A;  1ZAE A;  4L15 A;  3F2K A;  3P4I A;  1C1C A;  3LDS A;  5DYG A;  3CER A;  2P5G A;  1WLJ A;  3SYL A;  3SAU A;  1W0H A;  2EA0 A;  4B1V A;  3CCU N;  4KHQ A;  1LV7 A;  4EP5 A;  2PY5 A;  3CF0 A;  2QWP A;  3WEE B;  1YI2 N;  2O8D A;  3A5N C;  1VQ9 N;  3HYF A;  3LVW A;  3RVC A;  1CXQ A;  4GKK K;  3KOY E;  4M3R A;  2HHS A;  1OIP A;  2ATQ A;  4CZM A;  3SAG A;  1NMD A;  3CJ1 A;  5KGW A;  2FOI C;  4BG9 A;  4HVJ A;  1UWB A;  3SAT A;  2OAN A;  1KC8 O;  2IVO A;  4M9S A;  2IC3 A;  4FJ7 A;  5ITU A;  5AQZ A;  3GQ5 A;  1QHA A;  5KGX A;  1EWR A;  2E8A A;  2F5N A;  4YOX A;  3QNO A;  4KKO A;  4UQG A;  2NRT A;  4JS5 A;  3CM5 A;  4X65 K;  4GV6 A;  2GV9 A;  4BC2 A;  2VF7 A;  3CIP A;  4LJ5 A;  2NNW A;  3KOZ E;  1RT1 A;  5ITY A;  4DV1 K;  4P16 A;  2DPN A;  2CFO A;  4JRP A;  3SJJ A;  1TK0 A;  3VER A;  1ASU A;  2YKM A;  4IJA A;  4DKW A;  3MN5 A;  1EO1 A;  3CCR N;  1WUA A;  3CQX A;  3VLF B;  3L29 A;  4OKK A;  3PX4 A;  4K0K K;  5CZ1 A;  2KEB A;  5FSW A;  1S6Q A;  3QO9 A;  2CHV A;  2L6O A;  1FNN A;  2D0O A;  1MJG M;  2GUP A;  4KH6 A;  3OJS A;  1IBM M;  3L8B A;  2FC0 A;  3U6S A;  5I42 A;  1HYV A;  2VG7 A;  3GL1 A;  3J81 O;  3VKH A;  1VQK N;  4X64 M;  4CFA A;  2QSF X;  3HP9 A;  4LF6 K;  2L7I A;  4Y1D A;  1SXJ A;  4H5V A;  3S3M A;  3BZK A;  4CIF A;  2NRH A;  1XB2 B;  2OPF A;  5BR9 A;  2ASP A;  3KP0 E;  3MCP A;  2OZS A;  3MX5 A;  2O8E A;  1SXJ C;  4DV0 M;  3L0Q A;  2WC9 A;  3NF7 A;  4BRD A;  3B6O A;  4BC5 A;  5LMU M;  3LDO A;  4QS9 A;  2X74 A;  4Z6Y A;  3V4I A;  3RTV A;  1VEJ A;  4JI0 K;  5KQ8 A;  1JLF A;  2HCB A;  3AO1 A;  4CF9 A;  1Z6T A;  4Z4I A;  1IXS B;  2JWS A;  4CF0 A;  2DEN A;  2OCE A;  5M1P A;  3NGY A;  4CJL A;  5AQJ A;  4WFA L;  1NO1 A;  3OYG A;  4FLZ A;  4DQI A;  4FJ9 A;  4ID1 A;  1T7P A;  2D0A A;  3VQB A;  4M3Y A;  5C2F A;  4XEI A;  1NJG A;  2IIR A;  1ASW A;  2UXB M;  5HLF A;  1WSH A;  2YFQ A;  4HLQ A;  5FLX S;  4BGB A;  2CRU A;  5DNY A;  4HTL A;  3UZU A;  2KA6 B;  5H37 D;  3IS9 A;  4AM7 A;  3PO5 A;  1KVC A;  1YIJ N;  3ZC7 B;  1P90 A;  2NRX A;  4OLB A;  4CJU A;  4FJM A;  1GLF O;  3VQC A;  2W6K A;  3C0B A;  4JS4 A;  5HP1 A;  4DR7 K;  1YJW N;  4QS7 A;  1BOT O;  4NRW A;  2NRW A;  3S3O A;  1ZYQ A;  2D7E A;  4NC6 A;  2J7N A;  4WYB A;  4CEC A;  3H3O B;  2EX3 A;  2XH9 A;  1GLN A;  1S72 N;  2L4E A;  1TUY A;  3VA0 A;  4CED A;  4OGC A;  3T1H K;  3V9W A;  3H08 A;  4DSL A;  3SBT A;  4IDK A;  3OYB A;  1NGB A;  4CZF A;  1IBL M;  3V9Z A;  3LDP A;  3VMF B;  3QES A;  1Q9X A;  3VTI A;  3U60 A;  2ETJ A;  2CV2 A;  1JCF A;  4JN4 A;  4XH5 A;  3CME N;  2OOA A;  3FRI A;  3O1W A;  2OTL N;  3RMD A;  4JKG A;  4FCT A;  4DR6 M;  4FCV A;  3K8Z A;  3GLG A;  1DV0 A;  2ZM6 K;  3V9U A;  4JI4 M;  3CTW B;  5KPT A;  4EFH A;  2Y21 A;  4FK0 A;  1S5J A;  3LQR A;  3EZ5 A;  1IQP A;  2YCH A;  2IDO A;  2JY7 A;  3KFU G;  4LF4 M;  2R6F A;  3MMP A;  1EWQ A;  3HVR A;  3FZK A;  1R2Z A;  3GLH E;  1MDU B;  1ZMU A;  1VQN N;  3F73 A;  3MED A;  2D7H A;  1G4A E;  2E88 A;  2DFE A;  4PT5 A;  1T6O A;  1K3X A;  4CK1 A;  5HRS A;  3O3H A;  3CF5 L;  1UM8 A;  2R4J A;  1TAQ A;  2RGH A;  5IWA M;  3AGK A;  3ZT1 A;  3MMV A;  1U4B A;  2O8C A;  1WGL A;  2DWZ B;  1QQO A;  4ITQ A;  1VSJ A;  2F7T A;  4HUE A;  3GQ3 A;  3H46 O;  3HHX A;  3M6A A;  5AQV A;  4EP4 A;  1QAO A;  2MJ5 B;  3TWK A;  3TSP A;  3OS1 A;  1I4W A;  1T03 A;  2A1R A;  4BR0 A;  2A3Z A;  4M3Z A;  3DXM B;  2UU9 M;  1HMV A;  4AHR A;  3MX2 A;  3ISN C;  3HX3 A;  4MFB A;  4IBG A;  5E41 A;  4O5B A;  1X37 A;  3ID8 A;  1JLB A;  2HB5 A;  3E1Y A;  4QHT A;  1O13 A;  3EZW A;  3Q7B A;  4DTU A;  3L2W A;  3M6G A;  2XZF A;  3U61 B;  1RBR A;  4IOC L;  5IRE B;  3PSI A;  3V1Q A;  1NV9 A;  4A57 A;  3H45 C;  4H0T B;  3W0F A;  2ZGY A;  3BF3 A;  2CV0 A;  1QZ5 A;  4RW8 A;  1WN7 A;  4B9V A;  2DAE A;  3LAM A;  2CGL A;  5AQM A;  1SKW A;  2DXI A;  3E4R A;  5K14 A;  4LRT A;  1NV8 A;  1WHC A;  4B9U A;  4I7F A;  3D2F A;  1R7R A;  3ID6 A;  3JS6 A;  2O01 F;  2W6L A;  4ILH A;  1DTT A;  4F2S A;  2QNJ A;  1KFS A;  3FTD A;  4ELV A;  2O8B A;  1R2Y A;  3QIC A;  1C0F A;  3A5L C;  1U49 A;  1ZBI A;  1QAM A;  3HZJ A;  3U8X A;  4M0D A;  4AKI A;  3VF2 A;  2BJW A;  4YY3 K;  4OX9 M;  3ZX3 A;  4CD3 A;  1JR3 D;  3AO2 A;  4FLV A;  2DFF A;  3MXM A;  3E66 A;  4XH1 A;  3RSE B;  2V1C A;  2ZGZ A;  4DSI A;  2O25 A;  4IWV A;  3SHF A;  3P31 A;  3T1Y K;  4DBG B;  5SZT A;  4E7H A;  1HKC A;  2IVN A;  4NLB A;  4DV7 K;  4RW4 A;  4JI6 M;  5AQS A;  4MGI E;  4LFB M;  2IOC A;  4JKF A;  1TDH A;  2VQE K;  1YIT N;  4Z4H A;  3HPH A;  4CIE A;  2A5Y B;  4B3R M;  4E7L A;  2Q1N A;  4AM6 A;  3F9K A;  3DXK A;  3RMC A;  4LJ6 A;  5C15 A;  4B3T M;  3WXI A;  3DOL A;  4Z4E A;  1IXZ A;  3HXM A;  2HHW A;  3UE5 A;  4AKG A;  2HND A;  5BN9 A;  4DMN A;  1NVM A;  4BRN A;  1Q86 O;  1HQE A;  3EIH A;  3HGI A;  3L4I A;  2QP9 X;  4YOR A;  4KHN A;  1HLU A;  4H0O A;  1V4S A;  4DTS A;  4C8M A;  1KFV A;  3HTV A;  2JNH A;  1HNZ K;  3QDK A;  2D0B A;  3H1V X;  4YNQ A;  3NGZ A;  2EO2 A;  3R9P A;  3SUO A;  3GOI A;  5EJC A;  1RCH A;  2XSZ A;  3DZD A;  3P83 D;  4YOT A;  3ZSQ A;  1L3U A;  4DR3 M;  1PRB A;  2BE2 A;  4PUO A;  4WFB L;  1WR1 B;  5LY3 A;  4W5O A;  4CEA A;  3AOE A;  3SFZ A;  3VEX A;  4LRS A;  3U4L A;  3UKU B;  3GPX A;  3D8B A;  2C5R A;  1NGI A;  4Z8X A;  2AHM A;  5ITR A;  2E2P A;  3AO5 A;  1QYR A;  4ISE A;  4NSR A;  3K58 A;  2V7Y A;  3CCM N;  1OFH A;  3CI5 A;  1ZV1 A;  3AVH A;  4FJG A;  2DVW B;  4JI2 M;  4R5P A;  3KLH A;  1JCE A;  1D4X A;  4KBO A;  4E7J A;  3I56 N;  4I9L A;  4DU1 A;  4LF8 K;  4FPA A;  3U6C A;  1W97 L;  3L3U A;  3IUC A;  4WQ5 A;  1XMQ K;  1JR3 A;  2YJF A;  1QDR A;  3KHY A;  3NH0 A;  2Z1J A;  1CUK A;  1S9E A;  1W7A A;  4B8A B;  1V92 A;  1HJP A;  2DAM A;  3OVN A;  2L2D A;  1SUQ A;  3TAP A;  1NGA A;  2Q31 A;  2V51 B;  3OJU A;  4CHT B;  2YNF A;  4Z4C A;  2V6Z M;  5CZ2 A;  1RIL A;  5BR8 M;  4FJX A;  2LVN C;  4DSF A;  3BP8 A;  2JLE A;  3O9Q A;  1SL0 A;  1TL1 A;  1JLQ A;  3WXK A;  4FJH A;  1B9F A;  3OYK A;  3PLA A;  3U6E A;  3HI0 A;  3SPZ A;  3WEE A;  3I4Y A;  1NJX A;  1IKY A;  3NF8 A;  3UGJ A;  5LJV A;  1D0M A;  4QOS A;  1GAB A;  2Z1G A;  5J2M A;  3KD1 E;  2VDB B;  4MO4 A;  2HBK A;  1XC9 A;  1HJR A;  4OKE A;  2XF3 A;  2K0B X;  2EWS A;  3CGW A;  3TTD A;  2GQF A;  1RDA A;  4YOV A;  2Z4S A;  2JP7 A;  1IKX A;  3G25 A;  2X78 A;  4FCY A;  2JZ1 A;  4KB1 A;  4CJS A;  4DR5 M;  3SAH A;  3TWL A;  2HHV A;  2E6M A;  3HP6 A;  2EJS A;  1YXQ A;  3ZCM A;  1GLL O;  2XZU A;  1ZC6 A;  1RDD A;  3OBW A;  3M3Z A;  4FM0 A;  5KQD A;  3CG7 A;  4CIG A;  3GPU A;  4MGK E;  4I5S A;  3C6H A;  3V1R A;  3O3F A;  4JI5 K;  3QNN A;  1HPM A;  2P9U B;  1IBM K;  2LSN A;  4FYD A;  4B3M M;  2ZBK B;  3KLI A;  3AA5 X;  4OO1 J;  3C95 A;  2Q2E B;  1GKI A;  3SLC A;  4PWD A;  2ZQB A;  3MHV C;  2L09 A;  1M1K O;  1BIU A;  2RE2 A;  3L2U A;  4ISG A;  1OVY A;  4J8F A;  3DA1 A;  5EOY A;  4BRG A;  4CEZ A;  3PUF A;  5F1X A;  4XGI A;  2QW9 A;  4PD2 A;  2L4F A;  3TPZ A;  2UUC M;  4JK8 A;  4PA1 A;  4CJV A;  3TAR A;  4CHZ A;  5DM7 L;  5AZJ B;  4BRM A;  4YHH M;  1QSS A;  1JQJ C;  5C25 A;  5LMU K;  4Z4F A;  3HPO A;  3ZSW A;  3HZ6 A;  2Z8Y M;  4IG0 A;  3R8F A;  4PL7 A;  2P9L B;  3ULD A;  3MN9 A;  4AG6 A;  4B1X B;  5GIN A;  3K59 A;  4LJ7 A;  1RT7 A;  2KLA A;  1QQM A;  1N33 K;  5BRF A;  3C58 A;  3CCQ N;  1RTI A;  1WB9 A;  3MWP A;  4AHT A;  3KK2 A;  1IXS A;  3FGU A;  2QWR A;  3G0Z A;  3NF6 A;  1PJS A;  1DGB A;  4M7X A;  3I4V A;  4JN6 A;  3VOV A;  2XFT A;  3D7E O;  4DSE A;  2UXB K;  1EXQ A;  4IBN A;  4BVP A;  4GW6 A;  4GVE A;  4WCE L;  2XY7 A;  1C0G A;  1HQC A;  2HHH M;  1K8K B;  2RKO A;  1CXU A;  4FJJ A;  3OYA A;  3L2A A;  3RGS A;  1NGG A;  2R62 A;  4II7 A;  4MGY E;  1HNV A;  3BXW A;  4DTR A;  5AQF A;  4NRV A;  4L6V 6;  4LF9 M;  2QWQ A;  4CF8 A;  4F8R A;  4DR1 K;  4DV5 M;  4I2Q A;  4IFY A;  3T38 A;  2QBY B;  1GOB A;  5AQR A;  3VFD A;  3ZX2 A;  1YTA A;  3LAK A;  1XMO K;  3DI6 A;  5EX5 A;  2QEX N;  4O0J A;  1K3W A;  2P9N B;  4DG1 A;  3ENB A;  4MQ3 A;  4B9L A;  4RG8 A;  2HBL A;  2KDL A;  2FS1 A;  2FBT A;  2CP8 A;  4DTP A;  2BJV A;  2KXE A;  1YT3 A;  3TSQ A;  4JI3 K;  1JLC A;  1Z25 A;  4M3W A;  4BRQ A;  4CJE A;  4L16 A;  3CQ8 A;  1NK7 A;  5KO3 A;  1VG5 A;  5GKN A;  4J2B A;  4KHY A;  4IJE A;  4Q7J A;  2VWK A;  3K5O A;  2R65 A;  3WQT A; 
#chains in the Genus database with same CATH homology
 4JI7 M;  3G71 N;  1T6D A;  1BU6 O;  4FWQ A;  2QM1 A;  2NZT A;  4B7G A;  2NLX A;  4AW4 A;  3NVM A;  5AQK A;  4GC9 A;  5BN8 A;  2E2Q A;  4LF7 M;  1NJF A;  3BOS A;  1OFI A;  4CZK A;  2LH0 A;  5EXS A;  2QXL A;  1VQ4 N;  4AZF A;  1I94 M;  2C9C A;  1HKB A;  3SYK A;  3ZCB B;  4A59 A;  3C7N B;  4FVU A;  3K1J A;  2ZJR L;  1HNW M;  5LMN M;  1HUX A;  4I4L A;  4I81 A;  2XFS A;  3LDN A;  5BPV A;  5CR4 A;  4NL4 H;  3L27 A;  4A2A A;  3DXM A;  5KPZ A;  3U6L A;  4FWM A;  4IBJ A;  2KRK A;  3SC3 A;  4PCZ A;  1NNJ A;  5M1O A;  5LJW A;  4G4Q A;  4RNA A;  3FZL A;  1Z05 A;  3RGP A;  3U61 A;  1D2N A;  2GWJ A;  2JA2 A;  2WFB A;  3M1F A;  4ILJ A;  3HOT A;  2ZJP L;  4CBX A;  4L8R C;  2W82 A;  5KPR A;  4BB9 A;  3UK6 A;  3CQY A;  2E2N A;  4YOW A;  3A8Y A;  2X8A A;  2D1K A;  3EO3 A;  3CJA A;  3EE9 A;  3L6Q A;  3KXE C;  3IKM A;  4IXC A;  1NHW C;  3KWI A;  4CGY B;  1IBK M;  3VK7 A;  4DUY M;  1GL7 A;  3GDQ A;  4GIP A;  4LF5 M;  3SMS A;  2UUA M;  1S22 A;  4H5T A;  4NSO B;  1NGC A;  3N4Q A;  4WUR A;  1R6B X;  2FSJ A;  2E20 A;  3RSE A;  3HHY A;  4YDU A;  2Y20 A;  3HWS A;  1XUP O;  4MGH A;  1BO5 O;  3HRG A;  1VDD A;  4H0V B;  4NB4 A;  1YUB A;  4YDU C;  4BRP A;  1EE8 A;  8CAT A;  4IBB A;  4H5R A;  3LL3 A;  2GWK A;  1HKG A;  3KVW A;  2NRV A;  3CJ9 A;  1YJ9 N;  4RF0 A;  3CXC M;  3GRV A;  3HU2 A;  4GHL A;  2LWX A;  4GKJ M;  5FPN A;  3PNV A;  5EXT A;  4OPH A;  2C9O A;  3AJI B;  4IDH A;  2QZ4 A;  4JEP A;  3UKU A;  4BQL A;  3KOW E;  2UXD M;  3TU5 A;  4KOD A;  1HR0 M;  3HJ8 A;  2CHG A;  3MN6 A;  3CCS N;  3QAU A;  1NSF A;  2YNM D;  3JR4 A;  3T15 A;  5EP2 A;  4W5W A;  1GL6 A;  1BUP A;  4GRI A;  1E9R A;  3FUW A;  3O5B A;  3WXM B;  4LJ9 A;  3ZH9 B;  3HHW A;  3HM8 A;  3AY9 A;  2QCU A;  4R79 A;  4IOX A;  4IEE A;  4BY9 C;  4JK9 A;  4JI1 M;  5ITX E;  3SAR A;  3VF6 A;  1NGJ A;  4L4U A;  3LDQ A;  1ZXO A;  3CPE A;  1DGF A;  3KVG A;  1HQY E;  2YR0 A;  1YAG A;  1N75 A;  2V52 B;  5C10 A;  4FL9 A;  4BR7 A;  3VET A;  1Q18 A;  5BPM A;  3EKS A;  2F5Q A;  3KS8 A;  3L4Q A;  3KWG A;  5F3W A;  2V1U A;  4CBU A;  1VQ7 N;  3J80 S;  4NOO B;  4JXJ A;  2C98 A;  3WT0 A;  4X66 M;  3EE8 A;  4E1J A;  1J7K A;  1S3X A;  5EVZ A;  3NMU A;  3QWL A;  1BDG A;  2X49 A;  3FTF A;  3HU1 A;  4JK7 A;  4KH5 A;  3U9Z A;  3HU3 A;  2WUS A;  1N34 M;  1VQL N;  3PXG A;  3CC4 N;  4BRO A;  3M7G A;  3GLI B;  2CV1 A;  3A98 B;  4A5B A;  3AAQ A;  2BTF A;  1LCU A;  1NY6 A;  3J7A S;  2P9U A;  3ATV A;  5M1Q A;  5MLC Q;  2F5O A;  4RWT A;  4WFN L;  1TH2 A;  2ERC A;  3U6O A;  3I33 A;  4RCH A;  4FWD A;  5DYI A;  1NNU C;  5AZJ A;  4OVZ B;  3I51 A;  4KHP M;  3U6D A;  4JI8 M;  5FTN A;  4C23 A;  2YQZ A;  3VKG A;  2P9L A;  3SAS A;  2GEM A;  4M63 C;  1XWI A;  5EQT A;  4PKI A;  3U6P A;  4CZH A;  1E32 A;  3CJB A;  3FZF A;  3HBT A;  3RFW A;  3MN7 A;  2CUZ A;  5BRD A;  2FF3 B;  1Q81 O;  1IY2 A;  1GLJ O;  3DWL A;  3K9J A;  3UMM A;  4O8K A;  3FE1 A;  3H4M A;  1KXP A;  4R3D A;  4NO7 A;  1XNR M;  1T44 A;  2L7H A;  1H1V A;  4FOE A;  3NWL A;  3WXL A;  4KO8 A;  2KKZ A;  1K8K A;  2CGK A;  3O80 A;  1HT2 E;  3EKU A;  2FNA A;  2NRR A;  3GLH B;  4LCB A;  4X65 M;  4QS8 A;  4JKA A;  5AZI B;  4BRA A;  5FTL A;  3KK7 A;  3GRU A;  1XNQ M;  3MCA B;  3ENO A;  1Q7Y O;  2QBY A;  4PDG A;  1PJI A;  3CF6 E;  4JKE A;  3Q8X A;  4KH4 A;  4DV1 M;  1TH4 A;  1ATN A;  4DV4 M;  4IO9 L;  3E9O A;  5GIP A;  2P9N A;  1W5T A;  3VF4 A;  3GBT A;  1GLE G;  4LJ4 A;  4AI6 A;  2VGM A;  3IG8 A;  3DLL L;  4MM3 B;  1DT9 A;  3HOS A;  3LMM A;  5C1B A;  3O9T A;  4Z94 A;  4IOA L;  4LF6 M;  1W5S A;  4FSV A;  2IVP A;  3NVK A;  2LNH C;  4AKH A;  5IT9 S;  2H1R A;  2HF3 A;  2ZAN A;  3THG A;  3GPP A;  3VEV A;  1X3M A;  3AOE C;  4JI0 M;  1Y64 A;  5AQN A;  1Z5C A;  5FPD A;  5C0Y A;  4DHY A;  1IY0 A;  4UY8 O;  3CD6 N;  1K73 O;  3RE8 A;  1YUW A;  4FD2 A;  3KDS E;  5A2Q S;  2ITM A;  3C7N A;  3D6R A;  5C2D A;  3GRR A;  1DEJ A;  2F5P A;  3IFR A;  1YVN A;  3P39 A;  2DWM A;  3L28 A;  5E26 A;  4WQ5 C;  2UYT A;  4BRF A;  1JCG A;  1ORY B;  3QML A;  3O1B A;  4GIT A;  2FF6 A;  1GLD G;  3TTC A;  3FD9 A;  1ESV A;  1GVN A;  3R6M A;  5EXW A;  4BRK A;  1IG8 A;  5EXX A;  1QZM A;  2EUC A;  4HL4 A;  3VEN A;  3P38 A;  4CIS A;  1G59 A;  5DM6 L;  4G4O A;  4ISF A;  3M0E A;  1BG3 A;  4QNM A;  1E9S A;  3T7Z A;  4PDI A;  1YF5 L;  3T1H M;  3VGM A;  4IO8 A;  4B7H A;  3G6E N;  3H6E A;  3I55 N;  3HSC A;  3PNY A;  1Q39 A;  4A62 A;  3FR0 A;  2DZN B;  2F9W A;  2HBJ A;  3W0L B;  1OKJ A;  2QWN A;  3LVV A;  3SAW A;  1IM2 A;  2ZM6 M;  1G41 A;  1K82 A;  3D8L A;  1L1Z A;  2P9I B;  4PKG A;  3VGL A;  2VII A;  2HBM A;  1L2B A;  2J4R A;  2Q0R A;  4EIA A;  4LZJ A;  3R3L A;  4BR5 A;  1NGH A;  2K47 A;  3FTE A;  2HOE A;  3ULE B;  3ZX0 A;  3H1Q A;  1OJL A;  3D2E B;  1TH3 A;  3TL4 X;  3VGK A;  2D0P A;  3A42 A;  3HKP A;  4GY2 B;  2FSN A;  2YJE A;  3CJC A;  5AFU A;  1DGH B;  5JLH A;  5BRH A;  3TE6 A;  2CH5 A;  1TYQ B;  4OU7 A;  4D82 A;  5AQT A;  1NGF A;  2XLJ A;  5HOO A;  3MWT A;  3SAF A;  2G8L A;  1H6U A;  4IBI A;  5FTJ A;  2KW0 A;  1C1K A;  3A45 A;  5AQP A;  3U5Z B;  4BRH A;  3CC7 N;  2KZS A;  3LM2 A;  4IBF A;  3J27 B;  3FTC A;  3LM9 A;  1VQ8 N;  1K9M O;  5ITQ A;  4YY3 M;  4LY6 A;  2A41 A;  4AF1 A;  2OQ4 A;  1BA0 A;  3CCE N;  3AKZ A;  1TGU A;  2Q0U A;  3KP1 E;  4L3Q A;  1XXH B;  2ZAM A;  4CZL A;  4FWG A;  4IFE A;  2GEL A;  4CBW A;  3T1Y M;  1YHQ N;  2HST A;  1QAQ A;  3HHZ A;  2VCP A;  4DV7 M;  1XC3 A;  3JAM S;  4FWH A;  2R18 A;  5E84 A;  3WXJ A;  2VQE M;  4QNR A;  1NGD A;  1IN5 A;  3GG4 A;  3ENH A;  5F0X A;  1XHB A;  4D81 A;  2DHR A;  4MO5 A;  1ATS A;  1ZQ9 A;  4H0X B;  3GQ4 A;  1X3N A;  4B1U B;  1G8P A;  4A2B A;  1QQN A;  4XH4 A;  4JD2 B;  5AQW A;  1Z59 A;  1U6Z A;  4CZE A;  1VAZ A;  3AV0 A;  2F4V M;  4I8O A;  4GC5 A;  4M9Z A;  4M9X A;  3GLI A;  3FZM A;  1LOT B;  3VDU A;  2R46 A;  4B1Z A;  1Q82 O;  5BPL A;  1J6Z A;  3O08 A;  3CF2 A;  4DB3 A;  3MDQ A;  4LF8 M;  1M90 O;  4FPB A;  4LG2 A;  1XMQ M;  3A0I X;  1SXJ D;  3VK8 A;  3E9P A;  3ATU A;  4BR2 A;  4QOZ C;  2D7G A;  4OVZ A;  3FFK B;  4B08 A;  5ITX A;  1HNX M;  3KZB A;  4FWR A;  3QBW A;  4JAX A;  4JKD A;  1RDU A;  2HL7 A;  1IXR C;  4H5N A;  3ZET B;  2ASO A;  1QZ6 A;  5M1K A;  1SZ2 A;  4GV9 A;  4X62 M;  3TWM A;  4G4N A;  4JHD B;  1SAZ A;  4BC3 A;  2DWL A;  5AQL A;  2GTD A;  2M5Z A;  5FTK A;  2ZWH A;  1KAY A;  4BRL A;  3TQS A;  5GAG P;  3K9K A;  5EP1 A;  4EHT A;  5GAE P;  1GLB G;  3QFP A;  2W41 A;  1BWF O;  3GLH A;  4BRE A;  2JWL A;  5AZI A;  1JJ2 M;  3J81 S;  5BRE A;  3GE1 A;  1Z5B A;  1NGE A;  1KSF X;  2QI2 A;  2ASM A;  5BPN A;  3OW2 M;  3FUU A;  2YHX A;  1L2C A;  1X9J A;  4BBA A;  3U9D A;  2WBN A;  2P9S B;  2Y0Q A;  2I7N A;  1U2V B;  1Z5A A;  3CPW M;  3VEY A;  4JI5 M;  5CHI A;  1Q3C A;  1KQS M;  1KD1 O;  3N4P A;  1GLA G;  2BH1 A;  2P9K B;  2P9P B;  4PL8 A;  1HJO A;  4B1Y B;  2I7P A;  3CMA N;  3VES A;  3J7B A;  1SS6 A;  5EP4 A;  3DOA A;  3O9S A;  4B1W B;  3VEO A;  4NXM M;  2VGN A;  4CD1 A;  3CCV N;  5ELZ A;  4CJ7 A;  1K8A O;  3M5R A;  1S3S A;  1N33 M;  5JMV A;  2Z3X A;  4WW0 A;  5M1F A;  1P8Z A;  5H1S Q;  2KZU A;  4JKH A;  3O8M A;  1IN4 A;  3B9P A;  5I9E B;  4S12 A;  4FWK A;  4C1N I;  1T6C A;  2VYP A;  4GHA A;  4LGM A;  2R4E A;  3QFU A;  1NM1 A;  4DQ8 A;  4JNE A;  2VWB A;  1E4G T;  3EN9 A;  4FCW A;  1J5E M;  3BEX A;  3AGR A;  3IG5 A;  4DR1 M;  2PFU A;  5GAH P;  4RF1 A;  5JVH L;  2X4A A;  1NLV A;  2C99 A;  1XMO M;  5AFU H;  3UKR B;  4EHU A;  5AR0 A;  1DGK N;  2FSK A;  3SBG A;  5E6J A;  2A40 A;  3A46 A;  4DR4 M;  4YOY A;  2LXE A;  1PM5 A;  4L78 A;  3I8B A;  4JI3 M;  4IEI A;  2R45 A;  4OPA A;  4HWI A;  3GLF B;  3W0L A;  5AQQ A;  7CAT A;  1DKG D;  2YHY A;  1W2B M;  3W3D A;  3O6W A;  2UUB M;  1NWK A;  3BUZ B;  3KOX E;  4FWL A;  3ZEU B;  2O5R A;  3SMP A;  4DV6 M;  2P9I A;  1KAX A;  1CZA N;  3NBI A;  1L1T A;  3F5T A;  1TUU A;  4TUW A;  4LC9 B;  1SXJ E;  3ULE A;  1T3T A;  3VEW A;  3GO8 A;  4FO0 A;  4FW9 A;  4MH0 E;  5ITT A;  1E4F T;  3D2E A;  3Q7C A;  5C18 A;  3GPY A;  2QTD A;  3E9S A;  1IN7 A;  3FYD A;  1EQY A;  3QB0 A;  1YSY A;  2M60 A;  3QBX A;  2BNK A;  3FUX A;  1QAN A;  2E2O A;  3TTF A;  1DGH A;  4K41 A;  3KS4 A;  1WOQ A;  2KHO A;  1TYQ A;  3CJ7 A;  1Z6R A;  5ADX A;  4Y0W A;  4FOI A;  4R7G A;  4I6M A;  1RFQ A;  4G6Z A;  2XSZ D;  5M1N A;  4GKK M;  1ILY A;  1BA1 A;  2KRU A;  3PVS A;  4K25 A;  4IJF A;  4KLN A;  3ZYY X;  2CGJ A;  4NXN M;  2E1Z A;  5GIO A;  1RDW X;  3U5Z A;  2ZJQ L;  2YHW A;  4XBO A;  2XEP A;  5TKY A;  4DCH A;  2A42 A;  1VQM N;  4IBK A;  3FLC O;  2CE7 A;  3FZH A;  2AA4 A;  3VEZ A;  4MGZ E;  4FWN A;  2Z7J A;  1IJJ A;  3R9X B;  3WQU A;  1PJJ A;  3FKE A;  1YJN N;  1XXH A;  3O4W A;  3C65 A;  3PIP L;  4K0K M;  3ILK A;  2AP1 A;  3FUT A;  4OW0 A;  3CHW A;  3IDH A;  4IBE A;  3LDL A;  3AAR A;  4DV2 M;  1MWM A;  2QEN A;  2Z4R A;  1IN8 A;  2Y0T A;  4LGY A;  1SXJ B;  5FTM A;  3S41 A;  4BVO A;  4H0Y B;  2QA4 N;  5GAD P;  1NBW A;  3HJQ A;  3DJC A;  2DZO B;  4B3S M;  5JI3 E;  3SK3 A;  1VQ6 N;  3AOG A;  1KAZ A;  3C6A A;  4F9O A;  3KSX A;  3A5M C;  4MLE A;  1NJI O;  4D80 A;  4K42 A;  3EIE A;  2GX9 A;  4JD2 A;  4CI6 A;  2QWM A;  4LFA M;  4BLC A;  5IZ7 D;  3GRY A;  4JYA M;  2QWO A;  1NY5 A;  2ZAO A;  3H3N O;  2HF4 A;  2HKJ A;  4O8U A;  1SQK A;  4DR2 M;  2A6A A;  2A5X A;  1L8Q A;  1NHG C;  2J7O A;  3MJ5 A;  2YX6 A;  5JI2 E;  3FUV A;  2DWN A;  4U67 L;  2CH6 A;  4DR7 M;  4CZJ A;  3T69 A;  3TSU A;  1G99 A;  4MB7 A;  2D4W A;  4MDA A;  4LJ8 A;  1N77 A;  4IZ9 A;  2H3G X;  3WUH A;  3L26 A;  4IIW A;  3R8E A;  3OA9 A;  3HJS A;  4WQ4 A;  3ZET A;  1DO2 A;  4WF9 L;  1MA9 B;  2ZF5 O;  3U60 B;  3KW6 A;  3TPQ A;  2OTJ N;  4CZI A;  4JKB A;  4WQ4 C;  4JHD A;  4JKG B;  1FJG M;  2PBD A;  3GLG B;  3GP1 A;  4IBD A;  1QVG M;  1N32 M;  1DGG A;  1GLC G;  1QQW A;  5B8H A;  3UJN A;  4H5W A;  3DFZ A;  2Q2R A;  3PFI A;  3SBJ A;  4LFC M;  1E94 E;  4BR9 A;  2Q36 A;  4U7B A;  1J09 A;  4GNI A;  4G9Z A;  1VQO N;  4QHS A;  4G4R A;  2FLO A;  2P5T A;  3OHR A;  1WXQ A;  4BRI A;  3LQQ A;  3VDP A;  4A5A A;  2RGO A;  3U6Q A;  5CE3 A;  5AQU A;  4A61 A;  1R59 O;  2P9S A;  5AQG A;  1U2V A;  2NRZ A;  3F9M A;  4H03 B;  5JVG L;  2FFJ A;  3CC2 N;  4B7F A;  4FVM A;  3WHK A;  3E9L A;  2QPA A;  3O9R A;  1VQP N;  2P9K A;  2P9P A;  3K2L A;  5AQH A;  4B9Q A;  1DO0 A;  3MK6 A;  4EIW A;  3AL0 C;  1MX0 A;  5EY4 A;  4C1N K;  4I6M B;  3IMX A;  3CCJ N;  3CET A;  1ZBS A;  4IJN A;  2VQF M;  3B8A X;  3J8A A;  5FPM A;  4H0P A;  2FXU A;  3DAW A;  2JWK A;  1IY1 A;  3EL2 A;  3D2F B;  4MLH A;  2G5G X;  4GMQ A;  5EXP A;  3BF1 A;  1VQ5 N;  4GV3 A;  4DV3 M;  4ZPX A;  2CEA A;  5FPE A;  4ILG B;  3VPZ A;  4BG8 A;  2NQ8 C;  5AQY A;  3AFH A;  2F5S A;  3L25 A;  2XGN A;  4NLC A;  3PIO L;  4K43 A;  3VTH A;  4M0W A;  4JKC A;  3UB5 A;  4PHT X;  3SHG B;  1XC8 A;  4BC4 A;  4AQY M;  1V4T A;  1MU5 A;  4PKH A;  3J7Z O;  5AQI A;  4A3V B;  3SJH A;  2W40 A;  3JR5 A;  1L2D A;  2YI1 A;  3JXU A;  4REZ A;  3DXK B;  1ATR A;  4EAH D;  5C12 A;  4AG5 A;  2F9T A;  3UKR A;  3FYC A;  3O9U A;  4LZZ A;  5ADX H;  5HL7 L;  3U6M A;  4JV5 M;  5TKW A;  2QWL A;  1XQS C;  3R1X A;  1N8R O;  1MWK A;  1IN6 A;  4DUZ M;  1N78 A;  3GLF A;  3CCL N;  1TDZ A;  2C96 A;  1HNZ M;  2PAV A;  5AQO A;  4BGA A;  3KSJ A;  4FWP A;  3WHL A;  4IBC A;  3ZEU A;  4FWS A;  1QVF M;  1N36 M;  2UXC M;  4BQZ A;  4BR4 A;  2BUP A;  5JIC A;  4FWO A;  4M7Y A;  1G3I A;  5EP3 A;  2HMP A;  4MDB A;  1QVR A;  4YOU A;  2E1Y A;  1RGI A;  4O5F A;  2FE8 A;  4GH9 A;  5F2R A;  2CHQ A;  3A5O C;  5JLF A;  3OTO M;  4BRC A;  4CZG A;  1Q3B A;  2RHK A;  2V7Z A;  3K92 A;  3OBY A;  3SAV A;  2E5L M;  1YE9 A;  3AAP A;  1KYI A;  4RTF D;  2Q97 A;  3G4S N;  5AQX A;  1HX1 A;  4LJA A;  1HT1 E;  3J2P B;  1T3V A;  1ZAE A;  4L15 A;  3F2K A;  3P4I A;  5DYG A;  3CER A;  3SYL A;  3SAU A;  4B1V A;  2EA0 A;  3CCU N;  1LV7 A;  3CF0 A;  2QWP A;  3WEE B;  1YI2 N;  3A5N C;  1VQ9 N;  3LVW A;  3RVC A;  3KOY E;  4CZM A;  3SAG A;  1NMD A;  3CJ1 A;  2FOI C;  4BG9 A;  3SAT A;  2OAN A;  1KC8 O;  2IVO A;  4M9S A;  5ITU A;  5AQZ A;  3GQ5 A;  1QHA A;  2E8A A;  2F5N A;  4YOX A;  2NRT A;  4GV6 A;  4BC2 A;  3CIP A;  4LJ5 A;  2NNW A;  3KOZ E;  5ITY A;  4P16 A;  2DPN A;  2CFO A;  3VER A;  4IJA A;  4DKW A;  3MN5 A;  1EO1 A;  3CCR N;  1WUA A;  3CQX A;  3VLF B;  3L29 A;  2KEB A;  5FSW A;  2CHV A;  2L6O A;  1FNN A;  2D0O A;  2GUP A;  4KH6 A;  1IBM M;  3U6S A;  3GL1 A;  3VKH A;  1VQK N;  4X64 M;  2L7I A;  1SXJ A;  4H5V A;  2NRH A;  2OPF A;  5BR9 A;  2ASP A;  3KP0 E;  3MCP A;  3MX5 A;  1SXJ C;  4DV0 M;  3L0Q A;  2WC9 A;  4BRD A;  4BC5 A;  5LMU M;  3LDO A;  4QS9 A;  4Z6Y A;  5KQ8 A;  2HCB A;  1Z6T A;  1IXS B;  5M1P A;  5AQJ A;  4WFA L;  5C2F A;  4XEI A;  1NJG A;  2IIR A;  2UXB M;  2YFQ A;  4HLQ A;  5FLX S;  4BGB A;  5DNY A;  4HTL A;  3UZU A;  2KA6 B;  5H37 D;  4AM7 A;  1YIJ N;  3ZC7 B;  1P90 A;  2NRX A;  1GLF O;  3C0B A;  1YJW N;  4QS7 A;  1BOT O;  4NRW A;  2NRW A;  2D7E A;  2J7N A;  4WYB A;  3H3O B;  2XH9 A;  1GLN A;  1S72 N;  1TUY A;  3SBT A;  1NGB A;  4CZF A;  1IBL M;  3LDP A;  3VMF B;  3VTI A;  3U60 A;  2CV2 A;  1JCF A;  4JN4 A;  4XH5 A;  3CME N;  3O1W A;  2OTL N;  4JKG A;  4FCT A;  4DR6 M;  4FCV A;  3K8Z A;  3GLG A;  4JI4 M;  3CTW B;  5KPT A;  4EFH A;  2Y21 A;  3LQR A;  1IQP A;  2YCH A;  3KFU G;  4LF4 M;  3FZK A;  1R2Z A;  1MDU B;  1VQN N;  2D7H A;  1G4A E;  2E88 A;  4PT5 A;  1K3X A;  3CF5 L;  1UM8 A;  2R4J A;  2RGH A;  5IWA M;  3AGK A;  3MMV A;  2DWZ B;  1QQO A;  4ITQ A;  2F7T A;  3GQ3 A;  3H46 O;  3HHX A;  3M6A A;  5AQV A;  1QAO A;  3TWK A;  3TSP A;  1I4W A;  4BR0 A;  2A3Z A;  3DXM B;  2UU9 M;  3MX2 A;  4IBG A;  1X37 A;  3ID8 A;  3E1Y A;  3EZW A;  4QHT A;  1O13 A;  3Q7B A;  3M6G A;  2XZF A;  3U61 B;  4IOC L;  5IRE B;  4A57 A;  3H45 C;  4H0T B;  3W0F A;  2ZGY A;  3BF3 A;  2CV0 A;  1QZ5 A;  2CGL A;  5AQM A;  2DXI A;  3E4R A;  4LRT A;  3D2F A;  1R7R A;  3ID6 A;  3JS6 A;  4ILH A;  3FTD A;  1R2Y A;  3QIC A;  1C0F A;  3A5L C;  1QAM A;  3U8X A;  4M0D A;  4AKI A;  3VF2 A;  2BJW A;  4OX9 M;  3ZX3 A;  4CD3 A;  1JR3 D;  3E66 A;  4XH1 A;  3RSE B;  2V1C A;  2ZGZ A;  4IWV A;  3SHF A;  3P31 A;  1HKC A;  2IVN A;  4NLB A;  4JI6 M;  5AQS A;  4MGI E;  4LFB M;  4JKF A;  1TDH A;  1YIT N;  2A5Y B;  4B3R M;  2Q1N A;  4AM6 A;  3DXK A;  4LJ6 A;  5C15 A;  4B3T M;  3WXI A;  1IXZ A;  3UE5 A;  4AKG A;  5BN9 A;  1NVM A;  4BRN A;  1Q86 O;  3EIH A;  3HGI A;  3L4I A;  2QP9 X;  4YOR A;  1HLU A;  4H0O A;  1V4S A;  1KFV A;  3HTV A;  3QDK A;  3H1V X;  2EO2 A;  3R9P A;  3GOI A;  5EJC A;  2XSZ A;  3DZD A;  4YOT A;  4DR3 M;  4WFB L;  5LY3 A;  3AOE A;  3SFZ A;  3VEX A;  4LRS A;  3U4L A;  3UKU B;  3GPX A;  3D8B A;  2C5R A;  1NGI A;  4Z8X A;  2AHM A;  5ITR A;  2E2P A;  1QYR A;  4ISE A;  4NSR A;  2V7Y A;  3CCM N;  1OFH A;  3CI5 A;  2DVW B;  4JI2 M;  1JCE A;  1D4X A;  4KBO A;  3I56 N;  4FPA A;  3U6C A;  1W97 L;  3IUC A;  4WQ5 A;  1JR3 A;  2YJF A;  3KHY A;  1NGA A;  2Q31 A;  2V51 B;  4CHT B;  2V6Z M;  5BR8 M;  3BP8 A;  3O9Q A;  3WXK A;  3PLA A;  3U6E A;  3HI0 A;  3WEE A;  3I4Y A;  3UGJ A;  5LJV A;  4QOS A;  4MO4 A;  2HBK A;  2XF3 A;  2EWS A;  3TTD A;  4YOV A;  2Z4S A;  3G25 A;  4DR5 M;  3SAH A;  3TWL A;  1YXQ A;  1GLL O;  2XZU A;  1ZC6 A;  3OBW A;  3M3Z A;  5KQD A;  3GPU A;  4MGK E;  4I5S A;  3C6H A;  1HPM A;  2P9U B;  4B3M M;  2ZBK B;  4OO1 J;  2Q2E B;  1GKI A;  3SLC A;  3MHV C;  2L09 A;  1M1K O;  2RE2 A;  4ISG A;  1OVY A;  4J8F A;  3DA1 A;  5EOY A;  4BRG A;  5F1X A;  4XGI A;  2QW9 A;  4PD2 A;  3TPZ A;  2UUC M;  4JK8 A;  5DM7 L;  5AZJ B;  4BRM A;  4YHH M;  1JQJ C;  3HZ6 A;  3R8F A;  4PL7 A;  2P9L B;  3MN9 A;  4AG6 A;  4B1X B;  5GIN A;  4LJ7 A;  2KLA A;  1QQM A;  5BRF A;  3C58 A;  3CCQ N;  3MWP A;  3FGU A;  2QWR A;  1DGB A;  4M7X A;  3I4V A;  4JN6 A;  3VOV A;  2XFT A;  3D7E O;  4BVP A;  4GVE A;  4WCE L;  1C0G A;  1HQC A;  2HHH M;  1K8K B;  2RKO A;  3L2A A;  3RGS A;  1NGG A;  2R62 A;  4II7 A;  4MGY E;  5AQF A;  4NRV A;  4LF9 M;  2QWQ A;  4DV5 M;  3T38 A;  2QBY B;  5AQR A;  3VFD A;  3ZX2 A;  5EX5 A;  2QEX N;  1K3W A;  2P9N B;  3ENB A;  2HBL A;  2BJV A;  2KXE A;  3TSQ A;  4BRQ A;  4L16 A;  5KO3 A;  5GKN A;  4IJE A;  2R65 A;  3WQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...