2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Pantothenate kinase 1
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
3WQUA 5E84A 3EN9A 5B8HA 5LY3A 4WYBA 1QZ5A 1Z05A 2FLOA 2UYTA 2GUPA 4EHTA 3H45C 3FZHA 4FWOA 2PBDA 3D2FA 4WQ5C 3F9MA 5BRDA 3C0BA 3ZX3A 3VF6A 4PL8A 1SQKA 1MWMA 5AQHA 1LOTB 3L6QA 5AZIB 3FR0A 3GG4A 1QQMA 1NGAA 3FZLA 3H1QA 2P9UB 1H1VA 5E26A 4I6MB 3KZBA 2QM1A 5AZJA 1X3MA 4YDUA 4B1ZA 4GY2B 2GELA 4KBOA 1V4SA 3UKUA 2ZGYA 4WQ4A 3HI0A 4C23A 3CJ9A 2GEMA 3AAQA 3O80A 5I9EB 3ZX2A 4BRAA 1BUPA 1E4GT 4JD2A 4BREA 2E8AA 1NBWA 4FL9A 4XEIA 2GWKA 4FWPA 3VESA 3GDQA 4B1XB 2A40A 3EO3A 3W3DA 3JXUA 4FWLA 3IDHA 4RCHA 4JD2B 5EOYA 5FPDA 4FOEA 5AQPA 4BRQA 2NRHA 4QS9A 2ASOA 2CGKA 3EKUA 1ATRA 1QQOA 4K41A 1SAZA 2HF4A 3VEZA 1SZ2A 3ID8A 3WT0A 4HTLA 5JLHA 4RWTA 3TPQA 1LCUA 1C0FA 5ADXH 3EKSA 3QBXA 5FPEA 3P4IA 2A42A 2CH5A 1OKJA 3BP8A 2VCPA 4FSVA 4B1UB 1GLJO 1J6ZA 1QQNA 4WQ5A 2P9NA 3WXKA 4H03B 3MN9A 4NO7A 3M6GA 4QS8A 3LDOA 4CZJA 2E2NA 3CHWA 5AQQA 4B1WB 2P9IA 3O08A 2CGLA 2V52B 3ZETB 5AR0A 3DXMA 4DCHA 4A62A 3J8AA 3MMVA 1RFQA 3ZEUA 2P9PA 4H0VB 5AQWA 2ASMA 2QW9A 3KHYA 2E2QA 2VWBA 5EY4A 4AM6A 5AQIA 3MN5A 3I8BA 4BRHA 3QFPA 1NMDA 4PKGA 3D7EO 3IFRA 3TU5A 2ZGZA 4BRGA 3IMXA 2OANA 3VEVA 4BROA 3DXKB 4IZ9A 5AQZA 3VF4A 3I33A 4PKHA 4FPAA 5AQOA 1K8KB 2FF3B 3RSEA 3WUHA 2HOEA 4H0YB 4E1JA 1BWFO 3FZMA 1NM1A 4ISFA 1HKBA 4HWIA 2Q2RA 4BRKA 1HLUA 1E4FT 2QWQA 5AQGA 4CBUA 4CD1A 2FSNA 2QXLA 2D1KA 2D0OA 5EX5A 3QBWA 1GLLO 3FGUA 4FWSA 4H0TB 3EZWA 1R59O 3WEEA 2Q0RA 3HM8A 4GNIA 3UKUB 2GWJA 2P9LB 3O4WA 4ISEA 1YUWA 4YDUC 2F9WA 2QWMA 4B9QA 2WUSA 5F1XA 3O1WA 4IXCA 1RDWX 4PL7A 2I7PA 1Q18A 2E1ZA 2P9NB 3AARA 4WQ4C 1GLDG 4FWKA 4DHYA 2CH6A 3QB0A 3U9ZA 5BPMA 1HJOA 2Q36A 5AQVA 2FSKA 5BPNA 3O8MA 3UB5A 3AAPA 4BGBA 2Q97A 4FOIA 4CZKA 1TUYA 5AFUA 3O5BA 3QMLA 2QWOA 3VENA 5AQJA 2ZWHA 2IVPA 3CQXA 1S3XA 3DXMB 4RTFD 4BC3A 1C0GA 4JNEA 3AY9A 4M7XA 5AQSA 1HPMA 3HBTA 4CD3A 3A5NC 5F2RA 3L0QA 1BDGA 4CZIA 1MDUB 3H3NO 4K42A 1T6DA 4BR7A 4I6MA 3CI5A 1NLVA 1TYQB 5AQXA 3A5MC 3EL2A 3OHRA 4Y0WA 2I7NA 3LM2A 1YVNA 3O6WA 3ULEB 4BR0A 2E2PA 3L4IA 3GOIA 5EXWA 2EWSA 2YHXA 1P8ZA 3CJAA 4IWVA 3D2FB 2E2OA 3ENOA 3VEOA 1BU6O 4Z94A 4FWRA 2ITMA 3VETA 2A5XA 2P9SA 4XH1A 5AZIA 4XH4A 5BPLA 1NGCA 4M7YA 4BRPA 3HSCA 1T6CA 1QHAA 5JMVA 2E88A 3R6MA 2KHOA 3UE5A 5AQTA 2FXUA 3SLCA 4K25A 2YJEA 1D4XA 3A5LC 4BRLA 4CZHA 4M63C 1KAZA 3M1FA 1NGJA 3O1BA 3MDQA 4BRFA 3QFUA 2P9KB 1DKGD 1XUPO 2CGJA 2VYPA 3QICA 1HX1A 3LDNA 4BRDA 4B1VA 5JLFA 5AQNA 2W41A 3H3OB 3ENHA 3DAWA 2F9TA 1IJJA 3CETA 5KPZA 1Y64A 3GE1A 3FLCO 1XC3A 2Q0UA 1HKCA 3GL1A 2NLXA 1GLEG 3VGKA 5AQLA 1ZC6A 4LC9B 2D0PA 3CQYA 2YHYA 5AZJB 4BR9A 2H3GX 3QDKA 2ZF5O 3UKRA 4JHDA 4A2AA 1GLAG 1G99A 2D4WA 2J4RA 3ULEA 2HMPA 2PAVA 4JHDB 2IVNA 1DEJA 4FWMA 1YXQA 4BC4A 4BR5A 3C7NA 4CZGA 5KPTA 4EAHD 5KPRA 1BG3A 2A41A 4BVOA 4F9OA 4CZMA 4H5TA 5BR9A 4H5WA 3VERA 3R8EA 5JICA 5KQDA 1JCEA 4BC2A 4CBXA 4CZFA 5AQMA 4BRNA 1ESVA 3MN7A 4NB4A 5AQFA 4BR4A 1RGIA 4IJNA 1BO5O 4BR2A 3FE1A 4FO0A 5BRHA 2QWLA 4CJ7A 4IO8A 3RSEB 1GLFO 4FWQA 3VOVA 3MCPA 1YAGA 3VPZA 4EHUA 3ATUA 2A6AA 2P9SB 4BRCA 4FWNA 5AQUA 3H46O 5ELZA 1GLCG 3HTVA 2P9IB 2BUPA 4BVPA 3H6EA 4FPBA 1TYQA 3U4LA 1BA1A 1KXPA 3UKRB 2P9KA 2IIRA 3DWLA 3FZFA 5KQ8A 4BQLA 1ATSA 2Q31A 1BA0A 1HKGA 1Z6RA 2DPNA 3U8XA 5CE3A 1IG8A 3SJHA 2GTDA 3LDLA 3VEXA 1CZAN 4BQZA 4EIAA 2AP1A 4EFHA 2ASPA 1ATNA 2QWPA 3BF1A 3LDPA 3WXIA 2AA4A 3WXJA 1WOQA 4MLHA 3A8YA 3MN6A 3B8AX 4DB3A 5BREA 3A5OC 3CJ1A 4H0PA 3WXLA 4BRIA 5F0XA 1NGIA 5AQRA 3CIPA 1NGHA 4O5FA 3JS6A 2NZTA 3H1VX 4O8KA 3WEEB 3LL3A 1TUUA 1JCFA 2YI1A 1MWKA 1MA9B 2V51B 3ATVA 2E1YA 4CBWA 2P9LA 3CJ7A 5FPMA 1BOTO 2QWRA 3CERA 3C7NB 4AM7A 4BG9A 1X9JA 1U2VA 4MO5A 4H0XB 4MLEA 1NGGA 2QWNA 1EQYA 3ZEUB 3G25A 4A61A 3FFKB 3HZ6A 3S41A 5LJWA 1NWKA 3BF3A 1QZ6A 2FSJA 3GBTA 3ZX0A 4CI6A 2YJFA 3DJCA 2Q1NA 1HUXA 4A2BA 2IVOA 5AQKA 4BGAA 3MK6A 3M3ZA 2A3ZA 4L3QA 3CJBA 2FF6A 3VF2A 2V7YA 4H5NA 4BG8A 3VGMA 5TKYA 2YCHA 4MO4A 3ZETA 3D2EB 3VEWA 2HF3A 3CJCA 4IJAA 4K43A 1JCGA 3BUZB 3W0LA 1ZXOA 3SMPA 1T44A 1V4TA 4BC5A 3D2EA 3KVGA 3SMSA 2P9UA 3WQTA 1XQSC 4H5RA 4JAXA 3U9DA 3DXKA 1DGKN 2V7ZA 5EVZA 4H5VA 1WUAA 4CZEA 4JN4A 5BN8A 5FPNA 5AFUH 3VEYA 5BN9A 1GLBG 1NGEA 3IUCA 4H0OA 3SK3A 1U2VB 3A0IX 1U6ZA 1NGFA 3R9PA 4J8FA 1K8KA 5AQYA 1NGBA 1S22A 4XH5A 4BRMA 4PKIA 3VGLA 1X3NA 1ZBSA 4CZLA 1KAXA 1NGDA 5LJVA 2YHWA 1KAYA 4QS7A 5BRFA 5ADXA 3FZKA 4DQ8A 3BEXA 3LDQA 4B1YB 3LM9A 2E20A 4ISGA 2P9PB 2W40A 2BTFA
chains in the Genus database with same CATH superfamily
3WQUA 3M6AA 4DS4A 1HR0K 4C8OA 1TGUA 1QSSA 2VQEK 2Z1IA 3EN9A 4KH4A 5B8HA 5LY3A 4WYBA 3SYLA 1QZ5A 1JR3E 5FTMA 2BJVA 4PD2A 1TKTA 4BACA 2XY7A 3RMBA 1LWFA 3HP9A 4JI8K 4EHTA 1IXZA 3KS4A 2A5YB 3H45C 4FK2A 1XWIA 4B3OA 4E7KA 4Q5VA 3O9UA 4WQ5C 3F9MA 4NOOB 3ZX3A 4LJ6A 2Z1HA 1IN6A 4AILC 3FUWA 5AQHA 1SL1A 1JR3A 3WNHA 3DMJA 2BDPA 1IY2A 2BE2A 3TAFA 3LVVA 1S9EA 4HEOA 2YFQA 1NJFA 3FZLA 3NBXX 3LP2A 4LSNA 2GQFA 4I6MB 3RRHA 3KZBA 4KHPK 1RT4A 4H4MA 4A5BA 1GKIA 4MGZE 5AZJA 3G71N 1X3MA 3NH0A 1QSYA 4B1ZA 4JI4M 3HWSA 4X66M 4KBOA 2W42A 5IZ7D 5J2QA 4HLQA 3HI0A 4IG3A 4RW8A 3AAQA 5I9EB 1NNJA 4BRAA 1RU3A 2YHAA 2HL7A 1BUPA 2XSZA 3J7BA 4OU7A 3AKZA 4BREA 2VGNA 2F5QA 4PT5A 4G4QA 1BQNA 1NBWA 4FL9A 1D2NA 5BR8K 5M1FA 1RBRA 2A40A 1EP4A 1G71A 1J09A 1IM2A 2HBJA 4DQPA 5EOYA 4IBKA 4BRQA 1GABA 1HNZM 4AKHA 4OX9K 2QEXN 5LMUM 3HT3A 1RCHA 1SZ2A 3ZSQA 3EY1A 3J81S 4RWTA 2O8FB 1LCUA 5DYGA 1N6QA 5ADXH 3LWMA 1XXHB 3LAKA 4N56A 2OO9A 2A42A 3CGWA 2CH5A 1OKJA 2VQFK 3J7AS 3BP8A 3JAMO 3L27A 4YOXA 4B1UB 4CGGA 1GLJO 1J6ZA 1Q82O 2LSNA 2D7EA 3WXKA 3AVLA 4LFAK 3HX3A 4WW0A 3AVKA 3LVWA 2WC9A 3AO5A 5ITQA 4B3RM 3M6GA 3CCRN 3CD6N 2CV2A 2HB5A 3MEEA 4ELVA 3B6OA 4II7A 1OVYA 1S1TA 2V52B 3DXMA 3J8AA 3MMVA 1RFQA 4MDBA 2P9PA 3ZEUA 3N4PA 4KHNA 5CY4A 2W82A 1D9DA 2QW9A 1LW0A 2E2QA 2G8VA 5EY4A 3LANA 4UY8O 3MN5A 3NBIA 4DV3M 3VKHA 3OBWA 4BRGA 2JUJA 3B9PA 3HHWA 2WONA 3IMXA 5J2NA 1DTQA 1XWLA 4CK3A 4PY5A 3VF4A 4ZHRA 1M90O 3R8FA 3WUHA 1DGGA 5ITXE 1WSGA 4E1JA 1BWFO 1NK8A 4FCWA 1YT3A 1ASUA 3VMFB 1GJSA 4HWIA 3OTOK 3L2QA 4PUOA 3THWB 3MJ5A 1KFVA 2C5RA 5AQGA 2QWQA 1KLMA 3TR8A 2BGGA 1WN7A 2HHWA 3ZT2A 2QXLA 1OH8A 2D1KA 1REVA 2DAEA 4U7BA 2WTUA 1R6BX 1GLLO 2RN2A 3SJJA 4H0TB 3ZT1A 3LW5F 2O8BA 2IS3A 3T1HK 1WR1B 2HHVA 4DTNA 3U6FA 3K5OA 4E1MA 4B3SK 3O4WA 4NSRA 3I0SA 2QWMA 1NU0A 1WJ7A 1K6YA 4NC6A 1Q18A 2E1ZA 3OYCA 2UU9K 4I8OA 3DLGA 2CH6A 1RNHA 2RHKA 4LSLA 3IRXA 5JI3E 1HJOA 1N33M 5AQVA 2OPQA 5C42A 4FJIA 1L1ZA 2ATQA 3K9JA 3U3YA 4GHLA 5GINA 2XHBA 4L16A 3GLIA 2Q97A 4JK9A 3VQDA 4CZKA 2B6AA 3WHLA 2L7HA 2QKKA 3DXMB 1S3XA 1Z5BA 3MCAB 5C24A 2WSFF 3LCVB 1IBKK 3DLHA 5AQSA 1HNIA 4H4OA 5KGWA 3L0QA 3TTDA 4B9VA 3H3NO 2X49A 4NCGA 3M8QA 1C7YA 3WXMB 4FJLA 2XF3A 2FNAA 3FFIA 4LZZA 2O8DB 3EL2A 5IWAK 4DUZM 4Z4GA 4Y0WA 4J2DA 3LM2A 3K92A 3ULEB 2VIIA 3VN5A 4BR0A 3W68A 3QERA 2E2PA 4M42A 2UUBK 4AI6A 1WGLA 2NUBA 4KAZA 3GOIA 2EWSA 4Z4CA 1YI2N 1TK5A 1HNZK 3D2FB 4GVEA 3L3UA 3VEOA 1CZ9A 4PHTX 3SPZA 1JLFA 4GHAA 4CEBA 4F3OA 1WBBA 1O13A 3KLGA 3NBPA 4Z94A 4B3MK 3V76A 5LMNK 2KRKA 1BI4A 1BIZA 5AZIA 1TK8A 4XH4A 5GADP 2ERCA 3PNVA 4M0WA 3SBJA 4GMQA 3HSCA 3IAYA 2CV0A 1QHAA 4KV8A 5JMVA 2E88A 1ZQ9A 1BGXT 2FXUA 4E3SA 3KFUG 1IKXA 4F2SA 4GITA 4X62M 4DFJA 3CC2N 2O8CA 4GRIA 4G4NA 3M1FA 2GNOA 4BE1A 1TH2A 1KLNA 3MX2A 4DV0K 2KFNA 4FXDA 1QHTA 1WGNA 3OS0A 4I9QA 3SQ4A 1HX1A 4DV5K 3V81A 4M9ZA 3LDNA 4IEEA 1N75A 2HHHM 1G41A 3OYJA 4JI0M 4RW7A 4XGIA 1RDCA 5KPZA 2RPIA 2QK9A 3NF6A 1R7RA 2E4LA 2Q0UA 4AHTA 4XIUA 1N32K 3K58A 3VGKA 5AQLA 3Q8GA 4KPYA 1ORYB 2R6FA 3I4YA 2FBXA 4LC9B 3SBTA 4BR9A 4M3TA 4DTSA 2ZF5O 1U47A 1NK6A 4CFCA 1QVGM 3SC3A 3E46A 3AVAA 3LAMA 4A2AA 5DM7L 5ITXA 1GLAG 4YOVA 1JL1A 1LV7A 4FJKA 3ULEA 4JI7M 3DLBA 3CCQN 2KQ2A 1DEJA 3LALA 4BC4A 1XMQK 3QESA 3Q7CA 5KPTA 1QDTA 1IQPA 3AV0A 4BVOA 1W5TA 4F9OA 3TSUA 4DKWA 4LJ4A 5CZ2A 2CUZA 4CZMA 4AQYK 3BGRA 3R8EA 3VERA 5JICA 1JCEA 1ZBIA 4MGIE 3L3VA 4CBXA 1UWBA 1KCFA 3MX5A 1N34K 1NNEA 4JI0K 4KREA 3NVMA 1ESVA 4NB4A 4OVLA 4KRFA 1OFHA 1XC9A 1VQ6N 1LWEA 3QEWA 5FSWA 1QUSA 5I42A 1RTHA 4BB9A 4Q0BA 4CFBA 3T3FA 2LXEA 3PFIA 4FJXA 5EQTA 5I3UA 5BRHA 4F1IA 1X9MA 2ZANA 4KT0F 2ZTCA 1Y8GA 4OVZA 3VPZA 3VOVA 1TVRA 2YNMD 3T15A 4Z4EA 2V6ZM 5C0YA 1G59A 2A6AA 4IBCA 4BRCA 2X8AA 3QWLA 1RTJA 5ELZA 1GLCG 2CEAA 2BUPA 2P9IB 1T03A 1WB9A 3H6EA 3C3EA 1M1KO 4B9NA 1VK0A 1YJWN 1TYQA 3NMUA 1XNRK 1XNQM 3ZCMA 4PDGA 3UKRB 1NHGC 3DWLA 5C2DA 4QNMA 3L2WA 4FW9A 4BQLA 3GLIE 1N34M 1ATSA 1NJYA 3SYZA 2Q31A 2CHVA 4CGFA 4W5NA 1IKWA 1VEJA 2GTDA 3LDLA 4HUEA 4D82A 4FD2A 4L6V6 1CZAN 3E01A 3KD5E 2DAGA 2UXDK 4EFHA 3VDPA 1OQYA 3W0FA 3FUXA 4LFBK 3WXJA 3M8RA 3JSMA 3CMAN 2AJQA 1YSYA 4CF9A 4MLHA 3DLRA 1VQON 2DVWB 1FKPA 3MN6A 3KSJA 4CEEA 3U60A 4Z6YA 5F0XA 4B08A 1NGIA 1SS6A 3J27B 1XMOK 3GPUA 4CK1A 4N47A 4JKGB 4EP5A 5D3GA 1TUUA 3VQ4A 1MWKA 2V51B 3ATVA 3KWIA 4CBWA 1U49A 3GQ3A 1HJRA 1JLQA 1VQ1A 1BCOA 1DTTA 1YTAA 3F5TA 4D81A 3GPXA 3CERA 4CJQA 3G4SN 3U5ZB 4BG9A 1X9JA 4MO5A 4EZ6A 1VQMN 2A1SA 4JI3K 5DYIA 2WFBA 3DZDA 4DSJA 3G25A 4DR3M 3QEIA 3FFKB 2UUAK 2RF2A 1QZ6A 4NRVA 4A5AA 3ZX0A 4GH9A 4C8KA 1NJXA 3FRIA 4QOZB 5HRNA 4JK7A 3CCJN 1IXRC 1W2BM 2DWZB 4JI2M 4LFBM 2IVOA 3CM6A 3OYLA 4BGAA 3ISNC 1VQ4N 2A3ZA 1VSEA 2KLAA 4R71A 1JKHA 2XRIA 5EP1A 3THYA 2V7YA 4H5NA 4Y28F 4LF5K 3BBZA 2YCHA 2KZZA 4CJTA 1SXJE 4K0KM 4CERA 4IFEA 4MO4A 4EIWA 4OW0A 4P16A 3ASMA 5KO3A 1IFYA 3O9RA 1ZBFA 3CTWB 3CJCA 5EU7A 2EKFA 1NOYA 4WE1A 4K43A 3BUZB 3R3LA 3W0LA 1ZXOA 4Q7JA 2QP9X 3RE8A 3RR8A 1TDZA 1V4TA 1KFDA 1HQUA 3D2EA 3KVGA 2P9UA 4BDYA 1WBDA 2XEPA 3MMPA 3G10A 3C65A 3K0SA 2LVOC 1EWQA 1RT7A 3DXKA 2Z1GA 4YOWA 4CHPA 1DGKN 5EVZA 3V1RA 3HJQA 2Z4SA 1HQCA 3E1YA 4AG6A 5BN8A 3L28A 4DF8A 3PX6A 3GO8A 2K47A 3VEYA 2RGOA 2EA0A 1B92A 1GLBG 5BN9A 3IUCA 4M3YA 3A0IX 4NYNA 3PLAA 5FDLA 1NGFA 1S1WA 2HBMA 1NV8A 5AQYA 3V1QA 3K5MA 5IT9S 5GAGP 1Q8IA 2YX6A 1XHXA 3SAVA 1X3NA 1NJWA 3MAQA 4JYAM 4V19S 2ZM6K 1FK9A 4DS5A 3QYEA 2LVNC 1NGDA 1EO1A 3J80S 4QS7A 2DAMA 3HPGA 3FZKA 4E7JA 2YNIA 2E20A 3U6QA 4FJHA 1OH5A 4KTQA 3V9UA 2R0IA 5E84A 2MH8A 3AO2A 4LF6K 2O5RA 1Z05A 5HRPA 3HHZA 3TABA 1TK0A 3FZHA 4FWOA 4N41A 2PBDA 1GOCA 3D2FA 3OA9A 2EKKA 1NSFA 3K2PA 3U6MA 5BRDA 2HHQA 3KVWA 3MHVC 1MWMA 1PJSA 1LOTB 2J7OA 3I55N 4FM0A 4E7HA 5AZIB 2PYJA 3HRGA 1A5WA 1BHLA 3OJSA 3AVJA 1J5EK 3ULDA 1QQMA 1NGAA 2F5OA 1VQPN 2P9UB 3OYHA 1ZMUA 4LFCK 3GLFB 2QM1A 4AHRA 1G8PA 4OKEA 1U48A 4YDUA 3MEDA 4CJPA 3OS2A 4NXNM 3L2VA 1DGHA 1RBVA 4LFAM 4C23A 3OW2M 3CJ9A 3C58A 3O80A 2JP7A 4GEWA 4DV7M 4KKOA 3ZX2A 3SYKA 3HJ8A 2IDOA 3C94A 5ITYA 3AGKA 1E4GT 2E8AA 4FJGA 4A59A 1LW2A 1VEKA 1RDDA 4XEIA 1OVQA 3O3GA 3TTCA 2LH0A 4KTWA 2F7TA 4E89A 4DQSA 3PO4A 1EE8A 5FPDA 1YTUA 4JI2K 1RDBA 5AQPA 3SHGB 2APLA 2NRHA 2ZQBA 3QAUA 2CGKA 3EKUA 1K73O 4HL4A 4K41A 1JLCA 1SAZA 5FLXO 1RTDA 1RDUA 4HTLA 3DOKA 3VFDA 4IBGA 4JKDA 3QBXA 1GOBA 4M3XA 5FPEA 4LRTA 1W7AA 5GAEP 2Z7JA 2OYQA 1ASWA 1R4GA 5E41A 2R7YA 4JI4K 1HYZA 4W5QA 4FSVA 1QQNA 5EXPA 2NRRA 3QEVA 4TSXA 2JWKA 3G0ZA 5JVGL 1N36K 4YY3K 5KTQA 4DR5K 3A2FA 4NYFA 3CHWA 4B1WB 5GIOA 3O08A 4JI1K 1XHBA 5AR0A 4DCHA 3WNFA 3U6EA 1CXUA 4ILHA 3KHYA 2HHHK 3EZ5A 4FVUA 3I8BA 4BRHA 4M3ZA 1NMDA 4PKGA 4OGEA 5GAHP 4G4RA 2ZGZA 3LWLA 2Z3XA 2NRXA 2XH9A 1HT2E 1JLGA 2UXCK 4FK0A 2X6NA 2WSEF 4IBJA 3DXKB 4BROA 3SASA 3E4RA 3I33A 4FPAA 5AQOA 2FF3B 3RSEA 2HOEA 4H0YB 4OKKA 4CIGA 3FZMA 4DR4M 1NM1A 3DI6A 4FJNA 4M9SA 1JLEA 2G8KA 2MR9A 4S12A 1EIJA 3IG1A 1SG9A 1P90A 2FFJA 4JS5A 4FVMA 3KWGA 1HLUA 4O8UA 4BRKA 1IBKM 1E4FT 3CCSN 4DFMA 4FW2A 4FYDA 4AZFA 1L5UA 1E9RA 2EHGA 1XB2B 2D0OA 4CCHA 3QBWA 2ZAOA 4O0IA 1HR0M 1HRHA 2GBZA 3HKPA 3EZWA 5FLXS 4DR5M 4QHSA 3HM8A 1FW6A 1T7PA 1Q9XA 1IV0A 3MECA 3VQ6A 4ISEA 1QVRA 4IBFA 1TDHA 1YUWA 4WF9L 2F9WA 4K8ZA 4B9QA 3K5LA 3H4MA 2P9NB 1MN3A 4WQ4C 3U3GA 2VGMA 2YKNA 3QIOA 3RGSA 2YQZA 1BL3A 1VQ5N 5BPNA 4X65K 2HHTA 4B3MM 4BWMA 5M1QA 1QTMA 1VQLN 1Z59A 4L8RC 3QO9A 4CVNE 3KOWE 4KTZA 3SBGA 4FOIA 2D0BA 3I51A 4CIFA 4DSIA 2QWOA 5AQJA 1EWRA 1QZMA 3CQXA 4BC3A 4LF9M 4M7XA 5C18A 2ZTDA 3HBTA 2D7GA 5C1BA 3SAGA 3A5NC 5F2RA 4LRSA 3OY9A 3EE9A 4G9ZA 3Q7BA 2OQ4A 3S3NA 4K42A 1V34A 4L78A 3OYBA 4I6MA 3CI5A 1NLVA 3C6AA 4DV5M 2C9CA 2KNAA 3A5MC 4KH6A 1J53A 1S6QA 3O6WA 1TGOA 3KOYE 4JKEA 4JRQA 1VQ8N 3OYMA 1YE9A 4JKAA 3LQRA 2OZMA 3CJAA 2C99A 4IWVA 1X9WA 3ENOA 4OLAA 1VSDA 4JKBA 2QI2A 2J7NA 3J80O 1OIZA 4YORA 4FWRA 1ZMWA 1OH7A 3NVKA 1T3VA 2P9SA 1PJTA 1KC8O 2VQFM 4OPJA 4K8XA 4DTXA 3SQ0A 3R6MA 3UE5A 5AQTA 3AFHA 4LH4A 4LF9K 3SUPA 4W5OA 4FM1A 4K25A 3A5LC 4BRLA 1NGJA 3KIOA 4BRFA 4MGKE 4DSKA 1DKGD 1XUPO 1B9FA 1YVUA 2VYPA 1LAWA 1OAOC 4M0DA 4MB7A 4W5RA 1YF5L 5JLFA 3M7GA 2W41A 4FJ8A 4X64K 1EETA 4FJMA 1VHXA 4HCBA 4I2QA 3GE1A 1U4BA 4CESA 4GC5A 3VLFB 2HHUA 4MH0E 2F5PA 4ICLA 3GL1A 3FUTA 1KQSM 3IKMA 3OYFA 2CHGA 1GL7A 3GRYA 4DR6M 2D0PA 3BOSA 3RWUA 5AZJB 3VQBA 2L4EA 3L4QA 2LTUA 5EXSA 3TTFA 1G99A 2D4WA 2ZE2A 4Y1DA 5SZTA 3NF8A 3SI6A 2Q2EB 4LJ9A 1EXQA 1NKEA 3MXJA 4JHDB 4FWMA 1YXQA 4CZGA 4DU1A 1MU5A 4DV0M 4EAHD 5KPRA 4GV9A 1ZV1A 4Y1CA 4H5TA 5BR9A 4BC2A 4CZFA 1GL6A 4EP4A 4JN6A 3PVSA 2VWJA 4BRNA 3MN7A 2BWBA 1NY5A 4DV1M 3EIHA 1QS4A 4CGHA 5AQFA 2O4GA 1CLQA 3T7ZA 1IKYA 4BE0A 4X65M 4JV5K 1WSIA 4IJNA 2ZBKB 4OPHA 3B89A 3TAEA 4BR2A 4R7GA 4RG8A 1E94E 2HNZA 4CJ7A 1L2DA 2D7HA 2LVQD 1GLFO 3MXIA 1TH4A 4CEFA 3CCLN 5CR4A 2P9SB 1XMOM 3LDSA 3P83D 3OS1A 4CGJA 4DR2K 2FBTA 3SUQA 5HROA 2E6LA 4CJLA 4GC9A 5M1NA 3CF6E 3PSIA 1O1WA 1C1CA 1LTMA 2GUIA 1RT2A 3WHKA 4LD0A 3U4LA 1Z5AA 2IIRA 3UGJA 3JR4A 2JZ0A 3I56N 1VG5A 3NF9A 1BA0A 1Z6RA 2DPNA 3O9QA 4F2LA 2WOMA 4IDHA 3U8XA 5MLCQ 3LZJA 1UM8A 1R2ZA 3VEXA 3LP1A 3NHGA 2B3TA 2KEBA 2QWPA 3BF1A 2VG6A 4I4LA 3LDPA 5M1KA 5J1EA 4DQIA 4ZTJA 3IECA 1WOQA 4RNAA 4LJ8A 3QLHA 4H8KA 4CJEA 4KB1A 4BRIA 1NNUC 4CHYA 1WHCA 4O5FA 3M8PA 2CE7A 3GQ5A 3H1VX 1FKOA 1KVAA 2RE2A 3WNGA 4LFCM 2HCBA 4DUYK 3HVTA 2YI1A 3OYEA 1U45A 3PUFA 1VSMA 1RBTA 3C9PA 1KFSA 4KFBA 3RMDA 5FPMA 4IJFA 3ID6A 3GPPA 2JY6B 4ZTFA 4AM7A 1QUTA 1U2VA 3GLHE 3B6PA 4MGYE 4H0XB 4CF0A 3T6PA 4DTMA 3NGIA 4BDZA 4MLEA 3R9XB 2QWNA 3ZEUB 3NFAA 4MDAA 1IO2A 5LJWA 5HL7L 1KD1O 2H5XA 3OYIA 1NMNA 3AO4A 3GBTA 3FTFA 4F3TA 2R46A 3K1JA 3U61A 2D0AA 2YJFA 4CF8A 2DAIA 1HUXA 3C6UA 4JKCA 4IOCL 1F4IA 2DWMA 1OFIA 5AQKA 4OPKA 2E6MA 3CJBA 1QAQA 2ZD1A 3VF2A 1VSLA 3FKEA 4N76A 4BG8A 5DM6L 4B3TK 4JI7K 3VGMA 2BNKA 3HXMA 1HYVA 3S3MA 5HBMA 3ZETA 1V33A 3O9TA 3D2EB 4CJRA 4DQQA 3U6CA 1J7KA 2KZUA 1I39A 5KRTA 1JCGA 1IN4A 1SKSA 2LHCA 3PSFA 5C12A 1S1UA 4R3DA 4XK8F 3SMSA 3U6DA 3TWKA 1XQSC 2V1CA 3J2PB 3VQPA 2HSTA 4JAXA 3U9DA 3AO1A 4DTUA 3CCEN 3AA4A 2DI0A 1WUAA 4CZEA 3M8SA 4MGHA 1Q9YA 1K82A 5FPNA 2G8IA 3PX0A 4GMJB 1RT6A 4CJVA 4H0OA 1S1XA 4DV6M 5FRNA 1SKWA 1B9DA 4PWDA 3FRHA 2L09A 1HQEA 2R62A 1NGBA 2C9OA 3RFWA 4BY9C 1DLOA 4PKIA 5A2QO 5AJ3K 3GLFE 3U60B 4CZLA 3THVA 2YNFA 5LJVA 4X66K 5ADXA 1T3TA 4DQ8A 1N78A 2L2DA 3LDQA 3DLEA 2W40A 2BWEA 2ITGA 4HUFA 2BTFA 4IEIA 5BPVA 4FLUA 4FJ7A 4RW6A 4LZJA 3DOAA 2P1JA 2ZAMA 4YOTA 3KP0E 2P5TA 2GUPA 4GIPA 3ZT0A 3E21A 3CC7N 3VQQA 1UFZA 4LJ7A 3CM5A 3MWPA 3VF6A 3KP1E 2UU9M 3ZSWA 4PL8A 3PV8A 1LV5A 3RGPA 1I3AA 2QSFX 3PXGA 3L6QA 1BI4B 2FS1A 2KTQA 4CHZA 1N33K 1PM5A 3BY5A 2JY8A 2DHYA 3CCUN 1YLAA 1OKSA 4RW9A 2PY5A 3J7AP 1ZYQA 1UA1A 3P39A 4O4GA 2QA4N 2R65A 1JJ2M 4B9SA 3RRGA 1JL2A 4D80A 4GKKM 1X9SA 4KH5A 3ZSVA 4GY2B 4J2EA 4I5SA 1WIVA 2V1UA 4LG2A 1V4SA 4NLBA 3UKUA 2ZGYA 4WQ4A 2DY4A 2GEMA 3CG7A 1FJGK 2OZSA 4IJEA 4FLWA 2VDBB 4DR7K 2KHHA 1DGBA 2D0CA 2VQEM 1NO1A 2HVHA 4FWPA 3VESA 3MXMA 4ELTA 5ITTA 4RF0A 3EO3A 1EKEA 4FWLA 3IDHA 4RCHA 4JD2B 3PNYA 3HHXA 4CK2A 1NY6A 4DTPA 3EIEA 4CJ4A 4QS9A 3HJFA 2CHQA 4BLCA 3KXEC 3BDPA 3J81O 4DR1M 1HNWK 1CXQA 2FBYA 3ID8A 3PX4A 4AHUA 3JR5A 5JLHA 1DV0A 1ZMVA 3UMMA 1DT9A 3TPQA 1C0FA 4LH5A 3AOEC 5M1PA 4AHCA 1NK7A 1WNSA 3CFOA 3OTOM 3NAEA 4G6ZA 3NGZA 3VQAA 4KB0A 2VCPA 4E19A 2PFUA 4RKUF 4NXNK 1C6VA 3ILKA 2P9NA 3IS9A 4RW4A 5CZ1A 2XO7A 1I94K 4DU3A 4GKJK 2O8CB 3MN9A 3VQ7A 1S5JA 2LVAA 2VG7A 4W5TA 1UA0A 3LDOA 4B8CA 2C96A 4IOXA 4CJ5A 1HNXK 4LF7K 3ZETB 1X37A 4CJFA 4A62A 3E66A 4NCBA 4OKJA 4H0VB 5AQWA 2ASMA 4IIWA 2Y21A 4NRWA 1QSLA 2VWBA 2YR0A 4O5BA 3OVNA 1YJ9N 3AL0C 3K8ZA 3D7EO 4DMNA 4DU4A 4HTUA 4CF2A 1QZEA 2DZNB 1S9GA 3KTQA 1C0TA 4IZ9A 1YIJN 5AQZA 1IN7A 3BZKA 4OO1J 3TE6A 4M3RA 4JI5K 4LF4M 2O8DA 3KKSA 4DTRA 4LY6A 3SUOA 4ISFA 3AVIA 3T19A 1T05A 1Z6TA 3EEQA 1RILA 2Q2RA 2OTLN 3CXCM 4QOZC 1JQJC 2FSNA 1D5AA 1VSKA 3KLEA 3GRRA 2JY7A 2H1RA 3JYTA 1VQNN 3I0RA 1VSFA 3V6DA 3FGUA 1ILYA 3WEEA 2CWBA 2GWJA 2LNHC 3TQSA 2CRUA 5A2QS 3B7NA 1OJLA 1OTRA 3R1XA 4CEDA 3K57A 3O1WA 4P17A 4GV3A 2FBVA 1SXJA 3VK7A 3L2UA 4LJAA 2O25A 1E3MA 4JKFA 4FWKA 2A1RA 1PJIA 2ZJPL 4LGMA 3U9ZA 3TAMA 4JV5M 2FSKA 3VQ9A 4LCBA 3AVHA 4WP2A 3O8MA 3UB5A 3ZSYA 3AAPA 3SAWA 4BGBA 3S9HA 5FTKA 3NWLA 1E9SA 1TUYA 2G8UA 3QMLA 4AHVA 3VENA 2CFOA 2BH1A 2IVPA 4RTFD 4JNEA 3AY9A 3T1AA 3GRVA 3C6TA 4R79A 1WLJA 4CD3A 1I4WA 1J54A 2ETJA 1HT1E 3QEXA 2LHGA 1FJGM 1PRBA 3GLHA 1ZBUA 4M45A 4BR7A 1N8RO 3PY8A 3KW6A 3EYZA 3T1HM 1J9AA 1TYQB 1WSHA 2O01F 3QNOA 2QBYA 2I7NA 2JWLA 4X64M 1TL3A 4Z0UA 1QQWA 5HOOA 1QDRA 5EXWA 2YNHA 2Z4RA 3D45A 4JS4A 1J5OA 1VDLA 3E9LA 3L26A 2PYLA 4QNRA 2VF7A 1BU6O 2QENA 2UXDM 3PIOL 3IHPA 1GO5A 2XY6A 2A5XA 3KLHA 3LP0A 4XH1A 2L6OA 5BPLA 3T1YM 4I81A 4BRPA 3TARA 2E5LK 3LZIA 2F5NA 2R18A 3SLCA 2UXBK 2YJEA 1NJIO 2HNYA 3KKRA 1KAZA 3MDQA 1L3UA 4KHUA 2P9KB 4JI1M 1BISA 4IOAL 4G4OA 5M1OA 3QICA 1RT1A 2OPSA 2XFTA 4HVJA 3PO5A 4DUZK 2OTJN 4BRDA 4B1VA 5AQNA 4CW7B 3AVCA 3HO1A 3VK8A 3DAWA 2F9TA 1IJJA 2KNVA 2RRUA 3CETA 4JI3M 3OYGA 4FZYA 4CHTB 2JNHA 3DRPA 3FYCA 3FLCO 4FLZA 1SV5A 4PCZA 3OYAA 4HCCA 1HKCA 4IO9L 3ZLJA 1S1VA 1GLEG 1QAMA 3NF7A 3B7QA 1ZC6A 2QXFA 2RKIA 1D0MA 3CQYA 2H3GX 3QDKA 3L8BA 3UKRA 4JHDA 4CFDA 4Z4FA 1A5TA 2VWKA 5IT9O 2JGUA 2J4RA 2M5ZA 5F3WA 2HMPA 4JK8A 1Q86O 4KHYA 3HM9A 2QNJA 4N5SA 4K0KK 2O4IA 1VSIA 1SXJC 3D6RA 3C7NA 3AVNA 2G3QA 4CJSA 3I01M 1W0HA 2DAKA 3B74A 4G1QA 1BG3A 2A41A 4CEQA 2O8EB 4LY7A 1BVSA 2OOBA 4H5WA 3THGA 3DYAA 1EFUB 4OGCA 3HU2A 3V4IA 1JXEA 4CHNA 1NK9A 4L4UA 5AQMA 5FROA 1VQKN 3GP1A 3G6EN 4FZZA 2HNDA 4WFBL 3KOZE 1RGIA 1ZBHA 1HNVA 3KJVA 4DQRA 3HU1A 1W5SA 3A98B 3CF2A 1BO5O 2Y0TA 5HP1A 4HHTA 3CQ8A 3NH1A 4FO0A 2QWLA 3U6OA 3L2RA 4IO8A 1SXJB 3AVMA 2M60A 4FWQA 3RR7A 3MCPA 1YAGA 1Z25A 4Z4IA 3ATUA 1YHQN 4W5WA 3TWLA 1W97L 2LWXA 4EZ9A 4FWNA 4MFBA 5AQUA 4O0JA 4FJ9A 2F4VM 4B8AB 1GVNA 3FTEA 3HTVA 4BVPA 1WAJA 2KZSA 4FPBA 5KRSA 3V9SA 4DTOA 1BA1A 4QAGA 1TV6A 1IBMK 1P3QQ 2QHOB 2P9KA 2UUBM 2R4EA 3FZFA 4DLEA 2K0BX 1N77A 4B9LA 1TH3A 3T69A 4CEZA 1Y97A 3KLIA 2HW3A 3DLLL 4FLVA 1HKGA 3KK1A 3SJHA 4ANRA 3FTCA 2KZMA 2XY8A 1ASVA 4EIAA 3DA1A 1S6PA 3B8AX 4DB3A 5BREA 3O4QA 3WXLA 4H0PA 5SWMA 2O8EA 3I04M 3FTDA 3E9SA 1IN8A 2DZOB 3NGYA 5AQRA 3HU3A 1NGHA 4JLHA 2OA8A 3JS6A 4B9UA 4C8MA 2Y20A 1ITGA 4O8KA 2R45A 1JCFA 1RT3A 1MA9B 1NK4A 2E1YA 1OH6A 1DGHB 3AOGA 3E9OA 4KHWA 4GKKK 5C15A 3VA3A 1MJGM 3A45A 3CPWM 4FWHA 1BOTO 1T6OA 3PIPL 5EP4A 2QWRA 1HQYE 3UJNA 3C7NB 3ZSXA 4LGYA 4OVZB 1S3SA 3BXWA 5TKWA 3GLGB 3DRRA 2I5JA 2W6LA 1W9HA 3HZ6A 3TANA 3S41A 3UIQA 5BR8M 4KI6A 3HOTA 2N35A 5DFLA 3KK7A 2Q1NA 2K6BA 1XHZA 1HYSA 2JXNA 2NQ8C 1WSJA 1L1TA 4C8LA 2Y0QA 3J7ZO 5J2PA 3M3ZA 3CFRA 4L3QA 2C98A 2OPFA 2FF6A 3CCMN 4A3VB 3U6SA 3CCVN 3SATA 5TKYA 3W0LB 1VQ9N 3GLGE 2QKBA 1NVMA 1XXHE 2AHMA 2Z1JA 2GX9A 3ENBA 1SL0A 2HKJA 4NSOB 2HF3A 1V92A 2YNGA 4KO8A 4DTJA 3SZ2A 2PZSA 5DK5A 3CYMA 3SMPA 4GKJM 4FCVA 1KTQA 4DV4M 4AF1A 2NRZA 5DNYA 3B7ZA 2XY5A 1E32A 3WQTA 1UOCA 1IKVA 1HNXM 2HBLA 2VG5A 3FE3A 4CHOA 4JN4A 2IC3A 4CJKA 2CP8A 3KDSE 2DHRA 4CISA 4I9LA 3CF5L 3SNNA 5AFUH 4JRPA 4DV3K 1MU2A 4TUWA 5K14A 2IAJA 5T7BA 4REZA 3TSPA 3KSXA 2EUCA 3QETA 1S22A 2F4VK 4JI5M 4AKIA 3VGLA 1NV9A 5C2FA 4BBAA 5KI6A 1ZBSA 2FC0A 1NJZA 4Z8XA 3D0PA 1JLBA 5FTNA 1IBMM 2YHWA 1RT5A 1K3XA 2MGWA 4ID1A 1JLAA 4B1YB 3LPUA 4DV7K 3LM9A 4ISGA 5JVHL 1IXSA 2P9PB 1HPZA 1IG9A 3ITHA 3ZH9B 5ITRA 3HP6A 3V1OA 3GQ4A 1D0KA 2JA2A 3P5JA 2QZ4A 2UYTA 2FLOA 2FOIC 1C1BA 4IG0A 4B3SM 2RKOA 3CPEA 1Z26A 5KGXA 4DBGB 1VRTA 1KVBA 1VRUA 4NLCA 3C0BA 1DO0A 4GV6A 4OX9M 5JS1A 1SQKA 4WCEL 1A5XA 3SV3A 3FR0A 3THWA 3GG4A 5E6JA 3O3FA 3H1QA 1H1VA 5E26A 2MROB 3K9PA 8CATA 3K59A 1I94M 2YV0X 4CEOA 4L15A 2GELA 4YOUA 4FM2A 2KKZA 4NXMK 2JLEA 4KLNA 3GLFA 4MQ3A 3HY5A 1AUAA 3P38A 4JD2A 2XZFA 2P51A 4I2PA 1L3SA 4DSLA 2GWKA 4OJRA 3ZSRA 2JWSA 2QBYB 3GDQA 4FCTA 5IWAM 1C0MA 3AA5X 5JS2A 3ZSZA 4B1XB 2ZJRL 3W3DA 2QPAA 2XLJA 3JXUA 3TI0A 4FOEA 3OYNA 4QOSA 1WSEA 2ASOA 1ATRA 3T38A 1QQOA 1R5LA 2K9DA 4YFUA 3SV4A 4DFPA 2HF4A 4B3TM 3VEZA 3SQ2A 3THYB 3KK2A 3WT0A 3O3HA 4FZXC 1C0UA 1DGFA 3TWMA 5J2MA 3U6LA 2NRWA 4M41A 2NNWA 3F2KA 3EKSA 4ILJA 1IXSB 3RVCA 4DSEA 1L8QA 3P4IA 4KHPM 2KRUA 7CATA 4M3UA 4CJUA 3CF0A 3T1YK 3AVFA 4YOYA 3GRUA 4WQ5A 4H03B 5GKNA 1Q39A 4KODA 3K9KA 4NO7A 3LP3A 1IH7A 3HYFA 4QS8A 4CZJA 2R44A 1NK5A 1Q7YO 2E2NA 3VDUA 4JEPA 2EJSA 2KW0A 4B7HA 3SARA 5AQQA 4DR7M 2P9IA 2CGLA 3M5RA 4KI4A 1RDAA 1LWCA 1Q81O 4C1NI 2DWNA 3IG8A 1FXXA 2W6KA 4CFAA 1FNNA 4AM6A 3ALYA 5AQIA 4AH9A 1IBLM 3QFPA 4KHQA 3IFRA 4FLTA 1Q3CA 3TU5A 4DLGA 4OLBA 2IGIA 2OANA 1QANA 4JKHA 2KNZA 3VEVA 3O9SA 1N32M 4Z4HA 1UAXA 4PKHA 3H4JA 1K8KB 1GOAA 4F8RA 1TL1A 2ZJQL 1R2YA 4HUGA 4DR6K 3AV9A 2B4JA 1HKBA 3KD1E 1TKZA 4JYAK 1ZBLA 3OYKA 4C8NA 3A42A 3QYBA 1RBUA 4CBUA 4IKFA 4CD1A 1G4AE 3V9WA 3LCUA 4CGYB 1D9FA 2DXIA 3AJIB 3DFZA 5EX5A 4AW4A 3C6HA 3ZC7B 2OPRA 2F8TA 2FE8A 4FWSA 1SXJD 1R59O 4JKGA 4LJ5A 2Q0RA 4GNIA 3UKUB 3SFZA 2P9LB 3BZCA 2DENA 3KOXE 4YDUC 4CHQA 2DKLA 2WUSA 1F21A 5F1XA 3AA3A 5HRSA 1XXHA 1RDWX 4IXCA 4PL7A 2I7PA 2O8BB 3VQEA 3AARA 3UK6A 3OYDA 1GLDG 4CJWA 4DHYA 3KLFA 4PQUA 1GJTA 3QB0A 3D8LA 5BPMA 2G8HA 2Q36A 1GLNA 1J5EM 1BQMA 1QQCA 4CIEA 1QYRA 4E7LA 4XBOA 3AGRA 2EO2A 5AFUA 3O5BA 3HPOA 2KDLA 5L8RF 1WSFA 1HMVA 2ZWHA 1C0GA 1WAFA 4CJ6A 3V9XA 1A5VA 1HPMA 3SAHA 4X62K 4WFAL 1WXQA 2G8LA 3L25A 1BDGA 2OPPA 4CZIA 4R5PA 1MDUB 1VAZA 3C3DA 1T6DA 2R4JA 4IFVA 3DM2A 2DFHA 2WBNA 3W67A 3IG5A 3TWHA 5AQXA 3OHRA 1PJQA 4C1NK 5CHIA 3C95A 1YVNA 3NCIA 1YJNN 2KA6B 3MWTA 3I8DA 4JXJA 4MM3B 3L4IA 1L3VA 2X6SA 3U61B 2YHXA 1P8ZA 3VQ5A 4JI6M 3QNNA 2F8SA 1H6UA 2E2OA 3THXA 3SUNA 4CGDA 5CYQA 3DOLA 3SCXA 3FUVA 4BDPA 3HHYA 2X4AA 2O8FA 5H1SQ 2ITMA 3VETA 3NE6A 1NGCA 4LF8K 1TR8A 3M0EA 4M7YA 1D8YA 1T6CA 2OOAA 4IBIA 3UZUA 2KHOA 4M3WA 4QHTA 1D4XA 4CZHA 1HJPA 1NG9A 4M63C 3TPZA 2OCEA 1N36M 3AA2A 4G3OA 3O1BA 3VQ8A 2Y1JA 4LF7M 4IBEA 3QFUA 2CGJA 2UUCM 1Q02A 4GVMA 4ILGB 1Q3BA 2L7IA 1R0AA 3F92A 3AOEA 3H3OB 3ENHA 1IBLK 2G8WA 3N4QA 5CYMA 4DWIA 1Y64A 2XSZD 4CECA 4FCYA 2KFZA 1XC3A 3KK3A 2NLXA 4AKGA 4CE9A 5C25A 2XZUA 4DV2M 4LF4K 2NRVA 4DR4K 2KXEA 4B7GA 5LMNM 2YHYA 3U6PA 3LPTA 3VKGA 3HJSA 3P31A 5IREB 4F4KA 2DFFA 4IFYA 4CEAA 2E5LM 2WSCF 4M9XA 3TL4X 3RTVA 4QCLA 3LQQA 1X1PA 1IN5A 2UXBM 4ID5A 3ZSOA 1PJJA 4DR2M 2L4FA 3O4NA 2PAVA 5GIPA 2IVNA 3FD9A 3E9PA 5HRRA 3TAGA 4BR5A 1L3TA 1NKBA 1C1AA 5LL6Z 2JZ1A 3ZT4A 3HPHA 4YHHM 3NH2A 1TTEA 1LAVA 2G8FA 1KRPA 1JB0F 5KQDA 2Q3SA 1XI1A 4UN2B 2F96A 3CFPA 3VA0A 2DTUA 4CIZA 3CMEN 3HL8A 1NK0A 5FRMA 3RMCA 3AO3A 2YHBA 1JR3D 3WNEA 4BR4A 1KSPA 2G5GX 3P1GA 3DRSA 5EXTA 4GW6A 3VTIA 4CJ3A 4PA1A 4BWJA 1BCMA 1PGYA 3J7YP 1N5YA 2DZLA 1CUKA 2QTDA 4DV2K 3FE1A 3OJUA 4E7IA 2HMIA 5EXXA 3RSEB 1NHWC 4E1NA 2HWJA 2P5OA 4UQGA 2CV1A 4EHUA 2HBKA 3GLGA 1OAIA 4OPAA 4YNQA 1AIPC 2HVIA 3H46O 4DFKA 4WFNL 1L2BA 1XMQM 2KW4A 3QINA 1C1KA 2ZM6M 3DLKA 5JI2E 4YHHK 3MEGA 1KXPA 4AQYM 1RBSA 2X74A 4F2RA 3SHFA 5KQ8A 1VSHA 2GV9A 3KS8A 4RF1A 4ZPXA 3F9KA 4FW1A 4CGIA 3Q8XA 4NL4H 4DR3K 4JI6K 2LBCA 2HAKA 2LVPC 3ZQJA 4PDIA 1RTIA 2EX3A 5CE3A 1IG8A 1QVFM 2QQ8A 3ZT3A 1VQ7N 3SAUA 2P5GA 1TF0B 3EE8A 4BQZA 4JI8M 2AP1A 1K3WA 2ASPA 1ATNA 2XFSA 1EX4A 1D0LA 4LF8M 2AA4A 3WXIA 1VDDA 2BJWA 2JY5A 4KHSA 4FWGA 4FLYA 3A5OC 3CJ1A 4B7FA 3FUUA 2DFEA 1IY1A 3CIPA 1T43A 5DMRA 3A46A 1BIUA 5EP2A 2BANA 1IY0A 2NZTA 3AVBA 3WEEB 3LL3A 1TAUA 2UUCK 2NRTA 3ZCBB 1NKCA 2P9LA 4J2AA 3CJ7A 1S72N 2QCUA 2F5SA 1XNQK 3NDKA 3HVRA 3HGIA 5EP3A 2HHSA 5EJCA 1KYIA 1CZBA 1NGGA 1EQYA 4A61A 3HSTB 5FTJA 1VSJA 5HLFA 2D5RA 3K2LA 2WZJA 1NWKA 3CC4N 3AVGA 3BF3A 3RMAA 2FSJA 3OBYA 4CI6A 2J5YA 3DJCA 1VEGA 3HK2A 1QE1A 5C10A 3TAQA 2Z8YM 3ZYYX 5H37D 4O44A 3SPYA 1TKDA 2YKMA 4ITQA 4KO0A 4A2BA 1NOZA 1ZAEA 3QEPA 3D8BA 4E0DA 4FLXA 3MK6A 5ITUA 4DV6K 3TAPA 1U04A 1G15A 5LMUK 3L29A 1HNWM 4DR1K 4CF1A 1NJGA 2IOCA 4FWDA 1KVCA 1L2CA 3SAFA 1K9MO 3K9OA 3JAMS 4B9TA 3GLIB 4DUYM 3VEWA 3I4VA 1OIPA 4IJAA 2X78A 3VTHA 2FH0A 4FJ5A 1T44A 2DWLA 4BC5A 4B3RK 4AG5A 1DO2A 4B9MA 4IBNA 4DV1K 1KSFX 1YUBA 1JXBA 4YY3M 2MJ5B 1SUQA 4H5RA 4DSFA 3THXB 2UUAM 1TKXA 4LF6M 4IBDA 2V7ZA 4H5VA 4O55A 5FTLA 1G3IA 4IBBA 4FK4A 1MX0A 4AHSA 4J2BA 3HOSA 4I7FA 1NGEA 3F73A 3U5ZA 3LMMA 1SKRA 3SK3A 1U2VB 3TSQA 1U6ZA 2DNAA 4FJJA 2UXCM 3SQ1A 1SL2A 3R9PA 4J8FA 4LF5M 1K8KA 4ELUA 1QAOA 1Z5CA 4BE2A 2VF8A 4NCAA 2HHXA 3GPYA 4IDKA 4XH5A 4BRMA 3V9ZA 3S3OA 1K8AO 4DF4A 2B5JA 2Y1IA 3H08A 1KAXA 3FYDA 4DG1A 4L8RB 1XNRM 3HZJA 2RGHA 3GLHB 1KAYA 1XC8A 1TAQA 4NXMM 5BRFA 3L2AA 3BEXA 3VQCA 2XGNA 4A57A 1YITN 1T8EA 3QIPA 4WURA 4U67L 4DV4K 3K5NA 3A8YA
chains in the Genus database with same CATH topology
3WQUA 3M6AA 1TGUA 3EN9A 4KH4A 5B8HA 5LY3A 4WYBA 3SYLA 1QZ5A 5FTMA 2BJVA 4PD2A 4EHTA 1IXZA 3KS4A 2A5YB 3H45C 1XWIA 3O9UA 4WQ5C 3F9MA 4NOOB 3ZX3A 4LJ6A 1IN6A 3FUWA 5AQHA 1JR3A 1IY2A 3LVVA 2YFQA 1NJFA 3FZLA 4I6MB 3KZBA 3G71N 4A5BA 1GKIA 4MGZE 5AZJA 1X3MA 4B1ZA 4JI4M 3HWSA 4X66M 4KBOA 5IZ7D 4HLQA 3HI0A 3AAQA 5I9EB 1NNJA 4BRAA 2HL7A 1BUPA 2XSZA 3J7BA 4OU7A 3AKZA 4BREA 2VGNA 2F5QA 4PT5A 4G4QA 1NBWA 4FL9A 1D2NA 5M1FA 2A40A 1J09A 1IM2A 2HBJA 5EOYA 4IBKA 4BRQA 1HNZM 4AKHA 2QEXN 5LMUM 1SZ2A 3J81S 4RWTA 1LCUA 5DYGA 5ADXH 1XXHB 2A42A 2CH5A 1OKJA 3J7AS 3BP8A 3L27A 4YOXA 4B1UB 1GLJO 1J6ZA 1Q82O 2D7EA 3WXKA 4WW0A 3LVWA 2WC9A 3CD6N 5ITQA 4B3RM 3M6GA 3CCRN 2CV2A 4II7A 1OVYA 2V52B 3DXMA 3J8AA 3MMVA 1RFQA 4MDBA 2P9PA 3ZEUA 3N4PA 2W82A 2QW9A 2E2QA 5EY4A 4UY8O 3MN5A 3NBIA 4DV3M 3VKHA 3OBWA 4BRGA 3B9PA 3HHWA 3IMXA 3VF4A 1M90O 3R8FA 3WUHA 1DGGA 5ITXE 4E1JA 1BWFO 4FCWA 3VMFB 4HWIA 3MJ5A 1KFVA 2C5RA 5AQGA 2QWQA 2QXLA 2D1KA 4U7BA 1R6BX 1GLLO 4H0TB 3O4WA 4NSRA 2QWMA 1Q18A 2E1ZA 4I8OA 2CH6A 2RHKA 5JI3E 1HJOA 1N33M 5AQVA 1L1ZA 3K9JA 4GHLA 5GINA 4L16A 3GLIA 2Q97A 4JK9A 4CZKA 3WHLA 2L7HA 3DXMB 1S3XA 1Z5BA 3MCAB 5AQSA 3L0QA 3TTDA 3H3NO 2X49A 3WXMB 2XF3A 2FNAA 4LZZA 3EL2A 4DUZM 4Y0WA 3LM2A 3K92A 3ULEB 2VIIA 4BR0A 2E2PA 4AI6A 3GOIA 2EWSA 1YI2N 3D2FB 4GVEA 3VEOA 4PHTX 4GHAA 1O13A 4Z94A 2KRKA 5AZIA 4XH4A 5GADP 2ERCA 3PNVA 4M0WA 3SBJA 4GMQA 3HSCA 2CV0A 1QHAA 5JMVA 2E88A 1ZQ9A 2FXUA 3KFUG 4GITA 4X62M 3CC2N 4GRIA 4G4NA 3M1FA 1TH2A 3MX2A 1HX1A 4M9ZA 3LDNA 4IEEA 1N75A 2HHHM 1G41A 4JI0M 4XGIA 5KPZA 1R7RA 2Q0UA 3VGKA 5AQLA 1ORYB 3I4YA 4LC9B 3SBTA 4BR9A 2ZF5O 1QVGM 3SC3A 4A2AA 5DM7L 5ITXA 1GLAG 4YOVA 1LV7A 3ULEA 4JI7M 3CCQN 1DEJA 4BC4A 3Q7CA 5KPTA 1IQPA 3AV0A 4BVOA 1W5TA 4F9OA 3TSUA 4DKWA 4LJ4A 2CUZA 4CZMA 3VERA 3R8EA 5JICA 1JCEA 4MGIE 4CBXA 3MX5A 3NVMA 1ESVA 4NB4A 1OFHA 1VQ6N 5FSWA 4BB9A 2LXEA 3PFIA 5EQTA 5BRHA 2ZANA 4OVZA 3VPZA 3VOVA 2YNMD 3T15A 2V6ZM 5C0YA 1G59A 2A6AA 4IBCA 4BRCA 2X8AA 3QWLA 5ELZA 1GLCG 2CEAA 2BUPA 2P9IB 3H6EA 1M1KO 1YJWN 1TYQA 3NMUA 1XNQM 4PDGA 3UKRB 3DWLA 1NHGC 5C2DA 4QNMA 4FW9A 4BQLA 1N34M 1ATSA 2Q31A 2CHVA 2GTDA 3LDLA 4D82A 4FD2A 1CZAN 4EFHA 3VDPA 3W0FA 3FUXA 3WXJA 3CMAN 1YSYA 4MLHA 1VQON 2DVWB 3MN6A 3KSJA 3U60A 4Z6YA 5F0XA 4B08A 1NGIA 1SS6A 3J27B 3GPUA 4JKGB 1TUUA 1MWKA 2V51B 3ATVA 3KWIA 4CBWA 3GQ3A 3F5TA 3CERA 4D81A 3GPXA 3G4SN 3U5ZB 4BG9A 1X9JA 4MO5A 1VQMN 5DYIA 2WFBA 3DZDA 3G25A 4DR3M 3FFKB 1QZ6A 4NRVA 4A5AA 3ZX0A 4GH9A 4JK7A 3CCJN 1IXRC 1W2BM 2DWZB 4JI2M 4LFBM 2IVOA 4BGAA 1VQ4N 2A3ZA 2KLAA 5EP1A 2V7YA 4H5NA 2YCHA 1SXJE 4K0KM 4IFEA 4MO4A 4EIWA 4OW0A 4P16A 5KO3A 3O9RA 3CTWB 3CJCA 4K43A 3BUZB 3R3LA 3W0LA 1ZXOA 2QP9X 3RE8A 1TDZA 1V4TA 3D2EA 3KVGA 2P9UA 2XEPA 3C65A 3DXKA 4YOWA 1DGKN 5EVZA 3HJQA 2Z4SA 1HQCA 3E1YA 4AG6A 5BN8A 3L28A 3GO8A 2K47A 3VEYA 2RGOA 2EA0A 5BN9A 1GLBG 3IUCA 3A0IX 3PLAA 1NGFA 2HBMA 5AQYA 5IT9S 5GAGP 2YX6A 3SAVA 1X3NA 4JYAM 1NGDA 1EO1A 3J80S 4QS7A 3FZKA 2E20A 3U6QA 5E84A 2O5RA 1Z05A 3HHZA 3FZHA 4FWOA 2PBDA 3D2FA 3OA9A 1NSFA 3U6MA 5BRDA 3KVWA 3MHVC 1MWMA 1LOTB 2J7OA 3I55N 5AZIB 3HRGA 1QQMA 1NGAA 2F5OA 1VQPN 2P9UB 3GLFB 2QM1A 1G8PA 4YDUA 4NXNM 1DGHA 4LFAM 4C23A 3OW2M 3CJ9A 3C58A 3O80A 3ZX2A 4DV7M 3SYKA 3HJ8A 5ITYA 3AGKA 1E4GT 2E8AA 4A59A 4XEIA 3TTCA 2LH0A 2F7TA 1EE8A 5FPDA 5AQPA 3SHGB 2NRHA 3QAUA 2CGKA 3EKUA 1K73O 4HL4A 4K41A 1SAZA 1RDUA 4HTLA 3VFDA 4IBGA 4JKDA 3QBXA 5FPEA 4LRTA 5GAEP 2Z7JA 4FSVA 1QQNA 5EXPA 2NRRA 2JWKA 5JVGL 3CHWA 4B1WB 5GIOA 3O08A 1XHBA 5AR0A 4DCHA 3U6EA 4ILHA 3KHYA 4FVUA 3I8BA 4BRHA 1NMDA 4PKGA 5GAHP 4G4RA 2ZGZA 2Z3XA 2NRXA 2XH9A 1HT2E 4BROA 4IBJA 3DXKB 3SASA 3E4RA 3I33A 4FPAA 5AQOA 2FF3B 3RSEA 2HOEA 4H0YB 3FZMA 4DR4M 1NM1A 4M9SA 4S12A 1P90A 2FFJA 4FVMA 3KWGA 1HLUA 4O8UA 4BRKA 1IBKM 1E4FT 3CCSN 4AZFA 1E9RA 2D0OA 3QBWA 2ZAOA 1HR0M 3HKPA 3EZWA 5FLXS 4DR5M 4QHSA 3HM8A 4ISEA 1QVRA 4IBFA 1TDHA 1YUWA 4WF9L 2F9WA 4B9QA 3H4MA 2P9NB 4WQ4C 2VGMA 3RGSA 2YQZA 1VQ5N 5BPNA 4B3MM 5M1QA 1VQLN 1Z59A 4L8RC 3KOWE 3SBGA 4FOIA 3I51A 2QWOA 5AQJA 1QZMA 3CQXA 4BC3A 4LF9M 4M7XA 5C18A 3HBTA 2D7GA 5C1BA 3SAGA 3A5NC 5F2RA 4LRSA 3EE9A 4G9ZA 3Q7BA 2OQ4A 4K42A 4L78A 4I6MA 3CI5A 1NLVA 3C6AA 4DV5M 2C9CA 3A5MC 4KH6A 3O6WA 3KOYE 4JKEA 1VQ8N 1YE9A 4JKAA 3LQRA 3CJAA 2C99A 4IWVA 3ENOA 4JKBA 2QI2A 2J7NA 4YORA 4FWRA 3NVKA 1T3VA 2P9SA 1KC8O 2VQFM 3R6MA 3UE5A 5AQTA 3AFHA 4K25A 3A5LC 4BRLA 1NGJA 4BRFA 4MGKE 1DKGD 1XUPO 2VYPA 4M0DA 4MB7A 1YF5L 5JLFA 3M7GA 2W41A 3GE1A 4GC5A 3VLFB 4MH0E 2F5PA 3GL1A 3FUTA 1KQSM 3IKMA 2CHGA 1GL7A 3GRYA 4DR6M 2D0PA 3BOSA 5AZJB 3L4QA 5EXSA 3TTFA 1G99A 2D4WA 2Q2EB 4LJ9A 4JHDB 4FWMA 1YXQA 4CZGA 1MU5A 4DV0M 4EAHD 5KPRA 4GV9A 4H5TA 5BR9A 4BC2A 4CZFA 1GL6A 4JN6A 3PVSA 4BRNA 3MN7A 1NY5A 4DV1M 3EIHA 5AQFA 3T7ZA 4X65M 4IJNA 2ZBKB 4OPHA 4BR2A 4R7GA 1E94E 4CJ7A 1L2DA 2D7HA 1GLFO 1TH4A 3CCLN 5CR4A 2P9SB 1XMOM 4GC9A 5M1NA 3CF6E 3WHKA 3U4LA 1Z5AA 2IIRA 3UGJA 3JR4A 3I56N 1BA0A 1Z6RA 2DPNA 3O9QA 4IDHA 3U8XA 5MLCQ 1UM8A 1R2ZA 3VEXA 2KEBA 2QWPA 3BF1A 4I4LA 3LDPA 5M1KA 1WOQA 4RNAA 4LJ8A 4BRIA 1NNUC 4O5FA 2CE7A 3GQ5A 3H1VX 2RE2A 4LFCM 2HCBA 2YI1A 5FPMA 4IJFA 3ID6A 3GPPA 4AM7A 1U2VA 4H0XB 4MGYE 4MLEA 3R9XB 2QWNA 3ZEUB 4MDAA 5LJWA 1KD1O 5HL7L 3GBTA 3FTFA 2R46A 3K1JA 3U61A 2YJFA 1HUXA 4JKCA 4IOCL 2DWMA 1OFIA 5AQKA 3CJBA 1QAQA 3VF2A 3FKEA 4BG8A 5DM6L 3VGMA 2BNKA 3ZETA 3O9TA 3D2EB 3U6CA 1J7KA 2KZUA 1JCGA 1IN4A 5C12A 4R3DA 3SMSA 3U6DA 3TWKA 2V1CA 1XQSC 3J2PB 2HSTA 4JAXA 3U9DA 3CCEN 1WUAA 4CZEA 4MGHA 1K82A 5FPNA 4H0OA 4DV6M 2L09A 1NGBA 2R62A 2C9OA 3RFWA 4BY9C 4PKIA 3U60B 4CZLA 5LJVA 5ADXA 1T3TA 4DQ8A 1N78A 3LDQA 2W40A 4IEIA 2BTFA 5BPVA 4LZJA 3DOAA 2ZAMA 4YOTA 3KP0E 2P5TA 2GUPA 4GIPA 3CC7N 4LJ7A 3MWPA 3VF6A 3KP1E 2UU9M 4PL8A 3RGPA 3PXGA 3L6QA 1PM5A 3CCUN 3P39A 2QA4N 2R65A 1JJ2M 4D80A 4GKKM 4KH5A 4GY2B 4I5SA 1V4SA 2V1UA 4LG2A 4NLBA 3UKUA 2ZGYA 4WQ4A 2GEMA 4IJEA 1DGBA 2VQEM 4FWPA 3VESA 5ITTA 4RF0A 3EO3A 4FWLA 3IDHA 4RCHA 4JD2B 3PNYA 3HHXA 1NY6A 3EIEA 4QS9A 2CHQA 4BLCA 3KXEC 4DR1M 3ID8A 3JR5A 5JLHA 3TPQA 3UMMA 1DT9A 1C0FA 3AOEC 5M1PA 3OTOM 4G6ZA 2VCPA 2PFUA 3ILKA 2P9NA 3MN9A 3LDOA 2C96A 4IOXA 3ZETB 1X37A 4A62A 3E66A 4H0VB 5AQWA 2ASMA 4IIWA 2Y21A 4NRWA 2VWBA 2YR0A 1YJ9N 3AL0C 3K8ZA 3D7EO 2DZNB 1YIJN 4IZ9A 5AQZA 1IN7A 4OO1J 3TE6A 4LF4M 4LY6A 4ISFA 1Z6TA 2Q2RA 2OTLN 3CXCM 4QOZC 1JQJC 2FSNA 3GRRA 2H1RA 1VQNN 3FGUA 1ILYA 3WEEA 2GWJA 2LNHC 3TQSA 5A2QS 1OJLA 3R1XA 3O1WA 4GV3A 1SXJA 3VK7A 4LJAA 4JKFA 4FWKA 1PJIA 2ZJPL 4LGMA 3U9ZA 4JV5M 2FSKA 4LCBA 3O8MA 3UB5A 3AAPA 3SAWA 4BGBA 5FTKA 3NWLA 1E9SA 1TUYA 3QMLA 3VENA 2CFOA 2BH1A 4RTFD 2IVPA 4JNEA 3AY9A 4R79A 3GRVA 4CD3A 1I4WA 1HT1E 1FJGM 3GLHA 4BR7A 1N8RO 3KW6A 3T1HM 1TYQB 2QBYA 2I7NA 2JWLA 4X64M 1QQWA 5HOOA 5EXWA 2Z4RA 3E9LA 3L26A 4QNRA 1BU6O 2QENA 2UXDM 3PIOL 2A5XA 4XH1A 2L6OA 5BPLA 3T1YM 4I81A 4BRPA 2F5NA 2R18A 3SLCA 2YJEA 1NJIO 1KAZA 3MDQA 2P9KB 4JI1M 4IOAL 4G4OA 5M1OA 3QICA 2XFTA 2OTJN 4BRDA 4B1VA 5AQNA 3VK8A 3DAWA 2F9TA 1IJJA 3CETA 4JI3M 4CHTB 3FYCA 3FLCO 4PCZA 1HKCA 4IO9L 1GLEG 1QAMA 1ZC6A 3CQYA 2H3GX 3QDKA 3UKRA 4JHDA 2J4RA 2M5ZA 5F3WA 2HMPA 4JK8A 1Q86O 1SXJC 3D6RA 3C7NA 1BG3A 2A41A 4H5WA 3THGA 3HU2A 4L4UA 5AQMA 1VQKN 3GP1A 3G6EN 4WFBL 3KOZE 1RGIA 3HU1A 1W5SA 3A98B 3CF2A 1BO5O 2Y0TA 4FO0A 2QWLA 3U6OA 4IO8A 1SXJB 4FWQA 2M60A 3MCPA 1YAGA 3ATUA 1YHQN 4W5WA 3TWLA 1W97L 2LWXA 4FWNA 5AQUA 2F4VM 1GVNA 3FTEA 3HTVA 4BVPA 2KZSA 4FPBA 1BA1A 2P9KA 2UUBM 2R4EA 3FZFA 1N77A 1TH3A 3T69A 3DLLL 1HKGA 3SJHA 3FTCA 4EIAA 3DA1A 3B8AX 4DB3A 5BREA 3WXLA 4H0PA 3FTDA 3E9SA 1IN8A 2DZOB 5AQRA 3HU3A 1NGHA 3JS6A 2Y20A 4O8KA 2R45A 1JCFA 1MA9B 2E1YA 1DGHB 3AOGA 3E9OA 5C15A 3A45A 3CPWM 4FWHA 1BOTO 3PIPL 5EP4A 2QWRA 1HQYE 3UJNA 3C7NB 4LGYA 4OVZB 1S3SA 5TKWA 3GLGB 3HZ6A 3S41A 5BR8M 3HOTA 3KK7A 2Q1NA 2NQ8C 1L1TA 2Y0QA 3J7ZO 3M3ZA 4L3QA 2C98A 2OPFA 2FF6A 3CCMN 4A3VB 3U6SA 3CCVN 3SATA 5TKYA 3W0LB 1VQ9N 1NVMA 2AHMA 2GX9A 3ENBA 2HKJA 4NSOB 2HF3A 4KO8A 3SMPA 4GKJM 4FCVA 4DV4M 4AF1A 2NRZA 5DNYA 1E32A 3WQTA 1HNXM 2HBLA 4JN4A 3KDSE 2DHRA 4CISA 3CF5L 5AFUH 4TUWA 4REZA 3TSPA 3KSXA 2EUCA 1S22A 4JI5M 4AKIA 3VGLA 5C2FA 4BBAA 1ZBSA 4Z8XA 5FTNA 1IBMM 2YHWA 1K3XA 4B1YB 3LM9A 4ISGA 5JVHL 2P9PB 3ZH9B 5ITRA 3GQ4A 2JA2A 2QZ4A 2UYTA 2FLOA 2FOIC 4B3SM 2RKOA 3CPEA 4NLCA 3C0BA 1DO0A 4GV6A 4OX9M 1SQKA 4WCEL 3FR0A 3GG4A 5E6JA 3H1QA 1H1VA 5E26A 8CATA 1I94M 4L15A 2GELA 4YOUA 2KKZA 4KLNA 3GLFA 3P38A 4JD2A 2XZFA 2GWKA 2QBYB 3GDQA 4FCTA 5IWAM 4B1XB 2ZJRL 3W3DA 2QPAA 2XLJA 3JXUA 4FOEA 4QOSA 2ASOA 1ATRA 3T38A 1QQOA 2HF4A 4B3TM 3VEZA 3WT0A 1DGFA 3TWMA 3U6LA 2NRWA 2NNWA 3F2KA 3EKSA 4ILJA 1IXSB 3RVCA 1L8QA 3P4IA 4KHPM 2KRUA 7CATA 3CF0A 4YOYA 3GRUA 4WQ5A 4H03B 5GKNA 1Q39A 4KODA 3K9KA 4NO7A 4QS8A 4CZJA 1Q7YO 2E2NA 3VDUA 4JEPA 3SARA 2KW0A 4B7HA 5AQQA 4DR7M 2P9IA 2CGLA 3M5RA 1Q81O 4C1NI 2DWNA 3IG8A 1FNNA 4AM6A 5AQIA 1IBLM 3QFPA 3IFRA 1Q3CA 3TU5A 2OANA 1QANA 4JKHA 3VEVA 3O9SA 1N32M 4PKHA 1K8KB 2ZJQL 1R2YA 1HKBA 3A42A 4CBUA 4CD1A 1G4AE 4CGYB 2DXIA 3AJIB 3DFZA 5EX5A 4AW4A 3C6HA 3ZC7B 2FE8A 4FWSA 1SXJD 1R59O 4JKGA 4LJ5A 2Q0RA 4GNIA 3UKUB 3SFZA 2P9LB 3KOXE 4YDUC 2WUSA 5F1XA 1XXHA 1RDWX 4IXCA 4PL7A 2I7PA 3AARA 3UK6A 1GLDG 4DHYA 3QB0A 3D8LA 5BPMA 2Q36A 1GLNA 1J5EM 1QYRA 4XBOA 3AGRA 2EO2A 5AFUA 3O5BA 2ZWHA 1C0GA 1HPMA 3SAHA 4WFAL 1WXQA 2G8LA 3L25A 1BDGA 4CZIA 1MDUB 1VAZA 1T6DA 2R4JA 2WBNA 3IG5A 5AQXA 3OHRA 4C1NK 5CHIA 1YVNA 1YJNN 2KA6B 3MWTA 4JXJA 4MM3B 3L4IA 3U61B 2YHXA 1P8ZA 4JI6M 1H6UA 2E2OA 3FUVA 3HHYA 2X4AA 5H1SQ 2ITMA 3VETA 1NGCA 3M0EA 4M7YA 1T6CA 4IBIA 3UZUA 2KHOA 4QHTA 1D4XA 4CZHA 4M63C 3TPZA 1N36M 3O1BA 4LF7M 4IBEA 3QFUA 2CGJA 2UUCM 4ILGB 1Q3BA 2L7IA 3AOEA 3H3OB 3ENHA 3N4QA 1Y64A 2XSZD 1XC3A 2NLXA 4AKGA 2XZUA 4DV2M 2NRVA 2KXEA 4B7GA 5LMNM 2YHYA 3U6PA 3VKGA 3HJSA 3P31A 5IREB 2E5LM 4M9XA 3TL4X 3LQQA 1IN5A 2UXBM 1PJJA 4DR2M 2PAVA 5GIPA 2IVNA 3FD9A 3E9PA 4BR5A 4YHHM 5KQDA 3CMEN 1JR3D 4BR4A 2G5GX 5EXTA 3VTIA 2QTDA 3FE1A 5EXXA 3RSEB 1NHWC 2CV1A 4EHUA 2HBKA 3GLGA 4OPAA 3H46O 4WFNL 1L2BA 1XMQM 1C1KA 2ZM6M 5JI2E 1KXPA 4AQYM 3SHFA 5KQ8A 3KS8A 4RF1A 4ZPXA 3Q8XA 4NL4H 4PDIA 1QVFM 5CE3A 1IG8A 1VQ7N 3SAUA 3EE8A 4BQZA 4JI8M 2AP1A 1K3WA 2ASPA 1ATNA 2XFSA 4LF8M 2AA4A 3WXIA 1VDDA 2BJWA 4FWGA 3A5OC 3CJ1A 4B7FA 3FUUA 1IY1A 3CIPA 3A46A 5EP2A 1IY0A 2NZTA 3WEEB 3LL3A 2NRTA 3ZCBB 2P9LA 3CJ7A 1S72N 2QCUA 2F5SA 3HGIA 5EP3A 5EJCA 1KYIA 1NGGA 1EQYA 4A61A 5FTJA 3K2LA 1NWKA 3CC4N 3BF3A 2FSJA 3OBYA 4CI6A 3DJCA 5C10A 3ZYYX 5H37D 4ITQA 4A2BA 1ZAEA 3D8BA 3MK6A 5ITUA 3L29A 1HNWM 1NJGA 4FWDA 1L2CA 3SAFA 1K9MO 3JAMS 3GLIB 4DUYM 3VEWA 3I4VA 4IJAA 3VTHA 1T44A 2DWLA 4BC5A 4AG5A 1DO2A 1KSFX 1YUBA 4YY3M 4H5RA 2UUAM 4LF6M 4IBDA 2V7ZA 4H5VA 5FTLA 1G3IA 4IBBA 1MX0A 3HOSA 1NGEA 3U5ZA 3LMMA 3SK3A 1U2VB 3TSQA 1U6ZA 2UXCM 3R9PA 4J8FA 4LF5M 1K8KA 1QAOA 1Z5CA 3GPYA 4XH5A 4BRMA 1K8AO 3FYDA 1KAXA 1XNRM 2RGHA 3GLHB 1KAYA 1XC8A 5BRFA 4NXMM 3L2AA 3BEXA 4A57A 2XGNA 1YITN 4WURA 4U67L 3A8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQU A;  5E84 A;  3EN9 A;  5B8H A;  5LY3 A;  4WYB A;  1QZ5 A;  1Z05 A;  2FLO A;  2UYT A;  2GUP A;  4EHT A;  3H45 C;  3FZH A;  4FWO A;  2PBD A;  3D2F A;  4WQ5 C;  3F9M A;  5BRD A;  3C0B A;  3ZX3 A;  3VF6 A;  4PL8 A;  1SQK A;  1MWM A;  5AQH A;  1LOT B;  3L6Q A;  5AZI B;  3FR0 A;  3GG4 A;  1QQM A;  1NGA A;  3FZL A;  3H1Q A;  2P9U B;  1H1V A;  5E26 A;  4I6M B;  3KZB A;  2QM1 A;  5AZJ A;  1X3M A;  4YDU A;  4B1Z A;  4GY2 B;  2GEL A;  4KBO A;  1V4S A;  3UKU A;  2ZGY A;  4WQ4 A;  3HI0 A;  4C23 A;  3CJ9 A;  2GEM A;  3AAQ A;  3O80 A;  5I9E B;  3ZX2 A;  4BRA A;  1BUP A;  1E4G T;  4JD2 A;  4BRE A;  2E8A A;  1NBW A;  4FL9 A;  4XEI A;  2GWK A;  4FWP A;  3VES A;  3GDQ A;  4B1X B;  2A40 A;  3EO3 A;  3W3D A;  3JXU A;  4FWL A;  3IDH A;  4RCH A;  4JD2 B;  5EOY A;  5FPD A;  4FOE A;  5AQP A;  4BRQ A;  2NRH A;  4QS9 A;  2ASO A;  2CGK A;  3EKU A;  1ATR A;  1QQO A;  4K41 A;  1SAZ A;  2HF4 A;  3VEZ A;  1SZ2 A;  3ID8 A;  3WT0 A;  4HTL A;  5JLH A;  4RWT A;  3TPQ A;  1LCU A;  1C0F A;  5ADX H;  3EKS A;  3QBX A;  5FPE A;  3P4I A;  2A42 A;  2CH5 A;  1OKJ A;  3BP8 A;  2VCP A;  4FSV A;  4B1U B;  1GLJ O;  1J6Z A;  1QQN A;  4WQ5 A;  2P9N A;  3WXK A;  4H03 B;  3MN9 A;  4NO7 A;  3M6G A;  4QS8 A;  3LDO A;  4CZJ A;  2E2N A;  3CHW A;  5AQQ A;  4B1W B;  2P9I A;  3O08 A;  2CGL A;  2V52 B;  3ZET B;  5AR0 A;  3DXM A;  4DCH A;  4A62 A;  3J8A A;  3MMV A;  1RFQ A;  3ZEU A;  2P9P A;  4H0V B;  5AQW A;  2ASM A;  2QW9 A;  3KHY A;  2E2Q A;  2VWB A;  5EY4 A;  4AM6 A;  5AQI A;  3MN5 A;  3I8B A;  4BRH A;  3QFP A;  1NMD A;  4PKG A;  3D7E O;  3IFR A;  3TU5 A;  2ZGZ A;  4BRG A;  3IMX A;  2OAN A;  3VEV A;  4BRO A;  3DXK B;  4IZ9 A;  5AQZ A;  3VF4 A;  3I33 A;  4PKH A;  4FPA A;  5AQO A;  1K8K B;  2FF3 B;  3RSE A;  3WUH A;  2HOE A;  4H0Y B;  4E1J A;  1BWF O;  3FZM A;  1NM1 A;  4ISF A;  1HKB A;  4HWI A;  2Q2R A;  4BRK A;  1HLU A;  1E4F T;  2QWQ A;  5AQG A;  4CBU A;  4CD1 A;  2FSN A;  2QXL A;  2D1K A;  2D0O A;  5EX5 A;  3QBW A;  1GLL O;  3FGU A;  4FWS A;  4H0T B;  3EZW A;  1R59 O;  3WEE A;  2Q0R A;  3HM8 A;  4GNI A;  3UKU B;  2GWJ A;  2P9L B;  3O4W A;  4ISE A;  1YUW A;  4YDU C;  2F9W A;  2QWM A;  4B9Q A;  2WUS A;  5F1X A;  3O1W A;  4IXC A;  1RDW X;  4PL7 A;  2I7P A;  1Q18 A;  2E1Z A;  2P9N B;  3AAR A;  4WQ4 C;  1GLD G;  4FWK A;  4DHY A;  2CH6 A;  3QB0 A;  3U9Z A;  5BPM A;  1HJO A;  2Q36 A;  5AQV A;  2FSK A;  5BPN A;  3O8M A;  3UB5 A;  3AAP A;  4BGB A;  2Q97 A;  4FOI A;  4CZK A;  1TUY A;  5AFU A;  3O5B A;  3QML A;  2QWO A;  3VEN A;  5AQJ A;  2ZWH A;  2IVP A;  3CQX A;  1S3X A;  3DXM B;  4RTF D;  4BC3 A;  1C0G A;  4JNE A;  3AY9 A;  4M7X A;  5AQS A;  1HPM A;  3HBT A;  4CD3 A;  3A5N C;  5F2R A;  3L0Q A;  1BDG A;  4CZI A;  1MDU B;  3H3N O;  4K42 A;  1T6D A;  4BR7 A;  4I6M A;  3CI5 A;  1NLV A;  1TYQ B;  5AQX A;  3A5M C;  3EL2 A;  3OHR A;  4Y0W A;  2I7N A;  3LM2 A;  1YVN A;  3O6W A;  3ULE B;  4BR0 A;  2E2P A;  3L4I A;  3GOI A;  5EXW A;  2EWS A;  2YHX A;  1P8Z A;  3CJA A;  4IWV A;  3D2F B;  2E2O A;  3ENO A;  3VEO A;  1BU6 O;  4Z94 A;  4FWR A;  2ITM A;  3VET A;  2A5X A;  2P9S A;  4XH1 A;  5AZI A;  4XH4 A;  5BPL A;  1NGC A;  4M7Y A;  4BRP A;  3HSC A;  1T6C A;  1QHA A;  5JMV A;  2E88 A;  3R6M A;  2KHO A;  3UE5 A;  5AQT A;  2FXU A;  3SLC A;  4K25 A;  2YJE A;  1D4X A;  3A5L C;  4BRL A;  4CZH A;  4M63 C;  1KAZ A;  3M1F A;  1NGJ A;  3O1B A;  3MDQ A;  4BRF A;  3QFU A;  2P9K B;  1DKG D;  1XUP O;  2CGJ A;  2VYP A;  3QIC A;  1HX1 A;  3LDN A;  4BRD A;  4B1V A;  5JLF A;  5AQN A;  2W41 A;  3H3O B;  3ENH A;  3DAW A;  2F9T A;  1IJJ A;  3CET A;  5KPZ A;  1Y64 A;  3GE1 A;  3FLC O;  1XC3 A;  2Q0U A;  1HKC A;  3GL1 A;  2NLX A;  1GLE G;  3VGK A;  5AQL A;  1ZC6 A;  4LC9 B;  2D0P A;  3CQY A;  2YHY A;  5AZJ B;  4BR9 A;  2H3G X;  3QDK A;  2ZF5 O;  3UKR A;  4JHD A;  4A2A A;  1GLA G;  1G99 A;  2D4W A;  2J4R A;  3ULE A;  2HMP A;  2PAV A;  4JHD B;  2IVN A;  1DEJ A;  4FWM A;  1YXQ A;  4BC4 A;  4BR5 A;  3C7N A;  4CZG A;  5KPT A;  4EAH D;  5KPR A;  1BG3 A;  2A41 A;  4BVO A;  4F9O A;  4CZM A;  4H5T A;  5BR9 A;  4H5W A;  3VER A;  3R8E A;  5JIC A;  5KQD A;  1JCE A;  4BC2 A;  4CBX A;  4CZF A;  5AQM A;  4BRN A;  1ESV A;  3MN7 A;  4NB4 A;  5AQF A;  4BR4 A;  1RGI A;  4IJN A;  1BO5 O;  4BR2 A;  3FE1 A;  4FO0 A;  5BRH A;  2QWL A;  4CJ7 A;  4IO8 A;  3RSE B;  1GLF O;  4FWQ A;  3VOV A;  3MCP A;  1YAG A;  3VPZ A;  4EHU A;  3ATU A;  2A6A A;  2P9S B;  4BRC A;  4FWN A;  5AQU A;  3H46 O;  5ELZ A;  1GLC G;  3HTV A;  2P9I B;  2BUP A;  4BVP A;  3H6E A;  4FPB A;  1TYQ A;  3U4L A;  1BA1 A;  1KXP A;  3UKR B;  2P9K A;  2IIR A;  3DWL A;  3FZF A;  5KQ8 A;  4BQL A;  1ATS A;  2Q31 A;  1BA0 A;  1HKG A;  1Z6R A;  2DPN A;  3U8X A;  5CE3 A;  1IG8 A;  3SJH A;  2GTD A;  3LDL A;  3VEX A;  1CZA N;  4BQZ A;  4EIA A;  2AP1 A;  4EFH A;  2ASP A;  1ATN A;  2QWP A;  3BF1 A;  3LDP A;  3WXI A;  2AA4 A;  3WXJ A;  1WOQ A;  4MLH A;  3A8Y A;  3MN6 A;  3B8A X;  4DB3 A;  5BRE A;  3A5O C;  3CJ1 A;  4H0P A;  3WXL A;  4BRI A;  5F0X A;  1NGI A;  5AQR A;  3CIP A;  1NGH A;  4O5F A;  3JS6 A;  2NZT A;  3H1V X;  4O8K A;  3WEE B;  3LL3 A;  1TUU A;  1JCF A;  2YI1 A;  1MWK A;  1MA9 B;  2V51 B;  3ATV A;  2E1Y A;  4CBW A;  2P9L A;  3CJ7 A;  5FPM A;  1BOT O;  2QWR A;  3CER A;  3C7N B;  4AM7 A;  4BG9 A;  1X9J A;  1U2V A;  4MO5 A;  4H0X B;  4MLE A;  1NGG A;  2QWN A;  1EQY A;  3ZEU B;  3G25 A;  4A61 A;  3FFK B;  3HZ6 A;  3S41 A;  5LJW A;  1NWK A;  3BF3 A;  1QZ6 A;  2FSJ A;  3GBT A;  3ZX0 A;  4CI6 A;  2YJF A;  3DJC A;  2Q1N A;  1HUX A;  4A2B A;  2IVO A;  5AQK A;  4BGA A;  3MK6 A;  3M3Z A;  2A3Z A;  4L3Q A;  3CJB A;  2FF6 A;  3VF2 A;  2V7Y A;  4H5N A;  4BG8 A;  3VGM A;  5TKY A;  2YCH A;  4MO4 A;  3ZET A;  3D2E B;  3VEW A;  2HF3 A;  3CJC A;  4IJA A;  4K43 A;  1JCG A;  3BUZ B;  3W0L A;  1ZXO A;  3SMP A;  1T44 A;  1V4T A;  4BC5 A;  3D2E A;  3KVG A;  3SMS A;  2P9U A;  3WQT A;  1XQS C;  4H5R A;  4JAX A;  3U9D A;  3DXK A;  1DGK N;  2V7Z A;  5EVZ A;  4H5V A;  1WUA A;  4CZE A;  4JN4 A;  5BN8 A;  5FPN A;  5AFU H;  3VEY A;  5BN9 A;  1GLB G;  1NGE A;  3IUC A;  4H0O A;  3SK3 A;  1U2V B;  3A0I X;  1U6Z A;  1NGF A;  3R9P A;  4J8F A;  1K8K A;  5AQY A;  1NGB A;  1S22 A;  4XH5 A;  4BRM A;  4PKI A;  3VGL A;  1X3N A;  1ZBS A;  4CZL A;  1KAX A;  1NGD A;  5LJV A;  2YHW A;  1KAY A;  4QS7 A;  5BRF A;  5ADX A;  3FZK A;  4DQ8 A;  3BEX A;  3LDQ A;  4B1Y B;  3LM9 A;  2E20 A;  4ISG A;  2P9P B;  2W40 A;  2BTF A; 
#chains in the Genus database with same CATH topology
 3WQU A;  3M6A A;  4DS4 A;  1HR0 K;  4C8O A;  1TGU A;  1QSS A;  2VQE K;  2Z1I A;  3EN9 A;  4KH4 A;  5B8H A;  5LY3 A;  4WYB A;  3SYL A;  1QZ5 A;  1JR3 E;  5FTM A;  2BJV A;  4PD2 A;  1TKT A;  4BAC A;  2XY7 A;  3RMB A;  1LWF A;  3HP9 A;  4JI8 K;  4EHT A;  1IXZ A;  3KS4 A;  2A5Y B;  3H45 C;  4FK2 A;  1XWI A;  4B3O A;  4E7K A;  4Q5V A;  3O9U A;  4WQ5 C;  3F9M A;  4NOO B;  3ZX3 A;  4LJ6 A;  2Z1H A;  1IN6 A;  4AIL C;  3FUW A;  5AQH A;  1SL1 A;  1JR3 A;  3WNH A;  3DMJ A;  2BDP A;  1IY2 A;  2BE2 A;  3TAF A;  3LVV A;  1S9E A;  4HEO A;  2YFQ A;  1NJF A;  3FZL A;  3NBX X;  3LP2 A;  4LSN A;  2GQF A;  4I6M B;  3RRH A;  3KZB A;  4KHP K;  1RT4 A;  4H4M A;  4A5B A;  1GKI A;  4MGZ E;  5AZJ A;  3G71 N;  1X3M A;  3NH0 A;  1QSY A;  4B1Z A;  4JI4 M;  3HWS A;  4X66 M;  4KBO A;  2W42 A;  5IZ7 D;  5J2Q A;  4HLQ A;  3HI0 A;  4IG3 A;  4RW8 A;  3AAQ A;  5I9E B;  1NNJ A;  4BRA A;  1RU3 A;  2YHA A;  2HL7 A;  1BUP A;  2XSZ A;  3J7B A;  4OU7 A;  3AKZ A;  4BRE A;  2VGN A;  2F5Q A;  4PT5 A;  4G4Q A;  1BQN A;  1NBW A;  4FL9 A;  1D2N A;  5BR8 K;  5M1F A;  1RBR A;  2A40 A;  1EP4 A;  1G71 A;  1J09 A;  1IM2 A;  2HBJ A;  4DQP A;  5EOY A;  4IBK A;  4BRQ A;  1GAB A;  1HNZ M;  4AKH A;  4OX9 K;  2QEX N;  5LMU M;  3HT3 A;  1RCH A;  1SZ2 A;  3ZSQ A;  3EY1 A;  3J81 S;  4RWT A;  2O8F B;  1LCU A;  5DYG A;  1N6Q A;  5ADX H;  3LWM A;  1XXH B;  3LAK A;  4N56 A;  2OO9 A;  2A42 A;  3CGW A;  2CH5 A;  1OKJ A;  2VQF K;  3J7A S;  3BP8 A;  3JAM O;  3L27 A;  4YOX A;  4B1U B;  4CGG A;  1GLJ O;  1J6Z A;  1Q82 O;  2LSN A;  2D7E A;  3WXK A;  3AVL A;  4LFA K;  3HX3 A;  4WW0 A;  3AVK A;  3LVW A;  2WC9 A;  3AO5 A;  5ITQ A;  4B3R M;  3M6G A;  3CCR N;  3CD6 N;  2CV2 A;  2HB5 A;  3MEE A;  4ELV A;  3B6O A;  4II7 A;  1OVY A;  1S1T A;  2V52 B;  3DXM A;  3J8A A;  3MMV A;  1RFQ A;  4MDB A;  2P9P A;  3ZEU A;  3N4P A;  4KHN A;  5CY4 A;  2W82 A;  1D9D A;  2QW9 A;  1LW0 A;  2E2Q A;  2G8V A;  5EY4 A;  3LAN A;  4UY8 O;  3MN5 A;  3NBI A;  4DV3 M;  3VKH A;  3OBW A;  4BRG A;  2JUJ A;  3B9P A;  3HHW A;  2WON A;  3IMX A;  5J2N A;  1DTQ A;  1XWL A;  4CK3 A;  4PY5 A;  3VF4 A;  4ZHR A;  1M90 O;  3R8F A;  3WUH A;  1DGG A;  5ITX E;  1WSG A;  4E1J A;  1BWF O;  1NK8 A;  4FCW A;  1YT3 A;  1ASU A;  3VMF B;  1GJS A;  4HWI A;  3OTO K;  3L2Q A;  4PUO A;  3THW B;  3MJ5 A;  1KFV A;  2C5R A;  5AQG A;  2QWQ A;  1KLM A;  3TR8 A;  2BGG A;  1WN7 A;  2HHW A;  3ZT2 A;  2QXL A;  1OH8 A;  2D1K A;  1REV A;  2DAE A;  4U7B A;  2WTU A;  1R6B X;  1GLL O;  2RN2 A;  3SJJ A;  4H0T B;  3ZT1 A;  3LW5 F;  2O8B A;  2IS3 A;  3T1H K;  1WR1 B;  2HHV A;  4DTN A;  3U6F A;  3K5O A;  4E1M A;  4B3S K;  3O4W A;  4NSR A;  3I0S A;  2QWM A;  1NU0 A;  1WJ7 A;  1K6Y A;  4NC6 A;  1Q18 A;  2E1Z A;  3OYC A;  2UU9 K;  4I8O A;  3DLG A;  2CH6 A;  1RNH A;  2RHK A;  4LSL A;  3IRX A;  5JI3 E;  1HJO A;  1N33 M;  5AQV A;  2OPQ A;  5C42 A;  4FJI A;  1L1Z A;  2ATQ A;  3K9J A;  3U3Y A;  4GHL A;  5GIN A;  2XHB A;  4L16 A;  3GLI A;  2Q97 A;  4JK9 A;  3VQD A;  4CZK A;  2B6A A;  3WHL A;  2L7H A;  2QKK A;  3DXM B;  1S3X A;  1Z5B A;  3MCA B;  5C24 A;  2WSF F;  3LCV B;  1IBK K;  3DLH A;  5AQS A;  1HNI A;  4H4O A;  5KGW A;  3L0Q A;  3TTD A;  4B9V A;  3H3N O;  2X49 A;  4NCG A;  3M8Q A;  1C7Y A;  3WXM B;  4FJL A;  2XF3 A;  2FNA A;  3FFI A;  4LZZ A;  2O8D B;  3EL2 A;  5IWA K;  4DUZ M;  4Z4G A;  4Y0W A;  4J2D A;  3LM2 A;  3K92 A;  3ULE B;  2VII A;  3VN5 A;  4BR0 A;  3W68 A;  3QER A;  2E2P A;  4M42 A;  2UUB K;  4AI6 A;  1WGL A;  2NUB A;  4KAZ A;  3GOI A;  2EWS A;  4Z4C A;  1YI2 N;  1TK5 A;  1HNZ K;  3D2F B;  4GVE A;  3L3U A;  3VEO A;  1CZ9 A;  4PHT X;  3SPZ A;  1JLF A;  4GHA A;  4CEB A;  4F3O A;  1WBB A;  1O13 A;  3KLG A;  3NBP A;  4Z94 A;  4B3M K;  3V76 A;  5LMN K;  2KRK A;  1BI4 A;  1BIZ A;  5AZI A;  1TK8 A;  4XH4 A;  5GAD P;  2ERC A;  3PNV A;  4M0W A;  3SBJ A;  4GMQ A;  3HSC A;  3IAY A;  2CV0 A;  1QHA A;  4KV8 A;  5JMV A;  2E88 A;  1ZQ9 A;  1BGX T;  2FXU A;  4E3S A;  3KFU G;  1IKX A;  4F2S A;  4GIT A;  4X62 M;  4DFJ A;  3CC2 N;  2O8C A;  4GRI A;  4G4N A;  3M1F A;  2GNO A;  4BE1 A;  1TH2 A;  1KLN A;  3MX2 A;  4DV0 K;  2KFN A;  4FXD A;  1QHT A;  1WGN A;  3OS0 A;  4I9Q A;  3SQ4 A;  1HX1 A;  4DV5 K;  3V81 A;  4M9Z A;  3LDN A;  4IEE A;  1N75 A;  2HHH M;  1G41 A;  3OYJ A;  4JI0 M;  4RW7 A;  4XGI A;  1RDC A;  5KPZ A;  2RPI A;  2QK9 A;  3NF6 A;  1R7R A;  2E4L A;  2Q0U A;  4AHT A;  4XIU A;  1N32 K;  3K58 A;  3VGK A;  5AQL A;  3Q8G A;  4KPY A;  1ORY B;  2R6F A;  3I4Y A;  2FBX A;  4LC9 B;  3SBT A;  4BR9 A;  4M3T A;  4DTS A;  2ZF5 O;  1U47 A;  1NK6 A;  4CFC A;  1QVG M;  3SC3 A;  3E46 A;  3AVA A;  3LAM A;  4A2A A;  5DM7 L;  5ITX A;  1GLA G;  4YOV A;  1JL1 A;  1LV7 A;  4FJK A;  3ULE A;  4JI7 M;  3DLB A;  3CCQ N;  2KQ2 A;  1DEJ A;  3LAL A;  4BC4 A;  1XMQ K;  3QES A;  3Q7C A;  5KPT A;  1QDT A;  1IQP A;  3AV0 A;  4BVO A;  1W5T A;  4F9O A;  3TSU A;  4DKW A;  4LJ4 A;  5CZ2 A;  2CUZ A;  4CZM A;  4AQY K;  3BGR A;  3R8E A;  3VER A;  5JIC A;  1JCE A;  1ZBI A;  4MGI E;  3L3V A;  4CBX A;  1UWB A;  1KCF A;  3MX5 A;  1N34 K;  1NNE A;  4JI0 K;  4KRE A;  3NVM A;  1ESV A;  4NB4 A;  4OVL A;  4KRF A;  1OFH A;  1XC9 A;  1VQ6 N;  1LWE A;  3QEW A;  5FSW A;  1QUS A;  5I42 A;  1RTH A;  4BB9 A;  4Q0B A;  4CFB A;  3T3F A;  2LXE A;  3PFI A;  4FJX A;  5EQT A;  5I3U A;  5BRH A;  4F1I A;  1X9M A;  2ZAN A;  4KT0 F;  2ZTC A;  1Y8G A;  4OVZ A;  3VPZ A;  3VOV A;  1TVR A;  2YNM D;  3T15 A;  4Z4E A;  2V6Z M;  5C0Y A;  1G59 A;  2A6A A;  4IBC A;  4BRC A;  2X8A A;  3QWL A;  1RTJ A;  5ELZ A;  1GLC G;  2CEA A;  2BUP A;  2P9I B;  1T03 A;  1WB9 A;  3H6E A;  3C3E A;  1M1K O;  4B9N A;  1VK0 A;  1YJW N;  1TYQ A;  3NMU A;  1XNR K;  1XNQ M;  3ZCM A;  4PDG A;  3UKR B;  1NHG C;  3DWL A;  5C2D A;  4QNM A;  3L2W A;  4FW9 A;  4BQL A;  3GLI E;  1N34 M;  1ATS A;  1NJY A;  3SYZ A;  2Q31 A;  2CHV A;  4CGF A;  4W5N A;  1IKW A;  1VEJ A;  2GTD A;  3LDL A;  4HUE A;  4D82 A;  4FD2 A;  4L6V 6;  1CZA N;  3E01 A;  3KD5 E;  2DAG A;  2UXD K;  4EFH A;  3VDP A;  1OQY A;  3W0F A;  3FUX A;  4LFB K;  3WXJ A;  3M8R A;  3JSM A;  3CMA N;  2AJQ A;  1YSY A;  4CF9 A;  4MLH A;  3DLR A;  1VQO N;  2DVW B;  1FKP A;  3MN6 A;  3KSJ A;  4CEE A;  3U60 A;  4Z6Y A;  5F0X A;  4B08 A;  1NGI A;  1SS6 A;  3J27 B;  1XMO K;  3GPU A;  4CK1 A;  4N47 A;  4JKG B;  4EP5 A;  5D3G A;  1TUU A;  3VQ4 A;  1MWK A;  2V51 B;  3ATV A;  3KWI A;  4CBW A;  1U49 A;  3GQ3 A;  1HJR A;  1JLQ A;  1VQ1 A;  1BCO A;  1DTT A;  1YTA A;  3F5T A;  4D81 A;  3GPX A;  3CER A;  4CJQ A;  3G4S N;  3U5Z B;  4BG9 A;  1X9J A;  4MO5 A;  4EZ6 A;  1VQM N;  2A1S A;  4JI3 K;  5DYI A;  2WFB A;  3DZD A;  4DSJ A;  3G25 A;  4DR3 M;  3QEI A;  3FFK B;  2UUA K;  2RF2 A;  1QZ6 A;  4NRV A;  4A5A A;  3ZX0 A;  4GH9 A;  4C8K A;  1NJX A;  3FRI A;  4QOZ B;  5HRN A;  4JK7 A;  3CCJ N;  1IXR C;  1W2B M;  2DWZ B;  4JI2 M;  4LFB M;  2IVO A;  3CM6 A;  3OYL A;  4BGA A;  3ISN C;  1VQ4 N;  2A3Z A;  1VSE A;  2KLA A;  4R71 A;  1JKH A;  2XRI A;  5EP1 A;  3THY A;  2V7Y A;  4H5N A;  4Y28 F;  4LF5 K;  3BBZ A;  2YCH A;  2KZZ A;  4CJT A;  1SXJ E;  4K0K M;  4CER A;  4IFE A;  4MO4 A;  4EIW A;  4OW0 A;  4P16 A;  3ASM A;  5KO3 A;  1IFY A;  3O9R A;  1ZBF A;  3CTW B;  3CJC A;  5EU7 A;  2EKF A;  1NOY A;  4WE1 A;  4K43 A;  3BUZ B;  3R3L A;  3W0L A;  1ZXO A;  4Q7J A;  2QP9 X;  3RE8 A;  3RR8 A;  1TDZ A;  1V4T A;  1KFD A;  1HQU A;  3D2E A;  3KVG A;  2P9U A;  4BDY A;  1WBD A;  2XEP A;  3MMP A;  3G10 A;  3C65 A;  3K0S A;  2LVO C;  1EWQ A;  1RT7 A;  3DXK A;  2Z1G A;  4YOW A;  4CHP A;  1DGK N;  5EVZ A;  3V1R A;  3HJQ A;  2Z4S A;  1HQC A;  3E1Y A;  4AG6 A;  5BN8 A;  3L28 A;  4DF8 A;  3PX6 A;  3GO8 A;  2K47 A;  3VEY A;  2RGO A;  2EA0 A;  1B92 A;  1GLB G;  5BN9 A;  3IUC A;  4M3Y A;  3A0I X;  4NYN A;  3PLA A;  5FDL A;  1NGF A;  1S1W A;  2HBM A;  1NV8 A;  5AQY A;  3V1Q A;  3K5M A;  5IT9 S;  5GAG P;  1Q8I A;  2YX6 A;  1XHX A;  3SAV A;  1X3N A;  1NJW A;  3MAQ A;  4JYA M;  4V19 S;  2ZM6 K;  1FK9 A;  4DS5 A;  3QYE A;  2LVN C;  1NGD A;  1EO1 A;  3J80 S;  4QS7 A;  2DAM A;  3HPG A;  3FZK A;  4E7J A;  2YNI A;  2E20 A;  3U6Q A;  4FJH A;  1OH5 A;  4KTQ A;  3V9U A;  2R0I A;  5E84 A;  2MH8 A;  3AO2 A;  4LF6 K;  2O5R A;  1Z05 A;  5HRP A;  3HHZ A;  3TAB A;  1TK0 A;  3FZH A;  4FWO A;  4N41 A;  2PBD A;  1GOC A;  3D2F A;  3OA9 A;  2EKK A;  1NSF A;  3K2P A;  3U6M A;  5BRD A;  2HHQ A;  3KVW A;  3MHV C;  1MWM A;  1PJS A;  1LOT B;  2J7O A;  3I55 N;  4FM0 A;  4E7H A;  5AZI B;  2PYJ A;  3HRG A;  1A5W A;  1BHL A;  3OJS A;  3AVJ A;  1J5E K;  3ULD A;  1QQM A;  1NGA A;  2F5O A;  1VQP N;  2P9U B;  3OYH A;  1ZMU A;  4LFC K;  3GLF B;  2QM1 A;  4AHR A;  1G8P A;  4OKE A;  1U48 A;  4YDU A;  3MED A;  4CJP A;  3OS2 A;  4NXN M;  3L2V A;  1DGH A;  1RBV A;  4LFA M;  4C23 A;  3OW2 M;  3CJ9 A;  3C58 A;  3O80 A;  2JP7 A;  4GEW A;  4DV7 M;  4KKO A;  3ZX2 A;  3SYK A;  3HJ8 A;  2IDO A;  3C94 A;  5ITY A;  3AGK A;  1E4G T;  2E8A A;  4FJG A;  4A59 A;  1LW2 A;  1VEK A;  1RDD A;  4XEI A;  1OVQ A;  3O3G A;  3TTC A;  2LH0 A;  4KTW A;  2F7T A;  4E89 A;  4DQS A;  3PO4 A;  1EE8 A;  5FPD A;  1YTU A;  4JI2 K;  1RDB A;  5AQP A;  3SHG B;  2APL A;  2NRH A;  2ZQB A;  3QAU A;  2CGK A;  3EKU A;  1K73 O;  4HL4 A;  4K41 A;  1JLC A;  1SAZ A;  5FLX O;  1RTD A;  1RDU A;  4HTL A;  3DOK A;  3VFD A;  4IBG A;  4JKD A;  3QBX A;  1GOB A;  4M3X A;  5FPE A;  4LRT A;  1W7A A;  5GAE P;  2Z7J A;  2OYQ A;  1ASW A;  1R4G A;  5E41 A;  2R7Y A;  4JI4 K;  1HYZ A;  4W5Q A;  4FSV A;  1QQN A;  5EXP A;  2NRR A;  3QEV A;  4TSX A;  2JWK A;  3G0Z A;  5JVG L;  1N36 K;  4YY3 K;  5KTQ A;  4DR5 K;  3A2F A;  4NYF A;  3CHW A;  4B1W B;  5GIO A;  3O08 A;  4JI1 K;  1XHB A;  5AR0 A;  4DCH A;  3WNF A;  3U6E A;  1CXU A;  4ILH A;  3KHY A;  2HHH K;  3EZ5 A;  4FVU A;  3I8B A;  4BRH A;  4M3Z A;  1NMD A;  4PKG A;  4OGE A;  5GAH P;  4G4R A;  2ZGZ A;  3LWL A;  2Z3X A;  2NRX A;  2XH9 A;  1HT2 E;  1JLG A;  2UXC K;  4FK0 A;  2X6N A;  2WSE F;  4IBJ A;  3DXK B;  4BRO A;  3SAS A;  3E4R A;  3I33 A;  4FPA A;  5AQO A;  2FF3 B;  3RSE A;  2HOE A;  4H0Y B;  4OKK A;  4CIG A;  3FZM A;  4DR4 M;  1NM1 A;  3DI6 A;  4FJN A;  4M9S A;  1JLE A;  2G8K A;  2MR9 A;  4S12 A;  1EIJ A;  3IG1 A;  1SG9 A;  1P90 A;  2FFJ A;  4JS5 A;  4FVM A;  3KWG A;  1HLU A;  4O8U A;  4BRK A;  1IBK M;  1E4F T;  3CCS N;  4DFM A;  4FW2 A;  4FYD A;  4AZF A;  1L5U A;  1E9R A;  2EHG A;  1XB2 B;  2D0O A;  4CCH A;  3QBW A;  2ZAO A;  4O0I A;  1HR0 M;  1HRH A;  2GBZ A;  3HKP A;  3EZW A;  5FLX S;  4DR5 M;  4QHS A;  3HM8 A;  1FW6 A;  1T7P A;  1Q9X A;  1IV0 A;  3MEC A;  3VQ6 A;  4ISE A;  1QVR A;  4IBF A;  1TDH A;  1YUW A;  4WF9 L;  2F9W A;  4K8Z A;  4B9Q A;  3K5L A;  3H4M A;  2P9N B;  1MN3 A;  4WQ4 C;  3U3G A;  2VGM A;  2YKN A;  3QIO A;  3RGS A;  2YQZ A;  1BL3 A;  1VQ5 N;  5BPN A;  4X65 K;  2HHT A;  4B3M M;  4BWM A;  5M1Q A;  1QTM A;  1VQL N;  1Z59 A;  4L8R C;  3QO9 A;  4CVN E;  3KOW E;  4KTZ A;  3SBG A;  4FOI A;  2D0B A;  3I51 A;  4CIF A;  4DSI A;  2QWO A;  5AQJ A;  1EWR A;  1QZM A;  3CQX A;  4BC3 A;  4LF9 M;  4M7X A;  5C18 A;  2ZTD A;  3HBT A;  2D7G A;  5C1B A;  3SAG A;  3A5N C;  5F2R A;  4LRS A;  3OY9 A;  3EE9 A;  4G9Z A;  3Q7B A;  2OQ4 A;  3S3N A;  4K42 A;  1V34 A;  4L78 A;  3OYB A;  4I6M A;  3CI5 A;  1NLV A;  3C6A A;  4DV5 M;  2C9C A;  2KNA A;  3A5M C;  4KH6 A;  1J53 A;  1S6Q A;  3O6W A;  1TGO A;  3KOY E;  4JKE A;  4JRQ A;  1VQ8 N;  3OYM A;  1YE9 A;  4JKA A;  3LQR A;  2OZM A;  3CJA A;  2C99 A;  4IWV A;  1X9W A;  3ENO A;  4OLA A;  1VSD A;  4JKB A;  2QI2 A;  2J7N A;  3J80 O;  1OIZ A;  4YOR A;  4FWR A;  1ZMW A;  1OH7 A;  3NVK A;  1T3V A;  2P9S A;  1PJT A;  1KC8 O;  2VQF M;  4OPJ A;  4K8X A;  4DTX A;  3SQ0 A;  3R6M A;  3UE5 A;  5AQT A;  3AFH A;  4LH4 A;  4LF9 K;  3SUP A;  4W5O A;  4FM1 A;  4K25 A;  3A5L C;  4BRL A;  1NGJ A;  3KIO A;  4BRF A;  4MGK E;  4DSK A;  1DKG D;  1XUP O;  1B9F A;  1YVU A;  2VYP A;  1LAW A;  1OAO C;  4M0D A;  4MB7 A;  4W5R A;  1YF5 L;  5JLF A;  3M7G A;  2W41 A;  4FJ8 A;  4X64 K;  1EET A;  4FJM A;  1VHX A;  4HCB A;  4I2Q A;  3GE1 A;  1U4B A;  4CES A;  4GC5 A;  3VLF B;  2HHU A;  4MH0 E;  2F5P A;  4ICL A;  3GL1 A;  3FUT A;  1KQS M;  3IKM A;  3OYF A;  2CHG A;  1GL7 A;  3GRY A;  4DR6 M;  2D0P A;  3BOS A;  3RWU A;  5AZJ B;  3VQB A;  2L4E A;  3L4Q A;  2LTU A;  5EXS A;  3TTF A;  1G99 A;  2D4W A;  2ZE2 A;  4Y1D A;  5SZT A;  3NF8 A;  3SI6 A;  2Q2E B;  4LJ9 A;  1EXQ A;  1NKE A;  3MXJ A;  4JHD B;  4FWM A;  1YXQ A;  4CZG A;  4DU1 A;  1MU5 A;  4DV0 M;  4EAH D;  5KPR A;  4GV9 A;  1ZV1 A;  4Y1C A;  4H5T A;  5BR9 A;  4BC2 A;  4CZF A;  1GL6 A;  4EP4 A;  4JN6 A;  3PVS A;  2VWJ A;  4BRN A;  3MN7 A;  2BWB A;  1NY5 A;  4DV1 M;  3EIH A;  1QS4 A;  4CGH A;  5AQF A;  2O4G A;  1CLQ A;  3T7Z A;  1IKY A;  4BE0 A;  4X65 M;  4JV5 K;  1WSI A;  4IJN A;  2ZBK B;  4OPH A;  3B89 A;  3TAE A;  4BR2 A;  4R7G A;  4RG8 A;  1E94 E;  2HNZ A;  4CJ7 A;  1L2D A;  2D7H A;  2LVQ D;  1GLF O;  3MXI A;  1TH4 A;  4CEF A;  3CCL N;  5CR4 A;  2P9S B;  1XMO M;  3LDS A;  3P83 D;  3OS1 A;  4CGJ A;  4DR2 K;  2FBT A;  3SUQ A;  5HRO A;  2E6L A;  4CJL A;  4GC9 A;  5M1N A;  3CF6 E;  3PSI A;  1O1W A;  1C1C A;  1LTM A;  2GUI A;  1RT2 A;  3WHK A;  4LD0 A;  3U4L A;  1Z5A A;  2IIR A;  3UGJ A;  3JR4 A;  2JZ0 A;  3I56 N;  1VG5 A;  3NF9 A;  1BA0 A;  1Z6R A;  2DPN A;  3O9Q A;  4F2L A;  2WOM A;  4IDH A;  3U8X A;  5MLC Q;  3LZJ A;  1UM8 A;  1R2Z A;  3VEX A;  3LP1 A;  3NHG A;  2B3T A;  2KEB A;  2QWP A;  3BF1 A;  2VG6 A;  4I4L A;  3LDP A;  5M1K A;  5J1E A;  4DQI A;  4ZTJ A;  3IEC A;  1WOQ A;  4RNA A;  4LJ8 A;  3QLH A;  4H8K A;  4CJE A;  4KB1 A;  4BRI A;  1NNU C;  4CHY A;  1WHC A;  4O5F A;  3M8P A;  2CE7 A;  3GQ5 A;  3H1V X;  1FKO A;  1KVA A;  2RE2 A;  3WNG A;  4LFC M;  2HCB A;  4DUY K;  3HVT A;  2YI1 A;  3OYE A;  1U45 A;  3PUF A;  1VSM A;  1RBT A;  3C9P A;  1KFS A;  4KFB A;  3RMD A;  5FPM A;  4IJF A;  3ID6 A;  3GPP A;  2JY6 B;  4ZTF A;  4AM7 A;  1QUT A;  1U2V A;  3GLH E;  3B6P A;  4MGY E;  4H0X B;  4CF0 A;  3T6P A;  4DTM A;  3NGI A;  4BDZ A;  4MLE A;  3R9X B;  2QWN A;  3ZEU B;  3NFA A;  4MDA A;  1IO2 A;  5LJW A;  5HL7 L;  1KD1 O;  2H5X A;  3OYI A;  1NMN A;  3AO4 A;  3GBT A;  3FTF A;  4F3T A;  2R46 A;  3K1J A;  3U61 A;  2D0A A;  2YJF A;  4CF8 A;  2DAI A;  1HUX A;  3C6U A;  4JKC A;  4IOC L;  1F4I A;  2DWM A;  1OFI A;  5AQK A;  4OPK A;  2E6M A;  3CJB A;  1QAQ A;  2ZD1 A;  3VF2 A;  1VSL A;  3FKE A;  4N76 A;  4BG8 A;  5DM6 L;  4B3T K;  4JI7 K;  3VGM A;  2BNK A;  3HXM A;  1HYV A;  3S3M A;  5HBM A;  3ZET A;  1V33 A;  3O9T A;  3D2E B;  4CJR A;  4DQQ A;  3U6C A;  1J7K A;  2KZU A;  1I39 A;  5KRT A;  1JCG A;  1IN4 A;  1SKS A;  2LHC A;  3PSF A;  5C12 A;  1S1U A;  4R3D A;  4XK8 F;  3SMS A;  3U6D A;  3TWK A;  1XQS C;  2V1C A;  3J2P B;  3VQP A;  2HST A;  4JAX A;  3U9D A;  3AO1 A;  4DTU A;  3CCE N;  3AA4 A;  2DI0 A;  1WUA A;  4CZE A;  3M8S A;  4MGH A;  1Q9Y A;  1K82 A;  5FPN A;  2G8I A;  3PX0 A;  4GMJ B;  1RT6 A;  4CJV A;  4H0O A;  1S1X A;  4DV6 M;  5FRN A;  1SKW A;  1B9D A;  4PWD A;  3FRH A;  2L09 A;  1HQE A;  2R62 A;  1NGB A;  2C9O A;  3RFW A;  4BY9 C;  1DLO A;  4PKI A;  5A2Q O;  5AJ3 K;  3GLF E;  3U60 B;  4CZL A;  3THV A;  2YNF A;  5LJV A;  4X66 K;  5ADX A;  1T3T A;  4DQ8 A;  1N78 A;  2L2D A;  3LDQ A;  3DLE A;  2W40 A;  2BWE A;  2ITG A;  4HUF A;  2BTF A;  4IEI A;  5BPV A;  4FLU A;  4FJ7 A;  4RW6 A;  4LZJ A;  3DOA A;  2P1J A;  2ZAM A;  4YOT A;  3KP0 E;  2P5T A;  2GUP A;  4GIP A;  3ZT0 A;  3E21 A;  3CC7 N;  3VQQ A;  1UFZ A;  4LJ7 A;  3CM5 A;  3MWP A;  3VF6 A;  3KP1 E;  2UU9 M;  3ZSW A;  4PL8 A;  3PV8 A;  1LV5 A;  3RGP A;  1I3A A;  2QSF X;  3PXG A;  3L6Q A;  1BI4 B;  2FS1 A;  2KTQ A;  4CHZ A;  1N33 K;  1PM5 A;  3BY5 A;  2JY8 A;  2DHY A;  3CCU N;  1YLA A;  1OKS A;  4RW9 A;  2PY5 A;  3J7A P;  1ZYQ A;  1UA1 A;  3P39 A;  4O4G A;  2QA4 N;  2R65 A;  1JJ2 M;  4B9S A;  3RRG A;  1JL2 A;  4D80 A;  4GKK M;  1X9S A;  4KH5 A;  3ZSV A;  4GY2 B;  4J2E A;  4I5S A;  1WIV A;  2V1U A;  4LG2 A;  1V4S A;  4NLB A;  3UKU A;  2ZGY A;  4WQ4 A;  2DY4 A;  2GEM A;  3CG7 A;  1FJG K;  2OZS A;  4IJE A;  4FLW A;  2VDB B;  4DR7 K;  2KHH A;  1DGB A;  2D0C A;  2VQE M;  1NO1 A;  2HVH A;  4FWP A;  3VES A;  3MXM A;  4ELT A;  5ITT A;  4RF0 A;  3EO3 A;  1EKE A;  4FWL A;  3IDH A;  4RCH A;  4JD2 B;  3PNY A;  3HHX A;  4CK2 A;  1NY6 A;  4DTP A;  3EIE A;  4CJ4 A;  4QS9 A;  3HJF A;  2CHQ A;  4BLC A;  3KXE C;  3BDP A;  3J81 O;  4DR1 M;  1HNW K;  1CXQ A;  2FBY A;  3ID8 A;  3PX4 A;  4AHU A;  3JR5 A;  5JLH A;  1DV0 A;  1ZMV A;  3UMM A;  1DT9 A;  3TPQ A;  1C0F A;  4LH5 A;  3AOE C;  5M1P A;  4AHC A;  1NK7 A;  1WNS A;  3CFO A;  3OTO M;  3NAE A;  4G6Z A;  3NGZ A;  3VQA A;  4KB0 A;  2VCP A;  4E19 A;  2PFU A;  4RKU F;  4NXN K;  1C6V A;  3ILK A;  2P9N A;  3IS9 A;  4RW4 A;  5CZ1 A;  2XO7 A;  1I94 K;  4DU3 A;  4GKJ K;  2O8C B;  3MN9 A;  3VQ7 A;  1S5J A;  2LVA A;  2VG7 A;  4W5T A;  1UA0 A;  3LDO A;  4B8C A;  2C96 A;  4IOX A;  4CJ5 A;  1HNX K;  4LF7 K;  3ZET B;  1X37 A;  4CJF A;  4A62 A;  3E66 A;  4NCB A;  4OKJ A;  4H0V B;  5AQW A;  2ASM A;  4IIW A;  2Y21 A;  4NRW A;  1QSL A;  2VWB A;  2YR0 A;  4O5B A;  3OVN A;  1YJ9 N;  3AL0 C;  3K8Z A;  3D7E O;  4DMN A;  4DU4 A;  4HTU A;  4CF2 A;  1QZE A;  2DZN B;  1S9G A;  3KTQ A;  1C0T A;  4IZ9 A;  1YIJ N;  5AQZ A;  1IN7 A;  3BZK A;  4OO1 J;  3TE6 A;  4M3R A;  4JI5 K;  4LF4 M;  2O8D A;  3KKS A;  4DTR A;  4LY6 A;  3SUO A;  4ISF A;  3AVI A;  3T19 A;  1T05 A;  1Z6T A;  3EEQ A;  1RIL A;  2Q2R A;  2OTL N;  3CXC M;  4QOZ C;  1JQJ C;  2FSN A;  1D5A A;  1VSK A;  3KLE A;  3GRR A;  2JY7 A;  2H1R A;  3JYT A;  1VQN N;  3I0R A;  1VSF A;  3V6D A;  3FGU A;  1ILY A;  3WEE A;  2CWB A;  2GWJ A;  2LNH C;  3TQS A;  2CRU A;  5A2Q S;  3B7N A;  1OJL A;  1OTR A;  3R1X A;  4CED A;  3K57 A;  3O1W A;  4P17 A;  4GV3 A;  2FBV A;  1SXJ A;  3VK7 A;  3L2U A;  4LJA A;  2O25 A;  1E3M A;  4JKF A;  4FWK A;  2A1R A;  1PJI A;  2ZJP L;  4LGM A;  3U9Z A;  3TAM A;  4JV5 M;  2FSK A;  3VQ9 A;  4LCB A;  3AVH A;  4WP2 A;  3O8M A;  3UB5 A;  3ZSY A;  3AAP A;  3SAW A;  4BGB A;  3S9H A;  5FTK A;  3NWL A;  1E9S A;  1TUY A;  2G8U A;  3QML A;  4AHV A;  3VEN A;  2CFO A;  2BH1 A;  2IVP A;  4RTF D;  4JNE A;  3AY9 A;  3T1A A;  3GRV A;  3C6T A;  4R79 A;  1WLJ A;  4CD3 A;  1I4W A;  1J54 A;  2ETJ A;  1HT1 E;  3QEX A;  2LHG A;  1FJG M;  1PRB A;  3GLH A;  1ZBU A;  4M45 A;  4BR7 A;  1N8R O;  3PY8 A;  3KW6 A;  3EYZ A;  3T1H M;  1J9A A;  1TYQ B;  1WSH A;  2O01 F;  3QNO A;  2QBY A;  2I7N A;  2JWL A;  4X64 M;  1TL3 A;  4Z0U A;  1QQW A;  5HOO A;  1QDR A;  5EXW A;  2YNH A;  2Z4R A;  3D45 A;  4JS4 A;  1J5O A;  1VDL A;  3E9L A;  3L26 A;  2PYL A;  4QNR A;  2VF7 A;  1BU6 O;  2QEN A;  2UXD M;  3PIO L;  3IHP A;  1GO5 A;  2XY6 A;  2A5X A;  3KLH A;  3LP0 A;  4XH1 A;  2L6O A;  5BPL A;  3T1Y M;  4I81 A;  4BRP A;  3TAR A;  2E5L K;  3LZI A;  2F5N A;  2R18 A;  3SLC A;  2UXB K;  2YJE A;  1NJI O;  2HNY A;  3KKR A;  1KAZ A;  3MDQ A;  1L3U A;  4KHU A;  2P9K B;  4JI1 M;  1BIS A;  4IOA L;  4G4O A;  5M1O A;  3QIC A;  1RT1 A;  2OPS A;  2XFT A;  4HVJ A;  3PO5 A;  4DUZ K;  2OTJ N;  4BRD A;  4B1V A;  5AQN A;  4CW7 B;  3AVC A;  3HO1 A;  3VK8 A;  3DAW A;  2F9T A;  1IJJ A;  2KNV A;  2RRU A;  3CET A;  4JI3 M;  3OYG A;  4FZY A;  4CHT B;  2JNH A;  3DRP A;  3FYC A;  3FLC O;  4FLZ A;  1SV5 A;  4PCZ A;  3OYA A;  4HCC A;  1HKC A;  4IO9 L;  3ZLJ A;  1S1V A;  1GLE G;  1QAM A;  3NF7 A;  3B7Q A;  1ZC6 A;  2QXF A;  2RKI A;  1D0M A;  3CQY A;  2H3G X;  3QDK A;  3L8B A;  3UKR A;  4JHD A;  4CFD A;  4Z4F A;  1A5T A;  2VWK A;  5IT9 O;  2JGU A;  2J4R A;  2M5Z A;  5F3W A;  2HMP A;  4JK8 A;  1Q86 O;  4KHY A;  3HM9 A;  2QNJ A;  4N5S A;  4K0K K;  2O4I A;  1VSI A;  1SXJ C;  3D6R A;  3C7N A;  3AVN A;  2G3Q A;  4CJS A;  3I01 M;  1W0H A;  2DAK A;  3B74 A;  4G1Q A;  1BG3 A;  2A41 A;  4CEQ A;  2O8E B;  4LY7 A;  1BVS A;  2OOB A;  4H5W A;  3THG A;  3DYA A;  1EFU B;  4OGC A;  3HU2 A;  3V4I A;  1JXE A;  4CHN A;  1NK9 A;  4L4U A;  5AQM A;  5FRO A;  1VQK N;  3GP1 A;  3G6E N;  4FZZ A;  2HND A;  4WFB L;  3KOZ E;  1RGI A;  1ZBH A;  1HNV A;  3KJV A;  4DQR A;  3HU1 A;  1W5S A;  3A98 B;  3CF2 A;  1BO5 O;  2Y0T A;  5HP1 A;  4HHT A;  3CQ8 A;  3NH1 A;  4FO0 A;  2QWL A;  3U6O A;  3L2R A;  4IO8 A;  1SXJ B;  3AVM A;  2M60 A;  4FWQ A;  3RR7 A;  3MCP A;  1YAG A;  1Z25 A;  4Z4I A;  3ATU A;  1YHQ N;  4W5W A;  3TWL A;  1W97 L;  2LWX A;  4EZ9 A;  4FWN A;  4MFB A;  5AQU A;  4O0J A;  4FJ9 A;  2F4V M;  4B8A B;  1GVN A;  3FTE A;  3HTV A;  4BVP A;  1WAJ A;  2KZS A;  4FPB A;  5KRS A;  3V9S A;  4DTO A;  1BA1 A;  4QAG A;  1TV6 A;  1IBM K;  1P3Q Q;  2QHO B;  2P9K A;  2UUB M;  2R4E A;  3FZF A;  4DLE A;  2K0B X;  1N77 A;  4B9L A;  1TH3 A;  3T69 A;  4CEZ A;  1Y97 A;  3KLI A;  2HW3 A;  3DLL L;  4FLV A;  1HKG A;  3KK1 A;  3SJH A;  4ANR A;  3FTC A;  2KZM A;  2XY8 A;  1ASV A;  4EIA A;  3DA1 A;  1S6P A;  3B8A X;  4DB3 A;  5BRE A;  3O4Q A;  3WXL A;  4H0P A;  5SWM A;  2O8E A;  3I04 M;  3FTD A;  3E9S A;  1IN8 A;  2DZO B;  3NGY A;  5AQR A;  3HU3 A;  1NGH A;  4JLH A;  2OA8 A;  3JS6 A;  4B9U A;  4C8M A;  2Y20 A;  1ITG A;  4O8K A;  2R45 A;  1JCF A;  1RT3 A;  1MA9 B;  1NK4 A;  2E1Y A;  1OH6 A;  1DGH B;  3AOG A;  3E9O A;  4KHW A;  4GKK K;  5C15 A;  3VA3 A;  1MJG M;  3A45 A;  3CPW M;  4FWH A;  1BOT O;  1T6O A;  3PIP L;  5EP4 A;  2QWR A;  1HQY E;  3UJN A;  3C7N B;  3ZSX A;  4LGY A;  4OVZ B;  1S3S A;  3BXW A;  5TKW A;  3GLG B;  3DRR A;  2I5J A;  2W6L A;  1W9H A;  3HZ6 A;  3TAN A;  3S41 A;  3UIQ A;  5BR8 M;  4KI6 A;  3HOT A;  2N35 A;  5DFL A;  3KK7 A;  2Q1N A;  2K6B A;  1XHZ A;  1HYS A;  2JXN A;  2NQ8 C;  1WSJ A;  1L1T A;  4C8L A;  2Y0Q A;  3J7Z O;  5J2P A;  3M3Z A;  3CFR A;  4L3Q A;  2C98 A;  2OPF A;  2FF6 A;  3CCM N;  4A3V B;  3U6S A;  3CCV N;  3SAT A;  5TKY A;  3W0L B;  1VQ9 N;  3GLG E;  2QKB A;  1NVM A;  1XXH E;  2AHM A;  2Z1J A;  2GX9 A;  3ENB A;  1SL0 A;  2HKJ A;  4NSO B;  2HF3 A;  1V92 A;  2YNG A;  4KO8 A;  4DTJ A;  3SZ2 A;  2PZS A;  5DK5 A;  3CYM A;  3SMP A;  4GKJ M;  4FCV A;  1KTQ A;  4DV4 M;  4AF1 A;  2NRZ A;  5DNY A;  3B7Z A;  2XY5 A;  1E32 A;  3WQT A;  1UOC A;  1IKV A;  1HNX M;  2HBL A;  2VG5 A;  3FE3 A;  4CHO A;  4JN4 A;  2IC3 A;  4CJK A;  2CP8 A;  3KDS E;  2DHR A;  4CIS A;  4I9L A;  3CF5 L;  3SNN A;  5AFU H;  4JRP A;  4DV3 K;  1MU2 A;  4TUW A;  5K14 A;  2IAJ A;  5T7B A;  4REZ A;  3TSP A;  3KSX A;  2EUC A;  3QET A;  1S22 A;  2F4V K;  4JI5 M;  4AKI A;  3VGL A;  1NV9 A;  5C2F A;  4BBA A;  5KI6 A;  1ZBS A;  2FC0 A;  1NJZ A;  4Z8X A;  3D0P A;  1JLB A;  5FTN A;  1IBM M;  2YHW A;  1RT5 A;  1K3X A;  2MGW A;  4ID1 A;  1JLA A;  4B1Y B;  3LPU A;  4DV7 K;  3LM9 A;  4ISG A;  5JVH L;  1IXS A;  2P9P B;  1HPZ A;  1IG9 A;  3ITH A;  3ZH9 B;  5ITR A;  3HP6 A;  3V1O A;  3GQ4 A;  1D0K A;  2JA2 A;  3P5J A;  2QZ4 A;  2UYT A;  2FLO A;  2FOI C;  1C1B A;  4IG0 A;  4B3S M;  2RKO A;  3CPE A;  1Z26 A;  5KGX A;  4DBG B;  1VRT A;  1KVB A;  1VRU A;  4NLC A;  3C0B A;  1DO0 A;  4GV6 A;  4OX9 M;  5JS1 A;  1SQK A;  4WCE L;  1A5X A;  3SV3 A;  3FR0 A;  3THW A;  3GG4 A;  5E6J A;  3O3F A;  3H1Q A;  1H1V A;  5E26 A;  2MRO B;  3K9P A;  8CAT A;  3K59 A;  1I94 M;  2YV0 X;  4CEO A;  4L15 A;  2GEL A;  4YOU A;  4FM2 A;  2KKZ A;  4NXM K;  2JLE A;  4KLN A;  3GLF A;  4MQ3 A;  3HY5 A;  1AUA A;  3P38 A;  4JD2 A;  2XZF A;  2P51 A;  4I2P A;  1L3S A;  4DSL A;  2GWK A;  4OJR A;  3ZSR A;  2JWS A;  2QBY B;  3GDQ A;  4FCT A;  5IWA M;  1C0M A;  3AA5 X;  5JS2 A;  3ZSZ A;  4B1X B;  2ZJR L;  3W3D A;  2QPA A;  2XLJ A;  3JXU A;  3TI0 A;  4FOE A;  3OYN A;  4QOS A;  1WSE A;  2ASO A;  1ATR A;  3T38 A;  1QQO A;  1R5L A;  2K9D A;  4YFU A;  3SV4 A;  4DFP A;  2HF4 A;  4B3T M;  3VEZ A;  3SQ2 A;  3THY B;  3KK2 A;  3WT0 A;  3O3H A;  4FZX C;  1C0U A;  1DGF A;  3TWM A;  5J2M A;  3U6L A;  2NRW A;  4M41 A;  2NNW A;  3F2K A;  3EKS A;  4ILJ A;  1IXS B;  3RVC A;  4DSE A;  1L8Q A;  3P4I A;  4KHP M;  2KRU A;  7CAT A;  4M3U A;  4CJU A;  3CF0 A;  3T1Y K;  3AVF A;  4YOY A;  3GRU A;  4WQ5 A;  4H03 B;  5GKN A;  1Q39 A;  4KOD A;  3K9K A;  4NO7 A;  3LP3 A;  1IH7 A;  3HYF A;  4QS8 A;  4CZJ A;  2R44 A;  1NK5 A;  1Q7Y O;  2E2N A;  3VDU A;  4JEP A;  2EJS A;  2KW0 A;  4B7H A;  3SAR A;  5AQQ A;  4DR7 M;  2P9I A;  2CGL A;  3M5R A;  4KI4 A;  1RDA A;  1LWC A;  1Q81 O;  4C1N I;  2DWN A;  3IG8 A;  1FXX A;  2W6K A;  4CFA A;  1FNN A;  4AM6 A;  3ALY A;  5AQI A;  4AH9 A;  1IBL M;  3QFP A;  4KHQ A;  3IFR A;  4FLT A;  1Q3C A;  3TU5 A;  4DLG A;  4OLB A;  2IGI A;  2OAN A;  1QAN A;  4JKH A;  2KNZ A;  3VEV A;  3O9S A;  1N32 M;  4Z4H A;  1UAX A;  4PKH A;  3H4J A;  1K8K B;  1GOA A;  4F8R A;  1TL1 A;  2ZJQ L;  1R2Y A;  4HUG A;  4DR6 K;  3AV9 A;  2B4J A;  1HKB A;  3KD1 E;  1TKZ A;  4JYA K;  1ZBL A;  3OYK A;  4C8N A;  3A42 A;  3QYB A;  1RBU A;  4CBU A;  4IKF A;  4CD1 A;  1G4A E;  3V9W A;  3LCU A;  4CGY B;  1D9F A;  2DXI A;  3AJI B;  3DFZ A;  5EX5 A;  4AW4 A;  3C6H A;  3ZC7 B;  2OPR A;  2F8T A;  2FE8 A;  4FWS A;  1SXJ D;  1R59 O;  4JKG A;  4LJ5 A;  2Q0R A;  4GNI A;  3UKU B;  3SFZ A;  2P9L B;  3BZC A;  2DEN A;  3KOX E;  4YDU C;  4CHQ A;  2DKL A;  2WUS A;  1F21 A;  5F1X A;  3AA3 A;  5HRS A;  1XXH A;  1RDW X;  4IXC A;  4PL7 A;  2I7P A;  2O8B B;  3VQE A;  3AAR A;  3UK6 A;  3OYD A;  1GLD G;  4CJW A;  4DHY A;  3KLF A;  4PQU A;  1GJT A;  3QB0 A;  3D8L A;  5BPM A;  2G8H A;  2Q36 A;  1GLN A;  1J5E M;  1BQM A;  1QQC A;  4CIE A;  1QYR A;  4E7L A;  4XBO A;  3AGR A;  2EO2 A;  5AFU A;  3O5B A;  3HPO A;  2KDL A;  5L8R F;  1WSF A;  1HMV A;  2ZWH A;  1C0G A;  1WAF A;  4CJ6 A;  3V9X A;  1A5V A;  1HPM A;  3SAH A;  4X62 K;  4WFA L;  1WXQ A;  2G8L A;  3L25 A;  1BDG A;  2OPP A;  4CZI A;  4R5P A;  1MDU B;  1VAZ A;  3C3D A;  1T6D A;  2R4J A;  4IFV A;  3DM2 A;  2DFH A;  2WBN A;  3W67 A;  3IG5 A;  3TWH A;  5AQX A;  3OHR A;  1PJQ A;  4C1N K;  5CHI A;  3C95 A;  1YVN A;  3NCI A;  1YJN N;  2KA6 B;  3MWT A;  3I8D A;  4JXJ A;  4MM3 B;  3L4I A;  1L3V A;  2X6S A;  3U61 B;  2YHX A;  1P8Z A;  3VQ5 A;  4JI6 M;  3QNN A;  2F8S A;  1H6U A;  2E2O A;  3THX A;  3SUN A;  4CGD A;  5CYQ A;  3DOL A;  3SCX A;  3FUV A;  4BDP A;  3HHY A;  2X4A A;  2O8F A;  5H1S Q;  2ITM A;  3VET A;  3NE6 A;  1NGC A;  4LF8 K;  1TR8 A;  3M0E A;  4M7Y A;  1D8Y A;  1T6C A;  2OOA A;  4IBI A;  3UZU A;  2KHO A;  4M3W A;  4QHT A;  1D4X A;  4CZH A;  1HJP A;  1NG9 A;  4M63 C;  3TPZ A;  2OCE A;  1N36 M;  3AA2 A;  4G3O A;  3O1B A;  3VQ8 A;  2Y1J A;  4LF7 M;  4IBE A;  3QFU A;  2CGJ A;  2UUC M;  1Q02 A;  4GVM A;  4ILG B;  1Q3B A;  2L7I A;  1R0A A;  3F92 A;  3AOE A;  3H3O B;  3ENH A;  1IBL K;  2G8W A;  3N4Q A;  5CYM A;  4DWI A;  1Y64 A;  2XSZ D;  4CEC A;  4FCY A;  2KFZ A;  1XC3 A;  3KK3 A;  2NLX A;  4AKG A;  4CE9 A;  5C25 A;  2XZU A;  4DV2 M;  4LF4 K;  2NRV A;  4DR4 K;  2KXE A;  4B7G A;  5LMN M;  2YHY A;  3U6P A;  3LPT A;  3VKG A;  3HJS A;  3P31 A;  5IRE B;  4F4K A;  2DFF A;  4IFY A;  4CEA A;  2E5L M;  2WSC F;  4M9X A;  3TL4 X;  3RTV A;  4QCL A;  3LQQ A;  1X1P A;  1IN5 A;  2UXB M;  4ID5 A;  3ZSO A;  1PJJ A;  4DR2 M;  2L4F A;  3O4N A;  2PAV A;  5GIP A;  2IVN A;  3FD9 A;  3E9P A;  5HRR A;  3TAG A;  4BR5 A;  1L3T A;  1NKB A;  1C1A A;  5LL6 Z;  2JZ1 A;  3ZT4 A;  3HPH A;  4YHH M;  3NH2 A;  1TTE A;  1LAV A;  2G8F A;  1KRP A;  1JB0 F;  5KQD A;  2Q3S A;  1XI1 A;  4UN2 B;  2F96 A;  3CFP A;  3VA0 A;  2DTU A;  4CIZ A;  3CME N;  3HL8 A;  1NK0 A;  5FRM A;  3RMC A;  3AO3 A;  2YHB A;  1JR3 D;  3WNE A;  4BR4 A;  1KSP A;  2G5G X;  3P1G A;  3DRS A;  5EXT A;  4GW6 A;  3VTI A;  4CJ3 A;  4PA1 A;  4BWJ A;  1BCM A;  1PGY A;  3J7Y P;  1N5Y A;  2DZL A;  1CUK A;  2QTD A;  4DV2 K;  3FE1 A;  3OJU A;  4E7I A;  2HMI A;  5EXX A;  3RSE B;  1NHW C;  4E1N A;  2HWJ A;  2P5O A;  4UQG A;  2CV1 A;  4EHU A;  2HBK A;  3GLG A;  1OAI A;  4OPA A;  4YNQ A;  1AIP C;  2HVI A;  3H46 O;  4DFK A;  4WFN L;  1L2B A;  1XMQ M;  2KW4 A;  3QIN A;  1C1K A;  2ZM6 M;  3DLK A;  5JI2 E;  4YHH K;  3MEG A;  1KXP A;  4AQY M;  1RBS A;  2X74 A;  4F2R A;  3SHF A;  5KQ8 A;  1VSH A;  2GV9 A;  3KS8 A;  4RF1 A;  4ZPX A;  3F9K A;  4FW1 A;  4CGI A;  3Q8X A;  4NL4 H;  4DR3 K;  4JI6 K;  2LBC A;  2HAK A;  2LVP C;  3ZQJ A;  4PDI A;  1RTI A;  2EX3 A;  5CE3 A;  1IG8 A;  1QVF M;  2QQ8 A;  3ZT3 A;  1VQ7 N;  3SAU A;  2P5G A;  1TF0 B;  3EE8 A;  4BQZ A;  4JI8 M;  2AP1 A;  1K3W A;  2ASP A;  1ATN A;  2XFS A;  1EX4 A;  1D0L A;  4LF8 M;  2AA4 A;  3WXI A;  1VDD A;  2BJW A;  2JY5 A;  4KHS A;  4FWG A;  4FLY A;  3A5O C;  3CJ1 A;  4B7F A;  3FUU A;  2DFE A;  1IY1 A;  3CIP A;  1T43 A;  5DMR A;  3A46 A;  1BIU A;  5EP2 A;  2BAN A;  1IY0 A;  2NZT A;  3AVB A;  3WEE B;  3LL3 A;  1TAU A;  2UUC K;  2NRT A;  3ZCB B;  1NKC A;  2P9L A;  4J2A A;  3CJ7 A;  1S72 N;  2QCU A;  2F5S A;  1XNQ K;  3NDK A;  3HVR A;  3HGI A;  5EP3 A;  2HHS A;  5EJC A;  1KYI A;  1CZB A;  1NGG A;  1EQY A;  4A61 A;  3HST B;  5FTJ A;  1VSJ A;  5HLF A;  2D5R A;  3K2L A;  2WZJ A;  1NWK A;  3CC4 N;  3AVG A;  3BF3 A;  3RMA A;  2FSJ A;  3OBY A;  4CI6 A;  2J5Y A;  3DJC A;  1VEG A;  3HK2 A;  1QE1 A;  5C10 A;  3TAQ A;  2Z8Y M;  3ZYY X;  5H37 D;  4O44 A;  3SPY A;  1TKD A;  2YKM A;  4ITQ A;  4KO0 A;  4A2B A;  1NOZ A;  1ZAE A;  3QEP A;  3D8B A;  4E0D A;  4FLX A;  3MK6 A;  5ITU A;  4DV6 K;  3TAP A;  1U04 A;  1G15 A;  5LMU K;  3L29 A;  1HNW M;  4DR1 K;  4CF1 A;  1NJG A;  2IOC A;  4FWD A;  1KVC A;  1L2C A;  3SAF A;  1K9M O;  3K9O A;  3JAM S;  4B9T A;  3GLI B;  4DUY M;  3VEW A;  3I4V A;  1OIP A;  4IJA A;  2X78 A;  3VTH A;  2FH0 A;  4FJ5 A;  1T44 A;  2DWL A;  4BC5 A;  4B3R K;  4AG5 A;  1DO2 A;  4B9M A;  4IBN A;  4DV1 K;  1KSF X;  1YUB A;  1JXB A;  4YY3 M;  2MJ5 B;  1SUQ A;  4H5R A;  4DSF A;  3THX B;  2UUA M;  1TKX A;  4LF6 M;  4IBD A;  2V7Z A;  4H5V A;  4O55 A;  5FTL A;  1G3I A;  4IBB A;  4FK4 A;  1MX0 A;  4AHS A;  4J2B A;  3HOS A;  4I7F A;  1NGE A;  3F73 A;  3U5Z A;  3LMM A;  1SKR A;  3SK3 A;  1U2V B;  3TSQ A;  1U6Z A;  2DNA A;  4FJJ A;  2UXC M;  3SQ1 A;  1SL2 A;  3R9P A;  4J8F A;  4LF5 M;  1K8K A;  4ELU A;  1QAO A;  1Z5C A;  4BE2 A;  2VF8 A;  4NCA A;  2HHX A;  3GPY A;  4IDK A;  4XH5 A;  4BRM A;  3V9Z A;  3S3O A;  1K8A O;  4DF4 A;  2B5J A;  2Y1I A;  3H08 A;  1KAX A;  3FYD A;  4DG1 A;  4L8R B;  1XNR M;  3HZJ A;  2RGH A;  3GLH B;  1KAY A;  1XC8 A;  1TAQ A;  4NXM M;  5BRF A;  3L2A A;  3BEX A;  3VQC A;  2XGN A;  4A57 A;  1YIT N;  1T8E A;  3QIP A;  4WUR A;  4U67 L;  4DV4 K;  3K5N A;  3A8Y A; 
#chains in the Genus database with same CATH homology
 3WQU A;  3M6A A;  1TGU A;  3EN9 A;  4KH4 A;  5B8H A;  5LY3 A;  4WYB A;  3SYL A;  1QZ5 A;  5FTM A;  2BJV A;  4PD2 A;  4EHT A;  1IXZ A;  3KS4 A;  2A5Y B;  3H45 C;  1XWI A;  3O9U A;  4WQ5 C;  3F9M A;  4NOO B;  3ZX3 A;  4LJ6 A;  1IN6 A;  3FUW A;  5AQH A;  1JR3 A;  1IY2 A;  3LVV A;  2YFQ A;  1NJF A;  3FZL A;  4I6M B;  3KZB A;  3G71 N;  4A5B A;  1GKI A;  4MGZ E;  5AZJ A;  1X3M A;  4B1Z A;  4JI4 M;  3HWS A;  4X66 M;  4KBO A;  5IZ7 D;  4HLQ A;  3HI0 A;  3AAQ A;  5I9E B;  1NNJ A;  4BRA A;  2HL7 A;  1BUP A;  2XSZ A;  3J7B A;  4OU7 A;  3AKZ A;  4BRE A;  2VGN A;  2F5Q A;  4PT5 A;  4G4Q A;  1NBW A;  4FL9 A;  1D2N A;  5M1F A;  2A40 A;  1J09 A;  1IM2 A;  2HBJ A;  5EOY A;  4IBK A;  4BRQ A;  1HNZ M;  4AKH A;  2QEX N;  5LMU M;  1SZ2 A;  3J81 S;  4RWT A;  1LCU A;  5DYG A;  5ADX H;  1XXH B;  2A42 A;  2CH5 A;  1OKJ A;  3J7A S;  3BP8 A;  3L27 A;  4YOX A;  4B1U B;  1GLJ O;  1J6Z A;  1Q82 O;  2D7E A;  3WXK A;  4WW0 A;  3LVW A;  2WC9 A;  3CD6 N;  5ITQ A;  4B3R M;  3M6G A;  3CCR N;  2CV2 A;  4II7 A;  1OVY A;  2V52 B;  3DXM A;  3J8A A;  3MMV A;  1RFQ A;  4MDB A;  2P9P A;  3ZEU A;  3N4P A;  2W82 A;  2QW9 A;  2E2Q A;  5EY4 A;  4UY8 O;  3MN5 A;  3NBI A;  4DV3 M;  3VKH A;  3OBW A;  4BRG A;  3B9P A;  3HHW A;  3IMX A;  3VF4 A;  1M90 O;  3R8F A;  3WUH A;  1DGG A;  5ITX E;  4E1J A;  1BWF O;  4FCW A;  3VMF B;  4HWI A;  3MJ5 A;  1KFV A;  2C5R A;  5AQG A;  2QWQ A;  2QXL A;  2D1K A;  4U7B A;  1R6B X;  1GLL O;  4H0T B;  3O4W A;  4NSR A;  2QWM A;  1Q18 A;  2E1Z A;  4I8O A;  2CH6 A;  2RHK A;  5JI3 E;  1HJO A;  1N33 M;  5AQV A;  1L1Z A;  3K9J A;  4GHL A;  5GIN A;  4L16 A;  3GLI A;  2Q97 A;  4JK9 A;  4CZK A;  3WHL A;  2L7H A;  3DXM B;  1S3X A;  1Z5B A;  3MCA B;  5AQS A;  3L0Q A;  3TTD A;  3H3N O;  2X49 A;  3WXM B;  2XF3 A;  2FNA A;  4LZZ A;  3EL2 A;  4DUZ M;  4Y0W A;  3LM2 A;  3K92 A;  3ULE B;  2VII A;  4BR0 A;  2E2P A;  4AI6 A;  3GOI A;  2EWS A;  1YI2 N;  3D2F B;  4GVE A;  3VEO A;  4PHT X;  4GHA A;  1O13 A;  4Z94 A;  2KRK A;  5AZI A;  4XH4 A;  5GAD P;  2ERC A;  3PNV A;  4M0W A;  3SBJ A;  4GMQ A;  3HSC A;  2CV0 A;  1QHA A;  5JMV A;  2E88 A;  1ZQ9 A;  2FXU A;  3KFU G;  4GIT A;  4X62 M;  3CC2 N;  4GRI A;  4G4N A;  3M1F A;  1TH2 A;  3MX2 A;  1HX1 A;  4M9Z A;  3LDN A;  4IEE A;  1N75 A;  2HHH M;  1G41 A;  4JI0 M;  4XGI A;  5KPZ A;  1R7R A;  2Q0U A;  3VGK A;  5AQL A;  1ORY B;  3I4Y A;  4LC9 B;  3SBT A;  4BR9 A;  2ZF5 O;  1QVG M;  3SC3 A;  4A2A A;  5DM7 L;  5ITX A;  1GLA G;  4YOV A;  1LV7 A;  3ULE A;  4JI7 M;  3CCQ N;  1DEJ A;  4BC4 A;  3Q7C A;  5KPT A;  1IQP A;  3AV0 A;  4BVO A;  1W5T A;  4F9O A;  3TSU A;  4DKW A;  4LJ4 A;  2CUZ A;  4CZM A;  3VER A;  3R8E A;  5JIC A;  1JCE A;  4MGI E;  4CBX A;  3MX5 A;  3NVM A;  1ESV A;  4NB4 A;  1OFH A;  1VQ6 N;  5FSW A;  4BB9 A;  2LXE A;  3PFI A;  5EQT A;  5BRH A;  2ZAN A;  4OVZ A;  3VPZ A;  3VOV A;  2YNM D;  3T15 A;  2V6Z M;  5C0Y A;  1G59 A;  2A6A A;  4IBC A;  4BRC A;  2X8A A;  3QWL A;  5ELZ A;  1GLC G;  2CEA A;  2BUP A;  2P9I B;  3H6E A;  1M1K O;  1YJW N;  1TYQ A;  3NMU A;  1XNQ M;  4PDG A;  3UKR B;  3DWL A;  1NHG C;  5C2D A;  4QNM A;  4FW9 A;  4BQL A;  1N34 M;  1ATS A;  2Q31 A;  2CHV A;  2GTD A;  3LDL A;  4D82 A;  4FD2 A;  1CZA N;  4EFH A;  3VDP A;  3W0F A;  3FUX A;  3WXJ A;  3CMA N;  1YSY A;  4MLH A;  1VQO N;  2DVW B;  3MN6 A;  3KSJ A;  3U60 A;  4Z6Y A;  5F0X A;  4B08 A;  1NGI A;  1SS6 A;  3J27 B;  3GPU A;  4JKG B;  1TUU A;  1MWK A;  2V51 B;  3ATV A;  3KWI A;  4CBW A;  3GQ3 A;  3F5T A;  3CER A;  4D81 A;  3GPX A;  3G4S N;  3U5Z B;  4BG9 A;  1X9J A;  4MO5 A;  1VQM N;  5DYI A;  2WFB A;  3DZD A;  3G25 A;  4DR3 M;  3FFK B;  1QZ6 A;  4NRV A;  4A5A A;  3ZX0 A;  4GH9 A;  4JK7 A;  3CCJ N;  1IXR C;  1W2B M;  2DWZ B;  4JI2 M;  4LFB M;  2IVO A;  4BGA A;  1VQ4 N;  2A3Z A;  2KLA A;  5EP1 A;  2V7Y A;  4H5N A;  2YCH A;  1SXJ E;  4K0K M;  4IFE A;  4MO4 A;  4EIW A;  4OW0 A;  4P16 A;  5KO3 A;  3O9R A;  3CTW B;  3CJC A;  4K43 A;  3BUZ B;  3R3L A;  3W0L A;  1ZXO A;  2QP9 X;  3RE8 A;  1TDZ A;  1V4T A;  3D2E A;  3KVG A;  2P9U A;  2XEP A;  3C65 A;  3DXK A;  4YOW A;  1DGK N;  5EVZ A;  3HJQ A;  2Z4S A;  1HQC A;  3E1Y A;  4AG6 A;  5BN8 A;  3L28 A;  3GO8 A;  2K47 A;  3VEY A;  2RGO A;  2EA0 A;  5BN9 A;  1GLB G;  3IUC A;  3A0I X;  3PLA A;  1NGF A;  2HBM A;  5AQY A;  5IT9 S;  5GAG P;  2YX6 A;  3SAV A;  1X3N A;  4JYA M;  1NGD A;  1EO1 A;  3J80 S;  4QS7 A;  3FZK A;  2E20 A;  3U6Q A;  5E84 A;  2O5R A;  1Z05 A;  3HHZ A;  3FZH A;  4FWO A;  2PBD A;  3D2F A;  3OA9 A;  1NSF A;  3U6M A;  5BRD A;  3KVW A;  3MHV C;  1MWM A;  1LOT B;  2J7O A;  3I55 N;  5AZI B;  3HRG A;  1QQM A;  1NGA A;  2F5O A;  1VQP N;  2P9U B;  3GLF B;  2QM1 A;  1G8P A;  4YDU A;  4NXN M;  1DGH A;  4LFA M;  4C23 A;  3OW2 M;  3CJ9 A;  3C58 A;  3O80 A;  3ZX2 A;  4DV7 M;  3SYK A;  3HJ8 A;  5ITY A;  3AGK A;  1E4G T;  2E8A A;  4A59 A;  4XEI A;  3TTC A;  2LH0 A;  2F7T A;  1EE8 A;  5FPD A;  5AQP A;  3SHG B;  2NRH A;  3QAU A;  2CGK A;  3EKU A;  1K73 O;  4HL4 A;  4K41 A;  1SAZ A;  1RDU A;  4HTL A;  3VFD A;  4IBG A;  4JKD A;  3QBX A;  5FPE A;  4LRT A;  5GAE P;  2Z7J A;  4FSV A;  1QQN A;  5EXP A;  2NRR A;  2JWK A;  5JVG L;  3CHW A;  4B1W B;  5GIO A;  3O08 A;  1XHB A;  5AR0 A;  4DCH A;  3U6E A;  4ILH A;  3KHY A;  4FVU A;  3I8B A;  4BRH A;  1NMD A;  4PKG A;  5GAH P;  4G4R A;  2ZGZ A;  2Z3X A;  2NRX A;  2XH9 A;  1HT2 E;  4BRO A;  4IBJ A;  3DXK B;  3SAS A;  3E4R A;  3I33 A;  4FPA A;  5AQO A;  2FF3 B;  3RSE A;  2HOE A;  4H0Y B;  3FZM A;  4DR4 M;  1NM1 A;  4M9S A;  4S12 A;  1P90 A;  2FFJ A;  4FVM A;  3KWG A;  1HLU A;  4O8U A;  4BRK A;  1IBK M;  1E4F T;  3CCS N;  4AZF A;  1E9R A;  2D0O A;  3QBW A;  2ZAO A;  1HR0 M;  3HKP A;  3EZW A;  5FLX S;  4DR5 M;  4QHS A;  3HM8 A;  4ISE A;  1QVR A;  4IBF A;  1TDH A;  1YUW A;  4WF9 L;  2F9W A;  4B9Q A;  3H4M A;  2P9N B;  4WQ4 C;  2VGM A;  3RGS A;  2YQZ A;  1VQ5 N;  5BPN A;  4B3M M;  5M1Q A;  1VQL N;  1Z59 A;  4L8R C;  3KOW E;  3SBG A;  4FOI A;  3I51 A;  2QWO A;  5AQJ A;  1QZM A;  3CQX A;  4BC3 A;  4LF9 M;  4M7X A;  5C18 A;  3HBT A;  2D7G A;  5C1B A;  3SAG A;  3A5N C;  5F2R A;  4LRS A;  3EE9 A;  4G9Z A;  3Q7B A;  2OQ4 A;  4K42 A;  4L78 A;  4I6M A;  3CI5 A;  1NLV A;  3C6A A;  4DV5 M;  2C9C A;  3A5M C;  4KH6 A;  3O6W A;  3KOY E;  4JKE A;  1VQ8 N;  1YE9 A;  4JKA A;  3LQR A;  3CJA A;  2C99 A;  4IWV A;  3ENO A;  4JKB A;  2QI2 A;  2J7N A;  4YOR A;  4FWR A;  3NVK A;  1T3V A;  2P9S A;  1KC8 O;  2VQF M;  3R6M A;  3UE5 A;  5AQT A;  3AFH A;  4K25 A;  3A5L C;  4BRL A;  1NGJ A;  4BRF A;  4MGK E;  1DKG D;  1XUP O;  2VYP A;  4M0D A;  4MB7 A;  1YF5 L;  5JLF A;  3M7G A;  2W41 A;  3GE1 A;  4GC5 A;  3VLF B;  4MH0 E;  2F5P A;  3GL1 A;  3FUT A;  1KQS M;  3IKM A;  2CHG A;  1GL7 A;  3GRY A;  4DR6 M;  2D0P A;  3BOS A;  5AZJ B;  3L4Q A;  5EXS A;  3TTF A;  1G99 A;  2D4W A;  2Q2E B;  4LJ9 A;  4JHD B;  4FWM A;  1YXQ A;  4CZG A;  1MU5 A;  4DV0 M;  4EAH D;  5KPR A;  4GV9 A;  4H5T A;  5BR9 A;  4BC2 A;  4CZF A;  1GL6 A;  4JN6 A;  3PVS A;  4BRN A;  3MN7 A;  1NY5 A;  4DV1 M;  3EIH A;  5AQF A;  3T7Z A;  4X65 M;  4IJN A;  2ZBK B;  4OPH A;  4BR2 A;  4R7G A;  1E94 E;  4CJ7 A;  1L2D A;  2D7H A;  1GLF O;  1TH4 A;  3CCL N;  5CR4 A;  2P9S B;  1XMO M;  4GC9 A;  5M1N A;  3CF6 E;  3WHK A;  3U4L A;  1Z5A A;  2IIR A;  3UGJ A;  3JR4 A;  3I56 N;  1BA0 A;  1Z6R A;  2DPN A;  3O9Q A;  4IDH A;  3U8X A;  5MLC Q;  1UM8 A;  1R2Z A;  3VEX A;  2KEB A;  2QWP A;  3BF1 A;  4I4L A;  3LDP A;  5M1K A;  1WOQ A;  4RNA A;  4LJ8 A;  4BRI A;  1NNU C;  4O5F A;  2CE7 A;  3GQ5 A;  3H1V X;  2RE2 A;  4LFC M;  2HCB A;  2YI1 A;  5FPM A;  4IJF A;  3ID6 A;  3GPP A;  4AM7 A;  1U2V A;  4H0X B;  4MGY E;  4MLE A;  3R9X B;  2QWN A;  3ZEU B;  4MDA A;  5LJW A;  1KD1 O;  5HL7 L;  3GBT A;  3FTF A;  2R46 A;  3K1J A;  3U61 A;  2YJF A;  1HUX A;  4JKC A;  4IOC L;  2DWM A;  1OFI A;  5AQK A;  3CJB A;  1QAQ A;  3VF2 A;  3FKE A;  4BG8 A;  5DM6 L;  3VGM A;  2BNK A;  3ZET A;  3O9T A;  3D2E B;  3U6C A;  1J7K A;  2KZU A;  1JCG A;  1IN4 A;  5C12 A;  4R3D A;  3SMS A;  3U6D A;  3TWK A;  2V1C A;  1XQS C;  3J2P B;  2HST A;  4JAX A;  3U9D A;  3CCE N;  1WUA A;  4CZE A;  4MGH A;  1K82 A;  5FPN A;  4H0O A;  4DV6 M;  2L09 A;  1NGB A;  2R62 A;  2C9O A;  3RFW A;  4BY9 C;  4PKI A;  3U60 B;  4CZL A;  5LJV A;  5ADX A;  1T3T A;  4DQ8 A;  1N78 A;  3LDQ A;  2W40 A;  4IEI A;  2BTF A;  5BPV A;  4LZJ A;  3DOA A;  2ZAM A;  4YOT A;  3KP0 E;  2P5T A;  2GUP A;  4GIP A;  3CC7 N;  4LJ7 A;  3MWP A;  3VF6 A;  3KP1 E;  2UU9 M;  4PL8 A;  3RGP A;  3PXG A;  3L6Q A;  1PM5 A;  3CCU N;  3P39 A;  2QA4 N;  2R65 A;  1JJ2 M;  4D80 A;  4GKK M;  4KH5 A;  4GY2 B;  4I5S A;  1V4S A;  2V1U A;  4LG2 A;  4NLB A;  3UKU A;  2ZGY A;  4WQ4 A;  2GEM A;  4IJE A;  1DGB A;  2VQE M;  4FWP A;  3VES A;  5ITT A;  4RF0 A;  3EO3 A;  4FWL A;  3IDH A;  4RCH A;  4JD2 B;  3PNY A;  3HHX A;  1NY6 A;  3EIE A;  4QS9 A;  2CHQ A;  4BLC A;  3KXE C;  4DR1 M;  3ID8 A;  3JR5 A;  5JLH A;  3TPQ A;  3UMM A;  1DT9 A;  1C0F A;  3AOE C;  5M1P A;  3OTO M;  4G6Z A;  2VCP A;  2PFU A;  3ILK A;  2P9N A;  3MN9 A;  3LDO A;  2C96 A;  4IOX A;  3ZET B;  1X37 A;  4A62 A;  3E66 A;  4H0V B;  5AQW A;  2ASM A;  4IIW A;  2Y21 A;  4NRW A;  2VWB A;  2YR0 A;  1YJ9 N;  3AL0 C;  3K8Z A;  3D7E O;  2DZN B;  1YIJ N;  4IZ9 A;  5AQZ A;  1IN7 A;  4OO1 J;  3TE6 A;  4LF4 M;  4LY6 A;  4ISF A;  1Z6T A;  2Q2R A;  2OTL N;  3CXC M;  4QOZ C;  1JQJ C;  2FSN A;  3GRR A;  2H1R A;  1VQN N;  3FGU A;  1ILY A;  3WEE A;  2GWJ A;  2LNH C;  3TQS A;  5A2Q S;  1OJL A;  3R1X A;  3O1W A;  4GV3 A;  1SXJ A;  3VK7 A;  4LJA A;  4JKF A;  4FWK A;  1PJI A;  2ZJP L;  4LGM A;  3U9Z A;  4JV5 M;  2FSK A;  4LCB A;  3O8M A;  3UB5 A;  3AAP A;  3SAW A;  4BGB A;  5FTK A;  3NWL A;  1E9S A;  1TUY A;  3QML A;  3VEN A;  2CFO A;  2BH1 A;  4RTF D;  2IVP A;  4JNE A;  3AY9 A;  4R79 A;  3GRV A;  4CD3 A;  1I4W A;  1HT1 E;  1FJG M;  3GLH A;  4BR7 A;  1N8R O;  3KW6 A;  3T1H M;  1TYQ B;  2QBY A;  2I7N A;  2JWL A;  4X64 M;  1QQW A;  5HOO A;  5EXW A;  2Z4R A;  3E9L A;  3L26 A;  4QNR A;  1BU6 O;  2QEN A;  2UXD M;  3PIO L;  2A5X A;  4XH1 A;  2L6O A;  5BPL A;  3T1Y M;  4I81 A;  4BRP A;  2F5N A;  2R18 A;  3SLC A;  2YJE A;  1NJI O;  1KAZ A;  3MDQ A;  2P9K B;  4JI1 M;  4IOA L;  4G4O A;  5M1O A;  3QIC A;  2XFT A;  2OTJ N;  4BRD A;  4B1V A;  5AQN A;  3VK8 A;  3DAW A;  2F9T A;  1IJJ A;  3CET A;  4JI3 M;  4CHT B;  3FYC A;  3FLC O;  4PCZ A;  1HKC A;  4IO9 L;  1GLE G;  1QAM A;  1ZC6 A;  3CQY A;  2H3G X;  3QDK A;  3UKR A;  4JHD A;  2J4R A;  2M5Z A;  5F3W A;  2HMP A;  4JK8 A;  1Q86 O;  1SXJ C;  3D6R A;  3C7N A;  1BG3 A;  2A41 A;  4H5W A;  3THG A;  3HU2 A;  4L4U A;  5AQM A;  1VQK N;  3GP1 A;  3G6E N;  4WFB L;  3KOZ E;  1RGI A;  3HU1 A;  1W5S A;  3A98 B;  3CF2 A;  1BO5 O;  2Y0T A;  4FO0 A;  2QWL A;  3U6O A;  4IO8 A;  1SXJ B;  4FWQ A;  2M60 A;  3MCP A;  1YAG A;  3ATU A;  1YHQ N;  4W5W A;  3TWL A;  1W97 L;  2LWX A;  4FWN A;  5AQU A;  2F4V M;  1GVN A;  3FTE A;  3HTV A;  4BVP A;  2KZS A;  4FPB A;  1BA1 A;  2P9K A;  2UUB M;  2R4E A;  3FZF A;  1N77 A;  1TH3 A;  3T69 A;  3DLL L;  1HKG A;  3SJH A;  3FTC A;  4EIA A;  3DA1 A;  3B8A X;  4DB3 A;  5BRE A;  3WXL A;  4H0P A;  3FTD A;  3E9S A;  1IN8 A;  2DZO B;  5AQR A;  3HU3 A;  1NGH A;  3JS6 A;  2Y20 A;  4O8K A;  2R45 A;  1JCF A;  1MA9 B;  2E1Y A;  1DGH B;  3AOG A;  3E9O A;  5C15 A;  3A45 A;  3CPW M;  4FWH A;  1BOT O;  3PIP L;  5EP4 A;  2QWR A;  1HQY E;  3UJN A;  3C7N B;  4LGY A;  4OVZ B;  1S3S A;  5TKW A;  3GLG B;  3HZ6 A;  3S41 A;  5BR8 M;  3HOT A;  3KK7 A;  2Q1N A;  2NQ8 C;  1L1T A;  2Y0Q A;  3J7Z O;  3M3Z A;  4L3Q A;  2C98 A;  2OPF A;  2FF6 A;  3CCM N;  4A3V B;  3U6S A;  3CCV N;  3SAT A;  5TKY A;  3W0L B;  1VQ9 N;  1NVM A;  2AHM A;  2GX9 A;  3ENB A;  2HKJ A;  4NSO B;  2HF3 A;  4KO8 A;  3SMP A;  4GKJ M;  4FCV A;  4DV4 M;  4AF1 A;  2NRZ A;  5DNY A;  1E32 A;  3WQT A;  1HNX M;  2HBL A;  4JN4 A;  3KDS E;  2DHR A;  4CIS A;  3CF5 L;  5AFU H;  4TUW A;  4REZ A;  3TSP A;  3KSX A;  2EUC A;  1S22 A;  4JI5 M;  4AKI A;  3VGL A;  5C2F A;  4BBA A;  1ZBS A;  4Z8X A;  5FTN A;  1IBM M;  2YHW A;  1K3X A;  4B1Y B;  3LM9 A;  4ISG A;  5JVH L;  2P9P B;  3ZH9 B;  5ITR A;  3GQ4 A;  2JA2 A;  2QZ4 A;  2UYT A;  2FLO A;  2FOI C;  4B3S M;  2RKO A;  3CPE A;  4NLC A;  3C0B A;  1DO0 A;  4GV6 A;  4OX9 M;  1SQK A;  4WCE L;  3FR0 A;  3GG4 A;  5E6J A;  3H1Q A;  1H1V A;  5E26 A;  8CAT A;  1I94 M;  4L15 A;  2GEL A;  4YOU A;  2KKZ A;  4KLN A;  3GLF A;  3P38 A;  4JD2 A;  2XZF A;  2GWK A;  2QBY B;  3GDQ A;  4FCT A;  5IWA M;  4B1X B;  2ZJR L;  3W3D A;  2QPA A;  2XLJ A;  3JXU A;  4FOE A;  4QOS A;  2ASO A;  1ATR A;  3T38 A;  1QQO A;  2HF4 A;  4B3T M;  3VEZ A;  3WT0 A;  1DGF A;  3TWM A;  3U6L A;  2NRW A;  2NNW A;  3F2K A;  3EKS A;  4ILJ A;  1IXS B;  3RVC A;  1L8Q A;  3P4I A;  4KHP M;  2KRU A;  7CAT A;  3CF0 A;  4YOY A;  3GRU A;  4WQ5 A;  4H03 B;  5GKN A;  1Q39 A;  4KOD A;  3K9K A;  4NO7 A;  4QS8 A;  4CZJ A;  1Q7Y O;  2E2N A;  3VDU A;  4JEP A;  3SAR A;  2KW0 A;  4B7H A;  5AQQ A;  4DR7 M;  2P9I A;  2CGL A;  3M5R A;  1Q81 O;  4C1N I;  2DWN A;  3IG8 A;  1FNN A;  4AM6 A;  5AQI A;  1IBL M;  3QFP A;  3IFR A;  1Q3C A;  3TU5 A;  2OAN A;  1QAN A;  4JKH A;  3VEV A;  3O9S A;  1N32 M;  4PKH A;  1K8K B;  2ZJQ L;  1R2Y A;  1HKB A;  3A42 A;  4CBU A;  4CD1 A;  1G4A E;  4CGY B;  2DXI A;  3AJI B;  3DFZ A;  5EX5 A;  4AW4 A;  3C6H A;  3ZC7 B;  2FE8 A;  4FWS A;  1SXJ D;  1R59 O;  4JKG A;  4LJ5 A;  2Q0R A;  4GNI A;  3UKU B;  3SFZ A;  2P9L B;  3KOX E;  4YDU C;  2WUS A;  5F1X A;  1XXH A;  1RDW X;  4IXC A;  4PL7 A;  2I7P A;  3AAR A;  3UK6 A;  1GLD G;  4DHY A;  3QB0 A;  3D8L A;  5BPM A;  2Q36 A;  1GLN A;  1J5E M;  1QYR A;  4XBO A;  3AGR A;  2EO2 A;  5AFU A;  3O5B A;  2ZWH A;  1C0G A;  1HPM A;  3SAH A;  4WFA L;  1WXQ A;  2G8L A;  3L25 A;  1BDG A;  4CZI A;  1MDU B;  1VAZ A;  1T6D A;  2R4J A;  2WBN A;  3IG5 A;  5AQX A;  3OHR A;  4C1N K;  5CHI A;  1YVN A;  1YJN N;  2KA6 B;  3MWT A;  4JXJ A;  4MM3 B;  3L4I A;  3U61 B;  2YHX A;  1P8Z A;  4JI6 M;  1H6U A;  2E2O A;  3FUV A;  3HHY A;  2X4A A;  5H1S Q;  2ITM A;  3VET A;  1NGC A;  3M0E A;  4M7Y A;  1T6C A;  4IBI A;  3UZU A;  2KHO A;  4QHT A;  1D4X A;  4CZH A;  4M63 C;  3TPZ A;  1N36 M;  3O1B A;  4LF7 M;  4IBE A;  3QFU A;  2CGJ A;  2UUC M;  4ILG B;  1Q3B A;  2L7I A;  3AOE A;  3H3O B;  3ENH A;  3N4Q A;  1Y64 A;  2XSZ D;  1XC3 A;  2NLX A;  4AKG A;  2XZU A;  4DV2 M;  2NRV A;  2KXE A;  4B7G A;  5LMN M;  2YHY A;  3U6P A;  3VKG A;  3HJS A;  3P31 A;  5IRE B;  2E5L M;  4M9X A;  3TL4 X;  3LQQ A;  1IN5 A;  2UXB M;  1PJJ A;  4DR2 M;  2PAV A;  5GIP A;  2IVN A;  3FD9 A;  3E9P A;  4BR5 A;  4YHH M;  5KQD A;  3CME N;  1JR3 D;  4BR4 A;  2G5G X;  5EXT A;  3VTI A;  2QTD A;  3FE1 A;  5EXX A;  3RSE B;  1NHW C;  2CV1 A;  4EHU A;  2HBK A;  3GLG A;  4OPA A;  3H46 O;  4WFN L;  1L2B A;  1XMQ M;  1C1K A;  2ZM6 M;  5JI2 E;  1KXP A;  4AQY M;  3SHF A;  5KQ8 A;  3KS8 A;  4RF1 A;  4ZPX A;  3Q8X A;  4NL4 H;  4PDI A;  1QVF M;  5CE3 A;  1IG8 A;  1VQ7 N;  3SAU A;  3EE8 A;  4BQZ A;  4JI8 M;  2AP1 A;  1K3W A;  2ASP A;  1ATN A;  2XFS A;  4LF8 M;  2AA4 A;  3WXI A;  1VDD A;  2BJW A;  4FWG A;  3A5O C;  3CJ1 A;  4B7F A;  3FUU A;  1IY1 A;  3CIP A;  3A46 A;  5EP2 A;  1IY0 A;  2NZT A;  3WEE B;  3LL3 A;  2NRT A;  3ZCB B;  2P9L A;  3CJ7 A;  1S72 N;  2QCU A;  2F5S A;  3HGI A;  5EP3 A;  5EJC A;  1KYI A;  1NGG A;  1EQY A;  4A61 A;  5FTJ A;  3K2L A;  1NWK A;  3CC4 N;  3BF3 A;  2FSJ A;  3OBY A;  4CI6 A;  3DJC A;  5C10 A;  3ZYY X;  5H37 D;  4ITQ A;  4A2B A;  1ZAE A;  3D8B A;  3MK6 A;  5ITU A;  3L29 A;  1HNW M;  1NJG A;  4FWD A;  1L2C A;  3SAF A;  1K9M O;  3JAM S;  3GLI B;  4DUY M;  3VEW A;  3I4V A;  4IJA A;  3VTH A;  1T44 A;  2DWL A;  4BC5 A;  4AG5 A;  1DO2 A;  1KSF X;  1YUB A;  4YY3 M;  4H5R A;  2UUA M;  4LF6 M;  4IBD A;  2V7Z A;  4H5V A;  5FTL A;  1G3I A;  4IBB A;  1MX0 A;  3HOS A;  1NGE A;  3U5Z A;  3LMM A;  3SK3 A;  1U2V B;  3TSQ A;  1U6Z A;  2UXC M;  3R9P A;  4J8F A;  4LF5 M;  1K8K A;  1QAO A;  1Z5C A;  3GPY A;  4XH5 A;  4BRM A;  1K8A O;  3FYD A;  1KAX A;  1XNR M;  2RGH A;  3GLH B;  1KAY A;  1XC8 A;  5BRF A;  4NXM M;  3L2A A;  3BEX A;  4A57 A;  2XGN A;  1YIT N;  4WUR A;  4U67 L;  3A8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...