2I7NA

Crystal structure of human pank1 alpha: the catalytic core domain in complex with accoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
358
structure length
325
Chain Sequence
FPWFGMDIGGTLVKLVYFEPKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCATGGGAFKFEEDFLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Pantothenate kinase 1
total genus 95
structure length 325
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03630 Fumble Fumble
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.780 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2i7nA03
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA02
3.30.420.510 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2i7nA01
1BA0A 1IG8A 1KAYA 3VF4A 2P9NB 1Q18A 3G25A 3LDLA 3VEOA 2P9KA 1NGIA 2DPNA 5AQSA 2QM1A 4H03B 4FWQA 4CBXA 3ID8A 1JCGA 3DJCA 2ZGZA 1HKBA 4H5WA 3FE1A 3D2EA 1GLEG 1QHAA 2ZGYA 3VERA 5BREA 1R59O 4BRIA 1NGCA 3FZFA 1QQMA 5EOYA 4BQLA 3FR0A 1DKGD 1C0FA 3ZX2A 4XH4A 1Z05A 3ULEA 1NGBA 3L0QA 2WUSA 1BO5O 4J8FA 5CE3A 2FSNA 5AQZA 4CD3A 4BR5A 5LJWA 2VCPA 3M6GA 2FLOA 1HPMA 3IMXA 3QBWA 3ULEB 4BC4A 4CD1A 4BRLA 5BPMA 1RGIA 3VEYA 3CJCA 3D2EB 1MA9B 2Q2RA 3LL3A 4BR0A 4JD2B 1RDWX 1BA1A 1YXQA 3LDOA 2P9UA 3D2FA 3MN5A 4A62A 3CHWA 2UYTA 4CI6A 3F9MA 2V7ZA 2F9TA 1KXPA 3O1BA 3VGKA 3VF2A 4DHYA 3VEXA 2CH5A 2CGKA 3WXLA 2QWPA 2ASOA 2YJEA 2YHXA 3EO3A 4B1XB 3SLCA 4CZIA 5LJVA 4FOEA 4O8KA 5EY4A 1LOTB 4I6MA 3UKUA 5B8HA 2A6AA 4JHDB 5AQYA 3EKSA 5AQHA 4JAXA 5KPZA 3FZLA 3H46O 3KVGA 4CZGA 2P9SB 3CJBA 1GLLO 5KQ8A 1GLAG 5FPNA 4PKHA 3OHRA 3L4IA 4B1UB 4CBWA 1YAGA 2A42A 4M7YA 3UKRA 2CH6A 3D2FB 3VEWA 2W40A 2CGJA 2QWNA 4FO0A 3LM2A 2E1ZA 4NB4A 4Z94A 1DGKN 4HTLA 4RWTA 1BU6O 1K8KA 2QWLA 5EXWA 3UKUB 1QZ6A 4F9OA 5AQOA 4BG8A 3ENHA 3IUCA 3MDQA 4H5TA 4CBUA 1XQSC 1V4TA 5AQWA 4BC3A 4FPBA 4I6MB 4IZ9A 4ISEA 4EAHD 5AQNA 4ISFA 3IFRA 1ZXOA 2V7YA 5KQDA 3J8AA 3EKUA 4MLHA 4PKIA 3SK3A 3VENA 4HWIA 3H45C 4Y0WA 3H6EA 3TU5A 2Q0RA 3M1FA 2P9LB 3DXMA 3C0BA 2D0PA 3AAPA 4K25A 3HI0A 3MN6A 3O5BA 1SZ2A 3R6MA 3A5NC 2D0OA 4LC9B 5FPDA 1WUAA 4BQZA 2YHWA 3GE1A 5F0XA 5JLHA 3U9DA 4BRGA 4WQ5A 2NRHA 4IO8A 1NGDA 1XUPO 1MWMA 3WXKA 3RSEB 2A3ZA 3ZETA 2H3GX 2IVOA 3H1VX 4FWPA 3C7NA 4A2BA 3AAQA 5E84A 1JCFA 1S22A 4BG9A 1RFQA 3A5LC 5AZIA 4BRDA 4K43A 1TYQB 3H1QA 4JHDA 4DCHA 2E1YA 3H3OB 3BP8A 1IJJA 4A61A 2KHOA 3DXKB 3R9PA 4BC2A 3CQXA 2D4WA 3W3DA 3A5MC 2EWSA 2GELA 4FWLA 3CJ1A 5JICA 1TUUA 1Y64A 2E2NA 3LM9A 5BPLA 2FF3B 3UB5A 2D1KA 4BRHA 4PL7A 5AZJB 4RTFD 2QWQA 1ZBSA 5AQTA 5ADXH 3LDPA 4H0VB 3VETA 1U2VA 1BUPA 5ADXA 2E2QA 5AQIA 2IIRA 3WXIA 4CJ7A 2Q97A 1MWKA 4QS9A 3MN7A 5AQRA 1GLCG 4BGAA 5LY3A 4K42A 2QW9A 3I8BA 3GDQA 2P9PB 4MLEA 4M7XA 4B1YB 3GOIA 4BR7A 5AR0A 1ESVA 3EL2A 5FPEA 4B1WB 3HM8A 3IDHA 4EIAA 2YHYA 3A5OC 3QFPA 2ZWHA 2QWOA 1HLUA 4H0OA 4MO4A 2YCHA 3WQTA 4GNIA 3MN9A 4YDUC 5BN8A 4L3QA 4IWVA 4PL8A 3CERA 3KHYA 5FPMA 1T6CA 3LDQA 3O1WA 3WUHA 4EHTA 3MK6A 1U2VB 4BR9A 3QB0A 5AQQA 5E26A 3EN9A 3FZKA 4QS7A 3U4LA 3ZEUB 3QDKA 1X9JA 4BR4A 2J4RA 5AQPA 3QFUA 5EX5A 2GTDA 4FSVA 1BG3A 1QQOA 3VGLA 1SAZA 3H3NO 3L6QA 3O8MA 5KPTA 3FZHA 1QQNA 1HUXA 2P9NA 3ZX0A 4BREA 3MCPA 4NO7A 2GWKA 2NZTA 2PAVA 1NGJA 3QICA 5JMVA 4H0YB 4YDUA 2E8AA 2V51B 2Q0UA 4BRNA 2PBDA 5AQMA 4FOIA 4JD2A 4RCHA 3P4IA 3HTVA 3WQUA 2CGLA 3RSEA 5AQGA 3A0IX 4WQ4C 4CZKA 4C23A 3D7EO 5AQFA 4BRCA 3BEXA 5AQXA 2Q1NA 5BN9A 4FPAA 4BRQA 1KAXA 3VF6A 4EHUA 1C0GA 3WXJA 4BVOA 2BTFA 4XEIA 3UE5A 1NMDA 3DXMB 1HJOA 4H5RA 3SMSA 1BWFO 3CQYA 2E20A 1NGEA 2HF3A 2ASMA 2A5XA 4H5NA 3O08A 2E2OA 3GG4A 3MMVA 1WOQA 3DXKA 2Q36A 4E1JA 2FSJA 4B1ZA 3DWLA 3JXUA 1T6DA 2P9UB 5TKYA 4K41A 1JCEA 3ATUA 3QMLA 4A2AA 3FGUA 3KZBA 5JLFA 4KBOA 3ZETB 2VYPA 1BDGA 1J6ZA 5F1XA 4BRPA 4IJNA 2F9WA 3C7NB 3VGMA 5BPNA 4JN4A 3ZX3A 1DEJA 4WYBA 4IJAA 5F2RA 1SQKA 3CJAA 4B1VA 2HMPA 5AFUA 3O80A 1E4GT 2HOEA 3HBTA 4CZFA 2YI1A 4FWNA 1TUYA 5AQJA 1V4SA 4DB3A 3AARA 5AQLA 3ATVA 3A8YA 5BR9A 3CIPA 4BR2A 2I7NA 2P9SA 2I7PA 1HKGA 2QWRA 1ATSA 4EFHA 3UKRB 1ATNA 4PKGA 2P9KB 4XH5A 1NGGA 2GWJA 3U8XA 2FXUA 1X3NA 2Q31A 2YJFA 2BUPA 5AFUH 5BRDA 4BRAA 3O4WA 3BUZB 3FLCO 1MDUB 2P9IA 1LCUA 3GBTA 2AA4A 3U9ZA 4BGBA 3FFKB 1D4XA 3VPZA 4CZEA 4XH1A 2E88A 1YVNA 1NGHA 2ITMA 3ZEUA 5KPRA 1XC3A 2OANA 2QWMA 5AZIB 1CZAN 4FL9A 4JNEA 1ZC6A 4AM6A 3BF3A 1HKCA 4B9QA 3W0LA 3JS6A 3O6WA 2FSKA 1GLJO 4BRKA 3QBXA 2V52B 3CJ9A 3B8AX 4FWSA 1H1VA 5I9EB 3ENOA 2HF4A 3EZWA 5AQUA 2ASPA 3DAWA 1TYQA 2IVNA 2A40A 3WT0A 2W41A 3VOVA 2ZF5O 4DQ8A 4FWOA 2P9LA 1EQYA 3SMPA 4WQ4A 1ATRA 4CZHA 5AQVA 1BOTO 1NM1A 1KAZA 2A41A 3HZ6A 4FWKA 2P9PA 3S41A 3WEEA 4BRMA 4MO5A 4WQ5C 3HSCA 1Z6RA 5EVZA 4CZLA 2VWBA 1GLFO 2E2PA 3AY9A 1QZ5A 1YUWA 1NBWA 1X3MA 3WEEB 4O5FA 4BVPA 4BRFA 3FZMA 1G99A 3BF1A 4M63C 4H5VA 4QS8A 4ISGA 2GEMA 3VEVA 3CETA 5BRFA 1E4FT 4H0TB 4H0PA 4FWRA 3SJHA 1HX1A 2QXLA 1T44A 4H0XB 3VEZA 2AP1A 4BROA 1S3XA 4FWMA 4GY2B 2NLXA 5AQKA 1U6ZA 4CZMA 1GLDG 1NGAA 5BRHA 2IVPA 1NLVA 2FF6A 1OKJA 3R8EA 4BC5A 2GUPA 5AZJA 3LDNA 4CZJA 3GL1A 1NWKA 1K8KB 3I33A 4IXCA 1P8ZA 3M3ZA 1GLBG 4AM7A 5ELZA 3CI5A 2P9IB 3CJ7A 1NGFA 3VESA 3TPQA
chains in the Genus database with same CATH superfamily
3LPTA 3FRIA 1KAYA 2C99A 3AVFA 1Q18A 3LDLA 1G8PA 5AQSA 2QM1A 4H03B 4FCWA 1AUAA 3LP3A 3ZSXA 4JKGB 1NJZA 3DLKA 3ZT4A 2UXBK 3O3GA 4CJPA 4H5WA 2ZM6M 3RFWA 3I51A 4B3OA 4LFAM 1S1XA 3PX6A 2P5GA 3NVKA 1R59O 5K14A 2C9CA 2YR0A 3LP0A 4AHSA 3L2WA 2VF7A 3HVTA 2YNMD 1WR1B 1N32K 4KHPK 4JI6K 4XH4A 3R9XB 1WLJA 4YFUA 3CCRN 1DGHB 3UK6A 3ULEA 4DFKA 4ILHA 4FLXA 2WUSA 2QCUA 3V76A 4FZXC 4CD3A 4CERA 1QAOA 5LJWA 4CFBA 2FLOA 1HPMA 3ULEB 4J2BA 3MJ5A 5C15A 4HL4A 2X6NA 3NH1A 2IS3A 4B3RK 5C1BA 1S1UA 3HK2A 4DR1M 4NOOB 3LWMA 2MJ5B 1L2CA 2UU9M 3KLEA 5FTMA 1BQNA 3D2EB 3RGPA 8CATA 1MA9B 3TTCA 1TAQA 1UA0A 5J2MA 3EY1A 4IBDA 4BR0A 4JD2B 4C8NA 4WFNL 1BA1A 4OW0A 4OKJA 1J7KA 2DY4A 3K59A 3GLIB 2UYTA 4PA1A 1RTDA 3CMAN 3FUTA 2DTUA 2JY6B 2DAEA 2JY8A 2CH5A 3U60A 1EIJA 4IBGA 4NYNA 2QWPA 4CZIA 4L78A 2KZSA 3O9SA 5LJVA 1L1TA 1UA1A 2RRUA 1HT2E 1LOTB 3AVLA 5B8HA 2A6AA 2YFQA 3SAWA 4YOXA 5AQHA 1OH6A 2HW3A 4JAXA 1J54A 5CY4A 4CZGA 3U6DA 3AV0A 2P9SB 3GLGA 1GLAG 4I7FA 3RTVA 2LH0A 2B4JA 4B1UB 4CBWA 1E32A 1YAGA 4B3TM 4LF9M 5DFLA 4M42A 3AO4A 3UKRA 3DRSA 4DV4K 1VSIA 5GAGP 2CGJA 1LV5A 1GL6A 2BWBA 3I4VA 2BDPA 2DKLA 3AA5X 4JK8A 1B9FA 2XLJA 4LY7A 3CCMN 3THXB 4QHSA 4M3TA 3MEEA 4LFCM 2OTJN 2DHRA 1K8KA 4O8UA 2W42A 4AQYK 2D0BA 1IN6A 2KKZA 3HU3A 3TR8A 4BG8A 2CRUA 4CBUA 3TAFA 5HOOA 2MR9A 3V9ZA 2B6AA 4CF8A 5LMUK 1JLGA 1OFIA 1XHXA 4EAHD 2DENA 4DU3A 4E3SA 3TAQA 3SQ4A 1S3SA 4IBIA 4IBEA 1ZXOA 2D7EA 5KQDA 3J8AA 2VQEK 4HWIA 1U48A 2YHAA 2ZE2A 1Q8IA 3DXMA 1LAWA 3ZC7B 3JR4A 3GLIA 3C0BA 2VGMA 4DR6M 3LWLA 2XRIA 1LV7A 4DFJA 1J5EK 4FM2A 1I94K 1RDDA 3O5BA 1NK5A 3VQQA 4GKJK 1AIPC 1IM2A 4PQUA 4LC9B 5FPDA 4CISA 3A2FA 3VQ6A 3NFAA 4DV5K 3HPOA 4BE1A 3PFIA 2Y1JA 1JJ2M 3GLHB 1VQ5N 4IO8A 1NGDA 4Z4FA 3WXKA 3SHFA 2VF8A 3RSEB 3ZETA 4GW6A 2H3GX 2IVOA 2Z1JA 5E6JA 4FWPA 3PY8A 2J7OA 3KKSA 3EEQA 4DU4A 5JS1A 4E89A 3U6QA 4JI3K 4CIEA 4BRDA 1UWBA 2HNZA 5GINA 4DTJA 3SBGA 3AL0C 5HRSA 5FTJA 3NBIA 1DTTA 3VQEA 1IJJA 4W5QA 2HHQA 3L25A 1G59A 4NCGA 3GPXA 3M6AA 2D4WA 2QTDA 4ICLA 2UUBK 3L2UA 3B7ZA 3CJ1A 4AZFA 2O8BB 5C2DA 4CHOA 2E2NA 5BPLA 2FF3B 2CV2A 3J27B 2VWJA 1J9AA 4KH5A 4CHPA 5C10A 1PM5A 4DTRA 4KHYA 2DWZB 5ADXH 3OJUA 5EP1A 3LDPA 3VETA 4CECA 4R5PA 4OLAA 3G4SN 2CHGA 3WNGA 5AQIA 3WXIA 4QS9A 5AQRA 1GLCG 4DV6M 4OO1J 4TUWA 2QW9A 3I8BA 4CF9A 3AOEA 3ZH9B 2QQ8A 4RKUF 1WJ7A 3GDQA 4MLEA 1Q82O 2W6LA 3FYDA 3BXWA 2XEPA 3BGRA 4X65K 3QAUA 3VQ4A 2V1UA 4L6V6 1ESVA 1VSHA 2RGOA 4CW7B 2Z4RA 1ZBHA 4WE1A 4QHTA 4MO4A 4YOWA 2OOBA 3SBJA 2O25A 2HVIA 4YDUC 2QPAA 3OYBA 1JLAA 5DK5A 2OQ4A 3HT3A 4UY8O 3HJSA 3TWMA 1ASWA 3RMCA 4JEPA 5FPMA 4QOZC 3B7QA 3LDQA 1KVBA 1UM8A 3C3EA 3GRYA 3WUHA 3K2LA 1CXQA 1U2VB 4BR9A 1RNHA 3CFPA 1L5UA 2X74A 3QB0A 4F1IA 4DV6K 3U4LA 3HY5A 3QDKA 2HL7A 4E7LA 4M3UA 4GC9A 4YY3K 1EETA 4HUFA 1EWRA 1VHXA 3DMJA 3QEPA 4OGEA 4AH9A 4FSVA 3C94A 3J80S 1HNIA 4Z4HA 3D0PA 2JWLA 2NRTA 4B8CA 4J2EA 3O8MA 3FZHA 1QQNA 4CIGA 4I8OA 4DR2M 2LVQD 3M8QA 1PGYA 2P9NA 3ZX0A 1YJNN 2RKIA 3M8SA 5ITUA 3HPGA 4CJEA 2F5QA 5JMVA 1NGJA 4H0YB 4YDUA 4M0DA 2E8AA 3BZKA 4FM0A 4OX9K 1BIZA 1RDAA 3VQDA 2HHXA 2X6SA 3P4IA 4F8RA 3SQ0A 2UUCM 5AQGA 4WQ4C 3K9JA 1IKVA 2VG7A 4UN2B 3P83D 1A5WA 2Q2EB 5C42A 3D7EO 3VTIA 3WHKA 3FRHA 1TL1A 3CC4N 1JR3E 3ILKA 3RMBA 4B9SA 4U7BA 3CGWA 5C25A 4JI4M 2XY6A 4DBGB 5AQXA 4NXMK 4CEQA 3V9XA 3SQ1A 4IBCA 3VMFB 5BN9A 3FUXA 4DLGA 2IAJA 4JI0M 4EHUA 1C1CA 3WXJA 4GC5A 3UE5A 1QVFM 1RBSA 4FM1A 4JKGA 3DXMB 4H5RA 2XO7A 3E1YA 1NGEA 1LWFA 3GLFA 1IY1A 2ASMA 2A5XA 4H5NA 3O08A 2E2OA 2GUIA 4OGCA 3MMVA 4G4QA 3OYJA 2RHKA 3DWLA 2YKNA 1GJTA 2ZBKB 1N34K 5TKYA 4FCTA 5JI3E 4BLCA 2XZFA 1BCOA 3OS0A 3KLFA 4JV5K 3RE8A 3SNNA 5HL7L 3ZETB 1K73O 1KFSA 2WSFF 3C7NB 2Y0TA 1HNXK 1OFHA 3DA1A 4REZA 4JN4A 1DEJA 1HQCA 3ZX3A 2ZJQL 2G8VA 4IJAA 5F2RA 3NHGA 3OA9A 4B1VA 2HMPA 4XIUA 5HLFA 3O80A 1E4GT 2HOEA 3HBTA 3RMAA 1QAMA 2YI1A 4IFYA 4YOVA 2H5XA 3OY9A 1D9FA 2F5OA 3D45A 4DB3A 3HJ8A 4IBFA 3AARA 5AQLA 3ATVA 3KIOA 4L4UA 5BR9A 3JAMO 3P1GA 4GITA 3CIPA 4YOYA 2I7NA 4CF1A 1NK0A 1N34M 2QWRA 3AVNA 4DFMA 4BB9A 5TKWA 2KDLA 1WSFA 1JLBA 4DQSA 5AJ3K 4GV6A 3V1OA 5KI6A 4PKGA 2P9KB 5BPVA 2HNYA 3ZSRA 3AVBA 1JLQA 1HQUA 4DUZM 2NRZA 3BUZB 3BZCA 4GIPA 3OYCA 5GIOA 5EP3A 3JAMS 2AA4A 3U9ZA 3OTOK 3U6OA 3EIHA 2QSFX 3ZSYA 3GRRA 2K9DA 2ITMA 3NE6A 3SUNA 1LAVA 2R4EA 5AZIB 3O9TA 3U61B 1HKCA 4B9QA 3W0LA 3JS6A 3CCVN 4G4OA 2FSKA 4DUYM 3O6WA 1RDCA 4BRKA 3HP6A 4E7HA 1OQYA 5DM7L 5EXTA 4ZTFA 3L8BA 4FWSA 2FBXA 1HT1E 3U61A 5I9EB 5AQUA 5C2FA 3FTDA 1JL1A 1BIUA 4C8LA 1ZBFA 2ATQA 3NH0A 1V34A 4LG2A 2ZF5O 3ZT1A 3CCLN 3HU2A 1FJGM 3W67A 3AVJA 3I56N 3VTHA 4NLBA 1RU3A 3SMPA 4CGIA 3QEWA 4DV5M 3ENBA 1WGLA 2DVWB 1VEGA 3I04M 4AHUA 3HKPA 1GOCA 4CHTB 3WHLA 1Q81O 3VQPA 3GLHA 1M90O 1UAXA 1GL7A 3OYHA 4JK7A 4UQGA 4FJLA 1DLOA 1QZ5A 4JI7K 1YUWA 5LMNK 1YSYA 1YTUA 1NKEA 1X3MA 4QAGA 3CPEA 2DFFA 4O5FA 3C6AA 2D0CA 3AVKA 4KH4A 4RG8A 3BF1A 4FJNA 3I01M 3C3DA 2O8CA 4H5VA 4JLHA 3HHYA 4KHQA 2ZJRL 3C65A 5BRFA 3H4JA 3LALA 4A5AA 4AF1A 4OLBA 2OCEA 2OPQA 5C12A 3SJHA 3OYMA 4KT0F 1JKHA 4C1NI 4O55A 2XSZA 1R2ZA 4RF0A 2AP1A 2L7HA 4W5NA 4MDAA 4DSLA 1IBKM 2K47A 3THVA 1EXQA 4JI7M 3L2QA 3P5JA 3K8ZA 1OKJA 3R8EA 1N78A 3ZYYX 3DOLA 1VQON 3GL1A 4K8ZA 1QHTA 3MXMA 3NWLA 4LSNA 2PYLA 4NL4H 3CI5A 2P9IB 4B3SK 3CJ7A 4I81A 4DMNA 1NHWC 4DV2K 3VESA 3VENA 2Z4SA 1TDHA 1YF5L 4DSJA 3MX2A 3VEOA 3CM6A 5JVHL 1HNZK 4LSLA 2UUAK 1NJGA 1A5VA 4FWQA 2HBKA 4FLUA 4EZ6A 3O9RA 4CGFA 2E5LM 1VSLA 1HKBA 3TTFA 3AVAA 3D2EA 3B6PA 1GLEG 2ZGYA 3FZFA 1QQMA 1LWCA 1CZ9A 3LW5F 4GKKK 3I0SA 3FR0A 3S3OA 4J2DA 3FTFA 3ZX2A 5M1QA 3ZSZA 1X9MA 1G41A 3VKGA 1U4BA 2GV9A 1OAIA 3TTDA 3WNEA 3IG8A 2G8LA 2J5YA 1NG9A 2HHSA 1NOZA 2FBVA 3THGA 4KO8A 1IFYA 5CE3A 3OYLA 3RR7A 3CCUN 4PUOA 4JK9A 3DOKA 3HZJA 4BR5A 4M41A 4KI4A 3GPYA 1VQ4N 3QBWA 3QO9A 4FYDA 3DYAA 3P38A 1TTEA 4C8KA 2R0IA 3OYKA 4CEOA 1JR3D 3AOGA 5FTNA 3C95A 5BPMA 4NCAA 2EA0A 3LDSA 4DR2K 3VQ7A 4IO9L 3AVIA 3QLHA 3CJCA 3GLGE 1RT1A 2Q2RA 1NO1A 1DGBA 3TANA 1SKSA 1KCFA 3LDOA 3VKHA 2P9UA 3D2FA 3PO4A 4AI6A 4CI6A 3F9MA 4CHQA 3NF7A 4I9QA 3O1BA 3RVCA 3CG7A 2OPSA 2LNHC 4KHPM 3LQRA 2UXDK 4CESA 4B9UA 4CEEA 1VDLA 3SARA 2FBTA 2CGKA 3WXLA 2ASOA 2YJEA 4OPAA 5IWAK 2LHCA 2YHXA 3EO3A 3ZT0A 3UJNA 3VA3A 4FOEA 3IECA 3V1RA 4XBOA 1VQ6N 3UKUA 4JHDB 5AQYA 4BE0A 4NXMM 4ELVA 1HPZA 5IREB 3TE6A 3TL4X 5KPZA 3FZLA 4EP5A 2OOAA 4DQPA 3BY5A 5FPNA 4LJ9A 3QNNA 3OHRA 4F2LA 3T15A 4CEDA 3U6SA 1N36K 1UOCA 1QVRA 2R45A 4AG6A 5GAEP 3Q8GA 2WSEF 3F9KA 4NSOB 3SAVA 3J7AP 1ORYB 4KREA 1VSEA 3RRGA 3PV8A 1K6YA 4FO0A 5ITXA 1ZV1A 4WW0A 3LM2A 1O1WA 3VQ9A 1L1ZA 2E1ZA 3PUFA 3SYZA 4NB4A 4NSRA 4DV7K 4HTLA 1OH8A 4GKJM 1BU6O 3OYNA 3SQ2A 1KQSM 1FKPA 1SXJB 2X78A 5AQOA 4B3MK 5HP1A 2XFTA 3KP1E 1HNXM 2AJQA 4BC3A 3K9KA 1N36M 3AO2A 2VIIA 3MX5A 4Y28F 4DR4M 3FD9A 1OKSA 4KODA 4IBKA 1B9DA 4MLHA 3SK3A 3EKUA 1TF0B 4CJQA 3BDPA 4JI3M 1W9HA 5H1SQ 5I3UA 3T3FA 1NK7A 4GVEA 4JKBA 3I55N 5JI2E 3GQ5A 1OH5A 3FE3A 2D0PA 4K25A 4O0JA 3MN6A 2RF2A 3TSPA 4CK2A 2G8HA 4NRVA 1Z5AA 3R6MA 2YQZA 3LZJA 4G9ZA 3A42A 3T1YK 1HNZM 1OAOC 1WUAA 4BQZA 3TARA 1QZMA 2YHWA 5JLHA 2NRHA 3ZCMA 2BJWA 3E9LA 1I4WA 1XUPO 2JXNA 3LCVB 1MWMA 1PRBA 2O8FA 3V1QA 1XNQK 3H1VX 1S9GA 3E01A 4A2BA 5H37D 3KWIA 2XZUA 3OYIA 4KAZA 2DWMA 3NBPA 4RW9A 2KNVA 4CJ3A 1VK0A 1RFQA 3A5LC 5AZIA 4AILC 3H1QA 3NAEA 1R7RA 3CCEN 4GHAA 3M5RA 1D9DA 3L3VA 4L16A 1C1BA 1HR0M 2KHOA 2CP8A 3EIEA 3R9PA 3T1YM 2O8CB 3QWLA 3SCXA 2GELA 4X64M 2DZNB 3G10A 4JYAM 1J53A 2F5NA 1TUUA 3LM9A 3O4QA 5BR8K 3V81A 4CJKA 2JY5A 4JI1M 5F3WA 3KLGA 3TWHA 4ILJA 3CF2A 5EXPA 4H0VB 1IKWA 2HWJA 1BUPA 2HBMA 4CJ7A 4A59A 3AVMA 4TSXA 1MWKA 1TH4A 5LMNM 5J2PA 1A5TA 3V4IA 1WAJA 4LJ8A 2P9PB 1KRPA 1OTRA 2QZ4A 4M7XA 1Q9YA 1GABA 3GOIA 4AKIA 4PDIA 4AHTA 2G8FA 3CF6E 4BR7A 2DNAA 4QCLA 1XXHA 4B1WB 3HM8A 4EIAA 2YHYA 1C0UA 1RTJA 2QWOA 2XY5A 4DR3K 2VG5A 3WQTA 3MN9A 1B92A 1MX0A 4DR5M 2D0AA 5BN8A 3QINA 1NNJA 2H1RA 4OPJA 3HU1A 4JI1K 2F5PA 4PL8A 3TSUA 3L2VA 3LCUA 1WAFA 1T6CA 3O1WA 2FC0A 2R4JA 3MK6A 2I5JA 4GH9A 4N76A 1L8QA 3BOSA 4FLYA 1WIVA 4B9MA 2QBYB 3ULDA 3ZEUB 3CF5L 3DLLL 4ID1A 4BR4A 4X66K 4GMJB 1NVMA 1D2NA 4JI4K 4DWIA 5EX5A 1NJWA 2OA8A 4BWJA 2QK9A 5ITYA 1SAZA 3H3NO 4JI0K 4CJRA 2P1JA 5KPTA 4N56A 5JVGL 3J7ZO 4R71A 3L2RA 1W7AA 2DWLA 1QAQA 4DR7M 3L29A 4B7GA 1E9SA 3K92A 3NF6A 2QI2A 4CHYA 3KWGA 2HHWA 1SS6A 1H6UA 1U47A 2F7TA 3VA0A 3MMPA 1HRHA 2V51B 3CFRA 3TAGA 3QEIA 4FOIA 4QOZB 4RNAA 2CHQA 1RT3A 3WQUA 2CGLA 1N77A 3V9SA 3A0IX 5SZTA 3MXIA 3AA2A 3FUWA 3K2PA 5FROA 4DQRA 5AQFA 4E7IA 4GV9A 1T43A 3UMMA 3ZSWA 3J7BA 4QOSA 2B3TA 4BRQA 1X37A 1KAXA 4DR7K 3VF6A 1VQ1A 1KLMA 5FSWA 1C0GA 3LPUA 1N5YA 4BVOA 1L3VA 4HUEA 5T7BA 3L4QA 1CLQA 2BANA 4FJHA 3HYFA 1R0AA 2BE2A 1XNQM 3THYA 1LWEA 3B89A 3E66A 3SAHA 1TDZA 4LF4M 4CJFA 1NK4A 4DV4M 3IRXA 1IY2A 4HLQA 4FW9A 2L2DA 1T6OA 2NRWA 1KFDA 2P9UB 1QANA 5DNYA 1K3WA 1L3UA 2UXDM 4LFCK 1ASUA 1IXRC 3HSTB 3KLIA 4E19A 1HR0K 3KSJA 3KZBA 3PSFA 2KA6B 2QHOB 1ASVA 1J6ZA 1Z26A 1I3AA 1XWLA 5CYMA 4FZZA 3MHVC 5EP2A 1XMOK 3W68A 2DWNA 1VQKN 3DFZA 1X1PA 3KK7A 2HB5A 3OJSA 4YOUA 3CJAA 3HGIA 1S6PA 5AFUA 4ANRA 3DRRA 5KO3A 3F5TA 1TUYA 5AQJA 3DLGA 3HM9A 1IN7A 4BDZA 4W5TA 3CF0A 1ZAEA 3GLFE 4CJLA 4DTXA 2KRKA 2I7PA 1YI2N 3KOYE 1LW2A 4O4GA 1TKXA 1QZEA 1IQPA 1JL2A 2HNDA 1BCMA 4EFHA 3VK8A 4CIFA 4HCCA 4IEEA 3UKRB 3OYAA 2QEXN 4JV5M 4G4RA 3V6DA 3U8XA 3KK1A 1X3NA 3PVSA 1CXUA 1R2YA 1QS4A 4IDKA 3IKMA 5BRDA 3VK7A 3WXMB 4BRAA 3O4WA 4MM3B 3ZSVA 4B7HA 1LCUA 3NGIA 2PFUA 3FFKB 4D82A 1D4XA 3KDSE 4CZEA 2E88A 1YVNA 2MGWA 1KD1O 2DAKA 4W5WA 3ZEUA 5KPRA 3U6CA 4K0KK 3SV4A 1CZAN 3I8DA 2O8EA 1HJPA 1GLJO 4W5RA 2V52B 3CJ9A 4JI5K 3M8RA 2AHMA 4KLNA 1BVSA 3B8AX 5I42A 2ZTDA 3J7YP 2R46A 3TPZA 1NJYA 1NJIO 1SL1A 3E9OA 2HF4A 3EZWA 4I5SA 2IVNA 4NXNM 2FH0A 2A40A 4H4MA 1GVNA 5HRRA 2QKBA 3VOVA 1NNUC 1XNRM 2ZD1A 4DQ8A 2VG6A 3RRHA 2HCBA 2P9LA 2YNIA 4IEIA 3HHZA 4Z0UA 3P39A 4CZHA 1NM1A 2XGNA 5IT9S 4ZHRA 3S3MA 1TVRA 3ALYA 5M1KA 2P9PA 1S72N 4FK2A 1BI4B 5M1FA 4BRMA 2EO2A 1SUQA 4IJEA 1G15A 2DZLA 3HSCA 3QNOA 1SXJE 4DTNA 2F4VK 1GLFO 2E2PA 2QA4N 4LF7K 2YKMA 4D80A 1WSJA 4FJ9A 1T3TA 1BI4A 2EX3A 1D0LA 2LBCA 5EQTA 4MDBA 3K9OA 4FJJA 3OBYA 3FZMA 4CGHA 4M63C 5M1NA 3B9PA 1TK8A 1D5AA 4GV3A 3HWSA 4FWDA 4KHUA 3IG5A 4NC6A 3U6MA 2EKFA 3B7NA 5L8RF 4JKEA 1PJIA 1VG5A 2DAGA 2E4LA 4LF6K 4FJ8A 2E6MA 4IDHA 4F3TA 2DAIA 2VGNA 3FFIA 4IOXA 1NV8A 1T3VA 4BROA 1QDTA 4GY2B 3NCIA 3LP1A 1RT7A 2NLXA 5AQKA 4JI2M 1ZBIA 3KOZE 2C98A 4I4LA 3GP1A 4CJVA 5BRHA 4GKKM 1E3MA 1NLVA 4BC5A 1HYZA 3E9PA 3LDNA 4CZJA 3GQ3A 1ZBLA 3B6OA 3KOXE 4IXCA 3I33A 1WSEA 4CCHA 3GLFB 1Q3BA 4OVZA 4FW2A 3OYEA 3K1JA 3AO3A 1NGFA 3PNYA 4PHTX 3EE8A 5EXSA 3GLGB 1XMOM 2P9NB 3VF4A 4GHLA 3G25A 3P31A 1NGIA 4CBXA 4DR5K 3ID8A 1KSPA 3ZT2A 3CXCM 3DJCA 2KFNA 4AHRA 4FLTA 4M9ZA 4ZPXA 3TSQA 1QSYA 4JI8M 1WBDA 4JXJA 3QERA 4FW1A 5BREA 4BRIA 3T1AA 4DV0K 1IBMK 3FUVA 1DKGD 5D3GA 3J80O 2UUCK 2WOMA 4FVMA 1Z05A 4KTZA 4M3ZA 4FJ7A 4E0DA 1U04A 3M7GA 1YIJN 3J7AS 2FSNA 4OVLA 3DLBA 4WF9L 5ITQA 1RT2A 4CGYB 3M6GA 4I2PA 3IMXA 4AKHA 5KRSA 2C96A 1XHBA 3R8FA 2FOIC 4BRLA 1R5LA 1REVA 3L27A 1U49A 4A5BA 1Z6TA 1IG9A 2R18A 1IBMM 1RBUA 1NKBA 1N32M 4A62A 1BHLA 3ZT3A 2V7ZA 2M5ZA 3VGKA 1V33A 2JP7A 3VF2A 2GBZA 2A5YB 4LF5M 2RPIA 3VEXA 5M1OA 4NXNK 3VQAA 3SFZA 2KNAA 4B1XB 4ELUA 4EIWA 5HBMA 2HHTA 1L2DA 5J1EA 3B74A 3OVNA 4I6MA 2LTUA 2YNGA 3U60B 3EKSA 3SZ2A 4BBAA 4IFVA 3A45A 4CJSA 2EUCA 2CWBA 3U3YA 1GLLO 5KQ8A 3SUQA 4C8OA 4DR4K 4PKHA 4FJIA 3HXMA 2OPFA 3N4PA 3K5NA 1K9MO 3GRUA 2CH6A 4BDYA 3D2FB 1QE1A 2A1SA 1QYRA 4HTUA 3VEWA 4KHNA 4GVMA 1VQMN 4Y1CA 3OS2A 4L8RC 3GO8A 4D81A 3TAEA 3U6PA 2CE7A 1NOYA 4YY3M 4B08A 3IS9A 3DI6A 1GO5A 4Z94A 3KJVA 2A1RA 1KC8O 2C9OA 4AW4A 1D0KA 2JA2A 4JKDA 4RWTA 5ITRA 3CCJN 3HHWA 1F4IA 1I94M 2QWLA 5EXWA 3UKUB 4F9OA 4YHHM 3OYFA 1NU0A 3ENHA 3IUCA 4H5TA 2CFOA 3NVMA 5CHIA 1VEJA 4KKOA 1XQSC 2L09A 1V4TA 5AQWA 3SV3A 2O8DB 4I6MB 1VQLN 1WNSA 4IZ9A 4ISEA 5A2QO 3ZLJA 5AQNA 4ISFA 3IFRA 2UXCM 4PCZA 1KTQA 4YNQA 4Y0WA 3H6EA 2Z1IA 2ZJPL 2P9LB 4AHVA 2Y21A 3AAPA 1EFUB 3HI0A 2W6KA 3DLRA 1T7PA 1DT9A 4HEOA 3MCAB 4ITQA 1WSIA 3SYLA 4LY6A 4CJWA 4G4NA 2L6OA 3VLFB 2D0OA 4F2RA 2MROB 2F8SA 3C9PA 4ILGB 3GE1A 1RDBA 3U9DA 4WQ5A 4HVJA 3SC3A 3MECA 4F2SA 1C7YA 2A3ZA 4LFAK 3HO1A 3C7NA 3CPWM 4BACA 1KYIA 3AAQA 4DV0M 2KZMA 4FD2A 1E9RA 1YTAA 1S22A 4BG9A 1Z5BA 1RTHA 4B9VA 4K43A 4WFAL 4DV1K 3KS8A 1TYQB 4WP2A 1HQEA 3K5MA 4DCHA 3VN5A 1HJRA 3NMUA 4OU7A 1LTMA 1DO0A 4MGYE 3CQXA 2OZMA 3MWTA 2XSZD 1OVQA 3U5ZA 1TL3A 1NY5A 2EWSA 4FWLA 5FLXO 4DR1K 2L4FA 2YHBA 4M3XA 5JICA 4Z4EA 4P16A 1Y8GA 4BRHA 4LD0A 4PL7A 4Z6YA 1Z59A 1ZBSA 3AA4A 2F4VM 2E2QA 5GIPA 1BQMA 3T69A 1QTMA 1TAUA 4K42A 4ZTJA 4MGZE 4CJ5A 4FLZA 1TKTA 4B3SM 1NY6A 2G8KA 3A98B 2VQFM 5AR0A 4DV2M 1QSLA 3MAQA 3EL2A 2JZ0A 3IDHA 1Z25A 3QFPA 1ZMWA 2ZWHA 4LRSA 1JXBA 4H0OA 1RT6A 4N47A 4GNIA 2HBLA 1KLNA 3TAPA 1YUBA 4IWVA 3OTOM 1C6VA 1O13A 3KVWA 4FLWA 3UIQA 3KHYA 3TWLA 1DGFA 2YNHA 3MXJA 1MU2A 4BWMA 5DYGA 3KXEC 2XY8A 1PJQA 3R3LA 3O3HA 5E26A 3EN9A 4QS7A 3I0RA 3CMEN 1UFZA 4FK0A 4DF8A 4S12A 1BGXT 4DV3K 4DS4A 1DTQA 5AQPA 4CFAA 2V1CA 4W5OA 3ITHA 1IN4A 4DSFA 1VEKA 3ZCBB 1NMNA 2GTDA 3QEXA 3NDKA 1ZMVA 3NGZA 3AOEC 1IKXA 4Z4CA 1QQOA 1FW6A 1FJGK 3O3FA 1EX4A 5HROA 1IH7A 2XH9A 4Y1DA 3Q7CA 4E7KA 5HRPA 4JS5A 3CTWB 2UXBM 1SXJA 2X8AA 2PAVA 3QICA 2CEAA 2VQEM 2Y1IA 2Q0UA 4BRNA 4JD2A 3SASA 3QESA 2O8FB 4JI6M 3CFOA 4CZKA 3KKRA 2NQ8C 3KSXA 1IY0A 2NUBA 3F2KA 1NSFA 4X66M 1DO2A 4BRCA 1YVUA 3BEXA 3VDPA 3SAGA 2Q1NA 3L28A 4FPAA 3LZIA 1KSFX 1YHQN 4MGIE 2G5GX 2BTFA 4XEIA 1NNEA 4CK3A 3JR5A 2O01F 1VSKA 1R6BX 1NMDA 3QIOA 1ITGA 2O8BA 3SMSA 1WN7A 3SPZA 1BWFO 2E20A 1YJWN 3HL8A 2HF3A 2JY7A 1S9EA 2W82A 3GG4A 4DTUA 2EHGA 1WOQA 4CJTA 2Q36A 4E1JA 2FSJA 3JXUA 1L2BA 3SUPA 2FNAA 1JCEA 2CUZA 2IC3A 3TABA 2RKOA 3FGUA 3O4NA 3KOWE 2VYPA 3MEDA 1BDGA 5CYQA 3NH2A 2BJVA 1YLAA 3VGMA 3SBTA 3S3NA 4XK8F 1HMVA 1R4GA 1SQKA 1WSGA 4DUZK 4DKWA 2KZUA 4IBNA 4CZFA 4FWNA 2HKJA 4E1NA 1FKOA 4R7GA 3RMDA 2PYJA 3CC2N 4PY5A 3A8YA 2LVOC 3AVHA 1WGNA 4WFBL 3J81O 1W2BM 1CUKA 4KPYA 5FDLA 4R79A 1HKGA 3SPYA 3SJJA 3M8PA 4LF8M 1RDUA 3VQBA 3H4MA 1ATSA 1NK8A 1D0MA 3R1XA 3HJQA 1ATNA 4JS4A 4IOAL 1SL2A 2DFEA 4XH5A 3OS1A 1XNRK 4MB7A 2R6FA 2Q31A 2F8TA 3K9PA 1XWIA 1TKZA 1X9WA 1MDUB 2P9IA 3ISNC 3HPHA 4NCBA 3JSMA 3GLHE 4JKAA 5KRTA 1HYSA 4MFBA 4KO0A 3VPZA 4QNRA 2ZQBA 5GADP 3KS4A 1D8YA 4Z4GA 3ZQJA 3VQ5A 2OANA 1JLCA 2DXIA 1GOAA 1ZBUA 3OBWA 1NV9A 2E6LA 4JNEA 1ZC6A 4AM6A 4DFPA 2APLA 2XFSA 2QP9X 2LSNA 2Z1GA 2D5RA 3QBXA 3E4RA 2JNHA 2R44A 4MQ3A 3HOSA 1VQ7N 1H1VA 4L8RB 4LFBM 4KTWA 3THXA 3U6EA 3DAWA 1S5JA 1TYQA 1YT3A 1HQYE 1LW0A 1XC8A 3O9UA 4M0WA 4PDGA 4Q5VA 1E94E 3M0EA 4DLEA 4DQIA 5FRMA 1RILA 4PD2A 3NGYA 3T6PA 4FWOA 1TH2A 1SXJC 3LAMA 4LRTA 2OTLN 2NNWA 4I9LA 4FK4A 1ILYA 1JLEA 5AQVA 3K0SA 1VSMA 1KAZA 3SAUA 2HHUA 2JLEA 2ZTCA 2ZAOA 3HZ6A 4KFBA 4L15A 2M60A 3HHXA 3S41A 3DLHA 4MO5A 2RN2A 4WQ5C 5EVZA 2BH1A 2DAMA 2VWBA 2KFZA 4RW8A 1YE9A 3JYTA 4CFDA 1QUSA 3N4QA 4EZ9A 2KHHA 1NBWA 3O9QA 1CZBA 4KH6A 4BVPA 1FXXA 4BRFA 1G99A 2YV0X 3LP2A 2KW4A 4FCYA 4QS8A 4ISGA 2GEMA 1MJGM 3VEVA 4R3DA 2QXFA 4CEZA 3Q8XA 4MH0E 4H0PA 2DI0A 4FWRA 3QEVA 2Q3SA 3PLAA 3AKZA 3QETA 1HX1A 1W97L 1FK9A 1P3QQ 5DM6L 4G1QA 3ZSOA 4O5BA 3VEZA 3FKEA 3L2AA 4DU1A 2UUAM 1RBVA 2WTUA 3D8LA 2ZM6K 4JRPA 2LVNC 1KVAA 1Z5CA 4YORA 4CZMA 3AGRA 2VWKA 1OJLA 2OYQA 4C8MA 1EKEA 3HP9A 3ID6A 2BGGA 2IVPA 3HOTA 5J2NA 2FF6A 4H4OA 4M3RA 1IV0A 5MLCQ 2O4GA 1N33M 4Z4IA 2V6ZM 4KHSA 1EWQA 1VQ8N 3W0LB 3FYCA 1WHCA 1XB2B 2N35A 1P8ZA 2LWXA 1JXEA 5ELZA 4X65M 2XY7A 1S1VA 3U6FA 3TPQA 5J2QA 3C6UA 1BA0A 1IG8A 5IZ7D 1IXSB 3PIOL 4FVUA 3FUUA 3G71N 3TAMA 4CHNA 2P9KA 1XMQK 4GEWA 2DPNA 4BY9C 1XI1A 3RGSA 1RT4A 1NK9A 4JKHA 1U45A 2XHBA 1IXSA 1IN8A 1JCGA 2ZGZA 2ZANA 4Q7JA 2K0BX 1HYVA 3FE1A 3CM5A 3KP0E 1QHAA 3VERA 4JI2K 4BE2A 1NGCA 2NRXA 2F96A 2XF3A 2O4IA 1N33K 4OKKA 5EOYA 4BQLA 4F4KA 5SWMA 3AFHA 1C0FA 2WC9A 3U3GA 4DSKA 2KTQA 3AV9A 1NGBA 3L0QA 2D7GA 3HX3A 4DV3M 1BO5O 4J8FA 4KV8A 2O5RA 3THWA 5AQZA 2KZZA 2K6BA 2O8EB 2VCPA 4BC4A 1L3SA 4PT5A 3ZSQA 2QKKA 1SL0A 4CD1A 4IOCL 5GAHP 3CQ8A 3D8BA 4LJ4A 1IN5A 1RGIA 5JS2A 3VEYA 1YITN 4JRQA 1TK0A 4FJMA 4LH4A 4V19S 3FTCA 3LL3A 4MGHA 2OO9A 4JI8K 1RDWX 5C24A 1GKIA 3E46A 1YXQA 4CF2A 3IHPA 3MN5A 3CHWA 1QQCA 2F9TA 2JGUA 1KXPA 4OKEA 4RW4A 3K58A 4DHYA 4IG3A 3K5LA 1IKYA 2BNKA 4LJ5A 4MGKE 4A3VB 3V9UA 2DFHA 3KLHA 1NK6A 1M1KO 3SLCA 5E41A 4O8KA 5KGXA 3OYGA 3L3UA 5EY4A 1EO1A 3E21A 1FNNA 4HUGA 3KVGA 3H46O 1XC9A 1VSJA 3CJBA 3TQSA 3AVGA 5HRNA 3LVVA 2O8DA 2KRUA 3L4IA 1RTIA 2A42A 2UXCK 4B8AB 1W5SA 4M7YA 1A5XA 5CR4A 4NYFA 3RWUA 3PX4A 2KNZA 1NJXA 4CIZA 1L3TA 2W40A 1T03A 2D7HA 2QWNA 4FCVA 4M45A 1SKRA 2KQ2A 4FWHA 5DYIA 1NJFA 3AGKA 4N41A 4C1NK 1DGKN 4PWDA 1C1AA 4LJAA 3V9WA 2FS1A 1QZ6A 4DSEA 3THWB 1OVYA 2Y20A 3MDQA 5EP4A 3T7ZA 3Q7BA 4FPBA 4P17A 4Q0BA 1VDDA 1IBLM 4FWGA 2YX6A 3KD1E 3J81S 3KK2A 4LCBA 2ITGA 1N8RO 3QYBA 2LXEA 4WCEL 2V7YA 4PKIA 5M1PA 3LMMA 4IBBA 4KB1A 3H45C 4CGGA 4JI5M 3OYDA 3TU5A 4LJ6A 1MU5A 4ELTA 2Q0RA 3M1FA 2HHHM 3DZDA 4XGIA 2IOCA 3TWKA 1VQNN 2DZOB 4DTPA 1SZ2A 2QBYA 1N75A 2KW0A 1PJSA 3A5NC 4CEAA 1QUTA 1IO2A 1XMQM 4HCBA 1Q3CA 5F0XA 2ETJA 4BRGA 4JYAK 1KFVA 1IBLK 2E5LK 1EE8A 3WNFA 4IBJA 4DG1A 4LF4K 1S6QA 5E84A 2C5RA 2LVAA 1S1TA 1Q86O 1JCFA 1TGOA 1EP4A 2HHHK 4QNMA 1TKDA 4CVNE 3CYMA 4CF0A 4JHDA 4H8KA 2E1YA 3H3OB 3BP8A 1XXHE 1GLNA 2VQFK 4II7A 4A61A 1G3IA 1J5EM 3DXKB 3NF8A 4BC2A 3DLEA 3C6HA 4G6ZA 4IG0A 3GPUA 3W3DA 3A5MC 3LANA 4B9NA 4LGYA 3KW6A 1DGHA 4DR3M 2WBNA 1Q9XA 3BBZA 4RW6A 2GNOA 1JB0F 1Y64A 1JQJC 1VRTA 2D1KA 3UB5A 3AA3A 5AZJB 1C0MA 4RTFD 2QWQA 3GPPA 5AQTA 1ZMUA 2Y0QA 5FTKA 1U2VA 5ADXA 3F73A 2IIRA 5LY3A 2Q97A 1K3XA 3MN7A 4BGAA 4NLCA 3AJIB 3CC7N 4B1YB 1N6QA 2HMIA 2Z3XA 5FLXS 2KEBA 3AO5A 1SXJD 2HVHA 1XHZA 1RBTA 3EZ5A 5FPEA 3SI6A 2WSCF 3A5OC 4CJ4A 1WSHA 1HLUA 2HHVA 1ZQ9A 2YCHA 4OPHA 3EYZA 4ID5A 4DF4A 3C6TA 3D6RA 5CZ2A 2X49A 4L3QA 2NRVA 4RW7A 2RGHA 3U6LA 1K82A 2GX9A 1QDRA 4LGMA 4KHWA 1VQ9N 4B9LA 4KTQA 3CERA 4KI6A 1S1WA 4CJUA 1C0TA 4Z8XA 1IBKK 4EHTA 1VQPN 3U5ZB 4FJXA 1QQWA 3VQ8A 5AQQA 3FZKA 3FTEA 1DV0A 4FXDA 3KTQA 3T38A 2Z1HA 1NKCA 3TI0A 1X9JA 1X9SA 5ITXE 2FFJA 2J4RA 3QFUA 3K57A 4YOTA 3SAFA 3J2PB 1BG3A 2CV0A 1C1KA 4B3MM 4CGJA 3VGLA 3VDUA 1TR8A 2G3QA 2KLAA 3L6QA 3RR8A 4B3RM 4LZJA 2R7YA 2P5TA 1HUXA 3QIPA 4O44A 1IXZA 3SUOA 2UU9K 3DM2A 1T05A 4BREA 3MCPA 3AVCA 4J2AA 4NO7A 2GWKA 3SHGB 2NZTA 2R65A 4JKCA 4KRFA 3LAKA 1JLFA 3LVWA 2PBDA 4IJFA 5AQMA 4DTSA 4RCHA 1WXQA 5A2QS 3HTVA 4JN6A 1NHGC 3RSEA 3KFUG 1P90A 2NRRA 2G8WA 1OH7A 3GLIE 4C23A 1K8AO 4X62K 2PZSA 1VAZA 3HVRA 1TK5A 3ASMA 4OPKA 1G71A 2HAKA 2KXEA 4DSIA 1OIPA 1HJOA 2CHVA 2P5OA 4B3TK 3CQYA 2JWSA 4FJGA 2DHYA 2JWKA 3T19A 1WB9A 4BDPA 1J09A 5C0YA 4A57A 3PXGA 4OX9M 3DXKA 4FJKA 4GMQA 1BISA 4B1ZA 1HNWK 4LH5A 4LF8K 1T6DA 1GOBA 4RF1A 4IIWA 3MWPA 3NF9A 4X62M 4K41A 3VFDA 3C58A 3ATUA 3QMLA 4AQYM 4A2AA 3DOAA 2HSTA 3EE9A 5JLFA 5IWAM 4KBOA 3SATA 4JKFA 1Q39A 3T1HK 2L7IA 5F1XA 4BRPA 3NBXX 2F9WA 4IJNA 4X64K 1PJJA 5BPNA 1Q02A 1YJ9N 3QYEA 4AKGA 2ERCA 2CV1A 4WYBA 2JUJA 3SYKA 2HBJA 4FJ5A 4U67L 1SKWA 2P51A 1TGUA 1VSFA 3DRPA 1BL3A 1Y97A 3H08A 1V4SA 2PY5A 5DMRA 4FZYA 3GQ4A 1HNWM 4BR2A 2X4AA 2P9SA 3GRVA 3HRGA 1F21A 2IDOA 3KK3A 1XXHB 3I4YA 4HHTA 5GKNA 4I2QA 4FLVA 3K5OA 3OW2M 2WFBA 3PSIA 4CJ6A 3T1HM 5EJCA 2G8IA 4DV7M 3W0FA 1SV5A 1NGGA 2B5JA 2GWJA 2FXUA 2YJFA 2BUPA 5AFUH 4IKFA 4E1MA 3FLCO 2OPPA 3LQQA 4LZZA 1RCHA 3GBTA 4G3OA 7CATA 4BGBA 1DGGA 3PX0A 4XH1A 2GQFA 5C18A 2FBYA 2WZJA 2FE8A 1NGHA 1XC3A 2QWMA 2Z7JA 1PJTA 4FL9A 1Q7YO 2JZ1A 3BF3A 1WBBA 4CEFA 5IT9O 4DQQA 4DV1M 4LJ7A 5EU7A 2Z8YM 4CE9A 4OVZB 1GJSA 4AG5A 4NRWA 2LVPC 3ENOA 1VSDA 2IGIA 1TV6A 2ASPA 4EP4A 4M3WA 3PO5A 2L4EA 3IG1A 2LHGA 2R62A 3WT0A 4B9TA 2W41A 3MEGA 1KVCA 5FRNA 4N5SA 2YNFA 3VQCA 3AO1A 2UUBM 2WONA 1EQYA 3CD6N 4WQ4A 4LF6M 1ATRA 1W0HA 1BOTO 5KGWA 2A41A 3F92A 4FWKA 4K8XA 5EXXA 4K0KM 3CCSN 1SG9A 3WEEA 3G0ZA 4F3OA 1Z6RA 1HNVA 1OIZA 4CZLA 4M3YA 3AY9A 4LF9K 4DTMA 2J7NA 4DTOA 1QVGM 4IFEA 1J5OA 3PIPL 3WEEB 4DUYK 1W5TA 5FTLA 4DS5A 2BWEA 1RT5A 4KB0A 1V92A 2ZAMA 3CETA 4LFBK 3UGJA 1I39A 3A46A 1E4FT 4H0TB 3CCQN 1VRUA 1T8EA 1JR3A 3THYB 3PNVA 3L26A 4YHHK 5ITTA 2QXLA 1T44A 3UZUA 4H0XB 3G6EN 4CEBA 4M9XA 1ZYQA 4M9SA 2OPRA 1S3XA 4WURA 4FWMA 4CK1A 5LMUM 1QSSA 1G4AE 5BR8M 5KTQA 1U6ZA 1GLDG 3HJFA 2RE2A 2EKKA 1NGAA 4LF7M 4LF5K 2VDBB 4AHCA 3S9HA 3WNHA 4O0IA 4CHZA 2QNJA 2OZSA 2EJSA 4GRIA 2GUPA 4OJRA 5AZJA 3KD5E 2G8UA 2QENA 1K8KB 1NWKA 5LL6Z 4B7FA 4CFCA 2F5SA 4E7JA 3E9SA 3M3ZA 1GLBG 4AM7A 4DR6K 1RBRA 4CGDA 1TH3A 2MH8A 3IAYA 1MN3A 5CZ1A
chains in the Genus database with same CATH topology
1KAYA 2C99A 1Q18A 3LDLA 1G8PA 5AQSA 2QM1A 4H03B 4FCWA 4JKGB 4H5WA 2ZM6M 3RFWA 3I51A 4LFAM 3NVKA 1R59O 2C9CA 2YR0A 2YNMD 4XH4A 3R9XB 3CCRN 1DGHB 3UK6A 3ULEA 4ILHA 2WUSA 2QCUA 4CD3A 1QAOA 5LJWA 2FLOA 1HPMA 3ULEB 3MJ5A 5C15A 4HL4A 5C1BA 4DR1M 4NOOB 1L2CA 2UU9M 5FTMA 3D2EB 3RGPA 8CATA 1MA9B 3TTCA 4IBDA 4BR0A 4JD2B 4WFNL 1BA1A 4OW0A 1J7KA 3GLIB 2UYTA 3CMAN 3FUTA 2CH5A 3U60A 4IBGA 2QWPA 4CZIA 4L78A 2KZSA 3O9SA 5LJVA 1L1TA 1HT2E 1LOTB 5B8HA 4YOXA 2A6AA 2YFQA 3SAWA 5AQHA 4JAXA 4CZGA 3U6DA 3AV0A 2P9SB 3GLGA 1GLAG 2LH0A 4B1UB 4CBWA 1E32A 1YAGA 4B3TM 4LF9M 3UKRA 5GAGP 2CGJA 1GL6A 3I4VA 4JK8A 2XLJA 3CCMN 4QHSA 4LFCM 2OTJN 2DHRA 1K8KA 4O8UA 1IN6A 2KKZA 3HU3A 4BG8A 4CBUA 5HOOA 1OFIA 4EAHD 1S3SA 4IBIA 4IBEA 1ZXOA 2D7EA 5KQDA 3J8AA 4HWIA 3DXMA 3ZC7B 3JR4A 3GLIA 3C0BA 2VGMA 4DR6M 1LV7A 3O5BA 1IM2A 4LC9B 5FPDA 4CISA 1JJ2M 3PFIA 3GLHB 1VQ5N 4IO8A 1NGDA 3WXKA 3SHFA 3RSEB 3ZETA 2H3GX 2IVOA 5E6JA 4FWPA 2J7OA 3U6QA 4BRDA 5GINA 3SBGA 3AL0C 5FTJA 3NBIA 1IJJA 3L25A 1G59A 3GPXA 3M6AA 2D4WA 2QTDA 3CJ1A 4AZFA 5C2DA 2E2NA 5BPLA 2FF3B 2CV2A 3J27B 4KH5A 5C10A 1PM5A 2DWZB 5ADXH 5EP1A 3LDPA 3VETA 3G4SN 2CHGA 5AQIA 3WXIA 4QS9A 5AQRA 1GLCG 4DV6M 4OO1J 4TUWA 2QW9A 3I8BA 1Q82O 3AOEA 3ZH9B 3GDQA 4MLEA 3FYDA 2XEPA 3QAUA 2V1UA 1ESVA 2RGOA 2Z4RA 4QHTA 4MO4A 4YOWA 3SBJA 4YDUC 2QPAA 2OQ4A 4UY8O 3HJSA 3TWMA 4JEPA 5FPMA 4QOZC 3LDQA 3GRYA 1UM8A 1Q81O 3WUHA 3K2LA 1U2VB 4BR9A 3QB0A 3U4LA 3QDKA 2HL7A 4GC9A 4FSVA 3J80S 2JWLA 2NRTA 3O8MA 3FZHA 1QQNA 4I8OA 4DR2M 2P9NA 3ZX0A 1YJNN 5ITUA 2F5QA 5JMVA 1NGJA 4H0YB 4YDUA 4M0DA 2E8AA 3P4IA 2UUCM 5AQGA 4WQ4C 3K9JA 2Q2EB 3D7EO 3VTIA 3WHKA 3CC4N 3ILKA 4U7BA 4JI4M 5AQXA 4IBCA 3VMFB 5BN9A 3FUXA 4JI0M 4EHUA 3WXJA 4GC5A 3UE5A 1QVFM 4JKGA 3DXMB 4H5RA 3E1YA 1NGEA 3GLFA 1IY1A 2ASMA 2A5XA 4H5NA 3O08A 2E2OA 3MMVA 4G4QA 2RHKA 3DWLA 2ZBKB 5TKYA 4FCTA 5JI3E 4BLCA 2XZFA 3RE8A 5HL7L 3ZETB 1K73O 3C7NB 2Y0TA 4JN4A 1OFHA 3DA1A 4REZA 1DEJA 1HQCA 3ZX3A 2ZJQL 4IJAA 5F2RA 3OA9A 4B1VA 2HMPA 3O80A 1E4GT 2HOEA 3HBTA 1QAMA 2YI1A 4YOVA 2F5OA 4DB3A 3HJ8A 4IBFA 3AARA 5AQLA 3ATVA 4L4UA 5BR9A 4GITA 3CIPA 4YOYA 2I7NA 1N34M 2QWRA 4BB9A 5TKWA 4GV6A 4PKGA 2P9KB 5BPVA 4DUZM 2NRZA 3BUZB 4GIPA 5GIOA 5EP3A 3JAMS 2AA4A 3U9ZA 3EIHA 3U6OA 3GRRA 2ITMA 2R4EA 5AZIB 3O9TA 3U61B 1HKCA 4B9QA 3W0LA 3JS6A 3CCVN 4G4OA 2FSKA 4DUYM 3O6WA 4BRKA 5DM7L 5EXTA 4FWSA 1HT1E 3U61A 5I9EB 5AQUA 5C2FA 3FTDA 4LG2A 2ZF5O 3CCLN 3HU2A 1FJGM 3I56N 3VTHA 4NLBA 3SMPA 4DV5M 3ENBA 2DVWB 3HKPA 4CHTB 3WHLA 3GLHA 1M90O 1GL7A 4JK7A 1QZ5A 1YUWA 1YSYA 1X3MA 3CPEA 4O5FA 3C6AA 4KH4A 3BF1A 4H5VA 3HHYA 2ZJRL 3C65A 5BRFA 4A5AA 4AF1A 5C12A 3SJHA 4C1NI 2XSZA 1R2ZA 4RF0A 2AP1A 2L7HA 4MDAA 1IBKM 2K47A 4JI7M 3K8ZA 1OKJA 3R8EA 1N78A 3ZYYX 1VQON 3GL1A 3NWLA 4NL4H 3CI5A 2P9IB 3CJ7A 4I81A 1NHWC 3VESA 3VENA 2Z4SA 1TDHA 1YF5L 3MX2A 3VEOA 5JVHL 1NJGA 4FWQA 2HBKA 3O9RA 2E5LM 1HKBA 3TTFA 3D2EA 1GLEG 2ZGYA 3FZFA 1QQMA 3FR0A 3FTFA 3ZX2A 5M1QA 1G41A 3VKGA 3TTDA 3IG8A 2G8LA 3THGA 4KO8A 5CE3A 3CCUN 4JK9A 4BR5A 3GPYA 1VQ4N 3QBWA 3P38A 1JR3D 3AOGA 5FTNA 5BPMA 2EA0A 4IO9L 3CJCA 2Q2RA 1DGBA 3LDOA 3VKHA 2P9UA 3D2FA 4AI6A 4CI6A 3F9MA 3O1BA 3RVCA 2LNHC 4KHPM 3LQRA 3SARA 2CGKA 3WXLA 2ASOA 2YJEA 4OPAA 2YHXA 3EO3A 3UJNA 4FOEA 4XBOA 1VQ6N 3UKUA 4JHDB 5AQYA 4NXMM 5IREB 3TE6A 3TL4X 5KPZA 3FZLA 5FPNA 4LJ9A 3OHRA 3T15A 3U6SA 1QVRA 2R45A 4AG6A 5GAEP 4NSOB 3SAVA 1ORYB 4FO0A 5ITXA 4WW0A 3LM2A 1L1ZA 2E1ZA 4NB4A 4NSRA 4HTLA 4GKJM 1BU6O 1KQSM 1SXJB 5AQOA 2XFTA 3KP1E 1HNXM 4BC3A 3K9KA 1N36M 2VIIA 3MX5A 4DR4M 3FD9A 4KODA 4IBKA 4MLHA 3SK3A 3EKUA 4JI3M 5H1SQ 4GVEA 4JKBA 3I55N 5JI2E 3GQ5A 2D0PA 4K25A 3MN6A 3TSPA 4NRVA 1Z5AA 3R6MA 2YQZA 4G9ZA 3A42A 1HNZM 1WUAA 4BQZA 1QZMA 2YHWA 5JLHA 2NRHA 2BJWA 3E9LA 1I4WA 1XUPO 1MWMA 3H1VX 4A2BA 5H37D 3KWIA 2XZUA 2DWMA 1RFQA 3A5LC 5AZIA 3H1QA 3CCEN 1R7RA 4GHAA 3M5RA 4L16A 1HR0M 2KHOA 3EIEA 3R9PA 3T1YM 3QWLA 2GELA 4X64M 2DZNB 4JYAM 2F5NA 1TUUA 3LM9A 4JI1M 5F3WA 4ILJA 3CF2A 5EXPA 4H0VB 1BUPA 2HBMA 4CJ7A 4A59A 1MWKA 1TH4A 5LMNM 4LJ8A 2P9PB 2QZ4A 4M7XA 3GOIA 4AKIA 4PDIA 3CF6E 4BR7A 1XXHA 4B1WB 3HM8A 4EIAA 2YHYA 2QWOA 3WQTA 3MN9A 1MX0A 4DR5M 5BN8A 1NNJA 2H1RA 3HU1A 2F5PA 4PL8A 3TSUA 1T6CA 3O1WA 2R4JA 3MK6A 4GH9A 1L8QA 3BOSA 2QBYB 3ZEUB 3CF5L 3DLLL 4BR4A 1NVMA 1D2NA 5EX5A 5ITYA 1SAZA 3H3NO 5KPTA 5JVGL 3J7ZO 2DWLA 1QAQA 4DR7M 3L29A 4B7GA 1E9SA 3K92A 2QI2A 3KWGA 1SS6A 1H6UA 2F7TA 2V51B 4FOIA 4RNAA 2CHQA 3WQUA 2CGLA 1N77A 3A0IX 3FUWA 5AQFA 4GV9A 3UMMA 3J7BA 4QOSA 4BRQA 1X37A 1KAXA 3VF6A 5FSWA 1C0GA 4BVOA 3L4QA 1XNQM 3E66A 3SAHA 1TDZA 4LF4M 4DV4M 1IY2A 4HLQA 4FW9A 2NRWA 2P9UB 1QANA 5DNYA 1K3WA 2UXDM 1IXRC 3KSJA 3KZBA 2KA6B 1J6ZA 3MHVC 5EP2A 1VQKN 2DWNA 3DFZA 3KK7A 4YOUA 3CJAA 3HGIA 5AFUA 5KO3A 3F5TA 1TUYA 5AQJA 1IN7A 3CF0A 1ZAEA 2KRKA 2I7PA 1YI2N 3KOYE 1IQPA 4EFHA 3VK8A 4IEEA 3UKRB 2QEXN 4JV5M 4G4RA 3U8XA 1X3NA 3PVSA 1R2YA 3IKMA 5BRDA 3VK7A 3WXMB 4BRAA 3O4WA 4MM3B 4B7HA 1LCUA 2PFUA 3FFKB 4D82A 1D4XA 3KDSE 4CZEA 2E88A 1YVNA 1KD1O 4W5WA 3ZEUA 5KPRA 3U6CA 1CZAN 1GLJO 2V52B 3CJ9A 2AHMA 4KLNA 3B8AX 2R46A 3TPZA 1NJIO 3E9OA 2HF4A 3EZWA 4I5SA 2IVNA 4NXNM 2A40A 1GVNA 3VOVA 1NNUC 1XNRM 4DQ8A 2HCBA 2P9LA 4IEIA 3HHZA 3P39A 4CZHA 2XGNA 1NM1A 5IT9S 5M1KA 2P9PA 1S72N 5M1FA 4BRMA 2EO2A 3HSCA 4IJEA 1SXJE 1GLFO 2E2PA 2QA4N 4D80A 1T3TA 5EQTA 4MDBA 3OBYA 3FZMA 4M63C 5M1NA 3B9PA 4GV3A 3HWSA 4FWDA 3IG5A 3U6MA 4JKEA 1PJIA 4IDHA 2VGNA 4IOXA 1T3VA 4BROA 4GY2B 2NLXA 5AQKA 4JI2M 3KOZE 2C98A 4I4LA 3GP1A 5BRHA 4GKKM 1NLVA 4BC5A 3E9PA 3LDNA 4CZJA 3GQ3A 3KOXE 4IXCA 3I33A 3GLFB 1Q3BA 4OVZA 3K1JA 1NGFA 3PNYA 4PHTX 3EE8A 5EXSA 3GLGB 1XMOM 2P9NB 3VF4A 4GHLA 3G25A 3P31A 1NGIA 4CBXA 3ID8A 3CXCM 3DJCA 4M9ZA 4ZPXA 3TSQA 4JI8M 4JXJA 5BREA 4BRIA 3FUVA 1DKGD 4FVMA 1Z05A 3M7GA 1YIJN 3J7AS 2FSNA 4WF9L 5ITQA 4CGYB 3M6GA 3IMXA 4AKHA 2C96A 1XHBA 3R8FA 2FOIC 4BRLA 3L27A 4A5BA 1Z6TA 2R18A 1IBMM 1N32M 4A62A 2V7ZA 2M5ZA 3VGKA 3VF2A 2A5YB 4LF5M 3VEXA 5M1OA 3SFZA 4B1XB 4EIWA 1L2DA 4I6MA 3U60B 3EKSA 4BBAA 3A45A 2EUCA 1GLLO 5KQ8A 4PKHA 2OPFA 3N4PA 1K9MO 3GRUA 2CH6A 3D2FB 1QYRA 3VEWA 1VQMN 4L8RC 3GO8A 4D81A 3U6PA 2CE7A 4YY3M 4B08A 4Z94A 1KC8O 2C9OA 4AW4A 2JA2A 4JKDA 4RWTA 5ITRA 3CCJN 3HHWA 1I94M 2QWLA 5EXWA 3UKUB 4F9OA 4YHHM 3ENHA 3IUCA 4H5TA 2CFOA 3NVMA 5CHIA 1XQSC 2L09A 1V4TA 5AQWA 4I6MB 1VQLN 4IZ9A 4ISEA 5AQNA 4ISFA 3IFRA 2UXCM 4PCZA 4Y0WA 3H6EA 2ZJPL 2P9LB 2Y21A 3AAPA 3HI0A 1DT9A 3MCAB 4ITQA 3SYLA 4LY6A 4G4NA 2L6OA 3VLFB 2D0OA 4ILGB 3GE1A 3U9DA 4WQ5A 3SC3A 2A3ZA 3C7NA 3CPWM 1KYIA 3AAQA 4DV0M 4FD2A 1E9RA 1S22A 4BG9A 1Z5BA 4K43A 4WFAL 3KS8A 1TYQB 4DCHA 3NMUA 4OU7A 1DO0A 4MGYE 3CQXA 3MWTA 2XSZD 3U5ZA 1NY5A 2EWSA 4FWLA 5JICA 4P16A 4BRHA 4PL7A 4Z6YA 1Z59A 1ZBSA 2F4VM 2E2QA 5GIPA 3T69A 4K42A 4MGZE 4B3SM 1NY6A 3A98B 2VQFM 5AR0A 4DV2M 3EL2A 3IDHA 3QFPA 2ZWHA 4LRSA 4H0OA 4GNIA 2HBLA 1YUBA 4IWVA 3OTOM 1O13A 3KVWA 3KHYA 3TWLA 1DGFA 5DYGA 3KXEC 3R3LA 5E26A 3EN9A 4QS7A 3CMEN 4S12A 5AQPA 2V1CA 1IN4A 3ZCBB 2GTDA 3AOEC 1QQOA 2XH9A 3Q7CA 3CTWB 2UXBM 1SXJA 2X8AA 2PAVA 3QICA 2CEAA 2VQEM 2Q0UA 4BRNA 4JD2A 3SASA 4JI6M 4CZKA 2NQ8C 3KSXA 1IY0A 3F2KA 1NSFA 4X66M 1DO2A 4BRCA 3BEXA 3VDPA 3SAGA 2Q1NA 3L28A 4FPAA 1KSFX 1YHQN 4MGIE 2G5GX 2BTFA 4XEIA 3JR5A 1R6BX 1NMDA 3SMSA 1BWFO 2E20A 1YJWN 2HF3A 2W82A 3GG4A 1WOQA 2Q36A 4E1JA 2FSJA 3JXUA 1L2BA 2FNAA 1JCEA 2CUZA 2RKOA 3FGUA 3KOWE 2VYPA 1BDGA 2BJVA 3VGMA 3SBTA 1SQKA 4DKWA 2KZUA 4CZFA 4FWNA 2HKJA 4R7GA 3CC2N 3A8YA 4WFBL 1W2BM 4R79A 1HKGA 4LF8M 1RDUA 3H4MA 1ATSA 3R1XA 3HJQA 1ATNA 4IOAL 4XH5A 4MB7A 2Q31A 1XWIA 1MDUB 2P9IA 4JKAA 3VPZA 4QNRA 5GADP 3KS4A 2OANA 2DXIA 3OBWA 4JNEA 1ZC6A 4AM6A 2XFSA 2QP9X 3QBXA 3E4RA 3HOSA 1VQ7N 1H1VA 4LFBM 3U6EA 3DAWA 1TYQA 1HQYE 3O9UA 1XC8A 4M0WA 4PDGA 1E94E 3M0EA 4PD2A 4FWOA 1TH2A 1SXJC 4LRTA 2OTLN 2NNWA 1ILYA 5AQVA 3SAUA 1KAZA 3HZ6A 2ZAOA 4L15A 2M60A 3HHXA 3S41A 4MO5A 4WQ5C 5EVZA 2BH1A 2VWBA 1YE9A 3N4QA 1NBWA 3O9QA 4KH6A 4BVPA 4BRFA 1G99A 4QS8A 4ISGA 2GEMA 3VEVA 4R3DA 3Q8XA 4MH0E 4H0PA 4FWRA 3PLAA 3AKZA 1HX1A 1W97L 5DM6L 3VEZA 3FKEA 3L2AA 2UUAM 3D8LA 1Z5CA 4YORA 4CZMA 3AGRA 1OJLA 3ID6A 2IVPA 3HOTA 2FF6A 5MLCQ 1N33M 2V6ZM 1VQ8N 3W0LB 3FYCA 1P8ZA 2LWXA 5ELZA 4X65M 3TPQA 1BA0A 1IG8A 5IZ7D 1IXSB 3PIOL 4FVUA 3FUUA 3G71N 2P9KA 2DPNA 4BY9C 3RGSA 4JKHA 1IN8A 1JCGA 2ZGZA 2ZANA 3FE1A 3KP0E 1QHAA 3VERA 1NGCA 2NRXA 2XF3A 5EOYA 4BQLA 3AFHA 1C0FA 2WC9A 1NGBA 3L0QA 2D7GA 4DV3M 1BO5O 4J8FA 2O5RA 5AQZA 2VCPA 4BC4A 4PT5A 4CD1A 4IOCL 5GAHP 3D8BA 4LJ4A 1IN5A 1RGIA 3VEYA 1YITN 3FTCA 3LL3A 4MGHA 1RDWX 1GKIA 1YXQA 3MN5A 3CHWA 2F9TA 1KXPA 4DHYA 2BNKA 4LJ5A 4MGKE 4A3VB 1M1KO 3SLCA 4O8KA 5EY4A 1EO1A 1FNNA 3KVGA 3H46O 3CJBA 3TQSA 3LVVA 2KRUA 3L4IA 2A42A 1W5SA 4M7YA 5CR4A 2W40A 2D7HA 2QWNA 4FCVA 4FWHA 5DYIA 1NJFA 3AGKA 4C1NK 1DGKN 4LJAA 1QZ6A 1OVYA 2Y20A 3MDQA 5EP4A 3T7ZA 3Q7BA 4FPBA 1VDDA 1IBLM 4FWGA 2YX6A 3J81S 4LCBA 1N8RO 2LXEA 4WCEL 2V7YA 4PKIA 5M1PA 3LMMA 4IBBA 3H45C 4JI5M 3TU5A 4LJ6A 1MU5A 2Q0RA 3M1FA 2HHHM 3DZDA 4XGIA 3TWKA 1VQNN 2DZOB 1SZ2A 2QBYA 1N75A 2KW0A 3A5NC 1XMQM 1Q3CA 5F0XA 4BRGA 1KFVA 1EE8A 4IBJA 5E84A 2C5RA 1Q86O 1JCFA 4QNMA 4JHDA 2E1YA 3H3OB 3BP8A 1GLNA 4II7A 4A61A 1G3IA 1J5EM 3DXKB 4BC2A 3C6HA 4G6ZA 3GPUA 3W3DA 3A5MC 4LGYA 3KW6A 1DGHA 4DR3M 2WBNA 1Y64A 1JQJC 3UB5A 2D1KA 5AZJB 4RTFD 2QWQA 5AQTA 3GPPA 2Y0QA 5FTKA 1U2VA 5ADXA 2IIRA 5LY3A 2Q97A 1K3XA 3MN7A 4BGAA 4NLCA 3AJIB 3CC7N 4B1YB 2Z3XA 5FLXS 2KEBA 1SXJD 5FPEA 3A5OC 1HLUA 1ZQ9A 2YCHA 4OPHA 3D6RA 2X49A 4L3QA 2NRVA 2RGHA 3U6LA 1K82A 2GX9A 4LGMA 1VQ9N 3CERA 4Z8XA 4EHTA 1VQPN 3U5ZB 1QQWA 5AQQA 3FZKA 3FTEA 3T38A 1X9JA 5ITXE 2FFJA 2J4RA 3QFUA 4YOTA 3SAFA 3J2PB 1BG3A 2CV0A 1C1KA 4B3MM 3VGLA 3VDUA 2KLAA 3L6QA 4B3RM 4LZJA 2P5TA 1HUXA 1IXZA 4BREA 3MCPA 4NO7A 2GWKA 3SHGB 2NZTA 2R65A 4JKCA 3LVWA 2PBDA 4IJFA 5AQMA 4RCHA 1WXQA 5A2QS 3HTVA 4JN6A 1NHGC 3RSEA 3KFUG 1P90A 2NRRA 1K8AO 4C23A 1VAZA 2KXEA 1HJOA 2CHVA 3CQYA 2JWKA 1J09A 5C0YA 4A57A 3PXGA 4OX9M 3DXKA 4GMQA 4B1ZA 1T6DA 4RF1A 3MWPA 4IIWA 4K41A 4X62M 3VFDA 3C58A 3ATUA 3QMLA 4AQYM 4A2AA 3DOAA 2HSTA 3EE9A 5JLFA 5IWAM 4KBOA 3SATA 4JKFA 1Q39A 2L7IA 5F1XA 4BRPA 4IJNA 2F9WA 1PJJA 5BPNA 1YJ9N 4AKGA 2ERCA 2CV1A 4WYBA 3SYKA 2HBJA 4U67L 1TGUA 1V4SA 3GQ4A 1HNWM 4BR2A 2X4AA 2P9SA 3GRVA 3HRGA 1XXHB 3I4YA 5GKNA 3OW2M 2WFBA 3T1HM 5EJCA 4DV7M 3W0FA 1NGGA 2GWJA 2FXUA 2YJFA 2BUPA 5AFUH 3FLCO 3LQQA 4LZZA 3GBTA 7CATA 4BGBA 1DGGA 4XH1A 5C18A 2FE8A 1NGHA 1XC3A 2QWMA 2Z7JA 4FL9A 1Q7YO 3BF3A 4DV1M 4LJ7A 4OVZB 4AG5A 4NRWA 3ENOA 2ASPA 2R62A 3WT0A 2W41A 2UUBM 1EQYA 3CD6N 4WQ4A 4LF6M 1ATRA 1BOTO 2A41A 4FWKA 5EXXA 4K0KM 3CCSN 3WEEA 1Z6RA 4CZLA 3AY9A 2J7NA 1QVGM 4IFEA 3PIPL 3WEEB 1W5TA 5FTLA 2ZAMA 3CETA 3UGJA 3A46A 1E4FT 4H0TB 3CCQN 1JR3A 3PNVA 3L26A 5ITTA 2QXLA 1T44A 3UZUA 4H0XB 3G6EN 4M9XA 4M9SA 1S3XA 4WURA 4FWMA 5LMUM 1G4AE 5BR8M 1U6ZA 1GLDG 2RE2A 1NGAA 4LF7M 4GRIA 2GUPA 5AZJA 2QENA 1K8KB 1NWKA 4B7FA 2F5SA 3E9SA 3M3ZA 1GLBG 4AM7A 1TH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA0 A;  1IG8 A;  1KAY A;  3VF4 A;  2P9N B;  1Q18 A;  3G25 A;  3LDL A;  3VEO A;  2P9K A;  1NGI A;  2DPN A;  5AQS A;  2QM1 A;  4H03 B;  4FWQ A;  4CBX A;  3ID8 A;  1JCG A;  3DJC A;  2ZGZ A;  1HKB A;  4H5W A;  3FE1 A;  3D2E A;  1GLE G;  1QHA A;  2ZGY A;  3VER A;  5BRE A;  1R59 O;  4BRI A;  1NGC A;  3FZF A;  1QQM A;  5EOY A;  4BQL A;  3FR0 A;  1DKG D;  1C0F A;  3ZX2 A;  4XH4 A;  1Z05 A;  3ULE A;  1NGB A;  3L0Q A;  2WUS A;  1BO5 O;  4J8F A;  5CE3 A;  2FSN A;  5AQZ A;  4CD3 A;  4BR5 A;  5LJW A;  2VCP A;  3M6G A;  2FLO A;  1HPM A;  3IMX A;  3QBW A;  3ULE B;  4BC4 A;  4CD1 A;  4BRL A;  5BPM A;  1RGI A;  3VEY A;  3CJC A;  3D2E B;  1MA9 B;  2Q2R A;  3LL3 A;  4BR0 A;  4JD2 B;  1RDW X;  1BA1 A;  1YXQ A;  3LDO A;  2P9U A;  3D2F A;  3MN5 A;  4A62 A;  3CHW A;  2UYT A;  4CI6 A;  3F9M A;  2V7Z A;  2F9T A;  1KXP A;  3O1B A;  3VGK A;  3VF2 A;  4DHY A;  3VEX A;  2CH5 A;  2CGK A;  3WXL A;  2QWP A;  2ASO A;  2YJE A;  2YHX A;  3EO3 A;  4B1X B;  3SLC A;  4CZI A;  5LJV A;  4FOE A;  4O8K A;  5EY4 A;  1LOT B;  4I6M A;  3UKU A;  5B8H A;  2A6A A;  4JHD B;  5AQY A;  3EKS A;  5AQH A;  4JAX A;  5KPZ A;  3FZL A;  3H46 O;  3KVG A;  4CZG A;  2P9S B;  3CJB A;  1GLL O;  5KQ8 A;  1GLA G;  5FPN A;  4PKH A;  3OHR A;  3L4I A;  4B1U B;  4CBW A;  1YAG A;  2A42 A;  4M7Y A;  3UKR A;  2CH6 A;  3D2F B;  3VEW A;  2W40 A;  2CGJ A;  2QWN A;  4FO0 A;  3LM2 A;  2E1Z A;  4NB4 A;  4Z94 A;  1DGK N;  4HTL A;  4RWT A;  1BU6 O;  1K8K A;  2QWL A;  5EXW A;  3UKU B;  1QZ6 A;  4F9O A;  5AQO A;  4BG8 A;  3ENH A;  3IUC A;  3MDQ A;  4H5T A;  4CBU A;  1XQS C;  1V4T A;  5AQW A;  4BC3 A;  4FPB A;  4I6M B;  4IZ9 A;  4ISE A;  4EAH D;  5AQN A;  4ISF A;  3IFR A;  1ZXO A;  2V7Y A;  5KQD A;  3J8A A;  3EKU A;  4MLH A;  4PKI A;  3SK3 A;  3VEN A;  4HWI A;  3H45 C;  4Y0W A;  3H6E A;  3TU5 A;  2Q0R A;  3M1F A;  2P9L B;  3DXM A;  3C0B A;  2D0P A;  3AAP A;  4K25 A;  3HI0 A;  3MN6 A;  3O5B A;  1SZ2 A;  3R6M A;  3A5N C;  2D0O A;  4LC9 B;  5FPD A;  1WUA A;  4BQZ A;  2YHW A;  3GE1 A;  5F0X A;  5JLH A;  3U9D A;  4BRG A;  4WQ5 A;  2NRH A;  4IO8 A;  1NGD A;  1XUP O;  1MWM A;  3WXK A;  3RSE B;  2A3Z A;  3ZET A;  2H3G X;  2IVO A;  3H1V X;  4FWP A;  3C7N A;  4A2B A;  3AAQ A;  5E84 A;  1JCF A;  1S22 A;  4BG9 A;  1RFQ A;  3A5L C;  5AZI A;  4BRD A;  4K43 A;  1TYQ B;  3H1Q A;  4JHD A;  4DCH A;  2E1Y A;  3H3O B;  3BP8 A;  1IJJ A;  4A61 A;  2KHO A;  3DXK B;  3R9P A;  4BC2 A;  3CQX A;  2D4W A;  3W3D A;  3A5M C;  2EWS A;  2GEL A;  4FWL A;  3CJ1 A;  5JIC A;  1TUU A;  1Y64 A;  2E2N A;  3LM9 A;  5BPL A;  2FF3 B;  3UB5 A;  2D1K A;  4BRH A;  4PL7 A;  5AZJ B;  4RTF D;  2QWQ A;  1ZBS A;  5AQT A;  5ADX H;  3LDP A;  4H0V B;  3VET A;  1U2V A;  1BUP A;  5ADX A;  2E2Q A;  5AQI A;  2IIR A;  3WXI A;  4CJ7 A;  2Q97 A;  1MWK A;  4QS9 A;  3MN7 A;  5AQR A;  1GLC G;  4BGA A;  5LY3 A;  4K42 A;  2QW9 A;  3I8B A;  3GDQ A;  2P9P B;  4MLE A;  4M7X A;  4B1Y B;  3GOI A;  4BR7 A;  5AR0 A;  1ESV A;  3EL2 A;  5FPE A;  4B1W B;  3HM8 A;  3IDH A;  4EIA A;  2YHY A;  3A5O C;  3QFP A;  2ZWH A;  2QWO A;  1HLU A;  4H0O A;  4MO4 A;  2YCH A;  3WQT A;  4GNI A;  3MN9 A;  4YDU C;  5BN8 A;  4L3Q A;  4IWV A;  4PL8 A;  3CER A;  3KHY A;  5FPM A;  1T6C A;  3LDQ A;  3O1W A;  3WUH A;  4EHT A;  3MK6 A;  1U2V B;  4BR9 A;  3QB0 A;  5AQQ A;  5E26 A;  3EN9 A;  3FZK A;  4QS7 A;  3U4L A;  3ZEU B;  3QDK A;  1X9J A;  4BR4 A;  2J4R A;  5AQP A;  3QFU A;  5EX5 A;  2GTD A;  4FSV A;  1BG3 A;  1QQO A;  3VGL A;  1SAZ A;  3H3N O;  3L6Q A;  3O8M A;  5KPT A;  3FZH A;  1QQN A;  1HUX A;  2P9N A;  3ZX0 A;  4BRE A;  3MCP A;  4NO7 A;  2GWK A;  2NZT A;  2PAV A;  1NGJ A;  3QIC A;  5JMV A;  4H0Y B;  4YDU A;  2E8A A;  2V51 B;  2Q0U A;  4BRN A;  2PBD A;  5AQM A;  4FOI A;  4JD2 A;  4RCH A;  3P4I A;  3HTV A;  3WQU A;  2CGL A;  3RSE A;  5AQG A;  3A0I X;  4WQ4 C;  4CZK A;  4C23 A;  3D7E O;  5AQF A;  4BRC A;  3BEX A;  5AQX A;  2Q1N A;  5BN9 A;  4FPA A;  4BRQ A;  1KAX A;  3VF6 A;  4EHU A;  1C0G A;  3WXJ A;  4BVO A;  2BTF A;  4XEI A;  3UE5 A;  1NMD A;  3DXM B;  1HJO A;  4H5R A;  3SMS A;  1BWF O;  3CQY A;  2E20 A;  1NGE A;  2HF3 A;  2ASM A;  2A5X A;  4H5N A;  3O08 A;  2E2O A;  3GG4 A;  3MMV A;  1WOQ A;  3DXK A;  2Q36 A;  4E1J A;  2FSJ A;  4B1Z A;  3DWL A;  3JXU A;  1T6D A;  2P9U B;  5TKY A;  4K41 A;  1JCE A;  3ATU A;  3QML A;  4A2A A;  3FGU A;  3KZB A;  5JLF A;  4KBO A;  3ZET B;  2VYP A;  1BDG A;  1J6Z A;  5F1X A;  4BRP A;  4IJN A;  2F9W A;  3C7N B;  3VGM A;  5BPN A;  4JN4 A;  3ZX3 A;  1DEJ A;  4WYB A;  4IJA A;  5F2R A;  1SQK A;  3CJA A;  4B1V A;  2HMP A;  5AFU A;  3O80 A;  1E4G T;  2HOE A;  3HBT A;  4CZF A;  2YI1 A;  4FWN A;  1TUY A;  5AQJ A;  1V4S A;  4DB3 A;  3AAR A;  5AQL A;  3ATV A;  3A8Y A;  5BR9 A;  3CIP A;  4BR2 A;  2I7N A;  2P9S A;  2I7P A;  1HKG A;  2QWR A;  1ATS A;  4EFH A;  3UKR B;  1ATN A;  4PKG A;  2P9K B;  4XH5 A;  1NGG A;  2GWJ A;  3U8X A;  2FXU A;  1X3N A;  2Q31 A;  2YJF A;  2BUP A;  5AFU H;  5BRD A;  4BRA A;  3O4W A;  3BUZ B;  3FLC O;  1MDU B;  2P9I A;  1LCU A;  3GBT A;  2AA4 A;  3U9Z A;  4BGB A;  3FFK B;  1D4X A;  3VPZ A;  4CZE A;  4XH1 A;  2E88 A;  1YVN A;  1NGH A;  2ITM A;  3ZEU A;  5KPR A;  1XC3 A;  2OAN A;  2QWM A;  5AZI B;  1CZA N;  4FL9 A;  4JNE A;  1ZC6 A;  4AM6 A;  3BF3 A;  1HKC A;  4B9Q A;  3W0L A;  3JS6 A;  3O6W A;  2FSK A;  1GLJ O;  4BRK A;  3QBX A;  2V52 B;  3CJ9 A;  3B8A X;  4FWS A;  1H1V A;  5I9E B;  3ENO A;  2HF4 A;  3EZW A;  5AQU A;  2ASP A;  3DAW A;  1TYQ A;  2IVN A;  2A40 A;  3WT0 A;  2W41 A;  3VOV A;  2ZF5 O;  4DQ8 A;  4FWO A;  2P9L A;  1EQY A;  3SMP A;  4WQ4 A;  1ATR A;  4CZH A;  5AQV A;  1BOT O;  1NM1 A;  1KAZ A;  2A41 A;  3HZ6 A;  4FWK A;  2P9P A;  3S41 A;  3WEE A;  4BRM A;  4MO5 A;  4WQ5 C;  3HSC A;  1Z6R A;  5EVZ A;  4CZL A;  2VWB A;  1GLF O;  2E2P A;  3AY9 A;  1QZ5 A;  1YUW A;  1NBW A;  1X3M A;  3WEE B;  4O5F A;  4BVP A;  4BRF A;  3FZM A;  1G99 A;  3BF1 A;  4M63 C;  4H5V A;  4QS8 A;  4ISG A;  2GEM A;  3VEV A;  3CET A;  5BRF A;  1E4F T;  4H0T B;  4H0P A;  4FWR A;  3SJH A;  1HX1 A;  2QXL A;  1T44 A;  4H0X B;  3VEZ A;  2AP1 A;  4BRO A;  1S3X A;  4FWM A;  4GY2 B;  2NLX A;  5AQK A;  1U6Z A;  4CZM A;  1GLD G;  1NGA A;  5BRH A;  2IVP A;  1NLV A;  2FF6 A;  1OKJ A;  3R8E A;  4BC5 A;  2GUP A;  5AZJ A;  3LDN A;  4CZJ A;  3GL1 A;  1NWK A;  1K8K B;  3I33 A;  4IXC A;  1P8Z A;  3M3Z A;  1GLB G;  4AM7 A;  5ELZ A;  3CI5 A;  2P9I B;  3CJ7 A;  1NGF A;  3VES A;  3TPQ A; 
#chains in the Genus database with same CATH topology
 3LPT A;  3FRI A;  1KAY A;  2C99 A;  3AVF A;  1Q18 A;  3LDL A;  1G8P A;  5AQS A;  2QM1 A;  4H03 B;  4FCW A;  1AUA A;  3LP3 A;  3ZSX A;  4JKG B;  1NJZ A;  3DLK A;  3ZT4 A;  2UXB K;  3O3G A;  4CJP A;  4H5W A;  2ZM6 M;  3RFW A;  3I51 A;  4B3O A;  4LFA M;  1S1X A;  3PX6 A;  2P5G A;  3NVK A;  1R59 O;  5K14 A;  2C9C A;  2YR0 A;  3LP0 A;  4AHS A;  3L2W A;  2VF7 A;  3HVT A;  2YNM D;  1WR1 B;  1N32 K;  4KHP K;  4JI6 K;  4XH4 A;  3R9X B;  1WLJ A;  4YFU A;  3CCR N;  1DGH B;  3UK6 A;  3ULE A;  4DFK A;  4ILH A;  4FLX A;  2WUS A;  2QCU A;  3V76 A;  4FZX C;  4CD3 A;  4CER A;  1QAO A;  5LJW A;  4CFB A;  2FLO A;  1HPM A;  3ULE B;  4J2B A;  3MJ5 A;  5C15 A;  4HL4 A;  2X6N A;  3NH1 A;  2IS3 A;  4B3R K;  5C1B A;  1S1U A;  3HK2 A;  4DR1 M;  4NOO B;  3LWM A;  2MJ5 B;  1L2C A;  2UU9 M;  3KLE A;  5FTM A;  1BQN A;  3D2E B;  3RGP A;  8CAT A;  1MA9 B;  3TTC A;  1TAQ A;  1UA0 A;  5J2M A;  3EY1 A;  4IBD A;  4BR0 A;  4JD2 B;  4C8N A;  4WFN L;  1BA1 A;  4OW0 A;  4OKJ A;  1J7K A;  2DY4 A;  3K59 A;  3GLI B;  2UYT A;  4PA1 A;  1RTD A;  3CMA N;  3FUT A;  2DTU A;  2JY6 B;  2DAE A;  2JY8 A;  2CH5 A;  3U60 A;  1EIJ A;  4IBG A;  4NYN A;  2QWP A;  4CZI A;  4L78 A;  2KZS A;  3O9S A;  5LJV A;  1L1T A;  1UA1 A;  2RRU A;  1HT2 E;  1LOT B;  3AVL A;  5B8H A;  2A6A A;  2YFQ A;  3SAW A;  4YOX A;  5AQH A;  1OH6 A;  2HW3 A;  4JAX A;  1J54 A;  5CY4 A;  4CZG A;  3U6D A;  3AV0 A;  2P9S B;  3GLG A;  1GLA G;  4I7F A;  3RTV A;  2LH0 A;  2B4J A;  4B1U B;  4CBW A;  1E32 A;  1YAG A;  4B3T M;  4LF9 M;  5DFL A;  4M42 A;  3AO4 A;  3UKR A;  3DRS A;  4DV4 K;  1VSI A;  5GAG P;  2CGJ A;  1LV5 A;  1GL6 A;  2BWB A;  3I4V A;  2BDP A;  2DKL A;  3AA5 X;  4JK8 A;  1B9F A;  2XLJ A;  4LY7 A;  3CCM N;  3THX B;  4QHS A;  4M3T A;  3MEE A;  4LFC M;  2OTJ N;  2DHR A;  1K8K A;  4O8U A;  2W42 A;  4AQY K;  2D0B A;  1IN6 A;  2KKZ A;  3HU3 A;  3TR8 A;  4BG8 A;  2CRU A;  4CBU A;  3TAF A;  5HOO A;  2MR9 A;  3V9Z A;  2B6A A;  4CF8 A;  5LMU K;  1JLG A;  1OFI A;  1XHX A;  4EAH D;  2DEN A;  4DU3 A;  4E3S A;  3TAQ A;  3SQ4 A;  1S3S A;  4IBI A;  4IBE A;  1ZXO A;  2D7E A;  5KQD A;  3J8A A;  2VQE K;  4HWI A;  1U48 A;  2YHA A;  2ZE2 A;  1Q8I A;  3DXM A;  1LAW A;  3ZC7 B;  3JR4 A;  3GLI A;  3C0B A;  2VGM A;  4DR6 M;  3LWL A;  2XRI A;  1LV7 A;  4DFJ A;  1J5E K;  4FM2 A;  1I94 K;  1RDD A;  3O5B A;  1NK5 A;  3VQQ A;  4GKJ K;  1AIP C;  1IM2 A;  4PQU A;  4LC9 B;  5FPD A;  4CIS A;  3A2F A;  3VQ6 A;  3NFA A;  4DV5 K;  3HPO A;  4BE1 A;  3PFI A;  2Y1J A;  1JJ2 M;  3GLH B;  1VQ5 N;  4IO8 A;  1NGD A;  4Z4F A;  3WXK A;  3SHF A;  2VF8 A;  3RSE B;  3ZET A;  4GW6 A;  2H3G X;  2IVO A;  2Z1J A;  5E6J A;  4FWP A;  3PY8 A;  2J7O A;  3KKS A;  3EEQ A;  4DU4 A;  5JS1 A;  4E89 A;  3U6Q A;  4JI3 K;  4CIE A;  4BRD A;  1UWB A;  2HNZ A;  5GIN A;  4DTJ A;  3SBG A;  3AL0 C;  5HRS A;  5FTJ A;  3NBI A;  1DTT A;  3VQE A;  1IJJ A;  4W5Q A;  2HHQ A;  3L25 A;  1G59 A;  4NCG A;  3GPX A;  3M6A A;  2D4W A;  2QTD A;  4ICL A;  2UUB K;  3L2U A;  3B7Z A;  3CJ1 A;  4AZF A;  2O8B B;  5C2D A;  4CHO A;  2E2N A;  5BPL A;  2FF3 B;  2CV2 A;  3J27 B;  2VWJ A;  1J9A A;  4KH5 A;  4CHP A;  5C10 A;  1PM5 A;  4DTR A;  4KHY A;  2DWZ B;  5ADX H;  3OJU A;  5EP1 A;  3LDP A;  3VET A;  4CEC A;  4R5P A;  4OLA A;  3G4S N;  2CHG A;  3WNG A;  5AQI A;  3WXI A;  4QS9 A;  5AQR A;  1GLC G;  4DV6 M;  4OO1 J;  4TUW A;  2QW9 A;  3I8B A;  4CF9 A;  3AOE A;  3ZH9 B;  2QQ8 A;  4RKU F;  1WJ7 A;  3GDQ A;  4MLE A;  1Q82 O;  2W6L A;  3FYD A;  3BXW A;  2XEP A;  3BGR A;  4X65 K;  3QAU A;  3VQ4 A;  2V1U A;  4L6V 6;  1ESV A;  1VSH A;  2RGO A;  4CW7 B;  2Z4R A;  1ZBH A;  4WE1 A;  4QHT A;  4MO4 A;  4YOW A;  2OOB A;  3SBJ A;  2O25 A;  2HVI A;  4YDU C;  2QPA A;  3OYB A;  1JLA A;  5DK5 A;  2OQ4 A;  3HT3 A;  4UY8 O;  3HJS A;  3TWM A;  1ASW A;  3RMC A;  4JEP A;  5FPM A;  4QOZ C;  3B7Q A;  3LDQ A;  1KVB A;  1UM8 A;  3C3E A;  3GRY A;  3WUH A;  3K2L A;  1CXQ A;  1U2V B;  4BR9 A;  1RNH A;  3CFP A;  1L5U A;  2X74 A;  3QB0 A;  4F1I A;  4DV6 K;  3U4L A;  3HY5 A;  3QDK A;  2HL7 A;  4E7L A;  4M3U A;  4GC9 A;  4YY3 K;  1EET A;  4HUF A;  1EWR A;  1VHX A;  3DMJ A;  3QEP A;  4OGE A;  4AH9 A;  4FSV A;  3C94 A;  3J80 S;  1HNI A;  4Z4H A;  3D0P A;  2JWL A;  2NRT A;  4B8C A;  4J2E A;  3O8M A;  3FZH A;  1QQN A;  4CIG A;  4I8O A;  4DR2 M;  2LVQ D;  3M8Q A;  1PGY A;  2P9N A;  3ZX0 A;  1YJN N;  2RKI A;  3M8S A;  5ITU A;  3HPG A;  4CJE A;  2F5Q A;  5JMV A;  1NGJ A;  4H0Y B;  4YDU A;  4M0D A;  2E8A A;  3BZK A;  4FM0 A;  4OX9 K;  1BIZ A;  1RDA A;  3VQD A;  2HHX A;  2X6S A;  3P4I A;  4F8R A;  3SQ0 A;  2UUC M;  5AQG A;  4WQ4 C;  3K9J A;  1IKV A;  2VG7 A;  4UN2 B;  3P83 D;  1A5W A;  2Q2E B;  5C42 A;  3D7E O;  3VTI A;  3WHK A;  3FRH A;  1TL1 A;  3CC4 N;  1JR3 E;  3ILK A;  3RMB A;  4B9S A;  4U7B A;  3CGW A;  5C25 A;  4JI4 M;  2XY6 A;  4DBG B;  5AQX A;  4NXM K;  4CEQ A;  3V9X A;  3SQ1 A;  4IBC A;  3VMF B;  5BN9 A;  3FUX A;  4DLG A;  2IAJ A;  4JI0 M;  4EHU A;  1C1C A;  3WXJ A;  4GC5 A;  3UE5 A;  1QVF M;  1RBS A;  4FM1 A;  4JKG A;  3DXM B;  4H5R A;  2XO7 A;  3E1Y A;  1NGE A;  1LWF A;  3GLF A;  1IY1 A;  2ASM A;  2A5X A;  4H5N A;  3O08 A;  2E2O A;  2GUI A;  4OGC A;  3MMV A;  4G4Q A;  3OYJ A;  2RHK A;  3DWL A;  2YKN A;  1GJT A;  2ZBK B;  1N34 K;  5TKY A;  4FCT A;  5JI3 E;  4BLC A;  2XZF A;  1BCO A;  3OS0 A;  3KLF A;  4JV5 K;  3RE8 A;  3SNN A;  5HL7 L;  3ZET B;  1K73 O;  1KFS A;  2WSF F;  3C7N B;  2Y0T A;  1HNX K;  1OFH A;  3DA1 A;  4REZ A;  4JN4 A;  1DEJ A;  1HQC A;  3ZX3 A;  2ZJQ L;  2G8V A;  4IJA A;  5F2R A;  3NHG A;  3OA9 A;  4B1V A;  2HMP A;  4XIU A;  5HLF A;  3O80 A;  1E4G T;  2HOE A;  3HBT A;  3RMA A;  1QAM A;  2YI1 A;  4IFY A;  4YOV A;  2H5X A;  3OY9 A;  1D9F A;  2F5O A;  3D45 A;  4DB3 A;  3HJ8 A;  4IBF A;  3AAR A;  5AQL A;  3ATV A;  3KIO A;  4L4U A;  5BR9 A;  3JAM O;  3P1G A;  4GIT A;  3CIP A;  4YOY A;  2I7N A;  4CF1 A;  1NK0 A;  1N34 M;  2QWR A;  3AVN A;  4DFM A;  4BB9 A;  5TKW A;  2KDL A;  1WSF A;  1JLB A;  4DQS A;  5AJ3 K;  4GV6 A;  3V1O A;  5KI6 A;  4PKG A;  2P9K B;  5BPV A;  2HNY A;  3ZSR A;  3AVB A;  1JLQ A;  1HQU A;  4DUZ M;  2NRZ A;  3BUZ B;  3BZC A;  4GIP A;  3OYC A;  5GIO A;  5EP3 A;  3JAM S;  2AA4 A;  3U9Z A;  3OTO K;  3U6O A;  3EIH A;  2QSF X;  3ZSY A;  3GRR A;  2K9D A;  2ITM A;  3NE6 A;  3SUN A;  1LAV A;  2R4E A;  5AZI B;  3O9T A;  3U61 B;  1HKC A;  4B9Q A;  3W0L A;  3JS6 A;  3CCV N;  4G4O A;  2FSK A;  4DUY M;  3O6W A;  1RDC A;  4BRK A;  3HP6 A;  4E7H A;  1OQY A;  5DM7 L;  5EXT A;  4ZTF A;  3L8B A;  4FWS A;  2FBX A;  1HT1 E;  3U61 A;  5I9E B;  5AQU A;  5C2F A;  3FTD A;  1JL1 A;  1BIU A;  4C8L A;  1ZBF A;  2ATQ A;  3NH0 A;  1V34 A;  4LG2 A;  2ZF5 O;  3ZT1 A;  3CCL N;  3HU2 A;  1FJG M;  3W67 A;  3AVJ A;  3I56 N;  3VTH A;  4NLB A;  1RU3 A;  3SMP A;  4CGI A;  3QEW A;  4DV5 M;  3ENB A;  1WGL A;  2DVW B;  1VEG A;  3I04 M;  4AHU A;  3HKP A;  1GOC A;  4CHT B;  3WHL A;  1Q81 O;  3VQP A;  3GLH A;  1M90 O;  1UAX A;  1GL7 A;  3OYH A;  4JK7 A;  4UQG A;  4FJL A;  1DLO A;  1QZ5 A;  4JI7 K;  1YUW A;  5LMN K;  1YSY A;  1YTU A;  1NKE A;  1X3M A;  4QAG A;  3CPE A;  2DFF A;  4O5F A;  3C6A A;  2D0C A;  3AVK A;  4KH4 A;  4RG8 A;  3BF1 A;  4FJN A;  3I01 M;  3C3D A;  2O8C A;  4H5V A;  4JLH A;  3HHY A;  4KHQ A;  2ZJR L;  3C65 A;  5BRF A;  3H4J A;  3LAL A;  4A5A A;  4AF1 A;  4OLB A;  2OCE A;  2OPQ A;  5C12 A;  3SJH A;  3OYM A;  4KT0 F;  1JKH A;  4C1N I;  4O55 A;  2XSZ A;  1R2Z A;  4RF0 A;  2AP1 A;  2L7H A;  4W5N A;  4MDA A;  4DSL A;  1IBK M;  2K47 A;  3THV A;  1EXQ A;  4JI7 M;  3L2Q A;  3P5J A;  3K8Z A;  1OKJ A;  3R8E A;  1N78 A;  3ZYY X;  3DOL A;  1VQO N;  3GL1 A;  4K8Z A;  1QHT A;  3MXM A;  3NWL A;  4LSN A;  2PYL A;  4NL4 H;  3CI5 A;  2P9I B;  4B3S K;  3CJ7 A;  4I81 A;  4DMN A;  1NHW C;  4DV2 K;  3VES A;  3VEN A;  2Z4S A;  1TDH A;  1YF5 L;  4DSJ A;  3MX2 A;  3VEO A;  3CM6 A;  5JVH L;  1HNZ K;  4LSL A;  2UUA K;  1NJG A;  1A5V A;  4FWQ A;  2HBK A;  4FLU A;  4EZ6 A;  3O9R A;  4CGF A;  2E5L M;  1VSL A;  1HKB A;  3TTF A;  3AVA A;  3D2E A;  3B6P A;  1GLE G;  2ZGY A;  3FZF A;  1QQM A;  1LWC A;  1CZ9 A;  3LW5 F;  4GKK K;  3I0S A;  3FR0 A;  3S3O A;  4J2D A;  3FTF A;  3ZX2 A;  5M1Q A;  3ZSZ A;  1X9M A;  1G41 A;  3VKG A;  1U4B A;  2GV9 A;  1OAI A;  3TTD A;  3WNE A;  3IG8 A;  2G8L A;  2J5Y A;  1NG9 A;  2HHS A;  1NOZ A;  2FBV A;  3THG A;  4KO8 A;  1IFY A;  5CE3 A;  3OYL A;  3RR7 A;  3CCU N;  4PUO A;  4JK9 A;  3DOK A;  3HZJ A;  4BR5 A;  4M41 A;  4KI4 A;  3GPY A;  1VQ4 N;  3QBW A;  3QO9 A;  4FYD A;  3DYA A;  3P38 A;  1TTE A;  4C8K A;  2R0I A;  3OYK A;  4CEO A;  1JR3 D;  3AOG A;  5FTN A;  3C95 A;  5BPM A;  4NCA A;  2EA0 A;  3LDS A;  4DR2 K;  3VQ7 A;  4IO9 L;  3AVI A;  3QLH A;  3CJC A;  3GLG E;  1RT1 A;  2Q2R A;  1NO1 A;  1DGB A;  3TAN A;  1SKS A;  1KCF A;  3LDO A;  3VKH A;  2P9U A;  3D2F A;  3PO4 A;  4AI6 A;  4CI6 A;  3F9M A;  4CHQ A;  3NF7 A;  4I9Q A;  3O1B A;  3RVC A;  3CG7 A;  2OPS A;  2LNH C;  4KHP M;  3LQR A;  2UXD K;  4CES A;  4B9U A;  4CEE A;  1VDL A;  3SAR A;  2FBT A;  2CGK A;  3WXL A;  2ASO A;  2YJE A;  4OPA A;  5IWA K;  2LHC A;  2YHX A;  3EO3 A;  3ZT0 A;  3UJN A;  3VA3 A;  4FOE A;  3IEC A;  3V1R A;  4XBO A;  1VQ6 N;  3UKU A;  4JHD B;  5AQY A;  4BE0 A;  4NXM M;  4ELV A;  1HPZ A;  5IRE B;  3TE6 A;  3TL4 X;  5KPZ A;  3FZL A;  4EP5 A;  2OOA A;  4DQP A;  3BY5 A;  5FPN A;  4LJ9 A;  3QNN A;  3OHR A;  4F2L A;  3T15 A;  4CED A;  3U6S A;  1N36 K;  1UOC A;  1QVR A;  2R45 A;  4AG6 A;  5GAE P;  3Q8G A;  2WSE F;  3F9K A;  4NSO B;  3SAV A;  3J7A P;  1ORY B;  4KRE A;  1VSE A;  3RRG A;  3PV8 A;  1K6Y A;  4FO0 A;  5ITX A;  1ZV1 A;  4WW0 A;  3LM2 A;  1O1W A;  3VQ9 A;  1L1Z A;  2E1Z A;  3PUF A;  3SYZ A;  4NB4 A;  4NSR A;  4DV7 K;  4HTL A;  1OH8 A;  4GKJ M;  1BU6 O;  3OYN A;  3SQ2 A;  1KQS M;  1FKP A;  1SXJ B;  2X78 A;  5AQO A;  4B3M K;  5HP1 A;  2XFT A;  3KP1 E;  1HNX M;  2AJQ A;  4BC3 A;  3K9K A;  1N36 M;  3AO2 A;  2VII A;  3MX5 A;  4Y28 F;  4DR4 M;  3FD9 A;  1OKS A;  4KOD A;  4IBK A;  1B9D A;  4MLH A;  3SK3 A;  3EKU A;  1TF0 B;  4CJQ A;  3BDP A;  4JI3 M;  1W9H A;  5H1S Q;  5I3U A;  3T3F A;  1NK7 A;  4GVE A;  4JKB A;  3I55 N;  5JI2 E;  3GQ5 A;  1OH5 A;  3FE3 A;  2D0P A;  4K25 A;  4O0J A;  3MN6 A;  2RF2 A;  3TSP A;  4CK2 A;  2G8H A;  4NRV A;  1Z5A A;  3R6M A;  2YQZ A;  3LZJ A;  4G9Z A;  3A42 A;  3T1Y K;  1HNZ M;  1OAO C;  1WUA A;  4BQZ A;  3TAR A;  1QZM A;  2YHW A;  5JLH A;  2NRH A;  3ZCM A;  2BJW A;  3E9L A;  1I4W A;  1XUP O;  2JXN A;  3LCV B;  1MWM A;  1PRB A;  2O8F A;  3V1Q A;  1XNQ K;  3H1V X;  1S9G A;  3E01 A;  4A2B A;  5H37 D;  3KWI A;  2XZU A;  3OYI A;  4KAZ A;  2DWM A;  3NBP A;  4RW9 A;  2KNV A;  4CJ3 A;  1VK0 A;  1RFQ A;  3A5L C;  5AZI A;  4AIL C;  3H1Q A;  3NAE A;  1R7R A;  3CCE N;  4GHA A;  3M5R A;  1D9D A;  3L3V A;  4L16 A;  1C1B A;  1HR0 M;  2KHO A;  2CP8 A;  3EIE A;  3R9P A;  3T1Y M;  2O8C B;  3QWL A;  3SCX A;  2GEL A;  4X64 M;  2DZN B;  3G10 A;  4JYA M;  1J53 A;  2F5N A;  1TUU A;  3LM9 A;  3O4Q A;  5BR8 K;  3V81 A;  4CJK A;  2JY5 A;  4JI1 M;  5F3W A;  3KLG A;  3TWH A;  4ILJ A;  3CF2 A;  5EXP A;  4H0V B;  1IKW A;  2HWJ A;  1BUP A;  2HBM A;  4CJ7 A;  4A59 A;  3AVM A;  4TSX A;  1MWK A;  1TH4 A;  5LMN M;  5J2P A;  1A5T A;  3V4I A;  1WAJ A;  4LJ8 A;  2P9P B;  1KRP A;  1OTR A;  2QZ4 A;  4M7X A;  1Q9Y A;  1GAB A;  3GOI A;  4AKI A;  4PDI A;  4AHT A;  2G8F A;  3CF6 E;  4BR7 A;  2DNA A;  4QCL A;  1XXH A;  4B1W B;  3HM8 A;  4EIA A;  2YHY A;  1C0U A;  1RTJ A;  2QWO A;  2XY5 A;  4DR3 K;  2VG5 A;  3WQT A;  3MN9 A;  1B92 A;  1MX0 A;  4DR5 M;  2D0A A;  5BN8 A;  3QIN A;  1NNJ A;  2H1R A;  4OPJ A;  3HU1 A;  4JI1 K;  2F5P A;  4PL8 A;  3TSU A;  3L2V A;  3LCU A;  1WAF A;  1T6C A;  3O1W A;  2FC0 A;  2R4J A;  3MK6 A;  2I5J A;  4GH9 A;  4N76 A;  1L8Q A;  3BOS A;  4FLY A;  1WIV A;  4B9M A;  2QBY B;  3ULD A;  3ZEU B;  3CF5 L;  3DLL L;  4ID1 A;  4BR4 A;  4X66 K;  4GMJ B;  1NVM A;  1D2N A;  4JI4 K;  4DWI A;  5EX5 A;  1NJW A;  2OA8 A;  4BWJ A;  2QK9 A;  5ITY A;  1SAZ A;  3H3N O;  4JI0 K;  4CJR A;  2P1J A;  5KPT A;  4N56 A;  5JVG L;  3J7Z O;  4R71 A;  3L2R A;  1W7A A;  2DWL A;  1QAQ A;  4DR7 M;  3L29 A;  4B7G A;  1E9S A;  3K92 A;  3NF6 A;  2QI2 A;  4CHY A;  3KWG A;  2HHW A;  1SS6 A;  1H6U A;  1U47 A;  2F7T A;  3VA0 A;  3MMP A;  1HRH A;  2V51 B;  3CFR A;  3TAG A;  3QEI A;  4FOI A;  4QOZ B;  4RNA A;  2CHQ A;  1RT3 A;  3WQU A;  2CGL A;  1N77 A;  3V9S A;  3A0I X;  5SZT A;  3MXI A;  3AA2 A;  3FUW A;  3K2P A;  5FRO A;  4DQR A;  5AQF A;  4E7I A;  4GV9 A;  1T43 A;  3UMM A;  3ZSW A;  3J7B A;  4QOS A;  2B3T A;  4BRQ A;  1X37 A;  1KAX A;  4DR7 K;  3VF6 A;  1VQ1 A;  1KLM A;  5FSW A;  1C0G A;  3LPU A;  1N5Y A;  4BVO A;  1L3V A;  4HUE A;  5T7B A;  3L4Q A;  1CLQ A;  2BAN A;  4FJH A;  3HYF A;  1R0A A;  2BE2 A;  1XNQ M;  3THY A;  1LWE A;  3B89 A;  3E66 A;  3SAH A;  1TDZ A;  4LF4 M;  4CJF A;  1NK4 A;  4DV4 M;  3IRX A;  1IY2 A;  4HLQ A;  4FW9 A;  2L2D A;  1T6O A;  2NRW A;  1KFD A;  2P9U B;  1QAN A;  5DNY A;  1K3W A;  1L3U A;  2UXD M;  4LFC K;  1ASU A;  1IXR C;  3HST B;  3KLI A;  4E19 A;  1HR0 K;  3KSJ A;  3KZB A;  3PSF A;  2KA6 B;  2QHO B;  1ASV A;  1J6Z A;  1Z26 A;  1I3A A;  1XWL A;  5CYM A;  4FZZ A;  3MHV C;  5EP2 A;  1XMO K;  3W68 A;  2DWN A;  1VQK N;  3DFZ A;  1X1P A;  3KK7 A;  2HB5 A;  3OJS A;  4YOU A;  3CJA A;  3HGI A;  1S6P A;  5AFU A;  4ANR A;  3DRR A;  5KO3 A;  3F5T A;  1TUY A;  5AQJ A;  3DLG A;  3HM9 A;  1IN7 A;  4BDZ A;  4W5T A;  3CF0 A;  1ZAE A;  3GLF E;  4CJL A;  4DTX A;  2KRK A;  2I7P A;  1YI2 N;  3KOY E;  1LW2 A;  4O4G A;  1TKX A;  1QZE A;  1IQP A;  1JL2 A;  2HND A;  1BCM A;  4EFH A;  3VK8 A;  4CIF A;  4HCC A;  4IEE A;  3UKR B;  3OYA A;  2QEX N;  4JV5 M;  4G4R A;  3V6D A;  3U8X A;  3KK1 A;  1X3N A;  3PVS A;  1CXU A;  1R2Y A;  1QS4 A;  4IDK A;  3IKM A;  5BRD A;  3VK7 A;  3WXM B;  4BRA A;  3O4W A;  4MM3 B;  3ZSV A;  4B7H A;  1LCU A;  3NGI A;  2PFU A;  3FFK B;  4D82 A;  1D4X A;  3KDS E;  4CZE A;  2E88 A;  1YVN A;  2MGW A;  1KD1 O;  2DAK A;  4W5W A;  3ZEU A;  5KPR A;  3U6C A;  4K0K K;  3SV4 A;  1CZA N;  3I8D A;  2O8E A;  1HJP A;  1GLJ O;  4W5R A;  2V52 B;  3CJ9 A;  4JI5 K;  3M8R A;  2AHM A;  4KLN A;  1BVS A;  3B8A X;  5I42 A;  2ZTD A;  3J7Y P;  2R46 A;  3TPZ A;  1NJY A;  1NJI O;  1SL1 A;  3E9O A;  2HF4 A;  3EZW A;  4I5S A;  2IVN A;  4NXN M;  2FH0 A;  2A40 A;  4H4M A;  1GVN A;  5HRR A;  2QKB A;  3VOV A;  1NNU C;  1XNR M;  2ZD1 A;  4DQ8 A;  2VG6 A;  3RRH A;  2HCB A;  2P9L A;  2YNI A;  4IEI A;  3HHZ A;  4Z0U A;  3P39 A;  4CZH A;  1NM1 A;  2XGN A;  5IT9 S;  4ZHR A;  3S3M A;  1TVR A;  3ALY A;  5M1K A;  2P9P A;  1S72 N;  4FK2 A;  1BI4 B;  5M1F A;  4BRM A;  2EO2 A;  1SUQ A;  4IJE A;  1G15 A;  2DZL A;  3HSC A;  3QNO A;  1SXJ E;  4DTN A;  2F4V K;  1GLF O;  2E2P A;  2QA4 N;  4LF7 K;  2YKM A;  4D80 A;  1WSJ A;  4FJ9 A;  1T3T A;  1BI4 A;  2EX3 A;  1D0L A;  2LBC A;  5EQT A;  4MDB A;  3K9O A;  4FJJ A;  3OBY A;  3FZM A;  4CGH A;  4M63 C;  5M1N A;  3B9P A;  1TK8 A;  1D5A A;  4GV3 A;  3HWS A;  4FWD A;  4KHU A;  3IG5 A;  4NC6 A;  3U6M A;  2EKF A;  3B7N A;  5L8R F;  4JKE A;  1PJI A;  1VG5 A;  2DAG A;  2E4L A;  4LF6 K;  4FJ8 A;  2E6M A;  4IDH A;  4F3T A;  2DAI A;  2VGN A;  3FFI A;  4IOX A;  1NV8 A;  1T3V A;  4BRO A;  1QDT A;  4GY2 B;  3NCI A;  3LP1 A;  1RT7 A;  2NLX A;  5AQK A;  4JI2 M;  1ZBI A;  3KOZ E;  2C98 A;  4I4L A;  3GP1 A;  4CJV A;  5BRH A;  4GKK M;  1E3M A;  1NLV A;  4BC5 A;  1HYZ A;  3E9P A;  3LDN A;  4CZJ A;  3GQ3 A;  1ZBL A;  3B6O A;  3KOX E;  4IXC A;  3I33 A;  1WSE A;  4CCH A;  3GLF B;  1Q3B A;  4OVZ A;  4FW2 A;  3OYE A;  3K1J A;  3AO3 A;  1NGF A;  3PNY A;  4PHT X;  3EE8 A;  5EXS A;  3GLG B;  1XMO M;  2P9N B;  3VF4 A;  4GHL A;  3G25 A;  3P31 A;  1NGI A;  4CBX A;  4DR5 K;  3ID8 A;  1KSP A;  3ZT2 A;  3CXC M;  3DJC A;  2KFN A;  4AHR A;  4FLT A;  4M9Z A;  4ZPX A;  3TSQ A;  1QSY A;  4JI8 M;  1WBD A;  4JXJ A;  3QER A;  4FW1 A;  5BRE A;  4BRI A;  3T1A A;  4DV0 K;  1IBM K;  3FUV A;  1DKG D;  5D3G A;  3J80 O;  2UUC K;  2WOM A;  4FVM A;  1Z05 A;  4KTZ A;  4M3Z A;  4FJ7 A;  4E0D A;  1U04 A;  3M7G A;  1YIJ N;  3J7A S;  2FSN A;  4OVL A;  3DLB A;  4WF9 L;  5ITQ A;  1RT2 A;  4CGY B;  3M6G A;  4I2P A;  3IMX A;  4AKH A;  5KRS A;  2C96 A;  1XHB A;  3R8F A;  2FOI C;  4BRL A;  1R5L A;  1REV A;  3L27 A;  1U49 A;  4A5B A;  1Z6T A;  1IG9 A;  2R18 A;  1IBM M;  1RBU A;  1NKB A;  1N32 M;  4A62 A;  1BHL A;  3ZT3 A;  2V7Z A;  2M5Z A;  3VGK A;  1V33 A;  2JP7 A;  3VF2 A;  2GBZ A;  2A5Y B;  4LF5 M;  2RPI A;  3VEX A;  5M1O A;  4NXN K;  3VQA A;  3SFZ A;  2KNA A;  4B1X B;  4ELU A;  4EIW A;  5HBM A;  2HHT A;  1L2D A;  5J1E A;  3B74 A;  3OVN A;  4I6M A;  2LTU A;  2YNG A;  3U60 B;  3EKS A;  3SZ2 A;  4BBA A;  4IFV A;  3A45 A;  4CJS A;  2EUC A;  2CWB A;  3U3Y A;  1GLL O;  5KQ8 A;  3SUQ A;  4C8O A;  4DR4 K;  4PKH A;  4FJI A;  3HXM A;  2OPF A;  3N4P A;  3K5N A;  1K9M O;  3GRU A;  2CH6 A;  4BDY A;  3D2F B;  1QE1 A;  2A1S A;  1QYR A;  4HTU A;  3VEW A;  4KHN A;  4GVM A;  1VQM N;  4Y1C A;  3OS2 A;  4L8R C;  3GO8 A;  4D81 A;  3TAE A;  3U6P A;  2CE7 A;  1NOY A;  4YY3 M;  4B08 A;  3IS9 A;  3DI6 A;  1GO5 A;  4Z94 A;  3KJV A;  2A1R A;  1KC8 O;  2C9O A;  4AW4 A;  1D0K A;  2JA2 A;  4JKD A;  4RWT A;  5ITR A;  3CCJ N;  3HHW A;  1F4I A;  1I94 M;  2QWL A;  5EXW A;  3UKU B;  4F9O A;  4YHH M;  3OYF A;  1NU0 A;  3ENH A;  3IUC A;  4H5T A;  2CFO A;  3NVM A;  5CHI A;  1VEJ A;  4KKO A;  1XQS C;  2L09 A;  1V4T A;  5AQW A;  3SV3 A;  2O8D B;  4I6M B;  1VQL N;  1WNS A;  4IZ9 A;  4ISE A;  5A2Q O;  3ZLJ A;  5AQN A;  4ISF A;  3IFR A;  2UXC M;  4PCZ A;  1KTQ A;  4YNQ A;  4Y0W A;  3H6E A;  2Z1I A;  2ZJP L;  2P9L B;  4AHV A;  2Y21 A;  3AAP A;  1EFU B;  3HI0 A;  2W6K A;  3DLR A;  1T7P A;  1DT9 A;  4HEO A;  3MCA B;  4ITQ A;  1WSI A;  3SYL A;  4LY6 A;  4CJW A;  4G4N A;  2L6O A;  3VLF B;  2D0O A;  4F2R A;  2MRO B;  2F8S A;  3C9P A;  4ILG B;  3GE1 A;  1RDB A;  3U9D A;  4WQ5 A;  4HVJ A;  3SC3 A;  3MEC A;  4F2S A;  1C7Y A;  2A3Z A;  4LFA K;  3HO1 A;  3C7N A;  3CPW M;  4BAC A;  1KYI A;  3AAQ A;  4DV0 M;  2KZM A;  4FD2 A;  1E9R A;  1YTA A;  1S22 A;  4BG9 A;  1Z5B A;  1RTH A;  4B9V A;  4K43 A;  4WFA L;  4DV1 K;  3KS8 A;  1TYQ B;  4WP2 A;  1HQE A;  3K5M A;  4DCH A;  3VN5 A;  1HJR A;  3NMU A;  4OU7 A;  1LTM A;  1DO0 A;  4MGY E;  3CQX A;  2OZM A;  3MWT A;  2XSZ D;  1OVQ A;  3U5Z A;  1TL3 A;  1NY5 A;  2EWS A;  4FWL A;  5FLX O;  4DR1 K;  2L4F A;  2YHB A;  4M3X A;  5JIC A;  4Z4E A;  4P16 A;  1Y8G A;  4BRH A;  4LD0 A;  4PL7 A;  4Z6Y A;  1Z59 A;  1ZBS A;  3AA4 A;  2F4V M;  2E2Q A;  5GIP A;  1BQM A;  3T69 A;  1QTM A;  1TAU A;  4K42 A;  4ZTJ A;  4MGZ E;  4CJ5 A;  4FLZ A;  1TKT A;  4B3S M;  1NY6 A;  2G8K A;  3A98 B;  2VQF M;  5AR0 A;  4DV2 M;  1QSL A;  3MAQ A;  3EL2 A;  2JZ0 A;  3IDH A;  1Z25 A;  3QFP A;  1ZMW A;  2ZWH A;  4LRS A;  1JXB A;  4H0O A;  1RT6 A;  4N47 A;  4GNI A;  2HBL A;  1KLN A;  3TAP A;  1YUB A;  4IWV A;  3OTO M;  1C6V A;  1O13 A;  3KVW A;  4FLW A;  3UIQ A;  3KHY A;  3TWL A;  1DGF A;  2YNH A;  3MXJ A;  1MU2 A;  4BWM A;  5DYG A;  3KXE C;  2XY8 A;  1PJQ A;  3R3L A;  3O3H A;  5E26 A;  3EN9 A;  4QS7 A;  3I0R A;  3CME N;  1UFZ A;  4FK0 A;  4DF8 A;  4S12 A;  1BGX T;  4DV3 K;  4DS4 A;  1DTQ A;  5AQP A;  4CFA A;  2V1C A;  4W5O A;  3ITH A;  1IN4 A;  4DSF A;  1VEK A;  3ZCB B;  1NMN A;  2GTD A;  3QEX A;  3NDK A;  1ZMV A;  3NGZ A;  3AOE C;  1IKX A;  4Z4C A;  1QQO A;  1FW6 A;  1FJG K;  3O3F A;  1EX4 A;  5HRO A;  1IH7 A;  2XH9 A;  4Y1D A;  3Q7C A;  4E7K A;  5HRP A;  4JS5 A;  3CTW B;  2UXB M;  1SXJ A;  2X8A A;  2PAV A;  3QIC A;  2CEA A;  2VQE M;  2Y1I A;  2Q0U A;  4BRN A;  4JD2 A;  3SAS A;  3QES A;  2O8F B;  4JI6 M;  3CFO A;  4CZK A;  3KKR A;  2NQ8 C;  3KSX A;  1IY0 A;  2NUB A;  3F2K A;  1NSF A;  4X66 M;  1DO2 A;  4BRC A;  1YVU A;  3BEX A;  3VDP A;  3SAG A;  2Q1N A;  3L28 A;  4FPA A;  3LZI A;  1KSF X;  1YHQ N;  4MGI E;  2G5G X;  2BTF A;  4XEI A;  1NNE A;  4CK3 A;  3JR5 A;  2O01 F;  1VSK A;  1R6B X;  1NMD A;  3QIO A;  1ITG A;  2O8B A;  3SMS A;  1WN7 A;  3SPZ A;  1BWF O;  2E20 A;  1YJW N;  3HL8 A;  2HF3 A;  2JY7 A;  1S9E A;  2W82 A;  3GG4 A;  4DTU A;  2EHG A;  1WOQ A;  4CJT A;  2Q36 A;  4E1J A;  2FSJ A;  3JXU A;  1L2B A;  3SUP A;  2FNA A;  1JCE A;  2CUZ A;  2IC3 A;  3TAB A;  2RKO A;  3FGU A;  3O4N A;  3KOW E;  2VYP A;  3MED A;  1BDG A;  5CYQ A;  3NH2 A;  2BJV A;  1YLA A;  3VGM A;  3SBT A;  3S3N A;  4XK8 F;  1HMV A;  1R4G A;  1SQK A;  1WSG A;  4DUZ K;  4DKW A;  2KZU A;  4IBN A;  4CZF A;  4FWN A;  2HKJ A;  4E1N A;  1FKO A;  4R7G A;  3RMD A;  2PYJ A;  3CC2 N;  4PY5 A;  3A8Y A;  2LVO C;  3AVH A;  1WGN A;  4WFB L;  3J81 O;  1W2B M;  1CUK A;  4KPY A;  5FDL A;  4R79 A;  1HKG A;  3SPY A;  3SJJ A;  3M8P A;  4LF8 M;  1RDU A;  3VQB A;  3H4M A;  1ATS A;  1NK8 A;  1D0M A;  3R1X A;  3HJQ A;  1ATN A;  4JS4 A;  4IOA L;  1SL2 A;  2DFE A;  4XH5 A;  3OS1 A;  1XNR K;  4MB7 A;  2R6F A;  2Q31 A;  2F8T A;  3K9P A;  1XWI A;  1TKZ A;  1X9W A;  1MDU B;  2P9I A;  3ISN C;  3HPH A;  4NCB A;  3JSM A;  3GLH E;  4JKA A;  5KRT A;  1HYS A;  4MFB A;  4KO0 A;  3VPZ A;  4QNR A;  2ZQB A;  5GAD P;  3KS4 A;  1D8Y A;  4Z4G A;  3ZQJ A;  3VQ5 A;  2OAN A;  1JLC A;  2DXI A;  1GOA A;  1ZBU A;  3OBW A;  1NV9 A;  2E6L A;  4JNE A;  1ZC6 A;  4AM6 A;  4DFP A;  2APL A;  2XFS A;  2QP9 X;  2LSN A;  2Z1G A;  2D5R A;  3QBX A;  3E4R A;  2JNH A;  2R44 A;  4MQ3 A;  3HOS A;  1VQ7 N;  1H1V A;  4L8R B;  4LFB M;  4KTW A;  3THX A;  3U6E A;  3DAW A;  1S5J A;  1TYQ A;  1YT3 A;  1HQY E;  1LW0 A;  1XC8 A;  3O9U A;  4M0W A;  4PDG A;  4Q5V A;  1E94 E;  3M0E A;  4DLE A;  4DQI A;  5FRM A;  1RIL A;  4PD2 A;  3NGY A;  3T6P A;  4FWO A;  1TH2 A;  1SXJ C;  3LAM A;  4LRT A;  2OTL N;  2NNW A;  4I9L A;  4FK4 A;  1ILY A;  1JLE A;  5AQV A;  3K0S A;  1VSM A;  1KAZ A;  3SAU A;  2HHU A;  2JLE A;  2ZTC A;  2ZAO A;  3HZ6 A;  4KFB A;  4L15 A;  2M60 A;  3HHX A;  3S41 A;  3DLH A;  4MO5 A;  2RN2 A;  4WQ5 C;  5EVZ A;  2BH1 A;  2DAM A;  2VWB A;  2KFZ A;  4RW8 A;  1YE9 A;  3JYT A;  4CFD A;  1QUS A;  3N4Q A;  4EZ9 A;  2KHH A;  1NBW A;  3O9Q A;  1CZB A;  4KH6 A;  4BVP A;  1FXX A;  4BRF A;  1G99 A;  2YV0 X;  3LP2 A;  2KW4 A;  4FCY A;  4QS8 A;  4ISG A;  2GEM A;  1MJG M;  3VEV A;  4R3D A;  2QXF A;  4CEZ A;  3Q8X A;  4MH0 E;  4H0P A;  2DI0 A;  4FWR A;  3QEV A;  2Q3S A;  3PLA A;  3AKZ A;  3QET A;  1HX1 A;  1W97 L;  1FK9 A;  1P3Q Q;  5DM6 L;  4G1Q A;  3ZSO A;  4O5B A;  3VEZ A;  3FKE A;  3L2A A;  4DU1 A;  2UUA M;  1RBV A;  2WTU A;  3D8L A;  2ZM6 K;  4JRP A;  2LVN C;  1KVA A;  1Z5C A;  4YOR A;  4CZM A;  3AGR A;  2VWK A;  1OJL A;  2OYQ A;  4C8M A;  1EKE A;  3HP9 A;  3ID6 A;  2BGG A;  2IVP A;  3HOT A;  5J2N A;  2FF6 A;  4H4O A;  4M3R A;  1IV0 A;  5MLC Q;  2O4G A;  1N33 M;  4Z4I A;  2V6Z M;  4KHS A;  1EWQ A;  1VQ8 N;  3W0L B;  3FYC A;  1WHC A;  1XB2 B;  2N35 A;  1P8Z A;  2LWX A;  1JXE A;  5ELZ A;  4X65 M;  2XY7 A;  1S1V A;  3U6F A;  3TPQ A;  5J2Q A;  3C6U A;  1BA0 A;  1IG8 A;  5IZ7 D;  1IXS B;  3PIO L;  4FVU A;  3FUU A;  3G71 N;  3TAM A;  4CHN A;  2P9K A;  1XMQ K;  4GEW A;  2DPN A;  4BY9 C;  1XI1 A;  3RGS A;  1RT4 A;  1NK9 A;  4JKH A;  1U45 A;  2XHB A;  1IXS A;  1IN8 A;  1JCG A;  2ZGZ A;  2ZAN A;  4Q7J A;  2K0B X;  1HYV A;  3FE1 A;  3CM5 A;  3KP0 E;  1QHA A;  3VER A;  4JI2 K;  4BE2 A;  1NGC A;  2NRX A;  2F96 A;  2XF3 A;  2O4I A;  1N33 K;  4OKK A;  5EOY A;  4BQL A;  4F4K A;  5SWM A;  3AFH A;  1C0F A;  2WC9 A;  3U3G A;  4DSK A;  2KTQ A;  3AV9 A;  1NGB A;  3L0Q A;  2D7G A;  3HX3 A;  4DV3 M;  1BO5 O;  4J8F A;  4KV8 A;  2O5R A;  3THW A;  5AQZ A;  2KZZ A;  2K6B A;  2O8E B;  2VCP A;  4BC4 A;  1L3S A;  4PT5 A;  3ZSQ A;  2QKK A;  1SL0 A;  4CD1 A;  4IOC L;  5GAH P;  3CQ8 A;  3D8B A;  4LJ4 A;  1IN5 A;  1RGI A;  5JS2 A;  3VEY A;  1YIT N;  4JRQ A;  1TK0 A;  4FJM A;  4LH4 A;  4V19 S;  3FTC A;  3LL3 A;  4MGH A;  2OO9 A;  4JI8 K;  1RDW X;  5C24 A;  1GKI A;  3E46 A;  1YXQ A;  4CF2 A;  3IHP A;  3MN5 A;  3CHW A;  1QQC A;  2F9T A;  2JGU A;  1KXP A;  4OKE A;  4RW4 A;  3K58 A;  4DHY A;  4IG3 A;  3K5L A;  1IKY A;  2BNK A;  4LJ5 A;  4MGK E;  4A3V B;  3V9U A;  2DFH A;  3KLH A;  1NK6 A;  1M1K O;  3SLC A;  5E41 A;  4O8K A;  5KGX A;  3OYG A;  3L3U A;  5EY4 A;  1EO1 A;  3E21 A;  1FNN A;  4HUG A;  3KVG A;  3H46 O;  1XC9 A;  1VSJ A;  3CJB A;  3TQS A;  3AVG A;  5HRN A;  3LVV A;  2O8D A;  2KRU A;  3L4I A;  1RTI A;  2A42 A;  2UXC K;  4B8A B;  1W5S A;  4M7Y A;  1A5X A;  5CR4 A;  4NYF A;  3RWU A;  3PX4 A;  2KNZ A;  1NJX A;  4CIZ A;  1L3T A;  2W40 A;  1T03 A;  2D7H A;  2QWN A;  4FCV A;  4M45 A;  1SKR A;  2KQ2 A;  4FWH A;  5DYI A;  1NJF A;  3AGK A;  4N41 A;  4C1N K;  1DGK N;  4PWD A;  1C1A A;  4LJA A;  3V9W A;  2FS1 A;  1QZ6 A;  4DSE A;  3THW B;  1OVY A;  2Y20 A;  3MDQ A;  5EP4 A;  3T7Z A;  3Q7B A;  4FPB A;  4P17 A;  4Q0B A;  1VDD A;  1IBL M;  4FWG A;  2YX6 A;  3KD1 E;  3J81 S;  3KK2 A;  4LCB A;  2ITG A;  1N8R O;  3QYB A;  2LXE A;  4WCE L;  2V7Y A;  4PKI A;  5M1P A;  3LMM A;  4IBB A;  4KB1 A;  3H45 C;  4CGG A;  4JI5 M;  3OYD A;  3TU5 A;  4LJ6 A;  1MU5 A;  4ELT A;  2Q0R A;  3M1F A;  2HHH M;  3DZD A;  4XGI A;  2IOC A;  3TWK A;  1VQN N;  2DZO B;  4DTP A;  1SZ2 A;  2QBY A;  1N75 A;  2KW0 A;  1PJS A;  3A5N C;  4CEA A;  1QUT A;  1IO2 A;  1XMQ M;  4HCB A;  1Q3C A;  5F0X A;  2ETJ A;  4BRG A;  4JYA K;  1KFV A;  1IBL K;  2E5L K;  1EE8 A;  3WNF A;  4IBJ A;  4DG1 A;  4LF4 K;  1S6Q A;  5E84 A;  2C5R A;  2LVA A;  1S1T A;  1Q86 O;  1JCF A;  1TGO A;  1EP4 A;  2HHH K;  4QNM A;  1TKD A;  4CVN E;  3CYM A;  4CF0 A;  4JHD A;  4H8K A;  2E1Y A;  3H3O B;  3BP8 A;  1XXH E;  1GLN A;  2VQF K;  4II7 A;  4A61 A;  1G3I A;  1J5E M;  3DXK B;  3NF8 A;  4BC2 A;  3DLE A;  3C6H A;  4G6Z A;  4IG0 A;  3GPU A;  3W3D A;  3A5M C;  3LAN A;  4B9N A;  4LGY A;  3KW6 A;  1DGH A;  4DR3 M;  2WBN A;  1Q9X A;  3BBZ A;  4RW6 A;  2GNO A;  1JB0 F;  1Y64 A;  1JQJ C;  1VRT A;  2D1K A;  3UB5 A;  3AA3 A;  5AZJ B;  1C0M A;  4RTF D;  2QWQ A;  3GPP A;  5AQT A;  1ZMU A;  2Y0Q A;  5FTK A;  1U2V A;  5ADX A;  3F73 A;  2IIR A;  5LY3 A;  2Q97 A;  1K3X A;  3MN7 A;  4BGA A;  4NLC A;  3AJI B;  3CC7 N;  4B1Y B;  1N6Q A;  2HMI A;  2Z3X A;  5FLX S;  2KEB A;  3AO5 A;  1SXJ D;  2HVH A;  1XHZ A;  1RBT A;  3EZ5 A;  5FPE A;  3SI6 A;  2WSC F;  3A5O C;  4CJ4 A;  1WSH A;  1HLU A;  2HHV A;  1ZQ9 A;  2YCH A;  4OPH A;  3EYZ A;  4ID5 A;  4DF4 A;  3C6T A;  3D6R A;  5CZ2 A;  2X49 A;  4L3Q A;  2NRV A;  4RW7 A;  2RGH A;  3U6L A;  1K82 A;  2GX9 A;  1QDR A;  4LGM A;  4KHW A;  1VQ9 N;  4B9L A;  4KTQ A;  3CER A;  4KI6 A;  1S1W A;  4CJU A;  1C0T A;  4Z8X A;  1IBK K;  4EHT A;  1VQP N;  3U5Z B;  4FJX A;  1QQW A;  3VQ8 A;  5AQQ A;  3FZK A;  3FTE A;  1DV0 A;  4FXD A;  3KTQ A;  3T38 A;  2Z1H A;  1NKC A;  3TI0 A;  1X9J A;  1X9S A;  5ITX E;  2FFJ A;  2J4R A;  3QFU A;  3K57 A;  4YOT A;  3SAF A;  3J2P B;  1BG3 A;  2CV0 A;  1C1K A;  4B3M M;  4CGJ A;  3VGL A;  3VDU A;  1TR8 A;  2G3Q A;  2KLA A;  3L6Q A;  3RR8 A;  4B3R M;  4LZJ A;  2R7Y A;  2P5T A;  1HUX A;  3QIP A;  4O44 A;  1IXZ A;  3SUO A;  2UU9 K;  3DM2 A;  1T05 A;  4BRE A;  3MCP A;  3AVC A;  4J2A A;  4NO7 A;  2GWK A;  3SHG B;  2NZT A;  2R65 A;  4JKC A;  4KRF A;  3LAK A;  1JLF A;  3LVW A;  2PBD A;  4IJF A;  5AQM A;  4DTS A;  4RCH A;  1WXQ A;  5A2Q S;  3HTV A;  4JN6 A;  1NHG C;  3RSE A;  3KFU G;  1P90 A;  2NRR A;  2G8W A;  1OH7 A;  3GLI E;  4C23 A;  1K8A O;  4X62 K;  2PZS A;  1VAZ A;  3HVR A;  1TK5 A;  3ASM A;  4OPK A;  1G71 A;  2HAK A;  2KXE A;  4DSI A;  1OIP A;  1HJO A;  2CHV A;  2P5O A;  4B3T K;  3CQY A;  2JWS A;  4FJG A;  2DHY A;  2JWK A;  3T19 A;  1WB9 A;  4BDP A;  1J09 A;  5C0Y A;  4A57 A;  3PXG A;  4OX9 M;  3DXK A;  4FJK A;  4GMQ A;  1BIS A;  4B1Z A;  1HNW K;  4LH5 A;  4LF8 K;  1T6D A;  1GOB A;  4RF1 A;  4IIW A;  3MWP A;  3NF9 A;  4X62 M;  4K41 A;  3VFD A;  3C58 A;  3ATU A;  3QML A;  4AQY M;  4A2A A;  3DOA A;  2HST A;  3EE9 A;  5JLF A;  5IWA M;  4KBO A;  3SAT A;  4JKF A;  1Q39 A;  3T1H K;  2L7I A;  5F1X A;  4BRP A;  3NBX X;  2F9W A;  4IJN A;  4X64 K;  1PJJ A;  5BPN A;  1Q02 A;  1YJ9 N;  3QYE A;  4AKG A;  2ERC A;  2CV1 A;  4WYB A;  2JUJ A;  3SYK A;  2HBJ A;  4FJ5 A;  4U67 L;  1SKW A;  2P51 A;  1TGU A;  1VSF A;  3DRP A;  1BL3 A;  1Y97 A;  3H08 A;  1V4S A;  2PY5 A;  5DMR A;  4FZY A;  3GQ4 A;  1HNW M;  4BR2 A;  2X4A A;  2P9S A;  3GRV A;  3HRG A;  1F21 A;  2IDO A;  3KK3 A;  1XXH B;  3I4Y A;  4HHT A;  5GKN A;  4I2Q A;  4FLV A;  3K5O A;  3OW2 M;  2WFB A;  3PSI A;  4CJ6 A;  3T1H M;  5EJC A;  2G8I A;  4DV7 M;  3W0F A;  1SV5 A;  1NGG A;  2B5J A;  2GWJ A;  2FXU A;  2YJF A;  2BUP A;  5AFU H;  4IKF A;  4E1M A;  3FLC O;  2OPP A;  3LQQ A;  4LZZ A;  1RCH A;  3GBT A;  4G3O A;  7CAT A;  4BGB A;  1DGG A;  3PX0 A;  4XH1 A;  2GQF A;  5C18 A;  2FBY A;  2WZJ A;  2FE8 A;  1NGH A;  1XC3 A;  2QWM A;  2Z7J A;  1PJT A;  4FL9 A;  1Q7Y O;  2JZ1 A;  3BF3 A;  1WBB A;  4CEF A;  5IT9 O;  4DQQ A;  4DV1 M;  4LJ7 A;  5EU7 A;  2Z8Y M;  4CE9 A;  4OVZ B;  1GJS A;  4AG5 A;  4NRW A;  2LVP C;  3ENO A;  1VSD A;  2IGI A;  1TV6 A;  2ASP A;  4EP4 A;  4M3W A;  3PO5 A;  2L4E A;  3IG1 A;  2LHG A;  2R62 A;  3WT0 A;  4B9T A;  2W41 A;  3MEG A;  1KVC A;  5FRN A;  4N5S A;  2YNF A;  3VQC A;  3AO1 A;  2UUB M;  2WON A;  1EQY A;  3CD6 N;  4WQ4 A;  4LF6 M;  1ATR A;  1W0H A;  1BOT O;  5KGW A;  2A41 A;  3F92 A;  4FWK A;  4K8X A;  5EXX A;  4K0K M;  3CCS N;  1SG9 A;  3WEE A;  3G0Z A;  4F3O A;  1Z6R A;  1HNV A;  1OIZ A;  4CZL A;  4M3Y A;  3AY9 A;  4LF9 K;  4DTM A;  2J7N A;  4DTO A;  1QVG M;  4IFE A;  1J5O A;  3PIP L;  3WEE B;  4DUY K;  1W5T A;  5FTL A;  4DS5 A;  2BWE A;  1RT5 A;  4KB0 A;  1V92 A;  2ZAM A;  3CET A;  4LFB K;  3UGJ A;  1I39 A;  3A46 A;  1E4F T;  4H0T B;  3CCQ N;  1VRU A;  1T8E A;  1JR3 A;  3THY B;  3PNV A;  3L26 A;  4YHH K;  5ITT A;  2QXL A;  1T44 A;  3UZU A;  4H0X B;  3G6E N;  4CEB A;  4M9X A;  1ZYQ A;  4M9S A;  2OPR A;  1S3X A;  4WUR A;  4FWM A;  4CK1 A;  5LMU M;  1QSS A;  1G4A E;  5BR8 M;  5KTQ A;  1U6Z A;  1GLD G;  3HJF A;  2RE2 A;  2EKK A;  1NGA A;  4LF7 M;  4LF5 K;  2VDB B;  4AHC A;  3S9H A;  3WNH A;  4O0I A;  4CHZ A;  2QNJ A;  2OZS A;  2EJS A;  4GRI A;  2GUP A;  4OJR A;  5AZJ A;  3KD5 E;  2G8U A;  2QEN A;  1K8K B;  1NWK A;  5LL6 Z;  4B7F A;  4CFC A;  2F5S A;  4E7J A;  3E9S A;  3M3Z A;  1GLB G;  4AM7 A;  4DR6 K;  1RBR A;  4CGD A;  1TH3 A;  2MH8 A;  3IAY A;  1MN3 A;  5CZ1 A; 
#chains in the Genus database with same CATH homology
 1KAY A;  2C99 A;  1Q18 A;  3LDL A;  1G8P A;  5AQS A;  2QM1 A;  4H03 B;  4FCW A;  4JKG B;  4H5W A;  2ZM6 M;  3RFW A;  3I51 A;  4LFA M;  3NVK A;  1R59 O;  2C9C A;  2YR0 A;  2YNM D;  4XH4 A;  3R9X B;  3CCR N;  1DGH B;  3UK6 A;  3ULE A;  4ILH A;  2WUS A;  2QCU A;  4CD3 A;  1QAO A;  5LJW A;  2FLO A;  1HPM A;  3ULE B;  3MJ5 A;  5C15 A;  4HL4 A;  5C1B A;  4DR1 M;  4NOO B;  1L2C A;  2UU9 M;  5FTM A;  3D2E B;  3RGP A;  8CAT A;  1MA9 B;  3TTC A;  4IBD A;  4BR0 A;  4JD2 B;  4WFN L;  1BA1 A;  4OW0 A;  1J7K A;  3GLI B;  2UYT A;  3CMA N;  3FUT A;  2CH5 A;  3U60 A;  4IBG A;  2QWP A;  4CZI A;  4L78 A;  2KZS A;  3O9S A;  5LJV A;  1L1T A;  1HT2 E;  1LOT B;  5B8H A;  4YOX A;  2A6A A;  2YFQ A;  3SAW A;  5AQH A;  4JAX A;  4CZG A;  3U6D A;  3AV0 A;  2P9S B;  3GLG A;  1GLA G;  2LH0 A;  4B1U B;  4CBW A;  1E32 A;  1YAG A;  4B3T M;  4LF9 M;  3UKR A;  5GAG P;  2CGJ A;  1GL6 A;  3I4V A;  4JK8 A;  2XLJ A;  3CCM N;  4QHS A;  4LFC M;  2OTJ N;  2DHR A;  1K8K A;  4O8U A;  1IN6 A;  2KKZ A;  3HU3 A;  4BG8 A;  4CBU A;  5HOO A;  1OFI A;  4EAH D;  1S3S A;  4IBI A;  4IBE A;  1ZXO A;  2D7E A;  5KQD A;  3J8A A;  4HWI A;  3DXM A;  3ZC7 B;  3JR4 A;  3GLI A;  3C0B A;  2VGM A;  4DR6 M;  1LV7 A;  3O5B A;  1IM2 A;  4LC9 B;  5FPD A;  4CIS A;  1JJ2 M;  3PFI A;  3GLH B;  1VQ5 N;  4IO8 A;  1NGD A;  3WXK A;  3SHF A;  3RSE B;  3ZET A;  2H3G X;  2IVO A;  5E6J A;  4FWP A;  2J7O A;  3U6Q A;  4BRD A;  5GIN A;  3SBG A;  3AL0 C;  5FTJ A;  3NBI A;  1IJJ A;  3L25 A;  1G59 A;  3GPX A;  3M6A A;  2D4W A;  2QTD A;  3CJ1 A;  4AZF A;  5C2D A;  2E2N A;  5BPL A;  2FF3 B;  2CV2 A;  3J27 B;  4KH5 A;  5C10 A;  1PM5 A;  2DWZ B;  5ADX H;  5EP1 A;  3LDP A;  3VET A;  3G4S N;  2CHG A;  5AQI A;  3WXI A;  4QS9 A;  5AQR A;  1GLC G;  4DV6 M;  4OO1 J;  4TUW A;  2QW9 A;  3I8B A;  1Q82 O;  3AOE A;  3ZH9 B;  3GDQ A;  4MLE A;  3FYD A;  2XEP A;  3QAU A;  2V1U A;  1ESV A;  2RGO A;  2Z4R A;  4QHT A;  4MO4 A;  4YOW A;  3SBJ A;  4YDU C;  2QPA A;  2OQ4 A;  4UY8 O;  3HJS A;  3TWM A;  4JEP A;  5FPM A;  4QOZ C;  3LDQ A;  3GRY A;  1UM8 A;  1Q81 O;  3WUH A;  3K2L A;  1U2V B;  4BR9 A;  3QB0 A;  3U4L A;  3QDK A;  2HL7 A;  4GC9 A;  4FSV A;  3J80 S;  2JWL A;  2NRT A;  3O8M A;  3FZH A;  1QQN A;  4I8O A;  4DR2 M;  2P9N A;  3ZX0 A;  1YJN N;  5ITU A;  2F5Q A;  5JMV A;  1NGJ A;  4H0Y B;  4YDU A;  4M0D A;  2E8A A;  3P4I A;  2UUC M;  5AQG A;  4WQ4 C;  3K9J A;  2Q2E B;  3D7E O;  3VTI A;  3WHK A;  3CC4 N;  3ILK A;  4U7B A;  4JI4 M;  5AQX A;  4IBC A;  3VMF B;  5BN9 A;  3FUX A;  4JI0 M;  4EHU A;  3WXJ A;  4GC5 A;  3UE5 A;  1QVF M;  4JKG A;  3DXM B;  4H5R A;  3E1Y A;  1NGE A;  3GLF A;  1IY1 A;  2ASM A;  2A5X A;  4H5N A;  3O08 A;  2E2O A;  3MMV A;  4G4Q A;  2RHK A;  3DWL A;  2ZBK B;  5TKY A;  4FCT A;  5JI3 E;  4BLC A;  2XZF A;  3RE8 A;  5HL7 L;  3ZET B;  1K73 O;  3C7N B;  2Y0T A;  4JN4 A;  1OFH A;  3DA1 A;  4REZ A;  1DEJ A;  1HQC A;  3ZX3 A;  2ZJQ L;  4IJA A;  5F2R A;  3OA9 A;  4B1V A;  2HMP A;  3O80 A;  1E4G T;  2HOE A;  3HBT A;  1QAM A;  2YI1 A;  4YOV A;  2F5O A;  4DB3 A;  3HJ8 A;  4IBF A;  3AAR A;  5AQL A;  3ATV A;  4L4U A;  5BR9 A;  4GIT A;  3CIP A;  4YOY A;  2I7N A;  1N34 M;  2QWR A;  4BB9 A;  5TKW A;  4GV6 A;  4PKG A;  2P9K B;  5BPV A;  4DUZ M;  2NRZ A;  3BUZ B;  4GIP A;  5GIO A;  5EP3 A;  3JAM S;  2AA4 A;  3U9Z A;  3EIH A;  3U6O A;  3GRR A;  2ITM A;  2R4E A;  5AZI B;  3O9T A;  3U61 B;  1HKC A;  4B9Q A;  3W0L A;  3JS6 A;  3CCV N;  4G4O A;  2FSK A;  4DUY M;  3O6W A;  4BRK A;  5DM7 L;  5EXT A;  4FWS A;  1HT1 E;  3U61 A;  5I9E B;  5AQU A;  5C2F A;  3FTD A;  4LG2 A;  2ZF5 O;  3CCL N;  3HU2 A;  1FJG M;  3I56 N;  3VTH A;  4NLB A;  3SMP A;  4DV5 M;  3ENB A;  2DVW B;  3HKP A;  4CHT B;  3WHL A;  3GLH A;  1M90 O;  1GL7 A;  4JK7 A;  1QZ5 A;  1YUW A;  1YSY A;  1X3M A;  3CPE A;  4O5F A;  3C6A A;  4KH4 A;  3BF1 A;  4H5V A;  3HHY A;  2ZJR L;  3C65 A;  5BRF A;  4A5A A;  4AF1 A;  5C12 A;  3SJH A;  4C1N I;  2XSZ A;  1R2Z A;  4RF0 A;  2AP1 A;  2L7H A;  4MDA A;  1IBK M;  2K47 A;  4JI7 M;  3K8Z A;  1OKJ A;  3R8E A;  1N78 A;  3ZYY X;  1VQO N;  3GL1 A;  3NWL A;  4NL4 H;  3CI5 A;  2P9I B;  3CJ7 A;  4I81 A;  1NHW C;  3VES A;  3VEN A;  2Z4S A;  1TDH A;  1YF5 L;  3MX2 A;  3VEO A;  5JVH L;  1NJG A;  4FWQ A;  2HBK A;  3O9R A;  2E5L M;  1HKB A;  3TTF A;  3D2E A;  1GLE G;  2ZGY A;  3FZF A;  1QQM A;  3FR0 A;  3FTF A;  3ZX2 A;  5M1Q A;  1G41 A;  3VKG A;  3TTD A;  3IG8 A;  2G8L A;  3THG A;  4KO8 A;  5CE3 A;  3CCU N;  4JK9 A;  4BR5 A;  3GPY A;  1VQ4 N;  3QBW A;  3P38 A;  1JR3 D;  3AOG A;  5FTN A;  5BPM A;  2EA0 A;  4IO9 L;  3CJC A;  2Q2R A;  1DGB A;  3LDO A;  3VKH A;  2P9U A;  3D2F A;  4AI6 A;  4CI6 A;  3F9M A;  3O1B A;  3RVC A;  2LNH C;  4KHP M;  3LQR A;  3SAR A;  2CGK A;  3WXL A;  2ASO A;  2YJE A;  4OPA A;  2YHX A;  3EO3 A;  3UJN A;  4FOE A;  4XBO A;  1VQ6 N;  3UKU A;  4JHD B;  5AQY A;  4NXM M;  5IRE B;  3TE6 A;  3TL4 X;  5KPZ A;  3FZL A;  5FPN A;  4LJ9 A;  3OHR A;  3T15 A;  3U6S A;  1QVR A;  2R45 A;  4AG6 A;  5GAE P;  4NSO B;  3SAV A;  1ORY B;  4FO0 A;  5ITX A;  4WW0 A;  3LM2 A;  1L1Z A;  2E1Z A;  4NB4 A;  4NSR A;  4HTL A;  4GKJ M;  1BU6 O;  1KQS M;  1SXJ B;  5AQO A;  2XFT A;  3KP1 E;  1HNX M;  4BC3 A;  3K9K A;  1N36 M;  2VII A;  3MX5 A;  4DR4 M;  3FD9 A;  4KOD A;  4IBK A;  4MLH A;  3SK3 A;  3EKU A;  4JI3 M;  5H1S Q;  4GVE A;  4JKB A;  3I55 N;  5JI2 E;  3GQ5 A;  2D0P A;  4K25 A;  3MN6 A;  3TSP A;  4NRV A;  1Z5A A;  3R6M A;  2YQZ A;  4G9Z A;  3A42 A;  1HNZ M;  1WUA A;  4BQZ A;  1QZM A;  2YHW A;  5JLH A;  2NRH A;  2BJW A;  3E9L A;  1I4W A;  1XUP O;  1MWM A;  3H1V X;  4A2B A;  5H37 D;  3KWI A;  2XZU A;  2DWM A;  1RFQ A;  3A5L C;  5AZI A;  3H1Q A;  3CCE N;  1R7R A;  4GHA A;  3M5R A;  4L16 A;  1HR0 M;  2KHO A;  3EIE A;  3R9P A;  3T1Y M;  3QWL A;  2GEL A;  4X64 M;  2DZN B;  4JYA M;  2F5N A;  1TUU A;  3LM9 A;  4JI1 M;  5F3W A;  4ILJ A;  3CF2 A;  5EXP A;  4H0V B;  1BUP A;  2HBM A;  4CJ7 A;  4A59 A;  1MWK A;  1TH4 A;  5LMN M;  4LJ8 A;  2P9P B;  2QZ4 A;  4M7X A;  3GOI A;  4AKI A;  4PDI A;  3CF6 E;  4BR7 A;  1XXH A;  4B1W B;  3HM8 A;  4EIA A;  2YHY A;  2QWO A;  3WQT A;  3MN9 A;  1MX0 A;  4DR5 M;  5BN8 A;  1NNJ A;  2H1R A;  3HU1 A;  2F5P A;  4PL8 A;  3TSU A;  1T6C A;  3O1W A;  2R4J A;  3MK6 A;  4GH9 A;  1L8Q A;  3BOS A;  2QBY B;  3ZEU B;  3CF5 L;  3DLL L;  4BR4 A;  1NVM A;  1D2N A;  5EX5 A;  5ITY A;  1SAZ A;  3H3N O;  5KPT A;  5JVG L;  3J7Z O;  2DWL A;  1QAQ A;  4DR7 M;  3L29 A;  4B7G A;  1E9S A;  3K92 A;  2QI2 A;  3KWG A;  1SS6 A;  1H6U A;  2F7T A;  2V51 B;  4FOI A;  4RNA A;  2CHQ A;  3WQU A;  2CGL A;  1N77 A;  3A0I X;  3FUW A;  5AQF A;  4GV9 A;  3UMM A;  3J7B A;  4QOS A;  4BRQ A;  1X37 A;  1KAX A;  3VF6 A;  5FSW A;  1C0G A;  4BVO A;  3L4Q A;  1XNQ M;  3E66 A;  3SAH A;  1TDZ A;  4LF4 M;  4DV4 M;  1IY2 A;  4HLQ A;  4FW9 A;  2NRW A;  2P9U B;  1QAN A;  5DNY A;  1K3W A;  2UXD M;  1IXR C;  3KSJ A;  3KZB A;  2KA6 B;  1J6Z A;  3MHV C;  5EP2 A;  1VQK N;  2DWN A;  3DFZ A;  3KK7 A;  4YOU A;  3CJA A;  3HGI A;  5AFU A;  5KO3 A;  3F5T A;  1TUY A;  5AQJ A;  1IN7 A;  3CF0 A;  1ZAE A;  2KRK A;  2I7P A;  1YI2 N;  3KOY E;  1IQP A;  4EFH A;  3VK8 A;  4IEE A;  3UKR B;  2QEX N;  4JV5 M;  4G4R A;  3U8X A;  1X3N A;  3PVS A;  1R2Y A;  3IKM A;  5BRD A;  3VK7 A;  3WXM B;  4BRA A;  3O4W A;  4MM3 B;  4B7H A;  1LCU A;  2PFU A;  3FFK B;  4D82 A;  1D4X A;  3KDS E;  4CZE A;  2E88 A;  1YVN A;  1KD1 O;  4W5W A;  3ZEU A;  5KPR A;  3U6C A;  1CZA N;  1GLJ O;  2V52 B;  3CJ9 A;  2AHM A;  4KLN A;  3B8A X;  2R46 A;  3TPZ A;  1NJI O;  3E9O A;  2HF4 A;  3EZW A;  4I5S A;  2IVN A;  4NXN M;  2A40 A;  1GVN A;  3VOV A;  1NNU C;  1XNR M;  4DQ8 A;  2HCB A;  2P9L A;  4IEI A;  3HHZ A;  3P39 A;  4CZH A;  2XGN A;  1NM1 A;  5IT9 S;  5M1K A;  2P9P A;  1S72 N;  5M1F A;  4BRM A;  2EO2 A;  3HSC A;  4IJE A;  1SXJ E;  1GLF O;  2E2P A;  2QA4 N;  4D80 A;  1T3T A;  5EQT A;  4MDB A;  3OBY A;  3FZM A;  4M63 C;  5M1N A;  3B9P A;  4GV3 A;  3HWS A;  4FWD A;  3IG5 A;  3U6M A;  4JKE A;  1PJI A;  4IDH A;  2VGN A;  4IOX A;  1T3V A;  4BRO A;  4GY2 B;  2NLX A;  5AQK A;  4JI2 M;  3KOZ E;  2C98 A;  4I4L A;  3GP1 A;  5BRH A;  4GKK M;  1NLV A;  4BC5 A;  3E9P A;  3LDN A;  4CZJ A;  3GQ3 A;  3KOX E;  4IXC A;  3I33 A;  3GLF B;  1Q3B A;  4OVZ A;  3K1J A;  1NGF A;  3PNY A;  4PHT X;  3EE8 A;  5EXS A;  3GLG B;  1XMO M;  2P9N B;  3VF4 A;  4GHL A;  3G25 A;  3P31 A;  1NGI A;  4CBX A;  3ID8 A;  3CXC M;  3DJC A;  4M9Z A;  4ZPX A;  3TSQ A;  4JI8 M;  4JXJ A;  5BRE A;  4BRI A;  3FUV A;  1DKG D;  4FVM A;  1Z05 A;  3M7G A;  1YIJ N;  3J7A S;  2FSN A;  4WF9 L;  5ITQ A;  4CGY B;  3M6G A;  3IMX A;  4AKH A;  2C96 A;  1XHB A;  3R8F A;  2FOI C;  4BRL A;  3L27 A;  4A5B A;  1Z6T A;  2R18 A;  1IBM M;  1N32 M;  4A62 A;  2V7Z A;  2M5Z A;  3VGK A;  3VF2 A;  2A5Y B;  4LF5 M;  3VEX A;  5M1O A;  3SFZ A;  4B1X B;  4EIW A;  1L2D A;  4I6M A;  3U60 B;  3EKS A;  4BBA A;  3A45 A;  2EUC A;  1GLL O;  5KQ8 A;  4PKH A;  2OPF A;  3N4P A;  1K9M O;  3GRU A;  2CH6 A;  3D2F B;  1QYR A;  3VEW A;  1VQM N;  4L8R C;  3GO8 A;  4D81 A;  3U6P A;  2CE7 A;  4YY3 M;  4B08 A;  4Z94 A;  1KC8 O;  2C9O A;  4AW4 A;  2JA2 A;  4JKD A;  4RWT A;  5ITR A;  3CCJ N;  3HHW A;  1I94 M;  2QWL A;  5EXW A;  3UKU B;  4F9O A;  4YHH M;  3ENH A;  3IUC A;  4H5T A;  2CFO A;  3NVM A;  5CHI A;  1XQS C;  2L09 A;  1V4T A;  5AQW A;  4I6M B;  1VQL N;  4IZ9 A;  4ISE A;  5AQN A;  4ISF A;  3IFR A;  2UXC M;  4PCZ A;  4Y0W A;  3H6E A;  2ZJP L;  2P9L B;  2Y21 A;  3AAP A;  3HI0 A;  1DT9 A;  3MCA B;  4ITQ A;  3SYL A;  4LY6 A;  4G4N A;  2L6O A;  3VLF B;  2D0O A;  4ILG B;  3GE1 A;  3U9D A;  4WQ5 A;  3SC3 A;  2A3Z A;  3C7N A;  3CPW M;  1KYI A;  3AAQ A;  4DV0 M;  4FD2 A;  1E9R A;  1S22 A;  4BG9 A;  1Z5B A;  4K43 A;  4WFA L;  3KS8 A;  1TYQ B;  4DCH A;  3NMU A;  4OU7 A;  1DO0 A;  4MGY E;  3CQX A;  3MWT A;  2XSZ D;  3U5Z A;  1NY5 A;  2EWS A;  4FWL A;  5JIC A;  4P16 A;  4BRH A;  4PL7 A;  4Z6Y A;  1Z59 A;  1ZBS A;  2F4V M;  2E2Q A;  5GIP A;  3T69 A;  4K42 A;  4MGZ E;  4B3S M;  1NY6 A;  3A98 B;  2VQF M;  5AR0 A;  4DV2 M;  3EL2 A;  3IDH A;  3QFP A;  2ZWH A;  4LRS A;  4H0O A;  4GNI A;  2HBL A;  1YUB A;  4IWV A;  3OTO M;  1O13 A;  3KVW A;  3KHY A;  3TWL A;  1DGF A;  5DYG A;  3KXE C;  3R3L A;  5E26 A;  3EN9 A;  4QS7 A;  3CME N;  4S12 A;  5AQP A;  2V1C A;  1IN4 A;  3ZCB B;  2GTD A;  3AOE C;  1QQO A;  2XH9 A;  3Q7C A;  3CTW B;  2UXB M;  1SXJ A;  2X8A A;  2PAV A;  3QIC A;  2CEA A;  2VQE M;  2Q0U A;  4BRN A;  4JD2 A;  3SAS A;  4JI6 M;  4CZK A;  2NQ8 C;  3KSX A;  1IY0 A;  3F2K A;  1NSF A;  4X66 M;  1DO2 A;  4BRC A;  3BEX A;  3VDP A;  3SAG A;  2Q1N A;  3L28 A;  4FPA A;  1KSF X;  1YHQ N;  4MGI E;  2G5G X;  2BTF A;  4XEI A;  3JR5 A;  1R6B X;  1NMD A;  3SMS A;  1BWF O;  2E20 A;  1YJW N;  2HF3 A;  2W82 A;  3GG4 A;  1WOQ A;  2Q36 A;  4E1J A;  2FSJ A;  3JXU A;  1L2B A;  2FNA A;  1JCE A;  2CUZ A;  2RKO A;  3FGU A;  3KOW E;  2VYP A;  1BDG A;  2BJV A;  3VGM A;  3SBT A;  1SQK A;  4DKW A;  2KZU A;  4CZF A;  4FWN A;  2HKJ A;  4R7G A;  3CC2 N;  3A8Y A;  4WFB L;  1W2B M;  4R79 A;  1HKG A;  4LF8 M;  1RDU A;  3H4M A;  1ATS A;  3R1X A;  3HJQ A;  1ATN A;  4IOA L;  4XH5 A;  4MB7 A;  2Q31 A;  1XWI A;  1MDU B;  2P9I A;  4JKA A;  3VPZ A;  4QNR A;  5GAD P;  3KS4 A;  2OAN A;  2DXI A;  3OBW A;  4JNE A;  1ZC6 A;  4AM6 A;  2XFS A;  2QP9 X;  3QBX A;  3E4R A;  3HOS A;  1VQ7 N;  1H1V A;  4LFB M;  3U6E A;  3DAW A;  1TYQ A;  1HQY E;  3O9U A;  1XC8 A;  4M0W A;  4PDG A;  1E94 E;  3M0E A;  4PD2 A;  4FWO A;  1TH2 A;  1SXJ C;  4LRT A;  2OTL N;  2NNW A;  1ILY A;  5AQV A;  3SAU A;  1KAZ A;  3HZ6 A;  2ZAO A;  4L15 A;  2M60 A;  3HHX A;  3S41 A;  4MO5 A;  4WQ5 C;  5EVZ A;  2BH1 A;  2VWB A;  1YE9 A;  3N4Q A;  1NBW A;  3O9Q A;  4KH6 A;  4BVP A;  4BRF A;  1G99 A;  4QS8 A;  4ISG A;  2GEM A;  3VEV A;  4R3D A;  3Q8X A;  4MH0 E;  4H0P A;  4FWR A;  3PLA A;  3AKZ A;  1HX1 A;  1W97 L;  5DM6 L;  3VEZ A;  3FKE A;  3L2A A;  2UUA M;  3D8L A;  1Z5C A;  4YOR A;  4CZM A;  3AGR A;  1OJL A;  3ID6 A;  2IVP A;  3HOT A;  2FF6 A;  5MLC Q;  1N33 M;  2V6Z M;  1VQ8 N;  3W0L B;  3FYC A;  1P8Z A;  2LWX A;  5ELZ A;  4X65 M;  3TPQ A;  1BA0 A;  1IG8 A;  5IZ7 D;  1IXS B;  3PIO L;  4FVU A;  3FUU A;  3G71 N;  2P9K A;  2DPN A;  4BY9 C;  3RGS A;  4JKH A;  1IN8 A;  1JCG A;  2ZGZ A;  2ZAN A;  3FE1 A;  3KP0 E;  1QHA A;  3VER A;  1NGC A;  2NRX A;  2XF3 A;  5EOY A;  4BQL A;  3AFH A;  1C0F A;  2WC9 A;  1NGB A;  3L0Q A;  2D7G A;  4DV3 M;  1BO5 O;  4J8F A;  2O5R A;  5AQZ A;  2VCP A;  4BC4 A;  4PT5 A;  4CD1 A;  4IOC L;  5GAH P;  3D8B A;  4LJ4 A;  1IN5 A;  1RGI A;  3VEY A;  1YIT N;  3FTC A;  3LL3 A;  4MGH A;  1RDW X;  1GKI A;  1YXQ A;  3MN5 A;  3CHW A;  2F9T A;  1KXP A;  4DHY A;  2BNK A;  4LJ5 A;  4MGK E;  4A3V B;  1M1K O;  3SLC A;  4O8K A;  5EY4 A;  1EO1 A;  1FNN A;  3KVG A;  3H46 O;  3CJB A;  3TQS A;  3LVV A;  2KRU A;  3L4I A;  2A42 A;  1W5S A;  4M7Y A;  5CR4 A;  2W40 A;  2D7H A;  2QWN A;  4FCV A;  4FWH A;  5DYI A;  1NJF A;  3AGK A;  4C1N K;  1DGK N;  4LJA A;  1QZ6 A;  1OVY A;  2Y20 A;  3MDQ A;  5EP4 A;  3T7Z A;  3Q7B A;  4FPB A;  1VDD A;  1IBL M;  4FWG A;  2YX6 A;  3J81 S;  4LCB A;  1N8R O;  2LXE A;  4WCE L;  2V7Y A;  4PKI A;  5M1P A;  3LMM A;  4IBB A;  3H45 C;  4JI5 M;  3TU5 A;  4LJ6 A;  1MU5 A;  2Q0R A;  3M1F A;  2HHH M;  3DZD A;  4XGI A;  3TWK A;  1VQN N;  2DZO B;  1SZ2 A;  2QBY A;  1N75 A;  2KW0 A;  3A5N C;  1XMQ M;  1Q3C A;  5F0X A;  4BRG A;  1KFV A;  1EE8 A;  4IBJ A;  5E84 A;  2C5R A;  1Q86 O;  1JCF A;  4QNM A;  4JHD A;  2E1Y A;  3H3O B;  3BP8 A;  1GLN A;  4II7 A;  4A61 A;  1G3I A;  1J5E M;  3DXK B;  4BC2 A;  3C6H A;  4G6Z A;  3GPU A;  3W3D A;  3A5M C;  4LGY A;  3KW6 A;  1DGH A;  4DR3 M;  2WBN A;  1Y64 A;  1JQJ C;  3UB5 A;  2D1K A;  5AZJ B;  4RTF D;  2QWQ A;  5AQT A;  3GPP A;  2Y0Q A;  5FTK A;  1U2V A;  5ADX A;  2IIR A;  5LY3 A;  2Q97 A;  1K3X A;  3MN7 A;  4BGA A;  4NLC A;  3AJI B;  3CC7 N;  4B1Y B;  2Z3X A;  5FLX S;  2KEB A;  1SXJ D;  5FPE A;  3A5O C;  1HLU A;  1ZQ9 A;  2YCH A;  4OPH A;  3D6R A;  2X49 A;  4L3Q A;  2NRV A;  2RGH A;  3U6L A;  1K82 A;  2GX9 A;  4LGM A;  1VQ9 N;  3CER A;  4Z8X A;  4EHT A;  1VQP N;  3U5Z B;  1QQW A;  5AQQ A;  3FZK A;  3FTE A;  3T38 A;  1X9J A;  5ITX E;  2FFJ A;  2J4R A;  3QFU A;  4YOT A;  3SAF A;  3J2P B;  1BG3 A;  2CV0 A;  1C1K A;  4B3M M;  3VGL A;  3VDU A;  2KLA A;  3L6Q A;  4B3R M;  4LZJ A;  2P5T A;  1HUX A;  1IXZ A;  4BRE A;  3MCP A;  4NO7 A;  2GWK A;  3SHG B;  2NZT A;  2R65 A;  4JKC A;  3LVW A;  2PBD A;  4IJF A;  5AQM A;  4RCH A;  1WXQ A;  5A2Q S;  3HTV A;  4JN6 A;  1NHG C;  3RSE A;  3KFU G;  1P90 A;  2NRR A;  1K8A O;  4C23 A;  1VAZ A;  2KXE A;  1HJO A;  2CHV A;  3CQY A;  2JWK A;  1J09 A;  5C0Y A;  4A57 A;  3PXG A;  4OX9 M;  3DXK A;  4GMQ A;  4B1Z A;  1T6D A;  4RF1 A;  3MWP A;  4IIW A;  4K41 A;  4X62 M;  3VFD A;  3C58 A;  3ATU A;  3QML A;  4AQY M;  4A2A A;  3DOA A;  2HST A;  3EE9 A;  5JLF A;  5IWA M;  4KBO A;  3SAT A;  4JKF A;  1Q39 A;  2L7I A;  5F1X A;  4BRP A;  4IJN A;  2F9W A;  1PJJ A;  5BPN A;  1YJ9 N;  4AKG A;  2ERC A;  2CV1 A;  4WYB A;  3SYK A;  2HBJ A;  4U67 L;  1TGU A;  1V4S A;  3GQ4 A;  1HNW M;  4BR2 A;  2X4A A;  2P9S A;  3GRV A;  3HRG A;  1XXH B;  3I4Y A;  5GKN A;  3OW2 M;  2WFB A;  3T1H M;  5EJC A;  4DV7 M;  3W0F A;  1NGG A;  2GWJ A;  2FXU A;  2YJF A;  2BUP A;  5AFU H;  3FLC O;  3LQQ A;  4LZZ A;  3GBT A;  7CAT A;  4BGB A;  1DGG A;  4XH1 A;  5C18 A;  2FE8 A;  1NGH A;  1XC3 A;  2QWM A;  2Z7J A;  4FL9 A;  1Q7Y O;  3BF3 A;  4DV1 M;  4LJ7 A;  4OVZ B;  4AG5 A;  4NRW A;  3ENO A;  2ASP A;  2R62 A;  3WT0 A;  2W41 A;  2UUB M;  1EQY A;  3CD6 N;  4WQ4 A;  4LF6 M;  1ATR A;  1BOT O;  2A41 A;  4FWK A;  5EXX A;  4K0K M;  3CCS N;  3WEE A;  1Z6R A;  4CZL A;  3AY9 A;  2J7N A;  1QVG M;  4IFE A;  3PIP L;  3WEE B;  1W5T A;  5FTL A;  2ZAM A;  3CET A;  3UGJ A;  3A46 A;  1E4F T;  4H0T B;  3CCQ N;  1JR3 A;  3PNV A;  3L26 A;  5ITT A;  2QXL A;  1T44 A;  3UZU A;  4H0X B;  3G6E N;  4M9X A;  4M9S A;  1S3X A;  4WUR A;  4FWM A;  5LMU M;  1G4A E;  5BR8 M;  1U6Z A;  1GLD G;  2RE2 A;  1NGA A;  4LF7 M;  4GRI A;  2GUP A;  5AZJ A;  2QEN A;  1K8K B;  1NWK A;  4B7F A;  2F5S A;  3E9S A;  3M3Z A;  1GLB G;  4AM7 A;  1TH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...