5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
4LF9M 5ITXE 4PDGA 3GPUA 4DV4M 3VK8A 4DV0M 4JYAM 3A42A 5FLXS 1L2BA 3SARA 2Q2EB 4NRVA 1FJGM 5LMUM 3SBJA 1XC8A 1PJIA 4ITQA 4JI8M 1K3XA 2HHHM 1J5EM 3DOAA 4B3TM 4JI3M 4DV2M 4B3RM 4G4QA 1R2YA 4DR7M 4JI7M 4PCZA 2F5OA 1Z59A 4LF4M 2F5NA 4NRWA 4YY3M 2UXCM 1Z5CA 1N33M 4KHPM 4DUZM 2EA0A 3GPXA 4JI6M 3SAVA 3C58A 5LMNM 4LF6M 2XZFA 4LFAM 1Z5AA 3JR4A 4G4OA 1NNJA 1HNWM 3JR5A 1I94M 1IBKM 4DUYM 2F5SA 4DV3M 3J7AS 3J80S 3GQ4A 1N36M 3U6CA 1K82A 4LFCM 1XNRM 5BR8M 1L1TA 2F5QA 4DR4M 3GPPA 4LF8M 3TWMA 5ITUA 3TWLA 1Q3BA 3T1HM 1TDZA 3U6OA 1IBMM 4LFBM 4JI0M 2UXDM 4MB7A 1K3WA 3GQ3A 2OPFA 4PD2A 3W0FA 4DR3M 1MU5A 4G4NA 4DV1M 2VQEM 3SAWA 4X65M 1PJJA 1XMQM 1L2CA 4B3MM 1N32M 2F4VM 3A46A 4NXMM 1N34M 2OQ4A 3JAMS 3GP1A 3GQ5A 3GPYA 3U6QA 4JI1M 1R2ZA 4DV6M 4JI4M 1L2DA 3T1YM 2E5LM 4B3SM 4LF7M 2XZUA 2HKJA 4GKKM 1HR0M 4JV5M 3U6DA 1KFVA 2UUCM 4G4RA 1MX0A 1HNXM 4K0KM 5ITQA 1Z5BA 4OX9M 4DV7M 3OTOM 1Q3CA 4PDIA 4YHHM 1XNQM 2ZM6M 2UUAM 2VQFM 3U6PA 4CISA 4X64M 3U6EA 2UXBM 4DR6M 4DR2M 1Q39A 3U6SA 1XMOM 5ITYA 4X62M 3U6LA 2F5PA 2UUBM 3U6MA 3SASA 1PM5A 5ITRA 3J81S 3SAUA 3SATA 4GKJM 1HNZM 5ITTA 4DR5M 3A45A 3VK7A 5A2QS 3GO8A 4NXNM 2UU9M 5IT9S 5IWAM 4DV5M 3TWKA 4DR1M 1L1ZA 1IBLM 4AQYM 4LF5M 1TDHA 5ITXA 4X66M 2ZBKB 4JI5M 4JI2M 1EE8A
chains in the Genus database with same CATH superfamily
1IN8A 5EXTA 3GLHA 4LF9M 1MN3A 2Z4RA 5EXXA 1QZEA 3TE6A 3T6PA 3TQSA 5EXSA 1E9RA 1NJGA 4JYAM 4FD2A 3AKZA 3FUXA 3L26A 3KS8A 2LHCA 2QBYA 1LV7A 2LBCA 2YFQA 1SXJB 2ZANA 3U5ZB 1XC8A 1FJGM 1NNUC 4BB9A 1VQ1A 1OIPA 2KXEA 1K3XA 3KDSE 1J5EM 2JZ0A 3DOAA 4JI3M 3PNVA 3IG5A 3GLHB 4PCZA 2Y0QA 2DWLA 2F5OA 5EP1A 1WIVA 4Q7JA 4YY3M 4L8RC 1JR3D 4IBFA 2EA0A 3GPXA 3FUUA 2N35A 3HJQA 1E32A 3C58A 2XFSA 1YE9A 4OU7A 4AKIA 4RKUF 4MGHA 1G71A 1ZV1A 4B7HA 3HX3A 4LJAA 3K8ZA 1HNWM 4L78A 2K6BA 2X4AA 4NSRA 1I94M 3GLGB 1KSFX 1IN7A 4LJ9A 1OAIA 3AOEA 3J80S 5FTJA 3GQ4A 4AI6A 1GVNA 2C9OA 4LFCM 1L1TA 1OQYA 2DAKA 1QANA 1QUSA 1VDDA 1GKIA 2QENA 3M7GA 3LVWA 2K0BX 3TWMA 2KNVA 1IY0A 2FS1A 4LJ8A 1PRBA 1QDRA 3LVVA 1GL7A 2B3TA 5IREB 3W68A 2C5RA 4JXJA 3GQ3A 3VFDA 2R4EA 2HAKA 1IQPA 4FCTA 2RKOA 1MU5A 2Z8YM 3PVSA 2VQEM 3KOXE 1N75A 3HHYA 3FUWA 1PJJA 3KOYE 1XMQM 1N32M 1IN5A 2GQFA 1IN4A 4KODA 2H5XA 4NXMM 4FW9A 7CATA 5KQDA 1DGBA 3U6QA 3CTWB 4FWDA 4DV6M 4BLCA 3WHLA 2XEPA 2C98A 2HKJA 1HR0M 2DNAA 3H4MA 4JV5M 2G5GX 3U6DA 3U60B 1SXJE 2WSFF 8CATA 3MMPA 3SFZA 4F2LA 4G4RA 1DGHB 1G59A 2V1UA 1MX0A 1HNXM 4K0KM 2Z7JA 1IY1A 1TTEA 1XXHA 3AL0C 2FFJA 4IBEA 1SXJA 3U5ZA 1Q3CA 1X37A 4IBCA 4KO8A 4GIPA 4REZA 3Q8GA 2ZM6M 2M60A 3GLIA 1OJLA 4BBAA 2EJSA 2VQFM 2UUAM 1Z6TA 3HJSA 3LCVB 2FH0A 3U6EA 5FSWA 2ZAOA 1G4AE 2DI0A 2MROB 2ZTCA 5EP2A 1IXZA 2KEBA 2Z4SA 3GRYA 3KW6A 1WR1B 3GLFE 3UGJA 1XMOM 2WSEF 4D80A 2UUBM 3B7ZA 4XK8F 3GLFA 3K1JA 3FD9A 2L7IA 3KS4A 1QVRA 3J81S 4GKJM 3W0LB 3FYDA 2DZOB 4RNAA 5ITTA 3KP0E 3I51A 2DWNA 1V92A 4FVMA 4II7A 2LHGA 4QNRA 3VK7A 2DXIA 4TUWA 4DV5M 2KDLA 1E94E 2XF3A 4LRSA 5ITXA 4JI5M 3HU3A 2XFTA 2X49A 1CUKA 1EE8A 5E6JA 5EP3A 2CHVA 3E21A 4XGIA 1NV8A 4CIZA 4DV4M 3VK8A 3CF2A 2BWEA 3J2PB 1L2BA 3SHGB 3SARA 2MR9A 1N78A 2Q2EB 4ITQA 3SBJA 1PJIA 3IG8A 2QBYB 2DAIA 3SYKA 3GLFB 4G4QA 3A98B 1NJFA 1R2YA 4M9XA 3R9XB 2HWJA 2BJWA 1ZMVA 5E26A 4LF4M 3FRHA 1NV9A 4MGZE 4NRWA 3HHWA 2DHYA 4KHPM 1D0MA 2MH8A 3SAVA 1GABA 2KNAA 1AIPC 1QAOA 3FRIA 1D0LA 3HHXA 3HWSA 2XZFA 5DYGA 3HHZA 2VIIA 2C9CA 2DWZB 3PXGA 2CV1A 1Z5AA 2LVNC 4B7GA 1NNJA 4HL4A 1XXHB 3AOGA 1TH3A 3THGA 4L4UA 4NL4H 1F4IA 1T43A 4GITA 4OVZB 5EQTA 1XNRM 4DR4M 3GPPA 1OFHA 3SAUA 3GLGE 3ZC7B 3ILKA 4KT0F 2QNJA 2LH0A 1IBMM 3HJ8A 4LFBM 1Y8GA 4LRTA 4JI0M 1IXRC 2DVWB 2OPFA 3D8LA 2J7NA 4CGYB 3K9PA 5FTNA 3TL4X 4IBGA 3RE8A 4DV1M 2H1RA 1NY5A 3FTCA 3GRRA 2EO2A 4B7FA 3WHKA 1L2CA 4GC9A 1D0KA 3D8BA 5EJCA 3SMSA 3KSXA 3UMMA 3AJIB 1PGYA 3HU2A 3J7BA 3JAMS 3GPYA 4JI1M 1XHBA 4AG6A 4I4LA 2LTUA 5BPVA 3DZDA 1V34A 1L2DA 3GLIB 1GLNA 1XB2B 2VDBB 2J5YA 3T1YM 1G41A 2E5LM 4GKKM 2XLJA 4L15A 1E9SA 1OFIA 2HL7A 2EKFA 1ZQ9A 2DHRA 2L7HA 4EIWA 3U60A 5DFLA 3L25A 1W5TA 2JUJA 2BJVA 3LW5F 2DENA 2RGHA 5KPTA 5GKNA 4GC5A 1HQYE 1QAQA 4M9SA 3HKPA 4GEWA 4CISA 2LVOC 4X64M 1IXSA 3VKHA 2UXBM 3J27B 4AW4A 2KW0A 2V6ZM 1WGNA 4JN6A 3DFZA 1QZMA 2L4EA 3V76A 1GJTA 1R6BX 3BXWA 3SASA 1TR8A 2LNHC 1DGFA 2OO9A 4HEOA 4Z6YA 5DNYA 3SATA 4GHLA 3VKGA 2JY7A 5A2QS 3GO8A 5EP4A 2UU9M 5IT9S 2QCUA 1JR3A 2JY5A 3B89A 3TWKA 4DR1M 1L1ZA 4MM3B 1IBLM 1VG5A 1IFYA 3GLHE 4A3VB 4AQYM 1HQCA 3VDUA 4LF5M 1LTMA 2R6FA 1W5SA 1JQJC 3E9SA 4QNMA 5JI2E 3UJNA 3ZH9B 5FTMA 4PDGA 4LZJA 1GO5A 4M9ZA 1PJQA 4OW0A 3I4VA 3T38A 3GPUA 2CV2A 2W82A 4DV0M 2APLA 1DGHA 4D81A 4L16A 4G3OA 4NRVA 4QOSA 4PT5A 2GNOA 4MH0E 1DV0A 1C1KA 2HHHM 1DO2A 3FTDA 4QHSA 4DV2M 4B3TM 2C99A 5EXPA 1QQWA 2R46A 3F92A 2WZJA 1Q02A 2C96A 3B7NA 3EIHA 2F5NA 3C3EA 3GRVA 3KOZE 4MGKE 2JY6B 1H6UA 1Z5CA 2EUCA 3B9PA 1G3IA 3E46A 2L6OA 3HZJA 3L29A 4UN2B 4DUZM 4IIWA 3MHVC 1R5LA 2QPAA 2DZNB 2YR0A 2Y20A 3QAUA 2R65A 3KVWA 1JB0F 4LFAM 2L09A 3U61A 3JR5A 1IBKM 2QHOB 4DUYM 3J7AS 1N36M 2JWSA 2O25A 4QHTA 3U6CA 1K82A 1EFUB 5BR8M 1NHGC 1VEGA 2JZ1A 2F5QA 4M0DA 4M0WA 4LF8M 2P5TA 1IXSB 2JXNA 1Q3BA 3T1HM 1OIZA 2FOIC 3GLGA 1TDZA 2UXDM 1TGUA 1K3WA 3QYEA 1G8PA 4L6V6 1ZAEA 1HJPA 3I01M 1EIJA 3W0FA 4WP2A 4Z8XA 3B74A 3FTFA 4G4NA 1QAMA 4NC6A 4CJ6A 1P3QQ 4S12A 3SAWA 4G6ZA 4LZZA 4FCVA 3FUTA 3GRUA 4X65M 5KPRA 4B3MM 2CHQA 1WGLA 2DAGA 1J7KA 2FE8A 2HCBA 4FWHA 3A46A 1VEJA 1N34M 1WHCA 3GQ5A 2JP7A 4LCBA 4LJ5A 2L4FA 1ZMWA 3PFIA 3I4YA 3W67A 4JI4M 2OOAA 3KFUG 4AKHA 4DBGB 4B3SM 2Y21A 2KRKA 4I8OA 3RGSA 1KFVA 4MGYE 3CF0A 3R8FA 4NSOB 1OTRA 4GRIA 2DAEA 5ITQA 1Z5BA 3K2LA 3VLFB 4DV7M 4XBOA 2Y0TA 3L28A 3KOWE 4AKGA 2O5RA 2RRUA 3LQQA 3L2AA 4IJEA 2XSZA 2AHMA 2I7PA 1MJGM 1IY2A 1YUBA 4DR6M 2ZTDA 2LVPC 4DR2M 2G3QA 2K47A 4I81A 2KA6B 3ZCBB 2M5ZA 1OKSA 2QP9X 5C1BA 4X62M 1HT2E 3U6LA 1N77A 4GMQA 2R18A 3M6AA 1VDLA 1PM5A 2KZUA 2CP8A 1L8QA 1S3SA 4GHAA 2R45A 5F3WA 1JR3E 1IN6A 3LCUA 4AZFA 1J09A 2KRUA 1BVSA 1WXQA 5IWAM 1GJSA 4LGMA 3NBXX 4RF1A 2R4JA 3HU1A 1PJSA 1NSFA 4LJ7A 3E4RA 2XGNA 4MGIE 1SG9A 2A5YB 1UFZA 5KO3A 4JI2M 1TF0B 2QSFX 3RFWA 5ITXE 2CRUA 3MK6A 3IHPA 1FNNA 2LVQD 3UK6A 3QWLA 4ANRA 3CF6E 2VF7A 3A42A 5FLXS 3C3DA 2RGOA 5FTKA 1RU3A 1NVMA 4LG2A 2YNMD 5LMUM 1UM8A 2O01F 4JI8M 3BOSA 1NY6A 1C7YA 4B3RM 1KYIA 4I5SA 4IBDA 4D82A 4DR7M 3CGWA 4JI7M 3LMMA 3FTEA 1Z59A 2QZ4A 2CUZA 2UXCM 1N33M 4AG5A 5JI3E 2R62A 1V33A 5IZ7D 2VF8A 3SMPA 2NQ8C 4GH9A 4JI6M 3ZQJA 5L8RF 4W5WA 1QYRA 5LMNM 4LF6M 3DA1A 1QDTA 2DKLA 1AUAA 4IJFA 3NBIA 3JR4A 4G4OA 5C18A 1D2NA 1T6OA 4IBJA 2KHHA 2QQ8A 3KSJA 1XWIA 2F5SA 2JA2A 5KQ8A 1R7RA 3AOEC 4LGYA 4DV3M 2DZLA 4FWGA 1GL6A 3HY5A 1I4WA 2CE7A 3TPZA 1DGGA 4LJ4A 5FTLA 5ITUA 3TWLA 4B08A 4R7GA 2JNHA 3LQRA 4WURA 3B7QA 4HLQA 3U6OA 3Q8XA 2DWMA 1IM2A 2LVAA 1PJTA 4MB7A 4QOZC 3IECA 3KP1E 2LWXA 1ORYB 2D7HA 4IBBA 3SHFA 4PD2A 2JY8A 3VDPA 5H37D 4DR3M 3K92A 2G8LA 3RGPA 3U61B 3BBZA 5KPZA 2YQZA 2F4VM 3SYLA 4NOOB 3AV0A 3HGIA 2OQ4A 4F1IA 3GP1A 3FKEA 3AFHA 2ZAMA 1R2ZA 4WW0A 2D7EA 2ERCA 3T15A 3NWLA 4LF7M 2BWBA 2V1CA 2XZUA 3C9PA 1R4GA 1VEKA 2D7GA 2K9DA 2UUCM 2BNKA 2CFOA 3H4JA 3UZUA 4CHTB 4OX9M 4IBIA 2XH9A 4LJ6A 2R44A 3OTOM 1SXJC 2KZSA 4PDIA 1OAOC 1SXJD 3M0EA 4YHHM 2XSZD 3PNYA 1XNQM 1TH4A 1XXHE 3FE3A 3U6PA 2CWBA 3QYBA 3L27A 2L2DA 3GLIE 2Z3XA 1Q39A 3U6SA 5ITYA 1A5TA 4OVZA 3MJ5A 4IBKA 4LY6A 2F5PA 3SC3A 2CHGA 4P17A 2CV0A 1ZMUA 2LXEA 1YSYA 3U6MA 1QUTA 3EIEA 2R0IA 3FUVA 5ITRA 1HT1E 2MJ5B 1NO1A 1DO0A 4P16A 4Y28F 1TH2A 2FNAA 4R71A 1HNZM 1YLAA 4DR5M 3I04M 3A45A 2MGWA 3K9OA 2I7NA 1WJ7A 2OOBA 5DYIA 3FYCA 4NXNM 4RF0A 1T3TA 1NHWC 2CEAA 2KNZA 2J7OA 4FCWA 4ZPXA 2X8AA 1TDHA 2WSCF 4X66M 2EKKA 2ZBKB 4KLNA 3KXEC 4R3DA 2DAMA
chains in the Genus database with same CATH topology
1IN8A 5EXTA 3GLHA 4LF9M 2Z4RA 5EXXA 3TE6A 3TQSA 5EXSA 1E9RA 1NJGA 4JYAM 4FD2A 3AKZA 3FUXA 3L26A 3KS8A 2QBYA 1LV7A 2YFQA 3U5ZB 1SXJB 2ZANA 1FJGM 1XC8A 1NNUC 4BB9A 2KXEA 1K3XA 3KDSE 1J5EM 3DOAA 4JI3M 3PNVA 3IG5A 3GLHB 4PCZA 2Y0QA 2DWLA 2F5OA 5EP1A 4YY3M 4L8RC 1JR3D 4IBFA 2EA0A 3GPXA 3FUUA 3HJQA 1E32A 3C58A 2XFSA 1YE9A 4OU7A 4AKIA 4MGHA 4B7HA 4LJAA 3K8ZA 1HNWM 4L78A 2X4AA 4NSRA 1I94M 3GLGB 1KSFX 1IN7A 4LJ9A 3AOEA 3J80S 3GQ4A 5FTJA 4AI6A 1GVNA 2C9OA 4LFCM 1L1TA 1QANA 1VDDA 1GKIA 2QENA 3M7GA 3LVWA 3TWMA 1IY0A 4LJ8A 3LVVA 1GL7A 5IREB 2C5RA 4JXJA 3GQ3A 3VFDA 2R4EA 1IQPA 4FCTA 2RKOA 1MU5A 3PVSA 2VQEM 3KOXE 1N75A 3HHYA 3FUWA 1PJJA 3KOYE 1XMQM 1N32M 1IN5A 1IN4A 4KODA 4NXMM 4FW9A 7CATA 5KQDA 1DGBA 3U6QA 3CTWB 4FWDA 4DV6M 4BLCA 3WHLA 2XEPA 2C98A 2HKJA 1HR0M 3H4MA 4JV5M 2G5GX 3U6DA 3U60B 1SXJE 8CATA 4G4RA 3SFZA 2V1UA 1DGHB 1G59A 1MX0A 1HNXM 4K0KM 2Z7JA 1IY1A 1XXHA 3AL0C 2FFJA 4IBEA 1SXJA 3U5ZA 1Q3CA 1X37A 4IBCA 4KO8A 4GIPA 4REZA 2ZM6M 3GLIA 2M60A 2UUAM 1OJLA 4BBAA 2VQFM 1Z6TA 3HJSA 3U6EA 5FSWA 2ZAOA 1G4AE 5EP2A 1IXZA 2KEBA 2Z4SA 3GRYA 3KW6A 3UGJA 1XMOM 4D80A 2UUBM 3GLFA 3K1JA 3FD9A 2L7IA 3KS4A 1QVRA 3J81S 4GKJM 3W0LB 3FYDA 2DZOB 4RNAA 5ITTA 3KP0E 3I51A 2DWNA 4II7A 4FVMA 4QNRA 3VK7A 2DXIA 4TUWA 4DV5M 1E94E 2XF3A 4LRSA 5ITXA 4JI5M 3HU3A 2XFTA 2X49A 1EE8A 5E6JA 5EP3A 2CHVA 4XGIA 4DV4M 3VK8A 3CF2A 3J2PB 1L2BA 3SHGB 3SARA 1N78A 2Q2EB 4ITQA 3SBJA 1PJIA 3IG8A 2QBYB 3SYKA 3GLFB 4G4QA 3A98B 1NJFA 1R2YA 4M9XA 3R9XB 2BJWA 5E26A 4LF4M 4NRWA 4MGZE 3HHWA 4KHPM 3SAVA 1QAOA 3HWSA 3HHXA 2XZFA 5DYGA 3HHZA 2VIIA 2C9CA 2DWZB 3PXGA 2CV1A 1Z5AA 4B7GA 1NNJA 4HL4A 1XXHB 3AOGA 1TH3A 3THGA 4L4UA 4NL4H 4GITA 4OVZB 5EQTA 1XNRM 4DR4M 3GPPA 1OFHA 3ZC7B 3ILKA 2LH0A 1IBMM 3HJ8A 4LFBM 4LRTA 4JI0M 1IXRC 2DVWB 2OPFA 3D8LA 2J7NA 4CGYB 5FTNA 3TL4X 4IBGA 3RE8A 4DV1M 2H1RA 1NY5A 3FTCA 3GRRA 2EO2A 4B7FA 3WHKA 1L2CA 4GC9A 3D8BA 5EJCA 3SMSA 3KSXA 3UMMA 3AJIB 3HU2A 3J7BA 3JAMS 3GPYA 4JI1M 1XHBA 4AG6A 4I4LA 5BPVA 3DZDA 1L2DA 3GLIB 1GLNA 3T1YM 2E5LM 1G41A 4GKKM 2XLJA 4L15A 1E9SA 1OFIA 1ZQ9A 2HL7A 2DHRA 2L7HA 4EIWA 3U60A 3L25A 1W5TA 2BJVA 5KPTA 2RGHA 5GKNA 4GC5A 1HQYE 1QAQA 4M9SA 3HKPA 4CISA 4X64M 3VKHA 2UXBM 3J27B 4AW4A 2KW0A 2V6ZM 4JN6A 3DFZA 1QZMA 1R6BX 3SASA 2LNHC 1DGFA 4Z6YA 5DNYA 3SATA 4GHLA 3VKGA 5A2QS 3GO8A 5EP4A 2UU9M 5IT9S 2QCUA 1JR3A 4DR1M 3TWKA 1L1ZA 4MM3B 1IBLM 4A3VB 4AQYM 1HQCA 3VDUA 4LF5M 3E9SA 1W5SA 1JQJC 4QNMA 5JI2E 3UJNA 3ZH9B 5FTMA 4PDGA 4LZJA 4M9ZA 4OW0A 3T38A 3I4VA 3GPUA 2CV2A 2W82A 4DV0M 1DGHA 4D81A 4L16A 4NRVA 4QOSA 4PT5A 4MH0E 1C1KA 2HHHM 1DO2A 3FTDA 4QHSA 4DV2M 4B3TM 2C99A 5EXPA 1QQWA 2R46A 2C96A 3EIHA 2F5NA 3GRVA 4MGKE 3KOZE 1H6UA 1Z5CA 2EUCA 3B9PA 1G3IA 3L29A 2L6OA 4DUZM 4IIWA 3MHVC 2QPAA 2DZNB 2YR0A 2Y20A 3QAUA 2R65A 3KVWA 4LFAM 2L09A 3U61A 3JR5A 1IBKM 4DUYM 3J7AS 1N36M 4QHTA 3U6CA 1K82A 5BR8M 1NHGC 2F5QA 4M0DA 4M0WA 4LF8M 2P5TA 1IXSB 1Q3BA 3T1HM 2FOIC 3GLGA 1TDZA 2UXDM 1TGUA 1K3WA 1G8PA 1ZAEA 3W0FA 4Z8XA 3FTFA 4G4NA 1QAMA 3SAWA 4S12A 4G6ZA 4LZZA 4FCVA 3FUTA 3GRUA 4X65M 5KPRA 4B3MM 2CHQA 1J7KA 2FE8A 2HCBA 4FWHA 3A46A 1N34M 3GQ5A 4LCBA 4LJ5A 3PFIA 3I4YA 4JI4M 3KFUG 4AKHA 4B3SM 2Y21A 2KRKA 4I8OA 3RGSA 1KFVA 4MGYE 3CF0A 3R8FA 4NSOB 4GRIA 5ITQA 1Z5BA 3K2LA 3VLFB 4DV7M 4XBOA 2Y0TA 3L28A 3KOWE 4AKGA 2O5RA 3LQQA 3L2AA 4IJEA 2XSZA 2AHMA 2I7PA 1IY2A 1YUBA 4DR6M 4DR2M 2K47A 4I81A 2KA6B 3ZCBB 2M5ZA 2QP9X 5C1BA 4X62M 1HT2E 3U6LA 1N77A 4GMQA 2R18A 3M6AA 1PM5A 2KZUA 1L8QA 1S3SA 4GHAA 2R45A 5F3WA 4AZFA 1IN6A 1J09A 2KRUA 1WXQA 5IWAM 4LGMA 4RF1A 2R4JA 3HU1A 4MGIE 1NSFA 4LJ7A 3E4RA 2XGNA 4JI2M 2A5YB 5KO3A 3RFWA 5ITXE 3MK6A 1FNNA 3UK6A 3QWLA 3CF6E 3A42A 5FLXS 2RGOA 5FTKA 1NVMA 4LG2A 2YNMD 5LMUM 1UM8A 4JI8M 3BOSA 1NY6A 4B3RM 1KYIA 4I5SA 4IBDA 4D82A 4DR7M 4JI7M 3LMMA 3FTEA 1Z59A 2QZ4A 2CUZA 2UXCM 1N33M 4AG5A 5JI3E 2R62A 5IZ7D 3SMPA 2NQ8C 4GH9A 4JI6M 4W5WA 1QYRA 5LMNM 4LF6M 3DA1A 4IJFA 3NBIA 3JR4A 4G4OA 5C18A 1D2NA 4IBJA 3KSJA 1XWIA 2F5SA 2JA2A 5KQ8A 1R7RA 3AOEC 4LGYA 4DV3M 4FWGA 1GL6A 1I4WA 2CE7A 3TPZA 1DGGA 4LJ4A 5FTLA 5ITUA 3TWLA 4B08A 4R7GA 3LQRA 4WURA 4HLQA 3U6OA 3Q8XA 2DWMA 1IM2A 4MB7A 4QOZC 3KP1E 2LWXA 1ORYB 2D7HA 4IBBA 3SHFA 4PD2A 3VDPA 5H37D 4DR3M 3K92A 2G8LA 3RGPA 3U61B 5KPZA 2YQZA 2F4VM 3SYLA 4NOOB 3AV0A 3HGIA 2OQ4A 3GP1A 3FKEA 3AFHA 2ZAMA 1R2ZA 4WW0A 2D7EA 2ERCA 3T15A 3NWLA 4LF7M 2V1CA 2XZUA 2D7GA 2UUCM 2BNKA 2CFOA 3UZUA 4CHTB 4OX9M 4IBIA 2XH9A 4LJ6A 3OTOM 1SXJC 2KZSA 4PDIA 1SXJD 3M0EA 4YHHM 1XNQM 2XSZD 3PNYA 1TH4A 3U6PA 3L27A 2Z3XA 1Q39A 3U6SA 5ITYA 4OVZA 3MJ5A 4IBKA 4LY6A 2F5PA 3SC3A 2CHGA 2CV0A 2LXEA 1YSYA 3U6MA 3EIEA 3FUVA 5ITRA 1HT1E 3SAUA 1DO0A 4P16A 1TH2A 2FNAA 1HNZM 4DR5M 3A45A 4NXNM 5DYIA 2I7NA 3FYCA 4RF0A 1T3TA 1NHWC 2CEAA 2J7OA 4FCWA 4ZPXA 2X8AA 1TDHA 4X66M 2ZBKB 4KLNA 3KXEC 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 M;  5ITX E;  4PDG A;  3GPU A;  4DV4 M;  3VK8 A;  4DV0 M;  4JYA M;  3A42 A;  5FLX S;  1L2B A;  3SAR A;  2Q2E B;  4NRV A;  1FJG M;  5LMU M;  3SBJ A;  1XC8 A;  1PJI A;  4ITQ A;  4JI8 M;  1K3X A;  2HHH M;  1J5E M;  3DOA A;  4B3T M;  4JI3 M;  4DV2 M;  4B3R M;  4G4Q A;  1R2Y A;  4DR7 M;  4JI7 M;  4PCZ A;  2F5O A;  1Z59 A;  4LF4 M;  2F5N A;  4NRW A;  4YY3 M;  2UXC M;  1Z5C A;  1N33 M;  4KHP M;  4DUZ M;  2EA0 A;  3GPX A;  4JI6 M;  3SAV A;  3C58 A;  5LMN M;  4LF6 M;  2XZF A;  4LFA M;  1Z5A A;  3JR4 A;  4G4O A;  1NNJ A;  1HNW M;  3JR5 A;  1I94 M;  1IBK M;  4DUY M;  2F5S A;  4DV3 M;  3J7A S;  3J80 S;  3GQ4 A;  1N36 M;  3U6C A;  1K82 A;  4LFC M;  1XNR M;  5BR8 M;  1L1T A;  2F5Q A;  4DR4 M;  3GPP A;  4LF8 M;  3TWM A;  5ITU A;  3TWL A;  1Q3B A;  3T1H M;  1TDZ A;  3U6O A;  1IBM M;  4LFB M;  4JI0 M;  2UXD M;  4MB7 A;  1K3W A;  3GQ3 A;  2OPF A;  4PD2 A;  3W0F A;  4DR3 M;  1MU5 A;  4G4N A;  4DV1 M;  2VQE M;  3SAW A;  4X65 M;  1PJJ A;  1XMQ M;  1L2C A;  4B3M M;  1N32 M;  2F4V M;  3A46 A;  4NXM M;  1N34 M;  2OQ4 A;  3JAM S;  3GP1 A;  3GQ5 A;  3GPY A;  3U6Q A;  4JI1 M;  1R2Z A;  4DV6 M;  4JI4 M;  1L2D A;  3T1Y M;  2E5L M;  4B3S M;  4LF7 M;  2XZU A;  2HKJ A;  4GKK M;  1HR0 M;  4JV5 M;  3U6D A;  1KFV A;  2UUC M;  4G4R A;  1MX0 A;  1HNX M;  4K0K M;  5ITQ A;  1Z5B A;  4OX9 M;  4DV7 M;  3OTO M;  1Q3C A;  4PDI A;  4YHH M;  1XNQ M;  2ZM6 M;  2UUA M;  2VQF M;  3U6P A;  4CIS A;  4X64 M;  3U6E A;  2UXB M;  4DR6 M;  4DR2 M;  1Q39 A;  3U6S A;  1XMO M;  5ITY A;  4X62 M;  3U6L A;  2F5P A;  2UUB M;  3U6M A;  3SAS A;  1PM5 A;  5ITR A;  3J81 S;  3SAU A;  3SAT A;  4GKJ M;  1HNZ M;  5ITT A;  4DR5 M;  3A45 A;  3VK7 A;  5A2Q S;  3GO8 A;  4NXN M;  2UU9 M;  5IT9 S;  5IWA M;  4DV5 M;  3TWK A;  4DR1 M;  1L1Z A;  1IBL M;  4AQY M;  4LF5 M;  1TDH A;  5ITX A;  4X66 M;  2ZBK B;  4JI5 M;  4JI2 M;  1EE8 A; 
#chains in the Genus database with same CATH topology
 1IN8 A;  5EXT A;  3GLH A;  4LF9 M;  1MN3 A;  2Z4R A;  5EXX A;  1QZE A;  3TE6 A;  3T6P A;  3TQS A;  5EXS A;  1E9R A;  1NJG A;  4JYA M;  4FD2 A;  3AKZ A;  3FUX A;  3L26 A;  3KS8 A;  2LHC A;  2QBY A;  1LV7 A;  2LBC A;  2YFQ A;  1SXJ B;  2ZAN A;  3U5Z B;  1XC8 A;  1FJG M;  1NNU C;  4BB9 A;  1VQ1 A;  1OIP A;  2KXE A;  1K3X A;  3KDS E;  1J5E M;  2JZ0 A;  3DOA A;  4JI3 M;  3PNV A;  3IG5 A;  3GLH B;  4PCZ A;  2Y0Q A;  2DWL A;  2F5O A;  5EP1 A;  1WIV A;  4Q7J A;  4YY3 M;  4L8R C;  1JR3 D;  4IBF A;  2EA0 A;  3GPX A;  3FUU A;  2N35 A;  3HJQ A;  1E32 A;  3C58 A;  2XFS A;  1YE9 A;  4OU7 A;  4AKI A;  4RKU F;  4MGH A;  1G71 A;  1ZV1 A;  4B7H A;  3HX3 A;  4LJA A;  3K8Z A;  1HNW M;  4L78 A;  2K6B A;  2X4A A;  4NSR A;  1I94 M;  3GLG B;  1KSF X;  1IN7 A;  4LJ9 A;  1OAI A;  3AOE A;  3J80 S;  5FTJ A;  3GQ4 A;  4AI6 A;  1GVN A;  2C9O A;  4LFC M;  1L1T A;  1OQY A;  2DAK A;  1QAN A;  1QUS A;  1VDD A;  1GKI A;  2QEN A;  3M7G A;  3LVW A;  2K0B X;  3TWM A;  2KNV A;  1IY0 A;  2FS1 A;  4LJ8 A;  1PRB A;  1QDR A;  3LVV A;  1GL7 A;  2B3T A;  5IRE B;  3W68 A;  2C5R A;  4JXJ A;  3GQ3 A;  3VFD A;  2R4E A;  2HAK A;  1IQP A;  4FCT A;  2RKO A;  1MU5 A;  2Z8Y M;  3PVS A;  2VQE M;  3KOX E;  1N75 A;  3HHY A;  3FUW A;  1PJJ A;  3KOY E;  1XMQ M;  1N32 M;  1IN5 A;  2GQF A;  1IN4 A;  4KOD A;  2H5X A;  4NXM M;  4FW9 A;  7CAT A;  5KQD A;  1DGB A;  3U6Q A;  3CTW B;  4FWD A;  4DV6 M;  4BLC A;  3WHL A;  2XEP A;  2C98 A;  2HKJ A;  1HR0 M;  2DNA A;  3H4M A;  4JV5 M;  2G5G X;  3U6D A;  3U60 B;  1SXJ E;  2WSF F;  8CAT A;  3MMP A;  3SFZ A;  4F2L A;  4G4R A;  1DGH B;  1G59 A;  2V1U A;  1MX0 A;  1HNX M;  4K0K M;  2Z7J A;  1IY1 A;  1TTE A;  1XXH A;  3AL0 C;  2FFJ A;  4IBE A;  1SXJ A;  3U5Z A;  1Q3C A;  1X37 A;  4IBC A;  4KO8 A;  4GIP A;  4REZ A;  3Q8G A;  2ZM6 M;  2M60 A;  3GLI A;  1OJL A;  4BBA A;  2EJS A;  2VQF M;  2UUA M;  1Z6T A;  3HJS A;  3LCV B;  2FH0 A;  3U6E A;  5FSW A;  2ZAO A;  1G4A E;  2DI0 A;  2MRO B;  2ZTC A;  5EP2 A;  1IXZ A;  2KEB A;  2Z4S A;  3GRY A;  3KW6 A;  1WR1 B;  3GLF E;  3UGJ A;  1XMO M;  2WSE F;  4D80 A;  2UUB M;  3B7Z A;  4XK8 F;  3GLF A;  3K1J A;  3FD9 A;  2L7I A;  3KS4 A;  1QVR A;  3J81 S;  4GKJ M;  3W0L B;  3FYD A;  2DZO B;  4RNA A;  5ITT A;  3KP0 E;  3I51 A;  2DWN A;  1V92 A;  4FVM A;  4II7 A;  2LHG A;  4QNR A;  3VK7 A;  2DXI A;  4TUW A;  4DV5 M;  2KDL A;  1E94 E;  2XF3 A;  4LRS A;  5ITX A;  4JI5 M;  3HU3 A;  2XFT A;  2X49 A;  1CUK A;  1EE8 A;  5E6J A;  5EP3 A;  2CHV A;  3E21 A;  4XGI A;  1NV8 A;  4CIZ A;  4DV4 M;  3VK8 A;  3CF2 A;  2BWE A;  3J2P B;  1L2B A;  3SHG B;  3SAR A;  2MR9 A;  1N78 A;  2Q2E B;  4ITQ A;  3SBJ A;  1PJI A;  3IG8 A;  2QBY B;  2DAI A;  3SYK A;  3GLF B;  4G4Q A;  3A98 B;  1NJF A;  1R2Y A;  4M9X A;  3R9X B;  2HWJ A;  2BJW A;  1ZMV A;  5E26 A;  4LF4 M;  3FRH A;  1NV9 A;  4MGZ E;  4NRW A;  3HHW A;  2DHY A;  4KHP M;  1D0M A;  2MH8 A;  3SAV A;  1GAB A;  2KNA A;  1AIP C;  1QAO A;  3FRI A;  1D0L A;  3HHX A;  3HWS A;  2XZF A;  5DYG A;  3HHZ A;  2VII A;  2C9C A;  2DWZ B;  3PXG A;  2CV1 A;  1Z5A A;  2LVN C;  4B7G A;  1NNJ A;  4HL4 A;  1XXH B;  3AOG A;  1TH3 A;  3THG A;  4L4U A;  4NL4 H;  1F4I A;  1T43 A;  4GIT A;  4OVZ B;  5EQT A;  1XNR M;  4DR4 M;  3GPP A;  1OFH A;  3SAU A;  3GLG E;  3ZC7 B;  3ILK A;  4KT0 F;  2QNJ A;  2LH0 A;  1IBM M;  3HJ8 A;  4LFB M;  1Y8G A;  4LRT A;  4JI0 M;  1IXR C;  2DVW B;  2OPF A;  3D8L A;  2J7N A;  4CGY B;  3K9P A;  5FTN A;  3TL4 X;  4IBG A;  3RE8 A;  4DV1 M;  2H1R A;  1NY5 A;  3FTC A;  3GRR A;  2EO2 A;  4B7F A;  3WHK A;  1L2C A;  4GC9 A;  1D0K A;  3D8B A;  5EJC A;  3SMS A;  3KSX A;  3UMM A;  3AJI B;  1PGY A;  3HU2 A;  3J7B A;  3JAM S;  3GPY A;  4JI1 M;  1XHB A;  4AG6 A;  4I4L A;  2LTU A;  5BPV A;  3DZD A;  1V34 A;  1L2D A;  3GLI B;  1GLN A;  1XB2 B;  2VDB B;  2J5Y A;  3T1Y M;  1G41 A;  2E5L M;  4GKK M;  2XLJ A;  4L15 A;  1E9S A;  1OFI A;  2HL7 A;  2EKF A;  1ZQ9 A;  2DHR A;  2L7H A;  4EIW A;  3U60 A;  5DFL A;  3L25 A;  1W5T A;  2JUJ A;  2BJV A;  3LW5 F;  2DEN A;  2RGH A;  5KPT A;  5GKN A;  4GC5 A;  1HQY E;  1QAQ A;  4M9S A;  3HKP A;  4GEW A;  4CIS A;  2LVO C;  4X64 M;  1IXS A;  3VKH A;  2UXB M;  3J27 B;  4AW4 A;  2KW0 A;  2V6Z M;  1WGN A;  4JN6 A;  3DFZ A;  1QZM A;  2L4E A;  3V76 A;  1GJT A;  1R6B X;  3BXW A;  3SAS A;  1TR8 A;  2LNH C;  1DGF A;  2OO9 A;  4HEO A;  4Z6Y A;  5DNY A;  3SAT A;  4GHL A;  3VKG A;  2JY7 A;  5A2Q S;  3GO8 A;  5EP4 A;  2UU9 M;  5IT9 S;  2QCU A;  1JR3 A;  2JY5 A;  3B89 A;  3TWK A;  4DR1 M;  1L1Z A;  4MM3 B;  1IBL M;  1VG5 A;  1IFY A;  3GLH E;  4A3V B;  4AQY M;  1HQC A;  3VDU A;  4LF5 M;  1LTM A;  2R6F A;  1W5S A;  1JQJ C;  3E9S A;  4QNM A;  5JI2 E;  3UJN A;  3ZH9 B;  5FTM A;  4PDG A;  4LZJ A;  1GO5 A;  4M9Z A;  1PJQ A;  4OW0 A;  3I4V A;  3T38 A;  3GPU A;  2CV2 A;  2W82 A;  4DV0 M;  2APL A;  1DGH A;  4D81 A;  4L16 A;  4G3O A;  4NRV A;  4QOS A;  4PT5 A;  2GNO A;  4MH0 E;  1DV0 A;  1C1K A;  2HHH M;  1DO2 A;  3FTD A;  4QHS A;  4DV2 M;  4B3T M;  2C99 A;  5EXP A;  1QQW A;  2R46 A;  3F92 A;  2WZJ A;  1Q02 A;  2C96 A;  3B7N A;  3EIH A;  2F5N A;  3C3E A;  3GRV A;  3KOZ E;  4MGK E;  2JY6 B;  1H6U A;  1Z5C A;  2EUC A;  3B9P A;  1G3I A;  3E46 A;  2L6O A;  3HZJ A;  3L29 A;  4UN2 B;  4DUZ M;  4IIW A;  3MHV C;  1R5L A;  2QPA A;  2DZN B;  2YR0 A;  2Y20 A;  3QAU A;  2R65 A;  3KVW A;  1JB0 F;  4LFA M;  2L09 A;  3U61 A;  3JR5 A;  1IBK M;  2QHO B;  4DUY M;  3J7A S;  1N36 M;  2JWS A;  2O25 A;  4QHT A;  3U6C A;  1K82 A;  1EFU B;  5BR8 M;  1NHG C;  1VEG A;  2JZ1 A;  2F5Q A;  4M0D A;  4M0W A;  4LF8 M;  2P5T A;  1IXS B;  2JXN A;  1Q3B A;  3T1H M;  1OIZ A;  2FOI C;  3GLG A;  1TDZ A;  2UXD M;  1TGU A;  1K3W A;  3QYE A;  1G8P A;  4L6V 6;  1ZAE A;  1HJP A;  3I01 M;  1EIJ A;  3W0F A;  4WP2 A;  4Z8X A;  3B74 A;  3FTF A;  4G4N A;  1QAM A;  4NC6 A;  4CJ6 A;  1P3Q Q;  4S12 A;  3SAW A;  4G6Z A;  4LZZ A;  4FCV A;  3FUT A;  3GRU A;  4X65 M;  5KPR A;  4B3M M;  2CHQ A;  1WGL A;  2DAG A;  1J7K A;  2FE8 A;  2HCB A;  4FWH A;  3A46 A;  1VEJ A;  1N34 M;  1WHC A;  3GQ5 A;  2JP7 A;  4LCB A;  4LJ5 A;  2L4F A;  1ZMW A;  3PFI A;  3I4Y A;  3W67 A;  4JI4 M;  2OOA A;  3KFU G;  4AKH A;  4DBG B;  4B3S M;  2Y21 A;  2KRK A;  4I8O A;  3RGS A;  1KFV A;  4MGY E;  3CF0 A;  3R8F A;  4NSO B;  1OTR A;  4GRI A;  2DAE A;  5ITQ A;  1Z5B A;  3K2L A;  3VLF B;  4DV7 M;  4XBO A;  2Y0T A;  3L28 A;  3KOW E;  4AKG A;  2O5R A;  2RRU A;  3LQQ A;  3L2A A;  4IJE A;  2XSZ A;  2AHM A;  2I7P A;  1MJG M;  1IY2 A;  1YUB A;  4DR6 M;  2ZTD A;  2LVP C;  4DR2 M;  2G3Q A;  2K47 A;  4I81 A;  2KA6 B;  3ZCB B;  2M5Z A;  1OKS A;  2QP9 X;  5C1B A;  4X62 M;  1HT2 E;  3U6L A;  1N77 A;  4GMQ A;  2R18 A;  3M6A A;  1VDL A;  1PM5 A;  2KZU A;  2CP8 A;  1L8Q A;  1S3S A;  4GHA A;  2R45 A;  5F3W A;  1JR3 E;  1IN6 A;  3LCU A;  4AZF A;  1J09 A;  2KRU A;  1BVS A;  1WXQ A;  5IWA M;  1GJS A;  4LGM A;  3NBX X;  4RF1 A;  2R4J A;  3HU1 A;  1PJS A;  1NSF A;  4LJ7 A;  3E4R A;  2XGN A;  4MGI E;  1SG9 A;  2A5Y B;  1UFZ A;  5KO3 A;  4JI2 M;  1TF0 B;  2QSF X;  3RFW A;  5ITX E;  2CRU A;  3MK6 A;  3IHP A;  1FNN A;  2LVQ D;  3UK6 A;  3QWL A;  4ANR A;  3CF6 E;  2VF7 A;  3A42 A;  5FLX S;  3C3D A;  2RGO A;  5FTK A;  1RU3 A;  1NVM A;  4LG2 A;  2YNM D;  5LMU M;  1UM8 A;  2O01 F;  4JI8 M;  3BOS A;  1NY6 A;  1C7Y A;  4B3R M;  1KYI A;  4I5S A;  4IBD A;  4D82 A;  4DR7 M;  3CGW A;  4JI7 M;  3LMM A;  3FTE A;  1Z59 A;  2QZ4 A;  2CUZ A;  2UXC M;  1N33 M;  4AG5 A;  5JI3 E;  2R62 A;  1V33 A;  5IZ7 D;  2VF8 A;  3SMP A;  2NQ8 C;  4GH9 A;  4JI6 M;  3ZQJ A;  5L8R F;  4W5W A;  1QYR A;  5LMN M;  4LF6 M;  3DA1 A;  1QDT A;  2DKL A;  1AUA A;  4IJF A;  3NBI A;  3JR4 A;  4G4O A;  5C18 A;  1D2N A;  1T6O A;  4IBJ A;  2KHH A;  2QQ8 A;  3KSJ A;  1XWI A;  2F5S A;  2JA2 A;  5KQ8 A;  1R7R A;  3AOE C;  4LGY A;  4DV3 M;  2DZL A;  4FWG A;  1GL6 A;  3HY5 A;  1I4W A;  2CE7 A;  3TPZ A;  1DGG A;  4LJ4 A;  5FTL A;  5ITU A;  3TWL A;  4B08 A;  4R7G A;  2JNH A;  3LQR A;  4WUR A;  3B7Q A;  4HLQ A;  3U6O A;  3Q8X A;  2DWM A;  1IM2 A;  2LVA A;  1PJT A;  4MB7 A;  4QOZ C;  3IEC A;  3KP1 E;  2LWX A;  1ORY B;  2D7H A;  4IBB A;  3SHF A;  4PD2 A;  2JY8 A;  3VDP A;  5H37 D;  4DR3 M;  3K92 A;  2G8L A;  3RGP A;  3U61 B;  3BBZ A;  5KPZ A;  2YQZ A;  2F4V M;  3SYL A;  4NOO B;  3AV0 A;  3HGI A;  2OQ4 A;  4F1I A;  3GP1 A;  3FKE A;  3AFH A;  2ZAM A;  1R2Z A;  4WW0 A;  2D7E A;  2ERC A;  3T15 A;  3NWL A;  4LF7 M;  2BWB A;  2V1C A;  2XZU A;  3C9P A;  1R4G A;  1VEK A;  2D7G A;  2K9D A;  2UUC M;  2BNK A;  2CFO A;  3H4J A;  3UZU A;  4CHT B;  4OX9 M;  4IBI A;  2XH9 A;  4LJ6 A;  2R44 A;  3OTO M;  1SXJ C;  2KZS A;  4PDI A;  1OAO C;  1SXJ D;  3M0E A;  4YHH M;  2XSZ D;  3PNY A;  1XNQ M;  1TH4 A;  1XXH E;  3FE3 A;  3U6P A;  2CWB A;  3QYB A;  3L27 A;  2L2D A;  3GLI E;  2Z3X A;  1Q39 A;  3U6S A;  5ITY A;  1A5T A;  4OVZ A;  3MJ5 A;  4IBK A;  4LY6 A;  2F5P A;  3SC3 A;  2CHG A;  4P17 A;  2CV0 A;  1ZMU A;  2LXE A;  1YSY A;  3U6M A;  1QUT A;  3EIE A;  2R0I A;  3FUV A;  5ITR A;  1HT1 E;  2MJ5 B;  1NO1 A;  1DO0 A;  4P16 A;  4Y28 F;  1TH2 A;  2FNA A;  4R71 A;  1HNZ M;  1YLA A;  4DR5 M;  3I04 M;  3A45 A;  2MGW A;  3K9O A;  2I7N A;  1WJ7 A;  2OOB A;  5DYI A;  3FYC A;  4NXN M;  4RF0 A;  1T3T A;  1NHW C;  2CEA A;  2KNZ A;  2J7O A;  4FCW A;  4ZPX A;  2X8A A;  1TDH A;  2WSC F;  4X66 M;  2EKK A;  2ZBK B;  4KLN A;  3KXE C;  4R3D A;  2DAM A; 
#chains in the Genus database with same CATH homology
 1IN8 A;  5EXT A;  3GLH A;  4LF9 M;  2Z4R A;  5EXX A;  3TE6 A;  3TQS A;  5EXS A;  1E9R A;  1NJG A;  4JYA M;  4FD2 A;  3AKZ A;  3FUX A;  3L26 A;  3KS8 A;  2QBY A;  1LV7 A;  2YFQ A;  3U5Z B;  1SXJ B;  2ZAN A;  1FJG M;  1XC8 A;  1NNU C;  4BB9 A;  2KXE A;  1K3X A;  3KDS E;  1J5E M;  3DOA A;  4JI3 M;  3PNV A;  3IG5 A;  3GLH B;  4PCZ A;  2Y0Q A;  2DWL A;  2F5O A;  5EP1 A;  4YY3 M;  4L8R C;  1JR3 D;  4IBF A;  2EA0 A;  3GPX A;  3FUU A;  3HJQ A;  1E32 A;  3C58 A;  2XFS A;  1YE9 A;  4OU7 A;  4AKI A;  4MGH A;  4B7H A;  4LJA A;  3K8Z A;  1HNW M;  4L78 A;  2X4A A;  4NSR A;  1I94 M;  3GLG B;  1KSF X;  1IN7 A;  4LJ9 A;  3AOE A;  3J80 S;  3GQ4 A;  5FTJ A;  4AI6 A;  1GVN A;  2C9O A;  4LFC M;  1L1T A;  1QAN A;  1VDD A;  1GKI A;  2QEN A;  3M7G A;  3LVW A;  3TWM A;  1IY0 A;  4LJ8 A;  3LVV A;  1GL7 A;  5IRE B;  2C5R A;  4JXJ A;  3GQ3 A;  3VFD A;  2R4E A;  1IQP A;  4FCT A;  2RKO A;  1MU5 A;  3PVS A;  2VQE M;  3KOX E;  1N75 A;  3HHY A;  3FUW A;  1PJJ A;  3KOY E;  1XMQ M;  1N32 M;  1IN5 A;  1IN4 A;  4KOD A;  4NXM M;  4FW9 A;  7CAT A;  5KQD A;  1DGB A;  3U6Q A;  3CTW B;  4FWD A;  4DV6 M;  4BLC A;  3WHL A;  2XEP A;  2C98 A;  2HKJ A;  1HR0 M;  3H4M A;  4JV5 M;  2G5G X;  3U6D A;  3U60 B;  1SXJ E;  8CAT A;  4G4R A;  3SFZ A;  2V1U A;  1DGH B;  1G59 A;  1MX0 A;  1HNX M;  4K0K M;  2Z7J A;  1IY1 A;  1XXH A;  3AL0 C;  2FFJ A;  4IBE A;  1SXJ A;  3U5Z A;  1Q3C A;  1X37 A;  4IBC A;  4KO8 A;  4GIP A;  4REZ A;  2ZM6 M;  3GLI A;  2M60 A;  2UUA M;  1OJL A;  4BBA A;  2VQF M;  1Z6T A;  3HJS A;  3U6E A;  5FSW A;  2ZAO A;  1G4A E;  5EP2 A;  1IXZ A;  2KEB A;  2Z4S A;  3GRY A;  3KW6 A;  3UGJ A;  1XMO M;  4D80 A;  2UUB M;  3GLF A;  3K1J A;  3FD9 A;  2L7I A;  3KS4 A;  1QVR A;  3J81 S;  4GKJ M;  3W0L B;  3FYD A;  2DZO B;  4RNA A;  5ITT A;  3KP0 E;  3I51 A;  2DWN A;  4II7 A;  4FVM A;  4QNR A;  3VK7 A;  2DXI A;  4TUW A;  4DV5 M;  1E94 E;  2XF3 A;  4LRS A;  5ITX A;  4JI5 M;  3HU3 A;  2XFT A;  2X49 A;  1EE8 A;  5E6J A;  5EP3 A;  2CHV A;  4XGI A;  4DV4 M;  3VK8 A;  3CF2 A;  3J2P B;  1L2B A;  3SHG B;  3SAR A;  1N78 A;  2Q2E B;  4ITQ A;  3SBJ A;  1PJI A;  3IG8 A;  2QBY B;  3SYK A;  3GLF B;  4G4Q A;  3A98 B;  1NJF A;  1R2Y A;  4M9X A;  3R9X B;  2BJW A;  5E26 A;  4LF4 M;  4NRW A;  4MGZ E;  3HHW A;  4KHP M;  3SAV A;  1QAO A;  3HWS A;  3HHX A;  2XZF A;  5DYG A;  3HHZ A;  2VII A;  2C9C A;  2DWZ B;  3PXG A;  2CV1 A;  1Z5A A;  4B7G A;  1NNJ A;  4HL4 A;  1XXH B;  3AOG A;  1TH3 A;  3THG A;  4L4U A;  4NL4 H;  4GIT A;  4OVZ B;  5EQT A;  1XNR M;  4DR4 M;  3GPP A;  1OFH A;  3ZC7 B;  3ILK A;  2LH0 A;  1IBM M;  3HJ8 A;  4LFB M;  4LRT A;  4JI0 M;  1IXR C;  2DVW B;  2OPF A;  3D8L A;  2J7N A;  4CGY B;  5FTN A;  3TL4 X;  4IBG A;  3RE8 A;  4DV1 M;  2H1R A;  1NY5 A;  3FTC A;  3GRR A;  2EO2 A;  4B7F A;  3WHK A;  1L2C A;  4GC9 A;  3D8B A;  5EJC A;  3SMS A;  3KSX A;  3UMM A;  3AJI B;  3HU2 A;  3J7B A;  3JAM S;  3GPY A;  4JI1 M;  1XHB A;  4AG6 A;  4I4L A;  5BPV A;  3DZD A;  1L2D A;  3GLI B;  1GLN A;  3T1Y M;  2E5L M;  1G41 A;  4GKK M;  2XLJ A;  4L15 A;  1E9S A;  1OFI A;  1ZQ9 A;  2HL7 A;  2DHR A;  2L7H A;  4EIW A;  3U60 A;  3L25 A;  1W5T A;  2BJV A;  5KPT A;  2RGH A;  5GKN A;  4GC5 A;  1HQY E;  1QAQ A;  4M9S A;  3HKP A;  4CIS A;  4X64 M;  3VKH A;  2UXB M;  3J27 B;  4AW4 A;  2KW0 A;  2V6Z M;  4JN6 A;  3DFZ A;  1QZM A;  1R6B X;  3SAS A;  2LNH C;  1DGF A;  4Z6Y A;  5DNY A;  3SAT A;  4GHL A;  3VKG A;  5A2Q S;  3GO8 A;  5EP4 A;  2UU9 M;  5IT9 S;  2QCU A;  1JR3 A;  4DR1 M;  3TWK A;  1L1Z A;  4MM3 B;  1IBL M;  4A3V B;  4AQY M;  1HQC A;  3VDU A;  4LF5 M;  3E9S A;  1W5S A;  1JQJ C;  4QNM A;  5JI2 E;  3UJN A;  3ZH9 B;  5FTM A;  4PDG A;  4LZJ A;  4M9Z A;  4OW0 A;  3T38 A;  3I4V A;  3GPU A;  2CV2 A;  2W82 A;  4DV0 M;  1DGH A;  4D81 A;  4L16 A;  4NRV A;  4QOS A;  4PT5 A;  4MH0 E;  1C1K A;  2HHH M;  1DO2 A;  3FTD A;  4QHS A;  4DV2 M;  4B3T M;  2C99 A;  5EXP A;  1QQW A;  2R46 A;  2C96 A;  3EIH A;  2F5N A;  3GRV A;  4MGK E;  3KOZ E;  1H6U A;  1Z5C A;  2EUC A;  3B9P A;  1G3I A;  3L29 A;  2L6O A;  4DUZ M;  4IIW A;  3MHV C;  2QPA A;  2DZN B;  2YR0 A;  2Y20 A;  3QAU A;  2R65 A;  3KVW A;  4LFA M;  2L09 A;  3U61 A;  3JR5 A;  1IBK M;  4DUY M;  3J7A S;  1N36 M;  4QHT A;  3U6C A;  1K82 A;  5BR8 M;  1NHG C;  2F5Q A;  4M0D A;  4M0W A;  4LF8 M;  2P5T A;  1IXS B;  1Q3B A;  3T1H M;  2FOI C;  3GLG A;  1TDZ A;  2UXD M;  1TGU A;  1K3W A;  1G8P A;  1ZAE A;  3W0F A;  4Z8X A;  3FTF A;  4G4N A;  1QAM A;  3SAW A;  4S12 A;  4G6Z A;  4LZZ A;  4FCV A;  3FUT A;  3GRU A;  4X65 M;  5KPR A;  4B3M M;  2CHQ A;  1J7K A;  2FE8 A;  2HCB A;  4FWH A;  3A46 A;  1N34 M;  3GQ5 A;  4LCB A;  4LJ5 A;  3PFI A;  3I4Y A;  4JI4 M;  3KFU G;  4AKH A;  4B3S M;  2Y21 A;  2KRK A;  4I8O A;  3RGS A;  1KFV A;  4MGY E;  3CF0 A;  3R8F A;  4NSO B;  4GRI A;  5ITQ A;  1Z5B A;  3K2L A;  3VLF B;  4DV7 M;  4XBO A;  2Y0T A;  3L28 A;  3KOW E;  4AKG A;  2O5R A;  3LQQ A;  3L2A A;  4IJE A;  2XSZ A;  2AHM A;  2I7P A;  1IY2 A;  1YUB A;  4DR6 M;  4DR2 M;  2K47 A;  4I81 A;  2KA6 B;  3ZCB B;  2M5Z A;  2QP9 X;  5C1B A;  4X62 M;  1HT2 E;  3U6L A;  1N77 A;  4GMQ A;  2R18 A;  3M6A A;  1PM5 A;  2KZU A;  1L8Q A;  1S3S A;  4GHA A;  2R45 A;  5F3W A;  4AZF A;  1IN6 A;  1J09 A;  2KRU A;  1WXQ A;  5IWA M;  4LGM A;  4RF1 A;  2R4J A;  3HU1 A;  4MGI E;  1NSF A;  4LJ7 A;  3E4R A;  2XGN A;  4JI2 M;  2A5Y B;  5KO3 A;  3RFW A;  5ITX E;  3MK6 A;  1FNN A;  3UK6 A;  3QWL A;  3CF6 E;  3A42 A;  5FLX S;  2RGO A;  5FTK A;  1NVM A;  4LG2 A;  2YNM D;  5LMU M;  1UM8 A;  4JI8 M;  3BOS A;  1NY6 A;  4B3R M;  1KYI A;  4I5S A;  4IBD A;  4D82 A;  4DR7 M;  4JI7 M;  3LMM A;  3FTE A;  1Z59 A;  2QZ4 A;  2CUZ A;  2UXC M;  1N33 M;  4AG5 A;  5JI3 E;  2R62 A;  5IZ7 D;  3SMP A;  2NQ8 C;  4GH9 A;  4JI6 M;  4W5W A;  1QYR A;  5LMN M;  4LF6 M;  3DA1 A;  4IJF A;  3NBI A;  3JR4 A;  4G4O A;  5C18 A;  1D2N A;  4IBJ A;  3KSJ A;  1XWI A;  2F5S A;  2JA2 A;  5KQ8 A;  1R7R A;  3AOE C;  4LGY A;  4DV3 M;  4FWG A;  1GL6 A;  1I4W A;  2CE7 A;  3TPZ A;  1DGG A;  4LJ4 A;  5FTL A;  5ITU A;  3TWL A;  4B08 A;  4R7G A;  3LQR A;  4WUR A;  4HLQ A;  3U6O A;  3Q8X A;  2DWM A;  1IM2 A;  4MB7 A;  4QOZ C;  3KP1 E;  2LWX A;  1ORY B;  2D7H A;  4IBB A;  3SHF A;  4PD2 A;  3VDP A;  5H37 D;  4DR3 M;  3K92 A;  2G8L A;  3RGP A;  3U61 B;  5KPZ A;  2YQZ A;  2F4V M;  3SYL A;  4NOO B;  3AV0 A;  3HGI A;  2OQ4 A;  3GP1 A;  3FKE A;  3AFH A;  2ZAM A;  1R2Z A;  4WW0 A;  2D7E A;  2ERC A;  3T15 A;  3NWL A;  4LF7 M;  2V1C A;  2XZU A;  2D7G A;  2UUC M;  2BNK A;  2CFO A;  3UZU A;  4CHT B;  4OX9 M;  4IBI A;  2XH9 A;  4LJ6 A;  3OTO M;  1SXJ C;  2KZS A;  4PDI A;  1SXJ D;  3M0E A;  4YHH M;  1XNQ M;  2XSZ D;  3PNY A;  1TH4 A;  3U6P A;  3L27 A;  2Z3X A;  1Q39 A;  3U6S A;  5ITY A;  4OVZ A;  3MJ5 A;  4IBK A;  4LY6 A;  2F5P A;  3SC3 A;  2CHG A;  2CV0 A;  2LXE A;  1YSY A;  3U6M A;  3EIE A;  3FUV A;  5ITR A;  1HT1 E;  3SAU A;  1DO0 A;  4P16 A;  1TH2 A;  2FNA A;  1HNZ M;  4DR5 M;  3A45 A;  4NXN M;  5DYI A;  2I7N A;  3FYC A;  4RF0 A;  1T3T A;  1NHW C;  2CEA A;  2J7O A;  4FCW A;  4ZPX A;  2X8A A;  1TDH A;  4X66 M;  2ZBK B;  4KLN A;  3KXE C;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...