5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
3GQ4A 4YHHM 3GPUA 2Q2EB 1FJGM 4JI7M 1IBKM 4DV6M 3U6MA 3A46A 4LFAM 4DV4M 4JI6M 2VQEM 3GPYA 1K3WA 4OX9M 1NNJA 1IBMM 4NXMM 3U6CA 1MX0A 1PJIA 1EE8A 5ITQA 3TWKA 4JYAM 4AQYM 5LMUM 4LFCM 1XNQM 1L2DA 2OPFA 1L1ZA 2UXDM 1I94M 3C58A 5A2QS 3DOAA 4PCZA 4G4RA 2F5PA 4DV2M 5LMNM 4DR3M 3GP1A 1N36M 4PDGA 1L1TA 4LF4M 3JR4A 5IT9S 4DV7M 3U6SA 4JI1M 2UXCM 1KFVA 2VQFM 3JAMS 3TWMA 4DUYM 2ZM6M 2F5NA 5ITXA 3SASA 1MU5A 2UU9M 4DR7M 3SAWA 4JI4M 3GPXA 4JI0M 4DV3M 1L2BA 4CISA 3J7AS 4DR6M 2OQ4A 1Z5CA 1HNZM 2EA0A 1Q39A 4LF7M 4X62M 1L2CA 2ZBKB 5ITUA 1PJJA 3SBJA 4DV1M 5ITTA 3U6EA 2XZUA 4B3MM 2HHHM 4DUZM 4G4NA 3SARA 4NRVA 4X64M 1K3XA 3U6QA 4B3TM 4PD2A 4ITQA 1PM5A 5IWAM 3W0FA 3J81S 2UXBM 5ITYA 1HNXM 3GPPA 4LF8M 4LF9M 3TWLA 1Z5BA 1TDHA 2HKJA 3SATA 4LFBM 3GO8A 4YY3M 1Q3CA 1IBLM 3U6OA 4GKKM 4JI8M 3U6PA 2F4VM 2F5OA 4MB7A 4JV5M 4DR5M 4JI5M 4DR1M 1TDZA 1R2ZA 4NXNM 3VK7A 4G4OA 4LF6M 4B3RM 1XC8A 3GQ3A 3VK8A 3J80S 4DV0M 4JI2M 4K0KM 3SAVA 4B3SM 1K82A 3SAUA 1HNWM 1N33M 4LF5M 3A45A 1XMQM 3GQ5A 4X66M 5ITRA 1N32M 3A42A 4JI3M 4X65M 1Z5AA 3T1HM 1Z59A 1J5EM 1Q3BA 1N34M 4DR4M 4DV5M 4G4QA 2F5SA 4GKJM 5BR8M 4DR2M 1XNRM 2UUBM 3OTOM 4NRWA 3T1YM 2UUCM 2E5LM 1HR0M 3U6DA 5FLXS 4KHPM 2F5QA 3U6LA 2UUAM 1XMOM 5ITXE 1R2YA 4PDIA 2XZFA 3JR5A
chains in the Genus database with same CATH superfamily
4YHHM 2Z3XA 3E21A 1FJGM 2FOIC 1IBKM 3KS4A 2CRUA 4DV6M 2Z7JA 3SFZA 4A3VB 3PXGA 1E94E 3A46A 4IBJA 4LFAM 3SHFA 4AG6A 3HKPA 4IBCA 3HZJA 3AKZA 4OX9M 2CEAA 1A5TA 1RU3A 4M9XA 1NNJA 2BWEA 4NXMM 5IZ7D 1EE8A 5ITQA 5KPRA 3TWKA 3FTCA 4JYAM 2R44A 4LFCM 4IBFA 1R5LA 1XNQM 1L1ZA 2X49A 3EIHA 3I51A 3HGIA 3IG5A 1C7YA 3A98B 3FUVA 3GLIA 1SG9A 3MK6A 1EIJA 2HL7A 2R46A 1OAIA 1Q02A 4MM3B 1N36M 3LMMA 1XXHB 2H1RA 2L6OA 2JA2A 2XEPA 3VLFB 3GRVA 3JR4A 2DWLA 2L2DA 1ZQ9A 4OW0A 2VQFM 3JAMS 3C9PA 2YQZA 2WZJA 4ANRA 1IN6A 1GLNA 1JR3E 1MU5A 2MROB 3HY5A 3FTFA 3NBIA 4JI4M 4AG5A 3T15A 4IIWA 2O5RA 1UM8A 4DV3M 5JI2E 2XLJA 4CISA 4DR6M 2OQ4A 1IN7A 1OIPA 1Z5CA 5GKNA 1Q39A 2DKLA 2ERCA 1PJJA 3K9OA 3BXWA 3ZQJA 5C18A 5ITTA 1QAOA 2LXEA 4NOOB 3UJNA 2QHOB 3B7QA 4BLCA 3U6EA 2C98A 2C96A 4IJEA 4B3MM 4G4NA 1CUKA 4X64M 5FTNA 4GHLA 5FTMA 2CE7A 1G8PA 5IWAM 2JZ1A 3HHYA 3J81S 2UXBM 3UK6A 1HNXM 1IN5A 3MHVC 3AL0C 2HKJA 2KXEA 4NSOB 4D81A 3SATA 4W5WA 2CV0A 4YY3M 1OTRA 1WR1B 2QZ4A 2Y21A 3MJ5A 1H6UA 4MGKE 4ZPXA 1IBLM 3VKHA 2BJWA 2DZOB 2F5OA 4BB9A 1PJQA 5KQ8A 1OAOC 1QQWA 2LH0A 4MGIE 2X8AA 1DGBA 1KYIA 4JI5M 1XXHE 5EXXA 2OOBA 1ZMWA 1R2ZA 2QP9X 1TH2A 3RE8A 1JR3A 4GKKM 3TPZA 2DWNA 3FYDA 4TUWA 3J80S 2VF8A 1OFIA 2OOAA 3I4YA 3QWLA 3V76A 1DV0A 4K0KM 5EQTA 2APLA 3LW5F 3Q8GA 2V1UA 1VEJA 3THGA 3A45A 2JY5A 4LRTA 3A42A 2O01F 5C1BA 4X65M 1QAMA 1Z5AA 1Z6TA 1Z59A 1J5EM 4XK8F 4JXJA 1SXJC 2CWBA 2KDLA 3FUWA 1DO2A 4G4QA 2F5SA 2D7EA 4CGYB 3VKGA 4KLNA 1J09A 4CJ6A 3AOEA 4IJFA 3PFIA 5DYIA 3OTOM 1NSFA 3B7NA 3KOZE 2Y20A 2X4AA 4KODA 2YNMD 3Q8XA 3AFHA 3U6DA 4FD2A 3GRYA 4XBOA 3KOWE 2CHVA 2R6FA 2QNJA 3HHXA 4R3DA 1Y8GA 3JR5A 5IT9S 1XXHA 3GPUA 1E9RA 1NNUC 5FTKA 1AIPC 1R6BX 4JI7M 3H4MA 1W5SA 2CHQA 3U6MA 2EKFA 1WGNA 4LZZA 2C9CA 3GPYA 2VIIA 3HWSA 4G6ZA 1MX0A 2K9DA 3HU3A 1TH3A 2DVWB 4L6V6 4QNMA 2DAEA 5E6JA 4AQYM 1V34A 3KP1E 2R0IA 1E32A 2EO2A 4KO8A 1WJ7A 4Z6YA 3K92A 1QAQA 1IQPA 1OIZA 1ZMUA 4IBEA 4DV2M 1HQYE 4DR3M 3GP1A 3B74A 4AKHA 1VEKA 2M60A 4I81A 4QNRA 3SMPA 2O25A 3U6SA 3FE3A 2LVAA 4GMQA 4LJ6A 2R62A 3TWMA 2LHCA 2LVQD 2Z8YM 2ZM6M 2F5NA 2J5YA 2KZSA 1T43A 2JP7A 3SASA 1IY2A 3SC3A 3GPXA 3K2LA 3KXEC 1QVRA 1IY0A 2FS1A 4RF1A 3FUXA 4UN2B 1YUBA 2QBYB 4QOSA 4DV1M 4D82A 3GLGB 2JY6B 3HU2A 3T6PA 1WGLA 2V6ZM 3GLFB 2VDBB 3LQRA 3M7GA 4DUZM 2ZTCA 5DNYA 1K3XA 2XFTA 4B3TM 4IBDA 2WSFF 2JNHA 3CF0A 3W0FA 2RGOA 1GKIA 1IXSB 2G3QA 4LF9M 2KRKA 3WHKA 2KNVA 4HEOA 5FTLA 3GO8A 5IREB 3PNVA 1JB0F 1Q3CA 1D0LA 1VG5A 1QANA 4JI8M 2K47A 2DWMA 2F4VM 5F3WA 4LJ7A 3L29A 4LJ4A 2MR9A 4MB7A 2DENA 3FUUA 4MGYE 4FCTA 3IECA 5DYGA 1IN8A 4GC9A 1TDZA 3IHPA 1HJPA 3HJSA 3GRUA 1FNNA 4LZJA 1P3QQ 1T3TA 2CV2A 4LF6M 4B3RM 1HT1E 3GQ3A 3VK8A 4GRIA 1V33A 3FRIA 1OKSA 2DZNB 3SAVA 4B3SM 2JXNA 3CGWA 3SAUA 3E46A 1G3IA 1HT2E 1YLAA 3J2PB 1NV9A 3KOXE 1XMQM 4WP2A 4M9SA 3GQ5A 2JWSA 1HQCA 4LGYA 4Z8XA 8CATA 1NV8A 4G3OA 3GLGE 4HLQA 2ZAMA 3LVVA 1N34M 2HAKA 1DO0A 4L15A 3GLFE 4DR4M 4REZA 2HWJA 5BR8M 2R4EA 4GITA 3EIEA 4DR2M 1XNRM 4P17A 3C3EA 1GL7A 2UUBM 3K9PA 2K0BX 4WW0A 3VFDA 2J7NA 4GIPA 2RKOA 4AW4A 4RF0A 1KFVA 4GH9A 4FCWA 2E5LM 2WSEF 4Y28F 1HR0M 5FLXS 3W68A 3U6LA 3J7BA 2UUAM 4AI6A 5ITXE 4R71A 4LG2A 2DXIA 1SXJD 4PDIA 1D0MA 3QAUA 2OO9A 1R4GA 3GQ4A 1DGGA 3K1JA 4B7FA 4LJ5A 2KA6B 4D80A 3HX3A 4LRSA 5JI3E 2FFJA 4OVZB 3RFWA 3U60B 1QDRA 4IBIA 4F1IA 4DV4M 1NY5A 5KPZA 2QPAA 3KS8A 2KEBA 2XF3A 3U6CA 3GLHE 4KT0F 2WSCF 4GC5A 5LMUM 1L2DA 3TE6A 2M5ZA 2QBYA 1I94M 3C58A 2UXDM 4RKUF 3GLGA 2DI0A 5A2QS 2GQFA 3DOAA 3FKEA 4M0WA 4G4RA 2I7NA 1SXJB 3IG8A 3GLFA 1WHCA 4BBAA 5LMNM 2CV1A 3QYBA 4PDGA 3FRHA 3SMSA 1L1TA 2XFSA 2CUZA 2EKKA 2DAKA 1NHGC 2D7GA 2L4EA 4DV7M 2R4JA 4RNAA 1IXSA 3DZDA 1QUTA 1XWIA 4QHSA 4XGIA 3NBXX 4IBKA 3C3DA 1IXRC 5ITXA 4II7A 5H37D 5EJCA 3SAWA 2UU9M 4DR7M 1F4IA 1NVMA 3F92A 4M9ZA 2Z4SA 1DGHB 2W82A 1T6OA 4GHAA 4FW9A 2EA0A 4X62M 2KHHA 2RGHA 1DGFA 2K6BA 3CF6E 1PJSA 4S12A 1UFZA 2XZUA 2HHHM 3M6AA 5L8RF 4JN6A 4NRVA 3U6QA 3I01M 2LVNC 3E9SA 2XSZD 4GEWA 4PD2A 1PM5A 2R18A 5ITYA 3GPPA 1JQJC 3H4JA 3HJQA 2JZ0A 1Z5BA 3TWLA 3UZUA 4EIWA 4R7GA 1YE9A 3GLIE 2XGNA 1GJSA 5FSWA 4MGZE 2G5GX 3DA1A 1SXJE 4DR5M 4CIZA 3HHWA 5EP4A 3J27B 2CHGA 2FNAA 4NXNM 1L8QA 4G4OA 2KNZA 2LNHC 1V92A 1XC8A 2C5RA 3CF2A 3SYKA 3L25A 5BPVA 2R45A 1TGUA 2KZUA 2QCUA 5EP3A 4DV0M 2J7OA 1IXZA 2GNOA 1K82A 1OFHA 1QUSA 1WXQA 1ZV1A 3SYLA 4CHTB 4NSRA 3KDSE 3B89A 3AOEC 5ITRA 2B3TA 2QSFX 4OVZA 1AUAA 4FWGA 4FWDA 5EXTA 3U60A 1EFUB 1VQ1A 1Q3BA 2CFOA 4I5SA 3W0LB 5KQDA 3D8BA 1N77A 4DV5M 4LY6A 2DHRA 2R65A 4NL4H 4Q7JA 2MJ5B 1ZMVA 2L09A 1OQYA 1D2NA 2ZTDA 2UUCM 1QZMA 4KHPM 2F5QA 1SXJA 4IBBA 3KW6A 1XMOM 1R2YA 3HU1A 3GLHB 3KVWA 1C1KA 1VDDA 4LGMA 4L8RC 2Q2EB 2KRUA 5EP2A 2JY8A 2EUCA 3RGPA 4MH0E 1IM2A 3U5ZB 2LWXA 1WIVA 1I4WA 2QQ8A 1R7RA 3ZC7B 1D0KA 2KW0A 4JI6M 2VQEM 1K3WA 3TQSA 1MN3A 1OJLA 1VDLA 1IBMM 3PVSA 2AHMA 1PJIA 1DGHA 2G8LA 3KP0E 3L28A 4B7HA 4AKGA 2OPFA 3FD9A 2EJSA 2NQ8C 2JY7A 2Z4RA 3T38A 2L7IA 2DHYA 1MJGM 3KFUG 3WHLA 3U61B 1G59A 4PCZA 3R8FA 1ZAEA 2F5PA 3SHGB 1LTMA 1VEGA 4AZFA 1GL6A 2BWBA 2YFQA 3CTWB 1GJTA 4LF4M 1N75A 2QENA 2ZAOA 7CATA 4JI1M 2UXCM 2LHGA 3AOGA 3AV0A 2I7PA 3ILKA 3LCVB 4MGHA 3TL4X 2HCBA 3LVWA 3W67A 4DUYM 2C9OA 1IN4A 2LTUA 1E9SA 4NC6A 2C99A 3VDUA 4M0DA 4WURA 2N35A 4JI0M 1L2BA 1GO5A 3J7AS 4LJAA 2LVPC 1HNZM 1XHBA 4LF7M 5EP1A 1L2CA 2ZBKB 5ITUA 3DFZA 2P5TA 2RRUA 3SBJA 1QYRA 2DAIA 1J7KA 3UMMA 3GLIB 2CP8A 3KSXA 1NJGA 3RGSA 2DAMA 1ORYB 3SARA 2V1CA 2XSZA 4LJ8A 1QDTA 1TF0B 3HHZA 4ITQA 1NY6A 3ZH9B 1YSYA 1PJTA 3L27A 3M0EA 2DNAA 1KSFX 4LF8M 1GVNA 3LCUA 1TDHA 2DZLA 4LFBM 2LBCA 2VF7A 3L26A 2Y0QA 3QYEA 4FVMA 2BJVA 3U6OA 2MH8A 1G4AE 4P16A 1TTEA 4QHTA 2L7HA 5KO3A 3U6PA 1LV7A 4F2LA 2FH0A 4JV5M 3KSJA 2FE8A 1TR8A 1GABA 3B7ZA 5EXPA 4DBGB 3VDPA 3R9XB 4DR1M 2A5YB 1BVSA 2ZANA 1NHWC 3KOYE 1G41A 4PT5A 4B08A 2DWZB 1G71A 3VK7A 1XB2B 3FTEA 3MMPA 2DAGA 1JR3D 2D7HA 2LVOC 4L4UA 3NWLA 1X37A 3B9PA 4LJ9A 5EXSA 1S3SA 2YR0A 4JI2M 3GLHA 2BNKA 4HL4A 1HNWM 2JUJA 3FTDA 3FYCA 1N33M 4LF5M 2MGWA 4L16A 4X66M 1N32M 2KNAA 3U5ZA 4QOZC 4JI3M 1IY1A 1NJFA 4I8OA 4OU7A 1QZEA 1TH4A 3T1HM 1NO1A 4FWHA 3I4VA 3K8ZA 3BBZA 3UGJA 4GKJM 3L2AA 4LCBA 4B7GA 5FTJA 1PRBA 3BOSA 3I04M 3AJIB 2Y0TA 4FCVA 3PNYA 1PGYA 4NRWA 3HJ8A 3GRRA 5DFLA 5KPTA 4I4LA 3E4RA 3FUTA 3T1YM 3U61A 3LQQA 3D8LA 1N78A 1W5TA 2XH9A 4AKIA 4L78A 4IBGA 3ZCBB 5E26A 1IFYA 2XZFA 2L4FA 2H5XA
chains in the Genus database with same CATH topology
4YHHM 2Z3XA 1FJGM 2FOIC 1IBKM 3KS4A 4DV6M 2Z7JA 3SFZA 4A3VB 3PXGA 1E94E 3A46A 4IBJA 4LFAM 3SHFA 4AG6A 3HKPA 4IBCA 3AKZA 4OX9M 2CEAA 4M9XA 1NNJA 4NXMM 5IZ7D 1EE8A 5ITQA 5KPRA 3TWKA 3FTCA 4JYAM 4LFCM 1XNQM 4IBFA 1L1ZA 2X49A 3EIHA 3I51A 3HGIA 3IG5A 3A98B 3FUVA 3GLIA 3MK6A 2HL7A 2R46A 4MM3B 1N36M 3LMMA 1XXHB 2H1RA 2L6OA 2JA2A 2XEPA 3VLFB 3GRVA 3JR4A 2DWLA 1ZQ9A 4OW0A 2VQFM 3JAMS 2YQZA 1IN6A 1GLNA 1MU5A 3FTFA 3NBIA 4JI4M 4AG5A 3T15A 4IIWA 2O5RA 1UM8A 4DV3M 5JI2E 2XLJA 4CISA 4DR6M 2OQ4A 1IN7A 1Z5CA 5GKNA 1Q39A 2ERCA 1PJJA 5C18A 5ITTA 1QAOA 2LXEA 4NOOB 3UJNA 3U6EA 4BLCA 2C98A 2C96A 4IJEA 4B3MM 4G4NA 4X64M 5FTNA 4GHLA 5FTMA 2CE7A 1G8PA 5IWAM 3HHYA 3J81S 2UXBM 3UK6A 1HNXM 1IN5A 3MHVC 3AL0C 2HKJA 2KXEA 4NSOB 4D81A 3SATA 4W5WA 2CV0A 4YY3M 2Y21A 2QZ4A 3MJ5A 4MGKE 1H6UA 4ZPXA 1IBLM 3VKHA 2BJWA 2DZOB 2F5OA 4BB9A 5KQ8A 1QQWA 2LH0A 4MGIE 2X8AA 1DGBA 1KYIA 4JI5M 5EXXA 1R2ZA 2QP9X 1TH2A 3RE8A 1JR3A 3TPZA 2DWNA 3FYDA 4TUWA 3J80S 1OFIA 3QWLA 3I4YA 4K0KM 5EQTA 2V1UA 3THGA 3A45A 4LRTA 3A42A 5C1BA 4X65M 1QAMA 1Z5AA 1Z6TA 1Z59A 1J5EM 4JXJA 1SXJC 3FUWA 1DO2A 4G4QA 2F5SA 2D7EA 4CGYB 3VKGA 4KLNA 1J09A 3AOEA 4IJFA 3PFIA 5DYIA 3OTOM 1NSFA 3KOZE 2Y20A 2X4AA 4KODA 2YNMD 3Q8XA 3AFHA 3U6DA 4FD2A 3GRYA 4XBOA 3KOWE 2CHVA 3HHXA 4R3DA 3JR5A 5IT9S 1XXHA 3GPUA 1E9RA 1NNUC 5FTKA 1R6BX 4JI7M 3H4MA 1W5SA 2CHQA 3U6MA 4LZZA 2C9CA 3GPYA 2VIIA 3HWSA 4G6ZA 1MX0A 3HU3A 1TH3A 2DVWB 4QNMA 5E6JA 4AQYM 3KP1E 1E32A 2EO2A 4KO8A 4Z6YA 3K92A 1QAQA 1IQPA 4IBEA 4DV2M 1HQYE 4DR3M 3GP1A 4AKHA 2M60A 4I81A 4QNRA 3SMPA 3U6SA 4GMQA 4LJ6A 2R62A 3TWMA 2ZM6M 2F5NA 2KZSA 3SASA 1IY2A 3SC3A 3GPXA 3K2LA 3KXEC 1QVRA 1IY0A 4RF1A 3FUXA 1YUBA 2QBYB 4QOSA 4DV1M 4D82A 3GLGB 3HU2A 2V6ZM 3GLFB 3M7GA 3LQRA 4DUZM 5DNYA 1K3XA 2XFTA 4B3TM 4IBDA 3CF0A 3W0FA 2RGOA 1GKIA 1IXSB 4LF9M 2KRKA 3WHKA 5FTLA 3GO8A 5IREB 3PNVA 1Q3CA 1QANA 4JI8M 2K47A 2DWMA 2F4VM 5F3WA 4LJ7A 3L29A 4LJ4A 4MB7A 3FUUA 4MGYE 4FCTA 5DYGA 1IN8A 4GC9A 1TDZA 3HJSA 3GRUA 1FNNA 4LZJA 2CV2A 1T3TA 4LF6M 4B3RM 1HT1E 3GQ3A 3VK8A 4GRIA 2DZNB 3SAVA 4B3SM 3SAUA 1G3IA 1HT2E 3J2PB 3KOXE 1XMQM 4M9SA 3GQ5A 1HQCA 4LGYA 4Z8XA 8CATA 4HLQA 2ZAMA 3LVVA 1N34M 1DO0A 4L15A 4DR4M 4REZA 5BR8M 2R4EA 4GITA 3EIEA 4DR2M 1XNRM 1GL7A 2UUBM 3VFDA 4WW0A 2J7NA 4GIPA 2RKOA 4AW4A 4RF0A 4GH9A 4FCWA 2E5LM 1HR0M 5FLXS 3U6LA 4AI6A 3J7BA 2UUAM 5ITXE 4LG2A 2DXIA 1SXJD 4PDIA 3QAUA 3GQ4A 1DGGA 3K1JA 4B7FA 4LJ5A 2KA6B 4D80A 4LRSA 5JI3E 2FFJA 4OVZB 3RFWA 3U60B 4IBIA 4DV4M 1NY5A 5KPZA 2QPAA 3KS8A 2KEBA 2XF3A 3U6CA 4GC5A 5LMUM 1L2DA 3TE6A 2M5ZA 2QBYA 1I94M 3C58A 2UXDM 3GLGA 5A2QS 3DOAA 4M0WA 3FKEA 4G4RA 2I7NA 1SXJB 3IG8A 3GLFA 4BBAA 5LMNM 2CV1A 4PDGA 3SMSA 1L1TA 2XFSA 2CUZA 1NHGC 2D7GA 4DV7M 2R4JA 4RNAA 3DZDA 1XWIA 4QHSA 4XGIA 4IBKA 5ITXA 1IXRC 4II7A 5H37D 5EJCA 3SAWA 2UU9M 4DR7M 1NVMA 4M9ZA 2Z4SA 1DGHB 2W82A 4GHAA 4FW9A 2EA0A 4X62M 2RGHA 1DGFA 3CF6E 4S12A 2XZUA 2HHHM 3M6AA 4JN6A 4NRVA 3U6QA 4PD2A 3E9SA 2XSZD 1PM5A 2R18A 5ITYA 3GPPA 1JQJC 3HJQA 3TWLA 1Z5BA 3UZUA 4EIWA 4R7GA 1YE9A 2XGNA 5FSWA 4MGZE 2G5GX 3DA1A 1SXJE 4DR5M 3HHWA 5EP4A 3J27B 2CHGA 2FNAA 4NXNM 1L8QA 4G4OA 2LNHC 1XC8A 2C5RA 3CF2A 3SYKA 3L25A 5BPVA 2R45A 1TGUA 2KZUA 2QCUA 5EP3A 4DV0M 2J7OA 1IXZA 1K82A 1OFHA 1WXQA 3SYLA 4CHTB 4NSRA 3KDSE 3AOEC 5ITRA 4OVZA 4FWGA 4FWDA 5EXTA 3U60A 1Q3BA 2CFOA 4I5SA 3W0LB 5KQDA 3D8BA 1N77A 4DV5M 4LY6A 2DHRA 2R65A 4NL4H 2L09A 1D2NA 2UUCM 1QZMA 4KHPM 2F5QA 1SXJA 4IBBA 3KW6A 1XMOM 1R2YA 3HU1A 3GLHB 3KVWA 1C1KA 1VDDA 4LGMA 4L8RC 2Q2EB 2KRUA 5EP2A 2EUCA 3RGPA 4MH0E 1IM2A 3U5ZB 2LWXA 1I4WA 1R7RA 3ZC7B 2KW0A 4JI6M 2VQEM 1K3WA 3TQSA 1OJLA 1IBMM 3PVSA 2AHMA 1PJIA 1DGHA 2G8LA 3KP0E 3L28A 4B7HA 4AKGA 2OPFA 3FD9A 2Z4RA 2NQ8C 3T38A 3KFUG 2L7IA 3WHLA 3U61B 1G59A 4PCZA 3R8FA 1ZAEA 2F5PA 3SHGB 4AZFA 1GL6A 2YFQA 3CTWB 4LF4M 1N75A 2QENA 2ZAOA 7CATA 4JI1M 2UXCM 3ILKA 3AOGA 3AV0A 2I7PA 3TL4X 1KFVA 4MGHA 2HCBA 3LVWA 4DUYM 2C9OA 1IN4A 1E9SA 2C99A 3VDUA 4M0DA 4WURA 4JI0M 1L2BA 3J7AS 4LJAA 1HNZM 1XHBA 4LF7M 5EP1A 1L2CA 2ZBKB 5ITUA 3DFZA 2P5TA 3SBJA 1QYRA 3GLIB 1J7KA 3UMMA 3KSXA 1NJGA 3RGSA 1ORYB 3SARA 2V1CA 2XSZA 4LJ8A 3HHZA 4ITQA 1NY6A 3ZH9B 1YSYA 3L27A 3M0EA 1KSFX 4LF8M 1GVNA 1TDHA 4LFBM 3L26A 2Y0QA 4FVMA 2BJVA 3U6OA 4GKKM 1G4AE 4P16A 4QHTA 5KO3A 2L7HA 3U6PA 1LV7A 4JV5M 3KSJA 2FE8A 5EXPA 3R9XB 3VDPA 4DR1M 2A5YB 2ZANA 1NHWC 3KOYE 1G41A 4PT5A 4B08A 2DWZB 3VK7A 3FTEA 1JR3D 2D7HA 4L4UA 3NWLA 1X37A 3B9PA 4LJ9A 5EXSA 1S3SA 2YR0A 4JI2M 3GLHA 2BNKA 4HL4A 1HNWM 3FTDA 3FYCA 1N33M 4LF5M 4L16A 4X66M 1N32M 3U5ZA 4QOZC 4JI3M 1IY1A 1NJFA 4I8OA 4OU7A 1TH4A 3T1HM 4FWHA 3I4VA 3K8ZA 3UGJA 4GKJM 3L2AA 4LCBA 4B7GA 5FTJA 3BOSA 3AJIB 2Y0TA 4FCVA 3PNYA 4NRWA 3HJ8A 3GRRA 5KPTA 4I4LA 3E4RA 3FUTA 3T1YM 3U61A 3LQQA 3D8LA 1N78A 1W5TA 2XH9A 4AKIA 4L78A 4IBGA 3ZCBB 5E26A 2XZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  4YHH M;  3GPU A;  2Q2E B;  1FJG M;  4JI7 M;  1IBK M;  4DV6 M;  3U6M A;  3A46 A;  4LFA M;  4DV4 M;  4JI6 M;  2VQE M;  3GPY A;  1K3W A;  4OX9 M;  1NNJ A;  1IBM M;  4NXM M;  3U6C A;  1MX0 A;  1PJI A;  1EE8 A;  5ITQ A;  3TWK A;  4JYA M;  4AQY M;  5LMU M;  4LFC M;  1XNQ M;  1L2D A;  2OPF A;  1L1Z A;  2UXD M;  1I94 M;  3C58 A;  5A2Q S;  3DOA A;  4PCZ A;  4G4R A;  2F5P A;  4DV2 M;  5LMN M;  4DR3 M;  3GP1 A;  1N36 M;  4PDG A;  1L1T A;  4LF4 M;  3JR4 A;  5IT9 S;  4DV7 M;  3U6S A;  4JI1 M;  2UXC M;  1KFV A;  2VQF M;  3JAM S;  3TWM A;  4DUY M;  2ZM6 M;  2F5N A;  5ITX A;  3SAS A;  1MU5 A;  2UU9 M;  4DR7 M;  3SAW A;  4JI4 M;  3GPX A;  4JI0 M;  4DV3 M;  1L2B A;  4CIS A;  3J7A S;  4DR6 M;  2OQ4 A;  1Z5C A;  1HNZ M;  2EA0 A;  1Q39 A;  4LF7 M;  4X62 M;  1L2C A;  2ZBK B;  5ITU A;  1PJJ A;  3SBJ A;  4DV1 M;  5ITT A;  3U6E A;  2XZU A;  4B3M M;  2HHH M;  4DUZ M;  4G4N A;  3SAR A;  4NRV A;  4X64 M;  1K3X A;  3U6Q A;  4B3T M;  4PD2 A;  4ITQ A;  1PM5 A;  5IWA M;  3W0F A;  3J81 S;  2UXB M;  5ITY A;  1HNX M;  3GPP A;  4LF8 M;  4LF9 M;  3TWL A;  1Z5B A;  1TDH A;  2HKJ A;  3SAT A;  4LFB M;  3GO8 A;  4YY3 M;  1Q3C A;  1IBL M;  3U6O A;  4GKK M;  4JI8 M;  3U6P A;  2F4V M;  2F5O A;  4MB7 A;  4JV5 M;  4DR5 M;  4JI5 M;  4DR1 M;  1TDZ A;  1R2Z A;  4NXN M;  3VK7 A;  4G4O A;  4LF6 M;  4B3R M;  1XC8 A;  3GQ3 A;  3VK8 A;  3J80 S;  4DV0 M;  4JI2 M;  4K0K M;  3SAV A;  4B3S M;  1K82 A;  3SAU A;  1HNW M;  1N33 M;  4LF5 M;  3A45 A;  1XMQ M;  3GQ5 A;  4X66 M;  5ITR A;  1N32 M;  3A42 A;  4JI3 M;  4X65 M;  1Z5A A;  3T1H M;  1Z59 A;  1J5E M;  1Q3B A;  1N34 M;  4DR4 M;  4DV5 M;  4G4Q A;  2F5S A;  4GKJ M;  5BR8 M;  4DR2 M;  1XNR M;  2UUB M;  3OTO M;  4NRW A;  3T1Y M;  2UUC M;  2E5L M;  1HR0 M;  3U6D A;  5FLX S;  4KHP M;  2F5Q A;  3U6L A;  2UUA M;  1XMO M;  5ITX E;  1R2Y A;  4PDI A;  2XZF A;  3JR5 A; 
#chains in the Genus database with same CATH topology
 4YHH M;  2Z3X A;  3E21 A;  1FJG M;  2FOI C;  1IBK M;  3KS4 A;  2CRU A;  4DV6 M;  2Z7J A;  3SFZ A;  4A3V B;  3PXG A;  1E94 E;  3A46 A;  4IBJ A;  4LFA M;  3SHF A;  4AG6 A;  3HKP A;  4IBC A;  3HZJ A;  3AKZ A;  4OX9 M;  2CEA A;  1A5T A;  1RU3 A;  4M9X A;  1NNJ A;  2BWE A;  4NXM M;  5IZ7 D;  1EE8 A;  5ITQ A;  5KPR A;  3TWK A;  3FTC A;  4JYA M;  2R44 A;  4LFC M;  4IBF A;  1R5L A;  1XNQ M;  1L1Z A;  2X49 A;  3EIH A;  3I51 A;  3HGI A;  3IG5 A;  1C7Y A;  3A98 B;  3FUV A;  3GLI A;  1SG9 A;  3MK6 A;  1EIJ A;  2HL7 A;  2R46 A;  1OAI A;  1Q02 A;  4MM3 B;  1N36 M;  3LMM A;  1XXH B;  2H1R A;  2L6O A;  2JA2 A;  2XEP A;  3VLF B;  3GRV A;  3JR4 A;  2DWL A;  2L2D A;  1ZQ9 A;  4OW0 A;  2VQF M;  3JAM S;  3C9P A;  2YQZ A;  2WZJ A;  4ANR A;  1IN6 A;  1GLN A;  1JR3 E;  1MU5 A;  2MRO B;  3HY5 A;  3FTF A;  3NBI A;  4JI4 M;  4AG5 A;  3T15 A;  4IIW A;  2O5R A;  1UM8 A;  4DV3 M;  5JI2 E;  2XLJ A;  4CIS A;  4DR6 M;  2OQ4 A;  1IN7 A;  1OIP A;  1Z5C A;  5GKN A;  1Q39 A;  2DKL A;  2ERC A;  1PJJ A;  3K9O A;  3BXW A;  3ZQJ A;  5C18 A;  5ITT A;  1QAO A;  2LXE A;  4NOO B;  3UJN A;  2QHO B;  3B7Q A;  4BLC A;  3U6E A;  2C98 A;  2C96 A;  4IJE A;  4B3M M;  4G4N A;  1CUK A;  4X64 M;  5FTN A;  4GHL A;  5FTM A;  2CE7 A;  1G8P A;  5IWA M;  2JZ1 A;  3HHY A;  3J81 S;  2UXB M;  3UK6 A;  1HNX M;  1IN5 A;  3MHV C;  3AL0 C;  2HKJ A;  2KXE A;  4NSO B;  4D81 A;  3SAT A;  4W5W A;  2CV0 A;  4YY3 M;  1OTR A;  1WR1 B;  2QZ4 A;  2Y21 A;  3MJ5 A;  1H6U A;  4MGK E;  4ZPX A;  1IBL M;  3VKH A;  2BJW A;  2DZO B;  2F5O A;  4BB9 A;  1PJQ A;  5KQ8 A;  1OAO C;  1QQW A;  2LH0 A;  4MGI E;  2X8A A;  1DGB A;  1KYI A;  4JI5 M;  1XXH E;  5EXX A;  2OOB A;  1ZMW A;  1R2Z A;  2QP9 X;  1TH2 A;  3RE8 A;  1JR3 A;  4GKK M;  3TPZ A;  2DWN A;  3FYD A;  4TUW A;  3J80 S;  2VF8 A;  1OFI A;  2OOA A;  3I4Y A;  3QWL A;  3V76 A;  1DV0 A;  4K0K M;  5EQT A;  2APL A;  3LW5 F;  3Q8G A;  2V1U A;  1VEJ A;  3THG A;  3A45 A;  2JY5 A;  4LRT A;  3A42 A;  2O01 F;  5C1B A;  4X65 M;  1QAM A;  1Z5A A;  1Z6T A;  1Z59 A;  1J5E M;  4XK8 F;  4JXJ A;  1SXJ C;  2CWB A;  2KDL A;  3FUW A;  1DO2 A;  4G4Q A;  2F5S A;  2D7E A;  4CGY B;  3VKG A;  4KLN A;  1J09 A;  4CJ6 A;  3AOE A;  4IJF A;  3PFI A;  5DYI A;  3OTO M;  1NSF A;  3B7N A;  3KOZ E;  2Y20 A;  2X4A A;  4KOD A;  2YNM D;  3Q8X A;  3AFH A;  3U6D A;  4FD2 A;  3GRY A;  4XBO A;  3KOW E;  2CHV A;  2R6F A;  2QNJ A;  3HHX A;  4R3D A;  1Y8G A;  3JR5 A;  5IT9 S;  1XXH A;  3GPU A;  1E9R A;  1NNU C;  5FTK A;  1AIP C;  1R6B X;  4JI7 M;  3H4M A;  1W5S A;  2CHQ A;  3U6M A;  2EKF A;  1WGN A;  4LZZ A;  2C9C A;  3GPY A;  2VII A;  3HWS A;  4G6Z A;  1MX0 A;  2K9D A;  3HU3 A;  1TH3 A;  2DVW B;  4L6V 6;  4QNM A;  2DAE A;  5E6J A;  4AQY M;  1V34 A;  3KP1 E;  2R0I A;  1E32 A;  2EO2 A;  4KO8 A;  1WJ7 A;  4Z6Y A;  3K92 A;  1QAQ A;  1IQP A;  1OIZ A;  1ZMU A;  4IBE A;  4DV2 M;  1HQY E;  4DR3 M;  3GP1 A;  3B74 A;  4AKH A;  1VEK A;  2M60 A;  4I81 A;  4QNR A;  3SMP A;  2O25 A;  3U6S A;  3FE3 A;  2LVA A;  4GMQ A;  4LJ6 A;  2R62 A;  3TWM A;  2LHC A;  2LVQ D;  2Z8Y M;  2ZM6 M;  2F5N A;  2J5Y A;  2KZS A;  1T43 A;  2JP7 A;  3SAS A;  1IY2 A;  3SC3 A;  3GPX A;  3K2L A;  3KXE C;  1QVR A;  1IY0 A;  2FS1 A;  4RF1 A;  3FUX A;  4UN2 B;  1YUB A;  2QBY B;  4QOS A;  4DV1 M;  4D82 A;  3GLG B;  2JY6 B;  3HU2 A;  3T6P A;  1WGL A;  2V6Z M;  3GLF B;  2VDB B;  3LQR A;  3M7G A;  4DUZ M;  2ZTC A;  5DNY A;  1K3X A;  2XFT A;  4B3T M;  4IBD A;  2WSF F;  2JNH A;  3CF0 A;  3W0F A;  2RGO A;  1GKI A;  1IXS B;  2G3Q A;  4LF9 M;  2KRK A;  3WHK A;  2KNV A;  4HEO A;  5FTL A;  3GO8 A;  5IRE B;  3PNV A;  1JB0 F;  1Q3C A;  1D0L A;  1VG5 A;  1QAN A;  4JI8 M;  2K47 A;  2DWM A;  2F4V M;  5F3W A;  4LJ7 A;  3L29 A;  4LJ4 A;  2MR9 A;  4MB7 A;  2DEN A;  3FUU A;  4MGY E;  4FCT A;  3IEC A;  5DYG A;  1IN8 A;  4GC9 A;  1TDZ A;  3IHP A;  1HJP A;  3HJS A;  3GRU A;  1FNN A;  4LZJ A;  1P3Q Q;  1T3T A;  2CV2 A;  4LF6 M;  4B3R M;  1HT1 E;  3GQ3 A;  3VK8 A;  4GRI A;  1V33 A;  3FRI A;  1OKS A;  2DZN B;  3SAV A;  4B3S M;  2JXN A;  3CGW A;  3SAU A;  3E46 A;  1G3I A;  1HT2 E;  1YLA A;  3J2P B;  1NV9 A;  3KOX E;  1XMQ M;  4WP2 A;  4M9S A;  3GQ5 A;  2JWS A;  1HQC A;  4LGY A;  4Z8X A;  8CAT A;  1NV8 A;  4G3O A;  3GLG E;  4HLQ A;  2ZAM A;  3LVV A;  1N34 M;  2HAK A;  1DO0 A;  4L15 A;  3GLF E;  4DR4 M;  4REZ A;  2HWJ A;  5BR8 M;  2R4E A;  4GIT A;  3EIE A;  4DR2 M;  1XNR M;  4P17 A;  3C3E A;  1GL7 A;  2UUB M;  3K9P A;  2K0B X;  4WW0 A;  3VFD A;  2J7N A;  4GIP A;  2RKO A;  4AW4 A;  4RF0 A;  1KFV A;  4GH9 A;  4FCW A;  2E5L M;  2WSE F;  4Y28 F;  1HR0 M;  5FLX S;  3W68 A;  3U6L A;  3J7B A;  2UUA M;  4AI6 A;  5ITX E;  4R71 A;  4LG2 A;  2DXI A;  1SXJ D;  4PDI A;  1D0M A;  3QAU A;  2OO9 A;  1R4G A;  3GQ4 A;  1DGG A;  3K1J A;  4B7F A;  4LJ5 A;  2KA6 B;  4D80 A;  3HX3 A;  4LRS A;  5JI3 E;  2FFJ A;  4OVZ B;  3RFW A;  3U60 B;  1QDR A;  4IBI A;  4F1I A;  4DV4 M;  1NY5 A;  5KPZ A;  2QPA A;  3KS8 A;  2KEB A;  2XF3 A;  3U6C A;  3GLH E;  4KT0 F;  2WSC F;  4GC5 A;  5LMU M;  1L2D A;  3TE6 A;  2M5Z A;  2QBY A;  1I94 M;  3C58 A;  2UXD M;  4RKU F;  3GLG A;  2DI0 A;  5A2Q S;  2GQF A;  3DOA A;  3FKE A;  4M0W A;  4G4R A;  2I7N A;  1SXJ B;  3IG8 A;  3GLF A;  1WHC A;  4BBA A;  5LMN M;  2CV1 A;  3QYB A;  4PDG A;  3FRH A;  3SMS A;  1L1T A;  2XFS A;  2CUZ A;  2EKK A;  2DAK A;  1NHG C;  2D7G A;  2L4E A;  4DV7 M;  2R4J A;  4RNA A;  1IXS A;  3DZD A;  1QUT A;  1XWI A;  4QHS A;  4XGI A;  3NBX X;  4IBK A;  3C3D A;  1IXR C;  5ITX A;  4II7 A;  5H37 D;  5EJC A;  3SAW A;  2UU9 M;  4DR7 M;  1F4I A;  1NVM A;  3F92 A;  4M9Z A;  2Z4S A;  1DGH B;  2W82 A;  1T6O A;  4GHA A;  4FW9 A;  2EA0 A;  4X62 M;  2KHH A;  2RGH A;  1DGF A;  2K6B A;  3CF6 E;  1PJS A;  4S12 A;  1UFZ A;  2XZU A;  2HHH M;  3M6A A;  5L8R F;  4JN6 A;  4NRV A;  3U6Q A;  3I01 M;  2LVN C;  3E9S A;  2XSZ D;  4GEW A;  4PD2 A;  1PM5 A;  2R18 A;  5ITY A;  3GPP A;  1JQJ C;  3H4J A;  3HJQ A;  2JZ0 A;  1Z5B A;  3TWL A;  3UZU A;  4EIW A;  4R7G A;  1YE9 A;  3GLI E;  2XGN A;  1GJS A;  5FSW A;  4MGZ E;  2G5G X;  3DA1 A;  1SXJ E;  4DR5 M;  4CIZ A;  3HHW A;  5EP4 A;  3J27 B;  2CHG A;  2FNA A;  4NXN M;  1L8Q A;  4G4O A;  2KNZ A;  2LNH C;  1V92 A;  1XC8 A;  2C5R A;  3CF2 A;  3SYK A;  3L25 A;  5BPV A;  2R45 A;  1TGU A;  2KZU A;  2QCU A;  5EP3 A;  4DV0 M;  2J7O A;  1IXZ A;  2GNO A;  1K82 A;  1OFH A;  1QUS A;  1WXQ A;  1ZV1 A;  3SYL A;  4CHT B;  4NSR A;  3KDS E;  3B89 A;  3AOE C;  5ITR A;  2B3T A;  2QSF X;  4OVZ A;  1AUA A;  4FWG A;  4FWD A;  5EXT A;  3U60 A;  1EFU B;  1VQ1 A;  1Q3B A;  2CFO A;  4I5S A;  3W0L B;  5KQD A;  3D8B A;  1N77 A;  4DV5 M;  4LY6 A;  2DHR A;  2R65 A;  4NL4 H;  4Q7J A;  2MJ5 B;  1ZMV A;  2L09 A;  1OQY A;  1D2N A;  2ZTD A;  2UUC M;  1QZM A;  4KHP M;  2F5Q A;  1SXJ A;  4IBB A;  3KW6 A;  1XMO M;  1R2Y A;  3HU1 A;  3GLH B;  3KVW A;  1C1K A;  1VDD A;  4LGM A;  4L8R C;  2Q2E B;  2KRU A;  5EP2 A;  2JY8 A;  2EUC A;  3RGP A;  4MH0 E;  1IM2 A;  3U5Z B;  2LWX A;  1WIV A;  1I4W A;  2QQ8 A;  1R7R A;  3ZC7 B;  1D0K A;  2KW0 A;  4JI6 M;  2VQE M;  1K3W A;  3TQS A;  1MN3 A;  1OJL A;  1VDL A;  1IBM M;  3PVS A;  2AHM A;  1PJI A;  1DGH A;  2G8L A;  3KP0 E;  3L28 A;  4B7H A;  4AKG A;  2OPF A;  3FD9 A;  2EJS A;  2NQ8 C;  2JY7 A;  2Z4R A;  3T38 A;  2L7I A;  2DHY A;  1MJG M;  3KFU G;  3WHL A;  3U61 B;  1G59 A;  4PCZ A;  3R8F A;  1ZAE A;  2F5P A;  3SHG B;  1LTM A;  1VEG A;  4AZF A;  1GL6 A;  2BWB A;  2YFQ A;  3CTW B;  1GJT A;  4LF4 M;  1N75 A;  2QEN A;  2ZAO A;  7CAT A;  4JI1 M;  2UXC M;  2LHG A;  3AOG A;  3AV0 A;  2I7P A;  3ILK A;  3LCV B;  4MGH A;  3TL4 X;  2HCB A;  3LVW A;  3W67 A;  4DUY M;  2C9O A;  1IN4 A;  2LTU A;  1E9S A;  4NC6 A;  2C99 A;  3VDU A;  4M0D A;  4WUR A;  2N35 A;  4JI0 M;  1L2B A;  1GO5 A;  3J7A S;  4LJA A;  2LVP C;  1HNZ M;  1XHB A;  4LF7 M;  5EP1 A;  1L2C A;  2ZBK B;  5ITU A;  3DFZ A;  2P5T A;  2RRU A;  3SBJ A;  1QYR A;  2DAI A;  1J7K A;  3UMM A;  3GLI B;  2CP8 A;  3KSX A;  1NJG A;  3RGS A;  2DAM A;  1ORY B;  3SAR A;  2V1C A;  2XSZ A;  4LJ8 A;  1QDT A;  1TF0 B;  3HHZ A;  4ITQ A;  1NY6 A;  3ZH9 B;  1YSY A;  1PJT A;  3L27 A;  3M0E A;  2DNA A;  1KSF X;  4LF8 M;  1GVN A;  3LCU A;  1TDH A;  2DZL A;  4LFB M;  2LBC A;  2VF7 A;  3L26 A;  2Y0Q A;  3QYE A;  4FVM A;  2BJV A;  3U6O A;  2MH8 A;  1G4A E;  4P16 A;  1TTE A;  4QHT A;  2L7H A;  5KO3 A;  3U6P A;  1LV7 A;  4F2L A;  2FH0 A;  4JV5 M;  3KSJ A;  2FE8 A;  1TR8 A;  1GAB A;  3B7Z A;  5EXP A;  4DBG B;  3VDP A;  3R9X B;  4DR1 M;  2A5Y B;  1BVS A;  2ZAN A;  1NHW C;  3KOY E;  1G41 A;  4PT5 A;  4B08 A;  2DWZ B;  1G71 A;  3VK7 A;  1XB2 B;  3FTE A;  3MMP A;  2DAG A;  1JR3 D;  2D7H A;  2LVO C;  4L4U A;  3NWL A;  1X37 A;  3B9P A;  4LJ9 A;  5EXS A;  1S3S A;  2YR0 A;  4JI2 M;  3GLH A;  2BNK A;  4HL4 A;  1HNW M;  2JUJ A;  3FTD A;  3FYC A;  1N33 M;  4LF5 M;  2MGW A;  4L16 A;  4X66 M;  1N32 M;  2KNA A;  3U5Z A;  4QOZ C;  4JI3 M;  1IY1 A;  1NJF A;  4I8O A;  4OU7 A;  1QZE A;  1TH4 A;  3T1H M;  1NO1 A;  4FWH A;  3I4V A;  3K8Z A;  3BBZ A;  3UGJ A;  4GKJ M;  3L2A A;  4LCB A;  4B7G A;  5FTJ A;  1PRB A;  3BOS A;  3I04 M;  3AJI B;  2Y0T A;  4FCV A;  3PNY A;  1PGY A;  4NRW A;  3HJ8 A;  3GRR A;  5DFL A;  5KPT A;  4I4L A;  3E4R A;  3FUT A;  3T1Y M;  3U61 A;  3LQQ A;  3D8L A;  1N78 A;  1W5T A;  2XH9 A;  4AKI A;  4L78 A;  4IBG A;  3ZCB B;  5E26 A;  1IFY A;  2XZF A;  2L4F A;  2H5X A; 
#chains in the Genus database with same CATH homology
 4YHH M;  2Z3X A;  1FJG M;  2FOI C;  1IBK M;  3KS4 A;  4DV6 M;  2Z7J A;  3SFZ A;  4A3V B;  3PXG A;  1E94 E;  3A46 A;  4IBJ A;  4LFA M;  3SHF A;  4AG6 A;  3HKP A;  4IBC A;  3AKZ A;  4OX9 M;  2CEA A;  4M9X A;  1NNJ A;  4NXM M;  5IZ7 D;  1EE8 A;  5ITQ A;  5KPR A;  3TWK A;  3FTC A;  4JYA M;  4LFC M;  1XNQ M;  4IBF A;  1L1Z A;  2X49 A;  3EIH A;  3I51 A;  3HGI A;  3IG5 A;  3A98 B;  3FUV A;  3GLI A;  3MK6 A;  2HL7 A;  2R46 A;  4MM3 B;  1N36 M;  3LMM A;  1XXH B;  2H1R A;  2L6O A;  2JA2 A;  2XEP A;  3VLF B;  3GRV A;  3JR4 A;  2DWL A;  1ZQ9 A;  4OW0 A;  2VQF M;  3JAM S;  2YQZ A;  1IN6 A;  1GLN A;  1MU5 A;  3FTF A;  3NBI A;  4JI4 M;  4AG5 A;  3T15 A;  4IIW A;  2O5R A;  1UM8 A;  4DV3 M;  5JI2 E;  2XLJ A;  4CIS A;  4DR6 M;  2OQ4 A;  1IN7 A;  1Z5C A;  5GKN A;  1Q39 A;  2ERC A;  1PJJ A;  5C18 A;  5ITT A;  1QAO A;  2LXE A;  4NOO B;  3UJN A;  3U6E A;  4BLC A;  2C98 A;  2C96 A;  4IJE A;  4B3M M;  4G4N A;  4X64 M;  5FTN A;  4GHL A;  5FTM A;  2CE7 A;  1G8P A;  5IWA M;  3HHY A;  3J81 S;  2UXB M;  3UK6 A;  1HNX M;  1IN5 A;  3MHV C;  3AL0 C;  2HKJ A;  2KXE A;  4NSO B;  4D81 A;  3SAT A;  4W5W A;  2CV0 A;  4YY3 M;  2Y21 A;  2QZ4 A;  3MJ5 A;  4MGK E;  1H6U A;  4ZPX A;  1IBL M;  3VKH A;  2BJW A;  2DZO B;  2F5O A;  4BB9 A;  5KQ8 A;  1QQW A;  2LH0 A;  4MGI E;  2X8A A;  1DGB A;  1KYI A;  4JI5 M;  5EXX A;  1R2Z A;  2QP9 X;  1TH2 A;  3RE8 A;  1JR3 A;  3TPZ A;  2DWN A;  3FYD A;  4TUW A;  3J80 S;  1OFI A;  3QWL A;  3I4Y A;  4K0K M;  5EQT A;  2V1U A;  3THG A;  3A45 A;  4LRT A;  3A42 A;  5C1B A;  4X65 M;  1QAM A;  1Z5A A;  1Z6T A;  1Z59 A;  1J5E M;  4JXJ A;  1SXJ C;  3FUW A;  1DO2 A;  4G4Q A;  2F5S A;  2D7E A;  4CGY B;  3VKG A;  4KLN A;  1J09 A;  3AOE A;  4IJF A;  3PFI A;  5DYI A;  3OTO M;  1NSF A;  3KOZ E;  2Y20 A;  2X4A A;  4KOD A;  2YNM D;  3Q8X A;  3AFH A;  3U6D A;  4FD2 A;  3GRY A;  4XBO A;  3KOW E;  2CHV A;  3HHX A;  4R3D A;  3JR5 A;  5IT9 S;  1XXH A;  3GPU A;  1E9R A;  1NNU C;  5FTK A;  1R6B X;  4JI7 M;  3H4M A;  1W5S A;  2CHQ A;  3U6M A;  4LZZ A;  2C9C A;  3GPY A;  2VII A;  3HWS A;  4G6Z A;  1MX0 A;  3HU3 A;  1TH3 A;  2DVW B;  4QNM A;  5E6J A;  4AQY M;  3KP1 E;  1E32 A;  2EO2 A;  4KO8 A;  4Z6Y A;  3K92 A;  1QAQ A;  1IQP A;  4IBE A;  4DV2 M;  1HQY E;  4DR3 M;  3GP1 A;  4AKH A;  2M60 A;  4I81 A;  4QNR A;  3SMP A;  3U6S A;  4GMQ A;  4LJ6 A;  2R62 A;  3TWM A;  2ZM6 M;  2F5N A;  2KZS A;  3SAS A;  1IY2 A;  3SC3 A;  3GPX A;  3K2L A;  3KXE C;  1QVR A;  1IY0 A;  4RF1 A;  3FUX A;  1YUB A;  2QBY B;  4QOS A;  4DV1 M;  4D82 A;  3GLG B;  3HU2 A;  2V6Z M;  3GLF B;  3M7G A;  3LQR A;  4DUZ M;  5DNY A;  1K3X A;  2XFT A;  4B3T M;  4IBD A;  3CF0 A;  3W0F A;  2RGO A;  1GKI A;  1IXS B;  4LF9 M;  2KRK A;  3WHK A;  5FTL A;  3GO8 A;  5IRE B;  3PNV A;  1Q3C A;  1QAN A;  4JI8 M;  2K47 A;  2DWM A;  2F4V M;  5F3W A;  4LJ7 A;  3L29 A;  4LJ4 A;  4MB7 A;  3FUU A;  4MGY E;  4FCT A;  5DYG A;  1IN8 A;  4GC9 A;  1TDZ A;  3HJS A;  3GRU A;  1FNN A;  4LZJ A;  2CV2 A;  1T3T A;  4LF6 M;  4B3R M;  1HT1 E;  3GQ3 A;  3VK8 A;  4GRI A;  2DZN B;  3SAV A;  4B3S M;  3SAU A;  1G3I A;  1HT2 E;  3J2P B;  3KOX E;  1XMQ M;  4M9S A;  3GQ5 A;  1HQC A;  4LGY A;  4Z8X A;  8CAT A;  4HLQ A;  2ZAM A;  3LVV A;  1N34 M;  1DO0 A;  4L15 A;  4DR4 M;  4REZ A;  5BR8 M;  2R4E A;  4GIT A;  3EIE A;  4DR2 M;  1XNR M;  1GL7 A;  2UUB M;  3VFD A;  4WW0 A;  2J7N A;  4GIP A;  2RKO A;  4AW4 A;  4RF0 A;  4GH9 A;  4FCW A;  2E5L M;  1HR0 M;  5FLX S;  3U6L A;  4AI6 A;  3J7B A;  2UUA M;  5ITX E;  4LG2 A;  2DXI A;  1SXJ D;  4PDI A;  3QAU A;  3GQ4 A;  1DGG A;  3K1J A;  4B7F A;  4LJ5 A;  2KA6 B;  4D80 A;  4LRS A;  5JI3 E;  2FFJ A;  4OVZ B;  3RFW A;  3U60 B;  4IBI A;  4DV4 M;  1NY5 A;  5KPZ A;  2QPA A;  3KS8 A;  2KEB A;  2XF3 A;  3U6C A;  4GC5 A;  5LMU M;  1L2D A;  3TE6 A;  2M5Z A;  2QBY A;  1I94 M;  3C58 A;  2UXD M;  3GLG A;  5A2Q S;  3DOA A;  4M0W A;  3FKE A;  4G4R A;  2I7N A;  1SXJ B;  3IG8 A;  3GLF A;  4BBA A;  5LMN M;  2CV1 A;  4PDG A;  3SMS A;  1L1T A;  2XFS A;  2CUZ A;  1NHG C;  2D7G A;  4DV7 M;  2R4J A;  4RNA A;  3DZD A;  1XWI A;  4QHS A;  4XGI A;  4IBK A;  5ITX A;  1IXR C;  4II7 A;  5H37 D;  5EJC A;  3SAW A;  2UU9 M;  4DR7 M;  1NVM A;  4M9Z A;  2Z4S A;  1DGH B;  2W82 A;  4GHA A;  4FW9 A;  2EA0 A;  4X62 M;  2RGH A;  1DGF A;  3CF6 E;  4S12 A;  2XZU A;  2HHH M;  3M6A A;  4JN6 A;  4NRV A;  3U6Q A;  4PD2 A;  3E9S A;  2XSZ D;  1PM5 A;  2R18 A;  5ITY A;  3GPP A;  1JQJ C;  3HJQ A;  3TWL A;  1Z5B A;  3UZU A;  4EIW A;  4R7G A;  1YE9 A;  2XGN A;  5FSW A;  4MGZ E;  2G5G X;  3DA1 A;  1SXJ E;  4DR5 M;  3HHW A;  5EP4 A;  3J27 B;  2CHG A;  2FNA A;  4NXN M;  1L8Q A;  4G4O A;  2LNH C;  1XC8 A;  2C5R A;  3CF2 A;  3SYK A;  3L25 A;  5BPV A;  2R45 A;  1TGU A;  2KZU A;  2QCU A;  5EP3 A;  4DV0 M;  2J7O A;  1IXZ A;  1K82 A;  1OFH A;  1WXQ A;  3SYL A;  4CHT B;  4NSR A;  3KDS E;  3AOE C;  5ITR A;  4OVZ A;  4FWG A;  4FWD A;  5EXT A;  3U60 A;  1Q3B A;  2CFO A;  4I5S A;  3W0L B;  5KQD A;  3D8B A;  1N77 A;  4DV5 M;  4LY6 A;  2DHR A;  2R65 A;  4NL4 H;  2L09 A;  1D2N A;  2UUC M;  1QZM A;  4KHP M;  2F5Q A;  1SXJ A;  4IBB A;  3KW6 A;  1XMO M;  1R2Y A;  3HU1 A;  3GLH B;  3KVW A;  1C1K A;  1VDD A;  4LGM A;  4L8R C;  2Q2E B;  2KRU A;  5EP2 A;  2EUC A;  3RGP A;  4MH0 E;  1IM2 A;  3U5Z B;  2LWX A;  1I4W A;  1R7R A;  3ZC7 B;  2KW0 A;  4JI6 M;  2VQE M;  1K3W A;  3TQS A;  1OJL A;  1IBM M;  3PVS A;  2AHM A;  1PJI A;  1DGH A;  2G8L A;  3KP0 E;  3L28 A;  4B7H A;  4AKG A;  2OPF A;  3FD9 A;  2Z4R A;  2NQ8 C;  3T38 A;  3KFU G;  2L7I A;  3WHL A;  3U61 B;  1G59 A;  4PCZ A;  3R8F A;  1ZAE A;  2F5P A;  3SHG B;  4AZF A;  1GL6 A;  2YFQ A;  3CTW B;  4LF4 M;  1N75 A;  2QEN A;  2ZAO A;  7CAT A;  4JI1 M;  2UXC M;  3ILK A;  3AOG A;  3AV0 A;  2I7P A;  3TL4 X;  1KFV A;  4MGH A;  2HCB A;  3LVW A;  4DUY M;  2C9O A;  1IN4 A;  1E9S A;  2C99 A;  3VDU A;  4M0D A;  4WUR A;  4JI0 M;  1L2B A;  3J7A S;  4LJA A;  1HNZ M;  1XHB A;  4LF7 M;  5EP1 A;  1L2C A;  2ZBK B;  5ITU A;  3DFZ A;  2P5T A;  3SBJ A;  1QYR A;  3GLI B;  1J7K A;  3UMM A;  3KSX A;  1NJG A;  3RGS A;  1ORY B;  3SAR A;  2V1C A;  2XSZ A;  4LJ8 A;  3HHZ A;  4ITQ A;  1NY6 A;  3ZH9 B;  1YSY A;  3L27 A;  3M0E A;  1KSF X;  4LF8 M;  1GVN A;  1TDH A;  4LFB M;  3L26 A;  2Y0Q A;  4FVM A;  2BJV A;  3U6O A;  4GKK M;  1G4A E;  4P16 A;  4QHT A;  5KO3 A;  2L7H A;  3U6P A;  1LV7 A;  4JV5 M;  3KSJ A;  2FE8 A;  5EXP A;  3R9X B;  3VDP A;  4DR1 M;  2A5Y B;  2ZAN A;  1NHW C;  3KOY E;  1G41 A;  4PT5 A;  4B08 A;  2DWZ B;  3VK7 A;  3FTE A;  1JR3 D;  2D7H A;  4L4U A;  3NWL A;  1X37 A;  3B9P A;  4LJ9 A;  5EXS A;  1S3S A;  2YR0 A;  4JI2 M;  3GLH A;  2BNK A;  4HL4 A;  1HNW M;  3FTD A;  3FYC A;  1N33 M;  4LF5 M;  4L16 A;  4X66 M;  1N32 M;  3U5Z A;  4QOZ C;  4JI3 M;  1IY1 A;  1NJF A;  4I8O A;  4OU7 A;  1TH4 A;  3T1H M;  4FWH A;  3I4V A;  3K8Z A;  3UGJ A;  4GKJ M;  3L2A A;  4LCB A;  4B7G A;  5FTJ A;  3BOS A;  3AJI B;  2Y0T A;  4FCV A;  3PNY A;  4NRW A;  3HJ8 A;  3GRR A;  5KPT A;  4I4L A;  3E4R A;  3FUT A;  3T1Y M;  3U61 A;  3LQQ A;  3D8L A;  1N78 A;  1W5T A;  2XH9 A;  4AKI A;  4L78 A;  4IBG A;  3ZCB B;  5E26 A;  2XZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...