5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
4PDGA 1PM5A 3U6OA 4GKJM 1XMOM 1R2ZA 3GQ5A 3TWKA 5ITUA 4JI7M 4OX9M 5ITRA 4JI4M 1NNJA 4JI3M 1KFVA 4PDIA 5BR8M 1I94M 3GPUA 3U6LA 1Q39A 4YY3M 1XNQM 2UUBM 5ITTA 1L2DA 1Z59A 1IBKM 1N33M 4G4QA 3GP1A 3A45A 2F5NA 2UUAM 2OPFA 1K3XA 2XZUA 5IWAM 3SATA 4PCZA 3JR5A 4DR5M 1EE8A 3C58A 4NRWA 4JYAM 2UU9M 2F5QA 1IBLM 1L1TA 1TDZA 1Z5CA 3TWLA 4YHHM 4DV3M 3SAWA 3U6MA 1N34M 3VK7A 2EA0A 4LF4M 4B3MM 1K82A 2Q2EB 3J7AS 4DV6M 2F5SA 5IT9S 4K0KM 3U6QA 1XNRM 2UXBM 3GPXA 4PD2A 4DV0M 1IBMM 2F5OA 4JI5M 1Z5BA 4JI6M 4DUYM 1Z5AA 4JI0M 3U6DA 3SAVA 1K3WA 4X64M 3GQ3A 4NRVA 1N36M 4LFAM 1PJIA 3J80S 1L2CA 2VQEM 3J81S 1TDHA 4NXMM 4G4OA 1MU5A 2OQ4A 3TWMA 5A2QS 3JR4A 5ITXA 4DR2M 3U6EA 1HR0M 3GO8A 4DV5M 4LFCM 2HKJA 4G4NA 4DV1M 1R2YA 3GPYA 4DR7M 2E5LM 4DR1M 3U6CA 3U6PA 4LF7M 4JI1M 3VK8A 1HNZM 4ITQA 1Q3BA 3DOAA 2F5PA 4DR4M 4LF8M 4X66M 2XZFA 2VQFM 4KHPM 3A42A 1PJJA 2UUCM 2UXCM 4B3RM 3T1YM 4GKKM 1L2BA 4JV5M 5ITQA 1J5EM 3SAUA 3SASA 2ZM6M 4LF6M 1L1ZA 3A46A 1XC8A 4DR3M 4B3TM 4DV4M 4JI2M 3W0FA 1HNWM 2F4VM 3JAMS 3SBJA 4B3SM 1N32M 5FLXS 4DUZM 5ITXE 4DV2M 4CISA 4X65M 3GPPA 5LMUM 2ZBKB 4X62M 1Q3CA 3T1HM 4LFBM 5LMNM 5ITYA 3U6SA 3GQ4A 4NXNM 4DV7M 4MB7A 3SARA 2UXDM 4JI8M 2HHHM 4LF5M 1XMQM 4LF9M 3OTOM 4DR6M 4G4RA 1FJGM 1MX0A 4AQYM 1HNXM
chains in the Genus database with same CATH superfamily
4LJ9A 2JNHA 1PM5A 1AUAA 2G5GX 3I51A 4G3OA 4GKJM 5FTNA 2QHOB 2ZTDA 3KOZE 3TWKA 4AZFA 4OX9M 2OOAA 4JI3M 1GLNA 4GC9A 3DA1A 2MH8A 2CHGA 2FS1A 4GITA 2YR0A 3U6LA 1C1KA 2DAGA 3L27A 1E9RA 3BOSA 5DNYA 5EQTA 1L2DA 3HZJA 1Z59A 1IBKM 3HU2A 4G4QA 4LJAA 2R0IA 3L29A 1BVSA 2LTUA 2DHYA 2YNMD 3SYKA 3IG5A 4GHLA 3UK6A 4CIZA 4DR5M 3KS4A 3C58A 4LCBA 1JR3A 1DGGA 3ZQJA 4QNMA 4GEWA 2KNAA 3PFIA 1Z5CA 1OKSA 2L4EA 3TWLA 3SAWA 3U6MA 3VK7A 4WW0A 2EUCA 4IJEA 4B3MM 4MGIE 2KA6B 2I7NA 2LHGA 1QAQA 2ZAMA 3CGWA 4M9ZA 2F5SA 1NVMA 1D0KA 2KNVA 1VDDA 3GPXA 4DV0M 7CATA 1NHGC 3HJSA 2LBCA 4AW4A 1GO5A 2DWZB 4JI6M 2JY5A 1K3WA 4IBIA 3SAVA 4X64M 3W68A 3L28A 3PNYA 4LFAM 1PJIA 1IN7A 4L6V6 2D7GA 4G4OA 1MU5A 2XH9A 2OQ4A 2R45A 5EXSA 3BBZA 3KOWE 4DR2M 2HWJA 1OAOC 3B7QA 4FWGA 3HHWA 4A3VB 3GLHE 2X49A 4LFCM 4DV1M 1C7YA 1IXSA 2N35A 3GLHB 3J27B 1YE9A 2OOBA 2XEPA 4XBOA 2I7PA 1HQYE 3FUTA 3HU1A 2R4EA 3I4VA 1HQCA 3AOGA 2VQFM 2XZFA 1NHWC 1NY6A 4KT0F 2QSFX 3L2AA 1IN8A 2XFSA 3VDUA 3TE6A 1ZMWA 1DO2A 1FNNA 4CGYB 2C5RA 2HL7A 1J5EM 3QYBA 3SASA 4Y28F 1NO1A 1GJTA 4WP2A 3A46A 2CV0A 4DR3M 1ZMVA 2FE8A 3MHVC 5FTKA 3Q8GA 4AKIA 4OVZB 3I01M 2QP9X 3ZCBB 5FLXS 4IBBA 4R71A 5ITXE 4DV2M 4I81A 1VEGA 4NL4H 3B7ZA 4X62M 4NSRA 3QYEA 1IY1A 3U6SA 3GQ4A 2P5TA 2XSZD 3KDSE 5EXTA 2Z4SA 3KSXA 3L26A 4LJ7A 2DKLA 2AHMA 2C99A 1XMQM 1GJSA 4LRTA 1LV7A 3UGJA 2FFJA 5IZ7D 3LVWA 2V1CA 2FOIC 3HKPA 4L78A 4AQYM 2DWMA 2QBYB 2JP7A 2VDBB 4PDGA 1Z6TA 1WHCA 4LGYA 3WHKA 3FTFA 4NC6A 2CHVA 1R2ZA 2WZJA 2A5YB 2DI0A 1XHBA 2J7OA 2O25A 5IREB 3GQ5A 5ITRA 3KSJA 1WJ7A 2VIIA 4BBAA 4JI4M 4JI7M 3J2PB 1E94E 1G41A 4JXJA 3D8BA 5BR8M 2CUZA 2D7HA 3KW6A 4I8OA 3AKZA 4AI6A 3SMPA 4LZZA 1Q39A 1XNQM 2JY7A 4FCWA 4EIWA 3SMSA 3Q8XA 1A5TA 3FTDA 4RNAA 2XFTA 2JXNA 2XZUA 3GLHA 1R5LA 2C9CA 3SATA 1IXRC 2L2DA 3PXGA 4PCZA 3JR5A 3C9PA 4GH9A 3KP0E 3HJQA 2DENA 2L7HA 4NRWA 1L1TA 5KPTA 1E32A 4CJ6A 1JQJC 4FW9A 2ZANA 1QANA 1MJGM 2EKKA 4MGYE 3U61B 4LF4M 1R7RA 2Y20A 3J7AS 3K9OA 3GRRA 4FWHA 4R3DA 2MGWA 2Z8YM 4QNRA 4S12A 3GRVA 2Z3XA 2UXBM 4PD2A 3PVSA 2XGNA 1QAMA 1NV8A 1IBMM 2UUBM 3GLIE 1QUTA 1VG5A 1SXJE 3THGA 1YUBA 1Z5BA 1GKIA 4FVMA 2R6FA 2DZOB 2JUJA 2VF7A 1Z5AA 3E4RA 1SXJB 4OVZA 3U6DA 3AOEA 4NRVA 1NJGA 1G8PA 1N36M 2VQEM 3KP1E 1JR3D 1P3QQ 1TDHA 3J81S 1D0LA 3QWLA 1YSYA 4NXMM 2DAMA 5A2QS 5ITXA 2QZ4A 3GRYA 3U6EA 2XF3A 1LTMA 1VQ1A 3FRIA 4DV5M 2KHHA 4BLCA 3DZDA 3FUUA 1N77A 1OQYA 1R2YA 3GPYA 2E5LM 5C18A 4DR1M 2O01F 5GKNA 2QBYA 4LF7M 3RE8A 4Z6YA 2F5PA 4DR4M 2KZSA 2QNJA 3M7GA 1V33A 4KHPM 2RKOA 1WXQA 4L15A 4D82A 1DGBA 5EXXA 4B3RM 3UJNA 2GQFA 3HHZA 2CP8A 4IBGA 1ZV1A 4G6ZA 3AJIB 1IQPA 5KPZA 2FNAA 1PJTA 3HWSA 1XC8A 1WIVA 4MGKE 5JI3E 4JI2M 3WHLA 4FCVA 4LJ5A 4F1IA 1TR8A 3JAMS 1CUKA 1N32M 3U5ZB 4Q7JA 4FCTA 4RF0A 1TGUA 2DWLA 1QZEA 2Z4RA 1HT2E 2KW0A 1GL6A 1QAOA 2LHCA 2K9DA 1QYRA 3U61A 3KS8A 4ZPXA 8CATA 4GHAA 4HL4A 3TPZA 3LQRA 2UXDM 3SHFA 1TH3A 2LH0A 2BWBA 2Z7JA 1JB0F 1OIPA 1E9SA 5EP1A 5KQDA 3OTOM 4DR6M 1DV0A 1QQWA 2J7NA 3B9PA 3LCVB 1WGNA 1MX0A 3H4MA 4QOZC 4LGMA 1V92A 1IXZA 3B89A 1MN3A 3RGPA 1KYIA 3GLFE 1WGLA 3K9PA 1XMOM 1QUSA 2CFOA 3KFUG 4LY6A 4ANRA 1SXJA 3HHYA 1NNJA 3VKGA 3GLFB 4PDIA 1XWIA 1PGYA 3SHGB 1I94M 3FTCA 1GVNA 4YY3M 1H6UA 1DGFA 1TF0B 2LNHC 4IBJA 4IBFA 1N33M 1J09A 1W5TA 3A45A 1OFHA 3E46A 2F5NA 1T6OA 2M5ZA 3VDPA 3ZC7B 4L16A 4B7GA 3K8ZA 1XXHE 1EFUB 3LCUA 1SG9A 4Z8XA 2DWNA 3HJ8A 1TDZA 4DV3M 1XXHB 2LVAA 3EIEA 3FD9A 3KOYE 1N34M 2EA0A 2D7EA 2DAEA 4LG2A 4DV6M 1VDLA 4GIPA 5IT9S 1TH4A 2C96A 3ILKA 3D8LA 2R62A 3TQSA 2MR9A 1ZQ9A 3EIHA 1J7KA 4GRIA 4MGZE 1NNUC 4NOOB 2F5OA 3KXEC 1G3IA 2RGOA 2CEAA 4AG6A 2LWXA 2DAKA 3FUVA 2R4JA 3MMPA 4KO8A 2JA2A 4DUYM 2JWSA 4AKGA 2B3TA 2NQ8C 2CE7A 2LVQD 2G3QA 4LRSA 1V34A 3U5ZA 1D0MA 1VEJA 5L8RF 1DGHB 1I4WA 1NSFA 2DHRA 3J80S 1L2CA 3FE3A 3I04M 4I5SA 2CV1A 3LVVA 1Q02A 2L09A 1S3SA 2HAKA 3QAUA 3FTEA 3U60B 4UN2B 1G59A 3VKHA 2HKJA 3F92A 1OAIA 3CF0A 3I4YA 3T15A 2XLJA 2L4FA 3FYDA 4REZA 1R6BX 2M60A 1UFZA 3LW5F 4IBEA 5KPRA 3SYLA 4WURA 3SC3A 4JI1M 1L8QA 1Q3BA 1EIJA 4X66M 3IECA 4JN6A 3A42A 1PJJA 4CHTB 3GLIB 3GLFA 3FRHA 4GKKM 2RRUA 2K47A 2KZUA 1NV9A 4IBKA 2KXEA 4LZJA 5ITQA 2HCBA 3HU3A 4I4LA 1T43A 1YLAA 2O5RA 4QHSA 3RGSA 2WSFF 3K92A 4RKUF 4B3TM 2L6OA 4DV4M 4DBGB 2QPAA 5DFLA 2F4VM 3V76A 1NJFA 4FWDA 4M0DA 1PJQA 2KRKA 2X8AA 4X65M 3GPPA 3A98B 2OO9A 3SFZA 3T1HM 1XXHA 4LFBM 1W5SA 3M0EA 2EJSA 5EP4A 5ITYA 4M9XA 1N75A 3L25A 1TTEA 4DV7M 5FSWA 2BJWA 3GLGE 3TL4X 3UMMA 4JI8M 3CF2A 3R9XB 4LF5M 2WSCF 3PNVA 1WR1B 3K1JA 2LVNC 3GLGB 1IFYA 4M0WA 5BPVA 1FJGM 4K0KM 1DO0A 1HNXM 2ERCA 1HT1E 2JZ0A 3W67A 4TUWA 1T3TA 3U6OA 2YFQA 2ZAOA 4QHTA 4MH0E 5ITUA 3MK6A 3CF6E 1Y8GA 4L4UA 2K0BX 1KFVA 2DAIA 1DGHA 1QZMA 4FD2A 3UZUA 3R8FA 3M6AA 4XGIA 4QOSA 3GPUA 1OFIA 2CV2A 3J7BA 2DVWB 1R4GA 3LMMA 1X37A 5E26A 5ITTA 3HX3A 1SXJC 2CWBA 3U60A 4RF1A 3GP1A 4NSOB 4AG5A 4OU7A 2UUAM 4D81A 2OPFA 3FUWA 1K3XA 1UM8A 1IN6A 1HJPA 4F2LA 5C1BA 4II7A 3ZH9B 5IWAM 3C3DA 1QDTA 1RU3A 3E21A 1EE8A 5KO3A 2LVPC 4JYAM 2UU9M 4OW0A 1IBLM 4MM3B 2F5QA 4AKHA 3AFHA 5DYGA 2V1UA 4YHHM 3E9SA 1OJLA 1ZAEA 2C9OA 4DR7M 5FTJA 1SXJD 1K82A 2Q2EB 3GLIA 3FKEA 3FYCA 5EJCA 4HEOA 2BJVA 3DFZA 4GC5A 5JI2E 3GRUA 3U6QA 2YQZA 1XNRM 1QDRA 4L8RC 4JI5M 2KNZA 1N78A 2DZNB 4D80A 2H1RA 2DNAA 4IIWA 1OTRA 1PRBA 1OIZA 1ZMUA 2FH0A 1IN5A 3BXWA 3FUXA 2Y0QA 4JI0M 5DYIA 1IY2A 3GQ3A 3IHPA 2CRUA 2QENA 3NBIA 2KEBA 4B08A 3TWMA 2R46A 4KODA 2J5YA 3JR4A 3MJ5A 2Y0TA 2W82A 2CHQA 2MJ5B 2BNKA 1HR0M 3GO8A 4G4NA 1QVRA 2LVOC 3HGIA 1JR3E 5KQ8A 3C3EA 3AV0A 4B7HA 5EP3A 4LJ6A 3GLGA 1IM2A 1TH2A 2DZLA 5EXPA 3T38A 3K2LA 3U6CA 3U6PA 5F3WA 2L7IA 4KLNA 3VLFB 3VK8A 1XB2B 1HNZM 4ITQA 3DOAA 2BWEA 4LF8M 2H5XA 4P17A 5FTMA 3T6PA 1IY0A 2XSZA 3CTWB 3B7NA 4GMQA 3W0LB 4B7FA 2UUCM 2UXCM 2RGHA 3T1YM 1D2NA 4XK8F 2EKFA 2QQ8A 4M9SA 2K6BA 2QCUA 3RFWA 1L2BA 4JV5M 2JY8A 1KSFX 3SAUA 2C98A 1VEKA 2APLA 2R65A 4IBCA 1G4AE 2ZM6M 4LF6M 1L1ZA 3AL0C 1GABA 2KRUA 3B74A 2EO2A 5E6JA 2X4AA 2DXIA 4R7GA 1IN4A 2R44A 3VFDA 1NY5A 2G8LA 3AOEC 3W0FA 2JZ1A 1HNWM 3SBJA 4B3SM 4DUZM 4IBDA 2LXEA 4PT5A 4CISA 4HLQA 4W5WA 2JY6B 5LMUM 2ZBKB 4LJ8A 2WSEF 5H37D 1Q3CA 3IG8A 1G71A 1GL7A 3HY5A 4IJFA 5LMNM 2V6ZM 1AIPC 3KVWA 4NXNM 3H4JA 1ORYB 2VF8A 4MGHA 4MB7A 2R18A 2ZTCA 5EP2A 3KOXE 3SARA 2HHHM 1IXSB 4P16A 5FTLA 2Y21A 3HHXA 4LF9M 1F4IA 2GNOA 2MROB 3NWLA 4BB9A 4G4RA 3LQQA 4LJ4A 3NBXX 1PJSA 2KDLA
chains in the Genus database with same CATH topology
4LJ9A 1PM5A 3I51A 2G5GX 4GKJM 5FTNA 3KOZE 3TWKA 4AZFA 4OX9M 4JI3M 1GLNA 4GC9A 3DA1A 2CHGA 4GITA 2YR0A 3U6LA 1C1KA 3L27A 1E9RA 3BOSA 5DNYA 5EQTA 1L2DA 1Z59A 1IBKM 3HU2A 4G4QA 4LJAA 3L29A 2YNMD 4GHLA 3SYKA 3IG5A 3UK6A 4DR5M 3KS4A 3C58A 4LCBA 1JR3A 1DGGA 4QNMA 3PFIA 1Z5CA 3TWLA 3SAWA 3U6MA 3VK7A 4WW0A 2EUCA 4IJEA 4B3MM 4MGIE 2KA6B 2I7NA 2ZAMA 1QAQA 4M9ZA 2F5SA 1NVMA 1VDDA 3GPXA 4DV0M 7CATA 1NHGC 3HJSA 4AW4A 2DWZB 4JI6M 1K3WA 4IBIA 3SAVA 4X64M 3L28A 3PNYA 4LFAM 1PJIA 1IN7A 2D7GA 4G4OA 1MU5A 2XH9A 2OQ4A 2R45A 5EXSA 3KOWE 4DR2M 4FWGA 4A3VB 3HHWA 2X49A 4LFCM 4DV1M 3J27B 3GLHB 1YE9A 2XEPA 4XBOA 2I7PA 1HQYE 3FUTA 3HU1A 2R4EA 3I4VA 1HQCA 3AOGA 2VQFM 2XZFA 1NHWC 1NY6A 3L2AA 1IN8A 2XFSA 3VDUA 3TE6A 1DO2A 1FNNA 4CGYB 2C5RA 2HL7A 1J5EM 3SASA 3A46A 2CV0A 4DR3M 2FE8A 3MHVC 5FTKA 4AKIA 4OVZB 2QP9X 3ZCBB 5FLXS 4IBBA 5ITXE 4DV2M 4I81A 4NL4H 4X62M 4NSRA 1IY1A 3U6SA 3GQ4A 2P5TA 2XSZD 3KDSE 5EXTA 2Z4SA 3KSXA 3L26A 4LJ7A 2AHMA 2C99A 1XMQM 4LRTA 1LV7A 3UGJA 2FFJA 5IZ7D 3LVWA 2V1CA 2FOIC 3HKPA 4L78A 4AQYM 2DWMA 2QBYB 4PDGA 1Z6TA 4LGYA 3WHKA 3FTFA 2CHVA 1R2ZA 2A5YB 3GQ5A 1XHBA 2J7OA 5IREB 4JI7M 5ITRA 3KSJA 2VIIA 4JI4M 4BBAA 3J2PB 1E94E 1G41A 4JXJA 3D8BA 5BR8M 2CUZA 2D7HA 3KW6A 4I8OA 3AKZA 4AI6A 3SMPA 4LZZA 1Q39A 1XNQM 4FCWA 4EIWA 3SMSA 3Q8XA 3FTDA 4RNAA 2XFTA 2XZUA 3GLHA 2C9CA 3SATA 1IXRC 3PXGA 4PCZA 3JR5A 4GH9A 3KP0E 3HJQA 4NRWA 2L7HA 1L1TA 5KPTA 1E32A 1JQJC 4FW9A 2ZANA 1QANA 4MGYE 3U61B 4LF4M 1R7RA 2Y20A 3J7AS 3GRRA 4FWHA 4R3DA 4QNRA 4S12A 3GRVA 2Z3XA 2UXBM 4PD2A 3PVSA 2XGNA 1QAMA 1IBMM 1SXJE 3THGA 1YUBA 1Z5BA 1GKIA 4FVMA 2DZOB 1Z5AA 3E4RA 1SXJB 4OVZA 3U6DA 3AOEA 4NRVA 1NJGA 1G8PA 1N36M 2VQEM 3KP1E 1JR3D 1TDHA 3J81S 4NXMM 3QWLA 1YSYA 5A2QS 5ITXA 2QZ4A 3GRYA 3U6EA 2XF3A 4DV5M 4BLCA 3DZDA 3FUUA 1N77A 1R2YA 3GPYA 2E5LM 5C18A 4DR1M 5GKNA 2QBYA 4LF7M 3RE8A 4Z6YA 2F5PA 4DR4M 2KZSA 3M7GA 4KHPM 2RKOA 1WXQA 4L15A 4D82A 1DGBA 5EXXA 4B3RM 3UJNA 3HHZA 4IBGA 4G6ZA 3AJIB 1IQPA 5KPZA 2FNAA 3HWSA 1XC8A 4MGKE 5JI3E 4JI2M 3WHLA 4FCVA 4LJ5A 3JAMS 1N32M 3U5ZB 4FCTA 4RF0A 1TGUA 2DWLA 2Z4RA 1HT2E 2KW0A 1GL6A 1QAOA 1QYRA 3U61A 3KS8A 4ZPXA 8CATA 4GHAA 4HL4A 3TPZA 3LQRA 2UXDM 3SHFA 1TH3A 2LH0A 2Z7JA 1E9SA 5EP1A 5KQDA 3OTOM 4DR6M 1QQWA 2J7NA 3B9PA 1MX0A 3H4MA 4QOZC 4LGMA 3RGPA 1IXZA 1KYIA 1XMOM 2CFOA 3KFUG 4LY6A 1SXJA 3HHYA 1NNJA 3VKGA 3GLFB 4PDIA 1XWIA 3SHGB 1I94M 3FTCA 1GVNA 4YY3M 1H6UA 1DGFA 2LNHC 4IBJA 4IBFA 1N33M 1J09A 1W5TA 3A45A 1OFHA 2F5NA 2M5ZA 3VDPA 3ZC7B 4L16A 4B7GA 3K8ZA 4Z8XA 2DWNA 3HJ8A 1TDZA 4DV3M 1XXHB 3EIEA 1N34M 3FD9A 3KOYE 2EA0A 2D7EA 4LG2A 4DV6M 4GIPA 5IT9S 1TH4A 2C96A 3ILKA 3D8LA 2R62A 3TQSA 4GRIA 1ZQ9A 3EIHA 1J7KA 4NOOB 4MGZE 1NNUC 2F5OA 3KXEC 1G3IA 2RGOA 2CEAA 4AG6A 2LWXA 3FUVA 4KO8A 2R4JA 4DUYM 2JA2A 4AKGA 2NQ8C 2CE7A 4LRSA 3U5ZA 1DGHB 1NSFA 1I4WA 2DHRA 3J80S 1L2CA 4I5SA 2CV1A 3LVVA 2L09A 1S3SA 3QAUA 3FTEA 3U60B 1G59A 3VKHA 2HKJA 3CF0A 3I4YA 3T15A 2XLJA 3FYDA 4REZA 1R6BX 2M60A 4IBEA 5KPRA 3SYLA 4WURA 3SC3A 4JI1M 1L8QA 1Q3BA 4X66M 4JN6A 3A42A 1PJJA 4CHTB 3GLIB 3GLFA 4GKKM 2K47A 2KZUA 4LZJA 4IBKA 2KXEA 5ITQA 2HCBA 3HU3A 4I4LA 4QHSA 2O5RA 3RGSA 3K92A 4B3TM 2L6OA 4DV4M 2QPAA 2F4VM 1NJFA 4FWDA 4M0DA 2KRKA 2X8AA 4X65M 3GPPA 3A98B 3SFZA 3T1HM 1XXHA 4LFBM 1W5SA 3M0EA 5ITYA 5EP4A 4M9XA 1N75A 3L25A 4DV7M 5FSWA 2BJWA 3TL4X 3UMMA 4JI8M 3CF2A 3R9XB 4LF5M 3PNVA 3K1JA 3GLGB 4M0WA 5BPVA 1FJGM 4K0KM 1DO0A 1HNXM 2ERCA 1HT1E 4TUWA 1T3TA 3U6OA 2YFQA 2ZAOA 4QHTA 4MH0E 5ITUA 3MK6A 3CF6E 4L4UA 1KFVA 1DGHA 1QZMA 4FD2A 3UZUA 3R8FA 3M6AA 4XGIA 4QOSA 3GPUA 1OFIA 2CV2A 3J7BA 2DVWB 3LMMA 2UUBM 1X37A 5E26A 5ITTA 3U60A 1SXJC 4RF1A 3GP1A 4NSOB 4AG5A 4OU7A 2UUAM 4D81A 2OPFA 3FUWA 1K3XA 1UM8A 1IN6A 5C1BA 5IWAM 4II7A 3ZH9B 1EE8A 5KO3A 4JYAM 2UU9M 4OW0A 1IBLM 4MM3B 2F5QA 4AKHA 3AFHA 5DYGA 2V1UA 4YHHM 3E9SA 1OJLA 1ZAEA 2C9OA 5FTJA 1SXJD 1K82A 2Q2EB 3GLIA 3FKEA 3FYCA 5EJCA 2BJVA 3DFZA 4GC5A 5JI2E 3GRUA 3U6QA 2YQZA 1XNRM 4L8RC 4JI5M 1N78A 2DZNB 4D80A 2H1RA 4IIWA 1IN5A 3FUXA 2Y0QA 4JI0M 5DYIA 1IY2A 3GQ3A 2QENA 3NBIA 2KEBA 4B08A 3TWMA 2R46A 4KODA 3JR4A 3MJ5A 2Y0TA 2W82A 2CHQA 1HR0M 2BNKA 3GO8A 4G4NA 1QVRA 3HGIA 5KQ8A 3AV0A 4B7HA 5EP3A 4LJ6A 3GLGA 1IM2A 1TH2A 5EXPA 3T38A 4DR7M 3K2LA 3U6CA 3U6PA 5F3WA 2L7IA 4KLNA 3VLFB 3VK8A 1HNZM 4ITQA 3DOAA 4LF8M 5FTMA 1IY0A 2XSZA 3CTWB 4GMQA 3W0LB 4B7FA 2UUCM 2UXCM 2RGHA 3T1YM 1D2NA 4M9SA 2QCUA 3RFWA 1L2BA 4JV5M 1KSFX 3SAUA 2C98A 2R65A 4IBCA 2ZM6M 1G4AE 4LF6M 3AL0C 1L1ZA 2KRUA 2EO2A 5E6JA 2X4AA 2DXIA 4R7GA 1IN4A 3VFDA 1NY5A 2G8LA 3AOEC 3W0FA 1HNWM 3SBJA 4B3SM 4DUZM 4IBDA 2LXEA 4PT5A 4CISA 4HLQA 4W5WA 5LMUM 2ZBKB 4LJ8A 5H37D 1Q3CA 3IG8A 1GL7A 4IJFA 5LMNM 2V6ZM 3KVWA 4NXNM 1ORYB 4MGHA 4MB7A 2R18A 5EP2A 3KOXE 3SARA 2HHHM 1IXSB 4P16A 5FTLA 2Y21A 3HHXA 4LF9M 3NWLA 4BB9A 4G4RA 3LQQA 4LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDG A;  1PM5 A;  3U6O A;  4GKJ M;  1XMO M;  1R2Z A;  3GQ5 A;  3TWK A;  5ITU A;  4JI7 M;  4OX9 M;  5ITR A;  4JI4 M;  1NNJ A;  4JI3 M;  1KFV A;  4PDI A;  5BR8 M;  1I94 M;  3GPU A;  3U6L A;  1Q39 A;  4YY3 M;  1XNQ M;  2UUB M;  5ITT A;  1L2D A;  1Z59 A;  1IBK M;  1N33 M;  4G4Q A;  3GP1 A;  3A45 A;  2F5N A;  2UUA M;  2OPF A;  1K3X A;  2XZU A;  5IWA M;  3SAT A;  4PCZ A;  3JR5 A;  4DR5 M;  1EE8 A;  3C58 A;  4NRW A;  4JYA M;  2UU9 M;  2F5Q A;  1IBL M;  1L1T A;  1TDZ A;  1Z5C A;  3TWL A;  4YHH M;  4DV3 M;  3SAW A;  3U6M A;  1N34 M;  3VK7 A;  2EA0 A;  4LF4 M;  4B3M M;  1K82 A;  2Q2E B;  3J7A S;  4DV6 M;  2F5S A;  5IT9 S;  4K0K M;  3U6Q A;  1XNR M;  2UXB M;  3GPX A;  4PD2 A;  4DV0 M;  1IBM M;  2F5O A;  4JI5 M;  1Z5B A;  4JI6 M;  4DUY M;  1Z5A A;  4JI0 M;  3U6D A;  3SAV A;  1K3W A;  4X64 M;  3GQ3 A;  4NRV A;  1N36 M;  4LFA M;  1PJI A;  3J80 S;  1L2C A;  2VQE M;  3J81 S;  1TDH A;  4NXM M;  4G4O A;  1MU5 A;  2OQ4 A;  3TWM A;  5A2Q S;  3JR4 A;  5ITX A;  4DR2 M;  3U6E A;  1HR0 M;  3GO8 A;  4DV5 M;  4LFC M;  2HKJ A;  4G4N A;  4DV1 M;  1R2Y A;  3GPY A;  4DR7 M;  2E5L M;  4DR1 M;  3U6C A;  3U6P A;  4LF7 M;  4JI1 M;  3VK8 A;  1HNZ M;  4ITQ A;  1Q3B A;  3DOA A;  2F5P A;  4DR4 M;  4LF8 M;  4X66 M;  2XZF A;  2VQF M;  4KHP M;  3A42 A;  1PJJ A;  2UUC M;  2UXC M;  4B3R M;  3T1Y M;  4GKK M;  1L2B A;  4JV5 M;  5ITQ A;  1J5E M;  3SAU A;  3SAS A;  2ZM6 M;  4LF6 M;  1L1Z A;  3A46 A;  1XC8 A;  4DR3 M;  4B3T M;  4DV4 M;  4JI2 M;  3W0F A;  1HNW M;  2F4V M;  3JAM S;  3SBJ A;  4B3S M;  1N32 M;  5FLX S;  4DUZ M;  5ITX E;  4DV2 M;  4CIS A;  4X65 M;  3GPP A;  5LMU M;  2ZBK B;  4X62 M;  1Q3C A;  3T1H M;  4LFB M;  5LMN M;  5ITY A;  3U6S A;  3GQ4 A;  4NXN M;  4DV7 M;  4MB7 A;  3SAR A;  2UXD M;  4JI8 M;  2HHH M;  4LF5 M;  1XMQ M;  4LF9 M;  3OTO M;  4DR6 M;  4G4R A;  1FJG M;  1MX0 A;  4AQY M;  1HNX M; 
#chains in the Genus database with same CATH topology
 4LJ9 A;  2JNH A;  1PM5 A;  1AUA A;  2G5G X;  3I51 A;  4G3O A;  4GKJ M;  5FTN A;  2QHO B;  2ZTD A;  3KOZ E;  3TWK A;  4AZF A;  4OX9 M;  2OOA A;  4JI3 M;  1GLN A;  4GC9 A;  3DA1 A;  2MH8 A;  2CHG A;  2FS1 A;  4GIT A;  2YR0 A;  3U6L A;  1C1K A;  2DAG A;  3L27 A;  1E9R A;  3BOS A;  5DNY A;  5EQT A;  1L2D A;  3HZJ A;  1Z59 A;  1IBK M;  3HU2 A;  4G4Q A;  4LJA A;  2R0I A;  3L29 A;  1BVS A;  2LTU A;  2DHY A;  2YNM D;  3SYK A;  3IG5 A;  4GHL A;  3UK6 A;  4CIZ A;  4DR5 M;  3KS4 A;  3C58 A;  4LCB A;  1JR3 A;  1DGG A;  3ZQJ A;  4QNM A;  4GEW A;  2KNA A;  3PFI A;  1Z5C A;  1OKS A;  2L4E A;  3TWL A;  3SAW A;  3U6M A;  3VK7 A;  4WW0 A;  2EUC A;  4IJE A;  4B3M M;  4MGI E;  2KA6 B;  2I7N A;  2LHG A;  1QAQ A;  2ZAM A;  3CGW A;  4M9Z A;  2F5S A;  1NVM A;  1D0K A;  2KNV A;  1VDD A;  3GPX A;  4DV0 M;  7CAT A;  1NHG C;  3HJS A;  2LBC A;  4AW4 A;  1GO5 A;  2DWZ B;  4JI6 M;  2JY5 A;  1K3W A;  4IBI A;  3SAV A;  4X64 M;  3W68 A;  3L28 A;  3PNY A;  4LFA M;  1PJI A;  1IN7 A;  4L6V 6;  2D7G A;  4G4O A;  1MU5 A;  2XH9 A;  2OQ4 A;  2R45 A;  5EXS A;  3BBZ A;  3KOW E;  4DR2 M;  2HWJ A;  1OAO C;  3B7Q A;  4FWG A;  3HHW A;  4A3V B;  3GLH E;  2X49 A;  4LFC M;  4DV1 M;  1C7Y A;  1IXS A;  2N35 A;  3GLH B;  3J27 B;  1YE9 A;  2OOB A;  2XEP A;  4XBO A;  2I7P A;  1HQY E;  3FUT A;  3HU1 A;  2R4E A;  3I4V A;  1HQC A;  3AOG A;  2VQF M;  2XZF A;  1NHW C;  1NY6 A;  4KT0 F;  2QSF X;  3L2A A;  1IN8 A;  2XFS A;  3VDU A;  3TE6 A;  1ZMW A;  1DO2 A;  1FNN A;  4CGY B;  2C5R A;  2HL7 A;  1J5E M;  3QYB A;  3SAS A;  4Y28 F;  1NO1 A;  1GJT A;  4WP2 A;  3A46 A;  2CV0 A;  4DR3 M;  1ZMV A;  2FE8 A;  3MHV C;  5FTK A;  3Q8G A;  4AKI A;  4OVZ B;  3I01 M;  2QP9 X;  3ZCB B;  5FLX S;  4IBB A;  4R71 A;  5ITX E;  4DV2 M;  4I81 A;  1VEG A;  4NL4 H;  3B7Z A;  4X62 M;  4NSR A;  3QYE A;  1IY1 A;  3U6S A;  3GQ4 A;  2P5T A;  2XSZ D;  3KDS E;  5EXT A;  2Z4S A;  3KSX A;  3L26 A;  4LJ7 A;  2DKL A;  2AHM A;  2C99 A;  1XMQ M;  1GJS A;  4LRT A;  1LV7 A;  3UGJ A;  2FFJ A;  5IZ7 D;  3LVW A;  2V1C A;  2FOI C;  3HKP A;  4L78 A;  4AQY M;  2DWM A;  2QBY B;  2JP7 A;  2VDB B;  4PDG A;  1Z6T A;  1WHC A;  4LGY A;  3WHK A;  3FTF A;  4NC6 A;  2CHV A;  1R2Z A;  2WZJ A;  2A5Y B;  2DI0 A;  1XHB A;  2J7O A;  2O25 A;  5IRE B;  3GQ5 A;  5ITR A;  3KSJ A;  1WJ7 A;  2VII A;  4BBA A;  4JI4 M;  4JI7 M;  3J2P B;  1E94 E;  1G41 A;  4JXJ A;  3D8B A;  5BR8 M;  2CUZ A;  2D7H A;  3KW6 A;  4I8O A;  3AKZ A;  4AI6 A;  3SMP A;  4LZZ A;  1Q39 A;  1XNQ M;  2JY7 A;  4FCW A;  4EIW A;  3SMS A;  3Q8X A;  1A5T A;  3FTD A;  4RNA A;  2XFT A;  2JXN A;  2XZU A;  3GLH A;  1R5L A;  2C9C A;  3SAT A;  1IXR C;  2L2D A;  3PXG A;  4PCZ A;  3JR5 A;  3C9P A;  4GH9 A;  3KP0 E;  3HJQ A;  2DEN A;  2L7H A;  4NRW A;  1L1T A;  5KPT A;  1E32 A;  4CJ6 A;  1JQJ C;  4FW9 A;  2ZAN A;  1QAN A;  1MJG M;  2EKK A;  4MGY E;  3U61 B;  4LF4 M;  1R7R A;  2Y20 A;  3J7A S;  3K9O A;  3GRR A;  4FWH A;  4R3D A;  2MGW A;  2Z8Y M;  4QNR A;  4S12 A;  3GRV A;  2Z3X A;  2UXB M;  4PD2 A;  3PVS A;  2XGN A;  1QAM A;  1NV8 A;  1IBM M;  2UUB M;  3GLI E;  1QUT A;  1VG5 A;  1SXJ E;  3THG A;  1YUB A;  1Z5B A;  1GKI A;  4FVM A;  2R6F A;  2DZO B;  2JUJ A;  2VF7 A;  1Z5A A;  3E4R A;  1SXJ B;  4OVZ A;  3U6D A;  3AOE A;  4NRV A;  1NJG A;  1G8P A;  1N36 M;  2VQE M;  3KP1 E;  1JR3 D;  1P3Q Q;  1TDH A;  3J81 S;  1D0L A;  3QWL A;  1YSY A;  4NXM M;  2DAM A;  5A2Q S;  5ITX A;  2QZ4 A;  3GRY A;  3U6E A;  2XF3 A;  1LTM A;  1VQ1 A;  3FRI A;  4DV5 M;  2KHH A;  4BLC A;  3DZD A;  3FUU A;  1N77 A;  1OQY A;  1R2Y A;  3GPY A;  2E5L M;  5C18 A;  4DR1 M;  2O01 F;  5GKN A;  2QBY A;  4LF7 M;  3RE8 A;  4Z6Y A;  2F5P A;  4DR4 M;  2KZS A;  2QNJ A;  3M7G A;  1V33 A;  4KHP M;  2RKO A;  1WXQ A;  4L15 A;  4D82 A;  1DGB A;  5EXX A;  4B3R M;  3UJN A;  2GQF A;  3HHZ A;  2CP8 A;  4IBG A;  1ZV1 A;  4G6Z A;  3AJI B;  1IQP A;  5KPZ A;  2FNA A;  1PJT A;  3HWS A;  1XC8 A;  1WIV A;  4MGK E;  5JI3 E;  4JI2 M;  3WHL A;  4FCV A;  4LJ5 A;  4F1I A;  1TR8 A;  3JAM S;  1CUK A;  1N32 M;  3U5Z B;  4Q7J A;  4FCT A;  4RF0 A;  1TGU A;  2DWL A;  1QZE A;  2Z4R A;  1HT2 E;  2KW0 A;  1GL6 A;  1QAO A;  2LHC A;  2K9D A;  1QYR A;  3U61 A;  3KS8 A;  4ZPX A;  8CAT A;  4GHA A;  4HL4 A;  3TPZ A;  3LQR A;  2UXD M;  3SHF A;  1TH3 A;  2LH0 A;  2BWB A;  2Z7J A;  1JB0 F;  1OIP A;  1E9S A;  5EP1 A;  5KQD A;  3OTO M;  4DR6 M;  1DV0 A;  1QQW A;  2J7N A;  3B9P A;  3LCV B;  1WGN A;  1MX0 A;  3H4M A;  4QOZ C;  4LGM A;  1V92 A;  1IXZ A;  3B89 A;  1MN3 A;  3RGP A;  1KYI A;  3GLF E;  1WGL A;  3K9P A;  1XMO M;  1QUS A;  2CFO A;  3KFU G;  4LY6 A;  4ANR A;  1SXJ A;  3HHY A;  1NNJ A;  3VKG A;  3GLF B;  4PDI A;  1XWI A;  1PGY A;  3SHG B;  1I94 M;  3FTC A;  1GVN A;  4YY3 M;  1H6U A;  1DGF A;  1TF0 B;  2LNH C;  4IBJ A;  4IBF A;  1N33 M;  1J09 A;  1W5T A;  3A45 A;  1OFH A;  3E46 A;  2F5N A;  1T6O A;  2M5Z A;  3VDP A;  3ZC7 B;  4L16 A;  4B7G A;  3K8Z A;  1XXH E;  1EFU B;  3LCU A;  1SG9 A;  4Z8X A;  2DWN A;  3HJ8 A;  1TDZ A;  4DV3 M;  1XXH B;  2LVA A;  3EIE A;  3FD9 A;  3KOY E;  1N34 M;  2EA0 A;  2D7E A;  2DAE A;  4LG2 A;  4DV6 M;  1VDL A;  4GIP A;  5IT9 S;  1TH4 A;  2C96 A;  3ILK A;  3D8L A;  2R62 A;  3TQS A;  2MR9 A;  1ZQ9 A;  3EIH A;  1J7K A;  4GRI A;  4MGZ E;  1NNU C;  4NOO B;  2F5O A;  3KXE C;  1G3I A;  2RGO A;  2CEA A;  4AG6 A;  2LWX A;  2DAK A;  3FUV A;  2R4J A;  3MMP A;  4KO8 A;  2JA2 A;  4DUY M;  2JWS A;  4AKG A;  2B3T A;  2NQ8 C;  2CE7 A;  2LVQ D;  2G3Q A;  4LRS A;  1V34 A;  3U5Z A;  1D0M A;  1VEJ A;  5L8R F;  1DGH B;  1I4W A;  1NSF A;  2DHR A;  3J80 S;  1L2C A;  3FE3 A;  3I04 M;  4I5S A;  2CV1 A;  3LVV A;  1Q02 A;  2L09 A;  1S3S A;  2HAK A;  3QAU A;  3FTE A;  3U60 B;  4UN2 B;  1G59 A;  3VKH A;  2HKJ A;  3F92 A;  1OAI A;  3CF0 A;  3I4Y A;  3T15 A;  2XLJ A;  2L4F A;  3FYD A;  4REZ A;  1R6B X;  2M60 A;  1UFZ A;  3LW5 F;  4IBE A;  5KPR A;  3SYL A;  4WUR A;  3SC3 A;  4JI1 M;  1L8Q A;  1Q3B A;  1EIJ A;  4X66 M;  3IEC A;  4JN6 A;  3A42 A;  1PJJ A;  4CHT B;  3GLI B;  3GLF A;  3FRH A;  4GKK M;  2RRU A;  2K47 A;  2KZU A;  1NV9 A;  4IBK A;  2KXE A;  4LZJ A;  5ITQ A;  2HCB A;  3HU3 A;  4I4L A;  1T43 A;  1YLA A;  2O5R A;  4QHS A;  3RGS A;  2WSF F;  3K92 A;  4RKU F;  4B3T M;  2L6O A;  4DV4 M;  4DBG B;  2QPA A;  5DFL A;  2F4V M;  3V76 A;  1NJF A;  4FWD A;  4M0D A;  1PJQ A;  2KRK A;  2X8A A;  4X65 M;  3GPP A;  3A98 B;  2OO9 A;  3SFZ A;  3T1H M;  1XXH A;  4LFB M;  1W5S A;  3M0E A;  2EJS A;  5EP4 A;  5ITY A;  4M9X A;  1N75 A;  3L25 A;  1TTE A;  4DV7 M;  5FSW A;  2BJW A;  3GLG E;  3TL4 X;  3UMM A;  4JI8 M;  3CF2 A;  3R9X B;  4LF5 M;  2WSC F;  3PNV A;  1WR1 B;  3K1J A;  2LVN C;  3GLG B;  1IFY A;  4M0W A;  5BPV A;  1FJG M;  4K0K M;  1DO0 A;  1HNX M;  2ERC A;  1HT1 E;  2JZ0 A;  3W67 A;  4TUW A;  1T3T A;  3U6O A;  2YFQ A;  2ZAO A;  4QHT A;  4MH0 E;  5ITU A;  3MK6 A;  3CF6 E;  1Y8G A;  4L4U A;  2K0B X;  1KFV A;  2DAI A;  1DGH A;  1QZM A;  4FD2 A;  3UZU A;  3R8F A;  3M6A A;  4XGI A;  4QOS A;  3GPU A;  1OFI A;  2CV2 A;  3J7B A;  2DVW B;  1R4G A;  3LMM A;  1X37 A;  5E26 A;  5ITT A;  3HX3 A;  1SXJ C;  2CWB A;  3U60 A;  4RF1 A;  3GP1 A;  4NSO B;  4AG5 A;  4OU7 A;  2UUA M;  4D81 A;  2OPF A;  3FUW A;  1K3X A;  1UM8 A;  1IN6 A;  1HJP A;  4F2L A;  5C1B A;  4II7 A;  3ZH9 B;  5IWA M;  3C3D A;  1QDT A;  1RU3 A;  3E21 A;  1EE8 A;  5KO3 A;  2LVP C;  4JYA M;  2UU9 M;  4OW0 A;  1IBL M;  4MM3 B;  2F5Q A;  4AKH A;  3AFH A;  5DYG A;  2V1U A;  4YHH M;  3E9S A;  1OJL A;  1ZAE A;  2C9O A;  4DR7 M;  5FTJ A;  1SXJ D;  1K82 A;  2Q2E B;  3GLI A;  3FKE A;  3FYC A;  5EJC A;  4HEO A;  2BJV A;  3DFZ A;  4GC5 A;  5JI2 E;  3GRU A;  3U6Q A;  2YQZ A;  1XNR M;  1QDR A;  4L8R C;  4JI5 M;  2KNZ A;  1N78 A;  2DZN B;  4D80 A;  2H1R A;  2DNA A;  4IIW A;  1OTR A;  1PRB A;  1OIZ A;  1ZMU A;  2FH0 A;  1IN5 A;  3BXW A;  3FUX A;  2Y0Q A;  4JI0 M;  5DYI A;  1IY2 A;  3GQ3 A;  3IHP A;  2CRU A;  2QEN A;  3NBI A;  2KEB A;  4B08 A;  3TWM A;  2R46 A;  4KOD A;  2J5Y A;  3JR4 A;  3MJ5 A;  2Y0T A;  2W82 A;  2CHQ A;  2MJ5 B;  2BNK A;  1HR0 M;  3GO8 A;  4G4N A;  1QVR A;  2LVO C;  3HGI A;  1JR3 E;  5KQ8 A;  3C3E A;  3AV0 A;  4B7H A;  5EP3 A;  4LJ6 A;  3GLG A;  1IM2 A;  1TH2 A;  2DZL A;  5EXP A;  3T38 A;  3K2L A;  3U6C A;  3U6P A;  5F3W A;  2L7I A;  4KLN A;  3VLF B;  3VK8 A;  1XB2 B;  1HNZ M;  4ITQ A;  3DOA A;  2BWE A;  4LF8 M;  2H5X A;  4P17 A;  5FTM A;  3T6P A;  1IY0 A;  2XSZ A;  3CTW B;  3B7N A;  4GMQ A;  3W0L B;  4B7F A;  2UUC M;  2UXC M;  2RGH A;  3T1Y M;  1D2N A;  4XK8 F;  2EKF A;  2QQ8 A;  4M9S A;  2K6B A;  2QCU A;  3RFW A;  1L2B A;  4JV5 M;  2JY8 A;  1KSF X;  3SAU A;  2C98 A;  1VEK A;  2APL A;  2R65 A;  4IBC A;  1G4A E;  2ZM6 M;  4LF6 M;  1L1Z A;  3AL0 C;  1GAB A;  2KRU A;  3B74 A;  2EO2 A;  5E6J A;  2X4A A;  2DXI A;  4R7G A;  1IN4 A;  2R44 A;  3VFD A;  1NY5 A;  2G8L A;  3AOE C;  3W0F A;  2JZ1 A;  1HNW M;  3SBJ A;  4B3S M;  4DUZ M;  4IBD A;  2LXE A;  4PT5 A;  4CIS A;  4HLQ A;  4W5W A;  2JY6 B;  5LMU M;  2ZBK B;  4LJ8 A;  2WSE F;  5H37 D;  1Q3C A;  3IG8 A;  1G71 A;  1GL7 A;  3HY5 A;  4IJF A;  5LMN M;  2V6Z M;  1AIP C;  3KVW A;  4NXN M;  3H4J A;  1ORY B;  2VF8 A;  4MGH A;  4MB7 A;  2R18 A;  2ZTC A;  5EP2 A;  3KOX E;  3SAR A;  2HHH M;  1IXS B;  4P16 A;  5FTL A;  2Y21 A;  3HHX A;  4LF9 M;  1F4I A;  2GNO A;  2MRO B;  3NWL A;  4BB9 A;  4G4R A;  3LQQ A;  4LJ4 A;  3NBX X;  1PJS A;  2KDL A; 
#chains in the Genus database with same CATH homology
 4LJ9 A;  1PM5 A;  3I51 A;  2G5G X;  4GKJ M;  5FTN A;  3KOZ E;  3TWK A;  4AZF A;  4OX9 M;  4JI3 M;  1GLN A;  4GC9 A;  3DA1 A;  2CHG A;  4GIT A;  2YR0 A;  3U6L A;  1C1K A;  3L27 A;  1E9R A;  3BOS A;  5DNY A;  5EQT A;  1L2D A;  1Z59 A;  1IBK M;  3HU2 A;  4G4Q A;  4LJA A;  3L29 A;  2YNM D;  4GHL A;  3SYK A;  3IG5 A;  3UK6 A;  4DR5 M;  3KS4 A;  3C58 A;  4LCB A;  1JR3 A;  1DGG A;  4QNM A;  3PFI A;  1Z5C A;  3TWL A;  3SAW A;  3U6M A;  3VK7 A;  4WW0 A;  2EUC A;  4IJE A;  4B3M M;  4MGI E;  2KA6 B;  2I7N A;  2ZAM A;  1QAQ A;  4M9Z A;  2F5S A;  1NVM A;  1VDD A;  3GPX A;  4DV0 M;  7CAT A;  1NHG C;  3HJS A;  4AW4 A;  2DWZ B;  4JI6 M;  1K3W A;  4IBI A;  3SAV A;  4X64 M;  3L28 A;  3PNY A;  4LFA M;  1PJI A;  1IN7 A;  2D7G A;  4G4O A;  1MU5 A;  2XH9 A;  2OQ4 A;  2R45 A;  5EXS A;  3KOW E;  4DR2 M;  4FWG A;  4A3V B;  3HHW A;  2X49 A;  4LFC M;  4DV1 M;  3J27 B;  3GLH B;  1YE9 A;  2XEP A;  4XBO A;  2I7P A;  1HQY E;  3FUT A;  3HU1 A;  2R4E A;  3I4V A;  1HQC A;  3AOG A;  2VQF M;  2XZF A;  1NHW C;  1NY6 A;  3L2A A;  1IN8 A;  2XFS A;  3VDU A;  3TE6 A;  1DO2 A;  1FNN A;  4CGY B;  2C5R A;  2HL7 A;  1J5E M;  3SAS A;  3A46 A;  2CV0 A;  4DR3 M;  2FE8 A;  3MHV C;  5FTK A;  4AKI A;  4OVZ B;  2QP9 X;  3ZCB B;  5FLX S;  4IBB A;  5ITX E;  4DV2 M;  4I81 A;  4NL4 H;  4X62 M;  4NSR A;  1IY1 A;  3U6S A;  3GQ4 A;  2P5T A;  2XSZ D;  3KDS E;  5EXT A;  2Z4S A;  3KSX A;  3L26 A;  4LJ7 A;  2AHM A;  2C99 A;  1XMQ M;  4LRT A;  1LV7 A;  3UGJ A;  2FFJ A;  5IZ7 D;  3LVW A;  2V1C A;  2FOI C;  3HKP A;  4L78 A;  4AQY M;  2DWM A;  2QBY B;  4PDG A;  1Z6T A;  4LGY A;  3WHK A;  3FTF A;  2CHV A;  1R2Z A;  2A5Y B;  3GQ5 A;  1XHB A;  2J7O A;  5IRE B;  4JI7 M;  5ITR A;  3KSJ A;  2VII A;  4JI4 M;  4BBA A;  3J2P B;  1E94 E;  1G41 A;  4JXJ A;  3D8B A;  5BR8 M;  2CUZ A;  2D7H A;  3KW6 A;  4I8O A;  3AKZ A;  4AI6 A;  3SMP A;  4LZZ A;  1Q39 A;  1XNQ M;  4FCW A;  4EIW A;  3SMS A;  3Q8X A;  3FTD A;  4RNA A;  2XFT A;  2XZU A;  3GLH A;  2C9C A;  3SAT A;  1IXR C;  3PXG A;  4PCZ A;  3JR5 A;  4GH9 A;  3KP0 E;  3HJQ A;  4NRW A;  2L7H A;  1L1T A;  5KPT A;  1E32 A;  1JQJ C;  4FW9 A;  2ZAN A;  1QAN A;  4MGY E;  3U61 B;  4LF4 M;  1R7R A;  2Y20 A;  3J7A S;  3GRR A;  4FWH A;  4R3D A;  4QNR A;  4S12 A;  3GRV A;  2Z3X A;  2UXB M;  4PD2 A;  3PVS A;  2XGN A;  1QAM A;  1IBM M;  1SXJ E;  3THG A;  1YUB A;  1Z5B A;  1GKI A;  4FVM A;  2DZO B;  1Z5A A;  3E4R A;  1SXJ B;  4OVZ A;  3U6D A;  3AOE A;  4NRV A;  1NJG A;  1G8P A;  1N36 M;  2VQE M;  3KP1 E;  1JR3 D;  1TDH A;  3J81 S;  4NXM M;  3QWL A;  1YSY A;  5A2Q S;  5ITX A;  2QZ4 A;  3GRY A;  3U6E A;  2XF3 A;  4DV5 M;  4BLC A;  3DZD A;  3FUU A;  1N77 A;  1R2Y A;  3GPY A;  2E5L M;  5C18 A;  4DR1 M;  5GKN A;  2QBY A;  4LF7 M;  3RE8 A;  4Z6Y A;  2F5P A;  4DR4 M;  2KZS A;  3M7G A;  4KHP M;  2RKO A;  1WXQ A;  4L15 A;  4D82 A;  1DGB A;  5EXX A;  4B3R M;  3UJN A;  3HHZ A;  4IBG A;  4G6Z A;  3AJI B;  1IQP A;  5KPZ A;  2FNA A;  3HWS A;  1XC8 A;  4MGK E;  5JI3 E;  4JI2 M;  3WHL A;  4FCV A;  4LJ5 A;  3JAM S;  1N32 M;  3U5Z B;  4FCT A;  4RF0 A;  1TGU A;  2DWL A;  2Z4R A;  1HT2 E;  2KW0 A;  1GL6 A;  1QAO A;  1QYR A;  3U61 A;  3KS8 A;  4ZPX A;  8CAT A;  4GHA A;  4HL4 A;  3TPZ A;  3LQR A;  2UXD M;  3SHF A;  1TH3 A;  2LH0 A;  2Z7J A;  1E9S A;  5EP1 A;  5KQD A;  3OTO M;  4DR6 M;  1QQW A;  2J7N A;  3B9P A;  1MX0 A;  3H4M A;  4QOZ C;  4LGM A;  3RGP A;  1IXZ A;  1KYI A;  1XMO M;  2CFO A;  3KFU G;  4LY6 A;  1SXJ A;  3HHY A;  1NNJ A;  3VKG A;  3GLF B;  4PDI A;  1XWI A;  3SHG B;  1I94 M;  3FTC A;  1GVN A;  4YY3 M;  1H6U A;  1DGF A;  2LNH C;  4IBJ A;  4IBF A;  1N33 M;  1J09 A;  1W5T A;  3A45 A;  1OFH A;  2F5N A;  2M5Z A;  3VDP A;  3ZC7 B;  4L16 A;  4B7G A;  3K8Z A;  4Z8X A;  2DWN A;  3HJ8 A;  1TDZ A;  4DV3 M;  1XXH B;  3EIE A;  1N34 M;  3FD9 A;  3KOY E;  2EA0 A;  2D7E A;  4LG2 A;  4DV6 M;  4GIP A;  5IT9 S;  1TH4 A;  2C96 A;  3ILK A;  3D8L A;  2R62 A;  3TQS A;  4GRI A;  1ZQ9 A;  3EIH A;  1J7K A;  4NOO B;  4MGZ E;  1NNU C;  2F5O A;  3KXE C;  1G3I A;  2RGO A;  2CEA A;  4AG6 A;  2LWX A;  3FUV A;  4KO8 A;  2R4J A;  4DUY M;  2JA2 A;  4AKG A;  2NQ8 C;  2CE7 A;  4LRS A;  3U5Z A;  1DGH B;  1NSF A;  1I4W A;  2DHR A;  3J80 S;  1L2C A;  4I5S A;  2CV1 A;  3LVV A;  2L09 A;  1S3S A;  3QAU A;  3FTE A;  3U60 B;  1G59 A;  3VKH A;  2HKJ A;  3CF0 A;  3I4Y A;  3T15 A;  2XLJ A;  3FYD A;  4REZ A;  1R6B X;  2M60 A;  4IBE A;  5KPR A;  3SYL A;  4WUR A;  3SC3 A;  4JI1 M;  1L8Q A;  1Q3B A;  4X66 M;  4JN6 A;  3A42 A;  1PJJ A;  4CHT B;  3GLI B;  3GLF A;  4GKK M;  2K47 A;  2KZU A;  4LZJ A;  4IBK A;  2KXE A;  5ITQ A;  2HCB A;  3HU3 A;  4I4L A;  4QHS A;  2O5R A;  3RGS A;  3K92 A;  4B3T M;  2L6O A;  4DV4 M;  2QPA A;  2F4V M;  1NJF A;  4FWD A;  4M0D A;  2KRK A;  2X8A A;  4X65 M;  3GPP A;  3A98 B;  3SFZ A;  3T1H M;  1XXH A;  4LFB M;  1W5S A;  3M0E A;  5ITY A;  5EP4 A;  4M9X A;  1N75 A;  3L25 A;  4DV7 M;  5FSW A;  2BJW A;  3TL4 X;  3UMM A;  4JI8 M;  3CF2 A;  3R9X B;  4LF5 M;  3PNV A;  3K1J A;  3GLG B;  4M0W A;  5BPV A;  1FJG M;  4K0K M;  1DO0 A;  1HNX M;  2ERC A;  1HT1 E;  4TUW A;  1T3T A;  3U6O A;  2YFQ A;  2ZAO A;  4QHT A;  4MH0 E;  5ITU A;  3MK6 A;  3CF6 E;  4L4U A;  1KFV A;  1DGH A;  1QZM A;  4FD2 A;  3UZU A;  3R8F A;  3M6A A;  4XGI A;  4QOS A;  3GPU A;  1OFI A;  2CV2 A;  3J7B A;  2DVW B;  3LMM A;  2UUB M;  1X37 A;  5E26 A;  5ITT A;  3U60 A;  1SXJ C;  4RF1 A;  3GP1 A;  4NSO B;  4AG5 A;  4OU7 A;  2UUA M;  4D81 A;  2OPF A;  3FUW A;  1K3X A;  1UM8 A;  1IN6 A;  5C1B A;  5IWA M;  4II7 A;  3ZH9 B;  1EE8 A;  5KO3 A;  4JYA M;  2UU9 M;  4OW0 A;  1IBL M;  4MM3 B;  2F5Q A;  4AKH A;  3AFH A;  5DYG A;  2V1U A;  4YHH M;  3E9S A;  1OJL A;  1ZAE A;  2C9O A;  5FTJ A;  1SXJ D;  1K82 A;  2Q2E B;  3GLI A;  3FKE A;  3FYC A;  5EJC A;  2BJV A;  3DFZ A;  4GC5 A;  5JI2 E;  3GRU A;  3U6Q A;  2YQZ A;  1XNR M;  4L8R C;  4JI5 M;  1N78 A;  2DZN B;  4D80 A;  2H1R A;  4IIW A;  1IN5 A;  3FUX A;  2Y0Q A;  4JI0 M;  5DYI A;  1IY2 A;  3GQ3 A;  2QEN A;  3NBI A;  2KEB A;  4B08 A;  3TWM A;  2R46 A;  4KOD A;  3JR4 A;  3MJ5 A;  2Y0T A;  2W82 A;  2CHQ A;  1HR0 M;  2BNK A;  3GO8 A;  4G4N A;  1QVR A;  3HGI A;  5KQ8 A;  3AV0 A;  4B7H A;  5EP3 A;  4LJ6 A;  3GLG A;  1IM2 A;  1TH2 A;  5EXP A;  3T38 A;  4DR7 M;  3K2L A;  3U6C A;  3U6P A;  5F3W A;  2L7I A;  4KLN A;  3VLF B;  3VK8 A;  1HNZ M;  4ITQ A;  3DOA A;  4LF8 M;  5FTM A;  1IY0 A;  2XSZ A;  3CTW B;  4GMQ A;  3W0L B;  4B7F A;  2UUC M;  2UXC M;  2RGH A;  3T1Y M;  1D2N A;  4M9S A;  2QCU A;  3RFW A;  1L2B A;  4JV5 M;  1KSF X;  3SAU A;  2C98 A;  2R65 A;  4IBC A;  2ZM6 M;  1G4A E;  4LF6 M;  3AL0 C;  1L1Z A;  2KRU A;  2EO2 A;  5E6J A;  2X4A A;  2DXI A;  4R7G A;  1IN4 A;  3VFD A;  1NY5 A;  2G8L A;  3AOE C;  3W0F A;  1HNW M;  3SBJ A;  4B3S M;  4DUZ M;  4IBD A;  2LXE A;  4PT5 A;  4CIS A;  4HLQ A;  4W5W A;  5LMU M;  2ZBK B;  4LJ8 A;  5H37 D;  1Q3C A;  3IG8 A;  1GL7 A;  4IJF A;  5LMN M;  2V6Z M;  3KVW A;  4NXN M;  1ORY B;  4MGH A;  4MB7 A;  2R18 A;  5EP2 A;  3KOX E;  3SAR A;  2HHH M;  1IXS B;  4P16 A;  5FTL A;  2Y21 A;  3HHX A;  4LF9 M;  3NWL A;  4BB9 A;  4G4R A;  3LQQ A;  4LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...