5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
3SATA 1N34M 4LF5M 4B3RM 4YY3M 3GP1A 3JR4A 2UXDM 5BR8M 4X65M 3A46A 4LFBM 1N33M 4DR7M 3GQ3A 1FJGM 4NRVA 1PJIA 2F5QA 2HHHM 2XZUA 2OQ4A 1IBMM 4LF7M 1R2ZA 4X66M 3U6DA 3TWLA 4DV7M 1XMQM 5ITTA 4DV3M 2HKJA 2F5OA 4JI4M 4NXMM 4GKJM 2XZFA 2UXCM 5IT9S 3TWKA 4AQYM 4JI3M 1R2YA 3SAVA 4DR6M 3SBJA 3J7AS 1XC8A 5ITXA 1Q3BA 5IWAM 2ZM6M 1Q39A 3OTOM 2F4VM 3GPYA 1Z5AA 1TDHA 1PJJA 3SASA 3U6SA 4NRWA 3U6PA 3U6CA 1TDZA 1K82A 1L1ZA 1KFVA 4LF9M 4PDGA 4LFCM 4MB7A 3DOAA 3TWMA 3U6QA 4JYAM 1XNQM 1Q3CA 3GPPA 1HR0M 1HNXM 2E5LM 4DR4M 4LF8M 1L2CA 1XMOM 1N32M 4PDIA 3J81S 4DR2M 1K3WA 3GQ4A 3JR5A 3VK7A 4LFAM 4PCZA 3SAWA 2EA0A 3C58A 4JI0M 2OPFA 3U6OA 1NNJA 1HNWM 1MX0A 1XNRM 4JI6M 5ITRA 4DUYM 5FLXS 3W0FA 3GQ5A 4B3TM 4PD2A 4DV5M 4G4RA 3A42A 5ITYA 4OX9M 2F5NA 3U6MA 2UUAM 4NXNM 2UUBM 1Z5BA 1PM5A 1Z5CA 4X62M 5LMUM 4DV2M 1I94M 3T1YM 4GKKM 1L1TA 4G4OA 1L2BA 1HNZM 3VK8A 4JI2M 4JI5M 4DR3M 5LMNM 4B3SM 2VQEM 4DV1M 4JI1M 3GPXA 3GPUA 3T1HM 3J80S 5ITXE 4DV6M 4B3MM 2F5PA 4YHHM 1N36M 4G4NA 1K3XA 1EE8A 4CISA 4JI8M 4LF6M 4DR5M 5ITUA 5A2QS 3U6LA 4DV4M 4DV0M 4DR1M 1Z59A 1IBLM 2VQFM 2UUCM 1MU5A 3SARA 2UU9M 4LF4M 1IBKM 3JAMS 4JV5M 4ITQA 4K0KM 2F5SA 1L2DA 4G4QA 2UXBM 4JI7M 3U6EA 3A45A 3GO8A 4X64M 2Q2EB 1J5EM 4KHPM 3SAUA 2ZBKB 4DUZM 5ITQA
chains in the Genus database with same CATH superfamily
2OOAA 1QDRA 4NOOB 4MGKE 2KA6B 2K6BA 4FWHA 2LBCA 1PGYA 4L6V6 1TR8A 1D0MA 3LVVA 1MJGM 4LCBA 5BR8M 3A46A 4LFBM 2DAMA 2O25A 3W0LB 3CTWB 3GQ3A 4P17A 3FUTA 2F5QA 1OQYA 2HL7A 2XZUA 4EIWA 3KW6A 4LF7M 3K92A 4X66M 1FNNA 4DBGB 1W5TA 2HCBA 1E32A 2Z8YM 4Q7JA 1ZMWA 1GLNA 3RGPA 1R6BX 2MR9A 3LQRA 4IJFA 4NXMM 1G41A 4RF0A 4GH9A 4R71A 3UK6A 3SAVA 3AL0C 3R9XB 1V92A 3CF6E 1TGUA 1VEJA 3MJ5A 5L8RF 2DXIA 1VQ1A 1SXJA 2EJSA 3GPYA 2LHGA 3KDSE 1HQCA 1T43A 3QYBA 3SASA 3U6CA 2KDLA 2QSFX 3IG8A 1GKIA 3LCVB 3HHZA 4L8RC 2M60A 3DOAA 2C99A 3FUVA 3TWMA 3WHLA 3GPPA 3GLHA 3RGSA 2Z3XA 1L2CA 1XMOM 1ZMVA 3W67A 3U5ZB 1F4IA 3M6AA 3FYDA 2BWEA 1IXRC 2X8AA 3FD9A 3E46A 3ZC7B 1G8PA 2DWZB 1RU3A 5EXSA 4FWDA 2DZOB 3AKZA 3AOEC 3VDUA 3VLFB 2J7NA 4B08A 3GQ4A 3VK7A 2JNHA 3SAWA 2Z7JA 3U6OA 1IN5A 3RFWA 3HGIA 2XLJA 5EP3A 1XXHA 1NNUC 3GLGA 2DWMA 2LNHC 1NY6A 1OAIA 1XNRM 1HT1E 3W0FA 2LVQD 3HU2A 3KXEC 5DNYA 5FLXS 4UN2B 3M0EA 2R44A 2KZUA 4DV5M 2CV0A 1EIJA 4M0WA 2XFSA 4OX9M 1TH4A 3ZCBB 4LJ7A 5DYIA 3LQQA 3FE3A 2R62A 1Z5BA 1PM5A 4QHSA 4IIWA 4X62M 5LMUM 1OIPA 4IBDA 1I94M 5EQTA 3B7QA 4LRTA 2W82A 4MGYE 4D81A 5KQ8A 2LTUA 3I4VA 2D7EA 4LJ9A 1TH3A 4B3SM 1VEKA 2LVAA 3GRYA 1VDLA 4II7A 3GPXA 2JY8A 4KO8A 5ITXE 3TL4X 4B3MM 2LVPC 1S3SA 2C5RA 4JI8M 2MJ5B 1J5EM 4LF6M 5ITUA 3SYKA 4FWGA 1NHGC 1N75A 3U6LA 4IBCA 3DZDA 1YE9A 4I81A 2YR0A 4QHTA 4B7GA 2VQFM 3PVSA 2KNZA 3ILKA 2OO9A 1CUKA 2LVOC 1IBKM 4JV5M 4OVZB 1J09A 2F5SA 4L15A 3W68A 1R4GA 4G4QA 1PJTA 1QAOA 4FD2A 2KW0A 1DO0A 2K47A 4X64M 4GHAA 2BNKA 2ZBKB 4DUZM 4GITA 3SATA 5KPZA 4RF1A 1PRBA 4AG5A 4R7GA 4Z6YA 2DAGA 1NY5A 2NQ8C 2Z4RA 4B7FA 3J27B 1BVSA 1N33M 1NV8A 3SMPA 4DR7M 2OOBA 3AOEA 4PT5A 4NRVA 3GLFA 3HHWA 4LJ4A 2R46A 1A5TA 3KP1E 2FOIC 4Y28F 4CGYB 2EKFA 3TWLA 3IECA 2JY5A 3J7BA 1GO5A 5GKNA 4GC9A 3HJQA 4GRIA 2HKJA 2CEAA 3HY5A 5IT9S 2DZNB 3VFDA 2K0BX 3TWKA 1OAOC 5JI3E 4AQYM 3I51A 1IN7A 4NSRA 2YQZA 3J7AS 4HLQA 3FRHA 4REZA 4AKGA 1PJJA 4NRWA 1JR3A 2RGHA 1AUAA 3U6PA 1TDZA 1L1ZA 2ERCA 1ORYB 2KEBA 2KNVA 2JZ0A 4PDGA 1KFVA 4LFCM 2R65A 2CUZA 2CE7A 3QAUA 3PFIA 1XNQM 2CFOA 5FSWA 4JN6A 2KZSA 4LJAA 5EP2A 1AIPC 4BB9A 4PDIA 4FVMA 4LZZA 1QAMA 3ZQJA 1T3TA 1K3WA 1N78A 2C98A 3MK6A 2QQ8A 2MGWA 4LFAM 2FFJA 3C58A 2JP7A 4LRSA 3FUXA 2EA0A 3B74A 4BLCA 1C7YA 3L26A 2CV1A 2RRUA 3SHFA 1G71A 4WURA 1HNWM 1MX0A 2FH0A 2FE8A 3LVWA 3Q8XA 1DO2A 4AKIA 2I7NA 2XEPA 1UM8A 1DV0A 1OFIA 2V6ZM 3GQ5A 1T6OA 4PD2A 3KOZE 4B3TM 3MHVC 1ZAEA 4M9XA 5ITYA 4LJ5A 3V76A 4XK8F 3KOYE 4NXNM 2UUBM 4IBFA 1SXJB 3U60A 1N77A 1NJFA 1LTMA 4D80A 5EXXA 4QOSA 1L1TA 5KPRA 4G4OA 1L2BA 4JI2M 2XGNA 2JZ1A 2R4EA 2QPAA 4DR3M 3PNYA 3THGA 1KYIA 4GEWA 2R6FA 3GLHB 2KNAA 4FCTA 2XSZD 3HU1A 4HL4A 3T1HM 5C18A 2DENA 3LMMA 4MH0E 1QZMA 5FTJA 4YHHM 2F5PA 1H6UA 2QCUA 2DHYA 2DZLA 1QZEA 2JA2A 2RGOA 4R3DA 4CISA 3NBXX 3HWSA 5A2QS 4NL4H 3UMMA 3HJSA 2A5YB 2QBYA 4KLNA 1IXSA 5JI2E 4DV4M 2CV2A 5FTNA 1XXHB 3GLGB 4LGMA 1LV7A 2UU9M 3KS4A 3FUUA 3GRVA 3M7GA 4LJ8A 4LF4M 3JAMS 2APLA 5H37D 1IY2A 2QENA 4LG2A 4L16A 1NV9A 2CWBA 2CP8A 3A45A 4M0DA 4NC6A 4RKUF 3VDPA 2QNJA 2DAEA 2L4EA 3T6PA 1Q02A 3SAUA 1D2NA 2VF8A 3ZH9B 1I4WA 4WP2A 4B3RM 4AI6A 4YY3M 4AKHA 3GP1A 4CIZA 1YLAA 1OIZA 3NWLA 1L8QA 2JUJA 2KRKA 1WGLA 3HU3A 1TF0B 1WR1B 2KHHA 3AFHA 4OU7A 7CATA 3AJIB 1FJGM 2HHHM 3K2LA 1WGNA 4CHTB 2XH9A 2ZAOA 4D82A 2AHMA 1GL6A 2OQ4A 2QZ4A 5EXTA 1R7RA 1IBMM 4I4LA 1G4AE 4I5SA 3U6DA 3U61A 1R5LA 2LWXA 2BWBA 3BBZA 4WW0A 2D7HA 3H4MA 1E9SA 1VG5A 3I01M 3E9SA 4I8OA 4LY6A 5EXPA 4AG6A 2F5OA 2XZFA 4JI4M 3KS8A 2UXCM 3U61B 3DFZA 4JI3M 1D0KA 2R0IA 2Y0QA 4W5WA 1R2YA 3SFZA 3H4JA 4KT0F 1XC8A 5ITXA 1QVRA 5IWAM 2ZM6M 3OTOM 2F4VM 3B9PA 1IM2A 1TDHA 3LW5F 1SG9A 1YUBA 1E9RA 3U6SA 1J7KA 3HX3A 2LHCA 1VEGA 2WSFF 1GJSA 3BOSA 3HZJA 5EJCA 1DGHA 3L2AA 2FNAA 1Q3CA 2Y20A 3KOXE 5EP4A 1HR0M 2E5LM 1TH2A 1XHBA 1MN3A 2YNMD 1N32M 2Z4SA 5E6JA 1KSFX 1OKSA 2CHVA 3UGJA 1DGHB 3KOWE 4G6ZA 2K9DA 3GLFB 2L09A 3KVWA 3TQSA 3JR5A 1XWIA 3C3DA 4M9ZA 4PCZA 4JI0M 2CHQA 3E21A 2GQFA 1HQYE 4IBIA 1JB0F 3FTDA 2FS1A 3FRIA 5FTLA 1P3QQ 4L4UA 2KRUA 3T38A 3FTFA 1W5SA 3DA1A 3KP0E 3K9PA 4OW0A 1SXJD 3SMSA 2R4JA 3GLIA 4JI6M 1C1KA 1OFHA 1HT2E 1NJGA 2C96A 4G4RA 3RE8A 5IREB 8CATA 4GHLA 1IN6A 5E26A 2N35A 1QYRA 2DWNA 3U6MA 1NO1A 3GLIB 1WIVA 4MM3B 3AOGA 1D0LA 4NSOB 3VKGA 4KODA 4GKKM 2DNAA 1QANA 3IHPA 3LCUA 3SC3A 4JI5M 3D8LA 4GC5A 2GNOA 2VQEM 4AZFA 3J2PB 2YFQA 4LF9M 4LZJA 3GPUA 3J80S 4DV6M 1N36M 1E94E 1SXJE 1EE8A 4G4NA 2BJWA 1IN8A 2V1CA 5KO3A 3K1JA 1NHWC 2KXEA 4DR5M 4KHPM 1QDTA 1OTRA 4MGZE 4A3VB 4DR1M 2XFTA 3CGWA 4MGIE 3GLHE 1Z59A 1GVNA 2DAIA 5KQDA 3R8FA 3K9OA 2UUCM 3SARA 1QUSA 1IXZA 1QQWA 2P5TA 4IBEA 2DWLA 4P16A 4ITQA 1DGGA 4K0KM 4QNRA 3F92A 1TTEA 1UFZA 2JY6B 3Q8GA 4QOZC 2WZJA 4JI7M 3U60B 3QWLA 2B3TA 4LGYA 3WHKA 1XB2B 1XXHE 5ITQA 3GLGE 3D8BA 4FW9A 3FTEA 1N34M 4LF5M 2LH0A 3JR4A 2H5XA 3FKEA 2UXDM 3EIEA 3TE6A 4IBGA 4X65M 2M5ZA 3U5ZA 2WSEF 4FCWA 1HJPA 4RNAA 3HKPA 2MH8A 3C9PA 1PJIA 2C9OA 2CHGA 4ANRA 4ZPXA 4G3OA 4GMQA 1QUTA 2DKLA 1R2ZA 1G3IA 2QBYB 2G3QA 1IXSB 2LXEA 4IBBA 1DGFA 2JY7A 1Y8GA 2L4FA 3CF0A 4DV7M 1XMQM 1IY1A 4JXJA 4Z8XA 2DHRA 5ITTA 4DV3M 4GKJM 3VKHA 2WSCF 3SYLA 3L28A 4F1IA 2R45A 4DR6M 4FCVA 3SBJA 2VF7A 1Q3BA 2EO2A 4QNMA 1Q39A 3I4YA 1Z5AA 3B89A 4XBOA 2JXNA 3PXGA 1GABA 1V34A 1VDDA 2G5GX 3KFUG 4F2LA 1K82A 2VIIA 2L6OA 2R18A 2L7HA 3B7NA 2DAKA 1GJTA 4MB7A 5DFLA 2VDBB 5KPTA 3U6QA 5FTKA 4JYAM 3A98B 4CJ6A 3T15A 1HNXM 1ZQ9A 2D7GA 3FYCA 4DR4M 3PNVA 4LF8M 2ZANA 1X37A 4B7HA 2L2DA 3J81S 3GRUA 3L25A 2QHOB 4DR2M 2I7PA 2EKKA 2XSZA 1PJSA 1YSYA 2O01F 1WJ7A 2BJVA 2HAKA 3SHGB 1EFUB 1ZMUA 3EIHA 4XGIA 2OPFA 1V33A 5F3WA 1NNJA 3CF2A 1DGBA 5ITRA 4DUYM 2RKOA 4IBJA 4TUWA 3A42A 4OVZA 1JR3D 3MMPA 2V1UA 3GLFE 3K8ZA 3KSJA 3B7ZA 3HHYA 5BPVA 2ZAMA 1WHCA 3IG5A 2F5NA 1IQPA 2UUAM 3HJ8A 1Z5CA 3NBIA 4DV2M 1IN4A 3T1YM 1SXJC 3GRRA 2C9CA 3I04M 1HNZM 3VK8A 5LMNM 5DYGA 1OJLA 1QAQA 5FTMA 3UJNA 2DI0A 3FTCA 4DV1M 4JI1M 3HHXA 1PJQA 3L29A 2Y21A 1WXQA 4AW4A 3GLIE 1K3XA 1Z6TA 4IBKA 3UZUA 2CRUA 4HEOA 3KSXA 2HWJA 3L27A 3C3EA 1JR3E 1NVMA 2QP9X 2ZTDA 4M9SA 1IFYA 3AV0A 2MROB 3QYEA 3FUWA 1GL7A 4DV0M 1IY0A 1ZV1A 2LVNC 2O5RA 4GIPA 3BXWA 1IBLM 2G8LA 2JWSA 2XF3A 2L7IA 2Y0TA 1MU5A 2H1RA 2X4AA 1JQJC 1NSFA 5IZ7D 3TPZA 2EUCA 3E4RA 2X49A 1L2DA 4LJ6A 2J7OA 2UXBM 4BBAA 4L78A 5C1BA 3U6EA 2DVWB 3GO8A 1G59A 4S12A 2Q2EB 2ZTCA 5EP1A 2J5YA 4MGHA 4IJEA
chains in the Genus database with same CATH topology
4NOOB 4MGKE 2KA6B 4FWHA 4LCBA 3LVVA 5BR8M 3A46A 4LFBM 3W0LB 3CTWB 3GQ3A 3FUTA 2F5QA 2HL7A 2XZUA 4EIWA 3KW6A 4LF7M 3K92A 4X66M 1FNNA 1W5TA 2HCBA 1E32A 1GLNA 3RGPA 1R6BX 4IJFA 3LQRA 4NXMM 1G41A 4RF0A 4GH9A 3UK6A 3SAVA 3AL0C 3R9XB 3CF6E 1TGUA 3MJ5A 2DXIA 1SXJA 3GPYA 3KDSE 1HQCA 3U6CA 3IG8A 4L8RC 3HHZA 1GKIA 2M60A 3DOAA 2C99A 3FUVA 3TWMA 3WHLA 3GPPA 3GLHA 3RGSA 2Z3XA 1L2CA 1XMOM 3U5ZB 3M6AA 3FYDA 3ZC7B 1IXRC 2X8AA 3FD9A 1G8PA 2DWZB 5EXSA 3AKZA 4FWDA 2DZOB 3GQ4A 3AOEC 3VDUA 3VLFB 2J7NA 4B08A 3VK7A 3SAWA 2Z7JA 3U6OA 1IN5A 3RFWA 3HGIA 2XLJA 5EP3A 1XXHA 1NNUC 3GLGA 2DWMA 2LNHC 1NY6A 1XNRM 1HT1E 3W0FA 5FLXS 3HU2A 3KXEC 5DNYA 3M0EA 4DV5M 2KZUA 2CV0A 4M0WA 2XFSA 4OX9M 1TH4A 3ZCBB 4LJ7A 5DYIA 3LQQA 2R62A 1Z5BA 1PM5A 4QHSA 4IIWA 4X62M 5LMUM 4IBDA 1I94M 5EQTA 4LRTA 2W82A 4MGYE 4D81A 5KQ8A 3I4VA 2D7EA 4LJ9A 1TH3A 4B3SM 3GRYA 4II7A 3GPXA 4KO8A 5ITXE 3TL4X 4B3MM 1S3SA 2C5RA 4JI8M 4LF6M 5ITUA 3SYKA 4FWGA 1NHGC 1N75A 3U6LA 4IBCA 3DZDA 1YE9A 4I81A 2YR0A 4QHTA 4B7GA 2VQFM 3PVSA 3ILKA 1IBKM 4JV5M 4OVZB 1J09A 2F5SA 4L15A 4G4QA 1QAOA 4FD2A 2KW0A 1DO0A 2K47A 4X64M 2ZBKB 2BNKA 4DUZM 4GITA 3SATA 5KPZA 4RF1A 4AG5A 4R7GA 4Z6YA 1NY5A 2NQ8C 2Z4RA 4B7FA 3J27B 1N33M 3SMPA 4DR7M 3AOEA 4PT5A 4NRVA 3GLFA 3HHWA 4LJ4A 2R46A 3KP1E 2FOIC 4CGYB 3TWLA 3J7BA 5GKNA 4GC9A 3HJQA 4GRIA 2HKJA 2CEAA 5IT9S 2DZNB 3VFDA 3TWKA 5JI3E 4AQYM 3I51A 1IN7A 4NSRA 2YQZA 3J7AS 4HLQA 4REZA 4AKGA 1PJJA 4NRWA 1JR3A 2RGHA 3U6PA 1TDZA 1L1ZA 2ERCA 1ORYB 2KEBA 1KFVA 4PDGA 4LFCM 2R65A 2CUZA 2CE7A 3QAUA 3PFIA 1XNQM 2CFOA 5FSWA 4JN6A 2KZSA 4LJAA 5EP2A 4BB9A 4PDIA 4FVMA 4LZZA 1QAMA 1T3TA 1K3WA 1N78A 2C98A 3MK6A 4LFAM 2FFJA 3C58A 4LRSA 2EA0A 3FUXA 4BLCA 2CV1A 3L26A 3SHFA 4WURA 1HNWM 1MX0A 2FE8A 3LVWA 3Q8XA 1DO2A 4AKIA 2I7NA 2XEPA 1UM8A 1OFIA 2V6ZM 3GQ5A 4B3TM 4PD2A 3KOZE 3MHVC 1ZAEA 4M9XA 5ITYA 4LJ5A 3KOYE 4NXNM 2UUBM 4IBFA 1SXJB 3U60A 1N77A 1NJFA 4D80A 5EXXA 4QOSA 1L1TA 5KPRA 4G4OA 1L2BA 4JI2M 2XGNA 2R4EA 4DR3M 2QPAA 3PNYA 3THGA 1KYIA 3GLHB 4FCTA 2XSZD 3HU1A 4HL4A 3T1HM 5C18A 3LMMA 4MH0E 5FTJA 1QZMA 4YHHM 2F5PA 1H6UA 2QCUA 2RGOA 2JA2A 4R3DA 4CISA 3HWSA 5A2QS 4NL4H 3UMMA 3HJSA 2A5YB 2QBYA 4KLNA 5JI2E 4DV4M 2CV2A 5FTNA 1XXHB 3GLGB 4LGMA 1LV7A 2UU9M 3KS4A 3FUUA 3GRVA 3M7GA 4LJ8A 4LF4M 3JAMS 5H37D 1IY2A 2QENA 4LG2A 4L16A 3A45A 4M0DA 3VDPA 3SAUA 1D2NA 3ZH9B 1I4WA 4B3RM 4AI6A 4YY3M 4AKHA 3GP1A 3NWLA 1L8QA 2KRKA 4OU7A 3HU3A 3AFHA 7CATA 3AJIB 1FJGM 2HHHM 3K2LA 4CHTB 2XH9A 2ZAOA 4D82A 2AHMA 1GL6A 2OQ4A 2QZ4A 5EXTA 1R7RA 1IBMM 4I4LA 1G4AE 4I5SA 3U6DA 3U61A 2LWXA 4WW0A 2D7HA 3H4MA 1E9SA 3E9SA 4I8OA 4LY6A 5EXPA 4AG6A 2F5OA 2XZFA 4JI4M 3KS8A 2UXCM 3U61B 3DFZA 4JI3M 1R2YA 4W5WA 2Y0QA 3SFZA 1XC8A 5ITXA 1QVRA 5IWAM 2ZM6M 3OTOM 2F4VM 3B9PA 1IM2A 1TDHA 1YUBA 1E9RA 3U6SA 1J7KA 3BOSA 5EJCA 1DGHA 3L2AA 2FNAA 1Q3CA 2Y20A 3KOXE 5EP4A 1HR0M 2E5LM 1TH2A 1XHBA 2YNMD 1N32M 2Z4SA 5E6JA 1KSFX 2CHVA 3UGJA 1DGHB 3KOWE 4G6ZA 3GLFB 2L09A 3KVWA 3TQSA 3JR5A 1XWIA 4M9ZA 4PCZA 4JI0M 2CHQA 4IBIA 1HQYE 5FTLA 3FTDA 4L4UA 2KRUA 3T38A 3FTFA 1W5SA 3DA1A 3KP0E 4OW0A 4JI6M 1SXJD 3SMSA 2R4JA 3GLIA 1C1KA 1OFHA 1HT2E 1NJGA 2C96A 4G4RA 3RE8A 5IREB 8CATA 4GHLA 1IN6A 5E26A 1QYRA 2DWNA 3U6MA 3GLIB 4MM3B 3AOGA 4NSOB 3VKGA 4KODA 4GKKM 1QANA 3SC3A 4JI5M 3D8LA 4GC5A 2VQEM 4AZFA 3J2PB 2YFQA 4LZJA 3GPUA 3J80S 4DV6M 1N36M 1E94E 1SXJE 1EE8A 4G4NA 2BJWA 1IN8A 2V1CA 5KO3A 3K1JA 1NHWC 2KXEA 4DR5M 4KHPM 4MGZE 4A3VB 4DR1M 2XFTA 4MGIE 1Z59A 1GVNA 5KQDA 3R8FA 2UUCM 3SARA 1IXZA 1QQWA 2P5TA 4IBEA 2DWLA 4P16A 4ITQA 1DGGA 4K0KM 4QNRA 4QOZC 4JI7M 3U60B 3QWLA 4LGYA 3WHKA 5ITQA 3D8BA 4FW9A 3FTEA 1N34M 4LF5M 2LH0A 3JR4A 3FKEA 2UXDM 3EIEA 3TE6A 4IBGA 4X65M 2M5ZA 3U5ZA 4FCWA 4RNAA 3HKPA 1PJIA 2C9OA 2CHGA 4ZPXA 4GMQA 1R2ZA 1G3IA 2QBYB 1IXSB 2LXEA 4IBBA 1DGFA 3CF0A 4DV7M 1XMQM 1IY1A 4JXJA 4Z8XA 2DHRA 5ITTA 4DV3M 4GKJM 3VKHA 3SYLA 3L28A 2R45A 4DR6M 4FCVA 3SBJA 1Q3BA 2EO2A 4QNMA 1Q39A 3I4YA 1Z5AA 4XBOA 3PXGA 1VDDA 2G5GX 3KFUG 1K82A 2VIIA 2L6OA 2R18A 2L7HA 5KPTA 4LF9M 4MB7A 4GHAA 3U6QA 5FTKA 4JYAM 3A98B 3T15A 1HNXM 1ZQ9A 2D7GA 3FYCA 4DR4M 3PNVA 4LF8M 2ZANA 1X37A 4B7HA 3J81S 3GRUA 3L25A 4DR2M 2I7PA 2XSZA 1YSYA 2BJVA 3SHGB 3EIHA 4XGIA 2OPFA 5F3WA 1NNJA 3CF2A 1DGBA 5ITRA 4DUYM 2RKOA 4IBJA 4TUWA 3A42A 4OVZA 1JR3D 2V1UA 3K8ZA 3KSJA 3HHYA 5BPVA 2ZAMA 3IG5A 2F5NA 2UUAM 1IQPA 3HJ8A 1Z5CA 3NBIA 4DV2M 1IN4A 3T1YM 1SXJC 3GRRA 2C9CA 1HNZM 3VK8A 5LMNM 5DYGA 1OJLA 1QAQA 5FTMA 3UJNA 3FTCA 4DV1M 4JI1M 3HHXA 3L29A 2Y21A 1WXQA 4AW4A 1K3XA 1Z6TA 4IBKA 3UZUA 3KSXA 3L27A 4M9SA 1NVMA 2QP9X 3AV0A 3FUWA 1GL7A 4DV0M 1IY0A 2O5RA 4GIPA 1IBLM 2G8LA 2XF3A 2Y0TA 2L7IA 1MU5A 2H1RA 2X4AA 1JQJC 1NSFA 5IZ7D 3TPZA 2EUCA 3E4RA 2X49A 1L2DA 4LJ6A 2J7OA 2UXBM 4BBAA 4L78A 5C1BA 3U6EA 2DVWB 3GO8A 1G59A 4S12A 2Q2EB 1J5EM 5EP1A 3SASA 4MGHA 4IJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAT A;  1N34 M;  4LF5 M;  4B3R M;  4YY3 M;  3GP1 A;  3JR4 A;  2UXD M;  5BR8 M;  4X65 M;  3A46 A;  4LFB M;  1N33 M;  4DR7 M;  3GQ3 A;  1FJG M;  4NRV A;  1PJI A;  2F5Q A;  2HHH M;  2XZU A;  2OQ4 A;  1IBM M;  4LF7 M;  1R2Z A;  4X66 M;  3U6D A;  3TWL A;  4DV7 M;  1XMQ M;  5ITT A;  4DV3 M;  2HKJ A;  2F5O A;  4JI4 M;  4NXM M;  4GKJ M;  2XZF A;  2UXC M;  5IT9 S;  3TWK A;  4AQY M;  4JI3 M;  1R2Y A;  3SAV A;  4DR6 M;  3SBJ A;  3J7A S;  1XC8 A;  5ITX A;  1Q3B A;  5IWA M;  2ZM6 M;  1Q39 A;  3OTO M;  2F4V M;  3GPY A;  1Z5A A;  1TDH A;  1PJJ A;  3SAS A;  3U6S A;  4NRW A;  3U6P A;  3U6C A;  1TDZ A;  1K82 A;  1L1Z A;  1KFV A;  4LF9 M;  4PDG A;  4LFC M;  4MB7 A;  3DOA A;  3TWM A;  3U6Q A;  4JYA M;  1XNQ M;  1Q3C A;  3GPP A;  1HR0 M;  1HNX M;  2E5L M;  4DR4 M;  4LF8 M;  1L2C A;  1XMO M;  1N32 M;  4PDI A;  3J81 S;  4DR2 M;  1K3W A;  3GQ4 A;  3JR5 A;  3VK7 A;  4LFA M;  4PCZ A;  3SAW A;  2EA0 A;  3C58 A;  4JI0 M;  2OPF A;  3U6O A;  1NNJ A;  1HNW M;  1MX0 A;  1XNR M;  4JI6 M;  5ITR A;  4DUY M;  5FLX S;  3W0F A;  3GQ5 A;  4B3T M;  4PD2 A;  4DV5 M;  4G4R A;  3A42 A;  5ITY A;  4OX9 M;  2F5N A;  3U6M A;  2UUA M;  4NXN M;  2UUB M;  1Z5B A;  1PM5 A;  1Z5C A;  4X62 M;  5LMU M;  4DV2 M;  1I94 M;  3T1Y M;  4GKK M;  1L1T A;  4G4O A;  1L2B A;  1HNZ M;  3VK8 A;  4JI2 M;  4JI5 M;  4DR3 M;  5LMN M;  4B3S M;  2VQE M;  4DV1 M;  4JI1 M;  3GPX A;  3GPU A;  3T1H M;  3J80 S;  5ITX E;  4DV6 M;  4B3M M;  2F5P A;  4YHH M;  1N36 M;  4G4N A;  1K3X A;  1EE8 A;  4CIS A;  4JI8 M;  4LF6 M;  4DR5 M;  5ITU A;  5A2Q S;  3U6L A;  4DV4 M;  4DV0 M;  4DR1 M;  1Z59 A;  1IBL M;  2VQF M;  2UUC M;  1MU5 A;  3SAR A;  2UU9 M;  4LF4 M;  1IBK M;  3JAM S;  4JV5 M;  4ITQ A;  4K0K M;  2F5S A;  1L2D A;  4G4Q A;  2UXB M;  4JI7 M;  3U6E A;  3A45 A;  3GO8 A;  4X64 M;  2Q2E B;  1J5E M;  4KHP M;  3SAU A;  2ZBK B;  4DUZ M;  5ITQ A; 
#chains in the Genus database with same CATH topology
 2OOA A;  1QDR A;  4NOO B;  4MGK E;  2KA6 B;  2K6B A;  4FWH A;  2LBC A;  1PGY A;  4L6V 6;  1TR8 A;  1D0M A;  3LVV A;  1MJG M;  4LCB A;  5BR8 M;  3A46 A;  4LFB M;  2DAM A;  2O25 A;  3W0L B;  3CTW B;  3GQ3 A;  4P17 A;  3FUT A;  2F5Q A;  1OQY A;  2HL7 A;  2XZU A;  4EIW A;  3KW6 A;  4LF7 M;  3K92 A;  4X66 M;  1FNN A;  4DBG B;  1W5T A;  2HCB A;  1E32 A;  2Z8Y M;  4Q7J A;  1ZMW A;  1GLN A;  3RGP A;  1R6B X;  2MR9 A;  3LQR A;  4IJF A;  4NXM M;  1G41 A;  4RF0 A;  4GH9 A;  4R71 A;  3UK6 A;  3SAV A;  3AL0 C;  3R9X B;  1V92 A;  3CF6 E;  1TGU A;  1VEJ A;  3MJ5 A;  5L8R F;  2DXI A;  1VQ1 A;  1SXJ A;  2EJS A;  3GPY A;  2LHG A;  3KDS E;  1HQC A;  1T43 A;  3QYB A;  3SAS A;  3U6C A;  2KDL A;  2QSF X;  3IG8 A;  1GKI A;  3LCV B;  3HHZ A;  4L8R C;  2M60 A;  3DOA A;  2C99 A;  3FUV A;  3TWM A;  3WHL A;  3GPP A;  3GLH A;  3RGS A;  2Z3X A;  1L2C A;  1XMO M;  1ZMV A;  3W67 A;  3U5Z B;  1F4I A;  3M6A A;  3FYD A;  2BWE A;  1IXR C;  2X8A A;  3FD9 A;  3E46 A;  3ZC7 B;  1G8P A;  2DWZ B;  1RU3 A;  5EXS A;  4FWD A;  2DZO B;  3AKZ A;  3AOE C;  3VDU A;  3VLF B;  2J7N A;  4B08 A;  3GQ4 A;  3VK7 A;  2JNH A;  3SAW A;  2Z7J A;  3U6O A;  1IN5 A;  3RFW A;  3HGI A;  2XLJ A;  5EP3 A;  1XXH A;  1NNU C;  3GLG A;  2DWM A;  2LNH C;  1NY6 A;  1OAI A;  1XNR M;  1HT1 E;  3W0F A;  2LVQ D;  3HU2 A;  3KXE C;  5DNY A;  5FLX S;  4UN2 B;  3M0E A;  2R44 A;  2KZU A;  4DV5 M;  2CV0 A;  1EIJ A;  4M0W A;  2XFS A;  4OX9 M;  1TH4 A;  3ZCB B;  4LJ7 A;  5DYI A;  3LQQ A;  3FE3 A;  2R62 A;  1Z5B A;  1PM5 A;  4QHS A;  4IIW A;  4X62 M;  5LMU M;  1OIP A;  4IBD A;  1I94 M;  5EQT A;  3B7Q A;  4LRT A;  2W82 A;  4MGY E;  4D81 A;  5KQ8 A;  2LTU A;  3I4V A;  2D7E A;  4LJ9 A;  1TH3 A;  4B3S M;  1VEK A;  2LVA A;  3GRY A;  1VDL A;  4II7 A;  3GPX A;  2JY8 A;  4KO8 A;  5ITX E;  3TL4 X;  4B3M M;  2LVP C;  1S3S A;  2C5R A;  4JI8 M;  2MJ5 B;  1J5E M;  4LF6 M;  5ITU A;  3SYK A;  4FWG A;  1NHG C;  1N75 A;  3U6L A;  4IBC A;  3DZD A;  1YE9 A;  4I81 A;  2YR0 A;  4QHT A;  4B7G A;  2VQF M;  3PVS A;  2KNZ A;  3ILK A;  2OO9 A;  1CUK A;  2LVO C;  1IBK M;  4JV5 M;  4OVZ B;  1J09 A;  2F5S A;  4L15 A;  3W68 A;  1R4G A;  4G4Q A;  1PJT A;  1QAO A;  4FD2 A;  2KW0 A;  1DO0 A;  2K47 A;  4X64 M;  4GHA A;  2BNK A;  2ZBK B;  4DUZ M;  4GIT A;  3SAT A;  5KPZ A;  4RF1 A;  1PRB A;  4AG5 A;  4R7G A;  4Z6Y A;  2DAG A;  1NY5 A;  2NQ8 C;  2Z4R A;  4B7F A;  3J27 B;  1BVS A;  1N33 M;  1NV8 A;  3SMP A;  4DR7 M;  2OOB A;  3AOE A;  4PT5 A;  4NRV A;  3GLF A;  3HHW A;  4LJ4 A;  2R46 A;  1A5T A;  3KP1 E;  2FOI C;  4Y28 F;  4CGY B;  2EKF A;  3TWL A;  3IEC A;  2JY5 A;  3J7B A;  1GO5 A;  5GKN A;  4GC9 A;  3HJQ A;  4GRI A;  2HKJ A;  2CEA A;  3HY5 A;  5IT9 S;  2DZN B;  3VFD A;  2K0B X;  3TWK A;  1OAO C;  5JI3 E;  4AQY M;  3I51 A;  1IN7 A;  4NSR A;  2YQZ A;  3J7A S;  4HLQ A;  3FRH A;  4REZ A;  4AKG A;  1PJJ A;  4NRW A;  1JR3 A;  2RGH A;  1AUA A;  3U6P A;  1TDZ A;  1L1Z A;  2ERC A;  1ORY B;  2KEB A;  2KNV A;  2JZ0 A;  4PDG A;  1KFV A;  4LFC M;  2R65 A;  2CUZ A;  2CE7 A;  3QAU A;  3PFI A;  1XNQ M;  2CFO A;  5FSW A;  4JN6 A;  2KZS A;  4LJA A;  5EP2 A;  1AIP C;  4BB9 A;  4PDI A;  4FVM A;  4LZZ A;  1QAM A;  3ZQJ A;  1T3T A;  1K3W A;  1N78 A;  2C98 A;  3MK6 A;  2QQ8 A;  2MGW A;  4LFA M;  2FFJ A;  3C58 A;  2JP7 A;  4LRS A;  3FUX A;  2EA0 A;  3B74 A;  4BLC A;  1C7Y A;  3L26 A;  2CV1 A;  2RRU A;  3SHF A;  1G71 A;  4WUR A;  1HNW M;  1MX0 A;  2FH0 A;  2FE8 A;  3LVW A;  3Q8X A;  1DO2 A;  4AKI A;  2I7N A;  2XEP A;  1UM8 A;  1DV0 A;  1OFI A;  2V6Z M;  3GQ5 A;  1T6O A;  4PD2 A;  3KOZ E;  4B3T M;  3MHV C;  1ZAE A;  4M9X A;  5ITY A;  4LJ5 A;  3V76 A;  4XK8 F;  3KOY E;  4NXN M;  2UUB M;  4IBF A;  1SXJ B;  3U60 A;  1N77 A;  1NJF A;  1LTM A;  4D80 A;  5EXX A;  4QOS A;  1L1T A;  5KPR A;  4G4O A;  1L2B A;  4JI2 M;  2XGN A;  2JZ1 A;  2R4E A;  2QPA A;  4DR3 M;  3PNY A;  3THG A;  1KYI A;  4GEW A;  2R6F A;  3GLH B;  2KNA A;  4FCT A;  2XSZ D;  3HU1 A;  4HL4 A;  3T1H M;  5C18 A;  2DEN A;  3LMM A;  4MH0 E;  1QZM A;  5FTJ A;  4YHH M;  2F5P A;  1H6U A;  2QCU A;  2DHY A;  2DZL A;  1QZE A;  2JA2 A;  2RGO A;  4R3D A;  4CIS A;  3NBX X;  3HWS A;  5A2Q S;  4NL4 H;  3UMM A;  3HJS A;  2A5Y B;  2QBY A;  4KLN A;  1IXS A;  5JI2 E;  4DV4 M;  2CV2 A;  5FTN A;  1XXH B;  3GLG B;  4LGM A;  1LV7 A;  2UU9 M;  3KS4 A;  3FUU A;  3GRV A;  3M7G A;  4LJ8 A;  4LF4 M;  3JAM S;  2APL A;  5H37 D;  1IY2 A;  2QEN A;  4LG2 A;  4L16 A;  1NV9 A;  2CWB A;  2CP8 A;  3A45 A;  4M0D A;  4NC6 A;  4RKU F;  3VDP A;  2QNJ A;  2DAE A;  2L4E A;  3T6P A;  1Q02 A;  3SAU A;  1D2N A;  2VF8 A;  3ZH9 B;  1I4W A;  4WP2 A;  4B3R M;  4AI6 A;  4YY3 M;  4AKH A;  3GP1 A;  4CIZ A;  1YLA A;  1OIZ A;  3NWL A;  1L8Q A;  2JUJ A;  2KRK A;  1WGL A;  3HU3 A;  1TF0 B;  1WR1 B;  2KHH A;  3AFH A;  4OU7 A;  7CAT A;  3AJI B;  1FJG M;  2HHH M;  3K2L A;  1WGN A;  4CHT B;  2XH9 A;  2ZAO A;  4D82 A;  2AHM A;  1GL6 A;  2OQ4 A;  2QZ4 A;  5EXT A;  1R7R A;  1IBM M;  4I4L A;  1G4A E;  4I5S A;  3U6D A;  3U61 A;  1R5L A;  2LWX A;  2BWB A;  3BBZ A;  4WW0 A;  2D7H A;  3H4M A;  1E9S A;  1VG5 A;  3I01 M;  3E9S A;  4I8O A;  4LY6 A;  5EXP A;  4AG6 A;  2F5O A;  2XZF A;  4JI4 M;  3KS8 A;  2UXC M;  3U61 B;  3DFZ A;  4JI3 M;  1D0K A;  2R0I A;  2Y0Q A;  4W5W A;  1R2Y A;  3SFZ A;  3H4J A;  4KT0 F;  1XC8 A;  5ITX A;  1QVR A;  5IWA M;  2ZM6 M;  3OTO M;  2F4V M;  3B9P A;  1IM2 A;  1TDH A;  3LW5 F;  1SG9 A;  1YUB A;  1E9R A;  3U6S A;  1J7K A;  3HX3 A;  2LHC A;  1VEG A;  2WSF F;  1GJS A;  3BOS A;  3HZJ A;  5EJC A;  1DGH A;  3L2A A;  2FNA A;  1Q3C A;  2Y20 A;  3KOX E;  5EP4 A;  1HR0 M;  2E5L M;  1TH2 A;  1XHB A;  1MN3 A;  2YNM D;  1N32 M;  2Z4S A;  5E6J A;  1KSF X;  1OKS A;  2CHV A;  3UGJ A;  1DGH B;  3KOW E;  4G6Z A;  2K9D A;  3GLF B;  2L09 A;  3KVW A;  3TQS A;  3JR5 A;  1XWI A;  3C3D A;  4M9Z A;  4PCZ A;  4JI0 M;  2CHQ A;  3E21 A;  2GQF A;  1HQY E;  4IBI A;  1JB0 F;  3FTD A;  2FS1 A;  3FRI A;  5FTL A;  1P3Q Q;  4L4U A;  2KRU A;  3T38 A;  3FTF A;  1W5S A;  3DA1 A;  3KP0 E;  3K9P A;  4OW0 A;  1SXJ D;  3SMS A;  2R4J A;  3GLI A;  4JI6 M;  1C1K A;  1OFH A;  1HT2 E;  1NJG A;  2C96 A;  4G4R A;  3RE8 A;  5IRE B;  8CAT A;  4GHL A;  1IN6 A;  5E26 A;  2N35 A;  1QYR A;  2DWN A;  3U6M A;  1NO1 A;  3GLI B;  1WIV A;  4MM3 B;  3AOG A;  1D0L A;  4NSO B;  3VKG A;  4KOD A;  4GKK M;  2DNA A;  1QAN A;  3IHP A;  3LCU A;  3SC3 A;  4JI5 M;  3D8L A;  4GC5 A;  2GNO A;  2VQE M;  4AZF A;  3J2P B;  2YFQ A;  4LF9 M;  4LZJ A;  3GPU A;  3J80 S;  4DV6 M;  1N36 M;  1E94 E;  1SXJ E;  1EE8 A;  4G4N A;  2BJW A;  1IN8 A;  2V1C A;  5KO3 A;  3K1J A;  1NHW C;  2KXE A;  4DR5 M;  4KHP M;  1QDT A;  1OTR A;  4MGZ E;  4A3V B;  4DR1 M;  2XFT A;  3CGW A;  4MGI E;  3GLH E;  1Z59 A;  1GVN A;  2DAI A;  5KQD A;  3R8F A;  3K9O A;  2UUC M;  3SAR A;  1QUS A;  1IXZ A;  1QQW A;  2P5T A;  4IBE A;  2DWL A;  4P16 A;  4ITQ A;  1DGG A;  4K0K M;  4QNR A;  3F92 A;  1TTE A;  1UFZ A;  2JY6 B;  3Q8G A;  4QOZ C;  2WZJ A;  4JI7 M;  3U60 B;  3QWL A;  2B3T A;  4LGY A;  3WHK A;  1XB2 B;  1XXH E;  5ITQ A;  3GLG E;  3D8B A;  4FW9 A;  3FTE A;  1N34 M;  4LF5 M;  2LH0 A;  3JR4 A;  2H5X A;  3FKE A;  2UXD M;  3EIE A;  3TE6 A;  4IBG A;  4X65 M;  2M5Z A;  3U5Z A;  2WSE F;  4FCW A;  1HJP A;  4RNA A;  3HKP A;  2MH8 A;  3C9P A;  1PJI A;  2C9O A;  2CHG A;  4ANR A;  4ZPX A;  4G3O A;  4GMQ A;  1QUT A;  2DKL A;  1R2Z A;  1G3I A;  2QBY B;  2G3Q A;  1IXS B;  2LXE A;  4IBB A;  1DGF A;  2JY7 A;  1Y8G A;  2L4F A;  3CF0 A;  4DV7 M;  1XMQ M;  1IY1 A;  4JXJ A;  4Z8X A;  2DHR A;  5ITT A;  4DV3 M;  4GKJ M;  3VKH A;  2WSC F;  3SYL A;  3L28 A;  4F1I A;  2R45 A;  4DR6 M;  4FCV A;  3SBJ A;  2VF7 A;  1Q3B A;  2EO2 A;  4QNM A;  1Q39 A;  3I4Y A;  1Z5A A;  3B89 A;  4XBO A;  2JXN A;  3PXG A;  1GAB A;  1V34 A;  1VDD A;  2G5G X;  3KFU G;  4F2L A;  1K82 A;  2VII A;  2L6O A;  2R18 A;  2L7H A;  3B7N A;  2DAK A;  1GJT A;  4MB7 A;  5DFL A;  2VDB B;  5KPT A;  3U6Q A;  5FTK A;  4JYA M;  3A98 B;  4CJ6 A;  3T15 A;  1HNX M;  1ZQ9 A;  2D7G A;  3FYC A;  4DR4 M;  3PNV A;  4LF8 M;  2ZAN A;  1X37 A;  4B7H A;  2L2D A;  3J81 S;  3GRU A;  3L25 A;  2QHO B;  4DR2 M;  2I7P A;  2EKK A;  2XSZ A;  1PJS A;  1YSY A;  2O01 F;  1WJ7 A;  2BJV A;  2HAK A;  3SHG B;  1EFU B;  1ZMU A;  3EIH A;  4XGI A;  2OPF A;  1V33 A;  5F3W A;  1NNJ A;  3CF2 A;  1DGB A;  5ITR A;  4DUY M;  2RKO A;  4IBJ A;  4TUW A;  3A42 A;  4OVZ A;  1JR3 D;  3MMP A;  2V1U A;  3GLF E;  3K8Z A;  3KSJ A;  3B7Z A;  3HHY A;  5BPV A;  2ZAM A;  1WHC A;  3IG5 A;  2F5N A;  1IQP A;  2UUA M;  3HJ8 A;  1Z5C A;  3NBI A;  4DV2 M;  1IN4 A;  3T1Y M;  1SXJ C;  3GRR A;  2C9C A;  3I04 M;  1HNZ M;  3VK8 A;  5LMN M;  5DYG A;  1OJL A;  1QAQ A;  5FTM A;  3UJN A;  2DI0 A;  3FTC A;  4DV1 M;  4JI1 M;  3HHX A;  1PJQ A;  3L29 A;  2Y21 A;  1WXQ A;  4AW4 A;  3GLI E;  1K3X A;  1Z6T A;  4IBK A;  3UZU A;  2CRU A;  4HEO A;  3KSX A;  2HWJ A;  3L27 A;  3C3E A;  1JR3 E;  1NVM A;  2QP9 X;  2ZTD A;  4M9S A;  1IFY A;  3AV0 A;  2MRO B;  3QYE A;  3FUW A;  1GL7 A;  4DV0 M;  1IY0 A;  1ZV1 A;  2LVN C;  2O5R A;  4GIP A;  3BXW A;  1IBL M;  2G8L A;  2JWS A;  2XF3 A;  2L7I A;  2Y0T A;  1MU5 A;  2H1R A;  2X4A A;  1JQJ C;  1NSF A;  5IZ7 D;  3TPZ A;  2EUC A;  3E4R A;  2X49 A;  1L2D A;  4LJ6 A;  2J7O A;  2UXB M;  4BBA A;  4L78 A;  5C1B A;  3U6E A;  2DVW B;  3GO8 A;  1G59 A;  4S12 A;  2Q2E B;  2ZTC A;  5EP1 A;  2J5Y A;  4MGH A;  4IJE A; 
#chains in the Genus database with same CATH homology
 4NOO B;  4MGK E;  2KA6 B;  4FWH A;  4LCB A;  3LVV A;  5BR8 M;  3A46 A;  4LFB M;  3W0L B;  3CTW B;  3GQ3 A;  3FUT A;  2F5Q A;  2HL7 A;  2XZU A;  4EIW A;  3KW6 A;  4LF7 M;  3K92 A;  4X66 M;  1FNN A;  1W5T A;  2HCB A;  1E32 A;  1GLN A;  3RGP A;  1R6B X;  4IJF A;  3LQR A;  4NXM M;  1G41 A;  4RF0 A;  4GH9 A;  3UK6 A;  3SAV A;  3AL0 C;  3R9X B;  3CF6 E;  1TGU A;  3MJ5 A;  2DXI A;  1SXJ A;  3GPY A;  3KDS E;  1HQC A;  3U6C A;  3IG8 A;  4L8R C;  3HHZ A;  1GKI A;  2M60 A;  3DOA A;  2C99 A;  3FUV A;  3TWM A;  3WHL A;  3GPP A;  3GLH A;  3RGS A;  2Z3X A;  1L2C A;  1XMO M;  3U5Z B;  3M6A A;  3FYD A;  3ZC7 B;  1IXR C;  2X8A A;  3FD9 A;  1G8P A;  2DWZ B;  5EXS A;  3AKZ A;  4FWD A;  2DZO B;  3GQ4 A;  3AOE C;  3VDU A;  3VLF B;  2J7N A;  4B08 A;  3VK7 A;  3SAW A;  2Z7J A;  3U6O A;  1IN5 A;  3RFW A;  3HGI A;  2XLJ A;  5EP3 A;  1XXH A;  1NNU C;  3GLG A;  2DWM A;  2LNH C;  1NY6 A;  1XNR M;  1HT1 E;  3W0F A;  5FLX S;  3HU2 A;  3KXE C;  5DNY A;  3M0E A;  4DV5 M;  2KZU A;  2CV0 A;  4M0W A;  2XFS A;  4OX9 M;  1TH4 A;  3ZCB B;  4LJ7 A;  5DYI A;  3LQQ A;  2R62 A;  1Z5B A;  1PM5 A;  4QHS A;  4IIW A;  4X62 M;  5LMU M;  4IBD A;  1I94 M;  5EQT A;  4LRT A;  2W82 A;  4MGY E;  4D81 A;  5KQ8 A;  3I4V A;  2D7E A;  4LJ9 A;  1TH3 A;  4B3S M;  3GRY A;  4II7 A;  3GPX A;  4KO8 A;  5ITX E;  3TL4 X;  4B3M M;  1S3S A;  2C5R A;  4JI8 M;  4LF6 M;  5ITU A;  3SYK A;  4FWG A;  1NHG C;  1N75 A;  3U6L A;  4IBC A;  3DZD A;  1YE9 A;  4I81 A;  2YR0 A;  4QHT A;  4B7G A;  2VQF M;  3PVS A;  3ILK A;  1IBK M;  4JV5 M;  4OVZ B;  1J09 A;  2F5S A;  4L15 A;  4G4Q A;  1QAO A;  4FD2 A;  2KW0 A;  1DO0 A;  2K47 A;  4X64 M;  2ZBK B;  2BNK A;  4DUZ M;  4GIT A;  3SAT A;  5KPZ A;  4RF1 A;  4AG5 A;  4R7G A;  4Z6Y A;  1NY5 A;  2NQ8 C;  2Z4R A;  4B7F A;  3J27 B;  1N33 M;  3SMP A;  4DR7 M;  3AOE A;  4PT5 A;  4NRV A;  3GLF A;  3HHW A;  4LJ4 A;  2R46 A;  3KP1 E;  2FOI C;  4CGY B;  3TWL A;  3J7B A;  5GKN A;  4GC9 A;  3HJQ A;  4GRI A;  2HKJ A;  2CEA A;  5IT9 S;  2DZN B;  3VFD A;  3TWK A;  5JI3 E;  4AQY M;  3I51 A;  1IN7 A;  4NSR A;  2YQZ A;  3J7A S;  4HLQ A;  4REZ A;  4AKG A;  1PJJ A;  4NRW A;  1JR3 A;  2RGH A;  3U6P A;  1TDZ A;  1L1Z A;  2ERC A;  1ORY B;  2KEB A;  1KFV A;  4PDG A;  4LFC M;  2R65 A;  2CUZ A;  2CE7 A;  3QAU A;  3PFI A;  1XNQ M;  2CFO A;  5FSW A;  4JN6 A;  2KZS A;  4LJA A;  5EP2 A;  4BB9 A;  4PDI A;  4FVM A;  4LZZ A;  1QAM A;  1T3T A;  1K3W A;  1N78 A;  2C98 A;  3MK6 A;  4LFA M;  2FFJ A;  3C58 A;  4LRS A;  2EA0 A;  3FUX A;  4BLC A;  2CV1 A;  3L26 A;  3SHF A;  4WUR A;  1HNW M;  1MX0 A;  2FE8 A;  3LVW A;  3Q8X A;  1DO2 A;  4AKI A;  2I7N A;  2XEP A;  1UM8 A;  1OFI A;  2V6Z M;  3GQ5 A;  4B3T M;  4PD2 A;  3KOZ E;  3MHV C;  1ZAE A;  4M9X A;  5ITY A;  4LJ5 A;  3KOY E;  4NXN M;  2UUB M;  4IBF A;  1SXJ B;  3U60 A;  1N77 A;  1NJF A;  4D80 A;  5EXX A;  4QOS A;  1L1T A;  5KPR A;  4G4O A;  1L2B A;  4JI2 M;  2XGN A;  2R4E A;  4DR3 M;  2QPA A;  3PNY A;  3THG A;  1KYI A;  3GLH B;  4FCT A;  2XSZ D;  3HU1 A;  4HL4 A;  3T1H M;  5C18 A;  3LMM A;  4MH0 E;  5FTJ A;  1QZM A;  4YHH M;  2F5P A;  1H6U A;  2QCU A;  2RGO A;  2JA2 A;  4R3D A;  4CIS A;  3HWS A;  5A2Q S;  4NL4 H;  3UMM A;  3HJS A;  2A5Y B;  2QBY A;  4KLN A;  5JI2 E;  4DV4 M;  2CV2 A;  5FTN A;  1XXH B;  3GLG B;  4LGM A;  1LV7 A;  2UU9 M;  3KS4 A;  3FUU A;  3GRV A;  3M7G A;  4LJ8 A;  4LF4 M;  3JAM S;  5H37 D;  1IY2 A;  2QEN A;  4LG2 A;  4L16 A;  3A45 A;  4M0D A;  3VDP A;  3SAU A;  1D2N A;  3ZH9 B;  1I4W A;  4B3R M;  4AI6 A;  4YY3 M;  4AKH A;  3GP1 A;  3NWL A;  1L8Q A;  2KRK A;  4OU7 A;  3HU3 A;  3AFH A;  7CAT A;  3AJI B;  1FJG M;  2HHH M;  3K2L A;  4CHT B;  2XH9 A;  2ZAO A;  4D82 A;  2AHM A;  1GL6 A;  2OQ4 A;  2QZ4 A;  5EXT A;  1R7R A;  1IBM M;  4I4L A;  1G4A E;  4I5S A;  3U6D A;  3U61 A;  2LWX A;  4WW0 A;  2D7H A;  3H4M A;  1E9S A;  3E9S A;  4I8O A;  4LY6 A;  5EXP A;  4AG6 A;  2F5O A;  2XZF A;  4JI4 M;  3KS8 A;  2UXC M;  3U61 B;  3DFZ A;  4JI3 M;  1R2Y A;  4W5W A;  2Y0Q A;  3SFZ A;  1XC8 A;  5ITX A;  1QVR A;  5IWA M;  2ZM6 M;  3OTO M;  2F4V M;  3B9P A;  1IM2 A;  1TDH A;  1YUB A;  1E9R A;  3U6S A;  1J7K A;  3BOS A;  5EJC A;  1DGH A;  3L2A A;  2FNA A;  1Q3C A;  2Y20 A;  3KOX E;  5EP4 A;  1HR0 M;  2E5L M;  1TH2 A;  1XHB A;  2YNM D;  1N32 M;  2Z4S A;  5E6J A;  1KSF X;  2CHV A;  3UGJ A;  1DGH B;  3KOW E;  4G6Z A;  3GLF B;  2L09 A;  3KVW A;  3TQS A;  3JR5 A;  1XWI A;  4M9Z A;  4PCZ A;  4JI0 M;  2CHQ A;  4IBI A;  1HQY E;  5FTL A;  3FTD A;  4L4U A;  2KRU A;  3T38 A;  3FTF A;  1W5S A;  3DA1 A;  3KP0 E;  4OW0 A;  4JI6 M;  1SXJ D;  3SMS A;  2R4J A;  3GLI A;  1C1K A;  1OFH A;  1HT2 E;  1NJG A;  2C96 A;  4G4R A;  3RE8 A;  5IRE B;  8CAT A;  4GHL A;  1IN6 A;  5E26 A;  1QYR A;  2DWN A;  3U6M A;  3GLI B;  4MM3 B;  3AOG A;  4NSO B;  3VKG A;  4KOD A;  4GKK M;  1QAN A;  3SC3 A;  4JI5 M;  3D8L A;  4GC5 A;  2VQE M;  4AZF A;  3J2P B;  2YFQ A;  4LZJ A;  3GPU A;  3J80 S;  4DV6 M;  1N36 M;  1E94 E;  1SXJ E;  1EE8 A;  4G4N A;  2BJW A;  1IN8 A;  2V1C A;  5KO3 A;  3K1J A;  1NHW C;  2KXE A;  4DR5 M;  4KHP M;  4MGZ E;  4A3V B;  4DR1 M;  2XFT A;  4MGI E;  1Z59 A;  1GVN A;  5KQD A;  3R8F A;  2UUC M;  3SAR A;  1IXZ A;  1QQW A;  2P5T A;  4IBE A;  2DWL A;  4P16 A;  4ITQ A;  1DGG A;  4K0K M;  4QNR A;  4QOZ C;  4JI7 M;  3U60 B;  3QWL A;  4LGY A;  3WHK A;  5ITQ A;  3D8B A;  4FW9 A;  3FTE A;  1N34 M;  4LF5 M;  2LH0 A;  3JR4 A;  3FKE A;  2UXD M;  3EIE A;  3TE6 A;  4IBG A;  4X65 M;  2M5Z A;  3U5Z A;  4FCW A;  4RNA A;  3HKP A;  1PJI A;  2C9O A;  2CHG A;  4ZPX A;  4GMQ A;  1R2Z A;  1G3I A;  2QBY B;  1IXS B;  2LXE A;  4IBB A;  1DGF A;  3CF0 A;  4DV7 M;  1XMQ M;  1IY1 A;  4JXJ A;  4Z8X A;  2DHR A;  5ITT A;  4DV3 M;  4GKJ M;  3VKH A;  3SYL A;  3L28 A;  2R45 A;  4DR6 M;  4FCV A;  3SBJ A;  1Q3B A;  2EO2 A;  4QNM A;  1Q39 A;  3I4Y A;  1Z5A A;  4XBO A;  3PXG A;  1VDD A;  2G5G X;  3KFU G;  1K82 A;  2VII A;  2L6O A;  2R18 A;  2L7H A;  5KPT A;  4LF9 M;  4MB7 A;  4GHA A;  3U6Q A;  5FTK A;  4JYA M;  3A98 B;  3T15 A;  1HNX M;  1ZQ9 A;  2D7G A;  3FYC A;  4DR4 M;  3PNV A;  4LF8 M;  2ZAN A;  1X37 A;  4B7H A;  3J81 S;  3GRU A;  3L25 A;  4DR2 M;  2I7P A;  2XSZ A;  1YSY A;  2BJV A;  3SHG B;  3EIH A;  4XGI A;  2OPF A;  5F3W A;  1NNJ A;  3CF2 A;  1DGB A;  5ITR A;  4DUY M;  2RKO A;  4IBJ A;  4TUW A;  3A42 A;  4OVZ A;  1JR3 D;  2V1U A;  3K8Z A;  3KSJ A;  3HHY A;  5BPV A;  2ZAM A;  3IG5 A;  2F5N A;  2UUA M;  1IQP A;  3HJ8 A;  1Z5C A;  3NBI A;  4DV2 M;  1IN4 A;  3T1Y M;  1SXJ C;  3GRR A;  2C9C A;  1HNZ M;  3VK8 A;  5LMN M;  5DYG A;  1OJL A;  1QAQ A;  5FTM A;  3UJN A;  3FTC A;  4DV1 M;  4JI1 M;  3HHX A;  3L29 A;  2Y21 A;  1WXQ A;  4AW4 A;  1K3X A;  1Z6T A;  4IBK A;  3UZU A;  3KSX A;  3L27 A;  4M9S A;  1NVM A;  2QP9 X;  3AV0 A;  3FUW A;  1GL7 A;  4DV0 M;  1IY0 A;  2O5R A;  4GIP A;  1IBL M;  2G8L A;  2XF3 A;  2Y0T A;  2L7I A;  1MU5 A;  2H1R A;  2X4A A;  1JQJ C;  1NSF A;  5IZ7 D;  3TPZ A;  2EUC A;  3E4R A;  2X49 A;  1L2D A;  4LJ6 A;  2J7O A;  2UXB M;  4BBA A;  4L78 A;  5C1B A;  3U6E A;  2DVW B;  3GO8 A;  1G59 A;  4S12 A;  2Q2E B;  1J5E M;  5EP1 A;  3SAS A;  4MGH A;  4IJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...