5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
4OX9M 4JV5M 4JI6M 5ITYA 3DOAA 3GO8A 3JR4A 4G4RA 1HNWM 3TWKA 4LF5M 3GPYA 3U6OA 4DR3M 3W0FA 4DR6M 4K0KM 1Z5CA 4JI1M 1N34M 1K82A 4NRVA 3GPUA 4DV2M 3J80S 4DV3M 2F5NA 4DUYM 1L2BA 1IBLM 2UXDM 4G4NA 4PD2A 3GP1A 4JI8M 4PDIA 4YY3M 1Z5BA 4ITQA 3JAMS 4LFAM 4X66M 4DV6M 4B3MM 3SBJA 3T1YM 4GKJM 4DR4M 4KHPM 3A42A 1Q3CA 2XZUA 1N36M 5ITXA 5LMNM 3A46A 5IWAM 5ITXE 4X64M 3GQ4A 1PM5A 1K3WA 2F5PA 1K3XA 2HKJA 3U6QA 4G4QA 3T1HM 4DUZM 4LF9M 1N33M 1N32M 3GPPA 3GQ3A 2HHHM 4JI4M 1HNZM 1NNJA 1XMQM 5ITRA 5ITTA 1IBKM 5IT9S 3GQ5A 3TWLA 1R2ZA 2F4VM 3SASA 5FLXS 1XNQM 3SAVA 4LF6M 2XZFA 1HNXM 2OPFA 4CISA 4DV0M 4B3TM 1HR0M 2ZBKB 3VK8A 3SAWA 1I94M 3VK7A 3U6PA 1PJIA 1Z59A 1IBMM 2UUBM 4MB7A 3U6SA 4B3SM 4JI7M 4NRWA 2F5OA 4JI0M 3U6LA 4LF7M 4GKKM 3U6CA 1EE8A 4DV4M 4DV5M 2UXBM 1Q39A 1KFVA 4DR5M 4LF4M 3U6MA 1MU5A 3SAUA 2ZM6M 1TDZA 2E5LM 4LFCM 4NXMM 3U6EA 5ITUA 2UXCM 5A2QS 4NXNM 1J5EM 2UU9M 4G4OA 1Z5AA 3A45A 1FJGM 1XMOM 4JYAM 4JI3M 3JR5A 1L2DA 4B3RM 4X65M 4JI2M 2UUAM 2UUCM 4DR7M 4LFBM 1L1TA 1MX0A 4DV1M 3C58A 3OTOM 3J7AS 3U6DA 1PJJA 3TWMA 1R2YA 5ITQA 2Q2EB 4DV7M 1TDHA 4X62M 5BR8M 4PCZA 2F5SA 1L1ZA 3SARA 3GPXA 4PDGA 2F5QA 2VQEM 1XNRM 4DR2M 5LMUM 1XC8A 3SATA 4YHHM 1Q3BA 3J81S 2OQ4A 4AQYM 1L2CA 4JI5M 2VQFM 4DR1M 4LF8M 2EA0A
chains in the Genus database with same CATH superfamily
4HL4A 1PGYA 1VEJA 1W5TA 3FTEA 3DOAA 4GC9A 4G4RA 3NBXX 5EXSA 4QHTA 2DNAA 2K47A 2ZTDA 4KLNA 2GNOA 2XFSA 4DR3M 4JI1M 1GABA 2L4FA 1NJFA 4NRVA 1QAMA 2DWLA 3FTCA 4P17A 3J80S 5EXPA 2JP7A 4DV3M 4EIWA 1SXJE 3GLFA 2R62A 3TL4X 2UXDM 3LQQA 1XXHB 4KO8A 1JR3E 4PDIA 1XXHA 4G3OA 1QUTA 1OFIA 4P16A 4B3MM 4DV6M 3GLGB 1YE9A 4GC5A 1HT2E 4XBOA 3GLIE 4KHPM 5ITXA 5LMNM 2CFOA 3H4MA 4S12A 5IREB 1EIJA 4IJFA 2JY7A 2R4JA 4M0DA 4OW0A 2LXEA 1K3WA 1K3XA 2Y21A 5IZ7D 4RNAA 3K92A 3EIHA 3GPPA 3AFHA 2HHHM 4QHSA 3KOWE 5C18A 1ZQ9A 1OKSA 3KSXA 3FRHA 2CWBA 2L7IA 3T6PA 3E9SA 2DWZB 2APLA 3L29A 2K6BA 2O25A 1T3TA 2OPFA 1QANA 2L7HA 2ZANA 3QYBA 4GH9A 2Y0TA 5FTNA 2K9DA 2L2DA 2V6ZM 4R7GA 4HEOA 2CHQA 4B3SM 1Z59A 2W82A 2LH0A 1IM2A 2LVNC 1HQCA 3FUVA 3HU2A 3RGPA 3K2LA 4MH0E 3U6LA 2QBYB 2J5YA 2WSEF 3FE3A 2EO2A 3WHLA 3U6CA 2QBYA 1EE8A 1YUBA 2ZAMA 1BVSA 3WHKA 3V76A 1J7KA 2AHMA 1VG5A 1QQWA 2C5RA 1MN3A 2RRUA 1L8QA 3U6MA 3B89A 1MU5A 2LBCA 5FTKA 2CV2A 2ZAOA 3DFZA 5EXTA 4G6ZA 4CJ6A 2KNZA 5ITUA 1G41A 4XK8F 2FH0A 3IG8A 5A2QS 1V33A 2QP9X 2R6FA 2WSCF 1X37A 5DNYA 4NXNM 5C1BA 1GL7A 3L25A 1HQYE 3T15A 1UFZA 3HWSA 3A45A 2V1CA 4B08A 3JR5A 2J7NA 1L2DA 4FCVA 1XB2B 2XH9A 3SC3A 3J27B 4LGMA 4LFBM 3FTDA 3ZC7B 3FTFA 2CUZA 3UK6A 4NSOB 4DR7M 3W67A 1GVNA 1MX0A 4IBEA 1TTEA 2FNAA 2Z7JA 3L2AA 4NC6A 4DV1M 5EP2A 1P3QQ 2QQ8A 4GRIA 4BBAA 3OTOM 1R4GA 3U6DA 5E26A 1NNUC 1PJJA 2CHVA 4A3VB 2LVOC 4QOSA 3TWMA 5JI2E 1R2YA 2MROB 3D8LA 5EXXA 4X62M 5GKNA 2QNJA 1I4WA 4AG6A 2X4AA 1GLNA 4F1IA 2JZ1A 3CF6E 1DGGA 1H6UA 1XNRM 3K8ZA 5E6JA 1WGLA 2DWMA 5EP3A 2R45A 3SATA 2OQ4A 1Q3BA 4JI5M 1OAOC 1DGFA 2VQFM 4K0KM 4FWHA 3UZUA 2EA0A 1OQYA 1V34A 4OVZB 4ANRA 1VEGA 1QDTA 3Q8GA 4KT0F 1TH3A 2R46A 4LJ9A 4OVZA 4JI6M 3VLFB 4L6V6 1E9SA 2A5YB 3DA1A 1D2NA 1FNNA 3AV0A 3FYCA 1HNWM 4LF5M 2JY5A 1XWIA 3FUUA 4LRTA 4L16A 5BPVA 3U6OA 2L09A 4DR6M 3VKGA 3J2PB 1NHWC 1K82A 2K0BX 4FVMA 2YFQA 3GPUA 3KS8A 4IBGA 2JA2A 4FWGA 4DUYM 2OOBA 2F5NA 3M0EA 1EFUB 3SFZA 1IBLM 4G4NA 4F2LA 1G3IA 3GP1A 2MGWA 2O5RA 4JI8M 3GLFE 2DHYA 4QNMA 1WXQA 3PVSA 4AZFA 1Z5BA 4I8OA 4YY3M 2QHOB 2KEBA 4AW4A 3JAMS 4X66M 1XXHE 3E46A 8CATA 4GKJM 2XEPA 1N36M 5EJCA 2XLJA 2XZUA 2JY6B 1QZMA 3BXWA 2KNVA 3VDUA 5ITXE 4LJ5A 4X64M 1G59A 4UN2B 1TGUA 2F5PA 1GL6A 2VF7A 3TPZA 4AKGA 2FE8A 2QCUA 2D7EA 1IN4A 3GRYA 4L4UA 3TWLA 3GQ5A 2DHRA 3KP0E 2EUCA 3E21A 1E94E 1J09A 2X8AA 2HAKA 2OO9A 1D0KA 1OIZA 2CRUA 1HT1E 1MJGM 3C3EA 4MGKE 1D0MA 1N75A 2KHHA 1YSYA 4LRSA 3GLGA 4HLQA 4FCTA 3IG5A 2C98A 4QNRA 3U6PA 3VK7A 2BJWA 1PJIA 1IBMM 4JI7M 5EP4A 4L8RC 4LG2A 4NRWA 2C99A 3HJ8A 4QOZC 3PNVA 2C96A 1VEKA 4CHTB 4CIZA 1Q39A 1VDDA 4I4LA 1T6OA 3LVVA 1TDZA 2ZM6M 2Y0QA 1IQPA 2G3QA 3FKEA 2ERCA 4IJEA 2UXCM 3HU1A 1D0LA 1J5EM 3GRRA 1QAOA 4LJAA 1Y8GA 4G4OA 2OOAA 2R44A 1AIPC 1E32A 3ZQJA 3CF0A 1XMOM 1WGNA 1GKIA 2WZJA 3I4YA 3HHZA 2KNAA 3PFIA 4AG5A 2UUCM 1ZAEA 1DO0A 2L6OA 1IXSB 2NQ8C 3KOXE 1IXSA 1SXJB 3LMMA 1QAQA 2H1RA 2LVQD 3KOYE 2JXNA 4FCWA 4LCBA 1SXJA 4NSRA 1RU3A 1ZMVA 2CE7A 2DWNA 4JN6A 2Q2EB 2G8LA 1TDHA 2Z4RA 1JR3A 3TE6A 4GIPA 3GLIB 3U61B 1R6BX 2LWXA 3U61A 3LW5F 2F5QA 4I81A 1G4AE 3HHWA 3J7BA 4LJ6A 2J7OA 1WHCA 1XC8A 3HU3A 3K9PA 2O01F 2DAGA 4YHHM 2CEAA 2Y20A 2MJ5B 1IXZA 5F3WA 4NOOB 2I7NA 1W5SA 4OX9M 3M7GA 1TR8A 2R65A 2KZSA 2Z3XA 5FTJA 4IIWA 2KRKA 1GJTA 3JR4A 4IBJA 3GO8A 4Z6YA 1JQJC 3GLHB 2M60A 3GPYA 4AKIA 3HJQA 3GLHA 3CF2A 2C9OA 2VF8A 3W0FA 1Z5CA 1T43A 3B7ZA 3FUTA 4M9ZA 3PNYA 5H37D 3UGJA 2YQZA 4XGIA 3SHFA 1ZV1A 2FFJA 2WSFF 5FTMA 1IN5A 2QZ4A 3H4JA 4PD2A 3AKZA 2MR9A 4REZA 1NO1A 2EKKA 2M5ZA 5DYIA 3KFUG 1GO5A 3I51A 4LFAM 3B74A 1WIVA 5KPZA 3I01M 2KW0A 3U5ZB 3A42A 1Q3CA 2BJVA 2BNKA 2XF3A 4IBIA 4IBDA 2JWSA 4LJ8A 3PXGA 4BLCA 1OAIA 4LGYA 3B7NA 2XSZD 4WP2A 1TH2A 3HHYA 5FSWA 3L26A 4Z8XA 1C7YA 3GRVA 4G4QA 1PJQA 3RGSA 4B7FA 4LF9M 3HJSA 2YNMD 1N32M 4JI4M 4FD2A 1Q02A 1QUSA 1NNJA 1XMQM 3L27A 5JI3E 1HNZM 2DI0A 5ITRA 3QYEA 3LQRA 1IBKM 5KO3A 5IT9S 2RGHA 4LZZA 1R2ZA 3VFDA 1AUAA 5FLXS 1XNQM 1SG9A 3K1JA 1IFYA 5DYGA 2EJSA 2JNHA 3LCUA 4ZPXA 4LZJA 4CISA 1NSFA 3R9XB 4DV0M 3LVWA 1HR0M 3D8BA 2BWEA 1ZMUA 2ZBKB 4GHLA 3MHVC 3KW6A 2CV0A 3SAWA 3CGWA 1I94M 1Z6TA 3FD9A 4M9XA 4L78A 3GLGE 2UUBM 1DV0A 1QDRA 4MB7A 5KQ8A 3U6SA 2RKOA 2XGNA 2F5OA 3F92A 2FS1A 4GKKM 1OTRA 1E9RA 3SMSA 1G8PA 1LV7A 4MM3B 1CUKA 3TQSA 4DV4M 1OJLA 1SXJD 3AOEA 4DV5M 3I4VA 5L8RF 3KSJA 2UXBM 1KFVA 1JR3D 4M9SA 1QZEA 4I5SA 1TH4A 1R5LA 4IBKA 4L15A 2B3TA 1JB0F 4KODA 3A98B 3SMPA 2D7HA 1HJPA 2VDBB 2YR0A 2CV1A 3U6EA 4FWDA 4IBBA 4RKUF 1IN6A 4LJ7A 3C3DA 1DGHB 7CATA 1DGHA 4B7GA 1KSFX 2N35A 1IY0A 3KOZE 4B3RM 4X65M 2LHGA 2Z8YM 3RFWA 2XSZA 2UUAM 5KPTA 2JUJA 4MGZE 1TF0B 1A5TA 3AOGA 1L1TA 1VQ1A 4LJ4A 3FUXA 3GLFB 2FOIC 4BB9A 5ITQA 4DV7M 3KS4A 5BR8M 4Q7JA 4II7A 2JY8A 3QWLA 4D82A 5FTLA 4PCZA 2H5XA 2BWBA 3HGIA 3FYDA 4AKHA 3FRIA 3SYLA 1GJSA 1SXJC 4RF1A 4PDGA 4OU7A 2VQEM 3C9PA 3R8FA 3QAUA 4MGYE 4AQYM 3BOSA 3HX3A 4LFCM 3HHXA 4R71A 3MMPA 3VDPA 2DXIA 3KP1E 3W0LB 4JV5M 2G5GX 4Y28F 2ZTCA 2QPAA 5ITYA 2DAIA 3U60B 2VIIA 1NY5A 1F4IA 3U60A 3TWKA 4B7HA 2KXEA 2LTUA 2P5TA 1XHBA 1N34M 3THGA 3GLHE 1V92A 2LHCA 4DV2M 1C1KA 1L2BA 1QYRA 1NHGC 2LVAA 1G71A 1LTMA 2GQFA 4MGHA 2DZLA 1NY6A 3GLIA 4ITQA 1WJ7A 3ZH9B 3SBJA 3T1YM 1UM8A 4DR4M 2DVWB 4FW9A 2DKLA 2RGOA 1R7RA 3M6AA 4M0WA 3A46A 4PT5A 3SYKA 5IWAM 1DO2A 3SHGB 5KPRA 3GQ4A 1PM5A 4IBCA 2HKJA 3U6QA 4TUWA 3T1HM 4DUZM 2DAMA 1IXRC 1N33M 2MH8A 3HY5A 3GQ3A 4DBGB 4R3DA 1IY1A 4CGYB 5ITTA 1VDLA 2QENA 3LCVB 3ZCBB 2F4VM 3SASA 2CHGA 2EKFA 3SAVA 4LF6M 2XZFA 1HNXM 2DZNB 1NV9A 3B9PA 5KQDA 4B3TM 4GITA 1OIPA 2I7PA 3DZDA 1ORYB 1IY2A 3HKPA 3IECA 2LNHC 3CTWB 3VK8A 3U5ZA 4W5WA 2LVPC 3BBZA 2L4EA 2JZ0A 4JI0M 4LF7M 4MGIE 2DAKA 1PJTA 5EQTA 1N78A 3B7QA 1KYIA 3NBIA 4GMQA 4IBFA 4JXJA 4LY6A 1DGBA 2X49A 2XFTA 2Z4SA 2HL7A 2HWJA 1YLAA 3EIEA 4DR5M 4LF4M 2C9CA 3T38A 2KZUA 1QVRA 2QSFX 1NVMA 1IN7A 3I04M 1PRBA 1PJSA 3SAUA 2E5LM 1ZMWA 3AOEC 1WR1B 4NXMM 3KDSE 4NL4H 4WW0A 3VKHA 3FUWA 1S3SA 2KRUA 4GHAA 3UJNA 5DFLA 4D81A 3W68A 2UU9M 1Z5AA 1FJGM 3GRUA 3KXEC 4JYAM 3NWLA 4JI3M 4JI2M 2KDLA 2KA6B 2HCBA 4AI6A 3MJ5A 2CP8A 3RE8A 2DENA 2D7GA 3K9OA 3Q8XA 1NV8A 3E4RA 1OFHA 3C58A 3J7AS 1IN8A 2R0IA 1N77A 4WURA 1NJGA 3ILKA 3KVWA 4D80A 2F5SA 1L1ZA 3UMMA 2DAEA 3MK6A 2V1UA 3SARA 5EP1A 3GPXA 3AL0C 2R18A 4RF0A 4DR2M 5LMUM 3HZJA 2DZOB 3AJIB 3J81S 2R4EA 4GEWA 1L2CA 3L28A 4DR1M 3IHPA 4LF8M
chains in the Genus database with same CATH topology
4HL4A 1W5TA 3FTEA 3DOAA 4GC9A 4G4RA 5EXSA 4QHTA 2K47A 4KLNA 2XFSA 4DR3M 4JI1M 1NJFA 4NRVA 1QAMA 2DWLA 3FTCA 3J80S 5EXPA 4DV3M 4EIWA 1SXJE 3GLFA 2R62A 3TL4X 2UXDM 3LQQA 1XXHB 4KO8A 4PDIA 1XXHA 1OFIA 4P16A 4B3MM 4DV6M 3GLGB 1YE9A 4GC5A 1HT2E 4XBOA 4KHPM 5ITXA 5LMNM 2CFOA 3H4MA 4S12A 5IREB 4IJFA 2R4JA 4M0DA 4OW0A 2LXEA 1K3WA 1K3XA 2Y21A 5IZ7D 4RNAA 3K92A 3EIHA 3GPPA 3AFHA 2HHHM 4QHSA 3KOWE 5C18A 1ZQ9A 3KSXA 2L7IA 3E9SA 2DWZB 3L29A 2OPFA 1T3TA 1QANA 2L7HA 2ZANA 4GH9A 2Y0TA 5FTNA 2V6ZM 4R7GA 2CHQA 4B3SM 1Z59A 2W82A 2LH0A 1IM2A 3FUVA 1HQCA 3HU2A 3RGPA 3K2LA 4MH0E 3U6LA 2QBYB 3WHLA 2EO2A 3U6CA 2QBYA 1EE8A 1YUBA 2ZAMA 3WHKA 1J7KA 2AHMA 1QQWA 2C5RA 1L8QA 3U6MA 1MU5A 5FTKA 2CV2A 2ZAOA 3DFZA 5EXTA 4G6ZA 5ITUA 1G41A 3IG8A 5A2QS 2QP9X 3L25A 1X37A 5DNYA 4NXNM 5C1BA 1GL7A 1HQYE 3T15A 3HWSA 3A45A 2V1CA 4B08A 3JR5A 2J7NA 1L2DA 4FCVA 2XH9A 3SC3A 3J27B 4LGMA 4LFBM 3FTDA 3ZC7B 3FTFA 2CUZA 3UK6A 4NSOB 4DR7M 1GVNA 1MX0A 4IBEA 2FNAA 2Z7JA 3L2AA 4DV1M 5EP2A 4GRIA 4BBAA 3OTOM 3U6DA 5E26A 1NNUC 1PJJA 2CHVA 4A3VB 3TWMA 4QOSA 1R2YA 5JI2E 3D8LA 5EXXA 4X62M 5GKNA 4AG6A 1I4WA 2X4AA 1GLNA 3CF6E 1DGGA 1H6UA 1XNRM 3K8ZA 5E6JA 2DWMA 5EP3A 2R45A 3SATA 2OQ4A 1Q3BA 4JI5M 1DGFA 2VQFM 4K0KM 4FWHA 3UZUA 2EA0A 4OVZB 1TH3A 2R46A 4LJ9A 4OVZA 4JI6M 3VLFB 1E9SA 2A5YB 3DA1A 1D2NA 1FNNA 3AV0A 3FYCA 1HNWM 4LF5M 1XWIA 3FUUA 4LRTA 4L16A 5BPVA 3U6OA 2L09A 4DR6M 3VKGA 3J2PB 1NHWC 1K82A 4FVMA 2YFQA 3GPUA 3KS8A 4IBGA 2JA2A 4FWGA 4DUYM 2F5NA 3M0EA 3SFZA 1IBLM 4G4NA 1G3IA 3GP1A 2O5RA 4JI8M 4QNMA 1WXQA 3PVSA 4AZFA 1Z5BA 4I8OA 4YY3M 2KEBA 4AW4A 3JAMS 4X66M 8CATA 4GKJM 2XEPA 1N36M 5EJCA 2XLJA 2XZUA 1QZMA 3VDUA 5ITXE 4LJ5A 4X64M 1G59A 2F5PA 1TGUA 1GL6A 3TPZA 4AKGA 2FE8A 2QCUA 2D7EA 1IN4A 3GRYA 4L4UA 3TWLA 3GQ5A 2DHRA 3KP0E 2EUCA 1E94E 1J09A 2X8AA 1HT1E 4MGKE 1N75A 1YSYA 4LRSA 3GLGA 4HLQA 4FCTA 3IG5A 2C98A 4QNRA 3U6PA 3VK7A 2BJWA 1PJIA 1IBMM 4JI7M 5EP4A 4L8RC 4LG2A 4NRWA 2C99A 3HJ8A 4QOZC 3PNVA 2C96A 4CHTB 1Q39A 1VDDA 4I4LA 3LVVA 1TDZA 2ZM6M 2Y0QA 1IQPA 3FKEA 2ERCA 4IJEA 2UXCM 3HU1A 1J5EM 3GRRA 1QAOA 4LJAA 4G4OA 1E32A 3CF0A 1XMOM 1GKIA 3I4YA 3HHZA 3PFIA 4AG5A 2UUCM 1ZAEA 1DO0A 2L6OA 1IXSB 2NQ8C 3KOXE 1SXJB 3LMMA 1QAQA 2H1RA 3KOYE 4FCWA 4LCBA 4NSRA 1SXJA 2CE7A 2DWNA 4JN6A 2Q2EB 2G8LA 1TDHA 2Z4RA 1JR3A 3TE6A 4GIPA 3GLIB 3U61B 1R6BX 2LWXA 3U61A 2F5QA 4I81A 1G4AE 3HHWA 3J7BA 4LJ6A 2J7OA 1XC8A 3HU3A 4YHHM 2CEAA 2Y20A 1IXZA 5F3WA 4NOOB 2I7NA 1W5SA 4OX9M 3M7GA 2R65A 2KZSA 2Z3XA 5FTJA 4IIWA 2KRKA 3JR4A 4IBJA 3GO8A 4Z6YA 1JQJC 3GLHB 2M60A 3GPYA 4AKIA 3HJQA 3GLHA 3CF2A 2C9OA 3W0FA 1Z5CA 3FUTA 5H37D 4M9ZA 3UGJA 3PNYA 2YQZA 4XGIA 3SHFA 2FFJA 5FTMA 1IN5A 2QZ4A 3AKZA 4PD2A 4REZA 2M5ZA 5DYIA 3KFUG 3I51A 4LFAM 5KPZA 2KW0A 3U5ZB 3A42A 1Q3CA 2BJVA 2BNKA 2XF3A 4IBIA 4IBDA 4LJ8A 3PXGA 4BLCA 4LGYA 2XSZD 1TH2A 3HHYA 5FSWA 3L26A 4Z8XA 3GRVA 4G4QA 3RGSA 4LF9M 4B7FA 3HJSA 2YNMD 1N32M 4JI4M 4FD2A 1HNZM 1NNJA 1XMQM 3L27A 5JI3E 5ITRA 1IBKM 3LQRA 5KO3A 5IT9S 2RGHA 4LZZA 1R2ZA 3VFDA 5FLXS 1XNQM 3K1JA 5DYGA 4CISA 4ZPXA 4LZJA 1NSFA 3R9XB 4DV0M 3LVWA 1HR0M 3D8BA 2ZBKB 4GHLA 3MHVC 3KW6A 2CV0A 3SAWA 1I94M 1Z6TA 3FD9A 4M9XA 4L78A 2UUBM 4MB7A 5KQ8A 3U6SA 2RKOA 2XGNA 2F5OA 4GKKM 3SMSA 1E9RA 1G8PA 1LV7A 4MM3B 3TQSA 4DV4M 1OJLA 1SXJD 3AOEA 4DV5M 3I4VA 2UXBM 3KSJA 1KFVA 1JR3D 4M9SA 4I5SA 4L15A 1TH4A 4IBKA 4KODA 3A98B 3SMPA 2D7HA 2YR0A 2CV1A 3U6EA 4FWDA 4IBBA 1IN6A 4LJ7A 1DGHB 7CATA 1DGHA 4B7GA 1KSFX 1IY0A 3KOZE 4B3RM 4X65M 3RFWA 2XSZA 2UUAM 5KPTA 4MGZE 3AOGA 1L1TA 4LJ4A 3FUXA 3GLFB 2FOIC 4BB9A 5ITQA 4DV7M 3KS4A 5BR8M 4II7A 3QWLA 4D82A 5FTLA 4PCZA 3HGIA 3FYDA 4AKHA 3SYLA 1SXJC 4RF1A 4PDGA 4OU7A 2VQEM 3R8FA 3QAUA 4MGYE 4AQYM 3BOSA 4LFCM 3HHXA 2DXIA 3VDPA 3KP1E 3W0LB 4JV5M 2G5GX 2QPAA 5ITYA 3U60B 2VIIA 1NY5A 3U60A 3TWKA 4B7HA 2KXEA 2P5TA 1XHBA 1N34M 3THGA 4DV2M 1C1KA 1L2BA 1QYRA 1NHGC 4MGHA 1NY6A 3GLIA 4ITQA 3ZH9B 3SBJA 3T1YM 1UM8A 4DR4M 2DVWB 4FW9A 2RGOA 1R7RA 3M6AA 4M0WA 3A46A 4PT5A 3SYKA 5IWAM 1DO2A 3SHGB 5KPRA 3GQ4A 1PM5A 4IBCA 2HKJA 3U6QA 4TUWA 3T1HM 4DUZM 1IXRC 1N33M 3GQ3A 4R3DA 1IY1A 4CGYB 5ITTA 2QENA 3ZCBB 2F4VM 3SASA 2CHGA 3SAVA 4LF6M 2XZFA 1HNXM 2DZNB 3B9PA 5KQDA 4B3TM 4GITA 2I7PA 3DZDA 1ORYB 1IY2A 3HKPA 3VK8A 2LNHC 3CTWB 3U5ZA 4W5WA 4JI0M 4LF7M 4MGIE 5EQTA 1N78A 3NBIA 1KYIA 4GMQA 4JXJA 4IBFA 4LY6A 1DGBA 2X49A 2XFTA 2Z4SA 2HL7A 3EIEA 4DR5M 4LF4M 2C9CA 3T38A 2KZUA 1QVRA 1NVMA 1IN7A 3SAUA 2E5LM 3AOEC 4NXMM 3KDSE 4NL4H 4WW0A 3VKHA 3FUWA 1S3SA 2KRUA 4GHAA 3UJNA 4D81A 2UU9M 1Z5AA 1FJGM 3GRUA 3KXEC 4JYAM 3NWLA 4JI3M 4JI2M 2KA6B 2HCBA 4AI6A 3MJ5A 3RE8A 2D7GA 3Q8XA 3E4RA 1OFHA 3C58A 3J7AS 1IN8A 1N77A 4WURA 1NJGA 3ILKA 3KVWA 4D80A 2F5SA 1L1ZA 3UMMA 3MK6A 2V1UA 3SARA 5EP1A 3GPXA 3AL0C 2R18A 4RF0A 4DR2M 5LMUM 2DZOB 3AJIB 3J81S 2R4EA 1L2CA 3L28A 4DR1M 4LF8M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 M;  4JV5 M;  4JI6 M;  5ITY A;  3DOA A;  3GO8 A;  3JR4 A;  4G4R A;  1HNW M;  3TWK A;  4LF5 M;  3GPY A;  3U6O A;  4DR3 M;  3W0F A;  4DR6 M;  4K0K M;  1Z5C A;  4JI1 M;  1N34 M;  1K82 A;  4NRV A;  3GPU A;  4DV2 M;  3J80 S;  4DV3 M;  2F5N A;  4DUY M;  1L2B A;  1IBL M;  2UXD M;  4G4N A;  4PD2 A;  3GP1 A;  4JI8 M;  4PDI A;  4YY3 M;  1Z5B A;  4ITQ A;  3JAM S;  4LFA M;  4X66 M;  4DV6 M;  4B3M M;  3SBJ A;  3T1Y M;  4GKJ M;  4DR4 M;  4KHP M;  3A42 A;  1Q3C A;  2XZU A;  1N36 M;  5ITX A;  5LMN M;  3A46 A;  5IWA M;  5ITX E;  4X64 M;  3GQ4 A;  1PM5 A;  1K3W A;  2F5P A;  1K3X A;  2HKJ A;  3U6Q A;  4G4Q A;  3T1H M;  4DUZ M;  4LF9 M;  1N33 M;  1N32 M;  3GPP A;  3GQ3 A;  2HHH M;  4JI4 M;  1HNZ M;  1NNJ A;  1XMQ M;  5ITR A;  5ITT A;  1IBK M;  5IT9 S;  3GQ5 A;  3TWL A;  1R2Z A;  2F4V M;  3SAS A;  5FLX S;  1XNQ M;  3SAV A;  4LF6 M;  2XZF A;  1HNX M;  2OPF A;  4CIS A;  4DV0 M;  4B3T M;  1HR0 M;  2ZBK B;  3VK8 A;  3SAW A;  1I94 M;  3VK7 A;  3U6P A;  1PJI A;  1Z59 A;  1IBM M;  2UUB M;  4MB7 A;  3U6S A;  4B3S M;  4JI7 M;  4NRW A;  2F5O A;  4JI0 M;  3U6L A;  4LF7 M;  4GKK M;  3U6C A;  1EE8 A;  4DV4 M;  4DV5 M;  2UXB M;  1Q39 A;  1KFV A;  4DR5 M;  4LF4 M;  3U6M A;  1MU5 A;  3SAU A;  2ZM6 M;  1TDZ A;  2E5L M;  4LFC M;  4NXM M;  3U6E A;  5ITU A;  2UXC M;  5A2Q S;  4NXN M;  1J5E M;  2UU9 M;  4G4O A;  1Z5A A;  3A45 A;  1FJG M;  1XMO M;  4JYA M;  4JI3 M;  3JR5 A;  1L2D A;  4B3R M;  4X65 M;  4JI2 M;  2UUA M;  2UUC M;  4DR7 M;  4LFB M;  1L1T A;  1MX0 A;  4DV1 M;  3C58 A;  3OTO M;  3J7A S;  3U6D A;  1PJJ A;  3TWM A;  1R2Y A;  5ITQ A;  2Q2E B;  4DV7 M;  1TDH A;  4X62 M;  5BR8 M;  4PCZ A;  2F5S A;  1L1Z A;  3SAR A;  3GPX A;  4PDG A;  2F5Q A;  2VQE M;  1XNR M;  4DR2 M;  5LMU M;  1XC8 A;  3SAT A;  4YHH M;  1Q3B A;  3J81 S;  2OQ4 A;  4AQY M;  1L2C A;  4JI5 M;  2VQF M;  4DR1 M;  4LF8 M;  2EA0 A; 
#chains in the Genus database with same CATH topology
 4HL4 A;  1PGY A;  1VEJ A;  1W5T A;  3FTE A;  3DOA A;  4GC9 A;  4G4R A;  3NBX X;  5EXS A;  4QHT A;  2DNA A;  2K47 A;  2ZTD A;  4KLN A;  2GNO A;  2XFS A;  4DR3 M;  4JI1 M;  1GAB A;  2L4F A;  1NJF A;  4NRV A;  1QAM A;  2DWL A;  3FTC A;  4P17 A;  3J80 S;  5EXP A;  2JP7 A;  4DV3 M;  4EIW A;  1SXJ E;  3GLF A;  2R62 A;  3TL4 X;  2UXD M;  3LQQ A;  1XXH B;  4KO8 A;  1JR3 E;  4PDI A;  1XXH A;  4G3O A;  1QUT A;  1OFI A;  4P16 A;  4B3M M;  4DV6 M;  3GLG B;  1YE9 A;  4GC5 A;  1HT2 E;  4XBO A;  3GLI E;  4KHP M;  5ITX A;  5LMN M;  2CFO A;  3H4M A;  4S12 A;  5IRE B;  1EIJ A;  4IJF A;  2JY7 A;  2R4J A;  4M0D A;  4OW0 A;  2LXE A;  1K3W A;  1K3X A;  2Y21 A;  5IZ7 D;  4RNA A;  3K92 A;  3EIH A;  3GPP A;  3AFH A;  2HHH M;  4QHS A;  3KOW E;  5C18 A;  1ZQ9 A;  1OKS A;  3KSX A;  3FRH A;  2CWB A;  2L7I A;  3T6P A;  3E9S A;  2DWZ B;  2APL A;  3L29 A;  2K6B A;  2O25 A;  1T3T A;  2OPF A;  1QAN A;  2L7H A;  2ZAN A;  3QYB A;  4GH9 A;  2Y0T A;  5FTN A;  2K9D A;  2L2D A;  2V6Z M;  4R7G A;  4HEO A;  2CHQ A;  4B3S M;  1Z59 A;  2W82 A;  2LH0 A;  1IM2 A;  2LVN C;  1HQC A;  3FUV A;  3HU2 A;  3RGP A;  3K2L A;  4MH0 E;  3U6L A;  2QBY B;  2J5Y A;  2WSE F;  3FE3 A;  2EO2 A;  3WHL A;  3U6C A;  2QBY A;  1EE8 A;  1YUB A;  2ZAM A;  1BVS A;  3WHK A;  3V76 A;  1J7K A;  2AHM A;  1VG5 A;  1QQW A;  2C5R A;  1MN3 A;  2RRU A;  1L8Q A;  3U6M A;  3B89 A;  1MU5 A;  2LBC A;  5FTK A;  2CV2 A;  2ZAO A;  3DFZ A;  5EXT A;  4G6Z A;  4CJ6 A;  2KNZ A;  5ITU A;  1G41 A;  4XK8 F;  2FH0 A;  3IG8 A;  5A2Q S;  1V33 A;  2QP9 X;  2R6F A;  2WSC F;  1X37 A;  5DNY A;  4NXN M;  5C1B A;  1GL7 A;  3L25 A;  1HQY E;  3T15 A;  1UFZ A;  3HWS A;  3A45 A;  2V1C A;  4B08 A;  3JR5 A;  2J7N A;  1L2D A;  4FCV A;  1XB2 B;  2XH9 A;  3SC3 A;  3J27 B;  4LGM A;  4LFB M;  3FTD A;  3ZC7 B;  3FTF A;  2CUZ A;  3UK6 A;  4NSO B;  4DR7 M;  3W67 A;  1GVN A;  1MX0 A;  4IBE A;  1TTE A;  2FNA A;  2Z7J A;  3L2A A;  4NC6 A;  4DV1 M;  5EP2 A;  1P3Q Q;  2QQ8 A;  4GRI A;  4BBA A;  3OTO M;  1R4G A;  3U6D A;  5E26 A;  1NNU C;  1PJJ A;  2CHV A;  4A3V B;  2LVO C;  4QOS A;  3TWM A;  5JI2 E;  1R2Y A;  2MRO B;  3D8L A;  5EXX A;  4X62 M;  5GKN A;  2QNJ A;  1I4W A;  4AG6 A;  2X4A A;  1GLN A;  4F1I A;  2JZ1 A;  3CF6 E;  1DGG A;  1H6U A;  1XNR M;  3K8Z A;  5E6J A;  1WGL A;  2DWM A;  5EP3 A;  2R45 A;  3SAT A;  2OQ4 A;  1Q3B A;  4JI5 M;  1OAO C;  1DGF A;  2VQF M;  4K0K M;  4FWH A;  3UZU A;  2EA0 A;  1OQY A;  1V34 A;  4OVZ B;  4ANR A;  1VEG A;  1QDT A;  3Q8G A;  4KT0 F;  1TH3 A;  2R46 A;  4LJ9 A;  4OVZ A;  4JI6 M;  3VLF B;  4L6V 6;  1E9S A;  2A5Y B;  3DA1 A;  1D2N A;  1FNN A;  3AV0 A;  3FYC A;  1HNW M;  4LF5 M;  2JY5 A;  1XWI A;  3FUU A;  4LRT A;  4L16 A;  5BPV A;  3U6O A;  2L09 A;  4DR6 M;  3VKG A;  3J2P B;  1NHW C;  1K82 A;  2K0B X;  4FVM A;  2YFQ A;  3GPU A;  3KS8 A;  4IBG A;  2JA2 A;  4FWG A;  4DUY M;  2OOB A;  2F5N A;  3M0E A;  1EFU B;  3SFZ A;  1IBL M;  4G4N A;  4F2L A;  1G3I A;  3GP1 A;  2MGW A;  2O5R A;  4JI8 M;  3GLF E;  2DHY A;  4QNM A;  1WXQ A;  3PVS A;  4AZF A;  1Z5B A;  4I8O A;  4YY3 M;  2QHO B;  2KEB A;  4AW4 A;  3JAM S;  4X66 M;  1XXH E;  3E46 A;  8CAT A;  4GKJ M;  2XEP A;  1N36 M;  5EJC A;  2XLJ A;  2XZU A;  2JY6 B;  1QZM A;  3BXW A;  2KNV A;  3VDU A;  5ITX E;  4LJ5 A;  4X64 M;  1G59 A;  4UN2 B;  1TGU A;  2F5P A;  1GL6 A;  2VF7 A;  3TPZ A;  4AKG A;  2FE8 A;  2QCU A;  2D7E A;  1IN4 A;  3GRY A;  4L4U A;  3TWL A;  3GQ5 A;  2DHR A;  3KP0 E;  2EUC A;  3E21 A;  1E94 E;  1J09 A;  2X8A A;  2HAK A;  2OO9 A;  1D0K A;  1OIZ A;  2CRU A;  1HT1 E;  1MJG M;  3C3E A;  4MGK E;  1D0M A;  1N75 A;  2KHH A;  1YSY A;  4LRS A;  3GLG A;  4HLQ A;  4FCT A;  3IG5 A;  2C98 A;  4QNR A;  3U6P A;  3VK7 A;  2BJW A;  1PJI A;  1IBM M;  4JI7 M;  5EP4 A;  4L8R C;  4LG2 A;  4NRW A;  2C99 A;  3HJ8 A;  4QOZ C;  3PNV A;  2C96 A;  1VEK A;  4CHT B;  4CIZ A;  1Q39 A;  1VDD A;  4I4L A;  1T6O A;  3LVV A;  1TDZ A;  2ZM6 M;  2Y0Q A;  1IQP A;  2G3Q A;  3FKE A;  2ERC A;  4IJE A;  2UXC M;  3HU1 A;  1D0L A;  1J5E M;  3GRR A;  1QAO A;  4LJA A;  1Y8G A;  4G4O A;  2OOA A;  2R44 A;  1AIP C;  1E32 A;  3ZQJ A;  3CF0 A;  1XMO M;  1WGN A;  1GKI A;  2WZJ A;  3I4Y A;  3HHZ A;  2KNA A;  3PFI A;  4AG5 A;  2UUC M;  1ZAE A;  1DO0 A;  2L6O A;  1IXS B;  2NQ8 C;  3KOX E;  1IXS A;  1SXJ B;  3LMM A;  1QAQ A;  2H1R A;  2LVQ D;  3KOY E;  2JXN A;  4FCW A;  4LCB A;  1SXJ A;  4NSR A;  1RU3 A;  1ZMV A;  2CE7 A;  2DWN A;  4JN6 A;  2Q2E B;  2G8L A;  1TDH A;  2Z4R A;  1JR3 A;  3TE6 A;  4GIP A;  3GLI B;  3U61 B;  1R6B X;  2LWX A;  3U61 A;  3LW5 F;  2F5Q A;  4I81 A;  1G4A E;  3HHW A;  3J7B A;  4LJ6 A;  2J7O A;  1WHC A;  1XC8 A;  3HU3 A;  3K9P A;  2O01 F;  2DAG A;  4YHH M;  2CEA A;  2Y20 A;  2MJ5 B;  1IXZ A;  5F3W A;  4NOO B;  2I7N A;  1W5S A;  4OX9 M;  3M7G A;  1TR8 A;  2R65 A;  2KZS A;  2Z3X A;  5FTJ A;  4IIW A;  2KRK A;  1GJT A;  3JR4 A;  4IBJ A;  3GO8 A;  4Z6Y A;  1JQJ C;  3GLH B;  2M60 A;  3GPY A;  4AKI A;  3HJQ A;  3GLH A;  3CF2 A;  2C9O A;  2VF8 A;  3W0F A;  1Z5C A;  1T43 A;  3B7Z A;  3FUT A;  4M9Z A;  3PNY A;  5H37 D;  3UGJ A;  2YQZ A;  4XGI A;  3SHF A;  1ZV1 A;  2FFJ A;  2WSF F;  5FTM A;  1IN5 A;  2QZ4 A;  3H4J A;  4PD2 A;  3AKZ A;  2MR9 A;  4REZ A;  1NO1 A;  2EKK A;  2M5Z A;  5DYI A;  3KFU G;  1GO5 A;  3I51 A;  4LFA M;  3B74 A;  1WIV A;  5KPZ A;  3I01 M;  2KW0 A;  3U5Z B;  3A42 A;  1Q3C A;  2BJV A;  2BNK A;  2XF3 A;  4IBI A;  4IBD A;  2JWS A;  4LJ8 A;  3PXG A;  4BLC A;  1OAI A;  4LGY A;  3B7N A;  2XSZ D;  4WP2 A;  1TH2 A;  3HHY A;  5FSW A;  3L26 A;  4Z8X A;  1C7Y A;  3GRV A;  4G4Q A;  1PJQ A;  3RGS A;  4B7F A;  4LF9 M;  3HJS A;  2YNM D;  1N32 M;  4JI4 M;  4FD2 A;  1Q02 A;  1QUS A;  1NNJ A;  1XMQ M;  3L27 A;  5JI3 E;  1HNZ M;  2DI0 A;  5ITR A;  3QYE A;  3LQR A;  1IBK M;  5KO3 A;  5IT9 S;  2RGH A;  4LZZ A;  1R2Z A;  3VFD A;  1AUA A;  5FLX S;  1XNQ M;  1SG9 A;  3K1J A;  1IFY A;  5DYG A;  2EJS A;  2JNH A;  3LCU A;  4ZPX A;  4LZJ A;  4CIS A;  1NSF A;  3R9X B;  4DV0 M;  3LVW A;  1HR0 M;  3D8B A;  2BWE A;  1ZMU A;  2ZBK B;  4GHL A;  3MHV C;  3KW6 A;  2CV0 A;  3SAW A;  3CGW A;  1I94 M;  1Z6T A;  3FD9 A;  4M9X A;  4L78 A;  3GLG E;  2UUB M;  1DV0 A;  1QDR A;  4MB7 A;  5KQ8 A;  3U6S A;  2RKO A;  2XGN A;  2F5O A;  3F92 A;  2FS1 A;  4GKK M;  1OTR A;  1E9R A;  3SMS A;  1G8P A;  1LV7 A;  4MM3 B;  1CUK A;  3TQS A;  4DV4 M;  1OJL A;  1SXJ D;  3AOE A;  4DV5 M;  3I4V A;  5L8R F;  3KSJ A;  2UXB M;  1KFV A;  1JR3 D;  4M9S A;  1QZE A;  4I5S A;  1TH4 A;  1R5L A;  4IBK A;  4L15 A;  2B3T A;  1JB0 F;  4KOD A;  3A98 B;  3SMP A;  2D7H A;  1HJP A;  2VDB B;  2YR0 A;  2CV1 A;  3U6E A;  4FWD A;  4IBB A;  4RKU F;  1IN6 A;  4LJ7 A;  3C3D A;  1DGH B;  7CAT A;  1DGH A;  4B7G A;  1KSF X;  2N35 A;  1IY0 A;  3KOZ E;  4B3R M;  4X65 M;  2LHG A;  2Z8Y M;  3RFW A;  2XSZ A;  2UUA M;  5KPT A;  2JUJ A;  4MGZ E;  1TF0 B;  1A5T A;  3AOG A;  1L1T A;  1VQ1 A;  4LJ4 A;  3FUX A;  3GLF B;  2FOI C;  4BB9 A;  5ITQ A;  4DV7 M;  3KS4 A;  5BR8 M;  4Q7J A;  4II7 A;  2JY8 A;  3QWL A;  4D82 A;  5FTL A;  4PCZ A;  2H5X A;  2BWB A;  3HGI A;  3FYD A;  4AKH A;  3FRI A;  3SYL A;  1GJS A;  1SXJ C;  4RF1 A;  4PDG A;  4OU7 A;  2VQE M;  3C9P A;  3R8F A;  3QAU A;  4MGY E;  4AQY M;  3BOS A;  3HX3 A;  4LFC M;  3HHX A;  4R71 A;  3MMP A;  3VDP A;  2DXI A;  3KP1 E;  3W0L B;  4JV5 M;  2G5G X;  4Y28 F;  2ZTC A;  2QPA A;  5ITY A;  2DAI A;  3U60 B;  2VII A;  1NY5 A;  1F4I A;  3U60 A;  3TWK A;  4B7H A;  2KXE A;  2LTU A;  2P5T A;  1XHB A;  1N34 M;  3THG A;  3GLH E;  1V92 A;  2LHC A;  4DV2 M;  1C1K A;  1L2B A;  1QYR A;  1NHG C;  2LVA A;  1G71 A;  1LTM A;  2GQF A;  4MGH A;  2DZL A;  1NY6 A;  3GLI A;  4ITQ A;  1WJ7 A;  3ZH9 B;  3SBJ A;  3T1Y M;  1UM8 A;  4DR4 M;  2DVW B;  4FW9 A;  2DKL A;  2RGO A;  1R7R A;  3M6A A;  4M0W A;  3A46 A;  4PT5 A;  3SYK A;  5IWA M;  1DO2 A;  3SHG B;  5KPR A;  3GQ4 A;  1PM5 A;  4IBC A;  2HKJ A;  3U6Q A;  4TUW A;  3T1H M;  4DUZ M;  2DAM A;  1IXR C;  1N33 M;  2MH8 A;  3HY5 A;  3GQ3 A;  4DBG B;  4R3D A;  1IY1 A;  4CGY B;  5ITT A;  1VDL A;  2QEN A;  3LCV B;  3ZCB B;  2F4V M;  3SAS A;  2CHG A;  2EKF A;  3SAV A;  4LF6 M;  2XZF A;  1HNX M;  2DZN B;  1NV9 A;  3B9P A;  5KQD A;  4B3T M;  4GIT A;  1OIP A;  2I7P A;  3DZD A;  1ORY B;  1IY2 A;  3HKP A;  3IEC A;  2LNH C;  3CTW B;  3VK8 A;  3U5Z A;  4W5W A;  2LVP C;  3BBZ A;  2L4E A;  2JZ0 A;  4JI0 M;  4LF7 M;  4MGI E;  2DAK A;  1PJT A;  5EQT A;  1N78 A;  3B7Q A;  1KYI A;  3NBI A;  4GMQ A;  4IBF A;  4JXJ A;  4LY6 A;  1DGB A;  2X49 A;  2XFT A;  2Z4S A;  2HL7 A;  2HWJ A;  1YLA A;  3EIE A;  4DR5 M;  4LF4 M;  2C9C A;  3T38 A;  2KZU A;  1QVR A;  2QSF X;  1NVM A;  1IN7 A;  3I04 M;  1PRB A;  1PJS A;  3SAU A;  2E5L M;  1ZMW A;  3AOE C;  1WR1 B;  4NXM M;  3KDS E;  4NL4 H;  4WW0 A;  3VKH A;  3FUW A;  1S3S A;  2KRU A;  4GHA A;  3UJN A;  5DFL A;  4D81 A;  3W68 A;  2UU9 M;  1Z5A A;  1FJG M;  3GRU A;  3KXE C;  4JYA M;  3NWL A;  4JI3 M;  4JI2 M;  2KDL A;  2KA6 B;  2HCB A;  4AI6 A;  3MJ5 A;  2CP8 A;  3RE8 A;  2DEN A;  2D7G A;  3K9O A;  3Q8X A;  1NV8 A;  3E4R A;  1OFH A;  3C58 A;  3J7A S;  1IN8 A;  2R0I A;  1N77 A;  4WUR A;  1NJG A;  3ILK A;  3KVW A;  4D80 A;  2F5S A;  1L1Z A;  3UMM A;  2DAE A;  3MK6 A;  2V1U A;  3SAR A;  5EP1 A;  3GPX A;  3AL0 C;  2R18 A;  4RF0 A;  4DR2 M;  5LMU M;  3HZJ A;  2DZO B;  3AJI B;  3J81 S;  2R4E A;  4GEW A;  1L2C A;  3L28 A;  4DR1 M;  3IHP A;  4LF8 M; 
#chains in the Genus database with same CATH homology
 4HL4 A;  1W5T A;  3FTE A;  3DOA A;  4GC9 A;  4G4R A;  5EXS A;  4QHT A;  2K47 A;  4KLN A;  2XFS A;  4DR3 M;  4JI1 M;  1NJF A;  4NRV A;  1QAM A;  2DWL A;  3FTC A;  3J80 S;  5EXP A;  4DV3 M;  4EIW A;  1SXJ E;  3GLF A;  2R62 A;  3TL4 X;  2UXD M;  3LQQ A;  1XXH B;  4KO8 A;  4PDI A;  1XXH A;  1OFI A;  4P16 A;  4B3M M;  4DV6 M;  3GLG B;  1YE9 A;  4GC5 A;  1HT2 E;  4XBO A;  4KHP M;  5ITX A;  5LMN M;  2CFO A;  3H4M A;  4S12 A;  5IRE B;  4IJF A;  2R4J A;  4M0D A;  4OW0 A;  2LXE A;  1K3W A;  1K3X A;  2Y21 A;  5IZ7 D;  4RNA A;  3K92 A;  3EIH A;  3GPP A;  3AFH A;  2HHH M;  4QHS A;  3KOW E;  5C18 A;  1ZQ9 A;  3KSX A;  2L7I A;  3E9S A;  2DWZ B;  3L29 A;  2OPF A;  1T3T A;  1QAN A;  2L7H A;  2ZAN A;  4GH9 A;  2Y0T A;  5FTN A;  2V6Z M;  4R7G A;  2CHQ A;  4B3S M;  1Z59 A;  2W82 A;  2LH0 A;  1IM2 A;  3FUV A;  1HQC A;  3HU2 A;  3RGP A;  3K2L A;  4MH0 E;  3U6L A;  2QBY B;  3WHL A;  2EO2 A;  3U6C A;  2QBY A;  1EE8 A;  1YUB A;  2ZAM A;  3WHK A;  1J7K A;  2AHM A;  1QQW A;  2C5R A;  1L8Q A;  3U6M A;  1MU5 A;  5FTK A;  2CV2 A;  2ZAO A;  3DFZ A;  5EXT A;  4G6Z A;  5ITU A;  1G41 A;  3IG8 A;  5A2Q S;  2QP9 X;  3L25 A;  1X37 A;  5DNY A;  4NXN M;  5C1B A;  1GL7 A;  1HQY E;  3T15 A;  3HWS A;  3A45 A;  2V1C A;  4B08 A;  3JR5 A;  2J7N A;  1L2D A;  4FCV A;  2XH9 A;  3SC3 A;  3J27 B;  4LGM A;  4LFB M;  3FTD A;  3ZC7 B;  3FTF A;  2CUZ A;  3UK6 A;  4NSO B;  4DR7 M;  1GVN A;  1MX0 A;  4IBE A;  2FNA A;  2Z7J A;  3L2A A;  4DV1 M;  5EP2 A;  4GRI A;  4BBA A;  3OTO M;  3U6D A;  5E26 A;  1NNU C;  1PJJ A;  2CHV A;  4A3V B;  3TWM A;  4QOS A;  1R2Y A;  5JI2 E;  3D8L A;  5EXX A;  4X62 M;  5GKN A;  4AG6 A;  1I4W A;  2X4A A;  1GLN A;  3CF6 E;  1DGG A;  1H6U A;  1XNR M;  3K8Z A;  5E6J A;  2DWM A;  5EP3 A;  2R45 A;  3SAT A;  2OQ4 A;  1Q3B A;  4JI5 M;  1DGF A;  2VQF M;  4K0K M;  4FWH A;  3UZU A;  2EA0 A;  4OVZ B;  1TH3 A;  2R46 A;  4LJ9 A;  4OVZ A;  4JI6 M;  3VLF B;  1E9S A;  2A5Y B;  3DA1 A;  1D2N A;  1FNN A;  3AV0 A;  3FYC A;  1HNW M;  4LF5 M;  1XWI A;  3FUU A;  4LRT A;  4L16 A;  5BPV A;  3U6O A;  2L09 A;  4DR6 M;  3VKG A;  3J2P B;  1NHW C;  1K82 A;  4FVM A;  2YFQ A;  3GPU A;  3KS8 A;  4IBG A;  2JA2 A;  4FWG A;  4DUY M;  2F5N A;  3M0E A;  3SFZ A;  1IBL M;  4G4N A;  1G3I A;  3GP1 A;  2O5R A;  4JI8 M;  4QNM A;  1WXQ A;  3PVS A;  4AZF A;  1Z5B A;  4I8O A;  4YY3 M;  2KEB A;  4AW4 A;  3JAM S;  4X66 M;  8CAT A;  4GKJ M;  2XEP A;  1N36 M;  5EJC A;  2XLJ A;  2XZU A;  1QZM A;  3VDU A;  5ITX E;  4LJ5 A;  4X64 M;  1G59 A;  2F5P A;  1TGU A;  1GL6 A;  3TPZ A;  4AKG A;  2FE8 A;  2QCU A;  2D7E A;  1IN4 A;  3GRY A;  4L4U A;  3TWL A;  3GQ5 A;  2DHR A;  3KP0 E;  2EUC A;  1E94 E;  1J09 A;  2X8A A;  1HT1 E;  4MGK E;  1N75 A;  1YSY A;  4LRS A;  3GLG A;  4HLQ A;  4FCT A;  3IG5 A;  2C98 A;  4QNR A;  3U6P A;  3VK7 A;  2BJW A;  1PJI A;  1IBM M;  4JI7 M;  5EP4 A;  4L8R C;  4LG2 A;  4NRW A;  2C99 A;  3HJ8 A;  4QOZ C;  3PNV A;  2C96 A;  4CHT B;  1Q39 A;  1VDD A;  4I4L A;  3LVV A;  1TDZ A;  2ZM6 M;  2Y0Q A;  1IQP A;  3FKE A;  2ERC A;  4IJE A;  2UXC M;  3HU1 A;  1J5E M;  3GRR A;  1QAO A;  4LJA A;  4G4O A;  1E32 A;  3CF0 A;  1XMO M;  1GKI A;  3I4Y A;  3HHZ A;  3PFI A;  4AG5 A;  2UUC M;  1ZAE A;  1DO0 A;  2L6O A;  1IXS B;  2NQ8 C;  3KOX E;  1SXJ B;  3LMM A;  1QAQ A;  2H1R A;  3KOY E;  4FCW A;  4LCB A;  4NSR A;  1SXJ A;  2CE7 A;  2DWN A;  4JN6 A;  2Q2E B;  2G8L A;  1TDH A;  2Z4R A;  1JR3 A;  3TE6 A;  4GIP A;  3GLI B;  3U61 B;  1R6B X;  2LWX A;  3U61 A;  2F5Q A;  4I81 A;  1G4A E;  3HHW A;  3J7B A;  4LJ6 A;  2J7O A;  1XC8 A;  3HU3 A;  4YHH M;  2CEA A;  2Y20 A;  1IXZ A;  5F3W A;  4NOO B;  2I7N A;  1W5S A;  4OX9 M;  3M7G A;  2R65 A;  2KZS A;  2Z3X A;  5FTJ A;  4IIW A;  2KRK A;  3JR4 A;  4IBJ A;  3GO8 A;  4Z6Y A;  1JQJ C;  3GLH B;  2M60 A;  3GPY A;  4AKI A;  3HJQ A;  3GLH A;  3CF2 A;  2C9O A;  3W0F A;  1Z5C A;  3FUT A;  5H37 D;  4M9Z A;  3UGJ A;  3PNY A;  2YQZ A;  4XGI A;  3SHF A;  2FFJ A;  5FTM A;  1IN5 A;  2QZ4 A;  3AKZ A;  4PD2 A;  4REZ A;  2M5Z A;  5DYI A;  3KFU G;  3I51 A;  4LFA M;  5KPZ A;  2KW0 A;  3U5Z B;  3A42 A;  1Q3C A;  2BJV A;  2BNK A;  2XF3 A;  4IBI A;  4IBD A;  4LJ8 A;  3PXG A;  4BLC A;  4LGY A;  2XSZ D;  1TH2 A;  3HHY A;  5FSW A;  3L26 A;  4Z8X A;  3GRV A;  4G4Q A;  3RGS A;  4LF9 M;  4B7F A;  3HJS A;  2YNM D;  1N32 M;  4JI4 M;  4FD2 A;  1HNZ M;  1NNJ A;  1XMQ M;  3L27 A;  5JI3 E;  5ITR A;  1IBK M;  3LQR A;  5KO3 A;  5IT9 S;  2RGH A;  4LZZ A;  1R2Z A;  3VFD A;  5FLX S;  1XNQ M;  3K1J A;  5DYG A;  4CIS A;  4ZPX A;  4LZJ A;  1NSF A;  3R9X B;  4DV0 M;  3LVW A;  1HR0 M;  3D8B A;  2ZBK B;  4GHL A;  3MHV C;  3KW6 A;  2CV0 A;  3SAW A;  1I94 M;  1Z6T A;  3FD9 A;  4M9X A;  4L78 A;  2UUB M;  4MB7 A;  5KQ8 A;  3U6S A;  2RKO A;  2XGN A;  2F5O A;  4GKK M;  3SMS A;  1E9R A;  1G8P A;  1LV7 A;  4MM3 B;  3TQS A;  4DV4 M;  1OJL A;  1SXJ D;  3AOE A;  4DV5 M;  3I4V A;  2UXB M;  3KSJ A;  1KFV A;  1JR3 D;  4M9S A;  4I5S A;  4L15 A;  1TH4 A;  4IBK A;  4KOD A;  3A98 B;  3SMP A;  2D7H A;  2YR0 A;  2CV1 A;  3U6E A;  4FWD A;  4IBB A;  1IN6 A;  4LJ7 A;  1DGH B;  7CAT A;  1DGH A;  4B7G A;  1KSF X;  1IY0 A;  3KOZ E;  4B3R M;  4X65 M;  3RFW A;  2XSZ A;  2UUA M;  5KPT A;  4MGZ E;  3AOG A;  1L1T A;  4LJ4 A;  3FUX A;  3GLF B;  2FOI C;  4BB9 A;  5ITQ A;  4DV7 M;  3KS4 A;  5BR8 M;  4II7 A;  3QWL A;  4D82 A;  5FTL A;  4PCZ A;  3HGI A;  3FYD A;  4AKH A;  3SYL A;  1SXJ C;  4RF1 A;  4PDG A;  4OU7 A;  2VQE M;  3R8F A;  3QAU A;  4MGY E;  4AQY M;  3BOS A;  4LFC M;  3HHX A;  2DXI A;  3VDP A;  3KP1 E;  3W0L B;  4JV5 M;  2G5G X;  2QPA A;  5ITY A;  3U60 B;  2VII A;  1NY5 A;  3U60 A;  3TWK A;  4B7H A;  2KXE A;  2P5T A;  1XHB A;  1N34 M;  3THG A;  4DV2 M;  1C1K A;  1L2B A;  1QYR A;  1NHG C;  4MGH A;  1NY6 A;  3GLI A;  4ITQ A;  3ZH9 B;  3SBJ A;  3T1Y M;  1UM8 A;  4DR4 M;  2DVW B;  4FW9 A;  2RGO A;  1R7R A;  3M6A A;  4M0W A;  3A46 A;  4PT5 A;  3SYK A;  5IWA M;  1DO2 A;  3SHG B;  5KPR A;  3GQ4 A;  1PM5 A;  4IBC A;  2HKJ A;  3U6Q A;  4TUW A;  3T1H M;  4DUZ M;  1IXR C;  1N33 M;  3GQ3 A;  4R3D A;  1IY1 A;  4CGY B;  5ITT A;  2QEN A;  3ZCB B;  2F4V M;  3SAS A;  2CHG A;  3SAV A;  4LF6 M;  2XZF A;  1HNX M;  2DZN B;  3B9P A;  5KQD A;  4B3T M;  4GIT A;  2I7P A;  3DZD A;  1ORY B;  1IY2 A;  3HKP A;  3VK8 A;  2LNH C;  3CTW B;  3U5Z A;  4W5W A;  4JI0 M;  4LF7 M;  4MGI E;  5EQT A;  1N78 A;  3NBI A;  1KYI A;  4GMQ A;  4JXJ A;  4IBF A;  4LY6 A;  1DGB A;  2X49 A;  2XFT A;  2Z4S A;  2HL7 A;  3EIE A;  4DR5 M;  4LF4 M;  2C9C A;  3T38 A;  2KZU A;  1QVR A;  1NVM A;  1IN7 A;  3SAU A;  2E5L M;  3AOE C;  4NXM M;  3KDS E;  4NL4 H;  4WW0 A;  3VKH A;  3FUW A;  1S3S A;  2KRU A;  4GHA A;  3UJN A;  4D81 A;  2UU9 M;  1Z5A A;  1FJG M;  3GRU A;  3KXE C;  4JYA M;  3NWL A;  4JI3 M;  4JI2 M;  2KA6 B;  2HCB A;  4AI6 A;  3MJ5 A;  3RE8 A;  2D7G A;  3Q8X A;  3E4R A;  1OFH A;  3C58 A;  3J7A S;  1IN8 A;  1N77 A;  4WUR A;  1NJG A;  3ILK A;  3KVW A;  4D80 A;  2F5S A;  1L1Z A;  3UMM A;  3MK6 A;  2V1U A;  3SAR A;  5EP1 A;  3GPX A;  3AL0 C;  2R18 A;  4RF0 A;  4DR2 M;  5LMU M;  2DZO B;  3AJI B;  3J81 S;  2R4E A;  1L2C A;  3L28 A;  4DR1 M;  4LF8 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...