5BR8M

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5br8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5br8M02
3W0FA 4NXNM 5IWAM 5LMUM 4DUZM 1Q3CA 4X64M 2F5SA 4JI2M 1L1ZA 2F4VM 1N33M 1N36M 4NXMM 4X65M 2F5OA 1Q3BA 3SASA 3SBJA 4DR4M 5ITQA 3U6QA 1Z5BA 1K82A 4LF5M 4K0KM 4B3TM 4DV7M 1TDZA 4CISA 4JI5M 3DOAA 1K3XA 5ITUA 4B3SM 4G4NA 3VK8A 4AQYM 4NRVA 4LFBM 1Q39A 1HR0M 3TWMA 3U6EA 1EE8A 2Q2EB 1R2ZA 3A45A 1HNWM 4G4QA 3T1HM 3GQ5A 3SARA 2HKJA 4JI1M 5ITTA 1K3WA 3GPXA 4LF6M 1L2DA 3GPUA 3JR4A 4JI0M 3U6LA 1L2CA 4JI8M 2UU9M 4LFCM 4KHPM 4DV0M 2UUAM 3GPYA 2F5QA 1Z5CA 3U6SA 1L2BA 4LF9M 2ZM6M 2UXCM 1R2YA 2UXDM 1HNXM 4JV5M 4ITQA 3SAVA 3A42A 4X66M 2OPFA 4B3RM 4B3MM 2XZUA 1MX0A 4OX9M 2UXBM 5ITYA 2VQFM 1FJGM 4LF8M 4LF7M 3JR5A 4DV5M 1XMQM 4PCZA 4PDIA 3GO8A 5ITXA 2F5PA 5ITXE 5IT9S 3VK7A 3GPPA 1IBLM 4JI4M 3TWLA 4PDGA 1HNZM 4NRWA 4DV1M 4JYAM 1Z59A 4G4RA 2EA0A 2UUBM 1XNRM 3SAUA 3J7AS 4DV2M 1J5EM 2HHHM 4X62M 4JI7M 1XNQM 4DV6M 1MU5A 4YY3M 3J80S 4LFAM 2F5NA 3SATA 1PM5A 1NNJA 3U6PA 2UUCM 4DV4M 1TDHA 1KFVA 3SAWA 1L1TA 4DR3M 2XZFA 3TWKA 1XMOM 2ZBKB 4PD2A 3JAMS 1N34M 3GQ4A 3U6MA 3OTOM 5FLXS 1PJJA 3A46A 3U6DA 3C58A 1N32M 4JI3M 4MB7A 4G4OA 2E5LM 4DUYM 4DR5M 5ITRA 3U6CA 4GKKM 1IBKM 4JI6M 4DR7M 4DR1M 3GQ3A 4DV3M 1XC8A 4DR6M 1IBMM 4DR2M 3U6OA 3T1YM 4LF4M 2VQEM 3GP1A 4YHHM 4GKJM 5BR8M 2OQ4A 3J81S 1PJIA 1Z5AA 1I94M 5A2QS 5LMNM
chains in the Genus database with same CATH superfamily
2EKFA 1QAQA 2QNJA 1GL7A 2O25A 2C9OA 2LVNC 4DUZM 4IBCA 1XXHB 3K9OA 1OJLA 4FD2A 1N33M 1N36M 4FVMA 3K92A 3HHZA 1GVNA 4NXMM 3VKHA 4GIPA 3AOEC 1G71A 1Q3BA 2JUJA 1QAOA 1TR8A 3DA1A 3V76A 5ITQA 3SASA 4LF5M 1C7YA 4B3TM 1QUTA 2MJ5B 1QVRA 1MN3A 2J5YA 2WSFF 3A98B 3GLGE 1RU3A 2DWNA 1HNWM 1ZQ9A 2BNKA 3GQ5A 4B7GA 4FCWA 2FFJA 1I4WA 1IN6A 1K3WA 2Z3XA 3GPXA 4LJ8A 1XWIA 3U60B 3IECA 2CV1A 3GLGA 1QDTA 3HWSA 1L2DA 1NJGA 3RFWA 1HJPA 1ORYB 3I01M 2UU9M 4M9ZA 4M9XA 1IXZA 4DV0M 2UUAM 3GPYA 2F5QA 3KXEC 1Z5CA 5FTKA 5IZ7D 3U6SA 4LF9M 2KZSA 1DO0A 2ZM6M 4CIZA 3KW6A 2DVWB 5EP1A 1ZMUA 2JY6B 3KOYE 3SHFA 4KO8A 1HNXM 3KOWE 4XGIA 3K2LA 4IJFA 3HHWA 2XLJA 2MROB 4I4LA 4LJ4A 2O5RA 2XZUA 2VIIA 4GEWA 4GC9A 2R6FA 4OX9M 4CJ6A 4LF7M 2EJSA 2Z7JA 1BVSA 3GLHB 1QUSA 3L29A 4GH9A 4B08A 2QHOB 3NWLA 4D81A 1XMQM 3L26A 5EXPA 4XK8F 2NQ8C 3FE3A 1UFZA 4FWHA 5ITXE 5IT9S 4AKHA 4B7HA 1J7KA 2RGOA 4LCBA 1IXSA 5DNYA 1HNZM 2LVQD 3B7ZA 3FUVA 4JYAM 1NJFA 1Z59A 3GLIA 1SG9A 4I81A 3KFUG 2DAKA 3SMSA 4Z6YA 2DKLA 1G41A 2C98A 1VDLA 4S12A 1VEGA 3CF6E 2J7NA 2CV2A 1R6BX 4DV6M 1R5LA 1MU5A 2Y0QA 3K1JA 4LFAM 3FTDA 1PJQA 3W68A 1NY5A 2CP8A 1NNJA 4JXJA 3NBXX 3U6PA 1JR3A 2DNAA 1KFVA 2UUCM 3UGJA 1J09A 3HU1A 4AW4A 4DR3M 3FD9A 2ZBKB 2ZAOA 5KPTA 3AKZA 1N34M 3GQ4A 3OTOM 2CRUA 2BWEA 3U6DA 3C58A 1N32M 5DFLA 3KVWA 2XH9A 2XFSA 4Y28F 5JI2E 1GABA 3ILKA 4L6V6 4MB7A 1QYRA 1D0LA 3E46A 4MGKE 4G4OA 4FCVA 3GRUA 3GLFA 2VDBB 2RGHA 2QSFX 2APLA 2KDLA 2KA6B 2HCBA 2QPAA 5C18A 2KRKA 2QZ4A 4GRIA 4DR7M 3PVSA 3SFZA 4DR1M 3U61A 5DYIA 1IBMM 3FRHA 4DR6M 4LGYA 3HHXA 3TE6A 2KHHA 3T1YM 1G4AE 2DWZB 1IY1A 4LF4M 3FKEA 2LH0A 2LHGA 4YHHM 1GJSA 2OQ4A 3D8BA 1PJIA 4QHTA 2C96A 1VG5A 3DZDA 1I94M 2W82A 2XEPA 2CHQA 4LJAA 5IWAM 4AZFA 2WZJA 2XSZA 3R9XB 4NOOB 2JNHA 2DAGA 2Z4SA 4LZZA 3MHVC 1L1ZA 2BWBA 2F4VM 3J7BA 3AJIB 3PFIA 3ZCBB 5KPRA 2G3QA 3U60A 1PJSA 4B7FA 4FWDA 3GLGB 3FTFA 3QAUA 1Z5BA 2FH0A 5KQ8A 4K0KM 1TDZA 1PJTA 2DENA 3J2PB 4CISA 4JI5M 3DOAA 1K3XA 4GHAA 1QDRA 4AQYM 2R18A 3AFHA 4NRVA 3B74A 2V1UA 1HR0M 3TWMA 1LTMA 2Z8YM 1GLNA 2KNVA 4MGIE 2HKJA 1IN7A 4AG5A 3VKGA 1NVMA 1TF0B 1VDDA 2K47A 4P17A 3KP0E 1H6UA 1W5SA 1HQYE 3AOGA 3UJNA 3U6LA 5EJCA 4TUWA 2CHVA 1EFUB 2I7NA 2A5YB 3QWLA 1A5TA 2Y21A 1PGYA 2JXNA 4IBBA 2FNAA 5EP4A 2LWXA 4REZA 4IIWA 4HEOA 1OQYA 3M7GA 4KLNA 4LJ9A 2CV0A 1D2NA 1E94E 1YE9A 2HAKA 3H4MA 1VEJA 3IG8A 4II7A 4ITQA 3HJQA 3H4JA 2VF7A 2OPFA 3PNVA 2UXBM 2RRUA 1MX0A 3MK6A 2YQZA 1E9RA 2R65A 4L15A 3FYCA 2R44A 3FUTA 4ANRA 4NC6A 1YSYA 2HWJA 4PCZA 4I5SA 3KS4A 4L16A 2F5PA 4JI4M 3TWLA 2X49A 3C3DA 2R0IA 5GKNA 3I4YA 4G4RA 2GQFA 1GO5A 2UUBM 3VFDA 3UZUA 3SAUA 4DV2M 3FTEA 1J5EM 1GJTA 1D0KA 3WHLA 3HU3A 2KRUA 1KSFX 3SC3A 1OFHA 2C9CA 2KNAA 3B7QA 1QQWA 4YY3M 3K9PA 3GLIE 1R7RA 3TPZA 1OIPA 2CHGA 1F4IA 2ZAMA 4LGMA 1L8QA 3LCVB 3LVWA 1L1TA 2XZFA 4M9SA 1XHBA 2L4EA 1IY2A 3K8ZA 3Q8GA 3LQRA 3PNYA 2OOAA 4UN2B 3UK6A 1E32A 4KT0F 2DHRA 1NY6A 2JP7A 2BJVA 3HHYA 3KOZE 1T43A 1N78A 3RGSA 2L2DA 4QHSA 5ITRA 3L25A 1V34A 2R46A 3U6CA 5FTJA 3B89A 3C3EA 3NBIA 3GQ3A 2H1RA 1R4GA 3HU2A 4LRTA 1XC8A 2JY5A 2WSEF 3I04M 4MGYE 4NSRA 4RNAA 2DI0A 3U6OA 2J7OA 3T38A 4L8RC 3GP1A 3QYEA 5BR8M 3BBZA 1GL6A 1NNUC 3FTCA 1W5TA 2EUCA 5IREB 3GLFB 1Z6TA 4M0DA 5LMUM 1Q3CA 2DAEA 2EO2A 3BXWA 4X64M 3GLFE 3L28A 4JI2M 4RKUF 3I4VA 3LQQA 4I8OA 3T6PA 2L7HA 2M5ZA 4KODA 4DR4M 3U6QA 1K82A 3LMMA 3KOXE 4Z8XA 5F3WA 4WURA 1WR1B 3GRYA 4RF0A 1YUBA 5DYGA 2FOIC 3AL0C 3ZC7B 3VK8A 4LRSA 4LFBM 1Q39A 4EIWA 1NV9A 1R2ZA 2H5XA 2R4EA 2X4AA 3A45A 3L2AA 5FTNA 1WJ7A 2ERCA 1WXQA 4GC5A 4IBDA 2KW0A 5KPZA 5ITTA 4GITA 3CF2A 1OAOC 1DV0A 3T15A 3JR4A 3ZQJA 3PXGA 1CUKA 2CUZA 4JI8M 3E9SA 4LFCM 4KHPM 2BJWA 3SMPA 2FS1A 4AG6A 1L2BA 1GKIA 2V1CA 4QNRA 4CGYB 2QBYB 2UXCM 2JY8A 2N35A 1JR3E 3ZH9B 2L6OA 1R2YA 1MJGM 1IXRC 4IBIA 3KSXA 3Q8XA 4JV5M 8CATA 4MH0E 3SAVA 4NSOB 3GLHA 3THGA 2P5TA 3A42A 1DGHA 5EXXA 1IN5A 1OAIA 1T6OA 2GNOA 2DWMA 4X66M 4B3RM 4D82A 2ZTDA 3UMMA 4M0WA 1IFYA 4R3DA 3F92A 4OVZA 3LW5F 5ITYA 1HQCA 1Y8GA 4IBEA 2OO9A 1NSFA 1IXSB 1DGHB 1XXHE 2C5RA 4QOZC 1DGBA 4QNMA 1E9SA 4WW0A 5ITXA 2M60A 1ZMWA 2Y0TA 1G59A 3GPPA 1IBLM 2YR0A 4OU7A 3VLFB 2QENA 2DXIA 3VDPA 4AKGA 2KEBA 3AV0A 4AKIA 2MH8A 1QZEA 3U5ZA 2HHHM 4JN6A 4JI7M 1PRBA 7CATA 1XNQM 3GLIB 3GLHE 4A3VB 5C1BA 2RKOA 4G6ZA 4LJ6A 3J80S 3RE8A 1IN8A 1WGNA 3IG5A 3E4RA 3GRVA 4F2LA 2HL7A 3EIEA 2Z4RA 1EIJA 3DFZA 1SXJC 1XMOM 4PD2A 4DBGB 2EKKA 3BOSA 1PJJA 1IY0A 5FSWA 4AI6A 3A46A 3R8FA 3KS8A 4IBKA 2CWBA 1TH3A 4HL4A 2LVOC 2WSCF 1JB0F 3KDSE 1AIPC 3HY5A 3LCUA 4FW9A 4D80A 4DUYM 2E5LM 1IM2A 2LVPC 4QOSA 3CF0A 3I51A 4GKKM 5FTMA 2DWLA 1IBKM 4FCTA 1LV7A 3B7NA 3E21A 3J27B 3TL4X 2VF8A 4DV3M 4GHLA 2JWSA 2LHCA 2XSZD 4MGZE 1OFIA 2VQEM 1AUAA 3M0EA 4GKJM 3W0LB 2LBCA 3U61B 2L4FA 3J81S 1QZMA 3VDUA 5A2QS 1HT1E 5LMNM 1VEKA 3B9PA 5EP2A 5EQTA 3W0FA 4NXNM 1TH2A 4LJ7A 1V33A 2D7GA 2MR9A 2JZ1A 3EIHA 5KO3A 2F5SA 2JZ0A 4RF1A 3LVVA 3HKPA 1SXJD 2LXEA 2CFOA 2QCUA 1KYIA 4HLQA 4X65M 2F5OA 2L09A 4LJ5A 1TGUA 2K0BX 3SBJA 3HGIA 1ZV1A 1N75A 4IBJA 4DV7M 5BPVA 5EXSA 1OIZA 2DZLA 3QYBA 5ITUA 2ZANA 4G4NA 4B3SM 4L4UA 2QBYA 3U6EA 1EE8A 2Q2EB 1SXJB 3C9PA 5JI3E 4G4QA 3T1HM 4IBFA 3SARA 1DGGA 4R7GA 1N77A 3M6AA 4JI1M 4GMQA 2DAMA 4OW0A 3IHPA 3SYLA 4LF6M 3MMPA 1SXJA 3CTWB 3GPUA 3L27A 4G3OA 1ZMVA 4JI0M 4FWGA 1UM8A 2I7PA 1L2CA 2AHMA 2DAIA 2LTUA 2X8AA 3FYDA 2XF3A 3W67A 2R62A 1P3QQ 2Y20A 4LG2A 1D0MA 5E6JA 1NV8A 4BLCA 2UXDM 4W5WA 2B3TA 2KXEA 2V6ZM 1HT2E 1YLAA 4PT5A 4WP2A 5L8RF 3CGWA 4B3MM 2QQ8A 1VQ1A 2LVAA 1IN4A 2VQFM 3GRRA 4LF8M 1DO2A 1FJGM 1T3TA 4LZJA 3JR5A 4DV5M 5EP3A 2CEAA 2DZNB 1ZAEA 4PDIA 2G5GX 3GO8A 5EXTA 2K6BA 3SYKA 2D7HA 2KZUA 1JR3D 3VK7A 1TH4A 1V92A 3FUWA 3MJ5A 2O01F 4PDGA 4NRWA 2YNMD 4Q7JA 3HZJA 4R71A 1JQJC 4DV1M 2XGNA 4BBAA 1C1KA 1FNNA 3FUXA 3HJSA 2EA0A 1XNRM 4LY6A 4F1IA 3WHKA 1SXJE 3J7AS 4OVZB 2OOBA 3SHGB 4BB9A 4X62M 1QANA 1TTEA 3AOEA 4IBGA 3TQSA 3FUUA 1NHGC 2F5NA 3SATA 2ZTCA 3KSJA 1PM5A 2QP9X 2MGWA 2L7IA 1TDHA 1Q02A 5E26A 4DV4M 3SAWA 4MM3B 4CHTB 1DGFA 4XBOA 3TWKA 2C99A 3JAMS 2JA2A 3U6MA 5FLXS 1NHWC 1XB2B 3D8LA 1G3IA 2R45A 3HJ8A 1NO1A 4IJEA 2DZOB 3U5ZB 4JI3M 2YFQA 2CE7A 2G8LA 3RGPA 2R4JA 1IQPA 3HX3A 4L78A 4DR5M 1X37A 3FRIA 4P16A 4MGHA 2K9DA 2XFTA 5FTLA 4ZPXA 1G8PA 4JI6M 2JY7A 2FE8A 3KP1E 5H37D 1OTRA 1WGLA 1WIVA 2D7EA 4DR2M 1WHCA 2KNZA 1OKSA 5KQDA 1S3SA 1XXHA 2DHYA 1Z5AA 4NL4H 2LNHC 1QAMA
chains in the Genus database with same CATH topology
1QAQA 1GL7A 2C9OA 4DUZM 4IBCA 1XXHB 1OJLA 4FD2A 1N33M 1N36M 4FVMA 3K92A 3HHZA 1GVNA 4NXMM 3VKHA 4GIPA 3AOEC 1Q3BA 3SASA 1QAOA 3DA1A 5ITQA 4LF5M 4B3TM 1QVRA 3A98B 2DWNA 1HNWM 1ZQ9A 2BNKA 3GQ5A 4B7GA 4FCWA 2FFJA 1I4WA 1IN6A 1K3WA 2Z3XA 3GPXA 4LJ8A 1XWIA 3U60B 2CV1A 3GLGA 3HWSA 1L2DA 1NJGA 3RFWA 1ORYB 2UU9M 4M9ZA 4M9XA 1IXZA 4DV0M 2UUAM 3GPYA 2F5QA 3KXEC 1Z5CA 5FTKA 5IZ7D 3U6SA 4LF9M 2KZSA 1DO0A 2ZM6M 3KW6A 2DVWB 5EP1A 3KOYE 3SHFA 4KO8A 1HNXM 3KOWE 4XGIA 3K2LA 4IJFA 3HHWA 2XLJA 4I4LA 4LJ4A 2O5RA 2XZUA 2VIIA 4OX9M 4GC9A 4LF7M 2Z7JA 3L29A 3GLHB 4B08A 4GH9A 4D81A 3NWLA 1XMQM 3L26A 5EXPA 2NQ8C 4FWHA 5IT9S 5ITXE 4AKHA 4B7HA 1J7KA 2RGOA 4LCBA 5DNYA 1HNZM 3FUVA 4JYAM 1NJFA 1Z59A 3GLIA 4I81A 3KFUG 3SMSA 4Z6YA 1G41A 2C98A 4S12A 3CF6E 2J7NA 2CV2A 1R6BX 4DV6M 1MU5A 2Y0QA 3K1JA 4LFAM 3FTDA 1NY5A 1NNJA 4JXJA 3U6PA 2UUCM 1JR3A 1KFVA 3UGJA 1J09A 3HU1A 4AW4A 4DR3M 3FD9A 2ZBKB 2ZAOA 5KPTA 3AKZA 1N34M 3GQ4A 3OTOM 3U6DA 3C58A 1N32M 3KVWA 2XH9A 2XFSA 5JI2E 3ILKA 4MB7A 4G4OA 1QYRA 4MGKE 4FCVA 3GRUA 3GLFA 2RGHA 2KA6B 2HCBA 2QPAA 5C18A 2KRKA 2QZ4A 4GRIA 4DR7M 3PVSA 3SFZA 4DR1M 3U61A 5DYIA 1IBMM 4DR6M 4LGYA 3HHXA 3TE6A 3T1YM 1G4AE 2DWZB 1IY1A 4LF4M 3FKEA 2LH0A 4YHHM 2OQ4A 3D8BA 1PJIA 4QHTA 2C96A 3DZDA 1I94M 2W82A 2XEPA 2CHQA 4LJAA 5IWAM 4AZFA 2XSZA 3R9XB 4NOOB 2Z4SA 4LZZA 3MHVC 1L1ZA 2F4VM 3J7BA 3AJIB 3PFIA 3ZCBB 5KPRA 3U60A 4B7FA 4FWDA 3GLGB 3FTFA 3QAUA 1Z5BA 5KQ8A 4K0KM 1TDZA 3J2PB 4CISA 4JI5M 3DOAA 1K3XA 4GHAA 4AQYM 2R18A 3AFHA 4NRVA 2V1UA 1HR0M 3TWMA 1GLNA 4MGIE 2HKJA 1IN7A 4AG5A 3VKGA 1NVMA 1VDDA 2K47A 3KP0E 1H6UA 1W5SA 1HQYE 3AOGA 3UJNA 3U6LA 5EJCA 4TUWA 2CHVA 3QWLA 2I7NA 2A5YB 2Y21A 4IBBA 2FNAA 5EP4A 2LWXA 4REZA 4IIWA 3M7GA 4KLNA 4LJ9A 2CV0A 1D2NA 1E94E 1YE9A 3H4MA 4ITQA 3IG8A 4II7A 3HJQA 2OPFA 3PNVA 2UXBM 1MX0A 3MK6A 2YQZA 1E9RA 2R65A 4L15A 3FYCA 3FUTA 1YSYA 4PCZA 4I5SA 3KS4A 4L16A 2F5PA 4JI4M 3TWLA 2X49A 5GKNA 3I4YA 4G4RA 2UUBM 3VFDA 3UZUA 3SAUA 4DV2M 3FTEA 1J5EM 3WHLA 3HU3A 2KRUA 1KSFX 3SC3A 1OFHA 2C9CA 4YY3M 1QQWA 1R7RA 3TPZA 2CHGA 2ZAMA 4LGMA 1L8QA 1L1TA 3LVWA 2XZFA 4M9SA 1XHBA 1IY2A 3K8ZA 3LQRA 3PNYA 3UK6A 1E32A 2DHRA 1NY6A 2BJVA 3HHYA 3KOZE 1N78A 3RGSA 4QHSA 5ITRA 3L25A 2R46A 3U6CA 5FTJA 3GQ3A 3NBIA 1XC8A 2H1RA 3HU2A 4LRTA 4MGYE 4NSRA 4RNAA 3U6OA 2J7OA 3T38A 4L8RC 3GP1A 5BR8M 1GL6A 1NNUC 3FTCA 1W5TA 2EUCA 5IREB 3GLFB 1Z6TA 4M0DA 5LMUM 1Q3CA 2EO2A 4X64M 4JI2M 3L28A 3I4VA 3LQQA 4I8OA 2L7HA 2M5ZA 4KODA 4DR4M 3U6QA 1K82A 3LMMA 3KOXE 4Z8XA 5F3WA 4WURA 3GRYA 4RF0A 1YUBA 5DYGA 2FOIC 3AL0C 3ZC7B 3VK8A 4LRSA 4LFBM 1Q39A 4EIWA 1R2ZA 2R4EA 2X4AA 3A45A 3L2AA 5FTNA 4IBDA 2ERCA 1WXQA 4GC5A 2KW0A 5KPZA 5ITTA 4GITA 3CF2A 3T15A 3JR4A 3PXGA 2CUZA 4JI8M 3E9SA 4LFCM 4KHPM 2BJWA 3SMPA 4AG6A 1L2BA 1GKIA 2V1CA 4QNRA 4CGYB 2QBYB 2UXCM 3ZH9B 2L6OA 1R2YA 1IXRC 4IBIA 3KSXA 3Q8XA 4JV5M 8CATA 4MH0E 3SAVA 4NSOB 3GLHA 3THGA 2P5TA 3A42A 1DGHA 5EXXA 1IN5A 2DWMA 4X66M 4B3RM 4D82A 3UMMA 4M0WA 4R3DA 4OVZA 5ITYA 1HQCA 4IBEA 2C5RA 1NSFA 1IXSB 1DGHB 4QOZC 1DGBA 4QNMA 1E9SA 4WW0A 5ITXA 2M60A 1G59A 2Y0TA 3GPPA 1IBLM 2YR0A 4OU7A 3VLFB 2QENA 2DXIA 3VDPA 4AKGA 2KEBA 3AV0A 4AKIA 3U5ZA 2HHHM 4JN6A 4JI7M 7CATA 1XNQM 3GLIB 4A3VB 5C1BA 4G6ZA 2RKOA 4LJ6A 3J80S 3RE8A 1IN8A 3IG5A 3E4RA 3GRVA 2HL7A 3EIEA 2Z4RA 3DFZA 1SXJC 1XMOM 4PD2A 3BOSA 1PJJA 1IY0A 5FSWA 4AI6A 3A46A 3R8FA 3KS8A 4IBKA 4HL4A 1TH3A 3KDSE 4FW9A 2E5LM 4D80A 4DUYM 1IM2A 4QOSA 3CF0A 3I51A 4GKKM 5FTMA 2DWLA 1IBKM 4FCTA 1LV7A 3J27B 3TL4X 4DV3M 4GHLA 2XSZD 4MGZE 1OFIA 2VQEM 3M0EA 4GKJM 3W0LB 3U61B 3J81S 1QZMA 3VDUA 5A2QS 1HT1E 5LMNM 3B9PA 5EP2A 5EQTA 3W0FA 4NXNM 1TH2A 4LJ7A 2D7GA 3EIHA 5KO3A 2F5SA 4RF1A 3LVVA 3HKPA 1SXJD 2LXEA 2CFOA 2QCUA 1KYIA 4HLQA 4X65M 2F5OA 2L09A 4LJ5A 1TGUA 3SBJA 3HGIA 1N75A 4IBJA 4DV7M 5BPVA 5EXSA 5ITUA 2ZANA 4G4NA 4B3SM 4L4UA 2QBYA 3U6EA 1EE8A 2Q2EB 1SXJB 5JI3E 4G4QA 3T1HM 4IBFA 3SARA 1DGGA 4R7GA 1N77A 3M6AA 4JI1M 4GMQA 4OW0A 3SYLA 4LF6M 1SXJA 3CTWB 3GPUA 3L27A 4JI0M 4FWGA 1UM8A 2I7PA 1L2CA 2AHMA 2X8AA 3FYDA 2XF3A 2R62A 2Y20A 4LG2A 5E6JA 4BLCA 2UXDM 4W5WA 2KXEA 2V6ZM 1HT2E 4PT5A 4B3MM 1IN4A 2VQFM 3GRRA 4LF8M 1DO2A 1FJGM 1T3TA 4LZJA 3JR5A 4DV5M 5EP3A 2CEAA 2DZNB 1ZAEA 4PDIA 2G5GX 3GO8A 5EXTA 3SYKA 2D7HA 2KZUA 1JR3D 3VK7A 1TH4A 3FUWA 3MJ5A 4PDGA 4NRWA 2YNMD 4DV1M 1JQJC 2XGNA 4BBAA 1C1KA 1FNNA 3FUXA 3HJSA 2EA0A 1XNRM 4LY6A 3WHKA 1SXJE 3J7AS 4OVZB 3SHGB 4BB9A 4X62M 1QANA 3AOEA 4IBGA 3TQSA 3FUUA 1NHGC 2F5NA 3SATA 3KSJA 1PM5A 2QP9X 5E26A 2L7IA 1TDHA 4DV4M 3SAWA 4MM3B 4CHTB 1DGFA 4XBOA 3TWKA 2C99A 3JAMS 2JA2A 3U6MA 5FLXS 1NHWC 3D8LA 1G3IA 2R45A 3HJ8A 4IJEA 2DZOB 3U5ZB 4JI3M 2YFQA 2CE7A 2G8LA 3RGPA 2R4JA 1IQPA 4L78A 4DR5M 1X37A 4P16A 4MGHA 2XFTA 5FTLA 4ZPXA 1G8PA 4JI6M 2FE8A 3KP1E 5H37D 4DR2M 2D7EA 5KQDA 1S3SA 1XXHA 1Z5AA 4NL4H 2LNHC 1QAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W0F A;  4NXN M;  5IWA M;  5LMU M;  4DUZ M;  1Q3C A;  4X64 M;  2F5S A;  4JI2 M;  1L1Z A;  2F4V M;  1N33 M;  1N36 M;  4NXM M;  4X65 M;  2F5O A;  1Q3B A;  3SAS A;  3SBJ A;  4DR4 M;  5ITQ A;  3U6Q A;  1Z5B A;  1K82 A;  4LF5 M;  4K0K M;  4B3T M;  4DV7 M;  1TDZ A;  4CIS A;  4JI5 M;  3DOA A;  1K3X A;  5ITU A;  4B3S M;  4G4N A;  3VK8 A;  4AQY M;  4NRV A;  4LFB M;  1Q39 A;  1HR0 M;  3TWM A;  3U6E A;  1EE8 A;  2Q2E B;  1R2Z A;  3A45 A;  1HNW M;  4G4Q A;  3T1H M;  3GQ5 A;  3SAR A;  2HKJ A;  4JI1 M;  5ITT A;  1K3W A;  3GPX A;  4LF6 M;  1L2D A;  3GPU A;  3JR4 A;  4JI0 M;  3U6L A;  1L2C A;  4JI8 M;  2UU9 M;  4LFC M;  4KHP M;  4DV0 M;  2UUA M;  3GPY A;  2F5Q A;  1Z5C A;  3U6S A;  1L2B A;  4LF9 M;  2ZM6 M;  2UXC M;  1R2Y A;  2UXD M;  1HNX M;  4JV5 M;  4ITQ A;  3SAV A;  3A42 A;  4X66 M;  2OPF A;  4B3R M;  4B3M M;  2XZU A;  1MX0 A;  4OX9 M;  2UXB M;  5ITY A;  2VQF M;  1FJG M;  4LF8 M;  4LF7 M;  3JR5 A;  4DV5 M;  1XMQ M;  4PCZ A;  4PDI A;  3GO8 A;  5ITX A;  2F5P A;  5ITX E;  5IT9 S;  3VK7 A;  3GPP A;  1IBL M;  4JI4 M;  3TWL A;  4PDG A;  1HNZ M;  4NRW A;  4DV1 M;  4JYA M;  1Z59 A;  4G4R A;  2EA0 A;  2UUB M;  1XNR M;  3SAU A;  3J7A S;  4DV2 M;  1J5E M;  2HHH M;  4X62 M;  4JI7 M;  1XNQ M;  4DV6 M;  1MU5 A;  4YY3 M;  3J80 S;  4LFA M;  2F5N A;  3SAT A;  1PM5 A;  1NNJ A;  3U6P A;  2UUC M;  4DV4 M;  1TDH A;  1KFV A;  3SAW A;  1L1T A;  4DR3 M;  2XZF A;  3TWK A;  1XMO M;  2ZBK B;  4PD2 A;  3JAM S;  1N34 M;  3GQ4 A;  3U6M A;  3OTO M;  5FLX S;  1PJJ A;  3A46 A;  3U6D A;  3C58 A;  1N32 M;  4JI3 M;  4MB7 A;  4G4O A;  2E5L M;  4DUY M;  4DR5 M;  5ITR A;  3U6C A;  4GKK M;  1IBK M;  4JI6 M;  4DR7 M;  4DR1 M;  3GQ3 A;  4DV3 M;  1XC8 A;  4DR6 M;  1IBM M;  4DR2 M;  3U6O A;  3T1Y M;  4LF4 M;  2VQE M;  3GP1 A;  4YHH M;  4GKJ M;  5BR8 M;  2OQ4 A;  3J81 S;  1PJI A;  1Z5A A;  1I94 M;  5A2Q S;  5LMN M; 
#chains in the Genus database with same CATH topology
 2EKF A;  1QAQ A;  2QNJ A;  1GL7 A;  2O25 A;  2C9O A;  2LVN C;  4DUZ M;  4IBC A;  1XXH B;  3K9O A;  1OJL A;  4FD2 A;  1N33 M;  1N36 M;  4FVM A;  3K92 A;  3HHZ A;  1GVN A;  4NXM M;  3VKH A;  4GIP A;  3AOE C;  1G71 A;  1Q3B A;  2JUJ A;  1QAO A;  1TR8 A;  3DA1 A;  3V76 A;  5ITQ A;  3SAS A;  4LF5 M;  1C7Y A;  4B3T M;  1QUT A;  2MJ5 B;  1QVR A;  1MN3 A;  2J5Y A;  2WSF F;  3A98 B;  3GLG E;  1RU3 A;  2DWN A;  1HNW M;  1ZQ9 A;  2BNK A;  3GQ5 A;  4B7G A;  4FCW A;  2FFJ A;  1I4W A;  1IN6 A;  1K3W A;  2Z3X A;  3GPX A;  4LJ8 A;  1XWI A;  3U60 B;  3IEC A;  2CV1 A;  3GLG A;  1QDT A;  3HWS A;  1L2D A;  1NJG A;  3RFW A;  1HJP A;  1ORY B;  3I01 M;  2UU9 M;  4M9Z A;  4M9X A;  1IXZ A;  4DV0 M;  2UUA M;  3GPY A;  2F5Q A;  3KXE C;  1Z5C A;  5FTK A;  5IZ7 D;  3U6S A;  4LF9 M;  2KZS A;  1DO0 A;  2ZM6 M;  4CIZ A;  3KW6 A;  2DVW B;  5EP1 A;  1ZMU A;  2JY6 B;  3KOY E;  3SHF A;  4KO8 A;  1HNX M;  3KOW E;  4XGI A;  3K2L A;  4IJF A;  3HHW A;  2XLJ A;  2MRO B;  4I4L A;  4LJ4 A;  2O5R A;  2XZU A;  2VII A;  4GEW A;  4GC9 A;  2R6F A;  4OX9 M;  4CJ6 A;  4LF7 M;  2EJS A;  2Z7J A;  1BVS A;  3GLH B;  1QUS A;  3L29 A;  4GH9 A;  4B08 A;  2QHO B;  3NWL A;  4D81 A;  1XMQ M;  3L26 A;  5EXP A;  4XK8 F;  2NQ8 C;  3FE3 A;  1UFZ A;  4FWH A;  5ITX E;  5IT9 S;  4AKH A;  4B7H A;  1J7K A;  2RGO A;  4LCB A;  1IXS A;  5DNY A;  1HNZ M;  2LVQ D;  3B7Z A;  3FUV A;  4JYA M;  1NJF A;  1Z59 A;  3GLI A;  1SG9 A;  4I81 A;  3KFU G;  2DAK A;  3SMS A;  4Z6Y A;  2DKL A;  1G41 A;  2C98 A;  1VDL A;  4S12 A;  1VEG A;  3CF6 E;  2J7N A;  2CV2 A;  1R6B X;  4DV6 M;  1R5L A;  1MU5 A;  2Y0Q A;  3K1J A;  4LFA M;  3FTD A;  1PJQ A;  3W68 A;  1NY5 A;  2CP8 A;  1NNJ A;  4JXJ A;  3NBX X;  3U6P A;  1JR3 A;  2DNA A;  1KFV A;  2UUC M;  3UGJ A;  1J09 A;  3HU1 A;  4AW4 A;  4DR3 M;  3FD9 A;  2ZBK B;  2ZAO A;  5KPT A;  3AKZ A;  1N34 M;  3GQ4 A;  3OTO M;  2CRU A;  2BWE A;  3U6D A;  3C58 A;  1N32 M;  5DFL A;  3KVW A;  2XH9 A;  2XFS A;  4Y28 F;  5JI2 E;  1GAB A;  3ILK A;  4L6V 6;  4MB7 A;  1QYR A;  1D0L A;  3E46 A;  4MGK E;  4G4O A;  4FCV A;  3GRU A;  3GLF A;  2VDB B;  2RGH A;  2QSF X;  2APL A;  2KDL A;  2KA6 B;  2HCB A;  2QPA A;  5C18 A;  2KRK A;  2QZ4 A;  4GRI A;  4DR7 M;  3PVS A;  3SFZ A;  4DR1 M;  3U61 A;  5DYI A;  1IBM M;  3FRH A;  4DR6 M;  4LGY A;  3HHX A;  3TE6 A;  2KHH A;  3T1Y M;  1G4A E;  2DWZ B;  1IY1 A;  4LF4 M;  3FKE A;  2LH0 A;  2LHG A;  4YHH M;  1GJS A;  2OQ4 A;  3D8B A;  1PJI A;  4QHT A;  2C96 A;  1VG5 A;  3DZD A;  1I94 M;  2W82 A;  2XEP A;  2CHQ A;  4LJA A;  5IWA M;  4AZF A;  2WZJ A;  2XSZ A;  3R9X B;  4NOO B;  2JNH A;  2DAG A;  2Z4S A;  4LZZ A;  3MHV C;  1L1Z A;  2BWB A;  2F4V M;  3J7B A;  3AJI B;  3PFI A;  3ZCB B;  5KPR A;  2G3Q A;  3U60 A;  1PJS A;  4B7F A;  4FWD A;  3GLG B;  3FTF A;  3QAU A;  1Z5B A;  2FH0 A;  5KQ8 A;  4K0K M;  1TDZ A;  1PJT A;  2DEN A;  3J2P B;  4CIS A;  4JI5 M;  3DOA A;  1K3X A;  4GHA A;  1QDR A;  4AQY M;  2R18 A;  3AFH A;  4NRV A;  3B74 A;  2V1U A;  1HR0 M;  3TWM A;  1LTM A;  2Z8Y M;  1GLN A;  2KNV A;  4MGI E;  2HKJ A;  1IN7 A;  4AG5 A;  3VKG A;  1NVM A;  1TF0 B;  1VDD A;  2K47 A;  4P17 A;  3KP0 E;  1H6U A;  1W5S A;  1HQY E;  3AOG A;  3UJN A;  3U6L A;  5EJC A;  4TUW A;  2CHV A;  1EFU B;  2I7N A;  2A5Y B;  3QWL A;  1A5T A;  2Y21 A;  1PGY A;  2JXN A;  4IBB A;  2FNA A;  5EP4 A;  2LWX A;  4REZ A;  4IIW A;  4HEO A;  1OQY A;  3M7G A;  4KLN A;  4LJ9 A;  2CV0 A;  1D2N A;  1E94 E;  1YE9 A;  2HAK A;  3H4M A;  1VEJ A;  3IG8 A;  4II7 A;  4ITQ A;  3HJQ A;  3H4J A;  2VF7 A;  2OPF A;  3PNV A;  2UXB M;  2RRU A;  1MX0 A;  3MK6 A;  2YQZ A;  1E9R A;  2R65 A;  4L15 A;  3FYC A;  2R44 A;  3FUT A;  4ANR A;  4NC6 A;  1YSY A;  2HWJ A;  4PCZ A;  4I5S A;  3KS4 A;  4L16 A;  2F5P A;  4JI4 M;  3TWL A;  2X49 A;  3C3D A;  2R0I A;  5GKN A;  3I4Y A;  4G4R A;  2GQF A;  1GO5 A;  2UUB M;  3VFD A;  3UZU A;  3SAU A;  4DV2 M;  3FTE A;  1J5E M;  1GJT A;  1D0K A;  3WHL A;  3HU3 A;  2KRU A;  1KSF X;  3SC3 A;  1OFH A;  2C9C A;  2KNA A;  3B7Q A;  1QQW A;  4YY3 M;  3K9P A;  3GLI E;  1R7R A;  3TPZ A;  1OIP A;  2CHG A;  1F4I A;  2ZAM A;  4LGM A;  1L8Q A;  3LCV B;  3LVW A;  1L1T A;  2XZF A;  4M9S A;  1XHB A;  2L4E A;  1IY2 A;  3K8Z A;  3Q8G A;  3LQR A;  3PNY A;  2OOA A;  4UN2 B;  3UK6 A;  1E32 A;  4KT0 F;  2DHR A;  1NY6 A;  2JP7 A;  2BJV A;  3HHY A;  3KOZ E;  1T43 A;  1N78 A;  3RGS A;  2L2D A;  4QHS A;  5ITR A;  3L25 A;  1V34 A;  2R46 A;  3U6C A;  5FTJ A;  3B89 A;  3C3E A;  3NBI A;  3GQ3 A;  2H1R A;  1R4G A;  3HU2 A;  4LRT A;  1XC8 A;  2JY5 A;  2WSE F;  3I04 M;  4MGY E;  4NSR A;  4RNA A;  2DI0 A;  3U6O A;  2J7O A;  3T38 A;  4L8R C;  3GP1 A;  3QYE A;  5BR8 M;  3BBZ A;  1GL6 A;  1NNU C;  3FTC A;  1W5T A;  2EUC A;  5IRE B;  3GLF B;  1Z6T A;  4M0D A;  5LMU M;  1Q3C A;  2DAE A;  2EO2 A;  3BXW A;  4X64 M;  3GLF E;  3L28 A;  4JI2 M;  4RKU F;  3I4V A;  3LQQ A;  4I8O A;  3T6P A;  2L7H A;  2M5Z A;  4KOD A;  4DR4 M;  3U6Q A;  1K82 A;  3LMM A;  3KOX E;  4Z8X A;  5F3W A;  4WUR A;  1WR1 B;  3GRY A;  4RF0 A;  1YUB A;  5DYG A;  2FOI C;  3AL0 C;  3ZC7 B;  3VK8 A;  4LRS A;  4LFB M;  1Q39 A;  4EIW A;  1NV9 A;  1R2Z A;  2H5X A;  2R4E A;  2X4A A;  3A45 A;  3L2A A;  5FTN A;  1WJ7 A;  2ERC A;  1WXQ A;  4GC5 A;  4IBD A;  2KW0 A;  5KPZ A;  5ITT A;  4GIT A;  3CF2 A;  1OAO C;  1DV0 A;  3T15 A;  3JR4 A;  3ZQJ A;  3PXG A;  1CUK A;  2CUZ A;  4JI8 M;  3E9S A;  4LFC M;  4KHP M;  2BJW A;  3SMP A;  2FS1 A;  4AG6 A;  1L2B A;  1GKI A;  2V1C A;  4QNR A;  4CGY B;  2QBY B;  2UXC M;  2JY8 A;  2N35 A;  1JR3 E;  3ZH9 B;  2L6O A;  1R2Y A;  1MJG M;  1IXR C;  4IBI A;  3KSX A;  3Q8X A;  4JV5 M;  8CAT A;  4MH0 E;  3SAV A;  4NSO B;  3GLH A;  3THG A;  2P5T A;  3A42 A;  1DGH A;  5EXX A;  1IN5 A;  1OAI A;  1T6O A;  2GNO A;  2DWM A;  4X66 M;  4B3R M;  4D82 A;  2ZTD A;  3UMM A;  4M0W A;  1IFY A;  4R3D A;  3F92 A;  4OVZ A;  3LW5 F;  5ITY A;  1HQC A;  1Y8G A;  4IBE A;  2OO9 A;  1NSF A;  1IXS B;  1DGH B;  1XXH E;  2C5R A;  4QOZ C;  1DGB A;  4QNM A;  1E9S A;  4WW0 A;  5ITX A;  2M60 A;  1ZMW A;  2Y0T A;  1G59 A;  3GPP A;  1IBL M;  2YR0 A;  4OU7 A;  3VLF B;  2QEN A;  2DXI A;  3VDP A;  4AKG A;  2KEB A;  3AV0 A;  4AKI A;  2MH8 A;  1QZE A;  3U5Z A;  2HHH M;  4JN6 A;  4JI7 M;  1PRB A;  7CAT A;  1XNQ M;  3GLI B;  3GLH E;  4A3V B;  5C1B A;  2RKO A;  4G6Z A;  4LJ6 A;  3J80 S;  3RE8 A;  1IN8 A;  1WGN A;  3IG5 A;  3E4R A;  3GRV A;  4F2L A;  2HL7 A;  3EIE A;  2Z4R A;  1EIJ A;  3DFZ A;  1SXJ C;  1XMO M;  4PD2 A;  4DBG B;  2EKK A;  3BOS A;  1PJJ A;  1IY0 A;  5FSW A;  4AI6 A;  3A46 A;  3R8F A;  3KS8 A;  4IBK A;  2CWB A;  1TH3 A;  4HL4 A;  2LVO C;  2WSC F;  1JB0 F;  3KDS E;  1AIP C;  3HY5 A;  3LCU A;  4FW9 A;  4D80 A;  4DUY M;  2E5L M;  1IM2 A;  2LVP C;  4QOS A;  3CF0 A;  3I51 A;  4GKK M;  5FTM A;  2DWL A;  1IBK M;  4FCT A;  1LV7 A;  3B7N A;  3E21 A;  3J27 B;  3TL4 X;  2VF8 A;  4DV3 M;  4GHL A;  2JWS A;  2LHC A;  2XSZ D;  4MGZ E;  1OFI A;  2VQE M;  1AUA A;  3M0E A;  4GKJ M;  3W0L B;  2LBC A;  3U61 B;  2L4F A;  3J81 S;  1QZM A;  3VDU A;  5A2Q S;  1HT1 E;  5LMN M;  1VEK A;  3B9P A;  5EP2 A;  5EQT A;  3W0F A;  4NXN M;  1TH2 A;  4LJ7 A;  1V33 A;  2D7G A;  2MR9 A;  2JZ1 A;  3EIH A;  5KO3 A;  2F5S A;  2JZ0 A;  4RF1 A;  3LVV A;  3HKP A;  1SXJ D;  2LXE A;  2CFO A;  2QCU A;  1KYI A;  4HLQ A;  4X65 M;  2F5O A;  2L09 A;  4LJ5 A;  1TGU A;  2K0B X;  3SBJ A;  3HGI A;  1ZV1 A;  1N75 A;  4IBJ A;  4DV7 M;  5BPV A;  5EXS A;  1OIZ A;  2DZL A;  3QYB A;  5ITU A;  2ZAN A;  4G4N A;  4B3S M;  4L4U A;  2QBY A;  3U6E A;  1EE8 A;  2Q2E B;  1SXJ B;  3C9P A;  5JI3 E;  4G4Q A;  3T1H M;  4IBF A;  3SAR A;  1DGG A;  4R7G A;  1N77 A;  3M6A A;  4JI1 M;  4GMQ A;  2DAM A;  4OW0 A;  3IHP A;  3SYL A;  4LF6 M;  3MMP A;  1SXJ A;  3CTW B;  3GPU A;  3L27 A;  4G3O A;  1ZMV A;  4JI0 M;  4FWG A;  1UM8 A;  2I7P A;  1L2C A;  2AHM A;  2DAI A;  2LTU A;  2X8A A;  3FYD A;  2XF3 A;  3W67 A;  2R62 A;  1P3Q Q;  2Y20 A;  4LG2 A;  1D0M A;  5E6J A;  1NV8 A;  4BLC A;  2UXD M;  4W5W A;  2B3T A;  2KXE A;  2V6Z M;  1HT2 E;  1YLA A;  4PT5 A;  4WP2 A;  5L8R F;  3CGW A;  4B3M M;  2QQ8 A;  1VQ1 A;  2LVA A;  1IN4 A;  2VQF M;  3GRR A;  4LF8 M;  1DO2 A;  1FJG M;  1T3T A;  4LZJ A;  3JR5 A;  4DV5 M;  5EP3 A;  2CEA A;  2DZN B;  1ZAE A;  4PDI A;  2G5G X;  3GO8 A;  5EXT A;  2K6B A;  3SYK A;  2D7H A;  2KZU A;  1JR3 D;  3VK7 A;  1TH4 A;  1V92 A;  3FUW A;  3MJ5 A;  2O01 F;  4PDG A;  4NRW A;  2YNM D;  4Q7J A;  3HZJ A;  4R71 A;  1JQJ C;  4DV1 M;  2XGN A;  4BBA A;  1C1K A;  1FNN A;  3FUX A;  3HJS A;  2EA0 A;  1XNR M;  4LY6 A;  4F1I A;  3WHK A;  1SXJ E;  3J7A S;  4OVZ B;  2OOB A;  3SHG B;  4BB9 A;  4X62 M;  1QAN A;  1TTE A;  3AOE A;  4IBG A;  3TQS A;  3FUU A;  1NHG C;  2F5N A;  3SAT A;  2ZTC A;  3KSJ A;  1PM5 A;  2QP9 X;  2MGW A;  2L7I A;  1TDH A;  1Q02 A;  5E26 A;  4DV4 M;  3SAW A;  4MM3 B;  4CHT B;  1DGF A;  4XBO A;  3TWK A;  2C99 A;  3JAM S;  2JA2 A;  3U6M A;  5FLX S;  1NHW C;  1XB2 B;  3D8L A;  1G3I A;  2R45 A;  3HJ8 A;  1NO1 A;  4IJE A;  2DZO B;  3U5Z B;  4JI3 M;  2YFQ A;  2CE7 A;  2G8L A;  3RGP A;  2R4J A;  1IQP A;  3HX3 A;  4L78 A;  4DR5 M;  1X37 A;  3FRI A;  4P16 A;  4MGH A;  2K9D A;  2XFT A;  5FTL A;  4ZPX A;  1G8P A;  4JI6 M;  2JY7 A;  2FE8 A;  3KP1 E;  5H37 D;  1OTR A;  1WGL A;  1WIV A;  2D7E A;  4DR2 M;  1WHC A;  2KNZ A;  1OKS A;  5KQD A;  1S3S A;  1XXH A;  2DHY A;  1Z5A A;  4NL4 H;  2LNH C;  1QAM A; 
#chains in the Genus database with same CATH homology
 1QAQ A;  1GL7 A;  2C9O A;  4DUZ M;  4IBC A;  1XXH B;  1OJL A;  4FD2 A;  1N33 M;  1N36 M;  4FVM A;  3K92 A;  3HHZ A;  1GVN A;  4NXM M;  3VKH A;  4GIP A;  3AOE C;  1Q3B A;  3SAS A;  1QAO A;  3DA1 A;  5ITQ A;  4LF5 M;  4B3T M;  1QVR A;  3A98 B;  2DWN A;  1HNW M;  1ZQ9 A;  2BNK A;  3GQ5 A;  4B7G A;  4FCW A;  2FFJ A;  1I4W A;  1IN6 A;  1K3W A;  2Z3X A;  3GPX A;  4LJ8 A;  1XWI A;  3U60 B;  2CV1 A;  3GLG A;  3HWS A;  1L2D A;  1NJG A;  3RFW A;  1ORY B;  2UU9 M;  4M9Z A;  4M9X A;  1IXZ A;  4DV0 M;  2UUA M;  3GPY A;  2F5Q A;  3KXE C;  1Z5C A;  5FTK A;  5IZ7 D;  3U6S A;  4LF9 M;  2KZS A;  1DO0 A;  2ZM6 M;  3KW6 A;  2DVW B;  5EP1 A;  3KOY E;  3SHF A;  4KO8 A;  1HNX M;  3KOW E;  4XGI A;  3K2L A;  4IJF A;  3HHW A;  2XLJ A;  4I4L A;  4LJ4 A;  2O5R A;  2XZU A;  2VII A;  4OX9 M;  4GC9 A;  4LF7 M;  2Z7J A;  3L29 A;  3GLH B;  4B08 A;  4GH9 A;  4D81 A;  3NWL A;  1XMQ M;  3L26 A;  5EXP A;  2NQ8 C;  4FWH A;  5IT9 S;  5ITX E;  4AKH A;  4B7H A;  1J7K A;  2RGO A;  4LCB A;  5DNY A;  1HNZ M;  3FUV A;  4JYA M;  1NJF A;  1Z59 A;  3GLI A;  4I81 A;  3KFU G;  3SMS A;  4Z6Y A;  1G41 A;  2C98 A;  4S12 A;  3CF6 E;  2J7N A;  2CV2 A;  1R6B X;  4DV6 M;  1MU5 A;  2Y0Q A;  3K1J A;  4LFA M;  3FTD A;  1NY5 A;  1NNJ A;  4JXJ A;  3U6P A;  2UUC M;  1JR3 A;  1KFV A;  3UGJ A;  1J09 A;  3HU1 A;  4AW4 A;  4DR3 M;  3FD9 A;  2ZBK B;  2ZAO A;  5KPT A;  3AKZ A;  1N34 M;  3GQ4 A;  3OTO M;  3U6D A;  3C58 A;  1N32 M;  3KVW A;  2XH9 A;  2XFS A;  5JI2 E;  3ILK A;  4MB7 A;  4G4O A;  1QYR A;  4MGK E;  4FCV A;  3GRU A;  3GLF A;  2RGH A;  2KA6 B;  2HCB A;  2QPA A;  5C18 A;  2KRK A;  2QZ4 A;  4GRI A;  4DR7 M;  3PVS A;  3SFZ A;  4DR1 M;  3U61 A;  5DYI A;  1IBM M;  4DR6 M;  4LGY A;  3HHX A;  3TE6 A;  3T1Y M;  1G4A E;  2DWZ B;  1IY1 A;  4LF4 M;  3FKE A;  2LH0 A;  4YHH M;  2OQ4 A;  3D8B A;  1PJI A;  4QHT A;  2C96 A;  3DZD A;  1I94 M;  2W82 A;  2XEP A;  2CHQ A;  4LJA A;  5IWA M;  4AZF A;  2XSZ A;  3R9X B;  4NOO B;  2Z4S A;  4LZZ A;  3MHV C;  1L1Z A;  2F4V M;  3J7B A;  3AJI B;  3PFI A;  3ZCB B;  5KPR A;  3U60 A;  4B7F A;  4FWD A;  3GLG B;  3FTF A;  3QAU A;  1Z5B A;  5KQ8 A;  4K0K M;  1TDZ A;  3J2P B;  4CIS A;  4JI5 M;  3DOA A;  1K3X A;  4GHA A;  4AQY M;  2R18 A;  3AFH A;  4NRV A;  2V1U A;  1HR0 M;  3TWM A;  1GLN A;  4MGI E;  2HKJ A;  1IN7 A;  4AG5 A;  3VKG A;  1NVM A;  1VDD A;  2K47 A;  3KP0 E;  1H6U A;  1W5S A;  1HQY E;  3AOG A;  3UJN A;  3U6L A;  5EJC A;  4TUW A;  2CHV A;  3QWL A;  2I7N A;  2A5Y B;  2Y21 A;  4IBB A;  2FNA A;  5EP4 A;  2LWX A;  4REZ A;  4IIW A;  3M7G A;  4KLN A;  4LJ9 A;  2CV0 A;  1D2N A;  1E94 E;  1YE9 A;  3H4M A;  4ITQ A;  3IG8 A;  4II7 A;  3HJQ A;  2OPF A;  3PNV A;  2UXB M;  1MX0 A;  3MK6 A;  2YQZ A;  1E9R A;  2R65 A;  4L15 A;  3FYC A;  3FUT A;  1YSY A;  4PCZ A;  4I5S A;  3KS4 A;  4L16 A;  2F5P A;  4JI4 M;  3TWL A;  2X49 A;  5GKN A;  3I4Y A;  4G4R A;  2UUB M;  3VFD A;  3UZU A;  3SAU A;  4DV2 M;  3FTE A;  1J5E M;  3WHL A;  3HU3 A;  2KRU A;  1KSF X;  3SC3 A;  1OFH A;  2C9C A;  4YY3 M;  1QQW A;  1R7R A;  3TPZ A;  2CHG A;  2ZAM A;  4LGM A;  1L8Q A;  1L1T A;  3LVW A;  2XZF A;  4M9S A;  1XHB A;  1IY2 A;  3K8Z A;  3LQR A;  3PNY A;  3UK6 A;  1E32 A;  2DHR A;  1NY6 A;  2BJV A;  3HHY A;  3KOZ E;  1N78 A;  3RGS A;  4QHS A;  5ITR A;  3L25 A;  2R46 A;  3U6C A;  5FTJ A;  3GQ3 A;  3NBI A;  1XC8 A;  2H1R A;  3HU2 A;  4LRT A;  4MGY E;  4NSR A;  4RNA A;  3U6O A;  2J7O A;  3T38 A;  4L8R C;  3GP1 A;  5BR8 M;  1GL6 A;  1NNU C;  3FTC A;  1W5T A;  2EUC A;  5IRE B;  3GLF B;  1Z6T A;  4M0D A;  5LMU M;  1Q3C A;  2EO2 A;  4X64 M;  4JI2 M;  3L28 A;  3I4V A;  3LQQ A;  4I8O A;  2L7H A;  2M5Z A;  4KOD A;  4DR4 M;  3U6Q A;  1K82 A;  3LMM A;  3KOX E;  4Z8X A;  5F3W A;  4WUR A;  3GRY A;  4RF0 A;  1YUB A;  5DYG A;  2FOI C;  3AL0 C;  3ZC7 B;  3VK8 A;  4LRS A;  4LFB M;  1Q39 A;  4EIW A;  1R2Z A;  2R4E A;  2X4A A;  3A45 A;  3L2A A;  5FTN A;  4IBD A;  2ERC A;  1WXQ A;  4GC5 A;  2KW0 A;  5KPZ A;  5ITT A;  4GIT A;  3CF2 A;  3T15 A;  3JR4 A;  3PXG A;  2CUZ A;  4JI8 M;  3E9S A;  4LFC M;  4KHP M;  2BJW A;  3SMP A;  4AG6 A;  1L2B A;  1GKI A;  2V1C A;  4QNR A;  4CGY B;  2QBY B;  2UXC M;  3ZH9 B;  2L6O A;  1R2Y A;  1IXR C;  4IBI A;  3KSX A;  3Q8X A;  4JV5 M;  8CAT A;  4MH0 E;  3SAV A;  4NSO B;  3GLH A;  3THG A;  2P5T A;  3A42 A;  1DGH A;  5EXX A;  1IN5 A;  2DWM A;  4X66 M;  4B3R M;  4D82 A;  3UMM A;  4M0W A;  4R3D A;  4OVZ A;  5ITY A;  1HQC A;  4IBE A;  2C5R A;  1NSF A;  1IXS B;  1DGH B;  4QOZ C;  1DGB A;  4QNM A;  1E9S A;  4WW0 A;  5ITX A;  2M60 A;  1G59 A;  2Y0T A;  3GPP A;  1IBL M;  2YR0 A;  4OU7 A;  3VLF B;  2QEN A;  2DXI A;  3VDP A;  4AKG A;  2KEB A;  3AV0 A;  4AKI A;  3U5Z A;  2HHH M;  4JN6 A;  4JI7 M;  7CAT A;  1XNQ M;  3GLI B;  4A3V B;  5C1B A;  4G6Z A;  2RKO A;  4LJ6 A;  3J80 S;  3RE8 A;  1IN8 A;  3IG5 A;  3E4R A;  3GRV A;  2HL7 A;  3EIE A;  2Z4R A;  3DFZ A;  1SXJ C;  1XMO M;  4PD2 A;  3BOS A;  1PJJ A;  1IY0 A;  5FSW A;  4AI6 A;  3A46 A;  3R8F A;  3KS8 A;  4IBK A;  4HL4 A;  1TH3 A;  3KDS E;  4FW9 A;  2E5L M;  4D80 A;  4DUY M;  1IM2 A;  4QOS A;  3CF0 A;  3I51 A;  4GKK M;  5FTM A;  2DWL A;  1IBK M;  4FCT A;  1LV7 A;  3J27 B;  3TL4 X;  4DV3 M;  4GHL A;  2XSZ D;  4MGZ E;  1OFI A;  2VQE M;  3M0E A;  4GKJ M;  3W0L B;  3U61 B;  3J81 S;  1QZM A;  3VDU A;  5A2Q S;  1HT1 E;  5LMN M;  3B9P A;  5EP2 A;  5EQT A;  3W0F A;  4NXN M;  1TH2 A;  4LJ7 A;  2D7G A;  3EIH A;  5KO3 A;  2F5S A;  4RF1 A;  3LVV A;  3HKP A;  1SXJ D;  2LXE A;  2CFO A;  2QCU A;  1KYI A;  4HLQ A;  4X65 M;  2F5O A;  2L09 A;  4LJ5 A;  1TGU A;  3SBJ A;  3HGI A;  1N75 A;  4IBJ A;  4DV7 M;  5BPV A;  5EXS A;  5ITU A;  2ZAN A;  4G4N A;  4B3S M;  4L4U A;  2QBY A;  3U6E A;  1EE8 A;  2Q2E B;  1SXJ B;  5JI3 E;  4G4Q A;  3T1H M;  4IBF A;  3SAR A;  1DGG A;  4R7G A;  1N77 A;  3M6A A;  4JI1 M;  4GMQ A;  4OW0 A;  3SYL A;  4LF6 M;  1SXJ A;  3CTW B;  3GPU A;  3L27 A;  4JI0 M;  4FWG A;  1UM8 A;  2I7P A;  1L2C A;  2AHM A;  2X8A A;  3FYD A;  2XF3 A;  2R62 A;  2Y20 A;  4LG2 A;  5E6J A;  4BLC A;  2UXD M;  4W5W A;  2KXE A;  2V6Z M;  1HT2 E;  4PT5 A;  4B3M M;  1IN4 A;  2VQF M;  3GRR A;  4LF8 M;  1DO2 A;  1FJG M;  1T3T A;  4LZJ A;  3JR5 A;  4DV5 M;  5EP3 A;  2CEA A;  2DZN B;  1ZAE A;  4PDI A;  2G5G X;  3GO8 A;  5EXT A;  3SYK A;  2D7H A;  2KZU A;  1JR3 D;  3VK7 A;  1TH4 A;  3FUW A;  3MJ5 A;  4PDG A;  4NRW A;  2YNM D;  4DV1 M;  1JQJ C;  2XGN A;  4BBA A;  1C1K A;  1FNN A;  3FUX A;  3HJS A;  2EA0 A;  1XNR M;  4LY6 A;  3WHK A;  1SXJ E;  3J7A S;  4OVZ B;  3SHG B;  4BB9 A;  4X62 M;  1QAN A;  3AOE A;  4IBG A;  3TQS A;  3FUU A;  1NHG C;  2F5N A;  3SAT A;  3KSJ A;  1PM5 A;  2QP9 X;  5E26 A;  2L7I A;  1TDH A;  4DV4 M;  3SAW A;  4MM3 B;  4CHT B;  1DGF A;  4XBO A;  3TWK A;  2C99 A;  3JAM S;  2JA2 A;  3U6M A;  5FLX S;  1NHW C;  3D8L A;  1G3I A;  2R45 A;  3HJ8 A;  4IJE A;  2DZO B;  3U5Z B;  4JI3 M;  2YFQ A;  2CE7 A;  2G8L A;  3RGP A;  2R4J A;  1IQP A;  4L78 A;  4DR5 M;  1X37 A;  4P16 A;  4MGH A;  2XFT A;  5FTL A;  4ZPX A;  1G8P A;  4JI6 M;  2FE8 A;  3KP1 E;  5H37 D;  4DR2 M;  2D7E A;  5KQD A;  1S3S A;  1XXH A;  1Z5A A;  4NL4 H;  2LNH C;  1QAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...