3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
b'DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KOYE 3KOXE 3KOZE 3KOWE 3KP0E 3KP1E
chains in the Genus database with same CATH superfamily
2XF3A 3FTFA 2LVOC 5FTMA 4DR2M 4P17A 4UN2B 4BB9A 4AKHA 3SATA 1PJIA 3KFUG 4IBFA 3A45A 1GO5A 2Z8YM 1Z5CA 4IBCA 1XB2B 2DNAA 3ZC7B 4ITQA 5EP2A 2JA2A 4YY3M 4LFCM 4AG5A 1SG9A 4DV7M 1OAIA 4LRSA 4GKKM 1VDDA 3OTOM 3HU3A 2N35A 2Y20A 1R5LA 4LJ4A 2VQFM 3AOEC 1NHGC 5ITXE 1NSFA 3HHYA 1OIZA 2QP9X 1DGHA 1DGHB 2XH9A 2Z7JA 3LQQA 2ZBKB 2DAEA 4JI1M 4BBAA 1QUSA 4EIWA 2LWXA 1Y8GA 2R4EA 1OFIA 3HU2A 3GQ4A 1J09A 1NNJA 1XHBA 4AQYM 1IQPA 1UM8A 1N78A 2DZOB 4IJFA 2R0IA 1JQJC 3U6MA 2ZANA 1C7YA 3U6OA 5KQ8A 1PJSA 4AG6A 4DV6M 3C3EA 3HWSA 2C9OA 1NV8A 2KNVA 2WSCF 2C99A 2QHOB 2Y21A 1Z6TA 1GL7A 4B7FA 3U6DA 1D2NA 1JR3A 2UXCM 1UFZA 3TPZA 4AZFA 5ITXA 4FWGA 2R4JA 4ANRA 5LMUM 2DWMA 3L27A 1J5EM 3FYDA 2MROB 3ZCBB 4JI0M 1WGLA 2BJWA 2XSZD 3HHXA 1WR1B 3SBJA 3KOZE 3KS8A 4DR4M 1HNZM 1QDRA 2OQ4A 2L2DA 3B7QA 3LQRA 2D7HA 2CFOA 2JUJA 4B7GA 5IZ7D 4G4QA 4KHPM 1G3IA 2VDBB 5LMNM 1TR8A 3D8BA 3E21A 4G3OA 3SAVA 1X37A 2RGOA 4FWHA 5ITUA 4LJ8A 4K0KM 1T43A 2LVAA 4PDIA 5EXPA 2Y0QA 4GMQA 1IN8A 3T38A 2CV2A 3W67A 1CUKA 4JXJA 2UUBM 1VG5A 2LVPC 3CTWB 5IREB 3I4VA 4HLQA 2MR9A 1P3QQ 3RE8A 2O25A 4NC6A 2F5PA 4FW9A 4JI5M 4LG2A 1YE9A 3CF6E 2HKJA 3CF0A 4B3TM 3M7GA 2FE8A 1TH2A 1QZMA 3KSJA 4IBKA 2DWNA 5ITQA 4RF1A 1TH4A 3QAUA 4B08A 3HHWA 4KT0F 3IHPA 4L6V6 2OPFA 2D7GA 1TH3A 4JI6M 2M60A 3QYBA 3C9PA 1NVMA 3J27B 1OAOC 2R46A 2RRUA 3ILKA 4F1IA 2YR0A 3GPUA 2LVQD 4Z8XA 2QENA 3FKEA 3HJ8A 4HEOA 2R45A 3THGA 2QPAA 4D80A 3R8FA 3SHGB 3K9PA 3GRRA 3SMPA 3V76A 1W5TA 2ZAMA 4MGHA 5KQDA 1I4WA 2F4VM 1QDTA 2MH8A 3GLFE 2RKOA 3SARA 3B89A 2R65A 4GITA 5E6JA 1XMQM 3C3DA 5DFLA 2EJSA 1Z5AA 3AFHA 1N36M 3DFZA 2QBYB 2QBYA 1FJGM 1EE8A 5EXSA 2EKKA 4DV1M 4KO8A 2Q2EB 3TE6A 4MGIE 1KSFX 3VFDA 2CE7A 3UJNA 3U6PA 2EO2A 2XZFA 1G71A 1YUBA 3VKHA 3K2LA 4DUYM 4LRTA 3L25A 3GPPA 3VKGA 5FTKA 1ZMWA 2DZNB 5DNYA 4GC9A 1GL6A 4GH9A 2F5NA 4LJAA 1DO2A 2ERCA 2BNKA 1R4GA 2O5RA 3T1YM 2JNHA 3IG5A 3GLFA 3GLFB 3U60A 1PRBA 2JY6B 1JR3D 2QQ8A 2DKLA 1TTEA 3H4MA 3U60B 3HJQA 4NRVA 4LFAM 1L2DA 4Y28F 5EQTA 1E9SA 2KRKA 2QSFX 2KRUA 2C5RA 1E94E 4JI4M 2M5ZA 1QYRA 3HJSA 2UXDM 3GQ3A 3I04M 3GLGE 2DVWB 3FD9A 1YLAA 1OKSA 5JI3E 2DAIA 2ZTDA 3D8LA 4LJ6A 4LGMA 2FNAA 1V33A 1MX0A 2CV0A 4P16A 4IBGA 3DA1A 5KPZA 3C58A 3VDUA 1NY5A 3L29A 3U6QA 4FD2A 1HNXM 4LF5M 3MHVC 5KPTA 3E4RA 4R71A 2KNZA 3RGSA 3TQSA 1L8QA 3J7BA 1IN7A 2L7IA 4JN6A 5JI2E 2KXEA 4RKUF 4DR3M 4FCTA 2DXIA 3T6PA 4JI3M 3LVVA 3I01M 1ZQ9A 2XGNA 3MMPA 4I81A 1DGFA 1NJFA 3U6CA 2LXEA 4NL4H 4LF7M 4MH0E 1GJTA 2NQ8C 5BR8M 1MJGM 3IECA 3GLGB 3GLGA 2LBCA 2FOIC 5KPRA 3B7ZA 4DV3M 3BOSA 2C98A 2APLA 2L6OA 1HQYE 1ZMVA 3CGWA 4M0DA 1QAQA 2CRUA 2OOBA 4OVZB 4OVZA 1HR0M 1W5SA 4LZZA 3J80S 5FTJA 3PNYA 1SXJE 3TWLA 5C1BA 1IFYA 4M9ZA 5FTNA 1HNWM 4DR1M 2QZ4A 2JY8A 3HU1A 3QYEA 4I5SA 4LY6A 4D82A 1IY0A 1E9RA 5IT9S 2VQEM 1VDLA 2O01F 2DZLA 4LZJA 3EIEA 3UZUA 2XLJA 1FNNA 3JR5A 1OTRA 4DV0M 5ITYA 5IWAM 1K82A 4DR5M 4LF6M 1YSYA 2ZAOA 3PFIA 3TWMA 1K3XA 1XMOM 1QVRA 2KDLA 2R44A 4AKGA 2JZ0A 1T6OA 3BBZA 3NWLA 1WJ7A 1EFUB 3B7NA 4X66M 1IN5A 2FFJA 3GQ5A 1SXJA 1SXJB 2DHYA 3HHZA 1PJJA 2BWEA 1R2YA 3SYKA 2OO9A 3L28A 3FRIA 2C9CA 3DZDA 3FUXA 3K8ZA 3JAMS 3LCUA 2VF7A 4X62M 2V6ZM 1BVSA 3UK6A 1Q3CA 2K0BX 5ITTA 3GLHE 3KOYE 1KYIA 2Z4SA 2CUZA 4R3DA 4MGZE 1IXRC 5EXTA 3SYLA 2L7HA 3KDSE 4FCWA 4B7HA 2K47A 4S12A 2GQFA 4B3MM 1QUTA 4D81A 2LHCA 2VF8A 4G4RA 1E32A 1C1KA 2ZTCA 2HL7A 3W0LB 1TDZA 3L26A 3FTEA 2LTUA 1PJTA 3JR4A 3BXWA 2XFSA 3Q8XA 1D0KA 1VEGA 2JY7A 1T3TA 4IBIA 3SAUA 1QAMA 3FRHA 3PVSA 3NBIA 4L15A 5BPVA 1N34M 3KP1E 4OW0A 1KFVA 2A5YB 3RFWA 3AOEA 1IY1A 3FUTA 1OQYA 3SFZA 5H37D 1IBLM 3KOXE 3T15A 1Z5BA 5DYGA 3FUUA 4NOOB 1DV0A 4LJ5A 2UU9M 2KA6B 2UUAM 4GIPA 1RU3A 3GLHA 3GLHB 4GEWA 4NXNM 4CGYB 3QWLA 5F3WA 3HZJA 4GC5A 2AHMA 1IXSA 1IXSB 2CEAA 2Y0TA 1AUAA 3ZH9B 5FTLA 1XNQM 1R2ZA 3VLFB 4Q7JA 3U61A 3U61B 1MU5A 2CHGA 3NBXX 2KZSA 2X4AA 1G8PA 1HJPA 3W0FA 1IXZA 4F2LA 1F4IA 1HT1E 4PT5A 1VQ1A 4IBDA 4PD2A 2XFTA 1N75A 2CHVA 2MGWA 2Z4RA 1J7KA 3SMSA 3U6LA 4CISA 3R9XB 3GPYA 1Z59A 3VDPA 4I8OA 2DI0A 2ZM6M 4RF0A 4AKIA 2CHQA 4W5WA 2XSZA 3VK7A 3MK6A 1V92A 4GRIA 3AOGA 3A46A 2JXNA 4AW4A 4JI2M 1D0LA 2H5XA 2MJ5B 4OU7A 1GLNA 3FUVA 4M9XA 1L1TA 4Z6YA 2C96A 1R7RA 4NSOB 1EIJA 2F5QA 4WP2A 1I94M 2LVNC 1JB0F 4FVMA 3AKZA 1R6BX 4IBBA 4XK8F 1L1ZA 2HAKA 3AV0A 3M6AA 5EP4A 4A3VB 4YHHM 4LFBM 3B9PA 4NRWA 2FS1A 3U6EA 3LMMA 1DO0A 2R62A 3SAWA 3VK8A 4CIZA 2KW0A 1TF0B 1A5TA 3GO8A 4LGYA 5KO3A 2DHRA 2UUCM 4AI6A 4DR6M 2EUCA 4KLNA 4KODA 1ORYB 3CF2A 1VEJA 1ZV1A 3KVWA 1IBKM 4LF8M 3B74A 3PXGA 3SHFA 4I4LA 1IM2A 1QAOA 3EIHA 3UGJA 2GNOA 4REZA 4QNMA 5FSWA 2UXBM 2EA0A 5FLXS 3IG8A 4HL4A 1NV9A 4II7A 2X49A 1NNUC 4FWDA 4QOSA 1JR3E 3GLIE 1IN6A 3GRVA 2J5YA 2YQZA 3KOWE 4B3RM 2DAMA 4GKJM 1GKIA 4X65M 4DR7M 2HWJA 8CATA 3LCVB 1Q02A 3ZQJA 2W82A 2J7OA 1MN3A 3KXEC 3Q8GA 2G8LA 1TDHA 3GRYA 4XGIA 3E9SA 1XC8A 1VEKA 1WXQA 1G41A 3LVWA 1OFHA 2H1RA 4DUZM 1V34A 2CWBA 1Q3BA 3H4JA 3SASA 2DAKA 3KW6A 2XEPA 2CV1A 2V1CA 4MM3B 2DWLA 1H6UA 3FTCA 2E5LM 2KNAA 1NJGA 2I7PA 2HHHM 2WSEF 3FE3A 4G4OA 3GLIB 1LTMA 3GLIA 2K6BA 3K1JA 1L2BA 2V1UA 4XBOA 4RNAA 3E46A 3A98B 4NSRA 4L78A 2JY5A 1XXHE 2JWSA 4R7GA 1N33M 1L2CA 4TUWA 1PJQA 7CATA 2F5OA 4OX9M 1GABA 3W68A 2BJVA 4WW0A 4LF9M 3I51A 2RGHA 3DOAA 3J2PB 1S3SA 2CP8A 2L09A 2VIIA 4LCBA 3KSXA 3WHLA 3T1HM 4JI7M 1WIVA 2BWBA 4QHTA 3RGPA 1DGGA 1HQCA 2YNMD 3LW5F 2G3QA 2WSFF 3FTDA 2FH0A 2KZUA 4PCZA 2DAGA 2QCUA 5L8RF 1WHCA 3J81S 1K3WA 4DBGB 1N32M 2HCBA 2D7EA 2DWZB 2J7NA 3PNVA 3GRUA 1XNRM 3TWKA 2YFQA 5DYIA 4LJ9A 1OIPA 4CJ6A 1GVNA 3AJIB 4DV2M 4JYAM 1NY6A 2R18A 1DGBA 2KHHA 1D0MA 2L4FA 3M0EA 1XXHA 1XXHB 3I4YA 3AL0C 5EP3A 3J7AS 3A42A 5EP1A 3GPXA 2OOAA 3FUWA 4CHTB 3F92A 1QQWA 3HKPA 4IBEA 4BLCA 4X64M 2F5SA 3MJ5A 4L16A 4IIWA 1N77A 1TGUA 3WHKA 1PM5A 3K92A 2G5GX 4QNRA 3TL4X 2P5TA 5EXXA 1G59A 2EKFA 2B3TA 2R6FA 2I7NA 2DENA 4M0WA 5GKNA 3SC3A 3UMMA 2KEBA 4PDGA 3KS4A 2XZUA 4LF4M 1QANA 2X8AA 4GHAA 3U5ZA 2JZ1A 4G6ZA 1PGYA 4MB7A 1LV7A 3U5ZB 1G4AE 3HGIA 2LH0A 2WZJA 4IJEA 3U6SA 4L4UA 4QHSA 2JP7A 4JI8M 4WURA 4DV5M 2Z3XA 1IN4A 5E26A 4IBJA 1WGNA 2K9DA 3GP1A 1GJSA 1QZEA 3KP0E 4LJ7A 3HY5A 1IBMM 1ZAEA 3FYCA 1HT2E 1SXJD 4B3SM 1OJLA 1SXJC 4FCVA 4MGYE 1IY2A 4NXMM 1AIPC 1NO1A 5ITRA 5EJCA 3L2AA 4G4NA 4GHLA 4M9SA 2QNJA 5A2QS 4JV5M 2LNHC 4DV4M 2LHGA 4MGKE 1Q39A 1XWIA 2L4EA 3HX3A 4ZPXA 1ZMUA 1NHWC 5C18A 4QOZC 3K9OA 4L8RC
chains in the Genus database with same CATH topology
2XF3A 3FTFA 5FTMA 4DR2M 4BB9A 4AKHA 3SATA 1PJIA 3KFUG 4IBFA 3A45A 1Z5CA 4IBCA 3ZC7B 4ITQA 5EP2A 2JA2A 4YY3M 4LFCM 4AG5A 4DV7M 4LRSA 4GKKM 1VDDA 3OTOM 3HU3A 4LJ4A 2Y20A 2VQFM 3AOEC 1NHGC 5ITXE 1NSFA 3HHYA 2QP9X 1DGHA 1DGHB 2XH9A 2Z7JA 3LQQA 2ZBKB 4JI1M 4BBAA 4EIWA 3GQ4A 2LWXA 2R4EA 1OFIA 3HU2A 1J09A 1NNJA 1XHBA 4AQYM 1IQPA 1UM8A 1N78A 2DZOB 4IJFA 1JQJC 3U6MA 2ZANA 3U6OA 5KQ8A 4AG6A 4DV6M 3HWSA 2C9OA 2C99A 2Y21A 1Z6TA 1GL7A 4B7FA 3U6DA 1D2NA 1JR3A 2UXCM 3TPZA 4AZFA 5ITXA 4FWGA 2R4JA 5LMUM 2DWMA 2UUBM 3L27A 1J5EM 3FYDA 3ZCBB 4JI0M 2BJWA 2XSZD 3HHXA 3SBJA 3KS8A 3KOZE 4DR4M 1HNZM 2OQ4A 3LQRA 2D7HA 2CFOA 4B7GA 4G4QA 5IZ7D 4KHPM 1G3IA 5LMNM 3D8BA 3SAVA 1X37A 2RGOA 4FWHA 5ITUA 4LJ8A 4K0KM 4PDIA 5EXPA 2Y0QA 4GMQA 1IN8A 3T38A 2CV2A 4JXJA 3CTWB 5IREB 3I4VA 4HLQA 3RE8A 2F5PA 4FW9A 4JI5M 4LG2A 1YE9A 3CF6E 2HKJA 3CF0A 4B3TM 3M7GA 2FE8A 1TH2A 1QZMA 3KSJA 4IBKA 2DWNA 5ITQA 4RF1A 1TH4A 3QAUA 4B08A 3HHWA 2OPFA 2D7GA 1TH3A 4JI6M 2M60A 1NVMA 3J27B 2R46A 3ILKA 2YR0A 3GPUA 4Z8XA 2QENA 3FKEA 3HJ8A 2R45A 3THGA 2QPAA 4D80A 3R8FA 3SHGB 3GRRA 3SMPA 1W5TA 2ZAMA 4MGHA 5KQDA 1I4WA 2F4VM 2RKOA 3SARA 2R65A 4GITA 5E6JA 1XMQM 1Z5AA 3AFHA 1N36M 3DFZA 2QBYB 2QBYA 1FJGM 1EE8A 5EXSA 4DV1M 4KO8A 2Q2EB 3TE6A 4MGIE 1KSFX 3VFDA 2CE7A 3UJNA 3U6PA 2EO2A 2XZFA 1YUBA 3VKHA 3K2LA 4DUYM 4LRTA 3L25A 3GPPA 3VKGA 5FTKA 2DZNB 5DNYA 4GC9A 1GL6A 4GH9A 2F5NA 4LJAA 1DO2A 2ERCA 2BNKA 2O5RA 3T1YM 3IG5A 3GLFA 3GLFB 3U60A 3U60B 1XMOM 1JR3D 3H4MA 1L2DA 2E5LM 2UUAM 3HJQA 4NRVA 4LFAM 5EQTA 1E9SA 2KRKA 2KRUA 2C5RA 1E94E 4JI4M 2M5ZA 1QYRA 3HJSA 2UXDM 3GQ3A 2DVWB 3FD9A 5JI3E 4LJ6A 3D8LA 4LGMA 2FNAA 1MX0A 2CV0A 4P16A 4IBGA 3DA1A 5KPZA 3C58A 3VDUA 1NY5A 3L29A 3U6QA 4FD2A 1HNXM 4LF5M 3MHVC 5KPTA 3E4RA 3RGSA 3TQSA 1L8QA 3J7BA 1IN7A 2L7IA 4JN6A 5JI2E 2KXEA 4DR3M 4FCTA 2DXIA 4JI3M 3LVVA 1ZQ9A 2XGNA 4I81A 1DGFA 1NJFA 3U6CA 2LXEA 4NL4H 4LF7M 4MH0E 2NQ8C 5BR8M 3GLGB 3GLGA 2FOIC 5KPRA 4DV3M 3BOSA 2C98A 2L6OA 1HQYE 4M0DA 1QAQA 4OVZB 4OVZA 1HR0M 1W5SA 4LZZA 3J80S 5FTJA 3PNYA 1SXJE 3TWLA 5C1BA 4M9ZA 5FTNA 1HNWM 4DR1M 2QZ4A 4LY6A 3HU1A 4I5SA 4D82A 5IT9S 1IY0A 1E9RA 2VQEM 4LZJA 3EIEA 3UZUA 2XLJA 1FNNA 3JR5A 4DV0M 5ITYA 5IWAM 1K82A 4DR5M 4LF6M 1YSYA 2ZAOA 3PFIA 3TWMA 1K3XA 1QVRA 4AKGA 3NWLA 4X66M 1IN5A 2FFJA 3GQ5A 1SXJA 1SXJB 3HHZA 1PJJA 1R2YA 3SYKA 3L28A 2C9CA 3DZDA 3FUXA 3K8ZA 3JAMS 4X62M 2V6ZM 3UK6A 1Q3CA 5ITTA 3KOYE 1KYIA 2Z4SA 2CUZA 4R3DA 4MGZE 1IXRC 5EXTA 3SYLA 2L7HA 3KDSE 4FCWA 4B7HA 2K47A 4S12A 4B3MM 4D81A 4G4RA 1E32A 1C1KA 2HL7A 3W0LB 1TDZA 3L26A 3FTEA 3JR4A 2XFSA 3Q8XA 3SAUA 4IBIA 1T3TA 1N34M 1QAMA 5BPVA 3PVSA 3NBIA 4L15A 3KP1E 4OW0A 1KFVA 2A5YB 3RFWA 3AOEA 1IY1A 3FUTA 3SFZA 1IBLM 5H37D 3KOXE 3T15A 1Z5BA 5DYGA 3FUUA 4NOOB 4LJ5A 2UU9M 2KA6B 4GIPA 3GLHA 3GLHB 4NXNM 5F3WA 4CGYB 3QWLA 4GC5A 2AHMA 1IXSB 2CEAA 2Y0TA 3ZH9B 5FTLA 1XNQM 1R2ZA 3VLFB 3U61A 3U61B 1MU5A 2CHGA 2KZSA 2X4AA 1G8PA 3W0FA 1IXZA 1HT1E 4PT5A 4IBDA 4PD2A 2XFTA 1N75A 2CHVA 2Z4RA 3SMSA 1J7KA 3U6LA 4CISA 3R9XB 3GPYA 1Z59A 3VDPA 4I8OA 2ZM6M 4RF0A 4AKIA 2CHQA 4W5WA 2XSZA 3VK7A 3MK6A 4GRIA 3AOGA 3A46A 4AW4A 4JI2M 4OU7A 1GLNA 3FUVA 4M9XA 1L1TA 4Z6YA 2C96A 1R7RA 4NSOB 2F5QA 1I94M 4FVMA 3AKZA 1R6BX 4IBBA 1L1ZA 3AV0A 3M6AA 5EP4A 4A3VB 4YHHM 4LFBM 3B9PA 4NRWA 3U6EA 3LMMA 1DO0A 2R62A 3SAWA 3VK8A 2KW0A 3GO8A 4LGYA 5KO3A 2DHRA 2UUCM 4AI6A 4DR6M 2EUCA 4KLNA 4KODA 1ORYB 3CF2A 3KVWA 1IBKM 4LF8M 3PXGA 3SHFA 4I4LA 1IM2A 1QAOA 3EIHA 3UGJA 4REZA 4QNMA 5FSWA 2UXBM 2EA0A 5FLXS 3IG8A 4HL4A 4II7A 2X49A 1NNUC 4FWDA 4QOSA 1IN6A 3GRVA 2YQZA 3KOWE 4B3RM 4GKJM 1GKIA 4X65M 4DR7M 8CATA 2W82A 2J7OA 3KXEC 2G8LA 1TDHA 3GRYA 4XGIA 3E9SA 1XC8A 1WXQA 1G41A 3LVWA 1OFHA 2H1RA 4DUZM 1Q3BA 3SASA 3KW6A 2XEPA 2CV1A 2V1CA 4MM3B 2DWLA 1H6UA 3FTCA 1NJGA 2I7PA 2HHHM 4G4OA 3GLIB 3GLIA 3K1JA 1L2BA 2V1UA 4XBOA 4RNAA 3A98B 4NSRA 4L78A 1N33M 4R7GA 1L2CA 4TUWA 2F5OA 7CATA 4OX9M 2BJVA 4WW0A 4LF9M 3I51A 2RGHA 3DOAA 3J2PB 1S3SA 2L09A 2VIIA 4LCBA 3T1HM 3KSXA 3WHLA 4JI7M 4QHTA 3RGPA 1DGGA 1HQCA 2YNMD 4PCZA 3FTDA 1K3WA 2KZUA 2QCUA 3J81S 1N32M 2HCBA 2D7EA 2DWZB 2J7NA 3PNVA 3GRUA 1XNRM 3TWKA 2YFQA 5DYIA 4LJ9A 1GVNA 3AJIB 4DV2M 4JYAM 1NY6A 2R18A 1DGBA 3M0EA 1XXHA 1XXHB 3I4YA 3AL0C 5EP3A 3J7AS 3A42A 5EP1A 3GPXA 3FUWA 4CHTB 1QQWA 3HKPA 4IBEA 4BLCA 4X64M 2F5SA 3MJ5A 4L16A 4IIWA 1N77A 1TGUA 3WHKA 1PM5A 3K92A 2G5GX 4QNRA 3TL4X 2P5TA 5EXXA 1G59A 2I7NA 4M0WA 5GKNA 3SC3A 3UMMA 2KEBA 4PDGA 3KS4A 2XZUA 4LF4M 1QANA 2X8AA 4GHAA 3U5ZA 4MB7A 4G6ZA 3U5ZB 1LV7A 1G4AE 3HGIA 2LH0A 4IJEA 3U6SA 4L4UA 4QHSA 4JI8M 4WURA 4DV5M 2Z3XA 1IN4A 5E26A 4IBJA 3GP1A 3KP0E 4LJ7A 1IBMM 1ZAEA 3FYCA 1HT2E 1SXJD 4B3SM 1OJLA 1SXJC 4FCVA 4MGYE 1IY2A 4NXMM 5ITRA 5EJCA 3L2AA 4G4NA 4GHLA 4M9SA 5A2QS 4JV5M 2LNHC 4DV4M 4MGKE 1Q39A 1XWIA 4ZPXA 1NHWC 5C18A 4QOZC 4L8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOY E;  3KOX E;  3KOZ E;  3KOW E;  3KP0 E;  3KP1 E; 
#chains in the Genus database with same CATH topology
 2XF3 A;  3FTF A;  2LVO C;  5FTM A;  4DR2 M;  4P17 A;  4UN2 B;  4BB9 A;  4AKH A;  3SAT A;  1PJI A;  3KFU G;  4IBF A;  3A45 A;  1GO5 A;  2Z8Y M;  1Z5C A;  4IBC A;  1XB2 B;  2DNA A;  3ZC7 B;  4ITQ A;  5EP2 A;  2JA2 A;  4YY3 M;  4LFC M;  4AG5 A;  1SG9 A;  4DV7 M;  1OAI A;  4LRS A;  4GKK M;  1VDD A;  3OTO M;  3HU3 A;  2N35 A;  2Y20 A;  1R5L A;  4LJ4 A;  2VQF M;  3AOE C;  1NHG C;  5ITX E;  1NSF A;  3HHY A;  1OIZ A;  2QP9 X;  1DGH A;  1DGH B;  2XH9 A;  2Z7J A;  3LQQ A;  2ZBK B;  2DAE A;  4JI1 M;  4BBA A;  1QUS A;  4EIW A;  2LWX A;  1Y8G A;  2R4E A;  1OFI A;  3HU2 A;  3GQ4 A;  1J09 A;  1NNJ A;  1XHB A;  4AQY M;  1IQP A;  1UM8 A;  1N78 A;  2DZO B;  4IJF A;  2R0I A;  1JQJ C;  3U6M A;  2ZAN A;  1C7Y A;  3U6O A;  5KQ8 A;  1PJS A;  4AG6 A;  4DV6 M;  3C3E A;  3HWS A;  2C9O A;  1NV8 A;  2KNV A;  2WSC F;  2C99 A;  2QHO B;  2Y21 A;  1Z6T A;  1GL7 A;  4B7F A;  3U6D A;  1D2N A;  1JR3 A;  2UXC M;  1UFZ A;  3TPZ A;  4AZF A;  5ITX A;  4FWG A;  2R4J A;  4ANR A;  5LMU M;  2DWM A;  3L27 A;  1J5E M;  3FYD A;  2MRO B;  3ZCB B;  4JI0 M;  1WGL A;  2BJW A;  2XSZ D;  3HHX A;  1WR1 B;  3SBJ A;  3KOZ E;  3KS8 A;  4DR4 M;  1HNZ M;  1QDR A;  2OQ4 A;  2L2D A;  3B7Q A;  3LQR A;  2D7H A;  2CFO A;  2JUJ A;  4B7G A;  5IZ7 D;  4G4Q A;  4KHP M;  1G3I A;  2VDB B;  5LMN M;  1TR8 A;  3D8B A;  3E21 A;  4G3O A;  3SAV A;  1X37 A;  2RGO A;  4FWH A;  5ITU A;  4LJ8 A;  4K0K M;  1T43 A;  2LVA A;  4PDI A;  5EXP A;  2Y0Q A;  4GMQ A;  1IN8 A;  3T38 A;  2CV2 A;  3W67 A;  1CUK A;  4JXJ A;  2UUB M;  1VG5 A;  2LVP C;  3CTW B;  5IRE B;  3I4V A;  4HLQ A;  2MR9 A;  1P3Q Q;  3RE8 A;  2O25 A;  4NC6 A;  2F5P A;  4FW9 A;  4JI5 M;  4LG2 A;  1YE9 A;  3CF6 E;  2HKJ A;  3CF0 A;  4B3T M;  3M7G A;  2FE8 A;  1TH2 A;  1QZM A;  3KSJ A;  4IBK A;  2DWN A;  5ITQ A;  4RF1 A;  1TH4 A;  3QAU A;  4B08 A;  3HHW A;  4KT0 F;  3IHP A;  4L6V 6;  2OPF A;  2D7G A;  1TH3 A;  4JI6 M;  2M60 A;  3QYB A;  3C9P A;  1NVM A;  3J27 B;  1OAO C;  2R46 A;  2RRU A;  3ILK A;  4F1I A;  2YR0 A;  3GPU A;  2LVQ D;  4Z8X A;  2QEN A;  3FKE A;  3HJ8 A;  4HEO A;  2R45 A;  3THG A;  2QPA A;  4D80 A;  3R8F A;  3SHG B;  3K9P A;  3GRR A;  3SMP A;  3V76 A;  1W5T A;  2ZAM A;  4MGH A;  5KQD A;  1I4W A;  2F4V M;  1QDT A;  2MH8 A;  3GLF E;  2RKO A;  3SAR A;  3B89 A;  2R65 A;  4GIT A;  5E6J A;  1XMQ M;  3C3D A;  5DFL A;  2EJS A;  1Z5A A;  3AFH A;  1N36 M;  3DFZ A;  2QBY B;  2QBY A;  1FJG M;  1EE8 A;  5EXS A;  2EKK A;  4DV1 M;  4KO8 A;  2Q2E B;  3TE6 A;  4MGI E;  1KSF X;  3VFD A;  2CE7 A;  3UJN A;  3U6P A;  2EO2 A;  2XZF A;  1G71 A;  1YUB A;  3VKH A;  3K2L A;  4DUY M;  4LRT A;  3L25 A;  3GPP A;  3VKG A;  5FTK A;  1ZMW A;  2DZN B;  5DNY A;  4GC9 A;  1GL6 A;  4GH9 A;  2F5N A;  4LJA A;  1DO2 A;  2ERC A;  2BNK A;  1R4G A;  2O5R A;  3T1Y M;  2JNH A;  3IG5 A;  3GLF A;  3GLF B;  3U60 A;  1PRB A;  2JY6 B;  1JR3 D;  2QQ8 A;  2DKL A;  1TTE A;  3H4M A;  3U60 B;  3HJQ A;  4NRV A;  4LFA M;  1L2D A;  4Y28 F;  5EQT A;  1E9S A;  2KRK A;  2QSF X;  2KRU A;  2C5R A;  1E94 E;  4JI4 M;  2M5Z A;  1QYR A;  3HJS A;  2UXD M;  3GQ3 A;  3I04 M;  3GLG E;  2DVW B;  3FD9 A;  1YLA A;  1OKS A;  5JI3 E;  2DAI A;  2ZTD A;  3D8L A;  4LJ6 A;  4LGM A;  2FNA A;  1V33 A;  1MX0 A;  2CV0 A;  4P16 A;  4IBG A;  3DA1 A;  5KPZ A;  3C58 A;  3VDU A;  1NY5 A;  3L29 A;  3U6Q A;  4FD2 A;  1HNX M;  4LF5 M;  3MHV C;  5KPT A;  3E4R A;  4R71 A;  2KNZ A;  3RGS A;  3TQS A;  1L8Q A;  3J7B A;  1IN7 A;  2L7I A;  4JN6 A;  5JI2 E;  2KXE A;  4RKU F;  4DR3 M;  4FCT A;  2DXI A;  3T6P A;  4JI3 M;  3LVV A;  3I01 M;  1ZQ9 A;  2XGN A;  3MMP A;  4I81 A;  1DGF A;  1NJF A;  3U6C A;  2LXE A;  4NL4 H;  4LF7 M;  4MH0 E;  1GJT A;  2NQ8 C;  5BR8 M;  1MJG M;  3IEC A;  3GLG B;  3GLG A;  2LBC A;  2FOI C;  5KPR A;  3B7Z A;  4DV3 M;  3BOS A;  2C98 A;  2APL A;  2L6O A;  1HQY E;  1ZMV A;  3CGW A;  4M0D A;  1QAQ A;  2CRU A;  2OOB A;  4OVZ B;  4OVZ A;  1HR0 M;  1W5S A;  4LZZ A;  3J80 S;  5FTJ A;  3PNY A;  1SXJ E;  3TWL A;  5C1B A;  1IFY A;  4M9Z A;  5FTN A;  1HNW M;  4DR1 M;  2QZ4 A;  2JY8 A;  3HU1 A;  3QYE A;  4I5S A;  4LY6 A;  4D82 A;  1IY0 A;  1E9R A;  5IT9 S;  2VQE M;  1VDL A;  2O01 F;  2DZL A;  4LZJ A;  3EIE A;  3UZU A;  2XLJ A;  1FNN A;  3JR5 A;  1OTR A;  4DV0 M;  5ITY A;  5IWA M;  1K82 A;  4DR5 M;  4LF6 M;  1YSY A;  2ZAO A;  3PFI A;  3TWM A;  1K3X A;  1XMO M;  1QVR A;  2KDL A;  2R44 A;  4AKG A;  2JZ0 A;  1T6O A;  3BBZ A;  3NWL A;  1WJ7 A;  1EFU B;  3B7N A;  4X66 M;  1IN5 A;  2FFJ A;  3GQ5 A;  1SXJ A;  1SXJ B;  2DHY A;  3HHZ A;  1PJJ A;  2BWE A;  1R2Y A;  3SYK A;  2OO9 A;  3L28 A;  3FRI A;  2C9C A;  3DZD A;  3FUX A;  3K8Z A;  3JAM S;  3LCU A;  2VF7 A;  4X62 M;  2V6Z M;  1BVS A;  3UK6 A;  1Q3C A;  2K0B X;  5ITT A;  3GLH E;  3KOY E;  1KYI A;  2Z4S A;  2CUZ A;  4R3D A;  4MGZ E;  1IXR C;  5EXT A;  3SYL A;  2L7H A;  3KDS E;  4FCW A;  4B7H A;  2K47 A;  4S12 A;  2GQF A;  4B3M M;  1QUT A;  4D81 A;  2LHC A;  2VF8 A;  4G4R A;  1E32 A;  1C1K A;  2ZTC A;  2HL7 A;  3W0L B;  1TDZ A;  3L26 A;  3FTE A;  2LTU A;  1PJT A;  3JR4 A;  3BXW A;  2XFS A;  3Q8X A;  1D0K A;  1VEG A;  2JY7 A;  1T3T A;  4IBI A;  3SAU A;  1QAM A;  3FRH A;  3PVS A;  3NBI A;  4L15 A;  5BPV A;  1N34 M;  3KP1 E;  4OW0 A;  1KFV A;  2A5Y B;  3RFW A;  3AOE A;  1IY1 A;  3FUT A;  1OQY A;  3SFZ A;  5H37 D;  1IBL M;  3KOX E;  3T15 A;  1Z5B A;  5DYG A;  3FUU A;  4NOO B;  1DV0 A;  4LJ5 A;  2UU9 M;  2KA6 B;  2UUA M;  4GIP A;  1RU3 A;  3GLH A;  3GLH B;  4GEW A;  4NXN M;  4CGY B;  3QWL A;  5F3W A;  3HZJ A;  4GC5 A;  2AHM A;  1IXS A;  1IXS B;  2CEA A;  2Y0T A;  1AUA A;  3ZH9 B;  5FTL A;  1XNQ M;  1R2Z A;  3VLF B;  4Q7J A;  3U61 A;  3U61 B;  1MU5 A;  2CHG A;  3NBX X;  2KZS A;  2X4A A;  1G8P A;  1HJP A;  3W0F A;  1IXZ A;  4F2L A;  1F4I A;  1HT1 E;  4PT5 A;  1VQ1 A;  4IBD A;  4PD2 A;  2XFT A;  1N75 A;  2CHV A;  2MGW A;  2Z4R A;  1J7K A;  3SMS A;  3U6L A;  4CIS A;  3R9X B;  3GPY A;  1Z59 A;  3VDP A;  4I8O A;  2DI0 A;  2ZM6 M;  4RF0 A;  4AKI A;  2CHQ A;  4W5W A;  2XSZ A;  3VK7 A;  3MK6 A;  1V92 A;  4GRI A;  3AOG A;  3A46 A;  2JXN A;  4AW4 A;  4JI2 M;  1D0L A;  2H5X A;  2MJ5 B;  4OU7 A;  1GLN A;  3FUV A;  4M9X A;  1L1T A;  4Z6Y A;  2C96 A;  1R7R A;  4NSO B;  1EIJ A;  2F5Q A;  4WP2 A;  1I94 M;  2LVN C;  1JB0 F;  4FVM A;  3AKZ A;  1R6B X;  4IBB A;  4XK8 F;  1L1Z A;  2HAK A;  3AV0 A;  3M6A A;  5EP4 A;  4A3V B;  4YHH M;  4LFB M;  3B9P A;  4NRW A;  2FS1 A;  3U6E A;  3LMM A;  1DO0 A;  2R62 A;  3SAW A;  3VK8 A;  4CIZ A;  2KW0 A;  1TF0 B;  1A5T A;  3GO8 A;  4LGY A;  5KO3 A;  2DHR A;  2UUC M;  4AI6 A;  4DR6 M;  2EUC A;  4KLN A;  4KOD A;  1ORY B;  3CF2 A;  1VEJ A;  1ZV1 A;  3KVW A;  1IBK M;  4LF8 M;  3B74 A;  3PXG A;  3SHF A;  4I4L A;  1IM2 A;  1QAO A;  3EIH A;  3UGJ A;  2GNO A;  4REZ A;  4QNM A;  5FSW A;  2UXB M;  2EA0 A;  5FLX S;  3IG8 A;  4HL4 A;  1NV9 A;  4II7 A;  2X49 A;  1NNU C;  4FWD A;  4QOS A;  1JR3 E;  3GLI E;  1IN6 A;  3GRV A;  2J5Y A;  2YQZ A;  3KOW E;  4B3R M;  2DAM A;  4GKJ M;  1GKI A;  4X65 M;  4DR7 M;  2HWJ A;  8CAT A;  3LCV B;  1Q02 A;  3ZQJ A;  2W82 A;  2J7O A;  1MN3 A;  3KXE C;  3Q8G A;  2G8L A;  1TDH A;  3GRY A;  4XGI A;  3E9S A;  1XC8 A;  1VEK A;  1WXQ A;  1G41 A;  3LVW A;  1OFH A;  2H1R A;  4DUZ M;  1V34 A;  2CWB A;  1Q3B A;  3H4J A;  3SAS A;  2DAK A;  3KW6 A;  2XEP A;  2CV1 A;  2V1C A;  4MM3 B;  2DWL A;  1H6U A;  3FTC A;  2E5L M;  2KNA A;  1NJG A;  2I7P A;  2HHH M;  2WSE F;  3FE3 A;  4G4O A;  3GLI B;  1LTM A;  3GLI A;  2K6B A;  3K1J A;  1L2B A;  2V1U A;  4XBO A;  4RNA A;  3E46 A;  3A98 B;  4NSR A;  4L78 A;  2JY5 A;  1XXH E;  2JWS A;  4R7G A;  1N33 M;  1L2C A;  4TUW A;  1PJQ A;  7CAT A;  2F5O A;  4OX9 M;  1GAB A;  3W68 A;  2BJV A;  4WW0 A;  4LF9 M;  3I51 A;  2RGH A;  3DOA A;  3J2P B;  1S3S A;  2CP8 A;  2L09 A;  2VII A;  4LCB A;  3KSX A;  3WHL A;  3T1H M;  4JI7 M;  1WIV A;  2BWB A;  4QHT A;  3RGP A;  1DGG A;  1HQC A;  2YNM D;  3LW5 F;  2G3Q A;  2WSF F;  3FTD A;  2FH0 A;  2KZU A;  4PCZ A;  2DAG A;  2QCU A;  5L8R F;  1WHC A;  3J81 S;  1K3W A;  4DBG B;  1N32 M;  2HCB A;  2D7E A;  2DWZ B;  2J7N A;  3PNV A;  3GRU A;  1XNR M;  3TWK A;  2YFQ A;  5DYI A;  4LJ9 A;  1OIP A;  4CJ6 A;  1GVN A;  3AJI B;  4DV2 M;  4JYA M;  1NY6 A;  2R18 A;  1DGB A;  2KHH A;  1D0M A;  2L4F A;  3M0E A;  1XXH A;  1XXH B;  3I4Y A;  3AL0 C;  5EP3 A;  3J7A S;  3A42 A;  5EP1 A;  3GPX A;  2OOA A;  3FUW A;  4CHT B;  3F92 A;  1QQW A;  3HKP A;  4IBE A;  4BLC A;  4X64 M;  2F5S A;  3MJ5 A;  4L16 A;  4IIW A;  1N77 A;  1TGU A;  3WHK A;  1PM5 A;  3K92 A;  2G5G X;  4QNR A;  3TL4 X;  2P5T A;  5EXX A;  1G59 A;  2EKF A;  2B3T A;  2R6F A;  2I7N A;  2DEN A;  4M0W A;  5GKN A;  3SC3 A;  3UMM A;  2KEB A;  4PDG A;  3KS4 A;  2XZU A;  4LF4 M;  1QAN A;  2X8A A;  4GHA A;  3U5Z A;  2JZ1 A;  4G6Z A;  1PGY A;  4MB7 A;  1LV7 A;  3U5Z B;  1G4A E;  3HGI A;  2LH0 A;  2WZJ A;  4IJE A;  3U6S A;  4L4U A;  4QHS A;  2JP7 A;  4JI8 M;  4WUR A;  4DV5 M;  2Z3X A;  1IN4 A;  5E26 A;  4IBJ A;  1WGN A;  2K9D A;  3GP1 A;  1GJS A;  1QZE A;  3KP0 E;  4LJ7 A;  3HY5 A;  1IBM M;  1ZAE A;  3FYC A;  1HT2 E;  1SXJ D;  4B3S M;  1OJL A;  1SXJ C;  4FCV A;  4MGY E;  1IY2 A;  4NXM M;  1AIP C;  1NO1 A;  5ITR A;  5EJC A;  3L2A A;  4G4N A;  4GHL A;  4M9S A;  2QNJ A;  5A2Q S;  4JV5 M;  2LNH C;  4DV4 M;  2LHG A;  4MGK E;  1Q39 A;  1XWI A;  2L4E A;  3HX3 A;  4ZPX A;  1ZMU A;  1NHW C;  5C18 A;  4QOZ C;  3K9O A;  4L8R C; 
#chains in the Genus database with same CATH homology
 2XF3 A;  3FTF A;  5FTM A;  4DR2 M;  4BB9 A;  4AKH A;  3SAT A;  1PJI A;  3KFU G;  4IBF A;  3A45 A;  1Z5C A;  4IBC A;  3ZC7 B;  4ITQ A;  5EP2 A;  2JA2 A;  4YY3 M;  4LFC M;  4AG5 A;  4DV7 M;  4LRS A;  4GKK M;  1VDD A;  3OTO M;  3HU3 A;  4LJ4 A;  2Y20 A;  2VQF M;  3AOE C;  1NHG C;  5ITX E;  1NSF A;  3HHY A;  2QP9 X;  1DGH A;  1DGH B;  2XH9 A;  2Z7J A;  3LQQ A;  2ZBK B;  4JI1 M;  4BBA A;  4EIW A;  3GQ4 A;  2LWX A;  2R4E A;  1OFI A;  3HU2 A;  1J09 A;  1NNJ A;  1XHB A;  4AQY M;  1IQP A;  1UM8 A;  1N78 A;  2DZO B;  4IJF A;  1JQJ C;  3U6M A;  2ZAN A;  3U6O A;  5KQ8 A;  4AG6 A;  4DV6 M;  3HWS A;  2C9O A;  2C99 A;  2Y21 A;  1Z6T A;  1GL7 A;  4B7F A;  3U6D A;  1D2N A;  1JR3 A;  2UXC M;  3TPZ A;  4AZF A;  5ITX A;  4FWG A;  2R4J A;  5LMU M;  2DWM A;  2UUB M;  3L27 A;  1J5E M;  3FYD A;  3ZCB B;  4JI0 M;  2BJW A;  2XSZ D;  3HHX A;  3SBJ A;  3KS8 A;  3KOZ E;  4DR4 M;  1HNZ M;  2OQ4 A;  3LQR A;  2D7H A;  2CFO A;  4B7G A;  4G4Q A;  5IZ7 D;  4KHP M;  1G3I A;  5LMN M;  3D8B A;  3SAV A;  1X37 A;  2RGO A;  4FWH A;  5ITU A;  4LJ8 A;  4K0K M;  4PDI A;  5EXP A;  2Y0Q A;  4GMQ A;  1IN8 A;  3T38 A;  2CV2 A;  4JXJ A;  3CTW B;  5IRE B;  3I4V A;  4HLQ A;  3RE8 A;  2F5P A;  4FW9 A;  4JI5 M;  4LG2 A;  1YE9 A;  3CF6 E;  2HKJ A;  3CF0 A;  4B3T M;  3M7G A;  2FE8 A;  1TH2 A;  1QZM A;  3KSJ A;  4IBK A;  2DWN A;  5ITQ A;  4RF1 A;  1TH4 A;  3QAU A;  4B08 A;  3HHW A;  2OPF A;  2D7G A;  1TH3 A;  4JI6 M;  2M60 A;  1NVM A;  3J27 B;  2R46 A;  3ILK A;  2YR0 A;  3GPU A;  4Z8X A;  2QEN A;  3FKE A;  3HJ8 A;  2R45 A;  3THG A;  2QPA A;  4D80 A;  3R8F A;  3SHG B;  3GRR A;  3SMP A;  1W5T A;  2ZAM A;  4MGH A;  5KQD A;  1I4W A;  2F4V M;  2RKO A;  3SAR A;  2R65 A;  4GIT A;  5E6J A;  1XMQ M;  1Z5A A;  3AFH A;  1N36 M;  3DFZ A;  2QBY B;  2QBY A;  1FJG M;  1EE8 A;  5EXS A;  4DV1 M;  4KO8 A;  2Q2E B;  3TE6 A;  4MGI E;  1KSF X;  3VFD A;  2CE7 A;  3UJN A;  3U6P A;  2EO2 A;  2XZF A;  1YUB A;  3VKH A;  3K2L A;  4DUY M;  4LRT A;  3L25 A;  3GPP A;  3VKG A;  5FTK A;  2DZN B;  5DNY A;  4GC9 A;  1GL6 A;  4GH9 A;  2F5N A;  4LJA A;  1DO2 A;  2ERC A;  2BNK A;  2O5R A;  3T1Y M;  3IG5 A;  3GLF A;  3GLF B;  3U60 A;  3U60 B;  1XMO M;  1JR3 D;  3H4M A;  1L2D A;  2E5L M;  2UUA M;  3HJQ A;  4NRV A;  4LFA M;  5EQT A;  1E9S A;  2KRK A;  2KRU A;  2C5R A;  1E94 E;  4JI4 M;  2M5Z A;  1QYR A;  3HJS A;  2UXD M;  3GQ3 A;  2DVW B;  3FD9 A;  5JI3 E;  4LJ6 A;  3D8L A;  4LGM A;  2FNA A;  1MX0 A;  2CV0 A;  4P16 A;  4IBG A;  3DA1 A;  5KPZ A;  3C58 A;  3VDU A;  1NY5 A;  3L29 A;  3U6Q A;  4FD2 A;  1HNX M;  4LF5 M;  3MHV C;  5KPT A;  3E4R A;  3RGS A;  3TQS A;  1L8Q A;  3J7B A;  1IN7 A;  2L7I A;  4JN6 A;  5JI2 E;  2KXE A;  4DR3 M;  4FCT A;  2DXI A;  4JI3 M;  3LVV A;  1ZQ9 A;  2XGN A;  4I81 A;  1DGF A;  1NJF A;  3U6C A;  2LXE A;  4NL4 H;  4LF7 M;  4MH0 E;  2NQ8 C;  5BR8 M;  3GLG B;  3GLG A;  2FOI C;  5KPR A;  4DV3 M;  3BOS A;  2C98 A;  2L6O A;  1HQY E;  4M0D A;  1QAQ A;  4OVZ B;  4OVZ A;  1HR0 M;  1W5S A;  4LZZ A;  3J80 S;  5FTJ A;  3PNY A;  1SXJ E;  3TWL A;  5C1B A;  4M9Z A;  5FTN A;  1HNW M;  4DR1 M;  2QZ4 A;  4LY6 A;  3HU1 A;  4I5S A;  4D82 A;  5IT9 S;  1IY0 A;  1E9R A;  2VQE M;  4LZJ A;  3EIE A;  3UZU A;  2XLJ A;  1FNN A;  3JR5 A;  4DV0 M;  5ITY A;  5IWA M;  1K82 A;  4DR5 M;  4LF6 M;  1YSY A;  2ZAO A;  3PFI A;  3TWM A;  1K3X A;  1QVR A;  4AKG A;  3NWL A;  4X66 M;  1IN5 A;  2FFJ A;  3GQ5 A;  1SXJ A;  1SXJ B;  3HHZ A;  1PJJ A;  1R2Y A;  3SYK A;  3L28 A;  2C9C A;  3DZD A;  3FUX A;  3K8Z A;  3JAM S;  4X62 M;  2V6Z M;  3UK6 A;  1Q3C A;  5ITT A;  3KOY E;  1KYI A;  2Z4S A;  2CUZ A;  4R3D A;  4MGZ E;  1IXR C;  5EXT A;  3SYL A;  2L7H A;  3KDS E;  4FCW A;  4B7H A;  2K47 A;  4S12 A;  4B3M M;  4D81 A;  4G4R A;  1E32 A;  1C1K A;  2HL7 A;  3W0L B;  1TDZ A;  3L26 A;  3FTE A;  3JR4 A;  2XFS A;  3Q8X A;  3SAU A;  4IBI A;  1T3T A;  1N34 M;  1QAM A;  5BPV A;  3PVS A;  3NBI A;  4L15 A;  3KP1 E;  4OW0 A;  1KFV A;  2A5Y B;  3RFW A;  3AOE A;  1IY1 A;  3FUT A;  3SFZ A;  1IBL M;  5H37 D;  3KOX E;  3T15 A;  1Z5B A;  5DYG A;  3FUU A;  4NOO B;  4LJ5 A;  2UU9 M;  2KA6 B;  4GIP A;  3GLH A;  3GLH B;  4NXN M;  5F3W A;  4CGY B;  3QWL A;  4GC5 A;  2AHM A;  1IXS B;  2CEA A;  2Y0T A;  3ZH9 B;  5FTL A;  1XNQ M;  1R2Z A;  3VLF B;  3U61 A;  3U61 B;  1MU5 A;  2CHG A;  2KZS A;  2X4A A;  1G8P A;  3W0F A;  1IXZ A;  1HT1 E;  4PT5 A;  4IBD A;  4PD2 A;  2XFT A;  1N75 A;  2CHV A;  2Z4R A;  3SMS A;  1J7K A;  3U6L A;  4CIS A;  3R9X B;  3GPY A;  1Z59 A;  3VDP A;  4I8O A;  2ZM6 M;  4RF0 A;  4AKI A;  2CHQ A;  4W5W A;  2XSZ A;  3VK7 A;  3MK6 A;  4GRI A;  3AOG A;  3A46 A;  4AW4 A;  4JI2 M;  4OU7 A;  1GLN A;  3FUV A;  4M9X A;  1L1T A;  4Z6Y A;  2C96 A;  1R7R A;  4NSO B;  2F5Q A;  1I94 M;  4FVM A;  3AKZ A;  1R6B X;  4IBB A;  1L1Z A;  3AV0 A;  3M6A A;  5EP4 A;  4A3V B;  4YHH M;  4LFB M;  3B9P A;  4NRW A;  3U6E A;  3LMM A;  1DO0 A;  2R62 A;  3SAW A;  3VK8 A;  2KW0 A;  3GO8 A;  4LGY A;  5KO3 A;  2DHR A;  2UUC M;  4AI6 A;  4DR6 M;  2EUC A;  4KLN A;  4KOD A;  1ORY B;  3CF2 A;  3KVW A;  1IBK M;  4LF8 M;  3PXG A;  3SHF A;  4I4L A;  1IM2 A;  1QAO A;  3EIH A;  3UGJ A;  4REZ A;  4QNM A;  5FSW A;  2UXB M;  2EA0 A;  5FLX S;  3IG8 A;  4HL4 A;  4II7 A;  2X49 A;  1NNU C;  4FWD A;  4QOS A;  1IN6 A;  3GRV A;  2YQZ A;  3KOW E;  4B3R M;  4GKJ M;  1GKI A;  4X65 M;  4DR7 M;  8CAT A;  2W82 A;  2J7O A;  3KXE C;  2G8L A;  1TDH A;  3GRY A;  4XGI A;  3E9S A;  1XC8 A;  1WXQ A;  1G41 A;  3LVW A;  1OFH A;  2H1R A;  4DUZ M;  1Q3B A;  3SAS A;  3KW6 A;  2XEP A;  2CV1 A;  2V1C A;  4MM3 B;  2DWL A;  1H6U A;  3FTC A;  1NJG A;  2I7P A;  2HHH M;  4G4O A;  3GLI B;  3GLI A;  3K1J A;  1L2B A;  2V1U A;  4XBO A;  4RNA A;  3A98 B;  4NSR A;  4L78 A;  1N33 M;  4R7G A;  1L2C A;  4TUW A;  2F5O A;  7CAT A;  4OX9 M;  2BJV A;  4WW0 A;  4LF9 M;  3I51 A;  2RGH A;  3DOA A;  3J2P B;  1S3S A;  2L09 A;  2VII A;  4LCB A;  3T1H M;  3KSX A;  3WHL A;  4JI7 M;  4QHT A;  3RGP A;  1DGG A;  1HQC A;  2YNM D;  4PCZ A;  3FTD A;  1K3W A;  2KZU A;  2QCU A;  3J81 S;  1N32 M;  2HCB A;  2D7E A;  2DWZ B;  2J7N A;  3PNV A;  3GRU A;  1XNR M;  3TWK A;  2YFQ A;  5DYI A;  4LJ9 A;  1GVN A;  3AJI B;  4DV2 M;  4JYA M;  1NY6 A;  2R18 A;  1DGB A;  3M0E A;  1XXH A;  1XXH B;  3I4Y A;  3AL0 C;  5EP3 A;  3J7A S;  3A42 A;  5EP1 A;  3GPX A;  3FUW A;  4CHT B;  1QQW A;  3HKP A;  4IBE A;  4BLC A;  4X64 M;  2F5S A;  3MJ5 A;  4L16 A;  4IIW A;  1N77 A;  1TGU A;  3WHK A;  1PM5 A;  3K92 A;  2G5G X;  4QNR A;  3TL4 X;  2P5T A;  5EXX A;  1G59 A;  2I7N A;  4M0W A;  5GKN A;  3SC3 A;  3UMM A;  2KEB A;  4PDG A;  3KS4 A;  2XZU A;  4LF4 M;  1QAN A;  2X8A A;  4GHA A;  3U5Z A;  4MB7 A;  4G6Z A;  3U5Z B;  1LV7 A;  1G4A E;  3HGI A;  2LH0 A;  4IJE A;  3U6S A;  4L4U A;  4QHS A;  4JI8 M;  4WUR A;  4DV5 M;  2Z3X A;  1IN4 A;  5E26 A;  4IBJ A;  3GP1 A;  3KP0 E;  4LJ7 A;  1IBM M;  1ZAE A;  3FYC A;  1HT2 E;  1SXJ D;  4B3S M;  1OJL A;  1SXJ C;  4FCV A;  4MGY E;  1IY2 A;  4NXM M;  5ITR A;  5EJC A;  3L2A A;  4G4N A;  4GHL A;  4M9S A;  5A2Q S;  4JV5 M;  2LNH C;  4DV4 M;  4MGK E;  1Q39 A;  1XWI A;  4ZPX A;  1NHW C;  5C18 A;  4QOZ C;  4L8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...