3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KOZE 3KOWE 3KOYE 3KP1E 3KOXE 3KP0E
chains in the Genus database with same CATH superfamily
2CV2A 2HCBA 3NBIA 4OX9M 2QZ4A 3HHXA 3U6OA 2YNMD 2YR0A 1ORYB 3SBJA 3VKGA 5ITTA 3FTFA 3KS4A 2JY6B 3RGPA 2W82A 1TDHA 2WSEF 2R4EA 2LVNC 2DZNB 2F5PA 3FYDA 2ZTCA 1OFHA 3KOZE 4DR2M 1QVRA 4RF0A 2CEAA 5KPRA 1GABA 1NO1A 3BOSA 2JP7A 5DYIA 4M0WA 1HT2E 2BNKA 4Q7JA 2ERCA 4IBIA 1IXSA 3LCVB 4NL4H 7CATA 2FS1A 4LJ9A 5ITYA 2CP8A 2RGHA 5ITQA 2F5QA 4FWGA 4IBKA 4D81A 2V6ZM 2L7IA 5EP3A 1Z5BA 1PJTA 4AW4A 4DR4M 3PVSA 4LZZA 2EKFA 3AL0C 4CGYB 3LVVA 1IN8A 1PJSA 2VF7A 2DZLA 1DGHB 1SXJB 1UFZA 3GRRA 3KSXA 3M6AA 4FWDA 3JAMS 3U6QA 3L25A 4OU7A 2DWMA 3V76A 5EXXA 3WHKA 1QAOA 4AKHA 1EIJA 1G41A 2L09A 1R6BX 3HGIA 1IY1A 3HU3A 4NXNM 4X64M 1TDZA 3SATA 1TR8A 4GC5A 3U6SA 4LF4M 3AOEA 3UJNA 3LQRA 4HEOA 1D2NA 3I04M 3Q8XA 3HHYA 2LTUA 2MJ5B 2QCUA 3VDPA 3GLIE 4MGYE 4Z6YA 4DV7M 4B7HA 1Q02A 4XK8F 4DR1M 1TH4A 4S12A 5KQDA 3JR5A 4GHAA 4WP2A 2DAIA 4NXMM 4QNMA 3FRIA 2DWLA 2APLA 3U5ZA 2ZBKB 2CHQA 4FD2A 2D7GA 3ZCBB 4PCZA 1R2YA 1E9RA 4UN2B 1T3TA 3IECA 3K2LA 3MK6A 2I7NA 1XXHA 4CHTB 3B7QA 4Z8XA 2HKJA 2BJWA 2K0BX 4MB7A 4X66M 4LGMA 2L4FA 2O01F 4I8OA 2R65A 2FOIC 2Z4RA 4XBOA 3GQ5A 1T43A 4EIWA 2KNVA 2BWBA 3FKEA 2UUAM 1GL6A 4QOSA 3GLHA 4GEWA 2CV1A 1KYIA 3M0EA 3U6PA 1N33M 2L6OA 3A45A 1IXZA 1QQWA 2C5RA 3GQ4A 1F4IA 3J27B 1JR3E 1WHCA 3A42A 1J7KA 4LJ8A 3GLFA 2JY5A 2XZFA 1SXJC 4II7A 1SXJE 4NSOB 4AKGA 3MJ5A 2L7HA 3A46A 5EP4A 3KOWE 2R46A 3FTCA 4B3RM 1PM5A 5EXPA 4LJ7A 1IN7A 2LVPC 1IXSB 3KXEC 2LWXA 3SARA 5IZ7D 5ITXA 2DKLA 4IJEA 3GQ3A 1N78A 1N36M 3NWLA 1OAIA 2R4JA 4JI6M 1E94E 2XEPA 4LJAA 3PNYA 3SMPA 2UU9M 4FVMA 5KPZA 1LV7A 1NY6A 1UM8A 4I81A 2NQ8C 1YSYA 4B3MM 3VK7A 1R7RA 2R18A 3H4MA 1VEGA 3B74A 2VDBB 2JXNA 3D8LA 3PFIA 5GKNA 4BBAA 4D82A 4F2LA 3HJ8A 1DGGA 3GLGA 3U6DA 2VQFM 1WXQA 4L6V6 2CV0A 2Z7JA 4PD2A 4LF5M 3SHGB 3UZUA 2FH0A 5LMUM 2ZTDA 4ZPXA 2KNAA 3WHLA 2X49A 3VK8A 4G4RA 1IM2A 3CF2A 1W5SA 4Y28F 1L2CA 4X65M 1V34A 3QAUA 4DR7M 1YUBA 2C96A 2XFSA 2K47A 2V1UA 3SASA 3TL4X 3VLFB 4FCWA 1DO2A 2EJSA 1OAOC 3FUXA 1L1ZA 1WGNA 3HZJA 2ZANA 3UMMA 3PXGA 4B3TM 2WSCF 5EQTA 1HQCA 3I51A 1NV9A 1XXHB 5JI2E 2CRUA 3U6LA 3U6CA 3GPUA 2UXDM 1WJ7A 2OQ4A 4GITA 2L4EA 4GRIA 3ZQJA 3IG5A 4M9ZA 3RE8A 1G71A 1OIZA 2JNHA 2OOAA 3LVWA 3HY5A 4LRSA 4P17A 2O5RA 1FJGM 2B3TA 1P3QQ 1CUKA 3FRHA 5H37D 1TF0B 3D8BA 1I94M 2KEBA 3THGA 2XLJA 3U61A 1GO5A 2LH0A 3HHWA 1FNNA 1X37A 1NHGC 3FE3A 3HJQA 4XGIA 2ZAMA 3BXWA 3GLHB 2Z4SA 3GO8A 2DXIA 3TPZA 4R7GA 3KFUG 2QSFX 3TWKA 4QOZC 2KRUA 4NRVA 3I4YA 2WZJA 2L2DA 4DR6M 3W0LB 1D0KA 1Z59A 3J81S 2O25A 3HKPA 1G59A 4AG6A 2VIIA 2RRUA 1K3XA 4FCVA 1IBLM 2Q2EB 1GJSA 4M9XA 3W67A 2G5GX 2Y20A 2KZSA 3U6EA 1N32M 2JA2A 5KQ8A 3VKHA 3T1HM 1OKSA 2HL7A 5C1BA 3SAUA 4AQYM 2HAKA 3T15A 3QYEA 4DV2M 2BJVA 1XNRM 3FUUA 3KDSE 3SAVA 2DAGA 1GLNA 5LMNM 3AOEC 5BPVA 4DV3M 1DGBA 3B7NA 5FTLA 3SMSA 2XH9A 1XMQM 4JI1M 2A5YB 2GQFA 2CWBA 3QYBA 2UUCM 4NRWA 4JXJA 3AOGA 3CF6E 3IHPA 2Z8YM 4KO8A 4LCBA 4MGZE 1QAQA 3KP0E 5EP1A 4LFBM 3LCUA 4LG2A 1C1KA 1NNJA 3GLGB 2QQ8A 1IN4A 2GNOA 5E26A 1OJLA 4IBCA 3DFZA 1ZMVA 2J5YA 3GRUA 2AHMA 2FNAA 4G6ZA 4AZFA 5JI3E 2KZUA 3AJIB 2Z3XA 4LGYA 4WW0A 2J7OA 2D7EA 3UGJA 3GLIA 4IBEA 3E21A 3R9XB 2DWZB 1PRBA 3FUVA 5F3WA 4L16A 3I01M 4NC6A 4B3SM 5FTJA 2MR9A 4RKUF 5FTKA 5DFLA 2CHVA 4MGHA 1WGLA 2F4VM 5IWAM 3B9PA 1KFVA 3AV0A 4M9SA 4I5SA 1YLAA 3KP1E 1R4GA 3GLHE 2ZM6M 2EA0A 1AUAA 2EKKA 3ZH9B 1L1TA 2F5NA 1DV0A 2R6FA 4OVZA 5EJCA 1Z6TA 1I4WA 1WR1B 2R0IA 2YQZA 4I4LA 1MN3A 1Y8GA 4M0DA 2LHCA 1MU5A 1J09A 2H5XA 3HX3A 3I4VA 2YFQA 4RF1A 5C18A 4DR3M 1E32A 2P5TA 4LRTA 5DYGA 4LFCM 3U60A 3HU2A 4B7GA 5IT9S 4OW0A 1ZV1A 1G4AE 1N34M 3KVWA 1VG5A 4FWHA 5FLXS 3U61B 3B89A 1HQYE 2KW0A 2DENA 3A98B 3W0FA 1GL7A 3GP1A 1OIPA 2KRKA 1JR3A 4QNRA 3AFHA 1SG9A 2D7HA 1EFUB 2XSZA 1TH2A 1Q39A 4R3DA 3R8FA 2DVWB 1SXJA 1D0LA 1JR3D 1S3SA 3J7BA 2LXEA 4LJ4A 1QANA 4GIPA 3ZC7B 2LNHC 3L27A 2LVOC 2XSZD 2CHGA 1SXJD 2JZ1A 2X4AA 4MM3B 2MH8A 1HR0M 2R44A 3C3DA 4QHSA 1C7YA 5EXSA 4NOOB 2KDLA 1JQJC 3OTOM 2R45A 2CE7A 3L2AA 1NVMA 1YE9A 2KA6B 2DZOB 3HWSA 4A3VB 1HJPA 1HT1E 1VDDA 5KPTA 2Y21A 4LY6A 2MGWA 3U5ZB 2K6BA 3EIHA 4LJ5A 4GKJM 3VDUA 2H1RA 3GRYA 3VFDA 4JI8M 3IG8A 3K9PA 3SYLA 2F5OA 4GC9A 2M60A 2J7NA 4YY3M 4LJ6A 3NBXX 3Q8GA 1HNZM 2XGNA 1ZAEA 4DV1M 3GLIB 1QDTA 4LF9M 1IY0A 1G8PA 4PDIA 4IBDA 5A2QS 4GH9A 1K3WA 3W68A 3KW6A 1DO0A 1NNUC 1VEKA 4G3OA 3CTWB 4LF8M 4KHPM 2DHYA 4HL4A 1XWIA 1XHBA 1PJQA 4L78A 1D0MA 2JZ0A 1L2BA 1E9SA 1NSFA 1QZEA 3BBZA 2UXBM 1Z5CA 4JI2M 3MHVC 2OPFA 4OVZB 3GPPA 2QBYA 1J5EM 2EO2A 2QHOB 4RNAA 3SAWA 2DHRA 1N77A 2R62A 3RFWA 4CIZA 3GLFB 2C9CA 3L29A 3U6MA 3DOAA 4KODA 2HHHM 4LF6M 4FCTA 1NV8A 4IJFA 3U60B 3PNVA 3EIEA 2UUBM 1TGUA 3K1JA 4IBGA 1Q3CA 3E46A 1QZMA 4DUYM 3DA1A 5DNYA 4G4OA 4DV5M 2DAKA 3E4RA 3CGWA 1L8QA 4DBGB 3SFZA 3KS8A 3CF0A 1PJIA 1HNWM 2RKOA 1IXRC 2JUJA 4DUZM 3FTDA 3K9OA 2QNJA 3DZDA 1QDRA 1ZMUA 3C3EA 3E9SA 4IBFA 4JN6A 1A5TA 2MROB 5FTNA 2K9DA 1XC8A 3HU1A 3UK6A 1XNQM 4KLNA 1AIPC 2JY8A 2G8LA 4W5WA 1PGYA 1XXHE 1G3IA 1W5TA 2WSFF 1XMOM 2E5LM 1NJFA 1NY5A 4CJ6A 2QP9X 4ITQA 4AG5A 1HNXM 4GMQA 1N75A 1R2ZA 1OQYA 1EE8A 3LMMA 1OFIA 4L4UA 1Q3BA 4DV4M 1WIVA 2C9OA 3AKZA 3SC3A 1VQ1A 3FYCA 2LVAA 1XB2B 4BLCA 3L26A 2G3QA 3SYKA 1H6UA 2UXCM 1IBMM 8CATA 4JI5M 4B08A 3C58A 1L2DA 2RGOA 1MX0A 3KOXE 1DGFA 2KXEA 5ITUA 2F5SA 4AKIA 1NHWC 2DAMA 4K0KM 3K92A 1GKIA 3K8ZA 4REZA 4DR5M 3KOYE 2HWJA 1IBKM 2V1CA 3TQSA 2LBCA 4IBJA 3MMPA 1IN6A 3TWMA 5EP2A 3GPXA 2LVQD 1QYRA 3RGSA 2LHGA 4HLQA 3FD9A 4LZJA 4QHTA 3TWLA 3GLFE 3FUWA 1IFYA 1JB0F 4NSRA 1R5LA 2OO9A 4G4NA 2OOBA 1TTEA 4L8RC 3QWLA 3KSJA 4P16A 1IQPA 1ZQ9A 4KT0F 1LTMA 5FTMA 2DAEA 4DV6M 1ZMWA 5ITXE 5L8RF 3JR4A 3J7AS 5E6JA 4YHHM 2BWEA 1V92A 2XFTA 4AI6A 3C9PA 2XZUA 4MGIE 2XF3A 1VDLA 5IREB 1DGHA 2Y0QA 1NJGA 2QBYB 1PJJA 1IN5A 1GJTA 2CUZA 3L28A 3SHFA 1QUSA 4JYAM 4JI4M 3J80S 1RU3A 5FSWA 2DI0A 4WURA 4DV0M 3TE6A 4IBBA 2FFJA 3T38A 3GLGE 4G4QA 4JI0M 3T1YM 3FTEA 4JV5M 1GVNA 4FW9A 2VQEM 4GKKM 2ZAOA 4TUWA 2VF8A 4X62M 2QENA 1V33A 4JI7M 2JWSA 4LFAM 3B7ZA 4IIWA 2X8AA 2Y0TA 4B7FA 4GHLA 3GRVA 4PDGA 2KHHA 3FUTA 2M5ZA 2C98A 4JI3M 4ANRA 5ITRA 1MJGM 5EXTA 1VEJA 5KO3A 4F1IA 2EUCA 1TH3A 2N35A 1IY2A 3LW5F 3GPYA 3M7GA 4LF7M 4CISA 2CFOA 3H4JA 2DNAA 4R71A 3F92A 3LQQA 3J2PB 1Z5AA 2C99A 2I7PA 3HHZA 3HJSA 4MGKE 2FE8A 3T6PA 1K82A 1OTRA 1QAMA 4MH0E 4D80A 5BR8M 2JY7A 4PT5A 4BB9A 2QPAA 1T6OA 1BVSA 1KSFX 2KNZA 2DWNA 3ILKA 4L15A 1QUTA
chains in the Genus database with same CATH topology
2CV2A 2HCBA 3NBIA 4OX9M 2QZ4A 3HHXA 3U6OA 2YNMD 2YR0A 1ORYB 3SBJA 3VKGA 5ITTA 3FTFA 3KS4A 3RGPA 2W82A 1TDHA 2R4EA 2DZNB 2F5PA 3FYDA 1OFHA 3KOZE 4DR2M 1QVRA 4RF0A 2CEAA 5KPRA 3BOSA 5DYIA 4M0WA 1HT2E 2BNKA 2ERCA 4IBIA 4NL4H 7CATA 4LJ9A 5ITYA 2RGHA 5ITQA 2F5QA 4FWGA 4IBKA 4D81A 2V6ZM 2L7IA 5EP3A 1Z5BA 4AW4A 4DR4M 3PVSA 4LZZA 3AL0C 4CGYB 3LVVA 1IN8A 3KSXA 4FWDA 3M6AA 1DGHB 1SXJB 3GRRA 4XBOA 3JAMS 4K0KM 3U6QA 3L25A 4OU7A 2DWMA 5EXXA 3WHKA 1QAOA 4AKHA 1G41A 2L09A 1R6BX 3HGIA 1IY1A 3HU3A 4NXNM 4X64M 1TDZA 3SATA 4GC5A 3U6SA 4LF4M 3AOEA 3UJNA 3LQRA 1D2NA 3Q8XA 3HHYA 2QCUA 3VDPA 4MGYE 4Z6YA 4DV7M 4B7HA 4DR1M 1TH4A 4S12A 5KQDA 3JR5A 4GHAA 4NXMM 4QNMA 2DWLA 3U5ZA 2ZBKB 2CHQA 4FD2A 2D7GA 3ZCBB 4PCZA 1R2YA 1E9RA 1T3TA 3K2LA 3MK6A 2I7NA 1XXHA 4CHTB 4Z8XA 2HKJA 2BJWA 4MB7A 4X66M 4LGMA 4I8OA 2R65A 2FOIC 2Z4RA 3GQ5A 4EIWA 3FKEA 2UUAM 1GL6A 4QOSA 3GLHA 2CV1A 1KYIA 3M0EA 3U6PA 1N33M 2L6OA 3A45A 1IXZA 1QQWA 2C5RA 3GQ4A 3J27B 3A42A 1J7KA 4LJ8A 3GLFA 2XZFA 1SXJC 4II7A 1SXJE 4NSOB 4AKGA 3MJ5A 2L7HA 3A46A 5EP4A 3KOWE 2R46A 3FTCA 4B3RM 1PM5A 5EXPA 4LJ7A 1IN7A 1IXSB 3KXEC 2LWXA 3SARA 5IZ7D 5ITXA 4IJEA 3GQ3A 1N78A 1N36M 3NWLA 2R4JA 4JI6M 1E94E 2XEPA 4LJAA 3PNYA 3SMPA 2UU9M 4FVMA 5KPZA 1LV7A 1NY6A 1UM8A 4I81A 2NQ8C 1YSYA 4B3MM 3VK7A 1R7RA 2R18A 3H4MA 3D8LA 5GKNA 3PFIA 4BBAA 4D82A 3GLGA 1KFVA 3HJ8A 1DGGA 3U6DA 2VQFM 1WXQA 2CV0A 2Z7JA 4PD2A 4LF5M 3SHGB 3UZUA 5LMUM 4ZPXA 3WHLA 2X49A 3VK8A 4G4RA 1IM2A 3CF2A 1W5SA 1L2CA 4X65M 4DR7M 3QAUA 1YUBA 2C96A 2XFSA 2K47A 2V1UA 3SASA 3TL4X 3VLFB 4FCWA 1DO2A 3FUXA 1L1ZA 2ZANA 3UMMA 3PXGA 4B3TM 5EQTA 1HQCA 3I51A 1XXHB 5JI2E 3U6LA 3U6CA 3GPUA 2UXDM 2OQ4A 4GITA 4GRIA 3IG5A 4M9ZA 3RE8A 4LRSA 3LVWA 1FJGM 2O5RA 5H37D 1I94M 3D8BA 2KEBA 3THGA 2XLJA 3U61A 2LH0A 3HHWA 1FNNA 1X37A 1NHGC 3HJQA 4XGIA 2ZAMA 3GLHB 2Z4SA 3GO8A 2DXIA 3TPZA 4R7GA 3KFUG 4QOZC 3TWKA 2KRUA 4NRVA 3I4YA 4DR6M 3W0LB 1Z59A 3J81S 3HKPA 1G59A 4AG6A 2VIIA 1K3XA 4FCVA 1IBLM 2Q2EB 4M9XA 2G5GX 2Y20A 2KZSA 3U6EA 1N32M 2JA2A 5KQ8A 3VKHA 3T1HM 2HL7A 5C1BA 3SAUA 4AQYM 3T15A 4DV2M 2BJVA 1XNRM 3FUUA 3KDSE 3SAVA 1GLNA 5LMNM 3AOEC 5BPVA 4DV3M 1DGBA 5FTLA 3SMSA 2XH9A 1XMQM 4JI1M 2A5YB 2UUCM 4NRWA 4JXJA 3AOGA 3CF6E 4KO8A 4LCBA 4MGZE 1QAQA 3KP0E 5EP1A 4LFBM 4LG2A 1C1KA 1NNJA 3GLGB 1IN4A 5E26A 1OJLA 4IBCA 3DFZA 3GRUA 2AHMA 2FNAA 4G6ZA 4AZFA 5JI3E 2KZUA 3AJIB 2Z3XA 4LGYA 4WW0A 2J7OA 2D7EA 3UGJA 3GLIA 4IBEA 3R9XB 2DWZB 3FUVA 5F3WA 4L16A 4B3SM 5FTJA 5FTKA 2CHVA 4MGHA 2F4VM 5IWAM 3B9PA 3AV0A 4M9SA 4I5SA 3KP1E 2ZM6M 2EA0A 3ZH9B 1L1TA 2F5NA 4OVZA 5EJCA 1Z6TA 1I4WA 2YQZA 4I4LA 4M0DA 1MU5A 1J09A 3I4VA 2YFQA 4RF1A 5C18A 4DR3M 1E32A 2P5TA 4LRTA 5DYGA 4LFCM 3U60A 3HU2A 4B7GA 5IT9S 4OW0A 1G4AE 1N34M 3KVWA 4FWHA 5FLXS 3U61B 3W0FA 1HQYE 2KW0A 3A98B 3GP1A 1GL7A 2KRKA 1JR3A 4QNRA 3AFHA 2D7HA 2XSZA 1TH2A 1Q39A 4R3DA 3R8FA 2DVWB 1SXJA 1JR3D 3J7BA 1S3SA 4LJ4A 2LXEA 3ZC7B 1QANA 4GIPA 2LNHC 3L27A 2XSZD 2CHGA 1SXJD 2X4AA 4MM3B 1HR0M 4QHSA 5EXSA 4NOOB 3OTOM 1JQJC 2R45A 2CE7A 3L2AA 1NVMA 1YE9A 2KA6B 2DZOB 3HWSA 4A3VB 1HT1E 1VDDA 5KPTA 2Y21A 4LY6A 3U5ZB 4LJ5A 3EIHA 4GKJM 3VDUA 2H1RA 3GRYA 3VFDA 4JI8M 3IG8A 3SYLA 2F5OA 4GC9A 2M60A 2J7NA 4YY3M 4LJ6A 1HNZM 2XGNA 1ZAEA 4DV1M 3GLIB 4LF9M 1IY0A 1G8PA 4PDIA 4IBDA 5A2QS 4GH9A 1K3WA 3KW6A 1DO0A 1NNUC 3CTWB 4LF8M 4KHPM 4HL4A 1XWIA 1XHBA 4L78A 1L2BA 1E9SA 1NSFA 2UXBM 1Z5CA 4JI2M 3MHVC 2OPFA 4OVZB 3GPPA 2QBYA 1J5EM 2EO2A 3SAWA 4RNAA 1N77A 2DHRA 2R62A 3RFWA 3GLFB 2C9CA 3L29A 3U6MA 3DOAA 4KODA 2HHHM 4LF6M 4FCTA 4IJFA 3U60B 3PNVA 3EIEA 2UUBM 1TGUA 3K1JA 4IBGA 1Q3CA 4DUYM 1QZMA 3DA1A 5DNYA 4G4OA 4DV5M 3E4RA 1L8QA 3SFZA 3KS8A 3CF0A 1PJIA 1HNWM 2RKOA 1IXRC 4DUZM 3FTDA 3DZDA 3E9SA 4IBFA 4JN6A 5FTNA 1XC8A 3HU1A 3UK6A 1XNQM 4KLNA 2G8LA 4W5WA 1G3IA 1W5TA 1XMOM 2E5LM 1NJFA 1NY5A 2QP9X 4ITQA 4AG5A 1HNXM 4GMQA 1N75A 1R2ZA 1EE8A 3LMMA 1OFIA 4L4UA 1Q3BA 4DV4M 2C9OA 3AKZA 3SC3A 3L26A 3FYCA 4BLCA 3SYKA 1H6UA 2UXCM 1IBMM 8CATA 4JI5M 4B08A 3C58A 1L2DA 2RGOA 1MX0A 3KOXE 1DGFA 2KXEA 5ITUA 2F5SA 4AKIA 1NHWC 3K92A 1GKIA 3K8ZA 4REZA 4DR5M 3KOYE 1IBKM 2V1CA 3TQSA 4IBJA 3TWMA 1IN6A 5EP2A 3GPXA 1QYRA 3RGSA 4HLQA 3FD9A 4LZJA 4QHTA 3TWLA 3FUWA 4NSRA 4G4NA 4L8RC 3QWLA 3KSJA 4P16A 1IQPA 1ZQ9A 5FTMA 4DV6M 5ITXE 3JR4A 3J7AS 5E6JA 4YHHM 2XFTA 4AI6A 2XZUA 4MGIE 2XF3A 5IREB 1DGHA 2Y0QA 1NJGA 2QBYB 1PJJA 1IN5A 2CUZA 3L28A 3SHFA 4JYAM 4JI4M 3J80S 5FSWA 4WURA 4DV0M 3TE6A 4IBBA 2FFJA 3T38A 4G4QA 3T1YM 4JI0M 3FTEA 4JV5M 1GVNA 4FW9A 2VQEM 4GKKM 2ZAOA 4TUWA 4X62M 2QENA 4JI7M 4LFAM 4IIWA 2X8AA 2Y0TA 4B7FA 4GHLA 3GRVA 4PDGA 3FUTA 2M5ZA 2C98A 4JI3M 5ITRA 5EXTA 5KO3A 2EUCA 1TH3A 1IY2A 3GPYA 3M7GA 4LF7M 4CISA 2CFOA 3LQQA 3J2PB 1Z5AA 2C99A 2I7PA 3HHZA 3HJSA 4MGKE 2FE8A 1K82A 1QAMA 4MH0E 4D80A 5BR8M 4PT5A 4BB9A 2QPAA 1KSFX 2DWNA 3ILKA 4L15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOZ E;  3KOW E;  3KOY E;  3KP1 E;  3KOX E;  3KP0 E; 
#chains in the Genus database with same CATH topology
 2CV2 A;  2HCB A;  3NBI A;  4OX9 M;  2QZ4 A;  3HHX A;  3U6O A;  2YNM D;  2YR0 A;  1ORY B;  3SBJ A;  3VKG A;  5ITT A;  3FTF A;  3KS4 A;  2JY6 B;  3RGP A;  2W82 A;  1TDH A;  2WSE F;  2R4E A;  2LVN C;  2DZN B;  2F5P A;  3FYD A;  2ZTC A;  1OFH A;  3KOZ E;  4DR2 M;  1QVR A;  4RF0 A;  2CEA A;  5KPR A;  1GAB A;  1NO1 A;  3BOS A;  2JP7 A;  5DYI A;  4M0W A;  1HT2 E;  2BNK A;  4Q7J A;  2ERC A;  4IBI A;  1IXS A;  3LCV B;  4NL4 H;  7CAT A;  2FS1 A;  4LJ9 A;  5ITY A;  2CP8 A;  2RGH A;  5ITQ A;  2F5Q A;  4FWG A;  4IBK A;  4D81 A;  2V6Z M;  2L7I A;  5EP3 A;  1Z5B A;  1PJT A;  4AW4 A;  4DR4 M;  3PVS A;  4LZZ A;  2EKF A;  3AL0 C;  4CGY B;  3LVV A;  1IN8 A;  1PJS A;  2VF7 A;  2DZL A;  1DGH B;  1SXJ B;  1UFZ A;  3GRR A;  3KSX A;  3M6A A;  4FWD A;  3JAM S;  3U6Q A;  3L25 A;  4OU7 A;  2DWM A;  3V76 A;  5EXX A;  3WHK A;  1QAO A;  4AKH A;  1EIJ A;  1G41 A;  2L09 A;  1R6B X;  3HGI A;  1IY1 A;  3HU3 A;  4NXN M;  4X64 M;  1TDZ A;  3SAT A;  1TR8 A;  4GC5 A;  3U6S A;  4LF4 M;  3AOE A;  3UJN A;  3LQR A;  4HEO A;  1D2N A;  3I04 M;  3Q8X A;  3HHY A;  2LTU A;  2MJ5 B;  2QCU A;  3VDP A;  3GLI E;  4MGY E;  4Z6Y A;  4DV7 M;  4B7H A;  1Q02 A;  4XK8 F;  4DR1 M;  1TH4 A;  4S12 A;  5KQD A;  3JR5 A;  4GHA A;  4WP2 A;  2DAI A;  4NXM M;  4QNM A;  3FRI A;  2DWL A;  2APL A;  3U5Z A;  2ZBK B;  2CHQ A;  4FD2 A;  2D7G A;  3ZCB B;  4PCZ A;  1R2Y A;  1E9R A;  4UN2 B;  1T3T A;  3IEC A;  3K2L A;  3MK6 A;  2I7N A;  1XXH A;  4CHT B;  3B7Q A;  4Z8X A;  2HKJ A;  2BJW A;  2K0B X;  4MB7 A;  4X66 M;  4LGM A;  2L4F A;  2O01 F;  4I8O A;  2R65 A;  2FOI C;  2Z4R A;  4XBO A;  3GQ5 A;  1T43 A;  4EIW A;  2KNV A;  2BWB A;  3FKE A;  2UUA M;  1GL6 A;  4QOS A;  3GLH A;  4GEW A;  2CV1 A;  1KYI A;  3M0E A;  3U6P A;  1N33 M;  2L6O A;  3A45 A;  1IXZ A;  1QQW A;  2C5R A;  3GQ4 A;  1F4I A;  3J27 B;  1JR3 E;  1WHC A;  3A42 A;  1J7K A;  4LJ8 A;  3GLF A;  2JY5 A;  2XZF A;  1SXJ C;  4II7 A;  1SXJ E;  4NSO B;  4AKG A;  3MJ5 A;  2L7H A;  3A46 A;  5EP4 A;  3KOW E;  2R46 A;  3FTC A;  4B3R M;  1PM5 A;  5EXP A;  4LJ7 A;  1IN7 A;  2LVP C;  1IXS B;  3KXE C;  2LWX A;  3SAR A;  5IZ7 D;  5ITX A;  2DKL A;  4IJE A;  3GQ3 A;  1N78 A;  1N36 M;  3NWL A;  1OAI A;  2R4J A;  4JI6 M;  1E94 E;  2XEP A;  4LJA A;  3PNY A;  3SMP A;  2UU9 M;  4FVM A;  5KPZ A;  1LV7 A;  1NY6 A;  1UM8 A;  4I81 A;  2NQ8 C;  1YSY A;  4B3M M;  3VK7 A;  1R7R A;  2R18 A;  3H4M A;  1VEG A;  3B74 A;  2VDB B;  2JXN A;  3D8L A;  3PFI A;  5GKN A;  4BBA A;  4D82 A;  4F2L A;  3HJ8 A;  1DGG A;  3GLG A;  3U6D A;  2VQF M;  1WXQ A;  4L6V 6;  2CV0 A;  2Z7J A;  4PD2 A;  4LF5 M;  3SHG B;  3UZU A;  2FH0 A;  5LMU M;  2ZTD A;  4ZPX A;  2KNA A;  3WHL A;  2X49 A;  3VK8 A;  4G4R A;  1IM2 A;  3CF2 A;  1W5S A;  4Y28 F;  1L2C A;  4X65 M;  1V34 A;  3QAU A;  4DR7 M;  1YUB A;  2C96 A;  2XFS A;  2K47 A;  2V1U A;  3SAS A;  3TL4 X;  3VLF B;  4FCW A;  1DO2 A;  2EJS A;  1OAO C;  3FUX A;  1L1Z A;  1WGN A;  3HZJ A;  2ZAN A;  3UMM A;  3PXG A;  4B3T M;  2WSC F;  5EQT A;  1HQC A;  3I51 A;  1NV9 A;  1XXH B;  5JI2 E;  2CRU A;  3U6L A;  3U6C A;  3GPU A;  2UXD M;  1WJ7 A;  2OQ4 A;  4GIT A;  2L4E A;  4GRI A;  3ZQJ A;  3IG5 A;  4M9Z A;  3RE8 A;  1G71 A;  1OIZ A;  2JNH A;  2OOA A;  3LVW A;  3HY5 A;  4LRS A;  4P17 A;  2O5R A;  1FJG M;  2B3T A;  1P3Q Q;  1CUK A;  3FRH A;  5H37 D;  1TF0 B;  3D8B A;  1I94 M;  2KEB A;  3THG A;  2XLJ A;  3U61 A;  1GO5 A;  2LH0 A;  3HHW A;  1FNN A;  1X37 A;  1NHG C;  3FE3 A;  3HJQ A;  4XGI A;  2ZAM A;  3BXW A;  3GLH B;  2Z4S A;  3GO8 A;  2DXI A;  3TPZ A;  4R7G A;  3KFU G;  2QSF X;  3TWK A;  4QOZ C;  2KRU A;  4NRV A;  3I4Y A;  2WZJ A;  2L2D A;  4DR6 M;  3W0L B;  1D0K A;  1Z59 A;  3J81 S;  2O25 A;  3HKP A;  1G59 A;  4AG6 A;  2VII A;  2RRU A;  1K3X A;  4FCV A;  1IBL M;  2Q2E B;  1GJS A;  4M9X A;  3W67 A;  2G5G X;  2Y20 A;  2KZS A;  3U6E A;  1N32 M;  2JA2 A;  5KQ8 A;  3VKH A;  3T1H M;  1OKS A;  2HL7 A;  5C1B A;  3SAU A;  4AQY M;  2HAK A;  3T15 A;  3QYE A;  4DV2 M;  2BJV A;  1XNR M;  3FUU A;  3KDS E;  3SAV A;  2DAG A;  1GLN A;  5LMN M;  3AOE C;  5BPV A;  4DV3 M;  1DGB A;  3B7N A;  5FTL A;  3SMS A;  2XH9 A;  1XMQ M;  4JI1 M;  2A5Y B;  2GQF A;  2CWB A;  3QYB A;  2UUC M;  4NRW A;  4JXJ A;  3AOG A;  3CF6 E;  3IHP A;  2Z8Y M;  4KO8 A;  4LCB A;  4MGZ E;  1QAQ A;  3KP0 E;  5EP1 A;  4LFB M;  3LCU A;  4LG2 A;  1C1K A;  1NNJ A;  3GLG B;  2QQ8 A;  1IN4 A;  2GNO A;  5E26 A;  1OJL A;  4IBC A;  3DFZ A;  1ZMV A;  2J5Y A;  3GRU A;  2AHM A;  2FNA A;  4G6Z A;  4AZF A;  5JI3 E;  2KZU A;  3AJI B;  2Z3X A;  4LGY A;  4WW0 A;  2J7O A;  2D7E A;  3UGJ A;  3GLI A;  4IBE A;  3E21 A;  3R9X B;  2DWZ B;  1PRB A;  3FUV A;  5F3W A;  4L16 A;  3I01 M;  4NC6 A;  4B3S M;  5FTJ A;  2MR9 A;  4RKU F;  5FTK A;  5DFL A;  2CHV A;  4MGH A;  1WGL A;  2F4V M;  5IWA M;  3B9P A;  1KFV A;  3AV0 A;  4M9S A;  4I5S A;  1YLA A;  3KP1 E;  1R4G A;  3GLH E;  2ZM6 M;  2EA0 A;  1AUA A;  2EKK A;  3ZH9 B;  1L1T A;  2F5N A;  1DV0 A;  2R6F A;  4OVZ A;  5EJC A;  1Z6T A;  1I4W A;  1WR1 B;  2R0I A;  2YQZ A;  4I4L A;  1MN3 A;  1Y8G A;  4M0D A;  2LHC A;  1MU5 A;  1J09 A;  2H5X A;  3HX3 A;  3I4V A;  2YFQ A;  4RF1 A;  5C18 A;  4DR3 M;  1E32 A;  2P5T A;  4LRT A;  5DYG A;  4LFC M;  3U60 A;  3HU2 A;  4B7G A;  5IT9 S;  4OW0 A;  1ZV1 A;  1G4A E;  1N34 M;  3KVW A;  1VG5 A;  4FWH A;  5FLX S;  3U61 B;  3B89 A;  1HQY E;  2KW0 A;  2DEN A;  3A98 B;  3W0F A;  1GL7 A;  3GP1 A;  1OIP A;  2KRK A;  1JR3 A;  4QNR A;  3AFH A;  1SG9 A;  2D7H A;  1EFU B;  2XSZ A;  1TH2 A;  1Q39 A;  4R3D A;  3R8F A;  2DVW B;  1SXJ A;  1D0L A;  1JR3 D;  1S3S A;  3J7B A;  2LXE A;  4LJ4 A;  1QAN A;  4GIP A;  3ZC7 B;  2LNH C;  3L27 A;  2LVO C;  2XSZ D;  2CHG A;  1SXJ D;  2JZ1 A;  2X4A A;  4MM3 B;  2MH8 A;  1HR0 M;  2R44 A;  3C3D A;  4QHS A;  1C7Y A;  5EXS A;  4NOO B;  2KDL A;  1JQJ C;  3OTO M;  2R45 A;  2CE7 A;  3L2A A;  1NVM A;  1YE9 A;  2KA6 B;  2DZO B;  3HWS A;  4A3V B;  1HJP A;  1HT1 E;  1VDD A;  5KPT A;  2Y21 A;  4LY6 A;  2MGW A;  3U5Z B;  2K6B A;  3EIH A;  4LJ5 A;  4GKJ M;  3VDU A;  2H1R A;  3GRY A;  3VFD A;  4JI8 M;  3IG8 A;  3K9P A;  3SYL A;  2F5O A;  4GC9 A;  2M60 A;  2J7N A;  4YY3 M;  4LJ6 A;  3NBX X;  3Q8G A;  1HNZ M;  2XGN A;  1ZAE A;  4DV1 M;  3GLI B;  1QDT A;  4LF9 M;  1IY0 A;  1G8P A;  4PDI A;  4IBD A;  5A2Q S;  4GH9 A;  1K3W A;  3W68 A;  3KW6 A;  1DO0 A;  1NNU C;  1VEK A;  4G3O A;  3CTW B;  4LF8 M;  4KHP M;  2DHY A;  4HL4 A;  1XWI A;  1XHB A;  1PJQ A;  4L78 A;  1D0M A;  2JZ0 A;  1L2B A;  1E9S A;  1NSF A;  1QZE A;  3BBZ A;  2UXB M;  1Z5C A;  4JI2 M;  3MHV C;  2OPF A;  4OVZ B;  3GPP A;  2QBY A;  1J5E M;  2EO2 A;  2QHO B;  4RNA A;  3SAW A;  2DHR A;  1N77 A;  2R62 A;  3RFW A;  4CIZ A;  3GLF B;  2C9C A;  3L29 A;  3U6M A;  3DOA A;  4KOD A;  2HHH M;  4LF6 M;  4FCT A;  1NV8 A;  4IJF A;  3U60 B;  3PNV A;  3EIE A;  2UUB M;  1TGU A;  3K1J A;  4IBG A;  1Q3C A;  3E46 A;  1QZM A;  4DUY M;  3DA1 A;  5DNY A;  4G4O A;  4DV5 M;  2DAK A;  3E4R A;  3CGW A;  1L8Q A;  4DBG B;  3SFZ A;  3KS8 A;  3CF0 A;  1PJI A;  1HNW M;  2RKO A;  1IXR C;  2JUJ A;  4DUZ M;  3FTD A;  3K9O A;  2QNJ A;  3DZD A;  1QDR A;  1ZMU A;  3C3E A;  3E9S A;  4IBF A;  4JN6 A;  1A5T A;  2MRO B;  5FTN A;  2K9D A;  1XC8 A;  3HU1 A;  3UK6 A;  1XNQ M;  4KLN A;  1AIP C;  2JY8 A;  2G8L A;  4W5W A;  1PGY A;  1XXH E;  1G3I A;  1W5T A;  2WSF F;  1XMO M;  2E5L M;  1NJF A;  1NY5 A;  4CJ6 A;  2QP9 X;  4ITQ A;  4AG5 A;  1HNX M;  4GMQ A;  1N75 A;  1R2Z A;  1OQY A;  1EE8 A;  3LMM A;  1OFI A;  4L4U A;  1Q3B A;  4DV4 M;  1WIV A;  2C9O A;  3AKZ A;  3SC3 A;  1VQ1 A;  3FYC A;  2LVA A;  1XB2 B;  4BLC A;  3L26 A;  2G3Q A;  3SYK A;  1H6U A;  2UXC M;  1IBM M;  8CAT A;  4JI5 M;  4B08 A;  3C58 A;  1L2D A;  2RGO A;  1MX0 A;  3KOX E;  1DGF A;  2KXE A;  5ITU A;  2F5S A;  4AKI A;  1NHW C;  2DAM A;  4K0K M;  3K92 A;  1GKI A;  3K8Z A;  4REZ A;  4DR5 M;  3KOY E;  2HWJ A;  1IBK M;  2V1C A;  3TQS A;  2LBC A;  4IBJ A;  3MMP A;  1IN6 A;  3TWM A;  5EP2 A;  3GPX A;  2LVQ D;  1QYR A;  3RGS A;  2LHG A;  4HLQ A;  3FD9 A;  4LZJ A;  4QHT A;  3TWL A;  3GLF E;  3FUW A;  1IFY A;  1JB0 F;  4NSR A;  1R5L A;  2OO9 A;  4G4N A;  2OOB A;  1TTE A;  4L8R C;  3QWL A;  3KSJ A;  4P16 A;  1IQP A;  1ZQ9 A;  4KT0 F;  1LTM A;  5FTM A;  2DAE A;  4DV6 M;  1ZMW A;  5ITX E;  5L8R F;  3JR4 A;  3J7A S;  5E6J A;  4YHH M;  2BWE A;  1V92 A;  2XFT A;  4AI6 A;  3C9P A;  2XZU A;  4MGI E;  2XF3 A;  1VDL A;  5IRE B;  1DGH A;  2Y0Q A;  1NJG A;  2QBY B;  1PJJ A;  1IN5 A;  1GJT A;  2CUZ A;  3L28 A;  3SHF A;  1QUS A;  4JYA M;  4JI4 M;  3J80 S;  1RU3 A;  5FSW A;  2DI0 A;  4WUR A;  4DV0 M;  3TE6 A;  4IBB A;  2FFJ A;  3T38 A;  3GLG E;  4G4Q A;  4JI0 M;  3T1Y M;  3FTE A;  4JV5 M;  1GVN A;  4FW9 A;  2VQE M;  4GKK M;  2ZAO A;  4TUW A;  2VF8 A;  4X62 M;  2QEN A;  1V33 A;  4JI7 M;  2JWS A;  4LFA M;  3B7Z A;  4IIW A;  2X8A A;  2Y0T A;  4B7F A;  4GHL A;  3GRV A;  4PDG A;  2KHH A;  3FUT A;  2M5Z A;  2C98 A;  4JI3 M;  4ANR A;  5ITR A;  1MJG M;  5EXT A;  1VEJ A;  5KO3 A;  4F1I A;  2EUC A;  1TH3 A;  2N35 A;  1IY2 A;  3LW5 F;  3GPY A;  3M7G A;  4LF7 M;  4CIS A;  2CFO A;  3H4J A;  2DNA A;  4R71 A;  3F92 A;  3LQQ A;  3J2P B;  1Z5A A;  2C99 A;  2I7P A;  3HHZ A;  3HJS A;  4MGK E;  2FE8 A;  3T6P A;  1K82 A;  1OTR A;  1QAM A;  4MH0 E;  4D80 A;  5BR8 M;  2JY7 A;  4PT5 A;  4BB9 A;  2QPA A;  1T6O A;  1BVS A;  1KSF X;  2KNZ A;  2DWN A;  3ILK A;  4L15 A;  1QUT A; 
#chains in the Genus database with same CATH homology
 2CV2 A;  2HCB A;  3NBI A;  4OX9 M;  2QZ4 A;  3HHX A;  3U6O A;  2YNM D;  2YR0 A;  1ORY B;  3SBJ A;  3VKG A;  5ITT A;  3FTF A;  3KS4 A;  3RGP A;  2W82 A;  1TDH A;  2R4E A;  2DZN B;  2F5P A;  3FYD A;  1OFH A;  3KOZ E;  4DR2 M;  1QVR A;  4RF0 A;  2CEA A;  5KPR A;  3BOS A;  5DYI A;  4M0W A;  1HT2 E;  2BNK A;  2ERC A;  4IBI A;  4NL4 H;  7CAT A;  4LJ9 A;  5ITY A;  2RGH A;  5ITQ A;  2F5Q A;  4FWG A;  4IBK A;  4D81 A;  2V6Z M;  2L7I A;  5EP3 A;  1Z5B A;  4AW4 A;  4DR4 M;  3PVS A;  4LZZ A;  3AL0 C;  4CGY B;  3LVV A;  1IN8 A;  3KSX A;  4FWD A;  3M6A A;  1DGH B;  1SXJ B;  3GRR A;  4XBO A;  3JAM S;  4K0K M;  3U6Q A;  3L25 A;  4OU7 A;  2DWM A;  5EXX A;  3WHK A;  1QAO A;  4AKH A;  1G41 A;  2L09 A;  1R6B X;  3HGI A;  1IY1 A;  3HU3 A;  4NXN M;  4X64 M;  1TDZ A;  3SAT A;  4GC5 A;  3U6S A;  4LF4 M;  3AOE A;  3UJN A;  3LQR A;  1D2N A;  3Q8X A;  3HHY A;  2QCU A;  3VDP A;  4MGY E;  4Z6Y A;  4DV7 M;  4B7H A;  4DR1 M;  1TH4 A;  4S12 A;  5KQD A;  3JR5 A;  4GHA A;  4NXM M;  4QNM A;  2DWL A;  3U5Z A;  2ZBK B;  2CHQ A;  4FD2 A;  2D7G A;  3ZCB B;  4PCZ A;  1R2Y A;  1E9R A;  1T3T A;  3K2L A;  3MK6 A;  2I7N A;  1XXH A;  4CHT B;  4Z8X A;  2HKJ A;  2BJW A;  4MB7 A;  4X66 M;  4LGM A;  4I8O A;  2R65 A;  2FOI C;  2Z4R A;  3GQ5 A;  4EIW A;  3FKE A;  2UUA M;  1GL6 A;  4QOS A;  3GLH A;  2CV1 A;  1KYI A;  3M0E A;  3U6P A;  1N33 M;  2L6O A;  3A45 A;  1IXZ A;  1QQW A;  2C5R A;  3GQ4 A;  3J27 B;  3A42 A;  1J7K A;  4LJ8 A;  3GLF A;  2XZF A;  1SXJ C;  4II7 A;  1SXJ E;  4NSO B;  4AKG A;  3MJ5 A;  2L7H A;  3A46 A;  5EP4 A;  3KOW E;  2R46 A;  3FTC A;  4B3R M;  1PM5 A;  5EXP A;  4LJ7 A;  1IN7 A;  1IXS B;  3KXE C;  2LWX A;  3SAR A;  5IZ7 D;  5ITX A;  4IJE A;  3GQ3 A;  1N78 A;  1N36 M;  3NWL A;  2R4J A;  4JI6 M;  1E94 E;  2XEP A;  4LJA A;  3PNY A;  3SMP A;  2UU9 M;  4FVM A;  5KPZ A;  1LV7 A;  1NY6 A;  1UM8 A;  4I81 A;  2NQ8 C;  1YSY A;  4B3M M;  3VK7 A;  1R7R A;  2R18 A;  3H4M A;  3D8L A;  5GKN A;  3PFI A;  4BBA A;  4D82 A;  3GLG A;  1KFV A;  3HJ8 A;  1DGG A;  3U6D A;  2VQF M;  1WXQ A;  2CV0 A;  2Z7J A;  4PD2 A;  4LF5 M;  3SHG B;  3UZU A;  5LMU M;  4ZPX A;  3WHL A;  2X49 A;  3VK8 A;  4G4R A;  1IM2 A;  3CF2 A;  1W5S A;  1L2C A;  4X65 M;  4DR7 M;  3QAU A;  1YUB A;  2C96 A;  2XFS A;  2K47 A;  2V1U A;  3SAS A;  3TL4 X;  3VLF B;  4FCW A;  1DO2 A;  3FUX A;  1L1Z A;  2ZAN A;  3UMM A;  3PXG A;  4B3T M;  5EQT A;  1HQC A;  3I51 A;  1XXH B;  5JI2 E;  3U6L A;  3U6C A;  3GPU A;  2UXD M;  2OQ4 A;  4GIT A;  4GRI A;  3IG5 A;  4M9Z A;  3RE8 A;  4LRS A;  3LVW A;  1FJG M;  2O5R A;  5H37 D;  1I94 M;  3D8B A;  2KEB A;  3THG A;  2XLJ A;  3U61 A;  2LH0 A;  3HHW A;  1FNN A;  1X37 A;  1NHG C;  3HJQ A;  4XGI A;  2ZAM A;  3GLH B;  2Z4S A;  3GO8 A;  2DXI A;  3TPZ A;  4R7G A;  3KFU G;  4QOZ C;  3TWK A;  2KRU A;  4NRV A;  3I4Y A;  4DR6 M;  3W0L B;  1Z59 A;  3J81 S;  3HKP A;  1G59 A;  4AG6 A;  2VII A;  1K3X A;  4FCV A;  1IBL M;  2Q2E B;  4M9X A;  2G5G X;  2Y20 A;  2KZS A;  3U6E A;  1N32 M;  2JA2 A;  5KQ8 A;  3VKH A;  3T1H M;  2HL7 A;  5C1B A;  3SAU A;  4AQY M;  3T15 A;  4DV2 M;  2BJV A;  1XNR M;  3FUU A;  3KDS E;  3SAV A;  1GLN A;  5LMN M;  3AOE C;  5BPV A;  4DV3 M;  1DGB A;  5FTL A;  3SMS A;  2XH9 A;  1XMQ M;  4JI1 M;  2A5Y B;  2UUC M;  4NRW A;  4JXJ A;  3AOG A;  3CF6 E;  4KO8 A;  4LCB A;  4MGZ E;  1QAQ A;  3KP0 E;  5EP1 A;  4LFB M;  4LG2 A;  1C1K A;  1NNJ A;  3GLG B;  1IN4 A;  5E26 A;  1OJL A;  4IBC A;  3DFZ A;  3GRU A;  2AHM A;  2FNA A;  4G6Z A;  4AZF A;  5JI3 E;  2KZU A;  3AJI B;  2Z3X A;  4LGY A;  4WW0 A;  2J7O A;  2D7E A;  3UGJ A;  3GLI A;  4IBE A;  3R9X B;  2DWZ B;  3FUV A;  5F3W A;  4L16 A;  4B3S M;  5FTJ A;  5FTK A;  2CHV A;  4MGH A;  2F4V M;  5IWA M;  3B9P A;  3AV0 A;  4M9S A;  4I5S A;  3KP1 E;  2ZM6 M;  2EA0 A;  3ZH9 B;  1L1T A;  2F5N A;  4OVZ A;  5EJC A;  1Z6T A;  1I4W A;  2YQZ A;  4I4L A;  4M0D A;  1MU5 A;  1J09 A;  3I4V A;  2YFQ A;  4RF1 A;  5C18 A;  4DR3 M;  1E32 A;  2P5T A;  4LRT A;  5DYG A;  4LFC M;  3U60 A;  3HU2 A;  4B7G A;  5IT9 S;  4OW0 A;  1G4A E;  1N34 M;  3KVW A;  4FWH A;  5FLX S;  3U61 B;  3W0F A;  1HQY E;  2KW0 A;  3A98 B;  3GP1 A;  1GL7 A;  2KRK A;  1JR3 A;  4QNR A;  3AFH A;  2D7H A;  2XSZ A;  1TH2 A;  1Q39 A;  4R3D A;  3R8F A;  2DVW B;  1SXJ A;  1JR3 D;  3J7B A;  1S3S A;  4LJ4 A;  2LXE A;  3ZC7 B;  1QAN A;  4GIP A;  2LNH C;  3L27 A;  2XSZ D;  2CHG A;  1SXJ D;  2X4A A;  4MM3 B;  1HR0 M;  4QHS A;  5EXS A;  4NOO B;  3OTO M;  1JQJ C;  2R45 A;  2CE7 A;  3L2A A;  1NVM A;  1YE9 A;  2KA6 B;  2DZO B;  3HWS A;  4A3V B;  1HT1 E;  1VDD A;  5KPT A;  2Y21 A;  4LY6 A;  3U5Z B;  4LJ5 A;  3EIH A;  4GKJ M;  3VDU A;  2H1R A;  3GRY A;  3VFD A;  4JI8 M;  3IG8 A;  3SYL A;  2F5O A;  4GC9 A;  2M60 A;  2J7N A;  4YY3 M;  4LJ6 A;  1HNZ M;  2XGN A;  1ZAE A;  4DV1 M;  3GLI B;  4LF9 M;  1IY0 A;  1G8P A;  4PDI A;  4IBD A;  5A2Q S;  4GH9 A;  1K3W A;  3KW6 A;  1DO0 A;  1NNU C;  3CTW B;  4LF8 M;  4KHP M;  4HL4 A;  1XWI A;  1XHB A;  4L78 A;  1L2B A;  1E9S A;  1NSF A;  2UXB M;  1Z5C A;  4JI2 M;  3MHV C;  2OPF A;  4OVZ B;  3GPP A;  2QBY A;  1J5E M;  2EO2 A;  3SAW A;  4RNA A;  1N77 A;  2DHR A;  2R62 A;  3RFW A;  3GLF B;  2C9C A;  3L29 A;  3U6M A;  3DOA A;  4KOD A;  2HHH M;  4LF6 M;  4FCT A;  4IJF A;  3U60 B;  3PNV A;  3EIE A;  2UUB M;  1TGU A;  3K1J A;  4IBG A;  1Q3C A;  4DUY M;  1QZM A;  3DA1 A;  5DNY A;  4G4O A;  4DV5 M;  3E4R A;  1L8Q A;  3SFZ A;  3KS8 A;  3CF0 A;  1PJI A;  1HNW M;  2RKO A;  1IXR C;  4DUZ M;  3FTD A;  3DZD A;  3E9S A;  4IBF A;  4JN6 A;  5FTN A;  1XC8 A;  3HU1 A;  3UK6 A;  1XNQ M;  4KLN A;  2G8L A;  4W5W A;  1G3I A;  1W5T A;  1XMO M;  2E5L M;  1NJF A;  1NY5 A;  2QP9 X;  4ITQ A;  4AG5 A;  1HNX M;  4GMQ A;  1N75 A;  1R2Z A;  1EE8 A;  3LMM A;  1OFI A;  4L4U A;  1Q3B A;  4DV4 M;  2C9O A;  3AKZ A;  3SC3 A;  3L26 A;  3FYC A;  4BLC A;  3SYK A;  1H6U A;  2UXC M;  1IBM M;  8CAT A;  4JI5 M;  4B08 A;  3C58 A;  1L2D A;  2RGO A;  1MX0 A;  3KOX E;  1DGF A;  2KXE A;  5ITU A;  2F5S A;  4AKI A;  1NHW C;  3K92 A;  1GKI A;  3K8Z A;  4REZ A;  4DR5 M;  3KOY E;  1IBK M;  2V1C A;  3TQS A;  4IBJ A;  3TWM A;  1IN6 A;  5EP2 A;  3GPX A;  1QYR A;  3RGS A;  4HLQ A;  3FD9 A;  4LZJ A;  4QHT A;  3TWL A;  3FUW A;  4NSR A;  4G4N A;  4L8R C;  3QWL A;  3KSJ A;  4P16 A;  1IQP A;  1ZQ9 A;  5FTM A;  4DV6 M;  5ITX E;  3JR4 A;  3J7A S;  5E6J A;  4YHH M;  2XFT A;  4AI6 A;  2XZU A;  4MGI E;  2XF3 A;  5IRE B;  1DGH A;  2Y0Q A;  1NJG A;  2QBY B;  1PJJ A;  1IN5 A;  2CUZ A;  3L28 A;  3SHF A;  4JYA M;  4JI4 M;  3J80 S;  5FSW A;  4WUR A;  4DV0 M;  3TE6 A;  4IBB A;  2FFJ A;  3T38 A;  4G4Q A;  3T1Y M;  4JI0 M;  3FTE A;  4JV5 M;  1GVN A;  4FW9 A;  2VQE M;  4GKK M;  2ZAO A;  4TUW A;  4X62 M;  2QEN A;  4JI7 M;  4LFA M;  4IIW A;  2X8A A;  2Y0T A;  4B7F A;  4GHL A;  3GRV A;  4PDG A;  3FUT A;  2M5Z A;  2C98 A;  4JI3 M;  5ITR A;  5EXT A;  5KO3 A;  2EUC A;  1TH3 A;  1IY2 A;  3GPY A;  3M7G A;  4LF7 M;  4CIS A;  2CFO A;  3LQQ A;  3J2P B;  1Z5A A;  2C99 A;  2I7P A;  3HHZ A;  3HJS A;  4MGK E;  2FE8 A;  1K82 A;  1QAM A;  4MH0 E;  4D80 A;  5BR8 M;  4PT5 A;  4BB9 A;  2QPA A;  1KSF X;  2DWN A;  3ILK A;  4L15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...