3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KP1E 3KOXE 3KOWE 3KOZE 3KP0E 3KOYE
chains in the Genus database with same CATH superfamily
3JR5A 3IECA 4QNMA 4LF6M 3SYKA 2FH0A 4DR1M 1OAIA 1XMOM 4LRSA 2LNHC 4LF7M 2Y21A 1ZV1A 4AG5A 2VIIA 1DGFA 4DV4M 4GIPA 4CHTB 3GLIE 2D7HA 2L6OA 3LCVB 2Z8YM 3ILKA 3I4YA 2O25A 1J5EM 3KFUG 1EIJA 4G4QA 3UMMA 1QZMA 2WSCF 4IBCA 5EP3A 3W0FA 3R8FA 5DFLA 4OU7A 1QAQA 1PJTA 2KZSA 3W67A 1R2YA 4DUZM 2VQFM 1GVNA 2O01F 4F2LA 1IQPA 2F5SA 2RGOA 1JR3E 5EP1A 1E94E 2BJWA 4L78A 3FUWA 2Y20A 3L27A 4MGKE 3J7AS 1HT2E 4CGYB 3R9XB 1NJFA 5KPZA 4M9XA 5FLXS 1GLNA 2QSFX 2OOBA 3TL4X 4DV6M 1F4IA 3FRHA 4BB9A 4CJ6A 3E21A 1PM5A 1L1TA 4JXJA 4DV1M 4B3MM 2JUJA 4CIZA 2HHHM 3SATA 1XC8A 2FE8A 4F1IA 3T1YM 3HY5A 5LMUM 1IXRC 4DV5M 3FUUA 3U6EA 3NBIA 2XFSA 1NO1A 2DWZB 4GC9A 4LGMA 2K6BA 4GC5A 2L7IA 3HGIA 5A2QS 3FTDA 2G5GX 4QNRA 3KXEC 1L2DA 2FS1A 1SG9A 1Q3BA 2F5OA 2Z4RA 2XH9A 1MN3A 5ITUA 1G4AE 1W5SA 4P17A 5EXPA 1XXHB 3U61B 1OFIA 2H5XA 2CV0A 1X37A 3DA1A 1NY5A 1T3TA 3B7ZA 3HU3A 4BLCA 1Q39A 1G3IA 3HU1A 1VEKA 1D0KA 2LVPC 2OO9A 1JR3D 4DUYM 4JI2M 1OJLA 3KOZE 4LJ8A 5ITXE 3UK6A 3RFWA 2XGNA 2ZM6M 1NHWC 4LY6A 2AHMA 2FNAA 3MHVC 3GO8A 1IBLM 4OX9M 7CATA 1HT1E 2KNVA 2YNMD 3HJQA 4AG6A 1NNJA 1C7YA 4L8RC 3MJ5A 2WZJA 4DR6M 4JI5M 4DR4M 1ORYB 1TGUA 5EQTA 1L2BA 3GLHB 2NQ8C 2HWJA 2L4FA 4NXNM 1IXSB 1BVSA 3B7QA 2DAIA 3U6CA 3KP1E 3SMSA 3ZCBB 1PJIA 4JI1M 3TPZA 1IBMM 2R45A 3K8ZA 1OKSA 4MM3B 4XBOA 2RGHA 2DWLA 2LTUA 4ANRA 1DV0A 2LVQD 1IXZA 4IBDA 4I5SA 4PDIA 1GJSA 2CWBA 4LCBA 4AZFA 1MU5A 2QPAA 2X8AA 4LG2A 2Q2EB 1P3QQ 1IY2A 2RKOA 2XZFA 1NJGA 2DHYA 2JY5A 2EKFA 3GQ3A 4Z8XA 2HAKA 3U6LA 4RKUF 4B7HA 2V6ZM 4LZJA 2KXEA 1QDRA 3K9PA 2C9CA 3HHZA 4ZPXA 1SXJE 3SFZA 5ITXA 3AOEC 2CFOA 1D2NA 2C9OA 2JNHA 2VF7A 3FE3A 1GL7A 3LQQA 3RGPA 4GKJM 4GMQA 4X65M 3U61A 3B74A 3W68A 1Q3CA 3U6SA 4FWHA 1TH3A 5KO3A 1PGYA 4IBKA 4L16A 1Z59A 4P16A 4Z6YA 3U5ZA 1XNRM 3SHFA 4UN2B 2DZNB 1S3SA 2DVWB 3I4VA 3FD9A 4NOOB 5DNYA 3Q8XA 1E32A 3FUVA 3KOXE 4KLNA 1EFUB 5KQ8A 8CATA 4AKIA 4MGYE 3VK7A 1N33M 2CHGA 1TH4A 3PNVA 3ZH9B 2JY7A 4EIWA 2QQ8A 2Y0TA 1OIZA 4OW0A 4IBJA 1N78A 1WXQA 1IN4A 2QBYA 1Z5BA 1GL6A 4X66M 3KW6A 1RU3A 1TR8A 4NRVA 2EO2A 3A46A 1G71A 1K3XA 4CISA 3T38A 3CF6E 5FTNA 2DZOB 3FUTA 3KS8A 1EE8A 5H37D 1HR0M 4II7A 3SAUA 3L2AA 3FYCA 4AKHA 1T43A 1SXJD 3K2LA 3DOAA 2L2DA 4GHLA 1HNWM 2DNAA 2EUCA 2UXCM 3VK8A 3GLHE 3GPXA 2XZUA 1QAMA 5IWAM 2CHQA 4G4RA 1N77A 3U60B 1DGBA 1UM8A 3B89A 5E6JA 3MMPA 1WJ7A 4LFAM 2K9DA 4D81A 2JA2A 1K82A 2X49A 2GQFA 2I7NA 3U6MA 5DYGA 1Q02A 2DAMA 1QUTA 1R4GA 1VG5A 2LVAA 2C99A 2XLJA 1I4WA 3A98B 3LVWA 3PFIA 2XF3A 4HL4A 3T1HM 2HL7A 2JZ1A 2Z7JA 3F92A 2QNJA 4X62M 4HLQA 5ITRA 1N32M 3MK6A 3KS4A 1KYIA 1KSFX 3AOEA 3W0LB 4I4LA 2M60A 2HCBA 3C3EA 4LJ5A 3A42A 3GLFA 4FVMA 2F4VM 4NSRA 3FRIA 3B7NA 3KVWA 4WURA 2DAEA 5FTKA 4G4OA 3HJ8A 2GNOA 3J80S 4LF5M 1QVRA 3FTEA 2DI0A 2KA6B 1TF0B 3TE6A 3GP1A 2KRKA 2ZAOA 1LTMA 5FTJA 3NWLA 3GQ4A 1NV8A 2YFQA 3IG5A 4GRIA 4KO8A 3JR4A 3SARA 1J09A 1PJQA 2ZANA 4MH0E 2FFJA 1DGGA 2D7EA 2APLA 3KOYE 4IBFA 4FWGA 4B08A 1XB2B 5EJCA 3GRUA 1IY0A 1FNNA 1ZMVA 3BXWA 4PDGA 2F5NA 2YQZA 2OQ4A 4JI8M 3A45A 3KP0E 3LVVA 3VKHA 2BWBA 2X4AA 2G8LA 4DV7M 2QCUA 3PNYA 1L2CA 3D8LA 3IHPA 2R4JA 5ITQA 2BJVA 2OOAA 4LFBM 1Y8GA 1E9RA 4NRWA 2VDBB 3J7BA 2Z3XA 4JI0M 1ZMWA 4S12A 3CGWA 1IBKM 2UUBM 1Z6TA 1GJTA 1DGHB 1AIPC 1LV7A 5FSWA 1GKIA 3V76A 2EKKA 3ZC7B 2H1RA 2R44A 4DBGB 1HJPA 3TWMA 4PD2A 3NBXX 4M0DA 4R7GA 4REZA 3HHXA 3UJNA 2LHGA 4G3OA 5IT9S 2MROB 3K1JA 4LF8M 4I81A 3GRVA 4IJFA 2DWMA 3FTFA 4KT0F 4WP2A 4R3DA 1HNZM 4JI3M 3GLGA 4YHHM 4M9SA 5EP2A 2EA0A 1E9SA 3KOWE 3LW5F 1XNQM 3HU2A 1R6BX 4LJ9A 3TWLA 3GPUA 1NV9A 2L7HA 1WGNA 2LH0A 2R18A 4Q7JA 4MB7A 1W5TA 2KHHA 4K0KM 1JR3A 4FWDA 2DAGA 2ERCA 2KW0A 4DR5M 2LXEA 2WSFF 4JI6M 4DR3M 1N75A 4QOSA 1D0MA 4IJEA 1QQWA 3KSXA 4RF0A 3J2PB 3DFZA 1HQCA 2ZTCA 2ZTDA 2DENA 4LJ7A 5KQDA 1XHBA 1WR1B 4GEWA 2UUCM 1JQJC 4LJAA 2LVOC 4OVZB 2YR0A 1MX0A 2I7PA 2CEAA 2XFTA 4D82A 3J27B 3TQSA 1OQYA 4XK8F 2QHOB 1ZAEA 2Z4SA 3LQRA 5IREB 5IZ7D 4A3VB 5C18A 5FTMA 2JWSA 2BWEA 2CV1A 1QDTA 2P5TA 3AFHA 3HWSA 1UFZA 2JP7A 3GLIB 4LGYA 5E26A 5EXSA 1YLAA 1R7RA 3L28A 4B3TM 1QUSA 3ZQJA 2XEPA 2QBYB 4JI4M 3QWLA 1GO5A 2OPFA 1PRBA 2FOIC 5EP4A 4OVZA 3GPYA 3FTCA 2R65A 4QHTA 3QYEA 5DYIA 2MJ5B 5JI3E 4LF9M 1Z5CA 2LBCA 1TDZA 3GLFE 3SBJA 2R0IA 4B3RM 1TDHA 1NHGC 1QANA 1WHCA 1AUAA 1YE9A 3FKEA 4DR2M 3WHLA 4PT5A 3GLIA 3BOSA 1VEGA 2R62A 2LWXA 3RGSA 1WGLA 1ZQ9A 2DWNA 3E46A 3I51A 2A5YB 3CTWB 1VDLA 4QOZC 2Y0QA 3JAMS 2K0BX 5JI2E 3VKGA 1IN5A 1I94M 5GKNA 2LHCA 5C1BA 5BR8M 3EIHA 1NVMA 5EXXA 1CUKA 4M9ZA 2MR9A 4W5WA 4KODA 1TH2A 1DO2A 4NXMM 3HZJA 3D8BA 4JYAM 1DGHA 4JN6A 1PJSA 2XSZA 3AOGA 4IBBA 3L29A 2N35A 4IBGA 4I8OA 1DO0A 4NSOB 4R71A 3CF2A 3PVSA 1V92A 3Q8GA 2MH8A 2WSEF 3BBZA 2CHVA 4L4UA 3SHGB 3SAWA 3VDPA 2QP9X 4JI7M 5L8RF 4RF1A 5LMNM 4DV3M 4QHSA 4TUWA 4LF4M 2J7OA 4AW4A 2O5RA 1OTRA 3E9SA 2VF8A 3K92A 1IM2A 3H4JA 3KDSE 2J7NA 2VQEM 5F3WA 3LCUA 3M0EA 4L15A 3OTOM 3U5ZB 2JY8A 3C9PA 2DKLA 1OFHA 3GLGB 2UUAM 2QENA 4KHPM 1TTEA 5FTLA 5KPTA 4FCTA 1J7KA 2CP8A 2C5RA 1K3WA 2F5QA 1OIPA 2KRUA 3GRRA 1KFVA 2L4EA 1H6UA 2ZBKB 5EXTA 4D80A 1JB0F 4NL4H 3SASA 4MGIE 3PXGA 2JXNA 3VLFB 2CUZA 1XWIA 2ZAMA 2R4EA 2QZ4A 2BNKA 4G6ZA 3I01M 5BPVA 3RE8A 4MGHA 1IFYA 4LFCM 2XSZD 1D0LA 3DZDA 3EIEA 2F5PA 3L25A 4WW0A 1QZEA 1SXJC 3AL0C 1MJGM 2R46A 3U6PA 1SXJB 3KSJA 3UZUA 2L09A 2UU9M 2W82A 4FCVA 3T6PA 2KEBA 1Z5AA 4AQYM 1FJGM 3C3DA 2KNAA 1HNXM 4AKGA 1VQ1A 4LZZA 2EJSA 2HKJA 3K9OA 2KZUA 3GLGE 3U6QA 2K47A 1IXSA 3LMMA 3SMPA 1OAOC 4ITQA 4GH9A 1VEJA 3GLHA 1GABA 2R6FA 1PJJA 1C1KA 3T15A 3QAUA 2CV2A 1A5TA 1V33A 4B7GA 3U60A 1IN7A 2G3QA 2JY6B 1WIVA 4FW9A 2E5LM 2D7GA 4DV2M 3HKPA 4MGZE 3GRYA 1XXHE 4XGIA 2KNZA 3J81S 3I04M 3QYBA 4L6V6 1HQYE 4BBAA 1L8QA 2J5YA 5ITYA 3M6AA 2CRUA 1ZMUA 1YUBA 3M7GA 3AKZA 2M5ZA 4PCZA 3C58A 1R2ZA 2V1UA 3THGA 4DR7M 3L26A 2RRUA 3UGJA 4JV5M 4GITA 4AI6A 3WHKA 5ITTA 4FCWA 4IBIA 3IG8A 4Y28F 1NY6A 2LVNC 1XXHA 2UXDM 1NNUC 4HEOA 3GLFB 1IN6A 1N36M 3AJIB 3FUXA 4NC6A 4LJ4A 4GHAA 2B3TA 4DV0M 4LRTA 1G59A 4RNAA 1T6OA 4LJ6A 5KPRA 3H4MA 3HJSA 2KDLA 2C96A 2DAKA 1IY1A 1G8PA 3HHWA 4X64M 4G4NA 1G41A 1XMQM 1N34M 1L1ZA 4IIWA 2DXIA 2DZLA 4B3SM 3TWKA 4B7FA 3FYDA 1QAOA 1VDDA 1YSYA 1NSFA 1R5LA 1V34A 3GPPA 3GQ5A 1IN8A 3B9PA 4YY3M 3E4RA 3SYLA 4GKKM 2JZ0A 2V1CA 3CF0A 1SXJA 2DHRA 3VFDA 3SAVA 2MGWA 3U6OA 4FD2A 4IBEA 1QYRA 3HHYA 4M0WA 3AV0A 3HX3A 3U6DA 3SC3A 3VDUA 2CE7A 2UXBM 2C98A
chains in the Genus database with same CATH topology
3JR5A 4QNMA 4LF6M 3SYKA 4DR1M 1XMOM 4LRSA 2LNHC 4LF7M 2Y21A 4AG5A 2VIIA 1DGFA 4DV4M 4GIPA 4CHTB 2D7HA 2L6OA 3ILKA 3I4YA 1J5EM 3KFUG 4G4QA 3UMMA 1QZMA 5EP3A 4IBCA 3W0FA 3R8FA 4OU7A 1QAQA 2KZSA 1R2YA 4DUZM 2VQFM 1GVNA 2F5SA 1IQPA 2RGOA 5EP1A 1E94E 2BJWA 4L78A 3FUWA 2Y20A 3L27A 4MGKE 3J7AS 1HT2E 4CGYB 3R9XB 1NJFA 5KPZA 4M9XA 5FLXS 1GLNA 3TL4X 4DV6M 4BB9A 1PM5A 1L1TA 4JXJA 4DV1M 4B3MM 2HHHM 3SATA 1XC8A 2FE8A 3T1YM 5LMUM 1IXRC 4DV5M 3FUUA 3U6EA 4GC9A 3NBIA 2XFSA 2DWZB 4LGMA 4GC5A 2L7IA 3HGIA 5A2QS 3FTDA 2G5GX 4QNRA 3KXEC 1L2DA 1Q3BA 2F5OA 2Z4RA 2XH9A 5ITUA 1G4AE 1W5SA 5EXPA 1XXHB 3U61B 1OFIA 2CV0A 1X37A 3DA1A 1NY5A 1T3TA 3HU3A 4BLCA 1Q39A 1G3IA 3HU1A 4DUYM 1JR3D 4JI2M 1OJLA 3KOZE 4LJ8A 5ITXE 3UK6A 3RFWA 2XGNA 2ZM6M 1NHWC 4LY6A 2AHMA 2FNAA 3MHVC 3GO8A 1IBLM 4OX9M 7CATA 1HT1E 2YNMD 3HJQA 4AG6A 1NNJA 4L8RC 3MJ5A 4DR6M 4JI5M 4DR4M 1ORYB 1TGUA 5EQTA 1L2BA 3GLHB 2NQ8C 4NXNM 1IXSB 3U6CA 3KP1E 3SMSA 3ZCBB 1PJIA 4JI1M 3TPZA 1IBMM 2R45A 3K8ZA 4MM3B 4XBOA 2RGHA 2DWLA 1IXZA 4IBDA 4I5SA 4PDIA 4LCBA 4AZFA 1MU5A 2X8AA 2QPAA 4LG2A 2Q2EB 1IY2A 2RKOA 2XZFA 1NJGA 3GQ3A 4Z8XA 3U6LA 4B7HA 2V6ZM 4LZJA 2KXEA 2C9CA 3HHZA 4ZPXA 1SXJE 3SFZA 5ITXA 3AOEC 2CFOA 1D2NA 2C9OA 1GL7A 3LQQA 3RGPA 4GKJM 4GMQA 4X65M 3U61A 1Q3CA 3U6SA 4FWHA 1TH3A 5KO3A 4IBKA 4L16A 1Z59A 4P16A 4Z6YA 3U5ZA 1XNRM 3SHFA 2DZNB 1S3SA 2DVWB 3I4VA 3FD9A 4NOOB 5DNYA 3Q8XA 1E32A 3FUVA 3KOXE 4KLNA 5KQ8A 8CATA 4AKIA 4MGYE 3VK7A 1N33M 2CHGA 1TH4A 3PNVA 3ZH9B 4EIWA 2Y0TA 4OW0A 4IBJA 1N78A 1WXQA 1IN4A 2QBYA 1Z5BA 1GL6A 4X66M 3KW6A 4NRVA 2EO2A 3A46A 1K3XA 4CISA 3T38A 3CF6E 5FTNA 2DZOB 3FUTA 3KS8A 1EE8A 5H37D 1HR0M 4II7A 3SAUA 3L2AA 3FYCA 4AKHA 1SXJD 3K2LA 3DOAA 4GHLA 1HNWM 2EUCA 2UXCM 3VK8A 3GPXA 2XZUA 1QAMA 5IWAM 2CHQA 4G4RA 1N77A 3U60B 1DGBA 1UM8A 5E6JA 4LFAM 4D81A 2JA2A 1K82A 2X49A 2I7NA 3U6MA 5DYGA 2XLJA 2C99A 1I4WA 3A98B 3LVWA 3PFIA 2XF3A 4HL4A 3T1HM 2HL7A 2Z7JA 4X62M 4HLQA 5ITRA 1N32M 3MK6A 3KS4A 1KYIA 1KSFX 3AOEA 3W0LB 4I4LA 2M60A 2HCBA 4LJ5A 3A42A 3GLFA 4FVMA 2F4VM 4NSRA 4G4OA 3KVWA 4WURA 5FTKA 4LF5M 3HJ8A 3J80S 3FTEA 1QVRA 2KA6B 3TE6A 3GP1A 2KRKA 2ZAOA 3GQ4A 5FTJA 3NWLA 3IG5A 2YFQA 4GRIA 4KO8A 3JR4A 3SARA 1J09A 2ZANA 4MH0E 1DGGA 2D7EA 3KOYE 2FFJA 4IBFA 4B08A 4FWGA 5EJCA 3GRUA 1IY0A 1FNNA 4JI8M 2F5NA 2YQZA 2OQ4A 3A45A 3KP0E 3LVVA 3VKHA 2X4AA 2G8LA 4DV7M 2QCUA 3PNYA 1L2CA 3D8LA 2R4JA 5ITQA 2BJVA 4LFBM 1E9RA 4NRWA 3J7BA 2Z3XA 1IBKM 4JI0M 4S12A 2UUBM 1Z6TA 1DGHB 1LV7A 5FSWA 1GKIA 3ZC7B 2H1RA 3TWMA 4PD2A 4M0DA 4R7GA 4REZA 3HHXA 3UJNA 5IT9S 3K1JA 4LF8M 4I81A 3GRVA 4IJFA 2DWMA 3FTFA 1HNZM 4R3DA 4JI3M 3GLGA 4YHHM 4M9SA 5EP2A 2EA0A 1E9SA 3KOWE 1XNQM 3HU2A 1R6BX 4LJ9A 3TWLA 3GPUA 2L7HA 2LH0A 2R18A 4MB7A 1W5TA 4K0KM 1JR3A 4FWDA 2ERCA 2KW0A 4DR5M 2LXEA 4JI6M 4DR3M 1N75A 4QOSA 4IJEA 1QQWA 3KSXA 4RF0A 3J2PB 3DFZA 1HQCA 4LJ7A 5KQDA 1XHBA 2UUCM 1JQJC 4LJAA 4OVZB 2YR0A 1MX0A 2I7PA 2CEAA 2XFTA 4D82A 3J27B 3TQSA 1ZAEA 2Z4SA 3LQRA 5IREB 5IZ7D 4A3VB 5C18A 5FTMA 2CV1A 2P5TA 3AFHA 3HWSA 3GLIB 4LGYA 5E26A 5EXSA 1R7RA 3L28A 4B3TM 2XEPA 2QBYB 4JI4M 3QWLA 2OPFA 2FOIC 5EP4A 4OVZA 3GPYA 3FTCA 2R65A 4QHTA 5DYIA 5JI3E 4LF9M 1Z5CA 1TDZA 3SBJA 4B3RM 1TDHA 1NHGC 1QANA 3FKEA 1YE9A 4DR2M 3WHLA 4PT5A 3GLIA 3BOSA 2R62A 2LWXA 3RGSA 1ZQ9A 2DWNA 3I51A 2A5YB 3CTWB 4QOZC 2Y0QA 3JAMS 5JI2E 3VKGA 1IN5A 1I94M 5GKNA 5C1BA 5BR8M 3EIHA 1NVMA 5EXXA 4M9ZA 4W5WA 4KODA 1TH2A 1DO2A 4NXMM 3D8BA 4JYAM 1DGHA 4JN6A 2XSZA 3AOGA 4IBBA 3L29A 4IBGA 4I8OA 4NSOB 1DO0A 4PDGA 3CF2A 3PVSA 3SHGB 2CHVA 4L4UA 3SAWA 3VDPA 2QP9X 4JI7M 4RF1A 5LMNM 4DV3M 4QHSA 4TUWA 4LF4M 2J7OA 4AW4A 2O5RA 3E9SA 3K92A 1IM2A 3KDSE 2J7NA 2VQEM 5F3WA 3M0EA 4L15A 3OTOM 3U5ZB 1OFHA 3GLGB 2UUAM 2QENA 4KHPM 5FTLA 5KPTA 4FCTA 1J7KA 2C5RA 1K3WA 2F5QA 2KRUA 3GRRA 1KFVA 2ZBKB 1H6UA 5EXTA 4D80A 4NL4H 3SASA 4MGIE 3PXGA 3VLFB 2CUZA 1XWIA 2ZAMA 2R4EA 2QZ4A 2BNKA 4G6ZA 5BPVA 3RE8A 4MGHA 4LFCM 2XSZD 3DZDA 3EIEA 2F5PA 3L25A 4WW0A 1SXJC 3AL0C 2R46A 3U6PA 1SXJB 3KSJA 3UZUA 2L09A 2UU9M 2W82A 4FCVA 2KEBA 1Z5AA 4AQYM 1FJGM 1HNXM 4AKGA 4LZZA 2HKJA 2KZUA 3U6QA 2K47A 3LMMA 3SMPA 4ITQA 4GH9A 3GLHA 1PJJA 1C1KA 3T15A 3QAUA 2CV2A 4B7GA 3U60A 4FW9A 1IN7A 2E5LM 2D7GA 4DV2M 3HKPA 4MGZE 3GRYA 4XGIA 3J81S 1HQYE 4BBAA 1L8QA 5ITYA 3M6AA 1YUBA 3M7GA 3AKZA 2M5ZA 4PCZA 3C58A 1R2ZA 2V1UA 3THGA 4DR7M 3L26A 3UGJA 4JV5M 4GITA 4AI6A 3WHKA 5ITTA 4FCWA 4IBIA 3IG8A 1NY6A 1XXHA 2UXDM 1NNUC 3GLFB 1IN6A 1N36M 3AJIB 3FUXA 4LJ4A 4GHAA 4DV0M 4LRTA 1G59A 4RNAA 4LJ6A 5KPRA 3H4MA 3HJSA 2C96A 4G4NA 1IY1A 1G8PA 3HHWA 4X64M 1XMQM 1G41A 1N34M 1L1ZA 2DXIA 4IIWA 4B3SM 3TWKA 4B7FA 3FYDA 1QAOA 1VDDA 1YSYA 1NSFA 3GPPA 3GQ5A 1IN8A 3B9PA 4YY3M 3E4RA 3SYLA 4GKKM 3CF0A 2V1CA 3VFDA 1SXJA 2DHRA 3SAVA 3U6OA 4FD2A 4IBEA 1QYRA 3HHYA 4M0WA 3AV0A 3U6DA 3SC3A 3VDUA 2CE7A 2UXBM 2C98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP1 E;  3KOX E;  3KOW E;  3KOZ E;  3KP0 E;  3KOY E; 
#chains in the Genus database with same CATH topology
 3JR5 A;  3IEC A;  4QNM A;  4LF6 M;  3SYK A;  2FH0 A;  4DR1 M;  1OAI A;  1XMO M;  4LRS A;  2LNH C;  4LF7 M;  2Y21 A;  1ZV1 A;  4AG5 A;  2VII A;  1DGF A;  4DV4 M;  4GIP A;  4CHT B;  3GLI E;  2D7H A;  2L6O A;  3LCV B;  2Z8Y M;  3ILK A;  3I4Y A;  2O25 A;  1J5E M;  3KFU G;  1EIJ A;  4G4Q A;  3UMM A;  1QZM A;  2WSC F;  4IBC A;  5EP3 A;  3W0F A;  3R8F A;  5DFL A;  4OU7 A;  1QAQ A;  1PJT A;  2KZS A;  3W67 A;  1R2Y A;  4DUZ M;  2VQF M;  1GVN A;  2O01 F;  4F2L A;  1IQP A;  2F5S A;  2RGO A;  1JR3 E;  5EP1 A;  1E94 E;  2BJW A;  4L78 A;  3FUW A;  2Y20 A;  3L27 A;  4MGK E;  3J7A S;  1HT2 E;  4CGY B;  3R9X B;  1NJF A;  5KPZ A;  4M9X A;  5FLX S;  1GLN A;  2QSF X;  2OOB A;  3TL4 X;  4DV6 M;  1F4I A;  3FRH A;  4BB9 A;  4CJ6 A;  3E21 A;  1PM5 A;  1L1T A;  4JXJ A;  4DV1 M;  4B3M M;  2JUJ A;  4CIZ A;  2HHH M;  3SAT A;  1XC8 A;  2FE8 A;  4F1I A;  3T1Y M;  3HY5 A;  5LMU M;  1IXR C;  4DV5 M;  3FUU A;  3U6E A;  3NBI A;  2XFS A;  1NO1 A;  2DWZ B;  4GC9 A;  4LGM A;  2K6B A;  4GC5 A;  2L7I A;  3HGI A;  5A2Q S;  3FTD A;  2G5G X;  4QNR A;  3KXE C;  1L2D A;  2FS1 A;  1SG9 A;  1Q3B A;  2F5O A;  2Z4R A;  2XH9 A;  1MN3 A;  5ITU A;  1G4A E;  1W5S A;  4P17 A;  5EXP A;  1XXH B;  3U61 B;  1OFI A;  2H5X A;  2CV0 A;  1X37 A;  3DA1 A;  1NY5 A;  1T3T A;  3B7Z A;  3HU3 A;  4BLC A;  1Q39 A;  1G3I A;  3HU1 A;  1VEK A;  1D0K A;  2LVP C;  2OO9 A;  1JR3 D;  4DUY M;  4JI2 M;  1OJL A;  3KOZ E;  4LJ8 A;  5ITX E;  3UK6 A;  3RFW A;  2XGN A;  2ZM6 M;  1NHW C;  4LY6 A;  2AHM A;  2FNA A;  3MHV C;  3GO8 A;  1IBL M;  4OX9 M;  7CAT A;  1HT1 E;  2KNV A;  2YNM D;  3HJQ A;  4AG6 A;  1NNJ A;  1C7Y A;  4L8R C;  3MJ5 A;  2WZJ A;  4DR6 M;  4JI5 M;  4DR4 M;  1ORY B;  1TGU A;  5EQT A;  1L2B A;  3GLH B;  2NQ8 C;  2HWJ A;  2L4F A;  4NXN M;  1IXS B;  1BVS A;  3B7Q A;  2DAI A;  3U6C A;  3KP1 E;  3SMS A;  3ZCB B;  1PJI A;  4JI1 M;  3TPZ A;  1IBM M;  2R45 A;  3K8Z A;  1OKS A;  4MM3 B;  4XBO A;  2RGH A;  2DWL A;  2LTU A;  4ANR A;  1DV0 A;  2LVQ D;  1IXZ A;  4IBD A;  4I5S A;  4PDI A;  1GJS A;  2CWB A;  4LCB A;  4AZF A;  1MU5 A;  2QPA A;  2X8A A;  4LG2 A;  2Q2E B;  1P3Q Q;  1IY2 A;  2RKO A;  2XZF A;  1NJG A;  2DHY A;  2JY5 A;  2EKF A;  3GQ3 A;  4Z8X A;  2HAK A;  3U6L A;  4RKU F;  4B7H A;  2V6Z M;  4LZJ A;  2KXE A;  1QDR A;  3K9P A;  2C9C A;  3HHZ A;  4ZPX A;  1SXJ E;  3SFZ A;  5ITX A;  3AOE C;  2CFO A;  1D2N A;  2C9O A;  2JNH A;  2VF7 A;  3FE3 A;  1GL7 A;  3LQQ A;  3RGP A;  4GKJ M;  4GMQ A;  4X65 M;  3U61 A;  3B74 A;  3W68 A;  1Q3C A;  3U6S A;  4FWH A;  1TH3 A;  5KO3 A;  1PGY A;  4IBK A;  4L16 A;  1Z59 A;  4P16 A;  4Z6Y A;  3U5Z A;  1XNR M;  3SHF A;  4UN2 B;  2DZN B;  1S3S A;  2DVW B;  3I4V A;  3FD9 A;  4NOO B;  5DNY A;  3Q8X A;  1E32 A;  3FUV A;  3KOX E;  4KLN A;  1EFU B;  5KQ8 A;  8CAT A;  4AKI A;  4MGY E;  3VK7 A;  1N33 M;  2CHG A;  1TH4 A;  3PNV A;  3ZH9 B;  2JY7 A;  4EIW A;  2QQ8 A;  2Y0T A;  1OIZ A;  4OW0 A;  4IBJ A;  1N78 A;  1WXQ A;  1IN4 A;  2QBY A;  1Z5B A;  1GL6 A;  4X66 M;  3KW6 A;  1RU3 A;  1TR8 A;  4NRV A;  2EO2 A;  3A46 A;  1G71 A;  1K3X A;  4CIS A;  3T38 A;  3CF6 E;  5FTN A;  2DZO B;  3FUT A;  3KS8 A;  1EE8 A;  5H37 D;  1HR0 M;  4II7 A;  3SAU A;  3L2A A;  3FYC A;  4AKH A;  1T43 A;  1SXJ D;  3K2L A;  3DOA A;  2L2D A;  4GHL A;  1HNW M;  2DNA A;  2EUC A;  2UXC M;  3VK8 A;  3GLH E;  3GPX A;  2XZU A;  1QAM A;  5IWA M;  2CHQ A;  4G4R A;  1N77 A;  3U60 B;  1DGB A;  1UM8 A;  3B89 A;  5E6J A;  3MMP A;  1WJ7 A;  4LFA M;  2K9D A;  4D81 A;  2JA2 A;  1K82 A;  2X49 A;  2GQF A;  2I7N A;  3U6M A;  5DYG A;  1Q02 A;  2DAM A;  1QUT A;  1R4G A;  1VG5 A;  2LVA A;  2C99 A;  2XLJ A;  1I4W A;  3A98 B;  3LVW A;  3PFI A;  2XF3 A;  4HL4 A;  3T1H M;  2HL7 A;  2JZ1 A;  2Z7J A;  3F92 A;  2QNJ A;  4X62 M;  4HLQ A;  5ITR A;  1N32 M;  3MK6 A;  3KS4 A;  1KYI A;  1KSF X;  3AOE A;  3W0L B;  4I4L A;  2M60 A;  2HCB A;  3C3E A;  4LJ5 A;  3A42 A;  3GLF A;  4FVM A;  2F4V M;  4NSR A;  3FRI A;  3B7N A;  3KVW A;  4WUR A;  2DAE A;  5FTK A;  4G4O A;  3HJ8 A;  2GNO A;  3J80 S;  4LF5 M;  1QVR A;  3FTE A;  2DI0 A;  2KA6 B;  1TF0 B;  3TE6 A;  3GP1 A;  2KRK A;  2ZAO A;  1LTM A;  5FTJ A;  3NWL A;  3GQ4 A;  1NV8 A;  2YFQ A;  3IG5 A;  4GRI A;  4KO8 A;  3JR4 A;  3SAR A;  1J09 A;  1PJQ A;  2ZAN A;  4MH0 E;  2FFJ A;  1DGG A;  2D7E A;  2APL A;  3KOY E;  4IBF A;  4FWG A;  4B08 A;  1XB2 B;  5EJC A;  3GRU A;  1IY0 A;  1FNN A;  1ZMV A;  3BXW A;  4PDG A;  2F5N A;  2YQZ A;  2OQ4 A;  4JI8 M;  3A45 A;  3KP0 E;  3LVV A;  3VKH A;  2BWB A;  2X4A A;  2G8L A;  4DV7 M;  2QCU A;  3PNY A;  1L2C A;  3D8L A;  3IHP A;  2R4J A;  5ITQ A;  2BJV A;  2OOA A;  4LFB M;  1Y8G A;  1E9R A;  4NRW A;  2VDB B;  3J7B A;  2Z3X A;  4JI0 M;  1ZMW A;  4S12 A;  3CGW A;  1IBK M;  2UUB M;  1Z6T A;  1GJT A;  1DGH B;  1AIP C;  1LV7 A;  5FSW A;  1GKI A;  3V76 A;  2EKK A;  3ZC7 B;  2H1R A;  2R44 A;  4DBG B;  1HJP A;  3TWM A;  4PD2 A;  3NBX X;  4M0D A;  4R7G A;  4REZ A;  3HHX A;  3UJN A;  2LHG A;  4G3O A;  5IT9 S;  2MRO B;  3K1J A;  4LF8 M;  4I81 A;  3GRV A;  4IJF A;  2DWM A;  3FTF A;  4KT0 F;  4WP2 A;  4R3D A;  1HNZ M;  4JI3 M;  3GLG A;  4YHH M;  4M9S A;  5EP2 A;  2EA0 A;  1E9S A;  3KOW E;  3LW5 F;  1XNQ M;  3HU2 A;  1R6B X;  4LJ9 A;  3TWL A;  3GPU A;  1NV9 A;  2L7H A;  1WGN A;  2LH0 A;  2R18 A;  4Q7J A;  4MB7 A;  1W5T A;  2KHH A;  4K0K M;  1JR3 A;  4FWD A;  2DAG A;  2ERC A;  2KW0 A;  4DR5 M;  2LXE A;  2WSF F;  4JI6 M;  4DR3 M;  1N75 A;  4QOS A;  1D0M A;  4IJE A;  1QQW A;  3KSX A;  4RF0 A;  3J2P B;  3DFZ A;  1HQC A;  2ZTC A;  2ZTD A;  2DEN A;  4LJ7 A;  5KQD A;  1XHB A;  1WR1 B;  4GEW A;  2UUC M;  1JQJ C;  4LJA A;  2LVO C;  4OVZ B;  2YR0 A;  1MX0 A;  2I7P A;  2CEA A;  2XFT A;  4D82 A;  3J27 B;  3TQS A;  1OQY A;  4XK8 F;  2QHO B;  1ZAE A;  2Z4S A;  3LQR A;  5IRE B;  5IZ7 D;  4A3V B;  5C18 A;  5FTM A;  2JWS A;  2BWE A;  2CV1 A;  1QDT A;  2P5T A;  3AFH A;  3HWS A;  1UFZ A;  2JP7 A;  3GLI B;  4LGY A;  5E26 A;  5EXS A;  1YLA A;  1R7R A;  3L28 A;  4B3T M;  1QUS A;  3ZQJ A;  2XEP A;  2QBY B;  4JI4 M;  3QWL A;  1GO5 A;  2OPF A;  1PRB A;  2FOI C;  5EP4 A;  4OVZ A;  3GPY A;  3FTC A;  2R65 A;  4QHT A;  3QYE A;  5DYI A;  2MJ5 B;  5JI3 E;  4LF9 M;  1Z5C A;  2LBC A;  1TDZ A;  3GLF E;  3SBJ A;  2R0I A;  4B3R M;  1TDH A;  1NHG C;  1QAN A;  1WHC A;  1AUA A;  1YE9 A;  3FKE A;  4DR2 M;  3WHL A;  4PT5 A;  3GLI A;  3BOS A;  1VEG A;  2R62 A;  2LWX A;  3RGS A;  1WGL A;  1ZQ9 A;  2DWN A;  3E46 A;  3I51 A;  2A5Y B;  3CTW B;  1VDL A;  4QOZ C;  2Y0Q A;  3JAM S;  2K0B X;  5JI2 E;  3VKG A;  1IN5 A;  1I94 M;  5GKN A;  2LHC A;  5C1B A;  5BR8 M;  3EIH A;  1NVM A;  5EXX A;  1CUK A;  4M9Z A;  2MR9 A;  4W5W A;  4KOD A;  1TH2 A;  1DO2 A;  4NXM M;  3HZJ A;  3D8B A;  4JYA M;  1DGH A;  4JN6 A;  1PJS A;  2XSZ A;  3AOG A;  4IBB A;  3L29 A;  2N35 A;  4IBG A;  4I8O A;  1DO0 A;  4NSO B;  4R71 A;  3CF2 A;  3PVS A;  1V92 A;  3Q8G A;  2MH8 A;  2WSE F;  3BBZ A;  2CHV A;  4L4U A;  3SHG B;  3SAW A;  3VDP A;  2QP9 X;  4JI7 M;  5L8R F;  4RF1 A;  5LMN M;  4DV3 M;  4QHS A;  4TUW A;  4LF4 M;  2J7O A;  4AW4 A;  2O5R A;  1OTR A;  3E9S A;  2VF8 A;  3K92 A;  1IM2 A;  3H4J A;  3KDS E;  2J7N A;  2VQE M;  5F3W A;  3LCU A;  3M0E A;  4L15 A;  3OTO M;  3U5Z B;  2JY8 A;  3C9P A;  2DKL A;  1OFH A;  3GLG B;  2UUA M;  2QEN A;  4KHP M;  1TTE A;  5FTL A;  5KPT A;  4FCT A;  1J7K A;  2CP8 A;  2C5R A;  1K3W A;  2F5Q A;  1OIP A;  2KRU A;  3GRR A;  1KFV A;  2L4E A;  1H6U A;  2ZBK B;  5EXT A;  4D80 A;  1JB0 F;  4NL4 H;  3SAS A;  4MGI E;  3PXG A;  2JXN A;  3VLF B;  2CUZ A;  1XWI A;  2ZAM A;  2R4E A;  2QZ4 A;  2BNK A;  4G6Z A;  3I01 M;  5BPV A;  3RE8 A;  4MGH A;  1IFY A;  4LFC M;  2XSZ D;  1D0L A;  3DZD A;  3EIE A;  2F5P A;  3L25 A;  4WW0 A;  1QZE A;  1SXJ C;  3AL0 C;  1MJG M;  2R46 A;  3U6P A;  1SXJ B;  3KSJ A;  3UZU A;  2L09 A;  2UU9 M;  2W82 A;  4FCV A;  3T6P A;  2KEB A;  1Z5A A;  4AQY M;  1FJG M;  3C3D A;  2KNA A;  1HNX M;  4AKG A;  1VQ1 A;  4LZZ A;  2EJS A;  2HKJ A;  3K9O A;  2KZU A;  3GLG E;  3U6Q A;  2K47 A;  1IXS A;  3LMM A;  3SMP A;  1OAO C;  4ITQ A;  4GH9 A;  1VEJ A;  3GLH A;  1GAB A;  2R6F A;  1PJJ A;  1C1K A;  3T15 A;  3QAU A;  2CV2 A;  1A5T A;  1V33 A;  4B7G A;  3U60 A;  1IN7 A;  2G3Q A;  2JY6 B;  1WIV A;  4FW9 A;  2E5L M;  2D7G A;  4DV2 M;  3HKP A;  4MGZ E;  3GRY A;  1XXH E;  4XGI A;  2KNZ A;  3J81 S;  3I04 M;  3QYB A;  4L6V 6;  1HQY E;  4BBA A;  1L8Q A;  2J5Y A;  5ITY A;  3M6A A;  2CRU A;  1ZMU A;  1YUB A;  3M7G A;  3AKZ A;  2M5Z A;  4PCZ A;  3C58 A;  1R2Z A;  2V1U A;  3THG A;  4DR7 M;  3L26 A;  2RRU A;  3UGJ A;  4JV5 M;  4GIT A;  4AI6 A;  3WHK A;  5ITT A;  4FCW A;  4IBI A;  3IG8 A;  4Y28 F;  1NY6 A;  2LVN C;  1XXH A;  2UXD M;  1NNU C;  4HEO A;  3GLF B;  1IN6 A;  1N36 M;  3AJI B;  3FUX A;  4NC6 A;  4LJ4 A;  4GHA A;  2B3T A;  4DV0 M;  4LRT A;  1G59 A;  4RNA A;  1T6O A;  4LJ6 A;  5KPR A;  3H4M A;  3HJS A;  2KDL A;  2C96 A;  2DAK A;  1IY1 A;  1G8P A;  3HHW A;  4X64 M;  4G4N A;  1G41 A;  1XMQ M;  1N34 M;  1L1Z A;  4IIW A;  2DXI A;  2DZL A;  4B3S M;  3TWK A;  4B7F A;  3FYD A;  1QAO A;  1VDD A;  1YSY A;  1NSF A;  1R5L A;  1V34 A;  3GPP A;  3GQ5 A;  1IN8 A;  3B9P A;  4YY3 M;  3E4R A;  3SYL A;  4GKK M;  2JZ0 A;  2V1C A;  3CF0 A;  1SXJ A;  2DHR A;  3VFD A;  3SAV A;  2MGW A;  3U6O A;  4FD2 A;  4IBE A;  1QYR A;  3HHY A;  4M0W A;  3AV0 A;  3HX3 A;  3U6D A;  3SC3 A;  3VDU A;  2CE7 A;  2UXB M;  2C98 A; 
#chains in the Genus database with same CATH homology
 3JR5 A;  4QNM A;  4LF6 M;  3SYK A;  4DR1 M;  1XMO M;  4LRS A;  2LNH C;  4LF7 M;  2Y21 A;  4AG5 A;  2VII A;  1DGF A;  4DV4 M;  4GIP A;  4CHT B;  2D7H A;  2L6O A;  3ILK A;  3I4Y A;  1J5E M;  3KFU G;  4G4Q A;  3UMM A;  1QZM A;  5EP3 A;  4IBC A;  3W0F A;  3R8F A;  4OU7 A;  1QAQ A;  2KZS A;  1R2Y A;  4DUZ M;  2VQF M;  1GVN A;  2F5S A;  1IQP A;  2RGO A;  5EP1 A;  1E94 E;  2BJW A;  4L78 A;  3FUW A;  2Y20 A;  3L27 A;  4MGK E;  3J7A S;  1HT2 E;  4CGY B;  3R9X B;  1NJF A;  5KPZ A;  4M9X A;  5FLX S;  1GLN A;  3TL4 X;  4DV6 M;  4BB9 A;  1PM5 A;  1L1T A;  4JXJ A;  4DV1 M;  4B3M M;  2HHH M;  3SAT A;  1XC8 A;  2FE8 A;  3T1Y M;  5LMU M;  1IXR C;  4DV5 M;  3FUU A;  3U6E A;  4GC9 A;  3NBI A;  2XFS A;  2DWZ B;  4LGM A;  4GC5 A;  2L7I A;  3HGI A;  5A2Q S;  3FTD A;  2G5G X;  4QNR A;  3KXE C;  1L2D A;  1Q3B A;  2F5O A;  2Z4R A;  2XH9 A;  5ITU A;  1G4A E;  1W5S A;  5EXP A;  1XXH B;  3U61 B;  1OFI A;  2CV0 A;  1X37 A;  3DA1 A;  1NY5 A;  1T3T A;  3HU3 A;  4BLC A;  1Q39 A;  1G3I A;  3HU1 A;  4DUY M;  1JR3 D;  4JI2 M;  1OJL A;  3KOZ E;  4LJ8 A;  5ITX E;  3UK6 A;  3RFW A;  2XGN A;  2ZM6 M;  1NHW C;  4LY6 A;  2AHM A;  2FNA A;  3MHV C;  3GO8 A;  1IBL M;  4OX9 M;  7CAT A;  1HT1 E;  2YNM D;  3HJQ A;  4AG6 A;  1NNJ A;  4L8R C;  3MJ5 A;  4DR6 M;  4JI5 M;  4DR4 M;  1ORY B;  1TGU A;  5EQT A;  1L2B A;  3GLH B;  2NQ8 C;  4NXN M;  1IXS B;  3U6C A;  3KP1 E;  3SMS A;  3ZCB B;  1PJI A;  4JI1 M;  3TPZ A;  1IBM M;  2R45 A;  3K8Z A;  4MM3 B;  4XBO A;  2RGH A;  2DWL A;  1IXZ A;  4IBD A;  4I5S A;  4PDI A;  4LCB A;  4AZF A;  1MU5 A;  2X8A A;  2QPA A;  4LG2 A;  2Q2E B;  1IY2 A;  2RKO A;  2XZF A;  1NJG A;  3GQ3 A;  4Z8X A;  3U6L A;  4B7H A;  2V6Z M;  4LZJ A;  2KXE A;  2C9C A;  3HHZ A;  4ZPX A;  1SXJ E;  3SFZ A;  5ITX A;  3AOE C;  2CFO A;  1D2N A;  2C9O A;  1GL7 A;  3LQQ A;  3RGP A;  4GKJ M;  4GMQ A;  4X65 M;  3U61 A;  1Q3C A;  3U6S A;  4FWH A;  1TH3 A;  5KO3 A;  4IBK A;  4L16 A;  1Z59 A;  4P16 A;  4Z6Y A;  3U5Z A;  1XNR M;  3SHF A;  2DZN B;  1S3S A;  2DVW B;  3I4V A;  3FD9 A;  4NOO B;  5DNY A;  3Q8X A;  1E32 A;  3FUV A;  3KOX E;  4KLN A;  5KQ8 A;  8CAT A;  4AKI A;  4MGY E;  3VK7 A;  1N33 M;  2CHG A;  1TH4 A;  3PNV A;  3ZH9 B;  4EIW A;  2Y0T A;  4OW0 A;  4IBJ A;  1N78 A;  1WXQ A;  1IN4 A;  2QBY A;  1Z5B A;  1GL6 A;  4X66 M;  3KW6 A;  4NRV A;  2EO2 A;  3A46 A;  1K3X A;  4CIS A;  3T38 A;  3CF6 E;  5FTN A;  2DZO B;  3FUT A;  3KS8 A;  1EE8 A;  5H37 D;  1HR0 M;  4II7 A;  3SAU A;  3L2A A;  3FYC A;  4AKH A;  1SXJ D;  3K2L A;  3DOA A;  4GHL A;  1HNW M;  2EUC A;  2UXC M;  3VK8 A;  3GPX A;  2XZU A;  1QAM A;  5IWA M;  2CHQ A;  4G4R A;  1N77 A;  3U60 B;  1DGB A;  1UM8 A;  5E6J A;  4LFA M;  4D81 A;  2JA2 A;  1K82 A;  2X49 A;  2I7N A;  3U6M A;  5DYG A;  2XLJ A;  2C99 A;  1I4W A;  3A98 B;  3LVW A;  3PFI A;  2XF3 A;  4HL4 A;  3T1H M;  2HL7 A;  2Z7J A;  4X62 M;  4HLQ A;  5ITR A;  1N32 M;  3MK6 A;  3KS4 A;  1KYI A;  1KSF X;  3AOE A;  3W0L B;  4I4L A;  2M60 A;  2HCB A;  4LJ5 A;  3A42 A;  3GLF A;  4FVM A;  2F4V M;  4NSR A;  4G4O A;  3KVW A;  4WUR A;  5FTK A;  4LF5 M;  3HJ8 A;  3J80 S;  3FTE A;  1QVR A;  2KA6 B;  3TE6 A;  3GP1 A;  2KRK A;  2ZAO A;  3GQ4 A;  5FTJ A;  3NWL A;  3IG5 A;  2YFQ A;  4GRI A;  4KO8 A;  3JR4 A;  3SAR A;  1J09 A;  2ZAN A;  4MH0 E;  1DGG A;  2D7E A;  3KOY E;  2FFJ A;  4IBF A;  4B08 A;  4FWG A;  5EJC A;  3GRU A;  1IY0 A;  1FNN A;  4JI8 M;  2F5N A;  2YQZ A;  2OQ4 A;  3A45 A;  3KP0 E;  3LVV A;  3VKH A;  2X4A A;  2G8L A;  4DV7 M;  2QCU A;  3PNY A;  1L2C A;  3D8L A;  2R4J A;  5ITQ A;  2BJV A;  4LFB M;  1E9R A;  4NRW A;  3J7B A;  2Z3X A;  1IBK M;  4JI0 M;  4S12 A;  2UUB M;  1Z6T A;  1DGH B;  1LV7 A;  5FSW A;  1GKI A;  3ZC7 B;  2H1R A;  3TWM A;  4PD2 A;  4M0D A;  4R7G A;  4REZ A;  3HHX A;  3UJN A;  5IT9 S;  3K1J A;  4LF8 M;  4I81 A;  3GRV A;  4IJF A;  2DWM A;  3FTF A;  1HNZ M;  4R3D A;  4JI3 M;  3GLG A;  4YHH M;  4M9S A;  5EP2 A;  2EA0 A;  1E9S A;  3KOW E;  1XNQ M;  3HU2 A;  1R6B X;  4LJ9 A;  3TWL A;  3GPU A;  2L7H A;  2LH0 A;  2R18 A;  4MB7 A;  1W5T A;  4K0K M;  1JR3 A;  4FWD A;  2ERC A;  2KW0 A;  4DR5 M;  2LXE A;  4JI6 M;  4DR3 M;  1N75 A;  4QOS A;  4IJE A;  1QQW A;  3KSX A;  4RF0 A;  3J2P B;  3DFZ A;  1HQC A;  4LJ7 A;  5KQD A;  1XHB A;  2UUC M;  1JQJ C;  4LJA A;  4OVZ B;  2YR0 A;  1MX0 A;  2I7P A;  2CEA A;  2XFT A;  4D82 A;  3J27 B;  3TQS A;  1ZAE A;  2Z4S A;  3LQR A;  5IRE B;  5IZ7 D;  4A3V B;  5C18 A;  5FTM A;  2CV1 A;  2P5T A;  3AFH A;  3HWS A;  3GLI B;  4LGY A;  5E26 A;  5EXS A;  1R7R A;  3L28 A;  4B3T M;  2XEP A;  2QBY B;  4JI4 M;  3QWL A;  2OPF A;  2FOI C;  5EP4 A;  4OVZ A;  3GPY A;  3FTC A;  2R65 A;  4QHT A;  5DYI A;  5JI3 E;  4LF9 M;  1Z5C A;  1TDZ A;  3SBJ A;  4B3R M;  1TDH A;  1NHG C;  1QAN A;  3FKE A;  1YE9 A;  4DR2 M;  3WHL A;  4PT5 A;  3GLI A;  3BOS A;  2R62 A;  2LWX A;  3RGS A;  1ZQ9 A;  2DWN A;  3I51 A;  2A5Y B;  3CTW B;  4QOZ C;  2Y0Q A;  3JAM S;  5JI2 E;  3VKG A;  1IN5 A;  1I94 M;  5GKN A;  5C1B A;  5BR8 M;  3EIH A;  1NVM A;  5EXX A;  4M9Z A;  4W5W A;  4KOD A;  1TH2 A;  1DO2 A;  4NXM M;  3D8B A;  4JYA M;  1DGH A;  4JN6 A;  2XSZ A;  3AOG A;  4IBB A;  3L29 A;  4IBG A;  4I8O A;  4NSO B;  1DO0 A;  4PDG A;  3CF2 A;  3PVS A;  3SHG B;  2CHV A;  4L4U A;  3SAW A;  3VDP A;  2QP9 X;  4JI7 M;  4RF1 A;  5LMN M;  4DV3 M;  4QHS A;  4TUW A;  4LF4 M;  2J7O A;  4AW4 A;  2O5R A;  3E9S A;  3K92 A;  1IM2 A;  3KDS E;  2J7N A;  2VQE M;  5F3W A;  3M0E A;  4L15 A;  3OTO M;  3U5Z B;  1OFH A;  3GLG B;  2UUA M;  2QEN A;  4KHP M;  5FTL A;  5KPT A;  4FCT A;  1J7K A;  2C5R A;  1K3W A;  2F5Q A;  2KRU A;  3GRR A;  1KFV A;  2ZBK B;  1H6U A;  5EXT A;  4D80 A;  4NL4 H;  3SAS A;  4MGI E;  3PXG A;  3VLF B;  2CUZ A;  1XWI A;  2ZAM A;  2R4E A;  2QZ4 A;  2BNK A;  4G6Z A;  5BPV A;  3RE8 A;  4MGH A;  4LFC M;  2XSZ D;  3DZD A;  3EIE A;  2F5P A;  3L25 A;  4WW0 A;  1SXJ C;  3AL0 C;  2R46 A;  3U6P A;  1SXJ B;  3KSJ A;  3UZU A;  2L09 A;  2UU9 M;  2W82 A;  4FCV A;  2KEB A;  1Z5A A;  4AQY M;  1FJG M;  1HNX M;  4AKG A;  4LZZ A;  2HKJ A;  2KZU A;  3U6Q A;  2K47 A;  3LMM A;  3SMP A;  4ITQ A;  4GH9 A;  3GLH A;  1PJJ A;  1C1K A;  3T15 A;  3QAU A;  2CV2 A;  4B7G A;  3U60 A;  4FW9 A;  1IN7 A;  2E5L M;  2D7G A;  4DV2 M;  3HKP A;  4MGZ E;  3GRY A;  4XGI A;  3J81 S;  1HQY E;  4BBA A;  1L8Q A;  5ITY A;  3M6A A;  1YUB A;  3M7G A;  3AKZ A;  2M5Z A;  4PCZ A;  3C58 A;  1R2Z A;  2V1U A;  3THG A;  4DR7 M;  3L26 A;  3UGJ A;  4JV5 M;  4GIT A;  4AI6 A;  3WHK A;  5ITT A;  4FCW A;  4IBI A;  3IG8 A;  1NY6 A;  1XXH A;  2UXD M;  1NNU C;  3GLF B;  1IN6 A;  1N36 M;  3AJI B;  3FUX A;  4LJ4 A;  4GHA A;  4DV0 M;  4LRT A;  1G59 A;  4RNA A;  4LJ6 A;  5KPR A;  3H4M A;  3HJS A;  2C96 A;  4G4N A;  1IY1 A;  1G8P A;  3HHW A;  4X64 M;  1XMQ M;  1G41 A;  1N34 M;  1L1Z A;  2DXI A;  4IIW A;  4B3S M;  3TWK A;  4B7F A;  3FYD A;  1QAO A;  1VDD A;  1YSY A;  1NSF A;  3GPP A;  3GQ5 A;  1IN8 A;  3B9P A;  4YY3 M;  3E4R A;  3SYL A;  4GKK M;  3CF0 A;  2V1C A;  3VFD A;  1SXJ A;  2DHR A;  3SAV A;  3U6O A;  4FD2 A;  4IBE A;  1QYR A;  3HHY A;  4M0W A;  3AV0 A;  3U6D A;  3SC3 A;  3VDU A;  2CE7 A;  2UXB M;  2C98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...