3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KP1E 3KP0E 3KOWE 3KOXE 3KOZE 3KOYE
chains in the Genus database with same CATH superfamily
2R4EA 1L2DA 2CP8A 2VDBB 1IXRC 4AKIA 4M9SA 1SG9A 1A5TA 3GPPA 2WSCF 1XMQM 5DFLA 2DWLA 1R2YA 4LJ5A 3W0LB 4RNAA 3GLGE 4JI6M 3GRVA 2APLA 2V1CA 4IBCA 3GLIB 2F5QA 1ZMUA 4JI2M 2WSFF 1XB2B 2XSZD 4JV5M 4FWGA 1IN7A 1D0KA 3EIEA 5FTLA 2LTUA 1DGHB 4AQYM 5EXXA 1NJFA 2BWEA 3CF0A 4B3SM 4ANRA 3A46A 2LH0A 4L6V6 4OW0A 4HL4A 1LTMA 3SAWA 2Z8YM 2KZUA 4D81A 1IN8A 4DR5M 4LF6M 3GRYA 2C98A 4NC6A 5EXSA 4DV7M 4LG2A 4KODA 2Y21A 4WURA 4MH0E 3I01M 5E6JA 3KXEC 1NNUC 4GEWA 2DI0A 2MGWA 1Q02A 3V76A 4DR7M 4F2LA 3Q8GA 4LZZA 4G4QA 5IWAM 1L1ZA 3LW5F 1WHCA 3GPUA 2DZLA 2RGHA 1VEKA 1OFIA 3KOZE 2KNVA 3LCUA 4IBKA 3FTDA 3KSJA 1OTRA 1TF0B 4UN2B 1I94M 1QAOA 3HHYA 2UXBM 3VK7A 4KO8A 3HKPA 3U61A 2JA2A 3HX3A 2KA6B 1NV9A 1X37A 2LVOC 2QNJA 2H1RA 3HU2A 3MJ5A 3AKZA 3C3EA 3L29A 2CFOA 3T6PA 2DWMA 3KSXA 4LJ8A 1DV0A 1HJPA 4I4LA 5L8RF 2V6ZM 1JQJC 2H5XA 1Z6TA 2DHYA 4PDGA 3PFIA 2XGNA 1VEGA 1PJQA 4IJEA 1HR0M 4G4RA 4LGMA 2N35A 2P5TA 2WSEF 2CEAA 3SMSA 4LJ7A 1GO5A 1TDZA 2XFSA 2UUAM 1QQWA 3U61B 2UXDM 3IG8A 4F1IA 1KFVA 1IBKM 2DAMA 1G4AE 3GQ3A 3U6CA 2F5OA 2XSZA 3B9PA 1D0LA 3PNYA 4DV5M 3D8LA 4B3RM 1IY2A 1IQPA 3K92A 4JXJA 5EQTA 2DXIA 4KLNA 2ZAMA 1WJ7A 4X65M 3AFHA 5KQ8A 1N36M 3CGWA 4LCBA 1K3WA 5E26A 1IFYA 2J5YA 1GJTA 2OPFA 5FTMA 2ZBKB 4FCVA 4IBJA 4G4OA 1Z5CA 1HT2E 3QYBA 4LJ9A 1N32M 3U6SA 3K9PA 5F3WA 4AKGA 1DGGA 3UGJA 4M9XA 1GL6A 2CRUA 2L4FA 1E9RA 3U6LA 1Z5AA 1TR8A 2G8LA 2R46A 3HWSA 1WXQA 1OIZA 4JI4M 2EO2A 2JY7A 2V1UA 2KEBA 5KQDA 3IG5A 1NHGC 3AV0A 5EP2A 3U6EA 4CHTB 3B7NA 3L26A 3GQ4A 1HT1E 2K9DA 2Y0QA 3VKGA 3SAVA 1OJLA 3DA1A 1Z59A 1IY0A 2D7GA 3FKEA 3HZJA 3SHFA 5ITRA 4PDIA 2RKOA 1D2NA 3GLIE 2FNAA 3RGSA 3OTOM 3R9XB 2B3TA 2L2DA 3W0FA 1N34M 4LFBM 2R44A 2XF3A 3C58A 2ZAOA 2LHGA 1ZMVA 2KZSA 5EXTA 1NO1A 3BOSA 4OVZA 3VK8A 1LV7A 4MGZE 5DYIA 2ZM6M 3HJSA 1R5LA 1QAMA 3VDPA 5ITTA 5C1BA 5KPZA 3VDUA 2O25A 5DNYA 2JWSA 4DV1M 1NNJA 3GLHB 1PJIA 1J5EM 1NJGA 2QPAA 5A2QS 4NXMM 2R0IA 1J09A 3GRUA 1E32A 2WZJA 5EP4A 3I04M 2QSFX 3MK6A 1EIJA 1HQYE 2BJVA 3FYCA 4QNRA 1ZQ9A 3MMPA 4HEOA 2DNAA 4B3MM 2YR0A 3E46A 1XXHA 2ZANA 3BBZA 4PT5A 2FE8A 1I4WA 1PRBA 2LVAA 3J27B 4DUYM 3FUWA 1IN5A 4M9ZA 4TUWA 4LFAM 4CGYB 3L28A 1N75A 5LMUM 4IBIA 2K47A 1BVSA 3I4YA 3C3DA 3SC3A 2C5RA 1IXZA 4S12A 3U6PA 1FNNA 4NOOB 2HAKA 2DAIA 3VLFB 1SXJD 2A5YB 2D7HA 3DOAA 3T38A 3WHKA 2CV2A 3K8ZA 1L8QA 1FJGM 3A45A 1XXHB 2ERCA 1E94E 3GLFE 4GIPA 2UUBM 4FWHA 2J7NA 4GITA 3GO8A 1Y8GA 8CATA 4P16A 3UMMA 3LVWA 1QAQA 3AJIB 5ITXA 1G3IA 4M0DA 1HNWM 1QVRA 3B7QA 4DR4M 1ORYB 2X4AA 5DYGA 3RFWA 4DR1M 4JYAM 1OFHA 2UU9M 4GHLA 2DWNA 1CUKA 4YHHM 3RGPA 5KPTA 1K3XA 2F5SA 2O01F 2HCBA 3FE3A 3FRIA 3HHXA 3L27A 1N33M 4DV4M 2R62A 2FS1A 4AKHA 1QDRA 3ZQJA 3KDSE 2CHVA 2Z7JA 1HNXM 1OQYA 2AHMA 2MH8A 3QAUA 5H37D 3U6DA 1IY1A 3C9PA 2GNOA 2Z3XA 4JN6A 3IHPA 1VG5A 3DFZA 1YSYA 2L7HA 3BXWA 2DZNB 3U5ZA 2QBYA 2DAKA 5ITQA 4IBDA 1GVNA 1XMOM 2LBCA 1QUTA 1K82A 2L4EA 5BPVA 3U6OA 4LF9M 1EE8A 2Z4SA 3HGIA 3TPZA 4AZFA 2R4JA 1W5SA 3A98B 3AOEA 3KP1E 3J80S 3DZDA 2CWBA 3KOXE 2QCUA 3M0EA 2QQ8A 1DO2A 3SBJA 3ZCBB 3LQQA 2O5RA 3FTCA 3FRHA 3KS4A 1WR1B 3D8BA 1G59A 1NHWC 4ITQA 5EXPA 2YQZA 4MGIE 4II7A 1V33A 4GKJM 2JZ0A 2XFTA 4G4NA 4B3TM 2M60A 2XH9A 1Q3BA 3SHGB 1SXJA 2RRUA 3KVWA 4B7GA 4X62M 5IREB 4QNMA 1T6OA 3T15A 1WGLA 1JR3E 2DENA 2KNZA 1VEJA 3KP0E 2KNAA 1XC8A 4LJ6A 3GLHE 2HHHM 2Q2EB 1KSFX 5IZ7D 3T1YM 2I7PA 3FYDA 2Y20A 4IIWA 2JP7A 5IT9S 1P3QQ 2F5PA 1OAOC 1VDDA 2KRUA 4FW9A 3R8FA 2VF8A 4LJ4A 1IBLM 3A42A 3F92A 4X64M 4B7HA 1L2CA 3FUTA 4NSRA 2JY8A 3HY5A 3CTWB 1SXJB 2MR9A 4LY6A 2C96A 2R18A 2BJWA 2CE7A 1MU5A 3GP1A 2YFQA 1TH3A 4L4UA 3TWMA 3B74A 3HJQA 5EP1A 4OU7A 2BNKA 3SYLA 4QOSA 1T43A 3LVVA 3JAMS 4LF8M 4GHAA 3H4JA 2I7NA 1QDTA 1Q3CA 2LVQD 3HU3A 3I4VA 3TL4X 3THGA 1NVMA 1V92A 3T1HM 2EKFA 4L78A 2HL7A 4LF7M 1GLNA 1NY6A 4IBBA 5JI2E 4QHSA 4MGKE 5BR8M 4HLQA 3TWLA 4JI7M 1DGFA 1NSFA 5FLXS 2L09A 1TDHA 1YUBA 1XXHE 2LNHC 1GKIA 4EIWA 3U60A 2VF7A 3HHZA 4DR2M 2OOAA 1Z5BA 2JNHA 3LQRA 4DR6M 1RU3A 2HWJA 1HQCA 2UUCM 4RF0A 2E5LM 1G41A 1C1KA 4FCTA 2CV1A 1E9SA 2JY5A 3M7GA 4L16A 2LVNC 2VQFM 3SASA 3LCVB 2F4VM 4OVZB 1L2BA 3AOGA 1QZMA 4Z6YA 2D7EA 3GLIA 2UXCM 5EJCA 1Q39A 2ZTDA 4LJAA 4RKUF 4LF4M 2M5ZA 2LVPC 4R3DA 1ZV1A 2G3QA 1TH2A 2LHCA 1IXSA 2NQ8C 3SFZA 4BLCA 3VKHA 2YNMD 2C9CA 2FFJA 1DGHA 1IBMM 4JI8M 5ITUA 4JI0M 4PCZA 3SAUA 4AI6A 1TTEA 1MJGM 5KPRA 2L7IA 3UK6A 3M6AA 2GQFA 2XLJA 2QZ4A 2R65A 5ITXE 2QENA 4R7GA 2DAEA 1XNQM 1NY5A 1PJTA 4REZA 4D80A 1N77A 2QHOB 1TH4A 3NBIA 4MB7A 4AW4A 3Q8XA 2XZFA 4LGYA 4OX9M 4NL4H 3JR5A 2DKLA 1OIPA 4XK8F 4M0WA 1H6UA 3W67A 1IXSB 1PJJA 1KYIA 5C18A 4NRVA 1J7KA 2R45A 4NSOB 3CF2A 1ZMWA 4G6ZA 4IBEA 3GLGA 2BWBA 1F4IA 4KHPM 3MHVC 3U6MA 3KFUG 3W68A 1UM8A 4KT0F 3HU1A 4LZJA 5EP3A 3ZC7B 2KRKA 3FUUA 4JI3M 1PJSA 3AL0C 2EJSA 4WP2A 4BB9A 2JXNA 2G5GX 3K2LA 3PNVA 4A3VB 4JI1M 1XNRM 2CUZA 3KOWE 3E21A 4CIZA 4DV2M 3GRRA 3SATA 2Y0TA 3TWKA 1ZAEA 3KOYE 3KS8A 2ZTCA 1QANA 3CF6E 5ITYA 3ZH9B 1IN4A 2OOBA 5FTNA 1S3SA 4NRWA 1GL7A 4Q7JA 3UZUA 2DZOB 3J7BA 1JR3D 2FH0A 4RF1A 3GLGB 2KDLA 3GLFA 1PM5A 4DV0M 4Y28F 5FTJA 2R6FA 3JR4A 1SXJE 2HKJA 3UJNA 2L6OA 1R6BX 1NV8A 4I5SA 4LRTA 3SYKA 5LMNM 1QUSA 1G71A 4D82A 2LWXA 3IECA 2MROB 3SARA 3WHLA 1W5TA 3FTFA 2CV0A 3TQSA 1UFZA 4IBFA 3U5ZB 1XHBA 1DO0A 3L25A 1IN6A 4B08A 2QBYB 4L15A 1DGBA 2F5NA 4LFCM 2EUCA 3B89A 3ILKA 2EKKA 3KW6A 4GKKM 4DV6M 3GLFB 4L8RC 5JI3E 2W82A 3J2PB 4DBGB 4W5WA 1VQ1A 1G8PA 1WIVA 4B7FA 3LMMA 1MN3A 4AG5A 3FUVA 4MM3B 4GC5A 3L2AA 1PGYA 1IM2A 4GRIA 4PD2A 4MGYE 1MX0A 5GKNA 1C7YA 2VIIA 4GH9A 3GPYA 1OAIA 2VQEM 4BBAA 2CHQA 2KXEA 3U6QA 1N78A 4QOZC 3NWLA 2FOIC 4IBGA 2CHGA 4I81A 2KW0A 2K6BA 2XZUA 3J7AS 3PXGA 1YE9A 3VFDA 1R7RA 4DUZM 1TGUA 3K9OA 3E4RA 1V34A 1R4GA 4LRSA 4DV3M 4CISA 4AG6A 4FWDA 3AOEC 3EIHA 4G3OA 5KO3A 1D0MA 2JUJA 2KHHA 4Z8XA 4K0KM 1XWIA 5FSWA 2JZ1A 3GPXA 2JY6B 2X8AA 4P17A 4ZPXA 7CATA 3J81S 1JR3A 1JB0F 3E9SA 3HHWA 2X49A 4FD2A 2OQ4A 1R2ZA 4FCWA 2OO9A 2QP9X 3HJ8A 3GLHA 2EA0A 2RGOA 4DR3M 1HNZM 1YLAA 1QYRA 4XGIA 4R71A 1SXJC 4FVMA 2DHRA 4MGHA 4X66M 2XEPA 4WW0A 4JI5M 3FUXA 4GC9A 3QYEA 3B7ZA 3FTEA 4I8OA 1WGNA 2DWZB 1GABA 4GMQA 3H4MA 3RE8A 5FTKA 4IJFA 2LXEA 2Z4RA 3FD9A 2C99A 1T3TA 1L1TA 2C9OA 1EFUB 3I51A 3QWLA 1VDLA 2MJ5B 1AUAA 4YY3M 3NBXX 4QHTA 1GJSA 2K0BX 2J7OA 3TE6A 4LF5M 4NXNM 4CJ6A 1OKSA 1QZEA 3U60B 3PVSA 3K1JA 3SMPA 3GQ5A 2DAGA 4XBOA 2DVWB 1AIPC
chains in the Genus database with same CATH topology
2R4EA 1L2DA 4AKIA 1IXRC 4M9SA 3GPPA 1XMQM 2DWLA 1R2YA 4LJ5A 3W0LB 4RNAA 4JI6M 3GRVA 4IBCA 2V1CA 3GLIB 2F5QA 4JI2M 2XSZD 4JV5M 4FWGA 1IN7A 3EIEA 5FTLA 1DGHB 4AQYM 5EXXA 1NJFA 3CF0A 4B3SM 3A46A 2LH0A 4OW0A 4HL4A 3SAWA 2KZUA 4D81A 1IN8A 4DR5M 4LF6M 3GRYA 2C98A 5EXSA 4DV7M 4LG2A 4KODA 2Y21A 4WURA 4MH0E 5E6JA 3KXEC 1NNUC 4DR7M 4LZZA 4G4QA 5IWAM 1L1ZA 3GPUA 2RGHA 3KOZE 1OFIA 4IBKA 3FTDA 3KSJA 1I94M 1QAOA 3HHYA 2UXBM 3VK7A 4KO8A 3HKPA 3U61A 2JA2A 2KA6B 1X37A 2H1RA 3HU2A 3MJ5A 3AKZA 3L29A 2CFOA 2DWMA 3KSXA 4LJ8A 4I4LA 2V6ZM 1JQJC 1Z6TA 4PDGA 3PFIA 2XGNA 1HR0M 4IJEA 4G4RA 4LGMA 2P5TA 3SMSA 2CEAA 4LJ7A 1TDZA 2XFSA 2UUAM 1QQWA 3U61B 2UXDM 3IG8A 1KFVA 1IBKM 2F5OA 1G4AE 3GQ3A 3U6CA 3B9PA 2XSZA 4DV5M 3PNYA 3D8LA 4B3RM 1IY2A 1IQPA 3K92A 4JXJA 5EQTA 2DXIA 4KLNA 2ZAMA 4X65M 1N36M 3AFHA 5KQ8A 4LCBA 1K3WA 5E26A 2OPFA 5FTMA 2ZBKB 4FCVA 4IBJA 4G4OA 1Z5CA 1HT2E 4LJ9A 1N32M 3U6SA 5F3WA 4AKGA 1DGGA 3UGJA 4M9XA 1GL6A 1E9RA 3U6LA 1Z5AA 2G8LA 2R46A 3HWSA 1WXQA 4JI4M 2EO2A 2V1UA 2KEBA 5KQDA 3IG5A 1NHGC 3AV0A 5EP2A 3U6EA 4CHTB 3L26A 3GQ4A 1HT1E 3VKGA 2Y0QA 3SAVA 1OJLA 3DA1A 1Z59A 2D7GA 3FKEA 1IY0A 3SHFA 5ITRA 4PDIA 2RKOA 1D2NA 2FNAA 3RGSA 3OTOM 3R9XB 1N34M 3W0FA 4LFBM 2XF3A 3C58A 2ZAOA 2KZSA 5EXTA 3BOSA 4OVZA 3VK8A 1LV7A 4MGZE 5DYIA 2ZM6M 3HJSA 3VDPA 1QAMA 5ITTA 5C1BA 5KPZA 3VDUA 5DNYA 4DV1M 1NNJA 3GLHB 1PJIA 1J5EM 1NJGA 2QPAA 5A2QS 4NXMM 1J09A 3GRUA 1E32A 5EP4A 3MK6A 1HQYE 2BJVA 3FYCA 4QNRA 1ZQ9A 4B3MM 2YR0A 1XXHA 2ZANA 4PT5A 2FE8A 1I4WA 3J27B 4DUYM 3FUWA 1IN5A 4M9ZA 4TUWA 4LFAM 4CGYB 3L28A 1N75A 5LMUM 4IBIA 2K47A 3I4YA 3SC3A 2C5RA 1IXZA 4S12A 3U6PA 1FNNA 4NOOB 3VLFB 1SXJD 2A5YB 2D7HA 3DOAA 3T38A 3WHKA 2CV2A 3K8ZA 1L8QA 1FJGM 3A45A 1XXHB 2ERCA 1E94E 4GIPA 2UUBM 4FWHA 2J7NA 4GITA 3GO8A 8CATA 4P16A 3UMMA 3LVWA 1QAQA 3AJIB 5ITXA 1G3IA 4M0DA 1HNWM 1QVRA 4DR4M 1ORYB 2X4AA 5DYGA 3RFWA 4DR1M 4JYAM 1OFHA 2UU9M 4GHLA 2DWNA 4YHHM 3RGPA 5KPTA 1K3XA 2F5SA 3L27A 2HCBA 1N33M 3HHXA 4AKHA 4DV4M 2R62A 3KDSE 2CHVA 2Z7JA 1HNXM 2AHMA 3QAUA 5H37D 3U6DA 1IY1A 2Z3XA 4JN6A 3DFZA 1YSYA 2L7HA 2DZNB 3U5ZA 2QBYA 5ITQA 4IBDA 1GVNA 1XMOM 1K82A 5BPVA 3U6OA 4LF9M 1EE8A 3HGIA 2Z4SA 3TPZA 4AZFA 2R4JA 1W5SA 3A98B 3KP1E 3AOEA 3J80S 3DZDA 3KOXE 2QCUA 3M0EA 3SBJA 1DO2A 3ZCBB 3LQQA 2O5RA 3FTCA 3KS4A 3D8BA 1G59A 1NHWC 4ITQA 5EXPA 2YQZA 4MGIE 4II7A 4GKJM 2XFTA 4G4NA 4B3TM 2M60A 2XH9A 1Q3BA 3SHGB 1SXJA 3KVWA 4B7GA 4X62M 5IREB 4QNMA 3T15A 3KP0E 1XC8A 4LJ6A 2HHHM 2Q2EB 1KSFX 5IZ7D 3T1YM 2I7PA 3FYDA 2Y20A 4IIWA 5IT9S 2F5PA 1VDDA 2KRUA 4FW9A 3R8FA 4LJ4A 1IBLM 3A42A 4X64M 4B7HA 1L2CA 3FUTA 4NSRA 3CTWB 1SXJB 4LY6A 2C96A 2R18A 2BJWA 2CE7A 1MU5A 3GP1A 2YFQA 1TH3A 4L4UA 3TWMA 3HJQA 5EP1A 4OU7A 2BNKA 3SYLA 4QOSA 3LVVA 3JAMS 4LF8M 4GHAA 2I7NA 1Q3CA 3HU3A 3I4VA 3TL4X 3THGA 1NVMA 3T1HM 4L78A 2HL7A 4LF7M 1GLNA 1NY6A 4IBBA 5JI2E 4QHSA 4MGKE 5BR8M 4HLQA 3TWLA 4JI7M 1DGFA 1NSFA 5FLXS 2L09A 1TDHA 1YUBA 2LNHC 1GKIA 4EIWA 3U60A 3HHZA 4DR2M 1Z5BA 3LQRA 4DR6M 1HQCA 2UUCM 4RF0A 2E5LM 1G41A 1C1KA 4FCTA 2CV1A 1E9SA 4L16A 3M7GA 2VQFM 3SASA 2F4VM 4OVZB 1L2BA 3AOGA 1QZMA 4Z6YA 2D7EA 3GLIA 2UXCM 5EJCA 1Q39A 4LJAA 4LF4M 2M5ZA 4R3DA 3SFZA 1TH2A 2NQ8C 4BLCA 3VKHA 2YNMD 2C9CA 2FFJA 1DGHA 1IBMM 4JI8M 5ITUA 4JI0M 4PCZA 3SAUA 4AI6A 5KPRA 2L7IA 3UK6A 3M6AA 2XLJA 2QZ4A 2R65A 5ITXE 2QENA 4R7GA 1XNQM 1NY5A 4D80A 4REZA 1N77A 1TH4A 3NBIA 4MB7A 4AW4A 3Q8XA 2XZFA 4LGYA 4OX9M 4NL4H 3JR5A 4M0WA 1H6UA 1IXSB 1PJJA 1KYIA 5C18A 4NRVA 1J7KA 2R45A 4NSOB 3CF2A 4G6ZA 4IBEA 3GLGA 4KHPM 3MHVC 3U6MA 3KFUG 1UM8A 3HU1A 4LZJA 5EP3A 3ZC7B 2KRKA 3FUUA 4JI3M 3AL0C 4BB9A 3K2LA 2G5GX 4A3VB 3PNVA 4JI1M 1XNRM 2CUZA 3KOWE 4DV2M 3GRRA 3SATA 2Y0TA 3TWKA 1ZAEA 3KOYE 3KS8A 5ITYA 1QANA 3CF6E 3ZH9B 1IN4A 5FTNA 1S3SA 4NRWA 1GL7A 3UZUA 2DZOB 3J7BA 1JR3D 4RF1A 3GLGB 3GLFA 1PM5A 4DV0M 5FTJA 3JR4A 1SXJE 2HKJA 3UJNA 2L6OA 1R6BX 4LRTA 4I5SA 3SYKA 5LMNM 4D82A 2LWXA 3SARA 3WHLA 1W5TA 3FTFA 2CV0A 3TQSA 4IBFA 3U5ZB 1XHBA 1DO0A 3L25A 1IN6A 4B08A 2QBYB 4L15A 1DGBA 2F5NA 4LFCM 2EUCA 3ILKA 3KW6A 4GKKM 4DV6M 3GLFB 4L8RC 5JI3E 2W82A 3J2PB 4W5WA 1G8PA 4B7FA 3LMMA 4AG5A 3FUVA 4MM3B 4GC5A 3L2AA 1IM2A 4GRIA 4PD2A 4MGYE 1MX0A 5GKNA 2VIIA 4GH9A 3GPYA 2VQEM 4BBAA 2CHQA 2KXEA 3U6QA 1N78A 4QOZC 3NWLA 2FOIC 4IBGA 2CHGA 4I81A 2KW0A 2XZUA 3J7AS 3PXGA 1YE9A 3VFDA 1R7RA 4DUZM 1TGUA 3E4RA 4DV3M 4LRSA 4CISA 4AG6A 4FWDA 3AOEC 3EIHA 5KO3A 4Z8XA 4K0KM 1XWIA 5FSWA 3GPXA 2X8AA 4ZPXA 7CATA 3J81S 1JR3A 3E9SA 3HHWA 2X49A 4FD2A 2OQ4A 1R2ZA 4FCWA 2QP9X 3HJ8A 3GLHA 2EA0A 2RGOA 4DR3M 1HNZM 1QYRA 4XGIA 1SXJC 4FVMA 2DHRA 4MGHA 4X66M 2XEPA 4WW0A 4JI5M 3FUXA 4GC9A 3FTEA 4I8OA 2DWZB 4GMQA 3H4MA 3RE8A 5FTKA 4IJFA 2LXEA 2Z4RA 3FD9A 2C99A 1T3TA 1L1TA 2C9OA 3I51A 3QWLA 4YY3M 4QHTA 2J7OA 3TE6A 4LF5M 4NXNM 3U60B 3PVSA 3K1JA 3SMPA 3GQ5A 4XBOA 2DVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP1 E;  3KP0 E;  3KOW E;  3KOX E;  3KOZ E;  3KOY E; 
#chains in the Genus database with same CATH topology
 2R4E A;  1L2D A;  2CP8 A;  2VDB B;  1IXR C;  4AKI A;  4M9S A;  1SG9 A;  1A5T A;  3GPP A;  2WSC F;  1XMQ M;  5DFL A;  2DWL A;  1R2Y A;  4LJ5 A;  3W0L B;  4RNA A;  3GLG E;  4JI6 M;  3GRV A;  2APL A;  2V1C A;  4IBC A;  3GLI B;  2F5Q A;  1ZMU A;  4JI2 M;  2WSF F;  1XB2 B;  2XSZ D;  4JV5 M;  4FWG A;  1IN7 A;  1D0K A;  3EIE A;  5FTL A;  2LTU A;  1DGH B;  4AQY M;  5EXX A;  1NJF A;  2BWE A;  3CF0 A;  4B3S M;  4ANR A;  3A46 A;  2LH0 A;  4L6V 6;  4OW0 A;  4HL4 A;  1LTM A;  3SAW A;  2Z8Y M;  2KZU A;  4D81 A;  1IN8 A;  4DR5 M;  4LF6 M;  3GRY A;  2C98 A;  4NC6 A;  5EXS A;  4DV7 M;  4LG2 A;  4KOD A;  2Y21 A;  4WUR A;  4MH0 E;  3I01 M;  5E6J A;  3KXE C;  1NNU C;  4GEW A;  2DI0 A;  2MGW A;  1Q02 A;  3V76 A;  4DR7 M;  4F2L A;  3Q8G A;  4LZZ A;  4G4Q A;  5IWA M;  1L1Z A;  3LW5 F;  1WHC A;  3GPU A;  2DZL A;  2RGH A;  1VEK A;  1OFI A;  3KOZ E;  2KNV A;  3LCU A;  4IBK A;  3FTD A;  3KSJ A;  1OTR A;  1TF0 B;  4UN2 B;  1I94 M;  1QAO A;  3HHY A;  2UXB M;  3VK7 A;  4KO8 A;  3HKP A;  3U61 A;  2JA2 A;  3HX3 A;  2KA6 B;  1NV9 A;  1X37 A;  2LVO C;  2QNJ A;  2H1R A;  3HU2 A;  3MJ5 A;  3AKZ A;  3C3E A;  3L29 A;  2CFO A;  3T6P A;  2DWM A;  3KSX A;  4LJ8 A;  1DV0 A;  1HJP A;  4I4L A;  5L8R F;  2V6Z M;  1JQJ C;  2H5X A;  1Z6T A;  2DHY A;  4PDG A;  3PFI A;  2XGN A;  1VEG A;  1PJQ A;  4IJE A;  1HR0 M;  4G4R A;  4LGM A;  2N35 A;  2P5T A;  2WSE F;  2CEA A;  3SMS A;  4LJ7 A;  1GO5 A;  1TDZ A;  2XFS A;  2UUA M;  1QQW A;  3U61 B;  2UXD M;  3IG8 A;  4F1I A;  1KFV A;  1IBK M;  2DAM A;  1G4A E;  3GQ3 A;  3U6C A;  2F5O A;  2XSZ A;  3B9P A;  1D0L A;  3PNY A;  4DV5 M;  3D8L A;  4B3R M;  1IY2 A;  1IQP A;  3K92 A;  4JXJ A;  5EQT A;  2DXI A;  4KLN A;  2ZAM A;  1WJ7 A;  4X65 M;  3AFH A;  5KQ8 A;  1N36 M;  3CGW A;  4LCB A;  1K3W A;  5E26 A;  1IFY A;  2J5Y A;  1GJT A;  2OPF A;  5FTM A;  2ZBK B;  4FCV A;  4IBJ A;  4G4O A;  1Z5C A;  1HT2 E;  3QYB A;  4LJ9 A;  1N32 M;  3U6S A;  3K9P A;  5F3W A;  4AKG A;  1DGG A;  3UGJ A;  4M9X A;  1GL6 A;  2CRU A;  2L4F A;  1E9R A;  3U6L A;  1Z5A A;  1TR8 A;  2G8L A;  2R46 A;  3HWS A;  1WXQ A;  1OIZ A;  4JI4 M;  2EO2 A;  2JY7 A;  2V1U A;  2KEB A;  5KQD A;  3IG5 A;  1NHG C;  3AV0 A;  5EP2 A;  3U6E A;  4CHT B;  3B7N A;  3L26 A;  3GQ4 A;  1HT1 E;  2K9D A;  2Y0Q A;  3VKG A;  3SAV A;  1OJL A;  3DA1 A;  1Z59 A;  1IY0 A;  2D7G A;  3FKE A;  3HZJ A;  3SHF A;  5ITR A;  4PDI A;  2RKO A;  1D2N A;  3GLI E;  2FNA A;  3RGS A;  3OTO M;  3R9X B;  2B3T A;  2L2D A;  3W0F A;  1N34 M;  4LFB M;  2R44 A;  2XF3 A;  3C58 A;  2ZAO A;  2LHG A;  1ZMV A;  2KZS A;  5EXT A;  1NO1 A;  3BOS A;  4OVZ A;  3VK8 A;  1LV7 A;  4MGZ E;  5DYI A;  2ZM6 M;  3HJS A;  1R5L A;  1QAM A;  3VDP A;  5ITT A;  5C1B A;  5KPZ A;  3VDU A;  2O25 A;  5DNY A;  2JWS A;  4DV1 M;  1NNJ A;  3GLH B;  1PJI A;  1J5E M;  1NJG A;  2QPA A;  5A2Q S;  4NXM M;  2R0I A;  1J09 A;  3GRU A;  1E32 A;  2WZJ A;  5EP4 A;  3I04 M;  2QSF X;  3MK6 A;  1EIJ A;  1HQY E;  2BJV A;  3FYC A;  4QNR A;  1ZQ9 A;  3MMP A;  4HEO A;  2DNA A;  4B3M M;  2YR0 A;  3E46 A;  1XXH A;  2ZAN A;  3BBZ A;  4PT5 A;  2FE8 A;  1I4W A;  1PRB A;  2LVA A;  3J27 B;  4DUY M;  3FUW A;  1IN5 A;  4M9Z A;  4TUW A;  4LFA M;  4CGY B;  3L28 A;  1N75 A;  5LMU M;  4IBI A;  2K47 A;  1BVS A;  3I4Y A;  3C3D A;  3SC3 A;  2C5R A;  1IXZ A;  4S12 A;  3U6P A;  1FNN A;  4NOO B;  2HAK A;  2DAI A;  3VLF B;  1SXJ D;  2A5Y B;  2D7H A;  3DOA A;  3T38 A;  3WHK A;  2CV2 A;  3K8Z A;  1L8Q A;  1FJG M;  3A45 A;  1XXH B;  2ERC A;  1E94 E;  3GLF E;  4GIP A;  2UUB M;  4FWH A;  2J7N A;  4GIT A;  3GO8 A;  1Y8G A;  8CAT A;  4P16 A;  3UMM A;  3LVW A;  1QAQ A;  3AJI B;  5ITX A;  1G3I A;  4M0D A;  1HNW M;  1QVR A;  3B7Q A;  4DR4 M;  1ORY B;  2X4A A;  5DYG A;  3RFW A;  4DR1 M;  4JYA M;  1OFH A;  2UU9 M;  4GHL A;  2DWN A;  1CUK A;  4YHH M;  3RGP A;  5KPT A;  1K3X A;  2F5S A;  2O01 F;  2HCB A;  3FE3 A;  3FRI A;  3HHX A;  3L27 A;  1N33 M;  4DV4 M;  2R62 A;  2FS1 A;  4AKH A;  1QDR A;  3ZQJ A;  3KDS E;  2CHV A;  2Z7J A;  1HNX M;  1OQY A;  2AHM A;  2MH8 A;  3QAU A;  5H37 D;  3U6D A;  1IY1 A;  3C9P A;  2GNO A;  2Z3X A;  4JN6 A;  3IHP A;  1VG5 A;  3DFZ A;  1YSY A;  2L7H A;  3BXW A;  2DZN B;  3U5Z A;  2QBY A;  2DAK A;  5ITQ A;  4IBD A;  1GVN A;  1XMO M;  2LBC A;  1QUT A;  1K82 A;  2L4E A;  5BPV A;  3U6O A;  4LF9 M;  1EE8 A;  2Z4S A;  3HGI A;  3TPZ A;  4AZF A;  2R4J A;  1W5S A;  3A98 B;  3AOE A;  3KP1 E;  3J80 S;  3DZD A;  2CWB A;  3KOX E;  2QCU A;  3M0E A;  2QQ8 A;  1DO2 A;  3SBJ A;  3ZCB B;  3LQQ A;  2O5R A;  3FTC A;  3FRH A;  3KS4 A;  1WR1 B;  3D8B A;  1G59 A;  1NHW C;  4ITQ A;  5EXP A;  2YQZ A;  4MGI E;  4II7 A;  1V33 A;  4GKJ M;  2JZ0 A;  2XFT A;  4G4N A;  4B3T M;  2M60 A;  2XH9 A;  1Q3B A;  3SHG B;  1SXJ A;  2RRU A;  3KVW A;  4B7G A;  4X62 M;  5IRE B;  4QNM A;  1T6O A;  3T15 A;  1WGL A;  1JR3 E;  2DEN A;  2KNZ A;  1VEJ A;  3KP0 E;  2KNA A;  1XC8 A;  4LJ6 A;  3GLH E;  2HHH M;  2Q2E B;  1KSF X;  5IZ7 D;  3T1Y M;  2I7P A;  3FYD A;  2Y20 A;  4IIW A;  2JP7 A;  5IT9 S;  1P3Q Q;  2F5P A;  1OAO C;  1VDD A;  2KRU A;  4FW9 A;  3R8F A;  2VF8 A;  4LJ4 A;  1IBL M;  3A42 A;  3F92 A;  4X64 M;  4B7H A;  1L2C A;  3FUT A;  4NSR A;  2JY8 A;  3HY5 A;  3CTW B;  1SXJ B;  2MR9 A;  4LY6 A;  2C96 A;  2R18 A;  2BJW A;  2CE7 A;  1MU5 A;  3GP1 A;  2YFQ A;  1TH3 A;  4L4U A;  3TWM A;  3B74 A;  3HJQ A;  5EP1 A;  4OU7 A;  2BNK A;  3SYL A;  4QOS A;  1T43 A;  3LVV A;  3JAM S;  4LF8 M;  4GHA A;  3H4J A;  2I7N A;  1QDT A;  1Q3C A;  2LVQ D;  3HU3 A;  3I4V A;  3TL4 X;  3THG A;  1NVM A;  1V92 A;  3T1H M;  2EKF A;  4L78 A;  2HL7 A;  4LF7 M;  1GLN A;  1NY6 A;  4IBB A;  5JI2 E;  4QHS A;  4MGK E;  5BR8 M;  4HLQ A;  3TWL A;  4JI7 M;  1DGF A;  1NSF A;  5FLX S;  2L09 A;  1TDH A;  1YUB A;  1XXH E;  2LNH C;  1GKI A;  4EIW A;  3U60 A;  2VF7 A;  3HHZ A;  4DR2 M;  2OOA A;  1Z5B A;  2JNH A;  3LQR A;  4DR6 M;  1RU3 A;  2HWJ A;  1HQC A;  2UUC M;  4RF0 A;  2E5L M;  1G41 A;  1C1K A;  4FCT A;  2CV1 A;  1E9S A;  2JY5 A;  3M7G A;  4L16 A;  2LVN C;  2VQF M;  3SAS A;  3LCV B;  2F4V M;  4OVZ B;  1L2B A;  3AOG A;  1QZM A;  4Z6Y A;  2D7E A;  3GLI A;  2UXC M;  5EJC A;  1Q39 A;  2ZTD A;  4LJA A;  4RKU F;  4LF4 M;  2M5Z A;  2LVP C;  4R3D A;  1ZV1 A;  2G3Q A;  1TH2 A;  2LHC A;  1IXS A;  2NQ8 C;  3SFZ A;  4BLC A;  3VKH A;  2YNM D;  2C9C A;  2FFJ A;  1DGH A;  1IBM M;  4JI8 M;  5ITU A;  4JI0 M;  4PCZ A;  3SAU A;  4AI6 A;  1TTE A;  1MJG M;  5KPR A;  2L7I A;  3UK6 A;  3M6A A;  2GQF A;  2XLJ A;  2QZ4 A;  2R65 A;  5ITX E;  2QEN A;  4R7G A;  2DAE A;  1XNQ M;  1NY5 A;  1PJT A;  4REZ A;  4D80 A;  1N77 A;  2QHO B;  1TH4 A;  3NBI A;  4MB7 A;  4AW4 A;  3Q8X A;  2XZF A;  4LGY A;  4OX9 M;  4NL4 H;  3JR5 A;  2DKL A;  1OIP A;  4XK8 F;  4M0W A;  1H6U A;  3W67 A;  1IXS B;  1PJJ A;  1KYI A;  5C18 A;  4NRV A;  1J7K A;  2R45 A;  4NSO B;  3CF2 A;  1ZMW A;  4G6Z A;  4IBE A;  3GLG A;  2BWB A;  1F4I A;  4KHP M;  3MHV C;  3U6M A;  3KFU G;  3W68 A;  1UM8 A;  4KT0 F;  3HU1 A;  4LZJ A;  5EP3 A;  3ZC7 B;  2KRK A;  3FUU A;  4JI3 M;  1PJS A;  3AL0 C;  2EJS A;  4WP2 A;  4BB9 A;  2JXN A;  2G5G X;  3K2L A;  3PNV A;  4A3V B;  4JI1 M;  1XNR M;  2CUZ A;  3KOW E;  3E21 A;  4CIZ A;  4DV2 M;  3GRR A;  3SAT A;  2Y0T A;  3TWK A;  1ZAE A;  3KOY E;  3KS8 A;  2ZTC A;  1QAN A;  3CF6 E;  5ITY A;  3ZH9 B;  1IN4 A;  2OOB A;  5FTN A;  1S3S A;  4NRW A;  1GL7 A;  4Q7J A;  3UZU A;  2DZO B;  3J7B A;  1JR3 D;  2FH0 A;  4RF1 A;  3GLG B;  2KDL A;  3GLF A;  1PM5 A;  4DV0 M;  4Y28 F;  5FTJ A;  2R6F A;  3JR4 A;  1SXJ E;  2HKJ A;  3UJN A;  2L6O A;  1R6B X;  1NV8 A;  4I5S A;  4LRT A;  3SYK A;  5LMN M;  1QUS A;  1G71 A;  4D82 A;  2LWX A;  3IEC A;  2MRO B;  3SAR A;  3WHL A;  1W5T A;  3FTF A;  2CV0 A;  3TQS A;  1UFZ A;  4IBF A;  3U5Z B;  1XHB A;  1DO0 A;  3L25 A;  1IN6 A;  4B08 A;  2QBY B;  4L15 A;  1DGB A;  2F5N A;  4LFC M;  2EUC A;  3B89 A;  3ILK A;  2EKK A;  3KW6 A;  4GKK M;  4DV6 M;  3GLF B;  4L8R C;  5JI3 E;  2W82 A;  3J2P B;  4DBG B;  4W5W A;  1VQ1 A;  1G8P A;  1WIV A;  4B7F A;  3LMM A;  1MN3 A;  4AG5 A;  3FUV A;  4MM3 B;  4GC5 A;  3L2A A;  1PGY A;  1IM2 A;  4GRI A;  4PD2 A;  4MGY E;  1MX0 A;  5GKN A;  1C7Y A;  2VII A;  4GH9 A;  3GPY A;  1OAI A;  2VQE M;  4BBA A;  2CHQ A;  2KXE A;  3U6Q A;  1N78 A;  4QOZ C;  3NWL A;  2FOI C;  4IBG A;  2CHG A;  4I81 A;  2KW0 A;  2K6B A;  2XZU A;  3J7A S;  3PXG A;  1YE9 A;  3VFD A;  1R7R A;  4DUZ M;  1TGU A;  3K9O A;  3E4R A;  1V34 A;  1R4G A;  4LRS A;  4DV3 M;  4CIS A;  4AG6 A;  4FWD A;  3AOE C;  3EIH A;  4G3O A;  5KO3 A;  1D0M A;  2JUJ A;  2KHH A;  4Z8X A;  4K0K M;  1XWI A;  5FSW A;  2JZ1 A;  3GPX A;  2JY6 B;  2X8A A;  4P17 A;  4ZPX A;  7CAT A;  3J81 S;  1JR3 A;  1JB0 F;  3E9S A;  3HHW A;  2X49 A;  4FD2 A;  2OQ4 A;  1R2Z A;  4FCW A;  2OO9 A;  2QP9 X;  3HJ8 A;  3GLH A;  2EA0 A;  2RGO A;  4DR3 M;  1HNZ M;  1YLA A;  1QYR A;  4XGI A;  4R71 A;  1SXJ C;  4FVM A;  2DHR A;  4MGH A;  4X66 M;  2XEP A;  4WW0 A;  4JI5 M;  3FUX A;  4GC9 A;  3QYE A;  3B7Z A;  3FTE A;  4I8O A;  1WGN A;  2DWZ B;  1GAB A;  4GMQ A;  3H4M A;  3RE8 A;  5FTK A;  4IJF A;  2LXE A;  2Z4R A;  3FD9 A;  2C99 A;  1T3T A;  1L1T A;  2C9O A;  1EFU B;  3I51 A;  3QWL A;  1VDL A;  2MJ5 B;  1AUA A;  4YY3 M;  3NBX X;  4QHT A;  1GJS A;  2K0B X;  2J7O A;  3TE6 A;  4LF5 M;  4NXN M;  4CJ6 A;  1OKS A;  1QZE A;  3U60 B;  3PVS A;  3K1J A;  3SMP A;  3GQ5 A;  2DAG A;  4XBO A;  2DVW B;  1AIP C; 
#chains in the Genus database with same CATH homology
 2R4E A;  1L2D A;  4AKI A;  1IXR C;  4M9S A;  3GPP A;  1XMQ M;  2DWL A;  1R2Y A;  4LJ5 A;  3W0L B;  4RNA A;  4JI6 M;  3GRV A;  4IBC A;  2V1C A;  3GLI B;  2F5Q A;  4JI2 M;  2XSZ D;  4JV5 M;  4FWG A;  1IN7 A;  3EIE A;  5FTL A;  1DGH B;  4AQY M;  5EXX A;  1NJF A;  3CF0 A;  4B3S M;  3A46 A;  2LH0 A;  4OW0 A;  4HL4 A;  3SAW A;  2KZU A;  4D81 A;  1IN8 A;  4DR5 M;  4LF6 M;  3GRY A;  2C98 A;  5EXS A;  4DV7 M;  4LG2 A;  4KOD A;  2Y21 A;  4WUR A;  4MH0 E;  5E6J A;  3KXE C;  1NNU C;  4DR7 M;  4LZZ A;  4G4Q A;  5IWA M;  1L1Z A;  3GPU A;  2RGH A;  3KOZ E;  1OFI A;  4IBK A;  3FTD A;  3KSJ A;  1I94 M;  1QAO A;  3HHY A;  2UXB M;  3VK7 A;  4KO8 A;  3HKP A;  3U61 A;  2JA2 A;  2KA6 B;  1X37 A;  2H1R A;  3HU2 A;  3MJ5 A;  3AKZ A;  3L29 A;  2CFO A;  2DWM A;  3KSX A;  4LJ8 A;  4I4L A;  2V6Z M;  1JQJ C;  1Z6T A;  4PDG A;  3PFI A;  2XGN A;  1HR0 M;  4IJE A;  4G4R A;  4LGM A;  2P5T A;  3SMS A;  2CEA A;  4LJ7 A;  1TDZ A;  2XFS A;  2UUA M;  1QQW A;  3U61 B;  2UXD M;  3IG8 A;  1KFV A;  1IBK M;  2F5O A;  1G4A E;  3GQ3 A;  3U6C A;  3B9P A;  2XSZ A;  4DV5 M;  3PNY A;  3D8L A;  4B3R M;  1IY2 A;  1IQP A;  3K92 A;  4JXJ A;  5EQT A;  2DXI A;  4KLN A;  2ZAM A;  4X65 M;  1N36 M;  3AFH A;  5KQ8 A;  4LCB A;  1K3W A;  5E26 A;  2OPF A;  5FTM A;  2ZBK B;  4FCV A;  4IBJ A;  4G4O A;  1Z5C A;  1HT2 E;  4LJ9 A;  1N32 M;  3U6S A;  5F3W A;  4AKG A;  1DGG A;  3UGJ A;  4M9X A;  1GL6 A;  1E9R A;  3U6L A;  1Z5A A;  2G8L A;  2R46 A;  3HWS A;  1WXQ A;  4JI4 M;  2EO2 A;  2V1U A;  2KEB A;  5KQD A;  3IG5 A;  1NHG C;  3AV0 A;  5EP2 A;  3U6E A;  4CHT B;  3L26 A;  3GQ4 A;  1HT1 E;  3VKG A;  2Y0Q A;  3SAV A;  1OJL A;  3DA1 A;  1Z59 A;  2D7G A;  3FKE A;  1IY0 A;  3SHF A;  5ITR A;  4PDI A;  2RKO A;  1D2N A;  2FNA A;  3RGS A;  3OTO M;  3R9X B;  1N34 M;  3W0F A;  4LFB M;  2XF3 A;  3C58 A;  2ZAO A;  2KZS A;  5EXT A;  3BOS A;  4OVZ A;  3VK8 A;  1LV7 A;  4MGZ E;  5DYI A;  2ZM6 M;  3HJS A;  3VDP A;  1QAM A;  5ITT A;  5C1B A;  5KPZ A;  3VDU A;  5DNY A;  4DV1 M;  1NNJ A;  3GLH B;  1PJI A;  1J5E M;  1NJG A;  2QPA A;  5A2Q S;  4NXM M;  1J09 A;  3GRU A;  1E32 A;  5EP4 A;  3MK6 A;  1HQY E;  2BJV A;  3FYC A;  4QNR A;  1ZQ9 A;  4B3M M;  2YR0 A;  1XXH A;  2ZAN A;  4PT5 A;  2FE8 A;  1I4W A;  3J27 B;  4DUY M;  3FUW A;  1IN5 A;  4M9Z A;  4TUW A;  4LFA M;  4CGY B;  3L28 A;  1N75 A;  5LMU M;  4IBI A;  2K47 A;  3I4Y A;  3SC3 A;  2C5R A;  1IXZ A;  4S12 A;  3U6P A;  1FNN A;  4NOO B;  3VLF B;  1SXJ D;  2A5Y B;  2D7H A;  3DOA A;  3T38 A;  3WHK A;  2CV2 A;  3K8Z A;  1L8Q A;  1FJG M;  3A45 A;  1XXH B;  2ERC A;  1E94 E;  4GIP A;  2UUB M;  4FWH A;  2J7N A;  4GIT A;  3GO8 A;  8CAT A;  4P16 A;  3UMM A;  3LVW A;  1QAQ A;  3AJI B;  5ITX A;  1G3I A;  4M0D A;  1HNW M;  1QVR A;  4DR4 M;  1ORY B;  2X4A A;  5DYG A;  3RFW A;  4DR1 M;  4JYA M;  1OFH A;  2UU9 M;  4GHL A;  2DWN A;  4YHH M;  3RGP A;  5KPT A;  1K3X A;  2F5S A;  3L27 A;  2HCB A;  1N33 M;  3HHX A;  4AKH A;  4DV4 M;  2R62 A;  3KDS E;  2CHV A;  2Z7J A;  1HNX M;  2AHM A;  3QAU A;  5H37 D;  3U6D A;  1IY1 A;  2Z3X A;  4JN6 A;  3DFZ A;  1YSY A;  2L7H A;  2DZN B;  3U5Z A;  2QBY A;  5ITQ A;  4IBD A;  1GVN A;  1XMO M;  1K82 A;  5BPV A;  3U6O A;  4LF9 M;  1EE8 A;  3HGI A;  2Z4S A;  3TPZ A;  4AZF A;  2R4J A;  1W5S A;  3A98 B;  3KP1 E;  3AOE A;  3J80 S;  3DZD A;  3KOX E;  2QCU A;  3M0E A;  3SBJ A;  1DO2 A;  3ZCB B;  3LQQ A;  2O5R A;  3FTC A;  3KS4 A;  3D8B A;  1G59 A;  1NHW C;  4ITQ A;  5EXP A;  2YQZ A;  4MGI E;  4II7 A;  4GKJ M;  2XFT A;  4G4N A;  4B3T M;  2M60 A;  2XH9 A;  1Q3B A;  3SHG B;  1SXJ A;  3KVW A;  4B7G A;  4X62 M;  5IRE B;  4QNM A;  3T15 A;  3KP0 E;  1XC8 A;  4LJ6 A;  2HHH M;  2Q2E B;  1KSF X;  5IZ7 D;  3T1Y M;  2I7P A;  3FYD A;  2Y20 A;  4IIW A;  5IT9 S;  2F5P A;  1VDD A;  2KRU A;  4FW9 A;  3R8F A;  4LJ4 A;  1IBL M;  3A42 A;  4X64 M;  4B7H A;  1L2C A;  3FUT A;  4NSR A;  3CTW B;  1SXJ B;  4LY6 A;  2C96 A;  2R18 A;  2BJW A;  2CE7 A;  1MU5 A;  3GP1 A;  2YFQ A;  1TH3 A;  4L4U A;  3TWM A;  3HJQ A;  5EP1 A;  4OU7 A;  2BNK A;  3SYL A;  4QOS A;  3LVV A;  3JAM S;  4LF8 M;  4GHA A;  2I7N A;  1Q3C A;  3HU3 A;  3I4V A;  3TL4 X;  3THG A;  1NVM A;  3T1H M;  4L78 A;  2HL7 A;  4LF7 M;  1GLN A;  1NY6 A;  4IBB A;  5JI2 E;  4QHS A;  4MGK E;  5BR8 M;  4HLQ A;  3TWL A;  4JI7 M;  1DGF A;  1NSF A;  5FLX S;  2L09 A;  1TDH A;  1YUB A;  2LNH C;  1GKI A;  4EIW A;  3U60 A;  3HHZ A;  4DR2 M;  1Z5B A;  3LQR A;  4DR6 M;  1HQC A;  2UUC M;  4RF0 A;  2E5L M;  1G41 A;  1C1K A;  4FCT A;  2CV1 A;  1E9S A;  4L16 A;  3M7G A;  2VQF M;  3SAS A;  2F4V M;  4OVZ B;  1L2B A;  3AOG A;  1QZM A;  4Z6Y A;  2D7E A;  3GLI A;  2UXC M;  5EJC A;  1Q39 A;  4LJA A;  4LF4 M;  2M5Z A;  4R3D A;  3SFZ A;  1TH2 A;  2NQ8 C;  4BLC A;  3VKH A;  2YNM D;  2C9C A;  2FFJ A;  1DGH A;  1IBM M;  4JI8 M;  5ITU A;  4JI0 M;  4PCZ A;  3SAU A;  4AI6 A;  5KPR A;  2L7I A;  3UK6 A;  3M6A A;  2XLJ A;  2QZ4 A;  2R65 A;  5ITX E;  2QEN A;  4R7G A;  1XNQ M;  1NY5 A;  4D80 A;  4REZ A;  1N77 A;  1TH4 A;  3NBI A;  4MB7 A;  4AW4 A;  3Q8X A;  2XZF A;  4LGY A;  4OX9 M;  4NL4 H;  3JR5 A;  4M0W A;  1H6U A;  1IXS B;  1PJJ A;  1KYI A;  5C18 A;  4NRV A;  1J7K A;  2R45 A;  4NSO B;  3CF2 A;  4G6Z A;  4IBE A;  3GLG A;  4KHP M;  3MHV C;  3U6M A;  3KFU G;  1UM8 A;  3HU1 A;  4LZJ A;  5EP3 A;  3ZC7 B;  2KRK A;  3FUU A;  4JI3 M;  3AL0 C;  4BB9 A;  3K2L A;  2G5G X;  4A3V B;  3PNV A;  4JI1 M;  1XNR M;  2CUZ A;  3KOW E;  4DV2 M;  3GRR A;  3SAT A;  2Y0T A;  3TWK A;  1ZAE A;  3KOY E;  3KS8 A;  5ITY A;  1QAN A;  3CF6 E;  3ZH9 B;  1IN4 A;  5FTN A;  1S3S A;  4NRW A;  1GL7 A;  3UZU A;  2DZO B;  3J7B A;  1JR3 D;  4RF1 A;  3GLG B;  3GLF A;  1PM5 A;  4DV0 M;  5FTJ A;  3JR4 A;  1SXJ E;  2HKJ A;  3UJN A;  2L6O A;  1R6B X;  4LRT A;  4I5S A;  3SYK A;  5LMN M;  4D82 A;  2LWX A;  3SAR A;  3WHL A;  1W5T A;  3FTF A;  2CV0 A;  3TQS A;  4IBF A;  3U5Z B;  1XHB A;  1DO0 A;  3L25 A;  1IN6 A;  4B08 A;  2QBY B;  4L15 A;  1DGB A;  2F5N A;  4LFC M;  2EUC A;  3ILK A;  3KW6 A;  4GKK M;  4DV6 M;  3GLF B;  4L8R C;  5JI3 E;  2W82 A;  3J2P B;  4W5W A;  1G8P A;  4B7F A;  3LMM A;  4AG5 A;  3FUV A;  4MM3 B;  4GC5 A;  3L2A A;  1IM2 A;  4GRI A;  4PD2 A;  4MGY E;  1MX0 A;  5GKN A;  2VII A;  4GH9 A;  3GPY A;  2VQE M;  4BBA A;  2CHQ A;  2KXE A;  3U6Q A;  1N78 A;  4QOZ C;  3NWL A;  2FOI C;  4IBG A;  2CHG A;  4I81 A;  2KW0 A;  2XZU A;  3J7A S;  3PXG A;  1YE9 A;  3VFD A;  1R7R A;  4DUZ M;  1TGU A;  3E4R A;  4DV3 M;  4LRS A;  4CIS A;  4AG6 A;  4FWD A;  3AOE C;  3EIH A;  5KO3 A;  4Z8X A;  4K0K M;  1XWI A;  5FSW A;  3GPX A;  2X8A A;  4ZPX A;  7CAT A;  3J81 S;  1JR3 A;  3E9S A;  3HHW A;  2X49 A;  4FD2 A;  2OQ4 A;  1R2Z A;  4FCW A;  2QP9 X;  3HJ8 A;  3GLH A;  2EA0 A;  2RGO A;  4DR3 M;  1HNZ M;  1QYR A;  4XGI A;  1SXJ C;  4FVM A;  2DHR A;  4MGH A;  4X66 M;  2XEP A;  4WW0 A;  4JI5 M;  3FUX A;  4GC9 A;  3FTE A;  4I8O A;  2DWZ B;  4GMQ A;  3H4M A;  3RE8 A;  5FTK A;  4IJF A;  2LXE A;  2Z4R A;  3FD9 A;  2C99 A;  1T3T A;  1L1T A;  2C9O A;  3I51 A;  3QWL A;  4YY3 M;  4QHT A;  2J7O A;  3TE6 A;  4LF5 M;  4NXN M;  3U60 B;  3PVS A;  3K1J A;  3SMP A;  3GQ5 A;  4XBO A;  2DVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...