3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KOWE 3KOZE 3KOYE 3KP1E 3KP0E 3KOXE
chains in the Genus database with same CATH superfamily
1DGGA 2LHGA 3L2AA 2L2DA 2AHMA 3HWSA 2LH0A 5BPVA 4DR2M 1HNXM 2UUAM 1OIPA 1J7KA 2ERCA 2W82A 5ITXA 3HU3A 4LG2A 2FE8A 3W67A 3PFIA 3PNYA 3BOSA 3GRRA 4LCBA 4JI7M 1OJLA 4FWDA 1GJSA 1IN8A 5FTLA 2YQZA 5DYGA 4B7FA 5FTMA 2DKLA 3F92A 3I51A 2ZM6M 1X37A 3RGSA 1YUBA 2V1CA 1QYRA 1IY0A 1HNZM 1VG5A 1D0KA 3UK6A 3W0FA 4R71A 3B9PA 1XXHB 1NO1A 1RU3A 2C99A 3RFWA 3KFUG 3VDUA 3Q8GA 3L27A 2N35A 4LF4M 4AKIA 1Z5AA 3U6EA 4GMQA 5C1BA 1VEGA 4Z6YA 1QVRA 1ZQ9A 3U6LA 2X8AA 1D0LA 1DGHA 3J7BA 1GKIA 3DA1A 4XK8F 2HCBA 2CV1A 4DR7M 1OAIA 2UU9M 2RKOA 1EIJA 3MJ5A 2D7EA 4L16A 2LTUA 3W68A 3LQQA 2VF8A 1L8QA 2GNOA 4M9ZA 4GKJM 1G41A 4AG6A 2Y0QA 4MGHA 5FSWA 1NHGC 4REZA 4IBFA 1NJFA 3KOZE 4IBJA 1DO2A 1QZMA 1XNQM 3U6DA 2L7IA 3IHPA 3K9PA 1L1TA 1TGUA 3EIHA 4YY3M 4AG5A 1IXZA 3KDSE 3GPPA 3JAMS 1K3WA 3LCVB 4LF6M 4GHLA 2X4AA 1OKSA 1EE8A 5FTKA 2MH8A 4IBCA 1A5TA 4KHPM 2K0BX 2QENA 2ZTDA 2DWMA 2MROB 2HAKA 4DUYM 5KPRA 4DV2M 2CWBA 3A46A 2C9CA 1Z59A 3GLFA 1IBLM 4GEWA 5DYIA 4IBIA 4PCZA 1VEKA 4LRTA 1JQJC 4MGZE 4P17A 1IXRC 4F1IA 2LXEA 2ZBKB 4Z8XA 1N75A 2I7PA 3ZH9B 1K82A 1Q02A 5IT9S 4HEOA 5EXPA 4DV6M 1QUTA 1HT1E 3HHZA 4RNAA 2EJSA 1HR0M 1E94E 2RGOA 4IBBA 3KXEC 1G71A 4OVZA 3DOAA 2I7NA 2VQEM 1DGBA 4MM3B 4GIPA 3KS8A 4LFBM 3BBZA 3D8BA 4YHHM 5BR8M 3K8ZA 3SATA 4MGKE 2QP9X 1V92A 1QZEA 1BVSA 4DV5M 5H37D 1TH3A 3AOEC 2EO2A 2XGNA 3FUVA 1KSFX 4AKHA 2Y21A 2V6ZM 8CATA 1TF0B 2L7HA 2M60A 1JR3E 2C5RA 4LFCM 1R7RA 2RRUA 3SHGB 3SHFA 3MMPA 2L09A 4GC5A 4G4QA 4IBKA 3K92A 2A5YB 2YFQA 4GHAA 1QQWA 1MJGM 4WP2A 4NXNM 3MK6A 4L8RC 1C7YA 1G3IA 1IY1A 3HU2A 4IBEA 3ZQJA 3GLGE 4DR4M 2K47A 4X62M 4X64M 5F3WA 2Z3XA 2BWEA 4K0KM 2WSFF 3CF2A 1TDHA 4LJ7A 3GRVA 3FTCA 1NNJA 4DR5M 1XWIA 1E9SA 2WZJA 4F2LA 4JYAM 1Q3BA 3GPXA 1MN3A 2JZ0A 1MX0A 1J09A 5GKNA 4HL4A 3HJ8A 3SAVA 4X66M 4MH0E 4FWGA 5IWAM 1XNRM 2V1UA 4IBGA 5JI3E 3K1JA 5A2QS 2OPFA 4DV3M 3PNVA 3E21A 2DAGA 3KS4A 3SAUA 2UUBM 2YR0A 1D0MA 4CGYB 4GITA 2KRUA 2LHCA 3H4JA 5EXTA 3AKZA 2HKJA 3KSXA 1R6BX 3GLFE 3IG8A 1DGHB 2LVPC 2MJ5B 4JI3M 1T6OA 2F4VM 5EQTA 3QYBA 1PJQA 4MGYE 3AV0A 1XMOM 2HWJA 1XHBA 3L26A 2CRUA 1N36M 4RF1A 3JR5A 4AKGA 2WSCF 2QSFX 3FUUA 4PDIA 3SASA 3TL4X 2GQFA 1XXHA 1T3TA 1OQYA 1WXQA 3TE6A 3U5ZB 3VKGA 3AOGA 3ZCBB 4LZJA 2DAKA 1OIZA 1SXJD 2DAEA 2JY6B 5DNYA 3VLFB 5KPTA 4DUZM 4AI6A 2YNMD 1IBKM 3AJIB 5DFLA 1VEJA 3I4YA 3U60B 2JA2A 1Z5BA 1LTMA 3U61B 2DZNB 3H4MA 3T15A 3SMPA 4W5WA 5KO3A 2L6OA 5FTJA 1QAMA 1GABA 1PM5A 2DWZB 1AUAA 2KRKA 2OO9A 4OW0A 3T1HM 1GLNA 2EUCA 1NNUC 4UN2B 2VQFM 2DXIA 1N34M 5ITTA 1IBMM 2KEBA 1ZMVA 1SXJA 2CEAA 3CGWA 3NWLA 4FD2A 5EP4A 2F5QA 2C96A 3U6CA 4CJ6A 1JB0F 1HNWM 1T43A 2G8LA 3PXGA 3TQSA 3JR4A 3FRHA 1GO5A 1IY2A 2F5PA 1J5EM 4G3OA 4LGYA 1HJPA 3SYKA 3CF6E 2BNKA 1R2YA 4NSRA 2LVAA 3CF0A 1VDLA 3GPYA 2R44A 1Z5CA 4LJAA 1VDDA 1F4IA 3FUXA 2DI0A 2KW0A 4JI4M 3R9XB 2B3TA 3M0EA 4CHTB 3LVWA 1DGFA 2EA0A 2DHRA 4AW4A 4GC9A 2DZLA 5EJCA 2L4EA 2DHYA 3R8FA 2EKFA 3Q8XA 1QANA 3GQ3A 2VF7A 1KYIA 1GJTA 1PRBA 4DR6M 2QQ8A 3FTEA 2XFSA 1YSYA 3U6OA 1YLAA 5FTNA 3U61A 3QYEA 3J80S 2H5XA 3GLHA 4D81A 2LNHC 2R62A 1DO0A 2Q2EB 4B7GA 3L28A 4GKKM 3AL0C 1C1KA 4D82A 3SBJA 2P5TA 3WHKA 4BLCA 1IN4A 5KQ8A 1N78A 3U6SA 3IG5A 3GRUA 4DV4M 3A45A 2LVQD 1IN7A 1H6UA 4FWHA 4LF9M 1I94M 1P3QQ 5JI2E 2HL7A 3J27B 4JXJA 3V76A 4G4NA 2BJVA 4MB7A 2X49A 4JI1M 2G3QA 4NRWA 3B7QA 3SMSA 3THGA 2KNAA 1YE9A 4M9XA 3B89A 3GRYA 3RGPA 5KQDA 1XMQM 4G4OA 3MHVC 3I04M 3DFZA 2FFJA 2KA6B 1Q3CA 1TR8A 1CUKA 2J5YA 3LMMA 3SYLA 2NQ8C 3U6PA 2LVOC 2KNZA 3FUTA 1D2NA 2OOAA 3HU1A 1XB2B 2DVWB 5ITQA 3T1YM 4DV7M 2JXNA 2K9DA 4FCVA 1NV9A 4PDGA 1L2BA 1GL6A 5ITYA 1N77A 2O01F 5ITRA 1E32A 1N32M 2Z8YM 1SXJE 1IM2A 4LY6A 4L4UA 2F5SA 1SXJC 4AQYM 2FNAA 3FTDA 5EXXA 2KHHA 4FW9A 1GVNA 5EP2A 3GLIE 5IZ7D 2OQ4A 2QNJA 3K9OA 7CATA 2Z4SA 4LGMA 2XSZD 5L8RF 1ZV1A 2R6FA 1G59A 2DZOB 1NY6A 2WSEF 2KXEA 4NC6A 3EIEA 4XBOA 3KP1E 1ORYB 2F5OA 1L2CA 2RGHA 5ITXE 2QPAA 3VK7A 2CE7A 1DV0A 2FOIC 4WURA 2XEPA 2M5ZA 2R18A 2XFTA 2Y20A 4B3SM 2R0IA 5ITUA 1OFHA 1QDRA 4Q7JA 4ANRA 2H1RA 4KT0F 3VFDA 5E26A 4OU7A 3GLIA 2HHHM 4OVZB 3UGJA 1V33A 4ITQA 1MU5A 1IXSB 1HQYE 5C18A 1LV7A 3IECA 4FCWA 3U5ZA 4LFAM 4B7HA 4QNMA 4CIZA 2QZ4A 3QWLA 3GLHE 3HJQA 4LJ9A 2ZTCA 3A42A 3C9PA 3HY5A 1TTEA 2J7OA 4NRVA 1QAOA 2XZUA 2UXBM 4LJ5A 4KLNA 4NL4H 2DENA 1SG9A 2D7HA 2QHOB 3CTWB 4IJEA 4B08A 4DV0M 2UXDM 4L78A 3E9SA 3FRIA 4JI6M 4LJ6A 3LQRA 2JNHA 4LF8M 2E5LM 3HKPA 1ZAEA 4MGIE 2MGWA 4I5SA 2KZSA 3SARA 3KVWA 1W5SA 2L4FA 1FJGM 4B3MM 2Y0TA 1Y8GA 4NXMM 3KW6A 5LMNM 2XF3A 4QOZC 1PJSA 3PVSA 3T38A 3FUWA 1AIPC 4DBGB 3GLGB 1NV8A 4RKUF 1QAQA 3LVVA 1L2DA 1L1ZA 3GQ5A 3C3DA 3U6MA 4LJ4A 1R4GA 3M7GA 2D7GA 1OAOC 4PT5A 3OTOM 1TDZA 4TUWA 3J7AS 2CHGA 4BB9A 2LBCA 2JWSA 3J2PB 2O5RA 3GLIB 3FYCA 3AOEA 3GLHB 1ZMUA 4IJFA 2BWBA 5EXSA 1FNNA 2CHVA 2JP7A 3HHXA 3GPUA 4G4RA 4JV5M 2JY5A 1IN6A 4I8OA 3UJNA 3C3EA 3VDPA 3NBIA 4II7A 2DWNA 3U6QA 2CFOA 4DV1M 2C9OA 4GH9A 1Z6TA 3FE3A 3FTFA 4GRIA 4KODA 4LZZA 4PD2A 2UUCM 2R4JA 3NBXX 4DR3M 1JR3D 4LF5M 3LW5F 2Z7JA 5EP3A 1G8PA 2BJWA 4M9SA 3RE8A 4LRSA 3M6AA 3KOXE 3ZC7B 4Y28F 3VK8A 3KSJA 1ZMWA 5IREB 1TH2A 4DR1M 1K3XA 2CHQA 4B3TM 1QDTA 3LCUA 1V34A 1PJIA 1NY5A 2CV0A 2QCUA 2JY8A 1Q39A 4HLQA 3GLFB 3FYDA 3FD9A 2DNAA 2J7NA 3J81S 4RF0A 1GL7A 4B3RM 1NJGA 1OFIA 2G5GX 3SAWA 1N33M 3D8LA 3B7ZA 4P16A 1IN5A 4QHSA 3E4RA 1PGYA 2CV2A 3HX3A 2JUJA 1UM8A 2XH9A 2OOBA 2K6BA 2VDBB 4NOOB 3TWMA 2R4EA 3GP1A 1HT2E 1S3SA 4QOSA 4JI0M 2F5NA 2KZUA 1R5LA 4L15A 2DAMA 2O25A 3UZUA 4M0WA 2QBYB 1PJTA 3WHLA 5FLXS 4X65M 3U60A 1WIVA 1W5TA 3I4VA 1NSFA 3TWKA 1WHCA 2ZANA 2C98A 2CUZA 3HJSA 2DWLA 4JI8M 1IXSA 3GLGA 4NSOB 4KO8A 4IIWA 4FVMA 4WW0A 1WGLA 1QUSA 2FH0A 2DAIA 3HHYA 1NVMA 1XXHE 3AFHA 4R3DA 2VIIA 3W0LB 3GQ4A 4LF7M 3SFZA 4G6ZA 3E46A 4QHTA 2CP8A 2LVNC 2APLA 1IQPA 2JY7A 2Z4RA 4D80A 4CISA 4I4LA 3UMMA 1JR3A 3K2LA 3DZDA 3KP0E 2UXCM 3VKHA 3B74A 4ZPXA 4BBAA 2EKKA 3B7NA 2ZAMA 1WR1B 2R65A 1R2ZA 1E9RA 3A98B 2XZFA 3T6PA 3ILKA 4FCTA 4IBDA 3KOYE 4LJ8A 1IFYA 3SC3A 2QBYA 1NHWC 1G4AE 4OX9M 5EP1A 1KFVA 4AZFA 1OTRA 3C58A 2R45A 1EFUB 2KDLA 3L25A 4EIWA 3TWLA 2JZ1A 5KPZA 2R46A 3BXWA 3HHWA 5E6JA 4JI2M 1VQ1A 1TH4A 4JN6A 1I4WA 1UFZA 3HGIA 3KOWE 3GO8A 2XLJA 1WGNA 3QAUA 4L6V6 1PJJA 2XSZA 4JI5M 2FS1A 2LWXA 4M0DA 3FKEA 4A3VB 5LMUM 4QNRA 3L29A 4S12A 2ZAOA 4R7GA 2KNVA 3HZJA 3I01M 3TPZA 1HQCA 4XGIA 4I81A 1WJ7A 1SXJB 2MR9A 1XC8A
chains in the Genus database with same CATH topology
1DGGA 3L2AA 5BPVA 1HNXM 2AHMA 3HWSA 2LH0A 4DR2M 2UUAM 1J7KA 2ERCA 2W82A 5ITXA 3HU3A 4LG2A 2FE8A 3PFIA 3PNYA 3BOSA 3GRRA 4LCBA 4JI7M 1OJLA 4FWDA 1IN8A 5FTLA 2YQZA 5DYGA 4B7FA 5FTMA 3I51A 2ZM6M 1X37A 3RGSA 1YUBA 2V1CA 1QYRA 1IY0A 1HNZM 3W0FA 3UK6A 3B9PA 1XXHB 2C99A 3RFWA 3KFUG 3VDUA 3L27A 4LF4M 4AKIA 1Z5AA 3U6EA 4GMQA 5C1BA 4Z6YA 1QVRA 1ZQ9A 3U6LA 2X8AA 3J7BA 1DGHA 2CV1A 1GKIA 3DA1A 4DR7M 2HCBA 2UU9M 2RKOA 3MJ5A 2D7EA 4L16A 3LQQA 1L8QA 4GKJM 4M9ZA 1G41A 4AG6A 2Y0QA 4MGHA 5FSWA 1NHGC 4REZA 4IBFA 1NJFA 3KOZE 4IBJA 1DO2A 1QZMA 1XNQM 3U6DA 2L7IA 1L1TA 1TGUA 3EIHA 4YY3M 4AG5A 1IXZA 3KDSE 3GPPA 3JAMS 1K3WA 4LF6M 4GHLA 2X4AA 1EE8A 5FTKA 4IBCA 4KHPM 2QENA 2DWMA 4DUYM 5KPRA 4DV2M 3A46A 2C9CA 1Z59A 3GLFA 1IBLM 5DYIA 4IBIA 4PCZA 4LRTA 1JQJC 4MGZE 1IXRC 2LXEA 2ZBKB 4Z8XA 1N75A 2I7PA 3ZH9B 1K82A 5IT9S 5EXPA 4DV6M 1HT1E 3HHZA 4RNAA 1HR0M 1E94E 2RGOA 4IBBA 3KXEC 4OVZA 2E5LM 3DOAA 2I7NA 2VQEM 1DGBA 4MM3B 4GIPA 3KS8A 4LFBM 3D8BA 4YHHM 5BR8M 3K8ZA 3SATA 4MGKE 2QP9X 4DV5M 5H37D 1TH3A 3AOEC 2EO2A 2XGNA 3FUVA 1KSFX 4AKHA 2Y21A 2V6ZM 8CATA 2M60A 2L7HA 2C5RA 4LFCM 1R7RA 3SHGB 3SHFA 2L09A 4GC5A 4G4QA 4IBKA 3K92A 2A5YB 2YFQA 4GHAA 1QQWA 4NXNM 3MK6A 4L8RC 1G3IA 1IY1A 3HU2A 4IBEA 4DR4M 2K47A 4X62M 4X64M 5F3WA 2Z3XA 4K0KM 3CF2A 1TDHA 4LJ7A 3GRVA 3FTCA 1NNJA 4DR5M 1XWIA 1E9SA 4JYAM 1Q3BA 3GPXA 1MX0A 1J09A 5GKNA 4HL4A 3HJ8A 3SAVA 4X66M 4MH0E 4FWGA 5IWAM 1XNRM 2V1UA 4IBGA 5JI3E 3K1JA 5A2QS 2OPFA 4DV3M 3PNVA 3KS4A 3SAUA 2UUBM 2YR0A 4CGYB 4GITA 2KRUA 5EXTA 3AKZA 2HKJA 3KSXA 1R6BX 3IG8A 1DGHB 4JI3M 2F4VM 5EQTA 4MGYE 3AV0A 1XMOM 1XHBA 3L26A 1N36M 4RF1A 3JR5A 4AKGA 3FUUA 4PDIA 3SASA 3TL4X 1XXHA 1T3TA 1WXQA 3TE6A 3U5ZB 3VKGA 3AOGA 3ZCBB 4LZJA 1SXJD 5DNYA 3VLFB 5KPTA 4DUZM 4AI6A 2YNMD 1IBKM 3AJIB 3I4YA 3U60B 2JA2A 1Z5BA 3U61B 2DZNB 3H4MA 3T15A 3SMPA 4W5WA 5KO3A 2L6OA 5FTJA 1QAMA 1PM5A 2DWZB 2KRKA 4OW0A 3T1HM 1GLNA 2EUCA 1NNUC 2VQFM 2DXIA 1N34M 5ITTA 1IBMM 2KEBA 1SXJA 2CEAA 3NWLA 4FD2A 5EP4A 2F5QA 2C96A 3U6CA 1HNWM 2G8LA 3PXGA 3TQSA 3JR4A 1IY2A 2F5PA 1J5EM 4LGYA 3SYKA 3CF6E 2BNKA 1R2YA 4NSRA 3CF0A 3GPYA 1Z5CA 4LJAA 1VDDA 3FUXA 2KW0A 4JI4M 3R9XB 3M0EA 4CHTB 3LVWA 1DGFA 2EA0A 2DHRA 4AW4A 4GC9A 5EJCA 3R8FA 3Q8XA 1QANA 3GQ3A 1KYIA 4DR6M 3FTEA 2XFSA 1YSYA 3U6OA 5FTNA 3U61A 3J80S 3GLHA 4D81A 2LNHC 2R62A 1DO0A 2Q2EB 4B7GA 3L28A 4GKKM 3AL0C 1C1KA 4D82A 3SBJA 2P5TA 3WHKA 4BLCA 1IN4A 5KQ8A 1N78A 3U6SA 3IG5A 3GRUA 4DV4M 3A45A 1IN7A 4FWHA 1H6UA 4LF9M 1I94M 5JI2E 2HL7A 3J27B 4JXJA 4G4NA 2BJVA 4MB7A 2X49A 4JI1M 4NRWA 3SMSA 3THGA 1YE9A 4M9XA 3GRYA 5KQDA 3RGPA 1XMQM 4G4OA 3MHVC 3DFZA 2FFJA 2KA6B 1Q3CA 3LMMA 3SYLA 2NQ8C 3U6PA 3FUTA 1D2NA 3HU1A 2DVWB 5ITQA 3T1YM 4DV7M 4FCVA 4PDGA 1L2BA 1GL6A 5ITYA 1N77A 5ITRA 1E32A 1N32M 1SXJE 1IM2A 4LY6A 4L4UA 2F5SA 1SXJC 4AQYM 2FNAA 3FTDA 5EXXA 4FW9A 1GVNA 5EP2A 5IZ7D 2OQ4A 7CATA 2Z4SA 4LGMA 2XSZD 1G59A 2DZOB 1NY6A 2KXEA 4XBOA 3EIEA 3KP1E 1ORYB 2F5OA 1L2CA 2RGHA 5ITXE 2QPAA 3VK7A 2CE7A 2FOIC 4WURA 2XEPA 2M5ZA 2R18A 2XFTA 2Y20A 4B3SM 5ITUA 1OFHA 2H1RA 3VFDA 4OU7A 5E26A 3GLIA 2HHHM 4OVZB 3UGJA 4ITQA 1MU5A 1IXSB 1HQYE 5C18A 1LV7A 4FCWA 3U5ZA 4LFAM 4B7HA 4QNMA 2QZ4A 3QWLA 3HJQA 4LJ9A 3A42A 4NRVA 2J7OA 1QAOA 2XZUA 2UXBM 4LJ5A 4KLNA 4NL4H 3CTWB 2D7HA 4IJEA 3GLGA 2UXDM 4B08A 4DV0M 4L78A 3E9SA 4JI6M 4LJ6A 3LQRA 4LF8M 3HKPA 1ZAEA 4MGIE 4I5SA 2KZSA 3SARA 3KVWA 1W5SA 1FJGM 4B3MM 2Y0TA 4NXMM 3KW6A 5LMNM 2XF3A 4QOZC 3PVSA 3T38A 3FUWA 3GLGB 1QAQA 3LVVA 1L2DA 1L1ZA 3GQ5A 3U6MA 4LJ4A 3M7GA 4PT5A 2D7GA 3OTOM 1TDZA 4TUWA 3J7AS 2CHGA 4BB9A 3J2PB 2O5RA 3GLIB 3FYCA 3GLHB 3AOEA 4IJFA 5EXSA 1FNNA 2CHVA 3HHXA 3GPUA 4G4RA 4JV5M 1IN6A 4I8OA 3UJNA 3VDPA 3NBIA 4II7A 2DWNA 3U6QA 2CFOA 4DV1M 2C9OA 4GH9A 1Z6TA 3FTFA 4GRIA 4KODA 4LZZA 4PD2A 2UUCM 2R4JA 4DR3M 1JR3D 4LF5M 2Z7JA 5EP3A 1G8PA 2BJWA 4M9SA 3RE8A 4LRSA 3M6AA 3KOXE 3ZC7B 3VK8A 3KSJA 5IREB 1TH2A 4DR1M 1K3XA 2CHQA 4B3TM 2CV0A 1PJIA 1NY5A 2QCUA 1Q39A 4HLQA 3GLFB 3FYDA 3FD9A 2J7NA 3J81S 4RF0A 1GL7A 4B3RM 1NJGA 1OFIA 2G5GX 3SAWA 1N33M 3D8LA 4P16A 1IN5A 4QHSA 3E4RA 2CV2A 1UM8A 2XH9A 3TWMA 4NOOB 2R4EA 3GP1A 1HT2E 1S3SA 4QOSA 4JI0M 2F5NA 2KZUA 4L15A 3UZUA 4M0WA 2QBYB 3WHLA 5FLXS 4X65M 3U60A 1W5TA 3I4VA 1NSFA 3TWKA 2ZANA 2C98A 2CUZA 3HJSA 2DWLA 4JI8M 4NSOB 4KO8A 4IIWA 4FVMA 4WW0A 3HHYA 1NVMA 3AFHA 4R3DA 2VIIA 3W0LB 3GQ4A 4LF7M 3SFZA 4G6ZA 4QHTA 4D80A 2Z4RA 1IQPA 4CISA 4I4LA 3UMMA 1JR3A 3K2LA 3DZDA 3KP0E 2UXCM 3VKHA 4ZPXA 4BBAA 2ZAMA 2R65A 1R2ZA 1E9RA 3A98B 2XZFA 3ILKA 4FCTA 4IBDA 3KOYE 4LJ8A 3SC3A 2QBYA 1NHWC 1G4AE 4OX9M 5EP1A 1KFVA 4AZFA 3C58A 2R45A 3L25A 4EIWA 3TWLA 5KPZA 2R46A 3HHWA 5E6JA 4JI2M 1TH4A 4JN6A 1I4WA 3HGIA 3KOWE 3GO8A 2XLJA 3QAUA 1PJJA 2XSZA 4JI5M 2LWXA 4M0DA 3FKEA 4A3VB 5LMUM 4QNRA 3L29A 4S12A 2ZAOA 4R7GA 3TPZA 1HQCA 4XGIA 4I81A 1SXJB 1XC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOW E;  3KOZ E;  3KOY E;  3KP1 E;  3KP0 E;  3KOX E; 
#chains in the Genus database with same CATH topology
 1DGG A;  2LHG A;  3L2A A;  2L2D A;  2AHM A;  3HWS A;  2LH0 A;  5BPV A;  4DR2 M;  1HNX M;  2UUA M;  1OIP A;  1J7K A;  2ERC A;  2W82 A;  5ITX A;  3HU3 A;  4LG2 A;  2FE8 A;  3W67 A;  3PFI A;  3PNY A;  3BOS A;  3GRR A;  4LCB A;  4JI7 M;  1OJL A;  4FWD A;  1GJS A;  1IN8 A;  5FTL A;  2YQZ A;  5DYG A;  4B7F A;  5FTM A;  2DKL A;  3F92 A;  3I51 A;  2ZM6 M;  1X37 A;  3RGS A;  1YUB A;  2V1C A;  1QYR A;  1IY0 A;  1HNZ M;  1VG5 A;  1D0K A;  3UK6 A;  3W0F A;  4R71 A;  3B9P A;  1XXH B;  1NO1 A;  1RU3 A;  2C99 A;  3RFW A;  3KFU G;  3VDU A;  3Q8G A;  3L27 A;  2N35 A;  4LF4 M;  4AKI A;  1Z5A A;  3U6E A;  4GMQ A;  5C1B A;  1VEG A;  4Z6Y A;  1QVR A;  1ZQ9 A;  3U6L A;  2X8A A;  1D0L A;  1DGH A;  3J7B A;  1GKI A;  3DA1 A;  4XK8 F;  2HCB A;  2CV1 A;  4DR7 M;  1OAI A;  2UU9 M;  2RKO A;  1EIJ A;  3MJ5 A;  2D7E A;  4L16 A;  2LTU A;  3W68 A;  3LQQ A;  2VF8 A;  1L8Q A;  2GNO A;  4M9Z A;  4GKJ M;  1G41 A;  4AG6 A;  2Y0Q A;  4MGH A;  5FSW A;  1NHG C;  4REZ A;  4IBF A;  1NJF A;  3KOZ E;  4IBJ A;  1DO2 A;  1QZM A;  1XNQ M;  3U6D A;  2L7I A;  3IHP A;  3K9P A;  1L1T A;  1TGU A;  3EIH A;  4YY3 M;  4AG5 A;  1IXZ A;  3KDS E;  3GPP A;  3JAM S;  1K3W A;  3LCV B;  4LF6 M;  4GHL A;  2X4A A;  1OKS A;  1EE8 A;  5FTK A;  2MH8 A;  4IBC A;  1A5T A;  4KHP M;  2K0B X;  2QEN A;  2ZTD A;  2DWM A;  2MRO B;  2HAK A;  4DUY M;  5KPR A;  4DV2 M;  2CWB A;  3A46 A;  2C9C A;  1Z59 A;  3GLF A;  1IBL M;  4GEW A;  5DYI A;  4IBI A;  4PCZ A;  1VEK A;  4LRT A;  1JQJ C;  4MGZ E;  4P17 A;  1IXR C;  4F1I A;  2LXE A;  2ZBK B;  4Z8X A;  1N75 A;  2I7P A;  3ZH9 B;  1K82 A;  1Q02 A;  5IT9 S;  4HEO A;  5EXP A;  4DV6 M;  1QUT A;  1HT1 E;  3HHZ A;  4RNA A;  2EJS A;  1HR0 M;  1E94 E;  2RGO A;  4IBB A;  3KXE C;  1G71 A;  4OVZ A;  3DOA A;  2I7N A;  2VQE M;  1DGB A;  4MM3 B;  4GIP A;  3KS8 A;  4LFB M;  3BBZ A;  3D8B A;  4YHH M;  5BR8 M;  3K8Z A;  3SAT A;  4MGK E;  2QP9 X;  1V92 A;  1QZE A;  1BVS A;  4DV5 M;  5H37 D;  1TH3 A;  3AOE C;  2EO2 A;  2XGN A;  3FUV A;  1KSF X;  4AKH A;  2Y21 A;  2V6Z M;  8CAT A;  1TF0 B;  2L7H A;  2M60 A;  1JR3 E;  2C5R A;  4LFC M;  1R7R A;  2RRU A;  3SHG B;  3SHF A;  3MMP A;  2L09 A;  4GC5 A;  4G4Q A;  4IBK A;  3K92 A;  2A5Y B;  2YFQ A;  4GHA A;  1QQW A;  1MJG M;  4WP2 A;  4NXN M;  3MK6 A;  4L8R C;  1C7Y A;  1G3I A;  1IY1 A;  3HU2 A;  4IBE A;  3ZQJ A;  3GLG E;  4DR4 M;  2K47 A;  4X62 M;  4X64 M;  5F3W A;  2Z3X A;  2BWE A;  4K0K M;  2WSF F;  3CF2 A;  1TDH A;  4LJ7 A;  3GRV A;  3FTC A;  1NNJ A;  4DR5 M;  1XWI A;  1E9S A;  2WZJ A;  4F2L A;  4JYA M;  1Q3B A;  3GPX A;  1MN3 A;  2JZ0 A;  1MX0 A;  1J09 A;  5GKN A;  4HL4 A;  3HJ8 A;  3SAV A;  4X66 M;  4MH0 E;  4FWG A;  5IWA M;  1XNR M;  2V1U A;  4IBG A;  5JI3 E;  3K1J A;  5A2Q S;  2OPF A;  4DV3 M;  3PNV A;  3E21 A;  2DAG A;  3KS4 A;  3SAU A;  2UUB M;  2YR0 A;  1D0M A;  4CGY B;  4GIT A;  2KRU A;  2LHC A;  3H4J A;  5EXT A;  3AKZ A;  2HKJ A;  3KSX A;  1R6B X;  3GLF E;  3IG8 A;  1DGH B;  2LVP C;  2MJ5 B;  4JI3 M;  1T6O A;  2F4V M;  5EQT A;  3QYB A;  1PJQ A;  4MGY E;  3AV0 A;  1XMO M;  2HWJ A;  1XHB A;  3L26 A;  2CRU A;  1N36 M;  4RF1 A;  3JR5 A;  4AKG A;  2WSC F;  2QSF X;  3FUU A;  4PDI A;  3SAS A;  3TL4 X;  2GQF A;  1XXH A;  1T3T A;  1OQY A;  1WXQ A;  3TE6 A;  3U5Z B;  3VKG A;  3AOG A;  3ZCB B;  4LZJ A;  2DAK A;  1OIZ A;  1SXJ D;  2DAE A;  2JY6 B;  5DNY A;  3VLF B;  5KPT A;  4DUZ M;  4AI6 A;  2YNM D;  1IBK M;  3AJI B;  5DFL A;  1VEJ A;  3I4Y A;  3U60 B;  2JA2 A;  1Z5B A;  1LTM A;  3U61 B;  2DZN B;  3H4M A;  3T15 A;  3SMP A;  4W5W A;  5KO3 A;  2L6O A;  5FTJ A;  1QAM A;  1GAB A;  1PM5 A;  2DWZ B;  1AUA A;  2KRK A;  2OO9 A;  4OW0 A;  3T1H M;  1GLN A;  2EUC A;  1NNU C;  4UN2 B;  2VQF M;  2DXI A;  1N34 M;  5ITT A;  1IBM M;  2KEB A;  1ZMV A;  1SXJ A;  2CEA A;  3CGW A;  3NWL A;  4FD2 A;  5EP4 A;  2F5Q A;  2C96 A;  3U6C A;  4CJ6 A;  1JB0 F;  1HNW M;  1T43 A;  2G8L A;  3PXG A;  3TQS A;  3JR4 A;  3FRH A;  1GO5 A;  1IY2 A;  2F5P A;  1J5E M;  4G3O A;  4LGY A;  1HJP A;  3SYK A;  3CF6 E;  2BNK A;  1R2Y A;  4NSR A;  2LVA A;  3CF0 A;  1VDL A;  3GPY A;  2R44 A;  1Z5C A;  4LJA A;  1VDD A;  1F4I A;  3FUX A;  2DI0 A;  2KW0 A;  4JI4 M;  3R9X B;  2B3T A;  3M0E A;  4CHT B;  3LVW A;  1DGF A;  2EA0 A;  2DHR A;  4AW4 A;  4GC9 A;  2DZL A;  5EJC A;  2L4E A;  2DHY A;  3R8F A;  2EKF A;  3Q8X A;  1QAN A;  3GQ3 A;  2VF7 A;  1KYI A;  1GJT A;  1PRB A;  4DR6 M;  2QQ8 A;  3FTE A;  2XFS A;  1YSY A;  3U6O A;  1YLA A;  5FTN A;  3U61 A;  3QYE A;  3J80 S;  2H5X A;  3GLH A;  4D81 A;  2LNH C;  2R62 A;  1DO0 A;  2Q2E B;  4B7G A;  3L28 A;  4GKK M;  3AL0 C;  1C1K A;  4D82 A;  3SBJ A;  2P5T A;  3WHK A;  4BLC A;  1IN4 A;  5KQ8 A;  1N78 A;  3U6S A;  3IG5 A;  3GRU A;  4DV4 M;  3A45 A;  2LVQ D;  1IN7 A;  1H6U A;  4FWH A;  4LF9 M;  1I94 M;  1P3Q Q;  5JI2 E;  2HL7 A;  3J27 B;  4JXJ A;  3V76 A;  4G4N A;  2BJV A;  4MB7 A;  2X49 A;  4JI1 M;  2G3Q A;  4NRW A;  3B7Q A;  3SMS A;  3THG A;  2KNA A;  1YE9 A;  4M9X A;  3B89 A;  3GRY A;  3RGP A;  5KQD A;  1XMQ M;  4G4O A;  3MHV C;  3I04 M;  3DFZ A;  2FFJ A;  2KA6 B;  1Q3C A;  1TR8 A;  1CUK A;  2J5Y A;  3LMM A;  3SYL A;  2NQ8 C;  3U6P A;  2LVO C;  2KNZ A;  3FUT A;  1D2N A;  2OOA A;  3HU1 A;  1XB2 B;  2DVW B;  5ITQ A;  3T1Y M;  4DV7 M;  2JXN A;  2K9D A;  4FCV A;  1NV9 A;  4PDG A;  1L2B A;  1GL6 A;  5ITY A;  1N77 A;  2O01 F;  5ITR A;  1E32 A;  1N32 M;  2Z8Y M;  1SXJ E;  1IM2 A;  4LY6 A;  4L4U A;  2F5S A;  1SXJ C;  4AQY M;  2FNA A;  3FTD A;  5EXX A;  2KHH A;  4FW9 A;  1GVN A;  5EP2 A;  3GLI E;  5IZ7 D;  2OQ4 A;  2QNJ A;  3K9O A;  7CAT A;  2Z4S A;  4LGM A;  2XSZ D;  5L8R F;  1ZV1 A;  2R6F A;  1G59 A;  2DZO B;  1NY6 A;  2WSE F;  2KXE A;  4NC6 A;  3EIE A;  4XBO A;  3KP1 E;  1ORY B;  2F5O A;  1L2C A;  2RGH A;  5ITX E;  2QPA A;  3VK7 A;  2CE7 A;  1DV0 A;  2FOI C;  4WUR A;  2XEP A;  2M5Z A;  2R18 A;  2XFT A;  2Y20 A;  4B3S M;  2R0I A;  5ITU A;  1OFH A;  1QDR A;  4Q7J A;  4ANR A;  2H1R A;  4KT0 F;  3VFD A;  5E26 A;  4OU7 A;  3GLI A;  2HHH M;  4OVZ B;  3UGJ A;  1V33 A;  4ITQ A;  1MU5 A;  1IXS B;  1HQY E;  5C18 A;  1LV7 A;  3IEC A;  4FCW A;  3U5Z A;  4LFA M;  4B7H A;  4QNM A;  4CIZ A;  2QZ4 A;  3QWL A;  3GLH E;  3HJQ A;  4LJ9 A;  2ZTC A;  3A42 A;  3C9P A;  3HY5 A;  1TTE A;  2J7O A;  4NRV A;  1QAO A;  2XZU A;  2UXB M;  4LJ5 A;  4KLN A;  4NL4 H;  2DEN A;  1SG9 A;  2D7H A;  2QHO B;  3CTW B;  4IJE A;  4B08 A;  4DV0 M;  2UXD M;  4L78 A;  3E9S A;  3FRI A;  4JI6 M;  4LJ6 A;  3LQR A;  2JNH A;  4LF8 M;  2E5L M;  3HKP A;  1ZAE A;  4MGI E;  2MGW A;  4I5S A;  2KZS A;  3SAR A;  3KVW A;  1W5S A;  2L4F A;  1FJG M;  4B3M M;  2Y0T A;  1Y8G A;  4NXM M;  3KW6 A;  5LMN M;  2XF3 A;  4QOZ C;  1PJS A;  3PVS A;  3T38 A;  3FUW A;  1AIP C;  4DBG B;  3GLG B;  1NV8 A;  4RKU F;  1QAQ A;  3LVV A;  1L2D A;  1L1Z A;  3GQ5 A;  3C3D A;  3U6M A;  4LJ4 A;  1R4G A;  3M7G A;  2D7G A;  1OAO C;  4PT5 A;  3OTO M;  1TDZ A;  4TUW A;  3J7A S;  2CHG A;  4BB9 A;  2LBC A;  2JWS A;  3J2P B;  2O5R A;  3GLI B;  3FYC A;  3AOE A;  3GLH B;  1ZMU A;  4IJF A;  2BWB A;  5EXS A;  1FNN A;  2CHV A;  2JP7 A;  3HHX A;  3GPU A;  4G4R A;  4JV5 M;  2JY5 A;  1IN6 A;  4I8O A;  3UJN A;  3C3E A;  3VDP A;  3NBI A;  4II7 A;  2DWN A;  3U6Q A;  2CFO A;  4DV1 M;  2C9O A;  4GH9 A;  1Z6T A;  3FE3 A;  3FTF A;  4GRI A;  4KOD A;  4LZZ A;  4PD2 A;  2UUC M;  2R4J A;  3NBX X;  4DR3 M;  1JR3 D;  4LF5 M;  3LW5 F;  2Z7J A;  5EP3 A;  1G8P A;  2BJW A;  4M9S A;  3RE8 A;  4LRS A;  3M6A A;  3KOX E;  3ZC7 B;  4Y28 F;  3VK8 A;  3KSJ A;  1ZMW A;  5IRE B;  1TH2 A;  4DR1 M;  1K3X A;  2CHQ A;  4B3T M;  1QDT A;  3LCU A;  1V34 A;  1PJI A;  1NY5 A;  2CV0 A;  2QCU A;  2JY8 A;  1Q39 A;  4HLQ A;  3GLF B;  3FYD A;  3FD9 A;  2DNA A;  2J7N A;  3J81 S;  4RF0 A;  1GL7 A;  4B3R M;  1NJG A;  1OFI A;  2G5G X;  3SAW A;  1N33 M;  3D8L A;  3B7Z A;  4P16 A;  1IN5 A;  4QHS A;  3E4R A;  1PGY A;  2CV2 A;  3HX3 A;  2JUJ A;  1UM8 A;  2XH9 A;  2OOB A;  2K6B A;  2VDB B;  4NOO B;  3TWM A;  2R4E A;  3GP1 A;  1HT2 E;  1S3S A;  4QOS A;  4JI0 M;  2F5N A;  2KZU A;  1R5L A;  4L15 A;  2DAM A;  2O25 A;  3UZU A;  4M0W A;  2QBY B;  1PJT A;  3WHL A;  5FLX S;  4X65 M;  3U60 A;  1WIV A;  1W5T A;  3I4V A;  1NSF A;  3TWK A;  1WHC A;  2ZAN A;  2C98 A;  2CUZ A;  3HJS A;  2DWL A;  4JI8 M;  1IXS A;  3GLG A;  4NSO B;  4KO8 A;  4IIW A;  4FVM A;  4WW0 A;  1WGL A;  1QUS A;  2FH0 A;  2DAI A;  3HHY A;  1NVM A;  1XXH E;  3AFH A;  4R3D A;  2VII A;  3W0L B;  3GQ4 A;  4LF7 M;  3SFZ A;  4G6Z A;  3E46 A;  4QHT A;  2CP8 A;  2LVN C;  2APL A;  1IQP A;  2JY7 A;  2Z4R A;  4D80 A;  4CIS A;  4I4L A;  3UMM A;  1JR3 A;  3K2L A;  3DZD A;  3KP0 E;  2UXC M;  3VKH A;  3B74 A;  4ZPX A;  4BBA A;  2EKK A;  3B7N A;  2ZAM A;  1WR1 B;  2R65 A;  1R2Z A;  1E9R A;  3A98 B;  2XZF A;  3T6P A;  3ILK A;  4FCT A;  4IBD A;  3KOY E;  4LJ8 A;  1IFY A;  3SC3 A;  2QBY A;  1NHW C;  1G4A E;  4OX9 M;  5EP1 A;  1KFV A;  4AZF A;  1OTR A;  3C58 A;  2R45 A;  1EFU B;  2KDL A;  3L25 A;  4EIW A;  3TWL A;  2JZ1 A;  5KPZ A;  2R46 A;  3BXW A;  3HHW A;  5E6J A;  4JI2 M;  1VQ1 A;  1TH4 A;  4JN6 A;  1I4W A;  1UFZ A;  3HGI A;  3KOW E;  3GO8 A;  2XLJ A;  1WGN A;  3QAU A;  4L6V 6;  1PJJ A;  2XSZ A;  4JI5 M;  2FS1 A;  2LWX A;  4M0D A;  3FKE A;  4A3V B;  5LMU M;  4QNR A;  3L29 A;  4S12 A;  2ZAO A;  4R7G A;  2KNV A;  3HZJ A;  3I01 M;  3TPZ A;  1HQC A;  4XGI A;  4I81 A;  1WJ7 A;  1SXJ B;  2MR9 A;  1XC8 A; 
#chains in the Genus database with same CATH homology
 1DGG A;  3L2A A;  5BPV A;  1HNX M;  2AHM A;  3HWS A;  2LH0 A;  4DR2 M;  2UUA M;  1J7K A;  2ERC A;  2W82 A;  5ITX A;  3HU3 A;  4LG2 A;  2FE8 A;  3PFI A;  3PNY A;  3BOS A;  3GRR A;  4LCB A;  4JI7 M;  1OJL A;  4FWD A;  1IN8 A;  5FTL A;  2YQZ A;  5DYG A;  4B7F A;  5FTM A;  3I51 A;  2ZM6 M;  1X37 A;  3RGS A;  1YUB A;  2V1C A;  1QYR A;  1IY0 A;  1HNZ M;  3W0F A;  3UK6 A;  3B9P A;  1XXH B;  2C99 A;  3RFW A;  3KFU G;  3VDU A;  3L27 A;  4LF4 M;  4AKI A;  1Z5A A;  3U6E A;  4GMQ A;  5C1B A;  4Z6Y A;  1QVR A;  1ZQ9 A;  3U6L A;  2X8A A;  3J7B A;  1DGH A;  2CV1 A;  1GKI A;  3DA1 A;  4DR7 M;  2HCB A;  2UU9 M;  2RKO A;  3MJ5 A;  2D7E A;  4L16 A;  3LQQ A;  1L8Q A;  4GKJ M;  4M9Z A;  1G41 A;  4AG6 A;  2Y0Q A;  4MGH A;  5FSW A;  1NHG C;  4REZ A;  4IBF A;  1NJF A;  3KOZ E;  4IBJ A;  1DO2 A;  1QZM A;  1XNQ M;  3U6D A;  2L7I A;  1L1T A;  1TGU A;  3EIH A;  4YY3 M;  4AG5 A;  1IXZ A;  3KDS E;  3GPP A;  3JAM S;  1K3W A;  4LF6 M;  4GHL A;  2X4A A;  1EE8 A;  5FTK A;  4IBC A;  4KHP M;  2QEN A;  2DWM A;  4DUY M;  5KPR A;  4DV2 M;  3A46 A;  2C9C A;  1Z59 A;  3GLF A;  1IBL M;  5DYI A;  4IBI A;  4PCZ A;  4LRT A;  1JQJ C;  4MGZ E;  1IXR C;  2LXE A;  2ZBK B;  4Z8X A;  1N75 A;  2I7P A;  3ZH9 B;  1K82 A;  5IT9 S;  5EXP A;  4DV6 M;  1HT1 E;  3HHZ A;  4RNA A;  1HR0 M;  1E94 E;  2RGO A;  4IBB A;  3KXE C;  4OVZ A;  2E5L M;  3DOA A;  2I7N A;  2VQE M;  1DGB A;  4MM3 B;  4GIP A;  3KS8 A;  4LFB M;  3D8B A;  4YHH M;  5BR8 M;  3K8Z A;  3SAT A;  4MGK E;  2QP9 X;  4DV5 M;  5H37 D;  1TH3 A;  3AOE C;  2EO2 A;  2XGN A;  3FUV A;  1KSF X;  4AKH A;  2Y21 A;  2V6Z M;  8CAT A;  2M60 A;  2L7H A;  2C5R A;  4LFC M;  1R7R A;  3SHG B;  3SHF A;  2L09 A;  4GC5 A;  4G4Q A;  4IBK A;  3K92 A;  2A5Y B;  2YFQ A;  4GHA A;  1QQW A;  4NXN M;  3MK6 A;  4L8R C;  1G3I A;  1IY1 A;  3HU2 A;  4IBE A;  4DR4 M;  2K47 A;  4X62 M;  4X64 M;  5F3W A;  2Z3X A;  4K0K M;  3CF2 A;  1TDH A;  4LJ7 A;  3GRV A;  3FTC A;  1NNJ A;  4DR5 M;  1XWI A;  1E9S A;  4JYA M;  1Q3B A;  3GPX A;  1MX0 A;  1J09 A;  5GKN A;  4HL4 A;  3HJ8 A;  3SAV A;  4X66 M;  4MH0 E;  4FWG A;  5IWA M;  1XNR M;  2V1U A;  4IBG A;  5JI3 E;  3K1J A;  5A2Q S;  2OPF A;  4DV3 M;  3PNV A;  3KS4 A;  3SAU A;  2UUB M;  2YR0 A;  4CGY B;  4GIT A;  2KRU A;  5EXT A;  3AKZ A;  2HKJ A;  3KSX A;  1R6B X;  3IG8 A;  1DGH B;  4JI3 M;  2F4V M;  5EQT A;  4MGY E;  3AV0 A;  1XMO M;  1XHB A;  3L26 A;  1N36 M;  4RF1 A;  3JR5 A;  4AKG A;  3FUU A;  4PDI A;  3SAS A;  3TL4 X;  1XXH A;  1T3T A;  1WXQ A;  3TE6 A;  3U5Z B;  3VKG A;  3AOG A;  3ZCB B;  4LZJ A;  1SXJ D;  5DNY A;  3VLF B;  5KPT A;  4DUZ M;  4AI6 A;  2YNM D;  1IBK M;  3AJI B;  3I4Y A;  3U60 B;  2JA2 A;  1Z5B A;  3U61 B;  2DZN B;  3H4M A;  3T15 A;  3SMP A;  4W5W A;  5KO3 A;  2L6O A;  5FTJ A;  1QAM A;  1PM5 A;  2DWZ B;  2KRK A;  4OW0 A;  3T1H M;  1GLN A;  2EUC A;  1NNU C;  2VQF M;  2DXI A;  1N34 M;  5ITT A;  1IBM M;  2KEB A;  1SXJ A;  2CEA A;  3NWL A;  4FD2 A;  5EP4 A;  2F5Q A;  2C96 A;  3U6C A;  1HNW M;  2G8L A;  3PXG A;  3TQS A;  3JR4 A;  1IY2 A;  2F5P A;  1J5E M;  4LGY A;  3SYK A;  3CF6 E;  2BNK A;  1R2Y A;  4NSR A;  3CF0 A;  3GPY A;  1Z5C A;  4LJA A;  1VDD A;  3FUX A;  2KW0 A;  4JI4 M;  3R9X B;  3M0E A;  4CHT B;  3LVW A;  1DGF A;  2EA0 A;  2DHR A;  4AW4 A;  4GC9 A;  5EJC A;  3R8F A;  3Q8X A;  1QAN A;  3GQ3 A;  1KYI A;  4DR6 M;  3FTE A;  2XFS A;  1YSY A;  3U6O A;  5FTN A;  3U61 A;  3J80 S;  3GLH A;  4D81 A;  2LNH C;  2R62 A;  1DO0 A;  2Q2E B;  4B7G A;  3L28 A;  4GKK M;  3AL0 C;  1C1K A;  4D82 A;  3SBJ A;  2P5T A;  3WHK A;  4BLC A;  1IN4 A;  5KQ8 A;  1N78 A;  3U6S A;  3IG5 A;  3GRU A;  4DV4 M;  3A45 A;  1IN7 A;  4FWH A;  1H6U A;  4LF9 M;  1I94 M;  5JI2 E;  2HL7 A;  3J27 B;  4JXJ A;  4G4N A;  2BJV A;  4MB7 A;  2X49 A;  4JI1 M;  4NRW A;  3SMS A;  3THG A;  1YE9 A;  4M9X A;  3GRY A;  5KQD A;  3RGP A;  1XMQ M;  4G4O A;  3MHV C;  3DFZ A;  2FFJ A;  2KA6 B;  1Q3C A;  3LMM A;  3SYL A;  2NQ8 C;  3U6P A;  3FUT A;  1D2N A;  3HU1 A;  2DVW B;  5ITQ A;  3T1Y M;  4DV7 M;  4FCV A;  4PDG A;  1L2B A;  1GL6 A;  5ITY A;  1N77 A;  5ITR A;  1E32 A;  1N32 M;  1SXJ E;  1IM2 A;  4LY6 A;  4L4U A;  2F5S A;  1SXJ C;  4AQY M;  2FNA A;  3FTD A;  5EXX A;  4FW9 A;  1GVN A;  5EP2 A;  5IZ7 D;  2OQ4 A;  7CAT A;  2Z4S A;  4LGM A;  2XSZ D;  1G59 A;  2DZO B;  1NY6 A;  2KXE A;  4XBO A;  3EIE A;  3KP1 E;  1ORY B;  2F5O A;  1L2C A;  2RGH A;  5ITX E;  2QPA A;  3VK7 A;  2CE7 A;  2FOI C;  4WUR A;  2XEP A;  2M5Z A;  2R18 A;  2XFT A;  2Y20 A;  4B3S M;  5ITU A;  1OFH A;  2H1R A;  3VFD A;  4OU7 A;  5E26 A;  3GLI A;  2HHH M;  4OVZ B;  3UGJ A;  4ITQ A;  1MU5 A;  1IXS B;  1HQY E;  5C18 A;  1LV7 A;  4FCW A;  3U5Z A;  4LFA M;  4B7H A;  4QNM A;  2QZ4 A;  3QWL A;  3HJQ A;  4LJ9 A;  3A42 A;  4NRV A;  2J7O A;  1QAO A;  2XZU A;  2UXB M;  4LJ5 A;  4KLN A;  4NL4 H;  3CTW B;  2D7H A;  4IJE A;  3GLG A;  2UXD M;  4B08 A;  4DV0 M;  4L78 A;  3E9S A;  4JI6 M;  4LJ6 A;  3LQR A;  4LF8 M;  3HKP A;  1ZAE A;  4MGI E;  4I5S A;  2KZS A;  3SAR A;  3KVW A;  1W5S A;  1FJG M;  4B3M M;  2Y0T A;  4NXM M;  3KW6 A;  5LMN M;  2XF3 A;  4QOZ C;  3PVS A;  3T38 A;  3FUW A;  3GLG B;  1QAQ A;  3LVV A;  1L2D A;  1L1Z A;  3GQ5 A;  3U6M A;  4LJ4 A;  3M7G A;  4PT5 A;  2D7G A;  3OTO M;  1TDZ A;  4TUW A;  3J7A S;  2CHG A;  4BB9 A;  3J2P B;  2O5R A;  3GLI B;  3FYC A;  3GLH B;  3AOE A;  4IJF A;  5EXS A;  1FNN A;  2CHV A;  3HHX A;  3GPU A;  4G4R A;  4JV5 M;  1IN6 A;  4I8O A;  3UJN A;  3VDP A;  3NBI A;  4II7 A;  2DWN A;  3U6Q A;  2CFO A;  4DV1 M;  2C9O A;  4GH9 A;  1Z6T A;  3FTF A;  4GRI A;  4KOD A;  4LZZ A;  4PD2 A;  2UUC M;  2R4J A;  4DR3 M;  1JR3 D;  4LF5 M;  2Z7J A;  5EP3 A;  1G8P A;  2BJW A;  4M9S A;  3RE8 A;  4LRS A;  3M6A A;  3KOX E;  3ZC7 B;  3VK8 A;  3KSJ A;  5IRE B;  1TH2 A;  4DR1 M;  1K3X A;  2CHQ A;  4B3T M;  2CV0 A;  1PJI A;  1NY5 A;  2QCU A;  1Q39 A;  4HLQ A;  3GLF B;  3FYD A;  3FD9 A;  2J7N A;  3J81 S;  4RF0 A;  1GL7 A;  4B3R M;  1NJG A;  1OFI A;  2G5G X;  3SAW A;  1N33 M;  3D8L A;  4P16 A;  1IN5 A;  4QHS A;  3E4R A;  2CV2 A;  1UM8 A;  2XH9 A;  3TWM A;  4NOO B;  2R4E A;  3GP1 A;  1HT2 E;  1S3S A;  4QOS A;  4JI0 M;  2F5N A;  2KZU A;  4L15 A;  3UZU A;  4M0W A;  2QBY B;  3WHL A;  5FLX S;  4X65 M;  3U60 A;  1W5T A;  3I4V A;  1NSF A;  3TWK A;  2ZAN A;  2C98 A;  2CUZ A;  3HJS A;  2DWL A;  4JI8 M;  4NSO B;  4KO8 A;  4IIW A;  4FVM A;  4WW0 A;  3HHY A;  1NVM A;  3AFH A;  4R3D A;  2VII A;  3W0L B;  3GQ4 A;  4LF7 M;  3SFZ A;  4G6Z A;  4QHT A;  4D80 A;  2Z4R A;  1IQP A;  4CIS A;  4I4L A;  3UMM A;  1JR3 A;  3K2L A;  3DZD A;  3KP0 E;  2UXC M;  3VKH A;  4ZPX A;  4BBA A;  2ZAM A;  2R65 A;  1R2Z A;  1E9R A;  3A98 B;  2XZF A;  3ILK A;  4FCT A;  4IBD A;  3KOY E;  4LJ8 A;  3SC3 A;  2QBY A;  1NHW C;  1G4A E;  4OX9 M;  5EP1 A;  1KFV A;  4AZF A;  3C58 A;  2R45 A;  3L25 A;  4EIW A;  3TWL A;  5KPZ A;  2R46 A;  3HHW A;  5E6J A;  4JI2 M;  1TH4 A;  4JN6 A;  1I4W A;  3HGI A;  3KOW E;  3GO8 A;  2XLJ A;  3QAU A;  1PJJ A;  2XSZ A;  4JI5 M;  2LWX A;  4M0D A;  3FKE A;  4A3V B;  5LMU M;  4QNR A;  3L29 A;  4S12 A;  2ZAO A;  4R7G A;  3TPZ A;  1HQC A;  4XGI A;  4I81 A;  1SXJ B;  1XC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...