3KOWE

Crystal structure of ornithine 4,5 aminomutase backsoaked complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kowE02
3KOWE 3KP0E 3KOYE 3KOZE 3KP1E 3KOXE
chains in the Genus database with same CATH superfamily
5EP3A 3R9XB 3L27A 2CV2A 2FE8A 3PFIA 4X65M 1TDZA 4DR5M 4DV6M 3GPYA 1NNJA 4B3SM 3OTOM 4MGKE 2C5RA 3KXEC 4PDIA 5ITYA 2C9CA 1KSFX 4JI1M 4G4QA 1GO5A 4B7FA 3BXWA 2HL7A 1HNZM 3HJ8A 2KHHA 4GH9A 3RGSA 4YY3M 3AV0A 4MB7A 3T1HM 4PT5A 1GJSA 1OJLA 2QENA 2UUAM 3C3EA 1L2CA 1OIZA 2LVPC 3WHKA 2RGHA 1GJTA 1PJTA 4LJ5A 3QWLA 4LRTA 1VEGA 4X66M 5ITTA 1VEJA 1Z5BA 1NJFA 2R0IA 2YNMD 3VLFB 3U6QA 1HNWM 1IM2A 4DR7M 1IBLM 3I01M 1XXHE 2LBCA 2XLJA 3A45A 3TWLA 4XBOA 4HLQA 2V1CA 4LFCM 4MGYE 1IN7A 4G6ZA 3EIEA 1ZMUA 3FRHA 1ZQ9A 4FD2A 3KOXE 3MJ5A 1E9RA 4P17A 4REZA 1GL6A 3QYEA 5ITXE 2ZAMA 4DV3M 3I51A 1FJGM 1IN5A 1J7KA 1TGUA 1BVSA 2QSFX 3LCVB 1N34M 2R46A 4GRIA 5BPVA 1GKIA 4LZJA 4MH0E 1OAOC 2QP9X 2YQZA 2XSZA 3GLFB 1IFYA 3J80S 1JR3E 1PGYA 2R4EA 3D8BA 3HJSA 1DGBA 3U6DA 1G8PA 5LMNM 3VKGA 1SXJD 2C98A 3KOYE 2GQFA 2QBYB 4BBAA 3UJNA 1YE9A 2ZTDA 2C96A 2CP8A 3HWSA 1L1ZA 4X62M 3FUXA 3GPUA 2KZSA 2CUZA 3A46A 3QYBA 3FUTA 2D7EA 3Q8GA 5DFLA 1HQCA 4PDGA 2XEPA 5L8RF 2DZLA 2MH8A 5KPTA 1A5TA 2H5XA 5EP1A 4XK8F 1K3XA 5IREB 3HU1A 4AKIA 2Z7JA 3GLIE 3U5ZB 1MU5A 1QAMA 1G71A 1ZAEA 4IBJA 4FCVA 2Z3XA 2DAEA 2LVAA 3HHXA 3KP0E 3W0LB 1G4AE 3HU2A 1NVMA 1QQWA 4LJAA 3ZH9B 5EXXA 2E5LM 4ITQA 2CHGA 3AOGA 4DBGB 4AKGA 2KNVA 1XXHB 3L28A 3KOZE 2CV1A 1IN4A 1WGLA 2Y0TA 3M6AA 4JI7M 4XGIA 2V6ZM 1XC8A 1CUKA 1SG9A 1GABA 2L2DA 1W5TA 3UMMA 2Y21A 2JY7A 4QNMA 5F3WA 1TTEA 3AFHA 5FTJA 3CF0A 4GMQA 3ZC7B 4X64M 3UGJA 4GKKM 2H1RA 4Z8XA 4FVMA 3SARA 3QAUA 1L8QA 3W0FA 3GLGA 2CEAA 1NJGA 2VF8A 4DUZM 2N35A 3L25A 1GVNA 2HAKA 4B3RM 4GC9A 2APLA 5EXPA 3ZQJA 4L16A 1QAOA 2K9DA 2R44A 1GL7A 4MM3B 4Q7JA 2XZFA 2QQ8A 4IBIA 3DFZA 3VK7A 2V1UA 4JXJA 3SASA 3KDSE 3L29A 1FNNA 2KEBA 4CHTB 1T3TA 1WHCA 1QUSA 5C1BA 1QZMA 3KW6A 1EE8A 1NV8A 1HJPA 3GRVA 5EP4A 2JUJA 1N32M 4B08A 2UXBM 3H4JA 3SYKA 4CISA 3KP1E 2CRUA 3E21A 2ZBKB 2JWSA 1N75A 1R2YA 1VDLA 1G59A 3THGA 4PCZA 5JI2E 1WGNA 3SC3A 3GLIB 1KFVA 1DGHB 1R2ZA 4LGMA 3KVWA 2UUCM 2I7NA 4AI6A 1OFIA 4KO8A 1PJJA 4CJ6A 3KFUG 4KODA 3DA1A 3RGPA 1TH4A 1N33M 1WXQA 3SYLA 1LV7A 4LRSA 5FTNA 3Q8XA 3GP1A 2MGWA 4RNAA 5ITQA 3VFDA 1EFUB 3B7NA 3MK6A 3IG8A 3L2AA 2VF7A 3FRIA 2B3TA 4AG6A 1T6OA 2NQ8C 2WSCF 4ZPXA 1EIJA 4LCBA 3NBXX 4IBFA 4L4UA 1IXSB 2A5YB 2BNKA 3ZCBB 1J5EM 3TPZA 2EKFA 1E32A 1I94M 2R65A 2RGOA 2R62A 3U6MA 1SXJA 3GLHE 4JN6A 1H6UA 2P5TA 3GPPA 2D7GA 2EUCA 4R3DA 3SBJA 4M9XA 4CIZA 7CATA 1IXZA 4IBDA 5EP2A 2GNOA 4BLCA 2CWBA 3U61A 3J2PB 2Y20A 5IZ7D 2JY5A 2X49A 2UU9M 5KQ8A 2D7HA 2LHCA 1HT1E 2F5PA 4I5SA 4AW4A 3E4RA 2G8LA 1N36M 5IWAM 4M9SA 4NL4H 1OIPA 3LQRA 4I4LA 2OOBA 4RF0A 2L4FA 4JI0M 3SATA 3VDUA 4GC5A 4KLNA 3E46A 5FLXS 3FKEA 4LZZA 3K9OA 3JR4A 2DKLA 3NWLA 1SXJC 2Y0QA 4DV7M 2VQEM 2MR9A 2OPFA 1OFHA 2I7PA 4B7GA 2CHVA 2XZUA 1WJ7A 3U60B 4FWGA 2OQ4A 5E26A 5IT9S 4IBBA 3A42A 3T38A 4AQYM 1ORYB 3PVSA 3TWMA 1JR3D 3M7GA 1N78A 1DGFA 3AJIB 1QVRA 5FSWA 2F5SA 1DO0A 1RU3A 3FE3A 2KNZA 2M60A 3B7QA 1P3QQ 3HHYA 2KRKA 4IIWA 4QNRA 3C58A 3FUVA 1NY5A 1QYRA 2LH0A 3JAMS 1D0KA 4LG2A 4RF1A 2BJWA 4OVZB 1XNQM 4B7HA 5C18A 3GQ5A 2ZTCA 5KPRA 4OW0A 3GQ3A 2LTUA 2JY6B 2YR0A 2K6BA 4WW0A 2DENA 4B3MM 3C3DA 5EJCA 4LY6A 1Z59A 3FTCA 4DV0M 3GPXA 2L09A 1GLNA 2HCBA 4LJ6A 1VG5A 5ITRA 1YLAA 2CE7A 4KHPM 3VKHA 4IBEA 5JI3E 4UN2B 3GLHB 1PJSA 2G3QA 3DZDA 2L7IA 1Q02A 2XFTA 3KOWE 4M9ZA 4QHTA 4NSRA 3I4VA 1V92A 3CF6E 2XH9A 3I04M 3L26A 3FYCA 1MJGM 1V34A 2LVOC 2X4AA 2CV0A 2ZANA 3F92A 2OO9A 4LJ7A 3U6LA 2W82A 4JI4M 4AZFA 2XSZD 4GEWA 2LVNC 2O01F 3IG5A 4D82A 4G4RA 3KSXA 3W67A 4M0WA 4PD2A 3MMPA 4L6V6 2G5GX 2WZJA 4ANRA 3U6OA 1PM5A 3EIHA 4FW9A 4HEOA 4FCTA 4L15A 4D81A 3GLFA 2FNAA 1K3WA 1UFZA 2DVWB 2MJ5B 2ZAOA 1IN8A 3HJQA 2R18A 2ZM6M 4QOZC 2FS1A 2FH0A 2Z4SA 3BOSA 2QBYA 8CATA 1L2BA 3M0EA 4AKHA 2Z4RA 4YHHM 3T1YM 1NHWC 3FD9A 3V76A 4HL4A 2YFQA 2K47A 4G3OA 4L78A 1Z5CA 4JI3M 5ITUA 5EXTA 4DR2M 3PNYA 1IY2A 5GKNA 4M0DA 5BR8M 1HNXM 2HHHM 3T15A 4A3VB 4LF9M 1TF0B 2WSFF 3FYDA 1XMOM 1Z6TA 2M5ZA 4IJEA 1VDDA 5EXSA 4NOOB 3IECA 2UUBM 2QCUA 3R8FA 4LFBM 2KW0A 2VIIA 3AKZA 2Z8YM 4DV2M 4NRWA 1IQPA 4LFAM 3U5ZA 4NSOB 1IBMM 3K8ZA 1PJIA 1LTMA 1DGGA 1Q3CA 3AL0C 2DWZB 3E9SA 3VDPA 1TDHA 4JI5M 5H37D 4IBGA 2DWNA 4JI8M 1UM8A 1XXHA 1D2NA 4DV1M 1K82A 2DAMA 3SAVA 2AHMA 1AIPC 1Q3BA 3B89A 5FTLA 1TH2A 3MHVC 3GLGE 2DWLA 3UZUA 4LF6M 4NXMM 2R45A 3IHPA 1L2DA 2F5OA 2FOIC 2O25A 3U6CA 1OTRA 1QUTA 4QHSA 1YUBA 2CHQA 5ITXA 2JA2A 3HZJA 4AG5A 4RKUF 1E9SA 3B9PA 4L8RC 1D0MA 4DV5M 1PRBA 1NSFA 2DAKA 2DHYA 3KS4A 2O5RA 2C99A 4G4NA 3GO8A 1QDRA 2MROB 2KA6B 4LJ4A 1J09A 2KXEA 2KNAA 4DR3M 1JR3A 5EQTA 4GHAA 3FTFA 1XB2B 1X37A 2QNJA 3PXGA 2KRUA 2JP7A 3DOAA 1VQ1A 4NC6A 3FUUA 4P16A 4R7GA 3GQ4A 3A98B 2KDLA 2JZ0A 3BBZA 4Y28F 1MX0A 1XNRM 4DR6M 1E94E 1XWIA 3KS8A 4B3TM 2XFSA 5DNYA 1G3IA 1IBKM 3CTWB 1ZV1A 4QOSA 4LF5M 5KQDA 3FTDA 3J81S 4LJ9A 1T43A 3K92A 3LQQA 1JB0F 1C7YA 3HGIA 2BWEA 2DAGA 1ZMVA 4F2LA 5FTMA 2EKKA 3SHGB 3KSJA 1QZEA 2VDBB 3GLIA 1DGHA 3HHWA 4LGYA 2LXEA 3B74A 2BJVA 3J27B 1NHGC 3GRUA 5LMUM 3U6PA 2JY8A 3C9PA 4IBKA 4WP2A 1PJQA 5A2QS 1S3SA 1IXRC 2QPAA 3HHZA 2LVQD 3LCUA 1VEKA 1SXJE 5KO3A 1HT2E 3SAUA 2JXNA 2XGNA 1TH3A 3K9PA 1C1KA 2ERCA 3GLGB 2L4EA 3J7BA 4GITA 4TUWA 3NBIA 2EJSA 1WR1B 1MN3A 2JNHA 3T6PA 2Q2EB 1QDTA 2HWJA 1NY6A 2J5YA 3ILKA 2VQFM 1R4GA 2DWMA 1OKSA 2EO2A 2L7HA 1HQYE 1IXSA 1OQYA 4W5WA 2LWXA 2DXIA 4WURA 3U6EA 4OU7A 3SMSA 2X8AA 3J7AS 3LW5F 5DYGA 2DNAA 3W68A 3CF2A 4FCWA 2WSEF 1QAQA 3LVVA 1Z5AA 1F4IA 1I4WA 2HKJA 3HU3A 3SAWA 4BB9A 1JQJC 2DZNB 3UK6A 2LNHC 2XF3A 4DR4M 4OX9M 2F5NA 3AOEA 3CGWA 2RRUA 2KZUA 3B7ZA 4I81A 3RE8A 1DO2A 3HY5A 4GHLA 3HKPA 3I4YA 2BWBA 3FTEA 1YSYA 1NV9A 1ZMWA 3VK8A 3LVWA 4CGYB 3SMPA 2C9OA 2R6FA 1OAIA 2QZ4A 2J7NA 3U60A 1D0LA 3TQSA 2DHRA 4IJFA 2LHGA 3SFZA 3WHLA 4R71A 3GRRA 3HX3A 2JZ1A 3H4MA 1DV0A 4NRVA 1IN6A 4LF7M 4LJ8A 1QANA 3U6SA 4GKJM 4I8OA 4JV5M 1Q39A 1W5SA 3AOEC 3K2LA 4MGHA 1G41A 5KPZA 4LF8M 2F4VM 2FFJA 4K0KM 4OVZA 4DV4M 1SXJB 1XMQM 3SHFA 3PNVA 4KT0F 4F1IA 3TWKA 5FTKA 3GRYA 4DUYM 1N77A 4JI6M 4DR1M 4FWDA 2K0BX 3D8LA 1R5LA 4JYAM 1TR8A 2UXDM 3U61B 1IY1A 2DZOB 4EIWA 4G4OA 2F5QA 3FUWA 3TE6A 1AUAA 4Z6YA 1KYIA 3RFWA 1V33A 2QHOB 5E6JA 2R4JA 1IY0A 1NNUC 4MGIE 2OOAA 2RKOA 3GLHA 2UXCM 2DAIA 3TL4X 2EA0A 1HR0M 4JI2M 2DI0A 1R6BX 5DYIA 4GIPA 3K1JA 4D80A 3GLFE 1NO1A 3LMMA 3JR5A 1XHBA 1R7RA 4FWHA 4MGZE 1L1TA 2L6OA 2CFOA 4IBCA 4S12A 4NXNM 1WIVA 4LF4M 1Y8GA 2J7OA 4II7A
chains in the Genus database with same CATH topology
5EP3A 3R9XB 3L27A 2CV2A 2FE8A 3PFIA 4X65M 1TDZA 4DR5M 4DV6M 3GPYA 1NNJA 4B3SM 3OTOM 4MGKE 2C5RA 3KXEC 4PDIA 5ITYA 2C9CA 1KSFX 4JI1M 4G4QA 4B7FA 2HL7A 1HNZM 3HJ8A 4GH9A 3RGSA 4YY3M 3AV0A 4MB7A 3T1HM 4PT5A 1OJLA 2QENA 2UUAM 1L2CA 3WHKA 2RGHA 4LJ5A 3QWLA 4LRTA 4X66M 5ITTA 1Z5BA 1NJFA 2YNMD 3VLFB 3U6QA 4DR7M 1HNWM 1IM2A 1IBLM 2XLJA 3A45A 3TWLA 4XBOA 4HLQA 2V1CA 4LFCM 4MGYE 1IN7A 4G6ZA 3EIEA 1ZQ9A 4FD2A 3KOXE 3MJ5A 1E9RA 4REZA 1GL6A 5ITXE 4DV3M 2ZAMA 1FJGM 3I51A 1IN5A 1J7KA 1TGUA 1N34M 2R46A 4GRIA 5BPVA 1GKIA 4LZJA 4MH0E 2QP9X 2YQZA 2XSZA 3GLFB 3J80S 2R4EA 3D8BA 3HJSA 1DGBA 3U6DA 1G8PA 5LMNM 3VKGA 1SXJD 2C98A 3KOYE 2QBYB 4BBAA 3UJNA 1YE9A 2C96A 3HWSA 1L1ZA 4X62M 3FUXA 3GPUA 2KZSA 2CUZA 3A46A 3FUTA 2D7EA 1HQCA 4PDGA 2XEPA 5KPTA 5EP1A 1K3XA 5IREB 3HU1A 4AKIA 2Z7JA 3U5ZB 1MU5A 1QAMA 1ZAEA 4IBJA 4FCVA 2Z3XA 3HHXA 3KP0E 3W0LB 1G4AE 3HU2A 1NVMA 1QQWA 4LJAA 3ZH9B 5EXXA 2E5LM 4ITQA 2CHGA 3AOGA 4AKGA 1XXHB 3L28A 3KOZE 2CV1A 1IN4A 2Y0TA 3M6AA 4JI7M 4XGIA 2V6ZM 1XC8A 1W5TA 3UMMA 2Y21A 4QNMA 5F3WA 3AFHA 5FTJA 3CF0A 4GMQA 3ZC7B 4X64M 3UGJA 4GKKM 2H1RA 4Z8XA 4FVMA 3SARA 3QAUA 1L8QA 3W0FA 3GLGA 2CEAA 1NJGA 3L25A 4DUZM 1GVNA 4B3RM 4GC9A 5EXPA 4L16A 1QAOA 1GL7A 4MM3B 2XZFA 3SASA 4IBIA 3DFZA 3VK7A 2V1UA 4JXJA 3KDSE 3L29A 1FNNA 2KEBA 4CHTB 1T3TA 5C1BA 1QZMA 3KW6A 1EE8A 3GRVA 5EP4A 1N32M 4B08A 2UXBM 3SYKA 4CISA 3KP1E 2ZBKB 1N75A 1R2YA 1G59A 3THGA 4PCZA 5JI2E 3SC3A 3GLIB 1KFVA 1DGHB 1R2ZA 4LGMA 3KVWA 2UUCM 2I7NA 4AI6A 1OFIA 4KO8A 1PJJA 3KFUG 4KODA 3DA1A 3RGPA 1TH4A 1N33M 1WXQA 3SYLA 1LV7A 4LRSA 5FTNA 3Q8XA 3GP1A 4RNAA 5ITQA 3VFDA 3MK6A 3IG8A 3L2AA 4AG6A 2NQ8C 4ZPXA 4LCBA 4IBFA 4L4UA 1IXSB 2A5YB 2BNKA 3ZCBB 1J5EM 3TPZA 1E32A 1I94M 2R65A 2RGOA 2R62A 3U6MA 1SXJA 4JN6A 1H6UA 2P5TA 3GPPA 2D7GA 2EUCA 4R3DA 3SBJA 4M9XA 7CATA 1IXZA 4IBDA 5EP2A 4BLCA 3U61A 3J2PB 2Y20A 5IZ7D 2X49A 2UU9M 5KQ8A 2D7HA 2F5PA 1HT1E 4I5SA 4AW4A 3E4RA 2G8LA 1N36M 5IWAM 4M9SA 4NL4H 3LQRA 4I4LA 4JI0M 4RF0A 3SATA 3VDUA 4GC5A 4KLNA 5FLXS 3FKEA 4LZZA 3JR4A 3NWLA 1SXJC 2Y0QA 4DV7M 2VQEM 2OPFA 1OFHA 2I7PA 4B7GA 2CHVA 2XZUA 3U60B 4FWGA 2OQ4A 5E26A 5IT9S 4IBBA 3A42A 3T38A 4AQYM 1ORYB 3PVSA 3TWMA 1JR3D 3M7GA 1N78A 1DGFA 3AJIB 1QVRA 5FSWA 2F5SA 1DO0A 2M60A 3HHYA 2KRKA 4IIWA 4QNRA 3C58A 3FUVA 1NY5A 1QYRA 2LH0A 3JAMS 4LG2A 4RF1A 2BJWA 4OVZB 1XNQM 4B7HA 5C18A 3GQ5A 5KPRA 4OW0A 3GQ3A 2YR0A 4B3MM 4WW0A 5EJCA 4LY6A 1Z59A 3FTCA 4DV0M 3GPXA 2L09A 1GLNA 2HCBA 4LJ6A 5ITRA 2CE7A 4KHPM 3VKHA 4IBEA 5JI3E 3GLHB 3DZDA 3KOWE 2L7IA 2XFTA 4M9ZA 4QHTA 4NSRA 3I4VA 3CF6E 2XH9A 3L26A 3FYCA 2X4AA 2CV0A 2ZANA 4LJ7A 3U6LA 4JI4M 2W82A 4AZFA 2XSZD 4D82A 4G4RA 3IG5A 3KSXA 4M0WA 4PD2A 2G5GX 3U6OA 1PM5A 3EIHA 4FW9A 4FCTA 4L15A 4D81A 3GLFA 2FNAA 1K3WA 2DVWB 2ZAOA 1IN8A 3HJQA 2R18A 2ZM6M 4QOZC 2Z4SA 3BOSA 2QBYA 8CATA 1L2BA 3M0EA 4AKHA 2Z4RA 4YHHM 3T1YM 1NHWC 3FD9A 4HL4A 2YFQA 2K47A 4L78A 1Z5CA 4JI3M 5ITUA 5EXTA 4DR2M 3PNYA 1IY2A 5GKNA 4M0DA 5BR8M 1HNXM 2HHHM 3T15A 4A3VB 4LF9M 3FYDA 1XMOM 1Z6TA 2M5ZA 4IJEA 1VDDA 5EXSA 4NOOB 2UUBM 2QCUA 3R8FA 4LFBM 2KW0A 2VIIA 3AKZA 4DV2M 4NRWA 1IQPA 4LFAM 3U5ZA 4NSOB 1IBMM 3K8ZA 1PJIA 1DGGA 1Q3CA 3AL0C 2DWZB 3E9SA 3VDPA 1TDHA 4JI5M 5H37D 4IBGA 2DWNA 4JI8M 1UM8A 1XXHA 1D2NA 4DV1M 1K82A 3SAVA 2AHMA 1Q3BA 5FTLA 1TH2A 3MHVC 2DWLA 4LF6M 3UZUA 4NXMM 2R45A 1L2DA 2F5OA 2FOIC 3U6CA 4QHSA 1YUBA 2CHQA 5ITXA 2JA2A 4AG5A 1E9SA 3B9PA 4L8RC 4DV5M 1NSFA 3KS4A 2O5RA 2C99A 4G4NA 3GO8A 2KA6B 4LJ4A 1J09A 2KXEA 4DR3M 1JR3A 5EQTA 4GHAA 3FTFA 1X37A 3PXGA 2KRUA 3DOAA 3FUUA 4P16A 4R7GA 3GQ4A 3A98B 1XNRM 1MX0A 4DR6M 1E94E 1XWIA 3KS8A 4B3TM 2XFSA 5DNYA 1G3IA 1IBKM 3CTWB 4QOSA 4LF5M 5KQDA 3FTDA 3J81S 4LJ9A 3K92A 3LQQA 3HGIA 5FTMA 3SHGB 3KSJA 3GLIA 1DGHA 3HHWA 4LGYA 2LXEA 2BJVA 3J27B 1NHGC 3GRUA 5LMUM 3U6PA 4IBKA 5A2QS 1S3SA 1IXRC 2QPAA 3HHZA 1SXJE 5KO3A 1HT2E 3SAUA 2XGNA 1TH3A 1C1KA 2ERCA 3GLGB 3J7BA 4GITA 4TUWA 3NBIA 2Q2EB 3ILKA 1NY6A 2VQFM 2DWMA 2EO2A 2L7HA 1HQYE 4W5WA 2LWXA 2DXIA 4WURA 3U6EA 4OU7A 3SMSA 2X8AA 3J7AS 5DYGA 3CF2A 4FCWA 1QAQA 3LVVA 1Z5AA 1I4WA 2HKJA 3HU3A 3SAWA 4BB9A 1JQJC 2DZNB 3UK6A 2LNHC 2XF3A 4DR4M 4OX9M 2F5NA 3AOEA 2KZUA 4I81A 3RE8A 1DO2A 4GHLA 3HKPA 3I4YA 3FTEA 1YSYA 3VK8A 3LVWA 4CGYB 3SMPA 2C9OA 2QZ4A 2J7NA 3U60A 3TQSA 2DHRA 4IJFA 3SFZA 3WHLA 3GRRA 3H4MA 4NRVA 1IN6A 4LF7M 4LJ8A 1QANA 3U6SA 4GKJM 4I8OA 4JV5M 1Q39A 1W5SA 3AOEC 3K2LA 4MGHA 1G41A 5KPZA 4LF8M 2F4VM 2FFJA 4K0KM 4OVZA 4DV4M 1SXJB 1XMQM 3SHFA 3PNVA 3TWKA 5FTKA 3GRYA 4DUYM 1N77A 4JI6M 4DR1M 4FWDA 3D8LA 4JYAM 2UXDM 3U61B 1IY1A 2DZOB 4EIWA 4G4OA 2F5QA 3FUWA 3TE6A 4Z6YA 1KYIA 3RFWA 5E6JA 2R4JA 1IY0A 1NNUC 4MGIE 2RKOA 3GLHA 2UXCM 2EA0A 3TL4X 1HR0M 4JI2M 1R6BX 5DYIA 4GIPA 3K1JA 4D80A 3LMMA 3JR5A 1XHBA 1R7RA 4FWHA 4MGZE 1L1TA 2L6OA 2CFOA 4IBCA 4S12A 4NXNM 4LF4M 2J7OA 4II7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOW E;  3KP0 E;  3KOY E;  3KOZ E;  3KP1 E;  3KOX E; 
#chains in the Genus database with same CATH topology
 5EP3 A;  3R9X B;  3L27 A;  2CV2 A;  2FE8 A;  3PFI A;  4X65 M;  1TDZ A;  4DR5 M;  4DV6 M;  3GPY A;  1NNJ A;  4B3S M;  3OTO M;  4MGK E;  2C5R A;  3KXE C;  4PDI A;  5ITY A;  2C9C A;  1KSF X;  4JI1 M;  4G4Q A;  1GO5 A;  4B7F A;  3BXW A;  2HL7 A;  1HNZ M;  3HJ8 A;  2KHH A;  4GH9 A;  3RGS A;  4YY3 M;  3AV0 A;  4MB7 A;  3T1H M;  4PT5 A;  1GJS A;  1OJL A;  2QEN A;  2UUA M;  3C3E A;  1L2C A;  1OIZ A;  2LVP C;  3WHK A;  2RGH A;  1GJT A;  1PJT A;  4LJ5 A;  3QWL A;  4LRT A;  1VEG A;  4X66 M;  5ITT A;  1VEJ A;  1Z5B A;  1NJF A;  2R0I A;  2YNM D;  3VLF B;  3U6Q A;  1HNW M;  1IM2 A;  4DR7 M;  1IBL M;  3I01 M;  1XXH E;  2LBC A;  2XLJ A;  3A45 A;  3TWL A;  4XBO A;  4HLQ A;  2V1C A;  4LFC M;  4MGY E;  1IN7 A;  4G6Z A;  3EIE A;  1ZMU A;  3FRH A;  1ZQ9 A;  4FD2 A;  3KOX E;  3MJ5 A;  1E9R A;  4P17 A;  4REZ A;  1GL6 A;  3QYE A;  5ITX E;  2ZAM A;  4DV3 M;  3I51 A;  1FJG M;  1IN5 A;  1J7K A;  1TGU A;  1BVS A;  2QSF X;  3LCV B;  1N34 M;  2R46 A;  4GRI A;  5BPV A;  1GKI A;  4LZJ A;  4MH0 E;  1OAO C;  2QP9 X;  2YQZ A;  2XSZ A;  3GLF B;  1IFY A;  3J80 S;  1JR3 E;  1PGY A;  2R4E A;  3D8B A;  3HJS A;  1DGB A;  3U6D A;  1G8P A;  5LMN M;  3VKG A;  1SXJ D;  2C98 A;  3KOY E;  2GQF A;  2QBY B;  4BBA A;  3UJN A;  1YE9 A;  2ZTD A;  2C96 A;  2CP8 A;  3HWS A;  1L1Z A;  4X62 M;  3FUX A;  3GPU A;  2KZS A;  2CUZ A;  3A46 A;  3QYB A;  3FUT A;  2D7E A;  3Q8G A;  5DFL A;  1HQC A;  4PDG A;  2XEP A;  5L8R F;  2DZL A;  2MH8 A;  5KPT A;  1A5T A;  2H5X A;  5EP1 A;  4XK8 F;  1K3X A;  5IRE B;  3HU1 A;  4AKI A;  2Z7J A;  3GLI E;  3U5Z B;  1MU5 A;  1QAM A;  1G71 A;  1ZAE A;  4IBJ A;  4FCV A;  2Z3X A;  2DAE A;  2LVA A;  3HHX A;  3KP0 E;  3W0L B;  1G4A E;  3HU2 A;  1NVM A;  1QQW A;  4LJA A;  3ZH9 B;  5EXX A;  2E5L M;  4ITQ A;  2CHG A;  3AOG A;  4DBG B;  4AKG A;  2KNV A;  1XXH B;  3L28 A;  3KOZ E;  2CV1 A;  1IN4 A;  1WGL A;  2Y0T A;  3M6A A;  4JI7 M;  4XGI A;  2V6Z M;  1XC8 A;  1CUK A;  1SG9 A;  1GAB A;  2L2D A;  1W5T A;  3UMM A;  2Y21 A;  2JY7 A;  4QNM A;  5F3W A;  1TTE A;  3AFH A;  5FTJ A;  3CF0 A;  4GMQ A;  3ZC7 B;  4X64 M;  3UGJ A;  4GKK M;  2H1R A;  4Z8X A;  4FVM A;  3SAR A;  3QAU A;  1L8Q A;  3W0F A;  3GLG A;  2CEA A;  1NJG A;  2VF8 A;  4DUZ M;  2N35 A;  3L25 A;  1GVN A;  2HAK A;  4B3R M;  4GC9 A;  2APL A;  5EXP A;  3ZQJ A;  4L16 A;  1QAO A;  2K9D A;  2R44 A;  1GL7 A;  4MM3 B;  4Q7J A;  2XZF A;  2QQ8 A;  4IBI A;  3DFZ A;  3VK7 A;  2V1U A;  4JXJ A;  3SAS A;  3KDS E;  3L29 A;  1FNN A;  2KEB A;  4CHT B;  1T3T A;  1WHC A;  1QUS A;  5C1B A;  1QZM A;  3KW6 A;  1EE8 A;  1NV8 A;  1HJP A;  3GRV A;  5EP4 A;  2JUJ A;  1N32 M;  4B08 A;  2UXB M;  3H4J A;  3SYK A;  4CIS A;  3KP1 E;  2CRU A;  3E21 A;  2ZBK B;  2JWS A;  1N75 A;  1R2Y A;  1VDL A;  1G59 A;  3THG A;  4PCZ A;  5JI2 E;  1WGN A;  3SC3 A;  3GLI B;  1KFV A;  1DGH B;  1R2Z A;  4LGM A;  3KVW A;  2UUC M;  2I7N A;  4AI6 A;  1OFI A;  4KO8 A;  1PJJ A;  4CJ6 A;  3KFU G;  4KOD A;  3DA1 A;  3RGP A;  1TH4 A;  1N33 M;  1WXQ A;  3SYL A;  1LV7 A;  4LRS A;  5FTN A;  3Q8X A;  3GP1 A;  2MGW A;  4RNA A;  5ITQ A;  3VFD A;  1EFU B;  3B7N A;  3MK6 A;  3IG8 A;  3L2A A;  2VF7 A;  3FRI A;  2B3T A;  4AG6 A;  1T6O A;  2NQ8 C;  2WSC F;  4ZPX A;  1EIJ A;  4LCB A;  3NBX X;  4IBF A;  4L4U A;  1IXS B;  2A5Y B;  2BNK A;  3ZCB B;  1J5E M;  3TPZ A;  2EKF A;  1E32 A;  1I94 M;  2R65 A;  2RGO A;  2R62 A;  3U6M A;  1SXJ A;  3GLH E;  4JN6 A;  1H6U A;  2P5T A;  3GPP A;  2D7G A;  2EUC A;  4R3D A;  3SBJ A;  4M9X A;  4CIZ A;  7CAT A;  1IXZ A;  4IBD A;  5EP2 A;  2GNO A;  4BLC A;  2CWB A;  3U61 A;  3J2P B;  2Y20 A;  5IZ7 D;  2JY5 A;  2X49 A;  2UU9 M;  5KQ8 A;  2D7H A;  2LHC A;  1HT1 E;  2F5P A;  4I5S A;  4AW4 A;  3E4R A;  2G8L A;  1N36 M;  5IWA M;  4M9S A;  4NL4 H;  1OIP A;  3LQR A;  4I4L A;  2OOB A;  4RF0 A;  2L4F A;  4JI0 M;  3SAT A;  3VDU A;  4GC5 A;  4KLN A;  3E46 A;  5FLX S;  3FKE A;  4LZZ A;  3K9O A;  3JR4 A;  2DKL A;  3NWL A;  1SXJ C;  2Y0Q A;  4DV7 M;  2VQE M;  2MR9 A;  2OPF A;  1OFH A;  2I7P A;  4B7G A;  2CHV A;  2XZU A;  1WJ7 A;  3U60 B;  4FWG A;  2OQ4 A;  5E26 A;  5IT9 S;  4IBB A;  3A42 A;  3T38 A;  4AQY M;  1ORY B;  3PVS A;  3TWM A;  1JR3 D;  3M7G A;  1N78 A;  1DGF A;  3AJI B;  1QVR A;  5FSW A;  2F5S A;  1DO0 A;  1RU3 A;  3FE3 A;  2KNZ A;  2M60 A;  3B7Q A;  1P3Q Q;  3HHY A;  2KRK A;  4IIW A;  4QNR A;  3C58 A;  3FUV A;  1NY5 A;  1QYR A;  2LH0 A;  3JAM S;  1D0K A;  4LG2 A;  4RF1 A;  2BJW A;  4OVZ B;  1XNQ M;  4B7H A;  5C18 A;  3GQ5 A;  2ZTC A;  5KPR A;  4OW0 A;  3GQ3 A;  2LTU A;  2JY6 B;  2YR0 A;  2K6B A;  4WW0 A;  2DEN A;  4B3M M;  3C3D A;  5EJC A;  4LY6 A;  1Z59 A;  3FTC A;  4DV0 M;  3GPX A;  2L09 A;  1GLN A;  2HCB A;  4LJ6 A;  1VG5 A;  5ITR A;  1YLA A;  2CE7 A;  4KHP M;  3VKH A;  4IBE A;  5JI3 E;  4UN2 B;  3GLH B;  1PJS A;  2G3Q A;  3DZD A;  2L7I A;  1Q02 A;  2XFT A;  3KOW E;  4M9Z A;  4QHT A;  4NSR A;  3I4V A;  1V92 A;  3CF6 E;  2XH9 A;  3I04 M;  3L26 A;  3FYC A;  1MJG M;  1V34 A;  2LVO C;  2X4A A;  2CV0 A;  2ZAN A;  3F92 A;  2OO9 A;  4LJ7 A;  3U6L A;  2W82 A;  4JI4 M;  4AZF A;  2XSZ D;  4GEW A;  2LVN C;  2O01 F;  3IG5 A;  4D82 A;  4G4R A;  3KSX A;  3W67 A;  4M0W A;  4PD2 A;  3MMP A;  4L6V 6;  2G5G X;  2WZJ A;  4ANR A;  3U6O A;  1PM5 A;  3EIH A;  4FW9 A;  4HEO A;  4FCT A;  4L15 A;  4D81 A;  3GLF A;  2FNA A;  1K3W A;  1UFZ A;  2DVW B;  2MJ5 B;  2ZAO A;  1IN8 A;  3HJQ A;  2R18 A;  2ZM6 M;  4QOZ C;  2FS1 A;  2FH0 A;  2Z4S A;  3BOS A;  2QBY A;  8CAT A;  1L2B A;  3M0E A;  4AKH A;  2Z4R A;  4YHH M;  3T1Y M;  1NHW C;  3FD9 A;  3V76 A;  4HL4 A;  2YFQ A;  2K47 A;  4G3O A;  4L78 A;  1Z5C A;  4JI3 M;  5ITU A;  5EXT A;  4DR2 M;  3PNY A;  1IY2 A;  5GKN A;  4M0D A;  5BR8 M;  1HNX M;  2HHH M;  3T15 A;  4A3V B;  4LF9 M;  1TF0 B;  2WSF F;  3FYD A;  1XMO M;  1Z6T A;  2M5Z A;  4IJE A;  1VDD A;  5EXS A;  4NOO B;  3IEC A;  2UUB M;  2QCU A;  3R8F A;  4LFB M;  2KW0 A;  2VII A;  3AKZ A;  2Z8Y M;  4DV2 M;  4NRW A;  1IQP A;  4LFA M;  3U5Z A;  4NSO B;  1IBM M;  3K8Z A;  1PJI A;  1LTM A;  1DGG A;  1Q3C A;  3AL0 C;  2DWZ B;  3E9S A;  3VDP A;  1TDH A;  4JI5 M;  5H37 D;  4IBG A;  2DWN A;  4JI8 M;  1UM8 A;  1XXH A;  1D2N A;  4DV1 M;  1K82 A;  2DAM A;  3SAV A;  2AHM A;  1AIP C;  1Q3B A;  3B89 A;  5FTL A;  1TH2 A;  3MHV C;  3GLG E;  2DWL A;  3UZU A;  4LF6 M;  4NXM M;  2R45 A;  3IHP A;  1L2D A;  2F5O A;  2FOI C;  2O25 A;  3U6C A;  1OTR A;  1QUT A;  4QHS A;  1YUB A;  2CHQ A;  5ITX A;  2JA2 A;  3HZJ A;  4AG5 A;  4RKU F;  1E9S A;  3B9P A;  4L8R C;  1D0M A;  4DV5 M;  1PRB A;  1NSF A;  2DAK A;  2DHY A;  3KS4 A;  2O5R A;  2C99 A;  4G4N A;  3GO8 A;  1QDR A;  2MRO B;  2KA6 B;  4LJ4 A;  1J09 A;  2KXE A;  2KNA A;  4DR3 M;  1JR3 A;  5EQT A;  4GHA A;  3FTF A;  1XB2 B;  1X37 A;  2QNJ A;  3PXG A;  2KRU A;  2JP7 A;  3DOA A;  1VQ1 A;  4NC6 A;  3FUU A;  4P16 A;  4R7G A;  3GQ4 A;  3A98 B;  2KDL A;  2JZ0 A;  3BBZ A;  4Y28 F;  1MX0 A;  1XNR M;  4DR6 M;  1E94 E;  1XWI A;  3KS8 A;  4B3T M;  2XFS A;  5DNY A;  1G3I A;  1IBK M;  3CTW B;  1ZV1 A;  4QOS A;  4LF5 M;  5KQD A;  3FTD A;  3J81 S;  4LJ9 A;  1T43 A;  3K92 A;  3LQQ A;  1JB0 F;  1C7Y A;  3HGI A;  2BWE A;  2DAG A;  1ZMV A;  4F2L A;  5FTM A;  2EKK A;  3SHG B;  3KSJ A;  1QZE A;  2VDB B;  3GLI A;  1DGH A;  3HHW A;  4LGY A;  2LXE A;  3B74 A;  2BJV A;  3J27 B;  1NHG C;  3GRU A;  5LMU M;  3U6P A;  2JY8 A;  3C9P A;  4IBK A;  4WP2 A;  1PJQ A;  5A2Q S;  1S3S A;  1IXR C;  2QPA A;  3HHZ A;  2LVQ D;  3LCU A;  1VEK A;  1SXJ E;  5KO3 A;  1HT2 E;  3SAU A;  2JXN A;  2XGN A;  1TH3 A;  3K9P A;  1C1K A;  2ERC A;  3GLG B;  2L4E A;  3J7B A;  4GIT A;  4TUW A;  3NBI A;  2EJS A;  1WR1 B;  1MN3 A;  2JNH A;  3T6P A;  2Q2E B;  1QDT A;  2HWJ A;  1NY6 A;  2J5Y A;  3ILK A;  2VQF M;  1R4G A;  2DWM A;  1OKS A;  2EO2 A;  2L7H A;  1HQY E;  1IXS A;  1OQY A;  4W5W A;  2LWX A;  2DXI A;  4WUR A;  3U6E A;  4OU7 A;  3SMS A;  2X8A A;  3J7A S;  3LW5 F;  5DYG A;  2DNA A;  3W68 A;  3CF2 A;  4FCW A;  2WSE F;  1QAQ A;  3LVV A;  1Z5A A;  1F4I A;  1I4W A;  2HKJ A;  3HU3 A;  3SAW A;  4BB9 A;  1JQJ C;  2DZN B;  3UK6 A;  2LNH C;  2XF3 A;  4DR4 M;  4OX9 M;  2F5N A;  3AOE A;  3CGW A;  2RRU A;  2KZU A;  3B7Z A;  4I81 A;  3RE8 A;  1DO2 A;  3HY5 A;  4GHL A;  3HKP A;  3I4Y A;  2BWB A;  3FTE A;  1YSY A;  1NV9 A;  1ZMW A;  3VK8 A;  3LVW A;  4CGY B;  3SMP A;  2C9O A;  2R6F A;  1OAI A;  2QZ4 A;  2J7N A;  3U60 A;  1D0L A;  3TQS A;  2DHR A;  4IJF A;  2LHG A;  3SFZ A;  3WHL A;  4R71 A;  3GRR A;  3HX3 A;  2JZ1 A;  3H4M A;  1DV0 A;  4NRV A;  1IN6 A;  4LF7 M;  4LJ8 A;  1QAN A;  3U6S A;  4GKJ M;  4I8O A;  4JV5 M;  1Q39 A;  1W5S A;  3AOE C;  3K2L A;  4MGH A;  1G41 A;  5KPZ A;  4LF8 M;  2F4V M;  2FFJ A;  4K0K M;  4OVZ A;  4DV4 M;  1SXJ B;  1XMQ M;  3SHF A;  3PNV A;  4KT0 F;  4F1I A;  3TWK A;  5FTK A;  3GRY A;  4DUY M;  1N77 A;  4JI6 M;  4DR1 M;  4FWD A;  2K0B X;  3D8L A;  1R5L A;  4JYA M;  1TR8 A;  2UXD M;  3U61 B;  1IY1 A;  2DZO B;  4EIW A;  4G4O A;  2F5Q A;  3FUW A;  3TE6 A;  1AUA A;  4Z6Y A;  1KYI A;  3RFW A;  1V33 A;  2QHO B;  5E6J A;  2R4J A;  1IY0 A;  1NNU C;  4MGI E;  2OOA A;  2RKO A;  3GLH A;  2UXC M;  2DAI A;  3TL4 X;  2EA0 A;  1HR0 M;  4JI2 M;  2DI0 A;  1R6B X;  5DYI A;  4GIP A;  3K1J A;  4D80 A;  3GLF E;  1NO1 A;  3LMM A;  3JR5 A;  1XHB A;  1R7R A;  4FWH A;  4MGZ E;  1L1T A;  2L6O A;  2CFO A;  4IBC A;  4S12 A;  4NXN M;  1WIV A;  4LF4 M;  1Y8G A;  2J7O A;  4II7 A; 
#chains in the Genus database with same CATH homology
 5EP3 A;  3R9X B;  3L27 A;  2CV2 A;  2FE8 A;  3PFI A;  4X65 M;  1TDZ A;  4DR5 M;  4DV6 M;  3GPY A;  1NNJ A;  4B3S M;  3OTO M;  4MGK E;  2C5R A;  3KXE C;  4PDI A;  5ITY A;  2C9C A;  1KSF X;  4JI1 M;  4G4Q A;  4B7F A;  2HL7 A;  1HNZ M;  3HJ8 A;  4GH9 A;  3RGS A;  4YY3 M;  3AV0 A;  4MB7 A;  3T1H M;  4PT5 A;  1OJL A;  2QEN A;  2UUA M;  1L2C A;  3WHK A;  2RGH A;  4LJ5 A;  3QWL A;  4LRT A;  4X66 M;  5ITT A;  1Z5B A;  1NJF A;  2YNM D;  3VLF B;  3U6Q A;  4DR7 M;  1HNW M;  1IM2 A;  1IBL M;  2XLJ A;  3A45 A;  3TWL A;  4XBO A;  4HLQ A;  2V1C A;  4LFC M;  4MGY E;  1IN7 A;  4G6Z A;  3EIE A;  1ZQ9 A;  4FD2 A;  3KOX E;  3MJ5 A;  1E9R A;  4REZ A;  1GL6 A;  5ITX E;  4DV3 M;  2ZAM A;  1FJG M;  3I51 A;  1IN5 A;  1J7K A;  1TGU A;  1N34 M;  2R46 A;  4GRI A;  5BPV A;  1GKI A;  4LZJ A;  4MH0 E;  2QP9 X;  2YQZ A;  2XSZ A;  3GLF B;  3J80 S;  2R4E A;  3D8B A;  3HJS A;  1DGB A;  3U6D A;  1G8P A;  5LMN M;  3VKG A;  1SXJ D;  2C98 A;  3KOY E;  2QBY B;  4BBA A;  3UJN A;  1YE9 A;  2C96 A;  3HWS A;  1L1Z A;  4X62 M;  3FUX A;  3GPU A;  2KZS A;  2CUZ A;  3A46 A;  3FUT A;  2D7E A;  1HQC A;  4PDG A;  2XEP A;  5KPT A;  5EP1 A;  1K3X A;  5IRE B;  3HU1 A;  4AKI A;  2Z7J A;  3U5Z B;  1MU5 A;  1QAM A;  1ZAE A;  4IBJ A;  4FCV A;  2Z3X A;  3HHX A;  3KP0 E;  3W0L B;  1G4A E;  3HU2 A;  1NVM A;  1QQW A;  4LJA A;  3ZH9 B;  5EXX A;  2E5L M;  4ITQ A;  2CHG A;  3AOG A;  4AKG A;  1XXH B;  3L28 A;  3KOZ E;  2CV1 A;  1IN4 A;  2Y0T A;  3M6A A;  4JI7 M;  4XGI A;  2V6Z M;  1XC8 A;  1W5T A;  3UMM A;  2Y21 A;  4QNM A;  5F3W A;  3AFH A;  5FTJ A;  3CF0 A;  4GMQ A;  3ZC7 B;  4X64 M;  3UGJ A;  4GKK M;  2H1R A;  4Z8X A;  4FVM A;  3SAR A;  3QAU A;  1L8Q A;  3W0F A;  3GLG A;  2CEA A;  1NJG A;  3L25 A;  4DUZ M;  1GVN A;  4B3R M;  4GC9 A;  5EXP A;  4L16 A;  1QAO A;  1GL7 A;  4MM3 B;  2XZF A;  3SAS A;  4IBI A;  3DFZ A;  3VK7 A;  2V1U A;  4JXJ A;  3KDS E;  3L29 A;  1FNN A;  2KEB A;  4CHT B;  1T3T A;  5C1B A;  1QZM A;  3KW6 A;  1EE8 A;  3GRV A;  5EP4 A;  1N32 M;  4B08 A;  2UXB M;  3SYK A;  4CIS A;  3KP1 E;  2ZBK B;  1N75 A;  1R2Y A;  1G59 A;  3THG A;  4PCZ A;  5JI2 E;  3SC3 A;  3GLI B;  1KFV A;  1DGH B;  1R2Z A;  4LGM A;  3KVW A;  2UUC M;  2I7N A;  4AI6 A;  1OFI A;  4KO8 A;  1PJJ A;  3KFU G;  4KOD A;  3DA1 A;  3RGP A;  1TH4 A;  1N33 M;  1WXQ A;  3SYL A;  1LV7 A;  4LRS A;  5FTN A;  3Q8X A;  3GP1 A;  4RNA A;  5ITQ A;  3VFD A;  3MK6 A;  3IG8 A;  3L2A A;  4AG6 A;  2NQ8 C;  4ZPX A;  4LCB A;  4IBF A;  4L4U A;  1IXS B;  2A5Y B;  2BNK A;  3ZCB B;  1J5E M;  3TPZ A;  1E32 A;  1I94 M;  2R65 A;  2RGO A;  2R62 A;  3U6M A;  1SXJ A;  4JN6 A;  1H6U A;  2P5T A;  3GPP A;  2D7G A;  2EUC A;  4R3D A;  3SBJ A;  4M9X A;  7CAT A;  1IXZ A;  4IBD A;  5EP2 A;  4BLC A;  3U61 A;  3J2P B;  2Y20 A;  5IZ7 D;  2X49 A;  2UU9 M;  5KQ8 A;  2D7H A;  2F5P A;  1HT1 E;  4I5S A;  4AW4 A;  3E4R A;  2G8L A;  1N36 M;  5IWA M;  4M9S A;  4NL4 H;  3LQR A;  4I4L A;  4JI0 M;  4RF0 A;  3SAT A;  3VDU A;  4GC5 A;  4KLN A;  5FLX S;  3FKE A;  4LZZ A;  3JR4 A;  3NWL A;  1SXJ C;  2Y0Q A;  4DV7 M;  2VQE M;  2OPF A;  1OFH A;  2I7P A;  4B7G A;  2CHV A;  2XZU A;  3U60 B;  4FWG A;  2OQ4 A;  5E26 A;  5IT9 S;  4IBB A;  3A42 A;  3T38 A;  4AQY M;  1ORY B;  3PVS A;  3TWM A;  1JR3 D;  3M7G A;  1N78 A;  1DGF A;  3AJI B;  1QVR A;  5FSW A;  2F5S A;  1DO0 A;  2M60 A;  3HHY A;  2KRK A;  4IIW A;  4QNR A;  3C58 A;  3FUV A;  1NY5 A;  1QYR A;  2LH0 A;  3JAM S;  4LG2 A;  4RF1 A;  2BJW A;  4OVZ B;  1XNQ M;  4B7H A;  5C18 A;  3GQ5 A;  5KPR A;  4OW0 A;  3GQ3 A;  2YR0 A;  4B3M M;  4WW0 A;  5EJC A;  4LY6 A;  1Z59 A;  3FTC A;  4DV0 M;  3GPX A;  2L09 A;  1GLN A;  2HCB A;  4LJ6 A;  5ITR A;  2CE7 A;  4KHP M;  3VKH A;  4IBE A;  5JI3 E;  3GLH B;  3DZD A;  3KOW E;  2L7I A;  2XFT A;  4M9Z A;  4QHT A;  4NSR A;  3I4V A;  3CF6 E;  2XH9 A;  3L26 A;  3FYC A;  2X4A A;  2CV0 A;  2ZAN A;  4LJ7 A;  3U6L A;  4JI4 M;  2W82 A;  4AZF A;  2XSZ D;  4D82 A;  4G4R A;  3IG5 A;  3KSX A;  4M0W A;  4PD2 A;  2G5G X;  3U6O A;  1PM5 A;  3EIH A;  4FW9 A;  4FCT A;  4L15 A;  4D81 A;  3GLF A;  2FNA A;  1K3W A;  2DVW B;  2ZAO A;  1IN8 A;  3HJQ A;  2R18 A;  2ZM6 M;  4QOZ C;  2Z4S A;  3BOS A;  2QBY A;  8CAT A;  1L2B A;  3M0E A;  4AKH A;  2Z4R A;  4YHH M;  3T1Y M;  1NHW C;  3FD9 A;  4HL4 A;  2YFQ A;  2K47 A;  4L78 A;  1Z5C A;  4JI3 M;  5ITU A;  5EXT A;  4DR2 M;  3PNY A;  1IY2 A;  5GKN A;  4M0D A;  5BR8 M;  1HNX M;  2HHH M;  3T15 A;  4A3V B;  4LF9 M;  3FYD A;  1XMO M;  1Z6T A;  2M5Z A;  4IJE A;  1VDD A;  5EXS A;  4NOO B;  2UUB M;  2QCU A;  3R8F A;  4LFB M;  2KW0 A;  2VII A;  3AKZ A;  4DV2 M;  4NRW A;  1IQP A;  4LFA M;  3U5Z A;  4NSO B;  1IBM M;  3K8Z A;  1PJI A;  1DGG A;  1Q3C A;  3AL0 C;  2DWZ B;  3E9S A;  3VDP A;  1TDH A;  4JI5 M;  5H37 D;  4IBG A;  2DWN A;  4JI8 M;  1UM8 A;  1XXH A;  1D2N A;  4DV1 M;  1K82 A;  3SAV A;  2AHM A;  1Q3B A;  5FTL A;  1TH2 A;  3MHV C;  2DWL A;  4LF6 M;  3UZU A;  4NXM M;  2R45 A;  1L2D A;  2F5O A;  2FOI C;  3U6C A;  4QHS A;  1YUB A;  2CHQ A;  5ITX A;  2JA2 A;  4AG5 A;  1E9S A;  3B9P A;  4L8R C;  4DV5 M;  1NSF A;  3KS4 A;  2O5R A;  2C99 A;  4G4N A;  3GO8 A;  2KA6 B;  4LJ4 A;  1J09 A;  2KXE A;  4DR3 M;  1JR3 A;  5EQT A;  4GHA A;  3FTF A;  1X37 A;  3PXG A;  2KRU A;  3DOA A;  3FUU A;  4P16 A;  4R7G A;  3GQ4 A;  3A98 B;  1XNR M;  1MX0 A;  4DR6 M;  1E94 E;  1XWI A;  3KS8 A;  4B3T M;  2XFS A;  5DNY A;  1G3I A;  1IBK M;  3CTW B;  4QOS A;  4LF5 M;  5KQD A;  3FTD A;  3J81 S;  4LJ9 A;  3K92 A;  3LQQ A;  3HGI A;  5FTM A;  3SHG B;  3KSJ A;  3GLI A;  1DGH A;  3HHW A;  4LGY A;  2LXE A;  2BJV A;  3J27 B;  1NHG C;  3GRU A;  5LMU M;  3U6P A;  4IBK A;  5A2Q S;  1S3S A;  1IXR C;  2QPA A;  3HHZ A;  1SXJ E;  5KO3 A;  1HT2 E;  3SAU A;  2XGN A;  1TH3 A;  1C1K A;  2ERC A;  3GLG B;  3J7B A;  4GIT A;  4TUW A;  3NBI A;  2Q2E B;  3ILK A;  1NY6 A;  2VQF M;  2DWM A;  2EO2 A;  2L7H A;  1HQY E;  4W5W A;  2LWX A;  2DXI A;  4WUR A;  3U6E A;  4OU7 A;  3SMS A;  2X8A A;  3J7A S;  5DYG A;  3CF2 A;  4FCW A;  1QAQ A;  3LVV A;  1Z5A A;  1I4W A;  2HKJ A;  3HU3 A;  3SAW A;  4BB9 A;  1JQJ C;  2DZN B;  3UK6 A;  2LNH C;  2XF3 A;  4DR4 M;  4OX9 M;  2F5N A;  3AOE A;  2KZU A;  4I81 A;  3RE8 A;  1DO2 A;  4GHL A;  3HKP A;  3I4Y A;  3FTE A;  1YSY A;  3VK8 A;  3LVW A;  4CGY B;  3SMP A;  2C9O A;  2QZ4 A;  2J7N A;  3U60 A;  3TQS A;  2DHR A;  4IJF A;  3SFZ A;  3WHL A;  3GRR A;  3H4M A;  4NRV A;  1IN6 A;  4LF7 M;  4LJ8 A;  1QAN A;  3U6S A;  4GKJ M;  4I8O A;  4JV5 M;  1Q39 A;  1W5S A;  3AOE C;  3K2L A;  4MGH A;  1G41 A;  5KPZ A;  4LF8 M;  2F4V M;  2FFJ A;  4K0K M;  4OVZ A;  4DV4 M;  1SXJ B;  1XMQ M;  3SHF A;  3PNV A;  3TWK A;  5FTK A;  3GRY A;  4DUY M;  1N77 A;  4JI6 M;  4DR1 M;  4FWD A;  3D8L A;  4JYA M;  2UXD M;  3U61 B;  1IY1 A;  2DZO B;  4EIW A;  4G4O A;  2F5Q A;  3FUW A;  3TE6 A;  4Z6Y A;  1KYI A;  3RFW A;  5E6J A;  2R4J A;  1IY0 A;  1NNU C;  4MGI E;  2RKO A;  3GLH A;  2UXC M;  2EA0 A;  3TL4 X;  1HR0 M;  4JI2 M;  1R6B X;  5DYI A;  4GIP A;  3K1J A;  4D80 A;  3LMM A;  3JR5 A;  1XHB A;  1R7R A;  4FWH A;  4MGZ E;  1L1T A;  2L6O A;  2CFO A;  4IBC A;  4S12 A;  4NXN M;  4LF4 M;  2J7O A;  4II7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...