3KP0E

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (dab) (aerobic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
b'DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp0E02
3KOZE 3KOYE 3KOWE 3KP0E 3KP1E 3KOXE
chains in the Genus database with same CATH superfamily
1N77A 2F5PA 2XZFA 3FUWA 3SAWA 2LHCA 5EP1A 4OVZB 1CUKA 1SXJA 3KOYE 4NXNM 4DV0M 3HY5A 1OJLA 3KP0E 5ITRA 1XNRM 2FH0A 3HZJA 4OU7A 3U5ZB 2CHGA 5LMNM 1NSFA 4JYAM 5KPRA 1TH3A 3A46A 4BB9A 1IBMM 4M9ZA 2C98A 3KP1E 4NSOB 4ZPXA 2KW0A 4GIPA 2HHHM 2DHYA 5FTJA 3T15A 1UFZA 2FS1A 3HHZA 4OW0A 4G4NA 1DGHB 2RRUA 3SHGB 3TWMA 1SXJB 4DR5M 3H4MA 3A45A 3HKPA 3GPYA 1IFYA 3L26A 3AJIB 5ITYA 1XXHA 3M7GA 1GLNA 2QCUA 3K92A 3L27A 3AOEC 4NXMM 2OQ4A 5C1BA 2XLJA 4DR6M 1L1TA 1IN5A 4JXJA 2H1RA 4BBAA 2J7NA 3C58A 3B89A 3B9PA 3SYKA 3FE3A 2L4FA 2DWMA 4MGHA 2N35A 1QUSA 3VKGA 2KNVA 4FWDA 2CHQA 4G4RA 1IN6A 4AQYM 4B3SM 4GHLA 4LF5M 4GKJM 2LWXA 1NV9A 3FTDA 4FVMA 3GLFB 1HJPA 1WGLA 3B7NA 1XC8A 4AG6A 4DR1M 3FRHA 4IBJA 5EXSA 1XXHB 1ORYB 1R2ZA 2JUJA 3FUXA 2FE8A 4FWGA 8CATA 5KPTA 2CHVA 3LCUA 1IXRC 2JP7A 5EP2A 1D0KA 5EXPA 3GLHE 2QP9X 3SATA 1OAOC 2JZ1A 3GLGA 3KSXA 4P16A 3T1YM 4IIWA 3C3DA 1QAOA 3L29A 3U6EA 1WGNA 3U60B 1QZEA 4LFCM 1IXSB 2GNOA 2M60A 2DZOB 3U6OA 2F4VM 4MGIE 3FTEA 1YE9A 1G8PA 1Z5CA 1S3SA 4L8RC 2R4EA 3D8BA 4DR3M 3J7BA 1FNNA 1H6UA 3U6SA 4IBDA 4LGMA 1OAIA 1PJIA 1R2YA 1G3IA 3UMMA 3SYLA 4QHSA 1JR3D 2CEAA 4IBGA 5DFLA 2X8AA 2L7IA 1N33M 1P3QQ 3TQSA 1IBLM 2EO2A 5BPVA 1NVMA 2XGNA 4IBCA 3LVWA 3L2AA 4P17A 1TF0B 2ZM6M 4DUYM 1E32A 2APLA 3PFIA 3VK8A 2DZNB 4B08A 2W82A 2KDLA 4EIWA 3GLIE 5JI2E 2V6ZM 2VF8A 4LG2A 1E94E 3J7AS 2UU9M 1Q39A 2C96A 1OKSA 4LJ8A 3DZDA 2J5YA 4CISA 2DAIA 1G59A 4AW4A 1R5LA 4DV7M 1VDDA 3FTCA 4L16A 3GQ3A 4JI5M 2X4AA 4HEOA 2OPFA 2CV2A 2V1CA 3GLFE 2LVOC 4D82A 1JB0F 2VDBB 4CGYB 4X62M 1XB2B 2VIIA 2K47A 3C3EA 1PGYA 2Y0QA 1Z6TA 5GKNA 2Z4SA 4GMQA 3HU3A 4NRVA 1VG5A 1WHCA 5A2QS 2Y20A 4B7HA 2QZ4A 5IZ7D 4L15A 3W0FA 4A3VB 7CATA 2JY6B 3GRUA 1F4IA 2O25A 1NJFA 3L28A 1W5SA 3PNYA 1TGUA 2XSZA 1DGFA 2B3TA 2JY8A 2DZLA 1IN7A 4QOSA 2HL7A 1PRBA 1TH4A 2DVWB 4IBIA 1DV0A 1XMOM 2QENA 1JR3E 4BLCA 2C9OA 3FKEA 2FNAA 3EIHA 4PT5A 5L8RF 4LFAM 2WZJA 4DV6M 4LJ5A 3SFZA 2LBCA 2JWSA 2Y0TA 1ZMWA 2CWBA 3KW6A 2BNKA 4M9XA 1HNXM 1GO5A 2AHMA 3M0EA 4DUZM 2CE7A 2BWBA 4AZFA 3IHPA 1NY5A 2EUCA 3FUUA 2LVNC 3TL4X 1ZQ9A 2DWLA 2LTUA 5ITUA 3U61A 3H4JA 1W5TA 2HAKA 3GQ5A 1GKIA 2C99A 1GL6A 2K6BA 2ZAMA 1ZV1A 4DV2M 3KXEC 1QAMA 2YR0A 1YUBA 3KOZE 4GEWA 3HWSA 3HU1A 1IY0A 5FTLA 4DBGB 4DV5M 1AUAA 5F3WA 1K3XA 3THGA 2EA0A 2UUBM 1IY1A 3ZH9B 3U6LA 3PXGA 1SXJC 3CF6E 1HQCA 1T43A 2G5GX 3AOGA 3BXWA 2JY7A 4JI0M 5ITXE 1E9RA 5IWAM 4AI6A 1X37A 2F5SA 3I04M 3VFDA 1HQYE 1WXQA 4QOZC 1Q3BA 4B3RM 3KVWA 3FTFA 2MH8A 1N34M 4QNRA 1HNWM 3HGIA 2KZSA 3HJ8A 3Q8GA 1SXJD 4REZA 3FUTA 2GQFA 2NQ8C 2LVAA 5FTKA 4LFBM 3HHXA 2CRUA 2EKKA 2Y21A 2LH0A 5EP3A 4R71A 5C18A 1AIPC 1FJGM 3FD9A 2QQ8A 4LZZA 3FRIA 1V92A 1YLAA 4WURA 3SMSA 4AKIA 5EXXA 3J80S 1EIJA 2DAKA 4JI2M 4MH0E 2UXDM 4DR7M 4QHTA 4CJ6A 2DWZB 1N78A 2MJ5B 3BOSA 5ITQA 5KO3A 1ZAEA 2OOBA 3K2LA 4MB7A 1Y8GA 4II7A 1EFUB 1PJJA 4OX9M 1QAQA 1ZMUA 4NC6A 1TDZA 4KHPM 2JA2A 2VQFM 2R4JA 1QANA 3WHLA 1Q3CA 2EJSA 4I81A 2YQZA 4HL4A 3UJNA 3OTOM 4JI7M 5EP4A 3SBJA 1IXZA 4W5WA 2DAMA 5KQDA 1R6BX 2ZBKB 4FCWA 4LGYA 5E26A 3RGSA 3NBXX 1EE8A 2DXIA 3F92A 1MU5A 1PJSA 2DKLA 2H5XA 4JI4M 3SC3A 3GLGB 4YHHM 1D2NA 2JNHA 3U6MA 1SXJE 2Z8YM 4LRSA 2DENA 2L2DA 2D7EA 2A5YB 4IBFA 4JN6A 2QSFX 4M0WA 3LW5F 3I4VA 1Z5BA 4M9SA 4LF6M 1GL7A 2JXNA 2VF7A 3D8LA 1QYRA 3M6AA 4AKHA 4GC5A 4GH9A 1NNJA 2QBYA 4TUWA 4PCZA 4MGKE 3NWLA 3SARA 4KO8A 2G3QA 4KT0F 1N75A 3HU2A 4G3OA 4FCVA 3LMMA 2HWJA 3VDUA 1DGBA 3AL0C 3FYDA 4R3DA 2JY5A 3CF0A 3UK6A 2E5LM 3VDPA 4IBBA 1TDHA 4MM3B 4L6V6 3AFHA 1OQYA 4ITQA 1VEKA 2R44A 1RU3A 1XXHE 2KEBA 4IBKA 2UXBM 2JZ0A 1QZMA 4LJ4A 1G71A 2QBYB 3SASA 2CFOA 2QHOB 4GC9A 2XEPA 3K9OA 3LVVA 3A42A 4AKGA 3AKZA 4F1IA 3IECA 5ITTA 1XNQM 1YSYA 2L4EA 3I4YA 2OO9A 2WSFF 3R9XB 5H37D 4MGZE 5JI3E 1Z59A 1XWIA 1HR0M 3GPPA 1OFHA 3KDSE 2WSCF 3FYCA 1L2DA 3CTWB 3MJ5A 4KLNA 4RF0A 1SG9A 3RFWA 2V1UA 1PM5A 2L09A 3K1JA 3GLGE 2BWEA 3SAVA 2LNHC 4XBOA 5LMUM 2L6OA 2CUZA 4LJ9A 1G41A 3DOAA 1IY2A 4WP2A 4IJEA 2M5ZA 4RNAA 3W68A 3J2PB 1UM8A 3GQ4A 3GLHA 3I01M 1HT1E 3HJSA 3KOXE 3CF2A 1GJTA 4I4LA 2XFSA 3MK6A 3SHFA 3JAMS 3U6DA 1LTMA 4NL4H 4F2LA 3E46A 5IREB 1XMQM 1L2BA 2XSZD 4YY3M 1NV8A 2R65A 1R7RA 4LJ6A 4LCBA 3J27B 1L1ZA 5FTNA 3I51A 3KSJA 4G6ZA 3NBIA 5FSWA 2I7NA 3GPXA 3W0LB 4R7GA 4RF1A 4DR4M 1NY6A 5BR8M 3TWKA 3U61B 1DGHA 4DV3M 2DWNA 3ZCBB 3GLHB 2XZUA 5IT9S 1GABA 3R8FA 3SMPA 2K9DA 2DHRA 2KHHA 4GKKM 2LHGA 3ILKA 4RKUF 1JQJC 2YFQA 1I94M 3L25A 1KFVA 2KNZA 1T3TA 3EIEA 4FWHA 4LJAA 3VLFB 4Z6YA 1D0LA 2KRKA 2DAEA 4S12A 1R4GA 3U6CA 2FFJA 2MROB 2C9CA 3GLIA 2C5RA 3GRYA 1HT2E 2ZANA 1T6OA 3HHYA 1NJGA 4X65M 2CP8A 4AG5A 1OIPA 2X49A 3E21A 4CIZA 3AOEA 1KSFX 2K0BX 4LRTA 4GRIA 2MR9A 4Y28F 5KPZA 4DV1M 1N32M 5EXTA 3K8ZA 3FUVA 3GLFA 1MX0A 1NO1A 1PJQA 2HCBA 3E4RA 4NOOB 4HLQA 1J09A 1GVNA 3GPUA 2ERCA 2VQEM 1XHBA 3GLIB 4IJFA 3KOWE 1DGGA 1NHGC 2BJWA 3A98B 3BBZA 3C9PA 4D80A 4PDIA 1KYIA 3T1HM 1C1KA 2CV0A 2UUAM 4B3TM 3V76A 1GJSA 4MGYE 4B7FA 3HX3A 2R18A 4L4UA 1IBKM 1LV7A 4FD2A 4PD2A 1TR8A 4Z8XA 1K3WA 3VKHA 1Q02A 2YNMD 3Q8XA 4IBEA 3U60A 4L78A 2KZUA 2R0IA 3B7ZA 4CHTB 1IXSA 4NRWA 1VQ1A 3B74A 1OFIA 2MGWA 3QYEA 3VK7A 2QNJA 4M0DA 3ZC7B 3U6PA 1JR3A 2KXEA 1BVSA 1NNUC 2LVQD 3K9PA 5DYIA 1PJTA 3LQRA 3TPZA 4UN2B 3U6QA 2XFTA 2RGOA 3KS4A 1N36M 2F5QA 2CV1A 4XGIA 1L2CA 2F5OA 4PDGA 2R6FA 1L8QA 1J7KA 3IG5A 3PVSA 4LY6A 3QYBA 4DV4M 4JV5M 2O01F 1TH2A 5DYGA 1V34A 3TE6A 4JI1M 2G8LA 1IQPA 2ZTCA 2J7OA 3PNVA 2F5NA 2L7HA 3J81S 1QQWA 4LZJA 4X66M 3DFZA 1VEJA 2Z3XA 2KNAA 1WJ7A 3RE8A 5EQTA 1QDRA 4G4OA 4B3MM 4LF9M 3AV0A 4GITA 5FLXS 1A5TA 2LXEA 4I5SA 5ITXA 2EKFA 3KFUG 1Z5AA 3GO8A 3KS8A 4GHAA 2Z4RA 2RGHA 4D81A 1ZMVA 1QVRA 3QWLA 1QUTA 2I7PA 2KRUA 3WHKA 3HHWA 2WSEF 2FOIC 1E9SA 3TWLA 2Z7JA 3MMPA 3GRRA 1K82A 2KA6B 4JI6M 4Q7JA 2BJVA 3E9SA 1WR1B 4KODA 2P5TA 4WW0A 3LCVB 2Q2EB 5E6JA 3B7QA 5EJCA 4B7GA 3HJQA 2HKJA 1C7YA 2LVPC 4DR2M 2R62A 4K0KM 1QDTA 4LF8M 1V33A 2RKOA 2XH9A 3JR5A 1TTEA 3JR4A 1HNZM 2ZTDA 3W67A 1VEGA 1MJGM 1WIVA 2R46A 4LF7M 1OTRA 1J5EM 4NSRA 4XK8F 1IN4A 2D7HA 3QAUA 2QPAA 2UUCM 4FW9A 2OOAA 4LJ7A 3IG8A 3ZQJA 1G4AE 2ZAOA 1IM2A 2R45A 1DO2A 1VDLA 3T38A 2UXCM 2DAGA 4X64M 3MHVC 1I4WA 4OVZA 5FTMA 1D0MA 1MN3A 3U5ZA 1IN8A 1DO0A 2DI0A 3GP1A 3SAUA 3GRVA 4LF4M 2XF3A 3CGWA 4FCTA 1OIZA 3LQQA 1NHWC 2D7GA 2O5RA 5KQ8A 4JI3M 3T6PA 3RGPA 3UGJA 3DA1A 3UZUA 4QNMA 4G4QA 4ANRA 4JI8M 2DNAA 4I8OA 5DNYA
chains in the Genus database with same CATH topology
1N77A 2F5PA 2XZFA 3FUWA 3SAWA 5EP1A 4OVZB 3KOYE 1SXJA 4NXNM 4DV0M 1OJLA 3KP0E 5ITRA 1XNRM 4OU7A 3U5ZB 2CHGA 5LMNM 1NSFA 4JYAM 5KPRA 1TH3A 3A46A 4BB9A 1IBMM 4M9ZA 2C98A 3KP1E 4NSOB 4ZPXA 2KW0A 4GIPA 2HHHM 5FTJA 3T15A 3HHZA 4OW0A 4G4NA 1DGHB 3SHGB 3TWMA 1SXJB 4DR5M 3H4MA 3A45A 3HKPA 3GPYA 3L26A 3AJIB 5ITYA 1XXHA 3M7GA 1GLNA 2QCUA 3K92A 3L27A 3AOEC 4NXMM 2OQ4A 5C1BA 2XLJA 4DR6M 1L1TA 1IN5A 4JXJA 2H1RA 4BBAA 2J7NA 3C58A 3B9PA 3SYKA 2DWMA 4MGHA 3VKGA 4FWDA 2CHQA 4G4RA 1IN6A 4AQYM 4B3SM 4GHLA 4LF5M 4GKJM 2LWXA 3GLFB 3FTDA 4FVMA 1XC8A 4AG6A 4DR1M 4IBJA 5EXSA 1XXHB 1ORYB 1R2ZA 3FUXA 2FE8A 4FWGA 8CATA 5KPTA 2CHVA 1IXRC 5EP2A 5EXPA 3SATA 2QP9X 3GLGA 3KSXA 4P16A 3T1YM 4IIWA 1QAOA 3L29A 3U6EA 3U60B 4LFCM 1IXSB 2M60A 2DZOB 3U6OA 2F4VM 3FTEA 1YE9A 1G8PA 1Z5CA 1S3SA 4L8RC 2R4EA 3D8BA 4DR3M 3J7BA 1FNNA 1H6UA 3U6SA 4IBDA 4LGMA 1PJIA 1R2YA 1G3IA 3UMMA 3SYLA 4QHSA 1JR3D 2CEAA 4IBGA 2X8AA 2L7IA 1N33M 3TQSA 1IBLM 2EO2A 5BPVA 1NVMA 2XGNA 4IBCA 3LVWA 3L2AA 2ZM6M 4DUYM 1E32A 3PFIA 3VK8A 2DZNB 4B08A 2W82A 4EIWA 5JI2E 2V6ZM 4LG2A 1E94E 3J7AS 2UU9M 1Q39A 2C96A 4LJ8A 3DZDA 4CISA 1G59A 4AW4A 4DV7M 1VDDA 3FTCA 4L16A 3GQ3A 4JI5M 2X4AA 2OPFA 2CV2A 2V1CA 4D82A 4CGYB 4X62M 2VIIA 2K47A 2Y0QA 1Z6TA 5GKNA 2Z4SA 4GMQA 3HU3A 4NRVA 5A2QS 2Y20A 4B7HA 2QZ4A 5IZ7D 4L15A 3W0FA 4A3VB 7CATA 3GRUA 1NJFA 3L28A 1W5SA 3PNYA 1TGUA 2XSZA 1DGFA 4QOSA 1IN7A 2HL7A 1TH4A 2DVWB 4IBIA 1XMOM 2QENA 4BLCA 2C9OA 3FKEA 2FNAA 3EIHA 4PT5A 4LFAM 4DV6M 4LJ5A 3SFZA 2Y0TA 3KW6A 2BNKA 4M9XA 1HNXM 2AHMA 3M0EA 4DUZM 2CE7A 4AZFA 1NY5A 2EUCA 3FUUA 3TL4X 1ZQ9A 2DWLA 5ITUA 3U61A 1W5TA 3GQ5A 1GKIA 2C99A 1GL6A 2ZAMA 4DV2M 3KXEC 1QAMA 2YR0A 1YUBA 3KOZE 5FTLA 3HWSA 3HU1A 1IY0A 4DV5M 5F3WA 1K3XA 3THGA 2EA0A 2UUBM 1IY1A 3ZH9B 3U6LA 3PXGA 1SXJC 3CF6E 1HQCA 3AOGA 2G5GX 5ITXE 4JI0M 5IWAM 1E9RA 4AI6A 1X37A 2F5SA 3VFDA 1HQYE 1WXQA 4QOZC 1Q3BA 4B3RM 3KVWA 3FTFA 1N34M 4QNRA 1HNWM 3HGIA 2KZSA 3HJ8A 1SXJD 4REZA 3FUTA 5FTKA 2NQ8C 4LFBM 3HHXA 2Y21A 2LH0A 5EP3A 5C18A 1FJGM 3FD9A 4LZZA 4WURA 3SMSA 4AKIA 5EXXA 3J80S 4JI2M 4MH0E 2UXDM 4DR7M 4QHTA 2DWZB 1N78A 3BOSA 5ITQA 5KO3A 1ZAEA 3K2LA 4MB7A 4II7A 1PJJA 4OX9M 1QAQA 1TDZA 4KHPM 2JA2A 2VQFM 2R4JA 1QANA 3WHLA 1Q3CA 4I81A 2YQZA 4HL4A 3UJNA 3OTOM 4JI7M 5EP4A 3SBJA 1IXZA 4W5WA 5KQDA 1R6BX 2ZBKB 4FCWA 4LGYA 5E26A 3RGSA 2DXIA 1EE8A 1MU5A 4JI4M 3SC3A 3GLGB 4YHHM 1D2NA 3U6MA 1SXJE 4LRSA 2D7EA 2A5YB 4JN6A 4IBFA 4MGIE 4M0WA 3I4VA 1Z5BA 4M9SA 4LF6M 1GL7A 3D8LA 4AKHA 1QYRA 3M6AA 4GC5A 4GH9A 1NNJA 2QBYA 4TUWA 4PCZA 4MGKE 3NWLA 3SARA 4KO8A 1N75A 3HU2A 4FCVA 3LMMA 3VDUA 1DGBA 3AL0C 3FYDA 4R3DA 3CF0A 3UK6A 2E5LM 3VDPA 4IBBA 1TDHA 4MM3B 3AFHA 4ITQA 2KEBA 2UXBM 4IBKA 1QZMA 4LJ4A 2QBYB 3SASA 2CFOA 4GC9A 2XEPA 3LVVA 3A42A 4AKGA 3AKZA 5ITTA 1XNQM 1YSYA 3I4YA 3R9XB 5H37D 4MGZE 5JI3E 1Z59A 1XWIA 1HR0M 3GPPA 1OFHA 3KDSE 3FYCA 1L2DA 3CTWB 3MJ5A 4KLNA 4RF0A 3RFWA 2V1UA 1PM5A 2L09A 3K1JA 3SAVA 2LNHC 4XBOA 5LMUM 2L6OA 2CUZA 4LJ9A 1G41A 3DOAA 1IY2A 4IJEA 2M5ZA 4RNAA 3J2PB 1UM8A 3GQ4A 3GLHA 3KOXE 1HT1E 3HJSA 4I4LA 3CF2A 2XFSA 3MK6A 3SHFA 3JAMS 3U6DA 4NL4H 5IREB 1XMQM 1L2BA 2XSZD 4YY3M 2R65A 1R7RA 4LJ6A 4LCBA 3J27B 1L1ZA 5FTNA 3I51A 3KSJA 4G6ZA 3NBIA 5FSWA 2I7NA 3GPXA 3W0LB 4R7GA 4RF1A 4DR4M 1NY6A 5BR8M 3TWKA 3U61B 1DGHA 4DV3M 2DWNA 3ZCBB 3GLHB 2XZUA 5IT9S 3R8FA 3SMPA 2DHRA 4GKKM 3ILKA 1I94M 1JQJC 2YFQA 3L25A 1KFVA 1T3TA 3EIEA 4FWHA 4LJAA 3VLFB 4Z6YA 2KRKA 4S12A 3U6CA 2FFJA 2C9CA 3GLIA 2C5RA 3GRYA 1HT2E 2ZANA 3HHYA 1NJGA 4X65M 4AG5A 2X49A 3AOEA 1KSFX 4LRTA 4GRIA 5KPZA 4DV1M 1N32M 5EXTA 3K8ZA 3FUVA 3GLFA 1MX0A 2HCBA 3E4RA 4NOOB 4HLQA 1J09A 1GVNA 3GPUA 2ERCA 2VQEM 1XHBA 3GLIB 4IJFA 3KOWE 1DGGA 1NHGC 2BJWA 3A98B 4PDIA 4D80A 2CV0A 2UUAM 1KYIA 3T1HM 1C1KA 4B3TM 4MGYE 4B7FA 2R18A 4L4UA 1IBKM 1LV7A 4FD2A 4PD2A 4Z8XA 1K3WA 3VKHA 4IBEA 2YNMD 3Q8XA 3U60A 4L78A 2KZUA 4CHTB 4NRWA 1OFIA 3VK7A 4M0DA 3ZC7B 3U6PA 1JR3A 2KXEA 1NNUC 3TPZA 5DYIA 3LQRA 3U6QA 2XFTA 2RGOA 3KS4A 1N36M 2F5QA 2CV1A 4XGIA 1L2CA 2F5OA 4PDGA 1L8QA 1J7KA 3IG5A 3PVSA 4LY6A 4DV4M 4JV5M 1TH2A 5DYGA 3TE6A 4JI1M 2G8LA 1IQPA 2J7OA 3PNVA 2F5NA 2L7HA 3J81S 1QQWA 4LZJA 4X66M 3DFZA 2Z3XA 3RE8A 5EQTA 4G4OA 4B3MM 4LF9M 3AV0A 4GITA 5FLXS 2LXEA 4I5SA 5ITXA 3KFUG 1Z5AA 3GO8A 3KS8A 4GHAA 2Z4RA 2RGHA 4D81A 1QVRA 3QWLA 2I7PA 2KRUA 3WHKA 3HHWA 2FOIC 1E9SA 3TWLA 2Z7JA 3GRRA 1K82A 2KA6B 4JI6M 2BJVA 3E9SA 4WW0A 4KODA 2P5TA 2Q2EB 5E6JA 5EJCA 4B7GA 3HJQA 2HKJA 4DR2M 2R62A 4K0KM 4LF8M 2RKOA 3JR5A 2XH9A 3JR4A 1HNZM 2R46A 4LF7M 1J5EM 4NSRA 1IN4A 2D7HA 3QAUA 2QPAA 2UUCM 4FW9A 4LJ7A 3IG8A 1G4AE 2ZAOA 1IM2A 2R45A 1DO2A 3T38A 2UXCM 4X64M 3MHVC 1I4WA 4OVZA 5FTMA 3U5ZA 1IN8A 1DO0A 3GP1A 3SAUA 3GRVA 4LF4M 2XF3A 4FCTA 3LQQA 1NHWC 2D7GA 2O5RA 5KQ8A 4JI3M 3RGPA 3UGJA 3DA1A 3UZUA 4QNMA 4G4QA 4JI8M 4I8OA 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOZ E;  3KOY E;  3KOW E;  3KP0 E;  3KP1 E;  3KOX E; 
#chains in the Genus database with same CATH topology
 1N77 A;  2F5P A;  2XZF A;  3FUW A;  3SAW A;  2LHC A;  5EP1 A;  4OVZ B;  1CUK A;  1SXJ A;  3KOY E;  4NXN M;  4DV0 M;  3HY5 A;  1OJL A;  3KP0 E;  5ITR A;  1XNR M;  2FH0 A;  3HZJ A;  4OU7 A;  3U5Z B;  2CHG A;  5LMN M;  1NSF A;  4JYA M;  5KPR A;  1TH3 A;  3A46 A;  4BB9 A;  1IBM M;  4M9Z A;  2C98 A;  3KP1 E;  4NSO B;  4ZPX A;  2KW0 A;  4GIP A;  2HHH M;  2DHY A;  5FTJ A;  3T15 A;  1UFZ A;  2FS1 A;  3HHZ A;  4OW0 A;  4G4N A;  1DGH B;  2RRU A;  3SHG B;  3TWM A;  1SXJ B;  4DR5 M;  3H4M A;  3A45 A;  3HKP A;  3GPY A;  1IFY A;  3L26 A;  3AJI B;  5ITY A;  1XXH A;  3M7G A;  1GLN A;  2QCU A;  3K92 A;  3L27 A;  3AOE C;  4NXM M;  2OQ4 A;  5C1B A;  2XLJ A;  4DR6 M;  1L1T A;  1IN5 A;  4JXJ A;  2H1R A;  4BBA A;  2J7N A;  3C58 A;  3B89 A;  3B9P A;  3SYK A;  3FE3 A;  2L4F A;  2DWM A;  4MGH A;  2N35 A;  1QUS A;  3VKG A;  2KNV A;  4FWD A;  2CHQ A;  4G4R A;  1IN6 A;  4AQY M;  4B3S M;  4GHL A;  4LF5 M;  4GKJ M;  2LWX A;  1NV9 A;  3FTD A;  4FVM A;  3GLF B;  1HJP A;  1WGL A;  3B7N A;  1XC8 A;  4AG6 A;  4DR1 M;  3FRH A;  4IBJ A;  5EXS A;  1XXH B;  1ORY B;  1R2Z A;  2JUJ A;  3FUX A;  2FE8 A;  4FWG A;  8CAT A;  5KPT A;  2CHV A;  3LCU A;  1IXR C;  2JP7 A;  5EP2 A;  1D0K A;  5EXP A;  3GLH E;  2QP9 X;  3SAT A;  1OAO C;  2JZ1 A;  3GLG A;  3KSX A;  4P16 A;  3T1Y M;  4IIW A;  3C3D A;  1QAO A;  3L29 A;  3U6E A;  1WGN A;  3U60 B;  1QZE A;  4LFC M;  1IXS B;  2GNO A;  2M60 A;  2DZO B;  3U6O A;  2F4V M;  4MGI E;  3FTE A;  1YE9 A;  1G8P A;  1Z5C A;  1S3S A;  4L8R C;  2R4E A;  3D8B A;  4DR3 M;  3J7B A;  1FNN A;  1H6U A;  3U6S A;  4IBD A;  4LGM A;  1OAI A;  1PJI A;  1R2Y A;  1G3I A;  3UMM A;  3SYL A;  4QHS A;  1JR3 D;  2CEA A;  4IBG A;  5DFL A;  2X8A A;  2L7I A;  1N33 M;  1P3Q Q;  3TQS A;  1IBL M;  2EO2 A;  5BPV A;  1NVM A;  2XGN A;  4IBC A;  3LVW A;  3L2A A;  4P17 A;  1TF0 B;  2ZM6 M;  4DUY M;  1E32 A;  2APL A;  3PFI A;  3VK8 A;  2DZN B;  4B08 A;  2W82 A;  2KDL A;  4EIW A;  3GLI E;  5JI2 E;  2V6Z M;  2VF8 A;  4LG2 A;  1E94 E;  3J7A S;  2UU9 M;  1Q39 A;  2C96 A;  1OKS A;  4LJ8 A;  3DZD A;  2J5Y A;  4CIS A;  2DAI A;  1G59 A;  4AW4 A;  1R5L A;  4DV7 M;  1VDD A;  3FTC A;  4L16 A;  3GQ3 A;  4JI5 M;  2X4A A;  4HEO A;  2OPF A;  2CV2 A;  2V1C A;  3GLF E;  2LVO C;  4D82 A;  1JB0 F;  2VDB B;  4CGY B;  4X62 M;  1XB2 B;  2VII A;  2K47 A;  3C3E A;  1PGY A;  2Y0Q A;  1Z6T A;  5GKN A;  2Z4S A;  4GMQ A;  3HU3 A;  4NRV A;  1VG5 A;  1WHC A;  5A2Q S;  2Y20 A;  4B7H A;  2QZ4 A;  5IZ7 D;  4L15 A;  3W0F A;  4A3V B;  7CAT A;  2JY6 B;  3GRU A;  1F4I A;  2O25 A;  1NJF A;  3L28 A;  1W5S A;  3PNY A;  1TGU A;  2XSZ A;  1DGF A;  2B3T A;  2JY8 A;  2DZL A;  1IN7 A;  4QOS A;  2HL7 A;  1PRB A;  1TH4 A;  2DVW B;  4IBI A;  1DV0 A;  1XMO M;  2QEN A;  1JR3 E;  4BLC A;  2C9O A;  3FKE A;  2FNA A;  3EIH A;  4PT5 A;  5L8R F;  4LFA M;  2WZJ A;  4DV6 M;  4LJ5 A;  3SFZ A;  2LBC A;  2JWS A;  2Y0T A;  1ZMW A;  2CWB A;  3KW6 A;  2BNK A;  4M9X A;  1HNX M;  1GO5 A;  2AHM A;  3M0E A;  4DUZ M;  2CE7 A;  2BWB A;  4AZF A;  3IHP A;  1NY5 A;  2EUC A;  3FUU A;  2LVN C;  3TL4 X;  1ZQ9 A;  2DWL A;  2LTU A;  5ITU A;  3U61 A;  3H4J A;  1W5T A;  2HAK A;  3GQ5 A;  1GKI A;  2C99 A;  1GL6 A;  2K6B A;  2ZAM A;  1ZV1 A;  4DV2 M;  3KXE C;  1QAM A;  2YR0 A;  1YUB A;  3KOZ E;  4GEW A;  3HWS A;  3HU1 A;  1IY0 A;  5FTL A;  4DBG B;  4DV5 M;  1AUA A;  5F3W A;  1K3X A;  3THG A;  2EA0 A;  2UUB M;  1IY1 A;  3ZH9 B;  3U6L A;  3PXG A;  1SXJ C;  3CF6 E;  1HQC A;  1T43 A;  2G5G X;  3AOG A;  3BXW A;  2JY7 A;  4JI0 M;  5ITX E;  1E9R A;  5IWA M;  4AI6 A;  1X37 A;  2F5S A;  3I04 M;  3VFD A;  1HQY E;  1WXQ A;  4QOZ C;  1Q3B A;  4B3R M;  3KVW A;  3FTF A;  2MH8 A;  1N34 M;  4QNR A;  1HNW M;  3HGI A;  2KZS A;  3HJ8 A;  3Q8G A;  1SXJ D;  4REZ A;  3FUT A;  2GQF A;  2NQ8 C;  2LVA A;  5FTK A;  4LFB M;  3HHX A;  2CRU A;  2EKK A;  2Y21 A;  2LH0 A;  5EP3 A;  4R71 A;  5C18 A;  1AIP C;  1FJG M;  3FD9 A;  2QQ8 A;  4LZZ A;  3FRI A;  1V92 A;  1YLA A;  4WUR A;  3SMS A;  4AKI A;  5EXX A;  3J80 S;  1EIJ A;  2DAK A;  4JI2 M;  4MH0 E;  2UXD M;  4DR7 M;  4QHT A;  4CJ6 A;  2DWZ B;  1N78 A;  2MJ5 B;  3BOS A;  5ITQ A;  5KO3 A;  1ZAE A;  2OOB A;  3K2L A;  4MB7 A;  1Y8G A;  4II7 A;  1EFU B;  1PJJ A;  4OX9 M;  1QAQ A;  1ZMU A;  4NC6 A;  1TDZ A;  4KHP M;  2JA2 A;  2VQF M;  2R4J A;  1QAN A;  3WHL A;  1Q3C A;  2EJS A;  4I81 A;  2YQZ A;  4HL4 A;  3UJN A;  3OTO M;  4JI7 M;  5EP4 A;  3SBJ A;  1IXZ A;  4W5W A;  2DAM A;  5KQD A;  1R6B X;  2ZBK B;  4FCW A;  4LGY A;  5E26 A;  3RGS A;  3NBX X;  1EE8 A;  2DXI A;  3F92 A;  1MU5 A;  1PJS A;  2DKL A;  2H5X A;  4JI4 M;  3SC3 A;  3GLG B;  4YHH M;  1D2N A;  2JNH A;  3U6M A;  1SXJ E;  2Z8Y M;  4LRS A;  2DEN A;  2L2D A;  2D7E A;  2A5Y B;  4IBF A;  4JN6 A;  2QSF X;  4M0W A;  3LW5 F;  3I4V A;  1Z5B A;  4M9S A;  4LF6 M;  1GL7 A;  2JXN A;  2VF7 A;  3D8L A;  1QYR A;  3M6A A;  4AKH A;  4GC5 A;  4GH9 A;  1NNJ A;  2QBY A;  4TUW A;  4PCZ A;  4MGK E;  3NWL A;  3SAR A;  4KO8 A;  2G3Q A;  4KT0 F;  1N75 A;  3HU2 A;  4G3O A;  4FCV A;  3LMM A;  2HWJ A;  3VDU A;  1DGB A;  3AL0 C;  3FYD A;  4R3D A;  2JY5 A;  3CF0 A;  3UK6 A;  2E5L M;  3VDP A;  4IBB A;  1TDH A;  4MM3 B;  4L6V 6;  3AFH A;  1OQY A;  4ITQ A;  1VEK A;  2R44 A;  1RU3 A;  1XXH E;  2KEB A;  4IBK A;  2UXB M;  2JZ0 A;  1QZM A;  4LJ4 A;  1G71 A;  2QBY B;  3SAS A;  2CFO A;  2QHO B;  4GC9 A;  2XEP A;  3K9O A;  3LVV A;  3A42 A;  4AKG A;  3AKZ A;  4F1I A;  3IEC A;  5ITT A;  1XNQ M;  1YSY A;  2L4E A;  3I4Y A;  2OO9 A;  2WSF F;  3R9X B;  5H37 D;  4MGZ E;  5JI3 E;  1Z59 A;  1XWI A;  1HR0 M;  3GPP A;  1OFH A;  3KDS E;  2WSC F;  3FYC A;  1L2D A;  3CTW B;  3MJ5 A;  4KLN A;  4RF0 A;  1SG9 A;  3RFW A;  2V1U A;  1PM5 A;  2L09 A;  3K1J A;  3GLG E;  2BWE A;  3SAV A;  2LNH C;  4XBO A;  5LMU M;  2L6O A;  2CUZ A;  4LJ9 A;  1G41 A;  3DOA A;  1IY2 A;  4WP2 A;  4IJE A;  2M5Z A;  4RNA A;  3W68 A;  3J2P B;  1UM8 A;  3GQ4 A;  3GLH A;  3I01 M;  1HT1 E;  3HJS A;  3KOX E;  3CF2 A;  1GJT A;  4I4L A;  2XFS A;  3MK6 A;  3SHF A;  3JAM S;  3U6D A;  1LTM A;  4NL4 H;  4F2L A;  3E46 A;  5IRE B;  1XMQ M;  1L2B A;  2XSZ D;  4YY3 M;  1NV8 A;  2R65 A;  1R7R A;  4LJ6 A;  4LCB A;  3J27 B;  1L1Z A;  5FTN A;  3I51 A;  3KSJ A;  4G6Z A;  3NBI A;  5FSW A;  2I7N A;  3GPX A;  3W0L B;  4R7G A;  4RF1 A;  4DR4 M;  1NY6 A;  5BR8 M;  3TWK A;  3U61 B;  1DGH A;  4DV3 M;  2DWN A;  3ZCB B;  3GLH B;  2XZU A;  5IT9 S;  1GAB A;  3R8F A;  3SMP A;  2K9D A;  2DHR A;  2KHH A;  4GKK M;  2LHG A;  3ILK A;  4RKU F;  1JQJ C;  2YFQ A;  1I94 M;  3L25 A;  1KFV A;  2KNZ A;  1T3T A;  3EIE A;  4FWH A;  4LJA A;  3VLF B;  4Z6Y A;  1D0L A;  2KRK A;  2DAE A;  4S12 A;  1R4G A;  3U6C A;  2FFJ A;  2MRO B;  2C9C A;  3GLI A;  2C5R A;  3GRY A;  1HT2 E;  2ZAN A;  1T6O A;  3HHY A;  1NJG A;  4X65 M;  2CP8 A;  4AG5 A;  1OIP A;  2X49 A;  3E21 A;  4CIZ A;  3AOE A;  1KSF X;  2K0B X;  4LRT A;  4GRI A;  2MR9 A;  4Y28 F;  5KPZ A;  4DV1 M;  1N32 M;  5EXT A;  3K8Z A;  3FUV A;  3GLF A;  1MX0 A;  1NO1 A;  1PJQ A;  2HCB A;  3E4R A;  4NOO B;  4HLQ A;  1J09 A;  1GVN A;  3GPU A;  2ERC A;  2VQE M;  1XHB A;  3GLI B;  4IJF A;  3KOW E;  1DGG A;  1NHG C;  2BJW A;  3A98 B;  3BBZ A;  3C9P A;  4D80 A;  4PDI A;  1KYI A;  3T1H M;  1C1K A;  2CV0 A;  2UUA M;  4B3T M;  3V76 A;  1GJS A;  4MGY E;  4B7F A;  3HX3 A;  2R18 A;  4L4U A;  1IBK M;  1LV7 A;  4FD2 A;  4PD2 A;  1TR8 A;  4Z8X A;  1K3W A;  3VKH A;  1Q02 A;  2YNM D;  3Q8X A;  4IBE A;  3U60 A;  4L78 A;  2KZU A;  2R0I A;  3B7Z A;  4CHT B;  1IXS A;  4NRW A;  1VQ1 A;  3B74 A;  1OFI A;  2MGW A;  3QYE A;  3VK7 A;  2QNJ A;  4M0D A;  3ZC7 B;  3U6P A;  1JR3 A;  2KXE A;  1BVS A;  1NNU C;  2LVQ D;  3K9P A;  5DYI A;  1PJT A;  3LQR A;  3TPZ A;  4UN2 B;  3U6Q A;  2XFT A;  2RGO A;  3KS4 A;  1N36 M;  2F5Q A;  2CV1 A;  4XGI A;  1L2C A;  2F5O A;  4PDG A;  2R6F A;  1L8Q A;  1J7K A;  3IG5 A;  3PVS A;  4LY6 A;  3QYB A;  4DV4 M;  4JV5 M;  2O01 F;  1TH2 A;  5DYG A;  1V34 A;  3TE6 A;  4JI1 M;  2G8L A;  1IQP A;  2ZTC A;  2J7O A;  3PNV A;  2F5N A;  2L7H A;  3J81 S;  1QQW A;  4LZJ A;  4X66 M;  3DFZ A;  1VEJ A;  2Z3X A;  2KNA A;  1WJ7 A;  3RE8 A;  5EQT A;  1QDR A;  4G4O A;  4B3M M;  4LF9 M;  3AV0 A;  4GIT A;  5FLX S;  1A5T A;  2LXE A;  4I5S A;  5ITX A;  2EKF A;  3KFU G;  1Z5A A;  3GO8 A;  3KS8 A;  4GHA A;  2Z4R A;  2RGH A;  4D81 A;  1ZMV A;  1QVR A;  3QWL A;  1QUT A;  2I7P A;  2KRU A;  3WHK A;  3HHW A;  2WSE F;  2FOI C;  1E9S A;  3TWL A;  2Z7J A;  3MMP A;  3GRR A;  1K82 A;  2KA6 B;  4JI6 M;  4Q7J A;  2BJV A;  3E9S A;  1WR1 B;  4KOD A;  2P5T A;  4WW0 A;  3LCV B;  2Q2E B;  5E6J A;  3B7Q A;  5EJC A;  4B7G A;  3HJQ A;  2HKJ A;  1C7Y A;  2LVP C;  4DR2 M;  2R62 A;  4K0K M;  1QDT A;  4LF8 M;  1V33 A;  2RKO A;  2XH9 A;  3JR5 A;  1TTE A;  3JR4 A;  1HNZ M;  2ZTD A;  3W67 A;  1VEG A;  1MJG M;  1WIV A;  2R46 A;  4LF7 M;  1OTR A;  1J5E M;  4NSR A;  4XK8 F;  1IN4 A;  2D7H A;  3QAU A;  2QPA A;  2UUC M;  4FW9 A;  2OOA A;  4LJ7 A;  3IG8 A;  3ZQJ A;  1G4A E;  2ZAO A;  1IM2 A;  2R45 A;  1DO2 A;  1VDL A;  3T38 A;  2UXC M;  2DAG A;  4X64 M;  3MHV C;  1I4W A;  4OVZ A;  5FTM A;  1D0M A;  1MN3 A;  3U5Z A;  1IN8 A;  1DO0 A;  2DI0 A;  3GP1 A;  3SAU A;  3GRV A;  4LF4 M;  2XF3 A;  3CGW A;  4FCT A;  1OIZ A;  3LQQ A;  1NHW C;  2D7G A;  2O5R A;  5KQ8 A;  4JI3 M;  3T6P A;  3RGP A;  3UGJ A;  3DA1 A;  3UZU A;  4QNM A;  4G4Q A;  4ANR A;  4JI8 M;  2DNA A;  4I8O A;  5DNY A; 
#chains in the Genus database with same CATH homology
 1N77 A;  2F5P A;  2XZF A;  3FUW A;  3SAW A;  5EP1 A;  4OVZ B;  3KOY E;  1SXJ A;  4NXN M;  4DV0 M;  1OJL A;  3KP0 E;  5ITR A;  1XNR M;  4OU7 A;  3U5Z B;  2CHG A;  5LMN M;  1NSF A;  4JYA M;  5KPR A;  1TH3 A;  3A46 A;  4BB9 A;  1IBM M;  4M9Z A;  2C98 A;  3KP1 E;  4NSO B;  4ZPX A;  2KW0 A;  4GIP A;  2HHH M;  5FTJ A;  3T15 A;  3HHZ A;  4OW0 A;  4G4N A;  1DGH B;  3SHG B;  3TWM A;  1SXJ B;  4DR5 M;  3H4M A;  3A45 A;  3HKP A;  3GPY A;  3L26 A;  3AJI B;  5ITY A;  1XXH A;  3M7G A;  1GLN A;  2QCU A;  3K92 A;  3L27 A;  3AOE C;  4NXM M;  2OQ4 A;  5C1B A;  2XLJ A;  4DR6 M;  1L1T A;  1IN5 A;  4JXJ A;  2H1R A;  4BBA A;  2J7N A;  3C58 A;  3B9P A;  3SYK A;  2DWM A;  4MGH A;  3VKG A;  4FWD A;  2CHQ A;  4G4R A;  1IN6 A;  4AQY M;  4B3S M;  4GHL A;  4LF5 M;  4GKJ M;  2LWX A;  3GLF B;  3FTD A;  4FVM A;  1XC8 A;  4AG6 A;  4DR1 M;  4IBJ A;  5EXS A;  1XXH B;  1ORY B;  1R2Z A;  3FUX A;  2FE8 A;  4FWG A;  8CAT A;  5KPT A;  2CHV A;  1IXR C;  5EP2 A;  5EXP A;  3SAT A;  2QP9 X;  3GLG A;  3KSX A;  4P16 A;  3T1Y M;  4IIW A;  1QAO A;  3L29 A;  3U6E A;  3U60 B;  4LFC M;  1IXS B;  2M60 A;  2DZO B;  3U6O A;  2F4V M;  3FTE A;  1YE9 A;  1G8P A;  1Z5C A;  1S3S A;  4L8R C;  2R4E A;  3D8B A;  4DR3 M;  3J7B A;  1FNN A;  1H6U A;  3U6S A;  4IBD A;  4LGM A;  1PJI A;  1R2Y A;  1G3I A;  3UMM A;  3SYL A;  4QHS A;  1JR3 D;  2CEA A;  4IBG A;  2X8A A;  2L7I A;  1N33 M;  3TQS A;  1IBL M;  2EO2 A;  5BPV A;  1NVM A;  2XGN A;  4IBC A;  3LVW A;  3L2A A;  2ZM6 M;  4DUY M;  1E32 A;  3PFI A;  3VK8 A;  2DZN B;  4B08 A;  2W82 A;  4EIW A;  5JI2 E;  2V6Z M;  4LG2 A;  1E94 E;  3J7A S;  2UU9 M;  1Q39 A;  2C96 A;  4LJ8 A;  3DZD A;  4CIS A;  1G59 A;  4AW4 A;  4DV7 M;  1VDD A;  3FTC A;  4L16 A;  3GQ3 A;  4JI5 M;  2X4A A;  2OPF A;  2CV2 A;  2V1C A;  4D82 A;  4CGY B;  4X62 M;  2VII A;  2K47 A;  2Y0Q A;  1Z6T A;  5GKN A;  2Z4S A;  4GMQ A;  3HU3 A;  4NRV A;  5A2Q S;  2Y20 A;  4B7H A;  2QZ4 A;  5IZ7 D;  4L15 A;  3W0F A;  4A3V B;  7CAT A;  3GRU A;  1NJF A;  3L28 A;  1W5S A;  3PNY A;  1TGU A;  2XSZ A;  1DGF A;  4QOS A;  1IN7 A;  2HL7 A;  1TH4 A;  2DVW B;  4IBI A;  1XMO M;  2QEN A;  4BLC A;  2C9O A;  3FKE A;  2FNA A;  3EIH A;  4PT5 A;  4LFA M;  4DV6 M;  4LJ5 A;  3SFZ A;  2Y0T A;  3KW6 A;  2BNK A;  4M9X A;  1HNX M;  2AHM A;  3M0E A;  4DUZ M;  2CE7 A;  4AZF A;  1NY5 A;  2EUC A;  3FUU A;  3TL4 X;  1ZQ9 A;  2DWL A;  5ITU A;  3U61 A;  1W5T A;  3GQ5 A;  1GKI A;  2C99 A;  1GL6 A;  2ZAM A;  4DV2 M;  3KXE C;  1QAM A;  2YR0 A;  1YUB A;  3KOZ E;  5FTL A;  3HWS A;  3HU1 A;  1IY0 A;  4DV5 M;  5F3W A;  1K3X A;  3THG A;  2EA0 A;  2UUB M;  1IY1 A;  3ZH9 B;  3U6L A;  3PXG A;  1SXJ C;  3CF6 E;  1HQC A;  3AOG A;  2G5G X;  5ITX E;  4JI0 M;  5IWA M;  1E9R A;  4AI6 A;  1X37 A;  2F5S A;  3VFD A;  1HQY E;  1WXQ A;  4QOZ C;  1Q3B A;  4B3R M;  3KVW A;  3FTF A;  1N34 M;  4QNR A;  1HNW M;  3HGI A;  2KZS A;  3HJ8 A;  1SXJ D;  4REZ A;  3FUT A;  5FTK A;  2NQ8 C;  4LFB M;  3HHX A;  2Y21 A;  2LH0 A;  5EP3 A;  5C18 A;  1FJG M;  3FD9 A;  4LZZ A;  4WUR A;  3SMS A;  4AKI A;  5EXX A;  3J80 S;  4JI2 M;  4MH0 E;  2UXD M;  4DR7 M;  4QHT A;  2DWZ B;  1N78 A;  3BOS A;  5ITQ A;  5KO3 A;  1ZAE A;  3K2L A;  4MB7 A;  4II7 A;  1PJJ A;  4OX9 M;  1QAQ A;  1TDZ A;  4KHP M;  2JA2 A;  2VQF M;  2R4J A;  1QAN A;  3WHL A;  1Q3C A;  4I81 A;  2YQZ A;  4HL4 A;  3UJN A;  3OTO M;  4JI7 M;  5EP4 A;  3SBJ A;  1IXZ A;  4W5W A;  5KQD A;  1R6B X;  2ZBK B;  4FCW A;  4LGY A;  5E26 A;  3RGS A;  2DXI A;  1EE8 A;  1MU5 A;  4JI4 M;  3SC3 A;  3GLG B;  4YHH M;  1D2N A;  3U6M A;  1SXJ E;  4LRS A;  2D7E A;  2A5Y B;  4JN6 A;  4IBF A;  4MGI E;  4M0W A;  3I4V A;  1Z5B A;  4M9S A;  4LF6 M;  1GL7 A;  3D8L A;  4AKH A;  1QYR A;  3M6A A;  4GC5 A;  4GH9 A;  1NNJ A;  2QBY A;  4TUW A;  4PCZ A;  4MGK E;  3NWL A;  3SAR A;  4KO8 A;  1N75 A;  3HU2 A;  4FCV A;  3LMM A;  3VDU A;  1DGB A;  3AL0 C;  3FYD A;  4R3D A;  3CF0 A;  3UK6 A;  2E5L M;  3VDP A;  4IBB A;  1TDH A;  4MM3 B;  3AFH A;  4ITQ A;  2KEB A;  2UXB M;  4IBK A;  1QZM A;  4LJ4 A;  2QBY B;  3SAS A;  2CFO A;  4GC9 A;  2XEP A;  3LVV A;  3A42 A;  4AKG A;  3AKZ A;  5ITT A;  1XNQ M;  1YSY A;  3I4Y A;  3R9X B;  5H37 D;  4MGZ E;  5JI3 E;  1Z59 A;  1XWI A;  1HR0 M;  3GPP A;  1OFH A;  3KDS E;  3FYC A;  1L2D A;  3CTW B;  3MJ5 A;  4KLN A;  4RF0 A;  3RFW A;  2V1U A;  1PM5 A;  2L09 A;  3K1J A;  3SAV A;  2LNH C;  4XBO A;  5LMU M;  2L6O A;  2CUZ A;  4LJ9 A;  1G41 A;  3DOA A;  1IY2 A;  4IJE A;  2M5Z A;  4RNA A;  3J2P B;  1UM8 A;  3GQ4 A;  3GLH A;  3KOX E;  1HT1 E;  3HJS A;  4I4L A;  3CF2 A;  2XFS A;  3MK6 A;  3SHF A;  3JAM S;  3U6D A;  4NL4 H;  5IRE B;  1XMQ M;  1L2B A;  2XSZ D;  4YY3 M;  2R65 A;  1R7R A;  4LJ6 A;  4LCB A;  3J27 B;  1L1Z A;  5FTN A;  3I51 A;  3KSJ A;  4G6Z A;  3NBI A;  5FSW A;  2I7N A;  3GPX A;  3W0L B;  4R7G A;  4RF1 A;  4DR4 M;  1NY6 A;  5BR8 M;  3TWK A;  3U61 B;  1DGH A;  4DV3 M;  2DWN A;  3ZCB B;  3GLH B;  2XZU A;  5IT9 S;  3R8F A;  3SMP A;  2DHR A;  4GKK M;  3ILK A;  1I94 M;  1JQJ C;  2YFQ A;  3L25 A;  1KFV A;  1T3T A;  3EIE A;  4FWH A;  4LJA A;  3VLF B;  4Z6Y A;  2KRK A;  4S12 A;  3U6C A;  2FFJ A;  2C9C A;  3GLI A;  2C5R A;  3GRY A;  1HT2 E;  2ZAN A;  3HHY A;  1NJG A;  4X65 M;  4AG5 A;  2X49 A;  3AOE A;  1KSF X;  4LRT A;  4GRI A;  5KPZ A;  4DV1 M;  1N32 M;  5EXT A;  3K8Z A;  3FUV A;  3GLF A;  1MX0 A;  2HCB A;  3E4R A;  4NOO B;  4HLQ A;  1J09 A;  1GVN A;  3GPU A;  2ERC A;  2VQE M;  1XHB A;  3GLI B;  4IJF A;  3KOW E;  1DGG A;  1NHG C;  2BJW A;  3A98 B;  4PDI A;  4D80 A;  2CV0 A;  2UUA M;  1KYI A;  3T1H M;  1C1K A;  4B3T M;  4MGY E;  4B7F A;  2R18 A;  4L4U A;  1IBK M;  1LV7 A;  4FD2 A;  4PD2 A;  4Z8X A;  1K3W A;  3VKH A;  4IBE A;  2YNM D;  3Q8X A;  3U60 A;  4L78 A;  2KZU A;  4CHT B;  4NRW A;  1OFI A;  3VK7 A;  4M0D A;  3ZC7 B;  3U6P A;  1JR3 A;  2KXE A;  1NNU C;  3TPZ A;  5DYI A;  3LQR A;  3U6Q A;  2XFT A;  2RGO A;  3KS4 A;  1N36 M;  2F5Q A;  2CV1 A;  4XGI A;  1L2C A;  2F5O A;  4PDG A;  1L8Q A;  1J7K A;  3IG5 A;  3PVS A;  4LY6 A;  4DV4 M;  4JV5 M;  1TH2 A;  5DYG A;  3TE6 A;  4JI1 M;  2G8L A;  1IQP A;  2J7O A;  3PNV A;  2F5N A;  2L7H A;  3J81 S;  1QQW A;  4LZJ A;  4X66 M;  3DFZ A;  2Z3X A;  3RE8 A;  5EQT A;  4G4O A;  4B3M M;  4LF9 M;  3AV0 A;  4GIT A;  5FLX S;  2LXE A;  4I5S A;  5ITX A;  3KFU G;  1Z5A A;  3GO8 A;  3KS8 A;  4GHA A;  2Z4R A;  2RGH A;  4D81 A;  1QVR A;  3QWL A;  2I7P A;  2KRU A;  3WHK A;  3HHW A;  2FOI C;  1E9S A;  3TWL A;  2Z7J A;  3GRR A;  1K82 A;  2KA6 B;  4JI6 M;  2BJV A;  3E9S A;  4WW0 A;  4KOD A;  2P5T A;  2Q2E B;  5E6J A;  5EJC A;  4B7G A;  3HJQ A;  2HKJ A;  4DR2 M;  2R62 A;  4K0K M;  4LF8 M;  2RKO A;  3JR5 A;  2XH9 A;  3JR4 A;  1HNZ M;  2R46 A;  4LF7 M;  1J5E M;  4NSR A;  1IN4 A;  2D7H A;  3QAU A;  2QPA A;  2UUC M;  4FW9 A;  4LJ7 A;  3IG8 A;  1G4A E;  2ZAO A;  1IM2 A;  2R45 A;  1DO2 A;  3T38 A;  2UXC M;  4X64 M;  3MHV C;  1I4W A;  4OVZ A;  5FTM A;  3U5Z A;  1IN8 A;  1DO0 A;  3GP1 A;  3SAU A;  3GRV A;  4LF4 M;  2XF3 A;  4FCT A;  3LQQ A;  1NHW C;  2D7G A;  2O5R A;  5KQ8 A;  4JI3 M;  3RGP A;  3UGJ A;  3DA1 A;  3UZU A;  4QNM A;  4G4Q A;  4JI8 M;  4I8O A;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...