3KP0E

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (dab) (aerobic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp0E02
3KOXE 3KP0E 3KOYE 3KOZE 3KOWE 3KP1E
chains in the Genus database with same CATH superfamily
2V1CA 1TH3A 1IQPA 4L16A 2F5QA 2UUAM 1GJSA 1NHGC 2Z3XA 4M0WA 4OW0A 5A2QS 2EKFA 2LH0A 3J81S 4GKJM 4QNRA 2XFTA 2LVPC 1HT1E 3GRUA 4LZZA 3AJIB 1G8PA 2R18A 3KSJA 4IBEA 3RGSA 4EIWA 5BPVA 3GLGE 1YLAA 5GKNA 4AZFA 4G3OA 3Q8XA 3D8BA 4JI0M 5JI2E 2KA6B 1SXJE 3SFZA 4L8RC 1SXJC 3QYBA 2OQ4A 2MH8A 2LHCA 4JI2M 1Z5CA 5JI3E 1IY1A 3AKZA 4MB7A 2QP9X 3LVWA 3U60B 1VG5A 1G3IA 3A98B 1TH4A 1WIVA 2FNAA 5FTKA 3GLIB 2M60A 3FE3A 3LVVA 1ZMWA 1IN7A 1D0KA 1G71A 2Z7JA 4FCVA 1IFYA 4LJ4A 3MMPA 4IBCA 2OOBA 2ZBKB 3I4YA 3SC3A 3JAMS 4Q7JA 3SAWA 1OIPA 4JI7M 4NXMM 3KSXA 1MX0A 2LNHC 3SAVA 3GRYA 3W0LB 3GRVA 1C7YA 3ZC7B 3U6SA 2F5NA 1DO2A 2V6ZM 2RKOA 3MK6A 4DV0M 2X49A 1J5EM 2JY5A 2EJSA 2R6FA 2Y21A 4GC5A 1WXQA 1NNUC 2C98A 3JR5A 1SG9A 3PVSA 5KQDA 2JA2A 4GEWA 3GRRA 4DR1M 1VEJA 1HQCA 5KPZA 3AOEA 3KS4A 3KFUG 1OIZA 3GO8A 4M9XA 1OFHA 1QUSA 4F2LA 3SHFA 3M6AA 4AI6A 2K0BX 2QHOB 2WSFF 4G4OA 4IBIA 4CISA 1N32M 4MH0E 1PJQA 2HHHM 3AV0A 3K92A 1GVNA 4CIZA 4LFAM 3K1JA 5BR8M 3U5ZA 3FKEA 1DV0A 4KO8A 5EP1A 2JWSA 1K82A 4DV4M 4ITQA 1R5LA 4OVZA 3VK8A 2OO9A 1BVSA 1OJLA 1TGUA 2QSFX 1GL6A 2QENA 3CF6E 4NRWA 4G4RA 2J7NA 3NWLA 4IJFA 2O25A 3HWSA 3AL0C 2DAGA 2NQ8C 3FTCA 1S3SA 3RE8A 3B9PA 2R0IA 5IREB 2D7EA 1WGNA 2BNKA 3EIHA 4JV5M 4KODA 3AOEC 2M5ZA 1N34M 2BJWA 1XMQM 4GHAA 4KLNA 2G3QA 3C9PA 1I4WA 3U6QA 3ILKA 4DR2M 1PJIA 2RGHA 2XLJA 4JN6A 2FS1A 4FWGA 2CRUA 4LJ8A 1RU3A 3U5ZB 3FUWA 1QAQA 2K9DA 4MGIE 4NXNM 1SXJB 1R6BX 2Y0QA 4QHSA 3U6CA 1DGHA 2VIIA 4DR5M 1OAOC 3U6EA 1TH2A 2D7HA 1IBLM 2DAIA 3CF2A 1HNXM 5IWAM 3UZUA 4OU7A 3CTWB 2XEPA 3IECA 1D2NA 4DV6M 1IN5A 2DHRA 1NSFA 4MGYE 2JZ1A 4R3DA 2EA0A 1JR3A 3TWLA 1ZV1A 2JY8A 2LVQD 2YFQA 2QNJA 2K6BA 4FCTA 1IY2A 1Q3BA 4WURA 5ITRA 4NL4H 4X66M 1VDLA 3GPPA 1JQJC 4LF4M 1QQWA 2L2DA 1PGYA 1E32A 1WHCA 2LVNC 4WW0A 5FTMA 5ITUA 1GLNA 3H4MA 1D0LA 4LFCM 4G6ZA 3T1HM 4GIPA 2Z4RA 2FH0A 2MROB 3K9PA 1JR3D 5DFLA 4JYAM 2KRUA 3GPUA 1IXZA 3HGIA 2XGNA 2L7HA 4LGMA 1E94E 4P16A 4AKIA 3GLHA 3FTDA 1XHBA 2HWJA 1VDDA 4B3TM 4UN2B 3M0EA 3KP0E 4DV7M 1LV7A 2D7GA 3E9SA 3DOAA 3FD9A 1VEKA 3M7GA 3VLFB 3TL4X 1PJTA 1PM5A 2GNOA 4RKUF 5FTJA 3HZJA 1QDRA 1N75A 2AHMA 2N35A 3B7QA 4WP2A 3T6PA 5L8RF 4FWHA 1TDZA 5E26A 7CATA 1F4IA 3Q8GA 3HU3A 3LQRA 3TE6A 3ZH9B 1EFUB 3TPZA 3GPYA 3SMSA 1ZAEA 4PDGA 5EXSA 2FFJA 2XSZA 2LHGA 3LCVB 3MHVC 4P17A 4QOSA 2LWXA 4AQYM 4YHHM 2CV2A 1IXSA 2DWLA 4A3VB 4M9ZA 1LTMA 2DAEA 3FRHA 2KDLA 3RFWA 1NO1A 5EXTA 2H1RA 1YUBA 2JUJA 2KZUA 2LXEA 1IM2A 3NBIA 2F5OA 4LY6A 2XSZD 3CF0A 5EQTA 2I7PA 4AG6A 5ITYA 3UMMA 1L2BA 4JI1M 2KZSA 2J7OA 1QANA 2YNMD 4RF1A 4LG2A 2R46A 2C9OA 3HHZA 2CHQA 3L25A 1V92A 2LBCA 1XC8A 4OVZB 3GLIE 3DZDA 3BOSA 3HY5A 4IJEA 4II7A 1GJTA 4W5WA 1SXJD 2XF3A 3GQ5A 2DZOB 4ANRA 1T3TA 4R7GA 1I94M 2VQEM 1R2ZA 4YY3M 4DBGB 2CE7A 4GH9A 4L78A 2P5TA 2Z4SA 1IXRC 3E21A 2JP7A 2VQFM 3T1YM 4NRVA 1KSFX 2CHGA 4DR6M 3J7AS 1R2YA 1FNNA 3B74A 3PFIA 4LGYA 3KP1E 2RGOA 2UUBM 2CV0A 1QDTA 1HT2E 1ZMVA 4KT0F 1Z6TA 5ITXA 4CGYB 1NV8A 2MR9A 3LMMA 3U6MA 4IBBA 2UU9M 4DUZM 1L2CA 2DWMA 3U6LA 1V33A 4IBGA 1NVMA 4PCZA 3KOZE 3L28A 1XXHA 3QWLA 2DAKA 1GKIA 1HR0M 1L1TA 5KQ8A 3FRIA 4Z6YA 4IBFA 3LW5F 2FOIC 3U6DA 3SATA 2J5YA 5FTLA 4MGKE 1GABA 3J27B 2DWNA 1QUTA 4HL4A 1JB0F 3HU2A 1MU5A 2UXDM 3UGJA 3SYKA 2ZTCA 4NSRA 3FUUA 3IG5A 2CEAA 4QNMA 2KXEA 3KOYE 2FE8A 1DGHB 3L27A 2YQZA 4D81A 3DA1A 2H5XA 3W0FA 1JR3E 4MM3B 3RGPA 3KDSE 1SXJA 4LCBA 3WHLA 3V76A 3AOGA 3GQ4A 2ZTDA 4GRIA 3SMPA 4GHLA 4I81A 1DGGA 4QHTA 3WHKA 2R44A 2C96A 1C1KA 4AKGA 5ITXE 2EKKA 3GLFB 2UUCM 4DR4M 3FTFA 3HJ8A 2DKLA 2C9CA 2X4AA 2R45A 2R4JA 1N77A 1IY0A 1IXSB 1N33M 1R4GA 1Y8GA 3AFHA 5DNYA 3GLFA 1J09A 1A5TA 2ERCA 2DAMA 2UXBM 2XZUA 1DGBA 4LRSA 3VDPA 3OTOM 2CWBA 1QVRA 1DGFA 3HJSA 4DV1M 2C5RA 1OAIA 2DZLA 3B7ZA 4JXJA 3LQQA 4Y28F 1IN6A 1NJGA 2DI0A 3HHWA 5F3WA 4LF9M 3KS8A 1XB2B 2XZFA 4LF8M 1XXHE 1N78A 1Q39A 3A46A 4M0DA 2WSEF 8CATA 4L6V6 5ITTA 3FTEA 2MGWA 3U6OA 4M9SA 5H37D 4IBJA 1PJJA 1G59A 3W67A 1AUAA 3C3EA 4X65M 1HJPA 2CP8A 4FWDA 4LZJA 2B3TA 2VF8A 2DENA 2BJVA 1NHWC 5DYIA 4BBAA 2C99A 2HKJA 3NBXX 3VFDA 1NY5A 2ZM6M 3ZCBB 4QOZC 3E46A 2KNVA 4B7FA 2V1UA 1XXHB 1WJ7A 1ZMUA 2VF7A 1D0MA 3EIEA 4AW4A 4B7GA 1YSYA 2ZAOA 3KOXE 4I5SA 2R62A 1IBMM 4HEOA 5DYGA 2I7NA 3L29A 1QZEA 4RF0A 1DO0A 2QZ4A 4S12A 1L2DA 2EUCA 5KPTA 2X8AA 3GPXA 3GLFE 3GLGB 3VDUA 3PNVA 1ZQ9A 5KO3A 3PNYA 3SBJA 1G41A 3BXWA 2O01F 3VK7A 1EE8A 1QYRA 1IN4A 3KOWE 4DV2M 2RRUA 1W5TA 4D80A 3UJNA 4G4QA 2R65A 3GP1A 3I01M 5ITQA 1VQ1A 3U60A 4B3RM 2YR0A 3QAUA 5IT9S 3FUXA 4REZA 2KRKA 4DV5M 2KNAA 3JR4A 1J7KA 1WGLA 3J2PB 1HNZM 3SYLA 1PJSA 2CV1A 4FVMA 3TQSA 3W68A 5KPRA 4IBKA 4FCWA 2XFSA 1Q3CA 1Z5BA 1MN3A 1XWIA 4R71A 1IBKM 1FJGM 3VKGA 1UM8A 4GKKM 2ZAMA 1XMOM 3TWKA 1AIPC 4X64M 3HJQA 1NV9A 1Z59A 2QQ8A 4KHPM 5FLXS 1L8QA 3U61A 4G4NA 3D8LA 4I8OA 2A5YB 2Z8YM 1WR1B 1IN8A 1V34A 5EJCA 4L15A 3U61B 2HCBA 3FUTA 5EXPA 4DV3M 4AG5A 4JI3M 4OX9M 4I4LA 4CHTB 3GQ3A 3R9XB 5LMNM 1TR8A 2GQFA 4MGZE 2L4FA 1E9RA 2DWZB 4JI4M 3CGWA 4LRTA 2L09A 1HNWM 2APLA 1XNQM 4X62M 4LFBM 4NSOB 4GITA 4JI8M 3QYEA 1NNJA 4PDIA 4ZPXA 3FYDA 3KW6A 2WSCF 2F5SA 4LF7M 4GMQA 4LJ9A 4Z8XA 3SHGB 3SARA 3J80S 3PXGA 3GLHB 2KHHA 1Z5AA 3T15A 3BBZA 5C18A 1T6OA 2MJ5B 4B3SM 4LJ6A 3IHPA 5EP2A 4D82A 4JI5M 4GC9A 1GO5A 4PT5A 3HHXA 3SASA 2WZJA 2XH9A 2QBYB 2W82A 2JY6B 3A42A 1L1ZA 3J7BA 4FD2A 1KYIA 4LJ5A 1MJGM 4LJAA 3SAUA 2HL7A 3B7NA 4L4UA 4IBDA 3H4JA 1N36M 2JZ0A 4MGHA 1UFZA 1NY6A 5EP3A 4DR7M 2EO2A 2CHVA 2LVOC 3K8ZA 3R8FA 5EXXA 1XNRM 1K3WA 3VKHA 2QCUA 5C1BA 2DXIA 2KEBA 4B08A 3C3DA 3I04M 2DNAA 1G4AE 2CFOA 3F92A 3I51A 1NJFA 1ORYB 3L26A 2K47A 1X37A 4DR3M 2JNHA 3HU1A 2JXNA 2BWBA 1GL7A 2BWEA 3E4RA 4XBOA 3TWMA 3GLIA 2UXCM 2JY7A 4HLQA 1HQYE 2L7IA 4LF6M 3I4VA 1P3QQ 1Q02A 1H6UA 2O5RA 2DVWB 3FUVA 4PD2A 2VDBB 5EP4A 2OPFA 2G8LA 3L2AA 5E6JA 5FSWA 3GLGA 2Y20A 4LF5M 2HAKA 2QPAA 4LJ7A 2Q2EB 1PRBA 4TUWA 1TDHA 2DZNB 2Y0TA 3HX3A 2QBYA 3FYCA 2F4VM 1OTRA 4F1IA 3GLHE 1KFVA 3ZQJA 4NC6A 1CUKA 1T43A 2G5GX 2LTUA 1TF0B 5LMUM 2R4EA 3MJ5A 4BLCA 5FTNA 3U6PA 2E5LM 2LVAA 1QZMA 4NOOB 2F5PA 2L4EA 1OFIA 1VEGA 2L6OA 2KW0A 3LCUA 3A45A 3T38A 3HHYA 4B3MM 4FW9A 2OOAA 3KVWA 2ZANA 1E9SA 4CJ6A 1EIJA 1R7RA 2KNZA 3IG8A 4AKHA 3K2LA 1TTEA 1OKSA 1QAMA 1QAOA 3K9OA 4B7HA 3C58A 3HKPA 4XK8F 4DUYM 3DFZA 1YE9A 4JI6M 5IZ7D 1K3XA 4RNAA 4XGIA 1OQYA 3UK6A 3KXEC 4IIWA 1W5SA 2CUZA 3B89A 3THGA 4BB9A 4K0KM 2DHYA
chains in the Genus database with same CATH topology
2V1CA 1TH3A 1IQPA 4L16A 2F5QA 2UUAM 1NHGC 2Z3XA 4M0WA 4OW0A 5A2QS 2LH0A 3J81S 4GKJM 4QNRA 2XFTA 1HT1E 3GRUA 4LZZA 3AJIB 1G8PA 2R18A 3KSJA 4IBEA 3RGSA 4EIWA 5BPVA 4AZFA 5GKNA 3Q8XA 3D8BA 4JI0M 5JI2E 2KA6B 1SXJE 3SFZA 4L8RC 1SXJC 2OQ4A 4JI2M 1Z5CA 5JI3E 1IY1A 3AKZA 4MB7A 2QP9X 3LVWA 3U60B 1G3IA 3A98B 1TH4A 2FNAA 5FTKA 3GLIB 2M60A 3LVVA 2Z7JA 1IN7A 4FCVA 4LJ4A 4IBCA 2ZBKB 3I4YA 3SC3A 3JAMS 3SAWA 4JI7M 4NXMM 3KSXA 1MX0A 2LNHC 3SAVA 3GRYA 3W0LB 3GRVA 3ZC7B 3U6SA 2F5NA 1DO2A 2V6ZM 2RKOA 3MK6A 4DV0M 2X49A 1J5EM 2Y21A 4GC5A 1WXQA 1NNUC 2C98A 3JR5A 3PVSA 5KQDA 2JA2A 3GRRA 4DR1M 1HQCA 5KPZA 3AOEA 3KS4A 3KFUG 3GO8A 4M9XA 1OFHA 3SHFA 3M6AA 4AI6A 4G4OA 4IBIA 4CISA 1N32M 4MH0E 2HHHM 3AV0A 3K92A 1GVNA 5BR8M 4LFAM 3K1JA 3U5ZA 3FKEA 4KO8A 5EP1A 1K82A 4ITQA 4DV4M 4OVZA 3VK8A 1OJLA 1TGUA 1GL6A 2QENA 3CF6E 4NRWA 4G4RA 2J7NA 3NWLA 4IJFA 3HWSA 3AL0C 2NQ8C 3FTCA 1S3SA 3RE8A 3B9PA 5IREB 2D7EA 2BNKA 3EIHA 4JV5M 4KODA 3AOEC 2M5ZA 1N34M 2BJWA 1XMQM 4GHAA 4KLNA 1I4WA 3U6QA 3ILKA 4DR2M 1PJIA 2RGHA 2XLJA 4JN6A 4FWGA 4LJ8A 3U5ZB 3FUWA 1QAQA 4MGIE 4NXNM 1SXJB 1R6BX 2Y0QA 4QHSA 3U6CA 1DGHA 2VIIA 4DR5M 3U6EA 1TH2A 2D7HA 1IBLM 1HNXM 3CF2A 5IWAM 3UZUA 4OU7A 3CTWB 2XEPA 1D2NA 4DV6M 1IN5A 2DHRA 1NSFA 4MGYE 4R3DA 2EA0A 1JR3A 3TWLA 2YFQA 4FCTA 1IY2A 1Q3BA 4WURA 5ITRA 4NL4H 4X66M 3GPPA 1JQJC 4LF4M 1QQWA 1E32A 4WW0A 5FTMA 4LFCM 5ITUA 1GLNA 3H4MA 4G6ZA 3T1HM 4GIPA 2Z4RA 1JR3D 4JYAM 2KRUA 3GPUA 1IXZA 3HGIA 2XGNA 2L7HA 4LGMA 1E94E 4P16A 4AKIA 3GLHA 3FTDA 1XHBA 1VDDA 4B3TM 3M0EA 3KP0E 4DV7M 1LV7A 2D7GA 3E9SA 3DOAA 3FD9A 3M7GA 3VLFB 3TL4X 1PM5A 5FTJA 1N75A 2AHMA 1TDZA 4FWHA 5E26A 7CATA 3TE6A 3HU3A 3LQRA 3ZH9B 3TPZA 3GPYA 3SMSA 1ZAEA 4PDGA 5EXSA 2FFJA 2XSZA 3MHVC 4QOSA 4AQYM 2LWXA 4YHHM 2CV2A 2DWLA 4A3VB 4M9ZA 3RFWA 5EXTA 2H1RA 1YUBA 2LXEA 2KZUA 3NBIA 1IM2A 2F5OA 4LY6A 2XSZD 3CF0A 5EQTA 2I7PA 4AG6A 5ITYA 3UMMA 1L2BA 4JI1M 2KZSA 2J7OA 1QANA 2YNMD 4RF1A 4LG2A 2R46A 2C9OA 3HHZA 2CHQA 3L25A 1XC8A 4OVZB 3DZDA 3BOSA 4IJEA 4II7A 4W5WA 1SXJD 2XF3A 3GQ5A 2DZOB 1T3TA 4R7GA 1I94M 2VQEM 1R2ZA 4YY3M 2CE7A 4GH9A 4L78A 2P5TA 2Z4SA 1IXRC 3T1YM 2VQFM 4NRVA 1KSFX 2CHGA 4DR6M 3J7AS 1R2YA 1FNNA 3PFIA 4LGYA 3KP1E 2RGOA 2UUBM 2CV0A 1HT2E 1Z6TA 5ITXA 4CGYB 3LMMA 3U6MA 4IBBA 2UU9M 4DUZM 1L2CA 2DWMA 3U6LA 4IBGA 1NVMA 4PCZA 3KOZE 3L28A 1XXHA 3QWLA 1HR0M 1GKIA 1L1TA 5KQ8A 4Z6YA 4IBFA 2FOIC 3U6DA 3SATA 5FTLA 4MGKE 3J27B 2DWNA 4HL4A 3HU2A 1MU5A 2UXDM 3UGJA 3SYKA 4NSRA 3FUUA 3IG5A 2CEAA 4QNMA 2KXEA 3KOYE 2FE8A 1DGHB 3L27A 2YQZA 4D81A 3DA1A 3W0FA 4MM3B 3RGPA 3KDSE 1SXJA 4LCBA 3WHLA 3AOGA 3GQ4A 4GHLA 4GRIA 3SMPA 4I81A 1DGGA 4QHTA 3WHKA 2C96A 1C1KA 4AKGA 5ITXE 2UUCM 3GLFB 4DR4M 3FTFA 3HJ8A 2C9CA 2X4AA 2R45A 2R4JA 1N77A 1IY0A 1IXSB 1N33M 3AFHA 5DNYA 3GLFA 1J09A 2ERCA 2UXBM 2XZUA 1DGBA 4LRSA 3VDPA 3OTOM 1QVRA 1DGFA 3HJSA 4DV1M 2C5RA 4JXJA 3LQQA 1IN6A 1NJGA 5F3WA 3HHWA 4LF9M 3KS8A 4LF8M 2XZFA 1N78A 1Q39A 3A46A 4M0DA 5ITTA 8CATA 3FTEA 3U6OA 4M9SA 5H37D 4IBJA 1PJJA 1G59A 4X65M 4FWDA 4LZJA 2BJVA 1NHWC 5DYIA 4BBAA 2C99A 2HKJA 3VFDA 1NY5A 2ZM6M 3ZCBB 4QOZC 4B7FA 2V1UA 1XXHB 3EIEA 4AW4A 4B7GA 1YSYA 2ZAOA 3KOXE 4I5SA 2R62A 1IBMM 5DYGA 2I7NA 3L29A 4RF0A 1DO0A 2QZ4A 4S12A 1L2DA 2EUCA 5KPTA 2X8AA 3GPXA 3GLGB 3VDUA 3PNVA 1ZQ9A 5KO3A 3PNYA 3SBJA 1G41A 3VK7A 1EE8A 1QYRA 1IN4A 3KOWE 4DV2M 1W5TA 4D80A 3UJNA 4G4QA 2R65A 3GP1A 5ITQA 3U60A 4B3RM 2YR0A 3QAUA 5IT9S 3FUXA 4REZA 2KRKA 4DV5M 3JR4A 1J7KA 3J2PB 1HNZM 3SYLA 2CV1A 4FVMA 3TQSA 5KPRA 4IBKA 4FCWA 2XFSA 1Q3CA 1Z5BA 1XWIA 1IBKM 1FJGM 3VKGA 1UM8A 4GKKM 2ZAMA 1XMOM 3TWKA 4X64M 3HJQA 4KHPM 1Z59A 5FLXS 1L8QA 3U61A 4G4NA 3D8LA 4I8OA 2A5YB 1IN8A 5EJCA 4L15A 2HCBA 3FUTA 5EXPA 4DV3M 4AG5A 4JI3M 4OX9M 4I4LA 4CHTB 3GQ3A 3R9XB 5LMNM 4MGZE 1E9RA 2DWZB 4JI4M 4LRTA 2L09A 1HNWM 1XNQM 4LFBM 4X62M 4NSOB 4GITA 4JI8M 1NNJA 4PDIA 4ZPXA 3FYDA 3KW6A 2F5SA 4LF7M 4GMQA 4LJ9A 4Z8XA 3SHGB 3SARA 3J80S 3PXGA 3GLHB 1Z5AA 3T15A 5C18A 4B3SM 4LJ6A 5EP2A 4D82A 4JI5M 4GC9A 4PT5A 3HHXA 3SASA 2XH9A 2QBYB 2W82A 3A42A 1L1ZA 3J7BA 4FD2A 1KYIA 4LJ5A 4LJAA 3SAUA 2HL7A 4L4UA 4IBDA 1N36M 4MGHA 5EP3A 1NY6A 4DR7M 2EO2A 2CHVA 3K8ZA 3R8FA 5EXXA 1XNRM 1K3WA 3VKHA 2QCUA 5C1BA 2DXIA 2KEBA 4B08A 1G4AE 2CFOA 3I51A 1NJFA 1ORYB 3L26A 2K47A 1X37A 4DR3M 3HU1A 1GL7A 3E4RA 4XBOA 3TWMA 3GLIA 2UXCM 4HLQA 1HQYE 2L7IA 4LF6M 3I4VA 1H6UA 2O5RA 2DVWB 3FUVA 4PD2A 5EP4A 2OPFA 2G8LA 3L2AA 5E6JA 5FSWA 3GLGA 2Y20A 4LF5M 2QPAA 4LJ7A 2Q2EB 4TUWA 1TDHA 2DZNB 2Y0TA 2QBYA 3FYCA 2F4VM 1KFVA 2G5GX 5LMUM 2R4EA 3MJ5A 4BLCA 5FTNA 3U6PA 2E5LM 1QZMA 4NOOB 2F5PA 1OFIA 2L6OA 2KW0A 3T38A 3A45A 3HHYA 4B3MM 4FW9A 3KVWA 2ZANA 1E9SA 1R7RA 3IG8A 4AKHA 3K2LA 1QAMA 1QAOA 4B7HA 3C58A 3HKPA 4DUYM 3DFZA 1YE9A 4JI6M 5IZ7D 1K3XA 4RNAA 4XGIA 3UK6A 3KXEC 4IIWA 1W5SA 2CUZA 3THGA 4BB9A 4K0KM 3U61B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOX E;  3KP0 E;  3KOY E;  3KOZ E;  3KOW E;  3KP1 E; 
#chains in the Genus database with same CATH topology
 2V1C A;  1TH3 A;  1IQP A;  4L16 A;  2F5Q A;  2UUA M;  1GJS A;  1NHG C;  2Z3X A;  4M0W A;  4OW0 A;  5A2Q S;  2EKF A;  2LH0 A;  3J81 S;  4GKJ M;  4QNR A;  2XFT A;  2LVP C;  1HT1 E;  3GRU A;  4LZZ A;  3AJI B;  1G8P A;  2R18 A;  3KSJ A;  4IBE A;  3RGS A;  4EIW A;  5BPV A;  3GLG E;  1YLA A;  5GKN A;  4AZF A;  4G3O A;  3Q8X A;  3D8B A;  4JI0 M;  5JI2 E;  2KA6 B;  1SXJ E;  3SFZ A;  4L8R C;  1SXJ C;  3QYB A;  2OQ4 A;  2MH8 A;  2LHC A;  4JI2 M;  1Z5C A;  5JI3 E;  1IY1 A;  3AKZ A;  4MB7 A;  2QP9 X;  3LVW A;  3U60 B;  1VG5 A;  1G3I A;  3A98 B;  1TH4 A;  1WIV A;  2FNA A;  5FTK A;  3GLI B;  2M60 A;  3FE3 A;  3LVV A;  1ZMW A;  1IN7 A;  1D0K A;  1G71 A;  2Z7J A;  4FCV A;  1IFY A;  4LJ4 A;  3MMP A;  4IBC A;  2OOB A;  2ZBK B;  3I4Y A;  3SC3 A;  3JAM S;  4Q7J A;  3SAW A;  1OIP A;  4JI7 M;  4NXM M;  3KSX A;  1MX0 A;  2LNH C;  3SAV A;  3GRY A;  3W0L B;  3GRV A;  1C7Y A;  3ZC7 B;  3U6S A;  2F5N A;  1DO2 A;  2V6Z M;  2RKO A;  3MK6 A;  4DV0 M;  2X49 A;  1J5E M;  2JY5 A;  2EJS A;  2R6F A;  2Y21 A;  4GC5 A;  1WXQ A;  1NNU C;  2C98 A;  3JR5 A;  1SG9 A;  3PVS A;  5KQD A;  2JA2 A;  4GEW A;  3GRR A;  4DR1 M;  1VEJ A;  1HQC A;  5KPZ A;  3AOE A;  3KS4 A;  3KFU G;  1OIZ A;  3GO8 A;  4M9X A;  1OFH A;  1QUS A;  4F2L A;  3SHF A;  3M6A A;  4AI6 A;  2K0B X;  2QHO B;  2WSF F;  4G4O A;  4IBI A;  4CIS A;  1N32 M;  4MH0 E;  1PJQ A;  2HHH M;  3AV0 A;  3K92 A;  1GVN A;  4CIZ A;  4LFA M;  3K1J A;  5BR8 M;  3U5Z A;  3FKE A;  1DV0 A;  4KO8 A;  5EP1 A;  2JWS A;  1K82 A;  4DV4 M;  4ITQ A;  1R5L A;  4OVZ A;  3VK8 A;  2OO9 A;  1BVS A;  1OJL A;  1TGU A;  2QSF X;  1GL6 A;  2QEN A;  3CF6 E;  4NRW A;  4G4R A;  2J7N A;  3NWL A;  4IJF A;  2O25 A;  3HWS A;  3AL0 C;  2DAG A;  2NQ8 C;  3FTC A;  1S3S A;  3RE8 A;  3B9P A;  2R0I A;  5IRE B;  2D7E A;  1WGN A;  2BNK A;  3EIH A;  4JV5 M;  4KOD A;  3AOE C;  2M5Z A;  1N34 M;  2BJW A;  1XMQ M;  4GHA A;  4KLN A;  2G3Q A;  3C9P A;  1I4W A;  3U6Q A;  3ILK A;  4DR2 M;  1PJI A;  2RGH A;  2XLJ A;  4JN6 A;  2FS1 A;  4FWG A;  2CRU A;  4LJ8 A;  1RU3 A;  3U5Z B;  3FUW A;  1QAQ A;  2K9D A;  4MGI E;  4NXN M;  1SXJ B;  1R6B X;  2Y0Q A;  4QHS A;  3U6C A;  1DGH A;  2VII A;  4DR5 M;  1OAO C;  3U6E A;  1TH2 A;  2D7H A;  1IBL M;  2DAI A;  3CF2 A;  1HNX M;  5IWA M;  3UZU A;  4OU7 A;  3CTW B;  2XEP A;  3IEC A;  1D2N A;  4DV6 M;  1IN5 A;  2DHR A;  1NSF A;  4MGY E;  2JZ1 A;  4R3D A;  2EA0 A;  1JR3 A;  3TWL A;  1ZV1 A;  2JY8 A;  2LVQ D;  2YFQ A;  2QNJ A;  2K6B A;  4FCT A;  1IY2 A;  1Q3B A;  4WUR A;  5ITR A;  4NL4 H;  4X66 M;  1VDL A;  3GPP A;  1JQJ C;  4LF4 M;  1QQW A;  2L2D A;  1PGY A;  1E32 A;  1WHC A;  2LVN C;  4WW0 A;  5FTM A;  5ITU A;  1GLN A;  3H4M A;  1D0L A;  4LFC M;  4G6Z A;  3T1H M;  4GIP A;  2Z4R A;  2FH0 A;  2MRO B;  3K9P A;  1JR3 D;  5DFL A;  4JYA M;  2KRU A;  3GPU A;  1IXZ A;  3HGI A;  2XGN A;  2L7H A;  4LGM A;  1E94 E;  4P16 A;  4AKI A;  3GLH A;  3FTD A;  1XHB A;  2HWJ A;  1VDD A;  4B3T M;  4UN2 B;  3M0E A;  3KP0 E;  4DV7 M;  1LV7 A;  2D7G A;  3E9S A;  3DOA A;  3FD9 A;  1VEK A;  3M7G A;  3VLF B;  3TL4 X;  1PJT A;  1PM5 A;  2GNO A;  4RKU F;  5FTJ A;  3HZJ A;  1QDR A;  1N75 A;  2AHM A;  2N35 A;  3B7Q A;  4WP2 A;  3T6P A;  5L8R F;  4FWH A;  1TDZ A;  5E26 A;  7CAT A;  1F4I A;  3Q8G A;  3HU3 A;  3LQR A;  3TE6 A;  3ZH9 B;  1EFU B;  3TPZ A;  3GPY A;  3SMS A;  1ZAE A;  4PDG A;  5EXS A;  2FFJ A;  2XSZ A;  2LHG A;  3LCV B;  3MHV C;  4P17 A;  4QOS A;  2LWX A;  4AQY M;  4YHH M;  2CV2 A;  1IXS A;  2DWL A;  4A3V B;  4M9Z A;  1LTM A;  2DAE A;  3FRH A;  2KDL A;  3RFW A;  1NO1 A;  5EXT A;  2H1R A;  1YUB A;  2JUJ A;  2KZU A;  2LXE A;  1IM2 A;  3NBI A;  2F5O A;  4LY6 A;  2XSZ D;  3CF0 A;  5EQT A;  2I7P A;  4AG6 A;  5ITY A;  3UMM A;  1L2B A;  4JI1 M;  2KZS A;  2J7O A;  1QAN A;  2YNM D;  4RF1 A;  4LG2 A;  2R46 A;  2C9O A;  3HHZ A;  2CHQ A;  3L25 A;  1V92 A;  2LBC A;  1XC8 A;  4OVZ B;  3GLI E;  3DZD A;  3BOS A;  3HY5 A;  4IJE A;  4II7 A;  1GJT A;  4W5W A;  1SXJ D;  2XF3 A;  3GQ5 A;  2DZO B;  4ANR A;  1T3T A;  4R7G A;  1I94 M;  2VQE M;  1R2Z A;  4YY3 M;  4DBG B;  2CE7 A;  4GH9 A;  4L78 A;  2P5T A;  2Z4S A;  1IXR C;  3E21 A;  2JP7 A;  2VQF M;  3T1Y M;  4NRV A;  1KSF X;  2CHG A;  4DR6 M;  3J7A S;  1R2Y A;  1FNN A;  3B74 A;  3PFI A;  4LGY A;  3KP1 E;  2RGO A;  2UUB M;  2CV0 A;  1QDT A;  1HT2 E;  1ZMV A;  4KT0 F;  1Z6T A;  5ITX A;  4CGY B;  1NV8 A;  2MR9 A;  3LMM A;  3U6M A;  4IBB A;  2UU9 M;  4DUZ M;  1L2C A;  2DWM A;  3U6L A;  1V33 A;  4IBG A;  1NVM A;  4PCZ A;  3KOZ E;  3L28 A;  1XXH A;  3QWL A;  2DAK A;  1GKI A;  1HR0 M;  1L1T A;  5KQ8 A;  3FRI A;  4Z6Y A;  4IBF A;  3LW5 F;  2FOI C;  3U6D A;  3SAT A;  2J5Y A;  5FTL A;  4MGK E;  1GAB A;  3J27 B;  2DWN A;  1QUT A;  4HL4 A;  1JB0 F;  3HU2 A;  1MU5 A;  2UXD M;  3UGJ A;  3SYK A;  2ZTC A;  4NSR A;  3FUU A;  3IG5 A;  2CEA A;  4QNM A;  2KXE A;  3KOY E;  2FE8 A;  1DGH B;  3L27 A;  2YQZ A;  4D81 A;  3DA1 A;  2H5X A;  3W0F A;  1JR3 E;  4MM3 B;  3RGP A;  3KDS E;  1SXJ A;  4LCB A;  3WHL A;  3V76 A;  3AOG A;  3GQ4 A;  2ZTD A;  4GRI A;  3SMP A;  4GHL A;  4I81 A;  1DGG A;  4QHT A;  3WHK A;  2R44 A;  2C96 A;  1C1K A;  4AKG A;  5ITX E;  2EKK A;  3GLF B;  2UUC M;  4DR4 M;  3FTF A;  3HJ8 A;  2DKL A;  2C9C A;  2X4A A;  2R45 A;  2R4J A;  1N77 A;  1IY0 A;  1IXS B;  1N33 M;  1R4G A;  1Y8G A;  3AFH A;  5DNY A;  3GLF A;  1J09 A;  1A5T A;  2ERC A;  2DAM A;  2UXB M;  2XZU A;  1DGB A;  4LRS A;  3VDP A;  3OTO M;  2CWB A;  1QVR A;  1DGF A;  3HJS A;  4DV1 M;  2C5R A;  1OAI A;  2DZL A;  3B7Z A;  4JXJ A;  3LQQ A;  4Y28 F;  1IN6 A;  1NJG A;  2DI0 A;  3HHW A;  5F3W A;  4LF9 M;  3KS8 A;  1XB2 B;  2XZF A;  4LF8 M;  1XXH E;  1N78 A;  1Q39 A;  3A46 A;  4M0D A;  2WSE F;  8CAT A;  4L6V 6;  5ITT A;  3FTE A;  2MGW A;  3U6O A;  4M9S A;  5H37 D;  4IBJ A;  1PJJ A;  1G59 A;  3W67 A;  1AUA A;  3C3E A;  4X65 M;  1HJP A;  2CP8 A;  4FWD A;  4LZJ A;  2B3T A;  2VF8 A;  2DEN A;  2BJV A;  1NHW C;  5DYI A;  4BBA A;  2C99 A;  2HKJ A;  3NBX X;  3VFD A;  1NY5 A;  2ZM6 M;  3ZCB B;  4QOZ C;  3E46 A;  2KNV A;  4B7F A;  2V1U A;  1XXH B;  1WJ7 A;  1ZMU A;  2VF7 A;  1D0M A;  3EIE A;  4AW4 A;  4B7G A;  1YSY A;  2ZAO A;  3KOX E;  4I5S A;  2R62 A;  1IBM M;  4HEO A;  5DYG A;  2I7N A;  3L29 A;  1QZE A;  4RF0 A;  1DO0 A;  2QZ4 A;  4S12 A;  1L2D A;  2EUC A;  5KPT A;  2X8A A;  3GPX A;  3GLF E;  3GLG B;  3VDU A;  3PNV A;  1ZQ9 A;  5KO3 A;  3PNY A;  3SBJ A;  1G41 A;  3BXW A;  2O01 F;  3VK7 A;  1EE8 A;  1QYR A;  1IN4 A;  3KOW E;  4DV2 M;  2RRU A;  1W5T A;  4D80 A;  3UJN A;  4G4Q A;  2R65 A;  3GP1 A;  3I01 M;  5ITQ A;  1VQ1 A;  3U60 A;  4B3R M;  2YR0 A;  3QAU A;  5IT9 S;  3FUX A;  4REZ A;  2KRK A;  4DV5 M;  2KNA A;  3JR4 A;  1J7K A;  1WGL A;  3J2P B;  1HNZ M;  3SYL A;  1PJS A;  2CV1 A;  4FVM A;  3TQS A;  3W68 A;  5KPR A;  4IBK A;  4FCW A;  2XFS A;  1Q3C A;  1Z5B A;  1MN3 A;  1XWI A;  4R71 A;  1IBK M;  1FJG M;  3VKG A;  1UM8 A;  4GKK M;  2ZAM A;  1XMO M;  3TWK A;  1AIP C;  4X64 M;  3HJQ A;  1NV9 A;  1Z59 A;  2QQ8 A;  4KHP M;  5FLX S;  1L8Q A;  3U61 A;  4G4N A;  3D8L A;  4I8O A;  2A5Y B;  2Z8Y M;  1WR1 B;  1IN8 A;  1V34 A;  5EJC A;  4L15 A;  3U61 B;  2HCB A;  3FUT A;  5EXP A;  4DV3 M;  4AG5 A;  4JI3 M;  4OX9 M;  4I4L A;  4CHT B;  3GQ3 A;  3R9X B;  5LMN M;  1TR8 A;  2GQF A;  4MGZ E;  2L4F A;  1E9R A;  2DWZ B;  4JI4 M;  3CGW A;  4LRT A;  2L09 A;  1HNW M;  2APL A;  1XNQ M;  4X62 M;  4LFB M;  4NSO B;  4GIT A;  4JI8 M;  3QYE A;  1NNJ A;  4PDI A;  4ZPX A;  3FYD A;  3KW6 A;  2WSC F;  2F5S A;  4LF7 M;  4GMQ A;  4LJ9 A;  4Z8X A;  3SHG B;  3SAR A;  3J80 S;  3PXG A;  3GLH B;  2KHH A;  1Z5A A;  3T15 A;  3BBZ A;  5C18 A;  1T6O A;  2MJ5 B;  4B3S M;  4LJ6 A;  3IHP A;  5EP2 A;  4D82 A;  4JI5 M;  4GC9 A;  1GO5 A;  4PT5 A;  3HHX A;  3SAS A;  2WZJ A;  2XH9 A;  2QBY B;  2W82 A;  2JY6 B;  3A42 A;  1L1Z A;  3J7B A;  4FD2 A;  1KYI A;  4LJ5 A;  1MJG M;  4LJA A;  3SAU A;  2HL7 A;  3B7N A;  4L4U A;  4IBD A;  3H4J A;  1N36 M;  2JZ0 A;  4MGH A;  1UFZ A;  1NY6 A;  5EP3 A;  4DR7 M;  2EO2 A;  2CHV A;  2LVO C;  3K8Z A;  3R8F A;  5EXX A;  1XNR M;  1K3W A;  3VKH A;  2QCU A;  5C1B A;  2DXI A;  2KEB A;  4B08 A;  3C3D A;  3I04 M;  2DNA A;  1G4A E;  2CFO A;  3F92 A;  3I51 A;  1NJF A;  1ORY B;  3L26 A;  2K47 A;  1X37 A;  4DR3 M;  2JNH A;  3HU1 A;  2JXN A;  2BWB A;  1GL7 A;  2BWE A;  3E4R A;  4XBO A;  3TWM A;  3GLI A;  2UXC M;  2JY7 A;  4HLQ A;  1HQY E;  2L7I A;  4LF6 M;  3I4V A;  1P3Q Q;  1Q02 A;  1H6U A;  2O5R A;  2DVW B;  3FUV A;  4PD2 A;  2VDB B;  5EP4 A;  2OPF A;  2G8L A;  3L2A A;  5E6J A;  5FSW A;  3GLG A;  2Y20 A;  4LF5 M;  2HAK A;  2QPA A;  4LJ7 A;  2Q2E B;  1PRB A;  4TUW A;  1TDH A;  2DZN B;  2Y0T A;  3HX3 A;  2QBY A;  3FYC A;  2F4V M;  1OTR A;  4F1I A;  3GLH E;  1KFV A;  3ZQJ A;  4NC6 A;  1CUK A;  1T43 A;  2G5G X;  2LTU A;  1TF0 B;  5LMU M;  2R4E A;  3MJ5 A;  4BLC A;  5FTN A;  3U6P A;  2E5L M;  2LVA A;  1QZM A;  4NOO B;  2F5P A;  2L4E A;  1OFI A;  1VEG A;  2L6O A;  2KW0 A;  3LCU A;  3A45 A;  3T38 A;  3HHY A;  4B3M M;  4FW9 A;  2OOA A;  3KVW A;  2ZAN A;  1E9S A;  4CJ6 A;  1EIJ A;  1R7R A;  2KNZ A;  3IG8 A;  4AKH A;  3K2L A;  1TTE A;  1OKS A;  1QAM A;  1QAO A;  3K9O A;  4B7H A;  3C58 A;  3HKP A;  4XK8 F;  4DUY M;  3DFZ A;  1YE9 A;  4JI6 M;  5IZ7 D;  1K3X A;  4RNA A;  4XGI A;  1OQY A;  3UK6 A;  3KXE C;  4IIW A;  1W5S A;  2CUZ A;  3B89 A;  3THG A;  4BB9 A;  4K0K M;  2DHY A; 
#chains in the Genus database with same CATH homology
 2V1C A;  1TH3 A;  1IQP A;  4L16 A;  2F5Q A;  2UUA M;  1NHG C;  2Z3X A;  4M0W A;  4OW0 A;  5A2Q S;  2LH0 A;  3J81 S;  4GKJ M;  4QNR A;  2XFT A;  1HT1 E;  3GRU A;  4LZZ A;  3AJI B;  1G8P A;  2R18 A;  3KSJ A;  4IBE A;  3RGS A;  4EIW A;  5BPV A;  4AZF A;  5GKN A;  3Q8X A;  3D8B A;  4JI0 M;  5JI2 E;  2KA6 B;  1SXJ E;  3SFZ A;  4L8R C;  1SXJ C;  2OQ4 A;  4JI2 M;  1Z5C A;  5JI3 E;  1IY1 A;  3AKZ A;  4MB7 A;  2QP9 X;  3LVW A;  3U60 B;  1G3I A;  3A98 B;  1TH4 A;  2FNA A;  5FTK A;  3GLI B;  2M60 A;  3LVV A;  2Z7J A;  1IN7 A;  4FCV A;  4LJ4 A;  4IBC A;  2ZBK B;  3I4Y A;  3SC3 A;  3JAM S;  3SAW A;  4JI7 M;  4NXM M;  3KSX A;  1MX0 A;  2LNH C;  3SAV A;  3GRY A;  3W0L B;  3GRV A;  3ZC7 B;  3U6S A;  2F5N A;  1DO2 A;  2V6Z M;  2RKO A;  3MK6 A;  4DV0 M;  2X49 A;  1J5E M;  2Y21 A;  4GC5 A;  1WXQ A;  1NNU C;  2C98 A;  3JR5 A;  3PVS A;  5KQD A;  2JA2 A;  3GRR A;  4DR1 M;  1HQC A;  5KPZ A;  3AOE A;  3KS4 A;  3KFU G;  3GO8 A;  4M9X A;  1OFH A;  3SHF A;  3M6A A;  4AI6 A;  4G4O A;  4IBI A;  4CIS A;  1N32 M;  4MH0 E;  2HHH M;  3AV0 A;  3K92 A;  1GVN A;  5BR8 M;  4LFA M;  3K1J A;  3U5Z A;  3FKE A;  4KO8 A;  5EP1 A;  1K82 A;  4ITQ A;  4DV4 M;  4OVZ A;  3VK8 A;  1OJL A;  1TGU A;  1GL6 A;  2QEN A;  3CF6 E;  4NRW A;  4G4R A;  2J7N A;  3NWL A;  4IJF A;  3HWS A;  3AL0 C;  2NQ8 C;  3FTC A;  1S3S A;  3RE8 A;  3B9P A;  5IRE B;  2D7E A;  2BNK A;  3EIH A;  4JV5 M;  4KOD A;  3AOE C;  2M5Z A;  1N34 M;  2BJW A;  1XMQ M;  4GHA A;  4KLN A;  1I4W A;  3U6Q A;  3ILK A;  4DR2 M;  1PJI A;  2RGH A;  2XLJ A;  4JN6 A;  4FWG A;  4LJ8 A;  3U5Z B;  3FUW A;  1QAQ A;  4MGI E;  4NXN M;  1SXJ B;  1R6B X;  2Y0Q A;  4QHS A;  3U6C A;  1DGH A;  2VII A;  4DR5 M;  3U6E A;  1TH2 A;  2D7H A;  1IBL M;  1HNX M;  3CF2 A;  5IWA M;  3UZU A;  4OU7 A;  3CTW B;  2XEP A;  1D2N A;  4DV6 M;  1IN5 A;  2DHR A;  1NSF A;  4MGY E;  4R3D A;  2EA0 A;  1JR3 A;  3TWL A;  2YFQ A;  4FCT A;  1IY2 A;  1Q3B A;  4WUR A;  5ITR A;  4NL4 H;  4X66 M;  3GPP A;  1JQJ C;  4LF4 M;  1QQW A;  1E32 A;  4WW0 A;  5FTM A;  4LFC M;  5ITU A;  1GLN A;  3H4M A;  4G6Z A;  3T1H M;  4GIP A;  2Z4R A;  1JR3 D;  4JYA M;  2KRU A;  3GPU A;  1IXZ A;  3HGI A;  2XGN A;  2L7H A;  4LGM A;  1E94 E;  4P16 A;  4AKI A;  3GLH A;  3FTD A;  1XHB A;  1VDD A;  4B3T M;  3M0E A;  3KP0 E;  4DV7 M;  1LV7 A;  2D7G A;  3E9S A;  3DOA A;  3FD9 A;  3M7G A;  3VLF B;  3TL4 X;  1PM5 A;  5FTJ A;  1N75 A;  2AHM A;  1TDZ A;  4FWH A;  5E26 A;  7CAT A;  3TE6 A;  3HU3 A;  3LQR A;  3ZH9 B;  3TPZ A;  3GPY A;  3SMS A;  1ZAE A;  4PDG A;  5EXS A;  2FFJ A;  2XSZ A;  3MHV C;  4QOS A;  4AQY M;  2LWX A;  4YHH M;  2CV2 A;  2DWL A;  4A3V B;  4M9Z A;  3RFW A;  5EXT A;  2H1R A;  1YUB A;  2LXE A;  2KZU A;  3NBI A;  1IM2 A;  2F5O A;  4LY6 A;  2XSZ D;  3CF0 A;  5EQT A;  2I7P A;  4AG6 A;  5ITY A;  3UMM A;  1L2B A;  4JI1 M;  2KZS A;  2J7O A;  1QAN A;  2YNM D;  4RF1 A;  4LG2 A;  2R46 A;  2C9O A;  3HHZ A;  2CHQ A;  3L25 A;  1XC8 A;  4OVZ B;  3DZD A;  3BOS A;  4IJE A;  4II7 A;  4W5W A;  1SXJ D;  2XF3 A;  3GQ5 A;  2DZO B;  1T3T A;  4R7G A;  1I94 M;  2VQE M;  1R2Z A;  4YY3 M;  2CE7 A;  4GH9 A;  4L78 A;  2P5T A;  2Z4S A;  1IXR C;  3T1Y M;  2VQF M;  4NRV A;  1KSF X;  2CHG A;  4DR6 M;  3J7A S;  1R2Y A;  1FNN A;  3PFI A;  4LGY A;  3KP1 E;  2RGO A;  2UUB M;  2CV0 A;  1HT2 E;  1Z6T A;  5ITX A;  4CGY B;  3LMM A;  3U6M A;  4IBB A;  2UU9 M;  4DUZ M;  1L2C A;  2DWM A;  3U6L A;  4IBG A;  1NVM A;  4PCZ A;  3KOZ E;  3L28 A;  1XXH A;  3QWL A;  1HR0 M;  1GKI A;  1L1T A;  5KQ8 A;  4Z6Y A;  4IBF A;  2FOI C;  3U6D A;  3SAT A;  5FTL A;  4MGK E;  3J27 B;  2DWN A;  4HL4 A;  3HU2 A;  1MU5 A;  2UXD M;  3UGJ A;  3SYK A;  4NSR A;  3FUU A;  3IG5 A;  2CEA A;  4QNM A;  2KXE A;  3KOY E;  2FE8 A;  1DGH B;  3L27 A;  2YQZ A;  4D81 A;  3DA1 A;  3W0F A;  4MM3 B;  3RGP A;  3KDS E;  1SXJ A;  4LCB A;  3WHL A;  3AOG A;  3GQ4 A;  4GHL A;  4GRI A;  3SMP A;  4I81 A;  1DGG A;  4QHT A;  3WHK A;  2C96 A;  1C1K A;  4AKG A;  5ITX E;  2UUC M;  3GLF B;  4DR4 M;  3FTF A;  3HJ8 A;  2C9C A;  2X4A A;  2R45 A;  2R4J A;  1N77 A;  1IY0 A;  1IXS B;  1N33 M;  3AFH A;  5DNY A;  3GLF A;  1J09 A;  2ERC A;  2UXB M;  2XZU A;  1DGB A;  4LRS A;  3VDP A;  3OTO M;  1QVR A;  1DGF A;  3HJS A;  4DV1 M;  2C5R A;  4JXJ A;  3LQQ A;  1IN6 A;  1NJG A;  5F3W A;  3HHW A;  4LF9 M;  3KS8 A;  4LF8 M;  2XZF A;  1N78 A;  1Q39 A;  3A46 A;  4M0D A;  5ITT A;  8CAT A;  3FTE A;  3U6O A;  4M9S A;  5H37 D;  4IBJ A;  1PJJ A;  1G59 A;  4X65 M;  4FWD A;  4LZJ A;  2BJV A;  1NHW C;  5DYI A;  4BBA A;  2C99 A;  2HKJ A;  3VFD A;  1NY5 A;  2ZM6 M;  3ZCB B;  4QOZ C;  4B7F A;  2V1U A;  1XXH B;  3EIE A;  4AW4 A;  4B7G A;  1YSY A;  2ZAO A;  3KOX E;  4I5S A;  2R62 A;  1IBM M;  5DYG A;  2I7N A;  3L29 A;  4RF0 A;  1DO0 A;  2QZ4 A;  4S12 A;  1L2D A;  2EUC A;  5KPT A;  2X8A A;  3GPX A;  3GLG B;  3VDU A;  3PNV A;  1ZQ9 A;  5KO3 A;  3PNY A;  3SBJ A;  1G41 A;  3VK7 A;  1EE8 A;  1QYR A;  1IN4 A;  3KOW E;  4DV2 M;  1W5T A;  4D80 A;  3UJN A;  4G4Q A;  2R65 A;  3GP1 A;  5ITQ A;  3U60 A;  4B3R M;  2YR0 A;  3QAU A;  5IT9 S;  3FUX A;  4REZ A;  2KRK A;  4DV5 M;  3JR4 A;  1J7K A;  3J2P B;  1HNZ M;  3SYL A;  2CV1 A;  4FVM A;  3TQS A;  5KPR A;  4IBK A;  4FCW A;  2XFS A;  1Q3C A;  1Z5B A;  1XWI A;  1IBK M;  1FJG M;  3VKG A;  1UM8 A;  4GKK M;  2ZAM A;  1XMO M;  3TWK A;  4X64 M;  3HJQ A;  4KHP M;  1Z59 A;  5FLX S;  1L8Q A;  3U61 A;  4G4N A;  3D8L A;  4I8O A;  2A5Y B;  1IN8 A;  5EJC A;  4L15 A;  2HCB A;  3FUT A;  5EXP A;  4DV3 M;  4AG5 A;  4JI3 M;  4OX9 M;  4I4L A;  4CHT B;  3GQ3 A;  3R9X B;  5LMN M;  4MGZ E;  1E9R A;  2DWZ B;  4JI4 M;  4LRT A;  2L09 A;  1HNW M;  1XNQ M;  4LFB M;  4X62 M;  4NSO B;  4GIT A;  4JI8 M;  1NNJ A;  4PDI A;  4ZPX A;  3FYD A;  3KW6 A;  2F5S A;  4LF7 M;  4GMQ A;  4LJ9 A;  4Z8X A;  3SHG B;  3SAR A;  3J80 S;  3PXG A;  3GLH B;  1Z5A A;  3T15 A;  5C18 A;  4B3S M;  4LJ6 A;  5EP2 A;  4D82 A;  4JI5 M;  4GC9 A;  4PT5 A;  3HHX A;  3SAS A;  2XH9 A;  2QBY B;  2W82 A;  3A42 A;  1L1Z A;  3J7B A;  4FD2 A;  1KYI A;  4LJ5 A;  4LJA A;  3SAU A;  2HL7 A;  4L4U A;  4IBD A;  1N36 M;  4MGH A;  5EP3 A;  1NY6 A;  4DR7 M;  2EO2 A;  2CHV A;  3K8Z A;  3R8F A;  5EXX A;  1XNR M;  1K3W A;  3VKH A;  2QCU A;  5C1B A;  2DXI A;  2KEB A;  4B08 A;  1G4A E;  2CFO A;  3I51 A;  1NJF A;  1ORY B;  3L26 A;  2K47 A;  1X37 A;  4DR3 M;  3HU1 A;  1GL7 A;  3E4R A;  4XBO A;  3TWM A;  3GLI A;  2UXC M;  4HLQ A;  1HQY E;  2L7I A;  4LF6 M;  3I4V A;  1H6U A;  2O5R A;  2DVW B;  3FUV A;  4PD2 A;  5EP4 A;  2OPF A;  2G8L A;  3L2A A;  5E6J A;  5FSW A;  3GLG A;  2Y20 A;  4LF5 M;  2QPA A;  4LJ7 A;  2Q2E B;  4TUW A;  1TDH A;  2DZN B;  2Y0T A;  2QBY A;  3FYC A;  2F4V M;  1KFV A;  2G5G X;  5LMU M;  2R4E A;  3MJ5 A;  4BLC A;  5FTN A;  3U6P A;  2E5L M;  1QZM A;  4NOO B;  2F5P A;  1OFI A;  2L6O A;  2KW0 A;  3T38 A;  3A45 A;  3HHY A;  4B3M M;  4FW9 A;  3KVW A;  2ZAN A;  1E9S A;  1R7R A;  3IG8 A;  4AKH A;  3K2L A;  1QAM A;  1QAO A;  4B7H A;  3C58 A;  3HKP A;  4DUY M;  3DFZ A;  1YE9 A;  4JI6 M;  5IZ7 D;  1K3X A;  4RNA A;  4XGI A;  3UK6 A;  3KXE C;  4IIW A;  1W5S A;  2CUZ A;  3THG A;  4BB9 A;  4K0K M;  3U61 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...