3KP0E

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (dab) (aerobic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp0E02
3KOWE 3KOZE 3KOXE 3KP0E 3KP1E 3KOYE
chains in the Genus database with same CATH superfamily
1N32M 1QVRA 2R18A 3D8LA 2C5RA 4GRIA 4AKIA 2A5YB 1Q39A 3T38A 2F5NA 3U61A 5IREB 2QQ8A 3IG5A 3AOGA 4FCTA 4LZZA 5ITRA 4KHPM 2LVOC 1YLAA 2JY6B 1CUKA 2C96A 4G6ZA 4L6V6 4IBEA 3TWKA 2QBYA 4DV7M 5DFLA 3J7BA 4I5SA 5IZ7D 3GRUA 3L2AA 2EO2A 2QP9X 1R5LA 1K82A 1GL7A 1DGBA 3GLGE 2QPAA 3NBIA 3THGA 2G8LA 4AI6A 3L29A 1LTMA 2QENA 3KOZE 1N34M 1ORYB 5EJCA 4LJ4A 2K6BA 1TR8A 5JI2E 1PGYA 2ZBKB 3VKHA 4JI0M 3TQSA 2UUBM 3FTDA 2K9DA 2CUZA 1QZEA 2DNAA 2JZ0A 2DXIA 4GKJM 4G3OA 3SAWA 4TUWA 2DI0A 2LVQD 2GNOA 2M5ZA 1DO0A 2RKOA 2DAMA 4QNMA 5EQTA 3VFDA 2UUCM 1XXHE 4P16A 3K92A 3JAMS 1HJPA 2H5XA 2ZTCA 4LJAA 1NNUC 1YE9A 3L25A 1NY5A 2LHGA 3TWLA 4II7A 1QZMA 2OO9A 3F92A 3SFZA 5ITTA 2EA0A 2UXDM 2DZNB 2KW0A 1G41A 5EXPA 4HEOA 4BB9A 4L78A 4B7HA 1X37A 2XF3A 4S12A 1KFVA 4DR1M 1W5TA 2DHYA 1IQPA 4JI7M 1IBLM 4YHHM 3CF2A 1GO5A 4PCZA 2JY8A 3KS4A 5FTLA 3FKEA 3EIEA 2B3TA 4MGYE 2CV0A 2EKFA 2R6FA 2CWBA 2X49A 3L28A 4MM3B 4PDIA 1TH4A 1GL6A 3DA1A 3SBJA 1RU3A 2OOBA 2WSFF 1MJGM 2ZAMA 1ZV1A 3TL4X 1D0MA 1E94E 2FH0A 3C9PA 4LY6A 4DBGB 1XXHA 1OQYA 4AQYM 4DR4M 4M0WA 4D82A 4LGMA 1R7RA 2Z3XA 1VEGA 1K3WA 4BBAA 2Q2EB 2LWXA 3J81S 2FE8A 3CF6E 4LFAM 3QWLA 1IFYA 4I81A 2HL7A 4REZA 4GHLA 1HQCA 1T3TA 2F5OA 4DUZM 1D0KA 4WW0A 4MGHA 3GO8A 5DYIA 2V1UA 3KOXE 2BJVA 4IBDA 3I51A 1T6OA 3FUTA 3HHZA 3HKPA 1XMQM 1T43A 5IT9S 3ZC7B 2Z4RA 2NQ8C 5EP1A 4ITQA 2GQFA 4B7GA 4DR7M 1N78A 2Y0TA 1TF0B 4NL4H 1L1TA 2VDBB 1TH3A 1XMOM 3E46A 1KSFX 3J2PB 2LH0A 3SHGB 3VKGA 2QHOB 3K2LA 3RGPA 3GLHE 1IN5A 1VQ1A 1VEJA 1Z5CA 1ZMUA 3LVWA 4NRVA 3W0LB 2YR0A 2Z8YM 3Q8XA 3JR5A 3GRVA 2OOAA 1DGHB 5KQDA 2F5QA 3HWSA 4F1IA 2R65A 2JA2A 4IJFA 1VG5A 3LW5F 4UN2B 3GQ4A 2KEBA 1H6UA 2CEAA 3KSJA 3MMPA 4DV3M 1NHGC 1XC8A 4NSRA 4CHTB 3U6SA 3KOWE 2LBCA 1YSYA 4QHTA 2DWLA 1SXJE 3MJ5A 4GH9A 1W5SA 1GJSA 3CTWB 4RF1A 3GLFE 2HHHM 3V76A 3R9XB 4WURA 2RRUA 1KYIA 1TDHA 3IECA 4GC9A 3KDSE 1V34A 1Q3BA 4R3DA 5EXTA 3PXGA 8CATA 5FTJA 1IY0A 3OTOM 1TTEA 1MN3A 4IBFA 3FD9A 2H1RA 3U6LA 3U6CA 3H4JA 2X8AA 3IHPA 3KSXA 4DR2M 4DV6M 1N77A 2WSCF 1AUAA 2I7NA 3DFZA 4CJ6A 3A45A 1VDLA 2R62A 5IWAM 4LG2A 1XNQM 2D7HA 4FWHA 1PJJA 4IBJA 4QOSA 3VK7A 1DGHA 4LJ5A 1NNJA 2FNAA 2XLJA 3KP0E 2J7OA 3I01M 3FTFA 5ITXE 3A42A 3GQ3A 2XZUA 5DYGA 3GPUA 4P17A 3HGIA 3DOAA 4PT5A 3T1HM 2RGOA 2DAEA 1QQWA 5FLXS 2VF8A 2CV2A 2G5GX 4DUYM 4W5WA 1Z5AA 2MR9A 1R2ZA 4KODA 4LF6M 2KRUA 2DWMA 3B74A 4GKKM 4LZJA 1HR0M 3T1YM 3RFWA 2R4EA 2J7NA 3T15A 2YQZA 1IXSB 2LVNC 4M9ZA 3GLIA 1IXSA 1JQJC 1Z6TA 3GRRA 2VF7A 4ANRA 1HT1E 1GVNA 2L4FA 2RGHA 3L27A 2KNVA 4OVZA 2DWNA 5LMNM 3LCUA 4RNAA 3FUXA 1TGUA 4KLNA 4AG5A 1WR1B 4L15A 1Z5BA 4B3SM 3HU3A 3U60A 1E9SA 3B9PA 1R2YA 1A5TA 4LF4M 3I4YA 4GEWA 3SAUA 4RKUF 1QAQA 3T6PA 2DAIA 1BVSA 1XB2B 1Q02A 1TDZA 2CHVA 2MGWA 3AKZA 4WP2A 1IXRC 3R8FA 5ITYA 5L8RF 2FFJA 4FCWA 3RGSA 3D8BA 3U6PA 2FOIC 4MGKE 3GLFB 4XK8F 4FD2A 2MH8A 2KZSA 4OVZB 4JI3M 1SG9A 1C7YA 3B89A 4B3TM 1HT2E 1SXJD 2LVAA 3HX3A 1HNWM 4LF7M 1WXQA 4XGIA 1OIZA 2O01F 3C3DA 3AV0A 1XHBA 3M7GA 1PRBA 3NWLA 3UZUA 5FTKA 4AKGA 5F3WA 2X4AA 3TWMA 3U6QA 3AOEC 3AJIB 1OIPA 4G4NA 5KQ8A 1ZAEA 3J27B 4MGZE 2UXCM 2JXNA 1GLNA 3ZQJA 2WZJA 4NOOB 1EIJA 1DV0A 2XSZA 3C3EA 4AG6A 1EFUB 3GLIE 4JYAM 2KA6B 1MU5A 2LHCA 3TPZA 1L2DA 3B7ZA 2HKJA 3FRHA 3KW6A 2VQFM 3I4VA 3RE8A 3JR4A 3BBZA 1DO2A 1E9RA 1OFHA 3LQQA 1LV7A 2L7IA 3SATA 4LGYA 2DZOB 2YFQA 1QUTA 3K9OA 4LF9M 2G3QA 4Y28F 4DV1M 3AOEA 3BOSA 1QYRA 3KFUG 2UXBM 1Y8GA 3DZDA 4OU7A 2F5PA 2XEPA 4LF5M 3K9PA 3H4MA 3BXWA 3CF0A 2XH9A 1OAOC 3U6OA 4PDGA 1QDTA 3FYDA 5KO3A 2MROB 1IN6A 4LFBM 1JR3E 4ZPXA 1D2NA 3HHYA 1F4IA 1QAMA 1L8QA 4BLCA 1JB0F 1G3IA 3HJQA 3WHKA 2F5SA 4LJ8A 4X66M 1FNNA 5EP4A 2Y20A 2V1CA 3KS8A 3GP1A 1DGFA 2QZ4A 1OAIA 3KVWA 4M0DA 2CRUA 3U6MA 3FYCA 2WSEF 4AKHA 2XZFA 4B08A 3SMPA 2BJWA 1J7KA 3SARA 2C99A 4LFCM 3SC3A 5DNYA 3C58A 2K0BX 2V6ZM 3SAVA 4FCVA 3GLHB 1PM5A 3FTEA 1Q3CA 3FE3A 1PJIA 1NSFA 2Z4SA 2UUAM 2XFTA 1SXJA 4L16A 2BWEA 5C18A 1NO1A 2C9CA 4G4RA 1OKSA 3E21A 4LRTA 4XBOA 4X62M 2E5LM 1XXHB 2EJSA 1I4WA 4AW4A 1G59A 7CATA 3SMSA 4L4UA 2DWZB 1R6BX 2DAKA 1WHCA 3E9SA 3LVVA 4DR5M 3U5ZA 1HQYE 4D81A 1NJFA 4X65M 4GIPA 2ZANA 2F4VM 3PNYA 1NY6A 4X64M 3A98B 1QUSA 1WJ7A 3HU1A 3FUWA 3LQRA 1NV8A 2L09A 4DR6M 2AHMA 2ERCA 2ZM6M 1NV9A 3HY5A 4IBKA 1ZMVA 1UFZA 5ITQA 3MK6A 4AZFA 1J5EM 4IIWA 4JXJA 3SYLA 4DV5M 2DZLA 2N35A 4DV4M 4LJ6A 1S3SA 1JR3D 5EXSA 5FTNA 1P3QQ 5H37D 1HNXM 4JI8M 1JR3A 2MJ5B 2JP7A 4EIWA 2QBYB 3HHXA 1N36M 1R4GA 2KXEA 3FRIA 4LJ7A 3J80S 1K3XA 2OPFA 4KO8A 2DAGA 2L4EA 5KPRA 1AIPC 3PFIA 2JY5A 1PJTA 3QAUA 2R45A 4QOZC 1EE8A 2LVPC 1L1ZA 2DHRA 1SXJC 2XGNA 5LMUM 2CFOA 4OX9M 4PD2A 1XNRM 2I7PA 1YUBA 3KP1E 3PVSA 4K0KM 1OTRA 2C98A 5EP2A 2KNZA 4NXMM 3VDUA 1SXJB 3B7QA 4GC5A 4JI6M 2P5TA 2M60A 5A2QS 1TH2A 4KT0F 3GLHA 4NC6A 5EP3A 1NVMA 1GKIA 2QNJA 3ILKA 3IG8A 2JNHA 2KNAA 2EUCA 1G71A 2KZUA 1E32A 4FWGA 4IBIA 2K47A 4B7FA 4JI4M 4B3RM 2ZTDA 4I4LA 2JZ1A 4JN6A 2LNHC 5ITXA 4FW9A 4F2LA 1IY1A 1QAOA 4M9XA 2Y21A 3HU2A 1IXZA 1MX0A 1ZQ9A 2BWBA 3K1JA 3KXEC 1IM2A 3QYBA 1GABA 3W68A 2O5RA 1I94M 5FTMA 3EIHA 1IN4A 3FTCA 3LMMA 4D80A 2D7EA 4YY3M 2QSFX 4GMQA 3GQ5A 2JWSA 1NHWC 2R44A 3QYEA 4RF0A 2R0IA 4LF8M 3HJ8A 1UM8A 4MGIE 1J09A 3E4RA 2J5YA 3LCVB 3A46A 3U6EA 1N33M 4LJ9A 4IBBA 2D7GA 4LCBA 3U5ZB 4CISA 4B3MM 3GPPA 3HZJA 4MH0E 3M0EA 3UK6A 2JY7A 3B7NA 1FJGM 3VDPA 4IJEA 2C9OA 5FSWA 1WGLA 2KHHA 2FS1A 3J7AS 4R71A 4G4QA 3ZCBB 3SASA 3GPXA 2APLA 4CIZA 2LTUA 3I04M 1QDRA 2HWJA 2HAKA 4Z8XA 5BPVA 3U60B 4L8RC 4LRSA 4HL4A 4NSOB 2KDLA 4G4OA 3HHWA 3SHFA 2DKLA 2BNKA 1N75A 2DVWB 2HCBA 1Z59A 5ITUA 5BR8M 4HLQA 2O25A 3K8ZA 3ZH9B 5JI3E 1PJQA 2VIIA 2CP8A 2L2DA 3PNVA 2OQ4A 2L7HA 4GITA 3GLIB 4GHAA 1V92A 1WGNA 3W67A 1DGGA 2CHQA 1OFIA 4JI5M 2QCUA 4NRWA 5EXXA 1L2CA 1IBKM 1IN8A 5KPTA 4QHSA 4JV5M 2ZAOA 1L2BA 5C1BA 1C1KA 1XWIA 2R4JA 4DV2M 1D0LA 3GRYA 3VLFB 4QNRA 3UGJA 3NBXX 3UJNA 3MHVC 2LXEA 3UMMA 4OW0A 1VDDA 2YNMD 3M6AA 4Q7JA 4DR3M 2UU9M 1NJGA 3GLGA 4CGYB 3Q8GA 4I8OA 2W82A 4JI2M 3HJSA 2Y0QA 2KRKA 3AFHA 2XSZD 1G4AE 4IBCA 3U6DA 1V33A 2L6OA 4NXNM 4A3VB 1HNZM 3FUVA 3GLFA 1IN7A 1GJTA 1IY2A 1OJLA 2DENA 2VQEM 1VEKA 2XFSA 3SYKA 3L26A 1ZMWA 4R7GA 5E26A 5GKNA 3GPYA 4Z6YA 3CGWA 3GLGB 3KOYE 5E6JA 3FUUA 1PJSA 4M9SA 3W0FA 1G8PA 4IBGA 1WIVA 1QANA 3U61B 3VK8A 2Z7JA 2EKKA 1IBMM 2JUJA 3AL0C 3TE6A 3WHLA 4JI1M 4MB7A 2CE7A 4FWDA 5KPZA 4FVMA 2CHGA 2R46A 4DV0M 2CV1A
chains in the Genus database with same CATH topology
1N32M 1QVRA 2R18A 3D8LA 2C5RA 4GRIA 4AKIA 2A5YB 1Q39A 3T38A 2F5NA 3U61A 5IREB 3IG5A 4LZZA 3AOGA 4FCTA 4KHPM 5ITRA 2C96A 4G6ZA 4IBEA 3TWKA 2QBYA 4DV7M 3J7BA 4I5SA 5IZ7D 3GRUA 3L2AA 2EO2A 2QP9X 1K82A 1GL7A 1DGBA 2QPAA 3NBIA 3THGA 2G8LA 4AI6A 3L29A 2QENA 3KOZE 1N34M 1ORYB 5EJCA 4LJ4A 5JI2E 2ZBKB 3VKHA 4JI0M 3TQSA 2UUBM 3FTDA 2DXIA 2CUZA 4GKJM 4TUWA 3SAWA 2M5ZA 3VFDA 1DO0A 2RKOA 4QNMA 5EQTA 2UUCM 4P16A 3K92A 3JAMS 4LJAA 1NNUC 1YE9A 3L25A 1NY5A 3TWLA 4II7A 1QZMA 3SFZA 5ITTA 2EA0A 2UXDM 2DZNB 2KW0A 1G41A 5EXPA 4BB9A 4L78A 4B7HA 1X37A 2XF3A 4S12A 1KFVA 4DR1M 1W5TA 1IQPA 4JI7M 1IBLM 4YHHM 3CF2A 4PCZA 3KS4A 5FTLA 3FKEA 3EIEA 4MGYE 2CV0A 2X49A 3L28A 4MM3B 4PDIA 1TH4A 1GL6A 3DA1A 3SBJA 2ZAMA 3TL4X 1E94E 4LY6A 1XXHA 4AQYM 4DR4M 4M0WA 4D82A 4LGMA 1R7RA 2Z3XA 1K3WA 4BBAA 2Q2EB 2LWXA 3J81S 2FE8A 3CF6E 4LFAM 3QWLA 4I81A 2HL7A 4REZA 4GHLA 1HQCA 1T3TA 2F5OA 4DUZM 4WW0A 4MGHA 3GO8A 5DYIA 2V1UA 3KOXE 2BJVA 4IBDA 3I51A 3FUTA 3HHZA 3HKPA 1XMQM 5IT9S 3ZC7B 2Z4RA 2NQ8C 5EP1A 4ITQA 4DR7M 4B7GA 1N78A 2Y0TA 4NL4H 1L1TA 1TH3A 1XMOM 1KSFX 3J2PB 2LH0A 3SHGB 3VKGA 3K2LA 3RGPA 1IN5A 1Z5CA 3LVWA 3W0LB 4NRVA 2YR0A 3JR5A 3Q8XA 3GRVA 1DGHB 5KQDA 2F5QA 3HWSA 2R65A 2JA2A 4IJFA 3GQ4A 2KEBA 1H6UA 2CEAA 3KSJA 4DV3M 1NHGC 1XC8A 4NSRA 4CHTB 3U6SA 3KOWE 1YSYA 4QHTA 2DWLA 1SXJE 4GH9A 3MJ5A 1W5SA 3CTWB 4RF1A 2HHHM 3R9XB 4WURA 1KYIA 1TDHA 4GC9A 3KDSE 1Q3BA 4R3DA 5EXTA 3PXGA 8CATA 5FTJA 1IY0A 3OTOM 4IBFA 3FD9A 2H1RA 3U6LA 3U6CA 2X8AA 3KSXA 4DR2M 4DV6M 1N77A 2I7NA 3DFZA 3A45A 2R62A 5IWAM 4LG2A 1XNQM 2D7HA 4FWHA 1PJJA 4IBJA 4QOSA 3VK7A 1DGHA 4LJ5A 1NNJA 2FNAA 2XLJA 3KP0E 2J7OA 3FTFA 5ITXE 3A42A 3GQ3A 2XZUA 5DYGA 3GPUA 3HGIA 3DOAA 4PT5A 3T1HM 2RGOA 1QQWA 5FLXS 2CV2A 2G5GX 4DUYM 4W5WA 1Z5AA 1R2ZA 4KODA 4LF6M 2KRUA 2DWMA 4GKKM 4LZJA 1HR0M 3T1YM 3RFWA 2R4EA 2J7NA 3T15A 2YQZA 1IXSB 4M9ZA 3GLIA 1JQJC 1Z6TA 3GRRA 1HT1E 1GVNA 3L27A 2RGHA 4OVZA 2DWNA 5LMNM 4RNAA 3FUXA 1TGUA 4KLNA 4AG5A 4L15A 1Z5BA 4B3SM 3HU3A 3U60A 1E9SA 3B9PA 1R2YA 4LF4M 3I4YA 3SAUA 1QAQA 1TDZA 2CHVA 3AKZA 1IXRC 3R8FA 5ITYA 2FFJA 4FCWA 3RGSA 3D8BA 3U6PA 2FOIC 4MGKE 3GLFB 4FD2A 4OVZB 2KZSA 4JI3M 4B3TM 1HT2E 1SXJD 1HNWM 4LF7M 1WXQA 4XGIA 3AV0A 1XHBA 3M7GA 3UZUA 3NWLA 5FTKA 4AKGA 5F3WA 2X4AA 3TWMA 3U6QA 3AOEC 3AJIB 4G4NA 5KQ8A 1ZAEA 3J27B 4MGZE 2UXCM 1GLNA 4NOOB 2XSZA 4AG6A 4JYAM 2KA6B 1MU5A 3TPZA 1L2DA 2HKJA 3KW6A 2VQFM 3I4VA 3RE8A 3JR4A 3LQQA 1DO2A 1E9RA 1OFHA 1LV7A 2L7IA 3SATA 4LGYA 2DZOB 2YFQA 4LF9M 4DV1M 3AOEA 3BOSA 1QYRA 3KFUG 2UXBM 3DZDA 4OU7A 2F5PA 2XEPA 4LF5M 3H4MA 3CF0A 2XH9A 3U6OA 4PDGA 3FYDA 5KO3A 1IN6A 4LFBM 4ZPXA 1D2NA 3HHYA 1QAMA 1L8QA 4BLCA 3WHKA 1G3IA 3HJQA 2F5SA 4LJ8A 4X66M 1FNNA 5EP4A 2Y20A 2V1CA 3KS8A 3GP1A 1DGFA 2QZ4A 3KVWA 4M0DA 3U6MA 3FYCA 4AKHA 2XZFA 4B08A 3SMPA 2BJWA 1J7KA 3SARA 2C99A 4LFCM 3SC3A 5DNYA 3C58A 2V6ZM 3SAVA 4FCVA 3GLHB 1PM5A 3FTEA 1Q3CA 1PJIA 1NSFA 2Z4SA 2UUAM 2XFTA 1SXJA 4L16A 5C18A 2C9CA 4G4RA 4XBOA 4LRTA 4X62M 2E5LM 1XXHB 1I4WA 4AW4A 1G59A 7CATA 3SMSA 4L4UA 2DWZB 1R6BX 3E9SA 3LVVA 3U5ZA 4DR5M 1HQYE 4D81A 1NJFA 4X65M 4GIPA 2ZANA 2F4VM 3PNYA 1NY6A 4X64M 3A98B 3HU1A 3LQRA 3FUWA 2L09A 4DR6M 2AHMA 2ERCA 2ZM6M 4IBKA 5ITQA 3MK6A 4AZFA 1J5EM 4IIWA 4JXJA 3SYLA 4DV5M 4DV4M 4LJ6A 1S3SA 1JR3D 5EXSA 5FTNA 5H37D 1HNXM 4JI8M 1JR3A 4EIWA 2QBYB 3HHXA 1N36M 2KXEA 4LJ7A 3J80S 1K3XA 2OPFA 4KO8A 5KPRA 3PFIA 3QAUA 2R45A 4QOZC 1EE8A 1L1ZA 2DHRA 1SXJC 2XGNA 5LMUM 2CFOA 4OX9M 4PD2A 1XNRM 2I7PA 1YUBA 3KP1E 3PVSA 4K0KM 5EP2A 2C98A 4NXMM 3VDUA 1SXJB 4GC5A 4JI6M 2P5TA 2M60A 5A2QS 1TH2A 3GLHA 5EP3A 1NVMA 1GKIA 3ILKA 3IG8A 2EUCA 2KZUA 4B7FA 1E32A 4FWGA 4IBIA 2K47A 4JI4M 4B3RM 4I4LA 4JN6A 2LNHC 5ITXA 4FW9A 1IY1A 1QAOA 4M9XA 2Y21A 3HU2A 1IXZA 1MX0A 1ZQ9A 3K1JA 3KXEC 1IM2A 2O5RA 1I94M 5FTMA 3EIHA 1IN4A 3FTCA 3LMMA 4D80A 2D7EA 4YY3M 4GMQA 3GQ5A 1NHWC 4RF0A 4LF8M 3HJ8A 1UM8A 4MGIE 1J09A 3E4RA 3A46A 3U6EA 1N33M 4LJ9A 4IBBA 2D7GA 4LCBA 3U5ZB 4CISA 4B3MM 3GPPA 4MH0E 3M0EA 3UK6A 1FJGM 3VDPA 4IJEA 2C9OA 5FSWA 3J7AS 4G4QA 3ZCBB 3SASA 3GPXA 4Z8XA 5BPVA 3U60B 4L8RC 4LRSA 4HL4A 4NSOB 4G4OA 3HHWA 3SHFA 2BNKA 1N75A 2DVWB 2HCBA 1Z59A 5ITUA 5BR8M 4HLQA 3K8ZA 3ZH9B 5JI3E 2VIIA 3PNVA 2OQ4A 2L7HA 4GITA 3GLIB 4GHAA 1DGGA 2CHQA 1OFIA 4JI5M 2QCUA 4NRWA 5EXXA 1L2CA 1IBKM 1IN8A 5KPTA 4QHSA 4JV5M 2ZAOA 1L2BA 5C1BA 1C1KA 1XWIA 2R4JA 4DV2M 3GRYA 3VLFB 4QNRA 3UGJA 3UJNA 3MHVC 2LXEA 3UMMA 4OW0A 1VDDA 2YNMD 3M6AA 4DR3M 2UU9M 1NJGA 3GLGA 4CGYB 4I8OA 4JI2M 2W82A 3HJSA 2Y0QA 2KRKA 3AFHA 2XSZD 1G4AE 4IBCA 3U6DA 2L6OA 4NXNM 4A3VB 1HNZM 3FUVA 3GLFA 1IN7A 1IY2A 1OJLA 2VQEM 2XFSA 3SYKA 3L26A 4R7GA 5GKNA 5E26A 3GPYA 4Z6YA 3GLGB 3KOYE 5E6JA 3FUUA 4M9SA 3W0FA 1G8PA 4IBGA 1QANA 3U61B 3VK8A 2Z7JA 1IBMM 3AL0C 3TE6A 3WHLA 4JI1M 4MB7A 2CE7A 4FWDA 5KPZA 4FVMA 2CHGA 2R46A 4DV0M 2CV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOW E;  3KOZ E;  3KOX E;  3KP0 E;  3KP1 E;  3KOY E; 
#chains in the Genus database with same CATH topology
 1N32 M;  1QVR A;  2R18 A;  3D8L A;  2C5R A;  4GRI A;  4AKI A;  2A5Y B;  1Q39 A;  3T38 A;  2F5N A;  3U61 A;  5IRE B;  2QQ8 A;  3IG5 A;  3AOG A;  4FCT A;  4LZZ A;  5ITR A;  4KHP M;  2LVO C;  1YLA A;  2JY6 B;  1CUK A;  2C96 A;  4G6Z A;  4L6V 6;  4IBE A;  3TWK A;  2QBY A;  4DV7 M;  5DFL A;  3J7B A;  4I5S A;  5IZ7 D;  3GRU A;  3L2A A;  2EO2 A;  2QP9 X;  1R5L A;  1K82 A;  1GL7 A;  1DGB A;  3GLG E;  2QPA A;  3NBI A;  3THG A;  2G8L A;  4AI6 A;  3L29 A;  1LTM A;  2QEN A;  3KOZ E;  1N34 M;  1ORY B;  5EJC A;  4LJ4 A;  2K6B A;  1TR8 A;  5JI2 E;  1PGY A;  2ZBK B;  3VKH A;  4JI0 M;  3TQS A;  2UUB M;  3FTD A;  2K9D A;  2CUZ A;  1QZE A;  2DNA A;  2JZ0 A;  2DXI A;  4GKJ M;  4G3O A;  3SAW A;  4TUW A;  2DI0 A;  2LVQ D;  2GNO A;  2M5Z A;  1DO0 A;  2RKO A;  2DAM A;  4QNM A;  5EQT A;  3VFD A;  2UUC M;  1XXH E;  4P16 A;  3K92 A;  3JAM S;  1HJP A;  2H5X A;  2ZTC A;  4LJA A;  1NNU C;  1YE9 A;  3L25 A;  1NY5 A;  2LHG A;  3TWL A;  4II7 A;  1QZM A;  2OO9 A;  3F92 A;  3SFZ A;  5ITT A;  2EA0 A;  2UXD M;  2DZN B;  2KW0 A;  1G41 A;  5EXP A;  4HEO A;  4BB9 A;  4L78 A;  4B7H A;  1X37 A;  2XF3 A;  4S12 A;  1KFV A;  4DR1 M;  1W5T A;  2DHY A;  1IQP A;  4JI7 M;  1IBL M;  4YHH M;  3CF2 A;  1GO5 A;  4PCZ A;  2JY8 A;  3KS4 A;  5FTL A;  3FKE A;  3EIE A;  2B3T A;  4MGY E;  2CV0 A;  2EKF A;  2R6F A;  2CWB A;  2X49 A;  3L28 A;  4MM3 B;  4PDI A;  1TH4 A;  1GL6 A;  3DA1 A;  3SBJ A;  1RU3 A;  2OOB A;  2WSF F;  1MJG M;  2ZAM A;  1ZV1 A;  3TL4 X;  1D0M A;  1E94 E;  2FH0 A;  3C9P A;  4LY6 A;  4DBG B;  1XXH A;  1OQY A;  4AQY M;  4DR4 M;  4M0W A;  4D82 A;  4LGM A;  1R7R A;  2Z3X A;  1VEG A;  1K3W A;  4BBA A;  2Q2E B;  2LWX A;  3J81 S;  2FE8 A;  3CF6 E;  4LFA M;  3QWL A;  1IFY A;  4I81 A;  2HL7 A;  4REZ A;  4GHL A;  1HQC A;  1T3T A;  2F5O A;  4DUZ M;  1D0K A;  4WW0 A;  4MGH A;  3GO8 A;  5DYI A;  2V1U A;  3KOX E;  2BJV A;  4IBD A;  3I51 A;  1T6O A;  3FUT A;  3HHZ A;  3HKP A;  1XMQ M;  1T43 A;  5IT9 S;  3ZC7 B;  2Z4R A;  2NQ8 C;  5EP1 A;  4ITQ A;  2GQF A;  4B7G A;  4DR7 M;  1N78 A;  2Y0T A;  1TF0 B;  4NL4 H;  1L1T A;  2VDB B;  1TH3 A;  1XMO M;  3E46 A;  1KSF X;  3J2P B;  2LH0 A;  3SHG B;  3VKG A;  2QHO B;  3K2L A;  3RGP A;  3GLH E;  1IN5 A;  1VQ1 A;  1VEJ A;  1Z5C A;  1ZMU A;  3LVW A;  4NRV A;  3W0L B;  2YR0 A;  2Z8Y M;  3Q8X A;  3JR5 A;  3GRV A;  2OOA A;  1DGH B;  5KQD A;  2F5Q A;  3HWS A;  4F1I A;  2R65 A;  2JA2 A;  4IJF A;  1VG5 A;  3LW5 F;  4UN2 B;  3GQ4 A;  2KEB A;  1H6U A;  2CEA A;  3KSJ A;  3MMP A;  4DV3 M;  1NHG C;  1XC8 A;  4NSR A;  4CHT B;  3U6S A;  3KOW E;  2LBC A;  1YSY A;  4QHT A;  2DWL A;  1SXJ E;  3MJ5 A;  4GH9 A;  1W5S A;  1GJS A;  3CTW B;  4RF1 A;  3GLF E;  2HHH M;  3V76 A;  3R9X B;  4WUR A;  2RRU A;  1KYI A;  1TDH A;  3IEC A;  4GC9 A;  3KDS E;  1V34 A;  1Q3B A;  4R3D A;  5EXT A;  3PXG A;  8CAT A;  5FTJ A;  1IY0 A;  3OTO M;  1TTE A;  1MN3 A;  4IBF A;  3FD9 A;  2H1R A;  3U6L A;  3U6C A;  3H4J A;  2X8A A;  3IHP A;  3KSX A;  4DR2 M;  4DV6 M;  1N77 A;  2WSC F;  1AUA A;  2I7N A;  3DFZ A;  4CJ6 A;  3A45 A;  1VDL A;  2R62 A;  5IWA M;  4LG2 A;  1XNQ M;  2D7H A;  4FWH A;  1PJJ A;  4IBJ A;  4QOS A;  3VK7 A;  1DGH A;  4LJ5 A;  1NNJ A;  2FNA A;  2XLJ A;  3KP0 E;  2J7O A;  3I01 M;  3FTF A;  5ITX E;  3A42 A;  3GQ3 A;  2XZU A;  5DYG A;  3GPU A;  4P17 A;  3HGI A;  3DOA A;  4PT5 A;  3T1H M;  2RGO A;  2DAE A;  1QQW A;  5FLX S;  2VF8 A;  2CV2 A;  2G5G X;  4DUY M;  4W5W A;  1Z5A A;  2MR9 A;  1R2Z A;  4KOD A;  4LF6 M;  2KRU A;  2DWM A;  3B74 A;  4GKK M;  4LZJ A;  1HR0 M;  3T1Y M;  3RFW A;  2R4E A;  2J7N A;  3T15 A;  2YQZ A;  1IXS B;  2LVN C;  4M9Z A;  3GLI A;  1IXS A;  1JQJ C;  1Z6T A;  3GRR A;  2VF7 A;  4ANR A;  1HT1 E;  1GVN A;  2L4F A;  2RGH A;  3L27 A;  2KNV A;  4OVZ A;  2DWN A;  5LMN M;  3LCU A;  4RNA A;  3FUX A;  1TGU A;  4KLN A;  4AG5 A;  1WR1 B;  4L15 A;  1Z5B A;  4B3S M;  3HU3 A;  3U60 A;  1E9S A;  3B9P A;  1R2Y A;  1A5T A;  4LF4 M;  3I4Y A;  4GEW A;  3SAU A;  4RKU F;  1QAQ A;  3T6P A;  2DAI A;  1BVS A;  1XB2 B;  1Q02 A;  1TDZ A;  2CHV A;  2MGW A;  3AKZ A;  4WP2 A;  1IXR C;  3R8F A;  5ITY A;  5L8R F;  2FFJ A;  4FCW A;  3RGS A;  3D8B A;  3U6P A;  2FOI C;  4MGK E;  3GLF B;  4XK8 F;  4FD2 A;  2MH8 A;  2KZS A;  4OVZ B;  4JI3 M;  1SG9 A;  1C7Y A;  3B89 A;  4B3T M;  1HT2 E;  1SXJ D;  2LVA A;  3HX3 A;  1HNW M;  4LF7 M;  1WXQ A;  4XGI A;  1OIZ A;  2O01 F;  3C3D A;  3AV0 A;  1XHB A;  3M7G A;  1PRB A;  3NWL A;  3UZU A;  5FTK A;  4AKG A;  5F3W A;  2X4A A;  3TWM A;  3U6Q A;  3AOE C;  3AJI B;  1OIP A;  4G4N A;  5KQ8 A;  1ZAE A;  3J27 B;  4MGZ E;  2UXC M;  2JXN A;  1GLN A;  3ZQJ A;  2WZJ A;  4NOO B;  1EIJ A;  1DV0 A;  2XSZ A;  3C3E A;  4AG6 A;  1EFU B;  3GLI E;  4JYA M;  2KA6 B;  1MU5 A;  2LHC A;  3TPZ A;  1L2D A;  3B7Z A;  2HKJ A;  3FRH A;  3KW6 A;  2VQF M;  3I4V A;  3RE8 A;  3JR4 A;  3BBZ A;  1DO2 A;  1E9R A;  1OFH A;  3LQQ A;  1LV7 A;  2L7I A;  3SAT A;  4LGY A;  2DZO B;  2YFQ A;  1QUT A;  3K9O A;  4LF9 M;  2G3Q A;  4Y28 F;  4DV1 M;  3AOE A;  3BOS A;  1QYR A;  3KFU G;  2UXB M;  1Y8G A;  3DZD A;  4OU7 A;  2F5P A;  2XEP A;  4LF5 M;  3K9P A;  3H4M A;  3BXW A;  3CF0 A;  2XH9 A;  1OAO C;  3U6O A;  4PDG A;  1QDT A;  3FYD A;  5KO3 A;  2MRO B;  1IN6 A;  4LFB M;  1JR3 E;  4ZPX A;  1D2N A;  3HHY A;  1F4I A;  1QAM A;  1L8Q A;  4BLC A;  1JB0 F;  1G3I A;  3HJQ A;  3WHK A;  2F5S A;  4LJ8 A;  4X66 M;  1FNN A;  5EP4 A;  2Y20 A;  2V1C A;  3KS8 A;  3GP1 A;  1DGF A;  2QZ4 A;  1OAI A;  3KVW A;  4M0D A;  2CRU A;  3U6M A;  3FYC A;  2WSE F;  4AKH A;  2XZF A;  4B08 A;  3SMP A;  2BJW A;  1J7K A;  3SAR A;  2C99 A;  4LFC M;  3SC3 A;  5DNY A;  3C58 A;  2K0B X;  2V6Z M;  3SAV A;  4FCV A;  3GLH B;  1PM5 A;  3FTE A;  1Q3C A;  3FE3 A;  1PJI A;  1NSF A;  2Z4S A;  2UUA M;  2XFT A;  1SXJ A;  4L16 A;  2BWE A;  5C18 A;  1NO1 A;  2C9C A;  4G4R A;  1OKS A;  3E21 A;  4LRT A;  4XBO A;  4X62 M;  2E5L M;  1XXH B;  2EJS A;  1I4W A;  4AW4 A;  1G59 A;  7CAT A;  3SMS A;  4L4U A;  2DWZ B;  1R6B X;  2DAK A;  1WHC A;  3E9S A;  3LVV A;  4DR5 M;  3U5Z A;  1HQY E;  4D81 A;  1NJF A;  4X65 M;  4GIP A;  2ZAN A;  2F4V M;  3PNY A;  1NY6 A;  4X64 M;  3A98 B;  1QUS A;  1WJ7 A;  3HU1 A;  3FUW A;  3LQR A;  1NV8 A;  2L09 A;  4DR6 M;  2AHM A;  2ERC A;  2ZM6 M;  1NV9 A;  3HY5 A;  4IBK A;  1ZMV A;  1UFZ A;  5ITQ A;  3MK6 A;  4AZF A;  1J5E M;  4IIW A;  4JXJ A;  3SYL A;  4DV5 M;  2DZL A;  2N35 A;  4DV4 M;  4LJ6 A;  1S3S A;  1JR3 D;  5EXS A;  5FTN A;  1P3Q Q;  5H37 D;  1HNX M;  4JI8 M;  1JR3 A;  2MJ5 B;  2JP7 A;  4EIW A;  2QBY B;  3HHX A;  1N36 M;  1R4G A;  2KXE A;  3FRI A;  4LJ7 A;  3J80 S;  1K3X A;  2OPF A;  4KO8 A;  2DAG A;  2L4E A;  5KPR A;  1AIP C;  3PFI A;  2JY5 A;  1PJT A;  3QAU A;  2R45 A;  4QOZ C;  1EE8 A;  2LVP C;  1L1Z A;  2DHR A;  1SXJ C;  2XGN A;  5LMU M;  2CFO A;  4OX9 M;  4PD2 A;  1XNR M;  2I7P A;  1YUB A;  3KP1 E;  3PVS A;  4K0K M;  1OTR A;  2C98 A;  5EP2 A;  2KNZ A;  4NXM M;  3VDU A;  1SXJ B;  3B7Q A;  4GC5 A;  4JI6 M;  2P5T A;  2M60 A;  5A2Q S;  1TH2 A;  4KT0 F;  3GLH A;  4NC6 A;  5EP3 A;  1NVM A;  1GKI A;  2QNJ A;  3ILK A;  3IG8 A;  2JNH A;  2KNA A;  2EUC A;  1G71 A;  2KZU A;  1E32 A;  4FWG A;  4IBI A;  2K47 A;  4B7F A;  4JI4 M;  4B3R M;  2ZTD A;  4I4L A;  2JZ1 A;  4JN6 A;  2LNH C;  5ITX A;  4FW9 A;  4F2L A;  1IY1 A;  1QAO A;  4M9X A;  2Y21 A;  3HU2 A;  1IXZ A;  1MX0 A;  1ZQ9 A;  2BWB A;  3K1J A;  3KXE C;  1IM2 A;  3QYB A;  1GAB A;  3W68 A;  2O5R A;  1I94 M;  5FTM A;  3EIH A;  1IN4 A;  3FTC A;  3LMM A;  4D80 A;  2D7E A;  4YY3 M;  2QSF X;  4GMQ A;  3GQ5 A;  2JWS A;  1NHW C;  2R44 A;  3QYE A;  4RF0 A;  2R0I A;  4LF8 M;  3HJ8 A;  1UM8 A;  4MGI E;  1J09 A;  3E4R A;  2J5Y A;  3LCV B;  3A46 A;  3U6E A;  1N33 M;  4LJ9 A;  4IBB A;  2D7G A;  4LCB A;  3U5Z B;  4CIS A;  4B3M M;  3GPP A;  3HZJ A;  4MH0 E;  3M0E A;  3UK6 A;  2JY7 A;  3B7N A;  1FJG M;  3VDP A;  4IJE A;  2C9O A;  5FSW A;  1WGL A;  2KHH A;  2FS1 A;  3J7A S;  4R71 A;  4G4Q A;  3ZCB B;  3SAS A;  3GPX A;  2APL A;  4CIZ A;  2LTU A;  3I04 M;  1QDR A;  2HWJ A;  2HAK A;  4Z8X A;  5BPV A;  3U60 B;  4L8R C;  4LRS A;  4HL4 A;  4NSO B;  2KDL A;  4G4O A;  3HHW A;  3SHF A;  2DKL A;  2BNK A;  1N75 A;  2DVW B;  2HCB A;  1Z59 A;  5ITU A;  5BR8 M;  4HLQ A;  2O25 A;  3K8Z A;  3ZH9 B;  5JI3 E;  1PJQ A;  2VII A;  2CP8 A;  2L2D A;  3PNV A;  2OQ4 A;  2L7H A;  4GIT A;  3GLI B;  4GHA A;  1V92 A;  1WGN A;  3W67 A;  1DGG A;  2CHQ A;  1OFI A;  4JI5 M;  2QCU A;  4NRW A;  5EXX A;  1L2C A;  1IBK M;  1IN8 A;  5KPT A;  4QHS A;  4JV5 M;  2ZAO A;  1L2B A;  5C1B A;  1C1K A;  1XWI A;  2R4J A;  4DV2 M;  1D0L A;  3GRY A;  3VLF B;  4QNR A;  3UGJ A;  3NBX X;  3UJN A;  3MHV C;  2LXE A;  3UMM A;  4OW0 A;  1VDD A;  2YNM D;  3M6A A;  4Q7J A;  4DR3 M;  2UU9 M;  1NJG A;  3GLG A;  4CGY B;  3Q8G A;  4I8O A;  2W82 A;  4JI2 M;  3HJS A;  2Y0Q A;  2KRK A;  3AFH A;  2XSZ D;  1G4A E;  4IBC A;  3U6D A;  1V33 A;  2L6O A;  4NXN M;  4A3V B;  1HNZ M;  3FUV A;  3GLF A;  1IN7 A;  1GJT A;  1IY2 A;  1OJL A;  2DEN A;  2VQE M;  1VEK A;  2XFS A;  3SYK A;  3L26 A;  1ZMW A;  4R7G A;  5E26 A;  5GKN A;  3GPY A;  4Z6Y A;  3CGW A;  3GLG B;  3KOY E;  5E6J A;  3FUU A;  1PJS A;  4M9S A;  3W0F A;  1G8P A;  4IBG A;  1WIV A;  1QAN A;  3U61 B;  3VK8 A;  2Z7J A;  2EKK A;  1IBM M;  2JUJ A;  3AL0 C;  3TE6 A;  3WHL A;  4JI1 M;  4MB7 A;  2CE7 A;  4FWD A;  5KPZ A;  4FVM A;  2CHG A;  2R46 A;  4DV0 M;  2CV1 A; 
#chains in the Genus database with same CATH homology
 1N32 M;  1QVR A;  2R18 A;  3D8L A;  2C5R A;  4GRI A;  4AKI A;  2A5Y B;  1Q39 A;  3T38 A;  2F5N A;  3U61 A;  5IRE B;  3IG5 A;  4LZZ A;  3AOG A;  4FCT A;  4KHP M;  5ITR A;  2C96 A;  4G6Z A;  4IBE A;  3TWK A;  2QBY A;  4DV7 M;  3J7B A;  4I5S A;  5IZ7 D;  3GRU A;  3L2A A;  2EO2 A;  2QP9 X;  1K82 A;  1GL7 A;  1DGB A;  2QPA A;  3NBI A;  3THG A;  2G8L A;  4AI6 A;  3L29 A;  2QEN A;  3KOZ E;  1N34 M;  1ORY B;  5EJC A;  4LJ4 A;  5JI2 E;  2ZBK B;  3VKH A;  4JI0 M;  3TQS A;  2UUB M;  3FTD A;  2DXI A;  2CUZ A;  4GKJ M;  4TUW A;  3SAW A;  2M5Z A;  3VFD A;  1DO0 A;  2RKO A;  4QNM A;  5EQT A;  2UUC M;  4P16 A;  3K92 A;  3JAM S;  4LJA A;  1NNU C;  1YE9 A;  3L25 A;  1NY5 A;  3TWL A;  4II7 A;  1QZM A;  3SFZ A;  5ITT A;  2EA0 A;  2UXD M;  2DZN B;  2KW0 A;  1G41 A;  5EXP A;  4BB9 A;  4L78 A;  4B7H A;  1X37 A;  2XF3 A;  4S12 A;  1KFV A;  4DR1 M;  1W5T A;  1IQP A;  4JI7 M;  1IBL M;  4YHH M;  3CF2 A;  4PCZ A;  3KS4 A;  5FTL A;  3FKE A;  3EIE A;  4MGY E;  2CV0 A;  2X49 A;  3L28 A;  4MM3 B;  4PDI A;  1TH4 A;  1GL6 A;  3DA1 A;  3SBJ A;  2ZAM A;  3TL4 X;  1E94 E;  4LY6 A;  1XXH A;  4AQY M;  4DR4 M;  4M0W A;  4D82 A;  4LGM A;  1R7R A;  2Z3X A;  1K3W A;  4BBA A;  2Q2E B;  2LWX A;  3J81 S;  2FE8 A;  3CF6 E;  4LFA M;  3QWL A;  4I81 A;  2HL7 A;  4REZ A;  4GHL A;  1HQC A;  1T3T A;  2F5O A;  4DUZ M;  4WW0 A;  4MGH A;  3GO8 A;  5DYI A;  2V1U A;  3KOX E;  2BJV A;  4IBD A;  3I51 A;  3FUT A;  3HHZ A;  3HKP A;  1XMQ M;  5IT9 S;  3ZC7 B;  2Z4R A;  2NQ8 C;  5EP1 A;  4ITQ A;  4DR7 M;  4B7G A;  1N78 A;  2Y0T A;  4NL4 H;  1L1T A;  1TH3 A;  1XMO M;  1KSF X;  3J2P B;  2LH0 A;  3SHG B;  3VKG A;  3K2L A;  3RGP A;  1IN5 A;  1Z5C A;  3LVW A;  3W0L B;  4NRV A;  2YR0 A;  3JR5 A;  3Q8X A;  3GRV A;  1DGH B;  5KQD A;  2F5Q A;  3HWS A;  2R65 A;  2JA2 A;  4IJF A;  3GQ4 A;  2KEB A;  1H6U A;  2CEA A;  3KSJ A;  4DV3 M;  1NHG C;  1XC8 A;  4NSR A;  4CHT B;  3U6S A;  3KOW E;  1YSY A;  4QHT A;  2DWL A;  1SXJ E;  4GH9 A;  3MJ5 A;  1W5S A;  3CTW B;  4RF1 A;  2HHH M;  3R9X B;  4WUR A;  1KYI A;  1TDH A;  4GC9 A;  3KDS E;  1Q3B A;  4R3D A;  5EXT A;  3PXG A;  8CAT A;  5FTJ A;  1IY0 A;  3OTO M;  4IBF A;  3FD9 A;  2H1R A;  3U6L A;  3U6C A;  2X8A A;  3KSX A;  4DR2 M;  4DV6 M;  1N77 A;  2I7N A;  3DFZ A;  3A45 A;  2R62 A;  5IWA M;  4LG2 A;  1XNQ M;  2D7H A;  4FWH A;  1PJJ A;  4IBJ A;  4QOS A;  3VK7 A;  1DGH A;  4LJ5 A;  1NNJ A;  2FNA A;  2XLJ A;  3KP0 E;  2J7O A;  3FTF A;  5ITX E;  3A42 A;  3GQ3 A;  2XZU A;  5DYG A;  3GPU A;  3HGI A;  3DOA A;  4PT5 A;  3T1H M;  2RGO A;  1QQW A;  5FLX S;  2CV2 A;  2G5G X;  4DUY M;  4W5W A;  1Z5A A;  1R2Z A;  4KOD A;  4LF6 M;  2KRU A;  2DWM A;  4GKK M;  4LZJ A;  1HR0 M;  3T1Y M;  3RFW A;  2R4E A;  2J7N A;  3T15 A;  2YQZ A;  1IXS B;  4M9Z A;  3GLI A;  1JQJ C;  1Z6T A;  3GRR A;  1HT1 E;  1GVN A;  3L27 A;  2RGH A;  4OVZ A;  2DWN A;  5LMN M;  4RNA A;  3FUX A;  1TGU A;  4KLN A;  4AG5 A;  4L15 A;  1Z5B A;  4B3S M;  3HU3 A;  3U60 A;  1E9S A;  3B9P A;  1R2Y A;  4LF4 M;  3I4Y A;  3SAU A;  1QAQ A;  1TDZ A;  2CHV A;  3AKZ A;  1IXR C;  3R8F A;  5ITY A;  2FFJ A;  4FCW A;  3RGS A;  3D8B A;  3U6P A;  2FOI C;  4MGK E;  3GLF B;  4FD2 A;  4OVZ B;  2KZS A;  4JI3 M;  4B3T M;  1HT2 E;  1SXJ D;  1HNW M;  4LF7 M;  1WXQ A;  4XGI A;  3AV0 A;  1XHB A;  3M7G A;  3UZU A;  3NWL A;  5FTK A;  4AKG A;  5F3W A;  2X4A A;  3TWM A;  3U6Q A;  3AOE C;  3AJI B;  4G4N A;  5KQ8 A;  1ZAE A;  3J27 B;  4MGZ E;  2UXC M;  1GLN A;  4NOO B;  2XSZ A;  4AG6 A;  4JYA M;  2KA6 B;  1MU5 A;  3TPZ A;  1L2D A;  2HKJ A;  3KW6 A;  2VQF M;  3I4V A;  3RE8 A;  3JR4 A;  3LQQ A;  1DO2 A;  1E9R A;  1OFH A;  1LV7 A;  2L7I A;  3SAT A;  4LGY A;  2DZO B;  2YFQ A;  4LF9 M;  4DV1 M;  3AOE A;  3BOS A;  1QYR A;  3KFU G;  2UXB M;  3DZD A;  4OU7 A;  2F5P A;  2XEP A;  4LF5 M;  3H4M A;  3CF0 A;  2XH9 A;  3U6O A;  4PDG A;  3FYD A;  5KO3 A;  1IN6 A;  4LFB M;  4ZPX A;  1D2N A;  3HHY A;  1QAM A;  1L8Q A;  4BLC A;  3WHK A;  1G3I A;  3HJQ A;  2F5S A;  4LJ8 A;  4X66 M;  1FNN A;  5EP4 A;  2Y20 A;  2V1C A;  3KS8 A;  3GP1 A;  1DGF A;  2QZ4 A;  3KVW A;  4M0D A;  3U6M A;  3FYC A;  4AKH A;  2XZF A;  4B08 A;  3SMP A;  2BJW A;  1J7K A;  3SAR A;  2C99 A;  4LFC M;  3SC3 A;  5DNY A;  3C58 A;  2V6Z M;  3SAV A;  4FCV A;  3GLH B;  1PM5 A;  3FTE A;  1Q3C A;  1PJI A;  1NSF A;  2Z4S A;  2UUA M;  2XFT A;  1SXJ A;  4L16 A;  5C18 A;  2C9C A;  4G4R A;  4XBO A;  4LRT A;  4X62 M;  2E5L M;  1XXH B;  1I4W A;  4AW4 A;  1G59 A;  7CAT A;  3SMS A;  4L4U A;  2DWZ B;  1R6B X;  3E9S A;  3LVV A;  3U5Z A;  4DR5 M;  1HQY E;  4D81 A;  1NJF A;  4X65 M;  4GIP A;  2ZAN A;  2F4V M;  3PNY A;  1NY6 A;  4X64 M;  3A98 B;  3HU1 A;  3LQR A;  3FUW A;  2L09 A;  4DR6 M;  2AHM A;  2ERC A;  2ZM6 M;  4IBK A;  5ITQ A;  3MK6 A;  4AZF A;  1J5E M;  4IIW A;  4JXJ A;  3SYL A;  4DV5 M;  4DV4 M;  4LJ6 A;  1S3S A;  1JR3 D;  5EXS A;  5FTN A;  5H37 D;  1HNX M;  4JI8 M;  1JR3 A;  4EIW A;  2QBY B;  3HHX A;  1N36 M;  2KXE A;  4LJ7 A;  3J80 S;  1K3X A;  2OPF A;  4KO8 A;  5KPR A;  3PFI A;  3QAU A;  2R45 A;  4QOZ C;  1EE8 A;  1L1Z A;  2DHR A;  1SXJ C;  2XGN A;  5LMU M;  2CFO A;  4OX9 M;  4PD2 A;  1XNR M;  2I7P A;  1YUB A;  3KP1 E;  3PVS A;  4K0K M;  5EP2 A;  2C98 A;  4NXM M;  3VDU A;  1SXJ B;  4GC5 A;  4JI6 M;  2P5T A;  2M60 A;  5A2Q S;  1TH2 A;  3GLH A;  5EP3 A;  1NVM A;  1GKI A;  3ILK A;  3IG8 A;  2EUC A;  2KZU A;  4B7F A;  1E32 A;  4FWG A;  4IBI A;  2K47 A;  4JI4 M;  4B3R M;  4I4L A;  4JN6 A;  2LNH C;  5ITX A;  4FW9 A;  1IY1 A;  1QAO A;  4M9X A;  2Y21 A;  3HU2 A;  1IXZ A;  1MX0 A;  1ZQ9 A;  3K1J A;  3KXE C;  1IM2 A;  2O5R A;  1I94 M;  5FTM A;  3EIH A;  1IN4 A;  3FTC A;  3LMM A;  4D80 A;  2D7E A;  4YY3 M;  4GMQ A;  3GQ5 A;  1NHW C;  4RF0 A;  4LF8 M;  3HJ8 A;  1UM8 A;  4MGI E;  1J09 A;  3E4R A;  3A46 A;  3U6E A;  1N33 M;  4LJ9 A;  4IBB A;  2D7G A;  4LCB A;  3U5Z B;  4CIS A;  4B3M M;  3GPP A;  4MH0 E;  3M0E A;  3UK6 A;  1FJG M;  3VDP A;  4IJE A;  2C9O A;  5FSW A;  3J7A S;  4G4Q A;  3ZCB B;  3SAS A;  3GPX A;  4Z8X A;  5BPV A;  3U60 B;  4L8R C;  4LRS A;  4HL4 A;  4NSO B;  4G4O A;  3HHW A;  3SHF A;  2BNK A;  1N75 A;  2DVW B;  2HCB A;  1Z59 A;  5ITU A;  5BR8 M;  4HLQ A;  3K8Z A;  3ZH9 B;  5JI3 E;  2VII A;  3PNV A;  2OQ4 A;  2L7H A;  4GIT A;  3GLI B;  4GHA A;  1DGG A;  2CHQ A;  1OFI A;  4JI5 M;  2QCU A;  4NRW A;  5EXX A;  1L2C A;  1IBK M;  1IN8 A;  5KPT A;  4QHS A;  4JV5 M;  2ZAO A;  1L2B A;  5C1B A;  1C1K A;  1XWI A;  2R4J A;  4DV2 M;  3GRY A;  3VLF B;  4QNR A;  3UGJ A;  3UJN A;  3MHV C;  2LXE A;  3UMM A;  4OW0 A;  1VDD A;  2YNM D;  3M6A A;  4DR3 M;  2UU9 M;  1NJG A;  3GLG A;  4CGY B;  4I8O A;  4JI2 M;  2W82 A;  3HJS A;  2Y0Q A;  2KRK A;  3AFH A;  2XSZ D;  1G4A E;  4IBC A;  3U6D A;  2L6O A;  4NXN M;  4A3V B;  1HNZ M;  3FUV A;  3GLF A;  1IN7 A;  1IY2 A;  1OJL A;  2VQE M;  2XFS A;  3SYK A;  3L26 A;  4R7G A;  5GKN A;  5E26 A;  3GPY A;  4Z6Y A;  3GLG B;  3KOY E;  5E6J A;  3FUU A;  4M9S A;  3W0F A;  1G8P A;  4IBG A;  1QAN A;  3U61 B;  3VK8 A;  2Z7J A;  1IBM M;  3AL0 C;  3TE6 A;  3WHL A;  4JI1 M;  4MB7 A;  2CE7 A;  4FWD A;  5KPZ A;  4FVM A;  2CHG A;  2R46 A;  4DV0 M;  2CV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...