3KP0E

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (dab) (aerobic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp0E02
3KOYE 3KOWE 3KP1E 3KOXE 3KOZE 3KP0E
chains in the Genus database with same CATH superfamily
2XSZA 4IBEA 4JV5M 3AOEC 2XZFA 2M5ZA 3FUTA 2CV2A 2RRUA 2XEPA 3L28A 2V1CA 3L2AA 3IG5A 3CTWB 2XZUA 3M7GA 1GL7A 4B7GA 1J09A 1OTRA 3AJIB 4LRSA 4GC9A 4JI1M 4JI5M 1IBLM 5EP2A 4AQYM 4HL4A 2X4AA 2RKOA 4L16A 3UJNA 1E9RA 1PJJA 4B3RM 1LV7A 2QQ8A 2E5LM 4M9XA 4M9ZA 1V92A 4II7A 3THGA 3GP1A 3K92A 1OKSA 1N75A 1TR8A 1A5TA 4DV5M 5IZ7D 1D0MA 2FE8A 2R44A 1GLNA 4IBIA 3VK8A 4B7HA 5C1BA 2R4JA 1XHBA 2C96A 5ITRA 1WR1B 1P3QQ 2BNKA 2MR9A 5ITXA 3J80S 1J5EM 4I81A 4DV6M 4S12A 2ZBKB 4AKHA 3VKGA 3B9PA 3NBIA 2CV0A 2Y21A 4RF1A 3ZC7B 1LTMA 1R6BX 3FYCA 3HY5A 3GLIE 3FUXA 1D0LA 3KOYE 4IBDA 3GLFA 2R0IA 3CF0A 4LFBM 2O25A 3E46A 1QVRA 2JWSA 2Z4RA 1OJLA 4PD2A 1V33A 4RNAA 3A46A 3HU3A 3TE6A 2CV1A 1OAOC 4FD2A 2DVWB 3I4VA 1XNQM 4DR4M 4NSRA 3J81S 2CHQA 1XNRM 2L2DA 2JNHA 4QNMA 1R4GA 2JXNA 2VIIA 3U6PA 3KVWA 4G6ZA 1IXSA 4IBJA 2CP8A 3GQ5A 1PJIA 1NHWC 3GPXA 2RGOA 3KS8A 2QZ4A 3UGJA 2VQFM 3GRRA 2Y0QA 8CATA 2Y0TA 4L78A 3JR5A 4LF6M 2UXBM 1GVNA 1NNJA 3U5ZB 1NO1A 4DBGB 1JB0F 4GC5A 4CISA 2ZAOA 3HU1A 4G3OA 3A42A 3U6LA 1PRBA 1QYRA 2JY8A 1HJPA 4M0DA 4NXMM 2LXEA 4LGYA 4OU7A 1XC8A 2VDBB 1OIZA 2KNAA 1IN7A 4JI0M 2H1RA 2EJSA 1Z5AA 3FUVA 3SHFA 2XLJA 2DWLA 3GLHE 3GRVA 1NJFA 3GPUA 1WIVA 4X65M 4B3TM 3HJ8A 1OFHA 1XWIA 1HQCA 1XMQM 3GLGE 3C9PA 3LQRA 1Z59A 2XF3A 5EXSA 1QQWA 2CHGA 4QNRA 2DAKA 2VF8A 3I04M 4DV7M 5LMNM 2APLA 4LJ9A 4MGZE 4X62M 3SYKA 3J27B 1DO2A 2JA2A 4JI7M 2HKJA 1BVSA 3DA1A 1SXJC 3Q8XA 1IXSB 1UFZA 2MH8A 2WZJA 2UU9M 2G3QA 3MJ5A 1J7KA 4AI6A 2LVNC 4FVMA 3K9PA 2KRKA 3EIEA 3J7BA 4XGIA 2V6ZM 3U6MA 4LJ5A 3HHZA 1HNWM 1ORYB 5IT9S 3VKHA 1NY5A 4R7GA 4AZFA 1Q3BA 5DNYA 2F4VM 1NY6A 1VDDA 3GLHA 1SXJE 2KNVA 2FOIC 1TDZA 3L25A 2OOAA 1S3SA 3KOWE 3KP1E 3HHYA 3J2PB 4YY3M 2OPFA 1N36M 1IN4A 3KSJA 1PJQA 2EA0A 2HHHM 2OO9A 1HQYE 3L29A 3RE8A 3T1YM 1C7YA 5KPZA 2F5NA 2DAGA 2L6OA 3U61B 3W67A 3OTOM 1XXHE 2CWBA 5EJCA 3U61A 3VDUA 1SG9A 2KW0A 4D80A 1L2DA 4DV2M 1PM5A 5A2QS 4L4UA 1QDRA 2YNMD 1QZEA 4OVZA 4AG5A 4JI4M 4FCTA 2QBYA 5FTKA 3SBJA 2UXCM 4NL4H 1EFUB 1QUSA 2DZLA 2WSCF 3B7NA 4L6V6 1E94E 4LFCM 1N33M 1Q02A 4ITQA 3UMMA 2M60A 1VEGA 2R4EA 1E9SA 2UXDM 3SYLA 3SAWA 4IBBA 1SXJD 1G8PA 4GKKM 1ZMUA 3T38A 4D81A 4LJ8A 1OIPA 2N35A 3E21A 3RGPA 1IY1A 1R5LA 1TF0B 2QHOB 4LRTA 3C3DA 3IG8A 1NNUC 3AV0A 2VQEM 4L8RC 3J7AS 2FH0A 2K47A 1DGGA 3BOSA 1GJTA 3KW6A 3UK6A 3U60B 1H6UA 3FTCA 1VG5A 2ZM6M 3KOZE 4G4RA 2A5YB 4WW0A 2D7GA 2DZOB 5ITYA 1IN5A 4I8OA 1GL6A 5EXXA 1WXQA 1MX0A 2FNAA 1ZQ9A 4G4OA 1HT1E 1YLAA 3GO8A 4DV0M 3TWLA 4OW0A 3TWMA 4JI6M 1N34M 5EP4A 3GLIA 1NV9A 1VEJA 5GKNA 3SARA 1NHGC 4FWGA 1N78A 3GLFE 2HL7A 4Z8XA 1IFYA 2DHRA 2F5QA 1DGHA 4Z6YA 4D82A 4ANRA 4HEOA 2LHCA 3RFWA 2YQZA 2C9CA 1K3WA 2K6BA 3T1HM 2LVPC 3FD9A 3K8ZA 4FCWA 2ZANA 3E4RA 3HKPA 4QOZC 3QWLA 3W0FA 1UM8A 3LW5F 4REZA 2QPAA 4GITA 1VQ1A 3CGWA 1IBMM 3I4YA 3FKEA 3IHPA 4LY6A 3FTEA 2XGNA 3HWSA 4MH0E 3SATA 5FTJA 4LF8M 1G71A 1KSFX 1WJ7A 3BBZA 3KXEC 5KPRA 4LF4M 4LF9M 4K0KM 2FS1A 3K2LA 3ILKA 4QHSA 2KNZA 4FCVA 2DKLA 1QAMA 3K9OA 2KDLA 4DUYM 1OQYA 2K0BX 4IIWA 2UUCM 2DI0A 4X66M 4JI3M 3FTFA 2EO2A 3GPPA 2YFQA 1XB2B 5IREB 2DAMA 4WURA 1DGHB 1HNXM 2DWZB 2MJ5B 1EE8A 1G3IA 3EIHA 4P17A 3U6OA 2Z7JA 3SAVA 4CHTB 4JYAM 4DR6M 2DWNA 1NJGA 1JR3A 1QAQA 1TH4A 5EP1A 1FJGM 3T6PA 3MHVC 4NRVA 1NV8A 1TDHA 5DYIA 3TPZA 2H5XA 1D0KA 4NXNM 1XMOM 1W5SA 3B74A 1L2BA 4QHTA 2L7HA 1QZMA 4NSOB 3ZCBB 4GIPA 3GRYA 2MGWA 4DV3M 1IN6A 5KPTA 2I7NA 2F5PA 3SMPA 1HR0M 3R9XB 1MJGM 4LG2A 2B3TA 4WP2A 3D8LA 4RF0A 3HGIA 4GEWA 4GKJM 3L27A 4LZJA 4M0WA 2RGHA 4YHHM 4JI2M 4PDIA 4KHPM 2HCBA 2KZSA 1IXRC 2LVAA 4KT0F 4TUWA 3AOEA 3FE3A 3HHWA 5ITQA 3GQ4A 2L4EA 3ZQJA 1RU3A 2XH9A 3W68A 1GABA 2LNHC 2R62A 2V1UA 3FTDA 1K82A 3H4JA 1PJTA 3GLGA 1IM2A 2ERCA 5FTLA 1OAIA 2LVOC 3PXGA 3QYBA 2KEBA 2QSFX 2R18A 3LQQA 4DR7M 2O01F 3SASA 1N32M 2KA6B 2R46A 4DR1M 3U6SA 1K3XA 3SFZA 2ZAMA 3VLFB 1JR3D 2Z4SA 1IY0A 3AL0C 3AFHA 4P16A 2UUBM 3KP0E 2Z8YM 5EQTA 5FLXS 4DR3M 1T3TA 3PFIA 4XK8F 5E26A 2BWEA 1C1KA 2XFTA 3B89A 3NWLA 2R65A 1DGFA 2GQFA 3E9SA 2WSFF 4LGMA 2O5RA 1HNZM 3MK6A 1OFIA 2VF7A 5FTMA 2C98A 4F2LA 2KZUA 3U5ZA 4DUZM 4GRIA 2DNAA 3U60A 2L7IA 1ZMVA 1Z5BA 2JY6B 4IJFA 3HJQA 3PNVA 2XFSA 2CE7A 2LH0A 3HHXA 4PT5A 3U6QA 1IN8A 3B7QA 1HT2E 3SC3A 2JZ0A 4G4NA 1XXHA 3TQSA 2C99A 2C5RA 3WHLA 4DR5M 3AKZA 4B7FA 3ZH9B 2DZNB 3C58A 2QENA 1QUTA 2DAEA 1R2YA 1Q3CA 1YE9A 1Y8GA 5FTNA 1T43A 5ITUA 4KLNA 3C3EA 4KO8A 4F1IA 3JR4A 2CEAA 2JY5A 4R71A 2DHYA 2DAIA 1L1ZA 2EKFA 3GLFB 4M9SA 2BJWA 3T15A 1T6OA 3A45A 4XBOA 4UN2B 2OQ4A 1VDLA 3GPYA 2LVQD 2K9DA 1AIPC 2X8AA 4B08A 3DFZA 1YUBA 4B3MM 3K1JA 4IJEA 2G8LA 1L1TA 4BBAA 1QANA 2P5TA 1DGBA 2F5SA 1I94M 4NRWA 2Q2EB 1QDTA 2LBCA 4I4LA 3H4MA 2DWMA 4AW4A 3HJSA 4MB7A 2JZ1A 3GLHB 2EKKA 3M6AA 2AHMA 5IWAM 1EIJA 2D7EA 4Q7JA 5C18A 1L8QA 2OOBA 1WGNA 1ZAEA 4LCBA 1W5TA 3QYEA 4FWHA 4MGIE 1TGUA 1GO5A 3B7ZA 1Z6TA 3GRUA 3KSXA 1DO0A 1ZMWA 2JY7A 3KS4A 4BLCA 1WGLA 4LJ6A 2J7OA 2YR0A 1JR3E 5DFLA 1GJSA 5ITTA 3F92A 4G4QA 2G5GX 5KQ8A 2KHHA 2LHGA 1IBKM 3A98B 3GLIB 4QOSA 1NVMA 1SXJB 4IBKA 4ZPXA 1GKIA 2D7HA 2R6FA 5BPVA 4X64M 1G59A 3V76A 1IY2A 5EXTA 4NOOB 1CUKA 2LTUA 1R2ZA 3R8FA 3RGSA 4EIWA 4AG6A 2X49A 1V34A 3HZJA 4KODA 4DV1M 1N77A 4LF7M 4NC6A 3JAMS 2CHVA 3GQ3A 3FRIA 3W0LB 1XXHB 2I7PA 4PCZA 1ZV1A 5DYGA 3LMMA 1KYIA 5F3WA 4LJ7A 2F5OA 2W82A 3TL4X 2BWBA 1F4IA 4AKGA 5EXPA 1TTEA 1NSFA 3AOGA 4GMQA 1Q39A 2JP7A 2DENA 1DV0A 5JI2E 2BJVA 3LCUA 3TWKA 4GHLA 4OX9M 4DV4M 4MM3B 1SXJA 2J5YA 3FRHA 4LJAA 3VDPA 3CF6E 1AUAA 2Z3XA 4GHAA 4Y28F 4JN6A 5LMUM 2R45A 3I01M 2KRUA 2ZTCA 3LVWA 4IBFA 4B3SM 4HLQA 3D8BA 3WHKA 4JXJA 2XSZD 3QAUA 3DZDA 1X37A 2CRUA 2MROB 3SMSA 3GLGB 5L8RF 3L26A 3I51A 4DR2M 3U6CA 3VK7A 1L2CA 2LWXA 4AKIA 4W5WA 1WHCA 5KO3A 3FYDA 2ZTDA 3BXWA 5JI3E 3CF2A 5BR8M 3SHGB 1MN3A 1G41A 4R3DA 5ITXE 4CJ6A 4A3VB 3SAUA 4JI8M 3FUWA 2UUAM 3FUUA 2DXIA 1FNNA 4RKUF 5EP3A 3PVSA 2NQ8C 2HWJA 1YSYA 3UZUA 4LFAM 2KXEA 4MGHA 2CFOA 1MU5A 1PGYA 5H37D 4MGYE 4FW9A 2GNOA 4BB9A 7CATA 4LZZA 4PDGA 1VEKA 2HAKA 3LCVB 2QP9X 1E32A 4GH9A 1G4AE 3NBXX 3KDSE 2WSEF 2Y20A 4IBGA 2FFJA 3LVVA 1Z5CA 2EUCA 1D2NA 3KOXE 3M0EA 3VFDA 3U6DA 3MMPA 3KFUG 4CGYB 1R7RA 2L4FA 3Q8GA 5KQDA 2QNJA 3DOAA 4L15A 2JUJA 2CUZA 1I4WA 4CIZA 4FWDA 1KFVA 2L09A 1TH3A 4IBCA 4MGKE 1JQJC 1QAOA 1TH2A 5FSWA 3HU2A 2QCUA 1PJSA 3IECA 3PNYA 4LJ4A 4LF5M 1IQPA 5E6JA 1IXZA 2J7NA 3HX3A 4I5SA 4OVZB 2C9OA 3U6EA 2QBYB
chains in the Genus database with same CATH topology
2XSZA 4IBEA 4JV5M 3AOEC 2XZFA 2M5ZA 3FUTA 2CV2A 2XEPA 3L28A 2V1CA 3L2AA 3IG5A 3CTWB 2XZUA 3M7GA 1GL7A 4B7GA 1J09A 3AJIB 4LRSA 4GC9A 4JI1M 4JI5M 1IBLM 5EP2A 4AQYM 4HL4A 2X4AA 2RKOA 4L16A 3UJNA 1E9RA 1PJJA 1LV7A 2E5LM 4M9XA 4M9ZA 4II7A 3THGA 3GP1A 3K92A 1N75A 4DV5M 4B3RM 5IZ7D 2FE8A 3VK8A 4IBIA 1GLNA 4B7HA 5C1BA 2R4JA 1XHBA 2C96A 5ITRA 2BNKA 5ITXA 3J80S 1J5EM 4I81A 4DV6M 4S12A 2ZBKB 4AKHA 3VKGA 3B9PA 3NBIA 2CV0A 2Y21A 4RF1A 3ZC7B 1R6BX 3FYCA 3FUXA 4IBDA 3KOYE 3GLFA 3CF0A 4LFBM 1QVRA 2Z4RA 1OJLA 4PD2A 3A46A 4RNAA 3HU3A 3TE6A 2CV1A 4FD2A 2DVWB 3I4VA 1XNQM 4DR4M 4NSRA 3J81S 2CHQA 1XNRM 4QNMA 2VIIA 3U6PA 3KVWA 4G6ZA 4IBJA 3GQ5A 1PJIA 1NHWC 3GPXA 2RGOA 3KS8A 2QZ4A 3UGJA 2VQFM 3GRRA 2Y0QA 8CATA 2Y0TA 4L78A 3JR5A 4LF6M 2UXBM 1GVNA 1NNJA 3U5ZB 4GC5A 4CISA 2ZAOA 3HU1A 3A42A 3U6LA 1QYRA 4M0DA 4NXMM 2LXEA 4LGYA 4OU7A 1XC8A 4JI0M 1IN7A 2H1RA 3FUVA 1Z5AA 3SHFA 2XLJA 2DWLA 3GRVA 1NJFA 3GPUA 4X65M 4B3TM 3HJ8A 1OFHA 1XWIA 1HQCA 1XMQM 3LQRA 1Z59A 2XF3A 5EXSA 1QQWA 2CHGA 4QNRA 4DV7M 5LMNM 4LJ9A 4MGZE 4X62M 3SYKA 3J27B 1DO2A 2JA2A 4JI7M 2HKJA 3DA1A 1SXJC 3Q8XA 1IXSB 2UU9M 3MJ5A 1J7KA 4FVMA 2KRKA 3EIEA 3J7BA 4XGIA 2V6ZM 3U6MA 4LJ5A 3HHZA 1HNWM 1ORYB 5IT9S 3VKHA 1NY5A 4R7GA 4AZFA 1Q3BA 5DNYA 2F4VM 1NY6A 3GLHA 1VDDA 1SXJE 3L25A 2FOIC 1TDZA 1S3SA 3KOWE 3KP1E 3HHYA 3J2PB 4YY3M 2OPFA 1N36M 1IN4A 3KSJA 2EA0A 2HHHM 1HQYE 3L29A 3RE8A 3T1YM 5KPZA 2F5NA 2L6OA 3U61B 3OTOM 5EJCA 3U61A 3VDUA 2KW0A 4D80A 1L2DA 4DV2M 1PM5A 5A2QS 4L4UA 2YNMD 4OVZA 4AG5A 4JI4M 4FCTA 2QBYA 5FTKA 3SBJA 2UXCM 4NL4H 4LFCM 1E94E 1N33M 4ITQA 3UMMA 2M60A 2R4EA 1E9SA 2UXDM 3SYLA 3SAWA 4IBBA 1SXJD 1G8PA 4GKKM 3T38A 4D81A 4LJ8A 3RGPA 1IY1A 4LRTA 3IG8A 1NNUC 3AV0A 2VQEM 4L8RC 3J7AS 2K47A 1DGGA 3BOSA 3U60B 3KW6A 3UK6A 1H6UA 3FTCA 2ZM6M 3KOZE 4G4RA 2A5YB 4WW0A 2D7GA 2DZOB 5ITYA 1IN5A 4I8OA 1GL6A 5EXXA 1WXQA 1MX0A 2FNAA 1ZQ9A 4G4OA 1HT1E 3GO8A 4DV0M 4JI6M 3TWLA 4OW0A 3TWMA 1N34M 5EP4A 3GLIA 5GKNA 3SARA 1NHGC 4FWGA 1N78A 2HL7A 4Z8XA 2DHRA 2F5QA 1DGHA 4Z6YA 4D82A 3RFWA 2YQZA 2C9CA 1K3WA 3T1HM 3FD9A 3K8ZA 4FCWA 2ZANA 3E4RA 3HKPA 4QOZC 3QWLA 3W0FA 1UM8A 4REZA 1IBMM 2QPAA 4GITA 3I4YA 3FKEA 4LY6A 3FTEA 2XGNA 3HWSA 4MH0E 3SATA 5FTJA 4LF8M 4LF9M 1KSFX 5KPRA 3KXEC 4LF4M 4K0KM 3K2LA 3ILKA 4QHSA 4FCVA 1QAMA 4DUYM 4IIWA 2UUCM 4X66M 4JI3M 3FTFA 2EO2A 3GPPA 2YFQA 1HNXM 5IREB 4WURA 1DGHB 2DWZB 1EE8A 1G3IA 3EIHA 3U6OA 2Z7JA 3SAVA 4CHTB 4JYAM 4DR6M 2DWNA 1NJGA 1JR3A 1QAQA 1TH4A 5EP1A 1FJGM 3MHVC 4NRVA 1TDHA 5DYIA 3TPZA 4NXNM 1XMOM 1W5SA 1L2BA 4QHTA 2L7HA 1QZMA 4NSOB 3ZCBB 4GIPA 3GRYA 4DV3M 1IN6A 5KPTA 2I7NA 2F5PA 3SMPA 1HR0M 3R9XB 4LG2A 3D8LA 4RF0A 3HGIA 4GKJM 3L27A 4LZJA 4M0WA 2RGHA 4YHHM 4JI2M 4PDIA 4KHPM 2HCBA 2KZSA 1IXRC 4TUWA 3AOEA 3HHWA 5ITQA 3GQ4A 2XH9A 2LNHC 2R62A 2V1UA 3FTDA 1K82A 3GLGA 1IM2A 2ERCA 5FTLA 3PXGA 2KEBA 3LQQA 2R18A 4DR7M 3SASA 1N32M 2KA6B 2R46A 4DR1M 3U6SA 1K3XA 3SFZA 2ZAMA 3VLFB 1JR3D 2Z4SA 1IY0A 3AL0C 3AFHA 4P16A 2UUBM 3KP0E 5FLXS 5EQTA 4DR3M 1T3TA 3PFIA 5E26A 1C1KA 2XFTA 3NWLA 2R65A 1DGFA 3E9SA 4LGMA 2O5RA 1HNZM 3MK6A 1OFIA 5FTMA 2C98A 2KZUA 3U5ZA 4DUZM 4GRIA 3U60A 2L7IA 1Z5BA 4IJFA 3HJQA 3PNVA 2XFSA 2CE7A 2LH0A 3HHXA 4PT5A 3U6QA 1IN8A 1HT2E 3SC3A 4G4NA 1XXHA 3TQSA 2C99A 2C5RA 3WHLA 4DR5M 3AKZA 4B7FA 3ZH9B 2DZNB 3C58A 2QENA 1R2YA 1Q3CA 1YE9A 5FTNA 5ITUA 4KLNA 4KO8A 3JR4A 2CEAA 1L1ZA 3GLFB 4M9SA 2BJWA 3T15A 3A45A 4XBOA 2OQ4A 3GPYA 4B08A 2X8AA 3DFZA 1YUBA 4B3MM 3K1JA 4IJEA 2G8LA 1L1TA 4BBAA 1QANA 2P5TA 1DGBA 2F5SA 1I94M 4NRWA 2Q2EB 4I4LA 3H4MA 2DWMA 4AW4A 3HJSA 4MB7A 3GLHB 3M6AA 2AHMA 5IWAM 2D7EA 5C18A 1L8QA 1ZAEA 4LCBA 1W5TA 4FWHA 4MGIE 1TGUA 1Z6TA 3GRUA 3KSXA 1DO0A 3KS4A 4BLCA 4LJ6A 2J7OA 2YR0A 5ITTA 4G4QA 2G5GX 5KQ8A 1IBKM 3A98B 3GLIB 4QOSA 1NVMA 1SXJB 4IBKA 4ZPXA 1GKIA 2D7HA 5BPVA 4X64M 1G59A 1IY2A 5EXTA 4NOOB 1R2ZA 3R8FA 3RGSA 4EIWA 4AG6A 2X49A 4LF7M 4KODA 1N77A 4DV1M 3JAMS 3GQ3A 2CHVA 3W0LB 1XXHB 2I7PA 4PCZA 5DYGA 3LMMA 1KYIA 5F3WA 4LJ7A 2F5OA 2W82A 3TL4X 4AKGA 5EXPA 1NSFA 3AOGA 4GMQA 1Q39A 5JI2E 2BJVA 3TWKA 4GHLA 4OX9M 4DV4M 4MM3B 1SXJA 4LJAA 3VDPA 3CF6E 2Z3XA 4GHAA 4JN6A 5LMUM 2R45A 2KRUA 3LVWA 4IBFA 4B3SM 4HLQA 3D8BA 3WHKA 4JXJA 2XSZD 3QAUA 3DZDA 1X37A 3SMSA 3GLGB 3L26A 4DR2M 3I51A 3U6CA 3VK7A 1L2CA 2LWXA 4AKIA 4W5WA 5KO3A 3FYDA 5JI3E 5BR8M 3CF2A 3SHGB 1G41A 4R3DA 5ITXE 4A3VB 3SAUA 4JI8M 3FUWA 2UUAM 3FUUA 2DXIA 1FNNA 5EP3A 3PVSA 2NQ8C 1YSYA 3UZUA 4LFAM 2KXEA 4MGHA 2CFOA 1MU5A 5H37D 4MGYE 4FW9A 4BB9A 7CATA 4LZZA 4PDGA 2QP9X 1E32A 4GH9A 1G4AE 4IBGA 3KDSE 4AI6A 2Y20A 2FFJA 3LVVA 1Z5CA 2EUCA 1D2NA 3KOXE 3M0EA 3VFDA 3U6DA 3KFUG 4CGYB 1R7RA 5KQDA 3DOAA 4L15A 2CUZA 1I4WA 4FWDA 1KFVA 2L09A 1TH3A 4IBCA 4MGKE 1JQJC 1QAOA 1TH2A 5FSWA 3HU2A 2QCUA 3PNYA 4LJ4A 4LF5M 1IQPA 5E6JA 1IXZA 2J7NA 4I5SA 4OVZB 2C9OA 3U6EA 2QBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOY E;  3KOW E;  3KP1 E;  3KOX E;  3KOZ E;  3KP0 E; 
#chains in the Genus database with same CATH topology
 2XSZ A;  4IBE A;  4JV5 M;  3AOE C;  2XZF A;  2M5Z A;  3FUT A;  2CV2 A;  2RRU A;  2XEP A;  3L28 A;  2V1C A;  3L2A A;  3IG5 A;  3CTW B;  2XZU A;  3M7G A;  1GL7 A;  4B7G A;  1J09 A;  1OTR A;  3AJI B;  4LRS A;  4GC9 A;  4JI1 M;  4JI5 M;  1IBL M;  5EP2 A;  4AQY M;  4HL4 A;  2X4A A;  2RKO A;  4L16 A;  3UJN A;  1E9R A;  1PJJ A;  4B3R M;  1LV7 A;  2QQ8 A;  2E5L M;  4M9X A;  4M9Z A;  1V92 A;  4II7 A;  3THG A;  3GP1 A;  3K92 A;  1OKS A;  1N75 A;  1TR8 A;  1A5T A;  4DV5 M;  5IZ7 D;  1D0M A;  2FE8 A;  2R44 A;  1GLN A;  4IBI A;  3VK8 A;  4B7H A;  5C1B A;  2R4J A;  1XHB A;  2C96 A;  5ITR A;  1WR1 B;  1P3Q Q;  2BNK A;  2MR9 A;  5ITX A;  3J80 S;  1J5E M;  4I81 A;  4DV6 M;  4S12 A;  2ZBK B;  4AKH A;  3VKG A;  3B9P A;  3NBI A;  2CV0 A;  2Y21 A;  4RF1 A;  3ZC7 B;  1LTM A;  1R6B X;  3FYC A;  3HY5 A;  3GLI E;  3FUX A;  1D0L A;  3KOY E;  4IBD A;  3GLF A;  2R0I A;  3CF0 A;  4LFB M;  2O25 A;  3E46 A;  1QVR A;  2JWS A;  2Z4R A;  1OJL A;  4PD2 A;  1V33 A;  4RNA A;  3A46 A;  3HU3 A;  3TE6 A;  2CV1 A;  1OAO C;  4FD2 A;  2DVW B;  3I4V A;  1XNQ M;  4DR4 M;  4NSR A;  3J81 S;  2CHQ A;  1XNR M;  2L2D A;  2JNH A;  4QNM A;  1R4G A;  2JXN A;  2VII A;  3U6P A;  3KVW A;  4G6Z A;  1IXS A;  4IBJ A;  2CP8 A;  3GQ5 A;  1PJI A;  1NHW C;  3GPX A;  2RGO A;  3KS8 A;  2QZ4 A;  3UGJ A;  2VQF M;  3GRR A;  2Y0Q A;  8CAT A;  2Y0T A;  4L78 A;  3JR5 A;  4LF6 M;  2UXB M;  1GVN A;  1NNJ A;  3U5Z B;  1NO1 A;  4DBG B;  1JB0 F;  4GC5 A;  4CIS A;  2ZAO A;  3HU1 A;  4G3O A;  3A42 A;  3U6L A;  1PRB A;  1QYR A;  2JY8 A;  1HJP A;  4M0D A;  4NXM M;  2LXE A;  4LGY A;  4OU7 A;  1XC8 A;  2VDB B;  1OIZ A;  2KNA A;  1IN7 A;  4JI0 M;  2H1R A;  2EJS A;  1Z5A A;  3FUV A;  3SHF A;  2XLJ A;  2DWL A;  3GLH E;  3GRV A;  1NJF A;  3GPU A;  1WIV A;  4X65 M;  4B3T M;  3HJ8 A;  1OFH A;  1XWI A;  1HQC A;  1XMQ M;  3GLG E;  3C9P A;  3LQR A;  1Z59 A;  2XF3 A;  5EXS A;  1QQW A;  2CHG A;  4QNR A;  2DAK A;  2VF8 A;  3I04 M;  4DV7 M;  5LMN M;  2APL A;  4LJ9 A;  4MGZ E;  4X62 M;  3SYK A;  3J27 B;  1DO2 A;  2JA2 A;  4JI7 M;  2HKJ A;  1BVS A;  3DA1 A;  1SXJ C;  3Q8X A;  1IXS B;  1UFZ A;  2MH8 A;  2WZJ A;  2UU9 M;  2G3Q A;  3MJ5 A;  1J7K A;  4AI6 A;  2LVN C;  4FVM A;  3K9P A;  2KRK A;  3EIE A;  3J7B A;  4XGI A;  2V6Z M;  3U6M A;  4LJ5 A;  3HHZ A;  1HNW M;  1ORY B;  5IT9 S;  3VKH A;  1NY5 A;  4R7G A;  4AZF A;  1Q3B A;  5DNY A;  2F4V M;  1NY6 A;  1VDD A;  3GLH A;  1SXJ E;  2KNV A;  2FOI C;  1TDZ A;  3L25 A;  2OOA A;  1S3S A;  3KOW E;  3KP1 E;  3HHY A;  3J2P B;  4YY3 M;  2OPF A;  1N36 M;  1IN4 A;  3KSJ A;  1PJQ A;  2EA0 A;  2HHH M;  2OO9 A;  1HQY E;  3L29 A;  3RE8 A;  3T1Y M;  1C7Y A;  5KPZ A;  2F5N A;  2DAG A;  2L6O A;  3U61 B;  3W67 A;  3OTO M;  1XXH E;  2CWB A;  5EJC A;  3U61 A;  3VDU A;  1SG9 A;  2KW0 A;  4D80 A;  1L2D A;  4DV2 M;  1PM5 A;  5A2Q S;  4L4U A;  1QDR A;  2YNM D;  1QZE A;  4OVZ A;  4AG5 A;  4JI4 M;  4FCT A;  2QBY A;  5FTK A;  3SBJ A;  2UXC M;  4NL4 H;  1EFU B;  1QUS A;  2DZL A;  2WSC F;  3B7N A;  4L6V 6;  1E94 E;  4LFC M;  1N33 M;  1Q02 A;  4ITQ A;  3UMM A;  2M60 A;  1VEG A;  2R4E A;  1E9S A;  2UXD M;  3SYL A;  3SAW A;  4IBB A;  1SXJ D;  1G8P A;  4GKK M;  1ZMU A;  3T38 A;  4D81 A;  4LJ8 A;  1OIP A;  2N35 A;  3E21 A;  3RGP A;  1IY1 A;  1R5L A;  1TF0 B;  2QHO B;  4LRT A;  3C3D A;  3IG8 A;  1NNU C;  3AV0 A;  2VQE M;  4L8R C;  3J7A S;  2FH0 A;  2K47 A;  1DGG A;  3BOS A;  1GJT A;  3KW6 A;  3UK6 A;  3U60 B;  1H6U A;  3FTC A;  1VG5 A;  2ZM6 M;  3KOZ E;  4G4R A;  2A5Y B;  4WW0 A;  2D7G A;  2DZO B;  5ITY A;  1IN5 A;  4I8O A;  1GL6 A;  5EXX A;  1WXQ A;  1MX0 A;  2FNA A;  1ZQ9 A;  4G4O A;  1HT1 E;  1YLA A;  3GO8 A;  4DV0 M;  3TWL A;  4OW0 A;  3TWM A;  4JI6 M;  1N34 M;  5EP4 A;  3GLI A;  1NV9 A;  1VEJ A;  5GKN A;  3SAR A;  1NHG C;  4FWG A;  1N78 A;  3GLF E;  2HL7 A;  4Z8X A;  1IFY A;  2DHR A;  2F5Q A;  1DGH A;  4Z6Y A;  4D82 A;  4ANR A;  4HEO A;  2LHC A;  3RFW A;  2YQZ A;  2C9C A;  1K3W A;  2K6B A;  3T1H M;  2LVP C;  3FD9 A;  3K8Z A;  4FCW A;  2ZAN A;  3E4R A;  3HKP A;  4QOZ C;  3QWL A;  3W0F A;  1UM8 A;  3LW5 F;  4REZ A;  2QPA A;  4GIT A;  1VQ1 A;  3CGW A;  1IBM M;  3I4Y A;  3FKE A;  3IHP A;  4LY6 A;  3FTE A;  2XGN A;  3HWS A;  4MH0 E;  3SAT A;  5FTJ A;  4LF8 M;  1G71 A;  1KSF X;  1WJ7 A;  3BBZ A;  3KXE C;  5KPR A;  4LF4 M;  4LF9 M;  4K0K M;  2FS1 A;  3K2L A;  3ILK A;  4QHS A;  2KNZ A;  4FCV A;  2DKL A;  1QAM A;  3K9O A;  2KDL A;  4DUY M;  1OQY A;  2K0B X;  4IIW A;  2UUC M;  2DI0 A;  4X66 M;  4JI3 M;  3FTF A;  2EO2 A;  3GPP A;  2YFQ A;  1XB2 B;  5IRE B;  2DAM A;  4WUR A;  1DGH B;  1HNX M;  2DWZ B;  2MJ5 B;  1EE8 A;  1G3I A;  3EIH A;  4P17 A;  3U6O A;  2Z7J A;  3SAV A;  4CHT B;  4JYA M;  4DR6 M;  2DWN A;  1NJG A;  1JR3 A;  1QAQ A;  1TH4 A;  5EP1 A;  1FJG M;  3T6P A;  3MHV C;  4NRV A;  1NV8 A;  1TDH A;  5DYI A;  3TPZ A;  2H5X A;  1D0K A;  4NXN M;  1XMO M;  1W5S A;  3B74 A;  1L2B A;  4QHT A;  2L7H A;  1QZM A;  4NSO B;  3ZCB B;  4GIP A;  3GRY A;  2MGW A;  4DV3 M;  1IN6 A;  5KPT A;  2I7N A;  2F5P A;  3SMP A;  1HR0 M;  3R9X B;  1MJG M;  4LG2 A;  2B3T A;  4WP2 A;  3D8L A;  4RF0 A;  3HGI A;  4GEW A;  4GKJ M;  3L27 A;  4LZJ A;  4M0W A;  2RGH A;  4YHH M;  4JI2 M;  4PDI A;  4KHP M;  2HCB A;  2KZS A;  1IXR C;  2LVA A;  4KT0 F;  4TUW A;  3AOE A;  3FE3 A;  3HHW A;  5ITQ A;  3GQ4 A;  2L4E A;  3ZQJ A;  1RU3 A;  2XH9 A;  3W68 A;  1GAB A;  2LNH C;  2R62 A;  2V1U A;  3FTD A;  1K82 A;  3H4J A;  1PJT A;  3GLG A;  1IM2 A;  2ERC A;  5FTL A;  1OAI A;  2LVO C;  3PXG A;  3QYB A;  2KEB A;  2QSF X;  2R18 A;  3LQQ A;  4DR7 M;  2O01 F;  3SAS A;  1N32 M;  2KA6 B;  2R46 A;  4DR1 M;  3U6S A;  1K3X A;  3SFZ A;  2ZAM A;  3VLF B;  1JR3 D;  2Z4S A;  1IY0 A;  3AL0 C;  3AFH A;  4P16 A;  2UUB M;  3KP0 E;  2Z8Y M;  5EQT A;  5FLX S;  4DR3 M;  1T3T A;  3PFI A;  4XK8 F;  5E26 A;  2BWE A;  1C1K A;  2XFT A;  3B89 A;  3NWL A;  2R65 A;  1DGF A;  2GQF A;  3E9S A;  2WSF F;  4LGM A;  2O5R A;  1HNZ M;  3MK6 A;  1OFI A;  2VF7 A;  5FTM A;  2C98 A;  4F2L A;  2KZU A;  3U5Z A;  4DUZ M;  4GRI A;  2DNA A;  3U60 A;  2L7I A;  1ZMV A;  1Z5B A;  2JY6 B;  4IJF A;  3HJQ A;  3PNV A;  2XFS A;  2CE7 A;  2LH0 A;  3HHX A;  4PT5 A;  3U6Q A;  1IN8 A;  3B7Q A;  1HT2 E;  3SC3 A;  2JZ0 A;  4G4N A;  1XXH A;  3TQS A;  2C99 A;  2C5R A;  3WHL A;  4DR5 M;  3AKZ A;  4B7F A;  3ZH9 B;  2DZN B;  3C58 A;  2QEN A;  1QUT A;  2DAE A;  1R2Y A;  1Q3C A;  1YE9 A;  1Y8G A;  5FTN A;  1T43 A;  5ITU A;  4KLN A;  3C3E A;  4KO8 A;  4F1I A;  3JR4 A;  2CEA A;  2JY5 A;  4R71 A;  2DHY A;  2DAI A;  1L1Z A;  2EKF A;  3GLF B;  4M9S A;  2BJW A;  3T15 A;  1T6O A;  3A45 A;  4XBO A;  4UN2 B;  2OQ4 A;  1VDL A;  3GPY A;  2LVQ D;  2K9D A;  1AIP C;  2X8A A;  4B08 A;  3DFZ A;  1YUB A;  4B3M M;  3K1J A;  4IJE A;  2G8L A;  1L1T A;  4BBA A;  1QAN A;  2P5T A;  1DGB A;  2F5S A;  1I94 M;  4NRW A;  2Q2E B;  1QDT A;  2LBC A;  4I4L A;  3H4M A;  2DWM A;  4AW4 A;  3HJS A;  4MB7 A;  2JZ1 A;  3GLH B;  2EKK A;  3M6A A;  2AHM A;  5IWA M;  1EIJ A;  2D7E A;  4Q7J A;  5C18 A;  1L8Q A;  2OOB A;  1WGN A;  1ZAE A;  4LCB A;  1W5T A;  3QYE A;  4FWH A;  4MGI E;  1TGU A;  1GO5 A;  3B7Z A;  1Z6T A;  3GRU A;  3KSX A;  1DO0 A;  1ZMW A;  2JY7 A;  3KS4 A;  4BLC A;  1WGL A;  4LJ6 A;  2J7O A;  2YR0 A;  1JR3 E;  5DFL A;  1GJS A;  5ITT A;  3F92 A;  4G4Q A;  2G5G X;  5KQ8 A;  2KHH A;  2LHG A;  1IBK M;  3A98 B;  3GLI B;  4QOS A;  1NVM A;  1SXJ B;  4IBK A;  4ZPX A;  1GKI A;  2D7H A;  2R6F A;  5BPV A;  4X64 M;  1G59 A;  3V76 A;  1IY2 A;  5EXT A;  4NOO B;  1CUK A;  2LTU A;  1R2Z A;  3R8F A;  3RGS A;  4EIW A;  4AG6 A;  2X49 A;  1V34 A;  3HZJ A;  4KOD A;  4DV1 M;  1N77 A;  4LF7 M;  4NC6 A;  3JAM S;  2CHV A;  3GQ3 A;  3FRI A;  3W0L B;  1XXH B;  2I7P A;  4PCZ A;  1ZV1 A;  5DYG A;  3LMM A;  1KYI A;  5F3W A;  4LJ7 A;  2F5O A;  2W82 A;  3TL4 X;  2BWB A;  1F4I A;  4AKG A;  5EXP A;  1TTE A;  1NSF A;  3AOG A;  4GMQ A;  1Q39 A;  2JP7 A;  2DEN A;  1DV0 A;  5JI2 E;  2BJV A;  3LCU A;  3TWK A;  4GHL A;  4OX9 M;  4DV4 M;  4MM3 B;  1SXJ A;  2J5Y A;  3FRH A;  4LJA A;  3VDP A;  3CF6 E;  1AUA A;  2Z3X A;  4GHA A;  4Y28 F;  4JN6 A;  5LMU M;  2R45 A;  3I01 M;  2KRU A;  2ZTC A;  3LVW A;  4IBF A;  4B3S M;  4HLQ A;  3D8B A;  3WHK A;  4JXJ A;  2XSZ D;  3QAU A;  3DZD A;  1X37 A;  2CRU A;  2MRO B;  3SMS A;  3GLG B;  5L8R F;  3L26 A;  3I51 A;  4DR2 M;  3U6C A;  3VK7 A;  1L2C A;  2LWX A;  4AKI A;  4W5W A;  1WHC A;  5KO3 A;  3FYD A;  2ZTD A;  3BXW A;  5JI3 E;  3CF2 A;  5BR8 M;  3SHG B;  1MN3 A;  1G41 A;  4R3D A;  5ITX E;  4CJ6 A;  4A3V B;  3SAU A;  4JI8 M;  3FUW A;  2UUA M;  3FUU A;  2DXI A;  1FNN A;  4RKU F;  5EP3 A;  3PVS A;  2NQ8 C;  2HWJ A;  1YSY A;  3UZU A;  4LFA M;  2KXE A;  4MGH A;  2CFO A;  1MU5 A;  1PGY A;  5H37 D;  4MGY E;  4FW9 A;  2GNO A;  4BB9 A;  7CAT A;  4LZZ A;  4PDG A;  1VEK A;  2HAK A;  3LCV B;  2QP9 X;  1E32 A;  4GH9 A;  1G4A E;  3NBX X;  3KDS E;  2WSE F;  2Y20 A;  4IBG A;  2FFJ A;  3LVV A;  1Z5C A;  2EUC A;  1D2N A;  3KOX E;  3M0E A;  3VFD A;  3U6D A;  3MMP A;  3KFU G;  4CGY B;  1R7R A;  2L4F A;  3Q8G A;  5KQD A;  2QNJ A;  3DOA A;  4L15 A;  2JUJ A;  2CUZ A;  1I4W A;  4CIZ A;  4FWD A;  1KFV A;  2L09 A;  1TH3 A;  4IBC A;  4MGK E;  1JQJ C;  1QAO A;  1TH2 A;  5FSW A;  3HU2 A;  2QCU A;  1PJS A;  3IEC A;  3PNY A;  4LJ4 A;  4LF5 M;  1IQP A;  5E6J A;  1IXZ A;  2J7N A;  3HX3 A;  4I5S A;  4OVZ B;  2C9O A;  3U6E A;  2QBY B; 
#chains in the Genus database with same CATH homology
 2XSZ A;  4IBE A;  4JV5 M;  3AOE C;  2XZF A;  2M5Z A;  3FUT A;  2CV2 A;  2XEP A;  3L28 A;  2V1C A;  3L2A A;  3IG5 A;  3CTW B;  2XZU A;  3M7G A;  1GL7 A;  4B7G A;  1J09 A;  3AJI B;  4LRS A;  4GC9 A;  4JI1 M;  4JI5 M;  1IBL M;  5EP2 A;  4AQY M;  4HL4 A;  2X4A A;  2RKO A;  4L16 A;  3UJN A;  1E9R A;  1PJJ A;  1LV7 A;  2E5L M;  4M9X A;  4M9Z A;  4II7 A;  3THG A;  3GP1 A;  3K92 A;  1N75 A;  4DV5 M;  4B3R M;  5IZ7 D;  2FE8 A;  3VK8 A;  4IBI A;  1GLN A;  4B7H A;  5C1B A;  2R4J A;  1XHB A;  2C96 A;  5ITR A;  2BNK A;  5ITX A;  3J80 S;  1J5E M;  4I81 A;  4DV6 M;  4S12 A;  2ZBK B;  4AKH A;  3VKG A;  3B9P A;  3NBI A;  2CV0 A;  2Y21 A;  4RF1 A;  3ZC7 B;  1R6B X;  3FYC A;  3FUX A;  4IBD A;  3KOY E;  3GLF A;  3CF0 A;  4LFB M;  1QVR A;  2Z4R A;  1OJL A;  4PD2 A;  3A46 A;  4RNA A;  3HU3 A;  3TE6 A;  2CV1 A;  4FD2 A;  2DVW B;  3I4V A;  1XNQ M;  4DR4 M;  4NSR A;  3J81 S;  2CHQ A;  1XNR M;  4QNM A;  2VII A;  3U6P A;  3KVW A;  4G6Z A;  4IBJ A;  3GQ5 A;  1PJI A;  1NHW C;  3GPX A;  2RGO A;  3KS8 A;  2QZ4 A;  3UGJ A;  2VQF M;  3GRR A;  2Y0Q A;  8CAT A;  2Y0T A;  4L78 A;  3JR5 A;  4LF6 M;  2UXB M;  1GVN A;  1NNJ A;  3U5Z B;  4GC5 A;  4CIS A;  2ZAO A;  3HU1 A;  3A42 A;  3U6L A;  1QYR A;  4M0D A;  4NXM M;  2LXE A;  4LGY A;  4OU7 A;  1XC8 A;  4JI0 M;  1IN7 A;  2H1R A;  3FUV A;  1Z5A A;  3SHF A;  2XLJ A;  2DWL A;  3GRV A;  1NJF A;  3GPU A;  4X65 M;  4B3T M;  3HJ8 A;  1OFH A;  1XWI A;  1HQC A;  1XMQ M;  3LQR A;  1Z59 A;  2XF3 A;  5EXS A;  1QQW A;  2CHG A;  4QNR A;  4DV7 M;  5LMN M;  4LJ9 A;  4MGZ E;  4X62 M;  3SYK A;  3J27 B;  1DO2 A;  2JA2 A;  4JI7 M;  2HKJ A;  3DA1 A;  1SXJ C;  3Q8X A;  1IXS B;  2UU9 M;  3MJ5 A;  1J7K A;  4FVM A;  2KRK A;  3EIE A;  3J7B A;  4XGI A;  2V6Z M;  3U6M A;  4LJ5 A;  3HHZ A;  1HNW M;  1ORY B;  5IT9 S;  3VKH A;  1NY5 A;  4R7G A;  4AZF A;  1Q3B A;  5DNY A;  2F4V M;  1NY6 A;  3GLH A;  1VDD A;  1SXJ E;  3L25 A;  2FOI C;  1TDZ A;  1S3S A;  3KOW E;  3KP1 E;  3HHY A;  3J2P B;  4YY3 M;  2OPF A;  1N36 M;  1IN4 A;  3KSJ A;  2EA0 A;  2HHH M;  1HQY E;  3L29 A;  3RE8 A;  3T1Y M;  5KPZ A;  2F5N A;  2L6O A;  3U61 B;  3OTO M;  5EJC A;  3U61 A;  3VDU A;  2KW0 A;  4D80 A;  1L2D A;  4DV2 M;  1PM5 A;  5A2Q S;  4L4U A;  2YNM D;  4OVZ A;  4AG5 A;  4JI4 M;  4FCT A;  2QBY A;  5FTK A;  3SBJ A;  2UXC M;  4NL4 H;  4LFC M;  1E94 E;  1N33 M;  4ITQ A;  3UMM A;  2M60 A;  2R4E A;  1E9S A;  2UXD M;  3SYL A;  3SAW A;  4IBB A;  1SXJ D;  1G8P A;  4GKK M;  3T38 A;  4D81 A;  4LJ8 A;  3RGP A;  1IY1 A;  4LRT A;  3IG8 A;  1NNU C;  3AV0 A;  2VQE M;  4L8R C;  3J7A S;  2K47 A;  1DGG A;  3BOS A;  3U60 B;  3KW6 A;  3UK6 A;  1H6U A;  3FTC A;  2ZM6 M;  3KOZ E;  4G4R A;  2A5Y B;  4WW0 A;  2D7G A;  2DZO B;  5ITY A;  1IN5 A;  4I8O A;  1GL6 A;  5EXX A;  1WXQ A;  1MX0 A;  2FNA A;  1ZQ9 A;  4G4O A;  1HT1 E;  3GO8 A;  4DV0 M;  4JI6 M;  3TWL A;  4OW0 A;  3TWM A;  1N34 M;  5EP4 A;  3GLI A;  5GKN A;  3SAR A;  1NHG C;  4FWG A;  1N78 A;  2HL7 A;  4Z8X A;  2DHR A;  2F5Q A;  1DGH A;  4Z6Y A;  4D82 A;  3RFW A;  2YQZ A;  2C9C A;  1K3W A;  3T1H M;  3FD9 A;  3K8Z A;  4FCW A;  2ZAN A;  3E4R A;  3HKP A;  4QOZ C;  3QWL A;  3W0F A;  1UM8 A;  4REZ A;  1IBM M;  2QPA A;  4GIT A;  3I4Y A;  3FKE A;  4LY6 A;  3FTE A;  2XGN A;  3HWS A;  4MH0 E;  3SAT A;  5FTJ A;  4LF8 M;  4LF9 M;  1KSF X;  5KPR A;  3KXE C;  4LF4 M;  4K0K M;  3K2L A;  3ILK A;  4QHS A;  4FCV A;  1QAM A;  4DUY M;  4IIW A;  2UUC M;  4X66 M;  4JI3 M;  3FTF A;  2EO2 A;  3GPP A;  2YFQ A;  1HNX M;  5IRE B;  4WUR A;  1DGH B;  2DWZ B;  1EE8 A;  1G3I A;  3EIH A;  3U6O A;  2Z7J A;  3SAV A;  4CHT B;  4JYA M;  4DR6 M;  2DWN A;  1NJG A;  1JR3 A;  1QAQ A;  1TH4 A;  5EP1 A;  1FJG M;  3MHV C;  4NRV A;  1TDH A;  5DYI A;  3TPZ A;  4NXN M;  1XMO M;  1W5S A;  1L2B A;  4QHT A;  2L7H A;  1QZM A;  4NSO B;  3ZCB B;  4GIP A;  3GRY A;  4DV3 M;  1IN6 A;  5KPT A;  2I7N A;  2F5P A;  3SMP A;  1HR0 M;  3R9X B;  4LG2 A;  3D8L A;  4RF0 A;  3HGI A;  4GKJ M;  3L27 A;  4LZJ A;  4M0W A;  2RGH A;  4YHH M;  4JI2 M;  4PDI A;  4KHP M;  2HCB A;  2KZS A;  1IXR C;  4TUW A;  3AOE A;  3HHW A;  5ITQ A;  3GQ4 A;  2XH9 A;  2LNH C;  2R62 A;  2V1U A;  3FTD A;  1K82 A;  3GLG A;  1IM2 A;  2ERC A;  5FTL A;  3PXG A;  2KEB A;  3LQQ A;  2R18 A;  4DR7 M;  3SAS A;  1N32 M;  2KA6 B;  2R46 A;  4DR1 M;  3U6S A;  1K3X A;  3SFZ A;  2ZAM A;  3VLF B;  1JR3 D;  2Z4S A;  1IY0 A;  3AL0 C;  3AFH A;  4P16 A;  2UUB M;  3KP0 E;  5FLX S;  5EQT A;  4DR3 M;  1T3T A;  3PFI A;  5E26 A;  1C1K A;  2XFT A;  3NWL A;  2R65 A;  1DGF A;  3E9S A;  4LGM A;  2O5R A;  1HNZ M;  3MK6 A;  1OFI A;  5FTM A;  2C98 A;  2KZU A;  3U5Z A;  4DUZ M;  4GRI A;  3U60 A;  2L7I A;  1Z5B A;  4IJF A;  3HJQ A;  3PNV A;  2XFS A;  2CE7 A;  2LH0 A;  3HHX A;  4PT5 A;  3U6Q A;  1IN8 A;  1HT2 E;  3SC3 A;  4G4N A;  1XXH A;  3TQS A;  2C99 A;  2C5R A;  3WHL A;  4DR5 M;  3AKZ A;  4B7F A;  3ZH9 B;  2DZN B;  3C58 A;  2QEN A;  1R2Y A;  1Q3C A;  1YE9 A;  5FTN A;  5ITU A;  4KLN A;  4KO8 A;  3JR4 A;  2CEA A;  1L1Z A;  3GLF B;  4M9S A;  2BJW A;  3T15 A;  3A45 A;  4XBO A;  2OQ4 A;  3GPY A;  4B08 A;  2X8A A;  3DFZ A;  1YUB A;  4B3M M;  3K1J A;  4IJE A;  2G8L A;  1L1T A;  4BBA A;  1QAN A;  2P5T A;  1DGB A;  2F5S A;  1I94 M;  4NRW A;  2Q2E B;  4I4L A;  3H4M A;  2DWM A;  4AW4 A;  3HJS A;  4MB7 A;  3GLH B;  3M6A A;  2AHM A;  5IWA M;  2D7E A;  5C18 A;  1L8Q A;  1ZAE A;  4LCB A;  1W5T A;  4FWH A;  4MGI E;  1TGU A;  1Z6T A;  3GRU A;  3KSX A;  1DO0 A;  3KS4 A;  4BLC A;  4LJ6 A;  2J7O A;  2YR0 A;  5ITT A;  4G4Q A;  2G5G X;  5KQ8 A;  1IBK M;  3A98 B;  3GLI B;  4QOS A;  1NVM A;  1SXJ B;  4IBK A;  4ZPX A;  1GKI A;  2D7H A;  5BPV A;  4X64 M;  1G59 A;  1IY2 A;  5EXT A;  4NOO B;  1R2Z A;  3R8F A;  3RGS A;  4EIW A;  4AG6 A;  2X49 A;  4LF7 M;  4KOD A;  1N77 A;  4DV1 M;  3JAM S;  3GQ3 A;  2CHV A;  3W0L B;  1XXH B;  2I7P A;  4PCZ A;  5DYG A;  3LMM A;  1KYI A;  5F3W A;  4LJ7 A;  2F5O A;  2W82 A;  3TL4 X;  4AKG A;  5EXP A;  1NSF A;  3AOG A;  4GMQ A;  1Q39 A;  5JI2 E;  2BJV A;  3TWK A;  4GHL A;  4OX9 M;  4DV4 M;  4MM3 B;  1SXJ A;  4LJA A;  3VDP A;  3CF6 E;  2Z3X A;  4GHA A;  4JN6 A;  5LMU M;  2R45 A;  2KRU A;  3LVW A;  4IBF A;  4B3S M;  4HLQ A;  3D8B A;  3WHK A;  4JXJ A;  2XSZ D;  3QAU A;  3DZD A;  1X37 A;  3SMS A;  3GLG B;  3L26 A;  4DR2 M;  3I51 A;  3U6C A;  3VK7 A;  1L2C A;  2LWX A;  4AKI A;  4W5W A;  5KO3 A;  3FYD A;  5JI3 E;  5BR8 M;  3CF2 A;  3SHG B;  1G41 A;  4R3D A;  5ITX E;  4A3V B;  3SAU A;  4JI8 M;  3FUW A;  2UUA M;  3FUU A;  2DXI A;  1FNN A;  5EP3 A;  3PVS A;  2NQ8 C;  1YSY A;  3UZU A;  4LFA M;  2KXE A;  4MGH A;  2CFO A;  1MU5 A;  5H37 D;  4MGY E;  4FW9 A;  4BB9 A;  7CAT A;  4LZZ A;  4PDG A;  2QP9 X;  1E32 A;  4GH9 A;  1G4A E;  4IBG A;  3KDS E;  4AI6 A;  2Y20 A;  2FFJ A;  3LVV A;  1Z5C A;  2EUC A;  1D2N A;  3KOX E;  3M0E A;  3VFD A;  3U6D A;  3KFU G;  4CGY B;  1R7R A;  5KQD A;  3DOA A;  4L15 A;  2CUZ A;  1I4W A;  4FWD A;  1KFV A;  2L09 A;  1TH3 A;  4IBC A;  4MGK E;  1JQJ C;  1QAO A;  1TH2 A;  5FSW A;  3HU2 A;  2QCU A;  3PNY A;  4LJ4 A;  4LF5 M;  1IQP A;  5E6J A;  1IXZ A;  2J7N A;  4I5S A;  4OVZ B;  2C9O A;  3U6E A;  2QBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...