3KP0E

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (dab) (aerobic)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 39
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp0E02
3KP0E 3KP1E 3KOZE 3KOYE 3KOWE 3KOXE
chains in the Genus database with same CATH superfamily
4DV1M 2DENA 3PVSA 3VKGA 3SYKA 4CHTB 1ZV1A 1R5LA 4D80A 1R2ZA 3FUXA 3KS8A 5FTLA 2R18A 3SARA 3LQRA 1T3TA 1VEKA 2VQFM 3KP1E 3AKZA 4DR5M 1NY5A 1TTEA 1FJGM 3B7QA 3J7AS 1DGFA 3SATA 1ORYB 1NJGA 2HWJA 5ITTA 4CJ6A 2JNHA 2CE7A 4OU7A 3HKPA 1QZEA 2R0IA 2B3TA 4OX9M 3SBJA 1G4AE 4MGKE 2K6BA 1R2YA 1Q02A 3I4VA 3J80S 4PCZA 2R44A 3SAVA 4M9XA 1N32M 1QVRA 4GRIA 3GPXA 5EP2A 4BBAA 3V76A 3A98B 2VF7A 2QBYB 4B3SM 1IN4A 1TDZA 2DAKA 2DWZB 2C9OA 3I04M 5KQ8A 2UUCM 4W5WA 4JI3M 2DWMA 1JB0F 1QDRA 1NV8A 2APLA 3GPYA 3GLIA 3U6QA 3C3EA 1XWIA 1L2CA 4AW4A 2O5RA 2XZFA 3I4YA 3SMPA 2HHHM 2C98A 5EXPA 3GLGA 4LFBM 4NXMM 2UXCM 2V1CA 4QOZC 2DNAA 4A3VB 4NSRA 1N75A 4M0WA 1QAOA 2QHOB 1DGHA 3H4JA 2AHMA 5ITUA 4IBCA 4B7GA 2KNAA 4L16A 3GPPA 2QENA 4JYAM 3I51A 3B7NA 2LTUA 3KOXE 1IBMM 3VDPA 3ZCBB 4D81A 3GLHB 4JI4M 3UZUA 3U6DA 1YUBA 4JI1M 2Z8YM 1AIPC 1S3SA 3JAMS 1XNQM 1GKIA 4LJAA 3B9PA 3BBZA 2DI0A 5EP3A 3OTOM 3HHWA 4DR3M 3EIEA 3T6PA 1VG5A 4P17A 3B7ZA 4JI2M 3FUVA 2DKLA 2R65A 3KSJA 4IBKA 4DUZM 5FLXS 3U6MA 1AUAA 4B08A 3FTEA 2WSCF 3PFIA 2CHVA 3K8ZA 2JUJA 4FW9A 5IREB 3CF0A 4FCWA 4LG2A 1GVNA 1XXHA 2K9DA 5ITQA 1Z59A 3KDSE 1D0MA 2LH0A 3LVWA 2QCUA 1L1ZA 3HHZA 1L8QA 4JI5M 2LHCA 4XBOA 3PNVA 1A5TA 2BJWA 1K82A 4B3MM 2F4VM 3M0EA 4XK8F 7CATA 2J7NA 3LMMA 3H4MA 1IXSB 3GPUA 3DOAA 3KOYE 4LJ7A 4KLNA 1Z6TA 4AG5A 3T38A 1N36M 3L27A 2J7OA 2WZJA 3KXEC 4LJ5A 2D7GA 3GQ4A 2R6FA 2DWLA 3NBIA 1QAQA 2UUBM 5DYGA 1WXQA 3AJIB 1KSFX 4G4OA 5IZ7D 3AFHA 3JR5A 1DGBA 2EKKA 4DV3M 1TH2A 5KPTA 3GP1A 3DFZA 2BJVA 1P3QQ 2QNJA 4I8OA 4M9ZA 3SASA 1BVSA 1JR3E 1MJGM 4L4UA 2LBCA 2X4AA 2EA0A 1C7YA 1QANA 2JA2A 5KPZA 1WGLA 1R4GA 1YSYA 3KSXA 3VKHA 3GRYA 2CRUA 2L6OA 4AKGA 1IN8A 3GLFE 4B7FA 1WHCA 4DR2M 3GLFA 1PM5A 2F5QA 3E21A 4YY3M 2MGWA 4AQYM 3AOGA 1MX0A 3VFDA 3FTDA 2LXEA 2BWBA 4WP2A 2XLJA 3U6OA 3TPZA 4ITQA 2RRUA 1SXJC 2O25A 3NBXX 3RFWA 3L25A 3T1HM 2L7IA 2YFQA 3TWMA 2CV0A 3KW6A 1TDHA 2DZNB 1GABA 2HL7A 3PXGA 1TR8A 2KA6B 1NVMA 3FKEA 2MJ5B 1OAOC 2FH0A 1YLAA 4II7A 2JY7A 1SXJE 2FFJA 3K2LA 2ZAOA 1R7RA 1SXJA 3W0LB 4LF4M 3MJ5A 3LW5F 5FTJA 3U60B 2OOAA 2QP9X 1E9SA 1SG9A 3KP0E 2G8LA 2FE8A 3VK8A 3FYDA 2X49A 4FWHA 2Y0QA 1WJ7A 3K9OA 4LGYA 1N33M 1XC8A 2CHGA 2G5GX 2LVNC 1EFUB 2YQZA 3TWKA 4S12A 3GRRA 2QZ4A 4I5SA 3U6LA 4DR1M 1L2BA 4AKHA 2CFOA 4QNRA 4G4QA 1OFHA 4GKJM 1YE9A 4LZZA 2XF3A 1G71A 1PGYA 3EIHA 4X62M 1IQPA 4IBGA 4LF9M 1C1KA 3KS4A 2F5NA 3B74A 1IN6A 2DAIA 4M0DA 3KVWA 4LJ6A 5LMNM 4DBGB 1XMQM 3UK6A 3HZJA 4HL4A 4GITA 3U6EA 3GLIE 4OVZA 2MH8A 3SYLA 2I7NA 1MN3A 1ZMVA 1DO0A 1GL7A 2CV2A 4LCBA 3U5ZB 2I7PA 2MROB 1TGUA 2DAMA 3J81S 4BB9A 3R9XB 3GLGE 1VEJA 3SAWA 4B7HA 1F4IA 4L6V6 4K0KM 2XEPA 1HT2E 3GRUA 3K9PA 4QHTA 3W0FA 4MB7A 2R46A 2WSFF 2XH9A 3FUUA 2YR0A 4REZA 4I81A 2OPFA 4IBJA 5FTKA 2QPAA 4G6ZA 5H37D 3U6PA 5IWAM 3HX3A 3QWLA 4JV5M 2FNAA 2DHYA 2LVAA 4LRTA 4XGIA 3L26A 3U61B 2F5PA 2ZBKB 3SC3A 2YNMD 5JI2E 1NV9A 4YHHM 3IG8A 4GEWA 4Z6YA 4IBFA 3FTFA 2R45A 4LY6A 1EIJA 4CGYB 1HJPA 4L78A 1QUSA 4MGHA 2D7EA 4JI7M 1QQWA 2Q2EB 3I01M 3L29A 3IECA 3QAUA 3HU3A 2CUZA 5LMUM 3CF6E 4DR7M 2KZSA 1SXJB 5EQTA 1XXHE 2LHGA 2R62A 1EE8A 2BNKA 1UFZA 2L2DA 4GKKM 4D82A 3K1JA 3RGSA 4DUYM 3R8FA 2LVQD 2LVPC 1G8PA 1H6UA 2V1UA 3AL0C 1IY1A 3NWLA 1RU3A 2L7HA 5ITXA 3DZDA 3FTCA 3ZQJA 2G3QA 4L15A 4DV6M 4FWDA 5C1BA 1K3XA 1HNZM 4KO8A 5E26A 4BLCA 2VQEM 4KODA 3MK6A 3HU1A 2MR9A 1IXRC 4GIPA 2XSZA 4NRWA 2RGOA 5L8RF 2VDBB 2JP7A 2FS1A 4PDIA 1HR0M 1VEGA 2GQFA 3L28A 2JZ0A 1LTMA 3AV0A 2KRUA 4GH9A 4IBBA 5EP1A 1N77A 3GLIB 5IT9S 4R71A 3HJQA 4QNMA 2Y21A 4G4NA 4IJFA 1G41A 1V92A 4IBIA 2JWSA 3T15A 3W68A 4EIWA 1WR1B 1WIVA 5JI3E 1OIZA 5KQDA 3KFUG 3SHGB 3GLGB 1QDTA 5GKNA 2EKFA 1GLNA 4AKIA 2BWEA 1NNUC 3CF2A 1IM2A 5EXXA 3WHLA 5KPRA 4DR6M 4IBDA 5EP4A 1J5EM 2JY5A 2QBYA 3K92A 2ZTCA 1DGHB 2K0BX 3IHPA 4AG6A 2Z3XA 4B3TM 1Z5CA 1TF0B 1VDLA 4IBEA 4NC6A 1HNWM 5DNYA 1NHGC 2ERCA 5FTMA 1D0KA 1PJTA 4NL4H 4X65M 3ZH9B 5C18A 1G3IA 1V33A 2JY8A 2LVOC 2M5ZA 1Q3CA 1TH4A 5ITRA 4JI8M 1OQYA 4KT0F 4LZJA 2ZAMA 3IG5A 2Z4SA 5FSWA 1GJSA 1GJTA 1IN5A 2OOBA 3D8BA 1KFVA 2F5SA 1VDDA 2F5OA 2QSFX 3THGA 2VF8A 3QYBA 3TQSA 4P16A 3HY5A 1JR3D 2EUCA 3GRVA 3J2PB 1HQCA 1PJQA 2M60A 3FD9A 3U6CA 1HNXM 3GLHE 3GLHA 2KNVA 1XXHB 3J7BA 3UMMA 3HHXA 1GL6A 4WW0A 4NXNM 1IBLM 4F1IA 3MHVC 3F92A 3GQ3A 5E6JA 2H5XA 1G59A 1CUKA 3GO8A 2K47A 1HQYE 2CEAA 2VIIA 2V6ZM 4LFAM 4DV7M 3LQQA 1L2DA 4DV2M 1JQJC 3CTWB 4ZPXA 4X64M 3HJSA 3FYCA 1ZQ9A 2KHHA 4FCVA 4M9SA 4PT5A 1OIPA 2P5TA 5EXTA 3WHKA 2DXIA 1W5TA 2DAGA 5BPVA 3HGIA 1DV0A 2UUAM 2CWBA 3L2AA 2KRKA 2Y0TA 4NRVA 1QZMA 2OO9A 1SXJD 3SHFA 1J09A 3ILKA 3SMSA 1OTRA 1XHBA 1ZMUA 3C3DA 4MGYE 3T1YM 3Q8GA 1D0LA 3CGWA 2XZUA 1IBKM 3C9PA 3MMPA 1NY6A 1Z5AA 1PJSA 4MGIE 4Z8XA 1IFYA 1I4WA 2NQ8C 4FVMA 3RGPA 1IXSA 1IY0A 1NHWC 5BR8M 1MU5A 2RGHA 4LGMA 2RKOA 4ANRA 4F2LA 4MH0E 2L4FA 4LFCM 4LF5M 2EO2A 4Q7JA 2A5YB 4PDGA 3UJNA 1E32A 1NSFA 3GLFB 2WSEF 1N34M 2FOIC 1ZMWA 4QOSA 1L1TA 4LF6M 2DWNA 3VLFB 3AOEC 3LCVB 4DV5M 4AI6A 4KHPM 2KZUA 2XGNA 2R4JA 1PRBA 1R6BX 4CISA 3M6AA 2CP8A 1OJLA 4JI0M 2DHRA 4G3OA 3VK7A 3SFZA 1XB2B 4GC5A 3U6SA 3PNYA 2D7HA 2UXBM 3KOZE 2R4EA 4NSOB 2J5YA 3AOEA 3UGJA 1PJJA 4GMQA 5FTNA 4I4LA 5F3WA 2KEBA 3Q8XA 1Q39A 2X8AA 3RE8A 3M7GA 4IIWA 4R3DA 2ZM6M 1PJIA 1D2NA 1E9RA 2JXNA 2JZ1A 4RNAA 3C58A 1W5SA 1UM8A 3FE3A 2KXEA 5ITXE 4LF8M 1XNRM 4QHSA 4GHAA 4HLQA 2UU9M 3TWLA 5A2QS 2E5LM 4G4RA 1WGNA 2ZTDA 1Q3BA 4LJ4A 3D8LA 3A45A 3FUTA 1N78A 1OFIA 3HU2A 4JI6M 2KNZA 2LWXA 3B89A 4WURA 4L8RC 1GO5A 3LVVA 3U60A 8CATA 2XFSA 4B3RM 3DA1A 3ZC7B 3E9SA 1IXZA 1J7KA 1HT1E 3BOSA 3A46A 4Y28F 4JN6A 4DV4M 4RF1A 1IN7A 2C96A 2XFTA 3FRHA 5DFLA 4OVZB 1OKSA 3A42A 1Z5BA 2O01F 1X37A 2H1RA 2LNHC 1T43A 3BXWA 4OW0A 2DVWB 1T6OA 4CIZA 5ITYA 2CHQA 1K3WA 2HCBA 2Z4RA 1VQ1A 3TE6A 3J27B 3HHYA 1NNJA 2EJSA 4TUWA 3E4RA 4IJEA 2KW0A 4GHLA 2HKJA 4JXJA 1I94M 3E46A 4LRSA 1QYRA 5DYIA 2DZOB 3VDUA 4LF7M 2C9CA 1TH3A 4LJ8A 4DV0M 2XSZD 4RKUF 4LJ9A 2GNOA 2KDLA 5EJCA 1IY2A 1KYIA 3HJ8A 4HEOA 4R7GA 4X66M 3HWSA 3QYEA 3U5ZA 2C5RA 3SAUA 3KOWE 2C99A 2QQ8A 3TL4X 2UXDM 3LCUA 1QUTA 1JR3A 1DGGA 1DO2A 2DZLA 1Y8GA 3FUWA 4NOOB 2CV1A 4MM3B 4UN2B 4MGZE 1LV7A 3GQ5A 3JR4A 4FD2A 4RF0A 4FWGA 4GC9A 1NO1A 1ZAEA 2Y20A 2DAEA 2W82A 4AZFA 2HAKA 5EXSA 3W67A 2Z7JA 3U61A 1XMOM 3FRIA 1FNNA 4FCTA 1NJFA 1E94E 4PD2A 1OAIA 2JY6B 5KO3A 1V34A 2L09A 1QAMA 2OQ4A 2N35A 2ZANA 4DR4M 2L4EA
chains in the Genus database with same CATH topology
4DV1M 3PVSA 3VKGA 3SYKA 4CHTB 4D80A 1R2ZA 3FUXA 3KS8A 5FTLA 2R18A 3SARA 3LQRA 1T3TA 2VQFM 3KP1E 3AKZA 4DR5M 1NY5A 1FJGM 3J7AS 1DGFA 3SATA 1ORYB 1NJGA 5ITTA 2CE7A 4OU7A 3HKPA 4OX9M 3SBJA 1G4AE 4MGKE 1R2YA 3I4VA 3J80S 4PCZA 3SAVA 1N32M 4M9XA 1QVRA 4GRIA 3GPXA 5EP2A 4BBAA 3A98B 2QBYB 4B3SM 1IN4A 1TDZA 2DWZB 2C9OA 5KQ8A 2UUCM 4W5WA 4JI3M 2DWMA 3GPYA 3GLIA 3U6QA 1XWIA 1L2CA 4AW4A 2O5RA 2XZFA 3I4YA 3SMPA 2HHHM 2C98A 5EXPA 3GLGA 4LFBM 4NXMM 2UXCM 2V1CA 4QOZC 4A3VB 4NSRA 1N75A 4M0WA 1QAOA 1DGHA 2AHMA 5ITUA 4IBCA 4B7GA 3GPPA 4L16A 4JYAM 2QENA 3I51A 1IBMM 3KOXE 3VDPA 3ZCBB 4D81A 3GLHB 4JI4M 3UZUA 3U6DA 1YUBA 4JI1M 1S3SA 3JAMS 1XNQM 1GKIA 4LJAA 3B9PA 5EP3A 3OTOM 3HHWA 4DR3M 3EIEA 4JI2M 3FUVA 2R65A 4IBKA 3KSJA 4DUZM 3U6MA 5FLXS 3FTEA 4B08A 3PFIA 4FW9A 2CHVA 3K8ZA 5IREB 3CF0A 4FCWA 4LG2A 1GVNA 1XXHA 5ITQA 1Z59A 3KDSE 2LH0A 3LVWA 2QCUA 1L1ZA 3HHZA 1L8QA 4JI5M 4XBOA 3PNVA 1K82A 2BJWA 4B3MM 2F4VM 3M0EA 7CATA 2J7NA 3LMMA 3H4MA 1IXSB 3GPUA 3DOAA 3KOYE 4LJ7A 4KLNA 1Z6TA 4AG5A 3T38A 1N36M 3L27A 2J7OA 3KXEC 4LJ5A 2D7GA 3GQ4A 2DWLA 3NBIA 1QAQA 2UUBM 5DYGA 3AJIB 1WXQA 1KSFX 4G4OA 5IZ7D 3AFHA 3JR5A 1DGBA 4DV3M 1TH2A 5KPTA 3GP1A 3DFZA 2BJVA 3SASA 4I8OA 4M9ZA 4L4UA 2X4AA 2EA0A 1QANA 2JA2A 5KPZA 1YSYA 3KSXA 3VKHA 3GRYA 2L6OA 4AKGA 1IN8A 4B7FA 4DR2M 1PM5A 3GLFA 2F5QA 4YY3M 4AQYM 3AOGA 1MX0A 3VFDA 3FTDA 2LXEA 2XLJA 3U6OA 3TPZA 4ITQA 1SXJC 3RFWA 3L25A 3T1HM 2L7IA 2YFQA 3TWMA 2CV0A 3KW6A 1TDHA 2DZNB 2HL7A 3PXGA 2KA6B 1NVMA 3FKEA 4II7A 2FFJA 1SXJE 3K2LA 2ZAOA 1R7RA 1SXJA 3W0LB 4LF4M 3MJ5A 5FTJA 3U60B 2QP9X 1E9SA 3KP0E 2G8LA 2FE8A 3VK8A 3FYDA 2X49A 4FWHA 2Y0QA 4LGYA 1N33M 1XC8A 2CHGA 2G5GX 2YQZA 3TWKA 4S12A 3GRRA 2QZ4A 4I5SA 3U6LA 4DR1M 1L2BA 4AKHA 2CFOA 4QNRA 4G4QA 1OFHA 4GKJM 1YE9A 4LZZA 2XF3A 3EIHA 4X62M 1IQPA 4IBGA 4LF9M 1C1KA 3KS4A 2F5NA 1IN6A 4M0DA 3KVWA 4LJ6A 5LMNM 1XMQM 3UK6A 4HL4A 3U6EA 4GITA 4OVZA 3SYLA 2I7NA 2CV2A 1DO0A 1GL7A 4LCBA 3U5ZB 2I7PA 1TGUA 3J81S 4BB9A 3R9XB 3SAWA 4B7HA 4K0KM 2XEPA 1HT2E 3GRUA 4QHTA 3W0FA 4MB7A 2R46A 2XH9A 3FUUA 2YR0A 4REZA 4I81A 2OPFA 4IBJA 5FTKA 2QPAA 4G6ZA 5H37D 3U6PA 5IWAM 3QWLA 4JV5M 2FNAA 4XGIA 4LRTA 2F5PA 3L26A 3U61B 2ZBKB 3SC3A 2YNMD 5JI2E 4YHHM 3IG8A 4Z6YA 3FTFA 4IBFA 2R45A 4LY6A 4CGYB 4L78A 4MGHA 4JI7M 2D7EA 1QQWA 2Q2EB 3L29A 3QAUA 3HU3A 2CUZA 5LMUM 3CF6E 4DR7M 2KZSA 1SXJB 5EQTA 2R62A 1EE8A 2BNKA 4GKKM 4D82A 3K1JA 3RGSA 4DUYM 3R8FA 1G8PA 1H6UA 2V1UA 3AL0C 1IY1A 3NWLA 2L7HA 5ITXA 3DZDA 3FTCA 4L15A 4DV6M 1K3XA 4FWDA 5C1BA 1HNZM 4KO8A 5E26A 4BLCA 2VQEM 4KODA 3MK6A 3HU1A 1IXRC 4GIPA 2XSZA 4NRWA 2RGOA 4PDIA 1HR0M 3L28A 3AV0A 4IBBA 2KRUA 4GH9A 1N77A 5EP1A 5IT9S 3GLIB 3HJQA 4QNMA 2Y21A 4G4NA 4IJFA 1G41A 4IBIA 3T15A 4EIWA 5KQDA 3KFUG 5JI3E 3SHGB 3GLGB 5GKNA 1GLNA 4AKIA 1NNUC 3CF2A 1IM2A 5EXXA 3WHLA 5KPRA 4DR6M 4IBDA 5EP4A 1J5EM 2QBYA 3K92A 1DGHB 4AG6A 2Z3XA 4B3TM 1Z5CA 4IBEA 1HNWM 5DNYA 1NHGC 2ERCA 5FTMA 4NL4H 4X65M 3ZH9B 5C18A 1G3IA 2M5ZA 1Q3CA 1TH4A 5ITRA 4JI8M 4LZJA 2ZAMA 3IG5A 2Z4SA 5FSWA 1IN5A 3D8BA 1KFVA 2F5SA 1VDDA 2F5OA 3THGA 3TQSA 4P16A 2DWNA 1JR3D 2EUCA 3GRVA 3J2PB 1HQCA 3FD9A 2M60A 3U6CA 1HNXM 3GLHA 1XXHB 3J7BA 3UMMA 3HHXA 1GL6A 4WW0A 4NXNM 1IBLM 3MHVC 3GQ3A 5E6JA 1G59A 3GO8A 2K47A 1HQYE 2CEAA 2VIIA 2V6ZM 4LFAM 4DV7M 3LQQA 1L2DA 4DV2M 1JQJC 3CTWB 4ZPXA 4X64M 3HJSA 3FYCA 1ZQ9A 4FCVA 4M9SA 4PT5A 5EXTA 2DXIA 2P5TA 3WHKA 1W5TA 5BPVA 3HGIA 2UUAM 3L2AA 2KRKA 2Y0TA 4NRVA 1QZMA 1SXJD 3SHFA 1J09A 3ILKA 3SMSA 1XHBA 4MGYE 3T1YM 2XZUA 1IBKM 1NY6A 1Z5AA 4MGIE 4Z8XA 1I4WA 2NQ8C 4FVMA 3RGPA 1IY0A 1NHWC 5BR8M 1MU5A 2RGHA 4LGMA 2RKOA 4MH0E 4LFCM 4LF5M 2EO2A 4PDGA 2A5YB 3UJNA 1E32A 1NSFA 3GLFB 1N34M 2FOIC 4QOSA 1L1TA 4LF6M 3VLFB 3AOEC 4DV5M 4AI6A 4KHPM 2KZUA 2XGNA 2R4JA 1R6BX 4CISA 3M6AA 1OJLA 4JI0M 2DHRA 3VK7A 3SFZA 4GC5A 3U6SA 3PNYA 2D7HA 2UXBM 3KOZE 2R4EA 4NSOB 3UGJA 3AOEA 1PJJA 4GMQA 5FTNA 4I4LA 5F3WA 2KEBA 3Q8XA 1Q39A 2X8AA 3RE8A 3M7GA 4IIWA 4R3DA 2ZM6M 1PJIA 1D2NA 1E9RA 4RNAA 3C58A 1W5SA 1UM8A 5ITXE 2KXEA 4LF8M 1XNRM 4GHAA 4QHSA 4HLQA 2UU9M 3TWLA 5A2QS 2E5LM 4G4RA 4LJ4A 1Q3BA 3D8LA 3A45A 3FUTA 1N78A 1OFIA 3HU2A 4JI6M 2LWXA 4WURA 4L8RC 3LVVA 3U60A 8CATA 2XFSA 4B3RM 3DA1A 3ZC7B 3E9SA 1IXZA 1J7KA 1HT1E 3BOSA 3A46A 4JN6A 4DV4M 4RF1A 1IN7A 2C96A 2XFTA 4OVZB 3A42A 1Z5BA 1X37A 2H1RA 2LNHC 4OW0A 2DVWB 5ITYA 2CHQA 1K3WA 2HCBA 2Z4RA 3TE6A 3J27B 3HHYA 1NNJA 4TUWA 3E4RA 4IJEA 2KW0A 4GHLA 2HKJA 4JXJA 1I94M 4LRSA 1QYRA 5DYIA 2DZOB 3VDUA 4LF7M 2C9CA 1TH3A 4LJ8A 4DV0M 2XSZD 4LJ9A 5EJCA 4X66M 1IY2A 1KYIA 3HJ8A 4R7GA 3U5ZA 2C5RA 3HWSA 3SAUA 3KOWE 2C99A 3TL4X 2UXDM 1JR3A 1DGGA 1DO2A 4NOOB 3FUWA 2CV1A 4MM3B 4MGZE 1LV7A 3GQ5A 3JR4A 4FD2A 4RF0A 4FWGA 4GC9A 1ZAEA 2Y20A 2W82A 4AZFA 5EXSA 2Z7JA 3U61A 1XMOM 1FNNA 4FCTA 1NJFA 1E94E 4PD2A 5KO3A 2L09A 1QAMA 2OQ4A 2ZANA 4DR4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP0 E;  3KP1 E;  3KOZ E;  3KOY E;  3KOW E;  3KOX E; 
#chains in the Genus database with same CATH topology
 4DV1 M;  2DEN A;  3PVS A;  3VKG A;  3SYK A;  4CHT B;  1ZV1 A;  1R5L A;  4D80 A;  1R2Z A;  3FUX A;  3KS8 A;  5FTL A;  2R18 A;  3SAR A;  3LQR A;  1T3T A;  1VEK A;  2VQF M;  3KP1 E;  3AKZ A;  4DR5 M;  1NY5 A;  1TTE A;  1FJG M;  3B7Q A;  3J7A S;  1DGF A;  3SAT A;  1ORY B;  1NJG A;  2HWJ A;  5ITT A;  4CJ6 A;  2JNH A;  2CE7 A;  4OU7 A;  3HKP A;  1QZE A;  2R0I A;  2B3T A;  4OX9 M;  3SBJ A;  1G4A E;  4MGK E;  2K6B A;  1R2Y A;  1Q02 A;  3I4V A;  3J80 S;  4PCZ A;  2R44 A;  3SAV A;  4M9X A;  1N32 M;  1QVR A;  4GRI A;  3GPX A;  5EP2 A;  4BBA A;  3V76 A;  3A98 B;  2VF7 A;  2QBY B;  4B3S M;  1IN4 A;  1TDZ A;  2DAK A;  2DWZ B;  2C9O A;  3I04 M;  5KQ8 A;  2UUC M;  4W5W A;  4JI3 M;  2DWM A;  1JB0 F;  1QDR A;  1NV8 A;  2APL A;  3GPY A;  3GLI A;  3U6Q A;  3C3E A;  1XWI A;  1L2C A;  4AW4 A;  2O5R A;  2XZF A;  3I4Y A;  3SMP A;  2HHH M;  2C98 A;  5EXP A;  3GLG A;  4LFB M;  4NXM M;  2UXC M;  2V1C A;  4QOZ C;  2DNA A;  4A3V B;  4NSR A;  1N75 A;  4M0W A;  1QAO A;  2QHO B;  1DGH A;  3H4J A;  2AHM A;  5ITU A;  4IBC A;  4B7G A;  2KNA A;  4L16 A;  3GPP A;  2QEN A;  4JYA M;  3I51 A;  3B7N A;  2LTU A;  3KOX E;  1IBM M;  3VDP A;  3ZCB B;  4D81 A;  3GLH B;  4JI4 M;  3UZU A;  3U6D A;  1YUB A;  4JI1 M;  2Z8Y M;  1AIP C;  1S3S A;  3JAM S;  1XNQ M;  1GKI A;  4LJA A;  3B9P A;  3BBZ A;  2DI0 A;  5EP3 A;  3OTO M;  3HHW A;  4DR3 M;  3EIE A;  3T6P A;  1VG5 A;  4P17 A;  3B7Z A;  4JI2 M;  3FUV A;  2DKL A;  2R65 A;  3KSJ A;  4IBK A;  4DUZ M;  5FLX S;  3U6M A;  1AUA A;  4B08 A;  3FTE A;  2WSC F;  3PFI A;  2CHV A;  3K8Z A;  2JUJ A;  4FW9 A;  5IRE B;  3CF0 A;  4FCW A;  4LG2 A;  1GVN A;  1XXH A;  2K9D A;  5ITQ A;  1Z59 A;  3KDS E;  1D0M A;  2LH0 A;  3LVW A;  2QCU A;  1L1Z A;  3HHZ A;  1L8Q A;  4JI5 M;  2LHC A;  4XBO A;  3PNV A;  1A5T A;  2BJW A;  1K82 A;  4B3M M;  2F4V M;  3M0E A;  4XK8 F;  7CAT A;  2J7N A;  3LMM A;  3H4M A;  1IXS B;  3GPU A;  3DOA A;  3KOY E;  4LJ7 A;  4KLN A;  1Z6T A;  4AG5 A;  3T38 A;  1N36 M;  3L27 A;  2J7O A;  2WZJ A;  3KXE C;  4LJ5 A;  2D7G A;  3GQ4 A;  2R6F A;  2DWL A;  3NBI A;  1QAQ A;  2UUB M;  5DYG A;  1WXQ A;  3AJI B;  1KSF X;  4G4O A;  5IZ7 D;  3AFH A;  3JR5 A;  1DGB A;  2EKK A;  4DV3 M;  1TH2 A;  5KPT A;  3GP1 A;  3DFZ A;  2BJV A;  1P3Q Q;  2QNJ A;  4I8O A;  4M9Z A;  3SAS A;  1BVS A;  1JR3 E;  1MJG M;  4L4U A;  2LBC A;  2X4A A;  2EA0 A;  1C7Y A;  1QAN A;  2JA2 A;  5KPZ A;  1WGL A;  1R4G A;  1YSY A;  3KSX A;  3VKH A;  3GRY A;  2CRU A;  2L6O A;  4AKG A;  1IN8 A;  3GLF E;  4B7F A;  1WHC A;  4DR2 M;  3GLF A;  1PM5 A;  2F5Q A;  3E21 A;  4YY3 M;  2MGW A;  4AQY M;  3AOG A;  1MX0 A;  3VFD A;  3FTD A;  2LXE A;  2BWB A;  4WP2 A;  2XLJ A;  3U6O A;  3TPZ A;  4ITQ A;  2RRU A;  1SXJ C;  2O25 A;  3NBX X;  3RFW A;  3L25 A;  3T1H M;  2L7I A;  2YFQ A;  3TWM A;  2CV0 A;  3KW6 A;  1TDH A;  2DZN B;  1GAB A;  2HL7 A;  3PXG A;  1TR8 A;  2KA6 B;  1NVM A;  3FKE A;  2MJ5 B;  1OAO C;  2FH0 A;  1YLA A;  4II7 A;  2JY7 A;  1SXJ E;  2FFJ A;  3K2L A;  2ZAO A;  1R7R A;  1SXJ A;  3W0L B;  4LF4 M;  3MJ5 A;  3LW5 F;  5FTJ A;  3U60 B;  2OOA A;  2QP9 X;  1E9S A;  1SG9 A;  3KP0 E;  2G8L A;  2FE8 A;  3VK8 A;  3FYD A;  2X49 A;  4FWH A;  2Y0Q A;  1WJ7 A;  3K9O A;  4LGY A;  1N33 M;  1XC8 A;  2CHG A;  2G5G X;  2LVN C;  1EFU B;  2YQZ A;  3TWK A;  4S12 A;  3GRR A;  2QZ4 A;  4I5S A;  3U6L A;  4DR1 M;  1L2B A;  4AKH A;  2CFO A;  4QNR A;  4G4Q A;  1OFH A;  4GKJ M;  1YE9 A;  4LZZ A;  2XF3 A;  1G71 A;  1PGY A;  3EIH A;  4X62 M;  1IQP A;  4IBG A;  4LF9 M;  1C1K A;  3KS4 A;  2F5N A;  3B74 A;  1IN6 A;  2DAI A;  4M0D A;  3KVW A;  4LJ6 A;  5LMN M;  4DBG B;  1XMQ M;  3UK6 A;  3HZJ A;  4HL4 A;  4GIT A;  3U6E A;  3GLI E;  4OVZ A;  2MH8 A;  3SYL A;  2I7N A;  1MN3 A;  1ZMV A;  1DO0 A;  1GL7 A;  2CV2 A;  4LCB A;  3U5Z B;  2I7P A;  2MRO B;  1TGU A;  2DAM A;  3J81 S;  4BB9 A;  3R9X B;  3GLG E;  1VEJ A;  3SAW A;  4B7H A;  1F4I A;  4L6V 6;  4K0K M;  2XEP A;  1HT2 E;  3GRU A;  3K9P A;  4QHT A;  3W0F A;  4MB7 A;  2R46 A;  2WSF F;  2XH9 A;  3FUU A;  2YR0 A;  4REZ A;  4I81 A;  2OPF A;  4IBJ A;  5FTK A;  2QPA A;  4G6Z A;  5H37 D;  3U6P A;  5IWA M;  3HX3 A;  3QWL A;  4JV5 M;  2FNA A;  2DHY A;  2LVA A;  4LRT A;  4XGI A;  3L26 A;  3U61 B;  2F5P A;  2ZBK B;  3SC3 A;  2YNM D;  5JI2 E;  1NV9 A;  4YHH M;  3IG8 A;  4GEW A;  4Z6Y A;  4IBF A;  3FTF A;  2R45 A;  4LY6 A;  1EIJ A;  4CGY B;  1HJP A;  4L78 A;  1QUS A;  4MGH A;  2D7E A;  4JI7 M;  1QQW A;  2Q2E B;  3I01 M;  3L29 A;  3IEC A;  3QAU A;  3HU3 A;  2CUZ A;  5LMU M;  3CF6 E;  4DR7 M;  2KZS A;  1SXJ B;  5EQT A;  1XXH E;  2LHG A;  2R62 A;  1EE8 A;  2BNK A;  1UFZ A;  2L2D A;  4GKK M;  4D82 A;  3K1J A;  3RGS A;  4DUY M;  3R8F A;  2LVQ D;  2LVP C;  1G8P A;  1H6U A;  2V1U A;  3AL0 C;  1IY1 A;  3NWL A;  1RU3 A;  2L7H A;  5ITX A;  3DZD A;  3FTC A;  3ZQJ A;  2G3Q A;  4L15 A;  4DV6 M;  4FWD A;  5C1B A;  1K3X A;  1HNZ M;  4KO8 A;  5E26 A;  4BLC A;  2VQE M;  4KOD A;  3MK6 A;  3HU1 A;  2MR9 A;  1IXR C;  4GIP A;  2XSZ A;  4NRW A;  2RGO A;  5L8R F;  2VDB B;  2JP7 A;  2FS1 A;  4PDI A;  1HR0 M;  1VEG A;  2GQF A;  3L28 A;  2JZ0 A;  1LTM A;  3AV0 A;  2KRU A;  4GH9 A;  4IBB A;  5EP1 A;  1N77 A;  3GLI B;  5IT9 S;  4R71 A;  3HJQ A;  4QNM A;  2Y21 A;  4G4N A;  4IJF A;  1G41 A;  1V92 A;  4IBI A;  2JWS A;  3T15 A;  3W68 A;  4EIW A;  1WR1 B;  1WIV A;  5JI3 E;  1OIZ A;  5KQD A;  3KFU G;  3SHG B;  3GLG B;  1QDT A;  5GKN A;  2EKF A;  1GLN A;  4AKI A;  2BWE A;  1NNU C;  3CF2 A;  1IM2 A;  5EXX A;  3WHL A;  5KPR A;  4DR6 M;  4IBD A;  5EP4 A;  1J5E M;  2JY5 A;  2QBY A;  3K92 A;  2ZTC A;  1DGH B;  2K0B X;  3IHP A;  4AG6 A;  2Z3X A;  4B3T M;  1Z5C A;  1TF0 B;  1VDL A;  4IBE A;  4NC6 A;  1HNW M;  5DNY A;  1NHG C;  2ERC A;  5FTM A;  1D0K A;  1PJT A;  4NL4 H;  4X65 M;  3ZH9 B;  5C18 A;  1G3I A;  1V33 A;  2JY8 A;  2LVO C;  2M5Z A;  1Q3C A;  1TH4 A;  5ITR A;  4JI8 M;  1OQY A;  4KT0 F;  4LZJ A;  2ZAM A;  3IG5 A;  2Z4S A;  5FSW A;  1GJS A;  1GJT A;  1IN5 A;  2OOB A;  3D8B A;  1KFV A;  2F5S A;  1VDD A;  2F5O A;  2QSF X;  3THG A;  2VF8 A;  3QYB A;  3TQS A;  4P16 A;  3HY5 A;  1JR3 D;  2EUC A;  3GRV A;  3J2P B;  1HQC A;  1PJQ A;  2M60 A;  3FD9 A;  3U6C A;  1HNX M;  3GLH E;  3GLH A;  2KNV A;  1XXH B;  3J7B A;  3UMM A;  3HHX A;  1GL6 A;  4WW0 A;  4NXN M;  1IBL M;  4F1I A;  3MHV C;  3F92 A;  3GQ3 A;  5E6J A;  2H5X A;  1G59 A;  1CUK A;  3GO8 A;  2K47 A;  1HQY E;  2CEA A;  2VII A;  2V6Z M;  4LFA M;  4DV7 M;  3LQQ A;  1L2D A;  4DV2 M;  1JQJ C;  3CTW B;  4ZPX A;  4X64 M;  3HJS A;  3FYC A;  1ZQ9 A;  2KHH A;  4FCV A;  4M9S A;  4PT5 A;  1OIP A;  2P5T A;  5EXT A;  3WHK A;  2DXI A;  1W5T A;  2DAG A;  5BPV A;  3HGI A;  1DV0 A;  2UUA M;  2CWB A;  3L2A A;  2KRK A;  2Y0T A;  4NRV A;  1QZM A;  2OO9 A;  1SXJ D;  3SHF A;  1J09 A;  3ILK A;  3SMS A;  1OTR A;  1XHB A;  1ZMU A;  3C3D A;  4MGY E;  3T1Y M;  3Q8G A;  1D0L A;  3CGW A;  2XZU A;  1IBK M;  3C9P A;  3MMP A;  1NY6 A;  1Z5A A;  1PJS A;  4MGI E;  4Z8X A;  1IFY A;  1I4W A;  2NQ8 C;  4FVM A;  3RGP A;  1IXS A;  1IY0 A;  1NHW C;  5BR8 M;  1MU5 A;  2RGH A;  4LGM A;  2RKO A;  4ANR A;  4F2L A;  4MH0 E;  2L4F A;  4LFC M;  4LF5 M;  2EO2 A;  4Q7J A;  2A5Y B;  4PDG A;  3UJN A;  1E32 A;  1NSF A;  3GLF B;  2WSE F;  1N34 M;  2FOI C;  1ZMW A;  4QOS A;  1L1T A;  4LF6 M;  2DWN A;  3VLF B;  3AOE C;  3LCV B;  4DV5 M;  4AI6 A;  4KHP M;  2KZU A;  2XGN A;  2R4J A;  1PRB A;  1R6B X;  4CIS A;  3M6A A;  2CP8 A;  1OJL A;  4JI0 M;  2DHR A;  4G3O A;  3VK7 A;  3SFZ A;  1XB2 B;  4GC5 A;  3U6S A;  3PNY A;  2D7H A;  2UXB M;  3KOZ E;  2R4E A;  4NSO B;  2J5Y A;  3AOE A;  3UGJ A;  1PJJ A;  4GMQ A;  5FTN A;  4I4L A;  5F3W A;  2KEB A;  3Q8X A;  1Q39 A;  2X8A A;  3RE8 A;  3M7G A;  4IIW A;  4R3D A;  2ZM6 M;  1PJI A;  1D2N A;  1E9R A;  2JXN A;  2JZ1 A;  4RNA A;  3C58 A;  1W5S A;  1UM8 A;  3FE3 A;  2KXE A;  5ITX E;  4LF8 M;  1XNR M;  4QHS A;  4GHA A;  4HLQ A;  2UU9 M;  3TWL A;  5A2Q S;  2E5L M;  4G4R A;  1WGN A;  2ZTD A;  1Q3B A;  4LJ4 A;  3D8L A;  3A45 A;  3FUT A;  1N78 A;  1OFI A;  3HU2 A;  4JI6 M;  2KNZ A;  2LWX A;  3B89 A;  4WUR A;  4L8R C;  1GO5 A;  3LVV A;  3U60 A;  8CAT A;  2XFS A;  4B3R M;  3DA1 A;  3ZC7 B;  3E9S A;  1IXZ A;  1J7K A;  1HT1 E;  3BOS A;  3A46 A;  4Y28 F;  4JN6 A;  4DV4 M;  4RF1 A;  1IN7 A;  2C96 A;  2XFT A;  3FRH A;  5DFL A;  4OVZ B;  1OKS A;  3A42 A;  1Z5B A;  2O01 F;  1X37 A;  2H1R A;  2LNH C;  1T43 A;  3BXW A;  4OW0 A;  2DVW B;  1T6O A;  4CIZ A;  5ITY A;  2CHQ A;  1K3W A;  2HCB A;  2Z4R A;  1VQ1 A;  3TE6 A;  3J27 B;  3HHY A;  1NNJ A;  2EJS A;  4TUW A;  3E4R A;  4IJE A;  2KW0 A;  4GHL A;  2HKJ A;  4JXJ A;  1I94 M;  3E46 A;  4LRS A;  1QYR A;  5DYI A;  2DZO B;  3VDU A;  4LF7 M;  2C9C A;  1TH3 A;  4LJ8 A;  4DV0 M;  2XSZ D;  4RKU F;  4LJ9 A;  2GNO A;  2KDL A;  5EJC A;  1IY2 A;  1KYI A;  3HJ8 A;  4HEO A;  4R7G A;  4X66 M;  3HWS A;  3QYE A;  3U5Z A;  2C5R A;  3SAU A;  3KOW E;  2C99 A;  2QQ8 A;  3TL4 X;  2UXD M;  3LCU A;  1QUT A;  1JR3 A;  1DGG A;  1DO2 A;  2DZL A;  1Y8G A;  3FUW A;  4NOO B;  2CV1 A;  4MM3 B;  4UN2 B;  4MGZ E;  1LV7 A;  3GQ5 A;  3JR4 A;  4FD2 A;  4RF0 A;  4FWG A;  4GC9 A;  1NO1 A;  1ZAE A;  2Y20 A;  2DAE A;  2W82 A;  4AZF A;  2HAK A;  5EXS A;  3W67 A;  2Z7J A;  3U61 A;  1XMO M;  3FRI A;  1FNN A;  4FCT A;  1NJF A;  1E94 E;  4PD2 A;  1OAI A;  2JY6 B;  5KO3 A;  1V34 A;  2L09 A;  1QAM A;  2OQ4 A;  2N35 A;  2ZAN A;  4DR4 M;  2L4E A; 
#chains in the Genus database with same CATH homology
 4DV1 M;  3PVS A;  3VKG A;  3SYK A;  4CHT B;  4D80 A;  1R2Z A;  3FUX A;  3KS8 A;  5FTL A;  2R18 A;  3SAR A;  3LQR A;  1T3T A;  2VQF M;  3KP1 E;  3AKZ A;  4DR5 M;  1NY5 A;  1FJG M;  3J7A S;  1DGF A;  3SAT A;  1ORY B;  1NJG A;  5ITT A;  2CE7 A;  4OU7 A;  3HKP A;  4OX9 M;  3SBJ A;  1G4A E;  4MGK E;  1R2Y A;  3I4V A;  3J80 S;  4PCZ A;  3SAV A;  1N32 M;  4M9X A;  1QVR A;  4GRI A;  3GPX A;  5EP2 A;  4BBA A;  3A98 B;  2QBY B;  4B3S M;  1IN4 A;  1TDZ A;  2DWZ B;  2C9O A;  5KQ8 A;  2UUC M;  4W5W A;  4JI3 M;  2DWM A;  3GPY A;  3GLI A;  3U6Q A;  1XWI A;  1L2C A;  4AW4 A;  2O5R A;  2XZF A;  3I4Y A;  3SMP A;  2HHH M;  2C98 A;  5EXP A;  3GLG A;  4LFB M;  4NXM M;  2UXC M;  2V1C A;  4QOZ C;  4A3V B;  4NSR A;  1N75 A;  4M0W A;  1QAO A;  1DGH A;  2AHM A;  5ITU A;  4IBC A;  4B7G A;  3GPP A;  4L16 A;  4JYA M;  2QEN A;  3I51 A;  1IBM M;  3KOX E;  3VDP A;  3ZCB B;  4D81 A;  3GLH B;  4JI4 M;  3UZU A;  3U6D A;  1YUB A;  4JI1 M;  1S3S A;  3JAM S;  1XNQ M;  1GKI A;  4LJA A;  3B9P A;  5EP3 A;  3OTO M;  3HHW A;  4DR3 M;  3EIE A;  4JI2 M;  3FUV A;  2R65 A;  4IBK A;  3KSJ A;  4DUZ M;  3U6M A;  5FLX S;  3FTE A;  4B08 A;  3PFI A;  4FW9 A;  2CHV A;  3K8Z A;  5IRE B;  3CF0 A;  4FCW A;  4LG2 A;  1GVN A;  1XXH A;  5ITQ A;  1Z59 A;  3KDS E;  2LH0 A;  3LVW A;  2QCU A;  1L1Z A;  3HHZ A;  1L8Q A;  4JI5 M;  4XBO A;  3PNV A;  1K82 A;  2BJW A;  4B3M M;  2F4V M;  3M0E A;  7CAT A;  2J7N A;  3LMM A;  3H4M A;  1IXS B;  3GPU A;  3DOA A;  3KOY E;  4LJ7 A;  4KLN A;  1Z6T A;  4AG5 A;  3T38 A;  1N36 M;  3L27 A;  2J7O A;  3KXE C;  4LJ5 A;  2D7G A;  3GQ4 A;  2DWL A;  3NBI A;  1QAQ A;  2UUB M;  5DYG A;  3AJI B;  1WXQ A;  1KSF X;  4G4O A;  5IZ7 D;  3AFH A;  3JR5 A;  1DGB A;  4DV3 M;  1TH2 A;  5KPT A;  3GP1 A;  3DFZ A;  2BJV A;  3SAS A;  4I8O A;  4M9Z A;  4L4U A;  2X4A A;  2EA0 A;  1QAN A;  2JA2 A;  5KPZ A;  1YSY A;  3KSX A;  3VKH A;  3GRY A;  2L6O A;  4AKG A;  1IN8 A;  4B7F A;  4DR2 M;  1PM5 A;  3GLF A;  2F5Q A;  4YY3 M;  4AQY M;  3AOG A;  1MX0 A;  3VFD A;  3FTD A;  2LXE A;  2XLJ A;  3U6O A;  3TPZ A;  4ITQ A;  1SXJ C;  3RFW A;  3L25 A;  3T1H M;  2L7I A;  2YFQ A;  3TWM A;  2CV0 A;  3KW6 A;  1TDH A;  2DZN B;  2HL7 A;  3PXG A;  2KA6 B;  1NVM A;  3FKE A;  4II7 A;  2FFJ A;  1SXJ E;  3K2L A;  2ZAO A;  1R7R A;  1SXJ A;  3W0L B;  4LF4 M;  3MJ5 A;  5FTJ A;  3U60 B;  2QP9 X;  1E9S A;  3KP0 E;  2G8L A;  2FE8 A;  3VK8 A;  3FYD A;  2X49 A;  4FWH A;  2Y0Q A;  4LGY A;  1N33 M;  1XC8 A;  2CHG A;  2G5G X;  2YQZ A;  3TWK A;  4S12 A;  3GRR A;  2QZ4 A;  4I5S A;  3U6L A;  4DR1 M;  1L2B A;  4AKH A;  2CFO A;  4QNR A;  4G4Q A;  1OFH A;  4GKJ M;  1YE9 A;  4LZZ A;  2XF3 A;  3EIH A;  4X62 M;  1IQP A;  4IBG A;  4LF9 M;  1C1K A;  3KS4 A;  2F5N A;  1IN6 A;  4M0D A;  3KVW A;  4LJ6 A;  5LMN M;  1XMQ M;  3UK6 A;  4HL4 A;  3U6E A;  4GIT A;  4OVZ A;  3SYL A;  2I7N A;  2CV2 A;  1DO0 A;  1GL7 A;  4LCB A;  3U5Z B;  2I7P A;  1TGU A;  3J81 S;  4BB9 A;  3R9X B;  3SAW A;  4B7H A;  4K0K M;  2XEP A;  1HT2 E;  3GRU A;  4QHT A;  3W0F A;  4MB7 A;  2R46 A;  2XH9 A;  3FUU A;  2YR0 A;  4REZ A;  4I81 A;  2OPF A;  4IBJ A;  5FTK A;  2QPA A;  4G6Z A;  5H37 D;  3U6P A;  5IWA M;  3QWL A;  4JV5 M;  2FNA A;  4XGI A;  4LRT A;  2F5P A;  3L26 A;  3U61 B;  2ZBK B;  3SC3 A;  2YNM D;  5JI2 E;  4YHH M;  3IG8 A;  4Z6Y A;  3FTF A;  4IBF A;  2R45 A;  4LY6 A;  4CGY B;  4L78 A;  4MGH A;  4JI7 M;  2D7E A;  1QQW A;  2Q2E B;  3L29 A;  3QAU A;  3HU3 A;  2CUZ A;  5LMU M;  3CF6 E;  4DR7 M;  2KZS A;  1SXJ B;  5EQT A;  2R62 A;  1EE8 A;  2BNK A;  4GKK M;  4D82 A;  3K1J A;  3RGS A;  4DUY M;  3R8F A;  1G8P A;  1H6U A;  2V1U A;  3AL0 C;  1IY1 A;  3NWL A;  2L7H A;  5ITX A;  3DZD A;  3FTC A;  4L15 A;  4DV6 M;  1K3X A;  4FWD A;  5C1B A;  1HNZ M;  4KO8 A;  5E26 A;  4BLC A;  2VQE M;  4KOD A;  3MK6 A;  3HU1 A;  1IXR C;  4GIP A;  2XSZ A;  4NRW A;  2RGO A;  4PDI A;  1HR0 M;  3L28 A;  3AV0 A;  4IBB A;  2KRU A;  4GH9 A;  1N77 A;  5EP1 A;  5IT9 S;  3GLI B;  3HJQ A;  4QNM A;  2Y21 A;  4G4N A;  4IJF A;  1G41 A;  4IBI A;  3T15 A;  4EIW A;  5KQD A;  3KFU G;  5JI3 E;  3SHG B;  3GLG B;  5GKN A;  1GLN A;  4AKI A;  1NNU C;  3CF2 A;  1IM2 A;  5EXX A;  3WHL A;  5KPR A;  4DR6 M;  4IBD A;  5EP4 A;  1J5E M;  2QBY A;  3K92 A;  1DGH B;  4AG6 A;  2Z3X A;  4B3T M;  1Z5C A;  4IBE A;  1HNW M;  5DNY A;  1NHG C;  2ERC A;  5FTM A;  4NL4 H;  4X65 M;  3ZH9 B;  5C18 A;  1G3I A;  2M5Z A;  1Q3C A;  1TH4 A;  5ITR A;  4JI8 M;  4LZJ A;  2ZAM A;  3IG5 A;  2Z4S A;  5FSW A;  1IN5 A;  3D8B A;  1KFV A;  2F5S A;  1VDD A;  2F5O A;  3THG A;  3TQS A;  4P16 A;  2DWN A;  1JR3 D;  2EUC A;  3GRV A;  3J2P B;  1HQC A;  3FD9 A;  2M60 A;  3U6C A;  1HNX M;  3GLH A;  1XXH B;  3J7B A;  3UMM A;  3HHX A;  1GL6 A;  4WW0 A;  4NXN M;  1IBL M;  3MHV C;  3GQ3 A;  5E6J A;  1G59 A;  3GO8 A;  2K47 A;  1HQY E;  2CEA A;  2VII A;  2V6Z M;  4LFA M;  4DV7 M;  3LQQ A;  1L2D A;  4DV2 M;  1JQJ C;  3CTW B;  4ZPX A;  4X64 M;  3HJS A;  3FYC A;  1ZQ9 A;  4FCV A;  4M9S A;  4PT5 A;  5EXT A;  2DXI A;  2P5T A;  3WHK A;  1W5T A;  5BPV A;  3HGI A;  2UUA M;  3L2A A;  2KRK A;  2Y0T A;  4NRV A;  1QZM A;  1SXJ D;  3SHF A;  1J09 A;  3ILK A;  3SMS A;  1XHB A;  4MGY E;  3T1Y M;  2XZU A;  1IBK M;  1NY6 A;  1Z5A A;  4MGI E;  4Z8X A;  1I4W A;  2NQ8 C;  4FVM A;  3RGP A;  1IY0 A;  1NHW C;  5BR8 M;  1MU5 A;  2RGH A;  4LGM A;  2RKO A;  4MH0 E;  4LFC M;  4LF5 M;  2EO2 A;  4PDG A;  2A5Y B;  3UJN A;  1E32 A;  1NSF A;  3GLF B;  1N34 M;  2FOI C;  4QOS A;  1L1T A;  4LF6 M;  3VLF B;  3AOE C;  4DV5 M;  4AI6 A;  4KHP M;  2KZU A;  2XGN A;  2R4J A;  1R6B X;  4CIS A;  3M6A A;  1OJL A;  4JI0 M;  2DHR A;  3VK7 A;  3SFZ A;  4GC5 A;  3U6S A;  3PNY A;  2D7H A;  2UXB M;  3KOZ E;  2R4E A;  4NSO B;  3UGJ A;  3AOE A;  1PJJ A;  4GMQ A;  5FTN A;  4I4L A;  5F3W A;  2KEB A;  3Q8X A;  1Q39 A;  2X8A A;  3RE8 A;  3M7G A;  4IIW A;  4R3D A;  2ZM6 M;  1PJI A;  1D2N A;  1E9R A;  4RNA A;  3C58 A;  1W5S A;  1UM8 A;  5ITX E;  2KXE A;  4LF8 M;  1XNR M;  4GHA A;  4QHS A;  4HLQ A;  2UU9 M;  3TWL A;  5A2Q S;  2E5L M;  4G4R A;  4LJ4 A;  1Q3B A;  3D8L A;  3A45 A;  3FUT A;  1N78 A;  1OFI A;  3HU2 A;  4JI6 M;  2LWX A;  4WUR A;  4L8R C;  3LVV A;  3U60 A;  8CAT A;  2XFS A;  4B3R M;  3DA1 A;  3ZC7 B;  3E9S A;  1IXZ A;  1J7K A;  1HT1 E;  3BOS A;  3A46 A;  4JN6 A;  4DV4 M;  4RF1 A;  1IN7 A;  2C96 A;  2XFT A;  4OVZ B;  3A42 A;  1Z5B A;  1X37 A;  2H1R A;  2LNH C;  4OW0 A;  2DVW B;  5ITY A;  2CHQ A;  1K3W A;  2HCB A;  2Z4R A;  3TE6 A;  3J27 B;  3HHY A;  1NNJ A;  4TUW A;  3E4R A;  4IJE A;  2KW0 A;  4GHL A;  2HKJ A;  4JXJ A;  1I94 M;  4LRS A;  1QYR A;  5DYI A;  2DZO B;  3VDU A;  4LF7 M;  2C9C A;  1TH3 A;  4LJ8 A;  4DV0 M;  2XSZ D;  4LJ9 A;  5EJC A;  4X66 M;  1IY2 A;  1KYI A;  3HJ8 A;  4R7G A;  3U5Z A;  2C5R A;  3HWS A;  3SAU A;  3KOW E;  2C99 A;  3TL4 X;  2UXD M;  1JR3 A;  1DGG A;  1DO2 A;  4NOO B;  3FUW A;  2CV1 A;  4MM3 B;  4MGZ E;  1LV7 A;  3GQ5 A;  3JR4 A;  4FD2 A;  4RF0 A;  4FWG A;  4GC9 A;  1ZAE A;  2Y20 A;  2W82 A;  4AZF A;  5EXS A;  2Z7J A;  3U61 A;  1XMO M;  1FNN A;  4FCT A;  1NJF A;  1E94 E;  4PD2 A;  5KO3 A;  2L09 A;  1QAM A;  2OQ4 A;  2ZAN A;  4DR4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...