3E21A

Crystal structure of faf-1 uba domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
MDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAS-associated factor 1
publication title Crystal structure of FAF-1 UBA Domain
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 12
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3e21A00
2O25A 2L4FA 3F92A 2CP8A 2MR9A 2G3QA 2JZ1A 1TTEA 1QZEA 4F2LA 2MGWA 2DENA 1WGNA 2K0BX 3MMPA 2H5XA 3FRIA 2HWJA 1XB2B 1WR1B 2K9DA 2DKLA 1Q02A 2DAIA 1HT2E 3E21A 1T6OA 2JY5A 2EJSA 1KYIA 1TR8A 1VEGA 1Y8GA 1YLAA 3GLIE 3GLFE 2ZTDA 3E46A 1G41A 3BBZA 1ZMWA 1MN3A 1VEJA 1WHCA 2DAGA 5DFLA 2JY6B 2DNAA 2WZJA 3FE3A 1WIVA 3IHPA 2QSFX 1HT1E 2R0IA 1DV0A 1R4GA 3LCUA 1JR3E 1DO2A 1NV9A 1UFZA 1VG5A 2OOBA 3GLGE 1DO0A 4F1IA 1VEKA 2JZ0A 1A5TA 1G4AE 2JY8A 2LVQD 4G3OA 2EKKA 2LVAA 2DZLA 1XXHE 2DI0A 4Q7JA 2EKFA 2KNZA 2LVNC 1EFUB 2DAEA 2JUJA 3B89A 1BVSA 1T43A 1SG9A 1OAIA 2DAMA 2LVOC 2HAKA 2QNJA 2LTUA 3K9OA 1HQYE 1PGYA 1NV8A 1ZMVA 2QHOB 1WJ7A 1F4IA 1IM2A 3IECA 1G3IA 1V92A 2KNAA 1CUKA 2KNVA 2DAKA 2BWBA 2KHHA 4DBGB 3LCVB 1E94E 1AIPC 2DHYA 2OO9A 3T6PA 1IXSA 1ZMUA 3GLHE 3H4JA 4UN2B 5JI2E 2JNHA 2BWEA 4HEOA 2MROB 1HJPA 2B3TA 4R71A 2CWBA 1VQ1A 3FRHA 4GEWA 2ZTCA 2MJ5B 1OKSA 2JP7A 2JY7A 3K9PA 2L2DA 1C7YA 1WGLA 2L4EA 1OTRA 2OOAA 2RRUA 4WP2A 2LVPC 2LBCA 1ZV1A 1VDLA 1GO5A 1IFYA 1OQYA 1P3QQ
chains in the Genus database with same CATH superfamily
3KSXA 1GJSA 1XNQM 3KW6A 3F92A 1YE9A 3ZCBB 1GABA 1TTEA 3Q8XA 3UMMA 1YSYA 2VQFM 4MB7A 1QANA 4FCWA 2H5XA 2O01F 2ZAOA 4L4UA 5IREB 1AUAA 3U5ZA 3U60B 3SARA 4XK8F 2OPFA 5ITRA 4IJEA 2X4AA 3T15A 2RGHA 1K82A 2R18A 4DV2M 1Q02A 3CTWB 4OW0A 4MGIE 3GLIB 4G6ZA 3GLGA 2XF3A 3HHZA 4JI8M 2JY5A 3LMMA 3SATA 5F3WA 2UUBM 1TR8A 2R6FA 3GLFE 4IBKA 1G41A 3PXGA 3T1HM 1ZMWA 2AHMA 1PJQA 1N77A 2DAGA 4NSRA 4LFAM 3FYCA 3JR4A 4X62M 4LF4M 3FE3A 2C9CA 4IBCA 4R7GA 5FTMA 2BNKA 2R46A 3RFWA 3UK6A 1EE8A 3VK8A 1H6UA 1JQJC 2CEAA 3KOZE 1R4GA 4FD2A 4AW4A 1L1ZA 1HNXM 1NV9A 5L8RF 4RF0A 2F5PA 4MH0E 2OOBA 2UU9M 2W82A 1D2NA 3SMPA 3TWKA 3E4RA 2QZ4A 4LJ5A 4CISA 1A5TA 1G4AE 2LVQD 3GQ5A 1TGUA 1NVMA 2UUAM 3AV0A 4MGHA 1NJFA 1IN5A 2LHCA 4HLQA 3WHKA 1L2CA 1QAMA 3LW5F 2CV2A 1PJSA 1C1KA 2R4EA 2EKKA 2DZLA 1XXHE 5ITTA 2DI0A 3U5ZB 1N78A 3SYKA 3FKEA 4AKHA 5KQDA 4G4NA 2EA0A 3B7ZA 4DR6M 4QOZC 3I4YA 4M0DA 2VIIA 3I4VA 4LJ7A 1T43A 3L2AA 3TWMA 3I01M 1TH3A 3GRYA 5KPTA 3KS4A 4II7A 2HAKA 1L8QA 3HJSA 2LWXA 3MJ5A 3LQQA 2MH8A 1HQYE 4DV7M 3R9XB 3VKGA 3VDPA 1Z59A 1IM2A 2HKJA 3MHVC 3IECA 3KOWE 3CF2A 3U6CA 4FCTA 2KNAA 1UM8A 1G59A 1CUKA 4FW9A 1SXJA 1IBKM 1T3TA 1OAOC 4AKGA 3W68A 7CATA 1SXJC 1E32A 4K0KM 3VKHA 3SASA 2NQ8C 3HX3A 3KOXE 1OFIA 2Z4RA 2O5RA 4DBGB 3OTOM 1X37A 2P5TA 3PNYA 2OO9A 4FVMA 5E6JA 1ZMUA 3W67A 1KSFX 1R6BX 1V34A 1E9SA 2Q2EB 4IBEA 2JXNA 3SYLA 2Z4SA 2JA2A 1DGBA 2Z3XA 1PRBA 3K8ZA 3TPZA 1JB0F 2Y0TA 4I4LA 4LJ8A 3PFIA 4DV0M 3PVSA 2C5RA 1XNRM 4IIWA 3VK7A 4JYAM 1J7KA 3HHWA 4GEWA 1GL7A 3FRHA 4MGZE 3U60A 1N36M 2V1UA 1OKSA 2JP7A 3K9PA 3A45A 2L2DA 3DOAA 3AFHA 3U6SA 1MX0A 2L4EA 2OOAA 2XSZD 2KRUA 4B08A 2CHGA 2KXEA 3DA1A 1IFYA 1IXSB 1OQYA 3GLIA 3SHGB 2J7OA 4LFCM 3NBXX 5EQTA 3Q8GA 2L7IA 2CHVA 5GKNA 4CIZA 4I5SA 1QDTA 2RKOA 3HU1A 4X66M 2KA6B 3AOEC 2QPAA 1TDHA 3L29A 3HZJA 4JI1M 1KFVA 2XGNA 4B3TM 1SXJB 3ZQJA 2DAIA 4DR3M 4CJ6A 2ZANA 1DGFA 1HQCA 4GC9A 1IN6A 3KFUG 4FWDA 1XHBA 3RGSA 1NY5A 3J81S 3D8BA 2R4JA 1Y8GA 2LXEA 3HU3A 2XLJA 1PJIA 1IXRC 1I4WA 1MJGM 4G4QA 2UUCM 4LF8M 1NSFA 2G8LA 3HHYA 2DZOB 3GP1A 2JWSA 2K47A 2XFTA 3SFZA 3VLFB 1YUBA 2XZFA 3HWSA 5EP2A 2CE7A 2JY6B 2WZJA 4GRIA 4Y28F 2F5NA 1QZMA 2L7HA 2X49A 1I94M 3TQSA 4W5WA 1DV0A 5ITXE 2D7HA 1PJJA 4LF5M 1N75A 4GMQA 2DXIA 4OU7A 5EXXA 1JR3E 1DO2A 2C9OA 1IQPA 2KRKA 2H1RA 3GLGE 3BXWA 1IN4A 1IY1A 1W5SA 3UGJA 1TH4A 1IBLM 1MU5A 5EXTA 3M7GA 4LFBM 2EO2A 4YHHM 3I51A 4G3OA 5EP3A 2CFOA 2LVAA 4GKKM 4KLNA 3HY5A 1G71A 3H4MA 1GLNA 4PT5A 2LVNC 3GPPA 3QAUA 2V1CA 1S3SA 4M9ZA 2QBYA 4ITQA 1PM5A 4NRWA 3SMSA 3AOGA 3L26A 2WSCF 2JUJA 4L6V6 2F4VM 3B89A 4M0WA 2D7GA 2I7NA 4BBAA 2DAMA 5EXPA 2OQ4A 2C96A 2VF7A 3U6PA 5C1BA 4REZA 5H37D 4R3DA 1VDDA 2LHGA 2LTUA 2KDLA 3K9OA 3KDSE 1PGYA 1ZMVA 5DYIA 5IT9S 1XWIA 1WJ7A 2L6OA 3GQ4A 1NNJA 1F4IA 1G3IA 2DWNA 2UXDM 3KOYE 4JI0M 5BPVA 3NWLA 4GC5A 3FD9A 1NJGA 2FFJA 3KXEC 4ANRA 3T1YM 2KNVA 2J7NA 3SHFA 3WHLA 2BWBA 1TDZA 4NXNM 1SXJD 4LY6A 3UZUA 3GRVA 1E94E 3ZH9B 1AIPC 2DHYA 4XBOA 1IXSA 1D0KA 4LJ4A 5JI2E 3KP0E 1HR0M 3LVWA 4BLCA 1FNNA 4JV5M 1OFHA 2BWEA 4MGKE 2FOIC 1Q39A 4QHTA 3DFZA 1XMOM 3L27A 4HEOA 2MROB 1HJPA 3TE6A 2B3TA 3LVVA 2ZAMA 4L15A 2CWBA 4M9XA 4R71A 1SXJE 3U6QA 4FWGA 2MJ5B 1E9RA 4PDGA 3HJ8A 2RRUA 2Y20A 1GO5A 2QBYB 1ZV1A 1VDLA 2FE8A 3RGPA 4JI5M 4AQYM 4OVZA 5IWAM 5FLXS 4DR1M 5KPRA 3VFDA 4AKIA 2G3QA 2JZ1A 4IBGA 4DV1M 1QZEA 3EIEA 2MGWA 3JR5A 1WGNA 3EIHA 1IN8A 2CV1A 3J27B 3U6DA 2K0BX 5EJCA 1IY2A 3MMPA 3T38A 1QQWA 4NSOB 3B74A 2HWJA 4LJ9A 3FUXA 3CGWA 4B7HA 2KEBA 3GQ3A 4KT0F 1WR1B 4GIPA 1R2ZA 4JI7M 4P16A 3V76A 8CATA 2APLA 2DKLA 2EUCA 1HNWM 1HT2E 4D80A 3GLFB 1T6OA 1Z5AA 5KQ8A 3LQRA 2EJSA 2Y0QA 1Z5BA 2CV0A 3GLIE 1VEGA 4RKUF 4QOSA 3TWLA 4JI4M 1TF0B 3E46A 4DV5M 3QYBA 4LRTA 3BBZA 1LV7A 2CUZA 1N32M 1DGHB 2HCBA 3KP1E 2YR0A 4DR5M 2DWLA 4XGIA 4IBFA 3FTDA 4NOOB 5A2QS 4QNRA 2WSFF 3SAVA 4ZPXA 4JXJA 4DUYM 2Z8YM 1K3XA 5C18A 1OIZA 1GVNA 1HNZM 1IBMM 4AG5A 3LCUA 1XC8A 1N34M 3SC3A 1VG5A 1OJLA 2ZM6M 5EXSA 1L2DA 1J09A 1DO0A 3GPXA 1QDRA 2C99A 5E26A 1VEKA 2JZ0A 4OVZB 3A46A 2JY8A 1G8PA 4D82A 2YFQA 4JI6M 3U6OA 4OX9M 3KSJA 3SBJA 2KZSA 3CF6E 1ZQ9A 4DR2M 4S12A 2LNHC 2KZUA 4IBJA 2QP9X 1GKIA 5FTLA 2ERCA 4AZFA 2K6BA 1EFUB 2DAEA 3VDUA 5FTJA 3HKPA 1QVRA 3FTEA 5FTNA 4TUWA 3FTFA 3SAUA 2HHHM 1SG9A 3GLHA 4L78A 4DR7M 5FTKA 3HU2A 3R8FA 2XH9A 2QNJA 1NV8A 3GPYA 4LCBA 2QHOB 4DR4M 3FYDA 5EP4A 2KW0A 3JAMS 4FCVA 1NNUC 3C58A 4LZZA 3B7NA 3K92A 2DZNB 3B7QA 3THGA 2VF8A 2CHQA 3K1JA 2F5SA 4AI6A 4EIWA 2QCUA 3C3EA 2KHHA 4M9SA 1NO1A 2R45A 2XZUA 4LF9M 3FUUA 2FH0A 2LH0A 2FS1A 5ITYA 2UXCM 3H4JA 4UN2B 3RE8A 3UJNA 2VQEM 2JNHA 4Z6YA 4FWHA 3D8LA 5ITXA 3QWLA 3KVWA 2Y21A 4B3RM 1EIJA 4JI3M 3J80S 4IBDA 2DWZB 1JR3A 4LF6M 1Q3BA 3TL4X 3AKZA 5ITQA 3NBIA 4PD2A 3KS8A 1VQ1A 1QAOA 3J7AS 4B7FA 1C7YA 5LMNM 4KO8A 1OTRA 3FUTA 1IXZA 1XMQM 1R2YA 1QYRA 2MR9A 4DV3M 1V33A 1P3QQ 3M6AA 1DGGA 2O25A 4LGMA 2L4FA 3GLFA 2A5YB 2CP8A 3U61B 3W0LB 4F2LA 3GLHB 2DENA 3SAWA 2F5QA 2YQZA 1L1TA 4LJ6A 4P17A 3FRIA 4PDIA 1K3WA 1GL6A 1DGHA 2GNOA 2RGOA 3FTCA 4IBBA 1XB2B 1R5LA 4LG2A 2K9DA 3C3DA 1W5TA 2DHRA 4MM3B 1PJTA 4JN6A 4LGYA 3E21A 4GITA 4DUZM 3IG8A 1D0LA 2J5YA 1Z6TA 2C98A 4QHSA 1KYIA 1YLAA 1FJGM 4X65M 4LJAA 5ITUA 2ZTDA 3E9SA 2M60A 4NC6A 2BJWA 4DV6M 2E5LM 4B3SM 4NXMM 1D0MA 1MN3A 4KODA 2M5ZA 2HL7A 1VEJA 1WHCA 2CRUA 3FUVA 5DFLA 3W0FA 3M0EA 2DNAA 5IZ7D 1J5EM 1XXHA 1WIVA 3IHPA 2QSFX 1HT1E 2R0IA 4QNMA 4HL4A 1ZAEA 5FSWA 1Z5CA 3GLGB 4RF1A 1WXQA 1GJTA 1QAQA 4A3VB 1UFZA 3AJIB 3BOSA 3MK6A 3DZDA 5KO3A 4PCZA 2XEPA 4F1IA 4GH9A 4IJFA 1N33M 4D81A 3GRRA 3GO8A 1ORYB 4IBIA 3K2LA 4LZJA 5DNYA 1LTMA 4RNAA 1NHGC 4X64M 4CHTB 1QUTA 3J2PB 1IN7A 1IY0A 4MGYE 5BR8M 1OIPA 4Q7JA 2EKFA 4B7GA 4YY3M 4GKJM 2QENA 2KNZA 1TH2A 3L28A 4I8OA 1RU3A 3HJQA 2DWMA 4JI2M 4I81A 4G4OA 1Q3CA 4GHAA 3CF0A 1BVSA 2WSEF 2R62A 2XFSA 3GRUA 4AG6A 1OAIA 2X8AA 4L16A 3IG5A 3U6MA 2LVOC 4NRVA 5KPZA 1R7RA 3L25A 3ZC7B 3B9PA 2DVWB 1NY6A 4KHPM 2V6ZM 1QUSA 5DYGA 2F5OA 1V92A 3U6LA 3GPUA 3A98B 4WURA 1NHWC 4NL4H 1XXHB 3U6EA 4B3MM 2DAKA 5EP1A 2BJVA 3A42A 2UXBM 3C9PA 3FUWA 3LCVB 3J7BA 3HGIA 4WW0A 2FNAA 3AOEA 2I7PA 3I04M 4G4RA 3T6PA 4GHLA 3GLHE 5JI3E 3HHXA 2GQFA 4Z8XA 3AL0C 2D7EA 2VDBB 2R44A 3U61A 2ZBKB 2N35A 2Z7JA 4CGYB 5LMUM 4LRSA 3QYEA 2L09A 2R65A 2YNMD 1JR3D 2XSZA 4DV4M 2ZTCA 2JY7A 2G5GX 1WGLA 3ILKA 4WP2A 4BB9A 1L2BA 2LVPC 2LBCA 2QQ8A 4LF7M 4L8RC 3PNVA
chains in the Genus database with same CATH topology
2O25A 2L4FA 3F92A 2CP8A 2MR9A 2G3QA 2JZ1A 1TTEA 1QZEA 4F2LA 2MGWA 2DENA 1WGNA 2K0BX 3MMPA 2H5XA 3FRIA 2HWJA 1XB2B 1WR1B 2K9DA 2DKLA 1Q02A 2DAIA 1HT2E 3E21A 1T6OA 2JY5A 2EJSA 1KYIA 1TR8A 1VEGA 1Y8GA 1YLAA 3GLIE 3GLFE 2ZTDA 3E46A 1G41A 3BBZA 1ZMWA 1MN3A 1VEJA 1WHCA 2DAGA 5DFLA 2JY6B 2DNAA 2WZJA 3FE3A 1WIVA 3IHPA 2QSFX 1HT1E 2R0IA 1DV0A 1R4GA 3LCUA 1JR3E 1DO2A 1NV9A 1UFZA 1VG5A 2OOBA 3GLGE 1DO0A 4F1IA 1VEKA 2JZ0A 1A5TA 1G4AE 2JY8A 2LVQD 4G3OA 2EKKA 2LVAA 2DZLA 1XXHE 2DI0A 4Q7JA 2EKFA 2KNZA 2LVNC 1EFUB 2DAEA 2JUJA 3B89A 1BVSA 1T43A 1SG9A 1OAIA 2DAMA 2LVOC 2HAKA 2QNJA 2LTUA 3K9OA 1HQYE 1PGYA 1NV8A 1ZMVA 2QHOB 1WJ7A 1F4IA 1IM2A 3IECA 1G3IA 1V92A 2KNAA 1CUKA 2KNVA 2DAKA 2BWBA 2KHHA 4DBGB 3LCVB 1E94E 1AIPC 2DHYA 2OO9A 3T6PA 1IXSA 1ZMUA 3GLHE 3H4JA 4UN2B 5JI2E 2JNHA 2BWEA 4HEOA 2MROB 1HJPA 2B3TA 4R71A 2CWBA 1VQ1A 3FRHA 4GEWA 2ZTCA 2MJ5B 1OKSA 2JP7A 2JY7A 3K9PA 2L2DA 1C7YA 1WGLA 2L4EA 1OTRA 2OOAA 2RRUA 4WP2A 2LVPC 2LBCA 1ZV1A 1VDLA 1GO5A 1IFYA 1OQYA 1P3QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O25 A;  2L4F A;  3F92 A;  2CP8 A;  2MR9 A;  2G3Q A;  2JZ1 A;  1TTE A;  1QZE A;  4F2L A;  2MGW A;  2DEN A;  1WGN A;  2K0B X;  3MMP A;  2H5X A;  3FRI A;  2HWJ A;  1XB2 B;  1WR1 B;  2K9D A;  2DKL A;  1Q02 A;  2DAI A;  1HT2 E;  3E21 A;  1T6O A;  2JY5 A;  2EJS A;  1KYI A;  1TR8 A;  1VEG A;  1Y8G A;  1YLA A;  3GLI E;  3GLF E;  2ZTD A;  3E46 A;  1G41 A;  3BBZ A;  1ZMW A;  1MN3 A;  1VEJ A;  1WHC A;  2DAG A;  5DFL A;  2JY6 B;  2DNA A;  2WZJ A;  3FE3 A;  1WIV A;  3IHP A;  2QSF X;  1HT1 E;  2R0I A;  1DV0 A;  1R4G A;  3LCU A;  1JR3 E;  1DO2 A;  1NV9 A;  1UFZ A;  1VG5 A;  2OOB A;  3GLG E;  1DO0 A;  4F1I A;  1VEK A;  2JZ0 A;  1A5T A;  1G4A E;  2JY8 A;  2LVQ D;  4G3O A;  2EKK A;  2LVA A;  2DZL A;  1XXH E;  2DI0 A;  4Q7J A;  2EKF A;  2KNZ A;  2LVN C;  1EFU B;  2DAE A;  2JUJ A;  3B89 A;  1BVS A;  1T43 A;  1SG9 A;  1OAI A;  2DAM A;  2LVO C;  2HAK A;  2QNJ A;  2LTU A;  3K9O A;  1HQY E;  1PGY A;  1NV8 A;  1ZMV A;  2QHO B;  1WJ7 A;  1F4I A;  1IM2 A;  3IEC A;  1G3I A;  1V92 A;  2KNA A;  1CUK A;  2KNV A;  2DAK A;  2BWB A;  2KHH A;  4DBG B;  3LCV B;  1E94 E;  1AIP C;  2DHY A;  2OO9 A;  3T6P A;  1IXS A;  1ZMU A;  3GLH E;  3H4J A;  4UN2 B;  5JI2 E;  2JNH A;  2BWE A;  4HEO A;  2MRO B;  1HJP A;  2B3T A;  4R71 A;  2CWB A;  1VQ1 A;  3FRH A;  4GEW A;  2ZTC A;  2MJ5 B;  1OKS A;  2JP7 A;  2JY7 A;  3K9P A;  2L2D A;  1C7Y A;  1WGL A;  2L4E A;  1OTR A;  2OOA A;  2RRU A;  4WP2 A;  2LVP C;  2LBC A;  1ZV1 A;  1VDL A;  1GO5 A;  1IFY A;  1OQY A;  1P3Q Q; 
#chains in the Genus database with same CATH topology
 3KSX A;  1GJS A;  1XNQ M;  3KW6 A;  3F92 A;  1YE9 A;  3ZCB B;  1GAB A;  1TTE A;  3Q8X A;  3UMM A;  1YSY A;  2VQF M;  4MB7 A;  1QAN A;  4FCW A;  2H5X A;  2O01 F;  2ZAO A;  4L4U A;  5IRE B;  1AUA A;  3U5Z A;  3U60 B;  3SAR A;  4XK8 F;  2OPF A;  5ITR A;  4IJE A;  2X4A A;  3T15 A;  2RGH A;  1K82 A;  2R18 A;  4DV2 M;  1Q02 A;  3CTW B;  4OW0 A;  4MGI E;  3GLI B;  4G6Z A;  3GLG A;  2XF3 A;  3HHZ A;  4JI8 M;  2JY5 A;  3LMM A;  3SAT A;  5F3W A;  2UUB M;  1TR8 A;  2R6F A;  3GLF E;  4IBK A;  1G41 A;  3PXG A;  3T1H M;  1ZMW A;  2AHM A;  1PJQ A;  1N77 A;  2DAG A;  4NSR A;  4LFA M;  3FYC A;  3JR4 A;  4X62 M;  4LF4 M;  3FE3 A;  2C9C A;  4IBC A;  4R7G A;  5FTM A;  2BNK A;  2R46 A;  3RFW A;  3UK6 A;  1EE8 A;  3VK8 A;  1H6U A;  1JQJ C;  2CEA A;  3KOZ E;  1R4G A;  4FD2 A;  4AW4 A;  1L1Z A;  1HNX M;  1NV9 A;  5L8R F;  4RF0 A;  2F5P A;  4MH0 E;  2OOB A;  2UU9 M;  2W82 A;  1D2N A;  3SMP A;  3TWK A;  3E4R A;  2QZ4 A;  4LJ5 A;  4CIS A;  1A5T A;  1G4A E;  2LVQ D;  3GQ5 A;  1TGU A;  1NVM A;  2UUA M;  3AV0 A;  4MGH A;  1NJF A;  1IN5 A;  2LHC A;  4HLQ A;  3WHK A;  1L2C A;  1QAM A;  3LW5 F;  2CV2 A;  1PJS A;  1C1K A;  2R4E A;  2EKK A;  2DZL A;  1XXH E;  5ITT A;  2DI0 A;  3U5Z B;  1N78 A;  3SYK A;  3FKE A;  4AKH A;  5KQD A;  4G4N A;  2EA0 A;  3B7Z A;  4DR6 M;  4QOZ C;  3I4Y A;  4M0D A;  2VII A;  3I4V A;  4LJ7 A;  1T43 A;  3L2A A;  3TWM A;  3I01 M;  1TH3 A;  3GRY A;  5KPT A;  3KS4 A;  4II7 A;  2HAK A;  1L8Q A;  3HJS A;  2LWX A;  3MJ5 A;  3LQQ A;  2MH8 A;  1HQY E;  4DV7 M;  3R9X B;  3VKG A;  3VDP A;  1Z59 A;  1IM2 A;  2HKJ A;  3MHV C;  3IEC A;  3KOW E;  3CF2 A;  3U6C A;  4FCT A;  2KNA A;  1UM8 A;  1G59 A;  1CUK A;  4FW9 A;  1SXJ A;  1IBK M;  1T3T A;  1OAO C;  4AKG A;  3W68 A;  7CAT A;  1SXJ C;  1E32 A;  4K0K M;  3VKH A;  3SAS A;  2NQ8 C;  3HX3 A;  3KOX E;  1OFI A;  2Z4R A;  2O5R A;  4DBG B;  3OTO M;  1X37 A;  2P5T A;  3PNY A;  2OO9 A;  4FVM A;  5E6J A;  1ZMU A;  3W67 A;  1KSF X;  1R6B X;  1V34 A;  1E9S A;  2Q2E B;  4IBE A;  2JXN A;  3SYL A;  2Z4S A;  2JA2 A;  1DGB A;  2Z3X A;  1PRB A;  3K8Z A;  3TPZ A;  1JB0 F;  2Y0T A;  4I4L A;  4LJ8 A;  3PFI A;  4DV0 M;  3PVS A;  2C5R A;  1XNR M;  4IIW A;  3VK7 A;  4JYA M;  1J7K A;  3HHW A;  4GEW A;  1GL7 A;  3FRH A;  4MGZ E;  3U60 A;  1N36 M;  2V1U A;  1OKS A;  2JP7 A;  3K9P A;  3A45 A;  2L2D A;  3DOA A;  3AFH A;  3U6S A;  1MX0 A;  2L4E A;  2OOA A;  2XSZ D;  2KRU A;  4B08 A;  2CHG A;  2KXE A;  3DA1 A;  1IFY A;  1IXS B;  1OQY A;  3GLI A;  3SHG B;  2J7O A;  4LFC M;  3NBX X;  5EQT A;  3Q8G A;  2L7I A;  2CHV A;  5GKN A;  4CIZ A;  4I5S A;  1QDT A;  2RKO A;  3HU1 A;  4X66 M;  2KA6 B;  3AOE C;  2QPA A;  1TDH A;  3L29 A;  3HZJ A;  4JI1 M;  1KFV A;  2XGN A;  4B3T M;  1SXJ B;  3ZQJ A;  2DAI A;  4DR3 M;  4CJ6 A;  2ZAN A;  1DGF A;  1HQC A;  4GC9 A;  1IN6 A;  3KFU G;  4FWD A;  1XHB A;  3RGS A;  1NY5 A;  3J81 S;  3D8B A;  2R4J A;  1Y8G A;  2LXE A;  3HU3 A;  2XLJ A;  1PJI A;  1IXR C;  1I4W A;  1MJG M;  4G4Q A;  2UUC M;  4LF8 M;  1NSF A;  2G8L A;  3HHY A;  2DZO B;  3GP1 A;  2JWS A;  2K47 A;  2XFT A;  3SFZ A;  3VLF B;  1YUB A;  2XZF A;  3HWS A;  5EP2 A;  2CE7 A;  2JY6 B;  2WZJ A;  4GRI A;  4Y28 F;  2F5N A;  1QZM A;  2L7H A;  2X49 A;  1I94 M;  3TQS A;  4W5W A;  1DV0 A;  5ITX E;  2D7H A;  1PJJ A;  4LF5 M;  1N75 A;  4GMQ A;  2DXI A;  4OU7 A;  5EXX A;  1JR3 E;  1DO2 A;  2C9O A;  1IQP A;  2KRK A;  2H1R A;  3GLG E;  3BXW A;  1IN4 A;  1IY1 A;  1W5S A;  3UGJ A;  1TH4 A;  1IBL M;  1MU5 A;  5EXT A;  3M7G A;  4LFB M;  2EO2 A;  4YHH M;  3I51 A;  4G3O A;  5EP3 A;  2CFO A;  2LVA A;  4GKK M;  4KLN A;  3HY5 A;  1G71 A;  3H4M A;  1GLN A;  4PT5 A;  2LVN C;  3GPP A;  3QAU A;  2V1C A;  1S3S A;  4M9Z A;  2QBY A;  4ITQ A;  1PM5 A;  4NRW A;  3SMS A;  3AOG A;  3L26 A;  2WSC F;  2JUJ A;  4L6V 6;  2F4V M;  3B89 A;  4M0W A;  2D7G A;  2I7N A;  4BBA A;  2DAM A;  5EXP A;  2OQ4 A;  2C96 A;  2VF7 A;  3U6P A;  5C1B A;  4REZ A;  5H37 D;  4R3D A;  1VDD A;  2LHG A;  2LTU A;  2KDL A;  3K9O A;  3KDS E;  1PGY A;  1ZMV A;  5DYI A;  5IT9 S;  1XWI A;  1WJ7 A;  2L6O A;  3GQ4 A;  1NNJ A;  1F4I A;  1G3I A;  2DWN A;  2UXD M;  3KOY E;  4JI0 M;  5BPV A;  3NWL A;  4GC5 A;  3FD9 A;  1NJG A;  2FFJ A;  3KXE C;  4ANR A;  3T1Y M;  2KNV A;  2J7N A;  3SHF A;  3WHL A;  2BWB A;  1TDZ A;  4NXN M;  1SXJ D;  4LY6 A;  3UZU A;  3GRV A;  1E94 E;  3ZH9 B;  1AIP C;  2DHY A;  4XBO A;  1IXS A;  1D0K A;  4LJ4 A;  5JI2 E;  3KP0 E;  1HR0 M;  3LVW A;  4BLC A;  1FNN A;  4JV5 M;  1OFH A;  2BWE A;  4MGK E;  2FOI C;  1Q39 A;  4QHT A;  3DFZ A;  1XMO M;  3L27 A;  4HEO A;  2MRO B;  1HJP A;  3TE6 A;  2B3T A;  3LVV A;  2ZAM A;  4L15 A;  2CWB A;  4M9X A;  4R71 A;  1SXJ E;  3U6Q A;  4FWG A;  2MJ5 B;  1E9R A;  4PDG A;  3HJ8 A;  2RRU A;  2Y20 A;  1GO5 A;  2QBY B;  1ZV1 A;  1VDL A;  2FE8 A;  3RGP A;  4JI5 M;  4AQY M;  4OVZ A;  5IWA M;  5FLX S;  4DR1 M;  5KPR A;  3VFD A;  4AKI A;  2G3Q A;  2JZ1 A;  4IBG A;  4DV1 M;  1QZE A;  3EIE A;  2MGW A;  3JR5 A;  1WGN A;  3EIH A;  1IN8 A;  2CV1 A;  3J27 B;  3U6D A;  2K0B X;  5EJC A;  1IY2 A;  3MMP A;  3T38 A;  1QQW A;  4NSO B;  3B74 A;  2HWJ A;  4LJ9 A;  3FUX A;  3CGW A;  4B7H A;  2KEB A;  3GQ3 A;  4KT0 F;  1WR1 B;  4GIP A;  1R2Z A;  4JI7 M;  4P16 A;  3V76 A;  8CAT A;  2APL A;  2DKL A;  2EUC A;  1HNW M;  1HT2 E;  4D80 A;  3GLF B;  1T6O A;  1Z5A A;  5KQ8 A;  3LQR A;  2EJS A;  2Y0Q A;  1Z5B A;  2CV0 A;  3GLI E;  1VEG A;  4RKU F;  4QOS A;  3TWL A;  4JI4 M;  1TF0 B;  3E46 A;  4DV5 M;  3QYB A;  4LRT A;  3BBZ A;  1LV7 A;  2CUZ A;  1N32 M;  1DGH B;  2HCB A;  3KP1 E;  2YR0 A;  4DR5 M;  2DWL A;  4XGI A;  4IBF A;  3FTD A;  4NOO B;  5A2Q S;  4QNR A;  2WSF F;  3SAV A;  4ZPX A;  4JXJ A;  4DUY M;  2Z8Y M;  1K3X A;  5C18 A;  1OIZ A;  1GVN A;  1HNZ M;  1IBM M;  4AG5 A;  3LCU A;  1XC8 A;  1N34 M;  3SC3 A;  1VG5 A;  1OJL A;  2ZM6 M;  5EXS A;  1L2D A;  1J09 A;  1DO0 A;  3GPX A;  1QDR A;  2C99 A;  5E26 A;  1VEK A;  2JZ0 A;  4OVZ B;  3A46 A;  2JY8 A;  1G8P A;  4D82 A;  2YFQ A;  4JI6 M;  3U6O A;  4OX9 M;  3KSJ A;  3SBJ A;  2KZS A;  3CF6 E;  1ZQ9 A;  4DR2 M;  4S12 A;  2LNH C;  2KZU A;  4IBJ A;  2QP9 X;  1GKI A;  5FTL A;  2ERC A;  4AZF A;  2K6B A;  1EFU B;  2DAE A;  3VDU A;  5FTJ A;  3HKP A;  1QVR A;  3FTE A;  5FTN A;  4TUW A;  3FTF A;  3SAU A;  2HHH M;  1SG9 A;  3GLH A;  4L78 A;  4DR7 M;  5FTK A;  3HU2 A;  3R8F A;  2XH9 A;  2QNJ A;  1NV8 A;  3GPY A;  4LCB A;  2QHO B;  4DR4 M;  3FYD A;  5EP4 A;  2KW0 A;  3JAM S;  4FCV A;  1NNU C;  3C58 A;  4LZZ A;  3B7N A;  3K92 A;  2DZN B;  3B7Q A;  3THG A;  2VF8 A;  2CHQ A;  3K1J A;  2F5S A;  4AI6 A;  4EIW A;  2QCU A;  3C3E A;  2KHH A;  4M9S A;  1NO1 A;  2R45 A;  2XZU A;  4LF9 M;  3FUU A;  2FH0 A;  2LH0 A;  2FS1 A;  5ITY A;  2UXC M;  3H4J A;  4UN2 B;  3RE8 A;  3UJN A;  2VQE M;  2JNH A;  4Z6Y A;  4FWH A;  3D8L A;  5ITX A;  3QWL A;  3KVW A;  2Y21 A;  4B3R M;  1EIJ A;  4JI3 M;  3J80 S;  4IBD A;  2DWZ B;  1JR3 A;  4LF6 M;  1Q3B A;  3TL4 X;  3AKZ A;  5ITQ A;  3NBI A;  4PD2 A;  3KS8 A;  1VQ1 A;  1QAO A;  3J7A S;  4B7F A;  1C7Y A;  5LMN M;  4KO8 A;  1OTR A;  3FUT A;  1IXZ A;  1XMQ M;  1R2Y A;  1QYR A;  2MR9 A;  4DV3 M;  1V33 A;  1P3Q Q;  3M6A A;  1DGG A;  2O25 A;  4LGM A;  2L4F A;  3GLF A;  2A5Y B;  2CP8 A;  3U61 B;  3W0L B;  4F2L A;  3GLH B;  2DEN A;  3SAW A;  2F5Q A;  2YQZ A;  1L1T A;  4LJ6 A;  4P17 A;  3FRI A;  4PDI A;  1K3W A;  1GL6 A;  1DGH A;  2GNO A;  2RGO A;  3FTC A;  4IBB A;  1XB2 B;  1R5L A;  4LG2 A;  2K9D A;  3C3D A;  1W5T A;  2DHR A;  4MM3 B;  1PJT A;  4JN6 A;  4LGY A;  3E21 A;  4GIT A;  4DUZ M;  3IG8 A;  1D0L A;  2J5Y A;  1Z6T A;  2C98 A;  4QHS A;  1KYI A;  1YLA A;  1FJG M;  4X65 M;  4LJA A;  5ITU A;  2ZTD A;  3E9S A;  2M60 A;  4NC6 A;  2BJW A;  4DV6 M;  2E5L M;  4B3S M;  4NXM M;  1D0M A;  1MN3 A;  4KOD A;  2M5Z A;  2HL7 A;  1VEJ A;  1WHC A;  2CRU A;  3FUV A;  5DFL A;  3W0F A;  3M0E A;  2DNA A;  5IZ7 D;  1J5E M;  1XXH A;  1WIV A;  3IHP A;  2QSF X;  1HT1 E;  2R0I A;  4QNM A;  4HL4 A;  1ZAE A;  5FSW A;  1Z5C A;  3GLG B;  4RF1 A;  1WXQ A;  1GJT A;  1QAQ A;  4A3V B;  1UFZ A;  3AJI B;  3BOS A;  3MK6 A;  3DZD A;  5KO3 A;  4PCZ A;  2XEP A;  4F1I A;  4GH9 A;  4IJF A;  1N33 M;  4D81 A;  3GRR A;  3GO8 A;  1ORY B;  4IBI A;  3K2L A;  4LZJ A;  5DNY A;  1LTM A;  4RNA A;  1NHG C;  4X64 M;  4CHT B;  1QUT A;  3J2P B;  1IN7 A;  1IY0 A;  4MGY E;  5BR8 M;  1OIP A;  4Q7J A;  2EKF A;  4B7G A;  4YY3 M;  4GKJ M;  2QEN A;  2KNZ A;  1TH2 A;  3L28 A;  4I8O A;  1RU3 A;  3HJQ A;  2DWM A;  4JI2 M;  4I81 A;  4G4O A;  1Q3C A;  4GHA A;  3CF0 A;  1BVS A;  2WSE F;  2R62 A;  2XFS A;  3GRU A;  4AG6 A;  1OAI A;  2X8A A;  4L16 A;  3IG5 A;  3U6M A;  2LVO C;  4NRV A;  5KPZ A;  1R7R A;  3L25 A;  3ZC7 B;  3B9P A;  2DVW B;  1NY6 A;  4KHP M;  2V6Z M;  1QUS A;  5DYG A;  2F5O A;  1V92 A;  3U6L A;  3GPU A;  3A98 B;  4WUR A;  1NHW C;  4NL4 H;  1XXH B;  3U6E A;  4B3M M;  2DAK A;  5EP1 A;  2BJV A;  3A42 A;  2UXB M;  3C9P A;  3FUW A;  3LCV B;  3J7B A;  3HGI A;  4WW0 A;  2FNA A;  3AOE A;  2I7P A;  3I04 M;  4G4R A;  3T6P A;  4GHL A;  3GLH E;  5JI3 E;  3HHX A;  2GQF A;  4Z8X A;  3AL0 C;  2D7E A;  2VDB B;  2R44 A;  3U61 A;  2ZBK B;  2N35 A;  2Z7J A;  4CGY B;  5LMU M;  4LRS A;  3QYE A;  2L09 A;  2R65 A;  2YNM D;  1JR3 D;  2XSZ A;  4DV4 M;  2ZTC A;  2JY7 A;  2G5G X;  1WGL A;  3ILK A;  4WP2 A;  4BB9 A;  1L2B A;  2LVP C;  2LBC A;  2QQ8 A;  4LF7 M;  4L8R C;  3PNV A; 
#chains in the Genus database with same CATH homology
 2O25 A;  2L4F A;  3F92 A;  2CP8 A;  2MR9 A;  2G3Q A;  2JZ1 A;  1TTE A;  1QZE A;  4F2L A;  2MGW A;  2DEN A;  1WGN A;  2K0B X;  3MMP A;  2H5X A;  3FRI A;  2HWJ A;  1XB2 B;  1WR1 B;  2K9D A;  2DKL A;  1Q02 A;  2DAI A;  1HT2 E;  3E21 A;  1T6O A;  2JY5 A;  2EJS A;  1KYI A;  1TR8 A;  1VEG A;  1Y8G A;  1YLA A;  3GLI E;  3GLF E;  2ZTD A;  3E46 A;  1G41 A;  3BBZ A;  1ZMW A;  1MN3 A;  1VEJ A;  1WHC A;  2DAG A;  5DFL A;  2JY6 B;  2DNA A;  2WZJ A;  3FE3 A;  1WIV A;  3IHP A;  2QSF X;  1HT1 E;  2R0I A;  1DV0 A;  1R4G A;  3LCU A;  1JR3 E;  1DO2 A;  1NV9 A;  1UFZ A;  1VG5 A;  2OOB A;  3GLG E;  1DO0 A;  4F1I A;  1VEK A;  2JZ0 A;  1A5T A;  1G4A E;  2JY8 A;  2LVQ D;  4G3O A;  2EKK A;  2LVA A;  2DZL A;  1XXH E;  2DI0 A;  4Q7J A;  2EKF A;  2KNZ A;  2LVN C;  1EFU B;  2DAE A;  2JUJ A;  3B89 A;  1BVS A;  1T43 A;  1SG9 A;  1OAI A;  2DAM A;  2LVO C;  2HAK A;  2QNJ A;  2LTU A;  3K9O A;  1HQY E;  1PGY A;  1NV8 A;  1ZMV A;  2QHO B;  1WJ7 A;  1F4I A;  1IM2 A;  3IEC A;  1G3I A;  1V92 A;  2KNA A;  1CUK A;  2KNV A;  2DAK A;  2BWB A;  2KHH A;  4DBG B;  3LCV B;  1E94 E;  1AIP C;  2DHY A;  2OO9 A;  3T6P A;  1IXS A;  1ZMU A;  3GLH E;  3H4J A;  4UN2 B;  5JI2 E;  2JNH A;  2BWE A;  4HEO A;  2MRO B;  1HJP A;  2B3T A;  4R71 A;  2CWB A;  1VQ1 A;  3FRH A;  4GEW A;  2ZTC A;  2MJ5 B;  1OKS A;  2JP7 A;  2JY7 A;  3K9P A;  2L2D A;  1C7Y A;  1WGL A;  2L4E A;  1OTR A;  2OOA A;  2RRU A;  4WP2 A;  2LVP C;  2LBC A;  1ZV1 A;  1VDL A;  1GO5 A;  1IFY A;  1OQY A;  1P3Q Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...