3E21A

Crystal structure of faf-1 uba domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
MDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords FAS-associated factor 1
publication title Crystal structure of FAF-1 UBA Domain
rcsb
source organism Homo sapiens
total genus 12
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3e21A00
2LBCA 1NV8A 2BWBA 2OOAA 2CWBA 2MGWA 1VQ1A 2WZJA 4F1IA 2OOBA 2MROB 1DO0A 2QSFX 5DFLA 1WIVA 1ZMVA 1CUKA 2JZ0A 2MJ5B 1G4AE 1WGLA 2LVQD 2KNVA 2LVPC 4HEOA 2K0BX 2H5XA 2DI0A 1Q02A 3F92A 2ZTCA 1R4GA 2G3QA 3FRIA 1JR3E 2L2DA 2JP7A 2RRUA 2LVAA 2JY6B 3FRHA 1DO2A 1P3QQ 3LCUA 1HT2E 2OO9A 1VDLA 1WR1B 2R0IA 1WHCA 4DBGB 2DENA 2DAMA 1DV0A 3GLGE 3GLIE 2DHYA 2EKFA 2CP8A 2DKLA 1MN3A 2QNJA 1QZEA 1GO5A 1IM2A 2B3TA 1YLAA 2BWEA 2JY5A 1SG9A 1AIPC 2EKKA 1HJPA 1PGYA 3BBZA 2DAGA 3IECA 3LCVB 1NV9A 1EFUB 1TR8A 2KHHA 1OAIA 2O25A 1HT1E 1G41A 3IHPA 2LTUA 2L4EA 1VEJA 1WGNA 1VEGA 1WJ7A 1E94E 3MMPA 1OKSA 1OQYA 1OTRA 3H4JA 5JI2E 2JZ1A 1F4IA 2JY8A 1VG5A 2JY7A 1T6OA 4GEWA 2DZLA 1V92A 2DAIA 2KNAA 1XB2B 2QHOB 1UFZA 1XXHE 4UN2B 3GLFE 1KYIA 2LVNC 2JNHA 4R71A 1ZMUA 2K9DA 3E21A 2L4FA 2DAEA 1T43A 1HQYE 3K9OA 4WP2A 4Q7JA 2HWJA 4G3OA 3T6PA 1IXSA 1G3IA 3E46A 1BVSA 1IFYA 2HAKA 1VEKA 1Y8GA 2JUJA 2MR9A 1A5TA 2DNAA 2KNZA 3B89A 3GLHE 3K9PA 2EJSA 4F2LA 1C7YA 1TTEA 1ZMWA 2DAKA 2LVOC 2ZTDA 1ZV1A 3FE3A
chains in the Genus database with same CATH superfamily
4I4LA 2F5SA 3B7QA 1NV8A 2J5YA 3UZUA 4F1IA 3UJNA 2JXNA 3HU1A 3PNVA 4AKGA 3SMPA 1E9RA 3B74A 1XWIA 3THGA 1IY2A 3VDUA 1L2BA 2QSFX 4ZPXA 1L2CA 2Z4SA 1N33M 2EO2A 2HKJA 5DFLA 3SYLA 2XH9A 4LJ8A 4D81A 3HWSA 1V33A 2CHQA 2MJ5B 3NBXX 2C98A 2KNVA 1ZQ9A 3FYCA 2V6ZM 3GPPA 4Z6YA 3U60B 3HU2A 2DI0A 2P5TA 4QNRA 4WURA 3TPZA 3FTFA 1NHGC 1YE9A 5ITQA 1VDDA 3MHVC 1R4GA 1QDRA 4KODA 4G4OA 3TE6A 2UU9M 1NJFA 2G3QA 1L1ZA 1E32A 1HQCA 1SXJE 2C99A 2JP7A 3U6DA 4AQYM 2LVAA 4CGYB 4ITQA 1W5TA 4LJ4A 3CF0A 1TF0B 3SHGB 5IWAM 3K1JA 2NQ8C 3IG8A 3KDSE 1Z5BA 2VIIA 2LWXA 2OO9A 1VDLA 4PT5A 4AKHA 3ILKA 1JB0F 4L16A 3GQ3A 2DVWB 3EIEA 2APLA 4FCTA 2DAMA 4IBCA 1H6UA 5DYGA 4M9XA 2CUZA 3GLIE 2E5LM 3GLFB 3LMMA 2DKLA 4B3SM 4KT0F 5EP3A 1QZMA 1IM2A 2R45A 2JY5A 3GLHA 1SG9A 4B7GA 4RF1A 1N75A 2R4JA 3KOYE 1NV9A 4P17A 2FH0A 3GLFA 2OQ4A 1TR8A 2DZOB 2L6OA 4YHHM 2KHHA 1OAIA 2OPFA 1I4WA 2J7OA 2JWSA 5H37D 4LJ5A 2LTUA 2L4EA 1IN6A 1OFHA 2UUBM 2XEPA 5IREB 2CFOA 3SAVA 3GP1A 3HHYA 4B7FA 1R2ZA 2EUCA 1T3TA 2I7PA 2JZ1A 3GRRA 5EXXA 5KPRA 5LMUM 3HX3A 3FUTA 3T1YM 2HHHM 2X4AA 2JY8A 4XGIA 2O5RA 1TH4A 1PJSA 4QHTA 1D0MA 1T6OA 3HJQA 4NRVA 1JR3A 1V92A 3U6MA 4JI4M 2KNAA 3HGIA 3GPXA 4KO8A 3M7GA 1XXHE 2GQFA 3AV0A 4JI0M 1Q39A 3QYBA 4DV6M 2MH8A 1KYIA 4JN6A 3A42A 1IY0A 3KFUG 2WSFF 3FTDA 4MGIE 3E21A 5L8RF 3SARA 4CHTB 4JI2M 4L78A 3LVVA 2L7IA 4LF8M 2KXEA 4PD2A 3LQRA 4WP2A 3L29A 2X49A 2UXDM 4L4UA 1IXSA 1G3IA 3U61B 4OX9M 1QAOA 4JI6M 1BVSA 4G4NA 3W67A 3I4YA 1E9SA 2FOIC 3RGPA 1JR3D 3JAMS 2W82A 3GLGB 3CGWA 4LF9M 1IY1A 4II7A 2M60A 2MR9A 2DNAA 1XMOM 1XMQM 3K9PA 3U6CA 3RFWA 5EP2A 2K47A 5ITYA 5EJCA 4JI5M 2WSEF 2XSZD 1J5EM 1ZV1A 3AKZA 1Z5CA 2LBCA 3FD9A 2BWBA 2C9CA 1VQ1A 3TWLA 4GHAA 4DUZM 1KSFX 4DV3M 3L28A 3GLGA 2DWZB 2R4EA 1W5SA 4LF4M 2BNKA 1WIVA 3NBIA 4OU7A 1Z6TA 5KQ8A 3E9SA 2LVPC 1MX0A 4GITA 3M0EA 2K0BX 2RGOA 4HEOA 1OIPA 3V76A 2Z8YM 4I81A 3L26A 3LW5F 2G8LA 2DWMA 3IG5A 2XF3A 3HHWA 2FNAA 3FRIA 1R2YA 1YUBA 4DR7M 2C9OA 4QOZC 1XNQM 2JY6B 3FRHA 5ITUA 1DO2A 1PJIA 3KOXE 4HLQA 2QENA 4K0KM 4M9SA 4FD2A 4X65M 1NVMA 1MU5A 3CF6E 3VFDA 2CV1A 1DV0A 2H1RA 4AG6A 3VKHA 3PXGA 1XC8A 1NJGA 1GJTA 4LF7M 4DV2M 2DXIA 3KXEC 3JR5A 3U6OA 4JI3M 4DR6M 3SYKA 1QZEA 1N36M 3KW6A 4NSRA 2UXBM 4MB7A 4DV1M 1YLAA 2KRUA 1GKIA 3AOGA 3EIHA 3U6PA 1AIPC 4R3DA 1HJPA 4IBDA 1PGYA 5E26A 4LFAM 2DAGA 3IECA 4DR5M 2F5PA 4S12A 3AJIB 4HL4A 4DR3M 1K82A 4LY6A 3U6LA 1IBKM 5FTKA 5FLXS 3TWMA 1NNUC 1NHWC 3OTOM 3I01M 5ITXA 5DNYA 3AOEA 1VEJA 1VEGA 1TH2A 4GH9A 2R46A 5EXPA 3RGSA 3MMPA 2KZUA 3GLHB 4LJ7A 1OKSA 2RGHA 3TL4X 1OIZA 1OTRA 1IXZA 2Z4RA 4PCZA 2F5NA 5JI2E 3B7ZA 5LMNM 1JQJC 1Z5AA 3MK6A 3SATA 4QNMA 2WSCF 3C3EA 5ITRA 3KS4A 4BLCA 3R9XB 4GEWA 2KZSA 3Q8GA 1D2NA 1SXJA 2R65A 1ORYB 3SASA 3ZQJA 1IBLM 2Y0TA 2ZBKB 4G4QA 3WHKA 1GJSA 2VQEM 3GLFE 4FW9A 2Z3XA 1I94M 2V1CA 1TH3A 1GVNA 4R71A 2UUAM 2DZNB 5BR8M 5IZ7D 2DHRA 1TGUA 2K9DA 2L4FA 4LFCM 2DAEA 2F4VM 4GC5A 4NOOB 4DR4M 1L8QA 2GNOA 2X8AA 1DGGA 3D8BA 4Q7JA 3VLFB 4DV5M 4D82A 2N35A 5C18A 3FTEA 3AL0C 2ERCA 4GKJM 3NWLA 4DV4M 3E46A 3I04M 3KOZE 4L6V6 1IFYA 2LXEA 2ZM6M 1SXJD 4IBIA 4NL4H 1Y8GA 2KW0A 2KNZA 2EJSA 4FWDA 3A98B 1LTMA 5FSWA 3KP0E 4NXNM 1TTEA 4JXJA 4M0DA 4CJ6A 3IHPA 3KSXA 1IXSB 2CRUA 3TQSA 1ZAEA 2XSZA 5EP4A 4BB9A 8CATA 4LCBA 3GO8A 2MGWA 4LFBM 2WZJA 5KO3A 1EIJA 1PJQA 1NY5A 4AW4A 1PJTA 1HNWM 3ZCBB 1GL7A 1G8PA 1IN8A 4BBAA 2JZ0A 1G4AE 1WGLA 2CV2A 1DGFA 4B7HA 2KDLA 3U6EA 1N77A 3QYEA 4LGMA 1QAQA 3GRYA 1Q02A 3F92A 3HY5A 3FYDA 4IBEA 4JV5M 3GQ4A 1N34M 4REZA 2RKOA 1GLNA 4B3MM 2L2DA 4TUWA 4GKKM 2RRUA 3WHLA 4LZZA 4OW0A 3BXWA 3CF2A 1HNZM 2DWLA 4DR2M 3MJ5A 2BJWA 4IBGA 4IIWA 3DOAA 3PFIA 1HT2E 4MH0E 1WR1B 2R0IA 1Q3BA 4ANRA 1WHCA 4DBGB 3C58A 4AKIA 3J7BA 3KOWE 4FCVA 4MGYE 3GLGE 1XHBA 2ZAOA 4GMQA 4X66M 2C5RA 1G59A 3RE8A 3VKGA 3UK6A 4B3RM 3HJ8A 4W5WA 4LF5M 2CP8A 3ZH9B 1R7RA 1PM5A 3FKEA 1S3SA 2EA0A 2UUCM 1QUTA 4IBBA 5C1BA 3A46A 1D0KA 5KPZA 4NRWA 1GO5A 4JI8M 1RU3A 4IBFA 5FTNA 1UM8A 2UXCM 1C1KA 4LF6M 1PJJA 2EKKA 4FCWA 4DR1M 1QANA 3GPYA 3KP1E 2YNMD 2XGNA 1EFUB 1K3WA 5EXTA 1IBMM 1KFVA 1IN4A 4WW0A 1QVRA 1PRBA 1HT1E 3KSJA 4G4RA 3T15A 3GQ5A 2C96A 1WGNA 1WJ7A 3LQQA 5A2QS 4JI7M 5FTJA 2VF8A 1OQYA 3B7NA 2LHGA 2QP9X 1L2DA 2F5OA 2R44A 3SAWA 1NO1A 1NSFA 5IT9S 1OAOC 2FFJA 4LJ9A 2LH0A 2LHCA 1VG5A 3A45A 1L1TA 1R5LA 2JY7A 3VDPA 4M0WA 3HHXA 2AHMA 3K92A 4OVZA 3J7AS 1XB2B 2A5YB 4IJFA 1QQWA 2QCUA 1FJGM 1DGBA 3I4VA 4G6ZA 4NSOB 4JYAM 2QBYB 5ITXE 5FTMA 4A3VB 3U6QA 2XFSA 2FS1A 4IJEA 3L2AA 1OFIA 1T43A 3SC3A 4CISA 1SXJB 1HQYE 3K9OA 2I7NA 4GIPA 5EP1A 2XFTA 3AOEC 4PDGA 3GRUA 4IBKA 1DGHB 2QBYA 4QOSA 4JI1M 2HAKA 4M9ZA 2L7HA 1VEKA 2YR0A 1GL6A 3BOSA 4LZJA 2JUJA 3GLIB 3GLHE 2QQ8A 5E6JA 1D0LA 2XLJA 4LJ6A 2CV0A 4CIZA 2ZTDA 2K6BA 1SXJC 2L09A 2OOBA 3FE3A 3U60A 2J7NA 4P16A 4DUYM 1IXRC 1Q3CA 2OOAA 5FTLA 3FUVA 1DGHA 1QAMA 2CWBA 2VQFM 3T1HM 3KS8A 3CTWB 2MROB 1DO0A 3J27B 2HL7A 3HJSA 2LNHC 4FVMA 4L15A 3GLIA 3FUWA 1QYRA 3W0FA 4B3TM 1ZMVA 1CUKA 4X64M 2LVQD 3FUUA 5GKNA 2KA6B 3C9PA 2H5XA 2Y0QA 2XZUA 4GC9A 2BJVA 2ZTCA 3Q8XA 4LGYA 3K2LA 3SAUA 2G5GX 3GPUA 1JR3E 5JI3E 3D8LA 3PNYA 4RKUF 3B9PA 4AZFA 2QPAA 1OJLA 1P3QQ 3LCUA 3PVSA 4Y28F 5EXSA 4MM3B 1NNJA 4XK8F 3SBJA 4PDIA 4LG2A 2F5QA 2DENA 1EE8A 4YY3M 1N78A 1QUSA 2CEAA 2JA2A 2R62A 3GRVA 3M6AA 3AFHA 4MGZE 4GRIA 1AUAA 1XXHB 4KLNA 2DHYA 2EKFA 3W68A 3ZC7B 2KEBA 3HU3A 4X62M 4RNAA 1MN3A 2QNJA 3JR4A 5BPVA 3DZDA 3I51A 3KVWA 3R8FA 3FTCA 4FWGA 4MGKE 2B3TA 1YSYA 4NC6A 5KQDA 4FWHA 2BWEA 3DFZA 3W0LB 1G71A 3BBZA 1QDTA 3LCVB 3DA1A 1TDHA 1XXHA 3J2PB 4XBOA 1XNRM 1J7KA 4I5SA 2CE7A 4AG5A 1N32M 2O25A 2YFQA 3H4MA 1Z59A 2Y20A 1GABA 1G41A 2M5ZA 3UMMA 4LRSA 1HR0M 1E94E 3FUXA 4QHSA 1TDZA 1NY6A 2VDBB 3H4JA 4EIWA 3QAUA 3TWKA 2ZAMA 2FE8A 3T38A 5F3WA 3HZJA 1F4IA 1IQPA 1J09A 1FNNA 3SHFA 4B08A 4R7GA 3U5ZB 2CHGA 1LV7A 5ITTA 2D7GA 2R6FA 3HHZA 2YQZA 4GHLA 3L27A 4DV7M 2DZLA 2XZFA 2DAIA 4L8RC 1IN7A 2HCBA 2D7EA 4RF0A 4KHPM 2KRKA 2QHOB 1UFZA 3J81S 4UN2B 4DV0M 1K3XA 1X37A 2LVNC 2JNHA 3E4RA 3UGJA 3U6SA 3U61A 4MGHA 2ZANA 1ZMUA 3U5ZA 2CHVA 4D80A 1IN5A 4I8OA 2O01F 2R18A 3QWLA 2V1UA 4LRTA 7CATA 1R6BX 3C3DA 4OVZB 3HKPA 2HWJA 4G3OA 3T6PA 1MJGM 2QZ4A 3LVWA 4AI6A 1HNXM 3SMSA 5KPTA 3J80S 4IBJA 2Q2EB 3VK7A 4NXMM 2VF7A 4LJAA 2D7HA 3B89A 1A5TA 1V34A 2DWNA 3SFZA 3K8ZA 3VK8A 4F2LA 5DYIA 1C7YA 1WXQA 2DAKA 1ZMWA 2LVOC 2Y21A 2Z7JA 4Z8XA 3L25A 5EQTA
chains in the Genus database with same CATH topology
2LBCA 1NV8A 2BWBA 2OOAA 2CWBA 2MGWA 1VQ1A 2WZJA 4F1IA 2OOBA 2MROB 1DO0A 2QSFX 5DFLA 1WIVA 1ZMVA 1CUKA 2JZ0A 2MJ5B 1G4AE 1WGLA 2LVQD 2KNVA 2LVPC 4HEOA 2K0BX 2H5XA 2DI0A 1Q02A 3F92A 2ZTCA 1R4GA 2G3QA 3FRIA 1JR3E 2L2DA 2JP7A 2RRUA 2LVAA 2JY6B 3FRHA 1DO2A 1P3QQ 3LCUA 1HT2E 2OO9A 1VDLA 1WR1B 2R0IA 1WHCA 4DBGB 2DENA 2DAMA 1DV0A 3GLGE 3GLIE 2DHYA 2EKFA 2CP8A 2DKLA 1MN3A 2QNJA 1QZEA 1GO5A 1IM2A 2B3TA 1YLAA 2BWEA 2JY5A 1SG9A 1AIPC 2EKKA 1HJPA 1PGYA 3BBZA 2DAGA 3IECA 3LCVB 1NV9A 1EFUB 1TR8A 2KHHA 1OAIA 2O25A 1HT1E 1G41A 3IHPA 2LTUA 2L4EA 1VEJA 1WGNA 1VEGA 1WJ7A 1E94E 3MMPA 1OKSA 1OQYA 1OTRA 3H4JA 5JI2E 2JZ1A 1F4IA 2JY8A 1VG5A 2JY7A 1T6OA 4GEWA 2DZLA 1V92A 2DAIA 2KNAA 1XB2B 2QHOB 1UFZA 1XXHE 4UN2B 3GLFE 1KYIA 2LVNC 2JNHA 4R71A 1ZMUA 2K9DA 3E21A 2L4FA 2DAEA 1T43A 1HQYE 3K9OA 4WP2A 4Q7JA 2HWJA 4G3OA 3T6PA 1IXSA 1G3IA 3E46A 1BVSA 1IFYA 2HAKA 1VEKA 1Y8GA 2JUJA 2MR9A 1A5TA 2DNAA 2KNZA 3B89A 3GLHE 3K9PA 2EJSA 4F2LA 1C7YA 1TTEA 1ZMWA 2DAKA 2LVOC 2ZTDA 1ZV1A 3FE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBC A;  1NV8 A;  2BWB A;  2OOA A;  2CWB A;  2MGW A;  1VQ1 A;  2WZJ A;  4F1I A;  2OOB A;  2MRO B;  1DO0 A;  2QSF X;  5DFL A;  1WIV A;  1ZMV A;  1CUK A;  2JZ0 A;  2MJ5 B;  1G4A E;  1WGL A;  2LVQ D;  2KNV A;  2LVP C;  4HEO A;  2K0B X;  2H5X A;  2DI0 A;  1Q02 A;  3F92 A;  2ZTC A;  1R4G A;  2G3Q A;  3FRI A;  1JR3 E;  2L2D A;  2JP7 A;  2RRU A;  2LVA A;  2JY6 B;  3FRH A;  1DO2 A;  1P3Q Q;  3LCU A;  1HT2 E;  2OO9 A;  1VDL A;  1WR1 B;  2R0I A;  1WHC A;  4DBG B;  2DEN A;  2DAM A;  1DV0 A;  3GLG E;  3GLI E;  2DHY A;  2EKF A;  2CP8 A;  2DKL A;  1MN3 A;  2QNJ A;  1QZE A;  1GO5 A;  1IM2 A;  2B3T A;  1YLA A;  2BWE A;  2JY5 A;  1SG9 A;  1AIP C;  2EKK A;  1HJP A;  1PGY A;  3BBZ A;  2DAG A;  3IEC A;  3LCV B;  1NV9 A;  1EFU B;  1TR8 A;  2KHH A;  1OAI A;  2O25 A;  1HT1 E;  1G41 A;  3IHP A;  2LTU A;  2L4E A;  1VEJ A;  1WGN A;  1VEG A;  1WJ7 A;  1E94 E;  3MMP A;  1OKS A;  1OQY A;  1OTR A;  3H4J A;  5JI2 E;  2JZ1 A;  1F4I A;  2JY8 A;  1VG5 A;  2JY7 A;  1T6O A;  4GEW A;  2DZL A;  1V92 A;  2DAI A;  2KNA A;  1XB2 B;  2QHO B;  1UFZ A;  1XXH E;  4UN2 B;  3GLF E;  1KYI A;  2LVN C;  2JNH A;  4R71 A;  1ZMU A;  2K9D A;  3E21 A;  2L4F A;  2DAE A;  1T43 A;  1HQY E;  3K9O A;  4WP2 A;  4Q7J A;  2HWJ A;  4G3O A;  3T6P A;  1IXS A;  1G3I A;  3E46 A;  1BVS A;  1IFY A;  2HAK A;  1VEK A;  1Y8G A;  2JUJ A;  2MR9 A;  1A5T A;  2DNA A;  2KNZ A;  3B89 A;  3GLH E;  3K9P A;  2EJS A;  4F2L A;  1C7Y A;  1TTE A;  1ZMW A;  2DAK A;  2LVO C;  2ZTD A;  1ZV1 A;  3FE3 A; 
#chains in the Genus database with same CATH topology
 4I4L A;  2F5S A;  3B7Q A;  1NV8 A;  2J5Y A;  3UZU A;  4F1I A;  3UJN A;  2JXN A;  3HU1 A;  3PNV A;  4AKG A;  3SMP A;  1E9R A;  3B74 A;  1XWI A;  3THG A;  1IY2 A;  3VDU A;  1L2B A;  2QSF X;  4ZPX A;  1L2C A;  2Z4S A;  1N33 M;  2EO2 A;  2HKJ A;  5DFL A;  3SYL A;  2XH9 A;  4LJ8 A;  4D81 A;  3HWS A;  1V33 A;  2CHQ A;  2MJ5 B;  3NBX X;  2C98 A;  2KNV A;  1ZQ9 A;  3FYC A;  2V6Z M;  3GPP A;  4Z6Y A;  3U60 B;  3HU2 A;  2DI0 A;  2P5T A;  4QNR A;  4WUR A;  3TPZ A;  3FTF A;  1NHG C;  1YE9 A;  5ITQ A;  1VDD A;  3MHV C;  1R4G A;  1QDR A;  4KOD A;  4G4O A;  3TE6 A;  2UU9 M;  1NJF A;  2G3Q A;  1L1Z A;  1E32 A;  1HQC A;  1SXJ E;  2C99 A;  2JP7 A;  3U6D A;  4AQY M;  2LVA A;  4CGY B;  4ITQ A;  1W5T A;  4LJ4 A;  3CF0 A;  1TF0 B;  3SHG B;  5IWA M;  3K1J A;  2NQ8 C;  3IG8 A;  3KDS E;  1Z5B A;  2VII A;  2LWX A;  2OO9 A;  1VDL A;  4PT5 A;  4AKH A;  3ILK A;  1JB0 F;  4L16 A;  3GQ3 A;  2DVW B;  3EIE A;  2APL A;  4FCT A;  2DAM A;  4IBC A;  1H6U A;  5DYG A;  4M9X A;  2CUZ A;  3GLI E;  2E5L M;  3GLF B;  3LMM A;  2DKL A;  4B3S M;  4KT0 F;  5EP3 A;  1QZM A;  1IM2 A;  2R45 A;  2JY5 A;  3GLH A;  1SG9 A;  4B7G A;  4RF1 A;  1N75 A;  2R4J A;  3KOY E;  1NV9 A;  4P17 A;  2FH0 A;  3GLF A;  2OQ4 A;  1TR8 A;  2DZO B;  2L6O A;  4YHH M;  2KHH A;  1OAI A;  2OPF A;  1I4W A;  2J7O A;  2JWS A;  5H37 D;  4LJ5 A;  2LTU A;  2L4E A;  1IN6 A;  1OFH A;  2UUB M;  2XEP A;  5IRE B;  2CFO A;  3SAV A;  3GP1 A;  3HHY A;  4B7F A;  1R2Z A;  2EUC A;  1T3T A;  2I7P A;  2JZ1 A;  3GRR A;  5EXX A;  5KPR A;  5LMU M;  3HX3 A;  3FUT A;  3T1Y M;  2HHH M;  2X4A A;  2JY8 A;  4XGI A;  2O5R A;  1TH4 A;  1PJS A;  4QHT A;  1D0M A;  1T6O A;  3HJQ A;  4NRV A;  1JR3 A;  1V92 A;  3U6M A;  4JI4 M;  2KNA A;  3HGI A;  3GPX A;  4KO8 A;  3M7G A;  1XXH E;  2GQF A;  3AV0 A;  4JI0 M;  1Q39 A;  3QYB A;  4DV6 M;  2MH8 A;  1KYI A;  4JN6 A;  3A42 A;  1IY0 A;  3KFU G;  2WSF F;  3FTD A;  4MGI E;  3E21 A;  5L8R F;  3SAR A;  4CHT B;  4JI2 M;  4L78 A;  3LVV A;  2L7I A;  4LF8 M;  2KXE A;  4PD2 A;  3LQR A;  4WP2 A;  3L29 A;  2X49 A;  2UXD M;  4L4U A;  1IXS A;  1G3I A;  3U61 B;  4OX9 M;  1QAO A;  4JI6 M;  1BVS A;  4G4N A;  3W67 A;  3I4Y A;  1E9S A;  2FOI C;  3RGP A;  1JR3 D;  3JAM S;  2W82 A;  3GLG B;  3CGW A;  4LF9 M;  1IY1 A;  4II7 A;  2M60 A;  2MR9 A;  2DNA A;  1XMO M;  1XMQ M;  3K9P A;  3U6C A;  3RFW A;  5EP2 A;  2K47 A;  5ITY A;  5EJC A;  4JI5 M;  2WSE F;  2XSZ D;  1J5E M;  1ZV1 A;  3AKZ A;  1Z5C A;  2LBC A;  3FD9 A;  2BWB A;  2C9C A;  1VQ1 A;  3TWL A;  4GHA A;  4DUZ M;  1KSF X;  4DV3 M;  3L28 A;  3GLG A;  2DWZ B;  2R4E A;  1W5S A;  4LF4 M;  2BNK A;  1WIV A;  3NBI A;  4OU7 A;  1Z6T A;  5KQ8 A;  3E9S A;  2LVP C;  1MX0 A;  4GIT A;  3M0E A;  2K0B X;  2RGO A;  4HEO A;  1OIP A;  3V76 A;  2Z8Y M;  4I81 A;  3L26 A;  3LW5 F;  2G8L A;  2DWM A;  3IG5 A;  2XF3 A;  3HHW A;  2FNA A;  3FRI A;  1R2Y A;  1YUB A;  4DR7 M;  2C9O A;  4QOZ C;  1XNQ M;  2JY6 B;  3FRH A;  5ITU A;  1DO2 A;  1PJI A;  3KOX E;  4HLQ A;  2QEN A;  4K0K M;  4M9S A;  4FD2 A;  4X65 M;  1NVM A;  1MU5 A;  3CF6 E;  3VFD A;  2CV1 A;  1DV0 A;  2H1R A;  4AG6 A;  3VKH A;  3PXG A;  1XC8 A;  1NJG A;  1GJT A;  4LF7 M;  4DV2 M;  2DXI A;  3KXE C;  3JR5 A;  3U6O A;  4JI3 M;  4DR6 M;  3SYK A;  1QZE A;  1N36 M;  3KW6 A;  4NSR A;  2UXB M;  4MB7 A;  4DV1 M;  1YLA A;  2KRU A;  1GKI A;  3AOG A;  3EIH A;  3U6P A;  1AIP C;  4R3D A;  1HJP A;  4IBD A;  1PGY A;  5E26 A;  4LFA M;  2DAG A;  3IEC A;  4DR5 M;  2F5P A;  4S12 A;  3AJI B;  4HL4 A;  4DR3 M;  1K82 A;  4LY6 A;  3U6L A;  1IBK M;  5FTK A;  5FLX S;  3TWM A;  1NNU C;  1NHW C;  3OTO M;  3I01 M;  5ITX A;  5DNY A;  3AOE A;  1VEJ A;  1VEG A;  1TH2 A;  4GH9 A;  2R46 A;  5EXP A;  3RGS A;  3MMP A;  2KZU A;  3GLH B;  4LJ7 A;  1OKS A;  2RGH A;  3TL4 X;  1OIZ A;  1OTR A;  1IXZ A;  2Z4R A;  4PCZ A;  2F5N A;  5JI2 E;  3B7Z A;  5LMN M;  1JQJ C;  1Z5A A;  3MK6 A;  3SAT A;  4QNM A;  2WSC F;  3C3E A;  5ITR A;  3KS4 A;  4BLC A;  3R9X B;  4GEW A;  2KZS A;  3Q8G A;  1D2N A;  1SXJ A;  2R65 A;  1ORY B;  3SAS A;  3ZQJ A;  1IBL M;  2Y0T A;  2ZBK B;  4G4Q A;  3WHK A;  1GJS A;  2VQE M;  3GLF E;  4FW9 A;  2Z3X A;  1I94 M;  2V1C A;  1TH3 A;  1GVN A;  4R71 A;  2UUA M;  2DZN B;  5BR8 M;  5IZ7 D;  2DHR A;  1TGU A;  2K9D A;  2L4F A;  4LFC M;  2DAE A;  2F4V M;  4GC5 A;  4NOO B;  4DR4 M;  1L8Q A;  2GNO A;  2X8A A;  1DGG A;  3D8B A;  4Q7J A;  3VLF B;  4DV5 M;  4D82 A;  2N35 A;  5C18 A;  3FTE A;  3AL0 C;  2ERC A;  4GKJ M;  3NWL A;  4DV4 M;  3E46 A;  3I04 M;  3KOZ E;  4L6V 6;  1IFY A;  2LXE A;  2ZM6 M;  1SXJ D;  4IBI A;  4NL4 H;  1Y8G A;  2KW0 A;  2KNZ A;  2EJS A;  4FWD A;  3A98 B;  1LTM A;  5FSW A;  3KP0 E;  4NXN M;  1TTE A;  4JXJ A;  4M0D A;  4CJ6 A;  3IHP A;  3KSX A;  1IXS B;  2CRU A;  3TQS A;  1ZAE A;  2XSZ A;  5EP4 A;  4BB9 A;  8CAT A;  4LCB A;  3GO8 A;  2MGW A;  4LFB M;  2WZJ A;  5KO3 A;  1EIJ A;  1PJQ A;  1NY5 A;  4AW4 A;  1PJT A;  1HNW M;  3ZCB B;  1GL7 A;  1G8P A;  1IN8 A;  4BBA A;  2JZ0 A;  1G4A E;  1WGL A;  2CV2 A;  1DGF A;  4B7H A;  2KDL A;  3U6E A;  1N77 A;  3QYE A;  4LGM A;  1QAQ A;  3GRY A;  1Q02 A;  3F92 A;  3HY5 A;  3FYD A;  4IBE A;  4JV5 M;  3GQ4 A;  1N34 M;  4REZ A;  2RKO A;  1GLN A;  4B3M M;  2L2D A;  4TUW A;  4GKK M;  2RRU A;  3WHL A;  4LZZ A;  4OW0 A;  3BXW A;  3CF2 A;  1HNZ M;  2DWL A;  4DR2 M;  3MJ5 A;  2BJW A;  4IBG A;  4IIW A;  3DOA A;  3PFI A;  1HT2 E;  4MH0 E;  1WR1 B;  2R0I A;  1Q3B A;  4ANR A;  1WHC A;  4DBG B;  3C58 A;  4AKI A;  3J7B A;  3KOW E;  4FCV A;  4MGY E;  3GLG E;  1XHB A;  2ZAO A;  4GMQ A;  4X66 M;  2C5R A;  1G59 A;  3RE8 A;  3VKG A;  3UK6 A;  4B3R M;  3HJ8 A;  4W5W A;  4LF5 M;  2CP8 A;  3ZH9 B;  1R7R A;  1PM5 A;  3FKE A;  1S3S A;  2EA0 A;  2UUC M;  1QUT A;  4IBB A;  5C1B A;  3A46 A;  1D0K A;  5KPZ A;  4NRW A;  1GO5 A;  4JI8 M;  1RU3 A;  4IBF A;  5FTN A;  1UM8 A;  2UXC M;  1C1K A;  4LF6 M;  1PJJ A;  2EKK A;  4FCW A;  4DR1 M;  1QAN A;  3GPY A;  3KP1 E;  2YNM D;  2XGN A;  1EFU B;  1K3W A;  5EXT A;  1IBM M;  1KFV A;  1IN4 A;  4WW0 A;  1QVR A;  1PRB A;  1HT1 E;  3KSJ A;  4G4R A;  3T15 A;  3GQ5 A;  2C96 A;  1WGN A;  1WJ7 A;  3LQQ A;  5A2Q S;  4JI7 M;  5FTJ A;  2VF8 A;  1OQY A;  3B7N A;  2LHG A;  2QP9 X;  1L2D A;  2F5O A;  2R44 A;  3SAW A;  1NO1 A;  1NSF A;  5IT9 S;  1OAO C;  2FFJ A;  4LJ9 A;  2LH0 A;  2LHC A;  1VG5 A;  3A45 A;  1L1T A;  1R5L A;  2JY7 A;  3VDP A;  4M0W A;  3HHX A;  2AHM A;  3K92 A;  4OVZ A;  3J7A S;  1XB2 B;  2A5Y B;  4IJF A;  1QQW A;  2QCU A;  1FJG M;  1DGB A;  3I4V A;  4G6Z A;  4NSO B;  4JYA M;  2QBY B;  5ITX E;  5FTM A;  4A3V B;  3U6Q A;  2XFS A;  2FS1 A;  4IJE A;  3L2A A;  1OFI A;  1T43 A;  3SC3 A;  4CIS A;  1SXJ B;  1HQY E;  3K9O A;  2I7N A;  4GIP A;  5EP1 A;  2XFT A;  3AOE C;  4PDG A;  3GRU A;  4IBK A;  1DGH B;  2QBY A;  4QOS A;  4JI1 M;  2HAK A;  4M9Z A;  2L7H A;  1VEK A;  2YR0 A;  1GL6 A;  3BOS A;  4LZJ A;  2JUJ A;  3GLI B;  3GLH E;  2QQ8 A;  5E6J A;  1D0L A;  2XLJ A;  4LJ6 A;  2CV0 A;  4CIZ A;  2ZTD A;  2K6B A;  1SXJ C;  2L09 A;  2OOB A;  3FE3 A;  3U60 A;  2J7N A;  4P16 A;  4DUY M;  1IXR C;  1Q3C A;  2OOA A;  5FTL A;  3FUV A;  1DGH A;  1QAM A;  2CWB A;  2VQF M;  3T1H M;  3KS8 A;  3CTW B;  2MRO B;  1DO0 A;  3J27 B;  2HL7 A;  3HJS A;  2LNH C;  4FVM A;  4L15 A;  3GLI A;  3FUW A;  1QYR A;  3W0F A;  4B3T M;  1ZMV A;  1CUK A;  4X64 M;  2LVQ D;  3FUU A;  5GKN A;  2KA6 B;  3C9P A;  2H5X A;  2Y0Q A;  2XZU A;  4GC9 A;  2BJV A;  2ZTC A;  3Q8X A;  4LGY A;  3K2L A;  3SAU A;  2G5G X;  3GPU A;  1JR3 E;  5JI3 E;  3D8L A;  3PNY A;  4RKU F;  3B9P A;  4AZF A;  2QPA A;  1OJL A;  1P3Q Q;  3LCU A;  3PVS A;  4Y28 F;  5EXS A;  4MM3 B;  1NNJ A;  4XK8 F;  3SBJ A;  4PDI A;  4LG2 A;  2F5Q A;  2DEN A;  1EE8 A;  4YY3 M;  1N78 A;  1QUS A;  2CEA A;  2JA2 A;  2R62 A;  3GRV A;  3M6A A;  3AFH A;  4MGZ E;  4GRI A;  1AUA A;  1XXH B;  4KLN A;  2DHY A;  2EKF A;  3W68 A;  3ZC7 B;  2KEB A;  3HU3 A;  4X62 M;  4RNA A;  1MN3 A;  2QNJ A;  3JR4 A;  5BPV A;  3DZD A;  3I51 A;  3KVW A;  3R8F A;  3FTC A;  4FWG A;  4MGK E;  2B3T A;  1YSY A;  4NC6 A;  5KQD A;  4FWH A;  2BWE A;  3DFZ A;  3W0L B;  1G71 A;  3BBZ A;  1QDT A;  3LCV B;  3DA1 A;  1TDH A;  1XXH A;  3J2P B;  4XBO A;  1XNR M;  1J7K A;  4I5S A;  2CE7 A;  4AG5 A;  1N32 M;  2O25 A;  2YFQ A;  3H4M A;  1Z59 A;  2Y20 A;  1GAB A;  1G41 A;  2M5Z A;  3UMM A;  4LRS A;  1HR0 M;  1E94 E;  3FUX A;  4QHS A;  1TDZ A;  1NY6 A;  2VDB B;  3H4J A;  4EIW A;  3QAU A;  3TWK A;  2ZAM A;  2FE8 A;  3T38 A;  5F3W A;  3HZJ A;  1F4I A;  1IQP A;  1J09 A;  1FNN A;  3SHF A;  4B08 A;  4R7G A;  3U5Z B;  2CHG A;  1LV7 A;  5ITT A;  2D7G A;  2R6F A;  3HHZ A;  2YQZ A;  4GHL A;  3L27 A;  4DV7 M;  2DZL A;  2XZF A;  2DAI A;  4L8R C;  1IN7 A;  2HCB A;  2D7E A;  4RF0 A;  4KHP M;  2KRK A;  2QHO B;  1UFZ A;  3J81 S;  4UN2 B;  4DV0 M;  1K3X A;  1X37 A;  2LVN C;  2JNH A;  3E4R A;  3UGJ A;  3U6S A;  3U61 A;  4MGH A;  2ZAN A;  1ZMU A;  3U5Z A;  2CHV A;  4D80 A;  1IN5 A;  4I8O A;  2O01 F;  2R18 A;  3QWL A;  2V1U A;  4LRT A;  7CAT A;  1R6B X;  3C3D A;  4OVZ B;  3HKP A;  2HWJ A;  4G3O A;  3T6P A;  1MJG M;  2QZ4 A;  3LVW A;  4AI6 A;  1HNX M;  3SMS A;  5KPT A;  3J80 S;  4IBJ A;  2Q2E B;  3VK7 A;  4NXM M;  2VF7 A;  4LJA A;  2D7H A;  3B89 A;  1A5T A;  1V34 A;  2DWN A;  3SFZ A;  3K8Z A;  3VK8 A;  4F2L A;  5DYI A;  1C7Y A;  1WXQ A;  2DAK A;  1ZMW A;  2LVO C;  2Y21 A;  2Z7J A;  4Z8X A;  3L25 A;  5EQT A; 
#chains in the Genus database with same CATH homology
 2LBC A;  1NV8 A;  2BWB A;  2OOA A;  2CWB A;  2MGW A;  1VQ1 A;  2WZJ A;  4F1I A;  2OOB A;  2MRO B;  1DO0 A;  2QSF X;  5DFL A;  1WIV A;  1ZMV A;  1CUK A;  2JZ0 A;  2MJ5 B;  1G4A E;  1WGL A;  2LVQ D;  2KNV A;  2LVP C;  4HEO A;  2K0B X;  2H5X A;  2DI0 A;  1Q02 A;  3F92 A;  2ZTC A;  1R4G A;  2G3Q A;  3FRI A;  1JR3 E;  2L2D A;  2JP7 A;  2RRU A;  2LVA A;  2JY6 B;  3FRH A;  1DO2 A;  1P3Q Q;  3LCU A;  1HT2 E;  2OO9 A;  1VDL A;  1WR1 B;  2R0I A;  1WHC A;  4DBG B;  2DEN A;  2DAM A;  1DV0 A;  3GLG E;  3GLI E;  2DHY A;  2EKF A;  2CP8 A;  2DKL A;  1MN3 A;  2QNJ A;  1QZE A;  1GO5 A;  1IM2 A;  2B3T A;  1YLA A;  2BWE A;  2JY5 A;  1SG9 A;  1AIP C;  2EKK A;  1HJP A;  1PGY A;  3BBZ A;  2DAG A;  3IEC A;  3LCV B;  1NV9 A;  1EFU B;  1TR8 A;  2KHH A;  1OAI A;  2O25 A;  1HT1 E;  1G41 A;  3IHP A;  2LTU A;  2L4E A;  1VEJ A;  1WGN A;  1VEG A;  1WJ7 A;  1E94 E;  3MMP A;  1OKS A;  1OQY A;  1OTR A;  3H4J A;  5JI2 E;  2JZ1 A;  1F4I A;  2JY8 A;  1VG5 A;  2JY7 A;  1T6O A;  4GEW A;  2DZL A;  1V92 A;  2DAI A;  2KNA A;  1XB2 B;  2QHO B;  1UFZ A;  1XXH E;  4UN2 B;  3GLF E;  1KYI A;  2LVN C;  2JNH A;  4R71 A;  1ZMU A;  2K9D A;  3E21 A;  2L4F A;  2DAE A;  1T43 A;  1HQY E;  3K9O A;  4WP2 A;  4Q7J A;  2HWJ A;  4G3O A;  3T6P A;  1IXS A;  1G3I A;  3E46 A;  1BVS A;  1IFY A;  2HAK A;  1VEK A;  1Y8G A;  2JUJ A;  2MR9 A;  1A5T A;  2DNA A;  2KNZ A;  3B89 A;  3GLH E;  3K9P A;  2EJS A;  4F2L A;  1C7Y A;  1TTE A;  1ZMW A;  2DAK A;  2LVO C;  2ZTD A;  1ZV1 A;  3FE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...