3E21A

Crystal structure of faf-1 uba domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
MDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAS-associated factor 1
publication title Crystal structure of FAF-1 UBA Domain
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 12
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3e21A00
3LCVB 1VQ1A 1IXSA 3IECA 1AIPC 2JY6B 2MJ5B 1NV9A 1DO0A 2DAMA 1R4GA 3K9PA 3E46A 3GLGE 1BVSA 2LVPC 2DAGA 2EKKA 3GLIE 2LVAA 1ZV1A 2LVOC 2JZ0A 3FE3A 1OAIA 1T43A 1G41A 1YLAA 2LTUA 1E94E 1ZMWA 2OOBA 3GLHE 1XB2B 1WJ7A 2BWBA 2G3QA 2HWJA 2JNHA 1HT2E 1SG9A 2DHYA 1GO5A 1KYIA 1A5TA 1WIVA 2DAKA 1F4IA 1MN3A 2ZTCA 3GLFE 2QNJA 1IFYA 1G3IA 1CUKA 4UN2B 1UFZA 1IM2A 2JZ1A 3LCUA 2DI0A 2OOAA 2LVNC 3B89A 3IHPA 2JY5A 4Q7JA 1DO2A 1TTEA 5JI2E 2WZJA 2ZTDA 3MMPA 1DV0A 2JUJA 2L4FA 2LVQD 1HQYE 1OTRA 2MR9A 2QHOB 1VEJA 1Q02A 2JY8A 2L2DA 2K9DA 4R71A 1Y8GA 4DBGB 4WP2A 2KNVA 2H5XA 2QSFX 1JR3E 1V92A 1HJPA 2OO9A 3FRIA 1P3QQ 2CP8A 5DFLA 1ZMVA 2KNAA 4HEOA 2DAIA 1WGLA 2DENA 3FRHA 2DNAA 2KHHA 2EKFA 3T6PA 2JY7A 2RRUA 1VDLA 4F2LA 1WGNA 3H4JA 3K9OA 1OQYA 2L4EA 1TR8A 1WHCA 4F1IA 2JP7A 1VEKA 1PGYA 3BBZA 1C7YA 1XXHE 2MGWA 1WR1B 1ZMUA 2BWEA 1EFUB 3E21A 2K0BX 2EJSA 4GEWA 2CWBA 2LBCA 3F92A 2DAEA 1VEGA 2R0IA 2HAKA 1OKSA 2KNZA 2DKLA 2B3TA 2MROB 1NV8A 2O25A 1QZEA 1VG5A 1G4AE 4G3OA 2DZLA 1T6OA 1HT1E
chains in the Genus database with same CATH superfamily
4QOZC 2A5YB 2O01F 3KSJA 1Z5AA 4GMQA 3LVWA 3L25A 2JXNA 5LMNM 4DR6M 4LF9M 3VFDA 2DXIA 4JI2M 4M9SA 2L09A 1OFHA 2X49A 1ORYB 1KSFX 5ITQA 1D0LA 1R4GA 3E46A 1LV7A 3B7QA 4P16A 3W0FA 3W0LB 3GLIE 3SC3A 4MGYE 3QAUA 3U61A 4A3VB 1OAIA 3W68A 4GHLA 2YFQA 1ZMWA 4D81A 5IREB 4G4OA 4FWDA 2LHGA 2BWBA 2APLA 2JNHA 4IJEA 4AQYM 4AG5A 1KYIA 1RU3A 2J5YA 4ITQA 3GLGA 2UUAM 2O5RA 3VLFB 4JI3M 1NO1A 3NBIA 4BB9A 2VF8A 3A42A 2FS1A 2YQZA 5KPZA 5IZ7D 4B7FA 1HNXM 3SARA 2Z7JA 1UFZA 3GRVA 3KOXE 4UN2B 5JI3E 3L26A 1FJGM 1IM2A 4B08A 1HNZM 4LY6A 4X66M 3HU2A 4LGYA 3AOEA 5LMUM 4G4QA 2Z4RA 1DO2A 1TTEA 2YNMD 2ZTDA 5FTNA 5IT9S 1IXSB 2QP9X 4JXJA 2GNOA 4L15A 3W67A 2G5GX 1N36M 1V33A 1Q39A 5FTMA 4IBDA 3T38A 3A45A 1DGBA 3ZQJA 4DV6M 2VDBB 2C5RA 1Q02A 3HGIA 3HY5A 4DBGB 4OW0A 3TE6A 4FWHA 4M0DA 2LHCA 2QSFX 3RGSA 1DGFA 2J7NA 1JR3E 1NY6A 4LJAA 3GLHA 1IY0A 4MM3B 3C3DA 3M7GA 2R45A 1ZMVA 2CHVA 2KNAA 1TGUA 3KOYE 3JR4A 1VDDA 3T15A 2DENA 1PJJA 3FUUA 5ITYA 3GPXA 3T6PA 2V1CA 2Y20A 3B74A 1VDLA 4JI5M 1WXQA 4I4LA 2XFSA 2WSFF 5E26A 1K82A 3J81S 3H4JA 4CIZA 4DR5M 3K9OA 2VF7A 1AUAA 3U6MA 5EP3A 1OQYA 2UXCM 1T3TA 4TUWA 1TR8A 4PT5A 1SXJB 3K8ZA 3GQ3A 2DHRA 5A2QS 3U6LA 3BBZA 1C7YA 5ITXA 4LFAM 1EIJA 1GL7A 3KDSE 3ZH9B 3JAMS 1ZMUA 3QYBA 4LF4M 3CF2A 4DR3M 2CEAA 3U6OA 1K3XA 4K0KM 2HHHM 3LQQA 2CWBA 1GABA 1R7RA 2DAEA 2WSEF 4QNMA 1R6BX 2Q2EB 4I81A 2ZM6M 4LRSA 5FSWA 5F3WA 4B3TM 2KNZA 3FYCA 1Z5BA 3EIHA 8CATA 2V6ZM 2FNAA 3AL0C 2XEPA 4L4UA 3Q8GA 1G4AE 2DZLA 2W82A 4M9XA 1T6OA 1FNNA 1HT1E 2F5QA 2KA6B 1QAQA 2UXBM 1G8PA 1IXSA 4JI8M 1GJTA 2R18A 1R2ZA 2C96A 2DWZB 4M0WA 2EA0A 4B3RM 3AOEC 3KS4A 5E6JA 4X65M 3K9PA 5FTJA 4QOSA 3TL4X 1XMOM 2DAGA 4FD2A 3EIEA 2LVAA 1H6UA 2UU9M 4OX9M 3T1YM 1ZV1A 2LVOC 4DUZM 2JZ0A 3FE3A 1Q3BA 2DVWB 3U5ZB 2LTUA 1G41A 4OVZA 4LF5M 1E94E 2OOBA 5IWAM 4FCVA 1D0KA 4YY3M 3FD9A 1L8QA 4OU7A 1X37A 3GO8A 3GLHE 1XB2B 1WJ7A 4LF7M 2R62A 1HT2E 1SG9A 2XGNA 1GL6A 3C3EA 3LQRA 4FCTA 4AZFA 3C9PA 2QBYA 2DAKA 3KOWE 2ZANA 4GH9A 2XZUA 4JI1M 4KHPM 4S12A 4AKGA 2YR0A 4B7GA 5KPRA 4LJ9A 4I5SA 2JWSA 3B7ZA 1IXRC 4LF6M 5H37D 2QNJA 1TH4A 3HU3A 3GRRA 1S3SA 4ANRA 4XBOA 2FE8A 2UUCM 3AKZA 2JZ1A 1NHGC 5KO3A 3B89A 2LVNC 2R4JA 3OTOM 3I51A 1E9SA 4NSOB 2WZJA 4DV5M 2DWNA 3FKEA 1QDRA 4LRTA 1NNUC 1R2YA 1IN7A 3M0EA 3PXGA 5FTLA 5ITRA 4DV7M 1HR0M 3GRYA 2CV2A 3KS8A 3PNYA 2KZUA 2QHOB 4D80A 5BR8M 2JY8A 3GRUA 2K9DA 4R71A 1SXJD 3HHZA 4Z8XA 1J09A 2KNVA 4GC9A 2LXEA 5FTKA 2KXEA 1YE9A 5EP1A 4NRVA 4CISA 4WW0A 1TF0B 3I4YA 1MJGM 1NSFA 2C99A 4GIPA 4W5WA 4CGYB 3KFUG 2G8LA 1Z5CA 1C1KA 4DR4M 1IN8A 2R44A 3SYLA 4MGZE 3GLIB 1G59A 1WGLA 2KHHA 4LF8M 3GLFA 4JN6A 2KZSA 2HCBA 3J27B 4LGMA 4F2LA 3FTEA 4HL4A 1WGNA 1DGHA 1V34A 3GP1A 3LVVA 3U6CA 3SAUA 3SATA 1XNQM 2I7PA 3GPUA 1MU5A 1YSYA 3KSXA 4EIWA 4DV0M 4NXMM 2KRUA 4GITA 3KW6A 3U5ZA 2OPFA 2CV1A 2I7NA 1L1TA 4FWGA 4LZZA 1L2DA 1IXZA 1N34M 4JI7M 1XXHE 4XGIA 3TQSA 4LJ7A 1QAMA 2GQFA 4G4NA 2CRUA 4FW9A 4LJ8A 3HWSA 2BJVA 4IBJA 4GEWA 4LJ6A 1HQCA 3L2AA 4RNAA 3DA1A 2CFOA 4MGKE 4IBKA 1TH3A 4AI6A 5EP4A 3TWKA 2HKJA 1OIZA 3KP0E 1OKSA 2WSCF 4R3DA 1L1ZA 2MROB 2ZBKB 1GLNA 4DR1M 3DOAA 1IBKM 3QWLA 4GC5A 2C9CA 1NJFA 1QYRA 1OFIA 4LJ5A 1NNJA 2CV0A 2C98A 1Z59A 1N33M 1QZMA 2BNKA 3IG8A 3WHKA 4II7A 2R65A 3ZCBB 3IECA 3LW5F 4PDIA 3HJQA 1ZAEA 1XXHB 3SAWA 3L29A 1DO0A 3U60B 3GLGE 4RKUF 1BVSA 1OIPA 2D7GA 2D7EA 2EKKA 2LVPC 3DZDA 2XFTA 3VDUA 3U6PA 4NRWA 4QHSA 1G71A 1T43A 4JI6M 1YLAA 1L2BA 2Z8YM 5ITUA 4QHTA 2Z4SA 2EO2A 2UUBM 2DHYA 1GO5A 3KVWA 1A5TA 1NY5A 2DZOB 1I94M 3MK6A 7CATA 3FTFA 3FYDA 3SYKA 3GLIA 1IY1A 3GLFE 3U61B 1TDHA 2L7HA 3GQ5A 4BLCA 2D7HA 3SASA 1IFYA 1G3IA 1XNRM 3HJ8A 1OAOC 4JV5M 3E4RA 3LCUA 4JI4M 2OOAA 4KT0F 2JY5A 3R9XB 1PM5A 4B3SM 4Q7JA 3VKGA 3JR5A 1KFVA 3MMPA 2K6BA 2DZNB 1DV0A 1Z6TA 2L4FA 1I4WA 4GKJM 2CHGA 4MH0E 4CJ6A 4L6V6 2L7IA 2MH8A 4NSRA 1QAOA 1VEJA 3K2LA 3SHFA 3VK8A 2L2DA 1N78A 5KPTA 4DR7M 2XSZA 3HU1A 3L27A 4Z6YA 3TPZA 2RKOA 1PJIA 2H5XA 3NWLA 4NOOB 2UXDM 3CGWA 1D2NA 3L28A 3KXEC 1IQPA 3UJNA 2Z3XA 2FFJA 1V92A 1HJPA 2OO9A 3UGJA 1P3QQ 1Q3CA 5EXXA 4D82A 5C18A 2X4AA 5DFLA 1LTMA 2Y21A 4HEOA 2DAIA 1N75A 3SBJA 3FRHA 1SXJA 2XSZD 1QUTA 3HHXA 3K92A 3MJ5A 3AFHA 4MGIE 2EKFA 3FUVA 4WURA 3CF0A 4Y28F 3TWLA 5ITXE 2JY7A 2F5PA 2RRUA 3PVSA 1MX0A 1JR3A 5DYIA 3GLHB 3HKPA 4L78A 3UK6A 4P17A 2BJWA 4HLQA 4ZPXA 5GKNA 4XK8F 2L4EA 5EXPA 3AOGA 2VQFM 5BPVA 1WHCA 3B7NA 4NXNM 4F1IA 3VKHA 2JP7A 3I4VA 4GKKM 1K3WA 1PGYA 3KOZE 5FLXS 4DV2M 1IN6A 3WHLA 2C9OA 2FOIC 4LJ4A 1XC8A 1TDZA 4LZJA 1E9RA 1WR1B 1JR3D 4IBIA 3ZC7B 1EFUB 2LH0A 3E21A 2K0BX 4REZA 4PDGA 5KQDA 2EJSA 2X8AA 2LBCA 2KEBA 2LWXA 4LFBM 1VEGA 2R0IA 3RE8A 3I04M 2F4VM 1PJSA 1QDTA 3SMSA 2HAKA 2DKLA 2KRKA 2B3TA 2F5NA 1NV8A 2O25A 1QUSA 1N32M 1IN5A 1VG5A 3HJSA 3FTCA 3NBXX 3CTWB 4G3OA 1W5TA 4GRIA 3A46A 3J2PB 2L6OA 1J7KA 3ILKA 3TWMA 3LCVB 1VQ1A 1GKIA 3U6QA 1J5EM 5DYGA 1AIPC 4AW4A 2JY6B 2MJ5B 2QPAA 4R7GA 1ZQ9A 1IN4A 1NV9A 4JI0M 1QQWA 4LFCM 2DAMA 1PJTA 4M9ZA 2XH9A 3IG5A 2DWLA 3I01M 3SMPA 1L2CA 2F5SA 4DV4M 3RGPA 4AKHA 5EXTA 1OJLA 3FUWA 4MB7A 3SAVA 1PJQA 1GVNA 2HL7A 5KQ8A 2G3QA 2HWJA 3T1HM 2CHQA 1IBLM 4LG2A 1EE8A 5DNYA 1WIVA 4NC6A 4RF0A 2VIIA 4IBFA 3BXWA 4NL4H 1SXJE 4PCZA 4IBBA 4DV1M 1F4IA 1W5SA 1MN3A 2ZTCA 2QZ4A 3GQ4A 4GHAA 3H4MA 4OVZB 3MHVC 2NQ8C 3HHWA 3M6AA 2QQ8A 3E9SA 1CUKA 3UMMA 1QVRA 4G4RA 2V1UA 4L8RC 1JB0F 2ZAOA 4KODA 2QBYB 2P5TA 2DI0A 1SXJC 3AJIB 3IHPA 4DV3M 3Q8XA 3QYEA 2QCUA 2Y0TA 1IBMM 5JI2E 1PRBA 4DR2M 4DUYM 2CUZA 3THGA 4JYAM 3BOSA 2JUJA 2LVQD 4X64M 3D8LA 1HQYE 4B3MM 1OTRA 2Y0QA 3HHYA 3U6DA 2MR9A 3GPYA 3KP1E 4AKIA 2QENA 2K47A 4FCWA 2XLJA 5ITTA 1Y8GA 5EQTA 4MGHA 4WP2A 3LMMA 3D8BA 3AV0A 4IIWA 4QNRA 4IBCA 1XWIA 3FRIA 1DGGA 3HX3A 2M60A 4IBEA 5EJCA 1N77A 4BBAA 4RF1A 3HZJA 2CP8A 3J7BA 3GLGB 3K1JA 1IY2A 3PFIA 5EP2A 1XHBA 2DWMA 2DNAA 1XMQM 1GJSA 3FUXA 4KO8A 4PD2A 3C58A 1QANA 1NHWC 2R6FA 2AHMA 2KDLA 3DFZA 5EXSA 2R4EA 3RFWA 4CHTB 3U6SA 1HNWM 4YHHM 3FUTA 1JQJC 2RGHA 3B9PA 3U6EA 2XF3A 2KW0A 3UZUA 2ERCA 1VEKA 3GLFB 2R46A 3CF6E 2F5OA 2N35A 3J7AS 2J7OA 2MGWA 1DGHB 1D0MA 4IJFA 3VK7A 3FTDA 1R5LA 2BWEA 1NVMA 1YUBA 4IBGA 2JA2A 3F92A 2VQEM 4B7HA 2ZAMA 3PNVA 2CE7A 3J80S 3R8FA 4KLNA 4X62M 2XZFA 4L16A 1UM8A 3VDPA 2FH0A 5L8RF 5C1BA 4I8OA 3GPPA 2OQ4A 3SFZA 1XXHA 2EUCA 1E32A 1QZEA 3SHGB 2E5LM 3A98B 1TH2A 4FVMA 2H1RA 3U60A 2M5ZA 4LCBA 1NJGA 2RGOA 2LNHC 4AG6A 4G6ZA 3V76A
chains in the Genus database with same CATH topology
3LCVB 1VQ1A 1IXSA 3IECA 1AIPC 2JY6B 2MJ5B 1NV9A 1DO0A 2DAMA 1R4GA 3K9PA 3E46A 3GLGE 1BVSA 2LVPC 2DAGA 2EKKA 3GLIE 2LVAA 1ZV1A 2LVOC 2JZ0A 3FE3A 1OAIA 1T43A 1G41A 1YLAA 2LTUA 1E94E 1ZMWA 2OOBA 3GLHE 1XB2B 1WJ7A 2BWBA 2G3QA 2HWJA 2JNHA 1HT2E 1SG9A 2DHYA 1GO5A 1KYIA 1A5TA 1WIVA 2DAKA 1F4IA 1MN3A 2ZTCA 3GLFE 2QNJA 1IFYA 1G3IA 1CUKA 4UN2B 1UFZA 1IM2A 2JZ1A 3LCUA 2DI0A 2OOAA 2LVNC 3B89A 3IHPA 2JY5A 4Q7JA 1DO2A 1TTEA 5JI2E 2WZJA 2ZTDA 3MMPA 1DV0A 2JUJA 2L4FA 2LVQD 1HQYE 1OTRA 2MR9A 2QHOB 1VEJA 1Q02A 2JY8A 2L2DA 2K9DA 4R71A 1Y8GA 4DBGB 4WP2A 2KNVA 2H5XA 2QSFX 1JR3E 1V92A 1HJPA 2OO9A 3FRIA 1P3QQ 2CP8A 5DFLA 1ZMVA 2KNAA 4HEOA 2DAIA 1WGLA 2DENA 3FRHA 2DNAA 2KHHA 2EKFA 3T6PA 2JY7A 2RRUA 1VDLA 4F2LA 1WGNA 3H4JA 3K9OA 1OQYA 2L4EA 1TR8A 1WHCA 4F1IA 2JP7A 1VEKA 1PGYA 3BBZA 1C7YA 1XXHE 2MGWA 1WR1B 1ZMUA 2BWEA 1EFUB 3E21A 2K0BX 2EJSA 4GEWA 2CWBA 2LBCA 3F92A 2DAEA 1VEGA 2R0IA 2HAKA 1OKSA 2KNZA 2DKLA 2B3TA 2MROB 1NV8A 2O25A 1QZEA 1VG5A 1G4AE 4G3OA 2DZLA 1T6OA 1HT1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCV B;  1VQ1 A;  1IXS A;  3IEC A;  1AIP C;  2JY6 B;  2MJ5 B;  1NV9 A;  1DO0 A;  2DAM A;  1R4G A;  3K9P A;  3E46 A;  3GLG E;  1BVS A;  2LVP C;  2DAG A;  2EKK A;  3GLI E;  2LVA A;  1ZV1 A;  2LVO C;  2JZ0 A;  3FE3 A;  1OAI A;  1T43 A;  1G41 A;  1YLA A;  2LTU A;  1E94 E;  1ZMW A;  2OOB A;  3GLH E;  1XB2 B;  1WJ7 A;  2BWB A;  2G3Q A;  2HWJ A;  2JNH A;  1HT2 E;  1SG9 A;  2DHY A;  1GO5 A;  1KYI A;  1A5T A;  1WIV A;  2DAK A;  1F4I A;  1MN3 A;  2ZTC A;  3GLF E;  2QNJ A;  1IFY A;  1G3I A;  1CUK A;  4UN2 B;  1UFZ A;  1IM2 A;  2JZ1 A;  3LCU A;  2DI0 A;  2OOA A;  2LVN C;  3B89 A;  3IHP A;  2JY5 A;  4Q7J A;  1DO2 A;  1TTE A;  5JI2 E;  2WZJ A;  2ZTD A;  3MMP A;  1DV0 A;  2JUJ A;  2L4F A;  2LVQ D;  1HQY E;  1OTR A;  2MR9 A;  2QHO B;  1VEJ A;  1Q02 A;  2JY8 A;  2L2D A;  2K9D A;  4R71 A;  1Y8G A;  4DBG B;  4WP2 A;  2KNV A;  2H5X A;  2QSF X;  1JR3 E;  1V92 A;  1HJP A;  2OO9 A;  3FRI A;  1P3Q Q;  2CP8 A;  5DFL A;  1ZMV A;  2KNA A;  4HEO A;  2DAI A;  1WGL A;  2DEN A;  3FRH A;  2DNA A;  2KHH A;  2EKF A;  3T6P A;  2JY7 A;  2RRU A;  1VDL A;  4F2L A;  1WGN A;  3H4J A;  3K9O A;  1OQY A;  2L4E A;  1TR8 A;  1WHC A;  4F1I A;  2JP7 A;  1VEK A;  1PGY A;  3BBZ A;  1C7Y A;  1XXH E;  2MGW A;  1WR1 B;  1ZMU A;  2BWE A;  1EFU B;  3E21 A;  2K0B X;  2EJS A;  4GEW A;  2CWB A;  2LBC A;  3F92 A;  2DAE A;  1VEG A;  2R0I A;  2HAK A;  1OKS A;  2KNZ A;  2DKL A;  2B3T A;  2MRO B;  1NV8 A;  2O25 A;  1QZE A;  1VG5 A;  1G4A E;  4G3O A;  2DZL A;  1T6O A;  1HT1 E; 
#chains in the Genus database with same CATH topology
 4QOZ C;  2A5Y B;  2O01 F;  3KSJ A;  1Z5A A;  4GMQ A;  3LVW A;  3L25 A;  2JXN A;  5LMN M;  4DR6 M;  4LF9 M;  3VFD A;  2DXI A;  4JI2 M;  4M9S A;  2L09 A;  1OFH A;  2X49 A;  1ORY B;  1KSF X;  5ITQ A;  1D0L A;  1R4G A;  3E46 A;  1LV7 A;  3B7Q A;  4P16 A;  3W0F A;  3W0L B;  3GLI E;  3SC3 A;  4MGY E;  3QAU A;  3U61 A;  4A3V B;  1OAI A;  3W68 A;  4GHL A;  2YFQ A;  1ZMW A;  4D81 A;  5IRE B;  4G4O A;  4FWD A;  2LHG A;  2BWB A;  2APL A;  2JNH A;  4IJE A;  4AQY M;  4AG5 A;  1KYI A;  1RU3 A;  2J5Y A;  4ITQ A;  3GLG A;  2UUA M;  2O5R A;  3VLF B;  4JI3 M;  1NO1 A;  3NBI A;  4BB9 A;  2VF8 A;  3A42 A;  2FS1 A;  2YQZ A;  5KPZ A;  5IZ7 D;  4B7F A;  1HNX M;  3SAR A;  2Z7J A;  1UFZ A;  3GRV A;  3KOX E;  4UN2 B;  5JI3 E;  3L26 A;  1FJG M;  1IM2 A;  4B08 A;  1HNZ M;  4LY6 A;  4X66 M;  3HU2 A;  4LGY A;  3AOE A;  5LMU M;  4G4Q A;  2Z4R A;  1DO2 A;  1TTE A;  2YNM D;  2ZTD A;  5FTN A;  5IT9 S;  1IXS B;  2QP9 X;  4JXJ A;  2GNO A;  4L15 A;  3W67 A;  2G5G X;  1N36 M;  1V33 A;  1Q39 A;  5FTM A;  4IBD A;  3T38 A;  3A45 A;  1DGB A;  3ZQJ A;  4DV6 M;  2VDB B;  2C5R A;  1Q02 A;  3HGI A;  3HY5 A;  4DBG B;  4OW0 A;  3TE6 A;  4FWH A;  4M0D A;  2LHC A;  2QSF X;  3RGS A;  1DGF A;  2J7N A;  1JR3 E;  1NY6 A;  4LJA A;  3GLH A;  1IY0 A;  4MM3 B;  3C3D A;  3M7G A;  2R45 A;  1ZMV A;  2CHV A;  2KNA A;  1TGU A;  3KOY E;  3JR4 A;  1VDD A;  3T15 A;  2DEN A;  1PJJ A;  3FUU A;  5ITY A;  3GPX A;  3T6P A;  2V1C A;  2Y20 A;  3B74 A;  1VDL A;  4JI5 M;  1WXQ A;  4I4L A;  2XFS A;  2WSF F;  5E26 A;  1K82 A;  3J81 S;  3H4J A;  4CIZ A;  4DR5 M;  3K9O A;  2VF7 A;  1AUA A;  3U6M A;  5EP3 A;  1OQY A;  2UXC M;  1T3T A;  4TUW A;  1TR8 A;  4PT5 A;  1SXJ B;  3K8Z A;  3GQ3 A;  2DHR A;  5A2Q S;  3U6L A;  3BBZ A;  1C7Y A;  5ITX A;  4LFA M;  1EIJ A;  1GL7 A;  3KDS E;  3ZH9 B;  3JAM S;  1ZMU A;  3QYB A;  4LF4 M;  3CF2 A;  4DR3 M;  2CEA A;  3U6O A;  1K3X A;  4K0K M;  2HHH M;  3LQQ A;  2CWB A;  1GAB A;  1R7R A;  2DAE A;  2WSE F;  4QNM A;  1R6B X;  2Q2E B;  4I81 A;  2ZM6 M;  4LRS A;  5FSW A;  5F3W A;  4B3T M;  2KNZ A;  3FYC A;  1Z5B A;  3EIH A;  8CAT A;  2V6Z M;  2FNA A;  3AL0 C;  2XEP A;  4L4U A;  3Q8G A;  1G4A E;  2DZL A;  2W82 A;  4M9X A;  1T6O A;  1FNN A;  1HT1 E;  2F5Q A;  2KA6 B;  1QAQ A;  2UXB M;  1G8P A;  1IXS A;  4JI8 M;  1GJT A;  2R18 A;  1R2Z A;  2C96 A;  2DWZ B;  4M0W A;  2EA0 A;  4B3R M;  3AOE C;  3KS4 A;  5E6J A;  4X65 M;  3K9P A;  5FTJ A;  4QOS A;  3TL4 X;  1XMO M;  2DAG A;  4FD2 A;  3EIE A;  2LVA A;  1H6U A;  2UU9 M;  4OX9 M;  3T1Y M;  1ZV1 A;  2LVO C;  4DUZ M;  2JZ0 A;  3FE3 A;  1Q3B A;  2DVW B;  3U5Z B;  2LTU A;  1G41 A;  4OVZ A;  4LF5 M;  1E94 E;  2OOB A;  5IWA M;  4FCV A;  1D0K A;  4YY3 M;  3FD9 A;  1L8Q A;  4OU7 A;  1X37 A;  3GO8 A;  3GLH E;  1XB2 B;  1WJ7 A;  4LF7 M;  2R62 A;  1HT2 E;  1SG9 A;  2XGN A;  1GL6 A;  3C3E A;  3LQR A;  4FCT A;  4AZF A;  3C9P A;  2QBY A;  2DAK A;  3KOW E;  2ZAN A;  4GH9 A;  2XZU A;  4JI1 M;  4KHP M;  4S12 A;  4AKG A;  2YR0 A;  4B7G A;  5KPR A;  4LJ9 A;  4I5S A;  2JWS A;  3B7Z A;  1IXR C;  4LF6 M;  5H37 D;  2QNJ A;  1TH4 A;  3HU3 A;  3GRR A;  1S3S A;  4ANR A;  4XBO A;  2FE8 A;  2UUC M;  3AKZ A;  2JZ1 A;  1NHG C;  5KO3 A;  3B89 A;  2LVN C;  2R4J A;  3OTO M;  3I51 A;  1E9S A;  4NSO B;  2WZJ A;  4DV5 M;  2DWN A;  3FKE A;  1QDR A;  4LRT A;  1NNU C;  1R2Y A;  1IN7 A;  3M0E A;  3PXG A;  5FTL A;  5ITR A;  4DV7 M;  1HR0 M;  3GRY A;  2CV2 A;  3KS8 A;  3PNY A;  2KZU A;  2QHO B;  4D80 A;  5BR8 M;  2JY8 A;  3GRU A;  2K9D A;  4R71 A;  1SXJ D;  3HHZ A;  4Z8X A;  1J09 A;  2KNV A;  4GC9 A;  2LXE A;  5FTK A;  2KXE A;  1YE9 A;  5EP1 A;  4NRV A;  4CIS A;  4WW0 A;  1TF0 B;  3I4Y A;  1MJG M;  1NSF A;  2C99 A;  4GIP A;  4W5W A;  4CGY B;  3KFU G;  2G8L A;  1Z5C A;  1C1K A;  4DR4 M;  1IN8 A;  2R44 A;  3SYL A;  4MGZ E;  3GLI B;  1G59 A;  1WGL A;  2KHH A;  4LF8 M;  3GLF A;  4JN6 A;  2KZS A;  2HCB A;  3J27 B;  4LGM A;  4F2L A;  3FTE A;  4HL4 A;  1WGN A;  1DGH A;  1V34 A;  3GP1 A;  3LVV A;  3U6C A;  3SAU A;  3SAT A;  1XNQ M;  2I7P A;  3GPU A;  1MU5 A;  1YSY A;  3KSX A;  4EIW A;  4DV0 M;  4NXM M;  2KRU A;  4GIT A;  3KW6 A;  3U5Z A;  2OPF A;  2CV1 A;  2I7N A;  1L1T A;  4FWG A;  4LZZ A;  1L2D A;  1IXZ A;  1N34 M;  4JI7 M;  1XXH E;  4XGI A;  3TQS A;  4LJ7 A;  1QAM A;  2GQF A;  4G4N A;  2CRU A;  4FW9 A;  4LJ8 A;  3HWS A;  2BJV A;  4IBJ A;  4GEW A;  4LJ6 A;  1HQC A;  3L2A A;  4RNA A;  3DA1 A;  2CFO A;  4MGK E;  4IBK A;  1TH3 A;  4AI6 A;  5EP4 A;  3TWK A;  2HKJ A;  1OIZ A;  3KP0 E;  1OKS A;  2WSC F;  4R3D A;  1L1Z A;  2MRO B;  2ZBK B;  1GLN A;  4DR1 M;  3DOA A;  1IBK M;  3QWL A;  4GC5 A;  2C9C A;  1NJF A;  1QYR A;  1OFI A;  4LJ5 A;  1NNJ A;  2CV0 A;  2C98 A;  1Z59 A;  1N33 M;  1QZM A;  2BNK A;  3IG8 A;  3WHK A;  4II7 A;  2R65 A;  3ZCB B;  3IEC A;  3LW5 F;  4PDI A;  3HJQ A;  1ZAE A;  1XXH B;  3SAW A;  3L29 A;  1DO0 A;  3U60 B;  3GLG E;  4RKU F;  1BVS A;  1OIP A;  2D7G A;  2D7E A;  2EKK A;  2LVP C;  3DZD A;  2XFT A;  3VDU A;  3U6P A;  4NRW A;  4QHS A;  1G71 A;  1T43 A;  4JI6 M;  1YLA A;  1L2B A;  2Z8Y M;  5ITU A;  4QHT A;  2Z4S A;  2EO2 A;  2UUB M;  2DHY A;  1GO5 A;  3KVW A;  1A5T A;  1NY5 A;  2DZO B;  1I94 M;  3MK6 A;  7CAT A;  3FTF A;  3FYD A;  3SYK A;  3GLI A;  1IY1 A;  3GLF E;  3U61 B;  1TDH A;  2L7H A;  3GQ5 A;  4BLC A;  2D7H A;  3SAS A;  1IFY A;  1G3I A;  1XNR M;  3HJ8 A;  1OAO C;  4JV5 M;  3E4R A;  3LCU A;  4JI4 M;  2OOA A;  4KT0 F;  2JY5 A;  3R9X B;  1PM5 A;  4B3S M;  4Q7J A;  3VKG A;  3JR5 A;  1KFV A;  3MMP A;  2K6B A;  2DZN B;  1DV0 A;  1Z6T A;  2L4F A;  1I4W A;  4GKJ M;  2CHG A;  4MH0 E;  4CJ6 A;  4L6V 6;  2L7I A;  2MH8 A;  4NSR A;  1QAO A;  1VEJ A;  3K2L A;  3SHF A;  3VK8 A;  2L2D A;  1N78 A;  5KPT A;  4DR7 M;  2XSZ A;  3HU1 A;  3L27 A;  4Z6Y A;  3TPZ A;  2RKO A;  1PJI A;  2H5X A;  3NWL A;  4NOO B;  2UXD M;  3CGW A;  1D2N A;  3L28 A;  3KXE C;  1IQP A;  3UJN A;  2Z3X A;  2FFJ A;  1V92 A;  1HJP A;  2OO9 A;  3UGJ A;  1P3Q Q;  1Q3C A;  5EXX A;  4D82 A;  5C18 A;  2X4A A;  5DFL A;  1LTM A;  2Y21 A;  4HEO A;  2DAI A;  1N75 A;  3SBJ A;  3FRH A;  1SXJ A;  2XSZ D;  1QUT A;  3HHX A;  3K92 A;  3MJ5 A;  3AFH A;  4MGI E;  2EKF A;  3FUV A;  4WUR A;  3CF0 A;  4Y28 F;  3TWL A;  5ITX E;  2JY7 A;  2F5P A;  2RRU A;  3PVS A;  1MX0 A;  1JR3 A;  5DYI A;  3GLH B;  3HKP A;  4L78 A;  3UK6 A;  4P17 A;  2BJW A;  4HLQ A;  4ZPX A;  5GKN A;  4XK8 F;  2L4E A;  5EXP A;  3AOG A;  2VQF M;  5BPV A;  1WHC A;  3B7N A;  4NXN M;  4F1I A;  3VKH A;  2JP7 A;  3I4V A;  4GKK M;  1K3W A;  1PGY A;  3KOZ E;  5FLX S;  4DV2 M;  1IN6 A;  3WHL A;  2C9O A;  2FOI C;  4LJ4 A;  1XC8 A;  1TDZ A;  4LZJ A;  1E9R A;  1WR1 B;  1JR3 D;  4IBI A;  3ZC7 B;  1EFU B;  2LH0 A;  3E21 A;  2K0B X;  4REZ A;  4PDG A;  5KQD A;  2EJS A;  2X8A A;  2LBC A;  2KEB A;  2LWX A;  4LFB M;  1VEG A;  2R0I A;  3RE8 A;  3I04 M;  2F4V M;  1PJS A;  1QDT A;  3SMS A;  2HAK A;  2DKL A;  2KRK A;  2B3T A;  2F5N A;  1NV8 A;  2O25 A;  1QUS A;  1N32 M;  1IN5 A;  1VG5 A;  3HJS A;  3FTC A;  3NBX X;  3CTW B;  4G3O A;  1W5T A;  4GRI A;  3A46 A;  3J2P B;  2L6O A;  1J7K A;  3ILK A;  3TWM A;  3LCV B;  1VQ1 A;  1GKI A;  3U6Q A;  1J5E M;  5DYG A;  1AIP C;  4AW4 A;  2JY6 B;  2MJ5 B;  2QPA A;  4R7G A;  1ZQ9 A;  1IN4 A;  1NV9 A;  4JI0 M;  1QQW A;  4LFC M;  2DAM A;  1PJT A;  4M9Z A;  2XH9 A;  3IG5 A;  2DWL A;  3I01 M;  3SMP A;  1L2C A;  2F5S A;  4DV4 M;  3RGP A;  4AKH A;  5EXT A;  1OJL A;  3FUW A;  4MB7 A;  3SAV A;  1PJQ A;  1GVN A;  2HL7 A;  5KQ8 A;  2G3Q A;  2HWJ A;  3T1H M;  2CHQ A;  1IBL M;  4LG2 A;  1EE8 A;  5DNY A;  1WIV A;  4NC6 A;  4RF0 A;  2VII A;  4IBF A;  3BXW A;  4NL4 H;  1SXJ E;  4PCZ A;  4IBB A;  4DV1 M;  1F4I A;  1W5S A;  1MN3 A;  2ZTC A;  2QZ4 A;  3GQ4 A;  4GHA A;  3H4M A;  4OVZ B;  3MHV C;  2NQ8 C;  3HHW A;  3M6A A;  2QQ8 A;  3E9S A;  1CUK A;  3UMM A;  1QVR A;  4G4R A;  2V1U A;  4L8R C;  1JB0 F;  2ZAO A;  4KOD A;  2QBY B;  2P5T A;  2DI0 A;  1SXJ C;  3AJI B;  3IHP A;  4DV3 M;  3Q8X A;  3QYE A;  2QCU A;  2Y0T A;  1IBM M;  5JI2 E;  1PRB A;  4DR2 M;  4DUY M;  2CUZ A;  3THG A;  4JYA M;  3BOS A;  2JUJ A;  2LVQ D;  4X64 M;  3D8L A;  1HQY E;  4B3M M;  1OTR A;  2Y0Q A;  3HHY A;  3U6D A;  2MR9 A;  3GPY A;  3KP1 E;  4AKI A;  2QEN A;  2K47 A;  4FCW A;  2XLJ A;  5ITT A;  1Y8G A;  5EQT A;  4MGH A;  4WP2 A;  3LMM A;  3D8B A;  3AV0 A;  4IIW A;  4QNR A;  4IBC A;  1XWI A;  3FRI A;  1DGG A;  3HX3 A;  2M60 A;  4IBE A;  5EJC A;  1N77 A;  4BBA A;  4RF1 A;  3HZJ A;  2CP8 A;  3J7B A;  3GLG B;  3K1J A;  1IY2 A;  3PFI A;  5EP2 A;  1XHB A;  2DWM A;  2DNA A;  1XMQ M;  1GJS A;  3FUX A;  4KO8 A;  4PD2 A;  3C58 A;  1QAN A;  1NHW C;  2R6F A;  2AHM A;  2KDL A;  3DFZ A;  5EXS A;  2R4E A;  3RFW A;  4CHT B;  3U6S A;  1HNW M;  4YHH M;  3FUT A;  1JQJ C;  2RGH A;  3B9P A;  3U6E A;  2XF3 A;  2KW0 A;  3UZU A;  2ERC A;  1VEK A;  3GLF B;  2R46 A;  3CF6 E;  2F5O A;  2N35 A;  3J7A S;  2J7O A;  2MGW A;  1DGH B;  1D0M A;  4IJF A;  3VK7 A;  3FTD A;  1R5L A;  2BWE A;  1NVM A;  1YUB A;  4IBG A;  2JA2 A;  3F92 A;  2VQE M;  4B7H A;  2ZAM A;  3PNV A;  2CE7 A;  3J80 S;  3R8F A;  4KLN A;  4X62 M;  2XZF A;  4L16 A;  1UM8 A;  3VDP A;  2FH0 A;  5L8R F;  5C1B A;  4I8O A;  3GPP A;  2OQ4 A;  3SFZ A;  1XXH A;  2EUC A;  1E32 A;  1QZE A;  3SHG B;  2E5L M;  3A98 B;  1TH2 A;  4FVM A;  2H1R A;  3U60 A;  2M5Z A;  4LCB A;  1NJG A;  2RGO A;  2LNH C;  4AG6 A;  4G6Z A;  3V76 A; 
#chains in the Genus database with same CATH homology
 3LCV B;  1VQ1 A;  1IXS A;  3IEC A;  1AIP C;  2JY6 B;  2MJ5 B;  1NV9 A;  1DO0 A;  2DAM A;  1R4G A;  3K9P A;  3E46 A;  3GLG E;  1BVS A;  2LVP C;  2DAG A;  2EKK A;  3GLI E;  2LVA A;  1ZV1 A;  2LVO C;  2JZ0 A;  3FE3 A;  1OAI A;  1T43 A;  1G41 A;  1YLA A;  2LTU A;  1E94 E;  1ZMW A;  2OOB A;  3GLH E;  1XB2 B;  1WJ7 A;  2BWB A;  2G3Q A;  2HWJ A;  2JNH A;  1HT2 E;  1SG9 A;  2DHY A;  1GO5 A;  1KYI A;  1A5T A;  1WIV A;  2DAK A;  1F4I A;  1MN3 A;  2ZTC A;  3GLF E;  2QNJ A;  1IFY A;  1G3I A;  1CUK A;  4UN2 B;  1UFZ A;  1IM2 A;  2JZ1 A;  3LCU A;  2DI0 A;  2OOA A;  2LVN C;  3B89 A;  3IHP A;  2JY5 A;  4Q7J A;  1DO2 A;  1TTE A;  5JI2 E;  2WZJ A;  2ZTD A;  3MMP A;  1DV0 A;  2JUJ A;  2L4F A;  2LVQ D;  1HQY E;  1OTR A;  2MR9 A;  2QHO B;  1VEJ A;  1Q02 A;  2JY8 A;  2L2D A;  2K9D A;  4R71 A;  1Y8G A;  4DBG B;  4WP2 A;  2KNV A;  2H5X A;  2QSF X;  1JR3 E;  1V92 A;  1HJP A;  2OO9 A;  3FRI A;  1P3Q Q;  2CP8 A;  5DFL A;  1ZMV A;  2KNA A;  4HEO A;  2DAI A;  1WGL A;  2DEN A;  3FRH A;  2DNA A;  2KHH A;  2EKF A;  3T6P A;  2JY7 A;  2RRU A;  1VDL A;  4F2L A;  1WGN A;  3H4J A;  3K9O A;  1OQY A;  2L4E A;  1TR8 A;  1WHC A;  4F1I A;  2JP7 A;  1VEK A;  1PGY A;  3BBZ A;  1C7Y A;  1XXH E;  2MGW A;  1WR1 B;  1ZMU A;  2BWE A;  1EFU B;  3E21 A;  2K0B X;  2EJS A;  4GEW A;  2CWB A;  2LBC A;  3F92 A;  2DAE A;  1VEG A;  2R0I A;  2HAK A;  1OKS A;  2KNZ A;  2DKL A;  2B3T A;  2MRO B;  1NV8 A;  2O25 A;  1QZE A;  1VG5 A;  1G4A E;  4G3O A;  2DZL A;  1T6O A;  1HT1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...