4LJAA

Clpb nbd2 r621q from t. thermophilus in complex with amppcp and guanidinium chloride
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
321
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 109
structure length 321
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ljaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ljaA01
3KXLA 4V0ME 3BFVA 3UIEA 1CR4A 5TV2A 4PPGA 3LFUA 2WJGA 4LI0A 4MRSA 3WRYC 2QMOA 4TYQA 2G83A 1HV8A 5FL3A 1V5WA 1E0JA 2B21A 3OHMA 2FSGA 3LBIA 1E9BA 2JLRA 3QQ5A 1M2OB 4AYXA 4TZ6A 3M0EA 4PHTA 5TDHA 1DPFA 1E9FA 4QGGA 3I5XA 1GM5A 2J0UB 1AA9A 3GJ8A 3HU3A 1R2QA 3HPQA 3O47A 1QZXA 5TXGA 4DVGA 3LDAA 2YWGA 2B92A 2ZROA 3AGQA 1G21E 2W00A 4DLZA 1ZAKA 1P60A 1UADA 1E2GA 4FIDA 4CZ2A 1JJVA 1FP7A 2RHDA 1ZNYA 5FOTA 2EWWA 3B8HA 3PEWA 1FPMA 1S3GA 1XFAA 3OIWA 4JMPA 1P2TA 1XCMA 3QVUA 1WF3A 1N0UA 3QKUA 4LRWA 1ZD1A 1MABB 3R8FA 5GJCA 2AK3A 3GLGB 2Z0MA 5KSOA 1R8SA 2VHJA 4DLVA 1RRCA 5DO9A 4BFWA 3B1YA 3GLHE 3JZAA 2J87A 2QM7A 5A5GA 1JPNA 3P4YA 4DUGD 5CB6A 2R65A 1R7RA 1SHKA 3IGFA 2GETA 1IONA 2JAQA 4LDJA 4PO1A 3NDPA 5KSZA 5EE5B 5EXPA 1W36D 3RYTC 2FSFA 1ODFA 4QHTA 1PLKA 4DDUA 2CL0X 1N5LA 5CM8B 1AQUA 1EX7A 1LF0A 4HZUA 2H8KA 3KUDA 5C4GB 5C4MA 5JJIA 4CDGA 4DLSA 1SGWA 3MAAC 3QXCA 4TMVA 2J59A 4GFDA 2AKAB 1SKQA 1ZC3A 1VMAA 4GOKA 3ASYA 4QHYA 3WHLA 2QBYB 1ZNWA 3CZPA 4FI3C 2QT1A 4XJXA 1EFRA 3WNDA 4B71A 2ZRAA 3ND9A 4KFUA 3U44A 3KJHA 2ZS7A 1SQ5A 4BEJA 2GEVA 3OAAD 5CYOA 1W48A 1TX4B 4NYMQ 3UMFA 1GSIA 1G6OA 1ZCBA 3CUEF 4D81A 4CYMA 3BERA 5TB5A 4IJMA 3AF4A 2ZYWX 5EE0A 3FE2A 5C46F 5ANRB 3K53A 1Z0JA 4HB4A 3E1SA 2YYZA 1SVKA 3CH5A 4IFEA 1WBBA 3DMNA 5DI9A 1T5LA 1EWQA 1R5BA 3L0IB 3B9PA 2ORWA 3OEED 2GKSA 3EZ2A 2G9NA 4OHXA 3U4QA 1JXOA 1DOAA 1KK0A 2QSZA 2EFGA 4J0QA 4Q1AA 3RABA 2PZFA 4DEYA 2R6CA 2C2HA 3BH6A 5F3WB 4LBYA 2EW1A 4HSEA 4M21A 5FPTA 4YC7A 1LB1B 1KHTA 4C0QC 2A5FA 4Q9IA 4MDEA 2OFXA 4JJZA 4LBZA 1QHHA 3CR7A 1NBMD 2HXYA 2QMUA 4TTQA 2R62A 1G5RA 1E2PA 2A5YB 2XXAB 2O0JA 4PO8A 4KO8A 1D6JA 1K8RA 2F1JA 2VO1A 3BC1A 4TQAA 1XZQA 1VYTA 1KI1A 4FWIB 2CLCX 1S3SA 4OYHA 5DHFA 2GCNA 3VNVA 2ERXA 4LC1A 1ZIOA 2ONKA 4ILEA 1IJEA 3EZ9A 2Q9AA 2RGBA 4HZUB 4A92A 2O8BA 3WMFA 3S1AB 1CJMA 5A0FA 1WA5A 3ADDA 4RCYA 1FQKA 1GNRA 4ZIRB 3ICEA 3LH5A 2PEZA 4YQFA 2WVJA 1OH6A 2Y8EA 3MRSA 1SVMA 2NQ2C 1DAHA 2WSSA 5BW8A 1KI3A 1G18A 3VLFB 5BN5A 1JQLB 4LHYA 1LW7A 2W83A 4AYWA 1Q3TA 2HJGA 1HURA 1IBRA 2ZANA 1W0JA 4G5RA 5GJWC 1G1MA 1CTQA 1KOFA 1QHXA 3F0TA 3IHWA 1XMJA 4II7A 3D3QA 3ZQ6A 4BFVA 2EU8A 1NN3A 4HAYA 1II8A 5H68A 4B3CA 1KSHA 1P61B 3ECCA 3UG7A 4X8HA 1DADA 4NHOA 5BWMA 4Q66C 4D4JA 1ZU5A 1JPJA 4Q7JB 5F2EA 1GTVA 3U6BA 5EQTA 2E1RA 3TUJC 3AP2A 4O3MA 4C9BA 1A7JA 1DBSA 1W49A 2N46A 3KL4A 4IXMA 5CIQA 4ARZB 4UNNA 3CB4A 3VKWA 3DEFA 4BZPA 2VIIA 4CW7A 2QMHA 1Q0UA 4Q5IA 2ATVA 2L0XA 1IOZA 4AKIA 2P2LA 2HUPA 2ZPTX 1FQJA 3F5FA 4CF7A 1NP6A 1U9IA 1MT0A 1DO0A 1P5ZB 3AB3A 1CU1A 4B3DA 4RZ2A 3SJAA 2RGNC 1Q57A 3LW8A 2G88A 5JCZA 3KX2A 3AP3A 1KY3A 5KDLA 2WWWA 4FMDB 4M2LA 5F9HA 4MKFA 3ZS8A 4AKGA 1XB2A 4Q1EA 4S2EA 3WYFA 4O2LA 3IO5A 4QHSA 5B64A 1SVSA 1DAEA 2MMGA 4OI4A 2QRZA 2WOJA 3CNLA 3TVTA 1OPXA 1R0ZA 2BBTA 5AJWA 1XZPA 1GOTA 2ERYA 4TL8A 2AWNA 1Z0FA 3A8TA 3CX6A 5LB2A 1VPLA 1H8ED 3TQFA 4LJ6A 3Q5DA 5EP1A 2AHOA 2SHKA 3O8CA 1CLUA 5KTYA 3Q3JB 5FTNA 4W5JA 4X8MA 2NZ8A 1MRSA 1E9RA 1GVNB 1CJUC 1XX6A 4ON9A 2BJWA 2RKOA 1NVVR 3VNUA 2H57A 1ZVQA 3EA0A 5EUQB 1SXJD 2H5EA 1ZM3A 3I92A 3IILA 2QP4A 5GJVC 3ADCA 4GZMA 2ZRFA 4M1YA 2WZQA 4PTLA 1J70A 2C77A 5BQ5A 3T12A 3N5CA 4YMWA 3IBGA 1X6VA 4JBXA 5IK2A 1QHHB 3T61A 4NL4H 5HCIA 2FFAA 2P6RA 1KMQA 3U3RA 4RD2A 3I8SA 2WJJA 3KXKA 4RKFA 3RS3A 3IDQA 4KBGA 2WJHA 4Q1CA 4HYYA 2VF7A 2ZSAA 1OHHA 4BLQA 1Z28A 2H16A 4XVUA 1Z6XA 3WBJA 2DWQA 3U3JA 3SS8A 1AS2A 5K8LA 4JLVA 1HY3A 3RRZA 2OESA 3TRFA 2O0KA 1G7SA 1W2HA 4OQMA 4QM7A 2RGNA 3THOA 5J4HA 2J7PA 4RFSB 1S96A 2UVQA 3QVVA 5JLJA 4RY2A 2XTMA 4Q9JA 4U00A 4RFVA 1GKIA 2ZRDA 2KI5A 2D62A 1YZGA 2IX3A 4WZ6A 2Z4RA 4JVMA 3NTUA 4DB2A 1CF4A 4B32A 2PX0A 2KB0A 3CZQA 1E32A 4WW0A 1ZINA 2CJWA 4JKYA 3REGA 4TZ0A 4C0BA 2XEXA 1EG7A 4B47A 3THXB 3FHTA 2GK7A 3ZIAA 4QM6A 1RRFA 1P2SA 3NG1A 2VHUA 4BFSA 4JL8A 1ZBDA 4YDHB 2R8RA 1V43A 1XCPA 2KSQA 4OQXA 1E2IA 4DCUA 1Q1ZA 2F9LA 4BWYA 2F6RA 1JEEA 5HKKA 4DLYA 4BLTA 3AVOA 1RPZA 4C30A 3DHWC 2VPPA 1XWIA 2I1VB 2RGAA 3VR1A 4BGDA 1RFLA 2YHSA 3SHWA 2EFHB 3FHCB 4TWZA 4URVR 3E5HA 1Z0AA 3GFTA 2DFLA 1GL7A 1U99A 3UWOA 2ORVA 3Q85A 1E0KA 2VP4A 4CVNA 4XSGA 2OE2A 4DSOA 2F43A 2DVWB 2V9PA 3EWAA 1P7CA 1NG9A 1N6NA 5IT5A 1ZM9A 5FR1A 2PT5A 2GCOB 1ZP6A 3L8ZA 3L82B 3TMKA 1TU4A 1U8AA 4HLQB 4Q4JA 4LZZA 2VP6A 3ZZUA 2EFCB 2ZR0A 1NJGA 2I1QA 1W1WA 3SFVA 3QY0A 4X8OA 1NF3A 3AUYA 2AK2A 2B7BA 2KRKA 3AKEA 5JHGB 2XITA 2ZUBA 1GIAA 3FKSD 3ZD7A 4IEEA 2IF0A 4TL6A 4WZBE 4BFTA 1KKMA 2RGDA 5AJZA 2P6NA 3CF2A 1LY1A 1XTKA 4KFTA 3R20A 2GZHA 3UMSA 2XGJA 2WAYA 4M1OA 3TNFA 5AK0A 2JLWA 5AJXA 1ZW6A 1CR1A 1H8HD 5HE9A 3EASA 1G7CA 3PR1A 4M1WA 5TY0A 4F91B 2NO7A 5CIWA 5JI2E 2YWFA 5DYIA 1JQJC 3LRPA 1Z07A 4BPBA 1E1QA 3VHLB 4B33A 3U7GA 2XZLA 1NL3A 4W9MC 3H86A 3SDZA 4YMVA 3GLGA 2VQSA 1T0JB 4L16A 3DZDA 2CE7A 1FNNA 3AQ4A 2BBWA 2NGRA 2QG6A 2W2TA 1NG1A 3OESA 4GNKA 4BRUA 3QKRB 2P6UA 4GPTA 2JLQA 4HAWA 5DNYB 2R6FA 3EC2A 3E2IA 3P26A 4MGKR 2O8DA 4PO9A 3A58B 1GUAA 2OV2A 3B85A 1AZTA 3W5JA 3KQUA 1NRJB 4ZDKA 3NC1C 3SC3A 2JJ2D 3VR4A 3IPYA 2F9MA 2IYRA 5HE8A 5KDDA 2VH5R 1UFQA 1F3OA 5FL7D 5KNCA 1KO1A 4A2QA 4EUNA 3THWB 1KKLA 1NSTA 2ZRPA 4S35A 5KUTA 1NVUQ 5FI0B 5IHPA 4OI2A 3BORA 2GJAA 1Z6GA 4M22A 3THYA 1Y63A 4W7SA 1LVGA 3LAWA 3GFOA 2ASEA 5FOXA 1L7VC 1MO5A 4LYAA 4TMTA 2C99A 4BFUA 4UNRA 2GAAA 1JAHA 1E3MA 4DDTA 1R0XA 3IBYA 1NN1A 1R10A 1DS6A 5EP2A 4KCGA 5EUMA 1QG2A 3PEVA 2CHVA 1OYWA 5EZ6B 2VTKA 4AG5A 3AVWA 3CF0A 2D06A 3MJHA 4XTRA 1XPRA 3DZ8A 5EXXA 4F4CA 1E4YA 3KZ1E 5KYKA 4AKHA 1S1CA 2PCJA 2W0MA 3LBHA 2AXNA 4B44A 4UNQA 2CMKA 3OIVA 2CK3A 4YMUA 2J0QA 2CLDX 3KJIA 4GP6A 5CJPA 2IEYA 2OAQ1 1UEIA 3QJYA 4QJ5A 5E95A 4DLXA 1FUKA 3FFAA 3GQBA 1S9HA 2O8EA 2ZRMA 3SYKA 3Q8XB 1KK2A 4I99A 3CR8A 4IVRA 5CK4A 2VL7A 3OEHD 4EPTA 1CXZA 4LJ5A 1OFUX 2JJ8A 2NO6A 4OL0A 4UXIA 4IFBA 4QBIA 3SBEA 5DLQC 1GWNA 4ERNA 4R9UC 5JECA 4LRTA 1RRPA 2FPLA 2GCOA 1RKBA 1ZYUA 2B7CA 1FOEB 4PHGA 4PR0A 3ETLA 4P33A 1HUQA 3SYNA 1P2VA 3IIMA 1X37A 1E2HA 5AR1A 1NKTA 1L8QA 3AJIB 4DDVA 2HCJB 2AX4A 3PENA 1N5JA 2Q9CA 3AKDA 2XTNA 4WAUA 1TQ6A 2JLUA 2ZJBA 2ZI3A 5DN6D 4MYHA 1KAOA 1T3HA 4B2LA 1VDZA 2ZQ5A 3EARA 1FX0B 3RWMB 3T1TA 8OHMA 4FCWA 1VTKA 3P20A 4TYNA 4BECA 3ZD6A 1UKEA 4C0KA 1TADA 3PCRB 3VR2A 4IOJA 4JN6A 2QGNA 2O8CA 1KI9A 3WY9A 2QN6A 1BYIA 1W36C 2ZITA 3OFNA 2W6JD 1US8A 1OKKD 3MD0A 4IOMA 3U44B 2OUKA 1D5CA 1JXMA 5LDDC 1ONBA 5F9FA 1PUJA 1S4QA 2QPAA 1WDTA 1Z83A 3TUIC 3B13B 4R2IA 1Z22A 4NCKA 2PEYA 2ZI9A 4LYFA 4PC1A 3SR0A 2IYXA 3SN6A 2KE5A 4OHWA 2CNWD 3BK7A 4US0R 2YOFA 4PZYA 5E3HA 1KY2A 3GJ6A 4DCVA 4DT1A 4EQ6A 1UJ2A 2GXUA 3UATA 1VCOA 3TSWA 5FBQB 3LLUA 3HU1A 2ZTSA 1QHSA 4L4UA 1J99A 3T5GA 1NMXA 5L3VA 3CNOA 3EA5A 3FB4A 4I1OA 4CIDA 5DN6A 4ZDJA 2FFQA 4AG6A 1KJYA 1FUUA 1JR6A 1NKSA 3C4JA 1KSGA 2JJ1D 2Q3HA 2IUTA 2JJ1A 1JI0A 1G6HA 1YR6A 4NCHA 5JJKA 4KSBA 2XZOA 3PIRA 4ZCMA 3R7WA 4NYIQ 4Q4AA 3L43A 3R8CA 2PLFA 1OJLA 1GZSA 4Z1MA 4BE7B 1OIVA 1LTQA 1S8FA 3FVQA 2RGXA 2G1JA 3I1FA 1G8HA 1UPTA 4NE2A 3N70A 4URXR 4B6EA 4O25A 2NZJA 4URUR 2GXAA 3KTAB 3BOSA 4R98A 3UWKA 1Z08A 2QPOA 3THXA 2ZUCA 4A4DA 1GG2A 1NY6A 3X1DA 3IIKA 1E6CA 3NVAA 5KU1A 1AS3A 2WSSD 4AYTA 2OFOA 4FN5A 2J46A 4C2UA 1O87A 2CCKA 3NEYA 4NZYA 2NG1A 1G20E 1JAIA 4W5HA 3W3ZB 4PPQA 1EESA 1U9IC 3DMDA 1QF9A 2R2AA 1T4GA 4JS0A 5KSYA 3TR0A 1E9SA 1KTVA 2IEZA 2WWIA 4HLUC 3BRWD 4NONA 4ZCLA 3ZVMA 5JSZA 1F2UB 4GSYA 1F48A 3GLHA 3I4LA 3PUYA 1EX6A 4EPXA 4FMCF 4DIEA 4XD7A 3ZJYA 2J3EA 4LV5B 3FOZA 4RZUA 1SXJE 2DB3A 4R7ZA 1GILA 1TPZA 3CPHA 1Z2AA 4H1UA 3U7EB 3MWLA 2YOGA 3LLMA 2ZJAA 1N6RA 4C0SA 3C14C 3CO5A 4LHZA 2R9VA 2NO9A 4TQ9A 5SZHB 5TARA 1YZKA 4QJ3A 1KGDA 4TL9A 4M9SA 4DLWA 2GK6A 1VIYA 4FWGA 2W2XA 4A8JB 3G5UA 3ICQB 5C1BA 3G0HA 5KNBA 2B8TA 4DLRA 1IY2A 4YDSA 5HZHA 221PA 2V4ZA 4P4SB 4A9AA 1I2DA 1M1YE 1C9KA 1XDBA 1DAKA 2F1IA 3BIFA 4WZAE 2PLRA 2JLZA 2KWIA 3B2EA 3WP1B 2X2EA 4JKIA 2QNRA 3SBDA 3RS4A 3U4QB 1BMFA 1U8YA 3AF2A 4PAMA 2WJYA 2I4IA 1G3IA 2V1UA 3Q5EA 1GRNA 3ZS9A 2QAGA 1MR3F 4UXJA 1E94E 2G0NA 3DO6A 3K0CA 4RZXA 2OXCA 4RCZA 2ZJ5A 3W8NA 3QBTA 5JWOA 1E79D 2XOKD 1IHUA 1TNDA 4TLDA 3B78A 2FGJA 2P5TB 3H84A 4XWKA 4XVRA 3UG6A 5JBQA 1H65A 3BH7A 1ZCAA 5DE3A 1GP2A 4HLCA 2AKYA 3F8TA 1FP6A 1I2MA 2P67A 4DB4A 2WWYA 1X8LA 1TUEA 4Q9LA 2OXRA 4QXAA 4D4MA 4DT1B 1VCIA 1WXQA 3AVUA 4CEJB 1T91A 2QROA 3WMEA 4JLJA 3LD9A 3C15C 3K70B 3UPUA 5EP3A 1UBFA 3EZ6A 3R9XA 1B23P 4TMXA 3U3KA 4B48A 2O8CB 5KPDA 4D82A 1X86B 1D9XA 1P62B 3ZDQA 2IYSA 2VSOA 1N5IA 2CL7X 3RS7A 4EJSB 1AS0A 4I4LA 2GJ9A 2IYVA 4KHZA 4MA4A 3R9IA 1ZM7A 1CS4C 4F93B 1D2MA 2IC5A 1YJ5A 2QZ4A 1RRGA 1Z3IX 2ECKA 5BXQC 1KNQA 1U0LA 2EVWX 3CKLA 4HAXA 4GL2A 2HLDA 3TLXA 4F7WA 2IYYA 3FMPB 4V0OA 2I3BA 2C9YA 4Y0AA 3H4MA 4P3YA 4EFMA 1F60A 4C2TA 1L2TA 3CNNA 4FXPA 1DO2A 1J8MF 4M9QA 1NIJA 2JIZD 3AVPA 3WYGA 5H1YA 3A1VA 3RRNA 2PH1A 4HEJA 2J0SA 3GEHA 3PUWA 2YWEA 2XNSA 4V0MA 5JZVA 5JWRA 3LXXA 3BWDD 4NH0A 1XU4A 1W44A 4A1FA 5FUXA 2Q3FA 2XZPA 3CIOA 5BYJA 2HJVA 3CPEA 3QXSA 1N0VC 2IS4A 2ATXA 2QU8A 1X8JA 2BM0A 4ASUD 1JJ7A 4RD0A 2IW3A 1FMJA 3EWSA 1TU3A 2UZIR 1SXJB 2MSDB 2BJVA 4MUBA 1ELOA 2ZU0C 3BD9A 3OEHA 3VHXA 4ESVA 2WOOA 4O0MA 3PV0A 4HLDA 3W6OA 4PQFA 4X8LA 2OBMA 1EWRA 2JEOA 1A82A 4IKEA 4PC3A 1T0HB 1UEJA 3B60A 2PZEA 3LY5A 1SZPA 2DYKA 4XVQA 4DSNA 2NO0A 5CDFA 2CBZA 2ZRCA 4DZZA 4C0HA 3NHAA 3KQNA 1AIPA 2J7PD 2IXFA 3VKGA 1XD9A 1M34E 2A2ZA 2NOAA 4P31A 2HF9A 2LCFA 4AKEA 4HI0E 3T1OA 4HAVA 4BEBA 2LWIA 1TL7C 1OFTA 521PA 2F3RA 3T1VA 5JEEA 2QQ0A 3U7FB 4RJLA 5GVSA 2JLXA 2QENA 3WRXC 1II9A 2HYDA 3KW6A 3PITA 4A82A 2VRWA 3W9YA 4A8JC 3B6EA 2OBLA 2X1VA 3QI2A 4OK3A 4B3XA 4G0NA 2F1HA 2BM1A 3MFYA 5KDOA 1ZD9A 2GJSA 4PHFA 3ZVLA 3EC1A 3D7MA 1MABA 2WKQA 3K09C 1KYIA 4OI0A 2BMFA 1DAGA 1J8YF 5DGXA 5P21A 3V4RA 5KSPA 1IY1A 2CEAA 3SQXA 4M0LA 1OXTA 3AVVA 3I8XA 4G1UC 4BFXA 2GHIA 4QGHA 2A5DA 4TLCA 1RC8A 4URWR 1GAJA 3TGPA 3GLGE 4LJ7A 3FWYA 3MGCA 4YONB 1KI6B 4AK9A 2GNOA 4DUGA 3MLEA 2D7CA 3RC3A 5EP4A 4D0LB 1KNXA 3DM9B 4QKQA 2GVZC 2FA9A 3I5YA 1TQ2A 1Z47A 1EGAA 1M74A 3B1VA 4UJ5A 4XOIA 1SKYB 1D9ZA 3VKHA 2FMXA 4RD3A 3BS4A 3B1XA 2BCGY 1QVAA 1P3JA 4Q1BA 1P6XA 5G41A 4EPYA 4OHYA 1Z5ZA 3K0EA 2GEDA 2QP9X 2GILA 3GJ0A 4PHHA 3P27A 4LBVA 3FMIA 2GXSA 4IDQA 2HCBA 2QY9A 2RAPA 4NYJR 1ESMA 4B3GA 5IK2D 4WOPA 4D2IA 1ZU4A 4QOSA 1NVVQ 4JVSB 1G8FA 2BMEA 3BAFA 3TSZA 1BMFD 2F55A 1KO7A 5A4JA 3K9LA 3UANA 2QT0A 2LKDA 4JBYA 3LW7A 2J41A 2A3RA 4G01B 3GD7A 1X1RA 3QXJA 4CEHB 1I4LD 2HDNB 5SZJA 4V0KA 3FFBA 3FMOB 2RGCA 4V0LA 2ODBA 2A5JA 2VSXA 1KO4A 4LHXA 4ZI3A 5B2ZA 2F43B 4LPKA 3NHBA 1W7AA 2DWZB 2AFHE 3V00A 1A5TA 3J81k 2DFKB 1XTJA 1NNEA 5M04A 4POAA 4A36A 2DZOB 1UBGA 1E9DA 4MQBA 4KSCA 3X1XA 3R9WA 4JZKA 1E0AA 3RS5A 2EQBA 4B3BA 1KI2A 3QPWA 2ZE5A 3FGNA 2CLSA 3TJZA 2OLKA 1RYHA 3VTKA 4NYMR 3THYB 3DDCA 2CHGA 3A37A 3CLVA 1P9WA 4DCTA 1GRQA 3B9QA 4PANA 5AUNB 3KQKA 1U90A 4DLTA 1N25A 1N0WA 3F3YA 1YRAA 3NKVA 3EIHA 4A15A 2YC2C 4DRZA 2VLIA 4ZIRA 4WXRA 5G3YA 1W36B 4TL7A 2PX3A 2ZEJA 3QXXA 2QBYA 3MWYW 4RFSA 5J5CA 3TW8B 4UQOA 3WYAA 1NN0A 2IBMA 4JLPA 4M1KA 3GLFE 4MRVA 1TF7A 5DIFA 3QE0A 1G5PA 1U0JA 4HDCA 4Q1DA 2FWRA 1R0YA 2V54A 1HQYE 2O52A 1QRAA 2IS1A 3HPRA 3VR6A 1OIWA 1WQ1R 3UXMA 2FEMA 3KKNA 1YE8A 2IYQA 1MV5A 4F4JA 1IN7A 2YKGA 5J47A 2Q6TA 4F92B 5L8VA 2MMCA 1VG8A 2V6JA 2FDCA 2FSIA 4KXFB 3IQWA 2WJIA 2OEPA 2WWXA 4IRUB 1QVRA 5FBVB 3D6TB 3NBZC 3GJ5A 1E9AA 3BJIC 4DC9A 4B75A 1E99A 1G8PA 2V3CC 2HT1A 4I81A 3IHLA 2ZVPX 2GJ8A 3T35A 4PSKA 2AN9A 1OXSC 1XNJA 1G3RA 1MKYA 1DG3A 1AGPA 3U60B 1GKUB 1YU9A 4KU4A 4NP6A 3U6KA 3RS2A 4CGZA 4L9WA 5EE3A 1M8PA 4JYCA 4A6PA 3X2SA 3U3MA 2AR7A 1LFDB 1OIXA 2QORA 4MITA 4OQFA 1XXHB 5B58C 3K1JA 2YC4C 3GJXC 4LV6A 2BVNA 2IYLD 4L5BA 2Q3MA 1ZMXA 2OZEA 1KDOA 2UZ3A 4RKEA 3TW4A 5EZ5A 4OI1A 3GP8A 2EFEB 2GXQA 1D2EA 4IDPA 3U3OA 2HT6A 2IA5A 3EW9A 3HWSA 1YZQA 2B8WA 1TAGA 2GBLA 2ZAMA 2J7KA 1HE8B 4B74A 1DVRA 1OF1A 3WBKA 2PJZA 1KDTA 5G40A 1C1KA 2O8FB 1QDEA 2FOLA 1KJZA 4PPNA 4Q4JB 1MRNA 2XJ4A 4Q4AB 4DXAA 1HYQA 1NY5A 3R7WB 2IF2A 5JS7A 2QAGB 2ZSBA 1J2JA 1AK2A 1OT3A 3A36A 3NXSA 5K8TA 3G82C 4PC6A 4BZXA 1P72A 3AV0B 1OV4A 3K0FA 1WP9A 1JBKA 4IDHA 4JLNA 1D8TA 1KAGA 4DEXA 4GZLA 1OXUA 3ZZ0A 2QAGC 2O8EB 1KMHB 3SOPA 4IVPA 5FI1B 4EIWA 4RD4A 1W5SA 4ZPXA 4F38A 1YKSA 4Q7MB 3W8RA 3KFVA 1EFHA 1W4RA 1Z0KA 1UDWA 5J4VA 5FBRB 2D4HA 3DL0A 3Q72A 3LXRA 4OHVA 5SZIA 3CONA 4U7DA 1P75A 1IN4A 1NMYA 3GLFB 3FHOA 3RANA 4MRRA 4P4UA 1COWD 4BQSA 1E2MA 5L3RA 1OHHD 4AURA 2E9SA 1PV4A 4EPRA 1Z6TA 2GDJA 2XAUA 4FINA 1A2BA 4JT4A 4Q18A 1IN8A 2HF8A 4NPHA 4XWOA 3PUZA 4KYUA 2V6IA 4Q4HA 3CW2A 3W34A 1IAQA 1OW3B 5KO2A 1W0KD 1I4DD 3I72A 4HB0A 1C4OA 2ZRLA 4O2RA 5J4KA 3FKSA 1F2TA 2C9OA 1FFHA 5FPHA 4E03A 1G3QA 3EZ7A 1JALA 1YHNA 2WM9B 4LJAA 2GESA 1ZUIA 2C04A 2BHRA 2P5SA 3NWJA 2ONJA 2P65A 2VHCA 3K9HA 4GBMA 3M1IA 1KSJA 1VECA 4D4KA 3GMTA 2P3SA 4L15A 4Q00A 2QI9C 2FN4A 2CCJA 2JDIA 4P4SA 1Q22A 4QGAA 1M7BA 4KAXA 1H8EA 1JEDA 2GBLC 4Q01A 1W46A 3SZRA 1OLOA 1G291 4QBHA 2ANCA 1TF5A 1L4YA 3KB2A 4N0DA 4TN1A 1DEKA 1X8KA 3NC0C 4W5WA 4Q1FA 5JHHB 2H7VA 1E98A 4A0RA 4G3XA 1NI3A 3CX8A 4MRNA 1G17A 1YQTA 2IYWA 4IDNA 2ZVQX 1G7TA 1XTRA 2O0HA 2PMDA 2NMVA 3VX3A 4KJZA 3B82A 3HDTA 2ZU6A 3K0AB 4Q4HB 3AF3A 5UKDA 2DHRA 4DJTA 1H8HA 2FGKA 2QGZA 3AP1A 1E9CA 5DYGA 2JGNA 2NIPA 3CWZA 3BB3A 4QFMA 4PAQA 4AY2A 1E1RA 5AUOB 1OB5A 4DSUA 4HATA 2JASA 4LJYA 3KJGA 4M1SA 1IQPA 421PA 1FL9A 2EWVA 4ZO4A 4B2PA 2NO1A 5FBLB 2BWJA 4HUTA 1IM2A 4OK5A 3T34A 2DCUA 1Q12A 1XJCA 4JLOA 1GKYA 2ZREA 3THWA 2HEIA 4E09A 3VU9B 2Z43A 2OLJA 2CNWA 4R2HA 1F2UA 1ZUNB 3SEAA 4RZ3A 3TH5A 3AM1A 2CXXA 4ACBA 1UAAA 1W0JD 2J1LA 1E69A 3VAAA 4JYBA 3MWJA 4C7OA 1E79A 4V03A 3KFXA 1E2EA 4AC9A 2A30A 1P2UA 3NBXX 1X1SA 4NCNA 3A4MA 2J5XA 4XH9B 1NJFA 4JT2A 4LOAA 3SHFA 1CIPA 3OF5A 1T6NA 3SJCA 4AI6A 4IOKA 4TT3D 1VCNA 3A4LA 2D3WA 3NH9A 4ABYA 4C3ZA 2WWHA 3PUVA 1IJFA 5JFGA 5FTLA 1KDPA 4H1VA 5B57C 4TMZA 3K8YA 1R5NA 2G0TA 3MMPA 4MH0R 4URZR 1FMLA 4N3NA 1QBKC 1CR0A 3QKSA 1N6PA 1VG0B 3Q7PA 2J0VA 1KK3A 3P4XA 3JVUA 3QG5A 1EK0A 1LS6A 2ZI4A 4GOJA 4M1MA 1E2NA 2QUZA 4KBFA 2PMKA 5H8WA 2BEJA 4JVLA 5LBIA 3I62A 3S1AA 5AJVB 4MYTA 1YVDA 1Q44A 3KKPA 3KJEA 1GDDA 2OO7A 1U94A 1GITA 3ZIAD 2X2FA 1G5TA 2V1XA 3U2QA 5ELXA 2ZRNA 1GL6A 5HZKA 2JJ2A 2DY1A 2FX3A 1W47A 2ZR7A 4C7OB 1BOFA 4D6PA 2WAXA 5DHAA 5DSZA 4LWZA 4A0FA 3P32A 4WXPA 2Z83A 4Z8XA 5G53C 1XCGB 1UM8A 2ZSEA 1J90A 4QBFA 3LO5A 2N42A 2BMDA 5JRZA 1SULA 1XXHA 1Z63A 3SNHA 2WPDA 3LNCA 5GVRA 4KLZA 4A2WA 2R6DA 1G3MA 3QKSB 2REBA 4QL3A 4WA7A 3WMGA 5L3SA 2PZGA 5KHOC 4C0JA 2XX3A 3KQHA 1OFIA 2WMNB 2FSHA 1P4SA 1YR7A 4OBEA 1L4UA 3RHFA 3WNCA 4ZI2A 3EIQA 1WB9A 3RLFA 1VYVA 4EJSA 4HB3A 2ZJYA 5FPKA 3GJ7A 1E2JA 1R8QA 2PT7A 1E96A 4WBSA 1YR8A 5FOUA 1K5DA 1VKJA 2NPIA 4K8OA 4FCTA 2AD5A 3M6AA 4FCVA 3SFZA 4M4SA 1NSFA 3IEUA 1XPUA 4G5GA 4M9XA 4QG7A 5AJYA 3K9NA 3BFKA 4DDWA 4JL5A 1FNMA 4PX9A 4DBLC 2JCSA 2K5UA 2OCYC 3KB1A 5E4FA 2IXEA 1CRPA 1JECA 4MYUA 3VR3A 3QIAA 2ZE7A 1BH2A 1ZNZA 3X1WA 2PJRA 4CT5A 5EXSA 5FL7A 4QRHA 4IW3B 4C4PA 3B7GA 3CWQA 4PAOA 3VU9A 3I73A 2QEQA 1QHIA 2DBYA 3AUXA 1MO6A 4B2IA 4TLEA 4EFLA 4XWAA 1VG9B 3ZGXA 5L3QA 2BMJA 5FUYA 1QHGA 2YNMA 1UKVY 4KFRA 1FZQA 5HR5A 2YINC 2CDNA 1E4VA 1UKZA 4FMDF 3TAUA 1SKYE 1ZIPA 4MGZR 1GFIA 3LA6A 1TTTA 1F5NA 1E1QD 3WHKA 1G4UR 2FJUA 3TIFA 5F98A 4PZZA 4XIGS 4ZKEA 1MO3A 1CEEA 2FE4A 3VFDA 1QHYA 2W6JA 5JJLA 1XXHE 5FBWB 4BLSA 3BH0A 4LK2A 2R44A 4B76A 4D0NA 1XEFA 4TLAA 4US1R 2VF8A 4CEHA 2DFTA 3LX5A 4ITRC 4YMSA 1HEIA 3UK6A 2FV8A 2IS6A 4PZLA 2EYUA 1YZLA 1D2NA 4GP7A 3QPUA 1TEXA 4B6FA 3LX8A 5L3QB 1IN5A 1SVOA 4DSTA 721PA 1G64A 4Y0VA 4FMBB 1II8B 4XTCS 5EXTA 1W4CA 1G8GA 2QA5A 2H18A 1CKEA 5CLQA 2XSZA 1CR2A 2X8AA 3PEUA 3GJ4A 3RRYA 2A7QA 4EPVA 4EJSC 2FPKA 3LBNA 1ZUHA 1CBUA 1EFCA 1GL9B 3PJRA 1Z8FA 3BFXA 1JNYA 2ORIA 3QPVA 4TTPA 2V55B 2VP0A 3QG1A 4Z54A 2C8VA 2GCPA 1MH1A 1DAMA 3K70C 3BGWA 1WE2A 2QE7D 3EXAA 3OAAA 3LV8A 1OH5A 2CK3D 1M6NA 1U8ZA 3AGPA 3DOFA 1S2MA 2XTZA 3PQCA 4OJQA 3I61A 1OH8A 2GWHA 4HAUA 1HA3A 4ACAA 2GEUA 2HLDD 4JJKA 2VHQA 3ZH9B 4ZCIA 4MGYR 2YV5A 1KDRA 2XXAA 3QUSA 3CX7A 1XMIA 2JLVA 2Q0HA 4RD1A 4HDOB 1Z29A 1AQYA 1ZNXA 3GEEA 3ONWA 4LC0A 1DAFA 3K0SA 2FG5A 1TF2A 1JR3E 4A0HA 2UKDA 2C5LA 1O3YA 4TMWA 3OIUA 4LHVA 1RJ9A 4IEIA 1QHNA 2WBLC 4UJ3A 4D0GA 3NBFA 4PQRA 1CRQA 2A9KA 3K0FB 3H1TA 4P0TA 5FUVA 4EFNA 5TMPA 2B6HA 4HDQB 2V8OA 3IEVA 1RW4A 4NKRA 3QKTA 1F6BA 3RRMA 4ARZA 2JA1A 1R4AA 4LX0A 3DOEA 2A78A 5AUPB 4LHWA 4EQ6B 3L0SA 1U0HC 4PFSA 1II0A 2REOA 3EPKA 2O8FA 3D8BA 1IXZA 2F7SA 2FPMA 3HJNA 4AWXA 1AGRA 1J7KA 2YJTD 2QMEA 4KYIB 1K5GA 1BO6A 2QAJA 2MSEB 1A1VA 1Q20A 4NDZA 3VX4A 4WVFA 2ZI6A 3TK1A 2PL3A 4GITA 1XEWY 3Q9LA 4DHEA 4K46A 1R6BX 2ZRHA 4HUQB 1G19A 1XBTA 5CB8A 1G9XA 3IPXA 2D74A 3SI7A 2WV9A 3DM5A 1Z6YA 5FPSA 3C8UA 4BASA 3ADBA 1SXJC 1Z6AA 3QBVA 3EG5A 3QOFA 1N2CE 4OKSA 2OCBA 4G5QA 2CCGA 3MUFA 2C9CA 1Q21A 1KK1A 4PSVA 1EXMA 2CVFA 2GTPA 5FR2A 4FWHA 2FH5B 3GCGA 3OE7A 3VQTA 1VIAA 5KOYA 1Y3AA 3A4NA 3CRVA 3TQCA 4M9ZA 3BE4A 3HR7A 3NEJA 2BC9A 2BDTA 3I3SR 4CT4B 3TVDA 1SHZA 4HLUA 1OSNA 5CLLA 4LSGA 1Q1QA 5FOWA 1KI7A 4TTRA 4A2PA 3NIBA 1T3LA 4LYHA 2G6BA 3LVQE 3PXGA 3KKMA 2ANBA 4Z8YA 4B34A 4TT3A 3IQXA 4U5XA 3AVYA 3C41J 1DG1G 1NIPA 5D3QA 5EE9A 4TYWA 3L0PA 1COWA 2ODNA 3I32A 1OXVA 5HCNA 4US2R 4A8JA 4OHZA 2DR3A 4CEJA 1JB1A 2OBNA 5FFMA 1SVWA 1XF9A 3W6NA 3CBQA 2AD1A 2IYZA 5HKKD 3UMRA 2JLSA 1E2QA 1HQCA 2RB4A 2WKRA 2FEOA 2XNDD 1B0UA 2QE7A 3MG9A 5L3SB 2OHFA 2GAOA 4H9GA 5D3MA 4M1TA 3RDPA 4DWJA 2J9RA 2NPFA 1EFTA 1NBMA 2ZJ8A 2WIAA 4TMKA 4PPFA 1N6LA 4AIIA 2FU5C 1XMVA 1W4BA 4HUQA 3AVTA 3GFPA 1XEXA 4MKIA 1N6IA 1ETUA 2C78A 4Z1MD 1LF5A 3IIJA 1E1RD 3K9GA 2QTVB 2YZ2A 4IOLA 5AUQA 3AVQA 1PLJA 3A1TA 4EDHA 2QL6A 1G8YA 4EKDA 4ZDIA 3IKJA 2GVDC 4ZKDA 5LD2C 1G7RA 5KPJA 3QKRA 2ZS8A 4PQYA 2DFNA 3FTQA 4GDFA 4OJKA 3TKLA 1HTWA 5D3MB 2DWOA 2XNDA 1KI6A 1S9DA 1XTIA 4TYYA 2AXPA 3MHVC 2VYFA 3O8BA 3AVXA 3ZVNA 3DKVA 3ZLJA 2ZI7A 2QP3A 2O8DB 1X3SA 1T8UA 2QPTA 2ZRBA 4Q7KA 4N0EA 2ZXUA 1UBEA 2H17A 3FPAA 3EIEA 2C03A 1T5IA 4C0AC 1JR3A 2G77B 1N5KA 3A1WA 2O5VA 1XJQA 4Q21A 4QGFA 4I1VA 2VBCA 2D2EA 3PEYA 1HE1C 1MOZA 2V6ZM 1GRRA 3GLIB 1T3SA 3CF6R 1CULC 5AWFC 2CL6X 1KO8A 1KMHA 3QF4A 3GLHB 1OKKA 2ZS9A 4IHQA 1XD2A 4M8NE 1M7HA 1QG4A 4BLPA 1IN6A 3VR5A 4Q48A 3RSLA 1T9HA 2J0UA 3EAQA 1WMSA 1Z0IA 4UKDA 4PC7A 4ZV4A 3C5CA 1RE0A 2XSZD 2DWPA 4KV9A 3NH6A 2QM8A 5G3ZA 4BRWA 1VHTA 4CEIA 3A1UA 2AWOA 1CJTC 2RH5A 3WNBA 2FFBA 2OCPA 4RVCA 1IXRC 2VSFA 1G16A 1N6OA 4N1AA 2W58A 4B73A 1ZM2A 4BUJA 1W4AA 3GEIA 3TBKA 4NBSA 2REXB 3AKCA 3OEEA 1BKDR 4QBGB 5CDFE 2VHTA 3CRW1 3DVLA 3QENA 2IUUA 3Q7QA 1ZC4A 1EFUA 4JL6A 1BYUA 4JLKA 1W0KA 4OQLA 1OXXK 3KKOA 2BIFA 3EZFA 1TUIA 2ZRJA 5B30A 4DKXA 3BB1A 1P73A 2ZE8A 4YMTA 2D7DA 1AJEA 1E0SA 2ZYTX 5BYKA 1XTQA 2XOKA 4DCNA 3KDSE 1XD2B 4JLDA 5JEDA 1NVXQ 3QF4B 4LJ8A 1KO5A 5C2JB 2Z4SA 3GLIA 5GADl 4LGMA 4G5OA 4ESHA 3PUXA 1XTSA 2WPDD 621PA 4NTZA 4CEIB 3B5JA 3RC8A 4QNRA 1BIFA 4D4LA 5LPNA 5J4LA 3L0OA 1G3UA 4L8GA 3MSXA 3RWOA 2CVHA 3ND8A 4K81B 5HTKA 2CE2X 2VP9A 1NVMA 3UKDA 2BBOA 1CJVC 1XJ0A 4A0GA 2OG2A 1FTNA 5E7MA 3E70C 1G41A 1QZMA 1DAIA 1VG1A 4JLBA 1W2GA 1FTSA 3SYLA 1ZD8A 4JSYA 3U7HB 4HZIA 1XPOA 5GJBA 4BLRA 2KBEA 2WICA 5JI3E 1NLYA 3WXMA 2H1LA 2A5GA 2DZNB 3FMFA 3T06B 3QNUA 3LQQA 1K6MA 2RGGA 1IXSB 3PG5A 1A2KC 1RVDA 3VMFA 1KIMA 1US8B 2BOVA 3OE7D 4Q9KA 4MKHA 5JRJA 3NDBB 4QC2A 2OSBA 1TMKA 3U5ZB 1RYFA 2YOHA 4RD6A 3TUZC 4U02A 4UNSA 2ZRIA 4I1UA 5K8UA 2VA8A 3SE0A 1R5OA 5KNDA 2ZUDA 1NVWQ 3BBPA 4DLUA 5JCPA 4JLMA 1T8TA 2HYIC 3KKQA 4NU0A 3O8RA 1FX0A 4LBWA 1MO4A 4EPWA 2VP2A 5K8IA 4G5SA 4GMXA 2P0EA 3T15A 3JVVA 3B1WA 1HT2E 4LRSA 1NN5A 2W6ID 2XB4A 2AL7A 4OQNA 1ANKA 4MYCA 3QEOA 2C98A 2IWRA 1TEVA 4UNPA 3KQLA 2YWHA 2R6AA 4FMCB 6Q21A 3H0KA 1DELA 1S1MA 1LS1A 3K0AA 4FWTA 1PVOA 2D2FA 1XRJA 2IYUA 4WIAA 3V9PA 3IO3A 5FTKA 4QJ4A 1GNQA 4IDOA 2ZJ2A 3AF0A 2QSYA 3FKQA 2GZDA 3L8YA 3ZVRA 2V7QA 2OFWA 3IUYA 2OM2A 2RHMA 5JS8A 4IVQA 4PSAA 2YVUA 4D25A 1SVIA 1Z0DA 4KLNA 4KODA 4D80A 2E87A 4MDFA 1KI8A 1DE0A 3H2YA 3M4YA 4B43A 2W6IA 5JSZB 5LB4A 2HV8A 5JWHA 4KFSA 1ESNA 1FW6A 2ZSFA 2RMKA 2W2VA 1IY0A 4IXNA 4JIMA 3W90A 1E2LA 2VEDA 4BFYA 5IF9A 1I4TD 1RIFA 2GF9A 4GRAA 1YZTA 4P32A 2CJWB 2ZYVX 1NBME 2KJQA 1JR3D 2WWFA 4CRWB 2ZAOA 1F2TB 4YXWD 4YXWA 4LJ4A 3HR8A 3N2EA 4LCBA 1OE0A 2NTYC 5DISB 1EFRD 3ZQJA 1VYUA 3EPJA 4TYPA 4V0NA 4JVNA 1TQ4A 4XSHA 5CK5A 1YRBA 3FYHA 4PC2A 1YZNA 2PCLA 2EFDB 4P4TA 4LV8B 2W0SA 3OFND 1YR9A 4BFZA 2AFIE 3CRMA 2KBFA 1KZGB 2WJVA 3AH8A 5CM9C 2BEKA 3AEZA 1ZRHA 1ZM4A 2ODWA 3K70D 2IWHA 3X1ZA 2WTUA 2IT1A 3CH4B 4MGIR 3HYTA 2FF7A 1KI4A 2JDID 3CPJB 4LY6A 4JSTA 4Q19A 2WHXA 3O8DA 4MUAA 2GA8A 2IHYA 5J4YA 3WP0A 3TE6A 4UXHA 1CJKC 1XMSA 1DARA 2GF0A 2H92A 2IUSA 4HAZA 4Q03A 3RAPR 1E2FA 2FZLA 5DI3B 2PBRA 3SJZA 3T1QA 3JZMA 3MWKA 4GT1A 3X1YA 2C96A 1AM4D 2WWGA 3C7KA 2JATA 3QXHA 5J40A 4EAQA 1P9RA 2IXGA 3DPUA 3K0CC 4Q9HA 4ZDWA 2DPXA 4DCSA 2FZ4A 4Q4LA 3CM0A 3LWNA 2XJ9A 2ZRGA 2BCJQ 1XEWX 3NBYC 3EPLA 2G3YA 5TVKA 4AD8A 2Z6VA 2IL1A 1OFHA 3A6PC 4KI0A 2ZYUX 3BXZA 4URYR 2QQEA 5BN3A 2Z5FA 2WSMA 4MRPA 5SZKB 1OB2A 2BV3A 2CHQA 2ZM5A 4LYJA 1AN0A 3PVSA 4KVGA 4TSFA 4B35A 4E22A 3RSOA 1PJRA 2ZR9A 3PFIA 1SVLA 3ASZA 3W6PA 1VCMA 4YLGA 4MKGA 4L9SA 2F1RA 3LQRA 4RSGA 1YZUA 1C1YA 2MSCB 4NCJA 5FTMA 4NYJQ 3AF1A 2GRJA 1Q3HA 1PLLA 1SXJA 2RGEA 4Z51A 3T5DA 5JMTA 2F3TA 3P1JA 3ADKA 1KZ7B 1Q1BA 3N2IA 5IDVA 4GMDA 1LV7A 2X77A 1E9EA 2JLYA 2C95A 3W3AA 2BBSA 3C5HA 4XD7D 2ZJZA 3LVRE 1NMZA 1N3BA 4JLAA 2QRNA 2ZJOA 2IS2A 1NLZA 2ZIAA 5CJ2A 3CRRA 4Q47A 2OCAA 3QSYA 3U61B 4TSFD 3RNLA 4QNMA 2BKUA 1VHLA 5DH9A 1XP8A 4FWDA 2OT3B 2QTHA 4E07A 3A1SA 5FOSA 1HH4A 4LPSA 3SU8A 2J45A 2WIBA 1W5TA 4DIDA 3KXIA 4TQUS 1Z06A 1OYYA 3OIYA 4I1SA 1UF9A 4Q7LA 2WKPA 5FUWA 2OILA 3REFA 4E5UA 2Q9BA 5BN4A 3GJ3A 821PA 3D31A 3FDIA 3AKYA 1Q1EA 5H70A 2ZE6A 2TMKA 2IYTA 3GLIE 3OZXA 4C0LA 3RVBA 1A4RA 1AKYA 3DKPA 4B3FX 5LD2B 2VP5A 4NYIR 1KJWA 3L2OB 1E2DA 1KSFX 1UBCA 3TAHA 3RS0A 3HYRA 1AKEA 2LKCA 5IRCD 4BLOA 1NLFA 3EPHA 2IHBA 4ASUA 4LUCA 5FTJA 2BKEA 3V4FA 4A6XA 4F4IA 1M7GA 3W5IA 3MJRA 1U2RA 1RZ3A 4GI7A 3HU2A 3GLFA 121PA 1WCV1 5FPYA 2QTFA 2O8BB 3BB4A 4Q02A 2V7QD 2G1KA 1PUIA 4JBWA 2FFHA 1LNZA 3ZZTA 4D26A 4BZQA 2ODEA 4OK6A 4HB2A 1UDXA 1ZJ6A 4NMMA 4FD2A 2R6GA 4A3VB 1AZSC 5EJEA 5CITA 4NCIA 3KUCA 2GZAA 5CYPA 5E7IA 2ZRKA 1PZNA 2FNAA 3ZYCA 4KITB 4FW9A 2OAP1 1OH7A 3HP1A 4PXAA 1S0UA 2RCNA 3QEJA 1N6HA 3CRQA 3KTAA 1TQDA 1UKYA 1E2KA 1P9NA 5DI3A 1DTSA 5FOVA 3TSOA 2ZETA 1R0WA 2JIZA 5E7JA 3SJBA 4V02A 2HXSA 1U81A 4LJ9A 1Z2CA 2X19A 3SQWA 3C16C 1RJ9B 2ZSDA 4TLBA 4R71A 1N6KA 1XD8A 2EYQA 2Q21A 3GPLA 1G4AE 2N1BA 2WMOB 3QF7A 5FH9A 5C18A 1CP2A 1WBDA 3MCAA 1GNPA 1WRBA 3B1ZA 5EE1A 1HT1E 3K09A 1U98A 2IK8A 5HPYB 3EX7C 3TR5A 2ZI5A 4GOXA 2XB2A 4M53A 1BS1A 4KVAA 1XEXB 2GJKA
chains in the Genus database with same CATH superfamily
1PHRA 1RU3A 2B4RO 3NCTA 4V0ME 4ZOBA 2O8VA 3FAZA 3BFVA 1SOMA 1R8YA 4PPGA 1P4JA 3H18A 5F7JA 5TV2A 3GFQA 4L8YA 2ZBVA 4MRSA 4E7OA 2QMOA 5FP0A 2WFLB 2G9ZA 2J7OA 4X1IA 3L9XA 3TGLA 1CUFA 1RLIA 5TMEA 1J9EA 1E9BA 2JLRA 4EVRA 2X9QA 1PU2A 3I05A 3FNRA 1Q11A 1GLVA 1FSFA 3UQYS 4TZ6A 4D8YA 3KSBC 1IHOA 4PHTA 5TDHA 2IY7A 3SIWA 1R9NA 2E37A 1E9FA 4BO7A 4DPKA 4GPIB 5IS2A 3GJ8A 3V1TC 3HU3A 4G8BA 4KQ6A 2JXNA 1W59A 1KWGA 2YWGA 3PL1A 4GMFA 4G81A 3KU1A 4OAQA 1JKJA 3AGQA 1U63A 4RZ2A 3KR1A 2F1KA 4OMFG 1K3UB 2VJKA 1FS5A 2XWQA 1OX4A 2XWJI 4X41A 1M2VB 1YC2A 1ZAKA 1UADA 3COYA 5ENZA 4DLZA 2H54A 4AIRA 4CZ2A 1FP7A 2XVAA 1TTQB 3LLSA 4H16A 1OPRA 1YE5A 4E08A 3CLTC 3O1LA 1I0IA 1G5IA 1ZUWA 3B8HA 3SPXA 3TPFA 4YRBA 1F0NA 1S3GA 3OIWA 5KI6A 3PEWA 4P82A 4LDNA 4GRDA 8CATA 4FFNA 4FEYA 4TGLA 1EI9A 1NAIA 2L6OA 1TYCA 3QKUA 5FNVF 4E5PA 2JLCA 2DAKA 5JNUA 3R8FA 2ZWOA 3A1NA 2AK3A 3GLGB 2Z0MA 1UL1X 3PD0A 5EMKA 5GJCA 3HZHA 3SHTA 1YQDA 1QANA 2XGGA 1RRCA 1N34B 2EA0A 3UVEA 1DOHA 4N01A 3GLHE 1JA0A 1IPHA 2CVOA 2G08A 3G9XA 3O21A 3WK8A 2YS6A 3KP0E 1JPNA 5FORA 3RT1A 2R65A 1R7RA 5KREA 2YFYA 1R8JA 2B4TO 3IXLA 4X20B 2P4HX 4TSKA 4OUKX 4MUEA 4QUIA 1E20A 3OT1B 4EHJA 3H2HA 4BQOA 4QHTA 1OJ7A 2EJTA 2PYIA 4DDUA 4DBLE 4FX5A 5CM8B 1LDNA 2OORC 1KYVA 3E3LA 4KIGA 2X4AA 1RR6A 1LZKA 1EE9A 1AUAA 2HL7A 1TAQA 2UYGA 3KPYA 5C4GB 4CDGA 3ZDCA 3U4MA 1QTNA 3SASA 1Z2EA 4FOTA 2AKAB 4MB7A 4MI3A 4XDYA 2OQ2A 3ZHSA 5KYTA 1RWKA 2BN4A 3DZBA 2BEUB 3NHUA 1HE5A 3PDCA 4GOKA 1AO3A 3RKSA 3WHLA 1E5LA 2FKNA 3HBMA 2DI0A 5I8ZA 4WGFA 3EZNA 3NAGA 1JKMA 3G59A 4WWHA 4MW2A 1C29B 3O2JA 5CPBA 1EBBA 1JZQA 4G25A 4KFUA 2NACA 3ZXIA 1PX0A 1X0VA 5EYPB 2YHIA 4BEJA 5MN6A 1W48A 3F7NA 1TX4B 1QZEA 4I1YA 1GSIA 1KQNA 2LH0A 1N9ZA 4GQBA 5I9TA 3UMFA 4AMGA 1SWVA 5F73A 1GKLA 2PUTA 3CUEF 4H0NA 4CYMA 2OPFA 4XFDA 3MRTA 4JOBA 5TB5A 4CKBB 2JARA 3AF4A 3O0TA 4CIWA 4Z9BA 1D0MA 1CVRA 1YV9A 3FE2A 4KWEA 2R66A 2DNAA 3SMSA 1JSRA 2I8AA 2QTWB 2IOYA 4F4UA 2R6HA 5C46F 3E1SA 1E3TA 3C5WP 1W5FA 3CH5A 1MAUA 3C4QA 1EWQA 4DLPA 3A25A 5JS6A 4FFLA 1IHPA 3GAAA 4D0RA 4M7WA 4U2FA 1R2YA 1EE8A 3DC2A 1JXOA 4Q1AA 2EFGA 3QBEA 2PZFA 2X41A 3EH2A 3R4CA 2C2HA 4CIYA 2P4QA 2VJLA 3PC8A 4LBYA 4M21A 5FPTA 3STTA 1CUKA 4HG2A 2VHEA 3DZFA 4IBJA 3NATA 4WNYA 4DIKA 4L3OA 1OQYA 4LBZA 1QHHA 3WWZA 3SQNA 1G8KA 1SPBS 3Q8GA 2R62A 4MP3A 4JVOA 3K1YA 1GO2A 1QK4A 3PTLA 1NR7A 2R97A 5A9SA 1LC0A 2IPNA 4LJKA 2JFOA 3NBQA 4R8VA 4KRGA 5IVPA 3LVBA 3ZE7A 2JJQA 5EHGA 4ZI7F 4NXNB 1OBVA 2Q45A 2PYDA 5DHFA 6CHYA 3VNVA 4LFAM 1A9TA 1ESEA 1KYZA 3OMXA 4LMBA 2Z6AA 5DNVA 2X3YA 3QELB 1Q6YA 1IJEA 4BQRA 3E0XA 4HZUB 4JHXA 1VSUA 3S1AB 4IRXA 4DTIA 1BCSA 1FQKA 1GNRA 3F2VA 5CBPB 3C7DB 2R45A 3LH5A 4YQFA 1J42A 2WFAA 4ZIRB 4M1ZA 1C5KA 3T52A 1LWOA 1JYSA 4YUWA 1TT5B 1OU4A 4R6WA 4J2OA 2WSSA 2FP4A 4E21A 4QU9A 5BN5A 3VLFB 1K2WA 4P5PA 2CV1A 1XQ9A 4ZVOA 2J3IA 2OKGA 1M34B 1JQLB 3K30A 5G0VA 1JVNA 3HG7A 3O8OB 1LW7A 2UVPB 3EMKA 2VCHA 1Q3TA 1IBRA 1W0JA 5B6IA 1RI5A 2IW1A 3S2SA 1G1MA 4RACA 3RG8A 5ITRA 3T7JA 1ACMA 2JRLA 1W73A 2I3GA 1L7AA 2XUKA 4BFVA 3S5JA 1WXEA 2J3JA 1N2XA 4FZ3A 5H68A 3UG7A 3MJVA 2H08A 2HSEA 4X8HA 3UJ6A 3ZUPA 1VIMA 1NFQA 4GI3A 4M89A 4D4JA 2HRQA 3I2IA 1JEQB 1OLXA 4IJKA 5LWQA 2MGWA 4BMZA 3UK1A 2F2TA 2JI8A 1N2CA 3HO8A 3K2EA 4R1UA 5A71A 3ZGOA 1QQ7A 3MPUA 5I4BA 4C9BA 1A7JA 4IXMA 1GPJA 3V3TA 3WZMA 4BO6A 4UNNA 4BZPA 3DEFA 2VIIA 3NWLA 3TLYA 2R25B 5DP2A 2CFRA 2L0XA 3KPWA 1IOZA 1PR2A 1WZCA 2G07A 2RIPA 2WMYA 4XQCA 1FQJA 3G7UA 5BN5B 4DZRA 3M34A 1A5AB 1G9TA 4HX5A 1MT0A 2PU5A 4RABA 4UUPA 5CX4A 1VDMA 4JBHA 1CU1A 4R1PA 5DTRA 5J23A 4CL3A 2OHIA 3M9XA 2RGNC 1CQJB 5HDQA 3TTSA 4BX0A 3IG8A 2CXUA 3FCSB 2NUPB 3U4DA 2Y21A 4K0KM 3SS7X 1TRHA 3R6TA 3SKYA 2IPAB 1NX6A 3ZS8A 4O2LA 2JW5A 1QO9A 1I7LA 4O2AB 1T3GA 2I6QA 4OI4A 1VE6A 1W0CA 2Q28A 2AI2A 2QD4A 4M55A 2PZAA 3H1PA 4N54A 1GRCA 4JB0A 1F3LA 3M89A 1M6EX 1BDJA 5AJWA 1KS2A 3ORQA 3EXHC 3FPBA 4Q3AA 4TL8A 5J1TB 1V1JA 2CD9A 3A8TA 4N49A 4HDRA 1VPLA 4LXQA 4YAOA 3AUUA 3ZBPA 4C14A 1J0BA 1NRWA 1Z39A 3PYMA 3Q5DA 5LA6B 2AHOA 5SYMA 5JAPA 3AETA 1FTYA 1IFXA 2V9ZA 5KTYA 1XMOM 5FTNA 4AY5A 4RAQA 4W5JA 2NZ8A 4I5IA 1E9RA 3W1WA 5L40A 4L75A 4I3HA 2BJWA 1GUYA 1FB5A 3RUFA 3V2GA 1M75A 1PWHA 2V7EA 2H57A 2XWSA 3N28A 4GEGA 4M38A 4EW1A 4G0MA 3F78A 4ARIA 2C3UA 3F5MA 1CIVA 2EUCA 1EVKA 8LDHA 3IBTA 3CLSD 1K08A 3IJ5A 4IJ5A 3I92A 1WW3A 3JQ7B 2QP4A 4O3FA 1MX9A 5GJVC 2A9FA 2D7JA 3GUCA 3WYBA 4E51A 2VEOA 1DQPA 1WVIA 2EXXA 4QYWA 4HH1A 5GP1A 4YMWA 3VDXA 4E2FA 1ISMA 1NF9A 1QHHB 3KQWA 1NTRA 3T61A 2P6RA 1X9GA 2RBEA 3CZRA 3FLEA 4QDTA 5CRIA 1I14A 3ZWAA 3I8SA 1J5XA 3KXKA 4F2LA 3FPEA 3IDQA 5JCXA 5K6AC 5CW1A 2H29A 2WJHA 2ARKA 5HGXA 3EQ7A 3SSAA 1L5QA 3FG9A 2X5OA 4NDNE 4M83A 4XVUA 2WHEA 1Z6XA 3K2BA 1YJAA 3MOIA 1AS2A 1DXHA 1VE7A 2VDOB 3UV3A 3GGCA 1XZCA 2Z2ZA 3VO8A 3ND6A 2M32A 2O0KA 4OQMA 3DBHB 5ADUS 2RGNA 4K6GA 4ZYYA 1IOLA 5J4HA 3AWIA 1S96A 2JJYA 1RZVA 1ZGAA 4GW3A 4RL6A 3RUHA 2PGNA 3NHWA 2XTMA 2HKJA 3G68A 4JBLA 2H5JA 2ZDGA 1ZD4A 4U00A 4WKNA 4Q9JA 1GKIA 3JASB 2KI5A 3WBFA 2E5LM 1LPAB 1YZGA 3KZOA 1F9EA 2BY4A 2L18A 4BVBA 4XZ3A 2JFGA 1H6AA 3L7KA 4DNOA 1OTXA 1J5PA 1JG7A 2PT6A 2WYUA 2ZJ0A 4R51A 4WN9B 4KDCA 3PXDA 4X94A 4ZQEA 3EXIA 2Y1DA 3T1YM 2RGHA 3CTMA 4NAUA 2E1PA 4Y30A 1EG7A 1VE3A 3A4YA 3BIXA 1RE1A 4B47A 4XVCA 2GK7A 3FUUA 1HNZB 2JZ0A 1E1NA 4OBXA 2Q4EA 4AUMA 1P2SA 1EK5A 3DF7A 2RBKA 4MAFA 4OUDA 4GAEA 3TNLA 3AT1A 4UDNA 1N9KA 1HC7A 4FVMA 2EKKA 3KKLA 2KSQA 2IDJA 1BVRA 3DAGA 1JHOA 3ETCA 1E6LA 1CFJA 3ITEA 1WUIS 1JEEA 4UE2A 5D5PA 1RQNA 1PT6A 2RGOA 1UZUA 4UHDA 4WXEA 4D9HA 4DLYA 4HMQA 5E6RA 4C30A 2PZLA 3P9NA 3FHCB 1QE0A 4EG4A 5KWIA 3GFTA 1Z0AA 1H94A 4P54A 2ODPA 1PG5A 3VJMA 3WRWA 3A3KA 2ZB4A 5K8CA 3AINA 1V6AA 4NQRA 1F8UA 4UEQA 5HA5A 1MX1A 4FSHA 4Q16A 2ZQZA 2ACVA 4FYKA 2OE2A 4X65M 5T67A 4IJFA 3MTGA 3CPSA 4RLHA 2V9PA 2FDXA 3DE0X 1NE2A 1IQRA 1YCFA 5I4CA 5IT5A 1ZM9A 1R5JA 1ORYB 1ZP6A 3L8ZA 3L82B 1TU4A 3N3AC 4OF4A 3KJQA 4ZVLA 2EFCB 2WSEF 4OXRA 1ISSA 3WL5A 2ZSUA 2OGWA 4IDFA 3W2IA 5TQ0A 3GH3A 2XBLA 4CEJA 4RE5A 3P97A 1F7VA 1NF3A 1K0FA 3ZGYA 3AKEA 1TM1E 1PE0A 2NSDA 1U7PA 1JLLA 2XITA 4QOJA 1T6XA 1V11B 2H07A 3FKSD 1C9NA 4IS3A 1X2BA 4ZCPA 4NJMB 3VNBA 2C2MA 4ZCTA 2ZB8A 4W5TA 3AERB 3D2BA 1SCUB 4GGPA 3S27A 5JYBA 5U4XA 4RZHA 5SY4A 3SG0A 2GZHA 4URFA 2VUTA 4IIJA 4YI3A 4XM1A 3NRBA 4M1OA 3NRJA 3F46A 3IR5A 4CLXA 2JLWA 2QKYA 2XF2A 4H2DA 3P2MA 1CR1A 1H8HD 3RB8A 4I1PA 3OQPA 3O93A 4A0QA 3OJXA 4QQ8A 1RM4A 2NAPA 2WP8J 2O20A 3BCUA 3F4BA 4IF6A 4U7PB 3OOWA 5L51A 4H0FA 2HJHA 2ZW9A 3VK8A 4J0HA 3RASA 5DLPA 4F91B 4TRNA 5CIWA 1JU9A 4KK4A 2QTCA 1TVCA 3QU9A 5DYIA 4MCHA 5DHQA 4YYZA 5BPFA 1HNXM 4ZYWA 4IGEA 5IG2A 4BPBA 1E1QA 1LDBA 4D45A 4RETA 1XVAA 1ZMOA 5DK6A 3SSOA 4FOSA 2QG4A 3VHLB 4B33A 4QOHA 3S81A 3SDZA 1J56A 1QYXA 1L7MA 3PYXA 1T0JB 5EJAA 2VTEA 2G36A 1M2KA 2CE7A 1BVUA 5DYYA 3T7AA 2X5JO 2BBWA 2NGRA 5A1TA 3PRHA 4Y2SA 4BCCA 2B5OA 3SHVA 4NSOB 3E9EA 4WTOA 3QKRB 2PRKA 5AVRA 5DNYB 1V5FA 1F4PA 1RSZA 4FLEA 4O63O 3TLJA 3P26A 2E49A 4Z4HA 3IFSA 3U0VA 3NYIA 2OV2A 3BF7A 5E3IA 1IUPA 2IU3A 5JPDA 5KYUB 4MKXA 1FFGA 2QX9A 4OREX 1RM0A 1RPAA 5AK5A 2XCRB 2F9MA 5JQWA 1TC1A 5HE8A 3TEFA 4EUFA 4EYGA 5KDDA 1F3OA 3Q12A 1KO1A 1MB9A 2XFSA 1SU4A 2F4NA 3EBPA 3PFBA 4EUNA 2C7PA 1EIWA 2GS9A 2YRFA 5LZ4A 3OU6A 3ZZNA 3LWDA 4S35A 3KAPA 5JROA 4CL8A 1VYHA 5FYQA 3THYA 1JG4A 1Y63A 1LVGA 4JQZA 3ZHCA 1ZK2A 1DC3A 1M2OA 2E85A 2FEKA 2VDWB 4IWYA 4TMTA 2C99A 3VO9A 1LBEA 5AJHA 1SKMA 2IXBA 2GAAA 4IEFB 1B8UA 3WJ7A 5LQRA 2UYQA 3GNTA 4MV5A 3K6SA 1R10A 4ZHQF 5EUMA 1QG2A 3T8YA 1V9SA 4NXNM 1G98A 4B2YA 3U4CA 3AVWA 4AG5A 2WD7A 3EVDA 5IMBA 4CNBA 2OV8A 2XUOA 1T0IA 2ECPA 3OURA 4LVOA 3ICVA 1E4YA 2CUTA 4O2BF 3KZ1E 5CX1B 5KAPA 5CLFA 4LXHA 2PCJA 3IR7A 2PGXA 2AXNA 5F51A 1G2IA 4JNCA 1PQUA 4UNQA 1I36A 2RGYA 5CAEB 2M6LA 1T4CA 2VPWA 3FZEA 4YMUA 3GJRA 5C5DA 4GP6A 4EBFA 3QLUC 2IEYA 2OAQ1 2BE7A 2ON6A 4MVJI 5E2AA 5JNLA 4XCQA 4DJFC 2P41A 5BOSB 1RTKA 3IULA 5DB4A 3IVMA 4BKRA 2O8EA 1WDMA 5HKAA 4NRVA 2O1XA 3Q8XB 1KK2A 1MX0A 1XZ8A 2VL7A 2D0OB 4YBRA 1DP4A 1YMUA 1NQWA 4I66A 1CXZA 2CVPA 1Y1SA 2A0YA 3Q7IA 4OL0A 4UXIA 1VB5A 3QEBZ 4QBIA 1V7ZA 4Y2XA 5DLQC 4PSUA 4BB9A 4BAZA 1GWNA 3ZJVA 2RI1A 3F47A 1RRPA 1D2AA 2GCOA 5HJ2A 2J3HA 1ZYUA 4S1NA 3DH0A 3IECA 1Z26A 1L5GB 3W5SA 4YAKA 1X37A 2NSHA 4F3NA 4M9CA 4D4GA 3PENA 1J7JA 2Q27A 3AKDA 2P9TA 3DMRA 3FZNA 3KP1E 1DJOA 2GEBA 1H2HA 3KS8A 3KT0A 2ZI3A 4WAUA 5DN6D 2JLUA 3DULA 1NPTO 5IZ4A 1KAOA 1T3HA 3CLKA 1EAYA 2ZZNA 3KOUA 3R6WA 2BGIA 3KL2A 2F00A 3RVJA 3DAFA 3SAWA 1U0TA 2VDUE 3VR2A 4AMVA 2JP7A 2QGNA 4RORA 3PE6A 4AT1A 4CCYA 2L2QA 3WY9A 2QN6A 4BP1A 1XZLA 2PUJA 4Z4IA 3AZQA 3VOAA 3RAFC 3OFNA 1NBHA 2I62A 1YJBA 4A8PA 1MDFA 4PIPA 3KWJA 2OUKA 1XG5A 3PDIA 4K28A 4IDAA 1J5EM 4LYYA 5FHRA 1JXMA 1QMPA 1R27A 4Q9AA 4EB0A 4KPYA 1WDTA 1L7DA 1Z83A 3B13B 4R2IA 1Z22A 5AIAA 1XGKA 5GINE 1LTKA 4X1IB 3W67A 4AJEA 2J85A 2ZI9A 4LYFA 1XZKA 5CFRA 2IYXA 3WQQA 4WL0A 4AXBA 2IZ0A 2X0RA 1GQQA 1TM3E 2CNWD 2HRRA 2XUZA 5DBIA 5E3HA 1KY2A 2FEAA 3DE2X 4DT1A 4EQ6A 4CL2A 1UJ2A 3OT4A 5CA0A 3MJDA 1KP3A 2WDZA 3K6RA 3UATA 5FBQB 3LLUA 3JVIA 4R16A 2C7OA 3GJZA 3LC2O 3HV2A 1V2HE 3PC6A 3T5GA 1GZUA 1DHRA 2H0RA 2EZ9A 1KYXA 2PX5A 3EA5A 3EODA 3M6MD 4I1OA 2OZPA 5K45A 1J5EB 2J4FA 1W88B 3OF3A 1UR5A 1FUUA 1RS0A 2WMDA 3C4JA 2Q4TA 2SICE 3L7LA 4XDHA 2Q3HA 4R0VA 1GZDA 3NEAA 1J2EA 1G6HA 4NCHA 3DBOB 5JJKA 2P4SA 3N6RA 4E4YA 3HP7A 3BWBA 2XZOA 3K6KA 5JMOA 2PQMA 2RK6A 2PS0A 3VM6A 4XARA 1UBLS 1TM5E 4B6QA 4DNPA 5EWMB 3H2ZA 2A9JA 1YB1A 1OJLA 3LDHA 4LY0A 4KW7A 4Z1MA 3RTGA 1OIVA 1CY8A 1LTQA 1LVHA 1S8FA 1VMDA 2XYGA 4GQIA 1Q39A 4OVKA 4V38A 4NE2A 2P62A 1G8HA 3N70A 2Q5FA 5DWQA 4B6EA 2BFFA 4O25A 4JI2M 4RLFA 4JU8A 3PWZA 4GPD1 2FPGB 2P4EA 3KTAB 2VQDA 3NTLA 1NNJA 4BNDB 5AVSA 3P2EA 2BEWA 4S2UA 1EA7A 3G5LA 4FMPA 1CIJA 1OIPA 4L50A 1Z74A 3NVAA 2WSSD 4J0DA 4Q3DA 5JZ9A 1HZZA 4FN5A 4Q1VA 4RQAA 3HJAA 3NEYA 4FHZA 2M60A 1JSLA 5I45A 3FE3A 1I1OA 2P27A 4HVAA 4W5HA 4B6PA 4ZAWA 1JWBB 1Z4QA 4RLQA 3UJ9A 2G28A 4GR5A 3PTZA 2Q7XA 2XYQA 3KDPA 1Q2UA 3CZAA 3FPGA 4MVJE 1Y7PA 1ORTA 1MN3A 1FUIA 2IHTA 1MORA 4HLUC 4NFLA 3BRWD 4NONA 1UFKA 3EVAA 5JSZA 1F2UB 1F48A 3HV0A 2AJLI 3V42A 4XD7A 3ZJYA 4LV5B 3FOZA 1F6DA 1NZDA 1SXJE 4IBKA 4RZUA 1BS2A 2J32A 2WHYA 2NXCA 4S1TA 3EOZA 1Z2AA 5I7HA 5IZ7D 1Y7TA 3L0DA 3GT0A 4RK1A 1ZJJA 2YOGA 2ZUSA 5HJ7A 4BQEA 2YJNA 3GGSA 3CZ9A 2B0JA 1T9GS 4C6TA 3LKVA 3C14C 4DWWA 1VRWA 4XIIA 4EI9A 1F0YA 1B7GO 3I5MA 3IAXA 4C4SA 3C58A 4OGKA 1NJ1A 4JB8A 3ROMA 5D3KA 3C0KA 4LF4B 2JNWA 2YMLA 1JXQA 4DLWA 4E30A 4OU5A 4NH4A 5LKRA 1VIYA 2V7TA 1DRUA 2QUJA 3R5HA 3IAAA 2H3EA 4A8JB 3G5UA 3ZXXA 3K71B 5KNBA 2B8TA 5A3JA 5JYEA 5LLDA 3CU5A 5KYUA 2AG0A 2V4ZA 2Z7JA 1I4EB 3SVTA 1C9KA 3BDVA 4X54A 3CG0A 1UWVA 2JLZA 2A58A 2VF2A 1YB2A 2KWIA 3B2EA 3NS7A 1XDWA 3SBDA 5JZSA 2K7FA 4FLFA 4KREA 1TECE 1Y3DE 2Z8YM 3HZOA 1R4NA 1SZDA 4U8HA 1I1NA 1XRQA 4QQKA 3SK0A 3DLIA 4YV1A 2JK0A 3IP1A 4E2WA 3QBTA 3NCHA 1THZA 2Y0CA 2VYVA 5EY5B 4IH9A 1PIWA 3CZCA 3IPAA 3H84A 3L1UA 2LZ0A 4F3YA 3E7XA 4MGKE 4ML3A 4ZCRA 1O57A 5LJLA 1DQSA 1H65A 3BH7A 3D4PA 5CDHA 1M0TA 5JBQA 1EXDA 2UV8A 2ZT6A 3B3GA 1UJ4A 4CG0A 1IJBA 1NUQA 1RHMA 3ROXA 4ZVRA 4TTVA 2ZYSA 5E26A 3EXFA 4QQNA 3BRQA 5L7WA 3D59A 3HZRA 4M37A 3FFXA 1JHPA 3L05A 2JBAA 1I2AA 2SBTA 2A1TR 2QROA 4OYLA 4EA8A 4ND3A 1TKAA 2OBFA 1GU0A 3C15C 4IILA 1WETA 1NP7A 4L6V6 3EZ6A 4K9QA 4FONA 5KYXA 4DNFA 2W8ZA 4HQKA 4IJ6A 4P17A 1QP0A 2QN3A 1FQWA 3COZA 3CNEA 2JLBA 3RWBA 3TCXB 1M6VB 4F8YA 4UTOA 2BHTA 2WE8A 2X9NA 3E48A 2VSOA 1N5IA 3HUUA 3OOYA 3WGLA 4DQVA 3OPMA 2QTMA 1FSSA 4EJSB 2HEGA 4INJA 3TFQA 4PYIA 3SZGA 4E15A 4NQZA 1P9LA 4KHZA 3OT1A 6LDHA 1CS4C 1DGFA 4B46A 4CEHA 1K7CA 1JZTA 3HADA 2OAGA 1C30B 5K4HA 4MXDA 3H3JA 5C7LO 1WDWB 2Q7DA 4HAXA 1IJKA 1OLSA 1W6UA 3CKLA 1QQTA 1UPBA 1MZVA 5IBCA 2C4MA 4DR5B 1QRSA 4F7WA 3ELDA 2O5EA 1TJ4A 1A7AA 1BKYA 1PR0A 2PKXA 1EP2B 3LQ4A 4MV7A 4WSOA 4NU8X 5EOVA 5B5SA 3H4MA 1Y3CE 2JIDA 2WU0A 1F60A 1DC5A 1F38A 4ZPJA 4FXPA 5ILQA 4B31A 2W2MA 4LC9A 1J8MF 3AY3A 5IJWA 3T1YB 1EX1A 4M9QA 5AI9A 3WYGA 4ND6A 3RRNA 3IUJA 3O9VA 3GEHA 1AHNA 3PUWA 5ALNA 1I3OA 4CM4B 1QF6A 3CN7A 4HFJA 5JWRA 4BJ3A 1C1DA 1QC5A 1XU4A 1N1GA 1R6TA 1H69A 1W44A 3URKA 2QXYA 3CIOA 4HMPA 4MPRA 2B7LA 3BIWA 1YR2A 3A1FA 3U4HA 2IS4A 1PYGA 2HHCA 2ATXA 2Q46A 4NG5A 1H6UA 4DR7M 3FH0A 1YBAA 2XCLA 1A3CA 2BM0A 1R16A 1TCCA 4N6GA 1LNQA 3Q11A 4FJ2A 2QLTA 5JBIA 1Y5RA 4CISA 2HSJA 3W0FA 4FQ8A 4OB8A 2PMWB 4KR9A 3JAWA 3SIXA 1ELOA 4IV8A 3OEHA 3VHXA 4C3OB 4ESVA 4FBGA 4IHJA 1VSBA 4O0MA 3RSZA 2V6FA 3EY9A 4U7JA 4EHKA 2OBMA 3UUFA 1DB3A 3A32A 4MV8A 2JHGA 4L6CA 4Q9NA 1T0HB 4ER6A 2JHPA 2HZ7A 2B61A 2H5LA 1T9KA 1ZMBA 1MVOA 3OPNA 4JEMA 4OO3A 4EO7A 4U5QA 1JFRA 1Z5WA 2FSVC 1AMUA 3N2KB 2FMHA 4C0HA 2QRJA 3MC1A 2DTDA 3UC5A 4G23A 1ORDA 1QZZA 3F5QA 2A2ZA 4P31A 4Z0NA 2BYTA 3AM3A 1GR0A 3AFIA 3C5EA 3H8SA 4HAVA 1OFTA 5GPBA 4HDMA 4F11A 1QH1B 4JB3A 4DXDA 5JXHA 4TS1A 5JEEA 3TF5A 1FVFA 1XAGA 3DVRX 3HVUA 3ZOKA 5GVSA 1GA1A 4DY4A 2Q5CA 1II9A 1X80B 3AUTA 4UBOA 5FOQA 4HGZA 2WT9A 3PITA 1UPXA 2VRWA 2PMEA 1A04A 4X1KB 2CVZA 3DE1X 4H1WA 3B6EA 3QI2A 4E0BA 4RVGA 3GVHA 5K0NA 1KF0A 3MFYA 4QUDA 4IV5A 3DPIA 3PHHA 1C1HA 4XGKA 1Z4JA 1TYAE 2LR0A 5A1JA 3D7MA 5B4VA 4CT0A 4D5GA 2AVNA 2BMFA 2HK9A 1PVVA 3TI9A 3V48A 1J8YF 1E5DA 5KSPA 3RRFA 1HDEA 2LTAA 3NIGB 3SQXA 3L49A 5IARA 4H7EA 5F21A 2CGEA 3D5QA 2XYVA 5HK8A 3R3YA 5LUBA 4WBNB 2PTHA 5HHTA 4PLFA 2H4FA 1TGUA 1A8UA 4PR3A 5EUCA 3GQ4A 3IJPA 3F96A 1GCAA 4HADA 4JLWA 2OXEA 4LJ7A 3FWYA 3V1KA 2Z2YA 2AQKA 5ARBA 4XJSA 3A6JA 4YONB 3SVLA 3UZUA 1MO2A 3F7TA 3OU2A 3R7NA 4F97A 1U5AA 2D7CA 5F7ZA 2YV3A 3SY8A 5EP4A 1FDRA 4YLYA 3W5AA 2FP3A 2UVDA 1H2WA 4MUXA 5AVUA 2W4MA 2XLBA 3I58A 8MHTA 4JCOA 5D84A 2JA2A 4FTWA 4LHEA 5ALWA 3B1VA 4UJ5A 2FPXA 4ANFA 4Y9SA 1W87A 4GLJA 3FLBA 4EA7A 3B1XA 4HJRA 2QX7A 2MT9A 4FSDA 1VBNA 3JWJA 1P6XA 4Q1BA 3QW4B 1UEXC 1V26A 5KQRA 1KRHA 1PP4A 1Z5ZA 4OHYA 4O2AA 3LMKA 4R3WA 5M3BA 3UJCA 3GJ0A 5MFZA 1PQPA 5LDHA 4E5DA 5DKFA 1Y4UA 4LBVA 5F3RA 1MG5A 3M6LA 4IDQA 4OGGA 2HCBA 4X62B 4NYJR 1K3FA 2OWDA 3ZR4B 1I13A 4JI1B 5HUQA 1NVVQ 1O8CA 3R76A 4JJIA 4MWBA 1G20A 4QUEA 1G8FA 3STUA 2J4DA 1J21A 1BMFD 3DCIA 3HEMA 2A9VA 2WZCA 3WGVA 2XUFA 1GU7A 3JQQA 1UZAA 2QT0A 4HBGA 1EP9A 3BMNB 4QTUB 3ZE1B 2A3RA 1STOA 5CNIA 1MU0A 4G01B 2HC9A 4DCMA 4HWRA 5KNDD 4NOKA 1GN9A 5BOVA 5SZJA 5BSFA 4UBNA 5BV0A 5JFTA 2RGCA 3H2SA 4HGQA 2A5JA 4KC0A 3VHQA 3WTCA 5IUJC 1NRIA 1WNFA 1TB4A 3DFKA 1ARZA 2F43B 4FX2A 4ZC1A 5J63A 4K1XA 3MW8A 3CIFA 4DJAA 3AX6A 3PKJA 1WV1A 1PTJC 3J81k 3VC2A 1APBA 1P3DA 2C2OA 4WLFA 2FPPA 2N75A 4POAA 2A9RA 5DBHX 4ZN6A 3X1XA 1E9DA 2WT8A 3CGGA 5FQNA 2ZE5A 2X6QA 2EJBA 3CKYA 3MB5A 3TS1A 1RYHA 3VTKA 3NPMA 2OM6A 4NYMR 3DDCA 4UU1A 4NENA 2CHGA 1L2CA 2CYBA 3VDPA 4H7PA 4UAJA 1F51E 3B9QA 4JX9A 3WOHA 5ALQA 1EJ2A 4JJFA 1Q0ZA 1RKUA 3WL6A 4DLTA 4QDKA 3F3YA 3NKVA 1JDPA 1L1RA 2NZWA 3NQ41 3OVMA 4B4DA 4DRZA 2DWNA 3A2KA 2GAFA 1HFJA 1TZ2A 4GZ6A 1JIUA 1PQWA 1PJLA 2QBYA 1YVEI 3MHTA 2FLVA 1K86A 1SOAA 4QD3A 3ZHOA 3TW8B 2J9GA 2I7VA 1H1LA 2XMSA 3IPRA 3QVGA 2IBMA 4IJWA 3Q7RA 3ZCSA 3WA7A 3WK4A 4I7EA 5DYWA 4I6JA 2ONCA 4LKRA 2NU7B 4MRVA 3RBVA 4ZHQA 1TF7A 2AUNA 4PCLA 4NCAA 4P0PB 3QE0A 1LPBB 4QJBA 3BQ9A 5M5BA 1HQYE 3HPRA 3T95A 4HN9A 1OIWA 3VR6A 1IEXA 5BT9A 3V76A 4AROA 2EKPA 3KKNA 3BTOA 4JI3B 4NZNA 4Y8VA 5MGBA 4QBKA 1GV0A 1MV5A 3TPCA 4C21A 3UF0A 4BFLA 1A4UA 2GH1A 2WJ3A 1VMKA 1DT3A 1I5OA 1MC8A 1Y0BA 3OETA 4R40A 1T6BY 3TNDA 4BYGA 4NXMM 3ABRB 3I53A 1N8TA 1F2VA 1H0KA 3IQWA 3LDFA 2OEPA 4KXFB 4ZZ2A 3T7EA 4JFRA 4JI2B 2JHCA 5JYDA 3F6SA 1QVRA 5FBVB 2WJ6A 3D6TB 1XTPA 3NBZC 3ETHA 4F45A 5B6PA 3BJIC 4G5HA 1B23P 1K4YA 2NVBA 1NW9B 3IHLA 2ZVPX 4HEA6 1JUDA 3ML1A 2ESRA 3WLPA 1WCYA 1M10A 2XQKA 3RRXA 1OXSC 1CQZA 3TIIA 3NT5A 1R64A 3N0XA 1FU7A 1AGPA 1QOZA 1GKUB 3PNBA 4RZQA 1LPOA 4XCXA 5HF9A 1NVFA 3IOEA 4ZEXA 1UUFA 2OHVA 4HJXA 3S2EA 2ET6A 5EE3A 4OJMX 3OQVA 1M8PA 5SYAA 3F6RA 4L5AA 5FJJA 5JDCC 3X2SA 4ZGGA 6NULA 4MITA 2QTTA 2BSXA 5EIBC 2XW6A 5LYJB 4KR2A 2C2BA 3K1JA 2C57A 1V3UA 1KFVA 1ZMXA 3BCHA 2UZ3A 1O9GA 3DUWA 3VK7A 4PLHA 1PKXA 1O5IA 1YAHA 5EZ5A 3WHPA 4DCJA 1TJYA 2I54A 3DPSA 2XNKA 1EE1A 1TLLA 3U3OA 1SEVA 3G6KA 1N0HA 4GR4A 4JROA 3S2YA 4YCLA 2O01F 1TAGA 2ZLBA 4OQZA 4HRYA 1DVRA 1HDCA 3LT4A 1L1FA 2J08A 4L2IB 1C1KA 4Z7NB 4LOLA 1QCDA 2VWGA 2FOLA 3EVGA 4YRLA 3AR7A 1KJZA 3DDZX 4H1HA 1Z5GA 1XQYA 5EIOA 4Q4JB 1MRNA 2X0IA 5IXJA 1NY5A 3IE0A 2IF2A 3R74A 1SMKA 4FI3F 1AK2A 1OT3A 1XZIA 3KKZA 3NXSA 5K8TA 2H1SA 4BZXA 1TIPA 1G2OA 3PF9A 4N9WA 5C8XA 1A5BB 1YVPA 2CXNA 2HD4A 4N7JA 2EIHA 3HI4A 2XRFA 1WP9A 3B20A 3ZY6A 1I6MA 1ID8A 1PQ4A 1KE2A 1J39A 4A27A 4DEXA 3NETA 1OXUA 4KE6A 3STXA 2O8EB 2HHHB 2G3QA 1PGYA 1AH2A 1SY7A 3N0RA 4EIWA 5JSQA 2AFIA 1WQ4A 2HFKA 1AF7A 3HEAA 2PS9A 4J9VA 4ZPXA 4NI5A 3L8MA 1NW6A 1YI8A 4UQLA 1TE2A 3ZEAA 1YKFA 1E8DA 3W8RA 2DHDA 3JR3A 2FQ1A 4F8EA 1OI4A 2DR2A 4WJKB 3D3WB 2O07A 2ZTDA 4G1MB 1PS8A 4OBBA 2PRJA 3Q72A 3F6PA 3ND5A 5HQ3B 1B0PA 2QWXA 4HYEA 1HT3A 4JA0A 3RANA 3SQMA 1QLWA 5EHXA 4MRRA 1U1GA 4BQSA 2ZIXA 1YOVB 4D3SA 5L3RA 3SJUA 2KDLA 4IQGA 5B2EA 4K2AA 2LGJA 3QEMB 2XAUA 3QYBA 4FINA 4JT4A 1A2BA 3EQZA 3KZMA 4YRJA 3UHOA 1WABA 3EWNA 4N8DA 3V34A 4YRMA 5CDUA 2BGMA 1RM3A 3PUZA 4IJEA 4NARA 1OW3B 1UPUA 5JAHA 1W0KD 4OB7A 2YXEA 1NTOA 4HX2A 1FZTA 3RYCB 2ZRLA 3C1UA 3LXUX 3FKSA 5ECDA 2YJZA 2Z56A 5FPHA 2PTGA 3DEHA 1P2GA 1WGNA 2H0QA 2WM9B 2WV7A 3PPIA 2B78A 2P69A 4R2WA 1JQDA 3EXEB 3RHTA 1BEUB 3NWJA 3PGA1 4XQGA 2NV0A 4OFXA 4EM6A 4GH5A 4WECA 4H6WA 4L15A 1UH5A 3KJFA 4CFZA 1SBYA 2JDIA 1K97A 1RXEA 1Q5PA 2CP8A 4XX0B 5B3JC 2EBHX 3R7FA 4LMRA 2OCGA 1JEDA 2HK8A 4AP9A 3ME5A 1OLOA 2HLNA 2IOFK 2ANCA 1TF5A 4UVDA 3ZH2A 1ZW1A 3SKXA 3C43A 1VI2A 4JQCA 3HRIA 1GTG1 4W5WA 4Q1FA 4UDYX 2CJPA 1FMFA 5JHHB 2H7VA 1E98A 1MJHA 2F5SA 2LD4A 3WL7A 1C7FA 4G3XA 3BCRA 4HSGA 2RJ3A 2C97A 1BFKA 3ISVA 4RIEA 3R75A 2E4WA 1YQTA 2IYWA 2R4EA 2IDZA 2WFMA 3O2QB 3O5AA 4DC1A 4CKWA 5F77A 1ILEA 2C7GA 3QOXA 4CU5A 3MAGA