4LJAA

Clpb nbd2 r621q from t. thermophilus in complex with amppcp and guanidinium chloride
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
321
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
total genus 109
structure length 321
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ljaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ljaA01
3NHBA 2J45A 4HDQB 4DLXA 3L82B 2CE2X 2IXFA 2V3CC 2QNRA 2ZANA 4CW7A 3I62A 2F1HA 2RMKA 4NP6A 2P6NA 2QQ0A 1KI4A 2XAUA 1P4SA 3HPQA 4A2WA 4MYCA 2IYXA 1IN5A 1L2TA 1VCMA 5F9FA 3WNDA 2GDJA 3HJNA 2ZRAA 4OK3A 5K8IA 1US8B 3RS7A 4I1UA 4LUCA 1II9A 3ND8A 2ZYWX 4POAA 4QBFA 3LXRA 4JN6A 2WJJA 4F4IA 3WXMA 4US2R 3AUYA 3NKVA 1ZCAA 1KSFX 4CT4B 2CVHA 3KKQA 1PV4A 1EFHA 5DHFA 2GXUA 3CRRA 1A5TA 4DLRA 5EE5B 3CX7A 3OE7A 4OJQA 4PPNA 2BEJA 1J7KA 1M74A 4YMWA 2ERXA 4DSUA 3PJRA 4OQLA 2CNWA 4DT1A 2G0NA 4FCVA 1D6JA 5EP4A 1U8ZA 2CBZA 4JS0A 2XGJA 3T61A 2JLUA 1C1YA 3MLEA 4EPRA 1DEKA 3HU3A 1FMJA 3EIEA 2JCSA 2IYRA 3M6AA 2Z0MA 3PQCA 1DADA 4QJ3A 5AUPB 1CR1A 4DXAA 3CBQA 2WIAA 1J8MF 2RGBA 5IRCD 5IK2A 3FOZA 2IUTA 4Q1CA 4RZXA 2CCKA 4DSOA 2O8DB 3FDIA 3GJ4A 1KAOA 2W2TA 2ZE5A 2ZU6A 2ORWA 2C99A 1TF2A 1V43A 1AM4D 3KQUA 2AX4A 4EJSA 4FMCB 4Q02A 5AWFC 2A78A 4KJZA 3K9LA 3ZQJA 4ZI3A 1G8YA 1PLJA 2E87A 3MD0A 3VR6A 1K6MA 2QM7A 1XDBA 3C8UA 2G88A 4RD3A 3P32A 4WA7A 4BLPA 4BFYA 1VKJA 4ESHA 2IC5A 1IY0A 1KTVA 1YZKA 4GOJA 4MRPA 4E09A 3CUEF 2ZYTX 2DZNB 3PCRB 2ODNA 1XJQA 3ZYCA 4A15A 1TMKA 3F3YA 3LBNA 1OKKD 3CLVA 3CR7A 4JVNA 2EQBA 5H1YA 4XVRA 2ASEA 4RY2A 3FKSD 1GM5A 2DWPA 1P75A 4B47A 1G5RA 5FOSA 2FPLA 4JLMA 2NG1A 5HCNA 2DYKA 2H8KA 4KXFB 5TV2A 1HYQA 3CH4B 4QHYA 4PC3A 1OH8A 1IAQA 3FHTA 4BFZA 1KK0A 2CHGA 2BMDA 821PA 1LVGA 1M2OB 3KDSE 3AVVA 2VF8A 3KZ1E 2WAXA 4G5QA 3I3SR 4N0DA 2IWHA 1DAGA 2HJGA 2BMEA 2YWGA 1FQKA 2QPOA 4AG6A 5FTMA 4OHZA 2R6AA 1G5PA 1IOZA 1QRAA 3EZ6A 3I61A 2BEKA 1ZAKA 4WZBE 2CK3D 1Q44A 2RGAA 1MOZA 1SZPA 2DY1A 5JFGA 2FDCA 1A2BA 2QL6A 4CVNA 1MABB 5TB5A 1JJ7A 1J70A 1J99A 4ASUD 4B33A 1JB1A 5B30A 2PX3A 2EWVA 4GL2A 2RH5A 3H4MA 3FPAA 3VNVA 3FGNA 4HUQA 4LHZA 4MKIA 3RS3A 2PEYA 2NOAA 1B0UA 1DOAA 3U44A 3VU9B 2JLWA 3GJ8A 1R0YA 4NKRA 2W58A 3A36A 1N6PA 3K9HA 3ZIAD 4DB4A 3UWOA 2GZAA 4Z8XA 2IW3A 2V55B 2W0MA 3BORA 1YZLA 4BFWA 2DFNA 2VO1A 2GK6A 4C0SA 1YVDA 4KSCA 1XB2A 3DM5A 2E1RA 1EK0A 2GRJA 2UZIR 3CZPA 4BASA 4URVR 1CJKC 1T5IA 4ABYA 3LW7A 4IXMA 5E7MA 1VG0B 1PUJA 1T91A 2ZRIA 3B7GA 4WIAA 2ZJZA 2J1LA 3PUXA 4M1OA 3TGPA 1OPXA 4CF7A 1W4AA 2Z6VA 4NBSA 1NN0A 3B2EA 4TT3D 2R62A 1E9AA 1IY2A 3MSXA 1QHIA 3AF2A 4PHFA 2QUZA 5AJVB 2VLIA 3RS4A 2O8BA 2D7CA 2C5LA 1VTKA 4FCWA 1X1RA 1TF5A 1ZMXA 2NO0A 2RKOA 2BJWA 4LDJA 3GLFE 5FUYA 2CJWA 2A5YB 2IF2A 3IIJA 4PSAA 2KE5A 3TR0A 3NBZC 1Z06A 2NO6A 1HT2E 1CJMA 3OFNA 5L3QB 2P6RA 1GITA 1W0KA 2C78A 5FBVB 3AVPA 3CPEA 4N1AA 3VR5A 3PEUA 1UBEA 5HPYB 2IS6A 4B73A 5J4VA 1XXHB 1MO3A 4FD2A 1R5OA 3AKYA 2CL6X 1MO6A 1GZSA 3RVBA 1G17A 2FE4A 3EPJA 1RRCA 2XTZA 3RSOA 1JXOA 4X8OA 4OHWA 1L4YA 1NBMA 3IKJA 1XTIA 1YKSA 2EFHB 1QHNA 4FMDF 2WJYA 3KTAB 1WRBA 1SXJD 3PUYA 4IVPA 4M1MA 3I73A 5DGXA 2BJVA 621PA 1XPOA 2ZS9A 4DLYA 5UKDA 1KMHB 1E1QD 3MWLA 3WP1B 4DIDA 5JSZA 1DAHA 2RCNA 4AI6A 4EDHA 3LDAA 3I5XA 2MSEB 2ZUDA 3QXJA 3NBXX 1TAGA 1QDEA 3VAAA 1Z6XA 4JBYA 5KUTA 2F3RA 4IHQA 1AIPA 3R9XA 3IGFA 4IOMA 4R7ZA 2G1KA 5JEEA 1M7HA 1VYUA 4W5WA 3GFTA 4JLDA 3X1WA 2JDIA 4PTLA 3LX8A 2O8CB 1UDXA 3P1JA 4Z1MD 2KRKA 1GL6A 1VCNA 4JLAA 1IN8A 3OEEA 4YMSA 1UKZA 4PXAA 3JVUA 4XWAA 3ZZTA 4JKIA 1EX7A 5KDOA 1Z28A 5J4LA 8OHMA 2FFQA 2HUPA 4HB0A 1CXZA 1F48A 2GAOA 3RWOA 4EQ6B 5C1BA 4US0R 3U7HB 1BKDR 1GTVA 4HZUB 1EFRD 3W9YA 3ADKA 2XZOA 3IHWA 1P5ZB 3KQKA 2CHQA 3TE6A 3NVAA 2EU8A 4M0LA 4RKFA 1FTSA 1TF7A 3W3ZB 1R5NA 3TH5A 3A37A 4JJZA 2Z83A 4UXHA 2WM9B 3ZH9B 4XSHA 2A7QA 2WWIA 3AVOA 4EFNA 1GKIA 4Q9IA 1QHHB 2F7SA 1KI9A 1HE8B 1FNMA 1Z22A 1VYTA 3NXSA 4V0LA 1N6LA 2W83A 2CCJA 3B60A 5G40A 3BFKA 3P26A 1Z0DA 1J8YF 3CWZA 5G41A 4Q9KA 4AWXA 3PEVA 4A8JA 3MG9A 4OI1A 1T3LA 2I1VB 2X19A 3L2OB 4BQSA 3AVYA 2C8VA 2QSYA 2VIIA 1GNQA 4CEIA 2FV8A 4NL4H 3QG1A 2W2XA 5HKKA 2ZRPA 5FPSA 4DLVA 2FZLA 3WRXC 2H17A 4A0FA 2X2FA 3ZS8A 4E03A 2O0HA 3NC0C 3TJZA 2EYUA 1KK2A 2REOA 3LLMA 2ZREA 4LBZA 1MO4A 2XNDD 3QKSA 3SYKA 1X6VA 4B44A 1DG1G 1G1MA 1PLLA 3T15A 4KAXA 2YWHA 2ZJ2A 2AFHE 3U7EB 4PO8A 3CF6R 4OYHA 5TARA 1W5SA 2IS2A 3BIFA 5FTNA 4D82A 1SXJC 1YU9A 4RKEA 1S1MA 4AY2A 1G18A 2GXSA 1NKSA 2PEZA 5TMPA 4A4DA 1F2TB 4KFTA 2OV2A 1SVKA 1NMXA 1W0JA 1TL7C 4KLNA 3QPWA 2KB0A 2VP6A 2VSOA 1U98A 1KZGB 1NLYA 1MT0A 5JJKA 3QXCA 1ZM2A 5DI3A 4P4UA 1D9XA 5G3YA 1KSHA 2CMKA 1GG2A 2OAQ1 2ATXA 1E2MA 4H1UA 1YQTA 2J7PA 2ZE7A 4B48A 1N25A 1NMYA 4B3DA 1GUAA 1OXVA 1KDOA 2QE7D 2PLRA 4EIWA 4HAWA 3KXIA 3BXZA 1CP2A 4OHVA 2OCYC 3Q72A 2BV3A 2XTNA 2ZS8A 4MUBA 4IRUB 2R8RA 2HEIA 2W2VA 3DL0A 5GJBA 1Z08A 3Q85A 1ZM9A 2VHUA 1YZQA 3KFVA 2ZRKA 3MRSA 1CEEA 2OHFA 4EKDA 1TEXA 1E6CA 2WMNB 5FPKA 1Q3HA 2ZRGA 1DAIA 4TLDA 3MWKA 1NG1A 4GMXA 2GBLC 4KYIB 4RJLA 4URYR 5JJLA 4PO1A 1W36D 1ZD8A 5JS7A 1T0HB 4LRWA 2G6BA 1NY6A 3LNCA 4C30A 4NDZA 2XEXA 2BKEA 2ZE8A 4HLCA 4LI0A 3GEHA 4Q18A 4RD1A 4AYTA 1NLFA 3MCAA 5L3QA 3EG5A 1E2KA 5EUQB 1ESNA 3KB2A 2WWYA 4LBVA 2ERYA 2V7QA 4JLJA 2WKRA 1DAFA 1Q20A 1FNNA 2OCPA 3RS0A 3RC3A 3CRMA 1L7VC 3B1ZA 1H8EA 5CIWA 1UKEA 1CR0A 3NWJA 2GCOB 3EWAA 4NYMQ 3HPRA 4LRSA 5FBRB 4BECA 1KJYA 4Q9HA 3KTAA 1N0WA 1LW7A 1D2NA 2D06A 3VFDA 3MHVC 1NN5A 3VHLB 2GF0A 4TYWA 1GRNA 5C46F 4BFUA 5CDFE 1LS6A 2J9RA 2VPPA 2W6ID 3B9QA 1VIYA 4V02A 5FL7D 2B21A 1FTNA 3IO3A 4ZDKA 3VX3A 1ODFA 4Q1DA 4XVQA 5ANRB 4C0QC 2HLDD 1L4UA 4TL7A 1I4TD 1E0AA 3OAAA 2O8EB 4PQFA 2GXQA 4LJAA 5L3SB 4RZUA 1ZUIA 2RGGA 1NY5A 221PA 4GDFA 4C7OB 3CF2A 2J87A 2KJQA 2ZSBA 4IOJA 4B6FA 1CTQA 2WV9A 3LH5A 4QRHA 3THYB 2RB4A 4HAYA 3HYRA 3KX2A 1BS1A 2ZJYA 2JAQA 1RPZA 3M0EA 4Q48A 2ZE6A 2XB2A 1E96A 4V0NA 4Q9LA 2GJ9A 4IDQA 4HZUA 1N6OA 3SJCA 3VR3A 1E2DA 4G3XA 2P3SA 2PZFA 5FPYA 5J40A 5GJVC 1DAMA 5DN6D 3U3KA 1YE8A 2QPAA 2ZSFA 4JLNA 4MKGA 3TLXA 1KKLA 1OYWA 3BB4A 2B6HA 3QVVA 2CHVA 2QP9X 4NYMR 2QAJA 4PC2A 4QBGB 3V9PA 3U6KA 1N6NA 4FCTA 2JLSA 2XSZA 1VCOA 2ZROA 4RFVA 4TZ6A 4D26A 1G8HA 2DCUA 3KJGA 1QHHA 3AP2A 1XZQA 3THWB 1I2DA 3F8TA 3N5CA 4PAMA 3RS5A 2R2AA 2FSFA 2YOGA 2V6JA 3K1JA 3SFZA 1DARA 3VLFB 4AYXA 4GITA 1UADA 4PHHA 4JT2A 1XPUA 2IYQA 1D2EA 1ZM3A 3ETLA 4QHTA 1W36C 3SS8A 3TRFA 1BOFA 2ZRCA 3LBHA 3B5JA 1Z0FA 1ZNXA 1ZYUA 3O8BA 4TSFD 5JEDA 2P2LA 4LPSA 2OBMA 3N2EA 4EUNA 2EFDB 3ICQB 5JWOA 4LGMA 4PZZA 3PITA 4QGGA 4Q4AB 2HV8A 2J5XA 3AVQA 2D74A 1ZUNB 5JZVA 4GZLA 4YONB 3U7FB 1NP6A 4MDEA 3RRMA 3C5HA 2VP0A 3CPJB 3L0SA 1KO1A 4BEJA 1HQCA 3SOPA 1U9IC 2J0VA 2XJ4A 4I99A 3AVXA 2ZR0A 2IS1A 1DAEA 1TUIA 4KYUA 3U5ZB 4BLQA 1W46A 4C4PA 2NZ8A 3OIYA 1XD9A 2OZEA 2AL7A 4Z54A 1DVRA 3KJIA 3FE2A 1S3GA 2IEYA 3K09C 1PJRA 3T34A 1DE0A 3MJRA 3EASA 1E2PA 2GJKA 4LJ5A 1GFIA 2PMDA 2FFBA 2OXCA 5DE3A 2WJGA 1OYYA 3CRVA 4L9WA 4D81A 3IHLA 4I1OA 4Q4LA 1M7GA 1N6IA 4M1TA 4K8OA 5CJ2A 4B2IA 1KI2A 1S0UA 2PBRA 1GILA 4LHXA 1N5LA 4HLUC 2J0QA 1GKYA 3WNCA 1W4CA 4DB2A 2EWWA 5JWHA 4F93B 4YXWA 1W2HA 1RRPA 1PLKA 2GHIA 4TMKA 2F55A 2J0SA 3TQFA 4Q4JB 1SXJB 4G01B 2W6JD 1XTJA 3CNLA 2QAGC 3A1WA 2JIZD 2FH5B 2A3RA 2ZJ8A 1KO7A 2IL1A 1KK3A 3QKRA 5TY0A 1CF4A 3SZRA 3IBGA 1E2QA 3QJYA 1E2JA 1IBRA 2IYZA 2AR7A 1JQLB 2ECKA 3W3AA 4FXPA 3SHWA 1JI0A 3THXB 3VR4A 1VG8A 4C0KA 1LTQA 5JCPA 4HDOB 3QPVA 4WZ6A 1WDTA 3L8YA 1G41A 4UJ3A 3ICEA 3VNUA 4PQRA 4FMDB 1HEIA 3QOFA 1W4RA 2AXNA 1N5JA 2BBTA 4DDWA 5H68A 4QGFA 4LHWA 1XD2B 1XF9A 2FGJA 3AF3A 1UKVY 4DBLC 5AJYA 4TL6A 2WICA 4B76A 2GCOA 1ZD1A 1G9XA 4FWTA 2ZUCA 1AKYA 4OL0A 2Z5FA 4DUGD 4C3ZA 2XZLA 2F1JA 2EFEB 3THOA 1TQ2A 3ADCA 4LYFA 4DSTA 3BH0A 4CDGA 2JEOA 2A5GA 3A8TA 4MRRA 4ZDIA 4NHOA 2DWOA 1JJVA 4L5BA 1FUKA 4JYCA 3QNUA 5C18A 4E22A 1SKYB 4QGHA 4KI0A 3NDPA 2HDNB 5L3SA 3EIHA 2X2EA 5FL3A 3H1TA 3TUJC 4C7OA 1TNDA 4AKHA 5EE0A 1Q22A 5CYPA 5K8UA 3W34A 1YZNA 3U4QB 2PJZA 1RJ9B 1T6NA 5E4FA 1UEIA 4H1VA 1D8TA 1Q3TA 5EXPA 4HATA 2R6CA 1QVAA 3TUIC 1E0SA 3MUFA 4JSYA 4M1WA 2IF0A 2J0UB 4M9QA 3CRQA 1UDWA 1W49A 2QBYA 1GRQA 3NBFA 5B58C 1TADA 3CM0A 1SKQA 3D7MA 1N5KA 3AGPA 4XD7A 1VECA 1GL7A 1Q1BA 2ZI3A 1OF1A 4A2PA 2D7DA 2JJ1D 1E2IA 2XITA 5KNDA 4LV5B 1VCIA 4PZLA 4TTQA 2VHJA 3R8FA 4BLOA 4A82A 4RD0A 2WMOB 4OI2A 2C03A 4TMZA 4Q19A 3THWA 1S2MA 2N1BA 2DHRA 1OSNA 1P6XA 4JYBA 3GPLA 1R4AA 5DHAA 4EPTA 1B23P 1BMFA 3K0SA 2IUUA 2WSSA 3DKPA 2A2ZA 4HDCA 3CO5A 4L16A 1JAIA 4PPGA 3WYAA 4WXPA 2IYTA 2QP3A 4XH9B 2QGNA 1LV7A 1SVMA 3RDPA 5JRZA 1NSTA 1XWIA 3OIUA 1A82A 4Z8YA 4HAXA 4Q9JA 3ZIAA 3DZ8A 1II8B 4PC7A 4DDVA 3A4NA 1G64A 5EE1A 4KBGA 1YZUA 1JXMA 4IKEA 1K5GA 2LKDA 4GBMA 2QSZA 3B8HA 4QKQA 4FMBB 4HAZA 3NG1A 1CKEA 3U6BA 1PUIA 1Z6TA 2ZETA 2ZXUA 4QJ5A 2QMHA 1OH5A 1OFIA 3OESA 4Q5IA 3R7WB 1ESMA 2B7CA 2JLVA 2D2FA 3B82A 2YOHA 4AG5A 1N0UA 2QMEA 4P33A 4TTPA 4NE2A 2WPDA 1M34E 3QF4A 4IDOA 4I4LA 3AKCA 3L8ZA 5C2JB 3QBTA 5CDFA 2VP4A 4GP7A 2FU5C 4ZCLA 4JSTA 3AVTA 2PL3A 2IA5A 1OB2A 4A9AA 4CEHA 3LV8A 3X1ZA 1KY3A 3IUYA 1GNRA 1YR6A 1W36B 1F2UB 1KI3A 1OHHD 2Z4SA 3H84A 2OCAA 5FTJA 2C9YA 2Q6TA 3BRWD 3LWNA 1KGDA 2YOFA 5A5GA 3SI7A 1E0JA 2I4IA 1IJEA 4Q47A 4AD8A 1E9FA 2A30A 1YR7A 4DCSA 1RC8A 1UAAA 2WOOA 3QENA 2JLZA 1G3UA 4R2HA 1DPFA 3KKPA 4B74A 5EXSA 2ZVQX 3SR0A 5BXQC 2NGRA 2QT0A 4ZDJA 4UJ5A 2A5DA 1FP6A 3PEYA 4XIGS 3LLUA 1SXJA 5H8WA 4UXIA 2ODBA 3P27A 5SZIA 3AQ4A 2BCJQ 3M1IA 3V4FA 1EG7A 4QG7A 2OO7A 2ZQ5A 3N70A 3U2QA 5KPDA 3AVWA 4TQ9A 4KFUA 1W7AA 2Q9AA 4DIEA 2GKSA 3LQQA 3THXA 2RHDA 2VL7A 1MR3F 1SVWA 2JASA 2F1IA 3A58B 4BE7B 1S96A 1M8PA 5KDDA 1VMAA 1R6BX 1U81A 4ZCMA 1L8QA 4AYWA 5AUNB 1T8TA 3RANA 2J41A 4OQMA 3T06B 1G4AE 3MGCA 5B64A 2CL7X 4K46A 1G8PA 4Z1MA 3BB1A 3ONWA 3OE7D 4LWZA 4OBEA 2DVWB 1XMIA 1Q1QA 4DLZA 4XSGA 5BYKA 2FEOA 1JEEA 2RGCA 4UNNA 1T3HA 4IOKA 4YC7A 1E99A 5FH9A 5JMTA 2QZ4A 2QAGB 1R0ZA 3SEAA 5FPTA 4GPTA 5AJZA 5H70A 4LC1A 1YRAA 2YWFA 4ZIRA 5IK2D 1IQPA 4C0BA 1SVLA 3ZZUA 4NCKA 2RGNC 5JECA 4EFLA 1KK1A 2VA8A 4W5JA 4P4SB 2YJTD 4G5SA 5DYGA 4B3GA 2ONJA 1EXMA 3LO5A 2BKUA 5KNCA 2O5VA 1E9BA 3TMKA 4RCYA 3QF7A 4MGKR 1CR2A 1RJ9A 2ZIAA 3B78A 1YR9A 3MJHA 2G9NA 3GLGB 5E7IA 4JL5A 4Q7JB 1HV8A 1U0JA 4PO9A 3TNFA 3GEEA 4D4JA 1US8A 1GP2A 4U02A 1N6HA 2IHBA 4B43A 3KL4A 2ZAMA 2BMFA 2C9CA 2PLFA 4TQAA 3TK1A 4BZXA 5EXTA 1VG9B 3OZXA 1UF9A 4MGYR 3OEHD 2ODEA 1XTQA 2CVFA 1X86B 4CIDA 2FOLA 4BFVA 3IO5A 4WBSA 1OXUA 2C98A 1CU1A 2OXRA 3ZZ0A 3WHKA 4NYIQ 1X1SA 1E79A 1E9CA 4A6PA 5DLQC 1JR3A 5P21A 1VYVA 2H18A 1AKEA 1Z0AA 4P31A 1E2EA 3TAUA 5L8VA 3CX8A 3Q5DA 3SN6A 3ZD6A 1E4YA 3RRNA 1ZP6A 2RAPA 4BGDA 4NYJQ 5KSYA 2F43B 1YZTA 1QG2A 2QROA 3R8CA 3REFA 1AS3A 2XJ9A 4QJ4A 2NO7A 3LVQE 4BUJA 4M8NE 1Q57A 2G3YA 2PZEA 4URZR 3GJ6A 2QP4A 3NTUA 4Q1BA 3I8XA 4IFEA 4UKDA 2ZI5A 4MITA 4PQYA 1OB5A 2VHCA 3UIEA 3NBYC 3OIVA 1KO8A 2O8DA 4LYJA 2YWEA 1XZPA 4CRWB 4MUAA 3TSWA 1WXQA 3WMFA 4ITRC 1WF3A 3T35A 2DFLA 3EAQA 1X8JA 2P6UA 4YMVA 4HAVA 4CGZA 1BYIA 5KU1A 4IDHA 2B7BA 4F4CA 1FFHA 2OLKA 1ZC3A 2P65A 3LVRE 4GNKA 3UWKA 4JBXA 2BCGY 5EUMA 3QIAA 3R7WA 3VQTA 3W90A 4Q01A 4A0HA 2R6DA 3ZD7A 5FI0B 4QNMA 5DIFA 4A92A 4V0ME 5LBIA 3DM9B 4DKXA 1K5DA 1LNZA 2YHSA 5A0FA 4MRSA 1GVNB 1FOEB 2XTMA 4NU0A 4A2QA 2LCFA 2GETA 1HUQA 2IYWA 4TWZA 1WB9A 3Q9LA 5BWMA 3HYTA 3K0EA 2O8FB 1ZINA 2ZRJA 2GJ8A 4JBWA 4Q21A 4GSYA 1KDPA 2TMKA 3QUSA 4MA4A 1ZU5A 4G5OA 5D3MB 3S1AB 1F2UA 3EPKA 4W5HA 5JJIA 4L8GA 2OFWA 2KSQA 4TQUS 1EX6A 4ARZB 2VYFA 3O8RA 1NIPA 3GMTA 2DBYA 1TQ6A 4NYJR 2JJ2D 2X1VA 2NO9A 5CK5A 5TDHA 4EJSC 2QMUA 1CRPA 2BVNA 3I32A 1P60A 3I72A 2HXSA 2F9LA 2ZUBA 1XCGB 1NN3A 3TBKA 2H7VA 4M9XA 1LB1B 1G8GA 1F60A 1XFAA 5C4MA 1KHTA 5B2ZA 4DC9A 2FPKA 2Q3HA 4R9UC 1LY1A 2IYYA 2GEVA 2Q3MA 3P20A 2CDNA 4PPFA 2H16A 4PANA 5KSPA 1YHNA 3R20A 5SZHB 1MO5A 2ZRHA 4RD6A 4ZCIA 1QHGA 1HTWA 1HURA 4IEIA 2EFGA 2A5FA 1VIAA 3PXGA 1ZU4A 2DB3A 1S3SA 1MABA 3OFND 1M6NA 1T0JB 1Z0JA 3X1YA 2W6IA 3K09A 1UKYA 5FL7A 4ZI2A 3PIRA 1P2SA 5CJPA 1AJEA 1S9HA 2IEZA 3QXSA 2WKQA 4DCUA 5DNYB 5FOXA 1O87A 2HLDA 2IXEA 3WYFA 4G0NA 1C9KA 2OE2A 4NCNA 4TL8A 1NBMD 4MKHA 3HU2A 4LOAA 5JS8A 3VU9A 1NVWQ 3F0TA 1TEVA 2BM0A 1Q1EA 2KBFA 3WRYC 3K0CC 3SJAA 3PUWA 2V4ZA 1OXSC 1U0HC 4DZZA 3RHFA 1FX0B 1YRBA 5BN5A 1UJ2A 1ZM7A 3K70D 3A4MA 4JJKA 2W00A 2B8WA 3WP0A 4LZZA 2RGEA 1CJVC 1TTTA 4PX9A 3GLIB 4AIIA 4B2PA 4DLUA 5M04A 3SU8A 1PVOA 1G6HA 2FG5A 3NEJA 2J46A 1G7TA 3JZAA 1G3QA 2P0EA 3CZQA 1GKUB 2HT1A 2GCPA 4JT4A 2QTVB 5KHOC 1GOTA 2PT5A 5GVRA 4ACBA 1N2CE 3TSOA 4M9SA 3B1WA 3WYGA 1F3OA 1KSJA 2GVDC 3OEED 4HLQB 4LPKA 1OT3A 3U61B 4YMUA 4XOIA 2REBA 3PG5A 4QFMA 1VHLA 4FW9A 4B3CA 4M2LA 1KMQA 4BFSA 3OHMA 4I1SA 3DZDA 3TUZC 1IXRC 3GLGA 3O8CA 3REGA 2YC4C 2VBCA 3IIKA 1E0KA 4Q4HB 3SBEA 3V00A 2WIBA 1AQYA 4C2TA 4LHYA 3BWDD 1YJ5A 1XXHA 4TSFA 5IDVA 3W6OA 3RRZA 2OAP1 3TW4A 3ASYA 1RIFA 2ZSDA 4A1FA 2NQ2C 3AH8A 5DI9A 3IEVA 2FA9A 3ZVNA 2QN6A 4QC2A 121PA 3K53A 2ZRNA 4YDSA 2QT1A 3WBJA 3A1SA 4C0AC 3MAAC 1KMHA 3PEWA 3WBKA 4P32A 4BLSA 2BDTA 2ZYVX 4B35A 2QENA 3U60B 3SFVA 5EP3A 2HJVA 4ZDWA 3FMOB 5GVSA 3FMIA 5EXXA 2CE7A 2F43A 2NPFA 1Z3IX 1R0XA 2F3TA 2D2EA 1W47A 1WQ1R 2K5UA 1RRGA 4FIDA 1JECA 1XP8A 4ZPXA 3W5IA 2ZVPX 2ZU0C 2HYIC 1P2TA 2WTUA 3CX6A 2O8CA 4EFMA 4JKYA 4LRTA 2IT1A 2AXPA 2JA1A 2OBLA 4KLZA 3AEZA 4PSKA 1SVOA 5HE9A 3NIBA 1FMLA 2QTHA 2B92A 2BM1A 3BE4A 3I4LA 3EWSA 2VF7A 4UNRA 4EQ6A 3UXMA 1O3YA 3AKEA 5EP1A 3LA6A 3LBIA 4XJXA 1W0JD 2ZJBA 1FZQA 4B32A 3A1VA 2GNOA 3K0FB 1SXJE 5EQTA 4WXRA 4TTRA 3K70C 5L3RA 4XWOA 4D2IA 1YZGA 3BB3A 1IN6A 2W6JA 3AGQA 2FGKA 2GCNA 3DMDA 2UVQA 3C16C 4MYUA 4TMXA 2ZS7A 1JEDA 2FSHA 4KHZA 2N42A 2J7PD 5FUWA 3IBYA 4KU4A 1FW6A 2G83A 3HDTA 4E5UA 1KYIA 3FWYA 4F4JA 4R2IA 5EE9A 4ARZA 1G7CA 2C95A 2JJ8A 2A9KA 2LWIA 2O0KA 1A4RA 2P5TB 4JLBA 4OK5A 3PUZA 4B34A 3VR2A 4DDUA 3Q7QA 4V03A 4NCJA 1COWD 2AWOA 1BYUA 1W2GA 4OQXA 3EA5A 1NMZA 2FPMA 3QXHA 4EPXA 4L15A 3KJHA 5DISB 1WBDA 5KPJA 4TLCA 4DT1B 3BFXA 3U3MA 4ACAA 3K8YA 4GZMA 4DCTA 3VX4A 4OKSA 3VR1A 2PH1A 1U2RA 3VKHA 5FPHA 1EFUA 3I92A 4LJ8A 4D80A 1XEWY 4G1UC 4FI3C 3GFOA 2ZSEA 5FI1B 3B9PA 3ASZA 3TVDA 4R71A 5EZ6B 5CM8B 3IQWA 4L4UA 1SKYE 1AGPA 2IHYA 4YLGA 4R98A 1KOFA 1CR4A 1GSIA 3A4LA 3QE0A 1F2TA 3F5FA 5KNBA 2ANBA 1P3JA 4LYHA 2PCJA 4A8JC 4EJSB 1XCMA 4Q66C 4I1VA 3U3RA 3EPHA 2FSIA 2ORIA 3D3QA 4FINA 2Q3FA 1NVVQ 4U5XA 3FFBA 3D6TB 3AVUA 3ZJYA 3UMFA 3EARA 3BERA 4NMMA 5LDDC 2VSFA 1HE1C 2GJSA 3PVSA 4TLEA 4C9BA 3NH6A 3G5UA 2GILA 5CB6A 2Q0HA 4MKFA 1H8HD 3VKWA 1S4QA 1KJWA 3DHWC 2IYSA 2I3BA 4M9ZA 5HTKA 2IS4A 4NPHA 3OAAD 1G4UR 2GK7A 2HCBA 1Z5ZA 4NZYA 2JJ1A 1E32A 3SNHA 3VTKA 4U00A 1G7SA 4MQBA 2BHRA 1JR3E 2F6RA 2GA8A 3SBDA 1F5NA 4V0MA 4IXNA 3O47A 4LJYA 5FBLB 2QRNA 5HR5A 3KKOA 2ZSAA 4LX0A 5JI3E 1P62B 4MGIR 1G3RA 3KKMA 1DTSA 1SQ5A 2XNSA 2ZRBA 2ZYUX 1E94E 1EESA 1KY2A 4EPYA 1OXTA 3SJBA 1D2MA 3T5DA 2OT3B 4IJMA 1ELOA 2X77A 4UQOA 1D5CA 2MSCB 2REXB 3T1OA 4Q4HA 5FOVA 4RD2A 1U90A 4N0EA 2X8AA 1JALA 3U3OA 4UXJA 3SC3A 1SULA 2BBSA 1OV4A 1NIJA 5EP2A 1NVVR 2H57A 1UM8A 1MV5A 2AK2A 2N46A 2XSZD 2QTFA 1E2NA 5HCIA 1DELA 1ZVQA 2XXAB 4PR0A 2WZQA 5FOWA 4F7WA 1XJ0A 5JCZA 4QOSA 2EW1A 2DWZB 1E1RD 1QHYA 3K9GA 5KDLA 2XOKD 2J59A 2NZJA 4D0GA 3EZ2A 1A7JA 1TPZA 2FN4A 3AKDA 1AS0A 4JMPA 4V0OA 3WNBA 1GRRA 3CNNA 1KI1A 3ZVRA 2Z43A 3U44B 1E2HA 2QQEA 1OKKA 3FFAA 5BW8A 1XTSA 4Q1EA 1TU3A 2HT6A 3PV0A 2O8EA 4Q1AA 2O52A 4HB3A 3FKSA 2P67A 3ZS9A 2Z4RA 4KO8A 4G5RA 5AJWA 1OHHA 4JZKA 4TMWA 4JL8A 2JLYA 2VSXA 3B85A 2GWHA 4EPWA 4MRNA 1FPMA 1TQ4A 5CM9C 2WSMA 2VP5A 1I2MA 1E9EA 4URUR 4LY6A 1NJGA 3THYA 3KXKA 4W9MC 1SVIA 4KFRA 2PT7A 4QXAA 4D4MA 4LSGA 5KYKA 521PA 3SQWA 3D31A 4A0GA 4AKEA 1XRJA 2AK3A 2QA5A 1AK2A 1R0WA 2ZRDA 3J81k 1IXZA 3X2SA 3K0FA 2O8BB 3VHXA 5EJEA 3E2IA 2JGNA 3O8DA 1Z2AA 2GZDA 3TSZA 4BZPA 3R9WA 3I1FA 3JVVA 1E2GA 3GLHB 2ZR9A 2RGXA 2GVZC 2ZPTX 4RVCA 2G77B 5CK4A 3OIWA 4LJ9A 2CJWB 3MWJA 2IK8A 1Z8FA 5JHGB 4C0JA 4S35A 4DRZA 1JPJA 2VP9A 2G1JA 2CK3A 1P9NA 2Y8EA 4Y0AA 4BRWA 3KW6A 1T4GA 1XMJA 5DSZA 3DO6A 3QSYA 4RZ3A 3HU1A 2ZITA 2YINC 1XNJA 5F2EA 4ASUA 4LHVA 4Z51A 4PAQA 1Z0IA 4IDPA 2FNAA 1PZNA 1T3SA 1G3IA 1Z6YA 1T8UA 1ONBA 1QHXA 5L3VA 1GDDA 1ZNYA 2IYVA 4ZO4A 5LPNA 1XMSA 4YXWD 4F92B 4XTCS 3CB4A 4IDNA 1OFTA 3CONA 3LXXA 2GJAA 1BO6A 4MDFA 2ORVA 4BZQA 1ZIPA 2V1XA 4D25A 4BPBA 2VP2A 3GD7A 4GMDA 4M1YA 1AZTA 3Q3JB 5G3ZA 3W6PA 5CB8A 1N0VC 5JSZB 2C04A 4B3XA 2AD5A 1X8LA 4O0MA 3P4YA 2GEUA 4Q4AA 5J4HA 5IF9A 3K70B 1X37A 4BRUA 4JLVA 4DHEA 2QMOA 1IM2A 3VKGA 1Z07A 1ZNWA 3SYLA 3CWQA 4C0LA 1E98A 1NF3A 2ZTSA 3A6PC 4FWIB 4Q7MB 4B2LA 2OUKA 4O3MA 3D8BA 1G21E 4JLKA 1RZ3A 3AUXA 4TT3A 4OHXA 4CEJB 3WY9A 4TYNA 1Z0KA 1KI6B 1CRQA 2CLDX 2V54A 4WOPA 2ZRMA 3FHOA 4OK6A 5FR1A 5TVKA 4ZV4A 4M1SA 2B8TA 2OSBA 5KOYA 5GJCA 1UPTA 1P72A 4GRAA 3GLGE 1ZIOA 2ZAOA 1U8YA 1ZRHA 4XVUA 1Q0UA 3LFUA 4MYTA 1OIXA 5J5CA 4A0RA 2XB4A 2YC2C 5LD2C 5JHHB 2ZRLA 2IYUA 3FYHA 1U94A 3C7KA 3KQHA 3B1XA 5E3HA 1XXHE 1X3SA 4GI7A 2OM2A 3CKLA 4A6XA 5FTLA 2VRWA 1KI8A 1NKTA 1KAGA 1XPRA 3OEHA 5E95A 3L0IB 4TLBA 3QQ5A 4JLPA 3VMFA 4Y0VA 3KUCA 4DLWA 5FR2A 3QI2A 4Q4JA 2VHTA 4PHGA 5K8LA 4Q1FA 3RWMB 2GTPA 5F98A 2QPTA 3UK6A 1CULC 1KNQA 1QZXA 2ZI4A 1E1QA 1KNXA 1UEJA 2ZI6A 2ATVA 3RYTC 4HI0E 4D0LB 1WCV1 2ZJ5A 2SHKA 4NCHA 4TN1A 4A8JB 1HQYE 2BBOA 2GXAA 1R5BA 1FUUA 3MFYA 3X1DA 4CEIB 2GEDA 5IT5A 1ANKA 4LJ7A 5JRJA 1ZW6A 3IPXA 4TL9A 1RE0A 4BLTA 3K0CA 5KSOA 4YQFA 2MMGA 2R44A 4B6EA 3RLFA 1MRNA 1XEXB 4XD7D 3AB3A 4II7A 5FOTA 3WMGA 1J90A 4HZIA 1AZSC 1XTRA 1W1WA 1Z2CA 3BFVA 4YDHB 3QKSB 1LS1A 1CJUC 4D6PA 2HF8A 1XD2A 3OF5A 1AGRA 1GL9B 1N3BA 1SHZA 2CNWD 1H65A 2DWQA 3HR7A 2XXAA 1KO4A 2WOJA 3QKTA 1TUEA 1GWNA 3QY0A 5BYJA 2YVUA 1J2JA 1C1KA 1U0LA 1BMFD 3TW8B 1EFRA 2WSSD 4MH0R 4RFSB 4NTZA 2NMVA 3FTQA 3C14C 3RNLA 1XU4A 1NJFA 1G8FA 1KI7A 1X8KA 5DI3B 2GBLA 2AD1A 1R8QA 4A3VB 1DS6A 3T1QA 1Z29A 2WWWA 3N2IA 4F91B 3EPLA 2E9SA 2AKYA 4XWKA 4UNSA 2YNMA 2KI5A 1KDTA 1V5WA 4M22A 1XCPA 1IJFA 1G16A 4LJ6A 2KBEA 3ADBA 1RKBA 2FFHA 5DYIA 1QHSA 4M53A 2AN9A 2ZJOA 4B3BA 1U8AA 4DVGA 5K8TA 3AJIB 4B71A 4QGAA 2WHXA 3JZMA 3U4QA 2A5JA 4IVQA 1E3MA 2YYZA 1UFQA 2BOVA 2JJ2A 1ZD9A 2IXGA 4UNPA 2OEPA 4K81B 1NVMA 3KJEA 3SHFA 2IUSA 3DOEA 4DEXA 2NIPA 2WPDD 1AN0A 4NONA 4PFSA 4E07A 5JWRA 1JR6A 2J0UA 2BBWA 3LW8A 1W4BA 3DVLA 1OFUX 3GEIA 3B6EA 2QORA 3A1UA 2H1LA 3KXLA 3LRPA 3GLHA 1YR8A 4AKIA 1I4DD 1R2QA 5GJWC 1XEWX 3E70C 3LQRA 4M21A 4DCNA 2XNDA 2CLCX 1T9HA 3M4YA 5BQ5A 3U7GA 4GOXA 3GJ0A 4KFSA 3ND9A 2QY9A 3X1XA 1I4LD 1KJZA 3UG7A 3QKUA 3FHCB 3HWSA 2J7KA 4O2RA 4H9GA 2MMCA 2D62A 3BOSA 4M4SA 5FBWB 2FF7A 1Z63A 4KVAA 1TQDA 4LYAA 1XBTA 3G0HA 5CIQA 1EWRA 3BBPA 1JPNA 3E5HA 1OW3B 4IOLA 3QPUA 2FZ4A 1II8A 1NN1A 1G6OA 3GFPA 3UATA 3T5GA 4OI0A 3ZVLA 1JBKA 3AV0B 2OCBA 2W0SA 1M1YE 4UNQA 4OI4A 1IONA 4TYYA 1Z47A 5HZHA 2QE7A 2QGZA 3GLIE 3KB1A 4I81A 1T5LA 2FJUA 3PENA 2ZRFA 4QBHA 4KITB 1OH6A 3TVTA 4KBFA 4O2LA 1ZUHA 4ON9A 3WHLA 4RSGA 3NDBB 4B3FX 5J4KA 4CEJA 1SGWA 1UBFA 3CPHA 1S8FA 1IN7A 1DO2A 1TU4A 1QF9A 1Z83A 2WWHA 2XZPA 1IHUA 3L0PA 1NG9A 1KI6A 1W48A 2OG2A 1KIMA 3FKQA 1DBSA 1EFCA 3EX7C 4S2EA 2ZI7A 4M1KA 4NYIR 4OQNA 1E9SA 1P9WA 3CF0A 2BC9A 2C77A 2R6GA 1KO5A 2AFIE 3UANA 5J4YA 5FTKA 4Q03A 2UKDA 1P2UA 2GESA 4HAUA 3TR5A 5BN3A 2QI9C 1HA3A 1S9DA 2UZ3A 4MGZR 1QBKC 4ILEA 4V0KA 2EFCB 3DPUA 1OFHA 1E4VA 2IBMA 1QG4A 4LK2A 4X8HA 3GP8A 2OFXA 3DOFA 1MRSA 3TAHA 2Q9BA 2V9PA 3UMSA 4OJKA 1GIAA 4JVLA 4HUTA 4PC1A 5KSZA 4DEYA 3FVQA 3NC1C 3B1VA 2H5EA 4TLAA 1E2LA 1XD8A 4HYYA 3SDZA 4DLSA 3C5CA 1U9IA 3K0AB 3W6NA 4DWJA 2C9OA 4HEJA 1AS2A 3TQCA 2ONKA 1WP9A 4A36A 3GLFB 2FX3A 2EYQA 1P7CA 1W0KD 1ZC4A 5AUOB 1P2VA 4JLOA 4IFBA 1JAHA 4PC6A 1Y63A 4PPQA 5DO9A 3KUDA 3DKVA 2VHQA 2PJRA 5JLJA 1N5IA 3CH5A 1LFDB 2WWGA 3ZDQA 5BN4A 2BWJA 2RGDA 5LD2B 1XEXA 2WBLC 3TIFA 4X8MA 4PZYA 2QM8A 1N6KA 3BJIC 4AC9A 3A1TA 2YZ2A 3T1VA 1E79D 3FMPB 2VTKA 4HLUA 1JR3D 4BWYA 1HH4A 1JQJC 3QBVA 4KVGA 4URWR 3AM1A 4FMCF 3BC1A 3LD9A 4RCZA 4O25A 2V6IA 1NRJB 1QZMA 3AF4A 2JLXA 4X8LA 1VG1A 2WJIA 5HE8A 4RFSA 1Z6AA 2QAGA 3EZFA 2QG6A 4IW3B 2ZR7A 2J3EA 4QM6A 1S1CA 1RYFA 5DN6A 4LV8B 1NLZA 2NPIA 3BS4A 5LB4A 6Q21A 2IYLD 3K9NA 5CLLA 3H2YA 4F38A 2JDID 1TX4B 3RABA 1RYHA 3WMEA 2MSDB 3BK7A 3I8SA 2JLRA 1ZBDA 3EW9A 4P4SA 5E7JA 1WBBA 1D9ZA 4TYQA 5A4JA 4LV6A 2FEMA 3GCGA 3UPUA 5SZKB 3IIMA 3U3JA 4TZ0A 4U7DA 1CLUA 4WVFA 3SE0A 1OIVA 1BH2A 2VEDA 1FP7A 4TMTA 4BLRA 1G5TA 4L9SA 5KTYA 3Q5EA 3RAPR 1COWA 3KQNA 3AF0A 4Q00A 1A2KC 2R65A 3NEYA 2AWNA 4IEEA 2ODWA 4JL6A 4DLTA 4ERNA 2O0JA 3I5YA 1WE2A 4US1R 3QKRB 4DDTA 2L0XA 1MH1A 1CBUA 3BGWA 4LBYA 4NCIA 3RC8A 3LAWA 2OFOA 1Y3AA 2GAAA 4Q7LA 4P3YA 3V4RA 3T1TA 1CIPA 2VQSA 4P4TA 2VH5R 4EAQA 1QVRA 1OXXK 1FL9A 2HXYA 5C4GB 1P73A 2WAYA 4KSBA 1HT1E 1U99A 3HP1A 1F6BA 4LBWA 2ZEJA 3DMNA 4YMTA 5JI2E 5B57C 1OLOA 1OE0A 2KWIA 1KSGA 3PFIA 1G19A 3AF1A 2FFAA 3NHAA 5D3QA 2AKAB 1WA5A 4ZKDA 5FUXA 5HKKD 4P0TA 3LX5A 2EVWX 1NVUQ 2V6ZM 5CYOA 1G7RA 4HB2A 3DDCA 2WWXA 4GOKA 3W8NA 4QHSA 1ETUA 5DH9A 5SZJA 2BMJA 1OIWA 2LKCA 3E1SA 5IHPA 2G0TA 4DCVA 1H8HA 4JVMA 4FWHA 3BH6A 1R7RA 3CNOA 3CRW1 4KCGA 3G82C 1SHKA 3IQXA 4KV9A 3EZ7A 1SVSA 4AK9A 5AJXA 3GJ5A 4N3NA 4BFXA 421PA 1RRFA 2QEQA 1IN4A 5LB2A 721PA 1Q12A 1G291 1DG3A 2JIZA 3W8RA 4D4LA 3T12A 2QU8A 2O8FA 3IILA 5ELXA 3LY5A 2PX0A 3S1AA 2D3WA 5D3MA 2ZI9A 1AA9A 3SJZA 3BAFA 1HY3A 2F9MA 4AURA 4JIMA 4C0HA 5G53C 2ZJAA 2QBYB 1EWQA 1KKMA 2RHMA 4CT5A 4WAUA 3RS2A 4KODA 4MYHA 2F1RA 5FBQB 3CW2A 2WVJA 4C2UA 1NVXQ 4RD4A 3MWYW 4LC0A 1CJTC 2BIFA 3ZQ6A 2IX3A 4DUGA 3L0OA 3K0AA 3QG5A 1C4OA 3ECCA 2JLQA 1E1RA 5CITA 1JNYA 1RFLA 3ADDA 2XOKA 4NH0A 3GLFA 5JBQA 4J0QA 2HYDA 2C96A 1VPLA 1RW4A 3BD9A 3KFXA 3QEOA 3KKNA 4PSVA 2YKGA 4JVSB 1G20E 4QM7A 4AKGA 3EXAA 3PR1A 3H86A 1Z6GA 1E69A 1M7BA 1ZCBA 2V7QD 4TYPA 1XX6A 2HF9A 4G5GA 3GQBA 3QEJA 4PHTA 2H92A 1R10A 1DO0A 1XTKA 1E2FA 5CLQA 2ZM5A 1NNEA 2PZGA 1H8ED 2C2HA 2D4HA 2PCLA 3W5JA 2FMXA 2WJHA 3FB4A 4Q7KA 3ZGXA 4CZ2A 2Q21A 1W5TA 4QBIA 1P9RA 5AK0A 3SQXA 5F9HA 1IXSB 3GJ7A 1UBGA 3EC1A 3GJ3A 3QVUA 3RSLA 3IEUA 4TMVA 2IWRA 4EPVA 1KDRA 2NTYC 4FN5A 1NL3A 1FX0A 3C4JA 4RZ2A 4D4KA 2V1UA 2CCGA 1N6RA 3NH9A 2CL0X 3QF4B 4LCBA 5EZ5A 1MKYA 2WKPA 1VDZA 3GLHE 3GLIA 4CYMA 4GP6A 4CEHB 4BFTA 5F3WB 1FQJA 3Q8XB 4LJ4A 3DEFA 4GT1A 4GFDA 1VHTA 4ZKEA 4XTRA 4HB4A 1WMSA 5FFMA 1R8SA 3B1YA 1Q21A 3CR8A 1E9DA 1LF5A 1A1VA 1E9RA 2CLSA 1XJCA 1ZJ6A 2GF9A 1ZNZA 2XX3A 3IDQA 2HCJB 3EZ9A 4B75A 3KQLA 3EC2A 3UG6A 4W7SA 2OBNA 2DFTA 1UBCA 3EIQA 1DAKA 2AHOA 4ESVA 1NBME 4FWGA 1II0A 2Q9CA 2OESA 2ANCA 3P4XA 5TXGA 5HZKA 2QRZA 4QNRA 2R6FA 4D0NA 4FWDA 2PMKA 2DPXA 4QL3A 2CEAA 3GJXC 2P5SA 1XMVA 3Q7PA 4WW0A 3FMFA 3RRYA 3QXXA 4IVRA 1OJLA 3HR8A 2DR3A 1NI3A 4OQFA 1W44A 1RVDA 3R9IA 1ZM4A 5KO2A 3AP1A 4HSEA 2YV5A 5FOUA 3UMRA 3ZLJA 2RGNA 5AR1A 4OHYA 2WJVA 3BH7A 1P61B 1XEFA 5GADl 3EA0A 3PUVA 3IPYA 4HUQB 2DZOB 1K8RA 3TKLA 4MRVA 3C15C 4URXR 1BIFA 3UKDA 5FUVA 2FSGA 2NO1A 5J47A 2WWFA 1AQUA 2FWRA 3C41J 5EE3A 1GAJA 2DFKB 4WZAE 2OILA 3H0KA 3CIOA 4PAOA 3SYNA 1EGAA 1IY1A 2R9VA 3ZVMA 3B13B 4HLDA 2GZHA 2OLJA 5AUQA 2JATA 3MMPA 4ZIRB 4DJTA 1CS4C 1GNPA 4BEBA 3AP3A 1NSFA 3L43A 1EFTA 1G3MA 1OH7A 1Q1ZA 1LF0A 2I1QA 2CXXA 4DSNA 2V8OA 1KZ7B
chains in the Genus database with same CATH superfamily
3GAAA 1XDSA 4CG3A 4OBWA 3JYLA 1V3TA 3HPQA 5C8DA 5AK6A 3NHZA 3R0ZA 3SSMA 4QBFA 1BFUA 3CO0S 1MT3A 4D79A 3D8NA 5DHFA 3PA6A 2GZ3A 3VNSA 4ZVUA 3K2IA 1GGJA 4F5DA 4E4YA 1YI8A 1JVSA 4G65A 4JHXA 2JCSA 4QJ3A 3CBQA 4IIDA 2QVBA 4RZXA 4G8BA 1DU4A 2ORWA 2VT6A 1ZCJA 3KQUA 2Z3ZA 2A78A 3UUGA 4J4HA 4MIKA 2QM7A 4UVGA 5AKZA 3C8UA 5JDIA 3ZCUA 4E09A 5IHXA 3V9AA 2ASEA 5BSUA 5LIRA 5NULA 3FKSD 3TRHA 3E22A 3CEAA 5CBPB 2P0AA 3ANXA 4FIZA 3VV2A 2IIBA 3ISVA 1DGQA 2IJGX 2OQ2A 5CA0F 1PWYE 1DAGA 1RYMA 4EO7A 5KNDD 5CB4A 1L1TA 4ALMA 3RHSA 1SZPA 2VF5X 5F77A 5IVDA 1XRMA 1X7DA 4KE8A 3T9EA 3V4LA 1M67A 2GZAA 1KMMA 4R01A 1KC1A 2VBFA 3CZPA 4JLWA 2ZRIA 5HGXA 1AE1A 1W4AA 4JP5A 3EUWA 2A6PA 3IUQA 3OETA 1X1RA 4NMXB 2NO0A 4RVUA 3RJ5A 4PZPA 4MWZA 2BHSA 4PPYA 2L82A 4P4LA 3RSOA 5MGNA 5HWSA 5DGXA 4Z1OA 5IBQA 1GPWB 2MSEB 3TLGB 3QVGA 3NIDB 3NBXX 4CM9A 4JBYA 5EVJA 3KQOA 1P29A 1OU4A 4NY1A 2CJYA 4PTLA 5AVSA 1GL6A 5LMZA 3C85A 5C1OA 2BUCA 4TKVB 1LBEA 5C1BA 4US0R 4NRWA 4JBHA 4KZKA 1NJSA 5CU7A 5JJCA 3NBMA 2PUTA 4TUYF 5KNCH 1CD5A 1U02A 1DJPA 4W63A 5H3HA 2FWBA 3HYLA 4BNYA 2C58A 2NO4A 4CF6A 4A0FA 1TAHA 3NYIA 2ES4A 3DB2A 4E03A 3H9UA 5B36A 3PSHA 2B1QA 1PLLA 4XZ3A 2IS2A 2ZBDA 4PNPA 1PR2A 4DA7A 1NMXA 4GPZA 2Q2EB 3F1KA 5CVDA 4IH1A 4LVOA 2OAQ1 5HILA 3WNVA 1EFVA 2F62A 1NMYA 1BWSA 3FFTA 1A69A 1UBKS 1H4TA 2XPCA 4XI9A 3NTOA 1XNGA 3PZBA 4TTIA 3QWHA 3TECE 3CVYA 2J67A 5HIIA 1OIZA 5HGJA 1JQBA 3ER8A 4XIYA 2IYPA 2YNMC 1ESNA 2KNZA 3RC1A 5ISMA 1Y6RA 4NENB 5T4HA 3A14A 1SUCA 5CIWA 1CR0A 3GIWA 4EA7A 3RUIA 1L8AA 1NN5A 5IPFA 3WIBA 4Y2VA 1S01A 5AW9A 5ANRB 3RTBA 2H63A 1J4AA 1YV9A 1DGHB 2E18A 3AM5A 1NR5A 1KP3A 5IVKA 3NVMB 1YKFA 3M0EA 4Q48A 3LZCA 1JIUA 5FWYB 4B3TM 1SUBA 2PZFA 5GJVC 5HIAA 3LQKA 4NSOB 3OQNA 3MB5A 1U9JA 4R3NA 4PC2A 4NYMR 2XKKA 2LPMA 4UW9A 4DQVA 2I2WA 3GFRA 1VCOA 4RFVA 4HWOA 3C48A 3BXEA 1L7PA 1LW6E 5K01A 5IUJC 5ALWA 1BX1A 3HJGA 1W36C 3SS8A 3W7AA 4RDHA 3AK4A 2VF2A 4Z2AA 3WV4A 2EFDB 4J49A 2XMCA 4I4TB 4MDEA 4X7BA 2FW8A 4MVXA 1GY8A 2HKJA 2V6BA 5C34B 4BEJA 3AVXA 1DAEA 1ULBA 1KR5A 2DGDA 3A6HA 3OIYA 2J3JA 5EZSA 2EW8A 3KJIA 1XN4A 1Q91A 5KOIA 4MIEA 1CDZA 3CCCA 4DAEA 4XASA 1FSFA 3RSFA 5EZYB 1UP6A 2XQIA 1S0UA 5BQOA 2YJ3A 4S1WA 1GKYA 2XVZA 2HDWA 3R5XA 2J8ZA 1XZ8A 2QLLA 3M2PA 2W6JD 4U63A 5ER6A 2CMDA 2X7HA 4LGCA 1DMSA 3I3OA 1NQXA 5B3KA 3TIIA 5EMJA 4ZAWA 4NBTA 5KQDA 3HACA 5AM1A 4F5EA 3EXFA 4XR4A 5G4KB 1YQ9A 4PG4A 2AXNA 1N5JA 4NICA 3S2YA 1U1FA 1WGNA 2WE8A 3WGYA 4UC0A 5ILGA 3A8TA 3OUTA 4L5BA 1W87A 5TMBA 2QN8A 1I10A 3R7BA 1DFGA 4PRKA 3H3XA 3QTBA 4C7OA 3KSZO 2H5XA 1T13A 3HBAA 4AZ3B 2VR1A 3CRNA 5E4JA 4M9QA 3I6IA 4IQ8A 1VECA 1PW5A 4RHYA 1KDVA 1XMOM 4TMZA 4Q19A 1JW9B 1E5QA 4EPTA 2D7HA 1B23P 3EYWA 5LA6B 1L3CA 5U4XA 5DXJA 1G6Q1 4PGFA 5JAZA 1T1EA 4DDKA 4J4TA 3K5WA 4Q9JA 2R6R1 3R3HA 5EWJB 2O2SA 2FUG6 2JIBA 2Q62A 3DSRA 4M7PA 4HAZA 3T3DA 4XCVA 1H0KA 3PTLA 3WGGA 4FONA 4YALA 3QBTA 5CDFA 5BN1A 3ETDA 2WAMA 3V48A 2OQIA 1U8CB 1WMDA 1OJ7A 1QPGA 1D07A 1BWPA 4GM0A 1NAHA 3HXKA 1Q3CA 5JUWA 4XYEA 1OXMA 4R2HA 2C4HA 5EXSA 4G81A 2ZVQX 4CV3A 1NWCA 3BT7A 5FBHA 3WK5A 3PWSA 3NBIA 1NW9B 2AG6A 4QPDA 5SY4A 2I3AA 1JMYA 5KDDA 2XF3A 4G2TA 4RKWA 1FDVA 5AUNB 4Q0MA 3RANA 2ADMA 4I5FA 3IHKA 5BYKA 1Y6JA 3C8MA 2VXOA 3GELA 1MDBA 4AO6A 5FPTA 5A9SA 1BFKA 1E3EA 2CXQA 3BPSA 4EHIA 1V4NA 2PQ0A 1WL8A 4CTKA 1VPDA 1O57A 2QRHA 4Q3OA 5DYGA 1EXMA 4W5NA 4D56A 5EMKA 1I14A 4OP2A 4IH9A 1CR2A 5ARBA 3B78A 2PRZA 4G84A 2DT8A 4D4JA 1P0CA 4WN9A 4D3SA 1YB7A 3A1FA 1M0WA 2F90A 3QBDA 1XTQA 4CIDA 2DAMA 4TTAA 1CU1A 2O20A 1K68A 3QVXA 1DGGA 3K32A 2QUJA 1LSJA 4IUBS 2KEBA 5ICFA 4CQNA 2XJ9A 2XUDA 4L0QA 3BRCA 2Y0PA 1OB5A 2WDPA 4N47A 4LYJA 4ZVSA 3VC3A 4ND3A 1O89A 1X8JA 3WA7A 4ZT4A 4JJFA 5EUMA 1KVRA 4Q01A 4V0ME 2PRKA 5L4NA 1CNFA 1A8QA 2O3UA 2XKJE 1I4EB 3OJEA 3BG5A 1C4KA 2YICA 5LL6P 3T54A 1DNPA 3JQFA 3H5LA 1W4ZA 4QPJC 3JQBC 2IIPA 4AW4A 2FUNB 2VJKA 3N6VA 5EWMA 5C4MA 2FPKA 3RLIA 3RJZA 1S8OA 3R20A 1MO5A 1HRKA 4U6SA 2I3DA 1KC3A 1SK8A 4CCSA 3RG2A 4E4TA 4PYQA 4C01A 2RI1A 1UKYA 1B93A 1VGVA 5CJPA 1WEHA 1D2GA 4BGVA 1C9KA 4YN3A 3DVSX 3R0VA 4RY0A 3ZCTA 3SEQA 3VU9A 2OHIA 3F0TA 2DU8A 4QU9A 4ZMRA 1C0EA 3OHSX 2XB8A 2ZJ4A 5HW0A 3CLKA 3ROFA 2PT5A 3JVEA 1NTOA 3VH4A 1CZKA 4JGGA 2GPWA 4TT8A 3KOZA 1KAEA 2R4QA 3U62A 3N58A 2JG3A 1WUJS 3KZCA 4ZJUA 2VK4A 2D8AA 4ZTBA 2HO4A 1V41E 2QENA 3SFVA 1BU8A 3FMIA 3RI3A 2WJZB 4JP2A 3ER9A 2L09A 4B2YA 4JLUA 1V11B 4BP8A 1C3VA 4HWPA 1Q19A 4MZXA 4EFMA 3BHIA 1SC6A 1IFXA 1QCYA 2OV1A 2YQ4A 2PQ6A 1IULA 3A1VA 3K0FB 5DM60 4PCZA 4XWOA 1Y6QA 2XUIA 2JF0A 2NXJA 2ZTLA 2Z58A 3ZI4A 4WBNF 1JEDA 5LQNA 2FSHA 4DM3A 2OENG 1U0FA 3HNRA 3N59A 3HNOA 2ZBPA 5DTQA 1BYUA 3UICA 1QIHA 2FPMA 1B2RA 1T4CB 4P8RA 3BREA 4HL6A 3VDQA 3FNEA 3VR1A 1MOPA 1OLXA 3GA7A 4R71A 4NJMB 2CYBA 4Y2HA 4CR6A 4KWIA 4KH0A 1G59A 3LT5A 4X62B 4I1VA 4TYMA 4FINA 6ABPA 3AVUA 1GCGA 2OM6A 3EARA 3BFPA 1EUDB 3DTVD 4G1MB 1JLLB 4CV1A 4QOEA 2Q9UA 2BHRA 1JR3E 4BO9A 2GA8A 3I9MA 3AEQA 2HU7A 4H3SA 1SD5A 1NQVA 4EYEA 4QXMA 2KZUA 2X77A 3JR3A 5HMMA 4Q4HA 3ZLTA 4XGRA 3SC3A 1D09A 2PUAA 5GONB 3BIJA 1ZJJA 1QHYA 1PGJA 4OM7A 3CTPA 4EJ2A 2AOTB 3MA0A 3L7YA 3GGCA 2FPIB 1DCTA 1E3DA 1GQRA 2AJTA 4C07A 5FKJA 4BRSA 4LF5M 4RZHA 1MEOA 2CWWA 1QGAA 4X85A 4NJEB 4TMYA 4REQB 3FROA 3R9WA 3R3YA 5LQDA 4DRZA 4HX2A 2D13A 5K4GA 4BRWA 4G0QA 3RVDA 3E7XA 3IDOA 3K2BA 1ZNYA 1V9LA 4MDFA 1Y3FE 3V46A 2CBXA 1AZTA 1JLSA 2ZXFA 2C04A 3LWZA 5F51A 3SYLA 2ZTSA 2NU8B 3V4ZA 5B7PA 1JHQA 5ARDA 3HDVA 1PJ3A 3GFGA 4WOPA 4XBOA 4ZV4A 1CT9A 2PXCA 3GLGE 1ZIOA 3GUUA 2ZWMA 4MYTA 3I9LA 2ZRLA 1AZLA 2XD4A 4OCZA 2JIRA 1BVRA 3QI2A 3WFZA 5DJ5A 1A04A 3AL3A 1CULC 1KNQA 1KNXA 3WBFA 4D0LB 1IHPA 1FUUA 4NAUA 2X0RA 1D1TA 3WX0A 4XB6B 3TNDA 2MMGA 3ZHQA 5BPHA 5FOTA 1GARA 3SR3A 4JC0A 1XD2A 2ZIZA 4MMYB 1SHZA 2NUAA 1HYBA 1K66A 1T2CA 2IOYA 1WOMA 3N2KA 1J33A 3CT4A 4E51A 3HJBA 5B5SA 1TQHA 1JT9A 3AJIB 4QZVA 1HL3A 2H2FA 2IXGA 5I47A 4ABTA 4K81B 3KJEA 2WPDD 4HBGA 2AXQA 3GD5A 1YDWA 3PJFA 4H6XA 4U1RA 3WLAA 4P84A 1SWVA 1I7LA 1XEWX 4GUAA 4GE0A 3ZCBB 1T9HA 4GOXA 1P1BA 4I9UA 4A0SA 2CMHA 3HEAA 2B4QA 5CLIA 4H9GA 2XA2A 2XGMA 1JKJB 2DENA 3K4PA 3ZUPA 1XAJA 1V4VA 3ONEA 3DTVB 2FJUA 4EFDA 3OTIA 2HNBA 4IP0A 5C5EA 3OQ1A 4K9KA 4KWHA 5TS3A 1TUBA 4CF3A 1IN7A 4KXWA 1ZK1A 3KZKA 4OQNA 3C6YA 1HE4A 2R6GA 1RI3A 2EKPA 5BPFA 2JH8A 1KRHA 5AOBA 4ZYVA 1IBLM 4HSGA 2FMFA 1KETA 5DYWA 2G5PA 3WLKX 3AFNA 3H1BA 4FS8A 3KBOA 3Q3CA 3TCNA 2BMVA 1A7KA 2BKVA 1U9IA 1GGVA 3K0AB 3V4PB 1B14A 3E58A 1PNTA 2FX3A 2QL9A 1O6FA 2PGDA 2X22A 4KLCA 1BAPA 1TM2A 1O6BA 4EGFA 3IRVA 1XEXA 4AC9A 1E5XA 3TWMA 3IE0A 3CUKA 4EVIA 1DKPA 4LTNA 2Z3XA 4RIEA 4NS4A 2A9OA 2GERA 1TYAE 4EVQA 4LZOA 4CIWA 5KYUB 3K9NA 4F38A 1S4MA 3BWVA 4L5CA 4IKPA 4M86A 2BFEA 3IIMA 1QGZA 3F4KA 4LDNA 4F7DA 4BLRA 4EO4A 3U5TA 4ZQIA 1Y1TA 3K1YA 4TPKA 5EHQA 2AWNA 5CUQA 1JQKA 1HM5A 4I66A 4OQ4A 4UUPA 4HWRA 4JI6M 2OCDA 1J5PA 4BQRA 1YQUA 2PT9A 4RESA 2G8NA 2DHEA 4LCJA 2XNHA 4D42A 3G0OA 1KSGA 3NOXA 3BE5A 1Q2XA 3HCPA 5HZMA 2JFBA 1V71A 5IP5A 3E1SA 2G25A 4IJ6A 5A5FA 2YRXA 3B3AA 5IC5A 2RJOA 2H3HA 3D5TA 2F8TA 4GHLA 1RBZA 4Z4CA 3FBWA 2RHRA 4UBOA 4PYOA 3ZWPA 1M6WA 1P0PA 2OAEA 3MMNA 4RD4A 3PF8A 3GPDG 1C4OA 1KFEB 4NH0A 1UMCB 2Y2UA 4U2GA 4RLSA 3EXAA 1OAOA 5C5CA 3OO0A 4FJ0A 4HDMB 1FSSA 5BO5A 5EUCA 3ZGXA 4UFOA 2HMTA 3O4FA 3EC1A 5AVJA 4C76A 4W9NC 2VDKB 1KDRA 1HFKA 4D4KA 3D2CA 5JTUA 3R77A 2CL0X 2V4MA 2BDUA 4MCAA 3GLHE 5CHYA 1N77A 4CEHB 4YUYA 5AD1A 2XMGA 5CPBA 3WGHA 4N49A 3PQEA 3VJLA 4E08A 2R18A 3DZFA 4YRAA 3ZWQA 3P4XA 1CJCA 3I6MA 1XMVA 1ZHHA 1RZRA 3DD5A 3FDZA 4WW0A 3FMFA 4MWSA 1OJLA 2DUJA 3R9IA 3SKXA 3NONA 4O4JF 1K5HA 4LVUA 5MHTA 4ZI7B 2NM0A 2HB6A 5ALSA 1MIOA 1EU1A 3HJCA 4BNHA 2C59A 3CF6E 3F3KA 2RGWA 4CLXA 5AUQA 4ETIA 1XZIA 2R3SA 3P9XA 5EMNA 3W7BA 1SRRA 3PQCA 2RAUA 3FCAA 4EW3A 3BCUA 3TQOA 3BX1A 3HE3A 3LXUX 4YA6A 1IN5A 5F9FA 5CFOA 2VCHA 3VYSB 3RS7A 1II9A 1FJXA 2VDJA 4JN6A 4XB1A 1YCDA 1KSFX 4HH4A 2CVHA 2EHDA 4DCCA 2HPHA 2ERXA 4OQLA 4DT1A 1D6JA 5EP4A 2CBZA 3I1YA 3M4ZA 3G1UA 2O3TA 1O6GA 3LRXA 3MLEA 3SDBA 1VMEA 2Z3VA 1SU8A 2X8JB 5AKGA 2O06A 2ZKIA 1UP7A 3VO1A 2WYVA 4CKEA 3EF0A 3B5EA 3MSCA 5AWFC 1ZLYA 2CUKA 1JEAA 3GUCA 2C57A 1I32A 1K6MA 1ZHOA 4RD3A 5A0VA 4ER3A 1EM8A 4IL5A 1YZKA 3CUEF 2ODPA 3PCRB 2DZNB 3NV7A 2G5TA 1JPUA 3FMGA 3BKXA 1Y7PA 5IH3A 3Q8XA 4UPVA 2Q0QA 4J2OA 4ISBA 4GMQA 1CHDA 2B8NA 4LDRA 1YFLA 5DWQA 3FLAA 3EDYA 4C4OA 3I3SR 1AV7A 1FQKA 5FTMA 3V6LA 2P9GA 2HPVA 1DUVG 4UM7A 4DC1A 4EHJA 2N35A 1MNAA 4JI5B 1L4NA 4R3DA 1F8YA 4C88A 1KFVA 3RAJA 4P4NA 4JI4B 3GJ8A 4NSRA 1SBTA 2V9ZA 1JL3A 3MOGA 3M82A 4I50F 3HWRA 4GKKB 4JT8A 5KTPA 1Z12A 1QQ6A 1LX7A 2JZCA 3PD7A 3LMMA 5COAA 3HB1A 4TT3D 3FHLA 3LSTA 1FMFA 3DJYA 1QHIA 4NECA 3CZ4A 2WF5A 2BJWA 2NUBA 5KTOA 1LLUA 3GJRA 3NKLA 2XUJA 4N1AA 4OQDA 4LF7M 3PEUA 2PWBA 1BHJA 4PAWA 2XTZA 3A06A 1SXPA 4XYLA 4GKBA 4TLMB 3KEFA 4J1TA 3KTAB 2IBSA 1ZJYA 4L8WB 1GZ4A 3ICVA 2OLEA 1L5WA 2CDAA 1K82A 2O48X 1ZJZA 2WF6A 5AK4A 4M7RA 1GRCA 3CLRD 5I7VA 4W5WA 3X1WA 3KHTA 3DG9A 1R9JA 3K96A 2WILA 2N3ZA 1Z28A 1FXWF 1NBAA 1CXZA 1G2IA 1GTVA 2XNJA 2XZOA 2VI5A 4A03A 5B3LA 2PGXA 4JJZA 2Z83A 1T0PA 3JYHA 1GQFA 2YYSA 3FVVA 1KI9A 2HHHB 3BILA 1F8GA 4F45A 1Y3BE 4UBNA 2BHNA 3U16A 2QSYA 4HTFB 4MUNA 3TWKA 4KE6A 1SIBE 2FZLA 4JBLA 3JR7A 5JZOA 5EI5A 4F72A 3PB3A 2O25A 3PRKE 2KDLA 4KAXA 1PG0A 4HXYA 3LLSA 1CIVA 3R3JA 1D0VA 2PEZA 4KFTA 1W0JA 4QTXA 2GRUA 1PK8A 3VDMA 1BN7A 2AFRA 1C4WA 1W35A 3AIMA 4HAWA 1I94M 3KC2A 2H1HA 3ELUA 2P3QA 5I5EA 3T5AA 1YZQA 1C7QA 3UJCA 4CF4A 4YFYA 1H69A 4BNTA 4OEHA 1Q3KA 7ABPA 4CIYA 2PJUA 1YUMA 3T9CA 4P0PB 3KDPA 1C2YA 3GEHA 3C3KA 4WKNA 3UJDA 2WWYA 4POOA 1Q20A 2A67A 1L7VC 1C1XA 2PMCA 1XTBA 3K9OA 1GYQA 1NYQA 2VHXA 2VQ3A 3IEKA 4I5DA 5LMUB 3OQIB 3DW1X 2PLNA 3IO3A 1GAWA 3HG7A 4B6JA 5L3SB 3CF2A 1BVSA 3U1BA 5DASA 1Z8NA 4AZSA 1BDJA 1P7WA 3MUEA 3EWIA 2TECE 4U9UA 4CDMA 3U3KA 1AF7A 4JLNA 4MKGA 3G9TA 2FETA 2JFWA 5F76A 3RYIA 3U6KA 4DA8A 5AJUA 1V0JA 3N5KA 3RTGA 4ZMSA 1IG0A 5L4LA 2YOGA 1MG0A 4RV9A 1RLUA 4JT2A 3S99A 4O2BA 1E63A 3PKZA 1QP7A 1AUXA 5HF8A 1SZDA 4PZZA 2X9GA 3PITA 2X58A 2J9GA 4GZLA 1AV6A 3WMRA 3C5HA 4GVLA 4WV3A 4FVTA 2C2XA 4BS9A 5L9AA 5TPZA 2ZR0A 3OY2A 5CVCA 4KOEC 2EJCA 1UFVA 2IEYA 2O1XA 2YWCA 1J09A 4J2HA 3HXOA 1LDMA 3QFCA 3USZA 4P3KA 3W9UA 5CJ2A 1KI2A 2B1JA 1J06A 3Q2IA 2JZ1A 3KU1A 5CH5A 4H18A 1UQRA 4JV5M 2H4WA 3SASA 1HDIA 4RA9A 5EKXA 1HLPA 1CF4A 1XKLA 3THXB 2PS1A 4PM4A 3PLRA 3IVAA 1L5SA 1Q0TA 4B3IA 1GGEA 2O23A 2F1JA 4M8LA 3D64A 2PSHA 4WOKA 2JGKA 5E7QA 2BFDA 4TTJA 2VWQA 4TKUB 4E22A 5KWJA 1NR7A 4ID9A 3M6VA 4MB0A 2X2EA 4GX1A 2UZ0A 3N2NA 1MA3A 2YMLA 3U4QB 5EE0A 1YZNA 4FYKA 3O82A 1BVHA 3T7JA 5EXPA 1T4MA 2R6CA 1RXEA 3H8JA 2XQFA 3JY6A 1EVQA 3PBKA 1KAMA 3O26A 2IP2A 3B12A 1RXUA 4X7PA 1X1CA 3G0DA 3GEGA 3VR4H 3TRIA 4YJKA 2PX6A 2QP3A 1SVMA 4X92A 4L7QA 2AN3A 3IH5A 4LYEA 4JGBA 2Y0QA 2B7CA 2D2FA 1LTHR 4XFDA 4NE2A 1GKLA 2IBTA 2R84A 4YUXA 1KI3A 5FTJA 2OMEA 2YOFA 4L4SA 4AD8A 3HH8A 4AUKA 4CQMA 2MOKA 2V65A 4C1NA 4OU5A 1XCOA 5KTRA 2A5DA 1FP6A 8AT1A 3RVJA 3AQ4A 4CUJA 1HQDA 2JLAA 4ZZ2A 2C9BA 3U6SA 4RADA 2JNHA 4KFUA 3ZGZA 2Q9AA 3R6TA 4EHBA 4UFNA 3EEIA 1AHPA 3D8RA 5CD1A 1WB4A 4UNNA 3EVDA 5FH9A 2QLNA 4Y2RA 1TFRA 4P38A 1OZHA 2ADOA 4Z0NA 4ARUA 1ATZA 3TMAA 4XEUA 3BVPA 3TMKA 4OX9Y 3B7QA 3UPDA 2PNFA 2G9NA 3GLGB 3HR4A 1GP2A 2PV7A 3KL4A 4QTUB 5F2OA 4D0SA 3BWCA 1TK3A 4WBSA 1XT6A 5B7NA 4IGAA 3O73A 2CLEB 5DLQC 3U7RA 2REQB 3C97A 5IZ4A 1B42A 5JO9A 2F43B 1UIRA 3RYHA 1EXVA 2NPOA 3I34X 2WHPB 4D9CA 2JFGA 2O8DA 3AFOA 1DRKA 2I7NA 2C5GA 2R8YA 2D1TA 4HAVA 3PDJA 2CZCA 3B7NA 4H7PA 4DKXA 5A0FA 4MRSA 1GVNB 1FOEB 4QICA 2D5LA 1R0CA 2PT6A 3K0EA 1WXEA 3FWPA 1ZZEA 4Q21A 5IVIA 5D3MB 4INOA 4BWVA 2C88A 3O8RA 3GMTA 4B85A 1P60A 3I72A 3IV9A 1YWGO 4M88A 1OR8A 3GN1A 1T9AA 1J8FA 4F97A 1V5GA 1O5IA 2IV7A 2C8KA 2Y1LA 1ZISA 2QRKA 2FOIA 4DCUA 3FAZA 4CV0A 2FX2A 2WT4A 1TEVA 5HM8A 4L27A 4ND8A 1YRBA 1Y3CE 4HRXA 4AX4A 1BMQA 2J46A 1JTEA 1H23A 4ACBA 4MVJE 2I7TA 3R76A 3H5NA 2GM3A 3N0VA 2PGJA 1LK7A 4OHKA 4QFMA 3O94A 4D9JA 1EQUA 3W0FA 2QRMA 3IIKA 3M3PA 4DIFA 4Y30A 5KO3A 5I9BA 2NT3A 1ISPA 2FA9A 1PR1A 4IRXA 3NRBA 1LPNA 2GK3A 3A1SA 4C0AC 3K6SB 3HFGA 4B35A 1URPA 4ZDWA 4LYDA 3LBAA 2A0KA 1WQ1R 4GOMD 2PGAA 4IIUA 4R40A 1SUFA 2IT1A 5B1SA 3MRTA 4KIGA 4F60A 5CDSA 4UE6A 5C0OE 2NQ8C 3QPCA 2R97A 3AGQA 2J7OA 2V7BA 3DBHB 4KU4A 2QRVB 5BW6B 3VPDA 3JR5A 3UGJA 3HL4A 5K0EA 1L4FA 4OQXA 1UC5B 4F8EA 4EMUA 4WK2B 4TLCA 4BQOA 5FDFA 3I92A 1OTHA 2XRFA 2EP5A 3RU7A 3HCBA 5J59A 1CR4A 3A4LA 2HA5A 4U8HA 4NCAA 2OORA 5ERGB 2Q1UA 4RWZA 4ETNA 1XCMA 1EFDN 3H5WA 3KCQA 1M1UA 3VPGA 2VT7A 3BERA 5J58A 4UMFA 4TLEA 4X7MA 1VI5A 5ALTA 3G9XA 1M1YA 1T5BA 5DDIP 3E3AA 4JCCA 1UXIA 3TOCA 3KG2A 1KHHA 4JI8B 4M37A 2L4EA 2ZAGA 3I2GA 3UB3A 3GUYA 4ZALA 5FBLB 1M2GA 2FK7A 1FQWA 2QN2A 3QUQA 1ILEA 1V6SA 4Q3NA 2A94A 2C3YA 3DEHA 3J7AS 3ONDA 3A05A 4RIGA 4F9GA 3WLOA 4I9HA 5CFPA 1O95A 1MB0A 5D5PA 5D1NA 1BROA 2BEVA 4LTMA 4H7FA 1KJ9A 4JJ4A 2GM5A 5CFQA 1E1RD 3HYCA 3OM8A 4JMPA 1DC3A 3EVNA 2QQEA 4EYKA 1XTSA 1TU3A 1VMIA 5JCOC 3TQIA 2M9MA 1XB2B 2VSXA 1GPDG 4K9SA 3EGEA 3JVDA 3KXKA 4W9MC 4IDDA 4B7HA 4A0GA 5BQFA 2ZRDA 1IXZA 1YHYA 5ENZA 3GLHB 4EYOA 1V1RB 2CJWB 5FPPA 2XUZA 1QGDA 4IDPA 1T3SA 1ONBA 3DT9A 3B9BA 2NUPA 3JQ8B 2QJRA 3HHEA 2CXUA 5GOTA 5CT5A 2OPFA 3LUDA 2X6TA 3HZZA 3DOUA 1N2IA 1U7XA 4FWIB 5T4FA 4O3MA 4LS3A 1OWNA 3EBLA 5IEBA 2ZRQA 1JHXA 3FRHA 4TSRA 4DWVA 1JMKC 3EBPA 5B4VA 1UDCA 3QOYA 1N34B 4MWCA 4IIVA 3KOZE 5CR9A 4OGWA 2UYGA 3FYHA 2JJMA 1USWA 5KWEA 1KPHA 4CWAA 3I30X 3W9BA 3V6MA 4CTOA 2PZBA 3C87A 2JGEA 2EERA 2ZI6A 1UKBA 3FI0A 4A8JB 3KQYA 2P7HA 5JRJA 4L5JA 4TL9A 2AEFA 5T6BA 1CUGA 1XTRA 4YDHB 3QKSB 2HI0A 5A2QA 1OX6A 4O4HB 3HR7A 1KO4A 4F46A 3STWA 3OLWA 2GBLA 1DS6A 4FDMA 2AKYA 4J3JA 1W0CA 1GPKA 3NHKA 1KVUA 1DEHA 2A5JA 4RVNA 3WLPA 3T0IA 5I3CA 2XZFA 4U7GA 1D4OA 2DPGA 2GWRA 3LW8A 4PD2A 3GEIA 3EGXB 2FUG1 1XZCA 3G17A 3NI2A 2XNDA 5C9ZA 1HMYA 2QDKA 2BEWB 3V7WA 1T3GA 1I0LA 2CFIA 4M4SA 4GQBA 4TWBA 4L22A 2X41A 5CA1B 3H2SA 4HQFA 5J2TA 1K6IA 2QGZA 2NNWB 1OH6A 4D41A 2O3QA 1ORDA 1JDSA 3FKQA 2PUJA 5DW3A 4S2EA 3O03A 1P1CA 4I08A 5LN1A 5AKEA 3ADOA 1NLUA 2UKDA 1FDSA 1HA3A 1K3TA 4RV5A 1QG4A 4LK2A 4FUQA 1Q6YA 2AG5A 4DPKA 3HVHA 5FQOA 2BUAA 4DEYA 4BNZA 3LS2A 4ZYWA 4FGUA 2ECQA 3PQ7A 5T8KA 1ZC4A 1OOEA 3WYCA 2B9VA 2YJGA 4QEZA 4F9EA 2BWJA 3EMBA 4W6QA 1Z5NA 4E5NA 3AM1A 3LD9A 4G86A 2GBGA 4X8LA 4Y6PA 5E1MA 2CD9A 3RHZA 5DVZA 1WHSB 1TX4B 3CKMA 2MSDB 5E6UA 4J6EA 3PA8A 2LE0A 4YECA 3GCGA 5K0NA 2IW1A 4KFCA 3SE0A 4DR7B 2L7HA 3WQSB 1COWA 4ZMBA 4HGNA 1QQ5A 1QC5B 3PNQA 1MH1A 4NOLA 4P3YA 5H02A 3RUCA 5EHXA 2R751 2H1CA 4ZXPA 1K7XB 3FCCA 4HY3A 2KWIA 3NHAA 2ZBGA 1IN1A 2H4XA 3TBHA 5FIUA 2WTAA 5L7TA 1JU3A 3E9YA 1UQTA 5L8RF 4GPEA 3BHJA 3ETEA 2LKCA 4LOKA 4FYXA 2XLJA 3DNFA 1GEGA 4UARA 4RANA 4TWIA 5LKAA 4R9NA 2QU8A 1ZS9A 1M10A 3HO1A 3ILYA 3ROEA 2HXGA 3RM3A 3MOIA 2A86A 2BCEA 3WBBA 5EZQA 5FBQB 3L25A 1L7DA 4LC0A 4D99A 5T6MA 2B2NA 3L0OA 3VZRA 1CHNA 3UF0A 4AY6A 2ZM5A 1NQTA 4JKOA 3P45A 3HBMA 5FULA 3JSAA 4OB7A 2C00A 1H0RA 1RHQA 4FN5A 1NL3A 1JE0A 4LWOA 2W4IA 4A10A 4PLHA 4YCMA 2QQGA 1B3BA 1ZGJA 1YDFA 1U1EA 1R8SA 2GK4A 4ZD6A 1ZEMA 3JRWA 4IHAA 3KQLA 4ITUA 2EGHA 3W8FA 3B8EA 4BO5A 5GINE 3K9QO 4F11A 4EMBA 3E53A 2QZSA 5CB4B 2J07A 1BX0A 2BZ0A 3KJQA 2FEAA 3ZLJA 5JVDB 3EA0A 3ABZA 4D4GA 1RWVA 3C15C 3PCXA 4R1TA 3A0UA 3ANLA 5J47A 3C41J 2DFKB 3KQWA 3SYNA 4OH7A 2QN1A 5SY9A 3MMPA 3WLIA 1OH8A 4HDQB 3SMSA 2F1HA 4NP6A 2XAUA 5F7XA 3HCFA 2YFKA 4FEAA 2YN4A 3TGWA 1QANA 3LXRA 3IAAA 1R6VA 5F9MA 1H93A 2GXUA 1UMBA 4EHLA 3OE7A 1VLMA 3JATA 1UPFA 2G0NA 2M60A 3W3AH 2QD3A 4MVCA 1C1YA 2P9TA 1BXRA 5H16A 1X39A 1B8PA 4R4JA 1TK2A 4PZUA 5F35A 5ADWA 3GJ4A 5IDYA 5K0SA 4ZEVA 3O8NA 5A6SA 4ND2A 4EJSA 4FMCB 4Q02A 3K9LA 5BSHA 1A9ZA 1P33A 1XDBA 3M1YA 3C8HA 1TRHA 4WA7A 1FQOA 2C42A 1X7HA 5FCDA 1ZBQA 1B43A 2ODNA 4N8DA 1OFUA 3CR7A 3KVWA 1L1EA 4RY2A 5AK3A 5IU6A 4BO2A 1WXXA 5KJFA 4NULA 1FYWA 4BFZA 1KK0A 4PEVA 3KDSE 5DYYA 1OGJA 5GZ1A 3ESYA 1PJBA 2BMEA 4AG6A 3HGQA 3TZCA 1C1HA 5I9MA 3I28A 5I4BA 2I29A 2E6UX 4MVJD 4COKA 2SBTA 3DWFA 3KUXA 4NK5A 1EP3B 2ZBKB 1OWPA 1DOHA 4DV5B 2PEYA 4PLGA 1R0YA 4DB4A 3UWOA 4IRMA 3KEMA 1A8SA 1MENA 3FYSA 1J5EM 2FRXA 3TGPA 3PKIA 3O1IC 4ZAYA 3GMDA 4FX5A 3UK7A 5I9IA 2FN8A 4M60A 5AVTA 4U2DA 2IUFA 3WQBA 1S2DA 3FCUB 1VSBA 4YIHA 4ANRA 2C78A 3AVPA 4ZYZA 5E4YA 3WNZA 2FSVA 3OKCA 1EX9A 3NAMA 3BL6A 5KJ6A 3B36A 1VPEA 3PUHA 5A05A 1P1IA 1RM0A 2OQRA 5DNAA 2A1TS 1RVV1 4H0FA 5AW5A 1SXIA 3OIDA 3RBVA 2JDIA 1XOIA 1O6CA 4YMSA 1O5OA 3IE2A 3ONNA 3DDOA 5KI6A 4LNUB 1T6BY 2X1HA 3KQKA 1HNZM 4NE9A 2IY7A 4IMIB 1TF7A 1T5SA 2QXUA 5IARA 2A7QA 1MDFA 4FUTA 3VPCA 1N6LA 1TM1E 5EWLA 4V1CI 3L5KA 4AWXA 2WF7A 3N86A 4Q05A 4Q15A 2DQ4A 5K4AA 3OT4A 1OT5A 2DI0A 3ILKA 1Z37A 3GUVA 3ZV4A 3HO6A 2PX5A 4KR6A 5AKKA 4DYVA 1X6VA 4CMGA 1EVJA 3T15A 1TVKB 1U0SY 3PGA1 3MHPA 1YU6A 2V6FA 4ZHQF 3AOEA 2VZEA 3WDKA 4BDSA 4C7XA 3FNFA 4Z86A 1F1BA 4QDUA 1NLYA 2JP7A 5G3YA 5JFOA 4HK4A 5FT9A 4CM7A 1GG2A 3ILXA 3HBFA 2WLSA 3B9RA 3SF8B 5IJ9A 2KLHA 4CMAA 4CT0A 3IV7A 3WWPA 2HEIA 4RKRA 4MCHA 1C3OB 3SC4A 4AKTA 4GMXA 4Y7CA 3PQFA 2FWIA 1EUCA 4FE4A 3FPLA 2G6BA 1D6SA 4Q18A 3MCAA 3EG5A 1E2KA 4YMGA 4JI3B 2QJOA 1M2FA 2Y0EA 3F1LA 3EWAA 4S1VA 4NYMQ 3SR4A 4N4AA 1LW7A 2ZJ6A 4X63A 2GF0A 2NXWA 2FEPA 4RPIA 1QONA 4KQFA 4ZDKA 2XYQA 1WPRA 3DE4X 3IVGA 221PA 4C7OB 1Q1GA 2KJQA 5LC1A 5A7GA 3L3BA 3SLGA 3ORQA 3KX2A 3L0YA 4Q39A 4BIMA 4ZICA 1E2DA 1EM6A 5BPVA 2UUAM 5LQUA 2QPAA 4Y2SA 4JI2M 3SZMA 1XLUA 2QP9X 4R5HA 2ZROA 3CE6A 2MSNA 1FS4A 3TGLA 3WGUA 2XVXA 1W5BA 2PPVA 4MV1A 5FD8A 3Q10A 3TW0A 2PUWA 1L4EA 2WIJA 1ZYUA 3O8BA 4WESA 2QLFA 3PRJA 2IYOA 4HDNB 4JUCA 5K3DA 2J5XA 1D03A 1ZR4A 5JD6A 4KUHA 3RRMA 4PVDA 4Z7JA 3SAVA 2NP7A 2W42A 4J4BA 5ES3A 2IS1A 4C4PA 3FWZA 2VDPB 1OZFA 3T34A 3KPWA 3X43A 1GFIA 3EJWA 4DR4B 4FYMA 2YASA 1N5LA 4DMUB 4YXWA 3PQ8A 1RRPA 2JHPA 2DXIA 3DMFA 2X9VA 1U4NA 3C74A 1JB0F 5ESDA 3FAKA 2IL1A 4CM5A 5TY0A 3IBGA 1E2QA