4LJAA

Clpb nbd2 r621q from t. thermophilus in complex with amppcp and guanidinium chloride
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
321
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 109
structure length 321
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ljaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ljaA01
4RSGA 1A82A 4LJAA 4QBFA 3K1JA 2GXSA 3OIYA 1XTSA 1YQTA 5AJWA 1MT0A 2GJSA 4QHSA 4NYIQ 2HT1A 4Q1DA 4O3MA 3L43A 5K8UA 2ZROA 4URVR 1TPZA 2GBLC 3DDCA 5CK5A 5B58C 2C96A 2QGZA 4FN5A 3RRNA 2GJAA 5JWRA 2W83A 1U0HC 3A8TA 4EPWA 3ZD6A 1Z22A 1UJ2A 1HTWA 3KTAA 1LW7A 3OIVA 5J4VA 1IAQA 1E79D 2DVWB 1F6BA 4BZPA 4LBVA 3LRPA 2V8OA 2CHGA 4A2WA 3BH0A 2R9VA 2MSEB 4OI0A 2ODWA 3WMEA 2JLYA 3R20A 2FGJA 1CJVC 1CTQA 2ZRAA 1LS6A 2KWIA 1T91A 4X8OA 2X1VA 2A5GA 4F38A 2WV9A 1TUEA 1N0VC 4B6EA 2HT6A 1E2HA 3NH6A 1OXUA 1XJ0A 1ZC3A 2ZVPX 1W44A 3SHFA 4CZ2A 4JIMA 1NIPA 3TQCA 1D5CA 5E3HA 4WBSA 2QQ0A 5E4FA 2PJRA 1XDBA 2YNMA 1XD9A 2OHFA 2ZUCA 5L3QA 2ZR7A 1GWNA 5IK2A 1HY3A 2D3WA 1KSGA 5UKDA 2ORWA 4BLQA 4PQFA 3MUFA 1KI8A 5E95A 5K8IA 2IC5A 2OZEA 3QIAA 2WMOB 4QNMA 2FF7A 4HUQA 2O8BB 4O2LA 2RKOA 5EP2A 3RS0A 1LB1B 5FUYA 3ZS9A 4LHVA 1DAFA 3KTAB 2ZSAA 3A6PC 3TR0A 4ESHA 1FQJA 4LHZA 5AR1A 4ZDKA 2DWPA 4GFDA 3RNLA 1K5GA 1NSFA 3HWSA 2H92A 4Y0VA 5JEDA 2BVNA 1G7CA 3AKCA 1SULA 2QT1A 4QXAA 2NPFA 4XSHA 1EK0A 2VHCA 1QHGA 1E98A 3BERA 3NEYA 1JPNA 1TX4B 4PAQA 3KZ1E 2VP0A 4TYYA 3VU9B 3VKHA 3TR5A 3CONA 1HQCA 3MGCA 3EPJA 5SZHB 1F2TA 4BLPA 2W0SA 5G3YA 5IK2D 4L4UA 1D2NA 4UXJA 5TY0A 4ZIRB 4JMPA 4A36A 5JSZB 4NYJQ 4CF7A 4Q48A 4Q4AB 1GRNA 2XJ4A 2IS1A 1UKZA 2BEKA 2H18A 3OESA 4H1UA 4D4MA 1KSFX 1VMAA 5J4HA 4PO9A 4YLGA 1KO8A 1OV4A 2V6JA 3LH5A 3AF3A 5JEEA 4AYTA 3B78A 1R5OA 3RDPA 1N6PA 1TF5A 1P2UA 3OHMA 4IRUB 1P60A 4HSEA 4QM7A 3OE7D 2IT1A 3C15C 4Q9IA 2VP6A 3CM0A 2VA8A 4TLAA 4JJKA 3RS7A 4IXNA 4RD6A 3D8BA 1NN3A 2GILA 4IXMA 3AQ4A 1FMJA 1YZQA 2Z4SA 3GJ3A 5E7IA 1W36D 4E03A 4V02A 1BYUA 3QI2A 1ZMXA 3TSWA 3PEYA 2ZJAA 5A0FA 2XNDA 4TL9A 4UXIA 5FTLA 2FG5A 2ANBA 1OH5A 2O8CA 2WTUA 3WNCA 5BW8A 4JS0A 2IYXA 3VAAA 4ZI2A 3ZIAA 3EZ2A 2P5TB 2DR3A 3KX2A 1KNXA 2REBA 4IKEA 1UM8A 2YVUA 3WXMA 4U7DA 1D6JA 4JYCA 4F92B 3M6AA 1IN8A 3CNOA 2V6ZM 1X8JA 1ZNZA 2AN9A 5DISB 2OLJA 3NG1A 1R5BA 5DO9A 1N5JA 3R7WB 4GL2A 3ND8A 2ZRFA 2CDNA 2Z83A 2RAPA 2XNDD 3PXGA 4MQBA 3M0EA 2WZQA 5H68A 5G40A 2RGCA 1KJWA 4QHTA 5DIFA 3WYFA 2QTFA 3ZIAD 2VTKA 3CWZA 3CKLA 4TQ9A 3K0CA 2O0JA 3A1TA 2OBLA 2OCPA 4V0LA 1P2VA 4FMDF 4AKIA 4EPXA 4KHZA 4TT3A 2NO7A 4P4UA 1JEDA 2NGRA 1KDTA 5DHFA 2H7VA 3AVQA 1P6XA 2VYFA 5FOTA 5P21A 2CVHA 2HJVA 4LHYA 4M2LA 4UKDA 3ZVRA 1J99A 1BYIA 1KKLA 5CITA 2OCAA 4TYWA 3NH9A 2XXAB 1OIWA 1VG0B 2WHXA 4EFLA 4FCTA 4LJ9A 4LBYA 4JKYA 4EJSC 3FE2A 3T61A 4W7SA 3U7HB 2XTZA 1TTTA 1ZUNB 2BIFA 3MJRA 3CPJB 2W58A 1SVLA 3VHXA 2O0KA 1JR3E 2WKPA 3I1FA 2KBEA 3CH5A 4BWYA 4D6PA 1AQUA 3D6TB 2V3CC 4FW9A 1J90A 2OG2A 1NG1A 3TVTA 4A8JA 1KK1A 1E32A 4TT3D 4C0KA 1NL3A 4DT1B 2G6BA 2BBWA 1FNMA 2BMJA 2GJ9A 1P62B 3AKYA 1KAOA 4TSFA 1XJCA 1ZVQA 1XMIA 2NZJA 4TLBA 3GP8A 1PLLA 2FV8A 4L15A 1TQ4A 5SZIA 2I3BA 3BFXA 4LYFA 2O8EA 1N6KA 3CF0A 2CCJA 1IY0A 3U3MA 3I3SR 3KUDA 2QPAA 3FDIA 5DI3B 1RFLA 2FSHA 5KPJA 4HYYA 2FDCA 5FBRB 3T1QA 2CVFA 4HAXA 3THXB 5F3WB 1U8ZA 1ZCBA 5JFGA 4TMVA 5JZVA 2BKEA 4CIDA 3WY9A 4OI2A 5D3MB 4C7OB 5K8TA 2PT7A 3LBNA 3A4NA 4QFMA 5DH9A 1TADA 1CR1A 2XAUA 2J41A 3X1YA 1ODFA 2YZ2A 3NC1C 1JI0A 4MRVA 4TSFD 2R62A 1G6HA 3V00A 3NC0C 3T34A 3QQ5A 2YOHA 4KSBA 4PZYA 4KVAA 3P20A 4PSKA 4HLUC 4RVCA 2F3RA 1ZINA 1AS0A 2IYYA 5L8VA 4R71A 3QBVA 1DEKA 2ZRPA 4H1VA 1QHNA 4PC6A 2FEOA 2LKDA 2EFCB 3RLFA 1UKYA 1XEXB 2X8AA 2XSZA 3FHOA 1K8RA 1NN5A 4RD4A 5TMPA 1IQPA 4ZDWA 2ZS9A 2DB3A 4ZCLA 4QOSA 2IXGA 1GNQA 2OAP1 1VYUA 1F48A 1KDRA 4EPYA 5FFMA 2ZRIA 2D2EA 3K9NA 2J5XA 3WP0A 1E9SA 2ONJA 4BASA 5IHPA 1P61B 1X3SA 3TRFA 3DPUA 4JSYA 3LX8A 5GJWC 2N42A 3H86A 2BBSA 3VLFB 421PA 1KK0A 5A5GA 2IYTA 1D8TA 1KMHA 1T5IA 3DOEA 1JAIA 2FE4A 3IGFA 2AKAB 3HU2A 2G9NA 4RKEA 4XWKA 4QJ3A 3GJ7A 1G3IA 2R44A 3CWQA 4BFVA 1QF9A 1JR3D 2NMVA 4MYCA 2A5FA 2ZUDA 1RKBA 4LHWA 1KAGA 3ECCA 1Z29A 1FX0A 2OT3B 4Q1FA 1VCMA 5GVSA 3SU8A 2VQSA 2WJJA 1R4AA 5EE1A 4ZI3A 1E1RA 3DKPA 3NWJA 1QHHB 4KYIB 2CLCX 1P9NA 3TVDA 1BO6A 3A1VA 3TKLA 2KRKA 2WIBA 3U7FB 2ZJOA 2L0XA 1J8MF 1S8FA 4M1TA 1G8YA 3MWLA 1XMSA 2YWHA 5B2ZA 5JBQA 2MMCA 3BS4A 3TW4A 4NTZA 2WWHA 3AP3A 2VF7A 4NCIA 3SJBA 1A5TA 3KQHA 1OHHA 2QM8A 2FX3A 2ZJ8A 3ZVMA 4K8OA 2EFGA 3B60A 4Z54A 3LXRA 1CF4A 2WPDA 3K8YA 3UMFA 2VP2A 1N3BA 2GXUA 3GJ8A 2WVJA 3RS2A 2RCNA 1ONBA 1Q0UA 2I4IA 2NO9A 4B35A 3EC2A 5CIQA 1E1RD 1PUIA 4R9UC 3W5IA 2WJVA 3HR8A 1XNJA 3UWOA 1NVUQ 2FZ4A 4JT4A 4FMCB 2J7KA 2OESA 2ZI6A 2PZGA 2ZYWX 3FKSA 3QVUA 1S0UA 1G7RA 3AV0B 4AKEA 1H65A 1GKUB 3VFDA 1OIVA 3AGQA 5JJLA 1E9FA 2QT0A 4GMDA 2VIIA 5HPYB 1H8HD 3IHLA 1NVXQ 4FMBB 5FOUA 4PXAA 1ZD8A 3ZJYA 4EJSB 1KO4A 1VYTA 4QJ5A 2NQ2C 4GP7A 4CW7A 1FUKA 1R8SA 4V0MA 3MLEA 2AD1A 3W6PA 3T5DA 5DI9A 1W2HA 1EXMA 1GIAA 4A6XA 2ZJ5A 2JIZA 2DWOA 1F2UB 2GF0A 3R8FA 4US1R 4TN1A 2C9OA 1R10A 1DAEA 1GRRA 1U8YA 3KXIA 1E2GA 3FYHA 3IUYA 2JLQA 5EUMA 3IDQA 2WMNB 1J7KA 1QVRA 3AH8A 3L8ZA 3W6OA 3ZGXA 4A6PA 5A4JA 4P4SA 5KNBA 4TWZA 1LNZA 2A5JA 5CB8A 1DAKA 2QPTA 2EVWX 2AL7A 3ADDA 1ZC4A 1UEJA 4X8HA 5B57C 4E09A 1MRNA 3V4RA 3AUYA 4NE2A 2GEVA 1TQDA 3W5JA 1CP2A 4DCNA 1YR6A 2XZOA 2JIZD 2D4HA 3I72A 1C9KA 3B1ZA 4IFBA 2HXSA 4N3NA 2NTYC 2CL7X 4EQ6A 1U90A 4Q21A 3BB1A 3FGNA 5JECA 3D7MA 2C98A 4UNRA 4JKIA 1KYIA 2ZRDA 4KBGA 2FWRA 1S9HA 3MWKA 4JZKA 3WYGA 5JWOA 1XCMA 1J70A 1RVDA 2BCJQ 2ORIA 5JJKA 2WJGA 5F2EA 1ESNA 2GVDC 1KY3A 2RMKA 1RZ3A 3I92A 4C0HA 4S2EA 3GLHA 2PJZA 5DYIA 2V4ZA 1QHXA 4R2HA 2R6CA 1R0YA 3BC1A 3V9PA 4JLDA 4AC9A 2BM1A 1JEEA 4MRSA 1T0JB 4B3CA 4JJZA 1WBDA 3ZH9B 1RW4A 1NKSA 2QQEA 5CM9C 1JALA 2IUUA 3KB2A 3O47A 3TUZC 2WBLC 3SE0A 1IY2A 2C77A 3LW8A 2BJWA 2HYDA 2GESA 1R6BX 2OFXA 2WAYA 4EPVA 4LV8B 2KI5A 1ZM7A 2YHSA 3AKDA 3EASA 4G01B 2P2LA 1NMZA 2ZYUX 4KLZA 1XD2A 2OO7A 4P4TA 2DFLA 1OYWA 3A36A 1COWA 4NCKA 5JCZA 2XGJA 1IN7A 1UDWA 3GLIE 2RH5A 1RYFA 1IY1A 2VHUA 5J47A 4LYHA 3SYKA 4JVLA 2EWVA 3V4FA 2ZU6A 4MRNA 5KSOA 1GFIA 3T1TA 1DG3A 1R0WA 3K09C 4RFSB 1II8B 4Q5IA 4DLYA 4CEJB 3NVAA 5L3SB 3QKRB 3LW7A 3THYB 1S1CA 2P65A 4DLTA 4MGIR 2A5DA 2R65A 3EX7C 4NL4H 1W4RA 3GLFA 1E2EA 4DSNA 4NDZA 3VQTA 4URZR 3PUVA 2RB4A 221PA 4OQNA 2RGNC 2Q21A 4DLZA 2H1LA 4EIWA 2O52A 2JA1A 1A2BA 4KODA 2GWHA 1COWD 4F91B 4XD7D 2W2VA 2PX0A 4IDHA 1OFTA 2F43B 4CVNA 1E2IA 2CE7A 2Q3MA 4LBZA 4C0LA 3F5FA 4LOAA 2H17A 1G3UA 3MJHA 2ZETA 3TAUA 4RY2A 1KIMA 4S35A 1VCNA 2FPKA 2BKUA 2FPLA 3F3YA 4A2QA 4DCSA 5EE5B 1G41A 4QHYA 3QBTA 3QVVA 4Q1BA 1Z0DA 4BLOA 1RRCA 3E1SA 4BUJA 4TMXA 5AUPB 3VX3A 2GZDA 1SXJC 5CB6A 4MYHA 4L16A 1ZBDA 3B82A 1KI9A 1YU9A 2IYWA 4PO1A 4D80A 4PR0A 4GBMA 5C4GB 3GMTA 2C9YA 5GADl 2Y8EA 3QF4A 5E7MA 1UPTA 2F6RA 3Q3JB 3P4YA 4OL0A 2OXCA 2VO1A 3Q85A 5JCPA 5CYOA 5FTMA 1S96A 1E6CA 2Z6VA 1FL9A 1Q12A 2CK3A 2YC4C 1E9RA 1QRAA 2ZUBA 1E4YA 2ZSBA 2EFEB 1FPMA 1KI4A 4O0MA 2D2FA 4C0AC 2Z5FA 4NBSA 3VR1A 3CZPA 5JHGB 3NDBB 3KJEA 3BD9A 3Q7QA 2DFTA 3RS3A 3LFUA 3AVVA 1QDEA 1UFQA 1X1SA 1XTQA 4FIDA 3KFXA 4XWOA 1T0HB 4AYXA 5CM8B 3EARA 1UAAA 4DKXA 5AUNB 3NXSA 2UZIR 3LX5A 2GZHA 3DM9B 1KI3A 2ZJ2A 3K0AB 2KJQA 5CYPA 3G5UA 4M1WA 1IXZA 1II9A 3WYAA 1ZUIA 4BFTA 5HCNA 3SJCA 3X1ZA 1ZIPA 2CNWA 2CK3D 2QROA 3TE6A 4PHFA 2O8FB 4V0OA 1Z0FA 1GP2A 3GLIB 2ZU0C 4YMUA 2FU5C 1SXJE 1AS3A 1FTSA 1LVGA 4IOKA 2WKQA 4OHWA 1G4AE 2J0VA 4M8NE 2V7QA 5JRJA 2P67A 1PJRA 1AKEA 2ORVA 1W5SA 1Z08A 4ZCMA 1E79A 3NBXX 3VX4A 3CO5A 5BN3A 4TMZA 4CDGA 2GCNA 1NBME 1SHKA 3JZAA 1H8ED 4HDCA 1BKDR 3MFYA 2QUZA 1E2FA 3WNBA 5FL3A 1XWIA 4F4JA 1E4VA 1W48A 2R6FA 1LF5A 2CL6X 4DB2A 4LJ5A 5BXQC 3O8RA 1FP6A 2CNWD 4LPKA 2GKSA 4BFZA 2ZRMA 4W5HA 2AR7A 1IBRA 4D25A 4AD8A 2ZRNA 1AZSC 8OHMA 1NI3A 4DCUA 3TK1A 3W8RA 2O8BA 1KK2A 3WRYC 1KZ7B 4G5OA 1EWRA 2V7QD 5C18A 2F1RA 2ZE6A 2ZJYA 3EZ7A 4HB0A 2IWRA 1E96A 1AJEA 3LLMA 2YYZA 2W6JD 4TL7A 1AA9A 4Q4JB 5FTJA 2D62A 4Z51A 4QBIA 1NJGA 2Q9AA 1PZNA 1Z2CA 1P73A 3CF2A 2ZRLA 1GSIA 3QXXA 2QP4A 2ZRKA 1WXQA 3EPKA 3B1VA 3VU9A 2R6DA 4LSGA 1S3GA 1VKJA 2JAQA 3RVBA 1YE8A 5EXXA 2O5VA 5KO2A 4GOJA 4LRTA 4A9AA 3QXJA 2QAGC 2VPPA 4ZIRA 2WIAA 4B2LA 4N0EA 3QJYA 5JSZA 4Q4AA 3QE0A 1VIYA 2GNOA 4IDQA 2IXEA 4EPRA 5KUTA 4CEHB 2ZI7A 1QBKC 2E87A 1NVWQ 3ASYA 1VTKA 1VHTA 3DZ8A 3W6NA 2FOLA 121PA 4YDSA 1IN6A 3U4QA 1NN1A 5CLLA 3RSOA 1CU1A 3KQLA 2QE7D 3T12A 1T4GA 4HAWA 2OE2A 4UXHA 2KE5A 4OKSA 1FTNA 4LV6A 2ZRBA 1NLFA 4LJ8A 1P2SA 1TL7C 2R2AA 4B44A 1KI7A 4KITB 3ZZTA 4WXPA 4KO8A 2Z4RA 1M7GA 5IF9A 2PX3A 3U2QA 3J81k 1Z6XA 4D0LB 4C9BA 1OW3B 4CRWB 1SXJD 3OE7A 1VIAA 2EFHB 2QG6A 2V1XA 4JLAA 1OXVA 1W47A 4P3YA 4PHTA 1AGPA 3FKQA 4KFSA 3AF1A 3GLGE 1OXXK 2IK8A 3PG5A 4AG6A 3AM1A 4LC1A 3ZZ0A 4B34A 3CPEA 4D26A 3PEWA 1Z06A 3A37A 1M8PA 5J4KA 3K9HA 4OHXA 2HYIC 1AZTA 1SXJB 3CPHA 3ONWA 1US8B 2J87A 1D9ZA 5AK0A 3VTKA 2J59A 4U00A 4NCHA 2DPXA 3SN6A 1AIPA 4I4LA 5EP4A 4PC3A 1VCOA 3U4QB 3UATA 3BH6A 1YRBA 2RGEA 3QENA 4XVRA 1DE0A 1OSNA 3BH7A 3QUSA 3R7WA 2GXAA 3FMPB 3KUCA 4GDFA 4KSCA 1II0A 4BE7B 4QM6A 4OQXA 3CNNA 4JBYA 1YZUA 1VDZA 3QPWA 2GZAA 4JLOA 4K81B 4CT5A 5FOWA 2YV5A 1FFHA 2ZI4A 2FA9A 1RE0A 1RRFA 1EX6A 1XPOA 2FEMA 1MO3A 4G5QA 5KDLA 3QKTA 3CRMA 3Q5EA 4XIGS 3GFTA 3AEZA 3DVLA 3IHWA 3QPVA 2VP9A 3GJ4A 1Q57A 3X2SA 1EESA 1E9DA 2MMGA 3CLVA 1GNRA 1M1YE 2GF9A 2J7PA 4F7WA 3ZZUA 1G19A 3RS5A 2AXNA 3NBFA 4JVNA 2XXAA 2GBLA 2XB4A 4LYJA 4BFWA 4QL3A 2R6GA 2CMKA 2B8WA 2ZE8A 4MKGA 1Y63A 4RZUA 3PJRA 1GAJA 4JYBA 1JECA 2FFQA 1N6NA 3TNFA 2QP3A 2OUKA 1YRAA 3RAPR 4POAA 1KO1A 2IXFA 3FVQA 5FUXA 3QEOA 3IO3A 4WAUA 4XVUA 4DLUA 4JLNA 4B33A 4HB3A 4DT1A 4R2IA 1AS2A 3SFVA 5FPTA 1JB1A 2GAAA 4M22A 5KSPA 2UKDA 4LYAA 2J7PD 4AK9A 3A4LA 3EPHA 4PAMA 1E2KA 3I8XA 2FSGA 5HKKA 4XJXA 1D2MA 1P9RA 3WBKA 4ABYA 4Q9LA 2ZAOA 2GDJA 2FJUA 3ZLJA 5G41A 4I99A 1DO2A 2NOAA 2A3RA 1KDOA 4UJ3A 4XTCS 4TQAA 1CRPA 4D82A 1CRQA 3DMNA 3NBZC 5DI3A 1XPUA 3LVQE 4PZLA 1I4DD 2QRZA 3QXHA 1UBGA 2ZPTX 4LPSA 3OEHA 1XXHB 3THXA 1TEXA 1FQKA 1TF7A 2QNRA 2CXXA 2DBYA 2DYKA 4WZBE 3OZXA 4NYMR 5D3MA 4C7OA 1T5LA 2BOVA 2F1JA 5KSZA 1G8HA 3K0FB 4XVQA 1P7CA 4Q01A 3EPLA 1QHSA 2P3SA 4HAYA 5FTNA 1KO7A 3SR0A 1KI6B 2X77A 2WM9B 3GLGB 4EDHA 5B64A 4BEJA 3H2YA 1L7VC 5HKKD 3IPXA 1K6MA 1ZM3A 3KB1A 3CW2A 3NBYC 4RCYA 2FPMA 5JHHB 2B6HA 2YWGA 5GJCA 1KJZA 1FUUA 5HCIA 1EFRD 4QRHA 2RHDA 1XTIA 3DEFA 5BYJA 2QAGB 4UJ5A 3GEIA 5LB2A 1TF2A 2OM2A 3OEHD 2XTMA 4NMMA 3W9YA 1Q1EA 2B92A 3CX6A 1U94A 4JLKA 1XEXA 3NEJA 4A92A 4D2IA 3AVWA 1E2MA 4TZ6A 5CJPA 1FMLA 3QSYA 2J45A 2IS2A 1UDXA 4URUR 2G77B 4LRSA 1WF3A 4M9ZA 4OQLA 3DMDA 4E07A 2OLKA 5KSYA 3IEVA 4ZPXA 5J40A 4C0SA 4GOKA 1I2DA 1EFUA 1Q22A 5DGXA 4BZQA 3T1OA 1SVOA 5CIWA 3OIWA 3MWJA 1XMJA 1ZW6A 3KJGA 1ZP6A 2A78A 4Q9HA 5G53C 1G5RA 4MKFA 4ZKDA 4J0QA 4MKHA 3SEAA 4JBXA 1BMFA 3MMPA 4AG5A 1KMQA 3CRVA 4B75A 4EAQA 1JR6A 2JDIA 3W3AA 1ZNXA 3KKMA 1IJEA 1JJVA 2QBYB 2DCUA 4QC2A 4MDFA 4OYHA 1TQ6A 4W5JA 3QF7A 2MSDB 2YJTD 4O25A 3SJAA 3I5XA 1HYQA 4P31A 5TXGA 1FW6A 1QHHA 1ANKA 2UZ3A 2ZE5A 3OF5A 1JR3A 5LDDC 1GITA 4Q47A 3THWB 2P0EA 4IVPA 3SNHA 3BORA 2KSQA 1DO0A 2VL7A 4GSYA 2IYRA 2GCOB 1GRQA 1LS1A 4GMXA 1XEWX 4WZ6A 5AWFC 4ZDIA 4HDQB 1WRBA 2JJ1A 1N5KA 3G82C 1BMFD 4PC1A 4MYUA 4B3DA 3B9QA 2GHIA 3CRW1 2JDID 3ADBA 1WE2A 2RGXA 2NZ8A 3AVOA 2QMUA 1W0KA 1T6NA 4A2PA 5KDOA 2OEPA 1T3HA 3KKOA 2C04A 2BMEA 2Q6TA 4LDJA 1T8TA 4DLWA 1KTVA 2ECKA 4OI1A 2J0QA 4GI7A 1E9EA 3REFA 4DLRA 4JLVA 3U60B 1OXSC 4HAUA 2QMEA 4KI0A 1N5IA 1Q44A 1YVDA 5BN5A 2WOOA 5CDFE 3FFAA 1N0WA 1GVNB 1KOFA 1OKKA 2EU8A 4W9MC 3HP1A 1Z6YA 3GCGA 3RHFA 2JJ1D 4NCNA 3UMSA 2ZI5A 1RJ9B 1G17A 3TIFA 3U6BA 1U8AA 2FFAA 3AVYA 2RGGA 4EJSA 1BS1A 2IUTA 3CB4A 1OIXA 1W0KD 1IXRC 1MKYA 1CJKC 2DY1A 1FZQA 4AKGA 3KQUA 5HE9A 1JXMA 2JJ8A 2IWHA 4IDNA 4IOJA 3A4MA 2H16A 4D4LA 4NP6A 3CR7A 4PQYA 1G291 3SYLA 2KBFA 2ZRGA 4P32A 5GVRA 2RGAA 1H8HA 1IN4A 1GKYA 1WCV1 2F7SA 2C5LA 1TU3A 4FMDB 4B48A 4BLTA 1F2UA 3N5CA 3MD0A 2XZLA 1E3MA 5KDDA 5TDHA 1G3MA 1OKKD 2BBTA 2E1RA 4PHHA 3QY0A 2IYQA 4LZZA 5JI3E 1HE8B 4NYMQ 2XOKA 3I73A 4V0NA 1UADA 1R7RA 3X1DA 2X2EA 2WWXA 5DLQC 3BGWA 1KJYA 1QHYA 2J46A 2JASA 3KKNA 2ZQ5A 2IYLD 1XMVA 3RABA 4OJQA 2IS6A 3L0OA 3AVTA 2Z0MA 4L9WA 3BAFA 4RZ2A 2AK2A 3FFBA 3LV8A 2ZM5A 1R5NA 1MO5A 3E5HA 1RYHA 5C2JB 4TYNA 3PITA 3BFVA 2CE2X 1W49A 4V0KA 4TYPA 4RZ3A 2ERXA 3AP2A 1U0JA 4A15A 4B2IA 1HA3A 2PZEA 4ILEA 4OK3A 1YZNA 1ZU5A 3HPQA 4JVSB 2GAOA 2VHTA 5J5CA 4NPHA 4B3GA 2XOKD 2FMXA 1R0XA 2WJYA 1K5DA 5FR1A 3SZRA 1UKVY 4JL8A 4HB2A 1NIJA 2QMHA 1EX7A 3DOFA 2FH5B 4HLUA 4BZXA 2FSFA 1Z0AA 2JATA 1S9DA 2PMKA 2OSBA 2AK3A 2XEXA 3BE4A 3O8DA 4PZZA 5EXPA 1N0UA 2HUPA 2ZSDA 1VECA 5EQTA 1KGDA 1R0ZA 3LBHA 5JWHA 3TBKA 3ZVLA 1E2JA 2ZR9A 2A7QA 2F55A 3T15A 1KY2A 1P5ZB 1ZIOA 4CGZA 4TYQA 1CULC 5M04A 4TTRA 3B1XA 1T8UA 1NMYA 1CEEA 3W34A 2IX3A 4QGGA 4Q9KA 1J2JA 1N6OA 1L2TA 2HEIA 1E1QA 5D3QA 1Z6TA 2QTVB 4DEXA 2VLIA 1EG7A 3BB3A 4M21A 1AK2A 4Q02A 6Q21A 2IEYA 4CYMA 1YZLA 3U44B 2XZPA 1W46A 3QEJA 2ZJBA 3AVXA 1W4BA 1P9WA 5BYKA 1ZM2A 4OQFA 3EWSA 4K46A 2OAQ1 3KQNA 2IYUA 4PTLA 5BN4A 1IM2A 1CS4C 1CR4A 1R8QA 3PV0A 2PLFA 2QRNA 2AHOA 4V03A 4MGZR 3AB3A 4RFSA 4FCVA 1II8A 4I1UA 4I1VA 4CEJA 1SVKA 1ZRHA 5L3SA 1GKIA 3QKRA 5EP3A 2QN6A 4BEBA 3HR7A 3NDPA 3THYA 4URXR 4CEIB 1XTKA 1HT2E 3VHLB 3EWAA 1E1QD 1XP8A 4XTRA 3B8HA 5JJIA 4C0QC 5EXTA 2QORA 2QI9C 4HZUB 1CJTC 4B47A 4OHYA 4UNSA 3P4XA 3PQCA 1E9AA 4MA4A 1PVOA 4GOXA 1QZXA 3KL4A 4Q4HB 4KAXA 5K8LA 2ZS7A 3CIOA 2ASEA 2PT5A 1MABB 3LY5A 4DSUA 5FI1B 1M6NA 2NIPA 1U2RA 2Q0HA 4DLVA 1UKEA 2F43A 3B7GA 2HJGA 3IILA 5FOSA 1SHZA 3M1IA 1NRJB 1G5PA 3PENA 3QKSB 4Z8YA 1U9IC 1XX6A 1YKSA 3H0KA 2J0SA 1NKTA 4XD7A 4C0JA 4Q7MB 1OH8A 1CR0A 1E2LA 1GUAA 2G1JA 1S2MA 2B7BA 4KCGA 2PH1A 4M1KA 1KHTA 2WWGA 1P4SA 2FFBA 3QG1A 4M0LA 3HDTA 2HCJB 4RJLA 4DDWA 5KTYA 3KFVA 4HLDA 4M1YA 4GZLA 1F3OA 3PVSA 1JXOA 1CBUA 2QY9A 2BV3A 4IEEA 4DCTA 1TAGA 2F1IA 3KXKA 3T1VA 1FNNA 1M7HA 3WHLA 2H5EA 4OJKA 2H57A 3B6EA 3RWMB 1XTJA 3SBDA 1OE0A 2GEDA 1OPXA 1E2DA 4B3BA 1KNQA 4HATA 4NZYA 4U5XA 1WA5A 4DB4A 4KXFB 2JLUA 1GOTA 4ASUA 3SJZA 1MO4A 4BQSA 1IONA 4DIEA 4IVQA 1PLKA 2YOGA 2AWOA 2OFWA 1NVVR 2GA8A 2GXQA 3QPUA 2D7CA 1G4UR 3K9LA 4R7ZA 2ZI3A 3F0TA 1W7AA 4AYWA 1IJFA 1YZGA 3K0AA 3LWNA 4Q66C 1AGRA 4BRUA 2IA5A 1PUJA 1IXSB 4HAZA 1IOZA 2O8FA 4IEIA 3GLIA 4DZZA 3X1WA 5FH9A 1XFAA 2O8DB 2QEQA 3AVUA 4ASUD 2BC9A 4RD2A 1ZCAA 1T3LA 3PCRB 5EZ5A 1C4OA 4Q00A 4BFYA 5L3RA 5EE0A 1CLUA 3PEUA 4B76A 2VH5R 3IBYA 5FR2A 1E2NA 2IUSA 4HLQB 2WSMA 4M9XA 1IHUA 2XNSA 4Q7LA 1MH1A 2A2ZA 3E70C 3WNDA 4YONB 1G8FA 3ZVNA 3ICEA 3LBIA 2DZNB 2NG1A 3RC8A 1C1YA 1HT1E 4BGDA 2ZANA 4GT1A 2RGDA 1KI1A 3BK7A 2R6AA 3GD7A 1ELOA 3IIJA 2G88A 4OK6A 1H8EA 2H8KA 2ZEJA 4G1UC 1NLYA 1E99A 3IIKA 4EKDA 2XITA 4MGYR 4NYJR 5EZ6B 2KB0A 3UPUA 1YZTA 4YQFA 4LHXA 3GEHA 2E9SA 4G3XA 4Q4JA 2IL1A 4YMSA 5LB4A 2CL0X 4AURA 4DBLC 3LD9A 4YXWD 2IW3A 4QNRA 2ODNA 3C5CA 2IBMA 5FOVA 4BFSA 3QG5A 1YR9A 1SVIA 4O2RA 4Q1AA 2CCKA 3WP1B 5TVKA 5J4LA 2BJVA 4FCWA 4LJYA 4UNNA 1W36C 2OCBA 2W6JA 2CJWB 3BIFA 4JBWA 3PFIA 3ADKA 3TGPA 1ZD1A 1LV7A 1TQ2A 4FI3C 1NG9A 3NKVA 3K09A 2W2TA 2ZRCA 3CX8A 4BECA 1YR7A 4CEHA 2PEZA 4IHQA 2O0HA 3D31A 1Z07A 1NJFA 1YR8A 2ZVQX 3AP1A 4MH0R 2PLRA 3NHAA 4XWAA 4HUTA 4GPTA 1GZSA 4YMWA 4DSOA 1GTVA 4JSTA 5FBWB 1YHNA 3T06B 4H9GA 1SGWA 2RGNA 5HE8A 2J0UB 3R8CA 5EJEA 3FOZA 4GRAA 1Z28A 5FTKA 3I5YA 1V5WA 1DARA 4Q19A 5C4MA 1BIFA 5DE3A 3U3KA 5F98A 2PCLA 4QG7A 3SI7A 1UBFA 3M4YA 1KZGB 1VG8A 2ATXA 1DBSA 3LDAA 2QE7A 3AVPA 1GM5A 1E0KA 2PBRA 1VG1A 3TUJC 1O3YA 5KU1A 3BFKA 1XD8A 1CJMA 2IYZA 4M53A 5JS8A 2AX4A 2VBCA 1OH6A 3ZQ6A 3Q7PA 3B1WA 4RD3A 3RRYA 1C1KA 3SQWA 1XCGB 3O8BA 1DELA 3GJ5A 2N1BA 3N2EA 1DOAA 1SXJA 1US8A 1ZNYA 2NO1A 1X8LA 3A1UA 3KJIA 4ERNA 4B32A 1G6OA 2ZJZA 2GTPA 2WICA 3HYTA 2C9CA 2REOA 3AF4A 5IT5A 5KPDA 1M34E 2FGKA 1NVVQ 4P33A 4ARZB 3I62A 1NBMA 4US2R 4G0NA 1Q1ZA 2JLZA 3GFOA 1OYYA 5GJBA 4Q7JB 2EFDB 3KDSE 2IF0A 4RD1A 1MRSA 2ODBA 2VF8A 3S1AB 1DAGA 2GJ8A 4JLJA 2QP9X 3NIBA 1NNEA 1XXHE 3TQFA 2VSOA 4HLCA 3K0CC 5HTKA 4F93B 1N6RA 3RANA 2C95A 3OFNA 4GZMA 3A1SA 3VR2A 3P26A 3E2IA 2JEOA 1ESMA 3U7GA 5AJVB 4QBHA 1EFHA 1B23P 3IQWA 3L82B 4XSGA 4DUGA 5E7JA 2HLDA 2DZOB 3LA6A 3TH5A 2DWZB 4L8GA 4QKQA 1E9BA 2Q3HA 3DM5A 5C46F 1AM4D 5JLJA 1TEVA 1WDTA 1XEFA 1NBMD 1N2CE 4JLMA 4OI4A 4URYR 1RC8A 1A2KC 3U5ZB 1DAIA 4DLXA 4ESVA 4M1SA 2JLWA 4W5WA 3LLUA 3BRWD 3CF6R 1CJUC 1G1MA 1KSHA 1QHIA 2A30A 4MITA 2D74A 3RSLA 5AUQA 1NSTA 1LFDB 2AKYA 5G3ZA 2EWWA 2IF2A 3GJXC 5IDVA 2IS4A 721PA 3Q5DA 4A8JC 3P27A 5LPNA 4LCBA 2FFHA 3OFND 1N6HA 4BLSA 3VR5A 2AFIE 4B73A 1L4YA 5JMTA 1WB9A 4TLCA 3LXXA 1U0LA 5HZKA 4M9SA 5DHAA 4ON9A 5TV2A 2ZREA 4DUGD 4C4PA 1G7TA 2ZI9A 1NY6A 2HLDD 1DAHA 4DC9A 1SKYE 2WWFA 1SVMA 4PPGA 1EWQA 5L3QB 1GL7A 4D0GA 1X37A 2W2XA 2EW1A 4IOMA 5HR5A 4GITA 4QBGB 4LX0A 3BB4A 1T3SA 3HU3A 1OXTA 5TB5A 1XXHA 3UKDA 2BDTA 3KW6A 2WSSA 3G0HA 3R9WA 4HUQB 4I81A 3BOSA 4B3FX 4ZV4A 4UNQA 1HQYE 2JLSA 3K0FA 3ZS8A 4YMVA 3TMKA 3PUXA 1KI6A 4LJ7A 5KOYA 5EE3A 1GG2A 3GLGA 1XBTA 4YDHB 4ACBA 2HF9A 4QGAA 1HURA 1ZD9A 2QPOA 3KXLA 1G16A 1UF9A 4BFXA 3A58B 2J3EA 4FWDA 3I32A 2LKCA 5FUVA 3IBGA 2OCYC 1F2TB 3C4JA 1W36B 1ZUHA 1ZAKA 3AKEA 2G0TA 2C2HA 2QAGA 5FBQB 4B71A 3W90A 5FI0B 3NHBA 4IJMA 1R2QA 2WSSD 1N6IA 1TU4A 3LVRE 1P72A 3EIHA 4BPBA 1T9HA 3GFPA 3RC3A 1EFRA 1E0AA 4MRRA 4M4SA 5L3VA 3C41J 2AXPA 3EG5A 4TQUS 1G7SA 3IKJA 3OEEA 4YMTA 3IPYA 4NH0A 4D81A 2BWJA 4LRWA 3B9PA 1AQYA 3OAAA 2ZAMA 2JLRA 5AJZA 5SZKB 3TJZA 3KKPA 2OBNA 2I1VB 1MOZA 4A0FA 2JGNA 3U61B 1OF1A 2DFNA 2DWQA 4OBEA 5JRZA 3GJ6A 5F9HA 2EYUA 2J1LA 3RYTC 1Z3IX 1Z6AA 1S1MA 1NP6A 2YKGA 3IO5A 2O8CB 4DRZA 3Q72A 2QBYA 4HDOB 1X8KA 3DL0A 3MAAC 4LGMA 3ZQJA 4D0NA 4NKRA 3TSZA 3KQKA 3MHVC 3OEED 4AWXA 4UNPA 3T5GA 1EGAA 3HJNA 1L4UA 3FB4A 4BLRA 1UEIA 3OAAD 3THWA 2QM7A 4E5UA 4FMCF 2F9LA 2GCOA 1P3JA 2V1UA 4Q1CA 4IOLA 1B0UA 3GJ0A 4AY2A 5H8WA 4GNKA 1EFCA 1Z6GA 3ICQB 4NONA 2I1QA 2GJKA 4JN6A 1SKYB 2REXB 2XJ9A 3EA0A 4PC7A 1CKEA 2C78A 3ADCA 2UVQA 4IFEA 3CX7A 5ANRB 1E0JA 3L8YA 1NF3A 2IEZA 1NY5A 1W0JA 2BHRA 4MUAA 4KU4A 1GNPA 1W4CA 4X8LA 1CXZA 2J9RA 3FHCB 4A1FA 1GL6A 4PC2A 3REGA 1G8PA 1KSJA 4AIIA 2DFKB 5F9FA 5GJVC 1SVWA 3BBPA 3THOA 5BWMA 3DZDA 2ZIAA 2ZTSA 2V6IA 4M9QA 2OXRA 4ITRC 1CIPA 2QMOA 2VP5A 3GEEA 1RJ9A 1XCPA 2V9PA 3DHWC 3N70A 4MUBA 4Q7KA 2G0NA 1ETUA 3HPRA 1IN5A 1RRGA 1XRJA 3DO6A 3N2IA 2GETA 4HI0E 3CR8A 1DVRA 1V43A 1G21E 1XTRA 1Z5ZA 1W0JD 2YOFA 4MRPA 3CH4B 4LY6A 4A8JB 821PA 2W0MA 5JS7A 1KK3A 4Q4LA 1CR2A 5JI2E 4DVGA 4LWZA 1I4TD 1Q1BA 2QSZA 3ETLA 3T35A 2DHRA 2HCBA 1QG4A 4C0BA 1E9CA 1GL9B 1A4RA 2BMDA 1OJLA 3MWYW 4Q1EA 2JLVA 4HB4A 1JQJC 1FOEB 5H70A 1O87A 2O8EB 3TW8B 2XB2A 4LBWA 3EIQA 3UMRA 1SKQA 3K0EA 1G5TA 2IYSA 2QSYA 4YC7A 4C3ZA 4BRWA 1VG9B 3C7KA 1ZNWA 2G3YA 3K70C 2K5UA 5KNDA 1KKMA 2CLSA 4UQOA 3AGPA 3B5JA 4TLDA 3SOPA 1Z0IA 1XJQA 1N25A 3C5HA 3WMFA 1AN0A 3I4LA 1XF9A 4IVRA 3PIRA 2B7CA 2F9MA 2AD5A 4G5RA 4N1AA 4DDVA 3EAQA 3H84A 2GEUA 2QA5A 4IW3B 4D4JA 4C2TA 4XH9B 3DKVA 4A0HA 3QXSA 1Y3AA 5BQ5A 3R9XA 2XSZD 4R98A 2C99A 4V0ME 3B85A 3SYNA 2PMDA 2R8RA 3FMOB 4G5SA 3PEVA 3VMFA 2XX3A 2CHVA 1LF0A 5DYGA 2N46A 4ACAA 1S4QA 4F4IA 1VCIA 1W5TA 1EFTA 2C03A 4KVGA 5DSZA 4RKFA 2WOJA 3RRZA 4C2UA 1PLJA 1SQ5A 3UG6A 1G64A 5ELXA 3W8NA 2A9KA 1RIFA 2LCFA 4C30A 1Q20A 4TTQA 5J4YA 2PEYA 4DXAA 1E94E 1G18A 1P75A 1E2PA 4PQRA 4ZO4A 3VKWA 2QL6A 3KJHA 3EXAA 3QOFA 5AJXA 4B43A 2VSFA 2ZR0A 3FWYA 4EFMA 4MGKR 3U44A 1NN0A 4KV9A 5CJ2A 3P1JA 4JVMA 3ND9A 2Q3FA 3RWOA 3SDZA 3WHKA 1KMHB 3GPLA 3B2EA 2OBMA 1KDPA 3LQRA 2HV8A 4PO8A 2PZFA 5CDFA 4RCZA 5LBIA 3EIEA 521PA 4BFUA 5KYKA 2BEJA 4XOIA 2Z43A 4EPTA 3QXCA 2P6NA 1OFIA 1FX0B 3B13B 4JLBA 4ZDJA 4RD0A 3JVUA 4PPNA 1QG2A 2X2FA 1E2QA 2VSXA 4WXRA 5FL7A 4CEIA 1GILA 1L8QA 2GK6A 5LD2C 1DG1G 4JL6A 1VPLA 1OHHD 2FN4A 5SZJA 5EXSA 4RFVA 4HZUA 3WMGA 4A82A 1I2MA 1W4AA 1X86B 5FUWA 2WPDD 4FXPA 3U7EB 2CCGA 2ZSFA 1ZM4A 1VYVA 2YWFA 3GLHE 4A3VB 3C8UA 4Q4HA 4Q9JA 3VR4A 2SHKA 3U3RA 4NCJA 4LV5B 1MABA 1M7BA 2QGNA 2W6IA 1MO6A 3IQXA 3IIMA 4ZKEA 3WRXC 1W2GA 2VP4A 4WIAA 1J8YF 4FWTA 4OK5A 1Z8FA 1DADA 3HU1A 2BBOA 2XTNA 3FKSD 1XB2A 1OLOA 2YC2C 3QKSA 2ZXUA 3RS4A 3I8SA 1ZJ6A 2P6UA 2WWYA 1DPFA 5FL7D 2YWEA 1Q3TA 2LWIA 2ONKA 3EW9A 1XZPA 2ZRHA 4II7A 1HH4A 5AJYA 5CK4A 4AI6A 2HF8A 1RRPA 1Z0KA 2V55B 4DJTA 1YJ5A 3OIUA 1YZKA 1LY1A 2WWWA 4WVFA 4I1OA 5CLQA 1WQ1R 3CRQA 2VHQA 1TUIA 4GP6A 5FBLB 1E69A 1VHLA 1HUQA 2QU8A 2ZYVX 4QJ4A 4LUCA 3ASZA 2GVZC 3AF2A 1DS6A 3U3OA 4PHGA 2ZYTX 2W6ID 4EFNA 4F4CA 4Q03A 1GDDA 2A5YB 2BMFA 1SVSA 3JVVA 4KFRA 3W3ZB 4Z8XA 2NO0A 3PUWA 1P2TA 1Z83A 2ODEA 2V54A 4IDOA 3ZYCA 2G1KA 1M74A 1KI2A 3GLFE 3WBJA 2QZ4A 3UWKA 4LJ6A 4TL8A 3KKQA 3ZD7A 1SZPA 2Q9CA 3EC1A 3VKGA 1OFUX 1Z47A 5B30A 3UK6A 3LQQA 5AUOB 1U99A 2C8VA 2W00A 2ZITA 4N0DA 2FNAA 1TNDA 4AKHA 4QGFA 4TL6A 3IEUA 3SFZA 5FPKA 1G3QA 2ATVA 4DWJA 4US0R 2AFHE 5DN6A 4FD2A 2BCGY 3H4MA 3Q8XB 2JJ2A 4P4SB 3K70D 2QENA 1ZU4A 4P0TA 3VNVA 2JLXA 1HEIA 3AF0A 2CEAA 3K0SA 2BM0A 2D7DA 1JBKA 2EYQA 2B21A 1DTSA 4DEYA 1M2OB 1A7JA 4FINA 1Z0JA 3X1XA 4Y0AA 2HXYA 3MCAA 4MDEA 5EUQB 4A0RA 3LAWA 3K70B 1DAMA 2WAXA 5TARA 4NYIR 3TUIC 1NMXA 4TMWA 1Z2AA 4Z1MA 4L9SA 3Q9LA 2O8DA 1HV8A 1W1WA 4EUNA 3CUEF 5FPYA 3SHWA 4EQ6B 1XPRA 4B2PA 4E22A 3U6KA 4HZIA 3PUYA 1HE1C 2WJIA 5DN6D 3R9IA 2AWNA 2ERYA 4JT2A 1G8GA 4NHOA 2JJ2D 2RHMA 3C14C 3TAHA 3HYRA 1NVMA 4LK2A 3NTUA 4A0GA 4B6FA 4DDTA 4DSTA 2ANCA 2CBZA 4G5GA 2IYVA 3U3JA 3L0SA 2ZE7A 3I61A 3LNCA 4HAVA 3L0PA 4ZCIA 1PV4A 3FHTA 1NLZA 3A1WA 4DDUA 1E0SA 1UBEA 3EA5A 3GLHB 1F60A 2F3TA 3K9GA 4WZAE 4LJ4A 1ZYUA 3VR6A 2P5SA 3L0IB 4URWR 1D2EA 2YINC 2WWIA 2B8TA 4QGHA 3EZ9A 2FZLA 2TMKA 3C16C 5EE9A 1OFHA 1I4LD 1S3SA 4IDPA 4Z1MD 2GCPA 1ZM9A 2QTHA 4B3XA 1XZQA 1WMSA 2CHQA 1JAHA 3O8CA 2ZSEA 4PANA 5IRCD 2Q9BA 3B1YA 3L2OB 3UANA 5DNYB 1G20E 2NPIA 2VEDA 4TMKA 1Q3HA 4D4KA 3CNLA 1RPZA 2PL3A 3H1TA 3EZFA 4PX9A 2GK7A 3F8TA 4KFUA 4TLEA 1MV5A 3UXMA 4CT4B 2PCJA 4OQMA 3SC3A 2G83A 5FPHA 1XD2B 4HEJA 1Z63A 4FWGA 4MYTA 1JPJA 1U98A 4PSVA 3QNUA 3TSOA 2CJWA 4YXWA 1LTQA 3BWDD 4KLNA 1U81A 2RGBA 1BH2A 1TMKA 1Q21A 5H1YA 4DCVA 1WP9A 2GRJA 3D3QA 2ZS8A 3P32A 3VR3A 3CRRA 1N6LA 2WKRA 4PPFA 5FPSA 1OT3A 1Q1QA 3GLFB 5C1BA 2OFOA 4RZXA 1JJ7A 5LD2B 3QKUA 4U02A 1BOFA 2OILA 5HZHA 3VNUA 3FPAA 4M1MA 4PPQA 1XU4A 4KYUA 4A4DA 1A1VA 2J0UA 3UIEA 2F1HA 3EZ6A 4PFSA 5KNCA 4WA7A 4KBFA 2EQBA 2OV2A 1QZMA 1WBBA 4TTPA 1G9XA 1XEWY 1OH7A 1JQLB 3UG7A 1X1RA 2VHJA 4OHVA 4JL5A 4TMTA 5FBVB 1AKYA 3SQXA 2HDNB 2P6RA 3JZMA 1U9IA 3BJIC 4FWHA 2ZRJA 3K53A 3MG9A 1N5LA 2MSCB 2IHYA 4L5BA 2JCSA 3MSXA 3BXZA 2NO6A 3AUXA 3PR1A 3RRMA 4NU0A 3FTQA 1D9XA 3TLXA 1OB5A 1F5NA 3PUZA 3SS8A 1QVAA 1FP7A 4LC0A 3AJIB 5EP1A 4WW0A 1X6VA 4M1OA 2QAJA 1MR3F 2D06A 4X8MA 3SBEA 1KO5A 3QF4B 4OHZA 2X19A 4DIDA 4WOPA 3LO5A 4PSAA 3ZDQA 3GQBA 2VRWA 4FWIB 2IHBA 4JLPA 4MKIA 4ARZA 1OB2A 2WJHA 4DHEA 4LI0A 4PAOA 3FMIA 3FMFA 4Q18A 4KJZA 4I1SA 4B74A 621PA 2FSIA 3CZQA 2CLDX 4KFTA 3S1AA 1UBCA 5FOXA 3CBQA 3MRSA 4DLSA 1G3RA 4TZ0A 5KHOC 1JNYA
chains in the Genus database with same CATH superfamily
1YQTA 2GERA 1PHPA 1RCUA 4RNCA 1IUPA 2QGZA 1CP3A 3KEQA 5KJ6A 1V5EA 3OIVA 1MNQA 3I2HA 3ZD9A 2GNPA 4LBVA 2GPJA 5G1NA 5B1IA 3INGA 2BKLA 1QYRA 2JLYA 1CPYA 1C3EA 4K9MA 4QASA 3ZWWA 4B6EA 1EGVB 3I5UA 1WQ4A 3BIJA 3LOQA 2UVDA 1NIPA 2OXEA 5I9LA 1GSHA 4PGMA 2YZKA 3C48A 3L05A 1T1RA 4BLQA 3PKIA 5EMJA 2QYTA 4MA0A 2W7TA 3DMFA 2DY0A 1K5GA 3ZGOA 1E3SA 1EK0A 4PAQA 2GM4A 1WXXA 2ZZKA 4BLPA 1Y0BA 2OD2A 1P29A 5L40A 1LK0A 4BNFA 3W04A 4NV1A 3MBIA 1SIBE 3J7BA 3BL8A 5J2TA 2CLFB 1IXYA 3VM6A 4D0SA 2O7NA 4BEVA 4QIHA 2OO3A 4AJPA 3D8BA 3KZCA 1L7QA 3N58A 4WINA 2Q5LA 3ZY3A 2ZWPA 1YVEI 4D4IA 3LGAA 1XMOM 4C14A 4NXNB 2QJOA 5GP1A 4DMLA 1VJ1A 3NRJA 3X0DA 4EW3A 5DISB 2NW6A 1ESZA 2WTBA 2ACKA 4PNHA 3ASUA 5TT1A 4YRQA 4XGQA 3M0EA 5A5DA 3E46A 1KJWA 4H1HA 2W42A 1UM9B 4Z4EA 4IWNA 3CKLA 3K0CA 2C4VA 4PU0A 1P2VA 1LPOA 4ZD6A 3DBLB 5CGQB 5DM0A 5KYWB 1XZJA 2AJLI 5TSDA 1C0PA 2QX7A 3T61A 4W7SA 3U7HB 1Z18A 1KVUA 3VHXA 4WN9B 4HV4A 3CVXA 4RULA 5BSEA 3R5TA 3MA0A 3FH0A 2X5XA 4WY8A 2ZZMA 3GI1A 4YJGA 1OFUA 1UXGA 2V7GA 1MB0A 5HIAA 1A8IA 1QNFA 3WY9A 4OI2A 1QIEA 3VZCA 1X7XA 1IJBA 3T5CA 1QORA 5HYVA 1R6UA 4U2KA 3CGGA 2XUAA 2VUIB 2B20A 3RLFA 3AFIA 2J5RA 4RD4A 1IQPA 4G0ZA 3OQOA 1F48A 4F3CA 5I9MA 1FRZA 3HCFA 3KLNA 3JATB 1KMHA 1JAIA 2FE4A 5AVQA 1NXXA 4QJ3A 1Z39A 4C0XA 1Z29A 1R4AA 4QOIA 1R2ZA 3TVDA 1BO6A 2JD1A 3LHFA 4R1TA 1F12A 3TKAA 4CF6A 5ECGC 4NJOA 2HCTA 1DC4A 4W5TA 1YI0A 3IAS6 4HLNA 2EFGA 3B60A 4Z54A 1CF4A 3BE8A 1U7WA 1DG9A 4NULA 1F1JA 3AT1A 4G1VA 5FWNA 5IKXA 1XQ6A 4I4NA 1KEKA 1RAIA 1O57A 1X7ZA 3KQPA 4I1RA 3TQQA 4CDRA 3G17A 2EZTA 4FMBB 4KLCA 1MOPA 3KS9A 4C78A 1H2AS 3O84A 4NHEA 6ABPA 3WSTA 4PLVA 5A6SA 2DWOA 1R10A 2D7JA 1I9GA 3L7CA 4RHTA 1OASA 3PFGA 1X39A 1Z4OA 1KQGA 3ENVA 4OLAA 1CUJA 3ADDA 1KZ1A 1XRQA 4KWEA 4PV7A 1P3QQ 1GV0A 2HXSA 2CL7X 4K87A 4KRGA 1ZXLA 2FPGA 3PGA1 1YI8A 1TJ4A 4JKIA 1SEPA 4DV0B 5JWOA 1Q2UA 3R7FA 4DPLA 3WYEA 2PFKA 4KPUA 5DYIA 1LVUA 1U0EA 3WIBA 3QOXA 4EGCB 2Q07A 1XQ1A 4P3NA 1UZUA 4JJZA 2IUUA 4MUGA 4KR0A 3P5BA 1H1LA 1HYBA 4CHTA 1GYPA 4RK6A 4R8KA 1VM6A 4OIMA 3DEKA 3FIJA 4H08A 2K2WA 1EA5A 2E1PA 2NVWA 1HKUA 2FR1A 1QB7A 4MRNA 1RI2A 5TR9A 3U09A 4WKNA 5L3SB 2QS9A 4LVCA 4E6PA 3LHDA 1TYCA 4AROA 2BSQA 4JI1M 2B3TA 2A7XA 2CB0A 3FVVA 3INYA 4M8LA 4C6RA 2P3OA 4AN0A 1E7YA 1PR5A 2CE7A 3K1YA 4LBZA 4C0LA 2YVLA 5B4UA 4EA9A 4OMDA 2RGWA 1VCNA 4NSRA 4RESA 3F3YA 4KKVA 2ZBVA 3CNQS 3D5QA 2Q4DA 4PZ9A 2IEIA 1YU9A 2GQFA 3VZRA 1EQ2A 3U6QA 1UPTA 4XOUA 5FDFA 3I5AA 3TYXA 2A57A 4IQFA 1BXZA 4EHJA 1VEKA 2I2XB 4R2JA 2GZRA 3H8SA 5ALZA 3CLSD 2BFEA 5BR8B 2GPWA 3RS3A 1FFDA 3JRXA 1UFQA 1MHPA 2VPYA 2CLMB 4P22A 1P31A 1BEZA 1A76A 2GD0A 4DLBA 4KWTA 2KJQA 2EJUA 1ZUIA 2QROA 4R3UC 4QPPA 1VE5A 2H2DA 2P67A 4X5OA 4OQQA 4EW2A 4OXNA 4IX1A 3WLTA 1D2CA 4TZTA 1Z36A 2RH9B 4FGJA 1I51A 4HQFA 1LF5A 4L4XA 1FP6A 2CNWD 4WERA 1GR0A 4FZRA 1Z73A 3RFFA 3B6ZA 2O8BA 1BTOA 1PL6A 2V7QD 4IS3A 2H59A 3F6CA 2IXBA 5F21A 3TLEA 3STWA 2ERCA 1RHJA 2OMEA 4QTTB 4B0PA 1ADGA 9ABPA 4NFLA 5FHQA 2Z8XA 4GVPA 2OZLA 5TPWB 3QE0A 4INZA 3T6KA 1SCUA 3W6NA 2DQYA 4LVUA 4CLHA 2J3JA 1CU1A 4DMFA 4O2BB 2VDWB 2CBGA 1TDHA 3NOQA 3EA4A 4EATA 4FCCA 2QG6A 3MB5A 4G24A 2DKFA 3A9VA 3SF0A 2X3YA 2JFUA 4Z99A 3LWDA 2IK8A 5HQJA 3ANSA 5KC8A 1M6VA 5I9TA 2WD9A 3O74A 2GBGA 1QVZA 4PC3A 3Q7IA 3BH6A 3R7WA 2GXAA 2R66A 2EIHA 1MX5A 1YZUA 1HI9A 3K1ZA 2FA9A 3VVBA 3UA4A 2ZSJA 3IHWA 5IC5A 4BNMA 3FWKA 3KOXE 2LIVA 1Y63A 5GOTA 4HRYA 1LQ2A 4RX1A 3AIMA 2QP3A 2JD0A 4U7HA 3ETGA 4LZWA 3OY7A 4HB3A 4O6VA 2ECPA 5ISMA 3HHPA 3AYZB 1KYWA 5BV8A 3WBKA 4IICA 2FJUA 2QRVB 3AEUA 1ENPA 1CRPA 2ZPTX 1YZ3A 4W5NA 1TEXA 4WZBE 4XGNA 3W2IA 3O91A 3ANLA 4XVQA 3GDOA 1CUXA 4RL4A 1Z34A 4WFJA 2XIJA 5AP9A 3OKAA 4N5NA 4ENRA 1EFRD 4LZPA 4G0WA 1UMCA 3FAKA 5B4TA 3TN7A 3OEHD 1QLJA 3JAKA 4DCJA 4X66B 2C4NA 4M9ZA 3UHAA 1EFUA 2OCXA 4BZQA 3MWJA 1P74A 1Z38A 1J7JA 3FTNA 1ZOPA 2PFGA 3RFVA 5KQSA 1M1YB 2EC5A 3W3AA 4B7CA 4ZT4A 1FDTA 1ZNXA 1DT5A 3IAM1 3NRBA 1T2FA 3TQOA 3LQYA 4OYHA 4NOLA 1C41A 2UZ3A 1JFLA 3BWMA 1FYVA 1GITA 3LTNC 2P0EA 3BORA 4PFKA 4ZDIA 3G82C 5KPZA 1TTPB 2GHIA 1KZHA 3ZCBB 3J80S 3UYLA 2O7QA 4LDJA 3ZDXB 2BMEA 4BVHA 4DLWA 1BHQ1 1P0FA 4P0QB 4UREA 1VLMA 1GZUA 4NATA 4W9NC 1LTKA 1N3IA 4N5MA 2ADFA 4FGWA 4ZAYA 3PJEA 2ZI5A 1OXMA 4EJSA 4UTVA 1M8JA 2QSUA 3T7IA 1J0BA 3KOZA 2ZJ4A 1NNJA 1BCRA 1YS9A 3DDUA 4CM9D 3DZGA 3OZIA 2G76A 2XF3A 2HMTA 3QY0A 1HFEL 4KTVE 1KZ4A 2FY8A 4WECA 4ZI7A 5HS4A 1RWMA 4MQ5A 4N0QA 4YJHB 1E58A 1MO5A 4LAFA 5BMVF 3AP2A 2LTAA 4PDIA 2ZAYA 2VHTA 1IYZA 5J5CA 4UE6A 2DFPA 3SZRA 3O8DA 2QD3A 1PWXA 3T15A 1ZIOA 1M2JA 1FS5A 1PKEA 3U16A 4F4FA 4Q02A 3IV6A 5CFLA 4CFZA 1UBRS 3LUDA 1T5DX 2OAQ1 5DSTA 5K8VA 2W6ZA 4WCFC 2EGHA 4R81A 4QTUB 2Z57A 2PT9A 1FP2A 4DR2M 2HHHB 2QRMA 4ND2A 4OHYA 4HQKA 4LWOA 1LTMA 2A8YA 4RY8A 2ASEA 1FNCA 4TPKA 2DTDA 3AM4A 4GYWA 5FOSA 4OJYA 3AIIA 4CIXA 4LW8A 5THQA 1XX6A 3PEFA 2UVPB 1IIBA 1OH8A 1E2LA 3CISA 3IPCA 5JBNA 4UMVA 4MCIA 3A3KA 5IAOA 4HD8A 3NT5A 4JQZA 4HLDA 4LF5M 1SURA 5TGZA 3SBDA 3UFBA 2ISCA 4X60A 5ES3A 4HRAA 4Q3DA 1BAPA 1L4EA 2YOGA 5KO3A 2RJ3A 3FFTA 2C5EA 3TE7A 2CVOA 2YWDA 1RADA 4YJ2F 2ENUA 3ER8A 3UNXA 4I19A 5KINB 3K0AA 3K6KA 2IA5A 1CUFA 1T36A 1ZOOA 4J1SA 2HL6A 5JD4A 4JT9A 2W6QA 1GTJ1 1BEEA 1GGEA 4B76A 4UVDA 4M9XA 1TD9A 3ONVA 2PSJA 4K9PA 3BK7A 2VPZA 3IIJA 1ZK3A 2Y1DA 3MJTA 5IKMA 1ZVKA 2X4GA 5COQA 5EZ6B 4WESB 1CUBA 4O4JB 4PTYA 3TBHA 3FCXA 4DM7A 3DC2A 2CCKA 4MWZA 4V2UA 3Q10A 4LJYA 3SY8A 3PFIA 3RFXA 1C4KA 4H4EA 3K09A 4CEHA 3LP8A 4B4KA 2ZVQX 2CZCA 3CUWA 1WY5A 2C2KA 4FQ5A 1MORA 3OZVA 3ZWDA 2ZW9A 4LZOA 5DE3A 2P2GA 3LTEA 2PBRA 4D4GA 4QPDA 1VG1A 3FI0A 4FGSA 3TW0A 5IJZA 2DPLA 1DUVG 1SXJA 5E4JA 1Z15A 4B32A 1G5HA 4RIEA 1SNYA 2C9CA 2Z3VA 3OBIA 2RHTA 1PJ3A 5FEUA 2XE4A 3NS7A 5ICCA 4AU1A 3TWOA 1W88A 3RG2A 3TLGB 1V7QA 1XQWA 4EY8A 3P26A 3CFYA 3F3MA 5AJVB 4O59O 3KXPA 2PMFA 5A71A 1GN9A 1JSLA 3C3DA 1I2AA 4G65A 3K9CA 1RC8A 4QSHA 3O6VA 4M1SA 5ALYA 3LLUA 4MITA 4CMIB 1U1CA 2D74A 1E89A 5IBQA 1R4MB 2FFHA 4CJ6A 5ALNA 4BLSA 2AFIE 4KHPB 3OM0A 2L82A 3V2IA 5HZKA 1K0UA 4MUIA 2PA0A 2HO4A 1QO7A 5HZGA 1D4AA 5L3QB 4NJMB 5GGYA 1QGED 5K0CA 4M7PA 5F51A 3UICA 1JTFA 4MDHA 2WSSA 5K8JB 3AL0C 2CBXA 4UNQA 1RI4A 2H06A 2BF4A 1LVHA 1SR8A 3G6WA 4JI5B 3PUXA 3EVNA 5KOYA 1W4ZA 4QGAA 2VCYA 1I2ZA 4O8ZA 4UHBA 2ON6A 4HVLA 2QZ9A 4L50A 4MW4A 1R2QA 1J2UA 1ULZA 3JAWA 3LC2O 4BPBA 4J75A 4CMAA 3H6GA 3CU5A 1VMEA 3BXOA 3HKCA 5HIMA 2LVQD 2BWJA 2GJ4A 4B80A 3VYWA 3W1EA 4N0PA 2VI5A 4QAQA 5JRDS 2JKYA 4R69A 2AG5A 2JCXA 6NULA 4DMHA 2VJMA 4ER6A 4AL4A 5IJ0B 1X9GA 2HNBA 1EE9A 3HNOA 1TZCA 4D8XA 2XB9A 4ER7A 5CU7A 3V3KA 4UUAA 4E5UA 4FMCF 4UM9D 4CKEB 2E6KA 3X1KA 1QIKA 5FQOA 3DULA 1CKEA 4DZRA 4B4WA 3MN1A 1JG7A 3LQ4A 1J2RA 1W4CA 2C3YA 2H2AA 1C14A 3KS8A 4AECA 3ETEA 1QH0A 4Y2QA 5E6UA 4M9QA 4UTNA 3FHJA 5IXJA 1ZLYA 1CR6A 5IDXA 3QMPA 3WBFA 4EG3A 4X6YA 3GV0A 2CNDA 4WOBA 2O25A 2OPFA 4J3NA 2XMBA 3WOHA 4LDQA 2HQRA 1Q77A 4MQLA 4HB4A 4RM2A 1L1QA 4YC7A 1NAIA 1SB8A 4QYIB 2K5UA 3BXEA 5I7RA 3C85A 1Z0IA 2XYQA 3CTPA 1XF9A 4JLUA 2G08A 3RC1A 3PIRA 2KHZA 1P1KA 4ER3A 3OPMA 2VZLA 4V0ME 1I2CA 5ESDA 4REQA 2II6A 4OJNA 4QX6A 1PJSA 4D0RA 1KARA 1SQ5A 5H16A 3PRKE 1NYRA 3JQ9A 4C30A 4EUSA 3AR9A 4G36A 4WN3A 1NN0A 3AWDA 1Z4IA 3B2EA 3GU3A 1YV9A 1CIJA 1H6CA 2H51A 1YRLA 2XDQA 4DJJA 5BNZA 2C5FA 3H04A 4EHAA 1ZEMA 4HTFB 1I5RA 2H85A 4EDFA 4JT8A 1Q2XA 3OOYA 1VB3A 2I5PO 3E1KA 1ZM4A 3GLHE 2XUFA 4B6SA 4FE3A 1WUHS 3RREA 4B3TM 2Q29A 4TTIA 5GQSA 3FKSD 4KGDA 2GN0A 3VAYA 5AKKA 1PP4A 4M0EA 4II7A 4AI6A 4AVYA 2RAVA 3VKUA 3PICA 3ZWPA 3M70A 4PRZA 1SA0A 3T9CA 1GDDA 3DR3A 3S2ZA 3I23A 2NO0A 4IDOA 5JCJA 1NNI1 4E5MA 4IBDA 1BXRA 3VDUA 3MOGA 2P6OA 3K2BA 1FUEA 4HPJB 4UCXA 2BI7A 2C5SA 5D5QA 1U99A 3SFZA 1UEXC 5AJHA 5AHXA 4JJIA 1HEIA 1QRTA 4YT5A 4FINA 2F5OA 3P9IA 4BGVA 4TMYA 5FPPA 1DAMA 2Z8YM 2J5QA 5TQ2A 2Z3ZA 1PRYA 2BHLA 3QUCA 1HR0M 4A0GA 1DO8A 4GHLA 1FP1D 5EJ9A 3ZXXA 1CZUA 1GEGA 3L0IB 3D2BA 1XHBA 2IITA 1ZM9A 4B3XA 3CVJA 1J07A 3BRCA 1NI5A 1RPZA 2GK7A 3MS2A 4KFUA 5GWXA 2NSYA 5DM4A 4FB5A 2UYGA 1IFYA 3HJSA 3OA2A 3TAXA 1S3IA 4LWQA 5H1YA 1WP9A 3A9CA 3H4VA 1Z5PA 4WA8A 3GLFB 5LD2B 4U02A 1TJ3A 1GTSA 1XU4A 1MW8X 1Y4UA 3TTWA 5JCOA 4EUFA 4TTPA 2YJNA 3JQPA 2P6RA 2GZ2A 4QQRA 4MVJG 1NVKA 1EMDA 3AUKA 3UFXB 1IBLB 3W3AH 1IEXA 3D4PA 3R5SA 5C8DA 4BLUA 3CVVA 4DHEA 4I1SA 2G17A 4X61A 4RXUA 3AHHA 4WZAB 2BFDB 2WSLA 2V59A 4BO6A 1HFWA 4O3MA 2Y21A 3HQ4O 3IBCA 2RJOA 4URVR 3JVEA 5B58C 5G1PA 1T1GA 3KTAA 3MELA 4X41A 4YAGA 1UKCA 3RGWS 2EV9A 3D4OA 1U7XA 5B7GA 1NHWA 2ZRAA 1HNWM 3AONB 1TA4A 1TUEA 3NH6A 5BN3B 4CZ2A 2Q6LA 4JIMA 1G71A 5DIZA 1Z75A 1N77A 3OPYA 4AZWA 2AZXA 1U5BB 2VQ6A 4K9RA 2H54A 2BH9A 1XZNA 1U3FA 1U2ZA 2H92A 2RCYA 2C20A 4X1OA 5ALLA 2OD9A 4FOSA 1FTGA 1B0PA 4I9FA 1O03A 4UMDA 4LRTB 4ZZ3A 2YW9A 4Y9UA 5CGZA 4XPIA 4DYVA 5DP2A 1SZCA 1NF8A 1JG2A 2W2LA 2CP8A 2BHTA 3OHMA 1Z16A 1OLUA 3K0KA 2VP6A 2QAIA 4H77A 2Y1OA 4JJKA 1CEXA 4FEAA 2AR0A 5E7IA 4FSXA 1ZMXA 2HDHA 4TL9A 4F72A 3FNRA 3N0TA 3AZOA 2VYVD 1N2XA 3C7TA 3C4VA 3WXMA 4JYCA 1KS9A 4KJXA 2L7HA 1CHNA 3MILA 5CT4A 3IKVA 1W35A 1R15A 5AKHA 3I01A 3ND8A 4TTSA 4ECAA 3PXGA 1QCCA 2WZQA 1IBKB 3RV4A 2LW7A 2LZ0A 3CWZA 4TQ9A 2R00C 2OCPA 3GAFA 2Q5OA 3FPEA 4S3MA 1JEDA 2H7VA 1RM5A 3WGUA 1E6WA 2ZUVA 3V76A 1OIWA 1MC5A 3O83A 4JKYA 1P81A 2NO4A 5ECWA 5ICSA 5H3CA 2ZDQA 4CLEA 4QELA 1P62B 2GJ9A 3ZDDA 2I8LA 2PZAA 5ITYA 4TLBA 2FV8A 3U31A 3VPBA 3BFXA 2P4EA 5BUSA 4R1LA 4H15A 4AJHA 4G8BA 4BMDA 4IUBS 2QUAA 4C29A 3O7WA 4U7JA 13PKA 1L8OA 1KQNA 3X1YA 4PAGA 3UMYA 4YCLA 3INTA 3CG4A 2ZJ0A 4ZCQA 4OHMA 3I30X 5CJJA 1MGOA 3PXUA 4L75A 2EFCB 3WFZA 4ZCLA 4TXMA 3FZQA 2KZUA 5LXTB 4ZCRA 1Z45A 4OXIA 1I94B 1WMEA 2OO9A 5ITXE 1Z5OA 5KEIA 3QSGA 2ZUDA 3RYFB 3NM6B 4TXJA 2UXCB 4J9VA 2V98A 2W82A 3LDHA 3NNSA 2BEVA 1H42A 2B83A 3K6RA 3B1FA 4OL9A 1NONA 4R6WA 4OH7A 1KPHA 3ZCRA 4MLPA 2OHGA 4AZ3B 4FNOA 3RS2A 1XHFA 1OAOA 4IMPA 4NAUA 2WJVA 1NVUQ 1TD1A 2VYQA 4KQFA 4AKEA 5BXYA 1VOTA 4GMDA 1R8XA 4EF6A 4PXAA 2JIBA 1VJCA 2H1RA 5A4KA 5D3KA 1R18A 4XARA 2ZJ5A 1CDDA 3MT7A 4KXQA 3GQVA 3ZGXA 4A6PA 4M7OA 2Q2WA 1NURA 3KOWA 3OZGA 3M2PA 2ZJFA 5E9AA 3BE5A 3ESRA 4X8HA 5LQJA 5B57C 1MRNA 3EQ7A 1KXJA 1ZN2A 1PX2A 2PH7A 1C9KA 3B1ZA 2C59A 4NRWA 2PL9A 3OWXA 5IYZA 3BB1A 5JECA 3ZXUB 2ZRDA 4HAIA 1LQUA 2VDJA 4BO9A 1ESNA 1HFJA 4UHCA 3H97A 1B6RA 3KKLA 1JEEA 2CV1A 1WHCA 5CM9C 3SE0A 4YUAA 5JZSA 1Y6GA 1E3DA 1EBFA 4QREA 2RH5A 2ZU6A 1OZ0A 2XWBF 3A9WA 2CDBA 1CW2B 1DXHA 4DLTA 2A5DA 3SEFA 1B4DA 3FUCA 4L95C 2FZKA 2QV0A 3W5AA 2HH9A 221PA 2Q3BA 2QRHA 1D0SA 2F43B 2HLHA 3HLKA 3F5FA 4LOAA 2RHWA 3RU2A 1QGUB 3QVVA 2W98A 4GDMA 2F4VB 1TTEA 1ZBDA 2GD6A 1RP7A 4HGQA 1ABBA 1L5RA 3JARA 3L0BA 3DG9A 5G4KB 2QN3A 1AB5A 4NZZA 3ZHRA 3WLQA 1FL9A 2WUEA 2YJGA 4QXMA 2Q7OE 1FPMA 3DOOA 5K3BA 1U2DC 2C5BA 2DLCX 1NJ8A 3I53A 3WL6A 1X1SA 5HJ5A 1XZEA 4XWOA 5E0OA 1U1GA 3LX5A 3ORQA 1YC2A 2PBFA 3QELA 3VNRA 3QE4A 4PLHA 4G2TA 2VAMA 2R1VB 1ULSA 3W1WA 1C5KA 4ND3A 4OHWA 4E14A 3P0JA 4W4TA 3BIWA 4FX2A 3JZAA 4YAWA 3AFMA 5EL0A 5K51A 1SUIA 4IBGA 2AQHA 4MUYA 3LDGA 3ZU3A 4D25A 1D2GA 4BMZA 3O95A 4D9MA 1AA9A 3HRIA 2P78A 2Q9AA 3CF2A 1O1YA 1GSIA 2IUEA 2BZGA 3ZHBA 1MJGA 3P9CA 1S3GA 1U7PA 3H42B 3T1YB 5JNWA 5KCMA 5TEWA 2QAGC 2BUBA 3VKFA 3RS9A 1RQNA 4RPLA 1L5WA 1QBKC 2CXOA 2FOLA 4BTLA 5KZMB 4OAQA 3T3HA 3ZKWA 4LF8B 1GCIA 3VNBA 5IAKA 2OE2A 3UJDA 4MWCA 3AERA 2NU7A 3V32A 1Z6XA 1SVNA 1OW3B 5EQFA 1W47A 2HQBA 3WGKA 1KVTA 1OXXK 4NDNE 1VEJA 1JMYA 2Z9DA 4C4YA 5DCYA 5AK0A 3HVUA 4NCHA 1WXEA 2EXXA 1OSNA 4U6QA 2RH8A 1Q7EA 1Y6JA 4K81B 1DIGA 1I5OA 3NASA 3O0DA 1TMYA 4PS0A 4RKQA 2C2MA 4QDOA 5LMNB 5JE8A 3ZZUA 3RS5A 3NBFA 4EHFA 4Q3NA 2ZB7A 5JAOA 1H6BA 2CMKA 4MKGA 3VR5D 2FFQA 1T4CA 2ZBQA 3IO3A 2IOFA 3FE3A 5JD6A 4WDQA 3W7BA 4ZEMA 3BGDA 5F76A 3U4CA 2ONZA 4PGFA 3N28A 5E9JA 3QXGA 1DO2A 4R1QA 2AYXA 2XHZA 3KM0A 1UBGA 5HDQA 2Y66A 4NYMR 4C7OA 5KSZA 4Q01A 3VPGA 2IH5A 3GLGB 3TDKA 3H2YA 1K6MA 4U9HS 2O20A 5IJWA 3NHUA 2AUTA 3LT2A 1A3CA 2VQEB 4QU5A 4R41A 4A10A 2IHZA 2XTMA 5FB3A 1CDEA 3E48A 4FQ8A 3AVWA 2Q46A 1CZNA 2IS2A 4YIHA 4Z0PA 2WF9A 2E3JA 1AX9A 5DGXA 3LVVA 4XLTA 1XMJA 4LDPA 4ZJZA 4PZUA 3T4EA 1RLJA 5HIKA 3P2YA 4MKFA 2H4JA 3VHQA 1K86A 5IC6A 1VQ1A 3YASA 4L2IB 3Q6IA 4MDFA 1BU5A 4O4IF 3A6ZA 4IVPA 2JANA 2Z1NA 2I66A 3GLUA 4LG1A 4FFSA 5KS2A 2NZ8A 3H4IA 3FI9A 2C04A 4BQEA 1EFDN 4WCVA 2Q7DA 1RCFA 4RTJA 3DLBA 3SYRA 4M3NA 1P9OA 4G1MB 4Z7NB 1H23A 1XDUA 2JJ1D 3GH1A 3EBPA 3FDZA 4AQDA 5F35A 3AVYA 1VZ3A 1B16A 3TOVA 2C5LA 3L1JA 1JIUA 3QVKA 1OKKD 4PPYA 3K3PA 3I73A 3V8MA 3SSAA 1XL1A 3PGVA 1TJNA 3FPSA 3OQJA 4CLDA 4J1NA 3ZYZA 4N6OA 2MTBA 4QODA 2AK2A 3MINA 3KQOA 1YS4A 3OJFA 3C8DA 3N5KA 5LU9A 4XWTA 3EGDB 3IPLA 4P7FA 2PMKA 3BDVA 5M04A 2VDUE 1GABA 1J2JA 1H1TA 3ILHA 1U1EA 2FTKE 2VLIA 4TS1A 2C4WA 3QBDA 4BVEA 1YE5A 4PTLA 5HMLA 2I29A 1T9GR 4OLJA 3D0RA 4BX2A 1WHSB 5E8JA 3H6KA 2ISQA 4OLBA 1ECLA 3D6MA 4GBED 1R6AA 4GOXA 5MFPA 4AJNA 1E59A 2NIPA 3MPOA 2HJGA 4IMIB 3PENA 1GPDG 3HZRA 3IHTA 4G0VA 4Q7MB 5F7OA 1CR0A 2F8LA 2CMFA 3IX7A 5K45A 1Y5LA 3HYNA 2Z5VA 3CVOA 5DHTA 1E3QA 2GA9A 2Q5HA 3PVSA 2BV3A 3STTA 2FPIB 2W2MA 1XTJA 6REQA 1AQIA 3O4RA 3MCWA 3QUTA 1QZTA 3F73A 5A02A 3C6BA 3UW1A 4KX5A 3AHIA 3LE8A 2YYSA 1AGRA 5DGCA 1KOLA 1SUCA 3EDYA 2HAEA 2P35A 1AXGA 4B45A 2XR1A 4BN5A 4FDVA 5JSYA 3CKMA 5KMGB 5KQGA 4I36A 1Y8QB 2G1UA 2NG1A 3L7AA 2ZANA 4KE9A 3GT3A 3IIKA 5COBA 5IJ9B 4MGYR 3T3DA 5B37A 5LB4A 3ZWXA 3WLFA 5C1IA 2J32A 4Q1AA 3DMHA 1YVPA 2BJVA 3EXIA 2M6LA 1V35A 1FF9A 3BIFA 4D97A 3TLJA 1LV7A 4F9TA 1QCZA 3CX8A 2GPYA 4YJ2A 1QQTA 2G5PA 2WRZA 1RJFA 3EFBA 3AP1A 5EKTA 4JSTA 4CTMA 3I5YA 9MHTA 2GGSA 3LDAA 1HNXM 5TF0A 1Q16A 1CJMA 2O01F 3BWEA 1NJ1A 2GLTA 1UDRA 4CG2A 4Q82A 4TSKA 1Z8DA 2ZT7A 2ZJZA 2REOA 4F71A 3BKXA 1E6MA 1NVVQ 3GQBB 4OOFA 1NBMA 1ZJZA 2ZBDA 4RIIA 4TTVA 2JLZA 2VJPA 3KDSE 1NC3A 1PNOA 5IH7A 1BE1A 3EJ6A 1XXHE 3NMUF 3W9BA 3GH3A 3FNIA 1KVQA 1LPBB 2HLDA 3TH5A 3JD3A 2X58A 1AM4D 1WDTA 2KW0A 3O1HB 1QCYA 5T8KC 3D8TA 1C30B 1NSTA 2IF2A 5K2OA 4S1PA 1Z3CA 4ZAVA 4M9SA 4QPCA 3EZLA 2ZREA 1SVMA 3EQ2A 4G5HA 2ATEA 4I6GA 2ZSHA 2QW1A 2PWPA 2Z2KA 1FCJA 1T29A 3WRYA 2VC2B 1JDBC 2NYUA 1Y7HA 4DQKA 3AKEA 2QTTA 2G0TA 1CNFA 5HF5A 2OWDA 3BA1A 1ZOLA 3ILXA 4AJ1A 1EFRA 1QU2A 3W2GA 1U3WA 1LSJA 4LRWA 3OFVA 1AQYA 2ZAMA 4JEIA 1LSSA 3SBOA 1OF1A 3DT6A 3AK4A 4HS4A 2GHQA 2P3QA 1NWCA 5JU6A 3OCCA 3KQKA 3QEMB 1QBGA 4BLRA 1YCFA 1J5PA 3GARA 3RI3A 1NUAA 4WFQA 3OZTA 2B35A 1D0MA 2WV7A 3LCVB 2I1QA 5A03A 2XCUA 2UVQA 3MT8A 2Y1KA 2FLWA 5K4HA 2NUPB 3SIRA 4MUAA 2VVTA 3CZ9A 5I4CA 3ODGA 3ENKA 3I9JA 3TJRA 4NICA 1IB6A 5DWVA 1V0JA 5GJVC 3BCRA 2Z5LA 2ZIAA 2RHLA 4Y6RA 1EDEA 1RJ9A 2DENA 3A3OA 3U5TA 2X0JA 1GG8A 3VA7A 3FSJX 2G5TA 1B2RA 4RTQA 1G21E 4HDRA 1RCTE 1ZK2A 1Q1BA 2Q2NA 3BBLA 3R6GA 4IX9A 1OLSA 3VSDA 3RJ9A 3JQFC 1VKRA 3K0EA 5DLDA 1ORTA 3VPCA 1PVDA 1XP5A 3IEMA 1KKMA 5E9QA 2D0IA 5EOVA 1EUZA 3AWIA 1AN0A 3J80A 4WK6A 1YA8A 3ZE0B 5HILA 4BVAA 3SYNA 2GBIA 4MVWA 2Z9BA 3I2KA 5IG2A 4DRXA 2QDXA 1R9NA 4R0VA 1I3NA 4OMFG 2G40A 4BKMA 2W2KA 1WTCA 1DAPA 1P75A 3TQRA 1HJPA 5CJ2A 1Y9EA 1Y7LA 4PIMA 1EFVB 2DI0A 3LQRA 3JSXA 2PZFA 3AJAA 4OFWA 1JDPA 4AP6A 4BFUA 3W8EA 2Z43A 4JEMA 2P6NA 3PCXA 2PL5A 4IFIA 4PPNA 3HBLA 3HV2A 4ESOA 3QEKA 3VJMA 4G4QA 1PN3A 2V9CA 1X86B 2DERA 3QV1A 4BYGA 3AUFA 1MABA 1M7BA 4ANRA 2AYZA 1R27A 1CETA 4GWKA 1CYDA 2W4IA 4FWTA 3EVZA 2XTNA 5KPRA 1DPFA 1Q3TA 2V55B 3T3OA 1YZKA 3WAGA 1Z7BA 3CRQA 1JQKA 1FFBA 4ISBA 1W96A 4KTTE 2OK7A 4PYMA 4ZVPA 1E6KA 5LMUM 2D5BA 1H4SA 2KYRA 5DNUA 5FP0A 2GB4A 4US0R 3VBEA 4BFLA 4N3AA 2DAGA 4LCEA 1UBHS 4J2OA 3NV9A 4G0OA 4GGOA 2YQ5A 3DONA 2HN9A 2RDMA 4PCVA 4URHA 4GVLA 2DHCA 1K4MA 5FUQA 3Q7TA 4N9WA 4FZVA 3C14C 5CVUA 2GBFA 3C8ZA 3R5XA 2HA7A 4GR4A 5CPFA 1Y4AE 1E0SA 3RNOA 3NGLA 3K9GA 5E3JA 1DKMA 2GLUA 4K0KB 5ESRA 4CWAA 1OFHA 1JHUA 4RWEA 1K6EA 5IRCD 4D4KA 3MUEA 3O4GA 4JUBA 1Q0TA 1FP4A 2C82A 5FPHA 2Y93A 3GUCA 3UT0A 3UJPA 3RKRA 1Q21A 5DYYA 4QU0A 5ALGA 1K7YA 4MGHA 3IP6A 1WCYA 2IZOA 3ZGLA 2PSHA 4QA9A 2NYAA 1RM4A 1RLOA 1XE3A 2GZ3A 2PSSA 3DLHA 2I7CA 4Q3OA 1PGYA 2H4FA 4WPGA 1N5LA 3BZWA 4MDYA 1S5PA 3TLXA 3BMCB 1YH3A 3MRTA 2CWBA 4JWTA 3HZZA 1NJ6A 5KHAA 1MR3F 4DMMA 3LFHA 1LDYA 4OHZA 4HNVA 1RXSA 3F7TA 3ZGNA 4PN7A 1IOLA 4G1EB 3S1AA 4B87A 1P7VA 3P0IA 4XDZA 1XZFA 3S2SA 1LU9A 4IFTA 1JNYA 4GKKB 4JX9A 3TPCA 3BXFA 2GJSA 4C6HA 4NYIQ 2OOKA 2VJBA 2PLNA 5JAIA 1AHIA 5LNK6 1S8OA 1TPZA 1U0OC 1X70A 3RRNA 2JKZA 2DGDA 2EARA 1UJ2A 2IYNA 1LW7A 1OGYA 2VHEA 1PHRA 3U5ZA 5BWNA 2JFOA 2V8OA 4DY6A 3G5MA 4Y2HA 3HBAA 2MSEB 4B5KA 1DJPA 4LYEA 1SBQA 1CTQA 2KWIA 3UO8B 4EG4A 1QR6A 1PNQA 3G8AA 4DCMA 2P1DA 1DCFA 2CGEA 3PIIA 2MINB 1XD9A 3M5WA 4ENQA 4REOA 2IC5A 1XU9A 1JDTA 3M2TA 3H17A 2WMOB 2EFYA 2XUQA 4HUQA 4F97A 4LHVA 4X6UA 3OIDA 3CRZA 2C0QA 1JYFA 4JU8A 3RNLA 5LQKA 4KQJA 1LPAB 5CVJA 1PJ4A 4TYYA 3AXSA 3MGCA 2IIQA 3BX1A 1P1FA 5FA5A 1GRNA 2XJ4A 2BEKA 4EJ2A 2I4LA 5J4HA 4JB0A 4DZTA 1OV4A 4DQ0A 1N6PA 4BV2A 2V97A 3V2GA 2P4HX 3GZ4A 2ZJAA 1TPYA 4LTNA 2C2XA 2JB9A 5CVEA 1YHZA 1YS6A 3GHHA 1SZJG 5AI9A 2BHNA 2BSXA 2ISSD 2PUCA 3T5PA 4A5OA 3NXKA 4QXQA 4LJLA 1KY4A 1N5JA 4IV8A 4K6GA 1YRQA 3TSAA 3HYSA 2MSLA 1RLUA 4DW8A 1XCOA 4UDXX 2UUBM 2VTKA 1BW9B 3IQFA 4P17A 5ALMA 2OSVA 2X8JB 4PIVA 1M67A 4TLLB 3NH9A 2CMDA 4J29A 1WSBA 1JFRA 3ZGVA 1MQSA 3LKVA 1TGYA 1MEOA 2QTZA 3G49A 3D3JA 1C29B 3JYQA 3RU7A 3AMVA 5ALPA 1CJBA 3KG2A 1VI6A 3RVSA 4EF5A 3SM3A 3LT0A 1KBQA 3UEOA 4CFSA 5CCEA 5LM3A 3THXB 2O8VA 8AT1A 2BP7B 3VPDA 4A8HA 3HNPA 5DH9A 2JI4A 2MJLA 1G6HA 2FRDC 4K2AA 3MYRA 4I1YA 5A06A 3UT5B 5KYTA 2LUOA 3IECA 2FEOA 3FHOA 2R84A 5JYEA 2DWLA 2IXGA 5FFMA 2XBMA 3K9NA 1GFZA 2ONJA 5BPHA 4OUDB 2A0WA 4ZZIA 2Q7XA 4X7PA 2R44A 3GNTA 2F3PA 2Q0SA 4N54A 3V4VB 3ZDFA 4KXUA 2HWXA 4ZI3A 4KUGA 2VLBA 1TJ5A 4LXYA 1ST3A 1XMSA 5JBQA 3HXLA 4YJ3B 4EB8A 3VTFA 5JH7B 1PR6A 3PQDA 4FHDA 1N3BA 3G8BA 3O8QA 4OJMX 1PUIA 4R9UC 4UHHA 1PVVA 3ZV7A 2H5LA 4EGQA 3FKSA 1G7RA 3JYNA 3IHLA 2R4EA 4YRZA 4C4SA 3FJYA 2JL1A 4W99A 4CQMD 5A9TA 1CUCA 3W2EA 2PJUA 2VHWA 3HP4A 1XDWA 1U8YA