4LJAA

Clpb nbd2 r621q from t. thermophilus in complex with amppcp and guanidinium chloride
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
321
Chain Sequence
b'HMEVTEEDIAEIVSRWTGIPVSKLLEGELRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIQIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 109
structure length 321
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ljaA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ljaA01
4PHGA 1PV4A 1AA9A 4GBMA 4KVAA 2WBLC 5FR1A 1OYWA 1L8QA 5F9FA 5JI3E 3GJ7A 4AI6A 1OXSC 2RHMA 3W6NA 4PAQA 3RVBA 1HT2E 2GCOB 2VHCA 1O3YA 4ZV4A 1OH5A 4OQMA 4HAYA 2OE2A 3OESA 3TK1A 2ZS7A 4EPYA 1DAIA 2XTNA 2XXAA 1AS0A 1SKYE 4RFSB 4DEXA 3BBPA 2XJ4A 4PANA 3AVTA 2WMOB 3IIKA 2FEMA 2JAQA 2HCBA 1NVMA 3NXSA 4Q4JB 3RRMA 2JDID 1E2PA 4HLCA 3C8UA 1NN0A 3GLIA 5JWOA 1DEKA 2CHGA 5B2ZA 1H8HA 4POAA 2F7SA 2XB2A 4DIDA 5KOYA 1NJGA 4PO9A 1CTQA 1J8YF 3SZRA 3UATA 3W34A 5ELXA 1OPXA 3OHMA 4TLAA 2C78A 2OT3B 4CT5A 2HYIC 3X2SA 2WPDA 1P2VA 1NVUQ 1E1RD 2KRKA 2ZYWX 3CUEF 1N2CE 3GFOA 1SVMA 2F1HA 2B7BA 4IXMA 2ZRJA 2ZR0A 3L43A 2W00A 4G5SA 4Q7JB 5EUMA 5H70A 2HEIA 3TSOA 1CXZA 1DBSA 1R10A 2QORA 4DT1A 4I4LA 2R65A 3EC1A 3U44B 3X1DA 3KJGA 2NZJA 3L8ZA 4NPHA 2GEVA 4II7A 1KGDA 4IOJA 4XSHA 4BFXA 5JHGB 5JZVA 1GITA 3SI7A 1GFIA 2JJ8A 3CNOA 2AK2A 4HLUA 3CLVA 2IUSA 4PHFA 1N6RA 2W2XA 3WYFA 3CPEA 4A2QA 3K9HA 1HY3A 1W0JD 4HB0A 4JL8A 5HCNA 4P31A 4FCWA 1GWNA 2ASEA 5BWMA 4KLZA 3OE7D 1CRQA 2OZEA 2P5SA 4MDEA 4MITA 5FR2A 1G291 2LCFA 2Q6TA 3VX4A 3BORA 4EFNA 4DJTA 4EFMA 3CR8A 4EDHA 2WJVA 3KQNA 1OFIA 4QNMA 1J7KA 5GJCA 4WW0A 1Z0FA 1U8YA 1G19A 1YZLA 2QROA 1RIFA 4TYYA 4HLUC 3BJIC 3EPHA 2XZPA 4A8JB 4OJQA 3G5UA 3BOSA 3V4FA 1Z6TA 2CE2X 3NDPA 4V0OA 3ECCA 3GJ8A 3SJAA 4KO8A 4D4JA 2Z4RA 3TSZA 3QSYA 3AP1A 4Q4LA 4C30A 1N0WA 3IUYA 3QXSA 4D0LB 1W36B 4QFMA 4ON9A 5K8UA 4QJ3A 1F6BA 1XMSA 4AC9A 3Q5DA 4UXJA 3AVQA 5KSOA 2F6RA 3RRNA 1EESA 4B3XA 5CDFE 3CZQA 2XAUA 2FNAA 2PH1A 2DWPA 4A2PA 4BEBA 4JLDA 3QPVA 4LX0A 1UBGA 4WZBE 4M9XA 3PXGA 2BKEA 3FDIA 1I4DD 3LW8A 5JSZA 1BH2A 1P75A 1E0AA 3FTQA 1KHTA 4KXFB 3U3MA 1KY2A 1T3LA 4EIWA 1AS2A 4B3CA 4V0KA 3GQBA 5IK2D 3A8TA 4P33A 3E5HA 5CYPA 2Z83A 3OFND 1VYTA 2J41A 3DM9B 3RDPA 3AF3A 4HI0E 3OAAD 1RE0A 2ZR7A 3U3KA 1CJMA 1EG7A 4BE7B 2ZRNA 5AUQA 1HYQA 2WKPA 1YJ5A 3L2OB 2V55B 2ZS9A 4C0QC 3HYTA 2ODBA 3V4RA 2OLKA 3P32A 3RRZA 3QKTA 1A7JA 1TEXA 1Z0KA 4FXPA 1BOFA 4IDOA 2HYDA 3U4QA 1CR0A 4Y0AA 1NP6A 4PHTA 5JWHA 1XDBA 1XMJA 2GJSA 3IILA 3ICQB 1ZYUA 4QL3A 5DHFA 4C0JA 4LJAA 2XOKD 4PR0A 3TAUA 1CJVC 5FPSA 1NVXQ 2IYVA 4DLVA 2QMUA 1ELOA 1QF9A 2ZJYA 3H1TA 4LJ5A 2O8FB 4W5WA 1OXUA 4Q7LA 5BXQC 1OIXA 2JIZA 3C5CA 4XWAA 4B47A 1P73A 3MHVC 2H16A 5EE0A 4HDQB 1S0UA 1E69A 2OESA 1MO3A 4TLBA 2V6JA 2BJWA 3CRW1 4LBWA 1VHTA 1KK2A 2JJ1A 3ZD6A 2ZUBA 5DI3A 3REGA 3G0HA 2GCNA 1Z83A 3SHFA 1XTRA 1YHNA 2QM8A 4OI4A 1A2KC 4YONB 1E2MA 2VP5A 2BCJQ 1XPUA 4Z1MA 3ZZUA 1EX7A 1H8HD 4IW3B 2Q21A 5CB8A 3NG1A 2CE7A 3RSOA 4LSGA 4QKQA 2BKUA 4CRWB 3CRQA 2IT1A 1DADA 3RSLA 3VKWA 2FFHA 2OILA 1R6BX 2PEYA 4RCYA 3SFVA 2YNMA 1G8GA 1VPLA 3HDTA 2KB0A 4YQFA 1ZC3A 2G88A 2OLJA 5IDVA 3EG5A 4HAWA 4PHHA 3TBKA 1OXVA 3MWLA 4M2LA 1W4BA 2V8OA 3CF0A 5EXPA 4ASUA 1OHHA 1UF9A 3QXHA 4Q9JA 5EP4A 3KDSE 1P60A 3VAAA 4D0GA 4F38A 1SVIA 5BYKA 1KNQA 1NY6A 4CZ2A 1PLKA 1W44A 4JLNA 3TSWA 4BLOA 4BLQA 4DIEA 4JJZA 2C9OA 3MJHA 4M1KA 2V3CC 4RD0A 1OH8A 2DBYA 3B8HA 4IOKA 1G3UA 1CRPA 1XPOA 1NBME 4B2LA 1ZM7A 2DWZB 1NIJA 1SHZA 1Z2CA 3QKRB 5FL3A 721PA 3QEJA 5JRJA 1W46A 2J0UA 4TL9A 5FPHA 1GILA 1OJLA 4XSGA 3IDQA 2WICA 2AWNA 1E9FA 5DYIA 2C03A 3IGFA 5FPTA 3KTAB 5P21A 3CONA 4NYIQ 4ARZA 2Z0MA 4D6PA 2QBYA 3LLMA 4KHZA 1TU4A 2GAOA 4RD4A 1DTSA 3S1AB 3TJZA 3WBJA 1W48A 2QQEA 3FHOA 4HLDA 4G5RA 1NKTA 3B5JA 1HV8A 5FOWA 4MQBA 1WA5A 2PMKA 2BBWA 4IVPA 3GJ5A 3RC8A 1PLLA 3P20A 1G21E 1NLFA 4H1UA 1FFHA 2C9CA 4Z8XA 1NN5A 4IFBA 4US2R 2YZ2A 5B30A 1VMAA 5HKKD 2C99A 5D3MA 1C9KA 5LPNA 2D2EA 1ZAKA 1P72A 3QBVA 2NPFA 2WWFA 2X2FA 1DG1G 4M0LA 2HV8A 5HR5A 1VIYA 4HYYA 1SVOA 2H57A 3WNDA 5DLQC 1UM8A 5H1YA 1SVWA 4AKEA 1HE1C 2QTHA 2L0XA 3ZS8A 5JS7A 3SNHA 2XZLA 2NTYC 4DLWA 1VIAA 3BS4A 4OJKA 2IF0A 2NO6A 1IN8A 1HT1E 1U9IA 3JZMA 4HUQB 2O8BA 3T12A 1GAJA 1G7SA 3G82C 1E0KA 3GEHA 3AVUA 2GF0A 4RFSA 3T1OA 2ERYA 2SHKA 3TQFA 2R6GA 1NY5A 1QZMA 4MRNA 2WSSD 1JECA 3QI2A 2DZNB 4Q1AA 2FSGA 2QMOA 3H84A 3KX2A 3RS2A 4CEHA 4B3GA 2C9YA 4LJ6A 3PEUA 4O25A 3K09A 3V00A 2JLZA 1VG1A 2A5JA 2PT7A 4OQXA 3U7GA 4AYWA 4LDJA 1ZC4A 2IWHA 1E9BA 2ZRDA 1Q21A 1X3SA 4NCNA 1TQDA 1NJFA 2IC5A 4JVSB 2ECKA 4V0NA 2I4IA 1G6OA 3EXAA 1U9IC 5AUOB 1VKJA 4XJXA 4TTPA 2D7DA 1P7CA 4R2IA 4PPNA 3ZIAA 2LKCA 2PLFA 1KI4A 2KSQA 4P4SB 1XTJA 1TUIA 1M2OB 3TH5A 3PG5A 4W7SA 2ZUDA 4A2WA 1QHSA 4Q01A 5CDFA 3KKNA 1FPMA 4I99A 2CBZA 2DPXA 2ZI3A 1F60A 2DFLA 2DYKA 4IDNA 3OEHD 3X1YA 4BGDA 3LO5A 4P4TA 4B34A 1SZPA 3FB4A 2YOGA 4TLEA 5FUYA 4ACAA 1TQ4A 2JATA 1E9CA 2XITA 4YLGA 5HZKA 1UPTA 2ANBA 3I5XA 4C0BA 3QG1A 1U8AA 1Q1EA 1EFHA 4P0TA 1SXJE 4DWJA 3VLFB 4Z1MD 4LRTA 1FUUA 2QEQA 5KNCA 5L3SA 1X8JA 2F1RA 2VP4A 5KPDA 2BHRA 3MWKA 3LX5A 5JLJA 1PJRA 3W3AA 3LXXA 1IN4A 1GRNA 5HE9A 1NIPA 2KI5A 2ZI9A 1ZP6A 3NC0C 2NMVA 2G0TA 1UBEA 1T0HB 1T91A 1P2UA 2ZVQX 4PC6A 1S8FA 1UKZA 4XVRA 1ANKA 1RZ3A 4TYWA 3WY9A 1F3OA 3GJ3A 3I92A 1TQ6A 4UJ3A 1MRSA 4PQRA 2XB4A 3EX7C 3A37A 4W9MC 4LRWA 2PJZA 2PJRA 3LH5A 2J3EA 4Q9LA 3PFIA 1WXQA 2GKSA 3IBYA 2J59A 3LBIA 3B2EA 5TY0A 4D4MA 4BWYA 5A5GA 3THWA 1XPRA 4PAMA 1W0KA 3AP3A 4JL5A 1GUAA 3GCGA 1S9HA 2BMJA 4C7OA 3BB3A 4LYAA 4Q66C 1ZM9A 1CR1A 2WKRA 4FCVA 3EIQA 4G3XA 1X6VA 2RHDA 1KAGA 1M6NA 1UKEA 2VL7A 4OQNA 2RAPA 2ATVA 1KI8A 2EVWX 1WRBA 4OI2A 3FHCB 1KNXA 3LQQA 2DFNA 4R71A 3WHLA 3C15C 3CNLA 3NTUA 4KBGA 3U3RA 4NKRA 4PQYA 1E9EA 1VDZA 5JEEA 3TKLA 4CEJA 2AWOA 1AS3A 1ODFA 3W8RA 3IO3A 1E9AA 1NMXA 2G1KA 2JLSA 3BFVA 2OCBA 2IS1A 2O8DB 5BYJA 3W90A 4C0AC 1VYUA 1NSTA 5E7IA 3PUYA 4M1WA 3MAAC 1K5GA 2GRJA 3KKQA 2V1UA 5CLLA 1W49A 1U0HC 2OO7A 1YZQA 4ILEA 3WMFA 4MUBA 2Q9BA 4BFTA 4DUGA 1G8PA 1GRRA 1XFAA 1Z06A 1CF4A 1FQJA 2YWGA 3LQRA 3GJ6A 1U99A 4RD1A 5JSZB 1N6PA 1S2MA 1QHIA 3Q7PA 1XMVA 4DSTA 4GMDA 1UDWA 3C4JA 2IYZA 4JYBA 2BBOA 2BBSA 2QT1A 4NYMR 2BM1A 2Z43A 1KSHA 4WZ6A 4NCIA 4BFZA 4PX9A 2A2ZA 1XB2A 3GPLA 4CDGA 4DEYA 2PEZA 3ZYCA 4ZDJA 1Q1QA 1UKVY 2C77A 3UWKA 2OCYC 3THOA 3ZZ0A 1K8RA 5TMPA 4M1SA 3RNLA 4C2UA 1NBMA 3FKSA 1COWA 4DBLC 1S3GA 4QHSA 4GFDA 1E32A 4A0FA 4YDSA 4WVFA 2IS4A 4ZCMA 4OQLA 3NBFA 4GI7A 3PR1A 1DO0A 4AD8A 1W4RA 2ZRKA 2DVWB 2Z4SA 3TIFA 4PTLA 2GXAA 4DDWA 3CNNA 4ZDKA 4RFVA 1G20E 3NBXX 1YZNA 3SBEA 3PUZA 3WNBA 3EIEA 1OKKD 4U5XA 1YRAA 1CEEA 2QL6A 5KPJA 4TYNA 1FUKA 5FH9A 1WCV1 1N6OA 3CBQA 2NO0A 1Q12A 2CNWA 1WF3A 3LA6A 4KI0A 4A9AA 2KJQA 2IXFA 4URUR 3VTKA 3C7KA 8OHMA 2P6NA 3T1TA 2ZSBA 1MH1A 4KCGA 2GVDC 1M8PA 2CK3A 2IEYA 3F3YA 4C0KA 4UNNA 1NN1A 4M53A 5G41A 5JECA 1GNPA 4B3FX 1M7GA 1SHKA 1Y3AA 4B6EA 5BN4A 4V03A 3UXMA 2QY9A 5AJWA 4UQOA 2XNDD 1ONBA 5AJZA 2J0QA 4B2PA 2VSFA 2FZ4A 2O5VA 2RGGA 4Q7KA 4DHEA 5FBVB 4US0R 4IOMA 1OB2A 4HB4A 2AKAB 1AZTA 4NCKA 3QKRA 2JGNA 4EPXA 4LPKA 1J90A 4MRPA 1QRAA 1I4TD 1XZQA 1ZM4A 4OHXA 4Q7MB 2D3WA 1Q3HA 2REBA 3UMSA 1G8FA 4A36A 3HJNA 1Z3IX 4Q5IA 1LV7A 1II9A 3U7HB 3KFVA 4BLPA 4GL2A 2DR3A 1KOFA 2C5LA 1QHNA 1U90A 1G5RA 3UMRA 1WBDA 4TQ9A 3FPAA 4ZCIA 3B6EA 2I1VB 1E4YA 4DC9A 3ZVNA 3ZVMA 1JAIA 1ZD8A 2OFOA 4LYFA 1G8HA 2YWEA 4G1UC 5C4MA 1D5CA 1E2EA 4QBGB 3HWSA 3VR5A 4B3BA 1W36D 5G40A 2WWWA 4DCUA 4TLDA 5KNDA 1ZUIA 3AGQA 3R8FA 2J0UB 1MO5A 1SKYB 5F9HA 2XSZA 2FE4A 3CRVA 2BV3A 4MGZR 5FTMA 2I3BA 2RB4A 3NC1C 4YXWD 2QBYB 1DO2A 1CLUA 1XCPA 3AVYA 2QE7D 1SKQA 4G5GA 2WZQA 1L7VC 5FL7D 4DDTA 1U0LA 2WIBA 4QBHA 1UEIA 3B60A 3FMIA 1UBCA 3DHWC 4RVCA 1SXJA 4Q9IA 2N46A 3AQ4A 3LRPA 4PZLA 2ZJ2A 2ZSAA 3MLEA 2HT6A 2QU8A 3B82A 1DELA 2IXEA 1SVKA 3MWJA 4JT4A 1ZU5A 2QAGA 5D3MB 4NL4H 1KSGA 1ZVQA 1L2TA 1F2UA 1QHHB 2EYQA 1N6KA 2OBMA 1N3BA 3AKYA 1G3QA 2ONJA 2MSCB 3W6PA 3CH4B 4LJ4A 2J5XA 1LY1A 2QG6A 1G18A 4B2IA 4AYTA 4BFWA 3ADBA 3QJYA 4BLTA 2IX3A 3I61A 1CU1A 2OBNA 1SXJC 3A1VA 4K46A 5JEDA 5IT5A 5FOXA 1YRBA 1GVNB 4PC7A 4PZZA 1MR3F 4QNRA 3K0FA 2CLSA 3QG5A 4MGYR 2O8BB 2A78A 4P4SA 4ESVA 1FTNA 2WM9B 2ZROA 3P27A 4ZCLA 2YV5A 2XEXA 2NGRA 4UJ5A 2QAGC 1FMLA 1QVRA 2D62A 5AUPB 3LW7A 4CEHB 2ZQ5A 3RANA 2CHQA 2D2FA 2FOLA 3F5FA 1WP9A 2HLDD 4A6XA 2PZFA 2EYUA 2VLIA 1QVAA 2P3SA 2ZEJA 3I8XA 2C2HA 4MDFA 3SQXA 3U60B 1KMHB 4YMUA 1GM5A 3P1JA 1D2EA 1N6LA 4AWXA 5GJBA 1HE8B 1I4LD 3X1XA 1NKSA 2RGNA 2ZJ5A 2OCAA 3BGWA 2J87A 1GSIA 4ESHA 3NBYC 4Q48A 4QGAA 4I1SA 1Q1ZA 4HATA 4JLAA 3BD9A 4LV6A 4Q9HA 1XCGB 1TMKA 2QPAA 5DE3A 3A1SA 5SZIA 2H7VA 5AR1A 3KQHA 4N3NA 1T3SA 3K70C 2QPOA 4AKIA 2HCJB 2ZYVX 5L3RA 1P62B 1FTSA 3PUVA 4LHWA 4XIGS 3FVQA 5DHAA 2GXSA 4C4PA 2FPLA 2VP0A 3AF2A 3ZVRA 4H9GA 4WXPA 4TSFD 2YHSA 4FMBB 2WHXA 3NHBA 5G3YA 1TAGA 1PUJA 4HAXA 4YMVA 3TGPA 2ZI5A 3IKJA 3WYAA 2C8VA 2RGNC 4Q1FA 1NVWQ 4LJ8A 1AKEA 4NP6A 5L3SB 3GMTA 1NVVQ 1CJUC 4CIDA 2YOHA 3EZ2A 1AM4D 3TAHA 3RS7A 2EW1A 5J4VA 1S3SA 4URXR 2JEOA 4QM6A 5A4JA 3A6PC 2RCNA 5TV2A 5LDDC 5H8WA 4Q1EA 4DCVA 1XRJA 4P4UA 1OH7A 4MYHA 3FMPB 1VCNA 2X77A 2AR7A 3T15A 3ONWA 5DN6D 4OHZA 1N0UA 2V6ZM 2O8DA 1JXMA 1VG9B 4RZ2A 1NNEA 3THWB 1VTKA 4OK6A 2GK7A 3D7MA 1M74A 3VX3A 4F93B 1Z0AA 2KWIA 3R9WA 4IEEA 4C7OB 1R0XA 3CR7A 4IJMA 1OH6A 1E2JA 2IHBA 2YC4C 1TTTA 1G7CA 5FFMA 2ZE7A 1ZINA 4NDZA 4XD7D 4MYUA 4IEIA 3IEVA 2PX3A 1JEDA 3MRSA 5J4YA 1D9ZA 3KUCA 1TL7C 4EQ6A 5GADl 2NOAA 5KSZA 1GL7A 1TQ2A 1Z6AA 1OXTA 1EWRA 4CEJB 4JZKA 4L9WA 3KZ1E 3UPUA 4JS0A 1G6HA 2K5UA 2B6HA 2ZXUA 1OB5A 1DVRA 1JNYA 2QRNA 3NWJA 2WTUA 1KK3A 1YZKA 2AKYA 4DB2A 5KDLA 5FBQB 2DFTA 2OXCA 4WA7A 3AJIB 1G1MA 2BBTA 5CK4A 4LRSA 1T4GA 1VG8A 1H8ED 1GL6A 5E7JA 3AUXA 2FU5C 3UANA 4A0RA 4OQFA 1OLOA 4B6FA 2WIAA 2NQ2C 3AVPA 4I1UA 1R7RA 2GWHA 2Z6VA 2CXXA 2ZU6A 1XU4A 2FH5B 3DDCA 3B7GA 4KFUA 3TUZC 3BB4A 4QHTA 2ZJZA 3I32A 1EX6A 2ZE6A 3VHLB 5KDDA 2EFEB 2JJ2A 4PPQA 821PA 2JLRA 5E3HA 1IBRA 2O0KA 1MV5A 2R62A 2O0JA 3LBHA 1EFUA 3LAWA 2ZRIA 4EPVA 1JR3E 2LKDA 5KDOA 2YC2C 3GLGE 5KNBA 3BERA 3BH0A 2CJWA 1D9XA 5L3QB 3SYKA 1D6JA 1IJFA 5D3QA 2ZRPA 3JZAA 2JLWA 4XH9B 2VF7A 2FMXA 4FMCF 4JL6A 3L0PA 1BO6A 1AGRA 1XMIA 5J4KA 4TZ0A 3MG9A 2J9RA 4KYUA 4Z54A 4HEJA 4TN1A 2Q9AA 3AKEA 1S96A 5SZHB 1TEVA 2VIIA 3N2IA 5J4HA 4LJ7A 1P9NA 2IYLD 2A30A 4MYCA 2YOFA 3AEZA 2ZUCA 3C5HA 2CL0X 4IVRA 4L4UA 3NEJA 4DLTA 1CS4C 4LJ9A 2JASA 4BECA 1WDTA 3IQWA 2QPTA 5EXSA 5BN5A 1BYIA 2WPDD 5CB6A 3OIUA 4JLVA 2QP3A 3PENA 4Q02A 1P5ZB 2ORIA 1SGWA 3ZS9A 5L8VA 4D80A 2QRZA 4M22A 2CDNA 2R6DA 4CF7A 1VCIA 2H8KA 1Z6GA 3FYHA 4HDCA 2AD5A 2DWOA 3NVAA 4JT2A 3QY0A 3TE6A 2RH5A 3WYGA 2OHFA 3DPUA 4Y0VA 3KL4A 2P65A 1NG9A 2BOVA 3AH8A 1XX6A 1MO4A 3B13B 1X8LA 3JVVA 1BKDR 2JA1A 3CX7A 4B74A 4FWGA 1CP2A 4JSYA 3AKCA 3GFTA 4ITRC 4Q19A 1ZM3A 2V9PA 3B85A 5B64A 4DKXA 1I2DA 2WKQA 1GKYA 4ZKEA 1TF7A 5EP3A 3KKPA 1QHXA 1P6XA 2QTFA 3QF4B 1FW6A 4PZYA 1J8MF 2WV9A 5DI9A 5DNYB 2P0EA 1DAEA 1M34E 2W6JA 2H17A 4M4SA 1DAMA 1KI1A 2ZYUX 1HTWA 3MD0A 1GZSA 4B76A 1VCMA 5AWFC 2BEJA 3D8BA 1IOZA 1DAFA 1P9RA 3NH6A 4IRUB 5C2JB 3BH7A 1T8TA 5HTKA 3W8NA 1OIWA 4IOLA 2WWGA 3W5IA 1YE8A 2O0HA 5UKDA 1EWQA 1RRGA 3T06B 1QHYA 2VA8A 2B21A 5AJYA 3PQCA 4EPRA 4CGZA 2O8EA 2W2VA 2R6CA 3KJHA 1GKUB 4L9SA 1XXHE 4S35A 1ESMA 1R2QA 5TB5A 1ZCBA 2AFHE 1KYIA 2LWIA 4OI0A 3OEEA 2Z5FA 2QAJA 3I73A 2QSYA 4PFSA 1US8A 2ZJOA 1RRFA 3KJEA 1E1QA 1Z2AA 2V6IA 3I5YA 1PUIA 1Z0IA 1QHHA 2W6IA 1KY3A 1KK0A 3GP8A 2FSIA 4MGIR 4F91B 1IXZA 1AK2A 2WVJA 3THYA 4JLKA 1ZNXA 4MA4A 2CLCX 621PA 2WJIA 4NYIR 1WB9A 1XJQA 2GXUA 1EFRA 2CCJA 3GLFE 1M7BA 1XF9A 5GVRA 1ZM2A 3ND8A 1SXJB 2Q3HA 2RGCA 1N6HA 2VP2A 3TVDA 5AJVB 2QP4A 3CW2A 2NO9A 1ZW6A 4JMPA 4QC2A 2XGJA 1FX0A 1YKSA 3BK7A 5CYOA 3SN6A 3BFKA 3C16C 4BPBA 3KJIA 2FGJA 1YQTA 4FWHA 2AL7A 2GTPA 1CULC 2QAGB 3GLHE 2EWWA 3ADCA 3TRFA 4QXAA 1F2UB 4LWZA 4P3YA 4FWIB 1OSNA 4TL6A 4PC3A 2BWJA 3BH6A 3W3ZB 4KYIB 3M4YA 5CK5A 1K6MA 1GG2A 2RGDA 2VP6A 3K0EA 3SJBA 1KMHA 3OZXA 1N0VC 2EFDB 4XWKA 1TF5A 3K0FB 5DGXA 1JJVA 2ZJ8A 5EZ6B 1JJ7A 3EASA 1WBBA 1XEXB 2WJHA 3AF0A 3FFAA 4RD3A 2AK3A 3ZQJA 1HURA 2JIZD 2AN9A 2FPKA 4JIMA 5KTYA 4LOAA 5JMTA 1IJEA 4NZYA 2ZE8A 4A1FA 4TMZA 3HU1A 1ZRHA 2VP9A 4URWR 4F4IA 1E2QA 1OE0A 3K70B 2QI9C 2JJ1D 2VYFA 4KAXA 4LV5B 3T1VA 3FWYA 1HQCA 2A5YB 2G0NA 2VBCA 1C1KA 3SR0A 4FCTA 2C04A 4TQUS 2ZE5A 3ZH9B 4OI1A 4BUJA 1R5OA 3UIEA 4TT3A 3AVWA 2VHQA 3GJXC 1IONA 3L82B 3C14C 3CRMA 2X2EA 3CPHA 4KFRA 4FMDF 2TMKA 2EU8A 4OL0A 4KJZA 1F48A 2ANCA 1YR9A 3CH5A 3A4NA 2GA8A 4TL8A 4CT4B 3N70A 4WOPA 2KE5A 1IY1A 3VR1A 1KO5A 1Z29A 2GZAA 4ASUD 1OHHD 4I1OA 2RGAA 2VTKA 3DEFA 3AV0B 4KSBA 3O8RA 3R7WA 2IEZA 2Q3MA 4A92A 4DRZA 2ZRGA 4JSTA 4HUTA 3QPWA 4B48A 4XOIA 2NZ8A 5TVKA 2V4ZA 2A3RA 1D2MA 2QT0A 5FTJA 2ZPTX 5FBWB 1N5IA 2OM2A 3DMDA 1JR3A 3U5ZB 1E79A 2KBEA 3W6OA 3WP0A 5JCPA 3GLGA 4B71A 4EAQA 1W7AA 2F1IA 4BFUA 3WXMA 1E94E 1DS6A 3A36A 2ORVA 1E2KA 3BE4A 2YKGA 1JBKA 3DVLA 2FF7A 4V02A 3SS8A 1KSJA 2BVNA 3QQ5A 4U02A 1KSFX 2OFXA 3SC3A 1KJWA 1OYYA 4QG7A 1KDTA 3TUJC 2CHVA 4GSYA 1JPJA 4Q4AB 5FOVA 2R44A 3H86A 1GL9B 2CL6X 3UG6A 4BASA 4DDVA 5J4LA 4ZKDA 1G3IA 2UVQA 3R9XA 4BRWA 2ZM5A 2DHRA 1XTSA 2IYWA 2FG5A 4KVGA 4NYJQ 2XTMA 4LK2A 3GLIE 1KDOA 1PVOA 4IDPA 2ZRFA 2QMHA 1XJCA 3CRRA 1LF0A 1JB1A 5C1BA 3OEED 4OBEA 4Q4HA 3KQKA 1G3RA 1CKEA 5CLQA 1N6NA 3QXJA 2UKDA 4EQ6B 4JN6A 4OYHA 3J81k 4D25A 5SZKB 5FBRB 1AGPA 1E2GA 5CM8B 3ZGXA 3PUWA 1AQUA 1U81A 1G17A 2DWQA 5LB2A 2WSMA 2FV8A 3CPJB 1R0ZA 2IYRA 3CF6R 4RCZA 2ZREA 1G9XA 1G4AE 1HEIA 4DCTA 4BQSA 2W58A 2N42A 4OHVA 1XJ0A 2QA5A 5JI2E 4YMSA 3ZZTA 4QGFA 1R5BA 1VYVA 3VNUA 2ONKA 4NU0A 1E2FA 1NRJB 4EPTA 5L3QA 3W9YA 3X1ZA 2VSXA 3UWOA 4M9SA 1XCMA 4TMXA 1W1WA 3O8BA 4MRSA 1U94A 4NONA 1QDEA 3AM1A 1X1RA 2F9MA 4PQFA 4URYR 2FDCA 1U98A 2XZOA 2IBMA 4JVNA 1KZ7B 3B1VA 4PC1A 4GPTA 4FW9A 1U8ZA 2BDTA 2H18A 4MKGA 2JLQA 3K0AB 1Z07A 3LDAA 3I8SA 3IPXA 2I1QA 4EFLA 1K5DA 4RZ3A 1KZGB 3WHKA 4LHZA 5JJKA 2JDIA 4MYTA 2R9VA 2WWYA 5FTKA 1KJZA 3KB1A 5HZHA 3AGPA 4EKDA 4LCBA 2GJKA 1XXHA 4FINA 3I3SR 3ZIAD 4NCHA 2PMDA 2EFCB 3E1SA 5K8TA 4DCSA 1Z08A 2CJWB 4C0HA 5KSPA 1KMQA 4CW7A 5LD2C 4OK3A 4TWZA 4GZMA 3MWYW 3X1WA 3B9QA 1OT3A 1E1RA 4IDQA 3CZPA 1H65A 4BEJA 3EA5A 5JJLA 2ZI6A 1AN0A 3QIAA 3RWMB 1D8TA 3LVQE 1OFUX 1NN3A 4HZIA 4XWOA 4LY6A 4WXRA 4QJ5A 1RYHA 4LGMA 3U61B 1S1MA 3GLFA 1VG0B 2GZHA 2VEDA 3KKMA 5FUVA 4URVR 2FSFA 2HDNB 2FPMA 4U00A 2IW3A 5FTNA 1TADA 3QF4A 3NH9A 4A0GA 2GBLA 2FGKA 2PX0A 3V9PA 4QRHA 1Q22A 4HAZA 1Z28A 4E5UA 2YJTD 3LXRA 3K0CA 2ZITA 1XD9A 2HXYA 4PAOA 3VR4A 3AVVA 2IYQA 1NF3A 1AZSC 2V7QA 3SYNA 1UBFA 2NPIA 2OXRA 4KFTA 1L4UA 2REXB 4LHXA 1KO4A 4LV8B 3OE7A 2REOA 2O8CB 4EJSA 3IBGA 1YR8A 1BS1A 1CR4A 1AQYA 3OF5A 3ADKA 1JPNA 1LF5A 2ZRCA 3L0SA 3QXXA 2GVZC 1CBUA 1A82A 5FI1B 2B7CA 1ZMXA 4GOXA 5SZJA 4I81A 2QGNA 3H4MA 3LD9A 4KU4A 3OIVA 4M1OA 1J70A 2GBLC 1W0KD 2IUTA 1XNJA 3HR7A 1T3HA 2A5GA 4HZUA 1P9WA 3U6KA 3K0CC 4Q1BA 3TR0A 3MGCA 4ZIRB 1MABA 2AX4A 2WOJA 3VKGA 3TR5A 3KW6A 2JLVA 1XEWY 3QNUA 4HDOB 4D26A 2B92A 2BMDA 4EJSC 2VO1A 3Q3JB 1G41A 4O2RA 4V0LA 4P32A 1LNZA 3PVSA 5FUWA 4TTRA 2VH5R 2C95A 2RGXA 4B73A 2G1JA 2O8EB 2GZDA 4JBWA 2BEKA 4BRUA 4OKSA 4X8HA 2J46A 1IN6A 1KO1A 1EXMA 1AKYA 1OIVA 2GF9A 4IVQA 5IRCD 2X19A 3MJRA 4X8OA 2VF8A 3IIJA 3SU8A 4AIIA 2DB3A 5IK2A 1US8B 4TZ6A 3NEYA 4RJLA 4ERNA 1QG4A 1UJ2A 2PT5A 3M1IA 3OFNA 4UXIA 1N6IA 3DKVA 1Q3TA 4DUGD 3OAAA 1IN5A 521PA 1VHLA 1UDXA 2QQ0A 3QEOA 5JFGA 3HU3A 3EA0A 3IQXA 3THYB 3I62A 3SHWA 5F3WB 3ZDQA 3ASZA 2P5TB 2WAXA 4HSEA 3PIRA 2IUUA 1G16A 2P6UA 4QM7A 2H92A 3HPRA 5BW8A 3PEYA 3OIWA 5L3VA 2Q0HA 1XEXA 2IS6A 3KQLA 2VRWA 1Z0DA 2XOKA 5EXXA 4DCNA 1GP2A 3AF1A 1FX0B 1R8SA 3VMFA 3VKHA 3K1JA 3QKSA 3ZJYA 1Q44A 2PCJA 3LV8A 2IWRA 2OAQ1 4HB3A 2GAAA 5CITA 3UKDA 1NBMD 3FKSD 1COWD 2FEOA 1J2JA 1T6NA 3A4LA 3QENA 4M1TA 2A9KA 4PPGA 4US1R 2X1VA 5AUNB 4UNQA 3TUIC 5GVSA 2XJ9A 2UZIR 2ZVPX 4IKEA 2F1JA 4Q1CA 2IYSA 1G5PA 2P67A 4RKEA 4FN5A 4ZDWA 3CX6A 3R8CA 1KI7A 1ZUHA 2GEUA 2NG1A 1X86B 2R8RA 4R7ZA 3VFDA 4LHYA 3BB1A 4D4KA 3DL0A 3LVRE 1S9DA 3CX8A 1F2TB 4GOJA 2FFBA 3L0IB 4W5HA 2AHOA 3VR2A 1Z47A 4Q00A 1RC8A 3QOFA 2CNWD 3LBNA 5B57C 1E2LA 4GNKA 2EQBA 1FZQA 1U2RA 1M7HA 1QBKC 3EZ7A 3EPKA 3EIHA 3VR6A 2ZSEA 2CK3D 1UAAA 2D4HA 1N5KA 2GJ8A 5G53C 3LY5A 3K9GA 2ZTSA 3VR3A 4UKDA 2F43B 4PO1A 1E99A 1XP8A 1R0YA 3KFXA 4CYMA 1RKBA 3IHLA 1W2GA 1OFHA 1FNNA 2BJVA 2OSBA 3UMFA 1ZUNB 2GJAA 3ZD7A 4MH0R 1FP6A 4KITB 2EFGA 4IDHA 5JS8A 1E96A 2CCKA 1KKMA 4AK9A 1GRQA 3K9LA 1A4RA 3NDBB 2PZGA 2G77B 3I4LA 4KSCA 1KO8A 5EE1A 4LBYA 2Q9CA 1XZPA 1JQJC 2NO1A 4IHQA 1KDRA 1E6CA 3RS5A 3I1FA 2J7PA 3KXKA 2V7QD 4Q4AA 3SYLA 1E2NA 5J40A 1SULA 4LHVA 2AD1A 4TQAA 3R7WB 2A5FA 2F9LA 2V54A 3QE0A 4PSAA 4DLZA 1Z0JA 4DDUA 2W0MA 3PEVA 4QBIA 5EE9A 3VU9A 2J45A 1BMFA 4B44A 1RFLA 4TLCA 1G3MA 1B0UA 4Q9KA 4B35A 4C0LA 4TMKA 3AVOA 4FWTA 2YWHA 3D31A 1NVVR 3GLGB 1DOAA 1OF1A 5E7MA 5ANRB 1ESNA 1S4QA 2IYTA 3K53A 1PZNA 2Y8EA 2QZ4A 3EZFA 5LB4A 3TMKA 3KB2A 5EUQB 4GDFA 4O0MA 4YMWA 4Q47A 2XSZD 1KO7A 1LVGA 4PPFA 1FL9A 3KXIA 4ZO4A 2ZIAA 3IIMA 2QSZA 4F7WA 1XBTA 5FTLA 5AJXA 3QVVA 2FFAA 1ZJ6A 1YZUA 5HKKA 1YVDA 1TPZA 1MT0A 4LPSA 2XX3A 4N1AA 5HE8A 3FFBA 3CWQA 4FMCB 4PSVA 3CWZA 4XTRA 2IS2A 4OHWA 4JYCA 5DIFA 5E4FA 2CLDX 1ZIPA 3C41J 1SXJD 3FMFA 1IM2A 4TL7A 4DSUA 2CMKA 2QENA 2H5EA 1W5SA 2W2TA 1A1VA 3FKQA 3R20A 5DISB 4Q4HB 3FE2A 1LB1B 4PXAA 5J5CA 3RS4A 2AXPA 2WJYA 3BC1A 3WRXC 1DARA 1SVSA 3WP1B 3B1YA 4LBVA 4LI0A 1E98A 2FN4A 2CEAA 2C98A 4DB4A 1Z5ZA 4L15A 1NLYA 1W4CA 3Q8XB 2IYXA 1V43A 3K0AA 2ZJAA 1E0JA 5DYGA 3PCRB 3RAPR 2WSSA 1P61B 1JALA 1KAOA 3CB4A 1ZNZA 5KU1A 5EXTA 1DAHA 3QPUA 2ERXA 4JLJA 4KV9A 1XEWX 1QHGA 4RSGA 3Q9LA 5GJWC 1KK1A 4JVMA 5EE5B 1MOZA 3RABA 2NO7A 3ZQ6A 3O8CA 4G5QA 1GOTA 6Q21A 2OV2A 4LBZA 1T0JB 2J0SA 5J47A 2FWRA 4QJ4A 4WIAA 1MRNA 5C4GB 3SDZA 4QGGA 2BCGY 1ZD9A 2WWIA 5LD2B 3K70D 5CIQA 5M04A 4HLQB 1P3JA 1Q0UA 3OIYA 4L5BA 1W4AA 2OBLA 3VHXA 2VHTA 4Q1DA 3LX8A 1G7TA 1KI9A 3T35A 2R6FA 2A5DA 1KI6A 1Z63A 4EUNA 5HPYB 3TNFA 3OEHA 3EAQA 5DO9A 2HF8A 5IHPA 2DCUA 1JXOA 5TDHA 4AYXA 3RLFA 5BN3A 1PLJA 1FNMA 5F2EA 1XXHB 5JJIA 121PA 2MMGA 5AK0A 3BRWD 1RJ9A 1OFTA 5C18A 2PBRA 1EK0A 3SEAA 2AXNA 2G3YA 2R6AA 3FMOB 4R9UC 4F4CA 3KXLA 2HXSA 4UXHA 4C0SA 2ZR9A 4KLNA 1ZU4A 2VHJA 3RYTC 4A6PA 5IF9A 1UEJA 3ICEA 1AIPA 1KIMA 2O8CA 1MO6A 3K8YA 4MGKR 4TMVA 5CJPA 1UFQA 1GTVA 4NH0A 1LW7A 4CVNA 4JLPA 2QN6A 1GDDA 4GRAA 2C96A 1TU3A 2D06A 1ZIOA 4IXNA 2E87A 2BC9A 1X37A 3GLFB 1LS6A 2QGZA 2YYZA 4A15A 2ZYTX 4CEIB 2WAYA 5B58C 3ASYA 4O3MA 4LYHA 1SVLA 2IF2A 3DMNA 3REFA 1CR2A 4ZIRA 2RGBA 3T5GA 1RRCA 4AKGA 3KUDA 1U0JA 2ODWA 4V0ME 3SJCA 1EFTA 1TF2A 4B32A 1NLZA 2DY1A 2GESA 4ACBA 2GXQA 3GLHB 1FP7A 1XD2A 4RD6A 2XNSA 1Q1BA 3IO5A 1UKYA 3NKVA 4DLUA 4EJSB 2CVFA 4FI3C 3LNCA 4AG5A 3U7EB 4BZXA 4JKYA 1E2DA 1CIPA 2J7PD 4GP6A 4AURA 3SQWA 1HUQA 2NIPA 2JLUA 4JVLA 3NBZC 4GZLA 3AVXA 3SFZA 3MSXA 1D2NA 3BWDD 3VQTA 1TX4B 3HYRA 3IEUA 2FZLA 3E70C 1N5LA 4HZUB 1BMFD 2PL3A 5E95A 2G6BA 2DFKB 2UZ3A 1T5IA 2BMFA 4PC2A 1MABB 3L8YA 4WBSA 4G5OA 3THXA 2P2LA 1GIAA 1SQ5A 2R2AA 3HPQA 4B43A 3B1XA 5F98A 3O47A 4GOKA 1J99A 2QM7A 1QG2A 4DSOA 4D82A 3D3QA 2YINC 3K9NA 1RVDA 1FQKA 5EP1A 2JLXA 2A7QA 3U2QA 1M1YE 4MKIA 4MKHA 1DPFA 1I2MA 1Z6XA 5KSYA 5C46F 2E1RA 4DLXA 3Q5EA 2RMKA 1II8A 4LJYA 3K0SA 5FOUA 3GFPA 5FPYA 4WZAE 4DSNA 2VHUA 4K8OA 3B1ZA 5JCZA 4W5JA 2O52A 2GCOA 3TQCA 4AKHA 3T1QA 2GILA 2ATXA 4C3ZA 2N1BA 2VQSA 2ZRLA 3AKDA 4FD2A 4FMDB 3UK6A 3I72A 4C2TA 5G3ZA 3KQUA 4MKFA 3Q72A 2BM0A 3GEIA 3EPJA 2BIFA 4HB2A 1W47A 2WOOA 2FJUA 2JJ2D 2OCPA 2BMEA 1IAQA 2ZANA 1YZTA 3L0OA 4Q4JA 3RHFA 3QBTA 2EFHB 4N0EA 5TXGA 1F2TA 2ODNA 5KUTA 4M8NE 4NTZA 1G4UR 5DSZA 2JCSA 1DG3A 4OHYA 3PUXA 4UNRA 5BQ5A 2WJJA 3QKSB 3WMEA 5FBLB 4A4DA 4TMWA 1OKKA 3GD7A 2W0SA 1ZCAA 2IK8A 4L8GA 3B1WA 1A2BA 3HU2A 2J7KA 1A5TA 3SOPA 4S2EA 4BFYA 4KFSA 2GEDA 3RS0A 1E3MA 1C4OA 2F43A 1HQYE 4H1VA 3N5CA 1V5WA 4JJKA 4YC7A 2IA5A 4D4LA 2X8AA 5JBQA 2FFQA 3EARA 4Q21A 2XXAB 4JLBA 2FX3A 3SE0A 3U44A 3ZLJA 3K09C 1VECA 4LZZA 4X8LA 3SBDA 2ZSDA 3ETLA 3GLIB 1X1SA 2XNDA 3H0KA 4B33A 5GJVC 3CO5A 2J1LA 4ZDIA 3AB3A 3A1UA 3A58B 1IY2A 1FOEB 1DAGA 3EZ6A 1LFDB 5EZ5A 3EWAA 1T5LA 3BIFA 2MSDB 1NI3A 5EE3A 5TARA 1WQ1R 4Z8YA 4TYQA 4MRRA 4ZPXA 2FA9A 3MUFA 5H68A 4A82A 1X8KA 4BFSA 1XTQA 4LYJA 3U6BA 2ZJBA 2QUZA 4BFVA 2IXGA 4NMMA 3GJ4A 4RD2A 1E0SA 1XD8A 2QTVB 1B23P 3IPYA 2Q3FA 4DT1B 1XWIA 3UG7A 4JBXA 3SJZA 1T9HA 4HAUA 1W2HA 3P4XA 1NL3A 1F5NA 2WMNB 1KI2A 1YR6A 1YZGA 421PA 1IHUA 4J0QA 1W5TA 1DAKA 2ZRHA 3DOEA 4A8JA 5KHOC 3FOZA 3O8DA 1RYFA 1HA3A 3P26A 1G5TA 2ZRAA 1KJYA 3A4MA 3TW4A 2ZETA 3R9IA 2ZAOA 1FMJA 1N5JA 2F3TA 4MUAA 4E22A 2W6JD 3BXZA 4LC0A 2ZU0C 1CJKC 3TLXA 221PA 4RZUA 5FOTA 4JBYA 2RGEA 4ZI2A 1HH4A 2G9NA 5DH9A 4DLYA 4NE2A 3BAFA 3MMPA 1GKIA 1OV4A 3WMGA 3PJRA 2QP9X 4XVQA 4DVGA 4QOSA 3D6TB 3U7FB 4RKFA 3VU9B 4NYMQ 4YXWA 1KI3A 4BZQA 4A8JC 5FI0B 2QE7A 1BYUA 5FL7A 3F0TA 3ADDA 1P2TA 2F3RA 3PEWA 4B3DA 1XEFA 1W36C 2ZAMA 1BIFA 1NMYA 4M1MA 3CM0A 2RKOA 3AUYA 3N2EA 3T5DA 5EJEA 2HT1A 1E1QD 3A1WA 1UADA 2W6ID 4R98A 4JKIA 4FWDA 1Q57A 3NHAA 4G01B 1OXXK 3WBKA 4A3VB 3HP1A 2J0VA 3LWNA 1GNRA 4Z51A 3B78A 4OK5A 4I1VA 3QUSA 1R0WA 3TVTA 1IY0A 1EFRD 4BZPA 2DZOB 3ZVLA 3M0EA 2WJGA 3DOFA 4YMTA 1P2SA 4E03A 1RPZA 4GP7A 3Q7QA 2D74A 4NYJR 1JR6A 1IN7A 2GCPA 2IYUA 3CKLA 4X8MA 3BFXA 2OFWA 2WWHA 2B8WA 3ND9A 4AY2A 1E9DA 4DXAA 2G83A 4V0MA 1RW4A 2PZEA 4M1YA 2VSOA 2ZSFA 4IFEA 4A0HA 4XTCS 2O8FA 5K8LA 2HUPA 2PLRA 1JQLB 2MMCA 1ZNWA 1LS1A 4K81B 3NIBA 4N0DA 3T34A 1QZXA 2OAP1 4E09A 2QNRA 5FOSA 2GHIA 3U4QB 2HLDA 3QF7A 2OEPA 2HF9A 3DKPA 4G0NA 4Q03A 5FUXA 3CIOA 1S1CA 1T8UA 3QXCA 1GNQA 4O2LA 2E9SA 2ZRBA 4KBFA 1Y63A 3RWOA 4UNPA 4D2IA 4GT1A 4L16A 4NCJA 4ZI3A 2P6RA 3GJ0A 1LTQA 1G64A 1ZNYA 2V1XA 3B9PA 4EPWA 3A1TA 3VNVA 5CJ2A 1AJEA 4AG6A 1C1YA 2XTZA 1VCOA 1KI6B 3PITA 1CJTC 2CVHA 4C9BA 2GNOA 3H2YA 4TT3D 4WAUA 5K8IA 1II0A 3EPLA 3WRYC 2F55A 1E9SA 1E4VA 2ODEA 4CEIA 5HCIA 2QMEA 4TSFA 3DZ8A 4GITA 1EFCA 5DI3B 4E07A 2ORWA 3DO6A 2B8TA 1RJ9B 1Z8FA 1DE0A 1JI0A 4QGHA 4MRVA 4NBSA 4URZR 2WWXA 1W0JA 3GLHA 2CL7X 1YR7A 2YVUA 3JVUA 3W5JA 2OUKA 4F4JA 4F92B 1KTVA 4TMTA 5KYKA 4QHYA 1TNDA 4D0NA 2OG2A 4B75A 4DLRA 1YU9A 4JLMA 5EQTA 3RS3A 3EC2A 1E2IA 2IHYA 1O87A 3FHTA 2KBFA 4R2HA 4U7DA 3MFYA 3KKOA 2ZRMA 3EW9A 4LC1A 1ZBDA 1RRPA 1WE2A 3KTAA 4GMXA 1R4AA 4QBFA 4DLSA 5JRZA 3F8TA 1MKYA 1Z6YA 4YDHB 1NSFA 2ZS8A 5DN6A 1XTIA 5FPKA 4TYPA 2VPPA 2FSHA 1XTKA 2ZI7A 3EZ9A 1JR3D 1WMSA 1E79D 2EWVA 3Q85A 3S1AA 4RY2A 5A0FA 3RRYA 4M21A 2IYYA 1XD2B 1G8YA 1R5NA 3QKUA 1EGAA 1TUEA 2ZI4A 2H1LA 4XD7A 5CIWA 5CM9C 3QVUA 1JAHA 3MCAA 1NMZA 1NG1A 3CF2A 1KKLA 1JEEA 2AFIE 4DZZA 4HAVA 3RC3A 4KODA 2HJGA 4LUCA 3DM5A 1KDPA 2HJVA 1G7RA 2GJ9A 4UNSA 3GEEA 1Z22A 4ARZB 3M6AA 1OW3B 5JWRA 3P4YA 2IL1A 3PV0A 2GDJA 3T61A 1E9RA 3EWSA 3DZDA 2PCLA 5LBIA 4XVUA 3U3OA 1IXSB 4FIDA 4ABYA 2GETA 2JLYA 1E2HA 3LFUA 3THXB 1P4SA 1Q20A 4HUQA 4Q18A 3TW8B 3FGNA 5JHHB 1H8EA 3LLUA 2GK6A 5KO2A 4BLRA 2W83A 2YWFA 3AP2A 2D7CA 5EP2A 4BLSA 4M9QA 3IHWA 1R8QA 4PO8A 1N25A 2MSEB 4TTQA 4M9ZA 4JLOA 4PSKA 1IXRC 3WNCA 1IQPA 1ETUA 1ZD1A 3U3JA 4D81A 4RZXA 4NHOA 2CCGA 3E2IA 3HR8A 3AF4A 1L4YA 1II8B
chains in the Genus database with same CATH superfamily
4RY0A 5JI3E 4PAQA 4I7EA 4ND8A 4UU8A 4OQMA 1QQBA 2CMDA 2XGGA 4EPYA 3E3AA 1C0PA 3K9QO 2HCBA 2WSFF 3AEKB 1IHOA 1NRXA 4G5XA 4PO9A 2FK7A 3UATA 1WHSA 3X2SA 1PJTA 4BVFA 3C3JA 3FCXA 1G2PA 3PNLA 5H70A 5JPDA 4BX3A 4WZBB 2NQ8A 3EVDA 1Y9JA 2R8BA 3C3DA 2IUSA 4P7BA 2L6OA 1RMYA 3ECAA 3VYVA 1W0JD 4FCWA 4XM2A 3MTAA 3FWPA 2BFFB 2HLNA 4O63O 2ZAGA 3WTCA 4S1WA 4HLUC 3KIPA 4UVDA 5JSHA 2AC2A 4RZQA 3U1TA 5BXYA 4OGLA 3TWOA 5TGZA 5DNCA 4BX8A 3ZHTA 2YMPA 4UXJA 4G5YA 2F6RA 3DMTA 2H5LA 3AUJB 2R6HA 3FDIA 1BH2A 3F9RA 1JB9A 4KXFB 2QKYA 1QCDA 4WN9B 4HV4A 1VDLA 3IALA 2Z83A 4OOEA 1CUBA 2GEJA 1EG7A 5DCUA 1TEXA 3HDHA 5KU7A 4UBLA 1FVHA 1XMJA 4RBNA 3B20A 4QL3A 2ACEA 1QTRA 3IMCA 4PR0A 1IB0A 3OH8A 3SHGB 1EVQA 3DHEA 3QWHA 5IFKA 2AE2A 4R8KA 4BQEA 1BN6A 2HK9A 3FUWA 1AHPA 1FDTA 3TW0A 1H23A 4CLEA 2JJ1A 4GIBA 1FYVA 3ROXA 2Z7JA 1VJ5A 5DI3A 4IZHA 2TSYB 1XPUA 4J4TA 2FZGA 1X3LA 3HQ4O 4RHFA 4IW3B 3S2FA 4TTIA 3JWJA 2FFHA 4Y6RA 5BYBA 10MHA 5CAEA 1HMYA 3TBKA 2NZ2A 5CT9A 5IC6A 4MQEB 2HBZA 4D97A 3SE7A 3DCYA 2C9OA 1G3UA 4BX9A 2PMBA 3QEJA 3CX4A 1TYDE 1AQLA 1UDBA 1O0SA 2ATEA 2P91A 4HNSA 4UATA 3C3KA 5JYBA 4DHWA 3RC8A 4Y6SA 2C9CA 1Y8RB 1FPQA 2B4AA 4TV9A 2YZ2A 4B09A 3CNBA 1BGWA 2CXTA 1RHMA 3BAZA 2Q5QA 3NATA 4RJIA 1L5WA 1KZ6A 2N3ZA 1RNLA 1U2DC 3JVDA 4DLWA 1VIAA 2NUPA 1JP7A 1A4UA 3PIDA 1T43A 5J2TB 2R1UA 2FMUA 2O6HA 1QZMA 4MRNA 2WNHA 4BLWA 3PEUA 2BRUA 4C4XA 3V00A 1F1BA 2JLZA 1VG1A 2A5JA 2PT7A 4L7QA 4LDJA 3OA2A 1A4XA 4QEKA 1VKJA 4NR0A 4MLPA 3DE4X 5EJ2A 5DBIA 2RAVA 3E81A 1XTVA 4K9QA 1NNI1 2H2FA 4QELA 1B14A 2BFMA 3X1YA 2RI1A 1NAHA 4XB1A 1SZPA 4MX8A 1GPJA 2YOGA 1A5BB 1CY4A 1EAMA 1M2GA 3BKWA 1U8AA 3FAZA 1YMVA 1FUUA 1EFPA 1MTOA 3GPXA 2DT8A 3OY2A 2CLKB 2GYUA 1ANKA 4U7JA 4I4TF 1H94A 4PQRA 4Q3NA 2P9QA 1CQJB 4OIMA 3IUEA 4PAMA 3THGA 3EK2A 1S9HA 4C7OA 4PZ9A 4IUBS 2PQ6A 5AVXA 4RAQA 1L7EA 1IE3A 4UDNA 1V2GA 1NMXA 3W90A 1VYUA 3L9XA 1IK4A 4YRRA 1W49A 2NZVG 3TQTA 4Y9SA 1Z06A 4JROA 4GRIA 1K5HA 3P0HA 1KP3A 3H97A 4DR7M 2QF7A 4H1TA 3WMXA 3HLKA 3RKUA 4KL8S 2E4WA 1XB2A 1E64A 1HEUA 2QN2A 3OQHA 3UWKA 2OHGA 4DBLC 1I5EA 1AKUA 3PR1A 3VZRA 2HI0A 3ZU4A 1NUUA 5TMBA 1YWGO 3PDIB 3CNNA 4ZEMA 2V45A 4PYJA 2FZVA 3EIEA 3KJXA 4MV7A 1SHUX 4IXDA 3MB8A 3SM9A 5E4YA 3STUA 2WIDA 3UMMA 1NRIA 5BN4A 3R5HA 2CBGA 2WHEA 1YQDA 5AJZA 4WZAA 2C5HA 2AJDA 3ZWPA 1J9GA 4K1XA 1UM9B 1J90A 4E7PA 1WL8A 3U7IA 1M2NA 4R51A 2R87A 2I8AA 6REQA 1LV7A 3A6ZA 3KFVA 4KO1S 1ISIA 2NNLD 3DHNA 1D1SA 4YB8A 3O4VA 3OSUA 4B3BA 2JRCA 1W36D 2UXCB 1C9EA 3R8FA 1PQUA 1SKYB 1GZ5A 4EKNB 2XB6A 4BVGA 4BXOB 3NHZA 3SWWA 4YXWD 1SKQA 1DIGA 2WZQA 3U4CA 4XVCA 3E3NA 3GARA 4D3XA 1UBCA 2FUNB 1SXJA 2F8LA 3PVZA 4YAFA 1VOTA 4M0KA 3ONNA 2QR5A 1A9XB 3AKYA 3RVMA 2BGLA 4LJ4A 4IMPA 4C1NA 3I61A 5JEDA 3OM0A 1FTNA 5E8JA 3H4JA 2WM9B 1EEXB 3NAQA 4J7UA 4X95A 1AB5A 5ITRA 2D2FA 5KMGA 1I24A 1XAJA 3TRDA 2P3SA 3TKAA 3UKJA 2C7GA 2XUDA 1GM5A 2PO7A 3P1JA 3ZJVA 4I0WB 1PJ8A 2ZJ5A 3IHKA 4L78A 3A1SA 1IZ0A 4AKIA 4LOKA 2FYTA 2HJWA 4PLCA 1QH9A 3KVYA 4TSFD 3GUHA 2ZI5A 1NVWQ 4FBLA 1LPBB 1UUFA 3H1AA 5EVCA 3ZU5A 4NARA 3RS7A 5JXWA 1UWKA 1S3SA 1I4EB 4URXR 4UTVA 2QT9A 1HMPA 3AY0A 2X77A 3SOZA 1N0UA 4PGGA 1DV1A 5A4MS 2FDXA 4F6CA 1Z0AA 4IO0A 1D3AA 3KG2A 2BFCB 4IEIA 1L5FA 1T1EA 1OFGA 1X7YA 5GADl 2R6R1 3N2GA 5KSZA 1HSZA 1KP9A 2C29D 3DE5X 3IELA 3KQYA 4Q9AA 3UPUA 3ZEIA 4EVRA 4EY7A 2JXNA 1WVGA 4L8LA 3BJZA 2F5QA 3AX6A 2X8LA 4KFUA 2A6PA 3BB4A 3HJUA 1T1SA 1CY0A 4OU4A 1N5RA 2FZEA 3PXEA 2ZR8A 1UJNA 3FVTA 4I9GA 4CHTB 4C7KA 4EPVA 5KDOA 2PXCA 2AJBA 3MELA 1D9XA 4W82A 3SYKA 5DEIA 2FFJA 1KC3A 2Q8QA 2LVBA 4NOOB 2EZ4A 3U48A 4FS3A 4CF7A 1Z6GA 1WB6A 1WZIA 2C7RA 3R76A 3MXTA 1RI2A 1XX6A 4L50A 1PGOA 3B13B 2DKLA 2XLBA 2L4EA 5CM2Z 2LPMA 3RG2A 1FRFS 1XRNA 5EJIA 1TF7A 4B2YA 5AXDA 4JLUA 2O7NA 1E5XA 2C7PA 2Q2QA 2QZ9A 3HCBA 5TR9A 4IG9A 2WWGA 3LMMA 4TRMA 3FUUA 4BX0A 2B21A 3ZQUA 1R66A 4DV1B 2FUG6 3DV2A 1L7RA 1SKUA 1E59A 3LZ6A 4O8CA 2XRFA 3K0HA 3WGUA 1N57A 2MHCA 2FSIA 3SF0A 3IUSA 4JLKA 3PFNA 1G38A 3B7NA 1DDGA 4IIGA 4ZVQA 2NO9A 1E7SA 1R4NB 4YRJA 1VGVA 3HKEA 4UBKA 3VBCA 5JPIA 3I9MA 1VP9A 2QK4A 3ZDFA 3SYRA 1QE0A 2AS0A 1H4VB 3M6IA 4GPEA 4D5GA 3QVXA 2NU9A 1NUHA 3GCWA 2XEDA 5T4EA 2R86A 2GD6A 2H8GA 4X7PA 5KNBD 2PHZA 1E2QA 3USZA 1KETA 2VYFA 4KAJA 2A5YB 1C1KA 3A1DA 3QU5A 4UE3S 3AVWA 1CB0A 1ZUNA 3C6MA 4D99A 3BXHA 3WGZA 3CPHA 1ZDMA 4YA6A 3OPNA 5IM4F 1TCBA 3QBEA 1F48A 4UUPA 4RL6A 3FHJA 2PH7A 2EQAA 1VSTA 1G55A 3VR1A 2E5FA 2GZAA 4PLVA 4L1KA 3E7FA 5AVKA 4KE8A 3WGGA 4OGGA 2MINA 5AVYA 1IVSA 1FLNA 4FWBA 3U5ZB 3VZSA 4B71A 1R2YA 1Q0HA 1V6AA 1E3SA 3ELWA 4LZAA 3DNPA 1EDBA 2UVQA 4D9GA 2IYWA 2VATA 2ACVA 1GKKA 1H2HA 1KDOA 3TQIA 1I1HA 3L1IA 5BSHA 1RM4A 1BNCA 3RJMA 1Y37A 1E2GA 2IYRA 2QTBA 4PW0A 3RFCA 5EIAA 4ITVA 4OHVA 3EGXA 5I7EA 1NRJB 1KAMA 2ID9A 3PHJA 1MRZA 4RY8A 2DZDA 4NONA 4LSMA 1M34A 4GPTA 4U6NA 3RIHA 4QE3A 5M3BA 3CGWA 3IPXA 5ISMA 3L5OA 2MROB 2OBXA 2F00A 4ND4A 2O4CA 4FINA 1N36M 1DFHA 1AN0A 1N7HA 4FCCA 2A57A 1Q39A 1NN3A 4M7PA 2Y93A 4FONA 3LUGA 2HDNB 4R9VA 2PWBA 2GLTA 3JQAB 3QF4A 4YTEA 3NH9A 4A0GA 2BHTA 1Z28A 1I13A 1L4UA 1DLIA 3K2QA 1C7EA 3OE7A 4KKXB 1ZV1A 1AQYA 2GF2A 1LEHA 2GPYA 3EFOB 1L5NA 5FI1B 4X62M 1JKJA 2MSWA 1USVA 2AHRA 2D8MA 4HK4A 5ALIA 1G41A 4BLCA 1KOGA 4XGRA 1DC7A 1P6UA 1KO1A 1EXMA 3E9SA 1A98A 3L0DA 4JJ6A 3SFTA 2C20A 3Q4GA 3DAPA 2CLOB 3DKVA 1Z75A 3PT5A 1Y9EA 1SOUA 2WC1A 4IIYA 2PIDA 3AOGA 3QEOA 2UUCB 1EJ6A 4UEKA 5FBHA 3ZY2A 4RLQA 3QU4A 4JBHA 4B40A 4FLMA 3TUIC 4R41A 3KYIB 5EY5B 2G7MC 4NG4A 3WQSB 2BFBA 1VKNA 4IJ6A 3C6KA 1BVYF 4MCAA 5HF5A 3WOVA 4AZTA 1EM8A 2IPMA 3OOSA 1BJRE 2DQKA 3EPKA 1ZX1A 2G8NA 4HS4A 2VJDA 3LCUA 1E99A 4M1QA 3E9RA 1YO6A 1U11A 3HCDA 4BIIA 3ZD7A 2AGVA 3IVMA 2FRXA 4AXXA 2JIBA 3DKRA 1MNAA 2GEKA 1A9TA 3HDGA 1XZPA 2D7EA 1JEYA 1E6CA 5MDHA 3I6IA 5E26A 2LIVA 4TQAA 1DJPA 5IABA 4PSAA 2C5RA 3LHKA 1A8UA 1Z5UA 4DLZA 2VUSA 4ESOA 5KTRA 1B0UA 5DX0A 4XFDA 1C1DA 3P2YA 2BR4A 3K53A 2EKLA 2P1ZA 1SOMA 5LB4A 3BK1A 1NNUC 2FPGB 1ODLA 1LK5A 1GA6A 4CQMB 4OVZB 4LPSA 4MLCA 4I4IA 4XTRA 1NW7A 2NTVA 3R7DA 5DHSA 1PV1A 5A5VA 2WJYA 1NBWB 2FN4A 2CLLB 1E0JA 3PDUA 2V9CA 4UPEA 3CN7A 2FXIA 3T3PB 5HIKA 1DSSG 1I7QB 1X7WB 2NO7A 3O8CA 1F06A 1NMSA 3DQQA 1UPAA 4LF5B 2P90A 3OIYA 2OHOA 4X1IB 1KI9A 4YMHA 1KI6A 5HPYB 4G65A 3DMGA 5BN3A 4IINA 1PLJA 5AVJA 1H2AS 3FMOB 1NJ8A 2ZR9A 4A6PA 1QGZA 3EGVA 1L1TA 3QXGA 2AOUA 5ALYA 4IXNA 4WUTA 5B1EA 3F92A 5G1NA 4CEIB 1WNTA 1ZMVA 4HTFB 2LVPC 4ACBA 3GLHB 1GCIA 1RWOA 3ZUGA 1VKOA 5PNTA 3NBZC 5HJ5A 2W2KA 4LKOA 3X44A 4K8RB 5E9QA 4ZAZA 4QPZA 2YHIA 4R81A 2W71A 4FDVA 3O47A 4ZU6X 4CMJA 2QM7A 1KMMA 3K9NA 5CFMA 3KJFA 3WYNA 3A6HA 3GGCA 5JCZA 2XKJE 1T9ZA 3ML1A 2QYTA 3ZDDA 1RJWA 4TUWA 4C3ZA 5DP1A 1YA6A 4AY4A 2JUJA 2QLBA 2CZCA 2BIFA 2V58A 4UEWA 1IBCA 2FJUA 1TEZA 2A14A 3R7SA 4N0EA 4PHCA 4M8NE 5B5SA 1DG3A 1T3GA 4X0EA 2DPHA 1ZGGA 5FBLB 2OO9A 2ATCA 3B1WA 4DIUA 1N92A 4JR0A 2ZJ0A 4P92A 4KK3A 1VEGA 1VECA 4LZZA 1X87A 3S0JA 1SA0A 5J2TF 3CO5A 3MA0A 3PA6A 5JY6A 3EZ6A 5EZ5A 3UN1A 3BIFA 4DR3B 1U4OA 3U6BA 4BKMA 5G4LA 3WGTA 4BMYA 5EJ8A 3HZHA 4NH4A 1VM6A 2Q3FA 4DT1B 3R4VA 5IT9S 4R01A 2OYSA 5ECDA 4PSDA 3V46A 1Y1PA 5KHOC 2V7EA 1XMOM 2ZAOA 3JQRA 3TTTA 5L45A 3H9EO 2G9NA 3DPSA 1HLFA 3P9QA 2I4OA 2WR8A 1KI3A 3AU8A 3P2IA 1KE1A 3EXEA 1XZNA 4O5OA 1W4LA 4N5MA 3ADDA 2HMTA 4F2DA 1FRVA 3N2EA 4OFXA 3FDJA 3HP1A 3RC7A 2OSVA 5C4IA 3ETGA 1ZJ4A 4FUTA 4BNYA 2MIIA 2LNHC 3A3KA 4LOJA 3FPLA 1BHQ1 4A0HA 4DUYM 3ABQB 3ZTWA 5AJHA 1GTL1 2H59A 1VRCA 2OEPA 4G0NA 5EESA 3EOZA 1MLDA 3FNGA 1L5KA 2H1CA 4KKVA 5EL0A 3LPMA 4G0PA 1LTQA 1BOOA 5C1DA 4FFOA 1BWSA 1AJEA 4OLBA 5EMHA 2CLIB 3ZXXA 5JIBA 3PDJA 1NX9A 2F55A 4R83A 5ESRA 1M10A 1ZMOA 2G8LA 1Z8FA 4EB6B 2TMGA 2NO4A 3TLBA 1LJ8A 4X94A 5IJ0B 1PSDA 1L4HA 3L6DA 2PVCA 3NWBA 3PS9A 4U7DA 1P0MA 4IZOA 1ORTA 1Z8NA 2YVQA 2XD4A 2ZIEA 1VI6A 2C61A 3HZRA 1WMSA 4GLLA 5KYXB 5M34A 4KH1A 5TT1A 4W9NC 1DJLA 5IC4A 1EGAA 1TLTA 4OF4A 1S8AA 1SU6A 2GJ9A 3WDLA 2REQB 2WVHA 4BO6A 4E4TA 3EWSA 3GUCA 5ICEA 1U1DA 2JLYA 3R75A 2P4QA 1H8EA 3N53A 1C1HA 4M9ZA 5ALZA 3RROA 5G0VA 1OBHA 2OOSA 1U7PA 3FNFA 4OBWA 4ZV4A 3GPDG 3L0ZA 4Y1FA 1UWVA 2MT9A 5LFAA 3FN4A 2V7BA 2WY2D 4BFCA 2FEMA 3V97A 2FMFA 2HGSA 4PRZA 3COYA 3GLIA 2Q5FA 1CCWA 3O9MA 4P84A 3H5WA 4A0QA 1OPXA 1P2VA 4HDNA 2R48A 1DGBA 2F1HA 4LRUA 4REQB 2NTNA 3RE1A 1XYVA 2NV6A 3DVAA 1KGDA 5JHGB 5JZVA 5LQNA 4P9NA 2OWEA 5LQSA 1PTKA 4O29A 1L3IA 5AVWA 2AQHA 4OHKA 1JT9A 3HUEA 4BNZA 3R7LA 3LRTA 3VX4A 1J8FA 5HRAA 2DAGA 2QTTA 2VN8A 4Q3EA 1VJ0A 3UAGA 1H3EA 4BEBA 5KYGA 1UBGA 1Y1LA 1P75A 1T3LA 2X41A 2GLUA 2BGWA 3GNTA 1SXIA 1HNXM 2EBHX 2GN2A 1HXHA 2OYCA 4FEYA 4O5AA 1VMDA 2PRYA 4RTPA 3DKKA 4K6CA 4DBVO 4LDQA 4IDCA 1ZMBA 5ENDA 5TGTA 1PHPA 4WEOA 4OP2A 1GUBA 4LBWA 5ICFA 2BY4A 4DDHA 2ADMA 2G07A 4PCLA 1F8FA 3IOCA 1UBKS 3QHPA 4JP5A 1FMCA 5FRDA 2OLJA 3FRIA 2I55A 3IP7A 4CM5A 2WLTA 5EXPA 1OHHA 3ASUA 3KDSE 2ZCJA 3PJFA 3OMXA 3TSWA 1I7SB 4BLOA 2IHJA 3W05A 3N8GA 1EUYA 3PGVA 3L1UA 3HHXA 2JY6B 1OJLA 1E1LA 2PUJA 3SC2A 2VJQA 3LLMA 1C0IA 2J33A 1QZ3A 3S1AB 3EXFB 3HGTA 1RZVA 4MQBA 3GVPA 1TECE 5B36A 3GRRA 4D02A 2I2AA 2NPFA 5AICA 3MTBA 1DG1G 1JFFB 1UM8A 3S55A 4MVJG 1QUFA 1QVVA 4JQSA 3SNHA 4KMOA 3CEMA 1C0EA 5JASA 2OLEA 5DM1A 4N8EA 2B4KA 4QTXA 1GAJA 1E0KA 1KMCA 5CURA 4JJ4A 2I99A 2DUJA 3RSSA 5FQNA 2VQFM 1QFXA 3EXAA 2C2KA 2QZPA 3M9XA 2B1JA 4PS0A 4KOEC 2CNNA 3LPNA 4K0RA 2SKCA 1K9VF 5ES4B 1AKTA 1AG9A 2DFLA 3LO5A 4WZBA 4JNCA 3TFQA 1KY5A 2AW5A 2ZB4A 1PNOA 4MW1A 2WZBA 4GMQA 2WHQA 3D8TA 2QEQA 3BCSA 1F4PA 1NOIA 2A0UA 3MWKA 3W5HA 1PJRA 1GRNA 3BRSA 2G0TA 3ACBA 3CJQA 3U0VA 4IYJA 2XB4A 4GICA 2GKSA 1ENPA 4EHNA 1GPKA 5TY0A 1JDSA 4H17A 4IX1A 2J9XB 3HY5A 3L6CA 2WHPB 3AP3A 2BMJA 4C04A 4LYAA 3RREA 4F2PA 5A5FA 4L4XA 3WHLA 5DLPA 3CNLA 1U8TA 1L7XA 2AHMA 3D0OA 2PUBA 3L29A 3V4ZA 2AMLA 3FXAA 2IS1A 3PFCA 5E7IA 4Y9TA 3RE8A 4OBBA 2V1UA 1U0HC 4ARBA 4Q3AA 1CUKA 2EBUA 3SZMA 5JSZB 2I6TA 3FNEA 2QL5A 2QT1A 3LM8A 2FXVA 3O3CA 3E5RA 3AETB 3L4EA 4HGZA 2X8WA 5A9TA 3RYIA 1NRWA 3UJNA 4PO3X 3RNLA 1WUIS 1CB7A 4HF7A 3RFTA 4GI7A 4RK6A 3RPEA 3EOAI 3WRYA 1R6UA 1L8OA 1KPGA 1VB3A 3K8OE 3Q0TA 3QYBA 3NBXX 1NNLA 1C1XB 2CBXA 5JALA 4RIGA 4KI0A 3F7TA 1G21A 1Q16A 2VUIB 2NT4A 1MH1A 3LUDA 2VC2B 2HWXA 2O5VA 5LMUM 3R7BA 4RA9B 1Q3HA 2REBA 3ICPA 3C1AA 3FY4A 3QPDA 1WY5A 1T8SA 2EQ5A 3RVKA 4RH3A 1U90A 3CLTC 1Z5GA 3B6EA 4I8IA 3ZVNA 1F8UA 3MCUA 1ACLA 4A91A 3MERA 3R7AA 3AEXA 3E18A 1XEAA 3JAWB 4EO9A 5E3IA 2DEUA 2ZTCA 3F1LA 1E6KA 3D8RA 1HTBA 4M88A 3AQ4A 5HGXA 5BSVA 1BHSA 4NSNA 3B82A 1N2CB 2ZBEA 2Y0CA 4OYRA 3NW9A 2X4IA 2FWJA 3EWNA 1KSGA 2A88A 3IVXA 2OBMA 4OQ4A 2IX3A 3KSBC 5IUNC 5D7NA 4PZZA 3TOVA 2I62A 3KAPA 3KFLA 3DL7A 1QVRA 2O3JA 2VSYA 3F5FA 7REQB 1MX0A 4H35A 1QVAA 4DPMA 1N6LA 1F51E 4IKPA 3RS9A 5DDIP 5LUBA 3S28A 3AZOA 4LFAB 2EF0A 2Q2VA 5BWBA 3TKYA 2Q6LA 4O4HA 3GVXA 5FNZA 2IJGX 3WYAA 4OHCA 4NBTA 3ZWNA 1I80A 2HA7A 4M0MA 2Q49A 3QKIA 2HJRA 3A6PC 1V34A 3LVBA 2WFLB 4X91A 2JZ1A 3LQYA 4DCVA 4JJGA 1OD6A 1FJGB 3LIIA 5DN6D 1VG9B 1Z4QA 3PICA 4IJMA 2QRLA 4U7WA 4M0WA 5CNIA 3V1YA 4XD7D 4R0NA 1LW6E 2I6SA 2XWBF 3L0CA 3RQSA 4X1OA 3ZTYA 2VNJA 1OB5A 1EP3B 2Y1CA 3IV6A 1H05A 4MK4A 1G1MA 3Q8LA 2OVFA 3KSJA 1DCKA 1OLOA 1AX9A 4R16A 4XVHA 4PBSA 3DDCA 3PDIA 1WXIA 1KR2A 2E5LM 4UVHA 3ODGA 1J9EA 4DJDC 3BERA 2CV0A 5JZOA 1R8YA 1R4MB 1HRKA 1TYZA 4JL6A 4LZPA 2PYZA 5G0UA 1GPH1 4KYUA 4GR9A 1N1DA 2VDUE 2X49A 3AEZA 3WLPA 3C5HA 4LJ9A 4XSVA 2VYVD 2Z3WA 2QRGA 2H0RA 1C7JA 1Z2NX 1NF2A 4FNOA 4G4NA 1SEVA 3QIVA 2RH5A 2VJCA 4LXXA 5K5EA 1KJ9A 1WSAA 4IMJB 3B85A 4XDHA 3UA4A 1L0BA 2CVQA 3GV0A 2P78A 1FW6A 4PZYA 1PK9A 1TOAA 1KI1A 4BXOA 4B76A 1KDZA 4TWRA 3A2KA 1OIWA 1YE8A 1QHYA 4YT2A 4CGZA 1IVNA 4DR1M 2R6CA 3GLRA 4QXQA 1L4LA 1ZCBA 4EHBA 5AKGA 1MB3A 2FPUA 3L06A 2BFAA 3SMVA 2VHZA 3KJEA 1A9XA 5I8WA 1KY3A 1RWNA 4RV9A 3CKMA 3BE5A 3CO0S 1ZNXA 3GROA 2I2XB 3GLVA 2H3HA 4H7HA 2HMYB 5JSQA 3BK7A 2D2IA 2J9FB 5KCMA 4GVPA 3ADCA 4NJMA 4QXAA 2B1GA 4QDXA 3OKCA 1MEEA 4MPRA 4E70A 1OIZA 1T8RA 3B3AA 1JJVA 5EZ6B 3AF0A 4DCGA 4AMYA 3ZQJA 2AN9A 3OZDA 3HFGA 5KYUA 3OM9A 3HABA 5IKXA 1Z73A 1CD5A 3TR6A 2XVYA 1KYQA 1R5OA 4TT3A 4EUFA 4OXQA 4GI5A 2VZLA 3LT2A 4YO8A 4XKJA 2Z5VA 3OCWA 4K26A 3D3JA 2A59A 2Q3MA 3QPWA 5FORA 4RQUA 2OZKA 3IPRA 1N5IA 2OM2A 3HI6A 4GKVA 3ZDCA 1Y33E 3ANLA 3MLAA 3WKDA 2X3FA 2JBHA 4N5NA 4DJEC 1YQXA 5B4VA 1SBHA 3OQIA 2ZRFA 4C14A 1GYQA 3KQKA 1CKEA 3QXJA 3R41A 1Z5VA 2NUBA 3IAUA 4OYHA 5CM8B 4BZZA 1A9ZA 1R0ZA 1XDDA 4Z4GA 4JQCA 3DMYA 2YX1A 4XX0B 2IU6A 3VNUA 2GD1O 1TJYA 1KZ1A 1PYOA 1E7WA 3A28A 3DFFA 1XNRM 3DMPA 4E2YA 3B52X 1O1YA 4PD2A 4RPJA 4KO3S 4YRKA 4D9NA 2IIBA 3AGPA 4KN5A 4M0CA 2YW9A 2G5TA 4LYGA 4S04A 2VQ6A 4HN4B 3JYLA 3DMFA 4Q6WA 4WXRA 3NDRA 5A3RA 3G02A 4N3CA 2XZFA 2FSFA 2XF2A 4FZ5A 2W2PA 4IBBA 2QLFA 3ZHQA 4NU5A 1V1MA 3S40A 3ZZMA 2ZTVA 2PLNA 4ZICA 1GLNA 1DI0A 3VJKA 3M7IA 4GOXA 2VPZA 2QGNA 1IFYA 1G5QA 2GBLC 3NBKA 4ZIRB 1KFEB 4QOIA 1JEJA 13PKA 1DBVO 2ZJ3A 2ICAA 3Q3JB 1YE3A 3T4XA 4P32A 3O1IC 1G1AA 1W9MA 2PUGA 4CMCA 1OOEA 1ZJZA 5C31A 4UM8B 3AR4A 3LZDA 1IN5A 5JFGA 3I62A 2WWRA 4PSUA 1KGSA 4OLJA 2B36A 1G16A 2BEUB 4DE5A 5BW8A 4E7OA 2IS6A 2QSFX 4I50B 2HIHA 3FOEC 3CYFA 2IEGA 2HPAA 3QENA 1T6NA 3QE4A 2UXDM 2PRKA 3E61A 4Z0NA 2J08A 3HEBA 1RKQA 2PYDA 2UZIR 1VYHA 1G5PA 2P67A 3CGGA 2J09A 1QOZA 2JNWA 4HN2A 3UHJA 2GPBA 3NKFA 1SVNA 2P6MA 1WDLA 4EB3A 3CSDA 5B57C 1M83A 1TYCA 1UAAA 2D4HA 4IAOA 3T9CA 1CVRA 1GN8A 4FB5A 5DRTA 1LQ2A 3RAJA 5IZ4A 2Y4NA 4IDBA 4YS6A 4D3ZA 4KITB 4ONEA 1CR6A 3TYXA 3U5ZA 4PZCA 5BW6B 5BSUA 2H2DA 1BXGA 2CMHA 3UQZA 1GXSA 4MUIA 3FPGA 4I6JA 3CTMA 4QBIA 1QGED 2PPVA 3GL9A 1FXWA 2NQTA 3WV5A 4FWTA 2YWHA 3H05A 1OCEA 3W6ZA 2I6FA 2FCRA 4ZP1A 1FL9A 5A2QA 2NTEA 2LHGA 3RGWS 4N1AA 4HVLA 1FTQA 1R5LA 2Y6VA 1WCYA 4P7FA 3S8YA 1P74A 2RK6A 4DIKA 4PX5A 4OH1A 3LUJA 1WGNA 1B42A 4CIAA 4DB4A 2YHAA 1G66A 1JIUA 1V43A 1W8IA 3WQRA 3CB4A 4O02B 2ERXA 3Q87B 3L6RA 1LLDA 4LISA 5E38A 3VO2A 4JVMA 3ETHA 3K1AA 3L7JA 5C80A 1D2RA 1L5RA 3HVKA 3DDUA 1KAEA 2C57A 3NJRA 4E32A 2VH2A 2PBLA 1ZY2A 4ILKA 4PX2A 3RFFA 1FU7A 1BFDA 3CCFA 4EUNA 3TNFA 1GSOA 2Z58A 2BH9A 4LF6B 4JI2M 4D4GA 4XLZA 1WUYA 4U2GA 2DWLA 3ICEA 1PSZA 3KAKA 4OVKA 3EFOA 2C96A 4B7CA 3QV2A 1SOWA 1FJXA 2BC9A 3R7NA 3GLFB 2YZGA 1JWBB 3R0JA 5E2AA 1NLZA 3NORA 2DH6A 1Q1BA 3KWMA 1SIWA 1Z4NA 1E2DA 4FGLA 2H51A 1AQIA 3EYAA 2Q7OE 4H3HB 2AZMA 1N5LA 4HZUB 2GAJA 4Z6YA 5E1BA 1SG0A 3TW8A 1RR6A 4CV1A 3ESZA 1TAQA 1P4RA 1RVDA 4B81A 3H17A 5JCXA 1M1YE 4H0NA 1NYQA 3NUZA 2XUHA 2RMKA 3DFUA 5FOUA 4L51A 4JYPA 3VPHA 2NVOA 3DW1X 3MIZA 4L27A 2WTAA 4FMDB 5CP8A 4ZREA 2R6JA 1GADO 1WGLA 1CUIA 5CT5A 2QPLA 2SICE 4NTZA 5D5HA 2WIGA 5KHLB 4FYWA 3QKSB 1YBFA 4UU1A 5IT0A 3VV3A 1XC8A 4BFYA 4KFSA 2IA5A 4H3VA 4Q21A 4GLBA 2FX3A 4LOHA 1NVMB 1I32A 4F96A 2J1LA 1WAMA 3GRZA 3B9RA 2HQBA 4AW4A 2Q9UA 4G89A 3PXAA 3TDMA 5E0KB 3E7PA 4FKZA 1YZGA 2F67A 4EG3A 3DOEA 4B85A 4NJOA 2FPGA 2F3TA 4RA6B 5GAJA 1M72A 4V0RA 4NATA 4RSRA 3TLXA 4CQMA 1O9HA 4MYSA 4OVZA 3H11B 5DHRA 4QOSA 1T15A 5KVAA 3VSEA 4PRYA 2V9ZA 3BWBA 1KEVA 1UFVA 2CHFA 3R5FA 3RJ9A 4EG5A 1QO0A 2ZAMA 1U3TA 1LH0A 1B00A 5AKLA 4G01B 2OV1A 1CEQA 1GNRA 2DUUA 5JZBA 1M5RA 1GTRA 1G2OA 3TVTA 1JB0F 4TTAA 1OBOA 3PLNA 4GP7A 4U9UA 1N2IA 1QAMA 3DAFA 2E2WA 2WUDA 1RW4A 2I22A 4FZVA 3ONFA 3QVGA 3JXEA 4N0DA 1FFSA 3U4QB 2DTEA 2CF5A 1Z6PA 1MQSA 4BNTA 1UC9A 4AZ0B 2VG8A 3QXCA 1YC2A 1Y63A 4LXHA 2WMYA 2PWZA 2HRBA 2R00C 5CJ2A 4COKA 1GGEA 2WI8A 4CEIA 4GITA 1Q2UA 1RJ9B 1CY7A 3FLAA 4MRVA 3GLHA 2FOIC 2CL7X 1U9ZA 4F92B 4W5TA 4DLRA 3Q2IA 1OGIA 1YB7A 1FXSA 1TJNA 4O1IA 2EW8A 2P62A 2ODTX 2DQ4A 3VU1A 2ZI7A 1IWPB 3ZDBA 1HDXA 2VDBB 1OTRA 1XD2B 1ZCJA 1GQOA 1ISFA 1I1NA 2BT4A 5K9ZA 2ZCVA 2GDJA 4UZSA 2DJIA 2HMVA 2GKGA 4OSPA 4L57A 3IR5A 3IJPA 4FYKA 4M9QA 1TYAE 4D0RA 2IUEA 3GAZA 1ZD1A 2LR0A 3VYSB 2PZAA 1WU7A 1II8B 4KVAA 1IK6A 3MMXA 5T7BA 1OYWA 4YREA 2BF4A 3K71B 3K4QA 4IM7A 4XPIA 2ZS7A 4HNQA 3DNMA 2GR9A 2O9JA 4PFKA 4Q4JB 3UBTA 1T5DX 1PZMA 4EF6A 1JIJA 3I52A 3ID6C 2XMBA 2GB4A 3ZQ4A 1SB8A 4N0MA 2P9GA 1SVMA 1QUSA 1ZA1A 2B7BA 4CR8A 5DTEA 1DBSA 4DT1A 5TLSA 3X1DA 1SCUB 1WCWA 1PBTA 4TKZA 1MX1A 3FNRA 2YWDA 1PKEA 3KQQA 4EX7A 3WYFA 1AUVA 1HY3A 3ETNA 4HB0A 4JL8A 5HCNA 3U4MA 1Y4UA 1KA9H 4MDEA 2LCFA 4LSZA 1ZZEA 1DC8A 4DJTA 1IVYA 5IC5A 1ADCA 1YQQA 2OQ2A 3MJVA 3QSYA 3FJOA 1CJSA 2Z4RA 3TSZA 2EHDA 3AP1A 2KW0A 4AC9A 1SKBA 3HCNA 2XAUA 4I2VA 2FNAA 4B3MM 1IBSA 4M9XA 1I4DD 2R5NA 3FTQA 5IXYA 3VK7A 3NBQA 3PEEA 2FUKA 3LY9A 2Q5LA 4J1TA 4BBJA 2IDJA 3S4YA 3QTTA 4FGSA 1RE0A 4BE7B 1XZJA 1XHFA 1ABBA 3KK0A 3ICQB 4LJAA 1DTEA 4AJJA 5DV9A 3DEIA 4XLLA 3LNTA 1PFKA 4LX8A 4UBJA 4TWIA 3G6KA 3C24A 5HMLA 3HUDA 1E69A 1MO3A 1VHTA 3ZD6A 4TSRA 3G0HA 2FG6C 1VGQA 5KPTA 2WMDA 3QLUA 4L6IA 4Z1MA 1EX7A 3E5MA 3L7IA 3AUFA 6NULA 3KSXA 5BQOA 1GPYA 2C2MA 5JS2A 1O95D 1P4GA 2RHTA 1VFNA 3IULA 4ZWNA 4MPJA 3NP7A 3LOPA 3OX4A 3BGVA 2IVFA 4C7XA 1F38A 3LIPA 1WKBA 1P60A 4CZ2A 4JLNA 1EUCB 1Y3IA 4BE4A 3D6VA 5E1OA 4B2LA 4OUDB 3U40A 3NVKI 1XZAA 3FPCA 1SXPA 3KE8A 2REQA 2Z0MA 5GWXA 5ITTA 2KQUA 2YY5A 2RHHA 3C0KA 2UU9M 1MBZA 1FLVA 4ZQGA 1JDNA 5KQRA 3F71A 2EIHA 3ESBA 1SBQA 1XVUA 3ZK9A 4E12A 4Q93A 1SXGA 2AQ8A 4EKGA 4Y2QA 3OQBA 2Z6QA 2KZUA 1YOVA 4LFBM 1G7SA 4AQYB 2ID8A 4Z0HO 1O8CA 1WABA 5B3JC 2NVWA 3LRXA 4G8CA 2IWHA 2Q8PA 2DBZA 4G0ZA 4JSRA 1TQDA 4QPDA 5A4IS 1Z15A 2GHTA 2D7DA 5ITZB 3MINA 1GPNA 2OQRA 3WGHA 2QRUA 3HJQA 1ZCFA 4HFNA 4MQUA 1FK8A 2CBZA 1VSVA 2ZI3A 3FLEA 2W6OA 2DYKA 3DTVD 3GLSA 4R7GA 1TQ4A 1UPUA 2HEGA 2B8NA 4FK8A 5TMEA 4J2OA 4WFIA 4LRTA 3G8DA 3GIWA 1E6UA 4X00A 2KI5A 4R1OA 2YBEA 4EMUA 5BOSB 3GJ3A 3I92A 5ILGA 1MRSA 2Z2JA 2J3EA 2Q5EA 3TJMA 3GF4A 5I5GA 5KVQA 1QJCA 4FLFA 1A76A 2I7PA 2Y92A 2DLCX 5BP7A 2PWPA 3IRUA 4OI2A 2FEXA 5AQEA 4JR1A 4EYOA 2JIOA 1GZ4A 3U3RA 3N8NA 3TKLA 3KB8A 4ZOAA 1Q74A 3HZOA 1YGYA 1TAUA 2OCBA 1BA2A 1FFGA 3KJZA 3ZZNA 3L2AA 4MUBA 3K72B 4JNKA 3E6AA 1NJ2A 1FQJA 3J7TA 4EATA 3WGOA 3JYHA 3FWHA 3P9CA 3EH2A 4J0JA 2HBRA 4DLPA 2BP7B 3THOA 3TZKA 3FX2A 4KYTA 2HHHM 1C8VB 3A4VA 1NQTA 2R7MA