2FH0A

Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'GENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic regio
publication title Solution Structure of Saccharomyces cerevisiae Protein Ymr074cp
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2fh0A00
2JXNA 2K6BA 2FH0A 1EIJA 2CRUA
chains in the Genus database with same CATH superfamily
5ITTA 3HJ8A 1Q39A 2I7NA 4IBFA 3U5ZA 4B3MM 2FNAA 3CF6E 5KQ8A 2LXEA 4MH0E 2KXEA 2D7EA 3CF0A 4WURA 5H37D 4LF4M 3U6MA 2MJ5B 2R62A 2Q2EB 1XB2B 2QNJA 4B7GA 2UXCM 4CISA 2WSCF 3BOSA 2F5SA 3KDSE 2CHVA 3AOEA 4B7FA 4DV7M 4IBBA 3GLIE 4NXMM 3HWSA 2LH0A 3I51A 1SXJB 4FWHA 4JI3M 2QBYA 2BJWA 1T6OA 4GKJM 2Z8YM 1HQCA 3HY5A 1I94M 5KPTA 3GRVA 2CHQA 4TUWA 2UXDM 1Q3CA 2MR9A 3W68A 5BPVA 1E9RA 4LJ5A 4REZA 4DV2M 4M9ZA 2H5XA 1NHGC 3KW6A 1IN6A 1N36M 3I4VA 3U6EA 4Z6YA 1H6UA 1TH4A 4LRTA 2UXBM 1IM2A 3RGPA 3J81S 2EKKA 1IN7A 4LJ4A 1D0LA 4LF7M 3ZQJA 4G3OA 2P5TA 5EP3A 3SFZA 3TL4X 3KP0E 4MGIE 3W0LB 2DXIA 3GLHA 3U60A 3AOEC 4X65M 2R4EA 3L27A 1IN8A 4QNMA 1J5EM 4FWDA 3R8FA 1TF0B 3GPYA 2UUCM 2XFTA 3KS4A 4AKHA 3I01M 1Z5AA 4MGKE 3AL0C 2BWBA 2J7OA 3JR5A 3CF2A 2EA0A 1IBLM 4AW4A 2LWXA 3M7GA 3LVVA 2JNHA 1OIPA 2Z4SA 3FTCA 3FUUA 3B7ZA 3L29A 4DV1M 3CTWB 1QUSA 3HJSA 1GL7A 4RF1A 3DA1A 5EP2A 1HNXM 3HX3A 1L2CA 3FTEA 2ZTCA 1SXJA 4CHTB 1T43A 2L2DA 2LBCA 3FKEA 4G6ZA 1PJTA 2ZANA 4I4LA 2AHMA 1Z59A 2F5QA 1R6BX 1DO2A 5EXTA 1TH3A 4B3SM 2LHCA 2XFSA 2HWJA 2BJVA 2DWNA 3HU3A 1DGFA 1OFIA 3HHZA 1XC8A 5FTJA 3HHWA 4I81A 1IY1A 1VDDA 2NQ8C 3SATA 3DOAA 2V1CA 3KSXA 2HL7A 1WJ7A 3AFHA 2D7GA 1BVSA 3HZJA 3LVWA 4LJ9A 3D8BA 1DGGA 2XGNA 4AZFA 2L6OA 4ANRA 4CJ6A 4DR2M 4MGZE 2VIIA 4LFCM 1HT1E 2LVPC 1K3WA 4NRVA 1SG9A 1QZEA 2UUAM 4GHLA 2ZAOA 2CV2A 4CIZA 4DR5M 3HKPA 4JI6M 1JB0F 1G71A 2GNOA 2LVOC 2VDBB 3ZH9B 4DR7M 3U5ZB 2CUZA 3FUTA 2Y21A 3HJQA 4R71A 2HAKA 2QCUA 1YE9A 2XF3A 4JI8M 2YNMD 4AI6A 5BR8M 1MN3A 2DAKA 3UK6A 3FTDA 3FE3A 3SC3A 5IREB 5EXPA 3FRHA 2QBYB 1VEKA 4NRWA 3Q8XA 3HU2A 3AJIB 5E26A 4X66M 3GLFB 3U61A 4GMQA 3IG5A 4II7A 1WGLA 2APLA 4LGMA 3KFUG 2RRUA 4GEWA 1IXZA 4GIPA 1TR8A 1NO1A 1VDLA 4JI2M 1XXHA 1DGBA 5ITYA 3CGWA 4M9XA 1S3SA 4JI0M 1XWIA 1XNRM 3L2AA 4PD2A 4IBKA 2DVWB 3FD9A 2KNAA 2Y20A 4MM3B 3U60B 3J2PB 3K1JA 3SARA 3UJNA 3U6DA 2EJSA 2X4AA 4DV0M 2Z3XA 1N77A 3T1HM 2DHRA 2CV1A 1J7KA 3C9PA 5ITXA 1OAOC 4JN6A 7CATA 3GPXA 3PNVA 1R7RA 4XBOA 2C98A 2KNVA 1MU5A 1KSFX 2X49A 4FVMA 1AUAA 1IY2A 3A98B 3U6CA 3B7QA 1MJGM 4DBGB 3FYDA 1UFZA 5JI2E 2LNHC 2XLJA 2JWSA 2VQEM 2ERCA 2DAGA 2E5LM 4G4OA 1NJGA 1Q3BA 2W82A 3K9PA 5EXSA 3SHGB 1QAOA 3H4JA 3VLFB 4BB9A 1W5TA 4RF0A 3KSJA 3GLFA 4Y28F 4LGYA 2JXNA 4LJ8A 3C58A 1OQYA 3W0FA 3SBJA 3FYCA 3KVWA 3B7NA 2ZTDA 5EJCA 1ZMVA 1NHWC 2JY8A 1EIJA 2L4FA 2DKLA 1Z5BA 1F4IA 2CWBA 3TQSA 4FCVA 1XNQM 4AG6A 4OU7A 1QYRA 2JUJA 3ZC7B 4DV4M 1I4WA 3FUWA 3LCUA 3M6AA 3JR4A 2J7NA 5FTLA 3UZUA 1HNWM 1Q02A 2JY7A 2F5PA 4ITQA 4FWGA 3PXGA 1C1KA 4FCTA 1V33A 5EP1A 3AV0A 3OTOM 4OX9M 2DHYA 3U6QA 2VF8A 4PDIA 3GQ5A 5EP4A 3A42A 2I7PA 5DFLA 4MB7A 2C9CA 4OVZA 4K0KM 4Z8XA 3GLHE 1DGHA 2RGOA 5LMNM 2YQZA 2R18A 4IBGA 4NSOB 3AOGA 3HU1A 4AG5A 4G4NA 1WR1B 3A46A 4GHAA 2DWZB 4GRIA 4NC6A 2DZLA 2YR0A 1OKSA 3Q8GA 2KNZA 2JA2A 2L7HA 4MGHA 3LCVB 2G3QA 2XSZD 5DYGA 3U6SA 4GKKM 3GQ4A 3LMMA 3I4YA 4AQYM 1OJLA 4QHSA 1HT2E 2VF7A 4Q7JA 2DAMA 1SXJE 3U61B 5DYIA 4XK8F 1C7YA 4BBAA 1Y8GA 3MK6A 2DWLA 1NY5A 1IBKM 4BLCA 4IJFA 3LW5F 1TH2A 5FTNA 1NNUC 3EIHA 2JY6B 2OOBA 4LJAA 2Y0TA 3UGJA 1DO0A 1CUKA 3L25A 1HNZM 1XXHB 1IN5A 1NV9A 1NVMA 4IBDA 4RNAA 2V6ZM 1GJTA 1GABA 3KOXE 2J5YA 4IBIA 3RFWA 1PGYA 3D8LA 3LQQA 4CGYB 2QQ8A 2KZUA 1N78A 4I8OA 4X62M 2DZOB 3SMSA 3A45A 1G3IA 3BBZA 2MGWA 4WW0A 5IT9S 3QYEA 1QAQA 2Z7JA 3DFZA 5KQDA 1SXJD 3W67A 1QVRA 1NSFA 3IG8A 3VFDA 4GITA 1OIZA 1XMOM 2O25A 1Z6TA 3GPPA 1IXSB 2F5OA 3V76A 2XZUA 4NXNM 1TTEA 2WZJA 4L4UA 2KDLA 1PRBA 5IZ7D 5ITUA 2OO9A 2L4EA 3K8ZA 1GVNA 4P17A 3VDPA 4JV5M 1G8PA 2JP7A 2K9DA 3GO8A 3U6PA 3FRIA 3VK7A 1V92A 3FUVA 2RKOA 2XZFA 4W5WA 2DAEA 4DUZM 2LVAA 3F92A 2R0IA 1VG5A 1QAMA 3KOWE 4S12A 3MMPA 3SYLA 5C1BA 3NBXX 3L26A 2GQFA 3J7BA 1J09A 2F4VM 1D0MA 2LVNC 1ZMWA 1NY6A 3UMMA 1JR3E 1PM5A 5GKNA 2JY5A 3L28A 2CE7A 2QZ4A 1HJPA 3SAWA 2LVQD 4RKUF 4L78A 1T3TA 2DNAA 1VEGA 5FTMA 3TWLA 3GLGA 2MROB 2CV0A 3HHYA 2QSFX 2FOIC 3THGA 1XXHE 1G41A 4JI7M 4QOZC 2Y0QA 3RE8A 3SAUA 3FTFA 4YHHM 1ZAEA 1L1ZA 3E9SA 5F3WA 4OVZB 1FJGM 1IFYA 1DGHB 4YY3M 3M0EA 2FH0A 3DZDA 1IXSA 1R2YA 1W5SA 3FUXA 2Z4RA 4PCZA 3EIEA 1E9SA 3PVSA 2R6FA 5KO3A 5ITXE 3J7AS 1KYIA 2O01F 4LRSA 5DNYA 2UU9M 1ZV1A 3SHFA 1JR3D 3T15A 1VQ1A 4IJEA 1G4AE 2R46A 3B74A 1RU3A 4DV5M 4HEOA 1AIPC 2HKJA 2C99A 8CATA 3AKZA 1EE8A 3HGIA 1YSYA 3GLIA 2R4JA 4R3DA 1QANA 3MHVC 4NOOB 1N75A 2JZ0A 2KW0A 4KHPM 1K82A 3GLFE 2YFQA 3C3EA 4QNRA 3SAVA 1IQPA 1TGUA 2KRKA 2HHHM 3SMPA 2C96A 3GRYA 3RGSA 1KFVA 1L1TA 1IY0A 2BWEA 1TDHA 4FD2A 4QHTA 1OTRA 4F1IA 2RGHA 5C18A 3BXWA 1QDRA 2X8AA 5ITQA 4UN2B 2ZBKB 2HCBA 4D82A 1DV0A 3NWLA 3ZCBB 3VDUA 5IWAM 1PJIA 5E6JA 2XSZA 3QAUA 4DR6M 2LTUA 3KOZE 1WGNA 3TWKA 5FLXS 2UUBM 1R4GA 4JYAM 1D2NA 4B3TM 1QQWA 2N35A 4L16A 3VKHA 1JQJC 1PJSA 4LFBM 4NSRA 3TWMA 4DR1M 3VK8A 4OW0A 5FTKA 1TDZA 4P16A 1G59A 3VKGA 3WHLA 1QDTA 1GKIA 1N34M 1QZMA 1UM8A 2K47A 4KLNA 1P3QQ 1R2ZA 1K3XA 1OFHA 2XH9A 1Z5CA 2KHHA 3K2LA 4IBCA 1A5TA 1QUTA 2EO2A 1NNJA 3J27B 3TE6A 3U6LA 3R9XB 2MH8A 2D7HA 4LY6A 1XMQM 1NV8A 1GL6A 3IECA 1R5LA 1YLAA 3KP1E 3K92A 3JAMS 1FNNA 2QP9X 5FSWA 3GQ3A 4DV3M 1IBMM 3KS8A 4B3RM 4L15A 4L6V6 4LF6M 5JI3E 1HQYE 3GPUA 2FE8A 3HHXA 3C3DA 2O5RA 3E21A 1WXQA 2H1RA 3GP1A 4IBJA 2G5GX 1ZQ9A 1YUBA 2M5ZA 3QWLA 3K9OA 4R7GA 5KPZA 4DUYM 3GLGB 4JXJA 1IN4A 3TPZA 2BNKA 4PT5A 3KXEC 3T6PA 4X64M 2F5NA 5KPRA 2CP8A 2ZAMA 4JI5M 1NJFA 4LF8M 2R65A 2L09A 4AKIA 5L8RF 2R45A 1XHBA 4EIWA 5EQTA 4HL4A 4ZPXA 4WP2A 4D81A 4G4QA 4MGYE 2C5RA 2LHGA 4KO8A 4F2LA 5EXXA 1N32M 2K0BX 4AKGA 3PFIA 1MX0A 2CEAA 2KEBA 4LZZA 2JZ1A 4I5SA 1HR0M 4DR3M 1GJSA 4A3VB 2V1UA 2B3TA 2XEPA 4M0WA 1SXJC 3SYKA 1OAIA 2KRUA 2EKFA 2QENA 5LMUM 2DENA 4LJ7A 2G8LA 3B9PA 4B7HA 4D80A 3GRRA 4KODA 5ITRA 2ZM6M 2KA6B 3NBIA 3GLIB 3SASA 2R44A 4FCWA 4IBEA 4QOSA 1L2DA 1WIVA 2FFJA 4GC9A 4NL4H 1PJJA 4FW9A 1IXRC 4KT0F 4DV6M 4XGIA 3PNYA 2CHGA 1ORYB 2QHOB 2VQFM 2DWMA 4B08A 4L8RC 3B89A 4HLQA 1GLNA 2A5YB 4M9SA 2OPFA 2M60A 1LV7A 2WSEF 3E4RA 1E32A 1WHCA 2EUCA 3IHPA 1V34A 1ZMUA 2CFOA 4GH9A 2WSFF 1N33M 3KOYE 4LJ6A 4DR4M 1GO5A 1JR3A 1LTMA 1PJQA 2QPAA 1D0KA 1L8QA 3I04M 2OQ4A 1EFUB 3E46A 4JI1M 3GLGE 2C9OA 4LF9M 2L7IA 4PDGA 3LQRA 3T38A 4M0DA 1E94E 4LFAM 1L2BA 2KZSA 3QYBA 1X37A 2K6BA 3MJ5A 4JI4M 4LCBA 2OOAA 2FS1A 3WHKA 3GLHB 3GRUA 5A2QS 4LG2A 3T1YM 3H4MA 4GC5A 2DI0A 4IIWA 2DZNB 2DAIA 4LZJA 1VEJA 4LF5M 3J80S 3ILKA 4G4RA 3U6OA 2CRUA
chains in the Genus database with same CATH topology
2JXNA 2K6BA 2FH0A 1EIJA 2CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXN A;  2K6B A;  2FH0 A;  1EIJ A;  2CRU A; 
#chains in the Genus database with same CATH topology
 5ITT A;  3HJ8 A;  1Q39 A;  2I7N A;  4IBF A;  3U5Z A;  4B3M M;  2FNA A;  3CF6 E;  5KQ8 A;  2LXE A;  4MH0 E;  2KXE A;  2D7E A;  3CF0 A;  4WUR A;  5H37 D;  4LF4 M;  3U6M A;  2MJ5 B;  2R62 A;  2Q2E B;  1XB2 B;  2QNJ A;  4B7G A;  2UXC M;  4CIS A;  2WSC F;  3BOS A;  2F5S A;  3KDS E;  2CHV A;  3AOE A;  4B7F A;  4DV7 M;  4IBB A;  3GLI E;  4NXM M;  3HWS A;  2LH0 A;  3I51 A;  1SXJ B;  4FWH A;  4JI3 M;  2QBY A;  2BJW A;  1T6O A;  4GKJ M;  2Z8Y M;  1HQC A;  3HY5 A;  1I94 M;  5KPT A;  3GRV A;  2CHQ A;  4TUW A;  2UXD M;  1Q3C A;  2MR9 A;  3W68 A;  5BPV A;  1E9R A;  4LJ5 A;  4REZ A;  4DV2 M;  4M9Z A;  2H5X A;  1NHG C;  3KW6 A;  1IN6 A;  1N36 M;  3I4V A;  3U6E A;  4Z6Y A;  1H6U A;  1TH4 A;  4LRT A;  2UXB M;  1IM2 A;  3RGP A;  3J81 S;  2EKK A;  1IN7 A;  4LJ4 A;  1D0L A;  4LF7 M;  3ZQJ A;  4G3O A;  2P5T A;  5EP3 A;  3SFZ A;  3TL4 X;  3KP0 E;  4MGI E;  3W0L B;  2DXI A;  3GLH A;  3U60 A;  3AOE C;  4X65 M;  2R4E A;  3L27 A;  1IN8 A;  4QNM A;  1J5E M;  4FWD A;  3R8F A;  1TF0 B;  3GPY A;  2UUC M;  2XFT A;  3KS4 A;  4AKH A;  3I01 M;  1Z5A A;  4MGK E;  3AL0 C;  2BWB A;  2J7O A;  3JR5 A;  3CF2 A;  2EA0 A;  1IBL M;  4AW4 A;  2LWX A;  3M7G A;  3LVV A;  2JNH A;  1OIP A;  2Z4S A;  3FTC A;  3FUU A;  3B7Z A;  3L29 A;  4DV1 M;  3CTW B;  1QUS A;  3HJS A;  1GL7 A;  4RF1 A;  3DA1 A;  5EP2 A;  1HNX M;  3HX3 A;  1L2C A;  3FTE A;  2ZTC A;  1SXJ A;  4CHT B;  1T43 A;  2L2D A;  2LBC A;  3FKE A;  4G6Z A;  1PJT A;  2ZAN A;  4I4L A;  2AHM A;  1Z59 A;  2F5Q A;  1R6B X;  1DO2 A;  5EXT A;  1TH3 A;  4B3S M;  2LHC A;  2XFS A;  2HWJ A;  2BJV A;  2DWN A;  3HU3 A;  1DGF A;  1OFI A;  3HHZ A;  1XC8 A;  5FTJ A;  3HHW A;  4I81 A;  1IY1 A;  1VDD A;  2NQ8 C;  3SAT A;  3DOA A;  2V1C A;  3KSX A;  2HL7 A;  1WJ7 A;  3AFH A;  2D7G A;  1BVS A;  3HZJ A;  3LVW A;  4LJ9 A;  3D8B A;  1DGG A;  2XGN A;  4AZF A;  2L6O A;  4ANR A;  4CJ6 A;  4DR2 M;  4MGZ E;  2VII A;  4LFC M;  1HT1 E;  2LVP C;  1K3W A;  4NRV A;  1SG9 A;  1QZE A;  2UUA M;  4GHL A;  2ZAO A;  2CV2 A;  4CIZ A;  4DR5 M;  3HKP A;  4JI6 M;  1JB0 F;  1G71 A;  2GNO A;  2LVO C;  2VDB B;  3ZH9 B;  4DR7 M;  3U5Z B;  2CUZ A;  3FUT A;  2Y21 A;  3HJQ A;  4R71 A;  2HAK A;  2QCU A;  1YE9 A;  2XF3 A;  4JI8 M;  2YNM D;  4AI6 A;  5BR8 M;  1MN3 A;  2DAK A;  3UK6 A;  3FTD A;  3FE3 A;  3SC3 A;  5IRE B;  5EXP A;  3FRH A;  2QBY B;  1VEK A;  4NRW A;  3Q8X A;  3HU2 A;  3AJI B;  5E26 A;  4X66 M;  3GLF B;  3U61 A;  4GMQ A;  3IG5 A;  4II7 A;  1WGL A;  2APL A;  4LGM A;  3KFU G;  2RRU A;  4GEW A;  1IXZ A;  4GIP A;  1TR8 A;  1NO1 A;  1VDL A;  4JI2 M;  1XXH A;  1DGB A;  5ITY A;  3CGW A;  4M9X A;  1S3S A;  4JI0 M;  1XWI A;  1XNR M;  3L2A A;  4PD2 A;  4IBK A;  2DVW B;  3FD9 A;  2KNA A;  2Y20 A;  4MM3 B;  3U60 B;  3J2P B;  3K1J A;  3SAR A;  3UJN A;  3U6D A;  2EJS A;  2X4A A;  4DV0 M;  2Z3X A;  1N77 A;  3T1H M;  2DHR A;  2CV1 A;  1J7K A;  3C9P A;  5ITX A;  1OAO C;  4JN6 A;  7CAT A;  3GPX A;  3PNV A;  1R7R A;  4XBO A;  2C98 A;  2KNV A;  1MU5 A;  1KSF X;  2X49 A;  4FVM A;  1AUA A;  1IY2 A;  3A98 B;  3U6C A;  3B7Q A;  1MJG M;  4DBG B;  3FYD A;  1UFZ A;  5JI2 E;  2LNH C;  2XLJ A;  2JWS A;  2VQE M;  2ERC A;  2DAG A;  2E5L M;  4G4O A;  1NJG A;  1Q3B A;  2W82 A;  3K9P A;  5EXS A;  3SHG B;  1QAO A;  3H4J A;  3VLF B;  4BB9 A;  1W5T A;  4RF0 A;  3KSJ A;  3GLF A;  4Y28 F;  4LGY A;  2JXN A;  4LJ8 A;  3C58 A;  1OQY A;  3W0F A;  3SBJ A;  3FYC A;  3KVW A;  3B7N A;  2ZTD A;  5EJC A;  1ZMV A;  1NHW C;  2JY8 A;  1EIJ A;  2L4F A;  2DKL A;  1Z5B A;  1F4I A;  2CWB A;  3TQS A;  4FCV A;  1XNQ M;  4AG6 A;  4OU7 A;  1QYR A;  2JUJ A;  3ZC7 B;  4DV4 M;  1I4W A;  3FUW A;  3LCU A;  3M6A A;  3JR4 A;  2J7N A;  5FTL A;  3UZU A;  1HNW M;  1Q02 A;  2JY7 A;  2F5P A;  4ITQ A;  4FWG A;  3PXG A;  1C1K A;  4FCT A;  1V33 A;  5EP1 A;  3AV0 A;  3OTO M;  4OX9 M;  2DHY A;  3U6Q A;  2VF8 A;  4PDI A;  3GQ5 A;  5EP4 A;  3A42 A;  2I7P A;  5DFL A;  4MB7 A;  2C9C A;  4OVZ A;  4K0K M;  4Z8X A;  3GLH E;  1DGH A;  2RGO A;  5LMN M;  2YQZ A;  2R18 A;  4IBG A;  4NSO B;  3AOG A;  3HU1 A;  4AG5 A;  4G4N A;  1WR1 B;  3A46 A;  4GHA A;  2DWZ B;  4GRI A;  4NC6 A;  2DZL A;  2YR0 A;  1OKS A;  3Q8G A;  2KNZ A;  2JA2 A;  2L7H A;  4MGH A;  3LCV B;  2G3Q A;  2XSZ D;  5DYG A;  3U6S A;  4GKK M;  3GQ4 A;  3LMM A;  3I4Y A;  4AQY M;  1OJL A;  4QHS A;  1HT2 E;  2VF7 A;  4Q7J A;  2DAM A;  1SXJ E;  3U61 B;  5DYI A;  4XK8 F;  1C7Y A;  4BBA A;  1Y8G A;  3MK6 A;  2DWL A;  1NY5 A;  1IBK M;  4BLC A;  4IJF A;  3LW5 F;  1TH2 A;  5FTN A;  1NNU C;  3EIH A;  2JY6 B;  2OOB A;  4LJA A;  2Y0T A;  3UGJ A;  1DO0 A;  1CUK A;  3L25 A;  1HNZ M;  1XXH B;  1IN5 A;  1NV9 A;  1NVM A;  4IBD A;  4RNA A;  2V6Z M;  1GJT A;  1GAB A;  3KOX E;  2J5Y A;  4IBI A;  3RFW A;  1PGY A;  3D8L A;  3LQQ A;  4CGY B;  2QQ8 A;  2KZU A;  1N78 A;  4I8O A;  4X62 M;  2DZO B;  3SMS A;  3A45 A;  1G3I A;  3BBZ A;  2MGW A;  4WW0 A;  5IT9 S;  3QYE A;  1QAQ A;  2Z7J A;  3DFZ A;  5KQD A;  1SXJ D;  3W67 A;  1QVR A;  1NSF A;  3IG8 A;  3VFD A;  4GIT A;  1OIZ A;  1XMO M;  2O25 A;  1Z6T A;  3GPP A;  1IXS B;  2F5O A;  3V76 A;  2XZU A;  4NXN M;  1TTE A;  2WZJ A;  4L4U A;  2KDL A;  1PRB A;  5IZ7 D;  5ITU A;  2OO9 A;  2L4E A;  3K8Z A;  1GVN A;  4P17 A;  3VDP A;  4JV5 M;  1G8P A;  2JP7 A;  2K9D A;  3GO8 A;  3U6P A;  3FRI A;  3VK7 A;  1V92 A;  3FUV A;  2RKO A;  2XZF A;  4W5W A;  2DAE A;  4DUZ M;  2LVA A;  3F92 A;  2R0I A;  1VG5 A;  1QAM A;  3KOW E;  4S12 A;  3MMP A;  3SYL A;  5C1B A;  3NBX X;  3L26 A;  2GQF A;  3J7B A;  1J09 A;  2F4V M;  1D0M A;  2LVN C;  1ZMW A;  1NY6 A;  3UMM A;  1JR3 E;  1PM5 A;  5GKN A;  2JY5 A;  3L28 A;  2CE7 A;  2QZ4 A;  1HJP A;  3SAW A;  2LVQ D;  4RKU F;  4L78 A;  1T3T A;  2DNA A;  1VEG A;  5FTM A;  3TWL A;  3GLG A;  2MRO B;  2CV0 A;  3HHY A;  2QSF X;  2FOI C;  3THG A;  1XXH E;  1G41 A;  4JI7 M;  4QOZ C;  2Y0Q A;  3RE8 A;  3SAU A;  3FTF A;  4YHH M;  1ZAE A;  1L1Z A;  3E9S A;  5F3W A;  4OVZ B;  1FJG M;  1IFY A;  1DGH B;  4YY3 M;  3M0E A;  2FH0 A;  3DZD A;  1IXS A;  1R2Y A;  1W5S A;  3FUX A;  2Z4R A;  4PCZ A;  3EIE A;  1E9S A;  3PVS A;  2R6F A;  5KO3 A;  5ITX E;  3J7A S;  1KYI A;  2O01 F;  4LRS A;  5DNY A;  2UU9 M;  1ZV1 A;  3SHF A;  1JR3 D;  3T15 A;  1VQ1 A;  4IJE A;  1G4A E;  2R46 A;  3B74 A;  1RU3 A;  4DV5 M;  4HEO A;  1AIP C;  2HKJ A;  2C99 A;  8CAT A;  3AKZ A;  1EE8 A;  3HGI A;  1YSY A;  3GLI A;  2R4J A;  4R3D A;  1QAN A;  3MHV C;  4NOO B;  1N75 A;  2JZ0 A;  2KW0 A;  4KHP M;  1K82 A;  3GLF E;  2YFQ A;  3C3E A;  4QNR A;  3SAV A;  1IQP A;  1TGU A;  2KRK A;  2HHH M;  3SMP A;  2C96 A;  3GRY A;  3RGS A;  1KFV A;  1L1T A;  1IY0 A;  2BWE A;  1TDH A;  4FD2 A;  4QHT A;  1OTR A;  4F1I A;  2RGH A;  5C18 A;  3BXW A;  1QDR A;  2X8A A;  5ITQ A;  4UN2 B;  2ZBK B;  2HCB A;  4D82 A;  1DV0 A;  3NWL A;  3ZCB B;  3VDU A;  5IWA M;  1PJI A;  5E6J A;  2XSZ A;  3QAU A;  4DR6 M;  2LTU A;  3KOZ E;  1WGN A;  3TWK A;  5FLX S;  2UUB M;  1R4G A;  4JYA M;  1D2N A;  4B3T M;  1QQW A;  2N35 A;  4L16 A;  3VKH A;  1JQJ C;  1PJS A;  4LFB M;  4NSR A;  3TWM A;  4DR1 M;  3VK8 A;  4OW0 A;  5FTK A;  1TDZ A;  4P16 A;  1G59 A;  3VKG A;  3WHL A;  1QDT A;  1GKI A;  1N34 M;  1QZM A;  1UM8 A;  2K47 A;  4KLN A;  1P3Q Q;  1R2Z A;  1K3X A;  1OFH A;  2XH9 A;  1Z5C A;  2KHH A;  3K2L A;  4IBC A;  1A5T A;  1QUT A;  2EO2 A;  1NNJ A;  3J27 B;  3TE6 A;  3U6L A;  3R9X B;  2MH8 A;  2D7H A;  4LY6 A;  1XMQ M;  1NV8 A;  1GL6 A;  3IEC A;  1R5L A;  1YLA A;  3KP1 E;  3K92 A;  3JAM S;  1FNN A;  2QP9 X;  5FSW A;  3GQ3 A;  4DV3 M;  1IBM M;  3KS8 A;  4B3R M;  4L15 A;  4L6V 6;  4LF6 M;  5JI3 E;  1HQY E;  3GPU A;  2FE8 A;  3HHX A;  3C3D A;  2O5R A;  3E21 A;  1WXQ A;  2H1R A;  3GP1 A;  4IBJ A;  2G5G X;  1ZQ9 A;  1YUB A;  2M5Z A;  3QWL A;  3K9O A;  4R7G A;  5KPZ A;  4DUY M;  3GLG B;  4JXJ A;  1IN4 A;  3TPZ A;  2BNK A;  4PT5 A;  3KXE C;  3T6P A;  4X64 M;  2F5N A;  5KPR A;  2CP8 A;  2ZAM A;  4JI5 M;  1NJF A;  4LF8 M;  2R65 A;  2L09 A;  4AKI A;  5L8R F;  2R45 A;  1XHB A;  4EIW A;  5EQT A;  4HL4 A;  4ZPX A;  4WP2 A;  4D81 A;  4G4Q A;  4MGY E;  2C5R A;  2LHG A;  4KO8 A;  4F2L A;  5EXX A;  1N32 M;  2K0B X;  4AKG A;  3PFI A;  1MX0 A;  2CEA A;  2KEB A;  4LZZ A;  2JZ1 A;  4I5S A;  1HR0 M;  4DR3 M;  1GJS A;  4A3V B;  2V1U A;  2B3T A;  2XEP A;  4M0W A;  1SXJ C;  3SYK A;  1OAI A;  2KRU A;  2EKF A;  2QEN A;  5LMU M;  2DEN A;  4LJ7 A;  2G8L A;  3B9P A;  4B7H A;  4D80 A;  3GRR A;  4KOD A;  5ITR A;  2ZM6 M;  2KA6 B;  3NBI A;  3GLI B;  3SAS A;  2R44 A;  4FCW A;  4IBE A;  4QOS A;  1L2D A;  1WIV A;  2FFJ A;  4GC9 A;  4NL4 H;  1PJJ A;  4FW9 A;  1IXR C;  4KT0 F;  4DV6 M;  4XGI A;  3PNY A;  2CHG A;  1ORY B;  2QHO B;  2VQF M;  2DWM A;  4B08 A;  4L8R C;  3B89 A;  4HLQ A;  1GLN A;  2A5Y B;  4M9S A;  2OPF A;  2M60 A;  1LV7 A;  2WSE F;  3E4R A;  1E32 A;  1WHC A;  2EUC A;  3IHP A;  1V34 A;  1ZMU A;  2CFO A;  4GH9 A;  2WSF F;  1N33 M;  3KOY E;  4LJ6 A;  4DR4 M;  1GO5 A;  1JR3 A;  1LTM A;  1PJQ A;  2QPA A;  1D0K A;  1L8Q A;  3I04 M;  2OQ4 A;  1EFU B;  3E46 A;  4JI1 M;  3GLG E;  2C9O A;  4LF9 M;  2L7I A;  4PDG A;  3LQR A;  3T38 A;  4M0D A;  1E94 E;  4LFA M;  1L2B A;  2KZS A;  3QYB A;  1X37 A;  2K6B A;  3MJ5 A;  4JI4 M;  4LCB A;  2OOA A;  2FS1 A;  3WHK A;  3GLH B;  3GRU A;  5A2Q S;  4LG2 A;  3T1Y M;  3H4M A;  4GC5 A;  2DI0 A;  4IIW A;  2DZN B;  2DAI A;  4LZJ A;  1VEJ A;  4LF5 M;  3J80 S;  3ILK A;  4G4R A;  3U6O A;  2CRU A; 
#chains in the Genus database with same CATH homology
 2JXN A;  2K6B A;  2FH0 A;  1EIJ A;  2CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...