2FH0A

Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic regio
publication title Solution Structure of Saccharomyces cerevisiae Protein Ymr074cp
rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2fh0A00
2JXNA 1EIJA 2K6BA 2CRUA 2FH0A
chains in the Genus database with same CATH superfamily
1WIVA 1DGHB 2KHHA 3AOGA 4M9SA 5EQTA 3FD9A 2QHOB 4JI5M 3FTDA 1EFUB 2L2DA 2EJSA 3UJNA 4XK8F 3VKGA 5E26A 1Z59A 1QDRA 3VDPA 2BWBA 4GH9A 2VQEM 3BOSA 2F5SA 1GVNA 4R7GA 3DZDA 3THGA 2VQFM 2K0BX 4MH0E 1E9RA 3WHLA 3KS8A 1OFHA 4XBOA 1V34A 3GQ3A 4GHAA 2I7PA 1WHCA 4IBIA 2EKFA 2X4AA 2Z4SA 3T38A 3GO8A 1NO1A 4FCVA 1NNJA 1SXJC 1N33M 4IBGA 2JP7A 2R18A 2QBYA 1NHGC 5EXSA 4I5SA 1SG9A 3K9PA 4KT0F 1QYRA 4DV3M 3FE3A 3GLHA 4LRTA 2Z8YM 5DNYA 2BWEA 1ORYB 2DAKA 4A3VB 2LTUA 4AZFA 1NJFA 1SXJD 2DZNB 2Q2EB 2CV2A 2OPFA 1Z5BA 2XSZA 2MGWA 3B89A 1XHBA 2APLA 2QZ4A 1FNNA 4AG5A 1GL7A 2DWNA 1DGBA 1OIPA 3ZC7B 2JY8A 3FUWA 2R44A 1XXHB 2KRKA 4REZA 4ANRA 3J81S 3OTOM 1TDZA 5LMUM 1IBMM 3V76A 4RKUF 2BJVA 2HCBA 1WGNA 4LRSA 2R65A 4BLCA 3B9PA 2F5PA 4DR5M 1N36M 1QDTA 4L6V6 3K8ZA 2RGOA 2W82A 4FCWA 5EJCA 2UUCM 1P3QQ 1PJQA 1L2DA 3KXEC 4MGKE 5BR8M 1VDDA 4GMQA 2QSFX 3U60A 1TH3A 1GL6A 4B3TM 3L27A 5C1BA 2LWXA 4II7A 5IZ7D 4M0WA 1OJLA 1D2NA 4JI7M 4NXMM 3W67A 3RE8A 3JR4A 1NSFA 4AQYM 3D8LA 5EP2A 3E46A 1G71A 2BJWA 1TH2A 1ZMWA 3AOEA 3VK7A 2DKLA 2ZAOA 2DXIA 2FS1A 4Q7JA 3L25A 4D82A 1Z5AA 3E4RA 3GPXA 3R9XB 3FRIA 4AI6A 5L8RF 1YLAA 1AUAA 2P5TA 4GC5A 2JWSA 3PNYA 3GLGA 1HNWM 1L2CA 2A5YB 3KOXE 5DFLA 2DI0A 4OU7A 1JQJC 1KSFX 3FTCA 3GRUA 4IBEA 5EP1A 1XMQM 5KPZA 1Y8GA 4LF8M 2UU9M 4DV6M 1PM5A 1OKSA 1NY6A 2J7OA 2JXNA 3LCVB 1OTRA 4S12A 4JN6A 2Y21A 3T6PA 4JV5M 3U6CA 2D7GA 4QOZC 5C18A 2MROB 4LY6A 2UXBM 3Q8GA 1E94E 3HZJA 3I4YA 5LMNM 1WXQA 2LVQD 1SXJA 3W0FA 3U6LA 2MJ5B 3HWSA 3QWLA 2R46A 4NXNM 1C7YA 1HJPA 4JI0M 1L1TA 3SAWA 2ERCA 4DV1M 1J09A 4B3SM 3DA1A 1WR1B 3W0LB 4IJFA 2M5ZA 4D81A 4YHHM 1Q39A 4K0KM 1PGYA 5FTJA 3M6AA 2WZJA 4IIWA 1IY0A 2XSZD 1TF0B 1QQWA 3KW6A 1IN8A 1DGFA 2CE7A 3TWKA 1I4WA 3HGIA 5H37D 1NJGA 2JY5A 3NBIA 1JR3E 2Y0QA 2NQ8C 3A98B 4LJAA 4I8OA 1IN5A 5JI3E 4LF7M 3A45A 4D80A 2YR0A 1IFYA 3VLFB 2CFOA 2LVAA 4GITA 4X64M 1R2YA 5FSWA 1CUKA 4FWHA 3T1HM 5FTMA 4B7FA 2XEPA 1DV0A 1VEGA 2VF8A 3UGJA 1RU3A 4I4LA 3U5ZA 3L29A 1YSYA 4P17A 3GLFA 3U6MA 3GPYA 2L7IA 1GKIA 3GRVA 1L8QA 1ZMVA 1MU5A 2FE8A 1L2BA 3SASA 5ITTA 1D0MA 3KP1E 2KZUA 4M9ZA 2CHVA 2WSFF 3F92A 4MM3B 1DGGA 1XXHA 1VEJA 4OW0A 3Q8XA 3L26A 4DR2M 4L4UA 1LV7A 1QANA 1G4AE 2KEBA 3K9OA 2C5RA 1NY5A 2L6OA 1N78A 2M60A 2GNOA 4DUZM 4DV7M 2JNHA 1K82A 3KOZE 2FNAA 4KHPM 1N75A 4JI1M 4NSRA 2OO9A 5KQ8A 1VG5A 4AKHA 2QNJA 2CV0A 2VDBB 4PDGA 2RGHA 3GLIB 4DV0M 1IN6A 3LVWA 4CGYB 3MMPA 4LJ9A 2KNAA 3CF6E 4PCZA 2ZAMA 1XNRM 4B7GA 2JUJA 1IQPA 1MN3A 1VEKA 3MK6A 2D7HA 3J27B 5EXXA 1QZEA 5ITXE 1LTMA 4FWGA 1TTEA 1ZMUA 4LF5M 1TDHA 3FRHA 3I01M 4JI4M 4B3RM 2R45A 5DYGA 1XC8A 4LZJA 3NWLA 2MR9A 2YNMD 3U61B 1BVSA 2KA6B 3DOAA 4NL4H 1OFIA 3QYEA 3HU3A 4NRVA 1QAQA 2R0IA 2HL7A 3SYLA 2ZM6M 3SBJA 1IN7A 1R7RA 1IXSB 1TR8A 3GQ5A 1EIJA 2DAGA 4I81A 1VDLA 1QAOA 3LMMA 3AL0C 2EKKA 5FTNA 3GLIE 4LFCM 2LH0A 3VK8A 3KOWE 1D0KA 3I04M 4MGIE 3IHPA 4DR7M 2EUCA 4QHSA 2F5OA 4IJEA 2FOIC 2CUZA 1HT2E 4ITQA 3KOYE 3L28A 3ZH9B 4G4OA 3A42A 4QOSA 4L8RC 2C96A 3U6OA 1AIPC 3KSXA 3TQSA 4LJ6A 3LCUA 1YE9A 2XFSA 1PJTA 2V1UA 2DWMA 1IBLM 4B7HA 2LVPC 2F5QA 2QCUA 4UN2B 5ITYA 1GJTA 5FLXS 3LQQA 1T43A 4P16A 4AW4A 2UXCM 3GPPA 1Z6TA 3IG5A 3FUTA 4AKIA 1QUTA 4LGMA 1HQYE 1PJSA 2LXEA 4LZZA 4OVZA 4RF0A 5A2QS 1E32A 1EE8A 4Y28F 1QZMA 4NSOB 4DR3M 3PVSA 1K3XA 5IT9S 1IM2A 3A46A 2QBYB 1J5EM 4GEWA 3GPUA 2G8LA 2HWJA 3AFHA 4PD2A 1NNUC 1R2ZA 3CGWA 3GLHB 3GLFE 1N34M 1Z5CA 3U6QA 3FYDA 2Y0TA 4L15A 5KPTA 2AHMA 2LVNC 4KLNA 1ZV1A 3TE6A 1WJ7A 4IBKA 1IXRC 3KFUG 4R71A 4CHTB 1OIZA 3H4MA 4HLQA 4GC9A 3J2PB 1IY1A 3QYBA 3B7QA 3NBXX 1DGHA 5FTKA 3SAVA 3FTEA 4DV2M 2L4EA 1D0LA 2DAEA 3RFWA 3KDSE 4JI8M 3M7GA 3PXGA 3FTFA 2QPAA 3H4JA 1DO0A 1R5LA 2BNKA 2CRUA 2Z4RA 3GRRA 4JXJA 5ITUA 3U60B 4EIWA 1HQCA 1R4GA 3JAMS 2VIIA 2N35A 3ZCBB 2E5LM 2J5YA 4FVMA 4W5WA 4B08A 2HAKA 2XH9A 3U6EA 3GLHE 1PJIA 2QP9X 4X65M 1K3WA 1JR3D 3PFIA 2C9OA 4LGYA 4DV5M 3HU2A 2HKJA 4ZPXA 1X37A 2OOBA 4LCBA 4HEOA 4WP2A 2QENA 2H5XA 2C99A 2DZOB 2Z3XA 3T15A 1V92A 4HL4A 4FWDA 2B3TA 2V1CA 3WHKA 2O5RA 1H6UA 3VFDA 1IY2A 4LJ5A 4LJ7A 3ILKA 3LQRA 3U61A 4LJ4A 5BPVA 4GHLA 3C9PA 2UUAM 3HJQA 3SFZA 4R3DA 4TUWA 2K9DA 2X49A 2R4JA 2Y20A 3HKPA 5KQDA 3CF2A 2DHYA 1G8PA 1C1KA 4G4QA 1IXSA 1OQYA 1T6OA 1A5TA 2DNAA 2WSEF 2XLJA 2DVWB 3HU1A 1SXJB 4AKGA 3HJSA 1UFZA 2OOAA 3FUXA 2XFTA 1KFVA 1N32M 1NV8A 4MGHA 1Q02A 2XZUA 1PJJA 3EIHA 2JZ1A 1PRBA 4LJ8A 2DHRA 2DAMA 2CEAA 4BB9A 4PDIA 3DFZA 8CATA 3GQ4A 3T1YM 4JYAM 3GLGE 2CV1A 1UM8A 2JZ0A 2EA0A 1HNZM 3SARA 1V33A 2O01F 1T3TA 4DBGB 4WURA 3UMMA 4IBCA 3LW5F 3FYCA 4Z8XA 4DR1M 1GO5A 3GP1A 2R62A 3MJ5A 3RGPA 4KO8A 3SMSA 3UK6A 2I7NA 3HJ8A 4IBJA 2F5NA 3M0EA 1JR3A 5EXPA 1HNXM 3HX3A 4IBDA 5EXTA 5KPRA 1SXJE 1GJSA 4CJ6A 2WSCF 1ZQ9A 2LHGA 4G4NA 1YUBA 3IG8A 4FD2A 3U5ZB 1IBKM 2XZFA 2UXDM 1QVRA 2RRUA 3KVWA 3J80S 3C3EA 3GLFB 5F3WA 4G6ZA 2KNZA 3RGSA 2UUBM 2JY7A 3U6PA 2DWLA 2DAIA 4G3OA 4M9XA 4CIZA 3EIEA 4NRWA 4DR6M 3K1JA 3TWLA 2ZANA 2EO2A 1L1ZA 2CWBA 1TH4A 2ZTDA 3U6SA 4JI3M 3B7NA 3CF0A 3E9SA 3B7ZA 5KO3A 3HHZA 4XGIA 4LF4M 1ZAEA 1NHWC 3SATA 2VF7A 4RF1A 5DYIA 4LF9M 1HR0M 1Q3CA 3K2LA 3FKEA 3TPZA 4YY3M 1QUSA 4GKJM 2CP8A 4DV4M 1XNQM 5JI2E 3PNVA 1NVMA 1F4IA 4QNRA 5FTLA 3R8FA 3HY5A 2V6ZM 3D8BA 4F2LA 2K6BA 1E9SA 3HHWA 2C9CA 2DWZB 1XMOM 1S3SA 1FJGM 2JY6B 2LHCA 2HHHM 3C3DA 4DUYM 2LBCA 4CISA 2OQ4A 3SYKA 3VDUA 4PT5A 5E6JA 3AJIB 2ZBKB 2FH0A 4BBAA 2H1RA 1GLNA 2X8AA 1Q3BA 3B74A 4IBBA 3MHVC 1XXHE 2F4VM 2L09A 3ZQJA 2MH8A 2R6FA 1G3IA 3IECA 3JR5A 3HHXA 5ITXA 3K92A 4JI2M 4LFBM 1HT1E 1TGUA 7CATA 1N77A 1KYIA 2KNVA 5EP3A 3FUUA 1DO2A 2DENA 3KSJA 2YQZA 3TL4X 4QHTA 1MJGM 1OAOC 4FCTA 2CHGA 2KDLA 2L4FA 2YFQA 1MX0A 1NV9A 5IREB 2LVOC 3GRYA 4JI6M 4X62M 3SMPA 2XF3A 3E21A 5IWAM 2L7HA 4Z6YA 2KW0A 4F1IA 2GQFA 2LNHC 2G5GX 3GLIA 3L2AA 4B3MM 1G59A 2D7EA 1XWIA 4NC6A 1J7KA 3HHYA 2RKOA 4AG6A 2XGNA 3SC3A 4LF6M 3UZUA 2JA2A 3BXWA 3SAUA 3J7BA 1XB2B 3SHFA 4NOOB 1W5TA 4M0DA 2G3QA 2KZSA 4RNAA 3VKHA 4OX9M 1WGLA 4DR4M 4WW0A 2R4EA 5ITQA 3GLGB 1G41A 2K47A 4G4RA 1GABA 4X66M 4OVZB 2J7NA 3I4VA 3U6DA 1IXZA 3FUVA 1W5SA 4GRIA 4QNMA 3TWMA 3BBZA 1OAIA 2C98A 5GKNA 2QQ8A 2O25A 4LFAM 3I51A 3AV0A 2FFJA 1VQ1A 3J7AS 1IN4A 4L78A 4LG2A 2ZTCA 4GKKM 1I94M 5EP4A 4IBFA 4MGYE 3AKZA 5ITRA 1R6BX 2DZLA 4KODA 3KS4A 3SHGB 4MB7A 3W68A 3CTWB 1QAMA 3AOEC 4GIPA 4MGZE 2KXEA 1JB0F 3LVVA 2CHQA 2KRUA 3KP0E 3QAUA 4FW9A 4L16A 3C58A 2Z7JA
chains in the Genus database with same CATH topology
2JXNA 1EIJA 2K6BA 2CRUA 2FH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXN A;  1EIJ A;  2K6B A;  2CRU A;  2FH0 A; 
#chains in the Genus database with same CATH topology
 1WIV A;  1DGH B;  2KHH A;  3AOG A;  4M9S A;  5EQT A;  3FD9 A;  2QHO B;  4JI5 M;  3FTD A;  1EFU B;  2L2D A;  2EJS A;  3UJN A;  4XK8 F;  3VKG A;  5E26 A;  1Z59 A;  1QDR A;  3VDP A;  2BWB A;  4GH9 A;  2VQE M;  3BOS A;  2F5S A;  1GVN A;  4R7G A;  3DZD A;  3THG A;  2VQF M;  2K0B X;  4MH0 E;  1E9R A;  3WHL A;  3KS8 A;  1OFH A;  4XBO A;  1V34 A;  3GQ3 A;  4GHA A;  2I7P A;  1WHC A;  4IBI A;  2EKF A;  2X4A A;  2Z4S A;  3T38 A;  3GO8 A;  1NO1 A;  4FCV A;  1NNJ A;  1SXJ C;  1N33 M;  4IBG A;  2JP7 A;  2R18 A;  2QBY A;  1NHG C;  5EXS A;  4I5S A;  1SG9 A;  3K9P A;  4KT0 F;  1QYR A;  4DV3 M;  3FE3 A;  3GLH A;  4LRT A;  2Z8Y M;  5DNY A;  2BWE A;  1ORY B;  2DAK A;  4A3V B;  2LTU A;  4AZF A;  1NJF A;  1SXJ D;  2DZN B;  2Q2E B;  2CV2 A;  2OPF A;  1Z5B A;  2XSZ A;  2MGW A;  3B89 A;  1XHB A;  2APL A;  2QZ4 A;  1FNN A;  4AG5 A;  1GL7 A;  2DWN A;  1DGB A;  1OIP A;  3ZC7 B;  2JY8 A;  3FUW A;  2R44 A;  1XXH B;  2KRK A;  4REZ A;  4ANR A;  3J81 S;  3OTO M;  1TDZ A;  5LMU M;  1IBM M;  3V76 A;  4RKU F;  2BJV A;  2HCB A;  1WGN A;  4LRS A;  2R65 A;  4BLC A;  3B9P A;  2F5P A;  4DR5 M;  1N36 M;  1QDT A;  4L6V 6;  3K8Z A;  2RGO A;  2W82 A;  4FCW A;  5EJC A;  2UUC M;  1P3Q Q;  1PJQ A;  1L2D A;  3KXE C;  4MGK E;  5BR8 M;  1VDD A;  4GMQ A;  2QSF X;  3U60 A;  1TH3 A;  1GL6 A;  4B3T M;  3L27 A;  5C1B A;  2LWX A;  4II7 A;  5IZ7 D;  4M0W A;  1OJL A;  1D2N A;  4JI7 M;  4NXM M;  3W67 A;  3RE8 A;  3JR4 A;  1NSF A;  4AQY M;  3D8L A;  5EP2 A;  3E46 A;  1G71 A;  2BJW A;  1TH2 A;  1ZMW A;  3AOE A;  3VK7 A;  2DKL A;  2ZAO A;  2DXI A;  2FS1 A;  4Q7J A;  3L25 A;  4D82 A;  1Z5A A;  3E4R A;  3GPX A;  3R9X B;  3FRI A;  4AI6 A;  5L8R F;  1YLA A;  1AUA A;  2P5T A;  4GC5 A;  2JWS A;  3PNY A;  3GLG A;  1HNW M;  1L2C A;  2A5Y B;  3KOX E;  5DFL A;  2DI0 A;  4OU7 A;  1JQJ C;  1KSF X;  3FTC A;  3GRU A;  4IBE A;  5EP1 A;  1XMQ M;  5KPZ A;  1Y8G A;  4LF8 M;  2UU9 M;  4DV6 M;  1PM5 A;  1OKS A;  1NY6 A;  2J7O A;  2JXN A;  3LCV B;  1OTR A;  4S12 A;  4JN6 A;  2Y21 A;  3T6P A;  4JV5 M;  3U6C A;  2D7G A;  4QOZ C;  5C18 A;  2MRO B;  4LY6 A;  2UXB M;  3Q8G A;  1E94 E;  3HZJ A;  3I4Y A;  5LMN M;  1WXQ A;  2LVQ D;  1SXJ A;  3W0F A;  3U6L A;  2MJ5 B;  3HWS A;  3QWL A;  2R46 A;  4NXN M;  1C7Y A;  1HJP A;  4JI0 M;  1L1T A;  3SAW A;  2ERC A;  4DV1 M;  1J09 A;  4B3S M;  3DA1 A;  1WR1 B;  3W0L B;  4IJF A;  2M5Z A;  4D81 A;  4YHH M;  1Q39 A;  4K0K M;  1PGY A;  5FTJ A;  3M6A A;  2WZJ A;  4IIW A;  1IY0 A;  2XSZ D;  1TF0 B;  1QQW A;  3KW6 A;  1IN8 A;  1DGF A;  2CE7 A;  3TWK A;  1I4W A;  3HGI A;  5H37 D;  1NJG A;  2JY5 A;  3NBI A;  1JR3 E;  2Y0Q A;  2NQ8 C;  3A98 B;  4LJA A;  4I8O A;  1IN5 A;  5JI3 E;  4LF7 M;  3A45 A;  4D80 A;  2YR0 A;  1IFY A;  3VLF B;  2CFO A;  2LVA A;  4GIT A;  4X64 M;  1R2Y A;  5FSW A;  1CUK A;  4FWH A;  3T1H M;  5FTM A;  4B7F A;  2XEP A;  1DV0 A;  1VEG A;  2VF8 A;  3UGJ A;  1RU3 A;  4I4L A;  3U5Z A;  3L29 A;  1YSY A;  4P17 A;  3GLF A;  3U6M A;  3GPY A;  2L7I A;  1GKI A;  3GRV A;  1L8Q A;  1ZMV A;  1MU5 A;  2FE8 A;  1L2B A;  3SAS A;  5ITT A;  1D0M A;  3KP1 E;  2KZU A;  4M9Z A;  2CHV A;  2WSF F;  3F92 A;  4MM3 B;  1DGG A;  1XXH A;  1VEJ A;  4OW0 A;  3Q8X A;  3L26 A;  4DR2 M;  4L4U A;  1LV7 A;  1QAN A;  1G4A E;  2KEB A;  3K9O A;  2C5R A;  1NY5 A;  2L6O A;  1N78 A;  2M60 A;  2GNO A;  4DUZ M;  4DV7 M;  2JNH A;  1K82 A;  3KOZ E;  2FNA A;  4KHP M;  1N75 A;  4JI1 M;  4NSR A;  2OO9 A;  5KQ8 A;  1VG5 A;  4AKH A;  2QNJ A;  2CV0 A;  2VDB B;  4PDG A;  2RGH A;  3GLI B;  4DV0 M;  1IN6 A;  3LVW A;  4CGY B;  3MMP A;  4LJ9 A;  2KNA A;  3CF6 E;  4PCZ A;  2ZAM A;  1XNR M;  4B7G A;  2JUJ A;  1IQP A;  1MN3 A;  1VEK A;  3MK6 A;  2D7H A;  3J27 B;  5EXX A;  1QZE A;  5ITX E;  1LTM A;  4FWG A;  1TTE A;  1ZMU A;  4LF5 M;  1TDH A;  3FRH A;  3I01 M;  4JI4 M;  4B3R M;  2R45 A;  5DYG A;  1XC8 A;  4LZJ A;  3NWL A;  2MR9 A;  2YNM D;  3U61 B;  1BVS A;  2KA6 B;  3DOA A;  4NL4 H;  1OFI A;  3QYE A;  3HU3 A;  4NRV A;  1QAQ A;  2R0I A;  2HL7 A;  3SYL A;  2ZM6 M;  3SBJ A;  1IN7 A;  1R7R A;  1IXS B;  1TR8 A;  3GQ5 A;  1EIJ A;  2DAG A;  4I81 A;  1VDL A;  1QAO A;  3LMM A;  3AL0 C;  2EKK A;  5FTN A;  3GLI E;  4LFC M;  2LH0 A;  3VK8 A;  3KOW E;  1D0K A;  3I04 M;  4MGI E;  3IHP A;  4DR7 M;  2EUC A;  4QHS A;  2F5O A;  4IJE A;  2FOI C;  2CUZ A;  1HT2 E;  4ITQ A;  3KOY E;  3L28 A;  3ZH9 B;  4G4O A;  3A42 A;  4QOS A;  4L8R C;  2C96 A;  3U6O A;  1AIP C;  3KSX A;  3TQS A;  4LJ6 A;  3LCU A;  1YE9 A;  2XFS A;  1PJT A;  2V1U A;  2DWM A;  1IBL M;  4B7H A;  2LVP C;  2F5Q A;  2QCU A;  4UN2 B;  5ITY A;  1GJT A;  5FLX S;  3LQQ A;  1T43 A;  4P16 A;  4AW4 A;  2UXC M;  3GPP A;  1Z6T A;  3IG5 A;  3FUT A;  4AKI A;  1QUT A;  4LGM A;  1HQY E;  1PJS A;  2LXE A;  4LZZ A;  4OVZ A;  4RF0 A;  5A2Q S;  1E32 A;  1EE8 A;  4Y28 F;  1QZM A;  4NSO B;  4DR3 M;  3PVS A;  1K3X A;  5IT9 S;  1IM2 A;  3A46 A;  2QBY B;  1J5E M;  4GEW A;  3GPU A;  2G8L A;  2HWJ A;  3AFH A;  4PD2 A;  1NNU C;  1R2Z A;  3CGW A;  3GLH B;  3GLF E;  1N34 M;  1Z5C A;  3U6Q A;  3FYD A;  2Y0T A;  4L15 A;  5KPT A;  2AHM A;  2LVN C;  4KLN A;  1ZV1 A;  3TE6 A;  1WJ7 A;  4IBK A;  1IXR C;  3KFU G;  4R71 A;  4CHT B;  1OIZ A;  3H4M A;  4HLQ A;  4GC9 A;  3J2P B;  1IY1 A;  3QYB A;  3B7Q A;  3NBX X;  1DGH A;  5FTK A;  3SAV A;  3FTE A;  4DV2 M;  2L4E A;  1D0L A;  2DAE A;  3RFW A;  3KDS E;  4JI8 M;  3M7G A;  3PXG A;  3FTF A;  2QPA A;  3H4J A;  1DO0 A;  1R5L A;  2BNK A;  2CRU A;  2Z4R A;  3GRR A;  4JXJ A;  5ITU A;  3U60 B;  4EIW A;  1HQC A;  1R4G A;  3JAM S;  2VII A;  2N35 A;  3ZCB B;  2E5L M;  2J5Y A;  4FVM A;  4W5W A;  4B08 A;  2HAK A;  2XH9 A;  3U6E A;  3GLH E;  1PJI A;  2QP9 X;  4X65 M;  1K3W A;  1JR3 D;  3PFI A;  2C9O A;  4LGY A;  4DV5 M;  3HU2 A;  2HKJ A;  4ZPX A;  1X37 A;  2OOB A;  4LCB A;  4HEO A;  4WP2 A;  2QEN A;  2H5X A;  2C99 A;  2DZO B;  2Z3X A;  3T15 A;  1V92 A;  4HL4 A;  4FWD A;  2B3T A;  2V1C A;  3WHK A;  2O5R A;  1H6U A;  3VFD A;  1IY2 A;  4LJ5 A;  4LJ7 A;  3ILK A;  3LQR A;  3U61 A;  4LJ4 A;  5BPV A;  4GHL A;  3C9P A;  2UUA M;  3HJQ A;  3SFZ A;  4R3D A;  4TUW A;  2K9D A;  2X49 A;  2R4J A;  2Y20 A;  3HKP A;  5KQD A;  3CF2 A;  2DHY A;  1G8P A;  1C1K A;  4G4Q A;  1IXS A;  1OQY A;  1T6O A;  1A5T A;  2DNA A;  2WSE F;  2XLJ A;  2DVW B;  3HU1 A;  1SXJ B;  4AKG A;  3HJS A;  1UFZ A;  2OOA A;  3FUX A;  2XFT A;  1KFV A;  1N32 M;  1NV8 A;  4MGH A;  1Q02 A;  2XZU A;  1PJJ A;  3EIH A;  2JZ1 A;  1PRB A;  4LJ8 A;  2DHR A;  2DAM A;  2CEA A;  4BB9 A;  4PDI A;  3DFZ A;  8CAT A;  3GQ4 A;  3T1Y M;  4JYA M;  3GLG E;  2CV1 A;  1UM8 A;  2JZ0 A;  2EA0 A;  1HNZ M;  3SAR A;  1V33 A;  2O01 F;  1T3T A;  4DBG B;  4WUR A;  3UMM A;  4IBC A;  3LW5 F;  3FYC A;  4Z8X A;  4DR1 M;  1GO5 A;  3GP1 A;  2R62 A;  3MJ5 A;  3RGP A;  4KO8 A;  3SMS A;  3UK6 A;  2I7N A;  3HJ8 A;  4IBJ A;  2F5N A;  3M0E A;  1JR3 A;  5EXP A;  1HNX M;  3HX3 A;  4IBD A;  5EXT A;  5KPR A;  1SXJ E;  1GJS A;  4CJ6 A;  2WSC F;  1ZQ9 A;  2LHG A;  4G4N A;  1YUB A;  3IG8 A;  4FD2 A;  3U5Z B;  1IBK M;  2XZF A;  2UXD M;  1QVR A;  2RRU A;  3KVW A;  3J80 S;  3C3E A;  3GLF B;  5F3W A;  4G6Z A;  2KNZ A;  3RGS A;  2UUB M;  2JY7 A;  3U6P A;  2DWL A;  2DAI A;  4G3O A;  4M9X A;  4CIZ A;  3EIE A;  4NRW A;  4DR6 M;  3K1J A;  3TWL A;  2ZAN A;  2EO2 A;  1L1Z A;  2CWB A;  1TH4 A;  2ZTD A;  3U6S A;  4JI3 M;  3B7N A;  3CF0 A;  3E9S A;  3B7Z A;  5KO3 A;  3HHZ A;  4XGI A;  4LF4 M;  1ZAE A;  1NHW C;  3SAT A;  2VF7 A;  4RF1 A;  5DYI A;  4LF9 M;  1HR0 M;  1Q3C A;  3K2L A;  3FKE A;  3TPZ A;  4YY3 M;  1QUS A;  4GKJ M;  2CP8 A;  4DV4 M;  1XNQ M;  5JI2 E;  3PNV A;  1NVM A;  1F4I A;  4QNR A;  5FTL A;  3R8F A;  3HY5 A;  2V6Z M;  3D8B A;  4F2L A;  2K6B A;  1E9S A;  3HHW A;  2C9C A;  2DWZ B;  1XMO M;  1S3S A;  1FJG M;  2JY6 B;  2LHC A;  2HHH M;  3C3D A;  4DUY M;  2LBC A;  4CIS A;  2OQ4 A;  3SYK A;  3VDU A;  4PT5 A;  5E6J A;  3AJI B;  2ZBK B;  2FH0 A;  4BBA A;  2H1R A;  1GLN A;  2X8A A;  1Q3B A;  3B74 A;  4IBB A;  3MHV C;  1XXH E;  2F4V M;  2L09 A;  3ZQJ A;  2MH8 A;  2R6F A;  1G3I A;  3IEC A;  3JR5 A;  3HHX A;  5ITX A;  3K92 A;  4JI2 M;  4LFB M;  1HT1 E;  1TGU A;  7CAT A;  1N77 A;  1KYI A;  2KNV A;  5EP3 A;  3FUU A;  1DO2 A;  2DEN A;  3KSJ A;  2YQZ A;  3TL4 X;  4QHT A;  1MJG M;  1OAO C;  4FCT A;  2CHG A;  2KDL A;  2L4F A;  2YFQ A;  1MX0 A;  1NV9 A;  5IRE B;  2LVO C;  3GRY A;  4JI6 M;  4X62 M;  3SMP A;  2XF3 A;  3E21 A;  5IWA M;  2L7H A;  4Z6Y A;  2KW0 A;  4F1I A;  2GQF A;  2LNH C;  2G5G X;  3GLI A;  3L2A A;  4B3M M;  1G59 A;  2D7E A;  1XWI A;  4NC6 A;  1J7K A;  3HHY A;  2RKO A;  4AG6 A;  2XGN A;  3SC3 A;  4LF6 M;  3UZU A;  2JA2 A;  3BXW A;  3SAU A;  3J7B A;  1XB2 B;  3SHF A;  4NOO B;  1W5T A;  4M0D A;  2G3Q A;  2KZS A;  4RNA A;  3VKH A;  4OX9 M;  1WGL A;  4DR4 M;  4WW0 A;  2R4E A;  5ITQ A;  3GLG B;  1G41 A;  2K47 A;  4G4R A;  1GAB A;  4X66 M;  4OVZ B;  2J7N A;  3I4V A;  3U6D A;  1IXZ A;  3FUV A;  1W5S A;  4GRI A;  4QNM A;  3TWM A;  3BBZ A;  1OAI A;  2C98 A;  5GKN A;  2QQ8 A;  2O25 A;  4LFA M;  3I51 A;  3AV0 A;  2FFJ A;  1VQ1 A;  3J7A S;  1IN4 A;  4L78 A;  4LG2 A;  2ZTC A;  4GKK M;  1I94 M;  5EP4 A;  4IBF A;  4MGY E;  3AKZ A;  5ITR A;  1R6B X;  2DZL A;  4KOD A;  3KS4 A;  3SHG B;  4MB7 A;  3W68 A;  3CTW B;  1QAM A;  3AOE C;  4GIP A;  4MGZ E;  2KXE A;  1JB0 F;  3LVV A;  2CHQ A;  2KRU A;  3KP0 E;  3QAU A;  4FW9 A;  4L16 A;  3C58 A;  2Z7J A; 
#chains in the Genus database with same CATH homology
 2JXN A;  1EIJ A;  2K6B A;  2CRU A;  2FH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...