2FH0A

Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic regio
publication title Solution Structure of Saccharomyces cerevisiae Protein Ymr074cp
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2fh0A00
2JXNA 2CRUA 1EIJA 2FH0A 2K6BA
chains in the Genus database with same CATH superfamily
4QNRA 2L7IA 1N78A 5IT9S 2DAGA 2DAIA 2XSZD 5EP3A 4Z8XA 1NVMA 3Q8GA 5ITTA 2LVNC 2HCBA 4QOZC 4LF9M 3TWMA 1XXHB 4L16A 3PNVA 3TWKA 1SXJA 3FUVA 1MX0A 2DI0A 1EIJA 4DR1M 1K82A 3JAMS 1QVRA 2DXIA 2DZLA 2J7NA 4DV5M 3SASA 1R6BX 1KYIA 1G59A 3W68A 2KA6B 4MGIE 3CTWB 3AOEC 3U6DA 1G8PA 2R0IA 4BB9A 1IY2A 3T1YM 3H4JA 3SYKA 3VFDA 2B3TA 4I4LA 5FSWA 3K9PA 1NV8A 1ZMVA 3U5ZA 3FYCA 3BBZA 3KW6A 2L4EA 3QAUA 2F4VM 3IECA 1J09A 5EXTA 2DVWB 1MU5A 3NWLA 1VQ1A 2DWMA 3C9PA 3MJ5A 4AG6A 2BWBA 3GRYA 1T3TA 4X64M 4PD2A 1DO0A 1E94E 2QSFX 2BJVA 1P3QQ 4MGZE 3LQRA 1QANA 2OOAA 4QOSA 3GP1A 2DENA 3CGWA 2P5TA 4M9XA 5KPZA 4IBFA 1TGUA 3FRIA 2ZTCA 3U6EA 3F92A 1G4AE 2CRUA 3E4RA 3D8LA 3FRHA 4WURA 1IM2A 2AHMA 2MJ5B 3NBIA 4AZFA 4NXNM 3HHZA 2L6OA 2DKLA 1OQYA 4IBJA 1E9SA 3SMPA 3ZQJA 3AOEA 4PT5A 4XGIA 3J7AS 5EP2A 1DV0A 3GLFA 1SG9A 1L2CA 2JA2A 3MK6A 1TR8A 4CGYB 1E32A 4F1IA 1EE8A 2Q2EB 3K92A 2CV1A 2WSEF 5E6JA 2Y21A 3J7BA 4UN2B 2HAKA 5EQTA 3TPZA 4FW9A 2MROB 1HNZM 3OTOM 4DR5M 4OU7A 2DHYA 3FTFA 4JI8M 3SC3A 1HR0M 3ZC7B 2VF7A 4RNAA 4DUYM 1C1KA 1JR3E 2KHHA 1GL6A 3GLGE 4DV3M 4NRVA 1IY0A 1NJGA 1WGLA 2DAKA 3AJIB 4G4QA 4BLCA 3GLIA 4LGMA 2MR9A 3BOSA 5KO3A 1QYRA 2OO9A 1TTEA 2KRKA 2JY8A 3EIHA 1YLAA 3WHLA 2GNOA 3IG5A 2D7EA 1XXHE 3E21A 3GPUA 2Z8YM 4M9SA 3RFWA 2JP7A 1QAOA 4JI0M 5LMNM 5EXXA 1PGYA 3K1JA 1TDHA 1L2BA 4MB7A 3PNYA 2DAEA 2EO2A 4S12A 5DNYA 1YUBA 4IBGA 4D80A 5EP1A 4MM3B 3RGSA 4DV7M 4NC6A 2OOBA 2Z4SA 2CV0A 1N32M 2XH9A 5GKNA 4LJ5A 3SFZA 1GL7A 3T1HM 1ZMWA 1K3XA 2Y0TA 1W5SA 1TF0B 3I4VA 3LCUA 4JI3M 1T43A 3I01M 4MH0E 4D82A 3QYEA 2Z3XA 2LH0A 2JWSA 3I04M 4XK8F 3FUUA 1NNJA 4LF6M 4X62M 1OJLA 3HHXA 5FLXS 3JR4A 4AKIA 4R71A 4IBCA 5KQ8A 1WXQA 3ZH9B 3GRRA 4L8RC 1IN4A 2LVPC 2QBYA 4LF8M 3M0EA 1XHBA 3W67A 2Y0QA 5KQDA 3CF6E 1NJFA 4L6V6 5ITRA 3GQ5A 1Z5AA 2QNJA 2MGWA 5BPVA 2JY7A 1EFUB 3GPPA 4AW4A 3SMSA 2XZFA 1GABA 3KSJA 4I5SA 2UUAM 2KZSA 3HX3A 1ZMUA 3LMMA 4F2LA 4FWHA 1IBKM 4JI7M 3QWLA 4DR3M 5LMUM 4HLQA 3TWLA 5ITXE 3ZCBB 4I81A 1HT2E 3HHWA 4GC5A 1RU3A 2CHGA 2QCUA 3LQQA 3RE8A 2XFTA 3K8ZA 2XEPA 4P17A 4K0KM 3SBJA 1ZAEA 4OVZA 1TH2A 3K2LA 4NSRA 1ZQ9A 1HNXM 1GO5A 4IJFA 3C3EA 1N33M 2BJWA 5BR8M 2H1RA 3SYLA 3KDSE 3C3DA 5FTLA 2O25A 1QQWA 4IJEA 4JN6A 2O01F 3IHPA 4R7GA 2HKJA 1OIPA 2QP9X 3LVVA 4JI4M 4WW0A 2RKOA 3HWSA 1JR3A 3SAWA 3GLGA 4LFCM 2K0BX 2JXNA 3DOAA 3FYDA 3U6PA 4RF1A 4DV0M 2DAMA 5FTKA 3J80S 3U6MA 2CUZA 2KZUA 2EJSA 2XSZA 4FWDA 2QPAA 3M7GA 3KP0E 2DZNB 2G3QA 5A2QS 1WHCA 3RGPA 4FVMA 1JB0F 1XXHA 1Z5BA 3GLHB 3HJQA 1PM5A 1XNRM 4JXJA 1QUSA 3AKZA 2DWNA 1D0LA 2LVQD 2KEBA 4LJ8A 3IG8A 2ZTDA 3L28A 4EIWA 2H5XA 3QYBA 1DGBA 3KP1E 4YY3M 3CF2A 1Z5CA 1Z59A 3SHFA 2R46A 2Z7JA 2KXEA 1R5LA 4QNMA 4LJ7A 4LZJA 4GMQA 4QHSA 4GRIA 2XGNA 3FUXA 4D81A 1TDZA 3HU2A 1Q3CA 1NY6A 4DV2M 4KLNA 1ZV1A 2OPFA 4A3VB 1GKIA 3E46A 2BNKA 2CHVA 4LJ4A 5FTMA 2CEAA 1KSFX 3KS4A 3LVWA 2I7NA 2DWZB 2KDLA 1T6OA 4GEWA 1VEJA 1IBLM 3TE6A 2G8LA 3U6QA 1H6UA 1JQJC 1PJSA 4LY6A 4LF4M 1DGFA 1VDDA 3HZJA 1Z6TA 2KNAA 3KS8A 2K9DA 4KODA 2KNVA 3UGJA 2DWLA 1J7KA 1IXRC 3L2AA 2HWJA 4Z6YA 4NXMM 4HEOA 4MGKE 2JUJA 1OIZA 4TUWA 5JI3E 2UXCM 5JI2E 5IZ7D 1XNQM 4YHHM 3V76A 4DV1M 4ITQA 1D0KA 4PDIA 4BBAA 3KSXA 2UXDM 2C9CA 3VKGA 4OW0A 3FKEA 4IBDA 3GPXA 1F4IA 3SARA 3DFZA 1V33A 2D7HA 1Q02A 1QDRA 8CATA 5ITXA 1R2YA 4OX9M 1NO1A 2Y20A 4LCBA 3GQ3A 4KO8A 1IXSB 1E9RA 3B7QA 2JZ0A 2XZUA 2W82A 3U61B 4GC9A 2VF8A 2A5YB 4KT0F 4LRTA 4DR2M 2F5OA 2UXBM 3T6PA 1WR1B 3HU1A 3VDUA 2LXEA 4CHTB 1N36M 3A42A 3J27B 4II7A 1QZMA 1V92A 3B89A 1R7RA 1WGNA 4X66M 2QENA 3E9SA 2O5RA 2UUBM 4JI2M 1GLNA 2L7HA 4I8OA 4DUZM 1WIVA 2D7GA 4GKJM 5F3WA 3M6AA 4LGYA 3T15A 1W5TA 3B7ZA 3HY5A 2GQFA 4FCWA 4GIPA 1J5EM 5EXSA 3U60B 1DGHB 3T38A 2R45A 3HJ8A 2QZ4A 2C96A 2EA0A 1VG5A 4L4UA 3GLHE 4IBKA 3UZUA 1FJGM 4G4OA 5L8RF 3B7NA 2VDBB 3Q8XA 2APLA 5DYIA 4LFBM 2R18A 3GRVA 3J2PB 4QHTA 1OFIA 4GH9A 2DZOB 5C1BA 2XFSA 4JI1M 2R62A 1Q3BA 2QQ8A 2RGHA 3A98B 4B7GA 4XBOA 2WZJA 2X4AA 4M9ZA 3UK6A 3KOYE 3FUWA 3GLFE 4DV6M 1IBMM 2ZAMA 2E5LM 4B7FA 2L4FA 1HNWM 1L2DA 2XF3A 4MGYE 1NHGC 4DBGB 3SHGB 2J5YA 3B74A 2LVAA 4PDGA 3KXEC 1NV9A 2VQEM 2HL7A 1SXJB 5IWAM 1SXJD 4LG2A 2J7OA 4RF0A 1YSYA 2R4JA 1R4GA 4FD2A 3AOGA 2RRUA 4CISA 3R9XB 1L8QA 2EKFA 5C18A 2JY6B 1QAMA 1OTRA 5KPTA 2CHQA 4FCVA 3U5ZB 2ZM6M 4B08A 1JR3D 3VKHA 2ZANA 1YE9A 3L27A 3VK8A 1I94M 2ERCA 4M0DA 4LFAM 5FTNA 3PFIA 4AKHA 4ZPXA 1GVNA 1CUKA 4G4RA 4X65M 1GJSA 2V6ZM 1G41A 1G71A 4LZZA 3U6CA 2WSCF 3KOWE 1QZEA 4MGHA 3VK7A 1IN5A 3TL4X 4REZA 2DNAA 3GQ4A 1OKSA 2G5GX 3KOXE 4Q7JA 1DGGA 3WHKA 1IN6A 3L26A 3PXGA 3D8BA 3BXWA 4DV4M 1TH4A 4Y28F 3CF0A 5EJCA 1ORYB 4JI6M 4LRSA 1G3IA 2LTUA 2ZBKB 3A45A 4AG5A 4KHPM 1KFVA 3UJNA 1PJJA 1HQCA 1HT1E 1AUAA 2K47A 1FNNA 2N35A 4GITA 3W0FA 1QAQA 3U6SA 2VQFM 3LCVB 4ANRA 4HL4A 2V1UA 1UFZA 1I4WA 2KW0A 3GLFB 1X37A 2YFQA 4L78A 2X8AA 2C9OA 4W5WA 1R2ZA 1QUTA 2LVOC 4B7HA 1MN3A 2LHCA 2V1CA 3B9PA 4L15A 1LV7A 2EKKA 4RKUF 3SAUA 1OAOC 3GLHA 3DA1A 3FE3A 5H37D 1C7YA 2X49A 1LTMA 2R4EA 2I7PA 3TQSA 3I51A 2FOIC 5E26A 1N75A 2CE7A 1HJPA 2XLJA 2L09A 4LJ9A 1PJTA 3GO8A 3KFUG 3R8FA 4LJ6A 4B3MM 1D0MA 1NNUC 3GLIB 4R3DA 3FTDA 2RGOA 2CFOA 2FNAA 2FE8A 3MHVC 4FCTA 1V34A 1N77A 5ITYA 1A5TA 2MH8A 1Y8GA 2FFJA 1PJIA 1NY5A 4GHAA 4LF5M 1L1TA 1IN8A 4JI5M 2JNHA 3U6LA 4NRWA 1XWIA 1SXJE 2NQ8C 1GJTA 5ITQA 4P16A 3L29A 4JYAM 4GHLA 2LNHC 2FS1A 3I4YA 2Z4RA 3VLFB 5DYGA 3HJSA 2UU9M 2CP8A 4IBBA 4NSOB 3KVWA 1L1ZA 2F5NA 4LF7M 4JV5M 4NL4H 7CATA 1N34M 4AQYM 1BVSA 4CIZA 2HHHM 2F5QA 4B3TM 2LWXA 4FWGA 5KPRA 1IY1A 3FTCA 3SAVA 1UM8A 1HQYE 1D2NA 1OFHA 1PRBA 3MMPA 1NHWC 2KRUA 2M5ZA 3NBXX 4LJAA 2LBCA 1QDTA 1IQPA 2ZAOA 5ITUA 3L25A 2M60A 4WP2A 3AFHA 5FTJA 5EP4A 3HGIA 3LW5F 3AV0A 2LHGA 3HHYA 1OAIA 2YNMD 1XMOM 2YR0A 1S3SA 3ILKA 2DHRA 1Q39A 3FD9A 3K9OA 4G3OA 1IXSA 1XC8A 2C98A 3KOZE 2QHOB 1TH3A 3U61A 2CWBA 2EUCA 2VIIA 3W0LB 3FUTA 4NOOB 3C58A 3H4MA 2QBYB 4AKGA 4G4NA 2JZ1A 2R6FA 1MJGM 3VDPA 3A46A 3AL0C 4M0WA 1NSFA 5EXPA 3THGA 2R65A 2F5SA 1PJQA 2K6BA 3HU3A 1WJ7A 1SXJC 3EIEA 4IIWA 2KNZA 4IBIA 2UUCM 4PCZA 1VEKA 3JR5A 3GPYA 1VEGA 5IREB 2WSFF 3PVSA 4B3RM 3U60A 1DGHA 3UMMA 2L2DA 3SATA 2F5PA 1XB2B 2C99A 4OVZB 3FTEA 2YQZA 2FH0A 4IBEA 2R44A 3J81S 4GKKM 4DR4M 3HKPA 5DFLA 4B3SM 2CV2A 3GRUA 1XMQM 3DZDA 2JY5A 2OQ4A 1IFYA 1DO2A 4CJ6A 4DR6M 1AIPC 1IN7A 2C5RA 1VDLA 4AI6A 1IXZA 2BWEA 3GLIE 4DR7M 4G6ZA 3GLGB 3U6OA 1K3WA
chains in the Genus database with same CATH topology
2JXNA 2CRUA 1EIJA 2FH0A 2K6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXN A;  2CRU A;  1EIJ A;  2FH0 A;  2K6B A; 
#chains in the Genus database with same CATH topology
 4QNR A;  2L7I A;  1N78 A;  5IT9 S;  2DAG A;  2DAI A;  2XSZ D;  5EP3 A;  4Z8X A;  1NVM A;  3Q8G A;  5ITT A;  2LVN C;  2HCB A;  4QOZ C;  4LF9 M;  3TWM A;  1XXH B;  4L16 A;  3PNV A;  3TWK A;  1SXJ A;  3FUV A;  1MX0 A;  2DI0 A;  1EIJ A;  4DR1 M;  1K82 A;  3JAM S;  1QVR A;  2DXI A;  2DZL A;  2J7N A;  4DV5 M;  3SAS A;  1R6B X;  1KYI A;  1G59 A;  3W68 A;  2KA6 B;  4MGI E;  3CTW B;  3AOE C;  3U6D A;  1G8P A;  2R0I A;  4BB9 A;  1IY2 A;  3T1Y M;  3H4J A;  3SYK A;  3VFD A;  2B3T A;  4I4L A;  5FSW A;  3K9P A;  1NV8 A;  1ZMV A;  3U5Z A;  3FYC A;  3BBZ A;  3KW6 A;  2L4E A;  3QAU A;  2F4V M;  3IEC A;  1J09 A;  5EXT A;  2DVW B;  1MU5 A;  3NWL A;  1VQ1 A;  2DWM A;  3C9P A;  3MJ5 A;  4AG6 A;  2BWB A;  3GRY A;  1T3T A;  4X64 M;  4PD2 A;  1DO0 A;  1E94 E;  2QSF X;  2BJV A;  1P3Q Q;  4MGZ E;  3LQR A;  1QAN A;  2OOA A;  4QOS A;  3GP1 A;  2DEN A;  3CGW A;  2P5T A;  4M9X A;  5KPZ A;  4IBF A;  1TGU A;  3FRI A;  2ZTC A;  3U6E A;  3F92 A;  1G4A E;  2CRU A;  3E4R A;  3D8L A;  3FRH A;  4WUR A;  1IM2 A;  2AHM A;  2MJ5 B;  3NBI A;  4AZF A;  4NXN M;  3HHZ A;  2L6O A;  2DKL A;  1OQY A;  4IBJ A;  1E9S A;  3SMP A;  3ZQJ A;  3AOE A;  4PT5 A;  4XGI A;  3J7A S;  5EP2 A;  1DV0 A;  3GLF A;  1SG9 A;  1L2C A;  2JA2 A;  3MK6 A;  1TR8 A;  4CGY B;  1E32 A;  4F1I A;  1EE8 A;  2Q2E B;  3K92 A;  2CV1 A;  2WSE F;  5E6J A;  2Y21 A;  3J7B A;  4UN2 B;  2HAK A;  5EQT A;  3TPZ A;  4FW9 A;  2MRO B;  1HNZ M;  3OTO M;  4DR5 M;  4OU7 A;  2DHY A;  3FTF A;  4JI8 M;  3SC3 A;  1HR0 M;  3ZC7 B;  2VF7 A;  4RNA A;  4DUY M;  1C1K A;  1JR3 E;  2KHH A;  1GL6 A;  3GLG E;  4DV3 M;  4NRV A;  1IY0 A;  1NJG A;  1WGL A;  2DAK A;  3AJI B;  4G4Q A;  4BLC A;  3GLI A;  4LGM A;  2MR9 A;  3BOS A;  5KO3 A;  1QYR A;  2OO9 A;  1TTE A;  2KRK A;  2JY8 A;  3EIH A;  1YLA A;  3WHL A;  2GNO A;  3IG5 A;  2D7E A;  1XXH E;  3E21 A;  3GPU A;  2Z8Y M;  4M9S A;  3RFW A;  2JP7 A;  1QAO A;  4JI0 M;  5LMN M;  5EXX A;  1PGY A;  3K1J A;  1TDH A;  1L2B A;  4MB7 A;  3PNY A;  2DAE A;  2EO2 A;  4S12 A;  5DNY A;  1YUB A;  4IBG A;  4D80 A;  5EP1 A;  4MM3 B;  3RGS A;  4DV7 M;  4NC6 A;  2OOB A;  2Z4S A;  2CV0 A;  1N32 M;  2XH9 A;  5GKN A;  4LJ5 A;  3SFZ A;  1GL7 A;  3T1H M;  1ZMW A;  1K3X A;  2Y0T A;  1W5S A;  1TF0 B;  3I4V A;  3LCU A;  4JI3 M;  1T43 A;  3I01 M;  4MH0 E;  4D82 A;  3QYE A;  2Z3X A;  2LH0 A;  2JWS A;  3I04 M;  4XK8 F;  3FUU A;  1NNJ A;  4LF6 M;  4X62 M;  1OJL A;  3HHX A;  5FLX S;  3JR4 A;  4AKI A;  4R71 A;  4IBC A;  5KQ8 A;  1WXQ A;  3ZH9 B;  3GRR A;  4L8R C;  1IN4 A;  2LVP C;  2QBY A;  4LF8 M;  3M0E A;  1XHB A;  3W67 A;  2Y0Q A;  5KQD A;  3CF6 E;  1NJF A;  4L6V 6;  5ITR A;  3GQ5 A;  1Z5A A;  2QNJ A;  2MGW A;  5BPV A;  2JY7 A;  1EFU B;  3GPP A;  4AW4 A;  3SMS A;  2XZF A;  1GAB A;  3KSJ A;  4I5S A;  2UUA M;  2KZS A;  3HX3 A;  1ZMU A;  3LMM A;  4F2L A;  4FWH A;  1IBK M;  4JI7 M;  3QWL A;  4DR3 M;  5LMU M;  4HLQ A;  3TWL A;  5ITX E;  3ZCB B;  4I81 A;  1HT2 E;  3HHW A;  4GC5 A;  1RU3 A;  2CHG A;  2QCU A;  3LQQ A;  3RE8 A;  2XFT A;  3K8Z A;  2XEP A;  4P17 A;  4K0K M;  3SBJ A;  1ZAE A;  4OVZ A;  1TH2 A;  3K2L A;  4NSR A;  1ZQ9 A;  1HNX M;  1GO5 A;  4IJF A;  3C3E A;  1N33 M;  2BJW A;  5BR8 M;  2H1R A;  3SYL A;  3KDS E;  3C3D A;  5FTL A;  2O25 A;  1QQW A;  4IJE A;  4JN6 A;  2O01 F;  3IHP A;  4R7G A;  2HKJ A;  1OIP A;  2QP9 X;  3LVV A;  4JI4 M;  4WW0 A;  2RKO A;  3HWS A;  1JR3 A;  3SAW A;  3GLG A;  4LFC M;  2K0B X;  2JXN A;  3DOA A;  3FYD A;  3U6P A;  4RF1 A;  4DV0 M;  2DAM A;  5FTK A;  3J80 S;  3U6M A;  2CUZ A;  2KZU A;  2EJS A;  2XSZ A;  4FWD A;  2QPA A;  3M7G A;  3KP0 E;  2DZN B;  2G3Q A;  5A2Q S;  1WHC A;  3RGP A;  4FVM A;  1JB0 F;  1XXH A;  1Z5B A;  3GLH B;  3HJQ A;  1PM5 A;  1XNR M;  4JXJ A;  1QUS A;  3AKZ A;  2DWN A;  1D0L A;  2LVQ D;  2KEB A;  4LJ8 A;  3IG8 A;  2ZTD A;  3L28 A;  4EIW A;  2H5X A;  3QYB A;  1DGB A;  3KP1 E;  4YY3 M;  3CF2 A;  1Z5C A;  1Z59 A;  3SHF A;  2R46 A;  2Z7J A;  2KXE A;  1R5L A;  4QNM A;  4LJ7 A;  4LZJ A;  4GMQ A;  4QHS A;  4GRI A;  2XGN A;  3FUX A;  4D81 A;  1TDZ A;  3HU2 A;  1Q3C A;  1NY6 A;  4DV2 M;  4KLN A;  1ZV1 A;  2OPF A;  4A3V B;  1GKI A;  3E46 A;  2BNK A;  2CHV A;  4LJ4 A;  5FTM A;  2CEA A;  1KSF X;  3KS4 A;  3LVW A;  2I7N A;  2DWZ B;  2KDL A;  1T6O A;  4GEW A;  1VEJ A;  1IBL M;  3TE6 A;  2G8L A;  3U6Q A;  1H6U A;  1JQJ C;  1PJS A;  4LY6 A;  4LF4 M;  1DGF A;  1VDD A;  3HZJ A;  1Z6T A;  2KNA A;  3KS8 A;  2K9D A;  4KOD A;  2KNV A;  3UGJ A;  2DWL A;  1J7K A;  1IXR C;  3L2A A;  2HWJ A;  4Z6Y A;  4NXM M;  4HEO A;  4MGK E;  2JUJ A;  1OIZ A;  4TUW A;  5JI3 E;  2UXC M;  5JI2 E;  5IZ7 D;  1XNQ M;  4YHH M;  3V76 A;  4DV1 M;  4ITQ A;  1D0K A;  4PDI A;  4BBA A;  3KSX A;  2UXD M;  2C9C A;  3VKG A;  4OW0 A;  3FKE A;  4IBD A;  3GPX A;  1F4I A;  3SAR A;  3DFZ A;  1V33 A;  2D7H A;  1Q02 A;  1QDR A;  8CAT A;  5ITX A;  1R2Y A;  4OX9 M;  1NO1 A;  2Y20 A;  4LCB A;  3GQ3 A;  4KO8 A;  1IXS B;  1E9R A;  3B7Q A;  2JZ0 A;  2XZU A;  2W82 A;  3U61 B;  4GC9 A;  2VF8 A;  2A5Y B;  4KT0 F;  4LRT A;  4DR2 M;  2F5O A;  2UXB M;  3T6P A;  1WR1 B;  3HU1 A;  3VDU A;  2LXE A;  4CHT B;  1N36 M;  3A42 A;  3J27 B;  4II7 A;  1QZM A;  1V92 A;  3B89 A;  1R7R A;  1WGN A;  4X66 M;  2QEN A;  3E9S A;  2O5R A;  2UUB M;  4JI2 M;  1GLN A;  2L7H A;  4I8O A;  4DUZ M;  1WIV A;  2D7G A;  4GKJ M;  5F3W A;  3M6A A;  4LGY A;  3T15 A;  1W5T A;  3B7Z A;  3HY5 A;  2GQF A;  4FCW A;  4GIP A;  1J5E M;  5EXS A;  3U60 B;  1DGH B;  3T38 A;  2R45 A;  3HJ8 A;  2QZ4 A;  2C96 A;  2EA0 A;  1VG5 A;  4L4U A;  3GLH E;  4IBK A;  3UZU A;  1FJG M;  4G4O A;  5L8R F;  3B7N A;  2VDB B;  3Q8X A;  2APL A;  5DYI A;  4LFB M;  2R18 A;  3GRV A;  3J2P B;  4QHT A;  1OFI A;  4GH9 A;  2DZO B;  5C1B A;  2XFS A;  4JI1 M;  2R62 A;  1Q3B A;  2QQ8 A;  2RGH A;  3A98 B;  4B7G A;  4XBO A;  2WZJ A;  2X4A A;  4M9Z A;  3UK6 A;  3KOY E;  3FUW A;  3GLF E;  4DV6 M;  1IBM M;  2ZAM A;  2E5L M;  4B7F A;  2L4F A;  1HNW M;  1L2D A;  2XF3 A;  4MGY E;  1NHG C;  4DBG B;  3SHG B;  2J5Y A;  3B74 A;  2LVA A;  4PDG A;  3KXE C;  1NV9 A;  2VQE M;  2HL7 A;  1SXJ B;  5IWA M;  1SXJ D;  4LG2 A;  2J7O A;  4RF0 A;  1YSY A;  2R4J A;  1R4G A;  4FD2 A;  3AOG A;  2RRU A;  4CIS A;  3R9X B;  1L8Q A;  2EKF A;  5C18 A;  2JY6 B;  1QAM A;  1OTR A;  5KPT A;  2CHQ A;  4FCV A;  3U5Z B;  2ZM6 M;  4B08 A;  1JR3 D;  3VKH A;  2ZAN A;  1YE9 A;  3L27 A;  3VK8 A;  1I94 M;  2ERC A;  4M0D A;  4LFA M;  5FTN A;  3PFI A;  4AKH A;  4ZPX A;  1GVN A;  1CUK A;  4G4R A;  4X65 M;  1GJS A;  2V6Z M;  1G41 A;  1G71 A;  4LZZ A;  3U6C A;  2WSC F;  3KOW E;  1QZE A;  4MGH A;  3VK7 A;  1IN5 A;  3TL4 X;  4REZ A;  2DNA A;  3GQ4 A;  1OKS A;  2G5G X;  3KOX E;  4Q7J A;  1DGG A;  3WHK A;  1IN6 A;  3L26 A;  3PXG A;  3D8B A;  3BXW A;  4DV4 M;  1TH4 A;  4Y28 F;  3CF0 A;  5EJC A;  1ORY B;  4JI6 M;  4LRS A;  1G3I A;  2LTU A;  2ZBK B;  3A45 A;  4AG5 A;  4KHP M;  1KFV A;  3UJN A;  1PJJ A;  1HQC A;  1HT1 E;  1AUA A;  2K47 A;  1FNN A;  2N35 A;  4GIT A;  3W0F A;  1QAQ A;  3U6S A;  2VQF M;  3LCV B;  4ANR A;  4HL4 A;  2V1U A;  1UFZ A;  1I4W A;  2KW0 A;  3GLF B;  1X37 A;  2YFQ A;  4L78 A;  2X8A A;  2C9O A;  4W5W A;  1R2Z A;  1QUT A;  2LVO C;  4B7H A;  1MN3 A;  2LHC A;  2V1C A;  3B9P A;  4L15 A;  1LV7 A;  2EKK A;  4RKU F;  3SAU A;  1OAO C;  3GLH A;  3DA1 A;  3FE3 A;  5H37 D;  1C7Y A;  2X49 A;  1LTM A;  2R4E A;  2I7P A;  3TQS A;  3I51 A;  2FOI C;  5E26 A;  1N75 A;  2CE7 A;  1HJP A;  2XLJ A;  2L09 A;  4LJ9 A;  1PJT A;  3GO8 A;  3KFU G;  3R8F A;  4LJ6 A;  4B3M M;  1D0M A;  1NNU C;  3GLI B;  4R3D A;  3FTD A;  2RGO A;  2CFO A;  2FNA A;  2FE8 A;  3MHV C;  4FCT A;  1V34 A;  1N77 A;  5ITY A;  1A5T A;  2MH8 A;  1Y8G A;  2FFJ A;  1PJI A;  1NY5 A;  4GHA A;  4LF5 M;  1L1T A;  1IN8 A;  4JI5 M;  2JNH A;  3U6L A;  4NRW A;  1XWI A;  1SXJ E;  2NQ8 C;  1GJT A;  5ITQ A;  4P16 A;  3L29 A;  4JYA M;  4GHL A;  2LNH C;  2FS1 A;  3I4Y A;  2Z4R A;  3VLF B;  5DYG A;  3HJS A;  2UU9 M;  2CP8 A;  4IBB A;  4NSO B;  3KVW A;  1L1Z A;  2F5N A;  4LF7 M;  4JV5 M;  4NL4 H;  7CAT A;  1N34 M;  4AQY M;  1BVS A;  4CIZ A;  2HHH M;  2F5Q A;  4B3T M;  2LWX A;  4FWG A;  5KPR A;  1IY1 A;  3FTC A;  3SAV A;  1UM8 A;  1HQY E;  1D2N A;  1OFH A;  1PRB A;  3MMP A;  1NHW C;  2KRU A;  2M5Z A;  3NBX X;  4LJA A;  2LBC A;  1QDT A;  1IQP A;  2ZAO A;  5ITU A;  3L25 A;  2M60 A;  4WP2 A;  3AFH A;  5FTJ A;  5EP4 A;  3HGI A;  3LW5 F;  3AV0 A;  2LHG A;  3HHY A;  1OAI A;  2YNM D;  1XMO M;  2YR0 A;  1S3S A;  3ILK A;  2DHR A;  1Q39 A;  3FD9 A;  3K9O A;  4G3O A;  1IXS A;  1XC8 A;  2C98 A;  3KOZ E;  2QHO B;  1TH3 A;  3U61 A;  2CWB A;  2EUC A;  2VII A;  3W0L B;  3FUT A;  4NOO B;  3C58 A;  3H4M A;  2QBY B;  4AKG A;  4G4N A;  2JZ1 A;  2R6F A;  1MJG M;  3VDP A;  3A46 A;  3AL0 C;  4M0W A;  1NSF A;  5EXP A;  3THG A;  2R65 A;  2F5S A;  1PJQ A;  2K6B A;  3HU3 A;  1WJ7 A;  1SXJ C;  3EIE A;  4IIW A;  2KNZ A;  4IBI A;  2UUC M;  4PCZ A;  1VEK A;  3JR5 A;  3GPY A;  1VEG A;  5IRE B;  2WSF F;  3PVS A;  4B3R M;  3U60 A;  1DGH A;  3UMM A;  2L2D A;  3SAT A;  2F5P A;  1XB2 B;  2C99 A;  4OVZ B;  3FTE A;  2YQZ A;  2FH0 A;  4IBE A;  2R44 A;  3J81 S;  4GKK M;  4DR4 M;  3HKP A;  5DFL A;  4B3S M;  2CV2 A;  3GRU A;  1XMQ M;  3DZD A;  2JY5 A;  2OQ4 A;  1IFY A;  1DO2 A;  4CJ6 A;  4DR6 M;  1AIP C;  1IN7 A;  2C5R A;  1VDL A;  4AI6 A;  1IXZ A;  2BWE A;  3GLI E;  4DR7 M;  4G6Z A;  3GLG B;  3U6O A;  1K3W A; 
#chains in the Genus database with same CATH homology
 2JXN A;  2CRU A;  1EIJ A;  2FH0 A;  2K6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...