2FH0A

Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic regio
publication title Solution Structure of Saccharomyces cerevisiae Protein Ymr074cp
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2fh0A00
2K6BA 1EIJA 2CRUA 2FH0A 2JXNA
chains in the Genus database with same CATH superfamily
2ZTCA 4M0DA 2G5GX 4DV5M 1S3SA 1WHCA 3GLFB 4WW0A 2Y0QA 1D0MA 2JNHA 1L2CA 2NQ8C 1HQCA 2KDLA 2LTUA 2LVQD 2VF7A 3B9PA 5H37D 1EIJA 2JA2A 2J5YA 2MGWA 2DWNA 4FD2A 1Z59A 3CF2A 5EQTA 2EJSA 2VF8A 4IBEA 4K0KM 1IBLM 3HJ8A 1IY2A 4DBGB 2LVPC 1QUTA 1V34A 4WP2A 3W67A 4JI8M 4MGIE 2VQEM 3SC3A 3KP0E 3GLGA 2OOAA 2G3QA 1NHGC 4II7A 1OAOC 3B7NA 3CF0A 4RF1A 2V1UA 2FE8A 1HNXM 2QNJA 3HJQA 3HY5A 5KO3A 2JY7A 1PJJA 1HR0M 3Q8GA 5LMNM 2Z4SA 2EA0A 1QAOA 2RRUA 1VEJA 1N36M 3UGJA 1WXQA 3T38A 2KHHA 4QOZC 2DAKA 1IXSA 4M9XA 1ZMWA 1IXRC 1D2NA 3R9XB 4Z8XA 4JYAM 3GQ3A 1SXJD 2F5OA 1GO5A 1NSFA 4Y28F 2DAMA 4LF4M 1E94E 3KP1E 5IT9S 3GLIE 3U60A 2XZUA 3HU3A 1GL7A 1ZAEA 2JUJA 3J27B 1ORYB 1XB2B 4JI6M 4AZFA 2R44A 3J7BA 2H1RA 2D7HA 2QSFX 4UN2B 4DV2M 3PFIA 3W0LB 2YNMD 3A42A 2R4EA 3GLFA 2BWBA 1QZMA 1WGNA 5EP4A 3VLFB 1BVSA 2CP8A 5ITRA 3U5ZB 2XGNA 2DNAA 2DZOB 3L27A 4GIPA 3L29A 1NJFA 5JI3E 3J81S 4DV3M 2DHRA 2KNAA 4HL4A 2MH8A 4IBFA 4JI7M 3FYDA 5IWAM 3A45A 1L8QA 3LCUA 2R18A 1N33M 3QYBA 1MJGM 4L16A 3J80S 1GABA 3HZJA 4DR5M 1J7KA 3CF6E 4GKJM 2UUAM 1IQPA 3HX3A 1QVRA 1A5TA 2QENA 2HCBA 2DWLA 3FKEA 4MB7A 3E9SA 1C7YA 1DGHB 2EUCA 2G8LA 2MJ5B 4LF7M 2DAIA 4DR6M 3K2LA 5ITQA 1QUSA 1N77A 1GL6A 2J7NA 3B74A 2UU9M 1ZQ9A 2EKFA 3H4MA 2LHGA 3D8BA 4DV7M 1N78A 3EIEA 2GNOA 3DZDA 1EFUB 1PJTA 1SXJB 3SHGB 5ITXE 2L4FA 2L6OA 3AV0A 1ZMVA 5EP2A 5FTMA 3H4JA 4MGKE 3RGSA 2QBYB 5FTKA 1MU5A 1T3TA 3GRVA 3I04M 4CGYB 1XXHE 3LW5F 5FSWA 3UMMA 3KOYE 2YQZA 3LQQA 4BLCA 3LVWA 4B7HA 2JP7A 5KPTA 5E6JA 3IG5A 4BBAA 5C1BA 2LH0A 4GC5A 2XFTA 1DGFA 2DHYA 3W68A 4JI1M 4LF8M 2OOBA 1IN5A 3L2AA 4MH0E 4I8OA 4JI5M 5BR8M 2XZFA 2UUCM 2M5ZA 1OFHA 1V33A 2JY8A 4OU7A 3I51A 1NNUC 1NV9A 1X37A 4RNAA 4GHLA 1R2YA 4GITA 2EKKA 3GRUA 1QYRA 3IG8A 2F5QA 2B3TA 2LVNC 3U5ZA 1G4AE 2BNKA 3LQRA 4X66M 3FTFA 4AI6A 1Q39A 1Z5AA 2R6FA 3VDUA 3SAVA 4NRVA 1FNNA 4JV5M 3BXWA 4LG2A 4DV0M 2EO2A 2CHVA 2C5RA 4MGZE 3B7ZA 3PNYA 1GKIA 3UZUA 3HHZA 4EIWA 3VK7A 3L25A 5EXXA 4IBIA 5DYGA 3SFZA 3HU1A 4GH9A 3MMPA 1HT1E 1YLAA 2BJWA 2ZAOA 3GLHB 2QZ4A 3FTDA 3GP1A 1V92A 2LVAA 2R0IA 2WZJA 3U6LA 3AJIB 4FCTA 4M9SA 1DGHA 4P16A 2CEAA 1WJ7A 4DV4M 4I81A 1TR8A 2LWXA 2MROB 3E46A 4JI4M 2K47A 4L78A 3TWMA 1P3QQ 4LJ6A 1IXZA 2LVOC 3U6DA 3FUUA 4X62M 3A46A 1SXJA 1OIZA 3TL4X 4JI3M 3TWKA 3WHKA 2QBYA 2ERCA 3MJ5A 3K9PA 4NSRA 2FS1A 4AKHA 2CV0A 4JI0M 3U61B 4PCZA 4D82A 1XXHB 4M9ZA 3TWLA 3ZH9B 4AG6A 1IN7A 3PVSA 4S12A 5IZ7D 1GJTA 2JY6B 2Y0TA 3GLIA 4KT0F 2Z3XA 1OJLA 1SG9A 4KO8A 3FUWA 3KSJA 4DV6M 1ZV1A 4IBJA 2QHOB 3E4RA 4LZJA 4YY3M 2Q2EB 1E9RA 4DR1M 3SBJA 1L1TA 1K82A 1TGUA 2UXBM 4LY6A 4REZA 1Y8GA 1YSYA 4FCVA 3T6PA 4DR4M 3J2PB 1QAMA 2X8AA 1VEGA 3DFZA 1DGBA 2O5RA 1Q3CA 1XHBA 2K0BX 2D7EA 1HQYE 2Y20A 1XMQM 1QAQA 2WSEF 3HWSA 2QQ8A 2BWEA 2KZUA 1PJIA 4G4RA 4OW0A 4GMQA 3SMPA 1W5TA 2Z8YM 4GHAA 3GO8A 5KPZA 3GLGE 2I7PA 3B89A 3M0EA 3M7GA 2CV2A 3AFHA 1DO2A 8CATA 4FWGA 2F5PA 2QPAA 2KXEA 3GLHA 3KXEC 1Z6TA 1N32M 3I01M 2C9CA 3GQ5A 3SARA 1IFYA 1TH4A 4NC6A 2XLJA 1OTRA 1GVNA 2HAKA 3C58A 1IN4A 2C98A 4B3TM 3UJNA 3TQSA 1G8PA 2P5TA 3F92A 3K1JA 2KNVA 2HHHM 1F4IA 3D8LA 3TE6A 1HJPA 2RGOA 2HKJA 1N34M 1NV8A 4L6V6 1OQYA 1IBKM 3SATA 1UM8A 3EIHA 5DFLA 1JR3E 4LFCM 4GEWA 3VKHA 3I4VA 7CATA 1SXJC 3SASA 2A5YB 3KFUG 1JR3D 3U61A 1JB0F 1ZMUA 2UXDM 2LHCA 1XXHA 2JWSA 4FCWA 3KW6A 3LMMA 4AKGA 3DOAA 1DO0A 5E26A 3NWLA 4AKIA 1NY5A 3BOSA 3FRIA 3IHPA 4QNMA 3GLFE 1QDTA 3KOWE 1MN3A 1UFZA 1AUAA 2R45A 1WR1B 2R65A 1OFIA 4LJ7A 3I4YA 1Q02A 1XNQM 3PNVA 1OAIA 2X4AA 1R6BX 3HJSA 4JI2M 1MX0A 3FTEA 2AHMA 5A2QS 1VDLA 5FLXS 2XFSA 3GLIB 4LJ8A 4QHTA 1VQ1A 2KW0A 3K8ZA 1QANA 2E5LM 3MHVC 4LJ9A 3HHYA 3U6MA 4R3DA 4LJ5A 5ITUA 4CJ6A 2LXEA 2R4JA 4NL4H 3RE8A 5DYIA 1D0KA 4DUYM 3KSXA 3VFDA 4G6ZA 4B08A 2QCUA 4OVZB 4L8RC 2O01F 1TTEA 1GJSA 4LJAA 2XSZD 3AL0C 3ZCBB 5BPVA 2JXNA 2CFOA 4XGIA 1QZEA 2APLA 2KRKA 3SYLA 1PJSA 2C9OA 3ZC7B 4DR7M 4GKKM 2CWBA 2JY5A 3CGWA 1IBMM 1Z5CA 4OX9M 1TH2A 2VIIA 2VDBB 3L26A 2XF3A 4G4NA 1DV0A 1PJQA 3KOXE 5LMUM 3SAUA 2KRUA 5F3WA 1IY1A 3GQ4A 3QWLA 4D81A 3AOEA 4PD2A 2O25A 4I5SA 2N35A 1PM5A 1G3IA 1N75A 4NSOB 2WSFF 4QHSA 1E9SA 2DVWB 3FUTA 3T15A 4F2LA 4L4UA 2L09A 2Z4RA 2L7IA 1TDZA 1R5LA 3VK8A 4A3VB 2KZSA 2UUBM 2R62A 2L4EA 4LRTA 1NHWC 3GPXA 2F5SA 3U6EA 4B3SM 4AW4A 3GRYA 4FW9A 2OPFA 1IY0A 1L2DA 2YFQA 3AKZA 2XH9A 3MK6A 4NXNM 5EXSA 1I94M 2ZTDA 3KOZE 2DZNB 3UK6A 5EJCA 2H5XA 1AIPC 2DZLA 4B3RM 4NOOB 1HNWM 3RGPA 2Z7JA 2OQ4A 4QOSA 2UXCM 1H6UA 3U6OA 3THGA 2R46A 3E21A 1R7RA 4LFAM 3HHWA 1PRBA 2W82A 5FTLA 2RKOA 1XNRM 3KS4A 3HGIA 3SMSA 4KLNA 1DGGA 3FD9A 3HHXA 3FE3A 3GPUA 3U6SA 5ITTA 3KVWA 4LF6M 3HU2A 5GKNA 2JZ0A 1G71A 2F5NA 3L28A 2OO9A 1NNJA 1VEKA 1R4GA 1KYIA 3ILKA 1YUBA 2LNHC 4M0WA 4YHHM 4LGYA 1J5EM 1FJGM 3GPPA 2KA6B 3FYCA 4GRIA 2HL7A 4OVZA 2FNAA 5KPRA 2RGHA 2K9DA 2DWMA 2FH0A 3FRHA 3FUVA 1E32A 2Y21A 4HLQA 4ZPXA 4W5WA 3T1YM 1SXJE 2DXIA 4X65M 3M6AA 1OKSA 2F4VM 3A98B 4IBKA 2CUZA 5JI2E 2WSCF 3DA1A 3W0FA 4IIWA 3OTOM 1XWIA 3JR4A 2ZM6M 5KQ8A 1HT2E 4Z6YA 4MGHA 2JZ1A 1JR3A 1IN6A 2XEPA 5L8RF 2CV1A 4LZZA 5EP3A 3AOEC 4G4QA 4G3OA 3J7AS 4PDGA 4CISA 4XK8F 4LFBM 4GC9A 1W5SA 1I4WA 4NXMM 3QAUA 1XMOM 2D7GA 2KNZA 5ITXA 1Z5BA 1T43A 1Q3BA 4B3MM 3FTCA 2L2DA 2DKLA 3BBZA 2C96A 2DAGA 3C9PA 2CE7A 1VDDA 3HKPA 2DENA 2DI0A 1EE8A 2QP9X 1QQWA 5DNYA 1R2ZA 3K92A 3LVVA 1CUKA 4AQYM 4WURA 4DR3M 1IM2A 1WGLA 4FWHA 4LJ4A 1NJGA 4XBOA 3PXGA 1D0LA 4DUZM 4JN6A 3KS8A 3T1HM 3AOGA 4IJEA 4TUWA 3SAWA 4KHPM 3QYEA 1HNZM 3Q8XA 3GLHE 2LBCA 3R8FA 1K3XA 3U6QA 3C3EA 1VG5A 4X64M 3JAMS 4NRWA 3NBIA 2DWZB 4LF5M 1TF0B 2C99A 4LGMA 3V76A 4B7GA 3LCVB 2KEBA 5FTJA 2DAEA 5EP1A 2XSZA 4ITQA 4DR2M 4LRSA 4G4OA 2MR9A 2X49A 2K6BA 3NBXX 1L1ZA 4MM3B 4Q7JA 3ZQJA 1WIVA 1PGYA 4R7GA 1L2BA 5ITYA 2ZANA 3TPZA 2HWJA 4AG5A 4L15A 4IBCA 4FVMA 4RF0A 1OIPA 5FTNA 4MGYE 2GQFA 2J7OA 4JXJA 4ANRA 4R71A 3GLGB 3GRRA 4DV1M 2YR0A 3C3DA 3VDPA 1XC8A 4LF9M 3JR5A 4CIZA 4F1IA 4HEOA 4D80A 3FUXA 1T6OA 1LV7A 2FOIC 3VKGA 4FWDA 1J09A 1NVMA 4KODA 4IBBA 4P17A 2BJVA 4PDIA 2ZBKB 2I7NA 2L7HA 2M60A 3CTWB 3IECA 1KSFX 4IBDA 1QDRA 2ZAMA 1IXSB 5C18A 1RU3A 3U6PA 2CHGA 2V1CA 1JQJC 1TH3A 1NO1A 5KQDA 3GPYA 4PT5A 1K3WA 4QNRA 1TDHA 5EXTA 1IN8A 1G41A 5EXPA 3RFWA 1G59A 3B7QA 1NY6A 2CRUA 1LTMA 3U60B 1GLNA 4IJFA 3WHLA 1KFVA 3SYKA 2CHQA 3K9OA 4IBGA 2VQFM 3KDSE 4RKUF 2V6ZM 3U6CA 1C1KA 3SHFA 4CHTB 2FFJA 1YE9A 4BB9A 4B7FA 5IREB 4I4LA 4LCBA
chains in the Genus database with same CATH topology
2K6BA 1EIJA 2CRUA 2FH0A 2JXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6B A;  1EIJ A;  2CRU A;  2FH0 A;  2JXN A; 
#chains in the Genus database with same CATH topology
 2ZTC A;  4M0D A;  2G5G X;  4DV5 M;  1S3S A;  1WHC A;  3GLF B;  4WW0 A;  2Y0Q A;  1D0M A;  2JNH A;  1L2C A;  2NQ8 C;  1HQC A;  2KDL A;  2LTU A;  2LVQ D;  2VF7 A;  3B9P A;  5H37 D;  1EIJ A;  2JA2 A;  2J5Y A;  2MGW A;  2DWN A;  4FD2 A;  1Z59 A;  3CF2 A;  5EQT A;  2EJS A;  2VF8 A;  4IBE A;  4K0K M;  1IBL M;  3HJ8 A;  1IY2 A;  4DBG B;  2LVP C;  1QUT A;  1V34 A;  4WP2 A;  3W67 A;  4JI8 M;  4MGI E;  2VQE M;  3SC3 A;  3KP0 E;  3GLG A;  2OOA A;  2G3Q A;  1NHG C;  4II7 A;  1OAO C;  3B7N A;  3CF0 A;  4RF1 A;  2V1U A;  2FE8 A;  1HNX M;  2QNJ A;  3HJQ A;  3HY5 A;  5KO3 A;  2JY7 A;  1PJJ A;  1HR0 M;  3Q8G A;  5LMN M;  2Z4S A;  2EA0 A;  1QAO A;  2RRU A;  1VEJ A;  1N36 M;  3UGJ A;  1WXQ A;  3T38 A;  2KHH A;  4QOZ C;  2DAK A;  1IXS A;  4M9X A;  1ZMW A;  1IXR C;  1D2N A;  3R9X B;  4Z8X A;  4JYA M;  3GQ3 A;  1SXJ D;  2F5O A;  1GO5 A;  1NSF A;  4Y28 F;  2DAM A;  4LF4 M;  1E94 E;  3KP1 E;  5IT9 S;  3GLI E;  3U60 A;  2XZU A;  3HU3 A;  1GL7 A;  1ZAE A;  2JUJ A;  3J27 B;  1ORY B;  1XB2 B;  4JI6 M;  4AZF A;  2R44 A;  3J7B A;  2H1R A;  2D7H A;  2QSF X;  4UN2 B;  4DV2 M;  3PFI A;  3W0L B;  2YNM D;  3A42 A;  2R4E A;  3GLF A;  2BWB A;  1QZM A;  1WGN A;  5EP4 A;  3VLF B;  1BVS A;  2CP8 A;  5ITR A;  3U5Z B;  2XGN A;  2DNA A;  2DZO B;  3L27 A;  4GIP A;  3L29 A;  1NJF A;  5JI3 E;  3J81 S;  4DV3 M;  2DHR A;  2KNA A;  4HL4 A;  2MH8 A;  4IBF A;  4JI7 M;  3FYD A;  5IWA M;  3A45 A;  1L8Q A;  3LCU A;  2R18 A;  1N33 M;  3QYB A;  1MJG M;  4L16 A;  3J80 S;  1GAB A;  3HZJ A;  4DR5 M;  1J7K A;  3CF6 E;  4GKJ M;  2UUA M;  1IQP A;  3HX3 A;  1QVR A;  1A5T A;  2QEN A;  2HCB A;  2DWL A;  3FKE A;  4MB7 A;  3E9S A;  1C7Y A;  1DGH B;  2EUC A;  2G8L A;  2MJ5 B;  4LF7 M;  2DAI A;  4DR6 M;  3K2L A;  5ITQ A;  1QUS A;  1N77 A;  1GL6 A;  2J7N A;  3B74 A;  2UU9 M;  1ZQ9 A;  2EKF A;  3H4M A;  2LHG A;  3D8B A;  4DV7 M;  1N78 A;  3EIE A;  2GNO A;  3DZD A;  1EFU B;  1PJT A;  1SXJ B;  3SHG B;  5ITX E;  2L4F A;  2L6O A;  3AV0 A;  1ZMV A;  5EP2 A;  5FTM A;  3H4J A;  4MGK E;  3RGS A;  2QBY B;  5FTK A;  1MU5 A;  1T3T A;  3GRV A;  3I04 M;  4CGY B;  1XXH E;  3LW5 F;  5FSW A;  3UMM A;  3KOY E;  2YQZ A;  3LQQ A;  4BLC A;  3LVW A;  4B7H A;  2JP7 A;  5KPT A;  5E6J A;  3IG5 A;  4BBA A;  5C1B A;  2LH0 A;  4GC5 A;  2XFT A;  1DGF A;  2DHY A;  3W68 A;  4JI1 M;  4LF8 M;  2OOB A;  1IN5 A;  3L2A A;  4MH0 E;  4I8O A;  4JI5 M;  5BR8 M;  2XZF A;  2UUC M;  2M5Z A;  1OFH A;  1V33 A;  2JY8 A;  4OU7 A;  3I51 A;  1NNU C;  1NV9 A;  1X37 A;  4RNA A;  4GHL A;  1R2Y A;  4GIT A;  2EKK A;  3GRU A;  1QYR A;  3IG8 A;  2F5Q A;  2B3T A;  2LVN C;  3U5Z A;  1G4A E;  2BNK A;  3LQR A;  4X66 M;  3FTF A;  4AI6 A;  1Q39 A;  1Z5A A;  2R6F A;  3VDU A;  3SAV A;  4NRV A;  1FNN A;  4JV5 M;  3BXW A;  4LG2 A;  4DV0 M;  2EO2 A;  2CHV A;  2C5R A;  4MGZ E;  3B7Z A;  3PNY A;  1GKI A;  3UZU A;  3HHZ A;  4EIW A;  3VK7 A;  3L25 A;  5EXX A;  4IBI A;  5DYG A;  3SFZ A;  3HU1 A;  4GH9 A;  3MMP A;  1HT1 E;  1YLA A;  2BJW A;  2ZAO A;  3GLH B;  2QZ4 A;  3FTD A;  3GP1 A;  1V92 A;  2LVA A;  2R0I A;  2WZJ A;  3U6L A;  3AJI B;  4FCT A;  4M9S A;  1DGH A;  4P16 A;  2CEA A;  1WJ7 A;  4DV4 M;  4I81 A;  1TR8 A;  2LWX A;  2MRO B;  3E46 A;  4JI4 M;  2K47 A;  4L78 A;  3TWM A;  1P3Q Q;  4LJ6 A;  1IXZ A;  2LVO C;  3U6D A;  3FUU A;  4X62 M;  3A46 A;  1SXJ A;  1OIZ A;  3TL4 X;  4JI3 M;  3TWK A;  3WHK A;  2QBY A;  2ERC A;  3MJ5 A;  3K9P A;  4NSR A;  2FS1 A;  4AKH A;  2CV0 A;  4JI0 M;  3U61 B;  4PCZ A;  4D82 A;  1XXH B;  4M9Z A;  3TWL A;  3ZH9 B;  4AG6 A;  1IN7 A;  3PVS A;  4S12 A;  5IZ7 D;  1GJT A;  2JY6 B;  2Y0T A;  3GLI A;  4KT0 F;  2Z3X A;  1OJL A;  1SG9 A;  4KO8 A;  3FUW A;  3KSJ A;  4DV6 M;  1ZV1 A;  4IBJ A;  2QHO B;  3E4R A;  4LZJ A;  4YY3 M;  2Q2E B;  1E9R A;  4DR1 M;  3SBJ A;  1L1T A;  1K82 A;  1TGU A;  2UXB M;  4LY6 A;  4REZ A;  1Y8G A;  1YSY A;  4FCV A;  3T6P A;  4DR4 M;  3J2P B;  1QAM A;  2X8A A;  1VEG A;  3DFZ A;  1DGB A;  2O5R A;  1Q3C A;  1XHB A;  2K0B X;  2D7E A;  1HQY E;  2Y20 A;  1XMQ M;  1QAQ A;  2WSE F;  3HWS A;  2QQ8 A;  2BWE A;  2KZU A;  1PJI A;  4G4R A;  4OW0 A;  4GMQ A;  3SMP A;  1W5T A;  2Z8Y M;  4GHA A;  3GO8 A;  5KPZ A;  3GLG E;  2I7P A;  3B89 A;  3M0E A;  3M7G A;  2CV2 A;  3AFH A;  1DO2 A;  8CAT A;  4FWG A;  2F5P A;  2QPA A;  2KXE A;  3GLH A;  3KXE C;  1Z6T A;  1N32 M;  3I01 M;  2C9C A;  3GQ5 A;  3SAR A;  1IFY A;  1TH4 A;  4NC6 A;  2XLJ A;  1OTR A;  1GVN A;  2HAK A;  3C58 A;  1IN4 A;  2C98 A;  4B3T M;  3UJN A;  3TQS A;  1G8P A;  2P5T A;  3F92 A;  3K1J A;  2KNV A;  2HHH M;  1F4I A;  3D8L A;  3TE6 A;  1HJP A;  2RGO A;  2HKJ A;  1N34 M;  1NV8 A;  4L6V 6;  1OQY A;  1IBK M;  3SAT A;  1UM8 A;  3EIH A;  5DFL A;  1JR3 E;  4LFC M;  4GEW A;  3VKH A;  3I4V A;  7CAT A;  1SXJ C;  3SAS A;  2A5Y B;  3KFU G;  1JR3 D;  3U61 A;  1JB0 F;  1ZMU A;  2UXD M;  2LHC A;  1XXH A;  2JWS A;  4FCW A;  3KW6 A;  3LMM A;  4AKG A;  3DOA A;  1DO0 A;  5E26 A;  3NWL A;  4AKI A;  1NY5 A;  3BOS A;  3FRI A;  3IHP A;  4QNM A;  3GLF E;  1QDT A;  3KOW E;  1MN3 A;  1UFZ A;  1AUA A;  2R45 A;  1WR1 B;  2R65 A;  1OFI A;  4LJ7 A;  3I4Y A;  1Q02 A;  1XNQ M;  3PNV A;  1OAI A;  2X4A A;  1R6B X;  3HJS A;  4JI2 M;  1MX0 A;  3FTE A;  2AHM A;  5A2Q S;  1VDL A;  5FLX S;  2XFS A;  3GLI B;  4LJ8 A;  4QHT A;  1VQ1 A;  2KW0 A;  3K8Z A;  1QAN A;  2E5L M;  3MHV C;  4LJ9 A;  3HHY A;  3U6M A;  4R3D A;  4LJ5 A;  5ITU A;  4CJ6 A;  2LXE A;  2R4J A;  4NL4 H;  3RE8 A;  5DYI A;  1D0K A;  4DUY M;  3KSX A;  3VFD A;  4G6Z A;  4B08 A;  2QCU A;  4OVZ B;  4L8R C;  2O01 F;  1TTE A;  1GJS A;  4LJA A;  2XSZ D;  3AL0 C;  3ZCB B;  5BPV A;  2JXN A;  2CFO A;  4XGI A;  1QZE A;  2APL A;  2KRK A;  3SYL A;  1PJS A;  2C9O A;  3ZC7 B;  4DR7 M;  4GKK M;  2CWB A;  2JY5 A;  3CGW A;  1IBM M;  1Z5C A;  4OX9 M;  1TH2 A;  2VII A;  2VDB B;  3L26 A;  2XF3 A;  4G4N A;  1DV0 A;  1PJQ A;  3KOX E;  5LMU M;  3SAU A;  2KRU A;  5F3W A;  1IY1 A;  3GQ4 A;  3QWL A;  4D81 A;  3AOE A;  4PD2 A;  2O25 A;  4I5S A;  2N35 A;  1PM5 A;  1G3I A;  1N75 A;  4NSO B;  2WSF F;  4QHS A;  1E9S A;  2DVW B;  3FUT A;  3T15 A;  4F2L A;  4L4U A;  2L09 A;  2Z4R A;  2L7I A;  1TDZ A;  1R5L A;  3VK8 A;  4A3V B;  2KZS A;  2UUB M;  2R62 A;  2L4E A;  4LRT A;  1NHW C;  3GPX A;  2F5S A;  3U6E A;  4B3S M;  4AW4 A;  3GRY A;  4FW9 A;  2OPF A;  1IY0 A;  1L2D A;  2YFQ A;  3AKZ A;  2XH9 A;  3MK6 A;  4NXN M;  5EXS A;  1I94 M;  2ZTD A;  3KOZ E;  2DZN B;  3UK6 A;  5EJC A;  2H5X A;  1AIP C;  2DZL A;  4B3R M;  4NOO B;  1HNW M;  3RGP A;  2Z7J A;  2OQ4 A;  4QOS A;  2UXC M;  1H6U A;  3U6O A;  3THG A;  2R46 A;  3E21 A;  1R7R A;  4LFA M;  3HHW A;  1PRB A;  2W82 A;  5FTL A;  2RKO A;  1XNR M;  3KS4 A;  3HGI A;  3SMS A;  4KLN A;  1DGG A;  3FD9 A;  3HHX A;  3FE3 A;  3GPU A;  3U6S A;  5ITT A;  3KVW A;  4LF6 M;  3HU2 A;  5GKN A;  2JZ0 A;  1G71 A;  2F5N A;  3L28 A;  2OO9 A;  1NNJ A;  1VEK A;  1R4G A;  1KYI A;  3ILK A;  1YUB A;  2LNH C;  4M0W A;  4YHH M;  4LGY A;  1J5E M;  1FJG M;  3GPP A;  2KA6 B;  3FYC A;  4GRI A;  2HL7 A;  4OVZ A;  2FNA A;  5KPR A;  2RGH A;  2K9D A;  2DWM A;  2FH0 A;  3FRH A;  3FUV A;  1E32 A;  2Y21 A;  4HLQ A;  4ZPX A;  4W5W A;  3T1Y M;  1SXJ E;  2DXI A;  4X65 M;  3M6A A;  1OKS A;  2F4V M;  3A98 B;  4IBK A;  2CUZ A;  5JI2 E;  2WSC F;  3DA1 A;  3W0F A;  4IIW A;  3OTO M;  1XWI A;  3JR4 A;  2ZM6 M;  5KQ8 A;  1HT2 E;  4Z6Y A;  4MGH A;  2JZ1 A;  1JR3 A;  1IN6 A;  2XEP A;  5L8R F;  2CV1 A;  4LZZ A;  5EP3 A;  3AOE C;  4G4Q A;  4G3O A;  3J7A S;  4PDG A;  4CIS A;  4XK8 F;  4LFB M;  4GC9 A;  1W5S A;  1I4W A;  4NXM M;  3QAU A;  1XMO M;  2D7G A;  2KNZ A;  5ITX A;  1Z5B A;  1T43 A;  1Q3B A;  4B3M M;  3FTC A;  2L2D A;  2DKL A;  3BBZ A;  2C96 A;  2DAG A;  3C9P A;  2CE7 A;  1VDD A;  3HKP A;  2DEN A;  2DI0 A;  1EE8 A;  2QP9 X;  1QQW A;  5DNY A;  1R2Z A;  3K92 A;  3LVV A;  1CUK A;  4AQY M;  4WUR A;  4DR3 M;  1IM2 A;  1WGL A;  4FWH A;  4LJ4 A;  1NJG A;  4XBO A;  3PXG A;  1D0L A;  4DUZ M;  4JN6 A;  3KS8 A;  3T1H M;  3AOG A;  4IJE A;  4TUW A;  3SAW A;  4KHP M;  3QYE A;  1HNZ M;  3Q8X A;  3GLH E;  2LBC A;  3R8F A;  1K3X A;  3U6Q A;  3C3E A;  1VG5 A;  4X64 M;  3JAM S;  4NRW A;  3NBI A;  2DWZ B;  4LF5 M;  1TF0 B;  2C99 A;  4LGM A;  3V76 A;  4B7G A;  3LCV B;  2KEB A;  5FTJ A;  2DAE A;  5EP1 A;  2XSZ A;  4ITQ A;  4DR2 M;  4LRS A;  4G4O A;  2MR9 A;  2X49 A;  2K6B A;  3NBX X;  1L1Z A;  4MM3 B;  4Q7J A;  3ZQJ A;  1WIV A;  1PGY A;  4R7G A;  1L2B A;  5ITY A;  2ZAN A;  3TPZ A;  2HWJ A;  4AG5 A;  4L15 A;  4IBC A;  4FVM A;  4RF0 A;  1OIP A;  5FTN A;  4MGY E;  2GQF A;  2J7O A;  4JXJ A;  4ANR A;  4R71 A;  3GLG B;  3GRR A;  4DV1 M;  2YR0 A;  3C3D A;  3VDP A;  1XC8 A;  4LF9 M;  3JR5 A;  4CIZ A;  4F1I A;  4HEO A;  4D80 A;  3FUX A;  1T6O A;  1LV7 A;  2FOI C;  3VKG A;  4FWD A;  1J09 A;  1NVM A;  4KOD A;  4IBB A;  4P17 A;  2BJV A;  4PDI A;  2ZBK B;  2I7N A;  2L7H A;  2M60 A;  3CTW B;  3IEC A;  1KSF X;  4IBD A;  1QDR A;  2ZAM A;  1IXS B;  5C18 A;  1RU3 A;  3U6P A;  2CHG A;  2V1C A;  1JQJ C;  1TH3 A;  1NO1 A;  5KQD A;  3GPY A;  4PT5 A;  1K3W A;  4QNR A;  1TDH A;  5EXT A;  1IN8 A;  1G41 A;  5EXP A;  3RFW A;  1G59 A;  3B7Q A;  1NY6 A;  2CRU A;  1LTM A;  3U60 B;  1GLN A;  4IJF A;  3WHL A;  1KFV A;  3SYK A;  2CHQ A;  3K9O A;  4IBG A;  2VQF M;  3KDS E;  4RKU F;  2V6Z M;  3U6C A;  1C1K A;  3SHF A;  4CHT B;  2FFJ A;  1YE9 A;  4BB9 A;  4B7F A;  5IRE B;  4I4L A;  4LCB A; 
#chains in the Genus database with same CATH homology
 2K6B A;  1EIJ A;  2CRU A;  2FH0 A;  2JXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...