2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
b'GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
2Y0TA 4I5SA 2Y20A 2Y21A 2L7IA 2Y0QA 2L7HA
chains in the Genus database with same CATH superfamily
2Z7JA 5KO3A 3VLFB 4LZZA 3LCUA 2EJSA 4BBAA 4FW9A 1W5TA 3VKGA 4RKUF 2C98A 2L2DA 1TGUA 1IBKM 3GRRA 2DWNA 3LMMA 2KA6B 1XMQM 4PCZA 4DBGB 1DO2A 4LFBM 1VEGA 4OVZA 1K3WA 2C5RA 3GLFB 7CATA 1IN4A 2R65A 3UK6A 4X65M 2XF3A 5ITQA 3DOAA 1ZMUA 3B89A 3KP0E 4JN6A 4GEWA 3B7NA 4IJFA 4M0WA 4NOOB 3KW6A 1MU5A 3A98B 2LTUA 2W82A 3DZDA 3H4JA 4LZJA 2OQ4A 5FSWA 2M5ZA 4L16A 2BWBA 2VIIA 3T6PA 4BB9A 3VKHA 2DAGA 4LRTA 3AOEC 3AOEA 3FD9A 4IIWA 3GRYA 1T43A 4LF8M 3BBZA 2EUCA 4LG2A 1J7KA 3H4MA 2Y0QA 2CUZA 4FCWA 3J80S 2XEPA 5JI2E 3GPYA 1E9SA 4DUYM 3GLGB 3TQSA 2QQ8A 4G4OA 1LTMA 1RU3A 3C3EA 3K9OA 2JNHA 2HAKA 1VG5A 2LVPC 3GQ4A 1OAIA 1IN5A 4LJ8A 4HEOA 1XXHA 3L29A 2WSEF 2OOBA 5GKNA 1ZMVA 4LFCM 4LGYA 1MN3A 4AKIA 1EFUB 3SMSA 4IJEA 2F4VM 1L2CA 5EP2A 2LBCA 2CHGA 4GRIA 1OQYA 1XNRM 4GH9A 1IXZA 4FVMA 3J81S 1XMOM 3A42A 1N32M 3KOWE 2R4JA 2KZSA 1HQCA 3B9PA 1KSFX 1GLNA 2CFOA 1QAQA 2QSFX 3T1HM 1QAMA 1AIPC 3FUXA 2DVWB 1MJGM 1IQPA 2D7HA 5ITXA 3GPPA 4AKHA 2D7GA 2GNOA 2I7NA 5ITYA 5ITUA 1IN6A 4JXJA 2JY8A 1R2ZA 4X64M 3T15A 3B7QA 2G3QA 1TH3A 2J7OA 3CGWA 4ITQA 2HKJA 4JI2M 4IBEA 4DR2M 3EIHA 4JI8M 3U60A 3SATA 4B3SM 1TH2A 2XZFA 3U6DA 1OIPA 2XFSA 4L4UA 3JR5A 1L2BA 4IBJA 4M9ZA 4P17A 1VEKA 4I81A 1QYRA 4LGMA 5FTLA 3KS8A 1N78A 4BLCA 2LHCA 3NBIA 3M6AA 4JI1M 4L15A 1R5LA 3ZCBB 3UMMA 3E46A 3HHXA 4G6ZA 4DR7M 1H6UA 1QUSA 2ZANA 3FUWA 3U6QA 1C7YA 3M7GA 3SYLA 3I51A 3SHFA 4DV3M 2R62A 4DV4M 2H5XA 2F5PA 3K1JA 2WSFF 1J09A 4JI7M 2L4FA 4UN2B 1VDLA 2QBYA 1Q3CA 2DZNB 2F5NA 2LXEA 4KHPM 3DA1A 2DAEA 2NQ8C 4GHLA 2QPAA 3LCVB 4JI4M 3RFWA 3KFUG 1I4WA 4MGHA 3GPXA 3Q8XA 2O5RA 3KDSE 2F5QA 4AI6A 3U6CA 2YFQA 3HKPA 3LQRA 4HL4A 4G4QA 4MH0E 5E6JA 2L7IA 3U61A 3KVWA 4M0DA 2F5OA 4AKGA 3LQQA 3SFZA 4DV2M 5IT9S 1EIJA 4LF5M 2CHQA 4LF4M 3TWMA 2L6OA 2H1RA 5LMNM 1PJTA 4X66M 4ZPXA 4QOZC 1HJPA 1XXHB 3ILKA 1FNNA 3NBXX 2CWBA 2VF7A 1IY1A 3IECA 4D81A 4K0KM 3U5ZA 2FH0A 1Y8GA 3K92A 1HR0M 1SXJC 2JZ1A 1SXJA 1Z5BA 1UFZA 4XBOA 2Y0TA 3JAMS 3TE6A 2FS1A 4LJ7A 1KYIA 4GMQA 3JR4A 1JR3A 3CF0A 3C58A 4QNMA 5L8RF 4LF7M 3HHZA 1D2NA 1TDZA 4B3RM 1X37A 1GJTA 1IXSB 1W5SA 2DHYA 2LNHC 2CRUA 2EKKA 1QZMA 3BOSA 3A46A 5FLXS 3VFDA 3ZC7B 4MB7A 1OIZA 1NV8A 5LMUM 1SXJE 2KNVA 3I01M 1TTEA 3L2AA 1G59A 3U60B 2DZOB 2OOAA 4LF6M 4I4LA 3R9XB 3KSJA 3ZH9B 1CUKA 2CP8A 5DFLA 1JR3E 4WURA 2ZAMA 1A5TA 1DO0A 2ZTDA 4GC5A 4IBGA 4MGIE 4DR4M 3V76A 1NJGA 3FTEA 3U6SA 4JV5M 3IHPA 3KOZE 2JY7A 2KDLA 3E21A 3LVVA 3GPUA 3VK7A 2ZTCA 3RGSA 3SHGB 3HJQA 3Q8GA 4TUWA 4B08A 1PM5A 4WP2A 3HWSA 3GLHA 1NHWC 1IM2A 4GKJM 2UUBM 3AL0C 2K9DA 4JYAM 4GC9A 1JQJC 1L1ZA 4LF9M 3SASA 1OAOC 1N75A 4R3DA 2A5YB 1J5EM 3VK8A 1S3SA 4YY3M 2JUJA 2QBYB 1N33M 4DR1M 1OKSA 1QUTA 4QNRA 2OPFA 1ZQ9A 1VDDA 3UZUA 4A3VB 2CV2A 4B7FA 3UGJA 4PDGA 3MMPA 4B3TM 1DGHA 2Y20A 2F5SA 1ZMWA 1QANA 3A45A 3GLHE 2HCBA 1YLAA 5JI3E 4JI3M 3AV0A 3F92A 3HU3A 4NSOB 1QDRA 3U61B 3HU2A 4CHTB 2UUCM 1UM8A 4DR3M 2J5YA 3K8ZA 3K9PA 2DWZB 4B7HA 4GKKM 3AOGA 2MROB 2GQFA 3AFHA 4NXMM 2RRUA 3FTCA 3AKZA 3GQ5A 2FE8A 4M9SA 2HHHM 2KNAA 2UXCM 2R44A 3J7BA 5ITRA 3U5ZB 2KEBA 1V33A 2YR0A 1GKIA 2KNZA 1IY0A 1OJLA 1SXJB 1L8QA 2Z3XA 2DHRA 2BNKA 1DGGA 1NNJA 1Z59A 1E9RA 3W68A 4R71A 3SAUA 4MGYE 3CTWB 4FCVA 3FUVA 3C3DA 4AG5A 1KFVA 2DWLA 3PNYA 3B74A 3KS4A 2C9OA 3MJ5A 4FWDA 2KRUA 2LWXA 4LCBA 4II7A 2APLA 4FCTA 5DYIA 3NWLA 2R46A 4PT5A 2D7EA 5BR8M 4KLNA 2DXIA 4X62M 3D8BA 4XK8F 3L27A 2ZM6M 4Y28F 1NSFA 4AZFA 4KO8A 4PDIA 1HNXM 1VEJA 2QNJA 2DKLA 1QQWA 4AW4A 4JI5M 4OVZB 5ITTA 3THGA 5FTJA 1K82A 1DGFA 2L4EA 1D0MA 2ZBKB 4LJ4A 2C99A 4B7GA 2HWJA 3FUUA 2BWEA 3CF2A 4NSRA 4F2LA 4IBFA 2UXBM 3GLHB 2KW0A 5FTKA 4GHAA 3GLIE 4QHSA 1L2DA 3U6LA 3FRIA 1HNZM 2X49A 2MJ5B 2KZUA 1F4IA 3BXWA 4PD2A 3FTFA 5DYGA 4R7GA 1G41A 3U6MA 4L78A 2ERCA 3VDPA 3FRHA 4IBKA 1MX0A 4QOSA 1N36M 3HHWA 3U6PA 4RF1A 5FTNA 3LVWA 4NL4H 1ORYB 2X8AA 2JY6B 3OTOM 4QHTA 2Q2EB 2LVNC 5EP1A 2C96A 4YHHM 1HQYE 3R8FA 2HL7A 4JI0M 2R0IA 2K0BX 2MR9A 2XSZA 2QP9X 3QWLA 3D8LA 2VQFM 4G4RA 3IG5A 1DGBA 4XGIA 1G4AE 4FWGA 5E26A 4S12A 2BJWA 1D0KA 1TH4A 3AJIB 2C9CA 5EP3A 3FE3A 3ZQJA 4CISA 3C9PA 2Y21A 3PVSA 3GLGA 4MGKE 1QDTA 1WJ7A 2K6BA 3FYDA 3PNVA 5H37D 5EXXA 2V1CA 2RGOA 1K3XA 5KQDA 2N35A 1Q02A 4OX9M 1Z5CA 1IN7A 1LV7A 1Q39A 1TF0B 3TWKA 1IBLM 3SARA 4GITA 2LH0A 3L28A 1WIVA 3HJ8A 3HHYA 3J7AS 1GJSA 4DV6M 2JZ0A 3GLGE 4L6V6 2I7PA 5KQ8A 2L09A 5KPZA 3K2LA 4GIPA 3SMPA 3W0LB 4NXNM 2RKOA 1IBMM 4OW0A 3KOYE 3EIEA 2DENA 4OU7A 3GO8A 4RF0A 3L25A 4KODA 3HZJA 4DUZM 4LY6A 4LJ6A 1TDHA 1I94M 2XH9A 2G8LA 4D82A 1XB2B 3DFZA 1XWIA 2O01F 3U6OA 1OFHA 4AQYM 1XC8A 1Z5AA 5A2QS 2CV1A 2FNAA 3IG8A 8CATA 2EKFA 2EA0A 3RE8A 4W5WA 1SG9A 2AHMA 3GRUA 4CGYB 1C1KA 1R4GA 3FUTA 1NJFA 2JXNA 1OTRA 3HGIA 3FTDA 4D80A 3SAWA 4FD2A 5EQTA 4Q7JA 5IREB 1T3TA 1TR8A 2DAIA 1PJJA 4DR5M 4CJ6A 1NVMA 1OFIA 3L26A 4HLQA 3UJNA 2R6FA 5IWAM 1WGLA 4B3MM 1P3QQ 3W67A 3HJSA 2R18A 2YNMD 4P16A 2DI0A 4MM3B 3TPZA 2DAKA 2UXDM 3TWLA 3GRVA 3I4VA 1WXQA 3J27B 1NY6A 2B3TA 1Z6TA 1WHCA 2LHGA 1G8PA 2KHHA 1NHGC 1T6OA 2JA2A 3FKEA 1AUAA 2WSCF 1JB0F 4MGZE 5FTMA 4Z6YA 3T1YM 4G3OA 3HX3A 2MH8A 2ZAOA 4KT0F 3B7ZA 1R7RA 2V1UA 3SC3A 5F3WA 1R6BX 1IXRC 2RGHA 2VF8A 2E5LM 3GLIA 1GL7A 2X4AA 3KOXE 1GABA 2DWMA 1NNUC 2XFTA 3HU1A 3QAUA 1L1TA 1FJGM 2JP7A 2JWSA 1WR1B 2UU9M 3SYKA 1DV0A 1IXSA 4DV7M 4M9XA 1XXHE 4NC6A 1WGNA 2QENA 1VQ1A 1IFYA 1N77A 2XLJA 3KSXA 5BPVA 2MGWA 1E94E 3GP1A 2JY5A 3QYBA 1HT1E 3E9SA 2Z4SA 2XSZD 2CHVA 3PXGA 2CV0A 1R2YA 3E4RA 2YQZA 1QAOA 3GQ3A 2J7NA 4LRSA 3RGPA 5ITXE 4LFAM 1SXJD 5EXPA 4ANRA 4G4NA 1PRBA 5EJCA 3GLFA 2KXEA 2O25A 1IN8A 2LVOC 2R45A 2BJVA 5EP4A 1NY5A 4DR6M 5KPTA 3I4YA 2L7HA 1YUBA 1JR3D 1QVRA 1DGHB 1G3IA 4NRVA 3TL4X 5EXTA 5C1BA 4Z8XA 3M0EA 2KRKA 1BVSA 1PJQA 3LW5F 2Z8YM 1HNWM 1GVNA 2V6ZM 4CIZA 2CE7A 2LVAA 4L8RC 4DV1M 4NRWA 1PGYA 1V34A 2P5TA 3J2PB 4REZA 3GLFE 2QZ4A 2DAMA 4LJ5A 4I5SA 2QCUA 2OO9A 2QHOB 3WHLA 4IBDA 3MHVC 2EO2A 3HY5A 3WHKA 1V92A 4IBCA 3W0FA 3KXEC 3VDUA 1ZAEA 2VDBB 1GL6A 2CEAA 3FYCA 3MK6A 1HT2E 4FWHA 1XHBA 1Q3BA 4RNAA 1PJSA 3SBJA 4I8OA 1XNQM 4IBBA 2G5GX 3PFIA 3QYEA 2K47A 2DNAA 2XGNA 3T38A 3CF6E 1EE8A 4DV5M 4EIWA 2DZLA 5DNYA 1G71A 1PJIA 3I04M 1E32A 2M60A 1D0LA 4AG6A 3SAVA 1N34M 2XZUA 3U6EA 5KPRA 2VQEM 3GLIB 1GO5A 1QZEA 5EXSA 1NO1A 1YE9A 4LJ9A 2FOIC 2R4EA 1IY2A 4JI6M 2WZJA 1YSYA 3KP1E 5C18A 2FFJA 4LJAA 4F1IA 4DV0M 4IBIA 2Z4RA 5IZ7D 1ZV1A 2UUAM 1NV9A 2LVQD 4WW0A
chains in the Genus database with same CATH topology
2Z7JA 5KO3A 3VLFB 4LZZA 4BBAA 4FW9A 1W5TA 3VKGA 2C98A 1IBKM 1TGUA 3GRRA 2DWNA 3LMMA 2KA6B 1XMQM 4PCZA 1DO2A 4LFBM 1K3WA 4OVZA 2C5RA 3GLFB 7CATA 1IN4A 2R65A 3UK6A 4X65M 2XF3A 5ITQA 3DOAA 3KP0E 4JN6A 4IJFA 4M0WA 4NOOB 3KW6A 1MU5A 3A98B 2W82A 3DZDA 4LZJA 2OQ4A 5FSWA 2M5ZA 4L16A 2VIIA 4BB9A 3VKHA 4LRTA 3AOEC 3AOEA 3FD9A 4IIWA 3GRYA 4LF8M 2EUCA 4LG2A 1J7KA 3H4MA 2Y0QA 2CUZA 4FCWA 3J80S 2XEPA 5JI2E 3GPYA 1E9SA 4DUYM 3GLGB 3TQSA 4G4OA 3GQ4A 1IN5A 4LJ8A 1XXHA 3L29A 5GKNA 4LFCM 4LGYA 4AKIA 3SMSA 4IJEA 2F4VM 1L2CA 5EP2A 2CHGA 4GRIA 1XNRM 4GH9A 1IXZA 4FVMA 3J81S 1XMOM 3A42A 1N32M 3KOWE 2R4JA 2KZSA 1HQCA 3B9PA 1KSFX 1GLNA 2CFOA 1QAQA 3T1HM 1QAMA 3FUXA 2DVWB 1IQPA 2D7HA 5ITXA 3GPPA 4AKHA 2D7GA 2I7NA 5ITYA 5ITUA 1IN6A 4JXJA 1R2ZA 4X64M 3T15A 1TH3A 2J7OA 4ITQA 2HKJA 4JI2M 4IBEA 4DR2M 3EIHA 4JI8M 3U60A 3SATA 4B3SM 1TH2A 2XZFA 3U6DA 2XFSA 4L4UA 1L2BA 3JR5A 4IBJA 4M9ZA 4I81A 1QYRA 4LGMA 5FTLA 3KS8A 1N78A 4BLCA 3NBIA 3M6AA 4JI1M 4L15A 3ZCBB 3UMMA 4G6ZA 3HHXA 4DR7M 1H6UA 2ZANA 3FUWA 3U6QA 3M7GA 3SYLA 3I51A 3SHFA 4DV3M 2R62A 4DV4M 2F5PA 3K1JA 1J09A 4JI7M 2QBYA 1Q3CA 2DZNB 2F5NA 2LXEA 4KHPM 3DA1A 4GHLA 2NQ8C 2QPAA 4JI4M 3RFWA 3KFUG 1I4WA 4MGHA 3GPXA 3Q8XA 2O5RA 3KDSE 2F5QA 4AI6A 3U6CA 2YFQA 3HKPA 3LQRA 4HL4A 4G4QA 4MH0E 5E6JA 2L7IA 3U61A 3KVWA 4M0DA 2F5OA 4AKGA 3LQQA 3SFZA 4DV2M 5IT9S 4LF5M 2CHQA 4LF4M 3TWMA 2L6OA 2H1RA 5LMNM 4X66M 4ZPXA 4QOZC 1XXHB 3ILKA 4D81A 1FNNA 1IY1A 4K0KM 3U5ZA 3K92A 1HR0M 1SXJC 1SXJA 1Z5BA 4XBOA 2Y0TA 3JAMS 3TE6A 4LJ7A 1KYIA 4GMQA 3JR4A 1JR3A 3CF0A 3C58A 4QNMA 4LF7M 3HHZA 1D2NA 1TDZA 4B3RM 1X37A 1IXSB 1W5SA 2LNHC 1QZMA 3BOSA 3A46A 5FLXS 3VFDA 3ZC7B 4MB7A 5LMUM 1SXJE 3L2AA 1G59A 3U60B 2DZOB 4LF6M 4I4LA 3R9XB 3KSJA 3ZH9B 4WURA 2ZAMA 1DO0A 4GC5A 4IBGA 4MGIE 4DR4M 1NJGA 3FTEA 3U6SA 4JV5M 3LVVA 3KOZE 3GPUA 3VK7A 3RGSA 3SHGB 3HJQA 4TUWA 4B08A 1PM5A 3HWSA 3GLHA 1NHWC 1IM2A 4GKJM 2UUBM 3AL0C 4JYAM 4GC9A 1JQJC 1L1ZA 4LF9M 3SASA 1N75A 4R3DA 2A5YB 1J5EM 3VK8A 1S3SA 4YY3M 2QBYB 1N33M 4DR1M 4QNRA 2OPFA 1ZQ9A 1VDDA 3UZUA 4A3VB 2CV2A 4B7FA 3UGJA 4PDGA 4B3TM 1DGHA 2Y20A 2F5SA 1QANA 3A45A 2HCBA 5JI3E 4JI3M 3AV0A 4NSOB 3HU3A 3U61B 3HU2A 4CHTB 2UUCM 1UM8A 4DR3M 3K8ZA 2DWZB 4B7HA 4GKKM 3AOGA 3AFHA 4NXMM 3FTCA 3AKZA 3GQ5A 2FE8A 4M9SA 2HHHM 2UXCM 3J7BA 5ITRA 3U5ZB 2KEBA 2YR0A 1GKIA 1IY0A 1OJLA 1SXJB 1L8QA 2Z3XA 2DHRA 2BNKA 1DGGA 1NNJA 1Z59A 1E9RA 3SAUA 4MGYE 3CTWB 4FCVA 3FUVA 4AG5A 1KFVA 2DWLA 3PNYA 3KS4A 3MJ5A 2C9OA 5DYGA 4FWDA 2KRUA 2LWXA 4LCBA 4II7A 4JI0M 4FCTA 5DYIA 3NWLA 2R46A 4PT5A 2D7EA 5BR8M 4KLNA 2DXIA 4X62M 3D8BA 3L27A 2ZM6M 1NSFA 4AZFA 4KO8A 4PDIA 1HNXM 1QQWA 4AW4A 4JI5M 4OVZB 5ITTA 3THGA 5FTJA 1K82A 1DGFA 2ZBKB 4LJ4A 2C99A 4B7GA 3FUUA 3CF2A 4NSRA 4IBFA 2UXBM 3GLHB 2KW0A 5FTKA 4GHAA 4QHSA 1L2DA 3U6LA 1HNZM 2X49A 2KZUA 4PD2A 3FTFA 4R7GA 1G41A 3U6MA 4L78A 2ERCA 3VDPA 4IBKA 1MX0A 4QOSA 1N36M 3HHWA 3U6PA 4RF1A 5FTNA 3LVWA 4NL4H 1ORYB 2X8AA 3OTOM 4QHTA 2Q2EB 5EP1A 2C96A 4YHHM 1HQYE 3R8FA 2HL7A 4G4RA 2XSZA 3QWLA 2QP9X 2VQFM 3D8LA 3IG5A 1DGBA 4XGIA 1G4AE 4FWGA 5E26A 4S12A 2BJWA 1TH4A 3AJIB 2C9CA 5EP3A 4CISA 2Y21A 3PVSA 3GLGA 4MGKE 3FYDA 3PNVA 5H37D 5EXXA 2V1CA 2RGOA 1K3XA 5KQDA 4OX9M 1Z5CA 1Q39A 1IN7A 1LV7A 3TWKA 1IBLM 3SARA 4GITA 2LH0A 3L28A 3HJ8A 3HHYA 3J7AS 4DV6M 2I7PA 5KQ8A 2L09A 5KPZA 3K2LA 4GIPA 3SMPA 3W0LB 4NXNM 2RKOA 1IBMM 4OW0A 3KOYE 3EIEA 4OU7A 3GO8A 4RF0A 3L25A 4KODA 4DUZM 4LY6A 4LJ6A 1TDHA 1I94M 2XH9A 2G8LA 4D82A 3DFZA 1XWIA 3U6OA 1OFHA 4AQYM 1XC8A 1Z5AA 5A2QS 2CV1A 2FNAA 3IG8A 8CATA 2EA0A 3RE8A 4W5WA 2AHMA 3GRUA 4CGYB 1C1KA 3FUTA 1NJFA 3HGIA 3FTDA 4D80A 3SAWA 4FD2A 5EQTA 5IREB 1T3TA 1PJJA 4DR5M 1NVMA 1OFIA 3L26A 4HLQA 3UJNA 5IWAM 4B3MM 3HJSA 2R18A 2YNMD 4P16A 3TPZA 4MM3B 2UXDM 3TWLA 3GRVA 3I4VA 1WXQA 3J27B 1NY6A 1Z6TA 1G8PA 1NHGC 2JA2A 3FKEA 4MGZE 5FTMA 4Z6YA 3T1YM 2ZAOA 1R7RA 2V1UA 3SC3A 5F3WA 1R6BX 1IXRC 2RGHA 2E5LM 3GLIA 1GL7A 2X4AA 3KOXE 2DWMA 1NNUC 2XFTA 3HU1A 3QAUA 1L1TA 1FJGM 2UU9M 3SYKA 4DV7M 4M9XA 2QENA 1N77A 2XLJA 3KSXA 5BPVA 3GP1A 1E94E 1HT1E 3E9SA 2Z4SA 2XSZD 2CHVA 3PXGA 2CV0A 1R2YA 3E4RA 2YQZA 1QAOA 3GQ3A 2J7NA 4LRSA 3RGPA 5ITXE 4LFAM 1SXJD 5EXPA 4G4NA 5EJCA 3GLFA 2KXEA 1IN8A 2R45A 2BJVA 5EP4A 1NY5A 4DR6M 5KPTA 3I4YA 2L7HA 1YUBA 1JR3D 1QVRA 1DGHB 1G3IA 4NRVA 3TL4X 5EXTA 5C1BA 4Z8XA 3M0EA 2KRKA 1HNWM 1GVNA 2V6ZM 2CE7A 4L8RC 4DV1M 4NRWA 2P5TA 3J2PB 4REZA 2QZ4A 4LJ5A 4I5SA 2QCUA 3WHLA 4IBDA 3MHVC 2EO2A 3WHKA 4IBCA 3W0FA 3KXEC 3VDUA 1ZAEA 1GL6A 2CEAA 3FYCA 3MK6A 1HT2E 4FWHA 1XHBA 1Q3BA 4RNAA 1XNQM 3SBJA 4I8OA 4IBBA 2G5GX 3PFIA 2K47A 2XGNA 3T38A 3CF6E 1EE8A 4DV5M 4EIWA 5DNYA 1PJIA 1E32A 2M60A 4AG6A 3SAVA 1N34M 2XZUA 3U6EA 5KPRA 2VQEM 3GLIB 5EXSA 1YE9A 4LJ9A 2FOIC 2R4EA 1IY2A 4JI6M 1YSYA 3KP1E 5C18A 2FFJA 4LJAA 4DV0M 4IBIA 2Z4RA 5IZ7D 2UUAM 4WW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  4I5S A;  2Y20 A;  2Y21 A;  2L7I A;  2Y0Q A;  2L7H A; 
#chains in the Genus database with same CATH topology
 2Z7J A;  5KO3 A;  3VLF B;  4LZZ A;  3LCU A;  2EJS A;  4BBA A;  4FW9 A;  1W5T A;  3VKG A;  4RKU F;  2C98 A;  2L2D A;  1TGU A;  1IBK M;  3GRR A;  2DWN A;  3LMM A;  2KA6 B;  1XMQ M;  4PCZ A;  4DBG B;  1DO2 A;  4LFB M;  1VEG A;  4OVZ A;  1K3W A;  2C5R A;  3GLF B;  7CAT A;  1IN4 A;  2R65 A;  3UK6 A;  4X65 M;  2XF3 A;  5ITQ A;  3DOA A;  1ZMU A;  3B89 A;  3KP0 E;  4JN6 A;  4GEW A;  3B7N A;  4IJF A;  4M0W A;  4NOO B;  3KW6 A;  1MU5 A;  3A98 B;  2LTU A;  2W82 A;  3DZD A;  3H4J A;  4LZJ A;  2OQ4 A;  5FSW A;  2M5Z A;  4L16 A;  2BWB A;  2VII A;  3T6P A;  4BB9 A;  3VKH A;  2DAG A;  4LRT A;  3AOE C;  3AOE A;  3FD9 A;  4IIW A;  3GRY A;  1T43 A;  4LF8 M;  3BBZ A;  2EUC A;  4LG2 A;  1J7K A;  3H4M A;  2Y0Q A;  2CUZ A;  4FCW A;  3J80 S;  2XEP A;  5JI2 E;  3GPY A;  1E9S A;  4DUY M;  3GLG B;  3TQS A;  2QQ8 A;  4G4O A;  1LTM A;  1RU3 A;  3C3E A;  3K9O A;  2JNH A;  2HAK A;  1VG5 A;  2LVP C;  3GQ4 A;  1OAI A;  1IN5 A;  4LJ8 A;  4HEO A;  1XXH A;  3L29 A;  2WSE F;  2OOB A;  5GKN A;  1ZMV A;  4LFC M;  4LGY A;  1MN3 A;  4AKI A;  1EFU B;  3SMS A;  4IJE A;  2F4V M;  1L2C A;  5EP2 A;  2LBC A;  2CHG A;  4GRI A;  1OQY A;  1XNR M;  4GH9 A;  1IXZ A;  4FVM A;  3J81 S;  1XMO M;  3A42 A;  1N32 M;  3KOW E;  2R4J A;  2KZS A;  1HQC A;  3B9P A;  1KSF X;  1GLN A;  2CFO A;  1QAQ A;  2QSF X;  3T1H M;  1QAM A;  1AIP C;  3FUX A;  2DVW B;  1MJG M;  1IQP A;  2D7H A;  5ITX A;  3GPP A;  4AKH A;  2D7G A;  2GNO A;  2I7N A;  5ITY A;  5ITU A;  1IN6 A;  4JXJ A;  2JY8 A;  1R2Z A;  4X64 M;  3T15 A;  3B7Q A;  2G3Q A;  1TH3 A;  2J7O A;  3CGW A;  4ITQ A;  2HKJ A;  4JI2 M;  4IBE A;  4DR2 M;  3EIH A;  4JI8 M;  3U60 A;  3SAT A;  4B3S M;  1TH2 A;  2XZF A;  3U6D A;  1OIP A;  2XFS A;  4L4U A;  3JR5 A;  1L2B A;  4IBJ A;  4M9Z A;  4P17 A;  1VEK A;  4I81 A;  1QYR A;  4LGM A;  5FTL A;  3KS8 A;  1N78 A;  4BLC A;  2LHC A;  3NBI A;  3M6A A;  4JI1 M;  4L15 A;  1R5L A;  3ZCB B;  3UMM A;  3E46 A;  3HHX A;  4G6Z A;  4DR7 M;  1H6U A;  1QUS A;  2ZAN A;  3FUW A;  3U6Q A;  1C7Y A;  3M7G A;  3SYL A;  3I51 A;  3SHF A;  4DV3 M;  2R62 A;  4DV4 M;  2H5X A;  2F5P A;  3K1J A;  2WSF F;  1J09 A;  4JI7 M;  2L4F A;  4UN2 B;  1VDL A;  2QBY A;  1Q3C A;  2DZN B;  2F5N A;  2LXE A;  4KHP M;  3DA1 A;  2DAE A;  2NQ8 C;  4GHL A;  2QPA A;  3LCV B;  4JI4 M;  3RFW A;  3KFU G;  1I4W A;  4MGH A;  3GPX A;  3Q8X A;  2O5R A;  3KDS E;  2F5Q A;  4AI6 A;  3U6C A;  2YFQ A;  3HKP A;  3LQR A;  4HL4 A;  4G4Q A;  4MH0 E;  5E6J A;  2L7I A;  3U61 A;  3KVW A;  4M0D A;  2F5O A;  4AKG A;  3LQQ A;  3SFZ A;  4DV2 M;  5IT9 S;  1EIJ A;  4LF5 M;  2CHQ A;  4LF4 M;  3TWM A;  2L6O A;  2H1R A;  5LMN M;  1PJT A;  4X66 M;  4ZPX A;  4QOZ C;  1HJP A;  1XXH B;  3ILK A;  1FNN A;  3NBX X;  2CWB A;  2VF7 A;  1IY1 A;  3IEC A;  4D81 A;  4K0K M;  3U5Z A;  2FH0 A;  1Y8G A;  3K92 A;  1HR0 M;  1SXJ C;  2JZ1 A;  1SXJ A;  1Z5B A;  1UFZ A;  4XBO A;  2Y0T A;  3JAM S;  3TE6 A;  2FS1 A;  4LJ7 A;  1KYI A;  4GMQ A;  3JR4 A;  1JR3 A;  3CF0 A;  3C58 A;  4QNM A;  5L8R F;  4LF7 M;  3HHZ A;  1D2N A;  1TDZ A;  4B3R M;  1X37 A;  1GJT A;  1IXS B;  1W5S A;  2DHY A;  2LNH C;  2CRU A;  2EKK A;  1QZM A;  3BOS A;  3A46 A;  5FLX S;  3VFD A;  3ZC7 B;  4MB7 A;  1OIZ A;  1NV8 A;  5LMU M;  1SXJ E;  2KNV A;  3I01 M;  1TTE A;  3L2A A;  1G59 A;  3U60 B;  2DZO B;  2OOA A;  4LF6 M;  4I4L A;  3R9X B;  3KSJ A;  3ZH9 B;  1CUK A;  2CP8 A;  5DFL A;  1JR3 E;  4WUR A;  2ZAM A;  1A5T A;  1DO0 A;  2ZTD A;  4GC5 A;  4IBG A;  4MGI E;  4DR4 M;  3V76 A;  1NJG A;  3FTE A;  3U6S A;  4JV5 M;  3IHP A;  3KOZ E;  2JY7 A;  2KDL A;  3E21 A;  3LVV A;  3GPU A;  3VK7 A;  2ZTC A;  3RGS A;  3SHG B;  3HJQ A;  3Q8G A;  4TUW A;  4B08 A;  1PM5 A;  4WP2 A;  3HWS A;  3GLH A;  1NHW C;  1IM2 A;  4GKJ M;  2UUB M;  3AL0 C;  2K9D A;  4JYA M;  4GC9 A;  1JQJ C;  1L1Z A;  4LF9 M;  3SAS A;  1OAO C;  1N75 A;  4R3D A;  2A5Y B;  1J5E M;  3VK8 A;  1S3S A;  4YY3 M;  2JUJ A;  2QBY B;  1N33 M;  4DR1 M;  1OKS A;  1QUT A;  4QNR A;  2OPF A;  1ZQ9 A;  1VDD A;  3UZU A;  4A3V B;  2CV2 A;  4B7F A;  3UGJ A;  4PDG A;  3MMP A;  4B3T M;  1DGH A;  2Y20 A;  2F5S A;  1ZMW A;  1QAN A;  3A45 A;  3GLH E;  2HCB A;  1YLA A;  5JI3 E;  4JI3 M;  3AV0 A;  3F92 A;  3HU3 A;  4NSO B;  1QDR A;  3U61 B;  3HU2 A;  4CHT B;  2UUC M;  1UM8 A;  4DR3 M;  2J5Y A;  3K8Z A;  3K9P A;  2DWZ B;  4B7H A;  4GKK M;  3AOG A;  2MRO B;  2GQF A;  3AFH A;  4NXM M;  2RRU A;  3FTC A;  3AKZ A;  3GQ5 A;  2FE8 A;  4M9S A;  2HHH M;  2KNA A;  2UXC M;  2R44 A;  3J7B A;  5ITR A;  3U5Z B;  2KEB A;  1V33 A;  2YR0 A;  1GKI A;  2KNZ A;  1IY0 A;  1OJL A;  1SXJ B;  1L8Q A;  2Z3X A;  2DHR A;  2BNK A;  1DGG A;  1NNJ A;  1Z59 A;  1E9R A;  3W68 A;  4R71 A;  3SAU A;  4MGY E;  3CTW B;  4FCV A;  3FUV A;  3C3D A;  4AG5 A;  1KFV A;  2DWL A;  3PNY A;  3B74 A;  3KS4 A;  2C9O A;  3MJ5 A;  4FWD A;  2KRU A;  2LWX A;  4LCB A;  4II7 A;  2APL A;  4FCT A;  5DYI A;  3NWL A;  2R46 A;  4PT5 A;  2D7E A;  5BR8 M;  4KLN A;  2DXI A;  4X62 M;  3D8B A;  4XK8 F;  3L27 A;  2ZM6 M;  4Y28 F;  1NSF A;  4AZF A;  4KO8 A;  4PDI A;  1HNX M;  1VEJ A;  2QNJ A;  2DKL A;  1QQW A;  4AW4 A;  4JI5 M;  4OVZ B;  5ITT A;  3THG A;  5FTJ A;  1K82 A;  1DGF A;  2L4E A;  1D0M A;  2ZBK B;  4LJ4 A;  2C99 A;  4B7G A;  2HWJ A;  3FUU A;  2BWE A;  3CF2 A;  4NSR A;  4F2L A;  4IBF A;  2UXB M;  3GLH B;  2KW0 A;  5FTK A;  4GHA A;  3GLI E;  4QHS A;  1L2D A;  3U6L A;  3FRI A;  1HNZ M;  2X49 A;  2MJ5 B;  2KZU A;  1F4I A;  3BXW A;  4PD2 A;  3FTF A;  5DYG A;  4R7G A;  1G41 A;  3U6M A;  4L78 A;  2ERC A;  3VDP A;  3FRH A;  4IBK A;  1MX0 A;  4QOS A;  1N36 M;  3HHW A;  3U6P A;  4RF1 A;  5FTN A;  3LVW A;  4NL4 H;  1ORY B;  2X8A A;  2JY6 B;  3OTO M;  4QHT A;  2Q2E B;  2LVN C;  5EP1 A;  2C96 A;  4YHH M;  1HQY E;  3R8F A;  2HL7 A;  4JI0 M;  2R0I A;  2K0B X;  2MR9 A;  2XSZ A;  2QP9 X;  3QWL A;  3D8L A;  2VQF M;  4G4R A;  3IG5 A;  1DGB A;  4XGI A;  1G4A E;  4FWG A;  5E26 A;  4S12 A;  2BJW A;  1D0K A;  1TH4 A;  3AJI B;  2C9C A;  5EP3 A;  3FE3 A;  3ZQJ A;  4CIS A;  3C9P A;  2Y21 A;  3PVS A;  3GLG A;  4MGK E;  1QDT A;  1WJ7 A;  2K6B A;  3FYD A;  3PNV A;  5H37 D;  5EXX A;  2V1C A;  2RGO A;  1K3X A;  5KQD A;  2N35 A;  1Q02 A;  4OX9 M;  1Z5C A;  1IN7 A;  1LV7 A;  1Q39 A;  1TF0 B;  3TWK A;  1IBL M;  3SAR A;  4GIT A;  2LH0 A;  3L28 A;  1WIV A;  3HJ8 A;  3HHY A;  3J7A S;  1GJS A;  4DV6 M;  2JZ0 A;  3GLG E;  4L6V 6;  2I7P A;  5KQ8 A;  2L09 A;  5KPZ A;  3K2L A;  4GIP A;  3SMP A;  3W0L B;  4NXN M;  2RKO A;  1IBM M;  4OW0 A;  3KOY E;  3EIE A;  2DEN A;  4OU7 A;  3GO8 A;  4RF0 A;  3L25 A;  4KOD A;  3HZJ A;  4DUZ M;  4LY6 A;  4LJ6 A;  1TDH A;  1I94 M;  2XH9 A;  2G8L A;  4D82 A;  1XB2 B;  3DFZ A;  1XWI A;  2O01 F;  3U6O A;  1OFH A;  4AQY M;  1XC8 A;  1Z5A A;  5A2Q S;  2CV1 A;  2FNA A;  3IG8 A;  8CAT A;  2EKF A;  2EA0 A;  3RE8 A;  4W5W A;  1SG9 A;  2AHM A;  3GRU A;  4CGY B;  1C1K A;  1R4G A;  3FUT A;  1NJF A;  2JXN A;  1OTR A;  3HGI A;  3FTD A;  4D80 A;  3SAW A;  4FD2 A;  5EQT A;  4Q7J A;  5IRE B;  1T3T A;  1TR8 A;  2DAI A;  1PJJ A;  4DR5 M;  4CJ6 A;  1NVM A;  1OFI A;  3L26 A;  4HLQ A;  3UJN A;  2R6F A;  5IWA M;  1WGL A;  4B3M M;  1P3Q Q;  3W67 A;  3HJS A;  2R18 A;  2YNM D;  4P16 A;  2DI0 A;  4MM3 B;  3TPZ A;  2DAK A;  2UXD M;  3TWL A;  3GRV A;  3I4V A;  1WXQ A;  3J27 B;  1NY6 A;  2B3T A;  1Z6T A;  1WHC A;  2LHG A;  1G8P A;  2KHH A;  1NHG C;  1T6O A;  2JA2 A;  3FKE A;  1AUA A;  2WSC F;  1JB0 F;  4MGZ E;  5FTM A;  4Z6Y A;  3T1Y M;  4G3O A;  3HX3 A;  2MH8 A;  2ZAO A;  4KT0 F;  3B7Z A;  1R7R A;  2V1U A;  3SC3 A;  5F3W A;  1R6B X;  1IXR C;  2RGH A;  2VF8 A;  2E5L M;  3GLI A;  1GL7 A;  2X4A A;  3KOX E;  1GAB A;  2DWM A;  1NNU C;  2XFT A;  3HU1 A;  3QAU A;  1L1T A;  1FJG M;  2JP7 A;  2JWS A;  1WR1 B;  2UU9 M;  3SYK A;  1DV0 A;  1IXS A;  4DV7 M;  4M9X A;  1XXH E;  4NC6 A;  1WGN A;  2QEN A;  1VQ1 A;  1IFY A;  1N77 A;  2XLJ A;  3KSX A;  5BPV A;  2MGW A;  1E94 E;  3GP1 A;  2JY5 A;  3QYB A;  1HT1 E;  3E9S A;  2Z4S A;  2XSZ D;  2CHV A;  3PXG A;  2CV0 A;  1R2Y A;  3E4R A;  2YQZ A;  1QAO A;  3GQ3 A;  2J7N A;  4LRS A;  3RGP A;  5ITX E;  4LFA M;  1SXJ D;  5EXP A;  4ANR A;  4G4N A;  1PRB A;  5EJC A;  3GLF A;  2KXE A;  2O25 A;  1IN8 A;  2LVO C;  2R45 A;  2BJV A;  5EP4 A;  1NY5 A;  4DR6 M;  5KPT A;  3I4Y A;  2L7H A;  1YUB A;  1JR3 D;  1QVR A;  1DGH B;  1G3I A;  4NRV A;  3TL4 X;  5EXT A;  5C1B A;  4Z8X A;  3M0E A;  2KRK A;  1BVS A;  1PJQ A;  3LW5 F;  2Z8Y M;  1HNW M;  1GVN A;  2V6Z M;  4CIZ A;  2CE7 A;  2LVA A;  4L8R C;  4DV1 M;  4NRW A;  1PGY A;  1V34 A;  2P5T A;  3J2P B;  4REZ A;  3GLF E;  2QZ4 A;  2DAM A;  4LJ5 A;  4I5S A;  2QCU A;  2OO9 A;  2QHO B;  3WHL A;  4IBD A;  3MHV C;  2EO2 A;  3HY5 A;  3WHK A;  1V92 A;  4IBC A;  3W0F A;  3KXE C;  3VDU A;  1ZAE A;  2VDB B;  1GL6 A;  2CEA A;  3FYC A;  3MK6 A;  1HT2 E;  4FWH A;  1XHB A;  1Q3B A;  4RNA A;  1PJS A;  3SBJ A;  4I8O A;  1XNQ M;  4IBB A;  2G5G X;  3PFI A;  3QYE A;  2K47 A;  2DNA A;  2XGN A;  3T38 A;  3CF6 E;  1EE8 A;  4DV5 M;  4EIW A;  2DZL A;  5DNY A;  1G71 A;  1PJI A;  3I04 M;  1E32 A;  2M60 A;  1D0L A;  4AG6 A;  3SAV A;  1N34 M;  2XZU A;  3U6E A;  5KPR A;  2VQE M;  3GLI B;  1GO5 A;  1QZE A;  5EXS A;  1NO1 A;  1YE9 A;  4LJ9 A;  2FOI C;  2R4E A;  1IY2 A;  4JI6 M;  2WZJ A;  1YSY A;  3KP1 E;  5C18 A;  2FFJ A;  4LJA A;  4F1I A;  4DV0 M;  4IBI A;  2Z4R A;  5IZ7 D;  1ZV1 A;  2UUA M;  1NV9 A;  2LVQ D;  4WW0 A; 
#chains in the Genus database with same CATH homology
 2Z7J A;  5KO3 A;  3VLF B;  4LZZ A;  4BBA A;  4FW9 A;  1W5T A;  3VKG A;  2C98 A;  1IBK M;  1TGU A;  3GRR A;  2DWN A;  3LMM A;  2KA6 B;  1XMQ M;  4PCZ A;  1DO2 A;  4LFB M;  1K3W A;  4OVZ A;  2C5R A;  3GLF B;  7CAT A;  1IN4 A;  2R65 A;  3UK6 A;  4X65 M;  2XF3 A;  5ITQ A;  3DOA A;  3KP0 E;  4JN6 A;  4IJF A;  4M0W A;  4NOO B;  3KW6 A;  1MU5 A;  3A98 B;  2W82 A;  3DZD A;  4LZJ A;  2OQ4 A;  5FSW A;  2M5Z A;  4L16 A;  2VII A;  4BB9 A;  3VKH A;  4LRT A;  3AOE C;  3AOE A;  3FD9 A;  4IIW A;  3GRY A;  4LF8 M;  2EUC A;  4LG2 A;  1J7K A;  3H4M A;  2Y0Q A;  2CUZ A;  4FCW A;  3J80 S;  2XEP A;  5JI2 E;  3GPY A;  1E9S A;  4DUY M;  3GLG B;  3TQS A;  4G4O A;  3GQ4 A;  1IN5 A;  4LJ8 A;  1XXH A;  3L29 A;  5GKN A;  4LFC M;  4LGY A;  4AKI A;  3SMS A;  4IJE A;  2F4V M;  1L2C A;  5EP2 A;  2CHG A;  4GRI A;  1XNR M;  4GH9 A;  1IXZ A;  4FVM A;  3J81 S;  1XMO M;  3A42 A;  1N32 M;  3KOW E;  2R4J A;  2KZS A;  1HQC A;  3B9P A;  1KSF X;  1GLN A;  2CFO A;  1QAQ A;  3T1H M;  1QAM A;  3FUX A;  2DVW B;  1IQP A;  2D7H A;  5ITX A;  3GPP A;  4AKH A;  2D7G A;  2I7N A;  5ITY A;  5ITU A;  1IN6 A;  4JXJ A;  1R2Z A;  4X64 M;  3T15 A;  1TH3 A;  2J7O A;  4ITQ A;  2HKJ A;  4JI2 M;  4IBE A;  4DR2 M;  3EIH A;  4JI8 M;  3U60 A;  3SAT A;  4B3S M;  1TH2 A;  2XZF A;  3U6D A;  2XFS A;  4L4U A;  1L2B A;  3JR5 A;  4IBJ A;  4M9Z A;  4I81 A;  1QYR A;  4LGM A;  5FTL A;  3KS8 A;  1N78 A;  4BLC A;  3NBI A;  3M6A A;  4JI1 M;  4L15 A;  3ZCB B;  3UMM A;  4G6Z A;  3HHX A;  4DR7 M;  1H6U A;  2ZAN A;  3FUW A;  3U6Q A;  3M7G A;  3SYL A;  3I51 A;  3SHF A;  4DV3 M;  2R62 A;  4DV4 M;  2F5P A;  3K1J A;  1J09 A;  4JI7 M;  2QBY A;  1Q3C A;  2DZN B;  2F5N A;  2LXE A;  4KHP M;  3DA1 A;  4GHL A;  2NQ8 C;  2QPA A;  4JI4 M;  3RFW A;  3KFU G;  1I4W A;  4MGH A;  3GPX A;  3Q8X A;  2O5R A;  3KDS E;  2F5Q A;  4AI6 A;  3U6C A;  2YFQ A;  3HKP A;  3LQR A;  4HL4 A;  4G4Q A;  4MH0 E;  5E6J A;  2L7I A;  3U61 A;  3KVW A;  4M0D A;  2F5O A;  4AKG A;  3LQQ A;  3SFZ A;  4DV2 M;  5IT9 S;  4LF5 M;  2CHQ A;  4LF4 M;  3TWM A;  2L6O A;  2H1R A;  5LMN M;  4X66 M;  4ZPX A;  4QOZ C;  1XXH B;  3ILK A;  4D81 A;  1FNN A;  1IY1 A;  4K0K M;  3U5Z A;  3K92 A;  1HR0 M;  1SXJ C;  1SXJ A;  1Z5B A;  4XBO A;  2Y0T A;  3JAM S;  3TE6 A;  4LJ7 A;  1KYI A;  4GMQ A;  3JR4 A;  1JR3 A;  3CF0 A;  3C58 A;  4QNM A;  4LF7 M;  3HHZ A;  1D2N A;  1TDZ A;  4B3R M;  1X37 A;  1IXS B;  1W5S A;  2LNH C;  1QZM A;  3BOS A;  3A46 A;  5FLX S;  3VFD A;  3ZC7 B;  4MB7 A;  5LMU M;  1SXJ E;  3L2A A;  1G59 A;  3U60 B;  2DZO B;  4LF6 M;  4I4L A;  3R9X B;  3KSJ A;  3ZH9 B;  4WUR A;  2ZAM A;  1DO0 A;  4GC5 A;  4IBG A;  4MGI E;  4DR4 M;  1NJG A;  3FTE A;  3U6S A;  4JV5 M;  3LVV A;  3KOZ E;  3GPU A;  3VK7 A;  3RGS A;  3SHG B;  3HJQ A;  4TUW A;  4B08 A;  1PM5 A;  3HWS A;  3GLH A;  1NHW C;  1IM2 A;  4GKJ M;  2UUB M;  3AL0 C;  4JYA M;  4GC9 A;  1JQJ C;  1L1Z A;  4LF9 M;  3SAS A;  1N75 A;  4R3D A;  2A5Y B;  1J5E M;  3VK8 A;  1S3S A;  4YY3 M;  2QBY B;  1N33 M;  4DR1 M;  4QNR A;  2OPF A;  1ZQ9 A;  1VDD A;  3UZU A;  4A3V B;  2CV2 A;  4B7F A;  3UGJ A;  4PDG A;  4B3T M;  1DGH A;  2Y20 A;  2F5S A;  1QAN A;  3A45 A;  2HCB A;  5JI3 E;  4JI3 M;  3AV0 A;  4NSO B;  3HU3 A;  3U61 B;  3HU2 A;  4CHT B;  2UUC M;  1UM8 A;  4DR3 M;  3K8Z A;  2DWZ B;  4B7H A;  4GKK M;  3AOG A;  3AFH A;  4NXM M;  3FTC A;  3AKZ A;  3GQ5 A;  2FE8 A;  4M9S A;  2HHH M;  2UXC M;  3J7B A;  5ITR A;  3U5Z B;  2KEB A;  2YR0 A;  1GKI A;  1IY0 A;  1OJL A;  1SXJ B;  1L8Q A;  2Z3X A;  2DHR A;  2BNK A;  1DGG A;  1NNJ A;  1Z59 A;  1E9R A;  3SAU A;  4MGY E;  3CTW B;  4FCV A;  3FUV A;  4AG5 A;  1KFV A;  2DWL A;  3PNY A;  3KS4 A;  3MJ5 A;  2C9O A;  5DYG A;  4FWD A;  2KRU A;  2LWX A;  4LCB A;  4II7 A;  4JI0 M;  4FCT A;  5DYI A;  3NWL A;  2R46 A;  4PT5 A;  2D7E A;  5BR8 M;  4KLN A;  2DXI A;  4X62 M;  3D8B A;  3L27 A;  2ZM6 M;  1NSF A;  4AZF A;  4KO8 A;  4PDI A;  1HNX M;  1QQW A;  4AW4 A;  4JI5 M;  4OVZ B;  5ITT A;  3THG A;  5FTJ A;  1K82 A;  1DGF A;  2ZBK B;  4LJ4 A;  2C99 A;  4B7G A;  3FUU A;  3CF2 A;  4NSR A;  4IBF A;  2UXB M;  3GLH B;  2KW0 A;  5FTK A;  4GHA A;  4QHS A;  1L2D A;  3U6L A;  1HNZ M;  2X49 A;  2KZU A;  4PD2 A;  3FTF A;  4R7G A;  1G41 A;  3U6M A;  4L78 A;  2ERC A;  3VDP A;  4IBK A;  1MX0 A;  4QOS A;  1N36 M;  3HHW A;  3U6P A;  4RF1 A;  5FTN A;  3LVW A;  4NL4 H;  1ORY B;  2X8A A;  3OTO M;  4QHT A;  2Q2E B;  5EP1 A;  2C96 A;  4YHH M;  1HQY E;  3R8F A;  2HL7 A;  4G4R A;  2XSZ A;  3QWL A;  2QP9 X;  2VQF M;  3D8L A;  3IG5 A;  1DGB A;  4XGI A;  1G4A E;  4FWG A;  5E26 A;  4S12 A;  2BJW A;  1TH4 A;  3AJI B;  2C9C A;  5EP3 A;  4CIS A;  2Y21 A;  3PVS A;  3GLG A;  4MGK E;  3FYD A;  3PNV A;  5H37 D;  5EXX A;  2V1C A;  2RGO A;  1K3X A;  5KQD A;  4OX9 M;  1Z5C A;  1Q39 A;  1IN7 A;  1LV7 A;  3TWK A;  1IBL M;  3SAR A;  4GIT A;  2LH0 A;  3L28 A;  3HJ8 A;  3HHY A;  3J7A S;  4DV6 M;  2I7P A;  5KQ8 A;  2L09 A;  5KPZ A;  3K2L A;  4GIP A;  3SMP A;  3W0L B;  4NXN M;  2RKO A;  1IBM M;  4OW0 A;  3KOY E;  3EIE A;  4OU7 A;  3GO8 A;  4RF0 A;  3L25 A;  4KOD A;  4DUZ M;  4LY6 A;  4LJ6 A;  1TDH A;  1I94 M;  2XH9 A;  2G8L A;  4D82 A;  3DFZ A;  1XWI A;  3U6O A;  1OFH A;  4AQY M;  1XC8 A;  1Z5A A;  5A2Q S;  2CV1 A;  2FNA A;  3IG8 A;  8CAT A;  2EA0 A;  3RE8 A;  4W5W A;  2AHM A;  3GRU A;  4CGY B;  1C1K A;  3FUT A;  1NJF A;  3HGI A;  3FTD A;  4D80 A;  3SAW A;  4FD2 A;  5EQT A;  5IRE B;  1T3T A;  1PJJ A;  4DR5 M;  1NVM A;  1OFI A;  3L26 A;  4HLQ A;  3UJN A;  5IWA M;  4B3M M;  3HJS A;  2R18 A;  2YNM D;  4P16 A;  3TPZ A;  4MM3 B;  2UXD M;  3TWL A;  3GRV A;  3I4V A;  1WXQ A;  3J27 B;  1NY6 A;  1Z6T A;  1G8P A;  1NHG C;  2JA2 A;  3FKE A;  4MGZ E;  5FTM A;  4Z6Y A;  3T1Y M;  2ZAO A;  1R7R A;  2V1U A;  3SC3 A;  5F3W A;  1R6B X;  1IXR C;  2RGH A;  2E5L M;  3GLI A;  1GL7 A;  2X4A A;  3KOX E;  2DWM A;  1NNU C;  2XFT A;  3HU1 A;  3QAU A;  1L1T A;  1FJG M;  2UU9 M;  3SYK A;  4DV7 M;  4M9X A;  2QEN A;  1N77 A;  2XLJ A;  3KSX A;  5BPV A;  3GP1 A;  1E94 E;  1HT1 E;  3E9S A;  2Z4S A;  2XSZ D;  2CHV A;  3PXG A;  2CV0 A;  1R2Y A;  3E4R A;  2YQZ A;  1QAO A;  3GQ3 A;  2J7N A;  4LRS A;  3RGP A;  5ITX E;  4LFA M;  1SXJ D;  5EXP A;  4G4N A;  5EJC A;  3GLF A;  2KXE A;  1IN8 A;  2R45 A;  2BJV A;  5EP4 A;  1NY5 A;  4DR6 M;  5KPT A;  3I4Y A;  2L7H A;  1YUB A;  1JR3 D;  1QVR A;  1DGH B;  1G3I A;  4NRV A;  3TL4 X;  5EXT A;  5C1B A;  4Z8X A;  3M0E A;  2KRK A;  1HNW M;  1GVN A;  2V6Z M;  2CE7 A;  4L8R C;  4DV1 M;  4NRW A;  2P5T A;  3J2P B;  4REZ A;  2QZ4 A;  4LJ5 A;  4I5S A;  2QCU A;  3WHL A;  4IBD A;  3MHV C;  2EO2 A;  3WHK A;  4IBC A;  3W0F A;  3KXE C;  3VDU A;  1ZAE A;  1GL6 A;  2CEA A;  3FYC A;  3MK6 A;  1HT2 E;  4FWH A;  1XHB A;  1Q3B A;  4RNA A;  1XNQ M;  3SBJ A;  4I8O A;  4IBB A;  2G5G X;  3PFI A;  2K47 A;  2XGN A;  3T38 A;  3CF6 E;  1EE8 A;  4DV5 M;  4EIW A;  5DNY A;  1PJI A;  1E32 A;  2M60 A;  4AG6 A;  3SAV A;  1N34 M;  2XZU A;  3U6E A;  5KPR A;  2VQE M;  3GLI B;  5EXS A;  1YE9 A;  4LJ9 A;  2FOI C;  2R4E A;  1IY2 A;  4JI6 M;  1YSY A;  3KP1 E;  5C18 A;  2FFJ A;  4LJA A;  4DV0 M;  4IBI A;  2Z4R A;  5IZ7 D;  2UUA M;  4WW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...