2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
4I5SA 2Y0QA 2L7IA 2Y20A 2Y21A 2L7HA 2Y0TA
chains in the Genus database with same CATH superfamily
4BB9A 2F5SA 2DAMA 3GQ4A 4L8RC 2UXDM 3E46A 3JAMS 1ORYB 2XEPA 2Z7JA 3U61B 3LVWA 1QAQA 2E5LM 2I7NA 3CF0A 3GRUA 4DR6M 5ITYA 1G3IA 3VDPA 1V92A 5KQDA 1PM5A 2LVNC 2OOAA 2VDBB 2VIIA 3FTDA 1L1ZA 3LQQA 4G3OA 3EIHA 3HU1A 2UXCM 1S3SA 1TDHA 1N32M 1HR0M 2OO9A 4IBBA 3GLIA 3I51A 2DAGA 4B3TM 1OFIA 1XWIA 2XFSA 3DOAA 3AKZA 5EXSA 4DBGB 1Q39A 2RGHA 4A3VB 2OPFA 4IBCA 4AG5A 2CV0A 2XSZA 1IQPA 1ZV1A 1IN4A 3A45A 1QANA 3HJ8A 2HAKA 2R4JA 4AG6A 1ZMVA 3KOYE 1A5TA 3B74A 4FCWA 2L4FA 4X65M 4L16A 4OVZB 3C3EA 3GLFB 2HWJA 3LQRA 4LCBA 5FTJA 3U5ZA 1IM2A 2CFOA 1W5SA 2KRKA 5H37D 4LJ9A 2JY8A 3J7AS 1GL7A 2LHGA 4EIWA 3LCVB 1PRBA 2EKKA 3W0FA 3GLGE 3PFIA 3FKEA 2ERCA 2BNKA 3VK7A 4IBDA 1IBMM 1IXSA 2XSZD 4LJ4A 5KPTA 1PJIA 3U5ZB 1L2DA 3SFZA 1MX0A 3I04M 3HY5A 2R62A 3U6SA 4DV7M 3PXGA 2L7HA 3QWLA 3U6MA 3SMPA 2F5QA 2FNAA 1YUBA 4DV6M 4BLCA 4FWDA 4QOSA 3K8ZA 2EJSA 4QHTA 3KFUG 1KYIA 1QZEA 2L4EA 3AFHA 3SYKA 3IHPA 2APLA 2LBCA 5FTLA 3UMMA 2K6BA 2J7NA 3FUTA 3KP0E 1NJGA 2J5YA 3T6PA 4DR3M 2LWXA 3C9PA 2CV2A 3KS4A 2C5RA 4CIZA 1NV9A 4GC9A 3NBXX 1WGNA 1J09A 4NSOB 4QHSA 2VQFM 2V1CA 1HNWM 1Q3CA 3SAVA 4LG2A 4IBGA 2JNHA 1TH4A 4PDGA 1J7KA 3GLHE 4BBAA 3K9OA 4G6ZA 4Q7JA 3TE6A 3A46A 5LMUM 2KNVA 4FW9A 3U60A 1Z59A 2KZUA 2CHQA 2LHCA 2R0IA 4G4OA 2UUAM 2CE7A 4DR2M 2L7IA 1HNZM 4L6V6 1VQ1A 4GITA 4OU7A 1N34M 4AKIA 2CEAA 2Y0QA 4B7HA 2L09A 4DR5M 3VLFB 3U60B 5KPRA 3W0LB 2F5PA 2HKJA 3PNYA 5ITUA 1G8PA 2UXBM 4D81A 1KFVA 2JA2A 3ILKA 4AKHA 4LJ7A 7CATA 4R71A 4NSRA 1HJPA 1XB2B 1EIJA 4AKGA 4P17A 5EQTA 2RGOA 4DV4M 1ZAEA 1ZMWA 1NJFA 4QNRA 1I94M 2JUJA 1HT2E 1PJSA 3HX3A 3ZCBB 4GKJM 3HZJA 2OQ4A 1QUTA 3THGA 2QCUA 4D82A 3BXWA 4GIPA 1MU5A 3L29A 1P3QQ 3SYLA 3DZDA 3EIEA 3GQ5A 1QYRA 4LF4M 3UGJA 2ZTCA 2LVPC 1OJLA 4FWGA 3AJIB 1GL6A 3UK6A 3JR5A 1L2CA 3KS8A 4DR7M 3CTWB 2X8AA 4IBEA 2LTUA 1YSYA 3SARA 1BVSA 3FUUA 1XXHE 2WZJA 1L1TA 4OW0A 1K3XA 5ITQA 3R9XB 4I81A 3V76A 4IBJA 2LVQD 2W82A 1QDRA 3HKPA 3U6EA 3GO8A 1DV0A 3QYEA 1GVNA 4KLNA 1JQJC 3T1YM 3SHGB 4YY3M 2D7HA 8CATA 3D8LA 3KVWA 5ITXE 3TPZA 1OFHA 3J2PB 4MGKE 2YNMD 1F4IA 1JR3A 4MGHA 2F5OA 1PJJA 2QHOB 1T3TA 1Z5BA 3PVSA 2VQEM 1IXZA 4F2LA 2JP7A 2WSFF 1DGHB 1QVRA 2JZ0A 2KA6B 3AV0A 3HHWA 3KOXE 3U6QA 3FRHA 5FTNA 3U6CA 2J7OA 1D0KA 2MROB 1UM8A 3M6AA 3FTCA 2ZM6M 1D0MA 4M9XA 1XMOM 3HU2A 1IY2A 2V6ZM 1G71A 3JR4A 2BJVA 4KT0F 1KSFX 3WHLA 3T38A 4DV2M 1OKSA 3E21A 2LNHC 2R46A 3C3DA 4PT5A 3L2AA 4G4QA 1Q3BA 3MK6A 4JI6M 1JR3D 4HLQA 4NXMM 2F4VM 4AQYM 1OIZA 4MB7A 5LMNM 2R45A 3GPUA 1HQYE 1TR8A 1NY6A 1X37A 3CF6E 3ZC7B 3HJQA 3TWKA 2YR0A 2CV1A 2I7PA 4FVMA 3GLIB 4B7GA 2JY5A 3SMSA 4XK8F 4NOOB 2CWBA 5IT9S 4YHHM 4LZJA 1OIPA 4M9ZA 3GPYA 3L25A 1D0LA 4IJFA 4B3SM 4IJEA 1NHWC 2CRUA 2M60A 5E26A 1XNRM 1TH2A 3FUWA 1ZMUA 2R4EA 3AOEA 3HGIA 1SXJA 5EJCA 1K3WA 2CHVA 4X62M 4RF0A 1NO1A 4G4RA 1DGFA 1N77A 1OQYA 4R7GA 3U6PA 4LF6M 3GPPA 4RKUF 1MN3A 2B3TA 5IWAM 3TWLA 4PD2A 3GQ3A 4REZA 2X4AA 1XHBA 2KEBA 1IXSB 4IBIA 1SXJB 1E9SA 2JY6B 2Q2EB 4GKKM 3A42A 4ITQA 4GC5A 3RGPA 1SXJD 1GO5A 2P5TA 2X49A 1GJTA 3SAUA 3B7QA 3VDUA 5KQ8A 3QAUA 3KOZE 3C58A 1XXHA 4ZPXA 1LV7A 5DYGA 1G41A 5IZ7D 2ZBKB 4I5SA 3MJ5A 1D2NA 4GHAA 4DUZM 1QZMA 3HJSA 2FFJA 1Y8GA 3ZQJA 4MGIE 1AUAA 1R6BX 2L6OA 2K47A 3AOGA 3FYDA 2DHRA 2EUCA 2QNJA 3F92A 4MGZE 1IBKM 2QZ4A 1VDDA 5ITXA 4DV0M 3KXEC 3SBJA 1Z5AA 2CHGA 4HEOA 1L2BA 2LH0A 4MH0E 3SC3A 3GLFE 1HQCA 2O5RA 5FTKA 2FE8A 3HHYA 1SXJC 4KHPM 4LY6A 1PJTA 1VEJA 2KDLA 3CGWA 3ZH9B 4AI6A 4Y28F 2DAEA 5E6JA 1NSFA 4JI0M 5EP2A 1GABA 1UFZA 2Z4SA 3M0EA 4R3DA 1WR1B 2GNOA 2FOIC 4PCZA 2JZ1A 2DZNB 2MGWA 3E9SA 5FTMA 1EFUB 2R44A 2QPAA 1C1KA 1FNNA 4DUYM 3SASA 4MGYE 1V33A 3FD9A 2DWZB 2VF7A 4GHLA 2F5NA 2QBYA 4NXNM 3Q8XA 1IXRC 2MR9A 4DV5M 4LZZA 5KPZA 2A5YB 3A98B 3U6OA 1OTRA 2V1UA 3K2LA 4WW0A 1L8QA 1NV8A 4I4LA 2DWNA 2D7GA 3J7BA 4JV5M 3HU3A 4XGIA 1QAMA 3FTFA 3K1JA 4P16A 3B89A 4JI4M 3GRVA 4WP2A 2QBYB 3IG5A 4AZFA 2DHYA 3GLGA 2CUZA 4AW4A 1I4WA 3LCUA 4TUWA 3IECA 2KRUA 1IY0A 1QDTA 3W67A 3NWLA 1DGGA 3U6LA 1R2YA 2CP8A 4CGYB 2UU9M 4X66M 4LFBM 1TH3A 4W5WA 3BOSA 3W68A 2LVAA 2R65A 2JY7A 3E4RA 2MH8A 2XLJA 2FS1A 4DR1M 3UZUA 3IG8A 1T43A 4XBOA 3GLGB 1W5TA 2KXEA 5IREB 1N36M 2WSCF 4LF8M 2DZOB 1C7YA 3FTEA 1G59A 1G4AE 5L8RF 2EKFA 3PNVA 3TWMA 4LFCM 3TL4X 4S12A 2DVWB 4NC6A 3U61A 4FCTA 4M0DA 4DR4M 1GLNA 1R5LA 3LVVA 1WJ7A 1NHGC 3KW6A 4LF7M 2K0BX 2G3QA 3J81S 2YQZA 4JI1M 3J80S 4JN6A 1EE8A 2R18A 2FH0A 5JI3E 3GLHA 4KODA 2DWMA 4B7FA 2QSFX 5FLXS 2XZUA 3MHVC 2HCBA 3NBIA 3D8BA 2Z4RA 2C96A 1HT1E 3HHXA 5DFLA 3WHKA 2O01F 3KOWE 1QUSA 3L27A 2KHHA 3DA1A 2QQ8A 4FCVA 2HL7A 4RF1A 5EP1A 2XZFA 4B3MM 2HHHM 2K9DA 1LTMA 3M7GA 3RGSA 4OVZA 5EP3A 4II7A 3GLFA 1OAIA 4HL4A 2M5ZA 5JI2E 3GLHB 4GH9A 4JI5M 2QENA 1PGYA 2KNZA 4WURA 3R8FA 3AL0C 2UUBM 5C1BA 2NQ8C 5BPVA 4LJAA 3OTOM 1N33M 3RE8A 3B7NA 1AIPC 2BJWA 2L2DA 2YFQA 4UN2B 1R2ZA 1IBLM 4L78A 1V34A 4LJ5A 4LRTA 3GRYA 4GRIA 1GKIA 5ITTA 1N75A 4I8OA 2G8LA 2XFTA 2DAKA 4ANRA 2Y0TA 1DO2A 1XC8A 4IBKA 1VDLA 3BBZA 4NRVA 1TDZA 4JI8M 4KO8A 4FD2A 4LF9M 1IN5A 1IN7A 2ZAMA 3T15A 1TTEA 2QP9X 3H4MA 4LFAM 4JI7M 3K9PA 1XMQM 2H5XA 1TGUA 1NNJA 2UUCM 5DYIA 3T1HM 1H6UA 1JR3E 1Z5CA 5FSWA 1ZQ9A 2Z3XA 1QAOA 1YLAA 4LGYA 1GJSA 2VF8A 2ZANA 4F1IA 1K82A 4IIWA 4LJ8A 4OX9M 1XNQM 2WSEF 1XXHB 4M9SA 4X64M 3B7ZA 2JWSA 2DXIA 4LF5M 2DZLA 2KNAA 3GP1A 4K0KM 3HHZA 3GLIE 2OOBA 2LXEA 3AOEC 3KSXA 3VFDA 2DI0A 3UJNA 4CISA 4QNMA 2KZSA 3MMPA 3Q8GA 1MJGM 2C9CA 4JI3M 2O25A 2R6FA 4JXJA 4Z8XA 5BR8M 4G4NA 3I01M 1TF0B 3FUVA 4NRWA 4LRSA 4L4UA 2DWLA 2KW0A 1NY5A 3B9PA 4PDIA 1OAOC 1RU3A 1WHCA 4IBFA 1DGBA 3I4VA 1YE9A 4M0WA 1VEGA 3HWSA 3KP1E 2EO2A 4GMQA 1FJGM 1HNXM 3K92A 3VKHA 1N78A 5A2QS 3CF2A 2DENA 4LJ6A 4JYAM 5DNYA 1SXJE 2AHMA 1IN8A 1SG9A 1T6OA 1WGLA 2ZAOA 3FYCA 1JB0F 2Y20A 4MM3B 4DV3M 5F3WA 1PJQA 2N35A 4L15A 1R7RA 1J5EM 3SATA 5GKNA 2C9OA 4GEWA 1Q02A 3QYBA 3LW5F 2DKLA 4B3RM 2Y21A 1E94E 3SAWA 4Z6YA 2C98A 1CUKA 1DO0A 1NNUC 1NVMA 2BWBA 2H1RA 4RNAA 2EA0A 3KDSE 1E9RA 2GQFA 2LVOC 3H4JA 5EXPA 5KO3A 2C99A 3FRIA 3L26A 2XF3A 1R4GA 3DFZA 3RFWA 4FWHA 4CHTB 2G5GX 4DV1M 1VG5A 3FE3A 3U6DA 4QOZC 5EXXA 3TQSA 1WXQA 2JXNA 2ZTDA 3VK8A 2Z8YM 3LMMA 2DNAA 1E32A 3KSJA 3I4YA 2RRUA 4D80A 3GRRA 3L28A 2XH9A 2XGNA 2D7EA 2RKOA 4B08A 1IFYA 5EXTA 1WIVA 1IN6A 1DGHA 4LGMA 4JI2M 1IY1A 1QQWA 3GPXA 2MJ5B 3FUXA 3SHFA 2BWEA 1VEKA 2DAIA 5C18A 3VKGA 5EP4A 3J27B 4NL4H 1Z6TA 5ITRA 4CJ6A
chains in the Genus database with same CATH topology
4BB9A 2F5SA 4L8RC 3GQ4A 2UXDM 3JAMS 1ORYB 2XEPA 2Z7JA 3U61B 3LVWA 1QAQA 2E5LM 2I7NA 3CF0A 3GRUA 4DR6M 5ITYA 1G3IA 3VDPA 5KQDA 1PM5A 2VIIA 3FTDA 1L1ZA 3LQQA 3EIHA 3HU1A 2UXCM 1S3SA 1TDHA 1N32M 1HR0M 4IBBA 3GLIA 4B3TM 3I51A 1XNRM 1OFIA 1XWIA 2XFSA 3DOAA 3AKZA 5EXSA 1Q39A 2RGHA 4A3VB 2OPFA 4IBCA 4AG5A 2CV0A 2XSZA 1IQPA 3A45A 1IN4A 4AG6A 1QANA 3HJ8A 2R4JA 3KOYE 4FCWA 4X65M 4L16A 4OVZB 3GLFB 3U5ZA 3LQRA 4LCBA 5FTJA 1IM2A 2CFOA 1W5SA 2KRKA 5H37D 4LJ9A 3J7AS 1GL7A 4EIWA 3W0FA 3PFIA 3FKEA 2ERCA 2BNKA 3VK7A 4IBDA 1IBMM 2XSZD 4LJ4A 5KPTA 1PJIA 3U5ZB 1L2DA 3SFZA 1MX0A 2R62A 3U6SA 4DV7M 3PXGA 2L7HA 3QWLA 3U6MA 3SMPA 2F5QA 2FNAA 1YUBA 4DV6M 4BLCA 4FWDA 4QOSA 3K8ZA 4QHTA 3KFUG 1KYIA 3AFHA 3SYKA 5FTLA 3UMMA 2J7NA 3FUTA 3KP0E 1NJGA 4DR3M 2LWXA 2CV2A 3KS4A 2C5RA 4GC9A 4NSOB 4QHSA 1J09A 2VQFM 2V1CA 1HNWM 1Q3CA 3SAVA 4LG2A 4IBGA 1TH4A 4PDGA 1J7KA 4BBAA 4G6ZA 5LMUM 3TE6A 3A46A 3U60A 4FW9A 1Z59A 2CHQA 2KZUA 4G4OA 2UUAM 2CE7A 4DR2M 2L7IA 1HNZM 4GITA 4OU7A 1N34M 4AKIA 2CEAA 2Y0QA 4B7HA 2L09A 4DR5M 3VLFB 3U60B 5KPRA 3W0LB 2F5PA 2HKJA 3PNYA 5ITUA 1G8PA 2UXBM 4D81A 1KFVA 2JA2A 3ILKA 4LJ7A 7CATA 4AKGA 4NSRA 5EQTA 2RGOA 4DV4M 1ZAEA 1NJFA 4QNRA 1I94M 1HT2E 4GKJM 3ZCBB 2OQ4A 3THGA 4D82A 2QCUA 4GIPA 1MU5A 3L29A 3SYLA 3DZDA 3EIEA 3GQ5A 1QYRA 4LF4M 3UGJA 3KS8A 4FWGA 1OJLA 3UK6A 3AJIB 1GL6A 3JR5A 4DR7M 1L2CA 3CTWB 2X8AA 4IBEA 1YSYA 3SARA 3FUUA 1L1TA 4OW0A 1K3XA 5ITQA 3R9XB 4I81A 4IBJA 2W82A 3HKPA 3U6EA 3GO8A 1GVNA 4KLNA 1JQJC 3T1YM 3SHGB 4YY3M 2D7HA 8CATA 3D8LA 3KVWA 5ITXE 3TPZA 1OFHA 3J2PB 4MGKE 2YNMD 1JR3A 4MGHA 2F5OA 1PJJA 1T3TA 1Z5BA 3PVSA 2VQEM 1IXZA 3KOXE 1DGHB 1QVRA 3AV0A 2KA6B 3U6QA 3HHWA 5FTNA 3U6CA 2J7OA 1UM8A 3M6AA 3FTCA 2ZM6M 4M9XA 1XMOM 3HU2A 1IY2A 2V6ZM 3JR4A 2BJVA 1KSFX 3WHLA 3T38A 4DV2M 2LNHC 2R46A 4PT5A 3L2AA 4G4QA 1Q3BA 3MK6A 4JI6M 1JR3D 4HLQA 4NXMM 2F4VM 4AQYM 4MB7A 5LMNM 2R45A 3GPUA 1HQYE 1X37A 1NY6A 3CF6E 3ZC7B 3HJQA 3TWKA 2YR0A 2CV1A 2I7PA 4FVMA 3GLIB 4B7GA 3SMSA 4NOOB 5IT9S 4YHHM 4LZJA 4M9ZA 3GPYA 3L25A 4IJFA 4B3SM 4IJEA 1NHWC 2M60A 5E26A 1TH2A 3FUWA 2R4EA 3AOEA 3HGIA 1SXJA 5EJCA 1K3WA 2CHVA 4X62M 4RF0A 4G4RA 1DGFA 1N77A 4R7GA 3U6PA 4LF6M 3GPPA 5IWAM 3TWLA 4PD2A 3GQ3A 4REZA 2X4AA 1XHBA 2KEBA 1IXSB 4IBIA 1SXJB 1E9SA 4GKKM 2Q2EB 3A42A 4ITQA 4GC5A 3RGPA 1SXJD 2P5TA 2X49A 3SAUA 3VDUA 5KQ8A 3QAUA 3KOZE 3C58A 1XXHA 4ZPXA 1LV7A 5DYGA 1G41A 5IZ7D 2ZBKB 4I5SA 3MJ5A 1D2NA 4GHAA 4DUZM 1QZMA 3HJSA 2FFJA 4MGIE 1R6BX 2L6OA 2K47A 3AOGA 3FYDA 2DHRA 2EUCA 4MGZE 1IBKM 2QZ4A 1VDDA 5ITXA 4DV0M 3KXEC 3SBJA 1Z5AA 2CHGA 1L2BA 2LH0A 4MH0E 3SC3A 1HQCA 2O5RA 5FTKA 2FE8A 3HHYA 1SXJC 4KHPM 4LY6A 3ZH9B 4AI6A 5E6JA 1NSFA 4JI0M 5EP2A 2Z4SA 3M0EA 4R3DA 2FOIC 4PCZA 2DZNB 3E9SA 5FTMA 2QPAA 1C1KA 1FNNA 4DUYM 3SASA 4MGYE 3FD9A 2DWZB 4GHLA 2F5NA 2QBYA 4NXNM 3Q8XA 1IXRC 4DV5M 4LZZA 5KPZA 2A5YB 3A98B 3U6OA 2V1UA 3K2LA 4WW0A 1L8QA 2DWNA 4I4LA 2D7GA 3J7BA 4JV5M 3HU3A 4XGIA 1QAMA 3FTFA 3K1JA 4P16A 4JI4M 3GRVA 2QBYB 3IG5A 4AZFA 3GLGA 2CUZA 4AW4A 1I4WA 4TUWA 2KRUA 1IY0A 3U6LA 3NWLA 1DGGA 1R2YA 4CGYB 2UU9M 4X66M 4LFBM 1TH3A 4W5WA 3BOSA 2R65A 3E4RA 2XLJA 4DR1M 3UZUA 3IG8A 4XBOA 3GLGB 1W5TA 2KXEA 5IREB 1N36M 4LF8M 2DZOB 3FTEA 1G59A 1G4AE 3TWMA 3PNVA 4LFCM 3TL4X 4S12A 2DVWB 3U61A 4FCTA 4M0DA 4DR4M 1GLNA 3LVVA 3KW6A 1NHGC 4LF7M 3J81S 2YQZA 4JI1M 3J80S 4JN6A 1EE8A 2R18A 5JI3E 3GLHA 4KODA 2DWMA 4B7FA 5FLXS 2XZUA 3MHVC 2HCBA 3NBIA 3D8BA 2Z4RA 2C96A 1HT1E 3HHXA 3WHKA 3KOWE 3L27A 4FCVA 3DA1A 4RF1A 2XZFA 2HL7A 5EP1A 4B3MM 2HHHM 3M7GA 3RGSA 4OVZA 5EP3A 4II7A 3GLFA 4HL4A 2M5ZA 5JI2E 3GLHB 4GH9A 4JI5M 2QENA 4WURA 3R8FA 3AL0C 2UUBM 5C1BA 2NQ8C 5BPVA 4LJAA 3OTOM 1N33M 3RE8A 2BJWA 2YFQA 1R2ZA 1IBLM 4L78A 4LJ5A 4LRTA 3GRYA 4GRIA 1GKIA 5ITTA 1N75A 4I8OA 2G8LA 2XFTA 2Y0TA 1DO2A 1XC8A 4IBKA 4NRVA 1TDZA 4JI8M 4KO8A 4FD2A 4LF9M 1IN7A 1IN5A 2ZAMA 3T15A 2QP9X 3H4MA 4LFAM 4JI7M 1XMQM 1NNJA 1TGUA 2UUCM 5DYIA 3T1HM 1H6UA 5FSWA 1Z5CA 1ZQ9A 2Z3XA 1QAOA 4LGYA 2ZANA 1K82A 4IIWA 4LJ8A 4OX9M 1XNQM 1XXHB 4M9SA 4X64M 2DXIA 4LF5M 3GP1A 4K0KM 3HHZA 2LXEA 3AOEC 3KSXA 3VFDA 3UJNA 4CISA 4QNMA 2KZSA 2C9CA 4JI3M 4JXJA 4Z8XA 4G4NA 5BR8M 3FUVA 4NRWA 4LRSA 4L4UA 2DWLA 2KW0A 1NY5A 3B9PA 4PDIA 4IBFA 1DGBA 3I4VA 1YE9A 4M0WA 3HWSA 3KP1E 2EO2A 4GMQA 1FJGM 1HNXM 3K92A 3VKHA 1N78A 5A2QS 3CF2A 4LJ6A 4JYAM 5DNYA 1SXJE 1IN8A 2AHMA 2ZAOA 3FYCA 4MM3B 4DV3M 4AKHA 2Y20A 5F3WA 3SATA 1J5EM 4L15A 1R7RA 5GKNA 2C9OA 4B3RM 2Y21A 1E94E 3SAWA 4Z6YA 2C98A 1DO0A 1NNUC 4RNAA 1NVMA 2H1RA 2EA0A 3KDSE 1E9RA 3L26A 5EXPA 5KO3A 2C99A 2XF3A 3DFZA 3RFWA 4FWHA 4CHTB 2G5GX 4DV1M 3U6DA 4QOZC 5EXXA 3TQSA 1WXQA 3VK8A 3LMMA 1E32A 3KSJA 3I4YA 4D80A 3GRRA 3L28A 2XH9A 2XGNA 2D7EA 2RKOA 4B08A 5EXTA 1IN6A 1DGHA 4LGMA 4JI2M 1IY1A 1QQWA 3GPXA 3FUXA 5C18A 3SHFA 3VKGA 5EP4A 3J27B 4NL4H 1Z6TA 5ITRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  2Y0Q A;  2L7I A;  2Y20 A;  2Y21 A;  2L7H A;  2Y0T A; 
#chains in the Genus database with same CATH topology
 4BB9 A;  2F5S A;  2DAM A;  3GQ4 A;  4L8R C;  2UXD M;  3E46 A;  3JAM S;  1ORY B;  2XEP A;  2Z7J A;  3U61 B;  3LVW A;  1QAQ A;  2E5L M;  2I7N A;  3CF0 A;  3GRU A;  4DR6 M;  5ITY A;  1G3I A;  3VDP A;  1V92 A;  5KQD A;  1PM5 A;  2LVN C;  2OOA A;  2VDB B;  2VII A;  3FTD A;  1L1Z A;  3LQQ A;  4G3O A;  3EIH A;  3HU1 A;  2UXC M;  1S3S A;  1TDH A;  1N32 M;  1HR0 M;  2OO9 A;  4IBB A;  3GLI A;  3I51 A;  2DAG A;  4B3T M;  1OFI A;  1XWI A;  2XFS A;  3DOA A;  3AKZ A;  5EXS A;  4DBG B;  1Q39 A;  2RGH A;  4A3V B;  2OPF A;  4IBC A;  4AG5 A;  2CV0 A;  2XSZ A;  1IQP A;  1ZV1 A;  1IN4 A;  3A45 A;  1QAN A;  3HJ8 A;  2HAK A;  2R4J A;  4AG6 A;  1ZMV A;  3KOY E;  1A5T A;  3B74 A;  4FCW A;  2L4F A;  4X65 M;  4L16 A;  4OVZ B;  3C3E A;  3GLF B;  2HWJ A;  3LQR A;  4LCB A;  5FTJ A;  3U5Z A;  1IM2 A;  2CFO A;  1W5S A;  2KRK A;  5H37 D;  4LJ9 A;  2JY8 A;  3J7A S;  1GL7 A;  2LHG A;  4EIW A;  3LCV B;  1PRB A;  2EKK A;  3W0F A;  3GLG E;  3PFI A;  3FKE A;  2ERC A;  2BNK A;  3VK7 A;  4IBD A;  1IBM M;  1IXS A;  2XSZ D;  4LJ4 A;  5KPT A;  1PJI A;  3U5Z B;  1L2D A;  3SFZ A;  1MX0 A;  3I04 M;  3HY5 A;  2R62 A;  3U6S A;  4DV7 M;  3PXG A;  2L7H A;  3QWL A;  3U6M A;  3SMP A;  2F5Q A;  2FNA A;  1YUB A;  4DV6 M;  4BLC A;  4FWD A;  4QOS A;  3K8Z A;  2EJS A;  4QHT A;  3KFU G;  1KYI A;  1QZE A;  2L4E A;  3AFH A;  3SYK A;  3IHP A;  2APL A;  2LBC A;  5FTL A;  3UMM A;  2K6B A;  2J7N A;  3FUT A;  3KP0 E;  1NJG A;  2J5Y A;  3T6P A;  4DR3 M;  2LWX A;  3C9P A;  2CV2 A;  3KS4 A;  2C5R A;  4CIZ A;  1NV9 A;  4GC9 A;  3NBX X;  1WGN A;  1J09 A;  4NSO B;  4QHS A;  2VQF M;  2V1C A;  1HNW M;  1Q3C A;  3SAV A;  4LG2 A;  4IBG A;  2JNH A;  1TH4 A;  4PDG A;  1J7K A;  3GLH E;  4BBA A;  3K9O A;  4G6Z A;  4Q7J A;  3TE6 A;  3A46 A;  5LMU M;  2KNV A;  4FW9 A;  3U60 A;  1Z59 A;  2KZU A;  2CHQ A;  2LHC A;  2R0I A;  4G4O A;  2UUA M;  2CE7 A;  4DR2 M;  2L7I A;  1HNZ M;  4L6V 6;  1VQ1 A;  4GIT A;  4OU7 A;  1N34 M;  4AKI A;  2CEA A;  2Y0Q A;  4B7H A;  2L09 A;  4DR5 M;  3VLF B;  3U60 B;  5KPR A;  3W0L B;  2F5P A;  2HKJ A;  3PNY A;  5ITU A;  1G8P A;  2UXB M;  4D81 A;  1KFV A;  2JA2 A;  3ILK A;  4AKH A;  4LJ7 A;  7CAT A;  4R71 A;  4NSR A;  1HJP A;  1XB2 B;  1EIJ A;  4AKG A;  4P17 A;  5EQT A;  2RGO A;  4DV4 M;  1ZAE A;  1ZMW A;  1NJF A;  4QNR A;  1I94 M;  2JUJ A;  1HT2 E;  1PJS A;  3HX3 A;  3ZCB B;  4GKJ M;  3HZJ A;  2OQ4 A;  1QUT A;  3THG A;  2QCU A;  4D82 A;  3BXW A;  4GIP A;  1MU5 A;  3L29 A;  1P3Q Q;  3SYL A;  3DZD A;  3EIE A;  3GQ5 A;  1QYR A;  4LF4 M;  3UGJ A;  2ZTC A;  2LVP C;  1OJL A;  4FWG A;  3AJI B;  1GL6 A;  3UK6 A;  3JR5 A;  1L2C A;  3KS8 A;  4DR7 M;  3CTW B;  2X8A A;  4IBE A;  2LTU A;  1YSY A;  3SAR A;  1BVS A;  3FUU A;  1XXH E;  2WZJ A;  1L1T A;  4OW0 A;  1K3X A;  5ITQ A;  3R9X B;  4I81 A;  3V76 A;  4IBJ A;  2LVQ D;  2W82 A;  1QDR A;  3HKP A;  3U6E A;  3GO8 A;  1DV0 A;  3QYE A;  1GVN A;  4KLN A;  1JQJ C;  3T1Y M;  3SHG B;  4YY3 M;  2D7H A;  8CAT A;  3D8L A;  3KVW A;  5ITX E;  3TPZ A;  1OFH A;  3J2P B;  4MGK E;  2YNM D;  1F4I A;  1JR3 A;  4MGH A;  2F5O A;  1PJJ A;  2QHO B;  1T3T A;  1Z5B A;  3PVS A;  2VQE M;  1IXZ A;  4F2L A;  2JP7 A;  2WSF F;  1DGH B;  1QVR A;  2JZ0 A;  2KA6 B;  3AV0 A;  3HHW A;  3KOX E;  3U6Q A;  3FRH A;  5FTN A;  3U6C A;  2J7O A;  1D0K A;  2MRO B;  1UM8 A;  3M6A A;  3FTC A;  2ZM6 M;  1D0M A;  4M9X A;  1XMO M;  3HU2 A;  1IY2 A;  2V6Z M;  1G71 A;  3JR4 A;  2BJV A;  4KT0 F;  1KSF X;  3WHL A;  3T38 A;  4DV2 M;  1OKS A;  3E21 A;  2LNH C;  2R46 A;  3C3D A;  4PT5 A;  3L2A A;  4G4Q A;  1Q3B A;  3MK6 A;  4JI6 M;  1JR3 D;  4HLQ A;  4NXM M;  2F4V M;  4AQY M;  1OIZ A;  4MB7 A;  5LMN M;  2R45 A;  3GPU A;  1HQY E;  1TR8 A;  1NY6 A;  1X37 A;  3CF6 E;  3ZC7 B;  3HJQ A;  3TWK A;  2YR0 A;  2CV1 A;  2I7P A;  4FVM A;  3GLI B;  4B7G A;  2JY5 A;  3SMS A;  4XK8 F;  4NOO B;  2CWB A;  5IT9 S;  4YHH M;  4LZJ A;  1OIP A;  4M9Z A;  3GPY A;  3L25 A;  1D0L A;  4IJF A;  4B3S M;  4IJE A;  1NHW C;  2CRU A;  2M60 A;  5E26 A;  1XNR M;  1TH2 A;  3FUW A;  1ZMU A;  2R4E A;  3AOE A;  3HGI A;  1SXJ A;  5EJC A;  1K3W A;  2CHV A;  4X62 M;  4RF0 A;  1NO1 A;  4G4R A;  1DGF A;  1N77 A;  1OQY A;  4R7G A;  3U6P A;  4LF6 M;  3GPP A;  4RKU F;  1MN3 A;  2B3T A;  5IWA M;  3TWL A;  4PD2 A;  3GQ3 A;  4REZ A;  2X4A A;  1XHB A;  2KEB A;  1IXS B;  4IBI A;  1SXJ B;  1E9S A;  2JY6 B;  2Q2E B;  4GKK M;  3A42 A;  4ITQ A;  4GC5 A;  3RGP A;  1SXJ D;  1GO5 A;  2P5T A;  2X49 A;  1GJT A;  3SAU A;  3B7Q A;  3VDU A;  5KQ8 A;  3QAU A;  3KOZ E;  3C58 A;  1XXH A;  4ZPX A;  1LV7 A;  5DYG A;  1G41 A;  5IZ7 D;  2ZBK B;  4I5S A;  3MJ5 A;  1D2N A;  4GHA A;  4DUZ M;  1QZM A;  3HJS A;  2FFJ A;  1Y8G A;  3ZQJ A;  4MGI E;  1AUA A;  1R6B X;  2L6O A;  2K47 A;  3AOG A;  3FYD A;  2DHR A;  2EUC A;  2QNJ A;  3F92 A;  4MGZ E;  1IBK M;  2QZ4 A;  1VDD A;  5ITX A;  4DV0 M;  3KXE C;  3SBJ A;  1Z5A A;  2CHG A;  4HEO A;  1L2B A;  2LH0 A;  4MH0 E;  3SC3 A;  3GLF E;  1HQC A;  2O5R A;  5FTK A;  2FE8 A;  3HHY A;  1SXJ C;  4KHP M;  4LY6 A;  1PJT A;  1VEJ A;  2KDL A;  3CGW A;  3ZH9 B;  4AI6 A;  4Y28 F;  2DAE A;  5E6J A;  1NSF A;  4JI0 M;  5EP2 A;  1GAB A;  1UFZ A;  2Z4S A;  3M0E A;  4R3D A;  1WR1 B;  2GNO A;  2FOI C;  4PCZ A;  2JZ1 A;  2DZN B;  2MGW A;  3E9S A;  5FTM A;  1EFU B;  2R44 A;  2QPA A;  1C1K A;  1FNN A;  4DUY M;  3SAS A;  4MGY E;  1V33 A;  3FD9 A;  2DWZ B;  2VF7 A;  4GHL A;  2F5N A;  2QBY A;  4NXN M;  3Q8X A;  1IXR C;  2MR9 A;  4DV5 M;  4LZZ A;  5KPZ A;  2A5Y B;  3A98 B;  3U6O A;  1OTR A;  2V1U A;  3K2L A;  4WW0 A;  1L8Q A;  1NV8 A;  4I4L A;  2DWN A;  2D7G A;  3J7B A;  4JV5 M;  3HU3 A;  4XGI A;  1QAM A;  3FTF A;  3K1J A;  4P16 A;  3B89 A;  4JI4 M;  3GRV A;  4WP2 A;  2QBY B;  3IG5 A;  4AZF A;  2DHY A;  3GLG A;  2CUZ A;  4AW4 A;  1I4W A;  3LCU A;  4TUW A;  3IEC A;  2KRU A;  1IY0 A;  1QDT A;  3W67 A;  3NWL A;  1DGG A;  3U6L A;  1R2Y A;  2CP8 A;  4CGY B;  2UU9 M;  4X66 M;  4LFB M;  1TH3 A;  4W5W A;  3BOS A;  3W68 A;  2LVA A;  2R65 A;  2JY7 A;  3E4R A;  2MH8 A;  2XLJ A;  2FS1 A;  4DR1 M;  3UZU A;  3IG8 A;  1T43 A;  4XBO A;  3GLG B;  1W5T A;  2KXE A;  5IRE B;  1N36 M;  2WSC F;  4LF8 M;  2DZO B;  1C7Y A;  3FTE A;  1G59 A;  1G4A E;  5L8R F;  2EKF A;  3PNV A;  3TWM A;  4LFC M;  3TL4 X;  4S12 A;  2DVW B;  4NC6 A;  3U61 A;  4FCT A;  4M0D A;  4DR4 M;  1GLN A;  1R5L A;  3LVV A;  1WJ7 A;  1NHG C;  3KW6 A;  4LF7 M;  2K0B X;  2G3Q A;  3J81 S;  2YQZ A;  4JI1 M;  3J80 S;  4JN6 A;  1EE8 A;  2R18 A;  2FH0 A;  5JI3 E;  3GLH A;  4KOD A;  2DWM A;  4B7F A;  2QSF X;  5FLX S;  2XZU A;  3MHV C;  2HCB A;  3NBI A;  3D8B A;  2Z4R A;  2C96 A;  1HT1 E;  3HHX A;  5DFL A;  3WHK A;  2O01 F;  3KOW E;  1QUS A;  3L27 A;  2KHH A;  3DA1 A;  2QQ8 A;  4FCV A;  2HL7 A;  4RF1 A;  5EP1 A;  2XZF A;  4B3M M;  2HHH M;  2K9D A;  1LTM A;  3M7G A;  3RGS A;  4OVZ A;  5EP3 A;  4II7 A;  3GLF A;  1OAI A;  4HL4 A;  2M5Z A;  5JI2 E;  3GLH B;  4GH9 A;  4JI5 M;  2QEN A;  1PGY A;  2KNZ A;  4WUR A;  3R8F A;  3AL0 C;  2UUB M;  5C1B A;  2NQ8 C;  5BPV A;  4LJA A;  3OTO M;  1N33 M;  3RE8 A;  3B7N A;  1AIP C;  2BJW A;  2L2D A;  2YFQ A;  4UN2 B;  1R2Z A;  1IBL M;  4L78 A;  1V34 A;  4LJ5 A;  4LRT A;  3GRY A;  4GRI A;  1GKI A;  5ITT A;  1N75 A;  4I8O A;  2G8L A;  2XFT A;  2DAK A;  4ANR A;  2Y0T A;  1DO2 A;  1XC8 A;  4IBK A;  1VDL A;  3BBZ A;  4NRV A;  1TDZ A;  4JI8 M;  4KO8 A;  4FD2 A;  4LF9 M;  1IN5 A;  1IN7 A;  2ZAM A;  3T15 A;  1TTE A;  2QP9 X;  3H4M A;  4LFA M;  4JI7 M;  3K9P A;  1XMQ M;  2H5X A;  1TGU A;  1NNJ A;  2UUC M;  5DYI A;  3T1H M;  1H6U A;  1JR3 E;  1Z5C A;  5FSW A;  1ZQ9 A;  2Z3X A;  1QAO A;  1YLA A;  4LGY A;  1GJS A;  2VF8 A;  2ZAN A;  4F1I A;  1K82 A;  4IIW A;  4LJ8 A;  4OX9 M;  1XNQ M;  2WSE F;  1XXH B;  4M9S A;  4X64 M;  3B7Z A;  2JWS A;  2DXI A;  4LF5 M;  2DZL A;  2KNA A;  3GP1 A;  4K0K M;  3HHZ A;  3GLI E;  2OOB A;  2LXE A;  3AOE C;  3KSX A;  3VFD A;  2DI0 A;  3UJN A;  4CIS A;  4QNM A;  2KZS A;  3MMP A;  3Q8G A;  1MJG M;  2C9C A;  4JI3 M;  2O25 A;  2R6F A;  4JXJ A;  4Z8X A;  5BR8 M;  4G4N A;  3I01 M;  1TF0 B;  3FUV A;  4NRW A;  4LRS A;  4L4U A;  2DWL A;  2KW0 A;  1NY5 A;  3B9P A;  4PDI A;  1OAO C;  1RU3 A;  1WHC A;  4IBF A;  1DGB A;  3I4V A;  1YE9 A;  4M0W A;  1VEG A;  3HWS A;  3KP1 E;  2EO2 A;  4GMQ A;  1FJG M;  1HNX M;  3K92 A;  3VKH A;  1N78 A;  5A2Q S;  3CF2 A;  2DEN A;  4LJ6 A;  4JYA M;  5DNY A;  1SXJ E;  2AHM A;  1IN8 A;  1SG9 A;  1T6O A;  1WGL A;  2ZAO A;  3FYC A;  1JB0 F;  2Y20 A;  4MM3 B;  4DV3 M;  5F3W A;  1PJQ A;  2N35 A;  4L15 A;  1R7R A;  1J5E M;  3SAT A;  5GKN A;  2C9O A;  4GEW A;  1Q02 A;  3QYB A;  3LW5 F;  2DKL A;  4B3R M;  2Y21 A;  1E94 E;  3SAW A;  4Z6Y A;  2C98 A;  1CUK A;  1DO0 A;  1NNU C;  1NVM A;  2BWB A;  2H1R A;  4RNA A;  2EA0 A;  3KDS E;  1E9R A;  2GQF A;  2LVO C;  3H4J A;  5EXP A;  5KO3 A;  2C99 A;  3FRI A;  3L26 A;  2XF3 A;  1R4G A;  3DFZ A;  3RFW A;  4FWH A;  4CHT B;  2G5G X;  4DV1 M;  1VG5 A;  3FE3 A;  3U6D A;  4QOZ C;  5EXX A;  3TQS A;  1WXQ A;  2JXN A;  2ZTD A;  3VK8 A;  2Z8Y M;  3LMM A;  2DNA A;  1E32 A;  3KSJ A;  3I4Y A;  2RRU A;  4D80 A;  3GRR A;  3L28 A;  2XH9 A;  2XGN A;  2D7E A;  2RKO A;  4B08 A;  1IFY A;  5EXT A;  1WIV A;  1IN6 A;  1DGH A;  4LGM A;  4JI2 M;  1IY1 A;  1QQW A;  3GPX A;  2MJ5 B;  3FUX A;  3SHF A;  2BWE A;  1VEK A;  2DAI A;  5C18 A;  3VKG A;  5EP4 A;  3J27 B;  4NL4 H;  1Z6T A;  5ITR A;  4CJ6 A; 
#chains in the Genus database with same CATH homology
 4BB9 A;  2F5S A;  4L8R C;  3GQ4 A;  2UXD M;  3JAM S;  1ORY B;  2XEP A;  2Z7J A;  3U61 B;  3LVW A;  1QAQ A;  2E5L M;  2I7N A;  3CF0 A;  3GRU A;  4DR6 M;  5ITY A;  1G3I A;  3VDP A;  5KQD A;  1PM5 A;  2VII A;  3FTD A;  1L1Z A;  3LQQ A;  3EIH A;  3HU1 A;  2UXC M;  1S3S A;  1TDH A;  1N32 M;  1HR0 M;  4IBB A;  3GLI A;  4B3T M;  3I51 A;  1XNR M;  1OFI A;  1XWI A;  2XFS A;  3DOA A;  3AKZ A;  5EXS A;  1Q39 A;  2RGH A;  4A3V B;  2OPF A;  4IBC A;  4AG5 A;  2CV0 A;  2XSZ A;  1IQP A;  3A45 A;  1IN4 A;  4AG6 A;  1QAN A;  3HJ8 A;  2R4J A;  3KOY E;  4FCW A;  4X65 M;  4L16 A;  4OVZ B;  3GLF B;  3U5Z A;  3LQR A;  4LCB A;  5FTJ A;  1IM2 A;  2CFO A;  1W5S A;  2KRK A;  5H37 D;  4LJ9 A;  3J7A S;  1GL7 A;  4EIW A;  3W0F A;  3PFI A;  3FKE A;  2ERC A;  2BNK A;  3VK7 A;  4IBD A;  1IBM M;  2XSZ D;  4LJ4 A;  5KPT A;  1PJI A;  3U5Z B;  1L2D A;  3SFZ A;  1MX0 A;  2R62 A;  3U6S A;  4DV7 M;  3PXG A;  2L7H A;  3QWL A;  3U6M A;  3SMP A;  2F5Q A;  2FNA A;  1YUB A;  4DV6 M;  4BLC A;  4FWD A;  4QOS A;  3K8Z A;  4QHT A;  3KFU G;  1KYI A;  3AFH A;  3SYK A;  5FTL A;  3UMM A;  2J7N A;  3FUT A;  3KP0 E;  1NJG A;  4DR3 M;  2LWX A;  2CV2 A;  3KS4 A;  2C5R A;  4GC9 A;  4NSO B;  4QHS A;  1J09 A;  2VQF M;  2V1C A;  1HNW M;  1Q3C A;  3SAV A;  4LG2 A;  4IBG A;  1TH4 A;  4PDG A;  1J7K A;  4BBA A;  4G6Z A;  5LMU M;  3TE6 A;  3A46 A;  3U60 A;  4FW9 A;  1Z59 A;  2CHQ A;  2KZU A;  4G4O A;  2UUA M;  2CE7 A;  4DR2 M;  2L7I A;  1HNZ M;  4GIT A;  4OU7 A;  1N34 M;  4AKI A;  2CEA A;  2Y0Q A;  4B7H A;  2L09 A;  4DR5 M;  3VLF B;  3U60 B;  5KPR A;  3W0L B;  2F5P A;  2HKJ A;  3PNY A;  5ITU A;  1G8P A;  2UXB M;  4D81 A;  1KFV A;  2JA2 A;  3ILK A;  4LJ7 A;  7CAT A;  4AKG A;  4NSR A;  5EQT A;  2RGO A;  4DV4 M;  1ZAE A;  1NJF A;  4QNR A;  1I94 M;  1HT2 E;  4GKJ M;  3ZCB B;  2OQ4 A;  3THG A;  4D82 A;  2QCU A;  4GIP A;  1MU5 A;  3L29 A;  3SYL A;  3DZD A;  3EIE A;  3GQ5 A;  1QYR A;  4LF4 M;  3UGJ A;  3KS8 A;  4FWG A;  1OJL A;  3UK6 A;  3AJI B;  1GL6 A;  3JR5 A;  4DR7 M;  1L2C A;  3CTW B;  2X8A A;  4IBE A;  1YSY A;  3SAR A;  3FUU A;  1L1T A;  4OW0 A;  1K3X A;  5ITQ A;  3R9X B;  4I81 A;  4IBJ A;  2W82 A;  3HKP A;  3U6E A;  3GO8 A;  1GVN A;  4KLN A;  1JQJ C;  3T1Y M;  3SHG B;  4YY3 M;  2D7H A;  8CAT A;  3D8L A;  3KVW A;  5ITX E;  3TPZ A;  1OFH A;  3J2P B;  4MGK E;  2YNM D;  1JR3 A;  4MGH A;  2F5O A;  1PJJ A;  1T3T A;  1Z5B A;  3PVS A;  2VQE M;  1IXZ A;  3KOX E;  1DGH B;  1QVR A;  3AV0 A;  2KA6 B;  3U6Q A;  3HHW A;  5FTN A;  3U6C A;  2J7O A;  1UM8 A;  3M6A A;  3FTC A;  2ZM6 M;  4M9X A;  1XMO M;  3HU2 A;  1IY2 A;  2V6Z M;  3JR4 A;  2BJV A;  1KSF X;  3WHL A;  3T38 A;  4DV2 M;  2LNH C;  2R46 A;  4PT5 A;  3L2A A;  4G4Q A;  1Q3B A;  3MK6 A;  4JI6 M;  1JR3 D;  4HLQ A;  4NXM M;  2F4V M;  4AQY M;  4MB7 A;  5LMN M;  2R45 A;  3GPU A;  1HQY E;  1X37 A;  1NY6 A;  3CF6 E;  3ZC7 B;  3HJQ A;  3TWK A;  2YR0 A;  2CV1 A;  2I7P A;  4FVM A;  3GLI B;  4B7G A;  3SMS A;  4NOO B;  5IT9 S;  4YHH M;  4LZJ A;  4M9Z A;  3GPY A;  3L25 A;  4IJF A;  4B3S M;  4IJE A;  1NHW C;  2M60 A;  5E26 A;  1TH2 A;  3FUW A;  2R4E A;  3AOE A;  3HGI A;  1SXJ A;  5EJC A;  1K3W A;  2CHV A;  4X62 M;  4RF0 A;  4G4R A;  1DGF A;  1N77 A;  4R7G A;  3U6P A;  4LF6 M;  3GPP A;  5IWA M;  3TWL A;  4PD2 A;  3GQ3 A;  4REZ A;  2X4A A;  1XHB A;  2KEB A;  1IXS B;  4IBI A;  1SXJ B;  1E9S A;  4GKK M;  2Q2E B;  3A42 A;  4ITQ A;  4GC5 A;  3RGP A;  1SXJ D;  2P5T A;  2X49 A;  3SAU A;  3VDU A;  5KQ8 A;  3QAU A;  3KOZ E;  3C58 A;  1XXH A;  4ZPX A;  1LV7 A;  5DYG A;  1G41 A;  5IZ7 D;  2ZBK B;  4I5S A;  3MJ5 A;  1D2N A;  4GHA A;  4DUZ M;  1QZM A;  3HJS A;  2FFJ A;  4MGI E;  1R6B X;  2L6O A;  2K47 A;  3AOG A;  3FYD A;  2DHR A;  2EUC A;  4MGZ E;  1IBK M;  2QZ4 A;  1VDD A;  5ITX A;  4DV0 M;  3KXE C;  3SBJ A;  1Z5A A;  2CHG A;  1L2B A;  2LH0 A;  4MH0 E;  3SC3 A;  1HQC A;  2O5R A;  5FTK A;  2FE8 A;  3HHY A;  1SXJ C;  4KHP M;  4LY6 A;  3ZH9 B;  4AI6 A;  5E6J A;  1NSF A;  4JI0 M;  5EP2 A;  2Z4S A;  3M0E A;  4R3D A;  2FOI C;  4PCZ A;  2DZN B;  3E9S A;  5FTM A;  2QPA A;  1C1K A;  1FNN A;  4DUY M;  3SAS A;  4MGY E;  3FD9 A;  2DWZ B;  4GHL A;  2F5N A;  2QBY A;  4NXN M;  3Q8X A;  1IXR C;  4DV5 M;  4LZZ A;  5KPZ A;  2A5Y B;  3A98 B;  3U6O A;  2V1U A;  3K2L A;  4WW0 A;  1L8Q A;  2DWN A;  4I4L A;  2D7G A;  3J7B A;  4JV5 M;  3HU3 A;  4XGI A;  1QAM A;  3FTF A;  3K1J A;  4P16 A;  4JI4 M;  3GRV A;  2QBY B;  3IG5 A;  4AZF A;  3GLG A;  2CUZ A;  4AW4 A;  1I4W A;  4TUW A;  2KRU A;  1IY0 A;  3U6L A;  3NWL A;  1DGG A;  1R2Y A;  4CGY B;  2UU9 M;  4X66 M;  4LFB M;  1TH3 A;  4W5W A;  3BOS A;  2R65 A;  3E4R A;  2XLJ A;  4DR1 M;  3UZU A;  3IG8 A;  4XBO A;  3GLG B;  1W5T A;  2KXE A;  5IRE B;  1N36 M;  4LF8 M;  2DZO B;  3FTE A;  1G59 A;  1G4A E;  3TWM A;  3PNV A;  4LFC M;  3TL4 X;  4S12 A;  2DVW B;  3U61 A;  4FCT A;  4M0D A;  4DR4 M;  1GLN A;  3LVV A;  3KW6 A;  1NHG C;  4LF7 M;  3J81 S;  2YQZ A;  4JI1 M;  3J80 S;  4JN6 A;  1EE8 A;  2R18 A;  5JI3 E;  3GLH A;  4KOD A;  2DWM A;  4B7F A;  5FLX S;  2XZU A;  3MHV C;  2HCB A;  3NBI A;  3D8B A;  2Z4R A;  2C96 A;  1HT1 E;  3HHX A;  3WHK A;  3KOW E;  3L27 A;  4FCV A;  3DA1 A;  4RF1 A;  2XZF A;  2HL7 A;  5EP1 A;  4B3M M;  2HHH M;  3M7G A;  3RGS A;  4OVZ A;  5EP3 A;  4II7 A;  3GLF A;  4HL4 A;  2M5Z A;  5JI2 E;  3GLH B;  4GH9 A;  4JI5 M;  2QEN A;  4WUR A;  3R8F A;  3AL0 C;  2UUB M;  5C1B A;  2NQ8 C;  5BPV A;  4LJA A;  3OTO M;  1N33 M;  3RE8 A;  2BJW A;  2YFQ A;  1R2Z A;  1IBL M;  4L78 A;  4LJ5 A;  4LRT A;  3GRY A;  4GRI A;  1GKI A;  5ITT A;  1N75 A;  4I8O A;  2G8L A;  2XFT A;  2Y0T A;  1DO2 A;  1XC8 A;  4IBK A;  4NRV A;  1TDZ A;  4JI8 M;  4KO8 A;  4FD2 A;  4LF9 M;  1IN7 A;  1IN5 A;  2ZAM A;  3T15 A;  2QP9 X;  3H4M A;  4LFA M;  4JI7 M;  1XMQ M;  1NNJ A;  1TGU A;  2UUC M;  5DYI A;  3T1H M;  1H6U A;  5FSW A;  1Z5C A;  1ZQ9 A;  2Z3X A;  1QAO A;  4LGY A;  2ZAN A;  1K82 A;  4IIW A;  4LJ8 A;  4OX9 M;  1XNQ M;  1XXH B;  4M9S A;  4X64 M;  2DXI A;  4LF5 M;  3GP1 A;  4K0K M;  3HHZ A;  2LXE A;  3AOE C;  3KSX A;  3VFD A;  3UJN A;  4CIS A;  4QNM A;  2KZS A;  2C9C A;  4JI3 M;  4JXJ A;  4Z8X A;  4G4N A;  5BR8 M;  3FUV A;  4NRW A;  4LRS A;  4L4U A;  2DWL A;  2KW0 A;  1NY5 A;  3B9P A;  4PDI A;  4IBF A;  1DGB A;  3I4V A;  1YE9 A;  4M0W A;  3HWS A;  3KP1 E;  2EO2 A;  4GMQ A;  1FJG M;  1HNX M;  3K92 A;  3VKH A;  1N78 A;  5A2Q S;  3CF2 A;  4LJ6 A;  4JYA M;  5DNY A;  1SXJ E;  1IN8 A;  2AHM A;  2ZAO A;  3FYC A;  4MM3 B;  4DV3 M;  4AKH A;  2Y20 A;  5F3W A;  3SAT A;  1J5E M;  4L15 A;  1R7R A;  5GKN A;  2C9O A;  4B3R M;  2Y21 A;  1E94 E;  3SAW A;  4Z6Y A;  2C98 A;  1DO0 A;  1NNU C;  4RNA A;  1NVM A;  2H1R A;  2EA0 A;  3KDS E;  1E9R A;  3L26 A;  5EXP A;  5KO3 A;  2C99 A;  2XF3 A;  3DFZ A;  3RFW A;  4FWH A;  4CHT B;  2G5G X;  4DV1 M;  3U6D A;  4QOZ C;  5EXX A;  3TQS A;  1WXQ A;  3VK8 A;  3LMM A;  1E32 A;  3KSJ A;  3I4Y A;  4D80 A;  3GRR A;  3L28 A;  2XH9 A;  2XGN A;  2D7E A;  2RKO A;  4B08 A;  5EXT A;  1IN6 A;  1DGH A;  4LGM A;  4JI2 M;  1IY1 A;  1QQW A;  3GPX A;  3FUX A;  5C18 A;  3SHF A;  3VKG A;  5EP4 A;  3J27 B;  4NL4 H;  1Z6T A;  5ITR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...