2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Uncharacterized protein
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
2Y0TA 2L7HA 2Y20A 2Y0QA 4I5SA 2Y21A 2L7IA
chains in the Genus database with same CATH superfamily
3U61A 4JI6M 4JI3M 4X62M 3SHGB 3EIHA 2JY5A 4X64M 2XFSA 2KNVA 2Z4RA 1D0KA 4GC9A 7CATA 1GABA 2EKKA 2P5TA 3FUXA 1NY6A 4XGIA 4ITQA 5JI2E 2BNKA 4HL4A 2CUZA 4LJ7A 4LGYA 1OTRA 1LV7A 1TH3A 4G4RA 4JI2M 1DGBA 3SARA 2DZOB 3JAMS 3U61B 2R0IA 1PM5A 2F5NA 4HEOA 1PJTA 1IBMM 1VDLA 4G4QA 3VK7A 4RF1A 3HWSA 1JR3A 2K0BX 1R6BX 3FUWA 3LMMA 4FD2A 5KO3A 3JR4A 3K1JA 2HL7A 3SASA 2DNAA 4LJ4A 1N36M 1IN7A 3KP0E 4F1IA 2DZLA 5DYIA 4DR6M 1MX0A 5A2QS 1A5TA 1IXZA 1YLAA 3B89A 3NWLA 1K82A 1X37A 3HHWA 3GLGA 4PT5A 1HT2E 3CF2A 1KSFX 2C96A 2EKFA 1R5LA 3GLIA 1IN6A 4B7HA 1N78A 2RGOA 3ILKA 3E9SA 5EP3A 5FSWA 2E5LM 4MGKE 3EIEA 2OO9A 4GEWA 2L4EA 4IBFA 4FWDA 4GMQA 2JZ1A 2YR0A 4LZJA 4QOSA 1K3WA 1MJGM 1OFIA 4LF9M 3W67A 3PFIA 2QQ8A 2Z8YM 2K47A 5KPZA 1PGYA 4G3OA 5FTJA 1AUAA 1GVNA 3AV0A 4R71A 2JXNA 3VK8A 2OPFA 3K8ZA 2Y21A 1NV9A 2F5SA 4R3DA 1AIPC 2R4EA 3FYDA 3UMMA 4L8RC 1SG9A 4UN2B 2C5RA 3BXWA 1SXJD 5EP4A 1IY1A 1Y8GA 2HAKA 2WSCF 4QNMA 5IREB 4NRVA 3KDSE 3ZQJA 1NNJA 1GKIA 4L78A 3SC3A 3UJNA 1WHCA 4AG5A 2QZ4A 3L28A 1J5EM 2XFTA 4IBDA 3SAWA 3GQ5A 4B3RM 4BB9A 1C7YA 3D8BA 4LFAM 5F3WA 2CV0A 1Q02A 2DWLA 2EJSA 4CHTB 4JI1M 1EFUB 5KPTA 1DGHB 2QBYA 4LF4M 2L7HA 2ERCA 1IXSA 3ZCBB 2F5QA 3GLIE 2DAGA 3QAUA 4G6ZA 1PJQA 2K6BA 3FUTA 3M0EA 4WURA 4NRWA 1HJPA 1QZMA 3HJQA 3I01M 2H5XA 3C3EA 3GLIB 3L27A 2DWZB 2LVQD 2Q2EB 2DAEA 1WIVA 5LMUM 4EIWA 4L15A 3DZDA 4KODA 2I7PA 3SFZA 1N75A 3A42A 1TF0B 3A98B 3HU1A 4KO8A 3VKGA 4LJ6A 2O5RA 1Z59A 4DV0M 4OW0A 5FTMA 2CHQA 3T15A 4JN6A 4AZFA 2F5OA 3TWLA 3MK6A 3GPXA 2UUAM 3HY5A 3KS8A 2Z7JA 2CP8A 2DZNB 2FE8A 4M9ZA 4CIZA 1L1TA 3GRUA 3RGSA 3FUVA 3CF0A 1NHWC 2JWSA 4I5SA 4PCZA 4M0WA 1PJIA 3M6AA 3R8FA 3GO8A 5KPRA 1V34A 3HJ8A 5ITRA 2RRUA 4MB7A 3THGA 1XMQM 1DV0A 4DR3M 1JR3D 4BBAA 4B7GA 2DHYA 4NOOB 1IXSB 3PNVA 3ZH9B 1BVSA 3IG8A 4CISA 1TDHA 4NL4H 2XGNA 4DR7M 3GRYA 1IM2A 1RU3A 4DV5M 3R9XB 3QWLA 3VFDA 1IN4A 2QCUA 1IBKM 3HU2A 2UU9M 2DENA 2NQ8C 1WJ7A 2R6FA 3DFZA 3QYBA 3KFUG 3KS4A 4MGYE 3I4YA 1TH4A 5ITXA 2DAIA 2KA6B 2EO2A 3VDUA 3E21A 2CEAA 3L2AA 3U6OA 3J27B 1IN5A 1D0MA 2HKJA 4MM3B 1J09A 3TWKA 3J7AS 1IFYA 1QAOA 1T3TA 2FFJA 4L16A 3SHFA 2XLJA 1WGLA 1VQ1A 4IJEA 3Q8XA 4DV1M 1YE9A 2CRUA 1HT1E 2LVPC 3AOGA 3C3DA 4IJFA 4ZPXA 4DV2M 3B7NA 2D7EA 2RGHA 2LXEA 4REZA 4FCTA 1QUSA 2LVOC 3Q8GA 1XWIA 1HQCA 3GQ3A 1YSYA 4YY3M 4DR2M 4G4OA 2LTUA 4IIWA 2ZTDA 2BJWA 2QP9X 4DV3M 3LVWA 3K2LA 3I4VA 4II7A 2O01F 2KZSA 3IECA 3T6PA 2BWEA 4LF6M 1GJTA 2CE7A 1XXHE 1PRBA 3LQRA 4IBIA 1ZAEA 4P16A 2Z3XA 4AKGA 4AQYM 3NBIA 3W0FA 1SXJA 1IN8A 3HJSA 5DYGA 5DNYA 2XSZA 3KVWA 3LCVB 1IBLM 2XEPA 1HR0M 4LF7M 2ZTCA 2JA2A 3RGPA 1TDZA 4LJ5A 1VEGA 2ZM6M 1GLNA 2VIIA 3J7BA 1Z5AA 1T6OA 3UZUA 4JV5M 2UUCM 2D7GA 4YHHM 1NVMA 2J7OA 2A5YB 4PDIA 4MGZE 4KLNA 3KOWE 1Z5BA 2C9CA 4D82A 1N32M 2W82A 2ZBKB 3U60A 3GRRA 1QDRA 4LRSA 1L8QA 3CTWB 1PJJA 2KDLA 3MMPA 4RF0A 1ZQ9A 3GLHB 2FOIC 4QHSA 1XB2B 4LJ8A 3PXGA 1IY2A 2OQ4A 2N35A 4GHAA 4FCVA 1E9SA 1ZMVA 3LVVA 4DV6M 2R44A 1UM8A 5E26A 4LGMA 3IG5A 3HHYA 2UXDM 2APLA 4PDGA 1NJGA 1KYIA 1ZV1A 3B74A 3FE3A 1KFVA 1L2CA 3JR5A 4A3VB 1NHGC 2O25A 2Y0QA 3U6DA 4HLQA 1Z5CA 5FTLA 4Y28F 4B3SM 3RE8A 1OAIA 5ITUA 4DUZM 4ANRA 1G41A 1V92A 2CWBA 4DR4M 4L6V6 4Z8XA 3A45A 2HWJA 5EQTA 4OVZB 3T1YM 4GKKM 4W5WA 2XZFA 5EXXA 1Q39A 3V76A 3CGWA 2KNZA 3J2PB 1GJSA 3H4JA 2UXBM 3HGIA 2GNOA 1T43A 3GLHE 3DA1A 2MH8A 1ZMWA 3FTDA 4QOZC 1G4AE 1WXQA 1NSFA 2CHVA 3TE6A 2UUBM 3FKEA 1OIZA 1HNZM 1GO5A 4IBKA 4KHPM 1JQJC 2VQFM 4D81A 2DHRA 4LF8M 1ORYB 1QAMA 1MU5A 2R45A 2ZANA 1D2NA 4RNAA 2JNHA 3J81S 4I4LA 1H6UA 1VG5A 1TTEA 4IBCA 1G3IA 4LJ9A 2EA0A 3GLFE 3I51A 3T1HM 3H4MA 1NNUC 3MHVC 1V33A 5EXTA 2JUJA 4DV7M 3U6QA 3U6MA 2G3QA 3GPPA 4M9SA 4IBEA 2HCBA 3HHZA 4JI8M 2MROB 4OVZA 1OQYA 5IZ7D 4LG2A 1XXHB 3SAUA 4QHTA 2DI0A 4B08A 4DR1M 3U6SA 1NO1A 5FTNA 1E32A 3FTEA 2OOBA 1E9RA 3L25A 2DKLA 3KSJA 4F2LA 4GKJM 2GQFA 1E94E 2JZ0A 1HNXM 2AHMA 2J7NA 3SYKA 1Q3BA 5EXPA 5E6JA 4IBJA 4M0DA 5ITTA 4AKIA 3W68A 4GH9A 3QYEA 2KEBA 2LWXA 1UFZA 2CV2A 2LHGA 2YNMD 3E4RA 2DAMA 1N33M 2M5ZA 4LY6A 5ITQA 3GLFA 2VQEM 2YFQA 1NJFA 1VEKA 4JI7M 2BJVA 4S12A 3WHKA 2EUCA 4MGIE 5IWAM 1SXJC 3AOEC 2HHHM 5H37D 2LHCA 2C99A 4FCWA 5EP1A 3AKZA 4JI0M 4DBGB 3FYCA 2VF8A 3U6LA 2QHOB 3I04M 4AKHA 4OU7A 1G8PA 3FRHA 1CUKA 2QBYB 2DVWB 2DXIA 2LVNC 4MH0E 4XBOA 2L2DA 2RKOA 4NSRA 1Z6TA 4B3TM 3FTFA 4IBBA 2LNHC 3TPZA 1I4WA 2CHGA 4B7FA 3SATA 1J7KA 1OIPA 4RKUF 1W5TA 2JP7A 4X65M 3KXEC 4I8OA 2WSFF 2WSEF 2J5YA 1N77A 3CF6E 2XZUA 1C1KA 3OTOM 2QPAA 1P3QQ 2XH9A 4DR5M 2Z4SA 5GKNA 4PD2A 5ITYA 1EIJA 4AI6A 4LJAA 3GQ4A 3B7QA 1L2DA 4DV4M 4XK8F 1DGHA 4FWHA 3K9OA 2D7HA 3HZJA 3K9PA 4NC6A 5KQ8A 4GRIA 5BPVA 1JB0F 4K0KM 3VDPA 2R4JA 3FTCA 5IT9S 3ZC7B 2DWNA 3GPUA 4LRTA 2FNAA 1QVRA 4QNRA 2ZAMA 5C18A 1IY0A 1QDTA 4GIPA 2R65A 2X4AA 2Y20A 1TR8A 3GLHA 3HKPA 3IHPA 3PVSA 2JY7A 2QNJA 3TL4X 5C1BA 4BLCA 1L1ZA 2V1UA 2L6OA 3HU3A 2V6ZM 4OX9M 5DFLA 2KNAA 1QQWA 2JY6B 4X66M 2K9DA 4GC5A 5KQDA 1PJSA 4WP2A 4R7GA 4G4NA 3GP1A 4JI5M 3GLGB 4LFBM 3KOZE 4KT0F 5FTKA 1IXRC 1DGGA 1QANA 1R7RA 3BOSA 2C98A 4Q7JA 3FD9A 5JI3E 2BWBA 5LMNM 3HX3A 1XNQM 3HHXA 2KW0A 2H1RA 4AG6A 2VDBB 3SAVA 4GITA 3U60B 3MJ5A 1G71A 3SMPA 1D0LA 2R18A 4CGYB 1DO2A 1ZMUA 4I81A 4P17A 2FS1A 5FLXS 1GL6A 5EJCA 4WW0A 3AFHA 5ITXE 4TUWA 2F5PA 1QAQA 3D8LA 1EE8A 3U5ZA 2MJ5B 4FW9A 1WGNA 1LTMA 3KOYE 4FVMA 4CJ6A 3GLFB 1XNRM 2DAKA 1FJGM 3FRIA 1R2YA 1DGFA 2Y0TA 2MGWA 3F92A 3U6CA 2QSFX 4D80A 1YUBA 2JY8A 4LF5M 4LCBA 2KHHA 1IQPA 1SXJB 1VDDA 1TH2A 3KW6A 3TQSA 3B7ZA 3TWMA 4AW4A 4LZZA 5EXSA 2CV1A 1Q3CA 2G5GX 1GL7A 4B3MM 4MGHA 1XHBA 2KRUA 2WZJA 3VKHA 2XF3A 2R62A 1QZEA 3UGJA 4NXMM 1I94M 1OAOC 2V1CA 2KXEA 4JXJA 3FUUA 2CFOA 2X49A 3M7GA 2LH0A 2KRKA 1SXJE 1TGUA 2VF7A 1W5SA 3KP1E 2LBCA 4NXNM 5BR8M 1K3XA 2DWMA 3A46A 1XXHA 3AJIB 3WHLA 3LW5F 2MR9A 3SBJA 1N34M 3W0LB 4JI4M 1OJLA 3RFWA 1XMOM 3GRVA 3VLFB 4FWGA 1DO0A 1OKSA 2M60A 1S3SA 1QYRA 3LCUA 2UXCM 1NY5A 3AL0C 2LVAA 1QUTA 3DOAA 5L8RF 1G59A 2QENA 3KOXE 3LQQA 3J80S 3U6EA 2L4FA 1MN3A 2G8LA 4DUYM 2ZAOA 3C9PA 5EP2A 3U6PA 3GPYA 1R2ZA 3L26A 3K92A 2X8AA 2YQZA 3GLGE 4LFCM 2F4VM 3L29A 4Z6YA 2L09A 8CATA 3U5ZB 3SMSA 1L2BA 2C9OA 4JYAM 2B3TA 2FH0A 2R46A 2KZUA 1WR1B 2OOAA 1F4IA 3UK6A 3KSXA 4IBGA 3B9PA 1NV8A 1HNWM 4GHLA 3BBZA 2I7NA 3E46A 3NBXX 4NSOB 1FNNA 1R4GA 3AOEA 4M9XA 1HQYE 1JR3E 1VEJA 3SYLA 3C58A 1XC8A 4L4UA 1OFHA 2XSZD 3T38A 2L7IA 3PNYA
chains in the Genus database with same CATH topology
3U61A 4JI6M 4JI3M 4X62M 3SHGB 3EIHA 4X64M 2XFSA 7CATA 2Z4RA 4GC9A 2P5TA 3FUXA 1NY6A 4XGIA 4ITQA 5JI2E 2BNKA 4HL4A 2CUZA 4LJ7A 4LGYA 1LV7A 1TH3A 4G4RA 4JI2M 1DGBA 3SARA 2DZOB 3JAMS 3U61B 1PM5A 1IBMM 4G4QA 3VK7A 4RF1A 3HWSA 1JR3A 1R6BX 3FUWA 3LMMA 4FD2A 5KO3A 3JR4A 3K1JA 2HL7A 3SASA 4LJ4A 1N36M 1IN7A 3KP0E 5DYIA 4DR6M 1MX0A 5A2QS 1IXZA 3NWLA 1K82A 1X37A 3HHWA 3GLGA 4PT5A 1HT2E 3CF2A 1KSFX 2C96A 3GLIA 1IN6A 4B7HA 1N78A 2RGOA 3ILKA 3E9SA 5EP3A 5FSWA 2E5LM 4MGKE 3EIEA 4IBFA 4FWDA 4GMQA 2YR0A 4LZJA 4QOSA 1K3WA 1OFIA 4LF9M 3PFIA 2K47A 5KPZA 5FTJA 1GVNA 3AV0A 3VK8A 2OPFA 3K8ZA 2Y21A 2F5SA 4L8RC 4R3DA 3FYDA 2R4EA 3UMMA 2C5RA 1SXJD 5EP4A 1IY1A 5IREB 2F5NA 4QNMA 4NRVA 3KDSE 1NNJA 1GKIA 4L78A 3SC3A 3UJNA 4AG5A 2QZ4A 3L28A 1J5EM 2XFTA 4IBDA 3SAWA 3GQ5A 4B3RM 4BB9A 3D8BA 4LFAM 5F3WA 2CV0A 4CHTB 4JI1M 5KPTA 2QBYA 1DGHB 4LF4M 2L7HA 2ERCA 3ZCBB 2F5QA 3QAUA 4G6ZA 3M0EA 3FUTA 4WURA 4NRWA 1QZMA 3HJQA 3GLIB 3L27A 2DWZB 2Q2EB 5LMUM 4EIWA 4L15A 3DZDA 4KODA 2I7PA 3SFZA 1N75A 3A42A 3HU1A 3A98B 4KO8A 3VKGA 4LJ6A 2O5RA 1Z59A 4DV0M 4OW0A 5FTMA 2CHQA 3T15A 4JN6A 4AZFA 2F5OA 3TWLA 3MK6A 3GPXA 2UUAM 3KS8A 2Z7JA 2FE8A 2DZNB 4M9ZA 1L1TA 3GRUA 3RGSA 3FUVA 3CF0A 1NHWC 4I5SA 1PJIA 4PCZA 4M0WA 3M6AA 3R8FA 3GO8A 5KPRA 3HJ8A 5ITRA 4MB7A 3THGA 1XMQM 4DR3M 1JR3D 4BBAA 4B7GA 4NOOB 1IXSB 3PNVA 3ZH9B 3IG8A 4CISA 1TDHA 4NL4H 2XGNA 4DR7M 3GRYA 1IM2A 4DV5M 3R9XB 3QWLA 3VFDA 1IN4A 2QCUA 1IBKM 3HU2A 2UU9M 3KFUG 2NQ8C 3DFZA 3KS4A 4MGYE 3I4YA 1TH4A 5ITXA 2KA6B 3VDUA 2EO2A 2CEAA 3L2AA 3U6OA 3J27B 1IN5A 2HKJA 4MM3B 3TWKA 1J09A 3J7AS 1QAOA 1T3TA 2FFJA 4L16A 3SHFA 2XLJA 4IJEA 3Q8XA 4DV1M 1YE9A 1HT1E 3AOGA 4IJFA 4ZPXA 4DV2M 2D7EA 2RGHA 2LXEA 4REZA 4FCTA 1XWIA 1HQCA 3GQ3A 1YSYA 4YY3M 4DR2M 4G4OA 4IIWA 2BJWA 2QP9X 4DV3M 3LVWA 3K2LA 3I4VA 4II7A 2KZSA 4LF6M 2CE7A 3LQRA 4IBIA 4P16A 2Z3XA 1ZAEA 4AKGA 4AQYM 3NBIA 3W0FA 1SXJA 1IN8A 3HJSA 5DYGA 5DNYA 2XSZA 3KVWA 1IBLM 2XEPA 1HR0M 4LF7M 2JA2A 3RGPA 1TDZA 4LJ5A 2ZM6M 1GLNA 2VIIA 3J7BA 1Z5AA 4JV5M 3UZUA 2UUCM 2D7GA 4YHHM 1NVMA 2J7OA 2A5YB 4PDIA 4MGZE 4KLNA 3KOWE 1Z5BA 2C9CA 4D82A 1N32M 2W82A 2ZBKB 3U60A 3GRRA 4LRSA 1L8QA 3CTWB 1PJJA 2DWLA 4RF0A 2CV2A 1ZQ9A 3GLHB 2FOIC 4QHSA 4LJ8A 3PXGA 4GHAA 1IY2A 2OQ4A 4FCVA 1E9SA 3LVVA 4DV6M 1UM8A 5E26A 4LGMA 3IG5A 3HHYA 2UXDM 4PDGA 1NJGA 1KYIA 1KFVA 1L2CA 3JR5A 4A3VB 1NHGC 2Y0QA 3U6DA 4HLQA 1Z5CA 5FTLA 4B3SM 3RE8A 5ITUA 4DUZM 1G41A 4DR4M 4Z8XA 3A45A 5EQTA 4OVZB 3T1YM 4GKKM 4W5WA 2XZFA 5EXXA 1Q39A 3J2PB 2UXBM 3HGIA 1OFHA 3DA1A 4QOZC 3FTDA 1G4AE 1WXQA 1NSFA 2CHVA 3TE6A 2UUBM 3FKEA 1HNZM 4IBKA 1JQJC 2VQFM 4D81A 2DHRA 4LF8M 1ORYB 1QAMA 1MU5A 2R45A 2ZANA 1D2NA 4RNAA 3J81S 4I4LA 1H6UA 4IBCA 1G3IA 4LJ9A 2EA0A 3I51A 3T1HM 3H4MA 1NNUC 3MHVC 5EXTA 4DV7M 3U6QA 3U6MA 3GPPA 4M9SA 4IBEA 2HCBA 3HHZA 4JI8M 4OVZA 5IZ7D 4LG2A 1XXHB 3SAUA 4QHTA 4B08A 4DR1M 3U6SA 5FTNA 1E32A 3FTEA 1E9RA 3L25A 3KSJA 4GKJM 1E94E 1HNXM 2AHMA 2J7NA 3SYKA 1Q3BA 5EXPA 5E6JA 4IBJA 4M0DA 5ITTA 4AKIA 4GH9A 2KEBA 2LWXA 2YNMD 3E4RA 1N33M 2M5ZA 4LY6A 5ITQA 3GLFA 2VQEM 2YFQA 1NJFA 4JI7M 2BJVA 4S12A 3WHKA 2EUCA 4MGIE 5IWAM 1SXJC 3AOEC 2HHHM 5H37D 2C99A 4FCWA 5EP1A 3AKZA 4JI0M 3FYCA 3U6LA 4AKHA 4OU7A 1G8PA 2QBYB 2DVWB 2DXIA 4MH0E 4XBOA 4NSRA 2RKOA 1Z6TA 4B3TM 3FTFA 4IBBA 2LNHC 3TPZA 1I4WA 2CHGA 4B7FA 3SATA 1J7KA 1W5TA 4X65M 3KXEC 4I8OA 1N77A 3CF6E 2XZUA 1C1KA 3OTOM 2QPAA 2XH9A 4DR5M 2Z4SA 5GKNA 4PD2A 5ITYA 4AI6A 4LJAA 3GQ4A 1L2DA 4DV4M 1DGHA 4FWHA 2D7HA 5KQ8A 4GRIA 5BPVA 4K0KM 3VDPA 2R4JA 3FTCA 5IT9S 3ZC7B 2DWNA 3GPUA 4LRTA 2FNAA 1QVRA 4QNRA 2ZAMA 5C18A 1IY0A 4GIPA 2R65A 2X4AA 2Y20A 3GLHA 3PVSA 3HKPA 3TL4X 5C1BA 1L1ZA 4KHPM 4BLCA 2V1UA 3HU3A 2L6OA 2V6ZM 4OX9M 1QQWA 4X66M 4GC5A 5KQDA 4R7GA 4G4NA 3GP1A 4JI5M 3GLGB 4LFBM 3KOZE 5FTKA 1IXRC 1DGGA 1QANA 1R7RA 3BOSA 2C98A 5JI3E 3FD9A 5LMNM 1XNQM 3HHXA 2KW0A 2H1RA 4AG6A 3SAVA 4GITA 3U60B 3MJ5A 3SMPA 2R18A 4CGYB 1DO2A 4I81A 5FLXS 1GL6A 5EJCA 4WW0A 3AFHA 5ITXE 4TUWA 2F5PA 1QAQA 3D8LA 1EE8A 3U5ZA 4FW9A 3KOYE 4FVMA 1XNRM 3GLFB 1FJGM 1R2YA 1DGFA 2Y0TA 3U6CA 4D80A 1YUBA 4LF5M 4LCBA 1IQPA 1SXJB 1VDDA 1TH2A 3KW6A 3TQSA 3TWMA 4AW4A 4LZZA 5EXSA 2CV1A 1Q3CA 2G5GX 1GL7A 4B3MM 4MGHA 1XHBA 2KRUA 3VKHA 2XF3A 2R62A 3UGJA 4NXMM 1I94M 2V1CA 2KXEA 4JXJA 3FUUA 2CFOA 2X49A 3M7GA 2LH0A 2KRKA 1SXJE 1TGUA 3KP1E 1W5SA 4NXNM 5BR8M 1K3XA 2DWMA 3A46A 1XXHA 3AJIB 3WHLA 3SBJA 1N34M 3W0LB 4JI4M 1OJLA 3RFWA 1XMOM 3GRVA 3VLFB 4FWGA 1DO0A 2M60A 1S3SA 1QYRA 2UXCM 1NY5A 3AL0C 3DOAA 1G59A 2QENA 3KOXE 3LQQA 3J80S 3U6EA 2G8LA 4DUYM 5EP2A 3U6PA 3GPYA 1R2ZA 3L26A 3K92A 2X8AA 2YQZA 4LFCM 2F4VM 3L29A 4Z6YA 2L09A 8CATA 3U5ZB 3SMSA 1L2BA 2C9OA 4JYAM 2R46A 2KZUA 3UK6A 3KSXA 4IBGA 3B9PA 1HNWM 4GHLA 2I7NA 4NSOB 1FNNA 3AOEA 4M9XA 1HQYE 3SYLA 3C58A 1XC8A 4L4UA 2ZAOA 2XSZD 3T38A 2L7IA 3PNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  2L7H A;  2Y20 A;  2Y0Q A;  4I5S A;  2Y21 A;  2L7I A; 
#chains in the Genus database with same CATH topology
 3U61 A;  4JI6 M;  4JI3 M;  4X62 M;  3SHG B;  3EIH A;  2JY5 A;  4X64 M;  2XFS A;  2KNV A;  2Z4R A;  1D0K A;  4GC9 A;  7CAT A;  1GAB A;  2EKK A;  2P5T A;  3FUX A;  1NY6 A;  4XGI A;  4ITQ A;  5JI2 E;  2BNK A;  4HL4 A;  2CUZ A;  4LJ7 A;  4LGY A;  1OTR A;  1LV7 A;  1TH3 A;  4G4R A;  4JI2 M;  1DGB A;  3SAR A;  2DZO B;  3JAM S;  3U61 B;  2R0I A;  1PM5 A;  2F5N A;  4HEO A;  1PJT A;  1IBM M;  1VDL A;  4G4Q A;  3VK7 A;  4RF1 A;  3HWS A;  1JR3 A;  2K0B X;  1R6B X;  3FUW A;  3LMM A;  4FD2 A;  5KO3 A;  3JR4 A;  3K1J A;  2HL7 A;  3SAS A;  2DNA A;  4LJ4 A;  1N36 M;  1IN7 A;  3KP0 E;  4F1I A;  2DZL A;  5DYI A;  4DR6 M;  1MX0 A;  5A2Q S;  1A5T A;  1IXZ A;  1YLA A;  3B89 A;  3NWL A;  1K82 A;  1X37 A;  3HHW A;  3GLG A;  4PT5 A;  1HT2 E;  3CF2 A;  1KSF X;  2C96 A;  2EKF A;  1R5L A;  3GLI A;  1IN6 A;  4B7H A;  1N78 A;  2RGO A;  3ILK A;  3E9S A;  5EP3 A;  5FSW A;  2E5L M;  4MGK E;  3EIE A;  2OO9 A;  4GEW A;  2L4E A;  4IBF A;  4FWD A;  4GMQ A;  2JZ1 A;  2YR0 A;  4LZJ A;  4QOS A;  1K3W A;  1MJG M;  1OFI A;  4LF9 M;  3W67 A;  3PFI A;  2QQ8 A;  2Z8Y M;  2K47 A;  5KPZ A;  1PGY A;  4G3O A;  5FTJ A;  1AUA A;  1GVN A;  3AV0 A;  4R71 A;  2JXN A;  3VK8 A;  2OPF A;  3K8Z A;  2Y21 A;  1NV9 A;  2F5S A;  4R3D A;  1AIP C;  2R4E A;  3FYD A;  3UMM A;  4L8R C;  1SG9 A;  4UN2 B;  2C5R A;  3BXW A;  1SXJ D;  5EP4 A;  1IY1 A;  1Y8G A;  2HAK A;  2WSC F;  4QNM A;  5IRE B;  4NRV A;  3KDS E;  3ZQJ A;  1NNJ A;  1GKI A;  4L78 A;  3SC3 A;  3UJN A;  1WHC A;  4AG5 A;  2QZ4 A;  3L28 A;  1J5E M;  2XFT A;  4IBD A;  3SAW A;  3GQ5 A;  4B3R M;  4BB9 A;  1C7Y A;  3D8B A;  4LFA M;  5F3W A;  2CV0 A;  1Q02 A;  2DWL A;  2EJS A;  4CHT B;  4JI1 M;  1EFU B;  5KPT A;  1DGH B;  2QBY A;  4LF4 M;  2L7H A;  2ERC A;  1IXS A;  3ZCB B;  2F5Q A;  3GLI E;  2DAG A;  3QAU A;  4G6Z A;  1PJQ A;  2K6B A;  3FUT A;  3M0E A;  4WUR A;  4NRW A;  1HJP A;  1QZM A;  3HJQ A;  3I01 M;  2H5X A;  3C3E A;  3GLI B;  3L27 A;  2DWZ B;  2LVQ D;  2Q2E B;  2DAE A;  1WIV A;  5LMU M;  4EIW A;  4L15 A;  3DZD A;  4KOD A;  2I7P A;  3SFZ A;  1N75 A;  3A42 A;  1TF0 B;  3A98 B;  3HU1 A;  4KO8 A;  3VKG A;  4LJ6 A;  2O5R A;  1Z59 A;  4DV0 M;  4OW0 A;  5FTM A;  2CHQ A;  3T15 A;  4JN6 A;  4AZF A;  2F5O A;  3TWL A;  3MK6 A;  3GPX A;  2UUA M;  3HY5 A;  3KS8 A;  2Z7J A;  2CP8 A;  2DZN B;  2FE8 A;  4M9Z A;  4CIZ A;  1L1T A;  3GRU A;  3RGS A;  3FUV A;  3CF0 A;  1NHW C;  2JWS A;  4I5S A;  4PCZ A;  4M0W A;  1PJI A;  3M6A A;  3R8F A;  3GO8 A;  5KPR A;  1V34 A;  3HJ8 A;  5ITR A;  2RRU A;  4MB7 A;  3THG A;  1XMQ M;  1DV0 A;  4DR3 M;  1JR3 D;  4BBA A;  4B7G A;  2DHY A;  4NOO B;  1IXS B;  3PNV A;  3ZH9 B;  1BVS A;  3IG8 A;  4CIS A;  1TDH A;  4NL4 H;  2XGN A;  4DR7 M;  3GRY A;  1IM2 A;  1RU3 A;  4DV5 M;  3R9X B;  3QWL A;  3VFD A;  1IN4 A;  2QCU A;  1IBK M;  3HU2 A;  2UU9 M;  2DEN A;  2NQ8 C;  1WJ7 A;  2R6F A;  3DFZ A;  3QYB A;  3KFU G;  3KS4 A;  4MGY E;  3I4Y A;  1TH4 A;  5ITX A;  2DAI A;  2KA6 B;  2EO2 A;  3VDU A;  3E21 A;  2CEA A;  3L2A A;  3U6O A;  3J27 B;  1IN5 A;  1D0M A;  2HKJ A;  4MM3 B;  1J09 A;  3TWK A;  3J7A S;  1IFY A;  1QAO A;  1T3T A;  2FFJ A;  4L16 A;  3SHF A;  2XLJ A;  1WGL A;  1VQ1 A;  4IJE A;  3Q8X A;  4DV1 M;  1YE9 A;  2CRU A;  1HT1 E;  2LVP C;  3AOG A;  3C3D A;  4IJF A;  4ZPX A;  4DV2 M;  3B7N A;  2D7E A;  2RGH A;  2LXE A;  4REZ A;  4FCT A;  1QUS A;  2LVO C;  3Q8G A;  1XWI A;  1HQC A;  3GQ3 A;  1YSY A;  4YY3 M;  4DR2 M;  4G4O A;  2LTU A;  4IIW A;  2ZTD A;  2BJW A;  2QP9 X;  4DV3 M;  3LVW A;  3K2L A;  3I4V A;  4II7 A;  2O01 F;  2KZS A;  3IEC A;  3T6P A;  2BWE A;  4LF6 M;  1GJT A;  2CE7 A;  1XXH E;  1PRB A;  3LQR A;  4IBI A;  1ZAE A;  4P16 A;  2Z3X A;  4AKG A;  4AQY M;  3NBI A;  3W0F A;  1SXJ A;  1IN8 A;  3HJS A;  5DYG A;  5DNY A;  2XSZ A;  3KVW A;  3LCV B;  1IBL M;  2XEP A;  1HR0 M;  4LF7 M;  2ZTC A;  2JA2 A;  3RGP A;  1TDZ A;  4LJ5 A;  1VEG A;  2ZM6 M;  1GLN A;  2VII A;  3J7B A;  1Z5A A;  1T6O A;  3UZU A;  4JV5 M;  2UUC M;  2D7G A;  4YHH M;  1NVM A;  2J7O A;  2A5Y B;  4PDI A;  4MGZ E;  4KLN A;  3KOW E;  1Z5B A;  2C9C A;  4D82 A;  1N32 M;  2W82 A;  2ZBK B;  3U60 A;  3GRR A;  1QDR A;  4LRS A;  1L8Q A;  3CTW B;  1PJJ A;  2KDL A;  3MMP A;  4RF0 A;  1ZQ9 A;  3GLH B;  2FOI C;  4QHS A;  1XB2 B;  4LJ8 A;  3PXG A;  1IY2 A;  2OQ4 A;  2N35 A;  4GHA A;  4FCV A;  1E9S A;  1ZMV A;  3LVV A;  4DV6 M;  2R44 A;  1UM8 A;  5E26 A;  4LGM A;  3IG5 A;  3HHY A;  2UXD M;  2APL A;  4PDG A;  1NJG A;  1KYI A;  1ZV1 A;  3B74 A;  3FE3 A;  1KFV A;  1L2C A;  3JR5 A;  4A3V B;  1NHG C;  2O25 A;  2Y0Q A;  3U6D A;  4HLQ A;  1Z5C A;  5FTL A;  4Y28 F;  4B3S M;  3RE8 A;  1OAI A;  5ITU A;  4DUZ M;  4ANR A;  1G41 A;  1V92 A;  2CWB A;  4DR4 M;  4L6V 6;  4Z8X A;  3A45 A;  2HWJ A;  5EQT A;  4OVZ B;  3T1Y M;  4GKK M;  4W5W A;  2XZF A;  5EXX A;  1Q39 A;  3V76 A;  3CGW A;  2KNZ A;  3J2P B;  1GJS A;  3H4J A;  2UXB M;  3HGI A;  2GNO A;  1T43 A;  3GLH E;  3DA1 A;  2MH8 A;  1ZMW A;  3FTD A;  4QOZ C;  1G4A E;  1WXQ A;  1NSF A;  2CHV A;  3TE6 A;  2UUB M;  3FKE A;  1OIZ A;  1HNZ M;  1GO5 A;  4IBK A;  4KHP M;  1JQJ C;  2VQF M;  4D81 A;  2DHR A;  4LF8 M;  1ORY B;  1QAM A;  1MU5 A;  2R45 A;  2ZAN A;  1D2N A;  4RNA A;  2JNH A;  3J81 S;  4I4L A;  1H6U A;  1VG5 A;  1TTE A;  4IBC A;  1G3I A;  4LJ9 A;  2EA0 A;  3GLF E;  3I51 A;  3T1H M;  3H4M A;  1NNU C;  3MHV C;  1V33 A;  5EXT A;  2JUJ A;  4DV7 M;  3U6Q A;  3U6M A;  2G3Q A;  3GPP A;  4M9S A;  4IBE A;  2HCB A;  3HHZ A;  4JI8 M;  2MRO B;  4OVZ A;  1OQY A;  5IZ7 D;  4LG2 A;  1XXH B;  3SAU A;  4QHT A;  2DI0 A;  4B08 A;  4DR1 M;  3U6S A;  1NO1 A;  5FTN A;  1E32 A;  3FTE A;  2OOB A;  1E9R A;  3L25 A;  2DKL A;  3KSJ A;  4F2L A;  4GKJ M;  2GQF A;  1E94 E;  2JZ0 A;  1HNX M;  2AHM A;  2J7N A;  3SYK A;  1Q3B A;  5EXP A;  5E6J A;  4IBJ A;  4M0D A;  5ITT A;  4AKI A;  3W68 A;  4GH9 A;  3QYE A;  2KEB A;  2LWX A;  1UFZ A;  2CV2 A;  2LHG A;  2YNM D;  3E4R A;  2DAM A;  1N33 M;  2M5Z A;  4LY6 A;  5ITQ A;  3GLF A;  2VQE M;  2YFQ A;  1NJF A;  1VEK A;  4JI7 M;  2BJV A;  4S12 A;  3WHK A;  2EUC A;  4MGI E;  5IWA M;  1SXJ C;  3AOE C;  2HHH M;  5H37 D;  2LHC A;  2C99 A;  4FCW A;  5EP1 A;  3AKZ A;  4JI0 M;  4DBG B;  3FYC A;  2VF8 A;  3U6L A;  2QHO B;  3I04 M;  4AKH A;  4OU7 A;  1G8P A;  3FRH A;  1CUK A;  2QBY B;  2DVW B;  2DXI A;  2LVN C;  4MH0 E;  4XBO A;  2L2D A;  2RKO A;  4NSR A;  1Z6T A;  4B3T M;  3FTF A;  4IBB A;  2LNH C;  3TPZ A;  1I4W A;  2CHG A;  4B7F A;  3SAT A;  1J7K A;  1OIP A;  4RKU F;  1W5T A;  2JP7 A;  4X65 M;  3KXE C;  4I8O A;  2WSF F;  2WSE F;  2J5Y A;  1N77 A;  3CF6 E;  2XZU A;  1C1K A;  3OTO M;  2QPA A;  1P3Q Q;  2XH9 A;  4DR5 M;  2Z4S A;  5GKN A;  4PD2 A;  5ITY A;  1EIJ A;  4AI6 A;  4LJA A;  3GQ4 A;  3B7Q A;  1L2D A;  4DV4 M;  4XK8 F;  1DGH A;  4FWH A;  3K9O A;  2D7H A;  3HZJ A;  3K9P A;  4NC6 A;  5KQ8 A;  4GRI A;  5BPV A;  1JB0 F;  4K0K M;  3VDP A;  2R4J A;  3FTC A;  5IT9 S;  3ZC7 B;  2DWN A;  3GPU A;  4LRT A;  2FNA A;  1QVR A;  4QNR A;  2ZAM A;  5C18 A;  1IY0 A;  1QDT A;  4GIP A;  2R65 A;  2X4A A;  2Y20 A;  1TR8 A;  3GLH A;  3HKP A;  3IHP A;  3PVS A;  2JY7 A;  2QNJ A;  3TL4 X;  5C1B A;  4BLC A;  1L1Z A;  2V1U A;  2L6O A;  3HU3 A;  2V6Z M;  4OX9 M;  5DFL A;  2KNA A;  1QQW A;  2JY6 B;  4X66 M;  2K9D A;  4GC5 A;  5KQD A;  1PJS A;  4WP2 A;  4R7G A;  4G4N A;  3GP1 A;  4JI5 M;  3GLG B;  4LFB M;  3KOZ E;  4KT0 F;  5FTK A;  1IXR C;  1DGG A;  1QAN A;  1R7R A;  3BOS A;  2C98 A;  4Q7J A;  3FD9 A;  5JI3 E;  2BWB A;  5LMN M;  3HX3 A;  1XNQ M;  3HHX A;  2KW0 A;  2H1R A;  4AG6 A;  2VDB B;  3SAV A;  4GIT A;  3U60 B;  3MJ5 A;  1G71 A;  3SMP A;  1D0L A;  2R18 A;  4CGY B;  1DO2 A;  1ZMU A;  4I81 A;  4P17 A;  2FS1 A;  5FLX S;  1GL6 A;  5EJC A;  4WW0 A;  3AFH A;  5ITX E;  4TUW A;  2F5P A;  1QAQ A;  3D8L A;  1EE8 A;  3U5Z A;  2MJ5 B;  4FW9 A;  1WGN A;  1LTM A;  3KOY E;  4FVM A;  4CJ6 A;  3GLF B;  1XNR M;  2DAK A;  1FJG M;  3FRI A;  1R2Y A;  1DGF A;  2Y0T A;  2MGW A;  3F92 A;  3U6C A;  2QSF X;  4D80 A;  1YUB A;  2JY8 A;  4LF5 M;  4LCB A;  2KHH A;  1IQP A;  1SXJ B;  1VDD A;  1TH2 A;  3KW6 A;  3TQS A;  3B7Z A;  3TWM A;  4AW4 A;  4LZZ A;  5EXS A;  2CV1 A;  1Q3C A;  2G5G X;  1GL7 A;  4B3M M;  4MGH A;  1XHB A;  2KRU A;  2WZJ A;  3VKH A;  2XF3 A;  2R62 A;  1QZE A;  3UGJ A;  4NXM M;  1I94 M;  1OAO C;  2V1C A;  2KXE A;  4JXJ A;  3FUU A;  2CFO A;  2X49 A;  3M7G A;  2LH0 A;  2KRK A;  1SXJ E;  1TGU A;  2VF7 A;  1W5S A;  3KP1 E;  2LBC A;  4NXN M;  5BR8 M;  1K3X A;  2DWM A;  3A46 A;  1XXH A;  3AJI B;  3WHL A;  3LW5 F;  2MR9 A;  3SBJ A;  1N34 M;  3W0L B;  4JI4 M;  1OJL A;  3RFW A;  1XMO M;  3GRV A;  3VLF B;  4FWG A;  1DO0 A;  1OKS A;  2M60 A;  1S3S A;  1QYR A;  3LCU A;  2UXC M;  1NY5 A;  3AL0 C;  2LVA A;  1QUT A;  3DOA A;  5L8R F;  1G59 A;  2QEN A;  3KOX E;  3LQQ A;  3J80 S;  3U6E A;  2L4F A;  1MN3 A;  2G8L A;  4DUY M;  2ZAO A;  3C9P A;  5EP2 A;  3U6P A;  3GPY A;  1R2Z A;  3L26 A;  3K92 A;  2X8A A;  2YQZ A;  3GLG E;  4LFC M;  2F4V M;  3L29 A;  4Z6Y A;  2L09 A;  8CAT A;  3U5Z B;  3SMS A;  1L2B A;  2C9O A;  4JYA M;  2B3T A;  2FH0 A;  2R46 A;  2KZU A;  1WR1 B;  2OOA A;  1F4I A;  3UK6 A;  3KSX A;  4IBG A;  3B9P A;  1NV8 A;  1HNW M;  4GHL A;  3BBZ A;  2I7N A;  3E46 A;  3NBX X;  4NSO B;  1FNN A;  1R4G A;  3AOE A;  4M9X A;  1HQY E;  1JR3 E;  1VEJ A;  3SYL A;  3C58 A;  1XC8 A;  4L4U A;  1OFH A;  2XSZ D;  3T38 A;  2L7I A;  3PNY A; 
#chains in the Genus database with same CATH homology
 3U61 A;  4JI6 M;  4JI3 M;  4X62 M;  3SHG B;  3EIH A;  4X64 M;  2XFS A;  7CAT A;  2Z4R A;  4GC9 A;  2P5T A;  3FUX A;  1NY6 A;  4XGI A;  4ITQ A;  5JI2 E;  2BNK A;  4HL4 A;  2CUZ A;  4LJ7 A;  4LGY A;  1LV7 A;  1TH3 A;  4G4R A;  4JI2 M;  1DGB A;  3SAR A;  2DZO B;  3JAM S;  3U61 B;  1PM5 A;  1IBM M;  4G4Q A;  3VK7 A;  4RF1 A;  3HWS A;  1JR3 A;  1R6B X;  3FUW A;  3LMM A;  4FD2 A;  5KO3 A;  3JR4 A;  3K1J A;  2HL7 A;  3SAS A;  4LJ4 A;  1N36 M;  1IN7 A;  3KP0 E;  5DYI A;  4DR6 M;  1MX0 A;  5A2Q S;  1IXZ A;  3NWL A;  1K82 A;  1X37 A;  3HHW A;  3GLG A;  4PT5 A;  1HT2 E;  3CF2 A;  1KSF X;  2C96 A;  3GLI A;  1IN6 A;  4B7H A;  1N78 A;  2RGO A;  3ILK A;  3E9S A;  5EP3 A;  5FSW A;  2E5L M;  4MGK E;  3EIE A;  4IBF A;  4FWD A;  4GMQ A;  2YR0 A;  4LZJ A;  4QOS A;  1K3W A;  1OFI A;  4LF9 M;  3PFI A;  2K47 A;  5KPZ A;  5FTJ A;  1GVN A;  3AV0 A;  3VK8 A;  2OPF A;  3K8Z A;  2Y21 A;  2F5S A;  4L8R C;  4R3D A;  3FYD A;  2R4E A;  3UMM A;  2C5R A;  1SXJ D;  5EP4 A;  1IY1 A;  5IRE B;  2F5N A;  4QNM A;  4NRV A;  3KDS E;  1NNJ A;  1GKI A;  4L78 A;  3SC3 A;  3UJN A;  4AG5 A;  2QZ4 A;  3L28 A;  1J5E M;  2XFT A;  4IBD A;  3SAW A;  3GQ5 A;  4B3R M;  4BB9 A;  3D8B A;  4LFA M;  5F3W A;  2CV0 A;  4CHT B;  4JI1 M;  5KPT A;  2QBY A;  1DGH B;  4LF4 M;  2L7H A;  2ERC A;  3ZCB B;  2F5Q A;  3QAU A;  4G6Z A;  3M0E A;  3FUT A;  4WUR A;  4NRW A;  1QZM A;  3HJQ A;  3GLI B;  3L27 A;  2DWZ B;  2Q2E B;  5LMU M;  4EIW A;  4L15 A;  3DZD A;  4KOD A;  2I7P A;  3SFZ A;  1N75 A;  3A42 A;  3HU1 A;  3A98 B;  4KO8 A;  3VKG A;  4LJ6 A;  2O5R A;  1Z59 A;  4DV0 M;  4OW0 A;  5FTM A;  2CHQ A;  3T15 A;  4JN6 A;  4AZF A;  2F5O A;  3TWL A;  3MK6 A;  3GPX A;  2UUA M;  3KS8 A;  2Z7J A;  2FE8 A;  2DZN B;  4M9Z A;  1L1T A;  3GRU A;  3RGS A;  3FUV A;  3CF0 A;  1NHW C;  4I5S A;  1PJI A;  4PCZ A;  4M0W A;  3M6A A;  3R8F A;  3GO8 A;  5KPR A;  3HJ8 A;  5ITR A;  4MB7 A;  3THG A;  1XMQ M;  4DR3 M;  1JR3 D;  4BBA A;  4B7G A;  4NOO B;  1IXS B;  3PNV A;  3ZH9 B;  3IG8 A;  4CIS A;  1TDH A;  4NL4 H;  2XGN A;  4DR7 M;  3GRY A;  1IM2 A;  4DV5 M;  3R9X B;  3QWL A;  3VFD A;  1IN4 A;  2QCU A;  1IBK M;  3HU2 A;  2UU9 M;  3KFU G;  2NQ8 C;  3DFZ A;  3KS4 A;  4MGY E;  3I4Y A;  1TH4 A;  5ITX A;  2KA6 B;  3VDU A;  2EO2 A;  2CEA A;  3L2A A;  3U6O A;  3J27 B;  1IN5 A;  2HKJ A;  4MM3 B;  3TWK A;  1J09 A;  3J7A S;  1QAO A;  1T3T A;  2FFJ A;  4L16 A;  3SHF A;  2XLJ A;  4IJE A;  3Q8X A;  4DV1 M;  1YE9 A;  1HT1 E;  3AOG A;  4IJF A;  4ZPX A;  4DV2 M;  2D7E A;  2RGH A;  2LXE A;  4REZ A;  4FCT A;  1XWI A;  1HQC A;  3GQ3 A;  1YSY A;  4YY3 M;  4DR2 M;  4G4O A;  4IIW A;  2BJW A;  2QP9 X;  4DV3 M;  3LVW A;  3K2L A;  3I4V A;  4II7 A;  2KZS A;  4LF6 M;  2CE7 A;  3LQR A;  4IBI A;  4P16 A;  2Z3X A;  1ZAE A;  4AKG A;  4AQY M;  3NBI A;  3W0F A;  1SXJ A;  1IN8 A;  3HJS A;  5DYG A;  5DNY A;  2XSZ A;  3KVW A;  1IBL M;  2XEP A;  1HR0 M;  4LF7 M;  2JA2 A;  3RGP A;  1TDZ A;  4LJ5 A;  2ZM6 M;  1GLN A;  2VII A;  3J7B A;  1Z5A A;  4JV5 M;  3UZU A;  2UUC M;  2D7G A;  4YHH M;  1NVM A;  2J7O A;  2A5Y B;  4PDI A;  4MGZ E;  4KLN A;  3KOW E;  1Z5B A;  2C9C A;  4D82 A;  1N32 M;  2W82 A;  2ZBK B;  3U60 A;  3GRR A;  4LRS A;  1L8Q A;  3CTW B;  1PJJ A;  2DWL A;  4RF0 A;  2CV2 A;  1ZQ9 A;  3GLH B;  2FOI C;  4QHS A;  4LJ8 A;  3PXG A;  4GHA A;  1IY2 A;  2OQ4 A;  4FCV A;  1E9S A;  3LVV A;  4DV6 M;  1UM8 A;  5E26 A;  4LGM A;  3IG5 A;  3HHY A;  2UXD M;  4PDG A;  1NJG A;  1KYI A;  1KFV A;  1L2C A;  3JR5 A;  4A3V B;  1NHG C;  2Y0Q A;  3U6D A;  4HLQ A;  1Z5C A;  5FTL A;  4B3S M;  3RE8 A;  5ITU A;  4DUZ M;  1G41 A;  4DR4 M;  4Z8X A;  3A45 A;  5EQT A;  4OVZ B;  3T1Y M;  4GKK M;  4W5W A;  2XZF A;  5EXX A;  1Q39 A;  3J2P B;  2UXB M;  3HGI A;  1OFH A;  3DA1 A;  4QOZ C;  3FTD A;  1G4A E;  1WXQ A;  1NSF A;  2CHV A;  3TE6 A;  2UUB M;  3FKE A;  1HNZ M;  4IBK A;  1JQJ C;  2VQF M;  4D81 A;  2DHR A;  4LF8 M;  1ORY B;  1QAM A;  1MU5 A;  2R45 A;  2ZAN A;  1D2N A;  4RNA A;  3J81 S;  4I4L A;  1H6U A;  4IBC A;  1G3I A;  4LJ9 A;  2EA0 A;  3I51 A;  3T1H M;  3H4M A;  1NNU C;  3MHV C;  5EXT A;  4DV7 M;  3U6Q A;  3U6M A;  3GPP A;  4M9S A;  4IBE A;  2HCB A;  3HHZ A;  4JI8 M;  4OVZ A;  5IZ7 D;  4LG2 A;  1XXH B;  3SAU A;  4QHT A;  4B08 A;  4DR1 M;  3U6S A;  5FTN A;  1E32 A;  3FTE A;  1E9R A;  3L25 A;  3KSJ A;  4GKJ M;  1E94 E;  1HNX M;  2AHM A;  2J7N A;  3SYK A;  1Q3B A;  5EXP A;  5E6J A;  4IBJ A;  4M0D A;  5ITT A;  4AKI A;  4GH9 A;  2KEB A;  2LWX A;  2YNM D;  3E4R A;  1N33 M;  2M5Z A;  4LY6 A;  5ITQ A;  3GLF A;  2VQE M;  2YFQ A;  1NJF A;  4JI7 M;  2BJV A;  4S12 A;  3WHK A;  2EUC A;  4MGI E;  5IWA M;  1SXJ C;  3AOE C;  2HHH M;  5H37 D;  2C99 A;  4FCW A;  5EP1 A;  3AKZ A;  4JI0 M;  3FYC A;  3U6L A;  4AKH A;  4OU7 A;  1G8P A;  2QBY B;  2DVW B;  2DXI A;  4MH0 E;  4XBO A;  4NSR A;  2RKO A;  1Z6T A;  4B3T M;  3FTF A;  4IBB A;  2LNH C;  3TPZ A;  1I4W A;  2CHG A;  4B7F A;  3SAT A;  1J7K A;  1W5T A;  4X65 M;  3KXE C;  4I8O A;  1N77 A;  3CF6 E;  2XZU A;  1C1K A;  3OTO M;  2QPA A;  2XH9 A;  4DR5 M;  2Z4S A;  5GKN A;  4PD2 A;  5ITY A;  4AI6 A;  4LJA A;  3GQ4 A;  1L2D A;  4DV4 M;  1DGH A;  4FWH A;  2D7H A;  5KQ8 A;  4GRI A;  5BPV A;  4K0K M;  3VDP A;  2R4J A;  3FTC A;  5IT9 S;  3ZC7 B;  2DWN A;  3GPU A;  4LRT A;  2FNA A;  1QVR A;  4QNR A;  2ZAM A;  5C18 A;  1IY0 A;  4GIP A;  2R65 A;  2X4A A;  2Y20 A;  3GLH A;  3PVS A;  3HKP A;  3TL4 X;  5C1B A;  1L1Z A;  4KHP M;  4BLC A;  2V1U A;  3HU3 A;  2L6O A;  2V6Z M;  4OX9 M;  1QQW A;  4X66 M;  4GC5 A;  5KQD A;  4R7G A;  4G4N A;  3GP1 A;  4JI5 M;  3GLG B;  4LFB M;  3KOZ E;  5FTK A;  1IXR C;  1DGG A;  1QAN A;  1R7R A;  3BOS A;  2C98 A;  5JI3 E;  3FD9 A;  5LMN M;  1XNQ M;  3HHX A;  2KW0 A;  2H1R A;  4AG6 A;  3SAV A;  4GIT A;  3U60 B;  3MJ5 A;  3SMP A;  2R18 A;  4CGY B;  1DO2 A;  4I81 A;  5FLX S;  1GL6 A;  5EJC A;  4WW0 A;  3AFH A;  5ITX E;  4TUW A;  2F5P A;  1QAQ A;  3D8L A;  1EE8 A;  3U5Z A;  4FW9 A;  3KOY E;  4FVM A;  1XNR M;  3GLF B;  1FJG M;  1R2Y A;  1DGF A;  2Y0T A;  3U6C A;  4D80 A;  1YUB A;  4LF5 M;  4LCB A;  1IQP A;  1SXJ B;  1VDD A;  1TH2 A;  3KW6 A;  3TQS A;  3TWM A;  4AW4 A;  4LZZ A;  5EXS A;  2CV1 A;  1Q3C A;  2G5G X;  1GL7 A;  4B3M M;  4MGH A;  1XHB A;  2KRU A;  3VKH A;  2XF3 A;  2R62 A;  3UGJ A;  4NXM M;  1I94 M;  2V1C A;  2KXE A;  4JXJ A;  3FUU A;  2CFO A;  2X49 A;  3M7G A;  2LH0 A;  2KRK A;  1SXJ E;  1TGU A;  3KP1 E;  1W5S A;  4NXN M;  5BR8 M;  1K3X A;  2DWM A;  3A46 A;  1XXH A;  3AJI B;  3WHL A;  3SBJ A;  1N34 M;  3W0L B;  4JI4 M;  1OJL A;  3RFW A;  1XMO M;  3GRV A;  3VLF B;  4FWG A;  1DO0 A;  2M60 A;  1S3S A;  1QYR A;  2UXC M;  1NY5 A;  3AL0 C;  3DOA A;  1G59 A;  2QEN A;  3KOX E;  3LQQ A;  3J80 S;  3U6E A;  2G8L A;  4DUY M;  5EP2 A;  3U6P A;  3GPY A;  1R2Z A;  3L26 A;  3K92 A;  2X8A A;  2YQZ A;  4LFC M;  2F4V M;  3L29 A;  4Z6Y A;  2L09 A;  8CAT A;  3U5Z B;  3SMS A;  1L2B A;  2C9O A;  4JYA M;  2R46 A;  2KZU A;  3UK6 A;  3KSX A;  4IBG A;  3B9P A;  1HNW M;  4GHL A;  2I7N A;  4NSO B;  1FNN A;  3AOE A;  4M9X A;  1HQY E;  3SYL A;  3C58 A;  1XC8 A;  4L4U A;  2ZAO A;  2XSZ D;  3T38 A;  2L7I A;  3PNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...