2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Uncharacterized protein
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
2L7HA 2Y20A 2Y0QA 2L7IA 2Y0TA 2Y21A 4I5SA
chains in the Genus database with same CATH superfamily
1L2DA 2JY5A 1C1KA 2L7HA 3T1HM 4K0KM 3W0LB 2V1UA 2KNAA 3U6LA 2MROB 1XHBA 3K2LA 2DAIA 2QENA 3KSJA 3TQSA 1NHGC 3HU1A 3SYKA 3LW5F 3KDSE 3BBZA 4LGMA 3DFZA 1SXJB 2DWNA 4RKUF 4JN6A 1PJTA 3LMMA 1WJ7A 4MGZE 4RF0A 5EXPA 1S3SA 3I4VA 1E94E 3UK6A 2R4EA 1OIZA 3HGIA 2DXIA 4AG6A 4KO8A 3U60A 2CHVA 2DAKA 1WHCA 2XLJA 2EKKA 4JYAM 4DUZM 3VDUA 3A45A 4LF6M 4PD2A 1FNNA 3NBXX 2CFOA 4JI0M 2QNJA 3GLFE 2F5NA 2VIIA 4L6V6 3LVWA 4G4NA 2FH0A 1QUSA 2L2DA 5KPZA 4DR2M 1JB0F 3THGA 3SATA 2O25A 3FYDA 1PM5A 4QHSA 1NJGA 2OPFA 2JY6B 2JA2A 2QZ4A 3K9OA 4DV5M 3U6PA 1K3WA 3GLHE 1VEKA 3LCVB 1XNRM 1G41A 1JR3E 2NQ8C 1KSFX 2CRUA 2I7NA 3ZH9B 5IWAM 4LF5M 3ZCBB 2F5SA 3AJIB 2ERCA 1EFUB 2GQFA 2KA6B 5ITYA 3HHZA 1OAIA 2RKOA 1PJIA 2JZ1A 2OO9A 2QCUA 1XWIA 4D81A 2B3TA 4WP2A 1IM2A 3FUTA 5A2QS 4JI5M 1J5EM 4LJ8A 2O01F 4LZJA 3HKPA 3FTFA 2F5PA 3SASA 3A46A 3KW6A 3FE3A 2YFQA 2VDBB 4IBBA 4FVMA 3UMMA 3J7BA 2JWSA 4GC9A 3I51A 2HL7A 4XK8F 5ITXE 1OFIA 2LXEA 3KOYE 1NY6A 1TTEA 5DYGA 3GLGB 1IFYA 3H4MA 1IN6A 2CV1A 4YY3M 2K0BX 1TDHA 2L6OA 3K8ZA 1IBKM 3MJ5A 2XFSA 5EXXA 3GLIA 2R4JA 1R6BX 4F1IA 2X4AA 3HHWA 3T1YM 1QUTA 3UJNA 3B7NA 1IN7A 2LBCA 1VQ1A 3GRYA 3GLGE 4AKGA 4GHAA 3D8LA 4LFCM 3HU3A 2C96A 2VF7A 4DV1M 3U5ZB 4LF9M 5ITTA 2XH9A 3AV0A 3K92A 5DYIA 3JR5A 1I94M 4ANRA 3SFZA 3J7AS 3GP1A 1DGHA 2C99A 1D2NA 2Z4SA 4IBEA 1SXJA 3FUUA 4GMQA 1R5LA 1DV0A 4G3OA 2D7GA 1OTRA 1Y8GA 1SXJD 1DGHB 5ITRA 2KDLA 3L2AA 3LQRA 2FE8A 2R44A 5EXTA 4FW9A 3M7GA 4IBIA 4QNRA 2L7IA 4B7FA 2VQFM 4OU7A 3K1JA 3MHVC 4IJFA 2M5ZA 1DGFA 2AHMA 3TWKA 4MGKE 5ITQA 1V34A 4IBDA 1R7RA 1IQPA 1G4AE 3KS8A 3PXGA 1X37A 2OQ4A 3GLIB 1MX0A 3SAWA 1XXHB 3W67A 2K6BA 3M0EA 2LH0A 3E4RA 4HEOA 5L8RF 5ITUA 2ZANA 1QQWA 5FTKA 4M0WA 4NSOB 2QP9X 4B3TM 1Q02A 4M9SA 1OFHA 2JP7A 4QHTA 1L1ZA 4JI8M 2QBYA 1FJGM 4MGIE 3UGJA 2BWBA 3CF2A 2XF3A 4X65M 2X49A 5IREB 2JY7A 3KOXE 5C1BA 4LJ5A 3QYEA 4NC6A 4CGYB 1R2ZA 3T6PA 2XZUA 3GO8A 1GL7A 1NV9A 2XFTA 5EP2A 2WSFF 4G4RA 5IT9S 2FS1A 4DV4M 3GRVA 3U6EA 1Z5BA 4B7HA 4JI7M 3C9PA 5KO3A 3OTOM 5H37D 2Z3XA 3C3DA 4M9XA 1QAQA 4DV2M 4DV7M 1N77A 5KPTA 1YSYA 1OKSA 1QVRA 3SARA 3E46A 3B7ZA 4GHLA 3AKZA 4GIPA 4JI2M 1NV8A 3NWLA 1EE8A 1IY1A 4AQYM 3L27A 2CV2A 4KT0F 2XEPA 1KYIA 2R45A 3LCUA 4CJ6A 1Z5AA 1TGUA 2ZAMA 2EO2A 4L16A 3PVSA 1W5SA 2BWEA 2Y21A 2H5XA 1DO2A 3U60B 3I04M 3GLIE 1N32M 2EA0A 1NNUC 2D7EA 2UXBM 2M60A 3QWLA 3KOWE 2LTUA 2C5RA 1TH2A 4IBKA 3FUXA 2QQ8A 4Y28F 5EXSA 4PDGA 5ITXA 3PNVA 4R7GA 3J27B 1JR3A 4FCTA 5FTJA 4B3MM 2QHOB 2DHYA 3GQ3A 1HR0M 4IBCA 1MN3A 2JZ0A 3GLFB 4LG2A 3HY5A 3MK6A 4OX9M 3KXEC 2Q2EB 1E32A 2DKLA 2Y0QA 1GLNA 4GKJM 2A5YB 1HNZM 1R2YA 4LF7M 4LZZA 1N78A 2APLA 2KXEA 2O5RA 4OVZA 2E5LM 3ILKA 1XB2B 2CP8A 1AIPC 1UFZA 4AW4A 4G4OA 3Q8XA 5BR8M 3GLHB 3GRRA 4XGIA 1GJSA 2MGWA 5EQTA 4B08A 2WSCF 1H6UA 2LVPC 3JR4A 3SAVA 3B7QA 2EJSA 1XMQM 2R18A 4G4QA 4GH9A 1QAOA 3R8FA 1GABA 3GRUA 4L4UA 4LFAM 3KVWA 2R0IA 2YQZA 3CTWB 4IIWA 4MH0E 4NRVA 3J81S 2DWLA 1ORYB 3KP1E 2FNAA 3DA1A 1TR8A 2QPAA 5GKNA 3SAUA 4F2LA 1QANA 1V33A 4UN2B 2KRKA 4GEWA 2DWMA 3VK7A 2DVWB 4BLCA 3RGSA 1NVMA 2KNVA 3KSXA 4R3DA 3L26A 3U61B 2C9OA 1QYRA 2CHGA 2CHQA 4LJ7A 4LJAA 3KP0E 5C18A 4CISA 1G3IA 1XC8A 4LF4M 1ZQ9A 4LJ9A 3KFUG 2DZLA 4CIZA 1HQCA 4D80A 4L78A 3A42A 3IECA 3A98B 2GNOA 1K82A 4JI3M 2KHHA 3R9XB 2FFJA 2HHHM 2G8LA 4OVZB 3SYLA 1XXHE 4RF1A 5DNYA 2DAEA 3LQQA 3FUVA 1YLAA 2BJWA 3AL0C 2VF8A 4AKIA 4AG5A 2G5GX 2R6FA 1NY5A 1OQYA 1WGNA 3PNYA 4NOOB 4LRSA 1A5TA 3GPPA 4ZPXA 3U6OA 1W5TA 1J09A 3K9PA 3T38A 7CATA 3HHYA 2WSEF 1C7YA 3SC3A 4TUWA 1NO1A 1K3XA 2XZFA 1G71A 1GVNA 2CEAA 1F4IA 5EP1A 3B9PA 1G8PA 4DV3M 4X66M 4A3VB 4DR6M 1IN8A 3Q8GA 5FLXS 1L2CA 2F4VM 4I4LA 3U6CA 4HL4A 1ZMUA 3SHGB 4DV0M 2G3QA 2JXNA 1QZEA 4W5WA 4GC5A 5KQ8A 3FTDA 1V92A 2QSFX 1HJPA 4REZA 5EP3A 5FSWA 3ZQJA 3HZJA 1TF0B 2DNAA 2YNMD 4G6ZA 4WW0A 3GLGA 4MB7A 3I4YA 1T3TA 1WGLA 4NXMM 2KZSA 2MJ5B 4HLQA 2HWJA 3GPXA 3EIEA 1IBLM 4KODA 1E9RA 4GKKM 3BOSA 5EJCA 1N75A 2J7NA 1YE9A 3C58A 1Z59A 2VQEM 2L4FA 1L1TA 1Z6TA 3JAMS 4M0DA 4EIWA 5JI3E 1GKIA 1L2BA 1VDDA 4MGYE 1NHWC 1TH3A 1IY2A 2JUJA 4PT5A 4ITQA 2ZTDA 3DOAA 2DENA 2R62A 5KQDA 2R65A 1RU3A 1MJGM 2DAMA 1Q39A 2XGNA 1OJLA 1OIPA 4AZFA 1ZMVA 4QNMA 1T43A 4XBOA 2KNZA 5IZ7D 2F5QA 1DO0A 1Z5CA 3MMPA 3L25A 3AFHA 1IXRC 3IHPA 1SXJC 1NJFA 2J5YA 2BJVA 3DZDA 2LVOC 3WHLA 3VK8A 1MU5A 4FCVA 2OOBA 1IXSB 2KW0A 3U6QA 1CUKA 3HJ8A 1AUAA 4NL4H 1GO5A 4IBGA 5FTLA 3RE8A 2Z4RA 3SHFA 4LRTA 3FTEA 4YHHM 3LVVA 3QYBA 5F3WA 1TH4A 4II7A 1IN5A 3NBIA 2LVAA 2ZAOA 1N36M 4JXJA 2RGHA 1EIJA 4D82A 3VFDA 2UUAM 1Q3BA 1D0LA 1PJSA 2H1RA 2JY8A 2ZTCA 2Y0TA 3HHXA 4Q7JA 3SMPA 1HT1E 1IXSA 3E21A 1VG5A 3GPYA 1WR1B 3J2PB 4I81A 3IG8A 2C98A 3RGPA 1YUBA 1IBMM 4P16A 1IY0A 1NNJA 4DR7M 3W0FA 1SG9A 1DGBA 1J7KA 3TE6A 4DV6M 2L09A 3EIHA 4NXNM 3FKEA 1HQYE 5BPVA 4P17A 1LTMA 3M6AA 4CHTB 4S12A 4DUYM 2CWBA 3QAUA 4Z8XA 3VKHA 3J80S 1ZV1A 4MM3B 5FTMA 3ZC7B 2UUCM 3CF0A 3TWMA 1JQJC 3L28A 1JR3D 3FRHA 1N33M 1PRBA 2BNKA 4B7GA 1QZMA 4M9ZA 4IBFA 2N35A 4DR5M 1E9SA 4IBJA 1HT2E 3W68A 4AKHA 4FWGA 5FTNA 5DFLA 2UXDM 4FWDA 4PCZA 4BB9A 2ZM6M 2D7HA 1QDRA 2WZJA 1TDZA 2UU9M 3B74A 1Q3CA 4OW0A 4FWHA 3VKGA 4QOZC 1IN4A 1PJQA 2DZNB 4MGHA 4PDIA 3AOEA 1G59A 1BVSA 2W82A 1QDTA 3HX3A 3RFWA 5E26A 4GRIA 2F5OA 1L8QA 2LHCA 3C3EA 2XSZD 3U61A 1SXJE 2KZUA 2KRUA 4X62M 2CE7A 2LHGA 3AOEC 4LY6A 4GITA 3U6MA 3VDPA 3TWLA 4I5SA 4JI6M 1HNXM 3D8BA 1WIVA 4IJEA 1IXZA 1PGYA 4R71A 2HAKA 4JV5M 2V6ZM 3SMSA 4LFBM 2OOAA 5E6JA 2LNHC 5EP4A 5JI2E 4JI1M 3L29A 2EUCA 2X8AA 3CGWA 2HKJA 4KHPM 1WXQA 3B89A 1ZAEA 2ZBKB 1XXHA 3U6DA 1PJJA 3PFIA 1T6OA 2XSZA 3KOZE 3I01M 1GJTA 1NSFA 2Z7JA 3F92A 4LF8M 2HCBA 3GLHA 2CUZA 2DWZB 3H4JA 3HWSA 4QOSA 2LWXA 3GQ5A 2QBYB 4LGYA 2Z8YM 4JI4M 3FRIA 3AOGA 4LJ6A 3U6SA 5KPRA 4FD2A 2K9DA 4LJ4A 1HNWM 4FCWA 2MH8A 3GLFA 2MR9A 3SBJA 4X64M 4RNAA 4L8RC 2FOIC 2DZOB 2JNHA 4WURA 3HJQA 3TPZA 1ZMWA 2DAGA 1XNQM 4Z6YA 3UZUA 3BXWA 3KS4A 3GQ4A 2K47A 2LVQD 3CF6E 8CATA 4B3SM 1VEGA 2DI0A 1GL6A 2J7OA 4NRWA 2V1CA 3T15A 4BBAA 4DR1M 2L4EA 4L15A 1N34M 4AI6A 3E9SA 2C9CA 3FD9A 1OAOC 2Y20A 5LMUM 1D0KA 1QAMA 5LMNM 1XMOM 1LV7A 2CV0A 4DR3M 1DGGA 2DHRA 4KLNA 4I8OA 4NSRA 1D0MA 2P5TA 3V76A 4DR4M 2UXCM 2UUBM 1UM8A 3HJSA 3FUWA 3FTCA 4LCBA 3VLFB 3WHKA 1R4GA 4DBGB 2R46A 3GPUA 3HU2A 2KEBA 1P3QQ 3U5ZA 1KFVA 1I4WA 3TL4X 4B3RM 1VEJA 2RRUA 2YR0A 2I7PA 1VDLA 2EKFA 2LVNC 3FYCA 3IG5A 2RGOA
chains in the Genus database with same CATH topology
1L2DA 3T1HM 1C1KA 2L7HA 4K0KM 3W0LB 2V1UA 3U6LA 1XHBA 3K2LA 3TQSA 2QENA 3KSJA 1NHGC 3HU1A 3SYKA 3KDSE 4LGMA 3DFZA 1SXJB 2DWNA 4JN6A 3LMMA 4MGZE 4RF0A 5EXPA 1S3SA 3I4VA 1E94E 3UK6A 2R4EA 3HGIA 2DXIA 4AG6A 4KO8A 3U60A 2CHVA 2XLJA 4JYAM 4DUZM 3VDUA 3A45A 4LF6M 4PD2A 1FNNA 4JI0M 2CFOA 2F5NA 2VIIA 3LVWA 4G4NA 5KPZA 4DR2M 3THGA 3SATA 3FYDA 1PM5A 4QHSA 1NJGA 2OPFA 2JA2A 2QZ4A 4DV5M 3U6PA 1K3WA 1XNRM 1G41A 2NQ8C 1KSFX 2I7NA 3ZH9B 5IWAM 4LF5M 3ZCBB 2F5SA 3AJIB 2ERCA 2KA6B 5ITYA 3HHZA 2RKOA 1PJIA 2QCUA 1XWIA 4D81A 1IM2A 3FUTA 5A2QS 4JI5M 1J5EM 4LJ8A 4LZJA 3HKPA 3FTFA 2F5PA 3SASA 3A46A 3KW6A 2YFQA 4IBBA 4FVMA 3UMMA 3J7BA 4GC9A 3I51A 2HL7A 5ITXE 1OFIA 2LXEA 3KOYE 1NY6A 5DYGA 3GLGB 3H4MA 1IN6A 2CV1A 4YY3M 1TDHA 2L6OA 3K8ZA 1IBKM 3MJ5A 2XFSA 5EXXA 3GLIA 2R4JA 1R6BX 2X4AA 3HHWA 3T1YM 3UJNA 1IN7A 3GRYA 4AKGA 4GHAA 3D8LA 4LFCM 3HU3A 2C96A 4DV1M 3U5ZB 4LF9M 5ITTA 2XH9A 3AV0A 3K92A 5DYIA 3JR5A 1I94M 3SFZA 3J7AS 3GP1A 1DGHA 2C99A 1D2NA 2Z4SA 4IBEA 1SXJA 3FUUA 4GMQA 2D7GA 1SXJD 1DGHB 5ITRA 3L2AA 3LQRA 5EXTA 2FE8A 4FW9A 3M7GA 4IBIA 4QNRA 2L7IA 4B7FA 2VQFM 4OU7A 3K1JA 3MHVC 4IJFA 2M5ZA 1DGFA 2AHMA 3TWKA 4MGKE 5ITQA 4IBDA 1R7RA 1IQPA 1G4AE 3KS8A 3PXGA 1X37A 2OQ4A 3GLIB 1MX0A 3SAWA 1XXHB 3M0EA 2LH0A 3E4RA 5ITUA 2ZANA 1QQWA 5FTKA 4M0WA 4NSOB 2QP9X 4B3TM 4M9SA 4QHTA 1OFHA 1L1ZA 4JI8M 1FJGM 2QBYA 4MGIE 3UGJA 3CF2A 2XF3A 4X65M 2X49A 5IREB 3KOXE 5C1BA 4LJ5A 4CGYB 1R2ZA 2XZUA 3GO8A 1GL7A 2XFTA 5EP2A 4G4RA 5IT9S 4DV4M 3GRVA 3U6EA 1Z5BA 4B7HA 4JI7M 5KO3A 3OTOM 5H37D 2Z3XA 4M9XA 1QAQA 4DV2M 4DV7M 1N77A 5KPTA 1YSYA 3SARA 1QVRA 4GHLA 3AKZA 4GIPA 4JI2M 3NWLA 1EE8A 1IY1A 4AQYM 3L27A 2CV2A 2XEPA 1KYIA 2R45A 1Z5AA 1TGUA 2ZAMA 2EO2A 4L16A 3PVSA 1W5SA 2Y21A 1DO2A 3U60B 1N32M 2EA0A 1NNUC 2D7EA 2UXBM 2M60A 3QWLA 3KOWE 2C5RA 1TH2A 4IBKA 3FUXA 4PDGA 5EXSA 5ITXA 3PNVA 4R7GA 3J27B 1JR3A 4FCTA 5FTJA 4B3MM 3GQ3A 1HR0M 4IBCA 3GLFB 4LG2A 4OX9M 3MK6A 3KXEC 1E32A 2Q2EB 2Y0QA 4GKJM 1GLNA 2A5YB 1HNZM 1R2YA 4LF7M 4LZZA 1N78A 4OVZA 2KXEA 2O5RA 2E5LM 3ILKA 4AW4A 4G4OA 3Q8XA 5BR8M 3GLHB 3GRRA 4XGIA 5EQTA 4B08A 1H6UA 3JR4A 3SAVA 1XMQM 2R18A 4G4QA 4GH9A 1QAOA 3R8FA 3GRUA 4L4UA 4LFAM 3KVWA 2YQZA 3CTWB 4IIWA 4MH0E 4NRVA 3J81S 2DWLA 1ORYB 3KP1E 2FNAA 3DA1A 2QPAA 5GKNA 3SAUA 1QANA 2KRKA 2DWMA 3VK7A 2DVWB 4BLCA 3RGSA 1NVMA 3KSXA 4R3DA 3L26A 3U61B 2C9OA 1QYRA 2CHGA 2CHQA 4LJ7A 4LJAA 3KP0E 5C18A 4CISA 1G3IA 1XC8A 4LF4M 1ZQ9A 4LJ9A 3KFUG 1HQCA 4D80A 4L78A 3A42A 3A98B 1K82A 4JI3M 3R9XB 2FFJA 2HHHM 2G8LA 4OVZB 3SYLA 4RF1A 5DNYA 3LQQA 3FUVA 2BJWA 3AL0C 4AKIA 4AG5A 2G5GX 1NY5A 3PNYA 4NOOB 4LRSA 3GPPA 4ZPXA 3U6OA 1W5TA 1J09A 3T38A 7CATA 3HHYA 3SC3A 4TUWA 1K3XA 2XZFA 1GVNA 2CEAA 5EP1A 3B9PA 1G8PA 4DV3M 4X66M 4A3VB 4DR6M 1IN8A 5FLXS 1L2CA 2F4VM 4I4LA 3U6CA 4HL4A 3SHGB 4DV0M 4W5WA 4GC5A 5KQ8A 3FTDA 4REZA 5EP3A 5FSWA 1NNJA 4G6ZA 2YNMD 4WW0A 3GLGA 4MB7A 3I4YA 1T3TA 4NXMM 2KZSA 4HLQA 3GPXA 3EIEA 1IBLM 4KODA 1E9RA 4GKKM 3BOSA 5EJCA 1N75A 2J7NA 1YE9A 3C58A 1Z59A 2VQEM 1L1TA 1Z6TA 3JAMS 4M0DA 4EIWA 5JI3E 1GKIA 1L2BA 1VDDA 4MGYE 1NHWC 1TH3A 1IY2A 4PT5A 4ITQA 3DOAA 2R62A 5KQDA 2R65A 1Q39A 2XGNA 1OJLA 4AZFA 4QNMA 4XBOA 5IZ7D 2F5QA 1DO0A 1Z5CA 3L25A 3AFHA 1IXRC 1SXJC 1NJFA 3WHLA 2BJVA 3DZDA 3VK8A 1MU5A 4FCVA 1IXSB 2KW0A 3U6QA 3HJ8A 4NL4H 4IBGA 5FTLA 3RE8A 2Z4RA 3SHFA 4LRTA 3FTEA 4YHHM 3LVVA 5F3WA 1TH4A 4II7A 1IN5A 3NBIA 2ZAOA 1N36M 4JXJA 2RGHA 4D82A 3VFDA 2UUAM 1Q3BA 3SMPA 2H1RA 3HHXA 2Y0TA 1HT1E 3GPYA 3J2PB 4I81A 3IG8A 2C98A 3RGPA 1YUBA 1IBMM 4P16A 1IY0A 4DR7M 3W0FA 1DGBA 1J7KA 3TE6A 4DV6M 2L09A 3EIHA 4NXNM 3FKEA 1HQYE 5BPVA 3M6AA 4CHTB 4S12A 4DUYM 3QAUA 4Z8XA 3VKHA 3J80S 4MM3B 5FTMA 3ZC7B 2UUCM 3CF0A 3TWMA 1JQJC 3L28A 1JR3D 1N33M 2BNKA 4B7GA 1QZMA 4M9ZA 4IBFA 4AKHA 4DR5M 1E9SA 4IBJA 1HT2E 4FWGA 5FTNA 2UXDM 4FWDA 4PCZA 4BB9A 2ZM6M 2D7HA 1TDZA 2UU9M 1Q3CA 4OW0A 4FWHA 3VKGA 4QOZC 1IN4A 4PDIA 2DZNB 4MGHA 3AOEA 1G59A 2W82A 3RFWA 2F5OA 5E26A 4GRIA 1L8QA 3U61A 2XSZD 1SXJE 2KZUA 2KRUA 4X62M 2CE7A 3AOEC 4LY6A 4GITA 3U6MA 3VDPA 3TWLA 4I5SA 4JI6M 1HNXM 3D8BA 4IJEA 1IXZA 4JV5M 2V6ZM 3SMSA 4LFBM 5E6JA 2LNHC 5EP4A 5JI2E 4JI1M 3L29A 2EUCA 2X8AA 2HKJA 4KHPM 1WXQA 1PJJA 1ZAEA 2ZBKB 1XXHA 3U6DA 3PFIA 2XSZA 3KOZE 4LF8M 1NSFA 2Z7JA 2HCBA 3GLHA 2CUZA 2DWZB 3HWSA 4QOSA 3GQ5A 2LWXA 2QBYB 4LGYA 4JI4M 3AOGA 4LJ6A 3U6SA 5KPRA 4FD2A 4LJ4A 1HNWM 4FCWA 3GLFA 3SBJA 4X64M 4RNAA 4L8RC 2FOIC 2DZOB 3TPZA 4WURA 3HJQA 1XNQM 4Z6YA 3UZUA 3KS4A 3GQ4A 2K47A 8CATA 3CF6E 4B3SM 1GL6A 2J7OA 4NRWA 2V1CA 3T15A 4BBAA 4DR1M 4L15A 1N34M 4AI6A 3E9SA 2C9CA 3FD9A 2Y20A 5LMUM 1QAMA 5LMNM 1XMOM 1LV7A 2CV0A 4DR3M 1DGGA 2DHRA 4KLNA 4I8OA 4NSRA 4DR4M 2P5TA 2UXCM 2UUBM 1UM8A 3HJSA 3FUWA 3FTCA 4LCBA 3VLFB 3WHKA 3GPUA 2R46A 3HU2A 2KEBA 3U5ZA 1KFVA 1I4WA 3TL4X 4B3RM 2YR0A 2I7PA 3FYCA 3IG5A 2RGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7H A;  2Y20 A;  2Y0Q A;  2L7I A;  2Y0T A;  2Y21 A;  4I5S A; 
#chains in the Genus database with same CATH topology
 1L2D A;  2JY5 A;  1C1K A;  2L7H A;  3T1H M;  4K0K M;  3W0L B;  2V1U A;  2KNA A;  3U6L A;  2MRO B;  1XHB A;  3K2L A;  2DAI A;  2QEN A;  3KSJ A;  3TQS A;  1NHG C;  3HU1 A;  3SYK A;  3LW5 F;  3KDS E;  3BBZ A;  4LGM A;  3DFZ A;  1SXJ B;  2DWN A;  4RKU F;  4JN6 A;  1PJT A;  3LMM A;  1WJ7 A;  4MGZ E;  4RF0 A;  5EXP A;  1S3S A;  3I4V A;  1E94 E;  3UK6 A;  2R4E A;  1OIZ A;  3HGI A;  2DXI A;  4AG6 A;  4KO8 A;  3U60 A;  2CHV A;  2DAK A;  1WHC A;  2XLJ A;  2EKK A;  4JYA M;  4DUZ M;  3VDU A;  3A45 A;  4LF6 M;  4PD2 A;  1FNN A;  3NBX X;  2CFO A;  4JI0 M;  2QNJ A;  3GLF E;  2F5N A;  2VII A;  4L6V 6;  3LVW A;  4G4N A;  2FH0 A;  1QUS A;  2L2D A;  5KPZ A;  4DR2 M;  1JB0 F;  3THG A;  3SAT A;  2O25 A;  3FYD A;  1PM5 A;  4QHS A;  1NJG A;  2OPF A;  2JY6 B;  2JA2 A;  2QZ4 A;  3K9O A;  4DV5 M;  3U6P A;  1K3W A;  3GLH E;  1VEK A;  3LCV B;  1XNR M;  1G41 A;  1JR3 E;  2NQ8 C;  1KSF X;  2CRU A;  2I7N A;  3ZH9 B;  5IWA M;  4LF5 M;  3ZCB B;  2F5S A;  3AJI B;  2ERC A;  1EFU B;  2GQF A;  2KA6 B;  5ITY A;  3HHZ A;  1OAI A;  2RKO A;  1PJI A;  2JZ1 A;  2OO9 A;  2QCU A;  1XWI A;  4D81 A;  2B3T A;  4WP2 A;  1IM2 A;  3FUT A;  5A2Q S;  4JI5 M;  1J5E M;  4LJ8 A;  2O01 F;  4LZJ A;  3HKP A;  3FTF A;  2F5P A;  3SAS A;  3A46 A;  3KW6 A;  3FE3 A;  2YFQ A;  2VDB B;  4IBB A;  4FVM A;  3UMM A;  3J7B A;  2JWS A;  4GC9 A;  3I51 A;  2HL7 A;  4XK8 F;  5ITX E;  1OFI A;  2LXE A;  3KOY E;  1NY6 A;  1TTE A;  5DYG A;  3GLG B;  1IFY A;  3H4M A;  1IN6 A;  2CV1 A;  4YY3 M;  2K0B X;  1TDH A;  2L6O A;  3K8Z A;  1IBK M;  3MJ5 A;  2XFS A;  5EXX A;  3GLI A;  2R4J A;  1R6B X;  4F1I A;  2X4A A;  3HHW A;  3T1Y M;  1QUT A;  3UJN A;  3B7N A;  1IN7 A;  2LBC A;  1VQ1 A;  3GRY A;  3GLG E;  4AKG A;  4GHA A;  3D8L A;  4LFC M;  3HU3 A;  2C96 A;  2VF7 A;  4DV1 M;  3U5Z B;  4LF9 M;  5ITT A;  2XH9 A;  3AV0 A;  3K92 A;  5DYI A;  3JR5 A;  1I94 M;  4ANR A;  3SFZ A;  3J7A S;  3GP1 A;  1DGH A;  2C99 A;  1D2N A;  2Z4S A;  4IBE A;  1SXJ A;  3FUU A;  4GMQ A;  1R5L A;  1DV0 A;  4G3O A;  2D7G A;  1OTR A;  1Y8G A;  1SXJ D;  1DGH B;  5ITR A;  2KDL A;  3L2A A;  3LQR A;  2FE8 A;  2R44 A;  5EXT A;  4FW9 A;  3M7G A;  4IBI A;  4QNR A;  2L7I A;  4B7F A;  2VQF M;  4OU7 A;  3K1J A;  3MHV C;  4IJF A;  2M5Z A;  1DGF A;  2AHM A;  3TWK A;  4MGK E;  5ITQ A;  1V34 A;  4IBD A;  1R7R A;  1IQP A;  1G4A E;  3KS8 A;  3PXG A;  1X37 A;  2OQ4 A;  3GLI B;  1MX0 A;  3SAW A;  1XXH B;  3W67 A;  2K6B A;  3M0E A;  2LH0 A;  3E4R A;  4HEO A;  5L8R F;  5ITU A;  2ZAN A;  1QQW A;  5FTK A;  4M0W A;  4NSO B;  2QP9 X;  4B3T M;  1Q02 A;  4M9S A;  1OFH A;  2JP7 A;  4QHT A;  1L1Z A;  4JI8 M;  2QBY A;  1FJG M;  4MGI E;  3UGJ A;  2BWB A;  3CF2 A;  2XF3 A;  4X65 M;  2X49 A;  5IRE B;  2JY7 A;  3KOX E;  5C1B A;  4LJ5 A;  3QYE A;  4NC6 A;  4CGY B;  1R2Z A;  3T6P A;  2XZU A;  3GO8 A;  1GL7 A;  1NV9 A;  2XFT A;  5EP2 A;  2WSF F;  4G4R A;  5IT9 S;  2FS1 A;  4DV4 M;  3GRV A;  3U6E A;  1Z5B A;  4B7H A;  4JI7 M;  3C9P A;  5KO3 A;  3OTO M;  5H37 D;  2Z3X A;  3C3D A;  4M9X A;  1QAQ A;  4DV2 M;  4DV7 M;  1N77 A;  5KPT A;  1YSY A;  1OKS A;  1QVR A;  3SAR A;  3E46 A;  3B7Z A;  4GHL A;  3AKZ A;  4GIP A;  4JI2 M;  1NV8 A;  3NWL A;  1EE8 A;  1IY1 A;  4AQY M;  3L27 A;  2CV2 A;  4KT0 F;  2XEP A;  1KYI A;  2R45 A;  3LCU A;  4CJ6 A;  1Z5A A;  1TGU A;  2ZAM A;  2EO2 A;  4L16 A;  3PVS A;  1W5S A;  2BWE A;  2Y21 A;  2H5X A;  1DO2 A;  3U60 B;  3I04 M;  3GLI E;  1N32 M;  2EA0 A;  1NNU C;  2D7E A;  2UXB M;  2M60 A;  3QWL A;  3KOW E;  2LTU A;  2C5R A;  1TH2 A;  4IBK A;  3FUX A;  2QQ8 A;  4Y28 F;  5EXS A;  4PDG A;  5ITX A;  3PNV A;  4R7G A;  3J27 B;  1JR3 A;  4FCT A;  5FTJ A;  4B3M M;  2QHO B;  2DHY A;  3GQ3 A;  1HR0 M;  4IBC A;  1MN3 A;  2JZ0 A;  3GLF B;  4LG2 A;  3HY5 A;  3MK6 A;  4OX9 M;  3KXE C;  2Q2E B;  1E32 A;  2DKL A;  2Y0Q A;  1GLN A;  4GKJ M;  2A5Y B;  1HNZ M;  1R2Y A;  4LF7 M;  4LZZ A;  1N78 A;  2APL A;  2KXE A;  2O5R A;  4OVZ A;  2E5L M;  3ILK A;  1XB2 B;  2CP8 A;  1AIP C;  1UFZ A;  4AW4 A;  4G4O A;  3Q8X A;  5BR8 M;  3GLH B;  3GRR A;  4XGI A;  1GJS A;  2MGW A;  5EQT A;  4B08 A;  2WSC F;  1H6U A;  2LVP C;  3JR4 A;  3SAV A;  3B7Q A;  2EJS A;  1XMQ M;  2R18 A;  4G4Q A;  4GH9 A;  1QAO A;  3R8F A;  1GAB A;  3GRU A;  4L4U A;  4LFA M;  3KVW A;  2R0I A;  2YQZ A;  3CTW B;  4IIW A;  4MH0 E;  4NRV A;  3J81 S;  2DWL A;  1ORY B;  3KP1 E;  2FNA A;  3DA1 A;  1TR8 A;  2QPA A;  5GKN A;  3SAU A;  4F2L A;  1QAN A;  1V33 A;  4UN2 B;  2KRK A;  4GEW A;  2DWM A;  3VK7 A;  2DVW B;  4BLC A;  3RGS A;  1NVM A;  2KNV A;  3KSX A;  4R3D A;  3L26 A;  3U61 B;  2C9O A;  1QYR A;  2CHG A;  2CHQ A;  4LJ7 A;  4LJA A;  3KP0 E;  5C18 A;  4CIS A;  1G3I A;  1XC8 A;  4LF4 M;  1ZQ9 A;  4LJ9 A;  3KFU G;  2DZL A;  4CIZ A;  1HQC A;  4D80 A;  4L78 A;  3A42 A;  3IEC A;  3A98 B;  2GNO A;  1K82 A;  4JI3 M;  2KHH A;  3R9X B;  2FFJ A;  2HHH M;  2G8L A;  4OVZ B;  3SYL A;  1XXH E;  4RF1 A;  5DNY A;  2DAE A;  3LQQ A;  3FUV A;  1YLA A;  2BJW A;  3AL0 C;  2VF8 A;  4AKI A;  4AG5 A;  2G5G X;  2R6F A;  1NY5 A;  1OQY A;  1WGN A;  3PNY A;  4NOO B;  4LRS A;  1A5T A;  3GPP A;  4ZPX A;  3U6O A;  1W5T A;  1J09 A;  3K9P A;  3T38 A;  7CAT A;  3HHY A;  2WSE F;  1C7Y A;  3SC3 A;  4TUW A;  1NO1 A;  1K3X A;  2XZF A;  1G71 A;  1GVN A;  2CEA A;  1F4I A;  5EP1 A;  3B9P A;  1G8P A;  4DV3 M;  4X66 M;  4A3V B;  4DR6 M;  1IN8 A;  3Q8G A;  5FLX S;  1L2C A;  2F4V M;  4I4L A;  3U6C A;  4HL4 A;  1ZMU A;  3SHG B;  4DV0 M;  2G3Q A;  2JXN A;  1QZE A;  4W5W A;  4GC5 A;  5KQ8 A;  3FTD A;  1V92 A;  2QSF X;  1HJP A;  4REZ A;  5EP3 A;  5FSW A;  3ZQJ A;  3HZJ A;  1TF0 B;  2DNA A;  2YNM D;  4G6Z A;  4WW0 A;  3GLG A;  4MB7 A;  3I4Y A;  1T3T A;  1WGL A;  4NXM M;  2KZS A;  2MJ5 B;  4HLQ A;  2HWJ A;  3GPX A;  3EIE A;  1IBL M;  4KOD A;  1E9R A;  4GKK M;  3BOS A;  5EJC A;  1N75 A;  2J7N A;  1YE9 A;  3C58 A;  1Z59 A;  2VQE M;  2L4F A;  1L1T A;  1Z6T A;  3JAM S;  4M0D A;  4EIW A;  5JI3 E;  1GKI A;  1L2B A;  1VDD A;  4MGY E;  1NHW C;  1TH3 A;  1IY2 A;  2JUJ A;  4PT5 A;  4ITQ A;  2ZTD A;  3DOA A;  2DEN A;  2R62 A;  5KQD A;  2R65 A;  1RU3 A;  1MJG M;  2DAM A;  1Q39 A;  2XGN A;  1OJL A;  1OIP A;  4AZF A;  1ZMV A;  4QNM A;  1T43 A;  4XBO A;  2KNZ A;  5IZ7 D;  2F5Q A;  1DO0 A;  1Z5C A;  3MMP A;  3L25 A;  3AFH A;  1IXR C;  3IHP A;  1SXJ C;  1NJF A;  2J5Y A;  2BJV A;  3DZD A;  2LVO C;  3WHL A;  3VK8 A;  1MU5 A;  4FCV A;  2OOB A;  1IXS B;  2KW0 A;  3U6Q A;  1CUK A;  3HJ8 A;  1AUA A;  4NL4 H;  1GO5 A;  4IBG A;  5FTL A;  3RE8 A;  2Z4R A;  3SHF A;  4LRT A;  3FTE A;  4YHH M;  3LVV A;  3QYB A;  5F3W A;  1TH4 A;  4II7 A;  1IN5 A;  3NBI A;  2LVA A;  2ZAO A;  1N36 M;  4JXJ A;  2RGH A;  1EIJ A;  4D82 A;  3VFD A;  2UUA M;  1Q3B A;  1D0L A;  1PJS A;  2H1R A;  2JY8 A;  2ZTC A;  2Y0T A;  3HHX A;  4Q7J A;  3SMP A;  1HT1 E;  1IXS A;  3E21 A;  1VG5 A;  3GPY A;  1WR1 B;  3J2P B;  4I81 A;  3IG8 A;  2C98 A;  3RGP A;  1YUB A;  1IBM M;  4P16 A;  1IY0 A;  1NNJ A;  4DR7 M;  3W0F A;  1SG9 A;  1DGB A;  1J7K A;  3TE6 A;  4DV6 M;  2L09 A;  3EIH A;  4NXN M;  3FKE A;  1HQY E;  5BPV A;  4P17 A;  1LTM A;  3M6A A;  4CHT B;  4S12 A;  4DUY M;  2CWB A;  3QAU A;  4Z8X A;  3VKH A;  3J80 S;  1ZV1 A;  4MM3 B;  5FTM A;  3ZC7 B;  2UUC M;  3CF0 A;  3TWM A;  1JQJ C;  3L28 A;  1JR3 D;  3FRH A;  1N33 M;  1PRB A;  2BNK A;  4B7G A;  1QZM A;  4M9Z A;  4IBF A;  2N35 A;  4DR5 M;  1E9S A;  4IBJ A;  1HT2 E;  3W68 A;  4AKH A;  4FWG A;  5FTN A;  5DFL A;  2UXD M;  4FWD A;  4PCZ A;  4BB9 A;  2ZM6 M;  2D7H A;  1QDR A;  2WZJ A;  1TDZ A;  2UU9 M;  3B74 A;  1Q3C A;  4OW0 A;  4FWH A;  3VKG A;  4QOZ C;  1IN4 A;  1PJQ A;  2DZN B;  4MGH A;  4PDI A;  3AOE A;  1G59 A;  1BVS A;  2W82 A;  1QDT A;  3HX3 A;  3RFW A;  5E26 A;  4GRI A;  2F5O A;  1L8Q A;  2LHC A;  3C3E A;  2XSZ D;  3U61 A;  1SXJ E;  2KZU A;  2KRU A;  4X62 M;  2CE7 A;  2LHG A;  3AOE C;  4LY6 A;  4GIT A;  3U6M A;  3VDP A;  3TWL A;  4I5S A;  4JI6 M;  1HNX M;  3D8B A;  1WIV A;  4IJE A;  1IXZ A;  1PGY A;  4R71 A;  2HAK A;  4JV5 M;  2V6Z M;  3SMS A;  4LFB M;  2OOA A;  5E6J A;  2LNH C;  5EP4 A;  5JI2 E;  4JI1 M;  3L29 A;  2EUC A;  2X8A A;  3CGW A;  2HKJ A;  4KHP M;  1WXQ A;  3B89 A;  1ZAE A;  2ZBK B;  1XXH A;  3U6D A;  1PJJ A;  3PFI A;  1T6O A;  2XSZ A;  3KOZ E;  3I01 M;  1GJT A;  1NSF A;  2Z7J A;  3F92 A;  4LF8 M;  2HCB A;  3GLH A;  2CUZ A;  2DWZ B;  3H4J A;  3HWS A;  4QOS A;  2LWX A;  3GQ5 A;  2QBY B;  4LGY A;  2Z8Y M;  4JI4 M;  3FRI A;  3AOG A;  4LJ6 A;  3U6S A;  5KPR A;  4FD2 A;  2K9D A;  4LJ4 A;  1HNW M;  4FCW A;  2MH8 A;  3GLF A;  2MR9 A;  3SBJ A;  4X64 M;  4RNA A;  4L8R C;  2FOI C;  2DZO B;  2JNH A;  4WUR A;  3HJQ A;  3TPZ A;  1ZMW A;  2DAG A;  1XNQ M;  4Z6Y A;  3UZU A;  3BXW A;  3KS4 A;  3GQ4 A;  2K47 A;  2LVQ D;  3CF6 E;  8CAT A;  4B3S M;  1VEG A;  2DI0 A;  1GL6 A;  2J7O A;  4NRW A;  2V1C A;  3T15 A;  4BBA A;  4DR1 M;  2L4E A;  4L15 A;  1N34 M;  4AI6 A;  3E9S A;  2C9C A;  3FD9 A;  1OAO C;  2Y20 A;  5LMU M;  1D0K A;  1QAM A;  5LMN M;  1XMO M;  1LV7 A;  2CV0 A;  4DR3 M;  1DGG A;  2DHR A;  4KLN A;  4I8O A;  4NSR A;  1D0M A;  2P5T A;  3V76 A;  4DR4 M;  2UXC M;  2UUB M;  1UM8 A;  3HJS A;  3FUW A;  3FTC A;  4LCB A;  3VLF B;  3WHK A;  1R4G A;  4DBG B;  2R46 A;  3GPU A;  3HU2 A;  2KEB A;  1P3Q Q;  3U5Z A;  1KFV A;  1I4W A;  3TL4 X;  4B3R M;  1VEJ A;  2RRU A;  2YR0 A;  2I7P A;  1VDL A;  2EKF A;  2LVN C;  3FYC A;  3IG5 A;  2RGO A; 
#chains in the Genus database with same CATH homology
 1L2D A;  3T1H M;  1C1K A;  2L7H A;  4K0K M;  3W0L B;  2V1U A;  3U6L A;  1XHB A;  3K2L A;  3TQS A;  2QEN A;  3KSJ A;  1NHG C;  3HU1 A;  3SYK A;  3KDS E;  4LGM A;  3DFZ A;  1SXJ B;  2DWN A;  4JN6 A;  3LMM A;  4MGZ E;  4RF0 A;  5EXP A;  1S3S A;  3I4V A;  1E94 E;  3UK6 A;  2R4E A;  3HGI A;  2DXI A;  4AG6 A;  4KO8 A;  3U60 A;  2CHV A;  2XLJ A;  4JYA M;  4DUZ M;  3VDU A;  3A45 A;  4LF6 M;  4PD2 A;  1FNN A;  4JI0 M;  2CFO A;  2F5N A;  2VII A;  3LVW A;  4G4N A;  5KPZ A;  4DR2 M;  3THG A;  3SAT A;  3FYD A;  1PM5 A;  4QHS A;  1NJG A;  2OPF A;  2JA2 A;  2QZ4 A;  4DV5 M;  3U6P A;  1K3W A;  1XNR M;  1G41 A;  2NQ8 C;  1KSF X;  2I7N A;  3ZH9 B;  5IWA M;  4LF5 M;  3ZCB B;  2F5S A;  3AJI B;  2ERC A;  2KA6 B;  5ITY A;  3HHZ A;  2RKO A;  1PJI A;  2QCU A;  1XWI A;  4D81 A;  1IM2 A;  3FUT A;  5A2Q S;  4JI5 M;  1J5E M;  4LJ8 A;  4LZJ A;  3HKP A;  3FTF A;  2F5P A;  3SAS A;  3A46 A;  3KW6 A;  2YFQ A;  4IBB A;  4FVM A;  3UMM A;  3J7B A;  4GC9 A;  3I51 A;  2HL7 A;  5ITX E;  1OFI A;  2LXE A;  3KOY E;  1NY6 A;  5DYG A;  3GLG B;  3H4M A;  1IN6 A;  2CV1 A;  4YY3 M;  1TDH A;  2L6O A;  3K8Z A;  1IBK M;  3MJ5 A;  2XFS A;  5EXX A;  3GLI A;  2R4J A;  1R6B X;  2X4A A;  3HHW A;  3T1Y M;  3UJN A;  1IN7 A;  3GRY A;  4AKG A;  4GHA A;  3D8L A;  4LFC M;  3HU3 A;  2C96 A;  4DV1 M;  3U5Z B;  4LF9 M;  5ITT A;  2XH9 A;  3AV0 A;  3K92 A;  5DYI A;  3JR5 A;  1I94 M;  3SFZ A;  3J7A S;  3GP1 A;  1DGH A;  2C99 A;  1D2N A;  2Z4S A;  4IBE A;  1SXJ A;  3FUU A;  4GMQ A;  2D7G A;  1SXJ D;  1DGH B;  5ITR A;  3L2A A;  3LQR A;  5EXT A;  2FE8 A;  4FW9 A;  3M7G A;  4IBI A;  4QNR A;  2L7I A;  4B7F A;  2VQF M;  4OU7 A;  3K1J A;  3MHV C;  4IJF A;  2M5Z A;  1DGF A;  2AHM A;  3TWK A;  4MGK E;  5ITQ A;  4IBD A;  1R7R A;  1IQP A;  1G4A E;  3KS8 A;  3PXG A;  1X37 A;  2OQ4 A;  3GLI B;  1MX0 A;  3SAW A;  1XXH B;  3M0E A;  2LH0 A;  3E4R A;  5ITU A;  2ZAN A;  1QQW A;  5FTK A;  4M0W A;  4NSO B;  2QP9 X;  4B3T M;  4M9S A;  4QHT A;  1OFH A;  1L1Z A;  4JI8 M;  1FJG M;  2QBY A;  4MGI E;  3UGJ A;  3CF2 A;  2XF3 A;  4X65 M;  2X49 A;  5IRE B;  3KOX E;  5C1B A;  4LJ5 A;  4CGY B;  1R2Z A;  2XZU A;  3GO8 A;  1GL7 A;  2XFT A;  5EP2 A;  4G4R A;  5IT9 S;  4DV4 M;  3GRV A;  3U6E A;  1Z5B A;  4B7H A;  4JI7 M;  5KO3 A;  3OTO M;  5H37 D;  2Z3X A;  4M9X A;  1QAQ A;  4DV2 M;  4DV7 M;  1N77 A;  5KPT A;  1YSY A;  3SAR A;  1QVR A;  4GHL A;  3AKZ A;  4GIP A;  4JI2 M;  3NWL A;  1EE8 A;  1IY1 A;  4AQY M;  3L27 A;  2CV2 A;  2XEP A;  1KYI A;  2R45 A;  1Z5A A;  1TGU A;  2ZAM A;  2EO2 A;  4L16 A;  3PVS A;  1W5S A;  2Y21 A;  1DO2 A;  3U60 B;  1N32 M;  2EA0 A;  1NNU C;  2D7E A;  2UXB M;  2M60 A;  3QWL A;  3KOW E;  2C5R A;  1TH2 A;  4IBK A;  3FUX A;  4PDG A;  5EXS A;  5ITX A;  3PNV A;  4R7G A;  3J27 B;  1JR3 A;  4FCT A;  5FTJ A;  4B3M M;  3GQ3 A;  1HR0 M;  4IBC A;  3GLF B;  4LG2 A;  4OX9 M;  3MK6 A;  3KXE C;  1E32 A;  2Q2E B;  2Y0Q A;  4GKJ M;  1GLN A;  2A5Y B;  1HNZ M;  1R2Y A;  4LF7 M;  4LZZ A;  1N78 A;  4OVZ A;  2KXE A;  2O5R A;  2E5L M;  3ILK A;  4AW4 A;  4G4O A;  3Q8X A;  5BR8 M;  3GLH B;  3GRR A;  4XGI A;  5EQT A;  4B08 A;  1H6U A;  3JR4 A;  3SAV A;  1XMQ M;  2R18 A;  4G4Q A;  4GH9 A;  1QAO A;  3R8F A;  3GRU A;  4L4U A;  4LFA M;  3KVW A;  2YQZ A;  3CTW B;  4IIW A;  4MH0 E;  4NRV A;  3J81 S;  2DWL A;  1ORY B;  3KP1 E;  2FNA A;  3DA1 A;  2QPA A;  5GKN A;  3SAU A;  1QAN A;  2KRK A;  2DWM A;  3VK7 A;  2DVW B;  4BLC A;  3RGS A;  1NVM A;  3KSX A;  4R3D A;  3L26 A;  3U61 B;  2C9O A;  1QYR A;  2CHG A;  2CHQ A;  4LJ7 A;  4LJA A;  3KP0 E;  5C18 A;  4CIS A;  1G3I A;  1XC8 A;  4LF4 M;  1ZQ9 A;  4LJ9 A;  3KFU G;  1HQC A;  4D80 A;  4L78 A;  3A42 A;  3A98 B;  1K82 A;  4JI3 M;  3R9X B;  2FFJ A;  2HHH M;  2G8L A;  4OVZ B;  3SYL A;  4RF1 A;  5DNY A;  3LQQ A;  3FUV A;  2BJW A;  3AL0 C;  4AKI A;  4AG5 A;  2G5G X;  1NY5 A;  3PNY A;  4NOO B;  4LRS A;  3GPP A;  4ZPX A;  3U6O A;  1W5T A;  1J09 A;  3T38 A;  7CAT A;  3HHY A;  3SC3 A;  4TUW A;  1K3X A;  2XZF A;  1GVN A;  2CEA A;  5EP1 A;  3B9P A;  1G8P A;  4DV3 M;  4X66 M;  4A3V B;  4DR6 M;  1IN8 A;  5FLX S;  1L2C A;  2F4V M;  4I4L A;  3U6C A;  4HL4 A;  3SHG B;  4DV0 M;  4W5W A;  4GC5 A;  5KQ8 A;  3FTD A;  4REZ A;  5EP3 A;  5FSW A;  1NNJ A;  4G6Z A;  2YNM D;  4WW0 A;  3GLG A;  4MB7 A;  3I4Y A;  1T3T A;  4NXM M;  2KZS A;  4HLQ A;  3GPX A;  3EIE A;  1IBL M;  4KOD A;  1E9R A;  4GKK M;  3BOS A;  5EJC A;  1N75 A;  2J7N A;  1YE9 A;  3C58 A;  1Z59 A;  2VQE M;  1L1T A;  1Z6T A;  3JAM S;  4M0D A;  4EIW A;  5JI3 E;  1GKI A;  1L2B A;  1VDD A;  4MGY E;  1NHW C;  1TH3 A;  1IY2 A;  4PT5 A;  4ITQ A;  3DOA A;  2R62 A;  5KQD A;  2R65 A;  1Q39 A;  2XGN A;  1OJL A;  4AZF A;  4QNM A;  4XBO A;  5IZ7 D;  2F5Q A;  1DO0 A;  1Z5C A;  3L25 A;  3AFH A;  1IXR C;  1SXJ C;  1NJF A;  3WHL A;  2BJV A;  3DZD A;  3VK8 A;  1MU5 A;  4FCV A;  1IXS B;  2KW0 A;  3U6Q A;  3HJ8 A;  4NL4 H;  4IBG A;  5FTL A;  3RE8 A;  2Z4R A;  3SHF A;  4LRT A;  3FTE A;  4YHH M;  3LVV A;  5F3W A;  1TH4 A;  4II7 A;  1IN5 A;  3NBI A;  2ZAO A;  1N36 M;  4JXJ A;  2RGH A;  4D82 A;  3VFD A;  2UUA M;  1Q3B A;  3SMP A;  2H1R A;  3HHX A;  2Y0T A;  1HT1 E;  3GPY A;  3J2P B;  4I81 A;  3IG8 A;  2C98 A;  3RGP A;  1YUB A;  1IBM M;  4P16 A;  1IY0 A;  4DR7 M;  3W0F A;  1DGB A;  1J7K A;  3TE6 A;  4DV6 M;  2L09 A;  3EIH A;  4NXN M;  3FKE A;  1HQY E;  5BPV A;  3M6A A;  4CHT B;  4S12 A;  4DUY M;  3QAU A;  4Z8X A;  3VKH A;  3J80 S;  4MM3 B;  5FTM A;  3ZC7 B;  2UUC M;  3CF0 A;  3TWM A;  1JQJ C;  3L28 A;  1JR3 D;  1N33 M;  2BNK A;  4B7G A;  1QZM A;  4M9Z A;  4IBF A;  4AKH A;  4DR5 M;  1E9S A;  4IBJ A;  1HT2 E;  4FWG A;  5FTN A;  2UXD M;  4FWD A;  4PCZ A;  4BB9 A;  2ZM6 M;  2D7H A;  1TDZ A;  2UU9 M;  1Q3C A;  4OW0 A;  4FWH A;  3VKG A;  4QOZ C;  1IN4 A;  4PDI A;  2DZN B;  4MGH A;  3AOE A;  1G59 A;  2W82 A;  3RFW A;  2F5O A;  5E26 A;  4GRI A;  1L8Q A;  3U61 A;  2XSZ D;  1SXJ E;  2KZU A;  2KRU A;  4X62 M;  2CE7 A;  3AOE C;  4LY6 A;  4GIT A;  3U6M A;  3VDP A;  3TWL A;  4I5S A;  4JI6 M;  1HNX M;  3D8B A;  4IJE A;  1IXZ A;  4JV5 M;  2V6Z M;  3SMS A;  4LFB M;  5E6J A;  2LNH C;  5EP4 A;  5JI2 E;  4JI1 M;  3L29 A;  2EUC A;  2X8A A;  2HKJ A;  4KHP M;  1WXQ A;  1PJJ A;  1ZAE A;  2ZBK B;  1XXH A;  3U6D A;  3PFI A;  2XSZ A;  3KOZ E;  4LF8 M;  1NSF A;  2Z7J A;  2HCB A;  3GLH A;  2CUZ A;  2DWZ B;  3HWS A;  4QOS A;  3GQ5 A;  2LWX A;  2QBY B;  4LGY A;  4JI4 M;  3AOG A;  4LJ6 A;  3U6S A;  5KPR A;  4FD2 A;  4LJ4 A;  1HNW M;  4FCW A;  3GLF A;  3SBJ A;  4X64 M;  4RNA A;  4L8R C;  2FOI C;  2DZO B;  3TPZ A;  4WUR A;  3HJQ A;  1XNQ M;  4Z6Y A;  3UZU A;  3KS4 A;  3GQ4 A;  2K47 A;  8CAT A;  3CF6 E;  4B3S M;  1GL6 A;  2J7O A;  4NRW A;  2V1C A;  3T15 A;  4BBA A;  4DR1 M;  4L15 A;  1N34 M;  4AI6 A;  3E9S A;  2C9C A;  3FD9 A;  2Y20 A;  5LMU M;  1QAM A;  5LMN M;  1XMO M;  1LV7 A;  2CV0 A;  4DR3 M;  1DGG A;  2DHR A;  4KLN A;  4I8O A;  4NSR A;  4DR4 M;  2P5T A;  2UXC M;  2UUB M;  1UM8 A;  3HJS A;  3FUW A;  3FTC A;  4LCB A;  3VLF B;  3WHK A;  3GPU A;  2R46 A;  3HU2 A;  2KEB A;  3U5Z A;  1KFV A;  1I4W A;  3TL4 X;  4B3R M;  2YR0 A;  2I7P A;  3FYC A;  3IG5 A;  2RGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...