2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
2Y21A 2L7IA 4I5SA 2Y0TA 2Y0QA 2Y20A 2L7HA
chains in the Genus database with same CATH superfamily
4KODA 1IY1A 1PJSA 2V1CA 2UUCM 2GQFA 5KQ8A 4MGYE 3HHYA 2F5QA 1SXJE 3GO8A 2JZ0A 4I4LA 4AG5A 1GO5A 3AOGA 5ITYA 1OAOC 3U6DA 3CF0A 1EFUB 2KNZA 3DZDA 4LRTA 3J27B 2OQ4A 1T6OA 2DI0A 3AV0A 3ZC7B 2O01F 2K47A 3SC3A 4G3OA 4HEOA 4AG6A 4YHHM 1HQCA 4OU7A 4R71A 1XC8A 3LVVA 2G3QA 4IJEA 4FD2A 4CISA 4GKJM 2CEAA 1NNJA 3AJIB 3U6CA 3B7NA 1N78A 2Z3XA 2MR9A 3SMPA 4X65M 4G4QA 1V33A 2OOAA 1TGUA 4G4RA 4G4OA 5ITTA 4G6ZA 5ITRA 4PDIA 1XXHA 3HZJA 1DO2A 3RFWA 5EXXA 3GQ4A 2NQ8C 4DR2M 2JNHA 2XLJA 2LXEA 3PVSA 3U6EA 2CHVA 2C96A 3KSXA 3HJ8A 5ITXE 2YR0A 4ZPXA 3K1JA 2WSCF 4A3VB 1Q3CA 1XWIA 2C98A 3U5ZA 2XGNA 4QOSA 4RNAA 2WSEF 1HT1E 2KDLA 2ZAMA 4LF4M 3HU3A 4NRWA 4AKGA 2KNVA 4DR4M 4IBKA 1IY2A 4I8OA 1VDDA 2L2DA 4CIZA 1E9SA 4HLQA 2E5LM 3KW6A 2M5ZA 4HL4A 3J7BA 4FW9A 3QYEA 2R4EA 1YSYA 2R46A 2JY6B 4M9SA 1DGHB 5IZ7D 1IM2A 2LHCA 3TWLA 1MN3A 1IN7A 1NV8A 3C9PA 3NWLA 3W0FA 2Z7JA 5EP4A 4DV2M 1HR0M 4OW0A 1OKSA 2CV2A 3OTOM 4QOZC 3KDSE 5E6JA 4NL4H 1IN4A 1YLAA 2KW0A 3UJNA 3HHWA 1R2ZA 4D82A 1SG9A 1OJLA 3FKEA 3GPUA 3RE8A 1IXZA 3U60B 5F3WA 4FWDA 4FWGA 4GH9A 2LVNC 4FWHA 4XBOA 4LRSA 3KSJA 3GRYA 4DV7M 3VK7A 2F5OA 4B3SM 2D7EA 1L2DA 2MJ5B 1N32M 2R0IA 2VF8A 3KXEC 4M0WA 3E46A 2J7NA 4QHSA 1P3QQ 7CATA 4AI6A 5FTMA 4B3TM 2JY5A 1E32A 2ZBKB 3D8BA 3GLHB 3LMMA 1OIPA 2FH0A 2I7PA 3L28A 3U61A 2EUCA 2FNAA 2VQEM 1PGYA 2KZUA 3K2LA 1OFHA 4LF5M 4MGZE 1HT2E 3K92A 3HJSA 3GLFE 1QAMA 1HNZM 2JWSA 4AKIA 1DGBA 3FYCA 2L7HA 3SAWA 4CGYB 4B7FA 4PDGA 2VF7A 2QSFX 4M0DA 1IXRC 2DAMA 1C7YA 5IWAM 3IG8A 3GRVA 4F1IA 1JB0F 4JYAM 4WW0A 4JI1M 4LF9M 3PXGA 2EJSA 2D7GA 1MJGM 3M7GA 1QQWA 2HAKA 4MGKE 4BLCA 2DWLA 2R4JA 1GL6A 3H4JA 1NY5A 1Z59A 3DFZA 2LTUA 1Z5BA 3FTDA 3FUTA 1GVNA 2CUZA 3FRHA 3E21A 1PM5A 3I51A 1OTRA 2DWNA 2WZJA 2HCBA 4IIWA 3U6OA 2LNHC 1K3WA 2F5PA 1QAQA 1DGFA 4LJ7A 2FS1A 3KOWE 4REZA 1J5EM 1NY6A 2DWZB 4JXJA 1TH4A 4JI6M 1WIVA 3GLIA 1VEGA 4IBBA 4DV0M 1WGLA 3KOZE 1QANA 3J2PB 1K3XA 4Z8XA 1XB2B 4LJ9A 1IQPA 4OVZB 2EKKA 1IN8A 2LH0A 4UN2B 1GKIA 5GKNA 4GMQA 1HJPA 1SXJC 1TH3A 1EIJA 2HL7A 4L6V6 1QAOA 2HKJA 4GRIA 1ZMVA 2DAKA 2VIIA 1WHCA 1KSFX 4R3DA 2Y0TA 4DV1M 1V92A 2Y0QA 2DZLA 2C99A 2A5YB 3L27A 2DHYA 3C3DA 3LVWA 3WHLA 3SHFA 2ZAOA 3L29A 1XXHE 2CV0A 4JI5M 4LJ6A 3T1HM 3DOAA 3GRRA 3UGJA 2CV1A 2LBCA 4JI7M 1T3TA 3L25A 2RRUA 2KEBA 3HKPA 3MMPA 4ANRA 3FTFA 5EQTA 2XEPA 3B9PA 4FCTA 1IXSB 1D2NA 3MJ5A 1F4IA 1N33M 5JI2E 1J09A 2UXBM 1PJQA 1G71A 4KT0F 3GLGB 2O25A 3T6PA 4B08A 3HGIA 4S12A 2R62A 2OOBA 3I01M 2KRUA 2H1RA 4R7GA 3KP1E 1L2BA 4LJ4A 2EA0A 2CHQA 4LY6A 1G8PA 1GJTA 1QVRA 1JQJC 1AUAA 4DR1M 1G4AE 1IN5A 1R7RA 2H5XA 1NJFA 3HX3A 2R45A 4I81A 4L4UA 4JI3M 2XZFA 4X66M 4MGIE 3CGWA 2DAIA 3K8ZA 1R6BX 1NSFA 1SXJB 4PT5A 5EJCA 4LJ8A 2ZM6M 5EP1A 5EP3A 3Q8XA 2L09A 1X37A 1A5TA 2XF3A 4IBCA 1N34M 4OX9M 4JV5M 2BNKA 4IBIA 3LQRA 4WP2A 3T15A 4BB9A 4NOOB 2L4FA 4L8RC 1V34A 4DV3M 1VDLA 2DNAA 1L1TA 3D8LA 2MH8A 1NNUC 1G41A 4BBAA 2BWEA 2KRKA 5LMUM 3C3EA 3U60A 2CFOA 3M0EA 4LGMA 2JY7A 1L8QA 3VK8A 2Q2EB 3ZH9B 2QBYB 3KP0E 1KYIA 2BWBA 4QHTA 4QNMA 3JAMS 4NRVA 3B7QA 4W5WA 4P16A 1HQYE 3FUUA 2GNOA 2UXCM 1Z6TA 2UUAM 2F5NA 2CRUA 1R4GA 3GLHA 4EIWA 4Z6YA 1WXQA 4NXNM 5FLXS 4MM3B 3VKGA 5FTKA 1YUBA 3I4YA 3FRIA 2L7IA 3CTWB 2FOIC 3SFZA 3GPPA 1NJGA 2YQZA 5DNYA 1DGGA 2XSZD 1JR3D 1GLNA 2O5RA 3R8FA 3VKHA 4PD2A 1VQ1A 3J81S 3HWSA 4DV5M 3PNYA 4FVMA 2DWMA 2HHHM 3SATA 1NHGC 4LFBM 4QNRA 1N75A 3CF2A 4GITA 2QZ4A 2L4EA 5C1BA 1QYRA 2DHRA 5KO3A 1LTMA 3A46A 1QUTA 1L2CA 3J7AS 3TWMA 4KHPM 3GPXA 1ZMWA 4L78A 4JI8M 2ZANA 2DAGA 3KS4A 2I7NA 2XFTA 2V6ZM 1GL7A 3GQ5A 3U6LA 4KO8A 3T38A 3AOEC 3FD9A 4X62M 3E4RA 4IBFA 1E9RA 3QAUA 4FCVA 3V76A 2C5RA 3VLFB 2CWBA 3GQ3A 3U6MA 2RGHA 3GLIE 3SASA 2KXEA 1IBKM 2G5GX 3BOSA 1LV7A 2LVQD 1XHBA 1Y8GA 3UMMA 5FTLA 2LHGA 3HU2A 4GHAA 3HY5A 4G4NA 4GKKM 1D0KA 1J7KA 2EO2A 4II7A 3JR5A 4OVZA 1C1KA 3FYDA 2QHOB 3TE6A 1UM8A 1R2YA 1TDHA 3W68A 4LG2A 1H6UA 4DBGB 3GLFB 2JP7A 2LWXA 3FE3A 3WHKA 2XFSA 3IECA 4YY3M 4LCBA 2Y21A 3SAUA 3VDUA 2VDBB 4KLNA 1ORYB 4LFCM 3AFHA 2BJWA 3FTCA 1NVMA 2OO9A 3IG5A 5DYIA 1RU3A 1MX0A 3BXWA 1Z5AA 1K82A 2QENA 5KQDA 4NSRA 3SARA 2G8LA 3F92A 4LF8M 4XK8F 3HJQA 2Z8YM 4LZZA 2JY8A 2LVPC 2MROB 4M9ZA 3Q8GA 4K0KM 1NO1A 4DR7M 5LMNM 3HHXA 3NBIA 4B7GA 1VEJA 5FTJA 3LQQA 4DR6M 2FE8A 2QP9X 1IY0A 2JUJA 2J7OA 3MK6A 1QZEA 3PNVA 2UU9M 2R6FA 4IBEA 2DZNB 5C18A 2ZTDA 5FSWA 1QDTA 3U6SA 3KOYE 4P17A 3TPZA 5ITUA 5EP2A 1FNNA 3A45A 2J5YA 1OFIA 4GC9A 4D81A 5KPZA 3GLGA 4DUYM 4NC6A 3GP1A 5KPTA 1N36M 2DVWB 3A42A 1R5LA 3E9SA 3M6AA 5EXTA 1QZMA 2KHHA 1DO0A 3JR4A 1IBLM 1EE8A 1D0MA 4RF1A 3L26A 2X8AA 1TH2A 2YNMD 2EKFA 3FUXA 2Z4RA 2R44A 4GEWA 1SXJA 3NBXX 1TDZA 3B7ZA 1D0LA 1L1ZA 1Q3BA 2LVAA 3B89A 1VEKA 2QCUA 3SAVA 2QQ8A 1XMOM 2RGOA 5DFLA 4JI0M 1HNXM 5A2QS 1IBMM 2F5SA 3FTEA 1DGHA 1E94E 3LCUA 3J80S 1SXJD 1CUKA 2XZUA 3IHPA 3AKZA 4B3RM 3KFUG 2JZ1A 5BPVA 3L2AA 5BR8M 3BBZA 4MB7A 1W5SA 3DA1A 1GABA 4NXMM 4LJAA 2X49A 4LGYA 3W67A 1ZV1A 2X4AA 2LVOC 3U6QA 2L6OA 3AL0C 1XXHB 1XNQM 2P5TA 4AQYM 2K0BX 4JI4M 4IBDA 1S3SA 5H37D 5KPRA 1WJ7A 2D7HA 3A98B 8CATA 1PJJA 2QBYA 3I04M 3SYLA 4LZJA 4DV6M 3GLHE 4IBJA 3EIHA 2QNJA 5ITXA 3U5ZB 3VDPA 1JR3E 4B3MM 4L15A 2UXDM 1OIZA 2C9CA 5ITQA 2F4VM 1VG5A 3K9OA 1HNWM 1I94M 3U6PA 2RKOA 2CE7A 2C9OA 5EXSA 2XH9A 4LFAM 1N77A 3EIEA 3UZUA 2XSZA 1JR3A 1OAIA 4MH0E 3TWKA 2DXIA 1PJTA 3CF6E 1KFVA 1W5TA 3SBJA 4WURA 2K6BA 4FCWA 3K9PA 2Y20A 4L16A 3RGPA 3MHVC 3R9XB 1MU5A 4Q7JA 2HWJA 2DKLA 4RF0A 4LF6M 3KS8A 1TR8A 1DV0A 1YE9A 2DAEA 2KZSA 3RGSA 4AZFA 3HHZA 2W82A 1ZMUA 2DENA 4JI2M 4LJ5A 4M9XA 1NHWC 4RKUF 4JN6A 3ZCBB 3SMSA 1IN6A 1WR1B 3I4VA 1FJGM 2AHMA 4AW4A 3KOXE 4B7HA 2B3TA 3TL4X 3LCVB 3PFIA 3VFDA 4NSOB 2Z4SA 2K9DA 2WSFF 5IREB 2DZOB 2R18A 3U61B 4GC5A 3KVWA 1ZAEA 3C58A 2FFJA 1QUSA 4X64M 4DV4M 3GRUA 2MGWA 3ILKA 4LF7M 1ZQ9A 3B74A 1T43A 3FUVA 1Q39A 2CHGA 4IJFA 5E26A 1OQYA 4DR3M 1BVSA 1PRBA 1NV9A 2JXNA 3THGA 3ZQJA 3W0LB 3GLFA 4DUZM 4DR5M 2QPAA 2M60A 3QWLA 1IFYA 1G59A 5L8RF 1PJIA 1TF0B 1XNRM 4CJ6A 3SHGB 1Q02A 2KA6B 4IBGA 4XGIA 2CP8A 4CHTB 2UUBM 1AIPC 3TQSA 4F2LA 2BJVA 1Z5CA 3FUWA 2ZTCA 4TUWA 4Y28F 5EXPA 3SYKA 3GPYA 2R65A 3T1YM 4ITQA 1I4WA 5IT9S 3HU1A 3QYBA 3H4MA 4PCZA 5JI3E 1G3IA 1WGNA 3AOEA 4AKHA 5DYGA 4MGHA 1QDRA 2APLA 4D80A 2KNAA 3GLGE 1XMQM 3UK6A 2V1UA 3GLIB 2VQFM 1IXSA 2JA2A 4I5SA 2ERCA 4GIPA 2YFQA 1GJSA 3LW5F 5FTNA 2N35A 1TTEA 1UFZA 2OPFA 4GHLA
chains in the Genus database with same CATH topology
4KODA 1IY1A 2V1CA 2UUCM 5KQ8A 4MGYE 3HHYA 2F5QA 1SXJE 3GO8A 4AG5A 4I4LA 3AOGA 5ITYA 3U6DA 3CF0A 3DZDA 4LRTA 3J27B 2OQ4A 3AV0A 3ZC7B 2K47A 3SC3A 4AG6A 4YHHM 1HQCA 4OU7A 1XC8A 3LVVA 4IJEA 4FD2A 4CISA 4GKJM 2CEAA 1NNJA 3AJIB 3U6CA 1N78A 2Z3XA 3SMPA 4X65M 4G4QA 4G4RA 1TGUA 4G4OA 5ITTA 4G6ZA 5ITRA 4PDIA 1XXHA 1DO2A 3RFWA 5EXXA 3GQ4A 2NQ8C 4DR2M 2XLJA 2LXEA 3PVSA 3U6EA 2CHVA 2C96A 3KSXA 3HJ8A 5ITXE 2YR0A 4ZPXA 3K1JA 4A3VB 1Q3CA 1XWIA 2C98A 3U5ZA 2XGNA 4QOSA 4RNAA 1HT1E 2ZAMA 4LF4M 3HU3A 4NRWA 4AKGA 4DR4M 4IBKA 1IY2A 4I8OA 1VDDA 1E9SA 4HLQA 2E5LM 3KW6A 2M5ZA 4HL4A 3J7BA 4FW9A 2R4EA 1YSYA 2R46A 4M9SA 5IZ7D 1DGHB 1IM2A 3TWLA 1IN7A 3NWLA 3W0FA 2Z7JA 5EP4A 4DV2M 1HR0M 4OW0A 2CV2A 3OTOM 4QOZC 3KDSE 5E6JA 4NL4H 1IN4A 2KW0A 3UJNA 3HHWA 1R2ZA 4D82A 1OJLA 3FKEA 3GPUA 3RE8A 1IXZA 3U60B 5F3WA 4FWDA 4FWGA 4GH9A 4FWHA 4XBOA 4DV7M 4LRSA 3KSJA 3GRYA 3VK7A 2F5OA 4B3SM 2D7EA 1L2DA 1N32M 3KXEC 4M0WA 4AI6A 2J7NA 4QHSA 7CATA 5FTMA 4B3TM 1E32A 2ZBKB 3D8BA 3GLHB 3LMMA 2I7PA 3L28A 3U61A 2EUCA 2FNAA 2VQEM 3K2LA 2KZUA 1OFHA 4LF5M 4MGZE 1HT2E 3K92A 3HJSA 1HNZM 1QAMA 4AKIA 1DGBA 3FYCA 2L7HA 3SAWA 4CGYB 4B7FA 4PDGA 4M0DA 1IXRC 5IWAM 3IG8A 3GRVA 4JYAM 4WW0A 4JI1M 4LF9M 3PXGA 2D7GA 3M7GA 1QQWA 4MGKE 4BLCA 2DWLA 2R4JA 1GL6A 1NY5A 1Z59A 3DFZA 1Z5BA 3FTDA 3FUTA 1GVNA 2CUZA 1PM5A 3I51A 2DWNA 3U6OA 2HCBA 4IIWA 2F5PA 2LNHC 1K3WA 1QAQA 1DGFA 4LJ7A 3KOWE 4REZA 1J5EM 1NY6A 2DWZB 4JXJA 1TH4A 4JI6M 3GLIA 4IBBA 4DV0M 3KOZE 1QANA 3J2PB 1K3XA 4Z8XA 4LJ9A 1IQPA 4OVZB 1IN8A 2LH0A 1GKIA 5GKNA 4GMQA 1SXJC 1TH3A 2HL7A 1QAOA 2HKJA 4GRIA 2VIIA 1KSFX 4R3DA 2Y0TA 4DV1M 2Y0QA 2C99A 2A5YB 3L27A 3LVWA 3WHLA 3SHFA 2ZAOA 3L29A 2CV0A 4JI5M 4LJ6A 3T1HM 3DOAA 3GRRA 3UGJA 2CV1A 4JI7M 1T3TA 3L25A 2KEBA 3HKPA 3FTFA 5EQTA 2XEPA 3B9PA 4FCTA 1IXSB 1D2NA 3MJ5A 1N33M 5JI2E 1J09A 2UXBM 3GLGB 4B08A 3HGIA 4S12A 2R62A 2KRUA 2H1RA 4R7GA 3KP1E 1L2BA 4LJ4A 2EA0A 2CHQA 4LY6A 1G8PA 1QVRA 1JQJC 4DR1M 1G4AE 1IN5A 1R7RA 1NJFA 2R45A 4I81A 4L4UA 4JI3M 2XZFA 4X66M 4MGIE 3K8ZA 1R6BX 1NSFA 1SXJB 4PT5A 5EJCA 4LJ8A 2ZM6M 5EP1A 5EP3A 3Q8XA 2L09A 1X37A 2XF3A 4IBCA 1N34M 4OX9M 4JV5M 2BNKA 4IBIA 3LQRA 3T15A 4BB9A 4NOOB 4L8RC 4DV3M 1L1TA 3D8LA 1NNUC 1G41A 4BBAA 2KRKA 5LMUM 3U60A 2CFOA 3M0EA 4LGMA 3VK8A 1L8QA 2Q2EB 3ZH9B 2QBYB 3KP0E 1KYIA 4QHTA 4QNMA 3JAMS 4NRVA 4W5WA 4P16A 1HQYE 3FUUA 2UXCM 1Z6TA 2UUAM 2F5NA 3GLHA 4EIWA 4Z6YA 1WXQA 4NXNM 5FLXS 4MM3B 3VKGA 5FTKA 1YUBA 3I4YA 2L7IA 3CTWB 2FOIC 3SFZA 3GPPA 1NJGA 2YQZA 5DNYA 1DGGA 2XSZD 1JR3D 1GLNA 2O5RA 3R8FA 3VKHA 4PD2A 4DV5M 3J81S 3HWSA 2DWMA 3PNYA 4FVMA 2HHHM 3SATA 1NHGC 4LFBM 4QNRA 1N75A 3CF2A 4GITA 2QZ4A 5C1BA 1QYRA 2DHRA 5KO3A 3J7AS 3A46A 1L2CA 3TWMA 4KHPM 3GPXA 4L78A 4JI8M 2ZANA 3KS4A 2I7NA 2XFTA 2V6ZM 1GL7A 3GQ5A 3U6LA 4KO8A 3T38A 3AOEC 3FD9A 4X62M 3E4RA 4IBFA 1E9RA 3QAUA 4FCVA 2C5RA 3VLFB 3GQ3A 3U6MA 2RGHA 3SASA 2KXEA 1IBKM 2G5GX 3BOSA 1LV7A 1XHBA 3UMMA 5FTLA 3HU2A 4GHAA 4G4NA 4GKKM 1J7KA 2EO2A 4II7A 3JR5A 4OVZA 1C1KA 3FYDA 3TE6A 1UM8A 1R2YA 1TDHA 4LG2A 1H6UA 3GLFB 2LWXA 3WHKA 2XFSA 4YY3M 4LCBA 2Y21A 3SAUA 3VDUA 4KLNA 1ORYB 4LFCM 3AFHA 2BJWA 3FTCA 1NVMA 5DYIA 3IG5A 1MX0A 1Z5AA 1K82A 2QENA 5KQDA 4NSRA 3SARA 2G8LA 4LF8M 3HJQA 4LZZA 4M9ZA 4K0KM 4DR7M 5LMNM 3HHXA 3NBIA 4B7GA 5FTJA 3LQQA 4DR6M 2FE8A 2QP9X 1IY0A 2J7OA 3MK6A 3PNVA 2UU9M 4IBEA 2DZNB 5C18A 5FSWA 3U6SA 3KOYE 3TPZA 5ITUA 5EP2A 1FNNA 3A45A 4GC9A 1OFIA 4D81A 5KPZA 3GLGA 4DUYM 3GP1A 5KPTA 1N36M 2DVWB 3A42A 3E9SA 3M6AA 5EXTA 1QZMA 1DO0A 3JR4A 1IBLM 1EE8A 4RF1A 3L26A 2X8AA 1TH2A 2YNMD 3FUXA 2Z4RA 1TDZA 1SXJA 1L1ZA 1Q3BA 3SAVA 1XMOM 2QCUA 1HNXM 2RGOA 4JI0M 1IBMM 2F5SA 5A2QS 3FTEA 1DGHA 1E94E 3J80S 1SXJD 2XZUA 4B3RM 3AKZA 3KFUG 5BPVA 3L2AA 5BR8M 4MB7A 1W5SA 3DA1A 4NXMM 4LJAA 2X49A 4LGYA 2X4AA 3U6QA 2L6OA 3AL0C 1XXHB 1XNQM 2P5TA 4AQYM 4JI4M 4IBDA 1S3SA 5H37D 5KPRA 2D7HA 3A98B 8CATA 1PJJA 2QBYA 3SYLA 4LZJA 4DV6M 4IBJA 3EIHA 3U5ZB 5ITXA 3VDPA 4B3MM 4L15A 2UXDM 2C9CA 5ITQA 2F4VM 1HNWM 1I94M 3U6PA 2RKOA 2CE7A 2C9OA 5EXSA 2XH9A 4LFAM 1N77A 3EIEA 3UZUA 2XSZA 1JR3A 4MH0E 3TWKA 2DXIA 3CF6E 1KFVA 1W5TA 3SBJA 4WURA 4FCWA 2Y20A 4L16A 3RGPA 3MHVC 3R9XB 1MU5A 4RF0A 4LF6M 3KS8A 1YE9A 2KZSA 3RGSA 4AZFA 3HHZA 2W82A 4JI2M 4LJ5A 4M9XA 1NHWC 4JN6A 3ZCBB 3SMSA 1IN6A 3I4VA 1FJGM 2AHMA 4AW4A 3KOXE 4B7HA 3TL4X 3PFIA 3VFDA 4NSOB 2Z4SA 5IREB 2DZOB 2R18A 3U61B 4GC5A 3KVWA 1ZAEA 3C58A 2FFJA 4X64M 4DV4M 3GRUA 3ILKA 4LF7M 1ZQ9A 3FUVA 1Q39A 2CHGA 4IJFA 5E26A 4DR3M 3THGA 3W0LB 3GLFA 4DUZM 4DR5M 2QPAA 2M60A 3QWLA 1G59A 1PJIA 1XNRM 3SHGB 2KA6B 4IBGA 4XGIA 4CHTB 2UUBM 3TQSA 2BJVA 1Z5CA 3FUWA 4TUWA 5EXPA 3SYKA 3T1YM 3GPYA 2R65A 4ITQA 5IT9S 1I4WA 3HU1A 3H4MA 4PCZA 5JI3E 1G3IA 3AOEA 4AKHA 5DYGA 4MGHA 4D80A 1XMQM 3UK6A 2V1UA 3GLIB 2VQFM 2JA2A 4I5SA 2ERCA 4GIPA 2YFQA 5FTNA 2OPFA 4GHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y21 A;  2L7I A;  4I5S A;  2Y0T A;  2Y0Q A;  2Y20 A;  2L7H A; 
#chains in the Genus database with same CATH topology
 4KOD A;  1IY1 A;  1PJS A;  2V1C A;  2UUC M;  2GQF A;  5KQ8 A;  4MGY E;  3HHY A;  2F5Q A;  1SXJ E;  3GO8 A;  2JZ0 A;  4I4L A;  4AG5 A;  1GO5 A;  3AOG A;  5ITY A;  1OAO C;  3U6D A;  3CF0 A;  1EFU B;  2KNZ A;  3DZD A;  4LRT A;  3J27 B;  2OQ4 A;  1T6O A;  2DI0 A;  3AV0 A;  3ZC7 B;  2O01 F;  2K47 A;  3SC3 A;  4G3O A;  4HEO A;  4AG6 A;  4YHH M;  1HQC A;  4OU7 A;  4R71 A;  1XC8 A;  3LVV A;  2G3Q A;  4IJE A;  4FD2 A;  4CIS A;  4GKJ M;  2CEA A;  1NNJ A;  3AJI B;  3U6C A;  3B7N A;  1N78 A;  2Z3X A;  2MR9 A;  3SMP A;  4X65 M;  4G4Q A;  1V33 A;  2OOA A;  1TGU A;  4G4R A;  4G4O A;  5ITT A;  4G6Z A;  5ITR A;  4PDI A;  1XXH A;  3HZJ A;  1DO2 A;  3RFW A;  5EXX A;  3GQ4 A;  2NQ8 C;  4DR2 M;  2JNH A;  2XLJ A;  2LXE A;  3PVS A;  3U6E A;  2CHV A;  2C96 A;  3KSX A;  3HJ8 A;  5ITX E;  2YR0 A;  4ZPX A;  3K1J A;  2WSC F;  4A3V B;  1Q3C A;  1XWI A;  2C98 A;  3U5Z A;  2XGN A;  4QOS A;  4RNA A;  2WSE F;  1HT1 E;  2KDL A;  2ZAM A;  4LF4 M;  3HU3 A;  4NRW A;  4AKG A;  2KNV A;  4DR4 M;  4IBK A;  1IY2 A;  4I8O A;  1VDD A;  2L2D A;  4CIZ A;  1E9S A;  4HLQ A;  2E5L M;  3KW6 A;  2M5Z A;  4HL4 A;  3J7B A;  4FW9 A;  3QYE A;  2R4E A;  1YSY A;  2R46 A;  2JY6 B;  4M9S A;  1DGH B;  5IZ7 D;  1IM2 A;  2LHC A;  3TWL A;  1MN3 A;  1IN7 A;  1NV8 A;  3C9P A;  3NWL A;  3W0F A;  2Z7J A;  5EP4 A;  4DV2 M;  1HR0 M;  4OW0 A;  1OKS A;  2CV2 A;  3OTO M;  4QOZ C;  3KDS E;  5E6J A;  4NL4 H;  1IN4 A;  1YLA A;  2KW0 A;  3UJN A;  3HHW A;  1R2Z A;  4D82 A;  1SG9 A;  1OJL A;  3FKE A;  3GPU A;  3RE8 A;  1IXZ A;  3U60 B;  5F3W A;  4FWD A;  4FWG A;  4GH9 A;  2LVN C;  4FWH A;  4XBO A;  4LRS A;  3KSJ A;  3GRY A;  4DV7 M;  3VK7 A;  2F5O A;  4B3S M;  2D7E A;  1L2D A;  2MJ5 B;  1N32 M;  2R0I A;  2VF8 A;  3KXE C;  4M0W A;  3E46 A;  2J7N A;  4QHS A;  1P3Q Q;  7CAT A;  4AI6 A;  5FTM A;  4B3T M;  2JY5 A;  1E32 A;  2ZBK B;  3D8B A;  3GLH B;  3LMM A;  1OIP A;  2FH0 A;  2I7P A;  3L28 A;  3U61 A;  2EUC A;  2FNA A;  2VQE M;  1PGY A;  2KZU A;  3K2L A;  1OFH A;  4LF5 M;  4MGZ E;  1HT2 E;  3K92 A;  3HJS A;  3GLF E;  1QAM A;  1HNZ M;  2JWS A;  4AKI A;  1DGB A;  3FYC A;  2L7H A;  3SAW A;  4CGY B;  4B7F A;  4PDG A;  2VF7 A;  2QSF X;  4M0D A;  1IXR C;  2DAM A;  1C7Y A;  5IWA M;  3IG8 A;  3GRV A;  4F1I A;  1JB0 F;  4JYA M;  4WW0 A;  4JI1 M;  4LF9 M;  3PXG A;  2EJS A;  2D7G A;  1MJG M;  3M7G A;  1QQW A;  2HAK A;  4MGK E;  4BLC A;  2DWL A;  2R4J A;  1GL6 A;  3H4J A;  1NY5 A;  1Z59 A;  3DFZ A;  2LTU A;  1Z5B A;  3FTD A;  3FUT A;  1GVN A;  2CUZ A;  3FRH A;  3E21 A;  1PM5 A;  3I51 A;  1OTR A;  2DWN A;  2WZJ A;  2HCB A;  4IIW A;  3U6O A;  2LNH C;  1K3W A;  2F5P A;  1QAQ A;  1DGF A;  4LJ7 A;  2FS1 A;  3KOW E;  4REZ A;  1J5E M;  1NY6 A;  2DWZ B;  4JXJ A;  1TH4 A;  4JI6 M;  1WIV A;  3GLI A;  1VEG A;  4IBB A;  4DV0 M;  1WGL A;  3KOZ E;  1QAN A;  3J2P B;  1K3X A;  4Z8X A;  1XB2 B;  4LJ9 A;  1IQP A;  4OVZ B;  2EKK A;  1IN8 A;  2LH0 A;  4UN2 B;  1GKI A;  5GKN A;  4GMQ A;  1HJP A;  1SXJ C;  1TH3 A;  1EIJ A;  2HL7 A;  4L6V 6;  1QAO A;  2HKJ A;  4GRI A;  1ZMV A;  2DAK A;  2VII A;  1WHC A;  1KSF X;  4R3D A;  2Y0T A;  4DV1 M;  1V92 A;  2Y0Q A;  2DZL A;  2C99 A;  2A5Y B;  3L27 A;  2DHY A;  3C3D A;  3LVW A;  3WHL A;  3SHF A;  2ZAO A;  3L29 A;  1XXH E;  2CV0 A;  4JI5 M;  4LJ6 A;  3T1H M;  3DOA A;  3GRR A;  3UGJ A;  2CV1 A;  2LBC A;  4JI7 M;  1T3T A;  3L25 A;  2RRU A;  2KEB A;  3HKP A;  3MMP A;  4ANR A;  3FTF A;  5EQT A;  2XEP A;  3B9P A;  4FCT A;  1IXS B;  1D2N A;  3MJ5 A;  1F4I A;  1N33 M;  5JI2 E;  1J09 A;  2UXB M;  1PJQ A;  1G71 A;  4KT0 F;  3GLG B;  2O25 A;  3T6P A;  4B08 A;  3HGI A;  4S12 A;  2R62 A;  2OOB A;  3I01 M;  2KRU A;  2H1R A;  4R7G A;  3KP1 E;  1L2B A;  4LJ4 A;  2EA0 A;  2CHQ A;  4LY6 A;  1G8P A;  1GJT A;  1QVR A;  1JQJ C;  1AUA A;  4DR1 M;  1G4A E;  1IN5 A;  1R7R A;  2H5X A;  1NJF A;  3HX3 A;  2R45 A;  4I81 A;  4L4U A;  4JI3 M;  2XZF A;  4X66 M;  4MGI E;  3CGW A;  2DAI A;  3K8Z A;  1R6B X;  1NSF A;  1SXJ B;  4PT5 A;  5EJC A;  4LJ8 A;  2ZM6 M;  5EP1 A;  5EP3 A;  3Q8X A;  2L09 A;  1X37 A;  1A5T A;  2XF3 A;  4IBC A;  1N34 M;  4OX9 M;  4JV5 M;  2BNK A;  4IBI A;  3LQR A;  4WP2 A;  3T15 A;  4BB9 A;  4NOO B;  2L4F A;  4L8R C;  1V34 A;  4DV3 M;  1VDL A;  2DNA A;  1L1T A;  3D8L A;  2MH8 A;  1NNU C;  1G41 A;  4BBA A;  2BWE A;  2KRK A;  5LMU M;  3C3E A;  3U60 A;  2CFO A;  3M0E A;  4LGM A;  2JY7 A;  1L8Q A;  3VK8 A;  2Q2E B;  3ZH9 B;  2QBY B;  3KP0 E;  1KYI A;  2BWB A;  4QHT A;  4QNM A;  3JAM S;  4NRV A;  3B7Q A;  4W5W A;  4P16 A;  1HQY E;  3FUU A;  2GNO A;  2UXC M;  1Z6T A;  2UUA M;  2F5N A;  2CRU A;  1R4G A;  3GLH A;  4EIW A;  4Z6Y A;  1WXQ A;  4NXN M;  5FLX S;  4MM3 B;  3VKG A;  5FTK A;  1YUB A;  3I4Y A;  3FRI A;  2L7I A;  3CTW B;  2FOI C;  3SFZ A;  3GPP A;  1NJG A;  2YQZ A;  5DNY A;  1DGG A;  2XSZ D;  1JR3 D;  1GLN A;  2O5R A;  3R8F A;  3VKH A;  4PD2 A;  1VQ1 A;  3J81 S;  3HWS A;  4DV5 M;  3PNY A;  4FVM A;  2DWM A;  2HHH M;  3SAT A;  1NHG C;  4LFB M;  4QNR A;  1N75 A;  3CF2 A;  4GIT A;  2QZ4 A;  2L4E A;  5C1B A;  1QYR A;  2DHR A;  5KO3 A;  1LTM A;  3A46 A;  1QUT A;  1L2C A;  3J7A S;  3TWM A;  4KHP M;  3GPX A;  1ZMW A;  4L78 A;  4JI8 M;  2ZAN A;  2DAG A;  3KS4 A;  2I7N A;  2XFT A;  2V6Z M;  1GL7 A;  3GQ5 A;  3U6L A;  4KO8 A;  3T38 A;  3AOE C;  3FD9 A;  4X62 M;  3E4R A;  4IBF A;  1E9R A;  3QAU A;  4FCV A;  3V76 A;  2C5R A;  3VLF B;  2CWB A;  3GQ3 A;  3U6M A;  2RGH A;  3GLI E;  3SAS A;  2KXE A;  1IBK M;  2G5G X;  3BOS A;  1LV7 A;  2LVQ D;  1XHB A;  1Y8G A;  3UMM A;  5FTL A;  2LHG A;  3HU2 A;  4GHA A;  3HY5 A;  4G4N A;  4GKK M;  1D0K A;  1J7K A;  2EO2 A;  4II7 A;  3JR5 A;  4OVZ A;  1C1K A;  3FYD A;  2QHO B;  3TE6 A;  1UM8 A;  1R2Y A;  1TDH A;  3W68 A;  4LG2 A;  1H6U A;  4DBG B;  3GLF B;  2JP7 A;  2LWX A;  3FE3 A;  3WHK A;  2XFS A;  3IEC A;  4YY3 M;  4LCB A;  2Y21 A;  3SAU A;  3VDU A;  2VDB B;  4KLN A;  1ORY B;  4LFC M;  3AFH A;  2BJW A;  3FTC A;  1NVM A;  2OO9 A;  3IG5 A;  5DYI A;  1RU3 A;  1MX0 A;  3BXW A;  1Z5A A;  1K82 A;  2QEN A;  5KQD A;  4NSR A;  3SAR A;  2G8L A;  3F92 A;  4LF8 M;  4XK8 F;  3HJQ A;  2Z8Y M;  4LZZ A;  2JY8 A;  2LVP C;  2MRO B;  4M9Z A;  3Q8G A;  4K0K M;  1NO1 A;  4DR7 M;  5LMN M;  3HHX A;  3NBI A;  4B7G A;  1VEJ A;  5FTJ A;  3LQQ A;  4DR6 M;  2FE8 A;  2QP9 X;  1IY0 A;  2JUJ A;  2J7O A;  3MK6 A;  1QZE A;  3PNV A;  2UU9 M;  2R6F A;  4IBE A;  2DZN B;  5C18 A;  2ZTD A;  5FSW A;  1QDT A;  3U6S A;  3KOY E;  4P17 A;  3TPZ A;  5ITU A;  5EP2 A;  1FNN A;  3A45 A;  2J5Y A;  1OFI A;  4GC9 A;  4D81 A;  5KPZ A;  3GLG A;  4DUY M;  4NC6 A;  3GP1 A;  5KPT A;  1N36 M;  2DVW B;  3A42 A;  1R5L A;  3E9S A;  3M6A A;  5EXT A;  1QZM A;  2KHH A;  1DO0 A;  3JR4 A;  1IBL M;  1EE8 A;  1D0M A;  4RF1 A;  3L26 A;  2X8A A;  1TH2 A;  2YNM D;  2EKF A;  3FUX A;  2Z4R A;  2R44 A;  4GEW A;  1SXJ A;  3NBX X;  1TDZ A;  3B7Z A;  1D0L A;  1L1Z A;  1Q3B A;  2LVA A;  3B89 A;  1VEK A;  2QCU A;  3SAV A;  2QQ8 A;  1XMO M;  2RGO A;  5DFL A;  4JI0 M;  1HNX M;  5A2Q S;  1IBM M;  2F5S A;  3FTE A;  1DGH A;  1E94 E;  3LCU A;  3J80 S;  1SXJ D;  1CUK A;  2XZU A;  3IHP A;  3AKZ A;  4B3R M;  3KFU G;  2JZ1 A;  5BPV A;  3L2A A;  5BR8 M;  3BBZ A;  4MB7 A;  1W5S A;  3DA1 A;  1GAB A;  4NXM M;  4LJA A;  2X49 A;  4LGY A;  3W67 A;  1ZV1 A;  2X4A A;  2LVO C;  3U6Q A;  2L6O A;  3AL0 C;  1XXH B;  1XNQ M;  2P5T A;  4AQY M;  2K0B X;  4JI4 M;  4IBD A;  1S3S A;  5H37 D;  5KPR A;  1WJ7 A;  2D7H A;  3A98 B;  8CAT A;  1PJJ A;  2QBY A;  3I04 M;  3SYL A;  4LZJ A;  4DV6 M;  3GLH E;  4IBJ A;  3EIH A;  2QNJ A;  5ITX A;  3U5Z B;  3VDP A;  1JR3 E;  4B3M M;  4L15 A;  2UXD M;  1OIZ A;  2C9C A;  5ITQ A;  2F4V M;  1VG5 A;  3K9O A;  1HNW M;  1I94 M;  3U6P A;  2RKO A;  2CE7 A;  2C9O A;  5EXS A;  2XH9 A;  4LFA M;  1N77 A;  3EIE A;  3UZU A;  2XSZ A;  1JR3 A;  1OAI A;  4MH0 E;  3TWK A;  2DXI A;  1PJT A;  3CF6 E;  1KFV A;  1W5T A;  3SBJ A;  4WUR A;  2K6B A;  4FCW A;  3K9P A;  2Y20 A;  4L16 A;  3RGP A;  3MHV C;  3R9X B;  1MU5 A;  4Q7J A;  2HWJ A;  2DKL A;  4RF0 A;  4LF6 M;  3KS8 A;  1TR8 A;  1DV0 A;  1YE9 A;  2DAE A;  2KZS A;  3RGS A;  4AZF A;  3HHZ A;  2W82 A;  1ZMU A;  2DEN A;  4JI2 M;  4LJ5 A;  4M9X A;  1NHW C;  4RKU F;  4JN6 A;  3ZCB B;  3SMS A;  1IN6 A;  1WR1 B;  3I4V A;  1FJG M;  2AHM A;  4AW4 A;  3KOX E;  4B7H A;  2B3T A;  3TL4 X;  3LCV B;  3PFI A;  3VFD A;  4NSO B;  2Z4S A;  2K9D A;  2WSF F;  5IRE B;  2DZO B;  2R18 A;  3U61 B;  4GC5 A;  3KVW A;  1ZAE A;  3C58 A;  2FFJ A;  1QUS A;  4X64 M;  4DV4 M;  3GRU A;  2MGW A;  3ILK A;  4LF7 M;  1ZQ9 A;  3B74 A;  1T43 A;  3FUV A;  1Q39 A;  2CHG A;  4IJF A;  5E26 A;  1OQY A;  4DR3 M;  1BVS A;  1PRB A;  1NV9 A;  2JXN A;  3THG A;  3ZQJ A;  3W0L B;  3GLF A;  4DUZ M;  4DR5 M;  2QPA A;  2M60 A;  3QWL A;  1IFY A;  1G59 A;  5L8R F;  1PJI A;  1TF0 B;  1XNR M;  4CJ6 A;  3SHG B;  1Q02 A;  2KA6 B;  4IBG A;  4XGI A;  2CP8 A;  4CHT B;  2UUB M;  1AIP C;  3TQS A;  4F2L A;  2BJV A;  1Z5C A;  3FUW A;  2ZTC A;  4TUW A;  4Y28 F;  5EXP A;  3SYK A;  3GPY A;  2R65 A;  3T1Y M;  4ITQ A;  1I4W A;  5IT9 S;  3HU1 A;  3QYB A;  3H4M A;  4PCZ A;  5JI3 E;  1G3I A;  1WGN A;  3AOE A;  4AKH A;  5DYG A;  4MGH A;  1QDR A;  2APL A;  4D80 A;  2KNA A;  3GLG E;  1XMQ M;  3UK6 A;  2V1U A;  3GLI B;  2VQF M;  1IXS A;  2JA2 A;  4I5S A;  2ERC A;  4GIP A;  2YFQ A;  1GJS A;  3LW5 F;  5FTN A;  2N35 A;  1TTE A;  1UFZ A;  2OPF A;  4GHL A; 
#chains in the Genus database with same CATH homology
 4KOD A;  1IY1 A;  2V1C A;  2UUC M;  5KQ8 A;  4MGY E;  3HHY A;  2F5Q A;  1SXJ E;  3GO8 A;  4AG5 A;  4I4L A;  3AOG A;  5ITY A;  3U6D A;  3CF0 A;  3DZD A;  4LRT A;  3J27 B;  2OQ4 A;  3AV0 A;  3ZC7 B;  2K47 A;  3SC3 A;  4AG6 A;  4YHH M;  1HQC A;  4OU7 A;  1XC8 A;  3LVV A;  4IJE A;  4FD2 A;  4CIS A;  4GKJ M;  2CEA A;  1NNJ A;  3AJI B;  3U6C A;  1N78 A;  2Z3X A;  3SMP A;  4X65 M;  4G4Q A;  4G4R A;  1TGU A;  4G4O A;  5ITT A;  4G6Z A;  5ITR A;  4PDI A;  1XXH A;  1DO2 A;  3RFW A;  5EXX A;  3GQ4 A;  2NQ8 C;  4DR2 M;  2XLJ A;  2LXE A;  3PVS A;  3U6E A;  2CHV A;  2C96 A;  3KSX A;  3HJ8 A;  5ITX E;  2YR0 A;  4ZPX A;  3K1J A;  4A3V B;  1Q3C A;  1XWI A;  2C98 A;  3U5Z A;  2XGN A;  4QOS A;  4RNA A;  1HT1 E;  2ZAM A;  4LF4 M;  3HU3 A;  4NRW A;  4AKG A;  4DR4 M;  4IBK A;  1IY2 A;  4I8O A;  1VDD A;  1E9S A;  4HLQ A;  2E5L M;  3KW6 A;  2M5Z A;  4HL4 A;  3J7B A;  4FW9 A;  2R4E A;  1YSY A;  2R46 A;  4M9S A;  5IZ7 D;  1DGH B;  1IM2 A;  3TWL A;  1IN7 A;  3NWL A;  3W0F A;  2Z7J A;  5EP4 A;  4DV2 M;  1HR0 M;  4OW0 A;  2CV2 A;  3OTO M;  4QOZ C;  3KDS E;  5E6J A;  4NL4 H;  1IN4 A;  2KW0 A;  3UJN A;  3HHW A;  1R2Z A;  4D82 A;  1OJL A;  3FKE A;  3GPU A;  3RE8 A;  1IXZ A;  3U60 B;  5F3W A;  4FWD A;  4FWG A;  4GH9 A;  4FWH A;  4XBO A;  4DV7 M;  4LRS A;  3KSJ A;  3GRY A;  3VK7 A;  2F5O A;  4B3S M;  2D7E A;  1L2D A;  1N32 M;  3KXE C;  4M0W A;  4AI6 A;  2J7N A;  4QHS A;  7CAT A;  5FTM A;  4B3T M;  1E32 A;  2ZBK B;  3D8B A;  3GLH B;  3LMM A;  2I7P A;  3L28 A;  3U61 A;  2EUC A;  2FNA A;  2VQE M;  3K2L A;  2KZU A;  1OFH A;  4LF5 M;  4MGZ E;  1HT2 E;  3K92 A;  3HJS A;  1HNZ M;  1QAM A;  4AKI A;  1DGB A;  3FYC A;  2L7H A;  3SAW A;  4CGY B;  4B7F A;  4PDG A;  4M0D A;  1IXR C;  5IWA M;  3IG8 A;  3GRV A;  4JYA M;  4WW0 A;  4JI1 M;  4LF9 M;  3PXG A;  2D7G A;  3M7G A;  1QQW A;  4MGK E;  4BLC A;  2DWL A;  2R4J A;  1GL6 A;  1NY5 A;  1Z59 A;  3DFZ A;  1Z5B A;  3FTD A;  3FUT A;  1GVN A;  2CUZ A;  1PM5 A;  3I51 A;  2DWN A;  3U6O A;  2HCB A;  4IIW A;  2F5P A;  2LNH C;  1K3W A;  1QAQ A;  1DGF A;  4LJ7 A;  3KOW E;  4REZ A;  1J5E M;  1NY6 A;  2DWZ B;  4JXJ A;  1TH4 A;  4JI6 M;  3GLI A;  4IBB A;  4DV0 M;  3KOZ E;  1QAN A;  3J2P B;  1K3X A;  4Z8X A;  4LJ9 A;  1IQP A;  4OVZ B;  1IN8 A;  2LH0 A;  1GKI A;  5GKN A;  4GMQ A;  1SXJ C;  1TH3 A;  2HL7 A;  1QAO A;  2HKJ A;  4GRI A;  2VII A;  1KSF X;  4R3D A;  2Y0T A;  4DV1 M;  2Y0Q A;  2C99 A;  2A5Y B;  3L27 A;  3LVW A;  3WHL A;  3SHF A;  2ZAO A;  3L29 A;  2CV0 A;  4JI5 M;  4LJ6 A;  3T1H M;  3DOA A;  3GRR A;  3UGJ A;  2CV1 A;  4JI7 M;  1T3T A;  3L25 A;  2KEB A;  3HKP A;  3FTF A;  5EQT A;  2XEP A;  3B9P A;  4FCT A;  1IXS B;  1D2N A;  3MJ5 A;  1N33 M;  5JI2 E;  1J09 A;  2UXB M;  3GLG B;  4B08 A;  3HGI A;  4S12 A;  2R62 A;  2KRU A;  2H1R A;  4R7G A;  3KP1 E;  1L2B A;  4LJ4 A;  2EA0 A;  2CHQ A;  4LY6 A;  1G8P A;  1QVR A;  1JQJ C;  4DR1 M;  1G4A E;  1IN5 A;  1R7R A;  1NJF A;  2R45 A;  4I81 A;  4L4U A;  4JI3 M;  2XZF A;  4X66 M;  4MGI E;  3K8Z A;  1R6B X;  1NSF A;  1SXJ B;  4PT5 A;  5EJC A;  4LJ8 A;  2ZM6 M;  5EP1 A;  5EP3 A;  3Q8X A;  2L09 A;  1X37 A;  2XF3 A;  4IBC A;  1N34 M;  4OX9 M;  4JV5 M;  2BNK A;  4IBI A;  3LQR A;  3T15 A;  4BB9 A;  4NOO B;  4L8R C;  4DV3 M;  1L1T A;  3D8L A;  1NNU C;  1G41 A;  4BBA A;  2KRK A;  5LMU M;  3U60 A;  2CFO A;  3M0E A;  4LGM A;  3VK8 A;  1L8Q A;  2Q2E B;  3ZH9 B;  2QBY B;  3KP0 E;  1KYI A;  4QHT A;  4QNM A;  3JAM S;  4NRV A;  4W5W A;  4P16 A;  1HQY E;  3FUU A;  2UXC M;  1Z6T A;  2UUA M;  2F5N A;  3GLH A;  4EIW A;  4Z6Y A;  1WXQ A;  4NXN M;  5FLX S;  4MM3 B;  3VKG A;  5FTK A;  1YUB A;  3I4Y A;  2L7I A;  3CTW B;  2FOI C;  3SFZ A;  3GPP A;  1NJG A;  2YQZ A;  5DNY A;  1DGG A;  2XSZ D;  1JR3 D;  1GLN A;  2O5R A;  3R8F A;  3VKH A;  4PD2 A;  4DV5 M;  3J81 S;  3HWS A;  2DWM A;  3PNY A;  4FVM A;  2HHH M;  3SAT A;  1NHG C;  4LFB M;  4QNR A;  1N75 A;  3CF2 A;  4GIT A;  2QZ4 A;  5C1B A;  1QYR A;  2DHR A;  5KO3 A;  3J7A S;  3A46 A;  1L2C A;  3TWM A;  4KHP M;  3GPX A;  4L78 A;  4JI8 M;  2ZAN A;  3KS4 A;  2I7N A;  2XFT A;  2V6Z M;  1GL7 A;  3GQ5 A;  3U6L A;  4KO8 A;  3T38 A;  3AOE C;  3FD9 A;  4X62 M;  3E4R A;  4IBF A;  1E9R A;  3QAU A;  4FCV A;  2C5R A;  3VLF B;  3GQ3 A;  3U6M A;  2RGH A;  3SAS A;  2KXE A;  1IBK M;  2G5G X;  3BOS A;  1LV7 A;  1XHB A;  3UMM A;  5FTL A;  3HU2 A;  4GHA A;  4G4N A;  4GKK M;  1J7K A;  2EO2 A;  4II7 A;  3JR5 A;  4OVZ A;  1C1K A;  3FYD A;  3TE6 A;  1UM8 A;  1R2Y A;  1TDH A;  4LG2 A;  1H6U A;  3GLF B;  2LWX A;  3WHK A;  2XFS A;  4YY3 M;  4LCB A;  2Y21 A;  3SAU A;  3VDU A;  4KLN A;  1ORY B;  4LFC M;  3AFH A;  2BJW A;  3FTC A;  1NVM A;  5DYI A;  3IG5 A;  1MX0 A;  1Z5A A;  1K82 A;  2QEN A;  5KQD A;  4NSR A;  3SAR A;  2G8L A;  4LF8 M;  3HJQ A;  4LZZ A;  4M9Z A;  4K0K M;  4DR7 M;  5LMN M;  3HHX A;  3NBI A;  4B7G A;  5FTJ A;  3LQQ A;  4DR6 M;  2FE8 A;  2QP9 X;  1IY0 A;  2J7O A;  3MK6 A;  3PNV A;  2UU9 M;  4IBE A;  2DZN B;  5C18 A;  5FSW A;  3U6S A;  3KOY E;  3TPZ A;  5ITU A;  5EP2 A;  1FNN A;  3A45 A;  4GC9 A;  1OFI A;  4D81 A;  5KPZ A;  3GLG A;  4DUY M;  3GP1 A;  5KPT A;  1N36 M;  2DVW B;  3A42 A;  3E9S A;  3M6A A;  5EXT A;  1QZM A;  1DO0 A;  3JR4 A;  1IBL M;  1EE8 A;  4RF1 A;  3L26 A;  2X8A A;  1TH2 A;  2YNM D;  3FUX A;  2Z4R A;  1TDZ A;  1SXJ A;  1L1Z A;  1Q3B A;  3SAV A;  1XMO M;  2QCU A;  1HNX M;  2RGO A;  4JI0 M;  1IBM M;  2F5S A;  5A2Q S;  3FTE A;  1DGH A;  1E94 E;  3J80 S;  1SXJ D;  2XZU A;  4B3R M;  3AKZ A;  3KFU G;  5BPV A;  3L2A A;  5BR8 M;  4MB7 A;  1W5S A;  3DA1 A;  4NXM M;  4LJA A;  2X49 A;  4LGY A;  2X4A A;  3U6Q A;  2L6O A;  3AL0 C;  1XXH B;  1XNQ M;  2P5T A;  4AQY M;  4JI4 M;  4IBD A;  1S3S A;  5H37 D;  5KPR A;  2D7H A;  3A98 B;  8CAT A;  1PJJ A;  2QBY A;  3SYL A;  4LZJ A;  4DV6 M;  4IBJ A;  3EIH A;  3U5Z B;  5ITX A;  3VDP A;  4B3M M;  4L15 A;  2UXD M;  2C9C A;  5ITQ A;  2F4V M;  1HNW M;  1I94 M;  3U6P A;  2RKO A;  2CE7 A;  2C9O A;  5EXS A;  2XH9 A;  4LFA M;  1N77 A;  3EIE A;  3UZU A;  2XSZ A;  1JR3 A;  4MH0 E;  3TWK A;  2DXI A;  3CF6 E;  1KFV A;  1W5T A;  3SBJ A;  4WUR A;  4FCW A;  2Y20 A;  4L16 A;  3RGP A;  3MHV C;  3R9X B;  1MU5 A;  4RF0 A;  4LF6 M;  3KS8 A;  1YE9 A;  2KZS A;  3RGS A;  4AZF A;  3HHZ A;  2W82 A;  4JI2 M;  4LJ5 A;  4M9X A;  1NHW C;  4JN6 A;  3ZCB B;  3SMS A;  1IN6 A;  3I4V A;  1FJG M;  2AHM A;  4AW4 A;  3KOX E;  4B7H A;  3TL4 X;  3PFI A;  3VFD A;  4NSO B;  2Z4S A;  5IRE B;  2DZO B;  2R18 A;  3U61 B;  4GC5 A;  3KVW A;  1ZAE A;  3C58 A;  2FFJ A;  4X64 M;  4DV4 M;  3GRU A;  3ILK A;  4LF7 M;  1ZQ9 A;  3FUV A;  1Q39 A;  2CHG A;  4IJF A;  5E26 A;  4DR3 M;  3THG A;  3W0L B;  3GLF A;  4DUZ M;  4DR5 M;  2QPA A;  2M60 A;  3QWL A;  1G59 A;  1PJI A;  1XNR M;  3SHG B;  2KA6 B;  4IBG A;  4XGI A;  4CHT B;  2UUB M;  3TQS A;  2BJV A;  1Z5C A;  3FUW A;  4TUW A;  5EXP A;  3SYK A;  3T1Y M;  3GPY A;  2R65 A;  4ITQ A;  5IT9 S;  1I4W A;  3HU1 A;  3H4M A;  4PCZ A;  5JI3 E;  1G3I A;  3AOE A;  4AKH A;  5DYG A;  4MGH A;  4D80 A;  1XMQ M;  3UK6 A;  2V1U A;  3GLI B;  2VQF M;  2JA2 A;  4I5S A;  2ERC A;  4GIP A;  2YFQ A;  5FTN A;  2OPF A;  4GHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...