2L7IA

The solution structure of the hamp domain of the hypothetical transmembrane receptor af1503 (a291f variant)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
GSHMSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The Mechanisms of HAMP-Mediated Signaling in Transmembrane Receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 18
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l7iA00
2Y0TA 4I5SA 2L7HA 2Y21A 2Y20A 2L7IA 2Y0QA
chains in the Genus database with same CATH superfamily
5KPRA 1GJTA 1R5LA 1FNNA 2L6OA 3LCUA 3RGSA 4IBKA 2B3TA 1HQCA 5E26A 1HR0M 2KDLA 2LHGA 2M5ZA 1N36M 4FWGA 2CWBA 3DA1A 4B3TM 1QQWA 4I8OA 3E4RA 1Z5CA 3H4JA 3T6PA 5ITUA 1HT1E 5DYIA 4FW9A 3AOEC 1E9RA 3KP1E 3CTWB 3JAMS 2XLJA 2HCBA 1QYRA 4FD2A 4NSOB 5E6JA 2KZSA 1XXHB 1GL6A 1HJPA 4CJ6A 4XBOA 1DO0A 2CV0A 5C18A 1G71A 2Z7JA 4JN6A 3I04M 1D0LA 1TH3A 4Y28F 1Q02A 4B7FA 1JR3A 3FUVA 4IIWA 1PRBA 3IECA 2KHHA 2QNJA 1QAQA 2CHQA 3GLHB 3U60B 2QHOB 2A5YB 4KLNA 2DWNA 2CEAA 2DXIA 4NC6A 2JWSA 1S3SA 2K0BX 4AQYM 4GC9A 3K9PA 3GPXA 5LMNM 3FUXA 5IZ7D 2ZBKB 1N33M 2QBYB 3B7NA 2CE7A 4YY3M 2LBCA 3KOYE 1OKSA 3U6MA 2FFJA 2C5RA 5ITTA 4M0DA 3AJIB 1DGHA 1L2CA 3SATA 3J2PB 2Y0TA 4JXJA 2UUAM 1W5SA 4HL4A 2F5OA 4EIWA 2L7HA 2KXEA 4DR3M 1J09A 4LJ8A 3FUWA 2V1UA 4DUZM 4LJ9A 2H5XA 2C9OA 1IN7A 4Q7JA 3KS8A 3J7BA 4L78A 7CATA 2J7OA 1E94E 2UUCM 3C3DA 2KZUA 3L29A 4LF7M 1FJGM 3V76A 3SBJA 1N34M 2KRUA 1H6UA 4OVZB 5ITXE 1NHGC 3T1YM 4QNMA 1L2BA 1EIJA 1WGNA 3E21A 4KT0F 3L2AA 3ZC7B 3GLGA 3K92A 1RU3A 3IG5A 2P5TA 3J80S 2UUBM 4B3SM 1QAOA 4MGKE 4KODA 1OTRA 1PJIA 2F5PA 3I51A 3HKPA 2F4VM 2YQZA 3J81S 1G41A 1OJLA 2NQ8C 3KOWE 3KP0E 3WHLA 4DV3M 3QYEA 1IBLM 2APLA 1K3WA 3AFHA 2F5NA 3H4MA 2JP7A 4LJ6A 4JI8M 1E9SA 4W5WA 4LJ5A 3U60A 5FSWA 1GABA 5EP4A 2JZ1A 4DV1M 2DWMA 3RGPA 4GHAA 3VLFB 2LVNC 2ZANA 3LQRA 3QAUA 4DR2M 1SXJD 2MR9A 1EE8A 2EO2A 3JR4A 4II7A 3KXEC 3W0FA 4LCBA 2VQEM 1QAMA 4ZPXA 4P16A 1D0MA 1HT2E 5GKNA 5DFLA 4R3DA 3U6CA 4CIZA 1TH4A 4GIPA 4I4LA 2C96A 4IBCA 4M0WA 3UK6A 3GO8A 2BWEA 1A5TA 5KPZA 1CUKA 2LVQD 3FYCA 4ANRA 3IHPA 3PNYA 1PJJA 1IFYA 2LVPC 3Q8XA 3PXGA 3SASA 4JI2M 4XK8F 4DV4M 3B89A 4IBDA 4HLQA 4GMQA 3GLIA 3UMMA 2FE8A 2OPFA 3SMPA 3T1HM 4PDIA 3SAWA 2R4JA 1UM8A 2CRUA 3MHVC 2RGHA 1L8QA 4GHLA 2UXDM 3QWLA 4Z6YA 1GKIA 1GLNA 2Z3XA 4DV6M 1QUTA 1ZAEA 2R6FA 3A98B 2KNAA 3HU2A 5DNYA 4OVZA 3W68A 3U6SA 3VK7A 2LTUA 4I5SA 1C1KA 2BNKA 2ZM6M 1V33A 4LF4M 4I81A 4AG5A 2RRUA 1Z6TA 1SG9A 1IQPA 1ZMWA 1LTMA 3GRRA 1Q39A 2DVWB 3TL4X 2G8LA 3U6PA 1IM2A 4DR4M 5LMUM 2N35A 3SAVA 1K3XA 3RE8A 2V6ZM 4MB7A 4LG2A 2UXBM 1UFZA 1MN3A 2XFSA 3GRUA 5DYGA 1Z59A 3JR5A 4MGZE 1VEGA 3EIHA 1OQYA 2OO9A 3HHZA 4OU7A 3HJ8A 4K0KM 3SMSA 4MGHA 3FE3A 3NWLA 2AHMA 3BBZA 3TWKA 2OOBA 1R2YA 3BOSA 3QYBA 3SYKA 4DR1M 4FWDA 1XNQM 4QOZC 1YE9A 2ZTDA 4BBAA 2GNOA 2VQFM 1GO5A 1OAOC 2OOAA 2V1CA 2DHRA 1DGFA 2Z4RA 4WP2A 4BB9A 2HKJA 4R7GA 2XF3A 3TWMA 4JI4M 4G4QA 2UXCM 2WSCF 3AL0C 2KRKA 4BLCA 3U5ZB 2R4EA 5JI2E 2LXEA 1TR8A 3LMMA 1LV7A 1YLAA 2I7PA 2K9DA 1F4IA 1V34A 2M60A 2E5LM 1IN5A 1QVRA 3W0LB 4S12A 4WURA 3U61B 4IJFA 1XC8A 1IN8A 1KFVA 1QUSA 2LHCA 1VG5A 4B3RM 1NHWC 4AKHA 5FTMA 5C1BA 4CISA 4L6V6 3KS4A 4IJEA 1YUBA 4LF5M 3K2LA 3U6QA 1SXJE 2DAGA 1E32A 2RKOA 4MH0E 2K47A 3KOZE 3M0EA 1NO1A 3OTOM 1AIPC 1NV9A 3FRIA 3SFZA 3VDPA 4R71A 4QNRA 2DI0A 2R0IA 1VEJA 4RKUF 2LVOC 3HX3A 4B08A 5FTKA 3U6DA 5JI3E 4GKKM 1T3TA 1XHBA 2WSFF 4LJ7A 1DGBA 1R6BX 1XNRM 1SXJC 3HZJA 5KO3A 4LJAA 2XZUA 1KSFX 4REZA 2XEPA 4LF9M 1GJSA 1VQ1A 2Y21A 2C99A 4RF1A 4G6ZA 5EP1A 3GPYA 4DV0M 1VDDA 4FWHA 4LGMA 4AG6A 4JV5M 2QCUA 1IY2A 4IBFA 2XSZA 4GEWA 3FTEA 1Z5BA 3DOAA 2JZ0A 1XXHA 2R46A 1GL7A 2YR0A 3KW6A 2OQ4A 3LVWA 2G3QA 1J7KA 5EXTA 4P17A 4NXNM 4LFAM 1NNUC 4FCVA 2VF7A 1DO2A 3VFDA 4LZJA 3GQ5A 3GLHA 4GKJM 3J27B 2DHYA 3T38A 3ZCBB 2VDBB 4GRIA 2XGNA 1ZMVA 3HHYA 1QDTA 4JI5M 4DV7M 4GC5A 4KHPM 2F5QA 3B7ZA 1IY0A 5ITQA 2QBYA 2L4FA 5A2QS 3D8BA 3LCVB 3HJSA 1PJQA 1N75A 2DZLA 1WHCA 1JR3D 4PCZA 2F5SA 1AUAA 1N32M 2DAIA 2Q2EB 4A3VB 4DV2M 2D7EA 3CF6E 4CGYB 1IXRC 1G3IA 1DGGA 2Z4SA 4L4UA 2L2DA 1NSFA 2ZAOA 4GH9A 1I94M 1TTEA 1PM5A 1R7RA 1NVMA 1TH2A 2QPAA 1IXZA 4JI6M 2UU9M 1Y8GA 2DAMA 1QZEA 3LQQA 2KNZA 3HY5A 3M7GA 3R8FA 1SXJB 2YNMD 4QHSA 3HHWA 1V92A 4FVMA 3UGJA 1GVNA 1QDRA 4Z8XA 5FTJA 1X37A 2L09A 4XGIA 3SC3A 1R2ZA 5L8RF 3AOEA 2J7NA 1IN6A 2KEBA 4G4NA 2CV1A 3KFUG 3MJ5A 1OIZA 3KSJA 1JB0F 1WXQA 3FTCA 1HNWM 3C58A 1JQJC 2VIIA 2C98A 4D82A 3TQSA 3AKZA 3A45A 2DAEA 2WSEF 1YSYA 5KPTA 2DKLA 4NL4H 4G4OA 2HWJA 2RGOA 2FOIC 1TF0B 3K1JA 4JI0M 2K6BA 8CATA 3MMPA 3J7AS 3B7QA 3R9XB 2LWXA 3SAUA 2XZFA 1K82A 2DWLA 2EKFA 3FUTA 2JXNA 1XWIA 1Z5AA 3B74A 2YFQA 3HJQA 3C3EA 5EJCA 2X49A 2HAKA 5KQ8A 3NBIA 4LZZA 2DAKA 4FCTA 3W67A 4NSRA 1L1ZA 2FH0A 4G3OA 1HNXM 1KYIA 2LVAA 1OFIA 4KO8A 2JUJA 1L1TA 5EXSA 5ITRA 3GLFE 2ZTCA 1HQYE 1T43A 3D8LA 1IBMM 3SHFA 3VDUA 2R18A 3IG8A 4LF6M 5IREB 2I7NA 2GQFA 4B7GA 2O25A 3HU1A 4JI3M 1G59A 4FCWA 3FKEA 4AKGA 2CFOA 3K8ZA 2ERCA 1ORYB 4L8RC 1OIPA 1N77A 3I4YA 3CF0A 4JI1M 3GLIE 4B3MM 1DV0A 3AOGA 3GLGB 4QOSA 3E9SA 1NY6A 5FTLA 2EUCA 2CV2A 2VF8A 3TWLA 2O01F 1SXJA 1WR1B 3BXWA 2QENA 4LRTA 1ZMUA 3ZQJA 3FRHA 4LRSA 3UJNA 1Q3BA 3U6LA 5IWAM 3F92A 2L4EA 4DV5M 1NNJA 3DFZA 4LJ4A 1ZV1A 1MU5A 3L28A 2LH0A 1IXSB 4G4RA 1VEKA 2MGWA 4LFBM 2HHHM 4OW0A 2JY8A 5ITXA 1NJFA 2R45A 4HEOA 5ITYA 2BJWA 2DWZB 4OX9M 2KA6B 3UZUA 2LNHC 2QQ8A 3FUUA 3LW5F 3GRVA 2EA0A 4DR6M 3FTDA 4X66M 1G8PA 1PGYA 2XFTA 5FLXS 3FTFA 2DNAA 1G4AE 2J5YA 1JR3E 3ILKA 3B9PA 2R65A 3KDSE 4IBEA 1XB2B 4AI6A 3E46A 2MROB 3VKHA 4DR5M 3KVWA 4UN2B 3A46A 2DENA 5F3WA 4MGIE 1L2DA 4X65M 1EFUB 5EQTA 3SHGB 1WJ7A 3FD9A 3HU3A 5EP2A 3FYDA 4NRVA 3SARA 4LF8M 1D2NA 4QHTA 4AKIA 3GLFB 1D0KA 4X62M 2X4AA 3LVVA 3TPZA 4LFCM 2JY5A 4TUWA 4WW0A 3GLIB 2BJVA 4IBIA 3A42A 3HWSA 4F2LA 5EXPA 5KQDA 4NXMM 1W5TA 2C9CA 1TGUA 1VDLA 3PFIA 4JYAM 1P3QQ 2QSFX 2X8AA 1HNZM 2KW0A 2DZNB 2D7GA 3Q8GA 5H37D 2CP8A 4MM3B 3GP1A 1NY5A 3L27A 5BPVA 3U5ZA 3GPPA 1QANA 4DBGB 2ZAMA 3C9PA 2QP9X 4L15A 4PDGA 4AW4A 1PJTA 2EKKA 2KNVA 2R44A 2R62A 2H1RA 3U61A 4ITQA 2D7HA 1TDZA 1NJGA 1OAIA 2DZOB 1MX0A 2FNAA 2G5GX 4M9XA 3ZH9B 1QZMA 1IXSA 3M6AA 4B7HA 3VKGA 5EXXA 3L26A 1TDHA 3DZDA 3PVSA 3I01M 3GLGE 4D80A 5FTNA 1WGLA 4PD2A 1NV8A 1MJGM 2HL7A 1XXHE 2W82A 3EIEA 3KOXE 1C7YA 2BWBA 3MK6A 3TE6A 3KSXA 4CHTB 3U6EA 4NRWA 3L25A 2Y20A 4IBJA 3CF2A 2FS1A 2WZJA 3VK8A 3SYLA 1OFHA 3GLHE 4L16A 2Z8YM 2MH8A 3RFWA 2EJSA 3THGA 4IBBA 2MJ5B 1XMOM 1J5EM 1BVSA 1WIVA 3GPUA 4MGYE 4YHHM 4AZFA 4M9ZA 3GRYA 1IY1A 3GQ3A 1R4GA 2CHVA 1IN4A 3GLFA 4PT5A 5IT9S 4IBGA 4RNAA 3HHXA 4X64M 3CGWA 3U6OA 1PJSA 1ZQ9A 4M9SA 1XMQM 4GITA 4DR7M 2XH9A 4F1IA 2CUZA 3T15A 1DGHB 3PNVA 4DUYM 1IBKM 1Q3CA 4LY6A 2QZ4A 1I4WA 3K9OA 2JA2A 2JY6B 4LGYA 4D81A 3AV0A 2CHGA 5BR8M 2Y0QA 2XSZD 3WHKA 4JI7M 5EP3A 2O5RA 4NOOB 2JY7A 3GQ4A 3HGIA 1N78A 1T6OA 4RF0A 3I4VA 2L7IA 2JNHA 3NBXX
chains in the Genus database with same CATH topology
5KPRA 2L6OA 1FNNA 3RGSA 4IBKA 1HQCA 5E26A 1HR0M 2M5ZA 1N36M 4FWGA 3DA1A 4B3TM 1QQWA 4I8OA 3E4RA 1Z5CA 5ITUA 1HT1E 5DYIA 4FW9A 3AOEC 1E9RA 3KP1E 3CTWB 3JAMS 2XLJA 2HCBA 1QYRA 4FD2A 4NSOB 5E6JA 2KZSA 1XXHB 1GL6A 4XBOA 1DO0A 2CV0A 5C18A 2Z7JA 4JN6A 1TH3A 4B7FA 1JR3A 3FUVA 4IIWA 1QAQA 2CHQA 3GLHB 3U60B 2A5YB 4KLNA 2DWNA 2CEAA 2DXIA 1S3SA 4AQYM 4GC9A 3GPXA 5LMNM 3FUXA 5IZ7D 2ZBKB 1N33M 2QBYB 2CE7A 4YY3M 3KOYE 3U6MA 2FFJA 2C5RA 5ITTA 4M0DA 3AJIB 1DGHA 1L2CA 3SATA 3J2PB 2Y0TA 4JXJA 2UUAM 1W5SA 4HL4A 2F5OA 4EIWA 2L7HA 2KXEA 4DR3M 1J09A 4LJ8A 3FUWA 2V1UA 4DUZM 4LJ9A 2C9OA 1IN7A 3KS8A 3J7BA 4L78A 7CATA 2J7OA 1E94E 2UUCM 2KZUA 3L29A 4LF7M 1FJGM 3SBJA 1N34M 2KRUA 1H6UA 4OVZB 5ITXE 1NHGC 3T1YM 4QNMA 1L2BA 3L2AA 3ZC7B 3GLGA 3K92A 3IG5A 2P5TA 3J80S 2UUBM 4B3SM 1QAOA 4MGKE 4KODA 1PJIA 2F5PA 3I51A 3HKPA 2F4VM 2YQZA 3J81S 1OJLA 1G41A 2NQ8C 3KOWE 3KP0E 3WHLA 4DV3M 1IBLM 1K3WA 3AFHA 2F5NA 3H4MA 4JI8M 4LJ6A 1E9SA 4W5WA 4LJ5A 3U60A 5FSWA 5EP4A 4DV1M 2DWMA 3RGPA 4GHAA 3VLFB 3LQRA 2ZANA 3QAUA 4DR2M 1SXJD 1EE8A 2EO2A 3JR4A 4II7A 3KXEC 3W0FA 4LCBA 2VQEM 1QAMA 4ZPXA 4P16A 3U6CA 1HT2E 5GKNA 4R3DA 1TH4A 4GIPA 4I4LA 2C96A 4IBCA 4M0WA 3UK6A 3GO8A 5KPZA 3FYCA 1PJJA 3PNYA 3Q8XA 3PXGA 3SASA 4JI2M 4DV4M 4IBDA 4HLQA 4GMQA 3GLIA 3UMMA 2FE8A 2OPFA 3SMPA 3T1HM 4PDIA 3SAWA 2R4JA 1UM8A 3MHVC 2RGHA 1L8QA 4GHLA 2UXDM 3QWLA 4Z6YA 1GKIA 1GLNA 2Z3XA 4DV6M 1ZAEA 3A98B 5DNYA 3HU2A 4OVZA 3VK7A 3U6SA 4I5SA 1C1KA 2BNKA 2ZM6M 4LF4M 4I81A 4AG5A 1Z6TA 1IQPA 3GRRA 1Q39A 2DVWB 3TL4X 2G8LA 3U6PA 1IM2A 4DR4M 5LMUM 3SAVA 1K3XA 3RE8A 2V6ZM 4MB7A 4LG2A 2UXBM 2XFSA 3GRUA 5DYGA 1Z59A 3JR5A 4MGZE 3EIHA 3HHZA 4OU7A 3HJ8A 4K0KM 3SMSA 4MGHA 3NWLA 2AHMA 3TWKA 1R2YA 3BOSA 3SYKA 4DR1M 4FWDA 1XNQM 4QOZC 1YE9A 2VQFM 4BBAA 2V1CA 2DHRA 1DGFA 2Z4RA 4BB9A 2HKJA 4R7GA 2XF3A 3TWMA 4JI4M 4G4QA 2UXCM 3AL0C 2KRKA 4BLCA 3U5ZB 2R4EA 5JI2E 2LXEA 3LMMA 1LV7A 2I7PA 2M60A 2E5LM 1IN5A 1QVRA 3W0LB 4S12A 4WURA 3U61B 4IJFA 1XC8A 1IN8A 1KFVA 4B3RM 1NHWC 4AKHA 5FTMA 5C1BA 4CISA 3KS4A 4IJEA 1YUBA 4LF5M 3K2LA 3U6QA 1SXJE 2RKOA 1E32A 4MH0E 2K47A 3KOZE 3M0EA 3OTOM 3SFZA 3VDPA 4QNRA 4B08A 3U6DA 5FTKA 5JI3E 4GKKM 1T3TA 1XHBA 4LJ7A 1DGBA 1R6BX 1XNRM 1SXJC 5KO3A 2XZUA 4LJAA 4LF9M 1KSFX 4REZA 2XEPA 4AKGA 2Y21A 2C99A 4RF1A 4G6ZA 5EP1A 3GPYA 4DV0M 1VDDA 4FWHA 4LGMA 4AG6A 4JV5M 2QCUA 1IY2A 4IBFA 2XSZA 3FTEA 1Z5BA 3DOAA 1XXHA 2R46A 2YR0A 3KW6A 1GL7A 2OQ4A 3LVWA 1J7KA 5EXTA 4NXNM 4LFAM 1NNUC 4FCVA 1DO2A 3VFDA 4LZJA 3GQ5A 3GLHA 4GKJM 3J27B 3T38A 3ZCBB 4GRIA 2XGNA 3HHYA 4JI5M 4DV7M 4GC5A 4KHPM 2F5QA 1IY0A 5ITQA 2QBYA 5A2QS 3D8BA 3HJSA 1N75A 4PCZA 1JR3D 2F5SA 1N32M 2Q2EB 4A3VB 4DV2M 2D7EA 3CF6E 4CGYB 1IXRC 1G3IA 1DGGA 2Z4SA 4L4UA 1NSFA 2ZAOA 4GH9A 1I94M 1PM5A 1R7RA 1NVMA 1TH2A 2QPAA 1IXZA 4JI6M 2UU9M 3LQQA 3R8FA 3M7GA 1SXJB 2YNMD 4QHSA 3HHWA 4FVMA 3UGJA 1GVNA 5FTJA 4Z8XA 1X37A 2L09A 4XGIA 3SC3A 1R2ZA 3AOEA 2J7NA 1IN6A 2KEBA 4G4NA 2CV1A 3KFUG 3MJ5A 3KSJA 1HNWM 1WXQA 3FTCA 3C58A 1JQJC 2VIIA 2C98A 4D82A 3TQSA 3AKZA 3A45A 5KPTA 1YSYA 4NL4H 4G4OA 2RGOA 2FOIC 3K1JA 4JI0M 8CATA 3J7AS 3R9XB 2LWXA 3SAUA 2XZFA 1K82A 2DWLA 3FUTA 1XWIA 1Z5AA 2YFQA 3HJQA 5EJCA 2X49A 5KQ8A 3NBIA 4LZZA 4FCTA 4NSRA 1L1ZA 1HNXM 1KYIA 1OFIA 4KO8A 1L1TA 5EXSA 5ITRA 1HQYE 1IBMM 3D8LA 3SHFA 3VDUA 2R18A 3IG8A 4LF6M 5IREB 2I7NA 4B7GA 3HU1A 4JI3M 1G59A 4FCWA 3FKEA 2CFOA 3K8ZA 2ERCA 1ORYB 4L8RC 1N77A 3I4YA 3CF0A 4JI1M 4B3MM 3AOGA 3GLGB 4QOSA 3E9SA 1NY6A 5FTLA 2EUCA 2CV2A 3TWLA 1SXJA 2QENA 4LRTA 4LRSA 3UJNA 1Q3BA 3U6LA 5IWAM 4DV5M 1NNJA 3DFZA 4LJ4A 1MU5A 3L28A 2LH0A 1IXSB 4G4RA 4LFBM 2HHHM 4OW0A 5ITXA 1NJFA 2R45A 5ITYA 4OX9M 2BJWA 2DWZB 2KA6B 3UZUA 2LNHC 3FUUA 2EA0A 3GRVA 4DR6M 3FTDA 4X66M 1G8PA 2XFTA 5FLXS 3FTFA 1G4AE 3ILKA 3B9PA 2R65A 3KDSE 4IBEA 4AI6A 3VKHA 4DR5M 3KVWA 3A46A 5F3WA 4MGIE 1L2DA 4X65M 5EQTA 3SHGB 3FD9A 3HU3A 5EP2A 3FYDA 4NRVA 3SARA 4LF8M 1D2NA 4QHTA 4AKIA 3GLFB 4X62M 4TUWA 2X4AA 3LVVA 3TPZA 4LFCM 4WW0A 3GLIB 2BJVA 4IBIA 3A42A 3HWSA 5EXPA 5KQDA 4NXMM 1W5TA 2C9CA 1TGUA 3PFIA 4JYAM 2X8AA 1HNZM 2KW0A 2DZNB 2D7GA 3GP1A 5H37D 4MM3B 1NY5A 3L27A 5BPVA 3U5ZA 3GPPA 1QANA 2ZAMA 2QP9X 4L15A 4PDGA 4AW4A 2R62A 2H1RA 3U61A 4ITQA 2D7HA 1TDZA 1NJGA 2DZOB 2G5GX 1MX0A 2FNAA 4M9XA 3ZH9B 1QZMA 3M6AA 3VKGA 4B7HA 5EXXA 3L26A 1TDHA 3DZDA 3PVSA 4D80A 5FTNA 4PD2A 2HL7A 2W82A 3EIEA 3KOXE 4CHTB 3MK6A 3TE6A 3KSXA 3U6EA 4NRWA 3L25A 2Y20A 4IBJA 3CF2A 3VK8A 3SYLA 1OFHA 4L16A 3RFWA 3THGA 4IBBA 1XMOM 1J5EM 3GPUA 4MGYE 4YHHM 4AZFA 4M9ZA 3GRYA 1IY1A 3GQ3A 2CHVA 1IN4A 3GLFA 4PT5A 5IT9S 4IBGA 4RNAA 3HHXA 4X64M 3U6OA 1ZQ9A 4M9SA 4DR7M 1XMQM 4GITA 2XH9A 2CUZA 3T15A 1DGHB 3PNVA 4DUYM 1IBKM 1Q3CA 4LY6A 2QZ4A 1I4WA 4LGYA 2JA2A 4D81A 5BR8M 3AV0A 2CHGA 2Y0QA 2XSZD 3WHKA 4JI7M 5EP3A 2O5RA 4NOOB 3GQ4A 3HGIA 1N78A 4RF0A 3I4VA 2L7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  4I5S A;  2L7H A;  2Y21 A;  2Y20 A;  2L7I A;  2Y0Q A; 
#chains in the Genus database with same CATH topology
 5KPR A;  1GJT A;  1R5L A;  1FNN A;  2L6O A;  3LCU A;  3RGS A;  4IBK A;  2B3T A;  1HQC A;  5E26 A;  1HR0 M;  2KDL A;  2LHG A;  2M5Z A;  1N36 M;  4FWG A;  2CWB A;  3DA1 A;  4B3T M;  1QQW A;  4I8O A;  3E4R A;  1Z5C A;  3H4J A;  3T6P A;  5ITU A;  1HT1 E;  5DYI A;  4FW9 A;  3AOE C;  1E9R A;  3KP1 E;  3CTW B;  3JAM S;  2XLJ A;  2HCB A;  1QYR A;  4FD2 A;  4NSO B;  5E6J A;  2KZS A;  1XXH B;  1GL6 A;  1HJP A;  4CJ6 A;  4XBO A;  1DO0 A;  2CV0 A;  5C18 A;  1G71 A;  2Z7J A;  4JN6 A;  3I04 M;  1D0L A;  1TH3 A;  4Y28 F;  1Q02 A;  4B7F A;  1JR3 A;  3FUV A;  4IIW A;  1PRB A;  3IEC A;  2KHH A;  2QNJ A;  1QAQ A;  2CHQ A;  3GLH B;  3U60 B;  2QHO B;  2A5Y B;  4KLN A;  2DWN A;  2CEA A;  2DXI A;  4NC6 A;  2JWS A;  1S3S A;  2K0B X;  4AQY M;  4GC9 A;  3K9P A;  3GPX A;  5LMN M;  3FUX A;  5IZ7 D;  2ZBK B;  1N33 M;  2QBY B;  3B7N A;  2CE7 A;  4YY3 M;  2LBC A;  3KOY E;  1OKS A;  3U6M A;  2FFJ A;  2C5R A;  5ITT A;  4M0D A;  3AJI B;  1DGH A;  1L2C A;  3SAT A;  3J2P B;  2Y0T A;  4JXJ A;  2UUA M;  1W5S A;  4HL4 A;  2F5O A;  4EIW A;  2L7H A;  2KXE A;  4DR3 M;  1J09 A;  4LJ8 A;  3FUW A;  2V1U A;  4DUZ M;  4LJ9 A;  2H5X A;  2C9O A;  1IN7 A;  4Q7J A;  3KS8 A;  3J7B A;  4L78 A;  7CAT A;  2J7O A;  1E94 E;  2UUC M;  3C3D A;  2KZU A;  3L29 A;  4LF7 M;  1FJG M;  3V76 A;  3SBJ A;  1N34 M;  2KRU A;  1H6U A;  4OVZ B;  5ITX E;  1NHG C;  3T1Y M;  4QNM A;  1L2B A;  1EIJ A;  1WGN A;  3E21 A;  4KT0 F;  3L2A A;  3ZC7 B;  3GLG A;  3K92 A;  1RU3 A;  3IG5 A;  2P5T A;  3J80 S;  2UUB M;  4B3S M;  1QAO A;  4MGK E;  4KOD A;  1OTR A;  1PJI A;  2F5P A;  3I51 A;  3HKP A;  2F4V M;  2YQZ A;  3J81 S;  1G41 A;  1OJL A;  2NQ8 C;  3KOW E;  3KP0 E;  3WHL A;  4DV3 M;  3QYE A;  1IBL M;  2APL A;  1K3W A;  3AFH A;  2F5N A;  3H4M A;  2JP7 A;  4LJ6 A;  4JI8 M;  1E9S A;  4W5W A;  4LJ5 A;  3U60 A;  5FSW A;  1GAB A;  5EP4 A;  2JZ1 A;  4DV1 M;  2DWM A;  3RGP A;  4GHA A;  3VLF B;  2LVN C;  2ZAN A;  3LQR A;  3QAU A;  4DR2 M;  1SXJ D;  2MR9 A;  1EE8 A;  2EO2 A;  3JR4 A;  4II7 A;  3KXE C;  3W0F A;  4LCB A;  2VQE M;  1QAM A;  4ZPX A;  4P16 A;  1D0M A;  1HT2 E;  5GKN A;  5DFL A;  4R3D A;  3U6C A;  4CIZ A;  1TH4 A;  4GIP A;  4I4L A;  2C96 A;  4IBC A;  4M0W A;  3UK6 A;  3GO8 A;  2BWE A;  1A5T A;  5KPZ A;  1CUK A;  2LVQ D;  3FYC A;  4ANR A;  3IHP A;  3PNY A;  1PJJ A;  1IFY A;  2LVP C;  3Q8X A;  3PXG A;  3SAS A;  4JI2 M;  4XK8 F;  4DV4 M;  3B89 A;  4IBD A;  4HLQ A;  4GMQ A;  3GLI A;  3UMM A;  2FE8 A;  2OPF A;  3SMP A;  3T1H M;  4PDI A;  3SAW A;  2R4J A;  1UM8 A;  2CRU A;  3MHV C;  2RGH A;  1L8Q A;  4GHL A;  2UXD M;  3QWL A;  4Z6Y A;  1GKI A;  1GLN A;  2Z3X A;  4DV6 M;  1QUT A;  1ZAE A;  2R6F A;  3A98 B;  2KNA A;  3HU2 A;  5DNY A;  4OVZ A;  3W68 A;  3U6S A;  3VK7 A;  2LTU A;  4I5S A;  1C1K A;  2BNK A;  2ZM6 M;  1V33 A;  4LF4 M;  4I81 A;  4AG5 A;  2RRU A;  1Z6T A;  1SG9 A;  1IQP A;  1ZMW A;  1LTM A;  3GRR A;  1Q39 A;  2DVW B;  3TL4 X;  2G8L A;  3U6P A;  1IM2 A;  4DR4 M;  5LMU M;  2N35 A;  3SAV A;  1K3X A;  3RE8 A;  2V6Z M;  4MB7 A;  4LG2 A;  2UXB M;  1UFZ A;  1MN3 A;  2XFS A;  3GRU A;  5DYG A;  1Z59 A;  3JR5 A;  4MGZ E;  1VEG A;  3EIH A;  1OQY A;  2OO9 A;  3HHZ A;  4OU7 A;  3HJ8 A;  4K0K M;  3SMS A;  4MGH A;  3FE3 A;  3NWL A;  2AHM A;  3BBZ A;  3TWK A;  2OOB A;  1R2Y A;  3BOS A;  3QYB A;  3SYK A;  4DR1 M;  4FWD A;  1XNQ M;  4QOZ C;  1YE9 A;  2ZTD A;  4BBA A;  2GNO A;  2VQF M;  1GO5 A;  1OAO C;  2OOA A;  2V1C A;  2DHR A;  1DGF A;  2Z4R A;  4WP2 A;  4BB9 A;  2HKJ A;  4R7G A;  2XF3 A;  3TWM A;  4JI4 M;  4G4Q A;  2UXC M;  2WSC F;  3AL0 C;  2KRK A;  4BLC A;  3U5Z B;  2R4E A;  5JI2 E;  2LXE A;  1TR8 A;  3LMM A;  1LV7 A;  1YLA A;  2I7P A;  2K9D A;  1F4I A;  1V34 A;  2M60 A;  2E5L M;  1IN5 A;  1QVR A;  3W0L B;  4S12 A;  4WUR A;  3U61 B;  4IJF A;  1XC8 A;  1IN8 A;  1KFV A;  1QUS A;  2LHC A;  1VG5 A;  4B3R M;  1NHW C;  4AKH A;  5FTM A;  5C1B A;  4CIS A;  4L6V 6;  3KS4 A;  4IJE A;  1YUB A;  4LF5 M;  3K2L A;  3U6Q A;  1SXJ E;  2DAG A;  1E32 A;  2RKO A;  4MH0 E;  2K47 A;  3KOZ E;  3M0E A;  1NO1 A;  3OTO M;  1AIP C;  1NV9 A;  3FRI A;  3SFZ A;  3VDP A;  4R71 A;  4QNR A;  2DI0 A;  2R0I A;  1VEJ A;  4RKU F;  2LVO C;  3HX3 A;  4B08 A;  5FTK A;  3U6D A;  5JI3 E;  4GKK M;  1T3T A;  1XHB A;  2WSF F;  4LJ7 A;  1DGB A;  1R6B X;  1XNR M;  1SXJ C;  3HZJ A;  5KO3 A;  4LJA A;  2XZU A;  1KSF X;  4REZ A;  2XEP A;  4LF9 M;  1GJS A;  1VQ1 A;  2Y21 A;  2C99 A;  4RF1 A;  4G6Z A;  5EP1 A;  3GPY A;  4DV0 M;  1VDD A;  4FWH A;  4LGM A;  4AG6 A;  4JV5 M;  2QCU A;  1IY2 A;  4IBF A;  2XSZ A;  4GEW A;  3FTE A;  1Z5B A;  3DOA A;  2JZ0 A;  1XXH A;  2R46 A;  1GL7 A;  2YR0 A;  3KW6 A;  2OQ4 A;  3LVW A;  2G3Q A;  1J7K A;  5EXT A;  4P17 A;  4NXN M;  4LFA M;  1NNU C;  4FCV A;  2VF7 A;  1DO2 A;  3VFD A;  4LZJ A;  3GQ5 A;  3GLH A;  4GKJ M;  3J27 B;  2DHY A;  3T38 A;  3ZCB B;  2VDB B;  4GRI A;  2XGN A;  1ZMV A;  3HHY A;  1QDT A;  4JI5 M;  4DV7 M;  4GC5 A;  4KHP M;  2F5Q A;  3B7Z A;  1IY0 A;  5ITQ A;  2QBY A;  2L4F A;  5A2Q S;  3D8B A;  3LCV B;  3HJS A;  1PJQ A;  1N75 A;  2DZL A;  1WHC A;  1JR3 D;  4PCZ A;  2F5S A;  1AUA A;  1N32 M;  2DAI A;  2Q2E B;  4A3V B;  4DV2 M;  2D7E A;  3CF6 E;  4CGY B;  1IXR C;  1G3I A;  1DGG A;  2Z4S A;  4L4U A;  2L2D A;  1NSF A;  2ZAO A;  4GH9 A;  1I94 M;  1TTE A;  1PM5 A;  1R7R A;  1NVM A;  1TH2 A;  2QPA A;  1IXZ A;  4JI6 M;  2UU9 M;  1Y8G A;  2DAM A;  1QZE A;  3LQQ A;  2KNZ A;  3HY5 A;  3M7G A;  3R8F A;  1SXJ B;  2YNM D;  4QHS A;  3HHW A;  1V92 A;  4FVM A;  3UGJ A;  1GVN A;  1QDR A;  4Z8X A;  5FTJ A;  1X37 A;  2L09 A;  4XGI A;  3SC3 A;  1R2Z A;  5L8R F;  3AOE A;  2J7N A;  1IN6 A;  2KEB A;  4G4N A;  2CV1 A;  3KFU G;  3MJ5 A;  1OIZ A;  3KSJ A;  1JB0 F;  1WXQ A;  3FTC A;  1HNW M;  3C58 A;  1JQJ C;  2VII A;  2C98 A;  4D82 A;  3TQS A;  3AKZ A;  3A45 A;  2DAE A;  2WSE F;  1YSY A;  5KPT A;  2DKL A;  4NL4 H;  4G4O A;  2HWJ A;  2RGO A;  2FOI C;  1TF0 B;  3K1J A;  4JI0 M;  2K6B A;  8CAT A;  3MMP A;  3J7A S;  3B7Q A;  3R9X B;  2LWX A;  3SAU A;  2XZF A;  1K82 A;  2DWL A;  2EKF A;  3FUT A;  2JXN A;  1XWI A;  1Z5A A;  3B74 A;  2YFQ A;  3HJQ A;  3C3E A;  5EJC A;  2X49 A;  2HAK A;  5KQ8 A;  3NBI A;  4LZZ A;  2DAK A;  4FCT A;  3W67 A;  4NSR A;  1L1Z A;  2FH0 A;  4G3O A;  1HNX M;  1KYI A;  2LVA A;  1OFI A;  4KO8 A;  2JUJ A;  1L1T A;  5EXS A;  5ITR A;  3GLF E;  2ZTC A;  1HQY E;  1T43 A;  3D8L A;  1IBM M;  3SHF A;  3VDU A;  2R18 A;  3IG8 A;  4LF6 M;  5IRE B;  2I7N A;  2GQF A;  4B7G A;  2O25 A;  3HU1 A;  4JI3 M;  1G59 A;  4FCW A;  3FKE A;  4AKG A;  2CFO A;  3K8Z A;  2ERC A;  1ORY B;  4L8R C;  1OIP A;  1N77 A;  3I4Y A;  3CF0 A;  4JI1 M;  3GLI E;  4B3M M;  1DV0 A;  3AOG A;  3GLG B;  4QOS A;  3E9S A;  1NY6 A;  5FTL A;  2EUC A;  2CV2 A;  2VF8 A;  3TWL A;  2O01 F;  1SXJ A;  1WR1 B;  3BXW A;  2QEN A;  4LRT A;  1ZMU A;  3ZQJ A;  3FRH A;  4LRS A;  3UJN A;  1Q3B A;  3U6L A;  5IWA M;  3F92 A;  2L4E A;  4DV5 M;  1NNJ A;  3DFZ A;  4LJ4 A;  1ZV1 A;  1MU5 A;  3L28 A;  2LH0 A;  1IXS B;  4G4R A;  1VEK A;  2MGW A;  4LFB M;  2HHH M;  4OW0 A;  2JY8 A;  5ITX A;  1NJF A;  2R45 A;  4HEO A;  5ITY A;  2BJW A;  2DWZ B;  4OX9 M;  2KA6 B;  3UZU A;  2LNH C;  2QQ8 A;  3FUU A;  3LW5 F;  3GRV A;  2EA0 A;  4DR6 M;  3FTD A;  4X66 M;  1G8P A;  1PGY A;  2XFT A;  5FLX S;  3FTF A;  2DNA A;  1G4A E;  2J5Y A;  1JR3 E;  3ILK A;  3B9P A;  2R65 A;  3KDS E;  4IBE A;  1XB2 B;  4AI6 A;  3E46 A;  2MRO B;  3VKH A;  4DR5 M;  3KVW A;  4UN2 B;  3A46 A;  2DEN A;  5F3W A;  4MGI E;  1L2D A;  4X65 M;  1EFU B;  5EQT A;  3SHG B;  1WJ7 A;  3FD9 A;  3HU3 A;  5EP2 A;  3FYD A;  4NRV A;  3SAR A;  4LF8 M;  1D2N A;  4QHT A;  4AKI A;  3GLF B;  1D0K A;  4X62 M;  2X4A A;  3LVV A;  3TPZ A;  4LFC M;  2JY5 A;  4TUW A;  4WW0 A;  3GLI B;  2BJV A;  4IBI A;  3A42 A;  3HWS A;  4F2L A;  5EXP A;  5KQD A;  4NXM M;  1W5T A;  2C9C A;  1TGU A;  1VDL A;  3PFI A;  4JYA M;  1P3Q Q;  2QSF X;  2X8A A;  1HNZ M;  2KW0 A;  2DZN B;  2D7G A;  3Q8G A;  5H37 D;  2CP8 A;  4MM3 B;  3GP1 A;  1NY5 A;  3L27 A;  5BPV A;  3U5Z A;  3GPP A;  1QAN A;  4DBG B;  2ZAM A;  3C9P A;  2QP9 X;  4L15 A;  4PDG A;  4AW4 A;  1PJT A;  2EKK A;  2KNV A;  2R44 A;  2R62 A;  2H1R A;  3U61 A;  4ITQ A;  2D7H A;  1TDZ A;  1NJG A;  1OAI A;  2DZO B;  1MX0 A;  2FNA A;  2G5G X;  4M9X A;  3ZH9 B;  1QZM A;  1IXS A;  3M6A A;  4B7H A;  3VKG A;  5EXX A;  3L26 A;  1TDH A;  3DZD A;  3PVS A;  3I01 M;  3GLG E;  4D80 A;  5FTN A;  1WGL A;  4PD2 A;  1NV8 A;  1MJG M;  2HL7 A;  1XXH E;  2W82 A;  3EIE A;  3KOX E;  1C7Y A;  2BWB A;  3MK6 A;  3TE6 A;  3KSX A;  4CHT B;  3U6E A;  4NRW A;  3L25 A;  2Y20 A;  4IBJ A;  3CF2 A;  2FS1 A;  2WZJ A;  3VK8 A;  3SYL A;  1OFH A;  3GLH E;  4L16 A;  2Z8Y M;  2MH8 A;  3RFW A;  2EJS A;  3THG A;  4IBB A;  2MJ5 B;  1XMO M;  1J5E M;  1BVS A;  1WIV A;  3GPU A;  4MGY E;  4YHH M;  4AZF A;  4M9Z A;  3GRY A;  1IY1 A;  3GQ3 A;  1R4G A;  2CHV A;  1IN4 A;  3GLF A;  4PT5 A;  5IT9 S;  4IBG A;  4RNA A;  3HHX A;  4X64 M;  3CGW A;  3U6O A;  1PJS A;  1ZQ9 A;  4M9S A;  1XMQ M;  4GIT A;  4DR7 M;  2XH9 A;  4F1I A;  2CUZ A;  3T15 A;  1DGH B;  3PNV A;  4DUY M;  1IBK M;  1Q3C A;  4LY6 A;  2QZ4 A;  1I4W A;  3K9O A;  2JA2 A;  2JY6 B;  4LGY A;  4D81 A;  3AV0 A;  2CHG A;  5BR8 M;  2Y0Q A;  2XSZ D;  3WHK A;  4JI7 M;  5EP3 A;  2O5R A;  4NOO B;  2JY7 A;  3GQ4 A;  3HGI A;  1N78 A;  1T6O A;  4RF0 A;  3I4V A;  2L7I A;  2JNH A;  3NBX X; 
#chains in the Genus database with same CATH homology
 5KPR A;  2L6O A;  1FNN A;  3RGS A;  4IBK A;  1HQC A;  5E26 A;  1HR0 M;  2M5Z A;  1N36 M;  4FWG A;  3DA1 A;  4B3T M;  1QQW A;  4I8O A;  3E4R A;  1Z5C A;  5ITU A;  1HT1 E;  5DYI A;  4FW9 A;  3AOE C;  1E9R A;  3KP1 E;  3CTW B;  3JAM S;  2XLJ A;  2HCB A;  1QYR A;  4FD2 A;  4NSO B;  5E6J A;  2KZS A;  1XXH B;  1GL6 A;  4XBO A;  1DO0 A;  2CV0 A;  5C18 A;  2Z7J A;  4JN6 A;  1TH3 A;  4B7F A;  1JR3 A;  3FUV A;  4IIW A;  1QAQ A;  2CHQ A;  3GLH B;  3U60 B;  2A5Y B;  4KLN A;  2DWN A;  2CEA A;  2DXI A;  1S3S A;  4AQY M;  4GC9 A;  3GPX A;  5LMN M;  3FUX A;  5IZ7 D;  2ZBK B;  1N33 M;  2QBY B;  2CE7 A;  4YY3 M;  3KOY E;  3U6M A;  2FFJ A;  2C5R A;  5ITT A;  4M0D A;  3AJI B;  1DGH A;  1L2C A;  3SAT A;  3J2P B;  2Y0T A;  4JXJ A;  2UUA M;  1W5S A;  4HL4 A;  2F5O A;  4EIW A;  2L7H A;  2KXE A;  4DR3 M;  1J09 A;  4LJ8 A;  3FUW A;  2V1U A;  4DUZ M;  4LJ9 A;  2C9O A;  1IN7 A;  3KS8 A;  3J7B A;  4L78 A;  7CAT A;  2J7O A;  1E94 E;  2UUC M;  2KZU A;  3L29 A;  4LF7 M;  1FJG M;  3SBJ A;  1N34 M;  2KRU A;  1H6U A;  4OVZ B;  5ITX E;  1NHG C;  3T1Y M;  4QNM A;  1L2B A;  3L2A A;  3ZC7 B;  3GLG A;  3K92 A;  3IG5 A;  2P5T A;  3J80 S;  2UUB M;  4B3S M;  1QAO A;  4MGK E;  4KOD A;  1PJI A;  2F5P A;  3I51 A;  3HKP A;  2F4V M;  2YQZ A;  3J81 S;  1OJL A;  1G41 A;  2NQ8 C;  3KOW E;  3KP0 E;  3WHL A;  4DV3 M;  1IBL M;  1K3W A;  3AFH A;  2F5N A;  3H4M A;  4JI8 M;  4LJ6 A;  1E9S A;  4W5W A;  4LJ5 A;  3U60 A;  5FSW A;  5EP4 A;  4DV1 M;  2DWM A;  3RGP A;  4GHA A;  3VLF B;  3LQR A;  2ZAN A;  3QAU A;  4DR2 M;  1SXJ D;  1EE8 A;  2EO2 A;  3JR4 A;  4II7 A;  3KXE C;  3W0F A;  4LCB A;  2VQE M;  1QAM A;  4ZPX A;  4P16 A;  3U6C A;  1HT2 E;  5GKN A;  4R3D A;  1TH4 A;  4GIP A;  4I4L A;  2C96 A;  4IBC A;  4M0W A;  3UK6 A;  3GO8 A;  5KPZ A;  3FYC A;  1PJJ A;  3PNY A;  3Q8X A;  3PXG A;  3SAS A;  4JI2 M;  4DV4 M;  4IBD A;  4HLQ A;  4GMQ A;  3GLI A;  3UMM A;  2FE8 A;  2OPF A;  3SMP A;  3T1H M;  4PDI A;  3SAW A;  2R4J A;  1UM8 A;  3MHV C;  2RGH A;  1L8Q A;  4GHL A;  2UXD M;  3QWL A;  4Z6Y A;  1GKI A;  1GLN A;  2Z3X A;  4DV6 M;  1ZAE A;  3A98 B;  5DNY A;  3HU2 A;  4OVZ A;  3VK7 A;  3U6S A;  4I5S A;  1C1K A;  2BNK A;  2ZM6 M;  4LF4 M;  4I81 A;  4AG5 A;  1Z6T A;  1IQP A;  3GRR A;  1Q39 A;  2DVW B;  3TL4 X;  2G8L A;  3U6P A;  1IM2 A;  4DR4 M;  5LMU M;  3SAV A;  1K3X A;  3RE8 A;  2V6Z M;  4MB7 A;  4LG2 A;  2UXB M;  2XFS A;  3GRU A;  5DYG A;  1Z59 A;  3JR5 A;  4MGZ E;  3EIH A;  3HHZ A;  4OU7 A;  3HJ8 A;  4K0K M;  3SMS A;  4MGH A;  3NWL A;  2AHM A;  3TWK A;  1R2Y A;  3BOS A;  3SYK A;  4DR1 M;  4FWD A;  1XNQ M;  4QOZ C;  1YE9 A;  2VQF M;  4BBA A;  2V1C A;  2DHR A;  1DGF A;  2Z4R A;  4BB9 A;  2HKJ A;  4R7G A;  2XF3 A;  3TWM A;  4JI4 M;  4G4Q A;  2UXC M;  3AL0 C;  2KRK A;  4BLC A;  3U5Z B;  2R4E A;  5JI2 E;  2LXE A;  3LMM A;  1LV7 A;  2I7P A;  2M60 A;  2E5L M;  1IN5 A;  1QVR A;  3W0L B;  4S12 A;  4WUR A;  3U61 B;  4IJF A;  1XC8 A;  1IN8 A;  1KFV A;  4B3R M;  1NHW C;  4AKH A;  5FTM A;  5C1B A;  4CIS A;  3KS4 A;  4IJE A;  1YUB A;  4LF5 M;  3K2L A;  3U6Q A;  1SXJ E;  2RKO A;  1E32 A;  4MH0 E;  2K47 A;  3KOZ E;  3M0E A;  3OTO M;  3SFZ A;  3VDP A;  4QNR A;  4B08 A;  3U6D A;  5FTK A;  5JI3 E;  4GKK M;  1T3T A;  1XHB A;  4LJ7 A;  1DGB A;  1R6B X;  1XNR M;  1SXJ C;  5KO3 A;  2XZU A;  4LJA A;  4LF9 M;  1KSF X;  4REZ A;  2XEP A;  4AKG A;  2Y21 A;  2C99 A;  4RF1 A;  4G6Z A;  5EP1 A;  3GPY A;  4DV0 M;  1VDD A;  4FWH A;  4LGM A;  4AG6 A;  4JV5 M;  2QCU A;  1IY2 A;  4IBF A;  2XSZ A;  3FTE A;  1Z5B A;  3DOA A;  1XXH A;  2R46 A;  2YR0 A;  3KW6 A;  1GL7 A;  2OQ4 A;  3LVW A;  1J7K A;  5EXT A;  4NXN M;  4LFA M;  1NNU C;  4FCV A;  1DO2 A;  3VFD A;  4LZJ A;  3GQ5 A;  3GLH A;  4GKJ M;  3J27 B;  3T38 A;  3ZCB B;  4GRI A;  2XGN A;  3HHY A;  4JI5 M;  4DV7 M;  4GC5 A;  4KHP M;  2F5Q A;  1IY0 A;  5ITQ A;  2QBY A;  5A2Q S;  3D8B A;  3HJS A;  1N75 A;  4PCZ A;  1JR3 D;  2F5S A;  1N32 M;  2Q2E B;  4A3V B;  4DV2 M;  2D7E A;  3CF6 E;  4CGY B;  1IXR C;  1G3I A;  1DGG A;  2Z4S A;  4L4U A;  1NSF A;  2ZAO A;  4GH9 A;  1I94 M;  1PM5 A;  1R7R A;  1NVM A;  1TH2 A;  2QPA A;  1IXZ A;  4JI6 M;  2UU9 M;  3LQQ A;  3R8F A;  3M7G A;  1SXJ B;  2YNM D;  4QHS A;  3HHW A;  4FVM A;  3UGJ A;  1GVN A;  5FTJ A;  4Z8X A;  1X37 A;  2L09 A;  4XGI A;  3SC3 A;  1R2Z A;  3AOE A;  2J7N A;  1IN6 A;  2KEB A;  4G4N A;  2CV1 A;  3KFU G;  3MJ5 A;  3KSJ A;  1HNW M;  1WXQ A;  3FTC A;  3C58 A;  1JQJ C;  2VII A;  2C98 A;  4D82 A;  3TQS A;  3AKZ A;  3A45 A;  5KPT A;  1YSY A;  4NL4 H;  4G4O A;  2RGO A;  2FOI C;  3K1J A;  4JI0 M;  8CAT A;  3J7A S;  3R9X B;  2LWX A;  3SAU A;  2XZF A;  1K82 A;  2DWL A;  3FUT A;  1XWI A;  1Z5A A;  2YFQ A;  3HJQ A;  5EJC A;  2X49 A;  5KQ8 A;  3NBI A;  4LZZ A;  4FCT A;  4NSR A;  1L1Z A;  1HNX M;  1KYI A;  1OFI A;  4KO8 A;  1L1T A;  5EXS A;  5ITR A;  1HQY E;  1IBM M;  3D8L A;  3SHF A;  3VDU A;  2R18 A;  3IG8 A;  4LF6 M;  5IRE B;  2I7N A;  4B7G A;  3HU1 A;  4JI3 M;  1G59 A;  4FCW A;  3FKE A;  2CFO A;  3K8Z A;  2ERC A;  1ORY B;  4L8R C;  1N77 A;  3I4Y A;  3CF0 A;  4JI1 M;  4B3M M;  3AOG A;  3GLG B;  4QOS A;  3E9S A;  1NY6 A;  5FTL A;  2EUC A;  2CV2 A;  3TWL A;  1SXJ A;  2QEN A;  4LRT A;  4LRS A;  3UJN A;  1Q3B A;  3U6L A;  5IWA M;  4DV5 M;  1NNJ A;  3DFZ A;  4LJ4 A;  1MU5 A;  3L28 A;  2LH0 A;  1IXS B;  4G4R A;  4LFB M;  2HHH M;  4OW0 A;  5ITX A;  1NJF A;  2R45 A;  5ITY A;  4OX9 M;  2BJW A;  2DWZ B;  2KA6 B;  3UZU A;  2LNH C;  3FUU A;  2EA0 A;  3GRV A;  4DR6 M;  3FTD A;  4X66 M;  1G8P A;  2XFT A;  5FLX S;  3FTF A;  1G4A E;  3ILK A;  3B9P A;  2R65 A;  3KDS E;  4IBE A;  4AI6 A;  3VKH A;  4DR5 M;  3KVW A;  3A46 A;  5F3W A;  4MGI E;  1L2D A;  4X65 M;  5EQT A;  3SHG B;  3FD9 A;  3HU3 A;  5EP2 A;  3FYD A;  4NRV A;  3SAR A;  4LF8 M;  1D2N A;  4QHT A;  4AKI A;  3GLF B;  4X62 M;  4TUW A;  2X4A A;  3LVV A;  3TPZ A;  4LFC M;  4WW0 A;  3GLI B;  2BJV A;  4IBI A;  3A42 A;  3HWS A;  5EXP A;  5KQD A;  4NXM M;  1W5T A;  2C9C A;  1TGU A;  3PFI A;  4JYA M;  2X8A A;  1HNZ M;  2KW0 A;  2DZN B;  2D7G A;  3GP1 A;  5H37 D;  4MM3 B;  1NY5 A;  3L27 A;  5BPV A;  3U5Z A;  3GPP A;  1QAN A;  2ZAM A;  2QP9 X;  4L15 A;  4PDG A;  4AW4 A;  2R62 A;  2H1R A;  3U61 A;  4ITQ A;  2D7H A;  1TDZ A;  1NJG A;  2DZO B;  2G5G X;  1MX0 A;  2FNA A;  4M9X A;  3ZH9 B;  1QZM A;  3M6A A;  3VKG A;  4B7H A;  5EXX A;  3L26 A;  1TDH A;  3DZD A;  3PVS A;  4D80 A;  5FTN A;  4PD2 A;  2HL7 A;  2W82 A;  3EIE A;  3KOX E;  4CHT B;  3MK6 A;  3TE6 A;  3KSX A;  3U6E A;  4NRW A;  3L25 A;  2Y20 A;  4IBJ A;  3CF2 A;  3VK8 A;  3SYL A;  1OFH A;  4L16 A;  3RFW A;  3THG A;  4IBB A;  1XMO M;  1J5E M;  3GPU A;  4MGY E;  4YHH M;  4AZF A;  4M9Z A;  3GRY A;  1IY1 A;  3GQ3 A;  2CHV A;  1IN4 A;  3GLF A;  4PT5 A;  5IT9 S;  4IBG A;  4RNA A;  3HHX A;  4X64 M;  3U6O A;  1ZQ9 A;  4M9S A;  4DR7 M;  1XMQ M;  4GIT A;  2XH9 A;  2CUZ A;  3T15 A;  1DGH B;  3PNV A;  4DUY M;  1IBK M;  1Q3C A;  4LY6 A;  2QZ4 A;  1I4W A;  4LGY A;  2JA2 A;  4D81 A;  5BR8 M;  3AV0 A;  2CHG A;  2Y0Q A;  2XSZ D;  3WHK A;  4JI7 M;  5EP3 A;  2O5R A;  4NOO B;  3GQ4 A;  3HGI A;  1N78 A;  4RF0 A;  3I4V A;  2L7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...