2Z3XA

Structure of a protein-dna complex essential for dna protection in spore of bacillus species
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*GP*GP*GP*A)-3'
publication title Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 19
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00269 SASP Small, acid-soluble spore proteins, alpha/beta type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.910 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z3xA00
2Z3XA
chains in the Genus database with same CATH superfamily
5LMNM 3RGSA 3B7NA 1FJGM 1DGFA 2HAKA 1YE9A 2ZTDA 1C1KA 3KP1E 4AQYM 4JI8M 2D7HA 2V1CA 4GMQA 3GPXA 4G4OA 2YQZA 4G4NA 4MGKE 3A45A 3PNVA 4IBJA 2F5SA 3VFDA 4D82A 1DO2A 1PGYA 1CUKA 4MGZE 3VKGA 2WSCF 4DBGB 3A42A 1PRBA 1Z5BA 2LTUA 4RF1A 4DUZM 4B3SM 1PJSA 4IBCA 2R45A 5DYIA 4FWDA 3T15A 1OAIA 1XXHB 3HWSA 4MM3B 3I51A 4GEWA 1WIVA 2ZM6M 3U6DA 4X65M 1PJJA 2QBYA 2R18A 2O01F 2Z3XA 8CATA 4B3RM 3KS4A 5GKNA 2O25A 5KQDA 1GL6A 1SXJC 2QHOB 4PCZA 1MX0A 2CEAA 2UUCM 4GKKM 2OPFA 3WHKA 3E4RA 1TH4A 1YLAA 3FUUA 1PJTA 2LVPC 3LQRA 4AG5A 3U6CA 1WGNA 3IG5A 3RGPA 3GPYA 2YNMD 5KQ8A 2C5RA 3JR5A 2BJWA 4JYAM 2VQFM 1TF0B 1OIZA 1KSFX 1QANA 2Z4SA 3C3DA 1Z5AA 2MH8A 3NBIA 4MH0E 1SG9A 2LH0A 4OX9M 1VEJA 1IXSB 3D8BA 2R0IA 4LFAM 4YHHM 2J7OA 2KNAA 3LVWA 3CF6E 4B7GA 2Y21A 2KNZA 1KYIA 3FRIA 3GLHE 4UN2B 5DYGA 3GQ3A 3GQ4A 2XZFA 2APLA 1D0KA 2CHQA 1SXJD 1NNUC 3GLFE 4I4LA 1L8QA 3K92A 3GO8A 1A5TA 1JR3A 2I7PA 5IZ7D 4FD2A 1TDHA 5F3WA 1EIJA 2G8LA 3U60A 3SMPA 3B7ZA 2LVOC 2EKFA 3KXEC 2KXEA 3KSJA 3GLHA 3L27A 2LWXA 3PFIA 4RNAA 4DUYM 3J7BA 2D7EA 2QPAA 4Q7JA 3GLFA 4MB7A 1DV0A 1OFHA 3HKPA 3TL4X 5FTLA 4PDIA 1L2BA 2L4FA 1HJPA 1QAOA 3I04M 1IN5A 3KOYE 3HHWA 3KP0E 1FNNA 4GH9A 1IY0A 2CV2A 2DVWB 1Z6TA 3HHXA 3FUVA 1NJFA 4M0DA 1E32A 2XFSA 4LF8M 1VEKA 4OVZA 1N33M 1V33A 4DV3M 1K82A 2FS1A 2KRUA 4QNRA 1IFYA 2CE7A 2L7HA 4XBOA 4I81A 4JI2M 5DFLA 1PJQA 1NV8A 5IWAM 3U5ZA 3SMSA 1QZMA 2UUBM 2UU9M 4LJ9A 3CGWA 1OIPA 3NWLA 5JI3E 2L2DA 2DAGA 2EJSA 2VF7A 3ZH9B 2DWLA 3E21A 3L28A 4JI6M 3K1JA 1J09A 2WSFF 3VDPA 4MGIE 3D8LA 2Z4RA 4LJ4A 1NY5A 3TWKA 3C58A 3H4JA 3KOZE 5ITUA 4JI7M 3GLGE 4QHSA 2WSEF 1SXJE 3BBZA 3KOWE 3LCVB 1XHBA 4XGIA 4LRTA 1PJIA 1H6UA 1G4AE 1HT1E 2DAKA 2JA2A 4KODA 3UGJA 4LCBA 3R9XB 1G8PA 2V6ZM 3W0LB 1IN4A 2UXCM 3GRYA 4JI1M 4HEOA 2KA6B 4F1IA 4NRVA 1GLNA 1Q3CA 1IY2A 4LY6A 3GLGA 1SXJA 3TQSA 4OW0A 1IN7A 2VIIA 1X37A 4FCWA 4CGYB 3FTEA 4GC5A 4D80A 4G3OA 4DV6M 3DFZA 5C18A 2DAEA 4PD2A 3LCUA 3VK7A 1L1TA 1HQCA 4K0KM 2LVAA 1Y8GA 1T3TA 5EXXA 1K3WA 4NSOB 4LFCM 3U6PA 1I4WA 4DR1M 2FOIC 2A5YB 4CISA 3HX3A 4L15A 4I5SA 1GVNA 3DA1A 2DWNA 3LW5F 4IBGA 5ITYA 5KPRA 1IXZA 1R6BX 3QAUA 2N35A 2R6FA 5KO3A 4CHTB 4GIPA 4PT5A 2DI0A 2W82A 2DZNB 2K9DA 3PNYA 1JB0F 1NV9A 4I8OA 2EKKA 2QSFX 1R2ZA 2MJ5B 2C9OA 4LZJA 2R4JA 2EUCA 2L4EA 1HNXM 3W0FA 2DKLA 4L6V6 4DV2M 2C98A 1YSYA 3DZDA 3JR4A 5E6JA 1DGHB 1IBKM 5EP4A 3SAUA 2L09A 1R5LA 2RGOA 4LJ5A 2Y0QA 3FD9A 3SASA 5IT9S 2R65A 2CV1A 2CWBA 4RKUF 3MHVC 3UZUA 3WHLA 4G4RA 2QQ8A 3J27B 2H5XA 2VDBB 3I4VA 5EXTA 1XMOM 4OVZB 1TTEA 7CATA 2AHMA 1TR8A 1EE8A 3EIEA 3QYBA 3HU1A 4LJ7A 1WGLA 5L8RF 3L26A 1KFVA 3KSXA 5KPZA 2RKOA 1G59A 2R62A 2XFTA 1D0MA 3ZQJA 2MGWA 4WP2A 5IREB 4X64M 3GLIE 2CP8A 4FCTA 2GNOA 3HHYA 3Q8XA 4GC9A 5JI2E 2DNAA 3SAVA 1QZEA 1VDDA 4BLCA 2HHHM 4RF0A 4L8RC 1HNWM 2Z7JA 1D0LA 4KLNA 5BPVA 3SFZA 1W5SA 1T43A 3HU2A 3HJ8A 4JXJA 4QOSA 3LVVA 3T1HM 4IBIA 3W67A 3PVSA 4DV5M 2I7NA 3R8FA 3DOAA 2F5OA 3FRHA 3HU3A 3SHGB 3THGA 5KPTA 4JI5M 4S12A 3SYLA 2KZSA 3C9PA 1ORYB 1ZMUA 4DV4M 2MR9A 1WJ7A 1UM8A 4Z8XA 1L2CA 2RRUA 2JZ1A 1XXHE 4B08A 3L29A 1ZQ9A 3AV0A 3VLFB 2XLJA 3B7QA 2X8AA 3LMMA 5FTKA 3M0EA 1GKIA 1OQYA 3ZCBB 4CIZA 5ITTA 2FNAA 3SATA 3B9PA 4REZA 4G6ZA 5FLXS 4OU7A 3Q8GA 1N32M 2L7IA 1RU3A 2MROB 4GHAA 4DR7M 3OTOM 4IBKA 2C9CA 2HKJA 4D81A 3J81S 2ZANA 2DENA 4ITQA 1TGUA 2Z8YM 1GO5A 4II7A 2KRKA 2ZTCA 2KNVA 4FW9A 4LGYA 3AJIB 4PDGA 2HCBA 4AKHA 4DR2M 3GQ5A 2K6BA 3C3EA 3MMPA 4QOZC 2ZBKB 1VEGA 1IBMM 2JY7A 4YY3M 2VF8A 4LF7M 1HR0M 1IM2A 2UUAM 3ILKA 2BWEA 4LJAA 2X49A 2QBYB 4KHPM 4B7HA 2XSZA 1F4IA 1MU5A 5FTJA 4X62M 2DHYA 4NC6A 4KT0F 2J5YA 3UMMA 5ITXE 5EP1A 1I94M 3SBJA 1E94E 1GJSA 3TPZA 3SC3A 4EIWA 1XMQM 3GPUA 4G4QA 4KO8A 3VDUA 2OQ4A 4LF6M 2DZOB 1N75A 1Q39A 1IQPA 1DGBA 1OTRA 1N36M 1HNZM 2JY8A 2DXIA 1JQJC 3FUWA 2Y20A 4BB9A 3SYKA 2R44A 5FTNA 1VG5A 2FFJA 1QDRA 1G3IA 1QAQA 2GQFA 1ZV1A 5ITXA 4AG6A 4DV7M 1WR1B 4FWGA 2KDLA 5E26A 3U6EA 4LFBM 1V92A 3AOGA 4R3DA 1VDLA 2X4AA 3GRVA 2BWBA 2R4EA 1HQYE 2WZJA 3FYCA 4LJ6A 4B3TM 3LQQA 1NHGC 3TWLA 4L78A 2F5QA 2OO9A 2CV0A 4M9SA 3RFWA 2H1RA 2C99A 4HLQA 2L6OA 4AKIA 1K3XA 3KVWA 2ZAMA 3K8ZA 4Z6YA 4AKGA 1QVRA 3KDSE 3V76A 4CJ6A 4AZFA 2DHRA 2ERCA 4M9ZA 3CF2A 3FTCA 2B3TA 2R46A 1N77A 5EJCA 3J7AS 1NY6A 2QP9X 3U60B 4LF5M 3FYDA 2JP7A 3U6MA 1QYRA 1QQWA 4B7FA 3GLHB 2FE8A 2QCUA 2J7NA 5EP2A 3TWMA 3FUTA 1D2NA 3GLFB 3T1YM 2CUZA 3HJQA 3RE8A 3U6SA 3VKHA 2CHGA 2O5RA 2LHCA 1E9SA 3UK6A 1IN6A 4DR4M 1XC8A 3GP1A 1PM5A 4AI6A 4LJ8A 1QUSA 5EXPA 4DR6M 2CRUA 3PXGA 1TH3A 3QYEA 4QNMA 2XGNA 1IN8A 2VQEM 3FTDA 2LVQD 1NNJA 5EP3A 2KEBA 3BXWA 1NVMA 4M9XA 5EQTA 2JY6B 2LHGA 3U5ZB 2KW0A 4W5WA 1NSFA 5BR8M 2LBCA 2XSZD 1DO0A 4MGHA 3HY5A 2K47A 3JAMS 2F5NA 4TUWA 4IBBA 1HT2E 1NJGA 5DNYA 4NXMM 1OJLA 2V1UA 1OKSA 2BJVA 3KOXE 2D7GA 1Q3BA 4NL4H 1LTMA 2OOAA 4NSRA 1IXRC 3K9OA 3A46A 3QWLA 5ITRA 2QNJA 2F5PA 1WXQA 1Z5CA 1NHWC 3GRRA 4FVMA 4BBAA 3NBXX 2Q2EB 1QUTA 3M7GA 3FTFA 3EIHA 4MGYE 3AOEA 4R7GA 3CTWB 4NRWA 3GLIA 3SAWA 3L2AA 2OOBA 4NOOB 3K2LA 3IECA 4LZZA 2NQ8C 4AW4A 2KHHA 5C1BA 4QHTA 3T6PA 1T6OA 3HJSA 1JR3E 4WW0A 3BOSA 3GLGB 2P5TA 3VK8A 1DGGA 1SXJB 4FCVA 1VQ1A 2G5GX 4IBDA 4XK8F 4GKJM 1R4GA 4LF4M 4WURA 1ZAEA 3AFHA 1EFUB 1L1ZA 3AL0C 4JI0M 2UXDM 4JV5M 1UFZA 1QDTA 2XZUA 1R7RA 3W68A 1GJTA 1ZMWA 2Y0TA 4JN6A 4LRSA 4NXNM 2EO2A 4ANRA 3K9PA 1S3SA 1MJGM 1TDZA 4FWHA 4DV1M 2LXEA 2QENA 3L25A 1N78A 3H4MA 3A98B 2HL7A 2JUJA 1XXHA 3J80S 3U6OA 1GABA 3SHFA 3B74A 1E9RA 1J7KA 4ZPXA 2QZ4A 3UJNA 2RGHA 1AIPC 1DGHA 3HGIA 4L4UA 1G41A 3U61A 5H37D 3AOEC 3IG8A 4JI4M 1L2DA 1R2YA 1GL7A 5FSWA 3M6AA 2K0BX 2LNHC 2YR0A 3MJ5A 3FUXA 1YUBA 3IHPA 4L16A 2JY5A 3E9SA 2XH9A 2EA0A 2DWZB 4DR3M 1NO1A 3F92A 1MN3A 4P16A 2CHVA 4IIWA 4F2LA 1IBLM 4JI3M 2DZLA 1XB2B 3FE3A 1AUAA 1V34A 1TH2A 2G3QA 2ZAOA 4Y28F 2C96A 1XNQM 1XWIA 4IJEA 4X66M 1IXSA 4M0WA 3J2PB 3HZJA 3MK6A 3KW6A 4P17A 2UXBM 4A3VB 3U6QA 4HL4A 5A2QS 3I01M 5LMUM 3KFUG 3U61B 3KS8A 1QAMA 4LF9M 2DAIA 4DV0M 3SARA 2E5LM 3CF0A 4IBEA 3I4YA 2JNHA 5FTMA 3ZC7B 2JZ0A 4GRIA 3AKZA 3GPPA 1Z59A 1J5EM 3TE6A 2JWSA 2CFOA 2FH0A 1N34M 4R71A 2JXNA 2M60A 2XF3A 1P3QQ 3T38A 1Q02A 5ITQA 1G71A 3U6LA 5EXSA 3FKEA 4B3MM 1OFIA 4LG2A 1WHCA 2F4VM 2KZUA 2DAMA 3E46A 2LVNC 1BVSA 1IY1A 1OAOC 3GRUA 3B89A 4LGMA 3HHZA 3GLIB 4GITA 2YFQA 4IJFA 2XEPA 4DR5M 1LV7A 1W5TA 1ZMVA 2HWJA 2DWMA 4GHLA 4IBFA 2M5ZA 2BNKA 1XNRM 1C7YA 1JR3D
chains in the Genus database with same CATH topology
5LMNM 3RGSA 1FJGM 1DGFA 4JI8M 1YE9A 3KP1E 1C1KA 4AQYM 2D7HA 2V1CA 4GMQA 3GPXA 4G4OA 2YQZA 4G4NA 4MGKE 3A45A 3PNVA 4IBJA 2F5SA 3VFDA 4D82A 1DO2A 3VKGA 4MGZE 3A42A 1Z5BA 4RF1A 4DUZM 4B3SM 4IBCA 2R45A 5DYIA 4FWDA 3T15A 1XXHB 3HWSA 4MM3B 3I51A 2ZM6M 3U6DA 4X65M 1PJJA 2QBYA 2R18A 2Z3XA 8CATA 4B3RM 3KS4A 5GKNA 5KQDA 1GL6A 1SXJC 4PCZA 2UUCM 1MX0A 2CEAA 4GKKM 2OPFA 3WHKA 3E4RA 1TH4A 3FUUA 3U6CA 3LQRA 4AG5A 3IG5A 3RGPA 3GPYA 2YNMD 5KQ8A 2C5RA 3JR5A 2BJWA 4JYAM 2VQFM 1KSFX 1QANA 2Z4SA 1Z5AA 3NBIA 4MH0E 2LH0A 4OX9M 1IXSB 3D8BA 4LFAM 4YHHM 2J7OA 3LVWA 3CF6E 4B7GA 2Y21A 3GQ3A 1KYIA 2XZFA 5DYGA 3GQ4A 2CHQA 1SXJD 1NNUC 4I4LA 1L8QA 3K92A 3GO8A 1JR3A 2I7PA 5IZ7D 4FD2A 1TDHA 5F3WA 2G8LA 3U60A 3SMPA 3KXEC 2KXEA 3KSJA 3GLHA 3L27A 2LWXA 3PFIA 4RNAA 4DUYM 3J7BA 2D7EA 2QPAA 3GLFA 4MB7A 1OFHA 3HKPA 3TL4X 5FTLA 4PDIA 1L2BA 1QAOA 1IN5A 3KOYE 3HHWA 3KP0E 1FNNA 4GH9A 1IY0A 2CV2A 2DVWB 1Z6TA 3HHXA 3FUVA 1NJFA 4M0DA 1E32A 2XFSA 4LF8M 4OVZA 1N33M 4DV3M 1K82A 2KRUA 4QNRA 2CE7A 2L7HA 4XBOA 4I81A 4JI2M 5IWAM 3U5ZA 3SMSA 1QZMA 2UUBM 2UU9M 4LJ9A 3NWLA 5JI3E 3ZH9B 2DWLA 3L28A 4JI6M 3K1JA 1J09A 3VDPA 4MGIE 3D8LA 2Z4RA 4LJ4A 1NY5A 3TWKA 3C58A 4JI7M 3KOZE 5ITUA 4QHSA 1SXJE 3KOWE 4XGIA 1PJIA 1XHBA 4LRTA 1H6UA 1G4AE 1HT1E 2JA2A 4KODA 3UGJA 4LCBA 3R9XB 1G8PA 2V6ZM 3W0LB 1IN4A 2UXCM 3GRYA 4JI1M 2KA6B 4NRVA 1GLNA 1Q3CA 1IY2A 4LY6A 3GLGA 1SXJA 3TQSA 4OW0A 1IN7A 2VIIA 1X37A 4FCWA 4CGYB 3FTEA 4GC5A 4D80A 4DV6M 3DFZA 5C18A 4PD2A 3VK7A 1L1TA 4K0KM 1HQCA 1K3WA 1T3TA 5EXXA 4NSOB 4LFCM 3U6PA 1I4WA 4DR1M 2FOIC 2A5YB 4CISA 4L15A 4I5SA 1GVNA 3DA1A 2DWNA 4IBGA 5ITYA 5KPRA 1IXZA 1R6BX 3QAUA 5KO3A 4CHTB 4GIPA 4PT5A 3PNYA 2W82A 2DZNB 4I8OA 1R2ZA 4LZJA 2C9OA 2R4JA 2EUCA 1HNXM 3W0FA 4DV2M 2C98A 1YSYA 3DZDA 3JR4A 5E6JA 1DGHB 1IBKM 5EP4A 3SAUA 2L09A 2RGOA 4LJ5A 2Y0QA 3FD9A 3SASA 5IT9S 2R65A 2CV1A 4G4RA 3MHVC 3UZUA 3WHLA 3J27B 5EXTA 3I4VA 1XMOM 4OVZB 7CATA 2AHMA 3EIEA 1EE8A 4LJ7A 3HU1A 3L26A 1KFVA 3KSXA 5KPZA 2RKOA 1G59A 2R62A 2XFTA 5IREB 4X64M 4FCTA 3HHYA 3Q8XA 4GC9A 5JI2E 3SAVA 1VDDA 4BLCA 2HHHM 4RF0A 4L8RC 1HNWM 2Z7JA 4KLNA 5BPVA 3SFZA 1W5SA 3HU2A 3HJ8A 4JXJA 4QOSA 3LVVA 3T1HM 4IBIA 4DV5M 3PVSA 3R8FA 2I7NA 3DOAA 2F5OA 3HU3A 3THGA 3SHGB 5KPTA 4JI5M 4S12A 3SYLA 2KZSA 1ORYB 4DV4M 1UM8A 4Z8XA 1L2CA 4B08A 3L29A 1ZQ9A 3AV0A 3VLFB 2XLJA 3LMMA 2X8AA 5FTKA 3ZCBB 3M0EA 1GKIA 5ITTA 2FNAA 3SATA 3B9PA 4REZA 4G6ZA 5FLXS 4OU7A 1N32M 2L7IA 4GHAA 4DR7M 3OTOM 4IBKA 2C9CA 2HKJA 4D81A 3J81S 2ZANA 4ITQA 1TGUA 4II7A 2KRKA 4LGYA 4FW9A 3AJIB 4PDGA 2HCBA 4AKHA 4DR2M 3GQ5A 4QOZC 2ZBKB 1IBMM 4YY3M 4LF7M 1HR0M 1IM2A 2UUAM 3ILKA 4LJAA 2X49A 2QBYB 4KHPM 4B7HA 2XSZA 1MU5A 5FTJA 4X62M 3UMMA 5ITXE 5EP1A 1I94M 3SBJA 1E94E 3TPZA 3SC3A 4EIWA 1XMQM 3GPUA 4G4QA 4KO8A 3VDUA 2OQ4A 4LF6M 2DZOB 1N75A 1Q39A 1IQPA 1DGBA 1N36M 1HNZM 2DXIA 1JQJC 3FUWA 2Y20A 4BB9A 3SYKA 5FTNA 5ITXA 2FFJA 2CV0A 1QAQA 1G3IA 4AG6A 4DV7M 4FWGA 5E26A 3U6EA 4LFBM 3AOGA 4R3DA 2X4AA 3GRVA 2R4EA 3FYCA 1HQYE 4LJ6A 4B3TM 3LQQA 1NHGC 3TWLA 4L78A 2F5QA 4M9SA 3RFWA 2H1RA 2C99A 4HLQA 2L6OA 4AKIA 1K3XA 3KVWA 2ZAMA 3K8ZA 4Z6YA 4AKGA 1QVRA 3KDSE 4AZFA 2DHRA 2ERCA 4M9ZA 3CF2A 3FTCA 1N77A 2R46A 5EJCA 3J7AS 1NY6A 2QP9X 3U60B 4LF5M 3FYDA 3U6MA 1QYRA 1QQWA 4B7FA 3GLHB 2FE8A 2QCUA 2J7NA 5EP2A 3TWMA 3FUTA 1D2NA 3GLFB 3T1YM 2CUZA 3HJQA 3RE8A 3U6SA 3VKHA 2CHGA 2O5RA 1E9SA 3UK6A 1IN6A 4DR4M 1XC8A 3GP1A 1PM5A 4AI6A 4LJ8A 5EXPA 4DR6M 3PXGA 1TH3A 4QNMA 2XGNA 1IN8A 2VQEM 3FTDA 1NNJA 5EP3A 2KEBA 5EQTA 1NVMA 4M9XA 3U5ZB 2KW0A 4W5WA 1NSFA 5BR8M 4MGHA 2XSZD 1DO0A 3JAMS 3U61A 2K47A 2F5NA 4TUWA 4IBBA 1HT2E 1NJGA 5DNYA 4NXMM 1OJLA 2V1UA 2BJVA 3KOXE 2D7GA 1Q3BA 4NL4H 4NSRA 1IXRC 3A46A 3QWLA 5ITRA 2F5PA 1WXQA 1Z5CA 1NHWC 3GRRA 4FVMA 4BBAA 2Q2EB 3M7GA 3FTFA 3EIHA 4MGYE 3AOEA 4R7GA 3CTWB 4NRWA 3GLIA 3SAWA 3L2AA 4NOOB 3K2LA 4AW4A 4LZZA 2NQ8C 5C1BA 4QHTA 3HJSA 4WW0A 3BOSA 3GLGB 2P5TA 3VK8A 1DGGA 1SXJB 4FCVA 2G5GX 4IBDA 4GKJM 4LF4M 4WURA 1ZAEA 3AFHA 1L1ZA 3AL0C 4JI0M 2UXDM 4JV5M 2XZUA 1R7RA 4LRSA 2Y0TA 4JN6A 4NXNM 2EO2A 1S3SA 1TDZA 4FWHA 4DV1M 2LXEA 2QENA 3L25A 1N78A 3H4MA 3A98B 2HL7A 3U6OA 1XXHA 3J80S 3SHFA 1E9RA 1J7KA 4ZPXA 2QZ4A 3UJNA 2RGHA 1DGHA 3HGIA 4L4UA 1G41A 5H37D 3AOEC 3IG8A 4JI4M 1L2DA 1R2YA 1GL7A 5FSWA 3M6AA 2LNHC 2YR0A 3MJ5A 3FUXA 1YUBA 4L16A 3E9SA 2EA0A 2XH9A 2DWZB 4DR3M 4P16A 2CHVA 4IIWA 1IBLM 4JI3M 1TH2A 2ZAOA 2C96A 1XNQM 1XWIA 4IJEA 4X66M 4M0WA 2UXBM 3J2PB 3MK6A 3KW6A 4A3VB 3U6QA 4HL4A 5A2QS 5LMUM 3KFUG 3U61B 3KS8A 1QAMA 4LF9M 4DV0M 3SARA 2E5LM 3CF0A 4IBEA 3I4YA 5FTMA 3ZC7B 3AKZA 4GRIA 3GPPA 1Z59A 1J5EM 3TE6A 2CFOA 1N34M 2M60A 2XF3A 3T38A 5ITQA 3U6LA 5EXSA 3FKEA 4B3MM 1OFIA 4LG2A 2F4VM 2KZUA 3GLIB 1IY1A 3GRUA 3HHZA 4LGMA 4GITA 2YFQA 4IJFA 2XEPA 4DR5M 1LV7A 1W5TA 2DWMA 4GHLA 4IBFA 2M5ZA 2BNKA 1XNRM 1JR3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3X A; 
#chains in the Genus database with same CATH topology
 5LMN M;  3RGS A;  3B7N A;  1FJG M;  1DGF A;  2HAK A;  1YE9 A;  2ZTD A;  1C1K A;  3KP1 E;  4AQY M;  4JI8 M;  2D7H A;  2V1C A;  4GMQ A;  3GPX A;  4G4O A;  2YQZ A;  4G4N A;  4MGK E;  3A45 A;  3PNV A;  4IBJ A;  2F5S A;  3VFD A;  4D82 A;  1DO2 A;  1PGY A;  1CUK A;  4MGZ E;  3VKG A;  2WSC F;  4DBG B;  3A42 A;  1PRB A;  1Z5B A;  2LTU A;  4RF1 A;  4DUZ M;  4B3S M;  1PJS A;  4IBC A;  2R45 A;  5DYI A;  4FWD A;  3T15 A;  1OAI A;  1XXH B;  3HWS A;  4MM3 B;  3I51 A;  4GEW A;  1WIV A;  2ZM6 M;  3U6D A;  4X65 M;  1PJJ A;  2QBY A;  2R18 A;  2O01 F;  2Z3X A;  8CAT A;  4B3R M;  3KS4 A;  5GKN A;  2O25 A;  5KQD A;  1GL6 A;  1SXJ C;  2QHO B;  4PCZ A;  1MX0 A;  2CEA A;  2UUC M;  4GKK M;  2OPF A;  3WHK A;  3E4R A;  1TH4 A;  1YLA A;  3FUU A;  1PJT A;  2LVP C;  3LQR A;  4AG5 A;  3U6C A;  1WGN A;  3IG5 A;  3RGP A;  3GPY A;  2YNM D;  5KQ8 A;  2C5R A;  3JR5 A;  2BJW A;  4JYA M;  2VQF M;  1TF0 B;  1OIZ A;  1KSF X;  1QAN A;  2Z4S A;  3C3D A;  1Z5A A;  2MH8 A;  3NBI A;  4MH0 E;  1SG9 A;  2LH0 A;  4OX9 M;  1VEJ A;  1IXS B;  3D8B A;  2R0I A;  4LFA M;  4YHH M;  2J7O A;  2KNA A;  3LVW A;  3CF6 E;  4B7G A;  2Y21 A;  2KNZ A;  1KYI A;  3FRI A;  3GLH E;  4UN2 B;  5DYG A;  3GQ3 A;  3GQ4 A;  2XZF A;  2APL A;  1D0K A;  2CHQ A;  1SXJ D;  1NNU C;  3GLF E;  4I4L A;  1L8Q A;  3K92 A;  3GO8 A;  1A5T A;  1JR3 A;  2I7P A;  5IZ7 D;  4FD2 A;  1TDH A;  5F3W A;  1EIJ A;  2G8L A;  3U60 A;  3SMP A;  3B7Z A;  2LVO C;  2EKF A;  3KXE C;  2KXE A;  3KSJ A;  3GLH A;  3L27 A;  2LWX A;  3PFI A;  4RNA A;  4DUY M;  3J7B A;  2D7E A;  2QPA A;  4Q7J A;  3GLF A;  4MB7 A;  1DV0 A;  1OFH A;  3HKP A;  3TL4 X;  5FTL A;  4PDI A;  1L2B A;  2L4F A;  1HJP A;  1QAO A;  3I04 M;  1IN5 A;  3KOY E;  3HHW A;  3KP0 E;  1FNN A;  4GH9 A;  1IY0 A;  2CV2 A;  2DVW B;  1Z6T A;  3HHX A;  3FUV A;  1NJF A;  4M0D A;  1E32 A;  2XFS A;  4LF8 M;  1VEK A;  4OVZ A;  1N33 M;  1V33 A;  4DV3 M;  1K82 A;  2FS1 A;  2KRU A;  4QNR A;  1IFY A;  2CE7 A;  2L7H A;  4XBO A;  4I81 A;  4JI2 M;  5DFL A;  1PJQ A;  1NV8 A;  5IWA M;  3U5Z A;  3SMS A;  1QZM A;  2UUB M;  2UU9 M;  4LJ9 A;  3CGW A;  1OIP A;  3NWL A;  5JI3 E;  2L2D A;  2DAG A;  2EJS A;  2VF7 A;  3ZH9 B;  2DWL A;  3E21 A;  3L28 A;  4JI6 M;  3K1J A;  1J09 A;  2WSF F;  3VDP A;  4MGI E;  3D8L A;  2Z4R A;  4LJ4 A;  1NY5 A;  3TWK A;  3C58 A;  3H4J A;  3KOZ E;  5ITU A;  4JI7 M;  3GLG E;  4QHS A;  2WSE F;  1SXJ E;  3BBZ A;  3KOW E;  3LCV B;  1XHB A;  4XGI A;  4LRT A;  1PJI A;  1H6U A;  1G4A E;  1HT1 E;  2DAK A;  2JA2 A;  4KOD A;  3UGJ A;  4LCB A;  3R9X B;  1G8P A;  2V6Z M;  3W0L B;  1IN4 A;  2UXC M;  3GRY A;  4JI1 M;  4HEO A;  2KA6 B;  4F1I A;  4NRV A;  1GLN A;  1Q3C A;  1IY2 A;  4LY6 A;  3GLG A;  1SXJ A;  3TQS A;  4OW0 A;  1IN7 A;  2VII A;  1X37 A;  4FCW A;  4CGY B;  3FTE A;  4GC5 A;  4D80 A;  4G3O A;  4DV6 M;  3DFZ A;  5C18 A;  2DAE A;  4PD2 A;  3LCU A;  3VK7 A;  1L1T A;  1HQC A;  4K0K M;  2LVA A;  1Y8G A;  1T3T A;  5EXX A;  1K3W A;  4NSO B;  4LFC M;  3U6P A;  1I4W A;  4DR1 M;  2FOI C;  2A5Y B;  4CIS A;  3HX3 A;  4L15 A;  4I5S A;  1GVN A;  3DA1 A;  2DWN A;  3LW5 F;  4IBG A;  5ITY A;  5KPR A;  1IXZ A;  1R6B X;  3QAU A;  2N35 A;  2R6F A;  5KO3 A;  4CHT B;  4GIP A;  4PT5 A;  2DI0 A;  2W82 A;  2DZN B;  2K9D A;  3PNY A;  1JB0 F;  1NV9 A;  4I8O A;  2EKK A;  2QSF X;  1R2Z A;  2MJ5 B;  2C9O A;  4LZJ A;  2R4J A;  2EUC A;  2L4E A;  1HNX M;  3W0F A;  2DKL A;  4L6V 6;  4DV2 M;  2C98 A;  1YSY A;  3DZD A;  3JR4 A;  5E6J A;  1DGH B;  1IBK M;  5EP4 A;  3SAU A;  2L09 A;  1R5L A;  2RGO A;  4LJ5 A;  2Y0Q A;  3FD9 A;  3SAS A;  5IT9 S;  2R65 A;  2CV1 A;  2CWB A;  4RKU F;  3MHV C;  3UZU A;  3WHL A;  4G4R A;  2QQ8 A;  3J27 B;  2H5X A;  2VDB B;  3I4V A;  5EXT A;  1XMO M;  4OVZ B;  1TTE A;  7CAT A;  2AHM A;  1TR8 A;  1EE8 A;  3EIE A;  3QYB A;  3HU1 A;  4LJ7 A;  1WGL A;  5L8R F;  3L26 A;  1KFV A;  3KSX A;  5KPZ A;  2RKO A;  1G59 A;  2R62 A;  2XFT A;  1D0M A;  3ZQJ A;  2MGW A;  4WP2 A;  5IRE B;  4X64 M;  3GLI E;  2CP8 A;  4FCT A;  2GNO A;  3HHY A;  3Q8X A;  4GC9 A;  5JI2 E;  2DNA A;  3SAV A;  1QZE A;  1VDD A;  4BLC A;  2HHH M;  4RF0 A;  4L8R C;  1HNW M;  2Z7J A;  1D0L A;  4KLN A;  5BPV A;  3SFZ A;  1W5S A;  1T43 A;  3HU2 A;  3HJ8 A;  4JXJ A;  4QOS A;  3LVV A;  3T1H M;  4IBI A;  3W67 A;  3PVS A;  4DV5 M;  2I7N A;  3R8F A;  3DOA A;  2F5O A;  3FRH A;  3HU3 A;  3SHG B;  3THG A;  5KPT A;  4JI5 M;  4S12 A;  3SYL A;  2KZS A;  3C9P A;  1ORY B;  1ZMU A;  4DV4 M;  2MR9 A;  1WJ7 A;  1UM8 A;  4Z8X A;  1L2C A;  2RRU A;  2JZ1 A;  1XXH E;  4B08 A;  3L29 A;  1ZQ9 A;  3AV0 A;  3VLF B;  2XLJ A;  3B7Q A;  2X8A A;  3LMM A;  5FTK A;  3M0E A;  1GKI A;  1OQY A;  3ZCB B;  4CIZ A;  5ITT A;  2FNA A;  3SAT A;  3B9P A;  4REZ A;  4G6Z A;  5FLX S;  4OU7 A;  3Q8G A;  1N32 M;  2L7I A;  1RU3 A;  2MRO B;  4GHA A;  4DR7 M;  3OTO M;  4IBK A;  2C9C A;  2HKJ A;  4D81 A;  3J81 S;  2ZAN A;  2DEN A;  4ITQ A;  1TGU A;  2Z8Y M;  1GO5 A;  4II7 A;  2KRK A;  2ZTC A;  2KNV A;  4FW9 A;  4LGY A;  3AJI B;  4PDG A;  2HCB A;  4AKH A;  4DR2 M;  3GQ5 A;  2K6B A;  3C3E A;  3MMP A;  4QOZ C;  2ZBK B;  1VEG A;  1IBM M;  2JY7 A;  4YY3 M;  2VF8 A;  4LF7 M;  1HR0 M;  1IM2 A;  2UUA M;  3ILK A;  2BWE A;  4LJA A;  2X49 A;  2QBY B;  4KHP M;  4B7H A;  2XSZ A;  1F4I A;  1MU5 A;  5FTJ A;  4X62 M;  2DHY A;  4NC6 A;  4KT0 F;  2J5Y A;  3UMM A;  5ITX E;  5EP1 A;  1I94 M;  3SBJ A;  1E94 E;  1GJS A;  3TPZ A;  3SC3 A;  4EIW A;  1XMQ M;  3GPU A;  4G4Q A;  4KO8 A;  3VDU A;  2OQ4 A;  4LF6 M;  2DZO B;  1N75 A;  1Q39 A;  1IQP A;  1DGB A;  1OTR A;  1N36 M;  1HNZ M;  2JY8 A;  2DXI A;  1JQJ C;  3FUW A;  2Y20 A;  4BB9 A;  3SYK A;  2R44 A;  5FTN A;  1VG5 A;  2FFJ A;  1QDR A;  1G3I A;  1QAQ A;  2GQF A;  1ZV1 A;  5ITX A;  4AG6 A;  4DV7 M;  1WR1 B;  4FWG A;  2KDL A;  5E26 A;  3U6E A;  4LFB M;  1V92 A;  3AOG A;  4R3D A;  1VDL A;  2X4A A;  3GRV A;  2BWB A;  2R4E A;  1HQY E;  2WZJ A;  3FYC A;  4LJ6 A;  4B3T M;  3LQQ A;  1NHG C;  3TWL A;  4L78 A;  2F5Q A;  2OO9 A;  2CV0 A;  4M9S A;  3RFW A;  2H1R A;  2C99 A;  4HLQ A;  2L6O A;  4AKI A;  1K3X A;  3KVW A;  2ZAM A;  3K8Z A;  4Z6Y A;  4AKG A;  1QVR A;  3KDS E;  3V76 A;  4CJ6 A;  4AZF A;  2DHR A;  2ERC A;  4M9Z A;  3CF2 A;  3FTC A;  2B3T A;  2R46 A;  1N77 A;  5EJC A;  3J7A S;  1NY6 A;  2QP9 X;  3U60 B;  4LF5 M;  3FYD A;  2JP7 A;  3U6M A;  1QYR A;  1QQW A;  4B7F A;  3GLH B;  2FE8 A;  2QCU A;  2J7N A;  5EP2 A;  3TWM A;  3FUT A;  1D2N A;  3GLF B;  3T1Y M;  2CUZ A;  3HJQ A;  3RE8 A;  3U6S A;  3VKH A;  2CHG A;  2O5R A;  2LHC A;  1E9S A;  3UK6 A;  1IN6 A;  4DR4 M;  1XC8 A;  3GP1 A;  1PM5 A;  4AI6 A;  4LJ8 A;  1QUS A;  5EXP A;  4DR6 M;  2CRU A;  3PXG A;  1TH3 A;  3QYE A;  4QNM A;  2XGN A;  1IN8 A;  2VQE M;  3FTD A;  2LVQ D;  1NNJ A;  5EP3 A;  2KEB A;  3BXW A;  1NVM A;  4M9X A;  5EQT A;  2JY6 B;  2LHG A;  3U5Z B;  2KW0 A;  4W5W A;  1NSF A;  5BR8 M;  2LBC A;  2XSZ D;  1DO0 A;  4MGH A;  3HY5 A;  2K47 A;  3JAM S;  2F5N A;  4TUW A;  4IBB A;  1HT2 E;  1NJG A;  5DNY A;  4NXM M;  1OJL A;  2V1U A;  1OKS A;  2BJV A;  3KOX E;  2D7G A;  1Q3B A;  4NL4 H;  1LTM A;  2OOA A;  4NSR A;  1IXR C;  3K9O A;  3A46 A;  3QWL A;  5ITR A;  2QNJ A;  2F5P A;  1WXQ A;  1Z5C A;  1NHW C;  3GRR A;  4FVM A;  4BBA A;  3NBX X;  2Q2E B;  1QUT A;  3M7G A;  3FTF A;  3EIH A;  4MGY E;  3AOE A;  4R7G A;  3CTW B;  4NRW A;  3GLI A;  3SAW A;  3L2A A;  2OOB A;  4NOO B;  3K2L A;  3IEC A;  4LZZ A;  2NQ8 C;  4AW4 A;  2KHH A;  5C1B A;  4QHT A;  3T6P A;  1T6O A;  3HJS A;  1JR3 E;  4WW0 A;  3BOS A;  3GLG B;  2P5T A;  3VK8 A;  1DGG A;  1SXJ B;  4FCV A;  1VQ1 A;  2G5G X;  4IBD A;  4XK8 F;  4GKJ M;  1R4G A;  4LF4 M;  4WUR A;  1ZAE A;  3AFH A;  1EFU B;  1L1Z A;  3AL0 C;  4JI0 M;  2UXD M;  4JV5 M;  1UFZ A;  1QDT A;  2XZU A;  1R7R A;  3W68 A;  1GJT A;  1ZMW A;  2Y0T A;  4JN6 A;  4LRS A;  4NXN M;  2EO2 A;  4ANR A;  3K9P A;  1S3S A;  1MJG M;  1TDZ A;  4FWH A;  4DV1 M;  2LXE A;  2QEN A;  3L25 A;  1N78 A;  3H4M A;  3A98 B;  2HL7 A;  2JUJ A;  1XXH A;  3J80 S;  3U6O A;  1GAB A;  3SHF A;  3B74 A;  1E9R A;  1J7K A;  4ZPX A;  2QZ4 A;  3UJN A;  2RGH A;  1AIP C;  1DGH A;  3HGI A;  4L4U A;  1G41 A;  3U61 A;  5H37 D;  3AOE C;  3IG8 A;  4JI4 M;  1L2D A;  1R2Y A;  1GL7 A;  5FSW A;  3M6A A;  2K0B X;  2LNH C;  2YR0 A;  3MJ5 A;  3FUX A;  1YUB A;  3IHP A;  4L16 A;  2JY5 A;  3E9S A;  2XH9 A;  2EA0 A;  2DWZ B;  4DR3 M;  1NO1 A;  3F92 A;  1MN3 A;  4P16 A;  2CHV A;  4IIW A;  4F2L A;  1IBL M;  4JI3 M;  2DZL A;  1XB2 B;  3FE3 A;  1AUA A;  1V34 A;  1TH2 A;  2G3Q A;  2ZAO A;  4Y28 F;  2C96 A;  1XNQ M;  1XWI A;  4IJE A;  4X66 M;  1IXS A;  4M0W A;  3J2P B;  3HZJ A;  3MK6 A;  3KW6 A;  4P17 A;  2UXB M;  4A3V B;  3U6Q A;  4HL4 A;  5A2Q S;  3I01 M;  5LMU M;  3KFU G;  3U61 B;  3KS8 A;  1QAM A;  4LF9 M;  2DAI A;  4DV0 M;  3SAR A;  2E5L M;  3CF0 A;  4IBE A;  3I4Y A;  2JNH A;  5FTM A;  3ZC7 B;  2JZ0 A;  4GRI A;  3AKZ A;  3GPP A;  1Z59 A;  1J5E M;  3TE6 A;  2JWS A;  2CFO A;  2FH0 A;  1N34 M;  4R71 A;  2JXN A;  2M60 A;  2XF3 A;  1P3Q Q;  3T38 A;  1Q02 A;  5ITQ A;  1G71 A;  3U6L A;  5EXS A;  3FKE A;  4B3M M;  1OFI A;  4LG2 A;  1WHC A;  2F4V M;  2KZU A;  2DAM A;  3E46 A;  2LVN C;  1BVS A;  1IY1 A;  1OAO C;  3GRU A;  3B89 A;  4LGM A;  3HHZ A;  3GLI B;  4GIT A;  2YFQ A;  4IJF A;  2XEP A;  4DR5 M;  1LV7 A;  1W5T A;  1ZMV A;  2HWJ A;  2DWM A;  4GHL A;  4IBF A;  2M5Z A;  2BNK A;  1XNR M;  1C7Y A;  1JR3 D; 
#chains in the Genus database with same CATH homology
 5LMN M;  3RGS A;  1FJG M;  1DGF A;  4JI8 M;  1YE9 A;  3KP1 E;  1C1K A;  4AQY M;  2D7H A;  2V1C A;  4GMQ A;  3GPX A;  4G4O A;  2YQZ A;  4G4N A;  4MGK E;  3A45 A;  3PNV A;  4IBJ A;  2F5S A;  3VFD A;  4D82 A;  1DO2 A;  3VKG A;  4MGZ E;  3A42 A;  1Z5B A;  4RF1 A;  4DUZ M;  4B3S M;  4IBC A;  2R45 A;  5DYI A;  4FWD A;  3T15 A;  1XXH B;  3HWS A;  4MM3 B;  3I51 A;  2ZM6 M;  3U6D A;  4X65 M;  1PJJ A;  2QBY A;  2R18 A;  2Z3X A;  8CAT A;  4B3R M;  3KS4 A;  5GKN A;  5KQD A;  1GL6 A;  1SXJ C;  4PCZ A;  2UUC M;  1MX0 A;  2CEA A;  4GKK M;  2OPF A;  3WHK A;  3E4R A;  1TH4 A;  3FUU A;  3U6C A;  3LQR A;  4AG5 A;  3IG5 A;  3RGP A;  3GPY A;  2YNM D;  5KQ8 A;  2C5R A;  3JR5 A;  2BJW A;  4JYA M;  2VQF M;  1KSF X;  1QAN A;  2Z4S A;  1Z5A A;  3NBI A;  4MH0 E;  2LH0 A;  4OX9 M;  1IXS B;  3D8B A;  4LFA M;  4YHH M;  2J7O A;  3LVW A;  3CF6 E;  4B7G A;  2Y21 A;  3GQ3 A;  1KYI A;  2XZF A;  5DYG A;  3GQ4 A;  2CHQ A;  1SXJ D;  1NNU C;  4I4L A;  1L8Q A;  3K92 A;  3GO8 A;  1JR3 A;  2I7P A;  5IZ7 D;  4FD2 A;  1TDH A;  5F3W A;  2G8L A;  3U60 A;  3SMP A;  3KXE C;  2KXE A;  3KSJ A;  3GLH A;  3L27 A;  2LWX A;  3PFI A;  4RNA A;  4DUY M;  3J7B A;  2D7E A;  2QPA A;  3GLF A;  4MB7 A;  1OFH A;  3HKP A;  3TL4 X;  5FTL A;  4PDI A;  1L2B A;  1QAO A;  1IN5 A;  3KOY E;  3HHW A;  3KP0 E;  1FNN A;  4GH9 A;  1IY0 A;  2CV2 A;  2DVW B;  1Z6T A;  3HHX A;  3FUV A;  1NJF A;  4M0D A;  1E32 A;  2XFS A;  4LF8 M;  4OVZ A;  1N33 M;  4DV3 M;  1K82 A;  2KRU A;  4QNR A;  2CE7 A;  2L7H A;  4XBO A;  4I81 A;  4JI2 M;  5IWA M;  3U5Z A;  3SMS A;  1QZM A;  2UUB M;  2UU9 M;  4LJ9 A;  3NWL A;  5JI3 E;  3ZH9 B;  2DWL A;  3L28 A;  4JI6 M;  3K1J A;  1J09 A;  3VDP A;  4MGI E;  3D8L A;  2Z4R A;  4LJ4 A;  1NY5 A;  3TWK A;  3C58 A;  4JI7 M;  3KOZ E;  5ITU A;  4QHS A;  1SXJ E;  3KOW E;  4XGI A;  1PJI A;  1XHB A;  4LRT A;  1H6U A;  1G4A E;  1HT1 E;  2JA2 A;  4KOD A;  3UGJ A;  4LCB A;  3R9X B;  1G8P A;  2V6Z M;  3W0L B;  1IN4 A;  2UXC M;  3GRY A;  4JI1 M;  2KA6 B;  4NRV A;  1GLN A;  1Q3C A;  1IY2 A;  4LY6 A;  3GLG A;  1SXJ A;  3TQS A;  4OW0 A;  1IN7 A;  2VII A;  1X37 A;  4FCW A;  4CGY B;  3FTE A;  4GC5 A;  4D80 A;  4DV6 M;  3DFZ A;  5C18 A;  4PD2 A;  3VK7 A;  1L1T A;  4K0K M;  1HQC A;  1K3W A;  1T3T A;  5EXX A;  4NSO B;  4LFC M;  3U6P A;  1I4W A;  4DR1 M;  2FOI C;  2A5Y B;  4CIS A;  4L15 A;  4I5S A;  1GVN A;  3DA1 A;  2DWN A;  4IBG A;  5ITY A;  5KPR A;  1IXZ A;  1R6B X;  3QAU A;  5KO3 A;  4CHT B;  4GIP A;  4PT5 A;  3PNY A;  2W82 A;  2DZN B;  4I8O A;  1R2Z A;  4LZJ A;  2C9O A;  2R4J A;  2EUC A;  1HNX M;  3W0F A;  4DV2 M;  2C98 A;  1YSY A;  3DZD A;  3JR4 A;  5E6J A;  1DGH B;  1IBK M;  5EP4 A;  3SAU A;  2L09 A;  2RGO A;  4LJ5 A;  2Y0Q A;  3FD9 A;  3SAS A;  5IT9 S;  2R65 A;  2CV1 A;  4G4R A;  3MHV C;  3UZU A;  3WHL A;  3J27 B;  5EXT A;  3I4V A;  1XMO M;  4OVZ B;  7CAT A;  2AHM A;  3EIE A;  1EE8 A;  4LJ7 A;  3HU1 A;  3L26 A;  1KFV A;  3KSX A;  5KPZ A;  2RKO A;  1G59 A;  2R62 A;  2XFT A;  5IRE B;  4X64 M;  4FCT A;  3HHY A;  3Q8X A;  4GC9 A;  5JI2 E;  3SAV A;  1VDD A;  4BLC A;  2HHH M;  4RF0 A;  4L8R C;  1HNW M;  2Z7J A;  4KLN A;  5BPV A;  3SFZ A;  1W5S A;  3HU2 A;  3HJ8 A;  4JXJ A;  4QOS A;  3LVV A;  3T1H M;  4IBI A;  4DV5 M;  3PVS A;  3R8F A;  2I7N A;  3DOA A;  2F5O A;  3HU3 A;  3THG A;  3SHG B;  5KPT A;  4JI5 M;  4S12 A;  3SYL A;  2KZS A;  1ORY B;  4DV4 M;  1UM8 A;  4Z8X A;  1L2C A;  4B08 A;  3L29 A;  1ZQ9 A;  3AV0 A;  3VLF B;  2XLJ A;  3LMM A;  2X8A A;  5FTK A;  3ZCB B;  3M0E A;  1GKI A;  5ITT A;  2FNA A;  3SAT A;  3B9P A;  4REZ A;  4G6Z A;  5FLX S;  4OU7 A;  1N32 M;  2L7I A;  4GHA A;  4DR7 M;  3OTO M;  4IBK A;  2C9C A;  2HKJ A;  4D81 A;  3J81 S;  2ZAN A;  4ITQ A;  1TGU A;  4II7 A;  2KRK A;  4LGY A;  4FW9 A;  3AJI B;  4PDG A;  2HCB A;  4AKH A;  4DR2 M;  3GQ5 A;  4QOZ C;  2ZBK B;  1IBM M;  4YY3 M;  4LF7 M;  1HR0 M;  1IM2 A;  2UUA M;  3ILK A;  4LJA A;  2X49 A;  2QBY B;  4KHP M;  4B7H A;  2XSZ A;  1MU5 A;  5FTJ A;  4X62 M;  3UMM A;  5ITX E;  5EP1 A;  1I94 M;  3SBJ A;  1E94 E;  3TPZ A;  3SC3 A;  4EIW A;  1XMQ M;  3GPU A;  4G4Q A;  4KO8 A;  3VDU A;  2OQ4 A;  4LF6 M;  2DZO B;  1N75 A;  1Q39 A;  1IQP A;  1DGB A;  1N36 M;  1HNZ M;  2DXI A;  1JQJ C;  3FUW A;  2Y20 A;  4BB9 A;  3SYK A;  5FTN A;  5ITX A;  2FFJ A;  2CV0 A;  1QAQ A;  1G3I A;  4AG6 A;  4DV7 M;  4FWG A;  5E26 A;  3U6E A;  4LFB M;  3AOG A;  4R3D A;  2X4A A;  3GRV A;  2R4E A;  3FYC A;  1HQY E;  4LJ6 A;  4B3T M;  3LQQ A;  1NHG C;  3TWL A;  4L78 A;  2F5Q A;  4M9S A;  3RFW A;  2H1R A;  2C99 A;  4HLQ A;  2L6O A;  4AKI A;  1K3X A;  3KVW A;  2ZAM A;  3K8Z A;  4Z6Y A;  4AKG A;  1QVR A;  3KDS E;  4AZF A;  2DHR A;  2ERC A;  4M9Z A;  3CF2 A;  3FTC A;  1N77 A;  2R46 A;  5EJC A;  3J7A S;  1NY6 A;  2QP9 X;  3U60 B;  4LF5 M;  3FYD A;  3U6M A;  1QYR A;  1QQW A;  4B7F A;  3GLH B;  2FE8 A;  2QCU A;  2J7N A;  5EP2 A;  3TWM A;  3FUT A;  1D2N A;  3GLF B;  3T1Y M;  2CUZ A;  3HJQ A;  3RE8 A;  3U6S A;  3VKH A;  2CHG A;  2O5R A;  1E9S A;  3UK6 A;  1IN6 A;  4DR4 M;  1XC8 A;  3GP1 A;  1PM5 A;  4AI6 A;  4LJ8 A;  5EXP A;  4DR6 M;  3PXG A;  1TH3 A;  4QNM A;  2XGN A;  1IN8 A;  2VQE M;  3FTD A;  1NNJ A;  5EP3 A;  2KEB A;  5EQT A;  1NVM A;  4M9X A;  3U5Z B;  2KW0 A;  4W5W A;  1NSF A;  5BR8 M;  4MGH A;  2XSZ D;  1DO0 A;  3JAM S;  3U61 A;  2K47 A;  2F5N A;  4TUW A;  4IBB A;  1HT2 E;  1NJG A;  5DNY A;  4NXM M;  1OJL A;  2V1U A;  2BJV A;  3KOX E;  2D7G A;  1Q3B A;  4NL4 H;  4NSR A;  1IXR C;  3A46 A;  3QWL A;  5ITR A;  2F5P A;  1WXQ A;  1Z5C A;  1NHW C;  3GRR A;  4FVM A;  4BBA A;  2Q2E B;  3M7G A;  3FTF A;  3EIH A;  4MGY E;  3AOE A;  4R7G A;  3CTW B;  4NRW A;  3GLI A;  3SAW A;  3L2A A;  4NOO B;  3K2L A;  4AW4 A;  4LZZ A;  2NQ8 C;  5C1B A;  4QHT A;  3HJS A;  4WW0 A;  3BOS A;  3GLG B;  2P5T A;  3VK8 A;  1DGG A;  1SXJ B;  4FCV A;  2G5G X;  4IBD A;  4GKJ M;  4LF4 M;  4WUR A;  1ZAE A;  3AFH A;  1L1Z A;  3AL0 C;  4JI0 M;  2UXD M;  4JV5 M;  2XZU A;  1R7R A;  4LRS A;  2Y0T A;  4JN6 A;  4NXN M;  2EO2 A;  1S3S A;  1TDZ A;  4FWH A;  4DV1 M;  2LXE A;  2QEN A;  3L25 A;  1N78 A;  3H4M A;  3A98 B;  2HL7 A;  3U6O A;  1XXH A;  3J80 S;  3SHF A;  1E9R A;  1J7K A;  4ZPX A;  2QZ4 A;  3UJN A;  2RGH A;  1DGH A;  3HGI A;  4L4U A;  1G41 A;  5H37 D;  3AOE C;  3IG8 A;  4JI4 M;  1L2D A;  1R2Y A;  1GL7 A;  5FSW A;  3M6A A;  2LNH C;  2YR0 A;  3MJ5 A;  3FUX A;  1YUB A;  4L16 A;  3E9S A;  2EA0 A;  2XH9 A;  2DWZ B;  4DR3 M;  4P16 A;  2CHV A;  4IIW A;  1IBL M;  4JI3 M;  1TH2 A;  2ZAO A;  2C96 A;  1XNQ M;  1XWI A;  4IJE A;  4X66 M;  4M0W A;  2UXB M;  3J2P B;  3MK6 A;  3KW6 A;  4A3V B;  3U6Q A;  4HL4 A;  5A2Q S;  5LMU M;  3KFU G;  3U61 B;  3KS8 A;  1QAM A;  4LF9 M;  4DV0 M;  3SAR A;  2E5L M;  3CF0 A;  4IBE A;  3I4Y A;  5FTM A;  3ZC7 B;  3AKZ A;  4GRI A;  3GPP A;  1Z59 A;  1J5E M;  3TE6 A;  2CFO A;  1N34 M;  2M60 A;  2XF3 A;  3T38 A;  5ITQ A;  3U6L A;  5EXS A;  3FKE A;  4B3M M;  1OFI A;  4LG2 A;  2F4V M;  2KZU A;  3GLI B;  1IY1 A;  3GRU A;  3HHZ A;  4LGM A;  4GIT A;  2YFQ A;  4IJF A;  2XEP A;  4DR5 M;  1LV7 A;  1W5T A;  2DWM A;  4GHL A;  4IBF A;  2M5Z A;  2BNK A;  1XNR M;  1JR3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...