2Z3XA

Structure of a protein-dna complex essential for dna protection in spore of bacillus species
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*GP*GP*GP*A)-3'
total genus 19
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00269 SASP Small, acid-soluble spore proteins, alpha/beta type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.910 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z3xA00
2Z3XA
chains in the Genus database with same CATH superfamily
5EQTA 2X4AA 3SAVA 4GC5A 1GABA 1R4GA 2CP8A 1NHWC 3KFUG 3KW6A 1IY1A 4CJ6A 4OX9M 4GKKM 2I7NA 2DVWB 3B7ZA 1KSFX 2RGOA 4FWGA 3SHFA 3FTEA 3HJQA 3FYDA 3E46A 2OOAA 4ZPXA 1AUAA 4LF9M 1IXRC 3C58A 3L2AA 2XF3A 3SFZA 3E9SA 2HL7A 2KZUA 4DV4M 1YLAA 4FCTA 3B7QA 2OO9A 1HNWM 2UXDM 2BWBA 3AV0A 2HHHM 3HY5A 3C3EA 1MU5A 2LWXA 1JR3E 2BWEA 1WIVA 2KA6B 1D2NA 3FUXA 2BJWA 2JP7A 3EIEA 1YE9A 5C1BA 4IBEA 1EE8A 3FKEA 5JI2E 1NV9A 3K8ZA 1VEGA 3J7BA 5EJCA 3E4RA 2F5NA 1XWIA 1TR8A 3AKZA 4FW9A 4DUZM 2L7IA 3RFWA 3U5ZB 4K0KM 2JY5A 2G3QA 1VEJA 4MGKE 2L4EA 4PCZA 4NRVA 4MH0E 5ITUA 4LGMA 4MM3B 4G4RA 2R4EA 3W67A 2K0BX 1VG5A 2QBYB 2KEBA 3T6PA 1L2BA 4BB9A 4JYAM 2KDLA 3SATA 3U6OA 3KS8A 4GH9A 4I5SA 1FJGM 2VDBB 2MR9A 1VDLA 2DHYA 4IJFA 1OJLA 3K1JA 1R5LA 1IN8A 1J7KA 5EXTA 2XGNA 2QZ4A 1IN7A 3MHVC 2Z4RA 5KQDA 1IN4A 2OOBA 3V76A 1NHGC 3FE3A 3EIHA 3GQ5A 4MGZE 1N33M 4LZJA 2XEPA 3GLHA 3A46A 2QSFX 4AW4A 4IJEA 4G4OA 2LVPC 1IFYA 4LG2A 4GEWA 4MB7A 4LJ6A 4L78A 1R6BX 1HQCA 2LH0A 2Z7JA 1GO5A 5EP2A 2JY8A 2BJVA 5EXXA 2H1RA 1WHCA 1MX0A 1OAIA 3IHPA 4QHSA 3SARA 4LF5M 3FUWA 3GPXA 2DZLA 4S12A 2FS1A 3B89A 2LHGA 5FTLA 1XB2B 3C3DA 3D8BA 4CIZA 5IREB 4L15A 3ZH9B 1MJGM 1JB0F 2DI0A 3K2LA 1LV7A 3GO8A 1BVSA 3UK6A 3I51A 3U61B 1G71A 2QHOB 2Z8YM 4PDIA 2MROB 2KXEA 4DR5M 3SAWA 3GLGE 4KT0F 1NJGA 3Q8GA 1UM8A 4P16A 2CV1A 2QP9X 3I4VA 5DYGA 1OFIA 3GRRA 2DKLA 4M9SA 4F2LA 3Q8XA 3NWLA 2L7HA 2LVNC 3JR4A 3IECA 2R45A 8CATA 1VDDA 2QPAA 2UUAM 4AKIA 4I81A 3U6MA 4B08A 3IG5A 1FNNA 3FUVA 3HJ8A 5FLXS 3AL0C 1ORYB 4KHPM 4AI6A 3VKGA 4A3VB 2YNMD 1R2YA 4G4NA 2KZSA 7CATA 1L2DA 1N32M 1N34M 2ZAOA 5KQ8A 3TL4X 1SG9A 2FOIC 5EXSA 4WURA 4EIWA 1GL7A 4D80A 2HAKA 1ZMUA 4X62M 2KHHA 3KSXA 2DAMA 4YHHM 1N77A 2EKKA 1DO0A 1SXJB 1DGGA 3J2PB 1XNQM 4DR2M 3HZJA 3SC3A 1IXSA 2WSFF 4CHTB 2UUBM 4R7GA 1IY0A 1QAQA 4L4UA 4ITQA 3KXEC 3TWLA 4OW0A 5BPVA 3DA1A 1T6OA 2B3TA 3KS4A 1R2ZA 4M9XA 4HLQA 1XMQM 1NY6A 2R46A 2ZTDA 3JR5A 1HT1E 4BBAA 3CF0A 3UGJA 4B7FA 3D8LA 5FSWA 1PJSA 5ITXE 4LJAA 3HWSA 3KP0E 3DOAA 3BBZA 1L2CA 1ZQ9A 2LNHC 2DAIA 2KRKA 4Z8XA 3PFIA 4CISA 1V34A 2DENA 1ZV1A 3PXGA 2R44A 2AHMA 1HT2E 4DR3M 4JI0M 4DR1M 3KOWE 1X37A 3B7NA 1PJJA 1W5SA 2Y20A 1IBKM 1QQWA 1TDZA 3U61A 4HL4A 5LMNM 1G59A 4LFCM 4NSRA 2GQFA 3KOYE 3GRUA 3T1HM 2UXCM 1JR3A 1NNUC 1LTMA 2YQZA 2JZ1A 4UN2B 2ZM6M 1PM5A 4NRWA 1R7RA 2JXNA 5EXPA 2R6FA 4KO8A 3GLIA 1RU3A 3QYBA 5F3WA 1CUKA 2MJ5B 2LXEA 1QUTA 4AG5A 4DV6M 2F5PA 3J27B 2JY7A 2CV0A 4I4LA 3MK6A 3QWLA 2FFJA 4MGIE 5KPZA 2DWNA 3ILKA 4LF4M 3U60B 1GLNA 1PJQA 1D0MA 3BXWA 4GIPA 1G8PA 4REZA 4G6ZA 4L6V6 1OTRA 3SYLA 4IBKA 3SBJA 3J7AS 3GQ3A 5IZ7D 2M60A 2DNAA 2K47A 1G41A 2HKJA 1ZAEA 3MMPA 1TGUA 2APLA 2V6ZM 2OQ4A 2C5RA 3PVSA 2E5LM 1PGYA 2O5RA 3GLIB 4M0WA 1PRBA 1QAMA 2L09A 4IIWA 4RF1A 3U6DA 3VK8A 2V1UA 3U6SA 3TE6A 2X49A 4QOSA 3W68A 2XZFA 2C9OA 3GP1A 1DGHA 1C1KA 3KP1E 2KRUA 3B74A 4LRSA 2C96A 2ZAMA 3FUUA 2XSZD 3GPPA 5ITQA 1F4IA 4B7HA 3CF2A 2QENA 3T15A 3I01M 2MGWA 4NL4H 3VLFB 4II7A 3K9PA 2DHRA 2C98A 2W82A 3GLHE 3L27A 2XSZA 4HEOA 4JI3M 4DV3M 1L1ZA 3LMMA 2XFSA 1QUSA 1HQYE 3B9PA 3GLFE 3GLIE 3KOZE 1I4WA 2K6BA 3MJ5A 2HWJA 3FUTA 1QDTA 2LVQD 4ANRA 3JAMS 1GJSA 1Z5CA 3T1YM 2LVOC 4DBGB 1V92A 3M0EA 2KNZA 4Z6YA 4PT5A 4GHAA 3HJSA 4FWHA 3I4YA 5KPRA 5JI3E 1D0KA 3THGA 2XLJA 3TQSA 1KYIA 4LFAM 1QYRA 1P3QQ 2KNAA 2JA2A 1NJFA 3BOSA 3LCUA 4NXMM 1IY2A 1IM2A 2CRUA 4JXJA 1E9SA 1VQ1A 2D7HA 4IBCA 5E26A 1Q3BA 3KVWA 3KDSE 2JUJA 2XZUA 3R9XB 1K3XA 2P5TA 4GKJM 1Z5BA 2VF7A 3FRIA 4LJ7A 4GHLA 2LVAA 3AFHA 2O01F 1VEKA 5DNYA 3U6LA 1OIPA 4GRIA 4OVZA 3H4MA 4FCWA 2H5XA 4JI2M 3SYKA 3HX3A 3LVWA 4B3MM 1N75A 1KFVA 2VF8A 1DGFA 2R65A 3GLHB 4IBGA 3L29A 1YSYA 3VDUA 4F1IA 4R71A 3HU2A 5KPTA 2Z3XA 2L2DA 3SHGB 2DWMA 3AOGA 4B7GA 1L8QA 4P17A 5LMUM 1G4AE 2NQ8C 1Z5AA 2C9CA 2GNOA 4LZZA 5C18A 5KO3A 2JNHA 3A45A 1GL6A 3UMMA 4LJ9A 3AOEC 3T38A 5FTKA 3K9OA 1NNJA 3J80S 2WZJA 3NBIA 2X8AA 4NOOB 4QNRA 3TWMA 1TH3A 3DZDA 5A2QS 1YUBA 3U6CA 2ERCA 2UU9M 2DWLA 3GLGB 1XXHA 3AOEA 4LF8M 4D81A 2M5ZA 1J09A 2QCUA 3VK7A 3VFDA 5H37D 1QVRA 2CE7A 1NO1A 2R4JA 3VDPA 3UJNA 3GPYA 4LF6M 3PNYA 4RF0A 1NVMA 1SXJA 2EKFA 4Q7JA 4YY3M 1XXHE 3CTWB 2DZNB 3ZCBB 3SAUA 1N36M 1WGLA 3TPZA 4DR7M 1WJ7A 1WGNA 1WXQA 2QQ8A 2D7EA 3SMPA 2OPFA 1XXHB 2N35A 1HNZM 3UZUA 1TH4A 1SXJC 3FTCA 5IWAM 1NV8A 3K92A 4LCBA 3LCVB 2Q2EB 1TTEA 4AKGA 1E9RA 1GKIA 1JR3D 4LJ5A 4X65M 1IBLM 4L8RC 4GC9A 3U6EA 1V33A 4DV2M 3FYCA 4FWDA 4XBOA 4IBJA 4LY6A 4AZFA 3GRYA 3GLFB 5EP3A 3LW5F 2Y0TA 5BR8M 1Q3CA 5ITXA 1QZMA 2JZ0A 4QHTA 1OAOC 4DR4M 4NC6A 2MH8A 3W0FA 4WW0A 1DV0A 2Y21A 2ZTCA 4OVZB 2CEAA 3QYEA 1IBMM 4MGHA 1XC8A 4W5WA 3CGWA 1S3SA 1C7YA 1DGHB 2BNKA 1IXSB 3A42A 1GVNA 1QDRA 4JI1M 1TH2A 2LBCA 5EP4A 1OFHA 4OU7A 3GRVA 1QZEA 4DV1M 1G3IA 2F4VM 5E6JA 2KW0A 2DAGA 2FE8A 1Z6TA 2FNAA 2EUCA 1UFZA 1H6UA 2CV2A 3HHZA 1QAOA 1MN3A 5FTJA 4QOZC 4LGYA 2G8LA 1SXJD 1NSFA 2ZBKB 2XH9A 1GJTA 2F5SA 4IBIA 2J7OA 2CUZA 3U60A 4AQYM 2F5OA 2CFOA 3R8FA 2CHGA 4FVMA 4KLNA 2G5GX 2O25A 2ZANA 1N78A 2L6OA 2D7GA 4MGYE 4NXNM 1Y8GA 1J5EM 2UUCM 5ITTA 3RE8A 3F92A 3LQRA 3HKPA 1IQPA 4L16A 1OIZA 3HHXA 4LJ4A 2R18A 2EA0A 1EFUB 3ZQJA 4IBFA 2A5YB 2FH0A 2R62A 3QAUA 4I8OA 4XGIA 2DWZB 4JI7M 2RKOA 1IN6A 1A5TA 4DUYM 3PNVA 1OKSA 1D0LA 4R3DA 3U5ZA 5DFLA 4X64M 1PJTA 1T43A 2VQEM 1HJPA 4CGYB 2R0IA 1Z59A 2I7PA 4NSOB 3J81S 4JI5M 2KNVA 2DZOB 2JY6B 2Z4SA 3FTFA 4X66M 5ITYA 2YR0A 3L25A 1TF0B 4WP2A 4LF7M 3FRHA 3L28A 2F5QA 3H4JA 5FTMA 3FTDA 3I04M 4M9ZA 4JI6M 3M7GA 2JWSA 2J5YA 1XHBA 4IBDA 4JI4M 4DV0M 2RGHA 3W0LB 5IT9S 4B3SM 1IXZA 1E32A 3IG8A 1I94M 4FD2A 3LQQA 4Y28F 1L1TA 4M0DA 3GPUA 3HU3A 5DYIA 2CHVA 2K9DA 4LJ8A 5L8RF 3U6PA 4G3OA 4B3RM 2EJSA 1K3WA 5FTNA 3LVVA 2LHCA 2VIIA 3HU1A 3A98B 2CWBA 3E21A 3RGPA 3SMSA 3WHLA 1SXJE 2L4FA 4LRTA 1PJIA 1TDHA 3NBXX 1WR1B 1E94E 2RRUA 1Q02A 3C9PA 3KSJA 4JI8M 1DGBA 2HCBA 3WHKA 1QANA 1W5TA 4IBBA 4XK8F 5ITRA 2YFQA 1HR0M 3AJIB 3L26A 1XMOM 3SASA 2DAKA 3ZC7B 4DV5M 5EP1A 3HGIA 4QNMA 2DAEA 4G4QA 1Q39A 2WSEF 3KOXE 3OTOM 3GLFA 1HNXM 2QBYA 2UXBM 1EIJA 4D82A 3TWKA 2VQFM 1ZMVA 1T3TA 4DV7M 1XNRM 4AKHA 4JV5M 4LFBM 5GKNA 4BLCA 4TUWA 4B3TM 4FCVA 4RNAA 1AIPC 3RGSA 3DFZA 1ZMWA 4KODA 2Y0QA 3GLGA 2EO2A 2DXIA 4GMQA 3FD9A 4JN6A 1IN5A 3GQ4A 2J7NA 3HHYA 2CHQA 4PD2A 3HHWA 2C99A 1NY5A 1DO2A 2V1CA 4GITA 1K82A 2WSCF 3M6AA 3U6QA 3CF6E 1JQJC 2LTUA 4RKUF 1OQYA 4AG6A 4PDGA 2QNJA 2XFTA 4DR6M 3VKHA
chains in the Genus database with same CATH topology
5EQTA 2X4AA 3SAVA 4GC5A 1NHWC 3KFUG 3KW6A 1IY1A 4OX9M 4GKKM 2I7NA 2DVWB 1KSFX 2RGOA 4FWGA 3SHFA 3FTEA 3HJQA 3FYDA 4ZPXA 4LF9M 1IXRC 3C58A 3L2AA 2XF3A 3SFZA 3E9SA 2HL7A 2KZUA 4DV4M 4FCTA 1HNWM 2UXDM 3AV0A 2HHHM 1MU5A 2LWXA 2KA6B 1D2NA 3FUXA 2BJWA 3EIEA 1YE9A 5C1BA 4IBEA 1EE8A 3FKEA 5JI2E 3K8ZA 3J7BA 5EJCA 3E4RA 2F5NA 1XWIA 4DUZM 3AKZA 4FW9A 3U5ZB 2L7IA 3RFWA 4K0KM 4MGKE 4PCZA 4NRVA 4MH0E 5ITUA 4LGMA 4MM3B 4G4RA 2R4EA 2QBYB 2KEBA 1L2BA 4BB9A 4JYAM 3SATA 3U6OA 3KS8A 4GH9A 4I5SA 1FJGM 4IJFA 1OJLA 3K1JA 1IN8A 1J7KA 5EXTA 2XGNA 2QZ4A 1IN7A 3MHVC 2Z4RA 5KQDA 1IN4A 1NHGC 3EIHA 3GQ5A 4MGZE 1N33M 4LZJA 2XEPA 3GLHA 3A46A 4AW4A 4IJEA 4G4OA 4LG2A 4MB7A 4LJ6A 4L78A 1R6BX 1HQCA 2LH0A 2Z7JA 5EP2A 2BJVA 5EXXA 2H1RA 1MX0A 4QHSA 3SARA 4LF5M 3FUWA 3GPXA 4S12A 5FTLA 3D8BA 5IREB 4L15A 3ZH9B 3K2LA 1LV7A 3GO8A 3UK6A 3I51A 3U61B 4PDIA 4DR5M 2KXEA 3SAWA 1NJGA 1UM8A 4P16A 2CV1A 2QP9X 3I4VA 5DYGA 1OFIA 3GRRA 4M9SA 3Q8XA 3NWLA 2L7HA 3JR4A 8CATA 2R45A 1VDDA 2QPAA 2UUAM 4AKIA 4I81A 3U6MA 4B08A 3IG5A 1FNNA 3FUVA 3HJ8A 5FLXS 3AL0C 1ORYB 4KHPM 4AI6A 3VKGA 4A3VB 2YNMD 1R2YA 4G4NA 2KZSA 7CATA 1L2DA 1N32M 1N34M 2ZAOA 5KQ8A 3TL4X 2FOIC 5EXSA 4WURA 4EIWA 1GL7A 4D80A 4YHHM 4X62M 3KSXA 1N77A 1DO0A 1SXJB 1DGGA 3J2PB 1XNQM 4DR2M 3SC3A 4CHTB 2UUBM 4R7GA 1IY0A 1QAQA 4L4UA 4ITQA 3KXEC 3TWLA 4OW0A 5BPVA 3DA1A 3KS4A 1R2ZA 4M9XA 4HLQA 1XMQM 1NY6A 2R46A 3JR5A 1HT1E 4BBAA 3CF0A 3UGJA 4B7FA 3D8LA 5FSWA 5ITXE 4LJAA 3HWSA 3KP0E 3DOAA 1L2CA 1ZQ9A 2LNHC 2KRKA 4Z8XA 3PFIA 4CISA 3PXGA 2AHMA 1HT2E 4DR3M 4JI0M 4DR1M 3KOWE 1X37A 1PJJA 1IBKM 1W5SA 2Y20A 1QQWA 1TDZA 3U61A 4HL4A 5LMNM 1G59A 4LFCM 4NSRA 3KOYE 3GRUA 3T1HM 2UXCM 1JR3A 1NNUC 2YQZA 2ZM6M 4NRWA 1PM5A 1R7RA 5EXPA 4KO8A 3GLIA 5F3WA 2LXEA 4AG5A 4DV6M 2F5PA 3J27B 2CV0A 4I4LA 3MK6A 3QWLA 2FFJA 4MGIE 5KPZA 2DWNA 3ILKA 4LF4M 3U60B 1GLNA 4GIPA 1G8PA 4REZA 4G6ZA 3J7AS 3SYLA 4IBKA 3SBJA 3GQ3A 5IZ7D 2M60A 1G41A 2HKJA 2K47A 1ZAEA 1TGUA 2V6ZM 2OQ4A 2C5RA 3PVSA 2E5LM 2O5RA 3GLIB 4M0WA 4IIWA 1QAMA 2L09A 2V1UA 4RF1A 3U6DA 3VK8A 3U6SA 3TE6A 2X49A 4QOSA 2XZFA 2C9OA 3GP1A 1DGHA 1C1KA 3KP1E 2KRUA 4LRSA 2C96A 2ZAMA 3FUUA 2XSZD 3GPPA 5ITQA 4B7HA 3CF2A 2QENA 3T15A 3VLFB 4NL4H 4II7A 2DHRA 2C98A 2W82A 3L27A 4JI3M 2XSZA 4DV3M 1L1ZA 3LMMA 2XFSA 1HQYE 3B9PA 3KOZE 1I4WA 3MJ5A 3FUTA 3JAMS 1Z5CA 3T1YM 4GHAA 3M0EA 4Z6YA 4PT5A 3HJSA 4FWHA 3I4YA 5KPRA 5JI3E 3THGA 2XLJA 3TQSA 1KYIA 4LFAM 1QYRA 2JA2A 1NJFA 3BOSA 4NXMM 1IY2A 1IM2A 4JXJA 5E26A 1E9SA 2D7HA 4IBCA 1Q3BA 3KVWA 3KDSE 2XZUA 3R9XB 1K3XA 2P5TA 4GKJM 1Z5BA 4LJ7A 4GHLA 3AFHA 5DNYA 3U6LA 4GRIA 4OVZA 3H4MA 4FCWA 4JI2M 3SYKA 3LVWA 4B3MM 1N75A 1KFVA 1DGFA 2R65A 3GLHB 4IBGA 3L29A 1YSYA 3VDUA 2Z3XA 3HU2A 5KPTA 3SHGB 2DWMA 3AOGA 4B7GA 1L8QA 5LMUM 1G4AE 2NQ8C 1Z5AA 2C9CA 4LZZA 5C18A 5KO3A 3A45A 1GL6A 3UMMA 4LJ9A 3AOEC 3T38A 5FTKA 1NNJA 3J80S 3NBIA 2X8AA 4NOOB 4QNRA 3TWMA 1TH3A 3DZDA 5A2QS 1YUBA 3U6CA 2ERCA 2UU9M 2DWLA 3GLGB 1XXHA 3AOEA 4LF8M 4D81A 2M5ZA 1J09A 2QCUA 3VK7A 3VFDA 5H37D 1QVRA 2CE7A 3VDPA 2R4JA 3UJNA 3GPYA 4LF6M 3PNYA 4RF0A 1NVMA 1SXJA 4YY3M 3SAUA 3CTWB 2DZNB 3ZCBB 1N36M 4DR7M 3TPZA 1WXQA 2D7EA 3SMPA 2OPFA 1XXHB 1HNZM 3UZUA 1TH4A 1SXJC 3FTCA 5IWAM 3K92A 4LCBA 2Q2EB 4AKGA 1E9RA 1GKIA 1JR3D 4LJ5A 4X65M 1IBLM 4L8RC 4GC9A 3U6EA 4DV2M 3FYCA 4FWDA 4XBOA 4IBJA 4LY6A 4AZFA 3GRYA 3GLFB 5EP3A 5BR8M 2Y0TA 1Q3CA 5ITXA 1QZMA 4QHTA 4DR4M 3W0FA 4WW0A 2Y21A 4OVZB 1IBMM 2CEAA 4MGHA 1XC8A 4W5WA 1S3SA 1DGHB 2BNKA 1IXSB 3A42A 1GVNA 4JI1M 1TH2A 5EP4A 1OFHA 4OU7A 3GRVA 4DV1M 1G3IA 5E6JA 2KW0A 2FE8A 1Z6TA 2FNAA 2EUCA 1H6UA 2CV2A 3HHZA 1QAOA 5FTJA 4QOZC 4LGYA 2G8LA 1SXJD 1NSFA 2ZBKB 2XH9A 2F5SA 4IBIA 2J7OA 2CUZA 3U60A 4AQYM 2F5OA 2CFOA 3R8FA 2CHGA 4FVMA 4KLNA 2G5GX 2ZANA 1N78A 2L6OA 2D7GA 4MGYE 4NXNM 2UUCM 1J5EM 5ITTA 3RE8A 3LQRA 3HKPA 1IQPA 4L16A 4LJ4A 3HHXA 2R18A 2EA0A 4IBFA 2A5YB 2R62A 3QAUA 4I8OA 4XGIA 2DWZB 4JI7M 2RKOA 1IN6A 4DUYM 3PNVA 4R3DA 3U5ZA 4X64M 2VQEM 4CGYB 1Z59A 2I7PA 4NSOB 3J81S 4JI5M 2DZOB 3FTFA 2Z4SA 4X66M 5ITYA 2YR0A 3L25A 4LF7M 3L28A 2F5QA 5FTMA 3FTDA 4JI6M 4M9ZA 3M7GA 1XHBA 4IBDA 4JI4M 4DV0M 2RGHA 3W0LB 5IT9S 4B3SM 1IXZA 1E32A 3IG8A 1I94M 4FD2A 3LQQA 1L1TA 4M0DA 3GPUA 3HU3A 5DYIA 2CHVA 4LJ8A 3U6PA 4B3RM 1K3WA 5FTNA 3LVVA 2VIIA 3HU1A 3A98B 3WHLA 3RGPA 3SMSA 1SXJE 4LRTA 1PJIA 1TDHA 1E94E 3KSJA 4JI8M 1DGBA 2HCBA 3WHKA 1QANA 1W5TA 4IBBA 5ITRA 2YFQA 1HR0M 3AJIB 3L26A 1XMOM 3SASA 3ZC7B 4DV5M 5EP1A 3HGIA 4QNMA 4G4QA 1Q39A 3KOXE 3GLFA 3OTOM 2QBYA 1HNXM 2UXBM 4D82A 3TWKA 2VQFM 4DV7M 1T3TA 1XNRM 4AKHA 4JV5M 4LFBM 5GKNA 4BLCA 4TUWA 4B3TM 4FCVA 4RNAA 3RGSA 3DFZA 4KODA 2Y0QA 3GLGA 2EO2A 2DXIA 4GMQA 3FD9A 4JN6A 1IN5A 3GQ4A 2J7NA 3HHYA 2CHQA 4PD2A 3HHWA 2C99A 1NY5A 1DO2A 2V1CA 4GITA 1K82A 3M6AA 3U6QA 3CF6E 1JQJC 4AG6A 4PDGA 2F4VM 4DR6M 2XFTA 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3X A; 
#chains in the Genus database with same CATH topology
 5EQT A;  2X4A A;  3SAV A;  4GC5 A;  1GAB A;  1R4G A;  2CP8 A;  1NHW C;  3KFU G;  3KW6 A;  1IY1 A;  4CJ6 A;  4OX9 M;  4GKK M;  2I7N A;  2DVW B;  3B7Z A;  1KSF X;  2RGO A;  4FWG A;  3SHF A;  3FTE A;  3HJQ A;  3FYD A;  3E46 A;  2OOA A;  4ZPX A;  1AUA A;  4LF9 M;  1IXR C;  3C58 A;  3L2A A;  2XF3 A;  3SFZ A;  3E9S A;  2HL7 A;  2KZU A;  4DV4 M;  1YLA A;  4FCT A;  3B7Q A;  2OO9 A;  1HNW M;  2UXD M;  2BWB A;  3AV0 A;  2HHH M;  3HY5 A;  3C3E A;  1MU5 A;  2LWX A;  1JR3 E;  2BWE A;  1WIV A;  2KA6 B;  1D2N A;  3FUX A;  2BJW A;  2JP7 A;  3EIE A;  1YE9 A;  5C1B A;  4IBE A;  1EE8 A;  3FKE A;  5JI2 E;  1NV9 A;  3K8Z A;  1VEG A;  3J7B A;  5EJC A;  3E4R A;  2F5N A;  1XWI A;  1TR8 A;  3AKZ A;  4FW9 A;  4DUZ M;  2L7I A;  3RFW A;  3U5Z B;  4K0K M;  2JY5 A;  2G3Q A;  1VEJ A;  4MGK E;  2L4E A;  4PCZ A;  4NRV A;  4MH0 E;  5ITU A;  4LGM A;  4MM3 B;  4G4R A;  2R4E A;  3W67 A;  2K0B X;  1VG5 A;  2QBY B;  2KEB A;  3T6P A;  1L2B A;  4BB9 A;  4JYA M;  2KDL A;  3SAT A;  3U6O A;  3KS8 A;  4GH9 A;  4I5S A;  1FJG M;  2VDB B;  2MR9 A;  1VDL A;  2DHY A;  4IJF A;  1OJL A;  3K1J A;  1R5L A;  1IN8 A;  1J7K A;  5EXT A;  2XGN A;  2QZ4 A;  1IN7 A;  3MHV C;  2Z4R A;  5KQD A;  1IN4 A;  2OOB A;  3V76 A;  1NHG C;  3FE3 A;  3EIH A;  3GQ5 A;  4MGZ E;  1N33 M;  4LZJ A;  2XEP A;  3GLH A;  3A46 A;  2QSF X;  4AW4 A;  4IJE A;  4G4O A;  2LVP C;  1IFY A;  4LG2 A;  4GEW A;  4MB7 A;  4LJ6 A;  4L78 A;  1R6B X;  1HQC A;  2LH0 A;  2Z7J A;  1GO5 A;  5EP2 A;  2JY8 A;  2BJV A;  5EXX A;  2H1R A;  1WHC A;  1MX0 A;  1OAI A;  3IHP A;  4QHS A;  3SAR A;  4LF5 M;  3FUW A;  3GPX A;  2DZL A;  4S12 A;  2FS1 A;  3B89 A;  2LHG A;  5FTL A;  1XB2 B;  3C3D A;  3D8B A;  4CIZ A;  5IRE B;  4L15 A;  3ZH9 B;  1MJG M;  1JB0 F;  2DI0 A;  3K2L A;  1LV7 A;  3GO8 A;  1BVS A;  3UK6 A;  3I51 A;  3U61 B;  1G71 A;  2QHO B;  2Z8Y M;  4PDI A;  2MRO B;  2KXE A;  4DR5 M;  3SAW A;  3GLG E;  4KT0 F;  1NJG A;  3Q8G A;  1UM8 A;  4P16 A;  2CV1 A;  2QP9 X;  3I4V A;  5DYG A;  1OFI A;  3GRR A;  2DKL A;  4M9S A;  4F2L A;  3Q8X A;  3NWL A;  2L7H A;  2LVN C;  3JR4 A;  3IEC A;  2R45 A;  8CAT A;  1VDD A;  2QPA A;  2UUA M;  4AKI A;  4I81 A;  3U6M A;  4B08 A;  3IG5 A;  1FNN A;  3FUV A;  3HJ8 A;  5FLX S;  3AL0 C;  1ORY B;  4KHP M;  4AI6 A;  3VKG A;  4A3V B;  2YNM D;  1R2Y A;  4G4N A;  2KZS A;  7CAT A;  1L2D A;  1N32 M;  1N34 M;  2ZAO A;  5KQ8 A;  3TL4 X;  1SG9 A;  2FOI C;  5EXS A;  4WUR A;  4EIW A;  1GL7 A;  4D80 A;  2HAK A;  1ZMU A;  4X62 M;  2KHH A;  3KSX A;  2DAM A;  4YHH M;  1N77 A;  2EKK A;  1DO0 A;  1SXJ B;  1DGG A;  3J2P B;  1XNQ M;  4DR2 M;  3HZJ A;  3SC3 A;  1IXS A;  2WSF F;  4CHT B;  2UUB M;  4R7G A;  1IY0 A;  1QAQ A;  4L4U A;  4ITQ A;  3KXE C;  3TWL A;  4OW0 A;  5BPV A;  3DA1 A;  1T6O A;  2B3T A;  3KS4 A;  1R2Z A;  4M9X A;  4HLQ A;  1XMQ M;  1NY6 A;  2R46 A;  2ZTD A;  3JR5 A;  1HT1 E;  4BBA A;  3CF0 A;  3UGJ A;  4B7F A;  3D8L A;  5FSW A;  1PJS A;  5ITX E;  4LJA A;  3HWS A;  3KP0 E;  3DOA A;  3BBZ A;  1L2C A;  1ZQ9 A;  2LNH C;  2DAI A;  2KRK A;  4Z8X A;  3PFI A;  4CIS A;  1V34 A;  2DEN A;  1ZV1 A;  3PXG A;  2R44 A;  2AHM A;  1HT2 E;  4DR3 M;  4JI0 M;  4DR1 M;  3KOW E;  1X37 A;  3B7N A;  1PJJ A;  1W5S A;  2Y20 A;  1IBK M;  1QQW A;  1TDZ A;  3U61 A;  4HL4 A;  5LMN M;  1G59 A;  4LFC M;  4NSR A;  2GQF A;  3KOY E;  3GRU A;  3T1H M;  2UXC M;  1JR3 A;  1NNU C;  1LTM A;  2YQZ A;  2JZ1 A;  4UN2 B;  2ZM6 M;  1PM5 A;  4NRW A;  1R7R A;  2JXN A;  5EXP A;  2R6F A;  4KO8 A;  3GLI A;  1RU3 A;  3QYB A;  5F3W A;  1CUK A;  2MJ5 B;  2LXE A;  1QUT A;  4AG5 A;  4DV6 M;  2F5P A;  3J27 B;  2JY7 A;  2CV0 A;  4I4L A;  3MK6 A;  3QWL A;  2FFJ A;  4MGI E;  5KPZ A;  2DWN A;  3ILK A;  4LF4 M;  3U60 B;  1GLN A;  1PJQ A;  1D0M A;  3BXW A;  4GIP A;  1G8P A;  4REZ A;  4G6Z A;  4L6V 6;  1OTR A;  3SYL A;  4IBK A;  3SBJ A;  3J7A S;  3GQ3 A;  5IZ7 D;  2M60 A;  2DNA A;  2K47 A;  1G41 A;  2HKJ A;  1ZAE A;  3MMP A;  1TGU A;  2APL A;  2V6Z M;  2OQ4 A;  2C5R A;  3PVS A;  2E5L M;  1PGY A;  2O5R A;  3GLI B;  4M0W A;  1PRB A;  1QAM A;  2L09 A;  4IIW A;  4RF1 A;  3U6D A;  3VK8 A;  2V1U A;  3U6S A;  3TE6 A;  2X49 A;  4QOS A;  3W68 A;  2XZF A;  2C9O A;  3GP1 A;  1DGH A;  1C1K A;  3KP1 E;  2KRU A;  3B74 A;  4LRS A;  2C96 A;  2ZAM A;  3FUU A;  2XSZ D;  3GPP A;  5ITQ A;  1F4I A;  4B7H A;  3CF2 A;  2QEN A;  3T15 A;  3I01 M;  2MGW A;  4NL4 H;  3VLF B;  4II7 A;  3K9P A;  2DHR A;  2C98 A;  2W82 A;  3GLH E;  3L27 A;  2XSZ A;  4HEO A;  4JI3 M;  4DV3 M;  1L1Z A;  3LMM A;  2XFS A;  1QUS A;  1HQY E;  3B9P A;  3GLF E;  3GLI E;  3KOZ E;  1I4W A;  2K6B A;  3MJ5 A;  2HWJ A;  3FUT A;  1QDT A;  2LVQ D;  4ANR A;  3JAM S;  1GJS A;  1Z5C A;  3T1Y M;  2LVO C;  4DBG B;  1V92 A;  3M0E A;  2KNZ A;  4Z6Y A;  4PT5 A;  4GHA A;  3HJS A;  4FWH A;  3I4Y A;  5KPR A;  5JI3 E;  1D0K A;  3THG A;  2XLJ A;  3TQS A;  1KYI A;  4LFA M;  1QYR A;  1P3Q Q;  2KNA A;  2JA2 A;  1NJF A;  3BOS A;  3LCU A;  4NXM M;  1IY2 A;  1IM2 A;  2CRU A;  4JXJ A;  1E9S A;  1VQ1 A;  2D7H A;  4IBC A;  5E26 A;  1Q3B A;  3KVW A;  3KDS E;  2JUJ A;  2XZU A;  3R9X B;  1K3X A;  2P5T A;  4GKJ M;  1Z5B A;  2VF7 A;  3FRI A;  4LJ7 A;  4GHL A;  2LVA A;  3AFH A;  2O01 F;  1VEK A;  5DNY A;  3U6L A;  1OIP A;  4GRI A;  4OVZ A;  3H4M A;  4FCW A;  2H5X A;  4JI2 M;  3SYK A;  3HX3 A;  3LVW A;  4B3M M;  1N75 A;  1KFV A;  2VF8 A;  1DGF A;  2R65 A;  3GLH B;  4IBG A;  3L29 A;  1YSY A;  3VDU A;  4F1I A;  4R71 A;  3HU2 A;  5KPT A;  2Z3X A;  2L2D A;  3SHG B;  2DWM A;  3AOG A;  4B7G A;  1L8Q A;  4P17 A;  5LMU M;  1G4A E;  2NQ8 C;  1Z5A A;  2C9C A;  2GNO A;  4LZZ A;  5C18 A;  5KO3 A;  2JNH A;  3A45 A;  1GL6 A;  3UMM A;  4LJ9 A;  3AOE C;  3T38 A;  5FTK A;  3K9O A;  1NNJ A;  3J80 S;  2WZJ A;  3NBI A;  2X8A A;  4NOO B;  4QNR A;  3TWM A;  1TH3 A;  3DZD A;  5A2Q S;  1YUB A;  3U6C A;  2ERC A;  2UU9 M;  2DWL A;  3GLG B;  1XXH A;  3AOE A;  4LF8 M;  4D81 A;  2M5Z A;  1J09 A;  2QCU A;  3VK7 A;  3VFD A;  5H37 D;  1QVR A;  2CE7 A;  1NO1 A;  2R4J A;  3VDP A;  3UJN A;  3GPY A;  4LF6 M;  3PNY A;  4RF0 A;  1NVM A;  1SXJ A;  2EKF A;  4Q7J A;  4YY3 M;  1XXH E;  3CTW B;  2DZN B;  3ZCB B;  3SAU A;  1N36 M;  1WGL A;  3TPZ A;  4DR7 M;  1WJ7 A;  1WGN A;  1WXQ A;  2QQ8 A;  2D7E A;  3SMP A;  2OPF A;  1XXH B;  2N35 A;  1HNZ M;  3UZU A;  1TH4 A;  1SXJ C;  3FTC A;  5IWA M;  1NV8 A;  3K92 A;  4LCB A;  3LCV B;  2Q2E B;  1TTE A;  4AKG A;  1E9R A;  1GKI A;  1JR3 D;  4LJ5 A;  4X65 M;  1IBL M;  4L8R C;  4GC9 A;  3U6E A;  1V33 A;  4DV2 M;  3FYC A;  4FWD A;  4XBO A;  4IBJ A;  4LY6 A;  4AZF A;  3GRY A;  3GLF B;  5EP3 A;  3LW5 F;  2Y0T A;  5BR8 M;  1Q3C A;  5ITX A;  1QZM A;  2JZ0 A;  4QHT A;  1OAO C;  4DR4 M;  4NC6 A;  2MH8 A;  3W0F A;  4WW0 A;  1DV0 A;  2Y21 A;  2ZTC A;  4OVZ B;  2CEA A;  3QYE A;  1IBM M;  4MGH A;  1XC8 A;  4W5W A;  3CGW A;  1S3S A;  1C7Y A;  1DGH B;  2BNK A;  1IXS B;  3A42 A;  1GVN A;  1QDR A;  4JI1 M;  1TH2 A;  2LBC A;  5EP4 A;  1OFH A;  4OU7 A;  3GRV A;  1QZE A;  4DV1 M;  1G3I A;  2F4V M;  5E6J A;  2KW0 A;  2DAG A;  2FE8 A;  1Z6T A;  2FNA A;  2EUC A;  1UFZ A;  1H6U A;  2CV2 A;  3HHZ A;  1QAO A;  1MN3 A;  5FTJ A;  4QOZ C;  4LGY A;  2G8L A;  1SXJ D;  1NSF A;  2ZBK B;  2XH9 A;  1GJT A;  2F5S A;  4IBI A;  2J7O A;  2CUZ A;  3U60 A;  4AQY M;  2F5O A;  2CFO A;  3R8F A;  2CHG A;  4FVM A;  4KLN A;  2G5G X;  2O25 A;  2ZAN A;  1N78 A;  2L6O A;  2D7G A;  4MGY E;  4NXN M;  1Y8G A;  1J5E M;  2UUC M;  5ITT A;  3RE8 A;  3F92 A;  3LQR A;  3HKP A;  1IQP A;  4L16 A;  1OIZ A;  3HHX A;  4LJ4 A;  2R18 A;  2EA0 A;  1EFU B;  3ZQJ A;  4IBF A;  2A5Y B;  2FH0 A;  2R62 A;  3QAU A;  4I8O A;  4XGI A;  2DWZ B;  4JI7 M;  2RKO A;  1IN6 A;  1A5T A;  4DUY M;  3PNV A;  1OKS A;  1D0L A;  4R3D A;  3U5Z A;  5DFL A;  4X64 M;  1PJT A;  1T43 A;  2VQE M;  1HJP A;  4CGY B;  2R0I A;  1Z59 A;  2I7P A;  4NSO B;  3J81 S;  4JI5 M;  2KNV A;  2DZO B;  2JY6 B;  2Z4S A;  3FTF A;  4X66 M;  5ITY A;  2YR0 A;  3L25 A;  1TF0 B;  4WP2 A;  4LF7 M;  3FRH A;  3L28 A;  2F5Q A;  3H4J A;  5FTM A;  3FTD A;  3I04 M;  4M9Z A;  4JI6 M;  3M7G A;  2JWS A;  2J5Y A;  1XHB A;  4IBD A;  4JI4 M;  4DV0 M;  2RGH A;  3W0L B;  5IT9 S;  4B3S M;  1IXZ A;  1E32 A;  3IG8 A;  1I94 M;  4FD2 A;  3LQQ A;  4Y28 F;  1L1T A;  4M0D A;  3GPU A;  3HU3 A;  5DYI A;  2CHV A;  2K9D A;  4LJ8 A;  5L8R F;  3U6P A;  4G3O A;  4B3R M;  2EJS A;  1K3W A;  5FTN A;  3LVV A;  2LHC A;  2VII A;  3HU1 A;  3A98 B;  2CWB A;  3E21 A;  3RGP A;  3SMS A;  3WHL A;  1SXJ E;  2L4F A;  4LRT A;  1PJI A;  1TDH A;  3NBX X;  1WR1 B;  1E94 E;  2RRU A;  1Q02 A;  3C9P A;  3KSJ A;  4JI8 M;  1DGB A;  2HCB A;  3WHK A;  1QAN A;  1W5T A;  4IBB A;  4XK8 F;  5ITR A;  2YFQ A;  1HR0 M;  3AJI B;  3L26 A;  1XMO M;  3SAS A;  2DAK A;  3ZC7 B;  4DV5 M;  5EP1 A;  3HGI A;  4QNM A;  2DAE A;  4G4Q A;  1Q39 A;  2WSE F;  3KOX E;  3OTO M;  3GLF A;  1HNX M;  2QBY A;  2UXB M;  1EIJ A;  4D82 A;  3TWK A;  2VQF M;  1ZMV A;  1T3T A;  4DV7 M;  1XNR M;  4AKH A;  4JV5 M;  4LFB M;  5GKN A;  4BLC A;  4TUW A;  4B3T M;  4FCV A;  4RNA A;  1AIP C;  3RGS A;  3DFZ A;  1ZMW A;  4KOD A;  2Y0Q A;  3GLG A;  2EO2 A;  2DXI A;  4GMQ A;  3FD9 A;  4JN6 A;  1IN5 A;  3GQ4 A;  2J7N A;  3HHY A;  2CHQ A;  4PD2 A;  3HHW A;  2C99 A;  1NY5 A;  1DO2 A;  2V1C A;  4GIT A;  1K82 A;  2WSC F;  3M6A A;  3U6Q A;  3CF6 E;  1JQJ C;  2LTU A;  4RKU F;  1OQY A;  4AG6 A;  4PDG A;  2QNJ A;  2XFT A;  4DR6 M;  3VKH A; 
#chains in the Genus database with same CATH homology
 5EQT A;  2X4A A;  3SAV A;  4GC5 A;  1NHW C;  3KFU G;  3KW6 A;  1IY1 A;  4OX9 M;  4GKK M;  2I7N A;  2DVW B;  1KSF X;  2RGO A;  4FWG A;  3SHF A;  3FTE A;  3HJQ A;  3FYD A;  4ZPX A;  4LF9 M;  1IXR C;  3C58 A;  3L2A A;  2XF3 A;  3SFZ A;  3E9S A;  2HL7 A;  2KZU A;  4DV4 M;  4FCT A;  1HNW M;  2UXD M;  3AV0 A;  2HHH M;  1MU5 A;  2LWX A;  2KA6 B;  1D2N A;  3FUX A;  2BJW A;  3EIE A;  1YE9 A;  5C1B A;  4IBE A;  1EE8 A;  3FKE A;  5JI2 E;  3K8Z A;  3J7B A;  5EJC A;  3E4R A;  2F5N A;  1XWI A;  4DUZ M;  3AKZ A;  4FW9 A;  3U5Z B;  2L7I A;  3RFW A;  4K0K M;  4MGK E;  4PCZ A;  4NRV A;  4MH0 E;  5ITU A;  4LGM A;  4MM3 B;  4G4R A;  2R4E A;  2QBY B;  2KEB A;  1L2B A;  4BB9 A;  4JYA M;  3SAT A;  3U6O A;  3KS8 A;  4GH9 A;  4I5S A;  1FJG M;  4IJF A;  1OJL A;  3K1J A;  1IN8 A;  1J7K A;  5EXT A;  2XGN A;  2QZ4 A;  1IN7 A;  3MHV C;  2Z4R A;  5KQD A;  1IN4 A;  1NHG C;  3EIH A;  3GQ5 A;  4MGZ E;  1N33 M;  4LZJ A;  2XEP A;  3GLH A;  3A46 A;  4AW4 A;  4IJE A;  4G4O A;  4LG2 A;  4MB7 A;  4LJ6 A;  4L78 A;  1R6B X;  1HQC A;  2LH0 A;  2Z7J A;  5EP2 A;  2BJV A;  5EXX A;  2H1R A;  1MX0 A;  4QHS A;  3SAR A;  4LF5 M;  3FUW A;  3GPX A;  4S12 A;  5FTL A;  3D8B A;  5IRE B;  4L15 A;  3ZH9 B;  3K2L A;  1LV7 A;  3GO8 A;  3UK6 A;  3I51 A;  3U61 B;  4PDI A;  4DR5 M;  2KXE A;  3SAW A;  1NJG A;  1UM8 A;  4P16 A;  2CV1 A;  2QP9 X;  3I4V A;  5DYG A;  1OFI A;  3GRR A;  4M9S A;  3Q8X A;  3NWL A;  2L7H A;  3JR4 A;  8CAT A;  2R45 A;  1VDD A;  2QPA A;  2UUA M;  4AKI A;  4I81 A;  3U6M A;  4B08 A;  3IG5 A;  1FNN A;  3FUV A;  3HJ8 A;  5FLX S;  3AL0 C;  1ORY B;  4KHP M;  4AI6 A;  3VKG A;  4A3V B;  2YNM D;  1R2Y A;  4G4N A;  2KZS A;  7CAT A;  1L2D A;  1N32 M;  1N34 M;  2ZAO A;  5KQ8 A;  3TL4 X;  2FOI C;  5EXS A;  4WUR A;  4EIW A;  1GL7 A;  4D80 A;  4YHH M;  4X62 M;  3KSX A;  1N77 A;  1DO0 A;  1SXJ B;  1DGG A;  3J2P B;  1XNQ M;  4DR2 M;  3SC3 A;  4CHT B;  2UUB M;  4R7G A;  1IY0 A;  1QAQ A;  4L4U A;  4ITQ A;  3KXE C;  3TWL A;  4OW0 A;  5BPV A;  3DA1 A;  3KS4 A;  1R2Z A;  4M9X A;  4HLQ A;  1XMQ M;  1NY6 A;  2R46 A;  3JR5 A;  1HT1 E;  4BBA A;  3CF0 A;  3UGJ A;  4B7F A;  3D8L A;  5FSW A;  5ITX E;  4LJA A;  3HWS A;  3KP0 E;  3DOA A;  1L2C A;  1ZQ9 A;  2LNH C;  2KRK A;  4Z8X A;  3PFI A;  4CIS A;  3PXG A;  2AHM A;  1HT2 E;  4DR3 M;  4JI0 M;  4DR1 M;  3KOW E;  1X37 A;  1PJJ A;  1IBK M;  1W5S A;  2Y20 A;  1QQW A;  1TDZ A;  3U61 A;  4HL4 A;  5LMN M;  1G59 A;  4LFC M;  4NSR A;  3KOY E;  3GRU A;  3T1H M;  2UXC M;  1JR3 A;  1NNU C;  2YQZ A;  2ZM6 M;  4NRW A;  1PM5 A;  1R7R A;  5EXP A;  4KO8 A;  3GLI A;  5F3W A;  2LXE A;  4AG5 A;  4DV6 M;  2F5P A;  3J27 B;  2CV0 A;  4I4L A;  3MK6 A;  3QWL A;  2FFJ A;  4MGI E;  5KPZ A;  2DWN A;  3ILK A;  4LF4 M;  3U60 B;  1GLN A;  4GIP A;  1G8P A;  4REZ A;  4G6Z A;  3J7A S;  3SYL A;  4IBK A;  3SBJ A;  3GQ3 A;  5IZ7 D;  2M60 A;  1G41 A;  2HKJ A;  2K47 A;  1ZAE A;  1TGU A;  2V6Z M;  2OQ4 A;  2C5R A;  3PVS A;  2E5L M;  2O5R A;  3GLI B;  4M0W A;  4IIW A;  1QAM A;  2L09 A;  2V1U A;  4RF1 A;  3U6D A;  3VK8 A;  3U6S A;  3TE6 A;  2X49 A;  4QOS A;  2XZF A;  2C9O A;  3GP1 A;  1DGH A;  1C1K A;  3KP1 E;  2KRU A;  4LRS A;  2C96 A;  2ZAM A;  3FUU A;  2XSZ D;  3GPP A;  5ITQ A;  4B7H A;  3CF2 A;  2QEN A;  3T15 A;  3VLF B;  4NL4 H;  4II7 A;  2DHR A;  2C98 A;  2W82 A;  3L27 A;  4JI3 M;  2XSZ A;  4DV3 M;  1L1Z A;  3LMM A;  2XFS A;  1HQY E;  3B9P A;  3KOZ E;  1I4W A;  3MJ5 A;  3FUT A;  3JAM S;  1Z5C A;  3T1Y M;  4GHA A;  3M0E A;  4Z6Y A;  4PT5 A;  3HJS A;  4FWH A;  3I4Y A;  5KPR A;  5JI3 E;  3THG A;  2XLJ A;  3TQS A;  1KYI A;  4LFA M;  1QYR A;  2JA2 A;  1NJF A;  3BOS A;  4NXM M;  1IY2 A;  1IM2 A;  4JXJ A;  5E26 A;  1E9S A;  2D7H A;  4IBC A;  1Q3B A;  3KVW A;  3KDS E;  2XZU A;  3R9X B;  1K3X A;  2P5T A;  4GKJ M;  1Z5B A;  4LJ7 A;  4GHL A;  3AFH A;  5DNY A;  3U6L A;  4GRI A;  4OVZ A;  3H4M A;  4FCW A;  4JI2 M;  3SYK A;  3LVW A;  4B3M M;  1N75 A;  1KFV A;  1DGF A;  2R65 A;  3GLH B;  4IBG A;  3L29 A;  1YSY A;  3VDU A;  2Z3X A;  3HU2 A;  5KPT A;  3SHG B;  2DWM A;  3AOG A;  4B7G A;  1L8Q A;  5LMU M;  1G4A E;  2NQ8 C;  1Z5A A;  2C9C A;  4LZZ A;  5C18 A;  5KO3 A;  3A45 A;  1GL6 A;  3UMM A;  4LJ9 A;  3AOE C;  3T38 A;  5FTK A;  1NNJ A;  3J80 S;  3NBI A;  2X8A A;  4NOO B;  4QNR A;  3TWM A;  1TH3 A;  3DZD A;  5A2Q S;  1YUB A;  3U6C A;  2ERC A;  2UU9 M;  2DWL A;  3GLG B;  1XXH A;  3AOE A;  4LF8 M;  4D81 A;  2M5Z A;  1J09 A;  2QCU A;  3VK7 A;  3VFD A;  5H37 D;  1QVR A;  2CE7 A;  3VDP A;  2R4J A;  3UJN A;  3GPY A;  4LF6 M;  3PNY A;  4RF0 A;  1NVM A;  1SXJ A;  4YY3 M;  3SAU A;  3CTW B;  2DZN B;  3ZCB B;  1N36 M;  4DR7 M;  3TPZ A;  1WXQ A;  2D7E A;  3SMP A;  2OPF A;  1XXH B;  1HNZ M;  3UZU A;  1TH4 A;  1SXJ C;  3FTC A;  5IWA M;  3K92 A;  4LCB A;  2Q2E B;  4AKG A;  1E9R A;  1GKI A;  1JR3 D;  4LJ5 A;  4X65 M;  1IBL M;  4L8R C;  4GC9 A;  3U6E A;  4DV2 M;  3FYC A;  4FWD A;  4XBO A;  4IBJ A;  4LY6 A;  4AZF A;  3GRY A;  3GLF B;  5EP3 A;  5BR8 M;  2Y0T A;  1Q3C A;  5ITX A;  1QZM A;  4QHT A;  4DR4 M;  3W0F A;  4WW0 A;  2Y21 A;  4OVZ B;  1IBM M;  2CEA A;  4MGH A;  1XC8 A;  4W5W A;  1S3S A;  1DGH B;  2BNK A;  1IXS B;  3A42 A;  1GVN A;  4JI1 M;  1TH2 A;  5EP4 A;  1OFH A;  4OU7 A;  3GRV A;  4DV1 M;  1G3I A;  5E6J A;  2KW0 A;  2FE8 A;  1Z6T A;  2FNA A;  2EUC A;  1H6U A;  2CV2 A;  3HHZ A;  1QAO A;  5FTJ A;  4QOZ C;  4LGY A;  2G8L A;  1SXJ D;  1NSF A;  2ZBK B;  2XH9 A;  2F5S A;  4IBI A;  2J7O A;  2CUZ A;  3U60 A;  4AQY M;  2F5O A;  2CFO A;  3R8F A;  2CHG A;  4FVM A;  4KLN A;  2G5G X;  2ZAN A;  1N78 A;  2L6O A;  2D7G A;  4MGY E;  4NXN M;  2UUC M;  1J5E M;  5ITT A;  3RE8 A;  3LQR A;  3HKP A;  1IQP A;  4L16 A;  4LJ4 A;  3HHX A;  2R18 A;  2EA0 A;  4IBF A;  2A5Y B;  2R62 A;  3QAU A;  4I8O A;  4XGI A;  2DWZ B;  4JI7 M;  2RKO A;  1IN6 A;  4DUY M;  3PNV A;  4R3D A;  3U5Z A;  4X64 M;  2VQE M;  4CGY B;  1Z59 A;  2I7P A;  4NSO B;  3J81 S;  4JI5 M;  2DZO B;  3FTF A;  2Z4S A;  4X66 M;  5ITY A;  2YR0 A;  3L25 A;  4LF7 M;  3L28 A;  2F5Q A;  5FTM A;  3FTD A;  4JI6 M;  4M9Z A;  3M7G A;  1XHB A;  4IBD A;  4JI4 M;  4DV0 M;  2RGH A;  3W0L B;  5IT9 S;  4B3S M;  1IXZ A;  1E32 A;  3IG8 A;  1I94 M;  4FD2 A;  3LQQ A;  1L1T A;  4M0D A;  3GPU A;  3HU3 A;  5DYI A;  2CHV A;  4LJ8 A;  3U6P A;  4B3R M;  1K3W A;  5FTN A;  3LVV A;  2VII A;  3HU1 A;  3A98 B;  3WHL A;  3RGP A;  3SMS A;  1SXJ E;  4LRT A;  1PJI A;  1TDH A;  1E94 E;  3KSJ A;  4JI8 M;  1DGB A;  2HCB A;  3WHK A;  1QAN A;  1W5T A;  4IBB A;  5ITR A;  2YFQ A;  1HR0 M;  3AJI B;  3L26 A;  1XMO M;  3SAS A;  3ZC7 B;  4DV5 M;  5EP1 A;  3HGI A;  4QNM A;  4G4Q A;  1Q39 A;  3KOX E;  3GLF A;  3OTO M;  2QBY A;  1HNX M;  2UXB M;  4D82 A;  3TWK A;  2VQF M;  4DV7 M;  1T3T A;  1XNR M;  4AKH A;  4JV5 M;  4LFB M;  5GKN A;  4BLC A;  4TUW A;  4B3T M;  4FCV A;  4RNA A;  3RGS A;  3DFZ A;  4KOD A;  2Y0Q A;  3GLG A;  2EO2 A;  2DXI A;  4GMQ A;  3FD9 A;  4JN6 A;  1IN5 A;  3GQ4 A;  2J7N A;  3HHY A;  2CHQ A;  4PD2 A;  3HHW A;  2C99 A;  1NY5 A;  1DO2 A;  2V1C A;  4GIT A;  1K82 A;  3M6A A;  3U6Q A;  3CF6 E;  1JQJ C;  4AG6 A;  4PDG A;  2F4V M;  4DR6 M;  2XFT A;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...