2Z3XA

Structure of a protein-dna complex essential for dna protection in spore of bacillus species
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*GP*GP*GP*A)-3'
total genus 19
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00269 SASP Small, acid-soluble spore proteins, alpha/beta type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.910 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z3xA00
2Z3XA
chains in the Genus database with same CATH superfamily
1WXQA 1QUTA 3AKZA 3KP0E 5E6JA 4DR4M 2DZLA 4BLCA 4G4QA 4AKIA 1G4AE 1ZMUA 1QUSA 3E21A 4IBIA 4DV3M 4NL4H 1Z5AA 2R46A 3C9PA 3ILKA 3I4VA 8CATA 5ITTA 2KRKA 3UK6A 2G3QA 3TQSA 2DENA 1IBKM 1D0KA 2R44A 2R62A 5JI2E 4DV5M 3J7BA 3KP1E 4IBCA 1OIPA 4OVZA 1QYRA 5EXSA 4PD2A 2DWNA 1ZQ9A 4HL4A 2CHGA 3FUWA 3GLGA 2CV0A 4G4RA 1RU3A 3K2LA 3TWKA 2JY5A 4DV6M 2Y0TA 2HKJA 3FUTA 1IN5A 1VEGA 4JN6A 3W0LB 3UGJA 3OTOM 2MH8A 4AG6A 3U5ZB 4IJEA 1ZV1A 3J7AS 3AOEA 3B7QA 2X4AA 1GABA 2CFOA 4PCZA 2F5NA 1TH3A 3LW5F 4RKUF 2DAKA 2YQZA 1PGYA 3J81S 2F5PA 3L26A 3QAUA 3HHYA 1G3IA 3FYDA 3LQRA 2CV1A 1V33A 4FWGA 1Q02A 3A45A 1OAIA 1VDLA 1V34A 1GL6A 2D7HA 4XBOA 3GRUA 3E4RA 4GC5A 1N75A 1PM5A 4LFCM 1HNWM 2X8AA 3SHGB 3HJQA 4L8RC 4R7GA 3LCVB 3IG5A 2R65A 2ERCA 3L2AA 2FFJA 4NXNM 5DYIA 4B3MM 3AL0C 3R9XB 3GLIE 2YFQA 1SXJE 2VQEM 4LCBA 1MU5A 3FYCA 4M0WA 1E9RA 2LVPC 3PFIA 1JQJC 4HLQA 1J7KA 2R4JA 3RFWA 2FS1A 3KS8A 2LVAA 1IXZA 1XWIA 2ZTDA 1WIVA 4CGYB 3HJ8A 5EXTA 1GVNA 1IQPA 1WGNA 2K6BA 2JZ0A 1ORYB 3K9OA 3GLFE 3R8FA 2MROB 2L4FA 1IM2A 1LV7A 1HT1E 1PJQA 2C98A 5ITXE 4DV2M 2L7IA 3SAUA 2R6FA 1TH2A 4DUYM 3K9PA 4DR3M 3BBZA 2F4VM 5FTMA 3TWLA 2V6ZM 2WSEF 3FRIA 1GL7A 2BJVA 3DZDA 1KYIA 2R0IA 3SHFA 2UXCM 1W5TA 1TH4A 1QAOA 3HX3A 1JR3E 3HY5A 4LJ6A 5KQ8A 3U6DA 2CEAA 4PT5A 3GQ4A 2B3TA 4PDIA 1H6UA 2DHYA 3DA1A 4LJ5A 5E26A 2JWSA 1YLAA 3SAWA 3U6SA 3UMMA 1E94E 1KFVA 4AW4A 3I4YA 2DWLA 2D7GA 2Z4SA 4LGYA 1NJGA 4G4NA 3KOZE 5KQDA 4WURA 4MGIE 5EJCA 1VDDA 3A98B 4WW0A 4JI7M 3T38A 3B7ZA 4NC6A 2W82A 3U5ZA 2E5LM 4P17A 1JR3D 4KHPM 2KHHA 3A46A 4L6V6 2LH0A 1NY6A 5DFLA 3GPXA 2QPAA 3EIHA 3U61A 1LTMA 1IXSB 2O5RA 2JXNA 4DV1M 2GQFA 1C1KA 2XZFA 1HNXM 1MX0A 1N34M 4JXJA 1IY0A 3C3EA 4QHTA 1GJTA 3HHZA 1D2NA 2EO2A 3J2PB 4X65M 1T43A 1N77A 1XHBA 1DGHB 2C96A 4I5SA 1G8PA 4FCTA 5GKNA 3I04M 3GLHE 4M0DA 3GPPA 2RGHA 2WSCF 4AKGA 1QAMA 5DNYA 1TGUA 2DAMA 2KNAA 2QHOB 3A42A 4ZPXA 1UFZA 2KZUA 3IHPA 2CHVA 2ZAMA 2LVOC 3I51A 4I4LA 4MGKE 2QCUA 5FSWA 3AFHA 3AOGA 4MGHA 5FLXS 4L78A 1GLNA 4LF7M 3U6EA 4JI6M 1XNRM 4GHAA 2MJ5B 2DHRA 1SXJB 1AUAA 2DKLA 4IBJA 1L1ZA 2DAGA 1SXJA 3L27A 5EXXA 1K3XA 5A2QS 3GPYA 1E32A 2XZUA 4IIWA 4IBGA 2C99A 2KW0A 1XXHB 2JUJA 2R45A 1QDTA 2CRUA 3KW6A 1WHCA 3DFZA 3GQ5A 2L6OA 1YUBA 2UU9M 1Y8GA 4DR7M 1NV9A 1IXRC 1R7RA 1JR3A 1R4GA 4FWHA 2LHGA 3SMSA 1IXSA 3KS4A 3B74A 2I7PA 4IBKA 2JZ1A 3SC3A 2KXEA 3MMPA 3U6QA 2EUCA 1TR8A 5FTLA 4FCVA 5KO3A 2J5YA 1DGHA 4NSOB 3VLFB 5H37D 4JI4M 5LMUM 1DGFA 2K0BX 1NO1A 1IBLM 3CF6E 4S12A 3U61B 3D8LA 2LVQD 2QZ4A 2ZBKB 4KODA 4D81A 3FTCA 2CHQA 2VF8A 5EP2A 2QSFX 3B7NA 1Q3BA 4B3RM 1ZMWA 4Q7JA 3J80S 2CWBA 2KNZA 3CGWA 3GLHB 3LCUA 5BPVA 1IN7A 2Q2EB 2RRUA 4DV4M 4Z6YA 1D0LA 3WHKA 2Z4RA 3T1HM 1HQYE 2DAIA 3T1YM 4LF4M 2XFSA 4DV7M 3NWLA 2KNVA 1WR1B 5ITYA 4F2LA 2HAKA 3H4JA 3ZQJA 3E46A 2BJWA 3M0EA 4K0KM 3TPZA 1OJLA 4DV0M 3FUVA 4NRVA 2EA0A 2FH0A 3KFUG 1N36M 5FTJA 1A5TA 3LQQA 3VKHA 3HZJA 2DNAA 3IECA 3W0FA 1EE8A 1L1TA 4G4OA 4LJAA 2MR9A 3L25A 3AV0A 3QWLA 2L09A 4G6ZA 2EJSA 4JI0M 2Z8YM 3K8ZA 2QNJA 4LZZA 2VQFM 2XSZD 4JV5M 2APLA 3U6PA 1K82A 2F5OA 3W68A 1N33M 1TDHA 1R5LA 3BXWA 4B3SM 4X64M 2G8LA 3KOYE 2HWJA 5KPRA 1T3TA 1ZAEA 2LHCA 3EIEA 2UXBM 2OOBA 2G5GX 3VKGA 3C58A 4IBDA 4LG2A 4AKHA 1MJGM 2Z3XA 1E9SA 5C1BA 4DR6M 2D7EA 1HT2E 3FKEA 3M6AA 3V76A 4XK8F 1QANA 2UXDM 1OAOC 3L28A 3U6LA 4L16A 3RGPA 1QDRA 4BBAA 5C18A 2C9OA 1XXHA 3ZH9B 3Q8GA 1N32M 3U6CA 1GKIA 1R6BX 3MJ5A 2CUZA 2XFTA 4IJFA 4NRWA 1VEJA 1PJJA 2M5ZA 1DGBA 3HGIA 1DO0A 1I4WA 3GLFB 2UUAM 4FW9A 5IREB 2DWMA 2X49A 7CATA 2N35A 3FE3A 4GKJM 3HWSA 3GO8A 2CV2A 3KSXA 3GRRA 4Y28F 1V92A 1KSFX 2KDLA 2KEBA 1EFUB 3B89A 2K47A 3LMMA 4HEOA 3RE8A 1IY2A 3K1JA 4TUWA 1IN8A 4MM3B 3GQ3A 4LFBM 4I81A 1QQWA 4RF0A 2JY8A 3QYEA 5JI3E 4JI8M 4W5WA 2OOAA 4IBFA 2JY6B 4A3VB 3FD9A 4GITA 1J09A 2J7OA 4LF8M 1XXHE 3UZUA 3SFZA 3QYBA 4FD2A 3DOAA 4LJ9A 3GLIB 1J5EM 4LGMA 3SMPA 2R18A 3AOEC 2HL7A 5KPZA 1HNZM 4UN2B 4MB7A 3FUUA 2H5XA 3KXEC 3ZC7B 3W67A 1I94M 2L2DA 1HR0M 3M7GA 4MGYE 4KO8A 3T15A 4B7FA 2C9CA 5ITRA 4OX9M 3KOXE 1XMQM 3MHVC 5IT9S 1VG5A 3GLHA 4OW0A 3B9PA 4G3OA 1WJ7A 3HU2A 4X66M 1G59A 1FJGM 2DZOB 4M9SA 5IZ7D 2YR0A 3SAVA 2WSFF 3KSJA 2Z7JA 2XH9A 1W5SA 2V1CA 4AQYM 2M60A 2QBYB 4GHLA 3UJNA 2DXIA 1NNJA 2BWEA 3NBIA 1R2YA 1IN4A 2EKFA 3JAMS 5FTKA 3E9SA 1XB2B 2RKOA 3LVWA 4QHSA 4L15A 3GLFA 3HU3A 4GKKM 1D0MA 1PJSA 3MK6A 5EQTA 4D82A 4LRSA 2QQ8A 4LJ7A 3Q8XA 3GLIA 1T6OA 3BOSA 4QNRA 2LNHC 4GMQA 3VK7A 3FTEA 1NSFA 4LZJA 2WZJA 4B7GA 2O01F 4FVMA 2LVNC 1GO5A 1UM8A 2A5YB 1XC8A 4I8OA 1IN6A 1IY1A 3U6MA 2LXEA 3CF2A 4L4UA 3WHLA 3KVWA 3LVVA 4M9ZA 4BB9A 1IFYA 1DV0A 1NHWC 4KLNA 3F92A 3GP1A 1BVSA 3JR4A 1DGGA 3HKPA 2LBCA 1NVMA 2NQ8C 3GLGE 1G71A 1OQYA 4M9XA 4MGZE 2HHHM 1R2ZA 4RNAA 2JA2A 4GIPA 3T6PA 1OKSA 5ITUA 4D80A 2QBYA 4CIZA 4CISA 2HCBA 2CE7A 2QP9X 2H1RA 2C5RA 3FTFA 4P16A 4QNMA 4JI2M 1G41A 4B7HA 2JNHA 4AG5A 2VIIA 3SBJA 1PRBA 1NY5A 1SXJD 1TF0B 2DAEA 2DI0A 3FUXA 5ITQA 1Q39A 2KRUA 2XGNA 2R4EA 3SASA 2FNAA 4NOOB 1OFHA 4REZA 3RGSA 3SYKA 4QOSA 1QVRA 3U6OA 4B3TM 4GH9A 4LF9M 1K3WA 3VFDA 4AZFA 2YNMD 3TWMA 2UUBM 2RGOA 3SARA 1OTRA 5LMNM 2VF7A 4DR1M 1VEKA 5L8RF 5EP3A 1PJTA 2XEPA 4IBBA 2VDBB 3FRHA 1FNNA 3KDSE 2L4EA 1SXJC 2QENA 3PNVA 4LJ8A 1SG9A 1N78A 2LTUA 2K9DA 3AJIB 3L29A 3JR5A 2V1UA 4B08A 2CP8A 3PNYA 4NXMM 1PJIA 4AI6A 4CHTB 2BNKA 3HU1A 1QZEA 2KA6B 1Z59A 4ANRA 2P5TA 1TTEA 1ZMVA 2KZSA 4IBEA 2Y21A 2EKKA 4R3DA 1NV8A 4GEWA 4ITQA 1YE9A 1QZMA 3K92A 3CTWB 4NSRA 1HJPA 4LRTA 1WGLA 4II7A 2XLJA 1L2BA 3IG8A 4WP2A 1IBMM 1XMOM 4FWDA 1OIZA 4OU7A 2BWBA 4RF1A 1Z5CA 3HJSA 3TE6A 3HHWA 2Y0QA 1DO2A 2JP7A 1S3SA 4GRIA 3SATA 3FTDA 4R71A 4JI5M 1L2DA 2Y20A 5EP1A 5EXPA 3SYLA 5FTNA 4DUZM 3ZCBB 2JY7A 3U60A 2UUCM 3C3DA 3U60B 2XSZA 5IWAM 3VK8A 4JYAM 1Z5BA 1HQCA 2O25A 1NJFA 5KPTA 1OFIA 4LY6A 2J7NA 2ZAOA 2DWZB 2ZTCA 5DYGA 2F5SA 2L7HA 4DR2M 1VQ1A 4JI3M 2MGWA 5BR8M 1Z6TA 3J27B 4GC9A 2AHMA 1Q3CA 3GPUA 1QAQA 4XGIA 2ZM6M 1CUKA 3KOWE 4EIWA 2OPFA 3VDUA 4LF5M 3GRVA 1L8QA 2DZNB 1XNQM 1AIPC 2I7NA 4QOZC 3PXGA 1C7YA 5ITXA 1L2CA 1GJSA 4OVZB 2FE8A 2LWXA 1JB0F 1NNUC 4Z8XA 3VDPA 3THGA 1NHGC 3GLGB 2DVWB 1EIJA 3HHXA 4X62M 3I01M 4CJ6A 1P3QQ 4LFAM 3PVSA 3CF0A 1TDZA 2GNOA 4KT0F 4YHHM 2XF3A 2OQ4A 2OO9A 3NBXX 2F5QA 4F1IA 4DR5M 3TL4X 4LJ4A 4PDGA 4LF6M 3H4MA 1YSYA 5EP4A 4FCWA 4MH0E 4JI1M 1F4IA 5F3WA 1MN3A 3D8BA 2FOIC 4YY3M 1X37A 2ZANA 3GRYA 4DBGB
chains in the Genus database with same CATH topology
1WXQA 3AKZA 3KP0E 5E6JA 4DR4M 4BLCA 4G4QA 1G4AE 4IBIA 4DV3M 4NL4H 1Z5AA 2R46A 3ILKA 8CATA 3I4VA 5ITTA 2KRKA 3UK6A 1IBKM 3TQSA 2R62A 5JI2E 4DV5M 3J7BA 3KP1E 4IBCA 4OVZA 5EXSA 1QYRA 4PD2A 2DWNA 1ZQ9A 4HL4A 2CHGA 3FUWA 3GLGA 2CV0A 4G4RA 3K2LA 3TWKA 4DV6M 2Y0TA 2HKJA 3FUTA 1IN5A 4JN6A 3W0LB 3OTOM 3UGJA 3U5ZB 4AG6A 4IJEA 3AOEA 2X4AA 2CFOA 4PCZA 2F5NA 1TH3A 2YQZA 3J81S 2F5PA 3L26A 3QAUA 3HHYA 1G3IA 3FYDA 3LQRA 2CV1A 4FWGA 3A45A 1GL6A 2D7HA 4XBOA 3GRUA 3E4RA 4GC5A 1N75A 1PM5A 4LFCM 1HNWM 2X8AA 3SHGB 3HJQA 4L8RC 4R7GA 4AKIA 3L2AA 3IG5A 2ERCA 2R65A 2FFJA 4NXNM 5DYIA 4B3MM 3AL0C 3R9XB 2YFQA 1SXJE 2VQEM 4LCBA 1MU5A 3FYCA 4M0WA 1E9RA 3PFIA 1JQJC 4HLQA 1J7KA 2R4JA 3RFWA 3KS8A 1IXZA 1XWIA 4CGYB 3HJ8A 5EXTA 1GVNA 1IQPA 1ORYB 3R8FA 4DV2M 1IM2A 1LV7A 1HT1E 2C98A 5ITXE 3SAUA 2L7IA 1TH2A 4DUYM 4DR3M 2F4VM 5FTMA 3TWLA 2V6ZM 1GL7A 2BJVA 3DZDA 1KYIA 3SHFA 2UXCM 1W5TA 1TH4A 1QAOA 4LJ6A 5KQ8A 3U6DA 2CEAA 4PT5A 3GQ4A 4PDIA 1H6UA 3DA1A 4LJ5A 5E26A 3SAWA 3U6SA 3UMMA 1E94E 1KFVA 4AW4A 3I4YA 2DWLA 2D7GA 2Z4SA 4LGYA 1NJGA 4G4NA 3KOZE 5KQDA 4WURA 4MGIE 5EJCA 1VDDA 3A98B 4WW0A 4JI7M 3T38A 3U5ZA 2W82A 2E5LM 1JR3D 4KHPM 3A46A 2LH0A 1NY6A 3GPXA 2QPAA 3EIHA 3U61A 1IXSB 2O5RA 4DV1M 2XZFA 1HNXM 1C1KA 1MX0A 1N34M 4JXJA 1IY0A 4QHTA 3HHZA 1D2NA 2EO2A 3J2PB 4X65M 1N77A 1XHBA 1DGHB 2C96A 4I5SA 1G8PA 4FCTA 5GKNA 4M0DA 3GPPA 2RGHA 4AKGA 1QAMA 5DNYA 1TGUA 3A42A 4ZPXA 2KZUA 2CHVA 2ZAMA 3I51A 4I4LA 4MGKE 2QCUA 5FSWA 3AFHA 3AOGA 4MGHA 5FLXS 4L78A 1GLNA 4LF7M 3U6EA 4JI6M 1XNRM 4GHAA 2DHRA 1SXJB 1L1ZA 4IBJA 1SXJA 3L27A 5EXXA 1K3XA 5A2QS 3GPYA 1E32A 2XZUA 4IIWA 4IBGA 2C99A 2KW0A 1XXHB 2R45A 3KW6A 3DFZA 3GQ5A 2L6OA 1YUBA 2UU9M 4DR7M 1IXRC 1R7RA 1JR3A 4FWHA 3SMSA 3KS4A 4IBKA 2I7PA 3SC3A 2KXEA 3U6QA 2EUCA 5FTLA 4FCVA 5KO3A 4NSOB 1DGHA 3VLFB 5H37D 4JI4M 5LMUM 1DGFA 1IBLM 3CF6E 4S12A 3U61B 3D8LA 2QZ4A 2ZBKB 4KODA 4D81A 3FTCA 2CHQA 5EP2A 1Q3BA 4B3RM 3J80S 3GLHB 5BPVA 1IN7A 2Q2EB 4DV4M 4Z6YA 3WHKA 2Z4RA 3T1HM 1HQYE 3T1YM 4LF4M 2XFSA 4DV7M 3NWLA 5ITYA 2BJWA 3M0EA 4K0KM 3TPZA 1OJLA 4DV0M 3FUVA 4NRVA 2EA0A 3KFUG 1N36M 5FTJA 3LQQA 3VKHA 3W0FA 1EE8A 1L1TA 4G4OA 4LJAA 3L25A 3AV0A 3QWLA 2L09A 4G6ZA 4JI0M 2VQFM 3K8ZA 4LZZA 4JV5M 2XSZD 3U6PA 1K82A 2F5OA 1N33M 1TDHA 4B3SM 4X64M 2G8LA 3KOYE 5KPRA 1T3TA 1ZAEA 3EIEA 2UXBM 3VKGA 2G5GX 3C58A 4IBDA 4AKHA 2Z3XA 1E9SA 5C1BA 4DR6M 2D7EA 1HT2E 3FKEA 3M6AA 1QANA 2UXDM 3L28A 3U6LA 4L16A 3RGPA 4BBAA 5C18A 2C9OA 1XXHA 3ZH9B 1N32M 3U6CA 1GKIA 1R6BX 3MJ5A 2CUZA 2XFTA 4IJFA 4NRWA 1PJJA 2M5ZA 1DGBA 3HGIA 1DO0A 1I4WA 3GLFB 2UUAM 4FW9A 5IREB 2DWMA 2X49A 7CATA 4GKJM 3HWSA 3GO8A 2CV2A 3KSXA 3GRRA 3LMMA 1KSFX 2KEBA 3RE8A 4TUWA 2K47A 1IY2A 3K1JA 1IN8A 4MM3B 3GQ3A 4LFBM 4I81A 1QQWA 4RF0A 5JI3E 4JI8M 4W5WA 4IBFA 4A3VB 3FD9A 4GITA 1J09A 2J7OA 4LF8M 3UZUA 3SFZA 4FD2A 3GLIB 3DOAA 4LJ9A 1J5EM 4LGMA 3SMPA 2R18A 3AOEC 2HL7A 5KPZA 1HNZM 4MB7A 3FUUA 3ZC7B 3KXEC 1I94M 1HR0M 3M7GA 4MGYE 4KO8A 3T15A 4B7FA 2C9CA 5ITRA 4OX9M 3KOXE 1XMQM 3MHVC 5IT9S 3GLHA 4OW0A 3B9PA 3HU2A 4X66M 1G59A 1FJGM 2DZOB 4M9SA 5IZ7D 2YR0A 3SAVA 3KSJA 2Z7JA 2XH9A 1W5SA 2V1CA 4AQYM 2M60A 2QBYB 4GHLA 3UJNA 2DXIA 1NNJA 3NBIA 1R2YA 1IN4A 3JAMS 5FTKA 3E9SA 2RKOA 3LVWA 4QHSA 4L15A 3GLFA 3HU3A 4GKKM 3MK6A 5EQTA 4D82A 4LRSA 4LJ7A 3Q8XA 3GLIA 3BOSA 4QNRA 2LNHC 4GMQA 3VK7A 3FTEA 1NSFA 4LZJA 4B7GA 4FVMA 1UM8A 2A5YB 1XC8A 4I8OA 1IN6A 1IY1A 3U6MA 2LXEA 3CF2A 4L4UA 3WHLA 3KVWA 3LVVA 4M9ZA 4BB9A 1NHWC 4KLNA 3GP1A 3JR4A 1DGGA 3HKPA 1NVMA 2NQ8C 4M9XA 4MGZE 2HHHM 1R2ZA 4RNAA 2JA2A 4GIPA 5ITUA 4D80A 2QBYA 4CISA 2HCBA 2CE7A 2QP9X 2H1RA 2C5RA 3FTFA 4P16A 4QNMA 4JI2M 1G41A 4B7HA 4AG5A 2VIIA 3SBJA 1NY5A 1SXJD 3FUXA 5ITQA 3SASA 4LG2A 3J7AS 1Q39A 2KRUA 2XGNA 2R4EA 2FNAA 4NOOB 1OFHA 4REZA 3RGSA 3SYKA 4QOSA 1QVRA 3U6OA 4B3TM 4GH9A 4LF9M 1K3WA 3VFDA 4AZFA 2YNMD 3TWMA 2UUBM 2RGOA 3SARA 5LMNM 4DR1M 5EP3A 2XEPA 4IBBA 1FNNA 3KDSE 1SXJC 2QENA 3PNVA 4LJ8A 1N78A 3AJIB 3L29A 3JR5A 2V1UA 4B08A 3PNYA 4AI6A 4NXMM 1PJIA 4CHTB 2BNKA 3HU1A 2KA6B 1Z59A 2P5TA 4R3DA 2KZSA 4IBEA 2Y21A 4ITQA 1YE9A 1QZMA 3K92A 3CTWB 4NSRA 2XLJA 4LRTA 4II7A 1L2BA 3IG8A 1IBMM 1XMOM 4FWDA 4OU7A 4RF1A 1Z5CA 3HJSA 3TE6A 3HHWA 2Y0QA 1DO2A 1S3SA 4GRIA 3SATA 3FTDA 4JI5M 1L2DA 2Y20A 5EP1A 5EXPA 3SYLA 5FTNA 4DUZM 3ZCBB 2UUCM 3U60A 3U60B 2XSZA 5IWAM 3VK8A 4JYAM 1Z5BA 1HQCA 1NJFA 5KPTA 1OFIA 4LY6A 2J7NA 2ZAOA 2DWZB 5DYGA 2F5SA 2L7HA 4DR2M 4JI3M 5BR8M 1Z6TA 3J27B 4GC9A 2AHMA 1Q3CA 3GPUA 1QAQA 4XGIA 2ZM6M 2OPFA 3KOWE 4EIWA 4LF5M 3VDUA 3GRVA 1L8QA 2DZNB 1XNQM 4QOZC 2I7NA 3PXGA 5ITXA 1L2CA 4OVZB 2FE8A 2LWXA 4Z8XA 1NNUC 3VDPA 3THGA 1NHGC 3GLGB 2DVWB 3HHXA 4X62M 4LFAM 3PVSA 3CF0A 1TDZA 4YHHM 2XF3A 2OQ4A 2F5QA 4DR5M 3TL4X 4LJ4A 4PDGA 4LF6M 3H4MA 1YSYA 5EP4A 4FCWA 4MH0E 4JI1M 5F3WA 3D8BA 2FOIC 4YY3M 1X37A 2ZANA 3GRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3X A; 
#chains in the Genus database with same CATH topology
 1WXQ A;  1QUT A;  3AKZ A;  3KP0 E;  5E6J A;  4DR4 M;  2DZL A;  4BLC A;  4G4Q A;  4AKI A;  1G4A E;  1ZMU A;  1QUS A;  3E21 A;  4IBI A;  4DV3 M;  4NL4 H;  1Z5A A;  2R46 A;  3C9P A;  3ILK A;  3I4V A;  8CAT A;  5ITT A;  2KRK A;  3UK6 A;  2G3Q A;  3TQS A;  2DEN A;  1IBK M;  1D0K A;  2R44 A;  2R62 A;  5JI2 E;  4DV5 M;  3J7B A;  3KP1 E;  4IBC A;  1OIP A;  4OVZ A;  1QYR A;  5EXS A;  4PD2 A;  2DWN A;  1ZQ9 A;  4HL4 A;  2CHG A;  3FUW A;  3GLG A;  2CV0 A;  4G4R A;  1RU3 A;  3K2L A;  3TWK A;  2JY5 A;  4DV6 M;  2Y0T A;  2HKJ A;  3FUT A;  1IN5 A;  1VEG A;  4JN6 A;  3W0L B;  3UGJ A;  3OTO M;  2MH8 A;  4AG6 A;  3U5Z B;  4IJE A;  1ZV1 A;  3J7A S;  3AOE A;  3B7Q A;  2X4A A;  1GAB A;  2CFO A;  4PCZ A;  2F5N A;  1TH3 A;  3LW5 F;  4RKU F;  2DAK A;  2YQZ A;  1PGY A;  3J81 S;  2F5P A;  3L26 A;  3QAU A;  3HHY A;  1G3I A;  3FYD A;  3LQR A;  2CV1 A;  1V33 A;  4FWG A;  1Q02 A;  3A45 A;  1OAI A;  1VDL A;  1V34 A;  1GL6 A;  2D7H A;  4XBO A;  3GRU A;  3E4R A;  4GC5 A;  1N75 A;  1PM5 A;  4LFC M;  1HNW M;  2X8A A;  3SHG B;  3HJQ A;  4L8R C;  4R7G A;  3LCV B;  3IG5 A;  2R65 A;  2ERC A;  3L2A A;  2FFJ A;  4NXN M;  5DYI A;  4B3M M;  3AL0 C;  3R9X B;  3GLI E;  2YFQ A;  1SXJ E;  2VQE M;  4LCB A;  1MU5 A;  3FYC A;  4M0W A;  1E9R A;  2LVP C;  3PFI A;  1JQJ C;  4HLQ A;  1J7K A;  2R4J A;  3RFW A;  2FS1 A;  3KS8 A;  2LVA A;  1IXZ A;  1XWI A;  2ZTD A;  1WIV A;  4CGY B;  3HJ8 A;  5EXT A;  1GVN A;  1IQP A;  1WGN A;  2K6B A;  2JZ0 A;  1ORY B;  3K9O A;  3GLF E;  3R8F A;  2MRO B;  2L4F A;  1IM2 A;  1LV7 A;  1HT1 E;  1PJQ A;  2C98 A;  5ITX E;  4DV2 M;  2L7I A;  3SAU A;  2R6F A;  1TH2 A;  4DUY M;  3K9P A;  4DR3 M;  3BBZ A;  2F4V M;  5FTM A;  3TWL A;  2V6Z M;  2WSE F;  3FRI A;  1GL7 A;  2BJV A;  3DZD A;  1KYI A;  2R0I A;  3SHF A;  2UXC M;  1W5T A;  1TH4 A;  1QAO A;  3HX3 A;  1JR3 E;  3HY5 A;  4LJ6 A;  5KQ8 A;  3U6D A;  2CEA A;  4PT5 A;  3GQ4 A;  2B3T A;  4PDI A;  1H6U A;  2DHY A;  3DA1 A;  4LJ5 A;  5E26 A;  2JWS A;  1YLA A;  3SAW A;  3U6S A;  3UMM A;  1E94 E;  1KFV A;  4AW4 A;  3I4Y A;  2DWL A;  2D7G A;  2Z4S A;  4LGY A;  1NJG A;  4G4N A;  3KOZ E;  5KQD A;  4WUR A;  4MGI E;  5EJC A;  1VDD A;  3A98 B;  4WW0 A;  4JI7 M;  3T38 A;  3B7Z A;  4NC6 A;  2W82 A;  3U5Z A;  2E5L M;  4P17 A;  1JR3 D;  4KHP M;  2KHH A;  3A46 A;  4L6V 6;  2LH0 A;  1NY6 A;  5DFL A;  3GPX A;  2QPA A;  3EIH A;  3U61 A;  1LTM A;  1IXS B;  2O5R A;  2JXN A;  4DV1 M;  2GQF A;  1C1K A;  2XZF A;  1HNX M;  1MX0 A;  1N34 M;  4JXJ A;  1IY0 A;  3C3E A;  4QHT A;  1GJT A;  3HHZ A;  1D2N A;  2EO2 A;  3J2P B;  4X65 M;  1T43 A;  1N77 A;  1XHB A;  1DGH B;  2C96 A;  4I5S A;  1G8P A;  4FCT A;  5GKN A;  3I04 M;  3GLH E;  4M0D A;  3GPP A;  2RGH A;  2WSC F;  4AKG A;  1QAM A;  5DNY A;  1TGU A;  2DAM A;  2KNA A;  2QHO B;  3A42 A;  4ZPX A;  1UFZ A;  2KZU A;  3IHP A;  2CHV A;  2ZAM A;  2LVO C;  3I51 A;  4I4L A;  4MGK E;  2QCU A;  5FSW A;  3AFH A;  3AOG A;  4MGH A;  5FLX S;  4L78 A;  1GLN A;  4LF7 M;  3U6E A;  4JI6 M;  1XNR M;  4GHA A;  2MJ5 B;  2DHR A;  1SXJ B;  1AUA A;  2DKL A;  4IBJ A;  1L1Z A;  2DAG A;  1SXJ A;  3L27 A;  5EXX A;  1K3X A;  5A2Q S;  3GPY A;  1E32 A;  2XZU A;  4IIW A;  4IBG A;  2C99 A;  2KW0 A;  1XXH B;  2JUJ A;  2R45 A;  1QDT A;  2CRU A;  3KW6 A;  1WHC A;  3DFZ A;  3GQ5 A;  2L6O A;  1YUB A;  2UU9 M;  1Y8G A;  4DR7 M;  1NV9 A;  1IXR C;  1R7R A;  1JR3 A;  1R4G A;  4FWH A;  2LHG A;  3SMS A;  1IXS A;  3KS4 A;  3B74 A;  2I7P A;  4IBK A;  2JZ1 A;  3SC3 A;  2KXE A;  3MMP A;  3U6Q A;  2EUC A;  1TR8 A;  5FTL A;  4FCV A;  5KO3 A;  2J5Y A;  1DGH A;  4NSO B;  3VLF B;  5H37 D;  4JI4 M;  5LMU M;  1DGF A;  2K0B X;  1NO1 A;  1IBL M;  3CF6 E;  4S12 A;  3U61 B;  3D8L A;  2LVQ D;  2QZ4 A;  2ZBK B;  4KOD A;  4D81 A;  3FTC A;  2CHQ A;  2VF8 A;  5EP2 A;  2QSF X;  3B7N A;  1Q3B A;  4B3R M;  1ZMW A;  4Q7J A;  3J80 S;  2CWB A;  2KNZ A;  3CGW A;  3GLH B;  3LCU A;  5BPV A;  1IN7 A;  2Q2E B;  2RRU A;  4DV4 M;  4Z6Y A;  1D0L A;  3WHK A;  2Z4R A;  3T1H M;  1HQY E;  2DAI A;  3T1Y M;  4LF4 M;  2XFS A;  4DV7 M;  3NWL A;  2KNV A;  1WR1 B;  5ITY A;  4F2L A;  2HAK A;  3H4J A;  3ZQJ A;  3E46 A;  2BJW A;  3M0E A;  4K0K M;  3TPZ A;  1OJL A;  4DV0 M;  3FUV A;  4NRV A;  2EA0 A;  2FH0 A;  3KFU G;  1N36 M;  5FTJ A;  1A5T A;  3LQQ A;  3VKH A;  3HZJ A;  2DNA A;  3IEC A;  3W0F A;  1EE8 A;  1L1T A;  4G4O A;  4LJA A;  2MR9 A;  3L25 A;  3AV0 A;  3QWL A;  2L09 A;  4G6Z A;  2EJS A;  4JI0 M;  2Z8Y M;  3K8Z A;  2QNJ A;  4LZZ A;  2VQF M;  2XSZ D;  4JV5 M;  2APL A;  3U6P A;  1K82 A;  2F5O A;  3W68 A;  1N33 M;  1TDH A;  1R5L A;  3BXW A;  4B3S M;  4X64 M;  2G8L A;  3KOY E;  2HWJ A;  5KPR A;  1T3T A;  1ZAE A;  2LHC A;  3EIE A;  2UXB M;  2OOB A;  2G5G X;  3VKG A;  3C58 A;  4IBD A;  4LG2 A;  4AKH A;  1MJG M;  2Z3X A;  1E9S A;  5C1B A;  4DR6 M;  2D7E A;  1HT2 E;  3FKE A;  3M6A A;  3V76 A;  4XK8 F;  1QAN A;  2UXD M;  1OAO C;  3L28 A;  3U6L A;  4L16 A;  3RGP A;  1QDR A;  4BBA A;  5C18 A;  2C9O A;  1XXH A;  3ZH9 B;  3Q8G A;  1N32 M;  3U6C A;  1GKI A;  1R6B X;  3MJ5 A;  2CUZ A;  2XFT A;  4IJF A;  4NRW A;  1VEJ A;  1PJJ A;  2M5Z A;  1DGB A;  3HGI A;  1DO0 A;  1I4W A;  3GLF B;  2UUA M;  4FW9 A;  5IRE B;  2DWM A;  2X49 A;  7CAT A;  2N35 A;  3FE3 A;  4GKJ M;  3HWS A;  3GO8 A;  2CV2 A;  3KSX A;  3GRR A;  4Y28 F;  1V92 A;  1KSF X;  2KDL A;  2KEB A;  1EFU B;  3B89 A;  2K47 A;  3LMM A;  4HEO A;  3RE8 A;  1IY2 A;  3K1J A;  4TUW A;  1IN8 A;  4MM3 B;  3GQ3 A;  4LFB M;  4I81 A;  1QQW A;  4RF0 A;  2JY8 A;  3QYE A;  5JI3 E;  4JI8 M;  4W5W A;  2OOA A;  4IBF A;  2JY6 B;  4A3V B;  3FD9 A;  4GIT A;  1J09 A;  2J7O A;  4LF8 M;  1XXH E;  3UZU A;  3SFZ A;  3QYB A;  4FD2 A;  3DOA A;  4LJ9 A;  3GLI B;  1J5E M;  4LGM A;  3SMP A;  2R18 A;  3AOE C;  2HL7 A;  5KPZ A;  1HNZ M;  4UN2 B;  4MB7 A;  3FUU A;  2H5X A;  3KXE C;  3ZC7 B;  3W67 A;  1I94 M;  2L2D A;  1HR0 M;  3M7G A;  4MGY E;  4KO8 A;  3T15 A;  4B7F A;  2C9C A;  5ITR A;  4OX9 M;  3KOX E;  1XMQ M;  3MHV C;  5IT9 S;  1VG5 A;  3GLH A;  4OW0 A;  3B9P A;  4G3O A;  1WJ7 A;  3HU2 A;  4X66 M;  1G59 A;  1FJG M;  2DZO B;  4M9S A;  5IZ7 D;  2YR0 A;  3SAV A;  2WSF F;  3KSJ A;  2Z7J A;  2XH9 A;  1W5S A;  2V1C A;  4AQY M;  2M60 A;  2QBY B;  4GHL A;  3UJN A;  2DXI A;  1NNJ A;  2BWE A;  3NBI A;  1R2Y A;  1IN4 A;  2EKF A;  3JAM S;  5FTK A;  3E9S A;  1XB2 B;  2RKO A;  3LVW A;  4QHS A;  4L15 A;  3GLF A;  3HU3 A;  4GKK M;  1D0M A;  1PJS A;  3MK6 A;  5EQT A;  4D82 A;  4LRS A;  2QQ8 A;  4LJ7 A;  3Q8X A;  3GLI A;  1T6O A;  3BOS A;  4QNR A;  2LNH C;  4GMQ A;  3VK7 A;  3FTE A;  1NSF A;  4LZJ A;  2WZJ A;  4B7G A;  2O01 F;  4FVM A;  2LVN C;  1GO5 A;  1UM8 A;  2A5Y B;  1XC8 A;  4I8O A;  1IN6 A;  1IY1 A;  3U6M A;  2LXE A;  3CF2 A;  4L4U A;  3WHL A;  3KVW A;  3LVV A;  4M9Z A;  4BB9 A;  1IFY A;  1DV0 A;  1NHW C;  4KLN A;  3F92 A;  3GP1 A;  1BVS A;  3JR4 A;  1DGG A;  3HKP A;  2LBC A;  1NVM A;  2NQ8 C;  3GLG E;  1G71 A;  1OQY A;  4M9X A;  4MGZ E;  2HHH M;  1R2Z A;  4RNA A;  2JA2 A;  4GIP A;  3T6P A;  1OKS A;  5ITU A;  4D80 A;  2QBY A;  4CIZ A;  4CIS A;  2HCB A;  2CE7 A;  2QP9 X;  2H1R A;  2C5R A;  3FTF A;  4P16 A;  4QNM A;  4JI2 M;  1G41 A;  4B7H A;  2JNH A;  4AG5 A;  2VII A;  3SBJ A;  1PRB A;  1NY5 A;  1SXJ D;  1TF0 B;  2DAE A;  2DI0 A;  3FUX A;  5ITQ A;  1Q39 A;  2KRU A;  2XGN A;  2R4E A;  3SAS A;  2FNA A;  4NOO B;  1OFH A;  4REZ A;  3RGS A;  3SYK A;  4QOS A;  1QVR A;  3U6O A;  4B3T M;  4GH9 A;  4LF9 M;  1K3W A;  3VFD A;  4AZF A;  2YNM D;  3TWM A;  2UUB M;  2RGO A;  3SAR A;  1OTR A;  5LMN M;  2VF7 A;  4DR1 M;  1VEK A;  5L8R F;  5EP3 A;  1PJT A;  2XEP A;  4IBB A;  2VDB B;  3FRH A;  1FNN A;  3KDS E;  2L4E A;  1SXJ C;  2QEN A;  3PNV A;  4LJ8 A;  1SG9 A;  1N78 A;  2LTU A;  2K9D A;  3AJI B;  3L29 A;  3JR5 A;  2V1U A;  4B08 A;  2CP8 A;  3PNY A;  4NXM M;  1PJI A;  4AI6 A;  4CHT B;  2BNK A;  3HU1 A;  1QZE A;  2KA6 B;  1Z59 A;  4ANR A;  2P5T A;  1TTE A;  1ZMV A;  2KZS A;  4IBE A;  2Y21 A;  2EKK A;  4R3D A;  1NV8 A;  4GEW A;  4ITQ A;  1YE9 A;  1QZM A;  3K92 A;  3CTW B;  4NSR A;  1HJP A;  4LRT A;  1WGL A;  4II7 A;  2XLJ A;  1L2B A;  3IG8 A;  4WP2 A;  1IBM M;  1XMO M;  4FWD A;  1OIZ A;  4OU7 A;  2BWB A;  4RF1 A;  1Z5C A;  3HJS A;  3TE6 A;  3HHW A;  2Y0Q A;  1DO2 A;  2JP7 A;  1S3S A;  4GRI A;  3SAT A;  3FTD A;  4R71 A;  4JI5 M;  1L2D A;  2Y20 A;  5EP1 A;  5EXP A;  3SYL A;  5FTN A;  4DUZ M;  3ZCB B;  2JY7 A;  3U60 A;  2UUC M;  3C3D A;  3U60 B;  2XSZ A;  5IWA M;  3VK8 A;  4JYA M;  1Z5B A;  1HQC A;  2O25 A;  1NJF A;  5KPT A;  1OFI A;  4LY6 A;  2J7N A;  2ZAO A;  2DWZ B;  2ZTC A;  5DYG A;  2F5S A;  2L7H A;  4DR2 M;  1VQ1 A;  4JI3 M;  2MGW A;  5BR8 M;  1Z6T A;  3J27 B;  4GC9 A;  2AHM A;  1Q3C A;  3GPU A;  1QAQ A;  4XGI A;  2ZM6 M;  1CUK A;  3KOW E;  4EIW A;  2OPF A;  3VDU A;  4LF5 M;  3GRV A;  1L8Q A;  2DZN B;  1XNQ M;  1AIP C;  2I7N A;  4QOZ C;  3PXG A;  1C7Y A;  5ITX A;  1L2C A;  1GJS A;  4OVZ B;  2FE8 A;  2LWX A;  1JB0 F;  1NNU C;  4Z8X A;  3VDP A;  3THG A;  1NHG C;  3GLG B;  2DVW B;  1EIJ A;  3HHX A;  4X62 M;  3I01 M;  4CJ6 A;  1P3Q Q;  4LFA M;  3PVS A;  3CF0 A;  1TDZ A;  2GNO A;  4KT0 F;  4YHH M;  2XF3 A;  2OQ4 A;  2OO9 A;  3NBX X;  2F5Q A;  4F1I A;  4DR5 M;  3TL4 X;  4LJ4 A;  4PDG A;  4LF6 M;  3H4M A;  1YSY A;  5EP4 A;  4FCW A;  4MH0 E;  4JI1 M;  1F4I A;  5F3W A;  1MN3 A;  3D8B A;  2FOI C;  4YY3 M;  1X37 A;  2ZAN A;  3GRY A;  4DBG B; 
#chains in the Genus database with same CATH homology
 1WXQ A;  3AKZ A;  3KP0 E;  5E6J A;  4DR4 M;  4BLC A;  4G4Q A;  1G4A E;  4IBI A;  4DV3 M;  4NL4 H;  1Z5A A;  2R46 A;  3ILK A;  8CAT A;  3I4V A;  5ITT A;  2KRK A;  3UK6 A;  1IBK M;  3TQS A;  2R62 A;  5JI2 E;  4DV5 M;  3J7B A;  3KP1 E;  4IBC A;  4OVZ A;  5EXS A;  1QYR A;  4PD2 A;  2DWN A;  1ZQ9 A;  4HL4 A;  2CHG A;  3FUW A;  3GLG A;  2CV0 A;  4G4R A;  3K2L A;  3TWK A;  4DV6 M;  2Y0T A;  2HKJ A;  3FUT A;  1IN5 A;  4JN6 A;  3W0L B;  3OTO M;  3UGJ A;  3U5Z B;  4AG6 A;  4IJE A;  3AOE A;  2X4A A;  2CFO A;  4PCZ A;  2F5N A;  1TH3 A;  2YQZ A;  3J81 S;  2F5P A;  3L26 A;  3QAU A;  3HHY A;  1G3I A;  3FYD A;  3LQR A;  2CV1 A;  4FWG A;  3A45 A;  1GL6 A;  2D7H A;  4XBO A;  3GRU A;  3E4R A;  4GC5 A;  1N75 A;  1PM5 A;  4LFC M;  1HNW M;  2X8A A;  3SHG B;  3HJQ A;  4L8R C;  4R7G A;  4AKI A;  3L2A A;  3IG5 A;  2ERC A;  2R65 A;  2FFJ A;  4NXN M;  5DYI A;  4B3M M;  3AL0 C;  3R9X B;  2YFQ A;  1SXJ E;  2VQE M;  4LCB A;  1MU5 A;  3FYC A;  4M0W A;  1E9R A;  3PFI A;  1JQJ C;  4HLQ A;  1J7K A;  2R4J A;  3RFW A;  3KS8 A;  1IXZ A;  1XWI A;  4CGY B;  3HJ8 A;  5EXT A;  1GVN A;  1IQP A;  1ORY B;  3R8F A;  4DV2 M;  1IM2 A;  1LV7 A;  1HT1 E;  2C98 A;  5ITX E;  3SAU A;  2L7I A;  1TH2 A;  4DUY M;  4DR3 M;  2F4V M;  5FTM A;  3TWL A;  2V6Z M;  1GL7 A;  2BJV A;  3DZD A;  1KYI A;  3SHF A;  2UXC M;  1W5T A;  1TH4 A;  1QAO A;  4LJ6 A;  5KQ8 A;  3U6D A;  2CEA A;  4PT5 A;  3GQ4 A;  4PDI A;  1H6U A;  3DA1 A;  4LJ5 A;  5E26 A;  3SAW A;  3U6S A;  3UMM A;  1E94 E;  1KFV A;  4AW4 A;  3I4Y A;  2DWL A;  2D7G A;  2Z4S A;  4LGY A;  1NJG A;  4G4N A;  3KOZ E;  5KQD A;  4WUR A;  4MGI E;  5EJC A;  1VDD A;  3A98 B;  4WW0 A;  4JI7 M;  3T38 A;  3U5Z A;  2W82 A;  2E5L M;  1JR3 D;  4KHP M;  3A46 A;  2LH0 A;  1NY6 A;  3GPX A;  2QPA A;  3EIH A;  3U61 A;  1IXS B;  2O5R A;  4DV1 M;  2XZF A;  1HNX M;  1C1K A;  1MX0 A;  1N34 M;  4JXJ A;  1IY0 A;  4QHT A;  3HHZ A;  1D2N A;  2EO2 A;  3J2P B;  4X65 M;  1N77 A;  1XHB A;  1DGH B;  2C96 A;  4I5S A;  1G8P A;  4FCT A;  5GKN A;  4M0D A;  3GPP A;  2RGH A;  4AKG A;  1QAM A;  5DNY A;  1TGU A;  3A42 A;  4ZPX A;  2KZU A;  2CHV A;  2ZAM A;  3I51 A;  4I4L A;  4MGK E;  2QCU A;  5FSW A;  3AFH A;  3AOG A;  4MGH A;  5FLX S;  4L78 A;  1GLN A;  4LF7 M;  3U6E A;  4JI6 M;  1XNR M;  4GHA A;  2DHR A;  1SXJ B;  1L1Z A;  4IBJ A;  1SXJ A;  3L27 A;  5EXX A;  1K3X A;  5A2Q S;  3GPY A;  1E32 A;  2XZU A;  4IIW A;  4IBG A;  2C99 A;  2KW0 A;  1XXH B;  2R45 A;  3KW6 A;  3DFZ A;  3GQ5 A;  2L6O A;  1YUB A;  2UU9 M;  4DR7 M;  1IXR C;  1R7R A;  1JR3 A;  4FWH A;  3SMS A;  3KS4 A;  4IBK A;  2I7P A;  3SC3 A;  2KXE A;  3U6Q A;  2EUC A;  5FTL A;  4FCV A;  5KO3 A;  4NSO B;  1DGH A;  3VLF B;  5H37 D;  4JI4 M;  5LMU M;  1DGF A;  1IBL M;  3CF6 E;  4S12 A;  3U61 B;  3D8L A;  2QZ4 A;  2ZBK B;  4KOD A;  4D81 A;  3FTC A;  2CHQ A;  5EP2 A;  1Q3B A;  4B3R M;  3J80 S;  3GLH B;  5BPV A;  1IN7 A;  2Q2E B;  4DV4 M;  4Z6Y A;  3WHK A;  2Z4R A;  3T1H M;  1HQY E;  3T1Y M;  4LF4 M;  2XFS A;  4DV7 M;  3NWL A;  5ITY A;  2BJW A;  3M0E A;  4K0K M;  3TPZ A;  1OJL A;  4DV0 M;  3FUV A;  4NRV A;  2EA0 A;  3KFU G;  1N36 M;  5FTJ A;  3LQQ A;  3VKH A;  3W0F A;  1EE8 A;  1L1T A;  4G4O A;  4LJA A;  3L25 A;  3AV0 A;  3QWL A;  2L09 A;  4G6Z A;  4JI0 M;  2VQF M;  3K8Z A;  4LZZ A;  4JV5 M;  2XSZ D;  3U6P A;  1K82 A;  2F5O A;  1N33 M;  1TDH A;  4B3S M;  4X64 M;  2G8L A;  3KOY E;  5KPR A;  1T3T A;  1ZAE A;  3EIE A;  2UXB M;  3VKG A;  2G5G X;  3C58 A;  4IBD A;  4AKH A;  2Z3X A;  1E9S A;  5C1B A;  4DR6 M;  2D7E A;  1HT2 E;  3FKE A;  3M6A A;  1QAN A;  2UXD M;  3L28 A;  3U6L A;  4L16 A;  3RGP A;  4BBA A;  5C18 A;  2C9O A;  1XXH A;  3ZH9 B;  1N32 M;  3U6C A;  1GKI A;  1R6B X;  3MJ5 A;  2CUZ A;  2XFT A;  4IJF A;  4NRW A;  1PJJ A;  2M5Z A;  1DGB A;  3HGI A;  1DO0 A;  1I4W A;  3GLF B;  2UUA M;  4FW9 A;  5IRE B;  2DWM A;  2X49 A;  7CAT A;  4GKJ M;  3HWS A;  3GO8 A;  2CV2 A;  3KSX A;  3GRR A;  3LMM A;  1KSF X;  2KEB A;  3RE8 A;  4TUW A;  2K47 A;  1IY2 A;  3K1J A;  1IN8 A;  4MM3 B;  3GQ3 A;  4LFB M;  4I81 A;  1QQW A;  4RF0 A;  5JI3 E;  4JI8 M;  4W5W A;  4IBF A;  4A3V B;  3FD9 A;  4GIT A;  1J09 A;  2J7O A;  4LF8 M;  3UZU A;  3SFZ A;  4FD2 A;  3GLI B;  3DOA A;  4LJ9 A;  1J5E M;  4LGM A;  3SMP A;  2R18 A;  3AOE C;  2HL7 A;  5KPZ A;  1HNZ M;  4MB7 A;  3FUU A;  3ZC7 B;  3KXE C;  1I94 M;  1HR0 M;  3M7G A;  4MGY E;  4KO8 A;  3T15 A;  4B7F A;  2C9C A;  5ITR A;  4OX9 M;  3KOX E;  1XMQ M;  3MHV C;  5IT9 S;  3GLH A;  4OW0 A;  3B9P A;  3HU2 A;  4X66 M;  1G59 A;  1FJG M;  2DZO B;  4M9S A;  5IZ7 D;  2YR0 A;  3SAV A;  3KSJ A;  2Z7J A;  2XH9 A;  1W5S A;  2V1C A;  4AQY M;  2M60 A;  2QBY B;  4GHL A;  3UJN A;  2DXI A;  1NNJ A;  3NBI A;  1R2Y A;  1IN4 A;  3JAM S;  5FTK A;  3E9S A;  2RKO A;  3LVW A;  4QHS A;  4L15 A;  3GLF A;  3HU3 A;  4GKK M;  3MK6 A;  5EQT A;  4D82 A;  4LRS A;  4LJ7 A;  3Q8X A;  3GLI A;  3BOS A;  4QNR A;  2LNH C;  4GMQ A;  3VK7 A;  3FTE A;  1NSF A;  4LZJ A;  4B7G A;  4FVM A;  1UM8 A;  2A5Y B;  1XC8 A;  4I8O A;  1IN6 A;  1IY1 A;  3U6M A;  2LXE A;  3CF2 A;  4L4U A;  3WHL A;  3KVW A;  3LVV A;  4M9Z A;  4BB9 A;  1NHW C;  4KLN A;  3GP1 A;  3JR4 A;  1DGG A;  3HKP A;  1NVM A;  2NQ8 C;  4M9X A;  4MGZ E;  2HHH M;  1R2Z A;  4RNA A;  2JA2 A;  4GIP A;  5ITU A;  4D80 A;  2QBY A;  4CIS A;  2HCB A;  2CE7 A;  2QP9 X;  2H1R A;  2C5R A;  3FTF A;  4P16 A;  4QNM A;  4JI2 M;  1G41 A;  4B7H A;  4AG5 A;  2VII A;  3SBJ A;  1NY5 A;  1SXJ D;  3FUX A;  5ITQ A;  3SAS A;  4LG2 A;  3J7A S;  1Q39 A;  2KRU A;  2XGN A;  2R4E A;  2FNA A;  4NOO B;  1OFH A;  4REZ A;  3RGS A;  3SYK A;  4QOS A;  1QVR A;  3U6O A;  4B3T M;  4GH9 A;  4LF9 M;  1K3W A;  3VFD A;  4AZF A;  2YNM D;  3TWM A;  2UUB M;  2RGO A;  3SAR A;  5LMN M;  4DR1 M;  5EP3 A;  2XEP A;  4IBB A;  1FNN A;  3KDS E;  1SXJ C;  2QEN A;  3PNV A;  4LJ8 A;  1N78 A;  3AJI B;  3L29 A;  3JR5 A;  2V1U A;  4B08 A;  3PNY A;  4AI6 A;  4NXM M;  1PJI A;  4CHT B;  2BNK A;  3HU1 A;  2KA6 B;  1Z59 A;  2P5T A;  4R3D A;  2KZS A;  4IBE A;  2Y21 A;  4ITQ A;  1YE9 A;  1QZM A;  3K92 A;  3CTW B;  4NSR A;  2XLJ A;  4LRT A;  4II7 A;  1L2B A;  3IG8 A;  1IBM M;  1XMO M;  4FWD A;  4OU7 A;  4RF1 A;  1Z5C A;  3HJS A;  3TE6 A;  3HHW A;  2Y0Q A;  1DO2 A;  1S3S A;  4GRI A;  3SAT A;  3FTD A;  4JI5 M;  1L2D A;  2Y20 A;  5EP1 A;  5EXP A;  3SYL A;  5FTN A;  4DUZ M;  3ZCB B;  2UUC M;  3U60 A;  3U60 B;  2XSZ A;  5IWA M;  3VK8 A;  4JYA M;  1Z5B A;  1HQC A;  1NJF A;  5KPT A;  1OFI A;  4LY6 A;  2J7N A;  2ZAO A;  2DWZ B;  5DYG A;  2F5S A;  2L7H A;  4DR2 M;  4JI3 M;  5BR8 M;  1Z6T A;  3J27 B;  4GC9 A;  2AHM A;  1Q3C A;  3GPU A;  1QAQ A;  4XGI A;  2ZM6 M;  2OPF A;  3KOW E;  4EIW A;  4LF5 M;  3VDU A;  3GRV A;  1L8Q A;  2DZN B;  1XNQ M;  4QOZ C;  2I7N A;  3PXG A;  5ITX A;  1L2C A;  4OVZ B;  2FE8 A;  2LWX A;  4Z8X A;  1NNU C;  3VDP A;  3THG A;  1NHG C;  3GLG B;  2DVW B;  3HHX A;  4X62 M;  4LFA M;  3PVS A;  3CF0 A;  1TDZ A;  4YHH M;  2XF3 A;  2OQ4 A;  2F5Q A;  4DR5 M;  3TL4 X;  4LJ4 A;  4PDG A;  4LF6 M;  3H4M A;  1YSY A;  5EP4 A;  4FCW A;  4MH0 E;  4JI1 M;  5F3W A;  3D8B A;  2FOI C;  4YY3 M;  1X37 A;  2ZAN A;  3GRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...