2Z3XA

Structure of a protein-dna complex essential for dna protection in spore of bacillus species
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*GP*GP*GP*A)-3'
publication title Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
total genus 19
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00269 SASP Small, acid-soluble spore proteins, alpha/beta type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.910 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z3xA00
2Z3XA
chains in the Genus database with same CATH superfamily
4HLQA 2Y0QA 3U61B 4FWHA 2LNHC 5EJCA 3GQ3A 3KOYE 1PJSA 1GL6A 1AIPC 4GKKM 2APLA 3LQRA 1L2CA 1TH2A 4OX9M 1JR3D 1XB2B 4LRSA 4KO8A 4NRVA 2MROB 1V34A 3GLHB 1SXJB 1T43A 2XF3A 4XK8F 2CV1A 2X8AA 4LY6A 1C7YA 1XHBA 3HU1A 4FWDA 4OVZB 2HL7A 4NXNM 4F2LA 2RKOA 1PM5A 1LTMA 3K9OA 3SFZA 2DHYA 1E9SA 2YNMD 3IG8A 4D82A 2E5LM 1VEKA 3GLIE 3U60A 1DGGA 5ITXA 1OKSA 2FOIC 1TF0B 5IZ7D 1G41A 4DR5M 3VK7A 4AG5A 2F5SA 1AUAA 4L6V6 3GLGE 3L26A 3GQ5A 3GLFA 5EXTA 2Z3XA 2JY6B 3FTEA 2M5ZA 3JR5A 3B7NA 3A45A 3B9PA 2OPFA 2UUCM 1FJGM 2ZBKB 4JV5M 4LF7M 2QENA 2Y21A 4I4LA 4WW0A 3J7AS 4GMQA 1NSFA 2R0IA 5KPRA 1EFUB 1N78A 3SC3A 4DUZM 2K0BX 1HQYE 2VIIA 1D2NA 1T3TA 3W67A 3HWSA 4DR4M 1NNUC 1QYRA 3QYBA 4IBIA 5EP4A 1R2YA 4LJ5A 2WSFF 4YY3M 5EP1A 5IWAM 2JXNA 2JY7A 4CJ6A 3NBXX 1CUKA 2VDBB 4GHLA 1Z59A 5FTNA 3KS4A 1Z5CA 1TDHA 1JR3A 2XH9A 4GC5A 4MGYE 4QOSA 1TDZA 4KT0F 3CF0A 3LCUA 2HAKA 5E6JA 3M6AA 2EO2A 2FE8A 1WIVA 1IY2A 1YE9A 1VQ1A 1DO0A 2W82A 2CHQA 2G8LA 4D81A 1IFYA 2KXEA 4NL4H 5DFLA 3RE8A 2QPAA 3WHKA 4JN6A 1QAOA 2I7PA 2JP7A 2OO9A 3U6OA 3A42A 3DZDA 2UXCM 1Q02A 1ZMVA 4Z6YA 3SMPA 1Q3CA 4QNRA 1OTRA 3DFZA 2N35A 2D7HA 2ZAMA 3BOSA 4JI1M 3PFIA 2UXDM 2FNAA 2LTUA 3AV0A 1QAMA 2Y20A 3M0EA 4FCWA 1GL7A 1P3QQ 1VEJA 3B7QA 2QHOB 3U60B 1SXJC 1WGLA 4AG6A 4BBAA 4OU7A 4L8RC 2JWSA 4W5WA 4LJAA 3UZUA 2J7OA 3Q8GA 1X37A 1GLNA 4PT5A 2R18A 2MH8A 1UFZA 3GLFB 3W0FA 2JA2A 2LWXA 1IXRC 3HJQA 1SXJE 2V1UA 4JI4M 2CFOA 1ORYB 2K47A 5EP3A 3VKGA 3PVSA 1J5EM 3SAVA 4CHTB 1RU3A 3EIEA 3KXEC 3PXGA 3HHZA 3SAWA 1NJGA 4RKUF 4IBBA 4JI8M 2G5GX 3SAUA 2VF7A 3AKZA 3TPZA 3SARA 1IN7A 2L7IA 4ZPXA 4NRWA 1HNWM 1VEGA 4DV5M 2XZFA 4DBGB 3KVWA 2DAEA 5KQ8A 3WHLA 4JYAM 2JY8A 5L8RF 1JQJC 4JI2M 2DZNB 1OQYA 1HT2E 4JI0M 1N34M 1QUSA 4L4UA 4FW9A 1A5TA 2RRUA 4YHHM 2KNVA 2C5RA 3CTWB 3UJNA 4GITA 1PGYA 2NQ8C 2L4EA 3RGPA 3W0LB 1XNRM 2CUZA 3U6EA 2QNJA 4LCBA 1YUBA 5JI3E 5ITRA 4I81A 1TH4A 2CWBA 2FS1A 4MH0E 2L2DA 3K1JA 3EIHA 2UXBM 2DWMA 2JY5A 3R8FA 4LGMA 3LQQA 3L28A 5FLXS 3K92A 3FUTA 3VDUA 2X4AA 5KQDA 4L15A 4B7GA 5FTLA 1GABA 2QSFX 4DR1M 1TTEA 4HL4A 4GH9A 4WP2A 2C9CA 1VDDA 2R65A 1ZAEA 1ZMWA 4II7A 4CISA 1G59A 4RF1A 2ZANA 4PD2A 2YR0A 3L2AA 4FVMA 5DYIA 2MR9A 2Y0TA 2B3TA 4UN2B 3UMMA 1GVNA 2LVNC 1IBMM 1N77A 4IBKA 4AZFA 1OAIA 3HJ8A 3E4RA 1VG5A 3JAMS 4X62M 3AJIB 3K2LA 2LVAA 4DV7M 2ZAOA 3J81S 3VDPA 3GRYA 4B7HA 3L25A 2BWEA 3I51A 3U5ZA 3H4JA 2DAKA 2C9OA 1PJJA 4JI5M 1VDLA 2H5XA 4PDGA 1N33M 2L09A 2HKJA 1MU5A 4I8OA 4KHPM 4GIPA 1V92A 1XXHE 3J7BA 4F1IA 2OOBA 3FTDA 1JB0F 2CEAA 3A98B 2DI0A 2R45A 4IJFA 1TGUA 1L1ZA 1IQPA 4LG2A 1UM8A 3FUUA 3FUVA 1ZMUA 4B3RM 4LZJA 1R2ZA 3A46A 1G4AE 2DAIA 3HHYA 1LV7A 2XSZD 3HHWA 2OOAA 4QHSA 2BJVA 2VF8A 4LF9M 2KZUA 5EXPA 3K9PA 4LF8M 4DV0M 3GQ4A 1G3IA 4MGKE 2HCBA 3W68A 4DV6M 4LF4M 5JI2E 4D80A 2XFSA 3L29A 1OIPA 2R62A 3FKEA 2LHGA 2JZ1A 3KP1E 1SXJD 5LMNM 3GPYA 4Z8XA 3HJSA 3HHXA 4AW4A 3DOAA 1QZEA 2CV0A 3V76A 1K3WA 2LHCA 2G3QA 2O25A 3QAUA 4M9ZA 2DWLA 4M0DA 3FUWA 4KLNA 2XEPA 3PNVA 3KFUG 3ILKA 3HY5A 1OFIA 2XFTA 3GRRA 3THGA 3AOEC 4L16A 3FRIA 2KW0A 2LVPC 1ZV1A 2O5RA 2R44A 4Q7JA 1HR0M 2R4JA 2Z8YM 4Y28F 1OJLA 3T15A 5BR8M 3SMSA 3Q8XA 5H37D 2QCUA 3DA1A 3OTOM 3FTFA 4K0KM 4BLCA 3U6LA 5E26A 2GQFA 3U5ZB 4G4NA 2UU9M 4L78A 2ZTDA 3IECA 2L4FA 3JR4A 1C1KA 1N32M 4LFAM 4M9XA 3FTCA 1DGFA 1IN8A 2KNZA 4IBDA 2MJ5B 3TE6A 5F3WA 4IBFA 2WSEF 4CIZA 3SATA 4NSRA 4LZZA 4JI6M 3GLHE 5ITYA 4JI3M 1L1TA 1I94M 2UUBM 4FCVA 3I04M 2OQ4A 2RGHA 1GJSA 1Y8GA 4DR2M 5DNYA 1NO1A 3MK6A 2DZOB 2R6FA 1PJTA 1IXZA 3NWLA 5BPVA 1NV8A 3U6DA 4REZA 1IBKM 2F5PA 4P17A 5LMUM 1NY6A 1F4IA 1S3SA 2KRUA 2ZM6M 3ZCBB 2DAGA 4LJ6A 1QVRA 1L2BA 1E9RA 2CHGA 1QDRA 5EXXA 3KP0E 4DR6M 4LF6M 3K8ZA 1MN3A 3HU3A 1GO5A 4X66M 2LVOC 4LFCM 2LVQD 1V33A 5FTJA 3GRVA 1DO2A 2KNAA 1QUTA 2CRUA 3VKHA 1W5SA 3TL4X 4PCZA 2LH0A 5FTKA 4X65M 3AL0C 3MHVC 3R9XB 2BNKA 5EQTA 2KDLA 1QQWA 2P5TA 4GRIA 3C58A 1QANA 1WGNA 1KSFX 2F5QA 4LRTA 5DYGA 3TWLA 2KEBA 3SYKA 1D0MA 2YFQA 3U6QA 3T38A 1OIZA 4LJ8A 2JZ0A 4LF5M 4AKIA 2DWZB 1SG9A 2FH0A 3LCVB 2JNHA 2DKLA 2LXEA 1XMQM 1NNJA 1NHGC 3B89A 4EIWA 1I4WA 2DHRA 1D0LA 2DAMA 4NOOB 2Z7JA 2DZLA 1MX0A 1NHWC 3GPXA 2JUJA 2J5YA 1Z5AA 2I7NA 3MJ5A 4P16A 2C99A 1K82A 2YQZA 2DNAA 2FFJA 1IY1A 4FD2A 5ITTA 3J2PB 2C98A 2QQ8A 3C3EA 3KSXA 1PRBA 3I4YA 2EKKA 3J80S 4JI7M 3SHGB 2CP8A 3C3DA 1K3XA 4G3OA 3D8LA 4B7FA 4ITQA 4MGIE 4IIWA 3U6SA 1L8QA 2KRKA 1IN6A 3GLIA 2A5YB 4FCTA 3U6MA 3B7ZA 1HNZM 5ITXE 1QAQA 4XGIA 1PJIA 1XC8A 1TR8A 2KA6B 1XXHA 4B08A 2EUCA 3GLGA 4MGHA 3FYDA 3GLFE 3VFDA 2EA0A 3AFHA 3H4MA 1NJFA 3ZC7B 4OW0A 4AQYM 4GKJM 1KYIA 4FWGA 1XWIA 1R5LA 1W5TA 1OAOC 2Q2EB 4HEOA 4MB7A 4DR3M 2QBYA 4AKGA 4XBOA 1MJGM 1J7KA 4RNAA 2MGWA 1G71A 3FRHA 1TH3A 1Z5BA 1HQCA 3UGJA 3M7GA 1GJTA 4B3SM 2HHHM 1GKIA 2HWJA 3FYCA 5KPTA 4NSOB 1E32A 3PNYA 2D7GA 2R4EA 3C9PA 5KPZA 4LJ7A 4IBGA 4BB9A 8CATA 2DVWB 4M9SA 5FSWA 1JR3E 3VK8A 1YLAA 3CF6E 3I4VA 3LVWA 1IN4A 2F5NA 1IY0A 1EE8A 1WR1B 1IXSA 3TWMA 3T6PA 3BXWA 3GRUA 4X64M 1L2DA 1KFVA 2ERCA 2F5OA 1R4GA 3HKPA 4NXMM 1HJPA 1HNXM 2WSCF 3BBZA 3IG5A 4RF0A 2D7EA 3GP1A 5FTMA 1XNQM 4R3DA 3KSJA 4AKHA 3LVVA 1BVSA 1EIJA 4R7GA 2Z4RA 1G8PA 2QP9X 3GPPA 2XSZA 3CF2A 1YSYA 4AI6A 2Z4SA 1OFHA 2EKFA 4JXJA 1DGHA 4B3TM 1T6OA 2AHMA 4IBCA 3KOZE 4QHTA 1ZQ9A 2BWBA 2EJSA 3AOEA 3FE3A 4LJ4A 3B74A 2R46A 3GPUA 3GLIB 3U61A 4DV1M 3SBJA 3CGWA 3T1YM 1J09A 3F92A 2XGNA 1XXHB 2H1RA 3GLGB 1PJQA 4DR7M 2F4VM 4DV3M 3ZQJA 2LBCA 4LGYA 3HX3A 3E46A 2KHHA 4IBJA 3GLHA 5EP2A 1R7RA 4R71A 1SXJA 2VQEM 3E21A 5ITUA 4QOZC 4LFBM 1Q3BA 2CE7A 3FUXA 5C18A 4OVZA 2CHVA 1DGBA 1IN5A 3D8BA 2QBYB 3QWLA 4A3VB 4KODA 4NC6A 3VLFB 1N36M 1WXQA 3MMPA 2DXIA 2QZ4A 4CGYB 1QZMA 5ITQA 2DENA 2UUAM 7CATA 5IREB 4MGZE 1WJ7A 5GKNA 5IT9S 1Q39A 4GC9A 1FNNA 3QYEA 2DWNA 4DUYM 3AOGA 4G4QA 1HT1E 3IHPA 3I01M 1R6BX 1NY5A 2ZTCA 4IBEA 4LJ9A 4G4RA 3RGSA 3U6CA 2WZJA 3FD9A 2L7HA 3U6PA 1D0KA 2C96A 2XLJA 3ZH9B 1IM2A 2VQFM 2V1CA 4I5SA 4MM3B 2GNOA 2O01F 3SASA 3L27A 3RFWA 3T1HM 4G6ZA 1XMOM 4ANRA 3SHFA 1IXSB 3GO8A 2XZUA 3J27B 3KOWE 4S12A 2J7NA 2X49A 1E94E 4B3MM 3LMMA 4DV2M 3TQSA 2L6OA 4DV4M 1Z6TA 1N75A 3HZJA 3NBIA 4GEWA 4WURA 3UK6A 3KDSE 1NVMA 2M60A 1WHCA 2V6ZM 3HU2A 3LW5F 4PDIA 2K9DA 3TWKA 2CV2A 3SYLA 2RGOA 4TUWA 5EXSA 2BJWA 1NV9A 4M0WA 4IJEA 3E9SA 3KOXE 4QNMA 5C1BA 5KO3A 1IBLM 1DV0A 5A2QS 3HGIA 1DGHB 2K6BA 4G4OA 1H6UA 1QDTA 3KS8A 4GHAA 3KW6A 2KZSA
chains in the Genus database with same CATH topology
4HLQA 2Y0QA 3U61B 4FWHA 2LNHC 5EJCA 3GQ3A 3KOYE 1GL6A 4GKKM 3LQRA 1L2CA 1TH2A 4OX9M 1JR3D 4LRSA 4KO8A 4NRVA 3GLHB 1SXJB 2XF3A 2CV1A 2X8AA 4LY6A 1XHBA 3HU1A 4FWDA 4OVZB 2HL7A 4NXNM 2RKOA 1PM5A 3SFZA 2YNMD 1E9SA 3IG8A 4D82A 2E5LM 3U60A 1DGGA 5ITXA 2FOIC 5IZ7D 1G41A 4DR5M 3VK7A 4AG5A 2F5SA 3GQ5A 3GLFA 5EXTA 2Z3XA 3FTEA 2M5ZA 3JR5A 3A45A 3B9PA 2OPFA 2UUCM 1FJGM 2ZBKB 4JV5M 4LF7M 2QENA 2Y21A 4I4LA 4WW0A 3J7AS 4GMQA 1NSFA 5KPRA 1N78A 3SC3A 4DUZM 1HQYE 2VIIA 1D2NA 1T3TA 3HWSA 4DR4M 1NNUC 1QYRA 5EP4A 4IBIA 1R2YA 4LJ5A 4YY3M 5EP1A 5IWAM 4GHLA 1Z59A 5FTNA 3KS4A 1Z5CA 1TDHA 1JR3A 2XH9A 4GC5A 4MGYE 4QOSA 1TDZA 3CF0A 5E6JA 3M6AA 2EO2A 2FE8A 1IY2A 1YE9A 1DO0A 2W82A 2CHQA 2G8LA 4D81A 2KXEA 4NL4H 3RE8A 2QPAA 3WHKA 4JN6A 1QAOA 2I7PA 3U6OA 3A42A 3DZDA 2UXCM 4Z6YA 3SMPA 1Q3CA 4QNRA 3DFZA 2D7HA 2ZAMA 3BOSA 4JI1M 3PFIA 2UXDM 2FNAA 3AV0A 1QAMA 2Y20A 3M0EA 4FCWA 1GL7A 3U60B 1SXJC 4AG6A 4BBAA 4OU7A 4L8RC 4W5WA 4LJAA 3UZUA 2J7OA 1X37A 1GLNA 4PT5A 2R18A 3GLFB 3W0FA 2JA2A 2LWXA 1IXRC 3HJQA 1SXJE 2V1UA 4JI4M 2CFOA 1ORYB 2K47A 5EP3A 3VKGA 3PVSA 1J5EM 3SAVA 4CHTB 3EIEA 3PXGA 3KXEC 3HHZA 3SAWA 4JI8M 1NJGA 4IBBA 2G5GX 3SAUA 3AKZA 3TPZA 3SARA 1IN7A 2L7IA 4ZPXA 4NRWA 1HNWM 4DV5M 2XZFA 3KVWA 5KQ8A 3WHLA 4JYAM 1JQJC 4JI2M 2DZNB 1HT2E 4JI0M 1N34M 4L4UA 4FW9A 4YHHM 2C5RA 3CTWB 3UJNA 4GITA 2NQ8C 3RGPA 3W0LB 1XNRM 2CUZA 3U6EA 4LCBA 1YUBA 5JI3E 5ITRA 4I81A 1TH4A 4MH0E 3K1JA 3EIHA 2DWMA 3R8FA 4LGMA 3LQQA 3L28A 5FLXS 3K92A 3FUTA 3VDUA 2X4AA 5KQDA 4L15A 4B7GA 5FTLA 4DR1M 4HL4A 4GH9A 2C9CA 1VDDA 2R65A 1ZAEA 4II7A 4CISA 1G59A 4RF1A 2ZANA 4PD2A 2YR0A 3L2AA 4FVMA 5DYIA 2Y0TA 3UMMA 1GVNA 1IBMM 1N77A 4IBKA 4AZFA 3HJ8A 3E4RA 3JAMS 4X62M 3AJIB 3K2LA 4DV7M 2ZAOA 3J81S 3VDPA 3GRYA 4B7HA 3L25A 3I51A 3U5ZA 1PJJA 4JI5M 2C9OA 4PDGA 1N33M 2L09A 2HKJA 1MU5A 4I8OA 4KHPM 4GIPA 3J7BA 3FTDA 2CEAA 3A98B 2R45A 4IJFA 1TGUA 1L1ZA 1IQPA 4LG2A 1UM8A 3FUUA 3FUVA 4B3RM 4LZJA 1R2ZA 3A46A 1G4AE 3HHYA 1LV7A 2XSZD 3HHWA 4QHSA 2BJVA 4LF9M 2KZUA 5EXPA 4LF8M 4DV0M 3GQ4A 1G3IA 4MGKE 2HCBA 4DV6M 4LF4M 5JI2E 4D80A 2XFSA 3L29A 2R62A 3FKEA 3KP1E 1SXJD 5LMNM 3GPYA 4Z8XA 3HJSA 3HHXA 4AW4A 3DOAA 2CV0A 1K3WA 3QAUA 2DWLA 4M9ZA 4M0DA 3FUWA 4KLNA 2XEPA 3PNVA 3KFUG 3ILKA 1OFIA 2XFTA 3GRRA 3THGA 3AOEC 4L16A 2KW0A 2O5RA 1HR0M 2R4JA 5BR8M 3T15A 1OJLA 3SMSA 3Q8XA 5H37D 2QCUA 3DA1A 3OTOM 3FTFA 4K0KM 4BLCA 3U6LA 5E26A 3U5ZB 4G4NA 2UU9M 4L78A 3JR4A 1C1KA 1N32M 4LFAM 4M9XA 3FTCA 1DGFA 1IN8A 4IBDA 3TE6A 5F3WA 4IBFA 3SATA 4JI6M 4NSRA 4LZZA 5ITYA 4JI3M 1L1TA 1I94M 2UUBM 4FCVA 2OQ4A 2RGHA 4DR2M 5DNYA 3MK6A 2DZOB 1IXZA 3NWLA 5BPVA 3U6DA 1IBKM 4REZA 2F5PA 5LMUM 1NY6A 1S3SA 2KRUA 2ZM6M 3ZCBB 4LJ6A 1QVRA 1L2BA 1E9RA 2CHGA 5EXXA 3KP0E 4DR6M 4LF6M 3K8ZA 3HU3A 4X66M 4LFCM 5FTJA 3GRVA 1DO2A 3VKHA 1W5SA 3TL4X 4PCZA 2LH0A 5FTKA 4X65M 3AL0C 3MHVC 3R9XB 2BNKA 5EQTA 1QQWA 2P5TA 4GRIA 3C58A 1QANA 1KSFX 2F5QA 4LRTA 5DYGA 3TWLA 2KEBA 3SYKA 2YFQA 3U6QA 3T38A 4LJ8A 4LF5M 4AKIA 2DWZB 1XMQM 2LXEA 1NNJA 1NHGC 4EIWA 1I4WA 2DHRA 4NOOB 2Z7JA 1MX0A 1NHWC 3GPXA 1Z5AA 2I7NA 3MJ5A 4P16A 2C99A 1K82A 2YQZA 2FFJA 1IY1A 4FD2A 5ITTA 3J2PB 2C98A 3KSXA 3I4YA 3J80S 4JI7M 3SHGB 1K3XA 3D8LA 4B7FA 4ITQA 4MGIE 4IIWA 3U6SA 1L8QA 2KRKA 1IN6A 3GLIA 2A5YB 4FCTA 3U6MA 1HNZM 5ITXE 1QAQA 4XGIA 1PJIA 1XC8A 2KA6B 1XXHA 4B08A 2EUCA 3GLGA 4MGHA 3FYDA 3VFDA 2EA0A 3AFHA 3H4MA 1NJFA 3ZC7B 4OW0A 4AQYM 4GKJM 1KYIA 4FWGA 1XWIA 1W5TA 2Q2EB 4MB7A 4DR3M 2QBYA 4AKGA 4XBOA 1J7KA 4RNAA 1TH3A 1Z5BA 1HQCA 3UGJA 3M7GA 4B3SM 2HHHM 1GKIA 3FYCA 5KPTA 4NSOB 1E32A 3PNYA 2D7GA 2R4EA 5KPZA 4LJ7A 4IBGA 4BB9A 8CATA 2DVWB 4M9SA 5FSWA 3VK8A 3CF6E 3I4VA 3LVWA 1IN4A 2F5NA 1IY0A 1EE8A 3TWMA 3GRUA 4X64M 1L2DA 1KFVA 2ERCA 2F5OA 3HKPA 4NXMM 1HNXM 3IG5A 1XNQM 4RF0A 2D7EA 3GP1A 5FTMA 4R3DA 3KSJA 4AKHA 3LVVA 4R7GA 2Z4RA 1G8PA 2QP9X 3GPPA 2XSZA 3CF2A 1YSYA 4AI6A 2Z4SA 1OFHA 4JXJA 1DGHA 4B3TM 2AHMA 4IBCA 4QHTA 3KOZE 2UXBM 1ZQ9A 3AOEA 3GLIB 3U61A 4LJ4A 3GPUA 2R46A 4DV1M 3SBJA 3T1YM 1J09A 2XGNA 1XXHB 2H1RA 3GLGB 4DR7M 2F4VM 4DV3M 4LGYA 4IBJA 5EP2A 3GLHA 2VQEM 1R7RA 1SXJA 5ITUA 4QOZC 4LFBM 1Q3BA 2CE7A 3FUXA 5C18A 4OVZA 2CHVA 1DGBA 1IN5A 3D8BA 2QBYB 3QWLA 4A3VB 4KODA 3VLFB 1N36M 2DXIA 1WXQA 2QZ4A 4CGYB 1QZMA 5ITQA 2UUAM 7CATA 5IREB 4MGZE 5GKNA 5IT9S 1Q39A 4GC9A 1FNNA 2DWNA 4DUYM 3AOGA 4G4QA 1HT1E 1R6BX 1NY5A 4IBEA 4LJ9A 4G4RA 3RGSA 3U6CA 3FD9A 2L7HA 3U6PA 2C96A 2XLJA 3ZH9B 1IM2A 2VQFM 2V1CA 4I5SA 4MM3B 3SASA 3L27A 3RFWA 3T1HM 4G6ZA 1XMOM 3SHFA 1IXSB 3GO8A 2XZUA 3J27B 3KOWE 4S12A 2J7NA 2X49A 1E94E 4B3MM 3LMMA 4DV2M 3TQSA 2L6OA 4DV4M 1Z6TA 1N75A 3NBIA 3UK6A 4WURA 3KDSE 1NVMA 2M60A 2V6ZM 3HU2A 4PDIA 2CV2A 3TWKA 3SYLA 2RGOA 4TUWA 5EXSA 2BJWA 4M0WA 4IJEA 3E9SA 3KOXE 4QNMA 5C1BA 5KO3A 1IBLM 5A2QS 3HGIA 1DGHB 4G4OA 3KS8A 1H6UA 3L26A 4GHAA 3KW6A 2KZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3X A; 
#chains in the Genus database with same CATH topology
 4HLQ A;  2Y0Q A;  3U61 B;  4FWH A;  2LNH C;  5EJC A;  3GQ3 A;  3KOY E;  1PJS A;  1GL6 A;  1AIP C;  4GKK M;  2APL A;  3LQR A;  1L2C A;  1TH2 A;  4OX9 M;  1JR3 D;  1XB2 B;  4LRS A;  4KO8 A;  4NRV A;  2MRO B;  1V34 A;  3GLH B;  1SXJ B;  1T43 A;  2XF3 A;  4XK8 F;  2CV1 A;  2X8A A;  4LY6 A;  1C7Y A;  1XHB A;  3HU1 A;  4FWD A;  4OVZ B;  2HL7 A;  4NXN M;  4F2L A;  2RKO A;  1PM5 A;  1LTM A;  3K9O A;  3SFZ A;  2DHY A;  1E9S A;  2YNM D;  3IG8 A;  4D82 A;  2E5L M;  1VEK A;  3GLI E;  3U60 A;  1DGG A;  5ITX A;  1OKS A;  2FOI C;  1TF0 B;  5IZ7 D;  1G41 A;  4DR5 M;  3VK7 A;  4AG5 A;  2F5S A;  1AUA A;  4L6V 6;  3GLG E;  3L26 A;  3GQ5 A;  3GLF A;  5EXT A;  2Z3X A;  2JY6 B;  3FTE A;  2M5Z A;  3JR5 A;  3B7N A;  3A45 A;  3B9P A;  2OPF A;  2UUC M;  1FJG M;  2ZBK B;  4JV5 M;  4LF7 M;  2QEN A;  2Y21 A;  4I4L A;  4WW0 A;  3J7A S;  4GMQ A;  1NSF A;  2R0I A;  5KPR A;  1EFU B;  1N78 A;  3SC3 A;  4DUZ M;  2K0B X;  1HQY E;  2VII A;  1D2N A;  1T3T A;  3W67 A;  3HWS A;  4DR4 M;  1NNU C;  1QYR A;  3QYB A;  4IBI A;  5EP4 A;  1R2Y A;  4LJ5 A;  2WSF F;  4YY3 M;  5EP1 A;  5IWA M;  2JXN A;  2JY7 A;  4CJ6 A;  3NBX X;  1CUK A;  2VDB B;  4GHL A;  1Z59 A;  5FTN A;  3KS4 A;  1Z5C A;  1TDH A;  1JR3 A;  2XH9 A;  4GC5 A;  4MGY E;  4QOS A;  1TDZ A;  4KT0 F;  3CF0 A;  3LCU A;  2HAK A;  5E6J A;  3M6A A;  2EO2 A;  2FE8 A;  1WIV A;  1IY2 A;  1YE9 A;  1VQ1 A;  1DO0 A;  2W82 A;  2CHQ A;  2G8L A;  4D81 A;  1IFY A;  2KXE A;  4NL4 H;  5DFL A;  3RE8 A;  2QPA A;  3WHK A;  4JN6 A;  1QAO A;  2I7P A;  2JP7 A;  2OO9 A;  3U6O A;  3A42 A;  3DZD A;  2UXC M;  1Q02 A;  1ZMV A;  4Z6Y A;  3SMP A;  1Q3C A;  4QNR A;  1OTR A;  3DFZ A;  2N35 A;  2D7H A;  2ZAM A;  3BOS A;  4JI1 M;  3PFI A;  2UXD M;  2FNA A;  2LTU A;  3AV0 A;  1QAM A;  2Y20 A;  3M0E A;  4FCW A;  1GL7 A;  1P3Q Q;  1VEJ A;  3B7Q A;  2QHO B;  3U60 B;  1SXJ C;  1WGL A;  4AG6 A;  4BBA A;  4OU7 A;  4L8R C;  2JWS A;  4W5W A;  4LJA A;  3UZU A;  2J7O A;  3Q8G A;  1X37 A;  1GLN A;  4PT5 A;  2R18 A;  2MH8 A;  1UFZ A;  3GLF B;  3W0F A;  2JA2 A;  2LWX A;  1IXR C;  3HJQ A;  1SXJ E;  2V1U A;  4JI4 M;  2CFO A;  1ORY B;  2K47 A;  5EP3 A;  3VKG A;  3PVS A;  1J5E M;  3SAV A;  4CHT B;  1RU3 A;  3EIE A;  3KXE C;  3PXG A;  3HHZ A;  3SAW A;  1NJG A;  4RKU F;  4IBB A;  4JI8 M;  2G5G X;  3SAU A;  2VF7 A;  3AKZ A;  3TPZ A;  3SAR A;  1IN7 A;  2L7I A;  4ZPX A;  4NRW A;  1HNW M;  1VEG A;  4DV5 M;  2XZF A;  4DBG B;  3KVW A;  2DAE A;  5KQ8 A;  3WHL A;  4JYA M;  2JY8 A;  5L8R F;  1JQJ C;  4JI2 M;  2DZN B;  1OQY A;  1HT2 E;  4JI0 M;  1N34 M;  1QUS A;  4L4U A;  4FW9 A;  1A5T A;  2RRU A;  4YHH M;  2KNV A;  2C5R A;  3CTW B;  3UJN A;  4GIT A;  1PGY A;  2NQ8 C;  2L4E A;  3RGP A;  3W0L B;  1XNR M;  2CUZ A;  3U6E A;  2QNJ A;  4LCB A;  1YUB A;  5JI3 E;  5ITR A;  4I81 A;  1TH4 A;  2CWB A;  2FS1 A;  4MH0 E;  2L2D A;  3K1J A;  3EIH A;  2UXB M;  2DWM A;  2JY5 A;  3R8F A;  4LGM A;  3LQQ A;  3L28 A;  5FLX S;  3K92 A;  3FUT A;  3VDU A;  2X4A A;  5KQD A;  4L15 A;  4B7G A;  5FTL A;  1GAB A;  2QSF X;  4DR1 M;  1TTE A;  4HL4 A;  4GH9 A;  4WP2 A;  2C9C A;  1VDD A;  2R65 A;  1ZAE A;  1ZMW A;  4II7 A;  4CIS A;  1G59 A;  4RF1 A;  2ZAN A;  4PD2 A;  2YR0 A;  3L2A A;  4FVM A;  5DYI A;  2MR9 A;  2Y0T A;  2B3T A;  4UN2 B;  3UMM A;  1GVN A;  2LVN C;  1IBM M;  1N77 A;  4IBK A;  4AZF A;  1OAI A;  3HJ8 A;  3E4R A;  1VG5 A;  3JAM S;  4X62 M;  3AJI B;  3K2L A;  2LVA A;  4DV7 M;  2ZAO A;  3J81 S;  3VDP A;  3GRY A;  4B7H A;  3L25 A;  2BWE A;  3I51 A;  3U5Z A;  3H4J A;  2DAK A;  2C9O A;  1PJJ A;  4JI5 M;  1VDL A;  2H5X A;  4PDG A;  1N33 M;  2L09 A;  2HKJ A;  1MU5 A;  4I8O A;  4KHP M;  4GIP A;  1V92 A;  1XXH E;  3J7B A;  4F1I A;  2OOB A;  3FTD A;  1JB0 F;  2CEA A;  3A98 B;  2DI0 A;  2R45 A;  4IJF A;  1TGU A;  1L1Z A;  1IQP A;  4LG2 A;  1UM8 A;  3FUU A;  3FUV A;  1ZMU A;  4B3R M;  4LZJ A;  1R2Z A;  3A46 A;  1G4A E;  2DAI A;  3HHY A;  1LV7 A;  2XSZ D;  3HHW A;  2OOA A;  4QHS A;  2BJV A;  2VF8 A;  4LF9 M;  2KZU A;  5EXP A;  3K9P A;  4LF8 M;  4DV0 M;  3GQ4 A;  1G3I A;  4MGK E;  2HCB A;  3W68 A;  4DV6 M;  4LF4 M;  5JI2 E;  4D80 A;  2XFS A;  3L29 A;  1OIP A;  2R62 A;  3FKE A;  2LHG A;  2JZ1 A;  3KP1 E;  1SXJ D;  5LMN M;  3GPY A;  4Z8X A;  3HJS A;  3HHX A;  4AW4 A;  3DOA A;  1QZE A;  2CV0 A;  3V76 A;  1K3W A;  2LHC A;  2G3Q A;  2O25 A;  3QAU A;  4M9Z A;  2DWL A;  4M0D A;  3FUW A;  4KLN A;  2XEP A;  3PNV A;  3KFU G;  3ILK A;  3HY5 A;  1OFI A;  2XFT A;  3GRR A;  3THG A;  3AOE C;  4L16 A;  3FRI A;  2KW0 A;  2LVP C;  1ZV1 A;  2O5R A;  2R44 A;  4Q7J A;  1HR0 M;  2R4J A;  2Z8Y M;  4Y28 F;  1OJL A;  3T15 A;  5BR8 M;  3SMS A;  3Q8X A;  5H37 D;  2QCU A;  3DA1 A;  3OTO M;  3FTF A;  4K0K M;  4BLC A;  3U6L A;  5E26 A;  2GQF A;  3U5Z B;  4G4N A;  2UU9 M;  4L78 A;  2ZTD A;  3IEC A;  2L4F A;  3JR4 A;  1C1K A;  1N32 M;  4LFA M;  4M9X A;  3FTC A;  1DGF A;  1IN8 A;  2KNZ A;  4IBD A;  2MJ5 B;  3TE6 A;  5F3W A;  4IBF A;  2WSE F;  4CIZ A;  3SAT A;  4NSR A;  4LZZ A;  4JI6 M;  3GLH E;  5ITY A;  4JI3 M;  1L1T A;  1I94 M;  2UUB M;  4FCV A;  3I04 M;  2OQ4 A;  2RGH A;  1GJS A;  1Y8G A;  4DR2 M;  5DNY A;  1NO1 A;  3MK6 A;  2DZO B;  2R6F A;  1PJT A;  1IXZ A;  3NWL A;  5BPV A;  1NV8 A;  3U6D A;  4REZ A;  1IBK M;  2F5P A;  4P17 A;  5LMU M;  1NY6 A;  1F4I A;  1S3S A;  2KRU A;  2ZM6 M;  3ZCB B;  2DAG A;  4LJ6 A;  1QVR A;  1L2B A;  1E9R A;  2CHG A;  1QDR A;  5EXX A;  3KP0 E;  4DR6 M;  4LF6 M;  3K8Z A;  1MN3 A;  3HU3 A;  1GO5 A;  4X66 M;  2LVO C;  4LFC M;  2LVQ D;  1V33 A;  5FTJ A;  3GRV A;  1DO2 A;  2KNA A;  1QUT A;  2CRU A;  3VKH A;  1W5S A;  3TL4 X;  4PCZ A;  2LH0 A;  5FTK A;  4X65 M;  3AL0 C;  3MHV C;  3R9X B;  2BNK A;  5EQT A;  2KDL A;  1QQW A;  2P5T A;  4GRI A;  3C58 A;  1QAN A;  1WGN A;  1KSF X;  2F5Q A;  4LRT A;  5DYG A;  3TWL A;  2KEB A;  3SYK A;  1D0M A;  2YFQ A;  3U6Q A;  3T38 A;  1OIZ A;  4LJ8 A;  2JZ0 A;  4LF5 M;  4AKI A;  2DWZ B;  1SG9 A;  2FH0 A;  3LCV B;  2JNH A;  2DKL A;  2LXE A;  1XMQ M;  1NNJ A;  1NHG C;  3B89 A;  4EIW A;  1I4W A;  2DHR A;  1D0L A;  2DAM A;  4NOO B;  2Z7J A;  2DZL A;  1MX0 A;  1NHW C;  3GPX A;  2JUJ A;  2J5Y A;  1Z5A A;  2I7N A;  3MJ5 A;  4P16 A;  2C99 A;  1K82 A;  2YQZ A;  2DNA A;  2FFJ A;  1IY1 A;  4FD2 A;  5ITT A;  3J2P B;  2C98 A;  2QQ8 A;  3C3E A;  3KSX A;  1PRB A;  3I4Y A;  2EKK A;  3J80 S;  4JI7 M;  3SHG B;  2CP8 A;  3C3D A;  1K3X A;  4G3O A;  3D8L A;  4B7F A;  4ITQ A;  4MGI E;  4IIW A;  3U6S A;  1L8Q A;  2KRK A;  1IN6 A;  3GLI A;  2A5Y B;  4FCT A;  3U6M A;  3B7Z A;  1HNZ M;  5ITX E;  1QAQ A;  4XGI A;  1PJI A;  1XC8 A;  1TR8 A;  2KA6 B;  1XXH A;  4B08 A;  2EUC A;  3GLG A;  4MGH A;  3FYD A;  3GLF E;  3VFD A;  2EA0 A;  3AFH A;  3H4M A;  1NJF A;  3ZC7 B;  4OW0 A;  4AQY M;  4GKJ M;  1KYI A;  4FWG A;  1XWI A;  1R5L A;  1W5T A;  1OAO C;  2Q2E B;  4HEO A;  4MB7 A;  4DR3 M;  2QBY A;  4AKG A;  4XBO A;  1MJG M;  1J7K A;  4RNA A;  2MGW A;  1G71 A;  3FRH A;  1TH3 A;  1Z5B A;  1HQC A;  3UGJ A;  3M7G A;  1GJT A;  4B3S M;  2HHH M;  1GKI A;  2HWJ A;  3FYC A;  5KPT A;  4NSO B;  1E32 A;  3PNY A;  2D7G A;  2R4E A;  3C9P A;  5KPZ A;  4LJ7 A;  4IBG A;  4BB9 A;  8CAT A;  2DVW B;  4M9S A;  5FSW A;  1JR3 E;  3VK8 A;  1YLA A;  3CF6 E;  3I4V A;  3LVW A;  1IN4 A;  2F5N A;  1IY0 A;  1EE8 A;  1WR1 B;  1IXS A;  3TWM A;  3T6P A;  3BXW A;  3GRU A;  4X64 M;  1L2D A;  1KFV A;  2ERC A;  2F5O A;  1R4G A;  3HKP A;  4NXM M;  1HJP A;  1HNX M;  2WSC F;  3BBZ A;  3IG5 A;  4RF0 A;  2D7E A;  3GP1 A;  5FTM A;  1XNQ M;  4R3D A;  3KSJ A;  4AKH A;  3LVV A;  1BVS A;  1EIJ A;  4R7G A;  2Z4R A;  1G8P A;  2QP9 X;  3GPP A;  2XSZ A;  3CF2 A;  1YSY A;  4AI6 A;  2Z4S A;  1OFH A;  2EKF A;  4JXJ A;  1DGH A;  4B3T M;  1T6O A;  2AHM A;  4IBC A;  3KOZ E;  4QHT A;  1ZQ9 A;  2BWB A;  2EJS A;  3AOE A;  3FE3 A;  4LJ4 A;  3B74 A;  2R46 A;  3GPU A;  3GLI B;  3U61 A;  4DV1 M;  3SBJ A;  3CGW A;  3T1Y M;  1J09 A;  3F92 A;  2XGN A;  1XXH B;  2H1R A;  3GLG B;  1PJQ A;  4DR7 M;  2F4V M;  4DV3 M;  3ZQJ A;  2LBC A;  4LGY A;  3HX3 A;  3E46 A;  2KHH A;  4IBJ A;  3GLH A;  5EP2 A;  1R7R A;  4R71 A;  1SXJ A;  2VQE M;  3E21 A;  5ITU A;  4QOZ C;  4LFB M;  1Q3B A;  2CE7 A;  3FUX A;  5C18 A;  4OVZ A;  2CHV A;  1DGB A;  1IN5 A;  3D8B A;  2QBY B;  3QWL A;  4A3V B;  4KOD A;  4NC6 A;  3VLF B;  1N36 M;  1WXQ A;  3MMP A;  2DXI A;  2QZ4 A;  4CGY B;  1QZM A;  5ITQ A;  2DEN A;  2UUA M;  7CAT A;  5IRE B;  4MGZ E;  1WJ7 A;  5GKN A;  5IT9 S;  1Q39 A;  4GC9 A;  1FNN A;  3QYE A;  2DWN A;  4DUY M;  3AOG A;  4G4Q A;  1HT1 E;  3IHP A;  3I01 M;  1R6B X;  1NY5 A;  2ZTC A;  4IBE A;  4LJ9 A;  4G4R A;  3RGS A;  3U6C A;  2WZJ A;  3FD9 A;  2L7H A;  3U6P A;  1D0K A;  2C96 A;  2XLJ A;  3ZH9 B;  1IM2 A;  2VQF M;  2V1C A;  4I5S A;  4MM3 B;  2GNO A;  2O01 F;  3SAS A;  3L27 A;  3RFW A;  3T1H M;  4G6Z A;  1XMO M;  4ANR A;  3SHF A;  1IXS B;  3GO8 A;  2XZU A;  3J27 B;  3KOW E;  4S12 A;  2J7N A;  2X49 A;  1E94 E;  4B3M M;  3LMM A;  4DV2 M;  3TQS A;  2L6O A;  4DV4 M;  1Z6T A;  1N75 A;  3HZJ A;  3NBI A;  4GEW A;  4WUR A;  3UK6 A;  3KDS E;  1NVM A;  2M60 A;  1WHC A;  2V6Z M;  3HU2 A;  3LW5 F;  4PDI A;  2K9D A;  3TWK A;  2CV2 A;  3SYL A;  2RGO A;  4TUW A;  5EXS A;  2BJW A;  1NV9 A;  4M0W A;  4IJE A;  3E9S A;  3KOX E;  4QNM A;  5C1B A;  5KO3 A;  1IBL M;  1DV0 A;  5A2Q S;  3HGI A;  1DGH B;  2K6B A;  4G4O A;  1H6U A;  1QDT A;  3KS8 A;  4GHA A;  3KW6 A;  2KZS A; 
#chains in the Genus database with same CATH homology
 4HLQ A;  2Y0Q A;  3U61 B;  4FWH A;  2LNH C;  5EJC A;  3GQ3 A;  3KOY E;  1GL6 A;  4GKK M;  3LQR A;  1L2C A;  1TH2 A;  4OX9 M;  1JR3 D;  4LRS A;  4KO8 A;  4NRV A;  3GLH B;  1SXJ B;  2XF3 A;  2CV1 A;  2X8A A;  4LY6 A;  1XHB A;  3HU1 A;  4FWD A;  4OVZ B;  2HL7 A;  4NXN M;  2RKO A;  1PM5 A;  3SFZ A;  2YNM D;  1E9S A;  3IG8 A;  4D82 A;  2E5L M;  3U60 A;  1DGG A;  5ITX A;  2FOI C;  5IZ7 D;  1G41 A;  4DR5 M;  3VK7 A;  4AG5 A;  2F5S A;  3GQ5 A;  3GLF A;  5EXT A;  2Z3X A;  3FTE A;  2M5Z A;  3JR5 A;  3A45 A;  3B9P A;  2OPF A;  2UUC M;  1FJG M;  2ZBK B;  4JV5 M;  4LF7 M;  2QEN A;  2Y21 A;  4I4L A;  4WW0 A;  3J7A S;  4GMQ A;  1NSF A;  5KPR A;  1N78 A;  3SC3 A;  4DUZ M;  1HQY E;  2VII A;  1D2N A;  1T3T A;  3HWS A;  4DR4 M;  1NNU C;  1QYR A;  5EP4 A;  4IBI A;  1R2Y A;  4LJ5 A;  4YY3 M;  5EP1 A;  5IWA M;  4GHL A;  1Z59 A;  5FTN A;  3KS4 A;  1Z5C A;  1TDH A;  1JR3 A;  2XH9 A;  4GC5 A;  4MGY E;  4QOS A;  1TDZ A;  3CF0 A;  5E6J A;  3M6A A;  2EO2 A;  2FE8 A;  1IY2 A;  1YE9 A;  1DO0 A;  2W82 A;  2CHQ A;  2G8L A;  4D81 A;  2KXE A;  4NL4 H;  3RE8 A;  2QPA A;  3WHK A;  4JN6 A;  1QAO A;  2I7P A;  3U6O A;  3A42 A;  3DZD A;  2UXC M;  4Z6Y A;  3SMP A;  1Q3C A;  4QNR A;  3DFZ A;  2D7H A;  2ZAM A;  3BOS A;  4JI1 M;  3PFI A;  2UXD M;  2FNA A;  3AV0 A;  1QAM A;  2Y20 A;  3M0E A;  4FCW A;  1GL7 A;  3U60 B;  1SXJ C;  4AG6 A;  4BBA A;  4OU7 A;  4L8R C;  4W5W A;  4LJA A;  3UZU A;  2J7O A;  1X37 A;  1GLN A;  4PT5 A;  2R18 A;  3GLF B;  3W0F A;  2JA2 A;  2LWX A;  1IXR C;  3HJQ A;  1SXJ E;  2V1U A;  4JI4 M;  2CFO A;  1ORY B;  2K47 A;  5EP3 A;  3VKG A;  3PVS A;  1J5E M;  3SAV A;  4CHT B;  3EIE A;  3PXG A;  3KXE C;  3HHZ A;  3SAW A;  4JI8 M;  1NJG A;  4IBB A;  2G5G X;  3SAU A;  3AKZ A;  3TPZ A;  3SAR A;  1IN7 A;  2L7I A;  4ZPX A;  4NRW A;  1HNW M;  4DV5 M;  2XZF A;  3KVW A;  5KQ8 A;  3WHL A;  4JYA M;  1JQJ C;  4JI2 M;  2DZN B;  1HT2 E;  4JI0 M;  1N34 M;  4L4U A;  4FW9 A;  4YHH M;  2C5R A;  3CTW B;  3UJN A;  4GIT A;  2NQ8 C;  3RGP A;  3W0L B;  1XNR M;  2CUZ A;  3U6E A;  4LCB A;  1YUB A;  5JI3 E;  5ITR A;  4I81 A;  1TH4 A;  4MH0 E;  3K1J A;  3EIH A;  2DWM A;  3R8F A;  4LGM A;  3LQQ A;  3L28 A;  5FLX S;  3K92 A;  3FUT A;  3VDU A;  2X4A A;  5KQD A;  4L15 A;  4B7G A;  5FTL A;  4DR1 M;  4HL4 A;  4GH9 A;  2C9C A;  1VDD A;  2R65 A;  1ZAE A;  4II7 A;  4CIS A;  1G59 A;  4RF1 A;  2ZAN A;  4PD2 A;  2YR0 A;  3L2A A;  4FVM A;  5DYI A;  2Y0T A;  3UMM A;  1GVN A;  1IBM M;  1N77 A;  4IBK A;  4AZF A;  3HJ8 A;  3E4R A;  3JAM S;  4X62 M;  3AJI B;  3K2L A;  4DV7 M;  2ZAO A;  3J81 S;  3VDP A;  3GRY A;  4B7H A;  3L25 A;  3I51 A;  3U5Z A;  1PJJ A;  4JI5 M;  2C9O A;  4PDG A;  1N33 M;  2L09 A;  2HKJ A;  1MU5 A;  4I8O A;  4KHP M;  4GIP A;  3J7B A;  3FTD A;  2CEA A;  3A98 B;  2R45 A;  4IJF A;  1TGU A;  1L1Z A;  1IQP A;  4LG2 A;  1UM8 A;  3FUU A;  3FUV A;  4B3R M;  4LZJ A;  1R2Z A;  3A46 A;  1G4A E;  3HHY A;  1LV7 A;  2XSZ D;  3HHW A;  4QHS A;  2BJV A;  4LF9 M;  2KZU A;  5EXP A;  4LF8 M;  4DV0 M;  3GQ4 A;  1G3I A;  4MGK E;  2HCB A;  4DV6 M;  4LF4 M;  5JI2 E;  4D80 A;  2XFS A;  3L29 A;  2R62 A;  3FKE A;  3KP1 E;  1SXJ D;  5LMN M;  3GPY A;  4Z8X A;  3HJS A;  3HHX A;  4AW4 A;  3DOA A;  2CV0 A;  1K3W A;  3QAU A;  2DWL A;  4M9Z A;  4M0D A;  3FUW A;  4KLN A;  2XEP A;  3PNV A;  3KFU G;  3ILK A;  1OFI A;  2XFT A;  3GRR A;  3THG A;  3AOE C;  4L16 A;  2KW0 A;  2O5R A;  1HR0 M;  2R4J A;  5BR8 M;  3T15 A;  1OJL A;  3SMS A;  3Q8X A;  5H37 D;  2QCU A;  3DA1 A;  3OTO M;  3FTF A;  4K0K M;  4BLC A;  3U6L A;  5E26 A;  3U5Z B;  4G4N A;  2UU9 M;  4L78 A;  3JR4 A;  1C1K A;  1N32 M;  4LFA M;  4M9X A;  3FTC A;  1DGF A;  1IN8 A;  4IBD A;  3TE6 A;  5F3W A;  4IBF A;  3SAT A;  4JI6 M;  4NSR A;  4LZZ A;  5ITY A;  4JI3 M;  1L1T A;  1I94 M;  2UUB M;  4FCV A;  2OQ4 A;  2RGH A;  4DR2 M;  5DNY A;  3MK6 A;  2DZO B;  1IXZ A;  3NWL A;  5BPV A;  3U6D A;  1IBK M;  4REZ A;  2F5P A;  5LMU M;  1NY6 A;  1S3S A;  2KRU A;  2ZM6 M;  3ZCB B;  4LJ6 A;  1QVR A;  1L2B A;  1E9R A;  2CHG A;  5EXX A;  3KP0 E;  4DR6 M;  4LF6 M;  3K8Z A;  3HU3 A;  4X66 M;  4LFC M;  5FTJ A;  3GRV A;  1DO2 A;  3VKH A;  1W5S A;  3TL4 X;  4PCZ A;  2LH0 A;  5FTK A;  4X65 M;  3AL0 C;  3MHV C;  3R9X B;  2BNK A;  5EQT A;  1QQW A;  2P5T A;  4GRI A;  3C58 A;  1QAN A;  1KSF X;  2F5Q A;  4LRT A;  5DYG A;  3TWL A;  2KEB A;  3SYK A;  2YFQ A;  3U6Q A;  3T38 A;  4LJ8 A;  4LF5 M;  4AKI A;  2DWZ B;  1XMQ M;  2LXE A;  1NNJ A;  1NHG C;  4EIW A;  1I4W A;  2DHR A;  4NOO B;  2Z7J A;  1MX0 A;  1NHW C;  3GPX A;  1Z5A A;  2I7N A;  3MJ5 A;  4P16 A;  2C99 A;  1K82 A;  2YQZ A;  2FFJ A;  1IY1 A;  4FD2 A;  5ITT A;  3J2P B;  2C98 A;  3KSX A;  3I4Y A;  3J80 S;  4JI7 M;  3SHG B;  1K3X A;  3D8L A;  4B7F A;  4ITQ A;  4MGI E;  4IIW A;  3U6S A;  1L8Q A;  2KRK A;  1IN6 A;  3GLI A;  2A5Y B;  4FCT A;  3U6M A;  1HNZ M;  5ITX E;  1QAQ A;  4XGI A;  1PJI A;  1XC8 A;  2KA6 B;  1XXH A;  4B08 A;  2EUC A;  3GLG A;  4MGH A;  3FYD A;  3VFD A;  2EA0 A;  3AFH A;  3H4M A;  1NJF A;  3ZC7 B;  4OW0 A;  4AQY M;  4GKJ M;  1KYI A;  4FWG A;  1XWI A;  1W5T A;  2Q2E B;  4MB7 A;  4DR3 M;  2QBY A;  4AKG A;  4XBO A;  1J7K A;  4RNA A;  1TH3 A;  1Z5B A;  1HQC A;  3UGJ A;  3M7G A;  4B3S M;  2HHH M;  1GKI A;  3FYC A;  5KPT A;  4NSO B;  1E32 A;  3PNY A;  2D7G A;  2R4E A;  5KPZ A;  4LJ7 A;  4IBG A;  4BB9 A;  8CAT A;  2DVW B;  4M9S A;  5FSW A;  3VK8 A;  3CF6 E;  3I4V A;  3LVW A;  1IN4 A;  2F5N A;  1IY0 A;  1EE8 A;  3TWM A;  3GRU A;  4X64 M;  1L2D A;  1KFV A;  2ERC A;  2F5O A;  3HKP A;  4NXM M;  1HNX M;  3IG5 A;  1XNQ M;  4RF0 A;  2D7E A;  3GP1 A;  5FTM A;  4R3D A;  3KSJ A;  4AKH A;  3LVV A;  4R7G A;  2Z4R A;  1G8P A;  2QP9 X;  3GPP A;  2XSZ A;  3CF2 A;  1YSY A;  4AI6 A;  2Z4S A;  1OFH A;  4JXJ A;  1DGH A;  4B3T M;  2AHM A;  4IBC A;  4QHT A;  3KOZ E;  2UXB M;  1ZQ9 A;  3AOE A;  3GLI B;  3U61 A;  4LJ4 A;  3GPU A;  2R46 A;  4DV1 M;  3SBJ A;  3T1Y M;  1J09 A;  2XGN A;  1XXH B;  2H1R A;  3GLG B;  4DR7 M;  2F4V M;  4DV3 M;  4LGY A;  4IBJ A;  5EP2 A;  3GLH A;  2VQE M;  1R7R A;  1SXJ A;  5ITU A;  4QOZ C;  4LFB M;  1Q3B A;  2CE7 A;  3FUX A;  5C18 A;  4OVZ A;  2CHV A;  1DGB A;  1IN5 A;  3D8B A;  2QBY B;  3QWL A;  4A3V B;  4KOD A;  3VLF B;  1N36 M;  2DXI A;  1WXQ A;  2QZ4 A;  4CGY B;  1QZM A;  5ITQ A;  2UUA M;  7CAT A;  5IRE B;  4MGZ E;  5GKN A;  5IT9 S;  1Q39 A;  4GC9 A;  1FNN A;  2DWN A;  4DUY M;  3AOG A;  4G4Q A;  1HT1 E;  1R6B X;  1NY5 A;  4IBE A;  4LJ9 A;  4G4R A;  3RGS A;  3U6C A;  3FD9 A;  2L7H A;  3U6P A;  2C96 A;  2XLJ A;  3ZH9 B;  1IM2 A;  2VQF M;  2V1C A;  4I5S A;  4MM3 B;  3SAS A;  3L27 A;  3RFW A;  3T1H M;  4G6Z A;  1XMO M;  3SHF A;  1IXS B;  3GO8 A;  2XZU A;  3J27 B;  3KOW E;  4S12 A;  2J7N A;  2X49 A;  1E94 E;  4B3M M;  3LMM A;  4DV2 M;  3TQS A;  2L6O A;  4DV4 M;  1Z6T A;  1N75 A;  3NBI A;  3UK6 A;  4WUR A;  3KDS E;  1NVM A;  2M60 A;  2V6Z M;  3HU2 A;  4PDI A;  2CV2 A;  3TWK A;  3SYL A;  2RGO A;  4TUW A;  5EXS A;  2BJW A;  4M0W A;  4IJE A;  3E9S A;  3KOX E;  4QNM A;  5C1B A;  5KO3 A;  1IBL M;  5A2Q S;  3HGI A;  1DGH B;  4G4O A;  3KS8 A;  1H6U A;  3L26 A;  4GHA A;  3KW6 A;  2KZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...