2WSEF

Improved model of plant photosystem i
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 20
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wseF00
4KT0F 4Y28F 2WSEF 3LW5F 4L6V6 4RKUF 1JB0F 5L8RF 2WSCF 2O01F 4XK8F 2WSFF
chains in the Genus database with same CATH superfamily
5KPTA 4KT0F 2XLJA 3GLGE 2LHGA 2MR9A 4B3TM 2AHMA 4LJ5A 4G4QA 2UXCM 1V33A 3GQ5A 4LCBA 4QNRA 3GLFE 3K9OA 1V34A 2CUZA 5E6JA 1I94M 3T6PA 2HCBA 1SG9A 2Z3XA 2N35A 5EXPA 2CEAA 2KNVA 2WSEF 1SXJC 3PVSA 5EP1A 1VEJA 2F5QA 4FWHA 4OW0A 4S12A 4LJ7A 2WSFF 3HZJA 1HT1E 4GIPA 3C3EA 2L2DA 4OVZB 1VQ1A 2KRKA 4D81A 4IBBA 5KQ8A 2ZTDA 1TDHA 1IN7A 3L26A 2UUAM 1IBKM 5C18A 1SXJE 1L2CA 3H4JA 4Y28F 5IWAM 1MN3A 1D2NA 2KW0A 3DFZA 3HHXA 3UGJA 4JI3M 4EIWA 2LBCA 4M0WA 4PT5A 4DR7M 4LFBM 4CHTB 2QP9X 5FTMA 3I51A 4L16A 2D7HA 2B3TA 1G3IA 4JI6M 3U6PA 4JI1M 1SXJD 3AOGA 1QUSA 4WURA 1UFZA 1DV0A 4LF5M 4DV6M 4LRTA 1GABA 1T43A 3TPZA 3KOWE 4R3DA 3U60B 1IXSB 2CFOA 3KW6A 3AL0C 4DV0M 4L4UA 3AKZA 2Q2EB 2R4EA 2ERCA 2ZAMA 2XSZA 3NBIA 4DR1M 2UXDM 1N77A 5KPRA 3MJ5A 3M7GA 4JXJA 3U6MA 4I8OA 1XB2B 5L8RF 3A98B 5FSWA 2O5RA 2MROB 2OOBA 4FCVA 1ORYB 3F92A 2KA6B 4CIZA 1NV9A 4IJEA 5KO3A 3L28A 3T15A 1N78A 1OKSA 3VKGA 4JI8M 2LHCA 4FWGA 1D0KA 4DR2M 3C9PA 2ZTCA 2KHHA 3U6CA 4LF8M 1SXJB 2YQZA 1WHCA 3GLHB 3T1HM 3FTCA 2BWBA 2XF3A 2K47A 1C1KA 3MHVC 4GEWA 5FLXS 3QYBA 3OTOM 4MGZE 1GLNA 1D0LA 2FS1A 1NY6A 1TDZA 3KFUG 3VKHA 2LNHC 1IXSA 2DWNA 2APLA 3VDUA 4NSRA 4NOOB 4DV7M 2F5OA 4GKKM 2I7PA 4HEOA 2JZ1A 5KPZA 4AG5A 2C5RA 2DAGA 3U6OA 2X4AA 1MU5A 3AOEC 1XXHE 3W0FA 3LQQA 3FTEA 2MJ5B 2L7IA 2M5ZA 3WHLA 1IY2A 1CUKA 3SMSA 4CGYB 3GQ4A 4B7HA 2F5NA 4MGYE 2DWZB 3BOSA 3GPUA 2QBYA 2DVWB 4IBKA 4LG2A 2R45A 2H1RA 3MMPA 4NRWA 2LH0A 3DZDA 5ITQA 5A2QS 2XH9A 3AOEA 1HNWM 4DUZM 1L2BA 1EIJA 3U6EA 1DGHB 2LVOC 3FUVA 4B08A 1S3SA 1K3WA 4LGMA 3J80S 3KSXA 1HT2E 2CHVA 4G3OA 1KSFX 1P3QQ 2KNAA 3D8BA 1ZMVA 1NJFA 2LTUA 2CRUA 4PDGA 3RGPA 4CJ6A 3ZH9B 4KHPM 3HJQA 1C7YA 4DV5M 1J7KA 2JY6B 1JQJC 4OU7A 2HKJA 2UUBM 1FNNA 5JI2E 5GKNA 4AZFA 5FTNA 2H5XA 2O01F 2HL7A 4LJ6A 3GLIB 1XC8A 2ZAOA 4IBDA 3GRRA 3GO8A 1JR3A 4QNMA 1N33M 2Y0QA 4QHSA 1ZMUA 2LVPC 3KOYE 2L4FA 4PDIA 3SC3A 2EA0A 3A42A 4G4NA 4FVMA 2G3QA 4LZZA 3JR5A 2BNKA 2JY8A 3EIHA 1IN5A 3IG8A 1JR3D 1ZQ9A 3L2AA 5C1BA 1IY0A 1YUBA 3BXWA 1IY1A 3HHWA 4MGKE 3R9XB 1GL6A 4IJFA 2RGHA 2DAEA 4RF1A 3U5ZB 1XHBA 1TR8A 3TWMA 2Y20A 2KRUA 4IBFA 7CATA 3HJSA 2GQFA 1VDDA 2VF8A 4ANRA 2VDBB 3SYKA 1D0MA 3LCUA 4G4OA 1E32A 3KDSE 3E4RA 1YE9A 1QDRA 2ZM6M 1V92A 2JY5A 2M60A 2OOAA 3B74A 4LJ9A 4F1IA 3LVWA 4GC5A 1Y8GA 1PJTA 5ITYA 4DBGB 2DAIA 1PM5A 1AIPC 3TWKA 4JI7M 1FJGM 3Q8GA 3GLIA 4LFCM 1OIZA 1PRBA 1ZV1A 3QWLA 5ITUA 3Q8XA 4K0KM 2CE7A 2GNOA 1NVMA 3J7BA 2KDLA 2OO9A 4UN2B 4PCZA 4QHTA 4JI4M 3HGIA 2LVNC 5ITXE 1XNQM 1BVSA 4GRIA 3NWLA 4LY6A 2OQ4A 4XBOA 1DO0A 1EFUB 4IBJA 4FCTA 3JAMS 3R8FA 4I5SA 2R65A 4XGIA 3TL4X 4AKIA 4GHLA 4LJ8A 3B89A 4FWDA 4Z6YA 2RRUA 3GLIE 1QZMA 4I81A 2LXEA 1GO5A 2JUJA 3E46A 1PJIA 4GHAA 4BBAA 2JY7A 2R4JA 4LZJA 4Q7JA 3LCVB 4JV5M 4AKHA 1PGYA 3CF6E 5DYIA 3CTWB 1Z59A 1R6BX 4DV4M 3HU1A 2R62A 5ITXA 4M9XA 5LMNM 1G41A 5FTLA 1Z5AA 2JZ0A 4HL4A 1HJPA 2Z4SA 3GP1A 1GJSA 1QZEA 2JP7A 2KZUA 1GJTA 3HU3A 5EP3A 1WR1B 1IQPA 1L2DA 2F5SA 2DI0A 3GLGA 4X64M 1WIVA 2ZBKB 2C9CA 2KXEA 2R46A 3QAUA 4A3VB 4DR5M 1R2ZA 3W0LB 1RU3A 2J5YA 3U60A 1N36M 3HKPA 3KOZE 3LQRA 3HHYA 2G8LA 3QYEA 1F4IA 3T1YM 3WHKA 2DZNB 4M9ZA 2CV0A 2EKFA 3K2LA 5EQTA 3RE8A 3UZUA 5KQDA 2L4EA 4ZPXA 2LWXA 1J09A 3GPYA 2CWBA 2QBYB 2MGWA 1VEGA 2HWJA 3KSJA 4L15A 2EUCA 4B7GA 3LW5F 4REZA 1WGNA 4L6V6 4NSOB 3DA1A 4OVZA 3GRVA 1T6OA 3GQ3A 2RKOA 4MM3B 1HNZM 5IREB 2CV1A 1QYRA 2QHOB 4X62M 1NHGC 3AFHA 3FD9A 3C58A 3GRYA 4OX9M 8CATA 3LMMA 3SAUA 1IM2A 1QVRA 2FFJA 5IT9S 3SARA 3K9PA 2DAMA 3KXEC 3VLFB 3SBJA 5JI3E 3FYDA 3ZQJA 1KYIA 1NJGA 4IBCA 4FD2A 2C96A 4DUYM 3H4MA 1TTEA 4LJAA 4BLCA 2CV2A 2CHGA 4RNAA 4NXMM 4RKUF 5IZ7D 4ITQA 2DNAA 2P5TA 4NL4H 3GRUA 2DWMA 3KP1E 3VFDA 5DYGA 2DZOB 3SAWA 3PNYA 2C9OA 2RGOA 1Z5BA 2VIIA 2UUCM 3IHPA 1IN4A 3I01M 4X65M 1QAQA 3B7QA 2EO2A 3C3DA 4DV2M 4AW4A 4B3MM 1TF0B 4AKGA 5ITTA 2YNMD 1XMOM 1SXJA 1PJQA 1HQYE 1W5TA 1YLAA 2XGNA 3LVVA 4NC6A 4XK8F 5EJCA 1IFYA 1L8QA 3FUWA 1TGUA 3W68A 5EP2A 2BWEA 3B9PA 3I04M 4WW0A 3U5ZA 3KS8A 1DO2A 1Q3BA 2V1UA 4Z8XA 1NY5A 3AV0A 2K9DA 1GKIA 3HWSA 4LGYA 3GLFB 3IECA 2V6ZM 5E26A 1E94E 1L1ZA 3U61B 3J7AS 1R4GA 3AJIB 3K8ZA 2R44A 2X8AA 4R71A 1DGFA 2JXNA 2X49A 4FCWA 4LJ4A 2XZFA 2I7NA 2CHQA 3PXGA 2R0IA 4JI5M 1GL7A 4B3SM 1JB0F 4MGIE 1MJGM 2K0BX 2Y0TA 1QANA 2DHYA 4LF9M 1Q3CA 1DGBA 2F4VM 3HJ8A 3GLHA 2Z7JA 1MX0A 1HQCA 5FTJA 3ZC7B 1IN8A 4D82A 5ITRA 1NNUC 3KS4A 3RFWA 2CP8A 3L27A 1XWIA 3SHFA 2J7NA 1TH2A 1IBMM 1ZMWA 4FW9A 1EE8A 5LMUM 4IIWA 1LV7A 2DWLA 1TH3A 2FOIC 4LF7M 1NSFA 1DGGA 3RGSA 4DR6M 3FUXA 2NQ8C 1N75A 1PJSA 2XFTA 1XXHA 4I4LA 4D80A 3VK7A 1K3XA 1JR3E 3U6DA 2XEPA 3UK6A 3U61A 1PJJA 1G8PA 1N32M 4DV3M 3HHZA 4YY3M 3FYCA 3HU2A 4R7GA 4TUWA 3FRIA 3GPPA 2EJSA 2FH0A 2LVAA 3CF0A 1K82A 1QUTA 5FTKA 2QCUA 4X66M 3FUTA 1TH4A 2VQEM 3U6LA 3NBXX 3SYLA 4GITA 4KODA 3THGA 3DOAA 3UJNA 4JN6A 5BR8M 1E9RA 2QENA 1YSYA 2W82A 4B7FA 4B3RM 1VDLA 3SATA 2DKLA 2K6BA 4GMQA 1A5TA 3J27B 2O25A 2JNHA 2XSZD 2J7OA 1QQWA 3KP0E 1DGHA 4F2LA 1Q39A 1Z6TA 4WP2A 5BPVA 1T3TA 1R7RA 3A45A 3M6AA 1X37A 1XXHB 4G6ZA 3V76A 4KLNA 3FKEA 3K1JA 2A5YB 2OPFA 1Q02A 4GC9A 2QSFX 2QPAA 5DNYA 3PFIA 3GLFA 2L7HA 4BB9A 3JR4A 3GPXA 5F3WA 3D8LA 4QOZC 2ZANA 4IBGA 4II7A 1Z5CA 3FRHA 1UM8A 2VQFM 4M9SA 3SHGB 3FTFA 3EIEA 3M0EA 1IXRC 2JA2A 2YFQA 4CISA 1HR0M 2R18A 1IXZA 1QAMA 1IBLM 2QQ8A 3I4YA 4MGHA 5EP4A 3TQSA 4NRVA 4LF4M 1N34M 2DZLA 4GH9A 4LFAM 2QNJA 5DFLA 2HAKA 4G4RA 4LF6M 1E9SA 3E21A 4JI2M 1OTRA 1AUAA 4MB7A 1QAOA 4AI6A 4P17A 1W5SA 3KVWA 2QZ4A 3BBZA 2BJWA 3I4VA 3GLGB 1OFIA 2KEBA 1G4AE 2VF7A 2LVQD 1OAOC 4NXNM 3A46A 4PD2A 2DXIA 2YR0A 4L78A 3SMPA 5EXXA 1OAIA 2UXBM 1NHWC 1GVNA 3FE3A 2MH8A 2Y21A 4MH0E 3VDPA 1R5LA 2F5PA 4HLQA 2JWSA 2WZJA 4RF0A 3ZCBB 2DHRA 1WJ7A 1WGLA 2L09A 4QOSA 3UMMA 1R2YA 3ILKA 3TWLA 3B7NA 4DR4M 3CF2A 4JI0M 5H37D 4DV1M 3SFZA 1IN6A 2KNZA 3K92A 1NNJA 3KOXE 2E5LM 4IBEA 1QDTA 3SAVA 2BJVA 4YHHM 1I4WA 4W5WA 4DR3M 4M0DA 2D7EA 2EKKA 1OQYA 3J81S 2HHHM 3B7ZA 3FTDA 3PNVA 4L8RC 4IBIA 2C99A 3CGWA 3FUUA 3E9SA 2Z8YM 1G71A 1G59A 3U6QA 1NO1A 1J5EM 2KZSA 3TE6A 2V1CA 2DENA 1L1TA 2FE8A 1VEKA 1NV8A 2DAKA 2UU9M 3L25A 2WSCF 4LRSA 3MK6A 1KFVA 3J2PB 1ZAEA 2C98A 5EXSA 1H6UA 3L29A 1XNRM 2D7GA 2G5GX 5EXTA 2R6FA 1HNXM 1VG5A 2XZUA 3T38A 1LTMA 4KO8A 3VK8A 4GKJM 4JYAM 3HX3A 1OJLA 3U6SA 4AQYM 2Z4RA 2L6OA 3GLHE 1XMQM 1WXQA 3SASA 1OFHA 2XFSA 4P16A 4AG6A 3IG5A 3HY5A 3W67A 2FNAA 1OIPA
chains in the Genus database with same CATH topology
4KT0F 4Y28F 2WSEF 3LW5F 4L6V6 4RKUF 1JB0F 5L8RF 2WSCF 2O01F 4XK8F 2WSFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 F;  4Y28 F;  2WSE F;  3LW5 F;  4L6V 6;  4RKU F;  1JB0 F;  5L8R F;  2WSC F;  2O01 F;  4XK8 F;  2WSF F; 
#chains in the Genus database with same CATH topology
 5KPT A;  4KT0 F;  2XLJ A;  3GLG E;  2LHG A;  2MR9 A;  4B3T M;  2AHM A;  4LJ5 A;  4G4Q A;  2UXC M;  1V33 A;  3GQ5 A;  4LCB A;  4QNR A;  3GLF E;  3K9O A;  1V34 A;  2CUZ A;  5E6J A;  1I94 M;  3T6P A;  2HCB A;  1SG9 A;  2Z3X A;  2N35 A;  5EXP A;  2CEA A;  2KNV A;  2WSE F;  1SXJ C;  3PVS A;  5EP1 A;  1VEJ A;  2F5Q A;  4FWH A;  4OW0 A;  4S12 A;  4LJ7 A;  2WSF F;  3HZJ A;  1HT1 E;  4GIP A;  3C3E A;  2L2D A;  4OVZ B;  1VQ1 A;  2KRK A;  4D81 A;  4IBB A;  5KQ8 A;  2ZTD A;  1TDH A;  1IN7 A;  3L26 A;  2UUA M;  1IBK M;  5C18 A;  1SXJ E;  1L2C A;  3H4J A;  4Y28 F;  5IWA M;  1MN3 A;  1D2N A;  2KW0 A;  3DFZ A;  3HHX A;  3UGJ A;  4JI3 M;  4EIW A;  2LBC A;  4M0W A;  4PT5 A;  4DR7 M;  4LFB M;  4CHT B;  2QP9 X;  5FTM A;  3I51 A;  4L16 A;  2D7H A;  2B3T A;  1G3I A;  4JI6 M;  3U6P A;  4JI1 M;  1SXJ D;  3AOG A;  1QUS A;  4WUR A;  1UFZ A;  1DV0 A;  4LF5 M;  4DV6 M;  4LRT A;  1GAB A;  1T43 A;  3TPZ A;  3KOW E;  4R3D A;  3U60 B;  1IXS B;  2CFO A;  3KW6 A;  3AL0 C;  4DV0 M;  4L4U A;  3AKZ A;  2Q2E B;  2R4E A;  2ERC A;  2ZAM A;  2XSZ A;  3NBI A;  4DR1 M;  2UXD M;  1N77 A;  5KPR A;  3MJ5 A;  3M7G A;  4JXJ A;  3U6M A;  4I8O A;  1XB2 B;  5L8R F;  3A98 B;  5FSW A;  2O5R A;  2MRO B;  2OOB A;  4FCV A;  1ORY B;  3F92 A;  2KA6 B;  4CIZ A;  1NV9 A;  4IJE A;  5KO3 A;  3L28 A;  3T15 A;  1N78 A;  1OKS A;  3VKG A;  4JI8 M;  2LHC A;  4FWG A;  1D0K A;  4DR2 M;  3C9P A;  2ZTC A;  2KHH A;  3U6C A;  4LF8 M;  1SXJ B;  2YQZ A;  1WHC A;  3GLH B;  3T1H M;  3FTC A;  2BWB A;  2XF3 A;  2K47 A;  1C1K A;  3MHV C;  4GEW A;  5FLX S;  3QYB A;  3OTO M;  4MGZ E;  1GLN A;  1D0L A;  2FS1 A;  1NY6 A;  1TDZ A;  3KFU G;  3VKH A;  2LNH C;  1IXS A;  2DWN A;  2APL A;  3VDU A;  4NSR A;  4NOO B;  4DV7 M;  2F5O A;  4GKK M;  2I7P A;  4HEO A;  2JZ1 A;  5KPZ A;  4AG5 A;  2C5R A;  2DAG A;  3U6O A;  2X4A A;  1MU5 A;  3AOE C;  1XXH E;  3W0F A;  3LQQ A;  3FTE A;  2MJ5 B;  2L7I A;  2M5Z A;  3WHL A;  1IY2 A;  1CUK A;  3SMS A;  4CGY B;  3GQ4 A;  4B7H A;  2F5N A;  4MGY E;  2DWZ B;  3BOS A;  3GPU A;  2QBY A;  2DVW B;  4IBK A;  4LG2 A;  2R45 A;  2H1R A;  3MMP A;  4NRW A;  2LH0 A;  3DZD A;  5ITQ A;  5A2Q S;  2XH9 A;  3AOE A;  1HNW M;  4DUZ M;  1L2B A;  1EIJ A;  3U6E A;  1DGH B;  2LVO C;  3FUV A;  4B08 A;  1S3S A;  1K3W A;  4LGM A;  3J80 S;  3KSX A;  1HT2 E;  2CHV A;  4G3O A;  1KSF X;  1P3Q Q;  2KNA A;  3D8B A;  1ZMV A;  1NJF A;  2LTU A;  2CRU A;  4PDG A;  3RGP A;  4CJ6 A;  3ZH9 B;  4KHP M;  3HJQ A;  1C7Y A;  4DV5 M;  1J7K A;  2JY6 B;  1JQJ C;  4OU7 A;  2HKJ A;  2UUB M;  1FNN A;  5JI2 E;  5GKN A;  4AZF A;  5FTN A;  2H5X A;  2O01 F;  2HL7 A;  4LJ6 A;  3GLI B;  1XC8 A;  2ZAO A;  4IBD A;  3GRR A;  3GO8 A;  1JR3 A;  4QNM A;  1N33 M;  2Y0Q A;  4QHS A;  1ZMU A;  2LVP C;  3KOY E;  2L4F A;  4PDI A;  3SC3 A;  2EA0 A;  3A42 A;  4G4N A;  4FVM A;  2G3Q A;  4LZZ A;  3JR5 A;  2BNK A;  2JY8 A;  3EIH A;  1IN5 A;  3IG8 A;  1JR3 D;  1ZQ9 A;  3L2A A;  5C1B A;  1IY0 A;  1YUB A;  3BXW A;  1IY1 A;  3HHW A;  4MGK E;  3R9X B;  1GL6 A;  4IJF A;  2RGH A;  2DAE A;  4RF1 A;  3U5Z B;  1XHB A;  1TR8 A;  3TWM A;  2Y20 A;  2KRU A;  4IBF A;  7CAT A;  3HJS A;  2GQF A;  1VDD A;  2VF8 A;  4ANR A;  2VDB B;  3SYK A;  1D0M A;  3LCU A;  4G4O A;  1E32 A;  3KDS E;  3E4R A;  1YE9 A;  1QDR A;  2ZM6 M;  1V92 A;  2JY5 A;  2M60 A;  2OOA A;  3B74 A;  4LJ9 A;  4F1I A;  3LVW A;  4GC5 A;  1Y8G A;  1PJT A;  5ITY A;  4DBG B;  2DAI A;  1PM5 A;  1AIP C;  3TWK A;  4JI7 M;  1FJG M;  3Q8G A;  3GLI A;  4LFC M;  1OIZ A;  1PRB A;  1ZV1 A;  3QWL A;  5ITU A;  3Q8X A;  4K0K M;  2CE7 A;  2GNO A;  1NVM A;  3J7B A;  2KDL A;  2OO9 A;  4UN2 B;  4PCZ A;  4QHT A;  4JI4 M;  3HGI A;  2LVN C;  5ITX E;  1XNQ M;  1BVS A;  4GRI A;  3NWL A;  4LY6 A;  2OQ4 A;  4XBO A;  1DO0 A;  1EFU B;  4IBJ A;  4FCT A;  3JAM S;  3R8F A;  4I5S A;  2R65 A;  4XGI A;  3TL4 X;  4AKI A;  4GHL A;  4LJ8 A;  3B89 A;  4FWD A;  4Z6Y A;  2RRU A;  3GLI E;  1QZM A;  4I81 A;  2LXE A;  1GO5 A;  2JUJ A;  3E46 A;  1PJI A;  4GHA A;  4BBA A;  2JY7 A;  2R4J A;  4LZJ A;  4Q7J A;  3LCV B;  4JV5 M;  4AKH A;  1PGY A;  3CF6 E;  5DYI A;  3CTW B;  1Z59 A;  1R6B X;  4DV4 M;  3HU1 A;  2R62 A;  5ITX A;  4M9X A;  5LMN M;  1G41 A;  5FTL A;  1Z5A A;  2JZ0 A;  4HL4 A;  1HJP A;  2Z4S A;  3GP1 A;  1GJS A;  1QZE A;  2JP7 A;  2KZU A;  1GJT A;  3HU3 A;  5EP3 A;  1WR1 B;  1IQP A;  1L2D A;  2F5S A;  2DI0 A;  3GLG A;  4X64 M;  1WIV A;  2ZBK B;  2C9C A;  2KXE A;  2R46 A;  3QAU A;  4A3V B;  4DR5 M;  1R2Z A;  3W0L B;  1RU3 A;  2J5Y A;  3U60 A;  1N36 M;  3HKP A;  3KOZ E;  3LQR A;  3HHY A;  2G8L A;  3QYE A;  1F4I A;  3T1Y M;  3WHK A;  2DZN B;  4M9Z A;  2CV0 A;  2EKF A;  3K2L A;  5EQT A;  3RE8 A;  3UZU A;  5KQD A;  2L4E A;  4ZPX A;  2LWX A;  1J09 A;  3GPY A;  2CWB A;  2QBY B;  2MGW A;  1VEG A;  2HWJ A;  3KSJ A;  4L15 A;  2EUC A;  4B7G A;  3LW5 F;  4REZ A;  1WGN A;  4L6V 6;  4NSO B;  3DA1 A;  4OVZ A;  3GRV A;  1T6O A;  3GQ3 A;  2RKO A;  4MM3 B;  1HNZ M;  5IRE B;  2CV1 A;  1QYR A;  2QHO B;  4X62 M;  1NHG C;  3AFH A;  3FD9 A;  3C58 A;  3GRY A;  4OX9 M;  8CAT A;  3LMM A;  3SAU A;  1IM2 A;  1QVR A;  2FFJ A;  5IT9 S;  3SAR A;  3K9P A;  2DAM A;  3KXE C;  3VLF B;  3SBJ A;  5JI3 E;  3FYD A;  3ZQJ A;  1KYI A;  1NJG A;  4IBC A;  4FD2 A;  2C96 A;  4DUY M;  3H4M A;  1TTE A;  4LJA A;  4BLC A;  2CV2 A;  2CHG A;  4RNA A;  4NXM M;  4RKU F;  5IZ7 D;  4ITQ A;  2DNA A;  2P5T A;  4NL4 H;  3GRU A;  2DWM A;  3KP1 E;  3VFD A;  5DYG A;  2DZO B;  3SAW A;  3PNY A;  2C9O A;  2RGO A;  1Z5B A;  2VII A;  2UUC M;  3IHP A;  1IN4 A;  3I01 M;  4X65 M;  1QAQ A;  3B7Q A;  2EO2 A;  3C3D A;  4DV2 M;  4AW4 A;  4B3M M;  1TF0 B;  4AKG A;  5ITT A;  2YNM D;  1XMO M;  1SXJ A;  1PJQ A;  1HQY E;  1W5T A;  1YLA A;  2XGN A;  3LVV A;  4NC6 A;  4XK8 F;  5EJC A;  1IFY A;  1L8Q A;  3FUW A;  1TGU A;  3W68 A;  5EP2 A;  2BWE A;  3B9P A;  3I04 M;  4WW0 A;  3U5Z A;  3KS8 A;  1DO2 A;  1Q3B A;  2V1U A;  4Z8X A;  1NY5 A;  3AV0 A;  2K9D A;  1GKI A;  3HWS A;  4LGY A;  3GLF B;  3IEC A;  2V6Z M;  5E26 A;  1E94 E;  1L1Z A;  3U61 B;  3J7A S;  1R4G A;  3AJI B;  3K8Z A;  2R44 A;  2X8A A;  4R71 A;  1DGF A;  2JXN A;  2X49 A;  4FCW A;  4LJ4 A;  2XZF A;  2I7N A;  2CHQ A;  3PXG A;  2R0I A;  4JI5 M;  1GL7 A;  4B3S M;  1JB0 F;  4MGI E;  1MJG M;  2K0B X;  2Y0T A;  1QAN A;  2DHY A;  4LF9 M;  1Q3C A;  1DGB A;  2F4V M;  3HJ8 A;  3GLH A;  2Z7J A;  1MX0 A;  1HQC A;  5FTJ A;  3ZC7 B;  1IN8 A;  4D82 A;  5ITR A;  1NNU C;  3KS4 A;  3RFW A;  2CP8 A;  3L27 A;  1XWI A;  3SHF A;  2J7N A;  1TH2 A;  1IBM M;  1ZMW A;  4FW9 A;  1EE8 A;  5LMU M;  4IIW A;  1LV7 A;  2DWL A;  1TH3 A;  2FOI C;  4LF7 M;  1NSF A;  1DGG A;  3RGS A;  4DR6 M;  3FUX A;  2NQ8 C;  1N75 A;  1PJS A;  2XFT A;  1XXH A;  4I4L A;  4D80 A;  3VK7 A;  1K3X A;  1JR3 E;  3U6D A;  2XEP A;  3UK6 A;  3U61 A;  1PJJ A;  1G8P A;  1N32 M;  4DV3 M;  3HHZ A;  4YY3 M;  3FYC A;  3HU2 A;  4R7G A;  4TUW A;  3FRI A;  3GPP A;  2EJS A;  2FH0 A;  2LVA A;  3CF0 A;  1K82 A;  1QUT A;  5FTK A;  2QCU A;  4X66 M;  3FUT A;  1TH4 A;  2VQE M;  3U6L A;  3NBX X;  3SYL A;  4GIT A;  4KOD A;  3THG A;  3DOA A;  3UJN A;  4JN6 A;  5BR8 M;  1E9R A;  2QEN A;  1YSY A;  2W82 A;  4B7F A;  4B3R M;  1VDL A;  3SAT A;  2DKL A;  2K6B A;  4GMQ A;  1A5T A;  3J27 B;  2O25 A;  2JNH A;  2XSZ D;  2J7O A;  1QQW A;  3KP0 E;  1DGH A;  4F2L A;  1Q39 A;  1Z6T A;  4WP2 A;  5BPV A;  1T3T A;  1R7R A;  3A45 A;  3M6A A;  1X37 A;  1XXH B;  4G6Z A;  3V76 A;  4KLN A;  3FKE A;  3K1J A;  2A5Y B;  2OPF A;  1Q02 A;  4GC9 A;  2QSF X;  2QPA A;  5DNY A;  3PFI A;  3GLF A;  2L7H A;  4BB9 A;  3JR4 A;  3GPX A;  5F3W A;  3D8L A;  4QOZ C;  2ZAN A;  4IBG A;  4II7 A;  1Z5C A;  3FRH A;  1UM8 A;  2VQF M;  4M9S A;  3SHG B;  3FTF A;  3EIE A;  3M0E A;  1IXR C;  2JA2 A;  2YFQ A;  4CIS A;  1HR0 M;  2R18 A;  1IXZ A;  1QAM A;  1IBL M;  2QQ8 A;  3I4Y A;  4MGH A;  5EP4 A;  3TQS A;  4NRV A;  4LF4 M;  1N34 M;  2DZL A;  4GH9 A;  4LFA M;  2QNJ A;  5DFL A;  2HAK A;  4G4R A;  4LF6 M;  1E9S A;  3E21 A;  4JI2 M;  1OTR A;  1AUA A;  4MB7 A;  1QAO A;  4AI6 A;  4P17 A;  1W5S A;  3KVW A;  2QZ4 A;  3BBZ A;  2BJW A;  3I4V A;  3GLG B;  1OFI A;  2KEB A;  1G4A E;  2VF7 A;  2LVQ D;  1OAO C;  4NXN M;  3A46 A;  4PD2 A;  2DXI A;  2YR0 A;  4L78 A;  3SMP A;  5EXX A;  1OAI A;  2UXB M;  1NHW C;  1GVN A;  3FE3 A;  2MH8 A;  2Y21 A;  4MH0 E;  3VDP A;  1R5L A;  2F5P A;  4HLQ A;  2JWS A;  2WZJ A;  4RF0 A;  3ZCB B;  2DHR A;  1WJ7 A;  1WGL A;  2L09 A;  4QOS A;  3UMM A;  1R2Y A;  3ILK A;  3TWL A;  3B7N A;  4DR4 M;  3CF2 A;  4JI0 M;  5H37 D;  4DV1 M;  3SFZ A;  1IN6 A;  2KNZ A;  3K92 A;  1NNJ A;  3KOX E;  2E5L M;  4IBE A;  1QDT A;  3SAV A;  2BJV A;  4YHH M;  1I4W A;  4W5W A;  4DR3 M;  4M0D A;  2D7E A;  2EKK A;  1OQY A;  3J81 S;  2HHH M;  3B7Z A;  3FTD A;  3PNV A;  4L8R C;  4IBI A;  2C99 A;  3CGW A;  3FUU A;  3E9S A;  2Z8Y M;  1G71 A;  1G59 A;  3U6Q A;  1NO1 A;  1J5E M;  2KZS A;  3TE6 A;  2V1C A;  2DEN A;  1L1T A;  2FE8 A;  1VEK A;  1NV8 A;  2DAK A;  2UU9 M;  3L25 A;  2WSC F;  4LRS A;  3MK6 A;  1KFV A;  3J2P B;  1ZAE A;  2C98 A;  5EXS A;  1H6U A;  3L29 A;  1XNR M;  2D7G A;  2G5G X;  5EXT A;  2R6F A;  1HNX M;  1VG5 A;  2XZU A;  3T38 A;  1LTM A;  4KO8 A;  3VK8 A;  4GKJ M;  4JYA M;  3HX3 A;  1OJL A;  3U6S A;  4AQY M;  2Z4R A;  2L6O A;  3GLH E;  1XMQ M;  1WXQ A;  3SAS A;  1OFH A;  2XFS A;  4P16 A;  4AG6 A;  3IG5 A;  3HY5 A;  3W67 A;  2FNA A;  1OIP A; 
#chains in the Genus database with same CATH homology
 4KT0 F;  4Y28 F;  2WSE F;  3LW5 F;  4L6V 6;  4RKU F;  1JB0 F;  5L8R F;  2WSC F;  2O01 F;  4XK8 F;  2WSF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...