2WSEF

Improved model of plant photosystem i
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wseF00
2WSFF 2WSEF 4XK8F 5L8RF 1JB0F 2O01F 4KT0F 4Y28F 3LW5F 4RKUF 4L6V6 2WSCF
chains in the Genus database with same CATH superfamily
4D81A 1N36M 1T3TA 4IBEA 4L78A 2DWZB 2Z4SA 3T6PA 1E94E 1LV7A 4II7A 3HJQA 4I81A 1RU3A 4DV0M 1NNUC 1R5LA 2WZJA 3KFUG 2MH8A 2DHYA 4KHPM 4OW0A 2ERCA 2KXEA 2EKKA 5GKNA 3GLGA 1TR8A 4R7GA 2FE8A 3TE6A 2L09A 4NRVA 2LHCA 2EJSA 3AV0A 3FKEA 5E26A 3C3DA 2XZUA 1IN8A 5ITXE 5DNYA 3L25A 1MU5A 4LJ5A 2OOBA 3AOEC 5KPZA 2CFOA 3RGSA 2RRUA 1VEJA 2DAEA 4JI5M 4F2LA 3FUTA 3MMPA 4FD2A 3HHYA 3THGA 1DGHB 3ZQJA 2D7EA 2JY6B 3D8BA 3WHKA 4LZZA 4LFAM 4FCWA 4MGKE 4X66M 4FCVA 1J5EM 4RNAA 1HJPA 2FOIC 2HWJA 2YR0A 2KNVA 3AOEA 1KFVA 1XXHE 4GKJM 2C9CA 2ZBKB 1LTMA 2CWBA 1Z6TA 2J7OA 3JAMS 2LHGA 2RGOA 1IQPA 2APLA 1GJSA 4Z8XA 1Z5CA 4M0DA 4A3VB 3FUVA 3BOSA 2JY5A 1GL6A 1AIPC 3KP1E 1EFUB 2VQEM 3U6DA 1QUSA 4FW9A 2R4EA 3GLHE 2HHHM 2YQZA 1W5TA 1KYIA 3KSJA 1YE9A 4NL4H 3C58A 4LF4M 4DR4M 5FLXS 2BNKA 1JR3A 2V6ZM 1N75A 3MHVC 2DENA 1GLNA 2M60A 1C7YA 4ITQA 1QAOA 4JI1M 3M7GA 4DR7M 4L15A 4LRTA 2F4VM 4R71A 1QDRA 1IXSA 2ZTDA 2XSZA 3GRUA 5KO3A 4XK8F 3U6SA 2L4EA 2XGNA 2QPAA 3QYEA 2X49A 4B3RM 3HHWA 3GLFE 1N33M 1XB2B 1NJGA 2LVPC 2XFSA 2ZTCA 3CF6E 5BPVA 3L26A 3I01M 3GLFB 2UUBM 1WGLA 3GLIB 3PXGA 3U60B 2DXIA 2OOAA 2CV1A 4BBAA 3C9PA 2J5YA 2DAIA 1P3QQ 3FRIA 5EJCA 3TQSA 5KPRA 3NWLA 3U6MA 4GHLA 2XH9A 3U61B 3HU3A 3PNYA 4L6V6 1GVNA 4KO8A 2LVQD 4OVZA 3GPYA 3J81S 1IN4A 4LF5M 2CRUA 4LJ8A 4TUWA 2VF8A 2EA0A 1FNNA 2R44A 2WSEF 1IY1A 2DVWB 5H37D 1L2BA 2KHHA 3A45A 1TGUA 2YFQA 2UXCM 4K0KM 1YSYA 4B7FA 3KSXA 5EXPA 3AOGA 3AL0C 3UMMA 1DO2A 1J7KA 4B7GA 2L7IA 1N77A 2GQFA 1OIPA 4KT0F 4CIZA 5FTLA 2UUAM 4NSRA 1X37A 4ZPXA 2LTUA 1OFHA 2I7PA 3U6CA 1UM8A 1IBLM 4AKIA 1DGHA 3A46A 2QNJA 3FYCA 2K6BA 4KLNA 3FUUA 1PJSA 4GC5A 4GIPA 4ANRA 2Q2EB 4DUZM 1XMQM 5C18A 4G4RA 1NSFA 3I51A 2EO2A 4MH0E 3GO8A 2R62A 1MJGM 5KQDA 3HZJA 4DV3M 1XNQM 3AFHA 1D2NA 2KNZA 2HL7A 2M5ZA 4IBJA 1E32A 2HCBA 2DWLA 4AW4A 4LG2A 4CGYB 3EIEA 3FYDA 3V76A 5L8RF 3UZUA 4JI2M 1T43A 4M9ZA 4G4QA 3FD9A 2K47A 3QWLA 3H4MA 2LVNC 3PFIA 5EP2A 1WXQA 1XHBA 1QAQA 2ZANA 5ITRA 4LJ6A 1EIJA 3VKHA 4KODA 3SYLA 2OPFA 4NXNM 4CISA 3FUXA 1Q39A 1Y8GA 5FSWA 3C3EA 2EKFA 1V33A 3U5ZB 3SASA 2F5PA 1GL7A 3KW6A 4FVMA 1CUKA 3T1HM 2DHRA 1XMOM 2LH0A 2OO9A 3GQ4A 2G8LA 4HLQA 5FTMA 4JI4M 4DV2M 3K8ZA 1Z5BA 3IG5A 1N34M 1HNXM 1BVSA 4IJFA 2QQ8A 1ZMVA 5DYGA 4PDGA 5KPTA 2LWXA 4OX9M 3FTFA 1TH4A 3W67A 3SATA 3KOZE 5ITQA 2LXEA 4QHSA 3HY5A 3K92A 3GLFA 3GLIA 5FTNA 3HHZA 3JR4A 4CHTB 3U60A 4AI6A 2R0IA 4FCTA 4IBIA 3HJ8A 1I4WA 1NNJA 1QDTA 4W5WA 4IBCA 1IN6A 1IY0A 4L16A 4AZFA 4CJ6A 4B3TM 4NRWA 1D0KA 5IREB 1MX0A 1QUTA 3ZCBB 3U61A 2X8AA 4NC6A 1ZMUA 3GRRA 1QANA 1XXHB 3VDUA 3GPUA 4DUYM 3FTCA 1OJLA 3SMPA 2UXDM 4I5SA 5LMNM 2DZOB 2F5QA 1EE8A 2K0BX 1D0LA 1TH3A 2UXBM 2Z4RA 1ZV1A 1ZQ9A 3LQQA 1PJIA 1HR0M 4JYAM 2MJ5B 3B7NA 1PM5A 3M0EA 3SFZA 1C1KA 3R9XB 1HQCA 2F5OA 3RFWA 1D0MA 5EP4A 3GLHB 2WSCF 1OIZA 1NHGC 3U6PA 3W68A 1HT1E 3QAUA 4MGHA 4Y28F 5FTJA 1SXJE 2R45A 4DR1M 3F92A 3FTEA 2CEAA 3KVWA 3B9PA 4JXJA 1SXJB 3KOWE 3L28A 2G3QA 2JNHA 3D8LA 4AG6A 2JY8A 2JA2A 3VK7A 1R2ZA 4WW0A 2A5YB 3RGPA 4LF6M 3KS4A 3VK8A 1ZMWA 1IBKM 3TL4X 2MR9A 2QBYB 2QSFX 1FJGM 2L2DA 4OU7A 2BWEA 3K9OA 2UUCM 4JI3M 1SXJD 1DGBA 3UK6A 4LFCM 2L6OA 1XWIA 2F5NA 4QOSA 3LMMA 1TTEA 1QZEA 4Q7JA 4X64M 4F1IA 5DFLA 2P5TA 2Y0QA 1Z5AA 4DR3M 1JB0F 1TH2A 4GRIA 4NXMM 1MN3A 3IG8A 3SHFA 4P16A 3GRVA 2L7HA 2RKOA 2HKJA 1GO5A 3K9PA 2C5RA 4G4NA 4JV5M 4G4OA 1V92A 3KP0E 4LCBA 2CHVA 3LW5F 5E6JA 1HT2E 4PT5A 4GEWA 4B7HA 4HEOA 3U5ZA 4NSOB 1QVRA 4XBOA 1PGYA 4EIWA 3HU2A 1G59A 3AJIB 2QENA 2CV2A 4G6ZA 5EQTA 1ZAEA 4GMQA 4Z6YA 2W82A 2Z7JA 4IBBA 4WURA 5ITUA 1Q02A 1HQYE 2XZFA 2JY7A 1R4GA 5EXSA 2J7NA 5ITXA 5F3WA 2BWBA 1I94M 1VEKA 4B3MM 2HAKA 1SG9A 2DNAA 3HHXA 4GITA 2VF7A 1NHWC 1R6BX 4LGYA 3CF0A 1JR3E 2I7NA 1IM2A 3PVSA 5IT9S 2DWMA 3HJSA 2LVOC 4RKUF 3I4YA 1IN7A 3ZC7B 7CATA 4XGIA 1PJJA 3DOAA 4M0WA 3SAWA 1N78A 1G8PA 1XC8A 1WHCA 2CV0A 1XXHA 3W0LB 2DAMA 1NVMA 2BJVA 2JP7A 2JZ1A 1VDDA 2G5GX 4JI0M 3TPZA 1Z59A 1PJQA 3U6QA 2JUJA 3IHPA 3FTDA 5EP1A 3W0FA 4AKHA 2KZSA 3U6EA 1GKIA 1GABA 4GC9A 4IIWA 1G3IA 1L8QA 3HKPA 2O01F 4BLCA 4QNMA 3SAVA 1DGGA 4IBGA 1SXJC 2C99A 3GQ5A 1DO0A 3J7BA 4L8RC 4LGMA 3CTWB 1OAIA 2KW0A 2Y21A 4M9XA 3GLHA 3VDPA 2OQ4A 1R2YA 8CATA 3J80S 1IXZA 1IN5A 1VG5A 4LJ9A 1VDLA 2DZNB 2QP9X 2WSFF 4GH9A 4G3OA 4QNRA 3TWKA 3BXWA 3KS8A 1A5TA 3OTOM 4RF0A 2JXNA 2D7GA 4IBDA 1OTRA 4RF1A 4LF9M 1F4IA 3T15A 3Q8XA 1SXJA 3LVVA 1J09A 1K82A 1GJTA 3B74A 3E9SA 3RE8A 4LJ4A 1YLAA 3SBJA 1W5SA 4DR6M 4S12A 2V1CA 3SARA 3CGWA 2KRKA 2QZ4A 1TDHA 4LJAA 4R3DA 2CHQA 3I04M 2QBYA 3HGIA 4M9SA 3E46A 2KNAA 4MM3B 4P17A 2Z3XA 2NQ8C 3LVWA 2C9OA 2CE7A 4FWHA 2LNHC 5EXXA 4DR5M 3TWMA 1L1ZA 4AG5A 2ZM6M 3R8FA 4LRSA 3TWLA 2Y0TA 2JWSA 4LJ7A 1E9RA 4QOZC 4REZA 1E9SA 3WHLA 4X65M 5BR8M 1WIVA 4AQYM 4B3SM 3LQRA 3CF2A 1OFIA 1QZMA 2ZAOA 2X4AA 4DV4M 4DV7M 3H4JA 1L1TA 3MJ5A 3EIHA 3KXEC 3JR5A 4LF8M 2CUZA 1ORYB 1L2DA 3SMSA 5C1BA 2DKLA 4YHHM 2KDLA 2DWNA 1UFZA 1VEGA 4JI8M 1IXRC 2FFJA 3UGJA 3SYKA 1Q3CA 2L4FA 3U6OA 3GQ3A 2XLJA 2XF3A 3FUWA 3L29A 1G41A 3QYBA 1G71A 1NV8A 1IBMM 1OKSA 1OAOC 3VKGA 3J27B 2Y20A 4L4UA 2MROB 2YNMD 3E4RA 1L2CA 4QHTA 1HNWM 3J7AS 5ITTA 4AKGA 2D7HA 3GLGE 1WGNA 3B89A 4I8OA 4D80A 1G4AE 3BBZA 4MB7A 3MK6A 2BJWA 4I4LA 1NJFA 2JZ0A 4GHAA 2F5SA 3GLGB 3HX3A 4FWDA 1R7RA 4IBFA 3SC3A 2RGHA 3DZDA 3HU1A 3NBXX 5ITYA 5EXTA 1NY5A 4NOOB 1KSFX 1HNZM 1JQJC 2E5LM 5FTKA 1TDZA 2O5RA 2N35A 1YUBA 2XEPA 2O25A 4YY3M 1VQ1A 4LZJA 3LCUA 3GLIE 3Q8GA 4DR2M 2FH0A 3K2LA 1Q3BA 2DZLA 1XNRM 3GPPA 4MGZE 3A42A 3SHGB 2CHGA 3B7ZA 3ZH9B 2DAKA 3KOXE 1NO1A 4D82A 4GKKM 2LBCA 2C98A 3U6LA 3FRHA 2H1RA 3HWSA 4X62M 2K9DA 2R4JA 3I4VA 2KA6B 3KDSE 1N32M 4LF7M 1NY6A 2R18A 2VQFM 4LY6A 1AUAA 3T38A 4JI7M 3T1YM 2R6FA 1H6UA 1QYRA 1V34A 3K1JA 1T6OA 3PNVA 5IWAM 2UU9M 3A98B 1WR1B 4DV1M 2VIIA 4IJEA 5A2QS 2EUCA 3KOYE 2KRUA 4DV6M 4JI6M 4FWGA 5LMUM 1OQYA 5DYIA 2FS1A 1TF0B 1IY2A 3AKZA 1QQWA 3VLFB 1IFYA 4HL4A 4B08A 4PDIA 4IBKA 2Z8YM 1K3WA 2XFTA 2KZUA 1WJ7A 2QCUA 1DGFA 1QAMA 2H5XA 3M6AA 5EP3A 1IXSB 2CP8A 3SAUA 3ILKA 4PCZA 4PD2A 2VDBB 3FE3A 4MGIE 1K3XA 4BB9A 3J2PB 1NV9A 2GNOA 1JR3D 2MGWA 4WP2A 5JI2E 5KQ8A 2R46A 1PRBA 5JI3E 2AHMA 3DA1A 3DFZA 3E21A 2DI0A 3B7QA 3L27A 3LCVB 3NBIA 4DBGB 4LFBM 2XSZD 3GPXA 3L2AA 5IZ7D 3VFDA 2FNAA 4UN2B 3UJNA 2C96A 1DV0A 2ZAMA 2DAGA 2KEBA 2LVAA 4MGYE 1PJTA 2B3TA 2QHOB 3IECA 3GP1A 2V1UA 4OVZB 3GRYA 2R65A 4JN6A 4DV5M 1S3SA
chains in the Genus database with same CATH topology
2WSFF 2WSEF 4XK8F 5L8RF 1JB0F 2O01F 4KT0F 4Y28F 3LW5F 4RKUF 4L6V6 2WSCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF F;  2WSE F;  4XK8 F;  5L8R F;  1JB0 F;  2O01 F;  4KT0 F;  4Y28 F;  3LW5 F;  4RKU F;  4L6V 6;  2WSC F; 
#chains in the Genus database with same CATH topology
 4D81 A;  1N36 M;  1T3T A;  4IBE A;  4L78 A;  2DWZ B;  2Z4S A;  3T6P A;  1E94 E;  1LV7 A;  4II7 A;  3HJQ A;  4I81 A;  1RU3 A;  4DV0 M;  1NNU C;  1R5L A;  2WZJ A;  3KFU G;  2MH8 A;  2DHY A;  4KHP M;  4OW0 A;  2ERC A;  2KXE A;  2EKK A;  5GKN A;  3GLG A;  1TR8 A;  4R7G A;  2FE8 A;  3TE6 A;  2L09 A;  4NRV A;  2LHC A;  2EJS A;  3AV0 A;  3FKE A;  5E26 A;  3C3D A;  2XZU A;  1IN8 A;  5ITX E;  5DNY A;  3L25 A;  1MU5 A;  4LJ5 A;  2OOB A;  3AOE C;  5KPZ A;  2CFO A;  3RGS A;  2RRU A;  1VEJ A;  2DAE A;  4JI5 M;  4F2L A;  3FUT A;  3MMP A;  4FD2 A;  3HHY A;  3THG A;  1DGH B;  3ZQJ A;  2D7E A;  2JY6 B;  3D8B A;  3WHK A;  4LZZ A;  4LFA M;  4FCW A;  4MGK E;  4X66 M;  4FCV A;  1J5E M;  4RNA A;  1HJP A;  2FOI C;  2HWJ A;  2YR0 A;  2KNV A;  3AOE A;  1KFV A;  1XXH E;  4GKJ M;  2C9C A;  2ZBK B;  1LTM A;  2CWB A;  1Z6T A;  2J7O A;  3JAM S;  2LHG A;  2RGO A;  1IQP A;  2APL A;  1GJS A;  4Z8X A;  1Z5C A;  4M0D A;  4A3V B;  3FUV A;  3BOS A;  2JY5 A;  1GL6 A;  1AIP C;  3KP1 E;  1EFU B;  2VQE M;  3U6D A;  1QUS A;  4FW9 A;  2R4E A;  3GLH E;  2HHH M;  2YQZ A;  1W5T A;  1KYI A;  3KSJ A;  1YE9 A;  4NL4 H;  3C58 A;  4LF4 M;  4DR4 M;  5FLX S;  2BNK A;  1JR3 A;  2V6Z M;  1N75 A;  3MHV C;  2DEN A;  1GLN A;  2M60 A;  1C7Y A;  4ITQ A;  1QAO A;  4JI1 M;  3M7G A;  4DR7 M;  4L15 A;  4LRT A;  2F4V M;  4R71 A;  1QDR A;  1IXS A;  2ZTD A;  2XSZ A;  3GRU A;  5KO3 A;  4XK8 F;  3U6S A;  2L4E A;  2XGN A;  2QPA A;  3QYE A;  2X49 A;  4B3R M;  3HHW A;  3GLF E;  1N33 M;  1XB2 B;  1NJG A;  2LVP C;  2XFS A;  2ZTC A;  3CF6 E;  5BPV A;  3L26 A;  3I01 M;  3GLF B;  2UUB M;  1WGL A;  3GLI B;  3PXG A;  3U60 B;  2DXI A;  2OOA A;  2CV1 A;  4BBA A;  3C9P A;  2J5Y A;  2DAI A;  1P3Q Q;  3FRI A;  5EJC A;  3TQS A;  5KPR A;  3NWL A;  3U6M A;  4GHL A;  2XH9 A;  3U61 B;  3HU3 A;  3PNY A;  4L6V 6;  1GVN A;  4KO8 A;  2LVQ D;  4OVZ A;  3GPY A;  3J81 S;  1IN4 A;  4LF5 M;  2CRU A;  4LJ8 A;  4TUW A;  2VF8 A;  2EA0 A;  1FNN A;  2R44 A;  2WSE F;  1IY1 A;  2DVW B;  5H37 D;  1L2B A;  2KHH A;  3A45 A;  1TGU A;  2YFQ A;  2UXC M;  4K0K M;  1YSY A;  4B7F A;  3KSX A;  5EXP A;  3AOG A;  3AL0 C;  3UMM A;  1DO2 A;  1J7K A;  4B7G A;  2L7I A;  1N77 A;  2GQF A;  1OIP A;  4KT0 F;  4CIZ A;  5FTL A;  2UUA M;  4NSR A;  1X37 A;  4ZPX A;  2LTU A;  1OFH A;  2I7P A;  3U6C A;  1UM8 A;  1IBL M;  4AKI A;  1DGH A;  3A46 A;  2QNJ A;  3FYC A;  2K6B A;  4KLN A;  3FUU A;  1PJS A;  4GC5 A;  4GIP A;  4ANR A;  2Q2E B;  4DUZ M;  1XMQ M;  5C18 A;  4G4R A;  1NSF A;  3I51 A;  2EO2 A;  4MH0 E;  3GO8 A;  2R62 A;  1MJG M;  5KQD A;  3HZJ A;  4DV3 M;  1XNQ M;  3AFH A;  1D2N A;  2KNZ A;  2HL7 A;  2M5Z A;  4IBJ A;  1E32 A;  2HCB A;  2DWL A;  4AW4 A;  4LG2 A;  4CGY B;  3EIE A;  3FYD A;  3V76 A;  5L8R F;  3UZU A;  4JI2 M;  1T43 A;  4M9Z A;  4G4Q A;  3FD9 A;  2K47 A;  3QWL A;  3H4M A;  2LVN C;  3PFI A;  5EP2 A;  1WXQ A;  1XHB A;  1QAQ A;  2ZAN A;  5ITR A;  4LJ6 A;  1EIJ A;  3VKH A;  4KOD A;  3SYL A;  2OPF A;  4NXN M;  4CIS A;  3FUX A;  1Q39 A;  1Y8G A;  5FSW A;  3C3E A;  2EKF A;  1V33 A;  3U5Z B;  3SAS A;  2F5P A;  1GL7 A;  3KW6 A;  4FVM A;  1CUK A;  3T1H M;  2DHR A;  1XMO M;  2LH0 A;  2OO9 A;  3GQ4 A;  2G8L A;  4HLQ A;  5FTM A;  4JI4 M;  4DV2 M;  3K8Z A;  1Z5B A;  3IG5 A;  1N34 M;  1HNX M;  1BVS A;  4IJF A;  2QQ8 A;  1ZMV A;  5DYG A;  4PDG A;  5KPT A;  2LWX A;  4OX9 M;  3FTF A;  1TH4 A;  3W67 A;  3SAT A;  3KOZ E;  5ITQ A;  2LXE A;  4QHS A;  3HY5 A;  3K92 A;  3GLF A;  3GLI A;  5FTN A;  3HHZ A;  3JR4 A;  4CHT B;  3U60 A;  4AI6 A;  2R0I A;  4FCT A;  4IBI A;  3HJ8 A;  1I4W A;  1NNJ A;  1QDT A;  4W5W A;  4IBC A;  1IN6 A;  1IY0 A;  4L16 A;  4AZF A;  4CJ6 A;  4B3T M;  4NRW A;  1D0K A;  5IRE B;  1MX0 A;  1QUT A;  3ZCB B;  3U61 A;  2X8A A;  4NC6 A;  1ZMU A;  3GRR A;  1QAN A;  1XXH B;  3VDU A;  3GPU A;  4DUY M;  3FTC A;  1OJL A;  3SMP A;  2UXD M;  4I5S A;  5LMN M;  2DZO B;  2F5Q A;  1EE8 A;  2K0B X;  1D0L A;  1TH3 A;  2UXB M;  2Z4R A;  1ZV1 A;  1ZQ9 A;  3LQQ A;  1PJI A;  1HR0 M;  4JYA M;  2MJ5 B;  3B7N A;  1PM5 A;  3M0E A;  3SFZ A;  1C1K A;  3R9X B;  1HQC A;  2F5O A;  3RFW A;  1D0M A;  5EP4 A;  3GLH B;  2WSC F;  1OIZ A;  1NHG C;  3U6P A;  3W68 A;  1HT1 E;  3QAU A;  4MGH A;  4Y28 F;  5FTJ A;  1SXJ E;  2R45 A;  4DR1 M;  3F92 A;  3FTE A;  2CEA A;  3KVW A;  3B9P A;  4JXJ A;  1SXJ B;  3KOW E;  3L28 A;  2G3Q A;  2JNH A;  3D8L A;  4AG6 A;  2JY8 A;  2JA2 A;  3VK7 A;  1R2Z A;  4WW0 A;  2A5Y B;  3RGP A;  4LF6 M;  3KS4 A;  3VK8 A;  1ZMW A;  1IBK M;  3TL4 X;  2MR9 A;  2QBY B;  2QSF X;  1FJG M;  2L2D A;  4OU7 A;  2BWE A;  3K9O A;  2UUC M;  4JI3 M;  1SXJ D;  1DGB A;  3UK6 A;  4LFC M;  2L6O A;  1XWI A;  2F5N A;  4QOS A;  3LMM A;  1TTE A;  1QZE A;  4Q7J A;  4X64 M;  4F1I A;  5DFL A;  2P5T A;  2Y0Q A;  1Z5A A;  4DR3 M;  1JB0 F;  1TH2 A;  4GRI A;  4NXM M;  1MN3 A;  3IG8 A;  3SHF A;  4P16 A;  3GRV A;  2L7H A;  2RKO A;  2HKJ A;  1GO5 A;  3K9P A;  2C5R A;  4G4N A;  4JV5 M;  4G4O A;  1V92 A;  3KP0 E;  4LCB A;  2CHV A;  3LW5 F;  5E6J A;  1HT2 E;  4PT5 A;  4GEW A;  4B7H A;  4HEO A;  3U5Z A;  4NSO B;  1QVR A;  4XBO A;  1PGY A;  4EIW A;  3HU2 A;  1G59 A;  3AJI B;  2QEN A;  2CV2 A;  4G6Z A;  5EQT A;  1ZAE A;  4GMQ A;  4Z6Y A;  2W82 A;  2Z7J A;  4IBB A;  4WUR A;  5ITU A;  1Q02 A;  1HQY E;  2XZF A;  2JY7 A;  1R4G A;  5EXS A;  2J7N A;  5ITX A;  5F3W A;  2BWB A;  1I94 M;  1VEK A;  4B3M M;  2HAK A;  1SG9 A;  2DNA A;  3HHX A;  4GIT A;  2VF7 A;  1NHW C;  1R6B X;  4LGY A;  3CF0 A;  1JR3 E;  2I7N A;  1IM2 A;  3PVS A;  5IT9 S;  2DWM A;  3HJS A;  2LVO C;  4RKU F;  3I4Y A;  1IN7 A;  3ZC7 B;  7CAT A;  4XGI A;  1PJJ A;  3DOA A;  4M0W A;  3SAW A;  1N78 A;  1G8P A;  1XC8 A;  1WHC A;  2CV0 A;  1XXH A;  3W0L B;  2DAM A;  1NVM A;  2BJV A;  2JP7 A;  2JZ1 A;  1VDD A;  2G5G X;  4JI0 M;  3TPZ A;  1Z59 A;  1PJQ A;  3U6Q A;  2JUJ A;  3IHP A;  3FTD A;  5EP1 A;  3W0F A;  4AKH A;  2KZS A;  3U6E A;  1GKI A;  1GAB A;  4GC9 A;  4IIW A;  1G3I A;  1L8Q A;  3HKP A;  2O01 F;  4BLC A;  4QNM A;  3SAV A;  1DGG A;  4IBG A;  1SXJ C;  2C99 A;  3GQ5 A;  1DO0 A;  3J7B A;  4L8R C;  4LGM A;  3CTW B;  1OAI A;  2KW0 A;  2Y21 A;  4M9X A;  3GLH A;  3VDP A;  2OQ4 A;  1R2Y A;  8CAT A;  3J80 S;  1IXZ A;  1IN5 A;  1VG5 A;  4LJ9 A;  1VDL A;  2DZN B;  2QP9 X;  2WSF F;  4GH9 A;  4G3O A;  4QNR A;  3TWK A;  3BXW A;  3KS8 A;  1A5T A;  3OTO M;  4RF0 A;  2JXN A;  2D7G A;  4IBD A;  1OTR A;  4RF1 A;  4LF9 M;  1F4I A;  3T15 A;  3Q8X A;  1SXJ A;  3LVV A;  1J09 A;  1K82 A;  1GJT A;  3B74 A;  3E9S A;  3RE8 A;  4LJ4 A;  1YLA A;  3SBJ A;  1W5S A;  4DR6 M;  4S12 A;  2V1C A;  3SAR A;  3CGW A;  2KRK A;  2QZ4 A;  1TDH A;  4LJA A;  4R3D A;  2CHQ A;  3I04 M;  2QBY A;  3HGI A;  4M9S A;  3E46 A;  2KNA A;  4MM3 B;  4P17 A;  2Z3X A;  2NQ8 C;  3LVW A;  2C9O A;  2CE7 A;  4FWH A;  2LNH C;  5EXX A;  4DR5 M;  3TWM A;  1L1Z A;  4AG5 A;  2ZM6 M;  3R8F A;  4LRS A;  3TWL A;  2Y0T A;  2JWS A;  4LJ7 A;  1E9R A;  4QOZ C;  4REZ A;  1E9S A;  3WHL A;  4X65 M;  5BR8 M;  1WIV A;  4AQY M;  4B3S M;  3LQR A;  3CF2 A;  1OFI A;  1QZM A;  2ZAO A;  2X4A A;  4DV4 M;  4DV7 M;  3H4J A;  1L1T A;  3MJ5 A;  3EIH A;  3KXE C;  3JR5 A;  4LF8 M;  2CUZ A;  1ORY B;  1L2D A;  3SMS A;  5C1B A;  2DKL A;  4YHH M;  2KDL A;  2DWN A;  1UFZ A;  1VEG A;  4JI8 M;  1IXR C;  2FFJ A;  3UGJ A;  3SYK A;  1Q3C A;  2L4F A;  3U6O A;  3GQ3 A;  2XLJ A;  2XF3 A;  3FUW A;  3L29 A;  1G41 A;  3QYB A;  1G71 A;  1NV8 A;  1IBM M;  1OKS A;  1OAO C;  3VKG A;  3J27 B;  2Y20 A;  4L4U A;  2MRO B;  2YNM D;  3E4R A;  1L2C A;  4QHT A;  1HNW M;  3J7A S;  5ITT A;  4AKG A;  2D7H A;  3GLG E;  1WGN A;  3B89 A;  4I8O A;  4D80 A;  1G4A E;  3BBZ A;  4MB7 A;  3MK6 A;  2BJW A;  4I4L A;  1NJF A;  2JZ0 A;  4GHA A;  2F5S A;  3GLG B;  3HX3 A;  4FWD A;  1R7R A;  4IBF A;  3SC3 A;  2RGH A;  3DZD A;  3HU1 A;  3NBX X;  5ITY A;  5EXT A;  1NY5 A;  4NOO B;  1KSF X;  1HNZ M;  1JQJ C;  2E5L M;  5FTK A;  1TDZ A;  2O5R A;  2N35 A;  1YUB A;  2XEP A;  2O25 A;  4YY3 M;  1VQ1 A;  4LZJ A;  3LCU A;  3GLI E;  3Q8G A;  4DR2 M;  2FH0 A;  3K2L A;  1Q3B A;  2DZL A;  1XNR M;  3GPP A;  4MGZ E;  3A42 A;  3SHG B;  2CHG A;  3B7Z A;  3ZH9 B;  2DAK A;  3KOX E;  1NO1 A;  4D82 A;  4GKK M;  2LBC A;  2C98 A;  3U6L A;  3FRH A;  2H1R A;  3HWS A;  4X62 M;  2K9D A;  2R4J A;  3I4V A;  2KA6 B;  3KDS E;  1N32 M;  4LF7 M;  1NY6 A;  2R18 A;  2VQF M;  4LY6 A;  1AUA A;  3T38 A;  4JI7 M;  3T1Y M;  2R6F A;  1H6U A;  1QYR A;  1V34 A;  3K1J A;  1T6O A;  3PNV A;  5IWA M;  2UU9 M;  3A98 B;  1WR1 B;  4DV1 M;  2VII A;  4IJE A;  5A2Q S;  2EUC A;  3KOY E;  2KRU A;  4DV6 M;  4JI6 M;  4FWG A;  5LMU M;  1OQY A;  5DYI A;  2FS1 A;  1TF0 B;  1IY2 A;  3AKZ A;  1QQW A;  3VLF B;  1IFY A;  4HL4 A;  4B08 A;  4PDI A;  4IBK A;  2Z8Y M;  1K3W A;  2XFT A;  2KZU A;  1WJ7 A;  2QCU A;  1DGF A;  1QAM A;  2H5X A;  3M6A A;  5EP3 A;  1IXS B;  2CP8 A;  3SAU A;  3ILK A;  4PCZ A;  4PD2 A;  2VDB B;  3FE3 A;  4MGI E;  1K3X A;  4BB9 A;  3J2P B;  1NV9 A;  2GNO A;  1JR3 D;  2MGW A;  4WP2 A;  5JI2 E;  5KQ8 A;  2R46 A;  1PRB A;  5JI3 E;  2AHM A;  3DA1 A;  3DFZ A;  3E21 A;  2DI0 A;  3B7Q A;  3L27 A;  3LCV B;  3NBI A;  4DBG B;  4LFB M;  2XSZ D;  3GPX A;  3L2A A;  5IZ7 D;  3VFD A;  2FNA A;  4UN2 B;  3UJN A;  2C96 A;  1DV0 A;  2ZAM A;  2DAG A;  2KEB A;  2LVA A;  4MGY E;  1PJT A;  2B3T A;  2QHO B;  3IEC A;  3GP1 A;  2V1U A;  4OVZ B;  3GRY A;  2R65 A;  4JN6 A;  4DV5 M;  1S3S A; 
#chains in the Genus database with same CATH homology
 2WSF F;  2WSE F;  4XK8 F;  5L8R F;  1JB0 F;  2O01 F;  4KT0 F;  4Y28 F;  3LW5 F;  4RKU F;  4L6V 6;  2WSC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...