2WSEF

Improved model of plant photosystem i
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 20
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wseF00
3LW5F 1JB0F 4Y28F 2WSCF 5L8RF 2O01F 4RKUF 4KT0F 2WSEF 4XK8F 4L6V6 2WSFF
chains in the Genus database with same CATH superfamily
2RGOA 4LF8M 1E9RA 3HKPA 5FTKA 5KPTA 2DHRA 3GPYA 4KO8A 3U6MA 4M9SA 1L8QA 4G4RA 1JR3D 3HU1A 1GO5A 3HHYA 3W67A 1HQYE 3UK6A 4F2LA 3U6CA 1TF0B 2LVNC 1MJGM 3NBXX 4MH0E 1MX0A 1TDHA 3QYBA 2DI0A 1Z59A 3TL4X 3SBJA 1AIPC 5IREB 2RGHA 3F92A 2UXBM 4M9XA 1QAOA 3EIEA 4IJFA 2WZJA 4MGIE 5A2QS 3AOEC 2HAKA 3KOXE 5IZ7D 2KXEA 3GLHE 2QZ4A 3AJIB 4NSOB 2D7EA 1NVMA 5JI2E 4HL4A 4GITA 3KS4A 1D0MA 4JXJA 5GKNA 5KQDA 3GPUA 4DR5M 4YY3M 3ILKA 2F5OA 1BVSA 4FCTA 3KOZE 1XWIA 2A5YB 3DFZA 5KPZA 1GKIA 1TGUA 2KW0A 1IY0A 3SMSA 2QPAA 4REZA 3T15A 3I04M 3Q8XA 4GIPA 2BWEA 1XXHE 4NC6A 2L09A 5ITYA 3E46A 3H4JA 4IJEA 4B7GA 3FD9A 3MJ5A 4DV7M 2DWMA 2AHMA 1CUKA 4AKHA 3VKHA 1HNWM 4GKJM 2DVWB 3SAVA 1HT2E 2CHGA 2UU9M 1VEKA 2JY6B 2QBYB 1E94E 4LF4M 1PGYA 2Z8YM 4QNRA 1IXSB 1Z5CA 2CV2A 4P17A 4AG6A 2R0IA 1E32A 2JUJA 2Y20A 2YR0A 1OFHA 3A98B 3HU3A 3VDUA 1K3XA 4JI5M 3AFHA 4CIZA 3TWLA 2KA6B 1PJQA 2OO9A 1NY6A 3GLGB 4LJ5A 1N78A 2WSEF 2MGWA 1QYRA 3TPZA 2O5RA 2LHCA 3K8ZA 4G6ZA 4M9ZA 4PDGA 1N36M 2HL7A 3D8LA 4RKUF 2KHHA 3J7BA 1WIVA 2Z4SA 3L29A 3A45A 2DAEA 3MK6A 2CHQA 4FVMA 2DNAA 3FTCA 4GHAA 4JI0M 5EQTA 4GC5A 4DR3M 3J7AS 3U6SA 3SHGB 5FLXS 3THGA 1L1TA 1GJTA 2CFOA 5LMNM 3CF6E 5EJCA 2KNVA 3GQ5A 1IN4A 2UUCM 4FWGA 1NSFA 4LGMA 2R62A 4DR1M 4JYAM 1AUAA 1OTRA 3AKZA 1IBMM 4I5SA 1NHGC 1OKSA 3SC3A 2LHGA 1VDLA 2EJSA 2WSFF 3L27A 1KFVA 1VEJA 3HWSA 2VQEM 1EFUB 2DAKA 4QOSA 3W0FA 2JZ0A 3AV0A 3L28A 4BLCA 5DNYA 4A3VB 3C9PA 1SXJD 7CATA 3GLGA 2C9CA 1T3TA 2VIIA 1HR0M 2QSFX 3MHVC 4UN2B 4BB9A 2UXCM 1VG5A 4DR6M 2Z4RA 2GNOA 2XSZD 4RNAA 3U6EA 1D0KA 3W68A 4LF7M 3VK8A 3TQSA 3TWKA 4Z8XA 1N75A 1T6OA 2CEAA 3R9XB 3U61B 2JXNA 2QNJA 4XK8F 1GL7A 4R71A 5JI3E 3FRHA 1IBKM 3A42A 4B3TM 5ITRA 1OIZA 1IXRC 2R45A 1OFIA 3LCUA 4QOZC 1L2BA 2BNKA 1IY2A 3GRRA 2KNAA 2MJ5B 3DZDA 1ZMVA 3FUVA 1JR3A 4CISA 5C1BA 2XZUA 1R2ZA 3NBIA 5ITTA 1HNZM 1GJSA 2Y21A 3KW6A 3GLIE 2LVPC 2G3QA 4X62M 3LVVA 1QQWA 4NOOB 1HJPA 1K82A 4LFBM 2W82A 1EE8A 4LJ6A 1G71A 5KO3A 1IQPA 2ZANA 3B7QA 4D80A 1XMQM 2APLA 3HZJA 1V92A 4AW4A 2FE8A 1NY5A 2ZTCA 1I4WA 3VFDA 3CF0A 3FE3A 2YNMD 4L8RC 2JNHA 1WJ7A 1NV9A 2H5XA 3L26A 3U61A 1NO1A 1ORYB 4KODA 2K47A 3SAWA 5ITXE 4JI1M 5EXSA 3KOWE 1YSYA 2F5NA 2F5PA 4LF6M 1J09A 2BWBA 2FH0A 4MB7A 4KHPM 2Z3XA 3FUTA 1W5TA 4AKIA 3SYLA 3UZUA 2KRUA 1X37A 2KZUA 2DZNB 5EP4A 2C5RA 2JZ1A 1V34A 3QYEA 2N35A 5FTNA 5DYIA 5EP2A 4B08A 5BPVA 1NNJA 1GLNA 3U6QA 1S3SA 3ZC7B 2DXIA 3AL0C 3HHWA 4GMQA 1QDRA 3HU2A 4JI7M 5FTJA 2L4EA 1SXJB 4PD2A 3H4MA 3PNVA 4JI3M 3K2LA 2XGNA 3GLFE 4G4QA 2F5SA 3V76A 5L8RF 1PJSA 4LRTA 4RF1A 1XB2B 3KDSE 1UM8A 4OVZB 4AQYM 3J27B 1ZMWA 1GL6A 3BBZA 2L7IA 1H6UA 2YFQA 4D82A 2F5QA 3HJ8A 1Z5AA 3WHKA 3HX3A 2JY5A 2R65A 5EP3A 2G8LA 2OPFA 2V6ZM 2DWZB 3PFIA 2LNHC 2RKOA 1IY1A 5FTMA 3WHLA 3U6LA 3DA1A 2E5LM 2BJWA 1R7RA 2MROB 1N32M 1F4IA 5EXTA 2Z7JA 4DV0M 4DR4M 4QHSA 4NRWA 4LG2A 3E4RA 2P5TA 4IIWA 1HQCA 1QANA 4DV5M 1YLAA 2DZOB 1IM2A 5EXXA 2KZSA 2CWBA 3ZQJA 1XMOM 3SARA 3VKGA 3B7ZA 3LVWA 4FW9A 1N77A 1SXJA 1N34M 1QVRA 2L4FA 1WXQA 3RE8A 4B7FA 1Q3BA 3SATA 3GRVA 3HY5A 2BJVA 2XSZA 1WR1B 4LZJA 2R44A 2OQ4A 1G41A 1OQYA 2GQFA 1R2YA 3K9OA 1PM5A 4M0WA 3FTFA 1UFZA 1Q39A 4GC9A 4NSRA 4KT0F 2DAMA 2HHHM 2CV0A 2DAIA 3K1JA 4LJ7A 4NL4H 3GP1A 4LGYA 1TDZA 4ZPXA 4DR7M 2QBYA 1PRBA 1G59A 3I4VA 1IXSA 2EKFA 1YE9A 1D2NA 2XH9A 3BXWA 3CGWA 4PCZA 3UJNA 1TH3A 1ZMUA 4EIWA 1DO2A 2KDLA 3VLFB 4IBIA 4Y28F 3HJQA 1IN7A 1R6BX 3LQRA 5F3WA 5IT9S 4Q7JA 2Q2EB 2XF3A 2Y0TA 3FTEA 2UXDM 3SMPA 1EIJA 1TR8A 2OOBA 3GLHB 3FYCA 4CHTB 2D7GA 2HCBA 4IBEA 4LJ9A 3GQ4A 4P16A 2FS1A 3FYDA 2XFSA 3HJSA 4OW0A 5H37D 3A46A 1ZAEA 2YQZA 1YUBA 1XNQM 1NJFA 2NQ8C 4II7A 4X64M 4MGKE 3R8FA 4FCWA 4IBBA 2JY8A 3T6PA 1DGHB 1Q3CA 2ZAMA 3AOGA 1MN3A 1XXHB 1PJJA 1L1ZA 1IN5A 1GVNA 4MGZE 3SAUA 3U5ZB 1QUSA 4WP2A 3IG8A 4WURA 3CTWB 1QZMA 4HLQA 4X66M 4DUZM 2CUZA 3MMPA 4MGHA 3IG5A 4G3OA 2JP7A 3ZH9B 4GKKM 2QHOB 1DGFA 2UUAM 3C3EA 1C7YA 2HKJA 2EKKA 4F1IA 4JI2M 1TTEA 3E9SA 2DENA 3L2AA 1MU5A 4G4OA 2UUBM 4OX9M 5ITUA 4X65M 4IBGA 5BR8M 4CJ6A 3PXGA 1ZV1A 3LW5F 1JB0F 3FTDA 3KSXA 4IBFA 4IBKA 2CRUA 3GLHA 1JQJC 3K9PA 4DBGB 1Z5BA 1R4GA 2J5YA 2I7NA 3M0EA 1QUTA 1Z6TA 2C9OA 3GLGE 2G5GX 5KPRA 4TUWA 2LWXA 2VQFM 4PDIA 2F4VM 1NV8A 3KFUG 1N33M 1L2CA 1L2DA 3HGIA 2ZM6M 4DV1M 4W5WA 4L6V6 3GPPA 3NWLA 4I4LA 4JI4M 1DGHA 1ZQ9A 4Z6YA 4G4NA 2R4EA 3GQ3A 4LCBA 2MH8A 4QHTA 5E26A 3VK7A 4K0KM 3KOYE 4OU7A 1QAQA 3B89A 2LH0A 4FD2A 2ZTDA 4JV5M 4PT5A 3FUXA 1FJGM 2VF7A 3RGPA 4L16A 3KXEC 1K3WA 2C96A 3BOSA 3I4YA 3C3DA 2QENA 5EP1A 1C1KA 4MGYE 1JR3E 2R4JA 3PVSA 3GPXA 4I8OA 3U60B 2JWSA 4IBCA 4LF5M 5ITQA 4GRIA 2FFJA 2KNZA 3AOEA 4LFAM 8CATA 4IBJA 1PJTA 3KSJA 3RFWA 2VDBB 3PNYA 3HHXA 2K0BX 3Q8GA 2L6OA 1LV7A 1TH2A 4LJ4A 1R5LA 1HNXM 1I94M 3JR5A 1FNNA 1J7KA 1TH4A 4KLNA 3GRYA 2XLJA 4LRSA 2R6FA 4MM3B 4L78A 1OAOC 1IN8A 2LBCA 2CV1A 3D8BA 2QQ8A 4JI6M 1WGNA 4BBAA 3M7GA 3E21A 3C58A 3VDPA 3TWMA 2X49A 3GLIB 3KS8A 4LJ8A 2CP8A 3T1HM 5E6JA 2JA2A 1D0LA 2M5ZA 4FWDA 3SYKA 3U60A 2DHYA 2J7OA 3IECA 2XFTA 4LZZA 1GABA 4AKGA 3SASA 4DUYM 3KVWA 1KSFX 1DGBA 1T43A 2QCUA 2WSCF 2V1CA 1G3IA 2R18A 4OVZA 3JAMS 4AZFA 5LMUM 3T1YM 4DV6M 4R3DA 4ITQA 3FUWA 2LTUA 2R46A 1SXJC 2V1UA 2B3TA 2J7NA 3QWLA 2KRKA 1VEGA 3B9PA 3FUUA 3CF2A 3KP0E 4GH9A 2VF8A 4WW0A 2EA0A 2D7HA 1P3QQ 4XGIA 2JY7A 5DYGA 2DWLA 4JN6A 2LVOC 3IHPA 2HWJA 1G4AE 4RF0A 2DKLA 2K9DA 1NNUC 3U6PA 4QNMA 2ZBKB 2C99A 1WGLA 4NRVA 1IFYA 2MR9A 3B7NA 4FCVA 4IBDA 4M0DA 3J81S 3GLIA 4LJAA 1IBLM 4DV2M 1VDDA 1Y8GA 1KYIA 4B3SM 1DO0A 3EIHA 3T38A 3JR4A 3I01M 3GRUA 5FTLA 1SG9A 3GLFB 4DV4M 1J5EM 3LMMA 1QDTA 2EUCA 1XC8A 4B7HA 1V33A 4S12A 3HHZA 4B3MM 4HEOA 2CHVA 4AG5A 2O01F 2XEPA 5FSWA 1OIPA 1SXJE 1Q02A 2LVAA 4DV3M 2L2DA 2O25A 1NHWC 4AI6A 3W0LB 1NJGA 2DZLA 2KEBA 3GO8A 4JI8M 2ERCA 3L25A 1XNRM 3J2PB 2H1RA 4CGYB 4L4UA 1LTMA 3FKEA 4LF9M 5ITXA 1DGGA 1DV0A 5EXPA 3SHFA 3QAUA 2K6BA 1IN6A 1OAIA 3LCVB 4XBOA 3UGJA 2X4AA 2XZFA 2EO2A 3M6AA 4I81A 1WHCA 4FWHA 3KP1E 1XHBA 2CE7A 2FNAA 3SFZA 1IXZA 3FRIA 1A5TA 4R7GA 3RGSA 2C98A 5C18A 5KQ8A 3LQQA 3B74A 5DFLA 2OOAA 1E9SA 2FOIC 4L15A 3U6OA 4NXNM 2I7PA 2M60A 5IWAM 3J80S 4GHLA 1OJLA 3DOAA 3GLFA 4GEWA 1G8PA 2ZAOA 2X8AA 3OTOM 4B3RM 1QZEA 4ANRA 2DWNA 4LY6A 2L7HA 1HT1E 1XXHA 2Y0QA 1W5SA 3ZCBB 3U6DA 2DAGA 3U5ZA 3UMMA 2RRUA 2LXEA 3I51A 4YHHM 4LFCM 4NXMM 4DR2M 1PJIA 1VQ1A 2LVQD 2QP9X 3K92A 1RU3A 3TE6A 4D81A 1QAMA
chains in the Genus database with same CATH topology
3LW5F 1JB0F 4Y28F 2WSCF 5L8RF 2O01F 4RKUF 4KT0F 2WSEF 4XK8F 4L6V6 2WSFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 F;  1JB0 F;  4Y28 F;  2WSC F;  5L8R F;  2O01 F;  4RKU F;  4KT0 F;  2WSE F;  4XK8 F;  4L6V 6;  2WSF F; 
#chains in the Genus database with same CATH topology
 2RGO A;  4LF8 M;  1E9R A;  3HKP A;  5FTK A;  5KPT A;  2DHR A;  3GPY A;  4KO8 A;  3U6M A;  4M9S A;  1L8Q A;  4G4R A;  1JR3 D;  3HU1 A;  1GO5 A;  3HHY A;  3W67 A;  1HQY E;  3UK6 A;  4F2L A;  3U6C A;  1TF0 B;  2LVN C;  1MJG M;  3NBX X;  4MH0 E;  1MX0 A;  1TDH A;  3QYB A;  2DI0 A;  1Z59 A;  3TL4 X;  3SBJ A;  1AIP C;  5IRE B;  2RGH A;  3F92 A;  2UXB M;  4M9X A;  1QAO A;  3EIE A;  4IJF A;  2WZJ A;  4MGI E;  5A2Q S;  3AOE C;  2HAK A;  3KOX E;  5IZ7 D;  2KXE A;  3GLH E;  2QZ4 A;  3AJI B;  4NSO B;  2D7E A;  1NVM A;  5JI2 E;  4HL4 A;  4GIT A;  3KS4 A;  1D0M A;  4JXJ A;  5GKN A;  5KQD A;  3GPU A;  4DR5 M;  4YY3 M;  3ILK A;  2F5O A;  1BVS A;  4FCT A;  3KOZ E;  1XWI A;  2A5Y B;  3DFZ A;  5KPZ A;  1GKI A;  1TGU A;  2KW0 A;  1IY0 A;  3SMS A;  2QPA A;  4REZ A;  3T15 A;  3I04 M;  3Q8X A;  4GIP A;  2BWE A;  1XXH E;  4NC6 A;  2L09 A;  5ITY A;  3E46 A;  3H4J A;  4IJE A;  4B7G A;  3FD9 A;  3MJ5 A;  4DV7 M;  2DWM A;  2AHM A;  1CUK A;  4AKH A;  3VKH A;  1HNW M;  4GKJ M;  2DVW B;  3SAV A;  1HT2 E;  2CHG A;  2UU9 M;  1VEK A;  2JY6 B;  2QBY B;  1E94 E;  4LF4 M;  1PGY A;  2Z8Y M;  4QNR A;  1IXS B;  1Z5C A;  2CV2 A;  4P17 A;  4AG6 A;  2R0I A;  1E32 A;  2JUJ A;  2Y20 A;  2YR0 A;  1OFH A;  3A98 B;  3HU3 A;  3VDU A;  1K3X A;  4JI5 M;  3AFH A;  4CIZ A;  3TWL A;  2KA6 B;  1PJQ A;  2OO9 A;  1NY6 A;  3GLG B;  4LJ5 A;  1N78 A;  2WSE F;  2MGW A;  1QYR A;  3TPZ A;  2O5R A;  2LHC A;  3K8Z A;  4G6Z A;  4M9Z A;  4PDG A;  1N36 M;  2HL7 A;  3D8L A;  4RKU F;  2KHH A;  3J7B A;  1WIV A;  2Z4S A;  3L29 A;  3A45 A;  2DAE A;  3MK6 A;  2CHQ A;  4FVM A;  2DNA A;  3FTC A;  4GHA A;  4JI0 M;  5EQT A;  4GC5 A;  4DR3 M;  3J7A S;  3U6S A;  3SHG B;  5FLX S;  3THG A;  1L1T A;  1GJT A;  2CFO A;  5LMN M;  3CF6 E;  5EJC A;  2KNV A;  3GQ5 A;  1IN4 A;  2UUC M;  4FWG A;  1NSF A;  4LGM A;  2R62 A;  4DR1 M;  4JYA M;  1AUA A;  1OTR A;  3AKZ A;  1IBM M;  4I5S A;  1NHG C;  1OKS A;  3SC3 A;  2LHG A;  1VDL A;  2EJS A;  2WSF F;  3L27 A;  1KFV A;  1VEJ A;  3HWS A;  2VQE M;  1EFU B;  2DAK A;  4QOS A;  3W0F A;  2JZ0 A;  3AV0 A;  3L28 A;  4BLC A;  5DNY A;  4A3V B;  3C9P A;  1SXJ D;  7CAT A;  3GLG A;  2C9C A;  1T3T A;  2VII A;  1HR0 M;  2QSF X;  3MHV C;  4UN2 B;  4BB9 A;  2UXC M;  1VG5 A;  4DR6 M;  2Z4R A;  2GNO A;  2XSZ D;  4RNA A;  3U6E A;  1D0K A;  3W68 A;  4LF7 M;  3VK8 A;  3TQS A;  3TWK A;  4Z8X A;  1N75 A;  1T6O A;  2CEA A;  3R9X B;  3U61 B;  2JXN A;  2QNJ A;  4XK8 F;  1GL7 A;  4R71 A;  5JI3 E;  3FRH A;  1IBK M;  3A42 A;  4B3T M;  5ITR A;  1OIZ A;  1IXR C;  2R45 A;  1OFI A;  3LCU A;  4QOZ C;  1L2B A;  2BNK A;  1IY2 A;  3GRR A;  2KNA A;  2MJ5 B;  3DZD A;  1ZMV A;  3FUV A;  1JR3 A;  4CIS A;  5C1B A;  2XZU A;  1R2Z A;  3NBI A;  5ITT A;  1HNZ M;  1GJS A;  2Y21 A;  3KW6 A;  3GLI E;  2LVP C;  2G3Q A;  4X62 M;  3LVV A;  1QQW A;  4NOO B;  1HJP A;  1K82 A;  4LFB M;  2W82 A;  1EE8 A;  4LJ6 A;  1G71 A;  5KO3 A;  1IQP A;  2ZAN A;  3B7Q A;  4D80 A;  1XMQ M;  2APL A;  3HZJ A;  1V92 A;  4AW4 A;  2FE8 A;  1NY5 A;  2ZTC A;  1I4W A;  3VFD A;  3CF0 A;  3FE3 A;  2YNM D;  4L8R C;  2JNH A;  1WJ7 A;  1NV9 A;  2H5X A;  3L26 A;  3U61 A;  1NO1 A;  1ORY B;  4KOD A;  2K47 A;  3SAW A;  5ITX E;  4JI1 M;  5EXS A;  3KOW E;  1YSY A;  2F5N A;  2F5P A;  4LF6 M;  1J09 A;  2BWB A;  2FH0 A;  4MB7 A;  4KHP M;  2Z3X A;  3FUT A;  1W5T A;  4AKI A;  3SYL A;  3UZU A;  2KRU A;  1X37 A;  2KZU A;  2DZN B;  5EP4 A;  2C5R A;  2JZ1 A;  1V34 A;  3QYE A;  2N35 A;  5FTN A;  5DYI A;  5EP2 A;  4B08 A;  5BPV A;  1NNJ A;  1GLN A;  3U6Q A;  1S3S A;  3ZC7 B;  2DXI A;  3AL0 C;  3HHW A;  4GMQ A;  1QDR A;  3HU2 A;  4JI7 M;  5FTJ A;  2L4E A;  1SXJ B;  4PD2 A;  3H4M A;  3PNV A;  4JI3 M;  3K2L A;  2XGN A;  3GLF E;  4G4Q A;  2F5S A;  3V76 A;  5L8R F;  1PJS A;  4LRT A;  4RF1 A;  1XB2 B;  3KDS E;  1UM8 A;  4OVZ B;  4AQY M;  3J27 B;  1ZMW A;  1GL6 A;  3BBZ A;  2L7I A;  1H6U A;  2YFQ A;  4D82 A;  2F5Q A;  3HJ8 A;  1Z5A A;  3WHK A;  3HX3 A;  2JY5 A;  2R65 A;  5EP3 A;  2G8L A;  2OPF A;  2V6Z M;  2DWZ B;  3PFI A;  2LNH C;  2RKO A;  1IY1 A;  5FTM A;  3WHL A;  3U6L A;  3DA1 A;  2E5L M;  2BJW A;  1R7R A;  2MRO B;  1N32 M;  1F4I A;  5EXT A;  2Z7J A;  4DV0 M;  4DR4 M;  4QHS A;  4NRW A;  4LG2 A;  3E4R A;  2P5T A;  4IIW A;  1HQC A;  1QAN A;  4DV5 M;  1YLA A;  2DZO B;  1IM2 A;  5EXX A;  2KZS A;  2CWB A;  3ZQJ A;  1XMO M;  3SAR A;  3VKG A;  3B7Z A;  3LVW A;  4FW9 A;  1N77 A;  1SXJ A;  1N34 M;  1QVR A;  2L4F A;  1WXQ A;  3RE8 A;  4B7F A;  1Q3B A;  3SAT A;  3GRV A;  3HY5 A;  2BJV A;  2XSZ A;  1WR1 B;  4LZJ A;  2R44 A;  2OQ4 A;  1G41 A;  1OQY A;  2GQF A;  1R2Y A;  3K9O A;  1PM5 A;  4M0W A;  3FTF A;  1UFZ A;  1Q39 A;  4GC9 A;  4NSR A;  4KT0 F;  2DAM A;  2HHH M;  2CV0 A;  2DAI A;  3K1J A;  4LJ7 A;  4NL4 H;  3GP1 A;  4LGY A;  1TDZ A;  4ZPX A;  4DR7 M;  2QBY A;  1PRB A;  1G59 A;  3I4V A;  1IXS A;  2EKF A;  1YE9 A;  1D2N A;  2XH9 A;  3BXW A;  3CGW A;  4PCZ A;  3UJN A;  1TH3 A;  1ZMU A;  4EIW A;  1DO2 A;  2KDL A;  3VLF B;  4IBI A;  4Y28 F;  3HJQ A;  1IN7 A;  1R6B X;  3LQR A;  5F3W A;  5IT9 S;  4Q7J A;  2Q2E B;  2XF3 A;  2Y0T A;  3FTE A;  2UXD M;  3SMP A;  1EIJ A;  1TR8 A;  2OOB A;  3GLH B;  3FYC A;  4CHT B;  2D7G A;  2HCB A;  4IBE A;  4LJ9 A;  3GQ4 A;  4P16 A;  2FS1 A;  3FYD A;  2XFS A;  3HJS A;  4OW0 A;  5H37 D;  3A46 A;  1ZAE A;  2YQZ A;  1YUB A;  1XNQ M;  1NJF A;  2NQ8 C;  4II7 A;  4X64 M;  4MGK E;  3R8F A;  4FCW A;  4IBB A;  2JY8 A;  3T6P A;  1DGH B;  1Q3C A;  2ZAM A;  3AOG A;  1MN3 A;  1XXH B;  1PJJ A;  1L1Z A;  1IN5 A;  1GVN A;  4MGZ E;  3SAU A;  3U5Z B;  1QUS A;  4WP2 A;  3IG8 A;  4WUR A;  3CTW B;  1QZM A;  4HLQ A;  4X66 M;  4DUZ M;  2CUZ A;  3MMP A;  4MGH A;  3IG5 A;  4G3O A;  2JP7 A;  3ZH9 B;  4GKK M;  2QHO B;  1DGF A;  2UUA M;  3C3E A;  1C7Y A;  2HKJ A;  2EKK A;  4F1I A;  4JI2 M;  1TTE A;  3E9S A;  2DEN A;  3L2A A;  1MU5 A;  4G4O A;  2UUB M;  4OX9 M;  5ITU A;  4X65 M;  4IBG A;  5BR8 M;  4CJ6 A;  3PXG A;  1ZV1 A;  3LW5 F;  1JB0 F;  3FTD A;  3KSX A;  4IBF A;  4IBK A;  2CRU A;  3GLH A;  1JQJ C;  3K9P A;  4DBG B;  1Z5B A;  1R4G A;  2J5Y A;  2I7N A;  3M0E A;  1QUT A;  1Z6T A;  2C9O A;  3GLG E;  2G5G X;  5KPR A;  4TUW A;  2LWX A;  2VQF M;  4PDI A;  2F4V M;  1NV8 A;  3KFU G;  1N33 M;  1L2C A;  1L2D A;  3HGI A;  2ZM6 M;  4DV1 M;  4W5W A;  4L6V 6;  3GPP A;  3NWL A;  4I4L A;  4JI4 M;  1DGH A;  1ZQ9 A;  4Z6Y A;  4G4N A;  2R4E A;  3GQ3 A;  4LCB A;  2MH8 A;  4QHT A;  5E26 A;  3VK7 A;  4K0K M;  3KOY E;  4OU7 A;  1QAQ A;  3B89 A;  2LH0 A;  4FD2 A;  2ZTD A;  4JV5 M;  4PT5 A;  3FUX A;  1FJG M;  2VF7 A;  3RGP A;  4L16 A;  3KXE C;  1K3W A;  2C96 A;  3BOS A;  3I4Y A;  3C3D A;  2QEN A;  5EP1 A;  1C1K A;  4MGY E;  1JR3 E;  2R4J A;  3PVS A;  3GPX A;  4I8O A;  3U60 B;  2JWS A;  4IBC A;  4LF5 M;  5ITQ A;  4GRI A;  2FFJ A;  2KNZ A;  3AOE A;  4LFA M;  8CAT A;  4IBJ A;  1PJT A;  3KSJ A;  3RFW A;  2VDB B;  3PNY A;  3HHX A;  2K0B X;  3Q8G A;  2L6O A;  1LV7 A;  1TH2 A;  4LJ4 A;  1R5L A;  1HNX M;  1I94 M;  3JR5 A;  1FNN A;  1J7K A;  1TH4 A;  4KLN A;  3GRY A;  2XLJ A;  4LRS A;  2R6F A;  4MM3 B;  4L78 A;  1OAO C;  1IN8 A;  2LBC A;  2CV1 A;  3D8B A;  2QQ8 A;  4JI6 M;  1WGN A;  4BBA A;  3M7G A;  3E21 A;  3C58 A;  3VDP A;  3TWM A;  2X49 A;  3GLI B;  3KS8 A;  4LJ8 A;  2CP8 A;  3T1H M;  5E6J A;  2JA2 A;  1D0L A;  2M5Z A;  4FWD A;  3SYK A;  3U60 A;  2DHY A;  2J7O A;  3IEC A;  2XFT A;  4LZZ A;  1GAB A;  4AKG A;  3SAS A;  4DUY M;  3KVW A;  1KSF X;  1DGB A;  1T43 A;  2QCU A;  2WSC F;  2V1C A;  1G3I A;  2R18 A;  4OVZ A;  3JAM S;  4AZF A;  5LMU M;  3T1Y M;  4DV6 M;  4R3D A;  4ITQ A;  3FUW A;  2LTU A;  2R46 A;  1SXJ C;  2V1U A;  2B3T A;  2J7N A;  3QWL A;  2KRK A;  1VEG A;  3B9P A;  3FUU A;  3CF2 A;  3KP0 E;  4GH9 A;  2VF8 A;  4WW0 A;  2EA0 A;  2D7H A;  1P3Q Q;  4XGI A;  2JY7 A;  5DYG A;  2DWL A;  4JN6 A;  2LVO C;  3IHP A;  2HWJ A;  1G4A E;  4RF0 A;  2DKL A;  2K9D A;  1NNU C;  3U6P A;  4QNM A;  2ZBK B;  2C99 A;  1WGL A;  4NRV A;  1IFY A;  2MR9 A;  3B7N A;  4FCV A;  4IBD A;  4M0D A;  3J81 S;  3GLI A;  4LJA A;  1IBL M;  4DV2 M;  1VDD A;  1Y8G A;  1KYI A;  4B3S M;  1DO0 A;  3EIH A;  3T38 A;  3JR4 A;  3I01 M;  3GRU A;  5FTL A;  1SG9 A;  3GLF B;  4DV4 M;  1J5E M;  3LMM A;  1QDT A;  2EUC A;  1XC8 A;  4B7H A;  1V33 A;  4S12 A;  3HHZ A;  4B3M M;  4HEO A;  2CHV A;  4AG5 A;  2O01 F;  2XEP A;  5FSW A;  1OIP A;  1SXJ E;  1Q02 A;  2LVA A;  4DV3 M;  2L2D A;  2O25 A;  1NHW C;  4AI6 A;  3W0L B;  1NJG A;  2DZL A;  2KEB A;  3GO8 A;  4JI8 M;  2ERC A;  3L25 A;  1XNR M;  3J2P B;  2H1R A;  4CGY B;  4L4U A;  1LTM A;  3FKE A;  4LF9 M;  5ITX A;  1DGG A;  1DV0 A;  5EXP A;  3SHF A;  3QAU A;  2K6B A;  1IN6 A;  1OAI A;  3LCV B;  4XBO A;  3UGJ A;  2X4A A;  2XZF A;  2EO2 A;  3M6A A;  4I81 A;  1WHC A;  4FWH A;  3KP1 E;  1XHB A;  2CE7 A;  2FNA A;  3SFZ A;  1IXZ A;  3FRI A;  1A5T A;  4R7G A;  3RGS A;  2C98 A;  5C18 A;  5KQ8 A;  3LQQ A;  3B74 A;  5DFL A;  2OOA A;  1E9S A;  2FOI C;  4L15 A;  3U6O A;  4NXN M;  2I7P A;  2M60 A;  5IWA M;  3J80 S;  4GHL A;  1OJL A;  3DOA A;  3GLF A;  4GEW A;  1G8P A;  2ZAO A;  2X8A A;  3OTO M;  4B3R M;  1QZE A;  4ANR A;  2DWN A;  4LY6 A;  2L7H A;  1HT1 E;  1XXH A;  2Y0Q A;  1W5S A;  3ZCB B;  3U6D A;  2DAG A;  3U5Z A;  3UMM A;  2RRU A;  2LXE A;  3I51 A;  4YHH M;  4LFC M;  4NXM M;  4DR2 M;  1PJI A;  1VQ1 A;  2LVQ D;  2QP9 X;  3K92 A;  1RU3 A;  3TE6 A;  4D81 A;  1QAM A; 
#chains in the Genus database with same CATH homology
 3LW5 F;  1JB0 F;  4Y28 F;  2WSC F;  5L8R F;  2O01 F;  4RKU F;  4KT0 F;  2WSE F;  4XK8 F;  4L6V 6;  2WSF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...