2WSEF

Improved model of plant photosystem i
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
154
Chain Sequence
b'DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wseF00
2WSEF 4RKUF 2O01F 4KT0F 1JB0F 2WSCF 4XK8F 4Y28F 4L6V6 3LW5F 5L8RF 2WSFF
chains in the Genus database with same CATH superfamily
1NJGA 3LVVA 4LZJA 5LMNM 1HNWM 3H4JA 4NXNM 1IXSB 2OOBA 3HWSA 4CIZA 3U6PA 2M5ZA 1G3IA 2HWJA 5KPZA 2JY8A 3K8ZA 1OKSA 2L7IA 5ITYA 4NSRA 3ILKA 2H5XA 4HLQA 3U6SA 2A5YB 1E94E 2CWBA 2DI0A 2XEPA 1QQWA 3LW5F 1G59A 2UXCM 3CF6E 2KNZA 5KO3A 4OX9M 3B7ZA 1E9SA 4MGYE 5DYGA 1X37A 4LJ8A 4IBGA 2XZFA 1DGFA 3U61B 3I4YA 4KODA 4DR7M 2O01F 3KP1E 4DR4M 2ZAMA 3SBJA 2UUBM 3W67A 1IN4A 1XMOM 4D80A 5E6JA 5DYIA 4JI2M 5EXXA 3MK6A 1D0MA 2YR0A 1H6UA 4F2LA 3U5ZA 5EXPA 1TR8A 2LVQD 3M6AA 4AKGA 3J27B 3L29A 4I81A 2QPAA 1IY0A 2KZUA 4LF4M 4MGKE 1XNQM 1TF0B 3IG8A 1Z5AA 3FYDA 4HEOA 2FE8A 2JP7A 2OO9A 3DZDA 4DR1M 1I94M 1J09A 2L4FA 1L2CA 3SC3A 4REZA 4BB9A 4OU7A 2BNKA 3WHKA 2F5PA 2R45A 2YFQA 3GP1A 3L2AA 4JI4M 4IBEA 1SXJE 4G4RA 4MM3B 2C9CA 3HHXA 3U6CA 2ZM6M 2KDLA 1KYIA 2K47A 4IJFA 3SHFA 3U5ZB 4B7GA 2I7NA 1ZV1A 4BBAA 3LCVB 4LJ7A 3GPXA 2MGWA 2DKLA 2VQEM 2VDBB 3HX3A 1XB2B 3B9PA 4DV1M 1FJGM 1QAMA 1K3XA 2MJ5B 5EXTA 1YUBA 2BWBA 2CUZA 3GLIA 3WHLA 4GC9A 4X66M 3W0FA 4BLCA 4M0DA 2LH0A 1NY6A 2YNMD 3AOEA 1SXJC 4ZPXA 3U60A 1PM5A 3T1YM 4ANRA 2DWNA 1XWIA 4JI5M 1IXRC 4QNRA 4CISA 2FH0A 4JN6A 4IIWA 3HHWA 2Z8YM 2I7PA 3KSJA 3M7GA 2KEBA 2DAKA 2Z7JA 4G6ZA 1NO1A 1XXHE 2DAMA 3IECA 4NC6A 3ZH9B 5IT9S 3HU2A 4OVZB 5KQ8A 3U6DA 2XGNA 1QANA 4QHTA 2J7NA 4S12A 2OPFA 1JR3A 3VKHA 4A3VB 4D81A 1QDTA 3H4MA 3HKPA 4JXJA 2HAKA 2JY6B 3GLGA 1PJQA 4LZZA 1SXJD 2WSCF 2DZOB 2CHGA 3HJQA 1VEGA 4R71A 1OJLA 3A46A 5IREB 1D0LA 1NHWC 2UXBM 1G8PA 2EA0A 3A45A 3U6OA 3NBIA 4G4QA 1VEJA 1N33M 5A2QS 1SXJB 1WGLA 3GRUA 2DVWB 2DXIA 1PGYA 1HQYE 3HJ8A 1HR0M 1UM8A 4Z8XA 3VDPA 2KZSA 4CHTB 1J5EM 1EIJA 2F5NA 3KOWE 4B08A 8CATA 2LBCA 1NSFA 2QNJA 3DA1A 4WURA 3BXWA 1GJSA 1DO2A 2RRUA 2XSZA 3D8BA 2EJSA 3FKEA 4LJAA 3SYLA 4AW4A 4AQYM 3U6MA 1L1TA 2HKJA 4YHHM 3PNVA 4MH0E 1IXSA 3A42A 3TPZA 3AKZA 4QOZC 3K9PA 2Y20A 3MMPA 1MJGM 1T43A 2KA6B 4AKHA 4GC5A 2LHCA 2C5RA 3AFHA 3KS4A 3FD9A 4LJ9A 3C58A 3ZCBB 3AV0A 1Q3BA 1XXHB 3SHGB 2F4VM 3SATA 3U6QA 3EIHA 2FOIC 2L2DA 2F5SA 4LFBM 1DGGA 1XMQM 3TE6A 1N36M 2DWMA 1C1KA 2K0BX 1GVNA 2VF8A 2K9DA 3FE3A 4FW9A 1QVRA 2DAGA 3U61A 5ITTA 1LTMA 3LMMA 1T6OA 5FTNA 4AG5A 1XC8A 4JV5M 1Y8GA 4GEWA 1JQJC 1C7YA 4FCWA 4WW0A 1VDLA 3C3EA 3IG5A 4DV7M 4XBOA 3VK8A 1S3SA 2CHVA 4M0WA 2UUAM 4LFAM 2UUCM 3L25A 3QYBA 2XF3A 3KP0E 4GMQA 2CV0A 2R65A 1PRBA 1GJTA 1CUKA 3KXEC 1N32M 2VIIA 1NY5A 4RKUF 2C96A 4QHSA 5FSWA 3TWKA 1WIVA 4G4NA 2P5TA 3GLHE 2J7OA 3K2LA 3QWLA 4M9SA 4Q7JA 2CP8A 1Q3CA 4JI3M 1ZMVA 2VF7A 1SG9A 3UGJA 4IBDA 3FUTA 3RGSA 5DNYA 3FTEA 1EE8A 4QNMA 5KPTA 2CV2A 1QZMA 3FUWA 1WGNA 2DAEA 4IBIA 4LF5M 3BOSA 2XZUA 4B7HA 1NVMA 1R5LA 4L15A 3PFIA 4IBBA 3ZQJA 3JAMS 2O5RA 3HJSA 1MN3A 2LXEA 3VDUA 2XFSA 4LG2A 2DNAA 3GRRA 5C18A 4M9XA 1MX0A 4I8OA 4X64M 2Z3XA 5E26A 1OFIA 2LVOC 1UFZA 3T1HM 2L4EA 1IM2A 5JI2E 1WXQA 3BBZA 2CFOA 3CGWA 3FRIA 2LTUA 5ITXE 5EP2A 2R44A 4LJ4A 2UU9M 2X8AA 4DUYM 3UZUA 4LRTA 4LCBA 1QAQA 3HU3A 4PD2A 2V6ZM 3DFZA 2QP9X 1OFHA 4NSOB 5IZ7D 4GKKM 1K3WA 2DHYA 3FYCA 4OVZA 2K6BA 3R9XB 3GQ5A 4DV3M 4JI6M 2C99A 4JI7M 1E9RA 1QYRA 1P3QQ 2DENA 3KSXA 1GL6A 3GLFE 4KO8A 1DGBA 4L16A 2C9OA 2L09A 1K82A 2F5OA 1EFUB 2CRUA 3L27A 4Y28F 4X62M 2MR9A 4L6V6 2DZLA 2NQ8C 3LQRA 2G8LA 1TDZA 2RKOA 1GABA 3ZC7B 4B3TM 5GKNA 1SXJA 3GLHB 3KDSE 1VQ1A 3CTWB 1R2YA 3FTFA 2Y21A 2Y0QA 3FUXA 2LVAA 4G3OA 1I4WA 1E32A 3THGA 4FVMA 1WR1B 4CGYB 4PDGA 3AOGA 3SASA 2FFJA 3NWLA 3T38A 3K1JA 5ITQA 4MGIE 3JR4A 1L1ZA 2EO2A 4WP2A 1ZMWA 4DV5M 3E46A 3NBXX 3J2PB 4OW0A 2V1CA 4FCVA 1OTRA 1ORYB 1TTEA 5IWAM 2H1RA 2R18A 2ZAOA 4LF7M 1BVSA 4PT5A 3K92A 3LQQA 2ZTDA 3J7BA 4IJEA 1ZQ9A 2QZ4A 1NV9A 5BR8M 2LHGA 2G5GX 3FUUA 5FTLA 3T15A 2D7GA 2QCUA 2R46A 2Y0TA 2RGHA 3A98B 4AG6A 4LF6M 1V34A 1TH2A 3RE8A 2C98A 2G3QA 4FWDA 4LF9M 1DV0A 2BWEA 1YSYA 1XXHA 2Z4SA 3B89A 4JI0M 1HJPA 3TWLA 3CF2A 1WHCA 1A5TA 1IY2A 4I4LA 2B3TA 2ZTCA 4P16A 4DV2M 4L8RC 5FTMA 2QSFX 3GLFB 2R62A 1QZEA 4MB7A 2GNOA 4RF0A 3GRVA 2DHRA 3F92A 1HQCA 2D7EA 2X49A 3HY5A 4DV0M 2J5YA 1D2NA 2QENA 4XGIA 1VEKA 3QYEA 2LVPC 1N75A 2M60A 1TH4A 4I5SA 4M9ZA 2E5LM 2R4JA 1NHGC 2RGOA 2KRUA 2JZ0A 4KLNA 2KXEA 4ITQA 3T6PA 4Z6YA 1HNZM 3AL0C 1N77A 3SAWA 2JZ1A 1QDRA 3PXGA 7CATA 2KRKA 5H37D 2CV1A 1QUTA 4AI6A 2Q2EB 2CE7A 2L7HA 5EP4A 5LMUM 1F4IA 4AKIA 1R4GA 2EUCA 1W5TA 3GQ4A 5EXSA 1NNUC 2QQ8A 1AIPC 3SFZA 2QBYB 4NXMM 3KS8A 3FTDA 4NRWA 4NL4H 2LWXA 1YLAA 1KFVA 2GQFA 2DAIA 4KHPM 3B7QA 4FD2A 5EJCA 2KHHA 4DR5M 3VFDA 3KOYE 4R7GA 4F1IA 1Z5BA 5L8RF 4LFCM 2O25A 4EIWA 1IBMM 3SAUA 3E9SA 4GITA 2JY7A 3DOAA 3FTCA 3L26A 1XHBA 3KOXE 4DV6M 4B7FA 4XK8F 1HT1E 3Q8GA 4GH9A 5JI3E 2BJVA 3VLFB 4D82A 2APLA 3B7NA 5EQTA 2X4AA 3W68A 4DV4M 3J81S 1IN8A 4GRIA 1OIZA 3J7AS 2ZANA 3I4VA 5C1BA 1T3TA 2JA2A 1PJTA 3OTOM 1J7KA 1N34M 3GRYA 5DFLA 3EIEA 1N78A 1NJFA 1NV8A 3I01M 2JUJA 4KT0F 4LY6A 1JB0F 2FS1A 3GO8A 3GLHA 1L2DA 1IN7A 3C3DA 2OQ4A 1R2ZA 2JY5A 3UK6A 3HU1A 2WSEF 3GLIE 3SARA 1Q02A 1IBKM 2OOAA 1G4AE 3CF0A 2WZJA 3FUVA 5EP3A 1GKIA 2CHQA 1PJIA 4B3MM 4MGZE 4R3DA 1GO5A 1G71A 1TGUA 1ZMUA 1Z6TA 2AHMA 2KNVA 1MU5A 1HT2E 4JI1M 4GKJM 1JR3E 2JWSA 1W5SA 5ITXA 3PNYA 1L2BA 2EKFA 2KNAA 2R4EA 3GLGE 4DBGB 3V76A 1IQPA 2QHOB 3U6EA 2XH9A 3GPPA 2WSFF 1IFYA 1V33A 2HCBA 3AOEC 4FCTA 4NRVA 4QOSA 5BPVA 1Q39A 3PVSA 4DR3M 3HHYA 5KQDA 1TDHA 4L4UA 4B3RM 1WJ7A 2HL7A 4B3SM 5FTKA 3L28A 5ITRA 3UMMA 3SYKA 1R6BX 2LVNC 4IBFA 3GLFA 4DUZM 3JR5A 3KFUG 5FLXS 1IXZA 1ZAEA 3RGPA 2N35A 2LNHC 4CJ6A 5F3WA 1HNXM 2HHHM 3TL4X 4K0KM 2XLJA 2DWZB 4X65M 2VQFM 3UJNA 1PJJA 4GIPA 4TUWA 4JYAM 3HHZA 2JXNA 2W82A 2BJWA 3MHVC 1TH3A 3GQ3A 5EP1A 3GLIB 4LRSA 1DGHA 2DZNB 3I51A 1RU3A 2EKKA 3K9OA 3IHPA 1JR3D 3AJIB 4DR6M 1IY1A 4IBKA 4LF8M 3U60B 3W0LB 4GHAA 1L8QA 3KOZE 2MROB 3HGIA 2Z4RA 1IN5A 3R8FA 2R6FA 2ERCA 3VKGA 3D8LA 2FNAA 3M0EA 1VDDA 2KW0A 3HZJA 4G4OA 1OQYA 3VK7A 1NNJA 4RNAA 2CEAA 1XNRM 4LJ5A 4II7A 3QAUA 1R7RA 4LGYA 1KSFX 4GHLA 3SMSA 4PCZA 1LV7A 1QAOA 1QUSA 1AUAA 1Z59A 4L78A 4YY3M 3GLGB 2QBYA 4FWGA 3I04M 3GPUA 3RFWA 3SAVA 1IN6A 5ITUA 1DGHB 1OIPA 5FTJA 3KVWA 3GPYA 5KPRA 1D0KA 1IBLM 3TQSA 2L6OA 3E4RA 3LCUA 3LVWA 2MH8A 4LGMA 4NOOB 2UXDM 3Q8XA 1V92A 4W5WA 4HL4A 3MJ5A 1G41A 4MGHA 3SMPA 3FRHA 1DO0A 1VG5A 2YQZA 4FWHA 4P17A 1GLNA 2V1UA 2XSZD 2R0IA 4UN2B 3KW6A 2D7HA 1Z5CA 1OAIA 2XFTA 3B74A 4RF1A 1YE9A 3C9PA 4LJ6A 4DR2M 1OAOC 4AZFA 2DWLA 4PDIA 2F5QA 4IBCA 4IBJA 3J80S 1GL7A 2JNHA 1PJSA 2ZBKB 3E21A 4JI8M 1FNNA 3U6LA 3TWMA
chains in the Genus database with same CATH topology
2WSEF 4RKUF 2O01F 4KT0F 1JB0F 2WSCF 4XK8F 4Y28F 4L6V6 3LW5F 5L8RF 2WSFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE F;  4RKU F;  2O01 F;  4KT0 F;  1JB0 F;  2WSC F;  4XK8 F;  4Y28 F;  4L6V 6;  3LW5 F;  5L8R F;  2WSF F; 
#chains in the Genus database with same CATH topology
 1NJG A;  3LVV A;  4LZJ A;  5LMN M;  1HNW M;  3H4J A;  4NXN M;  1IXS B;  2OOB A;  3HWS A;  4CIZ A;  3U6P A;  2M5Z A;  1G3I A;  2HWJ A;  5KPZ A;  2JY8 A;  3K8Z A;  1OKS A;  2L7I A;  5ITY A;  4NSR A;  3ILK A;  2H5X A;  4HLQ A;  3U6S A;  2A5Y B;  1E94 E;  2CWB A;  2DI0 A;  2XEP A;  1QQW A;  3LW5 F;  1G59 A;  2UXC M;  3CF6 E;  2KNZ A;  5KO3 A;  4OX9 M;  3B7Z A;  1E9S A;  4MGY E;  5DYG A;  1X37 A;  4LJ8 A;  4IBG A;  2XZF A;  1DGF A;  3U61 B;  3I4Y A;  4KOD A;  4DR7 M;  2O01 F;  3KP1 E;  4DR4 M;  2ZAM A;  3SBJ A;  2UUB M;  3W67 A;  1IN4 A;  1XMO M;  4D80 A;  5E6J A;  5DYI A;  4JI2 M;  5EXX A;  3MK6 A;  1D0M A;  2YR0 A;  1H6U A;  4F2L A;  3U5Z A;  5EXP A;  1TR8 A;  2LVQ D;  3M6A A;  4AKG A;  3J27 B;  3L29 A;  4I81 A;  2QPA A;  1IY0 A;  2KZU A;  4LF4 M;  4MGK E;  1XNQ M;  1TF0 B;  3IG8 A;  1Z5A A;  3FYD A;  4HEO A;  2FE8 A;  2JP7 A;  2OO9 A;  3DZD A;  4DR1 M;  1I94 M;  1J09 A;  2L4F A;  1L2C A;  3SC3 A;  4REZ A;  4BB9 A;  4OU7 A;  2BNK A;  3WHK A;  2F5P A;  2R45 A;  2YFQ A;  3GP1 A;  3L2A A;  4JI4 M;  4IBE A;  1SXJ E;  4G4R A;  4MM3 B;  2C9C A;  3HHX A;  3U6C A;  2ZM6 M;  2KDL A;  1KYI A;  2K47 A;  4IJF A;  3SHF A;  3U5Z B;  4B7G A;  2I7N A;  1ZV1 A;  4BBA A;  3LCV B;  4LJ7 A;  3GPX A;  2MGW A;  2DKL A;  2VQE M;  2VDB B;  3HX3 A;  1XB2 B;  3B9P A;  4DV1 M;  1FJG M;  1QAM A;  1K3X A;  2MJ5 B;  5EXT A;  1YUB A;  2BWB A;  2CUZ A;  3GLI A;  3WHL A;  4GC9 A;  4X66 M;  3W0F A;  4BLC A;  4M0D A;  2LH0 A;  1NY6 A;  2YNM D;  3AOE A;  1SXJ C;  4ZPX A;  3U60 A;  1PM5 A;  3T1Y M;  4ANR A;  2DWN A;  1XWI A;  4JI5 M;  1IXR C;  4QNR A;  4CIS A;  2FH0 A;  4JN6 A;  4IIW A;  3HHW A;  2Z8Y M;  2I7P A;  3KSJ A;  3M7G A;  2KEB A;  2DAK A;  2Z7J A;  4G6Z A;  1NO1 A;  1XXH E;  2DAM A;  3IEC A;  4NC6 A;  3ZH9 B;  5IT9 S;  3HU2 A;  4OVZ B;  5KQ8 A;  3U6D A;  2XGN A;  1QAN A;  4QHT A;  2J7N A;  4S12 A;  2OPF A;  1JR3 A;  3VKH A;  4A3V B;  4D81 A;  1QDT A;  3H4M A;  3HKP A;  4JXJ A;  2HAK A;  2JY6 B;  3GLG A;  1PJQ A;  4LZZ A;  1SXJ D;  2WSC F;  2DZO B;  2CHG A;  3HJQ A;  1VEG A;  4R71 A;  1OJL A;  3A46 A;  5IRE B;  1D0L A;  1NHW C;  2UXB M;  1G8P A;  2EA0 A;  3A45 A;  3U6O A;  3NBI A;  4G4Q A;  1VEJ A;  1N33 M;  5A2Q S;  1SXJ B;  1WGL A;  3GRU A;  2DVW B;  2DXI A;  1PGY A;  1HQY E;  3HJ8 A;  1HR0 M;  1UM8 A;  4Z8X A;  3VDP A;  2KZS A;  4CHT B;  1J5E M;  1EIJ A;  2F5N A;  3KOW E;  4B08 A;  8CAT A;  2LBC A;  1NSF A;  2QNJ A;  3DA1 A;  4WUR A;  3BXW A;  1GJS A;  1DO2 A;  2RRU A;  2XSZ A;  3D8B A;  2EJS A;  3FKE A;  4LJA A;  3SYL A;  4AW4 A;  4AQY M;  3U6M A;  1L1T A;  2HKJ A;  4YHH M;  3PNV A;  4MH0 E;  1IXS A;  3A42 A;  3TPZ A;  3AKZ A;  4QOZ C;  3K9P A;  2Y20 A;  3MMP A;  1MJG M;  1T43 A;  2KA6 B;  4AKH A;  4GC5 A;  2LHC A;  2C5R A;  3AFH A;  3KS4 A;  3FD9 A;  4LJ9 A;  3C58 A;  3ZCB B;  3AV0 A;  1Q3B A;  1XXH B;  3SHG B;  2F4V M;  3SAT A;  3U6Q A;  3EIH A;  2FOI C;  2L2D A;  2F5S A;  4LFB M;  1DGG A;  1XMQ M;  3TE6 A;  1N36 M;  2DWM A;  1C1K A;  2K0B X;  1GVN A;  2VF8 A;  2K9D A;  3FE3 A;  4FW9 A;  1QVR A;  2DAG A;  3U61 A;  5ITT A;  1LTM A;  3LMM A;  1T6O A;  5FTN A;  4AG5 A;  1XC8 A;  4JV5 M;  1Y8G A;  4GEW A;  1JQJ C;  1C7Y A;  4FCW A;  4WW0 A;  1VDL A;  3C3E A;  3IG5 A;  4DV7 M;  4XBO A;  3VK8 A;  1S3S A;  2CHV A;  4M0W A;  2UUA M;  4LFA M;  2UUC M;  3L25 A;  3QYB A;  2XF3 A;  3KP0 E;  4GMQ A;  2CV0 A;  2R65 A;  1PRB A;  1GJT A;  1CUK A;  3KXE C;  1N32 M;  2VII A;  1NY5 A;  4RKU F;  2C96 A;  4QHS A;  5FSW A;  3TWK A;  1WIV A;  4G4N A;  2P5T A;  3GLH E;  2J7O A;  3K2L A;  3QWL A;  4M9S A;  4Q7J A;  2CP8 A;  1Q3C A;  4JI3 M;  1ZMV A;  2VF7 A;  1SG9 A;  3UGJ A;  4IBD A;  3FUT A;  3RGS A;  5DNY A;  3FTE A;  1EE8 A;  4QNM A;  5KPT A;  2CV2 A;  1QZM A;  3FUW A;  1WGN A;  2DAE A;  4IBI A;  4LF5 M;  3BOS A;  2XZU A;  4B7H A;  1NVM A;  1R5L A;  4L15 A;  3PFI A;  4IBB A;  3ZQJ A;  3JAM S;  2O5R A;  3HJS A;  1MN3 A;  2LXE A;  3VDU A;  2XFS A;  4LG2 A;  2DNA A;  3GRR A;  5C18 A;  4M9X A;  1MX0 A;  4I8O A;  4X64 M;  2Z3X A;  5E26 A;  1OFI A;  2LVO C;  1UFZ A;  3T1H M;  2L4E A;  1IM2 A;  5JI2 E;  1WXQ A;  3BBZ A;  2CFO A;  3CGW A;  3FRI A;  2LTU A;  5ITX E;  5EP2 A;  2R44 A;  4LJ4 A;  2UU9 M;  2X8A A;  4DUY M;  3UZU A;  4LRT A;  4LCB A;  1QAQ A;  3HU3 A;  4PD2 A;  2V6Z M;  3DFZ A;  2QP9 X;  1OFH A;  4NSO B;  5IZ7 D;  4GKK M;  1K3W A;  2DHY A;  3FYC A;  4OVZ A;  2K6B A;  3R9X B;  3GQ5 A;  4DV3 M;  4JI6 M;  2C99 A;  4JI7 M;  1E9R A;  1QYR A;  1P3Q Q;  2DEN A;  3KSX A;  1GL6 A;  3GLF E;  4KO8 A;  1DGB A;  4L16 A;  2C9O A;  2L09 A;  1K82 A;  2F5O A;  1EFU B;  2CRU A;  3L27 A;  4Y28 F;  4X62 M;  2MR9 A;  4L6V 6;  2DZL A;  2NQ8 C;  3LQR A;  2G8L A;  1TDZ A;  2RKO A;  1GAB A;  3ZC7 B;  4B3T M;  5GKN A;  1SXJ A;  3GLH B;  3KDS E;  1VQ1 A;  3CTW B;  1R2Y A;  3FTF A;  2Y21 A;  2Y0Q A;  3FUX A;  2LVA A;  4G3O A;  1I4W A;  1E32 A;  3THG A;  4FVM A;  1WR1 B;  4CGY B;  4PDG A;  3AOG A;  3SAS A;  2FFJ A;  3NWL A;  3T38 A;  3K1J A;  5ITQ A;  4MGI E;  3JR4 A;  1L1Z A;  2EO2 A;  4WP2 A;  1ZMW A;  4DV5 M;  3E46 A;  3NBX X;  3J2P B;  4OW0 A;  2V1C A;  4FCV A;  1OTR A;  1ORY B;  1TTE A;  5IWA M;  2H1R A;  2R18 A;  2ZAO A;  4LF7 M;  1BVS A;  4PT5 A;  3K92 A;  3LQQ A;  2ZTD A;  3J7B A;  4IJE A;  1ZQ9 A;  2QZ4 A;  1NV9 A;  5BR8 M;  2LHG A;  2G5G X;  3FUU A;  5FTL A;  3T15 A;  2D7G A;  2QCU A;  2R46 A;  2Y0T A;  2RGH A;  3A98 B;  4AG6 A;  4LF6 M;  1V34 A;  1TH2 A;  3RE8 A;  2C98 A;  2G3Q A;  4FWD A;  4LF9 M;  1DV0 A;  2BWE A;  1YSY A;  1XXH A;  2Z4S A;  3B89 A;  4JI0 M;  1HJP A;  3TWL A;  3CF2 A;  1WHC A;  1A5T A;  1IY2 A;  4I4L A;  2B3T A;  2ZTC A;  4P16 A;  4DV2 M;  4L8R C;  5FTM A;  2QSF X;  3GLF B;  2R62 A;  1QZE A;  4MB7 A;  2GNO A;  4RF0 A;  3GRV A;  2DHR A;  3F92 A;  1HQC A;  2D7E A;  2X49 A;  3HY5 A;  4DV0 M;  2J5Y A;  1D2N A;  2QEN A;  4XGI A;  1VEK A;  3QYE A;  2LVP C;  1N75 A;  2M60 A;  1TH4 A;  4I5S A;  4M9Z A;  2E5L M;  2R4J A;  1NHG C;  2RGO A;  2KRU A;  2JZ0 A;  4KLN A;  2KXE A;  4ITQ A;  3T6P A;  4Z6Y A;  1HNZ M;  3AL0 C;  1N77 A;  3SAW A;  2JZ1 A;  1QDR A;  3PXG A;  7CAT A;  2KRK A;  5H37 D;  2CV1 A;  1QUT A;  4AI6 A;  2Q2E B;  2CE7 A;  2L7H A;  5EP4 A;  5LMU M;  1F4I A;  4AKI A;  1R4G A;  2EUC A;  1W5T A;  3GQ4 A;  5EXS A;  1NNU C;  2QQ8 A;  1AIP C;  3SFZ A;  2QBY B;  4NXM M;  3KS8 A;  3FTD A;  4NRW A;  4NL4 H;  2LWX A;  1YLA A;  1KFV A;  2GQF A;  2DAI A;  4KHP M;  3B7Q A;  4FD2 A;  5EJC A;  2KHH A;  4DR5 M;  3VFD A;  3KOY E;  4R7G A;  4F1I A;  1Z5B A;  5L8R F;  4LFC M;  2O25 A;  4EIW A;  1IBM M;  3SAU A;  3E9S A;  4GIT A;  2JY7 A;  3DOA A;  3FTC A;  3L26 A;  1XHB A;  3KOX E;  4DV6 M;  4B7F A;  4XK8 F;  1HT1 E;  3Q8G A;  4GH9 A;  5JI3 E;  2BJV A;  3VLF B;  4D82 A;  2APL A;  3B7N A;  5EQT A;  2X4A A;  3W68 A;  4DV4 M;  3J81 S;  1IN8 A;  4GRI A;  1OIZ A;  3J7A S;  2ZAN A;  3I4V A;  5C1B A;  1T3T A;  2JA2 A;  1PJT A;  3OTO M;  1J7K A;  1N34 M;  3GRY A;  5DFL A;  3EIE A;  1N78 A;  1NJF A;  1NV8 A;  3I01 M;  2JUJ A;  4KT0 F;  4LY6 A;  1JB0 F;  2FS1 A;  3GO8 A;  3GLH A;  1L2D A;  1IN7 A;  3C3D A;  2OQ4 A;  1R2Z A;  2JY5 A;  3UK6 A;  3HU1 A;  2WSE F;  3GLI E;  3SAR A;  1Q02 A;  1IBK M;  2OOA A;  1G4A E;  3CF0 A;  2WZJ A;  3FUV A;  5EP3 A;  1GKI A;  2CHQ A;  1PJI A;  4B3M M;  4MGZ E;  4R3D A;  1GO5 A;  1G71 A;  1TGU A;  1ZMU A;  1Z6T A;  2AHM A;  2KNV A;  1MU5 A;  1HT2 E;  4JI1 M;  4GKJ M;  1JR3 E;  2JWS A;  1W5S A;  5ITX A;  3PNY A;  1L2B A;  2EKF A;  2KNA A;  2R4E A;  3GLG E;  4DBG B;  3V76 A;  1IQP A;  2QHO B;  3U6E A;  2XH9 A;  3GPP A;  2WSF F;  1IFY A;  1V33 A;  2HCB A;  3AOE C;  4FCT A;  4NRV A;  4QOS A;  5BPV A;  1Q39 A;  3PVS A;  4DR3 M;  3HHY A;  5KQD A;  1TDH A;  4L4U A;  4B3R M;  1WJ7 A;  2HL7 A;  4B3S M;  5FTK A;  3L28 A;  5ITR A;  3UMM A;  3SYK A;  1R6B X;  2LVN C;  4IBF A;  3GLF A;  4DUZ M;  3JR5 A;  3KFU G;  5FLX S;  1IXZ A;  1ZAE A;  3RGP A;  2N35 A;  2LNH C;  4CJ6 A;  5F3W A;  1HNX M;  2HHH M;  3TL4 X;  4K0K M;  2XLJ A;  2DWZ B;  4X65 M;  2VQF M;  3UJN A;  1PJJ A;  4GIP A;  4TUW A;  4JYA M;  3HHZ A;  2JXN A;  2W82 A;  2BJW A;  3MHV C;  1TH3 A;  3GQ3 A;  5EP1 A;  3GLI B;  4LRS A;  1DGH A;  2DZN B;  3I51 A;  1RU3 A;  2EKK A;  3K9O A;  3IHP A;  1JR3 D;  3AJI B;  4DR6 M;  1IY1 A;  4IBK A;  4LF8 M;  3U60 B;  3W0L B;  4GHA A;  1L8Q A;  3KOZ E;  2MRO B;  3HGI A;  2Z4R A;  1IN5 A;  3R8F A;  2R6F A;  2ERC A;  3VKG A;  3D8L A;  2FNA A;  3M0E A;  1VDD A;  2KW0 A;  3HZJ A;  4G4O A;  1OQY A;  3VK7 A;  1NNJ A;  4RNA A;  2CEA A;  1XNR M;  4LJ5 A;  4II7 A;  3QAU A;  1R7R A;  4LGY A;  1KSF X;  4GHL A;  3SMS A;  4PCZ A;  1LV7 A;  1QAO A;  1QUS A;  1AUA A;  1Z59 A;  4L78 A;  4YY3 M;  3GLG B;  2QBY A;  4FWG A;  3I04 M;  3GPU A;  3RFW A;  3SAV A;  1IN6 A;  5ITU A;  1DGH B;  1OIP A;  5FTJ A;  3KVW A;  3GPY A;  5KPR A;  1D0K A;  1IBL M;  3TQS A;  2L6O A;  3E4R A;  3LCU A;  3LVW A;  2MH8 A;  4LGM A;  4NOO B;  2UXD M;  3Q8X A;  1V92 A;  4W5W A;  4HL4 A;  3MJ5 A;  1G41 A;  4MGH A;  3SMP A;  3FRH A;  1DO0 A;  1VG5 A;  2YQZ A;  4FWH A;  4P17 A;  1GLN A;  2V1U A;  2XSZ D;  2R0I A;  4UN2 B;  3KW6 A;  2D7H A;  1Z5C A;  1OAI A;  2XFT A;  3B74 A;  4RF1 A;  1YE9 A;  3C9P A;  4LJ6 A;  4DR2 M;  1OAO C;  4AZF A;  2DWL A;  4PDI A;  2F5Q A;  4IBC A;  4IBJ A;  3J80 S;  1GL7 A;  2JNH A;  1PJS A;  2ZBK B;  3E21 A;  4JI8 M;  1FNN A;  3U6L A;  3TWM A; 
#chains in the Genus database with same CATH homology
 2WSE F;  4RKU F;  2O01 F;  4KT0 F;  1JB0 F;  2WSC F;  4XK8 F;  4Y28 F;  4L6V 6;  3LW5 F;  5L8R F;  2WSF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...