3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RcdA
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
2RRUA 2Y20A 4LG2A 2JP7A 2UXCM 3WHLA 2Y0TA 1PJJA 4D80A 4DV4M 3VK7A 4NXMM 5ITXA 2KA6B 4JXJA 4FCVA 3GLIB 2KZUA 1L2DA 2XLJA 3KS4A 1IXRC 3C3DA 2FH0A 1RU3A 1R4GA 2GNOA 1WJ7A 2KHHA 1MN3A 3FE3A 1OQYA 3PFIA 4CJ6A 4LJ7A 1Z5CA 5ITXE 4G4QA 3J7AS 1V33A 2QSFX 4PT5A 2KNZA 2WSCF 3J27B 2XGNA 1ZQ9A 4MGKE 3KSXA 2C9OA 3K1JA 1YE9A 1IM2A 4M9ZA 1R6BX 2O25A 2QENA 1WGNA 3J81S 4DR3M 1C7YA 1GLNA 1ZV1A 3CF0A 2LVAA 1GKIA 2EKKA 3HGIA 1ZMUA 5FTLA 3GQ4A 4CIZA 4M0WA 1EIJA 3U6SA 2KXEA 2CUZA 2WSFF 3AOEA 1H6UA 2L4FA 3B74A 1G8PA 4NRWA 1N36M 2KW0A 1JR3A 2OQ4A 4LF6M 2JY6B 4FWHA 3LVWA 2L7HA 5EP1A 4IBCA 3LQQA 1BVSA 2XFTA 3I51A 4ZPXA 1JR3E 3TE6A 1XMQM 1QQWA 2CV2A 4DV3M 2DAEA 2CV0A 2NQ8C 4UN2B 4JI2M 1J09A 1NY5A 2RGOA 4HEOA 3KOYE 4G4RA 1PJIA 1HT2E 4JI8M 2QCUA 2V6ZM 4G3OA 2OO9A 3KOWE 4G6ZA 2JZ1A 4BBAA 4DR6M 1Q39A 3KS8A 1QDTA 3IG8A 3PNYA 2F5SA 4FW9A 5KQDA 2M5ZA 3B7ZA 2ZAMA 3EIEA 2EA0A 2R6FA 1DO0A 2LTUA 1WIVA 3L29A 2QQ8A 3TL4X 3DZDA 5EJCA 2DAMA 2XZFA 2JA2A 3IECA 3AV0A 3L2AA 3SAUA 4HL4A 1G41A 5EQTA 2LNHC 3GRVA 1C1KA 2HKJA 4OX9M 4B3RM 2R45A 3I01M 3I04M 5L8RF 3FUUA 1QDRA 4AW4A 5FTNA 3R8FA 1GABA 5JI3E 4MGYE 2JY7A 2LVQD 3FUTA 3KOZE 3FTFA 3DFZA 2L09A 4Q7JA 4JI4M 3ZC7B 1IQPA 3RE8A 4EIWA 3HHWA 2ZANA 4L78A 3FTDA 2HL7A 4NOOB 2DHYA 2Q2EB 4GC5A 4B7HA 3E21A 1DGHA 4BLCA 1HNWM 3L28A 4R7GA 4AG5A 4S12A 2K6BA 1XMOM 2JWSA 2R0IA 3QWLA 5DNYA 1E9RA 3SBJA 4M9XA 4OVZA 3SHGB 3GLFA 3U6OA 4LJ5A 7CATA 2Z7JA 1X37A 3TPZA 3QYBA 2MGWA 4YY3M 2EO2A 2FNAA 4LY6A 1ZMVA 3GLFE 1LV7A 3VDPA 1T43A 1A5TA 1HJPA 4OW0A 5A2QS 3KP1E 4JI0M 3GQ3A 2CHQA 4AG6A 2OPFA 3GQ5A 2Z4SA 1R2ZA 2KZSA 3JR5A 1Q02A 1QANA 1NJGA 1XWIA 2D7EA 2KNAA 1NHGC 4DV0M 1R7RA 3M7GA 5EXTA 5LMNM 4X66M 3KOXE 1HT1E 1IY1A 4MGIE 1IN4A 2JY8A 3SHFA 3GLHA 4GMQA 2VF8A 3GPUA 2Y21A 4I8OA 1GO5A 4DV2M 3RFWA 1OAOC 4LJAA 4NSOB 3GLHE 1AIPC 3HJQA 1KFVA 2F5PA 2ZM6M 2D7HA 4L6V6 3GLGA 3FRHA 3W68A 4DR5M 1V92A 4LF5M 5E26A 2LH0A 4RF1A 1IBMM 4GITA 4L16A 1MX0A 3W0FA 2QHOB 4GKKM 3GLGE 4QOSA 2BWEA 5ITRA 2DWMA 1WHCA 1IFYA 2RKOA 1SG9A 3GRYA 2CHGA 4ANRA 4QHSA 5EXPA 3PXGA 2FFJA 4DV6M 3GP1A 3JAMS 2ERCA 3AFHA 4LF8M 2VIIA 1VG5A 2F5NA 3VK8A 4JI6M 1S3SA 4LRTA 5H37D 3H4MA 2C98A 3U61A 2ZBKB 2LVNC 3J7BA 3NBXX 2C99A 3SMSA 1SXJD 2N35A 4CGYB 2UU9M 2L4EA 1HNXM 3L27A 4AZFA 3U6DA 3U6PA 3GPPA 1NO1A 1IBKM 1N33M 2O5RA 1PRBA 3KFUG 4WP2A 4P16A 1VEJA 4B3MM 2XH9A 2D7GA 3FKEA 1J7KA 4L4UA 3C9PA 4L8RC 4TUWA 3T1HM 1Z5BA 2VF7A 3OTOM 3E4RA 2UUCM 4HLQA 1TH4A 1N75A 1P3QQ 3UJNA 2Z3XA 4LZJA 4B3TM 2MJ5B 2OOBA 2XFSA 4PCZA 2YFQA 4LZZA 5LMUM 2JXNA 1D0KA 3TWMA 5FSWA 1N34M 1Z6TA 2O01F 2QPAA 2HHHM 3VKHA 1OKSA 4JN6A 4NSRA 3SYKA 4I81A 1Q3BA 3HU1A 3FUXA 3T38A 4JI7M 4PDIA 1T6OA 4CISA 1YLAA 1IN6A 4RNAA 4R3DA 4X65M 2WSEF 1OAIA 2GQFA 1Q3CA 2K47A 4KLNA 2R62A 4LFCM 2J5YA 2YQZA 2C96A 1UM8A 1YSYA 2LBCA 4QHTA 4B3SM 1K82A 3RGPA 1ZAEA 3U60A 2Z4RA 3MK6A 4GHAA 3FUVA 2QBYA 4GH9A 3VLFB 1WXQA 2DAIA 1QUTA 1QZEA 5EP2A 4B7GA 5FTKA 3T1YM 4MGZE 2BJVA 2CHVA 3SATA 1SXJC 4Z8XA 4RF0A 2R46A 2L6OA 1QYRA 3HWSA 4LRSA 3T6PA 5DYGA 1L2BA 3HKPA 2FOIC 3TQSA 1DGHB 2L2DA 1N32M 2DI0A 2A5YB 3CF2A 3LCUA 2DAGA 3C3EA 4FCWA 5DFLA 4WW0A 1IN7A 2X4AA 4AQYM 3D8LA 1WGLA 3LMMA 1XC8A 4M9SA 1G59A 1G3IA 4OVZB 4X62M 3GLFB 3VKGA 2LVOC 4FWDA 2DNAA 2DWLA 4DUZM 4NC6A 3VDUA 2CWBA 3LQRA 4AKGA 1Y8GA 4MM3B 2I7NA 3U5ZA 2ZAOA 4GIPA 3SC3A 1OIZA 4XGIA 3THGA 1TTEA 4LGYA 2G3QA 3JR4A 3MMPA 2R65A 1VDDA 1F4IA 3AOGA 5IREB 2KRUA 1XNQM 4KT0F 1L1ZA 4LJ8A 3BXWA 5ITTA 1NVMA 1SXJA 2ZTCA 3Q8GA 2CP8A 3FYCA 5FLXS 2VQEM 4I4LA 4KODA 3HHYA 1FNNA 3KSJA 3EIHA 3U6CA 3GLHB 1SXJE 4II7A 4AKIA 4DR7M 4QNRA 2HAKA 3SFZA 1QVRA 5DYIA 1VEGA 4NL4H 1T3TA 5F3WA 2KDLA 2G8LA 4RKUF 1KSFX 1OFHA 1MJGM 3GLGB 5EXSA 4LGMA 1DO2A 1W5TA 5FTJA 3A98B 5KQ8A 1TH2A 3B89A 4FWGA 1DGGA 2J7NA 1GJTA 4CHTB 2DZNB 2K9DA 1D0LA 5C1BA 3D8BA 2YR0A 2UXBM 2AHMA 2HWJA 2FS1A 1JQJC 5BR8M 3GO8A 2UUBM 3DA1A 2DAKA 3NWLA 4IBFA 3SASA 2F4VM 3K92A 4ITQA 1GL7A 2R44A 2XZUA 4IBKA 1EFUB 2APLA 1K3XA 2LHGA 3TWKA 1K3WA 5BPVA 3I4VA 1LTMA 3HX3A 3C58A 2E5LM 1IXZA 4LFBM 3U61B 2M60A 3HHXA 3KVWA 1OFIA 3AKZA 2HCBA 2XSZD 1NJFA 2JZ0A 2EUCA 1IN8A 3SMPA 1CUKA 1QAOA 4LJ6A 3QAUA 2L7IA 4Z6YA 3SAWA 4B08A 2YNMD 5ITYA 2QZ4A 3MJ5A 3FUWA 1TH3A 3KDSE 4D81A 5GKNA 2W82A 3ZCBB 1DV0A 4K0KM 1XXHA 4MB7A 1E9SA 1R5LA 4L15A 5ITUA 2CV1A 2LWXA 1IXSA 1IY0A 1I4WA 2DVWB 4GHLA 1XXHE 4IBDA 4IJFA 3TWLA 3J80S 2B3TA 1MU5A 1ZMWA 2BNKA 4MH0E 2I7PA 3ILKA 3LW5F 4GC9A 4M0DA 8CATA 3AOEC 3B7QA 4WURA 3ZH9B 3BOSA 4KHPM 2DZOB 4Y28F 1PJTA 3A46A 3A45A 3HY5A 4LF7M 2C5RA 1I94M 1Z5AA 4P17A 4BB9A 4NRVA 4DR1M 2CFOA 2H5XA 1XNRM 4IBGA 2WZJA 1NV9A 2LHCA 2MROB 3DOAA 3H4JA 3I4YA 4QOZC 4IBBA 4JYAM 3KP0E 2BWBA 3U60B 1N78A 4DV1M 1PM5A 4IBEA 2QBYB 3AJIB 3J2PB 1D2NA 1G71A 3NBIA 2V1CA 1DGFA 1XHBA 3UGJA 1NNJA 2Z8YM 3GLIA 4FD2A 1TDZA 3RGSA 1L1TA 2F5OA 4W5WA 1IY2A 3K8ZA 3SYLA 4LJ4A 3GPYA 1TF0B 3GLIE 1TR8A 3FYDA 3L25A 4OU7A 3KW6A 3LCVB 2R18A 2LVPC 1TGUA 2EJSA 4DV5M 4NXNM 4AKHA 2Y0QA 4JI5M 2CRUA 1HR0M 3MHVC 2JY5A 4REZA 1TDHA 3T15A 1V34A 3L26A 4LF9M 3BBZA 4FVMA 1E32A 3HJ8A 3U6LA 4JI1M 3LVVA 2QNJA 3U5ZB 3HZJA 4GRIA 4DV7M 5E6JA 3CTWB 4DBGB 3FTCA 2P5TA 2JNHA 2XEPA 4XK8F 3A42A 4F2LA 1QUSA 1L8QA 3F92A 3UK6A 2V1UA 1E94E 1SXJB 2XSZA 3IHPA 2DZLA 1J5EM 1GVNA 4JV5M 1JB0F 3FTEA 2MR9A 3E46A 3HJSA 3K9OA 5IWAM 3FRIA 1NV8A 4IIWA 4F1IA 5EP3A 4R71A 3GRRA 1PJSA 3SAVA 4IJEA 1N77A 3UZUA 1G4AE 2DHRA 2BJWA 5KPRA 1KYIA 1VDLA 3U6EA 2FE8A 2JUJA 4IBJA 4XBOA 3WHKA 4KO8A 4B7FA 4LF4M 1GL6A 2CEAA 4LCBA 5IT9S 4PD2A 3PVSA 4D82A 1GJSA 2LXEA 3HU2A 3SARA 1PGYA 2K0BX 3B9PA 1NSFA 4LJ9A 5IZ7D 4DR2M 4I5SA 3AL0C 1D0MA 2X8AA 2F5QA 1FJGM 1QAMA 1QZMA 1YUBA 3VFDA 3B7NA 1XB2B 2G5GX 2KNVA 2R4EA 3CF6E 4JI3M 3M6AA 2VDBB 2EKFA 3IG5A 3HU3A 3U6QA 3Q8XA 1JR3D 3V76A 2OOAA 3W67A 1HNZM 5EXXA 5KPZA 1PJQA 5KPTA 5EP4A 5KO3A 1QAQA 1EE8A 2R4JA 4PDGA 2XF3A 1NY6A 4A3VB 2DWNA 3R9XB 1DGBA 1NHWC 3KXEC 4YHHM 1HQCA 2VQFM 1VQ1A 2KRKA 1L2CA 4AI6A 2KEBA 1OJLA 4LFAM 2DKLA 4IBIA 4G4OA 2ZTDA 1XXHB 4GEWA 1IN5A 4MGHA 1ORYB 2DXIA 2H1RA 5ITQA 1IXSB 5JI2E 2RGHA 3GRUA 2CE7A 3GPXA 4QNMA 3M0EA 3CGWA 1UFZA 3K9PA 3QYEA 3HHZA 3U6MA 1R2YA 3UMMA 2DENA 3W0LB 3PNVA 2DWZB 1IBLM 2X49A 1NNUC 3K2LA 3FD9A 4DUYM 2J7OA 2C9CA 4G4NA 1OIPA 2QP9X 1VEKA 1WR1B 5FTMA 1AUAA 3ZQJA 3E9SA 1Z59A 4X64M 5C18A 1OTRA 2MH8A 2UXDM 1HQYE 4DR4M 4FCTA 2UUAM 4GKJM 1W5SA
chains in the Genus database with same CATH topology
2Y20A 4LG2A 2UXCM 3WHLA 2Y0TA 1PJJA 4D80A 4DV4M 3VK7A 4NXMM 5ITXA 2KA6B 4JXJA 4FCVA 3GLIB 2KZUA 1L2DA 2XLJA 3KS4A 1IXRC 3PFIA 5ITXE 4LJ7A 1Z5CA 4G4QA 3J7AS 4PT5A 3J27B 2XGNA 1ZQ9A 4MGKE 3KSXA 2C9OA 3K1JA 1YE9A 1IM2A 4M9ZA 1R6BX 2QENA 3J81S 4DR3M 1GLNA 3CF0A 1GKIA 3HGIA 5FTLA 3GQ4A 4M0WA 3U6SA 2KXEA 2CUZA 3AOEA 1H6UA 1G8PA 4NRWA 1N36M 2KW0A 1JR3A 2OQ4A 4LF6M 4FWHA 3LVWA 2L7HA 5EP1A 4IBCA 3LQQA 2XFTA 3I51A 4ZPXA 1XMQM 2CV2A 3TE6A 1QQWA 4DV3M 2CV0A 4JI2M 2NQ8C 1J09A 1NY5A 2RGOA 3KOYE 4G4RA 1PJIA 1HT2E 4JI8M 2QCUA 2V6ZM 3KOWE 4G6ZA 4BBAA 4DR6M 1Q39A 3KS8A 3IG8A 3PNYA 2F5SA 4FW9A 5KQDA 2M5ZA 2ZAMA 3EIEA 2EA0A 1DO0A 3L29A 3TL4X 3DZDA 5EJCA 2XZFA 2JA2A 3AV0A 3L2AA 3SAUA 4HL4A 1G41A 5EQTA 2LNHC 3GRVA 1C1KA 2HKJA 4OX9M 4B3RM 2R45A 3FUUA 4AW4A 5FTNA 3R8FA 5JI3E 4MGYE 3FUTA 3KOZE 3FTFA 3DFZA 2L09A 4JI4M 3ZC7B 1IQPA 3RE8A 4EIWA 3HHWA 2ZANA 4L78A 3FTDA 2HL7A 4NOOB 2Q2EB 4GC5A 4B7HA 1DGHA 4BLCA 1HNWM 3L28A 4R7GA 4AG5A 4S12A 1XMOM 3QWLA 5DNYA 1E9RA 3SBJA 4M9XA 4OVZA 3SHGB 3GLFA 3U6OA 4LJ5A 7CATA 2Z7JA 1X37A 3TPZA 4YY3M 2EO2A 2FNAA 4LY6A 1LV7A 3VDPA 5A2QS 4OW0A 3KP1E 4JI0M 3GQ3A 2CHQA 4AG6A 2OPFA 3GQ5A 2Z4SA 1R2ZA 2KZSA 3JR5A 1QANA 1NJGA 1XWIA 2D7EA 1NHGC 4DV0M 1R7RA 3M7GA 5EXTA 5LMNM 4X66M 3KOXE 1HT1E 1IY1A 4MGIE 1IN4A 3SHFA 3GLHA 4GMQA 3GPUA 2Y21A 4I8OA 4DV2M 3RFWA 4LJAA 4NSOB 3HJQA 1KFVA 2F5PA 2ZM6M 2D7HA 3GLGA 4DR5M 4LF5M 5E26A 2LH0A 4RF1A 1IBMM 4GITA 4L16A 1MX0A 3W0FA 4GKKM 4QOSA 5ITRA 2DWMA 2RKOA 3GRYA 2CHGA 4QHSA 5EXPA 3PXGA 2FFJA 4DV6M 3GP1A 3JAMS 2ERCA 3AFHA 4LF8M 2VIIA 2F5NA 3VK8A 4JI6M 1S3SA 4LRTA 5H37D 3H4MA 2C98A 3U61A 2ZBKB 3J7BA 2C99A 3SMSA 1SXJD 4CGYB 2UU9M 1HNXM 3L27A 4AZFA 3U6DA 3U6PA 3GPPA 1IBKM 1N33M 2O5RA 3KFUG 4P16A 4B3MM 2XH9A 2D7GA 3FKEA 1J7KA 4L4UA 4L8RC 4TUWA 3T1HM 1Z5BA 3OTOM 3E4RA 2UUCM 4HLQA 1TH4A 1N75A 3UJNA 2Z3XA 4LZJA 4B3TM 2XFSA 4PCZA 2YFQA 4LZZA 5LMUM 3TWMA 1N34M 5FSWA 1Z6TA 2QPAA 2HHHM 3VKHA 4JN6A 3SYKA 4NSRA 4I81A 1Q3BA 3HU1A 3FUXA 3T38A 4JI7M 4PDIA 4CISA 1IN6A 4RNAA 4R3DA 4X65M 1Q3CA 2K47A 4KLNA 2R62A 4LFCM 2YQZA 2C96A 1UM8A 1YSYA 4QHTA 4B3SM 1K82A 3RGPA 1ZAEA 3U60A 2Z4RA 3MK6A 4GHAA 3FUVA 2QBYA 4GH9A 3VLFB 1WXQA 5EP2A 4B7GA 5FTKA 3T1YM 4MGZE 2BJVA 2CHVA 3SATA 1SXJC 4Z8XA 4RF0A 2R46A 2L6OA 1QYRA 3HWSA 4LRSA 5DYGA 1L2BA 3HKPA 2FOIC 3TQSA 1DGHB 1N32M 2A5YB 3CF2A 4FCWA 4AQYM 4WW0A 1IN7A 2X4AA 3D8LA 3LMMA 1XC8A 1G59A 4M9SA 1G3IA 4OVZB 4X62M 3GLFB 3VKGA 4FWDA 2DWLA 4DUZM 3VDUA 3LQRA 4AKGA 4MM3B 2I7NA 3U5ZA 2ZAOA 4GIPA 3SC3A 4XGIA 3THGA 4LGYA 3JR4A 2R65A 1VDDA 3AOGA 5IREB 2KRUA 1XNQM 1L1ZA 4LJ8A 5ITTA 1NVMA 1SXJA 3FYCA 5FLXS 2VQEM 4I4LA 4KODA 3HHYA 1FNNA 3KSJA 3EIHA 3U6CA 3GLHB 1SXJE 4II7A 4AKIA 4DR7M 4QNRA 3SFZA 1QVRA 5DYIA 4NL4H 1T3TA 5F3WA 2G8LA 1KSFX 1OFHA 3GLGB 5EXSA 4LGMA 1DO2A 1W5TA 5FTJA 3A98B 5KQ8A 1TH2A 4FWGA 1DGGA 2J7NA 4CHTB 2DZNB 5C1BA 3D8BA 2YR0A 2UXBM 2AHMA 5BR8M 2UUBM 1JQJC 3GO8A 3DA1A 3NWLA 4IBFA 3SASA 2F4VM 3K92A 4ITQA 1GL7A 2XZUA 4IBKA 1K3XA 3TWKA 1K3WA 5BPVA 3I4VA 3C58A 2E5LM 1IXZA 4LFBM 3U61B 2M60A 3HHXA 3KVWA 1OFIA 3AKZA 2HCBA 2XSZD 1NJFA 2EUCA 1IN8A 3SMPA 1QAOA 4LJ6A 3QAUA 2L7IA 4Z6YA 3SAWA 4B08A 2YNMD 5ITYA 2QZ4A 3MJ5A 3FUWA 1TH3A 3KDSE 4D81A 5GKNA 2W82A 3ZCBB 4K0KM 1XXHA 4MB7A 1E9SA 4L15A 5ITUA 2CV1A 2LWXA 1IY0A 1I4WA 2DVWB 4GHLA 4IBDA 3TWLA 4IJFA 3J80S 1MU5A 2BNKA 4MH0E 2I7PA 3ILKA 4GC9A 8CATA 4M0DA 3AOEC 4WURA 3ZH9B 3BOSA 4KHPM 2DZOB 3A46A 3A45A 4LF7M 2C5RA 1I94M 1Z5AA 4BB9A 4NRVA 4DR1M 2CFOA 1XNRM 4IBGA 3I4YA 4QOZC 3DOAA 4JYAM 4IBBA 3KP0E 3U60B 1N78A 4DV1M 1PM5A 4IBEA 2QBYB 3AJIB 3J2PB 1D2NA 3NBIA 2V1CA 1DGFA 1XHBA 3UGJA 1NNJA 3GLIA 1TDZA 4FD2A 1L1TA 3RGSA 2F5OA 4W5WA 1IY2A 3K8ZA 3SYLA 4LJ4A 3GPYA 3FYDA 3L25A 4OU7A 3KW6A 2R18A 4AKHA 1TGUA 4DV5M 4NXNM 2Y0QA 4JI5M 1HR0M 3MHVC 4REZA 3T15A 1TDHA 3L26A 4LF9M 4FVMA 1E32A 3HJ8A 3U6LA 4JI1M 3LVVA 3U5ZB 4GRIA 4DV7M 5E6JA 3CTWB 3FTCA 2P5TA 2XEPA 3A42A 1L8QA 3UK6A 2V1UA 1E94E 1SXJB 2XSZA 1J5EM 1GVNA 4JV5M 3FTEA 3HJSA 5IWAM 4IIWA 5EP3A 3GRRA 3SAVA 4IJEA 1N77A 3UZUA 1G4AE 2DHRA 2BJWA 5KPRA 1KYIA 3U6EA 2FE8A 4IBJA 4XBOA 3WHKA 4KO8A 4B7FA 4LF4M 1GL6A 2CEAA 4LCBA 5IT9S 4PD2A 3PVSA 4D82A 2LXEA 3HU2A 3SARA 3B9PA 1NSFA 4LJ9A 5IZ7D 4DR2M 4I5SA 3AL0C 2X8AA 2F5QA 1FJGM 1QAMA 1QZMA 1YUBA 3VFDA 2G5GX 2R4EA 3CF6E 4JI3M 3M6AA 3IG5A 3HU3A 3U6QA 3Q8XA 1JR3D 1HNZM 5EXXA 5KPZA 5KPTA 5EP4A 5KO3A 1QAQA 1EE8A 2R4JA 4PDGA 2XF3A 1NY6A 4A3VB 2DWNA 3R9XB 1DGBA 1NHWC 3KXEC 4YHHM 1HQCA 2VQFM 2KRKA 1L2CA 4AI6A 2KEBA 1OJLA 4LFAM 4IBIA 4G4OA 4MGHA 1XXHB 1IN5A 1ORYB 2DXIA 2H1RA 5ITQA 1IXSB 5JI2E 2RGHA 3GRUA 2CE7A 3GPXA 4QNMA 3M0EA 3U6MA 3HHZA 1R2YA 3UMMA 3W0LB 3PNVA 2DWZB 1IBLM 2X49A 1NNUC 3K2LA 3FD9A 4DUYM 2J7OA 2C9CA 4G4NA 2QP9X 5FTMA 3E9SA 1Z59A 4X64M 5C18A 2UXDM 1HQYE 4DR4M 4FCTA 2UUAM 4GKJM 1W5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 2RRU A;  2Y20 A;  4LG2 A;  2JP7 A;  2UXC M;  3WHL A;  2Y0T A;  1PJJ A;  4D80 A;  4DV4 M;  3VK7 A;  4NXM M;  5ITX A;  2KA6 B;  4JXJ A;  4FCV A;  3GLI B;  2KZU A;  1L2D A;  2XLJ A;  3KS4 A;  1IXR C;  3C3D A;  2FH0 A;  1RU3 A;  1R4G A;  2GNO A;  1WJ7 A;  2KHH A;  1MN3 A;  3FE3 A;  1OQY A;  3PFI A;  4CJ6 A;  4LJ7 A;  1Z5C A;  5ITX E;  4G4Q A;  3J7A S;  1V33 A;  2QSF X;  4PT5 A;  2KNZ A;  2WSC F;  3J27 B;  2XGN A;  1ZQ9 A;  4MGK E;  3KSX A;  2C9O A;  3K1J A;  1YE9 A;  1IM2 A;  4M9Z A;  1R6B X;  2O25 A;  2QEN A;  1WGN A;  3J81 S;  4DR3 M;  1C7Y A;  1GLN A;  1ZV1 A;  3CF0 A;  2LVA A;  1GKI A;  2EKK A;  3HGI A;  1ZMU A;  5FTL A;  3GQ4 A;  4CIZ A;  4M0W A;  1EIJ A;  3U6S A;  2KXE A;  2CUZ A;  2WSF F;  3AOE A;  1H6U A;  2L4F A;  3B74 A;  1G8P A;  4NRW A;  1N36 M;  2KW0 A;  1JR3 A;  2OQ4 A;  4LF6 M;  2JY6 B;  4FWH A;  3LVW A;  2L7H A;  5EP1 A;  4IBC A;  3LQQ A;  1BVS A;  2XFT A;  3I51 A;  4ZPX A;  1JR3 E;  3TE6 A;  1XMQ M;  1QQW A;  2CV2 A;  4DV3 M;  2DAE A;  2CV0 A;  2NQ8 C;  4UN2 B;  4JI2 M;  1J09 A;  1NY5 A;  2RGO A;  4HEO A;  3KOY E;  4G4R A;  1PJI A;  1HT2 E;  4JI8 M;  2QCU A;  2V6Z M;  4G3O A;  2OO9 A;  3KOW E;  4G6Z A;  2JZ1 A;  4BBA A;  4DR6 M;  1Q39 A;  3KS8 A;  1QDT A;  3IG8 A;  3PNY A;  2F5S A;  4FW9 A;  5KQD A;  2M5Z A;  3B7Z A;  2ZAM A;  3EIE A;  2EA0 A;  2R6F A;  1DO0 A;  2LTU A;  1WIV A;  3L29 A;  2QQ8 A;  3TL4 X;  3DZD A;  5EJC A;  2DAM A;  2XZF A;  2JA2 A;  3IEC A;  3AV0 A;  3L2A A;  3SAU A;  4HL4 A;  1G41 A;  5EQT A;  2LNH C;  3GRV A;  1C1K A;  2HKJ A;  4OX9 M;  4B3R M;  2R45 A;  3I01 M;  3I04 M;  5L8R F;  3FUU A;  1QDR A;  4AW4 A;  5FTN A;  3R8F A;  1GAB A;  5JI3 E;  4MGY E;  2JY7 A;  2LVQ D;  3FUT A;  3KOZ E;  3FTF A;  3DFZ A;  2L09 A;  4Q7J A;  4JI4 M;  3ZC7 B;  1IQP A;  3RE8 A;  4EIW A;  3HHW A;  2ZAN A;  4L78 A;  3FTD A;  2HL7 A;  4NOO B;  2DHY A;  2Q2E B;  4GC5 A;  4B7H A;  3E21 A;  1DGH A;  4BLC A;  1HNW M;  3L28 A;  4R7G A;  4AG5 A;  4S12 A;  2K6B A;  1XMO M;  2JWS A;  2R0I A;  3QWL A;  5DNY A;  1E9R A;  3SBJ A;  4M9X A;  4OVZ A;  3SHG B;  3GLF A;  3U6O A;  4LJ5 A;  7CAT A;  2Z7J A;  1X37 A;  3TPZ A;  3QYB A;  2MGW A;  4YY3 M;  2EO2 A;  2FNA A;  4LY6 A;  1ZMV A;  3GLF E;  1LV7 A;  3VDP A;  1T43 A;  1A5T A;  1HJP A;  4OW0 A;  5A2Q S;  3KP1 E;  4JI0 M;  3GQ3 A;  2CHQ A;  4AG6 A;  2OPF A;  3GQ5 A;  2Z4S A;  1R2Z A;  2KZS A;  3JR5 A;  1Q02 A;  1QAN A;  1NJG A;  1XWI A;  2D7E A;  2KNA A;  1NHG C;  4DV0 M;  1R7R A;  3M7G A;  5EXT A;  5LMN M;  4X66 M;  3KOX E;  1HT1 E;  1IY1 A;  4MGI E;  1IN4 A;  2JY8 A;  3SHF A;  3GLH A;  4GMQ A;  2VF8 A;  3GPU A;  2Y21 A;  4I8O A;  1GO5 A;  4DV2 M;  3RFW A;  1OAO C;  4LJA A;  4NSO B;  3GLH E;  1AIP C;  3HJQ A;  1KFV A;  2F5P A;  2ZM6 M;  2D7H A;  4L6V 6;  3GLG A;  3FRH A;  3W68 A;  4DR5 M;  1V92 A;  4LF5 M;  5E26 A;  2LH0 A;  4RF1 A;  1IBM M;  4GIT A;  4L16 A;  1MX0 A;  3W0F A;  2QHO B;  4GKK M;  3GLG E;  4QOS A;  2BWE A;  5ITR A;  2DWM A;  1WHC A;  1IFY A;  2RKO A;  1SG9 A;  3GRY A;  2CHG A;  4ANR A;  4QHS A;  5EXP A;  3PXG A;  2FFJ A;  4DV6 M;  3GP1 A;  3JAM S;  2ERC A;  3AFH A;  4LF8 M;  2VII A;  1VG5 A;  2F5N A;  3VK8 A;  4JI6 M;  1S3S A;  4LRT A;  5H37 D;  3H4M A;  2C98 A;  3U61 A;  2ZBK B;  2LVN C;  3J7B A;  3NBX X;  2C99 A;  3SMS A;  1SXJ D;  2N35 A;  4CGY B;  2UU9 M;  2L4E A;  1HNX M;  3L27 A;  4AZF A;  3U6D A;  3U6P A;  3GPP A;  1NO1 A;  1IBK M;  1N33 M;  2O5R A;  1PRB A;  3KFU G;  4WP2 A;  4P16 A;  1VEJ A;  4B3M M;  2XH9 A;  2D7G A;  3FKE A;  1J7K A;  4L4U A;  3C9P A;  4L8R C;  4TUW A;  3T1H M;  1Z5B A;  2VF7 A;  3OTO M;  3E4R A;  2UUC M;  4HLQ A;  1TH4 A;  1N75 A;  1P3Q Q;  3UJN A;  2Z3X A;  4LZJ A;  4B3T M;  2MJ5 B;  2OOB A;  2XFS A;  4PCZ A;  2YFQ A;  4LZZ A;  5LMU M;  2JXN A;  1D0K A;  3TWM A;  5FSW A;  1N34 M;  1Z6T A;  2O01 F;  2QPA A;  2HHH M;  3VKH A;  1OKS A;  4JN6 A;  4NSR A;  3SYK A;  4I81 A;  1Q3B A;  3HU1 A;  3FUX A;  3T38 A;  4JI7 M;  4PDI A;  1T6O A;  4CIS A;  1YLA A;  1IN6 A;  4RNA A;  4R3D A;  4X65 M;  2WSE F;  1OAI A;  2GQF A;  1Q3C A;  2K47 A;  4KLN A;  2R62 A;  4LFC M;  2J5Y A;  2YQZ A;  2C96 A;  1UM8 A;  1YSY A;  2LBC A;  4QHT A;  4B3S M;  1K82 A;  3RGP A;  1ZAE A;  3U60 A;  2Z4R A;  3MK6 A;  4GHA A;  3FUV A;  2QBY A;  4GH9 A;  3VLF B;  1WXQ A;  2DAI A;  1QUT A;  1QZE A;  5EP2 A;  4B7G A;  5FTK A;  3T1Y M;  4MGZ E;  2BJV A;  2CHV A;  3SAT A;  1SXJ C;  4Z8X A;  4RF0 A;  2R46 A;  2L6O A;  1QYR A;  3HWS A;  4LRS A;  3T6P A;  5DYG A;  1L2B A;  3HKP A;  2FOI C;  3TQS A;  1DGH B;  2L2D A;  1N32 M;  2DI0 A;  2A5Y B;  3CF2 A;  3LCU A;  2DAG A;  3C3E A;  4FCW A;  5DFL A;  4WW0 A;  1IN7 A;  2X4A A;  4AQY M;  3D8L A;  1WGL A;  3LMM A;  1XC8 A;  4M9S A;  1G59 A;  1G3I A;  4OVZ B;  4X62 M;  3GLF B;  3VKG A;  2LVO C;  4FWD A;  2DNA A;  2DWL A;  4DUZ M;  4NC6 A;  3VDU A;  2CWB A;  3LQR A;  4AKG A;  1Y8G A;  4MM3 B;  2I7N A;  3U5Z A;  2ZAO A;  4GIP A;  3SC3 A;  1OIZ A;  4XGI A;  3THG A;  1TTE A;  4LGY A;  2G3Q A;  3JR4 A;  3MMP A;  2R65 A;  1VDD A;  1F4I A;  3AOG A;  5IRE B;  2KRU A;  1XNQ M;  4KT0 F;  1L1Z A;  4LJ8 A;  3BXW A;  5ITT A;  1NVM A;  1SXJ A;  2ZTC A;  3Q8G A;  2CP8 A;  3FYC A;  5FLX S;  2VQE M;  4I4L A;  4KOD A;  3HHY A;  1FNN A;  3KSJ A;  3EIH A;  3U6C A;  3GLH B;  1SXJ E;  4II7 A;  4AKI A;  4DR7 M;  4QNR A;  2HAK A;  3SFZ A;  1QVR A;  5DYI A;  1VEG A;  4NL4 H;  1T3T A;  5F3W A;  2KDL A;  2G8L A;  4RKU F;  1KSF X;  1OFH A;  1MJG M;  3GLG B;  5EXS A;  4LGM A;  1DO2 A;  1W5T A;  5FTJ A;  3A98 B;  5KQ8 A;  1TH2 A;  3B89 A;  4FWG A;  1DGG A;  2J7N A;  1GJT A;  4CHT B;  2DZN B;  2K9D A;  1D0L A;  5C1B A;  3D8B A;  2YR0 A;  2UXB M;  2AHM A;  2HWJ A;  2FS1 A;  1JQJ C;  5BR8 M;  3GO8 A;  2UUB M;  3DA1 A;  2DAK A;  3NWL A;  4IBF A;  3SAS A;  2F4V M;  3K92 A;  4ITQ A;  1GL7 A;  2R44 A;  2XZU A;  4IBK A;  1EFU B;  2APL A;  1K3X A;  2LHG A;  3TWK A;  1K3W A;  5BPV A;  3I4V A;  1LTM A;  3HX3 A;  3C58 A;  2E5L M;  1IXZ A;  4LFB M;  3U61 B;  2M60 A;  3HHX A;  3KVW A;  1OFI A;  3AKZ A;  2HCB A;  2XSZ D;  1NJF A;  2JZ0 A;  2EUC A;  1IN8 A;  3SMP A;  1CUK A;  1QAO A;  4LJ6 A;  3QAU A;  2L7I A;  4Z6Y A;  3SAW A;  4B08 A;  2YNM D;  5ITY A;  2QZ4 A;  3MJ5 A;  3FUW A;  1TH3 A;  3KDS E;  4D81 A;  5GKN A;  2W82 A;  3ZCB B;  1DV0 A;  4K0K M;  1XXH A;  4MB7 A;  1E9S A;  1R5L A;  4L15 A;  5ITU A;  2CV1 A;  2LWX A;  1IXS A;  1IY0 A;  1I4W A;  2DVW B;  4GHL A;  1XXH E;  4IBD A;  4IJF A;  3TWL A;  3J80 S;  2B3T A;  1MU5 A;  1ZMW A;  2BNK A;  4MH0 E;  2I7P A;  3ILK A;  3LW5 F;  4GC9 A;  4M0D A;  8CAT A;  3AOE C;  3B7Q A;  4WUR A;  3ZH9 B;  3BOS A;  4KHP M;  2DZO B;  4Y28 F;  1PJT A;  3A46 A;  3A45 A;  3HY5 A;  4LF7 M;  2C5R A;  1I94 M;  1Z5A A;  4P17 A;  4BB9 A;  4NRV A;  4DR1 M;  2CFO A;  2H5X A;  1XNR M;  4IBG A;  2WZJ A;  1NV9 A;  2LHC A;  2MRO B;  3DOA A;  3H4J A;  3I4Y A;  4QOZ C;  4IBB A;  4JYA M;  3KP0 E;  2BWB A;  3U60 B;  1N78 A;  4DV1 M;  1PM5 A;  4IBE A;  2QBY B;  3AJI B;  3J2P B;  1D2N A;  1G71 A;  3NBI A;  2V1C A;  1DGF A;  1XHB A;  3UGJ A;  1NNJ A;  2Z8Y M;  3GLI A;  4FD2 A;  1TDZ A;  3RGS A;  1L1T A;  2F5O A;  4W5W A;  1IY2 A;  3K8Z A;  3SYL A;  4LJ4 A;  3GPY A;  1TF0 B;  3GLI E;  1TR8 A;  3FYD A;  3L25 A;  4OU7 A;  3KW6 A;  3LCV B;  2R18 A;  2LVP C;  1TGU A;  2EJS A;  4DV5 M;  4NXN M;  4AKH A;  2Y0Q A;  4JI5 M;  2CRU A;  1HR0 M;  3MHV C;  2JY5 A;  4REZ A;  1TDH A;  3T15 A;  1V34 A;  3L26 A;  4LF9 M;  3BBZ A;  4FVM A;  1E32 A;  3HJ8 A;  3U6L A;  4JI1 M;  3LVV A;  2QNJ A;  3U5Z B;  3HZJ A;  4GRI A;  4DV7 M;  5E6J A;  3CTW B;  4DBG B;  3FTC A;  2P5T A;  2JNH A;  2XEP A;  4XK8 F;  3A42 A;  4F2L A;  1QUS A;  1L8Q A;  3F92 A;  3UK6 A;  2V1U A;  1E94 E;  1SXJ B;  2XSZ A;  3IHP A;  2DZL A;  1J5E M;  1GVN A;  4JV5 M;  1JB0 F;  3FTE A;  2MR9 A;  3E46 A;  3HJS A;  3K9O A;  5IWA M;  3FRI A;  1NV8 A;  4IIW A;  4F1I A;  5EP3 A;  4R71 A;  3GRR A;  1PJS A;  3SAV A;  4IJE A;  1N77 A;  3UZU A;  1G4A E;  2DHR A;  2BJW A;  5KPR A;  1KYI A;  1VDL A;  3U6E A;  2FE8 A;  2JUJ A;  4IBJ A;  4XBO A;  3WHK A;  4KO8 A;  4B7F A;  4LF4 M;  1GL6 A;  2CEA A;  4LCB A;  5IT9 S;  4PD2 A;  3PVS A;  4D82 A;  1GJS A;  2LXE A;  3HU2 A;  3SAR A;  1PGY A;  2K0B X;  3B9P A;  1NSF A;  4LJ9 A;  5IZ7 D;  4DR2 M;  4I5S A;  3AL0 C;  1D0M A;  2X8A A;  2F5Q A;  1FJG M;  1QAM A;  1QZM A;  1YUB A;  3VFD A;  3B7N A;  1XB2 B;  2G5G X;  2KNV A;  2R4E A;  3CF6 E;  4JI3 M;  3M6A A;  2VDB B;  2EKF A;  3IG5 A;  3HU3 A;  3U6Q A;  3Q8X A;  1JR3 D;  3V76 A;  2OOA A;  3W67 A;  1HNZ M;  5EXX A;  5KPZ A;  1PJQ A;  5KPT A;  5EP4 A;  5KO3 A;  1QAQ A;  1EE8 A;  2R4J A;  4PDG A;  2XF3 A;  1NY6 A;  4A3V B;  2DWN A;  3R9X B;  1DGB A;  1NHW C;  3KXE C;  4YHH M;  1HQC A;  2VQF M;  1VQ1 A;  2KRK A;  1L2C A;  4AI6 A;  2KEB A;  1OJL A;  4LFA M;  2DKL A;  4IBI A;  4G4O A;  2ZTD A;  1XXH B;  4GEW A;  1IN5 A;  4MGH A;  1ORY B;  2DXI A;  2H1R A;  5ITQ A;  1IXS B;  5JI2 E;  2RGH A;  3GRU A;  2CE7 A;  3GPX A;  4QNM A;  3M0E A;  3CGW A;  1UFZ A;  3K9P A;  3QYE A;  3HHZ A;  3U6M A;  1R2Y A;  3UMM A;  2DEN A;  3W0L B;  3PNV A;  2DWZ B;  1IBL M;  2X49 A;  1NNU C;  3K2L A;  3FD9 A;  4DUY M;  2J7O A;  2C9C A;  4G4N A;  1OIP A;  2QP9 X;  1VEK A;  1WR1 B;  5FTM A;  1AUA A;  3ZQJ A;  3E9S A;  1Z59 A;  4X64 M;  5C18 A;  1OTR A;  2MH8 A;  2UXD M;  1HQY E;  4DR4 M;  4FCT A;  2UUA M;  4GKJ M;  1W5S A; 
#chains in the Genus database with same CATH homology
 2Y20 A;  4LG2 A;  2UXC M;  3WHL A;  2Y0T A;  1PJJ A;  4D80 A;  4DV4 M;  3VK7 A;  4NXM M;  5ITX A;  2KA6 B;  4JXJ A;  4FCV A;  3GLI B;  2KZU A;  1L2D A;  2XLJ A;  3KS4 A;  1IXR C;  3PFI A;  5ITX E;  4LJ7 A;  1Z5C A;  4G4Q A;  3J7A S;  4PT5 A;  3J27 B;  2XGN A;  1ZQ9 A;  4MGK E;  3KSX A;  2C9O A;  3K1J A;  1YE9 A;  1IM2 A;  4M9Z A;  1R6B X;  2QEN A;  3J81 S;  4DR3 M;  1GLN A;  3CF0 A;  1GKI A;  3HGI A;  5FTL A;  3GQ4 A;  4M0W A;  3U6S A;  2KXE A;  2CUZ A;  3AOE A;  1H6U A;  1G8P A;  4NRW A;  1N36 M;  2KW0 A;  1JR3 A;  2OQ4 A;  4LF6 M;  4FWH A;  3LVW A;  2L7H A;  5EP1 A;  4IBC A;  3LQQ A;  2XFT A;  3I51 A;  4ZPX A;  1XMQ M;  2CV2 A;  3TE6 A;  1QQW A;  4DV3 M;  2CV0 A;  4JI2 M;  2NQ8 C;  1J09 A;  1NY5 A;  2RGO A;  3KOY E;  4G4R A;  1PJI A;  1HT2 E;  4JI8 M;  2QCU A;  2V6Z M;  3KOW E;  4G6Z A;  4BBA A;  4DR6 M;  1Q39 A;  3KS8 A;  3IG8 A;  3PNY A;  2F5S A;  4FW9 A;  5KQD A;  2M5Z A;  2ZAM A;  3EIE A;  2EA0 A;  1DO0 A;  3L29 A;  3TL4 X;  3DZD A;  5EJC A;  2XZF A;  2JA2 A;  3AV0 A;  3L2A A;  3SAU A;  4HL4 A;  1G41 A;  5EQT A;  2LNH C;  3GRV A;  1C1K A;  2HKJ A;  4OX9 M;  4B3R M;  2R45 A;  3FUU A;  4AW4 A;  5FTN A;  3R8F A;  5JI3 E;  4MGY E;  3FUT A;  3KOZ E;  3FTF A;  3DFZ A;  2L09 A;  4JI4 M;  3ZC7 B;  1IQP A;  3RE8 A;  4EIW A;  3HHW A;  2ZAN A;  4L78 A;  3FTD A;  2HL7 A;  4NOO B;  2Q2E B;  4GC5 A;  4B7H A;  1DGH A;  4BLC A;  1HNW M;  3L28 A;  4R7G A;  4AG5 A;  4S12 A;  1XMO M;  3QWL A;  5DNY A;  1E9R A;  3SBJ A;  4M9X A;  4OVZ A;  3SHG B;  3GLF A;  3U6O A;  4LJ5 A;  7CAT A;  2Z7J A;  1X37 A;  3TPZ A;  4YY3 M;  2EO2 A;  2FNA A;  4LY6 A;  1LV7 A;  3VDP A;  5A2Q S;  4OW0 A;  3KP1 E;  4JI0 M;  3GQ3 A;  2CHQ A;  4AG6 A;  2OPF A;  3GQ5 A;  2Z4S A;  1R2Z A;  2KZS A;  3JR5 A;  1QAN A;  1NJG A;  1XWI A;  2D7E A;  1NHG C;  4DV0 M;  1R7R A;  3M7G A;  5EXT A;  5LMN M;  4X66 M;  3KOX E;  1HT1 E;  1IY1 A;  4MGI E;  1IN4 A;  3SHF A;  3GLH A;  4GMQ A;  3GPU A;  2Y21 A;  4I8O A;  4DV2 M;  3RFW A;  4LJA A;  4NSO B;  3HJQ A;  1KFV A;  2F5P A;  2ZM6 M;  2D7H A;  3GLG A;  4DR5 M;  4LF5 M;  5E26 A;  2LH0 A;  4RF1 A;  1IBM M;  4GIT A;  4L16 A;  1MX0 A;  3W0F A;  4GKK M;  4QOS A;  5ITR A;  2DWM A;  2RKO A;  3GRY A;  2CHG A;  4QHS A;  5EXP A;  3PXG A;  2FFJ A;  4DV6 M;  3GP1 A;  3JAM S;  2ERC A;  3AFH A;  4LF8 M;  2VII A;  2F5N A;  3VK8 A;  4JI6 M;  1S3S A;  4LRT A;  5H37 D;  3H4M A;  2C98 A;  3U61 A;  2ZBK B;  3J7B A;  2C99 A;  3SMS A;  1SXJ D;  4CGY B;  2UU9 M;  1HNX M;  3L27 A;  4AZF A;  3U6D A;  3U6P A;  3GPP A;  1IBK M;  1N33 M;  2O5R A;  3KFU G;  4P16 A;  4B3M M;  2XH9 A;  2D7G A;  3FKE A;  1J7K A;  4L4U A;  4L8R C;  4TUW A;  3T1H M;  1Z5B A;  3OTO M;  3E4R A;  2UUC M;  4HLQ A;  1TH4 A;  1N75 A;  3UJN A;  2Z3X A;  4LZJ A;  4B3T M;  2XFS A;  4PCZ A;  2YFQ A;  4LZZ A;  5LMU M;  3TWM A;  1N34 M;  5FSW A;  1Z6T A;  2QPA A;  2HHH M;  3VKH A;  4JN6 A;  3SYK A;  4NSR A;  4I81 A;  1Q3B A;  3HU1 A;  3FUX A;  3T38 A;  4JI7 M;  4PDI A;  4CIS A;  1IN6 A;  4RNA A;  4R3D A;  4X65 M;  1Q3C A;  2K47 A;  4KLN A;  2R62 A;  4LFC M;  2YQZ A;  2C96 A;  1UM8 A;  1YSY A;  4QHT A;  4B3S M;  1K82 A;  3RGP A;  1ZAE A;  3U60 A;  2Z4R A;  3MK6 A;  4GHA A;  3FUV A;  2QBY A;  4GH9 A;  3VLF B;  1WXQ A;  5EP2 A;  4B7G A;  5FTK A;  3T1Y M;  4MGZ E;  2BJV A;  2CHV A;  3SAT A;  1SXJ C;  4Z8X A;  4RF0 A;  2R46 A;  2L6O A;  1QYR A;  3HWS A;  4LRS A;  5DYG A;  1L2B A;  3HKP A;  2FOI C;  3TQS A;  1DGH B;  1N32 M;  2A5Y B;  3CF2 A;  4FCW A;  4AQY M;  4WW0 A;  1IN7 A;  2X4A A;  3D8L A;  3LMM A;  1XC8 A;  1G59 A;  4M9S A;  1G3I A;  4OVZ B;  4X62 M;  3GLF B;  3VKG A;  4FWD A;  2DWL A;  4DUZ M;  3VDU A;  3LQR A;  4AKG A;  4MM3 B;  2I7N A;  3U5Z A;  2ZAO A;  4GIP A;  3SC3 A;  4XGI A;  3THG A;  4LGY A;  3JR4 A;  2R65 A;  1VDD A;  3AOG A;  5IRE B;  2KRU A;  1XNQ M;  1L1Z A;  4LJ8 A;  5ITT A;  1NVM A;  1SXJ A;  3FYC A;  5FLX S;  2VQE M;  4I4L A;  4KOD A;  3HHY A;  1FNN A;  3KSJ A;  3EIH A;  3U6C A;  3GLH B;  1SXJ E;  4II7 A;  4AKI A;  4DR7 M;  4QNR A;  3SFZ A;  1QVR A;  5DYI A;  4NL4 H;  1T3T A;  5F3W A;  2G8L A;  1KSF X;  1OFH A;  3GLG B;  5EXS A;  4LGM A;  1DO2 A;  1W5T A;  5FTJ A;  3A98 B;  5KQ8 A;  1TH2 A;  4FWG A;  1DGG A;  2J7N A;  4CHT B;  2DZN B;  5C1B A;  3D8B A;  2YR0 A;  2UXB M;  2AHM A;  5BR8 M;  2UUB M;  1JQJ C;  3GO8 A;  3DA1 A;  3NWL A;  4IBF A;  3SAS A;  2F4V M;  3K92 A;  4ITQ A;  1GL7 A;  2XZU A;  4IBK A;  1K3X A;  3TWK A;  1K3W A;  5BPV A;  3I4V A;  3C58 A;  2E5L M;  1IXZ A;  4LFB M;  3U61 B;  2M60 A;  3HHX A;  3KVW A;  1OFI A;  3AKZ A;  2HCB A;  2XSZ D;  1NJF A;  2EUC A;  1IN8 A;  3SMP A;  1QAO A;  4LJ6 A;  3QAU A;  2L7I A;  4Z6Y A;  3SAW A;  4B08 A;  2YNM D;  5ITY A;  2QZ4 A;  3MJ5 A;  3FUW A;  1TH3 A;  3KDS E;  4D81 A;  5GKN A;  2W82 A;  3ZCB B;  4K0K M;  1XXH A;  4MB7 A;  1E9S A;  4L15 A;  5ITU A;  2CV1 A;  2LWX A;  1IY0 A;  1I4W A;  2DVW B;  4GHL A;  4IBD A;  3TWL A;  4IJF A;  3J80 S;  1MU5 A;  2BNK A;  4MH0 E;  2I7P A;  3ILK A;  4GC9 A;  8CAT A;  4M0D A;  3AOE C;  4WUR A;  3ZH9 B;  3BOS A;  4KHP M;  2DZO B;  3A46 A;  3A45 A;  4LF7 M;  2C5R A;  1I94 M;  1Z5A A;  4BB9 A;  4NRV A;  4DR1 M;  2CFO A;  1XNR M;  4IBG A;  3I4Y A;  4QOZ C;  3DOA A;  4JYA M;  4IBB A;  3KP0 E;  3U60 B;  1N78 A;  4DV1 M;  1PM5 A;  4IBE A;  2QBY B;  3AJI B;  3J2P B;  1D2N A;  3NBI A;  2V1C A;  1DGF A;  1XHB A;  3UGJ A;  1NNJ A;  3GLI A;  1TDZ A;  4FD2 A;  1L1T A;  3RGS A;  2F5O A;  4W5W A;  1IY2 A;  3K8Z A;  3SYL A;  4LJ4 A;  3GPY A;  3FYD A;  3L25 A;  4OU7 A;  3KW6 A;  2R18 A;  4AKH A;  1TGU A;  4DV5 M;  4NXN M;  2Y0Q A;  4JI5 M;  1HR0 M;  3MHV C;  4REZ A;  3T15 A;  1TDH A;  3L26 A;  4LF9 M;  4FVM A;  1E32 A;  3HJ8 A;  3U6L A;  4JI1 M;  3LVV A;  3U5Z B;  4GRI A;  4DV7 M;  5E6J A;  3CTW B;  3FTC A;  2P5T A;  2XEP A;  3A42 A;  1L8Q A;  3UK6 A;  2V1U A;  1E94 E;  1SXJ B;  2XSZ A;  1J5E M;  1GVN A;  4JV5 M;  3FTE A;  3HJS A;  5IWA M;  4IIW A;  5EP3 A;  3GRR A;  3SAV A;  4IJE A;  1N77 A;  3UZU A;  1G4A E;  2DHR A;  2BJW A;  5KPR A;  1KYI A;  3U6E A;  2FE8 A;  4IBJ A;  4XBO A;  3WHK A;  4KO8 A;  4B7F A;  4LF4 M;  1GL6 A;  2CEA A;  4LCB A;  5IT9 S;  4PD2 A;  3PVS A;  4D82 A;  2LXE A;  3HU2 A;  3SAR A;  3B9P A;  1NSF A;  4LJ9 A;  5IZ7 D;  4DR2 M;  4I5S A;  3AL0 C;  2X8A A;  2F5Q A;  1FJG M;  1QAM A;  1QZM A;  1YUB A;  3VFD A;  2G5G X;  2R4E A;  3CF6 E;  4JI3 M;  3M6A A;  3IG5 A;  3HU3 A;  3U6Q A;  3Q8X A;  1JR3 D;  1HNZ M;  5EXX A;  5KPZ A;  5KPT A;  5EP4 A;  5KO3 A;  1QAQ A;  1EE8 A;  2R4J A;  4PDG A;  2XF3 A;  1NY6 A;  4A3V B;  2DWN A;  3R9X B;  1DGB A;  1NHW C;  3KXE C;  4YHH M;  1HQC A;  2VQF M;  2KRK A;  1L2C A;  4AI6 A;  2KEB A;  1OJL A;  4LFA M;  4IBI A;  4G4O A;  4MGH A;  1XXH B;  1IN5 A;  1ORY B;  2DXI A;  2H1R A;  5ITQ A;  1IXS B;  5JI2 E;  2RGH A;  3GRU A;  2CE7 A;  3GPX A;  4QNM A;  3M0E A;  3U6M A;  3HHZ A;  1R2Y A;  3UMM A;  3W0L B;  3PNV A;  2DWZ B;  1IBL M;  2X49 A;  1NNU C;  3K2L A;  3FD9 A;  4DUY M;  2J7O A;  2C9C A;  4G4N A;  2QP9 X;  5FTM A;  3E9S A;  1Z59 A;  4X64 M;  5C18 A;  2UXD M;  1HQY E;  4DR4 M;  4FCT A;  2UUA M;  4GKJ M;  1W5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...