3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RcdA
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
2BNKA 2KRUA 3GRYA 4F1IA 2F5PA 2MH8A 2OOAA 2P5TA 4CIZA 1SXJC 2DHYA 2L4FA 3KOXE 4Y28F 4Z6YA 4B7GA 4DV6M 4Q7JA 4IBFA 1SXJB 3W0FA 4XBOA 4AG6A 1IY0A 3I01M 1DGFA 3W68A 2I7PA 5FTLA 2VIIA 3SYLA 3R9XB 2DXIA 3GQ4A 1IQPA 4LJ8A 3B74A 1K82A 4KODA 3JR4A 3FYDA 1GL7A 1JR3A 1NNUC 2QNJA 3K2LA 4GH9A 4ZPXA 4L15A 3U5ZA 1VG5A 4G3OA 4D82A 1Z6TA 1Z5AA 1T3TA 2F5SA 3ZH9B 2OO9A 4G4RA 3LMMA 3LVWA 2HHHM 2LVQD 2WSFF 1HQYE 5KO3A 3BOSA 3CGWA 1OIPA 4JI5M 4MGYE 3HHXA 3F92A 1QUTA 2MGWA 2F4VM 4IBJA 4M9ZA 4G4OA 4TUWA 2XF3A 2APLA 3KDSE 2DAMA 4MGHA 1N75A 2F5QA 4ITQA 4EIWA 2R44A 3C3DA 3E4RA 1HNZM 2HWJA 3GLIB 1DO2A 4JI3M 2D7HA 4D80A 1GLNA 2EO2A 3J7AS 3B9PA 4L78A 2J7OA 3NWLA 3DA1A 1IBLM 1NVMA 2OPFA 1XC8A 3GLFA 2JY6B 4IBKA 2XFSA 3FTDA 4LJ4A 2QQ8A 5ITRA 3SAWA 1E9SA 1D0LA 2CHQA 2MR9A 2Z7JA 4R71A 3NBIA 5C1BA 1V92A 2VDBB 1G41A 1GKIA 1G4AE 3RE8A 3L27A 4F2LA 4IBDA 3E46A 5H37D 1R7RA 4FW9A 4JI4M 4AKGA 1XMQM 1TGUA 3PNVA 1E9RA 1K3WA 3I51A 4LJ5A 1HNWM 3VDPA 3KXEC 4LRSA 3TWKA 3THGA 3VK8A 3IHPA 1WXQA 1L2DA 3NBXX 3KS4A 5DYGA 1IBKM 4AI6A 7CATA 3BXWA 1PM5A 3IG8A 5EXXA 2KNAA 5EJCA 4GC5A 2I7NA 4LY6A 3VLFB 2E5LM 1Z59A 3C9PA 3SBJA 1D0KA 2WSCF 3RFWA 2O5RA 3GP1A 4FD2A 2DENA 4NXNM 2XLJA 2HAKA 3K1JA 3WHLA 3SYKA 2FNAA 2JA2A 4DR3M 5EP3A 4GITA 1QAOA 4LCBA 3GLGA 4HEOA 4XGIA 5IT9S 3Q8XA 2QPAA 4JI2M 1JB0F 2KNVA 2XZUA 2EKKA 2C96A 3M7GA 4IIWA 3GLHE 1ZV1A 4MB7A 4D81A 3VK7A 3K9PA 1TTEA 2QENA 2OQ4A 1KYIA 4G6ZA 3E21A 2W82A 4JXJA 1LTMA 3SMSA 1N36M 4QNRA 4DUZM 3VDUA 2UXCM 1GJTA 2DWLA 3KW6A 3C3EA 4KLNA 3K92A 5KPZA 3U5ZB 4B3TM 4GKKM 4DR2M 4AQYM 1ORYB 2JY8A 1IN6A 2XH9A 1DV0A 4DV3M 4IJEA 1VQ1A 3J27B 1MX0A 5ITXE 2YNMD 3U6EA 1T6OA 3I4VA 3K8ZA 4DR5M 4WURA 3AL0C 2VF7A 2J5YA 5FLXS 3GQ5A 4GKJM 2DAEA 3FTCA 2H5XA 2UUAM 2NQ8C 4R3DA 3HGIA 3AOEA 2L09A 1TDHA 2JP7A 1X37A 3HHWA 3SFZA 1QANA 3L2AA 4K0KM 2DZNB 5IZ7D 1PJIA 4DV4M 1V34A 3TL4X 3LQRA 4HLQA 3U6QA 2DWMA 4LF9M 1EE8A 1WGLA 2QHOB 2L2DA 2CHVA 2V1CA 5ITYA 2WZJA 1WJ7A 3GLFB 1OTRA 4WW0A 3L25A 2KEBA 1EFUB 4X62M 3PXGA 5GKNA 4I81A 2JXNA 5LMUM 2CV1A 3SHFA 3FUXA 1ZMVA 3W0LB 4PCZA 2CV2A 4KHPM 3LQQA 2C9CA 4FCVA 3SHGB 1R4GA 2ZAMA 3SASA 2Z4RA 3A42A 2EUCA 4NSOB 2L4EA 3U6MA 1J5EM 1ZAEA 3HWSA 1IY1A 5KPRA 5ITUA 3EIHA 1QUSA 2X49A 1R6BX 2KW0A 2LNHC 4OW0A 4FCWA 4YY3M 2FOIC 2LH0A 2HCBA 4LGYA 3SC3A 3W67A 3LW5F 1SXJE 3IECA 4IBCA 4LJ9A 2D7EA 4X65M 1HR0M 1F4IA 2DHRA 1DGGA 3U6PA 1BVSA 2ZTCA 5JI2E 4BBAA 4JI1M 1IXRC 1DGHA 3PVSA 2F5OA 3U60A 1OFIA 3JR5A 1VEGA 1XNRM 4GMQA 1N78A 4MM3B 3TPZA 2DAIA 4R7GA 1XXHA 3KOWE 1Q3BA 3GLGB 2CP8A 4QHTA 5LMNM 2CEAA 5ITXA 2LBCA 2JY7A 1HT1E 2G5GX 2R0IA 3FUUA 3OTOM 2LVAA 3KSJA 3PFIA 2V1UA 4RNAA 3HX3A 1G3IA 1PJSA 2MROB 2L7IA 5C18A 1OFHA 1W5SA 4B7FA 1NHWC 1G71A 2DVWB 4B08A 4B3MM 4LZZA 4IBGA 4GC9A 3GPPA 2EA0A 3VKGA 2O01F 4IJFA 5FTMA 3H4MA 4NL4H 2QP9X 3HKPA 4IBIA 4LF8M 1FNNA 3KSXA 3L28A 1D2NA 1OAOC 3KP0E 2G8LA 1OJLA 3AKZA 3HHZA 1SXJD 2UXBM 1GJSA 1TR8A 3AV0A 4M9SA 4NOOB 1VEJA 2DAGA 4JI0M 4LG2A 2WSEF 1IXZA 3HZJA 4QOSA 3L29A 4P16A 2R4JA 1TH3A 3B7QA 5BR8M 2QBYA 3FUWA 3AOEC 3T38A 1IN5A 1AUAA 3HU3A 1QYRA 3DFZA 3QWLA 3U61A 1VEKA 3KFUG 2FFJA 3UZUA 2MJ5B 3D8BA 1Q39A 2C99A 2LVNC 2LTUA 2EJSA 2CE7A 1E32A 1L8QA 2JUJA 2LHCA 3HHYA 2ZTDA 5FSWA 1GVNA 1HJPA 3IG5A 2OOBA 1PGYA 4QHSA 5E26A 3EIEA 2AHMA 3GPUA 4M0DA 2CWBA 3HU1A 5A2QS 3KS8A 4RKUF 3UMMA 2LWXA 1KFVA 2ZM6M 2UUCM 3VFDA 3T1HM 2QZ4A 4HL4A 2V6ZM 3AOGA 2K0BX 4LF7M 4AZFA 4CJ6A 2LXEA 5BPVA 3ZC7B 1PJTA 4WP2A 1RU3A 4GIPA 3GRRA 3TWLA 3KP1E 4A3VB 2ERCA 4FVMA 5FTJA 2BJWA 1HQCA 2YFQA 4PT5A 3VKHA 3AJIB 2DZOB 2K9DA 2M60A 1QZMA 3KOYE 4KO8A 1QZEA 1PJJA 2F5NA 2JY5A 5E6JA 1IN8A 4DUYM 1IBMM 3LCVB 2ZANA 3WHKA 3A45A 1QAMA 1E94E 5EP4A 1TDZA 3CF6E 4NRWA 4JI7M 3J80S 1YE9A 1ZMUA 1PRBA 3MJ5A 2RGOA 1HT2E 4IBBA 1OKSA 1XB2B 2HL7A 4PD2A 1DGHB 1JR3E 2DKLA 3CF0A 3GRUA 3LVVA 3Q8GA 3U60B 5L8RF 2JZ0A 4NSRA 1G8PA 4AKHA 1YSYA 2EKFA 2Y20A 4NC6A 2LVPC 1XXHB 2BWBA 4KT0F 4DV1M 4I5SA 2VQEM 4DR4M 2C9OA 3A98B 4JN6A 2QSFX 2KA6B 2YQZA 2KZUA 4B7HA 3M0EA 1JQJC 3HU2A 4LJ6A 4Z8XA 5FTNA 2UU9M 4II7A 3FTEA 1L1TA 3JAMS 3GRVA 3E9SA 4X66M 1T43A 1IXSA 1C7YA 4BB9A 4GEWA 1KSFX 3J7BA 1WGNA 3QAUA 2KHHA 5IWAM 1PJQA 1XWIA 2JNHA 3R8FA 3DOAA 4B3SM 1UM8A 1N32M 4DR1M 4REZA 3KOZE 1J7KA 1OQYA 5DFLA 4LF4M 3U6CA 3ZCBB 1GABA 1SG9A 4M9XA 5EXSA 4GHAA 1NV9A 4P17A 1IM2A 3U6OA 3U6SA 4LGMA 2JWSA 2CUZA 2XFTA 3J2PB 5KQDA 3B89A 3DZDA 3GLHA 2CHGA 3MHVC 4LF6M 2RKOA 1QQWA 2DAKA 3QYEA 2R4EA 1ZQ9A 4L4UA 5EP1A 3GPXA 2QBYB 3U61B 2L6OA 1JR3D 4I8OA 2J7NA 4LZJA 2FS1A 3UK6A 2Q2EB 4MH0E 1R2ZA 5KQ8A 2Z8YM 1TF0B 1CUKA 4LJ7A 2N35A 3MK6A 1NY5A 2KNZA 4NRVA 1I4WA 1HNXM 3SARA 1QDTA 4PDIA 2R65A 3U6DA 1WR1B 2KDLA 2RGHA 3RGPA 4QNMA 4OVZA 3SATA 3UGJA 1NSFA 4DV7M 4QOZC 2DZLA 5IREB 4LJAA 2VF8A 5ITTA 3T1YM 3T15A 5ITQA 3GLGE 2R18A 4LFAM 2X8AA 4UN2B 2G3QA 3GLIE 1GL6A 1FJGM 3M6AA 3RGSA 1QDRA 4MGKE 1P3QQ 2R46A 1L2BA 2A5YB 2B3TA 3FRHA 4CGYB 4DV2M 4MGIE 2ZBKB 3HJSA 4DR6M 4AKIA 1MJGM 1Z5BA 1MU5A 5DYIA 1IN4A 5JI3E 2HKJA 2LHGA 2X4AA 2XGNA 3UJNA 5KPTA 3FE3A 3T6PA 2GNOA 5EXPA 4MGZE 4AG5A 2RRUA 2CV0A 3ZQJA 2Z3XA 2C5RA 4L16A 3BBZA 2D7GA 5EP2A 4BLCA 2XEPA 4IBEA 4FWHA 4LFBM 1DO0A 1NV8A 3AFHA 3ILKA 5EQTA 4LFCM 2KRKA 3K9OA 3I4YA 1K3XA 2C98A 4I4LA 3FTFA 8CATA 3SMPA 2BWEA 4S12A 2ZAOA 2QCUA 1SXJA 1LV7A 2Z4SA 2KZSA 1MN3A 3HY5A 1NO1A 5DNYA 1IXSB 1VDDA 3GPYA 3FUTA 1OIZA 5EXTA 4FWDA 2YR0A 4JI8M 2CRUA 3GQ3A 4G4NA 1L1ZA 1D0MA 2R6FA 3J81S 3FKEA 4RF0A 3HJ8A 1S3SA 2K47A 2XSZD 4GHLA 3KVWA 2M5ZA 1N33M 3C58A 4FCTA 2H1RA 3FD9A 2DNAA 5F3WA 3SAUA 2FE8A 2JZ1A 4OX9M 4DV5M 1UFZA 2DI0A 1QAQA 3LCUA 4LF5M 3GLHB 4M0WA 4AW4A 4DV0M 3MMPA 1ZMWA 2Y21A 3A46A 4XK8F 1IY2A 1NY6A 4W5WA 4L8RC 3HJQA 3GLIA 1XNQM 1YUBA 1WIVA 4RF1A 4LRTA 1DGBA 4ANRA 2XSZA 1TH4A 1EIJA 1YLAA 1I94M 4JI6M 2O25A 1R5LA 1Q02A 2DWZB 2CFOA 4B3RM 1C1KA 3L26A 1G59A 3H4JA 4GRIA 4OU7A 2R45A 1NJFA 1QVRA 3FYCA 2Y0TA 5FTKA 1W5TA 1R2YA 1VDLA 2L7HA 3D8LA 4JYAM 1GO5A 4DR7M 1J09A 2BJVA 1OAIA 1NNJA 1A5TA 3TQSA 2XZFA 4OVZB 1Z5CA 3GO8A 3TE6A 3TWMA 2UXDM 3SAVA 1IFYA 3I04M 1XXHE 4CISA 3CTWB 3FRIA 4CHTB 2GQFA 1N77A 1XMOM 1WHCA 1NHGC 4PDGA 2DWNA 3B7NA 4G4QA 1IN7A 1L2CA 1N34M 2UUBM 3PNYA 2FH0A 3GLFE 1AIPC 2R62A 1V33A 2Y0QA 4DBGB 2K6BA 4JV5M 4L6V6 1NJGA 4NXMM 1Q3CA 3CF2A 4FWGA 1H6UA 1XHBA 4X64M 3V76A 2KXEA 4YHHM 2VQFM 2LVOC 1Y8GA 1TH2A 3B7ZA 3FUVA 3U6LA 3QYBA
chains in the Genus database with same CATH topology
2BNKA 2KRUA 3GRYA 2F5PA 2P5TA 1SXJC 3KOXE 4Z6YA 4B7GA 4DV6M 4IBFA 1SXJB 3W0FA 4XBOA 4AG6A 1IY0A 1DGFA 2I7PA 5FTLA 2VIIA 3SYLA 3R9XB 2DXIA 3GQ4A 1IQPA 4LJ8A 1K82A 4KODA 3JR4A 3FYDA 1GL7A 1JR3A 1NNUC 3K2LA 4GH9A 4ZPXA 4L15A 3U5ZA 4D82A 1Z6TA 1Z5AA 1T3TA 2F5SA 3ZH9B 4G4RA 3LMMA 3LVWA 2HHHM 1HQYE 5KO3A 3BOSA 4JI5M 4MGYE 3HHXA 2F4VM 4IBJA 4M9ZA 4G4OA 4TUWA 2XF3A 4MGHA 3KDSE 2F5QA 1N75A 4ITQA 4EIWA 3E4RA 1HNZM 3GLIB 1DO2A 4JI3M 2D7HA 4D80A 1GLNA 2EO2A 3J7AS 3B9PA 4L78A 2J7OA 3NWLA 3DA1A 1IBLM 1NVMA 2OPFA 1XC8A 3GLFA 4IBKA 2XFSA 3FTDA 4LJ4A 5ITRA 3SAWA 1E9SA 2CHQA 2Z7JA 3NBIA 5C1BA 1G41A 1GKIA 1G4AE 3RE8A 3L27A 4IBDA 5H37D 1R7RA 4FW9A 4AKGA 1XMQM 1TGUA 3PNVA 1E9RA 1K3WA 3I51A 4LJ5A 1HNWM 3VDPA 3KXEC 4LRSA 3TWKA 3THGA 3VK8A 1WXQA 1L2DA 3KS4A 5DYGA 1IBKM 4AI6A 7CATA 1PM5A 3IG8A 5EXXA 5EJCA 4GC5A 2I7NA 4LY6A 3VLFB 2E5LM 1Z59A 3SBJA 3RFWA 2O5RA 3GP1A 4FD2A 4NXNM 2XLJA 3K1JA 3WHLA 3SYKA 2FNAA 2JA2A 4DR3M 5EP3A 4GITA 1QAOA 4LCBA 3GLGA 4XGIA 5IT9S 3Q8XA 2QPAA 4JI2M 2XZUA 2C96A 3M7GA 4IIWA 4MB7A 4D81A 3VK7A 2QENA 2OQ4A 1KYIA 4G6ZA 2W82A 4JXJA 3SMSA 1N36M 4QNRA 4DUZM 3VDUA 2UXCM 2DWLA 3KW6A 4GKKM 4KLNA 3K92A 5KPZA 3U5ZB 4B3TM 4DR2M 4AQYM 1ORYB 2XH9A 1IN6A 4DV3M 4IJEA 3J27B 1MX0A 5ITXE 2YNMD 3U6EA 3I4VA 3K8ZA 4DR5M 4WURA 3AL0C 5FLXS 3GQ5A 4GKJM 3FTCA 2UUAM 2NQ8C 4R3DA 3HGIA 3AOEA 2L09A 1TDHA 1X37A 3HHWA 3SFZA 1QANA 3L2AA 4K0KM 2DZNB 5IZ7D 1PJIA 4DV4M 3TL4X 3LQRA 4HLQA 3U6QA 2DWMA 4LF9M 1EE8A 2CHVA 2V1CA 5ITYA 3GLFB 4WW0A 3L25A 2KEBA 4X62M 3PXGA 5GKNA 4I81A 5LMUM 2CV1A 3SHFA 3FUXA 4PCZA 3W0LB 2CV2A 4KHPM 3LQQA 2C9CA 4FCVA 3SHGB 2ZAMA 3SASA 2Z4RA 3A42A 2EUCA 4NSOB 3U6MA 1J5EM 1ZAEA 3HWSA 1IY1A 5KPRA 5ITUA 3EIHA 2X49A 1R6BX 2KW0A 2LNHC 4OW0A 4FCWA 4YY3M 2FOIC 2LH0A 2HCBA 4LGYA 3SC3A 1SXJE 4IBCA 4LJ9A 2D7EA 4X65M 1HR0M 2DHRA 1DGGA 3U6PA 5JI2E 4BBAA 4JI1M 1IXRC 1DGHA 3PVSA 2F5OA 3U60A 1OFIA 3JR5A 1XNRM 4GMQA 1N78A 4MM3B 3TPZA 4R7GA 3GLGB 1XXHA 3KOWE 1Q3BA 5LMNM 4QHTA 2CEAA 5ITXA 1HT1E 2G5GX 3FUUA 3OTOM 3KSJA 3PFIA 2V1UA 4RNAA 1G3IA 2L7IA 5C18A 1OFHA 1W5SA 4B7FA 1NHWC 4B3MM 2DVWB 4B08A 4LZZA 4IBGA 4GC9A 3GPPA 2EA0A 3VKGA 5FTMA 4IJFA 3H4MA 4NL4H 2QP9X 3HKPA 4IBIA 4LF8M 1FNNA 3KSXA 3L28A 1D2NA 3KP0E 2G8LA 1OJLA 3AKZA 3HHZA 1SXJD 2UXBM 3AV0A 4M9SA 4NOOB 4JI0M 4LG2A 1IXZA 4QOSA 3L29A 4P16A 2R4JA 1TH3A 5BR8M 2QBYA 3FUWA 3AOEC 3T38A 1IN5A 3HU3A 3QWLA 1QYRA 3DFZA 3U61A 3KFUG 2FFJA 3UZUA 3D8BA 1Q39A 2C99A 4JYAM 2CE7A 1E32A 1L8QA 3HHYA 5FSWA 3IG5A 1GVNA 5E26A 4QHSA 3EIEA 2AHMA 3GPUA 4M0DA 3HU1A 5A2QS 3KS8A 3UMMA 1KFVA 2LWXA 2ZM6M 2UUCM 3VFDA 3T1HM 2QZ4A 4HL4A 2V6ZM 3AOGA 4LF7M 4AZFA 2LXEA 5BPVA 3ZC7B 3TWLA 4GIPA 3GRRA 3KP1E 4A3VB 2ERCA 4FVMA 5FTJA 2BJWA 1HQCA 2YFQA 4PT5A 3VKHA 3AJIB 2DZOB 2M60A 1QZMA 3KOYE 4KO8A 1PJJA 2F5NA 5E6JA 1IN8A 4DUYM 1IBMM 2ZANA 3WHKA 3A45A 1QAMA 1E94E 5EP4A 1TDZA 3CF6E 4NRWA 4JI7M 3J80S 1YE9A 3MJ5A 2RGOA 1HT2E 4IBBA 2HL7A 4PD2A 1DGHB 3CF0A 3U60B 3GRUA 3LVVA 4NSRA 1G8PA 4AKHA 1YSYA 2Y20A 1XXHB 4DV1M 4I5SA 2VQEM 4DR4M 2C9OA 3A98B 4JN6A 2KA6B 2YQZA 2KZUA 4B7HA 3M0EA 1JQJC 3HU2A 4LJ6A 4Z8XA 5FTNA 2UU9M 4II7A 3FTEA 1L1TA 3JAMS 3GRVA 3E9SA 4X66M 4BB9A 1KSFX 3J7BA 3QAUA 5IWAM 1XWIA 3R8FA 3DOAA 4B3SM 1UM8A 1N32M 4DR1M 4REZA 3KOZE 1J7KA 4LF4M 3U6CA 3ZCBB 4M9XA 5EXSA 4GHAA 1IM2A 3U6OA 3U6SA 4LGMA 2CUZA 2XFTA 3J2PB 5KQDA 3DZDA 3GLHA 2CHGA 3MHVC 4LF6M 2RKOA 1QQWA 2R4EA 1ZQ9A 4L4UA 5EP1A 3GPXA 2QBYB 3U61B 2L6OA 1JR3D 4I8OA 2J7NA 4LZJA 3UK6A 2Q2EB 4MH0E 1R2ZA 5KQ8A 4LJ7A 3MK6A 1NY5A 4NRVA 1I4WA 1HNXM 3SARA 4PDIA 2R65A 3U6DA 2RGHA 3RGPA 4QNMA 4OVZA 3SATA 3UGJA 1NSFA 4DV7M 4QOZC 5IREB 4LJAA 5ITTA 3T1YM 3T15A 5ITQA 2R18A 4LFAM 2X8AA 1GL6A 1FJGM 3M6AA 3RGSA 4MGKE 2R46A 1L2BA 2A5YB 4CGYB 4DV2M 4MGIE 2ZBKB 3HJSA 4DR6M 4AKIA 1Z5BA 5DYIA 1MU5A 5JI3E 1IN4A 2HKJA 2X4AA 2XGNA 3UJNA 5KPTA 5EXPA 4MGZE 4AG5A 2CV0A 2Z3XA 2C5RA 4L16A 5EP2A 2D7GA 4BLCA 2XEPA 4IBEA 4FWHA 4LFBM 1DO0A 3AFHA 3ILKA 5EQTA 4LFCM 2KRKA 3I4YA 1K3XA 2C98A 4I4LA 3FTFA 8CATA 3SMPA 4S12A 2ZAOA 2QCUA 1SXJA 1LV7A 2Z4SA 2KZSA 5DNYA 1IXSB 1VDDA 3GPYA 3FUTA 5EXTA 4FWDA 2YR0A 4JI8M 3GQ3A 4G4NA 1L1ZA 3J81S 3FKEA 4RF0A 3HJ8A 1S3SA 2K47A 2XSZD 4GHLA 3KVWA 2M5ZA 1N33M 3C58A 4FCTA 2H1RA 3FD9A 5F3WA 3SAUA 2FE8A 4OX9M 4DV5M 1QAQA 4LF5M 3GLHB 4M0WA 4AW4A 4DV0M 2Y21A 3A46A 1IY2A 1NY6A 4W5WA 4L8RC 3HJQA 3GLIA 1XNQM 1YUBA 4RF1A 4LRTA 1DGBA 2XSZA 1TH4A 1I94M 4JI6M 2DWZB 2CFOA 4B3RM 1C1KA 3L26A 1G59A 4GRIA 4OU7A 2R45A 1NJFA 1QVRA 3FYCA 2Y0TA 5FTKA 1W5TA 1R2YA 2L7HA 3D8LA 4DR7M 1J09A 2BJVA 1NNJA 3TQSA 2XZFA 4OVZB 1Z5CA 3GO8A 3TE6A 3TWMA 2UXDM 3SAVA 4CISA 3CTWB 4CHTB 1N77A 1XMOM 1NHGC 4PDGA 2DWNA 4G4QA 1IN7A 1L2CA 1N34M 2UUBM 3PNYA 2R62A 2Y0QA 4JV5M 1NJGA 4NXMM 1Q3CA 3CF2A 4FWGA 1H6UA 1XHBA 4X64M 2KXEA 4YHHM 2VQFM 1TH2A 3FUVA 4JI4M 3U6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 2BNK A;  2KRU A;  3GRY A;  4F1I A;  2F5P A;  2MH8 A;  2OOA A;  2P5T A;  4CIZ A;  1SXJ C;  2DHY A;  2L4F A;  3KOX E;  4Y28 F;  4Z6Y A;  4B7G A;  4DV6 M;  4Q7J A;  4IBF A;  1SXJ B;  3W0F A;  4XBO A;  4AG6 A;  1IY0 A;  3I01 M;  1DGF A;  3W68 A;  2I7P A;  5FTL A;  2VII A;  3SYL A;  3R9X B;  2DXI A;  3GQ4 A;  1IQP A;  4LJ8 A;  3B74 A;  1K82 A;  4KOD A;  3JR4 A;  3FYD A;  1GL7 A;  1JR3 A;  1NNU C;  2QNJ A;  3K2L A;  4GH9 A;  4ZPX A;  4L15 A;  3U5Z A;  1VG5 A;  4G3O A;  4D82 A;  1Z6T A;  1Z5A A;  1T3T A;  2F5S A;  3ZH9 B;  2OO9 A;  4G4R A;  3LMM A;  3LVW A;  2HHH M;  2LVQ D;  2WSF F;  1HQY E;  5KO3 A;  3BOS A;  3CGW A;  1OIP A;  4JI5 M;  4MGY E;  3HHX A;  3F92 A;  1QUT A;  2MGW A;  2F4V M;  4IBJ A;  4M9Z A;  4G4O A;  4TUW A;  2XF3 A;  2APL A;  3KDS E;  2DAM A;  4MGH A;  1N75 A;  2F5Q A;  4ITQ A;  4EIW A;  2R44 A;  3C3D A;  3E4R A;  1HNZ M;  2HWJ A;  3GLI B;  1DO2 A;  4JI3 M;  2D7H A;  4D80 A;  1GLN A;  2EO2 A;  3J7A S;  3B9P A;  4L78 A;  2J7O A;  3NWL A;  3DA1 A;  1IBL M;  1NVM A;  2OPF A;  1XC8 A;  3GLF A;  2JY6 B;  4IBK A;  2XFS A;  3FTD A;  4LJ4 A;  2QQ8 A;  5ITR A;  3SAW A;  1E9S A;  1D0L A;  2CHQ A;  2MR9 A;  2Z7J A;  4R71 A;  3NBI A;  5C1B A;  1V92 A;  2VDB B;  1G41 A;  1GKI A;  1G4A E;  3RE8 A;  3L27 A;  4F2L A;  4IBD A;  3E46 A;  5H37 D;  1R7R A;  4FW9 A;  4JI4 M;  4AKG A;  1XMQ M;  1TGU A;  3PNV A;  1E9R A;  1K3W A;  3I51 A;  4LJ5 A;  1HNW M;  3VDP A;  3KXE C;  4LRS A;  3TWK A;  3THG A;  3VK8 A;  3IHP A;  1WXQ A;  1L2D A;  3NBX X;  3KS4 A;  5DYG A;  1IBK M;  4AI6 A;  7CAT A;  3BXW A;  1PM5 A;  3IG8 A;  5EXX A;  2KNA A;  5EJC A;  4GC5 A;  2I7N A;  4LY6 A;  3VLF B;  2E5L M;  1Z59 A;  3C9P A;  3SBJ A;  1D0K A;  2WSC F;  3RFW A;  2O5R A;  3GP1 A;  4FD2 A;  2DEN A;  4NXN M;  2XLJ A;  2HAK A;  3K1J A;  3WHL A;  3SYK A;  2FNA A;  2JA2 A;  4DR3 M;  5EP3 A;  4GIT A;  1QAO A;  4LCB A;  3GLG A;  4HEO A;  4XGI A;  5IT9 S;  3Q8X A;  2QPA A;  4JI2 M;  1JB0 F;  2KNV A;  2XZU A;  2EKK A;  2C96 A;  3M7G A;  4IIW A;  3GLH E;  1ZV1 A;  4MB7 A;  4D81 A;  3VK7 A;  3K9P A;  1TTE A;  2QEN A;  2OQ4 A;  1KYI A;  4G6Z A;  3E21 A;  2W82 A;  4JXJ A;  1LTM A;  3SMS A;  1N36 M;  4QNR A;  4DUZ M;  3VDU A;  2UXC M;  1GJT A;  2DWL A;  3KW6 A;  3C3E A;  4KLN A;  3K92 A;  5KPZ A;  3U5Z B;  4B3T M;  4GKK M;  4DR2 M;  4AQY M;  1ORY B;  2JY8 A;  1IN6 A;  2XH9 A;  1DV0 A;  4DV3 M;  4IJE A;  1VQ1 A;  3J27 B;  1MX0 A;  5ITX E;  2YNM D;  3U6E A;  1T6O A;  3I4V A;  3K8Z A;  4DR5 M;  4WUR A;  3AL0 C;  2VF7 A;  2J5Y A;  5FLX S;  3GQ5 A;  4GKJ M;  2DAE A;  3FTC A;  2H5X A;  2UUA M;  2NQ8 C;  4R3D A;  3HGI A;  3AOE A;  2L09 A;  1TDH A;  2JP7 A;  1X37 A;  3HHW A;  3SFZ A;  1QAN A;  3L2A A;  4K0K M;  2DZN B;  5IZ7 D;  1PJI A;  4DV4 M;  1V34 A;  3TL4 X;  3LQR A;  4HLQ A;  3U6Q A;  2DWM A;  4LF9 M;  1EE8 A;  1WGL A;  2QHO B;  2L2D A;  2CHV A;  2V1C A;  5ITY A;  2WZJ A;  1WJ7 A;  3GLF B;  1OTR A;  4WW0 A;  3L25 A;  2KEB A;  1EFU B;  4X62 M;  3PXG A;  5GKN A;  4I81 A;  2JXN A;  5LMU M;  2CV1 A;  3SHF A;  3FUX A;  1ZMV A;  3W0L B;  4PCZ A;  2CV2 A;  4KHP M;  3LQQ A;  2C9C A;  4FCV A;  3SHG B;  1R4G A;  2ZAM A;  3SAS A;  2Z4R A;  3A42 A;  2EUC A;  4NSO B;  2L4E A;  3U6M A;  1J5E M;  1ZAE A;  3HWS A;  1IY1 A;  5KPR A;  5ITU A;  3EIH A;  1QUS A;  2X49 A;  1R6B X;  2KW0 A;  2LNH C;  4OW0 A;  4FCW A;  4YY3 M;  2FOI C;  2LH0 A;  2HCB A;  4LGY A;  3SC3 A;  3W67 A;  3LW5 F;  1SXJ E;  3IEC A;  4IBC A;  4LJ9 A;  2D7E A;  4X65 M;  1HR0 M;  1F4I A;  2DHR A;  1DGG A;  3U6P A;  1BVS A;  2ZTC A;  5JI2 E;  4BBA A;  4JI1 M;  1IXR C;  1DGH A;  3PVS A;  2F5O A;  3U60 A;  1OFI A;  3JR5 A;  1VEG A;  1XNR M;  4GMQ A;  1N78 A;  4MM3 B;  3TPZ A;  2DAI A;  4R7G A;  1XXH A;  3KOW E;  1Q3B A;  3GLG B;  2CP8 A;  4QHT A;  5LMN M;  2CEA A;  5ITX A;  2LBC A;  2JY7 A;  1HT1 E;  2G5G X;  2R0I A;  3FUU A;  3OTO M;  2LVA A;  3KSJ A;  3PFI A;  2V1U A;  4RNA A;  3HX3 A;  1G3I A;  1PJS A;  2MRO B;  2L7I A;  5C18 A;  1OFH A;  1W5S A;  4B7F A;  1NHW C;  1G71 A;  2DVW B;  4B08 A;  4B3M M;  4LZZ A;  4IBG A;  4GC9 A;  3GPP A;  2EA0 A;  3VKG A;  2O01 F;  4IJF A;  5FTM A;  3H4M A;  4NL4 H;  2QP9 X;  3HKP A;  4IBI A;  4LF8 M;  1FNN A;  3KSX A;  3L28 A;  1D2N A;  1OAO C;  3KP0 E;  2G8L A;  1OJL A;  3AKZ A;  3HHZ A;  1SXJ D;  2UXB M;  1GJS A;  1TR8 A;  3AV0 A;  4M9S A;  4NOO B;  1VEJ A;  2DAG A;  4JI0 M;  4LG2 A;  2WSE F;  1IXZ A;  3HZJ A;  4QOS A;  3L29 A;  4P16 A;  2R4J A;  1TH3 A;  3B7Q A;  5BR8 M;  2QBY A;  3FUW A;  3AOE C;  3T38 A;  1IN5 A;  1AUA A;  3HU3 A;  1QYR A;  3DFZ A;  3QWL A;  3U61 A;  1VEK A;  3KFU G;  2FFJ A;  3UZU A;  2MJ5 B;  3D8B A;  1Q39 A;  2C99 A;  2LVN C;  2LTU A;  2EJS A;  2CE7 A;  1E32 A;  1L8Q A;  2JUJ A;  2LHC A;  3HHY A;  2ZTD A;  5FSW A;  1GVN A;  1HJP A;  3IG5 A;  2OOB A;  1PGY A;  4QHS A;  5E26 A;  3EIE A;  2AHM A;  3GPU A;  4M0D A;  2CWB A;  3HU1 A;  5A2Q S;  3KS8 A;  4RKU F;  3UMM A;  2LWX A;  1KFV A;  2ZM6 M;  2UUC M;  3VFD A;  3T1H M;  2QZ4 A;  4HL4 A;  2V6Z M;  3AOG A;  2K0B X;  4LF7 M;  4AZF A;  4CJ6 A;  2LXE A;  5BPV A;  3ZC7 B;  1PJT A;  4WP2 A;  1RU3 A;  4GIP A;  3GRR A;  3TWL A;  3KP1 E;  4A3V B;  2ERC A;  4FVM A;  5FTJ A;  2BJW A;  1HQC A;  2YFQ A;  4PT5 A;  3VKH A;  3AJI B;  2DZO B;  2K9D A;  2M60 A;  1QZM A;  3KOY E;  4KO8 A;  1QZE A;  1PJJ A;  2F5N A;  2JY5 A;  5E6J A;  1IN8 A;  4DUY M;  1IBM M;  3LCV B;  2ZAN A;  3WHK A;  3A45 A;  1QAM A;  1E94 E;  5EP4 A;  1TDZ A;  3CF6 E;  4NRW A;  4JI7 M;  3J80 S;  1YE9 A;  1ZMU A;  1PRB A;  3MJ5 A;  2RGO A;  1HT2 E;  4IBB A;  1OKS A;  1XB2 B;  2HL7 A;  4PD2 A;  1DGH B;  1JR3 E;  2DKL A;  3CF0 A;  3GRU A;  3LVV A;  3Q8G A;  3U60 B;  5L8R F;  2JZ0 A;  4NSR A;  1G8P A;  4AKH A;  1YSY A;  2EKF A;  2Y20 A;  4NC6 A;  2LVP C;  1XXH B;  2BWB A;  4KT0 F;  4DV1 M;  4I5S A;  2VQE M;  4DR4 M;  2C9O A;  3A98 B;  4JN6 A;  2QSF X;  2KA6 B;  2YQZ A;  2KZU A;  4B7H A;  3M0E A;  1JQJ C;  3HU2 A;  4LJ6 A;  4Z8X A;  5FTN A;  2UU9 M;  4II7 A;  3FTE A;  1L1T A;  3JAM S;  3GRV A;  3E9S A;  4X66 M;  1T43 A;  1IXS A;  1C7Y A;  4BB9 A;  4GEW A;  1KSF X;  3J7B A;  1WGN A;  3QAU A;  2KHH A;  5IWA M;  1PJQ A;  1XWI A;  2JNH A;  3R8F A;  3DOA A;  4B3S M;  1UM8 A;  1N32 M;  4DR1 M;  4REZ A;  3KOZ E;  1J7K A;  1OQY A;  5DFL A;  4LF4 M;  3U6C A;  3ZCB B;  1GAB A;  1SG9 A;  4M9X A;  5EXS A;  4GHA A;  1NV9 A;  4P17 A;  1IM2 A;  3U6O A;  3U6S A;  4LGM A;  2JWS A;  2CUZ A;  2XFT A;  3J2P B;  5KQD A;  3B89 A;  3DZD A;  3GLH A;  2CHG A;  3MHV C;  4LF6 M;  2RKO A;  1QQW A;  2DAK A;  3QYE A;  2R4E A;  1ZQ9 A;  4L4U A;  5EP1 A;  3GPX A;  2QBY B;  3U61 B;  2L6O A;  1JR3 D;  4I8O A;  2J7N A;  4LZJ A;  2FS1 A;  3UK6 A;  2Q2E B;  4MH0 E;  1R2Z A;  5KQ8 A;  2Z8Y M;  1TF0 B;  1CUK A;  4LJ7 A;  2N35 A;  3MK6 A;  1NY5 A;  2KNZ A;  4NRV A;  1I4W A;  1HNX M;  3SAR A;  1QDT A;  4PDI A;  2R65 A;  3U6D A;  1WR1 B;  2KDL A;  2RGH A;  3RGP A;  4QNM A;  4OVZ A;  3SAT A;  3UGJ A;  1NSF A;  4DV7 M;  4QOZ C;  2DZL A;  5IRE B;  4LJA A;  2VF8 A;  5ITT A;  3T1Y M;  3T15 A;  5ITQ A;  3GLG E;  2R18 A;  4LFA M;  2X8A A;  4UN2 B;  2G3Q A;  3GLI E;  1GL6 A;  1FJG M;  3M6A A;  3RGS A;  1QDR A;  4MGK E;  1P3Q Q;  2R46 A;  1L2B A;  2A5Y B;  2B3T A;  3FRH A;  4CGY B;  4DV2 M;  4MGI E;  2ZBK B;  3HJS A;  4DR6 M;  4AKI A;  1MJG M;  1Z5B A;  1MU5 A;  5DYI A;  1IN4 A;  5JI3 E;  2HKJ A;  2LHG A;  2X4A A;  2XGN A;  3UJN A;  5KPT A;  3FE3 A;  3T6P A;  2GNO A;  5EXP A;  4MGZ E;  4AG5 A;  2RRU A;  2CV0 A;  3ZQJ A;  2Z3X A;  2C5R A;  4L16 A;  3BBZ A;  2D7G A;  5EP2 A;  4BLC A;  2XEP A;  4IBE A;  4FWH A;  4LFB M;  1DO0 A;  1NV8 A;  3AFH A;  3ILK A;  5EQT A;  4LFC M;  2KRK A;  3K9O A;  3I4Y A;  1K3X A;  2C98 A;  4I4L A;  3FTF A;  8CAT A;  3SMP A;  2BWE A;  4S12 A;  2ZAO A;  2QCU A;  1SXJ A;  1LV7 A;  2Z4S A;  2KZS A;  1MN3 A;  3HY5 A;  1NO1 A;  5DNY A;  1IXS B;  1VDD A;  3GPY A;  3FUT A;  1OIZ A;  5EXT A;  4FWD A;  2YR0 A;  4JI8 M;  2CRU A;  3GQ3 A;  4G4N A;  1L1Z A;  1D0M A;  2R6F A;  3J81 S;  3FKE A;  4RF0 A;  3HJ8 A;  1S3S A;  2K47 A;  2XSZ D;  4GHL A;  3KVW A;  2M5Z A;  1N33 M;  3C58 A;  4FCT A;  2H1R A;  3FD9 A;  2DNA A;  5F3W A;  3SAU A;  2FE8 A;  2JZ1 A;  4OX9 M;  4DV5 M;  1UFZ A;  2DI0 A;  1QAQ A;  3LCU A;  4LF5 M;  3GLH B;  4M0W A;  4AW4 A;  4DV0 M;  3MMP A;  1ZMW A;  2Y21 A;  3A46 A;  4XK8 F;  1IY2 A;  1NY6 A;  4W5W A;  4L8R C;  3HJQ A;  3GLI A;  1XNQ M;  1YUB A;  1WIV A;  4RF1 A;  4LRT A;  1DGB A;  4ANR A;  2XSZ A;  1TH4 A;  1EIJ A;  1YLA A;  1I94 M;  4JI6 M;  2O25 A;  1R5L A;  1Q02 A;  2DWZ B;  2CFO A;  4B3R M;  1C1K A;  3L26 A;  1G59 A;  3H4J A;  4GRI A;  4OU7 A;  2R45 A;  1NJF A;  1QVR A;  3FYC A;  2Y0T A;  5FTK A;  1W5T A;  1R2Y A;  1VDL A;  2L7H A;  3D8L A;  4JYA M;  1GO5 A;  4DR7 M;  1J09 A;  2BJV A;  1OAI A;  1NNJ A;  1A5T A;  3TQS A;  2XZF A;  4OVZ B;  1Z5C A;  3GO8 A;  3TE6 A;  3TWM A;  2UXD M;  3SAV A;  1IFY A;  3I04 M;  1XXH E;  4CIS A;  3CTW B;  3FRI A;  4CHT B;  2GQF A;  1N77 A;  1XMO M;  1WHC A;  1NHG C;  4PDG A;  2DWN A;  3B7N A;  4G4Q A;  1IN7 A;  1L2C A;  1N34 M;  2UUB M;  3PNY A;  2FH0 A;  3GLF E;  1AIP C;  2R62 A;  1V33 A;  2Y0Q A;  4DBG B;  2K6B A;  4JV5 M;  4L6V 6;  1NJG A;  4NXM M;  1Q3C A;  3CF2 A;  4FWG A;  1H6U A;  1XHB A;  4X64 M;  3V76 A;  2KXE A;  4YHH M;  2VQF M;  2LVO C;  1Y8G A;  1TH2 A;  3B7Z A;  3FUV A;  3U6L A;  3QYB A; 
#chains in the Genus database with same CATH homology
 2BNK A;  2KRU A;  3GRY A;  2F5P A;  2P5T A;  1SXJ C;  3KOX E;  4Z6Y A;  4B7G A;  4DV6 M;  4IBF A;  1SXJ B;  3W0F A;  4XBO A;  4AG6 A;  1IY0 A;  1DGF A;  2I7P A;  5FTL A;  2VII A;  3SYL A;  3R9X B;  2DXI A;  3GQ4 A;  1IQP A;  4LJ8 A;  1K82 A;  4KOD A;  3JR4 A;  3FYD A;  1GL7 A;  1JR3 A;  1NNU C;  3K2L A;  4GH9 A;  4ZPX A;  4L15 A;  3U5Z A;  4D82 A;  1Z6T A;  1Z5A A;  1T3T A;  2F5S A;  3ZH9 B;  4G4R A;  3LMM A;  3LVW A;  2HHH M;  1HQY E;  5KO3 A;  3BOS A;  4JI5 M;  4MGY E;  3HHX A;  2F4V M;  4IBJ A;  4M9Z A;  4G4O A;  4TUW A;  2XF3 A;  4MGH A;  3KDS E;  2F5Q A;  1N75 A;  4ITQ A;  4EIW A;  3E4R A;  1HNZ M;  3GLI B;  1DO2 A;  4JI3 M;  2D7H A;  4D80 A;  1GLN A;  2EO2 A;  3J7A S;  3B9P A;  4L78 A;  2J7O A;  3NWL A;  3DA1 A;  1IBL M;  1NVM A;  2OPF A;  1XC8 A;  3GLF A;  4IBK A;  2XFS A;  3FTD A;  4LJ4 A;  5ITR A;  3SAW A;  1E9S A;  2CHQ A;  2Z7J A;  3NBI A;  5C1B A;  1G41 A;  1GKI A;  1G4A E;  3RE8 A;  3L27 A;  4IBD A;  5H37 D;  1R7R A;  4FW9 A;  4AKG A;  1XMQ M;  1TGU A;  3PNV A;  1E9R A;  1K3W A;  3I51 A;  4LJ5 A;  1HNW M;  3VDP A;  3KXE C;  4LRS A;  3TWK A;  3THG A;  3VK8 A;  1WXQ A;  1L2D A;  3KS4 A;  5DYG A;  1IBK M;  4AI6 A;  7CAT A;  1PM5 A;  3IG8 A;  5EXX A;  5EJC A;  4GC5 A;  2I7N A;  4LY6 A;  3VLF B;  2E5L M;  1Z59 A;  3SBJ A;  3RFW A;  2O5R A;  3GP1 A;  4FD2 A;  4NXN M;  2XLJ A;  3K1J A;  3WHL A;  3SYK A;  2FNA A;  2JA2 A;  4DR3 M;  5EP3 A;  4GIT A;  1QAO A;  4LCB A;  3GLG A;  4XGI A;  5IT9 S;  3Q8X A;  2QPA A;  4JI2 M;  2XZU A;  2C96 A;  3M7G A;  4IIW A;  4MB7 A;  4D81 A;  3VK7 A;  2QEN A;  2OQ4 A;  1KYI A;  4G6Z A;  2W82 A;  4JXJ A;  3SMS A;  1N36 M;  4QNR A;  4DUZ M;  3VDU A;  2UXC M;  2DWL A;  3KW6 A;  4GKK M;  4KLN A;  3K92 A;  5KPZ A;  3U5Z B;  4B3T M;  4DR2 M;  4AQY M;  1ORY B;  2XH9 A;  1IN6 A;  4DV3 M;  4IJE A;  3J27 B;  1MX0 A;  5ITX E;  2YNM D;  3U6E A;  3I4V A;  3K8Z A;  4DR5 M;  4WUR A;  3AL0 C;  5FLX S;  3GQ5 A;  4GKJ M;  3FTC A;  2UUA M;  2NQ8 C;  4R3D A;  3HGI A;  3AOE A;  2L09 A;  1TDH A;  1X37 A;  3HHW A;  3SFZ A;  1QAN A;  3L2A A;  4K0K M;  2DZN B;  5IZ7 D;  1PJI A;  4DV4 M;  3TL4 X;  3LQR A;  4HLQ A;  3U6Q A;  2DWM A;  4LF9 M;  1EE8 A;  2CHV A;  2V1C A;  5ITY A;  3GLF B;  4WW0 A;  3L25 A;  2KEB A;  4X62 M;  3PXG A;  5GKN A;  4I81 A;  5LMU M;  2CV1 A;  3SHF A;  3FUX A;  4PCZ A;  3W0L B;  2CV2 A;  4KHP M;  3LQQ A;  2C9C A;  4FCV A;  3SHG B;  2ZAM A;  3SAS A;  2Z4R A;  3A42 A;  2EUC A;  4NSO B;  3U6M A;  1J5E M;  1ZAE A;  3HWS A;  1IY1 A;  5KPR A;  5ITU A;  3EIH A;  2X49 A;  1R6B X;  2KW0 A;  2LNH C;  4OW0 A;  4FCW A;  4YY3 M;  2FOI C;  2LH0 A;  2HCB A;  4LGY A;  3SC3 A;  1SXJ E;  4IBC A;  4LJ9 A;  2D7E A;  4X65 M;  1HR0 M;  2DHR A;  1DGG A;  3U6P A;  5JI2 E;  4BBA A;  4JI1 M;  1IXR C;  1DGH A;  3PVS A;  2F5O A;  3U60 A;  1OFI A;  3JR5 A;  1XNR M;  4GMQ A;  1N78 A;  4MM3 B;  3TPZ A;  4R7G A;  3GLG B;  1XXH A;  3KOW E;  1Q3B A;  5LMN M;  4QHT A;  2CEA A;  5ITX A;  1HT1 E;  2G5G X;  3FUU A;  3OTO M;  3KSJ A;  3PFI A;  2V1U A;  4RNA A;  1G3I A;  2L7I A;  5C18 A;  1OFH A;  1W5S A;  4B7F A;  1NHW C;  4B3M M;  2DVW B;  4B08 A;  4LZZ A;  4IBG A;  4GC9 A;  3GPP A;  2EA0 A;  3VKG A;  5FTM A;  4IJF A;  3H4M A;  4NL4 H;  2QP9 X;  3HKP A;  4IBI A;  4LF8 M;  1FNN A;  3KSX A;  3L28 A;  1D2N A;  3KP0 E;  2G8L A;  1OJL A;  3AKZ A;  3HHZ A;  1SXJ D;  2UXB M;  3AV0 A;  4M9S A;  4NOO B;  4JI0 M;  4LG2 A;  1IXZ A;  4QOS A;  3L29 A;  4P16 A;  2R4J A;  1TH3 A;  5BR8 M;  2QBY A;  3FUW A;  3AOE C;  3T38 A;  1IN5 A;  3HU3 A;  3QWL A;  1QYR A;  3DFZ A;  3U61 A;  3KFU G;  2FFJ A;  3UZU A;  3D8B A;  1Q39 A;  2C99 A;  4JYA M;  2CE7 A;  1E32 A;  1L8Q A;  3HHY A;  5FSW A;  3IG5 A;  1GVN A;  5E26 A;  4QHS A;  3EIE A;  2AHM A;  3GPU A;  4M0D A;  3HU1 A;  5A2Q S;  3KS8 A;  3UMM A;  1KFV A;  2LWX A;  2ZM6 M;  2UUC M;  3VFD A;  3T1H M;  2QZ4 A;  4HL4 A;  2V6Z M;  3AOG A;  4LF7 M;  4AZF A;  2LXE A;  5BPV A;  3ZC7 B;  3TWL A;  4GIP A;  3GRR A;  3KP1 E;  4A3V B;  2ERC A;  4FVM A;  5FTJ A;  2BJW A;  1HQC A;  2YFQ A;  4PT5 A;  3VKH A;  3AJI B;  2DZO B;  2M60 A;  1QZM A;  3KOY E;  4KO8 A;  1PJJ A;  2F5N A;  5E6J A;  1IN8 A;  4DUY M;  1IBM M;  2ZAN A;  3WHK A;  3A45 A;  1QAM A;  1E94 E;  5EP4 A;  1TDZ A;  3CF6 E;  4NRW A;  4JI7 M;  3J80 S;  1YE9 A;  3MJ5 A;  2RGO A;  1HT2 E;  4IBB A;  2HL7 A;  4PD2 A;  1DGH B;  3CF0 A;  3U60 B;  3GRU A;  3LVV A;  4NSR A;  1G8P A;  4AKH A;  1YSY A;  2Y20 A;  1XXH B;  4DV1 M;  4I5S A;  2VQE M;  4DR4 M;  2C9O A;  3A98 B;  4JN6 A;  2KA6 B;  2YQZ A;  2KZU A;  4B7H A;  3M0E A;  1JQJ C;  3HU2 A;  4LJ6 A;  4Z8X A;  5FTN A;  2UU9 M;  4II7 A;  3FTE A;  1L1T A;  3JAM S;  3GRV A;  3E9S A;  4X66 M;  4BB9 A;  1KSF X;  3J7B A;  3QAU A;  5IWA M;  1XWI A;  3R8F A;  3DOA A;  4B3S M;  1UM8 A;  1N32 M;  4DR1 M;  4REZ A;  3KOZ E;  1J7K A;  4LF4 M;  3U6C A;  3ZCB B;  4M9X A;  5EXS A;  4GHA A;  1IM2 A;  3U6O A;  3U6S A;  4LGM A;  2CUZ A;  2XFT A;  3J2P B;  5KQD A;  3DZD A;  3GLH A;  2CHG A;  3MHV C;  4LF6 M;  2RKO A;  1QQW A;  2R4E A;  1ZQ9 A;  4L4U A;  5EP1 A;  3GPX A;  2QBY B;  3U61 B;  2L6O A;  1JR3 D;  4I8O A;  2J7N A;  4LZJ A;  3UK6 A;  2Q2E B;  4MH0 E;  1R2Z A;  5KQ8 A;  4LJ7 A;  3MK6 A;  1NY5 A;  4NRV A;  1I4W A;  1HNX M;  3SAR A;  4PDI A;  2R65 A;  3U6D A;  2RGH A;  3RGP A;  4QNM A;  4OVZ A;  3SAT A;  3UGJ A;  1NSF A;  4DV7 M;  4QOZ C;  5IRE B;  4LJA A;  5ITT A;  3T1Y M;  3T15 A;  5ITQ A;  2R18 A;  4LFA M;  2X8A A;  1GL6 A;  1FJG M;  3M6A A;  3RGS A;  4MGK E;  2R46 A;  1L2B A;  2A5Y B;  4CGY B;  4DV2 M;  4MGI E;  2ZBK B;  3HJS A;  4DR6 M;  4AKI A;  1Z5B A;  5DYI A;  1MU5 A;  5JI3 E;  1IN4 A;  2HKJ A;  2X4A A;  2XGN A;  3UJN A;  5KPT A;  5EXP A;  4MGZ E;  4AG5 A;  2CV0 A;  2Z3X A;  2C5R A;  4L16 A;  5EP2 A;  2D7G A;  4BLC A;  2XEP A;  4IBE A;  4FWH A;  4LFB M;  1DO0 A;  3AFH A;  3ILK A;  5EQT A;  4LFC M;  2KRK A;  3I4Y A;  1K3X A;  2C98 A;  4I4L A;  3FTF A;  8CAT A;  3SMP A;  4S12 A;  2ZAO A;  2QCU A;  1SXJ A;  1LV7 A;  2Z4S A;  2KZS A;  5DNY A;  1IXS B;  1VDD A;  3GPY A;  3FUT A;  5EXT A;  4FWD A;  2YR0 A;  4JI8 M;  3GQ3 A;  4G4N A;  1L1Z A;  3J81 S;  3FKE A;  4RF0 A;  3HJ8 A;  1S3S A;  2K47 A;  2XSZ D;  4GHL A;  3KVW A;  2M5Z A;  1N33 M;  3C58 A;  4FCT A;  2H1R A;  3FD9 A;  5F3W A;  3SAU A;  2FE8 A;  4OX9 M;  4DV5 M;  1QAQ A;  4LF5 M;  3GLH B;  4M0W A;  4AW4 A;  4DV0 M;  2Y21 A;  3A46 A;  1IY2 A;  1NY6 A;  4W5W A;  4L8R C;  3HJQ A;  3GLI A;  1XNQ M;  1YUB A;  4RF1 A;  4LRT A;  1DGB A;  2XSZ A;  1TH4 A;  1I94 M;  4JI6 M;  2DWZ B;  2CFO A;  4B3R M;  1C1K A;  3L26 A;  1G59 A;  4GRI A;  4OU7 A;  2R45 A;  1NJF A;  1QVR A;  3FYC A;  2Y0T A;  5FTK A;  1W5T A;  1R2Y A;  2L7H A;  3D8L A;  4DR7 M;  1J09 A;  2BJV A;  1NNJ A;  3TQS A;  2XZF A;  4OVZ B;  1Z5C A;  3GO8 A;  3TE6 A;  3TWM A;  2UXD M;  3SAV A;  4CIS A;  3CTW B;  4CHT B;  1N77 A;  1XMO M;  1NHG C;  4PDG A;  2DWN A;  4G4Q A;  1IN7 A;  1L2C A;  1N34 M;  2UUB M;  3PNY A;  2R62 A;  2Y0Q A;  4JV5 M;  1NJG A;  4NXM M;  1Q3C A;  3CF2 A;  4FWG A;  1H6U A;  1XHB A;  4X64 M;  2KXE A;  4YHH M;  2VQF M;  1TH2 A;  3FUV A;  4JI4 M;  3U6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...