3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords RcdA
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
4IBJA 3GQ4A 2XZFA 3B7QA 5LMUM 1K3WA 2CP8A 4MH0E 4GIPA 3UK6A 4AG6A 5IWAM 3AKZA 1KSFX 2R6FA 4MGIE 1ZAEA 3J7BA 5ITXA 2RGOA 3GLFE 1PJQA 3FTDA 2E5LM 2CFOA 3R8FA 3FUXA 3K2LA 1MX0A 2KXEA 4LCBA 1QAMA 1NNUC 1D2NA 1YLAA 2BJVA 2DAKA 3MJ5A 4MGZE 4RF0A 4DUZM 1SXJA 2LVNC 1ZMWA 3GO8A 3K1JA 3BOSA 2XZUA 1IY2A 3GLIB 1S3SA 4IBBA 1QAQA 1L8QA 2VF8A 2JNHA 2W82A 4R3DA 3MK6A 4YY3M 2FH0A 4QNRA 3GQ5A 3C9PA 2JXNA 3L25A 1TH3A 3B9PA 2QP9X 3FUUA 3GQ3A 5A2QS 4DV5M 2C5RA 2DWMA 1XWIA 2BJWA 1XHBA 2N35A 2VIIA 2DHYA 1PJTA 4NSRA 4GEWA 3U61B 1DGGA 1HJPA 2I7PA 3HY5A 4LJ6A 3SHGB 3AL0C 3UMMA 4RNAA 3U5ZA 4X66M 2LHCA 3RGSA 2LVPC 3ZC7B 2WZJA 2BWBA 3E9SA 2GNOA 3L27A 4OW0A 4IBIA 7CATA 1EIJA 2L2DA 3GLFA 3AV0A 4MGHA 3SAVA 1XMQM 1ZQ9A 3ZQJA 4CISA 4OVZB 5ITYA 3B89A 4QOSA 4L4UA 4I4LA 4AW4A 1HT1E 4KT0F 5C1BA 2WSEF 1WIVA 1G4AE 4AQYM 1XNRM 1IN8A 4GRIA 5EP2A 3U61A 1PM5A 2Y0QA 2D7EA 2L4EA 4JI8M 4I81A 2LXEA 2DENA 3PVSA 3SBJA 2QBYA 1Z6TA 1F4IA 2R45A 3ZH9B 3VLFB 1BVSA 5IZ7D 1XNQM 1N78A 3THGA 3TWMA 1C1KA 4EIWA 2G3QA 4NSOB 1OFHA 1FJGM 3H4MA 4IBEA 1L1ZA 3T1YM 3KP0E 1SXJD 1PRBA 2KZUA 3KOZE 1RU3A 4FWGA 4BB9A 2HKJA 3U6MA 3U6SA 1NVMA 1GL7A 2DWZB 2WSFF 4OVZA 1L2DA 3IG5A 4QOZC 4AKIA 2HL7A 2QCUA 5E6JA 2OO9A 1T6OA 2HWJA 4GC5A 4RKUF 3IG8A 2UUCM 4LF6M 1Z5CA 1XC8A 2R46A 3LCVB 3RE8A 4GKKM 2CUZA 2ERCA 3CGWA 2NQ8C 2FE8A 2B3TA 4LFCM 4BLCA 1NHWC 3L2AA 4LJ4A 1GJTA 3W0FA 2JZ0A 2F5QA 3NBXX 1G41A 2KHHA 4PDIA 5KQDA 1Z59A 5KQ8A 2UXBM 1TR8A 3HHXA 4HEOA 2H1RA 3K9OA 2C9CA 3Q8GA 4GITA 4LGMA 2JY7A 1R2YA 3TQSA 5ITXE 3SYLA 4LJAA 4NRWA 4ZPXA 4MGYE 3HJQA 1N34M 4LFAM 2KNVA 4X65M 4Y28F 2F5SA 3EIEA 3CF0A 1SXJE 1OAIA 4YHHM 4DV7M 4HL4A 4WURA 4DUYM 4OX9M 2AHMA 1R4GA 2WSCF 3GPPA 5BPVA 3U6QA 5EP4A 1WJ7A 4B7FA 4HLQA 1GLNA 1UM8A 1GJSA 2YQZA 3LCUA 4NL4H 2XGNA 3VKHA 3A45A 4M9ZA 2V1UA 2DVWB 1VQ1A 2OQ4A 1C7YA 5FTLA 4XBOA 2O01F 3ZCBB 2R65A 1JR3A 2XF3A 4R7GA 3GRUA 4LF7M 1IN6A 3KS4A 1E94E 4DV4M 3FUVA 2KA6B 3T38A 4K0KM 2OOBA 3VKGA 4KHPM 4GH9A 4DR2M 2LHGA 1W5SA 2XSZA 1PGYA 3FE3A 4LJ8A 3QAUA 4BBAA 2OPFA 1IM2A 2APLA 3SC3A 4G4RA 1DO2A 2R62A 4L78A 3GLIE 3D8BA 3DOAA 3GPUA 2G8LA 2GQFA 4UN2B 1OAOC 1Z5BA 3E4RA 3OTOM 4XGIA 4QNMA 2O25A 1OFIA 3U6CA 4MB7A 3HZJA 2C98A 3M7GA 1NY5A 4GHAA 3DFZA 1WXQA 1NSFA 4LRSA 2LH0A 3HHZA 2DWNA 3R9XB 1V33A 1Q3BA 1NJGA 3QYEA 1OIPA 2MGWA 3VK7A 1E32A 3D8LA 1CUKA 4L16A 4JYAM 1YUBA 2A5YB 2EO2A 3DZDA 1NV9A 5ITRA 3CTWB 3HHWA 4B3SM 1MJGM 1E9RA 2KRUA 2DAMA 4B3MM 1VEJA 2QSFX 5F3WA 3ILKA 2RRUA 4JV5M 3Q8XA 2JUJA 5EXPA 1LTMA 1QUSA 3PNVA 2J5YA 1D0KA 2M5ZA 1TF0B 2JY5A 2R18A 5DFLA 1TH2A 3TPZA 3U6LA 2QPAA 1VEKA 3FTCA 4P16A 1G59A 2JP7A 1HNZM 2K0BX 3KW6A 1NV8A 1TGUA 2RKOA 2MJ5B 3CF6E 3LVVA 1IY0A 2EJSA 1H6UA 4P17A 3SFZA 1HQCA 1VDLA 2V1CA 1MU5A 4LJ7A 1YE9A 3VDUA 5C18A 5FTNA 3GLIA 2OOAA 2Z3XA 2EKFA 4GHLA 3T1HM 4LG2A 1HR0M 1N36M 4AG5A 1J5EM 2DI0A 4M0DA 1DO0A 4GKJM 1KFVA 1EFUB 3HJSA 1JR3D 1Q39A 3PNYA 2BWEA 2L7IA 3SASA 3VDPA 3J80S 1HNXM 2MR9A 1QVRA 1FNNA 2V6ZM 4I5SA 4LZJA 3U6OA 1QDTA 1YSYA 2Z4RA 3C3EA 3KSJA 5EXSA 1PJIA 3HU1A 1QYRA 4JI2M 2XSZD 4LJ9A 3U60B 4DV0M 2R4JA 3AJIB 1IBKM 4JI0M 4FCWA 5JI2E 4KLNA 1IXSB 3FRIA 1DGHB 3HKPA 4AKHA 3J81S 3MHVC 1QZEA 2CV1A 1GVNA 2BNKA 2LVQD 1R6BX 3B74A 3FKEA 1N32M 1G3IA 5KPRA 2X49A 5FTKA 4IJEA 5FTJA 4DR1M 4W5WA 2H5XA 3M0EA 2ZAMA 4REZA 2DAEA 2K9DA 3FD9A 2UUAM 2F4VM 3CF2A 3JR4A 1EE8A 5EP3A 4OU7A 1Y8GA 2EKKA 3SMPA 2DZLA 3FYDA 1TTEA 2FOIC 4JI4M 2K47A 2UXCM 3L29A 1JR3E 3GRVA 1XXHB 3U60A 2X8AA 2R0IA 3K92A 2P5TA 4NOOB 1VEGA 1HT2E 4WP2A 3TWLA 1IXSA 4CJ6A 3C58A 5FSWA 2CE7A 3JAMS 2I7NA 3SATA 2KDLA 3T6PA 3FRHA 4G4OA 1WGLA 2HAKA 3GP1A 1WGNA 2UU9M 4DR4M 2VQFM 4FD2A 3JR5A 4AKGA 4B08A 2L4FA 4Q7JA 1R2ZA 3KSXA 3KFUG 3GLHB 2QNJA 2LWXA 5H37D 2XEPA 3SAWA 3VFDA 4LF9M 4NXMM 5IT9S 3KP1E 2Z8YM 2EUCA 5LMNM 3IECA 1QQWA 4G3OA 4KODA 2F5PA 4B3TM 2HHHM 1IN7A 3J7AS 3DA1A 3L28A 3UZUA 4QHSA 1XXHA 1ZV1A 2R44A 3HX3A 5EJCA 2L09A 2DHRA 3FUWA 2CRUA 1WHCA 1IY1A 2L6OA 3TWKA 3A98B 2XFSA 2G5GX 4FWDA 3W0LB 4G4NA 4LZZA 5E26A 1T43A 5EP1A 1TDHA 2LVAA 3H4JA 1N75A 4LGYA 4DV6M 1V92A 3EIHA 3LW5F 1L2CA 2M60A 3AFHA 4Z8XA 1IN5A 3TE6A 2Z4SA 1IN4A 4CIZA 2CHGA 3PXGA 2CEAA 4FVMA 5ITQA 4LF8M 4LRTA 5ITUA 1XB2B 1IBMM 4JI6M 1T3TA 2J7NA 4GMQA 2C99A 2LVOC 4JI5M 2L7HA 3UJNA 3HU2A 4JI7M 1IQPA 3KS8A 3LVWA 1DGFA 1WR1B 4LF4M 2ZBKB 3KDSE 3SYKA 1LV7A 3KOYE 2XLJA 2Q2EB 4FCVA 4M9XA 1DGBA 2QZ4A 1J09A 4M9SA 5FLXS 1VDDA 4D82A 3RFWA 2DXIA 4IBKA 2VDBB 1N77A 2FS1A 2Y21A 1IBLM 5EQTA 2KW0A 5DYIA 4LFBM 1IXZA 2R4EA 1L2BA 3BXWA 4JI1M 1XMOM 5KPZA 3U5ZB 1NHGC 4JN6A 2DKLA 1NY6A 2JZ1A 4L8RC 5ITTA 3HWSA 4FCTA 1DV0A 1AIPC 4B3RM 2UUBM 3C3DA 3F92A 2JY8A 3GLFB 2LBCA 3GLGE 2QENA 5IREB 1K82A 1Q3CA 1R7RA 1TH4A 1ZMVA 3AOEC 4JXJA 3LMMA 2C9OA 2EA0A 1PJJA 4R71A 1NJFA 2Z7JA 1N33M 1Z5AA 3KOXE 3HU3A 3K8ZA 2ZAOA 3FUTA 2ZTCA 3GLGB 4II7A 3NBIA 1UFZA 3W67A 2KNAA 4PDGA 2FFJA 2QBYB 4DR3M 1J7KA 1OKSA 4IBCA 5KPTA 3WHLA 1GL6A 8CATA 3J2PB 2VQEM 2F5OA 3LQRA 3T15A 2JA2A 4FWHA 3U6DA 3M6AA 4DV3M 2ZTDA 2LTUA 4QHTA 3SAUA 1VG5A 2LNHC 2D7HA 3QYBA 1IXRC 4ANRA 3LQQA 3RGPA 1I94M 2DZNB 3FTFA 3E46A 2C96A 1XXHE 1A5TA 3VK8A 3KOWE 4G4QA 1OIZA 1V34A 2KRKA 3GPYA 2Y20A 2JWSA 5DYGA 2FNAA 4LJ5A 3I04M 2X4AA 3A42A 2YNMD 4MGKE 1E9SA 3KVWA 4D80A 4D81A 3UGJA 3V76A 2MH8A 3GLGA 1JB0F 1P3QQ 3SMSA 3U6EA 4DV1M 1OJLA 3IHPA 3FYCA 1SXJC 1QZMA 1OTRA 5GKNA 4F1IA 1SG9A 2CHVA 2O5RA 4G6ZA 1QANA 1DGHA 3GLHE 4GC9A 2F5NA 4NXNM 4L15A 4DR6M 3L26A 2KZSA 1PJSA 4LY6A 1GABA 1G8PA 1G71A 4KO8A 3I4YA 4DR7M 1QUTA 4WW0A 2YFQA 3BBZA 4IBGA 4RF1A 3QWLA 2QQ8A 3FTEA 4S12A 4PD2A 3WHKA 3B7NA 1X37A 5DNYA 3W68A 4IBDA 4A3VB 1IFYA 2DAGA 1ZMUA 4X64M 2RGHA 4PT5A 3PFIA 1W5TA 3SHFA 2CV0A 2KNZA 2HCBA 2CHQA 1NO1A 4XK8F 5FTMA 4LF5M 3U6PA 1KYIA 4DV2M 4TUWA 1QDRA 2QHOB 4NC6A 3I4VA 4B7GA 2DAIA 3B7ZA 2DNAA 4NRVA 4M0WA 2K6BA 3A46A 4AI6A 3HGIA 4PCZA 2CV2A 3J27B 2JY6B 1TDZA 3TL4X 4B7HA 3AOEA 3GRRA 1AUAA 3GLHA 3GRYA 4IBFA 1D0MA 1OQYA 3HHYA 2D7GA 5KO3A 2Y0TA 2DWLA 4X62M 5JI3E 2YR0A 4AZFA 4ITQA 1Q02A 4CGYB 2UXDM 3KXEC 1GO5A 3AOGA 5BR8M 3K9PA 2KEBA 1NNJA 1L1TA 4L6V6 1GKIA 1I4WA 2DZOB 1HNWM 2ZANA 4I8OA 1HQYE 3MMPA 2J7OA 4F2LA 4DR5M 4IJFA 4MM3B 3SARA 1SXJB 1MN3A 3I01M 1K3XA 5EXTA 2XH9A 4FW9A 5EXXA 4CHTB 4IIWA 1ORYB 2ZM6M 1JQJC 3I51A 2VF7A 4Z6YA 4JI3M 1QAOA 2MROB 1R5LA 2XFTA 3HJ8A 2CWBA 3E21A 3NWLA 5L8RF 4DBGB 3GPXA 1D0LA
chains in the Genus database with same CATH topology
4IBJA 3GQ4A 2XZFA 1K3WA 5LMUM 4MH0E 4GIPA 3UK6A 4AG6A 5IWAM 3AKZA 1KSFX 4MGIE 1ZAEA 3J7BA 5ITXA 2RGOA 2E5LM 3FTDA 2CFOA 3R8FA 3K2LA 3FUXA 1MX0A 2KXEA 4LCBA 1QAMA 1NNUC 1D2NA 2BJVA 3MJ5A 4MGZE 4RF0A 4DUZM 1SXJA 3GO8A 3K1JA 3BOSA 2XZUA 1IY2A 3GLIB 1S3SA 4IBBA 1QAQA 1L8QA 2W82A 4R3DA 3MK6A 4YY3M 4QNRA 3GQ5A 3L25A 1TH3A 3B9PA 2QP9X 3FUUA 3GQ3A 2DWMA 4DV5M 2C5RA 1XWIA 2BJWA 1XHBA 2VIIA 4NSRA 3U61B 1DGGA 2I7PA 4LJ6A 3SHGB 3AL0C 3UMMA 4RNAA 3U5ZA 4X66M 3RGSA 3ZC7B 3E9SA 3L27A 4OW0A 4IBIA 7CATA 3GLFA 3AV0A 4MGHA 3SAVA 1XMQM 1ZQ9A 4CISA 4OVZB 5ITYA 4QOSA 4L4UA 4I4LA 4AW4A 1HT1E 5C1BA 1G4AE 4AQYM 1XNRM 1IN8A 4GRIA 5EP2A 3U61A 1PM5A 2Y0QA 2D7EA 4JI8M 4I81A 2LXEA 3SBJA 3PVSA 2QBYA 1Z6TA 2R45A 3ZH9B 3VLFB 5IZ7D 1XNQM 1N78A 3THGA 3TWMA 1C1KA 4EIWA 4NSOB 1OFHA 1FJGM 3H4MA 4IBEA 1L1ZA 3T1YM 3KP0E 1SXJD 3KOZE 2KZUA 4FWGA 4BB9A 3U6MA 2HKJA 3U6SA 1NVMA 1GL7A 2DWZB 4OVZA 1L2DA 4QOZC 3IG5A 4AKIA 2HL7A 2QCUA 5E6JA 4GC5A 3IG8A 2UUCM 4LF6M 1Z5CA 1XC8A 2R46A 3RE8A 4GKKM 2CUZA 2ERCA 2NQ8C 2FE8A 4LFCM 4BLCA 1NHWC 3L2AA 4LJ4A 3W0FA 2F5QA 1G41A 5KQ8A 4PDIA 5KQDA 1Z59A 2UXBM 3HHXA 2H1RA 2C9CA 4GITA 4LGMA 1R2YA 3TQSA 5ITXE 3SYLA 4LJAA 4NRWA 4ZPXA 4MGYE 3HJQA 1N34M 4LFAM 4X65M 2F5SA 3EIEA 3CF0A 1SXJE 4YHHM 4DV7M 4HL4A 4WURA 4DUYM 4OX9M 2AHMA 3GPPA 5BPVA 3U6QA 5EP4A 4B7FA 4HLQA 1GLNA 1UM8A 2YQZA 4NL4H 2XGNA 3VKHA 3A45A 4M9ZA 2V1UA 2DVWB 2OQ4A 5FTLA 4XBOA 3ZCBB 2R65A 1JR3A 2XF3A 4R7GA 3GRUA 4LF7M 1IN6A 3KS4A 1E94E 4DV4M 3FUVA 2KA6B 3T38A 4K0KM 3VKGA 4KHPM 4GH9A 4DR2M 1W5SA 2XSZA 4LJ8A 3QAUA 4BBAA 2OPFA 1IM2A 3SC3A 4G4RA 1DO2A 2R62A 4L78A 3D8BA 3DOAA 3GPUA 2G8LA 1Z5BA 3E4RA 3OTOM 4XGIA 4QNMA 1OFIA 3U6CA 4MB7A 2C98A 3M7GA 1NY5A 4GHAA 3DFZA 1WXQA 1NSFA 4LRSA 2LH0A 3HHZA 2DWNA 3R9XB 1Q3BA 1NJGA 3VK7A 1E32A 3D8LA 4L16A 4JYAM 1YUBA 2A5YB 2EO2A 3DZDA 5ITRA 3CTWB 3HHWA 4B3SM 1E9RA 2KRUA 4B3MM 5F3WA 3ILKA 4JV5M 3Q8XA 5EXPA 3PNVA 2M5ZA 3U6LA 2R18A 3TPZA 1TH2A 2QPAA 3FTCA 4P16A 1G59A 1HNZM 3KW6A 1TGUA 2RKOA 3CF6E 3LVVA 1IY0A 1H6UA 3SFZA 1HQCA 4LJ7A 2V1CA 1MU5A 3VDUA 1YE9A 5C18A 5A2QS 5FTNA 3GLIA 2Z3XA 4GHLA 3T1HM 4LG2A 1HR0M 1N36M 4AG5A 1J5EM 4M0DA 1DO0A 4GKJM 1KFVA 3HJSA 1JR3D 1Q39A 3PNYA 2L7IA 3SASA 3VDPA 3J80S 1HNXM 1QVRA 1FNNA 2V6ZM 4I5SA 4LZJA 3U6OA 1YSYA 2Z4RA 5EXSA 3KSJA 1PJIA 3HU1A 1QYRA 4JI2M 2XSZD 4LJ9A 3U60B 4DV0M 2R4JA 3AJIB 1IBKM 4JI0M 4FCWA 5JI2E 4KLNA 1IXSB 1DGHB 3HKPA 4AKHA 3J81S 3MHVC 2CV1A 1GVNA 2BNKA 1R6BX 3FKEA 1N32M 1G3IA 5KPRA 2X49A 5FTKA 4IJEA 5FTJA 4DR1M 4W5WA 3M0EA 2ZAMA 4REZA 2UUAM 2F4VM 3FD9A 3CF2A 3JR4A 1EE8A 5EP3A 4OU7A 3SMPA 3FYDA 4JI4M 2FOIC 2K47A 2UXCM 3L29A 3GRVA 1XXHB 3U60A 2X8AA 3K92A 3TWLA 2P5TA 4NOOB 1HT2E 3C58A 5FSWA 2CE7A 3JAMS 2I7NA 3SATA 4G4OA 3GP1A 2UU9M 4DR4M 2VQFM 4FD2A 3JR5A 4AKGA 4B08A 1R2ZA 3KSXA 3KFUG 3GLHB 2LWXA 5H37D 2XEPA 3SAWA 3VFDA 4LF9M 4NXMM 5IT9S 3KP1E 2EUCA 5LMNM 2F5PA 1QQWA 4KODA 4B3TM 3J7AS 2HHHM 1IN7A 3DA1A 3L28A 3UZUA 4QHSA 1XXHA 5EJCA 2DHRA 2L09A 3FUWA 1IY1A 2L6OA 3TWKA 3A98B 2XFSA 2G5GX 4FWDA 3W0LB 4G4NA 4LZZA 5E26A 5EP1A 1TDHA 1N75A 4LGYA 4DV6M 3EIHA 1L2CA 2M60A 3AFHA 4Z8XA 1IN5A 3TE6A 2Z4SA 1IN4A 2CHGA 3PXGA 2CEAA 4FVMA 5ITQA 4LF8M 4LRTA 5ITUA 1IBMM 4JI6M 1T3TA 2J7NA 4GMQA 2C99A 4JI5M 2L7HA 3UJNA 3HU2A 4JI7M 1IQPA 3KS8A 3LVWA 1DGFA 4LF4M 2ZBKB 3KDSE 3SYKA 1LV7A 3KOYE 2XLJA 2Q2EB 4FCVA 4M9XA 1DGBA 2QZ4A 1J09A 4M9SA 5FLXS 1VDDA 4D82A 3RFWA 2DXIA 4IBKA 1N77A 2Y21A 1IBLM 5EQTA 2KW0A 5DYIA 4LFBM 1IXZA 2R4EA 1L2BA 4JI1M 1XMOM 5KPZA 3U5ZB 1NHGC 4JN6A 4L8RC 1NY6A 5ITTA 3HWSA 4FCTA 4B3RM 2UUBM 3GLFB 2QENA 5IREB 1K82A 1Q3CA 1R7RA 1TH4A 3AOEC 4JXJA 3LMMA 2C9OA 2EA0A 1PJJA 2Z7JA 1NJFA 1N33M 1Z5AA 3KOXE 3HU3A 3K8ZA 2ZAOA 3FUTA 3GLGB 4II7A 3NBIA 4PDGA 2FFJA 2QBYB 4DR3M 1J7KA 4IBCA 5KPTA 2VQEM 3WHLA 1GL6A 8CATA 3J2PB 2F5OA 3LQRA 3T15A 2JA2A 4FWHA 3U6DA 3M6AA 4DV3M 4QHTA 3SAUA 2LNHC 2D7HA 1IXRC 3LQQA 3RGPA 1I94M 2DZNB 3FTFA 2C96A 3VK8A 3KOWE 4G4QA 2KRKA 3GPYA 2Y20A 5DYGA 2FNAA 4LJ5A 2X4AA 3A42A 2YNMD 4MGKE 1E9SA 3KVWA 4D80A 4D81A 3UGJA 3GLGA 3SMSA 3U6EA 4DV1M 1OJLA 3FYCA 1SXJC 1QZMA 5GKNA 2CHVA 2O5RA 4G6ZA 1QANA 1DGHA 4GC9A 2F5NA 4NXNM 4L15A 4DR6M 3L26A 2KZSA 4LY6A 1G8PA 4KO8A 3I4YA 4DR7M 4WW0A 2YFQA 4IBGA 4RF1A 3QWLA 3FTEA 4S12A 4PD2A 3WHKA 1X37A 5DNYA 4A3VB 4IBDA 4X64M 2RGHA 4PT5A 3PFIA 1W5TA 3SHFA 2CV0A 2HCBA 2CHQA 5FTMA 4LF5M 3U6PA 1KYIA 4DV2M 4TUWA 3I4VA 4B7GA 4NRVA 4M0WA 3A46A 4AI6A 3HGIA 4PCZA 2CV2A 3J27B 1TDZA 3TL4X 4B7HA 3AOEA 3GRRA 3GLHA 3GRYA 4IBFA 3HHYA 2D7GA 5KO3A 2Y0TA 2DWLA 4X62M 5JI3E 2YR0A 4AZFA 4ITQA 4CGYB 2UXDM 3KXEC 3AOGA 5BR8M 2KEBA 1NNJA 1L1TA 1GKIA 1I4WA 2DZOB 1HNWM 2ZANA 4I8OA 1HQYE 4DR5M 2J7OA 4IJFA 4MM3B 3SARA 1SXJB 1K3XA 5EXTA 2XH9A 4FW9A 5EXXA 4CHTB 4IIWA 1ORYB 2ZM6M 1JQJC 3I51A 4Z6YA 4JI3M 1QAOA 2XFTA 3HJ8A 3NWLA 3GPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 4IBJ A;  3GQ4 A;  2XZF A;  3B7Q A;  5LMU M;  1K3W A;  2CP8 A;  4MH0 E;  4GIP A;  3UK6 A;  4AG6 A;  5IWA M;  3AKZ A;  1KSF X;  2R6F A;  4MGI E;  1ZAE A;  3J7B A;  5ITX A;  2RGO A;  3GLF E;  1PJQ A;  3FTD A;  2E5L M;  2CFO A;  3R8F A;  3FUX A;  3K2L A;  1MX0 A;  2KXE A;  4LCB A;  1QAM A;  1NNU C;  1D2N A;  1YLA A;  2BJV A;  2DAK A;  3MJ5 A;  4MGZ E;  4RF0 A;  4DUZ M;  1SXJ A;  2LVN C;  1ZMW A;  3GO8 A;  3K1J A;  3BOS A;  2XZU A;  1IY2 A;  3GLI B;  1S3S A;  4IBB A;  1QAQ A;  1L8Q A;  2VF8 A;  2JNH A;  2W82 A;  4R3D A;  3MK6 A;  4YY3 M;  2FH0 A;  4QNR A;  3GQ5 A;  3C9P A;  2JXN A;  3L25 A;  1TH3 A;  3B9P A;  2QP9 X;  3FUU A;  3GQ3 A;  5A2Q S;  4DV5 M;  2C5R A;  2DWM A;  1XWI A;  2BJW A;  1XHB A;  2N35 A;  2VII A;  2DHY A;  1PJT A;  4NSR A;  4GEW A;  3U61 B;  1DGG A;  1HJP A;  2I7P A;  3HY5 A;  4LJ6 A;  3SHG B;  3AL0 C;  3UMM A;  4RNA A;  3U5Z A;  4X66 M;  2LHC A;  3RGS A;  2LVP C;  3ZC7 B;  2WZJ A;  2BWB A;  3E9S A;  2GNO A;  3L27 A;  4OW0 A;  4IBI A;  7CAT A;  1EIJ A;  2L2D A;  3GLF A;  3AV0 A;  4MGH A;  3SAV A;  1XMQ M;  1ZQ9 A;  3ZQJ A;  4CIS A;  4OVZ B;  5ITY A;  3B89 A;  4QOS A;  4L4U A;  4I4L A;  4AW4 A;  1HT1 E;  4KT0 F;  5C1B A;  2WSE F;  1WIV A;  1G4A E;  4AQY M;  1XNR M;  1IN8 A;  4GRI A;  5EP2 A;  3U61 A;  1PM5 A;  2Y0Q A;  2D7E A;  2L4E A;  4JI8 M;  4I81 A;  2LXE A;  2DEN A;  3PVS A;  3SBJ A;  2QBY A;  1Z6T A;  1F4I A;  2R45 A;  3ZH9 B;  3VLF B;  1BVS A;  5IZ7 D;  1XNQ M;  1N78 A;  3THG A;  3TWM A;  1C1K A;  4EIW A;  2G3Q A;  4NSO B;  1OFH A;  1FJG M;  3H4M A;  4IBE A;  1L1Z A;  3T1Y M;  3KP0 E;  1SXJ D;  1PRB A;  2KZU A;  3KOZ E;  1RU3 A;  4FWG A;  4BB9 A;  2HKJ A;  3U6M A;  3U6S A;  1NVM A;  1GL7 A;  2DWZ B;  2WSF F;  4OVZ A;  1L2D A;  3IG5 A;  4QOZ C;  4AKI A;  2HL7 A;  2QCU A;  5E6J A;  2OO9 A;  1T6O A;  2HWJ A;  4GC5 A;  4RKU F;  3IG8 A;  2UUC M;  4LF6 M;  1Z5C A;  1XC8 A;  2R46 A;  3LCV B;  3RE8 A;  4GKK M;  2CUZ A;  2ERC A;  3CGW A;  2NQ8 C;  2FE8 A;  2B3T A;  4LFC M;  4BLC A;  1NHW C;  3L2A A;  4LJ4 A;  1GJT A;  3W0F A;  2JZ0 A;  2F5Q A;  3NBX X;  1G41 A;  2KHH A;  4PDI A;  5KQD A;  1Z59 A;  5KQ8 A;  2UXB M;  1TR8 A;  3HHX A;  4HEO A;  2H1R A;  3K9O A;  2C9C A;  3Q8G A;  4GIT A;  4LGM A;  2JY7 A;  1R2Y A;  3TQS A;  5ITX E;  3SYL A;  4LJA A;  4NRW A;  4ZPX A;  4MGY E;  3HJQ A;  1N34 M;  4LFA M;  2KNV A;  4X65 M;  4Y28 F;  2F5S A;  3EIE A;  3CF0 A;  1SXJ E;  1OAI A;  4YHH M;  4DV7 M;  4HL4 A;  4WUR A;  4DUY M;  4OX9 M;  2AHM A;  1R4G A;  2WSC F;  3GPP A;  5BPV A;  3U6Q A;  5EP4 A;  1WJ7 A;  4B7F A;  4HLQ A;  1GLN A;  1UM8 A;  1GJS A;  2YQZ A;  3LCU A;  4NL4 H;  2XGN A;  3VKH A;  3A45 A;  4M9Z A;  2V1U A;  2DVW B;  1VQ1 A;  2OQ4 A;  1C7Y A;  5FTL A;  4XBO A;  2O01 F;  3ZCB B;  2R65 A;  1JR3 A;  2XF3 A;  4R7G A;  3GRU A;  4LF7 M;  1IN6 A;  3KS4 A;  1E94 E;  4DV4 M;  3FUV A;  2KA6 B;  3T38 A;  4K0K M;  2OOB A;  3VKG A;  4KHP M;  4GH9 A;  4DR2 M;  2LHG A;  1W5S A;  2XSZ A;  1PGY A;  3FE3 A;  4LJ8 A;  3QAU A;  4BBA A;  2OPF A;  1IM2 A;  2APL A;  3SC3 A;  4G4R A;  1DO2 A;  2R62 A;  4L78 A;  3GLI E;  3D8B A;  3DOA A;  3GPU A;  2G8L A;  2GQF A;  4UN2 B;  1OAO C;  1Z5B A;  3E4R A;  3OTO M;  4XGI A;  4QNM A;  2O25 A;  1OFI A;  3U6C A;  4MB7 A;  3HZJ A;  2C98 A;  3M7G A;  1NY5 A;  4GHA A;  3DFZ A;  1WXQ A;  1NSF A;  4LRS A;  2LH0 A;  3HHZ A;  2DWN A;  3R9X B;  1V33 A;  1Q3B A;  1NJG A;  3QYE A;  1OIP A;  2MGW A;  3VK7 A;  1E32 A;  3D8L A;  1CUK A;  4L16 A;  4JYA M;  1YUB A;  2A5Y B;  2EO2 A;  3DZD A;  1NV9 A;  5ITR A;  3CTW B;  3HHW A;  4B3S M;  1MJG M;  1E9R A;  2KRU A;  2DAM A;  4B3M M;  1VEJ A;  2QSF X;  5F3W A;  3ILK A;  2RRU A;  4JV5 M;  3Q8X A;  2JUJ A;  5EXP A;  1LTM A;  1QUS A;  3PNV A;  2J5Y A;  1D0K A;  2M5Z A;  1TF0 B;  2JY5 A;  2R18 A;  5DFL A;  1TH2 A;  3TPZ A;  3U6L A;  2QPA A;  1VEK A;  3FTC A;  4P16 A;  1G59 A;  2JP7 A;  1HNZ M;  2K0B X;  3KW6 A;  1NV8 A;  1TGU A;  2RKO A;  2MJ5 B;  3CF6 E;  3LVV A;  1IY0 A;  2EJS A;  1H6U A;  4P17 A;  3SFZ A;  1HQC A;  1VDL A;  2V1C A;  1MU5 A;  4LJ7 A;  1YE9 A;  3VDU A;  5C18 A;  5FTN A;  3GLI A;  2OOA A;  2Z3X A;  2EKF A;  4GHL A;  3T1H M;  4LG2 A;  1HR0 M;  1N36 M;  4AG5 A;  1J5E M;  2DI0 A;  4M0D A;  1DO0 A;  4GKJ M;  1KFV A;  1EFU B;  3HJS A;  1JR3 D;  1Q39 A;  3PNY A;  2BWE A;  2L7I A;  3SAS A;  3VDP A;  3J80 S;  1HNX M;  2MR9 A;  1QVR A;  1FNN A;  2V6Z M;  4I5S A;  4LZJ A;  3U6O A;  1QDT A;  1YSY A;  2Z4R A;  3C3E A;  3KSJ A;  5EXS A;  1PJI A;  3HU1 A;  1QYR A;  4JI2 M;  2XSZ D;  4LJ9 A;  3U60 B;  4DV0 M;  2R4J A;  3AJI B;  1IBK M;  4JI0 M;  4FCW A;  5JI2 E;  4KLN A;  1IXS B;  3FRI A;  1DGH B;  3HKP A;  4AKH A;  3J81 S;  3MHV C;  1QZE A;  2CV1 A;  1GVN A;  2BNK A;  2LVQ D;  1R6B X;  3B74 A;  3FKE A;  1N32 M;  1G3I A;  5KPR A;  2X49 A;  5FTK A;  4IJE A;  5FTJ A;  4DR1 M;  4W5W A;  2H5X A;  3M0E A;  2ZAM A;  4REZ A;  2DAE A;  2K9D A;  3FD9 A;  2UUA M;  2F4V M;  3CF2 A;  3JR4 A;  1EE8 A;  5EP3 A;  4OU7 A;  1Y8G A;  2EKK A;  3SMP A;  2DZL A;  3FYD A;  1TTE A;  2FOI C;  4JI4 M;  2K47 A;  2UXC M;  3L29 A;  1JR3 E;  3GRV A;  1XXH B;  3U60 A;  2X8A A;  2R0I A;  3K92 A;  2P5T A;  4NOO B;  1VEG A;  1HT2 E;  4WP2 A;  3TWL A;  1IXS A;  4CJ6 A;  3C58 A;  5FSW A;  2CE7 A;  3JAM S;  2I7N A;  3SAT A;  2KDL A;  3T6P A;  3FRH A;  4G4O A;  1WGL A;  2HAK A;  3GP1 A;  1WGN A;  2UU9 M;  4DR4 M;  2VQF M;  4FD2 A;  3JR5 A;  4AKG A;  4B08 A;  2L4F A;  4Q7J A;  1R2Z A;  3KSX A;  3KFU G;  3GLH B;  2QNJ A;  2LWX A;  5H37 D;  2XEP A;  3SAW A;  3VFD A;  4LF9 M;  4NXM M;  5IT9 S;  3KP1 E;  2Z8Y M;  2EUC A;  5LMN M;  3IEC A;  1QQW A;  4G3O A;  4KOD A;  2F5P A;  4B3T M;  2HHH M;  1IN7 A;  3J7A S;  3DA1 A;  3L28 A;  3UZU A;  4QHS A;  1XXH A;  1ZV1 A;  2R44 A;  3HX3 A;  5EJC A;  2L09 A;  2DHR A;  3FUW A;  2CRU A;  1WHC A;  1IY1 A;  2L6O A;  3TWK A;  3A98 B;  2XFS A;  2G5G X;  4FWD A;  3W0L B;  4G4N A;  4LZZ A;  5E26 A;  1T43 A;  5EP1 A;  1TDH A;  2LVA A;  3H4J A;  1N75 A;  4LGY A;  4DV6 M;  1V92 A;  3EIH A;  3LW5 F;  1L2C A;  2M60 A;  3AFH A;  4Z8X A;  1IN5 A;  3TE6 A;  2Z4S A;  1IN4 A;  4CIZ A;  2CHG A;  3PXG A;  2CEA A;  4FVM A;  5ITQ A;  4LF8 M;  4LRT A;  5ITU A;  1XB2 B;  1IBM M;  4JI6 M;  1T3T A;  2J7N A;  4GMQ A;  2C99 A;  2LVO C;  4JI5 M;  2L7H A;  3UJN A;  3HU2 A;  4JI7 M;  1IQP A;  3KS8 A;  3LVW A;  1DGF A;  1WR1 B;  4LF4 M;  2ZBK B;  3KDS E;  3SYK A;  1LV7 A;  3KOY E;  2XLJ A;  2Q2E B;  4FCV A;  4M9X A;  1DGB A;  2QZ4 A;  1J09 A;  4M9S A;  5FLX S;  1VDD A;  4D82 A;  3RFW A;  2DXI A;  4IBK A;  2VDB B;  1N77 A;  2FS1 A;  2Y21 A;  1IBL M;  5EQT A;  2KW0 A;  5DYI A;  4LFB M;  1IXZ A;  2R4E A;  1L2B A;  3BXW A;  4JI1 M;  1XMO M;  5KPZ A;  3U5Z B;  1NHG C;  4JN6 A;  2DKL A;  1NY6 A;  2JZ1 A;  4L8R C;  5ITT A;  3HWS A;  4FCT A;  1DV0 A;  1AIP C;  4B3R M;  2UUB M;  3C3D A;  3F92 A;  2JY8 A;  3GLF B;  2LBC A;  3GLG E;  2QEN A;  5IRE B;  1K82 A;  1Q3C A;  1R7R A;  1TH4 A;  1ZMV A;  3AOE C;  4JXJ A;  3LMM A;  2C9O A;  2EA0 A;  1PJJ A;  4R71 A;  1NJF A;  2Z7J A;  1N33 M;  1Z5A A;  3KOX E;  3HU3 A;  3K8Z A;  2ZAO A;  3FUT A;  2ZTC A;  3GLG B;  4II7 A;  3NBI A;  1UFZ A;  3W67 A;  2KNA A;  4PDG A;  2FFJ A;  2QBY B;  4DR3 M;  1J7K A;  1OKS A;  4IBC A;  5KPT A;  3WHL A;  1GL6 A;  8CAT A;  3J2P B;  2VQE M;  2F5O A;  3LQR A;  3T15 A;  2JA2 A;  4FWH A;  3U6D A;  3M6A A;  4DV3 M;  2ZTD A;  2LTU A;  4QHT A;  3SAU A;  1VG5 A;  2LNH C;  2D7H A;  3QYB A;  1IXR C;  4ANR A;  3LQQ A;  3RGP A;  1I94 M;  2DZN B;  3FTF A;  3E46 A;  2C96 A;  1XXH E;  1A5T A;  3VK8 A;  3KOW E;  4G4Q A;  1OIZ A;  1V34 A;  2KRK A;  3GPY A;  2Y20 A;  2JWS A;  5DYG A;  2FNA A;  4LJ5 A;  3I04 M;  2X4A A;  3A42 A;  2YNM D;  4MGK E;  1E9S A;  3KVW A;  4D80 A;  4D81 A;  3UGJ A;  3V76 A;  2MH8 A;  3GLG A;  1JB0 F;  1P3Q Q;  3SMS A;  3U6E A;  4DV1 M;  1OJL A;  3IHP A;  3FYC A;  1SXJ C;  1QZM A;  1OTR A;  5GKN A;  4F1I A;  1SG9 A;  2CHV A;  2O5R A;  4G6Z A;  1QAN A;  1DGH A;  3GLH E;  4GC9 A;  2F5N A;  4NXN M;  4L15 A;  4DR6 M;  3L26 A;  2KZS A;  1PJS A;  4LY6 A;  1GAB A;  1G8P A;  1G71 A;  4KO8 A;  3I4Y A;  4DR7 M;  1QUT A;  4WW0 A;  2YFQ A;  3BBZ A;  4IBG A;  4RF1 A;  3QWL A;  2QQ8 A;  3FTE A;  4S12 A;  4PD2 A;  3WHK A;  3B7N A;  1X37 A;  5DNY A;  3W68 A;  4IBD A;  4A3V B;  1IFY A;  2DAG A;  1ZMU A;  4X64 M;  2RGH A;  4PT5 A;  3PFI A;  1W5T A;  3SHF A;  2CV0 A;  2KNZ A;  2HCB A;  2CHQ A;  1NO1 A;  4XK8 F;  5FTM A;  4LF5 M;  3U6P A;  1KYI A;  4DV2 M;  4TUW A;  1QDR A;  2QHO B;  4NC6 A;  3I4V A;  4B7G A;  2DAI A;  3B7Z A;  2DNA A;  4NRV A;  4M0W A;  2K6B A;  3A46 A;  4AI6 A;  3HGI A;  4PCZ A;  2CV2 A;  3J27 B;  2JY6 B;  1TDZ A;  3TL4 X;  4B7H A;  3AOE A;  3GRR A;  1AUA A;  3GLH A;  3GRY A;  4IBF A;  1D0M A;  1OQY A;  3HHY A;  2D7G A;  5KO3 A;  2Y0T A;  2DWL A;  4X62 M;  5JI3 E;  2YR0 A;  4AZF A;  4ITQ A;  1Q02 A;  4CGY B;  2UXD M;  3KXE C;  1GO5 A;  3AOG A;  5BR8 M;  3K9P A;  2KEB A;  1NNJ A;  1L1T A;  4L6V 6;  1GKI A;  1I4W A;  2DZO B;  1HNW M;  2ZAN A;  4I8O A;  1HQY E;  3MMP A;  2J7O A;  4F2L A;  4DR5 M;  4IJF A;  4MM3 B;  3SAR A;  1SXJ B;  1MN3 A;  3I01 M;  1K3X A;  5EXT A;  2XH9 A;  4FW9 A;  5EXX A;  4CHT B;  4IIW A;  1ORY B;  2ZM6 M;  1JQJ C;  3I51 A;  2VF7 A;  4Z6Y A;  4JI3 M;  1QAO A;  2MRO B;  1R5L A;  2XFT A;  3HJ8 A;  2CWB A;  3E21 A;  3NWL A;  5L8R F;  4DBG B;  3GPX A;  1D0L A; 
#chains in the Genus database with same CATH homology
 4IBJ A;  3GQ4 A;  2XZF A;  1K3W A;  5LMU M;  4MH0 E;  4GIP A;  3UK6 A;  4AG6 A;  5IWA M;  3AKZ A;  1KSF X;  4MGI E;  1ZAE A;  3J7B A;  5ITX A;  2RGO A;  2E5L M;  3FTD A;  2CFO A;  3R8F A;  3K2L A;  3FUX A;  1MX0 A;  2KXE A;  4LCB A;  1QAM A;  1NNU C;  1D2N A;  2BJV A;  3MJ5 A;  4MGZ E;  4RF0 A;  4DUZ M;  1SXJ A;  3GO8 A;  3K1J A;  3BOS A;  2XZU A;  1IY2 A;  3GLI B;  1S3S A;  4IBB A;  1QAQ A;  1L8Q A;  2W82 A;  4R3D A;  3MK6 A;  4YY3 M;  4QNR A;  3GQ5 A;  3L25 A;  1TH3 A;  3B9P A;  2QP9 X;  3FUU A;  3GQ3 A;  2DWM A;  4DV5 M;  2C5R A;  1XWI A;  2BJW A;  1XHB A;  2VII A;  4NSR A;  3U61 B;  1DGG A;  2I7P A;  4LJ6 A;  3SHG B;  3AL0 C;  3UMM A;  4RNA A;  3U5Z A;  4X66 M;  3RGS A;  3ZC7 B;  3E9S A;  3L27 A;  4OW0 A;  4IBI A;  7CAT A;  3GLF A;  3AV0 A;  4MGH A;  3SAV A;  1XMQ M;  1ZQ9 A;  4CIS A;  4OVZ B;  5ITY A;  4QOS A;  4L4U A;  4I4L A;  4AW4 A;  1HT1 E;  5C1B A;  1G4A E;  4AQY M;  1XNR M;  1IN8 A;  4GRI A;  5EP2 A;  3U61 A;  1PM5 A;  2Y0Q A;  2D7E A;  4JI8 M;  4I81 A;  2LXE A;  3SBJ A;  3PVS A;  2QBY A;  1Z6T A;  2R45 A;  3ZH9 B;  3VLF B;  5IZ7 D;  1XNQ M;  1N78 A;  3THG A;  3TWM A;  1C1K A;  4EIW A;  4NSO B;  1OFH A;  1FJG M;  3H4M A;  4IBE A;  1L1Z A;  3T1Y M;  3KP0 E;  1SXJ D;  3KOZ E;  2KZU A;  4FWG A;  4BB9 A;  3U6M A;  2HKJ A;  3U6S A;  1NVM A;  1GL7 A;  2DWZ B;  4OVZ A;  1L2D A;  4QOZ C;  3IG5 A;  4AKI A;  2HL7 A;  2QCU A;  5E6J A;  4GC5 A;  3IG8 A;  2UUC M;  4LF6 M;  1Z5C A;  1XC8 A;  2R46 A;  3RE8 A;  4GKK M;  2CUZ A;  2ERC A;  2NQ8 C;  2FE8 A;  4LFC M;  4BLC A;  1NHW C;  3L2A A;  4LJ4 A;  3W0F A;  2F5Q A;  1G41 A;  5KQ8 A;  4PDI A;  5KQD A;  1Z59 A;  2UXB M;  3HHX A;  2H1R A;  2C9C A;  4GIT A;  4LGM A;  1R2Y A;  3TQS A;  5ITX E;  3SYL A;  4LJA A;  4NRW A;  4ZPX A;  4MGY E;  3HJQ A;  1N34 M;  4LFA M;  4X65 M;  2F5S A;  3EIE A;  3CF0 A;  1SXJ E;  4YHH M;  4DV7 M;  4HL4 A;  4WUR A;  4DUY M;  4OX9 M;  2AHM A;  3GPP A;  5BPV A;  3U6Q A;  5EP4 A;  4B7F A;  4HLQ A;  1GLN A;  1UM8 A;  2YQZ A;  4NL4 H;  2XGN A;  3VKH A;  3A45 A;  4M9Z A;  2V1U A;  2DVW B;  2OQ4 A;  5FTL A;  4XBO A;  3ZCB B;  2R65 A;  1JR3 A;  2XF3 A;  4R7G A;  3GRU A;  4LF7 M;  1IN6 A;  3KS4 A;  1E94 E;  4DV4 M;  3FUV A;  2KA6 B;  3T38 A;  4K0K M;  3VKG A;  4KHP M;  4GH9 A;  4DR2 M;  1W5S A;  2XSZ A;  4LJ8 A;  3QAU A;  4BBA A;  2OPF A;  1IM2 A;  3SC3 A;  4G4R A;  1DO2 A;  2R62 A;  4L78 A;  3D8B A;  3DOA A;  3GPU A;  2G8L A;  1Z5B A;  3E4R A;  3OTO M;  4XGI A;  4QNM A;  1OFI A;  3U6C A;  4MB7 A;  2C98 A;  3M7G A;  1NY5 A;  4GHA A;  3DFZ A;  1WXQ A;  1NSF A;  4LRS A;  2LH0 A;  3HHZ A;  2DWN A;  3R9X B;  1Q3B A;  1NJG A;  3VK7 A;  1E32 A;  3D8L A;  4L16 A;  4JYA M;  1YUB A;  2A5Y B;  2EO2 A;  3DZD A;  5ITR A;  3CTW B;  3HHW A;  4B3S M;  1E9R A;  2KRU A;  4B3M M;  5F3W A;  3ILK A;  4JV5 M;  3Q8X A;  5EXP A;  3PNV A;  2M5Z A;  3U6L A;  2R18 A;  3TPZ A;  1TH2 A;  2QPA A;  3FTC A;  4P16 A;  1G59 A;  1HNZ M;  3KW6 A;  1TGU A;  2RKO A;  3CF6 E;  3LVV A;  1IY0 A;  1H6U A;  3SFZ A;  1HQC A;  4LJ7 A;  2V1C A;  1MU5 A;  3VDU A;  1YE9 A;  5C18 A;  5A2Q S;  5FTN A;  3GLI A;  2Z3X A;  4GHL A;  3T1H M;  4LG2 A;  1HR0 M;  1N36 M;  4AG5 A;  1J5E M;  4M0D A;  1DO0 A;  4GKJ M;  1KFV A;  3HJS A;  1JR3 D;  1Q39 A;  3PNY A;  2L7I A;  3SAS A;  3VDP A;  3J80 S;  1HNX M;  1QVR A;  1FNN A;  2V6Z M;  4I5S A;  4LZJ A;  3U6O A;  1YSY A;  2Z4R A;  5EXS A;  3KSJ A;  1PJI A;  3HU1 A;  1QYR A;  4JI2 M;  2XSZ D;  4LJ9 A;  3U60 B;  4DV0 M;  2R4J A;  3AJI B;  1IBK M;  4JI0 M;  4FCW A;  5JI2 E;  4KLN A;  1IXS B;  1DGH B;  3HKP A;  4AKH A;  3J81 S;  3MHV C;  2CV1 A;  1GVN A;  2BNK A;  1R6B X;  3FKE A;  1N32 M;  1G3I A;  5KPR A;  2X49 A;  5FTK A;  4IJE A;  5FTJ A;  4DR1 M;  4W5W A;  3M0E A;  2ZAM A;  4REZ A;  2UUA M;  2F4V M;  3FD9 A;  3CF2 A;  3JR4 A;  1EE8 A;  5EP3 A;  4OU7 A;  3SMP A;  3FYD A;  4JI4 M;  2FOI C;  2K47 A;  2UXC M;  3L29 A;  3GRV A;  1XXH B;  3U60 A;  2X8A A;  3K92 A;  3TWL A;  2P5T A;  4NOO B;  1HT2 E;  3C58 A;  5FSW A;  2CE7 A;  3JAM S;  2I7N A;  3SAT A;  4G4O A;  3GP1 A;  2UU9 M;  4DR4 M;  2VQF M;  4FD2 A;  3JR5 A;  4AKG A;  4B08 A;  1R2Z A;  3KSX A;  3KFU G;  3GLH B;  2LWX A;  5H37 D;  2XEP A;  3SAW A;  3VFD A;  4LF9 M;  4NXM M;  5IT9 S;  3KP1 E;  2EUC A;  5LMN M;  2F5P A;  1QQW A;  4KOD A;  4B3T M;  3J7A S;  2HHH M;  1IN7 A;  3DA1 A;  3L28 A;  3UZU A;  4QHS A;  1XXH A;  5EJC A;  2DHR A;  2L09 A;  3FUW A;  1IY1 A;  2L6O A;  3TWK A;  3A98 B;  2XFS A;  2G5G X;  4FWD A;  3W0L B;  4G4N A;  4LZZ A;  5E26 A;  5EP1 A;  1TDH A;  1N75 A;  4LGY A;  4DV6 M;  3EIH A;  1L2C A;  2M60 A;  3AFH A;  4Z8X A;  1IN5 A;  3TE6 A;  2Z4S A;  1IN4 A;  2CHG A;  3PXG A;  2CEA A;  4FVM A;  5ITQ A;  4LF8 M;  4LRT A;  5ITU A;  1IBM M;  4JI6 M;  1T3T A;  2J7N A;  4GMQ A;  2C99 A;  4JI5 M;  2L7H A;  3UJN A;  3HU2 A;  4JI7 M;  1IQP A;  3KS8 A;  3LVW A;  1DGF A;  4LF4 M;  2ZBK B;  3KDS E;  3SYK A;  1LV7 A;  3KOY E;  2XLJ A;  2Q2E B;  4FCV A;  4M9X A;  1DGB A;  2QZ4 A;  1J09 A;  4M9S A;  5FLX S;  1VDD A;  4D82 A;  3RFW A;  2DXI A;  4IBK A;  1N77 A;  2Y21 A;  1IBL M;  5EQT A;  2KW0 A;  5DYI A;  4LFB M;  1IXZ A;  2R4E A;  1L2B A;  4JI1 M;  1XMO M;  5KPZ A;  3U5Z B;  1NHG C;  4JN6 A;  4L8R C;  1NY6 A;  5ITT A;  3HWS A;  4FCT A;  4B3R M;  2UUB M;  3GLF B;  2QEN A;  5IRE B;  1K82 A;  1Q3C A;  1R7R A;  1TH4 A;  3AOE C;  4JXJ A;  3LMM A;  2C9O A;  2EA0 A;  1PJJ A;  2Z7J A;  1NJF A;  1N33 M;  1Z5A A;  3KOX E;  3HU3 A;  3K8Z A;  2ZAO A;  3FUT A;  3GLG B;  4II7 A;  3NBI A;  4PDG A;  2FFJ A;  2QBY B;  4DR3 M;  1J7K A;  4IBC A;  5KPT A;  2VQE M;  3WHL A;  1GL6 A;  8CAT A;  3J2P B;  2F5O A;  3LQR A;  3T15 A;  2JA2 A;  4FWH A;  3U6D A;  3M6A A;  4DV3 M;  4QHT A;  3SAU A;  2LNH C;  2D7H A;  1IXR C;  3LQQ A;  3RGP A;  1I94 M;  2DZN B;  3FTF A;  2C96 A;  3VK8 A;  3KOW E;  4G4Q A;  2KRK A;  3GPY A;  2Y20 A;  5DYG A;  2FNA A;  4LJ5 A;  2X4A A;  3A42 A;  2YNM D;  4MGK E;  1E9S A;  3KVW A;  4D80 A;  4D81 A;  3UGJ A;  3GLG A;  3SMS A;  3U6E A;  4DV1 M;  1OJL A;  3FYC A;  1SXJ C;  1QZM A;  5GKN A;  2CHV A;  2O5R A;  4G6Z A;  1QAN A;  1DGH A;  4GC9 A;  2F5N A;  4NXN M;  4L15 A;  4DR6 M;  3L26 A;  2KZS A;  4LY6 A;  1G8P A;  4KO8 A;  3I4Y A;  4DR7 M;  4WW0 A;  2YFQ A;  4IBG A;  4RF1 A;  3QWL A;  3FTE A;  4S12 A;  4PD2 A;  3WHK A;  1X37 A;  5DNY A;  4A3V B;  4IBD A;  4X64 M;  2RGH A;  4PT5 A;  3PFI A;  1W5T A;  3SHF A;  2CV0 A;  2HCB A;  2CHQ A;  5FTM A;  4LF5 M;  3U6P A;  1KYI A;  4DV2 M;  4TUW A;  3I4V A;  4B7G A;  4NRV A;  4M0W A;  3A46 A;  4AI6 A;  3HGI A;  4PCZ A;  2CV2 A;  3J27 B;  1TDZ A;  3TL4 X;  4B7H A;  3AOE A;  3GRR A;  3GLH A;  3GRY A;  4IBF A;  3HHY A;  2D7G A;  5KO3 A;  2Y0T A;  2DWL A;  4X62 M;  5JI3 E;  2YR0 A;  4AZF A;  4ITQ A;  4CGY B;  2UXD M;  3KXE C;  3AOG A;  5BR8 M;  2KEB A;  1NNJ A;  1L1T A;  1GKI A;  1I4W A;  2DZO B;  1HNW M;  2ZAN A;  4I8O A;  1HQY E;  4DR5 M;  2J7O A;  4IJF A;  4MM3 B;  3SAR A;  1SXJ B;  1K3X A;  5EXT A;  2XH9 A;  4FW9 A;  5EXX A;  4CHT B;  4IIW A;  1ORY B;  2ZM6 M;  1JQJ C;  3I51 A;  4Z6Y A;  4JI3 M;  1QAO A;  2XFT A;  3HJ8 A;  3NWL A;  3GPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...