3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
molecule keywords RcdA
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
3H4JA 1DV0A 4IBFA 1GLNA 3CF6E 2V1CA 1CUKA 5LMNM 3Q8XA 3SAVA 1N36M 4TUWA 5ITUA 3BBZA 4A3VB 5FTJA 3JR4A 3FRHA 1ZMWA 3HU3A 1JQJC 2EJSA 1DGFA 1QDRA 1WGNA 4LFAM 1R7RA 1ZQ9A 2L6OA 1X37A 3FD9A 3PFIA 1C7YA 4QNRA 4NL4H 1OKSA 5FTLA 3GLFA 2CFOA 2KNZA 4GIPA 4QOSA 1R5LA 3L26A 3FUTA 4LF9M 3KW6A 5GKNA 4CJ6A 2G5GX 3UZUA 3AV0A 4L16A 3T1YM 2KNVA 4KLNA 2UXCM 1NO1A 1QVRA 4LGMA 1LTMA 4GITA 4AW4A 1K3WA 1PJQA 2NQ8C 3B7QA 1TTEA 4BBAA 5BPVA 2OOBA 4IBGA 1L8QA 4FCVA 3GLIB 1T3TA 3U6DA 4LF5M 2Z4RA 3J27B 2CRUA 4I5SA 1J7KA 1VQ1A 3CTWB 4LJAA 2CHGA 4LY6A 3GRRA 4I8OA 3W68A 2CEAA 3CGWA 3U61A 3C9PA 1Q02A 2CHQA 4P17A 3J81S 4OX9M 4CHTB 2ZANA 5ITXA 1IN4A 1NNJA 4F2LA 1TDHA 1IY1A 1TDZA 3SAUA 5DFLA 4G4NA 3SAWA 1XC8A 4AI6A 2R0IA 3ILKA 4CISA 3R9XB 4L78A 2BJWA 1HQYE 3K2LA 3HHXA 5IREB 1WHCA 2UXBM 4FCTA 4FD2A 2BWBA 1QQWA 4DR3M 4X62M 3LQQA 4NC6A 2CE7A 3DOAA 3HY5A 3TL4X 2VQFM 2F5QA 3LW5F 3KOZE 4X66M 2DWNA 1VDLA 4Y28F 2W82A 1NV9A 3K9PA 4JI6M 5EQTA 4B3RM 2XSZA 2FNAA 3QYEA 4AQYM 1SXJE 1TGUA 2UXDM 3GQ4A 2LVAA 2CP8A 3E9SA 2Z3XA 2JP7A 1K3XA 3FUWA 4KO8A 5FLXS 5A2QS 3UK6A 1IBMM 1JR3E 3I4YA 2MH8A 3FRIA 3VDUA 1OFHA 1ZMVA 1MN3A 2BNKA 5EP3A 4LF6M 3CF2A 2HAKA 4OW0A 1ORYB 2DAEA 2MROB 1NVMA 3A45A 4DV7M 2EO2A 3HHWA 5EXXA 3TPZA 3FTFA 2Z7JA 2WSCF 3DZDA 1HNWM 4DUYM 1HQCA 1GJTA 1MJGM 1NHWC 3BXWA 3LCVB 4WP2A 3GRVA 3HHZA 1PJIA 2G3QA 3M7GA 1IM2A 2GQFA 1OFIA 3MK6A 4IIWA 3GRUA 3IECA 1V92A 3U6EA 1L2CA 3T1HM 2DWMA 3I04M 3VK7A 1EFUB 4LFCM 2RGOA 1W5SA 2V6ZM 5FTMA 4B08A 2FOIC 3C3DA 4GEWA 1L1ZA 3V76A 3ZH9B 5ITXE 2F4VM 4MGYE 3J80S 4JXJA 1GVNA 4HEOA 4DBGB 3F92A 3SMSA 4DR1M 1YSYA 3VDPA 4W5WA 3GO8A 3R8FA 2UUBM 2L2DA 2DZNB 3DFZA 1IQPA 1WIVA 1FNNA 1Q3CA 3HJ8A 3MJ5A 3LMMA 1HT2E 4D80A 4M0DA 2Y0TA 2L09A 1OAIA 3HJSA 3A46A 1OQYA 4LRTA 4PDGA 4G4OA 1J5EM 3FTDA 1DO2A 4I81A 2C9OA 2A5YB 1QUSA 3IG8A 4JV5M 2DAIA 2KNAA 3ZQJA 4ZPXA 3D8LA 2CV0A 4JI4M 2WSEF 1IXRC 2J7NA 4NRVA 2DZOB 2XFSA 3RGPA 4DR5M 2O25A 4RF0A 3GLIE 3HZJA 3L27A 1JR3A 1HT1E 4IBJA 3B7NA 3UMMA 2C5RA 5C18A 5EXPA 4QOZC 4IBDA 4LF4M 2C9CA 3AL0C 3E4RA 3SHFA 4X64M 3SMPA 2CUZA 1A5TA 4JI3M 2OQ4A 2FFJA 4M9XA 2I7PA 1SG9A 3WHLA 1IN8A 1G71A 5JI2E 4L4UA 2B3TA 3ZC7B 4B7GA 4KT0F 2ZBKB 4S12A 3L28A 1IBKM 1YE9A 3EIHA 2N35A 3GQ5A 1R6BX 3VFDA 1V33A 2L4EA 5KQ8A 1QDTA 1DGHA 1QANA 2JA2A 3U6LA 2KZSA 2Z8YM 3E46A 1IN5A 3H4MA 3KOWE 2QBYB 2DWLA 2K6BA 2AHMA 2C96A 2LHCA 2QCUA 2DHRA 2BJVA 3IG5A 4DR7M 3LVVA 3PVSA 2OPFA 3L25A 1R4GA 3RFWA 2H1RA 3KP1E 3SASA 4PT5A 2VF8A 3GLFB 2DENA 2XGNA 4JI1M 3TWKA 3TWLA 3D8BA 4IJFA 4HLQA 3QWLA 4LJ5A 1TH3A 4LF7M 1AIPC 1IN6A 2WZJA 2X8AA 1GL7A 2D7HA 2Y20A 1MX0A 2ZAMA 3FUXA 3FYDA 3IHPA 3PNYA 2ERCA 2K9DA 3E21A 4M0WA 3GLGA 4KODA 3AOGA 1JR3D 2O01F 1E94E 5DYIA 3U5ZB 4GKJM 2X4AA 3A42A 2DI0A 3GPPA 1XWIA 2CV1A 3C3EA 2L7HA 1L2DA 2UUAM 2JY8A 4IBIA 2QZ4A 4Z8XA 1UM8A 3GPYA 1XXHB 4L6V6 2F5NA 3QYBA 1PJTA 1XHBA 3FKEA 4R7GA 1GABA 4LRSA 4B3SM 2XF3A 2KA6B 1PGYA 2G8LA 3B7ZA 3T6PA 2XZUA 4G4QA 3U6MA 2OO9A 3KFUG 3K92A 1VDDA 2KXEA 3HHYA 3HKPA 3W0FA 1XXHE 5L8RF 4L8RC 4NXMM 1T6OA 5C1BA 2QSFX 2CWBA 4B7FA 2APLA 3I51A 2LTUA 2YNMD 1G8PA 4LJ6A 2OOAA 1Z5BA 1E9RA 2J7OA 4XBOA 4X65M 4GKKM 1BVSA 1QAOA 2EKFA 3L29A 1D0MA 3LCUA 1J09A 3M6AA 1FJGM 4D81A 2EA0A 1TH2A 2KHHA 1IXSA 5E26A 3RGSA 2KEBA 5KPRA 3U60A 2LH0A 4AKGA 2FH0A 2QHOB 3SHGB 3GPUA 2L7IA 3J7BA 1IFYA 2O5RA 4P16A 1WGLA 4UN2B 1SXJB 4NXNM 4WW0A 2HWJA 1I94M 4AG5A 1XNQM 2V1UA 1F4IA 4CIZA 1YUBA 4LF8M 3SFZA 1WR1B 2ZTDA 2FE8A 3W67A 4AKHA 2JZ0A 4PD2A 3KOXE 5EXSA 2UUCM 3K9OA 3KVWA 2QQ8A 2YFQA 3GLHB 2DAGA 2R18A 4OVZA 2JNHA 3KSXA 4FVMA 5EXTA 2JY6B 2QENA 1H6UA 5EP4A 3FTEA 2MR9A 3GLGE 2HHHM 2Y21A 3GLHA 4GRIA 4B3TM 1N78A 3KP0E 4G3OA 4JI0M 4KHPM 2LVNC 2VIIA 1PJJA 4LJ7A 4GMQA 3SYKA 1R2ZA 4PDIA 2I7NA 3J2PB 2MJ5B 2R62A 2XSZD 1C1KA 2GNOA 1N32M 1GL6A 5ITRA 2KDLA 2YR0A 3KXEC 4MM3B 1W5TA 2JY5A 3KDSE 4IBEA 3I4VA 4IJEA 1D0KA 2FS1A 3AOEA 3KS4A 1EIJA 2R4JA 3GLGB 4RNAA 4DV5M 4BLCA 3FTCA 2DWZB 1DO0A 4DV1M 4QHTA 1QAMA 5DNYA 4K0KM 1OTRA 3LQRA 4NSOB 4LFBM 2JWSA 1YLAA 5EJCA 3GPXA 1XMOM 5FSWA 3SARA 1IN7A 3MMPA 4M9SA 2HL7A 3GLFE 5JI3E 1K82A 4IBKA 3M0EA 3AJIB 4HL4A 3TE6A 2XZFA 8CATA 2C99A 1HR0M 3NBXX 1UFZA 3TWMA 2C98A 2D7GA 5ITYA 5ITQA 3QAUA 2BWEA 3FUUA 4G4RA 3HU1A 4YY3M 1TF0B 4F1IA 4Z6YA 2R46A 3KSJA 1T43A 4R3DA 1IY0A 3AFHA 1E32A 1Z59A 2YQZA 3B9PA 5IWAM 2JY7A 4Q7JA 2QNJA 1SXJC 4LJ8A 2ZTCA 3I01M 4PCZA 2RRUA 1L2BA 4GHAA 1DGBA 1P3QQ 5FTKA 4B3MM 1VEGA 4BB9A 2DAKA 4WURA 2EKKA 3SC3A 2F5OA 4GC5A 5E6JA 5H37D 4EIWA 4GH9A 2L4FA 1NV8A 2DHYA 1AUAA 1IY2A 2MGWA 3FE3A 1TH4A 3B89A 1E9SA 3GLHE 4YHHM 3VK8A 1Z5CA 4L15A 2R45A 2JUJA 2WSFF 4AG6A 3HX3A 1OJLA 1G59A 1G3IA 2HKJA 2R4EA 2Z4SA 3K1JA 1QYRA 3PNVA 3SYLA 2JXNA 3HWSA 3UJNA 4IBBA 3MHVC 5ITTA 3PXGA 1EE8A 1PM5A 4JI8M 1NNUC 3FYCA 1SXJA 1V34A 1HNZM 2CHVA 4NOOB 3Q8GA 3THGA 1KYIA 4DV2M 2KZUA 3JR5A 1S3SA 2ZAOA 2E5LM 2ZM6M 2DKLA 1IXSB 3GQ3A 2VF7A 1HNXM 3J7AS 3VKGA 4QNMA 3HGIA 2DNAA 3U6SA 4GHLA 5BR8M 3ZCBB 2DZLA 2H5XA 2RGHA 4IBCA 4OVZB 2M60A 2XLJA 4JI2M 2F5SA 4FWDA 4REZA 4DR2M 3DA1A 3W0LB 4LZZA 4MB7A 3AKZA 4DV0M 1XB2B 3U61B 4XGIA 3NBIA 2EUCA 2JZ1A 2R6FA 3K8ZA 1N34M 4NRWA 3U6OA 4LCBA 1VEKA 3CF0A 1N75A 3FUVA 2QBYA 1ZV1A 4MGZE 2R44A 4CGYB 2RKOA 1D0LA 2LXEA 4GC9A 4FW9A 2DXIA 1OAOC 1WXQA 4II7A 4ANRA 3B74A 4DR6M 3L2AA 2R65A 5KPZA 2X49A 1DGGA 3EIEA 4LZJA 1G41A 2UU9M 1NY5A 1SXJD 4G6ZA 3NWLA 2LVQD 4DV3M 3SBJA 2F5PA 2KW0A 4DR4M 1VG5A 2HCBA 3LVWA 1I4WA 4I4LA 1IBLM 4AKIA 3VKHA 1XMQM 2K47A 3U6CA 3U5ZA 3AOEC 1KSFX 4M9ZA 2LHGA 1NHGC 2Y0QA 1TR8A 2DAMA 2XFTA 1HJPA 3WHKA 1LV7A 5KO3A 3U6PA 3T38A 1QAQA 2LBCA 1N77A 3HU2A 1GJSA 3KOYE 3U6QA 5EP2A 4B7HA 1ZMUA 1NJFA 2LNHC 4DUZM 3OTOM 3TQSA 2K0BX 4JN6A 1PRBA 3KS8A 1XXHA 1R2YA 1XNRM 5LMUM 2QP9X 4FWHA 4DV4M 3GP1A 1G4AE 1RU3A 2D7EA 2M5ZA 1PJSA 4LJ9A 4MGIE 4MGKE 3GLIA 5F3WA 2VDBB 3U60B 2XH9A 1OIZA 2KRUA 1DGHB 3RE8A 4MGHA 3UGJA 1QZMA 1QZEA 4DV6M 1GKIA 2LWXA 4FWGA 1IXZA 2J5YA 1KFVA 1MU5A 1NJGA 1NSFA 4D82A 3SATA 2QPAA 2LVOC 4LGYA 3T15A 1JB0F 1QUTA 3VLFB 2Q2EB 4RF1A 4RKUF 1D2NA 2VQEM 4FCWA 7CATA 1L1TA 4OU7A 2P5TA 1GO5A 5KQDA 3GRYA 4ITQA 3BOSA 4AZFA 3JAMS 4XK8F 4LJ4A 1ZAEA 1Z6TA 2KRKA 3A98B 3HJQA 5KPTA 4JI5M 2DVWB 4JYAM 1NY6A 4NSRA 3C58A 5IT9S 2CV2A 5DYGA 1OIPA 1WJ7A 5IZ7D 4MH0E 4QHSA 5EP1A 4JI7M 2LVPC 4R71A 2XEPA 1N33M 1Q39A 1Z5AA 4LG2A 5FTNA 1Y8GA 1Q3BA 1VEJA
chains in the Genus database with same CATH topology
4IBFA 1GLNA 3CF6E 2V1CA 5LMNM 3SAVA 3Q8XA 1N36M 4TUWA 5ITUA 4A3VB 5FTJA 3JR4A 3HU3A 1JQJC 1DGFA 4LFAM 1R7RA 1ZQ9A 2L6OA 1X37A 3FD9A 3PFIA 4QNRA 4NL4H 5FTLA 3GLFA 2CFOA 4GIPA 4QOSA 3L26A 3FUTA 4LF9M 3KW6A 5GKNA 2G5GX 3UZUA 3AV0A 4L16A 3T1YM 2UXCM 4KLNA 4AW4A 1QVRA 4LGMA 1K3WA 4GITA 2NQ8C 4BBAA 5BPVA 4IBGA 1L8QA 4FCVA 3GLIB 1T3TA 3U6DA 4LF5M 2Z4RA 3J27B 4I5SA 4NRVA 1J7KA 3CTWB 4LJAA 4LY6A 2CHGA 3GRRA 4I8OA 2CEAA 3U61A 4OX9M 2CHQA 3J81S 4CHTB 2ZANA 5ITXA 1IN4A 1NNJA 1TDHA 1IY1A 1TDZA 3SAUA 4G4NA 3SAWA 1XC8A 4AI6A 3ILKA 4CISA 3R9XB 4L78A 2BJWA 1HQYE 3K2LA 3HHXA 2UXBM 4FCTA 4FD2A 1QQWA 4DR3M 4X62M 3LQQA 2CE7A 3DOAA 3TL4X 2VQFM 2F5QA 3KOZE 4X66M 2DWNA 2W82A 4JI6M 5EQTA 4B3RM 2XSZA 2FNAA 4AQYM 2UXDM 1SXJE 1TGUA 3GQ4A 3E9SA 2Z3XA 1K3XA 3FUWA 4KO8A 5FLXS 5A2QS 3UK6A 1IBMM 3I4YA 3VDUA 1OFHA 4LF6M 2BNKA 5EP3A 3CF2A 4OW0A 1ORYB 1NVMA 3A45A 4DV7M 2EO2A 3HHWA 5EXXA 3TPZA 3FTFA 2Z7JA 1HNWM 3DZDA 4DUYM 1HQCA 1NHWC 3GRVA 3HHZA 1PJIA 3M7GA 1IM2A 1OFIA 3MK6A 4IIWA 3GRUA 3U6EA 1L2CA 3T1HM 2DWMA 3VK7A 4LFCM 2RGOA 1W5SA 2V6ZM 5FTMA 4B08A 2FOIC 1L1ZA 3ZH9B 5ITXE 2F4VM 4MGYE 3J80S 4JXJA 1GVNA 3SMSA 4DR1M 1YSYA 3VDPA 4W5WA 3GO8A 3R8FA 2UUBM 2DZNB 3DFZA 1IQPA 1FNNA 1Q3CA 3HJ8A 3MJ5A 3LMMA 1HT2E 4D80A 4M0DA 2Y0TA 2L09A 3HJSA 3A46A 4G4OA 4LRTA 4PDGA 1J5EM 3FTDA 1DO2A 4I81A 2C9OA 2A5YB 3IG8A 4JV5M 4ZPXA 3D8LA 2CV0A 4JI4M 1IXRC 2J7NA 2DZOB 2XFSA 3RGPA 4DR5M 4RF0A 3L27A 1JR3A 1HT1E 4IBJA 3UMMA 2C5RA 5C18A 5EXPA 4QOZC 4IBDA 4LF4M 2C9CA 3AL0C 3E4RA 3SHFA 4X64M 3SMPA 2CUZA 4JI3M 2OQ4A 2FFJA 4M9XA 2I7PA 3WHLA 1IN8A 5JI2E 4L4UA 3ZC7B 4B7GA 2ZBKB 4S12A 3L28A 1IBKM 1YE9A 3EIHA 3GQ5A 1R6BX 3VFDA 5KQ8A 1DGHA 1QANA 2JA2A 3U6LA 2KZSA 2QBYB 1IN5A 3H4MA 3KOWE 2DWLA 2AHMA 2C96A 2QCUA 2DHRA 2BJVA 3IG5A 4DR7M 3LVVA 3PVSA 2OPFA 3L25A 3RFWA 2H1RA 3KP1E 3SASA 4PT5A 3GLFB 4JI1M 2XGNA 3TWKA 3TWLA 3D8BA 4IJFA 4HLQA 3QWLA 4LJ5A 1TH3A 4LF7M 1IN6A 2X8AA 2Y20A 3PNYA 1GL7A 3FYDA 3FUXA 2D7HA 1MX0A 2ZAMA 5IREB 3SFZA 3GLGA 2ERCA 4M0WA 4KODA 3AOGA 1JR3D 1E94E 5DYIA 3U5ZB 2X4AA 3A42A 3GPPA 1XWIA 2CV1A 2L7HA 1L2DA 2UUAM 4IBIA 4Z8XA 2QZ4A 1UM8A 3GPYA 1XXHB 2F5NA 1XHBA 3FKEA 4R7GA 4LRSA 4B3SM 2XF3A 2KA6B 2G8LA 2XZUA 4G4QA 3U6MA 3KFUG 3K92A 1VDDA 2KXEA 3HHYA 3HKPA 3W0FA 4L8RC 4NXMM 5C1BA 4B7FA 3I51A 2YNMD 1G8PA 4LJ6A 1Z5BA 1E9RA 2J7OA 4XBOA 4X65M 4GKKM 1QAOA 3L29A 3M6AA 1J09A 1FJGM 4D81A 2EA0A 1TH2A 5E26A 3RGSA 5KPRA 2KEBA 3U60A 2LH0A 4AKGA 3GPUA 3SHGB 2L7IA 3J7BA 2O5RA 4P16A 1SXJB 4NXNM 4WW0A 1I94M 4AG5A 1XNQM 2V1UA 1YUBA 4LF8M 2FE8A 4AKHA 4PD2A 3KOXE 5EXSA 2UUCM 3KVWA 2YFQA 3GLHB 2R18A 4OVZA 5EXTA 3KSXA 4FVMA 2QENA 1H6UA 5EP4A 3FTEA 2HHHM 2Y21A 3GLHA 4GRIA 4B3TM 1N78A 3KP0E 4JI0M 4KHPM 2VIIA 1PJJA 4LJ7A 4GMQA 3SYKA 1R2ZA 4PDIA 2I7NA 3J2PB 2R62A 2XSZD 1C1KA 1N32M 1GL6A 5ITRA 2YR0A 3KXEC 4MM3B 1W5TA 3KDSE 4IBEA 3I4VA 4IJEA 3AOEA 3KS4A 2R4JA 3GLGB 4RNAA 4DV5M 4BLCA 3FTCA 2DWZB 1DO0A 4DV1M 4QHTA 1QAMA 5DNYA 4K0KM 3LQRA 4NSOB 4LFBM 5EJCA 3GPXA 1XMOM 5FSWA 3SARA 1IN7A 4M9SA 1K82A 2HL7A 4GKJM 5JI3E 4IBKA 3M0EA 3AJIB 4HL4A 3TE6A 2XZFA 8CATA 2C99A 1HR0M 3TWMA 2C98A 2D7GA 5ITYA 5ITQA 3QAUA 4G4RA 3FUUA 3HU1A 4YY3M 4Z6YA 2R46A 3KSJA 4R3DA 1IY0A 3AFHA 1E32A 1Z59A 2YQZA 3B9PA 5IWAM 1SXJC 4LJ8A 4PCZA 1L2BA 4GHAA 1DGBA 5FTKA 4B3MM 4BB9A 4WURA 3SC3A 2F5OA 4GC5A 5E6JA 5H37D 4EIWA 4GH9A 1IY2A 1TH4A 1E9SA 3VK8A 4YHHM 1Z5CA 4L15A 2R45A 4AG6A 1G59A 1OJLA 1G3IA 2HKJA 2R4EA 2Z4SA 3K1JA 1QYRA 3PNVA 3SYLA 3HWSA 3UJNA 4IBBA 3MHVC 5ITTA 3PXGA 1EE8A 1PM5A 4JI8M 1NNUC 3FYCA 1SXJA 1HNZM 2CHVA 4NOOB 3THGA 4DV2M 1KYIA 2KZUA 3JR5A 1S3SA 2ZAOA 2E5LM 2ZM6M 1IXSB 3GQ3A 1HNXM 3J7AS 3VKGA 4QNMA 3HGIA 3U6SA 4GHLA 5BR8M 3ZCBB 2RGHA 4IBCA 4OVZB 2M60A 2XLJA 4JI2M 2F5SA 4FWDA 4REZA 4DR2M 3DA1A 3W0LB 4LZZA 4MB7A 3AKZA 4DV0M 3U61B 4XGIA 3NBIA 2EUCA 1N34M 3K8ZA 4NRWA 3U6OA 4LCBA 3CF0A 1N75A 3FUVA 2QBYA 4MGZE 4CGYB 2RKOA 2LXEA 4GC9A 4FW9A 2DXIA 1WXQA 4II7A 4DR6M 3L2AA 2R65A 5KPZA 2X49A 1DGGA 3EIEA 4LZJA 1G41A 2UU9M 1NY5A 1SXJD 4G6ZA 3NWLA 2F5PA 4DV3M 3SBJA 2KW0A 4DR4M 2HCBA 3LVWA 4I4LA 1I4WA 1IBLM 4AKIA 3VKHA 1XMQM 2K47A 3U6CA 3U5ZA 3AOEC 1KSFX 4M9ZA 1NHGC 2Y0QA 3WHKA 2XFTA 1LV7A 5KO3A 3U6PA 3T38A 1QAQA 1N77A 3HU2A 3KOYE 3U6QA 5EP2A 4B7HA 1NJFA 2LNHC 4DUZM 3OTOM 3TQSA 4JN6A 3KS8A 1XXHA 1R2YA 1XNRM 5LMUM 2QP9X 4FWHA 4DV4M 3GP1A 1G4AE 2D7EA 2M5ZA 4LJ9A 4MGIE 4MGKE 3GLIA 5F3WA 3U60B 2XH9A 2KRUA 1DGHB 3RE8A 4MGHA 3UGJA 1QZMA 4DV6M 1GKIA 4FWGA 2LWXA 1IXZA 1KFVA 1MU5A 1NJGA 1NSFA 4D82A 3SATA 2QPAA 4LGYA 3T15A 3VLFB 2Q2EB 4RF1A 1D2NA 2VQEM 4FCWA 7CATA 1L1TA 4OU7A 2P5TA 5KQDA 3GRYA 4ITQA 3BOSA 4AZFA 3JAMS 4LJ4A 1ZAEA 1Z6TA 2KRKA 3A98B 3HJQA 5KPTA 4JI5M 2DVWB 4JYAM 1NY6A 4NSRA 3C58A 5IT9S 2CV2A 5DYGA 5IZ7D 4MH0E 4QHSA 5EP1A 4JI7M 2XEPA 1N33M 1Q39A 1Z5AA 4LG2A 5FTNA 1Q3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 3H4J A;  1DV0 A;  4IBF A;  1GLN A;  3CF6 E;  2V1C A;  1CUK A;  5LMN M;  3Q8X A;  3SAV A;  1N36 M;  4TUW A;  5ITU A;  3BBZ A;  4A3V B;  5FTJ A;  3JR4 A;  3FRH A;  1ZMW A;  3HU3 A;  1JQJ C;  2EJS A;  1DGF A;  1QDR A;  1WGN A;  4LFA M;  1R7R A;  1ZQ9 A;  2L6O A;  1X37 A;  3FD9 A;  3PFI A;  1C7Y A;  4QNR A;  4NL4 H;  1OKS A;  5FTL A;  3GLF A;  2CFO A;  2KNZ A;  4GIP A;  4QOS A;  1R5L A;  3L26 A;  3FUT A;  4LF9 M;  3KW6 A;  5GKN A;  4CJ6 A;  2G5G X;  3UZU A;  3AV0 A;  4L16 A;  3T1Y M;  2KNV A;  4KLN A;  2UXC M;  1NO1 A;  1QVR A;  4LGM A;  1LTM A;  4GIT A;  4AW4 A;  1K3W A;  1PJQ A;  2NQ8 C;  3B7Q A;  1TTE A;  4BBA A;  5BPV A;  2OOB A;  4IBG A;  1L8Q A;  4FCV A;  3GLI B;  1T3T A;  3U6D A;  4LF5 M;  2Z4R A;  3J27 B;  2CRU A;  4I5S A;  1J7K A;  1VQ1 A;  3CTW B;  4LJA A;  2CHG A;  4LY6 A;  3GRR A;  4I8O A;  3W68 A;  2CEA A;  3CGW A;  3U61 A;  3C9P A;  1Q02 A;  2CHQ A;  4P17 A;  3J81 S;  4OX9 M;  4CHT B;  2ZAN A;  5ITX A;  1IN4 A;  1NNJ A;  4F2L A;  1TDH A;  1IY1 A;  1TDZ A;  3SAU A;  5DFL A;  4G4N A;  3SAW A;  1XC8 A;  4AI6 A;  2R0I A;  3ILK A;  4CIS A;  3R9X B;  4L78 A;  2BJW A;  1HQY E;  3K2L A;  3HHX A;  5IRE B;  1WHC A;  2UXB M;  4FCT A;  4FD2 A;  2BWB A;  1QQW A;  4DR3 M;  4X62 M;  3LQQ A;  4NC6 A;  2CE7 A;  3DOA A;  3HY5 A;  3TL4 X;  2VQF M;  2F5Q A;  3LW5 F;  3KOZ E;  4X66 M;  2DWN A;  1VDL A;  4Y28 F;  2W82 A;  1NV9 A;  3K9P A;  4JI6 M;  5EQT A;  4B3R M;  2XSZ A;  2FNA A;  3QYE A;  4AQY M;  1SXJ E;  1TGU A;  2UXD M;  3GQ4 A;  2LVA A;  2CP8 A;  3E9S A;  2Z3X A;  2JP7 A;  1K3X A;  3FUW A;  4KO8 A;  5FLX S;  5A2Q S;  3UK6 A;  1IBM M;  1JR3 E;  3I4Y A;  2MH8 A;  3FRI A;  3VDU A;  1OFH A;  1ZMV A;  1MN3 A;  2BNK A;  5EP3 A;  4LF6 M;  3CF2 A;  2HAK A;  4OW0 A;  1ORY B;  2DAE A;  2MRO B;  1NVM A;  3A45 A;  4DV7 M;  2EO2 A;  3HHW A;  5EXX A;  3TPZ A;  3FTF A;  2Z7J A;  2WSC F;  3DZD A;  1HNW M;  4DUY M;  1HQC A;  1GJT A;  1MJG M;  1NHW C;  3BXW A;  3LCV B;  4WP2 A;  3GRV A;  3HHZ A;  1PJI A;  2G3Q A;  3M7G A;  1IM2 A;  2GQF A;  1OFI A;  3MK6 A;  4IIW A;  3GRU A;  3IEC A;  1V92 A;  3U6E A;  1L2C A;  3T1H M;  2DWM A;  3I04 M;  3VK7 A;  1EFU B;  4LFC M;  2RGO A;  1W5S A;  2V6Z M;  5FTM A;  4B08 A;  2FOI C;  3C3D A;  4GEW A;  1L1Z A;  3V76 A;  3ZH9 B;  5ITX E;  2F4V M;  4MGY E;  3J80 S;  4JXJ A;  1GVN A;  4HEO A;  4DBG B;  3F92 A;  3SMS A;  4DR1 M;  1YSY A;  3VDP A;  4W5W A;  3GO8 A;  3R8F A;  2UUB M;  2L2D A;  2DZN B;  3DFZ A;  1IQP A;  1WIV A;  1FNN A;  1Q3C A;  3HJ8 A;  3MJ5 A;  3LMM A;  1HT2 E;  4D80 A;  4M0D A;  2Y0T A;  2L09 A;  1OAI A;  3HJS A;  3A46 A;  1OQY A;  4LRT A;  4PDG A;  4G4O A;  1J5E M;  3FTD A;  1DO2 A;  4I81 A;  2C9O A;  2A5Y B;  1QUS A;  3IG8 A;  4JV5 M;  2DAI A;  2KNA A;  3ZQJ A;  4ZPX A;  3D8L A;  2CV0 A;  4JI4 M;  2WSE F;  1IXR C;  2J7N A;  4NRV A;  2DZO B;  2XFS A;  3RGP A;  4DR5 M;  2O25 A;  4RF0 A;  3GLI E;  3HZJ A;  3L27 A;  1JR3 A;  1HT1 E;  4IBJ A;  3B7N A;  3UMM A;  2C5R A;  5C18 A;  5EXP A;  4QOZ C;  4IBD A;  4LF4 M;  2C9C A;  3AL0 C;  3E4R A;  3SHF A;  4X64 M;  3SMP A;  2CUZ A;  1A5T A;  4JI3 M;  2OQ4 A;  2FFJ A;  4M9X A;  2I7P A;  1SG9 A;  3WHL A;  1IN8 A;  1G71 A;  5JI2 E;  4L4U A;  2B3T A;  3ZC7 B;  4B7G A;  4KT0 F;  2ZBK B;  4S12 A;  3L28 A;  1IBK M;  1YE9 A;  3EIH A;  2N35 A;  3GQ5 A;  1R6B X;  3VFD A;  1V33 A;  2L4E A;  5KQ8 A;  1QDT A;  1DGH A;  1QAN A;  2JA2 A;  3U6L A;  2KZS A;  2Z8Y M;  3E46 A;  1IN5 A;  3H4M A;  3KOW E;  2QBY B;  2DWL A;  2K6B A;  2AHM A;  2C96 A;  2LHC A;  2QCU A;  2DHR A;  2BJV A;  3IG5 A;  4DR7 M;  3LVV A;  3PVS A;  2OPF A;  3L25 A;  1R4G A;  3RFW A;  2H1R A;  3KP1 E;  3SAS A;  4PT5 A;  2VF8 A;  3GLF B;  2DEN A;  2XGN A;  4JI1 M;  3TWK A;  3TWL A;  3D8B A;  4IJF A;  4HLQ A;  3QWL A;  4LJ5 A;  1TH3 A;  4LF7 M;  1AIP C;  1IN6 A;  2WZJ A;  2X8A A;  1GL7 A;  2D7H A;  2Y20 A;  1MX0 A;  2ZAM A;  3FUX A;  3FYD A;  3IHP A;  3PNY A;  2ERC A;  2K9D A;  3E21 A;  4M0W A;  3GLG A;  4KOD A;  3AOG A;  1JR3 D;  2O01 F;  1E94 E;  5DYI A;  3U5Z B;  4GKJ M;  2X4A A;  3A42 A;  2DI0 A;  3GPP A;  1XWI A;  2CV1 A;  3C3E A;  2L7H A;  1L2D A;  2UUA M;  2JY8 A;  4IBI A;  2QZ4 A;  4Z8X A;  1UM8 A;  3GPY A;  1XXH B;  4L6V 6;  2F5N A;  3QYB A;  1PJT A;  1XHB A;  3FKE A;  4R7G A;  1GAB A;  4LRS A;  4B3S M;  2XF3 A;  2KA6 B;  1PGY A;  2G8L A;  3B7Z A;  3T6P A;  2XZU A;  4G4Q A;  3U6M A;  2OO9 A;  3KFU G;  3K92 A;  1VDD A;  2KXE A;  3HHY A;  3HKP A;  3W0F A;  1XXH E;  5L8R F;  4L8R C;  4NXM M;  1T6O A;  5C1B A;  2QSF X;  2CWB A;  4B7F A;  2APL A;  3I51 A;  2LTU A;  2YNM D;  1G8P A;  4LJ6 A;  2OOA A;  1Z5B A;  1E9R A;  2J7O A;  4XBO A;  4X65 M;  4GKK M;  1BVS A;  1QAO A;  2EKF A;  3L29 A;  1D0M A;  3LCU A;  1J09 A;  3M6A A;  1FJG M;  4D81 A;  2EA0 A;  1TH2 A;  2KHH A;  1IXS A;  5E26 A;  3RGS A;  2KEB A;  5KPR A;  3U60 A;  2LH0 A;  4AKG A;  2FH0 A;  2QHO B;  3SHG B;  3GPU A;  2L7I A;  3J7B A;  1IFY A;  2O5R A;  4P16 A;  1WGL A;  4UN2 B;  1SXJ B;  4NXN M;  4WW0 A;  2HWJ A;  1I94 M;  4AG5 A;  1XNQ M;  2V1U A;  1F4I A;  4CIZ A;  1YUB A;  4LF8 M;  3SFZ A;  1WR1 B;  2ZTD A;  2FE8 A;  3W67 A;  4AKH A;  2JZ0 A;  4PD2 A;  3KOX E;  5EXS A;  2UUC M;  3K9O A;  3KVW A;  2QQ8 A;  2YFQ A;  3GLH B;  2DAG A;  2R18 A;  4OVZ A;  2JNH A;  3KSX A;  4FVM A;  5EXT A;  2JY6 B;  2QEN A;  1H6U A;  5EP4 A;  3FTE A;  2MR9 A;  3GLG E;  2HHH M;  2Y21 A;  3GLH A;  4GRI A;  4B3T M;  1N78 A;  3KP0 E;  4G3O A;  4JI0 M;  4KHP M;  2LVN C;  2VII A;  1PJJ A;  4LJ7 A;  4GMQ A;  3SYK A;  1R2Z A;  4PDI A;  2I7N A;  3J2P B;  2MJ5 B;  2R62 A;  2XSZ D;  1C1K A;  2GNO A;  1N32 M;  1GL6 A;  5ITR A;  2KDL A;  2YR0 A;  3KXE C;  4MM3 B;  1W5T A;  2JY5 A;  3KDS E;  4IBE A;  3I4V A;  4IJE A;  1D0K A;  2FS1 A;  3AOE A;  3KS4 A;  1EIJ A;  2R4J A;  3GLG B;  4RNA A;  4DV5 M;  4BLC A;  3FTC A;  2DWZ B;  1DO0 A;  4DV1 M;  4QHT A;  1QAM A;  5DNY A;  4K0K M;  1OTR A;  3LQR A;  4NSO B;  4LFB M;  2JWS A;  1YLA A;  5EJC A;  3GPX A;  1XMO M;  5FSW A;  3SAR A;  1IN7 A;  3MMP A;  4M9S A;  2HL7 A;  3GLF E;  5JI3 E;  1K82 A;  4IBK A;  3M0E A;  3AJI B;  4HL4 A;  3TE6 A;  2XZF A;  8CAT A;  2C99 A;  1HR0 M;  3NBX X;  1UFZ A;  3TWM A;  2C98 A;  2D7G A;  5ITY A;  5ITQ A;  3QAU A;  2BWE A;  3FUU A;  4G4R A;  3HU1 A;  4YY3 M;  1TF0 B;  4F1I A;  4Z6Y A;  2R46 A;  3KSJ A;  1T43 A;  4R3D A;  1IY0 A;  3AFH A;  1E32 A;  1Z59 A;  2YQZ A;  3B9P A;  5IWA M;  2JY7 A;  4Q7J A;  2QNJ A;  1SXJ C;  4LJ8 A;  2ZTC A;  3I01 M;  4PCZ A;  2RRU A;  1L2B A;  4GHA A;  1DGB A;  1P3Q Q;  5FTK A;  4B3M M;  1VEG A;  4BB9 A;  2DAK A;  4WUR A;  2EKK A;  3SC3 A;  2F5O A;  4GC5 A;  5E6J A;  5H37 D;  4EIW A;  4GH9 A;  2L4F A;  1NV8 A;  2DHY A;  1AUA A;  1IY2 A;  2MGW A;  3FE3 A;  1TH4 A;  3B89 A;  1E9S A;  3GLH E;  4YHH M;  3VK8 A;  1Z5C A;  4L15 A;  2R45 A;  2JUJ A;  2WSF F;  4AG6 A;  3HX3 A;  1OJL A;  1G59 A;  1G3I A;  2HKJ A;  2R4E A;  2Z4S A;  3K1J A;  1QYR A;  3PNV A;  3SYL A;  2JXN A;  3HWS A;  3UJN A;  4IBB A;  3MHV C;  5ITT A;  3PXG A;  1EE8 A;  1PM5 A;  4JI8 M;  1NNU C;  3FYC A;  1SXJ A;  1V34 A;  1HNZ M;  2CHV A;  4NOO B;  3Q8G A;  3THG A;  1KYI A;  4DV2 M;  2KZU A;  3JR5 A;  1S3S A;  2ZAO A;  2E5L M;  2ZM6 M;  2DKL A;  1IXS B;  3GQ3 A;  2VF7 A;  1HNX M;  3J7A S;  3VKG A;  4QNM A;  3HGI A;  2DNA A;  3U6S A;  4GHL A;  5BR8 M;  3ZCB B;  2DZL A;  2H5X A;  2RGH A;  4IBC A;  4OVZ B;  2M60 A;  2XLJ A;  4JI2 M;  2F5S A;  4FWD A;  4REZ A;  4DR2 M;  3DA1 A;  3W0L B;  4LZZ A;  4MB7 A;  3AKZ A;  4DV0 M;  1XB2 B;  3U61 B;  4XGI A;  3NBI A;  2EUC A;  2JZ1 A;  2R6F A;  3K8Z A;  1N34 M;  4NRW A;  3U6O A;  4LCB A;  1VEK A;  3CF0 A;  1N75 A;  3FUV A;  2QBY A;  1ZV1 A;  4MGZ E;  2R44 A;  4CGY B;  2RKO A;  1D0L A;  2LXE A;  4GC9 A;  4FW9 A;  2DXI A;  1OAO C;  1WXQ A;  4II7 A;  4ANR A;  3B74 A;  4DR6 M;  3L2A A;  2R65 A;  5KPZ A;  2X49 A;  1DGG A;  3EIE A;  4LZJ A;  1G41 A;  2UU9 M;  1NY5 A;  1SXJ D;  4G6Z A;  3NWL A;  2LVQ D;  4DV3 M;  3SBJ A;  2F5P A;  2KW0 A;  4DR4 M;  1VG5 A;  2HCB A;  3LVW A;  1I4W A;  4I4L A;  1IBL M;  4AKI A;  3VKH A;  1XMQ M;  2K47 A;  3U6C A;  3U5Z A;  3AOE C;  1KSF X;  4M9Z A;  2LHG A;  1NHG C;  2Y0Q A;  1TR8 A;  2DAM A;  2XFT A;  1HJP A;  3WHK A;  1LV7 A;  5KO3 A;  3U6P A;  3T38 A;  1QAQ A;  2LBC A;  1N77 A;  3HU2 A;  1GJS A;  3KOY E;  3U6Q A;  5EP2 A;  4B7H A;  1ZMU A;  1NJF A;  2LNH C;  4DUZ M;  3OTO M;  3TQS A;  2K0B X;  4JN6 A;  1PRB A;  3KS8 A;  1XXH A;  1R2Y A;  1XNR M;  5LMU M;  2QP9 X;  4FWH A;  4DV4 M;  3GP1 A;  1G4A E;  1RU3 A;  2D7E A;  2M5Z A;  1PJS A;  4LJ9 A;  4MGI E;  4MGK E;  3GLI A;  5F3W A;  2VDB B;  3U60 B;  2XH9 A;  1OIZ A;  2KRU A;  1DGH B;  3RE8 A;  4MGH A;  3UGJ A;  1QZM A;  1QZE A;  4DV6 M;  1GKI A;  2LWX A;  4FWG A;  1IXZ A;  2J5Y A;  1KFV A;  1MU5 A;  1NJG A;  1NSF A;  4D82 A;  3SAT A;  2QPA A;  2LVO C;  4LGY A;  3T15 A;  1JB0 F;  1QUT A;  3VLF B;  2Q2E B;  4RF1 A;  4RKU F;  1D2N A;  2VQE M;  4FCW A;  7CAT A;  1L1T A;  4OU7 A;  2P5T A;  1GO5 A;  5KQD A;  3GRY A;  4ITQ A;  3BOS A;  4AZF A;  3JAM S;  4XK8 F;  4LJ4 A;  1ZAE A;  1Z6T A;  2KRK A;  3A98 B;  3HJQ A;  5KPT A;  4JI5 M;  2DVW B;  4JYA M;  1NY6 A;  4NSR A;  3C58 A;  5IT9 S;  2CV2 A;  5DYG A;  1OIP A;  1WJ7 A;  5IZ7 D;  4MH0 E;  4QHS A;  5EP1 A;  4JI7 M;  2LVP C;  4R71 A;  2XEP A;  1N33 M;  1Q39 A;  1Z5A A;  4LG2 A;  5FTN A;  1Y8G A;  1Q3B A;  1VEJ A; 
#chains in the Genus database with same CATH homology
 4IBF A;  1GLN A;  3CF6 E;  2V1C A;  5LMN M;  3SAV A;  3Q8X A;  1N36 M;  4TUW A;  5ITU A;  4A3V B;  5FTJ A;  3JR4 A;  3HU3 A;  1JQJ C;  1DGF A;  4LFA M;  1R7R A;  1ZQ9 A;  2L6O A;  1X37 A;  3FD9 A;  3PFI A;  4QNR A;  4NL4 H;  5FTL A;  3GLF A;  2CFO A;  4GIP A;  4QOS A;  3L26 A;  3FUT A;  4LF9 M;  3KW6 A;  5GKN A;  2G5G X;  3UZU A;  3AV0 A;  4L16 A;  3T1Y M;  2UXC M;  4KLN A;  4AW4 A;  1QVR A;  4LGM A;  1K3W A;  4GIT A;  2NQ8 C;  4BBA A;  5BPV A;  4IBG A;  1L8Q A;  4FCV A;  3GLI B;  1T3T A;  3U6D A;  4LF5 M;  2Z4R A;  3J27 B;  4I5S A;  4NRV A;  1J7K A;  3CTW B;  4LJA A;  4LY6 A;  2CHG A;  3GRR A;  4I8O A;  2CEA A;  3U61 A;  4OX9 M;  2CHQ A;  3J81 S;  4CHT B;  2ZAN A;  5ITX A;  1IN4 A;  1NNJ A;  1TDH A;  1IY1 A;  1TDZ A;  3SAU A;  4G4N A;  3SAW A;  1XC8 A;  4AI6 A;  3ILK A;  4CIS A;  3R9X B;  4L78 A;  2BJW A;  1HQY E;  3K2L A;  3HHX A;  2UXB M;  4FCT A;  4FD2 A;  1QQW A;  4DR3 M;  4X62 M;  3LQQ A;  2CE7 A;  3DOA A;  3TL4 X;  2VQF M;  2F5Q A;  3KOZ E;  4X66 M;  2DWN A;  2W82 A;  4JI6 M;  5EQT A;  4B3R M;  2XSZ A;  2FNA A;  4AQY M;  2UXD M;  1SXJ E;  1TGU A;  3GQ4 A;  3E9S A;  2Z3X A;  1K3X A;  3FUW A;  4KO8 A;  5FLX S;  5A2Q S;  3UK6 A;  1IBM M;  3I4Y A;  3VDU A;  1OFH A;  4LF6 M;  2BNK A;  5EP3 A;  3CF2 A;  4OW0 A;  1ORY B;  1NVM A;  3A45 A;  4DV7 M;  2EO2 A;  3HHW A;  5EXX A;  3TPZ A;  3FTF A;  2Z7J A;  1HNW M;  3DZD A;  4DUY M;  1HQC A;  1NHW C;  3GRV A;  3HHZ A;  1PJI A;  3M7G A;  1IM2 A;  1OFI A;  3MK6 A;  4IIW A;  3GRU A;  3U6E A;  1L2C A;  3T1H M;  2DWM A;  3VK7 A;  4LFC M;  2RGO A;  1W5S A;  2V6Z M;  5FTM A;  4B08 A;  2FOI C;  1L1Z A;  3ZH9 B;  5ITX E;  2F4V M;  4MGY E;  3J80 S;  4JXJ A;  1GVN A;  3SMS A;  4DR1 M;  1YSY A;  3VDP A;  4W5W A;  3GO8 A;  3R8F A;  2UUB M;  2DZN B;  3DFZ A;  1IQP A;  1FNN A;  1Q3C A;  3HJ8 A;  3MJ5 A;  3LMM A;  1HT2 E;  4D80 A;  4M0D A;  2Y0T A;  2L09 A;  3HJS A;  3A46 A;  4G4O A;  4LRT A;  4PDG A;  1J5E M;  3FTD A;  1DO2 A;  4I81 A;  2C9O A;  2A5Y B;  3IG8 A;  4JV5 M;  4ZPX A;  3D8L A;  2CV0 A;  4JI4 M;  1IXR C;  2J7N A;  2DZO B;  2XFS A;  3RGP A;  4DR5 M;  4RF0 A;  3L27 A;  1JR3 A;  1HT1 E;  4IBJ A;  3UMM A;  2C5R A;  5C18 A;  5EXP A;  4QOZ C;  4IBD A;  4LF4 M;  2C9C A;  3AL0 C;  3E4R A;  3SHF A;  4X64 M;  3SMP A;  2CUZ A;  4JI3 M;  2OQ4 A;  2FFJ A;  4M9X A;  2I7P A;  3WHL A;  1IN8 A;  5JI2 E;  4L4U A;  3ZC7 B;  4B7G A;  2ZBK B;  4S12 A;  3L28 A;  1IBK M;  1YE9 A;  3EIH A;  3GQ5 A;  1R6B X;  3VFD A;  5KQ8 A;  1DGH A;  1QAN A;  2JA2 A;  3U6L A;  2KZS A;  2QBY B;  1IN5 A;  3H4M A;  3KOW E;  2DWL A;  2AHM A;  2C96 A;  2QCU A;  2DHR A;  2BJV A;  3IG5 A;  4DR7 M;  3LVV A;  3PVS A;  2OPF A;  3L25 A;  3RFW A;  2H1R A;  3KP1 E;  3SAS A;  4PT5 A;  3GLF B;  4JI1 M;  2XGN A;  3TWK A;  3TWL A;  3D8B A;  4IJF A;  4HLQ A;  3QWL A;  4LJ5 A;  1TH3 A;  4LF7 M;  1IN6 A;  2X8A A;  2Y20 A;  3PNY A;  1GL7 A;  3FYD A;  3FUX A;  2D7H A;  1MX0 A;  2ZAM A;  5IRE B;  3SFZ A;  3GLG A;  2ERC A;  4M0W A;  4KOD A;  3AOG A;  1JR3 D;  1E94 E;  5DYI A;  3U5Z B;  2X4A A;  3A42 A;  3GPP A;  1XWI A;  2CV1 A;  2L7H A;  1L2D A;  2UUA M;  4IBI A;  4Z8X A;  2QZ4 A;  1UM8 A;  3GPY A;  1XXH B;  2F5N A;  1XHB A;  3FKE A;  4R7G A;  4LRS A;  4B3S M;  2XF3 A;  2KA6 B;  2G8L A;  2XZU A;  4G4Q A;  3U6M A;  3KFU G;  3K92 A;  1VDD A;  2KXE A;  3HHY A;  3HKP A;  3W0F A;  4L8R C;  4NXM M;  5C1B A;  4B7F A;  3I51 A;  2YNM D;  1G8P A;  4LJ6 A;  1Z5B A;  1E9R A;  2J7O A;  4XBO A;  4X65 M;  4GKK M;  1QAO A;  3L29 A;  3M6A A;  1J09 A;  1FJG M;  4D81 A;  2EA0 A;  1TH2 A;  5E26 A;  3RGS A;  5KPR A;  2KEB A;  3U60 A;  2LH0 A;  4AKG A;  3GPU A;  3SHG B;  2L7I A;  3J7B A;  2O5R A;  4P16 A;  1SXJ B;  4NXN M;  4WW0 A;  1I94 M;  4AG5 A;  1XNQ M;  2V1U A;  1YUB A;  4LF8 M;  2FE8 A;  4AKH A;  4PD2 A;  3KOX E;  5EXS A;  2UUC M;  3KVW A;  2YFQ A;  3GLH B;  2R18 A;  4OVZ A;  5EXT A;  3KSX A;  4FVM A;  2QEN A;  1H6U A;  5EP4 A;  3FTE A;  2HHH M;  2Y21 A;  3GLH A;  4GRI A;  4B3T M;  1N78 A;  3KP0 E;  4JI0 M;  4KHP M;  2VII A;  1PJJ A;  4LJ7 A;  4GMQ A;  3SYK A;  1R2Z A;  4PDI A;  2I7N A;  3J2P B;  2R62 A;  2XSZ D;  1C1K A;  1N32 M;  1GL6 A;  5ITR A;  2YR0 A;  3KXE C;  4MM3 B;  1W5T A;  3KDS E;  4IBE A;  3I4V A;  4IJE A;  3AOE A;  3KS4 A;  2R4J A;  3GLG B;  4RNA A;  4DV5 M;  4BLC A;  3FTC A;  2DWZ B;  1DO0 A;  4DV1 M;  4QHT A;  1QAM A;  5DNY A;  4K0K M;  3LQR A;  4NSO B;  4LFB M;  5EJC A;  3GPX A;  1XMO M;  5FSW A;  3SAR A;  1IN7 A;  4M9S A;  1K82 A;  2HL7 A;  4GKJ M;  5JI3 E;  4IBK A;  3M0E A;  3AJI B;  4HL4 A;  3TE6 A;  2XZF A;  8CAT A;  2C99 A;  1HR0 M;  3TWM A;  2C98 A;  2D7G A;  5ITY A;  5ITQ A;  3QAU A;  4G4R A;  3FUU A;  3HU1 A;  4YY3 M;  4Z6Y A;  2R46 A;  3KSJ A;  4R3D A;  1IY0 A;  3AFH A;  1E32 A;  1Z59 A;  2YQZ A;  3B9P A;  5IWA M;  1SXJ C;  4LJ8 A;  4PCZ A;  1L2B A;  4GHA A;  1DGB A;  5FTK A;  4B3M M;  4BB9 A;  4WUR A;  3SC3 A;  2F5O A;  4GC5 A;  5E6J A;  5H37 D;  4EIW A;  4GH9 A;  1IY2 A;  1TH4 A;  1E9S A;  3VK8 A;  4YHH M;  1Z5C A;  4L15 A;  2R45 A;  4AG6 A;  1G59 A;  1OJL A;  1G3I A;  2HKJ A;  2R4E A;  2Z4S A;  3K1J A;  1QYR A;  3PNV A;  3SYL A;  3HWS A;  3UJN A;  4IBB A;  3MHV C;  5ITT A;  3PXG A;  1EE8 A;  1PM5 A;  4JI8 M;  1NNU C;  3FYC A;  1SXJ A;  1HNZ M;  2CHV A;  4NOO B;  3THG A;  4DV2 M;  1KYI A;  2KZU A;  3JR5 A;  1S3S A;  2ZAO A;  2E5L M;  2ZM6 M;  1IXS B;  3GQ3 A;  1HNX M;  3J7A S;  3VKG A;  4QNM A;  3HGI A;  3U6S A;  4GHL A;  5BR8 M;  3ZCB B;  2RGH A;  4IBC A;  4OVZ B;  2M60 A;  2XLJ A;  4JI2 M;  2F5S A;  4FWD A;  4REZ A;  4DR2 M;  3DA1 A;  3W0L B;  4LZZ A;  4MB7 A;  3AKZ A;  4DV0 M;  3U61 B;  4XGI A;  3NBI A;  2EUC A;  1N34 M;  3K8Z A;  4NRW A;  3U6O A;  4LCB A;  3CF0 A;  1N75 A;  3FUV A;  2QBY A;  4MGZ E;  4CGY B;  2RKO A;  2LXE A;  4GC9 A;  4FW9 A;  2DXI A;  1WXQ A;  4II7 A;  4DR6 M;  3L2A A;  2R65 A;  5KPZ A;  2X49 A;  1DGG A;  3EIE A;  4LZJ A;  1G41 A;  2UU9 M;  1NY5 A;  1SXJ D;  4G6Z A;  3NWL A;  2F5P A;  4DV3 M;  3SBJ A;  2KW0 A;  4DR4 M;  2HCB A;  3LVW A;  4I4L A;  1I4W A;  1IBL M;  4AKI A;  3VKH A;  1XMQ M;  2K47 A;  3U6C A;  3U5Z A;  3AOE C;  1KSF X;  4M9Z A;  1NHG C;  2Y0Q A;  3WHK A;  2XFT A;  1LV7 A;  5KO3 A;  3U6P A;  3T38 A;  1QAQ A;  1N77 A;  3HU2 A;  3KOY E;  3U6Q A;  5EP2 A;  4B7H A;  1NJF A;  2LNH C;  4DUZ M;  3OTO M;  3TQS A;  4JN6 A;  3KS8 A;  1XXH A;  1R2Y A;  1XNR M;  5LMU M;  2QP9 X;  4FWH A;  4DV4 M;  3GP1 A;  1G4A E;  2D7E A;  2M5Z A;  4LJ9 A;  4MGI E;  4MGK E;  3GLI A;  5F3W A;  3U60 B;  2XH9 A;  2KRU A;  1DGH B;  3RE8 A;  4MGH A;  3UGJ A;  1QZM A;  4DV6 M;  1GKI A;  4FWG A;  2LWX A;  1IXZ A;  1KFV A;  1MU5 A;  1NJG A;  1NSF A;  4D82 A;  3SAT A;  2QPA A;  4LGY A;  3T15 A;  3VLF B;  2Q2E B;  4RF1 A;  1D2N A;  2VQE M;  4FCW A;  7CAT A;  1L1T A;  4OU7 A;  2P5T A;  5KQD A;  3GRY A;  4ITQ A;  3BOS A;  4AZF A;  3JAM S;  4LJ4 A;  1ZAE A;  1Z6T A;  2KRK A;  3A98 B;  3HJQ A;  5KPT A;  4JI5 M;  2DVW B;  4JYA M;  1NY6 A;  4NSR A;  3C58 A;  5IT9 S;  2CV2 A;  5DYG A;  5IZ7 D;  4MH0 E;  4QHS A;  5EP1 A;  4JI7 M;  2XEP A;  1N33 M;  1Q39 A;  1Z5A A;  4LG2 A;  5FTN A;  1Q3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...