3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
molecule keywords RcdA
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
4HL4A 2DNAA 1TF0B 4LGMA 1KSFX 4Z8XA 2O01F 5EQTA 4ITQA 2L2DA 2LVPC 4IBIA 1XB2B 4HLQA 2VQEM 4JN6A 4WW0A 2KA6B 4RNAA 3FUVA 2C98A 1Q39A 1NHWC 3HHZA 4LF5M 4PD2A 1FNNA 4IBEA 4XGIA 1XHBA 2GNOA 4NRWA 1NVMA 1GABA 2G3QA 1HQCA 3SAWA 3HHWA 3U6MA 2KZUA 4LFCM 3VKHA 2LXEA 3M6AA 4KLNA 2QENA 2YQZA 4MGYE 2EUCA 4OVZB 4DR2M 3F92A 3HU3A 5EP4A 3KW6A 5H37D 3NBXX 1W5SA 2KHHA 3GQ3A 1GKIA 1IN4A 4ZPXA 3K2LA 3SHGB 4IBGA 1Q02A 2ZAOA 1QVRA 4HEOA 1QUTA 1AIPC 1D0MA 4LF8M 2CV1A 1PJIA 4JI4M 4QHSA 2DXIA 4BB9A 4G4OA 4LF9M 4QOSA 2QP9X 4LZJA 2RGHA 1GLNA 1OJLA 1XMQM 4IBCA 1IY0A 4IJEA 2LWXA 3QWLA 4II7A 5KQ8A 1NNUC 1VEKA 2L7HA 1L8QA 1QAMA 5DYIA 4L4UA 2DZLA 4DV4M 3EIEA 2ERCA 1G3IA 2LHGA 5C18A 4QHTA 1MJGM 1N34M 3J7BA 1XXHB 3GLIA 5KQDA 2F5QA 4YHHM 2DHYA 3KFUG 3KS4A 5ITYA 3JR4A 4NOOB 1GL6A 2RKOA 3AFHA 4GKJM 1YLAA 1WJ7A 5ITUA 3E9SA 3RE8A 5ITXA 4JI7M 3UK6A 3VKGA 3R8FA 2XH9A 3FKEA 3H4MA 4QNRA 5EXTA 3U6DA 3B7NA 2BJWA 1Z5BA 4MM3B 4NC6A 5IWAM 3HHYA 3GPPA 3GPUA 1N33M 2Y20A 1EFUB 1ORYB 5EXXA 3T15A 3U61B 3B9PA 4DV2M 1IBLM 3C9PA 1VQ1A 2Y0TA 1TDHA 1TDZA 3U6OA 3FTFA 1Q3CA 1PJQA 3HX3A 2UUCM 4NRVA 3C3EA 4F2LA 4X64M 2APLA 2DZOB 4M0DA 1E9SA 1QANA 4L78A 5ITQA 2HHHM 2X4AA 3GRRA 2W82A 3BBZA 1WGLA 2N35A 2VQFM 2Z3XA 4B3MM 2QZ4A 4G4QA 2OQ4A 4DUYM 4DV7M 1Z5AA 3U60B 1IXZA 1QAOA 2H1RA 1R2YA 2KNZA 3VK7A 1SXJC 2MR9A 2FNAA 1TGUA 2J5YA 3SYKA 1QDRA 5BPVA 1Z5CA 2ZM6M 3FTDA 1OAOC 3U6QA 4LF7M 4DR4M 2D7EA 1MX0A 2OO9A 1OTRA 3FRHA 2O25A 3ILKA 3K1JA 4I4LA 3Q8GA 4GIPA 3ZCBB 2R45A 5LMNM 2VF8A 4RF1A 3GPXA 4DV6M 1HNZM 4JV5M 2DWNA 1G59A 3VFDA 1YUBA 2UUBM 3BOSA 3FTCA 3QAUA 1PJJA 2V1CA 1C7YA 3PFIA 4LZZA 4AKHA 1Y8GA 1GJTA 2X8AA 3SBJA 1UM8A 1PM5A 3SARA 2F5OA 1VG5A 3HWSA 3EIHA 3FRIA 1P3QQ 2QCUA 1PJSA 2ZTDA 4LJ7A 1J5EM 2ZTCA 3CGWA 4R3DA 1N32M 2CV0A 5FTKA 2KRKA 2DKLA 4AW4A 3OTOM 1NNJA 1DV0A 4JI3M 4DR7M 3L29A 2L4FA 2LVAA 3U6SA 4GKKM 3SMSA 4LF4M 3QYEA 3E4RA 3C58A 4KO8A 1OQYA 5DFLA 1IBMM 3HKPA 4GMQA 4AG6A 1HT1E 2Z4SA 1J09A 1GVNA 3I4YA 2DAMA 5ITXE 4IIWA 4OU7A 1S3SA 2JA2A 4FWHA 3J27B 2XSZA 5LMUM 2LH0A 2QQ8A 2MH8A 4S12A 1NJFA 2CP8A 1PGYA 1OKSA 1I4WA 3LQQA 3TWLA 4KT0F 3T6PA 5KPTA 1HJPA 3UMMA 5IZ7D 5ITTA 3FYDA 2DI0A 1D0KA 3MHVC 1IXRC 2R4JA 3CF2A 2ZBKB 3LMMA 1TR8A 2V6ZM 1OIPA 1J7KA 4W5WA 4B3RM 2WSCF 3SHFA 1ZMVA 2L7IA 1N77A 2Z7JA 1TH3A 2A5YB 4FW9A 2M5ZA 4F1IA 5EXPA 3GLHA 4R7GA 4RF0A 1XWIA 3TL4X 4L16A 1K82A 2VF7A 2K6BA 3MJ5A 1E94E 2LVOC 2X49A 4L15A 4JYAM 4PDIA 4CISA 2BNKA 1R7RA 1DGHA 1OFHA 1SXJE 1WGNA 2BWEA 3W0FA 3U5ZA 1E32A 1TTEA 3B7QA 1IBKM 1XC8A 2V1UA 2ZAMA 4CJ6A 3FUWA 1G71A 2DAEA 4JI6M 3NBIA 1YSYA 4K0KM 4RKUF 1K3WA 5FTLA 1V34A 1IN8A 3E21A 5L8RF 1DGHB 3U5ZB 2KXEA 2E5LM 4BLCA 2MJ5B 4IJFA 1IQPA 4PDGA 1NSFA 2NQ8C 2FH0A 1V33A 3CF0A 4JI8M 1SXJD 2RGOA 1F4IA 3J80S 2CEAA 4KODA 2YFQA 2D7GA 2DENA 3GLHB 3KDSE 4D80A 4Z6YA 2QHOB 4DV3M 2R6FA 4Q7JA 4I8OA 3A46A 4LGYA 4BBAA 1IM2A 2DAGA 1NY6A 3AOGA 2OOBA 4AI6A 1KFVA 1QUSA 4B08A 1QZMA 3FTEA 1WIVA 2C96A 3FUTA 2OPFA 1JB0F 3MMPA 2CUZA 1W5TA 2QSFX 1V92A 5FSWA 3GRUA 2CFOA 5EXSA 3AKZA 3GO8A 4GH9A 4DV5M 2LHCA 4G4NA 1C1KA 4AZFA 2Y21A 3KVWA 4D81A 1IFYA 1N75A 3DOAA 2JY8A 1Z6TA 3LVWA 1N36M 1HT2E 3BXWA 4CGYB 4B7HA 4UN2B 3ZH9B 4IBFA 2HKJA 1G8PA 2F5PA 2EO2A 3I04M 7CATA 5DNYA 4CIZA 4B7FA 3J2PB 1R4GA 4G3OA 3LVVA 2MGWA 2OOAA 1EE8A 4Y28F 3PXGA 3V76A 3U6EA 4JI5M 1A5TA 4FWGA 4IBJA 2DWZB 3KSXA 4AKIA 1HQYE 2XEPA 2CWBA 1OFIA 3UJNA 1DGFA 3SATA 3IG5A 4MGZE 3KP1E 4X66M 3DZDA 1NO1A 3JAMS 2QBYA 1QAQA 1DGBA 2K0BX 3U6LA 1IN5A 3AOEA 1VDDA 3J7AS 1LTMA 3THGA 2EJSA 2VIIA 3T1YM 3AL0C 1GO5A 2KNAA 3VDPA 3WHKA 4LFBM 3IECA 4MB7A 3SASA 2DAKA 2HAKA 3Q8XA 4LRSA 2JY6B 3WHLA 4G4RA 4FCVA 2CHQA 2QBYB 2JZ1A 4FCWA 1UFZA 1DGGA 2JZ0A 1BVSA 2BJVA 2R46A 4GITA 8CATA 2FOIC 4X65M 1K3XA 2I7PA 2JUJA 2Z4RA 4JXJA 2DWMA 4MH0E 3SYLA 3U6CA 1PRBA 3LQRA 2Y0QA 4MGHA 1G41A 2HCBA 4WP2A 5DYGA 1QDTA 2D7HA 1JR3A 1SG9A 2O5RA 1L1TA 2UXDM 2KZSA 4B3SM 5C1BA 1QQWA 3GLGE 2JWSA 2XZFA 3U60A 1HR0M 2F5SA 2JNHA 3M0EA 3PVSA 2HL7A 4NSRA 4JI1M 1AUAA 3KS8A 3GLGA 1ZAEA 1JQJC 4OX9M 3JR5A 1WR1B 3RGPA 3LW5F 2FS1A 1NHGC 1XMOM 1EIJA 2JY7A 5IREB 3AJIB 4JI0M 4LRTA 1L2DA 2R65A 2WZJA 3HJ8A 1NJGA 4LJ8A 4LCBA 4MGKE 4D82A 5JI2E 2K9DA 4M9XA 3SAVA 2UXCM 3ZC7B 3U61A 2JXNA 3HJQA 1PJTA 2R4EA 1IXSA 1MN3A 3GLHE 1Z59A 1GJSA 2CHGA 3NWLA 3L2AA 5IT9S 2BWBA 2KRUA 3GPYA 4IBBA 1IN6A 4DR6M 3DA1A 1E9RA 3SMPA 3GLFE 4XBOA 3AOEC 3RGSA 2C5RA 1SXJA 1X37A 4DR1M 4DBGB 3VK8A 4B7GA 4LF6M 3U6PA 1XNRM 4FCTA 3GLFA 3W67A 5BR8M 2L6OA 2EA0A 1XXHA 4DR3M 1Q3BA 2R18A 3PNYA 3L27A 4NSOB 4DV0M 3LCUA 3CTWB 4IBDA 4P17A 3TE6A 1JR3D 1HNXM 4LY6A 4MGIE 3D8LA 4OW0A 3HU2A 3W0LB 3L28A 3GLGB 3E46A 3FE3A 4GRIA 1OAIA 4TUWA 3GLIB 4CHTB 3K9PA 2RRUA 2DWLA 2F5NA 2YR0A 1IN7A 4ANRA 3LCVB 5F3WA 2LVNC 1XNQM 2R44A 1CUKA 3A98B 4AG5A 2DZNB 2L09A 2KDLA 4L6V6 4XK8F 1WXQA 3H4JA 5E6JA 3IHPA 4GHLA 1HNWM 2CHVA 4DUZM 3B89A 2WSEF 2HWJA 3L25A 3HU1A 1LV7A 4LJAA 1SXJB 3HY5A 3FYCA 2R62A 4I81A 2G8LA 2DHRA 5EJCA 5EP1A 1JR3E 5JI3E 3GLFB 3M7GA 2XSZD 3R9XB 2C9OA 4G6ZA 1QZEA 4LJ5A 3J81S 2J7NA 3TQSA 1GL7A 5FTNA 4QOZC 3KOZE 5KO3A 1WHCA 3VLFB 1R6BX 5FTMA 2L4EA 1QYRA 3HHXA 3VDUA 2YNMD 1OIZA 3W68A 3GRVA 2XF3A 3HZJA 1G4AE 2CRUA 2DVWB 5FLXS 4GC9A 2XZUA 2EKFA 2LTUA 2UU9M 4REZA 1YE9A 1NV8A 4LFAM 2XFSA 2LVQD 4M9ZA 3KXEC 4FWDA 1ZQ9A 4LG2A 3T1HM 4AQYM 4KHPM 2VDBB 4LJ6A 1IXSB 5FTJA 2GQFA 2LNHC 4GEWA 3GP1A 3QYBA 3KP0E 3TWKA 2M60A 1ZMWA 3B7ZA 2XLJA 3I01M 3RFWA 4DV1M 2KEBA 3KOXE 1RU3A 4B3TM 1H6UA 1VEJA 3A42A 3FUXA 1IY1A 2P5TA 2QNJA 4R71A 1TH2A 3KSJA 3L26A 5EP3A 2CE7A 3I51A 4NXMM 4GHAA 1NV9A 3DFZA 3A45A 1ZV1A 2UUAM 3CF6E 3MK6A 4LJ4A 1L2BA 1N78A 3KOYE 5KPRA 1I94M 2F4VM 5ITRA 1R2ZA 1VEGA 2UXBM 2CV2A 4L8RC 5KPZA 4JI2M 2LBCA 2EKKA 3D8BA 2G5GX 3PNVA 2QPAA 4IBKA 2FFJA 2J7OA 5EP2A 1FJGM 1L1ZA 2KNVA 2Q2EB 1TH4A 3B74A 3KOWE 1DO2A 3SAUA 2MROB 1KYIA 2B3TA 2Z8YM 2DAIA 4PT5A 4WURA 4A3VB 3K8ZA 3UGJA 2H5XA 1L2CA 3GQ4A 3T38A 4M0WA 4FVMA 2I7NA 1MU5A 3GRYA 1XXHE 1ZMUA 2AHMA 4FD2A 4DR5M 2C99A 1VDLA 3FD9A 1T6OA 4GC5A 1D2NA 4M9SA 4LJ9A 3ZQJA 4EIWA 5A2QS 3TWMA 3TPZA 2XFTA 4NL4H 3FUUA 4I5SA 3UZUA 3GLIE 1D0LA 1NY5A 3GQ5A 2FE8A 3HGIA 4X62M 3AV0A 3K9OA 2C9CA 3SC3A 1T43A 2KW0A 1IY2A 3HJSA 1R5LA 1DO0A 2ZANA 3I4VA 5E26A 3C3DA 4P16A 2R0IA 4PCZA 3SFZA 1T3TA 2JP7A 2XGNA 4YY3M 4OVZA 2JY5A 3IG8A 2K47A 4AKGA 4NXNM 5GKNA 2WSFF 4QNMA 3K92A
chains in the Genus database with same CATH topology
4HL4A 4LGMA 4Z8XA 1KSFX 5EQTA 4ITQA 4IBIA 2VQEM 4HLQA 4JN6A 4WW0A 2KA6B 4RNAA 3FUVA 2C98A 1Q39A 1NHWC 3HHZA 4LF5M 4PD2A 1FNNA 4IBEA 4XGIA 1XHBA 4NRWA 1NVMA 1HQCA 3SAWA 3HHWA 3U6MA 2KZUA 4LFCM 3VKHA 2LXEA 3M6AA 4KLNA 2QENA 2YQZA 4MGYE 2EUCA 4OVZB 4DR2M 5EP4A 3HU3A 5H37D 3KW6A 1W5SA 3GQ3A 1GKIA 1IN4A 4ZPXA 3K2LA 3SHGB 4IBGA 2ZAOA 1QVRA 4LF8M 2CV1A 1PJIA 4QHSA 2DXIA 4BB9A 4G4OA 4LF9M 4QOSA 2QP9X 4LZJA 2RGHA 1GLNA 1OJLA 1XMQM 4IBCA 1IY0A 4IJEA 2LWXA 3QWLA 4II7A 5KQ8A 1NNUC 2L7HA 1L8QA 1QAMA 5DYIA 4L4UA 4DV4M 2ERCA 1G3IA 5C18A 4QHTA 1N34M 3J7BA 1XXHB 3GLIA 5KQDA 2F5QA 4YHHM 3KFUG 3KS4A 5ITYA 3JR4A 4NOOB 1GL6A 2RKOA 3AFHA 4GKJM 5ITUA 3E9SA 3RE8A 5ITXA 4JI7M 3UK6A 3VKGA 3R8FA 2XH9A 3FKEA 3H4MA 4QNRA 5EXTA 3U6DA 2BJWA 1Z5BA 4MM3B 5IWAM 3HHYA 3GPPA 3GPUA 1N33M 2Y20A 1ORYB 5EXXA 3T15A 3U61B 3B9PA 4DV2M 1IBLM 2Y0TA 1TDZA 1TDHA 3FTFA 3U6OA 1Q3CA 2UUCM 4NRVA 4X64M 2DZOB 4M0DA 1E9SA 1QANA 4L78A 5ITQA 2HHHM 2X4AA 3GRRA 2W82A 2VQFM 4B3MM 2Z3XA 2QZ4A 4G4QA 2OQ4A 4DUYM 4DV7M 1Z5AA 3U60B 1IXZA 1QAOA 2H1RA 1R2YA 3VK7A 1SXJC 2FNAA 3SYKA 1TGUA 5BPVA 1Z5CA 2ZM6M 3FTDA 3U6QA 4LF7M 4DR4M 2D7EA 1MX0A 4I4LA 3K1JA 3ILKA 4GIPA 3ZCBB 2R45A 5LMNM 4RF1A 3GPXA 4DV6M 1HNZM 4JV5M 2DWNA 1G59A 3VFDA 1YUBA 2UUBM 3BOSA 3FTCA 3QAUA 1PJJA 2V1CA 3PFIA 4LZZA 4AKHA 3SARA 2X8AA 3SBJA 1UM8A 1PM5A 2F5OA 3HWSA 3EIHA 2QCUA 4LJ7A 4R3DA 1N32M 2CV0A 5FTKA 2KRKA 4AW4A 3OTOM 1NNJA 4JI3M 4DR7M 3L29A 3U6SA 4GKKM 3SMSA 4LF4M 3E4RA 3C58A 4KO8A 1IBMM 3HKPA 4GMQA 4AG6A 1HT1E 2Z4SA 1J09A 1GVNA 3I4YA 5ITXE 4IIWA 4OU7A 1S3SA 2JA2A 4FWHA 3J27B 2XSZA 5LMUM 2LH0A 4S12A 1NJFA 1I4WA 3LQQA 3TWLA 5KPTA 3UMMA 5IZ7D 5ITTA 3FYDA 3MHVC 1IXRC 2R4JA 3CF2A 2ZBKB 3LMMA 2V6ZM 1J7KA 4W5WA 4B3RM 3SHFA 2L7IA 1N77A 2Z7JA 1TH3A 2A5YB 4FW9A 2M5ZA 5EXPA 3GLHA 4R7GA 4RF0A 1XWIA 3TL4X 4L16A 1K82A 3MJ5A 1E94E 2X49A 4L15A 4JYAM 4PDIA 4CISA 2BNKA 1R7RA 1DGHA 1OFHA 1SXJE 3W0FA 3U5ZA 1J5EM 1E32A 1IBKM 1XC8A 2V1UA 2ZAMA 3FUWA 4JI6M 3NBIA 1YSYA 4K0KM 1K3WA 5FTLA 1IN8A 1DGHB 3U5ZB 2KXEA 2E5LM 4BLCA 4IJFA 1IQPA 4PDGA 1NSFA 2NQ8C 3CF0A 4JI8M 1SXJD 2RGOA 3J80S 2CEAA 4KODA 2YFQA 2D7GA 3GLHB 3KDSE 4D80A 4Z6YA 4DV3M 4I8OA 3A46A 4LGYA 4BBAA 1IM2A 1NY6A 3AOGA 4AI6A 1KFVA 4B08A 1QZMA 3FTEA 2C96A 3FUTA 2OPFA 2CUZA 1W5TA 5FSWA 3GRUA 2CFOA 5EXSA 3AKZA 3GO8A 4GH9A 4DV5M 4G4NA 1C1KA 4AZFA 2Y21A 3KVWA 4D81A 1N75A 3DOAA 1Z6TA 3LVWA 1N36M 1HT2E 4CGYB 4B7HA 3ZH9B 4IBFA 2HKJA 1G8PA 2F5PA 2EO2A 7CATA 5DNYA 4B7FA 3J2PB 3PXGA 3LVVA 3U6EA 1EE8A 4JI5M 4FWGA 4IBJA 2DWZB 3KSXA 4AKIA 1HQYE 2XEPA 3UJNA 1OFIA 1DGFA 3SATA 3IG5A 4MGZE 3KP1E 4X66M 3DZDA 3JAMS 2QBYA 1QAQA 1DGBA 3U6LA 1IN5A 3AOEA 1VDDA 3J7AS 3AL0C 3THGA 2VIIA 3T1YM 3VDPA 3WHKA 4LFBM 4MB7A 3SASA 3Q8XA 3WHLA 4LRSA 4G4RA 4FCVA 2CHQA 2QBYB 4FCWA 1DGGA 2BJVA 2R46A 4GITA 8CATA 1K3XA 2FOIC 4X65M 4B3TM 2I7PA 2Z4RA 4JXJA 2DWMA 4MH0E 3SYLA 3U6CA 3LQRA 2Y0QA 4MGHA 1G41A 2HCBA 5DYGA 2D7HA 1JR3A 2O5RA 1L1TA 2UXDM 2KZSA 4B3SM 5C1BA 1QQWA 2XZFA 1HR0M 2F5SA 3U60A 4JI4M 3M0EA 3PVSA 2HL7A 4NSRA 4JI1M 3KS8A 3GLGA 1ZAEA 1JQJC 4OX9M 3JR5A 3RGPA 1NHGC 1XMOM 5IREB 3AJIB 4JI0M 4LRTA 1L2DA 2R65A 3HJ8A 4LJ8A 1NJGA 4LCBA 4MGKE 4D82A 5JI2E 4M9XA 3SAVA 2UXCM 3ZC7B 3U61A 3HJQA 2R4EA 1Z59A 2CHGA 3NWLA 3L2AA 5IT9S 2KRUA 3GPYA 4IBBA 1IN6A 4DR6M 3DA1A 1E9RA 3SMPA 4XBOA 3AOEC 3RGSA 2C5RA 1SXJA 1X37A 4DR1M 3VK8A 4B7GA 4LF6M 3U6PA 1XNRM 4FCTA 3GLFA 5BR8M 2L6OA 2EA0A 1XXHA 4DR3M 1Q3BA 2R18A 3PNYA 3L27A 4NSOB 4DV0M 3CTWB 4IBDA 3TE6A 1JR3D 1HNXM 4LY6A 4MGIE 3D8LA 4OW0A 3HU2A 3W0LB 3L28A 3GLGB 4TUWA 4GRIA 3GLIB 4CHTB 2DWLA 2F5NA 2YR0A 1IN7A 5F3WA 1XNQM 3A98B 4AG5A 2DZNB 2L09A 1WXQA 5E6JA 4GHLA 1HNWM 2CHVA 4DUZM 3L25A 3HU1A 1LV7A 4LJAA 1SXJB 3FYCA 2R62A 4I81A 2G8LA 2DHRA 5EJCA 5EP1A 5JI3E 3GLFB 3M7GA 2XSZD 3R9XB 2C9OA 4G6ZA 4LJ5A 3J81S 2J7NA 3TQSA 1GL7A 5FTNA 4QOZC 3KOZE 5KO3A 3VLFB 1R6BX 5FTMA 1QYRA 3HHXA 3VDUA 2YNMD 3GRVA 2XF3A 1G4AE 2DVWB 5FLXS 4GC9A 2XZUA 2UU9M 4REZA 1YE9A 4LFAM 2XFSA 4M9ZA 3KXEC 4FWDA 1ZQ9A 4LG2A 3T1HM 4AQYM 4KHPM 4LJ6A 1IXSB 5FTJA 2LNHC 3GP1A 3KP0E 3TWKA 2M60A 2XLJA 3RFWA 4DV1M 2KEBA 3KOXE 1H6UA 3A42A 3FUXA 1IY1A 2P5TA 1TH2A 3KSJA 3L26A 5EP3A 2CE7A 3I51A 4NXMM 4GHAA 3DFZA 3A45A 2UUAM 3CF6E 3MK6A 4LJ4A 1L2BA 1N78A 3KOYE 5KPRA 1I94M 2F4VM 5ITRA 1R2ZA 2UXBM 2CV2A 4L8RC 5KPZA 4JI2M 3D8BA 2G5GX 3PNVA 2QPAA 4IBKA 2FFJA 2J7OA 5EP2A 1FJGM 1L1ZA 2Q2EB 1TH4A 3KOWE 1DO2A 3SAUA 1KYIA 4PT5A 4WURA 4A3VB 3K8ZA 3UGJA 1L2CA 3GQ4A 3T38A 4M0WA 4FVMA 2I7NA 1MU5A 3GRYA 2AHMA 4FD2A 4DR5M 2C99A 3FD9A 4GC5A 1D2NA 4M9SA 4LJ9A 4EIWA 5A2QS 3TWMA 3TPZA 2XFTA 4NL4H 3FUUA 4I5SA 3UZUA 1NY5A 3GQ5A 2FE8A 3HGIA 4X62M 3AV0A 2C9CA 3SC3A 2KW0A 1IY2A 3HJSA 5E26A 1DO0A 2ZANA 3I4VA 4P16A 4PCZA 3SFZA 1T3TA 2XGNA 4YY3M 4OVZA 3IG8A 2K47A 4AKGA 4NXNM 5GKNA 3EIEA 4QNMA 3K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 4HL4 A;  2DNA A;  1TF0 B;  4LGM A;  1KSF X;  4Z8X A;  2O01 F;  5EQT A;  4ITQ A;  2L2D A;  2LVP C;  4IBI A;  1XB2 B;  4HLQ A;  2VQE M;  4JN6 A;  4WW0 A;  2KA6 B;  4RNA A;  3FUV A;  2C98 A;  1Q39 A;  1NHW C;  3HHZ A;  4LF5 M;  4PD2 A;  1FNN A;  4IBE A;  4XGI A;  1XHB A;  2GNO A;  4NRW A;  1NVM A;  1GAB A;  2G3Q A;  1HQC A;  3SAW A;  3HHW A;  3U6M A;  2KZU A;  4LFC M;  3VKH A;  2LXE A;  3M6A A;  4KLN A;  2QEN A;  2YQZ A;  4MGY E;  2EUC A;  4OVZ B;  4DR2 M;  3F92 A;  3HU3 A;  5EP4 A;  3KW6 A;  5H37 D;  3NBX X;  1W5S A;  2KHH A;  3GQ3 A;  1GKI A;  1IN4 A;  4ZPX A;  3K2L A;  3SHG B;  4IBG A;  1Q02 A;  2ZAO A;  1QVR A;  4HEO A;  1QUT A;  1AIP C;  1D0M A;  4LF8 M;  2CV1 A;  1PJI A;  4JI4 M;  4QHS A;  2DXI A;  4BB9 A;  4G4O A;  4LF9 M;  4QOS A;  2QP9 X;  4LZJ A;  2RGH A;  1GLN A;  1OJL A;  1XMQ M;  4IBC A;  1IY0 A;  4IJE A;  2LWX A;  3QWL A;  4II7 A;  5KQ8 A;  1NNU C;  1VEK A;  2L7H A;  1L8Q A;  1QAM A;  5DYI A;  4L4U A;  2DZL A;  4DV4 M;  3EIE A;  2ERC A;  1G3I A;  2LHG A;  5C18 A;  4QHT A;  1MJG M;  1N34 M;  3J7B A;  1XXH B;  3GLI A;  5KQD A;  2F5Q A;  4YHH M;  2DHY A;  3KFU G;  3KS4 A;  5ITY A;  3JR4 A;  4NOO B;  1GL6 A;  2RKO A;  3AFH A;  4GKJ M;  1YLA A;  1WJ7 A;  5ITU A;  3E9S A;  3RE8 A;  5ITX A;  4JI7 M;  3UK6 A;  3VKG A;  3R8F A;  2XH9 A;  3FKE A;  3H4M A;  4QNR A;  5EXT A;  3U6D A;  3B7N A;  2BJW A;  1Z5B A;  4MM3 B;  4NC6 A;  5IWA M;  3HHY A;  3GPP A;  3GPU A;  1N33 M;  2Y20 A;  1EFU B;  1ORY B;  5EXX A;  3T15 A;  3U61 B;  3B9P A;  4DV2 M;  1IBL M;  3C9P A;  1VQ1 A;  2Y0T A;  1TDH A;  1TDZ A;  3U6O A;  3FTF A;  1Q3C A;  1PJQ A;  3HX3 A;  2UUC M;  4NRV A;  3C3E A;  4F2L A;  4X64 M;  2APL A;  2DZO B;  4M0D A;  1E9S A;  1QAN A;  4L78 A;  5ITQ A;  2HHH M;  2X4A A;  3GRR A;  2W82 A;  3BBZ A;  1WGL A;  2N35 A;  2VQF M;  2Z3X A;  4B3M M;  2QZ4 A;  4G4Q A;  2OQ4 A;  4DUY M;  4DV7 M;  1Z5A A;  3U60 B;  1IXZ A;  1QAO A;  2H1R A;  1R2Y A;  2KNZ A;  3VK7 A;  1SXJ C;  2MR9 A;  2FNA A;  1TGU A;  2J5Y A;  3SYK A;  1QDR A;  5BPV A;  1Z5C A;  2ZM6 M;  3FTD A;  1OAO C;  3U6Q A;  4LF7 M;  4DR4 M;  2D7E A;  1MX0 A;  2OO9 A;  1OTR A;  3FRH A;  2O25 A;  3ILK A;  3K1J A;  4I4L A;  3Q8G A;  4GIP A;  3ZCB B;  2R45 A;  5LMN M;  2VF8 A;  4RF1 A;  3GPX A;  4DV6 M;  1HNZ M;  4JV5 M;  2DWN A;  1G59 A;  3VFD A;  1YUB A;  2UUB M;  3BOS A;  3FTC A;  3QAU A;  1PJJ A;  2V1C A;  1C7Y A;  3PFI A;  4LZZ A;  4AKH A;  1Y8G A;  1GJT A;  2X8A A;  3SBJ A;  1UM8 A;  1PM5 A;  3SAR A;  2F5O A;  1VG5 A;  3HWS A;  3EIH A;  3FRI A;  1P3Q Q;  2QCU A;  1PJS A;  2ZTD A;  4LJ7 A;  1J5E M;  2ZTC A;  3CGW A;  4R3D A;  1N32 M;  2CV0 A;  5FTK A;  2KRK A;  2DKL A;  4AW4 A;  3OTO M;  1NNJ A;  1DV0 A;  4JI3 M;  4DR7 M;  3L29 A;  2L4F A;  2LVA A;  3U6S A;  4GKK M;  3SMS A;  4LF4 M;  3QYE A;  3E4R A;  3C58 A;  4KO8 A;  1OQY A;  5DFL A;  1IBM M;  3HKP A;  4GMQ A;  4AG6 A;  1HT1 E;  2Z4S A;  1J09 A;  1GVN A;  3I4Y A;  2DAM A;  5ITX E;  4IIW A;  4OU7 A;  1S3S A;  2JA2 A;  4FWH A;  3J27 B;  2XSZ A;  5LMU M;  2LH0 A;  2QQ8 A;  2MH8 A;  4S12 A;  1NJF A;  2CP8 A;  1PGY A;  1OKS A;  1I4W A;  3LQQ A;  3TWL A;  4KT0 F;  3T6P A;  5KPT A;  1HJP A;  3UMM A;  5IZ7 D;  5ITT A;  3FYD A;  2DI0 A;  1D0K A;  3MHV C;  1IXR C;  2R4J A;  3CF2 A;  2ZBK B;  3LMM A;  1TR8 A;  2V6Z M;  1OIP A;  1J7K A;  4W5W A;  4B3R M;  2WSC F;  3SHF A;  1ZMV A;  2L7I A;  1N77 A;  2Z7J A;  1TH3 A;  2A5Y B;  4FW9 A;  2M5Z A;  4F1I A;  5EXP A;  3GLH A;  4R7G A;  4RF0 A;  1XWI A;  3TL4 X;  4L16 A;  1K82 A;  2VF7 A;  2K6B A;  3MJ5 A;  1E94 E;  2LVO C;  2X49 A;  4L15 A;  4JYA M;  4PDI A;  4CIS A;  2BNK A;  1R7R A;  1DGH A;  1OFH A;  1SXJ E;  1WGN A;  2BWE A;  3W0F A;  3U5Z A;  1E32 A;  1TTE A;  3B7Q A;  1IBK M;  1XC8 A;  2V1U A;  2ZAM A;  4CJ6 A;  3FUW A;  1G71 A;  2DAE A;  4JI6 M;  3NBI A;  1YSY A;  4K0K M;  4RKU F;  1K3W A;  5FTL A;  1V34 A;  1IN8 A;  3E21 A;  5L8R F;  1DGH B;  3U5Z B;  2KXE A;  2E5L M;  4BLC A;  2MJ5 B;  4IJF A;  1IQP A;  4PDG A;  1NSF A;  2NQ8 C;  2FH0 A;  1V33 A;  3CF0 A;  4JI8 M;  1SXJ D;  2RGO A;  1F4I A;  3J80 S;  2CEA A;  4KOD A;  2YFQ A;  2D7G A;  2DEN A;  3GLH B;  3KDS E;  4D80 A;  4Z6Y A;  2QHO B;  4DV3 M;  2R6F A;  4Q7J A;  4I8O A;  3A46 A;  4LGY A;  4BBA A;  1IM2 A;  2DAG A;  1NY6 A;  3AOG A;  2OOB A;  4AI6 A;  1KFV A;  1QUS A;  4B08 A;  1QZM A;  3FTE A;  1WIV A;  2C96 A;  3FUT A;  2OPF A;  1JB0 F;  3MMP A;  2CUZ A;  1W5T A;  2QSF X;  1V92 A;  5FSW A;  3GRU A;  2CFO A;  5EXS A;  3AKZ A;  3GO8 A;  4GH9 A;  4DV5 M;  2LHC A;  4G4N A;  1C1K A;  4AZF A;  2Y21 A;  3KVW A;  4D81 A;  1IFY A;  1N75 A;  3DOA A;  2JY8 A;  1Z6T A;  3LVW A;  1N36 M;  1HT2 E;  3BXW A;  4CGY B;  4B7H A;  4UN2 B;  3ZH9 B;  4IBF A;  2HKJ A;  1G8P A;  2F5P A;  2EO2 A;  3I04 M;  7CAT A;  5DNY A;  4CIZ A;  4B7F A;  3J2P B;  1R4G A;  4G3O A;  3LVV A;  2MGW A;  2OOA A;  1EE8 A;  4Y28 F;  3PXG A;  3V76 A;  3U6E A;  4JI5 M;  1A5T A;  4FWG A;  4IBJ A;  2DWZ B;  3KSX A;  4AKI A;  1HQY E;  2XEP A;  2CWB A;  1OFI A;  3UJN A;  1DGF A;  3SAT A;  3IG5 A;  4MGZ E;  3KP1 E;  4X66 M;  3DZD A;  1NO1 A;  3JAM S;  2QBY A;  1QAQ A;  1DGB A;  2K0B X;  3U6L A;  1IN5 A;  3AOE A;  1VDD A;  3J7A S;  1LTM A;  3THG A;  2EJS A;  2VII A;  3T1Y M;  3AL0 C;  1GO5 A;  2KNA A;  3VDP A;  3WHK A;  4LFB M;  3IEC A;  4MB7 A;  3SAS A;  2DAK A;  2HAK A;  3Q8X A;  4LRS A;  2JY6 B;  3WHL A;  4G4R A;  4FCV A;  2CHQ A;  2QBY B;  2JZ1 A;  4FCW A;  1UFZ A;  1DGG A;  2JZ0 A;  1BVS A;  2BJV A;  2R46 A;  4GIT A;  8CAT A;  2FOI C;  4X65 M;  1K3X A;  2I7P A;  2JUJ A;  2Z4R A;  4JXJ A;  2DWM A;  4MH0 E;  3SYL A;  3U6C A;  1PRB A;  3LQR A;  2Y0Q A;  4MGH A;  1G41 A;  2HCB A;  4WP2 A;  5DYG A;  1QDT A;  2D7H A;  1JR3 A;  1SG9 A;  2O5R A;  1L1T A;  2UXD M;  2KZS A;  4B3S M;  5C1B A;  1QQW A;  3GLG E;  2JWS A;  2XZF A;  3U60 A;  1HR0 M;  2F5S A;  2JNH A;  3M0E A;  3PVS A;  2HL7 A;  4NSR A;  4JI1 M;  1AUA A;  3KS8 A;  3GLG A;  1ZAE A;  1JQJ C;  4OX9 M;  3JR5 A;  1WR1 B;  3RGP A;  3LW5 F;  2FS1 A;  1NHG C;  1XMO M;  1EIJ A;  2JY7 A;  5IRE B;  3AJI B;  4JI0 M;  4LRT A;  1L2D A;  2R65 A;  2WZJ A;  3HJ8 A;  1NJG A;  4LJ8 A;  4LCB A;  4MGK E;  4D82 A;  5JI2 E;  2K9D A;  4M9X A;  3SAV A;  2UXC M;  3ZC7 B;  3U61 A;  2JXN A;  3HJQ A;  1PJT A;  2R4E A;  1IXS A;  1MN3 A;  3GLH E;  1Z59 A;  1GJS A;  2CHG A;  3NWL A;  3L2A A;  5IT9 S;  2BWB A;  2KRU A;  3GPY A;  4IBB A;  1IN6 A;  4DR6 M;  3DA1 A;  1E9R A;  3SMP A;  3GLF E;  4XBO A;  3AOE C;  3RGS A;  2C5R A;  1SXJ A;  1X37 A;  4DR1 M;  4DBG B;  3VK8 A;  4B7G A;  4LF6 M;  3U6P A;  1XNR M;  4FCT A;  3GLF A;  3W67 A;  5BR8 M;  2L6O A;  2EA0 A;  1XXH A;  4DR3 M;  1Q3B A;  2R18 A;  3PNY A;  3L27 A;  4NSO B;  4DV0 M;  3LCU A;  3CTW B;  4IBD A;  4P17 A;  3TE6 A;  1JR3 D;  1HNX M;  4LY6 A;  4MGI E;  3D8L A;  4OW0 A;  3HU2 A;  3W0L B;  3L28 A;  3GLG B;  3E46 A;  3FE3 A;  4GRI A;  1OAI A;  4TUW A;  3GLI B;  4CHT B;  3K9P A;  2RRU A;  2DWL A;  2F5N A;  2YR0 A;  1IN7 A;  4ANR A;  3LCV B;  5F3W A;  2LVN C;  1XNQ M;  2R44 A;  1CUK A;  3A98 B;  4AG5 A;  2DZN B;  2L09 A;  2KDL A;  4L6V 6;  4XK8 F;  1WXQ A;  3H4J A;  5E6J A;  3IHP A;  4GHL A;  1HNW M;  2CHV A;  4DUZ M;  3B89 A;  2WSE F;  2HWJ A;  3L25 A;  3HU1 A;  1LV7 A;  4LJA A;  1SXJ B;  3HY5 A;  3FYC A;  2R62 A;  4I81 A;  2G8L A;  2DHR A;  5EJC A;  5EP1 A;  1JR3 E;  5JI3 E;  3GLF B;  3M7G A;  2XSZ D;  3R9X B;  2C9O A;  4G6Z A;  1QZE A;  4LJ5 A;  3J81 S;  2J7N A;  3TQS A;  1GL7 A;  5FTN A;  4QOZ C;  3KOZ E;  5KO3 A;  1WHC A;  3VLF B;  1R6B X;  5FTM A;  2L4E A;  1QYR A;  3HHX A;  3VDU A;  2YNM D;  1OIZ A;  3W68 A;  3GRV A;  2XF3 A;  3HZJ A;  1G4A E;  2CRU A;  2DVW B;  5FLX S;  4GC9 A;  2XZU A;  2EKF A;  2LTU A;  2UU9 M;  4REZ A;  1YE9 A;  1NV8 A;  4LFA M;  2XFS A;  2LVQ D;  4M9Z A;  3KXE C;  4FWD A;  1ZQ9 A;  4LG2 A;  3T1H M;  4AQY M;  4KHP M;  2VDB B;  4LJ6 A;  1IXS B;  5FTJ A;  2GQF A;  2LNH C;  4GEW A;  3GP1 A;  3QYB A;  3KP0 E;  3TWK A;  2M60 A;  1ZMW A;  3B7Z A;  2XLJ A;  3I01 M;  3RFW A;  4DV1 M;  2KEB A;  3KOX E;  1RU3 A;  4B3T M;  1H6U A;  1VEJ A;  3A42 A;  3FUX A;  1IY1 A;  2P5T A;  2QNJ A;  4R71 A;  1TH2 A;  3KSJ A;  3L26 A;  5EP3 A;  2CE7 A;  3I51 A;  4NXM M;  4GHA A;  1NV9 A;  3DFZ A;  3A45 A;  1ZV1 A;  2UUA M;  3CF6 E;  3MK6 A;  4LJ4 A;  1L2B A;  1N78 A;  3KOY E;  5KPR A;  1I94 M;  2F4V M;  5ITR A;  1R2Z A;  1VEG A;  2UXB M;  2CV2 A;  4L8R C;  5KPZ A;  4JI2 M;  2LBC A;  2EKK A;  3D8B A;  2G5G X;  3PNV A;  2QPA A;  4IBK A;  2FFJ A;  2J7O A;  5EP2 A;  1FJG M;  1L1Z A;  2KNV A;  2Q2E B;  1TH4 A;  3B74 A;  3KOW E;  1DO2 A;  3SAU A;  2MRO B;  1KYI A;  2B3T A;  2Z8Y M;  2DAI A;  4PT5 A;  4WUR A;  4A3V B;  3K8Z A;  3UGJ A;  2H5X A;  1L2C A;  3GQ4 A;  3T38 A;  4M0W A;  4FVM A;  2I7N A;  1MU5 A;  3GRY A;  1XXH E;  1ZMU A;  2AHM A;  4FD2 A;  4DR5 M;  2C99 A;  1VDL A;  3FD9 A;  1T6O A;  4GC5 A;  1D2N A;  4M9S A;  4LJ9 A;  3ZQJ A;  4EIW A;  5A2Q S;  3TWM A;  3TPZ A;  2XFT A;  4NL4 H;  3FUU A;  4I5S A;  3UZU A;  3GLI E;  1D0L A;  1NY5 A;  3GQ5 A;  2FE8 A;  3HGI A;  4X62 M;  3AV0 A;  3K9O A;  2C9C A;  3SC3 A;  1T43 A;  2KW0 A;  1IY2 A;  3HJS A;  1R5L A;  1DO0 A;  2ZAN A;  3I4V A;  5E26 A;  3C3D A;  4P16 A;  2R0I A;  4PCZ A;  3SFZ A;  1T3T A;  2JP7 A;  2XGN A;  4YY3 M;  4OVZ A;  2JY5 A;  3IG8 A;  2K47 A;  4AKG A;  4NXN M;  5GKN A;  2WSF F;  4QNM A;  3K92 A; 
#chains in the Genus database with same CATH homology
 4HL4 A;  4LGM A;  4Z8X A;  1KSF X;  5EQT A;  4ITQ A;  4IBI A;  2VQE M;  4HLQ A;  4JN6 A;  4WW0 A;  2KA6 B;  4RNA A;  3FUV A;  2C98 A;  1Q39 A;  1NHW C;  3HHZ A;  4LF5 M;  4PD2 A;  1FNN A;  4IBE A;  4XGI A;  1XHB A;  4NRW A;  1NVM A;  1HQC A;  3SAW A;  3HHW A;  3U6M A;  2KZU A;  4LFC M;  3VKH A;  2LXE A;  3M6A A;  4KLN A;  2QEN A;  2YQZ A;  4MGY E;  2EUC A;  4OVZ B;  4DR2 M;  5EP4 A;  3HU3 A;  5H37 D;  3KW6 A;  1W5S A;  3GQ3 A;  1GKI A;  1IN4 A;  4ZPX A;  3K2L A;  3SHG B;  4IBG A;  2ZAO A;  1QVR A;  4LF8 M;  2CV1 A;  1PJI A;  4QHS A;  2DXI A;  4BB9 A;  4G4O A;  4LF9 M;  4QOS A;  2QP9 X;  4LZJ A;  2RGH A;  1GLN A;  1OJL A;  1XMQ M;  4IBC A;  1IY0 A;  4IJE A;  2LWX A;  3QWL A;  4II7 A;  5KQ8 A;  1NNU C;  2L7H A;  1L8Q A;  1QAM A;  5DYI A;  4L4U A;  4DV4 M;  2ERC A;  1G3I A;  5C18 A;  4QHT A;  1N34 M;  3J7B A;  1XXH B;  3GLI A;  5KQD A;  2F5Q A;  4YHH M;  3KFU G;  3KS4 A;  5ITY A;  3JR4 A;  4NOO B;  1GL6 A;  2RKO A;  3AFH A;  4GKJ M;  5ITU A;  3E9S A;  3RE8 A;  5ITX A;  4JI7 M;  3UK6 A;  3VKG A;  3R8F A;  2XH9 A;  3FKE A;  3H4M A;  4QNR A;  5EXT A;  3U6D A;  2BJW A;  1Z5B A;  4MM3 B;  5IWA M;  3HHY A;  3GPP A;  3GPU A;  1N33 M;  2Y20 A;  1ORY B;  5EXX A;  3T15 A;  3U61 B;  3B9P A;  4DV2 M;  1IBL M;  2Y0T A;  1TDZ A;  1TDH A;  3FTF A;  3U6O A;  1Q3C A;  2UUC M;  4NRV A;  4X64 M;  2DZO B;  4M0D A;  1E9S A;  1QAN A;  4L78 A;  5ITQ A;  2HHH M;  2X4A A;  3GRR A;  2W82 A;  2VQF M;  4B3M M;  2Z3X A;  2QZ4 A;  4G4Q A;  2OQ4 A;  4DUY M;  4DV7 M;  1Z5A A;  3U60 B;  1IXZ A;  1QAO A;  2H1R A;  1R2Y A;  3VK7 A;  1SXJ C;  2FNA A;  3SYK A;  1TGU A;  5BPV A;  1Z5C A;  2ZM6 M;  3FTD A;  3U6Q A;  4LF7 M;  4DR4 M;  2D7E A;  1MX0 A;  4I4L A;  3K1J A;  3ILK A;  4GIP A;  3ZCB B;  2R45 A;  5LMN M;  4RF1 A;  3GPX A;  4DV6 M;  1HNZ M;  4JV5 M;  2DWN A;  1G59 A;  3VFD A;  1YUB A;  2UUB M;  3BOS A;  3FTC A;  3QAU A;  1PJJ A;  2V1C A;  3PFI A;  4LZZ A;  4AKH A;  3SAR A;  2X8A A;  3SBJ A;  1UM8 A;  1PM5 A;  2F5O A;  3HWS A;  3EIH A;  2QCU A;  4LJ7 A;  4R3D A;  1N32 M;  2CV0 A;  5FTK A;  2KRK A;  4AW4 A;  3OTO M;  1NNJ A;  4JI3 M;  4DR7 M;  3L29 A;  3U6S A;  4GKK M;  3SMS A;  4LF4 M;  3E4R A;  3C58 A;  4KO8 A;  1IBM M;  3HKP A;  4GMQ A;  4AG6 A;  1HT1 E;  2Z4S A;  1J09 A;  1GVN A;  3I4Y A;  5ITX E;  4IIW A;  4OU7 A;  1S3S A;  2JA2 A;  4FWH A;  3J27 B;  2XSZ A;  5LMU M;  2LH0 A;  4S12 A;  1NJF A;  1I4W A;  3LQQ A;  3TWL A;  5KPT A;  3UMM A;  5IZ7 D;  5ITT A;  3FYD A;  3MHV C;  1IXR C;  2R4J A;  3CF2 A;  2ZBK B;  3LMM A;  2V6Z M;  1J7K A;  4W5W A;  4B3R M;  3SHF A;  2L7I A;  1N77 A;  2Z7J A;  1TH3 A;  2A5Y B;  4FW9 A;  2M5Z A;  5EXP A;  3GLH A;  4R7G A;  4RF0 A;  1XWI A;  3TL4 X;  4L16 A;  1K82 A;  3MJ5 A;  1E94 E;  2X49 A;  4L15 A;  4JYA M;  4PDI A;  4CIS A;  2BNK A;  1R7R A;  1DGH A;  1OFH A;  1SXJ E;  3W0F A;  3U5Z A;  1J5E M;  1E32 A;  1IBK M;  1XC8 A;  2V1U A;  2ZAM A;  3FUW A;  4JI6 M;  3NBI A;  1YSY A;  4K0K M;  1K3W A;  5FTL A;  1IN8 A;  1DGH B;  3U5Z B;  2KXE A;  2E5L M;  4BLC A;  4IJF A;  1IQP A;  4PDG A;  1NSF A;  2NQ8 C;  3CF0 A;  4JI8 M;  1SXJ D;  2RGO A;  3J80 S;  2CEA A;  4KOD A;  2YFQ A;  2D7G A;  3GLH B;  3KDS E;  4D80 A;  4Z6Y A;  4DV3 M;  4I8O A;  3A46 A;  4LGY A;  4BBA A;  1IM2 A;  1NY6 A;  3AOG A;  4AI6 A;  1KFV A;  4B08 A;  1QZM A;  3FTE A;  2C96 A;  3FUT A;  2OPF A;  2CUZ A;  1W5T A;  5FSW A;  3GRU A;  2CFO A;  5EXS A;  3AKZ A;  3GO8 A;  4GH9 A;  4DV5 M;  4G4N A;  1C1K A;  4AZF A;  2Y21 A;  3KVW A;  4D81 A;  1N75 A;  3DOA A;  1Z6T A;  3LVW A;  1N36 M;  1HT2 E;  4CGY B;  4B7H A;  3ZH9 B;  4IBF A;  2HKJ A;  1G8P A;  2F5P A;  2EO2 A;  7CAT A;  5DNY A;  4B7F A;  3J2P B;  3PXG A;  3LVV A;  3U6E A;  1EE8 A;  4JI5 M;  4FWG A;  4IBJ A;  2DWZ B;  3KSX A;  4AKI A;  1HQY E;  2XEP A;  3UJN A;  1OFI A;  1DGF A;  3SAT A;  3IG5 A;  4MGZ E;  3KP1 E;  4X66 M;  3DZD A;  3JAM S;  2QBY A;  1QAQ A;  1DGB A;  3U6L A;  1IN5 A;  3AOE A;  1VDD A;  3J7A S;  3AL0 C;  3THG A;  2VII A;  3T1Y M;  3VDP A;  3WHK A;  4LFB M;  4MB7 A;  3SAS A;  3Q8X A;  3WHL A;  4LRS A;  4G4R A;  4FCV A;  2CHQ A;  2QBY B;  4FCW A;  1DGG A;  2BJV A;  2R46 A;  4GIT A;  8CAT A;  1K3X A;  2FOI C;  4X65 M;  4B3T M;  2I7P A;  2Z4R A;  4JXJ A;  2DWM A;  4MH0 E;  3SYL A;  3U6C A;  3LQR A;  2Y0Q A;  4MGH A;  1G41 A;  2HCB A;  5DYG A;  2D7H A;  1JR3 A;  2O5R A;  1L1T A;  2UXD M;  2KZS A;  4B3S M;  5C1B A;  1QQW A;  2XZF A;  1HR0 M;  2F5S A;  3U60 A;  4JI4 M;  3M0E A;  3PVS A;  2HL7 A;  4NSR A;  4JI1 M;  3KS8 A;  3GLG A;  1ZAE A;  1JQJ C;  4OX9 M;  3JR5 A;  3RGP A;  1NHG C;  1XMO M;  5IRE B;  3AJI B;  4JI0 M;  4LRT A;  1L2D A;  2R65 A;  3HJ8 A;  4LJ8 A;  1NJG A;  4LCB A;  4MGK E;  4D82 A;  5JI2 E;  4M9X A;  3SAV A;  2UXC M;  3ZC7 B;  3U61 A;  3HJQ A;  2R4E A;  1Z59 A;  2CHG A;  3NWL A;  3L2A A;  5IT9 S;  2KRU A;  3GPY A;  4IBB A;  1IN6 A;  4DR6 M;  3DA1 A;  1E9R A;  3SMP A;  4XBO A;  3AOE C;  3RGS A;  2C5R A;  1SXJ A;  1X37 A;  4DR1 M;  3VK8 A;  4B7G A;  4LF6 M;  3U6P A;  1XNR M;  4FCT A;  3GLF A;  5BR8 M;  2L6O A;  2EA0 A;  1XXH A;  4DR3 M;  1Q3B A;  2R18 A;  3PNY A;  3L27 A;  4NSO B;  4DV0 M;  3CTW B;  4IBD A;  3TE6 A;  1JR3 D;  1HNX M;  4LY6 A;  4MGI E;  3D8L A;  4OW0 A;  3HU2 A;  3W0L B;  3L28 A;  3GLG B;  4TUW A;  4GRI A;  3GLI B;  4CHT B;  2DWL A;  2F5N A;  2YR0 A;  1IN7 A;  5F3W A;  1XNQ M;  3A98 B;  4AG5 A;  2DZN B;  2L09 A;  1WXQ A;  5E6J A;  4GHL A;  1HNW M;  2CHV A;  4DUZ M;  3L25 A;  3HU1 A;  1LV7 A;  4LJA A;  1SXJ B;  3FYC A;  2R62 A;  4I81 A;  2G8L A;  2DHR A;  5EJC A;  5EP1 A;  5JI3 E;  3GLF B;  3M7G A;  2XSZ D;  3R9X B;  2C9O A;  4G6Z A;  4LJ5 A;  3J81 S;  2J7N A;  3TQS A;  1GL7 A;  5FTN A;  4QOZ C;  3KOZ E;  5KO3 A;  3VLF B;  1R6B X;  5FTM A;  1QYR A;  3HHX A;  3VDU A;  2YNM D;  3GRV A;  2XF3 A;  1G4A E;  2DVW B;  5FLX S;  4GC9 A;  2XZU A;  2UU9 M;  4REZ A;  1YE9 A;  4LFA M;  2XFS A;  4M9Z A;  3KXE C;  4FWD A;  1ZQ9 A;  4LG2 A;  3T1H M;  4AQY M;  4KHP M;  4LJ6 A;  1IXS B;  5FTJ A;  2LNH C;  3GP1 A;  3KP0 E;  3TWK A;  2M60 A;  2XLJ A;  3RFW A;  4DV1 M;  2KEB A;  3KOX E;  1H6U A;  3A42 A;  3FUX A;  1IY1 A;  2P5T A;  1TH2 A;  3KSJ A;  3L26 A;  5EP3 A;  2CE7 A;  3I51 A;  4NXM M;  4GHA A;  3DFZ A;  3A45 A;  2UUA M;  3CF6 E;  3MK6 A;  4LJ4 A;  1L2B A;  1N78 A;  3KOY E;  5KPR A;  1I94 M;  2F4V M;  5ITR A;  1R2Z A;  2UXB M;  2CV2 A;  4L8R C;  5KPZ A;  4JI2 M;  3D8B A;  2G5G X;  3PNV A;  2QPA A;  4IBK A;  2FFJ A;  2J7O A;  5EP2 A;  1FJG M;  1L1Z A;  2Q2E B;  1TH4 A;  3KOW E;  1DO2 A;  3SAU A;  1KYI A;  4PT5 A;  4WUR A;  4A3V B;  3K8Z A;  3UGJ A;  1L2C A;  3GQ4 A;  3T38 A;  4M0W A;  4FVM A;  2I7N A;  1MU5 A;  3GRY A;  2AHM A;  4FD2 A;  4DR5 M;  2C99 A;  3FD9 A;  4GC5 A;  1D2N A;  4M9S A;  4LJ9 A;  4EIW A;  5A2Q S;  3TWM A;  3TPZ A;  2XFT A;  4NL4 H;  3FUU A;  4I5S A;  3UZU A;  1NY5 A;  3GQ5 A;  2FE8 A;  3HGI A;  4X62 M;  3AV0 A;  2C9C A;  3SC3 A;  2KW0 A;  1IY2 A;  3HJS A;  5E26 A;  1DO0 A;  2ZAN A;  3I4V A;  4P16 A;  4PCZ A;  3SFZ A;  1T3T A;  2XGN A;  4YY3 M;  4OVZ A;  3IG8 A;  2K47 A;  4AKG A;  4NXN M;  5GKN A;  3EIE A;  4QNM A;  3K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...