3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
molecule keywords RcdA
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
2W82A 2O25A 2VIIA 3FUTA 1OJLA 3SHGB 3HJQA 4MM3B 3I04M 2QHOB 2V1CA 2ZM6M 1XB2B 3KS4A 2DWMA 1G41A 3M7GA 2FH0A 3QWLA 3U61A 2M60A 1K3XA 3TQSA 3U5ZA 1DO2A 3GLIB 4AKIA 1HNZM 4LCBA 1G8PA 3FE3A 1C7YA 4GKJM 2FS1A 1WXQA 2LXEA 2AHMA 1QQWA 1J7KA 2OO9A 3U6EA 4CJ6A 4IBFA 4L15A 3L25A 3CF0A 2EKKA 3TE6A 3KOWE 4F2LA 1Z5CA 3GRUA 3TWLA 2D7GA 3K9PA 4IBKA 2RGOA 4LGMA 4B3SM 2YR0A 4IBEA 4JI7M 3FUUA 2UXCM 4ITQA 2FNAA 3WHLA 5IREB 3KP0E 4B7FA 1DGGA 1IXZA 2QQ8A 1IY0A 3C3EA 5KPTA 2Y21A 1GL7A 1TGUA 3C3DA 1MU5A 2Z4SA 2Z4RA 1N33M 4PDGA 2OOAA 4IIWA 3SARA 1MX0A 2J7NA 2UUAM 3KOZE 5EQTA 1N36M 1EE8A 2RGHA 1G3IA 5FTKA 4JI3M 3T38A 5EJCA 2DAGA 3KW6A 3V76A 1QUTA 3UGJA 2LHGA 4NSOB 1T3TA 3BOSA 4P17A 4M9ZA 4CISA 3TWMA 1AIPC 2XGNA 4MB7A 2O5RA 2CP8A 3IG8A 4LJ8A 2WSCF 2YFQA 3R8FA 4IBJA 1DGHB 3FRHA 1TH4A 2BWBA 3W68A 1XWIA 2DVWB 2L7HA 4FW9A 1JR3E 3WHKA 4MH0E 5FLXS 3K92A 4M9SA 3W0FA 1IBKM 3HJSA 1IN7A 4A3VB 1LTMA 4LF4M 4LF6M 2LVNC 4R7GA 2HAKA 4IBDA 3JAMS 1NJFA 2KRKA 4PT5A 1PRBA 4YHHM 1HT2E 1HR0M 1GJSA 2QENA 3I4YA 4XK8F 3AFHA 1KFVA 5EP4A 3UMMA 1VEKA 2WZJA 3FTCA 4LG2A 4BB9A 2L4EA 3B9PA 3HU3A 3KOXE 3RFWA 2K0BX 5L8RF 2LNHC 3KSJA 3VDUA 2R62A 2C96A 3GLIA 4PDIA 3HHZA 3MJ5A 4JI0M 2QZ4A 3HU1A 4DV2M 4KO8A 3SMPA 2EJSA 5ITTA 1QZEA 1WHCA 2VDBB 5IZ7D 5ITQA 3GLHE 3EIHA 4LJ5A 1E32A 3ZCBB 2UU9M 1JR3A 2Y20A 1MN3A 3AOGA 3KXEC 1ORYB 1V34A 2XSZD 3Q8GA 2V1UA 3ZH9B 4AZFA 5C1BA 4AG5A 1OFHA 3BBZA 1K82A 4WP2A 5ITYA 3GLFA 2M5ZA 1N34M 4B3RM 1C1KA 1SG9A 2GNOA 1HJPA 2JUJA 3K1JA 1ZQ9A 1SXJD 5KQDA 2VF7A 3NWLA 2G5GX 3UZUA 2QCUA 3GO8A 3U60A 1QDTA 3BXWA 3I4VA 2I7NA 1ZMWA 4QHSA 3U6QA 2C9CA 3SASA 1NV8A 4WW0A 2CV2A 4D80A 2K9DA 4AKGA 4LRSA 3D8LA 1QAQA 3B74A 3FUXA 4LY6A 1KSFX 2J5YA 1Z59A 3FYCA 5JI2E 3U6PA 3GPYA 1HT1E 1Z5BA 1WIVA 3CF6E 4B7GA 2UUBM 3HGIA 1OIZA 7CATA 4P16A 2FOIC 2V6ZM 3U6MA 3VKGA 4GH9A 2DWNA 1XHBA 3SATA 2FFJA 3I51A 4S12A 3A98B 2R45A 4Q7JA 3AOEC 8CATA 2OQ4A 4MGZE 1W5TA 1T6OA 2A5YB 4MGKE 4NRWA 2I7PA 3F92A 5DYIA 2XH9A 3H4MA 3AOEA 2F5SA 2B3TA 2XSZA 3HHYA 3TWKA 1ZV1A 5EXSA 4DV4M 1JR3D 4K0KM 4YY3M 4FD2A 5DFLA 1VG5A 3C58A 2L7IA 2KHHA 2EKFA 1Q02A 2JA2A 2Z7JA 2KXEA 4DV7M 4F1IA 5BPVA 1J5EM 4Y28F 3PVSA 1IM2A 2DI0A 3HZJA 4EIWA 1L1TA 1VEJA 3GLIE 2EO2A 4JI2M 1YE9A 1QAMA 3GP1A 3U6DA 2CV0A 4B3MM 2VQFM 3LVVA 2CHQA 1S3SA 2GQFA 2KNZA 4IBGA 4NXNM 4LZJA 5E6JA 3GPUA 4FWGA 3B89A 3JR5A 3U60B 3I01M 2P5TA 1JB0F 1E9RA 3E21A 3GRVA 4GHLA 2R18A 1IY2A 3ILKA 3VFDA 2MJ5B 1PJJA 1NNJA 1IN5A 2YQZA 1NO1A 1LV7A 2XF3A 4TUWA 4OW0A 3E9SA 4RF0A 4WURA 3W67A 1RU3A 1QAOA 4II7A 2F5PA 3GLHB 1KYIA 4IBCA 2QSFX 2MROB 1EFUB 4AW4A 3LW5F 1D0LA 1H6UA 2H1RA 2R46A 2VF8A 2LVQD 3Q8XA 4LF9M 3GQ3A 4LJ4A 2KZSA 3FRIA 3SAVA 3SC3A 2QPAA 3GLGA 2C98A 2HCBA 3GLGE 1NY6A 3U6OA 1J09A 1VDLA 2BJVA 2CWBA 5EXXA 1WJ7A 2BJWA 1W5SA 4M9XA 3D8BA 3T1YM 1TH2A 3B7NA 3K8ZA 3FYDA 5A2QS 1MJGM 1D2NA 2R4EA 2Z8YM 1TR8A 1GLNA 4DV1M 3VLFB 2LTUA 4LZZA 1K3WA 4GHAA 1R6BX 1TF0B 4GEWA 2DWLA 3E4RA 4QOSA 1PJSA 4QNRA 1PM5A 4AI6A 4G4OA 4FVMA 4JI5M 1NV9A 3FUVA 2HWJA 4MGYE 3VK7A 1GL6A 1NNUC 2L09A 5DYGA 2ZAMA 4QNMA 4X64M 4DR2M 3J81S 3KSXA 5EP2A 1DGHA 2CHVA 5LMUM 1NHGC 2OPFA 1N77A 1YLAA 4G4QA 2JWSA 3MHVC 4OVZA 1IBLM 4NRVA 1PJQA 3ZQJA 2DXIA 2BNKA 4IJEA 2E5LM 2J7OA 3L29A 3U5ZB 2HL7A 3UK6A 2NQ8C 1Z6TA 2JZ1A 3U6CA 2XZUA 2K47A 2KA6B 5GKNA 5IT9S 2DAIA 2JZ0A 3THGA 2F5OA 3NBXX 5ITXA 3HWSA 4FWDA 4DV0M 1N32M 1TTEA 2ZBKB 3K2LA 4X65M 3T15A 4JN6A 2QNJA 2APLA 4I81A 5JI3E 3U6SA 3HY5A 2DHYA 4XGIA 5KO3A 4OX9M 2LHCA 2MH8A 5EP1A 4RF1A 1VDDA 4G6ZA 1DV0A 4AKHA 3HX3A 1G71A 3R9XB 3SMSA 5IWAM 1E94E 4DUZM 5F3WA 2DZOB 1XXHE 1R2YA 1IQPA 2JY7A 3HJ8A 1I94M 2KW0A 1HQCA 4I4LA 4UN2B 5KPZA 3IG5A 1NHWC 3FD9A 5ITUA 3L2AA 4PCZA 3PNYA 3KVWA 1A5TA 4LF5M 4X62M 3CGWA 4REZA 2KRUA 1CUKA 2LVOC 3J27B 3TL4X 3KS8A 4DR6M 4AQYM 2F5QA 1GJTA 4IJFA 2QP9X 3LCVB 2R0IA 4GMQA 4I8OA 3AV0A 2K6BA 2FE8A 4R3DA 3VK8A 1XNQM 2D7HA 1D0MA 4FCWA 3B7ZA 2RKOA 4G3OA 3DZDA 4DR7M 1SXJB 4L8RC 2R6FA 5FTLA 4NC6A 1NY5A 2X49A 1QYRA 1T43A 5KQ8A 2DZLA 1OKSA 3L28A 2L6OA 2O01F 2DNAA 3FTFA 3UJNA 1IN4A 2C5RA 4LGYA 3VDPA 4DR5M 3T1HM 3LQQA 3KOYE 1L2DA 4I5SA 3DFZA 2LVAA 3E46A 2HKJA 3SYLA 4JV5M 3CTWB 4KHPM 1R5LA 1ZMUA 4GRIA 1VEGA 2EUCA 1L2BA 4GITA 3AL0C 1OAIA 2G8LA 3SYKA 2QBYA 2JY5A 3GRYA 2F4VM 4QHTA 3DA1A 4L6V6 2XLJA 4L78A 1GO5A 1DGFA 3TPZA 5BR8M 1VQ1A 2JY6B 2LH0A 3ZC7B 2HHHM 3HU2A 4LJAA 1QZMA 2JXNA 2LWXA 3M6AA 2C99A 1GVNA 4FCTA 3RE8A 3KDSE 2ERCA 1SXJE 1UM8A 4DR4M 2G3QA 1IXRC 1E9SA 1PGYA 2X8AA 4NOOB 1XXHA 4XBOA 1IXSA 1Q3CA 1TH3A 1QANA 5KPRA 2UUCM 4LF8M 4RNAA 1FJGM 2RRUA 1ZMVA 4AG6A 1N75A 4GIPA 4L16A 3IECA 2N35A 4FCVA 1D0KA 3LMMA 4R71A 3J2PB 1OAOC 1V33A 4KODA 3L27A 3GLGB 2LVPC 2C9OA 4OVZB 4LFBM 1IFYA 1L1ZA 4GKKM 4CHTB 1IXSB 1XXHB 1GABA 4KLNA 3H4JA 2DAKA 4LFAM 1XMOM 2JP7A 4LJ6A 5EP3A 1DO0A 4L4UA 3L26A 4Z6YA 2BWEA 1L8QA 2CEAA 2CUZA 2H5XA 1IY1A 5ITXE 2KNVA 3W0LB 1SXJC 4NSRA 1R4GA 1EIJA 1BVSA 3A45A 1R7RA 1Q3BA 5LMNM 1QVRA 4GC9A 2CHGA 1HNXM 2F5NA 1I4WA 2ZTCA 3RGPA 1P3QQ 4BBAA 1G59A 2Z3XA 1OFIA 4BLCA 4W5WA 2UXDM 4JI8M 4RKUF 3SAUA 2DZNB 4D82A 3U6LA 4OU7A 3HHXA 2DHRA 2OOBA 1HNWM 2KNAA 3AKZA 3U61B 2DENA 2KZUA 4DR1M 1AUAA 3PNVA 3KFUG 2DAEA 1FNNA 1Z5AA 1NSFA 4B08A 2R65A 2ZAOA 5FTMA 3JR4A 4JI1M 1Q39A 4LF7M 4HL4A 1X37A 4MGHA 1SXJA 2JY8A 2XEPA 1OIPA 2YNMD 4LRTA 3GPPA 3SBJA 3GLHA 1WGNA 1L2CA 3PFIA 5H37D 4DV5M 3PXGA 4LFCM 4JXJA 1NVMA 4M0WA 1TDZA 3SAWA 5FSWA 3M0EA 5EXPA 1QDRA 2CFOA 3QYBA 3LQRA 3GLFE 1OTRA 2Q2EB 5E26A 4QOZC 3J80S 4DUYM 2ZANA 4JI4M 1Y8GA 2D7EA 3AJIB 1XMQM 3QYEA 4MGIE 4B7HA 3GQ4A 3DOAA 4JYAM 5EXTA 2Y0TA 2KDLA 3J7BA 1R2ZA 4DV6M 1N78A 3OTOM 1PJTA 5FTJA 1IBMM 4NXMM 1IN6A 2CRUA 1WGLA 3KP1E 3LVWA 2JNHA 3C9PA 4HEOA 1DGBA 3GQ5A 3VKHA 2L4FA 2WSEF 4PD2A 2R4JA 3A46A 4JI6M 4FWHA 2DAMA 2WSFF 1PJIA 3QAUA 1QUSA 4D81A 5FTNA 3SHFA 1JQJC 4IBIA 2KEBA 4GC5A 1YUBA 3CF2A 1HQYE 4IBBA 2R44A 3RGSA 4LJ9A 3T6PA 4ANRA 1OQYA 2CV1A 2VQEM 2XFSA 4G4RA 2MR9A 2EA0A 3K9OA 3NBIA 3GPXA 4NL4H 3HKPA 3MK6A 4ZPXA 3FKEA 4CIZA 3LCUA 5ITRA 1IN8A 4LJ7A 4HLQA 2QBYB 3FTEA 3EIEA 5DNYA 5C18A 1GKIA 3SFZA 2MGWA 4X66M 4G4NA 1UFZA 2Y0QA 3HHWA 1XNRM 2DKLA 2CE7A 2XZFA 3IHPA 4M0DA 2XFTA 2ZTDA 1TDHA 3FUWA 1NJGA 1V92A 3GRRA 1F4IA 2LBCA 4DV3M 1ZAEA 3MMPA 4Z8XA 1YSYA 2L2DA 3A42A 1XC8A 3GLFB 2UXBM 1WR1B 2DWZB 4DR3M 4B3TM 3FTDA 1G4AE 3B7QA 4KT0F 3J7AS 2X4AA 4CGYB 4DBGB
chains in the Genus database with same CATH topology
2W82A 2VIIA 3FUTA 1OJLA 3SHGB 3HJQA 4MM3B 2ZM6M 2V1CA 3KS4A 2DWMA 1G41A 3M7GA 3QWLA 3U61A 2M60A 3TQSA 3U5ZA 1DO2A 3GLIB 4AKIA 1HNZM 4LCBA 1G8PA 4GKJM 1WXQA 2LXEA 2AHMA 1QQWA 1J7KA 3U6EA 4IBFA 4L15A 3L25A 3CF0A 3TE6A 3KOWE 1Z5CA 3GRUA 3TWLA 2D7GA 4IBKA 2RGOA 4LGMA 4B3SM 2YR0A 4IBEA 4JI7M 3FUUA 2UXCM 4ITQA 2FNAA 3WHLA 5IREB 3KP0E 4B7FA 1DGGA 1IXZA 1IY0A 5KPTA 2Y21A 1GL7A 1TGUA 1MU5A 2Z4SA 2Z4RA 1N33M 4PDGA 4IIWA 3SARA 1MX0A 2J7NA 2UUAM 3KOZE 5EQTA 1N36M 1EE8A 2RGHA 1G3IA 5FTKA 4JI3M 3T38A 5EJCA 3KW6A 3UGJA 4NSOB 1T3TA 3BOSA 4M9ZA 4CISA 3TWMA 2XGNA 4MB7A 2O5RA 3IG8A 4LJ8A 2YFQA 3R8FA 4IBJA 1DGHB 1TH4A 1K3XA 3WHKA 1XWIA 2DVWB 2L7HA 4FW9A 5FLXS 4MH0E 3K92A 4M9SA 3W0FA 1IBKM 3HJSA 1IN7A 4A3VB 4LF4M 4LF6M 4R7GA 4IBDA 3JAMS 4YHHM 1NJFA 2KRKA 4PT5A 1HT2E 1HR0M 2QENA 3I4YA 1KFVA 3AFHA 5EP4A 3UMMA 4LG2A 3FTCA 4BB9A 3B9PA 3HU3A 3KOXE 3RFWA 2LNHC 3KSJA 3VDUA 2R62A 2C96A 3GLIA 4PDIA 3HHZA 3MJ5A 4JI0M 2QZ4A 3HU1A 4DV2M 4KO8A 3SMPA 5ITTA 5IZ7D 5ITQA 3EIHA 4LJ5A 1E32A 3ZCBB 2UU9M 1JR3A 2Y20A 3AOGA 3KXEC 1ORYB 2XSZD 2V1UA 3ZH9B 4AZFA 5C1BA 4AG5A 1OFHA 1K82A 5ITYA 3GLFA 2M5ZA 1N34M 4B3RM 1C1KA 3K1JA 1ZQ9A 1SXJD 5KQDA 3NWLA 2G5GX 3UZUA 2QCUA 3GO8A 3U60A 3U6QA 4QHSA 3I4VA 2I7NA 3SASA 2C9CA 4WW0A 2CV2A 4D80A 4AKGA 4LRSA 3D8LA 1QAQA 3FUXA 4LY6A 1KSFX 1Z59A 3FYCA 5JI2E 3U6PA 3GPYA 1HT1E 1Z5BA 3CF6E 4B7GA 2UUBM 3HGIA 7CATA 4P16A 2FOIC 2V6ZM 3U6MA 3VKGA 4GH9A 2DWNA 1XHBA 3SATA 2FFJA 3I51A 4S12A 3A98B 2R45A 8CATA 3AOEC 2OQ4A 4MGZE 1W5TA 2A5YB 4MGKE 4NRWA 2I7PA 5DYIA 2XH9A 3H4MA 3AOEA 2F5SA 2XSZA 3HHYA 3TWKA 5EXSA 4DV4M 1JR3D 4K0KM 4YY3M 4FD2A 3C58A 2L7IA 2JA2A 2Z7JA 2KXEA 4DV7M 5BPVA 1J5EM 3PVSA 1IM2A 4EIWA 1L1TA 2EO2A 4JI2M 1YE9A 1QAMA 3GP1A 3U6DA 2CV0A 4B3MM 2VQFM 3LVVA 2CHQA 1S3SA 4IBGA 4NXNM 4LZJA 5E6JA 3GPUA 4FWGA 3JR5A 3U60B 2P5TA 1E9RA 3GRVA 4GHLA 2R18A 1IY2A 3ILKA 3VFDA 1PJJA 1NNJA 1IN5A 2YQZA 1LV7A 2XF3A 4TUWA 4OW0A 3E9SA 4RF0A 4WURA 2F5PA 1QAOA 4II7A 3GLHB 1KYIA 4IBCA 4AW4A 1H6UA 2H1RA 2R46A 3Q8XA 4LF9M 3GQ3A 4LJ4A 2KZSA 3SAVA 3SC3A 2QPAA 3GLGA 2C98A 2HCBA 3U6OA 1NY6A 1J09A 2BJVA 5EXXA 2BJWA 1W5SA 4M9XA 3D8BA 3T1YM 1TH2A 3K8ZA 3FYDA 5A2QS 1D2NA 2R4EA 1GLNA 4DV1M 3VLFB 1K3WA 4LZZA 4GHAA 1R6BX 2DWLA 3E4RA 4QOSA 4QNRA 1PM5A 4AI6A 4G4OA 4FVMA 4JI5M 3FUVA 4MGYE 3VK7A 1GL6A 1NNUC 2L09A 5DYGA 2ZAMA 4QNMA 4X64M 4DR2M 3J81S 3KSXA 5EP2A 1DGHA 2CHVA 5LMUM 1NHGC 2OPFA 1N77A 4G4QA 3MHVC 4OVZA 1IBLM 4NRVA 2DXIA 2BNKA 4IJEA 2E5LM 2J7OA 3L29A 3U5ZB 2HL7A 3UK6A 2NQ8C 1Z6TA 3U6CA 2XZUA 2K47A 2KA6B 5GKNA 5IT9S 3THGA 2F5OA 5ITXA 3HWSA 4FWDA 4DV0M 1N32M 2ZBKB 3K2LA 4X65M 3T15A 4JN6A 4I81A 5JI3E 3U6SA 4XGIA 5KO3A 4OX9M 5EP1A 4RF1A 1VDDA 4G6ZA 4AKHA 3R9XB 3SMSA 5IWAM 1E94E 4DUZM 5F3WA 2DZOB 1R2YA 1IQPA 3HJ8A 1I94M 2KW0A 1HQCA 4I4LA 5ITUA 5KPZA 3IG5A 1NHWC 3FD9A 3L2AA 4PCZA 3PNYA 3KVWA 4LF5M 4X62M 4REZA 2KRUA 4DR6M 3J27B 3TL4X 3KS8A 4AQYM 2F5QA 4IJFA 2QP9X 4GMQA 4I8OA 3AV0A 2FE8A 4R3DA 3VK8A 1XNQM 2D7HA 4FCWA 2RKOA 3DZDA 4DR7M 1SXJB 4L8RC 5FTLA 1NY5A 2X49A 1QYRA 5KQ8A 3L28A 2L6OA 3FTFA 3UJNA 1IN4A 2C5RA 4LGYA 3VDPA 4DR5M 3T1HM 3LQQA 3KOYE 1L2DA 4I5SA 3DFZA 3SYLA 2HKJA 4KHPM 4JV5M 3CTWB 4GRIA 1L2BA 2EUCA 3AL0C 4GITA 2G8LA 3SYKA 2QBYA 3GRYA 2F4VM 4QHTA 3DA1A 2XLJA 4L78A 1DGFA 3TPZA 5BR8M 2LH0A 3ZC7B 2HHHM 3HU2A 4LJAA 1QZMA 2LWXA 3M6AA 2C99A 1GVNA 4FCTA 3RE8A 3KDSE 2ERCA 1SXJE 1UM8A 4DR4M 1IXRC 1E9SA 2X8AA 4NOOB 1XXHA 4XBOA 5KPRA 1Q3CA 1TH3A 1QANA 2UUCM 4LF8M 4RNAA 1FJGM 4AG6A 1N75A 4GIPA 4L16A 4FCVA 3LMMA 3J2PB 3GLGB 4KODA 3L27A 4OVZB 2C9OA 4LFBM 1L1ZA 4GKKM 4CHTB 1IXSB 1XXHB 4KLNA 4LFAM 1XMOM 4LJ6A 5EP3A 1DO0A 4L4UA 3L26A 4Z6YA 1L8QA 2CEAA 2CUZA 1IY1A 5ITXE 3W0LB 1SXJC 4NSRA 3A45A 1HNXM 1R7RA 1Q3BA 5LMNM 1QVRA 4GC9A 2CHGA 2F5NA 1I4WA 3RGPA 4BBAA 1G59A 2Z3XA 1OFIA 4BLCA 4W5WA 2UXDM 4JI8M 3SAUA 2DZNB 4D82A 3U6LA 4OU7A 3HHXA 2DHRA 1HNWM 3AKZA 3U61B 2KZUA 4DR1M 3PNVA 3KFUG 1FNNA 1Z5AA 1NSFA 4B08A 2R65A 2ZAOA 5FTMA 3JR4A 4JI1M 1Q39A 4HL4A 1X37A 4MGHA 1SXJA 3GPPA 2XEPA 2YNMD 4LRTA 3SBJA 4LF7M 1L2CA 3GLHA 3PFIA 5H37D 4DV5M 3PXGA 4LFCM 4JXJA 1NVMA 4M0WA 1TDZA 3SAWA 5FSWA 3M0EA 5EXPA 2CFOA 3LQRA 4QOZC 2Q2EB 5E26A 3J80S 4DUYM 2ZANA 4JI4M 2D7EA 3AJIB 1XMQM 4MGIE 4B7HA 3GQ4A 3DOAA 4JYAM 5EXTA 2Y0TA 3J7BA 1R2ZA 4DV6M 1N78A 3OTOM 5FTJA 1IBMM 4NXMM 1IN6A 3KP1E 3LVWA 1DGBA 3GQ5A 3VKHA 4PD2A 2R4JA 3A46A 4JI6M 4FWHA 1PJIA 3QAUA 4D81A 5FTNA 3SHFA 1JQJC 4IBIA 2KEBA 4GC5A 1YUBA 3CF2A 1HQYE 4IBBA 3RGSA 4LJ9A 2CV1A 2VQEM 2XFSA 4G4RA 2EA0A 3NBIA 3GPXA 4NL4H 3HKPA 3MK6A 4ZPXA 3FKEA 5ITRA 1IN8A 4LJ7A 4HLQA 2QBYB 3FTEA 3EIEA 5DNYA 5C18A 1GKIA 3SFZA 4X66M 4G4NA 2Y0QA 3HHWA 1XNRM 2CE7A 2XZFA 4M0DA 2XFTA 1TDHA 3FUWA 1NJGA 3GRRA 4DV3M 1ZAEA 4Z8XA 1YSYA 3A42A 1XC8A 3GLFB 2UXBM 2DWZB 4DR3M 4B3TM 3FTDA 1G4AE 3J7AS 2X4AA 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 2W82 A;  2O25 A;  2VII A;  3FUT A;  1OJL A;  3SHG B;  3HJQ A;  4MM3 B;  3I04 M;  2QHO B;  2V1C A;  2ZM6 M;  1XB2 B;  3KS4 A;  2DWM A;  1G41 A;  3M7G A;  2FH0 A;  3QWL A;  3U61 A;  2M60 A;  1K3X A;  3TQS A;  3U5Z A;  1DO2 A;  3GLI B;  4AKI A;  1HNZ M;  4LCB A;  1G8P A;  3FE3 A;  1C7Y A;  4GKJ M;  2FS1 A;  1WXQ A;  2LXE A;  2AHM A;  1QQW A;  1J7K A;  2OO9 A;  3U6E A;  4CJ6 A;  4IBF A;  4L15 A;  3L25 A;  3CF0 A;  2EKK A;  3TE6 A;  3KOW E;  4F2L A;  1Z5C A;  3GRU A;  3TWL A;  2D7G A;  3K9P A;  4IBK A;  2RGO A;  4LGM A;  4B3S M;  2YR0 A;  4IBE A;  4JI7 M;  3FUU A;  2UXC M;  4ITQ A;  2FNA A;  3WHL A;  5IRE B;  3KP0 E;  4B7F A;  1DGG A;  1IXZ A;  2QQ8 A;  1IY0 A;  3C3E A;  5KPT A;  2Y21 A;  1GL7 A;  1TGU A;  3C3D A;  1MU5 A;  2Z4S A;  2Z4R A;  1N33 M;  4PDG A;  2OOA A;  4IIW A;  3SAR A;  1MX0 A;  2J7N A;  2UUA M;  3KOZ E;  5EQT A;  1N36 M;  1EE8 A;  2RGH A;  1G3I A;  5FTK A;  4JI3 M;  3T38 A;  5EJC A;  2DAG A;  3KW6 A;  3V76 A;  1QUT A;  3UGJ A;  2LHG A;  4NSO B;  1T3T A;  3BOS A;  4P17 A;  4M9Z A;  4CIS A;  3TWM A;  1AIP C;  2XGN A;  4MB7 A;  2O5R A;  2CP8 A;  3IG8 A;  4LJ8 A;  2WSC F;  2YFQ A;  3R8F A;  4IBJ A;  1DGH B;  3FRH A;  1TH4 A;  2BWB A;  3W68 A;  1XWI A;  2DVW B;  2L7H A;  4FW9 A;  1JR3 E;  3WHK A;  4MH0 E;  5FLX S;  3K92 A;  4M9S A;  3W0F A;  1IBK M;  3HJS A;  1IN7 A;  4A3V B;  1LTM A;  4LF4 M;  4LF6 M;  2LVN C;  4R7G A;  2HAK A;  4IBD A;  3JAM S;  1NJF A;  2KRK A;  4PT5 A;  1PRB A;  4YHH M;  1HT2 E;  1HR0 M;  1GJS A;  2QEN A;  3I4Y A;  4XK8 F;  3AFH A;  1KFV A;  5EP4 A;  3UMM A;  1VEK A;  2WZJ A;  3FTC A;  4LG2 A;  4BB9 A;  2L4E A;  3B9P A;  3HU3 A;  3KOX E;  3RFW A;  2K0B X;  5L8R F;  2LNH C;  3KSJ A;  3VDU A;  2R62 A;  2C96 A;  3GLI A;  4PDI A;  3HHZ A;  3MJ5 A;  4JI0 M;  2QZ4 A;  3HU1 A;  4DV2 M;  4KO8 A;  3SMP A;  2EJS A;  5ITT A;  1QZE A;  1WHC A;  2VDB B;  5IZ7 D;  5ITQ A;  3GLH E;  3EIH A;  4LJ5 A;  1E32 A;  3ZCB B;  2UU9 M;  1JR3 A;  2Y20 A;  1MN3 A;  3AOG A;  3KXE C;  1ORY B;  1V34 A;  2XSZ D;  3Q8G A;  2V1U A;  3ZH9 B;  4AZF A;  5C1B A;  4AG5 A;  1OFH A;  3BBZ A;  1K82 A;  4WP2 A;  5ITY A;  3GLF A;  2M5Z A;  1N34 M;  4B3R M;  1C1K A;  1SG9 A;  2GNO A;  1HJP A;  2JUJ A;  3K1J A;  1ZQ9 A;  1SXJ D;  5KQD A;  2VF7 A;  3NWL A;  2G5G X;  3UZU A;  2QCU A;  3GO8 A;  3U60 A;  1QDT A;  3BXW A;  3I4V A;  2I7N A;  1ZMW A;  4QHS A;  3U6Q A;  2C9C A;  3SAS A;  1NV8 A;  4WW0 A;  2CV2 A;  4D80 A;  2K9D A;  4AKG A;  4LRS A;  3D8L A;  1QAQ A;  3B74 A;  3FUX A;  4LY6 A;  1KSF X;  2J5Y A;  1Z59 A;  3FYC A;  5JI2 E;  3U6P A;  3GPY A;  1HT1 E;  1Z5B A;  1WIV A;  3CF6 E;  4B7G A;  2UUB M;  3HGI A;  1OIZ A;  7CAT A;  4P16 A;  2FOI C;  2V6Z M;  3U6M A;  3VKG A;  4GH9 A;  2DWN A;  1XHB A;  3SAT A;  2FFJ A;  3I51 A;  4S12 A;  3A98 B;  2R45 A;  4Q7J A;  3AOE C;  8CAT A;  2OQ4 A;  4MGZ E;  1W5T A;  1T6O A;  2A5Y B;  4MGK E;  4NRW A;  2I7P A;  3F92 A;  5DYI A;  2XH9 A;  3H4M A;  3AOE A;  2F5S A;  2B3T A;  2XSZ A;  3HHY A;  3TWK A;  1ZV1 A;  5EXS A;  4DV4 M;  1JR3 D;  4K0K M;  4YY3 M;  4FD2 A;  5DFL A;  1VG5 A;  3C58 A;  2L7I A;  2KHH A;  2EKF A;  1Q02 A;  2JA2 A;  2Z7J A;  2KXE A;  4DV7 M;  4F1I A;  5BPV A;  1J5E M;  4Y28 F;  3PVS A;  1IM2 A;  2DI0 A;  3HZJ A;  4EIW A;  1L1T A;  1VEJ A;  3GLI E;  2EO2 A;  4JI2 M;  1YE9 A;  1QAM A;  3GP1 A;  3U6D A;  2CV0 A;  4B3M M;  2VQF M;  3LVV A;  2CHQ A;  1S3S A;  2GQF A;  2KNZ A;  4IBG A;  4NXN M;  4LZJ A;  5E6J A;  3GPU A;  4FWG A;  3B89 A;  3JR5 A;  3U60 B;  3I01 M;  2P5T A;  1JB0 F;  1E9R A;  3E21 A;  3GRV A;  4GHL A;  2R18 A;  1IY2 A;  3ILK A;  3VFD A;  2MJ5 B;  1PJJ A;  1NNJ A;  1IN5 A;  2YQZ A;  1NO1 A;  1LV7 A;  2XF3 A;  4TUW A;  4OW0 A;  3E9S A;  4RF0 A;  4WUR A;  3W67 A;  1RU3 A;  1QAO A;  4II7 A;  2F5P A;  3GLH B;  1KYI A;  4IBC A;  2QSF X;  2MRO B;  1EFU B;  4AW4 A;  3LW5 F;  1D0L A;  1H6U A;  2H1R A;  2R46 A;  2VF8 A;  2LVQ D;  3Q8X A;  4LF9 M;  3GQ3 A;  4LJ4 A;  2KZS A;  3FRI A;  3SAV A;  3SC3 A;  2QPA A;  3GLG A;  2C98 A;  2HCB A;  3GLG E;  1NY6 A;  3U6O A;  1J09 A;  1VDL A;  2BJV A;  2CWB A;  5EXX A;  1WJ7 A;  2BJW A;  1W5S A;  4M9X A;  3D8B A;  3T1Y M;  1TH2 A;  3B7N A;  3K8Z A;  3FYD A;  5A2Q S;  1MJG M;  1D2N A;  2R4E A;  2Z8Y M;  1TR8 A;  1GLN A;  4DV1 M;  3VLF B;  2LTU A;  4LZZ A;  1K3W A;  4GHA A;  1R6B X;  1TF0 B;  4GEW A;  2DWL A;  3E4R A;  4QOS A;  1PJS A;  4QNR A;  1PM5 A;  4AI6 A;  4G4O A;  4FVM A;  4JI5 M;  1NV9 A;  3FUV A;  2HWJ A;  4MGY E;  3VK7 A;  1GL6 A;  1NNU C;  2L09 A;  5DYG A;  2ZAM A;  4QNM A;  4X64 M;  4DR2 M;  3J81 S;  3KSX A;  5EP2 A;  1DGH A;  2CHV A;  5LMU M;  1NHG C;  2OPF A;  1N77 A;  1YLA A;  4G4Q A;  2JWS A;  3MHV C;  4OVZ A;  1IBL M;  4NRV A;  1PJQ A;  3ZQJ A;  2DXI A;  2BNK A;  4IJE A;  2E5L M;  2J7O A;  3L29 A;  3U5Z B;  2HL7 A;  3UK6 A;  2NQ8 C;  1Z6T A;  2JZ1 A;  3U6C A;  2XZU A;  2K47 A;  2KA6 B;  5GKN A;  5IT9 S;  2DAI A;  2JZ0 A;  3THG A;  2F5O A;  3NBX X;  5ITX A;  3HWS A;  4FWD A;  4DV0 M;  1N32 M;  1TTE A;  2ZBK B;  3K2L A;  4X65 M;  3T15 A;  4JN6 A;  2QNJ A;  2APL A;  4I81 A;  5JI3 E;  3U6S A;  3HY5 A;  2DHY A;  4XGI A;  5KO3 A;  4OX9 M;  2LHC A;  2MH8 A;  5EP1 A;  4RF1 A;  1VDD A;  4G6Z A;  1DV0 A;  4AKH A;  3HX3 A;  1G71 A;  3R9X B;  3SMS A;  5IWA M;  1E94 E;  4DUZ M;  5F3W A;  2DZO B;  1XXH E;  1R2Y A;  1IQP A;  2JY7 A;  3HJ8 A;  1I94 M;  2KW0 A;  1HQC A;  4I4L A;  4UN2 B;  5KPZ A;  3IG5 A;  1NHW C;  3FD9 A;  5ITU A;  3L2A A;  4PCZ A;  3PNY A;  3KVW A;  1A5T A;  4LF5 M;  4X62 M;  3CGW A;  4REZ A;  2KRU A;  1CUK A;  2LVO C;  3J27 B;  3TL4 X;  3KS8 A;  4DR6 M;  4AQY M;  2F5Q A;  1GJT A;  4IJF A;  2QP9 X;  3LCV B;  2R0I A;  4GMQ A;  4I8O A;  3AV0 A;  2K6B A;  2FE8 A;  4R3D A;  3VK8 A;  1XNQ M;  2D7H A;  1D0M A;  4FCW A;  3B7Z A;  2RKO A;  4G3O A;  3DZD A;  4DR7 M;  1SXJ B;  4L8R C;  2R6F A;  5FTL A;  4NC6 A;  1NY5 A;  2X49 A;  1QYR A;  1T43 A;  5KQ8 A;  2DZL A;  1OKS A;  3L28 A;  2L6O A;  2O01 F;  2DNA A;  3FTF A;  3UJN A;  1IN4 A;  2C5R A;  4LGY A;  3VDP A;  4DR5 M;  3T1H M;  3LQQ A;  3KOY E;  1L2D A;  4I5S A;  3DFZ A;  2LVA A;  3E46 A;  2HKJ A;  3SYL A;  4JV5 M;  3CTW B;  4KHP M;  1R5L A;  1ZMU A;  4GRI A;  1VEG A;  2EUC A;  1L2B A;  4GIT A;  3AL0 C;  1OAI A;  2G8L A;  3SYK A;  2QBY A;  2JY5 A;  3GRY A;  2F4V M;  4QHT A;  3DA1 A;  4L6V 6;  2XLJ A;  4L78 A;  1GO5 A;  1DGF A;  3TPZ A;  5BR8 M;  1VQ1 A;  2JY6 B;  2LH0 A;  3ZC7 B;  2HHH M;  3HU2 A;  4LJA A;  1QZM A;  2JXN A;  2LWX A;  3M6A A;  2C99 A;  1GVN A;  4FCT A;  3RE8 A;  3KDS E;  2ERC A;  1SXJ E;  1UM8 A;  4DR4 M;  2G3Q A;  1IXR C;  1E9S A;  1PGY A;  2X8A A;  4NOO B;  1XXH A;  4XBO A;  1IXS A;  1Q3C A;  1TH3 A;  1QAN A;  5KPR A;  2UUC M;  4LF8 M;  4RNA A;  1FJG M;  2RRU A;  1ZMV A;  4AG6 A;  1N75 A;  4GIP A;  4L16 A;  3IEC A;  2N35 A;  4FCV A;  1D0K A;  3LMM A;  4R71 A;  3J2P B;  1OAO C;  1V33 A;  4KOD A;  3L27 A;  3GLG B;  2LVP C;  2C9O A;  4OVZ B;  4LFB M;  1IFY A;  1L1Z A;  4GKK M;  4CHT B;  1IXS B;  1XXH B;  1GAB A;  4KLN A;  3H4J A;  2DAK A;  4LFA M;  1XMO M;  2JP7 A;  4LJ6 A;  5EP3 A;  1DO0 A;  4L4U A;  3L26 A;  4Z6Y A;  2BWE A;  1L8Q A;  2CEA A;  2CUZ A;  2H5X A;  1IY1 A;  5ITX E;  2KNV A;  3W0L B;  1SXJ C;  4NSR A;  1R4G A;  1EIJ A;  1BVS A;  3A45 A;  1R7R A;  1Q3B A;  5LMN M;  1QVR A;  4GC9 A;  2CHG A;  1HNX M;  2F5N A;  1I4W A;  2ZTC A;  3RGP A;  1P3Q Q;  4BBA A;  1G59 A;  2Z3X A;  1OFI A;  4BLC A;  4W5W A;  2UXD M;  4JI8 M;  4RKU F;  3SAU A;  2DZN B;  4D82 A;  3U6L A;  4OU7 A;  3HHX A;  2DHR A;  2OOB A;  1HNW M;  2KNA A;  3AKZ A;  3U61 B;  2DEN A;  2KZU A;  4DR1 M;  1AUA A;  3PNV A;  3KFU G;  2DAE A;  1FNN A;  1Z5A A;  1NSF A;  4B08 A;  2R65 A;  2ZAO A;  5FTM A;  3JR4 A;  4JI1 M;  1Q39 A;  4LF7 M;  4HL4 A;  1X37 A;  4MGH A;  1SXJ A;  2JY8 A;  2XEP A;  1OIP A;  2YNM D;  4LRT A;  3GPP A;  3SBJ A;  3GLH A;  1WGN A;  1L2C A;  3PFI A;  5H37 D;  4DV5 M;  3PXG A;  4LFC M;  4JXJ A;  1NVM A;  4M0W A;  1TDZ A;  3SAW A;  5FSW A;  3M0E A;  5EXP A;  1QDR A;  2CFO A;  3QYB A;  3LQR A;  3GLF E;  1OTR A;  2Q2E B;  5E26 A;  4QOZ C;  3J80 S;  4DUY M;  2ZAN A;  4JI4 M;  1Y8G A;  2D7E A;  3AJI B;  1XMQ M;  3QYE A;  4MGI E;  4B7H A;  3GQ4 A;  3DOA A;  4JYA M;  5EXT A;  2Y0T A;  2KDL A;  3J7B A;  1R2Z A;  4DV6 M;  1N78 A;  3OTO M;  1PJT A;  5FTJ A;  1IBM M;  4NXM M;  1IN6 A;  2CRU A;  1WGL A;  3KP1 E;  3LVW A;  2JNH A;  3C9P A;  4HEO A;  1DGB A;  3GQ5 A;  3VKH A;  2L4F A;  2WSE F;  4PD2 A;  2R4J A;  3A46 A;  4JI6 M;  4FWH A;  2DAM A;  2WSF F;  1PJI A;  3QAU A;  1QUS A;  4D81 A;  5FTN A;  3SHF A;  1JQJ C;  4IBI A;  2KEB A;  4GC5 A;  1YUB A;  3CF2 A;  1HQY E;  4IBB A;  2R44 A;  3RGS A;  4LJ9 A;  3T6P A;  4ANR A;  1OQY A;  2CV1 A;  2VQE M;  2XFS A;  4G4R A;  2MR9 A;  2EA0 A;  3K9O A;  3NBI A;  3GPX A;  4NL4 H;  3HKP A;  3MK6 A;  4ZPX A;  3FKE A;  4CIZ A;  3LCU A;  5ITR A;  1IN8 A;  4LJ7 A;  4HLQ A;  2QBY B;  3FTE A;  3EIE A;  5DNY A;  5C18 A;  1GKI A;  3SFZ A;  2MGW A;  4X66 M;  4G4N A;  1UFZ A;  2Y0Q A;  3HHW A;  1XNR M;  2DKL A;  2CE7 A;  2XZF A;  3IHP A;  4M0D A;  2XFT A;  2ZTD A;  1TDH A;  3FUW A;  1NJG A;  1V92 A;  3GRR A;  1F4I A;  2LBC A;  4DV3 M;  1ZAE A;  3MMP A;  4Z8X A;  1YSY A;  2L2D A;  3A42 A;  1XC8 A;  3GLF B;  2UXB M;  1WR1 B;  2DWZ B;  4DR3 M;  4B3T M;  3FTD A;  1G4A E;  3B7Q A;  4KT0 F;  3J7A S;  2X4A A;  4CGY B;  4DBG B; 
#chains in the Genus database with same CATH homology
 2W82 A;  2VII A;  3FUT A;  1OJL A;  3SHG B;  3HJQ A;  4MM3 B;  2ZM6 M;  2V1C A;  3KS4 A;  2DWM A;  1G41 A;  3M7G A;  3QWL A;  3U61 A;  2M60 A;  3TQS A;  3U5Z A;  1DO2 A;  3GLI B;  4AKI A;  1HNZ M;  4LCB A;  1G8P A;  4GKJ M;  1WXQ A;  2LXE A;  2AHM A;  1QQW A;  1J7K A;  3U6E A;  4IBF A;  4L15 A;  3L25 A;  3CF0 A;  3TE6 A;  3KOW E;  1Z5C A;  3GRU A;  3TWL A;  2D7G A;  4IBK A;  2RGO A;  4LGM A;  4B3S M;  2YR0 A;  4IBE A;  4JI7 M;  3FUU A;  2UXC M;  4ITQ A;  2FNA A;  3WHL A;  5IRE B;  3KP0 E;  4B7F A;  1DGG A;  1IXZ A;  1IY0 A;  5KPT A;  2Y21 A;  1GL7 A;  1TGU A;  1MU5 A;  2Z4S A;  2Z4R A;  1N33 M;  4PDG A;  4IIW A;  3SAR A;  1MX0 A;  2J7N A;  2UUA M;  3KOZ E;  5EQT A;  1N36 M;  1EE8 A;  2RGH A;  1G3I A;  5FTK A;  4JI3 M;  3T38 A;  5EJC A;  3KW6 A;  3UGJ A;  4NSO B;  1T3T A;  3BOS A;  4M9Z A;  4CIS A;  3TWM A;  2XGN A;  4MB7 A;  2O5R A;  3IG8 A;  4LJ8 A;  2YFQ A;  3R8F A;  4IBJ A;  1DGH B;  1TH4 A;  1K3X A;  3WHK A;  1XWI A;  2DVW B;  2L7H A;  4FW9 A;  5FLX S;  4MH0 E;  3K92 A;  4M9S A;  3W0F A;  1IBK M;  3HJS A;  1IN7 A;  4A3V B;  4LF4 M;  4LF6 M;  4R7G A;  4IBD A;  3JAM S;  4YHH M;  1NJF A;  2KRK A;  4PT5 A;  1HT2 E;  1HR0 M;  2QEN A;  3I4Y A;  1KFV A;  3AFH A;  5EP4 A;  3UMM A;  4LG2 A;  3FTC A;  4BB9 A;  3B9P A;  3HU3 A;  3KOX E;  3RFW A;  2LNH C;  3KSJ A;  3VDU A;  2R62 A;  2C96 A;  3GLI A;  4PDI A;  3HHZ A;  3MJ5 A;  4JI0 M;  2QZ4 A;  3HU1 A;  4DV2 M;  4KO8 A;  3SMP A;  5ITT A;  5IZ7 D;  5ITQ A;  3EIH A;  4LJ5 A;  1E32 A;  3ZCB B;  2UU9 M;  1JR3 A;  2Y20 A;  3AOG A;  3KXE C;  1ORY B;  2XSZ D;  2V1U A;  3ZH9 B;  4AZF A;  5C1B A;  4AG5 A;  1OFH A;  1K82 A;  5ITY A;  3GLF A;  2M5Z A;  1N34 M;  4B3R M;  1C1K A;  3K1J A;  1ZQ9 A;  1SXJ D;  5KQD A;  3NWL A;  2G5G X;  3UZU A;  2QCU A;  3GO8 A;  3U60 A;  3U6Q A;  4QHS A;  3I4V A;  2I7N A;  3SAS A;  2C9C A;  4WW0 A;  2CV2 A;  4D80 A;  4AKG A;  4LRS A;  3D8L A;  1QAQ A;  3FUX A;  4LY6 A;  1KSF X;  1Z59 A;  3FYC A;  5JI2 E;  3U6P A;  3GPY A;  1HT1 E;  1Z5B A;  3CF6 E;  4B7G A;  2UUB M;  3HGI A;  7CAT A;  4P16 A;  2FOI C;  2V6Z M;  3U6M A;  3VKG A;  4GH9 A;  2DWN A;  1XHB A;  3SAT A;  2FFJ A;  3I51 A;  4S12 A;  3A98 B;  2R45 A;  8CAT A;  3AOE C;  2OQ4 A;  4MGZ E;  1W5T A;  2A5Y B;  4MGK E;  4NRW A;  2I7P A;  5DYI A;  2XH9 A;  3H4M A;  3AOE A;  2F5S A;  2XSZ A;  3HHY A;  3TWK A;  5EXS A;  4DV4 M;  1JR3 D;  4K0K M;  4YY3 M;  4FD2 A;  3C58 A;  2L7I A;  2JA2 A;  2Z7J A;  2KXE A;  4DV7 M;  5BPV A;  1J5E M;  3PVS A;  1IM2 A;  4EIW A;  1L1T A;  2EO2 A;  4JI2 M;  1YE9 A;  1QAM A;  3GP1 A;  3U6D A;  2CV0 A;  4B3M M;  2VQF M;  3LVV A;  2CHQ A;  1S3S A;  4IBG A;  4NXN M;  4LZJ A;  5E6J A;  3GPU A;  4FWG A;  3JR5 A;  3U60 B;  2P5T A;  1E9R A;  3GRV A;  4GHL A;  2R18 A;  1IY2 A;  3ILK A;  3VFD A;  1PJJ A;  1NNJ A;  1IN5 A;  2YQZ A;  1LV7 A;  2XF3 A;  4TUW A;  4OW0 A;  3E9S A;  4RF0 A;  4WUR A;  2F5P A;  1QAO A;  4II7 A;  3GLH B;  1KYI A;  4IBC A;  4AW4 A;  1H6U A;  2H1R A;  2R46 A;  3Q8X A;  4LF9 M;  3GQ3 A;  4LJ4 A;  2KZS A;  3SAV A;  3SC3 A;  2QPA A;  3GLG A;  2C98 A;  2HCB A;  3U6O A;  1NY6 A;  1J09 A;  2BJV A;  5EXX A;  2BJW A;  1W5S A;  4M9X A;  3D8B A;  3T1Y M;  1TH2 A;  3K8Z A;  3FYD A;  5A2Q S;  1D2N A;  2R4E A;  1GLN A;  4DV1 M;  3VLF B;  1K3W A;  4LZZ A;  4GHA A;  1R6B X;  2DWL A;  3E4R A;  4QOS A;  4QNR A;  1PM5 A;  4AI6 A;  4G4O A;  4FVM A;  4JI5 M;  3FUV A;  4MGY E;  3VK7 A;  1GL6 A;  1NNU C;  2L09 A;  5DYG A;  2ZAM A;  4QNM A;  4X64 M;  4DR2 M;  3J81 S;  3KSX A;  5EP2 A;  1DGH A;  2CHV A;  5LMU M;  1NHG C;  2OPF A;  1N77 A;  4G4Q A;  3MHV C;  4OVZ A;  1IBL M;  4NRV A;  2DXI A;  2BNK A;  4IJE A;  2E5L M;  2J7O A;  3L29 A;  3U5Z B;  2HL7 A;  3UK6 A;  2NQ8 C;  1Z6T A;  3U6C A;  2XZU A;  2K47 A;  2KA6 B;  5GKN A;  5IT9 S;  3THG A;  2F5O A;  5ITX A;  3HWS A;  4FWD A;  4DV0 M;  1N32 M;  2ZBK B;  3K2L A;  4X65 M;  3T15 A;  4JN6 A;  4I81 A;  5JI3 E;  3U6S A;  4XGI A;  5KO3 A;  4OX9 M;  5EP1 A;  4RF1 A;  1VDD A;  4G6Z A;  4AKH A;  3R9X B;  3SMS A;  5IWA M;  1E94 E;  4DUZ M;  5F3W A;  2DZO B;  1R2Y A;  1IQP A;  3HJ8 A;  1I94 M;  2KW0 A;  1HQC A;  4I4L A;  5ITU A;  5KPZ A;  3IG5 A;  1NHW C;  3FD9 A;  3L2A A;  4PCZ A;  3PNY A;  3KVW A;  4LF5 M;  4X62 M;  4REZ A;  2KRU A;  4DR6 M;  3J27 B;  3TL4 X;  3KS8 A;  4AQY M;  2F5Q A;  4IJF A;  2QP9 X;  4GMQ A;  4I8O A;  3AV0 A;  2FE8 A;  4R3D A;  3VK8 A;  1XNQ M;  2D7H A;  4FCW A;  2RKO A;  3DZD A;  4DR7 M;  1SXJ B;  4L8R C;  5FTL A;  1NY5 A;  2X49 A;  1QYR A;  5KQ8 A;  3L28 A;  2L6O A;  3FTF A;  3UJN A;  1IN4 A;  2C5R A;  4LGY A;  3VDP A;  4DR5 M;  3T1H M;  3LQQ A;  3KOY E;  1L2D A;  4I5S A;  3DFZ A;  3SYL A;  2HKJ A;  4KHP M;  4JV5 M;  3CTW B;  4GRI A;  1L2B A;  2EUC A;  3AL0 C;  4GIT A;  2G8L A;  3SYK A;  2QBY A;  3GRY A;  2F4V M;  4QHT A;  3DA1 A;  2XLJ A;  4L78 A;  1DGF A;  3TPZ A;  5BR8 M;  2LH0 A;  3ZC7 B;  2HHH M;  3HU2 A;  4LJA A;  1QZM A;  2LWX A;  3M6A A;  2C99 A;  1GVN A;  4FCT A;  3RE8 A;  3KDS E;  2ERC A;  1SXJ E;  1UM8 A;  4DR4 M;  1IXR C;  1E9S A;  2X8A A;  4NOO B;  1XXH A;  4XBO A;  5KPR A;  1Q3C A;  1TH3 A;  1QAN A;  2UUC M;  4LF8 M;  4RNA A;  1FJG M;  4AG6 A;  1N75 A;  4GIP A;  4L16 A;  4FCV A;  3LMM A;  3J2P B;  3GLG B;  4KOD A;  3L27 A;  4OVZ B;  2C9O A;  4LFB M;  1L1Z A;  4GKK M;  4CHT B;  1IXS B;  1XXH B;  4KLN A;  4LFA M;  1XMO M;  4LJ6 A;  5EP3 A;  1DO0 A;  4L4U A;  3L26 A;  4Z6Y A;  1L8Q A;  2CEA A;  2CUZ A;  1IY1 A;  5ITX E;  3W0L B;  1SXJ C;  4NSR A;  3A45 A;  1HNX M;  1R7R A;  1Q3B A;  5LMN M;  1QVR A;  4GC9 A;  2CHG A;  2F5N A;  1I4W A;  3RGP A;  4BBA A;  1G59 A;  2Z3X A;  1OFI A;  4BLC A;  4W5W A;  2UXD M;  4JI8 M;  3SAU A;  2DZN B;  4D82 A;  3U6L A;  4OU7 A;  3HHX A;  2DHR A;  1HNW M;  3AKZ A;  3U61 B;  2KZU A;  4DR1 M;  3PNV A;  3KFU G;  1FNN A;  1Z5A A;  1NSF A;  4B08 A;  2R65 A;  2ZAO A;  5FTM A;  3JR4 A;  4JI1 M;  1Q39 A;  4HL4 A;  1X37 A;  4MGH A;  1SXJ A;  3GPP A;  2XEP A;  2YNM D;  4LRT A;  3SBJ A;  4LF7 M;  1L2C A;  3GLH A;  3PFI A;  5H37 D;  4DV5 M;  3PXG A;  4LFC M;  4JXJ A;  1NVM A;  4M0W A;  1TDZ A;  3SAW A;  5FSW A;  3M0E A;  5EXP A;  2CFO A;  3LQR A;  4QOZ C;  2Q2E B;  5E26 A;  3J80 S;  4DUY M;  2ZAN A;  4JI4 M;  2D7E A;  3AJI B;  1XMQ M;  4MGI E;  4B7H A;  3GQ4 A;  3DOA A;  4JYA M;  5EXT A;  2Y0T A;  3J7B A;  1R2Z A;  4DV6 M;  1N78 A;  3OTO M;  5FTJ A;  1IBM M;  4NXM M;  1IN6 A;  3KP1 E;  3LVW A;  1DGB A;  3GQ5 A;  3VKH A;  4PD2 A;  2R4J A;  3A46 A;  4JI6 M;  4FWH A;  1PJI A;  3QAU A;  4D81 A;  5FTN A;  3SHF A;  1JQJ C;  4IBI A;  2KEB A;  4GC5 A;  1YUB A;  3CF2 A;  1HQY E;  4IBB A;  3RGS A;  4LJ9 A;  2CV1 A;  2VQE M;  2XFS A;  4G4R A;  2EA0 A;  3NBI A;  3GPX A;  4NL4 H;  3HKP A;  3MK6 A;  4ZPX A;  3FKE A;  5ITR A;  1IN8 A;  4LJ7 A;  4HLQ A;  2QBY B;  3FTE A;  3EIE A;  5DNY A;  5C18 A;  1GKI A;  3SFZ A;  4X66 M;  4G4N A;  2Y0Q A;  3HHW A;  1XNR M;  2CE7 A;  2XZF A;  4M0D A;  2XFT A;  1TDH A;  3FUW A;  1NJG A;  3GRR A;  4DV3 M;  1ZAE A;  4Z8X A;  1YSY A;  3A42 A;  1XC8 A;  3GLF B;  2UXB M;  2DWZ B;  4DR3 M;  4B3T M;  3FTD A;  1G4A E;  3J7A S;  2X4A A;  4CGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...