3CTWB

Crystal structure of rcda from caulobacter crescentus cb15
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
120
Chain Sequence
b'IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYAVEELPFGLMNLLQRSERLYERVRHLDRRMYVES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RcdA
publication title Crystal Structure of RcdA yields insights into efficient CtrA proteolysis
rcsb
source organism Caulobacter vibrioides
molecule tags Protein binding
total genus 44
structure length 120
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07323 DUF1465 Protein of unknown function (DUF1465)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.930 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ctwB00
3CTWB
chains in the Genus database with same CATH superfamily
1ZMUA 3U61B 2KNAA 4XBOA 4G4OA 4I4LA 4UN2B 2KW0A 1XMQM 1DGHA 3U60A 1N36M 4LJ8A 1G71A 3SHGB 3RE8A 3ILKA 4DR2M 4KLNA 5JI3E 1QYRA 3TPZA 1XMOM 3GRUA 1R6BX 1XXHE 1Z5AA 2DWZB 4RF0A 2DXIA 3KW6A 1ZAEA 1J09A 2DAMA 2G8LA 3IHPA 1OAIA 4DV1M 3K9OA 1K82A 3GLHA 4KODA 3M7GA 1IN5A 3FUVA 3FRHA 3AV0A 3SC3A 2X49A 3JR5A 2GNOA 3VLFB 1QAQA 3U6LA 5C18A 3GLHE 4LF9M 2O5RA 2C99A 2L09A 3B7QA 3FYDA 1T6OA 1JR3A 3T6PA 1XHBA 5E6JA 4MGIE 2WZJA 3QYEA 3TE6A 3KP0E 5F3WA 4GKKM 1IM2A 2K0BX 4QHTA 5ITYA 4QNMA 1JR3E 3K92A 1NY6A 1WIVA 3T1HM 3T1YM 2UXBM 2QQ8A 2C5RA 3KOZE 2MJ5B 3R8FA 1NHGC 4EIWA 2FE8A 4W5WA 3FRIA 4FWHA 3FUWA 3SYKA 1W5TA 2C9CA 2EJSA 4JN6A 1TGUA 4JI0M 4G3OA 4GHLA 2CHVA 5EQTA 4YY3M 2QP9X 1Z5BA 1LTMA 3CF6E 4IJFA 4DV4M 3Q8GA 2D7GA 2HKJA 4IBBA 4LZJA 4FCVA 4DV7M 1T3TA 1NHWC 3TWLA 1J7KA 2P5TA 4K0KM 4LRSA 1V92A 1IN4A 1F4IA 4JI6M 3L26A 4IBCA 2KXEA 1C7YA 1E32A 2DAEA 1QUTA 2H1RA 2L4EA 2XSZD 3IG8A 3V76A 3LMMA 2VIIA 1SXJC 2V1CA 2DWNA 3TQSA 3A98B 4GRIA 4P16A 4F2LA 4AG5A 1TH4A 5BR8M 4CISA 3W68A 2HCBA 1WHCA 4WW0A 4LJAA 4DV0M 3RGPA 1WGLA 1VQ1A 2DNAA 1LV7A 2N35A 3FYCA 4NRVA 2LNHC 2YFQA 4Z8XA 4OVZB 2R46A 1IXZA 1YUBA 3KSXA 5L8RF 1W5SA 1WR1B 1IN6A 4GMQA 4LG2A 1QAMA 3SBJA 2MR9A 2HL7A 3NWLA 4GHAA 3M0EA 3FTDA 1DGBA 2LVOC 1AIPC 2R6FA 4L6V6 3U5ZA 1V33A 2O01F 3GLIA 4LJ6A 1IXSA 2DZLA 4B7HA 1OTRA 2QSFX 1ZMVA 2VQFM 3SATA 3CF2A 2XZUA 3C58A 2J5YA 2F4VM 2EA0A 2VDBB 3GLIE 1Z6TA 1IBMM 3IECA 1HNWM 4NRWA 4CJ6A 4D82A 3H4MA 1MN3A 3B7NA 3L25A 3U6OA 2DENA 1HQCA 3J80S 1DO2A 4DBGB 2EO2A 4IBKA 4R3DA 4WURA 1L2DA 2CWBA 2KZSA 3A46A 3QYBA 4DR1M 4L15A 5EXXA 1G59A 3D8LA 3KOXE 2RRUA 3M6AA 2JY7A 4REZA 2QNJA 1E94E 2OOAA 3GRRA 3HY5A 2JZ0A 3Q8XA 4P17A 4WP2A 2DZOB 4KHPM 2J7OA 2D7EA 2B3TA 3GLGA 2D7HA 7CATA 1GABA 4II7A 3PXGA 4MGHA 1IY1A 4ANRA 3HKPA 4BLCA 1DO0A 3B89A 4IBDA 1I94M 2LHGA 1EFUB 4LJ9A 3GLGE 2X8AA 1TDHA 2JY5A 3LCVB 4AKGA 3AKZA 3U61A 4RF1A 2LWXA 2YNMD 3MHVC 2WSFF 4PT5A 3FTCA 4LFBM 5KO3A 4JI5M 5EXSA 1R4GA 2C98A 2A5YB 3A45A 2LVAA 4L16A 4PDIA 4NSRA 4LGMA 1Z5CA 3HGIA 4LY6A 4LZZA 3SHFA 2EUCA 1OFIA 2I7NA 3E9SA 4M0WA 3UMMA 1XXHA 4YHHM 4TUWA 2F5NA 3K9PA 4M9SA 1D0KA 4LJ7A 4BB9A 5ITTA 1NSFA 3LQQA 4X65M 2ZAMA 3JAMS 1Q3BA 2L4FA 1V34A 2ZM6M 2OQ4A 1XB2B 2WSEF 3D8BA 1N32M 2FNAA 3NBIA 1P3QQ 1XC8A 4JI8M 1QAOA 4BBAA 2Y0QA 3GRYA 3LVVA 2VF7A 4QHSA 4X66M 2LVQD 2EKFA 4B7FA 4Y28F 4B3SM 1HJPA 2ZANA 3PVSA 3KDSE 2BNKA 4GIPA 3CTWB 1H6UA 1N78A 2JUJA 2QBYA 3C3DA 2MGWA 4LF5M 1OJLA 3I01M 3RFWA 2JNHA 3TWKA 4M0DA 2Z3XA 2CUZA 4Q7JA 4FWGA 2ZTCA 1PJJA 2ZTDA 1IBLM 3HU2A 3QWLA 4L78A 4LRTA 3HWSA 3THGA 2QZ4A 4PCZA 5H37D 3GQ5A 1PJQA 3U6MA 2F5QA 3GPUA 2YR0A 3HX3A 1UFZA 5DNYA 1R7RA 2JA2A 1DGFA 1YSYA 4IBJA 3GQ4A 4JI7M 2OOBA 3FUXA 2KEBA 4B3TM 4MM3B 1VEGA 1DV0A 1EE8A 4R71A 1QUSA 1IFYA 3AJIB 1SXJE 2R45A 4IBIA 2UU9M 2UUBM 3KVWA 3KSJA 1SXJB 4IIWA 1IN7A 2LVPC 3J7AS 5C1BA 3VKGA 2Z8YM 2KA6B 4D80A 1HNZM 4DUYM 5E26A 1GLNA 1G41A 3GPYA 1HT2E 4PD2A 4ITQA 4LF7M 4RKUF 4Z6YA 1GL7A 4FCTA 3VDPA 2VF8A 4FW9A 4L8RC 1FNNA 1JQJC 3MK6A 1D0LA 3HJQA 4OVZA 2V6ZM 4DR7M 4AQYM 2C9OA 5FTJA 5KPTA 2EKKA 5KQ8A 4LF4M 1L1TA 3FTFA 2BWEA 2L7HA 1TR8A 3HJ8A 3UK6A 5ITRA 2F5OA 2XGNA 2DVWB 3DOAA 3AFHA 1HQYE 1IQPA 1E9SA 1UM8A 3J2PB 5IZ7D 1C1KA 4I8OA 5BPVA 1TDZA 3LVWA 4AZFA 1YLAA 2HWJA 2KRKA 2W82A 3BBZA 2DWMA 4AKHA 2FFJA 4F1IA 3HHYA 5LMNM 1WXQA 3U6SA 3FD9A 2JP7A 5EP4A 1RU3A 4CIZA 1PGYA 2CV2A 3R9XB 2R18A 1TF0B 2LXEA 1KFVA 1WGNA 2LVNC 2JZ1A 2JWSA 3SFZA 3K1JA 2UXCM 2K9DA 3HHXA 4JV5M 1NNUC 3KXEC 3SMSA 3A42A 3PNVA 4B7GA 4DV6M 2UUAM 1D0MA 4R7GA 4A3VB 5FSWA 2XSZA 5A2QS 4DR4M 3L2AA 3PNYA 3UZUA 4GC5A 4MGYE 1IY0A 1QQWA 2F5SA 3HU3A 3SAUA 1OQYA 4B3MM 2FOIC 4MGZE 1NJFA 3I04M 4CGYB 3EIHA 4XK8F 1MX0A 1X37A 3L29A 2KDLA 4LCBA 5EJCA 3GPXA 3GLFB 2DWLA 1HT1E 4IJEA 4LFCM 3I51A 1NO1A 3L28A 4AW4A 3B7ZA 1G4AE 3VKHA 3HHWA 4GC9A 4DR6M 3U5ZB 2Y0TA 2DKLA 4D81A 1QZMA 1IXSB 1ZV1A 2MH8A 2XFTA 4FD2A 4I81A 4B08A 4I5SA 4M9ZA 3QAUA 4NOOB 4NXNM 4GITA 4HEOA 1HR0M 3SMPA 2VQEM 3CF0A 2RGOA 3SARA 1QZEA 2LHCA 5ITXA 1OFHA 3U6CA 2L7IA 1VG5A 1Q39A 2Q2EB 1VDDA 2G5GX 5EXPA 5EP2A 3HHZA 2AHMA 1QVRA 2R65A 3ZQJA 3SYLA 1SXJD 1TH2A 5ITXE 1IBKM 2R4EA 5KPRA 4AKIA 1NY5A 1VDLA 3BXWA 3MJ5A 2KRUA 1GO5A 3T38A 4G6ZA 2XLJA 1NNJA 2BJVA 2M60A 2DZNB 2DI0A 2R62A 3SAVA 1PRBA 5FTLA 2XFSA 4JXJA 1NV8A 1Q3CA 2CEAA 5ITUA 2F5PA 3W67A 4DV2M 1IXRC 5ITQA 2CFOA 1NV9A 2R44A 3U6QA 1VEKA 2X4AA 4LF6M 4NL4H 2HAKA 4S12A 3VDUA 3VK7A 3SASA 3K2LA 3AOEA 1R2YA 5KPZA 4LF8M 4GEWA 3L27A 3I4YA 1PJIA 3I4VA 5LMUM 1K3WA 3OTOM 2MROB 3E21A 2WSCF 3B9PA 1XXHB 1DGHB 3TWMA 3U60B 3FTEA 2DAKA 3VK8A 1PM5A 4FWDA 2CV0A 4DUZM 4LJ5A 4AI6A 4FCWA 4G4NA 1YE9A 3HU1A 3FUUA 1GKIA 1SXJA 4FVMA 5DYGA 1L2CA 1GJSA 3U6DA 1L2BA 4LJ4A 1G3IA 2ERCA 4XGIA 2K47A 1Z59A 2ZBKB 1NJGA 1K3XA 4DR3M 3GLHB 4QNRA 1OIZA 4G4QA 4L4UA 2M5ZA 2JXNA 4X62M 3GP1A 5FTMA 3U6PA 4JYAM 1QANA 2G3QA 1PJSA 3E46A 3KOWE 3GRVA 3MMPA 2LTUA 3AL0C 3T15A 3LW5F 2BWBA 1JB0F 3FUTA 4LGYA 5IREB 2QBYB 2RKOA 1GJTA 2UXDM 4RNAA 1ORYB 1GL6A 2DAGA 3NBXX 2O25A 3RGSA 3GPPA 1QDRA 1L8QA 2C96A 2XH9A 2KNVA 3K8ZA 2DHRA 3DFZA 2R4JA 1GVNA 2QPAA 4DR5M 1KYIA 3KFUG 3AOEC 2OO9A 1SG9A 1VEJA 5IT9S 5GKNA 2CHGA 5FLXS 1XWIA 4CHTB 2J7NA 3J27B 3W0FA 2BJWA 2LH0A 1A5TA 1QDTA 2GQFA 4OW0A 4X64M 1OAOC 3PFIA 1IN8A 1NVMA 1OIPA 2R0IA 1N33M 4NC6A 1EIJA 1KSFX 3IG5A 3KP1E 5FTNA 5KQDA 3VFDA 2E5LM 4DV3M 2Z7JA 1L1ZA 2XEPA 1ZMWA 4HL4A 1Y8GA 5JI2E 4OX9M 2V1UA 3GO8A 4B3RM 1Q02A 4IBFA 3LQRA 4IBEA 4JI4M 3KS8A 2I7PA 1XNRM 3H4JA 1AUAA 2KNZA 4NSOB 2APLA 3KOYE 8CATA 4JI3M 3WHKA 3ZH9B 1E9RA 1TH3A 2L6OA 2QCUA 2YQZA 4DV5M 1N34M 2ZAOA 3W0LB 3ZC7B 3GLFA 3SAWA 2DHYA 3EIEA 2Z4SA 1OKSA 1FJGM 4QOZC 4QOSA 1WJ7A 2Y20A 1ZQ9A 3C3EA 4IBGA 2HHHM 2JY8A 3UGJA 1R5LA 3B74A 5EP3A 1BVSA 3GLFE 3DA1A 2CV1A 2OPFA 1XNQM 3J7BA 3C9PA 2LBCA 2H5XA 2K6BA 2L2DA 3BOSA 3F92A 3FE3A 3HZJA 3TL4X 2QENA 2JY6B 3GQ3A 1I4WA 4KO8A 1S3SA 4JI1M 4AG6A 4M9XA 3FKEA 4ZPXA 3GLIB 3JR4A 4GKJM 2CRUA 1HNXM 4HLQA 2UUCM 2CE7A 3DZDA 2XF3A 3E4RA 2NQ8C 4MH0E 1N77A 1TTEA 1IY2A 3WHLA 3LCUA 2KZUA 4PDGA 3AOGA 2XZFA 1J5EM 3CGWA 4JI2M 2FS1A 5EXTA 3ZCBB 2CP8A 3HJSA 5IWAM 1R2ZA 2DAIA 1MJGM 2CHQA 1G8PA 1T43A 5FTKA 4OU7A 3KS4A 2QHOB 4NXMM 1D2NA 1DGGA 5EP1A 4GH9A 1N75A 2Z4RA 4MGKE 1JR3D 1MU5A 2RGHA 5DFLA 5DYIA 2FH0A 4MB7A 4LFAM 3GLGB 2KHHA 4G4RA 1CUKA 3U6EA 3UJNA 3J81S 4KT0F 1PJTA 2Y21A
chains in the Genus database with same CATH topology
3U61B 4XBOA 4G4OA 4I4LA 2KW0A 1XMQM 1DGHA 3U60A 1N36M 4LJ8A 3SHGB 3RE8A 3ILKA 4DR2M 4KLNA 5JI3E 1QYRA 3TPZA 1XMOM 3GRUA 1R6BX 1Z5AA 2DWZB 4RF0A 2DXIA 3KW6A 1ZAEA 1J09A 2G8LA 1K82A 4DV1M 3GLHA 4KODA 3M7GA 1IN5A 3FUVA 3AV0A 3SC3A 2X49A 3JR5A 3VLFB 1QAQA 3U6LA 5C18A 4LF9M 2O5RA 2C99A 2L09A 3FYDA 1JR3A 1XHBA 5E6JA 4MGIE 3TE6A 3KP0E 5F3WA 4GKKM 1IM2A 4QHTA 5ITYA 4QNMA 3K92A 1NY6A 3T1HM 3T1YM 2UXBM 2C5RA 3KOZE 3R8FA 1NHGC 4EIWA 2FE8A 4W5WA 3SYKA 4FWHA 3FUWA 1W5TA 2C9CA 4JN6A 4JI0M 1TGUA 4GHLA 2CHVA 5EQTA 4YY3M 2QP9X 1Z5BA 3CF6E 4IJFA 4DV4M 2D7GA 2HKJA 4IBBA 4LZJA 4FCVA 4DV7M 1T3TA 1NHWC 3TWLA 1J7KA 2P5TA 4K0KM 4LRSA 1IN4A 4JI6M 3L26A 4IBCA 2KXEA 1E32A 2XSZD 2H1RA 3IG8A 3LMMA 2VIIA 1SXJC 2V1CA 2DWNA 3TQSA 3A98B 4GRIA 4P16A 4AG5A 1TH4A 5BR8M 4CISA 2HCBA 4WW0A 4LJAA 4DV0M 3RGPA 1LV7A 3FYCA 4NRVA 2LNHC 2YFQA 4Z8XA 4OVZB 2R46A 1IXZA 1YUBA 3KSXA 1W5SA 4GMQA 1IN6A 4LG2A 1QAMA 3SBJA 2HL7A 3NWLA 4GHAA 3M0EA 3FTDA 1DGBA 3U5ZA 3GLIA 4LJ6A 4B7HA 2VQFM 3SATA 3CF2A 2XZUA 3C58A 2F4VM 2EA0A 1Z6TA 1IBMM 1HNWM 4NRWA 4D82A 3H4MA 3L25A 3U6OA 1HQCA 3J80S 1DO2A 2EO2A 4IBKA 4R3DA 4WURA 1L2DA 2KZSA 3A46A 4DR1M 4L15A 5EXXA 1G59A 3D8LA 3KOXE 3M6AA 4REZA 1E94E 3GRRA 3Q8XA 4KHPM 2DZOB 2J7OA 2D7EA 3GLGA 2D7HA 7CATA 4II7A 3PXGA 4MGHA 1IY1A 4BLCA 3HKPA 1DO0A 4IBDA 1I94M 4LJ9A 2X8AA 1TDHA 4AKGA 3AKZA 3U61A 4RF1A 2LWXA 2YNMD 3MHVC 4PT5A 3FTCA 4LFBM 5KO3A 4JI5M 5EXSA 2C98A 3A45A 2A5YB 4L16A 4PDIA 4NSRA 4LGMA 1Z5CA 3HGIA 4LY6A 4LZZA 3SHFA 2EUCA 1OFIA 2I7NA 3E9SA 4M0WA 3UMMA 1XXHA 4YHHM 4TUWA 2F5NA 4M9SA 4LJ7A 4BB9A 5ITTA 1NSFA 3LQQA 4X65M 2ZAMA 3JAMS 1Q3BA 2ZM6M 2OQ4A 3D8BA 1N32M 2FNAA 3NBIA 1XC8A 4JI8M 1QAOA 4BBAA 2Y0QA 3GRYA 3LVVA 4X66M 4QHSA 4B7FA 4B3SM 2ZANA 3PVSA 3KDSE 2BNKA 4GIPA 3CTWB 1H6UA 1N78A 2QBYA 4LF5M 1OJLA 3RFWA 3TWKA 4M0DA 2Z3XA 2CUZA 4FWGA 1PJJA 1IBLM 3HU2A 3QWLA 4L78A 4LRTA 3HWSA 3THGA 2QZ4A 4PCZA 5H37D 3GQ5A 3U6MA 2F5QA 3GPUA 2YR0A 5DNYA 1R7RA 2JA2A 1DGFA 1YSYA 4IBJA 3GQ4A 4JI7M 3FUXA 2KEBA 4B3TM 4MM3B 1EE8A 3AJIB 1SXJE 2R45A 4IBIA 2UU9M 2UUBM 3KVWA 3KSJA 1SXJB 4IIWA 1IN7A 3J7AS 5C1BA 3VKGA 2KA6B 4D80A 1HNZM 4DUYM 5E26A 1GLNA 1G41A 3GPYA 1HT2E 4PD2A 4ITQA 4LF7M 4Z6YA 1GL7A 4FCTA 3VDPA 4FW9A 4L8RC 1FNNA 1JQJC 3MK6A 3HJQA 4OVZA 2V6ZM 4DR7M 4AQYM 2C9OA 5FTJA 5KPTA 5KQ8A 4LF4M 1L1TA 3FTFA 2F5OA 2L7HA 3HJ8A 3UK6A 2XGNA 2DVWB 3DOAA 3AFHA 1HQYE 1IQPA 1E9SA 1UM8A 3J2PB 5IZ7D 1C1KA 4I8OA 5BPVA 1TDZA 3LVWA 4AZFA 2KRKA 4AKHA 2DWMA 2W82A 2FFJA 3HHYA 5LMNM 1WXQA 3U6SA 3FD9A 5EP4A 3R9XB 2CV2A 2R18A 2LXEA 1KFVA 3SFZA 2UXCM 3K1JA 3HHXA 4JV5M 1NNUC 3KXEC 3SMSA 3A42A 3PNVA 4B7GA 4DV6M 2UUAM 4R7GA 4A3VB 5FSWA 2XSZA 5A2QS 4DR4M 3L2AA 3PNYA 3UZUA 4GC5A 4MGYE 1QQWA 1IY0A 2F5SA 3HU3A 3SAUA 4B3MM 2FOIC 4MGZE 1NJFA 4CGYB 3EIHA 1MX0A 1X37A 3L29A 4LCBA 3GPXA 5EJCA 3GLFB 2DWLA 1HT1E 4IJEA 4LFCM 3I51A 3L28A 4AW4A 1G4AE 3VKHA 3HHWA 4GC9A 4DR6M 3U5ZB 2Y0TA 4D81A 1QZMA 1IXSB 2XFTA 4FD2A 4B08A 4I81A 4I5SA 4M9ZA 3QAUA 4NOOB 4NXNM 4GITA 1HR0M 3SMPA 2VQEM 3CF0A 2RGOA 3SARA 5ITXA 1OFHA 3U6CA 2L7IA 1Q39A 2Q2EB 1VDDA 2G5GX 5EXPA 5EP2A 3HHZA 2AHMA 1QVRA 2R65A 3SYLA 1SXJD 1TH2A 5ITXE 1IBKM 2R4EA 5KPRA 4AKIA 1NY5A 3MJ5A 2KRUA 3T38A 4G6ZA 2XLJA 1NNJA 2BJVA 2M60A 2DZNB 2R62A 3SAVA 5FTLA 2XFSA 4JXJA 1Q3CA 2CEAA 5ITUA 2F5PA 4DV2M 1IXRC 5ITQA 2CFOA 3U6QA 2X4AA 4LF6M 4NL4H 3VDUA 4S12A 3VK7A 3SASA 3K2LA 3AOEA 1R2YA 5KPZA 4LF8M 3L27A 3I4YA 1PJIA 3I4VA 5LMUM 1K3WA 3OTOM 3B9PA 1XXHB 1DGHB 3TWMA 3U60B 3FTEA 3VK8A 1PM5A 4FWDA 2CV0A 4DUZM 4LJ5A 4AI6A 4FCWA 4G4NA 1YE9A 3HU1A 3FUUA 1GKIA 1SXJA 4FVMA 5DYGA 1L2CA 3U6DA 1L2BA 4LJ4A 1G3IA 2ERCA 4XGIA 2K47A 1Z59A 2ZBKB 1NJGA 1K3XA 4DR3M 3GLHB 4QNRA 4G4QA 4L4UA 2M5ZA 4X62M 3GP1A 5FTMA 3U6PA 4JYAM 1QANA 3KOWE 3GRVA 3AL0C 3T15A 3FUTA 4LGYA 5IREB 2QBYB 2RKOA 2UXDM 4RNAA 1ORYB 1GL6A 3RGSA 3GPPA 1L8QA 2C96A 2XH9A 3K8ZA 2DHRA 3DFZA 2R4JA 1GVNA 2QPAA 4DR5M 1KYIA 3KFUG 3AOEC 5IT9S 5GKNA 2CHGA 5FLXS 1XWIA 4CHTB 2J7NA 3J27B 3W0FA 2BJWA 2LH0A 4OW0A 4X64M 3PFIA 1IN8A 1NVMA 1N33M 1KSFX 3IG5A 3KP1E 5FTNA 5KQDA 3VFDA 2E5LM 4DV3M 2Z7JA 1L1ZA 2XEPA 4HL4A 5JI2E 4OX9M 2V1UA 3GO8A 4B3RM 4IBFA 3LQRA 4IBEA 4JI4M 3KS8A 2I7PA 1XNRM 4NSOB 3KOYE 8CATA 4JI3M 3WHKA 3ZH9B 1E9RA 1TH3A 2L6OA 2QCUA 2YQZA 4DV5M 1N34M 2ZAOA 3W0LB 3ZC7B 3GLFA 3SAWA 3EIEA 2Z4SA 1FJGM 4QOZC 4QOSA 2Y20A 4IBGA 1ZQ9A 2HHHM 3UGJA 5EP3A 3DA1A 2CV1A 2OPFA 1XNQM 3J7BA 3BOSA 3TL4X 2QENA 3GQ3A 1I4WA 4KO8A 1S3SA 4JI1M 4AG6A 4M9XA 3FKEA 4ZPXA 3GLIB 3JR4A 4GKJM 1HNXM 4HLQA 2UUCM 2CE7A 3DZDA 2XF3A 3E4RA 2NQ8C 4MH0E 1N77A 1IY2A 3WHLA 2KZUA 4PDGA 3AOGA 2XZFA 1J5EM 4JI2M 5EXTA 3ZCBB 3HJSA 5IWAM 1R2ZA 2CHQA 1G8PA 5FTKA 4OU7A 3KS4A 4NXMM 1D2NA 1DGGA 5EP1A 4GH9A 1N75A 2Z4RA 4MGKE 1JR3D 1MU5A 2RGHA 5DYIA 4G4RA 4MB7A 4LFAM 3GLGB 3U6EA 3UJNA 3J81S 5ITRA 2Y21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTW B; 
#chains in the Genus database with same CATH topology
 1ZMU A;  3U61 B;  2KNA A;  4XBO A;  4G4O A;  4I4L A;  4UN2 B;  2KW0 A;  1XMQ M;  1DGH A;  3U60 A;  1N36 M;  4LJ8 A;  1G71 A;  3SHG B;  3RE8 A;  3ILK A;  4DR2 M;  4KLN A;  5JI3 E;  1QYR A;  3TPZ A;  1XMO M;  3GRU A;  1R6B X;  1XXH E;  1Z5A A;  2DWZ B;  4RF0 A;  2DXI A;  3KW6 A;  1ZAE A;  1J09 A;  2DAM A;  2G8L A;  3IHP A;  1OAI A;  4DV1 M;  3K9O A;  1K82 A;  3GLH A;  4KOD A;  3M7G A;  1IN5 A;  3FUV A;  3FRH A;  3AV0 A;  3SC3 A;  2X49 A;  3JR5 A;  2GNO A;  3VLF B;  1QAQ A;  3U6L A;  5C18 A;  3GLH E;  4LF9 M;  2O5R A;  2C99 A;  2L09 A;  3B7Q A;  3FYD A;  1T6O A;  1JR3 A;  3T6P A;  1XHB A;  5E6J A;  4MGI E;  2WZJ A;  3QYE A;  3TE6 A;  3KP0 E;  5F3W A;  4GKK M;  1IM2 A;  2K0B X;  4QHT A;  5ITY A;  4QNM A;  1JR3 E;  3K92 A;  1NY6 A;  1WIV A;  3T1H M;  3T1Y M;  2UXB M;  2QQ8 A;  2C5R A;  3KOZ E;  2MJ5 B;  3R8F A;  1NHG C;  4EIW A;  2FE8 A;  4W5W A;  3FRI A;  4FWH A;  3FUW A;  3SYK A;  1W5T A;  2C9C A;  2EJS A;  4JN6 A;  1TGU A;  4JI0 M;  4G3O A;  4GHL A;  2CHV A;  5EQT A;  4YY3 M;  2QP9 X;  1Z5B A;  1LTM A;  3CF6 E;  4IJF A;  4DV4 M;  3Q8G A;  2D7G A;  2HKJ A;  4IBB A;  4LZJ A;  4FCV A;  4DV7 M;  1T3T A;  1NHW C;  3TWL A;  1J7K A;  2P5T A;  4K0K M;  4LRS A;  1V92 A;  1IN4 A;  1F4I A;  4JI6 M;  3L26 A;  4IBC A;  2KXE A;  1C7Y A;  1E32 A;  2DAE A;  1QUT A;  2H1R A;  2L4E A;  2XSZ D;  3IG8 A;  3V76 A;  3LMM A;  2VII A;  1SXJ C;  2V1C A;  2DWN A;  3TQS A;  3A98 B;  4GRI A;  4P16 A;  4F2L A;  4AG5 A;  1TH4 A;  5BR8 M;  4CIS A;  3W68 A;  2HCB A;  1WHC A;  4WW0 A;  4LJA A;  4DV0 M;  3RGP A;  1WGL A;  1VQ1 A;  2DNA A;  1LV7 A;  2N35 A;  3FYC A;  4NRV A;  2LNH C;  2YFQ A;  4Z8X A;  4OVZ B;  2R46 A;  1IXZ A;  1YUB A;  3KSX A;  5L8R F;  1W5S A;  1WR1 B;  1IN6 A;  4GMQ A;  4LG2 A;  1QAM A;  3SBJ A;  2MR9 A;  2HL7 A;  3NWL A;  4GHA A;  3M0E A;  3FTD A;  1DGB A;  2LVO C;  1AIP C;  2R6F A;  4L6V 6;  3U5Z A;  1V33 A;  2O01 F;  3GLI A;  4LJ6 A;  1IXS A;  2DZL A;  4B7H A;  1OTR A;  2QSF X;  1ZMV A;  2VQF M;  3SAT A;  3CF2 A;  2XZU A;  3C58 A;  2J5Y A;  2F4V M;  2EA0 A;  2VDB B;  3GLI E;  1Z6T A;  1IBM M;  3IEC A;  1HNW M;  4NRW A;  4CJ6 A;  4D82 A;  3H4M A;  1MN3 A;  3B7N A;  3L25 A;  3U6O A;  2DEN A;  1HQC A;  3J80 S;  1DO2 A;  4DBG B;  2EO2 A;  4IBK A;  4R3D A;  4WUR A;  1L2D A;  2CWB A;  2KZS A;  3A46 A;  3QYB A;  4DR1 M;  4L15 A;  5EXX A;  1G59 A;  3D8L A;  3KOX E;  2RRU A;  3M6A A;  2JY7 A;  4REZ A;  2QNJ A;  1E94 E;  2OOA A;  3GRR A;  3HY5 A;  2JZ0 A;  3Q8X A;  4P17 A;  4WP2 A;  2DZO B;  4KHP M;  2J7O A;  2D7E A;  2B3T A;  3GLG A;  2D7H A;  7CAT A;  1GAB A;  4II7 A;  3PXG A;  4MGH A;  1IY1 A;  4ANR A;  3HKP A;  4BLC A;  1DO0 A;  3B89 A;  4IBD A;  1I94 M;  2LHG A;  1EFU B;  4LJ9 A;  3GLG E;  2X8A A;  1TDH A;  2JY5 A;  3LCV B;  4AKG A;  3AKZ A;  3U61 A;  4RF1 A;  2LWX A;  2YNM D;  3MHV C;  2WSF F;  4PT5 A;  3FTC A;  4LFB M;  5KO3 A;  4JI5 M;  5EXS A;  1R4G A;  2C98 A;  2A5Y B;  3A45 A;  2LVA A;  4L16 A;  4PDI A;  4NSR A;  4LGM A;  1Z5C A;  3HGI A;  4LY6 A;  4LZZ A;  3SHF A;  2EUC A;  1OFI A;  2I7N A;  3E9S A;  4M0W A;  3UMM A;  1XXH A;  4YHH M;  4TUW A;  2F5N A;  3K9P A;  4M9S A;  1D0K A;  4LJ7 A;  4BB9 A;  5ITT A;  1NSF A;  3LQQ A;  4X65 M;  2ZAM A;  3JAM S;  1Q3B A;  2L4F A;  1V34 A;  2ZM6 M;  2OQ4 A;  1XB2 B;  2WSE F;  3D8B A;  1N32 M;  2FNA A;  3NBI A;  1P3Q Q;  1XC8 A;  4JI8 M;  1QAO A;  4BBA A;  2Y0Q A;  3GRY A;  3LVV A;  2VF7 A;  4QHS A;  4X66 M;  2LVQ D;  2EKF A;  4B7F A;  4Y28 F;  4B3S M;  1HJP A;  2ZAN A;  3PVS A;  3KDS E;  2BNK A;  4GIP A;  3CTW B;  1H6U A;  1N78 A;  2JUJ A;  2QBY A;  3C3D A;  2MGW A;  4LF5 M;  1OJL A;  3I01 M;  3RFW A;  2JNH A;  3TWK A;  4M0D A;  2Z3X A;  2CUZ A;  4Q7J A;  4FWG A;  2ZTC A;  1PJJ A;  2ZTD A;  1IBL M;  3HU2 A;  3QWL A;  4L78 A;  4LRT A;  3HWS A;  3THG A;  2QZ4 A;  4PCZ A;  5H37 D;  3GQ5 A;  1PJQ A;  3U6M A;  2F5Q A;  3GPU A;  2YR0 A;  3HX3 A;  1UFZ A;  5DNY A;  1R7R A;  2JA2 A;  1DGF A;  1YSY A;  4IBJ A;  3GQ4 A;  4JI7 M;  2OOB A;  3FUX A;  2KEB A;  4B3T M;  4MM3 B;  1VEG A;  1DV0 A;  1EE8 A;  4R71 A;  1QUS A;  1IFY A;  3AJI B;  1SXJ E;  2R45 A;  4IBI A;  2UU9 M;  2UUB M;  3KVW A;  3KSJ A;  1SXJ B;  4IIW A;  1IN7 A;  2LVP C;  3J7A S;  5C1B A;  3VKG A;  2Z8Y M;  2KA6 B;  4D80 A;  1HNZ M;  4DUY M;  5E26 A;  1GLN A;  1G41 A;  3GPY A;  1HT2 E;  4PD2 A;  4ITQ A;  4LF7 M;  4RKU F;  4Z6Y A;  1GL7 A;  4FCT A;  3VDP A;  2VF8 A;  4FW9 A;  4L8R C;  1FNN A;  1JQJ C;  3MK6 A;  1D0L A;  3HJQ A;  4OVZ A;  2V6Z M;  4DR7 M;  4AQY M;  2C9O A;  5FTJ A;  5KPT A;  2EKK A;  5KQ8 A;  4LF4 M;  1L1T A;  3FTF A;  2BWE A;  2L7H A;  1TR8 A;  3HJ8 A;  3UK6 A;  5ITR A;  2F5O A;  2XGN A;  2DVW B;  3DOA A;  3AFH A;  1HQY E;  1IQP A;  1E9S A;  1UM8 A;  3J2P B;  5IZ7 D;  1C1K A;  4I8O A;  5BPV A;  1TDZ A;  3LVW A;  4AZF A;  1YLA A;  2HWJ A;  2KRK A;  2W82 A;  3BBZ A;  2DWM A;  4AKH A;  2FFJ A;  4F1I A;  3HHY A;  5LMN M;  1WXQ A;  3U6S A;  3FD9 A;  2JP7 A;  5EP4 A;  1RU3 A;  4CIZ A;  1PGY A;  2CV2 A;  3R9X B;  2R18 A;  1TF0 B;  2LXE A;  1KFV A;  1WGN A;  2LVN C;  2JZ1 A;  2JWS A;  3SFZ A;  3K1J A;  2UXC M;  2K9D A;  3HHX A;  4JV5 M;  1NNU C;  3KXE C;  3SMS A;  3A42 A;  3PNV A;  4B7G A;  4DV6 M;  2UUA M;  1D0M A;  4R7G A;  4A3V B;  5FSW A;  2XSZ A;  5A2Q S;  4DR4 M;  3L2A A;  3PNY A;  3UZU A;  4GC5 A;  4MGY E;  1IY0 A;  1QQW A;  2F5S A;  3HU3 A;  3SAU A;  1OQY A;  4B3M M;  2FOI C;  4MGZ E;  1NJF A;  3I04 M;  4CGY B;  3EIH A;  4XK8 F;  1MX0 A;  1X37 A;  3L29 A;  2KDL A;  4LCB A;  5EJC A;  3GPX A;  3GLF B;  2DWL A;  1HT1 E;  4IJE A;  4LFC M;  3I51 A;  1NO1 A;  3L28 A;  4AW4 A;  3B7Z A;  1G4A E;  3VKH A;  3HHW A;  4GC9 A;  4DR6 M;  3U5Z B;  2Y0T A;  2DKL A;  4D81 A;  1QZM A;  1IXS B;  1ZV1 A;  2MH8 A;  2XFT A;  4FD2 A;  4I81 A;  4B08 A;  4I5S A;  4M9Z A;  3QAU A;  4NOO B;  4NXN M;  4GIT A;  4HEO A;  1HR0 M;  3SMP A;  2VQE M;  3CF0 A;  2RGO A;  3SAR A;  1QZE A;  2LHC A;  5ITX A;  1OFH A;  3U6C A;  2L7I A;  1VG5 A;  1Q39 A;  2Q2E B;  1VDD A;  2G5G X;  5EXP A;  5EP2 A;  3HHZ A;  2AHM A;  1QVR A;  2R65 A;  3ZQJ A;  3SYL A;  1SXJ D;  1TH2 A;  5ITX E;  1IBK M;  2R4E A;  5KPR A;  4AKI A;  1NY5 A;  1VDL A;  3BXW A;  3MJ5 A;  2KRU A;  1GO5 A;  3T38 A;  4G6Z A;  2XLJ A;  1NNJ A;  2BJV A;  2M60 A;  2DZN B;  2DI0 A;  2R62 A;  3SAV A;  1PRB A;  5FTL A;  2XFS A;  4JXJ A;  1NV8 A;  1Q3C A;  2CEA A;  5ITU A;  2F5P A;  3W67 A;  4DV2 M;  1IXR C;  5ITQ A;  2CFO A;  1NV9 A;  2R44 A;  3U6Q A;  1VEK A;  2X4A A;  4LF6 M;  4NL4 H;  2HAK A;  4S12 A;  3VDU A;  3VK7 A;  3SAS A;  3K2L A;  3AOE A;  1R2Y A;  5KPZ A;  4LF8 M;  4GEW A;  3L27 A;  3I4Y A;  1PJI A;  3I4V A;  5LMU M;  1K3W A;  3OTO M;  2MRO B;  3E21 A;  2WSC F;  3B9P A;  1XXH B;  1DGH B;  3TWM A;  3U60 B;  3FTE A;  2DAK A;  3VK8 A;  1PM5 A;  4FWD A;  2CV0 A;  4DUZ M;  4LJ5 A;  4AI6 A;  4FCW A;  4G4N A;  1YE9 A;  3HU1 A;  3FUU A;  1GKI A;  1SXJ A;  4FVM A;  5DYG A;  1L2C A;  1GJS A;  3U6D A;  1L2B A;  4LJ4 A;  1G3I A;  2ERC A;  4XGI A;  2K47 A;  1Z59 A;  2ZBK B;  1NJG A;  1K3X A;  4DR3 M;  3GLH B;  4QNR A;  1OIZ A;  4G4Q A;  4L4U A;  2M5Z A;  2JXN A;  4X62 M;  3GP1 A;  5FTM A;  3U6P A;  4JYA M;  1QAN A;  2G3Q A;  1PJS A;  3E46 A;  3KOW E;  3GRV A;  3MMP A;  2LTU A;  3AL0 C;  3T15 A;  3LW5 F;  2BWB A;  1JB0 F;  3FUT A;  4LGY A;  5IRE B;  2QBY B;  2RKO A;  1GJT A;  2UXD M;  4RNA A;  1ORY B;  1GL6 A;  2DAG A;  3NBX X;  2O25 A;  3RGS A;  3GPP A;  1QDR A;  1L8Q A;  2C96 A;  2XH9 A;  2KNV A;  3K8Z A;  2DHR A;  3DFZ A;  2R4J A;  1GVN A;  2QPA A;  4DR5 M;  1KYI A;  3KFU G;  3AOE C;  2OO9 A;  1SG9 A;  1VEJ A;  5IT9 S;  5GKN A;  2CHG A;  5FLX S;  1XWI A;  4CHT B;  2J7N A;  3J27 B;  3W0F A;  2BJW A;  2LH0 A;  1A5T A;  1QDT A;  2GQF A;  4OW0 A;  4X64 M;  1OAO C;  3PFI A;  1IN8 A;  1NVM A;  1OIP A;  2R0I A;  1N33 M;  4NC6 A;  1EIJ A;  1KSF X;  3IG5 A;  3KP1 E;  5FTN A;  5KQD A;  3VFD A;  2E5L M;  4DV3 M;  2Z7J A;  1L1Z A;  2XEP A;  1ZMW A;  4HL4 A;  1Y8G A;  5JI2 E;  4OX9 M;  2V1U A;  3GO8 A;  4B3R M;  1Q02 A;  4IBF A;  3LQR A;  4IBE A;  4JI4 M;  3KS8 A;  2I7P A;  1XNR M;  3H4J A;  1AUA A;  2KNZ A;  4NSO B;  2APL A;  3KOY E;  8CAT A;  4JI3 M;  3WHK A;  3ZH9 B;  1E9R A;  1TH3 A;  2L6O A;  2QCU A;  2YQZ A;  4DV5 M;  1N34 M;  2ZAO A;  3W0L B;  3ZC7 B;  3GLF A;  3SAW A;  2DHY A;  3EIE A;  2Z4S A;  1OKS A;  1FJG M;  4QOZ C;  4QOS A;  1WJ7 A;  2Y20 A;  1ZQ9 A;  3C3E A;  4IBG A;  2HHH M;  2JY8 A;  3UGJ A;  1R5L A;  3B74 A;  5EP3 A;  1BVS A;  3GLF E;  3DA1 A;  2CV1 A;  2OPF A;  1XNQ M;  3J7B A;  3C9P A;  2LBC A;  2H5X A;  2K6B A;  2L2D A;  3BOS A;  3F92 A;  3FE3 A;  3HZJ A;  3TL4 X;  2QEN A;  2JY6 B;  3GQ3 A;  1I4W A;  4KO8 A;  1S3S A;  4JI1 M;  4AG6 A;  4M9X A;  3FKE A;  4ZPX A;  3GLI B;  3JR4 A;  4GKJ M;  2CRU A;  1HNX M;  4HLQ A;  2UUC M;  2CE7 A;  3DZD A;  2XF3 A;  3E4R A;  2NQ8 C;  4MH0 E;  1N77 A;  1TTE A;  1IY2 A;  3WHL A;  3LCU A;  2KZU A;  4PDG A;  3AOG A;  2XZF A;  1J5E M;  3CGW A;  4JI2 M;  2FS1 A;  5EXT A;  3ZCB B;  2CP8 A;  3HJS A;  5IWA M;  1R2Z A;  2DAI A;  1MJG M;  2CHQ A;  1G8P A;  1T43 A;  5FTK A;  4OU7 A;  3KS4 A;  2QHO B;  4NXM M;  1D2N A;  1DGG A;  5EP1 A;  4GH9 A;  1N75 A;  2Z4R A;  4MGK E;  1JR3 D;  1MU5 A;  2RGH A;  5DFL A;  5DYI A;  2FH0 A;  4MB7 A;  4LFA M;  3GLG B;  2KHH A;  4G4R A;  1CUK A;  3U6E A;  3UJN A;  3J81 S;  4KT0 F;  1PJT A;  2Y21 A; 
#chains in the Genus database with same CATH homology
 3U61 B;  4XBO A;  4G4O A;  4I4L A;  2KW0 A;  1XMQ M;  1DGH A;  3U60 A;  1N36 M;  4LJ8 A;  3SHG B;  3RE8 A;  3ILK A;  4DR2 M;  4KLN A;  5JI3 E;  1QYR A;  3TPZ A;  1XMO M;  3GRU A;  1R6B X;  1Z5A A;  2DWZ B;  4RF0 A;  2DXI A;  3KW6 A;  1ZAE A;  1J09 A;  2G8L A;  1K82 A;  4DV1 M;  3GLH A;  4KOD A;  3M7G A;  1IN5 A;  3FUV A;  3AV0 A;  3SC3 A;  2X49 A;  3JR5 A;  3VLF B;  1QAQ A;  3U6L A;  5C18 A;  4LF9 M;  2O5R A;  2C99 A;  2L09 A;  3FYD A;  1JR3 A;  1XHB A;  5E6J A;  4MGI E;  3TE6 A;  3KP0 E;  5F3W A;  4GKK M;  1IM2 A;  4QHT A;  5ITY A;  4QNM A;  3K92 A;  1NY6 A;  3T1H M;  3T1Y M;  2UXB M;  2C5R A;  3KOZ E;  3R8F A;  1NHG C;  4EIW A;  2FE8 A;  4W5W A;  3SYK A;  4FWH A;  3FUW A;  1W5T A;  2C9C A;  4JN6 A;  4JI0 M;  1TGU A;  4GHL A;  2CHV A;  5EQT A;  4YY3 M;  2QP9 X;  1Z5B A;  3CF6 E;  4IJF A;  4DV4 M;  2D7G A;  2HKJ A;  4IBB A;  4LZJ A;  4FCV A;  4DV7 M;  1T3T A;  1NHW C;  3TWL A;  1J7K A;  2P5T A;  4K0K M;  4LRS A;  1IN4 A;  4JI6 M;  3L26 A;  4IBC A;  2KXE A;  1E32 A;  2XSZ D;  2H1R A;  3IG8 A;  3LMM A;  2VII A;  1SXJ C;  2V1C A;  2DWN A;  3TQS A;  3A98 B;  4GRI A;  4P16 A;  4AG5 A;  1TH4 A;  5BR8 M;  4CIS A;  2HCB A;  4WW0 A;  4LJA A;  4DV0 M;  3RGP A;  1LV7 A;  3FYC A;  4NRV A;  2LNH C;  2YFQ A;  4Z8X A;  4OVZ B;  2R46 A;  1IXZ A;  1YUB A;  3KSX A;  1W5S A;  4GMQ A;  1IN6 A;  4LG2 A;  1QAM A;  3SBJ A;  2HL7 A;  3NWL A;  4GHA A;  3M0E A;  3FTD A;  1DGB A;  3U5Z A;  3GLI A;  4LJ6 A;  4B7H A;  2VQF M;  3SAT A;  3CF2 A;  2XZU A;  3C58 A;  2F4V M;  2EA0 A;  1Z6T A;  1IBM M;  1HNW M;  4NRW A;  4D82 A;  3H4M A;  3L25 A;  3U6O A;  1HQC A;  3J80 S;  1DO2 A;  2EO2 A;  4IBK A;  4R3D A;  4WUR A;  1L2D A;  2KZS A;  3A46 A;  4DR1 M;  4L15 A;  5EXX A;  1G59 A;  3D8L A;  3KOX E;  3M6A A;  4REZ A;  1E94 E;  3GRR A;  3Q8X A;  4KHP M;  2DZO B;  2J7O A;  2D7E A;  3GLG A;  2D7H A;  7CAT A;  4II7 A;  3PXG A;  4MGH A;  1IY1 A;  4BLC A;  3HKP A;  1DO0 A;  4IBD A;  1I94 M;  4LJ9 A;  2X8A A;  1TDH A;  4AKG A;  3AKZ A;  3U61 A;  4RF1 A;  2LWX A;  2YNM D;  3MHV C;  4PT5 A;  3FTC A;  4LFB M;  5KO3 A;  4JI5 M;  5EXS A;  2C98 A;  3A45 A;  2A5Y B;  4L16 A;  4PDI A;  4NSR A;  4LGM A;  1Z5C A;  3HGI A;  4LY6 A;  4LZZ A;  3SHF A;  2EUC A;  1OFI A;  2I7N A;  3E9S A;  4M0W A;  3UMM A;  1XXH A;  4YHH M;  4TUW A;  2F5N A;  4M9S A;  4LJ7 A;  4BB9 A;  5ITT A;  1NSF A;  3LQQ A;  4X65 M;  2ZAM A;  3JAM S;  1Q3B A;  2ZM6 M;  2OQ4 A;  3D8B A;  1N32 M;  2FNA A;  3NBI A;  1XC8 A;  4JI8 M;  1QAO A;  4BBA A;  2Y0Q A;  3GRY A;  3LVV A;  4X66 M;  4QHS A;  4B7F A;  4B3S M;  2ZAN A;  3PVS A;  3KDS E;  2BNK A;  4GIP A;  3CTW B;  1H6U A;  1N78 A;  2QBY A;  4LF5 M;  1OJL A;  3RFW A;  3TWK A;  4M0D A;  2Z3X A;  2CUZ A;  4FWG A;  1PJJ A;  1IBL M;  3HU2 A;  3QWL A;  4L78 A;  4LRT A;  3HWS A;  3THG A;  2QZ4 A;  4PCZ A;  5H37 D;  3GQ5 A;  3U6M A;  2F5Q A;  3GPU A;  2YR0 A;  5DNY A;  1R7R A;  2JA2 A;  1DGF A;  1YSY A;  4IBJ A;  3GQ4 A;  4JI7 M;  3FUX A;  2KEB A;  4B3T M;  4MM3 B;  1EE8 A;  3AJI B;  1SXJ E;  2R45 A;  4IBI A;  2UU9 M;  2UUB M;  3KVW A;  3KSJ A;  1SXJ B;  4IIW A;  1IN7 A;  3J7A S;  5C1B A;  3VKG A;  2KA6 B;  4D80 A;  1HNZ M;  4DUY M;  5E26 A;  1GLN A;  1G41 A;  3GPY A;  1HT2 E;  4PD2 A;  4ITQ A;  4LF7 M;  4Z6Y A;  1GL7 A;  4FCT A;  3VDP A;  4FW9 A;  4L8R C;  1FNN A;  1JQJ C;  3MK6 A;  3HJQ A;  4OVZ A;  2V6Z M;  4DR7 M;  4AQY M;  2C9O A;  5FTJ A;  5KPT A;  5KQ8 A;  4LF4 M;  1L1T A;  3FTF A;  2F5O A;  2L7H A;  3HJ8 A;  3UK6 A;  2XGN A;  2DVW B;  3DOA A;  3AFH A;  1HQY E;  1IQP A;  1E9S A;  1UM8 A;  3J2P B;  5IZ7 D;  1C1K A;  4I8O A;  5BPV A;  1TDZ A;  3LVW A;  4AZF A;  2KRK A;  4AKH A;  2DWM A;  2W82 A;  2FFJ A;  3HHY A;  5LMN M;  1WXQ A;  3U6S A;  3FD9 A;  5EP4 A;  3R9X B;  2CV2 A;  2R18 A;  2LXE A;  1KFV A;  3SFZ A;  2UXC M;  3K1J A;  3HHX A;  4JV5 M;  1NNU C;  3KXE C;  3SMS A;  3A42 A;  3PNV A;  4B7G A;  4DV6 M;  2UUA M;  4R7G A;  4A3V B;  5FSW A;  2XSZ A;  5A2Q S;  4DR4 M;  3L2A A;  3PNY A;  3UZU A;  4GC5 A;  4MGY E;  1QQW A;  1IY0 A;  2F5S A;  3HU3 A;  3SAU A;  4B3M M;  2FOI C;  4MGZ E;  1NJF A;  4CGY B;  3EIH A;  1MX0 A;  1X37 A;  3L29 A;  4LCB A;  3GPX A;  5EJC A;  3GLF B;  2DWL A;  1HT1 E;  4IJE A;  4LFC M;  3I51 A;  3L28 A;  4AW4 A;  1G4A E;  3VKH A;  3HHW A;  4GC9 A;  4DR6 M;  3U5Z B;  2Y0T A;  4D81 A;  1QZM A;  1IXS B;  2XFT A;  4FD2 A;  4B08 A;  4I81 A;  4I5S A;  4M9Z A;  3QAU A;  4NOO B;  4NXN M;  4GIT A;  1HR0 M;  3SMP A;  2VQE M;  3CF0 A;  2RGO A;  3SAR A;  5ITX A;  1OFH A;  3U6C A;  2L7I A;  1Q39 A;  2Q2E B;  1VDD A;  2G5G X;  5EXP A;  5EP2 A;  3HHZ A;  2AHM A;  1QVR A;  2R65 A;  3SYL A;  1SXJ D;  1TH2 A;  5ITX E;  1IBK M;  2R4E A;  5KPR A;  4AKI A;  1NY5 A;  3MJ5 A;  2KRU A;  3T38 A;  4G6Z A;  2XLJ A;  1NNJ A;  2BJV A;  2M60 A;  2DZN B;  2R62 A;  3SAV A;  5FTL A;  2XFS A;  4JXJ A;  1Q3C A;  2CEA A;  5ITU A;  2F5P A;  4DV2 M;  1IXR C;  5ITQ A;  2CFO A;  3U6Q A;  2X4A A;  4LF6 M;  4NL4 H;  3VDU A;  4S12 A;  3VK7 A;  3SAS A;  3K2L A;  3AOE A;  1R2Y A;  5KPZ A;  4LF8 M;  3L27 A;  3I4Y A;  1PJI A;  3I4V A;  5LMU M;  1K3W A;  3OTO M;  3B9P A;  1XXH B;  1DGH B;  3TWM A;  3U60 B;  3FTE A;  3VK8 A;  1PM5 A;  4FWD A;  2CV0 A;  4DUZ M;  4LJ5 A;  4AI6 A;  4FCW A;  4G4N A;  1YE9 A;  3HU1 A;  3FUU A;  1GKI A;  1SXJ A;  4FVM A;  5DYG A;  1L2C A;  3U6D A;  1L2B A;  4LJ4 A;  1G3I A;  2ERC A;  4XGI A;  2K47 A;  1Z59 A;  2ZBK B;  1NJG A;  1K3X A;  4DR3 M;  3GLH B;  4QNR A;  4G4Q A;  4L4U A;  2M5Z A;  4X62 M;  3GP1 A;  5FTM A;  3U6P A;  4JYA M;  1QAN A;  3KOW E;  3GRV A;  3AL0 C;  3T15 A;  3FUT A;  4LGY A;  5IRE B;  2QBY B;  2RKO A;  2UXD M;  4RNA A;  1ORY B;  1GL6 A;  3RGS A;  3GPP A;  1L8Q A;  2C96 A;  2XH9 A;  3K8Z A;  2DHR A;  3DFZ A;  2R4J A;  1GVN A;  2QPA A;  4DR5 M;  1KYI A;  3KFU G;  3AOE C;  5IT9 S;  5GKN A;  2CHG A;  5FLX S;  1XWI A;  4CHT B;  2J7N A;  3J27 B;  3W0F A;  2BJW A;  2LH0 A;  4OW0 A;  4X64 M;  3PFI A;  1IN8 A;  1NVM A;  1N33 M;  1KSF X;  3IG5 A;  3KP1 E;  5FTN A;  5KQD A;  3VFD A;  2E5L M;  4DV3 M;  2Z7J A;  1L1Z A;  2XEP A;  4HL4 A;  5JI2 E;  4OX9 M;  2V1U A;  3GO8 A;  4B3R M;  4IBF A;  3LQR A;  4IBE A;  4JI4 M;  3KS8 A;  2I7P A;  1XNR M;  4NSO B;  3KOY E;  8CAT A;  4JI3 M;  3WHK A;  3ZH9 B;  1E9R A;  1TH3 A;  2L6O A;  2QCU A;  2YQZ A;  4DV5 M;  1N34 M;  2ZAO A;  3W0L B;  3ZC7 B;  3GLF A;  3SAW A;  3EIE A;  2Z4S A;  1FJG M;  4QOZ C;  4QOS A;  2Y20 A;  4IBG A;  1ZQ9 A;  2HHH M;  3UGJ A;  5EP3 A;  3DA1 A;  2CV1 A;  2OPF A;  1XNQ M;  3J7B A;  3BOS A;  3TL4 X;  2QEN A;  3GQ3 A;  1I4W A;  4KO8 A;  1S3S A;  4JI1 M;  4AG6 A;  4M9X A;  3FKE A;  4ZPX A;  3GLI B;  3JR4 A;  4GKJ M;  1HNX M;  4HLQ A;  2UUC M;  2CE7 A;  3DZD A;  2XF3 A;  3E4R A;  2NQ8 C;  4MH0 E;  1N77 A;  1IY2 A;  3WHL A;  2KZU A;  4PDG A;  3AOG A;  2XZF A;  1J5E M;  4JI2 M;  5EXT A;  3ZCB B;  3HJS A;  5IWA M;  1R2Z A;  2CHQ A;  1G8P A;  5FTK A;  4OU7 A;  3KS4 A;  4NXM M;  1D2N A;  1DGG A;  5EP1 A;  4GH9 A;  1N75 A;  2Z4R A;  4MGK E;  1JR3 D;  1MU5 A;  2RGH A;  5DYI A;  4G4R A;  4MB7 A;  4LFA M;  3GLG B;  3U6E A;  3UJN A;  3J81 S;  5ITR A;  2Y21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...