3DFZA

Sirc, precorrin-2 dehydrogenase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
196
Chain Sequence
MYTVMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDDQYRLSLVKQREFLQQIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-2 dehydrogenase
publication title Structure and function of SirC from Bacillus megaterium: a metal-binding precorrin-2 dehydrogenase
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 61
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.3.1.76: Precorrin-2 dehydrogenase.
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13241 NAD_binding_7 Putative NAD(P)-binding
A PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.610 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3dfzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfzA01
1CRWG 5DNAA 5F1OA 1NQAO 5CFZA 5JMWA 3NDIA 1Z82A 4FSHA 4L8VA 2AA3A 5ICSA 3WTCA 1R0LA 1BHSA 3BXXA 1MC4A 5BSFA 1P44A 1GQQA 4L0QA 5KKCA 3TZ6A 4BO4A 2ZB7A 4MVJE 2GLXA 5LDHA 4MPDA 4IQ8A 5HRUA 2I3AA 1P1IA 1E1MA 1JQBA 4J4HA 4UVGA 3DOCA 4RO0A 1NQ5A 5L9AA 3K96A 1DFIA 1GQYA 3DTYA 4O63O 1LXCA 4OH1A 4E30A 1E77A 3PDUA 3TPCA 2CZCA 1PJQA 4QTZA 4EJ6A 2FPGA 4TRNA 1XYGA 4RGBA 4EEXA 4J43A 4AJLA 1HF3A 2Q1UA 2OUIA 3JD4A 3WBFA 5TX7A 3PXXA 3EVNA 2P2SA 4I9UA 6ADHA 2QYSA 1EDOA 3ABIA 1Z7BA 3RBXA 5L40A 3T7EA 1GADO 1E3WB 3L4BC 1HE4A 3OMLA 5JS6A 1LRJA 2DT5A 2EIHA 4M89A 3GZNB 4WECA 3OEWA 1EDZA 1P74A 4R51A 4ND4A 3QVWA 4BB5A 5ADHA 2PGJA 3VVCA 3QE3A 5EMHA 1N2SA 2BFMA 2FSVA 1M6HA 1WLYA 4R1UA 3RCBA 3LC2O 1TVEA 5DBGA 1E92A 1XELA 2ILTA 3OJ0A 1PJTA 4OAQA 5BSHA 4NJMA 3RFTA 2OFPA 2VUTA 2X5OA 1YL5A 3Q1LA 1SC6A 1SNYA 2OGUA 1XWFA 2X58A 2DLDA 1LRLA 2G76A 2WD7A 4CUKA 1PJBA 5ENDA 5KJCA 3NDJA 5DCWA 1J6UA 3ZWPA 4LMPA 3FTNA 3RVDA 2NV6A 4DL9A 3WYCA 3I4CA 1RM4A 4E6PA 1EBFA 3A9WA 1IHXA 1EQ2A 3KVOA 3VTZA 3G17A 6LDHA 2X6TA 2NSDA 5G0TA 4JN6B 3ZWOA 1N9GA 4XD2A 4CJXA 1KC3A 1K2WA 1O89A 1R6DA 3EC7A 5JE8A 1KIFA 4XJTA 1B15A 3I9MA 3NT5A 2IXBA 3ASVA 2P68A 3BHMA 3WWYA 4RVDA 1IE3A 3ICPA 5L53A 3QW2A 3ANNA 4NH4A 5CDTA 4GQAA 1Q7CA 4IDDA 3P19A 3GLQA 4W9NA 2WM3A 1BDBA 4DLLA 2JJYA 4J2HA 1BDMA 2DTEA 3RKUA 3WYBA 3PYMA 1LSOA 3HZZA 4BNYA 4YA6A 5K6AC 2ZYGA 4CM6A 1DJNA 2GN8A 2VYND 5CEFA 3I9NA 5T6BA 1J5PA 1EUZA 4TQGA 4XQEA 4K26A 2V6BA 3MJ4A 1F0YA 3CUKA 5IAAA 4EUFA 4FC7A 3A1NA 3AU9A 1PZHA 1QYVA 3NGLA 1LLDA 2WE8A 1I3NA 4OM8A 3WGZA 2LDXA 3IQDB 4YJHB 4WEQA 1B8PA 2Q1WA 1VE9A 2H6EA 4PZEA 4KWHA 4O1MA 1T4DA 3K6JA 1E1KA 1MLDA 3B1JA 4O6VA 3GPDG 1EZ4A 1E6EA 3TJRA 4XQCA 4BO5A 2YW9A 3JQDA 3JD0A 3O03A 1GCOA 4OXKA 1RM5A 1MX3A 3WQQA 4DPMA 4BNNA 5U4QA 2DQ4A 2FZEA 1DAPA 3EDMA 4BO6A 2C2YA 3JYPA 3R1IA 4QFDA 4GPD1 3UHAA 1SO8A 4D3FA 4OQZA 1YDWA 1P1HA 2VZ9A 3D0OA 3JQCA 2WEKA 2W90A 4KUHA 1PJLA 3ENNA 2X0IA 1U7TA 2HK9A 1I10A 2YY7A 3I3OA 1EE9A 3ZWBA 3GH3A 1EUDA 4PCVA 3ZV6A 1K6XA 1Q7BA 2IEBA 4GSLA 2P9GA 3GVIA 4ND1A 2ZB3A 3DMYA 4KUEA 2I65A 3GR6A 1E6WA 4RVHA 1ENYA 3OFSA 3SX2A 1Y5RA 4ND2A 3K9QO 5A03A 2YQ5A 3M6IA 4R3NA 4U6SA 3MOGA 4TRMA 1I2CA 4FFOA 4Q39A 5IDXA 3NDRA 3E48A 3EYWA 2DUUA 2WMDA 2RCYA 4NU6A 3Q9NA 4XWYA 2POQX 2ZYDA 5ER9A 3WSWA 2HMSA 4S1VA 1EUCA 5DDIP 3TZKA 1F17A 2C7GA 3JD1A 3SC4A 3HFSA 2QX7A 2ET6A 3F46A 3H4VA 1N8KA 2CNBA 1Q0QA 3QY9A 1SCUA 2Y0EA 4TZTA 3MWEB 1PWZA 3BMQA 4YRBA 4R1NA 1VRWA 1IHYA 2FPIA 4G2NA 5F5LA 1ADCA 3FR7A 3OETA 4G65A 1C1XB 3S1LA 2DC1A 5ER6A 2DBZA 4NFYA 3ZZNA 4YACA 1LUAA 4EDFA 5KOIA 1ZH8A 3JQFA 4HNHA 4IDEA 2J3IA 4R1SA 5T8KC 1WW8A 2PH5A 2Y05A 2VYVD 2H63A 3ROMA 1GZ3A 4WNCA 1HZJA 1X7GA 3ZWMA 1I3LA 3RBZA 4ZJUA 3ZW9A 1VL6A 1N7GA 3KRTA 2Y1FA 4HFJA 4YBZA 2BHLA 1P45A 1HXHA 1E1LA 3ZHZA 4ZQFA 2VHVA 4M86A 1OI7A 3U62A 3VH1A 1NVMB 5TT0A 3WTBA 3ZCXA 1ZK1A 2LDBA 3AY3A 1K3TA 5COQA 1O9BA 1V3TA 2WE7A 4MVJI 4J6FA 2Q49A 2OBNA 4EBFA 4Q3EA 3Q0EA 1ZSVA 4EJ0A 4RDIA 4L4XA 4J49A 1ZBQA 3A4VA 1PZGA 2O3RA 1T2FA 2GUGA 4I1IA 3F4LA 3H8VA 3K8ZA 1E3IA 2PV7A 2W2LD 4II3A 1GV0A 1AUPA 4YT5A 1CQIA 3TZHA 1NAIA 4BNWA 4CMEA 3H9GA 1E3JA 3NT2A 2P4QA 1NWCA 2YHIB 2O3TA 3AOGA 3RU9A 2QZ9A 1NFRA 2JHGA 4CMBA 3PWSA 5JCJA 3NTOA 1LDYA 1UXJA 1MXFA 1YO6A 3GGOA 2V7PA 1E7YA 3INRA 4E0BA 4YCAA 5IN4A 3DZJA 4D46A 4D79A 1FDTA 2NM0A 2R00C 3I52A 3LC7O 1UP6A 1PGQA 3JYNA 1PJ2A 3C1OA 4CM9A 3ANLA 2C0CA 4CV0A 1GY8A 1E3WA 3HDYA 5L7WA 3BYZA 4IGFA 2BI7A 2GERA 3GZNA 4PG5A 1XDWA 3DXFA 5DP1A 4HP8A 4N7RA 3WLFA 3B70A 3IOYA 1PGPA 3C85A 4YT2A 1UAGA 3VH2A 3T4XA 5JDCC 2O7SA 3WGIA 2GYYA 3I6IA 3MWDB 3EMKA 1YB5A 3GUCA 1CDOA 1GZ4A 1XIVA 3ONDA 2I76A 4FGSA 3DAPA 3T7CA 2WDZA 2A4KA 2VZ8A 3R0IA 4EEZA 3WYEA 3GNSA 1VLLA 4XCVA 4CMAA 5IDQA 4UUOA 3TZQA 5COBA 3SLGA 3PHJA 4JNKA 4L9RA 4XR9A 5H83A 1ZMTA 4E3ZA 3I5MA 5JBIA 2HMTA 1HZZA 3W8DA 1PQUA 3BMCB 1KVSA 1D7OA 1K6IA 5F1PA 1YBVA 4M49A 1QYWA 5BNIA 2Z5LA 1T25A 3RROA 1CJCA 1WWKA 5ITVA 3QWAA 4HWKA 1ZMOA 1RWBA 3GVHA 1UR5A 1O5IA 3X2EA 3IDSA 1UDCA 3DBLB 4IJUA 3JQ7B 3JQGA 3SVTA 4DQUA 2OXIA 1ZK2A 4RVUA 4W6ZA 4PZDA 3AJRA 4NBWA 3V5NA 1I0ZA 3RUFA 2P91A 4EUEA 1HSZA 4ZRNA 1T4BA 4U0JA 1YOVB 4CMGA 3ZV4A 3ZH2A 1KVRA 3TN7A 2CSUA 4YT4A 2NVBA 4RF5A 1TLTA 4KTTE 4E5KA 3PLRA 2VUSA 2HO5A 3LT0A 1GUYA 3AI2A 1P0CA 4Q9NA 4TKMA 3GZ4A 4GMFA 2GNAA 3V1TC 5IZ4A 1RPNA 3V1UA 4GX0A 3RWBA 1QORA 4IDAA 5HS4A 4ZGWA 1A4IA 1CWUA 1U3TA 4WPGA 4XDZA 4U6QA 4B3IA 2OZPA 1PR9A 5TT1A 4WLUA 1CEQA 3TF5A 2G5CA 3DAGA 4OO3A 4DREA 4CLRB 3EGOA 4WCFC 1F8GA 3PIIA 4KZPA 4CPDA 4GVXA 2EKQA 2CVQA 2E82A 2O4UX 3GN2A 4AJ4A 5FEUA 3TFOA 4YJHA 1FDWA 3F1KA 4A73A 2IYPA 1T2DA 4F45A 2W4QA 1DB3A 1I3MA 1PQPA 1WVGA 4IDBA 4MKRA 3AW9A 4MVJF 4NJMB 3ZWVA 1RKXA 3D7LA 5TLSA 3HHPA 4GX5A 1XU7A 4QT0A 4UVHA 4GL4A 3ASUA 1PGJA 4BO9A 3OBBA 4ZVVA 1T2CA 4U5QA 1DHTA 1Q0HA 3WIDA 4TWRA 1D1TA 4CMHA 1ID1A 2QRKA 1TT5B 4LCEA 1DXYA 3RBVA 1M76A 5JNLA 5A9RA 5CG2A 2RH4A 3BMNB 5TNXA 1O0SA 2C07A 1GZ6A 1GV1A 2BKAA 1ZK4A 5F21A 1Y8QB 3HDHA 3RI3A 5KVCA 3ANMA 1ISMA 4R1TA 4IINA 4LSWA 4R69A 4PFJA 1H2BA 1YKFA 1IPEA 1MFPA 1SEPA 3JQAD 1BGVA 3WQRA 2ZKLA 3I1JA 1OAAA 2FWMX 3KHUA 1E7SA 1Z74A 2WYWA 2WJPA 3D1LA 5KVQA 5G0UA 3FRJA 3NT4A 1EVZA 3KYDB 5GMOA 4BNKA 4RF3A 3LZ6A 4B3HA 4J9UE 3FTPA 3D4OA 1DRVA 4GI2A 1A9ZA 3H5RA 3QV1A 1W6UA 1YDEA 3PWKA 1E0DA 3JQ9A 3DMTA 2GR9A 4C4OA 3HADA 1Q0LA 2B0JA 4BNUA 1Y5MA 3DTTA 4IBOA 1A71A 1P33A 4J3FA 5JCXA 3JSAA 2X0JA 4HX5A 3UW3A 4BNVA 4NMHA 3BMOB 2JCYA 4A7PA 4RF2A 1CETA 3DONA 1RYEA 1BG6A 4DRYA 1RM3A 4L76A 4BOYA 1ADGA 1PL7A 2HMWA 3GF4A 2HRZA 3KB6A 5EQDA 4MVJM 1DO8A 3CEAA 3H3FA 3KSZO 2UAGA 1LDNA 4WLOA 2BRUA 4FJ2A 1DIRA 1R4MB 4IS2A 3WGGA 5KJFA 1C1XA 2I6TA 4AJKA 4JGBA 4NK5A 4EYEA 1R37A 4KUGA 4E5MA 4WOJA 1A27A 3E82A 4J4TA 4R9SA 2V6FA 3I83A 4RL6A 4RZIA 2GN4A 3DZIA 3PHHA 3PTZA 2GGSA 1KS9A 2BGMA 4IDGA 3PLNA 5A9SB 4RVFA 3GQVA 3DQPA 4GKVA 1GR0A 3GAFA 4R5MA 4E5PA 5KJEA 2UV8A 5AXDA 1Z7EA 3BTSA 2O23A 4BGVA 1I30A 2PH3A 4D7AA 1EBUA 4CLHA 4JP2A 4HY3A 4PVCA 3GGGA 2QRLA 1LSJA 2HAEA 3C3XA 3E9QA 1E3EA 1WP4A 2QIOA 2VOEA 4K6CA 3CMCO 4GLOA 4BHTA 5B1YA 3H2SA 4IXTA 1PJSA 4CUJA 4ND5A 4BKOA 4IM7A 5I8ZA 3FSRA 2NU6A 4FFPA 3H65A 3ONFA 3H9JA 1GEEA 2WTBA 3BTOA 4FJ0A 1QSGA 1YB1A 4GH5A 3VPGA 3W4KA 8ADHA 1LEHA 1CERA 5DCUA 4OXNA 3UVEA 2JCXA 3DOOA 2VTEA 1UXGA 5A06A 3M2PA 4OXYA 2BELA 4YTEA 2C59A 1QLJA 3V2HA 3ZHXA 1AGNA 1H9AA 1GPJA 2AEJA 2E4AA 2P9EA 3W6ZA 4J2OA 2NU9A 2YHIA 1I5RA 2H5LA 1A5ZA 1B3RA 1R15A 2IZ1A 4PLPA 2X5JO 4URFA 4UEKA 5GY7A 2Y0DA 4GGOA 4MVJD 4PLFA 3WDSA 1Z6ZA 1ZSYA 3VVBA 1JWAB 3LT4A 3LF2A 5IF3A 3GC6A 1YS4A 1GQ2A 2NU7A 3HN7A 1NHWA 1WAMA 1TA4A 3JD2A 4TRJA 4F46A 1W8DA 4WE3A 4UVIA 3MZ0A 4U0KA 4K6FA 1C14A 2VYNA 2X9GA 2VOJA 3NTRA 3LU1A 1XHLA 1BVRA 3GPIA 3D5QA 4RPLA 1I8TA 4BL5A 2CY0A 1HETA 3WGYA 4B79A 3IS3A 4DUPA 1PX0A 4LCJA 3BTUA 2NVWA 2AE2A 4L74A 1LLUA 3JQFC 2DUWA 4IDCA 3OQ1A 3HN2A 5L4LA 3GRKA 1ZZEA 4DC0A 1NQTA 2TMDA 1Q1NA 2Q4EA 2J6IA 1A7AA 3BMCA 5AXAA 2OOSA 3DHEA 3AY7A 4XQGA 3EK2A 5EERA 4CMCA 1EVJA 2G1UA 1P1KA 2FR0A 1F12A 5BSGA 1G0NA 4ZQHA 2PGDA 3E9NA 3H6KA 5JAIA 1JKIA 2BF7A 3GA0A 4BGEA 4N5NA 5B12A 1KEVA 1LQUA 4HFNA 1V3UA 4F3YA 3DBLA 2VHWA 3UKOA 5A05A 2PY6A 2Y66A 3JQ7A 4CLOA 3K30A 1PWXA 1ISGA 1EVYA 5G4KB 1H94A 2CFCA 4NFHA 1KYQA 3RUAA 2E49A 2BLLA 1BWSA 3QWBA 3JQAB 1YOVA 4J1SA 4ALKA 3JD3A 1H6BA 4MP8A 3W4JA 3AOEA 4IS3A 3EZLA 3UH1A 1FJHA 3U4IA 3UCEA 3BHIA 3RC2A 4BO2A 3I9JA 2XXBA 5T64A 4UEOA 3LT1A 3NKLA 4ITUA 4CM8B 1KC1A 1NR7A 4WCDA 3G1TA 1NX6A 2Q99A 2ZATA 1X1TA 3NEPX 4IGEA 4Y6RA 3QVTA 1BXZA 1E7RA 3IJRA 3DEYX 4CLRA 1P77A 3OQ6A 5AVOA 3WGOA 1OMOA 2FZWA 4YAGA 4FFNA 1V6AA 4NFSA 2GRAA 2IXAA 2I99A 1EFKA 3BZUA 3DFUA 4LMRA 2ZTUA 3E18A 5BNFA 3DZGA 3QVOA 4FFLA 1V35A 1HE2A 2J3JA 1XEAA 4HUJA 4FJ1A 4ZQEA 3E8XA 4NHEA 1U3VA 1PS9A 3HWRA 2PTGA 4MKZA 2D4AA 3AM3A 1E5QA 4BNXA 2O2YA 2O3QA 4PG6A 4YQZA 5G4LA 1Y81A 4D0SA 1I36A 3LYLA 3GNTA 4KP7A 4FN4A 1TT5A 3IC5A 4YQYA 4BMNA 2NTJA 2VYVA 2Z95A 3KUXA 1NPDA 1YL6A 4JIGA 3BMNA 4ND3A 1UUFA 1NASA 3ZU3A 5JPIA 1Y8QA 1V3VA 2P5YA 3JQGB 3W8EA 3VPFA 2WD8A 5MGBA 1U8FO 4AL4A 3M1LA 5KNLA 4J7UA 1ZKMA 4OHUA 4EITA 2ZIZA 2EF1A 3F4BA 9LDTA 1GPDG 2HSDA 2VN8A 3DL2A 3HG7A 4CLEA 2PZJA 2D1YA 2Z1MA 3BIOA 4RF4A 4BKUA 3PI7A 4B8ZA 3RIHA 4CQMD 3GY0A 2XPCA 2W2KB 3KOUA 2Q1TA 1LTHR 2ZTVA 2ZJ1A 3KYDA 1F06A 4W99A 3DC2A 4TRRA 4AICA 5DF1A 1YQXA 3VZQA 1PJ4A 2ZQZA 3LDHA 4JBIA 1QLHA 1HDCA 1SB9A 4LVUA 1UXKA 4CMIB 3GDGA 5L4NA 3LF1A 3B1FA 1R66A 3S2IA 2W2LA 4JCOA 4NK4A 5I9NA 5BT9A 3BMOA 4RQUA 5CAEA 1AHIA 3GNQA 4HXYA 4XQ9A 1DEHA 4NG5A 3FNEA 4YDRA 5KJ6A 3BA1A 4RORA 3GFGA 1G0OA 1MB4A 1N1GA 4BMSA 3OA0A 4FCCA 3VKVA 3L4SO 5HM8A 1I01A 3MJCA 1HDXA 1ZJZA 1LA2A 2CD9A 1LDEA 1WMBA 1SMKA 4AG3A 3I9LA 1R4MA 1ZSNA 1YL7A 3HDJA 4GSKA 4PG4A 2V6MA 3KZVA 3H9QA 4MIEA 5JDIC 3R6DA 1LDBA 4RZHA 1ISJA 2O50A 2E6UX 4YPOA 1JN0A 4Y6PA 1NXQA 2AEFA 5A9SA 3H5AA 3U0BA 3IKVA 2EV9A 4CM7A 1X7HA 4KTVE 4QSMA 1WXDA 2YV2A 3IIEA 3C24A 1ZFNA 4A26A 4RLHA 2X0RA 3CMMA 3GOHA 4BB6A 4FDAA 3FN4A 5LDGA 4BMVA 1PTJA 4P8RA 2OP1A 4ZQBA 1PS0A 3U4CA 2HK7A 1E7QA 2I5PO 4XYMA 1ENPA 1B8VA 3FNFA 2DBQA 3WB9A 4JQCA 5LCXA 1FF9A 4HNGA 5I7SA 1X0XA 3QQPA 5HBRA 1IY8A 5GZ1A 2OBYA 3OJFA 3AY6A 1XGKA 2IYOA 3UN1A 1LX6A 3CZMA 1IL0A 3NX4A 5EESA 1K89A 2BFAA 2EWMA 1HTBA 3EVTA 4U8GA 3OSUA 3IUPA 1X14A 3FI9A 1DIBA 3TDKA 3MTGA 4PVDA 1YQDA 1B7GO 4WKGA 3ZWYA 3RFXA 5B37A 4ALJA 1CF2O 4EJMA 1DDOA 2DVMA 3GFBA 4CQLB 5C7IO 1MG0A 2PZMA 2VHYA 4AJ1A 3D5TA 5L45A 2DTXA 1VC2A 3CZRA 5DOZA 1R0SA 3AM5A 1GYRA 3WBBA 2VQ3A 3ZWNA 4PIVA 2DAPA 4I9HA 3F3SA 5F3RA 2DU8A 1ZEJA 3S8MA 1HLPA 2HQ1A 1U28A 1GDHA 3PJDA 4I5GA 1U9JA 1ZJYA 3FBGA 4R01A 2F1KA 3PZRA 1ORRA 5JMPA 1NFFA 4R4JA 3ROPA 4ROSA 4D3SA 4CMJA 2O3SA 1W0CA 2VNSA 1ISIA 1H9BA 1KEUA 4BKPA 1DLJA 3IP3A 1LC3A 4S3MA 4GBJA 4I5FA 2OL4A 3GK3A 1HYEA 2QYTA 3ONEA 3QP9A 4LRSB 1NBOA 2BGKA 3JQ6A 1A4UA 4OOFA 5TRTA 1HDYA 4YXFA 2I9PA 4QQRA 2NADA 2GD1O 1DC5A 4FC6A 4DXHA 5I7VA 3GDFA 8LDHA 5CDSA 2Q3EA 4FOOA 1HE5A 3ZHYA 4J16A 3VTFA 1KEPA 2J3KA 4WLVA 1DC4A 4Y98A 4GX2A 2D3TA 4AVYA 1B16A 4YEDA 3JYOA 5B4TA 2X86A 4AJPA 3FR8A 3GHYA 1O95A 3E6AA 4K1LA 3PHGA 3W1VA 2ZK7A 1X13A 3EY4A 3ZGYA 1VM6A 1DLIA 1PS8A 4JROA 4WNIA 3WGQA 2CVZA 4XB2A 4BS9A 4NU5A 3G49A 1UH5A 3A28A 3CSDA 3HE3A 3JV7A 5BSEA 2EGGA 3GG9A 3OM9A 4L75A 1JAYA 1JWBB 3Q3CA 3KEQA 4XB1A 4YVFA 3VZSA 4CV1A 2UDPA 4UUNA 5G4KA 4BUCA 1DOHA 3NUGA 3H3JA 1B2LA 1DRWA 1O6ZA 2BGLA 3JQAA 1HRDA 3CPSA 3DDNA 4QO8A 5TSDA 3D3WB 1LQTA 1HDRA 2JD0A 4BO1A 3NJ4A 1AHHA 1TT7A 4HFRA 4CQMB 4FB5A 2VWPA 3I6QA 4BO7A 4W7HA 2C29D 1FMCA 1Y1PA 4E4YA 4CM8A 1D3AA 5G0VA 5JSFA 3K2EA 1PQWA 2AG5A 4KWIA 4PG8A 2HK8A 5IXYA 3QVSA 5A4DA 3Q11A 3TQHA 1M75A 1ZCJA 1YRLA 2UUOA 2ZTMA 3QLJA 3L4BA 3S2EA 3DO5A 1F14A 1Y9EA 1E3LA 4FPXA 5JW6A 5CEJA 1PR3A 3D3EA 3TNLA 4AJHA 2HMUA 4YT8A 1TXGA 1HYHA 4XIYA 4OJNA 4GLLA 3K31A 2B35A 2NVUB 4HADA 3S2GA 4YYZA 5TJHA 4D42A 4A0SA 1WDKA 1UZMA 4WK6A 5HTOA 1E7WA 4GWKA 4F6LA 4RPGA 2V6GA 2Y1GA 1E5LA 4Q3BA 1B26A 2JD1A 3DHNA 4MP6A 5JAQA 5I7FA 3ZNNA 3E03A 3PPIA 1DC3A 4CLXA 3ZI0A 1Z75A 4IQ0A 1P31A 3ZHBA 3MJVA 2D8AA 4CLOB 1P3DA 2EG9A 2HMVA 3K2BA 1I32A 5THQA 3AI1A 3K92A 1BW9A 1ZVMA 2Y1CA 1JDJA 4NBRA 2AXQA 4XR4A 4Y8VA 1AXEA 1EVIA 3RUIA 3N74A 3ZNOA 1VL0A 2OP0A 4P4GA 4NNJA 4A5OA 4BNZA 2W2KA 2X4GA 3E5RA 5L3ZA 3W4IA 4YAJA 5JFOA 3ADOA 3GRPA 3F5QA 4OIMA 4YAIA 3OH8A 1HSOA 4DTIA 2EERA 5IZCA 2X23A 1U4OA 2DFVA 4XDYA 4D41A 5I7EA 5K6AA 3ADPA 1VSVA 2YQ4A 2G0TA 3NRCA 4LGVA 4ZA2A 4B4UA 4CMIA 2AHRA 3F9IA 5CDGA 1EQUA 3PDJA 4L73A 1ADFA 1ZXLA 2Y67A 3H2ZA 1P0FA 1ZW1A 1OFGA 3KSUA 2GSDA 4G5HA 4WCFB 3WFIA 4BVAA 4KQXA 1JVBA 1M67A 3ORFA 3ZV5A 2GN6A 2B4TO 4FW8A 5AXBA 4BQPA 4ZD6A 3S55A 5JO0A 3ROQA 4UULA 3PZBA 3D4NA 4MVJA 2Z1NA 2Q4BA 3OEYA 1DFGA 1H5QA 2JFHA 2O3UA 3L9XA 3KETA 1HDZA 3HQ4O 1ULUA 4CL8A 2SCUA 3OIFA 4MDHA 1UP4A 1BXGB 2VRCD 4BQRA 1QXSA 1WDMA 5L51A 4NI5A 1YONA 4XIJA 1JKFA 1T2EA 1XKQA 3AUAA 3PGXA 1W4ZA 4DPLA 1HL3A 1U3WA 5HWSA 3DZFA 2PKQP 1PZEA 1U5CA 4W82A 2JCVA 2PGLA 2E37A 2A9FA 5AXCA 5DT9A 3ZWXA 4EW6A 1NR1A 3B20A 4XEHA 1A7KA 4FFMA 4AJNA 1FDVA 4PLTA 3FPLA 2YHUA 3G3EA 4TSKA 5AOVA 4J7XA 1GEGA 2D0IA 4JJIA 3RUCA 1X1EA 2BFOA 3DR3A 3ZWCA 4JBGA 2R2GA 3BAZA 5C3MA 4MKXA 4RVSA 4YWJA 1TI7A 1PL6A 4J4BA 4EGFA 4E13A 4MIYA 4RDHA 5L7TA 4KQWA 4JLWA 4XRRA 2B5WA 3DZKA 3QWFA 3GVPA 4MJLA 4NJOA 4WASA 7ADHA 4G81A 5COAA 4PN3A 2YFHA 3FCOA 5FI3A 1KERA 4IY1A 1WMAA 5CDYA 5KCZA 4O0LA 4W9NC 3A14A 2X5KO 3AFMA 3G1UA 3OP4A 2Y1OA 4YRDA 1G6KA 4CR8A 4KDEA 2G17A 2PZKA 4CQLA 1IB6A 3CKYA 2J8ZA 2X22A 4JX8A 1QYXA 1H6DA 2PLAA 2WSBA 2YV3A 4LK3A 5TGDA 2ZCUA 2VT2A 3DBHB 1B14A 3O38A 5AQ1A 3H9EO 4MINA 1SB8A 1BVUA 4DBZA 5J23A 3RC7A 4FQ8A 4IJWA 4CLDA 4CV2A 2GO1A 1NVTA 3ETDA 2D2IA 1KVUA 1LDGA 4XYEA 1HE3A 4PG7A 3VZRA 2GZ2A 3VDRA 2Q2QA 2FRDA 2R6JA 2YUTA 4E33A 3WJ7A 1PJCA 3ST7A 1C1DB 4OGWA 4TMFA 4DIOA 4N54A 3JQBA 2PZLA 3JYQA 2HCTA 1KY5A 2AQKA 4WUVA 3NAQA 1VKOA 2YFQA 3UGKA 1FK8A 1IULA 3OICA 3TOXA 3U5TA 4HV4A 5I9LA 3ETGA 1J4AA 4J1QA 4LN1A 4MO2A 3SC6A 1PZFA 1VSUA 4XYLA 2NLOA 3DFZA 4BKRA 4DVJA 2AW5A 2CDBA 1UZLA 4J9VA 3Q2IA 1JU9A 3Q2KA 2NNLD 4LW8A 1I2ZA 4OQYA 1AE1A 1E1NA 1S7CA 5CDUA 4Z3DA 4UVDA 1BXKA 4Q3DA 5KVSA 4OMUA 2P5UA 2FOIA 5L7YA 5T57A 4B7CA 4E21A 4J1NA 2DPGA 3C1TA 3FHLA 5DOVA 3RD5A 3QVXA 1Y8RB 1DSSG 2QZZA 1BMDA 1Z45A 1NPTO 4TROA 3RUDA 4FOSA 4GAEA 4B4VA 4XGIA 3LC1O 5FF9A 2G82A 3PRJA 1C0PA 1NP3A 3LK7A 4XZ3A 3WIEA 5GZ3A 3D3WA 3DBRB 4INAA 3EUWA 4WGGA 4CQMA 2E48A 2HLPA 1NHGA 1MXHA 3QWIA 2O7QA 4E2WA 4QFCA 3FD8A 3JQ8B 3WXBA 4E2XA 1MP0A 4J1TA 5B4VA 1DIAA 1YJ8A 1ZK0A 3C7CB 4QXMA 5TIIA 1PGNA 2DKNA 2JFGA 1DBVO 3KEOA 4J0EA 1U2GA 3SJ7A 1QMGA 4UEJA 4BNHA 5A1TA 4BNIA 4I9NA 2B5VA 3EHEA 4KDFA 3ZWAA 1QYCA 3LLVA 4MVJP 5JDCA 4Y67A 1E3SA 1ML3A 4N5LA 3OJEA 1XSEA 3ZU2A 4DWVA 1JLLA 4CODB 1B0AA 2NVUA 4JXKA 1T1RA 5ILOA 2GASA 3GN1A 2FHSA 1UXIA 2AE1A 1DFHA 3H5NA 4IZHA 4FR5A 5DBIA 4CM3A 2JAPA 4BO8A 1ISFA 3GGPA 4EUHA 2VNAA 3L6EA 2NWQA 1CYDA 3RUEA 4ID9A 4BV8A 4XYGA 1N7HA 2F00A 4QUKA 2BMAA 1ARZA 3GG2A 3BTVA 3ZW8A 1Y9AA 1QYDA 2PK3A 5B4UA 4J7CA 3QRWA 1CIVA 2PKRA 5C37A 1DJQA 1VPDA 4C7KA 1U2DA 4YJGB 3LLSA 3PK0A 1YVEI 3VPHA 4DIFA 3GVXA 2W98A 1KVTA 3DAFA 3P7MA 3WMWA 5CPFA 5JYEA 3OECA 4EI2A 3INTA 4R41A 4XGKA 4DMMA 3CIFA 1IOLA 4ILKA 4W7IA 2Y68A 3AUSA 3GMSA 1R4NB 1KY4A 3CINA 4J90A 1VKNA 1GYQA 1NVGA 3VHRA 2BI8A 4P22A 1VJTA 4DGSA 4MOWA 1GAEO 2EHDA 4ZHSA 1E6UA 2X7HA 3TL3A 2HKIA 2BD0A 4IIUA 3RU7A 1WZIA 5G0WA 1H2HA 3O9ZA 1Q2XA 3PVZA 2EJWA 1U1IA 4CMEC 1GUZA 4XKJA 3PJEA 3DWFA 3KLPX 1QV7A 3MCVA 1I3KA 1ONOA 2X9NA 2ZYAA 1QV6A 1U4SA 3PYXA 4WJZA 3FNGA 3IL2A 2TMGA 3EW7A 4PRLA 2FR8A 2I67A 3LQFA 1HYGA 4WCFA 1YBMA 2A92A 4IJVA 5ILGA 4BGUA 1YBAA 3WS7A 3V1YA 3O8QB 1HLDA 4L4SA 4R3WA 3WNQA 4B7XA 4WLFA 4BNJA 5F1KA 3LT2A 3O26A 1I33A 3ZU5A 2Y1EA 4GWGA 1JA9A 3RC9A 4FD3A 5CHEA 3IKTA 4DA9A 4E31A 2OO5A 3F47A 5DCYA 2QQ5A 3KYBA 2I66A 4PZCA 2VRBA 3V2GA 3PEFA 1ZNQO 3GHHA 5EJ2A 2OHXA 2JAHA 4GX1A 4R5HA 3RSHA 1BXGA 3QJ5A 4IXWA 2ZQYA 3ROKA 3S2FA 1ULSA 3L77A 2VZ0A 1LU9A 1MV8A 3LSYA 2B4QA 4UREA 2ZTLA 3TRIA 4BGIA 4DLAA 3PJGA 1ZEMA 3ITKA 2W8ZA 3ETEA 1F8FA 4R9RA 1BRMA 4LISA 1XLTA 2B83A 1RYDA 5G0SA 2NACA 4BIIA 3L9WA 1SOWA 3DZHA 4AJIA 3W6UA 5A5FA 5IN5A 3VH4A 1BW9B 1V9LA 5KTKA 1GTMA 4UVEA 1EK6A 4PLCA 2C54A 1WNTA 3A06A 4Y9DA 3WG9A 4AJOA 5T5QA 1PIWA 1KOLA 5EIOA 4PLGA 4CR7A 1GL3A 2O48X 4YJFB 1DIGA 1UDAA 2FY8A 4UAGA 4D43A 1IYZA 3AWDA 3VAZA 1YGYA 3TL2A 3FWZA 3AK4A 5DP2A 1B3BA 2IDZA 1QP8A 1K5HA 3OHSX 3SJUA 1OC2A 1NWHA 5ITWA 2ZCVA 3WLEA 3WOHA 4PLWA 4ESOA 5HA5A 3VPXA 5IDWA 1C0LA 2GDZA 4WLNA 3ZN2A 3PHIA 3UOGA 4KMSA 5ICMA 1NNUA 4CM1A 2C20A 2GF2A 5K9ZA 4ZN6A 4DBVO 4X54A 5IZCC 4Z3KA 1Y6JA 2EW2A 4ALMA 1EK5A 3DBVO 2JD2A 2H9IA 3UCFA 2BH9A 3DBHA 3ULKA 4B7UA 1OC4A 3HB4X 5EQFA 5BQFA 2O3JA 1JTVA 2PD6A 3AM4A 1FDSA 2GCGA 5KJ1A 3L0DA 3AUUA 4QO7A 4UUPA 4F6CA 3UCXA 2IRWA 3IJPA 4H3VA 3RFVA 2D59A 2J3HA 2DM6A 3EZYA 3PQDA 5EINA 4MP3A 4RJTA 4NQZA 3WMXA 1D4FA 5DN9A 4E5NA 1HDOA 1KBZA 2VT3A 2PD3A 2VWQA 1UJMA 3OF2A 4DLBA 5IXSA 4RVGA 3RKRA 1SOVA 2FR1A 1C1DA 1UXHA 3N7UA 1P1FA 1SEVA 4I5EA 2VTDA 4ZU3A 5A9TA 3M2TA 1LC0A 1P1JA 3PFFA 4HKTA 4C7JA 1O94A 3D4PA 1PU2A 2Y0CA 2P4HX 2ZB4A 3NJ8A 4YRAA 4TKLA 1U3UA 3RASA 4AJEA 3IAHA 5I8WA 2HJRA 4DMLA 5TF4A 1NAHA 2B37A 1GFSA 3GEGA 4PLYA 1GYPA 2JFFA 2CUKA 3F5SA 4PLVA 4RPKA 1GU7A 3B6ZA 3QSGA 3I23A 1L1FA 3V8BA 2RH8A 3R3JA 3INGA 1ONNA 1ADBA 3V2UA 2UYYA 2C5EA 1ONPA 1GCUA 1SAYA 3HB5X 2AEMA 1RJWA 1Y8RA 2QRJA 2CMDA 2FPPA 3WGHA 5KKAA 3U4DA 2UUPA 1V0JA 2J5QA 1ZK3A 2GPTA 2Q2WA 5L95A 4D3DA 3KYCB 4DC1A 1LNQA 2CF6A 3SBOA 2EP5A 4FFRA 3OJOA 4CL3A 4M54A 4JJFA 1ISHA 3JQ9C 3DMTC 2AQHA 3KM0A 2WYVA 3PFWO 2YDYA 1P9LA 3DBRA 3K5PA 3P2YA 2VHZA 4PRKA 3MEQA 1LBEA 4GMGA 5EN4A 3HDQA 2IZ0A 1S6YA 5DBFA 4IMPA 3JQ8A 3MOIA 1L7DA 4PLHA 2EJVA 4IJKA 2O4CA 4E2ZA 2Y99A 1BTOA 4XA8A 3WQSB 2GZ1A 1LJ8A 1EEHA 1EMDA 2NTVA 4QECA 4BNFA 1DRUA 1KETA 4I8XA 1KVQA 4FS3A 2X8LA 5JC8A 2GZ3A 4MVJG 1YB4A 5JYDA 2ZJ0A 1OZAA 5JC1A 5CEEA 1O8CA 1GD1O 4OOEA 2Q46A 2P9CA 4FGWA 3ZV3A 1XA0A 4FIZA 1FXSA 1ZO8A 9LDBA 3UAGA 1HKUA 4TVOA 1DPGA 4OKIA 4IMRA 2VWGA 2WWRA 4LSMA 2PD4A 4J91A 3FNHA 5DULA 2NQ8A 5H81A 3K73O 2YJZA 1HEUA 1DIHA 2OMEA 3JQBC 2A35A 5THKA 2VRCA 5U1PA 3PQFA 4B3JA 5IJZA 4DPKA 3JTMA 3W8FA 4CM4B 4BKQA 4RLSA 3MJEA 3SEFA 5FFFA 4MIOA 4YJGA 1N92A 1XQ1A 2C5AA 1JKJA 3TOZA 2AQ8A 3GDOA 1X7DA 4Q3AA 1C3VA 1X15A 4A2CA 3L07A 4M8SA 3SXPA 3GT0A 1R4NA 3PHLA 2Q1SA 2J5RA 1IUKA 4M1QA 1MUUA 4NIMA 3ZNPA 3MTJA 2PA3A 4AJJA 4NZ9A 2VUUA 4B8WA 1T2AA 3GEMA 2WYUA 4A03A 1PGOA 4BNGA 1QR6A 1N5DA 4BV9A 4ALNA 5A02A 3NGXA 2FP4A 2HDHA 4GKBA 2EP7A 3TWOA 1D8AA 4IDFA 4YB8A 5TQVA 5F5NA 2YDXA 3I4FA 4OL9A 4PLZA 4Z0TA 5FWNA 5A04A 1YJQA 4GVLA 2J5KA 1ZXBA 1C0KA 1J0XO 4NBUA 3O4RA 2QW8A 2UVDA 4E32A 3TZCA 3HNPA 3O8QA 1XG5A 5U9CA 1A9YA 4U7WA 3RQSA 1MGOA 2HRBA 3KXDA 4P4NA 3ZDFA 3GEDA 3RAJA 5KWEA 4IZIA 3AFNA 4Q3CA 4BNLA 4O59O 1D1SA 4DYVA 4CV3A 4RPHA 2FN7A 3N58A 2D5AA 2QG4A 1LI4A 2NU8A 3HFGA 3VPSA 3IMFA 2HJSA 5FI5A 1NPYA 1JAXA 3NTQA 2GN9A 3FPCA 1SPXA 2VWHA 4AJ2A 3UUWA 1HDGO 2EKLA 3B1KA 3WWZA 2DPHA 4JJGA 2CDCA 3D64A 1I2BA 4L4RA 1ENZA 1HWYA 2PKQO 5A5EA 1UZNA 5IDYA 4XX0A 3ZU4A 3WX0A 4PGFA 3RJ9A 1XQ6A 4P38A 3M1AA 2VHXA 4N5MA 1VJ1A 4CM5A 3U9LA 3OIGA 4ZRMA 3PWZA 3VOSA 1MA0A 1M2WA 3RC1A 5DZSA 5GZ6A 4AFNA 4YJFA 3AUTA 3CE6A 2CF5A 4LVCA 3OJLA 3U49A 2AG8A 3UF0A 2XAAA 1U7HA 1GUFA 1EFLA 2PFGA 4O5OA 4QX6A 4XGNA 2DFDA 1SZJG 3WR5A 3WSVA 3AOEC 1H6AA 1HT0A 3WGTA 3U09A 4OKNA 4Z0HO 4BNMA 4RCVA 4RPJA 2C2XA 5JXWA 3PGJA 1CQJA 3KV3O 4DQVA 1PL8A 2DBRA 3PJFA 4R16A 4D0RA 4Z9XA 3IP1A 2Q2VA 5JO9A 3NYWA 3WNVA 3P5SA 2RIRA 4FBGA 1P1RA 2JKVA 1E7MA 4Z0PA 3QA9A 5EL0A 2YV1A 4OYRA 2CVOA 4IIVA 1WDLA 3WICA 2OORA 1JVSA 2IEDA 4GGPA 4N18A 4NDNE 5CPBA 3X2FA 1R12A 3Q9UA 5A3VA 1T1SA 3COSA 3C1AA 1H6CA 3H7AA 5ENVA 2CDAA 5JDIA 1SBYA 5L4SA 4LRTB 1U8XX 5K0ZA 2EGHA 4RQTA 1MC5A 4HBGA 4XRGA 2Q45A 4R54A 4HFMA 2EXXA 5JAZA 1T24A 2AQIA 2B4RO 4I5DA 4P4LA 2Y1DA 4RV9A 4UUMA 1MFZA 3ON5A 1XU9A 4IQGA 2WD7B 3KSDO 4B4WA 3C7AA 4Z6KA 3G79A 1FDUA 4WEOA 5TS3A 3VC7A 4ALLA 2XOXA 1TB4A 1YWGO 4R68A 2PWZA 1VJ0A 3FBTA 3C7DB 3HJAA 1R0KA 2DTDA 3I9OA 1AN9A 4M87A 1YH3A 3I9KA 1IZ0A 1BSVA 1N9GB 2I3GA 3MJSA 4TVBA 5JLAA 4DIBA 4A27A 5A3JA 3E5MA 1LLCA 4ZICA 4IPTA 1B8UA 1X0VA 2H1SA 5LC1A 4J0FA 2YYYA 1LSSA 1PEDA 1AXGA 4ALIA 5C7OO 2A94A 5JCJD 3UXYA 3HSKA 2BFPA 3KYCA 4YJDA 3ZWWA 1DC6A 3MJTA 1LLQA 4D45A 2D5CA 4MVJH 1NYTA 2YZ7A 3QIVA 4CM9D 1N1EA 3ENKA 3R3SA 4M55A 2PNFA 1G1AA 4JP3A 3FWNA 1K0UA 3E1KA 3VDQA 1LSUA 3AI3A 5CP8A 3UFXA 4KOAA 2B36A 2JHFA 2NQTA 1KEWA 4Q3NA 1UAYA 1IPFA 5TC4A 3JYLA 1MG5A 7MDHA 1QKIA 1LRKA 5ES3A 3IUSA 5T8KA 1R16A 5AYVA 3DHYA 4DQXA 5C5IA 3PYLA 1VI2A 3KLMX 1T26A 5HS6A 4A10A 3F6YA 3JQEA 3UICA 3PQEA 3OIDA 5IG2A 1ZUD1 5EPOA 5BNTA 4JK3A 4K28A 1U5AA 4NR0A 3VKUA 4CUZA 5CG1A 3KO8A 2QHXA 1L7EA 3BHJA 5TJ9A 3U3XA 5JY6A 2Q50A 3OQBA 3GUYA 1I24A 4E5YA 4OSOA 3KTDA 4H7PA 3ITDA 1DAOA 2FMUA 2IE0A 1QRRA 2IODA 3U4HA 3WJAA 4D44A 3FF4A 4QEDA 3ICCA 1UDBA 4Z9FA 2PR2A 1Z73A 1OOEA 5T67A 5MDHA 1TEHA 3F1LA 2RHCA 4JBHA 1EE2A 4H15A 3T4EA 4CM4A 5KVVA 2B69A 1J49A 2JL1A 3DB2A 4TZKA 4XJSA 4Y6SA 3RUHA 3JCZA 2NUAA 2EKPA 2O2SA 3L6DA 1V8BA 4E12A 3VZPA 4I08A 1Q7GA 1H93A 3CXRA 3G0OA 5I9MA 3QHAA 3E9MA 1W73A 1XCBA 3PIDA 3TSCA 3OA2A 1LDMA 1C0IA 4WOKA 5G2OA 4DYDA 4YR9A 4K9DA 2HU2A 3GMDA 3VH3A 4NBVA 1Y7TA 2RBEA 4NPCA 3LVFO 1DHRA 3GAZA 1YXMA 3PP8A 2C82A 2C7VA 2VCYA 3WFJA 1A72A 3EAGA 4E2YA 2NTNA 2R00A 4CMKA 4Z9YA 3CH6A 3AU8A 3TFQA 2IZZA 1IZ9A 5JAMA 2AMFA 4WLEA 1H0KA 1NTOA 1OBFO 4EZBA 4IUYA 4CR6A 1WPQA 2FSSA 3H9UA 1M66A 3P2OA 1RM0A 4B4OA 5IFLA 1PJ3A 3BMQB 3CTMA 3HUDA 4II2A 4W4TA 1NFQA 3ZNQA 4BNTA 3STHA 3DOJA 2RAFA 1QG6A 2RHRA 2XF8A 1ZIDA 1VL8A 3NV9A 2X1HA 2EEZA 1WZEA 1YE3A 1PSDA 1XR3A 3GVCA 4YAKA 2X0NA 5KIAA 3QWHA 3Q6IA 2HUNA 1NQOA 2X9VA 3C8MA 1NM5A 4NBTA 2V65A 4H16A 5FYDA 5C7LO 2ZB8A 1YQGA 4ONEA 5JY1A 2Y93A 2EW8A 4YAEA 3RJ5A 3SLKA 4BO0A 3KBOA 1JW9B 5H82A 1ENOA 4ZQGA 2XXJA 1M6WA 4OSPA 1K6JA 1UP7A 3DZBA 4BO3A 3L6OO 2DBVO 4XYBA 5BR7A
chains in the Genus database with same CATH superfamily
4NCKA 3BFXA 1E60A 2ACKA 2XFTA 4KQCA 1R6AA 3F90A 5E1BA 2PRZA 2IS2A 4GHLA 2WOOA 1IXKA 4FOPA 3KE8A 3PQ5A 3U9TA 1QQAA 4E30A 3C3JA 7ABPA 1U0JA 4UHCA 2ZIUB 5CT9A 1N7JA 1QIEA 1WCV1 4UAUA 1YQUA 1L7XA 1NURA 3L4BC 4MLDA 5HJEA 4DDVA 2XCSB 2C03A 3OCVA 4MCHA 1S2LA 3QE3A 2XECA 4D74A 2HREA 4U2KA 2UZ0A 3K1JA 1EDBA 2WD7A 2R6AA 4DL9A 2ZSDA 1OX4A 2NZXA 3G17A 4ZYTA 4ZREA 3TIXB 1B15A 4QTXA 1IE3A 1KEZA 3T1NA 1EP2B 3WYBA 5EQTA 2DTEA 1E2BA 5K0NA 5K6AC 5CTJA 5GP1A 2I0FA 2BH2A 2QX4A 1F0YA 3OVMA 4EUFA 3ADKA 3AU9A 3UAZA 3I5XA 3QEAZ 1NC1A 4O1MA 2JVIA 1R18A 2IFTA 4IWNA 2CVFA 4DSUA 3GPDG 1M7HA 3CVOA 3ZVMA 2GD0A 4KMOA 4JNCA 3TEMA 1NUHA 1KE2A 3ER6A 7REQB 1FFYA 3AHJA 3BL8A 3DE1X 2WEKA 1WKVA 1AKQA 3SEZA 1PVOA 5IS2A 3TSWA 4D9JA 3MRVA 2YQ5A 3DV2A 4Q39A 4L1KA 2RCYA 2GXAA 2OUKA 5KNDH 1NW5A 4L57A 4DLRA 4TTJA 4AMBA 1WPGA 3N5CA 3EULA 1DXQA 2OD9A 3A1TA 1NN3A 1Z0JA 4KO2S 5T8KC 4AMUA 1GGEA 4CHTA 5KYXA 2H63A 2VVTA 1M8KA 5DEIA 4R1MA 4LYFA 2VHCA 4US0R 4YCNA 2HKJA 2VHVA 1ZK1A 1K3TA 1ZOIA 3DAHA 5D5QA 3FCUB 1MD9A 1L3CA 3J7BA 1CUWA 2DLNA 4GPAA 1QIDA 5KTTA 2Z9CA 4RVCA 5A6SB 2AI1A 5DX8A 3C3PA 2PV7A 3EQ9A 3H1FA 1GV0A 4G1MB 1NAIA 5EZQA 3NT2A 4X44A 3AOGA 3OESA 1X1CA 4RHEA 4D99A 4B43A 4YCAA 5J4HA 4KLNA 3LPMA 1VG0B 1SUBA 1Z5UA 3C1OA 4HD8A 4HRAA 4Q93A 1YACA 1HDEA 4H08A 4DDKA 3ROFA 2DAGA 2VAVA 3VH2A 3MWDB 3FUXA 1CDOA 1XIVA 2I76A 2CMHA 2IYNA 2M6KA 4DJJA 1BO6A 1ZI9A 5L3SB 2VJQA 3AF6A 1KI3A 3H16A 1PQUA 2BGGA 1TJ4A 5I4CA 2MR9A 2Z6QA 5T4BA 2ZFUA 1EH5A 1DAFA 2GEVA 1WRBA 1UDCA 4FQ7A 3SVTA 1ST2A 4OQEA 3AJRA 5K99A 4I1RA 2AX4A 3U81A 3ET4A 1JR6A 3NCHA 5JZ9A 2PGXA 3W3AH 2RGUA 2Q3DA 1P0CA 4TKMA 4L8LA 4IVQA 4LXXA 5JBNA 3AT1A 2YXEA 2QTVA 1CEQA 5GPBA 5C5CA 4AS2A 2DWQA 3KUDA 3V8EA 3OFKA 5HE9A 1DZ3A 4F93B 1EEXB 3K0AA 4ZVVA 4QJ5A 3NMUF 3KD3A 4QQ8A 4JJZA 1RJGA 4YRRA 1M76A 1GV1A 4TUYF 5F21A 2G5TA 4R1TA 5HX7A 1VE5A 3OU7A 2KJQA 2XNJA 2WJPA 2E4VA 3H5RA 2G08A 1ZQ1A 4RMJA 1Q0LA 1T8PA 1Y5MA 5TS2A 1Z4IA 2AR0A 4YJ3A 5J1SB 4DYHA 4JI6M 4FEGA 4A2QA 2GBLA 4PF1A 4V03A 3R3WA 5ALMA 4P4TA 3LUBA 3A7EA 1MVNA 2PRYA 4D7AA 1D09A 4X65M 1VMEA 4HGRA 3II6X 1T6BY 1H8HD 3N70A 6REQB 4RY0A 3M2PA 2V55B 3CONA 2IS6A 2E4AA 3O2JA 1XMVA 2C4KA 2VXYA 2KNZA 4GIPA 1B3RA 1GSAA 2X5JO 4RYLA 3LT4A 4S05A 3LTNC 1UEJA 1TCAA 4REZA 3T12A 4ISBA 5K3AA 3N5KA 3W5CA 3R09A 5AP9A 4MW6A 2ZDQA 3JQFC 3D81A 4LOIA 4UFPA 2GVNA 1IM2A 2EJUA 4IXNA 4HAXA 2Q4EA 1I7NA 5B53A 721PA 3H6KA 3T6PA 3NONA 2JFNA 5KYNA 1W9HA 1MMFB 3RIYA 3U1TA 3SVZA 1ZH4A 2CFCA 2IEGA 4PGGA 2OEPA 4YMGA 1P5HA 2PQ6A 1KU0A 4BEWA 1MNQA 3KSAC 3EIQA 1JJAA 4P3YA 2CNKA 1IMOA 3NHWA 1AXRA 1NX6A 1R64A 3ZGNA 4QJ3A 2II6A 1E7RA 1JHUA 2V5AA 4GXNA 1J07A 1AKRA 1JLRA 5IHXA 3ZY6A 2OCAA 1PFGA 4GOLD 2ZTUA 6AT1A 3BFKA 1I9CA 3QVOA 2ZT5A 1V35A 4FK8A 1XEAA 4BLUA 4ZQEA 1M3SA 1VIYA 1YSCA 3HWRA 2JGKA 1GAJA 4CVNA 1YD7A 4WZBB 5G4LA 4D0SA 2JJMA 4R31A 4F92B 4LJRA 1BJRE 1RNLA 3KUXA 4FCVA 3QAUA 5CYPA 3D0KA 1DO0A 1XRSB 4WOPA 3CR3C 2OAP1 2HSDA 3Q4GA 3GI1A 5KU7A 4BMCA 2WWXA 4IGIA 1V5WA 3ZCQA 3ZTWA 1C9MA 1GG8A 4TRRA 4MRNA 3RYIB 1Y1SA 2IEAA 2PPLA 2P9TA 2PWYA 1CE8A 4EABA 1I1HA 4G84A 3AP3A 1ADJA 1G8KA 3TXXA 1XMSA 2GB4A 4CTKA 2L82A 2D7EA 5CAEA 4ZFNA 1C30B 1Q95A 1E2NA 2FV8A 5CVTA 4X85A 3EG9B 2J7PA 3EW9A 4ER3A 2J3QA 2OFXA 1UKEA 5B2EA 1EG2A 2BONA 2OORC 1MRZA 4PG4A 3HS3A 4B80A 5FXMA 1J24A 1JN0A 4QFMA 1X7HA 3MNFA 4PNPA 4BB6A 4KXUA 2BZSA 5KO2A 4L5IA 4S0ZA 2HK7A 1ZD1A 4U2EA 3KOMA 4JXJA 4WBNF 1A3CA 4KQIA 3VNBA 4HNTA 5EOVA 3BOSA 2BFAA 1Z63A 3KOOA 2KE5A 4C2BA 4HGOA 3MTGA 3FMOB 1PUJA 4LXUA 5C7IO 3OP1A 2XT9A 1O54A 2HNBA 2D1QA 3IE1A 4RJIA 3KKKA 4C0LA 1JF8A 4N3BA 3WWDA 2YMPA 1GDHA 1G3UA 4LX0A 2YZ2A 4R4JA 4WNAB 1TECE 5CX4A 5K8IA 2IY8A 4I5FA 5K8LA 4M46A 5TRTA 5CBKA 3G7SA 1QYIA 2Q3EA 1V8ZA 3WO1A 5G1PA 3Q7QA 5KNBH 1U65A 4BZQA 4RM3A 5B3JA 5EWLA 5D3KA 4WNIA 1Z5PA 4M4SA 4IHJF 3HE3A 1VEGA 3OM9A 4CV1A 2VYQA 4R0NA 4KWTA 2NU9B 1O6ZA 1DT5A 3MBKA 3KR2A 3CPSA 1ZS9A 1XLUA 4Q1BA 4IIBA 3UATA 4HFRA 1QTNA 4PANA 4W7HA 1KO7A 2IX9A 3DAYA 4DWOA 5G0VA 4XAQA 3IO5A 4GZ3A 1HFKA 4JELA 4L8FA 4FDUA 5I7HA 3EZ6A 1VHWA 3PEWA 2WKSA 5FTJA 1OXKB 2V7QA 3S2GA 2HAKA 5B5SA 2YWDA 1YZVA 3DGEC 2G80A 3PT5A 3ZNNA 2OB1A 3PPIA 3ZI0A 4PHTA 4C4YA 3MSXA 3ZEIA 1RWXA 3A1DA 3LP6A 1T36B 2AXQA 3NHKA 1EVIA 1M2OA 3OQVA 2IC5A 2ODWA 3E5RA 2X40A 3S27A 4ZOQI 2VBCA 5IZCA 1QONA 1USKA 3ADPA 4PYNA 3SLRA 3PDJA 2C4VA 2NT3A 4YP6A 5H5JA 1P0FA 1RFGE 1VP3A 1V95A 4K7JA 1JR2A 2WIGA 3ORFA 3ZV5A 4RH0A 2B4TO 2BOVA 2JLXA 3U7RA 3L9XA 4O1HA 2BFFB 1ULUA 1ZZGA 4H7EA 1SUAA 1E4EB 4CNBA 1XPOA 2F1JA 3FZGA 3PGXA 1OFVA 3AZQA 2KMLA 4GZ5A 3I51A 2XUZA 2ZPAA 1RHKA 2PGLA 5DT9A 5G1OA 3ZUPA 4TYPA 3K0FA 3WNBA 3ZHQA 3GLFB 1KQNA 3CUSA 2HU5A 3DMFA 3RWOA 3GVPA 3FCAA 2AR7A 4GICA 1G63A 3QHPA 3D0QA 1G6KA 3VZDA 3S68A 1W9MA 3ESXA 4FXOA 4D9NA 1IUOA 4JX8A 2VT2A 1D1PA 4FQ8A 3C70A 1NVTA 1VE7A 2DAEA 2VXOA 5CNJA 5LD2B 2GZ2A 2WR8A 3G2HA 2R6JA 3V7UA 3H2IA 1SVMA 5HFNA 4DIOA 1ULAA 3JQBA 4G1CA 5I9LA 1PZFA 1D2NA 1NF2A 2EX1A 3U60A 4A6XA 1USVA 3HZRA 1FE8A 4N8EA 4EPXA 1PTJC 4KQMA 1M2FA 4FGJA 4L6IA 1NJ2A 1JR3A 4TLAA 3W5BA 3PUYA 3DBOB 4NAHA 4WGGA 1N8NA 1TUBA 4LGCA 1OU0A 2FB9A 4BAGA 3L25A 3RYHA 4TYNA 1NULA 4X90A 2VSNA 4J1TA 1DIAA 2DKNA 3PXDA 4KFTA 4INJA 3IVRA 2R47A 1JTEA 1SVOA 4QXOA 5C32A 3RYCB 2MMGA 3WFZA 3QBTA 1NQWA 1SVWA 2AFIE 2QI9F 2XKKA 1ZU5A 1LV8A 4YJ2A 4UPVA 1DUIA 3I12A 1GARA 1ODTC 3P9SA 1ZM9A 2IE8A 1JKJB 2NZYA 3F6RA 4GHWA 2RAPA 2OFFA 2OCKA 3BIWA 3RU7A 3BREA 1KHTA 1Q2XA 1U1IA 3L7JA 2R1VB 1Q91A 3KLPX 1QV7A 4QWMA 5BVGA 1HLDA 4R3WA 3ZCBB 1HY3A 1PCXA 1GZUA 3ZBQA 1RJDA 4AZVA 5ALIA 3HJSA 4IXWA 3ZCVA 1BS9A 2VZ0A 4B3DA 5IVIA 2B4QA 3RRNA 4S2EA 1BRMA 2P6NA 3OPYI 4F06A 3L9WA 2F8SA 4XX0B 3UV6A 3VH4A 2IDKA 3D8UA 4HUTA 4HX9A 4IICA 2VT7A 4MWEA 1PM5A 1POXA 2FSUA 3SBXA 3IP8A 1JIUA 2UXDB 5EHGA 1W5FA 2OILA 1EIJA 5CT4A 2G36A 1NWHA 1UJBA 5H37D 1R8QA 5ICMA 4ENWA 3FWYA 3IO3A 1QF7A 5EQFA 1FUUA 5ELMA 2PD6A 1SFRA 1FDSA 3KFVA 2QAGC 3KU1A 5EINA 1GLVA 3ESCA 4ENSA 4EJ2A 3TGLA 3GD5A 3IT2A 4D8XA 2ZXFA 4TUYB 2ZT6A 2VBGA 5IJXA 3TEJA 1SEVA 4PZZA 1NV8A 4MYCA 2ACWA 4W5QA 1U3UA 3D3KA 3UBTA 2PPVA 4MV6A 4W6QA 1T34A 3U6MA 4UARA 3DV0A 4GU5A 2IXGA 3SGLA 5BXYA 1H2EA 3BWBA 2QRJA 1SR8A 2XCQA 5JRZA 4IEFB 4YAWA 1RP1A 3GP5A 1FNMA 5LUBA 2IBTA 3UKDA 2FCAA 4RTPA 1Z83A 3PEYA 3D02A 3GQ4A 4FI3C 4BNFA 4RFSA 1G7TA 4KKVA 1L2TA 4EA7A 4ODIA 5JC1A 3RHFA 5EKUA 5SY4A 3UHFA 2UU9B 5DULA 1IVYA 3K73O 1P62B 1J0AA 4Q9JA 1NZDA 3DLAA 3MJEA 4YI5A 1WTCA 5FFFA 2R8EA 1C4OA 1VB3A 2BZ1A 3TCNA 1ZJWA 2GXUA 1KEEA 2R4UA 2XZFA 2WYHA 4NIMA 2FZKA 4NY1A 2QVLA 4TQ9A 1N5DA 1XNJA 4HZUB 1D8AA 3IQFA 1S96A 5TQVA 4PZLA 3AGPA 2NUBA 5DHFA 2FUG1 2F5PA 1N0UA 2HRBA 2JFPA 4ZAWA 5IUNC 4RKYA 2VSQA 4D9FA 2F7SA 3TUJC 5K3FB 3VX3A 2D5AA 2QG4A 2KRKA 2GJAA 3NTQA 3AKDA 1CY0A 1GA4A 3UUWA 2QRUA 1I2BA 5IDYA 2NXEA 2HW8A 2RIPA 4RK1A 1P3JA 2H54A 1GUFA 1EFLA 2QTTA 3Q5EA 3WSVA 4G0PA 2G77B 2BWJA 1HE8B 2P3OA 1NTRA 1PL8A 5BMVF 3IRVA 4AWBA 1WQ1R 4Z4FA 2RIRA 3U16A 3PFHA 5EGSA 4IIVA 4DBLC 4ZCQA 3ZJ5A 4KSYA 7YASA 4G0XA 4C06A 1W5SA 4XVCA 4OW0A 4LRTB 5K0ZA 1JG1A 1MC5A 1V16A 4FMPA 4XRGA 4LDJA 3FB1A 1GJTA 2O8BB 2NX2A 4B76A 4MPTA 1PQ4A 3M8KA 1VE1A 3KQHA 4QJ4A 4HH4A 1XDDA 3RARA 1YH3A 4A92A 2ZRQA 1N9GB 2I3GA 2NUTB 1Q5PA 5JLAA 1KSFX 3BKXA 1X0VA 3GO8A 1Z88A 4IIHA 1FSPA 2YC2C 3E1GA 3C6QA 4G56A 3IUEA 3LYUA 1TJ3A 1DOAA 4OP3A 1N1EA 1NBWB 3HVKA 3N2ZB 1ITZA 3LL7A 2VHTA 1QKJA 1S1MA 5FHRA 1QKIA 4K9NA 2CRUA 3JQEA 2BFDB 4WN3A 5CG1A 3BHJA 5TJ9A 3ZJYA 1IHPA 3GUYA 1FVFA 4JKIA 3U4HA 3ICCA 4WBNB 4XGRA 3BK1A 2PVPA 4RBNA 1Y48E 3JCZA 1ORYB 5DM1A 5FBWB 4AQYB 3TLBA 3L6DA 4HAYA 4J0QA 3HKDA 2QF7A 2OCPA 5BV0A 4UMDA 3N7AA 3L41A 1TC2A 4NPCA 2QCUA 1ZA1A 2Q3CA 5FWYA 4HS4A 3EAGA 4KQ2A 5F64A 4ARSA 5AKZA 1NUAA 4G67A 2AMFA 2QG6A 1NTOA 3B1XA 1PLKA 2MINB 4OJTA 4AIRA 1E64A 3K9PA 2Q5LA 3DCIA 1M5UA 3KC2A 2J48A 4JHLA 1ZIDA 3UGQA 3T3MB 4U6NA 5FYDA 2QL9A 1LTMA 3CLSD 1IC6A 2O8DA 2XE4A 4KYVA 2XGJA 2P7IA 1UM9B 4IHJB 2C98A 4RW0A 3OF3A 1W36C 4U7TB 4WDRA 3CN7A 3BXXA 4EVIA 3H13A 4IDHA 4MVJE 5JEEA 5F78A 1TGVA 1E5DA 4XH9B 5LLTA 4C01A 2FP4B 3J27B 1IRXA 2XY4A 1G7CA 4I9GA 1GQYA 2X4DA 1PJQA 1L4FA 4TRNA 3TTYA 1XYGA 1KR5A 4Y2JA 3NWPA 1HF3A 4S1TA 4M1ZA 3C7TA 2O5RA 2D0PB 5PNTA 4WECA 4R51A 4B44A 1Y3HA 1X7WA 5I9IA 1BH2A 4D8VA 2RONA 2CCJA 1TQDA 2NYVA 2OFPA 2FFAA 4I55F 4Q1CA 2JGDB 3ZWPA 4E6PA 4P4SB 2APJA 2NSDA 3ZWOA 3FRIA 5JU6A 5ICFA 2VIIA 1RE1A 4IDDA 3P19A 2FQYA 5LIRA 1ZM2A 5DHQA 3PNLA 1AV7A 4B7HA 5CEFA 3I9NA 4BMXA 2PT5A 1X8KA 3QX9A 5FBHA 5FLXA 2VQSA 1NVDA 4N47A 2ZB2A 1ZV1A 1T4DA 4M6WB 5LLSA 4HQLA 1JYEA 1E1RD 4KHZA 2WSYB 4ENPA 2G9UA 1XRPA 4WXPA 5LP6A 4LF8M 3E3AA 3KTOA 4FOLA 4GPD1 4ZOLA 2HM7A 1U7TA 4MQBA 5JD5A 1EUDA 1O4VA 3ZTTA 2CLFB 2L2QA 3FOBA 3GVIA 1JFLA 1WB4A 4RA9B 4U7DA 5IBRA 4U6SA 5IDXA 1I1NA 5LBTA 2HJ9A 3HJFA 2C7GA 4DCJA 1DAMA 4BN5A 3G8AA 4QBGB 4PC7A 3G2PA 4DV4M 4FMDF 2CV0A 3Q6NA 1QQBA 2FPIA 2ZSJA 3ZZNA 1I4TD 1M1NA 3EXG2 2F4NA 3MAAC 4UDYX 1X3SA 2FGKA 2PH5A 4X7BA 4DLVA 4QNRA 1HZJA 1I3LA 4IRUB 1E9SA 4A1OA 2A5FA 4X8MA 1KKUA 2QVYX 4HFJA 2DWZB 4L78A 4M86A 1QX3A 2A78A 2ON6A 2GPAA 2OA0A 3Q0EA 3HEBA 5E9WA 5JZOA 3TW0A 2D74A 1PFYA 3ISJA 5EIFA 3TZHA 4BNWA 3PNQA 3H9GA 3G89A 2J7PD 2HWXA 2JHGA 1WLSA 4E0BA 1ZY2A 4LYEA 2OSVA 3RIXA 4F0JA 3IQEA 3GRUA 2BHRA 4DV0B 4B2PA 3X3HA 3GZNA 2J7NA 4D02A 2Q7DA 2J9FA 3C0KA 3T3NA 4Q4JA 2N75A 2QSYA 1YI0A 3L40A 3AILA 5H80A 3I4VA 2FDCA 3D59A 1HZZA 3BMCB 3AESB 5CB6A 4CIZA 3EGXA 4L6CA 1U2DC 4HNAA 1G3MA 3L0IB 1XRRA 2FLVA 4ZALA 1UJ5A 4S0XA 4NBLA 3QF7A 4NBWA 4EW3A 3L8ZA 3HB9A 1GUYA 3ICWA 3WMRA 4IMJB 4G97A 3HBLA 5KHOC 5IULC 2AFRA 5TT1A 5CLIA 821PA 2G5CA 4RELA 4M7PA 5DFAA 3CU5A 5H8WA 2BTQA 3HY5A 1N5LA 4HYQA 2NP6A 1KU6A 6GPBA 3UMFA 4DUYM 3L8DA 3HHPA 3E61A 1R0YA 2B5OA 4B3MM 1Q0HA 4UFOA 3O1JC 1SXIA 4OBEA 1AKMA 3HDHA 1JZQA 3CLHA 5FPHA 2GJ8A 5EUQB 1VGRA 2QN2A 5G0UA 2UZ4A 2CT8A 3QVGA 4BRSA 3ICQB 1ZOOA 4QOSA 2GX6A 2HTEA 3R4VA 2OXRA 2JCYA 4RD2A 1D6JA 5BYJA 4QOZC 4DRYA 3K6SA 1ADGA 2V7QD 2HRZA 1WV0A 2B6HA 2W22A 1DO8A 3EGVA 3JAKA 3ZHSA 1C1XA 1PHPA 4E5MA 4F5WA 1LBTA 3T5CA 3PHHA 5E9JA 4BP3A 1C4WA 3RRJA 1C8LA 3FH0A 4BGVA 1I30A 4H35A 4HDCA 4HY3A 3ZVLA 1WP4A 3CMCO 2H9AA 1PJSA 1Y8CA 2B25A 1JUDA 2FU5C 2LWXA 3E22B 1R4AA 2L6OA 2EFYA 3H9JA 5CB0A 1IBRA 2JCXA 4HDRB 4RIEA 1H9AA 2QX8A 2O5CA 1F0PA 4DOMA 3GCWA 3VU1A 3HH8A 1A1VA 3LZCA 4RK4A 1ZGCA 2I6FA 3DPIA 4Z4IA 1FYDA 3L84A 4KLAA 1N6IA 1S2OA 3LU1A 4URZR 3C8DA 3D5QA 5HUHA 4B79A 3CO0S 2ZYSA 2AZDA 1II0A 5CXXA 3GRKA 3S2YA 3E27A 3UJBA 3W9SA 3IBTA 1Q1NA 1VSBA 3OZTA 2RJNA 1E4OA 2OOSA 4HRYA 3AB3A 1RTKA 2QOEA 2AJTA 1E2EA 1TQHA 3ZIDA 3SEQA 2VHWA 5A05A 3DGFC 1ISGA 5AWFC 2DZLA 1QGED 1YOVA 3ZIAA 4MP8A 1ULHA 5BURA 3BHIA 4ZVPA 4LXGA 4ITUA 1ZUIA 4MGIR 1U98A 1Z2EA 1L5VA 1SZCA 2E4WA 2OAQ1 4LGMA 2G04A 2QZPA 2IXAA 1J1UA 3P0JA 3MILA 1JP7A 4HUJA 1GLNA 2JH9A 1PS9A 3CLRD 4B83A 4IQ4A 4KP7A 1XZLA 3M6XA 2QXTA 2JIZA 1JR3D 5EPUA 4YDQA 2WD8A 4R7GA 3M1LA 1NVWQ 3F4BA 2EF1A 4EY8A 4AP5A 1QCDA 3VDMA 1E62A 5CYGA 3VGJA 1EE8A 1VP9A 3OWXA 2XQVA 5BMVB 3VYUB 1ZP6A 1EWRA 3S2IA 1Q1EA 5I9NA 5LLDA 1AHIA 1TC1A 4MDEA 1N1GA 3VKVA 3NIBA 3PUKA 5HGJA 4WK2B 4W1QA 1XTZA 4LDAA 1Y1TA 1OAOC 5FJIA 2QAJA 4TWAA 4Y6PA 3U0BA 2GM5A 3VYTB 1NLZA 521PA 4BUJA 2BUCA 2VEDA 2Z6AA 4ESVA 3ZXSA 4ZT7A 2EZ4A 3OY7A 3OBIA 4ZKDA 4DG8A 3HYCA 3VGPA 1FF9A 1SA0B 2L09A 1FP2A 4DHEA 1YQDA 5F35A 2DVMA 3D5TA 3WBBA 2LVBA 4PIVA 3F3SA 4KKXB 1AGYA 4A0RA 2HQ1A 1U28A 2H4WA 4O3MA 1ZJYA 4B85A 4NOOB 3LUJA 2VQEB 2X49A 1LC3A 3LFHA 4FGZA 3R4CA 1C9KA 3ONEA 1I0IA 4XFKA 1PYDA 3RFCA 4DCNA 1R3UA 2VS1A 2W00A 2RGNA 4FOOA 5BSMA 4I1YA 1KEPA 4D4GA 1QRTA 4MI9A 3RU3A 1JSRA 1NATA 4G0MA 1PJJA 3UM9A 5A0VA 2LH0A 1AJEA 4BS9A 3TD2A 4E1AA 1JWBB 3T5AA 4NXNB 2UDPA 3CG0A 1X7YA 4UM7A 3N59A 3T54A 4L2IA 5FOTA 2BGLA 5FI0B 1RYNA 1K9VF 3MMSA 2PUJA 3UUGA 1A9XB 4OXQA 4GM1A 5JSFA 5CGZA 3QVSA 2JXNA 3CF4A 4JXZA 4EX6A 2VK2A 4PPFA 4F3CA 2NVUB 3VPDA 2FW6A 5FOXA 1XJWA 2OESA 3O9VA 4RVNA 4O4HF 3BG5A 1X92A 5I7FA 2P90A 2LR0A 1TKBA 3ZHBA 2KLHA 1GL9B 2MYPA 1I32A 4O4LA 2JARA 2AFIA 2HHJA 3ZZ1A 4OGLA 4EZEA 4YAIA 1AT1A 2XYPA 1TO1E 2IOFA 2FFBA 4GOOD 2IUSA 5J2TA 1S3IA 5CH3A 3WADA 4ZZIA 1OLXB 1ZCAA 3RTBA 5B1EA 4WXHA 4UULA 1RQXA 5C4MA 3EPRA 3PZBA 4OB7A 2Q4BA 3IR7A 4I55B 5ADVA 2UKDA 2QTGA 1QRDA 3ZXIA 3OIFA 2DG2A 1L1QA 3GLHA 4IFTA 4Z7NB 5IBPA 5HWSA 4OHBA 3U13A 1E1CA 4EW6A 3LKZA 4AJNA 2NP7A 3NWJA 3G3EA 3PC8C 4DR5B 2AXPA 4YR7A 1TM4E 1CJBA 1TI7A 2WA1A 3B2EA 4FGUA 4H3SA 4E13A 2ZEJA 4RDHA 5L7TA 1Z7YA 1SWWA 3R7WA 5EGNA 3FCOA 1DG1G 1XEFA 2C78A 1M2GA 1IB6A 3ZV7A 3VO8A 3PE6A 2ZCUA 2C97A 1COZA 3QUCA 5MGNA 5KSWB 2JFYA 3UANA 2VSXA 2BMEA 1U0NA 2Q2QA 3OZXA 4WKOA 4P0TA 3ZE8A 2AQKA 3PG5A 1BWQA 3KLNA 4N8DA 4Z4QA 2OZLA 2I1QA 5ICCA 3PUZA 2VA8A 2NLOA 1WY5A 1X7XA 3BGIA 1EFTA 3RIGA 2PL9A 3VKGA 5GADl 4DR1B 3IG8A 2HQBA 3O8RA 4XUEA 3WB2A 1NW9B 4GAEA 3F8WA 3OE7A 2GN0A 1QP0A 2GEJA 2IWHA 3REFA 3NEJA 2E48A 5DTJA 2IVFA 4FMDB 4D4MA 1DX4A 3DLHA 2AOXA 3GFOA 1DGQA 3EBOA 4MW0A 1SZDA 5KQLA 3K70B 2PG3A 1T0BA 1HLFA 4BNIA 4M37A 3MUNA 5FA5A 1F5SA 2FWJA 1T3HA 2B30A 4UBNA 4DWVA 4Y2XA 1B0AA 2W93A 3HKCA 3FPFA 2OVBA 1CYDA 3DVSX 4QUKA 3GG2A 2VH2A 3QRWA 4UDXX 3VPHA 3HWX1 3TLKA 3EZXA 1X19A 4ZHSA 5CU7A 5BQ5A 5ALRA 4E88A 5ALSA 1W94A 5EJ5A 4YCLA 3ICEA 2BEVA 2X9NA 2LVAA 1U4SA 4L0MA 4OGGA 1GTRA 3IL2A 1JG6A 4H7IA 5A0TA 3IG5A 1YBAA 5REQA 5J43A 1W44A 4QU5A 1NYQA 4EVSA 1GQOA 5DCYA 3AQ4A 3NHLA 2FJ0A 4F38A 2GTPA 4R5HA 1BXGA 1ULSA 1MV8A 4UREA 3FDJA 1W52X 2P9ZA 3VU8A 1EK6A 3GGDA 4C0AC 1M2OB 2PZGA 1KFCB 4Y9DA 5FDFA 1TF2A 3EXHC 3U3OA 4EPTA 5K3OA 3VAZA 1IBSA 1MDFA 3WLJA 4CEIB 3GT4A 3SC2A 3PNYA 1FXWF 2CP8A 5F33A 1VIMA 4FBLA 1IOVA 4JSYA 2C20A 3PXEA 5IRCD 2BFEB 5E6SA 5BQFA 4YAUA 1HV8A 2O3JA 3B6JA 2H2IA 2VP0A 4Z9AA 4G4OA 1WZCA 2JLAA 1Z22A 4B31A 4HC4A 4JUDX 5DBHX 3STXA 1OU4A 2C4UA 3RKRA 3RQIA 4C4XA 5LP6F 4IFBA 3PFFA 3SARA 5IMSA 2PEYA 2XUIA 1A5TA 2HYDA 3QMWA 4JI7B 2XV1A 5EAIA 3F5SA 1HRKA 4RF1A 4FKMA 2OYRA 3R3JA 3INGA 4EYGA 1ONPA 3U4DA 3IPLA 2EP5A 1BA3A 2R87A 4JI8B 4Q6BA 3RADC 3WV4A 2H0QA 3GJQA 4UATA 1N6KA 1CRPA 1KBQA 1NA5A 4KT0F 3L05A 2NTVA 5HKOA 1DRUA 3JVUA 4FS3A 5JC8A 5CCBA 1QO0A 1XNGA 1GD1O 3SYMA 2ZRKA 1B6RA 1ZO8A 3ZDZB 4UW9A 3KS9A 4RPIA 4LJ6A 5C8VA 1Y1QA 2ORED 2PSJA 1T5TA 2YJZA 5LMNB 4RACA 1EWKA 3SEFA 1D9XA 1N92A 4BN4A 1U3GA 4IKPA 1QCCA 2QN1A 4JEHA 1X7DA 2ECKA 4P31A 1AMOA 2NO9A 2OCBA 3OZGA 3SFVA 3AEKB 3KYJB 1MAHA 4A03A 1XVUA 3RYHB 3TWOA 1Y1KE 3SXUB 1K98A 5A04A 2JI8A 3L0YA 1A9YA 3DLBA 4LE0A 5ICEA 2Z8ZA 3V7WA 3R7AA 2AC7A 3R9KA 1QHGA 4TKVB 4ACBA 2OECA 3SOZA 5F4ZA 2P35A 4KVAA 4BP1A 3PCXA 5EXEA 2J0QA 2YXNA 1VJ1A 3TIVA 3OIGA 4ZRMA 4JJEA 4ND7A 2OGWA 3ZD9A 3I62A 4DLNA 3S8YA 3OE1A 4X84A 2I7VA 3NKVA 2C2ZA 3L6BA 1KL7A 1V3QE 4OKNA 2H48A 3THWA 3K9GA 3STTA 4BIMA 3TR0A 4HH0A 3WLMA 4YRJA 1GKYA 3P5SA 1YB6A 4FBGA 4QT4A 2IH2A 3MGCA 2X42A 2JRCA 3WICA 2K0BX 2QQEA 1JI0A 1Z12A 2X3UA 2HJVA 1C3XA 1EIWA 5M34A 3KG2A 3WLNA 1OT3A 2JHPA 4MRSA 2EXXA 3FFWA 2B4RO 3G9UA 3C3EA 3VAAA 4UUMA 3D6JA 2QTRA 4PBSA 2XR1A 2WFAA 2QD2A 5D84A 4D2IA 1FLDA 3RS9A 1Q3HA 1DBIA 1B8NA 3EQZA 2ZRFA 4UJ3A 3LSTA 2A94A 3HSKA 2Z83A 2Z8XA 2DENA 2B4YA 4YJDA 3Q7IA 2XB4A 3ZY2A 2HT6A 2D5CA 2ZVPX 4KGXA 3QIVA 2QR3A 3DA1A 1PG5A 3OZSA 3BZWA 1L4UA 3NM6B 5ERYA 3BXPA 3P20A 4EVQA 5D2CA 1KORA 3PYLA 1Q6ZA 3DVRX 3UQYS 3LY8A 1SQFA 5EFOA 4CUZA 1N34B 2UUCB 4AWAA 4LZJA 4H7PA 1MOQA 1PR1A 4MYHA 3ZCRA 2YWHA 2IP4A 1WO8A 1PR5A 3B6MA 1TEHA 1K3XA 1UL1X 2VHJA 3ONVA 4H15A 2C5LA 4TPKA 4BZPA 2RHBA 2OV3A 3UY4A 5BR1A 4GR4A 4TMWA 4A8JB 2LHCA 5KMGA 4I1VA 1XCBA 2QNBA 3P0FA 4ADSG 3EF3A 5BN3B 3CV3A 4ZDIA 3WFJA 5J47A 4QBFA 3IUMA 4K2HA 2ZM6B 2MJLA 4H7JA 3LUKA 1IJBA 3A27A 3OFNA 4NSNA 4OU4A 5LMCA 1IBKB 1M66A 2ZJ5A 4FFVA 2RAFA 3S6JA 3M33A 1AD2A 4BNDB 2OM6A 3NV9A 1YE3A 4YAKA 3QWHA 2BEUA 5BN5A 5IANA 2BMFA 4G4NA 2WFZA 1BN7A 4BZWA 5EC8A 1UP7A 4QLBA 3TQCA 4MUAA 1CUKA 4PYIA 1KZ7B 4D9GA 1E1RA 5KWJA 4Y1RA 5KREA 2GZRA 5AW3A 2C4NA 4RADA 1GABA 1M74A 2GLXA 1Z0DA 2BC9A 1PT5A 5BVHB 2MHCA 4F9GA 1L4EA 3K96A 3UTCA 1S2MA 5DGIA 4E5SA 5DIFA 1E77A 3ITNA 3PDUA 1HNWB 3JD4A 1BOOA 1Z37A 5CURA 5BRNA 4RY9A 5EE1A 1LRJA 5CK5A 2YBDA 3QGMA 4WFIA 4ND4A 3VVCA 1VFPA 1H23A 2WHPB 4O4HB 4BMZA 3F7MA 4DLUA 2R751 1YL5A 4G0YA 1NE2A 3SK0A 1B42A 1MJGM 4LF6B 4QVKA 1HBJA 2BCEA 2Q2NA 5L3QB 2WT8A 4PO9A 4QYSA 4OUKX 4PQRA 3IMEA 2IXBA 1QHYA 4OQMA 1GQFA 3SM9A 3HZZA 5AD1A 1E9BA 3C98A 4EA6A 2HBQA 1L4HA 1N2XA 3A1NA 3QE9Y 1QYVA 5M29A 1DQZA 2REQA 2P0YA 4KWHA 4O8CA 5EIXA 3IXMA 2Z4TA 4F5YA 3D4LA 4BO6A 5KPZA 2WMYA 2R45A 3W06A 4NYJQ 2DHQA 2X0IA 4KE6A 1QJCA 4CKEB 3I3OA 2CHQA 4KBGA 3ZIAD 5TARA 3BRQA 4UU0A 2R6CA 2ZB3A 4KUEA 1R5BA 1VZ3A 3K9QO 1XTIA 4ZCPA 3U26A 3M6IA 4R3NA 4YP7A 1I2CA 3CX3A 4G5XA 2W83A 3F8TA 1VDLA 3FY4A 4CCWA 1SXHA 3GZTB 1FU8A 4GEKA 1GJSA 1G8HA 3KXKA 1A5SB 4ZVQA 1V5FA 4WOCA 2ET6A 3OX1A 3GOQA 2FEOA 2Y0EA 3UB3A 3TLCA 3H5IA 3OMWA 5FNVA 4ZEVA 2DC1A 2OCLA 5MFZA 3IESA 3A1FA 1QKKA 1CF4A 1R5JA 3CJTA 4B6RA 4DZTA 2JIZD 4PFKA 3O1IC 5J4VA 5BV8A 4K9RA 2CBZA 4ZZ0A 3CRNA 4ILEA 2Q4OA 4TTTS 1R50A 4JOQA 3TLAA 1O7JA 2XMPA 4HLCA 2RKWA 3SQMA 4L4XA 5EIEA 2VEOA 1J0EA 4F7WA 4II3A 3FFAA 1Q2UA 4MVYA 1QTIA 2JKYA 3V8RA 2B98A 3T7KA 1NFRA 1G5PA 3NHFA 2Q5CA 1REQA 1LDYA 3O1HB 4QUHA 2A33A 5LZ2A 5INTA 4TZ0A 4RKRA 3G9QA 1SBCA 4QOFA 4ZVRA 2BI7A 4E1VA 2Q62A 4N7RA 1LBIA 3DE5X 3WYGA 4RZQA 3E7WA 3IV7A 3GUCA 5DGXA 3ONDA 4R83A 4OPMA 5IDQA 3OI7A 3SQWA 1DGHA 1I2AA 2Q4DA 3TD6A 5CK4A 4OLHA 3CX7A 5JJCA 3EQ7A 1Y8GA 4ZRNA 4EHKA 3ZBPA 7GPBA 1L8QA 3WLOA 2Q9CA 4Q34A 2HO5A 4LGYA 1WXHA 1TKCA 2ZYUX 3EFEA 2HCRA 1ZUNA 4CLRB 2C99A 1ODLA 1QVRA 1FA9A 3UYKA 3TFOA 1NLUA 3WNZA 1FSSA 1T2DA 5K3BA 1I3MA 2CEKA 3KZKA 4UBOA 1SBZA 4W8GA 1RKXA 5KTNA 3UMBA 3FWHA 1AQNA 4U5QA 4XPIA 3CWQA 1M73E 3L7YA 1N2BA 3ZGZA 3BQNB 2HHAA 1FU4A 4M36A 1ISMA 4LSWA 4ZTBA 4PFJA 1YKFA 3THYA 3HBJA 1MFPA 1OAAA 3USCS 3HCAA 1E7SA 4UMVA 4LYAA 3BE6A 1BCSB 2AOTB 5IJWA 4K9OA 4B7ZA 1GVNA 3K9BA 2IYLD 3RVRA 2UXDM 5T4FA 1E0DA 3JQ9A 3D3JA 4J3FA 2E21A 2D7CA 1U9CA 4HX5A 3N28A 2DSNA 3HLTA 4HAUA 5E38A 5DYWA 3WQHA 4HDKA 1JAZA 4R2IA 2HMWA 3KSZO 3DVAB 2PX3A 3CJQA 4IS2A 2FVXA 3VDUA 5F77A 2FJPA 4J4TA 5GV7A 2YMQA 4YRTA 3M5PA 4C7BA 3NBXX 3PNVA 5AJVB 1C5KA 3WRVA 2P3LA 2YXPX 4A3SA 3QU7A 3HCPA 4LXIA 3W5UA 4U7FA 3B7NA 2FWPA 3ONFA 3GRVA 2C2WA 3WY9A 4YUYA 3UVEA 1WCYA 5DCUA 1V11A 3UO8B 3R40A 2W4MA 2PLWA 4X64B 4PGHA 4OHVA 2BGWA 2XBLA 1M1NB 2CMGA 1ZONA 2AR9A 2PU7A 5ECGC 3VXKA 5C5EA 1Q77A 3OQ1A 9ATCA 4QEKA 2NQ8C 2IYTA 2UU9M 3LMMA 4IJEA 3V4OA 1PJRA 4MGKR 1U8YA 1XZ8A 2FR0A 3BH6A 4QVIA 4F56A 3R7SA 4AY2A 4N5NA 3SSMA 4CLOA 3WAGA 1QZXA 3K30A 2ZI7A 5SZIA 5IBQA 4IHQA 4X95A 5FLXS 2VKQA 1CUEA 2DT8A 4D9EA 3U7EB 4C08A 1GZDA 2IYWA 1M8PA 5AVOA 3MK6A 2BKXA 1OFHA 4IRMA 1V6AA 3EXFA 1J21A 3P9QA 2GRAA 1EFKA 3UMRA 1NUUA 5IJAA 2JZNA 2K9DA 1HE2A 2V59A 4POOA 1LK7A 3EXEA 1I36A 1FQWA 1WUIS 1YL6A 3BMNA 1JMKC 1TKAA 2EFCB 2BGNA 4EMBA 1DKPA 1V71A 3OE7D 1KJ9A 1GT91 4LBVA 2DH6A 3V9PA 4H0NA 2J5YA 1DDGA 3KOUA 1SQ0A 3VOBA 1JDTA 2PS3A 5J3JA 4KCGA 1YZYA 1HQYE 1QAMA 1VKHA 1DOZA 2BTQB 4RQUA 4FZ5A 5JRJA 4YDRA 2XUFA 1UPFA 3CF4G 3N2IA 3HVUA 3RFFA 3H18A 5A9SA 3U4GA 5D87A 2DHEA 2VF7A 1E0SA 1WXDA 1K08A 8ABPA 1ZFNA 2QTAA 1VZ2A 4EI9A 3FN4A 4BQFA 2R9VA 2C7PA 3PVSA 1MOZA 4HNGA 3QQPA 2OBYA 2BI4A 2RB5A 3DJYA 1Q39A 4TMZA 5HKBA 1HTBA 1KDZA 4ABTA 4YLYA 2HB6A 2G72A 2JF0A 2BP7A 1BGWA 4O33A 5KC9A 1GAXA 2IHYA 1UPTA 5EJ9A 4GOKA 1NI3A 5JMPA 2DULA 1IUPA 3ROPA 1EHCA 1GOTA 1X7ZB