3DFZA

Sirc, precorrin-2 dehydrogenase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
196
Chain Sequence
MYTVMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDDQYRLSLVKQREFLQQIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Precorrin-2 dehydrogenase
publication title Structure and function of SirC from Bacillus megaterium: a metal-binding precorrin-2 dehydrogenase
pubmed doi rcsb
source organism Bacillus megaterium
total genus 61
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.3.1.76: Precorrin-2 dehydrogenase.
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13241 NAD_binding_7 Putative NAD(P)-binding
A PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.610 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3dfzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfzA01
3OJOA 1LDBA 4ZU3A 2QG4A 1WVGA 3BTUA 4OQZA 3UCEA 4B8ZA 2VNSA 1NWHA 1RM5A 1X7GA 3AK4A 4J43A 7ADHA 1N92A 2IRWA 1E0DA 1G1AA 3TFOA 3AUTA 4E4YA 4R1UA 3VOSA 4GLLA 1HDRA 3IKVA 3DB2A 4YRBA 4J0EA 1PJSA 1Y1PA 3PI7A 2JJYA 1GDHA 3K6JA 3KO8A 4JBIA 4R9SA 4WCFB 5COBA 1R6DA 3QLJA 5A9SB 3PRJA 4IMPA 3WX0A 4CQMB 1GQYA 1N7HA 3AM5A 1Y5RA 4TZKA 2DUUA 2GRAA 1PJBA 1J4AA 3ZZNA 4DMLA 4DUPA 4CM6A 1X13A 4CMJA 5DP1A 1U3VA 2C0CA 3DZIA 5B37A 1PU2A 1Z7EA 1BRMA 3TNLA 4FJ2A 2O4UX 1DIAA 2ZCVA 4BNUA 2VZ0A 5A1TA 4IDGA 4R41A 1CQIA 4KUHA 1KOLA 3JQ9C 1OMOA 3GZ4A 3F5SA 3RFTA 2V6MA 1L7EA 4NK4A 4QECA 1NVGA 1KEPA 1NYTA 3P7MA 3AOEC 4DL9A 3GVIA 4GQAA 3WMWA 2EF1A 2HJRA 2XAAA 4J3FA 4E2ZA 1QYXA 4YAJA 1DRWA 2WJPA 5IAAA 1J5PA 2B5VA 2XOXA 3GZNB 3ZV4A 3OEYA 1BDBA 2YV2A 3F5QA 5JXWA 3QWBA 1TVEA 2VOJA 1SMKA 4WLNA 3IOYA 4XIJA 4ZQHA 2JD0A 1WNTA 4BMNA 3NT5A 4HBGA 3AM3A 4RZIA 5JS6A 1PL6A 2AQIA 3A1NA 1B8UA 3IIEA 4GKBA 2PH3A 4CLOB 1R0SA 2SCUA 2V6BA 3WIDA 2PWZA 2WM3A 1K3TA 3WSWA 3BA1A 4RVDA 2Q1TA 3GOHA 4ZQFA 4C4OA 1NFQA 4ALLA 2Y0CA 4BO4A 3E9NA 2POQX 1JDJA 3HDHA 1KETA 5H82A 1M75A 2HK7A 3ZU4A 5KVQA 1EDOA 2JKVA 3DO5A 4L73A 5CFZA 4GPD1 1U5AA 4PLCA 1VI2A 3DBVO 2Y99A 3QVOA 1DFIA 2Y67A 3OIFA 5TIIA 2Y0EA 1B8VA 1LU9A 3R6DA 4RGBA 3VDQA 3C1TA 4M1QA 1PWXA 1SOVA 2B37A 3GH3A 3ZWXA 2QW8A 2EJVA 3A4VA 4OSPA 1C0LA 3OA2A 5JO9A 1DHTA 3SBOA 2NM0A 4D42A 3OQBA 4XGKA 3FD8A 4CLXA 3PYMA 1CIVA 2GZ3A 1UZNA 3WGHA 3PZBA 2OL4A 3EC7A 2YQ4A 1LUAA 4CR8A 2GD1O 1H9BA 2ZYDA 3C8MA 3D1LA 3LC1O 1LNQA 2W2LD 3JYOA 3U4HA 3WBBA 1FXSA 1HL3A 1T1SA 1Z45A 3FF4A 4GSLA 1RYEA 2BGLA 1ZZEA 1P9LA 3JQAA 1Y9AA 3PWZA 4ZQEA 3T4XA 2OMEA 4QSMA 4XGNA 4EEXA 1LDGA 1YB4A 1K5HA 1T2EA 2BELA 4XB2A 1NTOA 3MWEB 4IZIA 4BNKA 3LT2A 3PEFA 1WDLA 1FK8A 2QQ5A 3BIOA 3NJ4A 1A9ZA 3VHRA 5JSFA 4CLEA 3VZPA 2CDAA 2G0TA 4RF2A 1MGOA 2I3AA 3MEQA 3Q1LA 1U3WA 4IQ8A 4R16A 2ZTUA 1TI7A 1I0ZA 1Y8QB 4YJGA 3TZCA 4XYGA 4BNTA 4PVDA 3H65A 1Z75A 4E2XA 3UFXA 2R6JA 3QY9A 3G1TA 3RJ5A 3ZWWA 1BDMA 3OA0A 4OO3A 2QIOA 6LDHA 4CV3A 1KVUA 2ZQZA 4W6ZA 1HXHA 3M2TA 1AGNA 2HDHA 3JQ7A 1DB3A 1GD1O 2X5JO 5IZCA 1PZEA 3D3WA 3WNQA 1XKQA 1HE3A 3PDJA 3AFNA 2Q3EA 3LT4A 3FHLA 5EN4A 4AJHA 3DQPA 4E21A 1HDCA 3GR6A 4DWVA 2EW2A 2FP4A 1ZK4A 4YDRA 3V1UA 1YQXA 3ULKA 3TZHA 4MP8A 1AN9A 2HO5A 4U0KA 4S1VA 4DPLA 2GO1A 3H6KA 3HHPA 4MOWA 4ZVVA 1A5ZA 1GUZA 2YV3A 4FFLA 1PS0A 4RQTA 1NX6A 4FSHA 4WNCA 5IDWA 1I5RA 3PVZA 2PA3A 5FF9A 3D4PA 4RDIA 2W2KA 1DIGA 3I9NA 2UAGA 4IS2A 3F1KA 1GFSA 2AEJA 3GVXA 1P1JA 3DHEA 2D8AA 3QWFA 4Y98A 1P1RA 4MKXA 1H6BA 4F3YA 1HYHA 5C5IA 1YQDA 3IAHA 4BNJA 5T8KA 4WLEA 1EFKA 4UUOA 4RPHA 3RUAA 5JDCA 1PEDA 2P9GA 3ROPA 1I3NA 3GVCA 1AHHA 4IIUA 1UZLA 4YJHA 4GSKA 1NFFA 3VPHA 3QRWA 2PV7A 4WOJA 1KVTA 2PZJA 3LYLA 3O4RA 5DF1A 1NNUA 5JCXA 1SEPA 4XD2A 2FSSA 3U4IA 4UVEA 1M6HA 2E82A 5IG2A 5JY6A 2G76A 2Q46A 4B7XA 5F1OA 1P3DA 3SC6A 4AJKA 5TQVA 5G2OA 3KYCA 3DZBA 4IJVA 3E18A 3WB9A 1D1TA 1R4NA 3RJ9A 4RZHA 2FRDA 3AI1A 4JGBA 3RKRA 3PGXA 3IP3A 3KLMX 3MCVA 2V6GA 2AQ8A 3W6ZA 4AG3A 5KWEA 4KUEA 3FPCA 3CH6A 4DC0A 5A03A 3ON5A 5IFLA 4YWJA 1KBZA 1T2AA 2DKNA 2FPIA 2PK3A 3GMDA 3N58A 3EVNA 3TWOA 2Q1SA 5DCWA 3TSCA 3VH1A 3CIFA 4JIGA 4DYVA 4MVJA 4BNGA 1Q0HA 5CP8A 1MFPA 1WP4A 3PWKA 3FRJA 4FCCA 2ZB8A 1YRLA 3JQAB 2NU6A 4JROA 4RQUA 1EBUA 1ZK0A 1V8BA 2NUAA 3TJRA 5ILGA 1PJLA 2X6TA 3C7DB 1K6IA 5A5EA 4UREA 3IJRA 3TOZA 4I5GA 3FWNA 2HUNA 1I2CA 4MVJM 4N5MA 5T6BA 3WFJA 3Q3CA 2CVZA 3JQBA 3S2FA 1U2DA 3C7AA 5H83A 3ONDA 5AXBA 4YVFA 5K6AA 4J1SA 2YFQA 5IN4A 5KVSA 3JQFA 5JC1A 4BO7A 2X58A 2HKIA 3FR7A 4DGSA 3I6IA 5DP2A 4ZA2A 1MC4A 1CQJA 1QG6A 4NU5A 3PHHA 2YV1A 2BFPA 3ABIA 1ENOA 3HG7A 4OKNA 5I8ZA 3M1AA 1LRJA 1N1GA 3I3OA 2JD1A 4NDNE 3DWFA 5A5FA 3WGYA 3ZHYA 1BMDA 2P9EA 1HDYA 1LSJA 4J90A 1X0VA 4XDZA 5A02A 4KTVE 3G79A 3ROMA 4BO8A 3ZWPA 3NTQA 2Y68A 3PJFA 4CM5A 4JX8A 4BMVA 5KJCA 1R66A 5AVOA 5L7TA 4ND2A 3AUAA 1AHIA 2FR1A 3JD0A 1UDAA 3OIGA 4WLVA 4CL3A 2O3RA 2H1SA 2G82A 4QO8A 2O23A 4GWKA 4PG8A 4YRDA 1PL8A 3PQFA 2GNAA 3UXYA 3FNEA 2DPHA 3RROA 1WDMA 4LRTB 3U62A 1DIHA 1H5QA 2QRKA 3KLPX 2NV6A 4CMEA 2W2KB 2HMTA 1KVRA 1M66A 5BSHA 4AL4A 4FN4A 3ETEA 3STHA 2VHYA 3WWZA 2BGKA 1B2LA 1Q7CA 1UXHA 2EKPA 3WTCA 2ZTVA 2ZB4A 4E5KA 4YQZA 1YONA 1WW8A 2CDCA 3L6DA 4OKIA 2HMSA 1NVMB 3VZSA 3PHGA 2Q45A 1BVUA 1C0PA 1Y8RB 2E48A 1GYPA 4CMEC 2O3QA 4YJHB 1FDSA 5CPBA 1O6ZA 1U28A 1NVTA 1QV7A 1VPDA 3DOCA 3NV9A 4QXMA 4KQXA 2O4CA 1Z6ZA 2WYUA 4AJNA 4MDHA 4BO9A 2VWHA 2NVUB 3VPGA 2GZ1A 3UUWA 5DBFA 3G49A 3E9QA 3GT0A 4JBHA 4NHEA 4Q3NA 2OO5A 3UKOA 4CR6A 1YQGA 3PZRA 3RC7A 1CRWG 1YL6A 3KYCB 4FPXA 3L9WA 4E33A 2CY0A 3H9UA 1T24A 4NIMA 3WGZA 1WZIA 5U9CA 1JAXA 2WSBA 4XB1A 1C1XA 4NG5A 4FQ8A 1NQAO 1FDVA 4UEJA 1NAIA 3W4KA 1IZ9A 3DTYA 3W1VA 3PYLA 1TA4A 4RV9A 3KYDB 2BFAA 2X9VA 5KTKA 4PCVA 4L8VA 2X0IA 2F00A 3D7LA 2JHFA 2VYVA 3ENNA 2CZCA 4O59O 5C7IO 4PLWA 5T57A 1PGOA 3GGPA 5JY1A 3OJEA 3KSZO 4PG4A 1VL8A 3CSDA 5C7OO 2PTGA 4BO3A 3GVPA 4IUYA 4HY3A 4OXNA 2Q4BA 2E37A 1HEUA 1DHRA 2WE8A 2R00A 1ONOA 1MG0A 1K89A 4I8XA 3INTA 2QYSA 1NFRA 1QV6A 1A4UA 3QJ5A 3RD5A 4NJOA 4PZCA 3QVTA 3D5TA 5ICSA 4BNFA 1JU9A 4GBJA 2Q99A 2EEZA 4E5MA 2OXIA 2PGLA 5G0UA 2AQHA 4MVJE 4RLSA 5TJ9A 3TZQA 4CUKA 4XRGA 5HS4A 1ZMTA 3ITDA 1JQBA 2R00C 1E1KA 1GL3A 1ZO8A 2HJSA 3GLQA 1XHLA 1GEEA 1LSSA 2HK9A 4K28A 1OAAA 1I01A 3ZHBA 3HN2A 4I5FA 4NMHA 4BQRA 4YT2A 4E30A 5HTOA 4CM8A 3L07A 3X2FA 2EHDA 3DOJA 4YTEA 3ANLA 2FPPA 1ID1A 2IZZA 3MOGA 1ZXBA 4J4TA 3ZNPA 4H16A 4CV1A 3MTJA 4GL4A 3VC7A 3HZZA 1I33A 3ZHXA 3BMNB 4PG7A 4CM9D 4R1TA 3DBHA 2G5CA 2VWPA 1H6AA 1A7KA 4R68A 5THKA 3RUCA 3I9LA 2IYPA 4IM7A 4ROSA 5MGBA 2EG9A 3DZGA 5AQ1A 1JWBB 2PLAA 4JCOA 3BYZA 4HFMA 3SXPA 1PZGA 3QWHA 4WEOA 1YOVA 3VPSA 1P77A 1QYWA 3PIIA 1WMBA 4DLBA 1YB5A 1PL7A 4ALKA 1HLDA 2WMDA 2DT5A 3L77A 4Z0PA 3BHMA 3PK0A 2NLOA 4U6SA 5TLSA 4PLFA 3M2PA 3ANNA 1U2GA 1T1RA 1EQUA 3VH2A 7MDHA 5H81A 2OBNA 4LVCA 2IE0A 4RJTA 3ZV6A 2LDBA 5AXAA 4G2NA 4XRRA 4BNXA 1DRVA 2P5YA 4I5EA 1LSUA 3C3XA 4HFRA 4LN1A 5DULA 4OYRA 1UZMA 4JK3A 3H9QA 3HDYA 4ZRMA 3I4FA 4HV4A 4TQGA 2YUTA 3CKYA 4ALJA 1UH5A 4CLDA 3HUDA 3RASA 1ZXLA 3QIVA 4BKRA 1PGPA 4RVHA 2NU7A 1VSVA 4EZBA 3UHAA 3ZI0A 4J9VA 3IUPA 3D4NA 3EW7A 1ADFA 5JBIA 4TKMA 3I5MA 2VHWA 3EK2A 4UULA 1VJ1A 3JQCA 3WWYA 2EW8A 4B3JA 3JQ8B 2B5WA 4WLOA 3JSAA 4GVXA 2D5AA 5CEJA 3H4VA 1PX0A 4MIEA 4QQRA 1NQTA 2FSVA 4KDFA 4XA8A 4XWYA 2YW9A 4AJPA 2PD6A 3G0OA 4IINA 2NNLD 1LSOA 4O0LA 5T5QA 4J7CA 1DEHA 1GV0A 1QXSA 2O3JA 5G0WA 3ZV5A 1U8FO 4L4SA 1C1DB 4OXKA 2PR2A 2P5UA 2TMDA 1IPFA 1NAHA 3VTZA 3S2EA 2BGMA 3WG9A 3V2HA 2VTEA 3GGGA 4E2YA 3SX2A 2FY8A 4FFMA 1ZK3A 1ENYA 1B3BA 2VHVA 3CMMA 5IJZA 1E1NA 2B4RO 3ZW8A 1M76A 5JYDA 4FJ1A 2ZTLA 1DC3A 3P2OA 5DBGA 2P9CA 4ZQGA 1SO8A 3DZJA 1KY5A 4WOKA 1SEVA 3VVCA 4BO0A 3BHIA 4IPTA 3IP1A 3ETDA 2IZ1A 4NBVA 3WGQA 1LBEA 2ZCUA 2EP5A 3TDKA 2YQ5A 4CODB 2I5PO 1EVZA 1MA0A 3OETA 2NSDA 3DBHB 4N54A 4XQEA 1F14A 3DOOA 2D1YA 4FB5A 1EVIA 2DBZA 4WK6A 4EJ6A 1ADGA 2AG8A 3EDMA 1XDWA 3K73O 1E6UA 4J7UA 4JN6B 4WPGA 3GPDG 4A2CA 2Q50A 2EJWA 4M89A 5JYEA 3I23A 2NVBA 3K5PA 4JQCA 1U4SA 1U7HA 2H5LA 3NYWA 5B1YA 4MVJF 2VTDA 2BKAA 2DQ4A 5EQDA 5HM8A 1PQWA 4K9DA 4CQMD 2YDXA 4K6FA 2VWGA 3RIHA 3BTSA 1X15A 3ZWAA 1NQ5A 3FTNA 2JCYA 4CMIB 3SJ7A 1TT5B 1SNYA 2X22A 4GLOA 5L3ZA 1QYCA 2I66A 2W8ZA 1K6XA 4XEHA 3RVDA 2Q2VA 2BLLA 4RF4A 5JCJD 4MVJI 1HETA 2OUIA 1QR6A 3Q2IA 4J6FA 4ZN6A 1LDNA 2EKLA 3JYPA 3HE3A 2A35A 2VUSA 3IC5A 4O63O 3OECA 3JQ9A 2GASA 3GUCA 4FDAA 2DPGA 3R3SA 4BUCA 3IQDB 5A05A 3HDJA 1HE4A 4UVGA 1IZ0A 5BQFA 4N5NA 1LXCA 2IZ0A 3AOEA 1MXHA 4BL5A 1X0XA 4CQLA 4YYZA 4BNWA 3OFSA 2C7VA 1R37A 4MJLA 5COAA 4AJIA 2DBRA 5JMWA 1HTBA 1RYDA 2DLDA 1HDXA 4R3NA 1N7GA 2O3TA 1T26A 2UVDA 1YB1A 4F6LA 3GEDA 3DL2A 2VYNA 3FR8A 1X7DA 3QQPA 1ZSYA 5ADHA 4BNYA 2PGJA 4D0SA 3W8EA 2AXQA 4IS3A 2PGDA 1IOLA 4J1NA 5B4VA 3JD3A 1HF3A 3GHHA 1D8AA 1E3LA 4PLHA 4FR5A 4XCVA 4Q3DA 1LLCA 4EYEA 3C7CB 4OHUA 1EUZA 4D45A 3WDSA 3EGOA 5F5LA 4Z3DA 1E6WA 3AOGA 3H7AA 1JW9B 2P4HX 3QP9A 5JAIA 4TRRA 1ZEJA 2J5KA 3AM4A 1K0UA 5IZ4A 1H2BA 2FPGA 4AJ1A 4UUMA 2BRUA 5HA5A 2XXBA 4D3SA 2ZIZA 2D59A 1DAPA 1EUCA 3KSUA 1R0KA 4AVYA 1BSVA 4JLWA 4II2A 3U5TA 1N9GA 2JCVA 4CMBA 2X4GA 3JD1A 5ITWA 4MP6A 1FMCA 2QZZA 3HB4X 5L4LA 5LC1A 3RC9A 1XG5A 2X86A 1U3UA 4J2OA 1BXKA 1JLLA 1LX6A 1MG5A 1SB8A 4U0JA 3RWBA 5I7EA 3JYNA 1I3LA 3DTTA 2Z1MA 4CUJA 1UR5A 2DTEA 4RL6A 4YAIA 1NHGA 1S7CA 4QTZA 3VZRA 3HNPA 4DRYA 5GZ3A 3SJUA 4NBUA 3GC6A 3GMSA 1BW9B 4AICA 4E5NA 5A9RA 1PSDA 2VZ8A 3ZWBA 2ZB7A 2ZK7A 2XPCA 1I24A 5ENVA 2P4QA 3U9LA 1Y9EA 4ZQBA 3RU9A 3PDUA 2BI7A 4HKTA 1TEHA 1PJQA 1SCUA 1E7RA 4G5HA 4AJOA 1KIFA 4DA9A 2YHIB 3IMFA 4OXYA 4A73A 4KMSA 4RVSA 1LLUA 4OAQA 1ULUA 4W82A 4LISA 5DN9A 4CM3A 4CPDA 1T4BA 3FTPA 4MKRA 3ZNNA 2HRBA 3V5NA 2W90A 2JFHA 3OHSX 1DSSG 3BTOA 4F46A 1EBFA 2CF6A 3UAGA 3KV3O 4H3VA 2YZ7A 1JWAB 3MJVA 3IS3A 1KS9A 2VQ3A 2WYVA 4J1QA 4YT4A 4J4HA 3JQ6A 4L74A 1TT7A 2OZPA 3HFSA 4PLZA 3Q0EA 5DNAA 3JYQA 4R69A 3GN2A 1YWGO 4BHTA 5IF3A 1I10A 1IYZA 4ALMA 2UYYA 1KVQA 4Y6PA 1HZZA 1P31A 3MTGA 3HSKA 1H0KA 5B4TA 3OICA 3DAGA 3I4CA 5TT0A 1FJHA 2D2IA 2AW5A 1GUFA 3WSVA 4CR7A 5LDHA 4CQLB 4YCAA 4EGFA 1SZJG 4E2WA 4E32A 2X9GA 1C0KA 2HU2A 1X1EA 4IQGA 4OQYA 3WYBA 4D41A 3W6UA 2P2SA 5KVCA 2CNBA 3NKLA 4XQCA 4IDCA 2NADA 2DTDA 4GAEA 4WGGA 5FFFA 4C7KA 1JN0A 2X9NA 1CDOA 2VNAA 4Q3CA 5J23A 3LK7A 2JL1A 2HMVA 4DLAA 4RPKA 4IY1A 1HE5A 2GR9A 4XDYA 4AJLA 1P45A 2A4KA 2RCYA 4YACA 1DLIA 3T7EA 5DCUA 3GAFA 5I9MA 1EK6A 3A28A 1P33A 3TPCA 3HFGA 4CM1A 1F8GA 2CUKA 1VJ0A 1QYVA 2O2YA 3O9ZA 2Y1OA 3GNTA 2CSUA 4QX6A 5A3VA 1ISIA 2VZ9A 4ALNA 2NTNA 2AE2A 3G3EA 3PQEA 4ND5A 3KB6A 4CLRA 4Z6KA 3G1UA 3QVXA 2QYTA 4XX0A 1GV1A 4YJFA 4M87A 2Y1EA 1FDUA 1GZ4A 1A71A 3A06A 3PGJA 3GG9A 1E7YA 4MP3A 4NPCA 4O5OA 2NACA 4BB6A 5GZ1A 3AU8A 4Y9DA 1KY4A 3RC2A 4EDFA 1XCBA 1XYGA 1ADCA 4IQ0A 4BVAA 4BNZA 3WGOA 2RH8A 4BGUA 1NM5A 4RF5A 5ILOA 1VE9A 1MP0A 1TB4A 4BKPA 2IEBA 1LRLA 3EAGA 3INRA 3LU1A 2DC1A 2CF5A 2B69A 3GA0A 1QLHA 3W8FA 1OBFO 3GNQA 2HMWA 4U6QA 4IIVA 2H9IA 5L95A 3KHUA 1WLYA 3GPIA 4L4XA 3L6EA 3JQAD 3FBTA 4N18A 2EGGA 3CZRA 3LF2A 2PH5A 4L0QA 5DZSA 4KDEA 2QX7A 3K31A 1U3TA 1FF9A 1XU7A 4TRNA 4EJ0A 3EY4A 5B12A 5EERA 2AMFA 2Y1GA 2YY7A 3IL2A 1Z7BA 3GY0A 2H63A 3NGXA 2VHXA 4HADA 2OORA 1PR9A 4K6CA 5JAZA 1UXGA 3OEWA 1DIRA 1YDWA 4UEKA 2PZMA 4WLFA 3FWZA 2VHZA 3WIEA 3BTVA 3H5RA 1ZNQO 2E6UX 4P22A 5BNFA 1T4DA 4HX5A 5KOIA 4RPLA 1VKNA 1HDGO 2BMAA 4IZHA 3BMQA 4B3HA 3EMKA 5G0SA 4FS3A 3AU9A 2C5EA 3QW2A 2P91A 1XR3A 1RM0A 3H8VA 4YJGB 1Y5MA 5TF4A 1WMAA 1SB9A 4NBRA 3B6ZA 4RORA 1B16A 5DDIP 3SLGA 4BGIA 1NBOA 4U7WA 4JJFA 4JNKA 2HLPA 4P4LA 3EHEA 1AE1A 1DC4A 5I8WA 3L4SO 2ZYGA 3RFXA 3JQ7B 3H9EO 5EIOA 1ONNA 1YBVA 5F21A 5G4KA 3B70A 3D3WB 4B4UA 1ARZA 4B3IA 1H9AA 5JAQA 4DQVA 4GX0A 1CEQA 1IY8A 4FFPA 3ROKA 4BV8A 1MFZA 1WAMA 3KYBA 3IKTA 3UN1A 4Y67A 3VDRA 4J0FA 5KVVA 3TOXA 2RH4A 4G65A 4OSOA 2O3SA 3EVTA 4DTIA 3LLSA 1U5CA 1A7AA 1V3UA 3BAZA 4ND4A 2D5CA 2C59A 3VAZA 4CM7A 1U8XX 1E3IA 4IBOA 4NQZA 4NJMA 1V3TA 1O5IA 2PY6A 3JD2A 5HWSA 1HT0A 3LVFO 5HBRA 3GRKA 4DIOA 4TKLA 4QFCA 2VRCA 2ZB3A 4CM4A 3I52A 4HXYA 1T2DA 1ISHA 3FN4A 4ND1A 4W7IA 3WJ7A 3GF4A 3TQHA 4YJDA 4B79A 3M1LA 3WQSB 1MLDA 5BSEA 1PZHA 3ZHZA 3KETA 2QZ9A 2RBEA 5HS6A 1UAYA 3O8QA 2Q49A 3JD4A 3WMXA 3HN7A 4XJTA 3WYEA 3JQGA 4R51A 2QRJA 5CDGA 3ETGA 1GR0A 1U4OA 4J7XA 4B7UA 1YVEI 3ADOA 5CAEA 5KKCA 2BI8A 4E3ZA 1LJ8A 5CPFA 2GUGA 3W8DA 4D3DA 3EZLA 2Z5LA 2X1HA 1ZIDA 2VRBA 3N74A 1R4NB 1SOWA 5TS3A 2FR8A 1HDOA 2X0NA 3OJ0A 1OC4A 2JAHA 5LCXA 1CYDA 4MVJD 3UICA 1DO8A 5G0TA 1E7SA 4DC1A 3C85A 1GYRA 1E3JA 2WD7A 4BNHA 1N1EA 3ENKA 3VPFA 5C7LO 4WKGA 3EUWA 4PLVA 8ADHA 2FOIA 2J3HA 3RKUA 3WOHA 4QEDA 9LDBA 4BIIA 4XQGA 3WBFA 2J3KA 4A7PA 1ZW1A 4BNIA 1QLJA 3OMLA 1PJ3A 1E3WA 3ROQA 1DXYA 3WQRA 4EW6A 1E1MA 2C29D 3QA9A 1PIWA 1K2WA 4CMKA 4LMRA 1ML3A 4DPKA 5L9AA 1E5LA 2IXBA 1V6AA 3CINA 2VUUA 2HSDA 3TL3A 4YAEA 3GQVA 4PLTA 3IDSA 3K2BA 3TRIA 4BMSA 2EV9A 5GY7A 2EIHA 1YXMA 4KTTE 2TMGA 1YL5A 3FI9A 3FSRA 3H9GA 1GQ2A 5L7WA 4HUJA 2BH9A 4YXFA 2OGUA 3BMQB 4BNNA 2OP1A 4GGOA 1OZAA 3I9JA 3I9OA 3GVHA 1U9JA 4LRSB 4AJ4A 2AE1A 1HKUA 5I7FA 3NUGA 3D5QA 4XYLA 5KJ6A 1X7HA 1KEUA 3RUIA 3WYCA 1V9LA 3I1JA 1PJ4A 1IE3A 4J2HA 4JP2A 2WTBA 4GMFA 1XQ6A 3OM9A 4OMUA 2VT2A 5JE8A 5I9LA 3MOIA 1ZSNA 1Z73A 2I6TA 2CMDA 1HYEA 4A03A 4IDFA 5JDIA 4OOEA 2B4TO 3ZWMA 4XYMA 4E0BA 2GERA 2FN7A 4WASA 2X7HA 4MVJH 4D3FA 1B14A 3E82A 3PHJA 1MC5A 3LC7O 1UJMA 4R3WA 3MJCA 2OBYA 4Q3EA 1Z74A 4WEQA 3NDRA 4RVUA 3OQ6A 3DHYA 1UXJA 4R01A 5JDIC 2ZYAA 1BWSA 3H2SA 1JKJA 3V1TC 3AJRA 1QYDA 2DVMA 3PTZA 4NJMB 4ID9A 1LC0A 2AA3A 3R0IA 5TX7A 1LDMA 3ZU5A 4KWHA 4CV0A 3PQDA 2B35A 2ZATA 5K9ZA 3RBZA 4CM4B 2XF8A 4PFJA 9LDTA 2GN9A 3V8BA 1KERA 2PZKA 1PGNA 4J16A 1OC2A 4PG5A 3VZQA 8LDHA 5F1KA 1P0FA 3AI3A 2WDZA 3KEOA 4ND3A 1X1TA 3UF0A 3FPLA 4U5QA 4RPJA 1LI4A 1O95A 4Y6SA 3O8QB 3O38A 1SBYA 3W4JA 1UDBA 3LQFA 4MKZA 3GAZA 3E03A 3WJAA 4J49A 5FI5A 2CDBA 1Y6JA 1E3SA 1LQTA 3OJLA 5EESA 2Q1WA 3FNFA 3ASVA 4Z9XA 5A9SA 4OM8A 2VYVD 4FFOA 1E7MA 1LDEA 1G6KA 2PKQO 4I1IA 4HFNA 1RJWA 4YT8A 2PKRA 1L1FA 3ZNQA 1C1XB 4HWKA 5T67A 3U4CA 3QE3A 3WNVA 2J5RA 3MJSA 2JFGA 1W73A 4BNMA 1I32A 1W0CA 3DEYX 4IDAA 4WCFC 3UVEA 3HADA 1PS8A 1MX3A 4OH1A 1V3VA 1EQ2A 2E4AA 1P1IA 3C24A 4R1NA 3OF2A 4MVJP 1NR7A 2DUWA 4L76A 1PZFA 3W4IA 5C37A 3PFWO 4R54A 1YO6A 5ES3A 1JAYA 3MJTA 3F47A 4BV9A 3GFBA 1D3AA 3U49A 2V6FA 1P74A 3MWDB 3ICPA 3I83A 2B4QA 4NI5A 5FWNA 4UVHA 1VKOA 1M67A 3JCZA 3CTMA 1DIBA 5F3RA 4XYEA 3UCFA 4KQWA 4NK5A 1EVYA 3GG2A 4A0SA 4K26A 1T2FA 3EYWA 1W6UA 3AY7A 4LSWA 1T2CA 4R5MA 4Z0HO 4U8GA 4AJEA 2HMUA 5MDHA 4QT0A 5A9TA 4EEZA 1BVRA 4W9NC 5DOVA 2Q2QA 3HB5X 2O48X 2QRLA 5TT1A 3JV7A 1UXKA 1PTJA 3FNGA 4XIYA 1ZCJA 3F4BA 4J1TA 1GZ3A 3CE6A 4RPGA 4RVFA 1OFGA 4CM8B 3A9WA 3Q9NA 1VLLA 4WJZA 3GEMA 3R3JA 1E77A 4R9RA 1NR1A 2ZQYA 3UCXA 1I3KA 1G0OA 3GEGA 1Q7BA 2PNFA 1PJCA 3P19A 3ADPA 1S6YA 1GUYA 1EUDA 2AHRA 3L9XA 5ER9A 4B8WA 5TGDA 3RCBA 4DYDA 2YHUA 3E5RA 3S2GA 5JLAA 4YBZA 1LC3A 1NPTO 3VVBA 5CDSA 5F1PA 3FCOA 2OHXA 3CPSA 5L53A 4BO2A 3PJEA 1YOVB 1Q0LA 1U1IA 3AUUA 4BGVA 4J4BA 4XR4A 3H2ZA 3WXBA 1VC2A 4LK3A 3NT2A 4CMAA 2DU8A 3PLRA 5TRTA 5C3MA 2DFVA 1YE3A 4FOOA 2Z1NA 1O8CA 3LT0A 3Q9UA 4TWRA 2C2XA 3H5AA 4MO2A 4D46A 1MUUA 3IJPA 5EPOA 2B83A 4A27A 3NEPX 2WYWA 2IXAA 3VH4A 2Y05A 2I65A 4C7JA 1BXZA 5KJFA 3OBBA 3V1YA 1PWZA 3OQ1A 4MPDA 3ZCXA 1EZ4A 5A06A 2GSDA 3ZU2A 5L40A 3HWRA 4ZICA 2WD8A 1NASA 4MINA 2W2LA 4HP8A 3ORFA 5DT9A 5U1PA 2EXXA 5CEFA 1XQ1A 4PG6A 3TF5A 5KJEA 1BXGA 4QUKA 1X14A 4DQUA 1NWCA 3OH8A 5IXSA 4UUNA 5LDGA 3K8ZA 2JCXA 1OOEA 3K9QO 3WGTA 3N7UA 1P1HA 5FI3A 1Y8QA 4IJKA 2P68A 4BKOA 2PD3A 5TNXA 1ZH8A 4P38A 4DIFA 2YJZA 4TROA 4YPOA 4EITA 1PR3A 1YDEA 3VKVA 5JO0A 3WS7A 1KEWA 2NTJA 2O3UA 4CLHA 1P0CA 4WE3A 1EK5A 5JAMA 5ER6A 3S55A 4M49A 5DCYA 4JBGA 1DC6A 4DVJA 2UUPA 3ZNOA 5BSGA 1NHWA 1VJTA 2PKQP 4NBWA 1I30A 3V2GA 3MJ4A 3LT1A 1E3EA 4GVLA 1F8FA 4P4NA 4ONEA 2G1UA 4DQXA 1P1KA 4NFSA 4FGWA 4IJUA 5KIAA 1B8PA 3SC4A 3DZHA 3QHAA 3S2IA 1ZFNA 4OIMA 4Y6RA 5FEUA 1NP3A 2V65A 3RAJA 1UUFA 1H6CA 3NX4A 4E12A 4CJXA 3I9KA 2JHGA 2VCYA 4LSMA 3IUSA 1R15A 3SLKA 3DAPA 2IODA 4BOYA 3K92A 2Y0DA 1I3MA 1GAEO 2R2GA 1YGYA 2FZWA 3GN1A 4K1LA 3RC1A 1GEGA 3AUSA 4Q39A 1OI7A 3PFFA 3WQQA 2FZEA 2ILTA 2OFPA 2OOSA 4N7RA 1J0XO 4BO6A 2GPTA 3OJFA 4FIZA 1D1SA 2J3JA 4XQ9A 1YKFA 1SC6A 3O26A 5BR7A 1LLDA 2RIRA 3F46A 4ESOA 3U4DA 3FNHA 3K2EA 1B15A 3QVSA 4KWIA 1DRUA 4I5DA 4O6VA 3NTOA 2FMUA 4E6PA 4UAGA 4UVIA 1P1FA 5ENDA 3LZ6A 1VM6A 3QWAA 1EFLA 4FBGA 1R4MA 1GU7A 1LDYA 2VOEA 5BT9A 4TZTA 3DZFA 1PQUA 1AUPA 1D4FA 4L9RA 1IL0A 3NDIA 4PN3A 5BNIA 2YFHA 4YA6A 3JYLA 3INGA 2XXJA 4BQPA 4XR9A 3AY6A 4CMGA 5BSFA 2F1KA 2BF7A 3LSYA 3GUYA 1ENPA 3CMCO 4UVDA 3RUDA 3NT4A 2DFDA 2CVQA 5G4LA 4W99A 2C2YA 4QFDA 1O89A 3AY3A 3PP8A 3ASUA 3LF1A 4EUEA 1QSGA 1YL7A 1Q2XA 1RKXA 3BMCA 4X54A 4JJIA 3DBRA 2OP0A 1HE2A 2NTVA 4FC7A 1BXGB 1UP4A 4PLYA 4OJNA 2VYND 4GX5A 3COSA 5EMHA 3ZWOA 1SAYA 2YYYA 5DBIA 4DIBA 2AG5A 4CV2A 1KVSA 3JQEA 1BHSA 1PGQA 2B0JA 3ANMA 3SVTA 2LDXA 1CJCA 4BNVA 3E1KA 1V35A 2GN4A 1RM3A 3RUEA 3HQ4O 3E8XA 4URFA 1E6EA 2RHCA 1ZK1A 3ZU3A 4ZHSA 5EL0A 5DOZA 1W4ZA 2HQ1A 3KZVA 4TRMA 5COQA 3NGLA 3RUHA 3BZUA 2UV8A 3NRCA 3QV1A 4TVOA 3TN7A 4Z3KA 4XZ3A 1E92A 3KM0A 1Y81A 3KVOA 3L6OO 1PJ2A 3ZWCA 3KBOA 2D3TA 3KUXA 3L0DA 1FDWA 4ALIA 5IZCC 1A27A 4EBFA 4KUGA 3GHYA 1HSZA 1I36A 2C5AA 4FW8A 3WTBA 3ZW9A 4E5PA 4M54A 2J5QA 4TVBA 4WECA 1N9GB 2X23A 4EJMA 2FR0A 3S1LA 2O2SA 3WGGA 3DC2A 3ZGYA 3VTFA 3P2YA 2JFFA 3P5SA 4ITUA 4RDHA 3VKUA 4PZDA 3LC2O 5THQA 1JVBA 1I8TA 3CUKA 4LCJA 3TZ6A 4CMHA 2DBQA 1Y8RA 3DFZA 4CL8A 4NFYA 2VWQA 4FGSA 3KOUA 5IN5A 3GNSA 5TSDA 3UH1A 2X0JA 4BB5A 4KZPA 3O03A 4MVJG 3KRTA 3KEQA 4NR0A 2NVUA 2ZTMA 1EVJA 1F17A 5T8KC 1KC1A 5L4SA 4I08A 5JDCC 4XKJA 1Z82A 3MJEA 1NXQA 3KXDA 1HLPA 2UDPA 1IHYA 4IMRA 2O50A 2WE7A 2EGHA 3E6AA 4G81A 1B3RA 3MZ0A 5EJ2A 4BGEA 5IDXA 2IDZA 2V7PA 1R4MB 4AFNA 4DBVO 1ZKMA 3S8MA 3KYDA 2IEDA 2X8LA 3PWSA 4BO5A 1U7TA 3QSGA 5EQFA 4B7CA 2C07A 1O0SA 1GADO 2X5KO 4WLUA 5KCZA 5KNLA 3NAQA 1SPXA 5GMOA 4D7AA 3UOGA 4TRJA 3F3SA 3RI3A 1AXEA 1ZK2A 3HDQA 5JPIA 3ZV3A 1YS4A 3AW9A 5EINA 2VT3A 3JQDA 2J3IA 4B4VA 1UDCA 1E1LA 3WICA 1DBVO 4EUFA 2BD0A 4INAA 4KP7A 4ILKA 3DZKA 3ONFA 3GGOA 1CF2O 4GX2A 1LQUA 4YRAA 3T7CA 2D0IA 1NQOA 1XA0A 3DXFA 2NVWA 3ONEA 4GH5A 2I67A 4UEOA 4DLLA 1WXDA 2QHXA 5CDTA 3G17A 3D0OA 1GZ6A 3A14A 1BGVA 3GFGA 2I76A 3BMCB 3F4LA 4IJWA 4GI2A 3DBRB 3RBXA 3AWDA 2X5OA 4PRKA 3H9JA 3C1OA 2W98A 1DFGA 4MIOA 1R16A 3GDFA 3PHIA 4ZD6A 1GYQA 3Q2KA 3D3EA 2O7SA 4GX1A 5GZ6A 3WGIA 4IDDA 4I9UA 5IXYA 4DREA 3RBVA 2JAPA 3JQBC 2VN8A 1TLTA 2PFGA 3RU7A 4A26A 5K6AC 2CD9A 3F9IA 3JQFC 4NH4A 2NU8A 4H7PA 1IB6A 1I2BA 3KTDA 1HWYA 2EP7A 3BMNA 5TJHA 1UXIA 4IDEA 1A4IA 2GN8A 2Q2WA 3B1JA 3Q11A 3UGKA 2C82A 3DAFA 5L45A 1H6DA 2GGSA 2IYOA 3BMOA 4LCEA 2WEKA 4RLHA 5A3JA 4I9HA 1UP6A 1I2ZA 2DTXA 2Y1FA 1LLQA 4RF3A 1GPDG 3KSDO 4XJSA 4L4RA 4OGWA 3E9MA 4FFRA 3TL2A 1J49A 3LDHA 4M8SA 4CM9A 3AFMA 5BNTA 4IXWA 4D0RA 4CLRB 2PZLA 2I99A 1QKIA 3M6IA 2H6EA 3Q6IA 4NBTA 3ZWYA 5CG2A 3D4OA 1UAGA 5CDYA 4YJFB 1DFHA 1TXGA 1HDZA 4OOFA 5K0ZA 1HRDA 2A9FA 2YDYA 5HRUA 5FYDA 3CEAA 1YJ8A 1N8KA 4YR9A 1ISMA 1XU9A 1E5QA 2ZJ1A 1ADBA 5IDQA 4OL9A 2X0RA 3LLVA 1AXGA 4LMPA 1PS9A 2AEMA 3TFQA 1VL6A 3UW3A 3PJDA 1VRWA 3EZYA 4DMMA 3U09A 2NU9A 3V2UA 3PJGA 2W4QA 4Z9YA 1O94A 5B4UA 1C14A 2EWMA 1GPJA 2Y66A 5AOVA 1QP8A 4YQYA 1F06A 3B1FA 3H3JA 1XIVA 3X2EA 4DBZA 4ZJUA 3GDOA 1W8DA 1N5DA 4DXHA 3DONA 4PVCA 4IDBA 1JKIA 4WCDA 1IHXA 4P4GA 3NTRA 4R4JA 4W4TA 2ZJ0A 5AXCA 2BHLA 4AJJA 1DDOA 3D64A 1DLJA 4E31A 3I9MA 2WWRA 3RUFA 3WFIA 4II3A 2CFCA 2NWQA 3JQ8A 2FWMX 2EKQA 3U3XA 1XLTA 4FC6A 4A5OA 5CEEA 1ENZA 3ZH2A 4E13A 4PRLA 4YEDA 1Q1NA 4NZ9A 1GCOA 4GWGA 2HCTA 4HFJA 3TZKA 2GDZA 4Q3AA 1DJQA 1FDTA 5JMPA 2A92A 1BG6A 1EMDA 2HK8A 3BXXA 4J91A 1ISGA 1EE2A 1LA2A 3NJ8A 1C1DA 2Y1CA 4Q9NA 3RFVA 3ZN2A 1CERA 4NU6A 2UUOA 4YAKA 2NQ8A 2GCGA 2I9PA 4EUHA 3R1IA 1JVSA 5CHEA 5A04A 1A9YA 1HZJA 3E48A 4N5LA 3DFUA 4PIVA 3ZDFA 3PXXA 4I9NA 3K96A 3ITKA 2RAFA 1BTOA 3PHLA 1NPYA 1VL0A 2PD4A 4M55A 5A4DA 4HNGA 5G4KB 5L4NA 2G17A 2A94A 5CDUA 4QO7A 4RCVA 1HYGA 5KJ1A 5AYVA 1DC5A 4TMFA 1T25A 3F6YA 4WNIA 1GCUA 1MB4A 1DJNA 4B4WA 3JTMA 1A72A 2GYYA 4Z0TA 3VPXA 2Y93A 3ICCA 4NFHA 4D79A 3RQSA 3ZWNA 4E5YA 4XGIA 1LEHA 1D7OA 1ISFA 1CWUA 1ZUD1 2RHRA 3PIDA 3DMTA 2VRCD 4WUVA 1ISJA 4A10A 2Q4EA 3GDGA 4IGEA 1MV8A 1GTMA 3B1KA 4UUPA 1B0AA 2BFOA 1L7DA 1IUKA 3QWIA 4TSKA 3C1AA 1YBMA 4GGPA 3WLFA 2GLXA 1QMGA 4FOSA 3OSUA 2NQTA 5JNLA 1F0YA 3BMOB 5IDYA 3DBLA 3HJAA 5JW6A 2J8ZA 5TC4A 4YB8A 1JKFA 1ZEMA 3DMTC 3U0BA 4GMGA 4KOAA 1GQQA 1ULSA 1ONPA 4FFNA 2GN6A 3ZWVA 4LVUA 4Y8VA 1EE9A 2GF2A 1M2WA 2C7GA 3DHNA 5ICMA 1R12A 2BFMA 3OIDA 1WPQA 4L75A 4CMIA 6ADHA 1TT5A 3JQGB 4F45A 4P8RA 4WCFA 1H2HA 2DAPA 5I9NA 4D43A 4NNJA 4RVGA 5AXDA 2Y1DA 4BNLA 1Q7GA 4CQMA 2D4AA 1ZMOA 5F5NA 4ZGWA 1ZVMA 4W7HA 5ITVA 1EEHA 4XYBA 1J6UA 2C20A 1HSOA 5CG1A 1XSEA 1H94A 1ZSVA 5JCJA 3K30A 2GZ2A 2DBVO 2FHSA 2WD7B 4LGVA 4YAGA 4JJGA 4JP3A 2Z95A 2O7QA 3AI2A 4MIYA 4BKUA 2HRZA 1B26A 4HNHA 3FBGA 2HAEA 3CXRA 3F1LA 1E7WA 2J6IA 4AJ2A 4CMCA 1E3WB 1KYQA 4DPMA 1XWFA 1M6WA 1YJQA 1P44A 2E49A 3VH3A 4W9NA 1XGKA 1JA9A 5L7YA 4H15A 1KC3A 1PGJA 3GZNA 4Q3BA 5L51A 3QVWA 5I7VA 2DM6A 3DMYA 4M86A 3L4BA 1E7QA 2B36A 2CVOA 3H5NA 5JFOA 1JTVA 1RPNA 1B7GO 4YT5A 3WLEA 1Q0QA 4IXTA 1PQPA 4LW8A 1F12A 1C0IA 1K6JA 1O9BA 4CLOA 4D44A 1XELA 3BHJA 1DAOA 5T64A 1DPGA 2VUTA 1C3VA 4F6CA 1ZJZA 1NPDA 4PGFA 2JD2A 1IPEA 1R0LA 3GRPA 3CZMA 3L4BC 1CETA 5I7SA 3PPIA 1ZJYA 4Z9FA 3RSHA 1KEVA 3PLNA 4J9UE 4IGFA 3NDJA 1VSUA 3ST7A 1XEAA 2ET6A 4O1MA 4CUZA 1RWBA 1EDZA 4B4OA 1N2SA 1QORA 4PLGA 4RO0A 3PYXA 2EERA 1LRKA 2I3GA 3T4EA 4JXKA 4EI2A 4S3MA 3I6QA 1GY8A 1ZBQA 1YBAA 3GK3A 4R1SA 4BKQA 2Q1UA 4BO1A 2AQKA 1LTHR 5U4QA 4GKVA 5KKAA 1ORRA 1UP7A 1WWKA 4PLPA 5G0VA 2C54A 1V0JA 1BW9A 3OP4A 4ZRNA 4PZEA 2ZKLA 1IULA 1QRRA 2AEFA 1YH3A 1G0NA 1PJTA 5JC8A 4FJ0A 1DOHA 1Y7TA 4R5HA 4FD3A 1H93A 3H3FA 1WZEA 3B20A 3E5MA 1WDKA 4BS9A 3DBLB 3WR5A 1MXFA 2YHIA 3SEFA 1RM4A 3DR3A 3DDNA
chains in the Genus database with same CATH superfamily
5D6NA 5DU2A 1AZTA 3PCTA 5K51A 2ZKIA 2QN3A 3FVQA 2J4FA 3D6JA 3IKVA 4RM3A 4MLDA 1OFUX 3S99A 2RKBA 1HX7A 4L0MA 5EZYB 2NNWB 3PRJA 3CN7A 1XV5A 2ZUEA 4KQ6A 1AKEA 5DB4A 2ATCA 2HN9A 4TYYA 2XODA 3KQUA 4K81B 4KITB 3F5SA 3OT1A 2XUFA 3AOEC 1W5AA 1YRHA 2ZTDA 4IV5A 3BXWA 2OSVA 3OEYA 5B6PA 3I92A 4XIJA 1RU3A 3RV3A 3AZOA 2D2XA 2A0FA 621PA 4YJ2A 2ODNA 4ALLA 2ZRIA 2ZIFA 3TRJA 5JD5A 1OIPA 3CJQA 3QF7A 3R6DA 2FLVA 4GKJM 3I5AA 1B74A 4LDPA 1KFKB 2BR3A 1V8OA 5FOSA 3PYMA 2GZ3A 2WWTA 1JT2A 3WA6A 4JJ8A 1GQFA 2QRMA 1R4ZA 4EKDA 4C05A 2LVPC 3CUYA 3T4XA 1SCJA 2BELA 4BNKA 2NP7A 2W0SA 3DCJA 1QH8A 1QO0D 2AZTA 1OZ0A 3VZPA 1S4MA 3DE6X 1E9RA 5J1TB 2BFWA 4PVDA 2C8KA 2H1FA 1PGYA 4DG5A 3L79A 1M34B 3ODGA 4X91A 4PYRA 3OZSA 1IAVA 1E99A 5DM60 1ZNXA 2Q3EA 4G84A 3SBDA 4E21A 5IH7A 2B30A 4O29A 5EHGA 3EIOA 1A5ZA 2WTAA 1JIJA 1PS0A 2Y0QA 1D8TA 1J8FA 4XLTA 1DIGA 4ZYYA 1JHMA 2C2HA 2EX4A 2XGMA 4XD7A 3T9EA 1MJ5A 4LOHA 1AHHA 1ZCZA 2LHGA 4JR0A 2PV7A 1F6DA 4PX5A 1FP4B 3I9V6 5ALMA 1NNUA 4XIIA 2FSSA 1E2MA 3IAS6 4ZGBA 3DTVD 4GKJB 3H83A 4WK2B 1NYLA 5JSQA 3IVXA 3ESQA 4OQNA 3RJ9A 2F8TA 4XIGS 2CWBA 1YIAA 1FPMA 1OH5A 4RK4A 1GR1A 5C5EA 2IE8A 3MC1A 1D9ZA 4EO7A 4F04A 4PZPA 5DFAA 1EBUA 3R24A 2CWDA 1G17A 4QBFA 4UCFA 4BMPB 5FDFA 1W1IA 4MA0A 3G88A 4OKNA 5EVJA 3PGMA 2QX9A 3EPLA 5A5FA 1YC5A 3ZHYA 4IBEA 3LIPA 2F3UA 3ILKA 1CUDA 5BWBA 3B2QA 1AHIA 1DDGA 3OIGA 4X6XA 4GWKA 3PX7A 3BXOA 4FMDB 4DNFA 4F2GA 1ZHFA 4RFSB 2HMTA 1YIOA 4KI0A 2ZIXA 5BN5B 2PZEA 4BMYA 4E5KA 2G4VA 2JARA 3EG5A 1IWBB 2YZMA 3I12A 3VZSA 1SPBS 4QXMA 3VMMA 4UTRA 3KOOA 1OKSA 5AIBA 1K8QA 3RC7A 1ZH4A 2FW0A 3K9PA 4C30A 4P3OA 5JH7B 1QFZA 4TV9A 1P5RA 2OO5C 4I0WB 5TXGA 4BFUA 1KZ9A 1NKVA 2JGNA 1BEZA 2HSJA 2DFPA 5HIMA 2XW6A 3EPHA 4HDMA 2QNJA 3RD5A 5ICSA 4FYVA 4BNFA 2EEZA 4E5MA 3CRVA 1YFKA 4PNZA 3Q8LA 2HK9A 4L6V6 5M34A 3QU4A 4NMHA 3ADBA 1IM5A 1U7OA 3E0QA 4KPEC 4Q4HA 5KYTA 3PXGA 5JTTA 1KOFA 1I33A 2QXYA 4EF5A 2X2FA 3L8GA 2DRIA 2XUKA 4U39A 2HT1A 1JJBA 1TAQA 1C29B 4UQPA 3PK0A 2DHYA 3NAGA 3N5CA 5BV0A 3M4XA 1D4AA 2O6HA 1NXOA 1DRVA 1CR1A 3OZRA 3OI7A 3IVRA 1R2ZA 2I29A 2ZBPA 1EGVB 2VSQA 4BLPA 4ALJA 1J06A 1W85A 2FDCA 3U81A 1MORA 2P2GA 4Z0NA 2NAFA 2QE7D 1AOXA 4B3JA 2ODWA 2WFAA 3SDBA 1ZN2A 3H4VA 1TX4B 2YOFA 4FMDF 4KDFA 3R3XA 4ZEVA 4ETIA 2ZSJA 3OMWA 3WAGA 2XIQA 5F52A 1E8NA 4E2YA 1XXLA 4I3FA 3EC2A 2VAXA 3ZW8A 1QTRA 4JL6A 3ZE1B 3HKDB 3NVAA 1NVVR 3RRNA 2DG2A 2VJNA 1K88A 1MEJA 4L85A 3RTAA 4NBVA 4Q4HB 1YDFA 4IGAA 2EP5A 4W5QA 5JH7F 4D9KA 3PQ6A 2O5VA 4WT7A 3P97A 3J7BA 2Y1KA 4G67A 2Q5HA 4HUQB 2MSEB 5F4ZA 4M89A 1H85A 3W06A 2ZUWA 2H5LA 4GOKA 4B87A 5CJPA 1XZKA 3IH5A 1NW8A 2HIAA 1ORYB 2D7GA 2P5SA 4OVKA 3MGAA 2CYBA 3LYHA 3WB0A 4O63O 1YS2X 3I04A 4MEBA 4IDNA 4KAJA 4UVGA 1OWLA 5KTTA 1EXVA 2CVHA 3QXJA 1W85B 3TUIC 1QOZA 3CNOA 1GTJ1 1F4LA 1E0KA 4H0CA 1RYDA 1BQ4A 5CA0A 2YN4A 3JU3A 2QTMA 3IVGA 1KFJB 3BICA 3JVDA 4B2LA 5KHLB 4KT0F 3T1VA 4JR2A 1T6BY 3L06A 2CCKA 1GDTA 3AM4A 1K0UA 1UPCA 3CLUC 5IZ4A 1QE3A 2B3DA 3WXMA 1FP7A 1SOMA 2FZKA 5CTJA 4CCYA 4DE5A 1NG1A 2I62A 1Z4OA 4BAZA 1LX6A 1K8XB 3A27A 3TTWA 3MINB 3GXOA 2EBWA 4N47A 3ROGA 2G9RA 3AF0A 1J7JA 1PK7A 4KMOA 3PNBA 3RU9A 1Q95A 4ZCTA 4JSRA 1SKAA 4PQFA 1WMFA 1KMHA 1YZTA 1J2EA 1JDNA 2C2WA 3ENWA 3I0NA 4J4HA 4G41A 2VDNB 5IF3A 4KFCA 1KVQA 1E94E 3P20A 4D4LA 3DAGA 4BFXA 1UBTS 5AKGA 1I3OA 1W5SA 5KINB 2C7QA 1KDPA 4DA7A 4GAEA 4DXDA 1JN0A 2VQDA 2WJAA 1ORTA 4UHFA 4DADA 1TIPA 1HE5A 2FV8A 2BTQB 3ER9A 5BR8M 4CM1A 2Y1OA 4QX6A 4PBTA 3MF4A 4N3CA 2DETA 3W34A 4I36A 4LRXA 5C9ZA 1VIMA 4MCAA 4AO6A 3G02A 2RH8A 4EPXA 4M1MA 5ILOA 2P1DA 1BN7A 1J70A 4QATA 2CF5A 1ZR2A 3BWBA 2I22A 1NLUA 4B6FA 5J4LA 2GM9A 2EGGA 4MS4A 2FWAA 1U3TA 1UBGA 1Z5AA 4H6XA 1B8OA 1QK4A 4HADA 3WIBA 4XM0A 2BFEA 2VHZA 1II0A 2AJCA 4IRXA 5GV8A 3PDHA 1ZNYA 1FLAA 4FS3A 2WY2D 3KZKA 4YJGB 4DCOA 1Q2UA 3L0PA 4R8SA 4BGIA 1M1YB 1O6FA 4GXNA 3STTA 1NYQA 4RTQA 5CVJA 1IK4A 3T06B 4D2IA 2YBEA 4Z1MD 4JQZA 1IY8A 1D2AA 1P2BA 3LBNA 4RXMA 1CPYA 3UN1A 6REQA 5BR8B 4DTIA 3MAAC 1A7AA 1ZD8A 2J59A 1DWOA 2BT4A 3DKRA 2ZAGA 2GCOB 5A62A 2NZ2A 3SYKA 3HSSA 3EFOA 1IH8A 1PZHA 1IDN1 1EI9A 3EVGA 3JATA 5KHOC 1VGQA 4B7UA 2Y2UA 3KPUA 4OF4A 3Q12A 4I2VA 1VB3A 4G0PA 1MENA 5D01A 4E3ZA 1CZUA 1M7GA 5ESWA 1S2NA 3I09A 1RD4A 2PKCA 2JFWA 2DZOB 3S40A 5EKDA 1MPXA 4FVMA 3I8SA 4HEHA 3K71B 2VBGA 1KYVA 5K8IA 3D8LA 4NARA 3CINA 5BMVA 2BFEB 2N1MA 4M0PA 5ITRA 2E4YA 1LNSA 1FNMA 4D25A 4JGIA 2OGUA 4BE9A 4AMBA 1BEUB 2VDLB 4N49A 3NUGA 3AETA 1DEAA 1IE3A 3MMSA 5B55A 1XQ6A 5I9LA 1QH9A 5H59A 3RYFA 3PT5A 4IDFA 2JJ2D 3ENVA 4RD0A 4E0BA 1VL5A 3U1VA 1KH3A 2PIDA 1DV2A 6REQB 4R3WA 2QSYA 1ZXXA 2GEFA 4ECAA 3AJRA 5FBLB 2XCLA 2DVMA 3BQMB 1UOPA 4F2HA 4IKPA 1DCKA 1YUBA 4LI3X 1DRKA 1KJIA 2EKKA 4O4JB 4D02A 1QS0A 4GRAA 3LMMA 2Q07A 4FTWA 3G68A 3EVDA 3W2TA 1FL9A 1YKSA 3W4JA 1UDBA 3WJAA 1VE7A 2X2EA 4QUDA 4YT8A 1L1FA 1B93A 1PHRA 3G9UA 2E4AA 1EFPA 4LWQA 3FNBA 1KMNA 1UODA 2DUWA 3ZX4A 3F47A 1FS4A 2G9UA 3ICPA 2ON6A 1IZ7A 1EZ1A 2Q5JA 5J5VA 1OJLA 1N2GA 2BDEA 4LSWA 1VE1A 4RCZA 1MW9X 1U04A 1T2VA 1XVLA 5A9TA 2GWRA 4W9NC 4Y9TA 1YE9A 2VG8A 2ZAOA 3OOWA 1ZCJA 3UJ6A 4MRAA 2RHHA 2QMUA 2P65A 4MWOA 3K9WA 3LQYA 3TNDA 1UEJA 2XYGA 3KQLA 3RYFB 3PICA 2UZ0A 1XZEA 2AEEA 3R20A 1EYZA 2YHUA 1XHBA 3JAWA 2WD9A 4XR4A 5HSGA 3GDHA 1OXXK 1DX9A 3FSEA 2X49A 4AY2A 4BNDB 2IXAA 2AJDA 4V0KA 3RREA 3SSOA 5KJFA 3MTBA 4AZ0A 1A9PA 3BH6A 2WD8A 4HP8A 3DS8A 3VDXA 4DQUA 4ZANA 1AMUA 1PI3A 3WGTA 3D7KA 1GSAA 1XP5A 4P38A 4DIFA 2NTJA 2P30A 5F78A 5C4GB 4QXOA 4OMFG 4G4SO 1NHWA 5F77A 4ML3A 3HCWA 3N6VA 4DR2M 2OGZA 2G1UA 1GJRA 4FGWA 3O8OB 5KIAA 3DZHA 2QD2A 1MD9A 4FBLA 1JIVA 1H6CA 3O83A 2JHGA 1Z5BA 1H1LA 4O4JF 3K92A 4KXNA 4N7RA 1FNCA 1CUCA 3R74A 3U7JA 1KTVA 1XEXB 1LLDA 1GN9A 1QU2A 4W1RA 2O20A 4RSMA 1V7PC 4K5QA 1VM6A 4YCMA 1CQZA 2FMXA 3DTVA 1O0BA 2FRVA 3U6OA 1AUPA 2SKEA 1ZCBA 2X9LA 3CC8A 3TBHA 1A8QA 3ANSA 1SCIA 1ZIXA 2GKOA 3TQFA 2F1KA 4MK4A 5E4FA 3GLGE 2ENWA 3MCWA 5DTRA 2XBLA 1O89A 3N2YA 2M1XA 1UP4A 5CNMA 2EFJA 4ZT3A 3B1YA 3BILA 3C8HA 1E2EA 3CNHA 2GT1A 3FGNA 2VP4A 5FLXS 4PZAA 3A4YA 5CLFA 4D1YA 3SHWA 1RM3A 4FDVA 4DR2B 3BCHA 3AKDA 1N5RA 3DE4X 2QDKA 2H65A 3L7DA 1C7EA 3A2MA 1VJRA 4LRTA 1HSZA 2ES4A 3L7KA 4GGMX 2F5QA 1N9GB 5GOTA 4C21A 1MB9A 1KSFX 1CS0B 1AN0A 5THQA 4ZOQI 3LD9A 4S1NA 2JHPA 3GX1A 4PU0A 4ZV9A 3KSMA 1A5BB 1I4TD 5LXTA 3NM4A 5L4SA 4OP2A 1JB0F 3KXDA 1HLPA 2PSFA 2EGHA 3DTVB 5EQFA 5FA6A 2X5KO 1MAVA 4ND6A 2Y1WA 2W8BB 3DZKA 4JL5A 1MO3A 3H1TA 3ORSA 4CKWA 2GMWA 3S3TA 3JARA 3C8DA 4DLLA 3D0OA 4QOHA 2KW0A 4PS0A 1V37A 3U6DA 4GI2A 2P1RA 3TE6A 4ZT6A 5HR5A 4LZJA 4P7BA 1VG0B 4K6KA 2H2GA 2LXNA 3TKAA 1LK5A 1ZM2A 2Z7JA 2D06A 4CCWA 2QYHA 3FDFA 1L4EA 3CXUA 4H7PA 1IB6A 5IJXA 2NU8A 3VV3A 4R9NA 2GN8A 4IUCS 2GGSA 4LCEA 4FCTA 1Z5NA 4D0RA 3E9CA 2QUKA 5K0ZA 4OOFA 4PDIA 2CW5A 5FYDA 2D1SA 1KFEB 5EHQA 1ECGA 4B9EA 5G3ZA 4D92A 5KOYA 4YCNA 2I7CA 2OQVA 2W4QA 5LXTB 1HFEL 2Y66A 5AOVA 4JVLA 5FBKA 3G7NA 3HJCA 1PG2A 4PVCA 4P4GA 2I2XB 5DN6D 1QYIA 4GUAA 3U3XA 1EU1A 1FTNA 5I9BA 3WGJA 4LVNA 3DOIA 2QE7A 1Q1NA 2ZTSA 4CRWB 1RWQA 2PMDA 4DCSA 3TZKA 1DJQA 2OYCA 5E8RA 4HRVA 2HK8A 5FBRB 4F1WA 1RI5A 3T9BA 2WP8J 4LECA 1ZC4A 3JARB 3RFVA 2UUOA 1FW8A 3N2LA 3ZGLA 1KIMA 4L50A 4EHHA 3O4HA 3T7RA 3PHLA 4KR3A 5UKDA 4UQOA 2WIGA 5CDUA 2FZ5A 1W4RA 2V58A 1LTQA 1A72A 4QFMA 3EAFA 1DKQA 3IEVA 3G2HA 4IGEA 2H8GA 2NU8B 4RLFA 4U4AA 3C3YA 1RYFA 4V1CB 3B48A 4GMGA 3RIYA 1ECFA 4YRFA 4JI8M 1Z33A 3ME5A 3KSBC 1AUQA 1OR8A 4IIJB 5BN1A 3O75A 3I01A 1KP3A 2W58A 2VF4X 2AG6A 3ZDCA 5E1MA 3COJA 1ZMOA 5F5NA 3KQPA 1XVAA 3RFWA 2QA5A 1P6UA 1J6UA 1GLVA 4FZJA 4X62M 1ZSVA 3NUZA 2KZSA 4F4UA 1M8GA 1USVA 1MQ8B 2O7QA 4LFBB 1TZJA 3D1JA 1Q20A 3RADC 3ND7A 2Z5GA 1E3WB 3TEMA 2D2VA 2FWPA 2XB9A 1QGOA 4HZIA 4JI7M 4BYMA 3IIKA 3NBUA 4MA4A 2DOKA 2GBPA 1RW4A 4MMZB 3RWMB 1W29A 1N25A 4WDRA 1G59A 2HA3A 3UTDA 1YHZA 3L4EA 4H4EA 3T4EA 3C6QA 1S2GA 5HCNA 5LXTF 2OTCA 2AQKA 1SK9A 4OX9Y 1KRXA 3HDVA 3A1SA 5ALEA 1U9IA 3MIZA 1QRRA 2AEFA 3CZAA 4JI8B 1V45E 1G7TA 3ABSB 1YT5A 1ZI6A 3IAUA 3SEFA 3B1ZA 1O6GA 1LDBA 4ZU3A 2OV2A 2BM1A 4MR9B 3RFUA 3AR5A 1NY6A 4ZK6A 1CUZA 3ZK9A 3E3LA 5FR2A 3MERA 4X62B 3D4LA 4CF6A 2D1RA 1NBHA 3OEHD 3AEZA 3TNLA 1HA3A 1YMQA 3D3QA 1CQIA 4CIAA 3MHVC 2JY6B 3VNVA 4JI7B 5D86A 4UTVA 1U7ZA 3L1HA 2A57A 1CBUA 2XOXA 3ZV4A 1KZYC 4HB4A 3OPYA 4RKUF 1N8NA 1GVHA 5FTLA 1SMKA 4TVKA 2JNHA 1Q83A 4IIJF 1M2VA 1G3QA 5JS6A 1RTTA 3WJ1A 1NFQA 2CJYA 3EOAI 2PYZA 3N0TA 1ILWA 1JX6A 2IVZA 5KVQA 3SEZA 3W9YA 3GJQA 3CLSC 1PCXA 1W2HA 3ZWXA 3TKYA 2P41A 4I4TA 2Y71A 1DGGA 5B2FA 1AJEA 3ZVKA 4CR8A 3W6OA 3B7PA 4GSLA 1G2QA 1Q0RA 5KSZA 4B6JA 3PWZA 3T1YM 2J3QA 3E0XA 1YB4A 1KI1A 3RSFA 3SYTA 2QLMA 1FK8A 1NQXA 2UXBM 5CXXA 2AOUA 2MINA 2N42A 1U6JA 5EQJB 3BXHA 1M2OB 2R6JA 4MULA 5E7JA 4PCZA 3AF4A 4UXJA 2JP7A 4JU8A 4WACA 5E6RA 3JQ7A 2L18A 3AHEA 4G3OA 5GWXA 5EN4A 1BXRB 2OK8A 3OCWA 3Q10A 3ES9A 4U0KA 4NE9A 2AIRA 4Z1MA 1RMYA 3EISA 6CHYA 2EZ9A 4M0EA 4OP3A 4FSHA 1CC1S 3JWJA 4RDIA 1ZMBA 3NYQA 2LPMA 1KSHA 4XASA 4FDUA 3DHEA 3QWFA 2HI0A 5KEIA 1M2VB 5ITQA 1KL7A 1EFKA 3QFFA 3GVCA 4YJHA 1NP7A 4H7HA 3VPHA 1KVTA 2GPWA 5JY6A 4QARA 1OX4A 2DSTA 3PGXA 5KSPA 1FTSA 4E1VA 4I4TB 3T1YB 3PA8A 5DCWA 3BQNB 3T3OA 3PWKA 1MH1A 2AN1A 2UXBB 3BJEA 1ZK0A 5AKZA 3FYCA 5ILGA 3H99A 2P11A 4ZAVA 2B1GA 2QD3A 3S27A 5AOCA 4NENA 3GGDA 2MYUA 5JC1A 4JI5B 2AOUB 2MINB 2GD2A 3URKA 1D2RA 1CFZA 1ENOA 5I8ZA 4LJ8A 3HVKA 3W5HA 3MAJA 2Q6LA 1V5FA 4LV8B 4XDZA 3ZWPA 4JYCA 4DLWA 5ECGC 1V4NA 2QOEA 2ZTHA 3ZWKA 1P9NA 4XE5A 3RYHA 3T6PA 3V76A 1YMUA 1PR0A 2DPHA 1WDMA 2JJ2A 1TQ8A 4NEGA 2C57A 3TWKA 3KZXA 4EY5A 1B2LA 4BX3A 1UFRA 3U60A 4UUBA 5EJ5A 3D7MA 4YJHB 1FDSA 1B2RA 2WYUA 4YNBA 4X7RA 1U7WA 4IOKA 4UBOA 2OO5A 1DXOA 2QNBA 3O3NB 5U9CA 2IDMA 1OX4B 3AG6A 2GB4A 3W4KA 5IT0A 1TA4A 1UBUS 2HU7A 3LKVA 3HB7A 2EKBA 3V4PB 2V7VA 2ONJA 3IP8A 3MS7A 2VP2A 3S7ZA 2RFLA 2VUHB 2X14A 4BPBA 4BQSA 3ZY3A 1JPVA 2I6SA 5C8YB 3IECA 3H75A 5AJHA 1TQ4A 3PVSA 4LXHA 3UZUA 3G8DA 1JHYA 2VDBB 4FHGA 1I7DA 1JQBA 4NENB 4KGZA 2G07A 4JLMA 5JQGA 2FPKA 2ZS8A 2KB0A 5CIWA 4CDMA 1C3EA 3BX1A 3HLTA 5BQOA 4H16A 1KE2A 4CV1A 4LYHA 3T95A 2CMKA 2G9QA 3BMNB 2WTNA 3O8DA 2VWPA 4FDLA 2GZDA 2ICAA 1E20A 2HC9A 4BRWA 4I4TF 3WZ2A 4Z49A 4GH9A 2YY6A 3PIIA 1P75A 1YJBA 1NYRA 2XECA 1P2DA 4H4DA 4AUMA 4X85A 3RVNA 3GJ5A 1XRSB 2XHEA 1ZY2A 3U60B 2OBNA 1R6UA 4BVLA 2OCYC 5K3DA 4C78A 1X3SA 3UT5B 1NY5A 3SZRA 3PF9A 1IHPA 2IHKA 2LVNC 1J7KA 2A0XA 4AW4A 2QP3A 4HEA1 3HDGA 5CT8A 3IMCA 3EJ6A 2EBFX 3LYAA 1RQRA 2QAGA 3LZDA 5JPDA 1JIKA 1AGRA 1BHQ1 1UBEA 1XP8A 2QRGA 2WF6A 4KIGA 2LH0A 3R0XA 4EHDA 4B8YA 5EPEA 2YW9A 5IC6A 1MOZA 2AFHA 2Z30A 3QFTA 1GV0A 3O4FA 4F3RA 4K9KA 5HTKA 3IOBA 5PNTA 1ZK3A 3RTBA 1F7VA 5JQGB 3BJZA 1CJVC 4MV6A 2O7NA 3R9WA 4IPTA 5FUXA 2YQ5A 1EVZA 4M0DA 1YU9A 4MKFA 3BB3A 4RANA 2EFEB 2WU1A 3LGAA 1D0MA 2AD5A 1D04A 2OHHA 4C20A 5KPDA 1P18A 1TJ5A 4CMIB 5C8YF 5HKKA 2I66A 2W8ZA 4J0JA 5AJUA 4BP8A 1J0EA 4FLEA 2E4UA 2YVLA 3JPWA 4B9AA 2FZVA 4QXQA 2WV9A 1R27A 1X0XA 3CTWB 4CQLA 2IZ6A 4QJ4A 2C7VA 3IQWA 1IMJA 1X7YA 4QOEA 1R8SA 3IDOA 3LPAA 5EGSA 3WLHA 4U00A 4D0SA 4DDTA 1YZGA 1BYIA 2P75A 1EDEA 4EYEA 5IYZB 1BH6A 3E3AA 2AFHB 2BRUA 1CE8B 4NLLA 2QQEA 3KSUA 2XEXA 1ODIA 1DL5A 2C03A 1S2OA 4IYRA 5D8DA 4CMBA 3V00A 2X4GA 3I5UA 4M8NE 3RVKA 1C5KA 2A3RA 2FMFA 5EMJA 5HF9A 3FKSD 3B9QA 1I3LA 1TF5A 1UR5A 2CXOA 1JILA 2BEWA 4K88A 3HXKA 2F59A 1RT9A 3SJUA 4E5NA 1STOA 5GONB 4REOA 4C08A 2WM8A 2HHCA 4BWFB 3U9LA 2X13A 4GKKM 4ZQBA 3A4IA 3DAYA 4M99A 3VA7A 4NV1A 4OB8A 1DTSA 3WI7A 3AYXB 1DSSG 1WPGA 3Q3IA 1QHHA 3ILYA 3M6VA 2XE4A 3MTDA 2E7ZA 3IG8A 1SVLA 5FPPA 1SFRA 5JQGF 3EYAA 4XI9A 5BPHA 4F38A 4CQLB 4YCAA 4DLVA 4WOCA 2DFKB 2DUMA 1XPOA 4PDGA 3K7EA 8ATCA 3W6UA 5KVCA 2CNBA 3DUFB 4MPTA 4UATA 3TZEA 1N5JA 1OIVA 3V7YA 5D1HA 1J25A 4XDYA 3DV0A 4YACA 3A9TA 5DNDA 1Q5PA 2R87A 1IN6A 1I4OA 5ARCA 2O2YA 2HDOA 4PGMA 2I55A 1RHJA 1NVDA 3GCGA 2DERA 4RA9B 1GZ4A 1ZL0A 1A71A 3KDAA 4BC1A 4PV7A 3X43A 4NAVA 3BRQA 4BNZA 4LEIA 1T10A 1QF6A 4DVGA 1FSGA 4ME6A 3GA0A 4MI9A 4ZZ1A 1XDUA 4BMZA 4Y9RA 5L95A 2Z8YM 1YS9A 4UN2B 4JT4A 1NM5C 3QKWA 2H4JA 3K31A 1FF9A 5KYWB 1M33A 1Z8FA 4G0QA 3FWHA 5IYZF 2CBGA 5AK0A 4RZQA 1QHHB 1JHAA 5DN6A 4ZOLA 4HBZA 4F85A 1II8B 3EMKA 4I8IA 2PR7A 1WMAA 1E60A 1R8XA 3AJ8A 3TM4A 2ZTCA 1P8JA 3THXB 2J9ZB 5CDFE 1TJYA 1MZPA 1ONNA 4LVOA 4B4UA 4D9FA 1H9AA 1ZH0A 3PFHA 1XVTA 4FFPA 1EFTA 4IHQA 1TCAA 1WAMA 5GONF 1Z88A 2WQ6A 3EVTA 2B78A 1VSQA 2X2OA 1P91A 4DA0A 4HLUA 3REQB 1N6RA 5C80A 3JD2A 5HBRA 4QFCA 4ANFA 3L0CA 3K9LA 2PL1A 3QE9Y 1JG6A 3M1LA 3EXHB 2CT8A 4C4TA 3CNLA 2P9YA 2K87A 1WZNA 5BN3B 1U9ZA 3OX4A 3PQ7A 4TMYA 1IY0A 9ABPA 3EZLA 2IEAA 4EVIA 1ZIDA 1O1YA 2XLCA 3LPDA 2JAHA 4XX1A 2PN1A 1TPYA 3JZFA 3C85A 3OOEA 1YCDA 3NVKI 1DQPA 4BNIA 3EG9B 1PJ3A 1J07A 2CXNA 2C29D 5AJZA 4D8VA 1XCGB 4Y2SA 1O6BA 1N2CE 1TEZA 2X3YA 4PLTA 10MHA 4OLAA 3KQSA 1T5TA 1YXMA 4CU5A 2ZEJA 4ZOLB 4YXFA 1SU6A 4L9AA 1ZD4A 3TINA 1G3RA 3MD9A 2H0QA 4QBKA 1SY7A 3SZLA 3F7TA 1MO5A 2ARKA 1I1QB 1JE1A 9GPBA 2JJQA 3CT4A 1SULA 4XYMA 2YL2A 3F96A 3COVA 3W9SA 2PUGA 3GI1A 1VRCA 1U1GA 4BY9E 4R01A 3A58B 3B60A 5KDDA 2FPRA 2HB6A 5FT9A 2PXAA 3LUAA 4S12A 1ZJJA 2VYQA 3IQIX 4YUXA 5EUMA 5DNUA 3HR7A 4MKZA 3DDUA 3DULA 4CKYA 5EZYA 4Z9XA 3IAFA 4TX1A 2VYVD 1OZFA 4UFNA 3RVMA 4HFNA 1YZFA 5FV7A 4U2CA 4JR1A 2JFGA 2OC9A 2BIFA 3F97A 3O7MA 1YO6A 3OEHA 2IU6A 3MWDB 4F56A 1BX1A 3I64A 5CIQA 2WZJA 1CUKA 5DLQC 4XYEA 3GYGA 3R0QA 3K4QA 1EVYA 3AY7A 2WJZB 3BBLA 2CC2A 5LBTA 4UNRA 2DWCA 5MDHA 1U7XA 4EEZA 1K7FB 1QQWA 3JAKB 3JV7A 1UPUA 2WMYA 1Y7PA 4WJZA 3BIWA 1GTZA 2PNFA 4Q4AB 3NUQA 1YCGA 2C9OA 4MLCA 2Q2EB 2PJRA 3DMRA 2C00A 3ORRA 3CF2A 2CUTA 2FS1A 1P1CA 4J4BA 1SBCA 1VBKA 3H2ZA 3TO5A 1KORA 4AF7A 3FTQA 2OR3A 3VSCA 5JNUA 5EPOA 4A27A 1H69A 5HCUA 2WSFF 1U9IC 4MPDA 4ZOLF 2V5VA 5JZVA 1G5IA 2KJQA 1KAEA 1XQVA 1BXGA 4UUNA 4G89A 4BKOA 4M9XA 5U4XA 3EDQA 5DNVA 4YPOA 1M34A 1VBMA 2GBLA 3STXA 1QZEA 5DCYA 2Y8EA 4FIDA 1SD5A 1EGHA 2EQ5A 1U6IA 1B8PA 1UJ6A 2XCUA 1KU6A 4YV0A 1CUYA 2IPOA 4Y6RA 3I9KA 2R86A 1WGLA 2QWXA 1JTEA 2Z8ZA 2GM5A 4Y2QA 5AW5A 4NAHA 3FBWA 3AUSA 3EARA 5AM2A 4A1OA 2OFPA 2UYCA 1FP4A 4XQ9A 3O26A 1B15A 1RKBA 3A04A 4I5DA 4R2MA 4M98A 3RYIA 3DHVA 2WIDA 3IT1A 1UC5B 3I3SR 1CUWA 4FNOA 1QE0A 1RXIA 3LV8A 5BORA 5BQPA 3FLMA 2QPAA 2E4VA 4CMGA 3V1MA 1ENPA 3T6KA 1Z3IX 4C1BA 1XZNA 1MO6A 3GQ4A 2NTVA 3NZEA 1BXGB 4B7FA 3C87A 4Q82A 2ZAYA 5DSTA 1X94A 1LF0A 1L5ZA 2QLFA 1AK9A 1H3NA 4BNVA 1H2XA 2BMDA 1W76A 2H9YA 4V0SA 4QOGA 5TGZA 2HQ1A 1AKYA 4Z3KA 5JD4A 2B4KA 5MHTA 4RKFA 4RFSA 4Q6WA 4NV3A 5BN5A 3QFSA 3DPSA 1JVBA 4NFYA 4US1R 2FWRA 1MB3A 4KZPA 3O03A 1HC7A 5EZYF 4MVJG 2OHJA 1JI0A 3MUFA 2HPVA 4XKJA 3RYIB 2W22A 2WE7A 1Z28A 3MZ0A 4K9LA 5JH7A 2V7PA 1HI9A 2WILA 1TU0A 3LIIA 1JKXA 2X8LA 4NYJQ 4TLBA 1OIWA 1D2NA 4MUBA 1VIYA 2JFQA 1W1UA 1SXGA 4N03A 3DWIA 2FPUA 3H5WA 4NCXA 1RCUA 2QGNA 2REOA 1HPLA 3RU2A 4NOOB 3FOEC 1QQBA 3K09C 3HHXA 1NN1A 3A14A 3GFGA 3TR5A 5HIIA 1NI3A 2QORA 2OXFA 1EP1B 1R16A 3UHOA 3OQOA 5K3FA 2GILA 1LZKA 1RKVA 3AL3A 2CD9A 3F9IA 2VDOB 2O8DB 1H3FA 2EP7A 5L8VA 3EZGA 2IYOA 3BMOA 4RJIA 3RU3A 3SLRA 1WXQA 2Y27A 1UBCA 4XJSA 5BO5A 4M8SA 4C3ZA 1P4GA 2I99A 4J7AA 3AHDA 2H6EA 4L0CA 1G3MA 5IAKA 2CYAA 3L43A 5JOQA 3CEAA 5IDQA 2X0RA 3AV3A 1YQ9A 2QEQA 5LQNA 5IS2A 1ZVJA 5C1BA 1N1DA 3IBYA 5LU8A 2O19A 3U09A 2QTAA 1U1CA 3D6TB 4LGCA 5HK9A 1GPJA 2FEPA 2CSXA 3BWVA 3DONA 4FWDA 5H16A 4PC1A 1D2HA 3H17A 3K2LA 1SOAA 5AUNB 2IY8A 2I7XA 2D5LA 1A96A 4DRZA 4FC6A 1N3BA 1UBRS 1I2AA 5HVNA 1EMDA 1ISGA 1EE2A 3EEBA 2GZSA 3ZN2A 3QMVA 4EMTA 1FDIA 3ZDYB 2HRRA 2WPDA 3FSJX 3R5JA 2G04A 4O2AA 5L4NA 3HKDA 5K3FB 2HWUA 3C3KA 4PZ9A 1E4EB 4QPPA 4Z4GA 2QTVA 2NXEA 2H2HA 4RKRA 4D79A 3ZWNA 4XVRA 1OXMA 2OCPA 3MWLA 1X1QA 2XJ9A 1F0YA 1Z4LA 3BMOB 2UU9M 4P2BA 1K98A 5TC4A 4HUQA 5BSWA 3ZWVA 4OL0A 2XFTA 2GF2A 1XAIA 3MFYA 2AHMA 4EPYA 1ZG3A 2KNAA 4EKIA 3Q0TA 1E0JA 4R40A 2OEPA 3OX1A 3AUFA 3K1TA 4KRFA 1XNHA 3GUZA 4TT3D 1XVUA 4EKYA 2DBVO 5BWCA 4DARA 1G7SA 4UDNA 4HNHA 2F8LA 1U0LA 2PA0A 2AKAB 1K2VN 4EYSA 1K3UB 2HPAA 4NS4A 1CR4A 3H5NA 1PK8A 4XAQA 3TOCA 2QAGC 2G63A 1CR2A 3CCFA 4H3KB 2HNBA 3F2IA 4KJXA 2G5TA 1CETA 1FUKA 1YI1A 2ET6A 5EFOA 1H1DA 1UKCA 2IYFA 3IDQA 4ZTBA 2XNCA 3S4YA 4HQKA 4O2AB 3MRSA 4LOJA 1A8HA 5C8XA 4C07A 4ITVA 3MWYW 3MINA 2QTVB 2PQMA 2M2IA 2UU9B 5CH8A 4HVCA 1W48A 4ZRNA 3FKSA 1K5PA 1IULA 3M3DA 1CY4A 2G36A 5JC8A 2RJNA 2ALJA 1WABA 4JMPA 4OQZA 4PO8A 2IRWA 1U2RA 1OREA 1K3XA 4R9SA 3GFSA 1SVUA 1HFKA 2X6RA 1NSFA 1SA0B 3E21A 2HSGA 4DUPA 1O8BA 4UZSA 3F73A 4MLPA 3FZNA 2G8LA 3MYYA 3FXAA 3GZ4A 4RJ2A 3PQ5A 4LK2A 2HQRA 1BJRE 3P7MA 1USUA 1Q57A 4A3SA 2BTQA 5JXWA 1TRKA 1T4GA 3ZS8A 1AGPA 4B5KA 4RACA 5CB8A 2DQKA 4G1CA 4RADA 3H1AA 2C8JA 3CRZA 3ZTYA 5ALXA 3P26A 3PRHA 2BRUC 4CIWA 1C1KA 4W5TA 5HE9A 1XUOA 4AZ3B 1SOVA 4LDRA 1SZDA 1C0LA 1DHTA 2YZ2A 3A42A 4G5RA 1JEQB 2RHTA 4CLXA 2FSPA 5LQDA 1CZLA 3PZBA 1L5HA 2PSDA 3N07A 4FNGA 2GD1O 3JYOA 3T9CA 3QKUA 1FXSA 4JENA 1ZZEA 4EMUA 1E69A 2VKTA 5J40A 2Q6KA 3LL4A 4RDCA 4ZYTA 2QQ5A 4MGKE 2XT6A 3ZCQA 4RF2A 3HMQA 1UF9A 1Q16A 3DEJA 4HH1A 3TI9A 4K3UA 2QL5A 4YJGA 3DE2X 5C53B 3TIXB 1M1YA 4W5HA 2A84A 3A1WA 4O2AF 3M2TA 1AGNA 1E66A 3WNQA 4I46A 4U2DA 4AJHA 1QG0A 4RY8A 3GR6A 3HKCB 3ODPA 4YECA 3MGKA 4RULA 4HF7A 2YH2A 1C4XA 4WNCA 1RI3A 2GCOA 1NMSA 4V0OA 4BUJA 1H6BA 1AS0A 4YP5A 1A2BA 5T8KA 4MRVA 4RPHA 4O02B 2VT6A 4F72A 2BGNA 4QPDA 1X1BA 3SAJA 3VTAA 3FFAA 3AC0A 4WN3A 3TNFA 4UPVA 2OHIA 3DZBA 1S2LA 1TKCA 3U13A 3PTAA 2FMHA 1J2RA 1SCDA 5FTMA 4RMIA 3T3GA 4X71A 1HG0A 3HCBA 3WP1B 1L5HB 3HKPA 1XTQA 1QQ7A 3FRJA 4FCCA 3ND6A 3TJRA 1Y1KE 4UREA 5JNVA 3X1WA 1I2CA 3B36A 1MJHA 4G9BA 3C7AA 2KRKA 4J0HA 5BQXA 5M7EA 2X58A 1MC4A 5HUJA 3IAS1 1XRPA 2ANBA 3LLCA 1INLA 1U2DC 2IUSA 4CT4B 3G79A 1SN7A 2DZDA 4KQEA 3UMMA 4GUDA 3QUSA 5KAMA 1RJEA 4PE5B 2Y6UA 4PXYA 4L8RC 4XWTA 1H5QA 3TEFA 4BQNA 3KR9A 3B82A 1ICIA 3I51A 1KSJA 3ETEA 1RP7A 2O57A 2EKPA 2Q2NA 4G4OA 4O4JA 2Q45A 1JQLB 2E48A 3LWZA 1H4SA 5F3DA 3RK4A 4HLUC 2B8JA 5JZMA 1QFSA 3IR5A 4EDHA 3UKOA 3KQWA 1G19A 2DVWB 4A0HA 4LDJA 4UCXA 3E4DA 2KNZA 5DM70 1IVNA 2B7LA 1EWQA 3DCIA 3I0MA 2X0IA 2VYVA 4EGAA 1WCWA 3NEJA 5F73A 4BO3A 3QJGA 4I8XA 3I6MA 1JU9A 1WCYA 2PGLA 1URPA 1TK2A 5HS4A 2HRCA 3TGWA 3GLQA 1VP3A 5CUQA 1GPWB 1QF7A 5HTOA 4GC9A 1NMEA 4DCTA 1QYRA 2AD1A 4X8LA 3GEIA 1L3BA 1KNXA 4I4CA 3ZVMA 2DBYA 4NOLA 1EVKA 1G8KA 1K63A 4UJ3A 2IGBA 4BNDA 7MDHA 4YCBA 2LDBA 2Z2KA 1XLVA 4KSCA 5MN5A 3EH2A 2ATIA 2NU9B 3LT5A 3DZDA 3C8ZA 1T9GR 1G8HA 4ZO6A 3WMGA 1OTHA 2IYVA 4IFBA 1YBFA 1DAEA 4DR6M 3JQ8B 4PFKA 2H1IA 2ZETA 2C3OA 3G2MA 2FZ4A 1NQTA 5ELXA 1ORHA 1XDBA 2L17A 1RPAA 4X7BA 3ZJVA 3MWGA 3O8OA 3D8TA 1XMSA 2WJGA 2R3SA 1JNYA 4RV4A 2C9CA 5E4YA 3S8EA 1I2DA 2XA9A 2ORIA 1XEXA 3MJ5A 3H0KA 2DPMA 2ZVJA 2WU4A 3WGQA 4UEWA 4CN8A 4B84A 1GZ7A 2NSDA 4N54A 4XUEA 2B20A 4EFKA 4FB5A 5EZQA 2VNKA 4PWYA 3M9XA 1ACLA 1U7HA 5EQDA 2ZWOA 3ZWAA 3SF0A 5BW5A 4HQOA 1CULC 1U65A 3HYTA 5MN4A 1XWWA 4MVJI 1RJ9B 2G1JA 5B30A 2X5XA 4XSVA 3SFVA 3L41A 3NALA 3OY7A 3U37A 3ZBPA 4EJSA 4DR6B 4DBLC 1QHYA 5H3HA 1KI8A 2VA8A 3K0HA 2AZ4A 4TWIA 4XPIB 4QDOA 4PINA 1QO0A 3VDMA 4G0ZA 4TL9A 4CT0A 5AVUA 1F5SA 1Y4UA 2ODPA 3GRVA 3FPHA 2D0PB 2Q5CA 2REXB 3AOGA 2GBLC 1UC8A 1UM9A 4DQ0A 5HOQA 5P8WA 2F9FA 5KTYA 3Q87B 3ID6C 1N9GA 4RBNA 4HGQA 4A3VB 4E5UA 3T9DA 2J3LA 5IVPA 1CS0A 2JZ1A 4JYBA 5F98A 1BXKA 3FH0A 1Z8NA 4R8MA 2WPNA 3AF1A 5ITXA 2HFJA 4YAIA 5CU7A 2G4CA 3USZA 3TZLA 2FGJA 3GC6A 4LTMA 1C3JA 1T8UA 3VO1A 4CHGA 3USES 2P4QA 3C5HA 1L4GA 1UJBA 2YHIB 2WW8A 1KAMA 4INOA 4KLZA 4A73A