3DFZA

Sirc, precorrin-2 dehydrogenase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
196
Chain Sequence
MYTVMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDDQYRLSLVKQREFLQQIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of SirC from Bacillus megaterium: a metal-binding precorrin-2 dehydrogenase
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Precorrin-2 dehydrogenase
total genus 61
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.3.1.76: Precorrin-2 dehydrogenase.
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13241 NAD_binding_7 Putative NAD(P)-binding
A PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.610 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3dfzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfzA01
2J8ZA 4K28A 2H1SA 3GPDG 1KEVA 4XB1A 1ZMOA 4G65A 3S2IA 3BHMA 3D4PA 3U09A 4IQ0A 1NVTA 4Y98A 4HBGA 5DP2A 3DTTA 3KEOA 3U49A 3ETGA 2ZB7A 2NQTA 3WBFA 2PA3A 2CVQA 1YQDA 5IJZA 3ZV5A 3F9IA 2X1HA 3KVOA 1MA0A 5AVOA 5K0ZA 3JYLA 2OOSA 4CUJA 2Q4EA 5COAA 1PJ3A 1B8VA 4FC6A 4E4YA 3EHEA 4RORA 1P1RA 2X9VA 4WCFC 4KUGA 3ZHZA 4BMNA 3K92A 3I4CA 2B5VA 3GVCA 3GZNA 5CHEA 4Z6KA 1NAHA 1DLJA 3GZ4A 3IJPA 5A5EA 4M87A 5L45A 1R0KA 5DBGA 3S1LA 3I6QA 1EFLA 4CM4B 3RFXA 3I6IA 1LDBA 4J1NA 2H63A 3UCXA 1K2WA 2NVUA 3GG9A 4LMPA 4U5QA 1PJ4A 2BH9A 3HJAA 1ZSNA 2GSDA 1C0PA 3WFIA 1DOHA 4HP8A 1B7GO 2EGHA 3LC2O 4ZQFA 2HRZA 2O3TA 4DC0A 5JC8A 4G5HA 3WJAA 1HDGO 3KLMX 1YKFA 3O26A 4YWJA 3UXYA 3DMTC 4ZVVA 3RC7A 1LLCA 3ONEA 2PY6A 4UVEA 1T1SA 2H6EA 1ADBA 1M66A 1HDCA 1EUZA 4FPXA 4Z9YA 4BO7A 4MOWA 1W73A 2NU7A 1PU2A 1WVGA 5JO0A 3WQQA 4BV9A 3QE3A 4YT8A 5A03A 1L1FA 1ZK3A 4S1VA 2PKRA 1MX3A 3D4NA 4I8XA 1GUZA 4GPD1 2EGGA 4YJHB 5C7LO 4BUCA 4DYVA 3D4OA 4XQCA 5IXYA 4FIZA 3H9JA 4RDIA 4CV1A 3LK7A 4NMHA 3C1AA 3D0OA 2AMFA 1KVQA 4B7CA 4WCFA 3SEFA 2EP5A 1QV7A 4GWKA 1NAIA 3JD2A 1NVGA 4Q3DA 3B1JA 2IZ0A 1T4DA 4CV3A 1M6WA 1C1DA 4ALNA 1WMBA 3NRCA 1WWKA 3DBHA 4YJGB 2WD8A 1PL6A 4BHTA 3AY3A 3B6ZA 1EDOA 2YQ5A 4LVUA 3EYWA 1VJ0A 1RPNA 2O3RA 5KCZA 1U9JA 2Z1MA 4JCOA 2EERA 2I99A 4D46A 3BMNA 1S7CA 4OAQA 1Y7TA 4HNHA 4S3MA 4JBGA 4MVJE 5T8KA 4P4LA 4CPDA 4DA9A 2Q1SA 3BAZA 1KERA 4GVXA 3QVSA 4CODB 1WW8A 1QYCA 3DFUA 1GPJA 3JQ6A 4GLLA 1QLHA 1NQTA 3CZRA 2X0IA 3IUSA 2VNAA 3DBVO 4GQAA 3ZWOA 4A27A 3DHNA 2WDZA 2Q1UA 5AOVA 4WCFB 4E5PA 3KO8A 4NJMB 4NFHA 4YRAA 1E7YA 1MG5A 1N92A 3U4CA 3VHRA 2BLLA 2Q1TA 1GADO 3SLGA 3T4EA 4YAGA 1ZVMA 2JD2A 3FBTA 4FQ8A 4TVOA 1A7AA 3HUDA 1C1DB 3HDQA 3BMCA 5I8ZA 1X13A 3VAZA 1KEWA 4KP7A 1WZIA 3B70A 2BRUA 2IODA 1N5DA 4J2OA 1WDKA 2I3AA 3H9EO 1LI4A 4GL4A 1E5QA 4AJ2A 3E03A 4BL5A 4EUHA 1T26A 4P4NA 5JAQA 1ISJA 4QO7A 2BMAA 1N8KA 2CSUA 3KSZO 1DBVO 5BSEA 1V9LA 4QFDA 2X5JO 1XEAA 4PCVA 4OM8A 5JSFA 1U1IA 3NAQA 4W4TA 3EC7A 3H8VA 4IJUA 2AG5A 3WSVA 2B0JA 1GV0A 1TT5A 2CY0A 2QQ5A 3GRPA 3OIFA 4J7UA 3QSGA 3WGZA 1GV1A 3FRJA 1CETA 4HFMA 4Y67A 4A10A 1NFFA 4DVJA 2NTJA 3WYBA 5C37A 3CMMA 5L7YA 1FMCA 1I3KA 1YH3A 3RWBA 4II3A 3QVOA 1AHIA 1LDGA 3RUCA 3SXPA 4ID9A 2DFDA 4ZHSA 4KZPA 3ANLA 5IZ4A 5JCJD 4RQTA 4BGUA 2A35A 1T2CA 1YJQA 2AW5A 4DUPA 3KYDA 3SC4A 3QVXA 1E6EA 4L75A 1KBZA 3W1VA 4B79A 2V6BA 3G0OA 1U8XX 5T8KC 3KXDA 2AQHA 5AXDA 3TWOA 2X9NA 4FJ1A 4YJDA 4NU5A 3PYXA 2HKIA 1CJCA 1DO8A 2B36A 4NBUA 1X0XA 1YRLA 4MVJI 4OYRA 3GVXA 5JDCA 2GASA 3RI3A 2GNAA 4YJFA 4F6CA 2O4UX 4CMIB 3F1KA 4LK3A 3KSDO 1GY8A 1D3AA 1O8CA 4BNKA 1EQUA 5U9CA 4LRTB 4NIMA 3O03A 3EVNA 4MIOA 4Z0TA 4XX0A 2W2KB 1F8FA 3H9UA 3BZUA 3LC7O 4ALIA 4YACA 3PIIA 1G0OA 2WTBA 2NLOA 4NJOA 5LDHA 1NTOA 2Y93A 4HADA 4XZ3A 4WEOA 1IYZA 3AK4A 3PWKA 4KDFA 3L4SO 4E12A 4JJFA 5TJHA 2ZYDA 3E5MA 1XU9A 3K96A 4XCVA 3DXFA 3EGOA 3ZV6A 1U7TA 1YS4A 2YDXA 4ZJUA 3OHSX 3SJUA 5KKCA 1PGJA 3ZWYA 5JAIA 3FNHA 2VYVD 3ANNA 1B2LA 1K3TA 4H15A 4AJLA 1LTHR 3K9QO 5T64A 2JFFA 5G0WA 1B3RA 4CM3A 2YHIB 4L74A 3FPLA 2AE1A 5I7SA 1QRRA 3LSYA 3ITDA 5EMHA 4CR6A 4D79A 2EEZA 2VTEA 3OFSA 1H93A 3PGXA 2GR9A 3ZWWA 3E82A 1MC5A 4ZQHA 3DC2A 4D3FA 4RF5A 1UP7A 4YRBA 2EWMA 1I2CA 2J3HA 3WICA 4R16A 3HWRA 2AQ8A 4E13A 1IPEA 4I5GA 2C7GA 3UICA 3A9WA 4AJ4A 3N74A 5F21A 4JNKA 2I76A 4UULA 5CPFA 2LDXA 2YW9A 3ZNOA 4R41A 2DBQA 1HXHA 2C7VA 3AOEA 3Q1LA 3C7AA 3JQDA 1ZW1A 2HMVA 3DBLA 2WYWA 5BSGA 2GCGA 4JJIA 1E3EA 3FN4A 1PWZA 1BXGB 1ZO8A 3DAFA 1E3LA 2C5AA 3C24A 2DPGA 2NACA 1XU7A 2D8AA 4XDZA 1LDYA 3QWBA 2YFHA 3ASUA 4BS9A 2ZQYA 4IDBA 1E7RA 1UDAA 4ALJA 3BMQA 4HKTA 3LYLA 3ZWPA 3QP9A 4RLSA 3T7EA 1X1EA 3JD1A 3PWSA 2VWPA 1PJBA 5GZ1A 3ZW8A 2B4RO 4CMGA 5IDYA 3H5RA 4ND1A 1LQTA 3OA2A 3NJ8A 4CUKA 3U5TA 4PLZA 1Y5MA 4A03A 3W8FA 2GLXA 3GEGA 4LRSB 4UVIA 4TRNA 2Y99A 4D3DA 4JJGA 9LDTA 3NTQA 3V1YA 2ZATA 4TZTA 2AXQA 1BVRA 3U62A 3ZWVA 3WSWA 4WGGA 1M75A 1R0SA 1MXHA 4PG4A 3RUFA 3PJGA 1J0XO 2OMEA 3L6DA 4ZRNA 4YXFA 2VZ0A 4U0KA 3D3WA 3GF4A 4IM7A 4PG6A 1EEHA 1YO6A 3IC5A 4JGBA 4GI2A 2VYNA 1E7WA 1LU9A 1EBFA 3WTBA 1SZJG 2GF2A 5G0UA 1G0NA 1YWGO 3G1UA 4BO2A 3BMQB 4XA8A 4LMRA 1ZEJA 3GNTA 4KQWA 3NYWA 4BQRA 3GAFA 3AUSA 3HB4X 4E0BA 3GDFA 4I5FA 2Y1FA 3WGIA 3JQEA 2OO5A 5G0TA 4KOAA 4CQLA 3PYMA 3WNQA 4B3IA 4PN3A 3K31A 5AXBA 4FBGA 3GHHA 4HX5A 1JN0A 5KJ1A 5TT0A 2LDBA 3JTMA 5DDIP 1BXKA 1CIVA 1Q2XA 4Z9XA 3OJFA 3DONA 1X7HA 3FSRA 4U6QA 3RKRA 3U4HA 4QO8A 3ROMA 3UGKA 3UUWA 4B3HA 2IE0A 3S2FA 5FF9A 1YXMA 1TT5B 3VPHA 1CYDA 2JHFA 3EVTA 1EVJA 1I8TA 4GH5A 3FR7A 3P2OA 1VC2A 1DEHA 1B14A 3L4BA 3DDNA 5G2OA 4IJKA 4CR8A 4RVGA 4FD3A 5HS6A 4DTIA 3JQ8A 2H5LA 4PLYA 3DO5A 4JBIA 1PGNA 2E82A 3OJEA 2QX7A 2Y0DA 3NKLA 1BW9A 4K1LA 4U8GA 1I2ZA 3UAGA 4EDFA 4L8VA 4BOYA 3AUAA 4R68A 4FFOA 5L53A 1K89A 2BGMA 4ZQBA 2JHGA 4CV2A 3FI9A 5F5NA 5C7OO 3R0IA 3ZWNA 1VKNA 1Y9AA 1YJ8A 3KYDB 1YB4A 1DRWA 4EJ6A 4E33A 2GERA 4PRKA 1HKUA 2C20A 3HHPA 5JNLA 4XYEA 3W4JA 3B1KA 1SPXA 2B69A 3IS3A 1JAXA 5GZ6A 1LUAA 4PLGA 1UR5A 1PQWA 2NU6A 1U2DA 3U3XA 1I3MA 1YGYA 1W4ZA 1ZSVA 3W6UA 1P74A 1U3VA 3JD0A 4CM9D 2Q45A 2AEMA 2XXBA 3A06A 2FSVA 3GGPA 1DJNA 5MGBA 4XGNA 1Y81A 2QRLA 1V0JA 4DC1A 4C4OA 1GCOA 2GRAA 3CMCO 3NT5A 3UF0A 1TB4A 4FS3A 4BIIA 1IZ9A 4YYZA 2JD0A 5L51A 1DC5A 1PQPA 1PZGA 3ZV4A 1JKJA 3JQBA 3RASA 1EQ2A 2Q2VA 5L4LA 4P22A 5JDIA 4LSMA 1BXZA 1X7GA 3F3SA 4ILKA 4E5MA 4R5HA 5EPOA 4B3JA 4D0SA 3AW9A 1ENZA 5CG2A 2OHXA 4P8RA 3PIDA 3L07A 4MVJA 3VZQA 3PFFA 4P38A 2X4GA 2FY8A 4ROSA 4EBFA 1ZH8A 2X9GA 4IS3A 3K30A 2JFHA 3QRWA 4YCAA 1QLJA 1ZXBA 3Q9UA 1SEVA 2HO5A 1M76A 2FPGA 3K6JA 4IY1A 3A28A 5IG2A 4LN1A 1UP4A 1NPDA 1U7HA 1F12A 1KY5A 4IJWA 1EUDA 3QWAA 1DIBA 2NADA 1HZZA 5JCXA 1XCBA 2O3QA 4MVJP 4JX8A 5JCJA 3TNLA 1VE9A 4XRGA 3PLNA 2OP1A 2GZ2A 3CPSA 3WLFA 3UHAA 1Q0QA 5DF1A 3SJ7A 3CXRA 5TSDA 3DBRB 1EVYA 2PZJA 4L73A 1VRWA 1NWHA 1H2HA 3NDIA 3DBLB 4B7XA 5KNLA 3OJ0A 2XOXA 3GMSA 5JDIC 2PNFA 3WIEA 1IY8A 4JROA 4DMLA 1E77A 3OJLA 4EGFA 1HE3A 4URFA 3KUXA 1XDWA 2EXXA 3S2GA 2OFPA 1BHSA 1EFKA 3PHIA 2IXBA 1H6BA 1MG0A 4IGEA 3W8EA 2WE8A 1QR6A 1BTOA 3VH3A 1DC4A 1UZMA 2W98A 4BKQA 1OBFO 3RSHA 5I9NA 4R51A 3E6AA 4YDRA 3D5QA 2NTVA 3V2HA 2CF6A 4OXYA 4E2WA 3IMFA 4NU6A 5DT9A 1PGPA 1RKXA 2VHYA 3LLSA 5TF4A 2PZLA 3NUGA 1NQAO 5A5FA 2PWZA 3RFTA 2PD6A 1E1LA 1QYDA 1SO8A 1F17A 3WGYA 3BMOB 3ZWXA 1AHHA 3PFWO 3WQSB 5CEJA 1ONOA 2DUUA 3P19A 2O2SA 3GN2A 1JWAB 4YAKA 3VPXA 4Q39A 2HU2A 1F0YA 1UXKA 2AG8A 1K6IA 3AUUA 3QW2A 1XELA 3TZ6A 4UAGA 3PRJA 2DLDA 4OJNA 4RVFA 3Q2IA 1P0FA 4ITUA 3QHAA 4ONEA 4AJOA 5EL0A 4KTTE 1YBAA 4RF2A 6ADHA 1VJ1A 2FWMX 5COQA 1IL0A 4CLOB 2B4QA 4G2NA 4CM7A 4IJVA 4B7UA 3FBGA 3Q0EA 2PK3A 1FJHA 1DHRA 2B5WA 3GNSA 4GAEA 2W4QA 1I5RA 3O38A 4L9RA 4NBTA 1U3TA 5T67A 1KVUA 5A9RA 4Z0HO 2EJVA 3ZV3A 1ORRA 4GKBA 1ISIA 2FPPA 3QWHA 2YV3A 3BA1A 2FP4A 5AQ1A 3C1OA 1MFZA 1F14A 1NQ5A 2CDAA 4CLXA 1NNUA 3V2UA 1U5AA 1GQYA 2CUKA 5H81A 1DPGA 4XJSA 5C3MA 4CMKA 3MOIA 5KWEA 4MVJF 2ZCVA 3TPCA 4WCDA 2Z1NA 3AY6A 1DAPA 3GA0A 4AL4A 1QYWA 4K6FA 1R4NA 3HG7A 4PLFA 3JQ8B 1SC6A 1GZ4A 3H9GA 4J1SA 2RHCA 4GKVA 5F5LA 1BW9B 4IDGA 1JAYA 1PZHA 3B20A 1U3WA 4BKRA 4J49A 4BKPA 4BNVA 2O3UA 3DZGA 3HDYA 4EITA 1HTBA 1ADGA 2C59A 1YB1A 4A7PA 3LZ6A 1PZEA 4ESOA 4CQMD 4IZHA 4AJEA 4OKNA 3X2FA 4W9NA 2XAAA 3MTGA 4IQ8A 4FFLA 5T6BA 2RIRA 1J6UA 1ENYA 3AY7A 5CDTA 1C3VA 1HYEA 2DC1A 2W2LD 5HS4A 4OXKA 1TT7A 1G1AA 3MJ4A 4E30A 3MWEB 1A7KA 3ZDFA 1XQ1A 2CVZA 3IQDB 2QG4A 4M86A 4E2YA 1H6CA 3EMKA 3PVZA 1E1NA 2GD1O 1O89A 2JCYA 2WE7A 2C54A 4O5OA 2E37A 4PG5A 4RCVA 5G4LA 3WJ7A 4FGSA 4IMRA 1LRKA 1YQGA 1I30A 2G82A 3ULKA 3BYZA 4D3SA 3IIEA 2BI8A 2DKNA 5KVVA 2X5KO 3T4XA 1K6JA 3GH3A 1P77A 3GGOA 4RLHA 1HDXA 4HWKA 1NASA 4YA6A 4WLVA 3JQCA 4OHUA 4Z3DA 1A72A 1LRLA 3HE3A 3PZRA 3AU8A 3GK3A 1PTJA 5A3VA 1V8BA 3PEFA 4PZCA 4UUPA 3RAJA 4CJXA 4GLOA 4W7HA 3L4BC 2BI7A 2FZWA 4KTVE 1DFGA 4BNFA 4BNWA 1M2WA 3LF2A 1OZAA 5TJ9A 3RJ5A 3N7UA 4QX6A 2X8LA 3AM5A 3MJSA 3OMLA 2GPTA 3JYQA 1P31A 3WBBA 3ZU2A 2EW2A 4CUZA 4OL9A 1YVEI 1UXHA 4TRMA 1HEUA 2X86A 4LSWA 5CPBA 4PLCA 1R12A 1N1GA 2BHLA 1JVSA 1ENPA 3JQAD 3K8ZA 3QA9A 4ZRMA 4EJMA 3N58A 4U6SA 2I5PO 4EI2A 3GOHA 2ZJ1A 3AWDA 1PX0A 3EZYA 1ZZEA 2P91A 2X6TA 1NXQA 4HFNA 2Y1DA 4RJTA 2GUGA 4J43A 3HNPA 3SX2A 3ZN2A 3WR5A 4ZN6A 1V6AA 3HB5X 4RZIA 3P7MA 4XKJA 2HDHA 4D44A 1Q1NA 5JLAA 3DBRA 1E92A 3GUYA 3TL3A 4E31A 1P1FA 3LT0A 3WS7A 3F4LA 4YR9A 2DBRA 4R5MA 4TSKA 3ROQA 5IDWA 2PGLA 5ITVA 4QEDA 3DOJA 4I5EA 3OJOA 4OH1A 2OORA 1ZKMA 4DPKA 3LT1A 3RUIA 2C2XA 3LT2A 2BFPA 4J4HA 3MJCA 4CLRA 4DLLA 1CQJA 1FDTA 3JQFC 1FDWA 3W4KA 1LSSA 4HFRA 3WMXA 3BTVA 1PR9A 4DQXA 1ZMTA 3DZHA 3ADOA 1JTVA 1T24A 2QW8A 3R6DA 4CM8B 1JQBA 4DGSA 3GQVA 2QHXA 1Y8QB 4CV0A 4N7RA 2DFVA 4NFSA 3GR6A 4FOOA 4D41A 3GMDA 5IXSA 2QZ9A 4IIUA 2XF8A 4XDYA 4HY3A 3GEMA 4RO0A 5ICMA 5KIAA 1A71A 1LLDA 4EUFA 3FNFA 1LX6A 2ZIZA 4BO8A 3BMOA 5FFFA 1N7HA 2VUUA 2VWHA 4IBOA 4CMEC 1EK6A 3PQEA 2Q2WA 4YRDA 2JFGA 1C1XB 3NEPX 3TQHA 5DOVA 2NTNA 2V6GA 3ONDA 5F1OA 4R1NA 5MDHA 4WLNA 3OEYA 4P4GA 4IQGA 4FFPA 2A4KA 5L7WA 1ID1A 1E3SA 4IUYA 4PLPA 1S6YA 3AM4A 2BKAA 4K26A 1I2BA 2DBZA 3O9ZA 2O3JA 3DZKA 4DQUA 1FDSA 4YAEA 4Q3AA 4B8ZA 3JQ9C 4Q3CA 1Q7CA 1GUYA 2HMWA 4QECA 5TC4A 1SAYA 2E6UX 3BTOA 4CM8A 1FDVA 1R37A 1CDOA 1VLLA 2CDCA 1HRDA 2YQ4A 4N18A 3KV3O 4WECA 3UH1A 3KETA 4D7AA 5A02A 1Z7BA 5T57A 5F1KA 2OP0A 2V6MA 1HDRA 2PKQP 2RH8A 4GBJA 3RQSA 1MV8A 1MUUA 4FGWA 3LF1A 1E7QA 3X2EA 4EZBA 1YL6A 3G3EA 4NFYA 1I3NA 4YJFB 2X23A 1X15A 4NZ9A 5K6AC 1GTMA 5TQVA 1UZLA 2YHUA 3HSKA 1IB6A 2C2YA 1XKQA 4K9DA 3ORFA 3EAGA 2VUTA 1ADCA 1T25A 1R4NB 3HFSA 1PWXA 2D5AA 1X1TA 2W2KA 4XJTA 3IL2A 2UDPA 4MINA 3ZH2A 3ZHXA 4B4VA 2IYOA 5L40A 1GQQA 2GZ1A 4ZICA 3K2BA 3I9JA 4N54A 5ENDA 2J6IA 2WEKA 3CKYA 4DIFA 5ICSA 5IFLA 2NSDA 3MJEA 1C0LA 4KQXA 4XQEA 2IRWA 4BNMA 1UXIA 2X0NA 4BO6A 1BDBA 4PVCA 1BWSA 3ZU3A 1FDUA 1EE9A 2AEJA 2ILTA 3WTCA 5IN4A 4UUMA 2PR2A 1HETA 2BFAA 4QTZA 3FCOA 1NX6A 1WNTA 1B16A 2D2IA 4BNLA 5JY1A 2PTGA 3KYBA 4KWHA 1C0KA 3B1FA 3RROA 5HBRA 1HE4A 3WOHA 4MDHA 1LA2A 1ONNA 3GDGA 5A9SA 4J9UE 4Y6PA 3FF4A 3Q2KA 1DRVA 4R3NA 2WSBA 3DZJA 2IEDA 3QJ5A 1SOVA 4W82A 1QV6A 3JV7A 4XR9A 5ENVA 5GY7A 1IULA 1D1SA 5I9MA 3UN1A 5JYEA 3E18A 2PH5A 2EJWA 3RC9A 2ZKLA 3L6EA 3ANMA 5BNIA 4WUVA 3AU9A 1P33A 3BXXA 4INAA 1PS9A 4YBZA 4EYEA 3MZ0A 4MKZA 1YBVA 4XB2A 4BNXA 1EVZA 2HJSA 2VHVA 1P9LA 3JCZA 2R2GA 4NH4A 2J5KA 1KVRA 1H0KA 4FDAA 3IP3A 5I8WA 5KVCA 1ZK2A 1PS8A 4J0FA 4JK3A 1Y8RB 3ZU4A 5FI3A 2P4QA 3L9XA 3D7LA 4CL8A 5JC1A 3I4FA 3PWZA 4CQMB 1CWUA 1NHWA 3O8QA 4YVFA 3I52A 2ZB8A 4TWRA 3JYOA 5A04A 3M1LA 5BQFA 2EV9A 4MIEA 3CSDA 3MJVA 4NK4A 5KJEA 1V35A 3EK2A 4W9NC 4NQZA 5A9SB 3WX0A 3T7CA 1O6ZA 4HV4A 1DSSG 1EVIA 3JQ7B 1A9ZA 4J9VA 4B8WA 3HN7A 5AYVA 2GN4A 4B4OA 2RHRA 3CUKA 1WDLA 5ILGA 5ER6A 4E6PA 2EW8A 3FTPA 4WE3A 1IUKA 5FI5A 2FPIA 3PQFA 4R1TA 2P68A 2A92A 5L7TA 1ZFNA 2VYVA 5EERA 3V5NA 3F4BA 2OUIA 4TROA 1H9BA 3CEAA 1ZK1A 2JCXA 4A5OA 2D4AA 4L4SA 4BQPA 2W2LA 3RCBA 1Y8RA 4R9SA 1UXJA 4ND5A 5G0VA 1U5CA 4FR5A 1OC4A 5CEFA 2VRCD 3O8QB 3F47A 3E9QA 4M55A 1I3LA 3E1KA 1W8DA 1HDOA 2C29D 4XR4A 3PI7A 5H83A 1NHGA 3DR3A 3ZU5A 4PLTA 5B12A 1MP0A 1WPQA 2O2YA 3JYPA 3ONFA 1K5HA 3VVCA 1PJCA 4W99A 4ND3A 1P0CA 1UXGA 2DQ4A 2VWQA 2CZCA 4WOKA 1WDMA 1PL8A 1VI2A 3TOZA 2FOIA 1SOWA 2Q1WA 4WLOA 2X22A 4DREA 4GMGA 1H5QA 1YL7A 2W8ZA 3KYCB 4BB5A 2QIOA 3OA0A 4D0RA 1RWBA 1XA0A 1TI7A 3BTSA 5L9AA 1HZJA 4HXYA 1ISMA 1B8UA 4LISA 3GY0A 2VZ8A 1JA9A 4HUJA 4CMIA 2YV1A 2QYSA 1KYQA 4K6CA 1X14A 4NBWA 2PKQO 4F6LA 3ZNPA 2GN9A 4MP3A 1BMDA 1NWCA 2PLAA 4J0EA 4ND2A 3V2GA 4I9NA 1YL5A 3ENKA 4EJ0A 1CRWG 3HFGA 3DHEA 3E5RA 2QRKA 4PZEA 3DOOA 4WOJA 1U4SA 3AFNA 4RVDA 1VL6A 2GDZA 2P4HX 4IDCA 1Z7EA 1U28A 1PJ2A 3S55A 3H65A 4IDDA 4R4JA 1GUFA 2AA3A 2VT2A 3QLJA 3PHLA 1Z73A 4G81A 1VL8A 1XIVA 1UAGA 3PYLA 2NWQA 4U7WA 2GZ3A 1U8FO 2CMDA 2J3JA 3Q9NA 4GWGA 1PL7A 1WP4A 3PP8A 1HWYA 5G0SA 3U0BA 4EUEA 3TSCA 1NM5A 3KYCA 4OIMA 3JQFA 2AE2A 3H4VA 1Q0HA 5JY6A 3E9NA 1W0CA 2CNBA 3UFXA 1UZNA 2RCYA 3V1TC 1DIHA 1L7EA 2PZMA 4L4XA 2DUWA 1DAOA 3KTDA 2UAGA 4IXWA 3UCFA 3BHIA 1DJQA 1Z6ZA 4QT0A 4FN4A 1SEPA 4BNNA 2HMTA 4Q3NA 1YE3A 4GX5A 3VH4A 3LQFA 2VCYA 3FWNA 4Y9DA 1UAYA 4UREA 4Y6SA 2Y0EA 3OETA 3DB2A 4XGKA 1WZEA 4FCCA 1I32A 5IAAA 2IYPA 3DZBA 4BNTA 2Q50A 3F5QA 4E3ZA 1WXDA 3M1AA 4DL9A 3RFVA 1ARZA 1EDZA 5A3JA 4J3FA 5DULA 1T2FA 2J5RA 2VUSA 1RM3A 4O59O 2R00A 3PQDA 4WASA 1QYVA 1TEHA 3DFZA 2J5QA 5EQFA 1E6UA 5L4NA 4IDEA 4ZQGA 4LW8A 1OFGA 2YY7A 4DIOA 3OIGA 4J6FA 1T2DA 2RH4A 3Q6IA 2FHSA 2FR8A 4OOEA 4OSOA 3WGGA 4DBZA 3LT4A 2HCTA 4MVJM 4RVSA 4ALMA 2JJYA 4M1QA 4YB8A 4ALLA 1GYPA 2OBNA 3ENNA 3PLRA 1AUPA 1LDNA 1LBEA 1GPDG 5A06A 4BVAA 5B4UA 1PJQA 1E7SA 4CLEA 1KC3A 5KJFA 3DQPA 2AEFA 4E5KA 2ZYAA 3C7CB 1O5IA 3INGA 4ZQEA 1WLYA 2G76A 4PIVA 2D5CA 3GRKA 5AXCA 1RM4A 2EIHA 2VTDA 1NP3A 1X0VA 4UEKA 4CMHA 2FRDA 1M67A 5IN5A 2PD3A 2Z5LA 3VDRA 4FFNA 2RAFA 1A27A 1AXEA 4J4BA 5DBIA 1DLIA 1Q0LA 3I1JA 3GUCA 1E3IA 1VL0A 2I67A 5DBFA 1RM0A 2YUTA 1DIGA 3HDJA 1T1RA 5H82A 4TMFA 1I01A 3C7DB 3KZVA 4PGFA 4PVDA 3D3WB 3LLVA 1IOLA 2VRBA 2W90A 1CF2O 4UVGA 2Q99A 1ISHA 3OSUA 1V3UA 1MLDA 4XYMA 1YBMA 2VN8A 3NDJA 2EG9A 5TRTA 3GFGA 8ADHA 4OXNA 2CDBA 3GT0A 4CM6A 1NFQA 2O3SA 2C5EA 3ZWCA 4BKOA 5JXWA 1LC0A 1HLPA 1HDZA 2BFOA 3QQPA 2DPHA 4AVYA 3GFBA 1O94A 4M89A 3DBHB 4YJGA 3W4IA 3NT2A 2V7PA 3VZPA 3HN2A 8LDHA 2P9GA 1GQ2A 3KB6A 1BGVA 4RF4A 5HWSA 5CDYA 2VOJA 1TA4A 3COSA 1E1KA 1ZNQO 4FJ0A 1EMDA 4GGOA 4RPJA 2HRBA 1NR7A 1R15A 1R16A 4NBRA 3L0DA 1KOLA 2D0IA 4E2ZA 2HLPA 1NQOA 1VPDA 4NHEA 1GEEA 4NK5A 4TVBA 1GL3A 5G4KB 3RC1A 3VZSA 5JMPA 7ADHA 4QFCA 1VSUA 4B4UA 4J2HA 3INTA 1E1MA 2VT3A 4UUNA 3RU7A 5CAEA 4DPLA 2TMGA 2DTDA 3HQ4O 3C1TA 2EP7A 3GN1A 5HRUA 1DDOA 1PR3A 1NPYA 2F1KA 1YOVA 5FYDA 4OO3A 4BNZA 2JCVA 4EW6A 5KKAA 4NJMA 2PV7A 3H5NA 2PH3A 3CTMA 5EJ2A 1JWBB 5TGDA 1BSVA 4AJ1A 4E5YA 3RBVA 4BNIA 4OKIA 2I3GA 1DB3A 4FJ2A 4FB5A 1XGKA 2Y66A 5BNTA 4QQRA 1AE1A 1PJSA 1ZEMA 3NV9A 4UVDA 2NUAA 3WWZA 3BMCB 3W6ZA 1ZSYA 2QYTA 2VZ9A 3PHJA 4BO1A 2QRJA 2HJRA 4E2XA 2O7QA 4CMCA 2FZEA 1OI7A 2YJZA 2Q49A 3QWIA 4UUOA 5JE8A 1LLQA 4BNGA 4H3VA 5GMOA 5JBIA 3JQAB 4M8SA 3GG2A 4Z9FA 2NQ8A 3ITKA 2I9PA 1Y5RA 1CEQA 1YONA 3BIOA 4MKXA 3QVWA 4I08A 5CDUA 2DM6A 2X7HA 1DXYA 3JYNA 1HL3A 4YTEA 2HQ1A 5J23A 3RJ9A 1ZXLA 5A1TA 5KOIA 2VHZA 4CM1A 2NU8A 2YYYA 3FPCA 4I9UA 5HA5A 3ZW9A 4BGEA 2D59A 1GAEO 5U4QA 1KVTA 1LSOA 2PGJA 1SB9A 4XIJA 1I10A 4KMSA 4RVUA 1EZ4A 3GNQA 4PZDA 1ML3A 1LLUA 2CF5A 1GZ6A 1SMKA 3ADPA 2G17A 3PK0A 4GVLA 4JP2A 4MO2A 1KEPA 1QP8A 1KVSA 1LSJA 3K2EA 3OICA 3OIDA 4F45A 1X7DA 3QVTA 4O6VA 2ZCUA 3CIFA 2Y05A 1GU7A 2G1UA 2HK7A 4NDNE 1B26A 2DU8A 4JLWA 1IHXA 3WB9A 3HZZA 3ABIA 2F00A 2YDYA 4M54A 3KRTA 4BNUA 2PD4A 4ZU3A 4BGVA 4JP3A 4DMMA 1TLTA 4GMFA 1E7MA 2Y1CA 4R69A 3SBOA 3I83A 3PPIA 4UVHA 4O0LA 1VSVA 1Z75A 2UVDA 2Z95A 3HADA 4WK6A 1A9YA 1Y6JA 3VPFA 4KWIA 1ZUD1 3AOEC 1SBYA 1HYHA 4NI5A 4GX0A 1MC4A 2WJPA 1V3VA 4J1TA 1UDBA 5CEEA 2VRCA 1JVBA 2G5CA 4MVJH 5JDCC 3TF5A 5IF3A 2H9IA 3VPGA 2JKVA 4FSHA 4MP8A 3ZWAA 3TN7A 3C85A 3IUPA 3ROKA 1LNQA 4I9HA 1HE5A 1ZK4A 1Z45A 1IPFA 5I7FA 3NTRA 4IMPA 3RKUA 3STHA 4TZKA 4DBVO 3GC6A 3NX4A 1QXSA 4RPHA 2BGKA 4CM5A 1NPTO 5KJ6A 2O48X 5HTOA 1DIAA 1NYTA 1T4BA 2X58A 1ADFA 2QZZA 4AJNA 1I36A 1ULSA 3M2TA 4RPLA 1ISGA 1H2BA 1MGOA 4JN6B 3DTYA 3WQRA 4A73A 5JW6A 2VNSA 2DT5A 1O9BA 1O95A 3I9KA 1HSOA 3WGHA 3WGOA 5F1PA 5THQA 4BO3A 2JAHA 1UDCA 4J7CA 1XQ6A 4CMBA 5THKA 2YZ7A 2O50A 2XXJA 3GEDA 5ILOA 1N9GA 3PZBA 4XIYA 2B37A 4N5LA 5BT9A 1J4AA 1EK5A 2HAEA 3TZQA 2BGLA 1UH5A 2O23A 4FOSA 4WJZA 1VJTA 3INRA 3AOGA 4A2CA 3LC1O 4JQCA 5I7EA 3BMNB 4XGIA 3ZHYA 2P2SA 2ZTMA 4J1QA 4BV8A 4RPKA 4MKRA 2AQKA 3ZNQA 5A05A 3MOGA 1NFRA 3GDOA 3RC2A 5JS6A 3ZHBA 4MIYA 3SC6A 1QG6A 1RJWA 1YB5A 4Z0PA 3F5SA 5L3ZA 2B4TO 5BNFA 4DLBA 1P1IA 3PXXA 4H7PA 5KJCA 2VOEA 1U3UA 2FSSA 5JYDA 4CLOA 4GGPA 3WYEA 4AJJA 5JO9A 2TMDA 4W7IA 1N1EA 1GYQA 1AN9A 4O1MA 2E48A 1EUCA 1JKIA 3RD5A 1OC2A 3IOYA 5A9TA 2R00C 2I66A 4ZGWA 1J5PA 2NV6A 4YAJA 7MDHA 4KUEA 4J16A 1OMOA 1B3BA 2ZB4A 1EBUA 3EUWA 4EEXA 4R01A 1N7GA 3ZGYA 1P44A 5EN4A 1R0LA 4IS2A 4M49A 2B83A 5DNAA 3L9WA 9LDBA 1JW9B 4BO9A 3D3EA 1UJMA 3KBOA 3RUAA 3DAGA 2C82A 2OGUA 5G4KA 5FEUA 4TKLA 4C7JA 2FN7A 4I5DA 5IZCC 3H3FA 3QWFA 1IHYA 1SB8A 2NU9A 3QY9A 3S2EA 1KIFA 1U4OA 1IZ0A 3SLKA 2DTXA 4LCEA 4XD2A 4DPMA 3ZWMA 4FC7A 1PIWA 1WAMA 5TX7A 1M6HA 2EKPA 1YOVB 5LDGA 4BMSA 3H2ZA 1DHTA 1D8AA 2UUPA 4IXTA 1DIRA 5FWNA 4AG3A 1B8PA 4CMEA 3UW3A 3NTOA 2DTEA 2WD7A 3TZKA 2DVMA 5TLSA 3ICCA 2VYND 1RM5A 1VKOA 3EZLA 1JLLA 4UEJA 2OL4A 4DXHA 1QKIA 3DZFA 2NVBA 1YDWA 3E9MA 4GX2A 5BSHA 4J7XA 3ZWBA 3PJDA 4JIGA 4LCJA 3RBZA 3RUDA 3WGQA 4A26A 3WLEA 2X0JA 1R4MB 1LDEA 3VTFA 5IDXA 5DOZA 3C3XA 3DHYA 1GYRA 1ENOA 3JQAA 1CQIA 2P9EA 5TT1A 3M2PA 4XYLA 3V8BA 4MJLA 3MCVA 4J90A 1HF3A 2E49A 2VHWA 3KHUA 2C07A 2EHDA 4MPDA 4R54A 2YV2A 2UV8A 2JAPA 3DMYA 4DIBA 4GSLA 2ZTVA 3I9MA 4YT4A 4MVJG 1E5LA 2P5YA 1KETA 2HMUA 3DWFA 3KSUA 3ZZNA 3O4RA 3PDUA 3JSAA 4IPTA 2JL1A 4BB6A 4RDHA 1E0DA 1ULUA 4YPOA 2OZPA 4TRJA 3AI2A 5IZCA 3WGTA 1R66A 4XYGA 1Q7GA 3H7AA 3TDKA 1P1HA 3JD3A 2ZJ0A 1ISFA 4AJHA 5T5QA 5K6AA 2HK8A 2ZYGA 4FW8A 2NM0A 3P5SA 3FWZA 1BG6A 1PZFA 5B1YA 4KDEA 2ZB3A 4BO4A 3WYCA 4ALKA 2Y1GA 2C0CA 1L7DA 3RBXA 4LGVA 1GZ3A 3NDRA 1V3TA 5EESA 3RVDA 2DBVO 1R4MA 3HDHA 4JBHA 4JXKA 2GN6A 5AXAA 3SVTA 1BVUA 2Q46A 3TFQA 1XYGA 3NGXA 1BDMA 1Z74A 4PLVA 4KUHA 2VQ3A 2PGDA 4Q9NA 1H94A 2GO1A 3UVEA 1H9AA 3PJEA 4WKGA 4BGIA 4J91A 4IIVA 4RVHA 4WLFA 2YHIA 4AJPA 3GGGA 5DP1A 4YT2A 5U1PA 2VWGA 4NBVA 3GVIA 3VVBA 4UEOA 4Y8VA 3AI1A 5LCXA 1P1KA 2Q2QA 1PS0A 3A1NA 3TFOA 3AFMA 3BTUA 2HMSA 1OOEA 3AM3A 3GVHA 4D43A 1ZIDA 4D45A 2A9FA 4L76A 4CMAA 1G6KA 4XYBA 2IZ1A 5HM8A 2Y1OA 3H2SA 2Y1EA 2AQIA 2ET6A 4BNHA 2IXAA 3OH8A 1OAAA 4Y6RA 1BXGA 4R1UA 2GYYA 3G1TA 2FR0A 4ZD6A 3F6YA 2BELA 3VPSA 3L77A 2P9CA 3OF2A 3W8DA 4CLRB 4BO0A 4WNCA 2WWRA 2XPCA 1SNYA 1TXGA 3NJ4A 1LC3A 2ZTLA 4Q3EA 3E8XA 3JQ7A 5DCYA 5CG1A 3OM9A 3OQ6A 4FFRA 5DCUA 3AJRA 1LSUA 1N9GB 3ON5A 5C7IO 1MB4A 3I5MA 2Y67A 4AJKA 5L4SA 4ND4A 1HT0A 4OSPA 4TQGA 1P45A 3OEWA 3UOGA 2J3IA 2WYVA 3WNVA 3TZHA 3MTJA 1AGNA 4XEHA 3ICPA 2UYYA 1F8GA 2Q4BA 4IDAA 3ZNNA 3IKTA 3G49A 1XHLA 3U9LA 2Q3EA 3A4VA 5B4TA 1N2SA 2HUNA 1U2GA 2AHRA 1C1XA 1DC3A 1MXFA 1MFPA 3K73O 4WLEA 2E4AA 3VTZA 1FF9A 3WFJA 1W6UA 4R9RA 3IKVA 3JQ9A 4OGWA 1D4FA 4O63O 3K5PA 1XR3A 4QUKA 2I65A 3Q3CA 1UUFA 3DL2A 1GEGA 4XQGA 5B37A 5CDGA 2WYUA 1B0AA 4B4WA 2G0TA 4AICA 4BMVA 5B4VA 1DFHA 4RPGA 1E6WA 1PEDA 1C0IA 1GR0A 4PG7A 1NR1A 3TL2A 3WG9A 1XG5A 4CQLB 1K6XA 3G79A 3D64A 2HK9A 3PTZA 4EEZA 3LU1A 1H6AA 1I0ZA 1NBOA 3OP4A 4YT5A 4BO5A 1HLDA 1PQUA 3ZI0A 1QSGA 4R1SA 3PGJA 3TZCA 3E48A 2X5OA 1AXGA 3I3OA 5JFOA 2D3TA 3RU9A 3ST7A 2PFGA 4WEQA 2BFMA 3QV1A 3S8MA 5JMWA 3PDJA 6LDHA 2OXIA 4MVJD 1HSZA 1T2EA 3EDMA 1DC6A 4RF3A 3FD8A 1QYXA 1CERA 3KOUA 4TKMA 4C7KA 4HFJA 3G17A 3VOSA 4E21A 2NVWA 3CE6A 4FFMA 2WD7B 4IGFA 4YQZA 2GGSA 4PLHA 3VC7A 4DLAA 1T2AA 5TIIA 3I9OA 4RQUA 4X54A 3FNEA 1DRUA 2FMUA 3R1IA 2B35A 1SCUA 4NR0A 1VM6A 1O0SA 1ZJZA 5BR7A 5ADHA 3GAZA 3OBBA 2HSDA 2P5UA 4E5NA 1JKFA 2JD1A 4QXMA 2WM3A 3KEQA 4CM4A 3MEQA 4ZA2A 2WMDA 3WMWA 4BKUA 4CMJA 1DFIA 5DN9A 3TJRA 1NVMB 4OMUA 3DAPA 3VH2A 3AUTA 1R6DA 5JPIA 4YAIA 3IJRA 4LVCA 5TS3A 2IZZA 1P3DA 3QIVA 1PGOA 1LXCA 1E3WB 2PZKA 3JQBC 4H16A 5GZ3A 3MJTA 3VKUA 1B15A 3VZRA 5DCWA 1KS9A 3H6KA 2NNLD 5A4DA 5CDSA 5JAZA 2VHXA 3R3JA 1ZCJA 3CZMA 2IEBA 2OBYA 2BF7A 3D1LA 4DQVA 4PFJA 4CM9A 5ES3A 4N5MA 3ETDA 2Y0CA 4RGBA 1JU9A 3I9NA 4OQYA 2BD0A 3NT4A 4HNGA 4YJHA 2A94A 2DAPA 5L95A 4MP6A 5DZSA 1BRMA 3L6OO 3FTNA 4CQMA 3GPIA 4RZHA 3VH1A 4CL3A 3RUEA 4BNYA 2R6JA 3ROPA 1I24A 4PG8A 4IZIA 3R3SA 2EKQA 3ETEA 5K9ZA 1D1TA 1E3JA 3DZIA 1RYDA 1P1JA 2FR1A 2GN8A 3PHGA 3RUHA 4XWYA 5KVQA 2CFCA 5CP8A 1JDJA 1KY4A 1E3WA 1HDYA 1LQUA 5EINA 3VKVA 1F06A 3WIDA 3H9QA 3AI3A 3LDHA 4I1IA 2O7SA 4R3WA 5EQDA 1YDEA 1GFSA 1XWFA 2CD9A 1XLTA 4CR7A 3JQGB 3GHYA 3ZCXA 3I23A 1WMAA 1ZK0A 3M6IA 4NPCA 3UCEA 4A0SA 1I33A 2D1YA 2EKLA 1TVEA 4OOFA 1QMGA 4NNJA 3KM0A 3I9LA 5BSFA 3BHJA 1Y9EA 1FK8A 3MWDB 4IINA 3GLQA 3V1UA 4W6ZA 4GX1A 2ZK7A 4WLUA 2YFQA 3UKOA 3OECA 3TOXA 3VDQA 1GDHA 4PLWA 4DYDA 4F46A 4Z3KA 1Q7BA 3U4IA 3PJFA 4NG5A 1C14A 1GCUA 1K0UA 1A4UA 2UUOA 3D5TA 1QORA 4QSMA 4YEDA 4AFNA 3FNGA 2CVOA 3LVFO 5JAMA 1A4IA 1PJTA 3DEYX 4F3YA 4WPGA 3TRIA 3PHHA 4GSKA 4L0QA 4BNJA 2RBEA 4CLHA 1LEHA 1EE2A 4II2A 3KLPX 4OQZA 5IDQA 3H3JA 2X0RA 3FR8A 3IP1A 4DRYA 3OQ1A 3U4DA 5KVSA 1ONPA 4N5NA 1KEUA 3FHLA 3JD4A 5F3RA 3JQGA 4WNIA 1YQXA 3NGLA 5TNXA 4CLDA 1XSEA 1FXSA 1HYGA 3WDSA 4DWVA 1RYEA 5KTKA 5LC1A 5C5IA 4Q3BA 3P2YA 2V6FA 1KC1A 3CH6A 5CFZA 1H6DA 4TRRA 1PJLA 3Q11A 3F46A 4XRRA 1Z82A 5I7VA 2V65A 1PGQA 4AJIA 3C8MA 1UP6A 2I6TA 4RV9A 1LJ8A 3GVPA 3WXBA 2EF1A 1GD1O 1IE3A 4U0JA 4J4TA 4YQYA 1LRJA 3F1LA 5COBA 3OQBA 4L4RA 3DOCA 5ER9A 1Y1PA 5I9LA 4E32A 3DMTA 2ZQZA 3EY4A 2O4CA 3GZNB 1A5ZA 1ZBQA 2SCUA 1D7OA 2Y68A 1LDMA 3EW7A 4RL6A 5EIOA 1ZJYA 1Y8QA 4D42A 1PSDA 2IDZA 3WWYA 3CINA 4PRLA 3A14A 3H5AA 3IDSA 5ITWA 3IAHA 2J3KA 2POQX 3RIHA 4XQ9A 2NVUB 4IDFA 2ZTUA 1HE2A 1J49A 3ASVA
chains in the Genus database with same CATH superfamily
3BX1A 3TM5A 3CR7A 1UWVA 2ANBA 2VCEA 3QENA 1OIWA 1RRFA 4Q7LA 1ATZA 4G65A 2B78A 5GONF 4AT1A 2ZYSA 5CNJA 1G6OA 4EQ6B 4EZEA 1NVTA 2Y6VA 2JHPA 1ZJWA 1I7QB 1RABA 3B6EA 1GXSA 3KEOA 2RJ3A 2ZB7A 2QG9A 3IELA 4M76B 1N2BA 2PA3A 3CKLA 3WBFA 1MX1A 2H7CA 5HOQA 5IJZA 2PWPA 2Q3CA 3LAWA 5KNDA 2OM6A 2X1HA 2XWQA 4O1IA 4OGKA 1MA0A 2A14A 4I7EA 5AUOB 2ZS7A 2HCBA 2J7PA 3GJ3A 1Z4JA 2VKQA 2Q4EA 4WKOA 5LUAA 4ER6A 1G60A 3BERA 3KKQA 2G5TA 1G3UA 5CIWA 2X9VA 5FL7A 4J76A 2GM3A 1ZX1A 3K92A 2B5VA 3GVCA 4LHWA 5CHEA 1ZN7A 2FPWA 1KI6B 1KMHA 2XLJA 1D07A 1WU7A 3B7PA 3C3AA 3I9V1 2CLDX 1PV1A 1FOEB 2PS1A 1R0KA 3UMJA 5DBGA 5CK5A 4FCTA 2A33A 1P7WA 1Q57A 1S7GA 1Y37A 2IGBA 3WGJA 5BNZA 3HVKA 1KRHA 5IT4A 2FF7A 2W6MA 4J1NA 4MGKR 1TAGA 3CUSA 4E11A 3KPVA 4U5QA 5BSTA 3IOBA 3D4LA 1F2UA 5FQNA 1ST3A 2CLKB 5GM2A 1ZSNA 3KCNA 4G67A 3CV3A 5ALDA 1CY4A 1DOHA 2AFVA 2EGHA 2FEXA 1R0RE 4HP8A 1OGYA 2HRZA 1MH1A 2O3TA 3EBOA 1YR9A 4C4YA 3N76A 3O2QB 4RDCA 1SKQA 4YWJA 4C2BA 3KQLA 3DMTC 3R44A 5JSYA 3RC7A 2BTEA 1OBOA 4C0AC 3DMNA 1N5OX 3KOWE 1M66A 2HBQA 3DKPA 3T3DA 1IBKM 4YQFA 1GKYA 1OIVA 1O9HA 4Y2JA 3MBOA 1OXKB 3RRBA 5F7OA 2E5LB 1ZONA 2VATA 2ZIAA 1C1HA 2NU7A 4JBXA 4NLLA 4BV9A 4YT8A 1WW2A 1L1FA 1CUSA 1ZK3A 4S1VA 5CB6A 1MAUA 3DP9A 3KDPA 3LW5F 5ESRA 2A7XA 4UM5A 3SIRA 4ZKEA 4DYVA 2IOQA 4H7EA 1E1CA 4FONA 2QJOA 4FIZA 4ACBA 3P2IA 4RDIA 3VTKA 5ADUS 2HYDA 4FKBA 1MTZA 1OVGA 1CYEA 2WVAA 1ZL2A 3S29A 4K2AA 5KYKA 1BCSB 4B7CA 1FSPA 2H5JA 2FB9A 4EAAA 4C4XA 2CKDA 2P2YA 1VEKA 3QYPA 5TQ0B 5B7QA 2B7LA 4Q3DA 1P2VA 2I6XA 3DLAA 2QMYA 1N2JA 4OLHA 4QSHA 1NVBA 1U2EA 3CNOA 1DINA 1C1DA 2ORYA 1R10A 1WWKA 1KE1A 2DKLA 4QLOA 2X40A 2ZITA 4K1XA 4HPXB 4Q00A 5DO9A 1PL6A 3LXMA 2ZTCA 4IOLA 2Q6OA 4GZ6A 3TCXB 4BWFB 4CIXA 4Q4JB 4C04A 5BRAA 2O8DB 2I6FA 2QL5A 3F9CA 4AB1A 3EMBA 1EDOA 4HNSA 3MS4A 2A58A 4N65A 5EJAA 2V55B 3T7SA 2WUWE 2PQMA 4HVLA 1GGNA 1Y63A 2Z1MA 4LRSA 2XEXA 4JCOA 2PLWA 4CU2A 2EERA 5B6PA 4JI0B 2J9XB 3LTEA 1WHSB 1S7CA 4RJ2A 4DV2B 2H00A 4S3MA 4F5DA 2HWYA 4JBGA 2DJ5A 4MVJE 3W3ZB 4HEJA 4A82A 2Q1SA 1TM2A 1DGHB 1KERA 1E1CB 2AI3A 1E0JA 3QVSA 3VNSA 1KAHA 2GBLC 4CODB 1WW8A 2MYPA 1NQTA 2C31A 3ZWOA 3IUSA 4W8HA 1PJZA 2YJGA 3R9KA 1YE5A 3D3JA 1XC7A 4EG4A 4QYMA 2Q1UA 4WCFB 1M0TA 1C1KA 1Z7WA 3LP5A 1WHCA 4NFHA 2JVIA 3V9PA 3U4CA 4AKSA 1KYVA 1P39A 2V96A 3HBAA 3IXLA 3SLGA 3T4EA 1WGLA 4V1CA 5FWYA 1R6UA 4XPZA 3R5FA 5AVTA 3FBTA 1A7AA 1RBMA 5I8ZA 1V7ZA 2FYTA 5GGYA 1KEWA 3OZ7A 4LX0A 4N5HX 4KP7A 2JY6B 3HP4A 2BRUA 2IYRA 5L3RA 4OHXA 4W1QA 1RVDA 2LH0A 2FE1A 1N6NA 1QHHB 2G0NA 3ILYA 1LI4A 2VT7A 3B6JA 4ZT3A 5CFPA 2GEVA 5BSRA 1Q92A 1Q7RA 1SBIA 4BL5A 2ZYUX 4MW9A 1QZEA 4NWIA 1L5OA 4P4NA 1EGVB 3IYLW 1S1CA 5J40A 1KAOA 2VSFA 1QP4A 3WMEA 3L0PA 5DIFA 2ZI5A 2BMAA 1OYOA 2ECPA 3T5DA 3VPBA 5D00A 4HV4A 2C84A 1NYQA 2EQ5A 2WM2A 4JP5A 2ZYHA 2NW6A 2QXYA 4P3XA 4QFDA 2LBCA 1SG9A 1QPGA 1XEAA 2FSIA 4OM8A 4RS4A 4W4TA 3VPCA 5BOSA 3E53A 3LDFA 4DJJA 2B0JA 1SZDA 3GRPA 3O95A 3OIFA 3I0ZA 3VR5D 4WA7A 2XKKA 3QSGA 1H5UA 2O7RA 2QEQA 3JAKB 1O94C 1PLJA 2NZYA 3DSRA 1WCWA 3PFHA 2IVZA 1YVDA 3I42A 3T1NA 4LE0A 3TUJC 3KQUA 4MR9A 5E7IA 4NZMA 4Y67A 2WZDA 1NUPA 2GFQA 5KSZA 1BE1A 5GKNA 2NTJA 2Q3BA 5KPTA 5L7YA 2OD2A 4YRZA 1NE2A 4YFVA 4DNOA 1FMCA 3RWBA 1FCJA 2Z98A 1D0MA 1N7IA 1LDGA 1F4PA 1RRMA 2V7BA 2V59A 2FE8A 4ID9A 3SXPA 1Z6QA 4ZHSA 1OB2A 3ANLA 2ZOSA 3K0KA 3NUZA 3HWSA 4UNPA 1BDJA 3EBPA 3PDCA 4HS4A 4WAUA 2AW5A 2ZRFA 4OF4A 4YLYA 2EOAA 3QKUA 2OYRA 4WNYA 3W1VA 5KSYA 6CHYA 2NSYA 2V6BA 3G0OA 1U8XX 1N77A 4PWYA 3DDSA 5H70A 5H80A 4GOKA 1JDZA 2A5DA 1ZMXA 3BDIA 2OCLA 2XUFA 3WLOA 2JBAB 1CJCA 4OJQA 2C5BA 2WSSD 4NU0A 2W9XA 3W5DA 2PT6A 1NRXA 2G08A 3KR2A 3OZFA 2QW0X 1II9A 4MLPA 4UDNA 4UEWA 2C5FA 5IABA 2YIMA 2VEDA 1SKAA 4CKBB 2Z43A 5IS2A 1BS1A 2C4VA 2PXXA 3RI3A 1VL1A 1PBTA 1PLKA 2GNAA 1WCYA 4HSEA 4EFDA 5EMLA 4MGIE 1WBJB 3OEHA 2V5VA 2AC2A 5J9FA 3EVBA 2Z8XA 3KSDO 1D3AA 2PYZA 3M6XA 2HCFA 3MGBA 1EQUA 1E2LA 3SNHA 3NWBA 2OPFA 5ALTA 4C0KA 4EAQA 2CWWA 4MR9B 1NJFA 1HJPA 1S89A 2AX3A 2QTTA 3EVNA 5E9JA 5AVXA 4F6RA 4UU0A 2W2KB 2BP7A 5GIOE 4C06A 1PCXA 3SSNA 1XO1A 4XDHA 3L7KA 1YMVA 3D02A 3LGXA 3RO7A 4E1VA 4YACA 5KMGB 1IBLM 2RAVA 1CZNA 3CW2A 5LBUA 3JVUA 2Q8PA 4NJOA 3J7AS 1NE7A 1NTOA 2Y93A 5H4HA 4XZ3A 4Z99A 3ZI4A 1BN6A 2HTFA 4CISA 2QA5A 4PYJA 4FFBA 2H5IA 5TS2A 4EKDA 2ZRGA 3AFHA 3L4SO 4XI9A 3NG1A 3UG6A 3ZX4A 1XU9A 4AIRA 3RVKA 3ADDA 4AZ0A 3CLSC 3ZQJA 2REOA 3I39X 4KREA 1OTYA 3DXFA 2VQ6A 1RPZA 1RLMA 2BCJQ 1F6WA 2X13A 1J07A 5IJ9A 5K3FB 4P0QB 5C53B 1PGJA 4CKCA 4DDHA 1UINA 2FR8C 3FNHA 2VYVD 1B2LA 2JFZA 4AJLA 5KTNA 5BWMA 2NUPB 2JFFA 5G0WA 2W6NA 1B3RA 1LFAA 2FX3A 2Q0XA 1T5TA 1ODJA 2ES4A 2IPAB 3DWGA 2YHIB 4WWHA 2AE1A 1P8JA 3LSYA 4Q16A 3N8HA 5DNWA 2AJBA 3ITDA 1ZGJA 1D2HA 4N7BA 3KAKA 2VTEA 4G4IA 4MAFA 5E0KB 3FB4A 5FLXS 5DNYB 4CGYA 4B9AA 3EBLA 3OFSA 5KQGA 5AHXA 3ZWWA 8GPBA 5FOQA 4IL5A 1MMFB 1MNAA 1Z18A 2CJYA 1M2GA 1E0AA 2XYPA 2ZS8A 3HX3A 4CKWA 1I2CA 3PRHA 4R16A 3HWRA 2AQ8A 3E7XA 4JVNA 4ZZ1A 4LYYA 2C7GA 5EY5B 3UICA 2E1RA 2QYHA 2FQYA 2GOYA 2DWQA 3HP7A 4AJ4A 4HUTA 3N74A 3CRW1 5F21A 1G5HA 2R44A 1UBRS 2Q2EB 3O4GA 4NCXA 1ECLA 2I76A 3F67A 2CHVA 5DHUA 2X0EA 3UKJA 3ZNOA 1V92A 1CUEA 1EGQA 3AOEA 4LGMA 2ANCA 3JQDA 4RETA 3RWMB 1ZW1A 2HMVA 3ET4A 3NALA 4V02A 1DGFA 5BSGA 1NQVA 3DPIA 3I2JA 4EF6A 1YIOA 4W5JA 2ODPA 3JATA 4FR2A 1XC8A 2NACA 5E4YA 1W36D 3DV9A 1XU7A 2WHRA 4IKPA 3F49S 1FNDA 2Y76A 2V54A 3ASUA 3CTPA 3W34A 4LGYA 4Y0NA 4QDTA 3GA5A 3QKSB 4ALJA 1K4YA 1SHUX 5F3WA 4RLFA 4HKTA 1EIJA 3LYLA 4TZ6A 2N9UA 3LNCA 4RLSA 5JMOA 1P4RA 2E5FA 4EPRA 5HIIA 3AZQA 4RCZA 1EUCB 5F76A 1J8DA 2GZMA 5AKYA 5DNYA 2OB1A 2VDMB 3KFLA 5DFLA 2VJOA 3JD1A 4TQUS 3O4VA 3HKCB 4NPHA 2XDAA 4OJYA 5BNWA 3OY7A 3KQKA 2Z6AA 1ONBA 1V48A 1C5KA 4CMGA 3I04M 2OK7A 3H5RA 1LQTA 1A5AB 4RJIA 3NJ8A 4R3UC 1SPBS 2RBKA 3SIWA 3H7IA 4BQIA 5DN6A 3QXJA 4PLZA 1Y5MA 2JFVA 2F5PA 3ENVA 3PQCA 9LDTA 3ZQUA 4P92A 1XTUA 2AXQA 4MUNA 1NF2A 2IU6A 1A9RA 1BVRA 3IVRA 2OBFA 4FYYA 2YXLA 5ALXA 2GAOA 4WGGA 1BHO1 1ISSA 1M75A 1RQ7A 1M6NA 3E9DA 3NBKA 4ZT4A 4ZYVA 5EHIA 3RUFA 1WO8A 3L4EA 1SOUA 1J0XO 2OMEA 1VIAA 1B74A 2JDIA 4ZRNA 4U0KA 4YXFA 2IH4A 3GF4A 4IM7A 3IXQA 1TQ2A 3GLVA 4NEHB 4CKZA 1YO6A 4WBNA 4JGBA 2I9KA 4AW4A 2QSFX 1D0LA 1MOSA 5CVTA 3AG6A 4KH0A 3WTBA 4XGRA 3ZD9A 3D4IA 1EESA 3D8LA 1GPWB 3HUFA 2VPQA 3PU6A 1XZKA 1G0NA 4F91B 5HGXA 2JIDA 4LXQA 1GTSA 1ZEJA 1UANA 1QCDA 3DLIA 5CD9A 1SA0B 1L4FA 4B7ZA 4JYBA 5J2TA 3GAFA 4FT4A 3ZOKA 2YJTD 3A05A 2HLDA 3GDFA 2SNIE 4AC9A 4E0BA 4EB0A 5B55A 5I7OA 1NV8A 5IDQA 4KOAA 4X8OA 4F92B 3PYMA 1WSWA 4F93B 4B3IA 1AQIA 2EFCB 3K31A 4QOGA 5FTLA 5AXBA 5WRFA 4HX5A 1JN0A 3TJZA 3IEPA 5HZGA 3V8QA 5TT0A 2G80A 2LDBA 2G88A 3G02A 4Z9XA 4AKIA 3F9RA 4ARBA 2AHMA 1BE0A 1JU3A 2ZSAA 3FSRA 3HA2A 3HLTA 3U4HA 4R6XA 1K97A 4QPZA 3UUWA 5BMOA 3H1GA 3QWLA 3JZFA 2VDNB 3MIZA 2OQVA 2PPLA 4MQMA 4YRJA 1ZGBA 2FQXA 3RVBA 1D2AA 2B6NA 1RD4A 1Y3AA 4MUMA 1N34B 1PTJC 1D6NA 3KPWA 1F9AA 2ZJ6A 3FR7A 5B58C 1JB9A 1IG0A 5DK6A 5E3JA 1H3EA 1VC2A 4C6HA 2ZBRA 1V1MB 1B14A 3L4BA 2GUWA 4X92A 5EKXA 4IJKA 4CFZA 5J4YA 5HS6A 3JQ8A 3FLEA 4PLYA 2M5ZA 1PFWA 2V0GA 4JBIA 5AKXA 1PGNA 3OJEA 3ADKA 2Y0DA 2IXFA 1A95A 1DQRA 3FYTA 1BW9A 3NKLA 4K1LA 4K3VA 4NJEB 4U8GA 2FPSA 2GM9A 4RIHA 3UAGA 1NJ8A 3HSSA 1FFXB 1UIRA 1GSAA 4L8VA 4BOYA 1BRTA 3QX8A 3DVSX 1ZQ1A 2J6HA 4ZQBA 2VSNA 2QMUA 4GPIB 1FP4B 2C83A 4F0JA 4HB0A 3HJBA 3FI9A 4QPJC 5C7OO 4EYSA 3ZWNA 4P4TA 3ZS8A 1VKNA 4C7MA 1I94B 1CEEA 3EH1A 4EHNA 3WK8A 2J6CA 5B36A 5D01A 4UQLA 1QE0A 1S3SA 1TDJA 1K63A 1J2YA 2CDNA 4HUQB 3NORA 1CULC 2C4HA 2NPIA 7REQA 1JU4A 5J2UA 1XNRM 1R00A 1HKUA 5AUPB 1ZN2A 1SVNA 2VDUE 2YZ2A 3HHPA 221PA 2GCPA 4XYEA 5JNLA 3B1KA 2B69A 3JPWA 2VP6A 3O4HA 3SC2B 4F5ZA 1TJNA 5JJCA 2BGRA 5GZ6A 1UR5A 1PQWA 2NU6A 3OKAA 3V97A 2CXUA 4D56A 1I3MA 3UFXB 2R5NA 3IAM1 2QTRA 3L5OA 4AJ9A 2Y20A 1P75A 4EHJA 4BFUA 1U3VA 5JH7A 5K0GA 1C7IA 3FTCA 1H2AS 1V1MA 2AEMA 2J33A 3GGPA 3TBFA 3PC4A 3WNDA 1OXMA 5A6SA 1DJNA 1NW3A 3EG5A 3MUNA 3ZZ1A 3SXUB 4Y2TA 3PCRB 4M2LA 3BD7A 3CLKA 3SARA 1GCOA 3QY0A 2QRPA 1O96A 1VKHA 3MCUA 3FNIA 5CYOA 4BIIA 4LJ8A 4ARAA 2GCOB 4XUCA 3A1UA 1W1IA 3H1FA 1DC5A 4BDTA 5L51A 4AAYA 2Q2VA 3PNMA 1UDWA 1RC0A 1IQUA 4KV9A 4TTRA 3TSWA 4LSMA 2XCIA 2XUPA 1BXZA 3F3SA 3NFYA 5AOCA 1G3IA 4H2DA 2NXCA 4POOA 1KFVA 1Z6PA 4KXQA 3ZJVA 2Q3FA 3NHAA 1EFHA 3OLZA 4L5IA 2ZAOA 1I4LD 4XFDA 4XLTA 4ID3A 3TMAA 3KOYE 4ES6A 4XVUA 3QUAA 1PYOA 5TQJA 1LPPA 1T35A 4OVZA 2XYRA 5C1OA 3HABA 2OHXA 4AKGA 2IV2X 3L07A 3ZCPA 4Y2XA 5GVRA 4F21A 3BJIC 3QGMA 5C32A 1EIWA 4KQMA 3WYNA 1AF7A 1EJBA 3UJ9A 4C4ZA 1TYDE 1KYXA 3GT4A 4RL4A 5IVDA 3T95A 3NGMA 4IUBS 1LNSA 3A6EA 3HN6A 4G5GA 3Q9UA 2XLCA 2HR1A 1E6MA 1EYZA 1RAHA 1SEVA 1M76A 2WWXA 2I80A 3AHGA 4RMHA 4UNIA 4D9JA 2C04A 1TH2A 3K6JA 1ECFA 2X19A 1MAWA 4GQBA 1GVNA 1ESDA 3D2CA 3A28A 2XAUA 2Q3DA 3BEOA 1QZTA 3SZGA 1UP4A 3GOQA 3K0EA 2QPAA 1D9ZA 3EIWA 4C0WA 4MHTA 1O5OA 1E2GA 4LDAA 3RFFA 3P8ZA 3FFWA 5JAUA 1IJFA 2O20A 2PZBA 1OAOA 1XZ8A 2PCJA 1SBHA 4NATA 4B87A 5JCJA 4ETMA 2MDTA 3PLNA 4XRGA 2PRSA 4BX9A 1RQXA 5LU8A 5MN5A 3FKEA 2EQAA 2QE7A 4C3OB 1Q0QA 4JI5M 3KHTA 5IVKA 4KPYA 3GQ3A 3CXRA 3K9GA 4L5JA 3R7DA 3ZCTA 4DUGD 4WXRA 2W58A 4OXRA 1NWHA 1H2HA 2RHGB 3DBLB 1DL5A 4FI3F 2AV6A 1QH1A 1X8JA 2ZW9A 4Q03A 2RRUA 3GEPA 4BPRA 3KOZE 1DEOA 2PNFA 2ZYIA 4QWMA 4OHVA 2QJTA 1SR8A 2CBXA 4QELA 2NG1A 3OJLA 1Z47A 3KFVA 3IR5A 1CDDA 4NVRA 4NV1A 1HE3A 1Q6ZA 2AK2A 1L7PA 4URFA 3BWXA 3RRZA 5I45A 1V16A 3L18A 4HL6A 4X7BA 3IG5A 1RXSA 3M33A 3S2GA 2OFPA 5BN5A 4HDKB 3KB2A 3CNQS 1EFKA 3TNYA 4PYLA 3U4GA 2IXBA 2J0SA 2ZJOA 1KGSA 1ZPDA 4ZC1A 2H2WA 2P0EA 2PSHA 2WE8A 1AKMA 2X2EA 1KI4A 3CHYA 3D6UA 4IX1A 1Y8AA 3U7JA 3QKWA 3BL8A 1FFEA 3G5TA 4L2IB 3VH3A 3E7PA 1OBFO 2J0UB 1U3CA 3GLIB 2HC9A 3K94A 3E6AA 5EXTA 3IERA 3D5QA 3OFND 1L5FA 5JG7A 1FTYA 2CF6A 1BAPA 1E5DA 1NMEA 3V2HA 4KLCA 3JW8A 3IMFA 5DT9A 5TF4A 4NFLA 1SUSA 3EZNA 3X1KA 1QYRA 3NUGA 2A88A 1X7XA 4D3ZA 2B30A 2PWZA 1QOQB 2QSZA 1X7YB 3WGYA 4FINA 2B1QA 4ANRA 3ZWXA 2FLVA 2WVHA 4KNVA 3ZJYA 3P19A 4EHKA 1JWAB 2OHHA 3P0FA 4CN9A 3EIHA 1M7GA 2HU2A 1NRWA 4GF5A 5DHQA 4LXTA 1HPLA 3GJ0A 3ODPA 3SC2A 1EFUA 4LWQA 3WSVA 4ONEA 5HRCA 3WLAA 4TTPA 5EL0A 1QFMA 1FFWA 3H86A 4KTTE 2HPHA 3QU5A 3TRFA 2R84A 1VJ1A 4M60A 2BFEB 3AZPA 5COQA 4I55F 2GQFA 4G63A 4FYIA 4G2NA 5BRNA 4EHDA 4FIDA 4ZTZB 1E2KA 4L5BA 2JVJA 4B7UA 4NCAA 1IBRA 1S02A 3GJQA 2DFKB 4HDKA 4YC7A 1FS5A 1FJHA 4REMA 3RK0A 3D7MA 2XUAA 3KE8A 3LYUA 3VU3A 1A5BB 1PWEA 1SOMA 3QXCA 4RSHA 2QGNA 3CIOA 4YX9A 2WTMA 4YRQA 4XOUA 1IVSA 1X80B 3Q2OA 1U3TA 3DNFA 4NBTA 1YC5A 2FSVC 1FSGA 2WVGA 3ESAA 4YMVA 1O95D 1ORRA 3BAFA 1KRWA 5LQJA 4DCUA 3MWEA 2O0KA 5T3YA 3UT0A 1QV9A 4PHCA 1Z5AA 3C1OA 1C7FA 2GYVA 3QU4A 1GPNA 3GCGA 5AQ1A 3SE0A 3PPYA 3H4TA 3UUFA 4LF5M 5KQPA 5JYBA 3OO1A 4CLXA 1NNUA 1NC3A 1N1DA 2IU4A 1U5AA 2G83A 1W5EA 1N33B 1GQYA 2CUKA 4FHGA 5EWLB 4X94A 5C3MA 2VQDA 3MHVC 5JJ5A 4A8TA 4EGAA 1OTRA 2XQGA 4C01A 4AMUA 1FVOA 2O8FA 1XQWA 1H3NA 4R2KA 1R4NA 2D74A 2ZR7A 4J1SA 2IS2A 2OV6A 4DLNA 4Q6WA 3A3KA 2BFCB 4OQFA 5F5LA 1JDSA 2UYOA 1JAYA 3FHOA 5KYYB 5MHTA 3OI7A 1U3WA 2WG1A 3DMPA 2VJAA 1QDRA 2OESA 1U99A 4HDSA 4J49A 3SYTA 3X1DA 4EGJA 1OVMA 2M6RA 3HDYA 4QDXA 4OCZA 3CX6A 3I12A 1ADGA 4XWTA 4A7PA 4B3RB 1JBEA 2I3DA 3A10A 1JLLB 5JUWA 4CQMD 4AJEA 4OKNA 4F2DA 1JMKC 3M6MD 2WKQA 4CEHB 2XAAA 4IQ8A 2QW1A 3V4RA 4YAWA 2V3CC 2DC1A 1OXVA 1VZ2A 1BX0A 5IWCA 1TT7A 3CR8A 1P19A 4TLCA 2WU3A 1MQ8B 4NCBA 1YA6A 2FP4B 3BE5A 4DUYM 5ITTA 3OX1A 4MS1B 3D6JA 4KQEA 1OT5A 3Q8XB 4KKXB 4OFBA 3IR7A 3B52X 5JJKA 2BEVA 2CHUA 1G64A 2JI6A 2YC4C 1K86A 2D2XA 4AW9A 3DZDA 1BVYF 1WQ1R 1I1QB 1Z16A 4ZO7A 5FWXA 1LW6E 1E1RA 2AF3C 2OC9A 2I4IA 2WE7A 2C54A 3E27A 2IXDA 4JSYA 4O5OA 3NATA 3DS8A 3ZCUA 5G4LA 1VLMA 3I3SR 5DNDA 4DRXB 3AP2A 1ZUNB 1LRKA 2VA9A 3OLQA 4KV7A 1TUBB 4CG2A 1ULAA 4EDFA 2F7SA 3BYZA 2P35A 5CW1A 3OWXA 5KNCH 1DWUA 2DKNA 3L6RA 1N6PA 2IH5A 1K6JA 4JMPA 4RLHA 1HDXA 2XXAB 3E15A 2HA4A 2PRIA 3OIUA 4HWKA 4JODA 2YJ5A 5CB0A 3JQCA 2FMFA 2GSWA 1KK1A 4Z3DA 2ZVQX 5F4ZA 3LY5A 5KTMA 3SM9A 3H2IA 2AS0A 2V1UA 1QTNA 2BGUA 3RAJA 4I8DA 4AIIA 2ZZMA 4EG8A 3KZ1E 2P6OA 3DE6X 3H8JA 4GLOA 5I51A 2UXBM 2FUG1 1KJNA 1S3GA 4BNFA 5I9SA 2OCYC 3VR4A 1P5JA 1EM6A 1T13A 3OUUA 3NDPA 1J97A 4G36A 3N7UA 3QYFA 4QX6A 3FOFC 1XF9A 4PSCA 2X8LA 4UNQA 4OVZB 3AM5A 3LHKA 4OIFA 3UTDA 4TLEA 1DKLA 1VMDA 3NZEA 3PKZA 1SGWA 4DLWA 1MGPA 4ADSG 3ZU2A 1GN9A 3JARA 3B1YA 4YRRA 1Q20A 2WRZA 2ZP1A 4REQB 4L6V6 2IXEA 2RIPA 1YVEI 1QWSA 2O2IA 3EXHC 4G85A 3EUAA 3ISVA 4TRMA 3GJXC 2X86A 4B76A 5CPBA 5J2UF 3URKA 1Q02A 2NXNA 4GEWA 3HCEA 1KDYA 4Q66C 1XCGB 2DAKA 2PT5A 3G2IA 2EYUA 1T36B 3W5UA 1ZIPA 5AIAA 3GW8A 3AHIA 4D97A 2AJCA 3DAHA 1TM3E 2CNNA 4PO3X 3GOHA 4GUDA 3WKDA 5CA1F 1ODTC 3AWDA 5SZKB 2ODBA 2WYIA 3UMBA 3RT9A 1G2PA 2L4EA 1NN1A 2Y1DA 3F3KA 4O4IB 4OQPA 4EKNB 2XMPA 4RJTA 5K4HA 4HHEA 1AXRA 3BZWA 2ZI6A 2NSHA 1QRSA 2DFNA 4OHPA 1V6AA 3WL5A 3MGCA 4DIKA 3HB5X 1NVVQ 2G7ZA 3W79A 1GABA 3FWPA 4QT4A 5KU1A 1QG0A 2ABWA 2M6SA 2N3ZA 1Q1NA 2XVAA 5B3AA 1WJ7A 2Q6IA 2VO1A 5LL6P 3IT1A 2AVDA 1ECCA 1E92A 2GEUA 3QKIA 1RLIA 1Z34A 3LT0A 1RTTA 5J5AA 4DSTA 2JI4A 3FJOA 5FAXA 3ROQA 1IXYA 4ABTA 4RSGA 3QMWA 5ITVA 1F5SA 1RS0A 1L7XA 3DOJA 3LOPA 4I5EA 3WHIA 2GAJA 2ZWMA 1HTWA 4OH1A 1UFRA 1Z5WA 1ZKMA 1G66A 3CLUD 2RKOA 3TL6A 3PJRA 4MV4A 2BFPA 4J4HA 1Y9ZA 3MJCA 4NBLA 4DLTA 4ZVLA 5IT0A 1EINA 4DLLA 5HKOA 2XYQA 1GQRA 2WHQA 1UJ5A 5CT5A 2EKZA 4O4JB 4EBBA 1Y7IA 2PZAA 4KQGA 5TE9A 1X8XA 1GPLA 1CR1A 4JCCA 4CEIB 3PLAE 2QW8A 1M2HA 4M7RA 4CM8B 1G59A 1AUAA 2QHXA 3A70A 1Y8QB 4KGZA 3TWLA 2DFVA 2YWDA 4N7RA 2Z7JA 3AKCA 4NFSA 4R1LA 4P6VF 3GLIE 2QX8A 3LOQA 1KY2A 4X60A 4YCJA 3ZC3A 3ZE7A 5IXSA 1J2RA 2F3UA 3DEFA 1T3TA 3KSJA 1CQZA 1JJ7A 2G8NA 3CZPA 4RO0A 2RHDA 1G41A 1OZGA 2OD7A 3GGCA 1XI2A 1KJ8A 2BRUC 3CLRC 1QB8A 5JCZA 4XXHA 3ZHCA 3BMOA 5FFFA 2VWHA 3WKAA 3N0XA 5IVIA 4KRYA 4YRDA 1W0JA 1X8LA 1P7ZA 1VDLA 3WHPA 4M0DA 5ALZA 2OT3B 4XCXA 1TVKB 1VLZA 2NTNA 2ODNA 3FRHA 5F1OA 1MTOA 3O3MB 1YUMA 2BY4A 4GQIA 4KFSA 4EG0A 2VH1A 1DZ3A 3DEZA 3OEYA 4P4UA 2X6QA 4F38A 1YDMA 3R4CA 4MICA 1A76A 5L7WA 2E21A 1ID1A 4ZVUA 3FUCA 2VNJA 1N2GA 2BKAA 3A8TA 1EX6A 4I19A 1LBQA 1LZLA 1G9XA 4NYJR 4WBXC 4F3TA 3DZKA 2GVNA 2WSFF 4HEA1 1FDSA 4UBJA 4LDZA 5AP9A 1GM5A 2FKNA 4Q3AA 1Q7CA 1GUYA 2NO6A 3D2AA 1K8XB 1DQZA 4GPZA 3KL2A 4MA0A 1UEIA 3A32A 5A5GA 4X62M 2E6UX 2C58A 2POCA 3KSMA 5GOTA 4IUDS 2YTZA 3L04A 1GPUA 4KQJA 1HRDA 2O8NA 4JI8B 1F7VA 2R65A 1SCIA 4D4JA 3FMFA 3HHXA 5GAJA 3RS7A 5LSAA 2BEKA 1UMBA 3H6HA 3UH1A 3ZD8A 5A4MS 3UQZA 5T57A 1DT5A 4GPAA 3EFEA 4BC0A 2BHTA 2PKQP 2RH8A 1JLMA 1K7YA 3LF1A 1E7QA 1MD9A 2ZI9A 3MTDA 4LPSA 4TTJA 3W5IA 4CKBA 4JB8A 2KZUA 3M6LA 3ZZUA 3LPNA 3ND5A 3BGIA 2BBWA 5CYGA 3TIGA 4HB2A 2QMHA 1UZLA 2HDOA 2VJYA 3HUUA 5TPZD 4HVTA 4OAPA 4UCWA 4QBHA 3EXG1 4YHBA 5JD4A 2XCTB 4P17A 1GITA 3GFRA 1ADCA 3UWOA 4B6JA 1J22A 2AR0A 5IH7A 1N5LA 3T1HB 1ABFA 1E6KA 2PV0A 5AW5A 1X1TA 3LA8A 3QVUA 1FYEA 4ENTA 4RM3A 1SUFA 1T9CA 3G13A 4AXBA 1OAKA 4B4VA 2IYOA 4H1HA 1GQQA 3OF5A 5LIPA 4GE0A 5ENDA 1XCPA 3CKYA 4EVQA 5IFLA 1BS2A 3UH0A 2HFJA 3MJEA 5TXGA 5A5EA 2IRWA 1M34A 1OLSA 5EVCA 4R7ZA 5JS8A 2OFFA 1N78A 3ZDAA 2CL7X 1Y9DA 2ILTA 3W9UA 3CUEF 1KK3A 2PR2A 3LVQE 1HLGA 1Q3BA 3F96A 2AOTB 1GZHB 3EC1A 3CW8X 4G0PA 1NX6A 1V6SA 3HGIA 1HQKA 2R96A 4JI6M 1PDWA 4O2BF 4BNLA 5JY1A 2NYUA 1AKYA 4FHZA 3T6KA 3M83A 4H59A 5K2MA 4ZOAA 3CF0A 1XZJA 3B1FA 3P71T 1EIZA 1EUQA 5BUCA 4ENPA 5FX2A 2XYHA 4FXOA 1EQAA 1M8PA 3U81A 3ECAA 1JKMA 4IIBA 4KJZA 4QYWA 5DXAA 4J9UE 4Y6PA 5J59A 2IW1A 2XJ4A 2X7XA 1FB5A 3WMRA 2VC2B 4QBGB 3WLRA 4X20B 3EWSA 5LXTB 3GRUA 4IDNA 4M21A 3TW4A 4W82A 4XR9A 4YP5A 5ENVA 5C1IA 3NH6A 1MN3A 1ZHOA 2PH5A 2MMCA 4HR7A 3RC9A 2OK8A 2ZKLA 3L6EA 5G02A 1SCJA 1Z8HA 2FSFA 4O4IF 4WUVA 5TPWB 3TG2A 3T99A 3BXXA 1G8HA 3CB2A 2VF7A 1OLOA 4DYHA 1EFPA 3M9LA 1T1EA 2A4MA 4BV3A 1P72A 1YBVA 1DARA 1FDOA 1R27A 2X3FA 1ACLA 2HJSA 4F06A 5EXEA 5C1PA 3AT1A 4MI9A 2VXBA 4OQXA 4HXFB 5HP4A 5E6SA 2FWPA 2F4VM 1JPNA 2R2GA 2EZTA 2J5KA 1PVVA 4X63A 5I8WA 3IP3A 2CXHA 5KVCA 1USIA 1ZK2A 2K9DA 1NBWB 2XJ9A 4HEQA 4KN6A 2PG3A 2XWPA 3FDFA 3OPXA 5EWJA 2X4LA 3EDYA 5KVAA 3OQNA 1E2NA 3FWKA 1DAIA 1MENA 1RBYA 1DQSA 2OGWA 3RR2A 1PDOA 1O6GA 3BWCA 3M5PA 3I52A 4YVFA 4F7WA 3KEMA 1J2JA 4AKHA 2OILA 3E21A 4DLVA 2D4HA 1JIKA 2ZB8A 4WESB 4J7AA 2VLBA 2VK4A 1G5QA 1NI4A 2K0BX 3DR5A 4I1OA 4IGKA 4L9AA 1QO0A 4OK5A 3I04A 3U7FB 4MIEA 4Q7MB 5KJEA 3G9TA 3R09A 3T3PB 4NQZA 4P83A 1I2MA 3LFTA 1INLA 2H9YA 2REQA 3VPAA 5BRJA 3H83A 3VBCA 3PUXA 4MW2A 5AYVA 4B8WA 4G9GA 3UOAB 4BP3A 1XMQM 3VUEA 1MNQA 4DOMA 5ED4A 4ARCA 4JHXA 4E15A 1RRPA 2RHRA 4YUAA 2YMLA 2R18A 4QHYA 8OHMA 3K8OE 5ER6A 5IWAM 5D8DA 3L28A 2IYUA 3K9NA 1ZI8A 4WE3A 4X24A 3DMDA 1T2VA 1QK3A 3K0HA 3OQIA 5IK2A 4O4JF 3B5EA 2VYVA 3TR5A 1SU7A 4GP7A 3V5NA 4UATA 3STVA 2HHHB 1IBKB 3T5AA 3C6MA 1YKGA 3SMVA 3HJTA 3DA1A 4RKWA 4L4SA 1KZGB 3MNFA 1SURA 2W2LA 1Z39A 1DU4A 1U0SY 1UXJA 3DEHA 4IJ6A 4ND5A 4EYGA 1BNCA 3I09A 5EJ8A 5KQRA 2NT3A 3OU2A 3OY2A 3ZZ0A 4RENA 3CN7A 3ESZA 1NBMA 4MS4B 4LHSA 1U8YA 1T5IA 2GBCA 1HA3A 3JTEA 3A6LA 1T5LA 4AQDA 1U1GA 5FBRB 1I3LA 3ZE1B 1W8DA 1AUXA 4EG6A 2HDWA 2JK0A 4DMGA 3D3NA 2BISA 1QPBA 3MRSA 2V58A 4EUNA 3GLHB 2JIRA 2YRXA 2Z3ZA 3K72B 4KR0A 3GJ5A 1Q3HA 2JGDA 3JYPA 1XZQA 4IFIA 5CK4A 3VVCA 3QVVA 2PA0A 1MO4A 1YD7A 4ND3A 1K7XB 2LKCA 3JRXA 1LKZA 1T8TA 3E22B 4Z53A 1V8PA 3GFVA 2VWQA 4EMSA 5CBPB 3ZZMA 2REBA 2XB2A 2VR1A 1FSZA 4C0JA 2ZBKB 1HKHA 2ZS9A 2A5GA 4QG3A 4B8YA 1VI2A 3OZEA 1TADA 3NKVA 1NVDA 2YFYA 2H59A 1MDBA 2FOIA 3I51A 3BMXA 1U8EA 2WSYB 3FCSB 4WDQA 4ZK2A 5CCEA 4GMGA 1H5QA 2PL5A 4D0RA 3IFSA 4LF8M 1D7AA 2FU5C 3HR7A 1TI7A 2FFRA 1E3TA 2W37A 3A9UA 3OURA 4IYJA 1JFSA 4WY2A 2DX7A 1O7JA 2KLBA 2W2TA 1SUDA 1ACJA 4JI1B 4EHAA 1ISMA 1BMQA 1P1CA 3EXFA 5AM5A 4FK8A 2HJWA 2HHCA 2VAXA 4YJ2A 3HXQA 3NHWA 2QD1A 1Z3CA 3KWMA 1VI6A 1KYQA 3OJXA 3MGGA 4NBWA 3VTAA 5FP0A 1BEZA 1OBCA 4RKQA 1SWVA 1PJJA 1DT3A 1MV5A 2PLAA 1NWCA 2CNOA 4J0EA 1NMZA 4L78A 1VLHA 4ND2A 1OTXA 4ZI7F 1HV8A 3HFGA 4KB5A 1VJDA 1KZ1A 1PDVA 3P2JA 3V4SA 4YLGA 4BYMA 4WOJA 1U4SA 1IJBA 1QNFA 2O0HA 5C4GB 4IDCA 1RRCA 1Z7EA 4ZXPA 3EXEB 3I6BA 4TTIA 1T4CA 4GSYA 3W0FA 4BC1A 4ME6A 3W3AH 2HF7A 1E99A 1A96A 3T41A 1XRJA 4DIDA 4DKXA 3B89A 2EARA 3Q40A 4G81A 1VL8A 1TO1E 4ER0A 4KGDA 2JY5A 1A8SA 3PYLA 4PC6A 1Q0TA 4HUQA 4QQKA 3SD7A 3OPYB 4PTYA 4B71A 4UE6A 3TQOA 1EJ0A 7YASA 1QQAA 1WSBA 1EHIA 3Q9NA 1PL7A 3FOEC 2DERA 3H18A 3UUEA 1DXHA 3D81A 4LQLA 1N36M 4BX8A 2P5SA 3FUWA 3DDUA 5B30A 2ZCJA 1CY1A 3I1FA 4H77A 2ZEJA 1V5FA 2PUFA 1QU2A 2BEWB 2ZRQA 3C48A 4RQAA 3LBHA 1QGED 4OIMA 2BAGA 5CM9C 5D6NA 3E9NA 3MHTA 1E9CA 4NONA 2L0XA 4TYQA 2BM9A 2CC2A 3N2GB 1UZNA 2H4WA 3EXIB 2GPAA 5HXAA 1DCTA 1B1AA 2R1TB 5DLPA 3U7HB 2TRSB 3UCFA 3KSAC 5K8LA 1UBHS 2PH1A 2FRDC 3F7NA 3VC2A 3T3NA 3DOHA 3OC0A 3HK2A 1DJQA 1Z6ZA 4TMYA 1BS9A 1CSEE 2WTUA 4BNNA 4KBGA 4X1YB 3WQBA 3VH4A 1ZNXA 3LQFA 1X9IA 3IHKA 5AI8A 3T9BA 2VCYA 4FCWA 2BZSA 2INGX 3DVRX 1EFVA 1EWKA 1QZUA 1JQ3A 5REQA 2ZZKA 1QP7A 2XVXA 3AERB 3ME5A 4NSNA 2Q5EA 1X1BA 1UT8A 1NMSA 5BSVA 4E3ZA 1WXDA 1ARZA 1QQ7A 5F3DA 2B0CA 4KIUA 1IN5A 2GWHA 4ND7A 5DULA 3HZJA 2J5RA 3A6FA 3BWEA 2IWHA 1IK6A 4RA9A 5FPQA 2P9QA 5CBKA 1RM3A 2H4YA 4O59O 4ND6A 2QWXA 3P9ZA 4EY6A 3ZU6A 4GHAA 4MS3B 3P9RA 1W9MA 3NNNA 4CCYB 1HNXB 4BBPA 3THSA 4MGKE 1O94D 1JJFA 3L1UA 1OR8A 4ZQGA 2YY5A 4LW8A 1R9NA 4NMMA 4OLJA 2RI0A 4X3OA 1XRNA 3FKSD 4J6FA 3MYYA 3WGGA 4DBZA 2DWZB 4ALMA 4BN5A 4ZJPA 3LUAA 4XDGA 4YB8A 1C3OB 2H4FA 4IBDA 3HB7A 4ZVMA 1OF1A 5BP7A 2Q6KA