3DFZA

Sirc, precorrin-2 dehydrogenase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
196
Chain Sequence
MYTVMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDDQYRLSLVKQREFLQQIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-2 dehydrogenase
publication title Structure and function of SirC from Bacillus megaterium: a metal-binding precorrin-2 dehydrogenase
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 61
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.3.1.76: Precorrin-2 dehydrogenase.
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13241 NAD_binding_7 Putative NAD(P)-binding
A PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.610 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3dfzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfzA01
2BGKA 1IE3A 2XPCA 3AU8A 3CMCO 1PQUA 4KOAA 4XGIA 1JKJA 5T64A 1E6UA 4FCCA 4OIMA 3V1UA 1C0KA 1ZMOA 4A2CA 1ZJZA 3U3XA 4BV8A 1YJQA 2HMUA 4IZIA 1KY4A 4D45A 1R4MB 4YJFB 3ROPA 1UZNA 2I66A 4YDRA 3GRPA 3JSAA 2Q45A 4J9UE 4CUJA 3VTZA 3OEWA 2VWGA 4FS3A 1QP8A 1BVUA 5ICSA 8LDHA 3L4SO 3MJCA 3UVEA 4ALKA 5K6AA 5JDIC 5T8KC 1WZIA 1N1EA 2JKVA 2J3IA 3ANNA 1EVIA 4H16A 4UUMA 3ZHXA 1MG5A 1ARZA 5IDXA 3WICA 1EDOA 2GZ1A 1WW8A 1K2WA 3OIGA 1PJLA 3QWFA 1T26A 4RPJA 1NHGA 1K6JA 2GZ3A 4HBGA 3TZKA 2AEFA 2EERA 1PU2A 5COQA 1K3TA 4P4GA 4DC0A 1HDOA 3QWHA 2NU6A 3BAZA 3SLGA 4R1UA 5TT1A 5EJ2A 3ZWVA 5JAZA 2DBVO 3ZV4A 4WOKA 4A03A 3PWZA 5I7VA 2G5CA 2DKNA 3I9KA 3BMNB 4KDEA 4CJXA 5JY6A 1RM0A 1ZH8A 2JD1A 1E92A 3GNQA 3WX0A 3ITKA 5B4VA 4I5DA 4WGGA 4B7CA 3ZNNA 1E6WA 1NQTA 1PGQA 1WPQA 2B36A 3BMQB 1UXKA 1CJCA 4J2OA 4RPGA 3INRA 4Q3BA 4GSKA 2FN7A 3TWOA 1X1TA 4BNTA 4E5KA 4IZHA 5JDIA 2V6MA 5IG2A 3F47A 2X8LA 4PLPA 1KETA 2AEMA 4BO0A 2CZCA 4AL4A 4BO4A 3K2EA 3Q11A 4Q3CA 3R3SA 4DREA 3QP9A 5JDCA 1XHLA 2Y68A 1T1SA 4BGUA 2O3TA 1Y5RA 4WECA 1LDMA 3D4PA 3CZMA 5JE8A 4E33A 3T4XA 4XA8A 2DQ4A 5DN9A 1WMBA 1E3SA 4BKPA 3AWDA 4BO9A 1ENPA 2E82A 4J4BA 2DC1A 5TT0A 3ZHYA 3E9QA 5DOZA 4BNFA 1P1HA 1Q2XA 4TSKA 3RUIA 3E9MA 3WJ7A 1ZXLA 3OQBA 1DJNA 4CMJA 4B4OA 1ZUD1 4FJ0A 4NNJA 3FD8A 4NR0A 3HB5X 4FGWA 2VUUA 5CDUA 4PVDA 3GMDA 4YJGB 2IZZA 2FPGA 4CM8B 3PHHA 2CY0A 1NAIA 1KVSA 4GLLA 1GUYA 1HEUA 4KDFA 3PZRA 4YAIA 4P8RA 3IL2A 2OORA 1RM4A 3TFOA 3I4FA 2HKIA 2B37A 1R15A 4JBHA 3ASVA 2CNBA 4WEOA 2DU8A 3LC1O 4YAJA 3FPLA 4FFMA 3N58A 2P4HX 1JA9A 3MTGA 3BHMA 3RASA 4CM9A 4CV1A 2DBRA 2RHRA 3DBRA 3STHA 2WD7A 2X7HA 3AUUA 2XAAA 3D7LA 2VQ3A 4M89A 1GEGA 1NASA 4J4HA 1ZXBA 3GDFA 3GUYA 3LT4A 5B4UA 2DUWA 3RUFA 3DBLA 4NJMB 5DT9A 4B7UA 4XEHA 3VZRA 5T6BA 4BHTA 4TROA 2DM6A 1IY8A 1Z6ZA 3HB4X 1Y1PA 2O4UX 4Q3EA 3ZWWA 3SJ7A 1NNUA 4EI2A 4BO5A 4NZ9A 4DYVA 4J2HA 1HE3A 3IDSA 1XQ1A 4XJTA 1YQGA 5I9NA 5JNLA 2X58A 4Z9FA 1Z45A 3H8VA 3H9QA 2NM0A 4B3IA 1MLDA 3FTPA 4U7WA 4ZHSA 4AJ2A 2O3JA 2R6JA 4P4LA 3ZH2A 3ONFA 1W0CA 2Q1SA 1XYGA 4HV4A 1IZ0A 3KYDA 2EKPA 4WCDA 3K9QO 1ZMTA 1ZZEA 1NX6A 4MIOA 2IXAA 2GGSA 1DAOA 2AQ8A 4ALLA 5C7OO 2FY8A 1GFSA 2PK3A 1HRDA 4MINA 2PA3A 3WR5A 2PH3A 2J3JA 3LDHA 3CPSA 1DEHA 4OMUA 1B2LA 1FDVA 1JWAB 1P1JA 1H6BA 1VLLA 2B4TO 1DC3A 4FFNA 3PQEA 3W6ZA 1BXGA 1N7GA 2QRJA 3LSYA 4TVBA 3EAGA 2W2LA 3HN7A 3BHIA 3RBVA 4RZIA 3LF1A 2BGLA 2JCYA 5AYVA 2OXIA 1EFKA 3BZUA 4PRLA 1J49A 1ISMA 1YL7A 4KUHA 2NU8A 3QQPA 3GGOA 4S1VA 1IUKA 1MXFA 3DHNA 5C3MA 1EUZA 3HUDA 1WXDA 1ONPA 5HS6A 3W4IA 4WPGA 2ZQYA 2Y1EA 1N2SA 5A5FA 2SCUA 3TJRA 1CDOA 1KS9A 4RV9A 1ULUA 2JFFA 2X0RA 2YUTA 2C0CA 4MOWA 2HQ1A 2F00A 3KLPX 1DOHA 3JQBC 3JD0A 1Z7EA 5G2OA 4RDHA 3S8MA 1U2DA 1EK6A 3V2GA 4ID9A 5LCXA 3UHAA 5TNXA 5L40A 5DZSA 3OA0A 4ZQGA 1I2CA 4LN1A 5ILGA 1E77A 3LC2O 4YAGA 2GCGA 1CQJA 2VRBA 2VNAA 4RVDA 1NM5A 4BO1A 4A5OA 4M86A 4QFCA 4XYEA 3HFSA 3TL3A 2D2IA 1NQ5A 4M8SA 5JLAA 1G1AA 3B1JA 3DC2A 4FR5A 4NFYA 1VJ0A 1KERA 3ZNPA 1PZFA 1L1FA 3G17A 4O1MA 3D3WA 4AJHA 1HDYA 2NVBA 3GAZA 3V2UA 3MJSA 3W8FA 3WIDA 4RVGA 5CPFA 4J90A 4ALNA 3PJFA 4N54A 2H5LA 1HLPA 2ILTA 3I3OA 2X5KO 1WZEA 2FWMX 3I9JA 4UAGA 2J3KA 3D3EA 3GPDG 1PIWA 3IUSA 5L53A 4XD2A 2J5KA 3WMXA 4IXTA 4D3FA 3FBTA 4W99A 3MOGA 1T2AA 2CVZA 5CDSA 3KV3O 1R6DA 5KJ1A 3K2BA 2IYPA 1MX3A 2YQ5A 3D5TA 3FPCA 3PGJA 4UULA 5EN4A 4NPCA 4A73A 4EZBA 4RPKA 3UF0A 1E5LA 1O94A 4XYBA 1C0PA 3FNGA 1EVYA 1JVSA 1N8KA 4UUPA 4XRRA 4ZICA 2EHDA 3JV7A 1YDWA 3TOXA 2NSDA 3DZGA 4BMNA 1GZ3A 1YBVA 3UCEA 1LLDA 1LRJA 3FRJA 3UW3A 2BRUA 3LU1A 3CUKA 1Z75A 2JD0A 4LVUA 3UXYA 1SEVA 4G2NA 3MTJA 3DONA 3RFXA 4B4WA 2HO5A 2PZMA 2Q2VA 2IEDA 2NUAA 3S55A 1KYQA 5GMOA 4WASA 5TLSA 1Y6JA 4MP3A 4YVFA 6LDHA 4TRJA 3WYCA 1Y8RB 3U0BA 3I83A 1VL6A 3GC6A 2NVUB 3H5NA 4IJVA 3OECA 1EBUA 2HJRA 4FC7A 5H81A 3WGYA 3JYQA 1GTMA 2AMFA 2P4QA 3FR7A 1I2BA 2VYVA 3AK4A 3ON5A 2E4AA 2EP7A 1QYVA 5JO9A 1DIAA 3TF5A 3DBHA 3IP1A 1QG6A 1VL8A 4BNKA 2I3AA 1PWXA 3WGIA 3RU7A 3GNTA 3TSCA 5TS3A 4Q9NA 4CLDA 2PH5A 4CMIB 2X9VA 3HADA 3MWDB 4PG7A 3AI2A 1OAAA 2DT5A 2UVDA 1LBEA 1WNTA 1WDMA 1DO8A 2B35A 3H9EO 1GAEO 1XSEA 2FZWA 1EVJA 3ADOA 2EXXA 4CLHA 3IJPA 3QVXA 1Z73A 3W4KA 4D42A 4HADA 3DR3A 5F1OA 2OOSA 5DOVA 3GAFA 3GVCA 2VCYA 1DB3A 4PN3A 4XRGA 5ENDA 3I5MA 1H0KA 3GT0A 2D1YA 3BTOA 2R2GA 2Z5LA 2V6FA 1MG0A 1X7DA 5G0WA 4A27A 1U8FO 2YYYA 1GYQA 3A14A 4TVOA 4CM5A 5EQFA 4HY3A 3ST7A 3UOGA 3E5MA 1O8CA 3PJEA 2Y0CA 5DP1A 2NADA 3GH3A 3E5RA 4AJJA 4DLBA 1UP7A 5KNLA 4M1QA 3FCOA 4LGVA 1PJTA 3P5SA 4RVUA 2H63A 3IIEA 1IHYA 1XG5A 4AJPA 4U5QA 1M75A 3F46A 4Z3DA 1P31A 3OH8A 1W8DA 4QXMA 1CWUA 5HA5A 4CR8A 2LDXA 1NVGA 2B83A 3M1AA 2BFPA 1ID1A 4B8WA 4CODB 5TX7A 1I32A 3TZCA 1PS8A 5AOVA 2EJVA 3WOHA 1DIBA 3NYWA 2I9PA 3OMLA 3UAGA 3ZWMA 1IL0A 5DBIA 2VT3A 1OC2A 2DBZA 2DFVA 3A28A 4IDBA 5G0UA 1LSSA 5JCJA 2Z1NA 3PDJA 3DFZA 2PKQO 2JL1A 3PHGA 1N7HA 4MVJI 3NDJA 3KUXA 5A3JA 1HT0A 3RWBA 3U5TA 5JYDA 5A3VA 4FJ1A 4MP6A 3H9GA 3ONEA 4JCOA 3NJ8A 3JD2A 2ZYAA 4K6FA 3IQDB 5BSGA 1HE4A 5IDYA 2P91A 3RUAA 4MKXA 1LC0A 2R00A 1K6XA 3S1LA 1R12A 4CM6A 1I33A 3DL2A 2AXQA 4OYRA 4R16A 2NTNA 2GNAA 4ONEA 4HP8A 1NQAO 4DTIA 1CF2O 4IDGA 3MWEB 1U3UA 3Q2IA 3E82A 3WGTA 5L7TA 4RZHA 4L75A 5KIAA 4QEDA 1B8UA 1PJQA 2X22A 3CE6A 1XKQA 3HNPA 3WGHA 1I5RA 4I08A 2PY6A 1I3MA 1P0FA 1SBYA 1SCUA 2GO1A 2YHIA 1HSZA 2AW5A 1A27A 1HDRA 3DDNA 2FOIA 4PG5A 1E7SA 1LI4A 4RORA 3L4BA 3NEPX 1ZK2A 2AEJA 3C85A 2BFAA 4TKLA 3KM0A 4CMBA 3EVNA 4M55A 2W2KA 1E0DA 2G76A 4ZJUA 5DDIP 2JFHA 1EMDA 1E7MA 2ZYDA 3DOOA 5JMWA 1ZFNA 3BMOA 3CZRA 4GGPA 2QRLA 1PR9A 1Y9AA 3C3XA 1JAYA 3ZHBA 5EQDA 5TIIA 1HDZA 1H2HA 1GPJA 1ORRA 1XLTA 1MGOA 1YBAA 2OMEA 4PG8A 4WOJA 3IOYA 2AHRA 1I3LA 3WWZA 4LSMA 2X0JA 5CAEA 3NUGA 3JQ7B 1XQ6A 3ETGA 3N7UA 4IUYA 4OOFA 3ZCXA 4EDFA 3JQ9C 3PK0A 4BGIA 2PD3A 3VC7A 1MC4A 1LEHA 3JQ6A 1IZ9A 2BFOA 3TN7A 3WBBA 5BNTA 4C7JA 4WNIA 2PZLA 2E37A 3FF4A 5THQA 4Z0TA 3DAFA 1LDBA 1VL0A 3QW2A 1WWKA 4IINA 1V0JA 1QSGA 1R16A 4CMAA 1JN0A 1L7EA 2IXBA 4OQYA 1I36A 4L73A 4MPDA 3IAHA 2PKQP 3EK2A 1V3TA 1E3JA 3PI7A 3EYWA 4TRRA 1K6IA 3TZHA 3GQVA 2O3SA 2QG4A 4E13A 1RJWA 1XGKA 3NJ4A 1UP6A 5L7WA 1LDYA 1VRWA 4WJZA 4XYLA 2ZYGA 4CQLA 4A10A 5C5IA 3KVOA 3I52A 1P44A 5KJCA 3I6IA 3L6EA 2EJWA 3D0OA 4IDFA 2IYOA 3ASUA 4NHEA 3C24A 4J3FA 1A7KA 4YAKA 4KZPA 1XA0A 3AFNA 2Y1OA 2VRCD 1ZK1A 4EJ0A 2RBEA 4NH4A 4BO7A 4GX2A 1PL6A 4A7PA 5HTOA 3PRJA 2P68A 3K30A 3QVOA 5A9RA 2NQ8A 5CDGA 4OJNA 2D3TA 1JW9B 2FR0A 4RF5A 3RFVA 5T57A 1YL6A 3VPSA 5I8WA 2G0TA 1I2ZA 1HZZA 1V3UA 1GD1O 2BI8A 3JD1A 4W82A 4HX5A 3W8EA 1KVUA 4PFJA 2BGMA 1SEPA 3H2ZA 4XR4A 3OJLA 1O5IA 1ZKMA 1DC5A 1YH3A 3HE3A 3IKVA 3BXXA 4IM7A 4MVJD 2YZ7A 3QVWA 4CQMD 1B15A 4LISA 2Q1UA 4IGFA 1NFRA 2P9CA 1BMDA 5BSFA 4JK3A 3LT0A 1ADBA 1ZNQO 2D8AA 3DMYA 3Q9UA 2DVMA 4YEDA 4AJKA 1MA0A 1LJ8A 4E2WA 1GYRA 3RKUA 1I3NA 1X13A 2B5WA 3LVFO 3ZNOA 2GN6A 4Y8VA 4CMEC 4E3ZA 3I9LA 1YRLA 4UEJA 2BH9A 2WWRA 4YWJA 4CV0A 3WQQA 4OHUA 4OGWA 4UREA 1MFZA 4OSPA 3ZV6A 2CVOA 3JQFC 1LDGA 1Q1NA 4J1QA 1WDKA 1TLTA 5MDHA 1F8GA 4EUHA 4QT0A 2VHVA 3S2EA 1ZW1A 4RVFA 5CEFA 4D79A 4CLRA 2PZKA 4BVAA 4R9RA 4JJIA 3K6JA 4CV3A 4J1NA 3QJ5A 1BSVA 2FMUA 4RPHA 4LCJA 2QX7A 1EQUA 1KEVA 3DAPA 1MXHA 5T67A 1TA4A 1W73A 2Q2QA 4K26A 2A4KA 3DAGA 3FSRA 4KTTE 3SLKA 3WTCA 1YVEI 5MGBA 3WMWA 2PKRA 1J5PA 3WBFA 2Z1MA 1H9AA 3K8ZA 4OKIA 3PWKA 3WSWA 3JQAA 3F6YA 4WLVA 4D46A 1IHXA 2FPIA 4RF2A 2Q2WA 3FNHA 2DBQA 1PGOA 1ULSA 4E5NA 4DC1A 2X9GA 3U4CA 3DHYA 1BXZA 1MV8A 3E9NA 4QQRA 1DC6A 1B3BA 3HDQA 5C7IO 4YACA 9LDTA 5A9SB 3DBRB 2WD7B 4GQAA 4W7HA 3S2GA 4M87A 4DPKA 2PD6A 1NXQA 3QY9A 4DGSA 3A06A 5T8KA 1LX6A 2O7SA 4CMCA 3LT1A 3MZ0A 2X5OA 3HJAA 1V3VA 1BGVA 3OETA 3WGOA 2WE7A 2EGGA 5I7EA 1XELA 1CIVA 5G0VA 1NVTA 2A9FA 3UICA 4NU6A 5DCYA 4BO6A 4PLGA 4BGVA 5FI5A 2O3RA 2CF6A 2G17A 3GGPA 2WE8A 2CDBA 2GR9A 1S6YA 5IDQA 3AY6A 3KETA 1U5AA 3CIFA 5C37A 3SJUA 1NHWA 2EW2A 1HL3A 4KTVE 1Y8QA 3IJRA 4NJOA 2Q1WA 1IULA 4OAQA 4U8GA 2PV7A 3UUWA 1M6WA 4GGOA 1NWCA 4BNXA 1UUFA 2EG9A 1XEAA 4RGBA 3OHSX 4FJ2A 4IJUA 3WFJA 1KVQA 3RC1A 2JFGA 2A94A 3DZIA 1X0VA 1OOEA 3JYPA 4CLEA 4PZDA 2EP5A 5TJHA 1KOLA 1IOLA 1HYGA 3R3JA 1ISFA 2P5UA 4AFNA 1PJBA 4HNHA 4YJFA 5TF4A 3E8XA 2HRZA 1I8TA 1HDXA 5CDYA 3GN1A 2VHWA 3OIFA 2WSBA 3RBXA 3B20A 5ER9A 1NP3A 2HU2A 3PZBA 5KVQA 4J1TA 3OFSA 4RF4A 2G82A 2HK9A 1B26A 4XX0A 3EGOA 1P74A 3NDIA 2X86A 4ZQEA 2I5PO 3V2HA 3WLEA 3D4NA 4DUPA 1BXGB 4ESOA 4ZU3A 4BQPA 3H9JA 4I1IA 4K28A 1GV0A 2W8ZA 2EKLA 3TNLA 4DMLA 1YJ8A 2WMDA 1U3VA 2RH8A 3H4VA 3VZQA 5COBA 4E32A 3C7DB 1IPFA 2EWMA 3PJDA 1AXEA 4DVJA 2NACA 1G0NA 1Z74A 5HBRA 1DRUA 3H7AA 4OXNA 5DBFA 3U4IA 4P38A 4N5LA 2CVQA 2DTXA 2I67A 4NBTA 3JQCA 1PZEA 4PLTA 5I9MA 3FR8A 5A9TA 5FF9A 2C7GA 4HFRA 2DFDA 4AICA 5A04A 3F1KA 1PZHA 2F1KA 3LF2A 2YQ4A 3VPHA 4JN6B 4KMSA 2QIOA 3DHEA 2EW8A 3EY4A 4XYGA 4BIIA 1PS0A 4RVSA 1ISJA 1YQXA 1DFIA 2W4QA 4Y6RA 2NTJA 4GPD1 4DPLA 2HUNA 4D43A 4XKJA 2P5YA 3WIEA 4FOSA 4JBIA 3RJ9A 4F46A 2ZCVA 1HLDA 5B1YA 1QMGA 4YJHA 5K0ZA 4MVJE 3AY3A 4AG3A 3IKTA 4IS3A 5IF3A 4R54A 3JD3A 3F5QA 3Q0EA 4Y6SA 1Y9EA 3LLSA 2X0IA 1JAXA 4HUJA 5G0TA 1H5QA 1RKXA 4BKUA 1T2CA 3GY0A 4NK4A 5JS6A 4Z0HO 3V1YA 3WSVA 2E6UX 3PPIA 1SB9A 3RFTA 3ENKA 2UV8A 4E5YA 4PZCA 5CFZA 3WJAA 3O26A 3DZKA 2PZJA 4I5EA 4KUGA 5L95A 3I4CA 4CM8A 5AQ1A 2VYNA 1FDTA 3KSUA 3HSKA 1QORA 2GERA 3PTZA 5IDWA 1AE1A 1SB8A 3FNEA 3IUPA 1CYDA 3PFWO 4DMMA 2PD4A 3VZPA 1Q7CA 4WLOA 5JPIA 3EVTA 5JAQA 2BLLA 2I99A 2POQX 3I1JA 1NYTA 3WLFA 4TKMA 2FR8A 3FTNA 3H3JA 3G1TA 3HZZA 1B8VA 4GKBA 1IB6A 2NWQA 2GRAA 4ITUA 5T5QA 1ENOA 2CF5A 3JQAD 4DLAA 1DXYA 2VUTA 4BNVA 1V8BA 4ZQHA 2GZ2A 1QRRA 3DMTC 4M54A 2ZQZA 4PCVA 4L8VA 1PSDA 3HN2A 3BA1A 3G0OA 1AGNA 5ICMA 2JHGA 4BQRA 5A4DA 1ZK3A 3GK3A 3TPCA 3SVTA 4WE3A 2JD2A 2WJPA 4YTEA 4NJMA 3ZWAA 2X0NA 3ETEA 5JC1A 1O9BA 3W4JA 3WGGA 4NBRA 4E2XA 5JC8A 4YYZA 3RJ5A 3NTRA 2PR2A 1K0UA 4HKTA 5G4KA 2HMTA 4YT8A 1FXSA 1A5ZA 4YT2A 3FWZA 3TZQA 1XU7A 3LK7A 1VI2A 3QRWA 3RQSA 1X7HA 1XDWA 3A9WA 2ZTMA 1BW9A 1LRKA 2QYSA 4ND4A 4OXYA 3DO5A 4XGNA 4GMFA 4PIVA 3M2TA 4UUOA 4DYDA 4TZTA 3VH3A 2YY7A 3U4HA 3UKOA 3PQFA 1FF9A 2WYUA 1UAGA 1J0XO 1B3RA 1GR0A 1ZK4A 5JAIA 1QYWA 3ENNA 5B12A 5TGDA 1LXCA 4O0LA 2HCTA 1EK5A 4AJ1A 4J7XA 4E2YA 2OHXA 5BSEA 1HXHA 3JQBA 5FWNA 4JIGA 3AI1A 3H6KA 1OFGA 1GQ2A 3SX2A 2YV3A 3OP4A 1H6CA 1JU9A 1DLIA 1PS9A 3P7MA 3ZU4A 3QA9A 4Y6PA 1TT5A 2PGLA 3OEYA 4E4YA 1QR6A 1NR1A 1BHSA 3ZU5A 5KVSA 4IIVA 3DEYX 1JTVA 3CSDA 2ZTUA 2FR1A 5HM8A 3VH4A 1H6DA 1BXKA 1RYDA 2X1HA 2IODA 3LZ6A 4U0JA 4XJSA 4L4SA 2OBYA 2OP0A 2YW9A 4D44A 3AFMA 4BKQA 5FI3A 4NBVA 2E49A 4CM9D 3BTUA 2I76A 5KJEA 3MJVA 4ZRNA 4Z9YA 4N5NA 3T7EA 4ZGWA 5DCWA 2UUOA 3H2SA 2FRDA 4NFSA 1GV1A 4I9UA 4CUKA 3WS7A 1FDSA 3COSA 1PQPA 2GN8A 4D3SA 3Q6IA 4XYMA 4HFNA 5IZCC 1EDZA 4CQMB 4IS2A 1YOVB 2VHYA 3K5PA 3WYEA 1N9GB 2O3UA 4IMRA 4E5MA 5ES3A 1PJ4A 2C82A 3H9UA 3Q3CA 5I7SA 3FHLA 3WGZA 1YONA 1O6ZA 2B4RO 1P1FA 5IXYA 4BNWA 4BO8A 3R6DA 1WMAA 2HAEA 2WEKA 3ANMA 3KEQA 1MP0A 5IN5A 3H65A 2E48A 2FHSA 5L51A 2BD0A 2VT2A 3GPIA 4XQCA 1C1XA 4YQZA 3WB9A 3WNQA 4EW6A 3I9OA 1XCBA 1DIRA 5BT9A 3WFIA 2OO5A 4BNLA 4JJGA 3A1NA 4CR6A 4WLFA 2X5JO 1ZSNA 5BR7A 1I01A 4FFLA 4D0RA 1LC3A 3NX4A 3DQPA 1ADFA 5EESA 3KHUA 3TOZA 3RI3A 1QLJA 4AJLA 2ZB3A 3HHPA 2LDBA 1O95A 1PWZA 5AXAA 3U09A 1P1IA 1VJ1A 2AE2A 1VSUA 2PLAA 3H5AA 2W2LD 3WWYA 4QX6A 1OMOA 3PLNA 4IDAA 2NLOA 2VYND 2Y1FA 2ZKLA 5I7FA 4HWKA 4KUEA 3NTOA 2YV2A 4UVIA 3NKLA 1G0OA 3BTVA 2HMVA 3PDUA 1KEPA 3AOEC 1C0LA 1R37A 2V7PA 3NDRA 3FNFA 1UJMA 1E3LA 1DIGA 4CR7A 4LK3A 3PVZA 1NFQA 1KEWA 1LQUA 2Y0DA 2C29D 3R1IA 4JLWA 4R9SA 1E7RA 4Q3AA 4YT5A 1A4IA 1H2BA 5TRTA 1X14A 4W6ZA 1R4NB 1M6HA 3E03A 1LUAA 1YDEA 1ISIA 1P1RA 3AOGA 3JYNA 1ZO8A 2HRBA 3EMKA 3GHYA 2XF8A 4R3WA 4GLOA 2O7QA 4WCFB 3PGXA 5FEUA 2J3HA 4AJEA 1DJQA 2ZK7A 3HWRA 3VAZA 3JCZA 3NGXA 5THKA 1BVRA 1NWHA 4B8ZA 4CMKA 1H94A 3INGA 2VOJA 4I8XA 2NV6A 1GCOA 4TWRA 1EBFA 2J5QA 8ADHA 4DQVA 1TI7A 2EV9A 2NVUA 2DUUA 3U4DA 1XU9A 3DBVO 3GVHA 5AXCA 5B37A 2BMAA 3ITDA 1RM5A 3AY7A 3DOJA 4FW8A 4JXKA 2YDXA 3L0DA 4R69A 1KVRA 3N74A 4PRKA 1LLQA 3GN2A 1T4BA 4TRNA 3ZWNA 3RC2A 2C5EA 4XQGA 5JYEA 1U2GA 4UEKA 1HYEA 4WEQA 1U3TA 2ZTVA 4F6CA 4R4JA 4ZN6A 2RIRA 5KKAA 3AUAA 3O8QA 3KOUA 1Y81A 3BIOA 2NQTA 2VWHA 1C14A 4PVCA 2NNLD 2HMWA 1AUPA 4LRTB 3OF2A 2Z95A 5A06A 4P22A 4MVJH 4I9NA 1X0XA 1JVBA 1QYCA 4BKOA 5JCXA 3PWSA 4BNMA 4IDCA 4GX1A 2B69A 3ZWYA 1VM6A 3BMCA 2PFGA 4E5PA 2ZJ0A 2Y1DA 4PG4A 4YBZA 4BMVA 4WCFC 1E1NA 3VPFA 3UN1A 2QHXA 1UAYA 3UH1A 4GX0A 4E2ZA 1D1TA 3NT2A 3EZYA 1HSOA 2IZ1A 2O2YA 3I23A 2Q50A 1UZLA 1D7OA 3GFGA 2X9NA 2VNSA 3NTQA 3DZBA 1IPEA 4OL9A 3GZNA 1P45A 2XXJA 5A02A 1V35A 4NFHA 4MO2A 3KYBA 4UVHA 4XIYA 3IC5A 1PX0A 3RBZA 4DXHA 1PGPA 2I6TA 3RSHA 3VOSA 5JO0A 1J6UA 4J6FA 1SOVA 4CM4B 1YE3A 1M76A 3PXXA 3OBBA 1HETA 4BNGA 3L6DA 3ZU3A 3V8BA 3RC7A 5BQFA 1F14A 1P3DA 2EEZA 2OUIA 1GY8A 4INAA 4YT4A 4DBZA 4CLOA 5F5LA 4XIJA 3SBOA 2XXBA 5COAA 3AU9A 3ZWXA 3ROQA 3WYBA 4AJOA 1X7GA 1VC2A 2ZB4A 4LCEA 3VH2A 2ZTLA 5CHEA 1NAHA 3K73O 1DC4A 3KBOA 1XR3A 5C7LO 3GA0A 3WQSB 4MVJG 2WTBA 2O50A 3INTA 2OL4A 3DTYA 3PHIA 2VYVD 4BNHA 4CL8A 2XOXA 4H3VA 5KJFA 4LW8A 5IN4A 5L4SA 3E48A 3JQ8A 4L4XA 1ISGA 3VTFA 4IQ8A 3DXFA 1A4UA 3WTBA 4FC6A 3RC9A 1R0LA 1DHRA 1GYPA 4R68A 4NBUA 2C20A 1T2EA 1LQTA 4MVJF 4AJ4A 1I24A 1W6UA 2ET6A 1GCUA 4CLRB 3O38A 1N5DA 1LDEA 4ZD6A 1OBFO 3VVBA 1DHTA 1LTHR 4NDNE 2HDHA 4PGFA 4CMHA 2Y05A 3JQ9A 1E5QA 4PLYA 3F9IA 4A0SA 3NGLA 3L9WA 1W4ZA 4PLZA 3CH6A 4R5HA 1I30A 4MP8A 5DULA 4TQGA 4N5MA 3KB6A 2FSVA 1UDBA 3U9LA 3V5NA 4F6LA 1P9LA 3G79A 3EHEA 3LLVA 2VHXA 3JQAB 1Y5MA 3B1KA 4DIFA 4IJWA 3AM5A 1C0IA 1YGYA 4LRSB 5F21A 4C7KA 3RROA 4ZQBA 3ZWBA 3QLJA 1CRWG 4EYEA 2DPGA 5EL0A 1KBZA 4GWGA 1IYZA 1PJCA 2D0IA 1EE9A 2HJSA 5EINA 4B3HA 1E1LA 3KO8A 4OXKA 2BF7A 2BKAA 2GASA 4IGEA 4CUZA 5HS4A 2PNFA 1CEQA 4RLSA 5F5NA 3C8MA 2P9EA 1C3VA 1E3IA 1ENYA 3K31A 4RDIA 4EEZA 1E3WA 3CEAA 1YQDA 4N18A 4QUKA 3DZJA 1VPDA 5K6AC 4YA6A 1GADO 5JMPA 3PHJA 2B4QA 4NQZA 4DIOA 2QQ5A 4R01A 5ITWA 1UZMA 1PL7A 4NBWA 1HWYA 3PFFA 4HFJA 5JCJD 4IBOA 3D64A 3S2IA 2PGJA 3GFBA 5DF1A 3RUHA 3RIHA 3G1UA 3JYOA 4GSLA 4NI5A 1NQOA 1Y8QB 1LSJA 1VSVA 3VHRA 2G1UA 3L6OO 3VKUA 3C1AA 4BB5A 4L9RA 1QKIA 4M49A 4ND5A 4ND1A 4WKGA 1NR7A 3L77A 1EE2A 3JQGA 2VTEA 2NVWA 3KZVA 3UCFA 4DWVA 4BGEA 1GEEA 1G6KA 1JWBB 1N1GA 1WP4A 1F17A 2BHLA 2OZPA 1M2WA 1PGNA 5LDGA 5CP8A 5F1PA 3KSZO 1Z7BA 2H1SA 4DL9A 4DLLA 3WQRA 4XDZA 3DTTA 1UXJA 2B0JA 5TSDA 1KIFA 1UH5A 4JQCA 2WDZA 2VHZA 4CMEA 4CM3A 1DFGA 4OM8A 1T4DA 5JDCC 1NTOA 2V6GA 6ADHA 3ULKA 3SC6A 3GG9A 5AVOA 5LC1A 2BELA 3U49A 2EIHA 4R51A 2VOEA 5KWEA 2W90A 3QWBA 4EITA 2AG8A 3F4LA 3JQFA 4JROA 4UUNA 4NU5A 5U1PA 1LA2A 4U6QA 3GOHA 4UVEA 3W1VA 3VZSA 1C1DA 1Q0HA 4CLXA 3F5SA 2Y0EA 4IDDA 3WNVA 4Z6KA 1PGJA 1DRWA 1T24A 3DBLB 3KYCA 2ZCUA 1T2DA 3NAQA 3JQDA 3DFUA 1OZAA 4EEXA 5AXBA 5AXDA 4D0SA 3GZ4A 3OA2A 4S3MA 4TRMA 2UDPA 4Y67A 3C1OA 1V9LA 3E6AA 1ZJYA 4YRDA 2D5AA 3I9MA 2RHCA 1RWBA 3RVDA 2Q99A 1LSOA 5G4LA 4XDYA 2UYYA 3AUSA 4YCAA 2Q4EA 1LSUA 4OO3A 3Q9NA 1Y7TA 4FOOA 5L4LA 3BTSA 1CERA 2ZIZA 4J0FA 1R4MA 4YJHB 3RD5A 2OFPA 3KYDB 3FBGA 2HK7A 3QHAA 3UCXA 1GU7A 5BNIA 3VPXA 4YB8A 2W98A 1SNYA 2C59A 4J0EA 4UVGA 3MJEA 1FDWA 1NBOA 4FGSA 5U9CA 1HE2A 5ENVA 2WYWA 4ALIA 4CV2A 4IXWA 2IDZA 1ZEMA 3EZLA 4W9NC 5A1TA 1NFFA 5CDTA 1DLJA 4FDAA 4BS9A 2JHFA 1ADCA 3SC4A 1E1KA 2Y1GA 4XGKA 3DOCA 4BO3A 4U0KA 2GDZA 1SOWA 2FP4A 2IEBA 3X2FA 4JP3A 1NPTO 4K6CA 4TZKA 2GN9A 3LYLA 5IFLA 1DRVA 1BTOA 4JX8A 4GVXA 2C7VA 4AVYA 4F3YA 4BOYA 5JFOA 5KVVA 1SMKA 3M2PA 2O4CA 4LSWA 1ZK0A 3VDQA 2PGDA 3BMNA 5KJ6A 1P77A 3RCBA 4Q3DA 1FDUA 2YV1A 5JBIA 3CXRA 1U3WA 4MVJP 2QZZA 1GDHA 1MC5A 4OQZA 1EZ4A 4GH5A 5F1KA 2D5CA 4HXYA 5EMHA 5I8ZA 3TRIA 3BMQA 4QO8A 1DDOA 5A9SA 3BYZA 1QV6A 5IAAA 2NTVA 3GEGA 4BNZA 5L9AA 4XWYA 4QECA 2AE1A 4W9NA 5F3RA 3RUDA 3ZWOA 4B7XA 2VUSA 4K1LA 4Z0PA 3ROMA 1PL8A 2GYYA 4FIZA 3RUCA 4CM1A 4PLHA 3ZV5A 3DB2A 1PQWA 3LC7O 2NU9A 5DP2A 2AQHA 2Y93A 4KQXA 3TQHA 3QWIA 2AQKA 3KRTA 4II2A 4BB6A 4E12A 4RPLA 5KVCA 3H3FA 2A35A 4FFOA 1Q7GA 4WLEA 1FJHA 3F4BA 3AJRA 1K89A 1QYDA 4R1TA 3L9XA 4FFPA 5G4KB 4H7PA 3ZDFA 1VKNA 2D59A 3OSUA 4MKRA 1U5CA 2RH4A 2UUPA 1PJSA 2IRWA 1QYXA 4BMSA 4XQ9A 1YB4A 5CPBA 1BW9B 4FSHA 4XB1A 4MVJM 3P2YA 4GAEA 4URFA 3QE3A 4R1SA 4YJGA 3D3WB 3ADPA 5K9ZA 3EW7A 3ABIA 4ROSA 1UP4A 3C7AA 1PJ2A 1YWGO 1QXSA 4IDEA 2X4GA 5GY7A 4F45A 2C07A 2YFQA 4J9VA 1PR3A 3AM4A 4WNCA 4B4VA 4R3NA 5HWSA 4ALJA 3WGQA 1Q7BA 3KTDA 2HK8A 4O5OA 1TT5B 3FWNA 4O59O 4GWKA 3MJTA 3RKRA 4D41A 2TMGA 5G0SA 2YJZA 1TB4A 1GZ4A 2UAGA 3ZNQA 3OJEA 1I0ZA 2FPPA 2Y99A 2FZEA 2QW8A 4W4TA 4GI2A 4Q39A 3TFQA 4UEOA 2O3QA 2QYTA 4ND3A 1WVGA 4YQYA 3VH1A 3EUWA 5B4TA 1GPDG 1CQIA 4C4OA 4L0QA 1U7TA 3TL2A 1KC1A 3PIIA 3MEQA 4LVCA 4N7RA 1NPYA 4RVHA 4CPDA 1LLCA 2VWQA 2Y66A 4W7IA 4ZRMA 4G65A 3VDRA 5BNFA 3LT2A 4J7UA 4BNUA 1QV7A 1BG6A 2YFHA 3KXDA 3E18A 4E0BA 3GVXA 4AJNA 4OOEA 1LNQA 2Q3EA 4JBGA 3T7CA 2HLPA 2J8ZA 3WG9A 3GEMA 5KCZA 2ZJ1A 1ZSYA 5DNAA 5EERA 4II3A 1ZCJA 4XQEA 3X2EA 1CETA 1X15A 3NV9A 4FBGA 1I10A 2YHUA 4QFDA 3AI3A 3MJ4A 2FSSA 3TDKA 5HRUA 2GPTA 3GLQA 2PTGA 2GSDA 5JW6A 4FB5A 3QV1A 3ICPA 1ADGA 3DMTA 1GZ6A 2GD1O 1E7QA 2VTDA 3B70A 1B14A 4EUEA 2ZB7A 1C1XB 2WYVA 3BHJA 1AN9A 3DBHB 3HDJA 3PLRA 1DAPA 4KWIA 2P2SA 4MIYA 4EJMA 1R66A 4GL4A 1YXMA 4IMPA 2ZB8A 4GBJA 3JD4A 1BDMA 4EJ6A 5IZ4A 4I5FA 1YBMA 1F06A 4XZ3A 2X23A 1YL5A 3DWFA 2DAPA 4A26A 2EGHA 4IPTA 1DFHA 2V6BA 1BDBA 2GLXA 4R41A 1P0CA 5H82A 1XWFA 4OKNA 4EBFA 3B6ZA 5JAMA 1RYEA 4BL5A 2EKQA 1ONOA 2TMDA 1PEDA 3M6IA 1F0YA 3O03A 4JGBA 4J49A 4D3DA 3ZGYA 2OBNA 2CFCA 2V65A 1QLHA 2VWPA 4RO0A 2DTEA 2P9GA 4Q3NA 2IE0A 5I9LA 5ILOA 5TQVA 1UR5A 3C7CB 1D8AA 3D1LA 3GDOA 1DIHA 3IMFA 1JQBA 3GHHA 5FYDA 4NMHA 3GNSA 2CDAA 4L76A 1LDNA 3CINA 1B8PA 2O23A 4RL6A 3P2OA 1OI7A 1ONNA 4B4UA 1JKFA 3PHLA 4PLCA 3EDMA 3GUCA 4L4RA 3I9NA 4ZVVA 3QVTA 4LMRA 1RPNA 3ANLA 1UDCA 1EVZA 3PJGA 5JSFA 1D3AA 1E3EA 3ZWPA 7ADHA 4O6VA 3H5RA 2HMSA 1EUCA 4QTZA 1GQYA 1HYHA 1U4OA 3TZ6A 3QSGA 4ZQFA 4UVDA 3NT4A 2A92A 3Q1LA 1U8XX 2I65A 1MFPA 4G81A 1E7YA 3NT5A 1KVTA 1F8FA 1A9ZA 2AA3A 3ZV3A 5KTKA 4B79A 1LU9A 2BFMA 5ER6A 5A5EA 1PZGA 3NRCA 4DA9A 2GUGA 3CTMA 4NIMA 1RM3A 1AHIA 4YRAA 2J6IA 1M66A 3ORFA 3QWAA 5IZCA 4XB2A 2O2SA 1ZSVA 1SC6A 1T1RA 2Q1TA 3GVPA 4NG5A 1WLYA 3ZU2A 1EEHA 1GQQA 5A03A 4DQXA 5DCUA 1HF3A 3FI9A 2GN4A 3ZWCA 1Q0QA 2CD9A 3DZHA 3JTMA 3O8QB 1P1KA 1EFLA 1ZVMA 2CUKA 2C54A 4IIUA 1HDGO 4J7CA 4WK6A 4EGFA 2GF2A 2VZ9A 1U4SA 4OH1A 5JXWA 4X54A 2IZ0A 4JJFA 2B5VA 2JAHA 3QIVA 4RCVA 3ZI0A 2YHIB 3W8DA 2YDYA 3HG7A 2AG5A 3OJ0A 4HFMA 3VVCA 4WUVA 2VRCA 3BMCB 4P4NA 2JCXA 3KLMX 3VPGA 4FFRA 1L7DA 1Q0LA 4MKZA 2H9IA 3OM9A 3GVIA 5JY1A 3OJFA 5KOIA 3PYLA 4YXFA 4KQWA 5ITVA 1NPDA 4O63O 1U7HA 2W2KB 4XR9A 4U6SA 1I3KA 2CMDA 3AW9A 1YB1A 3PYXA 3R0IA 5LDHA 4IY1A 1PTJA 3GZNB 2DLDA 3BMOB 3ICCA 4BV9A 2D4AA 2AQIA 3FN4A 2NU7A 4D7AA 4FQ8A 4MDHA 4LMPA 4PG6A 5J23A 1WAMA 1T25A 3LQFA 3SXPA 4YRBA 1KEUA 1ZEJA 1YS4A 1A71A 1A9YA 4MVJA 1H9BA 4CQMA 1H93A 4DPMA 1YOVA 2R00C 4DBVO 3IS3A 3HDHA 1N9GA 1SPXA 1UXGA 4IQ0A 1Y8RA 3P19A 3JQEA 4RLHA 4YJDA 4GVLA 4CLOB 3GF4A 3HFGA 5IJZA 3W6UA 3AOEA 1GUZA 4R1NA 4J91A 2EF1A 3PYMA 4DIBA 1E1MA 1SAYA 1TXGA 3ZZNA 4ALMA 3D4OA 1A72A 1SO8A 4K9DA 2O48X 1F12A 4B3JA 3UGKA 3GEDA 4R5MA 3RUEA 1B0AA 4YPOA 4J43A 4PZEA 2HSDA 1ML3A 4RQUA 1YO6A 4CMIA 1GUFA 3L4BC 1ISHA 3GR6A 3ZW8A 4EUFA 3MOIA 5L4NA 1O0SA 5A05A 3JQ8B 4QO7A 3O9ZA 4XCVA 5KKCA 3CKYA 4FPXA 4I9HA 3ZW9A 2J5RA 1HTBA 4GKVA 4L74A 3GRKA 3QVSA 1KY5A 1SZJG 2H6EA 1EUDA 4Y98A 4CQLB 3S2FA 5BSHA 5EIOA 2QZ9A 4Y9DA 3OIDA 3Q2KA 3D5QA 3EC7A 3ROKA 1HKUA 1V6AA 3OQ1A 5DBGA 5TJ9A 2Q46A 2ZATA 2JCVA 2I3GA 3V1TC 4J16A 1YKFA 5IXSA 4BNNA 4ND2A 2X6TA 3ONDA 1JKIA 1MB4A 1BRMA 1TVEA 5L7YA 1HZJA 4JNKA 1H6AA 4CMGA 1JDJA 2CSUA 2PWZA 3B1FA 1J4AA 4PLFA 4E6PA 2C5AA 3M1LA 1XIVA 3T4EA 4CM7A 2VZ0A 3PP8A 5H83A 2DPHA 3GG2A 2JJYA 2OGUA 3OJOA 1E7WA 1R4NA 1O89A 3PEFA 4YAEA 3UFXA 2JAPA 9LDBA 2Y1CA 4QSMA 1B16A 3U62A 5ADHA 5L3ZA 4DQUA 3GDGA 5CG1A 4WCFA 2Q49A 4BNYA 1FMCA 2DTDA 2VZ8A 4OSOA 3HDYA 4YR9A 1N92A 1E3WB 3PQDA 4IJKA 1PJ3A 1LLUA 3ZHZA 1T2FA 4BNIA 4FN4A 2WM3A 3KEOA 1ENZA 1U28A 3G3EA 3E1KA 5TC4A 1KC3A 1X1EA 1YB5A 4PLVA 2BI7A 3GMSA 4E30A 4BKRA 4AJIA 5CEEA 1HDCA 1P33A 4ZA2A 4RF3A 3WXBA 1UDAA 1WDLA 1R0SA 4MIEA 2C2XA 1K5HA 1VE9A 4GMGA 3RAJA 5GZ6A 4ILKA 3OICA 3IP3A 5FFFA 1DBVO 1UXHA 3JQGB 1AXGA 3L07A 3F3SA 4BNJA 1NVMB 4MJLA 1U1IA 1DPGA 3F1LA 5CEJA 5U4QA 1VJTA 3GGGA 2RAFA 3SEFA 4JP2A 7MDHA 3ZN2A 1ZBQA 3KSDO 3OQ6A 4J1SA 1GL3A 4BO2A 4WLNA 1TT7A 3CMMA 3I6QA 1A7AA 2Q4BA 3DZFA 4RJTA 1R0KA 1Z82A 4FD3A 3JYLA 3AM3A 3MCVA 2OP1A 3ETDA 4WLUA 4CL3A 2VN8A 5EPOA 1M67A 1AHHA 1EQ2A 4I5GA 1MUUA 4IQGA 5CG2A 3K92A 4H15A 2Y67A 3PIDA 1BWSA 1U9JA 1LRLA 1VKOA 2QRKA 5GZ3A 4Z3KA 1C1DB 4GX5A 3AUTA 4KWHA 4DRYA 1ZIDA 4KP7A 1JLLA 1TEHA 2WD8A 1D4FA 3O4RA 4CM4A 5GZ1A 4TMFA 5L45A 3WDSA 3VKVA 1OC4A 4G5HA 4E21A 4PLWA 4HNGA 3KYCB 4E31A 1FK8A 4BUCA 2C2YA 1B7GO 3G49A 3JQ7A 3K96A 1HE5A 2CDCA 4NK5A 4Z9XA 1UXIA 1D1SA 3A4VA 3C1TA 1DSSG 2RCYA 3HQ4O 1S7CA 3RU9A 4RQTA 1E6EA 4J4TA
chains in the Genus database with same CATH superfamily
4PXSA 3CMCO 1PQUA 2NO1A 2EL7A 5T6MA 4OIMA 3V1UA 2WIKA 3DMGA 1SHTX 5BWLA 4YBRA 3RRYA 1LK5A 3VTZA 5DMHA 2V45A 5AQEA 3MJCA 1V92A 4B3SM 4WK4B 2RGOA 2JKVA 1EVIA 4BLWA 3EXEA 3JZMA 2GZ3A 3TZKA 2H3EA 3T4UA 4CGYB 1E63A 3SLGA 3TLGB 5JAZA 4RK0A 1TGUA 5CLQA 4BX0A 3BRSA 4B7CA 1V39A 5EJ8A 4CETA 1TC1A 1J7JA 4E5KA 2I1WA 2V6MA 4PLPA 3ZGNA 3MCTA 4JLJA 4BGUA 2W48A 1IXSB 2QS9A 1Y5RA 3D4PA 4LV8B 1WMBA 3D7RA 1RYFA 1NVKA 3ND7A 3ZHYA 5EIBD 4RCZA 3U1VA 5BQ3A 4W1QA 3BWYA 3DDSA 4LZOA 1T0HB 4FX2A 1PJRA 2IZZA 2I7NA 2BR4A 1KBOA 3I4FA 2ZIGA 3KJNA 4ZO8A 1QVAA 5EG5A 3FPLA 2RJNA 3KQOA 3KAJA 1B41A 2XY4A 1FXWF 1AHNA 4JI1B 3LQYA 5JNVA 2BBWA 3NVAA 1THZA 1ZM3A 4EI2A 2H11A 1NNUA 4NZ9A 4DYVA 4C30A 4IVNA 2IHTA 3SZRA 4WINA 2K7FA 4B3IA 1YHZA 3FTPA 4Q4JA 3DMFA 4AJ2A 3ONFA 3ICWA 2XB8A 2P2NA 1HY3A 4WCDA 1S5PA 2KBFA 1G3RA 4DJ5X 2GGSA 4DKJA 1ZGAA 4IG9A 3VKHA 1MH1A 1M2EA 2IBTA 4FFNA 3FMIA 4JB3A 1ELOA 3VPBA 3HACA 1JQDA 1XKXA 1YFJA 1CF4A 4F4HA 1OYVA 4O4IB 4DC9A 2LGJA 4QM7A 5TDHA 2QM0A 5GM1A 5HS6A 1Z35A 1XF9A 3PFGA 1A4RA 3IKMB 1X92A 3WIVA 3L3BA 4EQ6A 4Z1MA 1G19A 1UBKS 3UAOA 4JI5M 2DHCA 7YASA 2DSTA 4BB9A 1YU9A 4M4SA 3FPFA 3BILA 8GPBA 3QPDA 1CTQA 2R65A 4JH0A 1NBIA 4CIZA 4YDHB 2H00A 4BAUA 1OAOA 4AYXA 1FFSA 3LRPA 1ESCA 1GO5A 2Q3DA 3K70D 4KE6A 4Q82A 3I6YA 1ZNYA 3ZIAA 4UAGA 1EXNA 1JJVA 4BMXA 1AKTA 3M4NA 3QLUC 2Q3CA 5KNCD 5EN4A 4BN5A 2DFPA 1CY6A 1O94A 5KNDD 1QO7A 4ZICA 1NTRA 2P90A 3THWA 3GJTA 3PTLA 2OQIA 4P6VF 4BFSA 3UXYA 4B4DA 2HHJA 1AF7A 5EY5B 1Y34E 3S55A 4XM0A 5TLSA 4R7GA 1VL6A 3Q7QA 1TQDA 1GJTA 1EBUA 2XTZA 3MTQA 1DIAA 2BGGA 3PRKE 4EGSA 4QPNA 5KREA 4CLDA 4Q6BA 3EPPA 1TTEA 4KT0F 4MWTA 4KG7A 1BYUA 3W4KA 4LRYA 5F1OA 2ZWAA 3ZBPA 2C5RA 2X9LA 1PFKA 2ODEA 5AJXA 3ST7A 1G5TA 1VSQA 1UP7A 2J9GA 2QJRA 1TCVA 3TUZC 2WTAA 2QTVB 4N4AA 2C4VA 1X39A 3IHTA 1T9ZA 4IDBA 1NOKA 3RSOA 5C5DA 2XTJA 1TUIA 4I2VA 4OJYA 2FSPA 5A3VA 1R74A 5I5GA 1BFUA 4K6FA 5BSGA 2FZKA 1JEOA 1Z8FA 1R2YA 4GNKA 2RGWA 3G2JA 3OTWA 1CUYA 3Q3HA 4OYRA 1D03A 3KZOA 4O5AA 4CFZA 2WFAA 3D1VA 1PJQA 3HNPA 3WGHA 1FP6A 4BUJA 2QAIA 4I08A 2PY6A 1P61B 3KZKA 1XNRM 1A27A 2VG8A 4DFDA 2IU4A 4H0NA 4RORA 2EJCA 1LGYA 3KM0A 1E0DA 3DDCA 5A6SB 3DOOA 5JMWA 3KSJA 3JWEA 1EFRA 3OE7D 4PX9A 5BVGA 4PTLA 1ORRA 1XLTA 1IY1A 1I3LA 5CAEA 3QVGA 4F11A 3D02A 2XRZA 5HSGA 3ETGA 5CFRA 3BWMA 5GJWC 3W5CA 1DUSA 5HCNA 4BGIA 1MC4A 1IZ9A 2A0XA 4TL6A 2ZCJA 2HZ7A 4Z0TA 4IINA 4PNEA 1ZGCA 2ERXA 3C5CA 1J2EA 1C7YA 5BSWA 1XTBA 2XOKA 4JJEA 4GBGA 3OPYB 3THXB 4B1FA 3ENVA 1L5OA 1RWNA 3RGPA 1TH4A 5JZMA 4EEKA 2UU9B 1U2QA 4MV9A 2ASEA 2ZI3A 1NC3A 5EAIA 3QEOA 4AS2A 2I0FA 2PLNA 4D6XA 4C1BA 3B6MA 2JAWA 1N2HA 4XSHA 1MO6A 3DMYA 4QGHA 1T9CA 3W2FA 3RKUA 3CH4B 3ZNOA 3QKIA 4CIVA 4WX2B 4X93A 2VJYA 1RZ3A 2JA1A 2JXNA 1T1JA 4XD7A 5B1IA 4WERA 1QIEA 3ZEIA 4ON9A 3AC0A 4RTKA 4FMCB 1OU4A 1XQYA 2PSFA 4IBBA 2IZOA 3E46A 5EXDA 3VDUA 2WF5A 3SAJA 2ZJ2A 4EATA 4WQMA 2L4FA 1QIMA 5HPYB 2GM4A 1B3BA 1R5OA 5A9SB 2WV7A 3T4PA 1Z5CA 1BGVA 4TLBA 3V1LA 3TVYA 3NHYA 4RJJA 2YS7A 2VQDA 4IBDA 3SJUA 4Y9SA 4CWAA 5FLYA 1G8PA 4GGOA 4E14A 4QNNA 1SC3A 5KYUB 2IUEA 3NKVA 3GPLA 4V38A 1EB9A 2B30A 2VDPB 5CDFE 1H0HA 2HRZA 4DMRA 1MOPA 4TMVA 2EJUA 1X7YB 1T2VA 4OGKA 1MW9X 1VIYA 3AP1A 3IIIA 2XFSA 4HAUA 4ZQEA 3PRHA 4BXOA 4HPWA 2W8ZA 5IYZB 2F9FA 4GEWA 3U26A 1G42A 4DEYA 3VMMA 3GDHA 4N5LA 1PVOA 1ZRHA 1KPIA 2ZDHA 3ZY5A 4KMSA 4BIIA 4RVSA 1ISJA 4BFXA 3DXYA 2W4QA 5DEOA 1KEEA 2ZBKB 5GGXA 1Y6RA 4YMHA 1CJKC 1NX9A 1CQJB 1Y9EA 1USWA 5KNBH 3C58A 2F5SA 3KWFA 4OK3A 3T1TA 1TZ2A 5ALHA 2EX4A 1QDUA 1MJGA 5CFZA 3O26A 1LB1B 3I42A 5LIRA 3PTZA 3DTVB 5AVVA 2BEWB 1TYDE 1WXFA 2VO1A 3LLMA 3IHKA 1DEKA 2EDCA 4PBRA 1H65A 3PC6A 3KS8A 1ENOA 4PHHA 2C3PA 4I4CA 4KQCA 3DMTC 4M54A 5F76A 2JJ2D 1CW2B 4FSXA 2IDMA 2WFLA 4WURA 4DR2M 3WGGA 1W29A 2WM8A 3L6UA 4Q16A 1DWQA 4EFDA 2XA2A 1RT9A 5CRIA 1R8XA 4TLMB 2JDID 4ETIA 4B17A 3U7EB 1T15A 2W2TA 3ZCQA 5FA6A 1Q0RA 3JAKB 2QPOA 2J3DA 3RRNA 1J97A 4IIVA 3BFVA 4CKXA 4I4TB 5G40A 1Z38A 4G67A 3N7TA 4DR6M 2OBYA 5HZKA 2ADFA 2HCBA 3UMCA 4HDSA 1QPBA 3I4LA 1XZPA 4GYWA 5IMBA 1WHCA 1XQXA 2GJKA 1NW8A 1VCNA 4NFSA 3R9XB 2WMOB 3E9CA 2EKBA 5HG0A 1FE8A 4LF9M 1U2TA 1Z2EA 2JAXA 1P1FA 1JZQA 1ZUIA 1MP0A 4YQZA 1Q44A 2VH1A 2GCOA 1K7XB 3UUGA 2GVZC 4ENPA 4IVQA 2FPMA 5CT8A 1M1YB 4LGCA 4WLFA 4YRMA 4XB6B 3UUEA 3KJGA 4O2AF 3E35A 3HHPA 1VJ1A 1OTXA 4M2LA 3U60A 1C7JA 1IUNA 1TM3E 2XBLA 4KJZA 3NKLA 2AJCA 3BTVA 3EDYA 3QKWA 3WGLA 4MUKA 1GO2A 4PCAA 2C29D 3BD9A 4Q3AA 1H0RA 5TRTA 3IB3A 2O2XA 3I09A 1Z68A 1YDEA 4A15A 3K9WA 2BMDA 4DXAA 2XF8A 4PSAA 1DGHA 1A9PA 3A9CA 2IHKA 3V4RA 1OJ7A 2DHEA 1BO6A 1W5BA 3U31A 2AUMA 1VJGA 3EVCA 3GMTA 1AQUA 1N6RA 3N74A 4L8WB 2GJ4A 3ZWNA 2C5EA 3VR6D 3ESCA 5B7QA 4Q24A 2HMWA 2X2FA 4ENTA 1L4UA 3KSAC 2QD2A 2XYRA 4PG4A 2IUUA 3ONVA 1OIXA 4X1IA 3KWMA 5A02A 4NFHA 1Z8DA 1D2GA 1JJBA 4H9GA 3OOHA 1C3EA 5JFTA 2GBLA 1NNSA 5DTRA 5JXJA 2R87A 5AM2A 3RFFA 1RSZA 5F5LA 1IZ8A 2EF0A 4EQZA 3VNAA 2B34A 3UAWA 1S8FA 2WINI 5EWMB 2HHCA 1XVIA 3J80S 3AJ8A 4H3VA 5KJFA 4YREA 2NPOA 2ZUSA 1SU7A 1E2FA 3V33A 4XFJA 1THTA 4CLRB 1N5DA 4LPSA 4I3FA 2JLYA 2ZPUA 3SG0A 2I7PA 3QFTA 1SJ9A 3D6NB 4R9VA 4ZT3A 2I2AA 3G79A 3EHEA 5E1DA 3B1KA 5BPFA 1SVWA 3TEJA 1LJUA 4OXKA 2APJA 4FWIB 2PNFA 2G6BA 2FEOA 3A1CA 3NHMA 1PL7A 4HFJA 5JCJD 4G5QA 2L17A 1QZUA 3L6OO 2QJOA 2ZWIA 3RVSA 1EE2A 4QAQA 1XPRA 4R6XA 1ZRSA 1HK7A 1RKUA 1L5FA 4JV5M 2RKBA 2P30A 1VCOA 3PNBA 5LC1A 3F4KA 1T3ZA 5IKPA 4G4IA 1B0PA 3JQFA 3DWEX 3NHKA 1P4HA 3OZWA 4GPTA 3RS3A 3PI6A 4UAVA 4D56A 1V4NA 5IASA 4MGYR 4XARA 3BS4A 2W6ID 3OJWA 3K70C 4K9SA 5AUOB 4FILA 1UOOA 3Q98A 1BHJA 1N6HA 3GZ4A 3OA2A 1GZVA 1JYSA 1SHKA 3MRVA 2UUAB 1V9LA 3HKPA 1O96A 2Z04A 5EEHA 4W6QA 2ZIZA 3QXSA 1GU7A 1S2GA 3VYVA 2C59A 1VLZA 4L4ZA 1DDIA 4I7EA 2E5WA 2OO7A 1FDOA 1NJ2A 1OJLA 4MQFB 4ALIA 3EMVA 1L3CA 3Q88A 1YC5A 5FV7A 5AK0A 1IBSA 2JB9A 1RC1A 3TSOA 3AGQA 3IOMA 1IU9A 4MUIA 1SMKA 1Z6TA 2ZXFA 1JR3D 1TX4B 4OTZA 4AZFA 2J9RA 2QZZA 1FJXA 2GQFA 4IWYA 1T1IA 2ZRQA 3LHIA 5JCZA 3RS7A 3ZWOA 1PL8A 2Y93A 4KQMA 1FW6A 3F4BA 4L8LA 4B3SB 3DCYA 1QHNA 1XXHB 4NZNA 4M88A 1SXJB 2YWXA 3WYGA 5J4HA 3QE3A 2WZBA 3ADPA 5KTRA 5GY7A 4F45A 1X7XA 5K8IA 3SHVA 3OCXA 3BZBA 3P5BA 5IKOA 3HCFA 1TEXA 3MJTA 2QW8A 1V7CA 1DQPA 5TV2A 1BE0A 2J59A 2OLKA 3R5FA 4QULA 1X2EA 1YJCA 1LNSA 2QTWB 3V42A 4J76A 3FCEA 1IUPA 4K40A 3WNDA 1QV7A 4QYTA 1Y6QA 4TT3A 4O08A 4OOEA 4Q01A 4UBIA 2F8TA 3AJIB 3IOEA 1IFXA 1JQAA 3BGWA 2RK4A 4RE6A 3R9KA 5I5EA 4H08A 3GCGA 1M8KA 4Q7LA 4R8VA 5IZ4A 2E4YA 5IM4F 4QQKA 1TKCA 3WZMA 2G5TA 1T5TA 3HP1A 2AR9A 3ZDEA 4KNYA 3B6ZA 3KDSE 3QLVC 3C6XA 4KSYA 1W1UA 2VWPA 1RWPA 3TWKA 1VHLA 3L4KA 4MCJA 5DGXA 4RL6A 2XOEA 4YP6A 3HZJA 2D7DA 5LNK6 1KPGA 3S27A 7ADHA 5HIAA 1EUCA 3LTEA 4WK0B 2I65A 4G81A 3SASA 3U39A 1N5IA 3W1EA 3T9AA 3CTMA 5B2ZA 5KYWA 3FYUA 4EYSA 5I47A 2WD9A 4C88A 3ZJTA 3V8QA 1Z7YA 2RHOA 2GN4A 3WHIA 3O8QB 3KZMA 4OHKA 4WK6A 1F2DA 1HORA 2ZETA 2HX1A 2B5VA 4LG2A 3DYIA 3TG2A 4PZUA 2YDYA 3O95A 3MTEA 4JI5B 1DX6A 3EOZA 5HW0A 1J8VA 4EI7A 4G4NA 3OQHA 1JXQA 3R0IA 3VQTA 1PTJA 1R5BA 2VA8A 2IL1A 1SKMA 2NYRA 4YCDA 1VIVA 1H9BA 1VRVA 4QVGA 3BQNB 1XRMA 1SCBA 1V3QE 4PZLA 3ELWA 3WDKA 3HVIA 3GF4A 3W0LB 4BB0A 1TXGA 3ZZNA 2GJ9A 2BWEA 3TLAA 4RXUA 4ACBA 3T5DA 2FOIC 1ZR2A 1JFSA 1TYZA 1M34A 1E2NA 3NBQA 3VR1A 4B80A 3QGMA 3KWJA 1XMXA 3OE1A 3B5JA 3G6KA 5KI6A 3GZTB 1YQ9A 3QK7A 2JGJA 1CJVC 3EFEA 3Q2KA 2W2VA 5DBGA 1FU7A 2P9FA 5I9BA 4UNSA 3NW9A 3A3KA 1F1BA 4MGZR 4CMGA 4JJAA 2C5AA 1TDJA 2RHHA 5HIKA 5FHQA 1QQBA 5EMLA 4L5BA 1VJCA 4O8CA 4OG2A 1W30A 4QSMA 3R4CA 1QK3A 5LQNA 1UDRA 2O59A 4MV8A 2EW1A 2IBSA 1ZH0A 1U80A 2PMDA 3WMFA 5HOQA 4PDIA 2CMKA 1KZGB 1O7JA 1TUBA 2AZDA 3Q41A 2Z0MA 1HDCA 3WXBA 3E84A 2Q0XA 2CDNA 2NQ8C 4GEKA 3SXJA 3P45A 4ILKA 2SBTA 4AJ9A 3MWEA 3OY7A 3SEFA 2P40A 4JVNA 1AMUA 1FRZA 2F3UA 4J1SA 2HA2A 3PTAA 1XB2B 4KXMA 3HSYA 4ZHQB 4MUEA 4L28A 1M2FA 1BWSA 3HCNA 1T10A 3SU8A 1VMEA 3D6UA 4PLWA 1N1DA 2MINA 5EZYF 1FK8A 1EG7A 3GWZA 3MK31 3JQ7A 3PUYA 4A1FA 3SK0A 4BN0A 5GIPE 5AD1A 1H2YA 1PR6A 1X3SA 4L0CA 1XXHE 4G1BA 2TYSB 3A9RA 1XNRB 1UFZA 3EZNA 4J9UE 5SY9A 3H5LA 1DOZA 3QNWA 3WOVA 5FWDA 5EC8A 4P16A 1K2WA 2W71A 3EQZA 5D3MA 3C5HA 5THXA 2EERA 1VSTA 1RS0A 1NHWC 1PX2A 4CJXA 5C8YB 4ZI7F 3CLRC 4I5DA 1KO7A 1CPYA 5KTOA 1JFFA 2EKKA 2II6A 2H2IA 4BNTA 5BP7A 4JYAM 3UK1A 3DE6X 2ZM5A 4I1OA 1JFTA 4BO4A 2BEVB 3NR2A 5DN9A 3AWDA 3SYKA 3HSSA 3UWMA 3QKSB 3CEJA 3OESA 3GMDA 2P5SA 2DEUA 2H07A 1NAIA 1ZAKA 1MRZA 3IE2A 3A6LA 4RSRA 4MAMA 3TK1A 3TLBA 2DU8A 1F4IA 3QM1A 4EF6A 2F8LA 1JA9A 2O0MA 4IIJB 1WUHS 1AQIA 3DBRA 4YV2A 4RYLA 2QU8A 1MO3A 2NPIA 4M9QA 2HNBA 1K7CA 5B4UA 3DBLA 2WJVA 1Z39A 3FNQA 1WVIA 4M1TA 2PH1A 3COJA 4FMDB 2VP4A 4B48A 1WXGA 4WXHA 2ZU0C 2B82A 1XZBA 2PTHA 3O73A 4ZARA 3DS8A 2J45A 3ABRB 3WR5A 1NNJA 1YZFA 1XZMA 2BW0A 2HPHA 2NO7A 4MH0E 3BHIA 3UKJA 3O3OB 3EZ9A 1WMSA 4P36A 2R8ZA 2OT3B 1VPLA 3HUTA 2GBPA 2OGSA 1IUKA 5CFMA 1NJGA 1RE1A 4GYYA 3N70A 4RV9A 2X0RA 4B5KA 1DOHA 1E9BA 3C5EA 5I7AA 2GD0A 1U0LA 4QDTA 5L40A 1MZPA 2I4IA 2XE7A 4FYMA 3LC2O 4YAGA 2ZJBA 3RFUA 3F5MA 5JZ9A 1H5UA 2G1PA 4M8SA 5JLAA 3B1JA 3HWWA 2E4XA 3P9CA 4EKNB 5ALRA 1JSZA 4LNUB 1UBGA 2AVNA 4KQ2A 1T4MA 2I3ZA 3LO8A 5AKJA 3E27A 1XJ0A 3IV6A 3K2BA 3RHZA 1FDIA 5HX7A 2H48A 3RRBA 2XHEA 2EHDA 2XF2A 5KQMA 1YDWA 4L3VA 3F3KA 4D6YA 2H85A 3K8OE 1P8JA 1KYQA 1XDZA 5B5SA 3ANSA 6LDHA 3H2BA 4I1SA 2NVUB 3H5NA 5GV7A 1SG6A 2QE6A 3FMFA 4IX1A 4MK4A 4N76A 4LS3A 2JI7A 1QQ6A 3COZA 2BZ1A 1E3MA 1Z4OA 3PUWA 4AP5A 3AI2A 2MSNA 2CEKA 3MHVC 3H9EO 2R751 5LFAA 2EXXA 1DAMA 4BVJA 5SICE 2D54A 2QR3A 3DR3A 4DR2B 2G9NA 5BO5A 5BVHB 4JVSB 4RSMA 2Z5LA 2NSJA 2YYYA 4TVOA 4HY3A 3LDFA 1BMFD 3JRXA 4RVUA 4BMYA 2OPHA 2C2HA 4JSTA 4CHTB 1CWUA 1TK3A 1WB5A 3SR3A 3SYLA 1ZCZA 4IUCS 4HI0E 2I9PA 3ZWMA 1OC2A 4PICA 1ZI9A 5G0UA 4TXJA 2YICA 3L79A 1SUBA 4DR6B 1QVWA 5BV0A 4Q03A 1RXSA 1YI1A 3PC8A 3D5EA 3E2MA 3HVHA 1G9TA 5IBPA 3I73A 3WGTA 1WCWA 3TNDA 5BN5A 2P2LA 2IPOA 3JAMA 1SCUA 4NAHA 3LGAA 4LF9B 3L27A 2ISQA 5KOJB 3FXAA 3CX4A 1NBAA 5K4AA 3KJFA 2LR0A 2ZR0A 1FFXA 5DDIP 1NJ6A 3WP1B 5H9VA 3HA7A 3ZHBA 4P86A 3HEAA 4DBLE 4KGZA 2G72A 1VA4A 4ZV7A 3N7UA 5IJXA 1CR0A 4DHWA 4C0XA 5BNTA 1ZQ9A 1S2DA 3KR9A 3QW2A 4ZCMA 1MEOA 4C4RA 2PG3A 5JSHA 1BJTA 2ZZMA 2DZDA 3EYWA 1ZJ5A 3C3MA 2QQFA 3JZDA 5C5IA 4B3CA 3I52A 3FB1A 2UXCM 2Q4TA 2FGKA 1KWGA 2ZT5A 1OBHA 2R1VA 5ITQA 3MW8A 4Q9IA 2XW6A 2VXCA 5AP9A 1CVRA 3MWJA 3LVBA 1VEKA 4LEIA 4ZU6X 1G3QA 4M9SA 5DWQA 1SCJA 4ZQIA 1ZKMA 2V97A 2EG5A 2JJMA 3DMDA 1GQFA 1U0HC 1PWYE 3V9PA 1T9KA 1DUVG 1AQ6A 2JI6A 4CCSA 4N9QA 4F6RB 3KVWA 1O6BA 5T67A 4OQ4A 2A4KA 4PSDA 5CT5A 3DKIA 2Y0PA 3QF4B 4G8BA 4R2XA 2ZI9A 5HKAA 3IYLW 1GNTA 4W7HA 3FWHA 2PD6A 3K9GA 5JNTA 1N2OA 3O75A 1E2DA 2A9FA 2CNWA 4PLGA 3IX7A 3IAXA 3M83A 5E4JA 1U0OC 3IQEA 1NXOA 2QQGA 2VQ6A 1XMSA 4EG7A 4U5XA 521PA 4OBXA 1JP7A 1FSSA 4MXDA 3TLEA 1QF7A 4F3CA 5JS7A 5HJ5A 4EDHA 4GHAA 5KVQA 2ZBRA 4Y30A 5ERGB 1GN8A 4I1IA 1JXAA 2R45A 1X8XA 1IPFA 3PJDA 1AXEA 3H7AA 3Q10A 4X63A 3QPUA 4NYMR 5ABPA 3EMDA 3FR8A 4AICA 3SF8A 3F1KA 3MGKA 1UT6A 4F06A 4F3NA 3VPHA 3C74A 4KXUA 2W11A 2A84A 2BGWA 4L95C 1O1YA 2R8EA 4B7FA 1YDMA 4U7DA 2RGEA 4FOSA 1GKLA 3T1VA 2B92A 4JV5B 1DBRA 2EBHX 1I7DA 2VDQB 3N2NA 2BH2A 4PZCA 5GP1A 3ZE7A 1W4LA 3HSKA 4NOOB 1AV7A 4WLOA 2AYYA 2BLLA 3UTDA 2DKLA 3U4MA 3IO5A 3M34A 3NVMB 4LJAA 1QRRA 3HABA 3OU6A 3DE0X 4N40A 3KL4A 1VOTA 3ASYA 4MS4A 4OAPA 2ISCA 2QRGA 5IVPA 4KR0A 4AN0A 2IF2A 4RACA 5GONA 3IV7A 3TZQA 1VI2A 5D3ZA 3SXUA 2REQB 5IXJA 1LRKA 3BEDA 4XGNA 3JVIA 1MU5A 3U4HA 1MJ5A 3EY9A 1ZK4A 1O4WA 4JZKA 2I7TA 3BMXA 2I29A 5IJ0B 3QA9A 4FCVA 1P0PA 3RF7A 2ZBEA 4GH9A 1GJRA 1JTVA 4PPYA 1JLHA 1D2AA 4C08A 2ZBUA 4RD4A 4PSUA 2P75A 4CM9D 2IU6A 4FSDA 1DG1G 3EGXB 4NABA 1QANA 3SAWA 3COSA 2NU7B 2GN8A 2YW2A 3WYEA 3QLUA 3C3PA 3MD0A 2LVBA 4GUDA 3IHPA 1SUEA 4YMGA 2I6XA 3NEAA 4XQCA 2QSUA 3CX6A 2VHJA 4BQNA 1C29B 4WZBA 3MK6A 3H5TA 4YAWA 1UWLA 2QX4A 3RUPA 4UTRA 3CS3A 1Z25A 4F56A 1JDBC 5BN4B 5AJVB 2FWAA 4KO8A 1S3FA 4G0VA 4KO1S 4NS1A 1VKZA 2RGUA 2FW0A 4DDKA 2NXWA 1KO4A 2XYHA 3NDRA 3ZE9A 1PJIA 3PVZA 2R4TA 1AZSC 1N4AA 2AI2A 4DDTA 1QNFA 1SVKA 1OTYA 4AJEA 3HWRA 4EMTA 2HJVA 1DQNA 1C4WA 5DISB 3T94A 3OJCA 3ME5A 3IALA 4XUGB 5DBHX 1KU0A 4QGAA 4XQGA 3M6FA 1U3TA 4ZDJA 2RAVA 2RIRA 5SZHB 2XADA 4LRTB 4DJTA 4LZAA 4UOEA 4P22A 1GDDA 1GVHA 2CJPA 4HGQA 4IDCA 1PDWA 4IHJA 1VIAA 4FFVA 3UH0A 3QMMA 4NCJA 4EX7A 1U11A 3I23A 5TARA 1Q19A 4LE2A 4HHEA 3P52A 4UVHA 1NBMD 3COWA 4DXHA 2I6TA 5GV8A 3RSHA 5JO0A 1YE3A 1NLYA 4R8SA 3EC1A 1ODLA 2FX3A 1QCZA 4C4ZA 4HX9A 4H17A 4XUCA 2QMUA 4YP7A 2YMMA 4RGQA 5EIAA 3AKYA 1NAHA 5KMGA 2O50A 3NH6A 1IPHA 1Z5UA 4R98A 1HQKA 1YS2X 1MF7A 3OAAD 3U48A 2OXFA 2E5FA 4D0GA 1DHRA 2XMQA 2LV8A 2NV0A 1OILA 4AJ4A 4LWQA 4ZC1A 1GCUA 2GZSA 1LDEA 4HMQA 4TLDA 1A1SA 5M04A 1I30A 4MP8A 4LRQA 3IXLA 4EBBA 2O2HA 3O84A 3QLJA 4FR0A 1M6YA 3T3OA 3AIKA 4JUFA 1G64A 2V0CA 1BA3A 5IAGA 1JHAA 3UPUA 5I4IA 3H1AA 1YAHA 5EJAA 3AF5A 2GARA 4KBYA 4QUBA 5JOQA 3SQLA 3HXMA 3PXUA 1NQOA 1LSJA 4FGZA 5IK2D 1QKIA 2JFPA 5B57C 3L8GA 2ID9A 4Y9UA 3I53A 1EIWA 2NVWA 1YRWA 3H5VA 1Y48E 4IR7A 4BGEA 4BEVA 2BHLA 4YRIA 1F17A 2OCDA 2C9YA 5F1PA 1Z7BA 3ESRA 2CL6X 3BD6A 1XU4A 1UH5A 1YAJA 2PFKA 3HMKA 1NIJA 4IJFA 1ZVJA 3H04A 1ECLA 4NCAA 4D26A 1XTPA 2X8AA 4N49A 3EZGA 1F4LA 3NHFA 3WNVA 1PGJA 5KTSA 1RXCA 2O25A 3CLHA 2QW1A 3QF7A 2AJ8A 4BLSA 4ODIA 1RWBA 3HUUA 2QX9A 1JFVA 1LSUA 3IAM6 3OCZA 2BEUA 4UJ5A 1SNYA 4ETNA 1FDWA 5H37D 3R7NA 1J70A 2YL2A 1EJ0A 3EZLA 5A1TA 1NFFA 1KJZA 2Y1GA 3U4QB 1OLSA 4BO3A 5DTQA 1WUJS 4Q9HA 1DRVA 4LMBA 1OYYA 1FZTA 3ZQUA 4B3XA 5KVVA 2MJ5B 1PM5A 1QDEA 2AJBA 2PGDA 1TUGA 1Q7RA 3HKBA 5AI5A 2BFBA 2VDKB 4GH5A 2FN4A 1BGXT 3MHPA 4IOJA 3F9RA 3BDIA 5G53C 4KH0A 4B7XA 2V6JA 4QXAA 1U9IC 3UMVA 4B7AA 4RFSA 1FL9A 5A6VA 4RHEA 3OSUA 2KA6B 1U5CA 1P0IA 5FWXB 1PV1A 4A0RA 4MVJM 1AX9A 4X3OA 3D3WB 4LWOA 1E1QD 4K05A 4MW2A 4J9VA 3HK2A 4X6UA 3C3EA 4X00A 1D4OA 1GZ4A 3OJEA 4JYAB 4UASA 2Y99A 1L9XA 1EAYA 3IAS1 4KB5A 3TL2A 3MEQA 1KFEB 1Q1EA 4RY8A 2BR3A 3ZE1B 5EKSA 4DXDA 2AI3A 3H9CA 1XKLA 5EUQB 1CR1A 4AJNA 5DW0A 2PSDA 4UHDA 1ULTA 5CA1B 3VU0A 5EJ5A 1T13A 2QZ4A 1DCTA 2C88A 2GSDA 4KRGA 3DMTA 3BCRA 1KE1A 2OXEA 5LB4A 3WHLA 3NDPA 4Q1CA 1BVYF 1Z5BA 4LG1A 1UPXA 3MFQA 2A1TS 5EJFA 2HF8A 1NVXQ 3W9BA 1RYEA 4ZGGA 2IHBA 1WRBA 2XGGA 1KL7A 5L3QA 2G70A 4J49A 4UCFA 3KHSA 4Q3NA 4NRDA 5DHFA 2FG6C 1N6KA 4QT4A 2CDAA 4JEHA 5JXHA 4YP0A 1KMHA 4B4UA 1YZTA 4LMRA 2QRNA 2PAAA 1R0ZA 2PRJA 5FUQA 5CCEA 2WIAA 2RARA 3IURA 3TZEA 4BRZA 5LQCA 3AY0A 4ZJYA 1BJRE 1RM3A 1AHIA 4RGYA 3KJQA 2CD9A 1ZVMA 1HDGO 4JJFA 5J5AA 1QP7A 4RCVA 3ZI0A 2N75A 2YHIB 1NBWB 4B33A 2GEUA 3E9RA 2COKA 5BV1A 3ELDA 4Y2JA 3VPGA 4M38A 421PA 5JY1A 3GVIA 3EDOA 4WH0A 1GTZA 1V8DA 1TMGE 4GU5A 1U7HA 2P35A 1BAPA 3A42A 4KACA 3U56A 4AWBA 3LQFA 5A0FA 2YXLA 5E9AA 2XB2A 4IQ0A 1J33A 1M10A 1DPFA 2YZMA 3ED5A 1XRSB 2HA6A 1N2CB 2XUKA 3FOZA 2ZVPX 4BLOA 4DANA 4KDCA 1HO3A 1Z07A 1J90A 1PSZA 4WKPA 3Q4GA 2WP0A 1SA0B 2F59A 5TJ9A 1QUSA 4GD3Q 4GZLA 2VDRB 5CIQA 3I5YA 2YV5A 2QUJA 5IAOA 4CM7A 2QN3A 9LDBA 2VTBB 4OSOA 2O5VA 5LYJF 1NKTA 5LR6A 5K09A 3H05A 5HZGA 2BI7A 1R0SA 4H59A 5E1OA 5FFFA 3A98B 1J24A 3G85A 1PKEA 3JQGB 4MJLA 4Z6YA 3L8DA 2GZRA 2RAFA 1TF7A 3AVPA 1E69A 3CMMA 2JY7A 3BORA 4GRAA 5ERXA 2O05A 3JYLA 1FBTA 2VQSA 4AZ0B 4LZZA 2ZWOA 3NATA 4JLPA 3SE0A 2HF2A 4XGRA 1P73A 2GTIA 1G8HA 3HKCA 5JISA 1JZTA 4HNRA 4Q4HA 1HE5A 2CDCA 3BBLA 2A9VA 4MVCA 3IEXA 3W5IA 4QYSA 4PWYA 4KQHA 4LIPD 1JE0A 1UJ5A 2YBEA 4KOAA 3AU8A 4ISBA 4IF6A 3U7HB 4H4DA 1E6UA 2QU7A 2O8EA 4FCCA 1EPUA 2SICE 1O03A 4IZIA 1GL9B 1ZGGA 4RF1A 2RHMA 1RVDA 5JWRA 3OEWA 4FS3A 1QP8A 2FFQA 3DGFC 3L7MA 4UUMA 2YMLA 1K68A 2OGZA 3O92A 4TYQA 3CR3C 4UNRA 4MW7A 3VYTB 1M83A 3AONB 1MB3A 3HR4A 1ZHHA 5EP2A 5EJ2A 4D4KA 3FBWA 2HA7A 3BMNB 3H3XA 2ACWA 5C32A 5JY6A 3DMHA 1E92A 3ITKA 2PT6A 4WGGA 1PEKE 3HWX1 4GQBA 4D57A 1GAQA 3F47A 2X8LA 1MN6A 1ONBA 4HDNB 3KPWA 3ICEA 2J4DA 2GK6A 5AW6A 3UWPA 4AY4A 4OLHA 3AEUB 4KVFA 4PV7A 4BKPA 4F1IA 2MSCB 2YZNA 2UXCB 4KXLA 1P1HA 3WK8A 2QTGA 3UBTA 3V4SA 1IZZA 1CEXA 1CUSA 3PSAA 1E1DA 2O1XA 2H52A 2WHRA 1LTKA 4J0GA 2DQSA 3PZRA 4QPDA 2ZLBA 5EHGA 2B37A 1YBFA 3U5ZB 5KNDA 1QK4A 2FPPB 4IFBA 1C50A 2F67A 3FPHA 1C7RA 3DLCA 5D51S 3E61A 2VQ3A 4J4HA 1SC4A 3ZE8A 4AW9A 4OUDA 3EIQA 2IY7A 4RESA 2CT8A 4ZVTA 1L1EA 2ZUCA 2QQ8A 3SKVA 2X58A 1ATZA 1TD1A 3FIJA 2NIPA 2V0NA 2RH9B 5JQWA 4GM1A 3VU8A 5AVQA 1IZ0A 1I4OA 2B7LA 1AV6A 3THGA 4FYWA 3DOIA 3RHSA 2FY8A 2FH5B 4O2BB 2BCEA 1XKTA 4ZTBA 2J3JA 2QW0X 1SQGA 4YRZA 2B4TO 4QXOA 2PKYX 3B2QA 4UMEA 2X4LA 1HMYA 4JYPA 3RYIA 4JEIA 1ZD8A 5CGZA 3L18A 4KR6A 2ECFA 4KUHA 3X1WA 4IFTA 5J2TA 4S1VA 4U63A 2VF8A 1KI8A 3C7TA 1MW8X 4WPGA 2K47A 4BZWA 3RIGA 3S2UA 4MV5A 4MOWA 5EEGA 1KSGA 5FTJA 1CUBA 3J7BA 1N8TA 3CISA 2X3FA 2J1LA 1O4VA 2ZS8A 3WGJA 3MF4A 2VRBA 3TG8A 1N2CE 3ETNA 4QHYA 2DUJA 3I9V1 2OBBA 1PZFA 5CA0F 2Q5LA 3CF2A 2X15A 4RVGA 4J90A 4ALNA 3S2ZA 8AT1A 3I3OA 3WO1A 1AK9A 1Y8GA 3GFVA 4G0MA 2J3KA 3LHKA 3HB9A 3LNTA 2VT6A 3NFRA 1YR1A 3H86A 4KPEC 1WPGA 2YQ5A 3HO6A 5C34B 5BWBA 2GHRA 1KI1A 1YI0A 3V8EA 3IQHX 3JV7A 1KI3A 1JV2B 3UCEA 1JEAA 1BXRA 1LLDA 3A45A 3FRJA 2H8GA 5K6TA 1WZUA 1SEVA 4FYIA 2CHVA 5CLJA 2GOYA 1T4GA 2NUAA 3B6JA 5IEBA 3FZYA 3LHSA 5MFZA 1ZLXA 2Z56A 4FLFA 1L7MA 1DMRA 4PQYA 1VPEA 1VDDA 2R18A 1I2BA 4WDQA 3DBHA 2OGTA 5TGTA 1DWUA 3J7AS 4BBPA 1JDTA 1P3JA 1WDMA 4I50B 1XMVA 1O97C 2FZWA 1YE5A 4INPA 3QXCA 3CPHA 3GT0A 3BTOA 3D7KA 5BWNA 1Y7LA 1X7DA 1ZUNA 1CUHA 2QYOA 3IIJA 1E99A 3PLAE 1ZOIA 3NBYC 3UT0A 1K2VN 3SC3A 2K87A 3HRIA 3F2VA 4EHAA 1P31A 1HMPA 2WJAA 5KU7A 2BFPA 1JDZA 1VG8A 1J09A 5LOVF 2PXAA 2MYPA 3ZBUA 3V80A 2C3YA 3AUFA 3X1MA 3I01A 5ICEA 1OWPA 1KHHA 3A9UA 1VL5A 4ZI3A 5DN6A 3DLHA 1K6XA 3TMKA 4H18A 3KB8A 2IP1A 1CF2O 3A1EA 4KEAA 4DLSA 1G41A 3U61A 3VHLB 3C16C 1HSZA 2FOIA 5EIBC 5DBOA 3RS2A 4B71A 5DM70 3RM3A 4JLMA 3BMOA 4FI3C 4R8KA 3N2ZB 3A04A 1DRKA 5C8ZA 3R3UA 3S1AB 4IUYA 3DLTA 4CQJA 1CV2A 4EDFA 2PD3A 1S0UA 3JALB 4JSRA 3GLKA 2X4DA 3PNKA 3U19A 3ZDQA 5J2UB 3EYAA 1XRPA 4LC0A 1ORYB 1UBOS 2ZTCA 5LXTF 1EP1B 4QQNA 2R84A 3TZHA 1XGKA 5L7WA 2C5SA 1EZZA 3CKKA 4L5CA 5B1DA 2QTLA 1RLOA 1A7KA 3YASA 2JBHA 3TM4A 5GGYA 2CLOB 2GEDA 1KI6A 4S1OA 2NQ8A 3EARA 3H0KA 3GFSA 4BYMA 1YFZA 2VI5A 3HL0A 4C4TA 2XNKA 3PC2A 4XR4A 2WJ6A 5D5HA 4OU7A 1XTVA 2WIGA 3LQ2A 3QVWA 2VF2A 2XYPA 4LISA 1BMDA 2CC2A 2ZRIA 4DA6A 3VBCA 2CRUA 2GN6A 4Y8VA 1QGUA 4CMEC 5UKDA 3P0IA 1TYEB 4IG4A 3R3YA 1GTL1 2JK0A 4D79A 1EQUA 4ZOBA 3T9CA 3GRFA 4MGKR 4GF5A 3WMWA 1L7XA 3CZ4A 2F5OA 1AURA 3DA1A 4DC1A 5HCUA 2PMCA 3T15A 1P7VA 3W0FA 4TUYB 2IITA 1RAAA 4Y6LA 2PZ8A 4EVRA 4N9WA 3IB6A 2X5OA 3HJAA 5CYFA 3EUAA 1NN1A 4YMTA 1MTZA 2ATVA 1S6YA 1TU4A 2NZ2A 4GP9A 1NHWA 4NJOA 5IRCD 3T1HM 3IUYA 2ANCA 4RXMA 1EWTA 1M6WA 1EM8B 1UUFA 4G36A 4FJ2A 1RZUA 3L0BA 3EA4A 3FH0A 5KBYA 2WI8A 4JD5A 5CDYA 2IZ7A 3PEYA 4S12A 2FE1A 4JOSA 5ER9A 1NXWA 3KG2A 3U6KA 2HCRA 2ZBDA 4RF4A 2NAFA 1QFXA 4CF5A 1U6IA 1JEEA 2XCRB 1JEYB 1YJ8A 2GK4A 4DVJA 1LBQA 3W6OA 2NU8B 2D7CA 1HL7A 1WF6A 2YFKA 1KDVA 3DR5A 4FN5A 4E6EA 2VHUA 1UM9A 2PL9A 5DVZA 1DADA 1ID8A 4M9XA 4MUNA 1ZMWA 5MN4A 2OY0A 1SHZA 3LP6A 1U0BB 1M8JA 1E59A 2OV4A 1ZL0A 4RK5A 4IZ6A 5CITA 4CCWA 2VJBA 1M1YE 2ZXEA 2Z5GA 3RODA 1M9NA 4L5IA 5MN5A 2Z3XA 2NWQA 2PX8A 4ITUA 2G88A 1DXYA 1L5VA 1YU6A 2V7XA 3HN2A 5FEMA 1AGNA 3VRHA 3MLEA 5A4DA 3H1GA 3TTSA 1X7WA 4Y6GB 4CI0B 4NBRA 4YYZA 5KO2A 4F9EA 4OX9Y 4KHZA 1KYWA 1I4TD 1TOAA 2G5PA 4DMGA 3MGGA 2YWDA 3KUDA 2WKPA 4GMFA 2BHTA 2K4MA 5TGDA 3U40A 5ITTA 1KZ9A 4AROA 3KLBA 1A5AB