3DFZA

Sirc, precorrin-2 dehydrogenase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
196
Chain Sequence
b'MYTVMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAVNKFVKQHIKNDQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDDQYRLSLVKQREFLQQIEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-2 dehydrogenase
publication title Structure and function of SirC from Bacillus megaterium: a metal-binding precorrin-2 dehydrogenase
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 61
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.3.1.76: Precorrin-2 dehydrogenase.
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13241 NAD_binding_7 Putative NAD(P)-binding
A PF14824 Sirohm_synth_M Sirohaem biosynthesis protein central
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.610 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3dfzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfzA01
4JP3A 4II3A 3PI7A 4F46A 5HTOA 1CQJA 2HAEA 4IZHA 4CM5A 1LBEA 1ZMTA 1LX6A 1MC4A 4J1TA 5T64A 4YR9A 3VPSA 4EBFA 5BNTA 1UDAA 3DR3A 1WMAA 2FR1A 1B0AA 4YYZA 1QYWA 3LF2A 3R3SA 4RO0A 1ZSVA 5KJCA 5DDIP 5FWNA 1LLDA 2F1KA 4XGIA 3SJ7A 2JAPA 5L4NA 1MC5A 4CV3A 1PZFA 4J4HA 4ZU3A 4Z6KA 1ADBA 3RBXA 1GV0A 1U9JA 2I66A 2FWMX 2Z95A 1LSJA 2ZB4A 3TDKA 3JQFA 3KLPX 4CL3A 4XR9A 2BGLA 4Q9NA 1HE2A 2BGMA 4J1QA 3GZ4A 4AVYA 1BMDA 3ORFA 1CIVA 4JP2A 3RD5A 1R4MA 5U1PA 1KY4A 4AG3A 3MEQA 4MVJF 4TZTA 2QYTA 4J7CA 5KKCA 2GZ3A 3ROMA 2WWRA 1M6HA 4W4TA 2FPIA 4GGPA 4D0RA 5A5EA 3ZWOA 1JKIA 3DMYA 3EAGA 4L73A 2EW2A 4Q3CA 4CPDA 1FDTA 4AJIA 1W73A 1P0CA 3UH1A 1YDEA 1DRWA 4NBWA 4J4TA 1A4UA 1VJ0A 2GZ2A 1GYPA 5EINA 1TEHA 2GR9A 5ITVA 3DBRA 4BNHA 3D3WB 1R4MB 1KVRA 1T2AA 3CEAA 2EP7A 3GVHA 3RC7A 4IY1A 2NM0A 5HS4A 4Z9YA 2AQKA 5JCXA 2PZMA 2QRJA 1NQOA 4OQZA 2HK7A 3HB5X 2VRBA 4IQGA 1O95A 3DQPA 1U3TA 3U0BA 4TRJA 1F17A 4BO6A 3DZIA 3EGOA 3E48A 4XIJA 3W8FA 3ITKA 3RWBA 2IEBA 3E5RA 3AY6A 2VNSA 3L9WA 3DBRB 2C54A 4R1TA 4OM8A 2B4TO 4D44A 2VUSA 1ZK0A 1O6ZA 3OJLA 3RJ9A 3GAFA 1BSVA 1Q2XA 3AY3A 3JQFC 4QO8A 2EXXA 2X86A 3PK0A 2CVZA 1P1RA 3GPDG 2J3HA 1LC0A 4TZKA 5KJ6A 3I4FA 2Q4BA 2GRAA 1NX6A 4CM9A 1Y8RB 1F14A 2EGHA 3FSRA 1FF9A 1Q7CA 1NQ5A 1I30A 1UXKA 2W2KA 3DXFA 3CKYA 1NAIA 4MDHA 4FB5A 2PZLA 1LSOA 1WZEA 1EVIA 1TT7A 3GEDA 3ENNA 4MP8A 4YRDA 3FD8A 3JQCA 3L4SO 4BMSA 5G0UA 4U5QA 1XGKA 4BB6A 5L7TA 3RCBA 1ZCJA 3ONEA 1K3TA 3ZWXA 3M1AA 4FPXA 2W2KB 1EUDA 2AE2A 4KUEA 5IZCA 4NDNE 2XOXA 3CZMA 1V3VA 1MG5A 3I9OA 3RI3A 4M86A 5L95A 1R37A 1ULSA 2X5KO 5KVVA 4A10A 1AHHA 4WNCA 3VVCA 4ZRNA 1MXHA 3BXXA 3EHEA 4Z3DA 2W2LA 3WTCA 3WG9A 1YQGA 1SC6A 3PHLA 4D41A 1BVUA 4BV8A 2QQ5A 1SOVA 5JPIA 2I65A 3CE6A 2E37A 4PLPA 4GAEA 3D0OA 3DZKA 2E82A 4JK3A 3DFZA 1HDXA 4JNKA 4BO8A 3PHHA 4PRLA 1O94A 5F1PA 1V8BA 4CJXA 1DO8A 1JTVA 1N2SA 3MTJA 4WKGA 3JQ6A 3CUKA 4XDZA 5IFLA 3VZRA 1PL6A 5KWEA 2H5LA 4FFLA 3I6IA 3RBZA 3W4KA 5JBIA 4HV4A 1YO6A 2C07A 1BG6A 3F4BA 5FEUA 2Y68A 4A0SA 1WXDA 3U4CA 5L51A 4W9NC 5BSHA 5ICMA 3L77A 3W4IA 2YDXA 4E6PA 3BIOA 3EDMA 1HEUA 3KTDA 2HJSA 4U0JA 4BQRA 2WD8A 3GK3A 1XKQA 1D8AA 2DBRA 4HX5A 3CMCO 3I3OA 4BGIA 5IZCC 2YV1A 1A9ZA 1IYZA 4RPJA 1N7GA 3ASVA 4B3JA 4ZQBA 4JJGA 3WX0A 2I6TA 5ILOA 2B4QA 3D5TA 4CM3A 1HDRA 1LXCA 3GHHA 1E7RA 3WWZA 1I3NA 3F5QA 2WE7A 3V2HA 2EJVA 3OICA 1BWSA 1H9BA 1QMGA 3L4BC 4I5EA 4XQ9A 4FJ1A 1NAHA 3I4CA 4A73A 2D3TA 2Y1OA 4WOJA 1LSSA 3W8DA 1XQ1A 1GD1O 4IJVA 3SX2A 1QG6A 4P4LA 1LDBA 1NXQA 3A9WA 1KOLA 2EWMA 2YJZA 3U49A 4ALIA 1Q0LA 1PTJA 3VPXA 4KZPA 3P19A 4RVFA 3VTZA 4ILKA 2AG8A 4R41A 4IMPA 4ZQHA 3H5RA 1XYGA 2HU2A 2FOIA 3CTMA 1RYDA 1VE9A 4L8VA 2O3JA 4A7PA 1UUFA 4R4JA 3VH2A 2J5QA 4CM7A 4ZICA 4YWJA 5IDXA 3KV3O 4L75A 2OORA 3GG9A 3D3EA 3SLGA 5EQDA 2HK9A 1DBVO 1O5IA 3SBOA 4CLRB 3ICPA 4UAGA 4LCJA 4CLXA 3OETA 1E3SA 4MOWA 5KIAA 4GX0A 1JU9A 3DBHA 3JQ7A 4E30A 4PG4A 1HZJA 3T4EA 1MGOA 2O7SA 2CFCA 1I33A 2PZKA 2DTXA 3O9ZA 4TKMA 5F1KA 1FMCA 4XKJA 4WEOA 2NQTA 4R1NA 3B1JA 4FDAA 4M55A 3JQ7B 1LA2A 3ZWPA 2X0JA 4GPD1 1PJ3A 4MVJG 3VZQA 1HE3A 3R0IA 1ADCA 1E5QA 3ZWYA 3R6DA 3VKVA 2FZWA 4HFJA 9LDBA 3IAHA 3KVOA 1DIBA 1T2EA 3H7AA 5L7WA 3WGYA 1J4AA 4ID9A 5TQVA 1F8GA 2BFMA 5TT1A 1CETA 4J4BA 3KZVA 3GDOA 1DOHA 1B7GO 3PZBA 4DIBA 4CQLA 3WSWA 5ITWA 4C4OA 2NU9A 2P4HX 2P5UA 2VOEA 3M6IA 4IDFA 3IUSA 2DC1A 2Y66A 1QXSA 1HYEA 5AXCA 4OQYA 3FNFA 3QHAA 4LK3A 4CMBA 4CV2A 1SPXA 2X0IA 5LCXA 1QV6A 3RC9A 2ZTVA 1DC4A 4GVXA 3PJGA 4RQTA 1PIWA 2X5JO 4Z0HO 2WM3A 1D7OA 2H6EA 1MG0A 3K31A 3ZHZA 4YJFB 1HSZA 2VWQA 4BNJA 3EY4A 3DDNA 4PIVA 3D4PA 1DIGA 1PJSA 1DJQA 1E7QA 1I8TA 4DC0A 3PDJA 5EERA 3HSKA 1ZK2A 3ZU3A 1QYVA 5DNAA 5IN5A 4ONEA 3ZV3A 3GNTA 1I2BA 2ILTA 4PLZA 5L3ZA 1A71A 4JJFA 4O1MA 4HKTA 1WWKA 4U8GA 5C7LO 4DVJA 4WLFA 4BL5A 2O3TA 4ZJUA 3SC4A 1FDSA 3PFWO 2FSSA 4GKVA 2HJRA 2R6JA 3N74A 4LCEA 1M6WA 2YFQA 3E5MA 3TZQA 4B8ZA 1H6CA 4CQMA 5GZ3A 1V6AA 4QEDA 4MVJH 3CXRA 3GDGA 3DL2A 3SVTA 4D0SA 4ZQEA 1S6YA 4GVLA 3ZWWA 3FCOA 2IEDA 3LC1O 3G49A 4IPTA 4M49A 5CPFA 3TL3A 3I9KA 4Y6PA 3U62A 4DIOA 5A5FA 2NACA 3FRJA 2PFGA 1ZK4A 5AXDA 4DLBA 4O63O 4BNUA 4DPLA 5JAMA 3VZSA 1I2CA 5CDYA 1CQIA 1Y9AA 1Y5RA 4CQMB 3TFQA 3JYNA 3OJFA 1DIHA 1ZH8A 3INGA 4OSPA 3HB4X 4E3ZA 1VL0A 4IJKA 2PLAA 2CY0A 4OSOA 4D46A 3EVNA 2R00C 5I8WA 4B4OA 1LDEA 2GYYA 2G82A 3AUAA 4CL8A 1MUUA 5HRUA 4KWHA 5FF9A 1NTOA 4TRNA 2O2SA 3PQDA 1NFQA 3DHNA 3OECA 1SAYA 1RKXA 2V65A 2DU8A 5GZ1A 3TOZA 4GX2A 3GFGA 2IZ0A 4MVJI 5JFOA 1QV7A 3BMQA 4GI2A 2Q1SA 4WUVA 2NVWA 2Q1UA 4MJLA 5CPBA 4BO3A 1HDYA 3GGGA 2ZB3A 2ZB8A 4OYRA 3LZ6A 3AI3A 1GQQA 5LDGA 3TF5A 1HRDA 4YACA 4I8XA 2VYVA 1RM3A 3WLEA 4YT4A 4MVJM 3LSYA 3RFTA 1Z82A 4RJTA 3AUTA 2J3KA 2QG4A 5DCUA 3G79A 3ZNNA 1QSGA 2HMTA 3A14A 5EIOA 3PWKA 3TOXA 1I32A 3H2SA 3R3JA 4XA8A 1YB1A 3PPIA 3WGIA 5KVCA 5L45A 1LDGA 1T4DA 4Q3AA 1GY8A 3ICCA 1KEUA 3LT4A 4GKBA 3C7AA 1R0KA 4DLLA 1E1NA 3PWSA 1K6XA 3ADOA 4WCDA 3PYLA 3PIDA 5TX7A 4Q3EA 5K9ZA 3ZNOA 2PKRA 3RAJA 1N9GA 3RIHA 3JD1A 4NBTA 2AW5A 2VWHA 3K6JA 4DLAA 5EMHA 4O0LA 4EYEA 1Y6JA 1KBZA 4XDYA 4XJTA 3WGOA 1ZEMA 4GSLA 4AJNA 4EJMA 2ZIZA 3ZHYA 1BGVA 4WCFA 5C3MA 2EGGA 1PZEA 2DFDA 3VPFA 1BHSA 2J3IA 1R4NA 5JAQA 4AJ1A 1HE4A 4S1VA 2JJYA 3O38A 3FR8A 3BMCA 4ZHSA 2UUPA 4Z0TA 3GN1A 1JKFA 4WCFB 4W99A 1X7HA 5T57A 1BTOA 2RBEA 5JC8A 3OA0A 1XU9A 3LC7O 3ROPA 4MPDA 3OA2A 4BKPA 1OC2A 2C7GA 5JCJA 1EQ2A 1YVEI 2IXAA 3QWHA 3BMCB 2JCXA 4BKOA 3LT0A 2HDHA 2XPCA 5K6AA 1VL8A 3G3EA 5TJ9A 2NSDA 5EN4A 2PNFA 3GDFA 3GLQA 2Q46A 2I99A 3TZKA 3Q2IA 1DLIA 1DXYA 2CVOA 2X8LA 3QIVA 3V1TC 4H15A 4IJWA 2QZ9A 4XYGA 1E3WA 1QR6A 4XYMA 3NDJA 4BNIA 5JDIA 3OP4A 5HM8A 5L40A 4FJ0A 1VM6A 2DFVA 2VHYA 3SEFA 2YYYA 3MTGA 3O8QA 5L4LA 1CERA 1NPDA 4IS3A 2HO5A 3L6OO 4Y6RA 3INTA 4JROA 2DPHA 4QO7A 4BNKA 3PLNA 1A4IA 1MFZA 3G17A 1A27A 2GF2A 5KNLA 1E3WB 1YL5A 5EJ2A 2YQ5A 3WXBA 4AJ2A 5BSGA 4I5DA 5KTKA 1W6UA 3RKRA 3DC2A 1XELA 1IE3A 4YAIA 5A9RA 2I9PA 3O8QB 1Y9EA 2AEMA 3GA0A 2GD1O 3HQ4O 3EVTA 1E0DA 5TF4A 4XX0A 4PG8A 1AXGA 3N58A 4QXMA 1C1DA 2G17A 2PWZA 4Y67A 1LTHR 3Q11A 1H5QA 4BNWA 1WDKA 3F6YA 1GV1A 4RZHA 3UCXA 4J9VA 5JSFA 4B8WA 1C0IA 4YT8A 4RL6A 3D64A 5K6AC 5IXYA 4YAGA 3M2TA 3LLSA 2YFHA 1JA9A 1ENPA 2PY6A 2TMGA 4IXTA 3TZ6A 3GUYA 5JC1A 1E7SA 3ZCXA 2BD0A 1Q7GA 1NQTA 1T2DA 1WVGA 4ALNA 4CM8A 3DBVO 4J2HA 3LVFO 4R1UA 4S3MA 2Z1NA 4CODB 1D4FA 4RPLA 5JW6A 1JAXA 5JDIC 3DZGA 2FP4A 3HFSA 5L9AA 2WYUA 4I1IA 4AJEA 4Z0PA 3L6EA 1U3UA 3QQPA 4NG5A 2Y05A 4E13A 1YJ8A 5A9TA 5DBFA 3FNEA 1UXHA 1VSUA 4IS2A 5KJEA 4CMIA 4DQVA 1ZEJA 4NJMB 2B83A 1T26A 2BI7A 1LJ8A 3D7LA 3JQ9C 2NVUA 4PLYA 2I5PO 1ZK1A 4YJHA 1PQWA 3UW3A 1IB6A 4TKLA 1WAMA 3WS7A 3DMTA 1SMKA 4HXYA 4G5HA 3FWNA 3UOGA 3MJVA 5C7OO 3BHIA 2QHXA 4P4GA 3QVWA 1YB5A 4CMIB 2VUUA 2O4CA 3BTOA 2Q45A 4C7JA 4GQAA 4B7CA 2YHIA 2I3GA 3BTVA 3KHUA 1IZ0A 4HNGA 4MKXA 4CUZA 1WMBA 2G1UA 3CZRA 3OF2A 3D4NA 3C85A 2PD4A 5CHEA 2NVUB 3RU9A 1PEDA 1PZGA 4YJHB 4IBOA 4BKRA 2CD9A 3FNGA 1GPDG 3WGTA 3AU8A 5JY1A 1DAOA 4DYVA 1M76A 3H3FA 1H2BA 1KC3A 3VH3A 5A9SA 5I9NA 2YHIB 3ZW8A 2DM6A 4R68A 4JXKA 3WMXA 4BNGA 1C1XA 1YH3A 2YW9A 4PVDA 1GZ6A 2EHDA 3WQSB 3AFMA 1PGJA 3K5PA 5JMPA 1KC1A 3DO5A 2CF5A 3ZU5A 3A4VA 5G4KA 1E6UA 3UXYA 1E7WA 5I7SA 2QIOA 3RROA 3H8VA 5A9SB 1GAEO 3OQ1A 1EZ4A 3H9UA 2OL4A 5AYVA 3FPLA 3U4DA 2DUWA 1GPJA 3QP9A 1C1XB 3AUSA 4IDAA 1UXIA 3D3WA 4J9UE 5A4DA 1UJMA 5KJ1A 1U4OA 2B5VA 4YVFA 2Y0DA 2BMAA 3ON5A 5DCYA 3U4HA 4PG5A 3U9LA 5IG2A 4OKIA 3PLRA 5G4KB 1AN9A 4FJ2A 4DWVA 1QLHA 3PTZA 3RJ5A 1ENYA 2BFOA 3ONDA 3OBBA 5DULA 5G2OA 4MVJA 3GMDA 2C5AA 4Y9DA 1P1HA 1MLDA 3ZV5A 2V6GA 4K26A 1IZ9A 4PFJA 9LDTA 3QE3A 2O48X 3WJ7A 1A7AA 2X1HA 1A9YA 3NTQA 3S55A 4K1LA 3C1OA 5ES3A 4AFNA 4CM9D 3BHJA 2PZJA 1E6EA 2P2SA 4YJDA 3I5MA 4FN4A 3MCVA 2CDAA 1XG5A 4W7IA 4QX6A 1Y8RA 4XQCA 5BNIA 1YL7A 3ANMA 2YY7A 4XRRA 1P9LA 1XEAA 1EQUA 3MWEB 4ZQFA 5KVSA 1RPNA 5I7FA 4XQGA 3UCEA 2WMDA 1GZ4A 3ONFA 4GWKA 4YQYA 1GEGA 1J0XO 2HMUA 4YAJA 4RORA 1QYXA 2O50A 2QRLA 1RJWA 4IIUA 2NU8A 2PR2A 2Y93A 3VAZA 4PLCA 4ALMA 4EZBA 1U28A 4ALJA 3FBGA 1DLJA 1E1MA 7ADHA 1ZZEA 3JD2A 4BHTA 3IL2A 3IDSA 1V35A 4U6QA 1NNUA 2W2LD 2FSVA 2FPGA 4NI5A 5MDHA 1NPYA 3K92A 4F45A 4XRGA 1FDWA 1PS9A 3I9JA 1NR7A 2JHGA 2V6MA 5H83A 1HZZA 1KEVA 1WDLA 3Q2KA 3MOGA 3P2OA 4OAQA 3ZHXA 5A3VA 3SC6A 4GLOA 3WFJA 4B3IA 2GO1A 1LLQA 4EEXA 3UAGA 3Q9UA 3F4LA 4BO5A 4BNVA 3KSDO 3CMMA 2A9FA 3TQHA 1LLCA 2WEKA 4RPHA 1HSOA 1XA0A 5B1YA 3PZRA 4XYEA 1VPDA 4QUKA 5I9MA 5DP1A 1EUZA 4RGBA 1E1KA 2PA3A 1P74A 2ZTMA 3NV9A 4AJHA 5A06A 4FSHA 5HS6A 4RQUA 3TNLA 3NJ4A 2VT3A 1EBFA 3LK7A 1BXZA 3AM5A 3GGOA 4Y98A 1T24A 3GRPA 1PGNA 4UREA 1TXGA 5BT9A 1VSVA 4E12A 4BNNA 2EW8A 2NV6A 1T1SA 1IL0A 3PHIA 5CDTA 1LRLA 1E3JA 5ER9A 4OH1A 4II2A 4AJKA 3DHYA 4JBIA 3UICA 4DREA 1HLDA 4OHUA 2VWPA 4MP6A 1HTBA 4YA6A 5U4QA 5IN4A 1MX3A 4BMNA 3I52A 2CF6A 3U5TA 4PZDA 1TT5B 3MWDB 1GCUA 3NT4A 1ULUA 3AUUA 4UUMA 3VPGA 4WASA 3MJTA 5A05A 4HNHA 1BDMA 1DHTA 3OEYA 4CR8A 3BMNB 3GEMA 4RVGA 1F0YA 2NWQA 2W90A 1YDWA 4PLWA 3TZHA 1A5ZA 4JBGA 4O59O 2H1SA 4J3FA 2GLXA 4W6ZA 4FFNA 1IPEA 3RKUA 3NX4A 1ZNQO 4ND4A 2X9NA 1ZSYA 4JIGA 5DT9A 4M8SA 4C7KA 1PU2A 1XU7A 3K30A 1EE9A 1NASA 1WW8A 3NDIA 3LQFA 1X7DA 2DAPA 1R0SA 1NR1A 2NQ8A 3P5SA 3F1KA 2X4GA 2VZ8A 4FW8A 4IXWA 3GN2A 4U0KA 2NTNA 2IODA 3VC7A 4BO9A 3H5AA 4CLRA 1LI4A 3RUCA 1I10A 2B37A 4PRKA 5IDQA 1KY5A 2AE1A 5GY7A 4IQ0A 1W0CA 3JD3A 4RF4A 4EDFA 2OBYA 3G1TA 3BZUA 4MO2A 4XZ3A 5TGDA 3WIEA 2YV3A 4M89A 1J49A 2CUKA 1I0ZA 1PJ2A 1YRLA 3DOJA 3U4IA 1KEWA 1SO8A 1UH5A 4OMUA 5TSDA 1AUPA 4J6FA 3AW9A 5I9LA 2Y99A 1ONOA 3WOHA 4YEDA 5CDUA 2VHZA 3FF4A 2HMWA 3T4XA 4OJNA 3X2FA 4L4XA 4D42A 1NBOA 1H6BA 4FC6A 3S2GA 4MIEA 2VYNA 4GL4A 3JYOA 4NBUA 1ISMA 4LMRA 4WK6A 4LW8A 3EK2A 4UULA 2IZ1A 4ND2A 4ND3A 3EZLA 4YT2A 3IS3A 4U7WA 2GNAA 1DSSG 3JCZA 4GWGA 4MKRA 2P9GA 2B36A 2I76A 4KTVE 3EC7A 5T67A 3VDRA 1JKJA 1YBVA 4E2WA 3DWFA 3JQAA 3NJ8A 4HP8A 4UUPA 3X2EA 4Q3BA 2C20A 1PJQA 1PL7A 2FMUA 4M54A 5DN9A 5KOIA 2YUTA 4CV0A 3RC1A 1X1EA 4MVJP 4P38A 4QQRA 3WQQA 3BHMA 1E77A 4J7UA 4JBHA 4XWYA 2HMVA 4D3SA 3GF4A 4MIOA 3H9QA 5TC4A 2D0IA 3H6KA 3ZDFA 3OJ0A 3TPCA 2R2GA 3OFSA 1ENZA 2Q1TA 4YJFA 4AICA 1DEHA 1KETA 1GEEA 3JQAB 2YHUA 1TVEA 4YCAA 1GQ2A 4BO2A 3Q1LA 4QFCA 1LQUA 1V0JA 4WLEA 1Z7EA 1I2ZA 2C82A 3V5NA 2H63A 1NWHA 2YZ7A 3B1KA 3KBOA 3ZU4A 5EESA 1K2WA 1U2DA 4B79A 3QVOA 3WDSA 5CG1A 2A94A 1O89A 4IDDA 2P91A 4Z9FA 1UP7A 3HDYA 3A28A 4R3WA 4D45A 2DVMA 3FTPA 3GG2A 3PJEA 4WLUA 4A2CA 3BYZA 2GZ1A 2JFHA 4CQMD 1HETA 4FOSA 2IDZA 3TL2A 3B1FA 3ZWNA 1FK8A 1IOLA 1YONA 3IKTA 2W8ZA 3I23A 4TMFA 4JGBA 2EKLA 2A92A 3B6ZA 5T8KA 4R51A 2EEZA 3IKVA 3A1NA 4MP3A 3ZU2A 2VRCA 4YBZA 3H9JA 3LLVA 3VOSA 5CEJA 3ETEA 1T25A 3QVSA 3HJAA 2EIHA 3OQBA 3ZV6A 7MDHA 1U1IA 4JLWA 1OI7A 3STHA 2Y1FA 1R15A 4BVAA 3BTUA 4EUEA 4L4RA 1BVRA 3IP1A 3KYDB 1M66A 3B20A 3PYMA 4GMFA 5G0VA 3W1VA 5G0SA 1CRWG 4ZD6A 2CMDA 3ZHBA 4ZGWA 1JW9B 5JLAA 1HYGA 2C2XA 2WDZA 3IUPA 1T4BA 5ENDA 5TT0A 3KYCB 4XEHA 4QFDA 4IDGA 4FIZA 2VYVD 2DQ4A 4NH4A 4GX5A 1NHWA 3UF0A 1PQPA 1X14A 4BNXA 4J0FA 1DRUA 1B16A 3HZZA 2W4QA 4IDCA 2C5EA 3BAZA 3PDUA 4M87A 1IULA 5G4LA 3RVDA 2Q3EA 3WJAA 4DC1A 4E5NA 3JQGB 3ZNQA 3DAGA 1Q0HA 2DLDA 4IQ8A 3WNQA 4DIFA 4YQZA 1C3VA 2P9CA 1O8CA 1Q7BA 4IINA 4L9RA 4OL9A 2ZJ0A 4PLFA 4EJ6A 2RIRA 4UVHA 2X6TA 3F47A 4KQXA 4UEJA 3ADPA 3WGQA 4JX8A 5A3JA 1ONNA 3LC2O 2D4AA 4E32A 3E1KA 3ZW9A 2Q99A 4NBVA 4H7PA 4K6FA 3Q6IA 4KWIA 1U3WA 2VQ3A 1YWGO 4WNIA 1P3DA 2JHFA 1NVMB 1UZNA 2UVDA 4M1QA 6LDHA 4YB8A 1PSDA 2Y1EA 4OKNA 5TLSA 4IGEA 2HMSA 2FY8A 2VUTA 2VOJA 4FFRA 3ZWBA 1MB4A 3GY0A 1EBUA 1EFLA 1PL8A 2JCVA 2BHLA 2PD3A 3HN2A 1XQ6A 4RV9A 3QV1A 2EV9A 3V1UA 1BXGB 4BS9A 4R9RA 3RQSA 1WPQA 4Z9XA 1EDOA 1L7EA 4WPGA 1H0KA 1SEPA 4XYBA 3HN7A 4EUHA 1WNTA 1CEQA 4LISA 4YJGB 2D59A 4RVUA 1M67A 1RM5A 4E2ZA 3QJ5A 1H94A 1A72A 2C29D 3PEFA 3RUIA 1KVTA 4BKUA 1HT0A 5EQFA 2G5CA 3AJRA 4CR6A 1MA0A 1TB4A 2O3SA 3DHEA 4CM6A 4D79A 4R01A 2NU6A 1MV8A 1K6IA 4YXFA 1PR3A 1CJCA 2Y1DA 5JCJD 4TRRA 2D1YA 3Q3CA 3S1LA 3HDHA 1GYQA 1NHGA 1EE2A 3QA9A 3G1UA 4INAA 3CINA 3OM9A 1SZJG 3EW7A 1YJQA 5F21A 2QYSA 3H9EO 3TFOA 3JQ8A 1X1TA 5JYDA 1ISGA 4BO1A 2VZ0A 5FI5A 5IDWA 3SLKA 3GR6A 2GASA 3ZZNA 1KYQA 4L76A 1PGQA 1LQTA 1JVBA 4HUJA 5B37A 2C0CA 3RUDA 3RUAA 3QVXA 5I8ZA 3NYWA 2GN8A 3NTRA 4J1SA 3RUEA 1YE3A 1Z45A 4CMJA 2UV8A 5CG2A 3FR7A 3JQ8B 3IC5A 4NFHA 1BDBA 3OIGA 3TZCA 1H6AA 3PJFA 2O3RA 2WTBA 2Q4EA 3UUWA 1PJ4A 4CLEA 2POQX 2RH4A 1DFHA 1TI7A 3KRTA 4DMLA 1PR9A 4QTZA 1I5RA 2UDPA 3JD4A 2VZ9A 4R9SA 4LRTB 1ZBQA 3UCFA 3WGHA 2FR8A 2WD7B 4IDEA 4RPGA 4E5YA 1GUYA 1K6JA 4WCFC 3OMLA 1AXEA 2D5CA 4RVSA 4ND1A 5CP8A 3VVBA 4Q3NA 4E4YA 4BNFA 5JS6A 3I6QA 3HDJA 1Z7BA 1ISFA 3DFUA 3OHSX 3PQEA 3KETA 5JDCA 2HK8A 1R6DA 1UZMA 4KQWA 5ER6A 2DBQA 4BNMA 2Z5LA 1GQYA 2OGUA 1PS0A 2ZQYA 2B0JA 5DOZA 4DMMA 3FTNA 1EUCA 3TN7A 3NGLA 3QWIA 3U09A 3MJCA 3HG7A 4XYLA 2NNLD 1B3RA 3DTTA 3UHAA 3W4JA 1AE1A 3Q9NA 3QY9A 3GQVA 2JFFA 5KJFA 1U5AA 1MP0A 1P1KA 1IPFA 1KVQA 2ZTLA 1D1TA 4GX1A 5BNFA 8LDHA 4NJMA 1ISHA 3K9QO 4B4UA 4B7XA 1GYRA 3ETGA 5CAEA 3WGZA 2X0NA 3PGXA 4NFYA 3MOIA 2OOSA 4IMRA 1EK5A 2PD6A 2FHSA 4NU5A 4W7HA 1E5LA 4AJOA 3GUCA 5B4TA 3AI2A 3F46A 3TRIA 4DTIA 2OUIA 1JWBB 4WLOA 5JO9A 1RM4A 2W98A 2O23A 3H2ZA 3OJOA 5DBIA 4L4SA 1G1AA 2JKVA 1Z73A 2DTEA 3JYQA 2JFGA 4RVDA 4TRMA 5GMOA 2DT5A 5GZ6A 5LDHA 5KKAA 3FWZA 4N5NA 1R66A 4B4VA 2VCYA 5JDCC 1GZ3A 4TVBA 5BR7A 3E18A 5LC1A 1N8KA 3PHJA 4WOKA 1F12A 2PH5A 1XSEA 2JD1A 4G65A 4EI2A 3WIDA 4BIIA 2AQIA 4DQUA 3T7CA 1LLUA 2C59A 3FN4A 1EMDA 2CDCA 1YL6A 1EVZA 4EITA 4BOYA 3JQBA 4BNTA 4CLOB 1E3EA 1LSUA 2B4RO 1B8VA 2D5AA 1KVUA 1OC4A 2OBNA 4LSMA 4PGFA 3ZWCA 3K73O 3DZJA 2ZCVA 4E5MA 1I24A 4GLLA 1K5HA 2NTVA 3NAQA 1ZUD1 3FBTA 2JL1A 1NVGA 1OAAA 3IP3A 4NNJA 5AQ1A 4RLHA 5DZSA 4L74A 4YAEA 4DBZA 2O3QA 1NYTA 1UAGA 4E2XA 5THQA 3AFNA 4YRBA 4R3NA 3LU1A 2F00A 1PJTA 4MVJD 2D8AA 3AU9A 4HFRA 2BLLA 4WJZA 4BNZA 1J5PA 1ZJZA 3OEWA 4NPCA 2ZJ1A 5BSEA 4IM7A 2VWGA 2XAAA 5L53A 3HHPA 1T2FA 2E48A 3QW2A 3DOCA 5A02A 1M2WA 1YGYA 4NK5A 3DMTC 4NQZA 5TS3A 1HDOA 2E6UX 3CSDA 5TNXA 4DXHA 4EW6A 4AJPA 4RCVA 4NMHA 4ZA2A 5TRTA 4FFPA 3RUHA 3C24A 2I67A 1ADGA 4N5MA 4HFNA 4CR7A 3EZYA 5B12A 1QYDA 2X58A 1LUAA 5C5IA 1IY8A 1DFIA 4WEQA 1SNYA 1DRVA 1Z74A 2AEJA 4HY3A 3ZWVA 2LDBA 2IXBA 1KEPA 2FPPA 3JQBC 1IUKA 2JD2A 1ZJYA 2HUNA 1AHIA 2QX7A 3VH4A 4BO7A 4CMAA 1W4ZA 2YV2A 4HWKA 1BXKA 2FZEA 3ZV4A 5L4SA 2QRKA 1PQUA 1DC5A 5I7EA 1V3UA 1UZLA 1EVYA 1NQAO 1R16A 1ZSNA 2RH8A 3GAZA 3E82A 4ND5A 3I1JA 1HYHA 4Y6SA 2J3JA 3WYCA 1P0FA 3K8ZA 1BRMA 3WMWA 2Y1GA 4PN3A 3Q0EA 3L9XA 1Z75A 4I9UA 4R16A 4OOFA 5A1TA 4NR0A 2NADA 2XXBA 1HLPA 2ZYGA 3K96A 1NFRA 3QWBA 3VDQA 2OZPA 1DAPA 3DOOA 4J1NA 5COQA 2VHXA 3HWRA 3PHGA 1P33A 1DPGA 3DBLA 3ULKA 3KOUA 1AGNA 3QWFA 2X23A 3W6UA 2FRDA 3CPSA 4JCOA 4J7XA 4FOOA 3LF1A 5JAZA 5COAA 1D1SA 1C0LA 1EEHA 1LRJA 1OZAA 2AEFA 1P44A 3C3XA 1LC3A 2PGJA 3C7CB 3HFGA 3KB6A 1EVJA 5I7VA 2E49A 2VHVA 1SBYA 3PIIA 3H5NA 4CMEA 1S7CA 1X7GA 3DBLB 4PLTA 2VTEA 2X5OA 3PGJA 1V3TA 3HUDA 4KUHA 1B26A 1Q1NA 4MINA 3GGPA 3C7DB 1QYCA 5U9CA 5MGBA 3RC2A 1EFKA 1N7HA 2EJWA 3C8MA 3O26A 4W9NA 5KVQA 1XWFA 1I3LA 1D3AA 1GU7A 3QSGA 2YQ4A 1YS4A 1U3VA 3WYEA 4B7UA 3GMSA 3PVZA 1ZXBA 3V2GA 2ZCUA 6ADHA 3KEOA 5JMWA 1ZKMA 3S2EA 2WSBA 3KEQA 3BA1A 3DZBA 4OOEA 1E7YA 2AQ8A 2YDYA 4Q39A 4IGFA 3OSUA 4A5OA 2Z1MA 4P4NA 4FFMA 4MIYA 1E1LA 4OO3A 4MKZA 1TT5A 3PFFA 3RSHA 4BGUA 1PZHA 4PLHA 3WB9A 3L4BA 2ZTUA 5EL0A 3OQ6A 4BV9A 3D1LA 3JQEA 1RWBA 3NRCA 2O3UA 3BMNA 2DUUA 3O03A 3DONA 2CVQA 4XCVA 5IZ4A 2EP5A 2WE8A 4YAKA 4PVCA 4E2YA 1LDYA 2A35A 4BMVA 3IJPA 3PQFA 4WLNA 2HRBA 3ZN2A 4CMEC 1VLLA 2VHWA 3IOYA 4CV1A 1SOWA 2HQ1A 3WICA 2GCGA 1ENOA 3H4VA 4TWRA 4RPKA 1DIRA 5IAAA 3KSUA 4LSWA 1XIVA 4GGOA 5FI3A 1ARZA 1WP4A 4DBVO 3UFXA 1GUFA 2ZQZA 4E0BA 5AOVA 3ANLA 4MVJE 4TQGA 2GDZA 1Y1PA 5T5QA 2PTGA 3S8MA 1GTMA 3WGGA 2OFPA 2C7VA 2OHXA 4KDEA 3BMOA 2NUAA 2A4KA 3DAFA 1UAYA 2AXQA 4ROSA 5AXBA 5DOVA 4DQXA 1CDOA 4FGSA 5L7YA 2GSDA 4IUYA 3D5QA 1JDJA 3GNSA 3NT2A 4JN6B 1FJHA 4EJ0A 1IHYA 4U6SA 1UDCA 5K0ZA 1U7TA 4OGWA 1VL6A 3MZ0A 4IDBA 3L07A 2X9VA 1W8DA 2VYND 4HFMA 3BMOB 3B70A 3PRJA 1N1EA 1ONPA 1PX0A 4FBGA 4KMSA 1SCUA 3RASA 5BQFA 1N5DA 4KUGA 4YRAA 1QP8A 4ZRMA 4QECA 1GFSA 2P5YA 4I9NA 1H93A 4PLGA 1XHLA 1ZFNA 1P31A 3PJDA 3UN1A 1EK6A 1J6UA 2HRZA 2O7QA 1R0LA 2PKQP 3JQAD 4K6CA 3M1LA 3NGXA 3GVCA 1L7DA 3WFIA 1Z6ZA 5B4VA 2AA3A 4RF3A 1ZXLA 4GSKA 5IXSA 3GVPA 4A03A 4CMGA 2QZZA 1U4SA 2IRWA 3WNVA 2X22A 4HADA 4ZVVA 3WR5A 3FI9A 4RVHA 4UEKA 3T7EA 3UKOA 2ZYDA 3RBVA 2J5KA 4CLDA 4FS3A 5F5NA 3ZWMA 3RFXA 2XXJA 2UUOA 1ORRA 2B35A 3DZHA 1RM0A 4D43A 2BFAA 2DBVO 2HKIA 3LT1A 4TSKA 2GERA 1OMOA 2V6FA 4ESOA 2Q49A 3WLFA 2OO5A 1DHRA 1HL3A 1SB8A 1H6DA 1PJLA 2C2YA 3G0OA 4Y8VA 3S2IA 3OJEA 3JYLA 1PGOA 5JO0A 1HWYA 1KIFA 3MJEA 3FHLA 3AOGA 4GH5A 4FQ8A 4NHEA 4WGGA 4PZEA 1B14A 2NU7A 4NBRA 3EMKA 3VTFA 1UXGA 3A06A 4XJSA 5JXWA 1VRWA 1TLTA 2BKAA 3DBHB 1X0VA 2Q1WA 3KUXA 1X0XA 2TMDA 1HDCA 1XCBA 2RAFA 4NK4A 3WQRA 2EERA 3L0DA 4X54A 2DTDA 3RU7A 4KOAA 1YBAA 1VKNA 4NJOA 3ROQA 1JAYA 1K89A 2RHCA 3I9LA 1DC6A 2RHRA 4OXNA 1YOVA 2I3AA 3HNPA 1GCOA 1F06A 1U7HA 2XF8A 2VRCD 1E92A 5ILGA 1ZO8A 3QRWA 4TROA 3W6ZA 4ALKA 4EUFA 1P1JA 3ANNA 4FR5A 1LDNA 2GUGA 4NU6A 5G0WA 3AK4A 2B69A 2OMEA 2GN4A 3ZI0A 1UXJA 2FR0A 5IF3A 1WZIA 1YOVB 4A26A 5J23A 2J8ZA 1G0NA 1XDWA 4CM1A 3P7MA 3LYLA 2VT2A 4UUOA 3NEPX 4CQLB 3R1IA 1CF2O 2QW8A 2R00A 3GRKA 3KYDA 4I5GA 2JD0A 3TJRA 3OIDA 2ZK7A 5JY6A 4DPKA 2BI8A 4OXYA 4UEOA 5C7IO 4UVDA 4WECA 4QT0A 4URFA 3ZWAA 4YDRA 3VZPA 4H3VA 5THKA 2P9EA 3ENKA 3KYCA 4NIMA 1OFGA 3AWDA 3F3SA 4N5LA 2Q50A 1P1FA 4FCCA 5ADHA 8ADHA 1FDVA 3JV7A 4GMGA 4LN1A 2CDBA 1ISJA 1DDOA 4PG7A 4DRYA 2X7HA 2BFPA 5DCWA 3JQGA 2X9GA 1TA4A 3ST7A 4BO4A 1ML3A 3DZFA 4R1SA 4A27A 2VN8A 3H9GA 4DUPA 4AJLA 1NFFA 3HE3A 1L1FA 1WDMA 1N1GA 2Q2QA 4IJUA 4CUJA 3JSAA 2E4AA 4G2NA 4DGSA 4RDIA 4RF5A 4CMKA 4P8RA 2H9IA 1P1IA 2IYOA 5COBA 5JYEA 4YTEA 2CNBA 1JQBA 3E9MA 3GFBA 2BGKA 4E5KA 4D3DA 2VTDA 4LGVA 3GT0A 4N7RA 3W8EA 5T8KC 3KSZO 4IIVA 5CEEA 3NT5A 2OP1A 4E33A 1GL3A 1JWAB 2AHRA 4AJJA 1QRRA 3GEGA 3KM0A 3TWOA 2UAGA 3GZNA 3GHYA 3MJSA 1BXGA 2ZB7A 3E03A 1NM5A 1U2GA 3AI1A 3NUGA 3C1AA 4F6LA 2PV7A 4E31A 4ZN6A 4BKQA 1DIAA 4P22A 4UUNA 3K2EA 1GUZA 4RZIA 1T2CA 2JAHA 5TIIA 3DEYX 4YJGA 4B3HA 1ADFA 2VNAA 3KLMX 2GPTA 3RFVA 1PS8A 1GDHA 5C37A 5A03A 3JYPA 1C14A 2NLOA 5H81A 3E9NA 3INRA 5HWSA 1PWXA 1X15A 3NDRA 4BB5A 3GZNB 1RYEA 3H3JA 1DFGA 5A04A 3DAPA 4YT5A 4UVEA 4I5FA 2ZYAA 4BGVA 3ZNPA 2DBZA 1G0OA 5CDGA 1YB4A 1HKUA 2NVBA 3NTOA 4R5MA 4K9DA 1LU9A 3COSA 3KYBA 4CUKA 4J16A 1F8FA 3VKUA 3GPIA 3JTMA 3BMQB 3JD0A 1UDBA 4UVIA 4DA9A 1B8PA 5DBGA 4DL9A 4J0EA 3E6AA 1VC2A 4BNLA 2EKPA 1Y81A 3GNQA 1E3IA 1Y5MA 4XR4A 4PLVA 1U5CA 4XD2A 1B2LA 1PJCA 1OOEA 2PKQO 3GH3A 4WE3A 3ZGYA 1QKIA 1B3BA 2X0RA 3I9NA 2D2IA 1H2HA 3WBFA 4WLVA 1C0PA 4J90A 5HBRA 1UP4A 1YXMA 2GN6A 1B8UA 4J2OA 3IJRA 1E3LA 5CFZA 1PGPA 1ZIDA 5FFFA 4F6CA 1SEVA 1LEHA 4XB2A 4J91A 1H9AA 1BW9A 2B5WA 2G76A 2J6IA 3ITDA 3WYBA 1QLJA 1E7MA 2Q2WA 2NTJA 4XGKA 3DTYA 1PWZA 1VI2A 5DF1A 3MJ4A 2Y1CA 3HDQA 3AM4A 3N7UA 3PWZA 4PCVA 4ALLA 3M2PA 2V7PA 1JVSA 3P2YA 4OIMA 1VJTA 5F3RA 3UGKA 1O0SA 5AVOA 3IMFA 3QLJA 1KS9A 3CH6A 1K0UA 3L6DA 1U8FO 1BW9B 4IZIA 3WWYA 2SCUA 2HSDA 5H82A 1P77A 1N9GB 2GN9A 4E5PA 4B4WA 1ZMOA 4BGEA 1HF3A 2WD7A 3D4OA 3AM3A 4O5OA 1GR0A 2CSUA 2O4UX 4KTTE 1UR5A 4N18A 2BRUA 1I36A 4LRSB 4R69A 1CYDA 1ZVMA 4XGNA 1ZW1A 4NFSA 1CWUA 3FNHA 3VHRA 4OXKA 5EPOA 2P68A 5ENVA 1HXHA 5T6BA 2Q2VA 4LMPA 4RDHA 3NKLA 4LVCA 1KERA 1R4NB 1UP6A 4Z3KA 5JNLA 2DKNA 3OH8A 1M75A 4JQCA 3EYWA 3V8BA 1DC3A 3CIFA 4D3FA 1NPTO 2BELA 4GBJA 2CZCA 3WTBA 5JAIA 3KO8A 1PJBA 3DB2A 2LDXA 3V1YA 3ASUA 4W82A 3LT2A 3KXDA 2Y0EA 3U3XA 2AG5A 4D7AA 1Y8QA 4I9HA 4DYDA 1LRKA 2BH9A 1ID1A 3GOHA 5HA5A 3F1LA 4BUCA 5CEFA 2Y67A 3F9IA 4BQPA 2UYYA 3QWAA 4I08A 2ZATA 3ETDA 3TSCA 4N54A 1YQXA 4ZQGA 1O9BA 2AQHA 2GGSA 1V9LA 3K2BA 1C0KA 2ET6A 3I9MA 5KCZA 4PG6A 3LDHA 3UVEA 3OIFA 4G81A 3RUFA 1Y8QB 2DPGA 4CMHA 1I3KA 3SXPA 4AL4A 1YQDA 3ZH2A 5F1OA 3C1TA 3BTSA 4CM4A 2EG9A 1JLLA 1HDZA 2PGDA 1QORA 1FXSA 3ROKA 1MXFA 4XIYA 3ABIA 3JQ9A 2ZKLA 4L0QA 5AXAA 5TJHA 4H16A 2BF7A 1U8XX 2AMFA 1GADO 4FC7A 1ZK3A 5IDYA 4J43A 3AOEA 4O6VA 3SJUA 3GVIA 1KVSA 3IQDB 1FDUA 3WSVA 1X13A 3I83A 3E9QA 4PZCA 5BSFA 1N92A 4XQEA 4CM4B 4Q3DA 4KDFA 4UVGA 1HE5A 4EGFA 3FPCA 4ITUA 1I01A 1EDZA 1Y7TA 2FN7A 4NZ9A 5F5LA 1P45A 4E21A 2O2YA 3O4RA 1R12A 2JCYA 4KP7A 4AJ4A 1Q0QA 2HLPA 4BO0A 1DJNA 1E6WA 1LDMA 1I3MA 3E8XA 3GVXA 1VJ1A 2IZZA 4K28A 4RLSA 1JN0A 4FGWA 3QVTA 3VPHA 2Y0CA 2OXIA 3WBBA 3EUWA 2PK3A 1ISIA 3PXXA 4QSMA 1C1DB 4JJIA 1NWCA 1B15A 2IYPA 3HADA 5FYDA 4FFOA 4LVUA 3VH1A 4CLOA 2WYWA 1OBFO 4HBGA 2PGLA 1NP3A 3PP8A 1YKFA 4EEZA 5B4UA 4YPOA 1SB9A 4CLHA 1MFPA 4CMCA 2G0TA 4CM8B 2EF1A 5CDSA 3IIEA 3JQDA 3S2FA 5ICSA 2RCYA 4TVOA 4XB1A 2J5RA 5DP2A 3V2UA 4BNYA 2OP0A 1T1RA 4R54A 2P4QA 2WJPA 2IE0A 3F5SA 1HDGO 1WLYA 1XLTA 2PH3A 3PYXA 3GC6A 5JE8A 4FD3A 1XR3A 3AOEC 1NVTA 1YBMA 3AY7A 4RF2A 5IJZA 1VKOA 1G6KA 4J49A 2EKQA 2WYVA 2V6BA 4DPMA 1IHXA 2HCTA 1A7KA 4F3YA 1LNQA 4R5HA 5G0TA 1DB3A 3H65A
chains in the Genus database with same CATH superfamily
3HYNA 5CB8A 1NBMD 2V58A 4ZIRA 4CM5A 3EG9A 4PHHA 4B73A 3VPSA 2QF7A 5BNTA 1AUOA 2P2ZA 3PCXA 4FSDA 2F1KA 1I7PA 3SNKA 1QHHB 1GVHA 3G85A 2J3DA 1UC9A 3KLPX 3SYKA 4FYJA 2G08A 1Q84A 2MT9A 3SARA 2IIVA 3DE5X 1FP4B 2AR0A 4LRWA 2YRFA 3H2HA 2VQSA 3D8UA 4ER3A 4GGPA 4UTOA 5ED4A 1YDEA 3IDAA 1ZCAA 4EG7A 1BA2A 3HJ8A 1VPVA 5JPCA 2OA0A 2FPIB 4Y0AA 2IZ6A 5JSKA 4UMEA 1ZWLA 1V45E 2I1LA 4DUGA 2Z2KA 1F14A 2FB9A 4JYZA 2R6FA 1EB9A 4ZVRA 2NO9A 4U7TB 1W1UA 2FETA 2DERA 3P5BA 1KSHA 5L7TA 3RCBA 3KTAB 3IQFA 4A8PA 2I4LA 3SC3A 4L1KA 2QVGA 2GEBA 3FGNA 3RI3A 4G5FA 1PM5A 4NLLA 1NVBA 5BMVF 4F4JA 1SOVA 3OD5A 4J0JA 4YROA 4OI4A 1KRWA 3WI7A 1GRCA 1B8NA 1PR1A 2FSFA 2BFCA 4OB7A 3OLXA 1XZEA 4UUBA 1PT8A 3BXPA 3DW3X 2WJZB 1JMVA 1W2WB 1OIWA 3KTDA 5IUNC 2AIRA 3CMCO 4BE4A 3EVCA 2WIBA 4ZYVA 3UA4A 5A7HA 4MEAA 4QUAA 3L29A 2WSYB 4TMVA 1V71A 4IH9A 1I7LA 4G1EB 1QOQB 3PUKA 4BBAA 3VGPA 1CUJA 3ND6A 4KZPA 4AZ3A 2CV0A 3O3CA 1VB3A 2JFWA 3ZD8A 2CZGA 2EGUA 1DBVO 1X92A 1DQRA 4UAGA 4GOMD 1R50A 3L8MA 2EL7A 2JFBA 1CB7A 4GIPA 1Z6PA 2XUGA 2WYOA 3V8RA 5SYMA 4WEOA 3F90A 2X0JA 1W2GA 4PWYA 1SQGA 1I6KA 3IAHA 1T2EA 3UWMA 4CQLA 3WSWA 2PPLA 5K0BA 3BG5A 4FCWA 3CGGA 2IV2X 2NO5A 5TV2A 1XZDA 3RVPA 2F4VM 4NZPA 4TTRA 4LNUA 5C80A 1FRVA 2J9ZB 3G0IA 4ZV9A 3D4PA 4X24A 2VJQA 5IN5A 1T10A 5LQRA 3EH2A 4MHOA 2H00A 2PUWA 4GOJA 2FSSA 3ESAA 3N8DA 2RKWA 1N2IA 1XUOA 1ZVVA 1NX9A 3DXZA 3ZWWA 3FCOA 3D3QA 2WT4A 2DVWB 5I3ZA 2WVJA 4QDJA 3ZIAA 2PBZA 4JUAA 3FUVA 1DIHA 4JV5M 4OSOA 4D46A 3KR1A 5ALOA 4QFBA 3WL4A 1MOQA 2R2AA 5JFOA 1ZOOA 3V00A 2Q1UA 1FTQA 5EWMB 4F8EA 3W5AA 4D9KA 1HRKA 3GLFB 5JXHA 2Y76A 3PJRA 3ROXA 1G9SA 3M6FA 4V0RA 5LBUA 5AOBA 3X3HA 2A7QA 3LT4A 3OZEA 4NARA 4NPAA 5FL7D 1PNTA 4M9SA 3E1GA 1DX4A 1OTHA 3JQQA 3PYLA 4BLPA 4V02A 3DLBA 1AQYA 1KZ7B 4QPZA 3AJAA 2PL5A 3QLEA 3GX1A 1W2HA 3H9BA 4GSLA 2J5YA 3KHTA 3CG4A 3O38A 3UV6A 3BMCA 5CVDA 3LC0A 1SHUX 1QQTA 1SBNE 1T36B 1H1LB 1SELA 5JC8A 5CLLA 4BKPA 4QWMA 3VV3A 3ZWKA 3ODGA 4AIRA 1QYIA 3BXGA 5L40A 1SK9A 3R09A 2XT9A 1VM6A 1X1DA 4X1KB 4UBIA 3UFBA 4N49A 2C9MA 1T1GA 4DV3M 3O8QB 4DMHA 5TF4A 4YRMA 3QPUA 4MUHA 1QU2A 1NF3A 1DTWA 2YJGA 1SUFA 3PC8A 3EFOB 1QQAA 4YFYA 4OHBA 1TR8A 1ULAA 2O8NA 4JI5M 1ZDMA 5KCMA 1JA9A 5DNUA 2J0EA 1NQTA 4R1UA 4QFMA 2FP4A 3GD7A 3Q8XB 1QGUA 1YR3A 3KCQA 5AVSA 4Q3KA 1YJ8A 4H31A 1Q3HA 4EGJA 3E46A 3Q9LA 2RB4A 3NEYA 3C3YA 1SMKA 4LNAA 4DJAA 5C7OO 4B6EA 2Y20A 5D3ZA 3Q6NA 4F5EA 2O7NA 1L4LA 1YD7A 2GFIA 1YRQA 1GA1A 3ICOA 1V8PA 3AU8A 1F0KA 2ICAA 5JY1A 1PVVA 4DLRA 1H2BA 2AC4A 3FIUA 4YRSA 1TH4A 4CCYB 1K5GA 1T5DX 1NL3A 4OQEA 1I4OA 1VCNA 4GLFA 3FX2A 2HM7A 1EZ4A 1MRNA 1GPJA 4OM7A 5KTRA 3Q8WA 3EIEA 4CRWB 3WA7A 5LYYA 1H8HD 4M22A 3OLVA 2ATEA 3S55A 2HF8A 3MINA 2JIDA 5IC4A 1E6EA 3COZA 2CDAA 1AKQA 1JQJC 4BVGA 2WPNA 3HYLA 2WMOB 4EQZA 2I9KA 2GARA 2QPOA 2E87A 2PR2A 1VG5A 3K1YA 4L7VA 1U28A 3AVTA 1RJGA 3AZPA 1NNUA 3EUAA 2RHMA 4MR8A 1GHTA 3LRXA 3MLEA 4XASA 4RESA 3B48A 2H7XA 4OAQA 1D6JA 1N2OA 2VDPB 3L1JA 4LC9A 3SC6A 2CE2X 1WTCA 1ZM4A 2GZDA 1A9QA 2OYRA 3V7YA 4MH0R 4IH1A 4OHFA 2VF7A 4FLMA 2QX4A 2Q3MA 5ALHA 4O08A 3ZXIA 4Y98A 3AR9A 3GRPA 1R9MA 1XD2A 1GO2A 4HDCA 4MGZE 2PT9A 1DWOA 2BBSA 4EGAA 1WJ7A 1CUGA 4N12A 3KU1A 5KTTA 4ZRDA 1C80A 1FJ2A 5AKHA 2KA6B 1J2EA 2ZRJA 1OVMA 4D5GA 1E63A 1HZZC 1TT5B 4CI9A 1U9IA 4NS4A 4H7IA 5A05A 5MF6A 1ODSA 4I2VA 5GM1A 4J3FA 3LGXA 1P4HA 4CIYA 2VI5A 2R45A 2IS4A 2Z2ZA 4JIGA 4AM8A 4ZT5A 2E18A 4IIYA 2B78A 4U7JA 1QRTA 4MV4A 3OM8A 2VZ8A 1Z35A 4UUAA 2QVLA 3DMDA 4YRLA 4PRKA 1NONA 4N0DA 4X44A 5FWYA 3W04A 1D2NA 1T0HB 3I9V6 5CDUA 2PMFA 3FF4A 2WT8A 4L4XA 4MV1A 5ALTA 4YAFA 5JU6A 4S2EA 1M1YA 2KB0A 3FLBA 3B9QA 5CM8B 3NS7A 3I01A 2FMUA 4M54A 2NXNA 1X1QA 3RC1A 3Q5GA 2CYAA 1YVPA 4UM8B 3WLJA 3ZDFA 4JLNA 1K5DA 4YJFA 2JVJA 5IWCA 1LQUA 3V5NA 2H63A 2YIVX 1U8TA 5JWHA 1G3QA 3FFAA 4XTRA 4TUYA 5FPKA 3JPWA 2O20A 3P20A 3BD9A 2VLIA 2J7KA 4A6EA 1MVOA 3TJMA 1PV4A 4JLWA 1OI7A 3LHDA 1TUEA 1E8NA 2VPYA 4ZV4A 2QBYA 4PANA 3NO4A 4ZD6A 1GG8A 1ZHOA 1HYGA 3BIJA 3KYCB 3LIPA 3CC8A 2YJ4A 2HA3A 4IDCA 3BAZA 1PJZA 1XVLA 3H17A 1QO0A 4GKKB 2NO0A 1O8CA 4BXOB 4TQ9A 1ONNA 3KJXA 5EKDA 1Z5UA 3ZW9A 1HQDA 1I0IA 1E32A 1LPAB 4HRVA 4F91B 1CUDA 1IONA 1WMEA 2PEYA 4QTYA 4PCUA 3MMZA 3F8WA 5C5DA 3CNLA 3NR2A 4RV9A 1QZMA 2P5SA 2F59A 3I62A 1GGFA 3V55A 3VR6A 5K3SA 4XYBA 4ZAZA 1TADA 2HA2A 2JWSA 1QIIA 2C29D 2UXBB 1PW5A 3O8RA 3PFBA 2G5CA 1D4OA 4CM6A 1R5LA 1K6IA 3KFLA 2FWNA 3IRUA 1JLMA 2G1AA 5B36A 3Q3CA 3ERCA 1CNMA 3N2GA 4MM3B 3PVSA 1VFPA 2WAMA 3RYHB 1YRYE 5F21A 2AI3A 1X1TA 3W34A 2VZ0A 2H08A 1LQTA 1X1CA 5CNKA 4HUJA 2C0CA 3DOEA 3V7UA 3QK7A 3JQ8B 5AVKA 3EPJA 1VMAA 2WW8A 1PR9A 4K9NA 5K0EA 1ZBQA 1VKJA 2O0LA 4PRZA 1WW2A 4OYHA 3PFKA 4RVSA 3IOMA 5DE3A 4A16A 3H1AA 3ZWDA 1CUUA 4EYKA 3H3XA 1BKDR 4QOGA 2CW5A 3I72A 3C3WA 2CXTA 3K8QA 4MV3A 3EQ9A 1H9CA 3NAZA 2ZUVA 4ETMA 4RCYA 1IPFA 3HBAA 2ZTSA 2JGFA 1PNVA 3PVCA 2X0NA 2F6RA 1OLSA 2OOSA 1QX3A 2DFTA 4GL2A 3QY0A 2CHFA 2EYQA 4Z4IA 4L4SA 1N5KA 3TI7A 2GN0A 3I5XA 1R66A 2BM9A 1UF9A 4EMSA 1ZHFA 4HB2A 2OO3A 4K2AA 4RA9B 3CN9A 2ADFA 4DM7A 2AEEA 3FFWA 5E9QA 5BRJA 5CA0A 2VP3A 3PNQA 3ZWQA 2W00A 1K5HA 5JH7F 5JCOC 3O4IA 2ZBKB 3B1WA 3TQRA 5DZSA 4FFVA 1E9CA 2XMRA 4JI4M 2HTFA 3OU2A 1N77A 3PX7A 3CSUA 3HGTA 2E48A 4LJ8A 5SZKB 1YGYA 2R6CA 1E1CB 4TKZA 2XTZA 2PGNA 4NMHA 2D5IA 5CK4A 2WJ4A 1CRPA 3EZYA 2FEWB 1VIVA 4BVFA 2CV2A 2FQYA 1VECA 2BSAA 5F7ZA 3AILA 1QRSA 3VO9A 4K6GA 1KEPA 3BGSA 2B5OA 4C4PA 4LV6A 1WXFA 5FNVF 4B6FA 3FZNA 5KYYA 4RK0A 1V3UA 4N0EA 1QQ5A 2J3EA 2IDJA 1FY2A 1QOPB 3FTDA 1JDNA 4HG2A 3G5UA 4D4HA 3K96A 4X8LA 2I7CA 3VDQA 2QTAA 2PQMA 1SQ6A 3IEIA 1EWVA 1W8IA 2XEPA 5J5AA 1AGNA 3L27A 2MYUA 5JAZA 1D1SA 3C3AA 3CONA 4Q02A 3ZQKA 1EVJA 1OT3A 1J20A 1SFRA 3C7DB 2RGWA 4MW6A 3KQKA 4IBIA 1YSCA 2HSGA 1WVMA 2E5LM 1TH3A 3R5KA 3PVZA 1T6ZA 2QIPA 1OGIA 2P3LA 4UM9D 1A50B 4EWLA 7MHTA 3D7MA 3IYLW 4OO3A 3D7SA 4BUJA 4CBVA 4MS3A 4BGUA 2XADA 3QSYA 1EX1A 2IUFA 3JQEA 5FIUA 4PW0A 4IDQA 2W0SA 4WZAA 4O4LF 1E66A 3WC4A 2ZBQA 1AKVA 4HMQA 3T0FA 5JSHA 1ZN9A 4DR1M 5FI3A 5CBPB 5AI4A 4G5RA 4OYLA 3KJGA 4G4GA 4ROSA 5K0LA 2WU3A 5TF0A 2GSDA 2CNKA 5CR9A 4JN6B 4EJ0A 4WMLA 5IHXA 1L1TA 4OGWA 2WFMA 2PBLA 5A0FA 5FP0A 3WKDA 2V7VA 5AICA 1SCUA 5B3JA 1GFSA 3UAZA 3UN1A 5AVWA 4UZSA 5CT5A 2J6BA 2YWCA 4WKCA 2JBAA 1FC0A 3OUZA 1RD4A 4CLDA 4KG7A 4CHGA 1E5VA 1IJKA 1K4KA 3CURA 1ORRA 1RM0A 4I1UA 4D43A 4TQUS 2Q49A 2IEIA 4HAUA 2OQ2A 1PGOA 4GZ6A 3GI1A 2QN2A 3L1UA 1W46A 1UK9A 3W06A 3NFYA 1NZDA 3EMKA 1TTQB 3NNNA 2ZUWA 4X54A 5IKXA 3E3MA 3HNOA 3FF1A 2YOFA 3OFKA 2XGJA 2DHEA 2AOTB 2NU7B 2DZLA 3NVDA 5K03A 3R0XA 2IYNA 4FR5A 5F23A 3AK4A 3I51A 2QHOB 2COEA 3OQMA 3ZH9B 3KOXE 1LI5A 2ZIUB 4X6UA 1Z8DA 5KAMA 3DOHA 4JENA 4JCCA 2RC6A 2HLDA 5AW8A 4GECA 4YDRA 5T6MA 4LKRA 5FUQA 1SCJA 1G21B 5GV8A 2KMLA 2VJDA 4BWFB 3A58B 3RS8A 5D3MB 4F2DA 4R1SA 1FRQA 1OR8A 2NO4A 4DUPA 1IHDA 2L4EA 1WDMA 3FIJA 3P1JA 2E4AA 4ZVKA 4EENA 2IXFA 4QICA 3V3KA 5JYEA 4CKBB 4C0LA 1NVMA 3PNMA 1WCYA 5EP3A 2FXIA 4BQEA 2GM9A 1DS6A 3GZNA 4B43A 3RYTC 2FCRA 1RC8A 3T7RA 2PMEA 5BW8A 1TJ4A 2IHTA 1T0PA 2PT7A 3U6DA 4G1MB 4QAQA 5BN5A 5DHQA 1QNLA 2L6OA 3T3GA 3NDRA 4BB5A 2CXRA 2REQA 4KSBA 5KQPA 3UHFA 3PF8A 4AY3A 3BIWA 5K8UA 4F3NA 2TMYA 2Y2VA 3TTWA 1ZD5A 1T3TA 3LKVA 4O1IA 3THXA 3NHWA 3KQLA 4J90A 1QHSA 2A3RA 1P72A 1Z3IX 1II8A 2B5WA 5EPUA 1A69A 2NTJA 2P5TB 4PCVA 2G3QA 1A2KC 1UBNA 3KEGA 3VR1A 3DFKA 3CH6A 1XNQM 2LVPC 2B0CA 3HKBA 4I2NA 3HLYA 4KC0A 3G0GA 4B4WA 1ZMOA 2O4UX 4A36A 4N18A 1ZVMA 3FZYA 1ZW1A 3RTDA 1Z5VA 1OFTA 5JNLA 3CIFA 1KJ9A 3WTBA 2CZCA 1CYEA 3U61B 2DENA 1WSBA 1J22A 2Y0EA 2AG5A 4D7AA 2Z08A 4XXHA 2MYNA 1JEAA 2BH9A 1G64A 3GOHA 3PDCA 4AQDA 1KH3A 4QXAA 3R76A 1WETA 4HQ6A 4POOA 2JGMA 1YQDA 3ZD9A 3W2HA 5BURA 3FW1A 1XF9A 1P7WA 4I55B 3SJUA 2XJ4A 3VSCA 5LZ2A 5AK4A 1A9XA 3V7WA 3FPCA 4M83A 3IKLA 1W36C 3MA0A 4K28A 3OAAA 1O4WA 3D8HA 3LJKA 3N0RA 5KQMA 3LBIA 5FYDA 1ACLA 2AOUA 4B17A 1RWKA 4BX0A 4F84A 4UD2A 1NJ5A 3MQFA 4XM1A 4BWGA 3AVWA 3GQ3A 1XR3A 5T4HA 2JLAA 2VPXA 1VKOA 4YUVA 1S01A 1N57A 4R5HA 3LA6A 1QH1A 1GUDA 3MILA 5HTOA 2HAEA 5LYJB 3C5CA 4PAWA 1MC4A 4UFPA 3TCXB 1UDAA 5GGYA 2HRRA 1B0AA 1BH2A 1CF4A 2RGOA 4CV3A 2I66A 2EKZA 3CR8A 4CL3A 1WL8A 4LE2A 2BGMA 4HD8A 2REOA 3HRHA 3UWKA 4EPWA 4AKEA 2BY4A 2V1UA 1ZL2A 5LZ9A 3A2MA 1Z18A 1NP7A 1YB7A 3DMYA 4CPDA 1ZGJA 3T7DA 5DPMA 2GCPA 4C29A 5HS4A 2AQKA 2Q9AA 3N86A 1ZI8A 3HB5X 4WNAB 1NVKA 1R9GA 4I8DA 3EGOA 2VJKA 1WXQA 1PNRA 1OLOA 2R5NA 1ZRSA 1X87A 5ALVA 1C41A 5ESRA 4ZYTA 2VUIB 1S2LA 3EZXA 2XMDA 4KREA 3A42A 3SP1A 1I30A 1WD7A 2CKDA 4FB5A 1X8XA 1WA5A 5D6OA 4MP8A 2G7MC 3IT0A 1COWD 1Q39A 3GFVA 2WAAA 5IZ7D 4DCPA 3MGAA 1HG0A 4A0FA 1LFDB 3EHEA 4IMIB 4YRRA 4P32A 5KOJB 4L0MA 3QNUA 4GAEA 1TQ8A 5AHXA 4LK2A 2NW6A 4QBFA 1M5UA 3D0QA 1DAHA 3PX3A 3BD7A 1PL6A 3H11A 2WIKA 1OASA 4MWGA 1WU7A 3QHPA 2YDXA 1U04A 2B30A 1X7WA 5AKIA 1SCKA 4R83A 3TSAA 2E85A 3CVUA 4X63A 3ASVA 1E98A 1YCDA 4OHCA 2D00A 3TZLA 2I7VA 5C9ZA 3LUBA 4OFBA 5JBNA 1XQ1A 3ZY5A 2PTHA 3L1HA 2IBMA 1Q0LA 4G23A 2WKPA 5EJCA 2GYUA 2O2CA 3TEMA 4KGZA 3HCDA 4WUTA 4BFLA 1TEVA 5LP6B 3BGWA 1DO0A 1TC2A 4HDKA 3EXIB 4K9PA 1U5BA 3OFJA 3ZUPA 3I92A 3G7NA 2E4ZA 3LYHA 2GFQA 3R6DA 3E5NA 2L7HA 5TQVA 1U0EA 4DIBA 4NMLA 4C4OA 2ZRGA 1Z0KA 1G19A 1ZAEA 3IOBA 1S2OA 4RH1A 1QKJA 5EHXA 1EX6A 5HP4A 1E7QA 1TAQA 3ZU3A 2Y6UA 2PRKA 1XKLA 2G8LA 1N6IA 1EXMA 3KQMA 1D07A 4H6VA 1L5ZA 4B4DA 4EJ2A 3I28A 4TTVA 1AQUA 4JWKA 4O8ZA 1MB2A 2NSYA 2QVCA 5HRAA 3NRBA 1ZJ6A 1Y9AA 2OWDA 4E3ZA 1QF7A 2RK3A 1H2WA 3HM2A 1R5JA 2EW1A 2XCOA 1FFHA 4TRNA 1TU0A 5K0CA 3OQIA 1CQIB 3NP7A 5BQPA 2Q3LA 5J63A 3CPJB 4FHDA 4EMBA 4QJBA 4JLDA 1CVIA 5TPZD 2VYVA 4XWGA 1AY0A 2EFYA 3IO5A 2G04A 4RMIA 1NNI1 3QVUA 3KL2A 2JAWA 1TF2A 1FS5A 3GUHA 3D1VA 1D0VA 1R00A 1NBIA 2HV8A 4DXDA 2VKQA 1OWPA 4UDOA 4NBTA 3SJZA 1G6Q1 3E3LA 5EMHA 4O0LA 2E3JA 4N03A 3WWCA 5C81A 1CUBA 4ZEXA 1KAEA 1EGVB 3VPFA 1R4NA 4BNDB 1HE4A 4EI7A 4S1VA 3IGFA 3KEMA 4M53A 1FFGA 4MEJA 1U8EA 4ZYWA 2GB4A 2HWJA 2KEBA 2PX2A 4WK2B 5A7GA 5IMSA 2QTVA 5E4JA 3GLQA 3Q2IA 1DXYA 3E22B 1K9SA 4OATA 3AW8A 4X6YA 3LP5A 2PKXA 2QMHA 1GT6A 4C7OB 3TE7A 1G5RA 1JLKA 3GA0A 1YQUA 4CL0A 3ICWA 4QYIA 4N5DA 4Y67A 1KYIA 4JUDX 5KAPA 3ZVRA 4P31A 2Y9PB 4DDWA 3UCXA 4L5YA 4EAAA 2XLBA 3Q7PA 3KW6A 2TMGA 4IXTA 3QKTA 5JC1A 1E7SA 3C5EA 1NF8A 4ALNA 3KZOA 1Y33E 2UZIR 3DMNA 4E88A 3M89A 1OHHA 1KSGA 4DQVA 1L8LA 1ZEJA 2FMXA 3LKZA 1GRRA 1T26A 3LK6A 4V0NA 2GXAA 3GZTB 1HFJA 4JGIA 1ZK1A 2G0NA 4YJHA 3UUFA 1DUVG 1PYGA 1ZJWA 5EJ8A 4C7JA 3TXAA 3MRVA 2QTNA 3BTVA 3KHUA 4MQ6A 4OHXA 3PC8C 1II0A 4PAOA 1UKBA 3RODA 3GJRA 5AUOB 4RANA 3DT6A 1KR5A 4HEHA 1YH3A 2EHDA 3IRVA 2AG0A 1SH7A 1N6LA 3DO5A 4G0XA 1P3JA 5L3QB 1E7WA 2QIOA 3RROA 2WZQA 3OQ1A 4RXTA 3WWPA 3EQ7A 4CDNA 3D3WA 3BCRA 3FNQA 2QN3A 3W68A 5G4KB 4PPGA 3SQOA 1P1HA 3IMGA 3MK6A 5DRTA 3GJ3A 4QYXA 2J7PA 4YJDA 3MCVA 4PY2A 4FOTA 3UCEA 1GZ4A 4RSGA 2BOVA 2HMUA 3I3SR 1A9OA 4MEBA 2QRLA 1I7QB 4UNPA 4EZBA 4PAQA 3V4FA 3H2YA 2PMCA 4DWOA 5IVHA 5A5VA 2V6MA 3SZ3A 1CS0A 2NU8B 1URPA 1TM7E 1DAIA 4B3IA 2GO1A 2FPGB 4Y7CA 3W6PA 4DQKA 2VVTA 2IWRA 1VPDA 5GONF 1JEQA 3R6LA 1GCAA 4QYMA 1K68A 5BMVA 3K70B 1SN7A 1J0BA 4FQ7A 1TK3A 3OEHA 1T1SA 1IL0A 2QOEA 2RK6A 2OCLA 3G8BA 5ESXA 5B6JA 1E2UA 1NNUC 4ZC8A 4PFSA 2CF6A 1AQJA 4ZI7F 5E26A 1DC8A 4Q47A 1H1TA 4FNOA 5CFRA 4A6PA 4JELA 4AZWA 4XPIB 4U7PB 5HFNA 1BMFD 3V8QA 2H4ZA 3FMGA 1ADJA 2IKQA 1NASA 3NDIA 3PHCA 2PZFA 5DXAA 1DAGA 5G40A 4BO9A 1Z2DA 2NZWA 4KNVA 3W7VA 1UM9A 1VE5A 1KZ6A 1E8MA 3D6AA 4B6GA 1XN1A 3TTTA 5BVGA 2IH2A 2SICE 5DM4A 1U9IC 4D42A 2EKKA 1ZISA 4HQKA 3ML1A 3EZLA 3SYMA 4EGCB 2WUGA 3ETJA 2I76A 2ZBVA 4LPKA 2F67A 3IIIA 4MQ4A 4GD3Q 2YUTA 4P38A 1Z2NX 3BHMA 3QF4B 3CLUC 3ND7A 1K6MA 3H9QA 3H6KA 1KHTA 5AI8A 1JKJB 3QIAA 3LX6A 3FUTA 5AM2A 4IRMA 4HQRA 4RD0A 1MX1A 2R4QA 3LQKA 5KYXB 1VTKA 1JHVA 1VMIA 3RS4A 4C6RA 4AWXA 1EM8B 3DDHA 1R6TA 1FYDA 3EGXA 1ZA2A 3OM0A 4KIWA 4MP3A 1W5SA 1WX1A 4ZP1A 3HNRA 3KLNA 4BIMA 4Z4HA 4PU0A 3GT4A 2JAXA 4OHYA 2ZUBA 1E0JA 2IW3A 4AY2A 1YZFA 4DCVA 4C3ZA 2GK7A 1U0TA 2HGSA 4PQGA 2I7DA 4ZCTA 2V1CA 4QFDA 2G70A 1E2QA 1KE2A 3DAYA 3BWEA 1IQPA 4BYGA 3WL5A 3WNQA 4KFUA 1CJTC 1FUIA 1IZ8A 3TYXA 1AV6A 2YXEA 1RLMA 2R4JA 4KWIA 5BSWA 2VQ3A 2NP6A 3BB3A 2TECE 1VLQA 3BXWA 1OREA 1KI3A 4HQNA 3UK6A 1WMDA 4GFDA 2YYSA 4WPGA 4I6GA 4D8XA 3R5HA 1H94A 1EYZA 3W1WA 3IP6A 1GNVA 2CMKA 5LLDA 5DYNA 1CJCA 3S1LA 3KALA 2PZBA 3G1UA 4OXRA 1N6PA 4FFBB 3QXXA 5TB5A 3TFOA 3TNYA 4C20A 1VBNA 4NNOA 2GT1A 3KQVA 3FTQA 3RFCA 2GBIA 2OOKA 1ZNYA 2RKBA 2FPSA 2B1JA 3RUAA 3DTVB 1NJ6A 2DMRA 4RJIA 3L92A 3DUWA 1EB8A 4LZLA 3DZCA 1XAJA 1DP4A 3G6WA 1EVQA 1Y1SA 1FUUA 1M8KA 1IM2A 4E5YA 4UKDA 4C6TA 4ITVA 1MN3A 2H59A 3QELA 4FYXA 2O5EA 3QUCA 4RZ3A 5J3JA 1YUMA 4Y30A 1SXJE 2NAPA 3LPLA 4M0KA 4NF2A 3O1IC 3ZYZA 2B0JA 3Q8LA 1LY1A 1W5BA 3KSAC 1P0IA 1WBDA 3W4JA 2ZRBA 4FHCA 4KJZA 3CO0S 4UC0A 1USVA 3V8MA 1W9MA 2C2ZA 3T6PA 2IA5A 2VEDA 3CZCA 3G9XA 2CXOA 4HVAA 3OJOA 2JKVA 3X1JA 4QOFA 3TGPA 4B4VA 1LS6A 3BQNB 4EHKA 4OAPA 5DI9A 1X38A 4JT2A 4WA7A 4EPRA 4JVNA 2AQIA 4DQUA 3TZEA 2KI5A 2CDCA 4EITA 4BOYA 3SHTA 3PQCA 3ZR4B 2D5AA 1XPJA 4BZZA 1DWUA 3X2SA 1RYYA 4HL4A 5CBKA 2C95A 2FPLA 1ZUD1 2XVZA 1IH8A 2H3HA 3ZGXA 421PA 3INNA 2O07A 3GCDA 4RGYA 3LLUA 6REQB 4YDQA 1LVHA 1M2WA 3HH8A 4YJ2B 4RCVA 5JBQA 2IT1A 2Q6KA 1YIAA 2J0UA 3OJCA 1DRVA 4UPEA 3RR2A 4EMUA 1ST2A 1CQZA 1AV7A 1JHXA 4GKAA 1KAGA 3HY5A 2WAYA 1EVYA 1JHQA 2FDXA 2FPPB 2ZSDA 4OOFA 4NR0A 1L4FA 5IAOA 4B3XA 4BC0A 1Z2EA 5BQOA 1DPGA 2YNMD 2C2WA 1FLDA 3EX7C 1Q7RA 5COAA 5BV0A 4UE3S 2XVXA 3ZHTA 2FW0A 3NHYA 4OHWA 2O8CB 1ZOPA 3UK2A 3WIBA 1OX5A 4RK7A 4K9MA 1YB6A 5K7SA 2J33A 2Z57A 2WTEA 2IPMA 1DOAA 1OV4A 5H9VA 1CRQA 3GMSA 2LH0A 1VSQA 1OFUX 1PWEA 2WSBA 2WSLA 3DZBA 4ZK6A 1E7YA 4Q39A 3FSJX 2C3OA 2L0XA 4IYJA 2CFTA 4BFTA 3FHJA 5J4HA 3QUBA 1NYRA 3BQMB 4HS4A 5IZ4A 1N25A 1AOXA 1JALA 3DTNA 1LFAA 4BCCA 1THMA 4ZMRA 3NDBB 1JHYA 1EINA 3T4UA 3U39A 1K63A 4ARZA 1ND5A 2JY8A 3S8MA 2C7VA 1JRLA 1RI4A 1RHJA 3F6EX 3OFND 2O8FA 1FJHA 3KQQA 1UDCA 3A7DA 1KK3A 1FNCA 3PRJA 5ELLA 3PE3A 5BR1A 3PGMA 1N5DA 3MCWA 4K6CA 3M1LA 4GE3A 4U4AA 5IXSA 2ECOA 4D80A 2IRWA 4NRDA 1CJVC 4RVHA 2ZYDA 4DANA 1OBOA 1VJCA 2W5UA 5C7YA 2BZSA 3PE4A 1DEKA 3S2IA 1D04A 2Z58A 4FNAA 3C98A 5JXWA 4BVHA 2CLOB 3KUXA 4CYMA 5B3JC 3QVLA 1D2RA 3BBPA 3O3NB 4RXMA 1GCOA 4BP3A 1DMRA 2VH2A 2P41A 2PWPA 5FOXA 4FNGA 1FS4A 1UXJA 5FLYA 2Q28A 3OBIA 3LYLA 4L8RC 1VG8A 5EJFA 4DPKA 1JHZA 2F9LA 2CL5A 3SNHA 2GA9A 1OFGA 4DEYA 2VTBA 4KQKA 2ZR0A 3B85A 2RGYA 3ST7A 3IUNA 2ETXA 5M3BA 2QAGA 5K3CA 3T0GA 1CJUC 1KGSA 2YVKA 3QYFA 4RFLA 3JSAA 1CU1A 1E2LA 4Q34A 3GPUA 4PE5B 1RRFA 2DFPA 3TMAA 2XD9A 3W8EA 5A6SA 4NXNB 4MW0A 3ORRA 1F1JA 4O5AA 4O4JB 4PINA 1U2TA 4LIPD 4RZIA 3HJGA 1MAAA 1P60A 3UJHA 4B81A 1E9FA 1IXKA 3K0AA 1RYEA 2VIIA 2COKA 3BRWA 2A7XA 1REQB 3FJOA 4Q48A 3ADCA 3TIVA 2YR0A 2HXSA 2QRQA 4WLVA 1NY6A 3C2QA 1CUEA 1SEVA 4CF5A 1EESA 5JJCA 1QLJA 1PWZA 1IC6A 3ICEA 5JEDA 4GBED 1Y1KE 1K0UA 5A1JA 2KLHA 2C8LA 1D5WA 3GAMA 2BSQA 2AMYA 2FWAA 2B25A 2HBZA 1CYDA 1W76A 1CWUA 2WJIA 4L07A 1I1OA 2UXCM 1CFJA 5HIAA 3ADKA 3BF8A 2IBSA 2DKNA 3BK2A 3IERA 4K1XA 1DC3A 5JAIA 3CE9A 5GIPE 4E1AA 3G59A 1YSYA 2RCNA 2CB9A 1E79A 5EWJB 4OFWA 1SVSA 1DT5A 1JG3A 3I9MA 3ZDDA 3LCJA 1TEZA 1RHUA 2R8OA 5AXAA 1UODA 3T1YB 4K6OA 3VPAA 1KVSA 5CYPA 3QF7A 5KWVA 3UGTA 2WJJA 4UZEA 4AMUA 5MN6A 4B5KA 3B7ZA 3HX3A 2J9FB 4DDMA 4CGYB 3M8KA 4CN9A 1ISIA 5F7XA 2XUHA 4RMGA 4EYGA 4ZCMA 1PR6A 5ESWA 1JX6A 2BWEA 3G6KA 3C1UA 3L26A 3MUEA 5EFZA 1PV1A 2RCYA 1GA4A 4TS1A 5FBZA 3KK0A 2OZLA 4TSFA 4DPMA 1LNQA 1SKQA 1A9TA 5JH7A 2YV4A 4JODA 3ROEA 1QYWA 3B7GA 5SZHB 2WSCF 4RAOA 2A9OA 3M1YA 3QPBA 5JAUA 3GZ4A 3DKKA 2R6HA 4BMZA 4BN4A 1NW7A 1EGMB 2WHRA 3KTFA 3NBQA 2GZ3A 1A8PA 1UEJA 5FNVA 3NBIA 1HE1C 1P0CA 1E6CA 4AG5A 1A5AB 3U6MA 2ZSKA 1S8OA 3LXUX 3H75A 3OLCX 1C3JA 4DR6M 2H9YA 3EZ9A 4RFSB 4EYSA 2VUSA 1WB9A 3RVJA 1YHNA 1PVDA 5JT1A 1UXKA 1RZUA 2IOFK 5AD1A 1Z5NA 3GEDA 3S7ZA 4QTXA 1CULC 4GC5A 5CVTA 4FPXA 1MG5A 3EEOA 2VJAA 5EGSA 3DE0X 4OHOA 4ZRNA 3FPFA 3DFMA 3O3MB 1QOZA 3SSMA 3ZGVA 3D0OA 2P6UA 3X0DA 1E3QA 4JVMA 4FYYA 1O94A 4WXYB 4DCOA 2DLNA 4HUQA 4O4LA 5JBIA 2C07A 5BSHA 1NJ2A 4Y1RB 3HR8A 1WTAA 1T8UA 5AVVA 2O5VA 1EIJA 3MSCA 2DBRA 4JBNA 4TGLA 4BGIA 3LXXA 1WZ2A 2B4QA 1HDRA 1ZJJA 1E7RA 1SCBA 1TCVA 4HLNA 2RGXA 3I42A 4RABA 3ZK7A 3JALA 4EECA 3TE6A 2A5YB 3DSRA 2AF3C 3OTOM 1W4RA 4R31A 2HQRA 1QDUA 3SS9X 4P4LA 3T3HA 3VR4D 4ALIA 5CW2A 3DWIA 4Z8YA 5EQDA 1JZTA 5A4MS 2EQ5A 2OCYC 4EKEA 3BH0A 4E30A 1T8YA 4O4IB 4OX9Y 3RSSA 4DUYB 4KXLA 1SWVA 4TKMA 5JJLA 1FMCA 3NC1C 3HBFA 1Q0UA 1WULS 2N42A 3VZQA 1G5FA 4GM4A 3V4VB 4MWEA 2RH5A 3KVOA 1F8GA 5HCIA 3PT5A 5F2EA 2P5UA 1N2CA 1J0DA 3HU1A 3DT8A 5KYUB 4R8KA 2MSCB 2ZIAA 5GVSA 5JHHB 1WD5A 2FPMA 4MIKA 4FI3F 3JWGA 1U2RA 3L8GA 3KS9A 1JG7A 2Z43A 3DJFA 4LFAM 4CF3A 1A71A 1H85A 4JJFA 1SD5A 1BKSB 2JI4A 4HKTA 2QDXA 1MHPA 4S2UA 3F5DA 1XK6A 3DYBA 2L42A 4MK4A 1TFRA 1H6CA 1BWPA 2IXGA 4D96A 3DEAA 1Y5RA 4CQMB 3JYNA 4A91A 4U9UA 1ZOSA 1S2IA 3QYBA 4EUSA 2OENG 3RFUA 4L0CA 3PQDA 3OECA 1SAYA 4PN7A 3GFGA 1VLVA 2ZSIA 3HCPA 4WUVA 3G5AA 3LP8A 4J29A 3GGGA 3ND8A 4HH0A 1CUHA 3TF5A 4LJ7A 1AC5A 3NWBA 4UNSA 3SLRA 3HN6A 3UQYS 3BOSA 1F2DA 3PWKA 2HPVA 4RTSA 2X4IA 2AF4C 2VJMB 4MWDA 1KEUA 2C83A 4H7DA 1IHPA 7REQA 4Q3EA 2Q5HA 3RV4A 3PUYA 1XNHA 4U2DA 2HN9A 3KKPA 5HZHA 5C3MA 1IIBA 1ZBDA 3ZZUA 3OO0A 2LWIA 2CL0X 4NBKA 4IR7A 3INYA 3P2JA 5JEEA 2DKOA 3ELDA 3SATA 3QQ5A 4M1OA 4WKOA 1U2EA 3B9PA 3LXMA 3VYTB 1PF7E 2NSDA 3KSJA 1Y8ZA 2I99A 3TZKA 4XYGA 3EDRA 2IEGA 1RSZA 3BSFA 2OT3B 1SUEA 2DFVA 4IRXA 3LSTA 1Z6TA 3FLEA 3INTA 3TLCA 4BNKA 3M4XA 1KU6A 1MFZA 1TM2A 2DSNA 4UMFA 1SA0B 4AF8A 4B6PA 1KYTA 3E7WA 5LZ8A 5CB6A 1DV1A 1D1QA 3FUXA 2AFHA 2WABA 1M10A 3QPDA 1LTHR 1G5QA 3THGA 2VSOA 4AKHA 4W5TA 4QA9A 3FYUB 1FRFS 2YFHA 3O95A 4LDPA 2BD0A 2PUGA 4BFSA 3OCWA 1T2DA 1Q14A 1DKQA 3GJSA 4I1IA 4AJEA 1BQ3A 4D0GA 1Q0PA 3AR2A 2Q2EB 5AK0A 3EFBA 2OAP1 2YCLA 1LJ8A 3D7LA 1M5RA 4L8WB 5J9FA 4PLYA 5DWQA 4V1CA 3AB7A 4B45A 4G5HA 1XMOM 3FPGA 4Q66C 2QNJA 3ZW7A 1P4AA 4MKXA 2VDVE 3CZRA 4P5PA 3A1WA 3R40A 2FK7A 1Q7TA 5SICE 1FIUA 3I01M 2I8LA 4ZHQB 4L08A 3Q3HA 2Y0QA 3VDUA 1Z28A 2VP6A 2MR6A 1GAEO 5J2TA 3HKDB 1AK2A 3CCFA 3FKSA 3AUSA 3W90A 4HZGA 4NYIQ 1FYFA 4ZYXA 1GNTA 2A3NA 1AN9A 3HCCA 4FE7A 4DVGA 4RHYA 2XYGA 1DGFA 2JBWA 2Q1XA 4E4RA 4NENA 1YDHA 1Z22A 3PDIA 1RR6A 4QBTA 5ALIA 2MWMA 3BX1A 1KZ9A 3UGQA 5CM9C 3G0DA 2WMDA 4KPUA 2C9DA 4KAXA 1O87A 1C4KA 4GEGA 1RJWA 1ONBA 2VZLA 3AB8A 3I8OA 3LXRA 4BHTA 1YTUA 3IDSA 5KSWB 3HK2A 2FSVA 3QBVA 2DH5A 1WIVA 4LSGA 2ORWA 4W63A 1E2EA 3VDNB 3G0HA 1LLQA 3ZI7A 2AK3A 3KSDO 2NOAA 1HFKA 3IP8A 1O95C 1HSOA 4MLZA 4C22A 5K0TA 5I9MA 2KQUA 2HPHA 3NV9A 1V11A 5BV8A 4ZV7A 1QQBA 5D7NA 4BNNA 2EW8A 4YRTA 5CDTA 1LRLA 4LQDA 3IE1A 2ID7A 2ERCA 1Y6FA 5F35A 3FVWA 4LWPA 3CS3A 3ZS9A 3MWDB 1R1DA 3AUUA 3EIUA 4TXNA 2Z8YA 1JB9A 5KNBH 3O21A 2V0NA 3H5AA 4CLRA 2D1TA 4JR0A 2WLSA 4JI5B 3HB7A 2OTCA 2PEZA 3FOAA 3E61A 4GPZA 1DBPA 3IPXA 3BRCA 2PPVA 1J49A 1SO8A 3SYRA 1AUPA 3AW9A 1U1GA 2C61A 2NYVA 1WCV1 4Y2UA 5YASA 2R11A 1JSRA 1E3TA 2K7ZA 4JKYA 4X97A 2BFBA 4OJNA 3X2FA 2X0DA 1FU8A 4UULA 3UJ3X 5E4FA 1H4VB 4NCNA 2W11A 2H16A 1XZHA 1CZKA 2B36A 1I4DD 2GHQA 5CH8A 5DN9A 3EODA 1NUUA 1FZQA 3A1UA 3AEYA 3CLTC 3C3EA 4MIOA 5TC4A 2AUTA 4L5CA 1ENZA 3JQAB 2FN9A 1V0JA 1I2ZA 1YULA 3KBOA 5KYWA 2DWQA 2WWHA 1U2DA 2A94A 1W4LA 2VATA 5AI9A 4WLUA 1WHCA 2GZ1A 3CXUA 2EKLA 3TSOA 2XYVA 3KAJA 1DV0A 3D8LA 2QS9A 4LXIA 4A1OA 2VNHA 4IFBA 1C7ZA 4CKWA 4LY3A 1QBGA 4ZEVA 1CD5A