1NHGC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 17
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nhgC00
1NHWC 1NNUC 2FOIC 1NHGC 2NQ8C
chains in the Genus database with same CATH superfamily
1DGHA 3KOWE 3L28A 4IBGA 5EXTA 2QSFX 3QAUA 4GHLA 2EJSA 2OOAA 5JI3E 4JI1M 3FYDA 3GQ5A 4LY6A 5E26A 4MGHA 5FTNA 2KA6B 2V1UA 2M60A 1IXRC 1LTMA 1XHBA 3IHPA 3CGWA 1WHCA 4CGYB 3T1YM 1E9SA 1YE9A 1SG9A 2O01F 2XEPA 3FUVA 3LMMA 3LVWA 3PNYA 3HJQA 1DGGA 3RGPA 5KPRA 3GRYA 4MH0E 1VEJA 3IG8A 4JI4M 4ZPXA 4AKIA 4NOOB 4X64M 4B7GA 4DR7M 1MU5A 1L1TA 1WXQA 3U60B 2J7OA 2KHHA 4P16A 4LRSA 1X37A 2FNAA 3GLGA 4DV3M 3L25A 4FWDA 4RNAA 5EXSA 4OU7A 1JR3A 4G4OA 2F5SA 2UXBM 4IJEA 3U6DA 2R44A 2LTUA 1WGLA 1Z5BA 3NWLA 2K0BX 4G4QA 2KZUA 4G4NA 2DXIA 1KSFX 4FCVA 1YUBA 4DR3M 1DGBA 2X49A 4DR1M 3JAMS 2CFOA 4X66M 4F1IA 4AKGA 2X4AA 2KDLA 4WURA 2DNAA 2OQ4A 1RU3A 1HR0M 1ZMVA 1IQPA 4JXJA 1QVRA 4XGIA 5KQDA 2JZ0A 3SFZA 1GKIA 4AI6A 4WW0A 5EP3A 3WHKA 4AW4A 2XF3A 1MN3A 3CF2A 2MH8A 1A5TA 2FE8A 4JI0M 1Q39A 2CP8A 5A2QS 3E4RA 2G3QA 4RF1A 4LFCM 1Q3BA 2EKKA 4CHTB 4DBGB 3U61B 1N34M 1L1ZA 1D0LA 4IBEA 4D80A 3MJ5A 5ITTA 2LVPC 1PJQA 1KYIA 2WSCF 3HHWA 4LJ6A 3GQ3A 3FUWA 1NHGC 4W5WA 4AZFA 3L26A 3HU2A 2R4EA 2KRUA 2XZFA 1JB0F 2HL7A 3J7BA 3U6QA 3RFWA 4DR6M 2I7NA 4PDIA 1HNWM 1JQJC 3NBXX 3U6LA 2CV0A 2Z4RA 5JI2E 4B3RM 1QUSA 2DHYA 3BXWA 3IG5A 4ANRA 2L09A 4YHHM 3M7GA 1C1KA 3HHXA 1TH2A 4R7GA 1QANA 5KQ8A 3KVWA 2JUJA 1PRBA 2Z8YM 2MJ5B 4L15A 3UJNA 3HHYA 2FH0A 2QHOB 2QQ8A 5LMUM 1OAOC 4DR4M 4JYAM 4GMQA 2OOBA 2D7GA 3B89A 2XH9A 2CHVA 2DZNB 4KT0F 3T1HM 3U5ZB 1G4AE 2JY8A 1IXZA 1WR1B 3FUXA 2UUCM 3KFUG 3U6SA 4G6ZA 1IXSB 4B3MM 1WJ7A 4OW0A 1XXHE 2RGOA 3HY5A 3HZJA 5ITQA 2XLJA 1F4IA 3UGJA 2DAEA 3LCVB 4LF8M 2MGWA 2VIIA 4NXNM 5FTKA 2MR9A 3A45A 1XC8A 1SXJC 4CISA 1YLAA 1R2YA 4I5SA 4L78A 4NSRA 1ZAEA 3I4YA 4KLNA 3U6MA 3HWSA 3R9XB 2KNVA 3DOAA 2APLA 3VK7A 3SYKA 2L4FA 1PJIA 1J09A 1TGUA 1VEGA 5IZ7D 1IFYA 4MGYE 2K6BA 4DR2M 2XZUA 2DI0A 2H5XA 1T43A 3HGIA 2VDBB 2D7EA 2QPAA 2KXEA 3ZH9B 3KSJA 2Z7JA 4BB9A 4I81A 1IN8A 5L8RF 1GVNA 1SXJE 1R7RA 1P3QQ 1LV7A 1ZV1A 3D8BA 2DZOB 3JR4A 3K1JA 1IXSA 2HHHM 3SYLA 2J5YA 3FYCA 3GLFA 2A5YB 2BJWA 2EA0A 1NY6A 3Q8GA 2E5LM 1GLNA 2XFSA 3CTWB 1J5EM 3U6OA 2C9CA 2DWZB 3HKPA 2XGNA 2LVAA 2KZSA 4HEOA 1G8PA 3J2PB 2CUZA 1QDTA 4LJ7A 1GJTA 1Q02A 4QNRA 5FTMA 2DWNA 1QAQA 4LGMA 2C99A 5IREB 3HHZA 4QHSA 5EP2A 3LQRA 2KNAA 1NV8A 4FWGA 5EP1A 3THGA 2LNHC 3T38A 3DZDA 2VF7A 5ITXA 2N35A 2R46A 2X8AA 1WIVA 4GRIA 3ZCBB 2LBCA 1PM5A 1XXHB 3M0EA 1L8QA 2LVOC 1I94M 2KRKA 1T3TA 4KO8A 3T15A 4JI7M 3GQ4A 1QUTA 3AJIB 4IBJA 3GRVA 1UFZA 3BOSA 4MB7A 2BWBA 3TL4X 5FLXS 2GNOA 3HU1A 7CATA 3W0FA 2QBYB 5EXXA 3FD9A 2D7HA 2LXEA 2CE7A 2L7HA 4M9ZA 4RKUF 1BVSA 3LVVA 1PGYA 2JY6B 1ZMUA 1V92A 2EUCA 3VDUA 3GLIA 4P17A 1IBLM 2YR0A 1SXJD 2ZAOA 2GQFA 2JY5A 2CWBA 1DGFA 1VEKA 3GPXA 4IJFA 2ZM6M 5LMNM 2CHQA 1HT1E 2CHGA 2Y20A 3A46A 3R8FA 3LCUA 2R45A 3LW5F 3VKGA 1SXJB 4G3OA 2DWMA 1QDRA 3SATA 3SMPA 3SAVA 3GPPA 3GLFE 3SASA 1J7KA 3AOEC 4XBOA 4GH9A 2M5ZA 2VQFM 3KW6A 1XXHA 4YY3M 3SARA 4K0KM 1HT2E 3MHVC 5F3WA 3SC3A 4GEWA 5ITUA 1TF0B 4B7FA 4CIZA 3QYBA 2G8LA 2C98A 5ITRA 4HLQA 3SAUA 1QZEA 4MGKE 1R4GA 4JI3M 4IBKA 5ITXE 1PJTA 1NY5A 4M0DA 3EIHA 3TPZA 3GP1A 4AG5A 2FS1A 2FOIC 3J80S 1XWIA 4AKHA 1DO0A 1EFUB 1IN5A 2L4EA 3C3DA 3FKEA 3VKHA 2KW0A 5FSWA 2WSEF 1I4WA 4OX9M 5BPVA 1HQCA 5EQTA 1V33A 2YNMD 3BBZA 3PFIA 4DUZM 3C9PA 3W68A 1OKSA 4JV5M 1T6OA 1N36M 3ZQJA 4EIWA 1SXJA 1AIPC 4FWHA 4JI6M 2YFQA 2J7NA 3EIEA 4BBAA 2EO2A 3KP1E 4AG6A 2MROB 3GLHE 1NO1A 3E46A 3GLIE 1N77A 3B7ZA 4L16A 2R62A 2XFTA 1E9RA 4UN2B 5DYGA 1PJJA 4MGIE 1FJGM 1VDDA 3GRRA 3H4JA 4L4UA 2ZAMA 4KODA 1TTEA 2JXNA 4X62M 2JP7A 2UXDM 1D0KA 2DAKA 1XMOM 3GLFB 2DVWB 1MJGM 5EXPA 4IBDA 3J27B 2EKFA 3V76A 3J7AS 1EE8A 2WSFF 3VDPA 3GPYA 3JR5A 3VK8A 3I4VA 1L2DA 4DV4M 2I7PA 4PDGA 1OTRA 2NQ8C 1E94E 4NRVA 4GC9A 3GPUA 1D2NA 2JWSA 4LFBM 1GJSA 3H4MA 1C7YA 1NJFA 1L2BA 2G5GX 5KO3A 4D81A 4ITQA 3TWMA 1NV9A 1OAIA 2AHMA 4IBCA 4M0WA 4LZJA 3K8ZA 2V6ZM 1OQYA 4QHTA 1VDLA 1K3XA 2C9OA 4LJAA 1HQYE 2QP9X 5IWAM 4FVMA 2UXCM 3DA1A 1VQ1A 3GO8A 3AKZA 2HCBA 5E6JA 2Y21A 3PVSA 3QWLA 4MM3B 4HL4A 1CUKA 1NHWC 1IN7A 2ZTCA 3D8LA 3GLHB 4LJ8A 3GLIB 3PNVA 3B9PA 3KS4A 3MK6A 2CV1A 1S3SA 1W5SA 1TH4A 4KHPM 3U6PA 4QOSA 5EP4A 1XNQM 3B74A 2BWEA 3KDSE 1ORYB 1N32M 4PT5A 2WZJA 2HKJA 5ITYA 1R6BX 1XB2B 3SHFA 3FRIA 3UK6A 4TUWA 3T6PA 1DO2A 2HWJA 1D0MA 4IIWA 2UU9M 3C58A 2Z4SA 4LF5M 3U6CA 3FTFA 3AOEA 1Z5CA 2HAKA 2LVNC 4LJ9A 2LVQD 3K9PA 4IBIA 2R6FA 5KPTA 4Q7JA 2O5RA 1R2ZA 2JZ1A 4GKJM 1GL6A 2L2DA 2V1CA 4MGZE 4WP2A 3ZC7B 2P5TA 4XK8F 4G4RA 2VQEM 3K2LA 2W82A 5BR8M 1H6UA 2UUBM 1GO5A 1OFHA 3W67A 5DFLA 3FTEA 3VLFB 1UM8A 3GLHA 2QBYA 3FUTA 2DWLA 4LCBA 1K82A 2DKLA 2DAIA 1OJLA 2Y0TA 1NNJA 3A42A 2F5QA 2L6OA 2CV2A 4FCWA 2F5NA 2ZTDA 1IY1A 4I8OA 4QNMA 3VFDA 2LHCA 2BNKA 1Q3CA 2F4VM 2LH0A 3CF0A 2OPFA 2F5PA 4R3DA 1NJGA 4DR5M 2CEAA 3TWLA 2B3TA 2Z3XA 5EJCA 2K9DA 2R4JA 4B08A 5FTJA 2KEBA 3F92A 3B7QA 4OVZB 3TQSA 3SBJA 4LF4M 1Y8GA 3HJ8A 4GKKM 5H37D 3KS8A 1IN4A 3QYEA 1VG5A 2FFJA 3K9OA 4CJ6A 1FNNA 1N33M 4LG2A 3TE6A 4LJ5A 1EIJA 3SHGB 3ILKA 4B3SM 4LF7M 1QAMA 5C1BA 1YSYA 1PJSA 3HX3A 3KP0E 1N75A 2QZ4A 3KXEC 2C5RA 4GIPA 1Z59A 2QNJA 2VF8A 3AV0A 4JN6A 2DAGA 2DENA 3C3EA 4AQYM 3WHLA 4GHAA 2DZLA 4LJ4A 2ERCA 5IT9S 3IECA 1ZQ9A 3FTDA 3I01M 1NNUC 2Y0QA 4A3VB 3AOGA 3U60A 4IBBA 5GKNA 3OTOM 4NRWA 1W5TA 1E32A 4GC5A 3SMSA 2H1RA 3PXGA 1HNXM 3KOYE 4S12A 4PCZA 4DV0M 4F2LA 1IM2A 4LF6M 3M6AA 2JY7A 4OVZA 1ZMWA 4DV7M 1IN6A 1G71A 2XSZD 3FE3A 3KOZE 1XNRM 1HJPA 2RKOA 1DV0A 1NVMA 1IBMM 5DYIA 1XMQM 1G3IA 3GLGE 3E9SA 2KNZA 4NSOB 3B7NA 3U6EA 1JR3E 3DFZA 4B7HA 4Y28F 3L27A 4DV1M 4LFAM 2K47A 2DHRA 5FTLA 3RE8A 4Z6YA 8CATA 4II7A 1HNZM 2RRUA 2LHGA 3K92A 4PD2A 4QOZC 4JI8M 2RGHA 1KFVA 2BJVA 1Z6TA 3HJSA 5C18A 3FUUA 4DV2M 5DNYA 4DV6M 4B3TM 4L8RC 2CRUA 2LWXA 3AL0C 3FTCA 2F5OA 3U61A 3LQQA 4I4LA 1K3WA 1V34A 1TR8A 1L2CA 1QZMA 3L29A 4FW9A 2YQZA 3RGSA 3A98B 4DV5M 2JNHA 1TH3A 1QYRA 4M9XA 3I04M 2C96A 3UZUA 1G41A 4LZZA 3GRUA 3W0LB 1IY0A 1TDZA 2ZANA 4REZA 3E21A 3SAWA 1WGNA 4JI5M 4NL4H 4Z8XA 1DGHB 4FD2A 1GABA 1OIPA 1G59A 4JI2M 2JA2A 2DAMA 1QAOA 2XSZA 4M9SA 1IBKM 3UMMA 3Q8XA 1N78A 1MX0A 1QQWA 2Q2EB 3NBIA 1NSFA 2R65A 1OFIA 2R18A 1Z5AA 2OO9A 1IY2A 2QENA 3J81S 3MMPA 4RF0A 3KOXE 4L6V6 1JR3D 1TDHA 2R0IA 2L7IA 4FCTA 3HU3A 4IBFA 4R71A 4DUYM 2ZBKB 4BLCA 5KPZA 4LF9M 1AUAA 3GLGB 3U5ZA 3CF6E 1OIZA 4NC6A 3TWKA 3FRHA 2O25A 2UUAM 2QCUA 3AFHA 3KSXA 4X65M 3I51A 4LRTA 1GL7A 4GITA 4NXMM 4D82A 4LGYA 3L2AA 1R5LA
chains in the Genus database with same CATH topology
1DGHA 3KOWE 3L28A 4IBGA 5EXTA 3QAUA 4GHLA 5JI3E 4JI1M 3FYDA 3GQ5A 4LY6A 5E26A 4MGHA 5FTNA 2KA6B 2V1UA 2M60A 1IXRC 1XHBA 4CGYB 3T1YM 1E9SA 1YE9A 2XEPA 3LVWA 3FUVA 3PNYA 3LMMA 3RGPA 2UXDM 3HJQA 1DGGA 5KPRA 3GRYA 4MH0E 3IG8A 4JI4M 4ZPXA 4AKIA 4NOOB 4X64M 4B7GA 4DR7M 1MU5A 1L1TA 1WXQA 3U60B 2J7OA 4DV3M 4P16A 4LRSA 1X37A 2FNAA 3GLGA 3L25A 4FWDA 4RNAA 5EXSA 4OU7A 1JR3A 4G4OA 2F5SA 2UXBM 4IJEA 3U6DA 1Z5BA 3NWLA 4G4QA 2KZUA 4G4NA 2DXIA 1KSFX 4FCVA 1YUBA 4DR3M 1DGBA 2X49A 4DR1M 3JAMS 2CFOA 4X66M 4AKGA 2X4AA 4WURA 2OQ4A 1HR0M 1IQPA 4JXJA 1QVRA 4XGIA 5KQDA 3SFZA 1GKIA 4AI6A 4WW0A 5EP3A 3WHKA 4AW4A 2XF3A 3CF2A 2FE8A 4JI0M 1Q39A 5A2QS 3E4RA 4RF1A 4LFCM 1Q3BA 4CHTB 3U61B 1N34M 1L1ZA 4IBEA 4D80A 3MJ5A 5ITTA 1KYIA 3HHWA 4LJ6A 3GQ3A 3FUWA 1NHGC 4W5WA 4AZFA 3L26A 3HU2A 2R4EA 2KRUA 2XZFA 2HL7A 3J7BA 3U6QA 3RFWA 4DR6M 2I7NA 4PDIA 1HNWM 1JQJC 3U6LA 2CV0A 2Z4RA 5JI2E 4B3RM 3IG5A 2L09A 4YHHM 3M7GA 1C1KA 3HHXA 1TH2A 4R7GA 1QANA 5KQ8A 3KVWA 4L15A 3UJNA 3HHYA 5LMUM 4DR4M 4JYAM 4GMQA 2D7GA 2XH9A 2CHVA 2DZNB 3T1HM 3U5ZB 2UUCM 1G4AE 3FUXA 1IXZA 3KFUG 3U6SA 4G6ZA 1IXSB 4B3MM 4OW0A 2RGOA 5ITQA 2XLJA 3UGJA 4LF8M 2VIIA 4NXNM 5FTKA 3A45A 1XC8A 1SXJC 4CISA 1R2YA 4I5SA 4L78A 4NSRA 1ZAEA 3I4YA 4KLNA 3U6MA 3HWSA 3R9XB 3DOAA 3VK7A 3SYKA 1PJIA 1J09A 1TGUA 5IZ7D 4MGYE 4DR2M 3HGIA 2D7EA 2QPAA 2KXEA 3ZH9B 3KSJA 2Z7JA 4BB9A 4I81A 1IN8A 1GVNA 1SXJE 1R7RA 1LV7A 3JR4A 3D8BA 2DZOB 3K1JA 2HHHM 3SYLA 3FYCA 3GLFA 2A5YB 2BJWA 2EA0A 1NY6A 2E5LM 1GLNA 2XFSA 3CTWB 1J5EM 3U6OA 2C9CA 2DWZB 3HKPA 2XGNA 2KZSA 1G8PA 3J2PB 2CUZA 4LJ7A 4QNRA 5FTMA 2DWNA 1QAQA 4LGMA 2C99A 5IREB 3HHZA 4QHSA 5EP2A 3LQRA 4FWGA 5EP1A 3THGA 2LNHC 3T38A 3DZDA 5ITXA 3ZCBB 2R46A 2X8AA 1PM5A 4GRIA 1XXHB 3M0EA 1L8QA 1I94M 2KRKA 1T3TA 4KO8A 3T15A 4JI7M 3GQ4A 3AJIB 4IBJA 4MB7A 3GRVA 3TL4X 3BOSA 2XZUA 5FLXS 3HU1A 7CATA 3W0FA 5EXXA 3FD9A 2D7HA 2CE7A 2LXEA 2L7HA 4M9ZA 3LVVA 2EUCA 3VDUA 3GLIA 1IBLM 2YR0A 1SXJD 2ZAOA 1DGFA 3GPXA 4IJFA 2ZM6M 5LMNM 2CHQA 1HT1E 2CHGA 2Y20A 3A46A 3R8FA 2R45A 3VKGA 1SXJB 2DWMA 3SATA 3SMPA 3SAVA 3GPPA 3SASA 1J7KA 3AOEC 4XBOA 4GH9A 2M5ZA 2VQFM 3KW6A 1XXHA 4YY3M 3SARA 4K0KM 1HT2E 3MHVC 5F3WA 3SC3A 5ITUA 4B7FA 2G8LA 2C98A 5ITRA 4HLQA 3SAUA 4MGKE 4JI3M 4IBKA 5ITXE 1NY5A 4M0DA 3EIHA 3TPZA 3GP1A 4AG5A 2FOIC 3J80S 1XWIA 4AKHA 1DO0A 1IN5A 3FKEA 3VKHA 2KW0A 5FSWA 1I4WA 4OX9M 5BPVA 1HQCA 5EQTA 2YNMD 3PFIA 4DUZM 4JV5M 1N36M 4EIWA 1SXJA 4FWHA 4JI6M 2YFQA 2J7NA 3EIEA 4BBAA 2EO2A 3KP1E 4AG6A 1N77A 4L16A 2R62A 2XFTA 1E9RA 5DYGA 1PJJA 4MGIE 1FJGM 1VDDA 3GRRA 4L4UA 2ZAMA 4KODA 4X62M 1XMOM 3GLFB 2DVWB 5EXPA 4IBDA 3J27B 3J7AS 1EE8A 3VK8A 3VDPA 3GPYA 3JR5A 3I4VA 1L2DA 4DV4M 2I7PA 4PDGA 2NQ8C 1E94E 4NRVA 4GC9A 3GPUA 1D2NA 4LFBM 3H4MA 1NJFA 1L2BA 2G5GX 5KO3A 4D81A 4ITQA 3TWMA 2AHMA 4IBCA 4M0WA 4LZJA 3K8ZA 2V6ZM 4QHTA 1K3XA 2C9OA 4LJAA 1HQYE 2QP9X 5IWAM 4FVMA 2UXCM 3DA1A 3GO8A 3AKZA 2HCBA 5E6JA 2Y21A 3PVSA 3QWLA 4MM3B 4HL4A 3GLIB 1NHWC 1IN7A 3D8LA 3GLHB 4LJ8A 2CV1A 2QBYB 3PNVA 3B9PA 3KS4A 3MK6A 1S3SA 1W5SA 1TH4A 4KHPM 3U6PA 4QOSA 5EP4A 1XNQM 3KDSE 1N32M 1ORYB 4PT5A 5ITYA 2HKJA 1R6BX 3SHFA 3UK6A 4TUWA 1DO2A 4IIWA 2UU9M 3C58A 2Z4SA 4LF5M 3U6CA 3FTFA 3AOEA 1Z5CA 4LJ9A 4IBIA 5KPTA 2O5RA 1R2ZA 4GKJM 1GL6A 2V1CA 4MGZE 3ZC7B 2P5TA 4G4RA 2VQEM 3K2LA 2W82A 5BR8M 1H6UA 2UUBM 1OFHA 3FTEA 3VLFB 1UM8A 3GLHA 2QBYA 3FUTA 2DWLA 4LCBA 1K82A 1OJLA 2Y0TA 1NNJA 3A42A 2F5QA 2L6OA 2CV2A 4FCWA 2F5NA 1IY1A 4I8OA 4QNMA 3VFDA 2BNKA 1Q3CA 2F4VM 2LH0A 3CF0A 2OPFA 2F5PA 4R3DA 1NJGA 4DR5M 2CEAA 3TWLA 2Z3XA 5EJCA 2R4JA 4B08A 5FTJA 2KEBA 4OVZB 3TQSA 3SBJA 4LF4M 3HJ8A 4GKKM 5H37D 3KS8A 1IN4A 2FFJA 1FNNA 1N33M 4LG2A 3TE6A 4LJ5A 3SHGB 3ILKA 4B3SM 4LF7M 1QAMA 5C1BA 1YSYA 3KP0E 3KXEC 1N75A 2QZ4A 2C5RA 4GIPA 1Z59A 4JN6A 3AV0A 4GHAA 4AQYM 3WHLA 4LJ4A 2ERCA 5IT9S 1ZQ9A 3FTDA 1NNUC 2Y0QA 4A3VB 3AOGA 3U60A 4IBBA 5GKNA 3OTOM 4NRWA 1W5TA 1E32A 4GC5A 3SMSA 2H1RA 3PXGA 1HNXM 3KOYE 4S12A 4PCZA 4DV0M 1IM2A 4LF6M 3M6AA 4OVZA 1XNRM 4DV7M 1IN6A 2XSZD 3KOZE 2RKOA 1NVMA 1IBMM 5DYIA 1XMQM 1G3IA 3E9SA 4NSOB 3U6EA 3DFZA 4B7HA 3L27A 4DV1M 4LFAM 2K47A 2DHRA 5FTLA 3RE8A 4Z6YA 8CATA 4II7A 1HNZM 3K92A 4QOZC 4PD2A 4JI8M 2RGHA 1KFVA 2BJVA 1Z6TA 3HJSA 5C18A 3FUUA 4DV2M 5DNYA 4DV6M 4B3TM 4L8RC 2LWXA 3AL0C 3FTCA 2F5OA 3U61A 3LQQA 4I4LA 1K3WA 1L2CA 1QZMA 3L29A 4FW9A 2YQZA 3RGSA 3A98B 4DV5M 1TH3A 1QYRA 4M9XA 3W0LB 2C96A 3UZUA 1G41A 4LZZA 3GRUA 1IY0A 1TDZA 2ZANA 4REZA 3SAWA 4JI5M 4NL4H 4Z8XA 1DGHB 4FD2A 1G59A 4JI2M 2JA2A 1QAOA 2XSZA 4M9SA 1IBKM 3UMMA 3Q8XA 1N78A 1MX0A 1QQWA 2Q2EB 3NBIA 1NSFA 2R65A 1OFIA 2R18A 1Z5AA 3J81S 1IY2A 2QENA 4RF0A 3KOXE 1JR3D 1TDHA 2L7IA 4FCTA 3HU3A 4IBFA 4DUYM 2ZBKB 4BLCA 5KPZA 4LF9M 3GLGB 3U5ZA 3CF6E 3TWKA 2UUAM 2QCUA 3AFHA 3KSXA 4X65M 3I51A 4LRTA 1GL7A 4GITA 4NXMM 4D82A 4LGYA 3L2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHW C;  1NNU C;  2FOI C;  1NHG C;  2NQ8 C; 
#chains in the Genus database with same CATH topology
 1DGH A;  3KOW E;  3L28 A;  4IBG A;  5EXT A;  2QSF X;  3QAU A;  4GHL A;  2EJS A;  2OOA A;  5JI3 E;  4JI1 M;  3FYD A;  3GQ5 A;  4LY6 A;  5E26 A;  4MGH A;  5FTN A;  2KA6 B;  2V1U A;  2M60 A;  1IXR C;  1LTM A;  1XHB A;  3IHP A;  3CGW A;  1WHC A;  4CGY B;  3T1Y M;  1E9S A;  1YE9 A;  1SG9 A;  2O01 F;  2XEP A;  3FUV A;  3LMM A;  3LVW A;  3PNY A;  3HJQ A;  1DGG A;  3RGP A;  5KPR A;  3GRY A;  4MH0 E;  1VEJ A;  3IG8 A;  4JI4 M;  4ZPX A;  4AKI A;  4NOO B;  4X64 M;  4B7G A;  4DR7 M;  1MU5 A;  1L1T A;  1WXQ A;  3U60 B;  2J7O A;  2KHH A;  4P16 A;  4LRS A;  1X37 A;  2FNA A;  3GLG A;  4DV3 M;  3L25 A;  4FWD A;  4RNA A;  5EXS A;  4OU7 A;  1JR3 A;  4G4O A;  2F5S A;  2UXB M;  4IJE A;  3U6D A;  2R44 A;  2LTU A;  1WGL A;  1Z5B A;  3NWL A;  2K0B X;  4G4Q A;  2KZU A;  4G4N A;  2DXI A;  1KSF X;  4FCV A;  1YUB A;  4DR3 M;  1DGB A;  2X49 A;  4DR1 M;  3JAM S;  2CFO A;  4X66 M;  4F1I A;  4AKG A;  2X4A A;  2KDL A;  4WUR A;  2DNA A;  2OQ4 A;  1RU3 A;  1HR0 M;  1ZMV A;  1IQP A;  4JXJ A;  1QVR A;  4XGI A;  5KQD A;  2JZ0 A;  3SFZ A;  1GKI A;  4AI6 A;  4WW0 A;  5EP3 A;  3WHK A;  4AW4 A;  2XF3 A;  1MN3 A;  3CF2 A;  2MH8 A;  1A5T A;  2FE8 A;  4JI0 M;  1Q39 A;  2CP8 A;  5A2Q S;  3E4R A;  2G3Q A;  4RF1 A;  4LFC M;  1Q3B A;  2EKK A;  4CHT B;  4DBG B;  3U61 B;  1N34 M;  1L1Z A;  1D0L A;  4IBE A;  4D80 A;  3MJ5 A;  5ITT A;  2LVP C;  1PJQ A;  1KYI A;  2WSC F;  3HHW A;  4LJ6 A;  3GQ3 A;  3FUW A;  1NHG C;  4W5W A;  4AZF A;  3L26 A;  3HU2 A;  2R4E A;  2KRU A;  2XZF A;  1JB0 F;  2HL7 A;  3J7B A;  3U6Q A;  3RFW A;  4DR6 M;  2I7N A;  4PDI A;  1HNW M;  1JQJ C;  3NBX X;  3U6L A;  2CV0 A;  2Z4R A;  5JI2 E;  4B3R M;  1QUS A;  2DHY A;  3BXW A;  3IG5 A;  4ANR A;  2L09 A;  4YHH M;  3M7G A;  1C1K A;  3HHX A;  1TH2 A;  4R7G A;  1QAN A;  5KQ8 A;  3KVW A;  2JUJ A;  1PRB A;  2Z8Y M;  2MJ5 B;  4L15 A;  3UJN A;  3HHY A;  2FH0 A;  2QHO B;  2QQ8 A;  5LMU M;  1OAO C;  4DR4 M;  4JYA M;  4GMQ A;  2OOB A;  2D7G A;  3B89 A;  2XH9 A;  2CHV A;  2DZN B;  4KT0 F;  3T1H M;  3U5Z B;  1G4A E;  2JY8 A;  1IXZ A;  1WR1 B;  3FUX A;  2UUC M;  3KFU G;  3U6S A;  4G6Z A;  1IXS B;  4B3M M;  1WJ7 A;  4OW0 A;  1XXH E;  2RGO A;  3HY5 A;  3HZJ A;  5ITQ A;  2XLJ A;  1F4I A;  3UGJ A;  2DAE A;  3LCV B;  4LF8 M;  2MGW A;  2VII A;  4NXN M;  5FTK A;  2MR9 A;  3A45 A;  1XC8 A;  1SXJ C;  4CIS A;  1YLA A;  1R2Y A;  4I5S A;  4L78 A;  4NSR A;  1ZAE A;  3I4Y A;  4KLN A;  3U6M A;  3HWS A;  3R9X B;  2KNV A;  3DOA A;  2APL A;  3VK7 A;  3SYK A;  2L4F A;  1PJI A;  1J09 A;  1TGU A;  1VEG A;  5IZ7 D;  1IFY A;  4MGY E;  2K6B A;  4DR2 M;  2XZU A;  2DI0 A;  2H5X A;  1T43 A;  3HGI A;  2VDB B;  2D7E A;  2QPA A;  2KXE A;  3ZH9 B;  3KSJ A;  2Z7J A;  4BB9 A;  4I81 A;  1IN8 A;  5L8R F;  1GVN A;  1SXJ E;  1R7R A;  1P3Q Q;  1LV7 A;  1ZV1 A;  3D8B A;  2DZO B;  3JR4 A;  3K1J A;  1IXS A;  2HHH M;  3SYL A;  2J5Y A;  3FYC A;  3GLF A;  2A5Y B;  2BJW A;  2EA0 A;  1NY6 A;  3Q8G A;  2E5L M;  1GLN A;  2XFS A;  3CTW B;  1J5E M;  3U6O A;  2C9C A;  2DWZ B;  3HKP A;  2XGN A;  2LVA A;  2KZS A;  4HEO A;  1G8P A;  3J2P B;  2CUZ A;  1QDT A;  4LJ7 A;  1GJT A;  1Q02 A;  4QNR A;  5FTM A;  2DWN A;  1QAQ A;  4LGM A;  2C99 A;  5IRE B;  3HHZ A;  4QHS A;  5EP2 A;  3LQR A;  2KNA A;  1NV8 A;  4FWG A;  5EP1 A;  3THG A;  2LNH C;  3T38 A;  3DZD A;  2VF7 A;  5ITX A;  2N35 A;  2R46 A;  2X8A A;  1WIV A;  4GRI A;  3ZCB B;  2LBC A;  1PM5 A;  1XXH B;  3M0E A;  1L8Q A;  2LVO C;  1I94 M;  2KRK A;  1T3T A;  4KO8 A;  3T15 A;  4JI7 M;  3GQ4 A;  1QUT A;  3AJI B;  4IBJ A;  3GRV A;  1UFZ A;  3BOS A;  4MB7 A;  2BWB A;  3TL4 X;  5FLX S;  2GNO A;  3HU1 A;  7CAT A;  3W0F A;  2QBY B;  5EXX A;  3FD9 A;  2D7H A;  2LXE A;  2CE7 A;  2L7H A;  4M9Z A;  4RKU F;  1BVS A;  3LVV A;  1PGY A;  2JY6 B;  1ZMU A;  1V92 A;  2EUC A;  3VDU A;  3GLI A;  4P17 A;  1IBL M;  2YR0 A;  1SXJ D;  2ZAO A;  2GQF A;  2JY5 A;  2CWB A;  1DGF A;  1VEK A;  3GPX A;  4IJF A;  2ZM6 M;  5LMN M;  2CHQ A;  1HT1 E;  2CHG A;  2Y20 A;  3A46 A;  3R8F A;  3LCU A;  2R45 A;  3LW5 F;  3VKG A;  1SXJ B;  4G3O A;  2DWM A;  1QDR A;  3SAT A;  3SMP A;  3SAV A;  3GPP A;  3GLF E;  3SAS A;  1J7K A;  3AOE C;  4XBO A;  4GH9 A;  2M5Z A;  2VQF M;  3KW6 A;  1XXH A;  4YY3 M;  3SAR A;  4K0K M;  1HT2 E;  3MHV C;  5F3W A;  3SC3 A;  4GEW A;  5ITU A;  1TF0 B;  4B7F A;  4CIZ A;  3QYB A;  2G8L A;  2C98 A;  5ITR A;  4HLQ A;  3SAU A;  1QZE A;  4MGK E;  1R4G A;  4JI3 M;  4IBK A;  5ITX E;  1PJT A;  1NY5 A;  4M0D A;  3EIH A;  3TPZ A;  3GP1 A;  4AG5 A;  2FS1 A;  2FOI C;  3J80 S;  1XWI A;  4AKH A;  1DO0 A;  1EFU B;  1IN5 A;  2L4E A;  3C3D A;  3FKE A;  3VKH A;  2KW0 A;  5FSW A;  2WSE F;  1I4W A;  4OX9 M;  5BPV A;  1HQC A;  5EQT A;  1V33 A;  2YNM D;  3BBZ A;  3PFI A;  4DUZ M;  3C9P A;  3W68 A;  1OKS A;  4JV5 M;  1T6O A;  1N36 M;  3ZQJ A;  4EIW A;  1SXJ A;  1AIP C;  4FWH A;  4JI6 M;  2YFQ A;  2J7N A;  3EIE A;  4BBA A;  2EO2 A;  3KP1 E;  4AG6 A;  2MRO B;  3GLH E;  1NO1 A;  3E46 A;  3GLI E;  1N77 A;  3B7Z A;  4L16 A;  2R62 A;  2XFT A;  1E9R A;  4UN2 B;  5DYG A;  1PJJ A;  4MGI E;  1FJG M;  1VDD A;  3GRR A;  3H4J A;  4L4U A;  2ZAM A;  4KOD A;  1TTE A;  2JXN A;  4X62 M;  2JP7 A;  2UXD M;  1D0K A;  2DAK A;  1XMO M;  3GLF B;  2DVW B;  1MJG M;  5EXP A;  4IBD A;  3J27 B;  2EKF A;  3V76 A;  3J7A S;  1EE8 A;  2WSF F;  3VDP A;  3GPY A;  3JR5 A;  3VK8 A;  3I4V A;  1L2D A;  4DV4 M;  2I7P A;  4PDG A;  1OTR A;  2NQ8 C;  1E94 E;  4NRV A;  4GC9 A;  3GPU A;  1D2N A;  2JWS A;  4LFB M;  1GJS A;  3H4M A;  1C7Y A;  1NJF A;  1L2B A;  2G5G X;  5KO3 A;  4D81 A;  4ITQ A;  3TWM A;  1NV9 A;  1OAI A;  2AHM A;  4IBC A;  4M0W A;  4LZJ A;  3K8Z A;  2V6Z M;  1OQY A;  4QHT A;  1VDL A;  1K3X A;  2C9O A;  4LJA A;  1HQY E;  2QP9 X;  5IWA M;  4FVM A;  2UXC M;  3DA1 A;  1VQ1 A;  3GO8 A;  3AKZ A;  2HCB A;  5E6J A;  2Y21 A;  3PVS A;  3QWL A;  4MM3 B;  4HL4 A;  1CUK A;  1NHW C;  1IN7 A;  2ZTC A;  3D8L A;  3GLH B;  4LJ8 A;  3GLI B;  3PNV A;  3B9P A;  3KS4 A;  3MK6 A;  2CV1 A;  1S3S A;  1W5S A;  1TH4 A;  4KHP M;  3U6P A;  4QOS A;  5EP4 A;  1XNQ M;  3B74 A;  2BWE A;  3KDS E;  1ORY B;  1N32 M;  4PT5 A;  2WZJ A;  2HKJ A;  5ITY A;  1R6B X;  1XB2 B;  3SHF A;  3FRI A;  3UK6 A;  4TUW A;  3T6P A;  1DO2 A;  2HWJ A;  1D0M A;  4IIW A;  2UU9 M;  3C58 A;  2Z4S A;  4LF5 M;  3U6C A;  3FTF A;  3AOE A;  1Z5C A;  2HAK A;  2LVN C;  4LJ9 A;  2LVQ D;  3K9P A;  4IBI A;  2R6F A;  5KPT A;  4Q7J A;  2O5R A;  1R2Z A;  2JZ1 A;  4GKJ M;  1GL6 A;  2L2D A;  2V1C A;  4MGZ E;  4WP2 A;  3ZC7 B;  2P5T A;  4XK8 F;  4G4R A;  2VQE M;  3K2L A;  2W82 A;  5BR8 M;  1H6U A;  2UUB M;  1GO5 A;  1OFH A;  3W67 A;  5DFL A;  3FTE A;  3VLF B;  1UM8 A;  3GLH A;  2QBY A;  3FUT A;  2DWL A;  4LCB A;  1K82 A;  2DKL A;  2DAI A;  1OJL A;  2Y0T A;  1NNJ A;  3A42 A;  2F5Q A;  2L6O A;  2CV2 A;  4FCW A;  2F5N A;  2ZTD A;  1IY1 A;  4I8O A;  4QNM A;  3VFD A;  2LHC A;  2BNK A;  1Q3C A;  2F4V M;  2LH0 A;  3CF0 A;  2OPF A;  2F5P A;  4R3D A;  1NJG A;  4DR5 M;  2CEA A;  3TWL A;  2B3T A;  2Z3X A;  5EJC A;  2K9D A;  2R4J A;  4B08 A;  5FTJ A;  2KEB A;  3F92 A;  3B7Q A;  4OVZ B;  3TQS A;  3SBJ A;  4LF4 M;  1Y8G A;  3HJ8 A;  4GKK M;  5H37 D;  3KS8 A;  1IN4 A;  3QYE A;  1VG5 A;  2FFJ A;  3K9O A;  4CJ6 A;  1FNN A;  1N33 M;  4LG2 A;  3TE6 A;  4LJ5 A;  1EIJ A;  3SHG B;  3ILK A;  4B3S M;  4LF7 M;  1QAM A;  5C1B A;  1YSY A;  1PJS A;  3HX3 A;  3KP0 E;  1N75 A;  2QZ4 A;  3KXE C;  2C5R A;  4GIP A;  1Z59 A;  2QNJ A;  2VF8 A;  3AV0 A;  4JN6 A;  2DAG A;  2DEN A;  3C3E A;  4AQY M;  3WHL A;  4GHA A;  2DZL A;  4LJ4 A;  2ERC A;  5IT9 S;  3IEC A;  1ZQ9 A;  3FTD A;  3I01 M;  1NNU C;  2Y0Q A;  4A3V B;  3AOG A;  3U60 A;  4IBB A;  5GKN A;  3OTO M;  4NRW A;  1W5T A;  1E32 A;  4GC5 A;  3SMS A;  2H1R A;  3PXG A;  1HNX M;  3KOY E;  4S12 A;  4PCZ A;  4DV0 M;  4F2L A;  1IM2 A;  4LF6 M;  3M6A A;  2JY7 A;  4OVZ A;  1ZMW A;  4DV7 M;  1IN6 A;  1G71 A;  2XSZ D;  3FE3 A;  3KOZ E;  1XNR M;  1HJP A;  2RKO A;  1DV0 A;  1NVM A;  1IBM M;  5DYI A;  1XMQ M;  1G3I A;  3GLG E;  3E9S A;  2KNZ A;  4NSO B;  3B7N A;  3U6E A;  1JR3 E;  3DFZ A;  4B7H A;  4Y28 F;  3L27 A;  4DV1 M;  4LFA M;  2K47 A;  2DHR A;  5FTL A;  3RE8 A;  4Z6Y A;  8CAT A;  4II7 A;  1HNZ M;  2RRU A;  2LHG A;  3K92 A;  4PD2 A;  4QOZ C;  4JI8 M;  2RGH A;  1KFV A;  2BJV A;  1Z6T A;  3HJS A;  5C18 A;  3FUU A;  4DV2 M;  5DNY A;  4DV6 M;  4B3T M;  4L8R C;  2CRU A;  2LWX A;  3AL0 C;  3FTC A;  2F5O A;  3U61 A;  3LQQ A;  4I4L A;  1K3W A;  1V34 A;  1TR8 A;  1L2C A;  1QZM A;  3L29 A;  4FW9 A;  2YQZ A;  3RGS A;  3A98 B;  4DV5 M;  2JNH A;  1TH3 A;  1QYR A;  4M9X A;  3I04 M;  2C96 A;  3UZU A;  1G41 A;  4LZZ A;  3GRU A;  3W0L B;  1IY0 A;  1TDZ A;  2ZAN A;  4REZ A;  3E21 A;  3SAW A;  1WGN A;  4JI5 M;  4NL4 H;  4Z8X A;  1DGH B;  4FD2 A;  1GAB A;  1OIP A;  1G59 A;  4JI2 M;  2JA2 A;  2DAM A;  1QAO A;  2XSZ A;  4M9S A;  1IBK M;  3UMM A;  3Q8X A;  1N78 A;  1MX0 A;  1QQW A;  2Q2E B;  3NBI A;  1NSF A;  2R65 A;  1OFI A;  2R18 A;  1Z5A A;  2OO9 A;  1IY2 A;  2QEN A;  3J81 S;  3MMP A;  4RF0 A;  3KOX E;  4L6V 6;  1JR3 D;  1TDH A;  2R0I A;  2L7I A;  4FCT A;  3HU3 A;  4IBF A;  4R71 A;  4DUY M;  2ZBK B;  4BLC A;  5KPZ A;  4LF9 M;  1AUA A;  3GLG B;  3U5Z A;  3CF6 E;  1OIZ A;  4NC6 A;  3TWK A;  3FRH A;  2O25 A;  2UUA M;  2QCU A;  3AFH A;  3KSX A;  4X65 M;  3I51 A;  4LRT A;  1GL7 A;  4GIT A;  4NXM M;  4D82 A;  4LGY A;  3L2A A;  1R5L A; 
#chains in the Genus database with same CATH homology
 1DGH A;  3KOW E;  3L28 A;  4IBG A;  5EXT A;  3QAU A;  4GHL A;  5JI3 E;  4JI1 M;  3FYD A;  3GQ5 A;  4LY6 A;  5E26 A;  4MGH A;  5FTN A;  2KA6 B;  2V1U A;  2M60 A;  1IXR C;  1XHB A;  4CGY B;  3T1Y M;  1E9S A;  1YE9 A;  2XEP A;  3LVW A;  3FUV A;  3PNY A;  3LMM A;  3RGP A;  2UXD M;  3HJQ A;  1DGG A;  5KPR A;  3GRY A;  4MH0 E;  3IG8 A;  4JI4 M;  4ZPX A;  4AKI A;  4NOO B;  4X64 M;  4B7G A;  4DR7 M;  1MU5 A;  1L1T A;  1WXQ A;  3U60 B;  2J7O A;  4DV3 M;  4P16 A;  4LRS A;  1X37 A;  2FNA A;  3GLG A;  3L25 A;  4FWD A;  4RNA A;  5EXS A;  4OU7 A;  1JR3 A;  4G4O A;  2F5S A;  2UXB M;  4IJE A;  3U6D A;  1Z5B A;  3NWL A;  4G4Q A;  2KZU A;  4G4N A;  2DXI A;  1KSF X;  4FCV A;  1YUB A;  4DR3 M;  1DGB A;  2X49 A;  4DR1 M;  3JAM S;  2CFO A;  4X66 M;  4AKG A;  2X4A A;  4WUR A;  2OQ4 A;  1HR0 M;  1IQP A;  4JXJ A;  1QVR A;  4XGI A;  5KQD A;  3SFZ A;  1GKI A;  4AI6 A;  4WW0 A;  5EP3 A;  3WHK A;  4AW4 A;  2XF3 A;  3CF2 A;  2FE8 A;  4JI0 M;  1Q39 A;  5A2Q S;  3E4R A;  4RF1 A;  4LFC M;  1Q3B A;  4CHT B;  3U61 B;  1N34 M;  1L1Z A;  4IBE A;  4D80 A;  3MJ5 A;  5ITT A;  1KYI A;  3HHW A;  4LJ6 A;  3GQ3 A;  3FUW A;  1NHG C;  4W5W A;  4AZF A;  3L26 A;  3HU2 A;  2R4E A;  2KRU A;  2XZF A;  2HL7 A;  3J7B A;  3U6Q A;  3RFW A;  4DR6 M;  2I7N A;  4PDI A;  1HNW M;  1JQJ C;  3U6L A;  2CV0 A;  2Z4R A;  5JI2 E;  4B3R M;  3IG5 A;  2L09 A;  4YHH M;  3M7G A;  1C1K A;  3HHX A;  1TH2 A;  4R7G A;  1QAN A;  5KQ8 A;  3KVW A;  4L15 A;  3UJN A;  3HHY A;  5LMU M;  4DR4 M;  4JYA M;  4GMQ A;  2D7G A;  2XH9 A;  2CHV A;  2DZN B;  3T1H M;  3U5Z B;  2UUC M;  1G4A E;  3FUX A;  1IXZ A;  3KFU G;  3U6S A;  4G6Z A;  1IXS B;  4B3M M;  4OW0 A;  2RGO A;  5ITQ A;  2XLJ A;  3UGJ A;  4LF8 M;  2VII A;  4NXN M;  5FTK A;  3A45 A;  1XC8 A;  1SXJ C;  4CIS A;  1R2Y A;  4I5S A;  4L78 A;  4NSR A;  1ZAE A;  3I4Y A;  4KLN A;  3U6M A;  3HWS A;  3R9X B;  3DOA A;  3VK7 A;  3SYK A;  1PJI A;  1J09 A;  1TGU A;  5IZ7 D;  4MGY E;  4DR2 M;  3HGI A;  2D7E A;  2QPA A;  2KXE A;  3ZH9 B;  3KSJ A;  2Z7J A;  4BB9 A;  4I81 A;  1IN8 A;  1GVN A;  1SXJ E;  1R7R A;  1LV7 A;  3JR4 A;  3D8B A;  2DZO B;  3K1J A;  2HHH M;  3SYL A;  3FYC A;  3GLF A;  2A5Y B;  2BJW A;  2EA0 A;  1NY6 A;  2E5L M;  1GLN A;  2XFS A;  3CTW B;  1J5E M;  3U6O A;  2C9C A;  2DWZ B;  3HKP A;  2XGN A;  2KZS A;  1G8P A;  3J2P B;  2CUZ A;  4LJ7 A;  4QNR A;  5FTM A;  2DWN A;  1QAQ A;  4LGM A;  2C99 A;  5IRE B;  3HHZ A;  4QHS A;  5EP2 A;  3LQR A;  4FWG A;  5EP1 A;  3THG A;  2LNH C;  3T38 A;  3DZD A;  5ITX A;  3ZCB B;  2R46 A;  2X8A A;  1PM5 A;  4GRI A;  1XXH B;  3M0E A;  1L8Q A;  1I94 M;  2KRK A;  1T3T A;  4KO8 A;  3T15 A;  4JI7 M;  3GQ4 A;  3AJI B;  4IBJ A;  4MB7 A;  3GRV A;  3TL4 X;  3BOS A;  2XZU A;  5FLX S;  3HU1 A;  7CAT A;  3W0F A;  5EXX A;  3FD9 A;  2D7H A;  2CE7 A;  2LXE A;  2L7H A;  4M9Z A;  3LVV A;  2EUC A;  3VDU A;  3GLI A;  1IBL M;  2YR0 A;  1SXJ D;  2ZAO A;  1DGF A;  3GPX A;  4IJF A;  2ZM6 M;  5LMN M;  2CHQ A;  1HT1 E;  2CHG A;  2Y20 A;  3A46 A;  3R8F A;  2R45 A;  3VKG A;  1SXJ B;  2DWM A;  3SAT A;  3SMP A;  3SAV A;  3GPP A;  3SAS A;  1J7K A;  3AOE C;  4XBO A;  4GH9 A;  2M5Z A;  2VQF M;  3KW6 A;  1XXH A;  4YY3 M;  3SAR A;  4K0K M;  1HT2 E;  3MHV C;  5F3W A;  3SC3 A;  5ITU A;  4B7F A;  2G8L A;  2C98 A;  5ITR A;  4HLQ A;  3SAU A;  4MGK E;  4JI3 M;  4IBK A;  5ITX E;  1NY5 A;  4M0D A;  3EIH A;  3TPZ A;  3GP1 A;  4AG5 A;  2FOI C;  3J80 S;  1XWI A;  4AKH A;  1DO0 A;  1IN5 A;  3FKE A;  3VKH A;  2KW0 A;  5FSW A;  1I4W A;  4OX9 M;  5BPV A;  1HQC A;  5EQT A;  2YNM D;  3PFI A;  4DUZ M;  4JV5 M;  1N36 M;  4EIW A;  1SXJ A;  4FWH A;  4JI6 M;  2YFQ A;  2J7N A;  3EIE A;  4BBA A;  2EO2 A;  3KP1 E;  4AG6 A;  1N77 A;  4L16 A;  2R62 A;  2XFT A;  1E9R A;  5DYG A;  1PJJ A;  4MGI E;  1FJG M;  1VDD A;  3GRR A;  4L4U A;  2ZAM A;  4KOD A;  4X62 M;  1XMO M;  3GLF B;  2DVW B;  5EXP A;  4IBD A;  3J27 B;  3J7A S;  1EE8 A;  3VK8 A;  3VDP A;  3GPY A;  3JR5 A;  3I4V A;  1L2D A;  4DV4 M;  2I7P A;  4PDG A;  2NQ8 C;  1E94 E;  4NRV A;  4GC9 A;  3GPU A;  1D2N A;  4LFB M;  3H4M A;  1NJF A;  1L2B A;  2G5G X;  5KO3 A;  4D81 A;  4ITQ A;  3TWM A;  2AHM A;  4IBC A;  4M0W A;  4LZJ A;  3K8Z A;  2V6Z M;  4QHT A;  1K3X A;  2C9O A;  4LJA A;  1HQY E;  2QP9 X;  5IWA M;  4FVM A;  2UXC M;  3DA1 A;  3GO8 A;  3AKZ A;  2HCB A;  5E6J A;  2Y21 A;  3PVS A;  3QWL A;  4MM3 B;  4HL4 A;  3GLI B;  1NHW C;  1IN7 A;  3D8L A;  3GLH B;  4LJ8 A;  2CV1 A;  2QBY B;  3PNV A;  3B9P A;  3KS4 A;  3MK6 A;  1S3S A;  1W5S A;  1TH4 A;  4KHP M;  3U6P A;  4QOS A;  5EP4 A;  1XNQ M;  3KDS E;  1N32 M;  1ORY B;  4PT5 A;  5ITY A;  2HKJ A;  1R6B X;  3SHF A;  3UK6 A;  4TUW A;  1DO2 A;  4IIW A;  2UU9 M;  3C58 A;  2Z4S A;  4LF5 M;  3U6C A;  3FTF A;  3AOE A;  1Z5C A;  4LJ9 A;  4IBI A;  5KPT A;  2O5R A;  1R2Z A;  4GKJ M;  1GL6 A;  2V1C A;  4MGZ E;  3ZC7 B;  2P5T A;  4G4R A;  2VQE M;  3K2L A;  2W82 A;  5BR8 M;  1H6U A;  2UUB M;  1OFH A;  3FTE A;  3VLF B;  1UM8 A;  3GLH A;  2QBY A;  3FUT A;  2DWL A;  4LCB A;  1K82 A;  1OJL A;  2Y0T A;  1NNJ A;  3A42 A;  2F5Q A;  2L6O A;  2CV2 A;  4FCW A;  2F5N A;  1IY1 A;  4I8O A;  4QNM A;  3VFD A;  2BNK A;  1Q3C A;  2F4V M;  2LH0 A;  3CF0 A;  2OPF A;  2F5P A;  4R3D A;  1NJG A;  4DR5 M;  2CEA A;  3TWL A;  2Z3X A;  5EJC A;  2R4J A;  4B08 A;  5FTJ A;  2KEB A;  4OVZ B;  3TQS A;  3SBJ A;  4LF4 M;  3HJ8 A;  4GKK M;  5H37 D;  3KS8 A;  1IN4 A;  2FFJ A;  1FNN A;  1N33 M;  4LG2 A;  3TE6 A;  4LJ5 A;  3SHG B;  3ILK A;  4B3S M;  4LF7 M;  1QAM A;  5C1B A;  1YSY A;  3KP0 E;  3KXE C;  1N75 A;  2QZ4 A;  2C5R A;  4GIP A;  1Z59 A;  4JN6 A;  3AV0 A;  4GHA A;  4AQY M;  3WHL A;  4LJ4 A;  2ERC A;  5IT9 S;  1ZQ9 A;  3FTD A;  1NNU C;  2Y0Q A;  4A3V B;  3AOG A;  3U60 A;  4IBB A;  5GKN A;  3OTO M;  4NRW A;  1W5T A;  1E32 A;  4GC5 A;  3SMS A;  2H1R A;  3PXG A;  1HNX M;  3KOY E;  4S12 A;  4PCZ A;  4DV0 M;  1IM2 A;  4LF6 M;  3M6A A;  4OVZ A;  1XNR M;  4DV7 M;  1IN6 A;  2XSZ D;  3KOZ E;  2RKO A;  1NVM A;  1IBM M;  5DYI A;  1XMQ M;  1G3I A;  3E9S A;  4NSO B;  3U6E A;  3DFZ A;  4B7H A;  3L27 A;  4DV1 M;  4LFA M;  2K47 A;  2DHR A;  5FTL A;  3RE8 A;  4Z6Y A;  8CAT A;  4II7 A;  1HNZ M;  3K92 A;  4QOZ C;  4PD2 A;  4JI8 M;  2RGH A;  1KFV A;  2BJV A;  1Z6T A;  3HJS A;  5C18 A;  3FUU A;  4DV2 M;  5DNY A;  4DV6 M;  4B3T M;  4L8R C;  2LWX A;  3AL0 C;  3FTC A;  2F5O A;  3U61 A;  3LQQ A;  4I4L A;  1K3W A;  1L2C A;  1QZM A;  3L29 A;  4FW9 A;  2YQZ A;  3RGS A;  3A98 B;  4DV5 M;  1TH3 A;  1QYR A;  4M9X A;  3W0L B;  2C96 A;  3UZU A;  1G41 A;  4LZZ A;  3GRU A;  1IY0 A;  1TDZ A;  2ZAN A;  4REZ A;  3SAW A;  4JI5 M;  4NL4 H;  4Z8X A;  1DGH B;  4FD2 A;  1G59 A;  4JI2 M;  2JA2 A;  1QAO A;  2XSZ A;  4M9S A;  1IBK M;  3UMM A;  3Q8X A;  1N78 A;  1MX0 A;  1QQW A;  2Q2E B;  3NBI A;  1NSF A;  2R65 A;  1OFI A;  2R18 A;  1Z5A A;  3J81 S;  1IY2 A;  2QEN A;  4RF0 A;  3KOX E;  1JR3 D;  1TDH A;  2L7I A;  4FCT A;  3HU3 A;  4IBF A;  4DUY M;  2ZBK B;  4BLC A;  5KPZ A;  4LF9 M;  3GLG B;  3U5Z A;  3CF6 E;  3TWK A;  2UUA M;  2QCU A;  3AFH A;  3KSX A;  4X65 M;  3I51 A;  4LRT A;  1GL7 A;  4GIT A;  4NXM M;  4D82 A;  4LGY A;  3L2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...