1NHGC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
b'YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 17
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nhgC00
1NNUC 1NHWC 1NHGC 2FOIC 2NQ8C
chains in the Genus database with same CATH superfamily
4GIPA 2CV1A 2K6BA 1NVMA 2L7HA 1G3IA 1BVSA 1OIZA 3GLIA 4NL4H 2QQ8A 1XXHE 4DR6M 3HGIA 4M9ZA 4NXNM 1PJTA 2C5RA 1IY0A 3HU2A 3KSXA 3AOGA 3FUXA 4CISA 1VEKA 3AL0C 2XEPA 1K3WA 1L8QA 2FE8A 2E5LM 5L8RF 1QQWA 3NBXX 2H1RA 5FTJA 4DV5M 3VKGA 3LVVA 4G4QA 3GRRA 3KOYE 5FTMA 3PNYA 3TE6A 1XC8A 2JA2A 2O25A 2GNOA 4PD2A 3SAVA 1N36M 2JNHA 1NO1A 5ITUA 1IN7A 5ITTA 4X62M 2QCUA 3L28A 2RGOA 5EQTA 2DHRA 3M7GA 2KZUA 4LF9M 2ZANA 2KHHA 1E9RA 3J7BA 4M9XA 3GRUA 1NSFA 2CHVA 5ITXA 1IBKM 3Q8XA 1I4WA 3U61B 3B7QA 1G71A 2AHMA 2KW0A 3U6SA 4HLQA 2F5NA 1NV8A 5ITQA 1IQPA 4LZZA 2Z3XA 1WGLA 1W5TA 3FRIA 3C3DA 1TGUA 4JN6A 4KHPM 2L4EA 2L09A 4B3TM 5EP1A 1IXSB 2MJ5B 4LF8M 1E32A 1J5EM 4MGYE 3RFWA 2DXIA 4CIZA 1NY6A 3GLIB 2CHGA 4FCTA 4Z8XA 3ZCBB 4BLCA 1IY2A 1IY1A 1VEGA 4MGZE 3GPUA 4M0DA 4AG6A 3VLFB 1TTEA 3ZQJA 2FNAA 3TQSA 3I51A 1XWIA 1QAQA 2KA6B 2KNVA 1OAOC 2R6FA 1IBLM 2DKLA 2JY8A 2KDLA 2Y0QA 5EXXA 3K9OA 2RGHA 2G3QA 4LGMA 4G4RA 2XLJA 1PJJA 1P3QQ 4CJ6A 1D0LA 1IXRC 1PJQA 4WURA 4GKJM 2QZ4A 3R9XB 2CE7A 1WXQA 2XSZA 3SYLA 5JI2E 2JY6B 4K0KM 2M60A 3GO8A 3SAWA 4LF4M 1DO0A 4KODA 3THGA 1EE8A 5H37D 2Q2EB 1K3XA 3KW6A 3HU3A 5KPRA 2CUZA 2MR9A 2QNJA 2Y0TA 2LXEA 1TH4A 3B9PA 1QZMA 4JXJA 4QNRA 3W0FA 2QENA 4JI2M 1R2ZA 4DR2M 2ZBKB 3GQ4A 3HKPA 1DGBA 1MU5A 4LFCM 3L25A 1OAIA 3LMMA 4IBIA 2VQEM 3B7ZA 4NSRA 4DR1M 3FUUA 2LHGA 1IN5A 3GLFA 2I7PA 1HR0M 1HNWM 4GMQA 2WSEF 3HU1A 4AKHA 4LJ7A 5IWAM 1D0KA 7CATA 5FTKA 3U6OA 3SYKA 5DFLA 4I5SA 5JI3E 4JYAM 2JP7A 2DAMA 4GC9A 2H5XA 2FS1A 1SXJA 5KO3A 4LJ4A 3FRHA 4JI5M 2L2DA 3U6CA 3K92A 1FNNA 3FTEA 3DA1A 2FH0A 5KPTA 3VK7A 4OW0A 1VEJA 3AOEA 3T1YM 1VDLA 3KSJA 3L26A 4JI1M 1J7KA 1L2CA 2BWBA 1C7YA 1YE9A 2JWSA 2LVAA 1A5TA 3HJSA 1ZQ9A 3VK8A 4LJ6A 2DVWB 4LY6A 4B7HA 3AFHA 4XK8F 2N35A 1OTRA 1WGNA 2R45A 3FUWA 4MM3B 4Q7JA 3KS4A 5EXSA 4G3OA 3VFDA 2JZ0A 3UJNA 1N33M 1IN6A 4IBKA 2DZLA 3IHPA 4L4UA 3I04M 2XFSA 3D8BA 4ANRA 4QOZC 2R44A 4JI6M 5IT9S 3GP1A 2CV0A 2CHQA 4AKIA 3HJ8A 1IXSA 2OPFA 2JUJA 2K0BX 5IZ7D 1H6UA 3FTCA 4Z6YA 4MGHA 4F1IA 1N75A 1DGHA 1QAMA 1SG9A 1ZMWA 3GLFB 2CRUA 2FFJA 4DV1M 3K2LA 2O5RA 1N77A 2Y20A 4LF6M 3M6AA 2YQZA 4DV0M 1TH3A 5DNYA 4X65M 4FVMA 1Q3CA 3K8ZA 4WW0A 4R7GA 5KQ8A 1PGYA 1R6BX 2HWJA 2UU9M 1OQYA 1SXJB 3W67A 5KPZA 2KNAA 4AI6A 1DO2A 4FCWA 1TH2A 4IBDA 3T1HM 1ZV1A 2D7HA 2WSFF 4IBCA 3IG5A 4LJ5A 1HT2E 2DI0A 2C98A 2M5ZA 4IBFA 4RKUF 3U6DA 2P5TA 1Z5BA 1E94E 2LVQD 3IECA 3ILKA 3ZH9B 4UN2B 1MX0A 1Z5CA 2KRUA 4G6ZA 1HNZM 4REZA 2XZUA 1IBMM 1QZEA 2V1CA 3RGPA 4NC6A 2APLA 5FLXS 5BPVA 4FCVA 1F4IA 2RKOA 3TPZA 2XF3A 3GLHA 1TDHA 4A3VB 3MMPA 3FYDA 1G41A 2VQFM 1IM2A 2FOIC 3B89A 3BXWA 4BBAA 1T6OA 3J27B 4DR3M 4MGIE 3GLGB 4FWHA 3OTOM 3CF6E 5EP4A 2D7EA 3Q8GA 3IG8A 2F5PA 1T3TA 1DGHB 3AOEC 3C9PA 5DYIA 5EXPA 4DBGB 3J81S 3U6PA 1QUTA 1ZMUA 5IREB 4FW9A 2QBYA 3KS8A 2BWEA 3BBZA 1R7RA 3DZDA 1NY5A 3QYEA 4IJFA 4ZPXA 3E46A 4PDIA 4DV7M 3E4RA 3V76A 4F2LA 2F5QA 1HJPA 3J7AS 3W68A 5FSWA 2QP9X 5A2QS 2LWXA 4IBEA 3U5ZB 4B7FA 4Y28F 3SAUA 4TUWA 1GL7A 4L15A 1XMOM 3SARA 3RE8A 1NNJA 1Z59A 2HL7A 2ZTCA 4EIWA 4NSOB 3AV0A 4GITA 2R65A 1W5SA 2ZM6M 2XFTA 3M0EA 3HHWA 2EKKA 2OOBA 5EP2A 3WHLA 4L16A 4LRTA 3VDUA 2UXCM 2VDBB 3GLHB 1G59A 2OQ4A 3C3EA 2R18A 3KVWA 2EO2A 4L6V6 3WHKA 1TDZA 4LCBA 2DAEA 4L78A 1C1KA 1NHWC 1GLNA 3GRYA 2YR0A 1G4AE 2XZFA 1K82A 1V92A 4GHAA 3JR4A 4DR4M 2NQ8C 1WIVA 5FTLA 3SASA 2R4JA 3E9SA 2DZOB 1VDDA 3RGSA 3U6EA 3T15A 3UK6A 1XB2B 4QOSA 2QBYB 3I01M 3FTFA 3K9PA 2BJVA 1PJSA 2WZJA 3T38A 4B7GA 4R71A 1LTMA 1L2BA 2MGWA 3L2AA 4CHTB 4B08A 1WHCA 1GL6A 2I7NA 1XXHB 2JZ1A 2Z4RA 5EJCA 5E26A 1OIPA 3H4MA 3QWLA 1PRBA 2C9OA 1IN8A 2UXDM 1YSYA 3I4VA 3PXGA 4FD2A 3JR5A 4D80A 3GLIE 3MJ5A 2DHYA 3ZC7B 4I4LA 4LG2A 3SMPA 2DWMA 3FTDA 3LCUA 4D81A 5E6JA 2BNKA 3A98B 1NV9A 5LMUM 4M9SA 4WP2A 4AG5A 4P16A 4G4OA 3A45A 4D82A 2LVPC 1KFVA 2CWBA 1JQJC 3MHVC 4LFBM 3KOZE 2WSCF 1GJSA 2G8LA 5ITRA 3JAMS 2MH8A 3DFZA 2UUBM 2J7NA 3AJIB 3CTWB 1HQYE 1JR3A 4LZJA 4IBJA 2JY7A 1AUAA 3QAUA 2DNAA 3GLGA 1T43A 3PFIA 2C9CA 3KP1E 4KT0F 1Z6TA 3J2PB 1ZAEA 5ITXE 1HQCA 1I94M 4NXMM 1MJGM 5C1BA 2HAKA 2CEAA 2L6OA 2DWNA 5ITYA 4I81A 3VKHA 2UUCM 1N78A 2XH9A 3BOSA 4BB9A 1VG5A 4AQYM 3AKZA 1TF0B 5KQDA 2Z4SA 1OFHA 4NOOB 2KNZA 3HHXA 2J7OA 4RF0A 2O01F 4GC5A 1GKIA 3U6MA 3U5ZA 3TWKA 4LFAM 4QHTA 4FWDA 1OFIA 3LW5F 2DWZB 1J09A 3LVWA 3GPYA 2LNHC 1NJGA 3HWSA 4DV6M 2CV2A 2A5YB 1Q3BA 1GABA 1QUSA 1VQ1A 3CF2A 3SHFA 4NRVA 1EFUB 4KO8A 3HHZA 4ITQA 3FYCA 2X4AA 4JI7M 4OVZB 4PCZA 1DGFA 2D7GA 3K1JA 3SHGB 3SATA 1XNRM 3F92A 2LHCA 4GH9A 3FD9A 4LRSA 4I8OA 4B3RM 2ZTDA 1XNQM 1NHGC 1MN3A 2C96A 2Z8YM 5BR8M 3NBIA 1GO5A 4DV4M 1SXJC 4W5WA 3D8LA 3GQ5A 1E9SA 2J5YA 3HZJA 4PDGA 1V34A 1R5LA 2LVNC 2ERCA 1QYRA 1R4GA 2R46A 1YLAA 4JI3M 1DGGA 4AKGA 4MH0E 3KP0E 4DV2M 4LGYA 2GQFA 1Z5AA 5C18A 1XHBA 2OOAA 2CFOA 3GQ3A 3A42A 2V6ZM 1QVRA 5GKNA 1TR8A 3UMMA 2F5SA 2VF7A 4KLNA 1JB0F 1LV7A 1XXHA 2R62A 3GRVA 3SFZA 1Q02A 1KSFX 4II7A 3R8FA 3U6LA 4HEOA 4DV3M 2MROB 1PM5A 2DENA 3GLFE 4XBOA 3TWMA 5DYGA 1AIPC 1NNUC 1WJ7A 4PT5A 4S12A 3L27A 2QSFX 2OO9A 2Y21A 3FUVA 4OU7A 4HL4A 3A46A 2EUCA 5EP3A 3LQRA 4LF5M 1DV0A 2LVOC 1KYIA 2HKJA 4DUYM 4M0WA 3SMSA 2KXEA 4IBGA 4JI4M 4QNMA 1SXJE 2B3TA 2R4EA 2RRUA 3HX3A 4LJ9A 3KOXE 2CP8A 4MGKE 3TWLA 3KFUG 1L1TA 2EJSA 3LCVB 2ZAMA 4GEWA 2F4VM 1CUKA 1V33A 3HJQA 2QPAA 3B7NA 3SBJA 2KEBA 2JY5A 2KZSA 3LQQA 3UZUA 2LBCA 1R2YA 2XGNA 1L1ZA 2DWLA 3E21A 3HY5A 2HHHM 1UFZA 3U60A 3QYBA 1N34M 1IXZA 2L7IA 2XSZD 3HHYA 5LMNM 1IFYA 3KXEC 1EIJA 4R3DA 2UXBM 2UUAM 4AW4A 2W82A 1ORYB 1RU3A 2LTUA 1JR3E 2L4FA 2VIIA 4LF7M 3GLGE 4DUZM 2KRKA 3FKEA 1QAOA 3EIEA 3GPXA 1XMQM 4JI8M 3VDPA 2YNMD 2C99A 1S3SA 2X8AA 2ZAOA 2JXNA 2DAKA 5FTNA 1QDRA 1NJFA 2K47A 4YHHM 4IJEA 2X49A 3B74A 1HT1E 1Q39A 1QANA 2R0IA 3EIHA 2F5OA 4XGIA 1L2DA 2G5GX 4QHSA 2V1UA 2YFQA 1FJGM 1N32M 4GRIA 1IN4A 2DAGA 3FUTA 4OVZA 3T6PA 8CATA 2DZNB 3TL4X 2DAIA 1G8PA 1UM8A 4LJAA 4CGYB 3L29A 1QDTA 4NRWA 1YUBA 4OX9M 4B3MM 3H4JA 2K9DA 1D2NA 4YY3M 5F3WA 3DOAA 2Z7JA 3KDSE 3CGWA 2BJWA 4MB7A 4JV5M 1SXJD 2EKFA 4JI0M 2EA0A 4FWGA 3U6QA 3NWLA 1X37A 4G4NA 3U60B 3MK6A 2VF8A 4IIWA 1D0MA 3UGJA 3GPPA 1GJTA 4LJ8A 3SC3A 3C58A 1WR1B 3PNVA 4AZFA 1OKSA 3PVSA 4RNAA 1ZMVA 1OJLA 3GLHE 4L8RC 3KOWE 2HCBA 2QHOB 4DR7M 1PJIA 3U61A 4GKKM 1GVNA 4X66M 4B3SM 3J80S 4X64M 4P17A 1HNXM 3FE3A 4GHLA 3W0LB 1JR3D 5EXTA 1Y8GA 4DR5M 4IBBA 3CF0A 2LH0A 4RF1A 3I4YA
chains in the Genus database with same CATH topology
4GIPA 2CV1A 1NVMA 2L7HA 1G3IA 3GLIA 4NL4H 4DR6M 3HGIA 4M9ZA 4NXNM 2C5RA 1IY0A 3HU2A 3KSXA 3AOGA 3FUXA 4CISA 3AL0C 2XEPA 1K3WA 1L8QA 2FE8A 2E5LM 1QQWA 5FTJA 2H1RA 4DV5M 3VKGA 3LVVA 4G4QA 3GRRA 3KOYE 5FTMA 3PNYA 3TE6A 1XC8A 2JA2A 1N36M 4PD2A 3SAVA 5ITUA 1IN7A 5ITTA 4X62M 2QCUA 3L28A 2RGOA 5EQTA 2DHRA 3M7GA 2KZUA 4LF9M 2ZANA 1E9RA 3J7BA 4M9XA 3GRUA 1NSFA 2CHVA 5ITXA 1IBKM 3Q8XA 1I4WA 3U61B 2AHMA 2KW0A 3U6SA 4HLQA 2F5NA 5ITQA 1IQPA 4LZZA 2Z3XA 1W5TA 1TGUA 4JN6A 4KHPM 2L09A 4B3TM 5EP1A 1IXSB 4LF8M 1E32A 1J5EM 4MGYE 3RFWA 2DXIA 1NY6A 3GLIB 2CHGA 4FCTA 4Z8XA 3ZCBB 4BLCA 1IY2A 1IY1A 4MGZE 3GPUA 4M0DA 4AG6A 3VLFB 2FNAA 3TQSA 3I51A 1XWIA 1QAQA 2KA6B 1IBLM 2Y0QA 5EXXA 2RGHA 4LGMA 1PJJA 4G4RA 2XLJA 4GKJM 1IXRC 4WURA 2QZ4A 3R9XB 2CE7A 1WXQA 2XSZA 3SYLA 5JI2E 4K0KM 2M60A 3GO8A 3SAWA 4LF4M 1DO0A 4KODA 3THGA 1EE8A 5H37D 2Q2EB 1K3XA 3KW6A 3HU3A 5KPRA 2CUZA 2Y0TA 2LXEA 1TH4A 3B9PA 1QZMA 4JXJA 4QNRA 3W0FA 2QENA 4JI2M 1R2ZA 4DR2M 2ZBKB 3GQ4A 3HKPA 1DGBA 1MU5A 4LFCM 3L25A 3LMMA 4IBIA 2VQEM 4NSRA 4DR1M 3FUUA 1IN5A 3GLFA 2I7PA 1HR0M 1HNWM 4GMQA 3HU1A 4AKHA 4LJ7A 5IWAM 7CATA 5FTKA 3U6OA 3SYKA 4I5SA 5JI3E 4JYAM 4GC9A 1SXJA 5KO3A 4LJ4A 4JI5M 3U6CA 3K92A 1FNNA 3FTEA 3DA1A 5KPTA 3VK7A 4OW0A 3AOEA 3T1YM 3KSJA 3L26A 4JI1M 1J7KA 1L2CA 1YE9A 3HJSA 3VK8A 1ZQ9A 4LJ6A 2DVWB 4LY6A 4B7HA 3AFHA 3FUWA 3VFDA 2R45A 4MM3B 5EXSA 3KS4A 3UJNA 1N33M 1IN6A 4IBKA 4L4UA 2XFSA 3D8BA 4QOZC 4JI6M 5IT9S 3GP1A 2CV0A 2CHQA 4AKIA 3HJ8A 2OPFA 5IZ7D 1H6UA 3FTCA 4Z6YA 4MGHA 1N75A 1DGHA 1QAMA 3GLFB 2FFJA 4DV1M 3K2LA 2O5RA 1N77A 2Y20A 4LF6M 3M6AA 2YQZA 4DV0M 1TH3A 5DNYA 4X65M 4FVMA 1Q3CA 3K8ZA 4WW0A 4R7GA 5KQ8A 1R6BX 2UU9M 1SXJB 5KPZA 4AI6A 1DO2A 4FCWA 1TH2A 4IBDA 3T1HM 2D7HA 4IBCA 3IG5A 4LJ5A 1HT2E 2C98A 2M5ZA 4IBFA 3U6DA 2P5TA 1Z5BA 1E94E 3ILKA 3ZH9B 1MX0A 1Z5CA 2KRUA 4G6ZA 1HNZM 4REZA 2XZUA 1IBMM 2V1CA 3RGPA 5FLXS 5BPVA 4FCVA 2RKOA 3TPZA 2XF3A 3GLHA 1TDHA 4A3VB 3FYDA 1G41A 2VQFM 1IM2A 2FOIC 4BBAA 3J27B 4DR3M 4MGIE 3GLGB 4FWHA 3OTOM 3CF6E 5EP4A 2D7EA 3IG8A 2F5PA 1T3TA 1DGHB 3AOEC 5DYIA 5EXPA 3J81S 3U6PA 5IREB 4FW9A 2QBYA 3KS8A 1R7RA 3DZDA 1NY5A 4IJFA 4ZPXA 4PDIA 4DV7M 2F5QA 3E4RA 5FSWA 2QP9X 5A2QS 2LWXA 4IBEA 3U5ZB 4B7FA 3SAUA 4TUWA 1GL7A 4L15A 1XMOM 3SARA 3RE8A 1NNJA 1Z59A 2HL7A 4EIWA 4NSOB 3AV0A 4GITA 2R65A 1W5SA 2ZM6M 2XFTA 3M0EA 3HHWA 3WHLA 5EP2A 4L16A 4LRTA 3VDUA 2UXCM 3GLHB 1G59A 2OQ4A 2R18A 3KVWA 2EO2A 3WHKA 1TDZA 4LCBA 4L78A 1C1KA 1NHWC 1GLNA 3GRYA 2YR0A 1G4AE 2XZFA 1K82A 4GHAA 3JR4A 4DR4M 2NQ8C 5FTLA 3SASA 2R4JA 3E9SA 2DZOB 1VDDA 3RGSA 3U6EA 3T15A 3UK6A 4QOSA 2QBYB 3FTFA 2BJVA 3T38A 4B7GA 1L2BA 3L2AA 4CHTB 4B08A 1GL6A 2I7NA 1XXHB 2Z4RA 5EJCA 5E26A 3H4MA 3QWLA 2UXDM 2C9OA 1IN8A 1YSYA 3I4VA 3PXGA 4FD2A 3JR5A 4D80A 3MJ5A 3ZC7B 4I4LA 4LG2A 3SMPA 2DWMA 3FTDA 4D81A 5E6JA 2BNKA 3A98B 5LMUM 4M9SA 4AG5A 4P16A 4G4OA 3A45A 4D82A 1KFVA 1JQJC 3MHVC 4LFBM 3KOZE 2G8LA 5ITRA 3JAMS 3DFZA 2UUBM 2J7NA 3AJIB 3CTWB 1HQYE 1JR3A 4LZJA 4IBJA 3QAUA 3GLGA 3PFIA 2C9CA 3KP1E 3J7AS 1Z6TA 3J2PB 1ZAEA 5ITXE 1HQCA 1I94M 4NXMM 5C1BA 2DWNA 2L6OA 2CEAA 5ITYA 4I81A 3VKHA 2UUCM 1N78A 2XH9A 3BOSA 4BB9A 4AQYM 3AKZA 5KQDA 2Z4SA 1OFHA 4NOOB 3HHXA 2J7OA 4RF0A 4GC5A 1GKIA 3U6MA 3U5ZA 3TWKA 4LFAM 4QHTA 4FWDA 1OFIA 2DWZB 1J09A 3LVWA 3GPYA 2LNHC 1NJGA 3HWSA 4DV6M 2CV2A 2A5YB 1Q3BA 3CF2A 3SHFA 4NRVA 4KO8A 3HHZA 4ITQA 3FYCA 2X4AA 4JI7M 4OVZB 4PCZA 1DGFA 2D7GA 3K1JA 3SHGB 3SATA 1XNRM 4GH9A 3FD9A 4LRSA 4I8OA 4B3RM 1XNQM 1NHGC 2C96A 5BR8M 3NBIA 4DV4M 1SXJC 4W5WA 3D8LA 3GQ5A 1E9SA 4PDGA 2ERCA 1QYRA 2R46A 4JI3M 1DGGA 4AKGA 4MH0E 3KP0E 4DV2M 4LGYA 1Z5AA 5C18A 1XHBA 3GQ3A 2CFOA 3A42A 2V6ZM 1QVRA 5GKNA 3UMMA 2F5SA 4KLNA 1LV7A 1XXHA 2R62A 3GRVA 3SFZA 1KSFX 4II7A 3R8FA 4DV3M 1PM5A 4XBOA 3TWMA 5DYGA 1NNUC 4PT5A 4S12A 3L27A 2Y21A 3FUVA 4OU7A 4LF5M 3A46A 4HL4A 2EUCA 5EP3A 3LQRA 1KYIA 2HKJA 4DUYM 4M0WA 3SMSA 2KXEA 4IBGA 4JI4M 4QNMA 1SXJE 2R4EA 4LJ9A 3U6LA 4MGKE 3TWLA 3KOXE 3KFUG 1L1TA 2ZAMA 2F4VM 3HJQA 2QPAA 3SBJA 2KEBA 2KZSA 3UZUA 3LQQA 1R2YA 2XGNA 1L1ZA 2DWLA 2HHHM 3U60A 1N34M 1IXZA 2L7IA 2XSZD 3HHYA 5LMNM 3KXEC 4R3DA 2UXBM 2UUAM 4AW4A 2W82A 1ORYB 2VIIA 4LF7M 4DUZM 2KRKA 3FKEA 1QAOA 3EIEA 3GPXA 1XMQM 4JI8M 3VDPA 2YNMD 2C99A 1S3SA 2X8AA 2ZAOA 5FTNA 1NJFA 2K47A 4YHHM 4IJEA 2X49A 1HT1E 1Q39A 1QANA 3EIHA 2F5OA 4XGIA 1L2DA 2G5GX 4QHSA 2V1UA 2YFQA 1FJGM 1N32M 4GRIA 1IN4A 4OVZA 3FUTA 8CATA 2DZNB 3TL4X 1G8PA 1UM8A 4LJAA 4CGYB 3L29A 4NRWA 1YUBA 4OX9M 4B3MM 4YY3M 1D2NA 5F3WA 3DOAA 2Z7JA 3KDSE 4MB7A 2BJWA 4JV5M 1SXJD 4JI0M 2EA0A 4FWGA 3U6QA 3NWLA 1X37A 4G4NA 3U60B 3MK6A 4IIWA 3UGJA 3GPPA 4LJ8A 3SC3A 3C58A 4L8RC 3PNVA 4AZFA 3PVSA 4RNAA 1OJLA 4DR7M 3KOWE 2HCBA 1PJIA 3U61A 4GKKM 1GVNA 4X66M 4B3SM 3J80S 4X64M 1HNXM 4GHLA 3W0LB 1JR3D 5EXTA 4DR5M 4IBBA 3CF0A 2LH0A 4RF1A 3I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNU C;  1NHW C;  1NHG C;  2FOI C;  2NQ8 C; 
#chains in the Genus database with same CATH topology
 4GIP A;  2CV1 A;  2K6B A;  1NVM A;  2L7H A;  1G3I A;  1BVS A;  1OIZ A;  3GLI A;  4NL4 H;  2QQ8 A;  1XXH E;  4DR6 M;  3HGI A;  4M9Z A;  4NXN M;  1PJT A;  2C5R A;  1IY0 A;  3HU2 A;  3KSX A;  3AOG A;  3FUX A;  4CIS A;  1VEK A;  3AL0 C;  2XEP A;  1K3W A;  1L8Q A;  2FE8 A;  2E5L M;  5L8R F;  1QQW A;  3NBX X;  2H1R A;  5FTJ A;  4DV5 M;  3VKG A;  3LVV A;  4G4Q A;  3GRR A;  3KOY E;  5FTM A;  3PNY A;  3TE6 A;  1XC8 A;  2JA2 A;  2O25 A;  2GNO A;  4PD2 A;  3SAV A;  1N36 M;  2JNH A;  1NO1 A;  5ITU A;  1IN7 A;  5ITT A;  4X62 M;  2QCU A;  3L28 A;  2RGO A;  5EQT A;  2DHR A;  3M7G A;  2KZU A;  4LF9 M;  2ZAN A;  2KHH A;  1E9R A;  3J7B A;  4M9X A;  3GRU A;  1NSF A;  2CHV A;  5ITX A;  1IBK M;  3Q8X A;  1I4W A;  3U61 B;  3B7Q A;  1G71 A;  2AHM A;  2KW0 A;  3U6S A;  4HLQ A;  2F5N A;  1NV8 A;  5ITQ A;  1IQP A;  4LZZ A;  2Z3X A;  1WGL A;  1W5T A;  3FRI A;  3C3D A;  1TGU A;  4JN6 A;  4KHP M;  2L4E A;  2L09 A;  4B3T M;  5EP1 A;  1IXS B;  2MJ5 B;  4LF8 M;  1E32 A;  1J5E M;  4MGY E;  3RFW A;  2DXI A;  4CIZ A;  1NY6 A;  3GLI B;  2CHG A;  4FCT A;  4Z8X A;  3ZCB B;  4BLC A;  1IY2 A;  1IY1 A;  1VEG A;  4MGZ E;  3GPU A;  4M0D A;  4AG6 A;  3VLF B;  1TTE A;  3ZQJ A;  2FNA A;  3TQS A;  3I51 A;  1XWI A;  1QAQ A;  2KA6 B;  2KNV A;  1OAO C;  2R6F A;  1IBL M;  2DKL A;  2JY8 A;  2KDL A;  2Y0Q A;  5EXX A;  3K9O A;  2RGH A;  2G3Q A;  4LGM A;  4G4R A;  2XLJ A;  1PJJ A;  1P3Q Q;  4CJ6 A;  1D0L A;  1IXR C;  1PJQ A;  4WUR A;  4GKJ M;  2QZ4 A;  3R9X B;  2CE7 A;  1WXQ A;  2XSZ A;  3SYL A;  5JI2 E;  2JY6 B;  4K0K M;  2M60 A;  3GO8 A;  3SAW A;  4LF4 M;  1DO0 A;  4KOD A;  3THG A;  1EE8 A;  5H37 D;  2Q2E B;  1K3X A;  3KW6 A;  3HU3 A;  5KPR A;  2CUZ A;  2MR9 A;  2QNJ A;  2Y0T A;  2LXE A;  1TH4 A;  3B9P A;  1QZM A;  4JXJ A;  4QNR A;  3W0F A;  2QEN A;  4JI2 M;  1R2Z A;  4DR2 M;  2ZBK B;  3GQ4 A;  3HKP A;  1DGB A;  1MU5 A;  4LFC M;  3L25 A;  1OAI A;  3LMM A;  4IBI A;  2VQE M;  3B7Z A;  4NSR A;  4DR1 M;  3FUU A;  2LHG A;  1IN5 A;  3GLF A;  2I7P A;  1HR0 M;  1HNW M;  4GMQ A;  2WSE F;  3HU1 A;  4AKH A;  4LJ7 A;  5IWA M;  1D0K A;  7CAT A;  5FTK A;  3U6O A;  3SYK A;  5DFL A;  4I5S A;  5JI3 E;  4JYA M;  2JP7 A;  2DAM A;  4GC9 A;  2H5X A;  2FS1 A;  1SXJ A;  5KO3 A;  4LJ4 A;  3FRH A;  4JI5 M;  2L2D A;  3U6C A;  3K92 A;  1FNN A;  3FTE A;  3DA1 A;  2FH0 A;  5KPT A;  3VK7 A;  4OW0 A;  1VEJ A;  3AOE A;  3T1Y M;  1VDL A;  3KSJ A;  3L26 A;  4JI1 M;  1J7K A;  1L2C A;  2BWB A;  1C7Y A;  1YE9 A;  2JWS A;  2LVA A;  1A5T A;  3HJS A;  1ZQ9 A;  3VK8 A;  4LJ6 A;  2DVW B;  4LY6 A;  4B7H A;  3AFH A;  4XK8 F;  2N35 A;  1OTR A;  1WGN A;  2R45 A;  3FUW A;  4MM3 B;  4Q7J A;  3KS4 A;  5EXS A;  4G3O A;  3VFD A;  2JZ0 A;  3UJN A;  1N33 M;  1IN6 A;  4IBK A;  2DZL A;  3IHP A;  4L4U A;  3I04 M;  2XFS A;  3D8B A;  4ANR A;  4QOZ C;  2R44 A;  4JI6 M;  5IT9 S;  3GP1 A;  2CV0 A;  2CHQ A;  4AKI A;  3HJ8 A;  1IXS A;  2OPF A;  2JUJ A;  2K0B X;  5IZ7 D;  1H6U A;  3FTC A;  4Z6Y A;  4MGH A;  4F1I A;  1N75 A;  1DGH A;  1QAM A;  1SG9 A;  1ZMW A;  3GLF B;  2CRU A;  2FFJ A;  4DV1 M;  3K2L A;  2O5R A;  1N77 A;  2Y20 A;  4LF6 M;  3M6A A;  2YQZ A;  4DV0 M;  1TH3 A;  5DNY A;  4X65 M;  4FVM A;  1Q3C A;  3K8Z A;  4WW0 A;  4R7G A;  5KQ8 A;  1PGY A;  1R6B X;  2HWJ A;  2UU9 M;  1OQY A;  1SXJ B;  3W67 A;  5KPZ A;  2KNA A;  4AI6 A;  1DO2 A;  4FCW A;  1TH2 A;  4IBD A;  3T1H M;  1ZV1 A;  2D7H A;  2WSF F;  4IBC A;  3IG5 A;  4LJ5 A;  1HT2 E;  2DI0 A;  2C98 A;  2M5Z A;  4IBF A;  4RKU F;  3U6D A;  2P5T A;  1Z5B A;  1E94 E;  2LVQ D;  3IEC A;  3ILK A;  3ZH9 B;  4UN2 B;  1MX0 A;  1Z5C A;  2KRU A;  4G6Z A;  1HNZ M;  4REZ A;  2XZU A;  1IBM M;  1QZE A;  2V1C A;  3RGP A;  4NC6 A;  2APL A;  5FLX S;  5BPV A;  4FCV A;  1F4I A;  2RKO A;  3TPZ A;  2XF3 A;  3GLH A;  1TDH A;  4A3V B;  3MMP A;  3FYD A;  1G41 A;  2VQF M;  1IM2 A;  2FOI C;  3B89 A;  3BXW A;  4BBA A;  1T6O A;  3J27 B;  4DR3 M;  4MGI E;  3GLG B;  4FWH A;  3OTO M;  3CF6 E;  5EP4 A;  2D7E A;  3Q8G A;  3IG8 A;  2F5P A;  1T3T A;  1DGH B;  3AOE C;  3C9P A;  5DYI A;  5EXP A;  4DBG B;  3J81 S;  3U6P A;  1QUT A;  1ZMU A;  5IRE B;  4FW9 A;  2QBY A;  3KS8 A;  2BWE A;  3BBZ A;  1R7R A;  3DZD A;  1NY5 A;  3QYE A;  4IJF A;  4ZPX A;  3E46 A;  4PDI A;  4DV7 M;  3E4R A;  3V76 A;  4F2L A;  2F5Q A;  1HJP A;  3J7A S;  3W68 A;  5FSW A;  2QP9 X;  5A2Q S;  2LWX A;  4IBE A;  3U5Z B;  4B7F A;  4Y28 F;  3SAU A;  4TUW A;  1GL7 A;  4L15 A;  1XMO M;  3SAR A;  3RE8 A;  1NNJ A;  1Z59 A;  2HL7 A;  2ZTC A;  4EIW A;  4NSO B;  3AV0 A;  4GIT A;  2R65 A;  1W5S A;  2ZM6 M;  2XFT A;  3M0E A;  3HHW A;  2EKK A;  2OOB A;  5EP2 A;  3WHL A;  4L16 A;  4LRT A;  3VDU A;  2UXC M;  2VDB B;  3GLH B;  1G59 A;  2OQ4 A;  3C3E A;  2R18 A;  3KVW A;  2EO2 A;  4L6V 6;  3WHK A;  1TDZ A;  4LCB A;  2DAE A;  4L78 A;  1C1K A;  1NHW C;  1GLN A;  3GRY A;  2YR0 A;  1G4A E;  2XZF A;  1K82 A;  1V92 A;  4GHA A;  3JR4 A;  4DR4 M;  2NQ8 C;  1WIV A;  5FTL A;  3SAS A;  2R4J A;  3E9S A;  2DZO B;  1VDD A;  3RGS A;  3U6E A;  3T15 A;  3UK6 A;  1XB2 B;  4QOS A;  2QBY B;  3I01 M;  3FTF A;  3K9P A;  2BJV A;  1PJS A;  2WZJ A;  3T38 A;  4B7G A;  4R71 A;  1LTM A;  1L2B A;  2MGW A;  3L2A A;  4CHT B;  4B08 A;  1WHC A;  1GL6 A;  2I7N A;  1XXH B;  2JZ1 A;  2Z4R A;  5EJC A;  5E26 A;  1OIP A;  3H4M A;  3QWL A;  1PRB A;  2C9O A;  1IN8 A;  2UXD M;  1YSY A;  3I4V A;  3PXG A;  4FD2 A;  3JR5 A;  4D80 A;  3GLI E;  3MJ5 A;  2DHY A;  3ZC7 B;  4I4L A;  4LG2 A;  3SMP A;  2DWM A;  3FTD A;  3LCU A;  4D81 A;  5E6J A;  2BNK A;  3A98 B;  1NV9 A;  5LMU M;  4M9S A;  4WP2 A;  4AG5 A;  4P16 A;  4G4O A;  3A45 A;  4D82 A;  2LVP C;  1KFV A;  2CWB A;  1JQJ C;  3MHV C;  4LFB M;  3KOZ E;  2WSC F;  1GJS A;  2G8L A;  5ITR A;  3JAM S;  2MH8 A;  3DFZ A;  2UUB M;  2J7N A;  3AJI B;  3CTW B;  1HQY E;  1JR3 A;  4LZJ A;  4IBJ A;  2JY7 A;  1AUA A;  3QAU A;  2DNA A;  3GLG A;  1T43 A;  3PFI A;  2C9C A;  3KP1 E;  4KT0 F;  1Z6T A;  3J2P B;  1ZAE A;  5ITX E;  1HQC A;  1I94 M;  4NXM M;  1MJG M;  5C1B A;  2HAK A;  2CEA A;  2L6O A;  2DWN A;  5ITY A;  4I81 A;  3VKH A;  2UUC M;  1N78 A;  2XH9 A;  3BOS A;  4BB9 A;  1VG5 A;  4AQY M;  3AKZ A;  1TF0 B;  5KQD A;  2Z4S A;  1OFH A;  4NOO B;  2KNZ A;  3HHX A;  2J7O A;  4RF0 A;  2O01 F;  4GC5 A;  1GKI A;  3U6M A;  3U5Z A;  3TWK A;  4LFA M;  4QHT A;  4FWD A;  1OFI A;  3LW5 F;  2DWZ B;  1J09 A;  3LVW A;  3GPY A;  2LNH C;  1NJG A;  3HWS A;  4DV6 M;  2CV2 A;  2A5Y B;  1Q3B A;  1GAB A;  1QUS A;  1VQ1 A;  3CF2 A;  3SHF A;  4NRV A;  1EFU B;  4KO8 A;  3HHZ A;  4ITQ A;  3FYC A;  2X4A A;  4JI7 M;  4OVZ B;  4PCZ A;  1DGF A;  2D7G A;  3K1J A;  3SHG B;  3SAT A;  1XNR M;  3F92 A;  2LHC A;  4GH9 A;  3FD9 A;  4LRS A;  4I8O A;  4B3R M;  2ZTD A;  1XNQ M;  1NHG C;  1MN3 A;  2C96 A;  2Z8Y M;  5BR8 M;  3NBI A;  1GO5 A;  4DV4 M;  1SXJ C;  4W5W A;  3D8L A;  3GQ5 A;  1E9S A;  2J5Y A;  3HZJ A;  4PDG A;  1V34 A;  1R5L A;  2LVN C;  2ERC A;  1QYR A;  1R4G A;  2R46 A;  1YLA A;  4JI3 M;  1DGG A;  4AKG A;  4MH0 E;  3KP0 E;  4DV2 M;  4LGY A;  2GQF A;  1Z5A A;  5C18 A;  1XHB A;  2OOA A;  2CFO A;  3GQ3 A;  3A42 A;  2V6Z M;  1QVR A;  5GKN A;  1TR8 A;  3UMM A;  2F5S A;  2VF7 A;  4KLN A;  1JB0 F;  1LV7 A;  1XXH A;  2R62 A;  3GRV A;  3SFZ A;  1Q02 A;  1KSF X;  4II7 A;  3R8F A;  3U6L A;  4HEO A;  4DV3 M;  2MRO B;  1PM5 A;  2DEN A;  3GLF E;  4XBO A;  3TWM A;  5DYG A;  1AIP C;  1NNU C;  1WJ7 A;  4PT5 A;  4S12 A;  3L27 A;  2QSF X;  2OO9 A;  2Y21 A;  3FUV A;  4OU7 A;  4HL4 A;  3A46 A;  2EUC A;  5EP3 A;  3LQR A;  4LF5 M;  1DV0 A;  2LVO C;  1KYI A;  2HKJ A;  4DUY M;  4M0W A;  3SMS A;  2KXE A;  4IBG A;  4JI4 M;  4QNM A;  1SXJ E;  2B3T A;  2R4E A;  2RRU A;  3HX3 A;  4LJ9 A;  3KOX E;  2CP8 A;  4MGK E;  3TWL A;  3KFU G;  1L1T A;  2EJS A;  3LCV B;  2ZAM A;  4GEW A;  2F4V M;  1CUK A;  1V33 A;  3HJQ A;  2QPA A;  3B7N A;  3SBJ A;  2KEB A;  2JY5 A;  2KZS A;  3LQQ A;  3UZU A;  2LBC A;  1R2Y A;  2XGN A;  1L1Z A;  2DWL A;  3E21 A;  3HY5 A;  2HHH M;  1UFZ A;  3U60 A;  3QYB A;  1N34 M;  1IXZ A;  2L7I A;  2XSZ D;  3HHY A;  5LMN M;  1IFY A;  3KXE C;  1EIJ A;  4R3D A;  2UXB M;  2UUA M;  4AW4 A;  2W82 A;  1ORY B;  1RU3 A;  2LTU A;  1JR3 E;  2L4F A;  2VII A;  4LF7 M;  3GLG E;  4DUZ M;  2KRK A;  3FKE A;  1QAO A;  3EIE A;  3GPX A;  1XMQ M;  4JI8 M;  3VDP A;  2YNM D;  2C99 A;  1S3S A;  2X8A A;  2ZAO A;  2JXN A;  2DAK A;  5FTN A;  1QDR A;  1NJF A;  2K47 A;  4YHH M;  4IJE A;  2X49 A;  3B74 A;  1HT1 E;  1Q39 A;  1QAN A;  2R0I A;  3EIH A;  2F5O A;  4XGI A;  1L2D A;  2G5G X;  4QHS A;  2V1U A;  2YFQ A;  1FJG M;  1N32 M;  4GRI A;  1IN4 A;  2DAG A;  3FUT A;  4OVZ A;  3T6P A;  8CAT A;  2DZN B;  3TL4 X;  2DAI A;  1G8P A;  1UM8 A;  4LJA A;  4CGY B;  3L29 A;  1QDT A;  4NRW A;  1YUB A;  4OX9 M;  4B3M M;  3H4J A;  2K9D A;  1D2N A;  4YY3 M;  5F3W A;  3DOA A;  2Z7J A;  3KDS E;  3CGW A;  2BJW A;  4MB7 A;  4JV5 M;  1SXJ D;  2EKF A;  4JI0 M;  2EA0 A;  4FWG A;  3U6Q A;  3NWL A;  1X37 A;  4G4N A;  3U60 B;  3MK6 A;  2VF8 A;  4IIW A;  1D0M A;  3UGJ A;  3GPP A;  1GJT A;  4LJ8 A;  3SC3 A;  3C58 A;  1WR1 B;  3PNV A;  4AZF A;  1OKS A;  3PVS A;  4RNA A;  1ZMV A;  1OJL A;  3GLH E;  4L8R C;  3KOW E;  2HCB A;  2QHO B;  4DR7 M;  1PJI A;  3U61 A;  4GKK M;  1GVN A;  4X66 M;  4B3S M;  3J80 S;  4X64 M;  4P17 A;  1HNX M;  3FE3 A;  4GHL A;  3W0L B;  1JR3 D;  5EXT A;  1Y8G A;  4DR5 M;  4IBB A;  3CF0 A;  2LH0 A;  4RF1 A;  3I4Y A; 
#chains in the Genus database with same CATH homology
 4GIP A;  2CV1 A;  1NVM A;  2L7H A;  1G3I A;  3GLI A;  4NL4 H;  4DR6 M;  3HGI A;  4M9Z A;  4NXN M;  2C5R A;  1IY0 A;  3HU2 A;  3KSX A;  3AOG A;  3FUX A;  4CIS A;  3AL0 C;  2XEP A;  1K3W A;  1L8Q A;  2FE8 A;  2E5L M;  1QQW A;  5FTJ A;  2H1R A;  4DV5 M;  3VKG A;  3LVV A;  4G4Q A;  3GRR A;  3KOY E;  5FTM A;  3PNY A;  3TE6 A;  1XC8 A;  2JA2 A;  1N36 M;  4PD2 A;  3SAV A;  5ITU A;  1IN7 A;  5ITT A;  4X62 M;  2QCU A;  3L28 A;  2RGO A;  5EQT A;  2DHR A;  3M7G A;  2KZU A;  4LF9 M;  2ZAN A;  1E9R A;  3J7B A;  4M9X A;  3GRU A;  1NSF A;  2CHV A;  5ITX A;  1IBK M;  3Q8X A;  1I4W A;  3U61 B;  2AHM A;  2KW0 A;  3U6S A;  4HLQ A;  2F5N A;  5ITQ A;  1IQP A;  4LZZ A;  2Z3X A;  1W5T A;  1TGU A;  4JN6 A;  4KHP M;  2L09 A;  4B3T M;  5EP1 A;  1IXS B;  4LF8 M;  1E32 A;  1J5E M;  4MGY E;  3RFW A;  2DXI A;  1NY6 A;  3GLI B;  2CHG A;  4FCT A;  4Z8X A;  3ZCB B;  4BLC A;  1IY2 A;  1IY1 A;  4MGZ E;  3GPU A;  4M0D A;  4AG6 A;  3VLF B;  2FNA A;  3TQS A;  3I51 A;  1XWI A;  1QAQ A;  2KA6 B;  1IBL M;  2Y0Q A;  5EXX A;  2RGH A;  4LGM A;  1PJJ A;  4G4R A;  2XLJ A;  4GKJ M;  1IXR C;  4WUR A;  2QZ4 A;  3R9X B;  2CE7 A;  1WXQ A;  2XSZ A;  3SYL A;  5JI2 E;  4K0K M;  2M60 A;  3GO8 A;  3SAW A;  4LF4 M;  1DO0 A;  4KOD A;  3THG A;  1EE8 A;  5H37 D;  2Q2E B;  1K3X A;  3KW6 A;  3HU3 A;  5KPR A;  2CUZ A;  2Y0T A;  2LXE A;  1TH4 A;  3B9P A;  1QZM A;  4JXJ A;  4QNR A;  3W0F A;  2QEN A;  4JI2 M;  1R2Z A;  4DR2 M;  2ZBK B;  3GQ4 A;  3HKP A;  1DGB A;  1MU5 A;  4LFC M;  3L25 A;  3LMM A;  4IBI A;  2VQE M;  4NSR A;  4DR1 M;  3FUU A;  1IN5 A;  3GLF A;  2I7P A;  1HR0 M;  1HNW M;  4GMQ A;  3HU1 A;  4AKH A;  4LJ7 A;  5IWA M;  7CAT A;  5FTK A;  3U6O A;  3SYK A;  4I5S A;  5JI3 E;  4JYA M;  4GC9 A;  1SXJ A;  5KO3 A;  4LJ4 A;  4JI5 M;  3U6C A;  3K92 A;  1FNN A;  3FTE A;  3DA1 A;  5KPT A;  3VK7 A;  4OW0 A;  3AOE A;  3T1Y M;  3KSJ A;  3L26 A;  4JI1 M;  1J7K A;  1L2C A;  1YE9 A;  3HJS A;  3VK8 A;  1ZQ9 A;  4LJ6 A;  2DVW B;  4LY6 A;  4B7H A;  3AFH A;  3FUW A;  3VFD A;  2R45 A;  4MM3 B;  5EXS A;  3KS4 A;  3UJN A;  1N33 M;  1IN6 A;  4IBK A;  4L4U A;  2XFS A;  3D8B A;  4QOZ C;  4JI6 M;  5IT9 S;  3GP1 A;  2CV0 A;  2CHQ A;  4AKI A;  3HJ8 A;  2OPF A;  5IZ7 D;  1H6U A;  3FTC A;  4Z6Y A;  4MGH A;  1N75 A;  1DGH A;  1QAM A;  3GLF B;  2FFJ A;  4DV1 M;  3K2L A;  2O5R A;  1N77 A;  2Y20 A;  4LF6 M;  3M6A A;  2YQZ A;  4DV0 M;  1TH3 A;  5DNY A;  4X65 M;  4FVM A;  1Q3C A;  3K8Z A;  4WW0 A;  4R7G A;  5KQ8 A;  1R6B X;  2UU9 M;  1SXJ B;  5KPZ A;  4AI6 A;  1DO2 A;  4FCW A;  1TH2 A;  4IBD A;  3T1H M;  2D7H A;  4IBC A;  3IG5 A;  4LJ5 A;  1HT2 E;  2C98 A;  2M5Z A;  4IBF A;  3U6D A;  2P5T A;  1Z5B A;  1E94 E;  3ILK A;  3ZH9 B;  1MX0 A;  1Z5C A;  2KRU A;  4G6Z A;  1HNZ M;  4REZ A;  2XZU A;  1IBM M;  2V1C A;  3RGP A;  5FLX S;  5BPV A;  4FCV A;  2RKO A;  3TPZ A;  2XF3 A;  3GLH A;  1TDH A;  4A3V B;  3FYD A;  1G41 A;  2VQF M;  1IM2 A;  2FOI C;  4BBA A;  3J27 B;  4DR3 M;  4MGI E;  3GLG B;  4FWH A;  3OTO M;  3CF6 E;  5EP4 A;  2D7E A;  3IG8 A;  2F5P A;  1T3T A;  1DGH B;  3AOE C;  5DYI A;  5EXP A;  3J81 S;  3U6P A;  5IRE B;  4FW9 A;  2QBY A;  3KS8 A;  1R7R A;  3DZD A;  1NY5 A;  4IJF A;  4ZPX A;  4PDI A;  4DV7 M;  2F5Q A;  3E4R A;  5FSW A;  2QP9 X;  5A2Q S;  2LWX A;  4IBE A;  3U5Z B;  4B7F A;  3SAU A;  4TUW A;  1GL7 A;  4L15 A;  1XMO M;  3SAR A;  3RE8 A;  1NNJ A;  1Z59 A;  2HL7 A;  4EIW A;  4NSO B;  3AV0 A;  4GIT A;  2R65 A;  1W5S A;  2ZM6 M;  2XFT A;  3M0E A;  3HHW A;  3WHL A;  5EP2 A;  4L16 A;  4LRT A;  3VDU A;  2UXC M;  3GLH B;  1G59 A;  2OQ4 A;  2R18 A;  3KVW A;  2EO2 A;  3WHK A;  1TDZ A;  4LCB A;  4L78 A;  1C1K A;  1NHW C;  1GLN A;  3GRY A;  2YR0 A;  1G4A E;  2XZF A;  1K82 A;  4GHA A;  3JR4 A;  4DR4 M;  2NQ8 C;  5FTL A;  3SAS A;  2R4J A;  3E9S A;  2DZO B;  1VDD A;  3RGS A;  3U6E A;  3T15 A;  3UK6 A;  4QOS A;  2QBY B;  3FTF A;  2BJV A;  3T38 A;  4B7G A;  1L2B A;  3L2A A;  4CHT B;  4B08 A;  1GL6 A;  2I7N A;  1XXH B;  2Z4R A;  5EJC A;  5E26 A;  3H4M A;  3QWL A;  2UXD M;  2C9O A;  1IN8 A;  1YSY A;  3I4V A;  3PXG A;  4FD2 A;  3JR5 A;  4D80 A;  3MJ5 A;  3ZC7 B;  4I4L A;  4LG2 A;  3SMP A;  2DWM A;  3FTD A;  4D81 A;  5E6J A;  2BNK A;  3A98 B;  5LMU M;  4M9S A;  4AG5 A;  4P16 A;  4G4O A;  3A45 A;  4D82 A;  1KFV A;  1JQJ C;  3MHV C;  4LFB M;  3KOZ E;  2G8L A;  5ITR A;  3JAM S;  3DFZ A;  2UUB M;  2J7N A;  3AJI B;  3CTW B;  1HQY E;  1JR3 A;  4LZJ A;  4IBJ A;  3QAU A;  3GLG A;  3PFI A;  2C9C A;  3KP1 E;  3J7A S;  1Z6T A;  3J2P B;  1ZAE A;  5ITX E;  1HQC A;  1I94 M;  4NXM M;  5C1B A;  2DWN A;  2L6O A;  2CEA A;  5ITY A;  4I81 A;  3VKH A;  2UUC M;  1N78 A;  2XH9 A;  3BOS A;  4BB9 A;  4AQY M;  3AKZ A;  5KQD A;  2Z4S A;  1OFH A;  4NOO B;  3HHX A;  2J7O A;  4RF0 A;  4GC5 A;  1GKI A;  3U6M A;  3U5Z A;  3TWK A;  4LFA M;  4QHT A;  4FWD A;  1OFI A;  2DWZ B;  1J09 A;  3LVW A;  3GPY A;  2LNH C;  1NJG A;  3HWS A;  4DV6 M;  2CV2 A;  2A5Y B;  1Q3B A;  3CF2 A;  3SHF A;  4NRV A;  4KO8 A;  3HHZ A;  4ITQ A;  3FYC A;  2X4A A;  4JI7 M;  4OVZ B;  4PCZ A;  1DGF A;  2D7G A;  3K1J A;  3SHG B;  3SAT A;  1XNR M;  4GH9 A;  3FD9 A;  4LRS A;  4I8O A;  4B3R M;  1XNQ M;  1NHG C;  2C96 A;  5BR8 M;  3NBI A;  4DV4 M;  1SXJ C;  4W5W A;  3D8L A;  3GQ5 A;  1E9S A;  4PDG A;  2ERC A;  1QYR A;  2R46 A;  4JI3 M;  1DGG A;  4AKG A;  4MH0 E;  3KP0 E;  4DV2 M;  4LGY A;  1Z5A A;  5C18 A;  1XHB A;  3GQ3 A;  2CFO A;  3A42 A;  2V6Z M;  1QVR A;  5GKN A;  3UMM A;  2F5S A;  4KLN A;  1LV7 A;  1XXH A;  2R62 A;  3GRV A;  3SFZ A;  1KSF X;  4II7 A;  3R8F A;  4DV3 M;  1PM5 A;  4XBO A;  3TWM A;  5DYG A;  1NNU C;  4PT5 A;  4S12 A;  3L27 A;  2Y21 A;  3FUV A;  4OU7 A;  4LF5 M;  3A46 A;  4HL4 A;  2EUC A;  5EP3 A;  3LQR A;  1KYI A;  2HKJ A;  4DUY M;  4M0W A;  3SMS A;  2KXE A;  4IBG A;  4JI4 M;  4QNM A;  1SXJ E;  2R4E A;  4LJ9 A;  3U6L A;  4MGK E;  3TWL A;  3KOX E;  3KFU G;  1L1T A;  2ZAM A;  2F4V M;  3HJQ A;  2QPA A;  3SBJ A;  2KEB A;  2KZS A;  3UZU A;  3LQQ A;  1R2Y A;  2XGN A;  1L1Z A;  2DWL A;  2HHH M;  3U60 A;  1N34 M;  1IXZ A;  2L7I A;  2XSZ D;  3HHY A;  5LMN M;  3KXE C;  4R3D A;  2UXB M;  2UUA M;  4AW4 A;  2W82 A;  1ORY B;  2VII A;  4LF7 M;  4DUZ M;  2KRK A;  3FKE A;  1QAO A;  3EIE A;  3GPX A;  1XMQ M;  4JI8 M;  3VDP A;  2YNM D;  2C99 A;  1S3S A;  2X8A A;  2ZAO A;  5FTN A;  1NJF A;  2K47 A;  4YHH M;  4IJE A;  2X49 A;  1HT1 E;  1Q39 A;  1QAN A;  3EIH A;  2F5O A;  4XGI A;  1L2D A;  2G5G X;  4QHS A;  2V1U A;  2YFQ A;  1FJG M;  1N32 M;  4GRI A;  1IN4 A;  4OVZ A;  3FUT A;  8CAT A;  2DZN B;  3TL4 X;  1G8P A;  1UM8 A;  4LJA A;  4CGY B;  3L29 A;  4NRW A;  1YUB A;  4OX9 M;  4B3M M;  4YY3 M;  1D2N A;  5F3W A;  3DOA A;  2Z7J A;  3KDS E;  4MB7 A;  2BJW A;  4JV5 M;  1SXJ D;  4JI0 M;  2EA0 A;  4FWG A;  3U6Q A;  3NWL A;  1X37 A;  4G4N A;  3U60 B;  3MK6 A;  4IIW A;  3UGJ A;  3GPP A;  4LJ8 A;  3SC3 A;  3C58 A;  4L8R C;  3PNV A;  4AZF A;  3PVS A;  4RNA A;  1OJL A;  4DR7 M;  3KOW E;  2HCB A;  1PJI A;  3U61 A;  4GKK M;  1GVN A;  4X66 M;  4B3S M;  3J80 S;  4X64 M;  1HNX M;  4GHL A;  3W0L B;  1JR3 D;  5EXT A;  4DR5 M;  4IBB A;  3CF0 A;  2LH0 A;  4RF1 A;  3I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...