1NHGC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords enoyl-acyl carrier reductase
total genus 17
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nhgC00
1NHWC 1NHGC 1NNUC 2FOIC 2NQ8C
chains in the Genus database with same CATH superfamily
1R6BX 2L7HA 3OTOM 2VQEM 1VEKA 4TUWA 3GLGB 3KXEC 3FUXA 1EE8A 2LH0A 4XK8F 1LV7A 2HAKA 4PT5A 2C5RA 5IZ7D 1ZMVA 3SYKA 1SXJC 2DENA 3VKGA 4MGKE 4LF7M 1QDTA 4DR3M 2I7NA 1IN4A 2QZ4A 2J5YA 4GC5A 1GO5A 2F4VM 1HT2E 1GLNA 1VEGA 4P16A 1QANA 2Q2EB 1E32A 2EKFA 3E21A 3C9PA 5JI3E 4QHTA 3L2AA 2L2DA 2DAEA 2ZTDA 5EP3A 3VFDA 1KSFX 2K47A 2VDBB 8CATA 3C58A 3K92A 2A5YB 5JI2E 3GPXA 4R3DA 1L1TA 4I5SA 1OIZA 1FJGM 2X8AA 1QUSA 2OQ4A 3SAUA 4Z8XA 3GPUA 1QAMA 1NNUC 2XFTA 3AOEA 4LJ8A 2CEAA 1TR8A 3B9PA 3D8LA 3U6DA 4DR4M 4DR1M 1GJSA 2R18A 1VDLA 2OPFA 5FSWA 4MM3B 1UM8A 1ZMWA 5ITUA 3J7AS 1L1ZA 4I81A 7CATA 4GMQA 4AKGA 5KPTA 1G8PA 3TWMA 1PJSA 1WIVA 5ITXA 3R8FA 1D0KA 3VKHA 4FVMA 1L2BA 3FTEA 2QQ8A 1GJTA 3EIHA 3T6PA 2F5PA 2Y0TA 2R62A 2BJWA 2C99A 3GLIB 3QAUA 1SG9A 4NC6A 4LG2A 2R44A 1R4GA 2AHMA 1Z59A 3CGWA 3PNYA 2KRKA 4IBIA 4B7HA 2LHGA 2CV0A 5C1BA 5DNYA 3C3DA 3PNVA 3J80S 4X62M 1HQCA 2XF3A 3GPPA 4GC9A 4LRTA 2LVNC 4FCVA 2CUZA 2UXBM 1YE9A 3LVVA 4NL4H 4JV5M 2F5NA 3QYBA 2KDLA 1MJGM 3HU2A 1ZQ9A 4QOZC 3E46A 2RGHA 3KVWA 2YFQA 4GKKM 1QAOA 3PXGA 4DR6M 3MJ5A 3HJSA 2K6BA 3E4RA 2CP8A 4I4LA 1YSYA 3FUUA 3W68A 4FWGA 2KZUA 2CHGA 4L6V6 3UJNA 3W0FA 5KPRA 4IBFA 3VDUA 1IXRC 3KS4A 3GP1A 4X66M 1Z5BA 1E9SA 1OQYA 4CHTB 2FFJA 2C9CA 4QNMA 1XXHE 4L8RC 3VK8A 3GQ5A 3CTWB 2DWMA 1D0LA 3FTDA 2EUCA 4JXJA 3GQ3A 4MB7A 2BNKA 3SFZA 3M0EA 3J7BA 3FTFA 2M60A 2DWLA 3FYDA 3U61B 1L8QA 2L6OA 2X49A 5ITRA 2ZM6M 3U60B 2Y0QA 4DV5M 1GL7A 1QAQA 4IBJA 2O5RA 4AZFA 4XBOA 2MROB 2JZ0A 2D7EA 3H4JA 1PRBA 4FWDA 4G6ZA 4ITQA 1E9RA 4HEOA 2XEPA 4DV1M 1JR3E 2L09A 2V6ZM 1TH4A 4LFAM 1IN8A 2HCBA 1SXJD 1Q3BA 5EXXA 5GKNA 1XMOM 3A45A 3KFUG 3HHWA 4LY6A 3HWSA 2JWSA 1NJFA 3J2PB 2G5GX 1J5EM 3SASA 5F3WA 1N78A 2KEBA 1IY1A 2GQFA 2N35A 3EIEA 1KFVA 2R0IA 3AL0C 3SHFA 1NJGA 1T43A 2R46A 3GLGE 3U61A 2HWJA 1ORYB 2W82A 4F1IA 3KSJA 1A5TA 4DBGB 3U60A 3B89A 1MX0A 4LF5M 2LTUA 3B7NA 1Z5CA 3DFZA 2KRUA 5FTKA 1IQPA 3FD9A 3F92A 3K9PA 3RGSA 1NVMA 2F5QA 3GLGA 4W5WA 5LMUM 5KQDA 1PJJA 3I4YA 2R6FA 4M9SA 1IN5A 3ZC7B 3J81S 3T15A 3U6SA 4LF8M 2EO2A 2QHOB 2UXDM 4MGZE 4LJ9A 3GLFB 2E5LM 2V1UA 1DGHA 2QSFX 3PVSA 2D7HA 2XGNA 5KQ8A 2FS1A 3HHXA 1SXJA 2D7GA 2CV1A 5FTNA 1JR3A 1IBMM 1OJLA 1XXHA 2L7IA 4IJFA 3U5ZA 4JI6M 4AG6A 1BVSA 3RGPA 1VG5A 3B7QA 4B3TM 5IWAM 1C1KA 1NSFA 1FNNA 3SYLA 3U6CA 3TWKA 3LCUA 4JI5M 1QYRA 2P5TA 4B3SM 4DV2M 2LBCA 3GLIA 3B74A 4B3MM 1DV0A 1XHBA 1UFZA 1YLAA 2CHQA 5FTJA 4NSRA 3TQSA 3HHYA 3L29A 1LTMA 3IECA 2OOAA 1AIPC 2KA6B 3HX3A 3PFIA 1R2YA 4X65M 2M5ZA 3ZH9B 5BPVA 2CHVA 4FCWA 2CRUA 4ZPXA 3LMMA 1EIJA 3KOZE 2FNAA 1OIPA 3AOGA 1ZV1A 1IXSA 3LW5F 4D80A 3SAWA 3B7ZA 1OTRA 4GIPA 2DHYA 2BJVA 4AKHA 3AFHA 1I94M 4GHLA 5A2QS 2KW0A 2O25A 3DZDA 3HHZA 3TE6A 3W0LB 1OKSA 2DNAA 1IFYA 1ZMUA 3KSXA 1NO1A 3SMPA 2DAMA 2CWBA 4YY3M 2WZJA 4GITA 2DKLA 3GLFA 2JY8A 2YNMD 3DOAA 4DR2M 4UN2B 1MU5A 3IG8A 4JI0M 1DGGA 2UXCM 2C96A 2L4EA 2R4JA 4PDIA 3GLFE 3I04M 2OO9A 2LWXA 3LCVB 5DYGA 4WURA 1GABA 1G71A 5EP4A 4KLNA 4R7GA 4GH9A 3QYEA 3GRUA 5IREB 5ITQA 3LQRA 4DV3M 2HKJA 2UUAM 4Z6YA 1NV8A 2FOIC 1R2ZA 3WHLA 4B08A 2R45A 3HJ8A 4HL4A 4DUYM 3GLHA 1PM5A 3SHGB 1J7KA 1DO2A 4P17A 3RE8A 4CISA 1TF0B 3L28A 4DV7M 1Q3CA 2C9OA 1TGUA 3AKZA 1GL6A 1N77A 2DWZB 2EJSA 3JR5A 4QHSA 3TPZA 2VIIA 2Y21A 4B7GA 2JUJA 2QP9X 5EXSA 1T3TA 2B3TA 3U6MA 3M7GA 3ZQJA 4M0WA 4II7A 3I51A 4GEWA 2JZ1A 4NOOB 4DUZM 5KPZA 1CUKA 4DV0M 4K0KM 4DV4M 4CGYB 1R5LA 4ANRA 4AW4A 3W67A 1TDZA 3SARA 3CF6E 1HNXM 4LF9M 2Z7JA 5EP1A 1TH3A 3AV0A 3KDSE 3GLHE 3GRRA 4G3OA 4MGIE 2DXIA 3FUVA 3FUTA 4L4UA 5L8RF 3U6EA 1GVNA 3GPYA 3ILKA 4G4RA 1NNJA 3V76A 2NQ8C 4RNAA 3T38A 4DR5M 4IIWA 1N36M 3I01M 1Q39A 4BLCA 1T6OA 1WXQA 1E94E 3TL4X 1NY6A 2ZAOA 3HGIA 4JI4M 3FTCA 4LGYA 2JNHA 4NRWA 1TH2A 3L25A 2QNJA 4LJ4A 4RF0A 4BBAA 3I4VA 3GO8A 4LRSA 1S3SA 4FCTA 1N33M 3K1JA 1QQWA 3MHVC 2OOBA 1G41A 2MR9A 1IY2A 3A98B 1WGLA 1PJQA 4IBEA 2BWBA 3L27A 4JI2M 1GKIA 3JAMS 1IN6A 4JI3M 4LCBA 3Q8XA 4NXMM 1KYIA 2LVAA 4JN6A 3T1YM 2XZFA 1G3IA 4B7FA 5EQTA 2LVOC 3HU1A 2ZTCA 3NBIA 3KOXE 2XZUA 3U5ZB 3NBXX 4LJ7A 3SMSA 4G4NA 1QUTA 1IXSB 2ZANA 1HR0M 3JR4A 2L4FA 4F2LA 2KNVA 1VQ1A 1XWIA 1NV9A 4FWHA 4XGIA 3C3EA 2QPAA 1HNZM 2XSZA 2DI0A 3THGA 1L2CA 1D2NA 1HNWM 3NWLA 1QZEA 1Y8GA 2XH9A 5E26A 3ZCBB 3U6QA 3T1HM 3U6LA 4IJEA 4G4OA 2FH0A 4WW0A 5DFLA 3LQQA 2Y20A 4FW9A 5FTMA 4RF1A 2EA0A 1HT1E 2DZNB 2KNZA 3MMPA 1P3QQ 2DAKA 1XB2B 4GKJM 1W5TA 1NHWC 1EFUB 1PGYA 2KNAA 2O01F 3K9OA 4I8OA 2QENA 4OW0A 2KXEA 3VDPA 4D81A 1OAOC 1XC8A 1L2DA 4GHAA 4DR7M 1OFIA 1QZMA 2CFOA 1IN7A 3QWLA 3KS8A 1ZAEA 4CIZA 1PJIA 3KW6A 3M6AA 4L16A 3KOYE 1DGBA 2XFSA 2DWNA 2BWEA 1X37A 2VF7A 1V33A 1AUAA 3SAVA 1MN3A 3HKPA 1WHCA 1F4IA 2WSEF 5EXPA 3GLHB 4YHHM 2J7NA 4NXNM 4GRIA 5H37D 5KO3A 2K9DA 4PD2A 4AQYM 2HHHM 2DHRA 2JP7A 4NSOB 1Z6TA 1V92A 3H4MA 4M9ZA 4HLQA 4BB9A 2I7PA 2DAIA 2ZBKB 3UZUA 2MJ5B 2C98A 2YR0A 4OX9M 2DAGA 4M9XA 4Y28F 3UK6A 3J27B 1Q02A 4QOSA 2DZOB 1HJPA 3FYCA 2Z3XA 2R4EA 4KHPM 1OAIA 2MGWA 3AOEC 5EP2A 3FUWA 2DZLA 2XSZD 2CE7A 2LVPC 1IY0A 3MK6A 2JY7A 1H6UA 3UMMA 3L26A 1VDDA 4IBCA 4M0DA 2MH8A 5FLXS 1WR1B 3GQ4A 4JI8M 1NY5A 2LVQD 4PCZA 2GNOA 3HY5A 1N34M 4LF6M 4A3VB 2VQFM 4AI6A 3SC3A 1TDHA 2QCUA 2K0BX 2ZAMA 3A42A 4KO8A 4OU7A 1DGHB 5FTLA 2LHCA 2HL7A 4OVZA 2X4AA 4LFBM 4JI1M 4D82A 1IXZA 3Q8GA 5BR8M 1G59A 5C18A 3HZJA 1XXHB 2RKOA 3LVWA 4IBKA 4Q7JA 3U6PA 3GRVA 3VLFB 3SATA 1SXJB 3IHPA 4MGHA 3AJIB 5ITTA 2UUCM 4IBBA 3VK7A 3E9SA 4L15A 5E6JA 2KZSA 3D8BA 2APLA 1XNQM 2JY5A 2JXNA 1XNRM 2H1RA 4B3RM 4LFCM 1DO0A 1K82A 4LZZA 4FD2A 5ITYA 2H5XA 2VF8A 1Z5AA 1VEJA 4OVZB 1J09A 1HQYE 1TTEA 2RRUA 2YQZA 2UU9M 4R71A 1R7RA 4JI7M 3K2LA 2QBYA 4X64M 4IBGA 3DA1A 1W5SA 4LZJA 2EKKA 3HU3A 4LF4M 3KP1E 4EIWA 5IT9S 3TWLA 3U6OA 2DVWB 1IBKM 2RGOA 3WHKA 4KT0F 2FE8A 4RKUF 3UGJA 1D0MA 4REZA 4CJ6A 3GLIE 1QVRA 1N32M 3CF0A 2UUBM 4JYAM 1PJTA 2J7OA 1K3XA 2Z4SA 4PDGA 3KP0E 5LMNM 1QDRA 2ERCA 2WSCF 3FE3A 3CF2A 3BOSA 1IM2A 3K8ZA 4S12A 4QNRA 1DGFA 1C7YA 3BXWA 5ITXE 4G4QA 3FRHA 2F5SA 4IBDA 4DV6M 1OFHA 4NRVA 3FKEA 2QBYB 4AKIA 2V1CA 3BBZA 2Z8YM 4WP2A 2XLJA 1XMQM 1N75A 1SXJE 2G3QA 1WJ7A 3IG5A 2R65A 5EJCA 1K3WA 1JR3D 3A46A 2LXEA 1G4AE 5DYIA 2KHHA 2G8LA 2JA2A 3RFWA 1RU3A 1IBLM 4MGYE 3R9XB 4LJ6A 3GRYA 1NHGC 1I4WA 3HJQA 2F5OA 1JB0F 2WSFF 4LJAA 4KODA 5EXTA 3FRIA 4LJ5A 1WGNA 2Z4RA 2CV2A 3KOWE 4L78A 3SBJA 1YUBA 4MH0E 2LNHC 1JQJC 1V34A 2JY6B 4AG5A 4LGMA
chains in the Genus database with same CATH topology
1R6BX 2L7HA 3OTOM 2VQEM 4TUWA 3GLGB 3KXEC 3FUXA 1EE8A 2LH0A 1LV7A 4PT5A 2C5RA 5IZ7D 3SYKA 1SXJC 3VKGA 4MGKE 4LF7M 4DR3M 2I7NA 1IN4A 2QZ4A 4GC5A 2F4VM 1HT2E 1GLNA 4P16A 1QANA 2Q2EB 1E32A 5JI3E 4QHTA 3L2AA 5EP3A 3VFDA 1KSFX 2K47A 8CATA 3C58A 3K92A 2A5YB 5JI2E 3GPXA 4R3DA 1L1TA 4I5SA 1FJGM 2X8AA 2OQ4A 3SAUA 4Z8XA 3GPUA 1QAMA 1NNUC 2XFTA 3AOEA 4LJ8A 2CEAA 3GLFA 3B9PA 3D8LA 3U6DA 4DR4M 4DR1M 2R18A 2OPFA 5FSWA 4MM3B 1UM8A 5ITUA 3J7AS 1L1ZA 4I81A 7CATA 4GMQA 4AKGA 5KPTA 1G8PA 3TWMA 5ITXA 3R8FA 3VKHA 4FVMA 1L2BA 3FTEA 3EIHA 2F5PA 2Y0TA 2R62A 2BJWA 2C99A 3GLIB 3QAUA 4LG2A 2AHMA 1Z59A 3PNYA 4IBIA 2KRKA 4B7HA 2CV0A 5C1BA 5DNYA 3PNVA 3J80S 4X62M 1HQCA 2XF3A 3GPPA 4GC9A 4LRTA 4FCVA 2CUZA 2UXBM 1YE9A 3LVVA 4NL4H 4JV5M 2F5NA 3HU2A 1ZQ9A 4QOZC 2RGHA 3KVWA 2YFQA 4GKKM 1QAOA 3PXGA 4DR6M 3MJ5A 3HJSA 3E4RA 4I4LA 1YSYA 3FUUA 4FWGA 2KZUA 2CHGA 3UJNA 3W0FA 5KPRA 4IBFA 3VDUA 1IXRC 3KS4A 3GP1A 4X66M 1Z5BA 1E9SA 4CHTB 2FFJA 2C9CA 4QNMA 4L8RC 3VK8A 3GQ5A 3CTWB 2DWMA 3FTDA 2EUCA 4JXJA 3GQ3A 4MB7A 2BNKA 3SFZA 3M0EA 3J7BA 3FTFA 2M60A 2DWLA 3FYDA 3U61B 1L8QA 2L6OA 2X49A 5ITRA 2ZM6M 3U60B 2Y0QA 4DV5M 1GL7A 1QAQA 4IBJA 2O5RA 4AZFA 4XBOA 2D7EA 4FWDA 4G6ZA 4ITQA 1E9RA 2XEPA 4DV1M 2V6ZM 2L09A 4LFAM 1TH4A 1IN8A 2HCBA 1SXJD 1Q3BA 5EXXA 5GKNA 1XMOM 3A45A 3KFUG 3HHWA 4LY6A 3HWSA 3J2PB 1NJFA 2G5GX 1J5EM 3SASA 5F3WA 1N78A 2KEBA 1IY1A 3EIEA 3AL0C 1KFVA 3SHFA 1NJGA 2R46A 3U61A 1ORYB 2W82A 3KSJA 3U60A 1MX0A 4LF5M 1Z5CA 3DFZA 2KRUA 5FTKA 1IQPA 3FD9A 3RGSA 1NVMA 2F5QA 3GLGA 4W5WA 5LMUM 5KQDA 1PJJA 3I4YA 3U6SA 4M9SA 1IN5A 3ZC7B 3J81S 3T15A 4LF8M 2EO2A 2UXDM 4MGZE 4LJ9A 3GLFB 2E5LM 2V1UA 1DGHA 3PVSA 2D7HA 2XGNA 5KQ8A 3HHXA 1SXJA 2D7GA 2CV1A 5FTNA 1JR3A 1IBMM 1OJLA 1XXHA 2L7IA 4IJFA 3U5ZA 4JI6M 4AG6A 3RGPA 4B3TM 5IWAM 1C1KA 1NSFA 1FNNA 3SYLA 3U6CA 3TWKA 4JI5M 1QYRA 2P5TA 4B3SM 4DV2M 3GLIA 4B3MM 1XHBA 2CHQA 5FTJA 4NSRA 3TQSA 3HHYA 3L29A 3PFIA 2KA6B 1R2YA 4X65M 2M5ZA 3ZH9B 5BPVA 2CHVA 4FCWA 4ZPXA 3LMMA 3KOZE 2FNAA 3AOGA 4D80A 3SAWA 4GIPA 2BJVA 4AKHA 3AFHA 1I94M 5A2QS 2KW0A 3DZDA 3HHZA 3TE6A 3W0LB 3KSXA 3SMPA 4YY3M 4GITA 2YNMD 3DOAA 4DR2M 1MU5A 3IG8A 4JI0M 1DGGA 2UXCM 2C96A 2R4JA 4PDIA 2LWXA 5DYGA 4WURA 5EP4A 4KLNA 4R7GA 4GH9A 3GRUA 5IREB 5ITQA 3LQRA 4DV3M 2HKJA 2UUAM 4Z6YA 2FOIC 1R2ZA 3WHLA 4B08A 2R45A 3HJ8A 4HL4A 4DUYM 3GLHA 1PM5A 3SHGB 1J7KA 1DO2A 3RE8A 4CISA 3L28A 4DV7M 1Q3CA 2C9OA 1TGUA 3AKZA 1GL6A 1N77A 2DWZB 3JR5A 4QHSA 3TPZA 2VIIA 2Y21A 4B7GA 2QP9X 5EXSA 1T3TA 3U6MA 3M7GA 4M0WA 4II7A 3I51A 4NOOB 4DUZM 5KPZA 4DV0M 4K0KM 4DV4M 4CGYB 4AW4A 1TDZA 3SARA 3CF6E 1HNXM 4LF9M 2Z7JA 5EP1A 1TH3A 3AV0A 3KDSE 3GRRA 4MGIE 2DXIA 3FUVA 3FUTA 4L4UA 3U6EA 1GVNA 3GPYA 3ILKA 4G4RA 1NNJA 2NQ8C 4RNAA 3T38A 4DR5M 4IIWA 1N36M 1Q39A 4BLCA 1WXQA 1E94E 3TL4X 1NY6A 2ZAOA 3HGIA 4JI4M 3FTCA 4LGYA 4NRWA 1TH2A 3L25A 4LJ4A 4RF0A 4BBAA 3I4VA 3GO8A 4LRSA 1S3SA 4FCTA 1N33M 3K1JA 1QQWA 3MHVC 1G41A 1IY2A 3A98B 4IBEA 3L27A 4JI2M 1GKIA 3JAMS 1IN6A 4JI3M 4LCBA 3Q8XA 4NXMM 1KYIA 3T1YM 4JN6A 2XZFA 1G3IA 4B7FA 5EQTA 3HU1A 3NBIA 3KOXE 2XZUA 3U5ZB 4LJ7A 3SMSA 4G4NA 1IXSB 2ZANA 1HR0M 3JR4A 4FWHA 1XWIA 4XGIA 1HNZM 2QPAA 2XSZA 3THGA 1L2CA 1D2NA 1HNWM 3NWLA 5E26A 3U6QA 2XH9A 3ZCBB 3T1HM 3U6LA 4IJEA 4G4OA 4WW0A 3LQQA 2Y20A 4FW9A 5FTMA 4RF1A 2EA0A 1HT1E 2DZNB 4GKJM 1W5TA 1NHWC 4I8OA 4OW0A 3VDPA 4D81A 2QENA 2KXEA 1XC8A 1L2DA 4GHAA 4DR7M 1OFIA 1QZMA 2CFOA 1IN7A 3QWLA 3KS8A 1ZAEA 1PJIA 3KW6A 3M6AA 4L16A 3KOYE 1DGBA 2XFSA 2DWNA 4GHLA 1X37A 3SAVA 3HKPA 5EXPA 3GLHB 4YHHM 2J7NA 4NXNM 4GRIA 5H37D 5KO3A 4PD2A 4AQYM 2HHHM 2DHRA 4NSOB 1Z6TA 3H4MA 4M9ZA 4HLQA 4BB9A 2I7PA 2ZBKB 3UZUA 2C98A 2YR0A 4OX9M 4M9XA 3UK6A 3J27B 4QOSA 2DZOB 3FYCA 2Z3XA 2R4EA 4KHPM 3AOEC 5EP2A 3FUWA 2XSZD 2CE7A 1IY0A 3MK6A 1H6UA 3UMMA 3L26A 1VDDA 4IBCA 4M0DA 5FLXS 3GQ4A 4JI8M 1NY5A 4PCZA 1N34M 4AI6A 4A3VB 2VQFM 3SC3A 1TDHA 2QCUA 2ZAMA 3A42A 4KO8A 4OU7A 1DGHB 5FTLA 2HL7A 4OVZA 2X4AA 4LFBM 4JI1M 4D82A 1IXZA 5BR8M 1G59A 5C18A 4IBKA 1XXHB 2RKOA 3LVWA 3U6PA 3GRVA 3VLFB 3SATA 1SXJB 5ITTA 4MGHA 3AJIB 2UUCM 4IBBA 3VK7A 3E9SA 4L15A 5E6JA 2KZSA 3D8BA 1XNQM 1XNRM 2H1RA 4B3RM 4LFCM 1DO0A 1K82A 4LZZA 4FD2A 5ITYA 1Z5AA 4OVZB 1J09A 1HQYE 2YQZA 2UU9M 1R7RA 4JI7M 3K2LA 2QBYA 4X64M 4IBGA 3DA1A 1W5SA 4LZJA 3HU3A 4LF4M 3KP1E 4EIWA 5IT9S 3TWLA 3U6OA 2DVWB 1IBKM 2RGOA 3WHKA 3UGJA 2FE8A 4REZA 1QVRA 1N32M 3CF0A 2UUBM 4JYAM 2J7OA 1K3XA 2Z4SA 4PDGA 3KP0E 5LMNM 2ERCA 3CF2A 3BOSA 1IM2A 3K8ZA 4S12A 4QNRA 1DGFA 5ITXE 4G4QA 2F5SA 4IBDA 4DV6M 1OFHA 4NRVA 3FKEA 2QBYB 4AKIA 2V1CA 4LF6M 1XMQM 2XLJA 1N75A 1SXJE 3IG5A 5EJCA 2R65A 1K3WA 1JR3D 3A46A 2LXEA 1G4AE 5DYIA 2G8LA 2JA2A 3RFWA 1IBLM 4MGYE 3R9XB 4LJ6A 3GRYA 1NHGC 1I4WA 3HJQA 2F5OA 4LJAA 4KODA 5EXTA 4LJ5A 2Z4RA 2CV2A 3KOWE 4L78A 3SBJA 1YUBA 4MH0E 2LNHC 1JQJC 4AG5A 4LGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHW C;  1NHG C;  1NNU C;  2FOI C;  2NQ8 C; 
#chains in the Genus database with same CATH topology
 1R6B X;  2L7H A;  3OTO M;  2VQE M;  1VEK A;  4TUW A;  3GLG B;  3KXE C;  3FUX A;  1EE8 A;  2LH0 A;  4XK8 F;  1LV7 A;  2HAK A;  4PT5 A;  2C5R A;  5IZ7 D;  1ZMV A;  3SYK A;  1SXJ C;  2DEN A;  3VKG A;  4MGK E;  4LF7 M;  1QDT A;  4DR3 M;  2I7N A;  1IN4 A;  2QZ4 A;  2J5Y A;  4GC5 A;  1GO5 A;  2F4V M;  1HT2 E;  1GLN A;  1VEG A;  4P16 A;  1QAN A;  2Q2E B;  1E32 A;  2EKF A;  3E21 A;  3C9P A;  5JI3 E;  4QHT A;  3L2A A;  2L2D A;  2DAE A;  2ZTD A;  5EP3 A;  3VFD A;  1KSF X;  2K47 A;  2VDB B;  8CAT A;  3C58 A;  3K92 A;  2A5Y B;  5JI2 E;  3GPX A;  4R3D A;  1L1T A;  4I5S A;  1OIZ A;  1FJG M;  2X8A A;  1QUS A;  2OQ4 A;  3SAU A;  4Z8X A;  3GPU A;  1QAM A;  1NNU C;  2XFT A;  3AOE A;  4LJ8 A;  2CEA A;  1TR8 A;  3B9P A;  3D8L A;  3U6D A;  4DR4 M;  4DR1 M;  1GJS A;  2R18 A;  1VDL A;  2OPF A;  5FSW A;  4MM3 B;  1UM8 A;  1ZMW A;  5ITU A;  3J7A S;  1L1Z A;  4I81 A;  7CAT A;  4GMQ A;  4AKG A;  5KPT A;  1G8P A;  3TWM A;  1PJS A;  1WIV A;  5ITX A;  3R8F A;  1D0K A;  3VKH A;  4FVM A;  1L2B A;  3FTE A;  2QQ8 A;  1GJT A;  3EIH A;  3T6P A;  2F5P A;  2Y0T A;  2R62 A;  2BJW A;  2C99 A;  3GLI B;  3QAU A;  1SG9 A;  4NC6 A;  4LG2 A;  2R44 A;  1R4G A;  2AHM A;  1Z59 A;  3CGW A;  3PNY A;  2KRK A;  4IBI A;  4B7H A;  2LHG A;  2CV0 A;  5C1B A;  5DNY A;  3C3D A;  3PNV A;  3J80 S;  4X62 M;  1HQC A;  2XF3 A;  3GPP A;  4GC9 A;  4LRT A;  2LVN C;  4FCV A;  2CUZ A;  2UXB M;  1YE9 A;  3LVV A;  4NL4 H;  4JV5 M;  2F5N A;  3QYB A;  2KDL A;  1MJG M;  3HU2 A;  1ZQ9 A;  4QOZ C;  3E46 A;  2RGH A;  3KVW A;  2YFQ A;  4GKK M;  1QAO A;  3PXG A;  4DR6 M;  3MJ5 A;  3HJS A;  2K6B A;  3E4R A;  2CP8 A;  4I4L A;  1YSY A;  3FUU A;  3W68 A;  4FWG A;  2KZU A;  2CHG A;  4L6V 6;  3UJN A;  3W0F A;  5KPR A;  4IBF A;  3VDU A;  1IXR C;  3KS4 A;  3GP1 A;  4X66 M;  1Z5B A;  1E9S A;  1OQY A;  4CHT B;  2FFJ A;  2C9C A;  4QNM A;  1XXH E;  4L8R C;  3VK8 A;  3GQ5 A;  3CTW B;  2DWM A;  1D0L A;  3FTD A;  2EUC A;  4JXJ A;  3GQ3 A;  4MB7 A;  2BNK A;  3SFZ A;  3M0E A;  3J7B A;  3FTF A;  2M60 A;  2DWL A;  3FYD A;  3U61 B;  1L8Q A;  2L6O A;  2X49 A;  5ITR A;  2ZM6 M;  3U60 B;  2Y0Q A;  4DV5 M;  1GL7 A;  1QAQ A;  4IBJ A;  2O5R A;  4AZF A;  4XBO A;  2MRO B;  2JZ0 A;  2D7E A;  3H4J A;  1PRB A;  4FWD A;  4G6Z A;  4ITQ A;  1E9R A;  4HEO A;  2XEP A;  4DV1 M;  1JR3 E;  2L09 A;  2V6Z M;  1TH4 A;  4LFA M;  1IN8 A;  2HCB A;  1SXJ D;  1Q3B A;  5EXX A;  5GKN A;  1XMO M;  3A45 A;  3KFU G;  3HHW A;  4LY6 A;  3HWS A;  2JWS A;  1NJF A;  3J2P B;  2G5G X;  1J5E M;  3SAS A;  5F3W A;  1N78 A;  2KEB A;  1IY1 A;  2GQF A;  2N35 A;  3EIE A;  1KFV A;  2R0I A;  3AL0 C;  3SHF A;  1NJG A;  1T43 A;  2R46 A;  3GLG E;  3U61 A;  2HWJ A;  1ORY B;  2W82 A;  4F1I A;  3KSJ A;  1A5T A;  4DBG B;  3U60 A;  3B89 A;  1MX0 A;  4LF5 M;  2LTU A;  3B7N A;  1Z5C A;  3DFZ A;  2KRU A;  5FTK A;  1IQP A;  3FD9 A;  3F92 A;  3K9P A;  3RGS A;  1NVM A;  2F5Q A;  3GLG A;  4W5W A;  5LMU M;  5KQD A;  1PJJ A;  3I4Y A;  2R6F A;  4M9S A;  1IN5 A;  3ZC7 B;  3J81 S;  3T15 A;  3U6S A;  4LF8 M;  2EO2 A;  2QHO B;  2UXD M;  4MGZ E;  4LJ9 A;  3GLF B;  2E5L M;  2V1U A;  1DGH A;  2QSF X;  3PVS A;  2D7H A;  2XGN A;  5KQ8 A;  2FS1 A;  3HHX A;  1SXJ A;  2D7G A;  2CV1 A;  5FTN A;  1JR3 A;  1IBM M;  1OJL A;  1XXH A;  2L7I A;  4IJF A;  3U5Z A;  4JI6 M;  4AG6 A;  1BVS A;  3RGP A;  1VG5 A;  3B7Q A;  4B3T M;  5IWA M;  1C1K A;  1NSF A;  1FNN A;  3SYL A;  3U6C A;  3TWK A;  3LCU A;  4JI5 M;  1QYR A;  2P5T A;  4B3S M;  4DV2 M;  2LBC A;  3GLI A;  3B74 A;  4B3M M;  1DV0 A;  1XHB A;  1UFZ A;  1YLA A;  2CHQ A;  5FTJ A;  4NSR A;  3TQS A;  3HHY A;  3L29 A;  1LTM A;  3IEC A;  2OOA A;  1AIP C;  2KA6 B;  3HX3 A;  3PFI A;  1R2Y A;  4X65 M;  2M5Z A;  3ZH9 B;  5BPV A;  2CHV A;  4FCW A;  2CRU A;  4ZPX A;  3LMM A;  1EIJ A;  3KOZ E;  2FNA A;  1OIP A;  3AOG A;  1ZV1 A;  1IXS A;  3LW5 F;  4D80 A;  3SAW A;  3B7Z A;  1OTR A;  4GIP A;  2DHY A;  2BJV A;  4AKH A;  3AFH A;  1I94 M;  4GHL A;  5A2Q S;  2KW0 A;  2O25 A;  3DZD A;  3HHZ A;  3TE6 A;  3W0L B;  1OKS A;  2DNA A;  1IFY A;  1ZMU A;  3KSX A;  1NO1 A;  3SMP A;  2DAM A;  2CWB A;  4YY3 M;  2WZJ A;  4GIT A;  2DKL A;  3GLF A;  2JY8 A;  2YNM D;  3DOA A;  4DR2 M;  4UN2 B;  1MU5 A;  3IG8 A;  4JI0 M;  1DGG A;  2UXC M;  2C96 A;  2L4E A;  2R4J A;  4PDI A;  3GLF E;  3I04 M;  2OO9 A;  2LWX A;  3LCV B;  5DYG A;  4WUR A;  1GAB A;  1G71 A;  5EP4 A;  4KLN A;  4R7G A;  4GH9 A;  3QYE A;  3GRU A;  5IRE B;  5ITQ A;  3LQR A;  4DV3 M;  2HKJ A;  2UUA M;  4Z6Y A;  1NV8 A;  2FOI C;  1R2Z A;  3WHL A;  4B08 A;  2R45 A;  3HJ8 A;  4HL4 A;  4DUY M;  3GLH A;  1PM5 A;  3SHG B;  1J7K A;  1DO2 A;  4P17 A;  3RE8 A;  4CIS A;  1TF0 B;  3L28 A;  4DV7 M;  1Q3C A;  2C9O A;  1TGU A;  3AKZ A;  1GL6 A;  1N77 A;  2DWZ B;  2EJS A;  3JR5 A;  4QHS A;  3TPZ A;  2VII A;  2Y21 A;  4B7G A;  2JUJ A;  2QP9 X;  5EXS A;  1T3T A;  2B3T A;  3U6M A;  3M7G A;  3ZQJ A;  4M0W A;  4II7 A;  3I51 A;  4GEW A;  2JZ1 A;  4NOO B;  4DUZ M;  5KPZ A;  1CUK A;  4DV0 M;  4K0K M;  4DV4 M;  4CGY B;  1R5L A;  4ANR A;  4AW4 A;  3W67 A;  1TDZ A;  3SAR A;  3CF6 E;  1HNX M;  4LF9 M;  2Z7J A;  5EP1 A;  1TH3 A;  3AV0 A;  3KDS E;  3GLH E;  3GRR A;  4G3O A;  4MGI E;  2DXI A;  3FUV A;  3FUT A;  4L4U A;  5L8R F;  3U6E A;  1GVN A;  3GPY A;  3ILK A;  4G4R A;  1NNJ A;  3V76 A;  2NQ8 C;  4RNA A;  3T38 A;  4DR5 M;  4IIW A;  1N36 M;  3I01 M;  1Q39 A;  4BLC A;  1T6O A;  1WXQ A;  1E94 E;  3TL4 X;  1NY6 A;  2ZAO A;  3HGI A;  4JI4 M;  3FTC A;  4LGY A;  2JNH A;  4NRW A;  1TH2 A;  3L25 A;  2QNJ A;  4LJ4 A;  4RF0 A;  4BBA A;  3I4V A;  3GO8 A;  4LRS A;  1S3S A;  4FCT A;  1N33 M;  3K1J A;  1QQW A;  3MHV C;  2OOB A;  1G41 A;  2MR9 A;  1IY2 A;  3A98 B;  1WGL A;  1PJQ A;  4IBE A;  2BWB A;  3L27 A;  4JI2 M;  1GKI A;  3JAM S;  1IN6 A;  4JI3 M;  4LCB A;  3Q8X A;  4NXM M;  1KYI A;  2LVA A;  4JN6 A;  3T1Y M;  2XZF A;  1G3I A;  4B7F A;  5EQT A;  2LVO C;  3HU1 A;  2ZTC A;  3NBI A;  3KOX E;  2XZU A;  3U5Z B;  3NBX X;  4LJ7 A;  3SMS A;  4G4N A;  1QUT A;  1IXS B;  2ZAN A;  1HR0 M;  3JR4 A;  2L4F A;  4F2L A;  2KNV A;  1VQ1 A;  1XWI A;  1NV9 A;  4FWH A;  4XGI A;  3C3E A;  2QPA A;  1HNZ M;  2XSZ A;  2DI0 A;  3THG A;  1L2C A;  1D2N A;  1HNW M;  3NWL A;  1QZE A;  1Y8G A;  2XH9 A;  5E26 A;  3ZCB B;  3U6Q A;  3T1H M;  3U6L A;  4IJE A;  4G4O A;  2FH0 A;  4WW0 A;  5DFL A;  3LQQ A;  2Y20 A;  4FW9 A;  5FTM A;  4RF1 A;  2EA0 A;  1HT1 E;  2DZN B;  2KNZ A;  3MMP A;  1P3Q Q;  2DAK A;  1XB2 B;  4GKJ M;  1W5T A;  1NHW C;  1EFU B;  1PGY A;  2KNA A;  2O01 F;  3K9O A;  4I8O A;  2QEN A;  4OW0 A;  2KXE A;  3VDP A;  4D81 A;  1OAO C;  1XC8 A;  1L2D A;  4GHA A;  4DR7 M;  1OFI A;  1QZM A;  2CFO A;  1IN7 A;  3QWL A;  3KS8 A;  1ZAE A;  4CIZ A;  1PJI A;  3KW6 A;  3M6A A;  4L16 A;  3KOY E;  1DGB A;  2XFS A;  2DWN A;  2BWE A;  1X37 A;  2VF7 A;  1V33 A;  1AUA A;  3SAV A;  1MN3 A;  3HKP A;  1WHC A;  1F4I A;  2WSE F;  5EXP A;  3GLH B;  4YHH M;  2J7N A;  4NXN M;  4GRI A;  5H37 D;  5KO3 A;  2K9D A;  4PD2 A;  4AQY M;  2HHH M;  2DHR A;  2JP7 A;  4NSO B;  1Z6T A;  1V92 A;  3H4M A;  4M9Z A;  4HLQ A;  4BB9 A;  2I7P A;  2DAI A;  2ZBK B;  3UZU A;  2MJ5 B;  2C98 A;  2YR0 A;  4OX9 M;  2DAG A;  4M9X A;  4Y28 F;  3UK6 A;  3J27 B;  1Q02 A;  4QOS A;  2DZO B;  1HJP A;  3FYC A;  2Z3X A;  2R4E A;  4KHP M;  1OAI A;  2MGW A;  3AOE C;  5EP2 A;  3FUW A;  2DZL A;  2XSZ D;  2CE7 A;  2LVP C;  1IY0 A;  3MK6 A;  2JY7 A;  1H6U A;  3UMM A;  3L26 A;  1VDD A;  4IBC A;  4M0D A;  2MH8 A;  5FLX S;  1WR1 B;  3GQ4 A;  4JI8 M;  1NY5 A;  2LVQ D;  4PCZ A;  2GNO A;  3HY5 A;  1N34 M;  4LF6 M;  4A3V B;  2VQF M;  4AI6 A;  3SC3 A;  1TDH A;  2QCU A;  2K0B X;  2ZAM A;  3A42 A;  4KO8 A;  4OU7 A;  1DGH B;  5FTL A;  2LHC A;  2HL7 A;  4OVZ A;  2X4A A;  4LFB M;  4JI1 M;  4D82 A;  1IXZ A;  3Q8G A;  5BR8 M;  1G59 A;  5C18 A;  3HZJ A;  1XXH B;  2RKO A;  3LVW A;  4IBK A;  4Q7J A;  3U6P A;  3GRV A;  3VLF B;  3SAT A;  1SXJ B;  3IHP A;  4MGH A;  3AJI B;  5ITT A;  2UUC M;  4IBB A;  3VK7 A;  3E9S A;  4L15 A;  5E6J A;  2KZS A;  3D8B A;  2APL A;  1XNQ M;  2JY5 A;  2JXN A;  1XNR M;  2H1R A;  4B3R M;  4LFC M;  1DO0 A;  1K82 A;  4LZZ A;  4FD2 A;  5ITY A;  2H5X A;  2VF8 A;  1Z5A A;  1VEJ A;  4OVZ B;  1J09 A;  1HQY E;  1TTE A;  2RRU A;  2YQZ A;  2UU9 M;  4R71 A;  1R7R A;  4JI7 M;  3K2L A;  2QBY A;  4X64 M;  4IBG A;  3DA1 A;  1W5S A;  4LZJ A;  2EKK A;  3HU3 A;  4LF4 M;  3KP1 E;  4EIW A;  5IT9 S;  3TWL A;  3U6O A;  2DVW B;  1IBK M;  2RGO A;  3WHK A;  4KT0 F;  2FE8 A;  4RKU F;  3UGJ A;  1D0M A;  4REZ A;  4CJ6 A;  3GLI E;  1QVR A;  1N32 M;  3CF0 A;  2UUB M;  4JYA M;  1PJT A;  2J7O A;  1K3X A;  2Z4S A;  4PDG A;  3KP0 E;  5LMN M;  1QDR A;  2ERC A;  2WSC F;  3FE3 A;  3CF2 A;  3BOS A;  1IM2 A;  3K8Z A;  4S12 A;  4QNR A;  1DGF A;  1C7Y A;  3BXW A;  5ITX E;  4G4Q A;  3FRH A;  2F5S A;  4IBD A;  4DV6 M;  1OFH A;  4NRV A;  3FKE A;  2QBY B;  4AKI A;  2V1C A;  3BBZ A;  2Z8Y M;  4WP2 A;  2XLJ A;  1XMQ M;  1N75 A;  1SXJ E;  2G3Q A;  1WJ7 A;  3IG5 A;  2R65 A;  5EJC A;  1K3W A;  1JR3 D;  3A46 A;  2LXE A;  1G4A E;  5DYI A;  2KHH A;  2G8L A;  2JA2 A;  3RFW A;  1RU3 A;  1IBL M;  4MGY E;  3R9X B;  4LJ6 A;  3GRY A;  1NHG C;  1I4W A;  3HJQ A;  2F5O A;  1JB0 F;  2WSF F;  4LJA A;  4KOD A;  5EXT A;  3FRI A;  4LJ5 A;  1WGN A;  2Z4R A;  2CV2 A;  3KOW E;  4L78 A;  3SBJ A;  1YUB A;  4MH0 E;  2LNH C;  1JQJ C;  1V34 A;  2JY6 B;  4AG5 A;  4LGM A; 
#chains in the Genus database with same CATH homology
 1R6B X;  2L7H A;  3OTO M;  2VQE M;  4TUW A;  3GLG B;  3KXE C;  3FUX A;  1EE8 A;  2LH0 A;  1LV7 A;  4PT5 A;  2C5R A;  5IZ7 D;  3SYK A;  1SXJ C;  3VKG A;  4MGK E;  4LF7 M;  4DR3 M;  2I7N A;  1IN4 A;  2QZ4 A;  4GC5 A;  2F4V M;  1HT2 E;  1GLN A;  4P16 A;  1QAN A;  2Q2E B;  1E32 A;  5JI3 E;  4QHT A;  3L2A A;  5EP3 A;  3VFD A;  1KSF X;  2K47 A;  8CAT A;  3C58 A;  3K92 A;  2A5Y B;  5JI2 E;  3GPX A;  4R3D A;  1L1T A;  4I5S A;  1FJG M;  2X8A A;  2OQ4 A;  3SAU A;  4Z8X A;  3GPU A;  1QAM A;  1NNU C;  2XFT A;  3AOE A;  4LJ8 A;  2CEA A;  3GLF A;  3B9P A;  3D8L A;  3U6D A;  4DR4 M;  4DR1 M;  2R18 A;  2OPF A;  5FSW A;  4MM3 B;  1UM8 A;  5ITU A;  3J7A S;  1L1Z A;  4I81 A;  7CAT A;  4GMQ A;  4AKG A;  5KPT A;  1G8P A;  3TWM A;  5ITX A;  3R8F A;  3VKH A;  4FVM A;  1L2B A;  3FTE A;  3EIH A;  2F5P A;  2Y0T A;  2R62 A;  2BJW A;  2C99 A;  3GLI B;  3QAU A;  4LG2 A;  2AHM A;  1Z59 A;  3PNY A;  4IBI A;  2KRK A;  4B7H A;  2CV0 A;  5C1B A;  5DNY A;  3PNV A;  3J80 S;  4X62 M;  1HQC A;  2XF3 A;  3GPP A;  4GC9 A;  4LRT A;  4FCV A;  2CUZ A;  2UXB M;  1YE9 A;  3LVV A;  4NL4 H;  4JV5 M;  2F5N A;  3HU2 A;  1ZQ9 A;  4QOZ C;  2RGH A;  3KVW A;  2YFQ A;  4GKK M;  1QAO A;  3PXG A;  4DR6 M;  3MJ5 A;  3HJS A;  3E4R A;  4I4L A;  1YSY A;  3FUU A;  4FWG A;  2KZU A;  2CHG A;  3UJN A;  3W0F A;  5KPR A;  4IBF A;  3VDU A;  1IXR C;  3KS4 A;  3GP1 A;  4X66 M;  1Z5B A;  1E9S A;  4CHT B;  2FFJ A;  2C9C A;  4QNM A;  4L8R C;  3VK8 A;  3GQ5 A;  3CTW B;  2DWM A;  3FTD A;  2EUC A;  4JXJ A;  3GQ3 A;  4MB7 A;  2BNK A;  3SFZ A;  3M0E A;  3J7B A;  3FTF A;  2M60 A;  2DWL A;  3FYD A;  3U61 B;  1L8Q A;  2L6O A;  2X49 A;  5ITR A;  2ZM6 M;  3U60 B;  2Y0Q A;  4DV5 M;  1GL7 A;  1QAQ A;  4IBJ A;  2O5R A;  4AZF A;  4XBO A;  2D7E A;  4FWD A;  4G6Z A;  4ITQ A;  1E9R A;  2XEP A;  4DV1 M;  2V6Z M;  2L09 A;  4LFA M;  1TH4 A;  1IN8 A;  2HCB A;  1SXJ D;  1Q3B A;  5EXX A;  5GKN A;  1XMO M;  3A45 A;  3KFU G;  3HHW A;  4LY6 A;  3HWS A;  3J2P B;  1NJF A;  2G5G X;  1J5E M;  3SAS A;  5F3W A;  1N78 A;  2KEB A;  1IY1 A;  3EIE A;  3AL0 C;  1KFV A;  3SHF A;  1NJG A;  2R46 A;  3U61 A;  1ORY B;  2W82 A;  3KSJ A;  3U60 A;  1MX0 A;  4LF5 M;  1Z5C A;  3DFZ A;  2KRU A;  5FTK A;  1IQP A;  3FD9 A;  3RGS A;  1NVM A;  2F5Q A;  3GLG A;  4W5W A;  5LMU M;  5KQD A;  1PJJ A;  3I4Y A;  3U6S A;  4M9S A;  1IN5 A;  3ZC7 B;  3J81 S;  3T15 A;  4LF8 M;  2EO2 A;  2UXD M;  4MGZ E;  4LJ9 A;  3GLF B;  2E5L M;  2V1U A;  1DGH A;  3PVS A;  2D7H A;  2XGN A;  5KQ8 A;  3HHX A;  1SXJ A;  2D7G A;  2CV1 A;  5FTN A;  1JR3 A;  1IBM M;  1OJL A;  1XXH A;  2L7I A;  4IJF A;  3U5Z A;  4JI6 M;  4AG6 A;  3RGP A;  4B3T M;  5IWA M;  1C1K A;  1NSF A;  1FNN A;  3SYL A;  3U6C A;  3TWK A;  4JI5 M;  1QYR A;  2P5T A;  4B3S M;  4DV2 M;  3GLI A;  4B3M M;  1XHB A;  2CHQ A;  5FTJ A;  4NSR A;  3TQS A;  3HHY A;  3L29 A;  3PFI A;  2KA6 B;  1R2Y A;  4X65 M;  2M5Z A;  3ZH9 B;  5BPV A;  2CHV A;  4FCW A;  4ZPX A;  3LMM A;  3KOZ E;  2FNA A;  3AOG A;  4D80 A;  3SAW A;  4GIP A;  2BJV A;  4AKH A;  3AFH A;  1I94 M;  5A2Q S;  2KW0 A;  3DZD A;  3HHZ A;  3TE6 A;  3W0L B;  3KSX A;  3SMP A;  4YY3 M;  4GIT A;  2YNM D;  3DOA A;  4DR2 M;  1MU5 A;  3IG8 A;  4JI0 M;  1DGG A;  2UXC M;  2C96 A;  2R4J A;  4PDI A;  2LWX A;  5DYG A;  4WUR A;  5EP4 A;  4KLN A;  4R7G A;  4GH9 A;  3GRU A;  5IRE B;  5ITQ A;  3LQR A;  4DV3 M;  2HKJ A;  2UUA M;  4Z6Y A;  2FOI C;  1R2Z A;  3WHL A;  4B08 A;  2R45 A;  3HJ8 A;  4HL4 A;  4DUY M;  3GLH A;  1PM5 A;  3SHG B;  1J7K A;  1DO2 A;  3RE8 A;  4CIS A;  3L28 A;  4DV7 M;  1Q3C A;  2C9O A;  1TGU A;  3AKZ A;  1GL6 A;  1N77 A;  2DWZ B;  3JR5 A;  4QHS A;  3TPZ A;  2VII A;  2Y21 A;  4B7G A;  2QP9 X;  5EXS A;  1T3T A;  3U6M A;  3M7G A;  4M0W A;  4II7 A;  3I51 A;  4NOO B;  4DUZ M;  5KPZ A;  4DV0 M;  4K0K M;  4DV4 M;  4CGY B;  4AW4 A;  1TDZ A;  3SAR A;  3CF6 E;  1HNX M;  4LF9 M;  2Z7J A;  5EP1 A;  1TH3 A;  3AV0 A;  3KDS E;  3GRR A;  4MGI E;  2DXI A;  3FUV A;  3FUT A;  4L4U A;  3U6E A;  1GVN A;  3GPY A;  3ILK A;  4G4R A;  1NNJ A;  2NQ8 C;  4RNA A;  3T38 A;  4DR5 M;  4IIW A;  1N36 M;  1Q39 A;  4BLC A;  1WXQ A;  1E94 E;  3TL4 X;  1NY6 A;  2ZAO A;  3HGI A;  4JI4 M;  3FTC A;  4LGY A;  4NRW A;  1TH2 A;  3L25 A;  4LJ4 A;  4RF0 A;  4BBA A;  3I4V A;  3GO8 A;  4LRS A;  1S3S A;  4FCT A;  1N33 M;  3K1J A;  1QQW A;  3MHV C;  1G41 A;  1IY2 A;  3A98 B;  4IBE A;  3L27 A;  4JI2 M;  1GKI A;  3JAM S;  1IN6 A;  4JI3 M;  4LCB A;  3Q8X A;  4NXM M;  1KYI A;  3T1Y M;  4JN6 A;  2XZF A;  1G3I A;  4B7F A;  5EQT A;  3HU1 A;  3NBI A;  3KOX E;  2XZU A;  3U5Z B;  4LJ7 A;  3SMS A;  4G4N A;  1IXS B;  2ZAN A;  1HR0 M;  3JR4 A;  4FWH A;  1XWI A;  4XGI A;  1HNZ M;  2QPA A;  2XSZ A;  3THG A;  1L2C A;  1D2N A;  1HNW M;  3NWL A;  5E26 A;  3U6Q A;  2XH9 A;  3ZCB B;  3T1H M;  3U6L A;  4IJE A;  4G4O A;  4WW0 A;  3LQQ A;  2Y20 A;  4FW9 A;  5FTM A;  4RF1 A;  2EA0 A;  1HT1 E;  2DZN B;  4GKJ M;  1W5T A;  1NHW C;  4I8O A;  4OW0 A;  3VDP A;  4D81 A;  2QEN A;  2KXE A;  1XC8 A;  1L2D A;  4GHA A;  4DR7 M;  1OFI A;  1QZM A;  2CFO A;  1IN7 A;  3QWL A;  3KS8 A;  1ZAE A;  1PJI A;  3KW6 A;  3M6A A;  4L16 A;  3KOY E;  1DGB A;  2XFS A;  2DWN A;  4GHL A;  1X37 A;  3SAV A;  3HKP A;  5EXP A;  3GLH B;  4YHH M;  2J7N A;  4NXN M;  4GRI A;  5H37 D;  5KO3 A;  4PD2 A;  4AQY M;  2HHH M;  2DHR A;  4NSO B;  1Z6T A;  3H4M A;  4M9Z A;  4HLQ A;  4BB9 A;  2I7P A;  2ZBK B;  3UZU A;  2C98 A;  2YR0 A;  4OX9 M;  4M9X A;  3UK6 A;  3J27 B;  4QOS A;  2DZO B;  3FYC A;  2Z3X A;  2R4E A;  4KHP M;  3AOE C;  5EP2 A;  3FUW A;  2XSZ D;  2CE7 A;  1IY0 A;  3MK6 A;  1H6U A;  3UMM A;  3L26 A;  1VDD A;  4IBC A;  4M0D A;  5FLX S;  3GQ4 A;  4JI8 M;  1NY5 A;  4PCZ A;  1N34 M;  4AI6 A;  4A3V B;  2VQF M;  3SC3 A;  1TDH A;  2QCU A;  2ZAM A;  3A42 A;  4KO8 A;  4OU7 A;  1DGH B;  5FTL A;  2HL7 A;  4OVZ A;  2X4A A;  4LFB M;  4JI1 M;  4D82 A;  1IXZ A;  5BR8 M;  1G59 A;  5C18 A;  4IBK A;  1XXH B;  2RKO A;  3LVW A;  3U6P A;  3GRV A;  3VLF B;  3SAT A;  1SXJ B;  5ITT A;  4MGH A;  3AJI B;  2UUC M;  4IBB A;  3VK7 A;  3E9S A;  4L15 A;  5E6J A;  2KZS A;  3D8B A;  1XNQ M;  1XNR M;  2H1R A;  4B3R M;  4LFC M;  1DO0 A;  1K82 A;  4LZZ A;  4FD2 A;  5ITY A;  1Z5A A;  4OVZ B;  1J09 A;  1HQY E;  2YQZ A;  2UU9 M;  1R7R A;  4JI7 M;  3K2L A;  2QBY A;  4X64 M;  4IBG A;  3DA1 A;  1W5S A;  4LZJ A;  3HU3 A;  4LF4 M;  3KP1 E;  4EIW A;  5IT9 S;  3TWL A;  3U6O A;  2DVW B;  1IBK M;  2RGO A;  3WHK A;  3UGJ A;  2FE8 A;  4REZ A;  1QVR A;  1N32 M;  3CF0 A;  2UUB M;  4JYA M;  2J7O A;  1K3X A;  2Z4S A;  4PDG A;  3KP0 E;  5LMN M;  2ERC A;  3CF2 A;  3BOS A;  1IM2 A;  3K8Z A;  4S12 A;  4QNR A;  1DGF A;  5ITX E;  4G4Q A;  2F5S A;  4IBD A;  4DV6 M;  1OFH A;  4NRV A;  3FKE A;  2QBY B;  4AKI A;  2V1C A;  4LF6 M;  1XMQ M;  2XLJ A;  1N75 A;  1SXJ E;  3IG5 A;  5EJC A;  2R65 A;  1K3W A;  1JR3 D;  3A46 A;  2LXE A;  1G4A E;  5DYI A;  2G8L A;  2JA2 A;  3RFW A;  1IBL M;  4MGY E;  3R9X B;  4LJ6 A;  3GRY A;  1NHG C;  1I4W A;  3HJQ A;  2F5O A;  4LJA A;  4KOD A;  5EXT A;  4LJ5 A;  2Z4R A;  2CV2 A;  3KOW E;  4L78 A;  3SBJ A;  1YUB A;  4MH0 E;  2LNH C;  1JQJ C;  4AG5 A;  4LGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...