1NHGC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords enoyl-acyl carrier reductase
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 17
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nhgC00
1NNUC 1NHGC 2NQ8C 1NHWC 2FOIC
chains in the Genus database with same CATH superfamily
1YLAA 1ZQ9A 5DYGA 4M9XA 3GLIB 3SAUA 3AOEA 3C3EA 4F1IA 4W5WA 3U60A 3GLGE 4ZPXA 1L2DA 4B3SM 4AG5A 3I04M 3HZJA 4BBAA 1GL6A 1V34A 1OQYA 5KQ8A 4FCVA 4GC5A 3VDPA 2KDLA 1L1ZA 1SXJA 1FNNA 2HHHM 1N78A 1ZMVA 3FUVA 2AHMA 1MU5A 2Q2EB 1JR3A 2R18A 2GQFA 1C7YA 1VG5A 3SYKA 2DXIA 4IBJA 1XWIA 1XXHA 1NSFA 1YE9A 3GRUA 1GL7A 2ZTDA 3KFUG 2RRUA 4QOZC 1DV0A 2XGNA 2F5QA 1J5EM 1D2NA 2APLA 4RNAA 4G3OA 2Z4RA 4GITA 2P5TA 4UN2B 1V92A 4YHHM 1GABA 1Z59A 1XC8A 2UU9M 2HWJA 2MR9A 1DGHB 4HLQA 3GLIA 2L2DA 3WHKA 1WXQA 1HQCA 4CGYB 2V6ZM 1HNZM 2DNAA 2DWMA 1Y8GA 1JR3E 1V33A 2DAKA 2UUBM 3M0EA 2XEPA 4MM3B 5FTJA 2L7IA 1XXHE 3B7NA 4D82A 4M9ZA 2J7OA 2KHHA 2Z4SA 2F5SA 3KSXA 2CFOA 2KA6B 2ZTCA 3RGSA 5FSWA 1IN6A 3DZDA 2XF3A 3ZQJA 4II7A 1AUAA 4LF9M 2XFSA 2YR0A 3UMMA 3RFWA 3LW5F 3UK6A 3GQ4A 4FWGA 4KLNA 1W5TA 3FE3A 4I5SA 2KRKA 1OFIA 4MH0E 3LMMA 3UZUA 4CHTB 2J7NA 2JZ1A 5IWAM 2R46A 3VKGA 3HJQA 1L2BA 1Z5BA 1FJGM 2KNZA 3IG8A 3HHWA 1HNXM 3PNYA 4L8RC 2RGOA 2DZOB 2K9DA 2X8AA 3U6OA 3CF6E 5FLXS 3GQ3A 2YNMD 3T6PA 2R4JA 3SC3A 4Y28F 3FUTA 3V76A 2DWLA 2DAMA 3GRYA 2L7HA 2CV1A 1IXZA 1D0KA 1DGBA 2CHVA 3U6LA 2JA2A 5ITXE 3GQ5A 2EKKA 3BBZA 2I7NA 2ZBKB 3GO8A 1XNRM 3BOSA 1TGUA 4L4UA 4RF1A 5KQDA 5LMNM 4DR5M 3CGWA 1QVRA 3HHXA 5DFLA 1XNQM 4DV6M 1IBMM 1D0LA 3GLHB 1YUBA 3GLFB 1Q3BA 2F5NA 1C1KA 5IT9S 2CEAA 2R62A 4B3RM 1PGYA 3TWMA 1GLNA 4NRVA 1IFYA 4LF8M 3KVWA 1RU3A 1N34M 3NWLA 2GNOA 3HX3A 5LMUM 4IIWA 2DAIA 3LVWA 4OX9M 2VQEM 4B7FA 4R3DA 5C1BA 3NBIA 8CATA 2LVOC 1PJTA 4LFBM 1DO0A 5JI2E 3HWSA 3C58A 4GHAA 2HAKA 4WW0A 1IY2A 1ZMWA 2XZUA 3HHZA 1K3WA 3FUWA 3SHFA 1PRBA 4PD2A 3C3DA 3B89A 1I4WA 3JR4A 4L16A 3AOEC 1TR8A 1W5SA 1L8QA 3UGJA 3J7AS 3B7ZA 1IBLM 4M0DA 4Z8XA 2NQ8C 4QHSA 5ITQA 1EIJA 3GLHA 3J27B 1NNJA 2LNHC 4LJAA 1G41A 1IY0A 2L4FA 3WHLA 4DR2M 4GRIA 3K8ZA 1SXJC 3SFZA 5F3WA 2DVWB 1G4AE 1QAQA 3K9PA 2G5GX 3FTCA 3EIEA 3VDUA 3JAMS 4X65M 2QPAA 1E94E 3MK6A 4ITQA 3K9OA 2K0BX 3GPYA 1HT2E 3IG5A 4OW0A 3KDSE 1DGFA 1QAOA 3GLHE 4FD2A 4TUWA 1EFUB 4NL4H 4LF6M 1XHBA 2B3TA 4NXNM 4DV1M 4AW4A 3MMPA 4AKGA 3KP0E 2QHOB 4LJ8A 1KYIA 4MGZE 1P3QQ 4AG6A 1BVSA 1HJPA 4FWHA 4IJEA 3U6CA 3FTEA 4JI7M 2DAEA 2L09A 3E9SA 1VQ1A 2CHQA 4FWDA 4LJ5A 4I8OA 1UM8A 5EJCA 4K0KM 4REZA 1TTEA 4RKUF 2LHCA 2VIIA 4LJ4A 4JI4M 3L29A 3KOYE 4JYAM 1NY6A 3RGPA 3KP1E 4JI1M 3FD9A 3L27A 4WURA 1SXJE 3KOZE 2VF7A 3U6PA 3T1YM 3W67A 2WSFF 2Z8YM 4MGHA 3SMPA 4FVMA 1NO1A 2KW0A 1VEKA 4JXJA 1QQWA 4JI0M 5BPVA 4OU7A 2C5RA 3FKEA 2Y0TA 1N75A 5EXSA 3KS8A 4CISA 3R8FA 3VK8A 3D8BA 2OOAA 4MGYE 2FH0A 3HU1A 4LZZA 4NXMM 1F4IA 3VKHA 1Q02A 2XLJA 2JNHA 4NOOB 2KRUA 3JR5A 2BJWA 3BXWA 3GLIE 3LVVA 2JWSA 3DFZA 4PDIA 1XMQM 2LVAA 4QNMA 3KOXE 1NJFA 1HT1E 2M60A 3CF0A 2OQ4A 2CE7A 2A5YB 2BWEA 4IBFA 3R9XB 1NHWC 5H37D 1DGHA 1OTRA 2C9CA 3NBXX 4DR6M 2F5OA 1WGNA 1TDHA 2LTUA 4AI6A 3U5ZB 1OAOC 3AKZA 3SATA 2O5RA 2XZFA 4AKHA 4LZJA 2KNAA 2XSZD 4LJ9A 2D7GA 2FS1A 5KO3A 4WP2A 4BLCA 3KXEC 3TE6A 2X49A 4JI3M 1PJQA 2MROB 3SHGB 3U6QA 5DYIA 1NHGC 3KS4A 4G6ZA 1E32A 2R0IA 5ITUA 4S12A 3TWKA 1N36M 3T15A 4X62M 2WSEF 2D7HA 3DOAA 4X64M 4JI8M 1TH3A 5EQTA 2JP7A 5E6JA 4DV5M 2V1UA 3MJ5A 2HKJA 1ZMUA 3M7GA 2MJ5B 4GH9A 3U6DA 3U6MA 4NSOB 2UUAM 3W0FA 2UUCM 5FTMA 3A98B 4DUZM 2HCBA 5BR8M 1D0MA 1E9SA 1T6OA 4HEOA 4ANRA 3D8LA 2RKOA 1DGGA 4GEWA 1IN5A 3FRIA 4QNRA 3U5ZA 2OOBA 1QDRA 1MJGM 2JZ0A 1QZEA 4GMQA 4DV0M 1PJJA 3U61B 3L25A 2CV2A 5KPRA 3PFIA 3B9PA 4P17A 2K6BA 3J81S 2DHRA 3GP1A 3SBJA 1UFZA 1I94M 3GLGB 3L28A 4IBKA 3C9PA 4LRSA 1IXSB 1Q3CA 5E26A 5IZ7D 3ZH9B 4D81A 4RF0A 4DR3M 5EP4A 3W68A 2DZNB 2LVNC 5FTKA 2KEBA 5EXXA 4R7GA 2XSZA 2QBYB 5C18A 3SYLA 2R44A 3QWLA 3Q8GA 2C9OA 4IBDA 1R7RA 4BB9A 1N77A 3GLFA 1QUSA 2MGWA 2QZ4A 4DV4M 3W0LB 1JB0F 1TH2A 2BWBA 3U60B 4B7GA 3HY5A 4XGIA 3SAVA 3FTFA 2MH8A 2CP8A 3IECA 4JI2M 1AIPC 4A3VB 3I01M 2KZUA 2QQ8A 5L8RF 1QYRA 2JY5A 1VEJA 2O01F 3U61A 4LJ7A 4DV2M 5EXPA 2EO2A 1OAIA 2QSFX 1KFVA 3GRVA 2H5XA 4LFCM 2C99A 3I4YA 3GLFE 3SASA 2QCUA 3GLGA 1MN3A 1VEGA 2CUZA 2RGHA 1E9RA 1IXSA 4L78A 2J5YA 2EUCA 3A45A 4LCBA 1TF0B 1IY1A 3ILKA 4AZFA 1ZV1A 2KZSA 2VQFM 3U6EA 3PNVA 3SARA 1XXHB 2DHYA 2X4AA 4Z6YA 2QBYA 4JI5M 1PJIA 4PCZA 1JQJC 4LG2A 3J2PB 3GPUA 3ZCBB 4LF5M 2OO9A 3AOGA 1Q39A 2W82A 3LCUA 4LRTA 1VDLA 2CHGA 4LF4M 1IBKM 4DR7M 4KHPM 2O25A 3T38A 1G3IA 2HL7A 1IN4A 1NNUC 4XBOA 4P16A 4QHTA 5FTNA 2V1CA 2DENA 3H4MA 5EP1A 5DNYA 1J7KA 1X37A 4HL4A 2DWZB 4B7HA 2XH9A 3SAWA 1LTMA 1OIPA 3UJNA 1OIZA 4DV3M 2QNJA 3HU3A 3H4JA 4JI6M 2UXBM 3J7BA 1QAMA 1GJSA 1G59A 2DKLA 2DZLA 2UXDM 4DBGB 2YFQA 5IREB 4DR1M 1PJSA 2EJSA 5JI3E 4LGMA 3T1HM 3I51A 1DO2A 1L1TA 2R65A 1NJGA 2LXEA 3AFHA 1GVNA 1R4GA 2BNKA 3CTWB 2FOIC 5A2QS 2I7PA 2JY8A 2JY6B 1Z5CA 5ITYA 2JUJA 2DWNA 1HQYE 1IQPA 2CRUA 3SMSA 4KO8A 2L4EA 3VFDA 4G4QA 2Y21A 4KODA 3F92A 4CIZA 2K47A 3GRRA 2JXNA 5EP3A 2R45A 4OVZB 5ITRA 3KOWE 3GPXA 2JY7A 4I81A 4NC6A 3THGA 3VLFB 1GKIA 3TL4X 2FFJA 2LVPC 3L2AA 3M6AA 4GKJM 1WHCA 3LQQA 2ZM6M 3E21A 1IN7A 5EP2A 1ORYB 2WSCF 3AV0A 3QYBA 4IBBA 4LJ6A 2VDBB 5KPZA 2ZAOA 2ERCA 3U6SA 4GKKM 1R5LA 3AJIB 2ZANA 3E46A 2QP9X 4IBIA 1R2YA 4GIPA 2C98A 1WGLA 3FYDA 4FW9A 4LGYA 4G4RA 3PVSA 1TDZA 4PT5A 4MB7A 4KT0F 1ZAEA 5ITXA 4MGKE 1GO5A 5EXTA 1T3TA 2F4VM 2D7EA 4MGIE 1EE8A 3MHVC 3L26A 1L2CA 4B3TM 1T43A 4GHLA 1A5TA 3IHPA 5KPTA 1VDDA 2FE8A 2XFTA 3B7QA 4GC9A 1Z5AA 2FNAA 4M9SA 1GJTA 4B3MM 1XMOM 3ZC7B 1MX0A 2Z7JA 4OVZA 7CATA 1G71A 3Q8XA 4Q7JA 4R71A 4QOSA 1PM5A 1WIVA 2LH0A 1N33M 4I4LA 1OKSA 1TH4A 4PDGA 3A46A 5FTLA 4M0WA 2Z3XA 1QUTA 3LCVB 1LV7A 3LQRA 3J80S 2CV0A 2OPFA 5ITTA 3GPPA 4IBGA 4X66M 3OTOM 4LFAM 1WJ7A 2N35A 4F2LA 2Y0QA 2H1RA 1J09A 2R6FA 2ZAMA 3HJ8A 4D80A 2DAGA 5GKNA 3A42A 3E4RA 3HU2A 3EIHA 1N32M 4NRWA 1G8PA 4IBCA 2E5LM 1R6BX 2LBCA 4JV5M 1R2ZA 1WR1B 1NVMA 2LWXA 2VF8A 4AQYM 4DV7M 3QYEA 2LVQD 2G3QA 3DA1A 4B08A 4LF7M 1HNWM 4DUYM 2G8LA 3HKPA 4FCWA 3QAUA 1SXJD 4G4NA 3FTDA 3TQSA 3AL0C 1IXRC 3FRHA 2M5ZA 4L15A 2KXEA 2UXCM 2L6OA 3FYCA 3HJSA 2R4EA 3TPZA 1XB2B 2C96A 2LHGA 1SG9A 1JR3D 1NY5A 3B74A 4IJFA 1HR0M 3K1JA 1Z6TA 2YQZA 1QANA 4JN6A 4CJ6A 3I4VA 3HGIA 4EIWA 3HHYA 1SXJB 4YY3M 3TWLA 3VK7A 1H6UA 1OJLA 1S3SA 1QDTA 4L6V6 4FCTA 4XK8F 1NV8A 3FUXA 1OFHA 3FUUA 4G4OA 3K2LA 2KNVA 3K92A 4NSRA 2F5PA 2Y20A 1QZMA 1NV9A 1K3XA 3RE8A 2BJVA 4DR4M 1CUKA 1KSFX 1IM2A 2CWBA 1IN8A 3KW6A 1K82A 2QENA 2WZJA 3CF2A 3KSJA 1YSYA 4LY6A 3PXGA 4IBEA 2EKFA 2EA0A 4AKIA 2DI0A
chains in the Genus database with same CATH topology
1ZQ9A 5DYGA 4M9XA 3GLIB 3SAUA 3AOEA 4W5WA 3U60A 4ZPXA 1L2DA 4B3SM 4AG5A 4BBAA 1GL6A 5KQ8A 4FCVA 4GC5A 3VDPA 1L1ZA 1SXJA 1FNNA 2HHHM 1N78A 3FUVA 2AHMA 1MU5A 2Q2EB 1JR3A 2R18A 3SYKA 2DXIA 4IBJA 1XWIA 1XXHA 1NSFA 1YE9A 3GRUA 1GL7A 3KFUG 4QOZC 2XGNA 2F5QA 1J5EM 1D2NA 4RNAA 2Z4RA 4GITA 2P5TA 4YHHM 1Z59A 1XC8A 2UU9M 1DGHB 4HLQA 3GLIA 3WHKA 1WXQA 1HQCA 4CGYB 2V6ZM 1HNZM 2DWMA 2UUBM 3M0EA 2XEPA 4MM3B 5FTJA 2L7IA 4D82A 4M9ZA 2J7OA 2Z4SA 2F5SA 3KSXA 2CFOA 2KA6B 3RGSA 5FSWA 1IN6A 3DZDA 2XF3A 4II7A 4LF9M 2XFSA 2YR0A 3UMMA 3RFWA 3UK6A 3GQ4A 4FWGA 4KLNA 1W5TA 4I5SA 2KRKA 1OFIA 4MH0E 3LMMA 3UZUA 4CHTB 2J7NA 5IWAM 2R46A 3VKGA 3HJQA 1L2BA 1Z5BA 1FJGM 3IG8A 3HHWA 1HNXM 3PNYA 4L8RC 2RGOA 2DZOB 2X8AA 3U6OA 3CF6E 5FLXS 3GQ3A 2YNMD 2R4JA 3SC3A 3FUTA 2DWLA 3GRYA 2L7HA 2CV1A 1IXZA 1DGBA 2CHVA 3U6LA 2JA2A 5ITXE 3GQ5A 2I7NA 2ZBKB 3GO8A 1XNRM 3BOSA 1TGUA 4L4UA 4RF1A 5KQDA 5LMNM 4DR5M 1QVRA 3HHXA 1XNQM 4DV6M 1IBMM 3GLHB 1YUBA 3GLFB 1Q3BA 2F5NA 1C1KA 5IT9S 2CEAA 2R62A 3TWMA 1GLNA 4NRVA 4LF8M 3KVWA 1N34M 3NWLA 5LMUM 4IIWA 3LVWA 4OX9M 2VQEM 4B7FA 4R3DA 5C1BA 3NBIA 8CATA 4LFBM 1DO0A 5JI2E 3HWSA 3C58A 4GHAA 4WW0A 1IY2A 2XZUA 3HHZA 1K3WA 3FUWA 3SHFA 4PD2A 1I4WA 3JR4A 4L16A 3AOEC 1W5SA 1L8QA 3UGJA 3J7AS 1IBLM 4M0DA 4Z8XA 2NQ8C 4QHSA 5ITQA 3GLHA 3J27B 1NNJA 2LNHC 4LJAA 1G41A 1IY0A 3WHLA 4DR2M 4GRIA 3K8ZA 1SXJC 3SFZA 5F3WA 2DVWB 1G4AE 1QAQA 2G5GX 3FTCA 3EIEA 3VDUA 3JAMS 4X65M 2QPAA 1E94E 3MK6A 4ITQA 3GPYA 1HT2E 3IG5A 4OW0A 3KDSE 1DGFA 1QAOA 4FD2A 4TUWA 4NL4H 4LF6M 1XHBA 4NXNM 4DV1M 4AW4A 4AKGA 3KP0E 4LJ8A 1KYIA 4MGZE 4AG6A 4FWHA 4IJEA 3U6CA 3FTEA 4JI7M 2L09A 3E9SA 2CHQA 4FWDA 4LJ5A 4I8OA 1UM8A 5EJCA 4K0KM 4REZA 2VIIA 4LJ4A 4JI4M 3L29A 3KOYE 4JYAM 1NY6A 3RGPA 3KP1E 4JI1M 3FD9A 3L27A 4WURA 1SXJE 3KOZE 3U6PA 3T1YM 4MGHA 3SMPA 4FVMA 2KW0A 4JXJA 4JI0M 1QQWA 5BPVA 4OU7A 2C5RA 3FKEA 2Y0TA 1N75A 5EXSA 3KS8A 4CISA 3R8FA 3VK8A 3D8BA 4MGYE 3HU1A 4LZZA 4NXMM 3VKHA 2XLJA 4NOOB 2KRUA 3JR5A 2BJWA 3LVVA 3DFZA 4PDIA 1XMQM 4QNMA 3KOXE 1NJFA 1HT1E 2M60A 3CF0A 2OQ4A 2CE7A 2A5YB 4IBFA 3R9XB 1NHWC 5H37D 1DGHA 2C9CA 4DR6M 2F5OA 1TDHA 4AI6A 3U5ZB 3AKZA 3SATA 2O5RA 2XZFA 4AKHA 4LZJA 2XSZD 4LJ9A 2D7GA 5KO3A 4BLCA 3KXEC 3TE6A 2X49A 4JI3M 3SHGB 3U6QA 5DYIA 1NHGC 3KS4A 4G6ZA 1E32A 5ITUA 4S12A 3TWKA 1N36M 3T15A 4X62M 3DOAA 2D7HA 4X64M 4JI8M 1TH3A 5EQTA 5E6JA 4DV5M 2V1UA 3MJ5A 2HKJA 3M7GA 3U6DA 4GH9A 3U6MA 2UUAM 2UUCM 4NSOB 3W0FA 5FTMA 3A98B 4DUZM 2HCBA 5BR8M 1E9SA 3D8LA 2RKOA 1DGGA 4QNRA 1IN5A 3U5ZA 4GMQA 4DV0M 1PJJA 3U61B 3L25A 2CV2A 5KPRA 3PFIA 3B9PA 3J81S 3GP1A 3SBJA 2DHRA 1I94M 3GLGB 3L28A 4IBKA 4LRSA 5E26A 1IXSB 1Q3CA 4D81A 5IZ7D 3ZH9B 4DR3M 4RF0A 5EP4A 2DZNB 5FTKA 2KEBA 5EXXA 4R7GA 2XSZA 2QBYB 5C18A 3SYLA 3QWLA 2C9OA 4IBDA 1R7RA 4BB9A 1N77A 3GLFA 2QZ4A 4DV4M 3W0LB 1TH2A 3U60B 4B7GA 4XGIA 3SAVA 3FTFA 4JI2M 4A3VB 2KZUA 1QYRA 3U61A 4LJ7A 4DV2M 5EXPA 2EO2A 1KFVA 3GRVA 4LFCM 2C99A 3I4YA 3SASA 4B3RM 2QCUA 3GLGA 2RGHA 2CUZA 1E9RA 4L78A 3A45A 2EUCA 4LCBA 3ILKA 1IY1A 4AZFA 2VQFM 2KZSA 3SARA 3U6EA 3PNVA 1XXHB 2X4AA 4Z6YA 2QBYA 4JI5M 1PJIA 4PCZA 1JQJC 4LG2A 3J2PB 3GPUA 3ZCBB 4LF5M 3AOGA 1Q39A 2W82A 4LRTA 2CHGA 4LF4M 1IBKM 4DR7M 4KHPM 3T38A 1G3IA 2HL7A 1IN4A 1NNUC 4XBOA 4P16A 4QHTA 5FTNA 2V1CA 3H4MA 5EP1A 5DNYA 1J7KA 1X37A 4HL4A 2DWZB 4B7HA 2XH9A 3SAWA 3UJNA 4DV3M 3HU3A 4JI6M 2UXBM 3J7BA 1QAMA 1G59A 2UXDM 2YFQA 5IREB 4DR1M 5JI3E 4LGMA 3T1HM 3I51A 1DO2A 1L1TA 2R65A 1NJGA 2LXEA 3AFHA 1GVNA 3CTWB 2BNKA 2FOIC 5A2QS 2I7PA 1Z5CA 5ITYA 2DWNA 1HQYE 1IQPA 3SMSA 4KO8A 3VFDA 4G4QA 2Y21A 4KODA 2K47A 3GRRA 5EP3A 2R45A 4OVZB 5ITRA 3KOWE 3GPXA 3THGA 4I81A 3VLFB 1GKIA 3TL4X 2FFJA 3L2AA 3M6AA 4GKJM 3LQQA 2ZM6M 1IN7A 5EP2A 1ORYB 4IBBA 3AV0A 4LJ6A 5KPZA 2ZAOA 2ERCA 3U6SA 4GKKM 3AJIB 4IBIA 2ZANA 2QP9X 1R2YA 4GIPA 2C98A 3FYDA 4FW9A 4LGYA 4G4RA 3PVSA 1TDZA 4PT5A 4MB7A 1ZAEA 5ITXA 4MGKE 5EXTA 1T3TA 2F4VM 2D7EA 4MGIE 1EE8A 3MHVC 3L26A 1L2CA 4B3TM 4GHLA 5KPTA 1VDDA 2FE8A 2XFTA 4GC9A 1Z5AA 2FNAA 4M9SA 4B3MM 1XMOM 3ZC7B 1MX0A 2Z7JA 4OVZA 7CATA 3Q8XA 1PM5A 1N33M 4QOSA 2LH0A 4I4LA 1TH4A 4PDGA 3A46A 5FTLA 4M0WA 2Z3XA 1LV7A 3LQRA 3J80S 2CV0A 2OPFA 5ITTA 3GPPA 4IBGA 4X66M 3OTOM 4LFAM 2Y0QA 2H1RA 1J09A 2ZAMA 3HJ8A 4D80A 5GKNA 3A42A 3E4RA 3HU2A 3EIHA 1N32M 4NRWA 1G8PA 4IBCA 2E5LM 1R6BX 4JV5M 1R2ZA 1NVMA 2LWXA 4AQYM 4DV7M 3DA1A 4B08A 4LF7M 1HNWM 4DUYM 2G8LA 3HKPA 4FCWA 3QAUA 1SXJD 4G4NA 3FTDA 3TQSA 3AL0C 1IXRC 4L15A 2M5ZA 2KXEA 2UXCM 2L6OA 3FYCA 3HJSA 2R4EA 3TPZA 2C96A 1JR3D 1NY5A 4IJFA 1HR0M 3K1JA 1Z6TA 2YQZA 1QANA 4JN6A 3I4VA 3HGIA 4EIWA 3HHYA 1SXJB 4YY3M 3TWLA 3VK7A 1H6UA 1OJLA 1S3SA 4FCTA 3FUXA 1OFHA 3FUUA 4G4OA 3K2LA 4NSRA 3K92A 2F5PA 2Y20A 1QZMA 1K3XA 3RE8A 2BJVA 4DR4M 1KSFX 1IM2A 3KW6A 1IN8A 1K82A 2QENA 3KSJA 3CF2A 4LY6A 1YSYA 2EA0A 3PXGA 4IBEA 4AKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNU C;  1NHG C;  2NQ8 C;  1NHW C;  2FOI C; 
#chains in the Genus database with same CATH topology
 1YLA A;  1ZQ9 A;  5DYG A;  4M9X A;  3GLI B;  3SAU A;  3AOE A;  3C3E A;  4F1I A;  4W5W A;  3U60 A;  3GLG E;  4ZPX A;  1L2D A;  4B3S M;  4AG5 A;  3I04 M;  3HZJ A;  4BBA A;  1GL6 A;  1V34 A;  1OQY A;  5KQ8 A;  4FCV A;  4GC5 A;  3VDP A;  2KDL A;  1L1Z A;  1SXJ A;  1FNN A;  2HHH M;  1N78 A;  1ZMV A;  3FUV A;  2AHM A;  1MU5 A;  2Q2E B;  1JR3 A;  2R18 A;  2GQF A;  1C7Y A;  1VG5 A;  3SYK A;  2DXI A;  4IBJ A;  1XWI A;  1XXH A;  1NSF A;  1YE9 A;  3GRU A;  1GL7 A;  2ZTD A;  3KFU G;  2RRU A;  4QOZ C;  1DV0 A;  2XGN A;  2F5Q A;  1J5E M;  1D2N A;  2APL A;  4RNA A;  4G3O A;  2Z4R A;  4GIT A;  2P5T A;  4UN2 B;  1V92 A;  4YHH M;  1GAB A;  1Z59 A;  1XC8 A;  2UU9 M;  2HWJ A;  2MR9 A;  1DGH B;  4HLQ A;  3GLI A;  2L2D A;  3WHK A;  1WXQ A;  1HQC A;  4CGY B;  2V6Z M;  1HNZ M;  2DNA A;  2DWM A;  1Y8G A;  1JR3 E;  1V33 A;  2DAK A;  2UUB M;  3M0E A;  2XEP A;  4MM3 B;  5FTJ A;  2L7I A;  1XXH E;  3B7N A;  4D82 A;  4M9Z A;  2J7O A;  2KHH A;  2Z4S A;  2F5S A;  3KSX A;  2CFO A;  2KA6 B;  2ZTC A;  3RGS A;  5FSW A;  1IN6 A;  3DZD A;  2XF3 A;  3ZQJ A;  4II7 A;  1AUA A;  4LF9 M;  2XFS A;  2YR0 A;  3UMM A;  3RFW A;  3LW5 F;  3UK6 A;  3GQ4 A;  4FWG A;  4KLN A;  1W5T A;  3FE3 A;  4I5S A;  2KRK A;  1OFI A;  4MH0 E;  3LMM A;  3UZU A;  4CHT B;  2J7N A;  2JZ1 A;  5IWA M;  2R46 A;  3VKG A;  3HJQ A;  1L2B A;  1Z5B A;  1FJG M;  2KNZ A;  3IG8 A;  3HHW A;  1HNX M;  3PNY A;  4L8R C;  2RGO A;  2DZO B;  2K9D A;  2X8A A;  3U6O A;  3CF6 E;  5FLX S;  3GQ3 A;  2YNM D;  3T6P A;  2R4J A;  3SC3 A;  4Y28 F;  3FUT A;  3V76 A;  2DWL A;  2DAM A;  3GRY A;  2L7H A;  2CV1 A;  1IXZ A;  1D0K A;  1DGB A;  2CHV A;  3U6L A;  2JA2 A;  5ITX E;  3GQ5 A;  2EKK A;  3BBZ A;  2I7N A;  2ZBK B;  3GO8 A;  1XNR M;  3BOS A;  1TGU A;  4L4U A;  4RF1 A;  5KQD A;  5LMN M;  4DR5 M;  3CGW A;  1QVR A;  3HHX A;  5DFL A;  1XNQ M;  4DV6 M;  1IBM M;  1D0L A;  3GLH B;  1YUB A;  3GLF B;  1Q3B A;  2F5N A;  1C1K A;  5IT9 S;  2CEA A;  2R62 A;  4B3R M;  1PGY A;  3TWM A;  1GLN A;  4NRV A;  1IFY A;  4LF8 M;  3KVW A;  1RU3 A;  1N34 M;  3NWL A;  2GNO A;  3HX3 A;  5LMU M;  4IIW A;  2DAI A;  3LVW A;  4OX9 M;  2VQE M;  4B7F A;  4R3D A;  5C1B A;  3NBI A;  8CAT A;  2LVO C;  1PJT A;  4LFB M;  1DO0 A;  5JI2 E;  3HWS A;  3C58 A;  4GHA A;  2HAK A;  4WW0 A;  1IY2 A;  1ZMW A;  2XZU A;  3HHZ A;  1K3W A;  3FUW A;  3SHF A;  1PRB A;  4PD2 A;  3C3D A;  3B89 A;  1I4W A;  3JR4 A;  4L16 A;  3AOE C;  1TR8 A;  1W5S A;  1L8Q A;  3UGJ A;  3J7A S;  3B7Z A;  1IBL M;  4M0D A;  4Z8X A;  2NQ8 C;  4QHS A;  5ITQ A;  1EIJ A;  3GLH A;  3J27 B;  1NNJ A;  2LNH C;  4LJA A;  1G41 A;  1IY0 A;  2L4F A;  3WHL A;  4DR2 M;  4GRI A;  3K8Z A;  1SXJ C;  3SFZ A;  5F3W A;  2DVW B;  1G4A E;  1QAQ A;  3K9P A;  2G5G X;  3FTC A;  3EIE A;  3VDU A;  3JAM S;  4X65 M;  2QPA A;  1E94 E;  3MK6 A;  4ITQ A;  3K9O A;  2K0B X;  3GPY A;  1HT2 E;  3IG5 A;  4OW0 A;  3KDS E;  1DGF A;  1QAO A;  3GLH E;  4FD2 A;  4TUW A;  1EFU B;  4NL4 H;  4LF6 M;  1XHB A;  2B3T A;  4NXN M;  4DV1 M;  4AW4 A;  3MMP A;  4AKG A;  3KP0 E;  2QHO B;  4LJ8 A;  1KYI A;  4MGZ E;  1P3Q Q;  4AG6 A;  1BVS A;  1HJP A;  4FWH A;  4IJE A;  3U6C A;  3FTE A;  4JI7 M;  2DAE A;  2L09 A;  3E9S A;  1VQ1 A;  2CHQ A;  4FWD A;  4LJ5 A;  4I8O A;  1UM8 A;  5EJC A;  4K0K M;  4REZ A;  1TTE A;  4RKU F;  2LHC A;  2VII A;  4LJ4 A;  4JI4 M;  3L29 A;  3KOY E;  4JYA M;  1NY6 A;  3RGP A;  3KP1 E;  4JI1 M;  3FD9 A;  3L27 A;  4WUR A;  1SXJ E;  3KOZ E;  2VF7 A;  3U6P A;  3T1Y M;  3W67 A;  2WSF F;  2Z8Y M;  4MGH A;  3SMP A;  4FVM A;  1NO1 A;  2KW0 A;  1VEK A;  4JXJ A;  1QQW A;  4JI0 M;  5BPV A;  4OU7 A;  2C5R A;  3FKE A;  2Y0T A;  1N75 A;  5EXS A;  3KS8 A;  4CIS A;  3R8F A;  3VK8 A;  3D8B A;  2OOA A;  4MGY E;  2FH0 A;  3HU1 A;  4LZZ A;  4NXM M;  1F4I A;  3VKH A;  1Q02 A;  2XLJ A;  2JNH A;  4NOO B;  2KRU A;  3JR5 A;  2BJW A;  3BXW A;  3GLI E;  3LVV A;  2JWS A;  3DFZ A;  4PDI A;  1XMQ M;  2LVA A;  4QNM A;  3KOX E;  1NJF A;  1HT1 E;  2M60 A;  3CF0 A;  2OQ4 A;  2CE7 A;  2A5Y B;  2BWE A;  4IBF A;  3R9X B;  1NHW C;  5H37 D;  1DGH A;  1OTR A;  2C9C A;  3NBX X;  4DR6 M;  2F5O A;  1WGN A;  1TDH A;  2LTU A;  4AI6 A;  3U5Z B;  1OAO C;  3AKZ A;  3SAT A;  2O5R A;  2XZF A;  4AKH A;  4LZJ A;  2KNA A;  2XSZ D;  4LJ9 A;  2D7G A;  2FS1 A;  5KO3 A;  4WP2 A;  4BLC A;  3KXE C;  3TE6 A;  2X49 A;  4JI3 M;  1PJQ A;  2MRO B;  3SHG B;  3U6Q A;  5DYI A;  1NHG C;  3KS4 A;  4G6Z A;  1E32 A;  2R0I A;  5ITU A;  4S12 A;  3TWK A;  1N36 M;  3T15 A;  4X62 M;  2WSE F;  2D7H A;  3DOA A;  4X64 M;  4JI8 M;  1TH3 A;  5EQT A;  2JP7 A;  5E6J A;  4DV5 M;  2V1U A;  3MJ5 A;  2HKJ A;  1ZMU A;  3M7G A;  2MJ5 B;  4GH9 A;  3U6D A;  3U6M A;  4NSO B;  2UUA M;  3W0F A;  2UUC M;  5FTM A;  3A98 B;  4DUZ M;  2HCB A;  5BR8 M;  1D0M A;  1E9S A;  1T6O A;  4HEO A;  4ANR A;  3D8L A;  2RKO A;  1DGG A;  4GEW A;  1IN5 A;  3FRI A;  4QNR A;  3U5Z A;  2OOB A;  1QDR A;  1MJG M;  2JZ0 A;  1QZE A;  4GMQ A;  4DV0 M;  1PJJ A;  3U61 B;  3L25 A;  2CV2 A;  5KPR A;  3PFI A;  3B9P A;  4P17 A;  2K6B A;  3J81 S;  2DHR A;  3GP1 A;  3SBJ A;  1UFZ A;  1I94 M;  3GLG B;  3L28 A;  4IBK A;  3C9P A;  4LRS A;  1IXS B;  1Q3C A;  5E26 A;  5IZ7 D;  3ZH9 B;  4D81 A;  4RF0 A;  4DR3 M;  5EP4 A;  3W68 A;  2DZN B;  2LVN C;  5FTK A;  2KEB A;  5EXX A;  4R7G A;  2XSZ A;  2QBY B;  5C18 A;  3SYL A;  2R44 A;  3QWL A;  3Q8G A;  2C9O A;  4IBD A;  1R7R A;  4BB9 A;  1N77 A;  3GLF A;  1QUS A;  2MGW A;  2QZ4 A;  4DV4 M;  3W0L B;  1JB0 F;  1TH2 A;  2BWB A;  3U60 B;  4B7G A;  3HY5 A;  4XGI A;  3SAV A;  3FTF A;  2MH8 A;  2CP8 A;  3IEC A;  4JI2 M;  1AIP C;  4A3V B;  3I01 M;  2KZU A;  2QQ8 A;  5L8R F;  1QYR A;  2JY5 A;  1VEJ A;  2O01 F;  3U61 A;  4LJ7 A;  4DV2 M;  5EXP A;  2EO2 A;  1OAI A;  2QSF X;  1KFV A;  3GRV A;  2H5X A;  4LFC M;  2C99 A;  3I4Y A;  3GLF E;  3SAS A;  2QCU A;  3GLG A;  1MN3 A;  1VEG A;  2CUZ A;  2RGH A;  1E9R A;  1IXS A;  4L78 A;  2J5Y A;  2EUC A;  3A45 A;  4LCB A;  1TF0 B;  1IY1 A;  3ILK A;  4AZF A;  1ZV1 A;  2KZS A;  2VQF M;  3U6E A;  3PNV A;  3SAR A;  1XXH B;  2DHY A;  2X4A A;  4Z6Y A;  2QBY A;  4JI5 M;  1PJI A;  4PCZ A;  1JQJ C;  4LG2 A;  3J2P B;  3GPU A;  3ZCB B;  4LF5 M;  2OO9 A;  3AOG A;  1Q39 A;  2W82 A;  3LCU A;  4LRT A;  1VDL A;  2CHG A;  4LF4 M;  1IBK M;  4DR7 M;  4KHP M;  2O25 A;  3T38 A;  1G3I A;  2HL7 A;  1IN4 A;  1NNU C;  4XBO A;  4P16 A;  4QHT A;  5FTN A;  2V1C A;  2DEN A;  3H4M A;  5EP1 A;  5DNY A;  1J7K A;  1X37 A;  4HL4 A;  2DWZ B;  4B7H A;  2XH9 A;  3SAW A;  1LTM A;  1OIP A;  3UJN A;  1OIZ A;  4DV3 M;  2QNJ A;  3HU3 A;  3H4J A;  4JI6 M;  2UXB M;  3J7B A;  1QAM A;  1GJS A;  1G59 A;  2DKL A;  2DZL A;  2UXD M;  4DBG B;  2YFQ A;  5IRE B;  4DR1 M;  1PJS A;  2EJS A;  5JI3 E;  4LGM A;  3T1H M;  3I51 A;  1DO2 A;  1L1T A;  2R65 A;  1NJG A;  2LXE A;  3AFH A;  1GVN A;  1R4G A;  2BNK A;  3CTW B;  2FOI C;  5A2Q S;  2I7P A;  2JY8 A;  2JY6 B;  1Z5C A;  5ITY A;  2JUJ A;  2DWN A;  1HQY E;  1IQP A;  2CRU A;  3SMS A;  4KO8 A;  2L4E A;  3VFD A;  4G4Q A;  2Y21 A;  4KOD A;  3F92 A;  4CIZ A;  2K47 A;  3GRR A;  2JXN A;  5EP3 A;  2R45 A;  4OVZ B;  5ITR A;  3KOW E;  3GPX A;  2JY7 A;  4I81 A;  4NC6 A;  3THG A;  3VLF B;  1GKI A;  3TL4 X;  2FFJ A;  2LVP C;  3L2A A;  3M6A A;  4GKJ M;  1WHC A;  3LQQ A;  2ZM6 M;  3E21 A;  1IN7 A;  5EP2 A;  1ORY B;  2WSC F;  3AV0 A;  3QYB A;  4IBB A;  4LJ6 A;  2VDB B;  5KPZ A;  2ZAO A;  2ERC A;  3U6S A;  4GKK M;  1R5L A;  3AJI B;  2ZAN A;  3E46 A;  2QP9 X;  4IBI A;  1R2Y A;  4GIP A;  2C98 A;  1WGL A;  3FYD A;  4FW9 A;  4LGY A;  4G4R A;  3PVS A;  1TDZ A;  4PT5 A;  4MB7 A;  4KT0 F;  1ZAE A;  5ITX A;  4MGK E;  1GO5 A;  5EXT A;  1T3T A;  2F4V M;  2D7E A;  4MGI E;  1EE8 A;  3MHV C;  3L26 A;  1L2C A;  4B3T M;  1T43 A;  4GHL A;  1A5T A;  3IHP A;  5KPT A;  1VDD A;  2FE8 A;  2XFT A;  3B7Q A;  4GC9 A;  1Z5A A;  2FNA A;  4M9S A;  1GJT A;  4B3M M;  1XMO M;  3ZC7 B;  1MX0 A;  2Z7J A;  4OVZ A;  7CAT A;  1G71 A;  3Q8X A;  4Q7J A;  4R71 A;  4QOS A;  1PM5 A;  1WIV A;  2LH0 A;  1N33 M;  4I4L A;  1OKS A;  1TH4 A;  4PDG A;  3A46 A;  5FTL A;  4M0W A;  2Z3X A;  1QUT A;  3LCV B;  1LV7 A;  3LQR A;  3J80 S;  2CV0 A;  2OPF A;  5ITT A;  3GPP A;  4IBG A;  4X66 M;  3OTO M;  4LFA M;  1WJ7 A;  2N35 A;  4F2L A;  2Y0Q A;  2H1R A;  1J09 A;  2R6F A;  2ZAM A;  3HJ8 A;  4D80 A;  2DAG A;  5GKN A;  3A42 A;  3E4R A;  3HU2 A;  3EIH A;  1N32 M;  4NRW A;  1G8P A;  4IBC A;  2E5L M;  1R6B X;  2LBC A;  4JV5 M;  1R2Z A;  1WR1 B;  1NVM A;  2LWX A;  2VF8 A;  4AQY M;  4DV7 M;  3QYE A;  2LVQ D;  2G3Q A;  3DA1 A;  4B08 A;  4LF7 M;  1HNW M;  4DUY M;  2G8L A;  3HKP A;  4FCW A;  3QAU A;  1SXJ D;  4G4N A;  3FTD A;  3TQS A;  3AL0 C;  1IXR C;  3FRH A;  2M5Z A;  4L15 A;  2KXE A;  2UXC M;  2L6O A;  3FYC A;  3HJS A;  2R4E A;  3TPZ A;  1XB2 B;  2C96 A;  2LHG A;  1SG9 A;  1JR3 D;  1NY5 A;  3B74 A;  4IJF A;  1HR0 M;  3K1J A;  1Z6T A;  2YQZ A;  1QAN A;  4JN6 A;  4CJ6 A;  3I4V A;  3HGI A;  4EIW A;  3HHY A;  1SXJ B;  4YY3 M;  3TWL A;  3VK7 A;  1H6U A;  1OJL A;  1S3S A;  1QDT A;  4L6V 6;  4FCT A;  4XK8 F;  1NV8 A;  3FUX A;  1OFH A;  3FUU A;  4G4O A;  3K2L A;  2KNV A;  3K92 A;  4NSR A;  2F5P A;  2Y20 A;  1QZM A;  1NV9 A;  1K3X A;  3RE8 A;  2BJV A;  4DR4 M;  1CUK A;  1KSF X;  1IM2 A;  2CWB A;  1IN8 A;  3KW6 A;  1K82 A;  2QEN A;  2WZJ A;  3CF2 A;  3KSJ A;  1YSY A;  4LY6 A;  3PXG A;  4IBE A;  2EKF A;  2EA0 A;  4AKI A;  2DI0 A; 
#chains in the Genus database with same CATH homology
 1ZQ9 A;  5DYG A;  4M9X A;  3GLI B;  3SAU A;  3AOE A;  4W5W A;  3U60 A;  4ZPX A;  1L2D A;  4B3S M;  4AG5 A;  4BBA A;  1GL6 A;  5KQ8 A;  4FCV A;  4GC5 A;  3VDP A;  1L1Z A;  1SXJ A;  1FNN A;  2HHH M;  1N78 A;  3FUV A;  2AHM A;  1MU5 A;  2Q2E B;  1JR3 A;  2R18 A;  3SYK A;  2DXI A;  4IBJ A;  1XWI A;  1XXH A;  1NSF A;  1YE9 A;  3GRU A;  1GL7 A;  3KFU G;  4QOZ C;  2XGN A;  2F5Q A;  1J5E M;  1D2N A;  4RNA A;  2Z4R A;  4GIT A;  2P5T A;  4YHH M;  1Z59 A;  1XC8 A;  2UU9 M;  1DGH B;  4HLQ A;  3GLI A;  3WHK A;  1WXQ A;  1HQC A;  4CGY B;  2V6Z M;  1HNZ M;  2DWM A;  2UUB M;  3M0E A;  2XEP A;  4MM3 B;  5FTJ A;  2L7I A;  4D82 A;  4M9Z A;  2J7O A;  2Z4S A;  2F5S A;  3KSX A;  2CFO A;  2KA6 B;  3RGS A;  5FSW A;  1IN6 A;  3DZD A;  2XF3 A;  4II7 A;  4LF9 M;  2XFS A;  2YR0 A;  3UMM A;  3RFW A;  3UK6 A;  3GQ4 A;  4FWG A;  4KLN A;  1W5T A;  4I5S A;  2KRK A;  1OFI A;  4MH0 E;  3LMM A;  3UZU A;  4CHT B;  2J7N A;  5IWA M;  2R46 A;  3VKG A;  3HJQ A;  1L2B A;  1Z5B A;  1FJG M;  3IG8 A;  3HHW A;  1HNX M;  3PNY A;  4L8R C;  2RGO A;  2DZO B;  2X8A A;  3U6O A;  3CF6 E;  5FLX S;  3GQ3 A;  2YNM D;  2R4J A;  3SC3 A;  3FUT A;  2DWL A;  3GRY A;  2L7H A;  2CV1 A;  1IXZ A;  1DGB A;  2CHV A;  3U6L A;  2JA2 A;  5ITX E;  3GQ5 A;  2I7N A;  2ZBK B;  3GO8 A;  1XNR M;  3BOS A;  1TGU A;  4L4U A;  4RF1 A;  5KQD A;  5LMN M;  4DR5 M;  1QVR A;  3HHX A;  1XNQ M;  4DV6 M;  1IBM M;  3GLH B;  1YUB A;  3GLF B;  1Q3B A;  2F5N A;  1C1K A;  5IT9 S;  2CEA A;  2R62 A;  3TWM A;  1GLN A;  4NRV A;  4LF8 M;  3KVW A;  1N34 M;  3NWL A;  5LMU M;  4IIW A;  3LVW A;  4OX9 M;  2VQE M;  4B7F A;  4R3D A;  5C1B A;  3NBI A;  8CAT A;  4LFB M;  1DO0 A;  5JI2 E;  3HWS A;  3C58 A;  4GHA A;  4WW0 A;  1IY2 A;  2XZU A;  3HHZ A;  1K3W A;  3FUW A;  3SHF A;  4PD2 A;  1I4W A;  3JR4 A;  4L16 A;  3AOE C;  1W5S A;  1L8Q A;  3UGJ A;  3J7A S;  1IBL M;  4M0D A;  4Z8X A;  2NQ8 C;  4QHS A;  5ITQ A;  3GLH A;  3J27 B;  1NNJ A;  2LNH C;  4LJA A;  1G41 A;  1IY0 A;  3WHL A;  4DR2 M;  4GRI A;  3K8Z A;  1SXJ C;  3SFZ A;  5F3W A;  2DVW B;  1G4A E;  1QAQ A;  2G5G X;  3FTC A;  3EIE A;  3VDU A;  3JAM S;  4X65 M;  2QPA A;  1E94 E;  3MK6 A;  4ITQ A;  3GPY A;  1HT2 E;  3IG5 A;  4OW0 A;  3KDS E;  1DGF A;  1QAO A;  4FD2 A;  4TUW A;  4NL4 H;  4LF6 M;  1XHB A;  4NXN M;  4DV1 M;  4AW4 A;  4AKG A;  3KP0 E;  4LJ8 A;  1KYI A;  4MGZ E;  4AG6 A;  4FWH A;  4IJE A;  3U6C A;  3FTE A;  4JI7 M;  2L09 A;  3E9S A;  2CHQ A;  4FWD A;  4LJ5 A;  4I8O A;  1UM8 A;  5EJC A;  4K0K M;  4REZ A;  2VII A;  4LJ4 A;  4JI4 M;  3L29 A;  3KOY E;  4JYA M;  1NY6 A;  3RGP A;  3KP1 E;  4JI1 M;  3FD9 A;  3L27 A;  4WUR A;  1SXJ E;  3KOZ E;  3U6P A;  3T1Y M;  4MGH A;  3SMP A;  4FVM A;  2KW0 A;  4JXJ A;  4JI0 M;  1QQW A;  5BPV A;  4OU7 A;  2C5R A;  3FKE A;  2Y0T A;  1N75 A;  5EXS A;  3KS8 A;  4CIS A;  3R8F A;  3VK8 A;  3D8B A;  4MGY E;  3HU1 A;  4LZZ A;  4NXM M;  3VKH A;  2XLJ A;  4NOO B;  2KRU A;  3JR5 A;  2BJW A;  3LVV A;  3DFZ A;  4PDI A;  1XMQ M;  4QNM A;  3KOX E;  1NJF A;  1HT1 E;  2M60 A;  3CF0 A;  2OQ4 A;  2CE7 A;  2A5Y B;  4IBF A;  3R9X B;  1NHW C;  5H37 D;  1DGH A;  2C9C A;  4DR6 M;  2F5O A;  1TDH A;  4AI6 A;  3U5Z B;  3AKZ A;  3SAT A;  2O5R A;  2XZF A;  4AKH A;  4LZJ A;  2XSZ D;  4LJ9 A;  2D7G A;  5KO3 A;  4BLC A;  3KXE C;  3TE6 A;  2X49 A;  4JI3 M;  3SHG B;  3U6Q A;  5DYI A;  1NHG C;  3KS4 A;  4G6Z A;  1E32 A;  5ITU A;  4S12 A;  3TWK A;  1N36 M;  3T15 A;  4X62 M;  3DOA A;  2D7H A;  4X64 M;  4JI8 M;  1TH3 A;  5EQT A;  5E6J A;  4DV5 M;  2V1U A;  3MJ5 A;  2HKJ A;  3M7G A;  3U6D A;  4GH9 A;  3U6M A;  2UUA M;  2UUC M;  4NSO B;  3W0F A;  5FTM A;  3A98 B;  4DUZ M;  2HCB A;  5BR8 M;  1E9S A;  3D8L A;  2RKO A;  1DGG A;  4QNR A;  1IN5 A;  3U5Z A;  4GMQ A;  4DV0 M;  1PJJ A;  3U61 B;  3L25 A;  2CV2 A;  5KPR A;  3PFI A;  3B9P A;  3J81 S;  3GP1 A;  3SBJ A;  2DHR A;  1I94 M;  3GLG B;  3L28 A;  4IBK A;  4LRS A;  5E26 A;  1IXS B;  1Q3C A;  4D81 A;  5IZ7 D;  3ZH9 B;  4DR3 M;  4RF0 A;  5EP4 A;  2DZN B;  5FTK A;  2KEB A;  5EXX A;  4R7G A;  2XSZ A;  2QBY B;  5C18 A;  3SYL A;  3QWL A;  2C9O A;  4IBD A;  1R7R A;  4BB9 A;  1N77 A;  3GLF A;  2QZ4 A;  4DV4 M;  3W0L B;  1TH2 A;  3U60 B;  4B7G A;  4XGI A;  3SAV A;  3FTF A;  4JI2 M;  4A3V B;  2KZU A;  1QYR A;  3U61 A;  4LJ7 A;  4DV2 M;  5EXP A;  2EO2 A;  1KFV A;  3GRV A;  4LFC M;  2C99 A;  3I4Y A;  3SAS A;  4B3R M;  2QCU A;  3GLG A;  2RGH A;  2CUZ A;  1E9R A;  4L78 A;  3A45 A;  2EUC A;  4LCB A;  3ILK A;  1IY1 A;  4AZF A;  2VQF M;  2KZS A;  3SAR A;  3U6E A;  3PNV A;  1XXH B;  2X4A A;  4Z6Y A;  2QBY A;  4JI5 M;  1PJI A;  4PCZ A;  1JQJ C;  4LG2 A;  3J2P B;  3GPU A;  3ZCB B;  4LF5 M;  3AOG A;  1Q39 A;  2W82 A;  4LRT A;  2CHG A;  4LF4 M;  1IBK M;  4DR7 M;  4KHP M;  3T38 A;  1G3I A;  2HL7 A;  1IN4 A;  1NNU C;  4XBO A;  4P16 A;  4QHT A;  5FTN A;  2V1C A;  3H4M A;  5EP1 A;  5DNY A;  1J7K A;  1X37 A;  4HL4 A;  2DWZ B;  4B7H A;  2XH9 A;  3SAW A;  3UJN A;  4DV3 M;  3HU3 A;  4JI6 M;  2UXB M;  3J7B A;  1QAM A;  1G59 A;  2UXD M;  2YFQ A;  5IRE B;  4DR1 M;  5JI3 E;  4LGM A;  3T1H M;  3I51 A;  1DO2 A;  1L1T A;  2R65 A;  1NJG A;  2LXE A;  3AFH A;  1GVN A;  3CTW B;  2BNK A;  2FOI C;  5A2Q S;  2I7P A;  1Z5C A;  5ITY A;  2DWN A;  1HQY E;  1IQP A;  3SMS A;  4KO8 A;  3VFD A;  4G4Q A;  2Y21 A;  4KOD A;  2K47 A;  3GRR A;  5EP3 A;  2R45 A;  4OVZ B;  5ITR A;  3KOW E;  3GPX A;  3THG A;  4I81 A;  3VLF B;  1GKI A;  3TL4 X;  2FFJ A;  3L2A A;  3M6A A;  4GKJ M;  3LQQ A;  2ZM6 M;  1IN7 A;  5EP2 A;  1ORY B;  4IBB A;  3AV0 A;  4LJ6 A;  5KPZ A;  2ZAO A;  2ERC A;  3U6S A;  4GKK M;  3AJI B;  4IBI A;  2ZAN A;  2QP9 X;  1R2Y A;  4GIP A;  2C98 A;  3FYD A;  4FW9 A;  4LGY A;  4G4R A;  3PVS A;  1TDZ A;  4PT5 A;  4MB7 A;  1ZAE A;  5ITX A;  4MGK E;  5EXT A;  1T3T A;  2F4V M;  2D7E A;  4MGI E;  1EE8 A;  3MHV C;  3L26 A;  1L2C A;  4B3T M;  4GHL A;  5KPT A;  1VDD A;  2FE8 A;  2XFT A;  4GC9 A;  1Z5A A;  2FNA A;  4M9S A;  4B3M M;  1XMO M;  3ZC7 B;  1MX0 A;  2Z7J A;  4OVZ A;  7CAT A;  3Q8X A;  1PM5 A;  1N33 M;  4QOS A;  2LH0 A;  4I4L A;  1TH4 A;  4PDG A;  3A46 A;  5FTL A;  4M0W A;  2Z3X A;  1LV7 A;  3LQR A;  3J80 S;  2CV0 A;  2OPF A;  5ITT A;  3GPP A;  4IBG A;  4X66 M;  3OTO M;  4LFA M;  2Y0Q A;  2H1R A;  1J09 A;  2ZAM A;  3HJ8 A;  4D80 A;  5GKN A;  3A42 A;  3E4R A;  3HU2 A;  3EIH A;  1N32 M;  4NRW A;  1G8P A;  4IBC A;  2E5L M;  1R6B X;  4JV5 M;  1R2Z A;  1NVM A;  2LWX A;  4AQY M;  4DV7 M;  3DA1 A;  4B08 A;  4LF7 M;  1HNW M;  4DUY M;  2G8L A;  3HKP A;  4FCW A;  3QAU A;  1SXJ D;  4G4N A;  3FTD A;  3TQS A;  3AL0 C;  1IXR C;  4L15 A;  2M5Z A;  2KXE A;  2UXC M;  2L6O A;  3FYC A;  3HJS A;  2R4E A;  3TPZ A;  2C96 A;  1JR3 D;  1NY5 A;  4IJF A;  1HR0 M;  3K1J A;  1Z6T A;  2YQZ A;  1QAN A;  4JN6 A;  3I4V A;  3HGI A;  4EIW A;  3HHY A;  1SXJ B;  4YY3 M;  3TWL A;  3VK7 A;  1H6U A;  1OJL A;  1S3S A;  4FCT A;  3FUX A;  1OFH A;  3FUU A;  4G4O A;  3K2L A;  4NSR A;  3K92 A;  2F5P A;  2Y20 A;  1QZM A;  1K3X A;  3RE8 A;  2BJV A;  4DR4 M;  1KSF X;  1IM2 A;  3KW6 A;  1IN8 A;  1K82 A;  2QEN A;  3KSJ A;  3CF2 A;  4LY6 A;  1YSY A;  2EA0 A;  3PXG A;  4IBE A;  4AKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...