1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords hemK protein
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
5FUBA 1JSXA 1P1CA 4R6XA 4FSXA 3TM4A 3E23A 3GCZA 4QTUB 3I58A 3SSOA 5LQKA 1FP2A 3GLIE 3HVHA 1ZV1A 2OO9A 2AR0A 1VQ1A 4P7FA 2BWEA 1RJFA 2AZTA 1NE2A 1BOOA 1JR4A 1AQJA 2Z6UA 1TW3A 2AOTB 3MCTA 3M4XA 3T0IA 4CXMA 4PYKA 1NW5A 3AWIA 3KR1A 3JWJA 3QV2A 1F3LA 1X19A 5FCDA 3ELDA 1VEKA 2QRVA 2V7EA 5F2KA 2LVOC 2ZIFA 3OE5A 1YF3A 5DWQA 1U2ZA 4IV8A 2K9DA 2HMYB 3BUSA 3BKXA 1JQ3A 1XB2B 2DULA 2ZBQA 1AF7A 3DXYA 5DSTA 1G3IA 2JJQA 5CCBA 3DLIA 2AVDA 1HMYA 2IIPA 5LQUA 4EKIA 1VP3A 3R0QA 4QVKA 1G8SA 5KYGA 1QYRA 2OO3A 1INLA 1D2GA 1XJ5A 2PXXA 3FZGA 2LVQD 3EVZA 2HWKA 3FYDA 3P97A 4RWZA 3TKYA 3HP7A 2HNKA 5LQJA 3NJRA 4E31A 4R8SA 1OKSA 2Y1WA 4CKEA 4POOA 4F1IA 1SUSA 4GOND 4PYLA 5FHQA 3FRIA 3EVAA 5EHIA 2C7PA 1IFYA 3FPEA 1NW7A 1XDUA 1HT1E 2G70A 3AXSA 3GWZA 4PCLA 4PIPA 5E9JA 4PGHA 5FWDA 3GLHE 1KPIA 2JNHA 3UJBA 4DA4A 3CJQA 4QPNA 3LBYA 2G71A 2LD4A 4KIGA 5FQOA 4C04A 3ER9A 3UJ9A 4X60A 10MHA 2ESRA 3ANXA 5EMJA 2BWBA 2IDJA 4UN2B 3CJRA 4AUKA 1VLMA 3GIWA 2C7OA 4AZSA 5E2AA 3NDIA 4QPPA 5DM0A 1TW2A 2LVNC 5DRTA 4QQKA 1PRYA 2JG3A 3I5UA 2ZW9A 2A14A 2ONYA 5FQNA 1JTFA 3R9XB 1NW3A 1P39A 5T67A 4C05A 4BY9E 2NXCA 5EZQA 1WGLA 4BLVA 3GRZA 1SQFA 1MHTA 1VIDA 1VL5A 2IFTA 2JH9A 2R3SA 4DZRA 2BR3A 1BC5A 2H5XA 2I62A 4XUDA 4Y30A 3HCDA 4E2YA 2O06A 3EVFA 5K0LA 1P1BA 3EPPA 2PWPA 3OCJA 1G60A 3LCVB 3DXZA 5HIIA 4OA5A 1DL5A 1TPYA 1FPQA 2I7CA 5CM2Z 3GRRA 1WXXA 3QOWA 4EVIA 3G8BA 2GAFA 4QQNA 3P71T 5E9QA 4C4AA 3KHKA 3EEYA 3T7SA 4RSRA 4WVLA 3E46A 2ZTHA 2HAKA 3FPFA 4M7RA 3FPHA 5CVJA 3TLJA 5EMLA 1RJGA 2G3QA 2HV9A 2PX8A 3DMFA 2QNJA 2K0BX 2DZLA 3DP7A 3OU6A 1QAMA 1SKMA 3KR2A 3P2EA 1NW8A 2LVPC 2GLUA 3THRA 2VDVE 1R8XA 2P3LA 3EMDA 4ZTBA 4RVHA 3M33A 4G56A 4PIMA 1XCLA 5GM2A 3BWBA 3FPGA 4RTMA 5E8JA 1ZHFA 4Q7JA 4PYMA 2QSFX 2G72A 3HCEA 4KDRA 2FHPA 3SSNA 2KNAA 4DQ0A 1VP9A 4PNEA 1JG4A 2YVLA 1D2HA 1RJEA 1HT2E 2XYRA 3DR5A 3IYLW 2OB1A 5GIPE 1M0EA 1R6AA 3LDUA 1T6OA 3BGDA 5LQAA 3HTXA 5HOQA 1JR3E 2IH5A 4QVGA 4AZVA 3A7EA 2IBTA 2ZZMA 3SSMA 5LQCA 5FA8A 4GF5A 2V74B 4HTFB 4MWZA 2JZ1A 3LX6A 4P7JA 3ER8A 7MHTA 1WGNA 4PYQA 2AOUB 4X63A 3FTFA 1R4GA 1KPGA 5EOVA 5EMMA 5BP7A 1TTEA 1L9KA 2NP6A 1NBIA 2P3OA 1N2XA 3C3YA 4HC4A 5DT2A 3SMQA 5K03A 3UBTA 2ZCJA 3FRHA 1ZMVA 1ZGJA 3MERA 1DO0A 2JHAA 3KKZA 5EIFA 5EC8A 3C3PA 4ATNA 4BP1A 2P7IA 5EMKA 1XTPA 2C7RA 2B25A 3HVJA 2E5WA 1G55A 1WR1B 4KVZA 4PYIA 2OBFA 4K6MA 2PGXA 1O54A 5DSXA 4EK9A 1SUIA 3GLFE 3P2IA 4CKBA 3BWCA 5LQRA 4RTJA 1NT2A 2VZ9A 3OFKA 4F84A 4FSDA 2DHYA 1SVUA 2AS0A 3FUUA 1FP1D 5JI2E 3PS9A 3PB3A 3KPVA 1V39A 2JY6B 3A4TA 5EEGA 1YFLA 3CCFA 1ORHA 1ZMWA 1WG8A 2BR5A 2VS1A 2ADMA 2ZWVA 3E7PA 5E1OA 2GH1A 2LVAA 2VP3A 3G5TA 4NECA 5F2NA 2ZVJA 3MCZA 4CTKA 3FPJA 2IH4A 5DTMA 2JY5A 4FR0A 3CGGA 2OB2A 3C6KA 3G2MA 3ME5A 5EKXA 4RTQA 1GO5A 4V0RA 2PX4A 3VC1A 2ZZKA 2UYHA 2NNWB 5CCXA 2ZSUA 3HNRA 3DMGA 2LBCA 3M6WA 3O31A 2I9KA 3LL7A 3REOA 2DPMA 2Y1XA 5KVAA 4O29A 1O9GA 1KHHA 1RI5A 2H1RA 2UYCA 4MTLA 4IKPA 4U7PB 5K0CA 2XBMA 2AOXA 2MROB 1X1DA 3TRKA 2HR1A 3TOSA 2PJDA 2Q41A 3KU1A 3A25A 3GU3A 3EGIA 3Q87B 3NWEA 1WZNA 5DLYA 2ZFUA 2UYOA 1IY9A 5EKUA 4GC9A 5HFJA 4ER5A 2IBSA 4EKGA 1Q0TA 2YX1A 3BZBA 2R0IA 2DENA 2DNAA 2FK8A 3B7PA 4KIFA 4M37A 5CVDA 4YUWA 1WHCA 5DTQA 1B42A 1KPHA 5GIOE 1DCTA 3M70A 4YV2A 5GINE 2JY8A 4C06A 5HZMA 1QZZA 1KYZA 2GA9A 2PVCA 3G2OA 2KHHA 1NBHA 2BM9A 4GC5A 1JQDA 1UFZA 3EVGA 4B17A 5GP1A 4AX8A 2JP7A 4YUXA 1XXLA 1R18A 3UJAA 3OU2A 2O07A 2P40A 3HCAA 2C7QA 2CP8A 4RYLA 2AN4A 3E8SA 3FUWA 2QM3A 4GOMD 4AZWA 1N7JA 2GPYA 2JHCA 2YXLA 4X61A 4V0QA 4YV0A 1EG2A 2B3TA 5DM1A 3KPJA 1OQYA 3HVKA 1XDSA 3PFGA 3V97A 3CKKA 1N7IA 3G88A 3HCCA 4FZVA 5K0FA 2P41A 1TR8A 2ZLBA 5K05A 4WP2A 5EPEA 1DUSA 1VPTA 1HQYE 3PT9A 4RTSA 1YZ3A 3BT7A 1EQAA 4OBXA 3SXJA 3OFJA 5D1NA 4RTNA 1RJDA 1YLAA 4A6DA 2QRVB 3HA5A 2N47A 3A7DA 3LBFA 3LKDA 2PT9A 3KPUA 2EX4A 5K0BA 3HEMA 2PBFA 5EZSA 5ERGB 1EJ6A 2PX5A 3DULA 4BLUA 3K6RA 4CWAA 1IXSA 3K0BA 4HG2A 4RTKA 1E94E 1MN3A 3AY0A 5G02A 3HCBA 3NWBA 4PINA 1QZEA 4RVGA 2AOWA 5DM2A 3TKAA 1XVAA 1VBFA 4YUYA 3G5LA 4E2ZA 3DTNA 2JZ0A 5E1BA 3UWPA 4ER6A 4HRAA 3CC8A 4QTTB 2MR9A 1I4WA 2OXTA 1VEJA 1HJPA 3EVEA 4DM3A 3UA3A 4R05A 4E2WA 3BBZA 3B5IA 3TMAA 3VSEA 4DMGA 3T7TA 3C0KA 4RTPA 3FE3A 5CVUA 5DRYA 1L1EA 2VDWA 1WS6A 2ERCA 2P7HA 1QAOA 5CVVA 4GEWA 3EGVA 3FUTA 3H2BA 3MQ2A 3P9KA 4R8RA 5DX1A 3ERCA 4HGYA 3TM5A 1H1DA 5K0GA 2B2CA 3CBGA 1KIAA 1UFKA 2IP2A 3HCFA 3UJ7A 5U4XA 3EEOA 2IGTA 2O05A 2UZ4A 4R6WA 1FJXA 4GUAA 4BP3A 2PLWA 5B1SA 4C07A 3B3JA 2PXCA 2ZULA 3LHDA 5HIKA 2OY0A 1WJ7A 3FYCA 3OU7A 1A5TA 2DAMA 5GOZA 1NV9A 5FWAA 3MMPA 1V92A 4GOOD 5C0OE 1ZGAA 4RTLA 5KQRA 3NVMB 1XCJA 3Q7EA 3SGLA 1DV0A 4GEKA 5MHTA 2NXEA 3DMHA 2WK1A 4DKJA 3LKZA 3O7WA 3TQSA 4YMGA 3BKWA 1G41A 4HTFA 4E70A 4RVDA 4RX1A 5HIJA 1QANA 4OQDA 2JHPA 4R71A 3BGIA 2AOTA 3UJCA 4E2XA 2LTUA 1R00A 5IH3A 3GGDA 2PSSA 3LCCA 4RTOA 2HTEA 1ORIA 1RI1A 3DOUA 3CVOA 1AIPC 1Q02A 3PLAE 2NP7A 2EKFA 2NXJA 2CMHA 2KNVA 2PKWA 5DX8A 4DCGA 2JY7A 2L2DA 1JG2A 2B9EA 5K8VA 2CL5A 2IPXA 1T43A 1VE3A 4LG1A 4PYOA 3G8AA 5HILA 3EVBA 3ELWA 5CD1A 5EHGA 3KQVA 3L8DA 2NXNA 3OZRA 4PWYA 3FTCA 4FT2A 3UJDA 3BWYA 4M38A 1VDLA 1JQEA 1UWVA 3BGVA 4PGGA 3ID6C 3V8VA 2IDKA 2GB4A 4KWCA 3FTDA 1EFUB 5KQSA 3B3FA 1ZQ9A 3GRVA 1KYIA 2FPOA 3KR9A 4Z2YA 2OOAA 1M6YA 2BM8A 4MHTA 2XYVA 9MHTA 3EVDA 1AQIA 3IECA 3NTVA 3P9CA 3K9PA 4Y2HA 4EMSA 2QY6A 5HIMA 1WY7A 2AVNA 3T6PA 3HA7A 1NKVA 4P7GA 5E9WA 3B3GA 3KQYA 3SX0A 3DLCA 1WIVA 5FADA 4YMHA 2AOUA 2IH2A 3BWMA 4P58A 3D2LA 4GBED 1L3CA 2I6GA 5EEHA 4QDKA 1PGYA 2DAIA 2DI0A 1I1NA 1O9HA 2AN5A 3KQQA 4PCAA 5K0NA 3SR4A 5IKMA 3SM3A 2L4FA 3P9NA 1OR8A 1BKYA 2CWBA 1C7YA 2B78A 5DTRA 3VYWA 4UOEA 1F38A 3HA3A 2G8NA 1IXKA 3KQTA 2KNZA 2ZBPA 5GM1A 4HEOA 4P7KA 4BLWA 5BXYA 5KS2A 3KQMA 4FT4A 4CTJA 4WXHA 1X1AA 1XDZA 3GXOA 3LPMA 4MQ4A 3UJ8A 1Y8CA 5BW4A 3NDJA 4PYNA 5DXAA 4X41A 1X1CA 1HNNA 2CKDA 1M6EX 2HWJA 1Y8GA 2FYTA 3MHTA 3F92A 3TPZA 3I9FA 3P8ZA 3H4JA 2OZVA 4ER7A 5ICGA 2H11A 3KR0A 3TR6A 8MHTA 3G89A 5T6BA 1OTRA 3PX3A 1BHJA 3G2QA 3KPYA 3NW9A 2QHOB 1UIRA 3KQOA 4H0NA 3NVKI 2ZTDA 5HEKA 4QDJA 2ORED 1YZHA 2EJUA 5EGSA 3LSTA 1SQGA 1P3QQ 2PT6A 4GOLD 2XYQA 2O57A 3ORHA 3PFHA 4IWNA 1L3BA 3LDFA 3LGAA 5GWXA 1IM8A 3S68A 2NYUA 1XXHE 3M6XA 2GS9A 1KYWA 3IV6A 2QE6A 4AZTA 3JWGA 3ELUA 5DXJA 1P91A 3JWHA 3PVCA 5E8RA 4E33A 2KW5A 2O0LA 2CWWA 2RRUA 5JUWA 2ZBRA 3WSTA 2YQZA 1G4AE 3GO4A 4OA8A 5FTWA 3GLGE 3SVZA 5C9ZA 5LR6A 2G1PA 1R74A 2EJSA 3CJTA 3IHTA 3T7RA 2UYQA 1KP9A 2PWYA 1RI2A 4HGZA 1VG5A 1YB2A 4U7TB 2DAGA 3IEIA 2ONZA 2L4EA 1KXZA 2OKCA 2YR0A 2K4MA 2XVMA 1G8AA 1EIZA 5E1MA 4ISCA 2R6ZA 3RIEA 2BZGA 3HVIA 3B89A 4C03A 5ICCA 5CVEA 2YXDA 4X1OA 2PX2A 2AOVA 4YV1A 4LWPA 1FBNA 3GJYA 5FA5A 4F85A 2BR4A 5M5BA 4KDCA 4DF3A 2P3QA 5BW5A 2EFJA 4FGZA 4OX9Y 3G2PA 3MB5A 3R3HA 3R24A 3ELYA 3R6TA 5K0EA 2YUIA 4XUEA 1YUBA 1RI4A 2EJTA 4PYJA 1JSZA 5C1IA 3IHPA 2ZIGA 5EG5A 1VEGA 4XCXA 1NV8A 2DAEA 2F8LA 2FRXA 4JXJA 1ZG3A 4DCMA 4EQZA 1PJZA 4XUCA 2YTZA 1G6Q1 5DX0A 4KRGA 3KPWA 3GNLA 1SG9A 3OE4A 2YXEA 2MGWA 4E32A 3O4FA 5K09A 3AJDA 2P1DA 1DO2A 5P8WA 4E30A 5JR3A 3FUXA 5CIYA 1AV6A 1F4IA 3EGEA 1D2CA 1JTEA 2WA2A 2MJ5B 3RW9A 2VDUE 1YFJA 2O25A 2FCAA 1OAIA 2ZWAA 3VC2A 4ER3A 5DFLA 2ZTCA 3LCUA 2XVAA 3P2KA 1WXWA 3LECA 4OBWA 2WZJA 1ZKDA 1JG3A 3MTIA 3FTEA 3A26A 4M36A 5FHRA 3U81A 4OQEA 1ZMUA 2PXAA 4FS8A 4KW7A 4IV0A 3GDHA 4HSGA 3X0DA 4A6EA 3UZUA 4YUZA 1R8YA 2FK7A 1BVSA 2OPBA 1L3IA 3MAGA 3AXTA 1IM2A 4G3OA 4FP9A 4LECA 5E1DA 3DXXA 5ICFA 3I64A 5DM4A 5T64A 4CKCA 3GRUA 3P9IA 5K0JA 3LDGA 3M6VA 4RTRA 4HH4A 5F2OA 2EKKA 3DUWA 3BXOA 1Q0SA 3A27A 3EMBA 3MGGA 3PX2A 3KQWA 3QOXA 1QAQA 1MJFA 3KQPA 3M6UA 1KR5A 5H02A 2AN3A 1G38A 4RVFA 2JUJA 1EJ0A 2ZZNA 2PV0A 3UA4A 1EAMA 1I9GA 3K9OA 2BH2A 2ZIEA 3OPNA 3JWIA 3PTAA 5FULA 5D1HA 2Z6QA 3I53A 5LSAA 3HM2A 4C08A 3FUVA 3KQSA 3RODA 2WA1A 1RI3A 1JG1A 2P8JA 2OOBA 4RV9A 5E2BA 1Z3CA 4L7VA 2OYRA 3E21A 4F86A 2Z6AA 5DPMA 4DBGB 2EG5A 3F4KA 3DH0A 4MIKA 3UJ6A 3EVCA 5EIWA 5ICEA 2H00A 2DAKA 2CMGA 4ER0A 5LQNA 3THSA 3E05A 4LWOA 3C6MA 2QYOA 2PY6A 5EQJB 5EVJA 5K01A 4GQBA 5CUQA 4YUVA 3UFBA 3TFWA 3NMUF 1NW6A 3OZTA 2DKLA 2P35A 3MTEA 1CUKA 3GRYA 2JH8A 3G7UA 1X1BA 4PONA 3OZSA 4F2LA
chains in the Genus database with same CATH superfamily
3KOUA 2YZKA 1NVEA 5IZCA 4CIZA 4EYGA 4KMSA 1KS9A 4YDQA 4C0HA 5CDSA 4ZQGA 4MJLA 3ZE1B 1HQCA 3GRPA 2A67A 3C7CB 4TTVA 5F5LA 4L0CA 1N92A 1TW3A 4DWWA 2NZXA 3CZRA 4AQYM 3DFUA 1FBTA 2BSXA 1NW5A 1GTL1 3KFUG 1I0LA 3EFHA 2EEPA 3IIEA 1ZA2A 3K20A 4RJTA 5KREA 1NSFA 2Y1DA 4QYXA 2JFBA 4B85A 2C4MA 4Q3EA 4GXNA 4OP2A 1OFUX 2P8SA 2R7NA 2WE8A 5DO9A 2HMYB 4DCJA 4D26A 1ZRNA 4A7PA 4CEJA 3BKXA 1BS9A 1JQ3A 3L6OO 1C80A 1AF7A 3MT7A 4OXYA 3RJTA 4BV3A 3OIUA 4CCSA 3H4MA 4YAGA 5KOYA 3WAKA 3ZBUA 5EHNA 3EB9A 1HX7A 2BEUB 3LC7O 1H9AA 3DYIA 1N6HA 1E2FA 1U3DA 2V58A 2V7BA 3DEIA 5CJ2A 9LDTA 2BELA 1E6MA 1N5OX 3EZNA 2IYTA 5ALUA 4WZBA 5ALLA 2AFVA 3FYDA 4CKXA 2FZCA 3RHTA 4JLUA 4Y67A 4LYGA 1XTIA 2HZBA 4NH4A 4ZVVA 2WI8A 4PYLA 3UAXA 5JOQA 3ICEA 1MU0A 3GA7A 4KT0F 1QIMA 1FDWA 2AA3A 5FWDA 3QEBZ 1XJCA 1UJ2A 2VF5X 3A3KA 3QLTA 4M53A 2FW6A 4PGHA 2I4NA 5LNK6 1MJHA 1MRNA 5FQOA 1L5FA 2ATCA 3GLVA 5IUKC 4OU7A 4ASUA 5JZMA 3T1HB 3NHMA 1MORA 3D9QX 2JIQA 4DV5M 4HAIA 4CCWA 2GKGA 1JYSA 4FHCA 1USIA 3OZGA 1DPFA 2QN3A 1YOBA 3A2NA 3UT5A 4EPRA 5KOJA 1MT0A 3DDOA 3NUGA 5E2AA 3C1UA 1MAAA 2YFYA 3KUUA 4PLWA 2V6BA 3RT7A 1AKUA 3ZYCA 2ZI7A 2WZBA 3SICE 5EYPA 2BRUA 3C3CA 3GCWA 1XMIA 1NXQA 2G1JA 2P9FA 3EYWA 2I2DA 1KNXA 3BTOA 3WRWA 2A2ZA 2C5EA 2B61A 3L25A 1T6BY 4EJSA 1U5CA 1ZYUA 3LBIA 1T2VA 1MC1A 1YBAA 4J0HA 3JY6A 2JEOA 2PUTA 2Z0MA 4Q1CA 5IF3A 3HP4A 4DCOA 3R8XA 3JARA 2EP8A 1U9YA 1FPQA 3RC7A 5A7FA 1XRJA 4BTEA 1JIKA 4IMRA 3QOWA 3VZQA 4QOEA 5E9QA 4CEHB 4Z2AA 2XE4A 3RE8A 3L8EA 1E3MA 1H93A 4RSRA 1Z56C 4NYJR 5CDHA 2BBWA 2VL7A 1PZFA 4KQIA 4WNAA 3DL0A 5KNDA 3ZCBB 3PF8A 1EPUA 1T2EA 3D5EA 3GFOA 3D4NA 4JX8A 3WYNA 2APJA 4NEQA 4UDXX 4IH9A 5A0TA 1IZYA 4PZYA 2MYUA 2P3LA 3EMDA 4XM2A 2H54A 4ARUA 4CV2A 3IBGA 1XCLA 3UPDA 4IS2A 3AIMA 3O47A 4CL0A 5I4KA 1E89A 2RGBA 2GEBA 3KSZO 1KJ8A 4IO0A 4P7BA 4POAA 4ECEA 2AX3A 3DV0B 3OETA 2POCA 3BFVA 3P9XA 4ESVA 1GRCA 3HB5X 4F97A 4PRYA 2D13A 1GSHA 2OHJA 1FA9A 3ZY2A 4R84A 5IUJC 2NPIA 3GGOA 3PEFA 3QUTA 4ZQFA 3X1ZA 1Z17A 3E5HA 4GM0A 4YONB 4B2YA 5JNTA 2GA8A 2OCPA 3WJAA 4OPMA 2OHOA 4H7KA 2W6CX 4WH0A 2LVBA 2AOUB 2AQKA 4FHEA 1A8HA 4XE5A 4OLAA 4XYEA 4JI0B 3TQCA 1UZUA 2NP6A 1NBIA 3UBTA 4Q37A 3ZJUA 5C5EA 1SM4A 4ZANA 5BR1A 5JJBA 2OCXA 2E1PA 1RWKA 5EIFA 1T6XA 4INAA 3VPAA 2A92A 3S2FA 4EECA 3TL2A 1I7NA 1ZOPA 3MCAA 4LOLA 3ZE8A 5ESDA 4K6MA 2W22A 4QJBA 4PFQA 5A05A 3UHJA 1O54A 4M1QA 1XNRB 5CXXA 3B6EA 1T3SA 5AW2A 3PFWO 1GEGA 3PFFA 2ZM6M 3S1LA 3FKSD 3LT0A 4X6YA 1LZKA 2P9YA 2O8BA 2IPAB 3RFWA 4FSDA 4NOMA 4E5MA 4RNAA 5LD2B 2OFPA 4I4TA 4MV4A 3KQUA 3I9V6 3B9PA 1DHRA 4GT1A 4Y6LA 3CN9A 3CCFA 3EULA 4E1AA 3S4YA 4HLUC 3QJYA 2DCMA 2AE2A 2RHDA 4HWSA 4AJKA 4Z54A 3T8YA 3FGZA 1EVZA 1N1MA 4S12A 4YV7A 2FSGA 1K75A 4M83A 1O4WA 2C9YA 2Q4DA 2V3WA 3I9LA 3U3MA 3BJMA 3OT4A 4UCFA 1AZSC 2WYIA 4M7OA 1QS0A 3V7YA 5MGNA 4FU0A 1SCIA 1MEJA 1P9RA 3Q3IA 1H4VB 1IEQA 3RJ5A 1VL6A 5B6PA 3FB1A 1GL9B 3LWBA 4EB8A 2C3MA 2JGEA 3K70C 4OHZA 2FS1A 3OOJA 4QO8A 3Q87B 3M4ZA 3UJ3X 3IB3A 4FIDA 1NZDA 1W44A 3MXOA 4K3UA 4BZPA 1I6WA 4WOJA 4I55A 2IZ6A 4XFJA 2YX1A 4BVLA 3UXYA 2FEKA 4MGIE 1JKMA 2H4JA 4KIFA 1YR3A 3SG0A 3E84A 3OTGA 5CIWA 2BFDA 4AZ0B 4LZOA 4REOA 1GZSA 8AT1A 2Z2IA 2JIDA 3PNLA 3RVOA 1QQTA 2Q5CA 3I6MA 4YUXA 1AA6A 4KB5A 2GYVA 2W6PA 4MUXA 1PR6A 3OU2A 2WUFA 3OAAD 2GCEA 5K3FA 2HXYA 1QMGA 1O6GA 1YSYA 1ZUIA 3OMWA 4OOFA 1S01A 2V45A 4P82A 1Y3AA 3SLKA 3LYLA 3R0ZA 1D4ZA 4QKQA 1RP1A 4DY4A 1AU9A 2YXLA 1A4RA 3TQTA 1OV4A 4HNUA 3HWX1 1HDCA 1NUHA 4NJMA 4Y9RA 4MS1A 5D3KA 3BB3A 3NHBA 3CRMA 1NX9A 5F1OA 1FC0A 1HA3A 1EUCA 2EJCA 2GN2A 2QN1A 4BVKA 4UFPA 5B4VA 3EDMA 3BT7A 1F3OA 2VYFA 4PTLA 4CGYA 3O74A 1QUTA 3OFJA 4RMJA 5GONF 5ER6A 5K8JB 1FXUA 1SQ6A 3HA5A 4IFBA 2HHAA 1H2XA 1M10A 2Q4EA 4YWHA 5C1PA 5C5IA 4CKCB 3DB2A 1SC4A 4YRLA 4I1SA 5EMNA 1MTZA 5TY0A 2C61A 3OLVA 2Q27A 2G7MC 2C4HA 1NJSA 4PLFA 2XF2A 1JEOA 4RTKA 3EPJA 3NJ8A 3PQ2A 4W5NA 1NFQA 2FPIB 1GG8A 2X5OA 2QM7A 1LI7A 1F0NA 2FA9A 1WXFA 3KJNA 3LJKA 4LQ4A 3IP6A 5T4HA 2ON6A 2HCBA 3W8RA 4N54A 2VJMB 4EL5A 4OREX 4ZTUB 4CL8A 3PQFA 1TO1E 4FJ0A 5AVUA 4OFBA 2QMQA 1V8ZA 3H05A 4DG8A 3CQ9A 1CZLA 3OT5A 2J32A 3G17A 3O9ZA 1GHTA 2HXSA 1RADA 3T54A 3UHPA 3WIUA 5IJWA 5KWJA 4GL4A 1NMSA 1KZHA 4RTPA 3B2EA 4AN0A 1OV6A 3VNAA 2RBEA 2L18A 8ADHA 1C3XA 3BRWA 4WLUA 1M7GA 2Q3JA 3I09A 5DX1A 4OB6A 1PLKA 1H1DA 4HAZA 1H2YA 1GQSA 3K0FB 3WGGA 1O8BA 2RHGB 5ITZA 5T3UA 2VHXA 4DVGA 4URVR 1PD1A 2RHWA 3FSGA 4MCJA 2O5CA 1DUIA 2Y1CA 2H85A 1ZEMA 4D9MA 2XNKA 1U6KA 3LHDA 1P45A 4MV5A 4JXKA 1WJ7A 1X2BA 2SCUB 2XCOA 1WE2A 2FOLA 1FNDA 1R6UA 2H07A 3ILXA 4KN8A 4MAFA 2V8BA 1ZISA 2RJOA 1XNQB 1PSZA 4R3DA 1LGYA 5DGIA 4CM4B 4CG1A 2GRJA 3B70A 3O7WA 4JWKA 1NDQA 4KXLA 4ND8A 4FN5A 1MXHA 4YMGA 3E3LA 5DBGA 4I46A 4GRAA 5DNDA 4HB2A 1CLEA 5MFPA 1G71A 5TV2A 4N0QA 5B1HA 2JHPA 4R71A 3K53A 1BXRA 5JAUA 1F7UA 1TL7C 2D2IA 3LO5A 1HNWM 3WWDA 2Q3MA 3W6UA 1IAQA 1LLQA 3SS7X 1HQDA 1J24A 1JLHA 2NP7A 4LYEA 1ZI6A 3GD7A 2CMHA 4QD3A 4RGQA 4ANFA 2B9EA 2H9IA 2IPXA 4BNNA 4EI9A 3E1SA 3RADC 3HRHA 4LHYA 1KOGA 3OIDA 5AI8A 4B3MM 1RJWA 1XWFA 2F3QA 3AUYA 1PZNA 1MENA 4QE3A 1EFTA 4QLOA 3I23A 4TWBA 1VDLA 3TMYA 1DBVO 2O4CA 4LQCA 5F7JA 3IBYA 4KHPM 1TC2A 5J5AA 2XB9A 1X7ZA 2FPOA 1C0KA 3H5WA 2QKYA 4NPCA 5HCIA 1TAUA 1DWQA 1CF2O 4ZYVA 4I55F 3MC1A 2J0SA 4ZI7F 3HK2A 2QV7A 5KNBA 1VOTA 2WT8A 3HE3A 2FE4A 4MUAA 4P7GA 3IUJA 5JDIA 3KQYA 3WYFA 4QNMA 1QDTA 3BOSA 1CTQA 1J97A 2A58A 4HQ6A 5I9LA 1IN4A 1L6IA 4FQ8A 4M1WA 5GZ6A 4F7DA 2Z30A 1ZJ6A 3UKDA 2AN5A 3A1DA 1I6LA 1LKZA 1YULA 1JF8A 1K27A 1YDFA 1RRFA 2HNAA 2ACEA 1K8ZB 2JLUA 2H2WA 3HM9A 4LFAB 4OQQA 4EM6A 5T4BA 3V4RA 2NACA 2HN9A 3OEWA 2V65A 1DAEA 1WMSA 2JGDA 1I3NA 1AKMA 1YZUA 1JE0A 2HLNA 2BOVA 2G83A 2WM9B 2XB4A 2XDWA 3E22B 4UQPA 4PAOA 3VU0A 2WKRA 3VA7A 5C51B 1Y8CA 5ADWA 3T9AA 5T6MA 5EJ8A 1O8CA 1AUQA 3FCUB 4PYNA 4JLOA 4MKHA 4M6WB 1PZMA 3U0BA 3JAMS 1B73A 1PT5A 5AIBA 2Z58A 4IQGA 4X20B 2FVXA 4L75A 3RD5A 2HI0A 3U7HB 5GV8A 2NO9A 3H4JA 1UM9A 3SNKA 1NMQA 1RRKA 2EGGA 3R9WA 1GAXA 3OZCA 3NTQA 4J1QA 1BWRA 2N75A 4BL5A 2HPZA 2YOHA 4BV8A 3NVKI 1M5UA 2ID4A 3LVQE 3K8OE 3OO1A 1J0EA 1W2GA 3IAFA 4MV3A 1WUYA 4URHA 5HEKA 1OXTA 4O4HA 2H63A 1EA7A 2EZ4A 2BEJA 5A9RA 1HDEA 2XA1A 1CY4A 3ZD7A 1V6CA 5KPZA 3RC8A 3BFKA 2HT6A 4IG4A 5C35A 4FDLA 3SF0A 4L16A 5IPFA 3K30A 4K6KA 5ITZB 3M7GA 3JWGA 3WBKA 1QZTA 4E33A 3R76A 3CHYA 4HCJA 2NU6A 3QU7A 1M1YA 4Q39A 4L9RA 1OYVA 2K7ZA 1UAYA 2B20A 4JP3A 3REQA 1X7YB 4G8CA 3K5PA 3QTBA 4MEAA 5C9ZA 2BDUA 2J1LA 2D1TA 1J0DA 3H1BA 4DW8A 2ONZA 1JHPA 4EPYA 3ETEA 2HA6A 3KXPA 4YAOA 4EMUA 1T13A 4ISCA 1DO8A 3HVIA 2PZBA 3U6QA 1PWXA 1F2UA 3HJBA 3AJAA 4UPVA 5J59A 5LXTA 2RAPA 2VPYA 3DHNA 1L7AA 5C8XA 1UDWA 4FGZA 1FX0B 5K6RA 3KP1E 1XPOA 1Z5GA 3O2NA 3REFA 2BEVB 1MVNA 1OY1A 3X44A 3PXBA 4AMZA 1ZJZA 1GV1A 2JBWA 3A98B 1ONNA 2XQIA 2NO5A 4TKUB 5EG5A 1IBLB 1GNSA 5FBZA 3TZQA 4J6EA 1IYZA 4MEBA 4Q21A 1B23P 3L1IA 4WE3A 1G42A 5DHPA 4D98A 3SJZA 1ORYB 1EDDA 3EFEA 2IEBA 1TTTA 3DLPX 1KK3A 3KKQA 4W9NA 4Z7QB 3OUTA 1ZXBA 3AJDA 1KZ9A 4O1IA 1WUKS 5JAQA 4HB0A 1N2CA 4YJGA 3SXPA 1ZN2A 3G02A 3MMXA 3DFZA 3ZUPA 4Q9DA 2WA2A 4P3KA 3LXUX 2GN8A 1CPYA 4X7RA 4ZAVA 3WLAA 4TMKA 3GPIA 1GPNA 1A1SA 3LCUA 3B6IA 4YQEA 1HTWA 3BCHA 4Z4QA 5FJJA 3WDKA 2BHRA 3EZFA 2QTFA 3OQVA 2IVFA 4LX8A 1XAJA 4MP3A 4TL8A 3IMFA 4LKRA 5ALIA 1FS6A 3UZUA 1LWOA 2JA2A 2Y20A 3AR7A 3DPIA 1BU5A 3JQPA 3PL5A 5AKHA 2C54A 2DM6A 3MSCA 5ALQA 4JDPA 1J20A 1MDFA 4B6SA 1QGED 1SXJA 2J07A 4DTCA 4C4PA 4F8YA 4EYEA 1FNMA 1E7WA 1KEZA 3A27A 1MW8X 3MGGA 3A42A 4D3FA 3N2KA 2IPMA 3E2IA 1MJFA 1KY3A 1QV9A 1R4AA 5CHYA 1K8RA 2Q1WA 4D02A 1Z2DA 3CG0A 3T95A 4OGLA 4IXNA 3L0SA 4UARA 5E6JA 3GT4A 5KJ1A 1Y5MA 5ESRA 6ADHA 2KQUA 3ESRA 3OZEA 4CE6A 4AKTA 3GG2A 2WM8A 5TARA 4RV9A 1E5DA 4BV2A 1TQ6A 3AHIA 5FPQA 2C5FA 4L8RC 4D46A 2JFHA 4GM1A 2F5OA 2A88A 3LI2A 3L4EA 4TGLA 1KYTA 4YMLA 3D54D 4UNIA 5EVJA 5EQJB 1ES9A 4GQBA 2B1GA 5DBOA 3TL3A 3WLRA 4M8NE 1WXDA 4J76A 3LWNA 3O5AA 1EK6A 5L4NA 2GO1A 2Q4OA 3U6DA 3ZQ6A 4EHJA 4IHKA 2ZAYA 2ODQA 3UATA 1H2ZA 5EJ2A 2MWMA 1JG6A 2CBZA 1T5OA 4M9XA 3C6YA 4B73A 1TUBA 1JRLA 3K71B 1ECJA 2QVZX 2JLBA 3I6YA 4KQCA 1E1MA 1FS4A 1NJ1A 4KQ6A 3STYA 3W8DA 4AT1A 5LP6A 1BFUA 4WUVA 1HZZA 4CG2A 4YJFA 4LE1A 3OECA 1NQ5A 3MTDA 4L15A 3W0FA 2QE7D 1CIPA 3LOPA 4QU9A 3EISA 1VEKA 1QIKA 1SHLA 1T5SA 4OYLA 5H81A 3G0DA 4FOLA 3KTOA 1TXGA 3OM0A 2DEUA 3KB6A 3UK6A 4IV8A 4IQ0A 4FE3A 4BRWA 4DAEA 2RHLA 2QLTA 3KKOA 3WYEA 3IT2A 4BKMA 4IGKA 3DLIA 1JHDA 1R2QA 5DGCA 3STWA 3ST7A 2F43A 1BEUB 3WYBA 5EPOA 1SBTA 5DISB 4QVKA 2PYDA 3CVXA 3Q3GE 1ID1A 4HEA1 2BUCA 4QAQA 2YJ4A 3BGOS 2GHRA 6CHYA 3BRSA 2GYUA 4B1FA 5CFNA 4UVEA 3UJNA 1HORA 4JOBA 1GKUB 4K9LA 1QO9A 2C5SA 1LI5A 2JGFA 3PC2A 1PDWA 1RAGA 2OHIA 4Y6OA 4DSTA 5AJTA 3FAZA 2WZDA 4TXHA 1WTAA 1XVUA 5CLFA 4KYUA 4OY3A 4Z1MA 1U3VA 1DRVA 1GTJ1 4F6LA 4GBMA 3D6VA 4CM6A 4KE9A 2CDRA 4GKJM 4Q82A 2G6TA 3LBYA 3Q7SA 2A1TS 2C03A 2FFHA 3M5CA 1P60A 4ZCPA 4KR2A 2JI6A 1H6DA 1GRQA 3QYFA 5EWMA 3TS1A 3B6KA 2PWBA 1GN8A 1QK3A 2P9BA 4UN2B 4FHFA 5THKA 1NT4A 2GPTA 4A4DA 1T2AA 3I72A 5DM0A 1ZRHA 3DUFB 5TVGA 4PN3A 1B8OA 3LGSA 3U80A 1IHOA 4D0LB 2VF7A 1KIFA 4I1RA 5JBNA 5IHXA 3IIIA 4R8KA 3PP8A 4C05A 3ESBA 4CTMA 2J5YA 1NYRA 1YQTA 2IXFA 1VIDA 1VL5A 2P6PA 2X4LA 4DMCA 2BR3A 2O2DA 2H5XA 3SATA 2ZIZA 4R69A 4XUDA 4NCHA 3JQ7B 4PAWA 2H48A 2IW1A 5A6SB 4D4MA 2WNIA 5B58T 5CM9C 3LCVB 5DGXA 4L6CA 4JYPA 1ZESA 5FPKA 4YLEA 1G5TA 1ZL2A 3PBKA 4Q3KA 3GRRA 3V55A 3LU1A 1XNHA 3PDIA 4OLHA 3LC0A 4NBTA 2V7UA 1YDMA 1U2GA 1J0AA 4BS9A 1QG4A 2RGGA 1E9RA 1VI5A 3DVLA 2H1FA 3H1AA 3TLJA 5JS6A 3UO8B 4IDFA 1XD2B 3TNDA 5TF0A 1WMDA 2VDBB 1RYFA 2E9SA 2VWPA 3MA0A 3OU6A 4XARA 1X94A 1Q16A 4DL9A 1V3VA 4F38A 3RGSA 2UUBM 1VL0A 3GFRA 3QFCA 5E95A 3V4VB 4F0JA 5KIAA 3OF3A 4FONA 5BQ5A 4DEXA 1XZFA 2J3DA 4LJLA 4HY3A 4U4AA 1AJEA 2XFTA 2OZPA 5A9SA 4DKXA 1WQ4A 5E26A 2A8YA 2JBHA 1LRJA 2ZYGA 4EHKA 2KNAA 4B3DA 3ZD6A 4MUBA 1J2RA 1O95D 4BNHA 3EPRA 4RA6A 2YVLA 2XYRA 3FNGA 2HA5A 3WTBA 3MGBA 3CPJB 2WMOB 5IZ7D 3SPXA 1BHO1 3LDUA 1ZGCA 2FGKA 4JELA 4NMHA 5IC4A 2A86A 3U7JA 2WJGA 1OX6A 3CUVA 1IXZA 2W6MA 3EGXA 4GF5A 3OPVA 5TC4A 2JZ1A 2EUCA 2XOEA 2VPXA 1ENOA 3FWYA 2JFWA 3O3CA 7MHTA 1L7DA 1DAOA 3EFOB 1IPEA 2A7QA 1E1LA 5K03A 3K4QA 2JVIA 2P2LA 3GLQA 3PQ4A 1QHSA 2PSEA 2PZ8A 5EC8A 1PWEA 1ORRA 5D51S 4RHTA 2W82A 2H4XA 5BYJA 3A1TA 4L6AA 1LX6A 1TX4B 4PAQA 5DSXA 1V5EA 2OBXA 2DJIA 3G82C 4LBYA 3NM5A 1NE7A 1NT2A 3D5QA 4K0KM 3KYCB 3QELA 3CKMA 2GF9A 3THYA 3L6BA 3VO8A 4RZ2A 3FUUA 1NL3A 2RH4A 4LK3A 2IXAA 2B35A 2BHLA 3UTDA 2VDKB 3SQNA 1WG8A 4TT3D 4CVNA 4CIYA 2ZWVA 2WFMA 5BSUA 1N3BA 3NHRA 3PJFA 5IWAM 4HV4A 1NF8A 2WAAA 1LY1A 5EKXA 4JT2A 4S0XA 4RF1A 4DUGA 4A8TA 1U1FA 3BXEA 3Q8XA 1DB3A 4G9GA 4IQFA 3TNLA 2DFNA 4RMGA 1WLSA 4IW3B 4KN5A 4WFJA 4TXJA 3FKSA 3KKEA 2CJYA 1MJGM 3EW9A 3ULKA 1Q3KA 1M2VA 3HU1A 4NDAA 1Y1QA 1BQEA 4ZAWA 1Q0LA 2Q2WA 3P9ZA 1S7GA 4JL5A 4OB7A 2LCQA 4ADSG 2VTDA 4DE5A 1I1QB 3RWMB 1CYDA 2XUIA 1EXDA 3FFWA 2RHJA 1NPDA 1XG5A 3B6ZA 4QQRA 2BFNA 4CEIB 1AHNA 2B83A 2AUTA 4NCIA 5CA0F 4BNDA 1TUEA 4BLSA 5AW9A 2AKYA 3QHPA 4BFYA 1W2WB 5BNTA 4PX3A 4QYSA 1Z4OA 1YR6A 3K2BA 1Z13A 1N6NA 3H84A 3M9LA 4V1CB 3U6MA 5AK3A 1ZD1A 2Q8NA 3PHBE 1QV7A 1QGOA 1JFVA 2C2WA 3SC6A 2ZRBA 1BDIA 4F5EA 5J43A 2AR9A 1VRWA 2O8FB 3MS2A 5F9HA 1RWWA 1C8KA 3I1JA 4GDMA 4JP2A 3LA8A 4HAVA 5FJIA 1CR0A 1FSGA 1PT6A 3CNOA 4QUBA 3RVBA 3U48A 2HBZA 1FP6A 2GO7A 1ULAA 4ZN6A 3KJGA 2ZUVA 4H16A 5AJXA 2QP4A 3O1JC 3UNXA 3OQIA 1P2SA 4ENUA 1VL1A 3G88A 5SZHB 1Z68A 2QM8A 4KXUA 2HQBA 3DKRA 1YD7A 3ET5A 1NUAA 1Y7TA 2IHVA 2CN1A 2VHQA 1R0SA 3L7AA 4O2LA 1Y8ZA 5CLQA 3QVTA 2XZLA 2A9RA 2VF8A 2GD2A 1FXWA 2QRVB 2O2CA 3I2KA 2QQ0A 2UZAA 3T7EA 3FHTA 3F2IA 4TRRA 3VBCA 2PZGA 3C8ZA 3U4MA 3HEMA 2F00A 4RE6A 2PBFA 4ALKA 5IYZB 4ZTZB 1RQRA 3T1HM 1NBAA 4XFKA 3OWOA 3K0BA 1ML3A 5A5EA 1E94E 2VP5A 3A1UA 3STTA 3UB2A 5E7QA 5ALMA 3BQMB 1Z6PA 5BRJA 4G4GA 1F0YA 2ZJ5A 3KCQA 1GLGA 2V55B 4DZZA 5JQGA 3CWQA 1PR1A 1L5VA 1KBZA 2HQRA 3IQFA 3S5UA 4NMWA 1YB6A 4NC6A 1KC3A 2WC1A 3L8HA 5B7NA 5EXPA 2AV6A 3AF5A 5REQB 4GHWA 3BBZA 2ZBKB 4AX4A 4Z1MD 4G4JA 4W1PA 5BR8M 4YAWA 2YWGA 2V6GA 4DJEC 4B08A 1SJ9A 5CVVA 4Y0AA 3MQ2A 4FI3F 4G1CA 4XQEA 1UFKA 2I55A 2C5LA 1MV5A 1ZM7A 3ETCA 2QD3A 2FNAA 5ITXE 3JQ9C 1QOQB 2HB6A 3PC3A 3HYNA 4D99A 4UPEA 2IUTA 1HYQA 2DPHA 4KVFA 3X2FA 3V34A 3U4HA 3PEYA 2IYEA 1QGYA 4D6PA 2XCIA 4CUKA 3T0GA 5L9AA 1ADCA 2HADA 5C18A 3KHSA 4HQ0A 1MFPA 3DT8A 5CCDA 3HB1A 4O4IF 3EXFB 2H4YA 2ZSJA 2ODNA 5CLHA 1DOAA 4CM8B 4YRKA 2C3YA 4RTLA 4TWRA 4PQRA 4Q19A 2GAJA 5AHRA 5HF9A 4F3CA 2JIBA 3Q7EA 1C9JA 4Z7NB 4WK2B 1HR0M 1DV0A 3A4VA 3DMHA 1Y37A 1QE0A 1YDWA 1ZI8A 2QE7A 3K31A 4UU8A 4YO7A 5DULA 5G0SA 3SEAA 1I7PA 4JV5B 2ZANA 1GYRA 1TQ8A 2GJ8A 4DR1M 3ZI0A 1AKWA 2FFJA 1SQ0A 1YB5A 1AUVA 2ZKIA 1Y4ZA 1DKMA 2IXBA 4PLZA 1GDDA 4PGMA 1FNCA 1E3IA 3TZKA 5IH3A 1AMUA 3ZGNA 3JZIA 2GZHA 5ADUS 2PUFA 1AKNA 4IDQA 2QEQA 4CKZA 1GLVA 1WKCA 1YGYA 2QMZA 3GJRA 3TF5A 3D3WA 4F2HA 2Q0XA 3UGKA 1W4CA 1P3DA 1RYYA 3L27A 1VE3A 2CE2X 2IPLA 2V4MA 2XMRA 2XWBF 1G7SA 1KVQA 4IIGA 4LG1A 4YP5A 1MQSA 2XNJA 4PBTA 4S0ZA 1TADA 5GV7A 2REBA 2I5PO 2FWBA 5A3QA 2BHTA 2NU7A 3LP8A 4IFIA 4PGGA 4L8LA 2NUBA 4BN5A 2V0CA 4HDAA 4OQZA 1PV4A 4JUAA 3Q15C 1MW9X 4N12A 3ZDYB 4MHTA 2ZI6A 3O4GA 3PD1A 3EQ2A 2N1MA 5BPFA 2E3JA 3CLHA 3RGWS 4B7AA 1QHGA 3K9PA 5M04A 2AI1A 3ZNOA 3WNCA 1JECA 4EDHA 5AFSA 4TMYA 5B6JA 4KACA 2C4WA 1NVMA 2PSHA 3DEZA 3RYFB 5IXSA 2ZJAA 3V76A 2CHUA 2EKBA 5KDOA 4JMLA 4L28A 4M0UA 3IAS1 1H6AA 4EIWA 1N32M 4MO9A 4V02A 5EEHA 4ABTA 2PTHA 5CDTA 5BUQA 1ZBDA 3IQEA 2UXCM 2HIAA 4PEVA 2Z98A 3MILA 3HMKA 3C5VA 1RQPA 4JJGA 1PG0A 2XNSA 2WU4A 3KSJA 2COUA 1M5TA 3FOAA 1XDZA 5DCUA 1T8UA 1XLVA 4BZQA 4CIVA 3QVSA 3ILVA 3OE7D 3E18A 2XKBA 4L5JA 4WINA 1T36A 5CBPB 3CW8X 4MEJA 2CKDA 2D1RA 2Y1GA 3MINA 3DVRX 2HK9A 3AETB 1SOAA 2W2KA 5JFOA 1QC5A 4YAKA 4RU1A 3UENA 1A9ZA 4G0VA 5TQ0A 3N8GA 1BHJA 4NAUA 1ZK4A 2H7CA 1VBKA 2J5KA 2P68A 2W6JD 3CTMA 3GJ6A 3NR2A 3OOEA 2NWQA 3R5KA 5CJPA 3CUUA 2HYIC 1L0BA 2GF0A 4DDMA 4IJEA 3VOAA 2R7KA 2HSJA 5ESXA 1E8DA 1KJZA 2EJUA 1JLRA 4R7ZA 5CYPA 5C31A 3VU8A 3UGTA 5C7IO 5JXWA 3ADDA 2X8LA 3P45A 3UUWA 3V1TC 4YCSA 1NM5A 2AMVA 3DM5A 2NO0A 3SMPA 2WM2A 3D3KA 4OXNA 5I7AA 2ADFA 5C7LO 1CV2A 1QGUA 2QAJA 3FJYA 5JHHB 3QUAA 5CB8A 2X5XA 3QVJA 1H9CA 3C6XA 3FHCB 3L92A 1FTNA 1PJSA 4W5WA 1K7YA 2GQFA 2SICE 5FNVB 1SVIA 1QU3A 1I4OA 5IANA 4DR5M 1IFXA 1KAQA 1KI6A 1HC7A 3GROA 1G3QA 4H7FA 5K4AA 1EUZA 2R60A 4GH5A 4M1EA 5IAGA 3W5UA 4XGQA 2PD4A 5HUHA 3THWB 1LPNA 1TA9A 4OHKA 3PENA 1MP0A 1RWPA 2AFRA 4I1IA 1E8MA 2H3HA 4AJEA 4DT1A 4CKWA 3MYYA 4MLCA 2CXUA 1Q1QA 2MHCA 3GYGA 4OXKA 4JBLA 1M2OB 2ERXA 2X7HA 3PCXA 4M0CA 2HCFA 2J6IA 3TLGB 4KZKA 1SCUB 3ICOA 4MV8A 5H80A 2FRVA 5I9SA 2ZDQA 4URYR 2QX4A 1YUBA 2Q4RA 4RCVA 2X3UA 5C1IA 2YZ2A 3OQHA 2G0NA 3UT0A 2E0IA 5FV7A 3W7VA 1ZOIA 1E6LA 1ZUD1 3PDCA 1ABFA 2D00A 4JEIA 1XZNA 3RG2A 2EL7A 2F90A 4DCMA 4E46A 3IDSA 4C6HA 4QDUA 3R7AA 5FV4A 4HFJA 5AHKA 3D3JA 4NV3A 4OKIA 3ZG6A 4TQAA 3RBAA 4CQMA 1DCKA 5GJVC 2FH0A 5EHIA 5G1NA 3GEIA 4BPBA 1DAGA 2R96A 1IATA 4MUMA 1DE0A 5L7YA 5LYJB 3TB6A 2VDUE 3NOVA 1DAKA 4J0CA 1OAIA 2PYIA 4MS1B 1GL7A 3QEOA 1U04A 3HCNA 4UUNA 1QTNA 4A6EA 4CGYB 2PXAA 4JYAB 3SN6A 4NCNA 4WRRA 1G7TA 2GBIA 3KKNA 3MAGA 1IM2A 3NAMA 4L4SA 1KDZA 4CKCA 2PUWA 4GU5A 1P7ZA 4UUOA 4FE4A 1KFEB 5HKBA 2NVBA 1USVA 5E6RA 2ZXEA 3CNQS 3EX7C 4QARA 2YBEA 4LVOA 1FYXA 4O4JB 3OJLA 1TU4A 2XBLA 1XVIA 4RVFA 1HUQA 4RLFA 4QRHA 3RS0A 3HKBA 3P20A 2KE5A 4FMCB 5KJCA 2BFOA 3K9OA 1VIYA 3AEQA 2X58A 3OPNA 3ZBPA 4QC2A 1Z37A 3O0TA 2Y3IA 1R9NA 2PRKA 5FA6A 2B6NA 1ENZA 1IC6A 2NVWA 2OFWA 4E14A 1F2DA 3OJCA 2YIJA 1R0YA 1Y5IA 3JQEA 1PP4A 2EG5A 2BZ1A 2ZJ4A 4Z99A 1JB0F 5KQLA 2EQ5A 5TNXA 5C3MA 1OFTA 5LQNA 1H2HA 1L7VC 3JATA 2Q3LA 3E05A 3KUDA 4DA6A 3ETNA 3RVSA 1MNQA 2QYOA 3QMVA 3M83A 2ID9A 2FMXA 2GTIA 4BVBA 3EBPA 4YXFA 2AF4C 3C85A 3WRXA 3ABIA 1IUNA 3OQPA 4F3KA 3OZSA 1LS6A 3AL2A 4JI3B 1DTWA 4QTUB 3HYSA 1IEVA 2GI4A 1SFRA 2L19A 3KVRA 4PZZA 4HL6A 3WGZA 1KSHA 3AVXA 4IVPA 4LGYA 1MC4A 3GUVA 4AP9A 4RZSA 3UG6A 3KOWA 4XDZA 1UXHA 4LJ6A 1KP3A 3EQ6A 4M8IA 1AQJA 3OJ0A 1SO8A 4C76A 4UUQA 1DJPA 3UC5A 1SXHA 2PUVA 1F3LA 5F35A 5FCDA 3PRJA 1XEXA 4B0OA 4KEAA 1NATA 1Y89A 3H2KA 4RGVA 1M2KA 1Y9EA 1YF3A 3N9IA 1PJ8A 4CMKA 4RD3A 2F5PA 5CNJA 3KOYE 3QYBA 4LZZA 1EU1A 1M1YE 1XN1A 3TLMA 5JS7A 1KWGA 2BTQB 1V8FA 1VJ5A 3ZDRA 2X1HA 5AVQA 2ZT7A 4KUGA 3SOPA 4B9AA 4MV6A 3WLIA 5KX5F 4IHJB 3UQZA 3NC0C 2ZQ5A 1EDEA 4IMPA 5D6OA 3VYSB 4OLBA 3ABRB 3SJCA 4AVYA 5A3SA 2EBFX 4HDNA 1INLA 1Q12A 4MLDA 2OQ4A 3BM5A 3KWLA 5FYQA 3L06A 2XNDD 5LQJA 3R3ZA 1RC1A 4ZHQB 3HP7A 4D3DA 2BSQA 3MLEA 2C98A 3U61B 3SIRA 4BE9A 5F3WB 4N7MA 2KRUA 1B0UA 3GLHA 1NPTO 4B7XA 1YQ9A 2A0XA 4PCLA 3N70A 4JQCA 2YICA 2DZDA 2JIRA 4F96A 4JA2A 4YO8A 3ZU2A 4QPNA 1QYIA 5JAMA 2C3UA 3W6ZA 1F2TA 3ZD8A 5AVKA 4F4DA 4X60A 4KJXA 4WKNA 1YZVA 1FJGM 4TLDA 1NWCA 5A4IS 3B13B 5A4DA 3GAFA 3LYUA 2WJWA 1LQTA 1CZUA 1LI4A 3HKEA 4L5CA 4MRAA 5K3DA 3TAUA 4AG3A 4F1KA 3GIWA 1GUYA 2LHCA 1NN0A 3AHEA 3M0EA 2NUAA 3RBXA 1ZCBA 2OHGA 1Y3IA 2DFKB 4U00A 5JXHA 4GHAA 1KWKA 2WWFA 3M3DA 4J7AA 1OA0A 1P4GA 3LD9A 1WGLA 4P84A 5LB4A 1MHTA 2IY7A 2YHSA 2DR2A 2DJ5A 4NYMR 5ECWA 1C3VA 2F6RA 3LPCA 5BWLA 5K0LA 2ZTMA 4C0AC 1AXRA 1NBWB 3F47A 3JQGA 1IULA 3O84A 5HIIA 5DHUA 4GIPA 2VBFA 3UAGA 4OA5A 3VR5D 2PKEA 1DL5A 4EA6A 1AK1A 3BTVA 3C1OA 2ZAIA 1T10A 2DVMA 3MUFA 4OHPA 4LOKA 3WGUA 3Q8MA 1EP1B 3Q8GA 1NUPA 2FN8A 3G85A 2XZDA 4MA5A 2C9BA 4YJ3A 5BN5B 4OX9B 2DUUA 3J80S 3N05A 2XADA 1DTEA 2O6HA 5AI9A 4AUMA 1S3IA 3COYA 1YS9A 4D96A 2OCGA 4NRDA 3EG5A 5K3AA 2O52A 4RDXA 3L1HA 1L4HA 1QAMA 2GCOA 2FQ1A 1KQPA 2J87A 1NW8A 3LC2O 5LZ5A 4E7OA 2OTCA 5IWAB 1GTVA 1KNQA 2G67A 2WTEA 2PGJA 4ZI3A 4I66A 3O93A 1WZEA 3HCOA 4BCCA 4PCVA 4WDQA 5FWYA 1WVIA 1V26A 2C29D 3RYHA 1WB5A 4D8XA 1VP9A 3RC9A 3F6BX 2VH1A 4I8DA 4ZPJA 3SR3A 1GQQA 5JXJA 4RQTA 4DCUA 1MAHA 1T6OA 1U80A 1XMSA 4OBEA 4S1PA 2QY9A 2NIPA 3U7RA 4ZJUA 3K7EA 3SYRA 3ZIDA 2IH5A 1AF4A 2VCYA 3WLHA 4YALA 4HTFB 3I0NA 4UMFA 2CEKA 1OLSB 4CT4B 5FTNA 3H17A 3JQAD 4O5OA 3ZUGA 5BV1A 3BERA 5LOVF 2ZRNA 1MH9A 4G8BA 4OF4A 4DLVA 3ZQKA 3DE5X 4HN9A 2FQWA 2PJRA 3KSAC 2P3OA 1IOLA 3AX6A 3GARA 3NALA 1RQNA 3NWOA 4IIUA 1ZMVA 2NZYA 1VJ1A 2RK4A 4BOYA 1ZNXA 3DQPA 3NCHA 2RBKA 2I7VA 5AM3A 4MW5A 2RGRA 4Y2QA 1UR5A 4X7BA 3FMPB 1W5EA 2Z8YM 1B8VA 1ODKA 2OBFA 1QNFA 1P77A 2PZLA 1PFKA 2VCHA 4KGXA 4YLGA 1EUQA 4ZI2A 1N36M 3PC4A 4BNMA 2D0PB 3H2YA 4HZUB 3RK1A 2WJPA 5KTOA 3QEMB 4QOSA 3BULA 4TQUS 2R18A 2WICA 4EELA 1YVPA 4QPZA 1U28C 2J6CA 4HUJA 2CCKA 1U0OC 2YH2A 4G09A 4PZUA 3PSAA 3PEEA 4Z7JA 5FOQA 3OCUA 2YKGA 2V8OA 3LUPA 2C4KA 3GJ3A 4DARA 1FVHA 3SASA 1XZKA 2W4IA 3IIKA 3G2MA 5K8UA 1F4LA 3QMMA 4CNQA 4CLRA 3CNBA 4CYMA 1YKSA 2M5ZA 1SVMA 5JAOA 2RGYA 3AG5A 2PFSA 3DBIA 3ENZA 3O95A 3TZEA 4FBMA 1SK8A 3DBRA 4XDGA 1TAHA 1WABA 1E9SA 2TSYB 3LWZA 3L18A 3N53A 4QZVA 3D7RA 2ZUEA 2R4UA 1K7XB 4G4QA 3UFXB 1DC5A 4C3UA 4UAGA 3JAKA 3TIGA 1UC5B 2P9HA 3PKJA 1T5IA 3L7LA 1GKIA 2P5TA 1SUDA 3QVGA 1J4AA 1HK7A 3W3AD 4A16A 1E1QA 1TDZA 1JYFA 4NZZA 1YVEI 2DENA 3KSXA 3PFIA 1G2OA 2X8WA 3AWDA 3EF3A 4QGBA 4A0QA 1II8B 3B48A 1GZ4A 1IZ9A 1OX4B 2HJ9A 2HF2A 4YHHB 2CLCX 1XVTA 1QZZA 1Y9ZA 4XDHA 1EHYA 2ZRKA 4KIJA 1CD5A 3U9TA 1ESNA 1L1TA 1PUIA 1OHHA 4TUWA 4B17A 2CBXA 2P1ZA 3SP1A 4IGEA 4B40A 1JFFA 1ZK3A 3RTAA 3SQWA 4HFRA 3U9LA 3IOBA 1MOQA 3NHWA 2GZAA 2HPHA 3N7TA 2IF0A 2EFHB 3NDRA 5LUBA 3RUHA 1WM1A 1D7OA 4KXQA 1E6EA 1UK8A 3WLMA 4EGJA 1HDRA 3H1FA 1EG2A 2MIIA 4MX8A 4RPKA 4K6OA 1WWKA 4Z1OA 3KS8A 4US2R 5T7BA 1TZMA 3HCCA 4L9AA 3DCNA 2B4QA 2P41A 2XE6A 1JG7A 2A0UA 2C2MA 4A0HA 3PT9A 3QUBA 3S8MA 2QX8A 1FSPA 2Q1UA 3HO1A 1WSWA 3CF4A 1U9ZA 2OLJA 3NGMA 3T5CA 1EEHA 1MXFA 5CW2A 5KTYA 2H2AA 7CATA 2DFLA 4GECA 1N5LA 5JNUA 1N3YA 4L0QA 4MV1A 5TLSA 1KA9H 3DNFA 1NBME 1YHNA 2Y66A 2XYHA 3WKAA 3FGOA 3LQFA 1NJ2A 2C96A 4ZVOA 4FIZA 4MUJA 2I80A 3MTJA 5BW6B 1JDUA 4C2UA 5JPCA 1BG6A 5GJCA 2ACKA 3B82A 4ZEXA 3RSFA 4C43A 5DYIA 1VG8A 3OJWA 2OG1A 2V96A 1GR1A 4NESA 4AUNA 1HDGO 2EZTA 3I62A 1AGRA 1ICEA 5BQPA 1OYWA 2NUPB 1R0WA 3DNMA 3KBBA 1CUAA 4MQEA 2B1QA 5T41A 1UBJS 2IU4A 1FNBA 1B7GO 2XXJA 4DV4M 3DOAA 1EVJA 3TLKA 4GEWA 4WCFB 3DVAB 2XMQA 4I3FA 4MR9B 3EC2A 1IDOA 2QLFA 2XLCA 3KOOA 2B2CA 4KWIA 3JD1A 3DJFA 3KWFA 1SG6A 4Y9TA 2A94A 4XGRA 2JKYA 1O7JA 2Z9BA 3U3RA 1SKQA 3H0KA 4I9HA 3VO9A 3ZVLA 4AMBA 5KVCA 4PHHA 2QTAA 3OCYA 5TMBA 5J3JA 1G5PA 4BWFB 5DI3A 4AF7A 4LF7M 4E5DA 2XDAA 4UQOA 1S2OA 5JMTA 2BUAA 2G5PA 3PGA1 5E6SA 3MMPA 2WTMA 2HH9A 2O59A 5DWDA 2WIKA 5TQJA 1D0MA 2IYVA 3C14C 3JQCA 5F64A 4LHWA 3K5WA 3TWOA 4ENSA 3TWLA 5EJMA 9GPBA 4RIGA 4M55A 4I3GA 5ALHA 2CW5A 5IN4A 3LG2A 3U7FB 3E48A 1TFUA 2PE5A 3NFRA 1I1OA 1V95A 1WIWA 2X3YA 3C48A 3HY3A 3EZLA 3ND8A 1GPKA 4LN1A 4G4IA 4MH0R 2YXNA 4UTOA 3UJCA 2BT4A 3T7KA 1LSOA 4WLFA 2Q5LA 1RI1A 2VAPA 4WD3A 4EWLA 1OPXA 1GTG1 1Q1ZA 1NXVA 2CLOB 1RQ2A 2E4YA 4HPXB 4OJKA 2M60A 1W34A 4JI2M 3PDHA 4JBGA 2DWZB 3W5JA 3W4IA 3ICPA 3MS4A 4R2IA 4XRRA 4IKEA 3BTSA 3U5ZA 3EUWA 4YDSA 2XMGA 4MPPA 1BA3A 5JD5A 1Z82A 4WV3A 5IARA 3UG7A 2Z2ZA 3QRWA 1HNWB 2IDKA 4RF4A 1IEXA 4LPSA 2PRIA 1U81A 3MELA 4QPCA 2W2QA 1ZR2A 2ZIXA 1EP2B 2B8WA 3IECA 5EPUA 4C30A 3HXPA 1E20A 2KWIA 3ZV4A 2XTMA 4EMSA 1VHTA 1DAPA 4F2WA 4P3OA 2JFOA 3IE0A 4J0GA 1CT9A 4DBVO 1KDOA 2C94A 3RVLA 2Q6IA 3HHWA 4IVNA 1Q0RA 4YMHA 1R0XA 2CXTA 3SJUA 3LW7A 2IELA 5FORA 1CDEA 5KTPA 3RVMA 4TV9F 1T8YA 3VI4B 3TTUA 4DDVA 1AGPA 3BAFA 2DI0A 1K3XA 1Y5NA 1DGQA 2GBLA 3A3PA 1L2BA 1I6KA 1I0ZA 1NM5C 2FPUA 3N7AA 2C92A 4R8LA 2L4FA 1QRTA 3I6QA 3WRYC 1C7YA 2AC2A 2QPLA 2HFJA 2R46A 1VB3A 1YQEA 1C0LA 4ZO8A 3UK7A 1KO4A 3DQZA 4FGKA 5BXYA 2F8TA 1UPXA 3GT7A 3UT5B 3ZK7A 4FT4A 1E4YA 1VKNA 1Y9DA 2G88A 2Z1DA 4CTJA 3P32A 4Z4IA 1XHBA 4MQ4A 2IUSA 3AV0B 4IOMA 1A0OA 3UYLA 3AVQA 1BGVA 3QG1A 4P5PA 4F4JA 5MDHA 1BEZA 1USUA 3S99A 4XGIA 4N6NA 4HPWA 2EBHX 1FFDA 1XQYA 3TPZA 1A9XB 3P8ZA 4ZDKA 4L4ZA 1QGAA 5JALA 3U6SA 2H1LA 2R5WA 4BQSA 4C2TA 1OFGA 4PR3A 2ZVPX 2Z3ZA 4ZOEA 3LDAA 3ZQ4A 2R48A 3ABQB 1QO7A 3LSTA 1C4XA 4NBRA 5F4ZA 3WL8A 5KYWB 4R2KA 3O75A 1C30A 3RC2A 3PWSA 1L2TA 4Q4AA 4YP7A 4ZCSA 3PXAA 4YMWA 4F21A 3PI7A 2GN4A 2GEDA 1KYWA 2GS9A 3QWHA 4AFNA 3L0DA 4IEEA 4B35A 1N33B 3EGDB 4QDTA 4OI1A 3PVCA 1XLWA 5A62A 2NW6A 4B32A 1QK4A 4DMKA 2RRUA 1RU3A 5E6UA 5FTWA 3TSZA 2MT9A 1WOMA 3IHTA 2C5RA 3QMPA 2CUTA 2UYQA 3IBSA 1VG5A 1WV0A 1U1CA 4Z3OA 4LHZA 3WV4A 2CXSA 3R9XA 2G4CA 2XVMA 1P7PA 1G8AA 1LA2A 2WFLA 3MUEA 3ECAA 2IU6A 5HBRA 2PO5A 4C4TA 4O8CA 1QF9A 2JLZA 3GBPA 1QRDA 4QFDA 4LXYA 4A6PA 1POWA 5A1TA 3QENA 5JXGA 2BR4A 4X44A 4XKJA 3ZJ4A 5M5BA 4DUYB 1Y42X 1NIPA 1AKEA 1UOPA 3RQSA 1KSFX 1G2PA 3O83A 1AM4D 1EXWA 2J7PD 3R6TA 3K09A 4X00A 3C9PA 1M8PA 2OOKA 3KZCA 5FO1A 2FR8A 3WL3A 4BYMA 4DC9A 3A9TA 3A04A 3GOQA 4D8WA 1M6NA 4UZEA 2PUEA 1GFIA 2DFTA 1XT6A 1SURA 2ECFA 3CISA 3I37X 3NYIA 4LRWA 5D7BA 1PFQA 5KQRA 2HWXA 1NLZA 5KAMA 5T8KA 3R6DA 4RPLA 2PGNA 3B74A 3GUHA 1YVRA 4H0CA 1V1RB 1EHIA 1PS8A 4DR7M 2AMYA 2GJSA 3VR2A 2NTVA 4UCQA 3DOJA 3OQIB 4LYHA 5F51A 2EW8A 1Q1BA 1VKZA 2PV7A 4DIBA 1ZC4A 3PEWA 4KNYA 3TJMA 2P4SA 1P80A 3O8LA 2WZJA 4JU8A 1PEYA 5CT5A 4E11A 1Q6YA 1FFBA 1M1UA 5DBIA 3F8SA 4QJ3A 4DDWA 3RGPA 2HEIA 3OX2A 1TGVA 2Q3CA 2X0RA 1OLUB 2VQSA 2AEJA 4HWOA 2NSHA 3NUZA 5AK5A 1EKXA 4CW7A 1NNEA 2NMVA 4RTRA 4TMZA 1EFVA 3U7QA 2EKKA 1PWHA 1RBQA 3J81k 1A69A 3PQEA 1S8NA 4DSUA 1QAQA 1GU7A 4NNOA 1X37A 1Y81A 4PFJA 1OBOA 5DU2A 1G2IA 2ZZNA 5IKOA 1SRRA 4EKEA 4MKRA 4L5IA 3TRDA 3CRW1 4G0WA 3P27A 4BIIA 2PMEA 1DJOA 5D1HA 1GCAA 1CVRA 2WKQA 3ZGVA 1HE1C 3H9GA 3VR3D 1PZXA 1SB8A 1T91A 3QLVA 4IDBA 4ZK6A 3ER8A 3KWMA 1IY1A 3HU5A 3ITKA 1ZICA 3SEZA 4IEFB 1ZSVA 2BGTA 1MB3A 2I65A 3AT1A 2H00A 3AJRA 4MWCA 4BFCA 1C29B 1RQLA 4C3ZA 4WKCA 4MB6A 2DBQA 4M7WA 5BSRA 1WHSB 4FNGA 4Y6SA 1VPWA 1PJCA 3DLHA 1W29A 3RVRA 1HT0A 3ESDA 4LF6B 4TYNA 3TQQA 3M4JA 5FIUA 2J45A 1WKVA 2AIRA 3L4BA 4TKZA 4DV1B 1KRXA 2J5XA 1PN3A 5TE9A 2AFIE 4LX0A 1JU4A 5IBPA 1VKOA 1OTXA 2BD0A 4NG5A 1SOVA 2J5BA 3R23A 4HQKA 5D5QA 3WK4A 4KREA 1VE7A 1VQ1A 4IJFA 4CLOA 4I0WB 4BCDA 1VIAA 5HQJA 3KBOA 4ETNA 4WY5A 3ZHOA 3LXRA 3M4XA 2V1CA 2PAFA 4PYKA 3AWIA 3HO6A 5ARCA 1X19A 2FWPA 4LRSB 1LS1A 3ZKWB 4RETA 5CB4F 4BJ6A 3U6KA 4BJ5A 2XWPA 1P0QA 3IAUA 4I4IA 4X64M 1DFIA 1QVVA 1E0SA 1JSCA 3W68A 1B74A 1BGXT 1G66A 2XKAA 2PPLA 4QUIA 4JI4M 4XIJA 3UCXA 3ZWNA 5IBQA 2ZWOA 5HUQA 2GF2A 4F46A 1RYNA 5BO5A 1O0SA 2PZEA 3F6CA 1K89A 2JK0A 4MQMA 4OMFG 1EDZA 4P4NA 5CCBA 3AUXA 4AZFA 1SH7A 2VNKA 3TDMA 1FYVA 1WDTA 3N2EA 4IEIA 1AB5A 1DRUA 1HFKA 3JZMA 3T5TA 3TW8B 1O1YA 3W79A 1K4YA 2BI8A 1KI7A 3BHIA 4D0NA 5JWRA 2IP1A 2PXXA 1YS4A 1UZNA 1ISHA 3P97A 2Q4TA 4U9IS 4V3CA 1SVKA 1OKSA 4ZYUA 1I2AA 3O4HA 2J7KA 3O8OA 3ZNQA 5E4TA 1V1JA 3FPEA 4PIPA 1MIHA 3FY4A 3VYTB 1KPIA 1EXMA 2AFIA 5IT0A 3V9PA 1QGZA 5J63A 1SBYA 1CUEA 2VDOB 2JWSA 1R9GA 1FFCA 1UADA 4K6FA 5H68A 1VLJA 4GVXA 2JC3A 2BV3A 4ZREA 3ZHRA 1YHYA 4A8HA 4HNHA 4BX8A 1K6IA 4CQJA 2H5EA 1L4YA 2W00A 3I39X 3KU4A 3WMXA 3U9SA 3NYRA 1KI9A 1JH8A 3AKEA 3PUKA 4P1ZA 2IEIA 1E1RA 2LVNC 3EPKA 4NRWA 3PNKA 2INGX 3JD2A 3NRCA 4UEKA 4LRTA 1KVUA 2JZCA 2ONYA 2ZW9A 3JQ8A 4KR6A 5LMUM 1DTSA 1FVOA 1QHFA 4GXTA 3AEKB 3KZ1E 4P5EA 1NLFA 1SQFA 1MVLA 2A84A 3WRYA 3MWFA 3P1JA 2ZJOA 3OMLA 1OF1A 2KB0A 5J47A 2FPGA 3ZDDA 4Y30A 3F6EX 3H75A 5EIAA 3HCDA 1X8JA 3X1JA 2C2BA 3VVMA 3MT9A 3DP9A 1RXUA 2W43A 1WHTA 4HB4A 1LBSA 1OVGA 3PLNA 3AB7A 1WXIA 4CM4A 4W5OA 3WMGA 1G5HA 2QVYX 4RD1A 3K9FC 2ZCUA 4HDMB 4KBGA 4WBSA 1IK6A 2OYCA 1S3SA 3GUZA 3K6KA 4FQ5A 1V6SA 4CM9D 2JIZD 5FAXA 3WO1A 1RCFA 1UIMA 5HKKA 3JYOA 2VLBA 1YZGA 1NHGC 4MS3B 3IP7A 3BA6A 3DMFA 3AKCA 1C7IA 3GLSA 3HABA 4NZ9A 1L4KA 2Y0DA 3V1LA 4B3BA 3LNTA 4MVYA 4B48A 2UXDM 2G1KA 4UBLA 1HE2A 4ZTBA 5L45A 3TIFA 5ERYA 1J8VA 3TCXB 3VYVA 3F90A 3R0XA 1P4RA 3BWBA 3EZYA 2XT0A 4GZMA 1K82A 3QVUA 3IBCA 5IAEA 5EXSA 2WUVA 4HX2A 2COKA 3IAXA 3RFXA 4G2NA 2JD2A 3EGCA 1X1TA 3ZHCA 2Z3XA 4RNDB 1XGKA 3QEAZ 2OM2A 3QX3A 4DQUA 2QRKA 1LBIA 2OORC 4J9UE 4B3RM 2PRZA 4IXDA 3TSYA 1RYBA 1XJWA 3DHVA 1MH1A 1E9FA 3Q7PA 3SI7A 2GOYA 4MWZA 2QSUA 1HNZB 3W5HA 1L8XA 2BBTA 3ZNPA 2JS7A 3IIMA 4XWAA 1AHPA 3IVMA 3JVDA 3SMQA 2ZS8A 1WDLA 4ARVA 4ANRA 4COOA 2Q3FA 5EIEA 4JP5A 3E5MA 3W2IA 2HMAA 6PFKA 4QBHA 3VR3A 4GPEA 1WR1B 2YOFA 1E7MA 1E3WA 2CZQA 3I12A 2JGDB 2YRFA 1H8HA 1SELA 2FZGA 2I8AA 3PHHA 2HMSA 1L5OA 4LTDA 3Q8KA 4NP6A 4CKBA 1E7QA 4PT5A 2KXEA 2JI4A 2NTNA 3DEAA 3INYA 4QBGB 4WK6A 3KQHA 3JQBC 3CLTD 1Y34E 1KI8A 1NWHA 4WOPA 1FP1D 4AP5A 3HFRA 3PB3A 1PJQA 1BW9B 1D8AA 3H5LA 1YFLA 1GA6A 1D4FA 4O5AA 3KZMA 1J7KA 2BR5A 2CNDA 2VS1A 1VGQA 4ZT4A 2PX3A 5B2ZA 4K05A 5FB3A 1RWOA 2NZVG 1G64A 3S1AA 1POXA 5BWBA 2DB3A 2D4AA 3RF7A 4P4UA 4GOXA 3KG2A 3W8FA 1RTTA 4BFUA 2WU8A 2QN2A 2YXPX 4HI0E 1T9HA 1U4NA 3HNRA 5BOSB 1M8FA 4GE3A 4U7FA 4EI7A 2I9KA 3DDNA 3NORA 4BJ3A 4WASA 4D41A 1L7PA 2QBYB 4O4JA 4R1QA 2VEOA 4Z9XA 1RRGA 3Q10A 3A9UA 1BAPA 1Z2OX 2HK7A 1C9KA 4MA4A 4MUFA 4DDTA 1GM5A 5SV2A 4FYIA 4LTMA 3H2GA 2WHXA 3RVDA 3MTBA 1JMYA 1OIZA 4M3NA 2CT8A 4WN9A 4WVFA 3REQB 3T7AA 3EXEA 5LQDA 4LFBB 1U8CB 4H15A 3ZX4A 4YUWA 3C15C 2NO4A 1QF7A 3AR2A 4LSZA 2MJLA 2OP0A 4KGVA 5I48A 2UZ0A 3AJ9A 5JVDF 1EEXB 1ITZA 5GINE 1EE9A 2B8EA 1HSOA 5BN4B 1YJBA 1KEUA 1ZUHA 1ZM4A 1I4TD 3DAHA 2GYWA 2OZKA 3G2OA 3QFFA 4E12A 2C97A 2C42A 3NANA 2ZJ6A 4I6JA 4ZDWA 4E4RA 3JCZA 3ZS9A 3K05A 5L3QA 3HYCA 3G5AA 2X0NA 1XXHA 1Q7CA 3CS3A 4QQFA 1A2KC 2GZSA 3IESA 3B1JA 3P7MA 3QLEA 1T1GA 2VJNA 3NWJA 3HDHA 3ROZA 1ORWA 1Y1SA 2WD7B 2XIJA 3L05A 1A3CA 1TMKA 1T8RA 3EMKA 4YV0A 5TIIA 1MRSA 1XQVA 2OK8A 3WIBA 1T5TA 3V97A 3UMBA 3FNIA 1FVFA 3PEUA 4BJ1A 4U39A 3UHOA 3ER6A 3RK4A 3PICA 1R0CA 4FWIB 3GPYA 1EQAA 2QJFA 4KBYA 4P32A 1VHDA 5EL0A 1I51A 4D9KA 1NXXA 4B3RB 3KS9A 4N3NA 4LF4M 4NK5A 4IZHA 4H1VA 1IB0A 4I5EA 1EJ6A 2R0QC 2ZU6A 3B1FA 4FUQA 1IXSA 5FBWB 1LTMA 3U39A 2PRJA 1P7CA 2QR5A 3ISVA 3L7NA 2OBYA 1M8GA 5MF6A 4N5LA 1YZNA 5C34B 4BUJA 2PKXA 1D6NA 3I6BA 3K5IA 5HS6A 5DM2A 4HDNB 1COZA 1VRVA 4XVCA 2PU5A 2HHHB 1J5XA 5CX4A 2JZ0A 4FDVA 1Y98A 1CQWA 2IC5A 5ICEA 1PEAA 2OXEA 2R2GA 3PNYA 3EVEA 3D4IA 2PMDA 2NTEA 3MIZA 4TL9A 3WK5A 4ODIA 3KUCA 4ZV9A 3PUZA 1K2WA 4DA8A 2HCJB 4HYEA 3K70D 3LA6A 3QEKA 1HEYA 3WWOA 1OXMA 2XZOA 4M0LA 2VDWA 4QIHA 4D5GA 2ZRIA 4JBHA 3C5CA 5EWJA 1IPHA 4BO7A 1JAHA 3WNDA 4ZV7A 4NFLA 3DZGA 3HVRA 3JQAB 3ZY4A 2JHGA 3PE6A 1EVLA 2OUKA 3OIGA 5H9VA 2D2FA 4A3SA 4MVJF 4PX9A 4PN7A 1R27A 3X1WA 2CV1A 1KDTA 2P4HX 3HWRA 1TH3A 4M99A 4Y18A 4K9QA 3B3JA 3LXXA 3WB9A 4AYWA 2OY0A 4LFAM 4YJ2A 3EXHA 3OE7A 1U1GA 4IX9A 3KD2A 1V92A 5KJFA 1ZGAA 3CURA 3C39A 1WD5A 4CDGA 5JFGA 2OGSA 2A1UA 5HJ5A 5KMGA 1R88A 2FEPA 4J3JA 4IF6A 4E6PA 2P78A 2RK6A 1ZNWA 1G41A 1RT9A 4RD0A 2SNIE 1PJJA 1NP3A 3W5DA 4BLOA 5HJ7A 3EMVA 1EFHA 3JALA 5LU9A 4JLDA 5JNLA 2CV0A 2WJVA 2QMEA 4ZHQF 1XOIA 5DX8A 4ZA2A 2COEA 5I7UA 4OVZB 3B1XA 1YTLA 4OUKX 1THZA 4LDJA 4EZEA 1E5TA 2R5FA 2NQ8C 4UU7A 1YJAA 3FKEA 1LLFA 4MR8A 4ENQA 4JOCA 3B5JA 1DGFA 1JHVA 3T1TA 5K8VA 4E07A 2VT2A 4J1TA 3CIOA 1Q7GA 2VCEA 3KFXA 2WRZA 3GRVA 3EDQA 3F5SA 4A23A 1B0PA 4UOZA 2WWXA 3EPHA 4O0MA 1NURA 2EEZA 4S04A 3CBQA 4DOMA 1G8YA 1UJ6A 2WV9A 1E2PA 1KO8A 5HE9A 3FA2A 4Z9AA 5KB3A 1PNRA 2I7TA 2PWZA 4DJDC 2IH2A 1J0CA 4DB2A 3TIVA 5LMNM 4EYSA 2JD1A 2Z2YA 2DZNB 5LOVA 3FBGA 1B6GA 1DELA 3N2LA 1L9XA 1WP9A 4HTAA 1KMMA 3KLMX 3R74A 4TV8B 4HDOB 3UWKA 4RAQA 5CYGA 1P61B 4QRIA 2D7DA 1J1IA 4Q16A 1DOZA 2F4VM 5KNCH 3CF2A 3I2JA 2BGUA 3M34A 2G8NA 2UUPA 3UH0A 4Z49A 5B57C 3I92A 1COWD 4BC1A 1I7SB 1WMBA 3OPQA 2OV6A 4OD0A 4U8HA 3YASA 4ZYLA 5I7WA 2PS1A 3L6CA 1GG2A 1NVWQ 3K32A 3MIIA 4DA9A 2FZ4A 3ACCA 2FU5C 2FYTA 2VAMA 3GGSA 4TTPA 3PJRA 2OPHA 2XF8A 5L8VA 1NAHA 5C4GB 2WF9A 4LGMA 4TXNA 5SY4A 1N2GA 5CDFE 4JVSB 3SHGB 1XF1A 3G2QA 2NQTA 4EF5A 1I0IA 2WYWA 3DBHA 3GYBA 2JIOA 2IZ7A 2VKQA 1WVMA 3PTLA 4HVTA 4QDJA 1TTPB 3WOHA 3RHZA 1SCAA 4JJAA 4MB2A 1G8PA 4A3VB 1C1KA 2QN6A 1KMHB 4Q93A 1V8PA 1QS0B 2FJ0A 4L07A 2VUUA 1ZSYA 3HL4A 2A7XA 1XNQM 1XF9A 2E85A 3A0RB 1XZGA 3PDIB 4RIIA 4XYMA 4YACA 4KFUA 1IHPA 3VRHA 2BCJQ 1M3SA 3N87A 4RPJA 3GNTA 1YJ8A 1H6BA 2O0LA 2QAIA 3AI7A 1UINA 2ZBRA 4DGQA 3B2NA 3DHWC 1UP7A 5BXQC 1X80B 2EJSA 5BYAA 4P4TA 4L8VA 1BKDR 4RBNA 3ESYA 1YA4A 1A7AA 3V8PA 1GPBA 2OESA 3OIYA 2NU9A 1JGTA 5KPDA 5JZOA 4GKKB 3N8NA 1SAYA 3IQWA 2YXDA 4B4VA 1CQJA 4YCCA 2GX6A 4QO7A 5FFMA 4ZYWA 1XNRM 3AF3A 3VYUB 2ZB3A 3UHFA 2CVPA 3HKDA 1Z28A 1JSZA 2FPKA 1CP2A 1K8YB 4L4UA 1VEGA 4IILA 1BYUA 3G9TA 2YYSA 4KTVE 4P5DA 3WGNA 2DQKA 4CR7A 1VMAA 4K9RA 3UICA 1JKIA 1ISPA 3SS8A 4M98A 2OO5A 4NJMB 3PHJA 2EAUA 3WK7A 3LP5A 1Q2XA 3X1MA 3GNLA 5JWHA 5A03A 1K8QA 5GADl 1ULZA 4Y6QA 3A14A 4REZA 4UDYX 3VU9B 1XPUA 2B4YA 3PRHA 3EGEA 1E9VA 1GZDA 1N6OA 2Z2KA 1CUBA 1CEYA 4U2CA 3OEEA 4DCTA 1FQKA 4JC0A 5AKXA 3H87A 4PPGA 3A26A 5FHRA 2PHZA 3U81A 4JT4A 3L7YA 4XB2A 3BHJA 3X0DA 1EM6A 2EV9A 2WM3A 2O2YA 3DA8A 2VJCA 3JTEA 3MVEA 5E1DA 4OL0A 2J5QA 1M2FA 4JBYA 2AXPA 3P9IA 4NMLA 4ZIRB 1DJQA 1NO1A 3OO0A 2NZUG 4WADA 1CUZA 3DUWA 3DWFA 2AEEA 4GIBA 4JC5A 5ALPA 3JYHA 3ZHUA 4EFLA 1W0CA 4R83A 3DW1X 3P9RA 2D5IA 2IXDA 4GP9A 1FQOA 3DZHA 4F4IA 4P86A 3IPLA 1Z47A 3NHKA 2TS1A 2Z56A 1W8DA 3F0TA 3TSOA 2R62A 2AXNA 3TGLA 1R1DA 1RPZA 3PTAA 1H2WA 1VLQA 4LISA 2VUIB 3KQSA 3BMOA 3PJEA 2NYVA 1ISIA 3I4VA 1U2PA 3BIXA 5FLYA 2OOBA 2BI4A 3SIXA 3TLZA 4IHAA 1U4SA 5B3LA 1EUYA 1UQTA 3F4KA 4UPDA 1C0IA 4UM7A 2QTRA 4YNBA 3WGMA 2DAKA 3IL2A 2V6FA 3NHLA 3P94A 1JEQB 2I4TA 4G1BA 3ROTA 4BN0A 1KFBB 3VZSA 2DBYA 1VJRA 1JR3D 4TS4A 2O8EB 1WB4A 2FPPA 1TT7A 3STHA 4FLEA 4KSYA 5EZ6B 1KQFA 5JTTA 4B0PA 2IS2A 3TW4A 2JH8A 1X1BA 3B2QA 2KRKA 1SHUX 1OD6A 2HW8A 5EZ5A 4D9GA 1GXSA 4GD3Q 5F12A 1N34B 3HYRA 1FP2A 1B8UA 1N0HA 4B46A 4BUZA 2MR6A 4ASUD 1DDOA 2MH8A 2YWHA 1BVRA 2O01F 1BH6A 1I4LD 3C24A 4MS4B 1N8NA 1OXUA 4FGWA 2Z8XA 4A26A 3T0IA 3HJRA 4IJKA 2OD2A 3VFDA 2C1ZA 2C0CA 3ESZA 4DUZB 2FWIA 2H08A 5HRUA 3RROA 4HKTA 1JDPA 2EKLA 2LXNA 4KXNA 4M21A 1MB4A 4JJ7A 1KZGB 1CUYA 4IDPA 3PK0A 1HDIA 2C2ZA 1OXBB 3L29A 3DXYA 2AZMA 4EJ0A 1BXGA 4HNRA 2ADOA 1XTZA 3SDZA 3TBHA 2AVDA 3VX3A 4BZXA 5DLEA 5AW6A 2RHTA 3U0VA 3BE6A 3L40A 4BVFA 1J5EB 2QTCA 4MCIA 1AURA 2OO3A 1CP3A 1UKVY 2C1EA 1MAWA 5JD6A 2ZIVB 1G7RA 2FOIA 1SBNE 5L51A 2W2LA 5EP2A 3NTRA 3QVKA 2IWRA 4KXFB 4DDKA 5IWCA 4E31A 1EJ2A 1OUMA 2I66A 3ANLA 3EIQA 4OI4A 4UHEA 1JXQA 2ZIXB 3ECSA 2R1TB 4U7JA 1BH2A 3HA2A 3D3EA 3ON5A 4GWLA 2VPWA 3LQ1A 5B58C 3I9OA 1XQXA 5E3IA 1XWWA 3X2SA 5K3EA 1RRPA 1XJQA 3L46A 2YIVX 2MSLA 3N5KA 1ZFNA 4RXMA 5H9WA 2G71A 3SBOA 4UUBA 3KIPA 4UMVA 4NABA