1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
1ORIA 4DMGA 2YXLA 3KQYA 3OU6A 5LQRA 5BW5A 2HMYB 3TMAA 4BP3A 1V92A 4PINA 3R6TA 4H0NA 2AOUA 4DA4A 8MHTA 4QPNA 3MTEA 2OZVA 3B3FA 3LKZA 1KR5A 3PS9A 4YUVA 5F2NA 3HCCA 4DCGA 5CCXA 3MMPA 1DUSA 3HEMA 3OFJA 1GO5A 2ZCJA 4PIPA 2FYTA 5FA8A 3O31A 2IH2A 1Q02A 1I1NA 2Y1WA 5LQNA 4V0QA 3P2IA 2VS1A 1AV6A 1R8XA 1JG4A 2ERCA 3FTCA 1G41A 4BY9E 3GGDA 3NW9A 9MHTA 2B2CA 5EGSA 2OY0A 3DTNA 3SSOA 3BGIA 1KYIA 2ADMA 5GP1A 5MHTA 3U81A 2GH1A 5GIPE 5DM1A 2R6ZA 3GLFE 3FPFA 2K9DA 3MTIA 4OBXA 3ER8A 2BH2A 2ZWVA 2B78A 1HT1E 1VEKA 3GLGE 1NT2A 3T7TA 1ZQ9A 3UZUA 4MWZA 5KYGA 2CL5A 5EG5A 2MJ5B 3FUWA 4PYOA 1U2ZA 3DP7A 2IH4A 5DXJA 5DPMA 4E31A 1YB2A 5CCBA 2CWWA 2L4FA 5FQNA 1AQIA 4PYJA 3GLHE 1G55A 4GBED 1O9GA 1X1AA 1TW3A 5ICGA 4X60A 1WS6A 2P1DA 3EVDA 3P2KA 3C0KA 2QRVB 4P58A 3G5TA 2XYRA 1FP2A 2ZBPA 1M6YA 3M6XA 1XDSA 2F8LA 3I58A 3B5IA 2QRVA 1F4IA 2DPMA 3WSTA 2A14A 4FGZA 4G56A 4L7VA 1JG3A 5LQUA 4AZSA 4HH4A 5KQSA 5LQCA 2BM9A 2PKWA 3FRHA 1NV9A 5DXAA 2PT6A 2H11A 2C7PA 4E2WA 1YFJA 3LSTA 4X63A 4KWCA 2LVNC 3EGVA 2AN5A 1ORHA 3JWIA 1I9GA 3MHTA 4YMGA 1ZGJA 3AY0A 3V97A 2KW5A 3KQMA 3TPZA 5FQOA 2DHYA 1R18A 3A7DA 3R24A 3KU1A 1Q0SA 1XB2B 2ONYA 2Y1XA 4HG2A 4PCLA 1KPIA 3SR4A 3B7PA 1UWVA 2P35A 3M4XA 3GIWA 2P3LA 2C7RA 3SMQA 5EPEA 3M6VA 4E30A 1DO2A 2ZWAA 1VEJA 2BM8A 2CMHA 4ER7A 5K0JA 5DWQA 3P9NA 1IXKA 4X1OA 1VP9A 4RWZA 3CJTA 3SGLA 1D2CA 4P7GA 1R74A 3AWIA 3KHKA 1MHTA 2LBCA 2NP7A 3LL7A 1BOOA 3ER9A 1EIZA 4RTSA 3BKWA 3SM3A 3UJ7A 2UYCA 5DRYA 4OX9Y 4DCMA 3C3YA 2OPBA 5FULA 4KDCA 4POOA 3C3PA 4OA5A 4Q7JA 4YV0A 1FPQA 1NW3A 3KPWA 3HA7A 3E23A 2JJQA 2ZTHA 3ELYA 1P1BA 2I7CA 1FBNA 5GINE 2QHOB 1IFYA 3TFWA 4IKPA 3IEIA 1SG9A 3BKXA 5D1HA 3M6WA 5EMJA 5EC8A 3UBTA 1BKYA 1P39A 2HAKA 1MN3A 3KR2A 5LQJA 5C9ZA 2YQZA 2JUJA 1F3LA 2NNWB 3G2QA 5ICCA 3F4KA 2LVAA 1L3IA 4ER0A 4BLWA 5HIMA 4AX8A 2PXAA 5FWAA 1EJ0A 5EMKA 3IV6A 3G2PA 3BXOA 3VC2A 2FPOA 1P3QQ 5FWDA 3ELUA 2GS9A 1JQEA 1QANA 4U7PB 2UYQA 5E1OA 3DMHA 5E9WA 3HNRA 2QYOA 3KPVA 1DO0A 1R00A 3TM5A 2JY6B 3FUUA 3HVKA 1M6EX 1EAMA 2AOTB 10MHA 5JR3A 3KR1A 3MERA 2DAIA 5BW4A 4E32A 1XJ5A 4RYLA 3Q87B 5FA5A 4QVKA 3P97A 1IY9A 2MR9A 2PVCA 4PYKA 3SSNA 4C4AA 3HTXA 2AVNA 4YMHA 2ZIGA 1V39A 3GRZA 3FPJA 4YV2A 1DCTA 5GOZA 3HCDA 2V7EA 2Q41A 3T0IA 4QDKA 1EG2A 4XUCA 3DXYA 2G71A 1XTPA 1G6Q1 2HR1A 1QYRA 2R3SA 2AOXA 1EQAA 4PYLA 2PJDA 1OKSA 4R71A 5K0EA 3RW9A 3SX0A 1QAMA 5CIYA 2KHHA 3HVJA 3HA3A 2VDWA 2ZFUA 4IV8A 3GRYA 5K09A 5LSAA 3LKDA 4F85A 3GNLA 1UIRA 2MGWA 5HIIA 4DQ0A 2GPYA 3FPHA 1PGYA 4M7RA 2XYVA 5HIJA 1JR3E 2NXJA 2DAGA 5DTQA 4RTPA 5EMLA 1H1DA 5E9QA 4QDJA 2ZBRA 1L1EA 3UJCA 3DLCA 1YUBA 5CVDA 2VDVE 1IM8A 3UJDA 3HP7A 2PX4A 2PGXA 2I6GA 3O7WA 1UFZA 3EGEA 4PYNA 1YZHA 3FRIA 4RV9A 5DTMA 1G8SA 1EJ6A 1VEGA 5DSTA 4MTLA 1Z3CA 2AOUB 2PXXA 3TKAA 4IV0A 4MQ4A 3AJDA 3LBFA 4IWNA 4E2XA 2IBTA 3ME5A 1O54A 4KIFA 2PX8A 2ZSUA 3DMFA 5DT2A 2PWPA 2EJSA 2BR3A 3EVAA 2YVLA 1Q0TA 3HCAA 2UYHA 5HIKA 4P7JA 5C1IA 2ZZNA 5ERGB 1KYZA 5IKMA 4HGZA 2O0LA 3PVCA 3EMDA 4C07A 2K0BX 5DSXA 1G60A 1DV0A 5P8WA 2WA2A 2OOBA 3DXZA 1HQYE 3FZGA 3GWZA 3RODA 1ZMWA 4A6EA 2HV9A 1QZEA 1G3IA 3BBZA 3THRA 1JQDA 3MQ2A 1PRYA 2C7OA 4CKCA 2DAMA 3KQOA 5CVUA 4WVLA 1I4WA 2OYRA 5K0FA 1XDZA 2G1PA 5DLYA 4FSXA 4GF5A 2H5XA 1L3CA 3NVKI 3PTAA 2BR5A 1KIAA 1G38A 2P7IA 1VDLA 3NMUF 5FCDA 3B89A 3DH0A 3SVZA 4RTJA 1NW7A 4P7KA 1O9HA 3ORHA 2ZLBA 3TR6A 2VDUE 4DM3A 3KQTA 5DX1A 3P8ZA 4AZVA 3G88A 3MCTA 5D1NA 3MB5A 1BHJA 4FR0A 1VIDA 3E46A 1T6OA 2R0IA 4CTJA 3KR9A 4WXHA 1R8YA 2B9EA 4BLUA 2QE6A 3A7EA 4P7FA 4GOOD 3EMBA 4UOEA 3OZRA 5HFJA 1P91A 3LDGA 4CKBA 2GA9A 1M0EA 3SXJA 3VSEA 5BP7A 2P3OA 3K9PA 4XUDA 3FTEA 4FP9A 3K9OA 3VYWA 2BR4A 3DLIA 2O25A 2PX2A 3E05A 5FHQA 3KPUA 5E9JA 3PX3A 5EZQA 2O07A 5E2BA 1JG2A 3B3GA 3FTDA 2AOVA 3TRKA 3TQSA 5KS2A 2FK8A 3I53A 5EOVA 1WR1B 5E2AA 1CUKA 1JTFA 2PLWA 3OZSA 3OPNA 1ZG3A 2JH9A 1ZMVA 3HCEA 1F38A 3KQPA 4QVGA 1XDUA 3DUWA 4GOMD 2B25A 4WP2A 1NV8A 4NECA 5K0NA 4HRAA 3G8BA 2GB4A 4PONA 5HOQA 3EVCA 4OQDA 2JHAA 3PFGA 2EFJA 2FCAA 1JTEA 3H4JA 3CVOA 3KQVA 1ZGAA 1ZMUA 3G89A 2CWBA 2JP7A 2G70A 4HEOA 1Y8CA 4OQEA 4R8RA 4F1IA 4ER3A 3BZBA 2ZIEA 2QNJA 4M36A 5DM0A 3LGAA 2YXDA 3G5LA 1TPYA 4GEWA 5H02A 1TTEA 1B42A 2PBFA 4RTRA 7MHTA 4CWAA 3GJYA 5U4XA 3DMGA 3LCVB 3R3HA 4LECA 5GIOE 3RIEA 5DTRA 4K6MA 2LVPC 1WIVA 1XCLA 3LECA 3UA4A 4HTFA 3GDHA 2IP2A 2WK1A 3O4FA 1KP9A 2P40A 4M37A 2EJTA 1NKVA 3CKKA 3HA5A 3ANXA 4F84A 1WXXA 1YLAA 2JY5A 1KPGA 3E7PA 2DAEA 1KXZA 3OU2A 3A27A 4EVIA 4EKGA 1R6AA 1C7YA 2KNVA 2DI0A 2V74B 3EVEA 2G8NA 1NBIA 2P41A 4HSGA 2IPXA 1XVAA 5E8RA 3OZTA 1HJPA 2EKKA 2G3QA 2NXEA 3HCFA 2ESRA 5LQKA 4RTNA 1HMYA 5DM2A 2KNZA 3V8VA 3BGDA 3BT7A 2JY7A 1NW5A 4RTMA 3GO4A 3FYCA 5CM2Z 2H1RA 1X1DA 3GRUA 2JHCA 5IH3A 3A4TA 2PWYA 5EIFA 5B1SA 2AVDA 5C0OE 3CC8A 3KQSA 3MCZA 3E21A 5HEKA 3B3JA 1L3BA 2OBFA 2DZLA 4OBWA 4PWYA 5EEHA 4XCXA 2AR0A 2LVOC 1HT2E 1YF3A 3THSA 1P1CA 3CJRA 2AS0A 3H2BA 2NXCA 5GWXA 3NJRA 3M33A 1RI2A 3NWEA 1XXHE 4LG1A 4ER6A 4CKEA 5CVEA 5K01A 4O29A 4PGGA 2OO9A 2EX4A 3NWBA 2L2DA 3KKZA 4FSDA 4PNEA 2AN3A 2JZ0A 2ZIFA 1RI5A 2Z6UA 5E1BA 3VC1A 5KVAA 3HM2A 1MJFA 3EVZA 4RVFA 1OR8A 4R6XA 1G4AE 3REOA 4EQZA 4RTQA 4RVGA 5FHRA 5T6BA 2WA1A 2DKLA 3BWCA 2ZTCA 4RTLA 3HVHA 1N2XA 1BC5A 2RRUA 3IYLW 3EVGA 3G2OA 3KQQA 1KPHA 4C06A 5DM4A 5EEGA 4DZRA 2I62A 1X1BA 4HGYA 2YTZA 5G02A 3QV2A 2P7HA 4GUAA 3IHTA 4C05A 4GQBA 3ERCA 3UJ9A 1XXLA 2DAKA 4ISCA 2IFTA 2XVAA 3LCUA 1YZ3A 2N47A 1AIPC 3IECA 4Y30A 5LQAA 2FRXA 3M6UA 3TKYA 3PLAE 3FUXA 2ZW9A 5M5BA 1SUIA 1L9KA 2UYOA 3BGVA 4LWOA 4UN2B 2PT9A 2IIPA 4GC9A 1VG5A 3CCFA 3KR0A 5E1MA 2IGTA 2O05A 1VP3A 3P71T 2O06A 4Y2HA 3NTVA 4EKIA 1RJEA 3BWMA 3PFHA 3NDIA 3OU7A 2PSSA 5BXYA 4OA8A 2P3QA 5HZMA 3NVMB 1X19A 2AN4A 1TR8A 4RTOA 2IH5A 5K0LA 1JG1A 2H00A 5E8JA 2YX1A 4QQNA 4KDRA 2ZULA 3TM4A 4V0RA 4YUZA 3D2LA 3ID6C 3G7UA 4YUWA 2JZ1A 3X0DA 4ZTBA 3EVBA 2OKCA 2O57A 1YFLA 2XYQA 5K0GA 1WZNA 2E5WA 4X61A 2EKFA 4E70A 2BZGA 5EMMA 3I9FA 2HWKA 2JH8A 3ELWA 3LPMA 2ZTDA 5E1DA 1WY7A 1VE3A 2I9KA 4GC5A 2B3TA 5FUBA 2GAFA 3EGIA 5T67A 3OE5A 4GOLD 3LX6A 3NDJA 3AXSA 1IXSA 1X1CA 1WJ7A 2JHPA 4PYIA 3FE3A 2IDJA 5EIWA 2ZZKA 3QOWA 1SUSA 2PXCA 2ZVJA 4XUEA 1Y8GA 5K0BA 4C04A 3GLIE 2EJUA 2QSFX 1JQ3A 4B17A 5EKUA 3LDUA 2OO3A 4F86A 2OOAA 3PT9A 1INLA 1RJFA 1R4GA 3HVIA 1RJDA 1ZKDA 2CMGA 2PV0A 2IDKA 3Q7EA 1NW8A 4QPPA 3LCCA 3CBGA 3BWBA 5EKXA 3EVFA 3OFKA 1JR4A 3E8SA 1T43A 4YV1A 1ZV1A 3P2EA 1OAIA 1QAQA 1JSXA 1E94E 3C6KA 3FUVA 4C08A 2JNHA 1AF7A 5KQRA 2LD4A 2DENA 2LTUA 1HNNA 1PJZA 3QOXA 3C6MA 3JWGA 3F92A 1OQYA 5CUQA 4EK9A 4DKJA 3FPEA 3R9XB 2YR0A 5DX8A 1D2GA 3LBYA 3PB3A 4PYQA 3M70A 2MROB 3EEOA 2DNAA 2ZZMA 1N7IA 3UJBA 4DF3A 4FT4A 5EHIA 3DULA 4A6DA 1NBHA 5ICEA 2QM3A 4MHTA 2L4EA 3JWJA 1RJGA 1WHCA 3HCBA 4E2ZA 2PY6A 3EPPA 5EVJA 1EFUB 4FS8A 2KNAA 1VLMA 1KYWA 3JWHA 5DRTA 2BWEA 4HTFB 4LWPA 5EQJB 3SSMA 2Z6AA 1OTRA 5CVJA 4M38A 2NP6A 4PGHA 1NE2A 5F2KA 1ZHFA 5GM2A 3KQWA 3P9IA 1WG8A 2VP3A 1BVSA 4E2YA 5T64A 3K0BA 4R05A 3DXXA 3KPYA 2DULA 3GRVA 4ER5A 3I64A 2P8JA 5EHGA 4GEKA 4RVDA 4AUKA 5K03A 4AZTA 2Z6QA 1RI1A 1SVUA 5HILA 4R8SA 4G3OA 4E33A 5JI2E 2CP8A 4FZVA 3UJAA 2JY8A 4RSRA 3P9CA 3FPGA 1N7JA 4MIKA 4HC4A 3G2MA 5ICFA 1RI3A 3OE4A 3DR5A 1QAOA 1NW6A 5K8VA 1AQJA 2G72A 2VZ9A 4AZWA 2OXTA 3LDFA 2NXNA 1UFKA 3AXTA 3DOUA 3TLJA 2AOWA 3A25A 1RI4A 4C03A 2QY6A 1WGNA 3R0QA 3GXOA 2NYUA 3LHDA 2XVMA 3K6RA 4R6WA 2PX5A 3T7SA 1WXWA 5DFLA 1FP1D 3PX2A 2WZJA 1D2HA 3ELDA 1VL5A 3GRRA 4EMSA 4FT2A 3G8AA 2OB2A 3FUTA 5GM1A 3UJ8A 3UA3A 5EZSA 2UZ4A 3MGGA 4X41A 2YUIA 1WGLA 5DX0A 3TOSA 3FYDA 2HTEA 3UJ6A 4PIMA 4JXJA 3EEYA 5K05A 5LR6A 1VQ1A 5CVVA 4ATNA 1SQFA 3MAGA 1IM2A 5F2OA 4PCAA 2AOTA 4YUXA 1KHHA 5JUWA 4PYMA 5CD1A 4KIGA 4RVHA 4F2LA 2FK7A 4CTKA 5K0CA 1DL5A 4QTUB 3A26A 2CKDA 1VBFA 1XCJA 1TW2A 4KRGA 1QZZA 3CJQA 4CXMA 2XBMA 3L8DA 1A5TA 3CGGA 2ZBQA 4QQKA 1G8AA 2FHPA 4YUYA 2ONZA 4BLVA 2AZTA 3BUSA 4BP1A 2ORED 5FADA 2BWBA 4RX1A 1SQGA 2C7QA 2JG3A 3GU3A 1SKMA 5FTWA 4RTKA 4KVZA 4Z2YA 2IBSA 2YXEA 2OB1A 2K4MA 4KW7A 3I5UA 2EG5A 3IHPA 3P9KA 3KPJA 4QTTB 3BWYA 3GCZA 3UWPA 4GOND 3UFBA 3S68A 1VPTA 3T7RA 2GLUA 2LVQD 3OCJA 2HWJA 3T6PA 3FTFA 2HNKA 4U7TB 1FJXA 4DBGB 1JSZA
chains in the Genus database with same CATH superfamily
3BXXA 4UAGA 2ZAYA 4N3BA 1LDEA 4QHSA 2MHCA 2PU5A 5HCNA 4IBBA 4N6GA 4JLJA 4R98A 4H7KA 4Y2JA 2H2GA 4QT0A 3KXKA 5CW2A 1OHHA 3IUSA 4RESA 3L7NA 4ND4A 4CR6A 1HG1A 7GPBA 2BUBA 3Q0TA 1KR5A 3OM0A 4IGAA 1NI3A 3RASA 3RS5A 1V9SA 3OFJA 1EWVA 1UXOA 3S28A 5KNDD 2P2YA 3H4MA 5J4LA 1D6NA 1I0LA 1N8TA 4S24A 2PYIA 3OQBA 4AB1A 4QBIA 2JCGA 3DHNA 3K7EA 3C4JA 2OY0A 3OQPA 1N9ZA 4PHFA 4RKWA 2R1VA 1QTRA 3ECSA 2GBGA 3W2HA 4JXXA 4DY4A 3SQMA 3IULA 2OCLA 3IE2A 1L7VC 1WCXA 4W9MC 1NVMB 1XKXA 3R5HA 1ZH6A 2H17A 4PRZA 1U2RA 1K3TA 4Q12A 1X94A 2Q50A 4DXAA 1VG9B 2J5RA 3ADOA 5DPMA 2QM0A 3BBLA 2GXUA 4YJ3B 5CCBA 5F3WA 2ONJA 1FB5A 3HB1A 2CV2A 4CQMD 1N6RA 2B20A 3DHWC 4GVLA 3KQUA 4RSMA 4ZAGA 1UKVY 5DDIP 1SOWA 1H69A 2QRVB 4MDEA 3SYTA 1EFAA 2WHQA 3AO0B 2GN0A 2DWUA 2PX0A 5FTMA 2ZAOA 3L6DA 4KHZA 1CB0A 1IJKA 3HNOA 3SLKA 5L3SB 4XM0A 3GUHA 4EPWA 2JLUA 3DDWA 2O1EA 1ZGHA 3NZEA 2PKWA 3FRHA 4TYQA 2OYSA 3OE7D 3WY9A 3EH2A 5JARA 3UKOA 5A05A 1DDIA 2BP7B 2IODA 4DLPA 2NNLD 1NNEA 1PJAA 2GK7A 3CF6E 1C7JA 2AN5A 3H11A 1TD1A 3P2JA 5EIHA 1ZGJA 2A9JA 2P4UA 5LJLA 1USWA 2WG1A 3A1UA 3FTNA 3LLCA 3PGLA 3EC7A 4BNFA 1FYWA 1R18A 1SCUB 2H4WA 3R24A 3KVYA 3D81A 2ONYA 3DEFA 3ZNNA 5CEEA 3PEEA 2AZ4A 5AYVA 2OXCA 3JR3A 1XQ6A 2OZLB 3M9LA 5K8CA 3UG7A 4DBLC 2QRMA 4ZRMA 5CX1A 1DHRA 1SCAA 3AF0A 3RC2A 4I4TF 4YRQA 2PWBA 3GFSA 4XDHA 1SXPA 3RYIB 2ID8A 3ETNA 3IPRA 3ZDBA 2PGLA 3KAQA 3NBXX 5BR4A 1OFUA 3EWAA 1YR3A 3SX4A 4HXEB 4EBFA 5JECA 4XM2A 3R5TA 4U2DA 4Q4LA 4IIJA 1P3Y1 1Z36A 4UHHA 4KR9A 2HYIC 3A42A 4XIIA 3ROMA 3U09A 4WXRA 4YC7A 2M32A 3SCZA 5A4KA 4ZV4A 3V7UA 4TTRA 5TLSA 1DUVG 3KUXA 5DLQC 4WGFA 2DG2A 3W1EA 2VH5R 1PR5A 3L6RA 2BAGA 2Q2WA 4OL9A 5BUSA 3GPBA 1NNLA 1GL9B 1A71A 2JJYA 2AF3C 2ZUUA 5FAKA 2XBLA 4C7VA 1HE2A 5KU1A 2ZB4A 3B7WA 1FOEB 5HJ7A 3DDCA 4JLUA 3TQCA 3CWQA 1E2HA 3MWDA 3L8EA 1AUVA 4DLAA 1S7GA 4NIMA 3DMHA 4EEKA 3WMWA 3JQGB 2L19A 2PEYA 4OQYA 3W6ZA 3RUIA 4KHPB 2QQ5A 5T8KA 3UH1A 3SIPA 2A5LA 1I2BA 10MHA 4QREA 1OZFA 5DGIA 4AO6A 4R69A 3R0JA 1XJ5A 3AGPA 2Q1WA 2QJRA 1JDSA 1GFWA 2HPAA 2VPTA 2O2YA 5AP9A 3AVVA 2AVNA 2ZIGA 4Q6WA 1AN9A 4X7BA 4X7RA 3ZWKA 1RBYA 2V7EA 6PFKA 3KETA 4NBUA 2NO4A 3SLRA 2DUWA 1GVNB 5ENDA 3C8ZA 1OASA 1PG5A 2R6DA 4NFYA 3ZJUA 2JFWA 3QSGA 4NAUA 2G71A 4C0SA 1TJ4A 4JQYA 1AXEA 3CIFA 4ZCMA 4PYLA 1ZOPA 3TL3A 1DAFA 4HYTA 2Y0DA 3D02A 4GKJM 1TM4E 3AR4A 4DILA 3KJZA 4LF6M 3Q7PA 2BFEA 2RONA 1ZNWA 4FYYA 5BWBA 3BD9A 4BMDA 2VYFA 5JAMA 1YZTA 1QK3A 3R40A 1TTTA 1KI1A 4ZOLF 1Y8AA 3DLCA 1HLFA 3PQ7A 2ZJ1A 4UQPA 1JG6A 2P5SA 3Q0IA 5IC5A 3I6IA 4FCVA 2PKQP 4OIMA 2WSLA 5GPBA 3ZGVA 1XEXA 2FG5A 2HLDA 3ACBA 4GWLA 2FKAA 1EJ2A 3C8MA 4C6RA 2O8NA 1BN7A 1YDGA 5KJ1A 4UZEA 4MRPA 3E84A 2F17A 4NXMB 2LR0A 3G2HA 4RJJA 3L0ZA 4DLZA 3U7QA 1ZGZA 1SC6A 1Z7YA 4E2XA 3ZC7B 1FUEA 2AMFA 1JH9A 3TOVA 4M0KA 3DMFA 4BJ6A 1QHFA 5C1IA 2PSEA 4QDZA 1N1EA 1NUAA 3PVCA 3HB0A 1IY1A 1GG8A 4WADA 3FZYA 3HDJA 1FQWA 2N3ZA 4MVJG 1WW3A 1D4OA 5FFMA 2WA2A 3PF9A 1HQYE 4P2GA 1QZMA 5KOHB 4KR6A 4BV8A 1G3IA 3GQBA 4JR1A 4ZCLA 1X8XA 4LIPD 3OY2A 5BV8A 4ZVVA 3CRZA 4WVLA 4WZBA 2OYRA 4QJ3A 2OGSA 4RADA 1L3CA 2X9VA 3I9V1 3GPIA 3DDNA 4LHWA 3JALB 5ESXA 2BH9A 2HMAA 1T1JA 2VSNA 3R9IA 4OM7A 2RGCA 2GZSA 3PJGA 5LLDA 4RJ2A 4J91A 4GLOA 2G36A 3ANYB 4O02B 2O8BA 4P0QB 2YN0A 1CJCA 1XNRM 3T1HM 2ZLBA 1A69A 2P79A 1NVFA 4ZYWA 4FFLA 2LDXA 2EG9A 4TMVA 4LDZA 3ZWDA 3PPVA 2I4MA 5JATA 5EE9A 5IAGA 1RWMA 1ECCA 2D7DA 2B9EA 2AXEA 2GHIA 1P6QA 1MLDA 3CPHA 3I6YA 2GJ8A 4KO3S 4HJRA 1K2VN 5AW0A 3I0MA 3ZNQA 3UGKA 1OLUB 2WHRA 3SK0A 2MTBA 1ABBA 4IRUB 3RI3A 3O03A 5AWFC 4OHOA 1N3IA 2O07A 2HX1A 2OLKA 4G23A 1T4CB 3KYDB 4OMFG 4RD1A 2R97A 5K3AA 5TS2A 4IWYA 2QL6A 3EPJA 2FQQA 1TOAA 1JPJA 4WLEA 4MINA 3BMQB 1WXHA 3TPFA 1F38A 3IG8A 3KHTA 1VOTA 1XDUA 3I2HA 1U9ZA 2X76A 1AGRA 3HSSA 1J5XA 4HRAA 3ZVRA 3R77A 4RDHA 1ZQ1A 1P77A 1U7UA 1W4ZA 4YT4A 1ZGAA 1HTWA 3BK7A 4V0MA 1I24A 1V96A 2ZR7A 2QUJA 3ZNPA 3VVLA 3TIIA 1SXJA 3DL4A 1U3UA 4YI5A 1DKQA 2OV1A 3X1JA 2C99A 3GUVA 5FIUA 1WCV1 4BVJA 1V71A 1KI9A 5B4TA 2WI8A 2P27A 4CDGA 2DFKB 5DE3A 3KWJA 4BTVA 3C7TA 4L6AA 1QHEA 4M89A 2WTXA 3HXTA 2WK1A 3O8QA 3GWGA 1YQUA 2PGIA 2I80A 5AT1A 1X3LA 3K32A 4ZV7A 4ERNA 4OJYA 3CGWA 4PZ9A 4ND3A 3U6EA 2HSDA 5B7PA 1KGDA 4IBOA 2QTTA 2UDPA 1DTWA 3C16C 3R5JA 5D3ZA 1SKBA 3ZW8A 2WZDA 3UMCA 2C2OA 2WNIA 5JNWA 4JI7M 4K46A 1R6AA 2P6UA 2W2VA 2LHCA 4MROA 4YRRA 1NHWA 4X1KA 4DUYM 5AW1A 1V41E 1NFFA 2OHOA 2YWCA 4EBBA 3G82C 4EHDA 2BC9A 1MBZA 4ZVPA 3VO2A 4QJBA 2CYAA 3LA8A 3SC2A 4JENA 3A04A 4MV7A 5DM2A 1FSSA 4B0PA 4C78A 1O5IA 3T5AA 5DHRA 5EE5B 1T2UA 2GAIA 1SWVA 5EUMA 2CNWD 1BE1A 4YQFA 2VPYA 3AHHA 4KYIB 1DXHA 3NRJA 5HJ5A 1XQWA 1IHUA 3WRYC 3A4TA 3OTOM 1J70A 3KAKA 3ABSB 5EIFA 1H2FA 1I6WA 1B3RA 3CN7A 5C8DA 5F52A 3JVDA 1HQCA 5DI9A 2XUKA 3DXFA 1L5FA 8CATA 1FY2A 4C7XA 3O92A 1GU0A 4I5SA 1ZK2A 1XO1A 4KXLA 1PR3A 1K75A 3KKOA 1XXHE 3D8NA 2FZWA 4XJXA 4P16A 1AGNA 4MP3A 5FTKA 4DQDA 2WQZA 4KL8S 4X65M 5T6MA 2G9QA 3WYDA 4M9CA 3BH6A 3G3EA 4QXMA 3LPCA 4G5SA 2G76A 3KJEA 3I92A 2DUMA 3WK8A 2M6RA 2MU1A 2XVYA 2M98A 1UP7A 2V8BA 4XZ3A 4L4UA 3QRWA 1ZK0A 4ENUA 1C7QA 3NPMA 2R68A 4HAXA 5C37A 3UK7A 3ADBA 3AF5A 1PKXA 3QMVA 3IP1A 4DV5B 4NRVA 4IR7A 1KYQA 3UMFA 2ORIA 1Z5GA 2VNHA 1NXOA 3AX6A 2XDQB 4ZK6A 3SNHA 5LMZA 5LQDA 2O0HA 4CN9A 2ZI9A 1W2GA 3E81A 6NULA 1O89A 3USES 2RSLA 4NP6A 3VNQA 3OZXA 4F4DA 1YJCA 2CXSA 1S8FA 3X1YA 4GZ3A 2W2KA 1WE2A 5I8PA 1M8KA 3NASA 5KNBD 5FWXB 3DE2X 4XASA 4QYTA 2GCPA 2BSQA 1GYQA 4BWVA 4WKOA 1WBDA 1RLTA 4WDQA 3MAAC 3MJSA 2VJPA 4RLQA 3O1HB 2UYOA 2OO5A 3ZXYA 4BO3A 4PBSA 4UN2B 1LNQA 4M9UA 2QZPA 1JR3D 1B6TA 3AFIA 3I9KA 3R76A 3ZLVA 1B3BA 1JT9A 3JQAA 2HA4A 3S2IA 4KH1A 4D98A 2P3QA 2CCKA 2AN4A 3GZ4A 1GQQA 2R6R1 5JDIC 3K1AA 3B9PA 5DH9A 4U7DA 4YJKA 2IU4A 3K70C 2VDJA 4I4IA 2OP0A 1NG9A 3CRVA 4BUCA 4H4DA 4PDIA 3B8EA 1QP8A 4ILEA 1L7OA 1IE3A 1JA1A 5HTKA 1JJIA 2VLBA 4MUXA 4YCAA 1SZDA 3T3GA 4JX8A 1TM5E 3I9OA 3ZI0A 5E1DA 4BFYA 1LDNA 4GE0A 1QF6A 5KNCH 1VE3A 1R0BA 4IGEA 4FS3A 1KEVA 2NZUG 1SU6A 2ZSAA 1FTWA 5BW8A 2SCUA 1VGVA 5BQ3A 3UJPA 2HWXA 4QU5A 2HYDA 1QQAA 4MUNA 1RKVA 1Y1RA 3S2YA 1JE1A 2HCFA 4XYMA 2V4UA 3B1WA 3ROKA 2WQ7A 1ENOA 3W8DA 1RPTA 2OXIA 4RU1A 4D02A 3RBZA 4AJNA 3SYRA 5HJEA 1QRSA 4R2MA 2B8WA 1JR4A 2ADOA 2IHNA 1DXYA 2PO5A 3KOYA 2O1WA 3MJFA 4JUCA 2RGXA 3HJFA 3AQIA 2PZFA 2WMOB 4E4RA 2OZEA 1F0YA 4JI1B 3MIIA 4TMYA 1L1QA 3FPLA 4JT9A 5LD2B 1IBLB 1HNNA 4PN7A 4Y18A 4L16A 1GNSA 2VXBA 3QXJA 2V54A 4EK9A 1XWIA 3R9XB 3F6BX 1GEGA 1I3NA 2O2JA 5I7HA 4XTRA 2J0QA 3HRHA 3PB3A 1R6XA 2DNAA 4Q1VA 4AJOA 2VT7A 5E0KB 1HSZA 4KOEC 4RV4A 2JJ2D 5ICEA 3EAFA 3AEZA 5IT4A 1SXQA 1OIZA 1JKFA 2ZRLA 5KHOC 3IXMA 4YR7A 1J0BA 4PLTA 4OCZA 1GZ3A 3HDQA 3RABA 2QL5A 5CLLA 3D5EA 3BB1A 1DQPA 4I9GA 5EQJB 4ZYLA 5AUOB 3JQBC 1RCTE 4M38A 3FDXA 4WZZA 1MJHA 3FCEA 4DGQA 4GLJA 4ZJYA 3VOAA 2W2LA 1BVSA 1A5ZA 3AV0B 1U0EA 3UF0A 2MYPA 5ITSA 3KVRA 3K9NA 1KQNA 1DQRA 4TRJA 4PAQA 5BQPA 1UBUS 3MOGA 2GZDA 1Y89A 4U8HA 1BIFA 1Y63A 4FZVA 1N2CB 3I5AA 3K0SA 3HEBA 4RE6A 1E3QA 2OG1A 4HC4A 3NVDA 4LXIA 2AFHB 3LO5A 1MV5A 3ETDA 2VHYA 5KYNA 2ZRJA 3HN2A 3AKYA 2DWPA 4JIGA 2CYCA 3WJAA 1EWYA 2HAEA 3JWPA 4KPFC 2QV0A 4HLQB 3F1KA 3V1YA 4Z6YA 1DE0A 3MT0A 4NBTA 4C9BA 1T4GA 4BYMA 4I4NA 2IIVA 5CM9C 4CKYA 1W0CA 3JATB 2VWGA 3G5UA 1SG0A 4MV1A 3UGTA 5FOTA 3OMLA 5K3CA 2JWSA 5ALNA 5D5HA 3WC4A 1Z45A 2C5FA 2YV2A 3PUKA 3GRRA 3WLJA 1JW9B 2OB2A 4BU1A 4P3OA 1VG1A 2L18A 1P9WA 4PIMA 4V03A 4ZQGA 4LDJA 1IM2A 3TZEA 1UKBA 2AI3A 4PYMA 4HQ0A 3QKWA 5KC9A 4GI7A 3OJEA 2VSYA 2X9GA 1N5DA 1QHXA 5JVDF 4BNWA 4QTUB 5K2OA 1OKKD 2DHRA 3B13B 3STXA 4MUIA 1ZVQA 1RFLA 3NKFA 1JAHA 4DLTA 4EB3A 1GKIA 2PZAA 2V6MA 4BLPA 3GVHA 2HMVA 1A5TA 4NYIQ 1T2EA 1UDCA 3GJ3A 1TKCA 1RM3A 4OHXA 1WHSA 4OOFA 4ALJA 1LB1B 5JCXA 1UZAA 1JWLA 4K86A 1LD3A 1RZ3A 2DJ5A 3BWVA 4JSYA 5C5IA 2C7QA 2CLSA 2R4QA 1T9BA 3DZJA 5KYYA 4KVZA 4IQ8A 1S1CA 1W19A 2YXEA 3U60B 5DNWA 3NBKA 4FQ8A 2VJDA 2C07A 2E9SA 4MZXA 1GU1A 1ZD1A 3QNUA 1GPYA 5J2UA 1VPTA 2WHYA 4Y2TA 3GW8A 4KO4S 2FFAA 5AKYA 5EE0A 3VSBA 4KBGA 1V4BA 3RYHA 1KY4A 3OLWA 2OBNA 2CCJA 4GHLA 1ISRA 4E2FA 1Z2NX 5JH7B 1SHKA 2RKOA 4OKNA 3M4NA 4IH9A 2HMYB 4IHJB 4LDRA 1SBTA 4WINA 4HN9A 4MW0A 1KO8A 1HE4A 4P54A 1JMKC 1QC5A 2BW0A 2QMOA 3EDMA 3BDVA 2CHVA 1HKHA 3STTA 5CCXA 3AK4A 4FDAA 3CVVA 1CG6A 2PUBA 1AQ6A 3GGOA 4GQAA 3B1KA 3LRTA 4PF1A 1WUIS 3WLLA 2VS1A 1OB5A 4IUDS 1ZL2A 1PSZA 2G09A 4ZVSA 5KSWB 1JWAB 4HLUA 1R8XA 1V47A 3C3DA 1V6AA 3ZY4A 3QU2A 1U9IA 5KX5B 5A4MS 6Q21A 1CUFA 3BGIA 3ZEAA 4WK6A 1DBWA 3O2NA 2XH9A 2GH1A 3UPDA 1QIHA 3CUUA 4HI0E 2TECE 4H2DA 1BS2A 3ICOA 1YAHA 1O94A 2ZWVA 4KUEA 1OI4A 5EHZA 1VJCA 4CM7A 3VI3B 4CU2A 4BDSA 1ELOA 2JFPA 4HQOA 1LBQA 4TYYA 2HHHM 2PBRA 4DLKA 3KTOA 2FR8A 1ESCA 4EPRA 4JKYA 3RVMA 4PYJA 4Q3AA 2CB9A 4IG9A 1NSTA 2JH3A 3RFVA 3KOOA 1WWKA 5AJYA 4O4HA 2LRHA 4JI5M 1LTKA 3BK1A 4DL9A 3PR3A 3FNIA 2DPMA 2WU4A 3B7ZA 4BS9A 2HXSA 2I03A 2IYUA 1GZUA 1MRZA 2R8BA 1HT0A 5LQCA 3CISA 1PG2A 2EZUA 1XRRA 3PDUA 3CH5A 3S6JA 1E9CA 3SNKA 4OFZA 5CVTA 3LSTA 3E5MA 3IJRA 3N2NA 3PYXA 1T25A 5KWJA 1R4MB 1F20A 2FN7A 1R66A 1W85B 2QSZA 2F1RA 1HC7A 2BDUA 3Q6MA 5FBWB 1J33A 3RARA 3LU1A 2YOHA 4EP1A 1O97D 2ANBA 2X15A 3SR4A 3B7PA 1Z8DA 4Z7NB 2O3RA 3X3HA 2W6PA 5J58A 1I01A 1IG0A 1QP0A 2UXDM 2ZG6A 3BPSA 1XELA 2Q8NA 2GXAA 1I2DA 1ZK4A 2AYZA 4JLMA 4KMSA 3GPYA 1BQEA 1YZVA 2V6JA 4B71A 1GUBA 3HKCA 4WCFB 1BJRE 3DC7A 4UBOA 1DJPA 5CNIA 2LBCA 3LSYA 3QUTA 4GIBA 4JB3A 3K8QA 3BKWA 5EZ5A 4KWIA 4B4UA 1LY1A 3O3OB 3CVWA 1AKUA 5IX8A 4D8XA 4ZDKA 3NUQA 4H15A 4PNPA 3W90A 1ZUNA 4AZ3A 3ZDRA 3E23A 6ADHA 3BD7A 3FA2A 3X1WA 4UATA 2HRQA 4OQLA 3O1JC 1OBVA 5EJEA 3HDVA 2O01F 3M6WA 2IV3A 4W5HA 5DASA 1RWNA 1TRHA 4TX1A 3A4LA 2NNWB 5ISMA 5GOTA 3T3OA 3G2QA 4UU1A 4ND7A 2IX3A 1TC1A 4BLWA 2UXCB 4OQPA 1IMJA 1IOZA 1P2FA 3TI9A 4E13A 1E62A 4NC6A 2W43A 1M1UA 3K09C 4YT8A 2BYTA 4J76A 1NJSA 1NMZA 4B46A 4DCVA 2C9BA 3PD7A 1L5WA 1W36D 2O7VA 3BJIC 2ZJ7A 3IIMA 1DT3A 1KVRA 3NTUA 1FP6A 3G0HA 4AJPA 3MERA 1Y9JA 4DDUA 1YL7A 4KQ2A 3N0XA 4LMRA 4EQ6A 3E8XA 2FGKA 2C5LA 1LDMA 2YJ5A 3UAZA 1QUEA 5K8LA 3UMYA 3GRZA 1PTKA 1T4DA 2V3VA 3BBPA 3UTCA 4Y6RA 4AZFA 1PS8A 4TSFA 3LOUA 5BSFA 2NU6A 1QYRA 3VPXA 4HEJA 3EBOA 4IDEA 3SX0A 1BS1A 2KHHA 2F1OA 5FFNA 3U49A 1AKEA 4YRAA 1NMEA 3RTBA 3EPLA 1IBCA 5K09A 1OVGA 2EDAA 1H2RS 3DQQA 3DFKA 4LVNA 3QI7A 3G49A 5CXQA 2PX3A 5CHYA 3LS2A 3LT2A 5JY6A 1H1DA 5TY0A 4DMKA 1AQLA 3S44A 1NZDA 1SVIA 4ZMBA 4HO1X 5TEVA 2AFIA 4Y9SA 2BD0A 1IY0A 4QDUA 4B3TM 2C5RA 1P61B 4LF5B 1OQAA 1U2DC 2AI1A 1IWOA 3VDXA 3VDPA 4HX2A 1ZIXA 1GZVA 4WXYB 1QVAA 5EERA 2YZGA 4DCOA 3JQ8B 4G9EA 4B3IA 3R3VA 4A8PA 4CM9D 4V3CA 1XJCA 3ICVA 4GMQA 2EJSA 4U7FA 4H18A 1E7YA 4IHQA 4Q3OA 2V55B 3H0CA 4YACA 4EZIA 4CL0A 2UU9B 5B4UA 4D41A 1FJ2A 3MW8A 3ZVLA 4Q7LA 2X0RA 1HNWB 4F71A 1NRWA 2BDTA 4RHCA 1E6EA 1U8EA 4YVFA 1TM7E 3CZ5A 1JKXA 1WVMA 2PKYX 1QPZA 4UTOA 3U61A 1OXXK 1MXFA 3C70A 2DEUA 2XCRB 3JQ7A 4LTDA 2CVOA 3KLMX 1LK7A 3DSRA 4FSXA 2IHVA 4MA4A 3NR2A 4DJFC 2LNHC 3UJNA 3FCSB 2PH3A 5C8YF 1G38A 1C3EA 3H2SA 2P0YA 1YQWA 3DH0A 4HXFB 1MJNA 2WWWA 4BNIA 4XB6B 4G8DA 4ZZ0A 2IV7A 1B6SA 5AJVB 4GSYA 2YIVX 3Q9LA 2X2PA 4CKBB 4ZODA 3KR9A 1QG0A 2ZIZA 3FHOA 1EA5A 1UOOA 4B73A 1JXMA 5HMLA 5CH8A 4B3SM 1A7JA 1M0EA 4OXRA 3GD5A 2K5UA 4RA9B 2ZSJA 1LPMA 2C9YA 3FTEA 3ZE9A 5EQTA 3VYWA 3DFIA 4XPIB 6YASA 5IASA 4MV3A 3BCHA 2Z9CA 2AJBA 4BNDB 3Q8XB 5KS2A 3VJRA 2AT1A 1QRAA 4O33A 2WFAA 3ZV6A 3HGTA 3LPDA 1CZOA 5E2AA 2IE0A 1Q1GA 1NVWQ 2ZI4A 3W77A 1GWNA 1R6UA 4BL5A 5B3AA 2KMLA 2YQ4A 1IUPA 5ALPA 3G7NA 3THOA 5JG7A 3T7AA 3Q40A 4DLWA 4WA8A 4HYEA 1ILEA 1Y8CA 4EF5A 3VYUB 1AKMA 3NLLA 4ER3A 2VAMA 3C1UA 4MX8A 2QU8A 3WLTA 3N2IA 2ZTSA 5I6DA 3BFVA 3AEQA 4GEWA 1FSFA 4MVJA 1C50A 3HJTA 4JBHA 4JLVA 2YNMC 1E5VA 2PBFA 4KP7A 1UM9A 4U1RA 2QPLA 3D4IA 2P1ZA 5FUMA 3TRHA 3A6JA 4QVIA 1T8TA 2JBWA 3II6X 4GIPA 3FYTA 4F91B 4ZU3A 2EP8A 5KDLA 1NKTA 3LQRA 2AFHE 4X20B 5E3HA 4KIJA 4FI3F 1CK4A 1KRWA 1QFXA 1MNQA 3UMGA 3STVA 3CUVA 3RREA 2J46A 1O95D 1G66A 2C7GA 1PYGA 2DFTA 3OZUA 5EIEA 3S5JA 5HRUA 1YCFA 5F4BA 3HKDA 5A0TA 1U0GA 3F8WA 1YBVA 4ROSA 3LUAA 4EG8A 2QOEA 2Q3LA 2J7NA 1CRLA 2HSWA 3EVEA 4KO2S 2NSHA 2P41A 3ZY5A 2WQ6A 3IDFA 4TKUB 2J6CA 3DJYA 1B8PA 2A6PA 5JSZA 2GYWA 4JC0A 3WGIA 2DECA 3WNQA 3GNSA 1SOAA 4K0KB 4KREA 2WOJA 2H08A 1KK0A 4J49A 2JANA 2FMIA 5DM70 1VMKA 2F3UA 3TQIA 3RC3A 4QUKA 5EIBD 2XA2A 2D59A 3MHVC 1P18A 1QH0A 5B1SA 3A3OA 4DBZA 4KWEA 1Y9ZA 4NCXA 1GNPA 1KP3A 5LIPA 2LIVA 4WZAB 5FORA 3OPVA 3U4HA 4IH1A 2AS0A 1AUAA 4S2EA 4TLMB 2FSFA 4RE5A 1EHCA 4XOIA 3UT6A 4Z8XA 1P8JA 3NIFB 1YNOA 1UBSB 3OEHA 4KFRA 1CJTC 2JCYA 1Y4AE 3MXOA 2HDNB 2PDAA 3VHLB 4OQFA 4Q4JA 1E6CA 2XQFA 1FFWA 3NWBA 1RIIA 3IMKA 3HFRA 3KKZA 3MF4A 5B7GA 4EUNA 3QVMA 3LT4A 2JIZA 4AJ9A 2RE8A 3OIFA 3BHJA 1IUNA 2WAMA 1QVWA 3IVRA 3E8MA 5FL7D 1WM1A 4R2HA 4YPOA 4KMRA 1I0IA 5DEIA 4RTQA 2H7VA 4OHKA 2F5OA 2X58A 3Q9UA 3TRFA 1GAJA 3E7WA 4MGEA 4RVGA 1F9AA 5T6BA 1BVUA 4FW9A 2YW9A 3DB1A 2DKLA 2G7MC 4QEDA 1N6NA 3QU9A 4GPIB 1ZH0A 2IEZA 2AHOA 1U7HA 3E18A 4R31A 4C06A 4OI1A 3NBYC 2HCRA 2VSXA 2QZ4A 5JPCA 3I12A 2P7HA 5B55A 1ZISA 4MV0A 4DMMA 4GQBA 3UJ9A 1KVTA 3B1ZA 2BFCB 4LA4A 1XXLA 3M4JA 2RAUA 5LB4A 1E0KA 1LLDA 1Z5CA 2V9CA 3MS4A 4XXHA 3KSXA 1X70A 1P2DA 1SXIA 1GNVA 1R8JA 1OBOA 4WURA 1QMPA 1L9KA 1TECE 5EIAA 4MV4A 4C4PA 2KS6A 4D3DA 4BKPA 3FKQA 3NTLA 2V3WA 3L8ZA 4GDFA 2IGTA 3WGHA 1UFVA 5KKCA 3NTVA 2DRIA 4RJIA 2HMUA 4BLCA 5BXYA 4HUQB 4HD8A 3HKBA 3I9LA 4IIGA 2NVBA 3G79A 2VT3A 4MAFA 2OHXA 1L7NA 2M1ZA 4M99A 2E89A 2OCDA 2QJTA 3O4JA 4MUFA 1O87A 3GPPA 1JAXA 4AF6A 1G9SA 4B6SA 3S70A 2ADFA 4ZTBA 4IQ4A 3D8LA 2DB3A 1Q0HA 2C2ZA 3V5NA 4TN1A 3FI9A 3EXG2 4R81A 1WD5A 4JYZA 4GPTA 1WJ7A 3PFCA 3LUHA 1G18A 2CV0A 4Y7CA 2JARA 3KV1A 3QLVC 2ZZKA 1PFQA 4LSWA 1U0NA 3KXLA 1DOHA 5IAAA 3QKIA 5LP6C 4CMJA 1RQXA 1H6DA 2HU2A 2HDWA 1Z0UA 5KYVA 3H5OA 3GHHA 3LRPA 5JCZA 3ZCRA 2VHUA 1P4JA 5BSWA 3F73A 3NYWA 1FL9A 3MWEA 3DDZX 1ZRNA 3A3KA 1KJJA 3UQZA 3UVEA 3QQPA 3IDAA 1ZW1A 5EJ4A 3DKVA 4FR2A 3FF4A 2Q5QA 5ALYA 4RGQA 5ALUA 1RHRA 1W34A 3SMVA 3GD7A 1A97A 2VPWA 1FDSA 1MAVA 3HY3A 1Z06A 4HPJB 5DK6A 4W5WA 3ONNA 4ITQA 5B2ZA 2HO5A 3AETA 1AMNA 3DOHA 3JWGA 4QG3A 2YR0A 4EHBA 5E3JA 2DH5A 1OYVA 1WB5A 3B6JA 3GB9A 4M1QA 1PL0A 3NAMA 1N7IA 3EOAI 4XB2A 1XK6A 5DI3A 3DZGA 4A6DA 4GEGA 2F62A 4ZEMA 4P92A 2W37A 1VMAA 3KQHA 2IX9A 4CI9A 4RA6A 3UV7A 3JVEA 3CWCA 3V33A 5KTYA 4DHEA 1BSVA 5DLEA 1YSYA 4HTFB 3SZOA 5DEOA 4HXGA 1SQ0A 1EFUA 3H9BA 3EUWA 3NC4A 1ODFA 4JJ4A 5FEUA 2FJ0A 3Q8KA 5HZGA 3ZCXA 4R05A 3WYBA 4U7HA 4DR7M 4K9NA 2IPAB 3VNUA 4P84A 2QX7A 3PZBA 5FRDA 3L5OA 4MQ5A 1JHUA 1MC5A 3GLVA 2Y71A 4CMHA 2XWBF 3CLSC 4DR5B 3U31A 4HTAA 4F1WA 1XF1A 1RI3A 1HFKA 3ZUGA 1SZPA 4EHHA 3P4YA 1P5HA 2YDXA 2H4XA 1XTTA 2HKIA 3AXTA 3OZAA 4Y2SA 3WKCA 1LV7A 3DM5A 3DVAA 3TX6A 2FPIB 5L40A 4BWGA 5BN4B 2J3QA 3LI2A 3R0QA 1C9JA 3IMCA 3MD0A 1YC2A 3T7DA 2QM8A 5JZ9A 1B0AA 1EFPB 4V0LA 5GMOA 5H81A 3ILSA 1UR5A 3DTVD 5ARDA 2VK1A 2DLDA 1Y6FA 5DB4A 1VE5A 4Q9AA 4M0WA 1QPBA 5EZSA 3QQ5A 2OR3A 2XCLA 4UREA 1Z5ZA 1E9RA 5L3ZA 1HNZM 3DDUA 5AKKA 5FKJA 3LP8A 2C03A 1MZVA 3S8YA 2V3CC 1MABA 2XKBA 3N59A 4LZWA 1EFVA 4YYZA 1J5PA 3DPUA 1XCGB 4EHIA 1I36A 3NQ41 3GZJA 3TBKA 1Y98A 1C0IA 2BE7A 1H22A 2XOKD 5IUNC 2X2FA 1Y9DA 5DW0A 5LBUA 4FX5A 4IDHA 3HYNA 3PDWA 4N5HX 4NMHA 1V2HE 1TVKA 1MX3A 4F1KA 3FHJA 4DARA 5I7RA 2QE7A 4UNRA 4OAQA 3ONDA 2D54A 3K9GA 4YUYA 4BLVA 5DN6D 3BUSA 3RLFA 3SIXA 4GZLA 4OXIA 4Y2YA 4RTKA 4TM7A 5T4HA 4Z2YA 1TTQB 1BMQA 2ZJ4A 3M89A 3TNYA 1NOKA 2K4MA 2HJGA 4GT1A 2DETA 1YZNA 3WS7A 3D1LA 2R48A 3FMGA 3QBVA 1AURA 1X1TA 4YS6A 5IKPA 3N6VA 3L7LA 3O2SB 2VJKA 1WMEA 7AT1A 3EXG1 1YOVB 1P81A 4FYPA 3RO7A 2PSJA 1Z4NA 2J0UA 3PJDA 5AO9A 1CJSA 3PWTA 3TMAA 3K2LA 4XVUA 3E61A 1BW9B 3LC0A 1OAAA 4EL5A 3UFXA 3ILYA 5DYYA 2I3ZA 1VYVA 1TL7C 3C7CB 5ITZA 2BT4A 1ZRHA 4ZZIA 2G3YA 1VPLA 3JQ6A 1GLNA 1XAHA 4NFSA 4L8FA 2R6JA 4L0QA 5LU9A 1G41A 3WHKA 2C78A 2FUNB 2XMZA 2HJVA 4KLAA 3WFZA 3NNSA 4N3NA 2GYYA 3EIUA 1GP2A 1TJ5A 4WBNF 1G42A 3H9UA 3FPFA 3MTIA 2WF6A 2ZBEA 3FI0A 3L6EA 1NT2A 4V38A 5TGZA 4BO4A 5CFLA 1HFEL 3QA9A 3BG5A 3TNFA 4V39A 2J3IA 3HZJA 4P7BA 4OMDA 3NX4A 4E31A 3ORQA 5DYGA 3SBEA 3ROGA 3C1OA 2GUGA 5HKAA 1AQIA 2ZBGA 3D8SA 2UXBM 4A27A 3VPSA 2YYYA 4BAGA 2OXFA 3ZI4A 2HA7A 1FP2A 2TMKA 3A11A 1EP2B 4I8IA 2VT2A 1XDSA 4BFXA 2J33A 5CG1A 4EHAA 4ZHQB 1HEYA 2I1VB 2ZRMA 4ZVQA 5C35A 3PICA 1WMFA 3K6SB 1HDCA 2HIHA 4AZSA 2H0AA 4HH4A 2IYZA 3EEFA 1WEHA 4L22A 3JAMS 1NV9A 3MHPA 2BI8A 2VF8A 4Z5XA 1B8UA 2FH5B 1ISSA 5EJMA 4W8OA 4XQ0A 3AC0A 3B2NA 5E6SB 2A7XA 3QLUA 1T0JB 2X19A 4IVNA 1ZXLA 1XTVA 3VK8A 5D51S 4B3RM 3BRWA 2H16A 1PWEA 3GUYA 1ZP6A 3RCBA 1VA4A 1I1HA 4UCFA 3T3PB 3TIVA 4KYVA 1NW9B 1H66A 4JVNA 4OY3A 2EATA 4EB6B 3HFJA 1IXKA 4MHSA 1XEAA 1D2CA 4K81B 1UKYA 4JB2A 3GJ6A 1S7CA 2DHEA 1VDMA 4R1NA 1EIZA 1R8SA 3BK2A 3BFPA 3H2IA 4C87A 4DV2M 1D5WA 4G4GA 1TQ8A 4WJKB 721PA 2IPLA 3QE4A 4GXQA 2G80A 1QPGA 2WHEA 5GGXA 4MYHA 1QWSA 2HK7A 3TDKA 2I3GA 4HDNB 1RT9A 2C59A 4MRRA 5LQJA 2Q21A 3CKYA 4JUAA 1NDQA 1J39A 5ICCA 4NEQA 4ER0A 4FNAA 4OP3A 1P0PA 1RU3A 2D2EA 3NEYA 4LG2A 3PF8A 5IAKA 2YWRA 3KK0A 3G2PA 3R7FA 2QDXA 5ECDA 2PPLA 2AFRA 2PGOA 3IKLA 3W2GA 5F64A 1TJNA 4OU4A 2WF8A 4F0JA 1MIOB 4MI9A 1QANA 1NRIA 4K7JA 3NHJA 2BJHA 4AW4A 3ZXIA 5K5EA 1AO0A 2JLBA 1VIMA 3KUUA 3R44A 4F3KA 2I8LA 3R7SA 3FUUA 3RIHA 4HB4A 5GQSA 1XZGA 3LOPA 4PG5A 4JR0A 4CMAA 4WZAE 2R6HA 5F1YA 2D1QA 2JDIA 2DAIA 3STUA 4UMVA 2GERA 1QUSA 3MB8A 1VYHA 5FR2A 2H0RA 2H4HA 3OEYA 2RI1A 1IEXA 4NCNA 1QB8A 3GY0A 5AFSA 2VHZA 3ZXUB 3JR4A 1NX9A 1WUHS 1JF8A 2Q41A 1XTKA 1MA3A 3H65A 3SATA 1WPGA 4P08A 4AQ7A 2GO7A 3CZQA 4YR9A 1Y5IA 2R3SA 4EJSC 1X7XA 4U8GA 4DAOA 4C01A 1O96A 4WXMA 3CZ4A 4IJ5A 3L0DA 4Q93A 1H8HA 4OHCA 3E2PA 3HA3A 3EZLA 3FCOA 4L78A 1UMDA 5L3RA 4M76B 4FHFA 5IM4A 1NLUA 5HIIA 4DT1B 2JGDA 3H2KA 2IRWA 1HA3A 1SVMA 1KJYA 3KEFA 5FXMA 5LLTA 4CYMA 1L1EA 2GM9A 4RXUA 4XX0A 4BO0A 3UJDA 1W93A 4L27A 1XUOA 3SHGB 2R66A 4DDKA 3ROPA 3MVEA 3K0AB 4OL0A 1OFUX 1NM5A 1U3VA 2REOA 5DTMA 4NCAA 2AOUB 3AJDA 4Y9TA 421PA 1BMFA 3T1OA 3IESA 4GGPA 1C4WA 5C4MA 2FPXA 1H6CA 1I3MA 4PC3A 4OHUA 3EASA 2QTWB 3EMDA 1NVDA 3EFHA 3JYQA 4KXWA 3TVYA 3G1UA 4OQMA 2WZQA 4DWVA 3CLRD 2F5NA 2P9GA 1JZTA 1IZ9A 1ECFA 4JKIA 1Z9BA 5AJHA 1PJCA 5TIIA 1RWBA 3EHDA 3I30X 4HWOA 3MQ2A 1RYYA 5FD8A 4O2AB 4TL6A 1V9CA 1FTGA 4Y1RB 4JWKA 2V7TA 3N74A 2GBLC 1JFSA 2DBVO 5F51A 1YU9A 1XDZA 5D85A 5FI3A 5DLYA 5JYBA 2H9IA 4TGLA 4GF5A 4MCAA 5LYJA 2H5XA 2X7HA 4FGJA 4ZQHA 4L72A 3DLBA 2IUUA 2F5QA 2GPSA 4IMPA 2XNDD 4MUBA 4AJ4A 5JQGF 4UHKA 1O9HA 3ORHA 2LXEA 2Y92A 1WF6A 2VTVA 4C7BA 5D7BA 2VQ3A 3FVWA 2G04A 2GDZA 3C48A 2JS7A 3T41A 1E1DA 3GT3A 1XAGA 5CB4A 9GPBA 4WTOA 1G4UR 3D7NA 1IEWA 4U7GA 3D1JA 1DEAA 5DBIA 3O47A 5DGHA 5G1NA 1HNXM 4FONA 1BVYF 3LP6A 1KI7A 4XUDA 4L4XA 1UH5A 4YRMA 1NUPA 5IAEA 2R46A 3DLIA 1OAOC 5H9VA 3A9VA 5CTAA 2UUOA 4NARA 3HP1A 4MKFA 5H82A 3PXAA 1RLOA 2WTUA 3OO0A 3WZ2A 4WZ6A 5IHPA 5JNTA 2EKPA 2JH9A 2GVDC 3I2GA 1Z62A 4CCAA 1RWPA 7REQB 1M8JA 2JFVA 2HWUA 4YP0A 2B25A 1W581 1PEKE 3EVCA 2QRQA 1Z22A 3F78A 1WKBA 2EFJA 5FF9A 1XZNA 1ZMUA 3EIQA 1CJVC 3HRKA 5EYPB 2W2MA 1JR6A 1Y7PA 1T8RA 5EESA 4FZ5A 3NFYA 4HEOA 2ZTVA 3G13A 4FYWA 2DCMA 1P5RA 4UCQA 4O1HA 1UDAA 1YONA 5IT9A 3EUAA 2WZCA 3H7AA 1CRZA 3TZQA 1Q39A 2HBZA 5FPTA 5U4XA 5ALOA 2ZRGA 4G6ZA 4XM1A 1PSDA 1NYRA 4ITUA 3WBFA 5DO9A 5LYYA 5DTRA 4DDTA 3LTNC 4D74A 1L8OA 4LHVA 5JD4A 1C30A 2MSNA 5DULA 3FZEA 3PNLA 1KH2A 5CA0B 2KXEA 2N0SA 1A4XA 3GPLA 4G8CA 1KJWA 4TV8A 1OXVA 4AW9A 1IONA 4UCWA 2V7GA 5FBKA 1AK1A 3Q8LA 3DEAA 1YLAA 1OJLA 1E5DA 2BGKA 1L5ZA 821PA 3GFRA 4D8YA 2FDXA 2OFFA 5REQA 3TWMA 1VXOA 4MARA 2QWXA 4JI2B 3DWGA 3NBFA 2G8NA 4RIHA 2YWJA 4PZ0A 2WRZA 2GJ9A 5JNLA 1GV0A 3DYIA 3HJGA 3UB3A 3EIEA 3LGXA 4Y0NA 3SAWA 3M5WA 1OT3A 4ASUD 1V8PA 2PV7A 5TT1A 3DEJA 2ZM5A 1N5RA 2KNZA 3RDPA 2QVCA 1QM5A 4UMEA 1H2HA 5JJ5A 3IBSA 1DWQA 2IPNA 3MG9A 2WSIA 2JHCA 4A3SA 3E58A 1W76A 5JAOA 4CF4A 3IT3A 4FN5A 3ETLA 3HX3A 1DG1G 4X62M 4HQRA 3PHIA 4PTLA 1C0LA 2KZSA 1P2BA 1RBQA 2GILA 3QX3A 4P4NA 1H6UA 1I2CA 4GMKA 1L4NA 3BWXA 1MB4A 1E1RA 5I48A 2VYVD 4XOUA 1EFRD 1RD4A 1NVVR 3I51A 3VR5D 1H4QA 2CD9A 3EULA 5KX5F 1FUYB 1KAEA 3L7CA 4J43A 1MVLA 1IEVA 2O3UA 4BFLA 2GASA 3BHMA 3HABA 2EQ5A 4NFHA 2VK8A 2LCIA 3BA6A 2FVXA 4JA0A 1FW6A 3TI7A 1O03A 3TSYA 5FHRA 1I33A 5TDHA 3B20A 4MULA 3BRCA 4M7WA 5FUQA 2POQX 1EVZA 3HXMA 2PYZA 2ZDGA 4EDFA 4HH1A 1E2IA 1Q74A 3GJ5A 5DM4A 3VR4D 4JHLA 3KD3A 1QYWA 1AUXA 4Z4FA 1L4EA 2R7AA 1JIVA 3GQ5A 1RKXA 2D0DA 3OT1B 1LVHA 2NX2A 4UMFA 1VLJA 4AP9A 1LV8A 2Z3ZA 3U6KA 3LCUA 4PS1A 4RPHA 1OBHA 2IXEA 5L45A 2QXYA 2X0FA 4BN0A 3M6UA 4ZEOA 4JLKA 2BE9A 2EGHA 1Q1QA 2VAPA 1L7AA 2Q5FA 2E5FA 3IPYA 2XHZA 4B83A 4I0WB 2E4AA 1VKNA 1HMPA 1PZEA 4LRTA 4WW0A 3D4OA 1QX3A 1ZMTA 4BMPB 1ZUIA 2JVKA 4QAJA 3PC6A 2I4NA 3B3AA 4JI0M 3E9DA 3U3RA 2HNBA 5JSFA 4UU8A 5HR5A 3WMXA 3LMMA 2WF5A 5TEWA 1EU1A 1WZNA 4S1TA 1TVCA 5ALRA 3MWKA 3OZ7A 1CUVA 3FETA 4LPKA 1KETA 3TTUA 5EZYB 3HO1A 2MR6A 1WW8A 2BCGY 2XY4A 5A7HA 2FSUA 5FUBA 1ZXBA 1WP9A 4R1PA 3QE9Y 2PMFA 1IXSA 5BORA 2JBHA 1QHHA 5MN4A 4O59O 2OSBA 4LN1A 3F1LA 2IDJA 4AJHA 1QGZA 2ZVDA 1DX6A 4FUQA 2PXCA 3E4RA 1RW4A 3UUWA 2IEDA 2I71A 4BVBA 2XT6A 4QBFA 1DGBA 2Z5VA 5KC8A 1L4UA 4FYKA 1AK2A 3G5MA 3SJ7A 4LY3A 5CT6A 3FPSA 1TJ3A 1NQTA 3DZHA 3JQ9A 2WE8A 2GN9A 4MITA 4I5FA 2ECFA 2C97A 1A0OA 2XZTA 4QPPA 4AJKA 3NH9A 5KOJA 5LWQA 4JMPA 3JYOA 1GSHA 5G2OA 3N3BC 4YV1A 3V7NA 2EL9A 4DIKA 1QAQA 1JHRA 3X2SA 1G2PA 5BRNA 4EDHA 2PAFA 3PHLA 4ARSA 4FHEA 3JRNA 2DENA 3IR7A 4G01B 3QOXA 2ICAA 1N57A 1FLNA 1VCIA 5KEIA 5JANA 1JJVA 1TEZA 4FWIB 1LPBB 2AJCA 1DIBA 2OHIA 5FOXA 5B7QA 3C6QA 4EI2A 3RJ5A 4DADA 2BFFA 3RANA 4D9BA 4C1NA 1YS1X 4Q4AB 2I6QA 4L8WB 2XFTA 2DBQA 2HADA 1NLMA 4AWXA 3PWZA 1GJTA 3U19A 5AH0A 4R3NA 4ZCPA 1XLVA 5KQMA 3JSAA 3LC2O 5CLGA 1NUHA 1OFVA 4MKHA 3F97A 5ITXA 4JQZA 3AG5A 3MINB 5J2TF 1GSAA 1GLGA 4N7BA 5HMMA 3GN1A 4BO6A 3CONA 1G21A 1PN3A 4BQOA 1E20A 2G77B 2QG9A 1QHYA 4XI9A 5JPDA 2JJ1A 4P4GA 1WG8A 2KDLA 5AM5A 1ML3A 1NNUA 3ZKWB 1CUIA 2W0MA 3RWMB 1UK8A 3V8BA 4XAQA 1KEZA 2YYAA 1FNDA 3HY4A 4PWZA 2JGIA 3LBIA 1JHVA 4RHEA 3P9YA 2QTVB 1E3EA 2JY8A 4ZGWA 3UMSA 3P9CA 5D5PA 4HZGA 5D00A 1E6MA 4I08A 3GMTA 4BB6A 3LK6A 1C3OB 1H2ZA 3CO0S 2R6AA 3WGTA 5K9ZA 1R5LA 2CLFB 3L79A 3LDFA 5BPHA 4LF9M 5KB3A 3DOUA 3B6MA 4F45A 1RI4A 3PC8C 4NJMB 2QY6A 3K92A 1CUYA 4AYXA 5K8IA 3O4RA 3CSUA 3A28A 3KC2A 3GYBA 2D6FA 1LC3A 1E6WA 3IVAA 3T34A 1P2VA 5IYZB 3WGGA 4QOHA 4M7OA 2HJWA 4A0RA 5ALMA 3G8AA 1V25A 5BQOA 2ILVA 3V1UA 2TMGA 4E5DA 3BDAA 1PR6A 4ATNA 3QTBA 2AOTA 2IVFA 2EUCA 4HFMA 4MMXB 4EO4A 1ZK3A 5AK3A 1RBZA 4F4HA 4RVHA 3PX7A 2FK7A 2I7XA 1JQLB 4GVPA 1MC8A 5F5XA 4B8YA 1F5SA 2WWHA 1ETHA 1ZUWA 3FKEA 2CDNA 1Z4IA 5AW9A 1T1GA 1JN0A 4OLJA 3VBCA 3W7AA 2XB6A 4B5KA 5G0VA 1W88A 5IVDA 2I4LA 2UUAB 2HJSA 1M0TA 3KP1E 2HREA 4BMCA 4ITVA 4I1RA 5JAIA 4W8HA 5L53A 3GEPA 4A0FA 2E5LB 1KERA 2Z3WA 1SKMA 5KINB 1GL6A 3N2KA 3AVYA 2GARA 3H5WA 4PHGA 3EN0A 3NG1A 3DBIA 1Z73A 4D6YA 2XKAA 1K9VF 2BGJA 2B7CA 1XQVA 4PQFA 4YDQA 2BGWA 1D6JA 4QTTB 1QTNA 2R6GA 3FZQA 3BE8A 3RVSA 1T5HX 1BE0A 2K6GA 5AVUA 1FJXA 2VSFA 4WE3A 3DVLA 2RJ3A 2IS4A 1WCYA 3VTAA 5KSOA 4BP3A 2NV6A 1V92A 3R6TA 1FU7A 1LSOA 4L07A 5IVPA 2Z04A 3ZU2A 4JL8A 2Y21A 5KNLA 2I7TA 4WKGA 1YIOA 4YUVA 4NABA 2EX1A 3HEMA 3PL5A 3SF8A 1FQOA 4DCTA 4LC9A 3LJKA 5KTOA 3DNPA 1XLUA 4W99A 3L4KA 5JMTA 3PNMA 4DR3B 5A4DA 5IWAM 1EB9A 2JAHA 1A9YA 1EVLA 1JG4A 4BY9E 3NW9A 1V8FA 4QYXA 4FU0A 1XMPA 4JSRA 1RM0A 1WMAA 5JD3A 3HWRA 1HQDA 1Y8QB 1WUTA 5ALLA 3OJXA 4MR8A 2QTGA 1JEDA 1BFDA 1YJAA 5DM1A 4ZARA 4PX9A 5C8XA 5LOVA 1TFUA 1XD2A 1B41A 3OEEA 2HQOA 1JQBA 1ZQ9A 1EUZA 1P1RA 1YGPA 5KYGA 1UJ2A 1V1RB 4NU8X 4IZIA 2QD5A 4NKRA 1G9XA 4RCZA 1ZGCA 1YL5A 2ZROA 2FY8A 3KSZO 1QRUA 4PGFA 3J81k 3LC1O 3N2LA 2HA6A 3SHOA 2G6TA 1W8DA 2WTMA 2Q1TA 4C0KA 4YQYA 2VZ0A 3LLSA 2OBXA 1FTSA 4N7RA 1NR5A 4CV3A 1VJ1A 1V3TA 3UW3A 1K4MA 5I9BA 3CRRA 3CG4A 3EGXB 4UHDA 4HDCA 4FGWA 5ESDA 4G56A 1T34A 4HQLA 3U7EB 2ZTMA 1SHUX 5LQUA 2O6HA 2CDAA 4MOWA 5AHKA 3AQ4A 2M60A 2FJUA 2ILTA 1N78A 4FWBA 4R51A 4MHOA 3PNPA 3WOHA 2BFBA 3ZNOA 2PA0A 3DWEX 4G0OA 4J4BA 4JI6B 1RRVA 1BCRA 3IAEA 2IA5A 3ORRA 4MS4A 4TQUS 1G20B 3VKGA 2TYSB 2GJAA 4FXPA 4IZ6A 2JHGA 3L4SO 3A7DA 2X5KO 1E9EA 4HG2A 4NJEB 4TL9A 3R20A 3OLXA 3PFWO 4QX6A 4CMCA 3BXWA 5DMXA 1B23P 2DJIA 1OC2A 2V7XA 3CS3A 3AEKB 2G4VA 1XFAA 3CLTC 3VVBA 3AUYA 3SMPA 1TUIA 1Z4PX 1OYWA 2ZDQA 1K7YA 1L5GB 4IIXA 2QVLA 3P9NA 3I28A 1U7TA 5DNEA 3SGLA 4P7GA 4X66B 3W0FA 4EGAA 2CBXA 4JYPA 5IZ7D 4X8HA 4BXOB 1P2TA 5WRFA 1E98A 3O2JA 2PMEA 2EJBA 3SM3A 5KPRA 1K2WA 2E49A 1CJUC 4M88A 4QJIA 2K7ZA 4X5OA 1URPA 2J5BA 3QKSB 3GYGA 2HRRA 1ZIDA 5CGZA 1N2CE 4Q7JA 3JZIA 4KJXA 1MDFA 3WG9A 1NW3A 3FJOA 2JJQA 1GNTA 1N0VC 5CT8A 5JCJA 4FKMA 1FBNA 2PJZA 5BN5A 4H1HA 4KI7A 3TCNA 1PR4A 2Y20A 2HT1A 3U13A 2FEKA 1DBVO 4X1YB 5EC8A 4JLAA 4RVCA 3W5SA 4HZIA 3SQWA 1TYZA 5C32A 3P52A 2NWQA 2YRFA 4J9UE 5SY9A 1OFTA 4XPZA 1A1VA 4F7WA 3JVIA 1VDDA 4QYWA 2I7VA 4KOAA 2WHPB 4YRJA 2A5GA 1CQWA 1V33A 3E3AA 4UW9A 3KLNA 2I6TA 3TOZA 4QPJC 5FWDA 2D13A 2WPDA 3PLNA 1U2SA 4WJZA 2R79A 3OQIA 3D3WA 2GMWA 5BR7A 1AT1A 3ABIA 1AQNA 1PFVA 4XSHA 1OGJA 3U7FB 2P2GA 2Q3DA 3TKLA 1QMGA 4Q7MB 4MR9B 2CLLB 1YB7A 2F67A 3VU9B 1RSZA 3QEBZ 2QSYA 3GGSA 1GZ4A 3GEGA 3IPLA 2R6FA 5JO0A 4OAPA 3V32A 4KNVA 2DKFA 2CFSA 1RTTA 4KQFA 4QLBA 4XFJA 4Z6KA 5AVSA 1NDHA 4B9AA 1NF9A 2X41A 2I7PA 1RC1A 1U6JA 2AYYA 2PT7A 3KEGA 1H93A 4HX9A 4LJ7A 3MGAA 1QGUA 5HBRA 2WJ6A 2VJMB 2W4QA 1J06A 4QOJA 1TCAA 1SMKA 1ZM3A 3KSDO 1HE8B 3KSMA 3ENZA 4OPMA 2ZAMA 1R5NA 2BHNA 2GZ2A 2G0TA 1RKUA 5CFPA 4PLYA 2PJDA 3AF3A 2CW5A 4J4HA 3AP3A 5KZMB 4EI8A 3QG1A 3M1LA 3Q3IA 5JCOA 1L4FA 3AI1A 2MGWA 4HDMB 1EGMB 1IATA 5JTTA 1MUUA 5IBRA 2XYVA 4O4IB 2JD2A 3D6NB 2GF0A 4MPRA 5LA6B 4QDJA 2DWCA 3U0BA 2RGNC 3UXMA 4D9HA 1W6RA 3DDHA 5IAOA 3N0RA 2VCHA 2P0AA 4D57A 2RB4A 3TLEA 2CB0A 2PGXA 4LWZA 4Z7QB 4IHKA 3K8OE 4YJ3F 3L01A 4DCNA 4N49A 4PS0A 4EH1A 1BA3A 2W6IA 3UV6A 1NN3A 1KQPA 2OQ2A 4N3AA 3HFSA 3LBFA 4XVRA 1CW2B 2OBLA 3HS3A 3C3BA 3RADC 4M3NA 4PZYA 4A3VB 4KIFA 2ZSUA 2GJ4A 3HKEA 3K72B 1FX1A 3EVAA 3OJFA 2YWXA 4P4SA 2UYHA 4F2DA 4FFBB 2MR5A 3UBMA 1D09A 2C3UA 4NZOA 4PE5B 3CPSA 4HGOA 4KPUB 3I39X 3EQZA 1FS5A 4ZJUA 1DBIA 4D9GA 1DV0A 5IT0A 4KZKA 2VJBA 3RPEA 4ZYYA 3O4GA 3CO5A 4HYYA 1IM5A 3WQSB 1S8OA 4CKCB 1UFRA 3DXZA 3WZLA 4OM8A 5FLXA 4TYMA 5DGDA 1JA9A 4NOKA 5DCLA 1Z59A 2B4RO 2HV9A 2Q62A 3A6LA 1QZEA 4BO5A 1D0IA 1HDRA 2LP4Y 5HTOA 4IQ0A 4B6GA 3EC1A 4RLFA 1ATZA 4CMKA 3AHFA 3UM9A 1CUDA 3DOEA 1XMOB 3V4ZA 1N36M 1GG2A 2V45A 2YZ7A 2JIBA 4NHEA 1JA0A 4CQNA 2G1KA 4N8EA 3ZW9A 3K0FB 4P4LA 2NVWA 1V16B 3PQ8A 1MRSA 2D00A 5ELLA 4YPVA 2DQ4A 3HJRA 4WHMA 3HB7A 1JV2B 2QLFA 3ODPA 2CHQA 4RPCA 3RVKA 5DHSA 3EPKA 2AKEA 4P0TA 4AZVA 4J0HA 3MCTA 3HJ8A 1QIDA 4MQMA 5AIBA 3AVQA 2IOQA 4YJFB 4BLUA 3D8UA 4FDVA 4YAIA 1MGOA 1CIPA 1OI7A 2X4GA 3MSCA 4AQYM 2NZXA 2H0QA 3PI7A 4MKGA 2RKWA 1FPMA 1U4SA 4S0ZA 2CSUA 4KUHA 4I1OA 1XZKA 3RAJA 5HF5A 3TL4X 1O57A 4WN3A 3INGA 2QQ0A 3WXMA 4JOSA 4BQEA 2FK8A 1TO6A 1I7LA 1E0JA 3I53A 4RMHA 3WB2A 1YS6A 1CUJA 4G8BA 3DYBA 4XKJA 4PG6A 3D6FA 2OMEA 1ZG3A 1LVUA 1PZXA 4FIDA 1KORA 1PWXA 5CA1A 3E3LA 1UAYA 2X0NA 1HT3A 4IGFA 2D74A 1VMDA 3OHMA 4G65A 3OJOA 1NOIA 1ULBA 1EWQA 3JQFC 1YR9A 4LFBM 1UFOA 2YXDA 4R2KA 2FP4A 1QO0A 3KSAC 4U6QA 1TTEA 1B42A 2QGNA 4NI5A 5BSHA 4YP6A 3VNRA 4JBIA 3F9RA 4FB5A 4NE7A 3ANNA 2RBGA 4Y98A 1UPTA 4MNTA 3T9DA 4MCJA 3NI2A 1WQ1R 5C4GB 1F17A 1ZWKA 3HC7A 3IEXA 4IX9A 1KFVA 3HLYA 1KQOA 4ID3A 1ES9A 1P5JA 4Y6OA 1PLLA 3I9NA 2H4FA 2CL0X 2DF8A 3R8CA 4OI4A 1JH8A 3FYUA 1BEEA 1MJ5A 3OU2A 2BNKA 2PQ2A 2XUOA 3A27A 4HLCA 2XOEA 3U4QB 3RT7A 3QU7A 1Z2OX 2M6SA 4R3UC 3O73A 4N5NA 3WGUA 3HGMA 4QYIA 2Y4NA 1A2KC 3VRHA 3S3TA 2F7SA 5K4GA 3VV2A 1ZI9A 4LZAA 3WMEA 1QQWA 1JHOA 4NBKA 2AE2A 2DVWB 3VMMA 3GHYA 2IYYA 5LQKA 4FFVA 4WNAA 3TB6A 1U0SY 3W1WA 5COQA 2VCYA 3KZMA 3V8VA 2IYAA 3PA6A 4HXYA 4RTMA 3ZWVA 2JEOA 3UTDA 4OOEA 1CUCA 2OD2A 4OH7A 2H1RA 2VBCA 2NQ8C 3P4XA 2R9VA 4EVRA 4L57A 3OZGA 2RMKA 3INYA 3S2EA 3OLYA 4RIGA 1E2MA 2H9AA 2XRZA 1TF7A 3WB0A 3N2YA 3ZHOA 1TZKA 2D1RA 2GEDA 4CEJB 1QGAA 3JD1A 3AB3A 5CP8A 1KOJA 5J4KA 2VJCA 4QOGA 4CKEA 4TYWA 4HNTA 1JYFA 5K01A 1SUEA 2JZOA 2WT4A 5TMDA 1Z4LA 2XXAB 3FSJX 3R75A 5IANA 1EFTA 3RNOA 1M73E 5B1IA 4HWTA 5CBPA 1E1KA 1VJRA 4RPIA 1GZHB 1GVHA 2HD4A 3RU9A 3V2HA 4M55A 3EGWA 1COWD 1SVOA 4P98A 1UBFA 3KXDA 4C7JA 1E2EA 4RTLA 1C1XA 1U5BB 4OUKX 1EXDA 4XBOA 5A7GA 3HE3A 1G5FA 1E89A 2FHSA 3KX2A 5K3DA 5K4AA 4OI0A 1PM5A 1JP7A 4RFSA 2EW1A 1BVHA 1LPNA 1D6SA 1S2DA 4C0WA 1D0KA 3KKNA 3DHYA 4ZHQF 4CMEC 4AWAA 4DABA 3ABZA 5ENZA 2QUHA 1YTLA 4X92A 4D3XA 4F4JA 2WSSD 3MJHA 4Y30A 4KIWA 2G5CA 5SYAA 2PH1A 1Z6XA 5BMVB 3NH6A 2RIPA 1T9AA 3TNLA 2XF8A 2PT9A 4GC9A 4DC1A 4C7OB 1Y4SA 1L4HA 5HE8A 3TE7A 5CW1A 1PW5A 3R0IA 3T7JA 1QHNA 1Y42X 4C29A 1VMEA 5C1OA 3NVMB 2IPOA 2EQBA 4HNQA 5CDHA 5EFZA 4RTOA 1RC8A 4DCPA 1KDRA 3CXUA 5JZOA 5U9CA 1BYIA 1C1YA 3ID6C 3G7UA 2RC6A 2DHCA 3GDOA 1EX6A 3HU1A 4UM9D 2RAVA 1GY8A 3I3SR 5BV7A 4KTVE 1VGRA 4OXKA 3FKSA 2JLXA 4ND8B 1DGQA 2JGKA 4D3SA 4AMUA 3WA7A 1V7PC 3MILA 3LX6A 3J81S 1BA2A 1GTL1 2HJHA 3AXSA 4E88A 5MN5A 5EWJB 2Z2IA 5FPSA 2VYND 1RZRA 1UQTA 5GAJA 1PJIA 4JQCA 4ZI7A 3ZD7A 3TGWA 2OOAA 1T8YA 3I32A 4GKJB 4BNJA 3QIVA 4W9RA 3TWKA 2HF8A 3PNYA 2O4UX 2VHCA 1EXWA 1Z0ZA 1UT5A 4NSOB 3V76A 1A8IA 4R7ZA 5IJ9B 1HYQA 3AHIA 2O5RA 3EVFA 2E4ZA 1GCUA 4HHEA 2WFLB 1I2AA 3JPYA 3P2EA 4II3A 2MSKA 1T2FA 1MG0A 2LD4A 1JEYA 4DB4A 1RLIA 4ARZB 2HIMA 1QFSA 1CHNA 3GLIA 1JIKA 4I50A 3SKVA 2KLHA 4LF8M 2Q28A 3LUPA 3F92A 1OQYA 2NZVG 4H6WA 1KOGA 4RZXA 4EPVA 1QIEA 1Q95A 3COJA 5IJAA 3P0EA 2QVBA 3Q2OA 4DJAA 3CZPA 3TJZA 3JWJA 1WHCA 1SCIA 3IX7A 1H6AA 3A3NA 5FI1B 3BMOA 2WJPA 2VP6A 3QE3A 4ZVUA 2FF5A 3DA8A 2IXTA 4PZDA 3JR5A 3SSMA 4KFTA 3UENA 1YZUA 2XX3A 3U5ZA 2NZJA 1U6KA 3TB4A 2VPZA 2PGDA 1CUSA 3TLKA 2HCJB 3E5HA 5BT8A 3NWOA 4Q4DA 4RZ3A 2PHZA 2DHQA 4C4OA 4GPD1 3DAFA 4ER5A 2GRUA 4O63O 3SM9A 3AM1A 1N2EA 1UBMS 1GV1A 4Q4CA 1N2BA 2D8MA 1SVUA 1DAPA 2V6BA 2YV3A 1YRQA 3L0CA 1GHTA 5B7NA 1P5ZB 3MELA 2XYHA 1DXOA 4JJ6A 3SZGA 1IBKM 1QZ3A 1N32M 1M2OB 2IIBA 3SC4A 5AVVA 1XNRB 3T1HB 2XVZA 1QAOA 1K7CA 4GLBA 2IYWA 1E3IA 1YZLA 2GZAA 5H59A 4WKNA 2K6BA 2SECE 5F1OA 1VHDA 4UFOA 4IHAA 1M2VB 3DT8A 4DRXA 3NNNA 1OH6A 4JN6A 4YQEA 4WX2B 2EHDA 2GFQA 2J7OA 4YJ2A 5SZIA 1SOMA 4R6WA 5DBGA 5ELXA 2VF4X 1HURA 2RGWA 1FP1D 5F23A 1UOQA 4HB0A 4DDHA 1VL5A 2E1PA 4L9SA 3MCWA 2XUIA 1DKMA 1CEQA 3L8FA 3UA3A 3KYCB 2XTAA 1NC3A 3INRA 1CBUA 1GYPA 4JUBA 1GDDA 3KLOA 4AN0A 3W7BA 3ET5A 2JI7A 4N39A 3GUCA 4HLDA 4ZAVA 1XTJA 3L41A 1HM5A 2R7NA 3I3OA 1L5HA 1Z6GA 3TGLA 4O2AF 3H05A 3B6EA 5BYBA 2PUVA 3KOZE 1YCDA 4FWTA 3ZHTA 5TPWB 3FMFA 3F3MA 4QQKA 3ZS9A 1N34B 3BN3A 1ZINA 2AE1A 1FC0A 3SQOA 4F21A 2HH9A 3ZD9A 4OHFA 4CM4A 1VL8A 4LDPA 2YHBA 4QUJA 4ZVLA 2FN4A 2PZBA 2QT0A 5EXDA 3J7AC 4YMLA 1MZPA 1UBLS 4EJ0A 4UEQA 3I76A 3BOSA 4D79A 1OXKB 2L0XA 4C3OB 4KW7A 2ZYHA 1PT8A 4TN5A 2EG5A 4OGLA 3THYA 4F38A 3BQ9A 1B4DA 2EBFX 3T4EA 3IMEA 2PKRA 2GLUA 4D96A 4QT4A 3EGDB 2IYTA 2REQB 3T1YB 5KNDA 4US0R 1P0QA 4IXTA 2RHWA 4ND2A 3OPMA 3W6NA 1N6OA 4N54A 1HDOA 3KOMA 1MVNA 2RH5A 2R86A 4G0XA 2Q1YA 1G3RA 4QPNA 1U7WA 4JI7B 4RZ2A 1FP4A 1KS2A 2Q3EA 3N76A 4H7EA 1H0KA 4D5GA 3WBKA 1OTXA 3WGOA 1XQXA 3IAXA 3NHUA 2A5FA 2FUG6 3EOZA 2XGJA 5CXSA 4OGWA 2CXRA 3SBOA 2BI4A 3AVXA 3D59A 3S2GA 1XZCA 3RIGA 2ZIVB 2VK2A 1Z56C 4RMNA 1M1NA 5SY4A 3KFLA 5FWYB 2V7UA 2XQIA 4CQMA 2QRPA 3AKZA 3K9CA 2BTOA 3P2YA 3OTOB 4OQ4A 3NUZA 1G8JA 4QOFA 1L8XA 4IFIA 4JNCA 3B1YA 2CYBA 1VSVA 4FC6A 2RHTA 4P80A 3NALA 3WLNA 3IUBA 4HL6A 4IDCA 2O50A 2B30A 4M98A 3RQIA 1UMCB 4BO8A 1QU2A 1VHJA 1ORVA 4EYSA 3BGSA 3EXHA 1Q17A 5D3MA 3WE7A 3BTUA 3KOWE 2WIGA 4E09A 3L8MA 1L1ZA 5CA0F 2ZBPA 3K5PA 2QQGA 3GRCA 3MK31 2ZUTA 4AKHA 3OMXA 1KC1A 4MB7A 1VPWA 2YRWA 4IG4A 3IAS6 4M1MA 4LF4M 3R6LA 1NHGC 3GH1A 2BM9A 2MSEB 1KI6B 2I2CA 4BZQA 5FAXA 3WLKX 3QV1A 3ND7A 2D1SA 2WSBA 1Y9AA 1OC4A 1JTVA 3ROZA 4E2WA 1YFJA 4YRZA 4AYWA 1BU5A 4BLOA 2J7PD 2P69A 2J09A 5DYNA 3U9LA 1BXGB 4QBTA 1ZGGA 2BTQA 3ENQA 4H4EA 4E7OA 5FV7A 3D0KA 1L0BA 3I5YA 2MINA 2C8VA 3RSSA 1W7AA 4JC4A 1E4EB 1Q14A 1DO2A 1K9SA 2BM8A 1PV2A 1A7AA 1GGJA 3UICA 4PZAA 3UWOA 3IQIX 2BHRA 4IP0A 3HU2A 1UXGA 2ZPTX 5ELMA 4BIMA 4U9UA 2WD7B 3JWEA 3VKFA 3MC1A 4YJHA 3MRTA 5B58C 5EL0A 1KMHA 1DKPA 4TVKA 1M34A 4D46A 4CTOA 4JI4M 1IOLA 3FNEA 3EZYA 3AVUA 3QENA 1THMA 2OM6A 4WRRA 4RXMA 3KPWA 4G4SO 4TLLB 4PDGA 1DQSA