1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords hemK protein
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
5CCBA 1RI1A 3FRHA 4YV2A 3GXOA 5DM4A 4LWPA 3HEMA 4PYKA 1Q0TA 3GJYA 1UFKA 2ZVJA 1O9GA 3GWZA 3TQSA 2AVNA 3UJ6A 3G5TA 1D2GA 1EQAA 4C03A 3B3JA 4CKCA 4DKJA 3MMPA 1XXLA 3P2EA 3TLJA 2PXCA 1PRYA 2JY7A 1VIDA 3AY0A 2NXJA 2QSFX 1IXKA 4ER0A 3HA5A 4A6EA 2XVMA 3CKKA 3I58A 5GIPE 2UYCA 3B5IA 5IH3A 4RTKA 4RTOA 2VP3A 3BGDA 2DHYA 2HWJA 2BWBA 4WP2A 2IDJA 3G8BA 5EMLA 2IH4A 3LX6A 4E32A 3DXXA 4GQBA 5FULA 1VEKA 2FK8A 2Q41A 5EHIA 1YF3A 2XBMA 3V8VA 4GEWA 1INLA 2P8JA 1DO0A 5DSXA 5GWXA 2ONZA 2HV9A 3OE4A 3ELWA 3E05A 5CVDA 5E1MA 2G1PA 3GRUA 1RI2A 3OPNA 5HZMA 1ORIA 4LWOA 2JNHA 3GIWA 3GLIE 3RW9A 4GUAA 2ZIFA 3KKZA 5DWQA 1AQIA 2GB4A 2PSSA 4MIKA 3PS9A 5K8VA 3QOXA 4PIPA 4BP3A 3OU7A 5EG5A 1DL5A 3SSMA 3KQOA 4FR0A 3BWYA 3FUXA 10MHA 4KIFA 4R8RA 1X1BA 2PV0A 2AN4A 4JXJA 2OOBA 5DSTA 3EEOA 4R6WA 2G72A 1U2ZA 2H1RA 5DM0A 3RODA 3JWHA 5M5BA 1XVAA 1Z3CA 2V74B 5CVEA 5IKMA 2CWBA 1YB2A 3UBTA 2JH8A 4AX8A 4C06A 5JUWA 1KR5A 1DV0A 1L3CA 1I4WA 4IV0A 3HCAA 2E5WA 2NYUA 3IV6A 3G2MA 1QYRA 3NWEA 3UWPA 2CWWA 2DULA 3H4JA 2BM8A 2YVLA 3OE5A 5LQJA 3IHPA 5DTMA 3DULA 4QQKA 3REOA 3SMQA 5DRYA 5JR3A 3OFJA 1JTFA 1TW2A 2GS9A 4RV9A 3LHDA 2Z6QA 3NWBA 4OBXA 1BC5A 3UFBA 3G88A 5LQUA 1F3LA 1MHTA 1EAMA 2AOWA 2UYOA 3PX2A 3FUUA 2H5XA 2JJQA 1T43A 1NBIA 1R74A 2PVCA 2NXCA 1Q02A 2O05A 1NW5A 4RVDA 4OQDA 5E1OA 5FUBA 3EVGA 2O25A 2OO9A 3HCDA 3DXYA 3P9NA 2KNVA 3QOWA 3A26A 4KVZA 3LKZA 5EEHA 4P7KA 2QM3A 4CKBA 1B42A 3ER9A 3DH0A 3CC8A 3EVDA 4B17A 1YFLA 2O07A 4QQNA 2IH5A 1P91A 4YUZA 4E2ZA 1JG2A 4YUXA 1HT1E 4RTPA 4X41A 3UJAA 2NXNA 4CKEA 1SG9A 1WG8A 1KYIA 3CVOA 2CMHA 4IWNA 3HCBA 4EKIA 3LCUA 5KVAA 1WXXA 2FPOA 1QZZA 4GF5A 2JH9A 3C6KA 1N7IA 1QAQA 4OX9Y 2KNAA 3R3HA 4HRAA 5JI2E 5HIIA 1RI3A 1H1DA 4F85A 1NW6A 3CJQA 3HCCA 3ME5A 5LR6A 5T64A 5DX1A 2ERCA 5LQKA 3P9IA 4RWZA 4F86A 2BH2A 5GINE 1VDLA 3FPGA 4RVGA 4E2YA 1I1NA 4RVFA 3TMAA 3A7EA 3G2PA 5EHGA 1BVSA 4ER6A 4ER3A 5ICEA 5BXYA 1M0EA 5HOQA 2YXLA 3C6MA 5E2AA 3BZBA 1ZGJA 2PX4A 2ZLBA 3EVAA 1SVUA 4C07A 5E1DA 1C7YA 2YTZA 1RJEA 2Y1WA 3CJRA 3HM2A 3LBYA 4AZSA 2JZ1A 5HILA 3M6VA 4FSDA 5DTQA 2JY8A 4MQ4A 1OKSA 3I5UA 3CJTA 1BHJA 1ZMUA 1JSXA 1XXHE 1AF7A 2EJUA 1O9HA 1AV6A 1X19A 1ZHFA 1NBHA 4OA8A 1YZHA 4EVIA 4DA4A 1WHCA 1HT2E 2ZBQA 5EMJA 2YXDA 5K0GA 5KQSA 4AZTA 4ISCA 3FTEA 4HTFA 2HR1A 2LVNC 3I9FA 3LDGA 3I53A 2I62A 1XCJA 5ERGB 1WS6A 3EGIA 1G4AE 5CVVA 4NECA 3BT7A 4UN2B 1OAIA 3IEIA 1NKVA 1V92A 3DUWA 2AOUB 2JHCA 2YX1A 3EVBA 3HVJA 2LVAA 5GM2A 3F4KA 3KQWA 4QPNA 2P1DA 1JG4A 2OKCA 2EKFA 3ORHA 4RTSA 1L1EA 4RSRA 4DM3A 1DUSA 2I9KA 3BKXA 1IXSA 2DENA 3Q7EA 2GA9A 2EFJA 4CWAA 2EJTA 2P40A 5CVJA 1N7JA 2UZ4A 2MR9A 4QDJA 2O57A 5LQAA 1NV8A 3FZGA 1MN3A 4MHTA 4HTFB 5DXJA 2IBTA 3NW9A 4PINA 1XDUA 5BP7A 2PT9A 3PTAA 4F84A 4M36A 1NV9A 4G56A 3G89A 4H0NA 1G8AA 5K0NA 3VSEA 5FA8A 4E70A 4HGZA 5CD1A 2IH2A 2KW5A 3O7WA 3SR4A 2LD4A 2G71A 1ZMVA 4Q7JA 5EIFA 5LSAA 3LDFA 2FK7A 2R6ZA 3PT9A 2YXEA 4AZVA 3LGAA 5E1BA 3B3FA 5FTWA 4GC5A 3EPPA 1P1CA 5DXAA 2CL5A 1TR8A 2BWEA 4LECA 2ZWAA 4Y30A 1QANA 2P7IA 2OB1A 1AIPC 1KPHA 4RX1A 3O31A 4PYLA 2BR3A 2ZIGA 3MTEA 3DMGA 3M70A 4X63A 3KPUA 1D2CA 5K09A 3T7SA 3KPYA 1G3IA 5LQRA 5EZQA 1OTRA 3F92A 3UJ7A 3TRKA 9MHTA 1DO2A 1UIRA 5ICCA 2ADMA 3PFGA 5F2NA 3K0BA 1EJ6A 2AOXA 2AR0A 3OZRA 3SXJA 3MGGA 2UYHA 1VL5A 2PX5A 1VP9A 3GU3A 1JQEA 1IFYA 2OPBA 1TTEA 3JWIA 4XUCA 3HCEA 2N47A 2B3TA 1E94E 1YUBA 2P7HA 2WK1A 4KDRA 4PIMA 3SM3A 5FWDA 4AUKA 1SKMA 4IKPA 1G60A 4ER5A 2IGTA 2K4MA 5EKUA 3SGLA 2OOAA 4K6MA 4CTJA 4GEKA 5ICFA 2V7EA 3BWMA 3BBZA 2HWKA 3PB3A 4UOEA 4RTNA 4V0RA 2AN5A 4PCAA 2NXEA 5P8WA 2JHPA 2LVPC 3M6XA 2K9DA 1UFZA 2BR5A 2ZTCA 2PY6A 3OZSA 4HG2A 2AN3A 4XUDA 2AOTA 4BP1A 3E23A 1WR1B 3DP7A 4DBGB 4LG1A 3B89A 4PYQA 3P8ZA 4DZRA 2C7QA 3UZUA 3VC1A 2PWYA 5HEKA 4CTKA 3OCJA 3M4XA 3BWBA 4R6XA 2GH1A 4YUWA 2Z6UA 4BLVA 4OA5A 2B78A 3TM5A 1FPQA 5LQNA 3CBGA 4FT2A 3R9XB 4PWYA 5U4XA 1PJZA 2IDKA 3P9CA 2AZTA 2XYRA 1NT2A 3G2OA 4PGHA 4PGGA 1M6EX 1JSZA 3GDHA 3KQYA 3R0QA 1R6AA 4FGZA 2FCAA 2ZSUA 1EJ0A 5CVUA 3HNRA 3X0DA 4EKGA 4RTLA 3HTXA 2PXXA 5EC8A 4FT4A 4L7VA 4POOA 3I64A 1WJ7A 1HMYA 3LL7A 3U81A 2O06A 3UJ9A 1MJFA 3P9KA 1P1BA 1IM2A 1SUIA 3SSOA 4M7RA 4PYIA 2WA2A 5EMKA 1SQFA 1DCTA 3THSA 3ELUA 3A4TA 2UYQA 4RYLA 4RTRA 3Q87B 1RI4A 3BGVA 2P3LA 3KPWA 5LQCA 5K0BA 2QRVA 1BKYA 3OFKA 2OXTA 3C3PA 3TFWA 1R18A 2MJ5B 3DXZA 3KR9A 5T6BA 1SQGA 3AJDA 2G8NA 4RTJA 3ERCA 1KHHA 2FYTA 1ORHA 2HNKA 3ID6C 3E46A 4ZTBA 1QZEA 1VPTA 4P7FA 4X60A 1ZV1A 4G3OA 1SUSA 2AS0A 4FSXA 3MB5A 3OU2A 4DCMA 4EQZA 2QYOA 1OQYA 1QAMA 2QY6A 2QE6A 4FZVA 2ZZKA 3FTCA 5E8JA 1RJGA 5BW4A 2C7PA 1EFUB 5DX8A 3FE3A 3E7PA 3KHKA 2OYRA 3BGIA 5MHTA 3KU1A 2DAKA 4Y2HA 1GO5A 1WY7A 2JHAA 2DPMA 1ZG3A 4GBED 1ZKDA 2IBSA 5D1HA 4C4AA 3LPMA 1CUKA 4KRGA 5DLYA 2CP8A 2GPYA 5EEGA 2HMYB 3EMDA 2PX2A 2LTUA 1G6Q1 2EX4A 3A27A 3NJRA 4QDKA 1JG3A 3R24A 3MHTA 2VDWA 3GRRA 2FRXA 4C04A 1NW3A 3DR5A 3LECA 4E2WA 1XB2B 2B9EA 1JTEA 5D1NA 2P35A 4E31A 5C1IA 2NP6A 2YR0A 4PCLA 3FTFA 2MROB 5DFLA 5E2BA 2F8LA 3IHTA 1EIZA 3DOUA 4M38A 4R8SA 5EQJB 3HCFA 2JZ0A 5FCDA 5KS2A 1Y8CA 4EMSA 4DF3A 5EKXA 1Y8GA 3T7RA 3V97A 5C9ZA 3ELDA 2C7RA 3TKYA 3R6TA 3LDUA 3NVKI 3BUSA 1KPIA 5DM1A 1VG5A 5EZSA 4IV8A 1ZQ9A 1KP9A 1HJPA 2CMGA 5DTRA 4MTLA 3UJ8A 1G41A 1O54A 4A6DA 5K05A 1WZNA 3NVMB 1YFJA 2ZFUA 2JY5A 2ONYA 2K0BX 4QTTB 1QAOA 1FJXA 4OBWA 3IYLW 4PYJA 1OR8A 5EMMA 2DKLA 2AOTB 1TW3A 5G02A 2OO3A 2VDVE 3SVZA 3HP7A 2IIPA 3FYDA 3T0IA 3JWGA 4WVLA 5HIKA 2OY0A 3FUWA 3KQMA 3P2IA 5B1SA 4YUVA 4AZWA 3GCZA 3GRYA 2PJDA 4MWZA 1XDSA 1JQ3A 3MTIA 5DT2A 1PGYA 2RRUA 1A5TA 4PYNA 1R8XA 5HIJA 3UA3A 3S68A 3KQPA 3THRA 2ESRA 2HTEA 4V0QA 4YMGA 3MCZA 2LBCA 3PLAE 2L4EA 4QVKA 2XVAA 1JQDA 1XDZA 3UA4A 1JG1A 2P41A 4GOND 2DI0A 1NW8A 3HA3A 2OZVA 3BKWA 3KQVA 5E9QA 5FQNA 4DMGA 1X1CA 3G8AA 4E2XA 3GLHE 3DMFA 3LCVB 3FRIA 3MQ2A 5K0JA 3O4FA 1KIAA 2ZULA 1IY9A 1NW7A 5EPEA 3AXSA 3MAGA 3QV2A 5HFJA 4HH4A 1R00A 3HVKA 5FWAA 1KPGA 5FHQA 4ATNA 1L3BA 3EVFA 3PX3A 5K03A 4P7JA 1JR3E 2DAIA 3T6PA 2PT6A 1WGNA 4F2LA 2O0LA 2I7CA 1R8YA 2ZBRA 3K9PA 1G8SA 2VS1A 1T6OA 1VEJA 3ANXA 3MCTA 3L8DA 1VLMA 4P58A 3LCCA 5FQOA 2BM9A 3VC2A 1Q0SA 4GOLD 2ZCJA 2ZTHA 2LVQD 1WIVA 1KYZA 3GGDA 1ZGAA 4HGYA 2ORED 2PX8A 1NE2A 3T7TA 4PYMA 2ZWVA 1XCLA 2IP2A 3GO4A 3WSTA 1TPYA 5H02A 5CCXA 5K0LA 5K0FA 3M6WA 4YMHA 4HC4A 3TOSA 4E30A 3AWIA 3JWJA 2XYVA 3PFHA 3KPJA 4EK9A 4OQEA 8MHTA 3HA7A 2FHPA 4HEOA 1M6YA 3UJBA 3EGVA 3NDIA 1V39A 3CCFA 5K01A 1P3QQ 1ZMWA 2L2DA 2KNZA 4PYOA 5C0OE 5K0CA 3G2QA 3TPZA 2H11A 2PGXA 3B3GA 3VYWA 1YZ3A 3BWCA 3DLCA 4GOMD 3P71T 1G38A 4BY9E 4Z2YA 4HSGA 4KIGA 1RJFA 4X1OA 1XJ5A 3LKDA 4DCGA 3UJDA 1WXWA 2C7OA 2QNJA 2BR4A 3TM4A 5EOVA 1F4IA 4BLWA 2JG3A 1R4GA 4WXHA 4YV0A 5CM2Z 3M6UA 2R0IA 2WA1A 3B7PA 4FP9A 4KWCA 2VDUE 3P97A 2DZLA 2AOUA 2B2CA 4X61A 2YUIA 5KYGA 3TKAA 5BW5A 1VP3A 3A25A 3GRZA 3KQSA 2DNAA 1FP2A 2A14A 2ZW9A 3KQTA 3A7DA 5E8RA 5HIMA 5GIOE 1VEGA 2DAMA 3FPEA 5GP1A 4KW7A 5DM2A 3NDJA 4YV1A 1L3IA 2ZBPA 5F2KA 2ZZNA 3D2LA 4YUYA 5K0EA 4PONA 4QPPA 4XUEA 5EGSA 1P39A 4DQ0A 3G7UA 3OU6A 2ZZMA 3EGEA 4BLUA 4E33A 2AOVA 3C0KA 3MERA 4XCXA 5CUQA 2LVOC 3AXTA 3FPFA 4ER7A 2JP7A 2L4FA 1RI5A 5DRTA 2H00A 3P2KA 4M37A 3IECA 4O29A 3DMHA 5DX0A 1I9GA 3HVHA 4P7GA 5EIWA 3CGGA 3PVCA 3E8SA 2NNWB 1VQ1A 2HAKA 1KYWA 2BZGA 2XYQA 4GC9A 3SX0A 2PXAA 2P3OA 2PWPA 1G55A 5FHRA 3G5LA 1WGLA 3FUTA 3ER8A 3EVEA 3FPHA 3RIEA 3KR2A 3EVZA 5FADA 4PNEA 2EKKA 1VBFA 2OB2A 4RVHA 3SSNA 5E9JA 2Y1XA 2WZJA 4R71A 4CXMA 2PBFA 2G70A 3UJCA 4U7PB 3H2BA 5EVJA 1HQYE 1X1DA 3OZTA 2GAFA 1FBNA 4R05A 2YQZA 2OBFA 2EG5A 2G3QA 1AQJA 1D2HA 2GLUA 2QHOB 2ZTDA 4F1IA 3BXOA 1KXZA 2PLWA 4GOOD 4RTMA 3EEYA 1UWVA 4C05A 5FA5A 3KPVA 3LBFA 2ZIEA 3ELYA 1RJDA 2VZ9A 2JY6B 1IM8A 2JUJA 3K6RA 4KDCA 1BOOA 3NTVA 4QVGA 1JR4A 2I6GA 2R3SA 3EMBA 1L9KA 1XTPA 2PKWA 3GLFE 3DTNA 4U7TB 1YLAA 2KHHA 3FPJA 3EVCA 2IFTA 4QTUB 2IPXA 3GRVA 5E9WA 4C08A 2AVDA 3HVIA 5DPMA 4RTQA 2MGWA 1F38A 3FTDA 5T67A 2DAGA 5F2OA 3KR1A 1FP1D 5KQRA 3FUVA 3KR0A 3C3YA 5CIYA 5GM1A 3KQQA 3GNLA 3LSTA 3GLGE 3DLIA 7MHTA 2EJSA 1X1AA 2Z6AA 1HNNA 3NMUF 3E21A 1EG2A 5GOZA 1VE3A 2DAEA 2QRVB 2P3QA 2B25A 3M33A 3FYCA 4FS8A 3TR6A 1N2XA 2CKDA 5ICGA 2NP7A 3K9OA
chains in the Genus database with same CATH superfamily
2G76A 5I7VA 1XKLA 3F7NA 3LUGA 3HN6A 2WFLB 1E9VA 2I76A 4KXQA 1G7SA 4J0CA 1T91A 4EG4A 1O9GA 5HHTA 5DGDA 4CT4B 2J5BA 2QGNA 5D8DA 1KY4A 2QTZA 3CZRA 4HXGA 5TF4A 4DKJA 2VJPA 5B7NA 2CNDA 1UT8A 1MX3A 1FDWA 1H4VB 4HXYA 5KYXB 4DG8A 4TMVA 2NXJA 1WUKS 3PA8A 5IH7A 4S12A 1URPA 1V4BA 5JDIC 3I9OA 1GR0A 1IBRA 4Q66C 3HXMA 4HSEA 3M5WA 2I2XB 5EWJB 3U4MA 2R5FA 2FWIA 4DMUB 2PQ0A 1P3JA 4QT0A 4TYQA 3ZOKA 4G0YA 2DBZA 1P73A 2H0QA 1A2BA 2FSUA 1YULA 1Z6AA 4NNJA 5JQGF 1KI9A 3MPUA 1NRXA 3PXXA 3BFKA 1XYVA 2IY9A 4IXDA 2A57A 2PD3A 4CUKA 3QHPA 3KBBA 2J9FB 4G8BA 1QFSA 2AJLI 3VX4A 4Q4CA 1N6PA 2YQ5A 3BIJA 3BREA 3ELWA 1F8UA 1VG9B 1YJBA 2C2YA 3GT0A 4BXOA 5F3WB 3W8NA 2Y8EA 5REQA 1E9RA 2C97A 4HAXA 2IHZA 3BMQB 4C14A 2OBXA 3F96A 1YS7A 2GARA 4QWWA 4DLZA 5HQ3A 2EZTA 2JDID 3SAVA 3PS9A 5AJTA 2A1TS 5WRFA 2A9QA 3HWSA 2WF6A 2O6LA 3FSGD 1UC4B 1SQ0A 4LXQA 2CDBA 1W581 3KVYA 3LLVA 3SASA 1K5PA 1R5OA 1ZM3A 5CD9A 3GJ7A 1CLUA 4G97A 4KIFA 4MVJA 3WWOA 1OYVA 4EX7A 4F4JA 1BU5A 4ESHA 1A98A 2Z0MA 2XZUA 4IS2A 4G36A 8GPBA 4C4YA 4WESA 2JCBA 3A6ZA 1M6NA 4JYAM 2DXIA 1YKSA 1JS1X 2O2ZA 4JZYA 3AESB 2WU3A 1QUTA 5U1PA 1L3CA 2PPLA 1JDTA 2PUHA 2X4LA 4PAWA 4XWTA 5A0FA 1PEYA 2C4NA 3DTVB 3OZGA 3R8XA 3U7IA 4EJFA 3PLNA 3IHPA 4YJ2A 2FJUA 3I1FA 3IHWA 2R96A 3F5SA 1UJ6A 4KKVA 4A0FA 4EWLA 4RV9A 2EBHX 1BQEA 3S7TA 4JAVC 3TS1A 4FB5A 1SHKA 1DX4A 1L1RA 3CYFA 3VKHA 2NAPA 1YAHA 3FUUA 3X1MA 2H5XA 1FDSA 3SMPA 1R74A 1Q02A 4L16A 2WFZA 4BBJA 1KVSA 1W75A 2DKFA 1KDVA 2M5ZA 2WAAA 4LF5M 3ZBUA 3QU7A 4C4OA 1L5RA 4WN3A 2HWXA 3A26A 2VF2A 3O8CA 1U2GA 2PM8A 3DH0A 4DQDA 1NVKA 4RZHA 4R1LA 4MKGA 5EXTA 1YDEA 2YYSA 3WJAA 1PN3A 1E79D 2REBA 3A0UA 3TUZC 2XDYA 4LF6B 4XQEA 1L7MA 3GLSA 3Q8WA 1JX6A 3F78A 3Q3IA 1IAQA 4XDHA 3T3NA 1CUHA 3CVOA 1GDDA 2FPOA 4O59O 4DDVA 3O90A 3FCSB 1UXIA 2BDUA 3V8RA 5KHAA 1G8JA 5JI2E 4O6VA 5CLQA 1OUMA 3ZY6A 3OOEA 4DXHA 2UUAM 1NVXQ 2XDQA 4WX2B 4AXBA 2GD1O 4JKIA 3HADA 2ZB7A 4GU5A 4GEGA 2YKGA 4YRRA 5EKDA 3TR0A 3UMFA 5JAUA 4JLWA 4LOKA 4KRFA 1DPFA 3SAJA 4L2IB 1ISRA 3KSUA 3KZ1E 1HLPA 4XJXA 2ZKLA 3CF6E 3FOZA 1Z62A 4QT4A 3RVOA 5EHZA 5CDHA 3C5HA 4C07A 1QZUA 1YMQA 3CRNA 3WNBA 4D57A 3MJTA 4RV5A 5SV2A 2Y4NA 5AXBA 1GJSA 2HBYA 3IH5A 4D9EA 2GEDA 2IEAA 3TBKA 3WRWA 2NO6A 2YRXA 1EXVA 4MRPA 3L0OA 3RAGA 4ECEA 2I4RA 1ZVJA 1I2DA 4Z49A 2A94A 1JE0A 5LCXA 4N6NA 4JX8A 2IOFA 2QR5A 2ZYAA 3AG5A 2J7PA 2JI9A 2Q3HA 1Z4QA 2J48A 4C6HA 1BKSB 1GITA 1SMKA 1BXZA 4EY8A 3O47A 2EL9A 5PGMA 1CEXA 1ML4A 1YRYE 1RP1A 2FF5A 2BMVA 2IOHA 1IJEA 1ECGA 3PC8A 4ZAYA 5FI0B 3RKRA 4XASA 4J91A 2K7FA 5BR7A 4N3AA 3NCHA 1GZ7A 5TDHA 2JHCA 4PQGA 2FCRA 3BXFA 4HVTA 2R9VA 1HE8B 2DPXA 1L8XA 4TKVA 5ITYA 3GJRA 5FH9A 5FX2A 1LY1A 2YS6A 3HDVA 4LNHA 3R7WA 4NCAA 4NE7A 1FNNA 3LO8A 1KBQA 3A3YA 2BKEA 3LSYA 3Q2OA 3ZU3A 1PAUA 2Y0TA 2PANA 4AJNA 2W6JD 4TZ0A 1EGQA 3H99A 3HXLA 1GPUA 1W1UA 4CCSA 3CE9A 3BIFA 3DO5A 2EYUA 5BVHB 2H51A 2OR3A 5CG2A 1ULZA 1VE6A 5JPCA 1KE1A 3G89A 3LNCA 4E70A 2KI5A 4ESOA 3NLLA 1FFAA 4MGKE 1OBCA 3G5MA 1EE9A 2PLNA 3H2HA 4FOOA 2BFPA 3WFZA 1XFAA 3B3FA 1UBMS 1GQ2A 3FTPA 2EQAA 3SVTA 2QV7A 1Y4ZA 2XOXA 2FSFA 4DSNA 2P62A 3HYCA 2W42A 1KPHA 2PMWB 1E6CA 1YR2A 1O96A 3RVRA 1NQAO 3I05A 2GCEA 1G64A 2W6ID 1XA0A 1SQ5A 2DFVA 4RK1A 1A8IA 1CEEA 4FHZA 1FNSA 1EJ6A 1Q16A 4NKRA 4NFLA 3GZTB 3HZRA 3V34A 4M1QA 1GUYA 2Q3BA 4WEOA 3UWKA 4JI1M 3ECAA 4KOEC 2R4EA 3B5JA 3WWCA 4PIMA 3EEQA 5KZMB 1SKMA 2IWHA 3VSCA 5I4KA 4R41A 2FPIA 4B6PA 2Y1GA 4J9UE 1FSPA 4TPKA 1R16A 1MJGM 1CJUC 1PLKA 3DFFA 3FLAA 4PO9A 2AN5A 2H1LA 2FZVA 5K3CA 4BZWA 4XPIA 4D02A 4D3YA 1SUCA 1UFZA 3D7SA 4D8VA 1U2SA 4HDSA 1ODLA 1GFSA 1POXA 3ZH2A 1KWGA 4MQUA 3VC1A 4BMYA 4HGPA 4WBNF 3QE3A 4C4ZA 1E60A 4DGSA 3PPXA 1OXMA 2B78A 4OHPA 4YN3A 3CBGA 3TM5A 5DM60 4PWYA 2IIVA 1LNSA 3HUEA 3N8IA 3QVUA 3SXPA 5E6RB 4PGHA 5C80A 2O48X 3QSGA 1R0XA 3T9AA 2I80A 3BBPA 3H3JA 5FWNA 5J2UA 4KUHA 1JLMA 3HTXA 4WUVA 2V5AA 4EKGA 2PXXA 2X3FA 4L7VA 4OATA 4J2TA 5JSKA 5TEVA 4BQQA 2APLA 1Z7GA 3GFVA 3ITKA 4YAKA 2ZAMA 4MA4A 2H48A 2HJVA 5CYFA 4C7BA 1B26A 1U3WA 3BRWD 2P1RA 2RI0A 3FPSA 3NV7A 4BNIA 1WE2A 4Z4HA 1HEIA 3QUCA 4YRGA 4KQWA 4D5GA 1E8MA 4P86A 5LQCA 4OXQA 2R751 1PJCA 2QX7A 4GH5A 1Q1GA 1TIBA 2AA3A 4TMYA 3EXG1 3G5AA 5AI6A 3KJIA 5CFQA 2C96A 4ZPXA 5E26A 1V96A 1Q17A 3PQFA 1YK0A 4B31A 4BV9A 3JATA 2PL9A 4JOQA 3F90A 4WZ6A 1TC1A 5JBQA 3EDOA 3SHTA 4MPJA 5I47A 1P6QA 2YJ3A 2BL4A 1DARA 2QE6A 1OWLA 3T3DA 3VNUA 1L4NA 3R9XA 3OPMA 3NXKA 4HFMA 2Q5IA 5EHNA 4I5SA 1L7OA 4PVDA 2J4CA 4DLAA 3RTBA 3PNYA 2RHWA 2ES4A 2IYLD 2P30A 3TZKA 1SBCA 3B38A 1D3AA 1GKLA 1XRQA 2M2IA 4MEBA 1LPOA 1P18A 5FR1A 3ZD8A 2H1WA 3ZHTA 1CUKA 2FFAA 1Z0IA 2YWXA 2B35A 2XOKD 1KMMA 3CKLA 5EEGA 2XTMA 3UFXA 2EX4A 2FFBA 5HJ5A 2B37A 4UMFA 3R7FA 4ARZA 4XIJA 2BEUA 3NR2A 5CXXA 1N8NA 5ECGC 2ZRGA 2ADFA 2SKDA 5C1IA 4MA5A 4TVKA 4PCLA 4KLNA 2FN4A 3UUGA 3GD7A 1U2PA 3CKMA 1EIZA 2QAIA 1VRCA 5D86A 4TMKA 3EW9A 4Q9IA 2ODEA 3U3DA 1YCGA 5JVDF 4EBBA 1ZJ6A 5JROA 1XTJA 3FYHA 3PUXA 2COKA 1XTRA 1LSJA 2DHEA 1QP8A 4JI6B 2LIVA 3VQTA 1CBUA 4B2IA 5BPFA 3PJRA 2ZE7A 5D6OA 1YJ8A 4MR7A 4A8JB 4RHUA 5M04A 3JQFA 2RHGB 5EZSA 3LYHA 1KP9A 1J5PA 1XZLA 1EE1A 2BFEB 3JWPA 1QRAA 2DH5A 1QIFA 1WZNA 3KVRA 3NEPX 3I4YA 3NVMB 2HIHA 4KI7A 5DIFA 1I7PA 5THKA 3RTDA 3EXFB 3T1HB 3UWSA 3D31A 5DSZA 2ILVA 5IMSA 2ACWA 4O2BA 5ITUA 5EYPB 4X65B 3P9RA 5EWMB 3FUWA 3NTQA 2N1BA 4QJ4A 3TEMA 3GRYA 3H11B 1KMHB 4AJIA 2FMHA 3BTOA 3HJAA 4YBZA 5IT4A 1LTHR 5LIPA 4KNYA 1U9CA 2ZBEA 4UBNA 3DPIA 4N48A 2ESRA 5D87A 1XD8A 2X9NA 4QYSA 2ZM6M 4XGQA 1RRVA 2CCKA 2D1RA 1YQXA 4QVKA 2H1FA 2R65A 3W9BA 3Q8GA 4U6NA 3WYEA 4F9GA 1JG1A 3SU8A 1C7FA 1J2EA 1QGUB 4DPMA 2GBLA 2V4MA 3ZEAA 3DL4A 1BMFA 5DEIA 3UO8B 4G0XA 3ZHQA 2WWIA 5CJ2A 2BBWA 3O4FA 1QKJA 3M1LA 1N2CB 1T6YA 4N40A 4WOJA 3RFWA 3Q1LA 1OXSC 1GFZA 1ZEJA 3RGSA 2ZJ5A 3HUUA 2QD2A 4CGYB 3AR8A 4PRZA 5FWAA 2P0EA 5B6JA 4MJLA 4ATNA 4AKIA 4PZAA 5J40A 2F2TA 1QIEA 3DGEC 4NV0A 4JLPA 4XR9A 3AUYA 1XMJA 2QP9X 2GLTA 2AMLA 3J81k 2IS6A 2ZREA 3HACA 4LMBA 3KEMA 5F7XA 2XNDD 2IYUA 5JNTA 4YTEA 1ETHA 2PT7A 5JD3A 1M33A 3ZE9A 3WSTA 4V0ME 5H02A 3DSRA 3RUIA 2FB9A 2OP0A 4ZICA 4N18A 1OD6A 4RKWA 1YK1A 2V1XA 3DFKA 3RFCA 1LB1B 2NU6A 3CUTA 3RUDA 3OC0A 1H4QA 2ZE6A 2QZSA 2WMNB 1SQ6A 3CCFA 2X8LA 4KACA 4NFSA 4E7OA 2IA5A 1HETA 3FMOB 1J8YF 4KAFA 4TSFA 3W05A 3FPAA 4G67A 1I51A 4Q7MB 2VDNB 3OOYA 3RK4A 2BD0A 1QK5A 5A02A 2G0TA 1YZ3A 2HLPA 4MQEB 4B6SA 5FUMA 1YSCA 4V0OA 4C6TA 1XZNA 4Z3KA 1SO8A 1HYQA 4X7PA 3T35A 5A0TA 1P17A 5B53A 5A9SA 2G80A 3CNNA 1WHSB 4C1NA 3IVGA 2ISSD 3K6JA 3FROA 4R1MA 4I50A 4FP9A 1NJGA 2JL1A 3CW9A 3FLBA 4K46A 1WSAA 4OHMA 5DDIP 4DSZA 1PT5A 3V7YA 621PA 4E03A 1DC5A 5D7BA 3JYQA 2Q07A 3VO2A 3WB1A 4WZBA 4CVNA 4MYDA 1KSHA 5AKIA 1AGYA 1YZVA 5E7JA 3FPEA 5E0KB 2QG9A 5GP1A 4XPIB 2C29D 2X2OA 4MVXA 3WK9A 3KFXA 4HEQA 2XY4A 1TZJA 5KTYA 5L6LB 5IWAM 3EG9B 2EERA 4UAJA 1SNYA 4DDUA 3D5EA 4DQ0A 3GFGA 4X3CA 3IUBA 4M1TA 2AOVA 4TL6A 4ACAA 1IM5A 2FQWA 4CIWA 4N3CA 3B7WA 1UQTA 3HUTA 1RRFA 2ORVA 5BN3B 1HK7A 5GADl 3T1QA 1P7CA 5CH8A 3T6KA 5IM4A 3QUSA 1ZMXA 1U9JA 2VDLB 5BMVF 1CS4C 1KMHA 4PX9A 3VA7A 1PS8A 4JU8A 2YY5A 2XYQA 1S2IA 3O84A 1BH2A 1CY8A 4N49A 2YC4C 3IR7A 1KBOA 2QRZA 3ER8A 4XLLA 1Y9AA 2VRBA 1NOJA 3H42B 1HDXA 1SA0A 4NBLA 2EKKA 5EY5B 4G2TA 4AU1A 3GN1A 3D7LA 5JEDA 3ESAA 2WSSA 1CQIA 1XX6A 1RQ2A 3B36A 5G41A 5U4QA 3FYUA 4C2BA 4R01A 4R9RA 3KQLA 1Q14A 2BEVB 4NEQA 3JR4A 4IBCA 1G8HA 3BMCA 3LVWA 3B1YA 2D7JA 4I46A 1QUSA 4PR3A 4LY3A 2CD9A 4BQEA 2GN0A 1PSDA 2AUMA 1CT9A 4MCJA 1ILWA 4DADA 5KQMA 4LF7B 5KCMA 5EN4A 1O57A 1VGQA 3IXLA 4P08A 4R2IA 1QHHA 2R1VA 5F3WA 2VTEA 3QFFA 4J7AA 3KJHA 1C30A 3ZHCA 4XH9B 2RK3A 2YFKA 3GHHA 3T12A 3LL4A 1HFJA 1XQXA 4OHYA 5K8UA 5THXA 4W1PA 5DWDA 2I55A 4MM3B 5LMNM 3VU8A 4K9LA 4NRWA 1KZGB 4EEXA 2JPDA 1RADA 5MFPA 3BXGA 5HZGA 2WYIA 1DZIA 1QDEA 3LY7A 4FYKA 4E5UA 4PPFA 1R64A 3KR0A 3QUBA 4YRJA 3H13A 1QH9A 5CB6A 3GNLA 3U3OA 4X00A 5IZ7D 1YDMA 4IICA 1JG7A 3ASUA 1TH2A 4DPKA 1GWNA 1YZUA 3IEPA 8LDHA 3QF4B 1OYYA 3V3TA 1O5IA 4HLQA 4MKHA 3K9OA 4WKPA 4K03A 3S28A 1X8JA 1SN7A 2OXEA 4MQEA 5F3DA 3DBLA 4N0MA 4PYKA 3OPYI 1CK4A 3CV3A 4YCCA 5BMOA 4U2BA 4TM8A 3GJ5A 1S0UA 4DT1A 2I3AA 5GGYA 4E5DA 3MWDA 3SR3A 5ALDA 3A8TA 4ITUA 3J7BA 4RDXA 4XLZA 4LZOA 5L4NA 5EUCA 1O6FA 3LI2A 2JKVA 1HNXM 1IXKA 1L8LA 2ZK7A 4LVNA 4KLAA 4QBFA 2O19A 3WE7A 1LDBA 1EWVA 1U0EA 1BE8A 2DBQA 4HNUA 3OTOM 1GOTA 1NF9A 1NLMA 3PGXA 2IDJA 2WFMA 4DJDC 2JGEA 3HRKA 4HBGA 2NGRA 5FULA 3RVJA 3WR5A 1U65A 2HMUA 3A06A 3DUFB 2QRPA 3JYLA 1YCHA 1UODA 1N8TA 2YHSA 4NOMA 2ONZA 4AZ0A 1ORVA 2FSSA 2XUDA 3GRUA 2YVQA 2II6A 3DV9A 3OPNA 3D3WA 4S1NA 4PGAA 4C7KA 3A6FA 1J42A 1I4EB 1U7XA 2FEWB 2WUDA 2WUWE 3BMNB 3B9RA 1D0KA 2EFDB 1P8AA 2W6OA 3S2FA 3U3MA 2B20A 1IUOA 1E3SA 5DK4A 2RBGA 4L4YA 3DMYA 4B47A 5JS8A 5F51A 2EARA 3H9QA 3U3ZA 4AO7A 1SBTA 2VPYA 3UIEA 4JOCA 3WIEA 4NRDA 2RGWA 4WOKA 4Z4EA 5F1KA 2HH9A 3G9TA 4PZLA 2BGUA 1EFKA 3HY3A 2N35A 4MKRA 2LTAA 4UD6A 4Q1BA 1U1GA 2OOBA 2NW6A 3FMIA 5DSTA 3ZK9A 1JAXA 3PC2A 3TSOA 2QXYA 2HL7A 3TXXA 1F8FA 1S02A 1JMKC 1NOIA 4OJTA 2JFPA 4Q3KA 4QU9A 3L0PA 4BX3A 5BR1A 1HOTA 1IMOA 3IURA 3UBTA 1K2VN 2FFQA 1XMOM 5DTEA 1FMTA 2V0GA 3HUDA 3CU5A 4KTTE 2XSZD 5K3FB 1MVLA 1XZFA 2BM8A 5FO1A 4B3HA 3HXOA 3ZBQA 3IDQA 4OYHA 2PS0A 1Z0UA 1KI2A 2Z6QA 2B83A 1P45A 1YVUA 3RG8A 4G5GA 2C9MA 1GNLA 5IT9S 3TDKA 5BY2A 4CKCB 4UJ3A 1AXRA 4AMVA 1X7WB 3UNXA 4GBGA 4S1WA 4YY3B 3LC1O 4FOLA 1WNFA 2O25A 2MSNA 3M6AA 1J8DA 3LKZA 2YOGA 4EKDA 5IBCA 3ER9A 4MQMA 2CY0A 3UJNA 1Z4IA 2VHUA 2O8DA 1JFLA 1YKGA 1CUEA 4NE2A 4PNPA 3OTIA 3ZVNA 4BUCA 4FUTA 4DGQA 1W36B 1HE1C 2ZR7A 3HYTA 1UJNA 4R84A 4KXFB 3RVNA 2FNAA 2Y67A 3NBUA 2IHVA 5BSHA 3VXKA 2AZ4A 3ZX5A 1C4XA 3C2QA 3HGTA 4BGIA 4EG5A 1VGRA 2PE5A 1M2VB 1O0BA 2OCDA 4DHEA 5LR6A 3W8EA 1Y1PA 5KNBD 2EW1A 1PLLA 3WMWA 4FQ5A 1TM3E 1IXRC 3QLEA 1QNLA 3IUJA 1PGOA 1EVLA 1AUPA 3OZDA 1SEPA 2IZOA 1EX9A 3JQFC 4NI5A 4X7BA 3LUCA 5CDSA 4RY0A 1UZMA 4EELA 1U5BA 1JP7A 1Q3HA 1Y89A 2PX4A 2WMOB 2XB9A 2Z08A 3QLTA 1CNEA 1G3QA 2QAGB 1LC3A 1UAAA 5F9FA 3HM2A 1C9DB 4XARA 4XTCS 5FOXA 4CPDA 5IXJA 5L3SA 4LJYA 1DFHA 4P4GA 5DCYA 1OKSA 3Q5DA 3RIMA 2QDXA 1XXHE 3L27A 2YV2A 4P82A 1RWWA 3QBTA 1EHCA 3WLEA 1Z34A 1NZDA 3EWAA 2EFGA 4OA8A 4YRFA 2M6RA 1Q1ZA 1B8UA 3AM3A 2FSPA 4CTNA 3GUYA 2MIIA 3HCRA 4Q37A 1W88A 4U2DA 1MO6A 4KSBA 4NOOB 3HSYA 4O0MA 4JI4M 1DELA 1TQ6A 3EXAA 1WOMA 3L6CA 3SARA 3QI2A 4QHYA 1OFVA 1OAIA 3RT9A 3C87A 5AJWA 3W0LB 2AOUB 4PSVA 5T4FA 3WB0A 4CM6A 5HKOA 4JEUA 1P7VA 2ZWPA 4REMA 1E5DA 5FORA 4BQNA 4EW3A 3F3SA 4L78A 4N12A 3CX7A 4JJZA 3VAZA 3CLTD 3N0VA 3MNFA 2O4UX 4QU8A 1NN0A 3VR3A 5CEFA 4O5AA 2QTHA 3O94A 2EJTA 2XF8A 4M0WA 1BDJA 4EA9A 4KN9S 4MK4A 4CFZA 4MKIA 4JN6A 2QIOA 3B1XA 3QOFA 4AJ9A 1WMDA 4PZCA 2R6DA 4BKRA 3RTEA 3LIIA 2L0XA 3A2LA 4F84A 5J4LA 4M36A 3VSEA 3GRAA 4JLOA 1FLAA 2G71A 1T3TA 2YWRA 1ZO8A 1CQJA 3WX0A 2GX6A 3O83A 2EWWA 1RBZA 1NBAA 4PU0A 2FR1A 1HZZC 3LGAA 4E21A 3K71B 2ZU6A 1FFXA 3CZ4A 1PO7A 3PLRA 4Y18A 4P54A 2EBUA 4KIUA 1Z4KA 4MPTA 2ZOSA 4Y30A 4QQFA 3DR3A 2OB1A 4H77A 3B78A 3ODPA 4MLZA 2V55B 5AUQA 4RX1A 1FXSA 4AF8A 4F8EA 4LRYA 5JNWA 1V1RB 2JB9A 4GE0A 1R88A 3DZGA 3M70A 4X63A 4YI3A 4Y6SA 3W5VA 5LQRA 1WCXA 3CVVA 1T6XA 2WJGA 2Q6LA 1K89A 3F3YA 4KFTA 4OGWA 1EESA 4JMPA 5ICCA 1R4MA 1XCBA 2WG2A 4BPBA 2CV2A 4FEAA 3CTPA 1KFKB 4XIIA 1W19A 2A9OA 4FYJA 4O1IA 2VG8A 1L9XA 5BUZA 1RU3A 3F6RA 1IFYA 3GFTA 2NNLD 4RKYA 5DTJA 1DWPA 4QODA 1JZTA 2EIHA 1C3VA 2EOAA 3AESA 3JQBA 3PE3A 1RW4A 1S2GA 2P7HA 2P9ZA 3KZMA 4KLRA 4KVGA 4Q7KA 5EJGA 5F7JA 3ESRA 3RVLA 4IDBA 1AGXA 4JJGA 4ER5A 3TXYA 5EKUA 1GQYA 2QU7A 4QEDA 3CO5A 3QVMA 4HATA 3N0WA 5DCLA 3W8DA 5JAPA 1SHLA 4FONA 4B8WA 2UUOA 4LDAA 2QF7A 4N7MA 2JHPA 4WCFC 2YCLA 6YASA 4H17A 4XK8F 3PEVA 1XU4A 3C8HA 4LOAA 3PITA 3TJRA 2FOXA 3CVWA 3O26A 2BFCB 4JJEA 1HT0A 4PF1A 1EYZA 1VSBA 1NZJA 2BMFA 3QY0A 1VSQA 4A0QA 1EB8A 4D9HA 2EZ9A 5JMTA 1QIHA 2CZGA 4IFIA 1YASA 2WHPB 1KY5A 5LQNA 1Z17A 3V7WA 3H84A 3ROEA 1G21E 4JXXA 4E5MA 4DCNA 3ILSA 2YWFA 1NI4A 1ZD5A 3UXHA 3DEHA 3FHLA 5LYYA 2GGSA 4POOA 1MZVA 1CDEA 1HMYA 2D1TA 1LK7A 1TTQB 1TCCA 2XKJE 1RNLA 3FMFA 4GI3A 2I87A 1WU7A 2C5AA 4B45A 3L4JA 3F49S 3F3KA 3HO1A 3FHCB 5JTUA 2UYQA 2YCBA 2HT1A 1FP6A 3WSWA 4DMLA 4PX3A 4DJ5X 4K26A 1EHYA 3C3PA 3FSRA 3ICWA 2OM6A 4M76B 1QOZA 4UHKA 1BS2A 1LLCA 3VPDA 4ZGGA 2XE4A 4TM7A 4G86A 3TW8B 4GHWA 4Y2SA 5AJZA 3ZYZA 3ERCA 2QKYA 4J7XA 3BT7A 3Q3VA 1TMKA 4ZAVA 5CP8A 4DMMA 1GR1A 1NNLA 4FSXA 3VHXA 4YCSA 4ZI7F 5EERA 4DRXB 4J2HA 2MSKA 1GZ5A 1QCZA 1IRXA 2Y0BA 2NT4A 1BXRB 1CHDA 3H5AA 1XCMA 3LIPA 2E48A 4HLQB 4QX6A 2DZDA 1CU1A 3BHNA 5BWNA 1FVOA 1GA1A 3BJIC 1JECA 4I5GA 4B46A 3G13A 3J7AC 4OGFA 3SZMA 4GKVA 4BO8A 1ATIA 4G5FA 4RA6B 3U7QA 1B8OA 5EWJA 4JC8A 2Q6OA 2YWHA 4JBXA 4C4AA 4I1YA 3QELA 4JOBA 5IKPA 4W1RA 1S5PA 1YBFA 1Q0QA 2HMYB 4QYXA 3TZ6A 5K4GA 3A27A 1WBJB 2VBGA 2IHTA 1JG3A 2WT9A 4B84A 2CVQA 1TKCA 2XUAA 2CVPA 1XB2B 1JTEA 4AMYA 5TIIA 3G59A 4GLOA 3QI7A 5JBNA 3ZDRA 4QXMA 4TKLA 5BSWA 4QGGA 4IQGA 3JVEA 1ZD4A 4QDTA 2PAFA 1K6JA 1NF2A 4XYBA 2ZDQA 5AW6A 1FMLA 1Y8GA 4YJDA 3DEYX 4YJKA 1UBTS 4KK4A 3WGZA 1DRUA 2NLOA 4ITRC 3TD6A 1TDHA 3M7IA 2I2BA 3DE1X 4BJ5A 4MW5A 3VYVA 4C0AC 3Q40A 3RSOA 1IBMB 2HGSA 4I66A 1FE8A 4OCZA 3H4TA 2QVCA 4TZ6A 4CV1A 1QV7A 4LXYA 1DBSA 4IXTA 1FDOA 5DW3A 3U6DA 2J6CA 1EFPA 3EGCA 3N5KA 2ZIZA 1N32M 3WLLA 2VDVE 2QTFA 1N36M 2IIPA 4QVGA 2OV4A 3FOEC 1L6IA 2QI9C 2QPOA 4RO0A 1X1QA 2QT0A 5EIBC 5DBOA 4Z8XA 1BFDA 3RG2A 3JXEA 3LCMA 4ZJPA 2QTTA 1XTTA 3KQPA 3N6XA 2PZKA 4GOXA 4IH1A 1A2QA 4I50B 1FCJA 4ZVRA 3V1UA 4YAGA 1GSIA 3E5HA 2WB4A 2WPNA 1Z0FA 3R6LA 3OWHA 4KPEC 1YR1A 2I1WA 4EI9A 3IV9A 4IEEA 4QOJA 3BB1A 1U9YA 3UJPA 2V65A 4RH1A 4UEWA 4XSVA 5IJWA 1LSSA 5BN1A 1VXRA 5AXAA 1ZC4A 2YFYA 3SHVA 4X92A 3PIRA 4M8SA 3BH7A 4Q3LA 4DMFA 2DG2A 4O4IF 1FUIA 1FP4A 1K27A 1XLTA 5D5HA 4CMGA 1G6KA 4HH4A 1HH4A 2ZWMA 4F2WA 1XEAA 3EVFA 2HTFA 4C2AA 1R12A 4CNQA 3T6PA 2C92A 1L1FA 4IGIA 3U6KA 5H3CA 1IDN1 3QYAA 5IJ0B 2NG1A 2VUHB 2ZJAA 2XT6A 4YRPA 3AJ9A 1SBNE 4BMVA 2NZVG 1KYZA 1NMEA 3DD1A 1E8DA 1P0IA 4GXQA 2BLLA 1SUPA 2PSHA 1GCOA 2QTBA 4I8OA 2WU0A 1PT7A 3GQBB 2K6BA 2DVMA 3JZDA 1W5SA 3IB6A 3A11A 3I2JA 3IQXA 4J4TA 5FFMA 5EHXA 4HEOA 5BV8A 4HBZA 3OQVA 4RVOA 1UBSB 3RANA 3V1NA 1C1DA 2PZGA 4LXTA 4F1JA 3X1DA 2KNZA 2SECE 1LWOA 4PYOA 1UP4A 5D3MB 4B6GA 2CSUA 3LJKA 4DR7M 2D59A 3D64A 4UTRA 3UXMA 1GAEO 4ZCIA 3HJTA 2XZTA 3M34A 1P5FA 3BWCA 3VH2A 4GOMD 4O4LF 2FZ5A 4ZQEA 1OHHA 1XROA 1O77A 2AF3C 4BLWA 3TM4A 1MOQA 5C34B 1C7ZA 2CL7X 4GPIB 4CMAA 5I4CA 2HSZA 2QD1A 1SFRA 3PXEA 2D7DA 4NXNM 2L6OA 1OBFO 4N5MA 4AKHA 4XX0A 1P80A 2UU9M 1LW6E 1A7UA 4WCVA 1E1CB 2A14A 5B57C 2ZCVA 3FN4A 1HYBA 2W11A 3KIPA 4UBKA 4KW7A 5DM2A 3ZDYB 1MCZA 3PGA1 5FPPA 4LFAB 1S3FA 1H3EA 3UOGA 3ILVA 5EGSA 4YIHA 1SA0B 1Y5LA 4B76A 3AEZA 3HJ8A 2BELA 4HJXA 1KOLA 4NTZA 3ZGNA 1VYUA 3WLNA 4OHCA 4LGVA 3UJCA 1RI5A 3DVAB 1PEAA 1CZKA 2CMFA 3WL8A 1ZM9A 3CR7A 2C82A 3W3AH 4ZFNA 5K99A 2XD9A 3EZ6A 4NQRA 4QBHA 4LHVA 4QJBA 4J0FA 1B74A 2PXAA 4KYIB 5BN3A 2IXTA 1UXOA 2FS1A 1CUWA 3H6GA 2Z57A 3A3KA 1IHDA 4MWBA 4Y9SA 5CT4A 5FUVA 2XB2A 4DM4A 4JYZA 4I36A 4HQ6A 5LB4A 2WILA 2OB2A 5KKAA 3B53X 2HXSA 4ZAWA 1UPCA 1YNOA 3HY5A 1J33A 3T1HM 2EF0A 1LX6A 4NG4A 4NESA 4Y2UA 9ABPA 3IHLA 4CQMB 1L7QA 1TU4A 2GAFA 3CX6A 4TMFA 2YQZA 2AG6A 5K45A 4M9ZA 1ECBA 2PX6A 3JWEA 3PHHA 4FZ3A 2GRUA 3JYPA 4HH1A 4MITA 3IAAA 1JJIA 3BXOA 3FHTA 5FNVF 3PCTA 4REOA 1J0EA 2Q0SA 3OLQA 4NX2A 3M8KA 2IEDA 1BN6A 1L6RA 1DAPA 2VZ9A 4DCMA 1BGVA 2WJ3A 2VPIA 3LBAA 2ZR8A 4DSTA 4N1AA 1Z75A 4OJMX 3T1NA 4C76A 3STTA 1X3LA 4U2FA 1K6EA 3WICA 5L9AA 5LP1A 1W85A 3HVIA 3THGA 3B82A 3HHPA 2XRFA 3T4XA 1ONBA 1EP1B 4HEJA 3IOCA 1XRMA 1LRLA 1A7JA 2GSDA 2VT3A 1U0NA 3MLBA 3STHA 5KNDA 1X1AA 3N76A 3F5FA 4Y2XA 1YZYA 3E21A 4DDWA 5A1JA 3DFZA 1U0GA 2QJOA 2AD5A 2X14A 2FZEA 2R48A 3FG9A 3K4QA 4P7JA 4ZVUA 2B82A 5ALPA 3LOPA 3N6VA 4RZSA 4MUEA 1U0LA 4W9RA 3UB4A 5BV1A 4NQZA 4P32A 1QRUA 1H1LA 2XODA 4EMUA 3U49A 1L7NA 4HWPA 5KTOA 1WVGA 2CLLB 1XU7A 2V0CA 3Q7PA 3LX5A 1DMSA 5IWAB 5DLQC 5G2OA 3QYPA 2D62A 4W8OA 2GESA 2HHAA 3H5NA 4GS5A 3MMPA 5I9BA 3ZIAA 3TLJA 1CCWA 1XXHB 1M2OB 1VIDA 3LUFA 3QLVA 4B4WA 4Q39A 2DFTA 3AR3A 2J46A 3OJ0A 3ZHZA 3Q5EA 3OF3A 4A6EA 1QHFA 4R8LA 4AWXA 2OV1A 2P78A 2HMTA 4X1IA 2ZUUA 2YJZA 1WW3A 2XZOA 3A9RA 3R6DA 4F21A 2C4KA 1L5ZA 2YRFA 1LPBB 1VI2A 1WVIA 5T7BA 1T9GR 1OIWA 1NW4A 3PJFA 4U2KA 3AY6A 3ZV3A 4ALLA 1VKJA 1IPEA 4B7AA 4FWGA 2D7EA 3U5TA 1QNFA 4R0NA 2AFIA 4JQYA 4LRSA 3GQ3A 4WK0B 3FVWA 3PIDA 2HRDA 4QEKA 2GBFA 5AUNB 4LC1A 2D2VA 4YAWA 4V02A 1LS6A 3MJCA 5T4BA 2WTXA 1FX0A 1G5HA 2WBLC 1WZCA 3IHKA 4CIVA 3GLIE 1JIQA 2B9VA 3ZLVA 3H3XA 2EL7A 3S70A 3FRJA 1QRRA 1NDHA 2C0PA 4EMTA 1YZNA 1TAHA 4BNNA 1EXWA 4YHBA 2XIJA 4YRNA 3F7TA 1QQWA 2LKDA 5FNVA 1EIJA 4XGKA 4UTOA 4X20A 3FUXA 3KOWA 3OZFA 3R9KA 4V0SA 1LK0A 1ZESA 5ALFA 4Q3EA 3HBNA 4Y9DA 1RSZA 3VZSA 5HKKD 2EX0A 2L82A 2GRAA 3KYCA 2PKRA 3OIDA 4IZIA 2FWNA 1KKMA 2OCYC 1GVHA 1R8SA 4WHMA 3ORRA 1DV0A 1CJSA 5JCOC 1C80A 1FY2A 3HL0A 3G2MA 3UWPA 4CR7A 4F8JA 2BUAA 1YZKA 5I4BA 1PKEA 2Y20A 2ZYHA 3ENZA 2YXNA 1TYZA 3EFEA 5IKOA 3SMQA 3OFJA 4YT4A 5AW5A 1JTFA 5IANA 1N2SA 3BXZA 5BW8A 3NWBA 3V6LA 3Q0IA 3RQIA 3RVSA 2YS7A 7GPBA 2D5AA 3L0SA 5AKXA 4Y9RA 3VH3A 4G0PA 3CUSA 3CT4A 3BTVA 2VUTA 5T3YA 5BOVA 2MCFA 1O6BA 4KXWA 3T5MA 4F9TA 3JYNA 2CFOA 4OQDA 4X95A 3S5UA 3KW6A 3HU1A 3N8DA 4GE3A 3DXYA 3OFSA 4D0RA 1RQPA 1IXSB 1FFYA 3CG4A 1Q7GA 4L7QA 4BGEA 2DQKA 2DUUA 2J85A 2IV2X 5E95A 4JH0A 5IHPA 1NO1A 4GIPA 1TA4A 2C99A 3MS4A 3C39A 1HT1E 5DNWA 3E15A 2LWXA 2PGDA 1AKTA 3OLCX 2BE9A 5C7IO 4OSEA 3MRXA 1WG8A 4IWNA 5IDQA 2HA2A 1J8FA 3JW8A 1B8NA 3QYEA 4S2EA 1R6UA 3OQPA 2Q3LA 4GF5A 4UBMA 1N7IA 3RS9A 1R9JA 2DLCX 3X43A 5KTSA 3A4YA 5CH5A 1RWPA 4BL5A 1EWKA 3CJQA 1J2RA 5BUQA 4R16A 4JROA 5DX1A 1ZHHA 1YV9A 3QTBA 4F9EA 4B40A 3OT1A 1Q1NA 1U0FA 2AG8A 3TN7A 5FTJA 4DFDA 3IL2A 4ZOCA 3D6MA 1SCAA 1QB7A 2ZB3A 4ZODA 3C6MA 4J29A 1VKHA 4GI1A 5E2AA 5FPQA 1YRHA 4RKQA 5AVTA 3EFHA 1C7YA 4FKBA 2O2IA 3ZCBB 3IILA 1B43A 3U3KA 4LK2A 4RPGA 5E6SA 1KJNA 2WKPA 2ZGVA 1SBHA 2I9PA 2NACA 2VI5A 3PQ2A 4D3DA 1AMUA 3KXEC 4DA7A 1AZTA 4GGPA 1Q92A 1J09A 1XTZA 1XEWX 2Q5JA 4O0LA 3KQUA 1IHYA 2QSYA 1ZN7A 4PPYA 2P6RA 4Q3OA 3LAWA 1JJBA 2RE8A 4A8HA 3IBYA 2VYQA 4MUKA 4UCXA 5ALTA 2EIXA 3DDUA 4BMNA 5AO9A 1PHPA 2QRGA 1GGFA 1O6ZA 2I62A 4A91A 5JQGA 2ATVA 4MGEA 2CW5A 5AOAA 1TQ4A 2Y1LA 3B5EA 4DCGA 1U2QA 1VIAA 4KTVE 1G8GA 4KG7A 1RYHA 3V4RA 4AUNA 3AERA 3PVSA 2IDMA 4NK5A 2F64A 4FZRA 4AX4A 2DT8A 5L8VA 2I9KA 4KQHA 5EPUA 1KRWA 3VUEA 2DR2A 1R3DA 2O57A 4ZMRA 1C4WA 3A05A 2C5HA 4M8NE 1Y33E 2XTJA 4X62B 2I1LA 3A9WA 1PVDA 1N1DA 3EIOA 1EGAA 3TQIA 1M1YB 2BM0A 2G67A 2RI6A 3MMSA 3WGJA 4BE7B 4L08A 2JAOA 2QPTA 1XLTC 4AURA 3MMNA 2GAOA 1JJAA 1P5HA 1U3UA 2WNHA 2D2FA 1ESZA 1Z8DA 2C61A 2N0SA 3OJLA 4I2NA 3HCOA 4JSYA 4ZT6A 4MRAA 4YRDA 3TLBA 4CZ2A 5A4DA 4C6RA 1WUYA 2P9EA 5C46F 3NVAA 4UE3S 5L3QB 4XJVA 3OOSA 3PDUA 4ZT4A 2VYVD 1Z4NA 3H1GA 2GLXA 2HCTA 2G9UA 3C3AA 3TQTA 1NUUA 1M2NA 3TJMA 3KQKA 5K3SA 1DEOA 2R8EA 2OCAA 4JNCA 4ZOLF 3G1UA 2C20A 3RYIB 3UJ7A 4YRBA 3V8BA 5ES3A 1DT3A 2OO7A 1XAJA 2WINI 2PD6A 2BZSA 3PNKA 5KYYA 5IVHA 4QM6A 4NCJA 3EZ9A 2I1QA 2O0MA 3SXJA 4CEIB 1KP2A 2UYHA 4G1VA 4MA0A 1IUNA 1VLLA 4EKNB 3PWTA 4LJLA 1RM5A 1ZQ1A 1GRNA 2XCIA 4P2BA 4QBKA 4Y67A 1MQ9A 4M49A 3GBVA 5LZ8A 1S2OA 3HN2A 1QU2A 1A82A 1OMOA 1XPJA 4R3DA 4LGYA 5KI6A 2KEBA 1QGUA 1YI1A 3I6IA 4CKEB 2JLUA 2IGTA 4RHEA 4RLSA 3CF4G 2X4GA 3UC9A 4CTJA 4JLUA 1N5RA 2BRUA 3M6XA 3PHCA 1QXSA 5JH7A 2Y9MB 4U7HA 2H1SA 1WR1B 3IP3A 4IQ0A 1KMQA 4CQMD 1IEVA 1Y9JA 4I1UA 4B08A 4UMVA 2NYAA 4ZU1X 4A92A 4CTKA 1TYEB 1HMPA 3R7WB 2I4MA 1DC4A 1QP4A 1COZA 3CCCA 3PUHA 3GEEA 1U7DA 3A14A 1JMYA 1WW8A 4I55B 2HIMA 4MMZB 1Y8QB 1M6EX 1QF7A 1CR0A 3GGPA 4OW0A 1TJYA 3RAJA 3DE3X 3SJZA 4PICA 4RIHA 2JARA 3FNIA 1ZCFA 2WOOA 4CKWB 1M9NA 2IZ7A 4CM5A 3I73A 1KF0A 3MBOA 3R6WA 3JR7A 1SUIA 4JJ8A 4N6GA 3TB6A 4U7DA 4HT3B 4PYIA 3VSBA 1GCGA 3CUEF 1WZIA 3D6FA 3L0BA 2HF9A 1JE1A 5IFLA 2WM3A 3ZCTA 1D04A 3Q9UA 4LOJA 1OXTA 2V7TA 1QP7A 2PAAA 4WVFA 1DBVO 2BI4A 3KR9A 3TNYA 4EEZA 1QZMA 2C77A 2HRZA 2CHUA 3I5YA 2PUGA 2DWNA 2P6NA 4YAFA 2B92A 3LM8A 3NDPA 3WK5A 1UP7A 1PJIA 2ZAIA 3MJ4A 2Z8ZA 4FHDA 1JEQA 1QZEA 2JBAB 3CY6A 2XKBA 2V6GA 1SUSA 3WGIA 3ETGA 4P7BA 2XLJA 1RJWA 3QVLA 3NUGA 1EU1A 2VT2A 2D7GA 1KK1A 1PNOA 5E8JA 1SOVA 4A5OA 3T15A 3QKIA 5ITTA 2QLJA 3DF7A 5AD1A 4XPZA 2OYRA 2DPHA 2RKOA 1UQRA 4WNCA 3QU2A 1NNJA 3ENQA 1P5ZB 4OP1A 4KHPM 4QWMA 4DA9A 4I55F 4OHZA 4C7MA 2A92A 2VKQA 3HWX1 2GPYA 2ZRDA 3U60A 2KS6A 3A4IA 4MWCA 1QUFA 4XVHA 3ZE6A 4UPVA 3WZMA 3C6ZA 4C04A 4I6EA 1GLVA 4E2WA 1N5DA 3EQ9A 1MX1A 5I7HA 1RPJA 4I4LA 3ADKA 3MINA 2MROB 3O4RA 3W9SA 3KVWA 3MTQA 5IM5A 1SELA 4R8SA 1X7XA 4U8GA 3H05A 1OASA 2B30A 2JZ0A 2WJPA 3SQWA 1Y8CA 2LR0A 4YJHB 5JFTA 3V7NA 3O93A 3QXHA 5FLKA 4BVHA 5K8TA 5TMPA 3ETEA 4W82A 1XCPA 4HJRA 2JATA 4KJXA 4ZCSA 2CKMA 1SZDA 2E5FA 2ZRIA 4HAOA 3DS8A 3P9SA 5J2UB 4B5KA 2CBZA 1A9TA 5BYAA 5DTRA 1ZQ9A 4NEHB 5BQ5A 3Q8XB 3QLVC 2X8WA 4QTTB 2YBDA 4FC6A 4E4YA 3F3MA 3IYLW 5EMMA 2GAAA 5CR9A 3TRFA 2RCYA 4RAQA 5JCXA 1ODTC 4EO9A 4QOZC 3HP7A 2FPPA 1E2IA 4H7PA 2OY0A 4FNOA 1PFUA 3W6PA 4P83A 5K3AA 5BNIA 2BI8A 3GCZA 3UHFA 2V6FA 2WMYA 4B33A 3K2QA 5ADWA 3ZWVA 3A6DA 3ETNA 4MRMB 2RRUA 1T3ZA 3RRJA 1R8XA 3H5TA 3EY4A 3PEEA 4OXKA 2W0SA 3C7TA 2HQRA 3ELBA 1Z0DA 2AHRA 2V7WA 2XVAA 3ESXA 3C4QA 3NAMA 3RC9A 3FDFA 3I1JA 3QVXA 3LP8A 4MS3B 5CFRA 1HFKA 4GOND 4YGXB 3MJ5A 2XDWA 3AUSA 1KJZA 3BKWA 3CEPB 4ZO7A 821PA 3PC6A 3PQ6A 5K5EA 3K1AB 1HURA 4YS6A 1W36C 3KKLA 1YOBA 2BWJA 1IEQA 3D7RA 4JVOA 4UOQA 4G5OA 5EAIA 3QNUA 3ZI4A 4EHAA 4LK3A 5IJAA 3DCNA 5FHQA 3FNGA 2I34A 4DQKA 1H22A 1Z6PA 3U17A 5KWVA 2O0LA 3M6UA 2WVAA 1EA5A 1ZA1A 1PK9A 1HE2A 3AX6A 4URVR 4P80A 2VXYA 2QZ9A 2R8ZA 1VJCA 1PWYE 7YASA 4OBEA 2OK8A 3I30X 3I8XA 4RE5A 2G7MC 3SIXA 4M98A 3H8SA 4DIEA 3GJQA 4HC4A 4JLBA 5IC6A 3AWIA 3OJXA 3TOSA 2QP3A 3EAGA 2ENWA 4J1SA 4H7DA 4J0IA 4FDVA 1Z0ZA 1OU0A 4D56A 4WY8A 3ZVRA 4QDXA 3HCNA 2XQKA 3T54A 4LJRA 5FPSA 5C18A 2UUAB 3S6JA 4DS3A 5C53B 4KREA 5T6MA 1G3MA 3T8YA 1AKVA 1QH1B 1RHRA 2C5GA 3BEDA 1GZ3A 4P36A 3U4AA 1F0PA 2KMLA 1IPHA 1FYDA 1TVCA 3U44A 1OFGA 1U9IC 2F67A 5J5VA 1IOWA 1CRQA 4HSGA 2SNIE 4EAAA 4F3RA 3DZFA 2Y9PB 3MUNA 3MGAA 4QNMA 1K3FA 1N0HA 1V16A 2JLVA 4HUJA 3PP8A 3NYRA 2VT6A 1PTJA 1KJQA 1S7GA 1CY1A 5CDTA 2NSJA 3SWWA 3JV7A 2PIDA 4UUNA 1N5OX 4KR3A 2WYWA 1Y5RA 3OF5A 3ZDAA 2P2DA 2X9LA 3GL9A 4XVUA 3H11A 1T9KA 2BHNA 5JVDB 2JFOA 5J2TF 5FOQA 1OFTA 2K5UA 5F3RA 2NVBA 2V7VA 3IV7A 3OM9A 1Y1KE 4A1FA 4DNOA 3K1AA 3CCBA 4KQEA 1YMVA 1U7TA 2YXPX 3HR7A 2V54A 4XUEA 2Y0CA 3GZ4A 4UHEA 4HN2A 3AVXA 3P4UA 2SKCA 2Z3ZA 2ZXUA 1VKOA 3A2MA 2WHEA 2EFHB 4MZXA 3TLMA 2QLBA 2ZTUA 3AHCA 2YNMA 4PG6A 4D3SA 4KMOA 4GKBA 3DNFA 5DULA 4GLJA 5F33A 2R00C 3F9CA 3PVZA 4UHBA 5AI9A 5TR9A 3HKCA 2M1ZA 2V98A 4I3FA 2BZGA 1AMOA 1W4RA 3RRZA 1HF3A 3OM8A 5HTKA 4ZI5A 1M1NA 3FPHA 4UM9B 4KQJA 4I9FA 4PQFA 3KE8A 1Z6YA 2X9QA 4NC9A 2O1EA 1NC3A 5ADVA 3REGA 4RVHA 2H1HA 1ISPA 1D0VA 2PSFA 4B3CA 5CLJA 1OVMA 5EP4A 4O2AF 1VHWA 1TZKA 4Q4DA 1TNDA 5AW8A 1J0XO 1L7EA 3WISA 4EHJA 2MYNA 2ZJZA 3FSJX 1CUFA 1FBNA 2GZMA 3DO8A 4R05A 2IYNA 1GTG1 3I9V6 1RQRA 2ZRKA 3GXBA 2HHCA 5BV2P 5LZ9A 1KSGA 5TARA 3BPSA 1OY1A 3OFNA 1Y3AA 3ZU4A 3TI9A 3RSQA 1JR3A 2AFVA 4U9HS 1P4JA 3GZNB 3WLSA 2WT4A 2JUJA 1C9MA 1XEFA 1E99A 1R5NA 1XTPA 2AG0A 3GLFE 2WE8A 1J97A 2JC3A 3FPJA 4HQ0A 1GADO 4ND2A 5TGDA 5A4AA 4TXHA 5E6UB 2AVDA 1ZJWA 3FIUA 2CNWA 2QWXA 4E0BA 4V0MA 3GG2A 4R3WA 2QCUA 3COPA 4MOWA 5KQRA 4WCFB 3U56A 4JCCA 1Z6GA 3IAHA 5DYGA 4TS1A 1NVVQ 1IN5A 1RWOA 4BNGA 4ZO4A 3NT2A 2I4NA 5HFNA 2P3QA 3TTTA 2QMZA 4EFNA 5A1TA 3OP1A 1BYUA 3V7FA 2C7GA 2ZI7A 3T1YM 5ULLA 5FWYA 1JFFB 3DL0A 1ODKA 1W2WB 4LWPA 2MYPA 3N2YA 4OO3A 5A6SB 3GJYA 3M1AA 3C6QA 5GPBA 3IT0A 4MVWA 1Z9BA 2NZXA 2P6OA 5MN6A 4HNQA 3EPLA 2SICE 3OLYA 4HQOA 3S4YA 1BFUA 1JFSA 1YC2A 1Q2XA 3G5TA 5JNLA 2LUOA 4BNJA 3DQZA 3A6EA 1QQAA 1PRYA 3HDYA 4KXVA 3UJ3X 5LUAA 4BNXA 1XZDA 3AY0A 3KOOA 5ARCA 5FLXA 1NTRA 2J41A 4BB9A 3HA5A 1AKRA 3BSYA 1JB1A 1K7XB 4OHWA 4KDFA 3KKPA 2C9CA 4RK6A 1TZBA 2HREA 1W0JA 2E7ZA 5I9TA 3ROFA 1UP6A 4LNUB 1QFJA 5H82A 3DXXA 4CG2A 1CYDA 5EHIA 1SD2A 3C48A 3RJZA 1M5RA 2A0YA 3GFRA 4R5MA 4ILKA 5D3ZA 4HDKB 1TT5B 5ILQA 3VZRA 4CCYB 6LDHA 2HV9A 3ZD6A 4X65M 2QS9A 2OBNA 3E9MA 5JY1A 4XBOA 3CFYA 3NHZA 4G0VA 5LA6B 3WL4A 2LH0A 1OFUA 2RIPA 2ORYA 1Q0LA 1BAPA 1BKDR 3PD7A 3I8OA 3K5HA 1MX9A 4M1YA 4EO4A 3TDMA 1AQIA 4HS9A 4BB5A 3CE6A 3B1ZA 3VR4A 2L42A 2NO1A 2YMPA 3IP1A 3NKLA 3IQFA 3ZWAA 2JFVA 4IX9A 2JIBA 5F12A 5FWXB 3GRFA 2HUPA 2XUGA 1OBHA 1UT6A 2WTNA 1CS0A 1Z5NA 3LA6A 3JQ8A 1QMGA 3M2TA 4O4HF 1ISMA 2PV0A 2AN4A 4ENVA 3HDTA 3ZUGA 2PXHA 3NC0C 3K73O 3UQYS 1RMYA 3OPVA 1JA1A 4WK6A 4B6FA 3Q3CA 6REQB 1Z3CA 1R0RE 1Z26A 1MB9A 3CUKA 4MYCA 1P1JA 221PA 5T4HA 5JUWA 1RC1A 4H7KA 5HF6A 1Y42X 3VM6A 1T2DA 1RQXA 3SYRA 4DOMA 2QENA 2Y21A 5GONB 5KJ6A 2YVLA 1YSYA 3LCRA 1JIUA 5DTMA 1KC3A 4JLVA 2W6CX 4K9DA 3AHGA 3FM9A 4KQ9A 4OKIA 5ECYA 2HJ9A 4XCQA 1WLSA 1GUZA 5AKLA 4WCFA 2PG3A 4YLGA 4OIMA 3T0FA 4DA0A 5FUBA 2Z83A 5C52B 4GI7A 3DDZX 3CR8A 2R5NA 4FB4A 3W3AD 4D8UA 4LF7M 1G5QA 1L5YA 4GGOA 4ZKEA 3CC8A 4B3JA 4FLMA 2QTLA 1ABBA 2P2NA 3LRPA 4DUYB 4IRUB 4JLAA 4DR4B 1EIWA 1OI7A 4RTPA 5ALLA 3AVOA 3FVTA 1HR0B 1CV2A 2NXNA 4O4JB 3RYTC 4OU5A 1X0XA 4JFAA 4M1KA 1CDDA 3IOEA 3O2NA 5AVKA 3U5ZA 3HBJA 3RRXA 4YYEA 1E1RA 3IFSA 2R0QC 5CNKA 4OX9Y 1C7EA 1T0JB 5G1OA 4PHHA 5AW2A 2XGMA 1P75A 1X7DA 3H5WA 3RFTA 3TH5A 3ZYCA 3F1KA 1GTL1 2H4ZA 4BRSA 3C85A 4ZKDA 3U09A 2CLCX 4DTCA 5E3JA 1RYDA 1VL0A 4LG2A 2O2YA 3VVCA 4B4KA 2VLBA 1F9EA 1PYDA 2NV2B 2VRCD 5KU1A 3M6FA 2TMDA 4UJ5A 1NA5A 5CA0A 1JEYB 3MT7A 3HXKA 4IFBA 5HK9A 4RHCA 1L2BA 2L17A 3W5SA 3RJTA 2OYSA 2YTZA 1ADJA 1SK9A 4IXMA 5JD4A 5DN9A 3ETJA 5MN5A 4IHQA 2CCJA 4FXPA 1RP7A 3I5UA 3OI7A 3L7MA 5J5AA 3ESBA 1XI2A 3THYB 1A77A 2HK9A 3WGYA 5A0VA 4HQFA 3PFFA 1TCUA 1X19A 4HF7A 3K6SA 5H8WA 2BFFB 4UXIA 4Z0NA 2G7ZA 4HNSA 4HL4A 3GFPA 4EW2A 3BWVA 3FCEA 1WHCA 5DISB 1OIZA 4GRIA 1ND6A 2E4UA 2PO7A 2ZBQA 4HDSB 4F46A 6NULA 5GZ3A 2PUTA 3OE7A 2PBRA 4WZBE 5AW7A 1O7JA 1J56A 1X1EA 1XE3A 1H94A 4EHNA 4K6HA 2BHLA 1DG1G 1S2MA 4NECA 4CKXA 4C4RA 1OWMA 4UN2B 4ERNA 1NKVA 4TWAA 2R6HA 1L5OA 3LUJA 3EZLA 4MR8A 2YX1A 6Q21A 4LF5B 4OMDA 4LMRA 1NVMB 2ZS9A 2INGX 1EM8B 4O2LA 1JG4A 4K86A 2OKCA 2CN1A 1T1GA 1ZWLA 3ORHA 4UNNA 2GRJA 3PNLA 3U62A 121PA 2IPMA 1AA6A 2CHVA 1MR3F 1U7WA 3C97A 1S8OA 3WL7A 2J31A 1NSFA 1H2EA 4QDJA 4KDEA 2O1XA 2G6TA 2QPLA 3OFND 4PINA 3RC8A 3KOZA 3FTNA 1GUAA 1MEOA 2VJNA 2WUGA 4EOGA 3JQ7A 3OPQA 4HX5A 3UT5A 1KI4A 2OESA 3OE7D 3SFTA 4F2PA 1IIBA 3B6ZA 3WADA 3LDFA 4XSGA 3A1EA 3KX2A 3FYUC 4Z3DA 4L02A 1B6GA 5FTWA 4R5HA 3CLUC 4MO2A 1K75A 3TLGB 1VMEA 1O87A 2CNWD 3DLBA 2A33A 2H9AA 3JSXA 1ZNWA 2ZWAA 2XZPA 3VZCA 5IT5A 5AXCA 1TECE 2P3SA 3GK3A 3DYBA 2F3SA 3GLTA 4BU0A 2H54A 3V8PA 1FUEA 1KK2A 2X77A 3FBWA 1NVVR 3MBKA 2VVTA 2QRLA 2REOA 3K8QA 3MTEA 1G3IA 4CCWA 4H1TA 1ISGA 4FVTA 1U6KA 3Q7IA 3QJGA 3DKRA 1PZHA 1YOVA 3QVJA 1TMOA 2DB3A 4Q9NA 4LS3A 2FOIA 4ZO9A 4KR6A 1ML3A 1C1HA 1OT3A 1AHHA 4FFBB 2NO5A 4I99A 1XPOA 1Q3BA 1ATZA 1DQYA 2HRCA 2IPAB 3CX8A 3DWIA 4A03A 2C9DA 2BZ0A 3E22A 1RPNA 4X1KA 2AUTA 3VX3A 5KREA 2XX3A 4FYHA 1TAUA 2W2LD 3QRWA 4K6MA 4PFSA 1UOEA 3FPLA 5IDYA 1H0RA 2BVNA 3PB3A 4FR5A 4JB8A 3DEFA 2GNAA 3CLRD 3WB9A 4BVKA 4CKBB 1COWA 2PMKA 3HY6A 2OD9A 5EQFA 3E27A 3WI7A 1DKQA 1NE7A 1P4AA 4I1SA 1E8NA 2XNHA 2X49A 2JH3A 3QWLA 3P26A 1JLKA 2R00A 2HNAA 3ONFA 2GTPA 2P2SA 3BXHA 3QMWA 5CYGA 1WBBA 1I9CA 1F0NA 4N7RA 1GPWB 1M34E 2I6TA 1FPQA 1IN4A 2DZOB 3C7DB 1M1XB 1V8OA 2A5JA 2ZSAA 3PDJA 3GJZA 1GZVA 1PJZA 3BIXA 4WNYA 2ECFA 2GZ3A 1YCFA 2AC7A 7MDHA 4KAAA 3SEQA 1T26A 4E6EA 3BDIA 4I5IA 1GNPA 4IBFA 2C2WA 1EJ0A 2Q7OE 3X0DA 5MN4A 2HYDA 2VEDA 1EFRA 1GD1O 2MINA 2QEQA 3I42A 5JCZA 5IUNC 2IZ5A 5ESWA 3W5JA 3GJ3A 1AQUA 5MF6A 1OZGA 1EFDN 2PZAA 1RPZA 4ZIRA 5IABA 4K2HA 2IVFA 3KLPX 1E1DA 2BUCA 3JAWA 1NI4B 4O4IB 3ZIUA 2ZJOA 4XQGA 4C0QC 1GQOA 3Q7QA 1RI4A 4RIIA 1QM5A 2PUVA 2BEUB 2VN8A 4FFOA 1VHDA 1R9MA 3BHJA 1YIAA 4R51A 3MWJA 3KJQA 3IAS6 2HLNA 1NXOA 1ULAA 1CUJA 1RPAA 3KEFA 4TL9A 2IY7A 3P4XA 1OYWA 1KJ8A 1YQTA 2AWOA 2ZI6A 3F8SA 3RUFA 3JYHA 4QXQA 2E9SA 3C74A 3CZQA 1PFKA 1VPTA 3RVMA 2HA3A 4YNBA 5TSDA 4JGGA 4EG1A 4RVUA 2A9KA 2VHWA 4GRAA 3GHYA 1ZRSA 4BZXA 1G19A 5ER6A 5I01A 1P4RA 2YVUA 2QMHA 4QFMA 5EUMA 3T06B 4IOJA 2QQ8A 4JYBA 4EJ6A 1GAJA 5BW4A 1OGJA 4OFBA 3WZ2A 3KU1A 3W4KA 1F17A 4JUDX 4LF4B 1XGKA 1DQNA 1G2QA 1DJLA 4X1IB 3L2AA 2R85A 4IBOA 2HBRA 3VKGA 1TIKA 2XE7A 2E37A 3IP8A 4IIBA 5ALZA 5TJHA 4OQLA 1WETA 1W85B 2C54A 4QDOA 5CRIA 4UFOA 3GQ4A 3OIGA 2CDAA 1UXKA 1MQSA 1NLUA 2D3TA 3D6VA 3S27A 1M83A 1G6HA 1YB1A 2AX4A 2JDIA 5IBPA 3TNDA 1WUIS 2CD7A 2CYAA 4ME6A 2ORWA 2GHRA 4D82A 4U0JA 4W6ZA 3RGPA 3ZWCA 2O8FA 1CUSA 4AICA 4IBJA 3ABIA 3OQOA 1VZ2A 5ITWA 1RD4A 4ZCQA 1XVIA 3R6TA 1BEEA 2R8OA 2H08A 4ZYXA 3G02A 2WHQA 3FF4A 1AKYA 1HJPA 2WWWA 2Y0EA 1E9SA 3RREA 3U7EB 3BGSA 4PS1A 1JHPA 2ZFUA 1VCMA 2RGHA 2ZQYA 4YMSA 5K1ZA 5C7YA 5LJLA 3LF2A 2P68A 1VE1A 4Q5IA 3F97A 3GLKA 4K88A 4KR7A 2EJBA 1IY2A 2NPOA 2WAOA 3CSDA 3DA8A 1E1KA 2SCUA 2XQVA 4U0KA 1VJTA 1OXBB 5D84A 5TQ2B 3VPXA 4LHZA 3SYNA 3WC4A 2V7UA 1E2GA 3VPSA 1JTVA 1SU7A 3LXUX 3AVYA 3MJSA 4V3CA 1ISSA 1E2LA 1RYMA 3D6TB 4D3XA 3UK7A 3UN1A 4WJLA 1NLFA 1K0UA 2WWXA 2DTDA 4I2VA 4L3OA 3NM5A 4JP5A 1K8XB 1WO8A 1TCVA 2LE0A 2LZ0A 4PSDA 2KBEA 1G6OA 1XHBA 2IHYA 4JLJA 1IXYA 2H29A 3R5SA 2O14A 2OWDA 4RNCA 1W4CA 1NULA 5DLEA 4AKSA 1EK6A 5AICA 5KJEA 5B6PA 3A1UA 3GP1A 4AMUA 1W36D 2P9JA 2KZSA 2G08A 2W8BB 4ENWA 2BDEA 3BA6A 4R1PA 5BR4A 1QJ4A 1T35A 1V33A 1P74A 2XVYA 5BT8A 2JLZA 3C3WA 3CR3C 1PQPA 2WICA 2GOYA 3D6UA 4K3UA 3TFOA 1ZMRA 3TVTA 2H16A 1XAGA 2JGNA 4RD4A 4MB7A 1RAAA 2F7SA 3V4OA 1ZR4A 2FPSA 7CATA 2QRJA 3OKPA 1Q0SA 1P19A 1KZYC 3SDBA 2H1OA 1JSRA 1TJ4A 4ARVA 3CUVA 2PLAA 3FIJA 2QSUA 2Z95A 5K0FA 1UXJA 3PQ5A 2HDWA 2C3YA 4BHTA 5CBPA 2Y3IA 1L4UA 5HIAA 3LT4A 4NOLA 5E2IA 4AF7A 2P2ZA 3Q7RA 4Z9FA 1ZLYA 1TKAA 4Y1RA 2E82A 1V39A 4IJMA 2H0RA 1JPUA 4LBYA 1OX6A 3FFWA 4TMTA 3TGPA 2YHAA 5HR5A 3I62A 5K0CA 3ZCSA 2V7GA 3RBZA 2NV6A 1IBCA 1DAKA 1E9FA 2HV8A 2I4IA 1NKSA 2OAEA 3B3GA 4MGZE 1OTYA 2JJMA 3FNBA 3QW4B 4RS3A 3IGFA 4QU5A 5D3QA 1GDTA 5F73A 3S2YA 3GZNA 5JXHA 2FPGB 1XJ5A 2MOKA 4IHJB 3UJDA 2QNJA 1FU7A 2TYSB 1IOVA 5EOVA 1XZEA 3NAGA 2QMYA 3AG6A 3S1LA 3INTA 2BI7A 2G6BA 4KUEA 2BF4A 3AEXA 4G1BA 4XDZA 1RWNA 1BHO1 3KQTA 1YUNA 1OI2A 2BMWA 1RTKA 3K5WA 4N03A 5D51S 1V47A 3SOPA 4BV3A 4IH9A 1UMBA 4MDEA 2QHXA 2QMUA 1UAYA 5ITVA 1LLFA 1Z4LA 1BW9B 1OA1A 4LEIA 4B7FA 3U2QA 4HUQA 1G2IA 5DHQA 5ICSA 4PGFA 5GY7A 4HLNA 3CF0A 3G7UA 2BFFA 1VA5A 2PZJA 4KAXA 5B7GA 1KK3A 4BTEA 5DRTA 2H00A 3P2KA 5C81A 4OX9B 3BGOS 2AXEA 2XITA 1DDGA 1I9GA 3HVHA 1E1LA 4DJTA 2DF8A 2GK6A 3CGGA 3PNQA 2DJ5A 5TQJA 1T9ZA 2O8CA 1EFAA 3WIOA 1A7AA 1IE3A 2PWPA 2H57A 1G5IA 3MQ4A 4GR4A 1XF9A 4F7WA 3IX7A 5JH7F 4ESVA 3WYBA 1GNSA 3KR2A 3D1VA 4UCFA 2ZT8A 3CA8A 4YVFA 2OBLA 1PV4A 1TJNA 1ORYB 3TRJA 3FBGA 5J23A 1X3SA 2FVXA 1BWQA 2SKEA 3H8VA 4J0JA 4B32A 4CBVA 5EJFA 1PW5A 1YIDA 1SU6A 1PGQA 2X2EA 1DLIA 1GCIA 3CUYA 4IIUA 5HE9A 5SY6A 3WTBA 2EG5A 4UM9D 2XCSB 2GLUA 1I94B 2HRBA 1HKHA 4KLZA 3I28A 1VJ0A 2YVKA 1TX4B 2ZT7A 4OVZB 2ZT5A 4U63A 5A71A 3H4VA 4BKQA 4QZVA 1YVDA 4K6GA 3NOXA 4OY3A 1RAEA 4D3ZA 4WBXC 3OX1A 4PRYA 1KNXA 2VJYA 4O1HA 1W4AA 4ITQA 4GPD1 1BOFA 1C4KA 2PZFA 3FAZA 2QMOA 1YZTA 4K9QA 4M83A 3L18A 4XWAA 3VDNB 1M1UA 4ONEA 4BFWA 1AKNA 3ESQA 4Q48A 3DHVA 4OU7A 3GRVA 3ECCA 1VL8A 4I19A 1OE0A 4O3MA 5H81A 3I34X 2RHHA 4PHTA 2ID8A 1SRRA 1X1RA 2RAUA 1PFQA 4RNAA 3RU9A 4V38A 5IUKC 4L27A 4I6GA 2F8MA 3BMQA 1II0A 4BKPA 3BHIA 1LI7A 1XWIA 4DCSA 2Z9DA 1FZQA 2GDJA 3JVIA 5GOZA 2YIJA 3ZPXA 2VXOA 2OMEA 3PC8C 4EPVA 3FYCA 3NIWA 2XR1A 1WXGA 4TUYA 4PTYA 4KXNA 3PT5A 1N2GA 4YV2A 4BGDA 3HHZA 4R7TA 4ZCMA 3LYLA 1FPMA 2GZSA 1N5MA 1JQ5A 1P0QA 1QWSA 2EZ8A 2C00A 2JAUA 2NX2A 2Y4OA 4LYHA 2W5UA 3UV7A 1KOGA 3V5NA 9GPBA 4RIGA 4Z8YA 4IIGA 1YKFA 2HADA 3TB4A 2RGRA 3G2KA 1G4HA 1NN5A 3F6PA 2PR2A 3PUIA 2NN3C 3I2GA 1C1YA 4IVPA 4R0MA 4DV4B 4B85A 4EEKA 4PRLA 1ZJ5A 4WV3A 1K7YA 5AUOB 2QSFX 3ZDCA 1A9QA 3NIFB 3ZHOA 1N33M 3VJMA 1ESDA 2GTHA 2FSVA 4I9HA 2CHGA 1W5EA 3UUFA 4A26A 4II3A 4YONB 4OYYA 1E6LA 1UJCA 4RVSA 1CXZA 5FBRB 5KOJB 3U1BA 4JBHA 4WP2A 1VI5A 3CEJA 2P2CA 3LDHA 5ELMA 3W2TA 3HLTA 3R3ZA 3AYXB 3R5FA 3QKRA 3HNOA 4DV7B 2ASEA 4CRWB 5JDCA 3ESCA 5M34A 3I9JA 2P8JA 4G5RA 2ACEA 4TOIA 3ZJVA 2P67A