1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
b'RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
4HC4A 5CCXA 5K0NA 2KNAA 3OPNA 4QPPA 1BC5A 1G8SA 4AZSA 1PGYA 3K9OA 3KPWA 4E70A 3SVZA 5LQKA 5ICEA 3EVCA 4PINA 3PFHA 5JR3A 3FUTA 1RJDA 2Z6QA 3A7EA 3T7RA 1R4GA 3H4JA 1A5TA 3MB5A 3OZRA 1JQ3A 4EKIA 2ZTDA 3TLJA 1WHCA 1OR8A 4C07A 3TQSA 3KPYA 2C7OA 2PX2A 2CL5A 5DTRA 2B25A 2EJUA 4IV0A 3KR1A 4HGZA 1XDSA 3ERCA 1SQGA 1H1DA 4BY9E 2XYRA 3M6WA 3G5TA 2OKCA 1WZNA 4RVHA 3Q7EA 1D2GA 5JI2E 1SG9A 4UN2B 3KQPA 3ME5A 4M36A 3EVAA 5FUBA 2IH4A 3FPEA 3G2MA 4PYIA 5LQAA 3QV2A 2YR0A 4V0RA 3D2LA 1FBNA 1SUSA 4MTLA 2DI0A 4RVFA 2EFJA 4C03A 1MN3A 3KPJA 1INLA 1OKSA 5DXAA 5G02A 3DXXA 5ICFA 5DTQA 2EJTA 4AUKA 4YV0A 1ZMUA 2ORED 2BR4A 2ERCA 5D1HA 4CWAA 4BLVA 4QTUB 4V0QA 2JUJA 4PYQA 3FYCA 1ZGJA 2P1DA 3GNLA 5IH3A 4E32A 3KQSA 3PB3A 5EOVA 4AX8A 1Z3CA 4MWZA 2YUIA 3SSMA 1XJ5A 3RW9A 3CCFA 1BKYA 5EZQA 2OB2A 4L7VA 3B3FA 5DT2A 3JWJA 3GLIE 5DM2A 2A14A 4DMGA 5T6BA 1X1CA 5HIMA 4Z2YA 4CKEA 2Z6AA 5E2BA 1TPYA 2EKKA 4RYLA 4AZWA 4E2YA 2HWJA 1JQEA 2G71A 2OXTA 2JY5A 3BWBA 3G8BA 1JG4A 4ISCA 4EVIA 1NKVA 3FTDA 5EKUA 2FK7A 4DCGA 2DAKA 4PYMA 3G5LA 3HEMA 4ATNA 1YZ3A 4QDJA 3GIWA 4RX1A 5DSXA 2ZTCA 3I5UA 4R6XA 3IHTA 3NDIA 3DMGA 4PYKA 3HVJA 1ZQ9A 2H00A 4GC9A 5GM1A 3K0BA 5E1DA 2ESRA 4YV1A 1DV0A 3GRUA 4POOA 4DKJA 2ZULA 4PCLA 2NXEA 1GO5A 3OU2A 5JUWA 2JHCA 4RTRA 4C08A 5K0CA 1YF3A 3GLHE 4MHTA 3HCBA 3E21A 2O0LA 3HCEA 3LBFA 1WXXA 3C0KA 3FE3A 2FYTA 2QM3A 3SX0A 4MQ4A 4EKGA 2BH2A 3P2EA 1NE2A 4PGHA 5FULA 1TTEA 3I53A 1QAQA 1ZMVA 1JG1A 1QANA 4OQEA 2QSFX 5E8RA 5FA5A 5FQNA 2AOWA 4BP1A 4YUZA 1KP9A 2IP2A 2ADMA 4QVKA 4RTJA 1VIDA 1E94E 1WGLA 1YUBA 1KHHA 1L3IA 2P8JA 4KIGA 1P1CA 4ER7A 2BR5A 3I64A 1PRYA 3PX2A 4LECA 5LQRA 1WS6A 2O06A 1WR1B 1EJ6A 1ORHA 4Y30A 4HGYA 3TOSA 5EC8A 1HT2E 3T7TA 3EVGA 4FS8A 2NP7A 3GXOA 3FUWA 2WA1A 5GIOE 3MMPA 4WXHA 4WVLA 1JG3A 1WXWA 3T7SA 4R71A 1O54A 2LVNC 1EAMA 4P58A 5FADA 5E9QA 3DR5A 2KNZA 2C7RA 2ZZMA 2DKLA 2R6ZA 3I58A 3KQQA 1N2XA 4YMHA 3PTAA 1R00A 3DTNA 4EK9A 5CVJA 2G3QA 2JY8A 1MHTA 4HG2A 2IH2A 1G38A 3DULA 2RRUA 1QZEA 3KQMA 5FHRA 2XBMA 3WSTA 1AQIA 4G56A 2DAIA 1YLAA 3MTEA 2C7QA 3P97A 1P3QQ 1OQYA 5HILA 1JTFA 3OU7A 1JR3E 5FWAA 5F2KA 2G70A 1UIRA 2CMHA 1ORIA 3B3GA 5E1BA 4CKBA 4LG1A 3SM3A 3VC1A 1AIPC 5LQNA 2L4EA 1WG8A 3R3HA 3LHDA 5LSAA 2OY0A 2FRXA 4HTFB 2DAGA 3GRRA 4F86A 3M4XA 3R9XB 2WA2A 2DHYA 3EVBA 4QDKA 1I4WA 3P8ZA 3UFBA 2ZWAA 5DM1A 2ZBPA 4YUYA 3FPJA 1XVAA 3B7PA 5HEKA 1KPGA 3A4TA 2PX4A 4GF5A 4R6WA 1YB2A 2ZWVA 3O4FA 2NNWB 4DA4A 3GRVA 3EMBA 3AWIA 4B17A 2LVOC 4ER3A 1X19A 4DM3A 3CC8A 1KIAA 3LSTA 1OTRA 4CTKA 2CKDA 5K0LA 4GOOD 2O07A 4UOEA 1XDZA 5E9WA 5DXJA 2VP3A 2QHOB 3EVEA 5HZMA 2PWYA 2VZ9A 1JR4A 2LVQD 3NTVA 5K03A 4FZVA 3BGVA 2ZVJA 3NVKI 2HMYB 3FUXA 3HCAA 2JP7A 4FSXA 3HA7A 4E33A 5EMKA 3HVIA 2JH9A 5BW4A 3KPVA 5EPEA 1P39A 1HQYE 1R8XA 2B78A 3P9NA 3MTIA 1F3LA 1DO0A 2YXEA 5FCDA 2I6GA 1I1NA 3V97A 3VYWA 1EG2A 1VLMA 3KQTA 2NP6A 5FWDA 2HNKA 3SSNA 3LDUA 2H11A 3RODA 5HFJA 5LQUA 3TM5A 3CKKA 2G8NA 3E7PA 1AF7A 3MAGA 2PSSA 2ZBQA 3R24A 4MIKA 1VE3A 2NYUA 1NV8A 2FPOA 1JQDA 5DRYA 2ZIEA 1HT1E 1RJFA 2AOXA 3PS9A 3LKDA 3QOWA 4FSDA 5E2AA 3NJRA 4DCMA 2VDUE 3KQVA 1B42A 1XCLA 3DUWA 1JSXA 1YFJA 1PJZA 3NDJA 4FP9A 1Q02A 5K05A 3LL7A 1SVUA 2QRVB 2OYRA 3GLFE 1XXLA 2PT9A 3TKAA 2B9EA 1VP3A 3BGIA 3THSA 4QTTB 5HIIA 4AZTA 5BXYA 4KRGA 1N7IA 1DL5A 2IFTA 4C4AA 1P1BA 3R0QA 4RTPA 3CJRA 1WY7A 1D2CA 4OBWA 2ZFUA 2DENA 3ELUA 3DLCA 4KDCA 4E2ZA 2NXCA 1ZV1A 2AOUA 1WJ7A 2L2DA 4Q7JA 2QYOA 2I62A 1RI4A 4H0NA 3A7DA 5GOZA 4PYOA 1EFUB 1R74A 4RVDA 2PBFA 3GRYA 3O7WA 2E5WA 2AOTA 4P7JA 4PWYA 3EVDA 4RTKA 2ZZKA 3TR6A 4QPNA 5P8WA 3S68A 1QAOA 4C06A 2I7CA 1X1AA 4GEKA 2GS9A 1NW5A 3GRZA 1BHJA 1G41A 1RI3A 3BT7A 3CJTA 4X60A 1CUKA 3MHTA 2UZ4A 4RTLA 3TRKA 9MHTA 3OU6A 3DOUA 2ZZNA 4HSGA 3UJ9A 3F92A 2P40A 2UYQA 2IBTA 3AXSA 1XCJA 1U2ZA 3E23A 4HRAA 5KS2A 1F4IA 3L8DA 4E2WA 4G3OA 4IWNA 2L4FA 2V74B 5CIYA 3ELWA 5U4XA 3ER8A 4PCAA 3IHPA 4E31A 3FUVA 2HR1A 4QVGA 4RSRA 3M6XA 2PXCA 3EMDA 3KR2A 3G7UA 2K9DA 2ZCJA 1F38A 1XTPA 5GIPE 3E05A 4AZVA 4RTOA 4ER0A 3C6KA 2O57A 3TPZA 1QAMA 5EHIA 2PX5A 2OPBA 4YMGA 4KWCA 1TW3A 2AZTA 1DUSA 2AOUB 4OA5A 2H1RA 3TMAA 4KIFA 1R18A 1TW2A 1RI2A 3UWPA 3UA3A 2AN4A 4GEWA 4EMSA 3C3YA 5K01A 2EX4A 2CP8A 3THRA 3JWIA 2ZW9A 4F2LA 5K0EA 1UFKA 1NT2A 3M6VA 3HVKA 1P91A 2OOAA 1C7YA 3FPHA 5M5BA 2PLWA 4RVGA 2OOBA 2GH1A 1T6OA 5CVUA 3SMQA 2N47A 4PYNA 1XDUA 5EHGA 1G6Q1 1ZMWA 2LVAA 2BZGA 3KQOA 3T6PA 2PGXA 2IGTA 3KKZA 5KQRA 4Y2HA 1I9GA 4KDRA 5D1NA 2LBCA 4PIMA 4M7RA 4RV9A 4F85A 2JHPA 3BXOA 3UBTA 1BOOA 1O9HA 4M37A 5KQSA 2XYVA 2ONZA 4E2XA 1R8YA 3M6UA 2DAMA 1YZHA 4GOMD 4OBXA 2UYHA 3BKXA 3G89A 3DXZA 4RTMA 2XVAA 3MGGA 2PVCA 5KVAA 3BZBA 2FK8A 1HMYA 2PV0A 2DNAA 5HIKA 2BM9A 3JWGA 5E1MA 3KU1A 3G2OA 1VL5A 2G72A 3FRIA 3OFJA 3O31A 3EGEA 2Y1WA 1IXSA 3C6MA 5T64A 2JY7A 1SKMA 3LDFA 1VEJA 5DX8A 3LKZA 3HA3A 4GQBA 2PXXA 3MCTA 3E8SA 2LVPC 3B89A 2KNVA 5ERGB 3AXTA 2OBFA 5B1SA 3UZUA 3BWMA 3H2BA 2PXAA 3A26A 1L9KA 2EJSA 1XXHE 5CVVA 1RI5A 1Y8CA 3VC2A 1IM2A 1FPQA 3HVHA 3HA5A 2IIPA 2IDJA 4LWPA 4FGZA 1VDLA 3OCJA 2BWBA 4HEOA 2HTEA 3FTEA 5EEHA 3FPFA 5GP1A 3CVOA 4CTJA 3GWZA 2DULA 4OQDA 2P7HA 5HIJA 3HCCA 3MERA 3TFWA 4RTSA 5CUQA 3P2KA 3P9IA 3SGLA 1V39A 3OE5A 4FT2A 1RJGA 4X61A 1HJPA 2Q41A 4RTQA 4DQ0A 1G3IA 2PX8A 2MR9A 5CM2Z 4BLUA 4NECA 1IFYA 1X1BA 4C05A 2IPXA 3KR9A 1EQAA 3KQWA 5DM0A 3BBZA 1KYZA 5GWXA 3DLIA 4R8RA 2BWEA 2AOVA 1DO2A 3BGDA 3UJ6A 1V92A 3G8AA 5FHQA 5BP7A 3LCUA 1KR5A 1T43A 4P7FA 2VDVE 1RI1A 3FRHA 5EG5A 3HNRA 2P41A 3FTCA 2LD4A 3DH0A 3KQYA 4OA8A 2K4MA 3HP7A 1L3CA 3ELYA 1MJFA 3UJAA 1X1DA 1KXZA 1QYRA 4FR0A 3C3PA 3UJ8A 5BW5A 4PGGA 2DZLA 3FTFA 3U81A 4PYJA 4F84A 1SQFA 3P71T 4RWZA 1M6EX 2O25A 4XUEA 3BWCA 2VDWA 4P7KA 1EJ0A 4RTNA 3SR4A 5DPMA 2KHHA 4GBED 1KPIA 4XUCA 3CBGA 5DRTA 1QZZA 2UYCA 4DZRA 2ZIFA 1DCTA 4U7PB 1IY9A 3IV6A 4C04A 4R8SA 2Y1XA 1VBFA 3GU3A 4BLWA 2GB4A 5E8JA 2I9KA 1ZG3A 3RIEA 1ZKDA 4HH4A 3LPMA 2BR3A 1OAIA 2JG3A 1L1EA 2QNJA 5EMMA 3REOA 5LR6A 2ZBRA 3TKYA 2O05A 2P7IA 3EGIA 5ICGA 2AVDA 2GPYA 3DXYA 3PX3A 3PT9A 4QQKA 5EKXA 5E1OA 5C0OE 2HV9A 3Q87B 1VEGA 1BVSA 2UYOA 3KR0A 10MHA 1VPTA 5EIWA 2ONYA 1G55A 2P3QA 2JZ0A 1NW6A 3UJDA 2CMGA 5KYGA 5DX1A 3OZTA 2JJQA 1FP1D 1Y8GA 1G60A 2HAKA 3AJDA 4KVZA 5DSTA 2BM8A 1JSZA 2EKFA 2IBSA 5DX0A 3B5IA 3M33A 2B3TA 2P3OA 3SXJA 1NBIA 5K0GA 2ZSUA 5FA8A 3LCCA 2B2CA 1AQJA 1YFLA 2WZJA 3LCVB 3OE4A 1WGNA 2EG5A 1KPHA 5CVEA 3EPPA 2AVNA 3K6RA 3M70A 2PWPA 4K6MA 4CKCA 3V8VA 4M38A 3GLGE 3AY0A 3FYDA 3KPUA 1G8AA 3JWHA 2OB1A 2OZVA 5CCBA 4GC5A 3ANXA 5GM2A 3DMFA 4JXJA 4BP3A 4O29A 3CGGA 2K0BX 3E46A 5K0FA 3FZGA 2MGWA 4PONA 3EEOA 1O9GA 2IDKA 3X0DA 4YV2A 2KW5A 3MQ2A 1KYIA 4ER6A 2HWKA 1G4AE 5EMJA 5EZSA 2H5XA 1Q0SA 5CVDA 3PFGA 2YQZA 1ZHFA 2YTZA 1ZGAA 1N7JA 2C7PA 2LTUA 4GOND 4IKPA 5EGSA 4YUWA 4YUXA 1M0EA 1Q0TA 4X41A 2ZIGA 4OX9Y 5LQCA 3DMHA 2AOTB 2GLUA 4X63A 4HTFA 3HM2A 1WIVA 3F4KA 3PVCA 5EVJA 2F8LA 4E30A 8MHTA 2R3SA 1NBHA 2JNHA 4LWOA 3ORHA 3LX6A 3LECA 3P9CA 3KHKA 5DTMA 3DP7A 3SSOA 4A6EA 2PKWA 3LBYA 3QOXA 3HCDA 3UJCA 1AV6A 2MJ5B 2GAFA 2P3LA 5H02A 3A25A 5EIFA 4QQNA 3G2QA 2XVMA 2OO3A 4ER5A 2JZ1A 4A6DA 3GGDA 3BKWA 3GO4A 3UJ7A 2Z6UA 3IECA 4GUAA 3LGAA 1RJEA 3VSEA 3OZSA 2PJDA 5C1IA 3R6TA 4F1IA 1IM8A 5K0JA 3EGVA 2OO9A 3HTXA 3BWYA 1R6AA 2ZLBA 2JY6B 4KW7A 3ELDA 1NV9A 1UFZA 2YXDA 4PIPA 4ZTBA 5EMLA 2NXNA 1FP2A 4PYLA 1KYWA 7MHTA 5K8VA 1NW7A 5ICCA 3T0IA 2FHPA 4PNEA 3NW9A 3P9KA 2AN3A 2XYQA 1D2HA 3ID6C 5DFLA 4IV8A 4WP2A 2JH8A 3TM4A 2QE6A 3BUSA 2YVLA 3OFKA 2AN5A 3NWEA 2GA9A 3EVFA 3LDGA 5LQJA 2YX1A 3FPGA 3CJQA 4XUDA 2MROB 5FQOA 3EVZA 2YXLA 2JHAA 1NW8A 3NMUF 2QY6A 3EEYA 2PT6A 5T67A 5DLYA 3MCZA 3NWBA 2WK1A 3NVMB 5K0BA 5F2OA 3GDHA 5MHTA 4R05A 2CWBA 1VG5A 3UJBA 2FCAA 2R0IA 5K09A 3K9PA 3HCFA 3G2PA 3IYLW 2ZTHA 2AS0A 3B3JA 5DM4A 3UA4A 3G88A 1L3BA 3A27A 1VEKA 3GCZA 4XCXA 5F2NA 2NXJA 2G1PA 1JG2A 2PY6A 4GOLD 1SUIA 4X1OA 1IXKA 2V7EA 2IH5A 3I9FA 4DBGB 5C9ZA 2QRVA 3IEIA 2CWWA 1EIZA 3ER9A 1NW3A 4P7GA 5CD1A 4DF3A 5EEGA 4YUVA 2VS1A 5IKMA 2P35A 5EQJB 1VP9A 5GINE 3PLAE 2DPMA 2DAEA 1HNNA 1UWVA 4U7TB 1XB2B 5HOQA 2AR0A 4FT4A 4EQZA 1JTEA 1FJXA 1TR8A 1M6YA 3FUUA 5DWQA 3GJYA 5E9JA 1VQ1A 5FTWA 3P2IA 4CXMA
chains in the Genus database with same CATH superfamily
3QELB 5K0NA 5I9MA 2NQ2C 3G0BA 3NHKA 1DKOA 3K9OA 4QODA 1AS0A 1IXSB 1CB0A 3VGPA 4MI1A 1PR1A 4KI7A 2Y76A 3EIOA 2Z95A 4TKVA 2DWOA 2GRUA 2WTAA 1DAFA 1TL7C 5BNIA 2Y0QA 3EDRA 1NL3A 2PZAA 2XV1A 3KB1A 4EKIA 4G1UC 1EE1A 2ZB4A 3AVUA 3P9ZA 5L6MB 4P08A 1RXCA 2G5GX 1DVRA 1Q0QA 3N8DA 2IY8A 4IS2A 4G81A 3ZPXA 5AESA 3I6IA 4BP9A 4EEXA 3G5TA 2ZBUA 4DVGA 3C5VA 3N70A 1I5EA 3B2EA 1SPXA 3G82C 1OBFO 4QXOA 5CK4A 1D2GA 2FMTA 4UN2B 4O0LA 1EA5A 3EVAA 2AG6A 1Z0JA 1I32A 3ORRA 2OCDA 3NRJA 4PO8A 3TEJA 1SUSA 3GLFB 1HE2A 1XROA 4HR7A 3EUEA 5KTRA 4BGDA 3FR7A 5FBLB 3O21A 4HWRA 2QJOA 4JOBA 3ZQ6A 5ICFA 1P77A 4ARZB 1YAJA 1S5PA 1YJQA 2X5KO 1X38A 5J47A 4CIYA 2PQ6A 7ABPA 1WBBA 2YWJA 2G1JA 4DA6A 5IF3A 2PXHA 4FNMA 4E32A 4FYVA 4X8OA 3KQSA 3CH6A 3RGSA 5J58A 2WYUA 2G8LA 3UV7A 4MRSA 5A0TA 3C39A 4XBOA 1PK7A 3LX8A 1NF9A 4ID9A 4BNVA 2Z6AA 1HOXA 1OAAA 3I2HA 4AZWA 5KDDA 3VX3A 4BNZA 3O7MA 1N6HA 2LV8A 2JJ2D 4MGIR 3BTOA 3C7KA 2WKSA 4RZ3A 4FNAA 4LBWA 4NXNM 2VAVA 2MH8A 2O2ZA 2LR0A 2O0MA 1CQZA 1TF5A 3BFXA 2Q6OA 4QEKA 3IT1A 3HCWA 2WWYA 1GGEA 3DBOB 4JFRA 3KC2A 2WD7A 1ZQ9A 3OIGA 1N0UA 1T8PA 1U7HA 1TECE 4N7MA 1SC6A 3WQHA 4MSUA 1P5JA 2J0QA 5EAIA 2BZ1A 4DUPA 4WCFB 1U6KA 2Z2YA 3GFSA 3P0FA 3FHOA 2IHNA 3GLKA 1GO5A 1IVYA 4LE2A 1Y5RA 4YT2A 4GNKA 1Q12A 2FZCA 5EINA 4BV3A 6AT1A 1TT5B 4G8BA 5AO9A 4TN5A 5KNLA 3K8OE 1QGDA 4GL4A 1IN4A 4R9VA 1Z8FA 1ZZGA 1AGRA 4XI9A 3BMOB 4JIMA 3UFXB 4JITA 3QK7A 4RD3A 1NF2A 3HKPA 1XZJA 2X77A 3JATB 4M21A 3EUWA 1QYIA 5FQNA 1VGRA 1EM8B 4BP1A 4ZYLA 4TKLA 3ZCQA 3BHMA 1KI6B 4ZEMA 1E94E 4Y1GA 2VDMB 3FSGD 2YFKA 1DELA 2DBYA 1UBNA 3U19A 4BMZA 4DMKA 3EXIA 4HGYA 1KZ6A 4K0RA 1TGUA 2M32A 1G59A 3ZDYB 1TAUA 4TWRA 3K5WA 2WFLB 4HDAA 4TMVA 2C07A 1XPUA 1CUBA 4LDZA 1HUQA 2XUGA 4HNAB 5FADA 2O7VA 2OORC 2R6ZA 2VDRB 3S2ZA 2IZ1A 3ZD8A 5IARA 1LH0A 5KVSA 2HSDA 4KO3S 3LXMA 2FKAA 3K70B 4PS1A 2RH9B 1T3ZA 4C4YA 3OU7A 4PLPA 3L9WA 1GQYA 2ASVA 4INPA 3EXAA 1ORIA 1PT8A 5KUTA 5DTJA 4PGFA 4D6XA 2JFOA 2X9VA 5ENDA 4MPTA 4C7KA 3GDGA 3VR3A 1Z3IX 3I9MA 2HRDA 1J5XA 1N8KA 3CSSA 1YCHA 4EG1A 1EWVA 4BCBA 3COZA 2OFXA 1RQPA 3AU8A 4ZV7A 2BZ0A 2A9RA 4P6VF 4J0IA 1KFVA 3SATA 4WSOA 3TZHA 1SOAA 3NOOA 2ACVA 1W29A 1E5TA 1L7QA 4IL5A 4M9UA 2A3RA 1Z4PX 2FMKA 3C8UA 3KE8A 3LY5A 3SHGB 3IUYA 1ISRA 2EP8A 4QT0A 1HWYA 4PZAA 3OETA 2VSNA 2LPMA 1HE1C 1L7BA 3O8OA 4LDRA 2G1UA 3DR3A 3QWHA 4JVSB 3ZHOA 2NNWB 3AUXA 1TT7A 1I10A 3OWOA 3HXMA 1PUJA 1ISGA 2QN8A 5MN6A 2WUGA 1KIAA 1IHUA 1CT9A 1GNSA 2HHAA 1XVIA 2D13A 3WGQA 4DZZA 3AB7A 5FBVB 4AQ7A 3GCGA 5K0LA 2O07A 5BWMA 3KOZE 2Q7DA 4GPIB 1S2IA 2JFFA 4JBXA 3RVDA 1KMCA 5ABPA 1LDYA 3BB4A 3R3WA 1H5QA 1ODSA 2CHVA 4JI6M 1YVUA 2HMYB 4L0CA 3QSYA 1EXVA 3FKQA 1IJKA 4DXDA 1H6UA 4ETWA 5EPEA 4RNDB 1PK9A 2WB4A 2HPAA 4FN4A 2B78A 1J24A 3C3JA 3NONA 1E98A 3VYWA 4QE3A 1RZVA 4QD3A 2NP6A 3K96A 3ZOKA 1XKTA 3STTA 1PR3A 1DPGA 3R5TA 1PFQA 2VK4A 3KB8A 1MTOA 1VHQA 1MENA 3C58A 1R8QA 2ZM5A 1CUSA 3IC5A 4BUZA 3ICOA 1TVEA 3VQTA 3ILYA 4LEIA 3FCUB 1HC7A 1HT1E 4PAGA 1Y1TA 4H7EA 2XMSA 4BKQA 2UUBM 2Q2WA 5EHZA 4KXFB 3K32A 3HBMA 3UOWA 2EJCA 2DVMA 4RFSA 1QV7A 3KQVA 1NVBA 3RFWA 3E7DA 5IJ9B 5A5FA 4TX1A 2JEYA 1Z9BA 4J16C 1MZPA 4ASUD 1R5BA 1GQQA 2IV7A 4JLPA 4PR0A 2IU4A 3MJFA 3H5VA 2C3OA 1DOHA 4KRGA 1N7IA 1DL5A 5C7YA 1EGQA 1RRVA 1Z7YA 4ARVA 3CF4A 3CJRA 1MH9A 3N6XA 3KKOA 3CINA 3W3AH 2PSJA 6CHYA 1M2EA 4JYMA 5JJBA 3LWZA 3EAFA 3BMNB 3NPMA 1ECJA 3H4MA 3DDCA 1X70A 3SYKA 5ITZA 3L46A 4QXQA 1ZVQA 5P8WA 2G40A 1L8OA 4RACA 3IX7A 1XQ9A 1R6DA 2Y0CA 3ZGNA 3UHPA 4Z1MA 3LLUA 4HVTA 5BWOA 2RGRA 1Y8RA 3AYXB 1L7NA 4TL6A 2I65A 3VUEA 4AJKA 3WO1A 1SZJG 2JIQA 2W93A 3CJTA 2H31A 2FSVC 3LK6A 4PTLA 4BECA 4HSGA 3KEQA 2YVKA 3RASA 4MS1A 1I3LA 1C1XB 3U3KA 1QTQA 4AQDA 2ZB2A 5EJ5A 2JBAB 4L4UA 4RJJA 2BMAA 1AU9A 1D4ZA 4GYWA 1OFHA 4XPIB 3SY8A 5AJUA 4BFWA 4BQQA 2HK7A 2FQYA 3FWHA 1N6IA 3LYLA 2FZVA 2QRKA 2MU1A 4MV5A 1XMIA 5U4XA 4E2FA 2P2DA 4M0KA 3G02A 1UDCA 1NOJA 2QY9A 2UU9B 1BX0A 1GCGA 1ODJA 5BMVB 2HA0A 2R2GA 2X0FA 3FJOA 2NU6B 2ZT5A 1UMDB 4YJHB 2UVQA 4NCNA 3ORYA 5B1EA 2OWEA 2CV0A 4C5CA 4ZQIA 3QKRB 3ABZA 1EUCB 1RJ9B 1FRFS 2MT9A 4EW1A 1ZBQA 3PSAA 3USES 2PX5A 2I55A 2EQ5A 5DGXA 1TW3A 1NJ8A 4OA5A 3RC8A 3TMAA 3WMWA 3EWIA 1JHYA 5LQDA 2B4TO 2VP6A 1KTIA 1O6FA 5BO5A 2FUEA 3G9QA 4HUQB 4B3RB 5LP6F 1M2JA 1U3TA 4KQHA 4MPJA 2TRSB 1A8HA 3DV9A 3SLKA 4B48A 3GCXA 4F2LA 1GVNB 4P84A 1Z4KA 3QPWA 1I4DD 3NP7A 1GP2A 3J7AC 1TZ2A 3QXCA 4J7CA 4YT4A 1ZJZA 3LUPA 3B13B 2PKQP 4OK3A 2IWHA 4FCVA 1P18A 4PNZA 3EDQA 4PIMA 4M7RA 4C5AA 3MFQA 2QBYB 2M6RA 2FMIA 5CLLA 3D8NA 4ZYYA 3OHMA 4ICIA 1XJ0A 3LNTA 2WZBA 2Q0SA 3L8YA 3V4ZA 3UHFA 1BJRE 3OZXA 4JGIA 1Y9DA 4WW0A 4FQ7A 1KOFA 1D9XA 2QTFA 3MGGA 3GAFA 1T8WA 4MI3A 4AO7A 3EPRA 3L0OA 2YUTA 2HLDA 1GT6A 2Y99A 4ND4A 1QX3A 1SKMA 3VU9B 3TI7A 4LYYA 3ZBUA 5KTNA 4RZ2A 4WK4B 1OKKA 2OBBA 5AKLA 3B89A 2BFFA 2Q62A 4Y9DA 4HEA1 4YPVA 3RGPA 3LK7A 3MM4A 1Q83A 4XPZA 1L2DA 3G9XA 2Y93A 1Q2UA 4HDSA 4RQAA 5SY4A 1FQJA 1UH5A 1JT2A 1Y8CA 3DG9A 1FPQA 4MCAA 1YASA 3EBLA 4AJIA 2DTEA 3PC6A 4PLVA 1YR6A 1GA1A 3LSYA 4WZ6A 1EINA 1HF3A 5JCJD 3H6KA 3FYUA 3WGIA 4CTJA 4EG4A 1FL9A 4WOKA 4LHXA 1Z06A 4WH0A 2O5RA 2ZXFA 2KZSA 5FUWA 2DBZA 4E7PA 3KUCA 4D25A 2CV2A 2GM5A 3B7QA 4UM9B 1O97C 2PTHA 3VFDA 1UZAA 3OOJA 4F9TA 4DQ0A 5CITA 2EYQA 4EY4A 4KQMA 4B8YA 3M4ZA 4DM7A 2Q9CA 4MYTA 2B21A 4CIWA 3BBZA 2Z56A 1J97A 1BX1A 3U7QB 4R8RA 1GSOA 2WE8A 5G0WA 1V92A 3FOWA 4J7UA 2OV1A 4UATA 1QE5A 3UCEA 3MUEA 4I55F 4GI7A 4X8HA 3UJNA 4LV5B 4LZWA 2PD6A 1VHDA 4HB2A 4L6CA 3W4KA 4ZOLF 3P0JA 3U49A 4MUBA 2DR0A 2OT3B 1CQWA 3FNIA 3IQEA 3K9GA 2WHYA 3ZIAD 2CUTA 4GBJA 4RHFA 2XTMA 5DHRA 3Q8WA 4PGGA 3U81A 4XJTA 1SQFA 1T6XA 3ESBA 2G17A 4DMHA 3EZ7A 3UUWA 1JN0A 3U44A 2GZHA 5ALWA 4KQ9A 3L0YA 1WPGA 3ZDQA 2VEDA 3EZNA 2JH3A 3LQKA 1MB2A 3OURA 5SY6A 4DZRA 4V0LA 5AJVB 5AD1A 3IV6A 2EF0A 1MLDA 1UCFA 4DR3B 1O58A 3GU3A 4Q39A 4KXVA 4BLWA 2I78A 2GM3A 5E8JA 4X65B 2ETXA 3GP3A 2AEMA 1LTKA 4GOKA 3SI7A 5F3DA 3AETB 1PYDA 3JQGA 3FPAA 3BK7A 4HDNA 4LFBB 1VLJA 3DZBA 1OAOA 4U7JA 1T35A 2LDXA 5IYZF 1DFHA 5AKJA 1JFFA 3PT9A 2VI5A 3BD8A 3HY6A 1YDMA 1VEGA 3IIMA 3ZW8A 2AXEA 1E2JA 2QU7A 1CW2B 3F5MA 1E7YA 4DUGA 3GLIB 2GEJA 4BN4A 1TM3E 3STXA 5I9IA 2YW9A 4Z54A 5JHGB 2J1LA 5A2GA 4HNGA 1PR2A 1U7WA 3WISA 4DT1B 1BMTA 3NQ41 4E0BA 4OQQA 1ESZA 1KO7A 5FA8A 3GVCA 3MCWA 4ACBA 2VP2A 4UHEA 4ZRNA 3M8KA 4XCQA 4KREA 1MDFA 3LCJA 3RRZA 5LUAA 1KNQA 4CKCA 4CTNA 4NICA 2QLNA 3TIVA 2CFOA 1DWOA 1OYWA 1THGA 2JFVA 2VNIA 1SK9A 2XTNA 3W79A 4R98A 4AW4A 1W25A 4BXOB 3ZDDA 2DWQA 4KR9A 1KZ4A 5A7HA 2ZAOA 2PZGA 3EXG2 2LIVA 2NUPB 3HWRA 1I14A 4PO3X 2Z43A 1TDJA 4ZCMA 1H93A 1OROA 4FN5A 1EVKA 1PLKA 4NVRA 1A8UA 4P0TA 4RZUA 3MQ2A 2JA1A 1UBSB 3U1TA 1DBVO 4GXTA 5IUKC 5HW0A 4WXEA 1YDFA 2OECA 2WU1A 4DWJA 2QROA 1K92A 3SOPA 3O0TA 3IMCA 1GL3A 2Y1KA 5BOSA 1RT9A 4HTFA 4D5EA 4Q1VA 3DNPA 4FFBB 3HCOA 3WB2A 4DLSA 3SVLA 4J90A 1FW8A 4NXMM 4B7GA 3P9CA 5DTMA 4M8NE 4ZVNA 1DQYA 5ALOA 4WZZA 1L5KA 4QNNA 4UVEA 1JU3A 3SZOA 2Q29A 3ZOZA 2QN1A 2H7CA 4NCKA 1T9ZA 3RV4A 3ILKA 3HHWA 5IXJA 3CONA 4ZXFA 3GJZA 2VZ8A 4REMA 4RD1A 3A3PA 3E0QA 3BEOA 3I72A 3UM9A 2QA5A 1IHXA 2XNHA 2WIAA 1UBHS 4ZDJA 3VOBA 2ZS8A 2AN1A 2FOIC 2WG0A 4E09A 5CXUA 3OIFA 3EHDA 2C4KA 4FDTA 2ZB7A 4QUJA 5ICCA 2VTKA 1OV6A 1LDGA 5ALIA 3FXAA 5B7GA 4JLAA 1Q44A 4YK7A 1RXEA 2BKVA 3P1JA 4WP2A 4FEAA 3DOEA 1GPJA 1SVIA 2X0KA 2ZI5A 1VCMA 3A28A 1RACA 4GRDA 2YX1A 3AKDA 3PQ7A 1PR0A 1M75A 2Q9UA 3RRMA 4U39A 2P6UA 5T67A 3RARA 4R9SA 1PYOA 1Q39A 3RHZA 2X8AA 1T2NA 4QT4A 4PSVA 4GH5A 3SBEA 4JBHA 3MT7A 2AS0A 1DRKA 5J2UA 2AI2A 4WFQA 1E2EA 2PBZA 4FNOA 5GMOA 3S7ZA 1ZMTA 3IP6A 2IS4A 1YCGA 4M83A 2ECPA 3PHIA 3U5ZA 2V7EA 3I9FA 1AZSC 2GNAA 4DREA 3U6CA 1CR4A 1M5UA 1UKYA 4JB3A 4K86A 1TYDE 1ICEA 3QPAA 2G5PA 4XWYA 3KO8A 3HJQA 3KTAA 1ZUD1 4CM3A 4LC1A 2VSXA 2C95A 5L8VA 2XOXA 1Z83A 5JAMA 1CYDA 1J22A 3EZXA 3GFQA 3CIFA 1SC1A 3NBFA 4EYQA 1GM5A 5GJCA 1QB8A 1I5RA 3B78A 1DMRA 1N6RA 1G8SA 3WLPA 2QD4A 2VJMB 4E70A 2J33A 3CHYA 4EYKA 4Q12A 3DQZA 3MWKA 2PFKA 2C3YA 4IOJA 5HA5A 3WK7A 2NQ8A 4HEQA 1L7VC 5LXTA 1VJ0A 3QU4A 4UNSA 3M1AA 2DETA 5FNZA 2PPLA 4NATA 4M49A 2Z9DA 3HEAA 3ACDA 2C7OA 1GTMA 3E9CA 2VDKB 4B74A 4GLFA 4P92A 4Q4CA 2CL5A 3PYLA 1MQSA 5JXJA 3KD2A 4OU5A 3RF6A 3GQ4A 2QOEA 1T8RA 1GITA 2E48A 1QSGA 1QRAA 1SKAA 1IZ9A 1FS6A 2RBKA 3HSYA 4DARA 2FPPA 3O5AA 5L51A 1P33A 3CH4B 1S02A 1PG2A 1FRNA 2PM8A 4YCBA 2CUNA 3L6CA 4HNSA 2X7HA 3FNHA 3TSAA 3UXHA 4RPGA 2FR8A 3WWYA 1G20E 4K26A 3OCWA 3FOFC 3W68A 4HS9A 1TO1E 4AKSA 3KPJA 5K6RA 5JEEA 2EP5A 4KYVA 2Y6VA 2WPDA 2BGLA 1A8SA 4RORA 3V8NA 5KYYA 5JJCA 3MTQA 1DZ3A 4AUKA 5B57C 1E0SA 5DMHA 1ANKA 1ZMUA 4PG5A 2HW8A 3ICQB 3RANA 5DO9A 2BE7A 3GEGA 1SHLA 2P4EA 4LX8A 5DI9A 5AXDA 2D1TA 2VIIA 1WMSA 1O0CA 1Q3TA 1Z33A 3LPLA 4NU0A 4J1TC 2VWHA 4DE5A 3NTXA 3RW9A 1LEHA 3JALA 1TQ4A 3WBBA 1LRLA 3UT5A 2JI4A 3H5IA 2WKRA 1NQUA 5ELLA 3L0IB 4L5YA 2V96A 4HLNA 1TU4A 4UNRA 3II6X 4DBVO 4LF4M 3UHJA 1RKQA 3JV7A 1QZMA 3BD6A 3QFSA 3TRIA 1V5FA 2OCYC 1ILWA 4JOCA 5KBYA 3LT1A 2W2QA 3DOAA 1N3YA 1DKQA 1OJLA 5DKFA 3V1TC 5ITYA 2FK7A 3DC2A 1QU2A 3BE4A 4MW5A 4AZ3B 4EW6A 1XAGA 1IBCA 4B7HA 2P69A 2WWHA 4OH1A 4R2LA 3HGMA 5K4HA 2W9XA 4J9UE 4MA5A 1MABA 2Z3VA 4I50A 1V3QE 2HHHB 4FYXA 4PRKA 5GONA 1ZSVA 1NURA 4GC9A 2IDZA 4Z3KA 1C30A 5HGJA 1UXOA 4F46A 1G8YA 3M5CA 3P2MA 1FDRA 3OP4A 1B41A 2BELA 3AY6A 3GN1A 4RH0A 3KCQA 6REQB 3CLTC 1ID8A 4FJ0A 2DT5A 3IT3A 1DIHA 4Q01A 2B5OA 2FSHA 1GZVA 1IBKB 2GN0A 3DBIA 2O0LA 2C2ZA 4M98A 3EQ9A 1UK8A 1YV9A 3IDSA 4X00A 1KYTA 3ET5A 4GPBA 3WQQA 1Q0HA 1KARA 1QANA 3BWVA 2IUFA 3DL4A 2C57A 4XGNA 4LC0A 3B9PA 1W4LA 5AOVA 4UXIA 4Z7JA 1BS9A 5T4HA 1WMAA 2E21A 2VWQA 3A9UA 1X2EA 4EUKA 2HL7A 4H77A 1U28C 4G4RA 4D0RA 1CJMA 2H1OA 4ZT7A 3OIDA 4HGQA 3MMNA 2OHJA 2OAQ1 1IVNA 4G0VA 4URUR 4WJKB 4O4IF 4G24A 2I7VA 1Y9AA 2GKSA 3JQAB 3MGCA 3QLEA 2Q3BA 1RWMA 1CPYA 2JVIA 1I3KA 3P4YA 3BL6A 1BTOA 4ND8A 1A7AA 4G86A 2BHTA 3T34A 1EWRA 2GF2A 3ESZA 2XNDA 5CEJA 2LWIA 5F5NA 3MRTA 5AVXA 2UZ3A 4KQJA 3FYTA 3OIUA 4BIMA 1GPKA 2PT7A 3P96A 2HU5A 3B6KA 4G56A 3QLUA 2DWUA 1XWIA 2A5JA 4P38A 4GI2A 4P53A 4CM8B 1D6NA 1KO1A 2HMWA 4OGLA 3PQ2A 3AT1A 3O26A 2NT4A 1JR3E 4X7RA 5F2KA 1GZ5A 5LD2B 3OFND 4LJLA 5E1BA 5TQ0A 2I5PO 4BEVA 4CKBA 1WVMA 3F7MA 2NO1A 5TDHA 1Z25A 3TXAA 4LXTA 4H08A 2GN8A 4EI2A 2XTZA 1H9AA 4TXNA 1XF9A 4H7IA 3JX9A 4P32A 3A4MA 5K20A 2WA2A 1E4EA 2Y1LA 1IJEA 2DHRA 3PF9A 3R6WA 2CHQA 3ZDZB 3RFFA 3PYMA 3GT0A 3BL8A 2QTCA 1Z0AA 2BFNA 4D9NA 1S89A 1OBCA 1YU6A 1D2AA 5DZSA 1QC5B 4IIHA 2GLXA 3PDCA 3KVVA 4GE3A 2XCQA 2FZ4A 1KRXA 2AQ8A 3KEGA 1VG9B 3C85A 3PR1A 4LFCM 2YH2A 4GI5A 3ORQA 3L8CA 1TFUA 2JLYA 3PENA 1DTSA 4RHYA 1XDZA 4GHLA 4EEKA 4IH4A 4BFVA 2X49A 1JHRA 1CUDA 1Y1RA 3BGVA 3RTBA 3M7IA 4X94A 5HQJA 2WIFA 4XLTA 1ZRNA 4M89A 2E85A 2INGX 1KDPA 5IULC 3ENVA 1LPSA 3HVIA 1M10A 1T9KA 2HIMA 5BVGB 4TZKA 2TMDA 4HLUA 4EPXA 1KQOA 5AM0A 1XWWA 3OH8A 4R51A 3O8BA 1EG2A 1K1EA 3SEQA 4TTQA 3SSNA 1LU9A 2P9ZA 2DUMA 2XF2A 3EEFA 1CQIA 3D3EA 2QQGA 5LQUA 3TM5A 2AT1A 4UW9A 3VHLB 1QDEA 4L8FA 1J2UA 4RKRA 3AOEA 3ISJA 5I8WA 2ZUCA 4G89A 2IZOA 5TPZD 2BFOA 3RTGA 1M67A 5K3FB 2CNDA 1E0KA 3OE7D 5AM5A 4DCMA 4BLPA 5HWSA 2LVBA 3HGQA 1YFJA 4FP9A 2QTNA 3C5WP 2CYCA 4QFDA 3GLFE 3ZEAA 2Q5CA 2QTLA 3E3MA 3TKAA 4L3OA 1ECPA 1H3FA 1QHIA 3BGIA 4TV9A 2N46A 1WCIA 2DB3A 1XTTA 1CJTC 1P1HA 3A1FA 2ZYGA 4OBWA 1WBJB 2HCBA 1O5OA 5P21A 4BVBA 2FZ5A 5A4IS 1BQ4A 5AHWA 4L50A 2X4GA 3LUHA 1TMGE 1DAHA 1VIVA 5CGZA 2QAIA 3UG7A 3KVYA 1JWBB 2VCHA 2FWMX 2ZRBA 1QO7A 1H4SA 1V34A 3U4HA 4A1FA 1KTVA 3KBBA 3SDSA 1NUQA 4LF5M 4KBFA 3HDTA 1P2UA 1U1IA 1H8HD 3DKRA 2X9QA 1KZ9A 2P91A 3ETCA 4EHAA 4P3KA 1ESMA 1BMQA 3OPYB 4ZIRB 2GZ3A 3U4IA 2BNKA 4PX3A 4PC6A 3TBHA 4FB4A 2R97A 4ESEA 3S99A 2UYQA 2DUNA 5IPFA 2H29A 1ESDA 3PQ5A 4UBJA 3K7EA 3PXGA 2I99A 4UHKA 5AI4A 1C1DB 2R6HA 4YQZA 3D4OA 2ZJ0A 2GBCA 1CCWA 2F43A 3NWJA 4B7UA 5IN5A 5C3MA 4UUPA 4JBWA 1MJ5A 2Q0QA 3ETDA 1NUSA 2HQ1A 2FZWA 2P0YA 1T10A 1XRRA 3T5PA 3EMDA 4CMHA 4HCJA 4BPRA 2V6MA 2WIKA 5ADWA 4RA6B 3I12A 5KNCD 1XTPA 2ZVDA 4DQUA 5JXGA 5HBRA 4PHCA 4MUNA 2KBEA 4LJ4A 4IRUB 4DLBA 1Q1AA 2KYRA 4IFTA 5TR9A 1H6BA 2W6ID 5I7HA 1XMQB 1UT8A 3UA3A 3B52X 1OYYA 1SA0A 4NENA 4QOFA 1K7FB 4JJ7A 2HSZA 3JWIA 4Y6GB 4G9EA 4DPMA 4R1UA 3FR8A 4J0QA 4Y2GA 2NPFA 3NKVA 1EXNA 1XYGA 1O94A 1F12A 1EXDA 3B9RA 1EGMB 5JQGF 1BWRA 2G9VA 4Y2XA 2ID8A 4GRAA 5LOVB 1BRTA 2LVAA 4A23A 4UUQA 5TC4A 3N58A 4UVDA 1EX6A 1NM5A 3UBTA 2GTHA 4PPYA 4AZ0B 2H9AA 4U4AA 2YIJA 3BK2A 5HQ3A 4JSTA 2A2ZA 4QLBA 3TW4A 2FR1A 4TL7A 3L41A 3M3DA 4C88A 1MB0A 4G41A 3RADC 1TUBB 4I0WB 1H2YA 1IPHA 4C20A 1KSFX 1Y9EA 5JS1A 3WWEA 1IUNA 1UADA 4Q03A 2Y9MB 2B4QA 3W7AA 4JLJA 4RKYA 1Y1LA 2VNKA 3GEEA 1PNQA 2IXEA 5JC8A 4Z6YA 5HG0A 1HG1A 2J31A 4GKKB 1JFVA 4GMKA 4U2EA 2Q6KA 2I1VB 3BWMA 1RXSA 1GPDG 2CJFA 5HKBA 4G3XA 5IABA 2B94A 5CG2A 2XJ9A 5LP6C 1TH4A 2RH5A 4KLCA 3HVHA 4ND3A 4QYIA 1FFAA 3OQMA 1SEVA 3DTVA 2I91A 3DVRX 1TC2A 2B0JA 1MPXA 2GSWA 5SZKB 4QM7A 4PGAA 2VRCA 2Y2UA 1OLXA 2CCGA 3ABQB 4OKNA 2PG3A 4BQFA 4KXQA 1HZJA 3D64A 2IPLA 3V1UA 4DEXA 2ZWIA 3L1IA 4S05A 4ITUA 4OXKA 4GPAA 3SYRA 2CZGA 1JI0A 5CUQA 2ZUUA 4BLRA 5FH9A 3L18A 5ALZA 5YASA 2IITA 1D1TA 2L2QA 1P0MA 3EAGA 1OIZA 4KMMA 4A2WA 2FX2A 3TAUA 2VH5R 1IFYA 3D0QA 3WGNA 5JYEA 3IMFA 3GQ5A 1NI5A 1Y6RA 2AG0A 3C4JA 4DHWA 1G8KA 5IBCA 2BGRA 3CH7A 4WECA 4IFIA 1DGGA 4HWSA 1KR5A 2P6MA 1KP3A 1BGVA 1EZ4A 5F76A 4HXYA 1MRNA 4ZYUA 1NR1A 5JO9A 3E7XA 3TTTA 1T5TA 1D3AA 1EG7A 2CUKA 1MJFA 5FPSA 2PO5A 3ZQ4A 4PZCA 5IAOA 1I2DA 3TSZA 2JGMA 3KP1A 1U2DA 3ZDBA 1BROA 5JAQA 3VKFA 3VAYA 2BGGA 4OY3A 1C81A 4IYRA 2PYDA 3OQBA 5HDQA 2H2DA 3CBGA 1YQEA 3PUKA 3NHPA 4PCZA 3RTAA 3U7FB 3DO8A 3OMWA 4CDRA 1JFLA 4KTVE 2GB4A 4C3ZA 1JU9A 1DWUA 1GG2A 3ACBA 2C2YA 2APLA 3WLOA 3JYNA 1XRPA 4KDEA 2BR3A 3IEVA 1TCVA 3AH8A 3ZGYA 1PX0A 1XTSA 1OLSB 3TKYA 2O05A 5I45A 4CBVA 4GWLA 3IDOA 4DM4A 3O4VA 3AV3A 4B9EA 3UY4A 1FYFA 1IG3A 3ZQUA 1N3IA 4P5PA 1T4MA 4R8VA 10MHA 4Z0TA 4HNVA 1FMJA 4J7XA 1FC0A 3ODPA 3RYHB 2CMGA 4IHKA 4LF8B 2ZRPA 3T1YB 1DMSA 1L2CA 3DE2X 5KOHA 1OHHD 5DX1A 1K4KA 2H4ZA 4RKEA 1QO9A 4DMRA 1SVWA 2QTAA 5DX0A 2ZBKB 1F1BA 1QJ4A 3D7LA 2VDLB 2CL7X 1HZZA 4HAIA 1ELOA 3SHFA 1ACLA 3CLRC 1AQJA 2WJZB 1PJBA 3W67A 1E6CA 4GPEA 3IVXA 1HE3A 4MUJA 3MF4A 4C4ZA 5J43A 1X80A 4GU5A 4FE7A 3RBZA 2I03A 5JZBA 4LGCA 4CG2A 4DV6M 4EGFA 1U11A 2GERA 3FYDA 3GPLA 3HU3A 2WMDA 3ZU4A 3PDIB 2XEPA 5GM2A 1M2FA 3ITNA 3QYPA 3OIVA 1M2KA 1ZEMA 2V03A 4GMXA 2MGWA 1YE9A 3U60B 2GBFA 5KWVA 1YVRA 3D1JA 2VDPB 1SVKA 1CF2O 4YJGB 1H4VB 3UICA 2HWKA 4QJ3A 1JIIA 3OVMA 5IC5A 1WU7A 3GLHB 1K3WA 1ADFA 2H5XA 3TZKA 3AL2A 1C2YA 1N7JA 2R11A 2WJWA 3T3DA 2LTUA 5HMMA 4O2AA 5E6UA 1EHYA 5I51A 2F4VM 3M4JA 2IS1A 1YVPA 4X41A 5TVGA 2OZPA 4KYTA 5AW8A 1X7YB 1NBEA 2CSXA 4OHZA 5HJEA 4F8EA 2DY0A 3PVCA 5FLYA 1I6MA 4E30A 1FYDA 2W6NA 3FB1A 2ZYSA 3NHWA 2VQEM 4LWOA 5BV7A 3VVMA 4O4HA 2D74A 4UU1A 3LBYA 3QOXA 1YD7A 1CE8A 1GQFA 4GD3Q 5IC6A 1X7ZA 2PUEA 2DPLA 2P3LA 1KKMA 1RNLA 3FNRA 4NCAA 3SF8B 4M9ZA 4JL8A 3KOOA 2MYNA 1GKYA 1LWNA 2JZ1A 1ZESA 3P4XA 3HHZA 2XYGA 2E89A 5JG7A 1CUCA 4G5XA 2HDHA 4UTOA 1WJGA 3EARA 5HKAA 8ABPA 1IUPA 2QN7A 3FCYA 3UUGA 4W8GA 4UBOA 1DU4A 1PD1A 2XT0A 3S2UA 3TAHA 1IM8A 4N3AA 1XE3A 1WSWA 2WF8A 4BMXA 3L0SA 2JGIA 3OOYA 1R2ZA 3RVLA 2YJ5A 4PIPA 2JANA 1Q1GA 3DTYA 3ZZ1A 2GBGA 2JBHA 2BMDA 2ZRAA 1TZBA 4AG5A 2KBFA 3TO5A 3KXKA 4LBVA 1JHQA 1F0KA 5KX5A 5I7UA 4KQCA 1G1AA 1A95A 3AHHA 3UV6A 2LIPA 3X1JA 4RIFA 4CLHA 1IRIA 3T9DA 1KWKA 4EBBA 1G3RA 1LTQA 1MAVA 1U3DA 3VLFB 1VXOA 2RB4A 3DBRB 3UJBA 3A1DA 4QZVA 4PANA 4B6JA 2FJUA 1M1ZA 2YV3A 2W6MA 2QE7A 5BRNA 1KBQA 3Q8MA 4HSEA 1J0DA 1XU9A 4FGSA 2B7BA 3DLPX 1UIMA 4NJOA 2XOKA 2GYWA 4QSMA 5KPRA 1FLDA 7AT1A 2Z57A 4PAWA 3FIJA 2IC5A 1G7CA 2Q28A 3NVAA 3M7GA 4JT8A 1QO0A 3AF6A 1HTWA 1W5TA 3KP0E 1I4OA 1J2EA 4NCJA 3VISA 4LTDA 3C8DA 2YJTD 1W94A 1Y1PA 3KU4A 3UBMA 3N3BC 1IOLA 1GCOA 1KI2A 4U0JA 2Y4OA 5B1DA 2H1CA 5G4LA 3Q98A 1JR6A 4Q7KA 1M6VB 2QSYA 2VSQA 3OZDA 4CEHB 1IOWA 1RIFA 4F3TA 2YY5A 5ETJA 1L4FA 3QTBA 4KL8S 2KNAA 5FPTA 5A3QA 1K89A 1TMKA 3CRQA 4IEIA 3RNLA 4LMAA 1CY7A 1QTIA 4C78A 4ITRC 4YQFA 2YN2A 1JHAA 4LXXA 2Z6QA 1IB6A 4BVEA 3OZRA 3PITA 1KC1A 3H0KA 1NZDA 2ZQYA 1UKAA 3EQZA 5C8XA 3IB3A 1CDZA 2JDID 4QUGA 3MPUA 3U4CA 1H85A 2PX2A 2ARKA 3H5AA 3HO1A 5KNBH 3KR1A 4HGZA 3W9BA 2R1UA 3V7NA 4IXNA 2CYBA 5IJXA 2DLNA 4Q82A 5AJYA 1T4DA 2PLRA 4N0PA 4JJZA 4DRXA 3HFJA 5JI2E 2L7HA 4KQ6A 4KUHA 1RJWA 4PVDA 4B08A 4FUTA 4MYUA 5AW2A 5DMXA 1KIFA 2HIHA 3K30A 2PO7A 2LWXA 2KLBA 5IFKA 4F91B 4OQXA 5G0UA 1WKBA 5CFLA 1I4EB 3G23A 1CQJB 4XR9A 1T0IA 3A2NA 2G9ZA 3K31A 4C1BA 4TT3A 5G02A 2O19A 3PVZA 1IDN1 1IHYA 3ODGA 2ORED 2R6DA 3F74A 4MO2A 1DWQA 4F92B 4Z6KA 2CE2X 2WIJA 4RDCA 4PYQA 1VKNA 3T41A 5ADUS 5BNZA 4MV7A 3RJ9A 4AJ9A 2QI9C 3BERA 4UKDA 3VOTA 1JQAA 2VJAA 2WJ6A 3RFXA 5BUZA 2FSUA 3MD0A 3WZ2A 5AW1A 3AEZA 2WW8A 3GLIE 3WSVA 3CEHA 3SR3A 3IQFA 2L09A 4MICA 5AKXA 1T3SA 2GKOA 2TECE 1HT3A 4TRJA 5C7IO 4NZNA 2ENWA 1YK1A 4LSGA 5CDFE 4ZDIA 5CH8A 3TOZA 1ZRSA 1C50A 1ESCA 3KSUA 2E9SA 3G8BA 4RH3A 3SF0A 1H2ZA 1RADA 5KNDH 3MGAA 2NAPA 1GT91 4PDIA 5DK6A 3P32A 4V0NA 4V1CB 4G2TA 1V7PC 4B6RA 2H8KA 3WIEA 2FUG1 3PCRB 1EBBA 3D1LA 1ZI9A 2PS9A 2JJ8A 1TH3A 4AECA 1U2RA 5B5SA 1SVLA 1I1HA 4UTRA 5B7NA 3U0VA 2Z8YM 5JWOA 4Y9TA 2ESRA 4YP9A 4ND2A 1GR1A 2BUBA 2OO5A 1V5IA 3RABA 3EBPA 4EUNA 2JHCA 2YWCA 3IUMA 2MYTA 3E15A 3CSUA 1ZH8A 3NM6B 2HBZA 4LF6B 1XMOM 3H5RA 1D0KA 3A6EA 4H7KA 2B7LA 2BH2A 2YZKA 1YKSA 2Q6VA 2H0AA 1W75A 4RD4A 3E7FA 1PR4A 2PKEA 5KDOA 5DBEX 5KINB 5CNKA 4UNIA 3IALA 1FDUA 3N8KA 4A91A 3NHYA 3ZR4B 4AG6A 1R15A 2P8JA 5LQSA 3IBFA 1D2EA 1PRYA 1NQAO 5C8YA 4REQA 3HXOA 3CRVA 2PA3A 5TJHA 4ZVRA 1PBNA 4UUMA 3UN1A 4A26A 5CYFA 2GARA 4Z4GA 2NP7A 3PQEA 5CFRA 3UMYA 2WTBA 4BS9A 2BI7A 3T52A 2D5BA 3X3HA 4A0SA 4M1TA 3T7SA 2WSBA 2YINC 2NZ2A 1EAMA 3E8XA 3MWGA 2VPTA 1K98A 5SYMA 3WB1A 5JSKA 3BCHA 4YMHA 1NI3A 1ORDA 4GKAA 1FF9A 3EE6A 5L95A 4P3NA 3EOBI 2C9OA 1N2ZA 2RRUA 1RLIA 3A8TA 5TGTA 3OFSA 1PFWA 5BOVA 4KPFC 1P3QQ 3NORA 3VO1A 1OQYA 4GDMA 1JEYB 3G2JA 4IIJF 4WBXC 5EHXA 4MX8A 3I0MA 4F3YA 4F6RB 3R09A 4OMFG 4TQ9A 1FQKA 3K05A 4BX3A 3K1YA 1R0SA 4ZTZB 4RE5A 1UBFA 2P75A 1UKZA 4ZD6A 5FPPA 4CPDA 5KTMA 2DAGA 4OJQA 2AXPA 4JJ6A 3BIJA 3GJ4A 4V2UA 2QLFA 4F86A 1Q7CA 2H4FA 1M54A 3R9XB 1ETUA 5CDSA 1U4NA 3QX8A 1G63A 2ZT6A 4G36A 3GJ0A 3KB2A 4NR0A 3CTWB 3FPJA 9ATCA 2XYPA 4EVRA 1NYTA 1Y4SA 1LTMA 2BEUA 4ES6A 5C35A 1Z6QA 3BAZA 2TMGA 4RKUF 3TLCA 3IBCA 2JJYA 2A0UA 5FWXB 3HKEB 1UL1X 1TB4A 3QKUA 4WA7A 4MJXA 2J46A 3AZPA 5JE8A 5IMSA 3OTOM 2H1VA 1QB7A 1LDNA 3HB4X 1N6PA 2GZSA 5B1HA 1T15A 2X42A 5EUQB 4I6EA 3U16A 2ZVJA 3AC0A 3ROMA 2C29D 1B14A 4HPXB 4YCNA 2JH9A 4JS0A 1TYEB 2BMFA 3PU6A 5AVKA 3BH7A 4P4TA 5M34A 2M5ZA 3AEQA 3UK2A 4Q4JA 2YXEA 2WJ3A 2I6GA 5FUXA 4CI9A 1LK0A 4ZVVA 4OGGA 5HFJA 3NRCA 2BGUA 2H4XA 4U3JB 5ITTA 1LVHA 5KIAA 2Z04A 2ZBEA 2ECFA 4GXQA 2ZJ3A 2JATA 4RMJA 2CJXA 4ISBA 2Z4SA 2X8JA 4FOLA 2Z30A 3LRPA 2ZIEA 4WURA 3UGQA 3ZCBB 4M8LA 2ID7A 3I9NA 1YONA 4WE3A 2ORYA 2Q4EA 1KETA 4JEUA 1Z5NA 4ALJA 4V0OA 1OD6A 4E15A 2E5LB 3MWDB 1ADBA 4FHEA 3IV7A 3VGJA 2JJ1A 4GR5A 5K2MA 3KOYA 4KPGA 1FZTA 2IYOA 4KNVA 3THSA 4P83A 3QFRA 4OQNA 5EERA 1G6KA 4RK6A 2ZTMA 2CVOA 3LOPA 3M4YA 2M60A 2GMWA 3E1SA 2BUCA 4XIIA 4UZFA 5LBIA 3DT6A 3MJ4A 3W3AA 3GRYA 1HDYA 3HKCB 4Q47A 2CEKA 3SM9A 2AOTA 3RVRA 2O2IA 3LW7A 1N2IA 2H2AA 3K6KA 3C6BA 4QPNA 2F3QA 3WYEA 3WK8A 5CB4A 3N2GB 1Q77A 1OTXA 5E3IA 3FG9A 1U1FA 5DCYA 4EFLA 3IRVA 4UULA 3KTDA 3MAAC 2CXNA 2YJGA 1L6RA 4YVFA 3ZJYA 1BHJA 2ASEA 4KAFA 2G04A 4BNKA 4JB0A 4LISA 2NO4A 5LIPA 2AR9A 3OQIB 2HPHA 2P2YA 4XB2A 4JR0A 4DLPA 2BFMA 3V42A 3E23A 1EP2B 1CY4A 4MYSA 2PFGA 4E2WA 4G3OA 5ALEA 4RHCA 1MG0A 2Q99A 4FDLA 1OB2A 3UKDA 2HU2A 1IL0A 1UK9A 2W2MA 2X19A 1TU3A 5ESXA 1DEKA 2JAPA 5DLPA 4M87A 4TSFA 2OKGA 1ZJ5A 4V0KA 2XVYA 1P3DA 1V8OA 1SUPA 1MVNA 4ZARA 1YDEA 3GVPA 3CEAA 3WI7A 1BHQ1 5I47A 5AT1A 1PNRA 2FEOA 2POCA 3CVJA 1Y6GA 1H2EA 3TGPA 3L07A 4MQFA 4U2CA 4GR4A 4XX0B 4U9UA 5FPQA 3SKXA 2PANA 4J7AA 2R7LA 3SEZA 3LE8A 4UVHA 4ZVUA 2H16A 2WIGA 4KH1A 5LYJB 2QV7A 4GEWA 4EP1A 2V7WA 4EMSA 5JVDF 1NBMD 2CP8A 2J9ZB 5ERXA 1B8PA 2VJPA 3LT0A 5IKPA 1AKWA 1Y5NA 3OSUA 5IJWA 2WJVA 5FI0B 2OVFA 3TQTA 2AUTA 3A4IA 4DNFA 5CVTA 4ZU6X 1A4UA 3FBWA 5M5BA 2PLWA 4Q5IA 2GH1A 2ZBFA 3ZHXA 1OASA 3COWA 4N3BA 1FNDA 2N47A 5LDGA 4J8PA 1E79D 4W5HA 3LVQE 4IFBA 3L92A 3KOWE 5KQRA 3WYBA 2NUTB 4HTAA 5A3RA 3I0ZA 1U1GA 5KAMA 2JZCA 3VR4A 3SE0A 2B30A 1QV9A 4QLAA 1N5DA 4U02A 5F1KA 4E2XA 1CY0A 1CR2A 1O6BA 1JJBA 2NU9A 3BKXA 5I4KA 4WASA 3VNQA 4RGVA 4ZC1A 1ADGA 5BSEA 2H2IA 1VC2A 2AQKA 3KSJA 4FHDA 2OZLB 1FDSA 3KX2A 4NZ9A 4KVGA 2Z1NA 2REQB 1SCUA 7REQB 2NMVA 5FEUA 4WNCA 2QSZA 5F21A 1M34A 2JLRA 2VBGA 3EGEA 2A0KA 3AHCA 1ZH0A 2DBQA 3BXGA 1VHJA 4H6XA 2QGZA 1W88A 4NS4A 5HVNA 3L8EA 3UMRA 1RAGA 1THZA 4W9MC 4I4TB 2B8TA 1PL6A 1I1OA 2FLWA 2MSWA 1LC3A 3MSXA 2OWDA 4JFAA 3HN7A 4LPKA 2OA0A 1QMGA 3HZZA 4DEYA 1JLLA 5F7OA 2ZS7A 4O4JB 2PIAA 3MFYA 4L5JA 4LYHA 1U9IA 2A4MA 1I3OA 2WJIA 3PFCA 2O6LA 2QMUA 1RI5A 5CLJA 4LWPA 4DQDA 3SKYA 3VHRA 3FTEA 1VDMA 3ZTWA 3KALA 1ZK4A 4XQCA 4RZSA 4MDYA 2IQIA 3FGOA 4HD8A 1ULUA 4LCJA 3TOXA 2WE7A 2P7HA 4LHEA 1VL1A 2G0NA 1L8AA 1EK2A 4ZHQF 3BMCB 3WR5A 4NFHA 1LBHA 1GDDA 3OZCA 4QECA 2CD7A 2V4MA 1XRNA 1JGTA 1MAAA 1OH7A 1YCFA 2V6FA 2VUIB 1G3IA 1C1HA 2XB4A 4HH3C 1OI2A 4MV0A 3KQWA 3TNFA 5GWXA 2ZU0C 4BO8A 2RHDA 4NDAA 2F8MA 4GMQA 3UKJA 4AJEA 3AVYA 2QI9F 1EVZA 2D8MA 4K6OA 4GIBA 1ZWKA 2HBQA 4ROTA 4AAYA 4PBTA 1E1NA 1CY6A 1AO0A 4WA8A 4KOAA 2A94A 3DH0A 4ABYA 1P4AA 3IQDB 2L0XA 2K4MA 3INRA 1BJTA 3JRWA 3USCS 3HDQA 3F96A 1X1DA 2ZAGA 4RJ2A 1GPLA 2VG8A 3LQ2A 1IXRC 3V4OA 4DG8A 1LVUA 4MH0E 5CMLA 1DE0A 3KAPA 5IH7A 2WSIA 3T4PA 3G9UA 2O8CA 4NPCA 2BC9A 1ZM3A 2OZKA 4JL6A 4G63A 4CEIA 2VBCA 3DNFA 2I4RA 2BBOA 1U5CA 3TLXA 1IY9A 1RWBA 2G09A 2YYAA 1QQTA 4M0MA 3WX0A 2A5FA 1OREA 2Q1UA 3PC3A 3CR8A 3OQ1A 2I4TA 2EQBA 5BWNA 3AFOA 4D3XA 1A4RA 2EZ4A 4XARA 5ALLA 4C2TA 1G0OA 3IT0A 2Q8PA 5JC1A 3IHKA 2D2VA 4DYHA 3W2IA 3UAYA 4MUKA 1V95A 3SXUB 3DA8A 3UAXA 3STVA 3PEUA 4TV8F 4DV1M 2D2IA 1TM4E 4Y2UA 4I8IA 3W0LB 3S44A 4FDVA 1UEXC 2VYNA 1FNBA 3GLUA 4OREX 1H05A 2UYOA 3DVAA 5GAJA 4NDNE 2RK3A 2F64A 3HUEA 4RK4A 4M46A 2RGGA 2YFYA 1ML3A 2XLCA 1RM3A 3C3EA 5IM4F 4BTLA 3JR5A 4X3CA 2EX1A 3ANTA 4YJ2B 1VMDA 2HAKA 1L5ZA 3OZUA 4A9AA 1L1RA 1KAMA 4L9SA 3K6JA 5CFZA 4IVRA 1CZNA 4NC6A 2B4YA 1YRHA 4E1VA 9LDTA 3OE4A 1KERA 1USKA 3OKAA 5IVPA 4J0HA 5AWFC 2CLCX 4LW8A 4AY4A 1GAQA 3QPDA 3JWHA 2G25A 3W5DA 1I2MA 2EKPA 3AZQA 4LHZA 4MVJI 5THKA 3QMPA 2VPZA 1TJ5A 1V2GA 4NY1A 2VHCA 3HL0A 1LLUA 1IZYA 4IIGA 4HH0A 5AUPB 1M1YA 4G07A 3ESAA 5EI5A 1T4CA 4WKBA 1G71A 1ZK0A 3ZCSA 2WYWA 1NPDA 3HUUA 2BJWA 3LKBA 2A6PA 5EQDA 2VKQA 1B7GO 2BFBB 1IK4A 3UOGA 1G4AE 3JR3A 2YQZA 2YTZA 1F0NA 2ZUEA 3ED5A 2HSGA 1VL0A 3RT1A 4OFZA 2XFSA 1EK1A 1VBMA 5LQCA 2R6GA 2VXOA 4HHEA 1XTIA 3TFQA 3M9LA 4Q4DA 3WNZA 2L19A 3IMGA 3D54D 2BGWA 3A2KA 3DKPA 5LU9A 3H1AA 4C6TA 2ZR0A 1SXJD 1MX9A 2BF4A 4H0CA 5K4AA 5A7GA 5I7RA 3RU9A 2GDJA 3LP6A 2H1SA 4IM7A 1MB9A 5L9AA 3O0DA 3R7BA 1QCYA 4I5DA 3UJ7A 2XZFA 5BV8A 2QS9A 4IS3A 4GUAA 1OFGA 4DIKA 2OCKA 1BAPA 3EWNA 4QIHA 3R40A 1R0CA 1DQZA 1F2DA 2DKOA 4WFJA 3MCUA 1DKPA 3EW7A 3DUFB 4G1VA 4F56A 3VNUA 1N4AA 1SBYA 1XPOA 1U8CB 3SK0A 1Y7LA 1MU5A 1X8LA 2Q2NA 1DX4A 1OIVA 3DKKA 2AN9A 1C7FA 2ZI4A 3RC7A 4DUZB 1K7YA 4UE3S 2OGTA 2QM0A 4RENA 1EWQA 2B1IA 4BGUA 4YRMA 1JPJA 4CCYB 2QE6A 3IP8A 1KH3A 4ABTA 1SHKA 2GA9A 2ZBDA 3KUXA 4EY7A 4JAVC 2FPGA 2R00A 3K6SB 2AG8A 1TD1A 2GYUA 1E2FA 3NMUF 1JS1X 4I1IA 1UPUA 5MFPA 4DR1M 3NVMB 3WYAA 1J09A 2Z4RA 3AVQA 2GJ8A 7CATA 5J4HA 3I09A 4Y2JA 1P2TA 3TBFA 4O2BB 5K09A 2GN9A 4HYQA 1BA2A 3URKA 2ZTHA 3SJAA 5DM4A 1NP6A 3NAGA 3GCZA 3ESCA 3B5JA 1OZAA 1RDFA 3ZVMA 4BB6A 3NNSA 5LCXA 1JG2A 4YAKA 1PHPA 1DJOA 3AM5A 4J4HA 2Y27A 3GEIA 1Z0FA 1XQXA 3PEFA 1O77A 4DJDC 3GZJA 2VJKA 3AR6A 1EFCA 2QRVA 1SK8A 4H27A 4ZI2A 1JG7A 4UHJA 1T1GA 2VTEA 1TD9A 3OCXA 1N0WA 1CUHA 2AJLI 4EITA 3GX1A 4TOIA 3PXBA 2P5YA 1FOEB 4RUKA 2NVBA 3PLAE 2IOFK 1K6IA 3F0TA 4L07A 2VQFM 4LX0A 1EFDN 1N6LA 3H83A 1OGJA 3QIVA 3PC8C 1M6YA 1PFKA 1SQSA 2QL6A 1LD3A 1OV4A 4V02A 1NX6A 4GXNA 3B1WA 4RMNA 4GPTA 5ILQA 3GMSA 2GHRA 2Q7XA 5EZYF 3LLMA 3KOUA 4EA8A 2JVJA 4IDNA 4GQIA 5ICEA 5JR3A 2BMJA 3FUTA 2ADOA 4EDFA 3AFGA 3WV5A 3GDOA 2QRZA 4FZJA 3MB5A 1A5TA 3OF3A 2F90A 2IBMA 1Z5UA 3O1IC 1P2SA 4DC1A 1MBZA 1Q21A 1PEAA 3OZVA 1YK0A 4CQJA 5JAHA 2ZETA 3IBSA 1FYEA 4L4RA 3ZE8A 1A9YA 4FYHA 1DX9A 1QS0B 3W6OA 4KKVA 1N0VC 4L1KA 3LBAA 4QUHA 2FQQA 1JL3A 4O3FA 5BURA 1SBNE 3QWBA 3TWLA 3LQ1A 3G0DA 4MROA 1C14A 4R8LA 2CK3D 5IUNC 4YRLA 4LF9B 4UPEA 5LQAA 1N8TA 2M9MA 1VYVA 1NJGA 4ZYXA 1NMEA 3OEWA 4RHTA 1YS2X 3M9WA 3QG1A 1RZ3A 4ZT5A 2PEZA 1INLA 1B8VA 1SCQA 1S7CA 4P4LA 2QVLA 4HRVA 4M3NA 4MRMA 1V1MB 2NVUB 1O5TA 1A8QA 2I29A 3AERA 5HGXA 5AJZA 2XGNA 2QLBA 1GN9A 3UJPA 3PB3A 3IV9A 2EKDA 5ESWA 3CX6A 1KJJA 5E7QA 4E07A 1U0RA 3SSMA 3GYGA 1A9XB 3U48A 2QPLA 4JP8A 4QXRA 2WNSA 4P82A 4J3FA 3A3KA 3VHQA 3B3FA 2JAXA 5FWYA 2ERYA 1VIMA 3GLSA 3D7NA 3P0RA 4RDHA 4IIEA 5DM60 5FTLA 3BORA 4Y6RA 3SZ3A 1RD4A 1T4BA 1VRVA 3GRCA 4HDMA 3H84A 2O59A 2HJGA 3IEXA 5AI9A 2GPAA 3A6JA 3IE2A 4UNPA 4B44A 2GXAA 5KYTA 2N0SA 4H17A 2GCEA 4LMRA 3LC7O 2C5BA 2X1MA 1H0SA 1AHIA 3L1VA 3OUUA 4WK2B 1QKJA 4DV4B 1TYBE 3HEMA 1P44A 3ZV6A 3P9XA 3PHCA 3I5UA 3SOZA 1TADA 2CFSA 4AVYA 1WVGA 3E5HA 3QBJA 3GG2A 1T1RA 3QW4B 4NV3A 1VE9A 4LJSA 4RS3A 5F2EA 2MWMA 4US0R 4BMPB 2BSQA 3Q6NA 4FWDA 3D3NA 4CFSA 5C80A 1KAGA 3GQBB 4JUFA 3M89A 4F5YA 4YP7A 1VHTA 3AIOA 4O5OA 2W2OA 3A36A 1MGPA 1XZIA 3Q4GA 1U94A 1JBKA 2CLEB 5AOAA 2WWIA 2YVQA 1Y3BE 1G2QA 3R6DA 3GLHE 3GBPA 5H68A 1JQBA 3PTZA 5EMHA 4GZMA 1I1QB 2GCIA 1QVAA 1EDEA 3P2EA 2A57A 2DF8A 5CFNA 3L7IA 1AX9A 4N54A 2DR3A 5EQFA 1QK4A 3SBOA 1QH1B 1J8YF 1P9NA 3V7UA 1I7QB 4DLXA 3ZJ4A 4HFNA 1KF0A 1P1CA 4BP8A 5A62A 4DXAA 3NIDB 2FEWB 1RPJA 3LVWA 4ZZ2A 5IYZA 5CA0B 4ZODA 4F3NA 4TUYF 3IXQA 4QOEA 1X7XA 3EVGA 4B85A 4FS8A 3TOCA 4YCJA 1KVRA 2RIRA 4X24A 3AHJA 2BWJA 2VFAA 2H48A 2D8AA 4IHJB 1QCDA 3Q10A 1E3WA 9ABPA 3F3YA 2VF5X 3JQ9C 2C8LA 2PVSA 3CZAA 1WCYA 5HNKA 3B1KA 5JTUA 1L4GA 3NS7A 3DHYA 4LN1A 2X23A 4AU1A 3JQ8B 1L7RA 1L5QA 1G38A 1QZEA 3QI7A 1KC3A 4AJNA 1UC8A 1M76A 2P9QA 1CD5A 2EWWA 1L1QA 1E9EA 3WGOA 3EQ6A 2A4KA 1NYRA 2I76A 2WFMA 3LBIA 4A10A 4NJEA 2QT9A 1K3TA 1P1KA 4F11A 4B3FX 5DOZA 1HORA 4WLVA 3R20A 5H83A 5BUSA 4F4IA 2E37A 2BUAA 1ZSNA 1ULHA 1ZHHA 1Q3HA 1N6NA 3M34A 2C2HA 2MSNA 2IUTA 2OORA 3MRXA 3R3HA 1DQPA 3SJUA 2DOKA 2DPGA 4TLEA 4ARBA 1XNQB 4OHRA 1X9HA 3E2PA 3PNLA 4EO7A 3W2FA 3GI1A 1YR3A 1Z17A 3DBHB 2VPWA 1YB2A 5D51S 4HDRA 1A5AB 1BEZA 3A1TA 3OPMA 2ZYVX 3WLLA 3MIZA 1ZVVA 3UH0A 3BHJA 1L2BA 4C4XA 4RQBA 3TXXA 1UBEA 1SVMA 5T3YA 3NPAA 4PNHA 5GTDA 2YRFA 3WVNA 1EP9A 5EJ7A 3LUJA 3ZJTA 4D9GA 2XQFA 1GZ4A 4UOEA 721PA 4LRTB 2I7NA 3E0XA 1X6VA 1SU8A 1LBTA 2VO1A 4S2UA 3JAMA 1IEXA 2WB2A 1M0SA 1XNRB 3HCAA 3TMKA 4FFLA 1HRDA 2XZDA 1U02A 1UZLA 4O4LB 4E33A 3TBKA 2O4UX 1AUAA 2HMUA 2J5QA 5B58T 2KA6B 2NV6A 3PUZA 2BKAA 3V34A 3OLVA 3UYKA 3AUYA 1PJAA 2QT1A 3WGLA 2XBUA 4Y1FA 3QP9A 3DE7X 4BNXA 5J2TA 3IUNA 1RQNA 2C94A 3TIFA 3F49S 1CUAA 1JPVA 1CUVA 3LMKA 4MIKA 4E1BA 3R7LA 5EUBA 2AJBA 3DE3X 3SARA 3L8MA 2JFZA 1PQPA 4FCCA 2DHEA 1NUHA 4JVLA 4R16A 1PJ8A 3M6IA 1GG5A 3WGJA 1GG8A 1UJ6A 5AHXA 3HHPA 4RY8A 1EUDB 2PZJA 3QUAA 3RHTA 3SYMA 3O4RA 4J2HA 2J3QA 1W0JA 4QFMA 3VZRA 4LZZA 3OQVA 5GADl 1SBHA 1GHTA 1XXLA 4PO9A 3IFSA 2J85A 2BOVA 1D4OA 2C4UA 2H65A 2B9EA 1Z6XA 1W0CA 2MSLA 3SD7A 4YMLA 4UJ5A 3FMVA 3BIWA 3DCJA 1J2RA 4M8SA 2WYIA 4OXQA 5LZ2A 4YJ3B 2DG2A 3NM4A 4MR7B 1U4SA 3DLCA 3N0VA 3QVGB 2QJRA 4ZI3A 2WILA 1BMFA 2R79A 1SOWA 2PBFA 1Y3DE 4WNYA 4EHHA 4P7JA 4P4UA 4QGBA 3S29A 2IEBA 2AD5A 5CCDA 3QX7A 4DV2B 2EFCB 1E3SA 4YH1A 2FP4A 2R751 1IY2A 1G64A 3HA2A 3KL2A 2WTEA 2YJ4A 3MA0A 4JNCA 3RWMB 3SC2A 5A4MS 5TMPA 1CUKA 3VR6H 3UGJA 4GYJA 1ONNA 3LVBA 3UJ9A 4N5IX 2GJ4A 2V7VA 1V8PA 5DXFA 4CR8A 3KUUA 1U04A 4LKOA 1HSOA 5BN5B 4YRJA 3A6KA 1NNEA 5AKHA 3PNPA 2F3RA 5K3BA 2ZJ6A 2VF8A 1K5HA 2D5CA 2KPOA 2UXBB 1S9HA 3H1GA 3LIPA 3B82A 1O3YA 4B7CA 1ATIA 3DKIA 2O7SA 2GHQA 1AK2A 1BVRA 2CNBA 5JNRA 3CEJA 2FSVA 4QGHA 3F2VA 2IPAB 4TL9A 2JI7A 3RV3A 4S04A 4IG4A 1X15A 2YDYA 4CETA 4ID3A 4HWGA 1GADO 2J5BA 2I22A 4J75A 4RPHA 2GI4A 3RWOA 1M73E 2B1GA 2FW8A 5LA6A 4MGZE 3Q7SA 1EVIA 1FXWA 1XWFA 2VHZA 4S1VA 4RFLA 1YVEI 3ZCTA 2WUFA 1PEYA 4FOTA 5IANA 3JARA 1SC9A 4JV5M 1W73A 4WOJA 4INJA 3I37X 3WFIA 4B6FA 4Z4IA 1XDDA 5KPTA 3TXYA 1A69A 4K2HA 4JYPA 4B6EA 1C7YA 1VKHA 4A1OA 5AUQA 2YIDA 4FE3A 4WLFA 4OKSA 1P4GA 3DOHA 2R8EA 3V2GA 3ZVKA 1TDHA 5DP2A 2IIQA 4LY3A 3WBKA 1RCFA 3UENA 1OVGA 1XHEA 1VE7A 5JW6A 3JQRA 3QVUA 2HK9A 4EZBA 1SHUX 3PFKA 1NQ5A 4OBXA 2UYHA 3ROFA 3GYBA 1XKQA 1Y82A 3S1LA 5DBIA 1T0HB 2Q6LA 3L8HA 5DNUA 2XZOA 5DHFA 3ZTTA 4IICA 3KOXE 3ES9A 1DEOA 1L7DA 1XTJA 4DNXA 4DMCA 3VSAA 4E4YA 1PJQA 2HEGA 2RK6A 4EGSA 2Z0MA 2BHNA 1H3NA 2O52A 2C2KA 4OM8A 3PI7A 1AK1A 4QJBA 3HRKA 2PCJA 2P1ZA 1DKUA 3VUFA 1N36M 1C8KA 3I2FA 1W19A 3H19A 2OG1A 3O1JC 1HX7A 4B47A 1HA3A 2O5EA 4Y3UA 3KFXA 5ECDA 3V00A 1M2OB 1VI5A 2COUA 3HACA 3IP9A 4UARA 3K8QA 3V1MA 3T7CA 3DV2A 5EIBD 1KOJA 3EXIB 3DTTA 3ZLJA 1U5BB 5EQTA 1M8KA 3FVRA 3L25A 1YHZA 1EBUA 3MERA 1JKIA 3D5TA 3GJQA 4OATA 3EC1A 1ORWA 2EWMA 1NMXA 3P2KA 4IPTA 4CQMD 4CTMA 1QIKA 1LW6E 3LLCA 2VUUA 2QVXX 4OHYA 3CWQA 4RTQA 1HE4A 5ED0A 1KI3A 2RGYA 3HZOA 1YRQA 1K9VF 2AFIA 4DUYM 4FYIA 1OI4A 1DAPA 4M1SA 1TO2E 2BWEA 5ITSA 4KR0A 3DMYA 4XVUA 4I1SA 1PZFA 2PIDA 4BHTA 1NNJA 5ECYA 2ZRGA 3CTPA 4F6LA 4HFMA 3ZWDA 4O4IA 3HYCA 3OQ6A 4OHKA 1OTHA 2J3HA 4RZIA 3JZFA 2B9VA 2O4CA 1TMYA 3HZJA 1DJLA 1MPTA 2RI0A 2O25A 1HNWB 5BW8A 4IDAA 1RFGE 3LDAA 4OP1A 1I2CA 3SFTA 3BSSA 5H5JA 4TT8A 2EP7A 4HWTA 3WOHA 1L5YA 5LUBA 1O0SA 3LC0A 4ZC8A 3OHSX 3SBJA 4IZIA 1X0VA 2O2DA 4Q1DA 4F04A 1JAHA 4NX2A 5DN6D 3ISTA 5JFTA 3O8OB 3F4BA 1GUFA 3OO0A 1RABA 2YQ4A 2WSMA 4DPLA 3M6MD 4QARA 5E7MA 2I9KA 1BVYF 1WF6A 2D00A 4X1IA 2F1HA 1NU6A 3X2EA 5HF9A 3ZJ5A 3ZHSA 4M1OA 1U1CA 3HY5A 4H2DA 8OHMA 5LZ5A 4HEHA 4L02A 3DXYA 3ZLUA 4HRYA 1WMBA 4ZAYA 2QRHA 3BXXA 3KR0A 4UXHA 2WWVD 4BVKA 3WMGA 5DASA 4BUCA 2C9CA 1UBRS 3HXKA 3PFBA 4R81A 4EW2A 4QGSA 2RCYA 1E1RD 2HMVA 1Z63A 3L9XA 4RQTA 2CY0A 4I9NA 1OF1A 1QHGA 3AJDA 1VCHA 4NONA 4DVJA 3GP8A 1TGYA 1UAYA 4K9PA 3QWLA 3SXJA 4RF0A 5CTAA 4D3SA 4PCVA 3HABA 1Z2AA 3O9MA 2YV4A 1WGNA 3AQ4A 3S5UA 2XMZA 4X93A 5CG1A 1KJZA 3IDAA 3K6RA 5CIQA 4TLAA 1I9CA 3FFWA 4KSBA 2X3YA 2OZVA 5CCBA 2V8OA 2HQBA 3I3SR 4OHXA 4R2WA 3IQIX 4YI5A 2C00A 1QHNA 3AHEA 1TUGA 4UPVA 1SCKA 2FEAA 3OC6A 2Y9PB 2XJ4A 3QVMA 3THWA 4NBRA 3ADKA 2ACWA 5EE3A 2YWRA 4RLSA 1OH8A 1M2VB 1JBEA 3UIEA 2XZLA 4IMJB 1C0EA 4B87A 1B26A 1SN7A 4BKOA 1J9ZA 5EMJA 4PN7A 3WGTA 5F1YA 1S3FA 2FLKA 2HK6A 5FUMA 1SAYA 2WJAA 2Q6IA 5FXMA 2PU7A 4IKPA 2ONCA 1VSTA 3BC1A 5F7XA 4MS4B 2PS0A 2ZIGA 4D0LB 1R8SA 3S2YA 3GFOA 4X63A 1M5TA 2ZTLA 2K6GA 1ACMA 5KYNA 5ITZB 3ZKWA 1BDHA 2AL7A 3FBGA 5FTJA 1QIIA 3COVA 2JNHA 1OZFA 5FFMA 4EFMA 4WL0A 1ONSA 2PKWA 2LDBA 2DUJA 2QX4A 4JCOA 2GAFA 3VU3A 3K1JA 3QFTA 2A5YB 4LI0A 1QP4A 1ZUNA 2WMNB 4EPRA 1NQVA 3P0HA 3K71B 3UAWA 3OQHA 5FI3A 4U9IS 3R7WA 3B9QA 2JCYA 1ZCZA 3VX4A 4U8GA 5CDTA 4J0EA 2ZLBA 1LLDA 3ELDA 3ESYA 4L0MA 1D5WA 2DSNA 1L7XA 1JEJA 2DQKA 4XA8A 3ASVA 4JYAB 1Z4LA 5DFLA 5LMUB 1Q19A 2JHGA 2BM0A 5D86A 3OFKA 2BCJQ 2JCVA 1QKIA 2Q5EA 3DWIA 2PT6A 4ACAA 3MXOA 1RPZA 5K0BA 1VLZA 4KR6A 3QNWA 4GKJB 1RKBA 2FOIA 3AU9A 4Q3LA 3NBQA 4HUTA 4F4JA 3EFHA 1Q0PA 1NRXA 3QLVC 1FSSA 3G88A 2A88A 5FNVA 1U2PA 2P2GA 1N2JA 3BHIA 5CDUA 3KQKA 1U7UA 1XNHA 2ZSAA 5EKTA 5BYBA 3PGKA 4IH1A 4IW3B 4D74A 2V65A 4PZZA 2K2QB 4B3XA 1CVRA 5K3EA 2YHUA 3IEIA 4DJAA 4CFZA 1Q0LA 1EFHA 1HNXB 1M8PA 4F8JA 3N7AA 2DPMA 3I4FA 4X7MA 3ILXA 1EE9A 1PGPA 2EBWA 1ZH2A 2ZOSA 2AFHE 2DPXA 3NT5A 2VUSA 3RK1A 5JQGA 3J81k 1EM6A 3DHEA 1DADA 2DY1A 3TLBA 3MK6A 5K8LA 2IW3A 1F8YA 1XZLA 4A5SA 5BUQA 2P90A 1RC1A 1KQGA 2PUDA 3T9CA 1QHEA 1MHPA 4HQ6A 4AP6A 3R7SA 4BNJA 1A50B 1K5GA 4N5MA 4JI1B 2QTHA 2CLOB 2QGNA 3GUHA 2QD1A 5K8TA 4DGQA 4DDVA 4B83A 1NQWA 3RR2A 3PPVA 3LGXA 3NAZA 4MGZR 5CW2A 5KNBA 1WQ3A 2XUQA 2BDTA 4BKRA 5JMWA 1D4AA 4AQYB 3Q7EA 3D2BA 1E1LA 3KQPA 4IUDS 3ME5A 4RVUA 2YZGA 2R60A 3A1VA 3H3XA 4H31A 3FYUB 4HLQA 2JW5A 3IODA 3FPEA 2AW3A 3ZD6A 3X1XA 1A82A 5DHUA 2CMFA 5D85A 1GQ2A 4KR2A 5CURA 2YWEA 2BP7A 2W6JA 1SHTX 1GV0A 3AF4A 3WZMA 3OQJA 1GZDA 4GFDA 1RQRA 5JFOA 4PLWA 2GJAA 4DR2B 5ED4A 4V0QA 3JYLA 2M6LA 5CAEA 2P4UA 3P9QA