1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords hemK protein
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
1JG3A 5CCXA 1VEGA 3LX6A 2ZVJA 4KIFA 3THRA 3CVOA 4KDCA 3WSTA 4E70A 3TLJA 5JUWA 5LQAA 2BR5A 2JZ0A 1DCTA 1AV6A 3HA3A 3FPFA 3P2IA 5EG5A 4C07A 4PYJA 2HNKA 2YX1A 3E8SA 3BKXA 5C9ZA 2G8NA 3IYLW 3THSA 2JNHA 4YUYA 1JG2A 2OO3A 1BHJA 5K03A 1EFUB 5FADA 3FUTA 1NW7A 4FSDA 2QNJA 2PKWA 2B78A 2DAIA 1L1EA 2IDKA 2O06A 1VDLA 3MGGA 1P39A 4EVIA 5K01A 3TQSA 3B3FA 2VS1A 2Y1XA 5DPMA 2NXJA 1RI4A 2P7HA 3MB5A 4IV8A 1Q0SA 1UFZA 2NXEA 2G72A 4OQEA 4CKBA 3KQMA 3EVDA 3BUSA 4IWNA 2K4MA 4PGGA 1KPIA 3UA4A 1AQJA 4F1IA 4QDJA 2XYQA 5EC8A 4KIGA 4YMHA 10MHA 3CKKA 5CVEA 2JJQA 2ZIFA 5DRTA 4YUXA 4PCLA 2VDVE 1RJDA 2ZULA 2HMYB 4JXJA 2MROB 3QOXA 2H11A 2PT6A 4HH4A 3MAGA 1OTRA 3DXYA 1C7YA 4XCXA 5EIFA 2QYOA 2VZ9A 4E30A 5EKXA 3BT7A 3A25A 2HTEA 1XCLA 3HCAA 3KPVA 3LCCA 3I5UA 1JQ3A 2ZFUA 1QZEA 1NBIA 4ER6A 2ZWVA 4G3OA 2CMHA 2YXDA 3HA7A 1Z3CA 1SQFA 2OZVA 2L4FA 3X0DA 2C7OA 5HIMA 2IPXA 2YXEA 4HRAA 1U2ZA 2NNWB 2NP7A 4HSGA 2AOUB 2R6ZA 3O7WA 1R8XA 1RI2A 3FPGA 3HP7A 5E9QA 5P8WA 3GLGE 4KDRA 1P1CA 5FHQA 2GS9A 3G5LA 3R3HA 5LQRA 3KQWA 4A6DA 1N7JA 4GC5A 4RTLA 4MHTA 4F86A 2OKCA 4PONA 3PVCA 2PX8A 2IH4A 3DLIA 3TR6A 3HCFA 5K0CA 3SR4A 2C7QA 2PWPA 5DSTA 3BGDA 3UJBA 3Q7EA 1X1BA 2NXNA 1XDUA 1VLMA 2BWEA 3HVHA 3P9CA 5DLYA 5F2NA 2VDUE 1YFLA 1JQEA 1R18A 2ZTCA 2PV0A 3M4XA 5FUBA 3A7EA 3U81A 3K6RA 4QQKA 1SUSA 2DULA 3E05A 5ICFA 2JH8A 2UYOA 3GXOA 1RI1A 5EMLA 3T6PA 3VYWA 3DTNA 3DMHA 3TRKA 2Z6QA 5LQNA 2WA1A 5FULA 1AQIA 2PBFA 2OOBA 4KW7A 5CVDA 3A7DA 1HMYA 3C3YA 3OZSA 3NVKI 3SM3A 5E8RA 4F84A 4AZWA 2I9KA 5DFLA 5GINE 2JZ1A 2AVNA 4PYLA 2PXXA 3LHDA 3TKAA 1HT2E 1YB2A 1L3CA 2XYVA 4P58A 5EHGA 5U4XA 1MJFA 3H4JA 1R6AA 2OB2A 1VEKA 2O07A 5K0LA 1WS6A 3HVIA 5GOZA 1IY9A 1V39A 4EKIA 5HIKA 1X1AA 2YXLA 1M6EX 2DAGA 1PRYA 3NDIA 2EKKA 3KPWA 3KQVA 4X1OA 2LTUA 1BKYA 5DX0A 3S68A 1PGYA 4C4AA 1HJPA 3ORHA 4Z2YA 3UJCA 2AOUA 3R24A 5EVJA 4R05A 1G8SA 1KHHA 1BC5A 1O54A 2P3LA 1EJ6A 4MIKA 1JTFA 2DKLA 1SQGA 1JSZA 3I64A 1HNNA 5CVJA 3KR2A 4RX1A 5JI2E 3FTEA 3VC2A 4M37A 5K0EA 3SXJA 3G8BA 2AOVA 4RVHA 2G71A 2N47A 2P35A 5T6BA 3DLCA 4RVFA 4YMGA 4YV2A 3UJDA 3EEOA 4QTTB 3BXOA 3EVFA 1FPQA 3KQPA 2BM9A 4MQ4A 2ZZNA 4C06A 2DAMA 3LL7A 2IDJA 5BW4A 4BLUA 2UZ4A 2MGWA 5LQUA 5EZQA 1VEJA 1EIZA 3ER8A 1JG4A 2MJ5B 3CJRA 4BY9E 1YUBA 3EVEA 3H2BA 3OE5A 4E2XA 2AN3A 1VQ1A 1I4WA 2LD4A 2OBFA 3P9KA 3SVZA 2DAEA 4OBWA 2P1DA 3HNRA 5DXAA 1VP9A 3PLAE 4Y30A 2HAKA 4OX9Y 4M38A 5FHRA 1BVSA 2ZBRA 3TPZA 1X19A 2ERCA 5EQJB 2OPBA 3DP7A 2EG5A 2V7EA 3DMFA 3DUWA 3P8ZA 4DA4A 1UFKA 1IFYA 2EX4A 3FTCA 5HIIA 1AIPC 4MTLA 4RTSA 1QAOA 5DRYA 3BGIA 3GU3A 5HILA 2RRUA 2L2DA 2GA9A 4PWYA 5F2KA 2IP2A 3AXTA 3GDHA 3FTFA 3LGAA 1ZV1A 2JUJA 2DZLA 3BWYA 1DV0A 4IV0A 3FUWA 5MHTA 5EGSA 3TM5A 1ZQ9A 2CL5A 5ICEA 2CWBA 5K09A 1G60A 2ZIEA 2JG3A 2Q41A 3EVAA 1VG5A 4GEKA 3FUVA 5G02A 3KQYA 1JTEA 3G2MA 4O29A 3LBYA 4FR0A 2C7RA 1B42A 4RTOA 1OKSA 3O31A 5DM1A 4E33A 5K8VA 1DO0A 5DXJA 1NV9A 1VPTA 4RTMA 1FP2A 1TR8A 5EHIA 3FUXA 2LVQD 5FA8A 1M6YA 2ADMA 2WK1A 3GNLA 3LKZA 4HGYA 4X60A 5DM4A 3TMAA 2GH1A 4HTFA 4GQBA 1KYZA 1WGLA 2KNVA 3AWIA 1H1DA 1OQYA 4YV0A 4PYNA 2FCAA 2KHHA 1F38A 4K6MA 2F8LA 4YUWA 3CJTA 4HC4A 3UZUA 3DOUA 1XDZA 1JG1A 2QM3A 3GGDA 1NW3A 3MCTA 2O05A 3A26A 1G4AE 1WJ7A 1T6OA 1DO2A 4RTRA 1R8YA 3EPPA 3EMDA 2E5WA 1WIVA 4KRGA 1ZMVA 5FWAA 4LWPA 4IKPA 4KVZA 3NDJA 4R6WA 3GJYA 3NWEA 4ER3A 2R0IA 3GCZA 4P7JA 4RWZA 3HCDA 4ER0A 1UWVA 1D2HA 2DHYA 3BBZA 2QY6A 3EVCA 3ER9A 3EVGA 3RW9A 1GO5A 4KWCA 5BXYA 3PTAA 3MHTA 1VL5A 3M6XA 3NJRA 3DH0A 3UJ7A 2ZBQA 5ICCA 2KNZA 3JWGA 4L7VA 2ZBPA 1M0EA 3KR1A 5GIOE 1KYIA 3E7PA 1G6Q1 4ATNA 3ELDA 2GB4A 4RTQA 1SKMA 2YQZA 3IECA 5DM0A 5EIWA 1ORIA 4R8RA 3ELYA 2PVCA 5C1IA 1YF3A 3BZBA 1QANA 1XVAA 2I6GA 2Y1WA 4HG2A 5T67A 3GLIE 3UJ6A 3FRHA 4P7FA 3PS9A 1TW2A 3HVJA 1RJGA 5E1DA 2OO9A 2FK8A 2GLUA 3LCUA 1N7IA 4U7TB 5FWDA 3FYDA 1O9HA 4E2WA 4GF5A 4UOEA 1OAIA 1P3QQ 1NV8A 1G38A 5E2AA 2JY7A 2CP8A 3G2QA 3CCFA 5K0JA 2HWKA 5E8JA 4OBXA 4PNEA 5F2OA 2IH5A 3C6MA 1G55A 2YTZA 4CXMA 2EJSA 1E94E 2JHPA 3KPJA 3OE4A 3KPYA 5HZMA 2HR1A 5LSAA 3ERCA 3G7UA 3OU6A 1EJ0A 3P2EA 3PB3A 2YVLA 3PX2A 1X1DA 2JHCA 3EMBA 3LKDA 1ZGJA 5D1NA 5H02A 4E32A 1VP3A 1EAMA 2PY6A 4CTKA 3DXXA 4P7KA 3T7SA 4C03A 2JY8A 4X63A 2AOWA 4DZRA 4V0QA 3M33A 2PX2A 2HV9A 3JWHA 4PINA 3HM2A 5DWQA 3R0QA 5ERGB 1WG8A 3UJ9A 3TM4A 4M36A 1KP9A 3A27A 3P71T 4QQNA 4Y2HA 5DSXA 5EKUA 5T64A 3SX0A 3OU2A 4YV1A 1NT2A 2DENA 3DR5A 4U7PB 2IFTA 1DUSA 1RJFA 2ONZA 3T0IA 2LVPC 2ZTHA 5CCBA 1DL5A 1INLA 3JWJA 5LR6A 2O57A 4R71A 1KIAA 2NP6A 1KXZA 1T43A 4RVGA 2PT9A 3SSNA 4A6EA 5E1MA 7MHTA 3REOA 5EOVA 3KQSA 1WZNA 2FHPA 2QRVA 2ZLBA 4F2LA 3CBGA 3OPNA 5E1BA 5EMJA 4C04A 4DCMA 5JR3A 4NECA 2PLWA 4XUCA 1N2XA 4GC9A 4PYOA 1XTPA 2PXCA 3I53A 2OXTA 1XXHE 3E23A 2IIPA 3MERA 5K0GA 3R9XB 3CC8A 4MWZA 4XUEA 1MHTA 3HCBA 2H1RA 3GRZA 3OZTA 1WGNA 2AN5A 3K0BA 3GRUA 4PYQA 4BLWA 4QDKA 1P1BA 2OY0A 1WR1B 3FRIA 4RVDA 4ZTBA 4GOND 1G3IA 2BWBA 3EGVA 1HQYE 3HA5A 3B89A 2AOXA 2IGTA 1UIRA 1P91A 4PIPA 3M70A 2V74B 2XYRA 1VIDA 4AUKA 2Z6UA 4PGHA 4HEOA 3E46A 3EGEA 4H0NA 3HEMA 5ICGA 4RTNA 1ZKDA 4RSRA 4YUVA 3BKWA 3B3GA 3LDGA 3FPEA 3HTXA 2DI0A 1IXSA 4X41A 3NMUF 2DNAA 2FRXA 3EVZA 3P9NA 3G2OA 1WY7A 4V0RA 3UBTA 2IBSA 1CUKA 2MR9A 3BGVA 4HTFB 1NW8A 5C0OE 3V8VA 1SUIA 3DMGA 5HFJA 3NWBA 3K9OA 2AN4A 3IHTA 1XCJA 2PWYA 3LPMA 4R8SA 5CD1A 1WXXA 3LDUA 4RTKA 2CWWA 4FZVA 2G1PA 5B1SA 1QZZA 2EJTA 1G41A 3FZGA 3OFJA 4B17A 3M6UA 3CGGA 1ZG3A 4QTUB 3KQTA 3JWIA 2BM8A 3SMQA 4LECA 3IEIA 1V92A 4EMSA 3GWZA 3EVBA 4BP3A 5FTWA 4AZTA 1ZMWA 1ZGAA 4GOMD 1NE2A 1FBNA 3GLHE 2PGXA 3DULA 4OA8A 2FK7A 2BR3A 2YUIA 4E31A 2O0LA 2QE6A 1XXLA 9MHTA 1TW3A 2CMGA 5CM2Z 1KPGA 2ONYA 2O25A 2PX4A 1Q0TA 4AZSA 4GBED 2WA2A 2K9DA 2OOAA 5E2BA 4E2ZA 3NTVA 3Q87B 4EKGA 3IV6A 4Q7JA 1XB2B 3IHPA 2ZTDA 3ELUA 3NVMB 5EMKA 5K0BA 2G3QA 1I1NA 2AVDA 4ISCA 2PSSA 4GEWA 5GM2A 3BWMA 3QOWA 1ORHA 3OZRA 5KQRA 1OR8A 3KHKA 3KR0A 4FS8A 3EEYA 3TOSA 3GLFE 1EQAA 2A14A 2YR0A 3KU1A 4DMGA 5K05A 2P3QA 2K0BX 4PYKA 3PX3A 4QVGA 2FPOA 5LQCA 3FYCA 2JY5A 5CIYA 3MTEA 3PFGA 2LVNC 1PJZA 3I9FA 4FT4A 2Z6AA 3ANXA 4EQZA 3CJQA 1NKVA 3PT9A 5FQNA 3C6KA 3LSTA 2EKFA 1VE3A 4R6XA 3VC1A 2UYCA 2BH2A 3G8AA 3LBFA 1NW5A 1KYWA 2QRVB 3M6VA 3QV2A 3F4KA 1JSXA 3P9IA 4FT2A 4OA5A 2KNAA 2LBCA 1F3LA 3KPUA 5CVVA 2ZIGA 5HIJA 4CWAA 4RV9A 1NBHA 3UWPA 1KR5A 2VP3A 2ZW9A 1A5TA 5EEHA 2P3OA 2UYQA 3FUUA 2NXCA 1R74A 2WZJA 4EK9A 3UJAA 2PJDA 2VDWA 1VBFA 4DF3A 3P97A 2IBTA 3MTIA 4GOOD 1QYRA 3LCVB 5DTMA 3UFBA 3GRRA 2OB1A 3OU7A 3L8DA 4FSXA 2GPYA 2ZWAA 3UA3A 1KPHA 1IM2A 3K9PA 3F92A 1O9GA 3G88A 3HCEA 5LQKA 3MCZA 3G5TA 4C08A 1TTEA 2R3SA 2I62A 5GP1A 2ESRA 8MHTA 1XDSA 4G56A 2KW5A 1F4IA 3BWBA 1L3BA 1QAQA 2B2CA 3R6TA 5DX1A 4DCGA 5KS2A 1Q02A 5DTRA 2EFJA 1IM8A 3FE3A 3EGIA 3KQQA 4HGZA 4RYLA 2NYUA 5DX8A 5E1OA 1RI3A 4CTJA 3NW9A 2BZGA 4YUZA 2GAFA 2P7IA 2AOTB 5K0FA 2ZSUA 3HCCA 5E9WA 2C7PA 1R4GA 3OFKA 2ZZMA 2PXAA 3C3PA 1HT1E 1YZ3A 5HEKA 5EEGA 4UN2B 3PFHA 2H5XA 1EG2A 4FP9A 2I7CA 4WVLA 5D1HA 4WXHA 5E9JA 3MQ2A 2AR0A 4RTPA 2LVAA 3T7RA 3SSOA 1TPYA 2OYRA 3T7TA 3DXZA 2JP7A 3HVKA 3B3JA 4DQ0A 5EZSA 1XJ5A 2AS0A 3M6WA 3G2PA 3RODA 3ID6C 4QPNA 1BOOA 3AJDA 3D2LA 3GRYA 2JH9A 3P2KA 4LG1A 4P7GA 5FQOA 5GWXA 3SGLA 4PIMA 2P8JA 5BP7A 2EJUA 3O4FA 1R00A 5EMMA 2P41A 1FP1D 3KR9A 1QAMA 5HOQA 3AXSA 4M7RA 1YZHA 1SG9A 4QPPA 5GM1A 2AZTA 3TKYA 1ZMUA 4RTJA 3MMPA 2JHAA 3I58A 2P40A 1YFJA 4GUAA 1RJEA 3OCJA 1L3IA 1JR4A 1WHCA 1IXKA 2JY6B 1X1CA 4F85A 2CKDA 1Y8CA 5CUQA 2B25A 3FTDA 5K0NA 4POOA 1YLAA 1AF7A 5IKMA 2G70A 3AY0A 3TFWA 4OQDA 4X61A 5CVUA 5LQJA 5FA5A 3V97A 3ELWA 3E21A 3FPJA 1MN3A 4C05A 4DM3A 1Y8GA 2FYTA 5KQSA 3BWCA 5FCDA 2AOTA 3LECA 4AZVA 4XUDA 2B3TA 2LVOC 4QVKA 3UJ8A 4CKCA 2B9EA 4E2YA 5DTQA 5BW5A 5KVAA 2ORED 5KYGA 1JQDA 2L4EA 5M5BA 4PYIA 5DM2A 2XBMA 1SVUA 3GRVA 3KQOA 5DT2A 5IH3A 5EPEA 4DBGB 4AX8A 1D2GA 3ME5A 3A4TA 3GIWA 1L9KA 3KKZA 3LDFA 4FGZA 1JR3E 4GOLD 4PYMA 1ZHFA 2DAKA 2XVAA 3B7PA 4BLVA 2DPMA 4CKEA 1G8AA 2PX5A 3C0KA 1RI5A 2UYHA 2ZCJA 1WXWA 2HWJA 3G89A 5GIPE 4LWOA 1NW6A 2QSFX 3SSMA 3VSEA 3FPHA 1D2CA 3B5IA 4BP1A 2ZZKA 2H00A 4DKJA 3RIEA 2IH2A 2BR4A 2XVMA 4ER7A 1FJXA 2QHOB 4PCAA 4ER5A 4WP2A 1I9GA 3GO4A
chains in the Genus database with same CATH superfamily
3IQHX 1GKIA 3UICA 3TSZA 3VU3A 4EW2A 4EPVA 4CR8A 5JUWA 3W90A 2AK2A 5DHPA 5ECDA 5IXJA 2ZSHA 4ZDKA 3N07A 4EY4A 2XXAA 4DG9A 2F5QA 3FFXA 1V95A 3E5RA 4JBIA 4PG6A 4U2BA 4BX0A 4DJJA 1A7JA 1J5PA 1NW7A 1Q3KA 2I2AA 3DGEC 4JENA 4MYCA 4UHCA 2QENA 4KX3A 1FSSA 4HX5A 5GZ6A 3MGGA 5K01A 5G0UA 1D4OA 2CFRA 4AZ0B 1OI3A 1DCKA 1Z5NA 2G09A 4FFLA 4UVDA 3RIHA 4QFCA 1VIAA 3GZNB 5DNVA 2EFCB 1ISMA 3OEEA 3GPYA 4FDAA 5IUKC 4BZXA 2XA1A 4MVJI 1KPIA 2AXPA 3TYXA 4YMHA 5J47A 1E5TA 1EHIA 2Y0TA 3GQVA 1T6BY 2VYNA 3R7SA 5EHNA 2XWQA 4A16A 1AUVA 1CDZA 3QEJA 4IH1A 4NDZA 3O84A 6Q21A 4ZOEA 4R7GA 3T1VA 1HNXB 2XOXA 1BXZA 4G3OA 1FS4A 4X8HA 4Y2UA 1Z3CA 4W1PA 2C7OA 1V4VA 3D1VA 4MHOA 3Q8WA 2QLNA 1VHJA 3ZU5A 3D4NA 1SVOA 3OPYI 2WLTA 1H22A 3LF2A 1Y7IA 4L9RA 4MB2A 5FNZA 1J0AA 5LB2A 5P8WA 4A3SA 3PNSA 3U4QA 1H6BA 4LOKA 1Y7LA 2LBPA 3N8KA 4LQ4A 4EAAA 1P7VA 2MT9A 3OQIB 4PX2A 2WG2A 5IN4A 1NU8A 4IBKA 1GARA 1FDOA 1SCKA 3OTGA 5CPFA 5BQFA 1GGJA 2PH1A 2W37A 3QVGB 4LGMA 1GDDA 2IEGA 1W46A 3UXMA 2Z1DA 4IBBA 5C1PA 2R1VA 3EQ2A 5BN4B 4O2LA 2HSJA 3MXTA 4D42A 2QTAA 2DM6A 1R18A 3RIXA 3A8TA 5K9ZA 1XTIA 3GQ5A 3A7EA 3N86A 4KJXA 1P9LA 4AJEA 3LVWA 4QA9A 5BNIA 5BMVA 2C5FA 1A8QA 1VGVA 2ATVA 4LAFA 5F1YA 1ICIA 1IVNA 1HFWA 3A1EA 2D7EA 3GLHA 1C1DB 1VGQA 4GR4A 2DFVA 3VPHA 2OILA 3PP8A 4KFUA 5B1DA 4YRSA 1SC4A 4WGFA 5D6NA 5A7GA 4F1WA 3S8YA 5JCXA 2YJZA 2OSVA 4QWWA 3R74A 3SC3A 3HY6A 5ADUS 1ODKA 5FULA 1NOJA 3P0RA 5DNWA 2XUFA 2VDJA 3F73A 1JHRA 1K5HA 1MG5A 1YI1A 2KS6A 2RGUA 1TCVA 5AOCA 2KHZA 4G81A 3SIXA 5BR7A 4RFSB 2NSDA 4H1VA 4P6VF 4WZBB 3TKAA 2ZBUA 3C5EA 5BYKA 5DW0A 1UCFA 4P58A 4B3XA 1IU9A 1WXDA 2D13A 3CH7A 2LPMA 3CXUA 3K96A 3NGLA 1MB9A 3NS7A 3R3VA 4Q16A 4X91A 5CIQA 1PV1A 5GOZA 4N6GA 3NDIA 1ORYB 4NFHA 1KY2A 1MGPA 2C2KA 2ACEA 1GUBA 1GGNA 2QD3A 3W04A 4F9TA 1KYTA 3KQUA 2DH5A 3RRNA 2P4QA 3RVLA 4PSCA 2UXBB 3LT5A 4OKSA 4V0SA 4DA7A 4C7OB 3BHJA 3EEBA 1XFDA 3P26A 3ND8A 4L9SA 4NESA 1WSWA 4YDRA 5DO9A 4R1QA 3UB4A 2MTBA 4DR5B 3UCXA 3VM6A 4NZNA 3MF4A 3B7QA 4TMWA 1XA0A 5K0EA 4J9UE 1A9YA 3PUZA 4B32A 5H3LA 1U3UA 2Q9AA 3VNAA 2VJYA 2WYOA 4FQ5A 1WDWB 3H5OA 3KJXA 4KN9S 4UUMA 2AWOA 1NR7A 1NUQA 3QKRB 2XA2A 1SXJE 1P2GA 4WIAA 4Q01A 1Q0RA 1SUEA 3RB8A 1AHIA 4LEIA 3SIWA 2LDBA 5FWXB 4CF5A 5AR1A 3IL2A 4IJMA 2I1QA 4IL5A 3AF1A 3OE5A 1YO6A 1E9AA 4J90A 4FYKA 4R98A 4X3PA 4B2LA 1B3RA 3LCMA 4A8PA 3LGSA 2O8CB 1HPLA 1COWA 3ISVA 4D3FA 5AHKA 1WHSB 1A4XA 1OXSC 4ZANA 4FNGA 5T4BA 4B87A 3MS7A 1U0OC 3NO4A 3PL5A 2I87A 2CF6A 1ZMTA 3AG5A 2PTGA 1Q74A 4ZZ0A 3I5XA 5ULLA 5DRYA 1OH6A 5TS3A 2L82A 3GU3A 4LF9M 2H1IA 4L76A 2ISCA 4OI2A 3FTFA 1ZUWA 3ILYA 3HGQA 2RJOA 4KUEA 3EF1A 3HXTA 5G0TA 5LMNB 4DV5B 1ZK2A 4UCXA 1CIPA 4TXJA 1K8XB 1EX7A 4NHOA 4MULA 3UAWA 1QIDA 2VWQA 2PO7A 2DUMA 2DWOA 4DMLA 3LO8A 2Q3FA 4TZTA 2Z8YA 4RTOA 1E5QA 2WD7B 2W58A 1YTUA 4R3DA 3AP2A 2Q6IA 4W7IA 1M1ZA 3L46A 4DLKA 4JNCA 3MK6A 1MB2A 2UVDA 4MW7A 1P31A 1HQCA 2FOLA 4NJMA 4CT4B 4WV3A 3VR1A 4HNQA 1GPNA 2X6TA 1NBWB 3ABQB 3N75A 2WK1A 5DM4A 5FA8A 1FU4A 1T4DA 4DZZA 2O1SA 3IQIX 3OKAA 1L5KA 3UKJA 4DR3B 5D00A 4YV0A 1YZGA 4MDFA 2O1XA 2DWNA 1ZESA 2WAOA 4NRDA 4TLEA 4AQ7A 2J4FA 5K3AA 1JEOA 2WVAA 2O05A 3ZN2A 3A26A 3FDZA 6PFKA 1EK0A 4WUVA 2P9CA 3FGPA 4B0OA 2KXEA 1QMPA 1E6UA 2XPCA 4IDEA 4I2VA 4R6WA 1JDTA 4U2FA 3NWEA 5ALSA 5JS8A 1YR9A 4N49A 5A9SA 5AVWA 1PR4A 4FWBA 4KTTE 1Y33E 4BX3A 4GH9A 5KJCA 2BFBB 4BAZA 3IDSA 4XCQA 2W2TA 4BU0A 1C7IA 2NV6A 4MV5A 4YCSA 4WDQA 5KQMA 1QKKA 2HHCA 2CDNA 4XIGS 5ESRA 5DBIA 2JJ2A 2X8AA 1RXSA 3COWA 5GGXA 4DBVO 2YV1A 5E6RB 1MMFB 1BN7A 3URKA 2IZOA 5TQ2A 5ALHA 1UBRS 3C1AA 2LDXA 3HO1A 3FMFA 2DHQA 3N9IA 5JQGF 1LH0A 1UC8A 2FJUA 3AR3A 1CJKC 1GTVA 4IBCA 3RAFC 2R18A 2Q3MA 2QUIA 3CNNA 2WTMA 4DR3M 1E89A 1XVAA 5DNYB 2Y1WA 1G5FA 3LMKA 3MTQA 2J9XB 3LQKA 3MGKA 3UAYA 4X97A 1J25A 3PUXA 2GN2A 3LCUA 2QTLA 4A6PA 1VG9B 3KP1A 4DQXA 4GF5A 5K4AA 4AB1A 4GMFA 4WN9A 4M8LA 3IP1A 1QG6A 2EKBA 3D5EA 4GMXA 3WMFA 4BNYA 4ESOA 4UKDA 5CDSA 4FOLA 3INGA 4YJ3A 4BRZA 4J43A 5K0SA 3J80A 4RNCA 3VBEA 4X1KA 5K6AA 3ANYB 1PR1A 1MORA 3EUAA 2Q5EA 2HK7A 4XEUA 4Y2TA 2GHTA 5EE3A 5H0IA 5J4KA 1GAQA 2X19A 1IZYA 2O3QA 3G5AA 1EJ0A 1XKLA 2V8BA 3L0OA 3P2EA 1OU0A 1VB5A 3LKDA 5DULA 3U1TA 4X20A 3HL4A 5LZ9A 4UE3S 4Q6WA 3U4HA 5A5FA 5JSUA 2H1VA 1I2MA 1BVRA 3M33A 3UXHA 3G9UA 3BFVA 2HA0A 3LYAA 5B1EA 2PRZA 3J7AS 2AMYA 3A27A 1N0WA 1T9KA 2XB8A 4YR7A 3G6KA 4JCOA 3TX6A 4F9GA 1YNOA 1VKJA 3HY5A 1PZEA 2DG2A 2CE7A 1ZWLA 3BXEA 3DR5A 3RG8A 3ZHTA 4DL9A 4MUJA 4M9ZA 5AESA 4H3KB 4F1KA 4MRMB 4LDQA 4JNKA 4D57A 3B48A 4EB3A 3PNVA 1Z0ZA 4KQEA 3CBGA 3REOA 2D1YA 1LVUA 1OXMA 2C2HA 3UMCA 5KPJA 1D6JA 1LXCA 3A6EA 1HT0A 4KOAA 1M34B 3VK7A 5K0GA 3R9XB 3ZJYA 3HB7A 1NJ5A 2DRIA 3GRZA 3DE5X 3VZRA 1Q1AA 1Y81A 2P4EA 3TD9A 1O0BA 2HA2A 4ETNA 3C70A 1DG3A 3EAQA 4K9NA 4YJGA 5KX5A 3ZVNA 2QMYA 3KV3O 1A5ZA 1D09A 2QW8A 4HWOA 4YJ3F 2BCGY 2W2KA 3TFQA 5K45A 1SKYE 2B0CA 2OENG 1PTJC 4PGHA 5AM1A 3RHSA 5LNK6 4KR2A 5ICGA 2B20A 3FF4A 2J5BA 4HX2A 2YVAA 3FPEA 3V4PB 1IVSA 3CZAA 3HP1A 1PFVA 4X41A 3UBTA 1LD3A 1Q92A 5ALQA 4OUDB 1NPTO 4P4UA 1DGFA 3DEIA 1U1CA 3BTUA 1QBGA 2Q7OE 1VHTA 1ONBA 3CCBA 1Z5WA 5LQSA 3AWDA 1JPJA 4QYIA 2CL6X 9ATCA 1Q0ZA 5KNDD 1Z6GA 4PWZA 1NLYA 2Q21A 1ORVA 3GA7A 3ZZUA 5JNUA 3ORSA 2CCJA 2QTFA 4IJEA 5KYKA 3IOEA 3LDUA 3V7YA 4HNTA 3AERB 4F5EA 4EVQA 3AFOA 3KQTA 3OX3A 3TLEA 4GVPA 4M0EA 2JLVA 2ID9A 4DR6M 1TCCA 3DA8A 3KKMA 1GG5A 1M2GA 4OXXA 3GEBA 3Q88A 3RROA 1W1WA 1SXGA 1L5RA 2GTHA 4MUFA 1ZGAA 2EJCA 4I6JA 2PGXA 5DI3B 3GLHE 3GFFA 4X3CA 5DNUA 5ETJA 4UDOA 3WGNA 3NBAA 3M6LA 4HB0A 3E27A 4JLJA 3U44B 3RK4A 5FBQB 3D5QA 1GNRA 3NTVA 2JLUA 3M82A 4S12A 3ELUA 4X44A 4YMVA 3LPAA 2AEEA 4DARA 2ATIA 5TJ9A 5KYXA 3S81A 2D0PB 4PANA 5J4VA 1U3VA 1Y6RA 1QH0A 1GKYA 2NADA 4HF7A 1XZIA 4XQ0A 5EZ5A 5J63A 5KPTA 1NSTA 4HXYA 4ESVA 3F1KA 1GGKA 5FWXA 3STXA 3P9YA 4EJSC 3HNPA 1LQ2A 4G4SP 3D3NA 1LTKA 2X5OA 5E4TA 4LRUA 5WRFA 1C1YA 1QWSA 3QSGA 4RF5A 1P4HA 2OBBA 1FQWA 4C0BA 3VYRB 4DR6B 1COWD 5LA6B 5B4UA 3ICOA 1U0HC 2FPGB 4KXXA 3GAMA 1QHHA 1KSFX 1SWWA 2AF4C 3LBHA 5LMUM 1XVTA 2DE0X 5DGCA 1OFVA 5KJEA 3OFSA 3OPMA 1Z6ZA 4M86A 2HDNB 2VTVA 5B2ZA 2VP3A 4TXMA 1PTJA 1T2FA 1R0SA 1G1AA 2WSLA 5T57A 1NJ6A 1SU7A 4BPRA 4EK9A 1J24A 4JT9A 1KI7A 1R9MA 4IUBS 3VZBA 2QAIA 3WP0A 5DTMA 3LCVB 4J29A 4YBRA 4DQVA 3R6WA 4LJYA 5BRJA 3LM8A 1QHFA 1HK7A 1HDEA 1G291 4F72A 1MB0A 2I7DA 1H1LB 1PUXA 2ZAYA 3OCCA 3QM1A 4LTMA 3WKBA 1TQ4A 1JEYB 2O8DA 1QUEA 1GZDA 1XDSA 1AUAA 4MGYE 4ZYWA 5ERXA 5KOYA 2HRRA 4R84A 1ZI9A 2AFIA 4XE5A 5DX1A 2WT8A 5KTPA 1MTOA 1I4LD 4FILA 1KP2A 3KQQA 3NIGB 1GSHA 5KYXB 3WJAA 3BZWA 1OZAA 5CFMA 1FRVA 3MPUA 1ANKA 1V45E 2J3LA 1RU3A 3L18A 3VR6D 4LNAA 1C1DA 4B6GA 4URWR 1D0IA 1E61A 4WFIA 2WM2A 4NCNA 4DIDA 3OZUA 3MMNA 5DNCA 1Y98A 2P90A 2IYTA 2YV5A 3A3OA 1PNVA 1LBSA 1PGOA 2ZJ7A 2YBDA 3REFA 3JVIA 4G9BA 4K86A 5CA0F 1O7JA 2J08A 3VVBA 1Q11A 2YVKA 3FVQA 2I29A 3ZE9A 4ANFA 2B2NA 5BUSA 5I5EA 1NRIA 3DXZA 3VC3A 1I2AA 4GR5A 2O8FB 2C57A 5DHQA 2ZJ5A 2VVTA 3ISJA 1RWXA 4P7GA 1GFZA 2D2FA 3JQRA 1KMNA 2ODTX 4F2HA 5DBEX 2FQXA 2C92A 5HF6A 3TL2A 2HCBA 3U1VA 1G16A 4II7A 2P41A 3K0AB 4TMTA 5D85A 1NVAA 2RH4A 2XEPA 1PYOA 2PJZA 2YS7A 2LIPA 1U8CB 3AXSA 3NHFA 4G63A 1AD2A 3NEJA 1SVNA 4GHWA 3HHPA 4JMPA 5DTJA 4V39A 2C9BA 3NASA 2C59A 1LPSA 2QF7A 3AY0A 3NC4A 2HMTA 3PTLA 4OREX 4B3TB 2Y21A 2OHHA 5DXFA 4F3TA 3FPJA 1JXOA 2CB0A 4DM3A 1ES9A 3H5AA 3NYRA 1ZUIA 3AG6A 4BO3A 4DQLA 1YE9A 4QJ3A 1S2OA 1A2KC 1SQ5A 2RGXA 2A1UA 2V7UA 2O7SA 2I22A 2VQDA 2O2CA 2GZSA 3DFKA 1CY1A 1W52X 5IAJA 2OVFA 2AF3C 5ECYA 5EINA 4DTCA 4HLNA 2Z7JA 1P9NA 5EPEA 2GBLC 3M1AA 4K0RA 1CIJA 1AXRA 2L2QA 2D7GA 1F2UA 1K6MA 3GIWA 3K9NA 3OMLA 3F1LA 3L84A 3R0ZA 4QUBA 3W68A 2PJRA 4DLYA 1G8AA 1LPMA 5J2UA 2BKUA 3DBVO 4OAOA 2QYHA 1Z4PX 1GA1A 2WSSA 4QODA 4YT5A 4LF4M 2CBZA 2FHSA 3ASZA 3NU1A 1E1RD 3OD5A 3LRXA 3MT9A 1MQ9A 1T6ZA 2GMWA 2QSFX 3DF9A 4QNNA 4IPTA 5FUQA 3Q0TA 3SASA 4GLOA 3B5IA 5G3YA 3CIFA 3SXPA 1PR0A 1XUOA 1VI5A 2QHOB 4ZAGA 4XDZA 4C20A 3HA3A 3IAUA 2MR5A 3IVCA 4DT1A 3TWOA 1CTQA 2I6UA 4DDUA 4IXWA 3CVOA 4FZ3A 1RVV1 5AUNB 2BR5A 2EKLA 5BN5B 2Q1TA 4MA4A 1AV6A 4Y8VA 3MJHA 4GLBA 3CBQA 2WWFA 4HEQA 1EAYA 3NGMA 3CNOA 3CW2A 3QVSA 3QY0A 3GFRA 4CMEA 5DN6D 1IBSA 4ARVA 3W1EA 4JLSA 5C9ZA 3TUJC 3T3PB 3G2LA 4CIVA 4G4OA 2IF2A 1QO0A 3ZEIA 4WERA 4ZCQA 1MEEA 3T9DA 1B4DA 2DAIA 2IDKA 2MMCA 1NNUA 3IGFA 3KYCA 3H99A 3O9MA 2OUKA 4FBLA 3U4DA 3TQSA 2WTBA 4ZVNA 5LD2B 4G89A 1OFGA 2C2BA 2P7HA 4RHFA 2ZANA 2OYCA 4LHEA 4RHTA 2C8VA 4WZBE 1Y4AE 1IONA 1SEPA 3BUSA 3ER8A 4IWNA 4L5IA 4XD7D 1PJBA 3R8CA 3CVYA 3CR8A 3HJCA 3I72A 4W82A 3P7MA 5D3MA 3GRAA 4GP9A 3BWDD 5JVDA 4LMBA 4R2XA 2YJ4A 1A9PA 4PCLA 3KEFA 5JD5A 1IUOA 4WN9B 5F4BA 5BUQA 5IT5A 3Q8MA 1ZSYA 1IQPA 2H11A 3ZY3A 3I6ZA 3O8CA 4G4RA 2CVZA 2B82A 2F1OA 2QYOA 5KAPA 1W0JD 2IYLD 4G37A 1VB3A 4AY4A 4ER6A 2UXDB 2X1VA 4OQLA 3F46A 2L4FA 4QSMA 1FFXA 1GYPA 3H5VA 2R4JA 3P96A 2YXEA 4QO7A 2FG5A 3O2SB 1EVZA 1P81A 3ONWA 4ZI2A 3ABSB 4GPBA 4DLWA 2VJCA 1F8YA 3ZH9B 2XNKA 2ZJ1A 1P1CA 2Q5IA 3EXAA 1Q16A 4KDRA 4YJHA 2R6HA 5FHQA 4D74A 2IDZA 2Y3IA 1JHPA 2FAXA 4C4SA 2LNDA 2PQ0A 4RD4A 2JD2A 1R5LA 2XQKA 3EQZA 1NTOA 4NJEB 4S3MA 4QOGA 1Z16A 1RQ2A 3ZLTA 3JAKB 4PG5A 1K8QA 1MO6A 4TT3D 1T5SA 2FWAA 4A36A 1W4ZA 2FZWA 1W94A 1B74A 1P72A 1PE0A 2PV0A 3G17A 3A9VA 3M4XA 4QQKA 1P9WA 1YZNA 2EBWA 1ZIYA 4KH1A 3FDZB 5INTA 2UDPA 2WMDA 2IYZA 3R0VA 2ORIA 5HUQA 1AUXA 4OUKX 3DTNA 3F90A 1I3KA 4YCAA 2PBFA 4CLHA 4CM4B 5F9MA 4KW7A 1UDAA 4HRYA 1CUDA 4L27A 2GK6A 2J07A 2V3VA 4F84A 5JSZB 3GQBA 3N39C 5B1HA 5DFLA 2UZ1B 1JR2A 2A30A 2Y1EA 3PVZA 3VC7A 5JPCA 1PSWA 1U8XX 3HBNA 2Y0BA 5E7QA 2YUTA 3CSDA 3DLPX 3EY9A 1EBBA 2VHVA 3RHZA 2HO4A 1T4CA 4CBVA 2QAGB 4YAWA 1JH9A 3O93A 5FNVF 2PLFA 1WJGA 3FPSA 4X6YA 2P2NA 4IJ5A 2EKKA 1BXRB 1F5NA 3H83A 3NAQA 4MO9A 5CGZA 4XR4A 2ZTMA 2BGRA 4ASUD 3FIJA 4G23A 3IUSA 1M72A 5BV8A 3K2QA 2ATXA 4INPA 4B3SM 3ILHA 4X71A 1EJ6A 3P9ZA 5IDYA 4WESB 4B31A 1ZAKA 1Q12A 3T3IA 2R4UA 1DGBA 4OHRA 1NYTA 3IDOA 4DA9A 2OV8A 4ME6A 5BSGA 5HGJA 1BU8A 5IDWA 4KKXB 4RKFA 2V6JA 3GLGB 1KKUA 4YA6A 4NBNA 4DJFC 5JYCA 4YV2A 2A5YB 1Y8QB 4DNFA 3PPWA 3EEOA 4ED9A 3KQPA 1A72A 3K09A 2OD9A 5JJKA 4WCVA 1XVLA 1Y8RA 2J9ZB 4F3NA 1PTKA 1ADJA 3OX1A 4DY4A 4WXYB 1TJ3A 1Y3AA 3FOWA 5ITXA 3JTMA 2I1LA 2ZROA 5FOTA 4F5WA 5DCUA 3H2BA 3Q98A 4GFDA 5ICMA 2FEPA 1QVVA 4ND7A 2HQRA 3J7TA 2WWIA 1B0AA 1Z2PX 4DRZA 3IHLA 1ODJA 1KYQA 5IZCA 1DDIA 2VP5A 1SGWA 2X2OA 2QW1A 4FHZA 2G0AA 3DT9A 3QMMA 3F7MA 1US8A 1SCNE 2B4QA 4EYKA 4DA4A 1CQJA 3IE0A 5LYJA 1Q91A 2Y27A 3CU5A 1X39A 1AB6A 3P0FA 1NDHA 5CITA 3ASVA 5A4JA 5I7UA 1H2XA 1HZZC 2RJ3A 5F2KA 3SY8A 2Q8QA 1FVXA 2GN0A 4DA0A 4PZ9A 4QM7A 1YR1A 4H17A 1KO1A 4OHMA 4R3UC 3W8RA 5TMBA 3IEUA 2DHRA 5G02A 4Z5XA 3BK2A 3P19A 1QC5B 2G7MC 4RVSA 4Z0PA 2BGIA 1UPXA 3TXAA 3IO3A 4LYFA 4QQRA 4RIHA 4FEAA 4UATA 4C30A 3U3JA 5FLKA 1QH1B 1CUZA 3OZBA 1WP9A 5CFOA 2XZTA 2GZAA 1VPTA 3CM0A 3KB1A 3ZWQA 4B3HA 4CKEB 1G1MA 2UUOA 2NG1A 4PLPA 3Q5GA 1A7KA 2ADMA 2P4HX 1SBCA 3T9AA 2AG1A 2OLKA 2D2EA 3LP6A 1IN8A 1KYZA 3AFMA 5C4GB 4UPEA 1GNVA 3ZD7A 3T3OA 5BR8M 4UOZA 1XDDA 2FWIA 2CY0A 3DZDA 3VNQA 3P32A 3ESCA 3MSCA 3ZJUA 1XKTA 3A04A 3UZUA 3DOUA 1XDZA 2MU1A 1U2SA 2QM3A 4JLDA 2BGGA 5B3JA 2WTEA 3Q5DA 5EE1A 4B8WA 3F6YA 3X2SA 4FYVA 4G0YA 4YBZA 1OXBB 2RKWA 1FYXA 3EMDA 3X1KA 4AN4A 3X1ZA 4LWPA 4R7TA 3WB0A 1ECJA 5FXMA 2OV4A 4S2UA 3SYNA 3ZWDA 1TQHA 3VFDA 2GEJA 4WRRA 1D2HA 3ER9A 4UTOA 1MC8A 1NW9B 4FD2A 4IW3B 3VOTA 3BHNA 4M9CA 4ILKA 1J5EM 2JZCA 1SKBA 1GTMA 3M4JA 1J56A 2EKDA 2HJHA 4I3GA 1ZJ6A 5BPVA 2GJAA 2Y1CA 1I24A 2QLJA 4C2BA 3ZVMA 1AXEA 1SXJC 3Q1LA 2FSVA 5F1OA 4CU5A 4RDHA 5LBUA 4ZO6A 1J6UA 1TLFA 4YRIA 4H2DA 2QUZA 1MJNA 2BNKA 4PRKA 5IVIA 4DRXA 1PGPA 3QH4A 4DG5A 2E82A 1BN6A 5DLQC 2EF0A 3V8EA 1DELA 2CMKA 2IU3A 2VDQB 4LCEA 4LXGA 4U7TB 3WYEA 3BGOS 1K8RA 3ZHBA 4AMVA 5JFTA 4BNMA 2W4MA 4DUYM 2EV9A 4Q4HB 1L5ZA 4JR1A 4OHUA 5AJWA 1DGQA 3I45A 2XNHA 4FDMA 2B36A 2VH1A 3GZ4A 3R23A 4NS1A 1G55A 4UEQA 3LK7A 2HR1A 4V0OA 4GZ3A 3Q9UA 3C3WA 3FBWA 5I9TA 5HNKA 2E7ZA 2CLEB 2XMDA 4NZPA 5DP1A 1KZHA 1RXUA 3ZLBA 2JKVA 5D1NA 1G17A 1X7GA 1T9BA 4F6CA 4UBJA 1VP3A 1P9RA 4L02A 1N3LA 2IUTA 4LVNA 3FTNA 1POWA 3DTVD 2JY8A 4P7KA 2AI2A 3EZ7A 2XSZD 3THOA 1V1MA 2NW6A 2PMWB 3OIDA 4BFCA 4D6PA 3PTZA 2VHQA 2NLOA 3FCXA 1NF2A 2DETA 4EPWA 4OX9M 1EVIA 4JYPA 4Y2HA 5FOSA 5T64A 2X0FA 1GQFA 1AGPA 2Q8NA 3G9QA 4ZV9A 4C0WA 1UR5A 2JAWA 3T7IA 3LUDA 2IUYA 1FJHA 3PHCA 5FOUA 7AT1A 1E6MA 1CUGA 4DDHA 3MIIA 4BYMA 2BKLA 2BVNA 2CXHA 4ZEXA 3KQSA 3KOYE 3I23A 2QRVA 4B2IA 2X3UA 5J58A 1T8UA 4L7QA 3ETGA 1GU7A 3T94A 3RS2A 2QE7A 4QSHA 3RTEA 1MOZA 3I6IA 4QUGA 4MWZA 1IEQA 1RPTA 3HKEB 3QY9A 3KVWA 4H35A 4NE7A 2I78A 4ZQCB 4BRUA 2CB9A 4BLWA 3NH6A 2BD0A 1YR7A 2ZRNA 3K2IA 4K8OA 3TQIA 4CHTB 4Z9FA 5L6LB 5DM70 4OP2A 3B78A 2ZUFA 4AS3A 1G6OA 1D0LA 4O2BB 2HCRA 5M7EA 5LMZA 1RWNA 1CF4A 4U5QA 1T1EA 3BWEA 3NKFA 4JI7B 2WYIA 2C5LA 2P5UA 4KO4S 1ULTA 3R20A 1EZZA 2M5ZA 2VSXA 2PMBA 4MQLA 4JJKA 3V6LA 3MJFA 1PW5A 3OQHA 4H0CA 4YUVA 1WA5A 1BO6A 2ZTSA 3U60A 3EIFA 5TF0A 2ZJBA 1KDTA 1OYOA 3EVZA 3L1JA 3S1LA 2XAAA 1FTSA 2TSYB 4UBKA 5KTKA 2FEAA 1UZNA 3V8VA 5E0OA 1PJAA 4CVNA 3SMSA 2OFXA 4HADA 3HADA 5KPDA 4OIMA 1REQB 3L5OA 4RY8A 4IF6A 3NG1A 5BSVA 5KSZA 3TLYA 3ZLJA 2DUWA 2R8RA 3SZLA 4GMQA 3M6UA 3BMQB 5CT8A 1Z8NA 4JUBA 4UVGA 2PLNA 2BM8A 3EIOA 2NZJA 3M1YA 4W5QA 3CLSC 3MC1A 4OCZA 4LXHA 3CRW1 1GUFA 4KI7A 4DS3A 2V7TA 3OLXA 4Q39A 4MTCA 4WFQA 4NRWA 5FTWA 4HXEB 2VTBA 3AR8A 2X4DA 1U11A 2E4VA 2YC2C 3B9BA 3L8YA 3NGXA 2GPJA 2O0HA 4MQBA 2AQIA 4RMNA 3AUJB 1W581 5A1JA 3RUFA 1UXKA 3W2HA 3C1UA 2O0LA 1TW3A 2ASVA 3NHWA 4YP9A 1M2VB 2VPWA 2PX4A 5EMHA 4AT1A 1CJMA 3QKSA 4EM6A 1NXTA 3BA1A 3ZU3A 4KPYA 3K53A 3ZNQA 2F9MA 2NZVG 1IB6A 2FW9A 2XZPA 4JQCA 3EJ6A 4V3BA 2RHMA 4L95C 2AYZA 1ORHA 2JA2A 1I1QB 2EKQA 3OPVA 1SD5A 3WGGA 3KR0A 3W8NA 1PI3A 3P27A 3TOSA 4EL0A 5B5SA 3ICEA 1YZVA 3F6RA 1I7LA 3WO0A 3KFUG 1F3OA 2ZRGA 2LP4Y 4NOKA 4HWGA 1UPAA 3BDIA 1KO4A 3I8OA 3PFGA 1NNSA 2BFEA 2MMGA 2N1BA 1H0KA 5B36A 2G06A 1UJNA 1L7BA 4WA8A 3T1HM 4QUIA 1KYWA 2JGAA 2CNOA 3E9MA 2EGGA 3E8XA 3HEAA 3HUTA 3LUPA 5IBRA 3H9BA 4OF4A 2Q5OA 2HF8A 3MUOA 2BUBA 3T99A 1SPXA 3WGYA 2PMFA 4WFKA 4ZA2A 4MVYA 1J8QA 2HEIA 2P3OA 2ID7A 4Y1GA 4PF1A 3IRVA 4YY3B 1NUAA 2H59A 4ZODA 2NXCA 3PC3A 1D2MA 5JBIA 3AW9A 1VG1A 3GT4A 4NYJQ 1GGVA 1JQJC 1L5GB 1DQZA 5TC4A 4IDAA 3UFBA 4HI0E 1QIJA 4OXIA 3WGMA 1P5HA 2JL1A 1QGOA 3H5NA 4LC0A 4BVBA 2CL7X 4BVAA 5BORA 3O3NB 1IJEA 3PNLA 3U4AA 3O5AA 4NEGA 5IHPA 3H04A 4LF9B 3KOWE 1J39A 1WDTA 3M6IA 4ETMA 5KIAA 4W5OA 3G13A 4IDQA 4UBMA 3L41A 1L3BA 2Y1KA 1J7KA 3CVJA 3TVDA 3IS3A 3R5HA 4FYMA 3H11B 3DPSA 4PNZA 1J0XO 4N5NA 3QAUA 1MW9X 1YS7A 3L1HA 3GLSA 1OC2A 1YQGA 2I8AA 5HFNA 5CM8B 2IX3A 1MDBA 1NFQA 4RD2A 2BHSA 2HIHA 1MO5A 3OFKA 4GKAA 1DJPA 3EW7A 3PEVA 4B5KA 5K2MA 5AI0A 4HMOA 3UNXA 2G1KA 3WL5A 4F2PA 4UHHA 4NYIR 3EGWA 4IILA 4XDGA 2HA3A 1L7DA 1IEWA 1J2UA 4QYXA 2OM2A 3IP9A 4FFMA 1NBEA 4DQ0A 3R3WA 3X3HA 3EPJA 1VKRA 1SN7A 1VRVA 4N6NA 1FYEA 2IP4A 2DT5A 3L06A 1I2BA 1Z2OX 2AC7A 2Z95A 1SWVA 4QFDA 4Q4AB 4RY0A 3V8MA 5EMMA 3KRTA 2SCUA 3BRCA 3LUCA 2A0KA 4O8ZA 4EYGA 3NHSA 5IS2A 3HN7A 1I32A 3VR4A 3U09A 2A92A 2HL6A 3MMPA 1UDCA 1FJGM 2DPLA 2IXDA 5K3DA 4GUAA 1WHTA 1U8ZA 3B1FA 1XNJA 2KW0A 3U6PA 2BMJA 1XN1A 2B25A 3JQAB 3NBUA 4ECAA 4ZGGA 4QUDA 5JDIC 3E82A 4E2WA 4TTVA 1CUAA 4OQDA 2QTNA 1TYAE 2CV0A 2YOHA 2JEOA 4ZCPA 2A2ZA 4RVUA 1L5HA 1H2BA 5D5HA 2P9JA 5CFRA 5FCDA 2XB9A 1D1PA 2A9JA 3OJLA 1KEEB 2LVOC 2GBLA 4Q1BA 5CX4A 1S4QA 4NCJA 4OL9A 2ORED 3UFXB 1RNLA 5JSHA 2F3SA 1AGRA 1SVUA 1EU1A 3V80A 5KKCA 1L1QA 1M6VA 1T3LA 5BW6B 1TT5B 2ZSKA 3T7CA 4PYMA 2F59A 3LDFA 4XRRA 3V7UA 4P2BA 2ZSJA 5BRAA 1RHJA 3B7PA 3KLPX 3IP5A 4LFAB 1DLJA 4XIYA 3CW9A 1Z83A 2X1LA 3C39A 3DDOA 3NTLA 3UF0A 4ZICA 5AVXA 1JJAA 1TF5A 1JNYA 5HQJA 3O92A 5JS2A 1B8UA 3RC8A 2J4DA 4Q3CA 5J5VA 3UQZA 1ZMOA 3QQ5A 3CKYA 2WWRA 3F4BA 4TTIA 5CT6A 3SSMA 1U6JA 2ACKA 4BQRA 5TIIA 1M7GA 1ZD3A 3U37A 5E6SB 3PKJA 4DXAA 1SJ9A 4RPCA 2FPUA 5DE3A 5CCXA 3MHVC 5LDGA 1P7PA 3T1OA 1LS1A 4EHLA 2ZB4A 2G08A 1Q0QA 1KE2A 4QZVA 3GFTA 3KZCA 4H4CA 4J0CA 4CYMA 5CNKA 3VSAA 2JNHA 4CCYB 4WZAE 2PCJA 3TTSA 5K03A 1CUYA 4C7VA 4RF0A 3K5IA 4KLZA 4LK3A 4OLJA 1DC3A 1Y1SA 2VUSA 3IBGA 5LIPA 1QZMA 1H6DA 2RK4A 4X20B 4EYQA 2VTEA 2CJWB 3V8QA 3P4UA 3OCUA 1JNXX 3B38A 5A4DA 3KQMA 5LU8A 1DB3A 2QVLA 2D5IA 1XU9A 3RVNA 1LGYA 1AQJA 3FROA 3K5WA 2QPLA 2P2GA 4K9PA 1ZAEA 1V26A 3CKKA 1LI4A 2FSHA 1UC4B 2JAXA 4F96A 1GEEA 2ZRFA 1N8NA 1PJSA 2F48A 2X0IA 2VDVE 1YA4A 5KVQA 2EFGA 3T7KA 1BHO1 1DSSG 4BC0A 1OAAA 2X2FA 2XIJA 1P17A 1ECPA 1TLLA 3KPVA 3PSHA 5JYDA 1JWLA 4OI0A 2B2XA 2IHYA 3HR4A 1PT7A 2OZVA 2VDRB 3TBFA 3VUEA 4G09A 2XQVA 3H3JA 4QU5A 3P2YA 2Q5LA 2EBHX 1T5HX 3QFRA 4PD2A 4HSGA 3WIVA 2R6ZA 2NP7A 2OCBA 1EJBA 1H93A 1VJTA 3MLEA 2B8JA 2HSWA 3OIFA 2DBVO 1FLNA 1QH8A 3IAFA 2YY7A 3K9LA 5LQRA 5JS7A 4GNRA 3LVQE 3R0IA 4J0HA 1KQOA 1ZS9A 4A2WA 3OTOB 1NWCA 2VT2A 3HGIA 2J5YA 4F8EA 1JDPA 4A6XA 4M83A 5BURA 5CIYA 1PL0A 1XDUA 8ATCA 1YHZA 4BX2A 1JJVA 1QIMA 1RHQA 3EC2A 3ES9A 4P3OA 4Q19A 5ALUA 4DGSA 1K7XB 1C30A 3NC0C 2V4UA 3WICA 4CQMD 2VUIB 1D6SA 4RHYA 1OWLA 4BNXA 2WM3A 3FXAA 4IVPA 1RW4A 3I52A 4UC0A 3UEOA 4A0HA 4WMLA 1WCYA 3E1KA 4MVJH 4LHVA 2DUUA 4BC1A 4WW0A 1JXMA 4FWIB 4LMRA 1ZVJA 1QPGA 3OHPA 2OOBA 3COZA 4MUYA 3GB9A 3LL4A 4Q9HA 1SC3A 1L4EA 2C3UA 2PQMA 4PFJA 1XTVA 2P62A 2H9IA 1IIBA 1U9CA 4R81A 2OAP1 3JY6A 1HT2E 1JX6A 2J3KA 3JASB 3OM0A 2BT4A 4XEHA 4BB5A 3TNFA 5C8DA 1CYDA 1LWNA 1OT5A 1I7PA 3ABIA 3FLAA 3IP6A 3WYGA 2VK2A 2QMEA 4WK6A 1DC7A 1VZ2A 1Y4UA 4DMUB 1QP7A 2ZUBA 5EIAA 3SHFA 1WW2A 2C2WA 4LY0A 4A5OA 2XWBF 4X3OA 2ALJA 3ZE6A 2C3MA 4EA7A 4J7UA 3BDVA 2C9OA 4BEJA 2OQVA 5F1KA 2GQFA 1JTFA 1V9LA 4DCCA 4BNNA 1B6GA 1RCFA 1LBHA 1RYDA 2A59A 4P16A 2B98A 1Z0IA 1OIZA 2YMMA 4FQ8A 4QFMA 4ZOLB 2NWQA 5D2CA 3TLBA 4BEBA 5K99A 5KNCD 2CZQA 3WMEA 1GGHA 1RWBA 3HU1A 1ISGA 1H2HA 1ST2A 4ZCIA 2ZS7A 3FNFA 4HGPA 4L5JA 2C5EA 5I48A 3KT3A 1TX4B 3UJDA 1UBCA 3PPVA 2UUBM 4QTTB 3EVFA 3L4BC 1XD2B 5LM3A 3HWSA 1O6ZA 2PYIA 2N0SA 1NATA 2CNWD 2A5FA 4TQUS 5EL0A 2TMYA 3STWA 1L4MA 2DFNA 4RD6A 4C3VA 2G9ZA 1TU4A 3QHAA 1MB3A 2BP7B 4U2CA 3WSVA 2W82A 4E0BA 3GPIA 3NM6B 3F7NA 3CT6A 3ZQ6A 3HZOA 5E7JA 4BXOB 1A98A 3ML1A 5F78A 2OZPA 2AKEA 3GLUA 2JFHA 1F7VA 3T7EA 3FMIA 2RGNC 2K7ZA 3DDUA 3KTDA 3R7WB 3T9CA 3WDLA 2AJLI 4ID3A 4MTLA 2JI4A 4TMYA 4UNIA 3ONDA 2BDTA 2YZMA 3D6FA 4BNTA 4R1NA 4QXMA 2O2GA 3ESXA 4AMYA 3GDHA 4IO1A 2JUJA 1TGVA 2ODBA 1DG1G 4V1CB 2DSNA 1TTHA 1ZC4A 1A69A 3WNVA 5A9RA 4CETA 2VAPA 1ZDMA 4OB8A 2Q41A 2P68A 3EVAA 3T3MB 4N7MA 2A33A 5K3EA 1AY0A 3OX2A 4BGEA 3QF4B 1CX9B 1QM5A 2YFYA 2FMXA 3BJRA 4JC0A 5EZ6B 5K8CA 4E1VA 3W2GA 3SYLA 4GD3Q 1E2IA 2VUHB 3AR4A 3HCOA 4JBLA 3AV0A 1RSZA 2FN4A 4LG2A 2VBGA 3NUZA 3PWTA 4IDOA 4WLVA 4ZO7A 5DM1A 3TKLA 4Y6OA 3AIKA 1RLUA 2HSZA 2YHBA 1E7RA 2NQTA 3MWEB 2UZ3A 3OE7A 1YBMA 2Q4EA 4JJ8A 3LKZA 4X60A 1KRXA 1ZM4A 3BMNA 1Z22A 2P2CA 3FNGA 4FSHA 3W7BA 1MX0A 1BXKA 2JFNA 1XYVA 4PYNA 4K6MA 1RZRA 4J1QA 3OTWA 1T4GA 3VYUB 4BRWA 3D6AA 1JG1A 3EFOA 2O5EA 4YRLA 5CYFA 3DFZA 2Q07A 4GBJA 4O4HF 4YCNA 1OI7A 5T3YA 3TXYA 2QTBA 2H4FA 3RGSA 1J8VA 5B4TA 2IIVA 4IKPA 9ABPA 5L7WA 3ZDCA 3V7WA 4KV9A 1FTWA 3ZNPA 4ER3A 2R0IA 1NVBA 1RM0A 3VLFB 2ZS9A 2AYXA 3HR7A 3ICWA 1UWVA 3KVOA 3VISA 3AR2A 4Y6QA 3KKOA 1EFPA 1PF7E 4R2WA 4DM7A 1CJSA 4BQQA 1Z74A 5HTOA 5MHTA 4A0SA 3ACCA 1KJIA 3AHJA 1XMSA 2SCUB 3FCOA 2II6A 1DBVO 2R6GA 3HDVA 3QPVA 6YASA 3PTAA 1IK6A 2ZR0A 2KNZA 3KOZA 1FYVA 1OX4A 3U7FB 3IR5A 3T3NA 4BMYA 1M0EA 4G26A 2GB4A 1BGVA 1YQWA 2F1RA 4MV4A 1Z0AA 1UQUA 2FSUA 1JWBB 3TL3A 2ZI4A 3K9FC 2J46A 3LQ1A 5ENDA 1NXXA 1TQ6A 1W8DA 4XM0A 4MW1A 3ZGNA 4H6PA 1TW2A 3H1EA 3HVJA 2VSFA 2HKIA 3KSMA 2PVSA 3WKEA 3W5VA 4B84A 4CF7A 1GG2A 4QELA 2XB4A 1G8JA 2CLDX 3I42A 3OI7A 3GV0A 4I5DA 4TKUB 2A1TR 1FNBA 4FKMA 1XZDA 2PS9A 4KXFB 4R1PA 1T91A 2W6MA 2JFWA 4EJMA 2CK3D 1XDWA 4MH0R 1TIKA 3WL3A 4G8CA 3WLLA 3VAZA 1SXQA 4BKRA 2ZTVA 4E32A 2JHCA 3AR9A 1SOWA 1Y7HA 2ZG6A 3BMOB 3TMYA 4Q4HA 4X63A 3QU5A 4L73A 4HJRA 5BT8A 5ESWA 4OJQA 1CIVA 5TT1A 1DUVG 3R0QA 1QZXA 1SCUA 4BL5A 3QEMB 1C80A 1GL9B 5DIFA 5KNBD 3ZGZA 2DFKB 5D8DA 1OLSA 3VV2A 2G36A 4E94A 3J7BA 3L01A 1PR3A 2F1KA 2XAUA 3ABRB 3QSYA 4N3BA 1VYTA 3R0JA 1XA4A 1UKCA 3CZQA 2OCIA 3OQNA 2CLIB 4LF4B 1KZ7B 3STYA 4Q1AA 1V1RA 2EXXA 1LSJA 3I4FA 4LVUA 1VYUA 4LNUB 1UC5B 2RB4A 2FMFA 1X7HA 3E3AA 1MO4A 3BCSA 2I9PA 1EE8A 1WR8A 1PG0A 3AONB 3N7TA 5LCXA 4A23A 4AICA 1HKUA 1XTUA 4IIUA 4WOBA 1S8NA 2CXPA 2X5KO 1GNTA 4GG1A 4LE1A 2B0JA 2IYUA 1ST3A 3AHIA 4RE6A 1CBUA 2Q3DA 3KYDA 4ZEOA 1DTEA 3QELB 1P1BA 2E89A 3G8CA 4RVDA 4DLZA 3HBFA 5K2OA 1Y6GA 1YVEI 2CHGA 3L4SO 5HK9A 1QHXA 4BJ6A 4Z4EA 2EBUA 2EHDA 1BS9A 1ZFNA 3JD2A 3WLIA 1ZM3A 1TH2A 1VDMA 2E6KA 1SFRA 2XY4A 1DKUA 3SBXA 1CEXA 2QJWA 2Y1FA 3O2NA 1B00A 1KJJA 4DLUA 3GUHA 5ADVA 1NVTA 1XB2A 3HN6A 1NNLA 4KO1S 4LJ6A 1OWOA 1J00A 2FSGA 2OHIA 3VO8A 3U3MA 2VJDA 1CQXA 4FYHA 4CG0A 2B9VA 3GG9A 4JLUA 4WXPA 1E1CB 1C0IA 2AZMA 2VYCA 1SXJB 1WY7A 3GA0A 2WI8A 3NIBA 5DLEA 3JPWA 5HBRA 4D46A 4ZRNA 2P9GA 4UU0A 1KF0A 4HTFB 4HNVA 1AMUA 4YAOA 2Y20A 2FW6A 1FNSA 3WLEA 3BH0A 2VKTA 4F8JA 5F7XA 3P45A 4UCFA 3PBKA 4KVFA 4ND1A 4RZHA 3D7MA 1LF5A 3KU4A 3KUXA 3LPMA 1FP4B 3OFVA 1P0PA 1V4NA 3DE4X 1SBYA 2BTQA 2Z98A 3WMXA 821PA 3HB4X 1YJ8A 1T2CA 2FUNB 4RPGA 1W2HA 4DR2B 1QFZA 4KQIA 1TCUA 2LZ0A 4AY5A 2ZUUA 5JROA 5EERA 3I6MA 2UXDM 1JA0A 3I83A 1RXIA 1TLTA 3WFIA 2BBTA 1SVSA 3C24A 1KFBB 5TMDA 4WGGA 1FFXB 4Y1RA 1RJ9B 2A67A 1C7JA 4E31A 1LV8A 1K06A 3A1DA 1U9IC 1RYEA 4CDRA 5KU1A 5HM8A 3VI3B 3R7WA 3AI7A 1BQEA 5DJ5A 2OGTA 4AROA 2OGWA 1YCDA 2FP3A 4JL8A 3UAXA 1GV0A 1O6CA 3IB6A 1I1NA 1LDEA 4OBBA 4HQLA 3PC2A 4U0JA 1TQ8A 1OR8A 1R0RE 1SVKA 3RAEC 3FA2A 2D06A 3AYXB 4IXNA 3VZQA 1QG2A 4IH4A 4QVIA 1XZCA 2MSEB 4QBIA 2R25B 1NVVR 1U1DA 2ZJAA 3PHLA 3CRQA 1TK2A 3CJQA 3E3MA 1QHSA 3E9DA 2XUGA 1VE3A 1SD1A 2UYCA 3AHCA 3I2FA 3MGAA 1HC7A 5BQ5A 1XKQA 4EFMA 2CLLB 1IY2A 1IE3A 3DDZX 1QYVA 1Z7BA 3U26A 5CVVA 1CYEA 5HQTA 5HZHA 1XZBA 2WFLA 1F60A 3QLEA 1GLVA 3FCCA 1EWRA 1B0UA 1ZD5A 4CW7A 2EZ9A 3KTAB 2GPNA 2O2SA 3HO8A 3QFFA 4Q3KA 3AR5A 3WHIA 3BJEA 3PUKA 3PNQA 2QT0A 3ZS8A 4I19A 3EIQA 4JIGA 3OT1B 5SZKB 3DS8A 2L69A 2QMHA 3O7MA 1J22A 2C9ZA 5KC8A 1JKXA 1Q0HA 3QYBA 1RWKA 2PHZA 3IPLA 1JDUA 4ZRMA 3RC1A 5BVHA 1SBIA 3LZ6A 1J9GA 3MCZA 1TTEA 3J27B 2J32A 2CKMA 2H5LA 3PXDA 4B2PA 3PITA 1STOA 4HV4A 1JHYA 2GESA 3IOMA 3JRWA 3KAPA 2MHCA 2Y1OA 2APLA 2YJTD 4DJDC 2K2WA 2P91A 1EWQA 4JI3B 2YHIA 3NYWA 6REQA 5IM4F 1PD1A 5DX8A 4LX0A 2ZYTX 3KS8A 2VDLB 1WSDA 4MICA 4ALJA 4YUZA 3J7AC 1XMIA 2EKZA 3W67A 2WUDA 2NPFA 4BBJA 3IEVA 3PC4A 2ZQ5A 4Q9DA 5ANRB 4PQGA 5I7WA 4J3NA 3FNIA 2YKGA 1JR3A 1R4GA 1EE9A 1XF1A 2P6MA 1V6SA 3B51X 2EWVA 3KT0A 4H0FA 4L16A 4PGAA 2HT1A 1QGAA 4OG2A 4EFLA 4BFWA 3D0QA 5AW2A 5L4NA 3SSOA 4RGYA 2BDEA 3F3YA 1BU5A 1KAGA 1I13A 4G67A 1I6WA 1QO0D 3GW8A 3MQFA 1A9SA 3QVXA 4NJEA 4ARIA 2AS0A 3HDGA 1U3WA 2QVBA 2RCNA 3D2LA 1O5TA 2JFFA 3BB3A 2MSCB 3A2MA 4MV9A 4NOMA 1RVDA 4QOHA 4R16A 2NO1A 4CLOA 5IABA 4OHKA 3E4CA 5HOQA 5JTTA 4D9BA 4A73A 1PQUA 2C3YA 1GT6A 2HWWA 3H5TA 2P40A 3NYQA 3PFKA 5LD2C 3FSGD 1SUAA 2PFKA 2W0SA 2PGIA 5LP6F 3N76A 1YLAA 3KUDA 4O4JB 1S3FA 3DAOA 1ZOLA 3VKHA 3V4VB 1YS1X 4UUPA 5IMBA 3V97A 4E6PA 3TZLA 1TM5E 2H3HA 4FDTA 2OFWA 3N6RA 4Y6PA 1ZOOA 2FYTA 5FX2A 5TARA 4RLFA 2PL5A 5KQSA 1A1SA 4FGSA 4MW5A 4K2AA 4YP7A 3TRIA 2E5LB 1JAYA 4RXTA 4BWGA 2D6FA 1YFKA 1WX1A 2F2TA 2WYVA 3M5CA 1ZP6A 2I2CA 3G9ZA 4LHYA 2I2XB 2HJGA 3KXLA 1U2TA 1IOZA 5KMGA 4W8HA 1NM5A 3JZAA 3MIZA 1JH8A 3O74A 5F2EA 3GCXA 3BTVA 3ZWWA 1XRNA 1RRFA 4UZSA 3IIJA 1G7SA 4CFZA 4FGZA 1UFQA 2EBFX 2HF9A 5IJZA 1EQUA 3WOVA 3W77A 4DV2B 1ZHFA 3FFBA 1H0HA 3LQ4A 4JY7A 1QH9A 3PUHA 4K87A 4J7AA 2A1TS 3S44A 2WIAA 3EZLA 3DKKA 1KNQA 3AJRA 2XB2A 3KAJA 3KVVA 1D2CA 2Y76A 5DDIP 3GUZA 1OZ0A 2ODPA 3JRNA 3NHAA 2D7DA 5AFSA 2Z9CA 2P5YA 5J5CA 3GEHA 1V7PC 5KYTA 2GYUA 3TZBA 2VTDA 4LOLA 4UHDA 3RAPR 3RTGA 3RG2A 3B3AA 3IH5A 4IVQA 4M46A 5BSWA 4ZYXA 2CFSA 4F93B 1YB1A 3EF0A 4LFAM 1WB6A 2NTYC 5IFKA 5J2UF 4C4ZA 4XQCA 1KQ3A 4TWRA 5F9FA 1LY1A 4G1VA 3J80S 4I5SA 5FADA 1GYQA 5FLYA 1RKVA 3H0EA 2CNDA 1NVFA 1HWYA 2AFVA 2GJ4A 4AJPA 4EVIA 3FZEA 3DBOB 1WU8A 2C95A 2Y1XA 4X7MA 1YR3A 3HYSA 1JIUA 2I4OA 2ZJ4A 4MSUA 3S3TA 1SUBA 5JC1A 1Q0SA 4GE3A 3EIWA 1E2UA 1YBAA 4OQEA 3L0IB 4QGGA 4TX1A 4X66M 3H1FA 2HGSA 4XJXA 4BTEA 5KTYA 1W9HA 1IM5A 1CC1S 2GNPA 2IEDA 2QTHA 1H4VB 4CUKA 1RADA 2IVZA 2H1HA 1H2RS 4CM1A 1ITZA 5LZ4A 1E1LA 1G42A 1RYHA 4E30A 4LRTA 1C7YA 3HCPA 4GI1A 4UNRA 1N8KA 4MK4A 3PIIA 1K0FA 1MQ8B 1NDQA 1ZOPA 2N1MA 4WNAB 4C43A 4B6EA 5FTNA 3F98A 1FLVA 2VXYA 1LDMA 1OZHA 1R9NA 2Q0HA 2HXGA 3IJEB 3O1LA 4KPUB 1TF2A 4NQRA 4KT0F 4OGLA 4X00A 5FI0B 1BMQA 3HHEA 4D1YA 1S2IA 3KJGA 2ZUTA 3O7WA 4BNJA 2M9MA 4YRPA 3SF0A 4NV0A 4L8RC 3R5TA 3TTUA 4F97A 4I1PA 3SLGA 1R8QA 2VF8A 1LSSA 1I5OA 1N7JA 3KQWA 2WY2D 2R0QC 2ZTLA 4MHTA 4F86A 2OL4A 1A97A 2PX8A 3TW8A 3MHPA 5C8VA 2WM8A 3F4LA 1LPOA 3DZBA 2PWPA 2YN0A 1YS4A 5FBVB 1SH7A 2WDPA 5DLYA 4GPAA 4ML3A 4DR1M 1T6NA 1HYQA 4LIPD 2VPYA 2OGSA 5HGXA 4BO7A 1GTL1 2CF5A 2Y6UA 4CZ2A 1IJBA 4G0PA 4I1OA 3PT5A 3IA7A 4EPTA 5BV2P 4GXQA 2LR0A 1N34M 5FTJA 4LOHA 5AKIA 3G0IA 3VYWA 4LMPA 1HOXA 3CG0A 4OQXA 3DMHA 3MGBA 2WVGA 2JASA 4ZCMA 1WMSA 3SEZA 3W5JA 1AVTA 1FB5A 2HJWA 1H65A 1WCV1 1AA9A 1M2NA 2QLBA 2XLBA 3P9RA 3WMRA 5AHRA 3AVXA 1HMYA 2ZETA 4B2YA 1QX3A 1ZU4A 4NARA 1QS0A 1DCTA 1NZJA 5B3JC 2JZ1A 2DJIA 4HD8A 3SICE 1VSUA 2W6PA 1AZLA 1WVMA 5CH3A 1HDOA 2FI1A 5ENZA 1Z73A 3DKIA 3CUKA 1EP2B 3ER6A 4I14A 4JDUA 5U4XA 1OVMA 1G59A 1OGJA 2QQ0A 2IXAA 1KH3A 1M74A 2XUJA 3B8HA 3S8EA 5TS2A 2GBGA 4M6WA 4QGFA 4NE2A 4YHHB 3OOHA 1M1NA 1T0HB 2LTUA 2WAMA 3EBOA 4CCAA 4PZDA 1EE1A 2WJHA 4HNGA 1HJPA 1GUZA 2BL4A 5CYPA 3R24A 1F8FA 1BWRA 1R50A 1M2OB 1BX1A 1KHHA 2BJHA 4EHJA 2H7XA 4XPIB 4NI5A 3BXFA 4D3DA 5HRAA 3DDWA 1GL7A 3FTEA 5CJPA 5SYMA 1E1KA 1WEKA 2RK6A 4Z7QB 2QW0X 5CEJA 4L3WA 3SXJA 4YIHA 3MM4A 2H51A 4MKXA 1XVVA 3TVYA 4ZVQA 1KY5A 3TAHA 2GBCA 2ZXEA 1J8MF 1G0OA 1QFXA 3GEDA 3OF2A 2R5NA 5IEJA 5JJ5A 4M8KA 5AW9A 4GQAA 4A92A 2SKEA 3IP7A 3IDQA 1X7XB 4G8BA 5LLSA 2MSLA 4C06A 5A62A 5CG1A 4M89A 2G9UA 1H5QA 3K2EA 5LQUA 2XODA 2H1CA 4PS1A 3RHTA 5B7GA 5CB4A 3RV3A 2JZNA 1Z7YA 4W5NA 5JBNA 4RCVA 4TL6A 1R0XA 3DCJA 3MINA 4JD5A 2ZB7A 3QA3E 4ZOCA 3VJRA 4D4IA 1DAOA 3WAKA 2EW2A 3FSGA 3O3CA 5DGIA 1UM9B 4RNDB 1A5AB 4WY5A 2UKDA 2VT6A 2DH6A 4IDGA 4I4TF 2EG5A 1V35A 2H1WA 2C5RA 3FTCA 2EX4A 3RVDA 1X37A 3GLFA 1FXSA 4E07A 4M87A 4Z51A 3UW3A 1AQLA 1ZGZA 2QM7A 1WDLA 1AK9A 1ZSVA 3IRUA 1AUOA 1R6UA 1V7ZA 1C0EA 2VHUA 2ZIEA 3RS7A 2VDBB 2TECE 2JIZA 1WXHA 2Y1DA 2FQQA 3GFOA 3VR2A 4EF6A 3NRBA 3SEQA 4INAA 3UT5A 1TMGE 3L1KA 4P4SB 4GOKA 1R6XA 2CFIA 5KNCH 5IXSA 2LKCA 2XCSB 1LUAA 2YV2A 5F64A 3A4MA 3KHTA 1MV5A 2C58A 2G04A 4WOJA 2GFIA 3H9UA 4X64M 1E9CA 1SO8A 2GR9A 4ATNA 2XSZA 3GFSA 1BWPA 2VRWA 1E6WA 2BEUA 2G0TA 2QGZA 4YRQA 4H6WA 4Z9YA 4Y9UA 2EATA 1ZMXA 1YB7A 1CJTC 3BL8A 1CZHA 1V48A 3NBYC 2DMRA 2JBAB 1E9VA 2OP0A 3CSUA 2W8BB 5IPFA 5FV7A 3I4VA 3KVYA 3MCTA 4UHEA 4BNLA 2P2SA 3HKPA 4RJKA 4HAOA 2BUCA 3NOXA 2R8OA 3CZ9A 5T7BA 5ELMA 3ILXA 4J6EA 5B1IA 2D3WA 2P6PA 2QSJA 1U80A 3I4LA 4KVZA 2WYUA 2Q4TA 3GCZA 1UXHA 3T5BA 2GAIA 1WCXA 2KJQA 2Q6LA 1TD1A 4UW9A 5C7LO 4Q7QA 1KI2A 1GO5A 1RD4A 2RKOA 2JCVA 3AF5A 2J45A 4ZZ1A 1PZMA 3GNSA 1Y34E 2VC2B 2VP4A 2BWJA 1UBSB 4FS3A 3TW4A 3VR4H 4F6RB 5BSKA 3P2MA 4AECA 1U3GA 5BWMA 2ZP1A 1IHPA 4FYWA 3N2LA 4P22A 1NYLA 1T5LA 3V1MA 1PUIA 2FN8A 4CM9D 3LLVA 4PQYA 1UFOA 1R4AA 2XJ9A 1PEAA 1DEXA 1CY0A 3S28A 1UBOS 4MRRA 5H1YA 2B7LA 1FMJA 3SQNA 3UJ6A 3WA7A 1CS4C 4X90A 3MK31 4N12A 1ENYA 5J43A 1ADGA 1IUKA 2DC1A 1E3LA 2YY6A 4X1IB 4LV5B 4L3OA 3C6XA 1I5EA 1NRJB 5E2AA 5EWMA 3SZGA 2KYRA 2WJPA 4RD1A 4JU8A 5HG0A 2QTCA 4OBXA 5GPBA 2XT6A 4IJ6A 5F2OA 1UOPA 4I66A 5L7TA 2XRYA 4M1EA 3ZGVA 2JHPA 4L6V6 1CUBA 4XWGA 1GGMA 5JDCA 4X1KB 1MDFA 5H02A 2FDCA 5MFPA 5DBFA 1VMIA 1G21A 2X7JA 1AGNA 1EAMA 4I81A 3T7SA 4C03A 5K4GA 1AIPA 4K05A 4R1SA 2J41A 5K20A 1V8ZA 2AG0A 2V1XA 1W87A 1WG8A 3M5WA 1JU9A 4M36A 5DKFA 1VMAA 4MGZE 2IKQA 4TZ0A 4QYWA 2OOKA 3WKCA 3HJRA 4JSRA 3L5KA 1DWUA 2C0QA 3L7DA 4AJ4A 3O2QB 1YACA 2PX0A 1DC4A 5EE5B 1EFKA 3WK8A 2HGZA 4ALKA 1AXGA 3LK6A 4C7OA 2EQAA 3IB3A 2WFAA 3LLSA 2P6UA 4MPPA 1YZLA 1BCSA 3CN9A 4JROA 5EOVA 3M49A 1GABA 1L7QA 4KAFA 1GN9A 4NECA 1YAJA 2PLWA 3UHOA 1M1YB 1VKOA 2FMTA 4JI8M 3RV4A 3ZZ0A 1XEFA 5E3HA 4TV9F 5H37D 2AFRA 2I4TA 2N75A 1W36B 4AWXA 5KYVA 1L7NA 2YMLA 4K6FA 1GNPA 2Q4OA 3IAM1 4C0KA 3ND9A 1HQYE 3RBZA 1X7YB 1C3JA 3PQ7A 2IGTA 4JVOA 1P91A 2ZXUA 3M70A 3GQ3A 2QR2A 2VHZA 4ZHQA 1KS2A 2WDZA 1KR2A 3HVUA 1Z0KA 2QROA 4MRAA 4QBGB 5DNEA 3WL7A 2N35A 2ORVA 5BWOA 5LIRA 1DC5A 1QE3A 2XZFA 1H5UA 1EM6A 2FPMA 3ZWVA 3LWBA 3DKRA 3WXBA 3UK7A 1IHOA 2XMQA 2BMVA 2PGAA 3C5WP 4RL6A 2IY8A 2IBSA 5AIAA 4GM4A 4Y9SA 1ZR2A 2MR9A 1J0CA 5C0OE 4O4JA 4F4UA 3CLTC 1MHPA 3NCHA 3NWOA 1Z35A 1PQPA 3TZ6A 2MYNA 3NWBA 5U1PA 3X1YA 3NPAA 2UZAA 1VJ5A 1XCJA 4PZCA 5JZSA 1WXXA 1DOAA 1I2ZA 2XDAA 3DNPA 4FZVA 4FBMA 5ALLA 1NNUC 3ITDA 3OFJA 4B17A 3BRWD 3C3XA 4ZJYA 2ZYVX 1RWWA 4TYMA 5ALVA 4W8OA 2XB6A 5DMHA 3V9PA 2ZPUA 4CM7A 4OHOA 3QNWA 2NYAA 1FYWA 4W4TA 1NG1A 1MENA 3F2VA 2K6GA 4QG7A 4EO4A 1LNZA 1OVGA 1V5GA 2WZCA 3LP8A 3N2NA 1FBNA 4FR5A 1AOXA 3O26A 2WKWA 3KD3A 4BVLA 2BR3A 4R0NA 4E3ZA 1NULA 1P5RA 2EU8A 4BATA 1XWWA 2XH8A 4H7EA 1EM8A 1XVIA 3ETNA 4JLBA 5FYQA 4C2TA 5ADWA 4GBED 4V0MA 4HRVA 3TDMA 1LNSA 2OHJA 1CJVC 4OKNA 2JFGA 3V8PA 4JEIA 3HHZA 4F3KA 5FLXS 4RCYA 5JAHA 3VBCA 4WOPA 1GU0A 1TYDE 5H70A 4DCNA 4LJAA 1SBNE 3QG1A 2DF8A 4O2BA 1V34A 2W71A 4C87A 1DWPA 2JFXA 1W25A 2JI8A 3QE3A 5JY6A 5LQCA 3Q7SA 2JY5A 3RTBA 4G1BA 3UC9A 5JAOA 2GZ2A 5ITTA 4QFBA 4RKUF 3G1UA 1CFJA 1RYYA 3ZXYA 4D26A 3DVAA 1XWIA 1Q3BA 4FWGA 1R0WA 3GI1A 2Z6AA 3ADPA 1YL6A 1W34A 5D5PA 1RQLA 2H8KA 2ODAA 4KSBA 4NOLA 5AM5A 3TLZA 3U6EA 2ZJ2A 3QV2A 5CLFA 4FHGA 4DIEA 1CUJA 3KPUA 4K5QA 3ZXSA 5CDFE 3D3WA 4MCAA 3U5ZB 4EGFA 1GADO 2Z5GA 2QUJA 4RV9A 2AL7A 2RGNA 4IZIA 1NBHA 1CW2B 2HDOA 3RJTA 5JAZA 5IYZB 5FWYB 3KAKA 4CGYB 1WUYA 2FFQA 1H2FA 2V03A 2P27A 3PC7A 4Z9AA 3WRVA 4DY6A 1E5LA 1OBHA 1PR9A 3CF4G 1KQPA 1ZLYA 2CVPA 4DUPA 1CJUC 3M9WA 4B4VA 3SHGB 2ST1A 2ZRBA 3QUAA 1ZWKA 4Y9DA 2ZWAA 3M4ZA 2HA6A 3OOSA 1UEXC 4OLHA 1TA0A 5DK6A 3H3XA 3K72B 1XALA 1XMVA 1YE3A 1UDXA 3EEFA 2XUPA 5F9HA 4EOGA 2D5AA 1MT0A 1JMYA 4AMUA 5A5GA 3UAOA 5B64A 3BWBA 4UTNA 1GD1O 1GSOA 1R37A 1O8BA 4ROTA 1ECBA 5EJMA 5HRCA 4AKIA 1ZINA 4WINA 4TUWA 1W7AA 2IHNA 3KUKA 4CTJA 3MD9A 1DGHA 3U0VA 1CVRA 3N8IA 4MGKE 1QQWA 4TRRA 3KT6A 1UK9A 2CT8A 4TLLB 4B4KA 4KQWA 2X15A 3L27A 1JHMA 2WW8A 3DZIA 1CF9A 2IZ5A 4J0GA 3WNBA 3IVMA 3AP3A 5LXTA 1NQ5A 2H06A 3BS4A 3N8HA 4ASUA 4L5BA 4DUZM 2ZWMA 1Z6AA 3IIKA 1T5TA 3D0OA 4R54A 3CEPB 2HN9A 1OYVA 1YDGA 1P1RA 1P33A 1NVWQ 4JVLA 2H08A 1DOZA 2IOQA 4LG1A 4MS4A 4O1MA 5E6RA 5TPZA 1DPFA 3REQA 3ZK8A 3AJEA 1GCAA 1P19A 3M5PA 4GGPA 5IULC 2RDMA 1N5OX 2B1QA 3QYAA 1T2EA 2YBEA 4YGYA 2W2QA 2IP1A 1I36A 4G3XA 4REMA 2DVWB 2NSYA 4XIJA 4F85A 1HBJA 3NEAA 1TYBE 2GO7A 2YOFA 3CX6A 1YNSA 5K3FA 4D0GA 4H3HB 1V6CA 4P98A 1O96B 4PTLA 1H3EA 4C05A 1F4LA 4UTRA 5B1YA 2HI0A 3PDUA 1GRNA 4XFJA 4ZTZB 4BVGA 1R0BA 1LVHA 5DTQA 1ZNQO 2KE5A 4D3YA 4L85A 1JQDA 5FPQA 1QP8A 5DZSA 4OHCA 3V55A 1AN9A 1C3XA 4KXMA 4GKVA 4LTNA 3SHOA 3DKVA 4ZMBA 2ZR9A 2V0NA 2GEBA 4LY9A 3KYJB 4BLVA 2XVAA 3FJYA 4MLCA 4DLBA 1UPUA 2PLAA 3IAAA 3QJ5A 4G0VA 2D7JA 4W9NA 2Y4NA 4WHMA 5ICSA 2EKPA 4AW9A 4I1UA 5I4IA 1K7CA 2VAWA 2XWSA 1JMKC 3ISTA 2QM8A 4YS6A 5FBHA 4YAEA 2HWJA 4BMXA 3WDSA 2RCYA 5CB0A 1Y8ZA 4KACA 1E3WB 2VDWB 4JJEA 1YMVA 2IH2A 3AKEA 1G71A 4B76A 2RGDA 2X42A 4LRSA 1PFYA 3LT2A 1ZQ1A 3PHHA 4O4IF 5GV8A 1Q7GA 3THRA 1IBMB 3O8RA 1EBFA 3LUFA 1IK4A 1U5BB 2I4MA 2NUPB 3W9SA 2VJOA 3JQCA 4H7HA 3RF6A 3L6CA 4LF7M 3WNQA 3ZVLA 4EJFA 5IX8A 4RCZA 2PUHA 1K8ZB 3T0FA 4L4XA 2GUWA 1N4AA 3ZQ4A 3FH0A 1SCUB 4IS2A 1R6TA 1RLOA 4N54A 4ZVSA 2ECOA 2C7BA 2IDMA 2QAGC 5LWHA 3PGVA 4NCAA 5EIOA 1EVQA 3ECAA 1IUNA 4ZQEA 5F77A 4H16A 3OUUA 2H0AA 5TXGA 1AS2A 5HWSA 3G6WA 3I76A 4H27A 4BTLA 5L3QB 2W6JA 1F2UB 5LXTF 3DBLB 1G21E 4YDHB 4KE7A 1C7RA 3UA4A 1QJ4A 2G77B 4YRZA 1PZGA 2OBMA 4N65A 3CLSD 1J1UA 1RTKA 2A1UB 4O25A 3TWKA 3W3ZB 4IDHA 5DRTA 3FKSA 4LWQA 2PUBA 1X9HA 3ETDA 1EGAA 3T5TA 3DXYA 3W78A 1N5JA 2ZE7A 5DASA 2HMSA 1V33A 3IAXA 4C14A 2X0NA 4LJSA 4QL3A 3L4EA 4R8MA 3NATA 5AKHA 2ET6A 5E2IA 2PAAA 3X0DA 4YYEA 1JJBA 3DEHA 1U2ZA 2NNWB 5G4LA 3ADBA 1KZYC 4JV5M 4HPXB 3RUIA