1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
b'RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
molecule tags Transferase
source organism Thermotoga maritima
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
1G4AE 4MQ4A 1NV8A 1WG8A 3LPMA 3SM3A 5BP7A 3DULA 1VE3A 2IIPA 4P7KA 5CVDA 3T7SA 3TOSA 1MN3A 3M33A 4BLVA 4KIGA 1IXKA 1RI4A 3IEIA 5K0LA 1R00A 4AUKA 4FT4A 4UOEA 2GPYA 2HV9A 2HR1A 2PX4A 3MERA 2WZJA 5EMMA 1EQAA 3FRIA 1E94E 2JY7A 1TW2A 3KR9A 5DSTA 5HIMA 3CJTA 4XUEA 4QPNA 1I1NA 1RI3A 2YTZA 5ICGA 2PSSA 3MHTA 4GOOD 2P35A 3THRA 2YXDA 4F85A 2YX1A 3T7RA 1KYIA 4U7PB 1JG4A 4C06A 1L1EA 2ZBPA 1L3CA 3KKZA 3KPJA 5GM1A 1QZZA 2CMGA 3G2QA 3LGAA 5K0EA 1G38A 1YF3A 3LX6A 3I58A 4CWAA 4DCGA 5B1SA 3GWZA 1OAIA 5T67A 3OFKA 4RV9A 3BGDA 3K0BA 4UN2B 4QVGA 2UYOA 1R74A 3SMQA 1WGLA 4GOLD 1KPIA 3JWIA 3BZBA 5DX1A 2BR5A 3UBTA 5CVEA 3L8DA 4Y30A 3UJ7A 1TW3A 1UWVA 1XDUA 2PY6A 3HA5A 2L4EA 3KR0A 5K0JA 3V97A 4GC5A 5KS2A 2HWJA 1FP2A 1P91A 5EEGA 4E30A 2DHYA 4ER5A 4F86A 5GIOE 5GIPE 3GLGE 1OKSA 1XCJA 2IPXA 5EMLA 4RTNA 1MHTA 3P9NA 4DCMA 3C6KA 3BBZA 4PONA 2OYRA 2AS0A 4Q7JA 2QSFX 2PLWA 3KQPA 2C7OA 1OR8A 2VS1A 3DTNA 2QNJA 2QRVB 2I7CA 3ERCA 2JJQA 5FQNA 4YV0A 3BXOA 2OO3A 5E8JA 4RTQA 3NVKI 3B3JA 3O7WA 1ZGAA 4C03A 3HTXA 1ZGJA 4A6EA 5F2KA 3K9OA 3P9IA 3Q7EA 4AX8A 1JTEA 2ZZKA 3Q87B 2JH9A 4CTKA 2QYOA 1WGNA 1R18A 3CJQA 1G6Q1 1Z3CA 2JH8A 2IP2A 3G88A 3M6UA 4QTUB 4P7FA 5EIWA 5FHRA 2NXJA 3LBYA 4IV8A 3NTVA 3LECA 4OA8A 3IHPA 2JHCA 1DV0A 1R4GA 4DKJA 4FS8A 1OTRA 2PT9A 3KQWA 4R6XA 5FQOA 1B42A 2JNHA 2HTEA 3FUUA 3TKYA 3SR4A 5F2NA 3FRHA 2F8LA 3KPUA 4R05A 5FCDA 2PGXA 3UJCA 1X1BA 4IKPA 3FTFA 3K9PA 5KQSA 1DCTA 1ZKDA 4FZVA 3HA7A 1Q0SA 2FYTA 2ZFUA 1EIZA 1BVSA 3G7UA 4X1OA 2NP7A 3E46A 4RVDA 3KPVA 2Z6UA 3QOWA 4PYQA 3KQVA 3OE4A 4X61A 2MJ5B 2GAFA 1KYWA 2ZBQA 4PCAA 5DM2A 5GWXA 3X0DA 3IV6A 3DOUA 3FPFA 5DTMA 5EKXA 3UJDA 3FTEA 3OZRA 5E2BA 1X1DA 1ZG3A 2LD4A 3A7EA 4Z2YA 4ATNA 1NW8A 5K0FA 3HCAA 3GLFE 3A4TA 3ELYA 3FPEA 2C7PA 2BM8A 3NDIA 5E9JA 3FUXA 3GNLA 3GXOA 5FHQA 4EKIA 1EFUB 4PINA 5CM2Z 1JR3E 1N7IA 3F4KA 4GEKA 1KYZA 3LDGA 1F3LA 4HGZA 4PIPA 4QDJA 3DUWA 4U7TB 1ORHA 4V0QA 4PGGA 3CC8A 2ZIEA 3OU2A 5E2AA 2GS9A 2ZW9A 2H1RA 3IYLW 1HMYA 2QHOB 4CKCA 3GJYA 3LDUA 4MTLA 1ZMVA 1EJ6A 1AF7A 2PX8A 5E8RA 3R6TA 2NP6A 1VEJA 3CCFA 2XYRA 4KDRA 5HIIA 4A6DA 3SSOA 2C7QA 1WY7A 1A5TA 3LKZA 4NECA 3EVBA 4XUCA 5HILA 2OB2A 1UFZA 2K4MA 3HCCA 4OQDA 5CVVA 5FWDA 5LQAA 1M0EA 1VBFA 1YZ3A 4M7RA 5C9ZA 4RVHA 4YUZA 3TFWA 2LVAA 3NW9A 5DX8A 3UWPA 3E21A 1T43A 3HCDA 1N7JA 5DTQA 4X63A 4PYMA 2AOWA 1AQJA 1JSXA 1D2CA 3HCEA 3DMHA 1KXZA 3HCFA 3O4FA 3AWIA 4PYLA 1X1CA 2OB1A 3OU7A 1N2XA 1EAMA 1WZNA 2O05A 1HQYE 1DL5A 4HRAA 4M36A 1Y8GA 1YLAA 2AOVA 1YUBA 2H5XA 5EG5A 2R0IA 5DT2A 3DLCA 1BOOA 1F4IA 2ZWVA 3REOA 1BC5A 5T64A 3TM5A 3FZGA 5JUWA 2AOUB 4RYLA 5FTWA 2BZGA 3RW9A 3MTEA 3T0IA 5C0OE 4RTSA 4PYIA 3MQ2A 3HVKA 2Q41A 2FK8A 2JUJA 3KQTA 4F84A 2LVNC 3I9FA 3NWEA 1FP1D 4CKBA 4GQBA 1IM2A 3LCUA 1O9HA 4ER0A 1AV6A 1VEGA 3B89A 3DXZA 1KHHA 3R24A 3FYCA 3A26A 4MHTA 4IV0A 4EK9A 2KNVA 3NMUF 2AN4A 2EJUA 2P41A 2UYHA 3EGIA 1QZEA 1QAMA 8MHTA 3PB3A 3BT7A 2EKKA 2BR4A 5HZMA 3FUWA 1HT2E 4LWPA 5K8VA 5DM0A 1XB2B 4PGHA 1IM8A 1M6EX 2PWPA 2CL5A 3ID6C 3MTIA 3KHKA 4FP9A 4M38A 5LSAA 3ER9A 3EEYA 3MCZA 4YMHA 5K0CA 5CCXA 1R8XA 1XDZA 2ZVJA 3DH0A 3OZTA 3P8ZA 4RTRA 2NYUA 1GO5A 4DZRA 4R71A 5DPMA 2G3QA 2FPOA 2DAIA 2VDWA 5KYGA 5EZSA 2JZ1A 2DZLA 1NW3A 4HEOA 3I5UA 3LCVB 1TTEA 3P2EA 2AOTA 2LVOC 5EOVA 5K0NA 3EVGA 2ZZNA 3BKWA 1I9GA 3VYWA 2GA9A 3DMFA 1RI1A 2G8NA 4M37A 2OPBA 4PYOA 3M4XA 4CXMA 2AR0A 3ME5A 2V7EA 3CGGA 4YUYA 5HIKA 1SKMA 3PVCA 1KPGA 2GLUA 2DAKA 3G89A 4ZTBA 1RJEA 1JQEA 2ESRA 2A14A 2JY8A 1D2GA 2IDJA 1U2ZA 3GRRA 4P58A 2G70A 5JR3A 5E1MA 5LQCA 2ZIGA 3B3FA 3OPNA 5E1DA 5GINE 2LTUA 3H2BA 3OE5A 4PYKA 5D1HA 4BP1A 3GRUA 2JHPA 2WK1A 3D2LA 2IH5A 1HT1E 2QE6A 2BH2A 4RSRA 5DRTA 1EJ0A 1RJDA 1TR8A 1XVAA 4HG2A 2JZ0A 4PNEA 2P3QA 2PT6A 5HFJA 2UYQA 4OBXA 1PJZA 2K0BX 3E23A 1KP9A 2AVNA 5GP1A 3UZUA 2IBSA 2ZCJA 3ER8A 4JXJA 2YVLA 1HNNA 2XVMA 3R9XB 1MJFA 4Y2HA 3KQOA 2IBTA 2EX4A 2JY6B 2CMHA 1KR5A 2WA1A 3NVMB 4QTTB 1P3QQ 3HVIA 3P9CA 4RVGA 2DKLA 2AOTB 3OU6A 1AQIA 1JQ3A 1YZHA 1G55A 3BWBA 3EVFA 3GO4A 2ADMA 3HP7A 3UJBA 4ER3A 3C3PA 5K0GA 1ZQ9A 2P1DA 3A27A 1RI5A 3E05A 3THSA 1VL5A 4DMGA 4LG1A 3P9KA 4EKGA 4RTMA 1T6OA 2DENA 2FRXA 1V39A 4DM3A 2ZTCA 3WSTA 2FCAA 3G8BA 2KNZA 1VEKA 3SSMA 4YMGA 2UYCA 3C6MA 2MR9A 4ER6A 1FJXA 2XYVA 2XVAA 4X60A 5EZQA 5FA5A 1SG9A 4L7VA 3HVHA 5LQJA 1IFYA 3KPWA 4C05A 5H02A 2P8JA 2GB4A 2PXCA 4PYNA 1NE2A 1CUKA 1IY9A 4RWZA 4YV1A 5DXAA 2VP3A 2GH1A 2PJDA 3BGIA 3G8AA 4R6WA 4RX1A 2OXTA 4DBGB 2Y1XA 5LQNA 2ZZMA 2YUIA 1UFKA 3FYDA 4HSGA 3G2OA 2YXEA 2O07A 3B5IA 3GCZA 2PBFA 5LQKA 3R3HA 3K6RA 5GOZA 4AZWA 1L3BA 1ORIA 2AOUA 3NWBA 4DF3A 5IKMA 3G5TA 4BY9E 2ONYA 3GRYA 4O29A 3HCBA 3MGGA 5EMKA 2PWYA 2ZWAA 3EGVA 4FGZA 1WXXA 4RVFA 2B78A 3SXJA 3GLHE 2OOBA 1I4WA 2L2DA 4POOA 2LBCA 3M6WA 5P8WA 3HEMA 1WR1B 1NBIA 3SX0A 5FADA 5HIJA 5T6BA 3HNRA 4QDKA 10MHA 1NW5A 2P3OA 5E9QA 1X1AA 3KQMA 2P7HA 4YUWA 4RTJA 1IXSA 1F38A 1VQ1A 1XJ5A 4E31A 1OQYA 2O25A 1RI2A 3MAGA 4WP2A 2VDUE 4GOMD 1H1DA 2B2CA 4XUDA 3P2KA 2YR0A 2HAKA 1VP9A 3SGLA 5BW4A 2CP8A 1NW6A 1WS6A 2VDVE 4MIKA 4C04A 2ZULA 1ZMWA 3CBGA 4FR0A 5DWQA 1QAOA 3RIEA 4C08A 3KQYA 3B3GA 3HM2A 3RODA 3GIWA 5BXYA 3MMPA 2ZLBA 1M6YA 2O0LA 2AOXA 4E33A 5LQUA 3OFJA 5IH3A 2AN3A 4MWZA 4B17A 2NNWB 4E2XA 3KQQA 1ZHFA 3PTAA 5DTRA 3HA3A 2CWBA 1R8YA 1NKVA 3GU3A 3IHTA 4G3OA 1YFJA 3MCTA 1TPYA 5M5BA 1O54A 3DXYA 4KW7A 2EKFA 3KR2A 4V0RA 4GF5A 2IDKA 3G2PA 1R6AA 2ORED 3B7PA 1C7YA 2DPMA 1INLA 2DULA 4BP3A 4C4AA 5HOQA 3EEOA 4EVIA 3H4JA 1L9KA 3O31A 3TKAA 2JP7A 2HMYB 4X41A 3DMGA 1WHCA 1SQFA 1SUIA 2BWEA 5CVJA 3QV2A 4GEWA 3GRVA 4LWOA 2ZTHA 5E9WA 1L3IA 2EG5A 4C07A 2DAGA 3NJRA 2I6GA 4P7GA 2OY0A 1SQGA 3CKKA 1JG2A 2G72A 2OO9A 3DXXA 1BKYA 3BGVA 2IGTA 3I53A 4FSDA 3ELWA 4QPPA 3TQSA 2IH2A 3FPHA 2I9KA 1HJPA 3EVDA 3BWCA 3EGEA 5E1BA 5CVUA 1FPQA 1YB2A 1SUSA 2HNKA 4AZVA 1QANA 1G8SA 5BW5A 3C0KA 1VG5A 5ERGB 1EG2A 1G3IA 3LL7A 2Z6AA 1D2HA 2P40A 5DLYA 5EKUA 2BWBA 3BKXA 5DX0A 5DFLA 3T7TA 5CCBA 4HC4A 2ONZA 3BWMA 2ZTDA 3DR5A 2NXNA 4QQKA 4BLWA 3NDJA 3UJ8A 5CD1A 7MHTA 1XDSA 1NV9A 2EJTA 4PCLA 2IFTA 1JG1A 1O9GA 4YUXA 2UZ4A 2KHHA 1WIVA 3TM4A 4PIMA 3VC1A 2WA2A 4E70A 2B9EA 4EMSA 1DO2A 2OOAA 3G2MA 2FK7A 2DNAA 5K03A 1VP3A 3ELDA 3PX2A 3SVZA 2PX5A 1YFLA 5LR6A 3QOXA 1RJFA 3E8SA 3F92A 3DP7A 3EMBA 3KQSA 3LBFA 4HTFA 4KWCA 1DUSA 3FPGA 5C1IA 2CKDA 3EVEA 3UA3A 5KVAA 1JR4A 3GDHA 5K09A 1V92A 1PRYA 3EVAA 5DSXA 5FUBA 2XYQA 4PYJA 1QAQA 2NXEA 4GBED 4EQZA 5ICFA 2B3TA 4OBWA 4RTKA 3TR6A 3TLJA 2KW5A 4FSXA 3LDFA 3U81A 2EJSA 3VSEA 5EHGA 3UJ6A 4OQEA 4BLUA 5U4XA 4GC9A 1VPTA 2PXAA 5FULA 3I64A 1NBHA 2JHAA 2KNAA 1WJ7A 2Y1WA 3AJDA 3EPPA 1XXHE 2R3SA 3P71T 5K01A 5CIYA 4KVZA 3GRZA 2JY5A 2CWWA 2OBFA 1JSZA 1P39A 4LECA 5EC8A 3G5LA 5EIFA 2AVDA 5EGSA 2NXCA 3TRKA 2Z6QA 5EEHA 2LVQD 3FPJA 3M70A 3T6PA 3E7PA 3FUTA 1NT2A 3BUSA 4F2LA 3KPYA 3C3YA 3LKDA 2ZIFA 3R0QA 4P7JA 2YQZA 4FT2A 2G1PA 5EQJB 5MHTA 3PS9A 4F1IA 1VIDA 4RTPA 5ICCA 5ICEA 2L4FA 3S68A 4HTFB 1JG3A 2MROB 4R8RA 3PLAE 2ERCA 2H11A 5F2OA 5GM2A 3GLIE 1G8AA 4DA4A 4E2ZA 4YV2A 5EPEA 4QVKA 4WVLA 3AXTA 5EHIA 1KPHA 3ORHA 5FA8A 4ER7A 2B25A 5LQRA 3V8VA 1VDLA 1JQDA 2JG3A 5KQRA 2OZVA 4GOND 4AZTA 2V74B 4OA5A 3DLIA 1WXWA 2HWKA 4RTOA 3JWJA 4G56A 2K9DA 1XTPA 2E5WA 2OKCA 2QRVA 2PX2A 3M6XA 3P2IA 5DM4A 2R6ZA 3FUVA 2MGWA 2P3LA 2ZBRA 4CTJA 4PWYA 2BR3A 5E1OA 3IECA 3JWGA 2C7RA 3ELUA 3PT9A 5K05A 1Q0TA 1AIPC 4GUAA 2QY6A 1RJGA 3P97A 4QQNA 5D1NA 3GGDA 2BM9A 1DO0A 3MB5A 1BHJA 2ZSUA 2DAEA 1VLMA 3EVZA 4R8SA 4WXHA 3OCJA 5HEKA 1X19A 4KRGA 3FTCA 1XCLA 1JTFA 1XXLA 3VC2A 5K0BA 3A25A 2H00A 3LCCA 3M6VA 3SSNA 1PGYA 2P7IA 2PV0A 5EMJA 3JWHA 5CUQA 3UJAA 3HVJA 4XCXA 2G71A 5FWAA 4HGYA 3PFGA 2N47A 3EVCA 3PX3A 2IH4A 2YXLA 4KIFA 2EFJA 3KR1A 2VZ9A 2PKWA 3UFBA 4E32A 2QM3A 4HH4A 1ZV1A 2PVCA 2PXXA 1QYRA 2DI0A 5DM1A 4H0NA 4CKEA 4DQ0A 3KU1A 5EVJA 4E2WA 4E2YA 2AN5A 2FHPA 4YUVA 1UIRA 4AZSA 5DRYA 9MHTA 3BWYA 1Q02A 2O06A 4KDCA 3TPZA 2RRUA 3UJ9A 3LSTA 1P1CA 2DAMA 3A7DA 3EMDA 4IWNA 3TMAA 2XBMA 3AY0A 3OZSA 3FTDA 3PFHA 4ISCA 5JI2E 1SVUA 2AZTA 4OX9Y 4RTLA 3FE3A 2I62A 1ZMUA 3UA4A 5G02A 1NW7A 4K6MA 5DXJA 3LHDA 2LVPC 1Y8CA 2O57A 1P1BA 3ANXA 1KIAA 1G41A 3CJRA 1G60A 3CVOA 3AXSA 1FBNA
chains in the Genus database with same CATH superfamily
1NV8A 1FU7A 4MKZA 1ZK2A 2I5PO 2R11A 3DULA 3F5QA 4PQFA 5CLFA 5A4DA 2YWBA 5GMOA 3WIBA 3IEIA 4OKSA 3W34A 2GJ9A 2J1LA 2OFFA 1NF2A 4M9QA 3CH6A 1XROA 3PPVA 4CTOA 3QYEA 3ANYB 4MUJA 1YS9A 3I2YX 5F51A 3ZWDA 16PKA 3LUCA 3JY6A 4Q7JB 4ABTA 4P5PA 3GJ0A 4PIPA 1Q14A 1ZKMA 2VQSA 3WKDA 1AH2A 3KDSE 2IT1A 4BZWA 4Z4HA 1E1QD 1JEQA 1TO6A 3DKRA 3MT8A 1L1EA 3WDMA 5CG2A 3MUEA 3PXUA 4H1HA 3GG2A 3PSHA 2XT9A 3WL3A 1PGOA 1IK6A 1YB6A 3HRKA 1KJQA 4NYMQ 3CTPA 2Q2NA 2O5CA 2J4CA 3H6KA 2YJ6A 1H94A 1YFKA 1A97A 1ABFA 4EVQA 1JB0F 4NV1A 4IUYA 2B8EA 3C1AA 4OXXA 3TDNA 5BR4A 5KX5B 2F5NA 1PX0A 1KP3A 1CQWA 1PX2A 3VUFA 1IZZA 1V6SA 2PL9A 4LF8M 1RLTA 1O89A 2I03A 1TW3A 3ONDA 4Y30A 2QUJA 2PH5A 4KOAA 4KIWA 3W5DA 4Q3KA 2WVGA 1R9MA 1V95A 3I9LA 1OKSA 4Q7EA 1RLMA 4FYKA 3PGKA 1XVUA 1ULZA 1ND5A 1YZLA 3RQSA 1R5LA 2RBEA 4I5FA 3SR0A 3VX4A 3IUQA 4AT1A 3T1HB 2F8TA 4ZA2A 2VG8A 4RH3A 3BXWA 1JQBA 3HBJA 3LP6A 1CUZA 5F2KA 3UO8B 3UUEA 4A6EA 5CA1B 3MVEA 1O94A 3TK1A 1YVRA 4RD4A 2C9MA 3TW6A 2HMVA 3EF0A 3O1LA 3E03A 1WGNA 5DKFA 4TV8B 3FYUB 2XWPA 3JAMA 1LTHR 2NLOA 3Q8WA 4XGQA 5LOVF 4YQZA 5DOVA 4HNHA 3WQRA 4P32A 4I5SA 2ZJ1A 4G4SO 4JZYA 4NULA 5DTIA 3W5JA 1T8SA 1JFVA 3AR7A 5FCDA 3WZLA 2QRGA 3GP5A 4OXRA 3BGSA 4QUBA 1K5GA 4KVGA 1CZUA 3M3HA 2DERA 3FHOA 2VEDA 3AIKA 3W9SA 5JCXA 5KTNA 3WLEA 5LU8A 1UAAA 3HYTA 4GXNA 1IUPA 3GA7A 3MUFA 3V1TC 1YE9A 1ML3A 2AD1A 3FR7A 3PJGA 2PSFA 4JBWA 3I62A 4HUQB 2BTQA 3FFAA 1QYDA 4FJ0A 4Q34A 2NZYA 3F97A 3KK0A 4XB2A 3STHA 4ZCLA 1F2UB 4X20B 3X0DA 5CXUA 1D8AA 3P2OA 4E51A 3DO6A 3Q9UA 2PPVA 3VU9B 1L6RA 1G66A 1OLSA 3LW8A 1RJ9B 3A7EA 3KKLA 1NW8A 4TV8A 4ENVA 3QFRA 3AOEA 1LBEA 1NBAA 3G5AA 5E9JA 4H1TA 2BGMA 5F1YA 3WVNA 5IYZF 3LVBA 4PINA 5HQ3A 1HH4A 2PJZA 4LRSB 4LYJA 4B8WA 4LCJA 4MPDA 4UJ3A 3RS8A 3T3HA 5BNTA 4RVCA 3D8NA 2HRZA 5DV9A 4UE2A 4LRWA 4BFLA 1L5QA 4DR7B 1Q50A 2H2WA 2GFIA 1EDBA 1YJ8A 3MMNA 1WUJS 4ZYVA 3BA6A 2ZU6A 4CFZA 2LKCA 1XN1A 5DGXA 5KPTA 2WW8A 3Q3GE 1GV1A 1WUIS 2QW8A 1SIBE 4AMUA 2ZUFA 2AFIE 2UZ0A 3KZKA 4G65A 3R74A 5AKHA 3KKNA 1WLSA 2VRNA 4YBRA 5JALA 3D8HA 3VPDA 1XB2A 2WD7B 1TO1E 1ZY2A 3H87A 2QUHA 1B43A 1U7XA 3HCFA 2Y05A 1RVV1 3ZD6A 2FR0A 1SG0A 3FDZB 4XYBA 4K81B 4F45A 4P3OA 2L19A 1YKSA 1P61B 1OC2A 4QOHA 3LWBA 4EB6B 1KJZA 3H2HA 4JOQA 1K82A 4UARA 1VKZA 4GBJA 3SNKA 5HWSA 3TM5A 1YDGA 1ZL0A 2HLHA 4K5QA 4MCAA 5FTWA 5IAKA 3L4JA 1Q11A 2C7GA 3C8HA 3HUEA 4AB1A 1GRRA 1PT5A 1ZDMA 1MQ8B 2I3GA 4ZDIA 1OI4A 3TAUA 2LWIA 3NH9A 4TMWA 3GPYA 3BRCA 3U44B 4LRXA 1XRNA 5FOQA 5EN4A 3MCWA 4QSHA 2MHCA 2P41A 3EGIA 3MLEA 4WNCA 5FFFA 3HSYA 4JB8A 4M49A 3U4MA 4AW9A 4JGIA 4Q18A 5E38A 4ZVQA 5K8VA 4RL4A 4ZEWA 1EE1A 1DKMA 2QR3A 1Q95A 4WK0B 3WQBA 4Y1FA 2WG1A 3O9ZA 1GGMA 1OYYA 3FZEA 4AULA 3N8GA 1PG2A 1I4TD 3BXEA 1A27A 3AHCA 1XMOM 2AWOA 2I6QA 2J6HA 1RPAA 2NZUG 4GMQA 2EKQA 1P62B 2OG1A 1GSIA 3GI1A 4RCVA 4CCYB 2Z0MA 5FI5A 3KJFA 4M7PA 4ZQIA 4HP8A 2XCLA 1K7YA 1OZHA 1QH8B 2G1JA 3V8NA 1O8CA 3RSSA 1X1EA 1SUCA 4GI7A 2X7HA 1V3TA 1SKYE 4G1BA 5B2FA 3F1KA 3V7WA 1ZN9A 4YJ2A 3C3DA 1MBZA 3L6CA 4ITRC 5DGHA 1XQWA 1UJ6A 2FMHA 3VZPA 4V0SA 1AMUA 4WJZA 1QRUA 2RGBA 2PUTA 4EF4A 4EHJA 1PD0A 2JKVA 2YDXA 4FUTA 2G70A 4O2BF 5E6RB 3N2GB 1PGJA 3GZTB 3AEKA 1T91A 1DB3A 5KPRA 1JZSA 2AH5A 1NXWA 2OZKA 2WTBA 3DV9A 4YWHA 2WHYA 4L51A 2ZE7A 2JLBA 3Q7TA 3A6DA 4PNPA 1RKVA 3IEXA 2R00C 2WSSD 4E3WA 1TTHA 2AVNA 1RM3A 4ZVMA 1EVQA 2H5LA 1PWHA 1WCWA 1Y3BE 4EYGA 3WKCA 5BV1A 2KWIA 3CSUA 2DPGA 4FQ5A 2IHYA 2XSZA 2B83A 3M6FA 3OE7A 3VZBA 4CKBA 1ZUNB 4RKUF 3GNTA 1XCBA 2H31A 3L8ZA 4W6QA 3U9SA 1YKGA 3ZLJA 2BEJA 2HWXA 3RRXA 3T5TA 4UTRA 3Q3HA 4P82A 4AMBA 1R10A 4XE5A 2Z30A 2JHGA 1T6XA 1HDXA 4EKGA 2RHJA 4XFJA 4I50B 1T6OA 1JZTA 4XPIA 1ZMRA 1EUDA 3RIHA 5B6IA 3S2FA 2N46A 2D1SA 4PQRA 3NHUA 5A71A 4EEKA 1K89A 2QD3A 1L4LA 3KT0A 2XYVA 1QVWA 2Z4SA 1SG9A 1NN1A 3ZPXA 3G68A 1IFYA 5FI1B 4B9AA 2R1UA 1G8HA 2GB4A 4A7PA 2F00A 2X2OA 1IY9A 1QU3A 1V34A 1CUGA 5HKKA 5F12A 5JJBA 1CF4A 2PJDA 2G80A 5JH7A 2OO5C 2ACVA 4TTSA 2FUCA 4KFSA 1PJBA 1M10A 3N87A 4E6PA 1AE1A 2OV4A 2YZGA 1GQYA 2JFUA 3GV0A 4ZT7A 1ZWKA 3HUDA 3VMMA 3W4IA 4UMDA 2VHVA 2DSNA 2MSLA 3L8HA 3MWEB 5DYYA 4DILA 4CNQA 5IC4A 3QLUC 3UB2A 1R3UA 1KQFA 2GN6A 1WB9A 5HPYB 3SXJA 3C1UA 1SXQA 1GN9A 3DNMA 4POOA 3GG9A 1Q7CA 2LBCA 3GJ5A 3KHTA 1ID1A 5BSGA 4NX2A 3WWOA 3H0EA 3E2MA 1COWD 3MW8A 5CPFA 2ATEA 9LDTA 5H16A 4HPWA 3SX0A 3IT0A 4CV1A 3F90A 4AY5A 1Y6FA 1WOYA 1V9LA 1KK1A 3PQ2A 3ZC3A 4WSOA 4CMEA 5LP6F 2PUHA 3KQMA 3ZVMA 1ZGHA 2B1RA 1Y48E 1CP3A 4JI3M 2O25A 3DW3X 1G20E 1TVMA 2W6OA 2VYCA 3ZDAA 1C3OA 1E5LA 2C2YA 3M49A 4HF7A 4L75A 2HKJA 3AU8A 4LSWA 4Q9IA 2CRUA 2VCYA 4FHGA 1J1ZA 3OZVA 4RF2A 4B4DA 4DDTA 3FOAA 2BDTA 2WJVA 1CD5A 4EJSA 2CT8A 4NBNA 3ZWMA 1J9EA 2XCSB 3QX3A 5C8YB 3CT4A 2PGIA 6PFKA 1YS6A 1NUPA 1J4AA 3C8MA 3LW5F 3P2YA 4MIKA 2LZ0A 1W1IA 3NT5A 1EBUA 4MVYA 3PITA 3VO9A 3KM0A 1F4PA 3IQGX 2LCFA 1XVLA 4MQFA 4OO3A 4PHFA 1RE1A 1Z0UA 2GK7A 1YE5A 4Z8XA 2JPDA 4CQMD 2CMKA 3QVUA 4R01A 1F7VA 4DC9A 1KMMA 2XZPA 4QYIB 5C8DA 1N9KA 1K68A 2FN8A 3ESAA 3MRXA 4FS3A 2DTDA 2R6JA 4L72A 1TM7E 1U65A 4DGQA 3KOOA 4M9ZA 2OBYA 4KR6A 2BFEB 4Y2YA 2REOA 4KW7A 4LXHA 4B34A 3MWLA 3GLVA 4E7PA 3FHLA 4BV3A 3IURA 4Q3CA 3DBHB 3U7QB 4BWFB 3U1TA 4FWTA 4Z9YA 3DVAB 3EEOA 4XQ9A 4TLBA 4LOAA 1A7UA 5K3OA 3RTCA 4C01A 3QE0A 5FLKA 1XPOA 2RG7A 4B32A 1XPRA 1M0TA 2GMWA 3VPXA 1CIJA 1VIMA 1DDIA 1JQLB 3KXIA 3H1BA 2PMKA 1BWSA 1CR2A 1L7BA 3FZNA 3QW4B 3RHTA 3ZN2A 4HFMA 4V24A 3E0QA 4B31A 2G4VA 4N6NA 5EXDA 4OG2A 5FBKA 1KA9H 3X2FA 3WQHA 3ZHXA 2IH2A 3DE5X 4B3IA 4ERXA 2DE0X 3BD6A 1MXHA 2WHQA 3HXKA 2ZR7A 4U2BA 1B73A 4RIGA 4Z7QB 1EZ1A 3I01A 2Z6AA 2NSLA 3JQDA 1D0LA 3RWMB 5TQ0A 5SV2A 5FBZA 5I7VA 4KPYA 1L4FA 4MQ5A 1U0HC 1U2GC 4RZHA 4URHA 1OFTA 5KOJA 1A5SB 3DMTC 3PNPA 1W4LA 2YWFA 3KOZE 3NAQA 3UJ8A 4PFKA 2Q27A 3JYLA 3KDAA 2C96A 1Y1SA 2PL3A 5HS6A 3ROTA 1UH5A 1YJ5A 3NGXA 4GKJB 1NM5A 5LYJA 1BVYF 3IPXA 4AKSA 3AZQA 2IXTA 4PIMA 1M2EA 2HSGA 3U19A 1RXSA 1QOPB 1V48A 4ENQA 4MKXA 2W71A 2DNAA 1BCRB 1IY2A 1E2HA 2L2QA 1Y5IA 1FB5A 3QOXA 4AECA 4RLFA 4TUYF 3BXGA 3A1TA 1H6AA 2HEIA 3I3SR 2GI4A 4BN4A 4KIJA 1XOIA 1NAHA 1VJGA 5FUBA 3DPSA 1D2AA 1JIIA 2BMVA 3BBPA 5JZBA 5K4HA 2XWQA 4FEYA 4BB0A 4QHSA 4FI3C 3ST7A 3ZD7A 1KZ6A 3CKYA 4KXQA 4Z1OA 3STWA 4ILEA 5KEIA 2OZLB 3IRVA 1MJNA 3MZ0A 1W0KD 2OO7A 3I4CA 3IJRA 4DRZA 5J9FA 4CEIB 5BWBA 1M8FA 3RSQA 4GSYA 1AXEA 4I1RA 1XXHE 1G42A 4E21A 5EIBC 3QY9A 3T5DA 3WHPA 1DC8A 4IDHA 1KEZA 4DQVA 2VYVA 2J9RA 3VISA 3KYDA 2FLWA 1XRRA 2QROA 1PNVA 2NYVA 3T6PA 1QYIA 1J23A 1Q91A 2WEKA 1EGVB 2ZYAA 3AJAA 4N6OA 4MVJH 5KVQA 3CW2A 1TTQB 5JVDF 4MOWA 4C9BA 2EW1A 1BCRA 1YJAA 2FPUA 2QVBA 2OKGA 3O4IA 3QLVC 1W96A 4B4VA 5BUZA 1DRWA 1QRSA 3DUFB 5EHQA 4G4RA 2J59A 4R8RA 4HR7A 3OF3A 3SMSA 5CIWA 2NO0A 3RUCA 2QN9A 1ZH8A 2QI9C 2XW6A 4KBFA 4EG7A 2QRMA 4N9QA 5BYAA 2ZAMA 2VUSA 1T3TA 2QJWA 5EPEA 1WDWB 4LJKA 1CDOA 3B74A 1BN7A 4JC4A 4JITA 4TLLB 1FRZA 3R7LA 3DOAA 3KCNA 1KOFA 3AWDA 5KJ6A 1KSHA 2IVZA 3V42A 1R4NA 4BFTA 3AB3A 4EF6A 1KBQA 4RY8A 4C7MA 4QOFA 3IULA 1TUEA 3H2JA 3MWDA 5SY6A 5IF9A 2V03A 3C7DB 1R8SA 3C3XA 1Q74A 3USES 1HNXB 2J0QA 3Q3CA 3MTQA 3B60A 1FYXA 1MZVA 1HWYA 1ZOLA 3GOHA 3QV1A 1JKFA 1Q0TA 1G20A 1SRRA 2JCVA 2H63A 5JDIA 2OWDA 3G0OA 4HLQA 1O77A 3PDCA 2F3SA 2JHFA 4PLFA 3OX2A 3JSXA 2R7MA 1QE5A 5JRDS 3HZJA 1X19A 2EP5A 3JQ7B 4JWKA 2YCLA 2YQ4A 1HTTA 2C42A 3HABA 2H00A 3M6VA 4AZ0A 2C94A 1EP3B 1W0JD 2AJCA 1VFPA 4FFPA 2YV1A 3M3DA 1G16A 6AT1A 3WV5A 1X1RA 5K8CA 1QG6A 2XEXA 4IMIB 2X0EA 3GFGA 2QBYA 1KEKA 4X7PA 1HNWB 1LDNA 2EJWA 2JJ1D 2X23A 4JELA 4KWIA 1M66A 2X5KO 3EF3A 2D6FA 4NH0A 3STXA 3UQZA 3AC0A 1QLHA 1Z4IA 2WOJA 3BHIA 1T1RA 1I6WA 2EEZA 2PKEA 3M5DA 1XZPA 3ZU4A 1PUIA 1QX3A 1P1CA 3LSTA 4O1IA 4ZVRA 3RT1A 5FUWA 3H11B 3X2SA 2BWJA 4MULA 1BQ3A 1F2UA 1YQTA 4X20A 3NOQA 3AHEA 5CAEA 2V6JA 4JYPA 5F3WA 2FMIA 2XKJE 3IP1A 2GZHA 3EGCA 3QXHA 1YZFA 2GKOA 2I9PA 3U3RA 2D1RA 3W04A 1S7CA 1H9BA 1G21B 2FPPB 2H8GA 1HTWA 1R3DA 2XTMA 4KUGA 4R1OA 1VFNA 1BFDA 1N2ZA 1BXKA 1W2WB 2AW5A 2BCJQ 4LRSA 4P7KA 4C7BA 3TOCA 1ZJ4A 4C1BA 1Y81A 4Z9AA 4WN3A 2OG2A 3ZS9A 1TJ5A 4OFBA 5IZCC 2KMLA 5E7QA 3I30X 1WDMA 2FH5B 4S1TA 3B6IA 1V43A 2J31A 3OEED 2AC4A 5JG7A 3WMWA 4JXXA 4PAMA 3RKUA 5CFOA 3HXLA 2CMFA 4E08A 2QLNA 5JCPA 1PFQA 2HHHB 2QUBA 4GOOD 5BSTA 1BDHA 4GP6A 1BGVA 3T3OA 2YX1A 4JEIA 3HBNA 1L4EA 4F2GA 1MZPA 1DIBA 1SZPA 3WGNA 1RQNA 2EOAA 3G82C 3L07A 3CVUA 3U6QA 3LC2O 4RW0A 6YASA 2FTKE 4YMSA 5ALSA 2DWQA 4DSAA 4JB2A 3FNQA 3SS9X 4EHFA 2NVWA 3BGDA 2P67A 3K0BA 3ROQA 1RZVA 2BUAA 4JHLA 4DOMA 2WPNA 1U2QA 1AXRA 3D02A 2UUPA 3W68A 4JGBA 2PZ8A 4FBMA 4NBSA 1U3WA 2WVAA 4XJSA 4TTJA 5T41A 5CLJA 4NABA 1EDEA 2QT9A 1T5SA 1W2HA 1XZ8A 1YU6A 2GK6A 5EXPA 1HPLA 3AERA 3GJXC 3IP7A 3OT1A 1QDRA 2CDRA 4X8MA 4N39A 5CLLA 5HTKA 3NFRA 2OQVA 5KYUB 5KKAA 3GJRA 2XA9A 3GJQA 4GM0A 1FP2A 1GJRA 1X7HA 3GLUA 4F86A 2DHYA 1CEXA 1N2GA 4A26A 3WLTA 4EG5A 1JEAA 4O4JF 2WG2A 5I9MA 1U2RA 2CFRA 2Y1KA 5CYGA 1FVOA 1PEYA 2HL6A 5BSKA 3E53A 2C7OA 4EABA 1XSEA 3AR4A 3EOZA 1TJPB 1ZUHA 2HIMA 3H9QA 5CJ2A 5BSUA 2FWAA 1BFUA 1I24A 3H6GA 3SM9A 4BGEA 5ITZB 5HNKA 3CIOA 3STUA 3PD7A 1JHXA 4Y0NA 1JQ5A 4J0DA 3KFUG 2J87A 3WGQA 1GJTA 3FSRA 4I3FA 4ZJZA 6REQB 4MP6A 3PA8A 4G63A 2A78A 1VKOA 4L8VA 5EFZA 2ZZKA 1BU5A 3HZHA 3ZE7A 4ZZ0A 3ZIAD 5FL7A 1AKTA 4BO3A 1Z3CA 4FPXA 4XVQA 1NASA 4DJJA 1V5FA 1UKAA 3EAQA 5F5XA 4CCYA 1TKCA 3TQFA 4FS8A 5H8WA 1GA4A 3H1AA 3ACBA 2HTEA 2JJ2D 2QMOA 1HE2A 3ZTTA 4ENTA 5F2NA 2JVKA 3QBVA 3AJ8A 5TV2A 1KAEA 2GFHA 2C78A 3EXHA 1AUOA 4FCVA 2XEPA 1N34M 5DBOA 1FL9A 2FN3A 1AK2A 4Y2VA 3G7UA 3I6IA 5LA6B 2QA5A 3ZEIA 4EGAA 4Z7OB 3R3XA 4P4LA 1V7PC 4PPGA 4RUKA 5KOYA 3DDOA 5CT9A 1FS4A 5B1HA 1V11B 2ZBQA 4F0JA 3W5CA 4IIBA 2A0FA 1NXOA 3DOUA 1FFBA 2H1FA 2VAVA 1H05A 3B6ZA 4QFDA 5CGZA 3WISA 5HVNA 2NU6A 1KRHA 3B6EA 4Q39A 4A5OA 4GRIA 4GX2A 3IUSA 2HGSA 4CKEA 4EHDA 4EKIA 1QQTA 3UIEA 1JR3E 4GEKA 1EIWA 1PZGA 4MA5A 2P75A 4P84A 1TKRA 1BSVA 4GX5A 3DUWA 1Z73A 2B4YA 4H3VA 3DJYA 5E8RA 3BL6A 3R7BA 4JUAA 1NX6A 4NAUA 1JHRA 1FFDA 3ZOZA 4EPWA 4KUHA 1QDUA 3MS2A 4TZ0A 1T2CA 4KDRA 1M34A 1Z45A 3SSOA 1RPTA 4BQEA 4N0QA 3C3JA 5AK3A 5J1TB 4WUVA 2A9QA 4ZP1A 2OB2A 1UFZA 2YV4A 4J76A 1UFRA 2Q21A 4YHBA 4QAJA 4WASA 4QPCA 4QLOA 2JVJA 3BWVA 3RIMA 3TFWA 2LVAA 3SARA 1LY1A 2BEKA 2IS2A 1FJ2A 2WJZB 1IJEA 1GAEO 3EXEA 3ANNA 1EZZA 3AW9A 3D59A 2A5GA 4PYMA 4ZD6A 4WURA 3BTVA 2VXYA 1RR6A 4OATA 4I0WB 4G0WA 4L8LA 3OU7A 4YRQA 1IN7A 4YK7A 4B35A 5I7WA 3H9CA 1AM4D 2GHTA 1GKKA 4HDSA 3V9AA 4WBNB 3AJRA 4K05A 1B8OA 4DYHA 3O2NA 3DLCA 2HA6A 4FHZA 1JBKA 1N0VC 3OFNA 1MH1A 4URZR 5FOVA 3REOA 2BHTA 1D1PA 4JP1A 4IW3B 3RW9A 1P72A 1HX7A 4D9JA 1B8NA 1TQ8A 3HDHA 4EEZA 1E4OA 1GU1A 1QP4A 2PA0A 3KQTA 5TMBA 4BMXA 2C58A 2MIIA 2FW0A 1TMOA 4IQGA 2OBNA 3TNLA 2IX3A 1XELA 3DXZA 2COEA 1IWPB 2YQ5A 3HHEA 5D3MA 2E48A 2BZ0A 2NUPA 4LZWA 2UYHA 5C8ZA 2G67A 2V6ZM 1L5HB 3SASA 3BBLA 1I1QB 1O1YA 4JN6A 1XJ0A 2B7CA 2OL4A 4KXLA 3ADCA 1ZN2A 4Y2GA 4PM4A 2RONA 2YMMA 3KYCB 5JNUA 4RKEA 1G2OA 4JBHA 1QTNA 1QHYA 5EWMB 3EEQA 4M21A 2NU8B 4B2YA 4A73A 4F2WA 1CBUA 1QWSA 4RK4A 3SZMA 3VBCA 5HS4A 1PSWA 3NNSA 4XB1A 4FFLA 3D6HA 5KNBA 1SC9A 4NYIQ 2SKCA 1OZ0A 1QIGA 2G1KA 2R4UA 1JI0A 3WAJA 1Z5PA 4JZKA 2OPHA 5HIKA 5IT9A 1FMFA 2XCQA 4YMTA 3HRIA 3IR6A 2O8EB 2AOTA 2NSHA 3L7NA 3R7WA 1GL3A 4M37A 1MN6A 4RL6A 4RXMA 1XEWX 3CEHA 4QDOA 1CX9B 1JLLB 1NXPA 1T1SA 1JHQA 1FU4A 2V7EA 3FPLA 4HEA1 4MR8B 3EZLA 2OBLA 3L92A 3WDKA 1UQUA 1KPGA 4J4BA 4Y2JA 1EKXA 1ONBA 1U2TA 4C3ZA 5BUQA 1RMYA 3PR1A 4ZRNA 1U2ZA 2WYHA 1M8JA 4AJJA 4G0QA 4INPA 1YVEI 2LH0A 3TPFA 1FW8A 4GUDA 1K6IA 4WNYA 3BE8A 1FS5A 3A6ZA 4PYKA 1DTWA 3NAGA 1V8ZA 2WK1A 2P2CA 3UJ3X 4RZ3A 1AZWA 1TECE 1WM1A 2Q3BA 3EZNA 2JZ0A 1RMQA 3I42A 4OLHA 4OP3A 1ELOA 4K1LA 5HFJA 4MCHA 3OTIA 1DKPA 3GVCA 3ND6A 3CN7A 2APLA 2VJKA 5FJIA 3R8CA 3QSYA 2VJPA 1GGFA 1YL7A 2REXB 3DAYA 3HVUA 2ZJ2A 3G8YA 3GFVA 3P9CA 5IT0A 5ALWA 2PDAA 1YZHA 2EYUA 4FHFA 1QHGA 1TJ4A 1KL7A 4ADSG 1FSSA 3FDIA 4OW0A 1CUVA 1GQFA 4JQOA 4R8VA 1J8YF 1Z4QA 4EP1A 5K20A 1GPWB 4IINA 4ND4A 1GKUB 4IVRA 4R98A 1JIKA 3OZWA 4X62B 1X7ZB 1V1JA 1BMTA 4LDAA 4RPJA 5DGCA 1Q2XA 1A2OA 1V47A 4BMOB 1OLUB 2J0UB 4ZOQI 1ZK3A 3H8SA 2VTBA 2J8ZA 2X3FA 5CNMA 5BN5B 4BXOA 1FLNA 2P8JA 2C4VA 1P0MA 2JVIA 2IEDA 4GKVA 2H6EA 2VJAA 5IEBA 1DG3A 2GH1A 2NVOA 4LOLA 3GK3A 2QP4A 3O2SB 1EFRD 4TSKA 2ZRFA 3KJZA 4KNVA 2PMEA 4NAHA 3AG5A 5EJIA 1GFIA 1U4SA 3KETA 4D3DA 3EUFA 2VKTA 2ZBKB 4RVUA 3MGGA 3OZFA 3L93A 1IIBA 5IBRA 1BS9A 1DVRA 1F2VA 1PW7A 4KH0A 4CM3A 4E1VA 4D96A 4KGDA 5IBQA 3T3PB 5HM8A 1HNXM 1ZOOA 2EX1A 3QVXA 2BKAA 3IDOA 4LNAA 1ULUA 2Q5FA 1NBIA 1ODCA 3H2ZA 4TSRA 1PT6A 4KOEC 2H29A 4NFYA 1J2JA 1QZTA 4NDZA 2I0FA 3CF0A 3ZWNA 3M4NA 1GZ3A 2AZ4A 3RFWA 2CBZA 1NNSA 4C6HA 1OLUA 1UOPA 4JHXA 5B3JA 4LF8B 2AMLA 2F4NA 4B3SB 3O4JA 4QPZA 2PAFA 3Q40A 3WBBA 2XF8A 3GX1A 3X44A 2XZDA 4GOMD 1RKQA 2Y1LA 2VSXA 4L4RA 5CFRA 2HDHA 5HZGA 3KSXA 1TYCA 2PU5A 3NRBA 3AHHA 3N7AA 5EIOA 4CCWA 4GO1A 1WZIA 1WKBA 3JQ9A 3HP1A 4AJ4A 5DBEX 4YFYA 2ZRCA 5CFNA 3B1JA 1RFGE 5LM3A 2PUDA 1DXYA 2WAAA 1JR2A 1S02A 3MWEA 4OJQA 3RIEA 1H1LB 2I55A 2C5LA 3B3GA 4M1EA 3LHKA 5J43A 3OCCA 5HE9A 1YR2A 4DMFA 3LXMA 4X6LA 1B0AA 1MB0A 1Z13A 4GR4A 5F76A 3FTQA 4B2LA 2AN3A 3W6PA 4BEBA 4JBXA 4MJXA 4ND6A 4WK6A 4M53A 3ETHA 1I1HA 1LBIA 1JGTA 3OEHA 4RORA 1L5LA 3WJ7A 1HGXA 4ODIA 4FMBB 3S2IA 1YQWA 2W2QA 3DXYA 3I9V1 4PZLA 4V0RA 3AYXB 3T7KA 2J9GA 4CMCA 3I61A 4I6GA 2GM9A 1OWPA 1PHPA 1SK8A 1TM5E 2CHUA 1INLA 3IBTA 4KK3A 1RHRA 5CD9A 3L06A 2OGTA 5I8WA 3ZZ1A 3NLLA 2DR2A 3QMMA 1WHCA 2CJYA 1GNSA 4NSRA 3EF1A 4I1PA 1EUCB 2FLKA 4ZOLF 3NHJA 2J5BA 1JHDA 3CY6A 2ENWA 3LVRE 3NJRA 4JLVA 5AUQA 3V4LA 5L51A 3CKKA 1T36B 1E1MA 5IARA 1BTOA 5BVGA 1YIDA 2DTEA 2QK4A 3IILA 1BG6A 3K0AA 3CWZA 1SCDA 1NNUC 3FPHA 1OWLA 1HJPA 2INGX 2C2WA 3C4QA 3K4QA 4FSHA 3TR0A 3V4ZA 3NTLA 1UUFA 4RA6B 3V8MA 4O25A 1KDVA 3C0KA 1VG5A 4OVZB 2D8AA 3D7RA 3F8WA 3FFBA 5EKSA 1OT5A 4UNRA 5DLYA 4PANA 4QT0A 2QG6A 2IUEA 1E20A 3BE6A 4BNKA 3I5AA 3EARA 4B7UA 5CCDA 4U8GA 1VRCA 2CLDX 1SHTX 4G4NA 1YE3A 3JRWA 1ADJA 3ES9A 2KHHA 3OKAA 3QKSB 3TCNA 1TVKA 3H2YA 2WA2A 3DOJA 3EXG1 4EMSA 4JI1M 3QYPA 4EGJA 5KNBH 2SECE 2VBGA 2YMQA 4DUGD 5LR6A 3E8SA 1Z5OA 3KQSA 3RUHA 2HI0A 4NEGA 4NK4A 3D4OA 3QU7A 2F6RA 5DSXA 1D7AA 2QT1A 2XYQA 3DLAA 1WAMA 1XWFA 5JV5A 3MOIA 1JPJA 3RVKA 2P9QA 3TR6A 3WNVA 3LDFA 2LIPA 4JYBA 4AQ7A 3ZGVA 4WLUA 4BLUA 4XGKA 4JR1A 4TMXA 5U4XA 3WLKX 4C0HA 7REQB 1MX0A 3HKPA 1SUDA 2D06A 4YP9A 4YJ2F 3I2KA 5KOJB 3FI9A 1N9ZA 1IYZA 2EQAA 2IHTA 2Q49A 1ZUIA 2NUTB 2OC9A 2R3SA 4MW9A 3QG1A 3SZRA 4DV1B 5B6PA 2G0AA 4HRXA 3G5LA 3JYHA 2AD5A 2DKFA 2QN1A 5D01A 4MWGA 2HCBA 1TM3E 1MX3A 2ZIFA 3E84A 3IUPA 2D7GA 2I8AA 4MS1B 1DG1G 1IONA 1GQRA 1EVIA 2G40A 121PA 1CUIA 3M4YA 3MC1A 1GKYA 2RGDA 1FDUA 1YDFA 1KNQA 4HUJA 5JXIA 1TJYA 5F2OA 2SNIE 3GMTA 2E6KA 1VG8A 4BTVA 3IQWA 3ZNQA 3ZKAA 1W47A 3AVYA 3U62A 3QE3A 3WYCA 5I3ZA 1OKKD 4BNXA 4G0YA 1ZK1A 5ITTA 5I45A 2HDOA 1T8TA 1Y1PA 4LMPA 1OTXA 3DEIA 3JATB 4RY2A 3UMMA 3HKCA 3K1ZA 4MSUA 3IPCA 4OA5A 5CJPA 1GD1O 2OGSA 3R3ZA 3HJTA 1JH9A 1KEUA 4LGCA 5AJUA 3GEBA 4GGPA 3RJ9A 3QA3E 3FUVA 3H4VA 5H70A 3QRWA 4MYCA 5E1OA 3HKBB 3I0ZA 4IEIA 1SCKA 1FUIA 4GPD1 4KHPB 3V48A 2PPLA 3G0HA 1RJGA 1Z4LA 4FU0A 5D1NA 2I4RA 1Y1KE 4DSTA 4L74A 5LL6P 2FUNB 1CUSA 1Z28A 3E6AA 1ESMA 2IIVA 1NHWC 4DR7M 3DL4A 3H1TA 3W7VA 3KT6A 4CODB 5TGTA 2D0PB 4K6KA 4TTPA 2QL6A 4MARA 3NBZC 5F73A 3RVBA 1AHPA 2ZSKA 5GADl 2IH4A 2ZITA 3W8FA 4MWTA 2FSIA 2AYYA 2PUVA 3KR1A 4ZAWA 1J22A 1ZC3A 3AR9A 3KSZO 1NONA 2C9CA 1K8ZB 3DOIA 3QITA 1Z74A 4KAXA 3JQ6A 5IDWA 4RHTA 4HWGA 3ZW7A 2ILTA 2R6CA 4N12A 4KQJA 4TXHA 3UVEA 4E5PA 3L7OA 5DRYA 5IAOA 1G9SA 1UBOS 3LRPA 3CSDA 3NGMA 3NNNA 3ZHRA 2FDCA 1E7YA 1G6KA 3AY0A 5FBRB 3QIAA 3L28A 1EUYA 3EZ9A 3W77A 1GILA 4JP5A 4GZ3A 4LC1A 1ZMUA 3WFIA 3UA4A 3C9PA 2ZRMA 1TDZA 1JVNA 2Y1OA 4H3KB 4BCBA 3DEHA 3F67A 2O2SA 3OQHA 4AG5A 4J9VA 1Y3AA 2BFPA 4MKRA 3NIFB 3U6CA 3P0HA 1CJVC 1BVRA 4CM4A 5ERXA 4WHMA 2XVXA 4OBBA 5BQ3A 5JYCA 5M04A 4DV3B 1BJKA 2HBQA 1GIAA 4XQGA 5FD8A 3H3XA 1K7CA 1T9AA 3V1MA 9LDBA 1D5CA 1PG5A 2IHJA 1I8TA 4N3CA 1W85A 4Q00A 1LI4A 5TVGA 4F8JA 4X65M 3EYAA 3FWZA 4GZ5A 4KVAA 4H7DA 2Y99A 1Z0JA 3TIXB 4D6XA 3TRFA 5TT1A 3U16A 4MGEA 4KJXA 2O7QA 4DV6M 2BFBA 2QGNA 4BMSA 1MD9A 3HB7A 4GMKA 4IEEA 4D7AA 2GZDA 6ADHA 3IXLA 4ECEA 5K0EA 4PLPA 2C4NA 2D7EA 3ESDA 3RSHA 1TK3A 3FXAA 1MC8A 4X7BA 3ZJ4A 4DA8A 4NZYA 1O97C 4ZGWA 2DLNA 3SS8A 3T9CA 5LZ9A 1PZEA 1NLMA 4RO0A 1BE1A 1U9JA 2ZRJA 4MUEA 1KOLA 2H0QA 4BX8A 4HNGA 2DWPA 2PUAA 4G0VA 2QG4A 1U5BB 4E4YA 2ANCA 1I1OA 5EA2A 4JLOA 1KVSA 4V03A 2QM0A 1L8QA 4IBEA 3K0CA 4QGHA 5BYJA 3OJCA 2R2GA 4URXR 5GIPE 2B1GA 1YT5A 2O0KA 1CUJA 2IPXA 3BSWA 5D84A 4RTNA 1J42A 3BBZA 1AURA 1KEVA 2Q4DA 1MKYA 3L0DA 1RAFA 2BEVB 3MLAA 1QK5A 3NP9A 2C88A 2KS6A 1OR8A 2I78A 2JBHA 2PSJA 4BLSA 3ERCA 4C5AA 2W5UA 4CPDA 1VHLA 3B3JA 3N8DA 4LJ8A 1ZCBA 1ZW6A 1PR4A 1ZI6A 3CKLA 3MBKA 4YCCA 1VCNA 5A04A 3PCRB 2IOFA 2V9CA 1J9ZA 1PD1A 3M7IA 2R7LA 4CTKA 2QTLA 1VL1A 3G88A 4XDHA 4TVOA 3SEAA 1KJIA 1P17A 2IP2A 1OYOA 3GUZA 1XZCA 4NBWA 5ETJA 3CZ5A 1KWKA 2P0YA 2WLSA 2VUTA 2ZTUA 4S2UA 4O1MA 1E1RD 1LZKA 1I33A 1BGXT 3BFVA 3CRVA 1E60A 3F3SA 2DT8A 3PXXA 4NJOA 2J3EA 1LSSA 3BULA 2JKYA 4JLUA 5ESRA 3R7WB 2FR1A 1TKBA 4F71A 3NDRA 2W2NA 3M9XA 4DRXA 2ZJ3A 3N0TA 5BMVB 2D7DA 4PSKA 2IF0A 5JSHA 1UP4A 4CKEB 2DHQA 9ABPA 3AUJB 2WIJA 2AI1A 4X6UA 3TNJA 2VH2A 3S81A 2VJOA 2HDNB 2O5RA 2DX7A 3UB4A 1QU2A 1ULTA 4X1OA 3AKZA 3CRW1 3L7CA 4OSEA 5L3SA 2IDMA 5JYEA 4FOLA 4H17A 3BJMA 1MRNA 2COUA 5IRCD 5EP4A 4EJFA 3U37A 4G1UC 2FSUA 4NVRA 3UHJA 3MJTA 4JXKA 4YCLA 5JO0A 4JI7M 1T3LA 1U3VA 4DA9A 3CVJA 3FNHA 3DEKA 1RQXA 1Z6XA 3E9DA 3TL6A 2BM8A 1YZVA 2RI6A 2Z5LA 1ORDA 3MHPA 3TUIC 5JWHA 4BYMA 2XT0A 4JT8A 4WUTA 3QGMA 2RHHA 1XU4A 4KGXA 1SCJA 2R5FA 3HBMA 1YA6A 1JH8A 1PNQA 2PLNA 1P6UA 3ABSB 3LPCA 2GS9A 2C97A 2RDMA 2YOFA 1QP8A 3UK1A 3ZV6A 3TIVA 4HQOA 3MK6A 1KS9A 4YALA 3ZY3A 5B53A 3DE1X 1JRLA 4CV2A 5J4LA 3COPA 1QGUA 4PPQA 3IE2A 4G8JA 3HGMA 1A5TA 2Q7DA 4N7JA 3AEQA 3D7LA 3EJ6A 3EVBA 4OUKX 4R1SA 4ZRDA 4ITUA 1MABB 1YZ3A 2J0UA 2J4FA 2LXNA 3IJPA 1RXVA 2M2IA 3LL4A 5DX8A 5CJJA 4D26A 5IPFA 1KSFX 4I81A 2NN3C 2VPZA 3I2GA 4MQMA 3GJ7A 1TU3A 2CV0A 4ZN6A 1YB4A 3W06A 3LX4A 4A2PA 4CW7A 2OB1A 4DREA 4YMLA 5IM4F 1W73A 1KJ9A 3OUTA 4KWHA 5H83A 1E62A 1Y8GA 3DAOA 4Q3NA 5E6UA 4D8XA 1FX0A 3PUWA 3LT0A 4E5VA 3DCJA 1F0YA 4I46A 3HLKA 3DKVA 4W1SA 2AOUB 4P4SB 4HNVA 3E9ZA 4O33A 2Y6VA 5EWLA 1F1JA 1M9NA 4R9UC 2F90A 1E4EA 2I6TA 4F6CA 4XGIA 4WGFA 3H1FA 3WKEA 4V1CI 1PVVA 1IM2A 4M0MA 5JHHB 1WB4A 1U3CA 2H1IA 3F5SA 1K8QA 2D0OB 3IOMA 3M1IA 4RAOA 3UMJA 4BQPA 1HNZB 3PNMA 3C7CB 4UHBA 2HCTA 4P31A 1HC7A 5AVQA 4UUBA 2LCIA 1KJNA 4JS0A 1MABA 2RJ3A 3FUWA 4BZXA 2ARKA 4OKIA 3IA2A 5F98A 1QE0A 1OH8A 1F51E 1JNXX 1U0EA 3AVPA 3AZOA 4PGHA 4TMFA 2OORA 4WRRA 3B36A 3VR5D 5BSVA 1BDIA 2JIOA 1H0HA 2OOSA 3SKVA 1DDOA 1QTQA 1SCBA 2FQ1A 3NBAA 1B6SA 1OAAA 3PGA1 4YMHA 2GT1A 2JDID 3OZTA 3V2UA 621PA 2NYUA 4TTAA 1YCFA 2WG0A 4TT8A 7MDHA 1FX0B 3SLRA 3VU8A 4KO2S 2FSFA 2GPNA 3I5UA 4QL3A 1Q1GA 3PNLA 3IPAA 1VLQA 4HN4B 4CG1A 2V7QD 4BJHB 3ND8A 3PFWO 2IXGA 4WCFA 4M98A 3ZXSA 2YASA 5C7OO 5HCNA 5SZJA 2BT4A 2BSAA 5E26A 4MRRA 3FFWA 1MGPA 1UMDA 2OECA 4QD3A 3R2JA 4ID9A 5FUXA 1T35A 4LZLA 3T7AA 3P4UA 3THWB 1Q84A 4D8UA 5A1TA 1NVUQ 7ABPA 3CNBA 3QELB 4Y6QA 1VDDA 1SCUA 2V6MA 3K2QA 4KVFA 4BLTA 5GINE 3AV0A 1OY1A 3GRUA 3SAWA 2JHPA 3NBYC 2IYXA 3D2LA 4LF4B 1NQXA 4JQSA 4DCPA 3L8GA 4OHWA 1GZVA 1CY6A 1OXUA 1PZMA 4IGIA 2PS1A 3L8YA 4DSUA 4G3XA 2VSOA 1A4IA 2DG2A 2ZI7A 3BXFA 1OX4B 4DV1M 1PDVA 4JLSA 3SE0A 3WKAA 1I6LA 1GEEA 4KQWA 4TV8F 1ONOA 2YVLA 3GGOA 2B4RO 3B7NA 3GQ3A 3NM5A 1SUAA 3ZHVA 3QKTA 4DZTA 1P3QQ 1BKDR 3HVIA 4M0CA 3ZWWA 3LD9A 2DY1A 3JQAA 3FKQA 1G55A 4HMPA 2I1LA 3BWBA 3C5HA 4HCJA 3KB1A 2W2VA 4HXGA 4GYYA 4V0OA 2ADMA 4HK4A 4C0KA 1EESA 2JIQA 4BB9A 1EQUA 3TTSA 5JXWA 1OPRA 2UYCA 5C1OA 6Q21A 4R0MA 4QFBA 1TF2A 5FWYB 1NVMA 3PC7A 2J41A 2WAXA 1JP7A 2WWTA 3ML1A 2C0QA 2QVCA 3DOEA 3FCOA 4KXXA 1GRNA 3HEBA 3OC6A 1KERA 4R2XA 2OENG 1EGMB 1Y4DE 2OZEA 5H0IA 4RNAA 5FA5A 2YUTA 3EISA 4A1OA 4RLSA 4KQGA 1P1FA 4RQAA 1SU8A 4OHMA 4DTCA 4IBGA 4IZ6A 1DEAA 3D6UA 1A76A 3ZY2A 3AQIA 3VZQA 3RVDA 2R0QC 3RYIB 3Q8GA 1L4NA 3LRXA 3RABA 1VG1A 4JKIA 4OHVA 1EX1A 4S1WA 1NVTA 2G7MC 4FEGA 2NYRA 2RIRA 2I4OA 3C3CA 5AW8A 3VV2A 2O07A 3Q7RA 2ZT7A 3PV0A 3RTAA 2XIJA 1HYBA 4TWBA 3OOWA 3J7AC 2OGWA 3DCYA 2B98A 3NWBA 4FE3A 3SS7X 4AX4A 4NXNB 3HYNA 2C1ZA 2WFLA 3D3WA 3WLPA 1P4HA 4REZA 3WKBA 1Y8RA 2ZSJA 2YYSA 4WLFA 2NZ8A 2A2ZA 4US1R 2HBZA 3QW2A 3AINA 3HEMA 1WR1B 4J03A 1ML4A 3DYBA 5FFNA 4BNZA 4ZIRB 4ZZ1A 1ZVKA 3OQNA 3MELA 3NGLA 5I7EA 5FADA 3GUVA 2PBLA 5FPHA 4NBVA 2DZDA 2I8LA 4X1KB 2CNLA 4M1ZA 4EA9A 2KJQA 1TAHA 3YASA 1E8MA 2R1TB 3R75A 4F3KA 1SQ0A 2NPIA 3C6ZA 4IFBA 4XD7D 1GGJA 3PDIB 4EOGA 2O2HA 4ZPXA 2VDUE 1JE1A 1RYHA 1IY0A 1HDZA 5JJ5A 1EP1B 1HF3A 3LJKA 3BMQA 3TWOA 3ZS8A 4CR6A 5KYWB 4B5KA 1ISSA 4MB2A 2ZRLA 2O5EA 4I55F 3V00A 2DR0A 2QQGA 1YK0A 4Q21A 4HEJA 4X9XA 5KNDD 4AW4A 1NFFA 2CD9A 3M2PA 3GCGA 1Z4MA 2ZULA 4J7AA 4X1YB 3VM6A 4EYEA 5JVDA 1ZM2A 4PZUA 2QUKA 1UBSB 3KQYA 2YWJA 4L57A 4LYYA 4OEHA 4F11A 4CIYA 5F35A 1M8GA 3DFUA 2ZLBA 4AWBA 1YOVA 4M1OA 3WIUA 5JY6A 1OFUX 2IYQA 4UTVA 2FOXA 3NHLA 3PCTA 4K0KM 3DC7A 1M5UA 5CRIA 2C9BA 3KQQA 4FFWA 1G64A 5GONB 4M1YA 2FR8A 1SM4A 3H04A 3N2GA 3B12A 3E7XA 3KUXA 3KR2A 4U3JA 3F8TA 2PK3A 2XGOA 3K9QO 2JIPA 4FX5A 4E5SA 3L40A 1YDMA 4RPKA 3U7RA 1PR1A 4ALKA 4GWKA 4EFLA 3KKMA 2W9XA 1E6LA 4PZZA 4DJTA 1ZCJA 2XTJA 4FEEA 3WGVA 3ZJTA 1UDCA 1SWVA 5AVZA 4RCZA 3L1JA 2W6ID 2E6UX 3VC3A 3VU1A 5E9WA 4OUDB 1IQRA 1J0CA 1KQ3A 3MGBA 4MYSA 4CFYA 4MIYA 4C3UA 1QVAA 1IIRA 1QV6A 4X1YA 3I53A 3H5IA 5IXYA 4IRXA 2RGYA 4X84A 1G2QA 1KDRA 3R40A 4GLJA 4IFEA 1DKQA 1Z33A 1JEJA 4Q9KA 4WLVA 5TRTA 4B3HA 2I7TA 5B58C 5KZMB 1BXZA 2Q1YA 5LBTA 1Z0IA 4A0SA 2V0CA 4YJFB 3V1UA 1GTSA 4K9DA 4XEHA 2EWVA 2BTEA 2XB2A 4D3XA 7MHTA 1YS1X 3FDXA 2ZUTA 2AA3A 2C5FA 1KC1A 4AURA 2UZ4A 2IYPA 2R6HA 2W00A 2C5BA 3VC1A 1S2GA 3PPWA 4LMBA 3JALA 2WJAA 2JI7A 4D9EA 2ZWPA 3QVVA 3ZWKA 2WC1A 2X3YA 2UZIR 5DMXA 3RD5A 4D79A 1P9RA 3CUEF 4X62M 4HQKA 3PVZA 5KNCD 4KHZA 4MQLA 1A7KA 1RU3A 5K9ZA 4IRMA 4PPFA 3CUTA 1U9CA 4ZOCA 4MV0A 1P2GA 4ZAYA 2OWEA 4XSHA 3GT7A 2IODA 3TLJA 1FP6A 1UOEA 3L0OA 3U81A 4A8JA 3GYBA 5EHGA 3H83A 4WA7A 5FEUA 1L1RA 2BFDB 3F6SA 4A6XA 3NOXA 3DWIA 4YN3A 3I52A 4TXJA 5FR1A 1XP5A 3AFNA 3EPPA 4BO2A 4NXMB 1V16A 1W49A 3H75A 4YGXB 4B17A 3G85A 4UBOA 2HT1A 1HFKA 1ULSA 4WXYB 1M2WA 4Y9SA 1D2EA 4DNXA 3KPYA 1RPZA 3ZJVA 2J5XA 1LJ8A 3FSGD 4YLEA 1YU9A 5K4AA 3VU0A 4DDHA 2YHIA 4H31A 3PS9A 5HUQA 3D9QX 5CURA 2O8BA 3Q0EA 1ZFNA 2QKYA 3H18A 2RH8A 1Y1QA 4DARA 5B2ZA 1JPNA 4OU5A 5GM2A 1E4VA 1WTCA 4CIXA 4KLNA 1ZU4A 2F64A 3PDWA 2ZQYA 1Y37A 3DKPA 1KBOA 1ATIA 1ZZEA 1XMPA 1MX9A 3SZGA 2OOKA 1W1WA 4DLKA 4HGQA 1CC1S 2P2LA 2ZJ0A 1N6NA 4JFAA 1ZW1A 3H5VA 4ZO6A 3V32A 3DLIA 2ERYA 2V7UA 4BEJA 4BVAA 1EAYA 4RTOA 4DMMA 1JEYA 4DV7M 3EG9A 2WKWA 2C3PA 2E5WA 4R1UA 1J7KA 1Y4AE 1KU6A 1Q1EA 1U8YA 1WWKA 4IDAA 4CLEA 2GUWA 3Q41A 1C4WA 1QE3A 1XALA 2GF9A 1KK2A 3AM3A 2ZSIA 3QTLA 4LZNA 3WLIA 4A27A 3HU3A 1YE8A 2GN8A 2Z5VA 2BGUA 4J0JA 4EHKA 5K05A 2E21A 2E4UA 2MWMA 4M83A 1W4AA 4F3TA 4CM9D 3BGWA 3L0SA 2UYGA 1QGYA 4JIMA 4EUFA 3PRJA 4I3GA 3GFBA 1HDYA 3TSCA 2GSDA 3GHHA 2UXCM 4LYDA 5FP0A 1CZOA 3PFGA 2XHZA 3K6JA 3P52A 1FXSA 4D8TA 2XUKA 3H8JA 4NYMR 4RA6A 3FRJA 1W5EA 4HX2A 2PCLA 4QC2A 4D98A 3KU1A 3TVDA 2B8JA 4A0QA 3FSJX 2ZAIA 4FHEA 1UC9A 3GLSA 4PXAA 1T25A 3G2JA 2W6NA 3AKEA 4FYXA 3WWCA 2QMZA 5FXMA 4FFVA 3X1DA 4ITVA 4QUDA 5LIRA 1FP4B 5AVKA 1G8FA 1C7RA 2RHWA 1GCOA 2WAYA 3BF8A 3COSA 4RU1A 1G7TA 4XI9A 1FRQA 1LK0A 5CDFE 1V0JA 1RIFA 2D2FA 2NU9B 1TAUA 2BKEA 4KXYA 2EW8A 5J58A 1EFPB 4H16A 3K09C 5C3UA 2ZSHA 2WAOA 5I6DA 4PAGA 2Y6UA 2BH9A 2R6FA 1G41A 2GNOA 3U60A 3M6AA 2ZJ6A 3IAUA 4B3RB 3WL6A 1AUVA 1US8A 3JS5A 3GGCA 3VSCA 3P9RA 5IXJA 2D1TA 3WLNA 1DFGA 3N5KA 3TW0A 1EM6A 3WI7A 1SKQA 1L1QA 1NNJA 4YMUA 3V4RA 5K0LA 5LQDA 2AV6A 2HJWA 1BWRA 2ZB7A 3R9WA 4LJRA 2GPYA 2E4WA 1PDOA 5C80A 3MQFA 1CZRA 1QH0A 1E94E 1WSWA 2BONA 4YMIA 5DCWA 3F4LA 4PGAA 3TZKA 3UB3A 4YX9A 5C35A 4MICA 4WEQA 5KQPA 2VJNA 4JQZA 1C8KA 1TYZA 1U7TA 3MHTA 2VNIA 4NLLA 2IOQA 2P35A 4WCDA 2FWBA 3DMTA 4CL3A 1Z5VA 3NWLA 1NBWB 2Q3JA 1EB8A 2HSJA 2BE7A 3QWFA 4U02A 5CR9A 3VR3A 3Q8LA 3GJTA 3S6JA 3V9PA 4JSYA 2Y21A 1RMTA 3L1IA 1B0UA 4AY3A 2GCEA 4C21A 4HWTA 3I58A 3WK4A 1DBPA 2F5QA 1GTMA 4GH5A 1WSBA 3TLYA 1WLYA 4A15A 2YXPX 2QUAA 5DP2A 4QVGA 2NPFA 3NHRA 4CG2A 4LBZA 1TAGA 4UCQA 5ECGC 1UBJS 1O5TA 4UMFA 2NSDA 4LF7M 4D3FA 1J2UA 4IOKA 3UJ7A 1O95A 2GJ8A 3VVBA 2JWSA 1UJ2A 2HZ7A 4FDUA 4M1MA 1F0NA 1Y42X 5IAEA 2EF0A 1M1YA 1NVXQ 3IMCA 2QPAA 1VMDA 3V97A 1XZIA 3CG4A 5A9TA 5GIOE 5CBPB 3L4EA 3FLMA 4KO8A 3U6SA 1OFVA 3C6KA 3DT8A 2OYRA 4BECA 2C8VA 1A0OA 2G06A 3LXUX 4WL0A 3ZX5A 2DKOA 2V6FA 1DKNA 1OB2A 2VL7A 4OLBA 3WIDA 2WP8J 2FEMA 1J97A 3RBVA 2PUFA 1KK0A 4L6IA 4ZVPA 2DLCX 1RM5A 2R47A 2FFBA 4JC0A 3CUVA 1TJNA 1WUKS 3LUAA 5JW6A 3QFSA 1OBHA 1X80B 4H1UA 4TUYB 3KT8A 4BKPA 2D7JA 2SCUA 5DI9A 4HMQA 5AJVB 4DL9A 2FSGA 2BHLA 3JD1A 3P5SA 3PGMA 1DAEA 2OEPA 3IQDB 4L2IA 4OA8A 1X37A 2ODAA 3FBGA 3MEQA 1GLGA 4JSRA 3Q0TA 3TIFA 4DVJA 2HMSA 4DKJA 3L2OB 1S9DA 2O2IA 1GQOA 3DEJA 5EGNA 1UBLS 3FZYA 4MTCA 1N5DA 1H0RA 2GKSA 2P4HX 2H5JA 2XQGA 1ZXBA 1T2AA 1M1YB 2ODEA 2W0MA 1YDEA 2W8BA 4FYJA 4EL5A 5IEJA 3ISJA 5J2UF 1A9SA 3UJCA 5I9LA 3PFKA 2O1WA 3SVLA 3FTFA 3A28A 3PJFA 4ZOLB 3K9PA 1RYBA 1SY7A 2OHHA 4RNDB 1GYPA 1YZUA 2VHQA 3GXBA 5BURA 4KQ1A 4B4UA 1PTJC 2HM7A 2Q28A 5H7XA 2X0JA 5MGNA 3F2IA 3PUXA 2FRVA 1VMIA 5CNIA 3FNGA 4EGQA 3D7NA 3LLUA 1KRXA 1ENZA 2EGUA 4EBBA 1WHSA 3FTEA 2E5LM 1T5IA 1GA6A 4R69A 2VHEA 5FOWA 3KFVA 1NBEA 2YS7A 4QUGA 4ZT6A 3IB3A 1ZG3A 2LD4A 4JI0M 4Q15A 5DF1A 4PN7A 2CSXA 2RGCA 2ODQA 3TBFA 3VAZA 4P5EA 3SAUA 5CYFA 1XLVA 3OESA 1FJHA 3P26A 4F1JA 2IOYA 1DJLA 3BXPA 2HRQA 3OT5A 4RSGA 3TFOA 1QVVA 1SQ6A 5H4GA 3Q3VA 2VQFM 1KZ9A 1XK6A 4F12A 1IU9A 1UF9A 4G84A 4PZEA 3KAKA 2KYRA 2NP6A 1FPMA 2NZJA 4MYTA 1XKTA 1QJCA 2OFPA 2B8WA 1R27A 1NY5A 1ABEA 3FLEA 4F4HA 1AGNA 1VG0B 2QTFA 3E1GA 3BXHA 4NJEB 5LQAA 5CVVA 1V33A 1QHEA 2ZBFA 5K3DA 1B6RA 4JN6B 2XV1A 4AC9A 4FFNA 4BBPA 9ATCA 2F1OA 3ZXYA 1YSCA 1ZXXA 2X8BA 3NW9A 4PX9A 3V2GA 2CYAA 2GZAA 3ISVA 4IIXA 5EIBD 4ESOA 5G0TA 3C7KA 4XXHA 3SXUA 3CTMA 1Q3CA 6LDHA 1JSXA 1T1IA 3HCEA 3O4FA 5E3IA 1AQJA 3ZZUA 4D4GA 1Z39A 2X6RA 4JI8B 3DBOB 4KQ2A 1RJ9A 1W8DA 2EQBA 4HTAA 1EDZA 2H5XA 2Q5OA 1N7GA 1NYLA 3IVRA 1EK5A 4QGFA 4DIFA 4Q19A 1V7CA 1Q20A 3UHAA 4O0LA 1ECPA 4Y6OA 2Q6LA 3HZRA 4YRIA 1OI7A 4RTSA 3I4VA 2WZDA 3QPDA 3LUJA 1IDN1 1XQ6A 4BRWA 4DDMA 1MEOA 2Q41A 1VYVA 2JUJA 3E48A 5LYJF 4S2EA 1JU4A 1ZAEA 4QQ8A 3LCUA 4XVHA 2X1HA 3C70A 5DM60 4WN9B 3FYCA 3VJRA 3NEYA 4P3XA 3RREA 1T34A 4MM3B 2B8TA 3F7TA 3GFFA 2BMDA 4FWBA 4ECAA 4WINA 1NT4A 1J0AA 2CZQA 2AFHE 3SQMA 2QD5A 2F67A 1NM5C 4X1KA 2XRZA 1ARZA 1AX9A 2ERXA 2Q2OA 4RS3A 1P4RA 3KHKA 2YFYA 4PRKA 5K0SA 1V4BA 1YVDA 3U3ZA 4IHAA 2RH9B 4B0PA 4RTRA 4RSMA 4NE2A 3FDZA 1R6DA 5COQA 4JLDA 5TDHA 1ILEA 3HI4A 1E9EA 5DPMA 2G3QA 2WU0A 1YAJA 3ZNPA 4D0LB 3OLVA 4F04A 1ESDA 1MIOB 1YQEA 1P1HA 2XUAA 3NOOA 3IIIA 4OI2A 2AR9A 3MPOA 2ZZNA 1XWIA 3TIGA 5JSQA 5JVDB 4GWGA 4ND8A 2PO7A 5I4BA 3NHSA 3WMGA 3DMFA 5AK4A 4Q3AA 4F9TA 3GEPA 1QTRA 1LSJA 3NKFA 2O8CB 3F1LA 2YFHA 4EFKA 4BFZA 4PW0A 1T5BA 2UDPA 1JQEA 2VATA 3PXCX 1L2TA 5G0SA 2ZETA 4C0XA 1BZYA 4LSZA 1KY5A 5CLHA 1LLDA 2AUTA 3O75A 4IR7A 4LAFA 2GM5A 2VF5X 4WBNF 2UZ3A 3PNBA 4BP1A 1PJIA 4CNBA 1K8RA 4MLZA 2W6JD 3QEMB 4MYHA 4L8WB 4PLWA 5ITXE 2XUFA 3R3WA 3Q5EA 3RHFA 3GHYA 1Z12A 2Z8YA 3PXBA 4DKXA 3A4MA 4KZPA 1NMSA 3T3GA 2W6CX 2IY8A 4HDMA 1VL2A 1BJRE 2R79A 2C5RA 2UUCB 4CCSA 4B84A 3L7DA 4Q4JA 1XXHA 1CG6A 1HNNA 3FWHA 3Q3EA 4OAQA 1YI0A 2WA1A 3P0EA 4RVGA 4XJTA 3CVYA 4DJ5X 5AJYA 3EH2A 4OFXA 1PFYA 3Q7QA 4GPBA 4U2DA 3H5OA 4ZAVA 3ZV4A 3IVAA 1ZEMA 3K05A 3LWNA 5HJ2A 2DQZA 2L09A 1JDZA 3ZK9A 4PN3A 3DE0X 1KR2A 4DMGA 4IIYA 1VGRA 3W9UA 2NTEA 1GNQA 1V5GA 4E12A 4MQ6A 2A84A 1T2DA 2CNKA 2ID9A 2GJSA 3L3BA 1X77A 2KNZA 3AUYA 3ROPA 3FWNA 4NY1A 4Y1GA 3SAJA 3C1OA 1UBTS 4RJKA 5JJLA 2V4ZA 3H97A 1DHRA 1DUIA 1VL6A 2JD1A 2ZBUA 1ZNQO 1IDOA 2XR1A 3OQPA 3C24A 5L3QA 5LQJA 4LHSA 4QE3A 4L0CA 1DQNA 3DR3A 3NX4A 5ILGA 3NI2A 3G9QA 1F12A 3DQZA 4NV3A 5DB4A 4KQEA 3GPLA 1DGBA 4BLCA 1PYDA 4B2IA 2OD9A 2BJWA 3VFDA 3DA8A 2P4EA 5E6UB 5B7GA 3HJNA 2D5CA 2J3HA 2J3MA 3G2OA 3KD2A 4WZZA 1QIEA 3VR1A 1DLIA 2QNBA 3EY4A 5DIZA 2JLUA 3OAAA 1JR3D 2AOUA 2NO7A 4YT2A 4ZREA 1U8XX 1RZRA 4GPIB 2NO4A 3RSLA 5BQOA 4RVFA 3HK2A 1QQBA 1LA2A 2VNHA 4D80A 1ZLYA 1G5RA 2W2LA 4UAJA 3WLQA 3Q5GA 1CY8A 3BL5A 5KVVA 3QUQA 3U56A 1NY6A 3J27B 1M0SA 2VOEA 3FOBA 3L0YA 3N8HA 5B57C 1HKHA 3D0OA 2HQSA 3KP1A 4DLUA 4CTMA 1JDBC 2ZIAA 4N5DA 4C4RA 1YZQA 1JBQA 2HF2A 1FDIA 3R0ZA 1H23A 5A6SB 5H68A 3UAZA 3V7YA 1Q0HA 3K2EA 5F7JA 3TB6A 3TLGA 3TRDA 2VWGA 3W79A 4E31A 2XGJA 1HXHA 1PVDA 3I51A 3RYIA 4MVJF 3HPRA 1ES9A 4Q3DA 5JANA 1CKEA 2Q1UA 2CNBA 4JROA 1NG1A 3E9RA 4YRGA 1DGHA 2GRAA 3ED5A 3KLOA 4J6EA 4N5HX 3U31A 4NL4H 4BP8A 5LDGA 4CI0B 4AJPA 1FX1A 1H2BA 4E2FA 5BR1A 5JZMA 3CBGA 5DWQA 3ZW9A 1Q21A 1E2EA 2DUNA 2QU7A 3EIWA 3QHQA 1ZN8A 3UOWA 3HM2A 1CZLA 3PLRA 4JCOA 4MV1A 4F06A 3SBXA 4K6CA 3JTEA 4MV4A 3HCNA 3IELA 4E33A 4MZXA 3VZCA 1JQKA 2GZ1A 5EQDA 2P6MA 2HIGA 1Z68A 2RGEA 4E2XA 1R2YA 1GYQA 5DTRA 4IIDA 3IHTA 4JBNA 2O2ZA 2A57A 1FOEB 3CUUA 4OHCA 1IHUA 1PSZA 5M5BA 2EKFA 2XNCA 3M1LA 4L76A 1Y9EA 2Y0DA 1EP2B 2VH5R 2ZKLA 4XWWA 2QZ4A 3I5MA 3NYRA 4URYR 4HSEA 2DWNA 3A3OA 2ZJFA 3BERA 1I5OA 3NUGA 3PDIA 4S35A 5H4HA 4BP3A 1L9KA 1CS0A 2OR3A 5I9SA 2CB9A 1Z2EA 2QTBA 3RIXA 3QV2A 1DARA 1W75A 1IJFA 4XYGA 3KC2A 1PO7A 3WWDA 1UDBA 4JB3A 1Y3HA 2NG1A 5DW0A 4AWXA 2G72A 3CX7A 2WJHA 1VGQA 1VG9B 5FI3A 3OY2A 3KQNA 3BDIA 4UUOA 3RUEA 2VQEM 1NNUA 2FN4A 1EWVA 3EVDA 1N1EA 2HNKA 2Z8YM 3JVDA 2HN9A 1G71A 1YZNA 4HT3B 5C8XA 1F8UA 3QMVA 3QYJA 5ALNA 2OCLA 3ZI7A 4NKRA 2Z1DA 2EARA 1FYDA 3Q85A 2BWBA 3TUZC 1C7EA 2G76A 4WXRA 5CD1A 2R4QA 2B4AA 2KPOA 1SBTA 3RADC 5AW5A 1PJCA 1C8BA 2V98A 1T9BA 1C4KA 1C1HA 5KCZA 1IQ0A 1JEDA 3RFXA 4I3HA 2UVPA 1KKMA 1CJTC 2HK8A 5AQ1A 1DO8A 1HDOA 2B9EA 3G2HA 3TH5A 5K03A 1P4SA 2GESA 1W88B 3KYBA 3ENKA 4L5IA 5LOVA 1IPFA 1Q7BA 1DUVG 3C39A 4EG6A 2ZKIA 1L4GA 4KFRA 5K09A 1G3QA 1X7WA 4YJ3A 2EFGA 5HE8A 3TZBA 3K71B 4A0RA 3EN0A 4AMZA 3AIIA 3ZJ5A 3EZ7A 2KW5A 4IJQA 5IJ0B 3ISTA 4V3CA 1B6TA 3UK6A 1TKAA 1R9GA 1DWUA 1T4GA 5BV7A 1NMXA 5JWOA 4BJ3A 3CNEA 4YCBA 4FXOA 3HJGA 1LBQA 4KFTA 2QL9A 3AUUA 4YJFA 1UK7A 2X7XA 2X9VA 3I9V6 4PX3A 3ZWCA 3C3EA 3K8QA 1NJFA 3O2JA 5EY5B 1E0JA 1Q57A 1QCDA 3DOHA 4PYRA 4YPFA 3UNXA 4U0KA 1MV5A 4B0OA 3A46A 2LVQD 1Z2AA 1CQJA 2HSWA 4BU0A 4C78A 3R0QA 4A8HA 1NR5A 3CBQA 4P7JA 1WBBA 3GDOA 3FOWA 4YAUA 1JVSA 5EQJB 3QU2A 2W43A 1JHUA 1E18A 2ORIA 3IH5A 5ICEA 4QEDA 2Q9CA 2D1QA 4HYTA 4HGPA 4ZYZA 3BOSA 1E1CB 1UBUS 2XCIA 4BNTA 3EPLA 5B64A 1D6SA 1UC5B 2B1IA 2YWEA 5C5IA 1H6CA 2I65A 2VSQA 3CZRA 3IOYA 1BQEA 4WVLA 3AI1A 3IUNA 1SA0B 2FUG6 1R9JA 4EJSC 1JKXA 3QZUA 4S1OA 3T1HM 1U9IA 3A6EA 5AK0A 3JW8A 3WZ2A 2C3YA 3IA7A 1NHWA 3F96A 4IZIA 5J3JA 1AKEA 1U94A 1LLQA 2OZVA 1R7RA 2VHUA 4X91A 1TYDE 2FETA 2P9YA 4G1VA 3HXTA 4PNHA 3HL4A 4RZ2A 4CIZA 1NNLA 4Q7MB 1NAIA 2JI9A 2OKCA 3M6XA 3PDUA 1RM0A 3GNSA 1ICEA 2IYNA 4LRUA 4DV4B 1UXJA 4ZAXA 4JLNA 4A03A 4I9NA 1Z36A 3H5RA 1FQWA 3JAKA 5B3LA 4DV0B 4G0ZA 4MUGA 3DZJA 1SRQA 2WHXA 2DAEA 1IMOA 2OHFA 2RGNC 5HEKA 5JNVA 4LNUA 5LMCA 2VPPA 3V80A 4EM6A 3A25A 1QRDA 3PNYA 4P3PA 4XTRA 2BFAA 2RHCA 3JWHA 4PLHA 5BO5A 3VC7A 2XTAA 3VSBA 4CM4B 1RRKA 4F92B 5HQTA 3LTNC 1TUGA 4I19A 2XAAA 4YXWD 2ZR0A 2G5TA 1SCQA 1TZMA 1QPZA 1Z34A 5AI6A 1ZV1A 3F98A 3JQ8B 4DV0M 2WJ6A 4KLAA 3DOCA 2KZSA 3DV0B 5KJ1A 1P81A 4GEGA 4BNGA 2GRJA 3E9NA 2ZCVA 3RSZA 5I7HA 1HETA 3BK1A 2JAHA 2EAUA 2DT5A 4GLLA 4Z54A 4Q4HA 4F7DA 1OAKA 4ESHA 2PT5A 3DT9A 1WZUA 1XD8A 2F48A 2OV3A 2ZYWX 3MMSA 3UV7A 3QKSA 5FLEX 1WHSB 2J5QA 3WWPA 1CF9A 2R62A 3FE3A 2DQYA 3D3EA 3S2SA 2JGDB 5G02A 1AO0A 4TMYA 1JHZA 5DXJA 2HU7A 5EXTA 3VPSA 3A1VA 1MIHA 1Y8CA 2F1RA 3TSAA 3ITDA 1V4NA 3SGLA 4M55A 4OQZA 3SM3A 3DBRB 2PV7A 3O1HB 3EE6A 3SZUA 2Y8EA 2R6GA 2CLOB 3KUUA 4KIGA 4TUWA 5IUNC 3GLHB 2PR2A 1TF0B 3HA2A 3CW9A 3I2IA 3IP3A 3PYLA 3G6KA 2HV9A 2HWWA 5HGXA 3FNIA 3IMFA 3PIDA 1MQSA 5F2EA 3EBPA 3IDFA 1BS2A 3PFNA 1G291 1I30A 1YS7A 1JEOA 4DXDA 8LDHA 5ADHA 4RDIA 1VC2A 1V16B 1Z7WA 3PC4A 2I66A 4L5AA 3RDPA 2C7BA 2BP7A 2J46A 4UPVA 3FYSA 3TZEA 5A4MS