1NV8A

N5-glutamine methyltransferase, hemk
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
RKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
total genus 91
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv8A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv8A02
3BWCA 2OB1A 5KS2A 2JUJA 3LKDA 2DAMA 3P2EA 1JR3E 3TKYA 3CJTA 3HM2A 2MJ5B 2JY7A 1C7YA 5HILA 1YFJA 3GRUA 4BLWA 2C7OA 2OBFA 5KYGA 4BLVA 3LKZA 4E2WA 5CCBA 3BWYA 2JY5A 4YV2A 2HR1A 3GGDA 4Y30A 5EMJA 2NXCA 4QQNA 3GIWA 5DLYA 2ZBPA 1YB2A 2BWEA 4CTJA 2P3LA 5BW5A 5ICCA 3RODA 3UJAA 5EMLA 2I62A 3NDJA 4E2ZA 1NV9A 1G4AE 4RTOA 5EIWA 3GRYA 4AZTA 3CJRA 5BXYA 1IFYA 1F3LA 1KPGA 5FA8A 2NXEA 2OY0A 1KP9A 2AS0A 5M5BA 4RTJA 2P41A 1KR5A 2OOAA 5E9QA 1JQEA 4HGYA 1JG3A 4HEOA 3HA3A 3CCFA 1M6EX 5HIIA 4PGGA 4Y2HA 4E2XA 1I4WA 3OU2A 4BLUA 3HVHA 2WZJA 5LQNA 2C7RA 4RTMA 3B89A 5ICFA 9MHTA 4GC9A 2JH9A 2CL5A 1O9GA 3I53A 4F84A 3DOUA 5CVUA 2G1PA 4DMGA 1DV0A 5BW4A 2I6GA 4R05A 4ER3A 3DUWA 1NW3A 4PYNA 2B25A 2VZ9A 5CVVA 2VDVE 1HT2E 3B3JA 3G2OA 4PCLA 3G5TA 5CD1A 2V7EA 2G3QA 2AN3A 5H02A 5FHRA 5FCDA 3UJDA 3MHTA 4PIMA 5DRYA 3RW9A 2H11A 3HEMA 1R18A 5EGSA 2XYVA 1HT1E 4RX1A 2K4MA 1XVAA 2P1DA 2QY6A 1VPTA 4X41A 1G41A 2LVPC 2IPXA 4KIFA 1IM2A 5DM0A 1ZV1A 2O05A 2FYTA 4BP3A 3X0DA 3P8ZA 1JQDA 1G38A 4HG2A 2CMHA 3IV6A 1Y8CA 4C04A 5EHGA 1RJEA 3FYDA 1FP1D 4XCXA 2OOBA 3R6TA 2IP2A 4AZSA 5HIKA 2AOTA 2ZVJA 4P7GA 3M6XA 3PS9A 1TTEA 3LBYA 5GWXA 2CMGA 5U4XA 2BZGA 2Q41A 2O25A 4DQ0A 3FTDA 5DPMA 4CXMA 4GQBA 3P9CA 1DCTA 4GOMD 2JP7A 5DWQA 1UFZA 1NW6A 3V97A 1RJGA 1NW8A 1G8AA 3A7EA 3IEIA 3PX3A 3E7PA 2IFTA 5GM2A 1L3BA 1JSZA 5DTRA 5DT2A 2KNAA 3FRIA 3HTXA 3TR6A 1WJ7A 4M7RA 4ER0A 2JH8A 4MIKA 4AUKA 1R00A 5K0NA 2AOUA 1BC5A 3IHPA 2FPOA 2JZ1A 2Z6QA 3FRHA 4F86A 5ICGA 3ME5A 3NVKI 2DHYA 2OO9A 1XDZA 2R0IA 4EKGA 5K0EA 1VBFA 2H1RA 3SSMA 4OBXA 1RI3A 4FSXA 3B3FA 3GWZA 5T64A 3G2MA 3ORHA 3C3YA 3M6WA 2HWKA 5GINE 5BP7A 5CUQA 2ZZNA 1TW3A 4DM3A 4R6XA 4HGZA 3DTNA 1X19A 2YVLA 1YF3A 1ZMWA 1QZEA 3FPJA 3D2LA 2IIPA 1YZHA 2AZTA 1Q02A 1H1DA 5HZMA 2ZTDA 2B78A 1R6AA 4EKIA 4FP9A 1JTFA 3I5UA 5CVDA 2P40A 3FUUA 3E21A 5EZSA 2GPYA 2WA1A 4OBWA 1XDUA 2P8JA 4FR0A 3GRRA 1VQ1A 3O7WA 3AJDA 2L2DA 2QSFX 5K09A 3EVAA 1NV8A 1PJZA 1AV6A 3TKAA 1VLMA 2V74B 3FUWA 2RRUA 3GJYA 2R6ZA 2OPBA 4KDRA 4RYLA 1SG9A 3OFKA 3B5IA 3M4XA 1O54A 1KIAA 3KQOA 5FA5A 2IH5A 1UFKA 5DM4A 5E9WA 1YUBA 4F1IA 5GOZA 2FK8A 3B3GA 5HOQA 5LR6A 4C06A 3KQVA 5GP1A 2N47A 5K03A 2DULA 4LWPA 5FWDA 1A5TA 1TR8A 1DUSA 3IHTA 2XVAA 2IBTA 5K05A 3MMPA 4C4AA 2QHOB 3FYCA 5DX1A 4E70A 4X1OA 3UJ6A 2ZFUA 4O29A 5KVAA 5DTMA 1ZGAA 4P7FA 7MHTA 3EGIA 1JSXA 3FE3A 2GA9A 2PGXA 3C3PA 2LTUA 1EJ6A 1KPIA 4R6WA 4FGZA 2I9KA 2IDKA 3G2QA 2PT9A 1T43A 2ZIEA 4LG1A 2O07A 3T7TA 4CWAA 1VG5A 4KIGA 4QTUB 5DM1A 3WSTA 3GLIE 2DAGA 1WXWA 2G71A 3V8VA 1PRYA 1JTEA 3GLHE 5JR3A 2PVCA 5C9ZA 4QVGA 3M6VA 4C08A 4NECA 2AOWA 2GAFA 4P7JA 2EKFA 4DZRA 3E05A 4V0RA 1BKYA 2H5XA 3FTFA 3GU3A 5HIMA 2LD4A 2ZBQA 2PXCA 1RI1A 1INLA 4ER7A 3BGDA 1QAQA 3PTAA 3M70A 4F85A 3A7DA 4GOLD 3JWIA 2DENA 2DKLA 3S68A 3TPZA 5FADA 1YZ3A 5K8VA 2HMYB 5D1HA 5E8JA 5G02A 4IV8A 1NW7A 3OZTA 4G3OA 2PX8A 3TQSA 2JNHA 3UA4A 2IDJA 3SXJA 5EVJA 3LCVB 3UJ9A 1JG2A 5GM1A 5ERGB 2DI0A 2BM8A 2AOVA 3P9KA 1WIVA 3EVEA 3LDUA 4U7TB 2A14A 4DKJA 1FPQA 4P58A 5EMMA 1NKVA 2LVAA 3EMDA 4EQZA 3PVCA 2ZWVA 2YX1A 2YXLA 2YXEA 3NWBA 2AN4A 2NP7A 1WR1B 2DPMA 5C1IA 4IWNA 3VSEA 4LWOA 3MTEA 3LGAA 4PGHA 4RSRA 5DXJA 3G8AA 5LQCA 3BUSA 4FT2A 2JHPA 5DTQA 1L3CA 3ELWA 3LECA 1Z3CA 2JY8A 2KNVA 2EJSA 1X1BA 2KW5A 4JXJA 1TPYA 3EGEA 4MHTA 1FP2A 1UIRA 4YMGA 3KQWA 3F4KA 1NBHA 3UJ8A 2OXTA 4C07A 1RJFA 3C6MA 4OA8A 3HVIA 3UJ7A 3R3HA 3UFBA 3OZSA 5DSTA 4AZWA 1SUSA 2QRVB 1WXXA 2AOTB 3P2KA 2MGWA 4C05A 3R9XB 3EVBA 4KRGA 4KWCA 1NBIA 1N2XA 2GB4A 1BVSA 3DLIA 1B42A 2JG3A 3TRKA 4QTTB 5EC8A 2EJTA 4RVFA 3LX6A 4MTLA 3A26A 5FULA 5EG5A 4E30A 3LCCA 4ER5A 1KHHA 5HFJA 2WA2A 3NMUF 4XUCA 3AWIA 3GRVA 5FHQA 1R8YA 1SKMA 3VC1A 3HVJA 1I9GA 2R3SA 1VL5A 3A27A 2VDWA 3I58A 2UYQA 5EEGA 4YUWA 2AOUB 1ZHFA 3HCAA 2H00A 2NYUA 4GEWA 5CVJA 3LDFA 4V0QA 4RTLA 4ER6A 3DMHA 3SX0A 3ELUA 5JI2E 1M0EA 3T6PA 4GEKA 3LHDA 5FWAA 3KR9A 3OCJA 3BT7A 3UBTA 4P7KA 4IV0A 3JWGA 3THRA 2GS9A 4UOEA 3F92A 1EAMA 4A6EA 2EG5A 3FPHA 2XYRA 3FUVA 4DBGB 3GLGE 2CWWA 2PLWA 4QDKA 2P7HA 4HSGA 3P9NA 3HVKA 1OTRA 2NP6A 3NJRA 4X60A 2QYOA 2FCAA 3AXSA 2FHPA 4KDCA 3EEOA 2DAIA 3NVMB 3KQPA 5DX0A 3CBGA 4E2YA 1R74A 5DX8A 1WGLA 3G2PA 4ATNA 5HIJA 5K0GA 1P3QQ 2P7IA 4HTFA 3AXTA 4RTSA 3ER9A 5DFLA 1WG8A 4DF3A 3UJCA 5LSAA 3M6UA 1RI2A 2UYCA 3EGVA 2HTEA 4OQEA 1MHTA 2ADMA 5E1MA 3BKXA 5MHTA 3HCCA 3FPGA 2PKWA 2PY6A 3U81A 3DLCA 3HCEA 5ICEA 3QV2A 3BWBA 5LQUA 3UZUA 3G88A 2EKKA 5K0LA 2DZLA 3MERA 1SVUA 1EG2A 2IH2A 4F2LA 4WVLA 5LQAA 4YUXA 4R8RA 2BR3A 4UN2B 1FBNA 1IM8A 4PINA 4GF5A 4QVKA 4GUAA 3IECA 3KR0A 5FUBA 3K9OA 3EEYA 3C0KA 3BXOA 2YTZA 1RJDA 1G6Q1 4K6MA 3KQSA 3GO4A 4PONA 5EKUA 3DXYA 3UJBA 2NXNA 1GO5A 1QYRA 2UZ4A 1HNNA 3KPUA 1ZMUA 5E8RA 3NWEA 4PCAA 3SGLA 1ORIA 2ZSUA 2P35A 2ZBRA 2EFJA 4X63A 10MHA 2ZCJA 5F2KA 2PV0A 4QQKA 1L1EA 2B2CA 3OFJA 5JUWA 3PX2A 1XXLA 2O0LA 2L4EA 4E31A 5FQOA 4EVIA 1JQ3A 3HCDA 2B9EA 3BGVA 1DO2A 2G8NA 4B17A 5D1NA 3OPNA 3VC2A 2F8LA 2FRXA 3TLJA 3EMBA 3IYLW 5DXAA 1YLAA 1VP9A 5IKMA 1HMYA 1YFLA 2ORED 4CKCA 5F2NA 5LQKA 4PYMA 1ORHA 1Y8GA 1VEKA 3ELYA 1QAMA 3RIEA 3KPVA 3K0BA 1WS6A 1R4GA 2AR0A 4RTQA 3FTEA 5CCXA 3OU7A 2JHCA 3ID6C 3T0IA 5FTWA 4OQDA 2PX5A 4OX9Y 1ZG3A 2PX2A 2ZZMA 2Z6UA 1P39A 3G5LA 2ZLBA 1P1BA 2JZ0A 3MCZA 1UWVA 3TM5A 1R8XA 3QOXA 1P91A 2ZTHA 3THSA 4QDJA 1EFUB 3B7PA 3TM4A 2AOXA 3KPWA 5F2OA 4YMHA 1XTPA 1P1CA 2PBFA 1NW5A 3T7SA 3GLFE 1AQJA 1D2GA 4WP2A 3NDIA 3DMGA 1ZQ9A 2EJUA 2DAEA 5T6BA 2HWJA 3LDGA 4M38A 2ZWAA 3MAGA 1OKSA 3KKZA 3I64A 2QE6A 3Q87B 4RTRA 3DXZA 1ZMVA 3SSOA 5K0BA 1DL5A 4PNEA 3OE5A 3EPPA 3LSTA 3AY0A 2ZULA 1QANA 4POOA 1M6YA 3UA3A 1KXZA 5C0OE 5KQSA 2YXDA 2PJDA 1KYZA 3SMQA 3GXOA 1L9KA 1VDLA 5CIYA 1MJFA 2Z6AA 4YUZA 3DMFA 2BR4A 5EPEA 8MHTA 1N7JA 1NT2A 4PYLA 2AN5A 5K0FA 3PFHA 1OR8A 3TFWA 3FUTA 5E1DA 4KW7A 3QOWA 3REOA 2XBMA 4CKBA 2QM3A 5P8WA 4ISCA 1TW2A 3SR4A 4RTPA 1E94E 2O57A 3LPMA 1VEGA 1G8SA 5EMKA 1JG1A 4M36A 5K0JA 3A4TA 1T6OA 2ZTCA 1V92A 2O06A 3HNRA 4Z2YA 3KQQA 3L8DA 3OU6A 3HCFA 4GC5A 1IY9A 5T67A 1KYIA 4WXHA 1PGYA 1HQYE 4OA5A 4IKPA 3HA5A 3JWHA 5DRTA 3LBFA 2PX4A 3SSNA 2I7CA 3OZRA 3ANXA 4C03A 4RTNA 4XUEA 3HA7A 3EVDA 4YUVA 2ZIFA 4U7PB 2PXXA 4MQ4A 3FZGA 2L4FA 4PWYA 1AF7A 2BM9A 1SQFA 3TOSA 1XJ5A 4HTFB 4XUDA 1BOOA 2K9DA 2AVNA 3CKKA 3MGGA 5KQRA 3SM3A 5EQJB 2AVDA 1AQIA 3GCZA 4YUYA 2EX4A 2C7QA 2DNAA 2GLUA 3O4FA 4CTKA 1IXKA 1EQAA 2OZVA 3KHKA 1NE2A 5CM2Z 3BWMA 3G8BA 3JWJA 1KPHA 2PT6A 1MN3A 3CGGA 3FPFA 1Q0TA 3R0QA 4ZTBA 1IXSA 4Q7JA 1VIDA 2P3QA 1X1AA 4AZVA 3BKWA 5IH3A 2YQZA 4GOND 1OAIA 4YV0A 3PB3A 2LVQD 5GIPE 2QRVA 1DO0A 3E23A 2ONYA 2G72A 2IGTA 2PWPA 1FJXA 3DXXA 1X1CA 1O9HA 3NTVA 2XYQA 3FTCA 3SVZA 3NW9A 3OE4A 3A25A 5EOVA 3KR2A 3KQTA 3CVOA 1AIPC 3T7RA 1VP3A 4FS8A 4GOOD 3PLAE 5E1BA 1V39A 1ZKDA 1WHCA 2UYHA 4PYOA 5CVEA 2ERCA 4M37A 1HJPA 4R8SA 1G3IA 2E5WA 5EIFA 3HCBA 1XXHE 3E8SA 5FQNA 2NXJA 1QZZA 4FSDA 5EKXA 1RI4A 1OQYA 3G7UA 1XCLA 3H2BA 3ERCA 4QPNA 3GRZA 3MQ2A 2B3TA 4R71A 3LCUA 2YUIA 2BR5A 5K0CA 2OKCA 2MR9A 2ZW9A 1SUIA 3P2IA 4E32A 1SQGA 1N7IA 5EEHA 2QNJA 1U2ZA 4QPPA 5E2BA 5E2AA 2BH2A 5K01A 3MCTA 2OYRA 4YV1A 1XCJA 4HH4A 3DH0A 3R24A 5GIOE 3KU1A 4DCMA 1XB2B 2HNKA 2MROB 5LQJA 1X1DA 3EVCA 2IBSA 3CJQA 2G70A 2KHHA 2PSSA 4HC4A 4HRAA 1BHJA 5EHIA 3BBZA 2CKDA 4DCGA 2IH4A 4EMSA 4PYIA 1JG4A 3EVGA 4MWZA 1VEJA 2C7PA 3PFGA 3VYWA 2YR0A 1D2CA 3KR1A 2ZIGA 1D2HA 1KYWA 1Q0SA 1WZNA 2OB2A 3P71T 5E1OA 2HAKA 4G56A 5B1SA 1RI5A 3GNLA 2ESRA 3M33A 2ONZA 2Y1WA 3KPJA 1WY7A 1VE3A 2PXAA 3K9PA 3BGIA 2VDUE 1F4IA 5DSXA 1WGNA 1ZGJA 3GDHA 1G55A 3EVFA 4A6DA 2JHAA 4PYJA 2KNZA 3BZBA 1L3IA 2LBCA 3DR5A 3I9FA 4CKEA 2LVNC 4RV9A 3KQMA 3ELDA 3EVZA 1EIZA 4LECA 2HV9A 3KPYA 1XDSA 3P9IA 2DAKA 4EK9A 2JJQA 2XVMA 1QAOA 3UWPA 2NNWB 1CUKA 3PT9A 4BY9E 4RVHA 4RVGA 2VP3A 4E33A 4KVZA 4RVDA 4H0NA 3P97A 4RWZA 3DULA 2UYOA 3TMAA 4DA4A 2K0BX 4BP1A 2ZZKA 5EZQA 2PWYA 2OO3A 4FT4A 4L7VA 2CP8A 3KQYA 1JR4A 4PYKA 2VS1A 2FK7A 3CC8A 3HP7A 4PIPA 2LVOC 2BWBA 4PYQA 3MTIA 3E46A 2P3OA 1G60A 2JY6B 5DM2A 4AX8A 3MB5A 5E9JA 1F38A 3DP7A 3K6RA 3G89A 4RTKA 3H4JA 5HEKA 2GH1A 2WK1A 3FUXA 1EJ0A 3C6KA 4FZVA 4GBED 5LQRA 4X61A 3LL7A 3O31A 1I1NA 2Y1XA 3ER8A 3FPEA 3Q7EA 2CWBA
chains in the Genus database with same CATH superfamily
5DNVA 1Y1QA 4RPCA 5BR7A 1SOAA 3ZU4A 4I6GA 1GZ7A 4DYHA 5JH7B 2HT1A 1A9RA 4DJTA 3O9VA 3P2EA 1WBBA 2ZYVX 1DXQA 1N6NA 3GA7A 4BLQA 4TTTS 3HM2A 3U4CA 3AY3A 1ZUD1 4X6YA 2Z04A 3NFYA 3HR8A 3S2SA 3NT5A 2WMOB 2VSOA 3D5EA 5ALWA 2RGNA 1JBQA 2FH0A 4KZKA 6AT1A 3B6MA 3OP1A 4YV2A 5EE0A 3LWDA 2A5JA 4JJ7A 1XAHA 1VG1A 3NHFA 3UJAA 2IE8A 3EFBA 4E2ZA 3N75A 5EIWA 3RUEA 4TN1A 3UHPA 1SVLA 3RAFC 4IJ5A 3IPAA 3Q5DA 4PZLA 5BWOA 4N3NA 2FX5A 3BWVA 2QJFA 5C8ZA 4FHGA 5B6PA 4D3XA 3WA7A 1V9CA 3EEBA 4QXMA 3RF7A 2AX4A 3WBJA 2Q0SA 1YMQA 3K09C 1R4AA 1QC5A 2E1RA 3JQ7A 4IWXA 1HNXM 4RTMA 4KI0A 2JH9A 2PH7A 2YJ6A 4EG1A 1G59A 1XR3A 2MYPA 3SYMA 2ZSKA 5K2MA 3UIEA 1ZN9A 1O96B 1NTRA 4K9DA 3H1TA 4EPTA 4FIZA 3V1TC 3DVRX 2HBQA 2LVBA 1GTVA 1R3DA 1SD5A 4UDYX 4L0MA 2D0PB 4TKMA 3AUSA 2HY7A 1IULA 1Q2XA 1FDRA 3KOMA 3ONDA 1G2IA 2DSTA 1YC2A 2AN3A 4G26A 2Q2QA 1OFUX 5DRYA 4CM8A 1V26A 1ZCFA 3BXPA 2DLNA 3ECSA 2XYVA 1PYGA 4YRFA 2Q4TA 4B5KA 3PC7A 3C1UA 2NACA 4IDNA 5JQGF 2J09A 2LVPC 1XC8A 4MYTA 4MZDA 4NC6A 2BFAA 5IJ9A 2BDEA 3PWKA 3AUYA 1JYEA 4FILA 5LZ8A 3UEOA 1PEYA 2AW3A 3PNYA 1KP3A 1XQ9A 1KQNA 2RK4A 1ODCA 3NORA 5EHGA 2NYVA 1LSSA 1GCAA 3FYDA 1Y9ZA 4RVCA 3RC2A 1ZH8A 3OOJA 2IP2A 1DG3A 1F0YA 3SJ7A 4OV6B 1RQXA 3HU3A 4ENTA 2WIKA 4M6WB 5LD2B 3O9MA 3OLWA 4ZIRA 3O8NA 4ARUA 3V97A 1T4MA 1NXOA 4BDSA 1RXVA 1WQ4A 4WMLA 2J33A 2PEZA 4PN3A 2GBGA 5LLSA 2FRDC 1KI7A 3SWWA 1JSZA 1YGYA 4OGWA 2HREA 3CUKA 3TR6A 2JD2A 4ONEA 1QYXA 4L5CA 5K3BA 4HLCA 1MD9A 1JEYB 4Q4HA 4MKXA 3E9QA 3PFIA 4N01A 1KA9H 1R00A 2MDTA 2FPOA 1AZWA 4ACBA 5E7IA 2UZIR 1ND5A 4F86A 2KHZA 5DGHA 3NVKI 2OO9A 3I1FA 3MLBA 5K0EA 3HRHA 5BSHA 3B3FA 2PUVA 1BJRE 4Q15A 4O08A 5KYVA 4NEHB 5ICMA 3A36A 3AHCA 2QMYA 2YC2C 2BHRA 3DTNA 3H1FA 2BOVA 1F51E 2CXUA 3RFFA 1GPMA 1I10A 3D2LA 4IUCS 2GCEA 1NKSA 3M6IA 2NUAB 2XUHA 4ZMBA 5THXA 5EJ2A 1PP4A 1QU2A 3DOJA 3VU0A 2P40A 3FUUA 1E6LA 2CXSA 4B47A 4D56A 3H1GA 2RHOA 1AZLA 4F4JA 3PNMA 1CY4A 1CF2O 2NUTB 3DAPA 2WB2A 2IGBA 5DYNA 3LWZA 5BT9A 1XPRA 4YRAA 2ODAA 3K6JA 4JJ6A 5L53A 2ZUBA 3PHLA 3FAZA 5F9FA 2DWQA 3BILA 1KYQA 4F1IA 3B36A 2TMYA 1QH1B 1ZUNB 1XWIA 2PRKA 4I2VA 3NHKA 4E3ZA 4J07A 1QV9A 5P21A 2L7HA 3FHCB 5HM6A 3NVDA 4XRGA 1E2BA 2Y1OA 3WL5A 3TDNA 1DKPA 2VP0A 2R84A 4DY4A 1XB2A 1NULA 1XVIA 2J3HA 3L0IB 3DZKA 3PDJA 2KBFA 5KVAA 1CNFA 3AFIA 2I7TA 3DVQX 4R1PA 4XIFA 1R0KA 1Z0FA 4DRXB 2JEYA 2IU4A 1O4VA 1NXTA 2EF0A 4JXZA 3PJGA 3D1LA 4YXWA 3HB1A 4BX2A 4RLFA 2DUMA 4CKWB 4PC7A 1S02A 1NLFA 5LM3A 2ST1A 3T9CA 3D43A 5IJ0B 3WGLA 3CNBA 2O7RA 4AW4A 3TIXB 1YJ8A 3TQTA 2WAAA 2ZAYA 4C08A 3ZQJA 1E3TA 1TO2E 1X8LA 4DA0A 3HJCA 3W5HA 4GS5A 3V34A 3F0TA 1OBVA 2JFWA 2OAP1 3NBFA 4CRWB 5B53A 1CUIA 1QRTA 2OBBA 1XCPA 2A0UA 4HBZA 1NZJA 3HO8A 4GYWA 1J09A 5IYZF 2J7NA 1ACJA 4OOFA 3VR4H 4RL4A 3SHQA 2ZRHA 3G0HA 3AY7A 2I2FA 6GPBA 2HSZA 1EVKA 2OBMA 1XAIA 2YCLA 1MMFB 2C0CA 4FHDA 2WUDA 4J16C 1Y4UA 1N2IA 4U6NA 5FBKA 5JC1A 3A4LA 5JDIA 4KK3A 1W96A 1NF9A 1RHMA 1AGNA 2X5XA 1CEXA 3GMTA 1XZIA 2X13A 4C4YA 1YVPA 4EUEA 1KQOA 5ERGB 3OPQA 3LXRA 1HR0B 3EVEA 3GW8A 1Y7HA 3W9SA 1YB5A 3EE6A 1QG0A 3T7CA 1JFRA 1BAPA 3MWKA 2XDAA 4QGBA 1WBJB 3FJYA 5MGNA 2G09A 3SSAA 3QVSA 5KWEA 2PE5A 4E51A 4M9SA 1XAGA 3T7EA 4GZLA 1IJEA 5DTQA 4GDFA 5TGZA 3FY4A 1U1EA 4U02A 3I72A 1TPYA 1W0CA 1R6DA 1RXSA 3L7MA 3F4KA 4JI2M 2OXTA 4UDNA 1D2RA 1ZK0A 1AKEA 5CD9A 3HVIA 3ASYA 1DJQA 2QRVB 4S35A 2P8SA 5JS2A 1PT9A 4UJ5A 1PYDA 4CL0A 3NM4A 2CE2X 3EVBA 2GEVA 1H0SA 3RK1A 3TB6A 1W1UA 4HUTA 1MRNA 3BK1A 2ZTVA 1ISMA 3UUWA 4GP6A 4DV6B 4Y9SA 3ZNQA 1P3JA 2ORIA 3O2QB 2HPVA 1S2MA 2IZOA 2P30A 1L2CA 1OV6A 2EFYA 4QXQA 3V8QA 4LRQA 1PBNA 1BX1A 2YFQA 3NMUF 4DMMA 5H80A 1JEEA 1JFFA 5CNMA 2UU9B 1O7JA 3GQBB 1OX5A 3I37X 4MKFA 4EARA 4DR7B 1YACA 4B6RA 2QZZA 1Y6ZA 4UUQA 1X3SA 2H4WA 4YACA 2FSHA 4DB4A 4TM7A 1O89A 4LBZA 5MGBA 2WDPA 2R751 1L5WA 3QG5A 3OIFA 3RHZA 4G37A 2R7KA 3ANTA 1EMDA 4Z4QA 4M9ZA 3AKDA 1SCUB 4DNQA 3W6ZA 4DG8A 2GS9A 2NU9A 2QENA 2WM3A 1I5EA 1ONBA 2ZU6A 1Z5UA 2YY6A 2IKSA 2PYDA 1T4GA 2GA8A 5IBQA 1V7ZA 4FFBB 3PQDA 3ZBPA 4UTVA 1LUAA 3PJDA 2ONJA 5CYPA 5FL7D 1IJBA 1O96A 2GBLA 2V5UA 1Y7TA 3B2NA 4JI7M 2H1IA 1H1LB 2RG1A 3KB6A 1XFDA 1URPA 1DKMA 4MVYA 1S8AA 1ZJ5A 3PG5A 1DKRA 4W7SA 5DX8A 3L7AA 2F1OA 1RAFA 1SBTA 4UBKA 1DWQA 2O9JA 1WG8A 3JYHA 1OGIA 3M6UA 3ZUPA 1AQYA 4ENWA 3ZWKA 3WB0A 3T5TA 4DPMA 3J80S 4LGVA 5DLDA 3EGCA 2QTRA 4D0RA 2Z95A 1RSZA 4X3PA 4XB1A 1GSHA 4IYJA 3DLPX 1WMEA 3R7NA 4M1WA 3HO1A 2PWBA 1JJIA 1G1MA 2WOJA 3ZWPA 1CUYA 1YI8A 2WZQA 3KJEA 1O57A 1VG8A 2FNAA 1E2PA 3LBIA 1IXRC 1NHWC 4C6SA 4M6WA 3W34A 3IECA 3CVVA 5LZ9A 3GAMA 1MBZA 1V8OA 3ZZ0A 2JGFA 5JPIA 4CZ2A 1DBWA 4G67A 3PD0A 2F59A 3GO4A 3UJBA 3QTTA 1MAHA 4EY4A 3PA6A 4M8LA 4XWAA 5A0VA 1COWA 2Z4TA 3MJRA 2P35A 4DDVA 3MTBA 4P4UA 1LBEA 2J9YB 1BE6A 2C8KA 2G8LA 1QIGA 4LRXA 3Q2KA 2VYND 3DDNA 5LYJB 2VDMB 3RUFA 4DMCA 2FWAA 1JQ3A 4D9BA 1Y1PA 3L1IA 4QYTA 3W5CA 2PA0A 4MV8A 2ZDQA 4M0DA 4N7JA 5K3SA 2NZUG 2RBEA 1RYZA 3EDRA 5T4EA 1TK9A 4KVGA 3O84A 3OQOA 1QAMA 3QWFA 3VZCA 2NUAA 3K0BA 3L25A 2AR0A 4NHOA 4O59O 4CR7A 4L16A 3KTDA 2ZWIA 6REQA 3NAQA 2IHUA 3FR8A 5AHOA 4ZK2A 2RD2A 3G2JA 1N2BA 2NUTA 3B6JA 1OXBB 1JIQA 1FMJA 1P17A 2DWNA 2O3SA 3IVCA 1TYCA 2PGDA 2HJGA 4YQFA 3E1GA 3LXUX 2NTVA 1XMPA 4ZI5A 3QMWA 4O25A 4QDTA 2XNCA 4NWIA 1QH1A 1ZUNA 4XWGA 4HPWA 3UMGA 4DMLA 3GA0A 1W5BA 1JQKA 4S1PA 2Q2OA 3S2IA 5EIEA 3Q87B 4UM9D 4Z0TA 1E7QA 1HMPA 3N2IA 1LDNA 1JAXA 4TZ0A 1D2AA 3HJNA 2UYYA 1S8FA 4DRXA 4PQFA 4YJHB 3OUUA 1NOIA 2XNHA 3IEXA 1M6YA 5AJTA 1ZC3A 5EA2A 1DKNA 3GYBA 1CB7A 3BBLA 3L0OA 3SMQA 3H5VA 4CKWA 3WTCA 2FSUA 4P34A 1ZRNA 4EFKA 3QXCA 1SN7A 5IJ0A 2F9FA 4DV3B 4EKDA 3IVAA 2QTLA 4RK6A 3ZWQA 1O6ZA 4PYLA 1SUWA 1ULSA 3AEYA 3A9TA 4UAGA 4B82A 4AIIA 2QQGA 1QDRA 4MV9A 1V2HE 2GBIA 3CNHA 4CLXA 2XBMA 1CY2A 2WWXA 4E94A 2IHJA 4RTPA 2CB0A 3WLEA 4C4XA 1U1FA 3WRYA 3NHSA 1JG1A 2HX1A 3PZRA 1HNZM 4JODA 2BGTA 1YHNA 2WRZA 3OQMA 4FWIB 2REBA 4YY3B 2ZRGA 4DLNA 2C5EA 1THTA 2XRFA 5A3RA 3L8DA 2L42A 1RVV1 3TQHA 3ZJ4A 3R3ZA 2XQFA 1FFSA 4M86A 1ORRA 5G1OA 3PI6A 2I3AA 1CX9B 1B6SA 4AJEA 3GLQA 5JTUA 5DRTA 3L6RA 3TRHA 1VBMA 1GZUA 1FA9A 3PXUA 3B9BA 3HSSA 3BD9A 5K9ZA 1L7DA 3NV9A 5K0SA 1X9GA 2FOIA 4LDAA 1WA5A 2R6DA 4N3AA 4BDTA 3GNQA 4P98A 1P4GA 2QZSA 2L2QA 5A4KA 2VSFA 3QVOA 4QXPA 4ZAGA 3PPXA 1E18A 4A2WA 3U3JA 4K9QA 2VJNA 3GPCA 1P0MA 2LDBA 2AC4A 4B84A 1II0A 4RFSA 3QNMA 1CJUC 3LX8A 4JYCA 4UBLA 3OEHA 3I5AA 3JWJA 4OJKA 3A32A 1DJNA 2WM2A 2AD5A 1A1VA 1KOLA 4ASUA 1O0CA 1SZPA 5I47A 1HLDA 4B8YA 2J3DA 3TW8B 3ZXXA 1GDHA 3RH0A 3PB3A 1P3Y1 3N8GA 2QRVA 3EBOA 4XFJA 1DKUA 1ZD5A 3EA5A 3DXXA 2BV3A 2YWXA 4MQ5A 1M5UA 3IQEA 3PZBA 4ALIA 5MFPA 3NW9A 3FH0A 2GLTA 2ZI7A 3T7RA 2F62A 4V2IA 1TFRA 2GDZA 3ESBA 5CVEA 4PS1A 3OFSA 4E09A 1BVUA 2QX4A 4L4UA 3ZIUA 3RTDA 2LCQA 3GQBA 3EMVA 2V8BA 2YMQA 1SUCA 4IGIA 1WB5A 1J2EA 1VSBA 2DRIA 1PGJA 3QZUA 2ZW9A 1NVKA 4NMLA 3ZCBB 4QPPA 4YI3A 3EZFA 2QW8A 1MX0A 3ZZ1A 1T13A 3R24A 1FDUA 4DCMA 3ROKA 1PZMA 3D5QA 4NBWA 1E9FA 3MGKA 2G70A 2C88A 4QGGA 4WGFA 4L5YA 1U4OA 5LMNM 3L6BA 1FSZA 2HK8A 4FFBA 1GA6A 1N4AA 2B0JA 4OQNA 4NRVA 4FZJA 1E66A 1U2DA 2R6FA 1J00A 3RLIA 1M6WA 1H1LA 4B32A 1ISRA 1WY7A 3H8VA 1JECA 4HQ6A 2A5GA 3JALA 2XUIA 2NX2A 3T15A 1NQTA 1AV7A 3SQXA 4TYQA 3TPCA 1G5RA 4NMHA 1KQPA 1F1BA 3FW1A 1FDIA 4KYTA 2FP4B 2IEZA 2QN2A 1LI5A 3STTA 4XTRA 1ZVKA 3EC1A 5AH0A 2I3ZA 2N42A 3L6CA 4DS3A 4QOFA 4A16A 1GEEA 4RVGA 1X74A 4HRVA 4E33A 1QCDA 1LVGA 5JROA 3HHWA 3TTYA 3SYTA 4M0EA 1U3CA 1U8EA 2XCTB 3DULA 4MRVA 4BQEA 1KOGA 4BQSA 4FT4A 1I3OA 4L7VA 3D0OA 2CP8A 2R4TA 3FOBA 4J2HA 1P7WA 1G5HA 2VI5A 3C4QA 1IB0A 3FG9A 3UGJA 1AB5A 2I2BA 3ACBA 5FJIA 4RSMA 1EX1A 1OY1A 1WSBA 3HCNA 5HR5A 2HSGA 2G9NA 2OZLB 1U0RA 1C80A 3VZSA 1V47A 2XWQA 2PG3A 3QP9A 3E9YA 3LUFA 2J3QA 3A0RB 3B5JA 1IRIA 5KOYA 3EG9B 4ZOLB 4YBZA 1JWLA 1D0KA 1HTTA 2HL6A 4UVIA 3TWOA 3ZI7A 4A15A 2W58A 3LT5A 4ZT7A 3U7JA 5IFLA 4IBFA 3TD2A 3VPBA 4RU1A 3AUKA 1JAZA 1NWHA 1Z8NA 4QM6A 3WL4A 1YL6A 5FA6A 1X87A 1YQQA 4FQ8A 5LYJA 3CE6A 4PNHA 1KJIA 2DAMA 3TKYA 4B1FA 1GGVA 5FYQA 1PJAA 3HE3A 1C7YA 4BLWA 3FPCA 4BMSA 2CLIB 1JSCA 4NBLA 3RG8A 5T8KA 4OSOA 4I50F 4DJJA 4U0KA 1JDZA 1WSDA 2P9GA 4OHBA 1XNHA 3RTAA 3GIWA 5ADUS 3G6WA 1JJBA 4GKVA 4WBSA 4QGAA 5FWXA 2H54A 1LC3A 2H18A 4D0NA 1GAQA 3U2QA 2HWXA 4YA6A 1KKMA 3VH4A 3NDJA 3ZC7B 2PGOA 4J76A 1JEQB 3EXHC 1TPZA 1IFYA 4MTCA 4QUGA 4UULA 4P4NA 3MSXA 4CIDA 1N2OA 2WM9B 1B41A 3PIIA 1NVDA 2GD1O 1BXKA 1JG3A 3CCFA 3ZXUB 1WF6A 4HB2A 5JFTA 3CA8A 4P31A 2REOA 2XT6A 3EARA 1HYEA 3I53A 5HMMA 4JD5A 4DMGA 5CYOA 2A94A 1UDWA 1X7HA 3ETDA 2YV3A 3GWGA 4LEIA 2H57A 5HS4A 2V7EA 4YJHA 4JI3M 2G08A 3BIOA 3E5MA 2ATIA 1B8OA 2V98A 4EPVA 2QMZA 2NWQA 1S89A 2PFKA 4KO1S 3B1JA 2PRSA 3G8YA 3BJRA 2EBFX 2OCKA 3E9DA 4BVGA 4TT8A 1OHHD 2X2EA 4QICA 3QFCA 3Q9NA 3GDWA 3I1IA 3IPLA 1G38A 6PFKA 3HCOA 5ALZA 1JH8A 4ZT2A 1L5LA 3AVUA 3GJ6A 3O8RA 2CHVA 3I04M 3KYIB 2X49A 1X1RA 2EIXA 3DZJA 3TX6A 4Z7QB 3I61A 4LC1A 3DMRA 2GK7A 4MP8A 4ZT4A 4DQ0A 3OTOM 3I9MA 1G6HA 1RXIA 4GOMD 1TCAA 1AQ6A 4F93B 1RJGA 2R45A 5EE1A 3JTEA 1WIWA 4GQIA 3AHEA 3PT5A 2PMWB 1YZUA 3E7PA 2IFTA 3LPCA 3UV6A 1LVHA 3UANA 4IEEA 3FRIA 3A4VA 4X8LA 3EIQA 1R8QA 3CV3A 4DBLC 2HSJA 3AX6A 4GOXA 4PPGA 5EE5B 4EUHA 4L85A 3UXEA 2JZ1A 2PMFA 1MO3A 2JRCA 1YQGA 1T5BA 1SY7A 4LA4A 2G0NA 4EFLA 4XM1A 3UG6A 1U3VA 3S1SA 1VCIA 1S8NA 4OBXA 3COVA 1XRJA 3SBOA 2O3UA 4Y2XA 3TW8A 4ZGGA 1QZEA 4M1YA 1QORA 2IITA 1XMQB 1HZZA 2IYOA 4KT0F 4FNMA 4TZTA 5AHWA 3LA8A 5FP0A 4G5HA 4WFJA 5KBYA 5CVDA 1QO0D 1E3LA 1Z4PX 2P9BA 2WPDD 1RABA 4ND1A 5E7MA 3HJ8A 3R7WB 4YIHA 3MILA 1P7VA 3WSWA 3V6LA 3S2YA 5BYBA 4PEVA 4K8RB 2GR9A 3GJYA 3UKJA 2WYUA 4YPFA 4RBNA 4KSBA 1YR3A 4MUXA 4X8MA 4YP6A 1UFKA 3A46A 3FPLA 4B2IA 1U5CA 4JP8A 2FK8A 1M8JA 1Z28A 4LRTB 4CEJB 3TEJA 1Q7BA 2LR0A 4IHAA 1VKOA 3D8NA 2JA2A 1KORA 4KQGA 3D7RA 1GUDA 4Q16A 1NYRA 1DUSA 1Q0LA 2HDNB 3QKIA 1YAJA 4NBKA 2RGYA 4W8HA 4V3CA 2ODBA 1RYFA 2FWRA 3DYIA 4DCCA 2C2MA 1NC1A 4LF5B 2ATCA 1XP8A 4AJ2A 4ZODA 3HYNA 4DMHA 2VJAA 4PRKA 4BVJA 4A0GA 4MQFB 1JIKA 1YJQA 4WBNB 3ND7A 5JSUA 1RC1A 2IY8A 1Q1GA 5CH5A 5FOVA 3HACA 3KD3A 1K7CA 3UK0A 5IKXA 2CLDX 1OASA 3L92A 1XMXA 2IHNA 1V45E 1TKCA 1GYRA 3IFSA 3E05A 3QPCA 4WKBA 2VYFA 2W2KB 4JJ8A 1G1AA 3GRFA 2FW0A 4FW8A 2A9RA 3I05A 3MG9A 3E53A 3JQRA 4WNCA 3ZDQA 5CT4A 2D5AA 4YNBA 4YDQA 3PTAA 1E5LA 4RF0A 4R54A 4F85A 2PT7A 3WLJA 1G7RA 2FP4A 1SD1A 1QC5B 1KVQA 3JQ7B 1RAAA 4MVJH 1RTKA 2P75A 3ZYZA 2BELA 3HWSA 3OZTA 4JT8A 3LCJA 4DJEC 2BHNA 3U3ZA 1DIOB 3F4BA 5AKIA 1JG2A 1E32A 5JCJA 3OY2A 1GU7A 3QNUA 3Q2IA 4BEBA 3II6X 1LTHR 3HB0A 3LVQE 4R2MA 5EMMA 4NE2A 1F9AA 4BKPA 2FB9A 5BN3B 1LK7A 1N33M 1Q20A 5TY0A 1FTQA 1NDQA 3QTBA 4S1TA 1JV2B 4J0HA 1Y8AA 2OZLA 3BUSA 4S1NA 2C83A 3D3WA 3CH5A 3IULA 4D2IA 1Z3CA 4DDUA 3JVDA 4M7OA 3IJRA 3KXLA 4EA8A 5CLLA 5FR2A 4YMGA 2FFRA 3BH6A 4WE3A 5AT1A 3BCHA 4RANA 4LE2A 2AHMA 4KUHA 5KTOA 1I2DA 2GN4A 1YQEA 4PBRA 3DE2X 4RSHA 5E6RB 3G7NA 5JCXA 2VRWA 1L7QA 2ZTSA 2I1QA 2DCUA 1XLUA 2BBOA 2GB4A 1FTYA 1SB8A 1FJGM 3H8WA 2XAUA 2CXXA 3PRJA 4A0SA 1AKWA 3QHQA 3H8SA 4O2AB 2VT6A 2O23A 3WIBA 3A26A 2JGMA 4Q1VA 1IBKM 1N5RA 4CTNA 2J07A 1J8VA 1JPNA 1S5PA 3FBTA 4JLPA 3F7TA 2A92A 2C9OA 1W73A 4BX0A 3WJ7A 1KE2A 5F7XA 5FUQA 4M0KA 1NQ5A 3WAKA 1L4MA 3EA0A 4PC3A 3ZE0B 4OHUA 2WJIA 2ZJ8A 1S1CA 4ZVTA 1NASA 4RD2A 2A1TR 3PYMA 2XZLA 4Q4HB 4DR3M 1D4OA 4DG5A 4AYXA 1DNPA 3KYDB 1AQNA 4MW7A 3G02A 3H86A 4RCZA 2IUUA 4YJ2F 3FLMA 4ZEWA 5LQDA 2AUMA 4F4DA 2H2GA 1RWNA 4HNHA 3ELUA 4OJQA 4L8GA 4FBLA 4XTCS 1K8ZB 1RBYA 1VTKA 4W5TA 1FIUA 5FWAA 3WWCA 5AK3A 4AUNA 4ND5A 5D3MB 5C8YB 2WJAA 1ORWA 4MLPA 2P2YA 1E7SA 3L8FA 2PT5A 2R97A 5EXSA 3A1WA 3DW3X 4ROSA 4Q1EA 2B8TA 2MSLA 4AI6A 1XVVA 2VXBA 5KOJB 4K0KB 1TJNA 4YGXB 2W6CX 3ASUA 1AQLA 3F2IA 2O4UX 1ID1A 1JBKA 1Q22A 2VNJA 4RQBA 1O9BA 3WADA 5EJ4A 1MVOA 5F5NA 1WGLA 2D4HA 4D99A 1TI7A 4B4OA 1GNTA 2COUA 4MW1A 2MTBA 4IIBA 1L7EA 4QNNA 4CE6A 3AXTA 3K9HA 2WSMA 3O8OA 3RABA 3HY5A 3PHJA 3NC0C 4UM7A 1RI2A 2PN1A 5CM8B 3EGVA 3PXGA 3NLLA 4DV5M 1DC4A 2RBGA 3A1FA 5G3YA 1J9EA 4RPLA 2JFNA 3GGJA 2Z2YA 2X0EA 4P2GA 3N7TA 3UMCA 4DA8A 2WFMA 3B82A 4L95C 3L0SA 2ZJ1A 5ESWA 2D8AA 1BCSB 1IEVA 1XA3A 2QLTA 3UZUA 4IJWA 4P3PA 3VDQA 3R4CA 1OTYA 4M9UA 4Q7KA 3JRXA 4TL8A 3LK6A 3IPYA 2EAUA 3PPYA 3O0DA 2NQ2C 2BJVA 1ISGA 1MQ8B 3P9YA 1DX4A 4D81A 1QZTA 2VPWA 2DX7A 2WHEA 1Q1AA 2F67A 3TAUA 1USUA 3OZUA 1MEJA 1NNJA 2GVNA 3RJMA 3M6MD 2VRNA 1CXZA 5ITXA 2R87A 4YYZA 5G0SA 2UZ4A 4HVTA 4CLEA 1VSTA 5IJAA 3LO8A 4EW2A 4ZVNA 3NBUA 3RJTA 1NJFA 2HIHA 2OYSA 4WZAB 2XH9A 2VJQA 2YH2A 3E35A 2PV0A 4QQKA 4IIJF 2YYSA 4BCDA 1Y5IA 3IP6A 4G4GA 1XXLA 1J2RA 3WMFA 4DSTA 2XUQA 1C30B 5C5DA 3CEPB 4MKHA 1B8NA 3TG8A 4MP6A 1FSSA 4ZU3A 4B17A 1FRNA 1NNEA 4DIOA 1RM3A 1JSRA 3VC2A 1O6GA 4B44A 5C53B 2FP3A 3ITEA 4UU8A 4EW1A 1CHNA 2RK3A 3AI3A 4V1CI 4WFQA 1OIZA 1ONPA 2IIBA 3VR2D 1PM5A 2HPAA 3J81A 4KWEA 3H75A 5A1JA 3JX9A 4R81A 1JHYA 5SZHB 1ES9A 1A3CA 2PUWA 3RC8A 1RJWA 4V0LA 4DABA 2RGOA 5FR1A 3TLKA 3IAS6 3N58A 1OC2A 1RHRA 3C6QA 1XCOA 4QODA 3SE0A 1U0NA 4HEJA 4ZO4A 2I3BA 3K70D 2BEUB 2P5YA 1YZLA 5IDQA 3KDSE 2C78A 3M3HA 1OPRA 1OIXA 3NJ4A 3K05A 2FPXA 1UBEA 3TRIA 1C4KA 4LYEA 4ZVUA 5TGTA 4X65B 4YJ3F 1P4SA 1E4YA 4PGAA 5L6MB 1RCUA 3UTCA 1C7JA 3SIRA 1PTKA 4FMPA 4G5XA 1X92A 2Y4OA 4PU0A 3OZDA 4RH1A 2I7VA 1ECJA 1M76A 2YIJA 3BGWA 4P86A 4RGQA 1E69A 3K6KA 4PO3X 3H4MA 1KO1A 1BWSA 1HE5A 2P77A 5C0OE 4MQFA 1VGRA 2Y9MB 1L7PA 1JFFB 4WBNA 2F17A 4QNMA 3F74A 1VDLA 5CIYA 4AL4A 1U1CA 3FDFA 2W6MA 4KQ9A 3JCZA 4I4TB 4Q3BA 2IS4A 2ZIXB 5GONF 1AUAA 3FBWA 2IUTA 3FRJA 3FN4A 1C9DB 2W2KA 4UEWA 3ASZA 1JYFA 3OKPA 3VR6H 4AQDA 3LE8A 5EMKA 2QLLA 3P27A 2GCIA 2QZPA 5BV2P 5JXGA 5EWJA 2FE4A 1RQ2A 1ZXLA 2FG6C 2NU9B 4O2RA 5IEBA 3KQQA 3DV0B 3AOEA 3LNTA 2NG1A 2Q0XA 4UKDA 1TYAE 1CJVC 2RSLA 4DARA 3ILXA 2BIFA 1OVGA 3K5WA 2RMKA 3SAWA 2PX4A 3MQFA 3BXWA 4KHZA 1O97D 3MJEA 1OZGA 3ABQB 3UICA 4HLNA 2W90A 3RBXA 3AI7A 2JATA 5BN3A 2YBEA 4EG7A 3F6BX 2WTXA 2AVNA 2VP2A 3KL4A 4TZKA 3BHNA 1N32B 3OQJA 4JV5B 2O6HA 3DVLA 2OT3B 4RD3A 4PG8A 4E5YA 3OJFA 4WI1A 3LLMA 5AUNB 1QF6A 2VK8A 4Q3KA 3AH8A 1O94D 3AHHA 1HOXA 3QKRA 5IXSA 3ZBTA 3NR2A 1X42A 4JT9A 5BV1A 2C95A 3WGZA 1ESEA 1UMBB 1XF1A 4KVFA 4YV0A 3O38A 4A8JB 2D2FA 3ZIAA 1YCHA 3C43A 4W5HA 2BMWA 5E6RA 3D3QA 2AQKA 4YMSA 4I3HA 3G2IA 3ZDZB 5H5JA 3UCXA 2FWPA 4YR9A 2GO1A 5T6MA 1CC1S 4JLNA 5ITXE 2BHSA 2NPFA 3DNPA 3VBEA 1GTSA 2HYIC 1L5NA 2FDCA 4O2AA 4RKWA 3LMKA 1NT4A 4J7CA 1V8PA 5DYYA 5JYDA 2FZ5A 3UN1A 2F3SA 1WJGA 2CUZA 5J2TF 4KWIA 2IF0A 4CISA 2P2SA 3PEYA 1DC3A 1FW6A 3OZVA 5TEVA 3PEWA 3LMMA 4H7FA 2F4VB 1H93A 4ANRA 3MQ2A 3MT7A 2VNKA 1VECA 3KYDA 1EWRA 1NLMA 1TGVA 1U80A 1M67A 1MH9A 3ROQA 5B7NA 4TTVA 1G0OA 4TPKA 3E9CA 1IM5A 3OSZA 5TQ0B 5E3JA 4BO0A 3B5EA 5FOQA 1VI2A 1SIBE 2PJZA 5LQJA 2P91A 4DREA 2I4NA 2R8PA 3DE6X 3K1ZA 1IAVA 5D3MA 5C8YA 3QUBA 1BMFD 2M6LA 4LYHA 4X8HA 3QTLA 4G0PA 4F9TA 4P0PB 5EQTA 4GBMA 3AUXA 1D2HA 1NUUA 1KYWA 4W9NA 3P2JA 1Q0SA 4XLTA 1HGXA 3ADOA 4GP7A 6REQB 5KOJA 3QX3A 4K9OA 1M0SA 4HQLA 2HA2A 3SFVA 4KR2A 3OZAA 2BTOA 1LS6A 2QLFA 4RZUA 1PQWA 4JHXA 2A5FA 1F60A 1H5QA 5ALOA 2G1UA 5LZ4A 2JXNA 4OU7A 4UFOA 2WABA 3SX4A 4X93A 2KNZA 2QYTA 2P27A 2FKNA 1JU4A 4ZQIA 1V25A 1TIKA 1EFHA 3KPYA 3E18A 3HX3A 3DDHA 3S8MA 1AM4D 5BWCA 2ZSJA 5H81A 1UPFA 1IHDA 3L5KA 2C8LA 3CMMA 3T3HA 3Q10A 1EUYA 1BCSA 4NEQA 3AP2A 2FGKA 2J7PA 2UYOA 1EIJA 4BO7A 4LF6B 5EZQA 3Q40A 4IBDA 3L8HA 1RIFA 4NFYA 4LRWA 3TW6A 3PV0A 4GT1A 5HS6A 2G80A 2XQVA 5FWNA 4YLYA 4F3KA 1JBEA 1P1FA 2OC9A 2HQRA 4YRLA 2BRUC 3L6EA 5E7QA 1A5BB 4LVUA 1EQUA 4D9FA 5HZKA 1DGBA 2ACVA 1N2EA 2Q27A 3TF5A 2DVWB 2HHCA 3G89A 2HM7A 2HBRA 3O83A 1HE4A 5ALIA 4OLFA 2QP9X 1ANKA 1RWWA 4N48A 2B6NA 1K5GA 2QQ8A 1ACLA 3NCTA 4JUDX 1MJHA 4HRYA 2H1VA 4WZAA 4X61A 1KVRA 1VE5A 1BEUB 4PCUA 4W6QA 1WDWB 1R15A 2LKCA 1KZ1A 1FQJA 1B23P 1HR0M 4RZQA 1MC5A 3H2SA 3BYZA 3HVRA 2JJ1D 3KVOA 2XTZA 3RIHA 3KKOA 1C30A 4DYVA 1N2SA 3ZGYA 2P2GA 2NSJA 5HE9A 2Y92A 5B64A 1DQPA 3V8PA 1H94A 4E14A 3UAWA 1T6NA 2VHXA 2QK4A 4WVFA 2OBFA 5KYGA 4BLVA 4TSFA 2SKDA 4OJYA 4FGLA 3REGA 2A9JA 1QVZA 2VWGA 2B8WA 1V5FA 2HR1A 2EYQA 4HFJA 3BIJA 2PUCA 1WETA 5K3OA 4BB9A 3F2VA 1NM5C 2O4CA 4JA2A 4DG9A 3RVMA 2KMLA 1BW9B 4L0QA 1TMGE 1DKQA 2QMUA 4RFSB 3R7BA 3GPIA 1ISJA 4ILEA 2NXEA 4MLDA 5ER6A 2BEUA 4FHFA 5M5BA 2C31A 5ALRA 3E9RA 4M49A 2J1LA 3GEIA 2EQAA 4D92A 5CA1B 4Y18A 2I71A 2WUEA 4DV6M 3VHQA 1KZGB 5HKLA 5FBLB 3RUIA 3S2GA 3FMIA 5AD1A 3VR4A 3KZMA 4P32A 2FMHA 2D5IA 4V0SA 5COBA 3H65A 2UU9M 3ZWAA 1SZDA 3AB8A 5HFAA 1VHTA 3WBKA 2FMIA 3IE0A 5JASA 4P08A 5TC4A 1NW3A 4DR7M 3WJ1A 1CQWA 1P29A 2J4DA 3NPAA 4E22A 4IJQA 3R3SA 1KMMA 1FFAA 4K86A 4EPXA 5JJBA 2VDVE 4X54A 2BFNA 1JNYA 1QHFA 2H16A 1JVNA 5EIOA 3DLHA 4D4GA 2O3TA 5AWFC 4OQMA 1CVLA 3PUWA 4NZZA 3QITA 2H11A 2QE7A 2JCXA 1WP9A 2CLKB 1U11A 1KU0A 1QB8A 2K4MA 4Y6OA 1OA0A 3AINA 3NEJA 3ORFA 3H4TA 3D2AA 2VHVA 4I4TA 4OP1A 1HDZA 2ZIXA 3GJRA 4E7OA 1EUQA 4I9HA 5D6NA 1BHO1 2FDXA 4YRTA 2EW2A 4H1UA 1O95D 3TNDA 1CY6A 5CJJA 1P33A 3N05A 1RRKA 3ZJUA 2OBLA 3JAMA 1U8AA 5C32A 3WIOA 4X00A 2CMGA 2RAFA 3LOPA 3DV0A 1HWYA 4BMNA 3PICA 2BFEB 4P1ZA 4BFWA 4IMRA 5B2FA 3S8YA 1PLKA 4HNTA 3AUFA 1DX9A 4E88A 1S4QA 5JYEA 3OZFA 3ROPA 1UBHS 1KI9A 1CJMA 4FMDF 3PLNA 2KPOA 3JALB 3HTXA 5CR9A 1ZFNA 2ZM6B 3FLBA 4NMWA 721PA 1H6CA 5GV8A 2Q8QA 3N74A 4Y6PA 5EWLB 2WC1A 1JA0A 1D4AA 1VMIA 2WIGA 3VYTB 2MIIA 2FW8A 1OA1A 1EA7A 5HA5A 3ORRA 1Y0BA 1SBYA 1FFCA 5AICA 5K99A 3IQGX 3SIXA 4WX2B 4YECA 3WQBA 1QFXA 2ZYIA 3G2MA 3C3YA 5TMBA 2IYEA 5FPHA 2HWKA 4P54A 3ZG6A 3IOBA 2GO7A 1GJSA 4Z49A 3H5OA 3T9AA 4CKCB 1UMBA 2INGX 1T36B 4L75A 1Q3BA 4A8JA 5KB3A 4TWJA 4J1TC 4UHEA 3N7UA 4UHKA 3LCRA 3FKEA 2E21A 5IEJA 2VTVA 2ZTDA 4ND6A 1XZPA 4F8EA 3CRZA 4N6GA 3QYBA 4FYKA 3Q7IA 5EZSA 3UPUA 1VL8A 2C4VA 1K88A 2QSFX 3M5WA 2QUHA 4WZAE 3LUDA 3TKAA 1RADA 1VLMA 5CTAA 2EBWA 3VTZA 1ZMTA 2BCGY 5AVYA 1QRAA 2REXB 1U8FO 4EHAA 2WI8A 4QM7A 4XVCA 3V4RA 3B3GA 3FTQA 4J2TA 4LSWA 4H6WA 4G4SP 5L8RF 1N5OX 2OLKA 1PJSA 1K66A 2O6LA 3QHPA 1U8CB 2H31A 5B12A 3EOAI 4LAFA 4S3MA 4XPZA 2H6EA 3Q41A 5TQ0A 2ECPA 2G7ZA 3G13A 2Z3VA 3H19A 3A8TA 3GFSA 1HSZA 2H1LA 2PJUA 4RMHA 1A7KA 1LFDB 4QQRA 4KN8A 4ZAZA 4JBNA 5JXJA 1FSGA 1CHDA 1JSXA 3CO5A 4X64B 3QH4A 2K7ZA 4TL9A 1YVEI 2AW5A 2F3QA 1KOFA 4BNXA 2IDKA 1GFZA 4XSHA 3VQTA 3D4NA 1NOKA 2PT9A 4K6HA 2A7QA 4OUKX 3C87A 3E82A 1H3FA 3IE2A 4CWAA 1L8AA 2H5EA 1OZHA 1OXKB 1KOJA 4ZEXA 1I01A 2FEKA 5FWXB 4PX5A 4II7A 4JR0A 2PVCA 1YVDA 2P4EA 1VB5A 5U4QA 3WFJA 2CLLB 5CB6A 1G9XA 4P17A 4CKBB 2YINC 3CF6R 1HOTA 3T1HB 2WWFA 2IZ6A 4YIKA 2ON6A 3C4JA 2LD4A 2NYAA 3C3EA 2XOXA 3BIXA 2ODNA 1OXTA 2IXDA 3BGDA 4F96A 4FFPA 2F2TA 2M9MA 4JOQA 2CHGA 2HMTA 4CQMD 1T9BA 3JWIA 4OYRA 1FLAA 3IRUA 3HXLA 5FADA 1ZCBA 5FOUA 1Z4KA 3A1NA 5FLKA 4E7PA 4D7AA 2EP7A 2VNIA 2W93A 2GASA 3U6LA 1ZN2A 1OFIA 3LCVB 3SP1A 4DV3M 1ZD1A 3CSUA 1CTQA 3QKUA 1FYDA 1WPQA 1KRWA 3KT6A 1J8QA 1FPQA 5DT9A 3ZCXA 2DP4E 3T95A 3Q7RA 4B71A 2CLSA 4LMBA 2E3JA 2YXLA 4ZZ1A 3NWBA 3P20A 2JAUA 4R2HA 5JD6A 3OE7A 3KRTA 5KQGA 1L1FA 1XEWY 2B6HA 1MO5A 3DKKA 3QLVC 2A9QA 3FWZA 2ZUFA 4FT2A 2ZUTA 4YY3M 1ZAKA 4HZGA 4G4NA 4EOGA 2HSDA 2Q9BA 4BV3A 16PKA 3WLFA 4D8UA 1G2OA 4XK8F 2YWCA 1QKKA 1KMIY 1DRKA 4CT4B 1XOIA 2W43A 4N8DA 3QFSA 4WACA 1RWMA 3NWOA 1Z38A 1Z2DA 1RWKA 5AMXA 5JCOA 4JVOA 1MABB 1JAYA 3BXGA 4C0BA 5JFGA 1SIOA 3OAAA 3EZ6A 3IP7A 3LQ2A 4FXOA 1KHHA 4FZRA 2DFDA 2CEAA 3QE0A 1OYYA 4N7MA 1T0HB 2JKZA 2NQ8A 5A4DA 3HB5X 4P3YA 4YWJA 1D1TA 1RCTE 2I2XB 3JRWA 3LHIA 1HYBA 1TKBA 3PENA 1MX1A 1BW9A 4N47A 5ENVA 4G5GA 5CVJA 2B8NA 1GVNB 1MEEA 1YHYA 5C46F 1U7PA 4LK2A 5I3ZA 2Q4EA 3TIGA 2VDPB 3W9UA 4C6RA 4NOLA 3ZPXA 3SC2B 3TTUA 3WZLA 3T6PA 1L1TA 3LHDA 1DBVO 3DV2A 2V4ZA 5CA1A 5DCYA 3T1OA 5K0TA 2D7DA 3JWGA 5JLAA 2G40A 2JIRA 1SNYA 4TXJA 4CMIB 5JZSA 3GLKA 2C61A 1GZ6A 1Z62A 2FH5B 1HV8A 3PQCA 3RFCA 3LWNA 3T52A 4BAGA 1WKBA 2HL7A 1OOEA 2EX1A 1Z7YA 4GWLA 2Q5JA 5TS2A 4A8TA 3S2ZA 3HP4A 2VJPA 2NZYA 1I6WA 4E2YA 2V7QD 4WCFB 1U3TA 3AF3A 2BSAA 3T1TA 2JI6A 1HEYA 5FTNA 3HDHA 3NONA 4OREX 3C74A 4BECA 1T3GA 1Z3IX 5EKSA 2CL6X 4BZQA 4D45A 3NKFA 4INJA 9LDTA 5HIAA 2E1PA 2ZRLA 4XDGA 3FSEA 4CM7A 2HTEA 3C8MA 2HU2A 3V5NA 3D6NB 3BXHA 4OSPA 4B87A 5MHTA 3MT9A 2A5LA 4WCVA 2ZYGA 4MIYA 4YT2A 5EXPA 1O6BA 4WY5A 4B3TB 1EQ2A 1WF3A 4Y7CA 3WG9A 4E07A 2AE2A 3N8NA 5H83A 2ZB3A 1A97A 5HSGA 2Z09A 2X9NA 2PH1A 5K0LA 5KOIA 2CXHA 3MERA 3KSUA 2ZR0A 1P5JA 3A1EA 1QG6A 3FBGA 5CLQA 1US8B 1VBKA 3KXEC 1A4UA 1Z5ZA 2BFEA 5TPZA 5JIBA 2BTQB 1ZW1A 1ZNYA 2RI0A 2ZT5A 4M54A 2QG4A 3TYXA 1TVEA 4H1VA 4JHLA 2NU8B 3Q9UA 3VH1A 1MXFA 2DFNA 1G6Q1 3O1LA 4K6MA 3L7JA 4R69A 5B3JC 5IMBA 4D43A 5I7OA 1C8VB 1PW5A 4XIGS 3QWHA 5DHAA 2YJ5A 1B43A 1HPLA 4X63A 5EWLA 5A6VA 4IMIB 4U39A 1N0VC 2RHCA 4V02A 1WU7A 4MW4A 1BJTA 4MS4B 2JEZA 4XARA 3GEPA 4RIHA 3FOWA 3RVNA 1KMCA 4LZWA 4G2TA 3A6DA 3B7NA 2QBYB 3DV9A 4OAPA 5IZ4A 1E6KA 1YBAA 3PQFA 1MVNA 1K3TA 3U7FB 3EMBA 2GSWA 1DFGA 2ZJYA 4V24A 3PD1A 4CKCA 1T36A 1VLQA 3I2HA 1Y8GA 4BB5A 1NVAA 4BMDA 3MRXA 4IKOA 3MTGA 4EO9A 2GEJA 4OB7A 5B57C 1E9AA 3SYRA 2PEYA 3ZTWA 1EDEA 1PFYA 4NDZA 4RLHA 1XMIA 3HU5A 1Y3HA 3PXEA 1CUEA 4QWWA 2Q28A 2FE8A 3DBIA 4LE0A 1NJ2A 5SY9A 3V1YA 4K6KA 2DU8A 3OEYA 2O7NA 2HJWA 1TVMA 1NBOA 3FPAA 3D3WB 1D6MA 1ZU4A 3QHAA 3QOXA 5ESDA 4DCSA 1WB6A 1XTSA 4L7QA 5LQSA 2K6BA 1A2QA 4NULA 2WU1A 3A2KA 4EHBA 4W82A 3N9IA 3RUDA 3PKIA 1O58A 2NZ8A 5J59A 4GI7A 2EJUA 4C0XA 3JD0A 3A3OA 3ZHTA 4JC8A 5JNVA 1OUMA 5G1PA 3OWOA 5DVZA 1TMKA 1RQRA 2J3MA 4IY1A 1S8OA 1DL5A 2OLJA 4WJLA 4KVAA 4XA8A 1LLQA 3LKVA 4POOA 3FKQA 2CFRA 1RXCA 1BHSA 3G2NA 4PLHA 4DUPA 4YCCA 2HU7A 1HG1A 3QMMA 1C0IA 2RC5A 3R8CA 1YQUA 1SPXA 3KT3A 4AMVA 4NJEB 3EZYA 1Z4IA 2Z3ZA 5JZVA 1BFKA 4RVOA 4EA9A 4CKBA 4G0ZA 3NHPA 1SBHA 3AR5A 3CB2A 2B4KA 3HJAA 1V1MB 3JR5A 2QP4A 4I36A 3GUZA 3ADPA 4TTRA 4H3SA 3LHFA 2OXCA 1C1HA 3FB1A 2PMEA 4ZCQA 1TVKB 1TKRA 2X9VA 1N5IA 3L4BA 1SVWA 3RS3A 4Z4CA 5DMXA 1GKUB 4WJZA 1IY9A 1GKKA 1UDRA 4C0WA 5IC5A 3VNUA 4WXHA 3EAQA 3WDLA 3EGOA 5LWQA 4LV8B 4NNPA 3SSNA 1TCBA 3OZRA 5ALNA 1FVOA 1HFKA 4AO7A 2CB9A 1ONNA 1XTQA 4C87A 4CKXA 4XUEA 3HA7A 4DLKA 2OHXA 2WTBA 3X2FA 4LOHA 4QNRA 3QA9A 2ZIFA 1JQ5A 2Q5OA 3FHOA 3CISA 4OK3A 5DTJA 4O4JF 4MLZA 1DOAA 4EEKA 3QLUC 1NJSA 4FFOA 3DNMA 1E9CA 1ZBQA 5F1KA 4R16A 1KAHA 1Z7EA 3MGGA 3O8OB 1F7UA 4YPOA 3L8ZA 1DAMA 5KSZA 3B3QA 4MXDA 4IO1A 1TZBA 3RSQA 4JROA 3UKOA 4NATA 1P7PA 4B6SA 2YHAA 5HFNA 4BNIA 3RRYA 2Q6VA 2DFLA 4QXOA 3SKVA 3KL2A 3RKSA 4QGSA 2MWMA 1P7CA 4QOGA 2X3FA 3ZVRA 3DR3A 4J7XA 2GOYA 1QIMA 1Q2UA 1BS2A 1KSFX 2PL5A 3U6MA 2KWIA 5DI3B 3QYJA 4X24A 2UUCB 4DSOA 3VYRB 2MSCB 1MABA 1HQCA 1K4KA 1SC4A 3GLGB 3NNDA 2Z6VA 4XVHA 1I0IA 1XNQB 2DZDA 2W9XA 1FYEA 4NAVA 4CV1A 3DZCA 1K86A 1YS6A 1V9SA 4JITA 1RI4A 3Q0EA 3NOQA 2JZOA 4MO2A 4V0NA 2EUCA 4I5SA 2D0IA 4HO1X 3E2PA 3KVYA 2KM1A 4P6VF 2CYAA 2I34A 1P8AA 1XMQM 2W8ZA 1M72A 4BASA 4PFSA 4XRRA 2G25A 1GVNA 5KYKA 2E5LB 3AWDA 4M1TA 3QE4A 4UZEA 3E03A 3N8DA 1S2DA 3TW4A 3SC2A 1RLUA 5BSFA 4E5DA 4HRAA 1TM1E 2CKDA 1XD2B 1D9ZA 4CMIA 1CUCA 1JEOA 1SCKA 3VPAA 2ZIGA 3PXCX 3ICCA 3FOCA 1DBIA 2PUBA 4TT3D 1IL0A 3UWSA 3V7WA 3IAEA 1OQAA 4A27A 4RDXA 2X86A 3I4CA 4UHHA 1CUZA 1P2BA 2BGKA 5IZCA 1SKYB 2O7VA 4URUR 2ACWA 4ZZ2A 2IYVA 4WCFA 5HF5A 2A5YB 5EUCA 1LW7A 4JB2A 3LYHA 4M8KA 2OM6A 4D26A 1NHGC 4PYJA 1YRQA 3RYFA 4IW3B 1D1PA 2R6JA 2O5RA 4LF5M 4ZTZB 3EVZA 1N7HA 1ILEA 2J85A 1YWGO 2XZOA 3TNLA 3ET5A 4LZOA 3A11A 1NZDA 5FAKA 1Z12A 2JIQA 5D84A 3DO8A 4KVZA 5DM70 3F6PA 5BN4B 1W1WA 5A5FA 4CI9A 3TNYA 5EPOA 4DA4A 1I7PA 2ZETA 1YKGA 1B0ZA 2QU8A 3U16A 2YKGA 2WKWA 4KV7A 3WJ2A 1US8A 5JRZA 2X40A 4JVSB 3BRQA 5FUYA 1MX3A 3OQBA 1YB4A 2JDID 2HCFA 2BTQA 4X1KB 3K31A 5DM2A 2YWJA 3UVEA 5I45A 4AO8A 1ZQ1A 2NU8A 4MI1A 4JP5A 1EJ2A 3DP7A 1F8FA 5HCUA 5HP4A 3H4JA 1Z5VA 2V4UA 1CZRA 5E0OA 1QIEA 5HEKA 2GCPA 2V4MA 4URXR 1TJYA 1E98A 2VYCA 1QZUA 2A33A 4LN1A 1OI4A 4IBOA 4QU9A 5EWJB 2ETXA 4MS4A 1J0CA 5B2EA 4GG1A 3ELBA 3IB6A 5DK4A 3RYHB 4R40A 3GLFB 2QBYA 3ANMA 4TMTA 2RGCA 3AM3A 3WL6A 2CNBA 3Q6NA 2WUGA 3PKZA 2BZ1A 2AN9A 2JY7A 4FWTA 1YFJA 1M83A 3RVLA 5HOEA 4BNDB 2R18A 5H59A 3N0TA 4J9UE 4ZOCA 3PGJA 3PNKA 1NBAA 2A1IA 4BNZA 3R5SA 1T4DA 2B30A 1KDOA 4LCEA 4P81A 3TW0A 3LTEA 5EZYF 4ESHA 1YB2A 3BDAA 1D2MA 3UOGA 4XJXA 4RZXA 3O3MB 4M7PA 3TD6A 2YWHA 4QSHA 1W0KD 5JS8A 1NUPA 3PDWA 1NBMA 5GGXA 3ZEAA 3CJRA 2QRQA 5D51S 4KJXA 3BXEA 1KJJA 4JCCA 3EFEA 3HL4A 4Z7OB 5LYYA 5DLQC 3QKRB 2TMDA 4ZYVA 1T2FA 1Z5PA 3J27B 3VK7A 4F8YA 4ZD6A 4F2WA 1L8XA 3OU2A 3PI7A 1ZLYA 1PQPA 3CW9A 4FWHA 3CSDA 1D5WA 2WZJA 3B89A 3TUIC 1M73E 1PK8A 1TIBA 3RAEC 1V11A 5IREB 1SRRA 3THWB 5ALUA 4MVJA 3VX3A 1LTMA 5CVUA 3GO8A 1M75A 4HXGA 3LQRA 4TLDA 2J4FA 2WTAA 1DWUA 5IP5A 1RE1A 2HQ1A 2PUHA 2QL6A 1EFPB 2HLHA 3LRTA 2CK3D 2O7QA 3AP3A 2A3NA 4GLLA 4X6LA 2Z83A 1Y48E 3L0YA 1L4YA 3ESXA 2W82A 2BGGA 2RH5A 5KREA 4N3BA 3AVTA 2J0UA 4YQEA 3SAVA 2C96A 3H9JA 4RXMA 1U9JA 2NQTA 4NJEA 4TTPA 5KQ8A 3MS7A 3R75A 3D5TA 3PWSA 1F0NA 1PZHA 4OO3A 1Y5NA 1V1MA 2X77A 2NADA 2OHHA 4TKZA 1NFRA 3DO5A 4RYDA 4K6CA 3RS9A 1ZESA 4K0KM 4MGIE 2PS9A 4Z4FA 1Y3FE 4TTQA 2OOKA 1TVKA 1CU1A 3NHAA 1C8LA 1Z74A 2PHZA 4GMKA 3HVUA 5EJIA 3HN7A 2PFSA 4RJLA 4FDMA 1DCTA 4G89A 1EGHA 1KMNA 2BEWA 2QTHA 4DW8A 3FETA 2JGNA 3RR2A 1DKOA 3VOSA 1JLMA 5BQOA 5SY6A 5GM2A 4JSRA 5LKRA 2W2LA 4N7RA 1TUBB 3KYJB 4K87A 1JDSA 1G8HA 2QPLA 4RE5A 3CINA 1E9EA 2ZTUA 1T1JA 5C7OO 3RFVA 4IG4A 1NQAO 4DADA 1H5NA 1M2VA 3B1WA 1JQBA 3K8YA 3QE3A 4KNWA 4UUOA 4I5IA 3L8MA 4JL8A 3DBVO 2N9UA 3SSMA 1M34B 4ZC8A 1EK1A 3ZDYB 2F5QA 3PUYA 1YF3A 4JLOA 1ZMWA 1YDHA 1ZDMA 2R4JA 1CLUA 1DAFA 2F3RA 2VDLB 1KZ6A 4IHQA 4CLHA 3N8KA 3ZWOA 3FLEA 1CDOA 3NH9A 5DI3A 4Z7NB 3OC6A 2X8WA 2YN2A 2Z57A 2GUWA 4AYWA 4HXFB 1E20A 1DELA 3GLGA 4DEYA 3HI6A 3HHYA 1GL6A 3EQ8A 1EFTA 3EC2A 2ZI4A 1H8EA 1T9AA 2O1WA 1MC8A 3TD9A 2IS6A 4TN5A 3BX1A 4AKHA 2ATVA 3OFKA 3K92A 1M1NB 1O54A 5TEWA 1TJPB 4AF8A 4ETNA 3HPQA 4YDRA 1C1DA 1QH8B 3L7BA 4KSCA 1IEXA 2G4CA 4B3BA 5FO1A 5LR6A 4FZ3A 1WHTB 5LNK1 2VCEA 4NOOB 3PXBA 3A28A 3UUFA 2WQ7A 1EXDA 3I9V6 3IHTA 4JP1A 1D04A 4K2AA 1XLTA 1MRSA 2X6QA 2XMQA 1V8ZA 3QXHA 3DDSA 3GVHA 1GARA 1LRKA 3CUWA 5F35A 1NIJA 2B61A 2TS1A 3QLEA 1THGA 2PL3A 3OIUA 4FKMA 5AJXA 4JJFA 1WEHA 3G59A 5JC8A 1XD2A 3IP9A 3O26A 2HRCA 1FMTA 4FGZA 1E6EA 3KQNA 5KIAA 2X0NA 1NP7A 2PL1A 1TCCA 3K0CA 4F4IA 1ZX1A 2AHOA 2J5XA 1KYVA 4F9FA 2RFLA 1PRYA 3BCUA 4X65M 2G6BA 3AKZA 3M6VA 2IXGA 3EBLA 1PK7A 4CG3A 3R5HA 2JI7A 4DR4B 2XMCA 3KX2A 5E6SA 4CKZA 5AUOB 4NOJA 3H7AA 5LB4A 1MUUA 3AIIA 3C70A 4A2CA 3QVGA 3ZCRA 1ZVJA 1J1IA 4MVJE 3URKA 5F21A 3ACCA 1HURA 3WRXC 4OLJA 2ADOA 2DKLA 1KJNA 3LW8A 3DZGA 1YZ3A 1RZ3A 4E6EA 1JVSA 3MOGA 3WKDA 2KI5A 1MHPA 3DFIA 3CH6A 4PAMA 5FNVF 1YZGA 5JU6A 1GR1A 4EBFA 1GA1A 3JXEA 4JI1M 3U6PA 1JNXX 1SXJB 3IT2A 1XZJA 2ZSBA 4IKEA 5BN4A 1QG4A 2C1XA 4HUQB 2C5SA 5DULA 3NOOA 4P58A 2VJDA 3VI3B 1A27A 4EQ6B 2NP7A 1ENYA 4QYIB 5F7ZA 4LWOA 2PUJA 3F71A 1J42A 4L9WA 2D7JA 4JI1B 3TSCA 5DYGA 4X1KA 5LQCA 2HCBA 3NHYA 4PHGA 2HXYA 4PBSA 1RMYA 3AUUA 5A4JA 4JCOA 3LECA 4W1PA 3WNBA 1JDTA 5L4LA 5DMHA 3L93A 3PSAA 4KMSA 3GJTA 3IESA 5BYAA 3WLOA 5PNTA 4NPAA 1Z15A 1H2ZA 4D3ZA 2XR1A 1XDDA 2QQFA 1XHEA 1SIUA 2IPMA 1EE8A 2MGWA 1Q3CA 2BKEA 3GARA 3WFIA 2L82A 3Q8LA 3M4ZA 5HRAA 3ZV5A 1FK8A 3CRQA 2O8DB 3RYHA 1N2ZA 3TRKA 5CM9C 3RU7A 1W1IA 2EP5A 3GLFA 1FU8A 3Q1KA 5BSMA 3UFXA 1D2NA 1O87A 1N32M 4M9QA 4JV5M 1FNBA 3L7KA 5B3LA 4FX2A 3KSDO 5HFJA 4BNDA 2CJFA 3COJA 2F55A 1N0HA 2VHWA 4S1VA 4IJ6A 4M87A 4L2IB 4HXYA 5ISMA 2EJVA 4O2LA 1SOVA 1RR6A 3RKUA 3A14A 3HU2A 3CF4G 3PPWA 5DIFA 5LJLA 4IOKA 4Q9NA 1AE1A 1VRCA 3IEKA 2PZBA 2WIFA 3WP1B 5I3CA 1E3EA 2RAUA 2GTHA 3UTDA 2IOHA 2I87A 4ER6A 1N8SA 1BVRA 3FMFA 3VJMA 4Q37A 5FT9A 2X42A 2DY1A 4MAAA 3IA7A 3SCZA 2MT9A 3AO0B 1PFUA 3BT7A 5K6AA 3VDNB 2EKQA 3LP5A 1IZZA 3VR6A 1N57A 3PUKA 4ZQBA 2V9ZA 1KARA 3AUJB 3G6KA 3BXXA 3GLGE 1XROA 3OETA 2W83A 5JADA 5CCDA 1A9ZA 3THWA 3K0FB 4OP2A 2ZPTX 1NMQA 3VTKA 2RG7A 4HNGA 2CD9A 3RT9A 2EW1A 3FWHA 4MCJA 2F4VM 4EA6A 2C92A 5EAIA 2FHPA 2BC9A 3ZCSA 5JVDF 1GQRA 5DX0A 2ZJ7A 3G0GA 1ML4A 2IDMA 1EFPA 4DV4B 4ZC1A 2XTNA 4QGFA 2QS9A 3AHGA 4IBBA 5K0GA 3T3PB 3VSCA 1DRJA 4UUNA 4EY3A 4RLSA 1K5PA 3AZQA 2EZTA 2NO4A 4D9MA 3R44A 4PX2A 5KYNA 3I6YA 3ED5A 6LDHA 1KI4A 2ADMA 2VZEA 3WWOA 3CONA 4TMYA 1M9NA 2YW9A 3HNPA 3MT8A 4JUAA 3JZDA 3Q9SA 5DV9A 4JSTA 4TMXA 3D3NA 2I2DA 2G06A 4WUTA 2BGLA 3QPDA 3I0MA 2QJWA 2R46A 4KE6A 4MR9B 4QULA 2DFPA 4QJ4A 2O2IA 1VHWA 2YFHA 3ETLA 3SLRA 2ACEA 1J8FA 2P5TA 1SKYE 2GFIA 3GR6A 3ND5A 4DV1M 1V6CA 4LHVA 1S3SA 1U63A 3FGNA 2Q3JA 3L79A 4UBOA 2WVJA 3AL3A 2E6UX 2AI2A 5B30A 2QGFA 4W63A 5EMHA 2JIDA 2PCLA 5EHNA 1EVIA 1IY2A 4MUKA 2AQIA 3PC6A 2BE7A 1Q12A 4RA6B 1TUBA 3OHPA 4Q6WA 1CNMA 1Y6RA 4R0VA 1ZD4A 3BC1A 1M2FA 3O91A 4JJ4A 2CNKA 1E2FA 1YDFA 5KPRA 1R4ZA 1B16A 4DV1B 2R4QA 2JJ2A 2ET6A 3GBVA 3V8RA 4E15A 1R4NB 4LF6M 2QN7A 3W90A 1U5AA 2VJMB 1PDOA 1QQAA 1NFQA 2X8LA 2A0XA 4QHYA 3MS4A 1M8KA 4FYPA 2FRXA 1M34A 2B1RA 4BQIA 3TGLA 1DHTA 3KKPA 1ZMRA 1Y63A 1UFOA 3TSZA 1VP9A 1CF4A 4B2PA 1I2BA 5L40A 2C4NA 3RPEA 4B0PA 2GN8A 3NDRA 2C58A 5MN4A 4Z3KA 2YHBA 3D3EA 2IHZA 5DP2A 3LW7A 1PL0A 5B3KA 3V9PA 1FZTA 1SQ6A 1A9SA 3FTEA 4BX8A 3ZNNA 1J6UA 1VE1A 2JHCA 4MHOA 3P2OA 4A5SA 3KLNA 4IG9A 1C4WA 1ZNZA 4MI9A 3DF7A 1AN9A 4KQJA 5B2ZA 4IVPA 3EZGA 1P39A 4FYXA 1CR2A 4K8OA 5F3WB 4NMMA 1OWOA 1IZ8A 2IOQA 3ML1A 3AEUB 1IUKA 3PNOA 1DLJA 1ATIA 2FFQA 4ZYTA 1ZJWA 1M1NA 3O8LA 5H8WA 4B48A 1QH8A 5TT0A 3S2EA 4DLBA 3GLFE 1TAUA 4Q3LA 3LRPA 4E0BA 2D00A 4D4MA 3AONB 1FFEA 1WHTA 5CLFA 1DEKA 5CIQA 1NLZA 1ESZA 4ZU1X 2A0FA 4R5HA 2DAEA 1TEZA 3DF9A 3LDGA 1B4DA 1YS4A 4H77A 4C7VA 1OXXK 2PSHA 1GQ2A 4YP0A 3L27A 4DXDA 1WLSA 3L0BA 5J58A 1X1EA 1BROA 2B20A 1W5TA 1FNSA 3ZR4B 1H22A 4JLKA 2E4AA 4TYYA 3WC4A 1E3WB 2PJDA 3OEWA 1PFGA 5KPDA 4JZKA 2I4RA 5JPDA 5IC6A 4DJFC 2B83A 1Q57A 2PMCA 1NVTA 5C3MA 4RADA 4G4JA 2OGTA 1NT2A 1Z59A 2FN7A 4MGKR 5F7OA 1M33A 4DIBA 1DGFA 5AI5A 2OAGA 1LX6A 1XNJA 3NEPX 3NJ8A 4MGEA 3OQ1A 1E94E 3W9YA 4RNCA 4UXHA 2H52A 2WW8A 3I8SA 3W5VA 4HK4A 1OXSC 4FYMA 3GAZA 5JAUA 3BS4A 4F60A 1T34A 3V8EA 3LW5F 3HJSA 1HUQA 3DMDA 3U3DA 2IS1A 3I92A 5FLXA 5CDHA 3M5CA 5AFSA 4N9WA 2HNBA 5CDYA 1N3BA 4QEKA 5EHXA 5IM4F 3GJSA 4MB6A 3R9IA 2X6RA 3IQXA 3EB9A 2PH3A 1SXJA 1G8FA 1TC2A 2HN9A 1U94A 3VGJA 4HUQA 5TARA 2FRDA 5IDYA 3ND9A 3COWA 4GMQA 1XX6A 1DQRA 1JR3A 2JLQA 3TUJC 2MH8A 4EQ6A 5KVQA 5DW0A 2K9DA 1P73A 1TTPB 4QYIA 1VGVA 2GNPA 2PTGA 4PZAA 5CRIA 2CLHB 2HMUA 3GIDA 3O4FA 4ZVQA 4BC1A 3HADA 3GJ7A 2RH4A 4H18A 3NUQA 3CM0A 3M3PA 3RK0A 3WOHA 4U7GA 3KLPX 3Q3IA 5HKOA 5EE3A 4LWZA 4TXMA 4KQIA 1DO0A 1EFRA 4GO1A 2ONYA 4Z0PA 2IGTA 3AHIA 4IJMA 2Q46A 3EUFA 5F64A 5LMCA 2ZTLA 2ZM6M 2GM4A 3TBKA 4ENVA 5EOVA 2SKEA 2O8DA 3ISVA 4WN3A 1TJ4A 1AKNA 3MSCA 1I1QB 1E63A 2CVFA 4RS3A 4ENUA 4ZRDA 1HJPA 1N34B 4D6YA 2OZEA 2NZVG 1OGJA 2NXJA 4L2IA 3ZHRA 3MAJA 1KMQA 1Y1TA 4PCVA 4GHWA 4ID9A 4HS4A 3G7UA 1R5BA 4OJNA 4EHFA 4MV0A 1J99A 1M34E 3OP4A 2D3TA 5AW4A 4RM3A 1XVTA 2JFZA 2C98A 2V59A 1E3IA 5E2BA 5E2AA 3WVNA 1KNXA 1GTMA 4I9FA 4YV1A 1ISPA 4U2FA 3K7EA 4X7MA 5AR1A 2I4TA 3G1WA 2HH9A 2KRKA 1VJ0A 1W36B 3F6YA 1L6IA 3IBCA 1O08A 2EARA 2VAXA 1BQ3A 1WXEA 1SKAA 3R77A 4H35A 2FUCA 3Q11A 4RCVA 2DPXA 3ROGA 1HE2A 3B70A 1VSQA 3WB2A 5I8PA 2YWRA 1RYHA 2FE1A 3H17A 2GJKA 1JA9A 1D0VA 2WFAA 2DC1A 1Z8DA 3ZDDA 3K0FA 3P71T 3TWMA 3LC2O 4REQB 3SHVA 1KO8A 4TYMA 1T9ZA 3R74A 5KCMA 5EQFA 1BFDA 3MTDA 4LTMA 2PXAA 1BYIA 4C2AA 3MCUA 2VDUE 2E2WA 1MO6A 1E0AA 4NY1A 5C8XA 2FPKA 2XMDA 1T8UA 3HWWA 4H1TA 3GDOA 4C7BA 2LBCA 2FKAA 3U3KA 1UF9A 2JAPA 3W2HA 4LHYA 4BAUA 1SIWA 1OT5A 3DDUA 1RYDA 4X64M 8OHMA 3W4IA 1EZ1A 5T4BA 3ZXIA 1X86B 3DOEA 3WGUA 1RMTA 3Q3CA 5ANRB 2W4QA 4INZA 2Q5FA 5AKJA 4F6RB 4CQLA 3IVXA 3PQ4A 1HI9A 2Z2IA 1GL3A 3UYKA 3OPYB 2K0BX 4I99A 3S27A 4Y0AA 1K8XB 3FZQA 4MR9A 1ZBDA 3IBYA 1J7JA 1RP1A 1RLMA 1EK2A 4G1MB 3ZDCA 3T1HM 4MWEA 3AHDA 3ESQA 2BWBA 4HLDA 4KYIB 2PRIA 3KP0E 5IARA 1JHAA 3TQCA 4JSYA 1DMRA 5K5EA 1GNSA 4MI3A 4DM4A 1D0MA 1QV7A 4YRDA 1GQYA 1KEPA 3W2GA 2QSUA 2GN2A 1YCDA 2IZ1A 3ZV7A 4RA6A 1M7BA 2Y0TA 3I45A 1SM4A 1I1OA 3LBNA 5G2OA 4ZFNA 3WGOA 2CN1A 1FTGA 4W5NA 5SZJA 4R1UA 4MIEA 1J4AA 3HDVA 3UCEA 4WKCA 1R4NA 1SXJE 3K9QO 1GPKA 4TRNA 3T5PA 1PE0A 2XD4A 1WR8A 2VJMA 1FB5A 2WTMA 1JR3E 2ZANA 4PX9A 1ORDA 4PZCA 1U1GA 2DVMA 2IJGX 2GHRA 1JXAA 4Z0HO 1A5SB 2H48A 3OA0A 3QVTA 2ECOA 1E64A 4CIAA 1SZCA 2VHTA 4E46A 2DLDA 1XZDA 4F5YA 1Z18A 2WU8A 4E2WA 5HJEA 1R2YA 3V7UA 4MVWA 1WP4A 3AGPA 3KJQA 4FOPA 4XGIA 5EMJA 5JE8A 5A05A 2J3LA 1Z0SA 1KSJA