2DAKA

Solution structure of the second uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
total genus 16
structure length 63
sequence length 63
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dakA00
3E46A 2DENA 1VQ1A 1G41A 2QSFX 4R71A 1WGNA 2LBCA 2QHOB 1XXHE 4GEWA 1TTEA 5DFLA 2K0BX 4Q7JA 2OOBA 2DAMA 1ZMWA 2KNZA 2ZTCA 2L4EA 1BVSA 3IECA 2MGWA 2H5XA 2KNAA 3GLHE 1ZMVA 1GO5A 1DO2A 1KYIA 2OOAA 2MJ5B 2EKKA 2HWJA 1WIVA 3B89A 1PGYA 4UN2B 1SG9A 2LTUA 1TR8A 2LVPC 1WR1B 1EFUB 2JY8A 2LVOC 4HEOA 1E94E 3LCVB 2JY5A 3FE3A 3GLFE 3IHPA 3LCUA 2KNVA 2BWBA 1JR3E 2JZ0A 2JP7A 3E21A 1WJ7A 2KHHA 2MROB 1IFYA 1HJPA 1A5TA 1V92A 4F2LA 3GLGE 1IXSA 1HQYE 1Y8GA 1HT1E 2B3TA 3K9PA 1R4GA 1XB2B 2EJSA 2JY7A 1IM2A 2R0IA 1NV8A 1VEKA 2K9DA 4DBGB 2JZ1A 1HT2E 1QZEA 2BWEA 1VDLA 2DNAA 2DZLA 2OO9A 5JI2E 2JY6B 1VEJA 1G4AE 3FRIA 1CUKA 2QNJA 1Q02A 2JNHA 3GLIE 2DAIA 2G3QA 2CP8A 2DI0A 4WP2A 2LVQD 2EKFA 1ZV1A 2WZJA 2DAGA 1C7YA 1ZMUA 1OTRA 3F92A 2DAKA 1VEGA 2O25A 2L2DA 2JUJA 1YLAA 1VG5A 2DAEA 1G3IA 2LVNC 1NV9A 1WHCA 1F4IA 4F1IA 3H4JA 3K9OA 2ZTDA 1P3QQ 1DV0A 1OKSA 1OQYA 2CWBA 3BBZA 1MN3A 1T43A 4G3OA 1UFZA 1AIPC 1OAIA 2MR9A 2RRUA 2LVAA 2DHYA 1T6OA 3FRHA 2HAKA 2L4FA 3MMPA 1WGLA 1DO0A 3T6PA 2DKLA
chains in the Genus database with same CATH superfamily
1GVNA 2CEAA 3BXWA 2EA0A 4JI3M 2LHCA 2X4AA 4YY3M 3VFDA 4DR3M 2UXBM 1G8PA 3A42A 4JI4M 2QSFX 3A98B 3R9XB 1D2NA 3FYDA 2DWLA 2UU9M 3C3EA 2UUCM 1PRBA 5DFLA 1GJTA 3PXGA 1TDZA 4IIWA 4DV1M 5ITXA 4Q7JA 1ZMWA 2KNZA 3VDPA 3EIEA 1TH3A 3FTCA 3IECA 4JV5M 3J7BA 4TUWA 2H5XA 2KNAA 3L25A 5GKNA 1ZMVA 4IBJA 1KFVA 4GHAA 2G5GX 1KYIA 2V1CA 2C99A 2MJ5B 2HWJA 4JI6M 1E9RA 4GRIA 2O01F 1R2YA 1YUBA 4AKHA 3GQ4A 1EFUB 4HEOA 3T1HM 3LCVB 2JY5A 3B7QA 4LF6M 3GP1A 4FWHA 2KNVA 4IBKA 4B7GA 2D7GA 3ILKA 3L28A 3MK6A 3I4VA 4LY6A 3HZJA 3U61A 4GKKM 2KHHA 4LGMA 2CHGA 4FW9A 2MROB 1K3WA 1IFYA 1HJPA 1V92A 2CV1A 3QYEA 2R44A 4FWDA 4I5SA 4IJEA 4Z6YA 4DR4M 2ZAOA 2L09A 1NJGA 1IXSA 2OPFA 4FCVA 2B3TA 3SARA 1R4GA 3SMPA 3KFUG 5IREB 3GRVA 1G71A 1D0MA 2CUZA 1FNNA 3D8LA 4DR5M 2WSCF 3AV0A 3FYCA 1L2CA 3PNYA 3LW5F 3CTWB 3AOEC 2DZLA 1TH4A 4AW4A 3UZUA 3ZQJA 3PNVA 5ITQA 4FD2A 3QYBA 1VEJA 2HCBA 2F5NA 1IY0A 3AL0C 3FRIA 7CATA 1ZAEA 4DUZM 4JYAM 1TDHA 2QNJA 1YSYA 2HHHM 2JNHA 3GPUA 3IG8A 3VKGA 2FS1A 4LRTA 1L1TA 2DVWB 3HU1A 2DI0A 4WP2A 3C9PA 2F5SA 1C7YA 1XNRM 2VIIA 5F3WA 3GLFA 2BJWA 5ITXE 1OTRA 1NY6A 5BPVA 4S12A 3RGPA 3SC3A 2O25A 4LZJA 1N77A 4LF4M 2WSFF 1IN4A 1DGFA 4CJ6A 4BBAA 2XFTA 3LQQA 3HJSA 3GLGA 1R5LA 2KEBA 3NBXX 4R3DA 2V1UA 2Z3XA 1NV9A 1V34A 2ERCA 1OIZA 1NSFA 1WHCA 4KO8A 2KRUA 4OVZA 1F4IA 3DOAA 3KOZE 3V76A 3U6EA 3K9OA 1QVRA 3U6LA 1QQWA 2KRKA 3HU2A 4FCWA 4LJ7A 4QOSA 2CHVA 2DZNB 1DV0A 5EXPA 1OQYA 4GKJM 4LF9M 4PDGA 5FTKA 3WHLA 2M60A 1AIPC 1OJLA 4LFAM 2DHYA 2XGNA 1T6OA 2HAKA 4MB7A 2VF7A 4NRVA 3MMPA 1E9SA 4P16A 3A45A 4RNAA 3B9PA 2QBYB 1DO0A 1OFIA 4JI0M 4JI7M 2DENA 2X49A 4M0DA 3JAMS 2AHMA 2G8LA 3U61B 1G41A 3SASA 2CHQA 4EIWA 5ITYA 2CV0A 3FTEA 1R2ZA 4R71A 4B3SM 3E4RA 3GQ5A 3JR4A 1DGHA 4B7HA 2GNOA 4IJFA 3I51A 4PCZA 2DAMA 1L2BA 1QUTA 3B7NA 3TWKA 5JI3E 2EUCA 4CIZA 1E32A 3KS8A 2X8AA 2MGWA 4CGYB 1YE9A 2K47A 4A3VB 4NL4H 3LQRA 4OU7A 4Z8XA 3TE6A 2FNAA 4W5WA 3U6SA 2I7PA 2RGHA 1SG9A 3GQ3A 4BB9A 2LVOC 2JY8A 3DA1A 1FJGM 3LVVA 2YQZA 4XGIA 2UXCM 2DWNA 1G59A 1XMOM 2GQFA 4B3TM 3GLFE 3IHPA 3LVWA 4DR2M 2BWBA 1IXZA 2JZ0A 2JP7A 4GC9A 1WJ7A 1W5TA 2QPAA 2RGOA 5KQDA 4BLCA 1OIPA 3PFIA 2Z4SA 1C1KA 5KQ8A 1N36M 1A5TA 4NOOB 1NO1A 3KW6A 4F2LA 1QDTA 1Z5CA 3OTOM 3L27A 3GLGE 4G4RA 3HJQA 3HJ8A 4LJAA 1NNJA 1HR0M 3CF0A 2FFJA 2FE8A 4II7A 3KSXA 3WHKA 2EJSA 3VK8A 2JY7A 4JI2M 1MU5A 1XNQM 2R0IA 4LFBM 3LMMA 1XXHA 8CATA 4AQYM 1NV8A 1D0LA 1VEKA 5E26A 4L16A 3H4MA 4X64M 4OVZB 2QQ8A 2XF3A 4RF1A 1HT2E 1QZEA 1TH2A 1JQJC 4JI5M 5EQTA 3PVSA 1SXJA 3UJNA 3U60A 4G4QA 3GPXA 1NY5A 3Q8GA 4NSRA 4LG2A 1KSFX 1EIJA 2KA6B 1NHWC 4QHTA 1GL6A 3I04M 5FLXS 4L8RC 2DWMA 4K0KM 3HU3A 3THGA 2NQ8C 3SAUA 2LH0A 1K3XA 4M0WA 2Y0QA 2L7HA 2UXDM 3W68A 3HWSA 4I8OA 2R46A 2LVQD 2EKFA 4DR6M 1ZMUA 4DV4M 2R45A 3AKZA 2XZFA 1IN5A 2DAKA 4KHPM 1PJQA 1I4WA 3T1YM 4PD2A 3CF2A 2L2DA 3R8FA 2KZUA 3HHZA 3FUUA 3J7AS 2JUJA 3UK6A 1NVMA 1DGHB 2BJVA 2CRUA 4B3MM 1N78A 2EO2A 2LVNC 4KLNA 3BOSA 2OQ4A 3J80S 2VDBB 5EP2A 3U6OA 1NHGC 2QZ4A 3K1JA 3TPZA 2KZSA 5IZ7D 4F1IA 3M0EA 3J81S 3VKHA 1P3QQ 2M5ZA 3J27B 4NSOB 1XWIA 5ITRA 1OKSA 3KOWE 1IN7A 3AFHA 1N33M 4Y28F 3HY5A 1X37A 3C3DA 4AZFA 3KOYE 5FTMA 4AKIA 2L4FA 3K2LA 2QCUA 3GRRA 1TGUA 1Z5BA 2R18A 3AJIB 3FTFA 2DHRA 2WSEF 3HX3A 4FVMA 5DNYA 4M9SA 2Y20A 1XC8A 3FUVA 4ZPXA 1HQCA 3W0FA 1PJJA 3QAUA 4MGZE 1GKIA 3GLIA 3SBJA 1ORYB 5EP3A 4KT0F 2KDLA 1WGNA 2LBCA 4FCTA 1XXHE 4HL4A 1TTEA 2L6OA 3M6AA 2OOBA 3ZC7B 1R7RA 2YNMD 3UGJA 4AI6A 3DZDA 2FH0A 2F5OA 3NBIA 2UUAM 1Q3BA 2V6ZM 1SXJE 4MGYE 2L4EA 4KODA 4X62M 1BVSA 1IBKM 4LJ4A 1N34M 3SMSA 2C9OA 4XBOA 2OOAA 2EKKA 1WIVA 4D81A 2JXNA 3TWMA 2LTUA 1NJFA 3K92A 1TR8A 4DV7M 3U6MA 2LVPC 4I4LA 3U60B 4AKGA 1HNZM 1PJSA 3U6DA 2C98A 2JA2A 3HGIA 2P5TA 3FE3A 3HHYA 4X66M 4DR7M 1IXRC 3SYKA 2I7NA 4G6ZA 3KVWA 5ITUA 1IXSB 1L2DA 2R62A 1PJTA 1Q3CA 3SHGB 4QOZC 3B7ZA 1Y8GA 3IG5A 1HT1E 3K9PA 1QAQA 4D80A 2ZBKB 3VK7A 2VF8A 1IBMM 4IBGA 4MM3B 4GIPA 3U5ZA 1MJGM 4L15A 3FTDA 5FSWA 4LF8M 3GRUA 2JZ1A 1SXJC 5LMUM 4ITQA 1L8QA 1VDLA 1D0KA 1NNUC 5DYGA 2OO9A 5C1BA 4LF5M 3RE8A 5C18A 2JY6B 3CGWA 3FUXA 4LGYA 3L2AA 2LNHC 3GLHA 2J7NA 3SAWA 2CV2A 1Q39A 1CUKA 4LZZA 3GPYA 4IBEA 5L8RF 1LV7A 3CF6E 1QYRA 4X65M 3FD9A 3NWLA 3GLIE 5E6JA 2W82A 2DAIA 1GL7A 3GLFB 4GH9A 2CP8A 2BNKA 1QANA 3KP0E 3D8BA 4FWGA 2Y21A 1IN8A 1ZV1A 2Z7JA 2DAGA 5FTLA 3KXEC 3GPPA 5A2QS 1TF0B 1QAMA 1XHBA 4PDIA 3U6QA 1JR3A 3FUWA 2UUBM 2KW0A 4JN6A 3SHFA 3GLGB 1IBLM 2D7EA 1VG5A 2A5YB 4XK8F 1R6BX 2F4VM 4NXNM 1G3IA 3L26A 3KSJA 4B08A 1QAOA 4AG6A 4GITA 2ZTDA 4LFCM 1V33A 4M9XA 3HHWA 2LXEA 2Z4RA 1N75A 3BBZA 1HNWM 1AUAA 4R7GA 4G3OA 4GMQA 2KXEA 1IN6A 2RRUA 4PT5A 2HL7A 4LJ9A 2Q2EB 2Y0TA 3T38A 2DZOB 3FRHA 1I94M 4D82A 4RF0A 1WGLA 4LF7M 4DV5M 3GO8A 4CISA 1Z5AA 3T15A 1IY2A 4MGHA 2DKLA 3E46A 2QENA 2D7HA 3GRYA 4L78A 2C9CA 3TL4X 3E9SA 3W0LB 4CHTB 3C58A 1VQ1A 1K82A 2QBYA 1LTMA 1IQPA 1DGBA 2C96A 3VLFB 1MX0A 3VDUA 1QDRA 4G4OA 1PM5A 2XEPA 2QHOB 3B74A 4GEWA 3TQSA 3SYLA 2K0BX 4DV2M 3M7GA 1QUSA 2QP9X 3AOGA 1S3SA 2RKOA 2XSZA 5FTJA 3L29A 2J7OA 4IBIA 2XZUA 3U6PA 2ZTCA 5KO3A 4GHLA 5KPTA 4LJ6A 3GLHE 3W67A 1XMQM 1GABA 1PJIA 3U5ZB 3KS4A 1GO5A 1DO2A 4ANRA 3J2PB 4NC6A 4MGIE 2FOIC 3B89A 5EXSA 2XFSA 3U6CA 1PGYA 4UN2B 4WW0A 1WR1B 1E94E 4IBDA 3GLHB 4OW0A 4G4NA 2N35A 4DV6M 1JR3D 3EIHA 3QWLA 4QHSA 5EXXA 2APLA 3LCUA 3I01M 5FTNA 3SFZA 3ZCBB 4DR1M 1JR3E 1VDDA 4JXJA 3SATA 3E21A 2H1RA 4NXMM 5KPRA 2J5YA 2L7IA 2VQFM 2YFQA 1HNXM 1Z59A 4DV0M 2XH9A 2R4JA 1SXJD 5EJCA 4B7FA 4M9ZA 4YHHM 4LCBA 5BR8M 3FKEA 1HQYE 4P17A 2R65A 4IBCA 1XXHB 1W5SA 1XB2B 3HKPA 4NRWA 4QNRA 1IM2A 2R6FA 2VQEM 2F5PA 1ZQ9A 4JI8M 5DYIA 5EP4A 2DXIA 4DBGB 5LMNM 1SXJB 1QZMA 4L4UA 4MH0E 2BWEA 3HHXA 2DNAA 2CE7A 3MJ5A 5JI2E 1GJSA 1DGGA 3RGSA 3AOEA 1G4AE 3FUTA 4I81A 2HKJA 1J7KA 3SAVA 4AG5A 2K6BA 4LRSA 4GC5A 1GLNA 1Q02A 1J5EM 2XLJA 1RU3A 2G3QA 1J09A 1Z6TA 2DWZB 3UMMA 4DUYM 2WZJA 2ZAMA 2XSZD 2JWSA 4B3RM 2Z8YM 3I4YA 3F92A 1VEGA 1IY1A 3JR5A 2MH8A 4IBFA 1YLAA 5EXTA 3MHVC 2DAEA 1H6UA 1L1ZA 3RFWA 4LJ5A 3TWLA 2ZM6M 1OAOC 4REZA 3KDSE 2E5LM 2LWXA 4MGKE 1N32M 3H4JA 2YR0A 5ITTA 2O5RA 4L6V6 5IWAM 1UM8A 3ZH9B 4JI1M 4WURA 2CWBA 1OFHA 1MN3A 1T43A 2LHGA 3A46A 4QNMA 1UFZA 4HLQA 4IBBA 3KOXE 1OAIA 2MR9A 2CFOA 2C5RA 2LVAA 1JB0F 4OX9M 4RKUF 5IT9S 2ZANA 1T3TA 4LJ8A 3DFZA 1WXQA 4DV3M 2F5QA 3K8ZA 1EE8A 5EP1A 2R4EA 5KPZA 3Q8XA 3KP1E 5H37D 3GLIB 3T6PA 2K9DA
chains in the Genus database with same CATH topology
3E46A 2DENA 1VQ1A 1G41A 2QSFX 4R71A 1WGNA 2LBCA 2QHOB 1XXHE 4GEWA 1TTEA 5DFLA 2K0BX 4Q7JA 2OOBA 2DAMA 1ZMWA 2KNZA 2ZTCA 2L4EA 1BVSA 3IECA 2MGWA 2H5XA 2KNAA 3GLHE 1ZMVA 1GO5A 1DO2A 1KYIA 2OOAA 2MJ5B 2EKKA 2HWJA 1WIVA 3B89A 1PGYA 4UN2B 1SG9A 2LTUA 1TR8A 2LVPC 1WR1B 1EFUB 2JY8A 2LVOC 4HEOA 1E94E 3LCVB 2JY5A 3FE3A 3GLFE 3IHPA 3LCUA 2KNVA 2BWBA 1JR3E 2JZ0A 2JP7A 3E21A 1WJ7A 2KHHA 2MROB 1IFYA 1HJPA 1A5TA 1V92A 4F2LA 3GLGE 1IXSA 1HQYE 1Y8GA 1HT1E 2B3TA 3K9PA 1R4GA 1XB2B 2EJSA 2JY7A 1IM2A 2R0IA 1NV8A 1VEKA 2K9DA 4DBGB 2JZ1A 1HT2E 1QZEA 2BWEA 1VDLA 2DNAA 2DZLA 2OO9A 5JI2E 2JY6B 1VEJA 1G4AE 3FRIA 1CUKA 2QNJA 1Q02A 2JNHA 3GLIE 2DAIA 2G3QA 2CP8A 2DI0A 4WP2A 2LVQD 2EKFA 1ZV1A 2WZJA 2DAGA 1C7YA 1ZMUA 1OTRA 3F92A 2DAKA 1VEGA 2O25A 2L2DA 2JUJA 1YLAA 1VG5A 2DAEA 1G3IA 2LVNC 1NV9A 1WHCA 1F4IA 4F1IA 3H4JA 3K9OA 2ZTDA 1P3QQ 1DV0A 1OKSA 1OQYA 2CWBA 3BBZA 1MN3A 1T43A 4G3OA 1UFZA 1AIPC 1OAIA 2MR9A 2RRUA 2LVAA 2DHYA 1T6OA 3FRHA 2HAKA 2L4FA 3MMPA 1WGLA 1DO0A 3T6PA 2DKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E46 A;  2DEN A;  1VQ1 A;  1G41 A;  2QSF X;  4R71 A;  1WGN A;  2LBC A;  2QHO B;  1XXH E;  4GEW A;  1TTE A;  5DFL A;  2K0B X;  4Q7J A;  2OOB A;  2DAM A;  1ZMW A;  2KNZ A;  2ZTC A;  2L4E A;  1BVS A;  3IEC A;  2MGW A;  2H5X A;  2KNA A;  3GLH E;  1ZMV A;  1GO5 A;  1DO2 A;  1KYI A;  2OOA A;  2MJ5 B;  2EKK A;  2HWJ A;  1WIV A;  3B89 A;  1PGY A;  4UN2 B;  1SG9 A;  2LTU A;  1TR8 A;  2LVP C;  1WR1 B;  1EFU B;  2JY8 A;  2LVO C;  4HEO A;  1E94 E;  3LCV B;  2JY5 A;  3FE3 A;  3GLF E;  3IHP A;  3LCU A;  2KNV A;  2BWB A;  1JR3 E;  2JZ0 A;  2JP7 A;  3E21 A;  1WJ7 A;  2KHH A;  2MRO B;  1IFY A;  1HJP A;  1A5T A;  1V92 A;  4F2L A;  3GLG E;  1IXS A;  1HQY E;  1Y8G A;  1HT1 E;  2B3T A;  3K9P A;  1R4G A;  1XB2 B;  2EJS A;  2JY7 A;  1IM2 A;  2R0I A;  1NV8 A;  1VEK A;  2K9D A;  4DBG B;  2JZ1 A;  1HT2 E;  1QZE A;  2BWE A;  1VDL A;  2DNA A;  2DZL A;  2OO9 A;  5JI2 E;  2JY6 B;  1VEJ A;  1G4A E;  3FRI A;  1CUK A;  2QNJ A;  1Q02 A;  2JNH A;  3GLI E;  2DAI A;  2G3Q A;  2CP8 A;  2DI0 A;  4WP2 A;  2LVQ D;  2EKF A;  1ZV1 A;  2WZJ A;  2DAG A;  1C7Y A;  1ZMU A;  1OTR A;  3F92 A;  2DAK A;  1VEG A;  2O25 A;  2L2D A;  2JUJ A;  1YLA A;  1VG5 A;  2DAE A;  1G3I A;  2LVN C;  1NV9 A;  1WHC A;  1F4I A;  4F1I A;  3H4J A;  3K9O A;  2ZTD A;  1P3Q Q;  1DV0 A;  1OKS A;  1OQY A;  2CWB A;  3BBZ A;  1MN3 A;  1T43 A;  4G3O A;  1UFZ A;  1AIP C;  1OAI A;  2MR9 A;  2RRU A;  2LVA A;  2DHY A;  1T6O A;  3FRH A;  2HAK A;  2L4F A;  3MMP A;  1WGL A;  1DO0 A;  3T6P A;  2DKL A; 
#chains in the Genus database with same CATH topology
 1GVN A;  2CEA A;  3BXW A;  2EA0 A;  4JI3 M;  2LHC A;  2X4A A;  4YY3 M;  3VFD A;  4DR3 M;  2UXB M;  1G8P A;  3A42 A;  4JI4 M;  2QSF X;  3A98 B;  3R9X B;  1D2N A;  3FYD A;  2DWL A;  2UU9 M;  3C3E A;  2UUC M;  1PRB A;  5DFL A;  1GJT A;  3PXG A;  1TDZ A;  4IIW A;  4DV1 M;  5ITX A;  4Q7J A;  1ZMW A;  2KNZ A;  3VDP A;  3EIE A;  1TH3 A;  3FTC A;  3IEC A;  4JV5 M;  3J7B A;  4TUW A;  2H5X A;  2KNA A;  3L25 A;  5GKN A;  1ZMV A;  4IBJ A;  1KFV A;  4GHA A;  2G5G X;  1KYI A;  2V1C A;  2C99 A;  2MJ5 B;  2HWJ A;  4JI6 M;  1E9R A;  4GRI A;  2O01 F;  1R2Y A;  1YUB A;  4AKH A;  3GQ4 A;  1EFU B;  4HEO A;  3T1H M;  3LCV B;  2JY5 A;  3B7Q A;  4LF6 M;  3GP1 A;  4FWH A;  2KNV A;  4IBK A;  4B7G A;  2D7G A;  3ILK A;  3L28 A;  3MK6 A;  3I4V A;  4LY6 A;  3HZJ A;  3U61 A;  4GKK M;  2KHH A;  4LGM A;  2CHG A;  4FW9 A;  2MRO B;  1K3W A;  1IFY A;  1HJP A;  1V92 A;  2CV1 A;  3QYE A;  2R44 A;  4FWD A;  4I5S A;  4IJE A;  4Z6Y A;  4DR4 M;  2ZAO A;  2L09 A;  1NJG A;  1IXS A;  2OPF A;  4FCV A;  2B3T A;  3SAR A;  1R4G A;  3SMP A;  3KFU G;  5IRE B;  3GRV A;  1G71 A;  1D0M A;  2CUZ A;  1FNN A;  3D8L A;  4DR5 M;  2WSC F;  3AV0 A;  3FYC A;  1L2C A;  3PNY A;  3LW5 F;  3CTW B;  3AOE C;  2DZL A;  1TH4 A;  4AW4 A;  3UZU A;  3ZQJ A;  3PNV A;  5ITQ A;  4FD2 A;  3QYB A;  1VEJ A;  2HCB A;  2F5N A;  1IY0 A;  3AL0 C;  3FRI A;  7CAT A;  1ZAE A;  4DUZ M;  4JYA M;  1TDH A;  2QNJ A;  1YSY A;  2HHH M;  2JNH A;  3GPU A;  3IG8 A;  3VKG A;  2FS1 A;  4LRT A;  1L1T A;  2DVW B;  3HU1 A;  2DI0 A;  4WP2 A;  3C9P A;  2F5S A;  1C7Y A;  1XNR M;  2VII A;  5F3W A;  3GLF A;  2BJW A;  5ITX E;  1OTR A;  1NY6 A;  5BPV A;  4S12 A;  3RGP A;  3SC3 A;  2O25 A;  4LZJ A;  1N77 A;  4LF4 M;  2WSF F;  1IN4 A;  1DGF A;  4CJ6 A;  4BBA A;  2XFT A;  3LQQ A;  3HJS A;  3GLG A;  1R5L A;  2KEB A;  3NBX X;  4R3D A;  2V1U A;  2Z3X A;  1NV9 A;  1V34 A;  2ERC A;  1OIZ A;  1NSF A;  1WHC A;  4KO8 A;  2KRU A;  4OVZ A;  1F4I A;  3DOA A;  3KOZ E;  3V76 A;  3U6E A;  3K9O A;  1QVR A;  3U6L A;  1QQW A;  2KRK A;  3HU2 A;  4FCW A;  4LJ7 A;  4QOS A;  2CHV A;  2DZN B;  1DV0 A;  5EXP A;  1OQY A;  4GKJ M;  4LF9 M;  4PDG A;  5FTK A;  3WHL A;  2M60 A;  1AIP C;  1OJL A;  4LFA M;  2DHY A;  2XGN A;  1T6O A;  2HAK A;  4MB7 A;  2VF7 A;  4NRV A;  3MMP A;  1E9S A;  4P16 A;  3A45 A;  4RNA A;  3B9P A;  2QBY B;  1DO0 A;  1OFI A;  4JI0 M;  4JI7 M;  2DEN A;  2X49 A;  4M0D A;  3JAM S;  2AHM A;  2G8L A;  3U61 B;  1G41 A;  3SAS A;  2CHQ A;  4EIW A;  5ITY A;  2CV0 A;  3FTE A;  1R2Z A;  4R71 A;  4B3S M;  3E4R A;  3GQ5 A;  3JR4 A;  1DGH A;  4B7H A;  2GNO A;  4IJF A;  3I51 A;  4PCZ A;  2DAM A;  1L2B A;  1QUT A;  3B7N A;  3TWK A;  5JI3 E;  2EUC A;  4CIZ A;  1E32 A;  3KS8 A;  2X8A A;  2MGW A;  4CGY B;  1YE9 A;  2K47 A;  4A3V B;  4NL4 H;  3LQR A;  4OU7 A;  4Z8X A;  3TE6 A;  2FNA A;  4W5W A;  3U6S A;  2I7P A;  2RGH A;  1SG9 A;  3GQ3 A;  4BB9 A;  2LVO C;  2JY8 A;  3DA1 A;  1FJG M;  3LVV A;  2YQZ A;  4XGI A;  2UXC M;  2DWN A;  1G59 A;  1XMO M;  2GQF A;  4B3T M;  3GLF E;  3IHP A;  3LVW A;  4DR2 M;  2BWB A;  1IXZ A;  2JZ0 A;  2JP7 A;  4GC9 A;  1WJ7 A;  1W5T A;  2QPA A;  2RGO A;  5KQD A;  4BLC A;  1OIP A;  3PFI A;  2Z4S A;  1C1K A;  5KQ8 A;  1N36 M;  1A5T A;  4NOO B;  1NO1 A;  3KW6 A;  4F2L A;  1QDT A;  1Z5C A;  3OTO M;  3L27 A;  3GLG E;  4G4R A;  3HJQ A;  3HJ8 A;  4LJA A;  1NNJ A;  1HR0 M;  3CF0 A;  2FFJ A;  2FE8 A;  4II7 A;  3KSX A;  3WHK A;  2EJS A;  3VK8 A;  2JY7 A;  4JI2 M;  1MU5 A;  1XNQ M;  2R0I A;  4LFB M;  3LMM A;  1XXH A;  8CAT A;  4AQY M;  1NV8 A;  1D0L A;  1VEK A;  5E26 A;  4L16 A;  3H4M A;  4X64 M;  4OVZ B;  2QQ8 A;  2XF3 A;  4RF1 A;  1HT2 E;  1QZE A;  1TH2 A;  1JQJ C;  4JI5 M;  5EQT A;  3PVS A;  1SXJ A;  3UJN A;  3U60 A;  4G4Q A;  3GPX A;  1NY5 A;  3Q8G A;  4NSR A;  4LG2 A;  1KSF X;  1EIJ A;  2KA6 B;  1NHW C;  4QHT A;  1GL6 A;  3I04 M;  5FLX S;  4L8R C;  2DWM A;  4K0K M;  3HU3 A;  3THG A;  2NQ8 C;  3SAU A;  2LH0 A;  1K3X A;  4M0W A;  2Y0Q A;  2L7H A;  2UXD M;  3W68 A;  3HWS A;  4I8O A;  2R46 A;  2LVQ D;  2EKF A;  4DR6 M;  1ZMU A;  4DV4 M;  2R45 A;  3AKZ A;  2XZF A;  1IN5 A;  2DAK A;  4KHP M;  1PJQ A;  1I4W A;  3T1Y M;  4PD2 A;  3CF2 A;  2L2D A;  3R8F A;  2KZU A;  3HHZ A;  3FUU A;  3J7A S;  2JUJ A;  3UK6 A;  1NVM A;  1DGH B;  2BJV A;  2CRU A;  4B3M M;  1N78 A;  2EO2 A;  2LVN C;  4KLN A;  3BOS A;  2OQ4 A;  3J80 S;  2VDB B;  5EP2 A;  3U6O A;  1NHG C;  2QZ4 A;  3K1J A;  3TPZ A;  2KZS A;  5IZ7 D;  4F1I A;  3M0E A;  3J81 S;  3VKH A;  1P3Q Q;  2M5Z A;  3J27 B;  4NSO B;  1XWI A;  5ITR A;  1OKS A;  3KOW E;  1IN7 A;  3AFH A;  1N33 M;  4Y28 F;  3HY5 A;  1X37 A;  3C3D A;  4AZF A;  3KOY E;  5FTM A;  4AKI A;  2L4F A;  3K2L A;  2QCU A;  3GRR A;  1TGU A;  1Z5B A;  2R18 A;  3AJI B;  3FTF A;  2DHR A;  2WSE F;  3HX3 A;  4FVM A;  5DNY A;  4M9S A;  2Y20 A;  1XC8 A;  3FUV A;  4ZPX A;  1HQC A;  3W0F A;  1PJJ A;  3QAU A;  4MGZ E;  1GKI A;  3GLI A;  3SBJ A;  1ORY B;  5EP3 A;  4KT0 F;  2KDL A;  1WGN A;  2LBC A;  4FCT A;  1XXH E;  4HL4 A;  1TTE A;  2L6O A;  3M6A A;  2OOB A;  3ZC7 B;  1R7R A;  2YNM D;  3UGJ A;  4AI6 A;  3DZD A;  2FH0 A;  2F5O A;  3NBI A;  2UUA M;  1Q3B A;  2V6Z M;  1SXJ E;  4MGY E;  2L4E A;  4KOD A;  4X62 M;  1BVS A;  1IBK M;  4LJ4 A;  1N34 M;  3SMS A;  2C9O A;  4XBO A;  2OOA A;  2EKK A;  1WIV A;  4D81 A;  2JXN A;  3TWM A;  2LTU A;  1NJF A;  3K92 A;  1TR8 A;  4DV7 M;  3U6M A;  2LVP C;  4I4L A;  3U60 B;  4AKG A;  1HNZ M;  1PJS A;  3U6D A;  2C98 A;  2JA2 A;  3HGI A;  2P5T A;  3FE3 A;  3HHY A;  4X66 M;  4DR7 M;  1IXR C;  3SYK A;  2I7N A;  4G6Z A;  3KVW A;  5ITU A;  1IXS B;  1L2D A;  2R62 A;  1PJT A;  1Q3C A;  3SHG B;  4QOZ C;  3B7Z A;  1Y8G A;  3IG5 A;  1HT1 E;  3K9P A;  1QAQ A;  4D80 A;  2ZBK B;  3VK7 A;  2VF8 A;  1IBM M;  4IBG A;  4MM3 B;  4GIP A;  3U5Z A;  1MJG M;  4L15 A;  3FTD A;  5FSW A;  4LF8 M;  3GRU A;  2JZ1 A;  1SXJ C;  5LMU M;  4ITQ A;  1L8Q A;  1VDL A;  1D0K A;  1NNU C;  5DYG A;  2OO9 A;  5C1B A;  4LF5 M;  3RE8 A;  5C18 A;  2JY6 B;  3CGW A;  3FUX A;  4LGY A;  3L2A A;  2LNH C;  3GLH A;  2J7N A;  3SAW A;  2CV2 A;  1Q39 A;  1CUK A;  4LZZ A;  3GPY A;  4IBE A;  5L8R F;  1LV7 A;  3CF6 E;  1QYR A;  4X65 M;  3FD9 A;  3NWL A;  3GLI E;  5E6J A;  2W82 A;  2DAI A;  1GL7 A;  3GLF B;  4GH9 A;  2CP8 A;  2BNK A;  1QAN A;  3KP0 E;  3D8B A;  4FWG A;  2Y21 A;  1IN8 A;  1ZV1 A;  2Z7J A;  2DAG A;  5FTL A;  3KXE C;  3GPP A;  5A2Q S;  1TF0 B;  1QAM A;  1XHB A;  4PDI A;  3U6Q A;  1JR3 A;  3FUW A;  2UUB M;  2KW0 A;  4JN6 A;  3SHF A;  3GLG B;  1IBL M;  2D7E A;  1VG5 A;  2A5Y B;  4XK8 F;  1R6B X;  2F4V M;  4NXN M;  1G3I A;  3L26 A;  3KSJ A;  4B08 A;  1QAO A;  4AG6 A;  4GIT A;  2ZTD A;  4LFC M;  1V33 A;  4M9X A;  3HHW A;  2LXE A;  2Z4R A;  1N75 A;  3BBZ A;  1HNW M;  1AUA A;  4R7G A;  4G3O A;  4GMQ A;  2KXE A;  1IN6 A;  2RRU A;  4PT5 A;  2HL7 A;  4LJ9 A;  2Q2E B;  2Y0T A;  3T38 A;  2DZO B;  3FRH A;  1I94 M;  4D82 A;  4RF0 A;  1WGL A;  4LF7 M;  4DV5 M;  3GO8 A;  4CIS A;  1Z5A A;  3T15 A;  1IY2 A;  4MGH A;  2DKL A;  3E46 A;  2QEN A;  2D7H A;  3GRY A;  4L78 A;  2C9C A;  3TL4 X;  3E9S A;  3W0L B;  4CHT B;  3C58 A;  1VQ1 A;  1K82 A;  2QBY A;  1LTM A;  1IQP A;  1DGB A;  2C96 A;  3VLF B;  1MX0 A;  3VDU A;  1QDR A;  4G4O A;  1PM5 A;  2XEP A;  2QHO B;  3B74 A;  4GEW A;  3TQS A;  3SYL A;  2K0B X;  4DV2 M;  3M7G A;  1QUS A;  2QP9 X;  3AOG A;  1S3S A;  2RKO A;  2XSZ A;  5FTJ A;  3L29 A;  2J7O A;  4IBI A;  2XZU A;  3U6P A;  2ZTC A;  5KO3 A;  4GHL A;  5KPT A;  4LJ6 A;  3GLH E;  3W67 A;  1XMQ M;  1GAB A;  1PJI A;  3U5Z B;  3KS4 A;  1GO5 A;  1DO2 A;  4ANR A;  3J2P B;  4NC6 A;  4MGI E;  2FOI C;  3B89 A;  5EXS A;  2XFS A;  3U6C A;  1PGY A;  4UN2 B;  4WW0 A;  1WR1 B;  1E94 E;  4IBD A;  3GLH B;  4OW0 A;  4G4N A;  2N35 A;  4DV6 M;  1JR3 D;  3EIH A;  3QWL A;  4QHS A;  5EXX A;  2APL A;  3LCU A;  3I01 M;  5FTN A;  3SFZ A;  3ZCB B;  4DR1 M;  1JR3 E;  1VDD A;  4JXJ A;  3SAT A;  3E21 A;  2H1R A;  4NXM M;  5KPR A;  2J5Y A;  2L7I A;  2VQF M;  2YFQ A;  1HNX M;  1Z59 A;  4DV0 M;  2XH9 A;  2R4J A;  1SXJ D;  5EJC A;  4B7F A;  4M9Z A;  4YHH M;  4LCB A;  5BR8 M;  3FKE A;  1HQY E;  4P17 A;  2R65 A;  4IBC A;  1XXH B;  1W5S A;  1XB2 B;  3HKP A;  4NRW A;  4QNR A;  1IM2 A;  2R6F A;  2VQE M;  2F5P A;  1ZQ9 A;  4JI8 M;  5DYI A;  5EP4 A;  2DXI A;  4DBG B;  5LMN M;  1SXJ B;  1QZM A;  4L4U A;  4MH0 E;  2BWE A;  3HHX A;  2DNA A;  2CE7 A;  3MJ5 A;  5JI2 E;  1GJS A;  1DGG A;  3RGS A;  3AOE A;  1G4A E;  3FUT A;  4I81 A;  2HKJ A;  1J7K A;  3SAV A;  4AG5 A;  2K6B A;  4LRS A;  4GC5 A;  1GLN A;  1Q02 A;  1J5E M;  2XLJ A;  1RU3 A;  2G3Q A;  1J09 A;  1Z6T A;  2DWZ B;  3UMM A;  4DUY M;  2WZJ A;  2ZAM A;  2XSZ D;  2JWS A;  4B3R M;  2Z8Y M;  3I4Y A;  3F92 A;  1VEG A;  1IY1 A;  3JR5 A;  2MH8 A;  4IBF A;  1YLA A;  5EXT A;  3MHV C;  2DAE A;  1H6U A;  1L1Z A;  3RFW A;  4LJ5 A;  3TWL A;  2ZM6 M;  1OAO C;  4REZ A;  3KDS E;  2E5L M;  2LWX A;  4MGK E;  1N32 M;  3H4J A;  2YR0 A;  5ITT A;  2O5R A;  4L6V 6;  5IWA M;  1UM8 A;  3ZH9 B;  4JI1 M;  4WUR A;  2CWB A;  1OFH A;  1MN3 A;  1T43 A;  2LHG A;  3A46 A;  4QNM A;  1UFZ A;  4HLQ A;  4IBB A;  3KOX E;  1OAI A;  2MR9 A;  2CFO A;  2C5R A;  2LVA A;  1JB0 F;  4OX9 M;  4RKU F;  5IT9 S;  2ZAN A;  1T3T A;  4LJ8 A;  3DFZ A;  1WXQ A;  4DV3 M;  2F5Q A;  3K8Z A;  1EE8 A;  5EP1 A;  2R4E A;  5KPZ A;  3Q8X A;  3KP1 E;  5H37 D;  3GLI B;  3T6P A;  2K9D A; 
#chains in the Genus database with same CATH homology
 3E46 A;  2DEN A;  1VQ1 A;  1G41 A;  2QSF X;  4R71 A;  1WGN A;  2LBC A;  2QHO B;  1XXH E;  4GEW A;  1TTE A;  5DFL A;  2K0B X;  4Q7J A;  2OOB A;  2DAM A;  1ZMW A;  2KNZ A;  2ZTC A;  2L4E A;  1BVS A;  3IEC A;  2MGW A;  2H5X A;  2KNA A;  3GLH E;  1ZMV A;  1GO5 A;  1DO2 A;  1KYI A;  2OOA A;  2MJ5 B;  2EKK A;  2HWJ A;  1WIV A;  3B89 A;  1PGY A;  4UN2 B;  1SG9 A;  2LTU A;  1TR8 A;  2LVP C;  1WR1 B;  1EFU B;  2JY8 A;  2LVO C;  4HEO A;  1E94 E;  3LCV B;  2JY5 A;  3FE3 A;  3GLF E;  3IHP A;  3LCU A;  2KNV A;  2BWB A;  1JR3 E;  2JZ0 A;  2JP7 A;  3E21 A;  1WJ7 A;  2KHH A;  2MRO B;  1IFY A;  1HJP A;  1A5T A;  1V92 A;  4F2L A;  3GLG E;  1IXS A;  1HQY E;  1Y8G A;  1HT1 E;  2B3T A;  3K9P A;  1R4G A;  1XB2 B;  2EJS A;  2JY7 A;  1IM2 A;  2R0I A;  1NV8 A;  1VEK A;  2K9D A;  4DBG B;  2JZ1 A;  1HT2 E;  1QZE A;  2BWE A;  1VDL A;  2DNA A;  2DZL A;  2OO9 A;  5JI2 E;  2JY6 B;  1VEJ A;  1G4A E;  3FRI A;  1CUK A;  2QNJ A;  1Q02 A;  2JNH A;  3GLI E;  2DAI A;  2G3Q A;  2CP8 A;  2DI0 A;  4WP2 A;  2LVQ D;  2EKF A;  1ZV1 A;  2WZJ A;  2DAG A;  1C7Y A;  1ZMU A;  1OTR A;  3F92 A;  2DAK A;  1VEG A;  2O25 A;  2L2D A;  2JUJ A;  1YLA A;  1VG5 A;  2DAE A;  1G3I A;  2LVN C;  1NV9 A;  1WHC A;  1F4I A;  4F1I A;  3H4J A;  3K9O A;  2ZTD A;  1P3Q Q;  1DV0 A;  1OKS A;  1OQY A;  2CWB A;  3BBZ A;  1MN3 A;  1T43 A;  4G3O A;  1UFZ A;  1AIP C;  1OAI A;  2MR9 A;  2RRU A;  2LVA A;  2DHY A;  1T6O A;  3FRH A;  2HAK A;  2L4F A;  3MMP A;  1WGL A;  1DO0 A;  3T6P A;  2DKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...