2DAKA

Solution structure of the second uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 63
sequence length 63
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dakA00
2DAEA 1JR3E 2KNZA 2MJ5B 4DBGB 1Y8GA 1QZEA 2JY5A 1OKSA 1UFZA 2EKFA 1VEGA 3GLFE 1WHCA 2KNAA 1SG9A 2JZ0A 4Q7JA 1WGNA 2QHOB 2BWBA 4WP2A 3GLGE 2DAMA 3IHPA 2DI0A 1XXHE 2LBCA 1E94E 2OOAA 3T6PA 4F2LA 3K9OA 2HWJA 2O25A 1TTEA 2KHHA 4F1IA 2L2DA 2EKKA 2RRUA 2LVAA 2JZ1A 1VDLA 1VEKA 4G3OA 2CP8A 2LTUA 1V92A 2H5XA 2JY7A 2DAKA 2WZJA 1XB2B 2JUJA 1NV8A 2JP7A 1T43A 1G41A 1G3IA 1T6OA 1ZV1A 3FE3A 4GEWA 1P3QQ 2QSFX 2ZTDA 2MR9A 1OTRA 2R0IA 1WGLA 2DKLA 2DHYA 1DV0A 1ZMUA 1OQYA 1BVSA 2LVNC 4R71A 2L4EA 3IECA 1PGYA 2L4FA 2CWBA 3K9PA 2B3TA 1CUKA 3MMPA 1IXSA 2MGWA 3B89A 2JNHA 2DNAA 3H4JA 1MN3A 2OO9A 1WJ7A 2EJSA 1C7YA 3E21A 1HQYE 1HT1E 2QNJA 1R4GA 3LCVB 1TR8A 2JY8A 2LVPC 2BWEA 2K9DA 2LVOC 2HAKA 1HJPA 1IFYA 1ZMWA 3F92A 1WR1B 4UN2B 1YLAA 2K0BX 3E46A 1G4AE 1AIPC 1Q02A 1F4IA 1DO2A 2JY6B 3FRIA 1IM2A 3GLHE 1WIVA 1A5TA 1OAIA 2ZTCA 1KYIA 2DAGA 2OOBA 3LCUA 1NV9A 2DENA 2MROB 1EFUB 3BBZA 1ZMVA 1VEJA 1GO5A 2DAIA 5DFLA 2G3QA 2LVQD 1HT2E 3FRHA 2DZLA 5JI2E 3GLIE 1DO0A 1VQ1A 4HEOA 2KNVA 1VG5A
chains in the Genus database with same CATH superfamily
3KS4A 4IBJA 1FJGM 1R2ZA 2UU9M 2CHVA 2DXIA 1JR3D 2C99A 1OKSA 1UFZA 1I94M 4LFCM 2VDBB 3ZH9B 4DUZM 3DOAA 3CGWA 1TH3A 1NHGC 4LF4M 3PNYA 4NSOB 5FSWA 3MJ5A 3SFZA 3B7ZA 5IZ7D 4DV5M 2CUZA 2J5YA 4OW0A 3DZDA 2Q2EB 1Z5CA 3R9XB 3NBXX 4JI2M 4DV4M 2DAMA 4LG2A 3ZCBB 3T6PA 3UMMA 2EUCA 2CRUA 4LCBA 3V76A 5C18A 7CATA 3RE8A 2YFQA 3I04M 1NY5A 1TTEA 2XSZA 4JI4M 2XFTA 2EKKA 2KXEA 3I51A 3J27B 3GLGB 1QYRA 2CV0A 2XH9A 4XK8F 4DR6M 3W0FA 1XXHB 3K1JA 4GKKM 2JZ1A 2ZAMA 3R8FA 1ZQ9A 4GC9A 1KFVA 4MGIE 1EIJA 1IN6A 2KEBA 2DVWB 4I8OA 5EJCA 1JQJC 2LTUA 3FTFA 2JY7A 2M5ZA 3L25A 4IBBA 3E4RA 1SXJE 1XB2B 5EP4A 3PFIA 3KP0E 2FS1A 4M0DA 2Z3XA 3AJIB 5F3WA 1G3IA 5EP1A 4G4NA 1T6OA 4CHTB 1ZV1A 3GLHA 2QSFX 3NWLA 2DZNB 4GHLA 4DV7M 2R0IA 5KQ8A 2R18A 2UUAM 4QOSA 3L26A 2DHYA 4X62M 4CISA 1OQYA 1T3TA 3GPPA 3FYCA 3J80S 4IBIA 3W67A 2NQ8C 4D80A 4CIZA 3IECA 3QWLA 4L6V6 2CWBA 4LJ6A 1CUKA 4P16A 3MMPA 4LRSA 5FTLA 2MGWA 5EXSA 1LTMA 4MB7A 4MM3B 4NXNM 1PJJA 4DR5M 1MN3A 4I81A 4Z6YA 3PXGA 4PCZA 5KPZA 3GRUA 4JI0M 2R44A 1XNRM 4PT5A 5FTNA 1HNZM 3GPYA 3EIHA 4IBCA 1Z59A 4OX9M 4B7HA 2LVOC 4JN6A 1HJPA 1IXRC 3AKZA 1EE8A 1IN5A 2C9OA 1QUSA 3U6DA 2F5NA 1IFYA 3F92A 2CE7A 2M60A 3AOEC 1GVNA 1WXQA 3B9PA 4FWDA 3L27A 3SMSA 3E46A 1G4AE 4WW0A 3GO8A 1F4IA 1IXZA 3HU1A 1L1TA 3MK6A 4FCVA 3U5ZA 2ZTCA 5E26A 2R4EA 2FH0A 3D8BA 5BR8M 1QUTA 1RU3A 2DAGA 3GRRA 3LCUA 3LQRA 3HJ8A 1QQWA 1D0LA 2V1UA 2R62A 4RNAA 5ITUA 1J7KA 1X37A 2DAIA 3FUXA 4G4OA 3VKGA 3GLHB 1D0MA 1PRBA 2O5RA 2QZ4A 4M9SA 4L15A 2J7NA 3SYKA 3A46A 2QBYA 5LMUM 5JI2E 3GLIE 2Y0TA 2R4JA 1I4WA 1Q39A 2X8AA 3SMPA 4NSRA 4JI5M 4HEOA 1K82A 3C3EA 2DAEA 2KNZA 4GIPA 1QAMA 1Y8GA 2BJVA 2JY5A 3SC3A 1UM8A 1SXJA 1XHBA 2FFJA 1NSFA 3SAWA 3K92A 4LRTA 4NRVA 2QPAA 3I4VA 5ITXA 4BLCA 1G59A 5KO3A 2G8LA 5DYGA 1TH4A 2LHCA 1XXHA 3GP1A 3LVVA 3QYBA 2CV1A 4B08A 2HL7A 3SYLA 4Q7JA 2F5PA 4B7FA 4LF7M 2BWBA 2D7EA 3TWLA 4WP2A 4QHTA 2KW0A 4LZZA 4BBAA 4CGYB 3HY5A 4AKGA 3IHPA 2DI0A 3DA1A 3SBJA 2LBCA 1SXJC 2OOAA 2Z8YM 4NOOB 1TH2A 3HX3A 3M7GA 2WSEF 1ORYB 1GJTA 2HCBA 2KHHA 3CF0A 3ZQJA 4R7GA 3GPXA 2L2DA 3SAUA 3U5ZB 2RRUA 1IN8A 2CHGA 2JXNA 4HLQA 2V1CA 2CFOA 2LVAA 4AG5A 4I5SA 2R46A 3U61A 1VEKA 1QDTA 4LGMA 4W5WA 3U6OA 4LZJA 1QZMA 1XWIA 4B7GA 4DV3M 1J09A 2H5XA 5DNYA 2QBYB 3VK7A 4BB9A 3WHLA 1YSYA 3QAUA 1NV8A 2JP7A 2Y20A 3K8ZA 3KDSE 4X64M 4B3RM 2KZUA 1QVRA 3Q8GA 1R2YA 5FTMA 1XNQM 4GEWA 2QCUA 4GHAA 2XF3A 3VDUA 4FD2A 1IBLM 1OTRA 1SXJB 4PD2A 3TL4X 4DV1M 3T1HM 1ZMUA 4X66M 5DYIA 1W5TA 3AL0C 2JA2A 1HNWM 3U6PA 4K0KM 4KO8A 1IN7A 5L8RF 3FKEA 1PGYA 3I01M 4IBGA 5EXXA 4DR3M 4REZA 5H37D 1IXSA 3GLIA 1QAQA 1PJIA 4LF6M 2KZSA 5C1BA 3MHVC 3U6QA 3HU3A 3QYEA 3TWKA 5GKNA 1N32M 2QNJA 1OJLA 5EXPA 4LJ4A 3FD9A 3U60A 3KS8A 1R4GA 3LCVB 2Z4RA 2LVPC 2BWEA 1GABA 1KSFX 3A98B 3UJNA 3SAVA 4LFBM 2YR0A 4GH9A 3ZC7B 1ZMWA 3T38A 3U61B 3FTCA 1H6UA 1L2DA 1WIVA 1Z6TA 1R7RA 4JI3M 3L28A 5KPRA 3AOEA 4IJFA 1Q3CA 4FWHA 2C9CA 1ZMVA 3J2PB 1GO5A 1GLNA 4KHPM 4RKUF 4GKJM 1GKIA 2L7IA 1OIPA 1NVMA 4QNRA 3KVWA 2DZLA 4DV0M 4R3DA 2Y0QA 3UZUA 4RF0A 4TUWA 2KNVA 4JXJA 1VG5A 5E6JA 2KRKA 3C9PA 1JR3E 4MGZE 2VQEM 1TDHA 4DBGB 3H4MA 2KRUA 4LY6A 3HZJA 3GRVA 3FUTA 2V6ZM 1JB0F 1MU5A 1G8PA 2Z4SA 1IXSB 3HGIA 3GLIB 2EKFA 4FCTA 4M0WA 4IBDA 3GLFE 1WHCA 2F5OA 2VIIA 4B3SM 3TWMA 4WURA 1NJFA 2CEAA 2DWLA 3GQ3A 4JI6M 1OFHA 4AKHA 3U6CA 3M0EA 1SG9A 2JZ0A 3U6MA 5ITRA 3E9SA 3U60B 1WGNA 2UXCM 2CHQA 2LXEA 2UXBM 2VQFM 2GNOA 1DGGA 2J7OA 1N33M 3IG8A 3J7AS 4F2LA 5EP2A 4XGIA 1IY0A 2D7GA 2ERCA 2ZAOA 4LJ5A 3J81S 2O25A 3D8LA 4F1IA 3KFUG 3RGPA 3HJQA 1MJGM 3GPUA 2DZOB 3IG5A 4IBEA 3TPZA 2R6FA 3M6AA 4M9XA 3VFDA 4LF5M 1IN4A 3GQ4A 4G3OA 3K2LA 2CP8A 1DGFA 4X65M 4DV6M 2C96A 1V92A 1FNNA 2L7HA 2P5TA 5EXTA 2WZJA 2LH0A 2JUJA 4IBKA 2XFSA 3HWSA 4MGYE 2K6BA 1HQCA 1K3XA 1SXJD 1T43A 2F5SA 3FTEA 1Z5BA 1TF0B 2OPFA 2C5RA 4L8RC 1P3QQ 1IBKM 2LWXA 1N75A 3CTWB 1WGLA 2UXDM 3Q8XA 1L1ZA 3KOZE 2JWSA 2LVNC 4DUYM 4R71A 2YQZA 2L4EA 2H1RA 2XZUA 4FW9A 1V34A 4XBOA 3KXEC 2L4FA 3K9PA 1DGBA 5ITYA 4AG6A 2FOIC 4MGKE 3RFWA 4M9ZA 3TQSA 4G6ZA 3U6EA 4LJ9A 2JNHA 2DNAA 3H4JA 2Y21A 2RGHA 1NNUC 2OO9A 3HU2A 1WJ7A 5JI3E 1W5SA 2XGNA 1QDRA 5IREB 1XMQM 2ZANA 3HHZA 2ZBKB 1JR3A 4GMQA 1NNJA 3A42A 1DGHA 1PJTA 1HQYE 3E21A 4FWGA 1IBMM 3L2AA 8CATA 2HHHM 1TR8A 2JY8A 3B7QA 3SHFA 3AOGA 2K9DA 3GLFA 1NY6A 5KPTA 4JI8M 2AHMA 2G5GX 4L78A 3T15A 3LVWA 3KSJA 1YLAA 5FTJA 1AUAA 1YE9A 1AIPC 1Q02A 1DO2A 2MH8A 3KOXE 4D81A 4DR2M 2KDLA 1A5TA 1OAIA 1KYIA 3U6SA 2I7NA 2RKOA 4B3MM 2OOBA 4DV2M 2F5QA 2D7HA 3KSXA 1MX0A 1EFUB 2MROB 5EQTA 3AV0A 4KT0F 2LNHC 3KOYE 2HKJA 2XSZD 3CF6E 5ITQA 4LJ8A 2QP9X 5DFLA 2G3QA 2APLA 3BOSA 2LVQD 3BXWA 4LGYA 3UK6A 2WSFF 1DO0A 3RGSA 2ZM6M 1VQ1A 4QHSA 4YY3M 2QENA 4JI7M 1PJQA 2MJ5B 1Q3BA 4S12A 1QZEA 1LV7A 1PM5A 3VLFB 1C1KA 1N36M 1J5EM 4LJAA 2YNMD 4L16A 1V33A 4A3VB 4G4RA 2E5LM 1TDZA 3U6LA 2CV2A 1VEGA 1D2NA 1IQPA 2KA6B 3OTOM 4P17A 3VKHA 2W82A 3JR4A 3LW5F 1OIZA 2XLJA 1DGHB 3PVSA 1E9SA 1GL7A 2KNAA 3KOWE 4D82A 4LF8M 4GITA 2QHOB 5A2QS 1L2CA 2LHGA 5ITXE 3NBIA 3GLFB 3GLGE 1E32A 4AI6A 1XXHE 1E94E 1PJSA 2L09A 2X4AA 3I4YA 4ZPXA 3PNVA 1S3SA 3K9OA 4FVMA 1NHWC 2HWJA 3A45A 4QNMA 1YUBA 4OVZA 4EIWA 2OQ4A 4KLNA 1K3WA 1HR0M 4MGHA 2Z7JA 2F4VM 3JAMS 4GRIA 4NC6A 3LMMA 3T1YM 4DR7M 1VDLA 3KP1E 4NRWA 4QOZC 3EIEA 2QQ8A 3FYDA 1G71A 1C7YA 4L4UA 1QANA 4ITQA 4IIWA 5BPVA 2DAKA 1VDDA 3J7BA 2UUBM 4FCWA 5LMNM 3HHYA 4JI1M 2EO2A 2FNAA 3HJSA 4PDGA 4NXMM 1G41A 5IWAM 1ZAEA 2R65A 1HNXM 4GC5A 4AW4A 1N77A 3FE3A 2A5YB 3GRYA 3B74A 4I4LA 1XMOM 2VF7A 1D0KA 5KQDA 4AKIA 2ZTDA 2BNKA 3W68A 2MR9A 4YHHM 2DKLA 3VK8A 1DV0A 3FTDA 1BVSA 1OAOC 2VF8A 3SATA 4MH0E 1XC8A 3SASA 3CF2A 2WSCF 2BJWA 2RGOA 4LFAM 4AQYM 2DWMA 3FUWA 5EP3A 2B3TA 2X49A 5IT9S 1N34M 2O01F 3ILKA 3B89A 4RF1A 3SHGB 3TE6A 1TGUA 2UUCM 3C3DA 3HKPA 2EJSA 3FUUA 4II7A 4LJ7A 4Y28F 3WHKA 3FUVA 4LF9M 2DWNA 4DR1M 1HT1E 3B7NA 1OFIA 1IY2A 4OU7A 4OVZB 2EA0A 2HAKA 1Z5AA 3HHWA 3HHXA 4CJ6A 4IBFA 4Z8XA 5ITTA 1WR1B 4UN2B 1GL6A 1R5LA 3L29A 2K0BX 1L2BA 2R45A 2I7PA 2JY6B 4NL4H 3AFHA 3FRIA 3GQ5A 1IM2A 3GLHE 1NJGA 4ANRA 4PDIA 3GLGA 2FE8A 2XEPA 3UGJA 3DFZA 4IJEA 2L6OA 3SARA 4JV5M 1NV9A 2DENA 1E9RA 3BBZA 4KODA 4G4QA 1R6BX 3LQQA 4DR4M 4B3TM 1GJSA 1VEJA 4AZFA 3C58A 4JYAM 1NO1A 3W0LB 2XZFA 2GQFA 1QAOA 2C98A 2N35A 1HT2E 3FRHA 3THGA 1IY1A 2K47A 4HL4A 3JR5A 3VDPA 3KW6A 5FLXS 2DHRA 1N78A 2DWZB 5FTKA 1L8QA
chains in the Genus database with same CATH topology
2DAEA 1JR3E 2KNZA 2MJ5B 4DBGB 1Y8GA 1QZEA 2JY5A 1OKSA 1UFZA 2EKFA 1VEGA 3GLFE 1WHCA 2KNAA 1SG9A 2JZ0A 4Q7JA 1WGNA 2QHOB 2BWBA 4WP2A 3GLGE 2DAMA 3IHPA 2DI0A 1XXHE 2LBCA 1E94E 2OOAA 3T6PA 4F2LA 3K9OA 2HWJA 2O25A 1TTEA 2KHHA 4F1IA 2L2DA 2EKKA 2RRUA 2LVAA 2JZ1A 1VDLA 1VEKA 4G3OA 2CP8A 2LTUA 1V92A 2H5XA 2JY7A 2DAKA 2WZJA 1XB2B 2JUJA 1NV8A 2JP7A 1T43A 1G41A 1G3IA 1T6OA 1ZV1A 3FE3A 4GEWA 1P3QQ 2QSFX 2ZTDA 2MR9A 1OTRA 2R0IA 1WGLA 2DKLA 2DHYA 1DV0A 1ZMUA 1OQYA 1BVSA 2LVNC 4R71A 2L4EA 3IECA 1PGYA 2L4FA 2CWBA 3K9PA 2B3TA 1CUKA 3MMPA 1IXSA 2MGWA 3B89A 2JNHA 2DNAA 3H4JA 1MN3A 2OO9A 1WJ7A 2EJSA 1C7YA 3E21A 1HQYE 1HT1E 2QNJA 1R4GA 3LCVB 1TR8A 2JY8A 2LVPC 2BWEA 2K9DA 2LVOC 2HAKA 1HJPA 1IFYA 1ZMWA 3F92A 1WR1B 4UN2B 1YLAA 2K0BX 3E46A 1G4AE 1AIPC 1Q02A 1F4IA 1DO2A 2JY6B 3FRIA 1IM2A 3GLHE 1WIVA 1A5TA 1OAIA 2ZTCA 1KYIA 2DAGA 2OOBA 3LCUA 1NV9A 2DENA 2MROB 1EFUB 3BBZA 1ZMVA 1VEJA 1GO5A 2DAIA 5DFLA 2G3QA 2LVQD 1HT2E 3FRHA 2DZLA 5JI2E 3GLIE 1DO0A 1VQ1A 4HEOA 2KNVA 1VG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAE A;  1JR3 E;  2KNZ A;  2MJ5 B;  4DBG B;  1Y8G A;  1QZE A;  2JY5 A;  1OKS A;  1UFZ A;  2EKF A;  1VEG A;  3GLF E;  1WHC A;  2KNA A;  1SG9 A;  2JZ0 A;  4Q7J A;  1WGN A;  2QHO B;  2BWB A;  4WP2 A;  3GLG E;  2DAM A;  3IHP A;  2DI0 A;  1XXH E;  2LBC A;  1E94 E;  2OOA A;  3T6P A;  4F2L A;  3K9O A;  2HWJ A;  2O25 A;  1TTE A;  2KHH A;  4F1I A;  2L2D A;  2EKK A;  2RRU A;  2LVA A;  2JZ1 A;  1VDL A;  1VEK A;  4G3O A;  2CP8 A;  2LTU A;  1V92 A;  2H5X A;  2JY7 A;  2DAK A;  2WZJ A;  1XB2 B;  2JUJ A;  1NV8 A;  2JP7 A;  1T43 A;  1G41 A;  1G3I A;  1T6O A;  1ZV1 A;  3FE3 A;  4GEW A;  1P3Q Q;  2QSF X;  2ZTD A;  2MR9 A;  1OTR A;  2R0I A;  1WGL A;  2DKL A;  2DHY A;  1DV0 A;  1ZMU A;  1OQY A;  1BVS A;  2LVN C;  4R71 A;  2L4E A;  3IEC A;  1PGY A;  2L4F A;  2CWB A;  3K9P A;  2B3T A;  1CUK A;  3MMP A;  1IXS A;  2MGW A;  3B89 A;  2JNH A;  2DNA A;  3H4J A;  1MN3 A;  2OO9 A;  1WJ7 A;  2EJS A;  1C7Y A;  3E21 A;  1HQY E;  1HT1 E;  2QNJ A;  1R4G A;  3LCV B;  1TR8 A;  2JY8 A;  2LVP C;  2BWE A;  2K9D A;  2LVO C;  2HAK A;  1HJP A;  1IFY A;  1ZMW A;  3F92 A;  1WR1 B;  4UN2 B;  1YLA A;  2K0B X;  3E46 A;  1G4A E;  1AIP C;  1Q02 A;  1F4I A;  1DO2 A;  2JY6 B;  3FRI A;  1IM2 A;  3GLH E;  1WIV A;  1A5T A;  1OAI A;  2ZTC A;  1KYI A;  2DAG A;  2OOB A;  3LCU A;  1NV9 A;  2DEN A;  2MRO B;  1EFU B;  3BBZ A;  1ZMV A;  1VEJ A;  1GO5 A;  2DAI A;  5DFL A;  2G3Q A;  2LVQ D;  1HT2 E;  3FRH A;  2DZL A;  5JI2 E;  3GLI E;  1DO0 A;  1VQ1 A;  4HEO A;  2KNV A;  1VG5 A; 
#chains in the Genus database with same CATH topology
 3KS4 A;  4IBJ A;  1FJG M;  1R2Z A;  2UU9 M;  2CHV A;  2DXI A;  1JR3 D;  2C99 A;  1OKS A;  1UFZ A;  1I94 M;  4LFC M;  2VDB B;  3ZH9 B;  4DUZ M;  3DOA A;  3CGW A;  1TH3 A;  1NHG C;  4LF4 M;  3PNY A;  4NSO B;  5FSW A;  3MJ5 A;  3SFZ A;  3B7Z A;  5IZ7 D;  4DV5 M;  2CUZ A;  2J5Y A;  4OW0 A;  3DZD A;  2Q2E B;  1Z5C A;  3R9X B;  3NBX X;  4JI2 M;  4DV4 M;  2DAM A;  4LG2 A;  3ZCB B;  3T6P A;  3UMM A;  2EUC A;  2CRU A;  4LCB A;  3V76 A;  5C18 A;  7CAT A;  3RE8 A;  2YFQ A;  3I04 M;  1NY5 A;  1TTE A;  2XSZ A;  4JI4 M;  2XFT A;  2EKK A;  2KXE A;  3I51 A;  3J27 B;  3GLG B;  1QYR A;  2CV0 A;  2XH9 A;  4XK8 F;  4DR6 M;  3W0F A;  1XXH B;  3K1J A;  4GKK M;  2JZ1 A;  2ZAM A;  3R8F A;  1ZQ9 A;  4GC9 A;  1KFV A;  4MGI E;  1EIJ A;  1IN6 A;  2KEB A;  2DVW B;  4I8O A;  5EJC A;  1JQJ C;  2LTU A;  3FTF A;  2JY7 A;  2M5Z A;  3L25 A;  4IBB A;  3E4R A;  1SXJ E;  1XB2 B;  5EP4 A;  3PFI A;  3KP0 E;  2FS1 A;  4M0D A;  2Z3X A;  3AJI B;  5F3W A;  1G3I A;  5EP1 A;  4G4N A;  1T6O A;  4CHT B;  1ZV1 A;  3GLH A;  2QSF X;  3NWL A;  2DZN B;  4GHL A;  4DV7 M;  2R0I A;  5KQ8 A;  2R18 A;  2UUA M;  4QOS A;  3L26 A;  2DHY A;  4X62 M;  4CIS A;  1OQY A;  1T3T A;  3GPP A;  3FYC A;  3J80 S;  4IBI A;  3W67 A;  2NQ8 C;  4D80 A;  4CIZ A;  3IEC A;  3QWL A;  4L6V 6;  2CWB A;  4LJ6 A;  1CUK A;  4P16 A;  3MMP A;  4LRS A;  5FTL A;  2MGW A;  5EXS A;  1LTM A;  4MB7 A;  4MM3 B;  4NXN M;  1PJJ A;  4DR5 M;  1MN3 A;  4I81 A;  4Z6Y A;  3PXG A;  4PCZ A;  5KPZ A;  3GRU A;  4JI0 M;  2R44 A;  1XNR M;  4PT5 A;  5FTN A;  1HNZ M;  3GPY A;  3EIH A;  4IBC A;  1Z59 A;  4OX9 M;  4B7H A;  2LVO C;  4JN6 A;  1HJP A;  1IXR C;  3AKZ A;  1EE8 A;  1IN5 A;  2C9O A;  1QUS A;  3U6D A;  2F5N A;  1IFY A;  3F92 A;  2CE7 A;  2M60 A;  3AOE C;  1GVN A;  1WXQ A;  3B9P A;  4FWD A;  3L27 A;  3SMS A;  3E46 A;  1G4A E;  4WW0 A;  3GO8 A;  1F4I A;  1IXZ A;  3HU1 A;  1L1T A;  3MK6 A;  4FCV A;  3U5Z A;  2ZTC A;  5E26 A;  2R4E A;  2FH0 A;  3D8B A;  5BR8 M;  1QUT A;  1RU3 A;  2DAG A;  3GRR A;  3LCU A;  3LQR A;  3HJ8 A;  1QQW A;  1D0L A;  2V1U A;  2R62 A;  4RNA A;  5ITU A;  1J7K A;  1X37 A;  2DAI A;  3FUX A;  4G4O A;  3VKG A;  3GLH B;  1D0M A;  1PRB A;  2O5R A;  2QZ4 A;  4M9S A;  4L15 A;  2J7N A;  3SYK A;  3A46 A;  2QBY A;  5LMU M;  5JI2 E;  3GLI E;  2Y0T A;  2R4J A;  1I4W A;  1Q39 A;  2X8A A;  3SMP A;  4NSR A;  4JI5 M;  4HEO A;  1K82 A;  3C3E A;  2DAE A;  2KNZ A;  4GIP A;  1QAM A;  1Y8G A;  2BJV A;  2JY5 A;  3SC3 A;  1UM8 A;  1SXJ A;  1XHB A;  2FFJ A;  1NSF A;  3SAW A;  3K92 A;  4LRT A;  4NRV A;  2QPA A;  3I4V A;  5ITX A;  4BLC A;  1G59 A;  5KO3 A;  2G8L A;  5DYG A;  1TH4 A;  2LHC A;  1XXH A;  3GP1 A;  3LVV A;  3QYB A;  2CV1 A;  4B08 A;  2HL7 A;  3SYL A;  4Q7J A;  2F5P A;  4B7F A;  4LF7 M;  2BWB A;  2D7E A;  3TWL A;  4WP2 A;  4QHT A;  2KW0 A;  4LZZ A;  4BBA A;  4CGY B;  3HY5 A;  4AKG A;  3IHP A;  2DI0 A;  3DA1 A;  3SBJ A;  2LBC A;  1SXJ C;  2OOA A;  2Z8Y M;  4NOO B;  1TH2 A;  3HX3 A;  3M7G A;  2WSE F;  1ORY B;  1GJT A;  2HCB A;  2KHH A;  3CF0 A;  3ZQJ A;  4R7G A;  3GPX A;  2L2D A;  3SAU A;  3U5Z B;  2RRU A;  1IN8 A;  2CHG A;  2JXN A;  4HLQ A;  2V1C A;  2CFO A;  2LVA A;  4AG5 A;  4I5S A;  2R46 A;  3U61 A;  1VEK A;  1QDT A;  4LGM A;  4W5W A;  3U6O A;  4LZJ A;  1QZM A;  1XWI A;  4B7G A;  4DV3 M;  1J09 A;  2H5X A;  5DNY A;  2QBY B;  3VK7 A;  4BB9 A;  3WHL A;  1YSY A;  3QAU A;  1NV8 A;  2JP7 A;  2Y20 A;  3K8Z A;  3KDS E;  4X64 M;  4B3R M;  2KZU A;  1QVR A;  3Q8G A;  1R2Y A;  5FTM A;  1XNQ M;  4GEW A;  2QCU A;  4GHA A;  2XF3 A;  3VDU A;  4FD2 A;  1IBL M;  1OTR A;  1SXJ B;  4PD2 A;  3TL4 X;  4DV1 M;  3T1H M;  1ZMU A;  4X66 M;  5DYI A;  1W5T A;  3AL0 C;  2JA2 A;  1HNW M;  3U6P A;  4K0K M;  4KO8 A;  1IN7 A;  5L8R F;  3FKE A;  1PGY A;  3I01 M;  4IBG A;  5EXX A;  4DR3 M;  4REZ A;  5H37 D;  1IXS A;  3GLI A;  1QAQ A;  1PJI A;  4LF6 M;  2KZS A;  5C1B A;  3MHV C;  3U6Q A;  3HU3 A;  3QYE A;  3TWK A;  5GKN A;  1N32 M;  2QNJ A;  1OJL A;  5EXP A;  4LJ4 A;  3FD9 A;  3U60 A;  3KS8 A;  1R4G A;  3LCV B;  2Z4R A;  2LVP C;  2BWE A;  1GAB A;  1KSF X;  3A98 B;  3UJN A;  3SAV A;  4LFB M;  2YR0 A;  4GH9 A;  3ZC7 B;  1ZMW A;  3T38 A;  3U61 B;  3FTC A;  1H6U A;  1L2D A;  1WIV A;  1Z6T A;  1R7R A;  4JI3 M;  3L28 A;  5KPR A;  3AOE A;  4IJF A;  1Q3C A;  4FWH A;  2C9C A;  1ZMV A;  3J2P B;  1GO5 A;  1GLN A;  4KHP M;  4RKU F;  4GKJ M;  1GKI A;  2L7I A;  1OIP A;  1NVM A;  4QNR A;  3KVW A;  2DZL A;  4DV0 M;  4R3D A;  2Y0Q A;  3UZU A;  4RF0 A;  4TUW A;  2KNV A;  4JXJ A;  1VG5 A;  5E6J A;  2KRK A;  3C9P A;  1JR3 E;  4MGZ E;  2VQE M;  1TDH A;  4DBG B;  3H4M A;  2KRU A;  4LY6 A;  3HZJ A;  3GRV A;  3FUT A;  2V6Z M;  1JB0 F;  1MU5 A;  1G8P A;  2Z4S A;  1IXS B;  3HGI A;  3GLI B;  2EKF A;  4FCT A;  4M0W A;  4IBD A;  3GLF E;  1WHC A;  2F5O A;  2VII A;  4B3S M;  3TWM A;  4WUR A;  1NJF A;  2CEA A;  2DWL A;  3GQ3 A;  4JI6 M;  1OFH A;  4AKH A;  3U6C A;  3M0E A;  1SG9 A;  2JZ0 A;  3U6M A;  5ITR A;  3E9S A;  3U60 B;  1WGN A;  2UXC M;  2CHQ A;  2LXE A;  2UXB M;  2VQF M;  2GNO A;  1DGG A;  2J7O A;  1N33 M;  3IG8 A;  3J7A S;  4F2L A;  5EP2 A;  4XGI A;  1IY0 A;  2D7G A;  2ERC A;  2ZAO A;  4LJ5 A;  3J81 S;  2O25 A;  3D8L A;  4F1I A;  3KFU G;  3RGP A;  3HJQ A;  1MJG M;  3GPU A;  2DZO B;  3IG5 A;  4IBE A;  3TPZ A;  2R6F A;  3M6A A;  4M9X A;  3VFD A;  4LF5 M;  1IN4 A;  3GQ4 A;  4G3O A;  3K2L A;  2CP8 A;  1DGF A;  4X65 M;  4DV6 M;  2C96 A;  1V92 A;  1FNN A;  2L7H A;  2P5T A;  5EXT A;  2WZJ A;  2LH0 A;  2JUJ A;  4IBK A;  2XFS A;  3HWS A;  4MGY E;  2K6B A;  1HQC A;  1K3X A;  1SXJ D;  1T43 A;  2F5S A;  3FTE A;  1Z5B A;  1TF0 B;  2OPF A;  2C5R A;  4L8R C;  1P3Q Q;  1IBK M;  2LWX A;  1N75 A;  3CTW B;  1WGL A;  2UXD M;  3Q8X A;  1L1Z A;  3KOZ E;  2JWS A;  2LVN C;  4DUY M;  4R71 A;  2YQZ A;  2L4E A;  2H1R A;  2XZU A;  4FW9 A;  1V34 A;  4XBO A;  3KXE C;  2L4F A;  3K9P A;  1DGB A;  5ITY A;  4AG6 A;  2FOI C;  4MGK E;  3RFW A;  4M9Z A;  3TQS A;  4G6Z A;  3U6E A;  4LJ9 A;  2JNH A;  2DNA A;  3H4J A;  2Y21 A;  2RGH A;  1NNU C;  2OO9 A;  3HU2 A;  1WJ7 A;  5JI3 E;  1W5S A;  2XGN A;  1QDR A;  5IRE B;  1XMQ M;  2ZAN A;  3HHZ A;  2ZBK B;  1JR3 A;  4GMQ A;  1NNJ A;  3A42 A;  1DGH A;  1PJT A;  1HQY E;  3E21 A;  4FWG A;  1IBM M;  3L2A A;  8CAT A;  2HHH M;  1TR8 A;  2JY8 A;  3B7Q A;  3SHF A;  3AOG A;  2K9D A;  3GLF A;  1NY6 A;  5KPT A;  4JI8 M;  2AHM A;  2G5G X;  4L78 A;  3T15 A;  3LVW A;  3KSJ A;  1YLA A;  5FTJ A;  1AUA A;  1YE9 A;  1AIP C;  1Q02 A;  1DO2 A;  2MH8 A;  3KOX E;  4D81 A;  4DR2 M;  2KDL A;  1A5T A;  1OAI A;  1KYI A;  3U6S A;  2I7N A;  2RKO A;  4B3M M;  2OOB A;  4DV2 M;  2F5Q A;  2D7H A;  3KSX A;  1MX0 A;  1EFU B;  2MRO B;  5EQT A;  3AV0 A;  4KT0 F;  2LNH C;  3KOY E;  2HKJ A;  2XSZ D;  3CF6 E;  5ITQ A;  4LJ8 A;  2QP9 X;  5DFL A;  2G3Q A;  2APL A;  3BOS A;  2LVQ D;  3BXW A;  4LGY A;  3UK6 A;  2WSF F;  1DO0 A;  3RGS A;  2ZM6 M;  1VQ1 A;  4QHS A;  4YY3 M;  2QEN A;  4JI7 M;  1PJQ A;  2MJ5 B;  1Q3B A;  4S12 A;  1QZE A;  1LV7 A;  1PM5 A;  3VLF B;  1C1K A;  1N36 M;  1J5E M;  4LJA A;  2YNM D;  4L16 A;  1V33 A;  4A3V B;  4G4R A;  2E5L M;  1TDZ A;  3U6L A;  2CV2 A;  1VEG A;  1D2N A;  1IQP A;  2KA6 B;  3OTO M;  4P17 A;  3VKH A;  2W82 A;  3JR4 A;  3LW5 F;  1OIZ A;  2XLJ A;  1DGH B;  3PVS A;  1E9S A;  1GL7 A;  2KNA A;  3KOW E;  4D82 A;  4LF8 M;  4GIT A;  2QHO B;  5A2Q S;  1L2C A;  2LHG A;  5ITX E;  3NBI A;  3GLF B;  3GLG E;  1E32 A;  4AI6 A;  1XXH E;  1E94 E;  1PJS A;  2L09 A;  2X4A A;  3I4Y A;  4ZPX A;  3PNV A;  1S3S A;  3K9O A;  4FVM A;  1NHW C;  2HWJ A;  3A45 A;  4QNM A;  1YUB A;  4OVZ A;  4EIW A;  2OQ4 A;  4KLN A;  1K3W A;  1HR0 M;  4MGH A;  2Z7J A;  2F4V M;  3JAM S;  4GRI A;  4NC6 A;  3LMM A;  3T1Y M;  4DR7 M;  1VDL A;  3KP1 E;  4NRW A;  4QOZ C;  3EIE A;  2QQ8 A;  3FYD A;  1G71 A;  1C7Y A;  4L4U A;  1QAN A;  4ITQ A;  4IIW A;  5BPV A;  2DAK A;  1VDD A;  3J7B A;  2UUB M;  4FCW A;  5LMN M;  3HHY A;  4JI1 M;  2EO2 A;  2FNA A;  3HJS A;  4PDG A;  4NXM M;  1G41 A;  5IWA M;  1ZAE A;  2R65 A;  1HNX M;  4GC5 A;  4AW4 A;  1N77 A;  3FE3 A;  2A5Y B;  3GRY A;  3B74 A;  4I4L A;  1XMO M;  2VF7 A;  1D0K A;  5KQD A;  4AKI A;  2ZTD A;  2BNK A;  3W68 A;  2MR9 A;  4YHH M;  2DKL A;  3VK8 A;  1DV0 A;  3FTD A;  1BVS A;  1OAO C;  2VF8 A;  3SAT A;  4MH0 E;  1XC8 A;  3SAS A;  3CF2 A;  2WSC F;  2BJW A;  2RGO A;  4LFA M;  4AQY M;  2DWM A;  3FUW A;  5EP3 A;  2B3T A;  2X49 A;  5IT9 S;  1N34 M;  2O01 F;  3ILK A;  3B89 A;  4RF1 A;  3SHG B;  3TE6 A;  1TGU A;  2UUC M;  3C3D A;  3HKP A;  2EJS A;  3FUU A;  4II7 A;  4LJ7 A;  4Y28 F;  3WHK A;  3FUV A;  4LF9 M;  2DWN A;  4DR1 M;  1HT1 E;  3B7N A;  1OFI A;  1IY2 A;  4OU7 A;  4OVZ B;  2EA0 A;  2HAK A;  1Z5A A;  3HHW A;  3HHX A;  4CJ6 A;  4IBF A;  4Z8X A;  5ITT A;  1WR1 B;  4UN2 B;  1GL6 A;  1R5L A;  3L29 A;  2K0B X;  1L2B A;  2R45 A;  2I7P A;  2JY6 B;  4NL4 H;  3AFH A;  3FRI A;  3GQ5 A;  1IM2 A;  3GLH E;  1NJG A;  4ANR A;  4PDI A;  3GLG A;  2FE8 A;  2XEP A;  3UGJ A;  3DFZ A;  4IJE A;  2L6O A;  3SAR A;  4JV5 M;  1NV9 A;  2DEN A;  1E9R A;  3BBZ A;  4KOD A;  4G4Q A;  1R6B X;  3LQQ A;  4DR4 M;  4B3T M;  1GJS A;  1VEJ A;  4AZF A;  3C58 A;  4JYA M;  1NO1 A;  3W0L B;  2XZF A;  2GQF A;  1QAO A;  2C98 A;  2N35 A;  1HT2 E;  3FRH A;  3THG A;  1IY1 A;  2K47 A;  4HL4 A;  3JR5 A;  3VDP A;  3KW6 A;  5FLX S;  2DHR A;  1N78 A;  2DWZ B;  5FTK A;  1L8Q A; 
#chains in the Genus database with same CATH homology
 2DAE A;  1JR3 E;  2KNZ A;  2MJ5 B;  4DBG B;  1Y8G A;  1QZE A;  2JY5 A;  1OKS A;  1UFZ A;  2EKF A;  1VEG A;  3GLF E;  1WHC A;  2KNA A;  1SG9 A;  2JZ0 A;  4Q7J A;  1WGN A;  2QHO B;  2BWB A;  4WP2 A;  3GLG E;  2DAM A;  3IHP A;  2DI0 A;  1XXH E;  2LBC A;  1E94 E;  2OOA A;  3T6P A;  4F2L A;  3K9O A;  2HWJ A;  2O25 A;  1TTE A;  2KHH A;  4F1I A;  2L2D A;  2EKK A;  2RRU A;  2LVA A;  2JZ1 A;  1VDL A;  1VEK A;  4G3O A;  2CP8 A;  2LTU A;  1V92 A;  2H5X A;  2JY7 A;  2DAK A;  2WZJ A;  1XB2 B;  2JUJ A;  1NV8 A;  2JP7 A;  1T43 A;  1G41 A;  1G3I A;  1T6O A;  1ZV1 A;  3FE3 A;  4GEW A;  1P3Q Q;  2QSF X;  2ZTD A;  2MR9 A;  1OTR A;  2R0I A;  1WGL A;  2DKL A;  2DHY A;  1DV0 A;  1ZMU A;  1OQY A;  1BVS A;  2LVN C;  4R71 A;  2L4E A;  3IEC A;  1PGY A;  2L4F A;  2CWB A;  3K9P A;  2B3T A;  1CUK A;  3MMP A;  1IXS A;  2MGW A;  3B89 A;  2JNH A;  2DNA A;  3H4J A;  1MN3 A;  2OO9 A;  1WJ7 A;  2EJS A;  1C7Y A;  3E21 A;  1HQY E;  1HT1 E;  2QNJ A;  1R4G A;  3LCV B;  1TR8 A;  2JY8 A;  2LVP C;  2BWE A;  2K9D A;  2LVO C;  2HAK A;  1HJP A;  1IFY A;  1ZMW A;  3F92 A;  1WR1 B;  4UN2 B;  1YLA A;  2K0B X;  3E46 A;  1G4A E;  1AIP C;  1Q02 A;  1F4I A;  1DO2 A;  2JY6 B;  3FRI A;  1IM2 A;  3GLH E;  1WIV A;  1A5T A;  1OAI A;  2ZTC A;  1KYI A;  2DAG A;  2OOB A;  3LCU A;  1NV9 A;  2DEN A;  2MRO B;  1EFU B;  3BBZ A;  1ZMV A;  1VEJ A;  1GO5 A;  2DAI A;  5DFL A;  2G3Q A;  2LVQ D;  1HT2 E;  3FRH A;  2DZL A;  5JI2 E;  3GLI E;  1DO0 A;  1VQ1 A;  4HEO A;  2KNV A;  1VG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...