2DAKA

Solution structure of the second uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
total genus 16
structure length 63
sequence length 63
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dakA00
1QZEA 4GEWA 4UN2B 2DZLA 2DAIA 2HAKA 3E21A 2JZ1A 2DAGA 1HQYE 2K9DA 2LVQD 2O25A 1CUKA 2KHHA 2DENA 2OO9A 3FE3A 1ZMUA 1TR8A 1MN3A 1JR3E 2JY7A 1Q02A 1SG9A 4HEOA 3H4JA 2JUJA 3GLIE 1C7YA 5DFLA 3T6PA 1YLAA 1T43A 1P3QQ 1VQ1A 1BVSA 4WP2A 3FRIA 2DKLA 2EKFA 1G41A 1V92A 1A5TA 1R4GA 1NV9A 3K9PA 2K0BX 1OAIA 3IHPA 1HT1E 3E46A 1VEJA 1WIVA 1HT2E 1XXHE 2BWBA 4DBGB 1VEGA 1DO0A 2QSFX 1AIPC 1IM2A 2LVNC 1DO2A 1OTRA 1XB2B 2MJ5B 2EKKA 3F92A 4G3OA 2JY6B 1TTEA 4F2LA 1E94E 1UFZA 2LVOC 2B3TA 2L4FA 2OOAA 1EFUB 1PGYA 2QNJA 2MGWA 2R0IA 2ZTDA 1DV0A 2WZJA 2LVPC 2OOBA 3B89A 3BBZA 3FRHA 2KNVA 4Q7JA 1IXSA 1NV8A 1KYIA 1IFYA 4F1IA 2DHYA 2CWBA 3GLGE 2BWEA 2EJSA 1WR1B 1WJ7A 1ZV1A 2KNAA 3MMPA 2JP7A 1HJPA 2CP8A 2DAKA 3GLHE 5JI2E 3GLFE 2LVAA 3LCUA 1Y8GA 2RRUA 1WHCA 1F4IA 1ZMVA 2G3QA 2JY8A 3IECA 2JZ0A 1WGNA 1G4AE 2QHOB 2MR9A 2MROB 1GO5A 1OKSA 2LBCA 2DAEA 2ZTCA 1VG5A 1T6OA 2JY5A 2LTUA 4R71A 1G3IA 2DAMA 2JNHA 1OQYA 1ZMWA 3LCVB 2KNZA 1VDLA 1VEKA 2L2DA 2DNAA 1WGLA 3K9OA 2HWJA 2L4EA 2DI0A 2H5XA
chains in the Genus database with same CATH superfamily
1NVMA 1QZEA 3FYCA 1YSYA 4LRTA 3AOEC 3CF2A 4LFBM 4II7A 2DAIA 4L15A 4QOSA 4IIWA 2CV2A 4ITQA 3E21A 2LHCA 2EO2A 1IBLM 5C18A 2F5NA 3B7ZA 5FSWA 2K9DA 1S3SA 1V34A 4DR3M 3GLIA 4LCBA 2R44A 3FE3A 4DV4M 2FNAA 1QAOA 2X49A 1IN8A 4I4LA 5EP1A 2C9OA 2ZBKB 4JI7M 3FKEA 2CUZA 4DR6M 2Y0QA 4TUWA 2K6BA 4QOZC 8CATA 4P16A 1QDTA 3EIHA 4LJ4A 4DV7M 1C7YA 1LTMA 2BJVA 2M60A 1YLAA 2VIIA 4BLCA 2O5RA 1BVSA 3FUXA 4FD2A 1IN6A 4XK8F 3UJNA 3C58A 3T1HM 3JAMS 3U61A 2XSZA 3CGWA 1SXJB 2F5SA 3J2PB 2DXIA 4I81A 4REZA 4AKHA 1Z5CA 2K0BX 3RGSA 1OAIA 1N34M 3SMSA 5DNYA 2XFSA 2D7EA 2BWBA 4Z8XA 4DBGB 1PRBA 2KXEA 2ZANA 1VEGA 1FNNA 2FH0A 1EIJA 1NHGC 4LY6A 4X66M 2UUAM 2XH9A 2J7NA 2GQFA 2EUCA 2J5YA 3R8FA 2QPAA 1OTRA 1QDRA 1N33M 4MGIE 1UM8A 4RF1A 3A98B 4FWGA 1G71A 2YNMD 4DV2M 5BPVA 3B74A 1TTEA 4F2LA 3GPYA 4LFCM 3KDSE 1K82A 2HCBA 1EFUB 1ZQ9A 3KP0E 3KW6A 3KXEC 3HJ8A 2W82A 2LVPC 3C9PA 3KOWE 2OOBA 2E5LM 3B89A 4LF6M 1DGFA 2K47A 3U6OA 1T3TA 3FRHA 2VF7A 1VDDA 2YFQA 3AL0C 1XNRM 1NV8A 3U61B 1QVRA 3AKZA 4NOOB 1TGUA 3K8ZA 4GMQA 2XSZD 4RKUF 4F1IA 1PM5A 3GLGB 1L1ZA 4WURA 3VFDA 4IBGA 4K0KM 1XWIA 4DV3M 5KQDA 1IBMM 1YE9A 2P5TA 4D81A 1XXHB 4KT0F 3A46A 1IBKM 3TQSA 4JXJA 2DWZB 5IREB 3DA1A 4QHTA 4CGYB 4IJFA 1IY0A 1J09A 4L6V6 2R45A 3KS8A 4L16A 4B3TM 1OFHA 3FYDA 4D80A 4GIPA 1ZMVA 4FVMA 4JYAM 1ZAEA 2JZ0A 4LRSA 1WGNA 5ITQA 2QCUA 3HKPA 4JI8M 4IJEA 3L29A 4JI3M 1OKSA 4B08A 2C96A 2JY5A 2J7OA 2RGHA 3I4VA 4JI2M 1HNWM 3SMPA 1L2BA 4GKJM 4JV5M 2CHGA 5L8RF 3HJSA 3ILKA 3EIEA 1QYRA 3GPXA 2R6FA 3I01M 4FWHA 3U5ZA 4PDIA 1R7RA 1HNXM 3GPPA 2LVAA 2H5XA 3FUUA 3V76A 2F5OA 3GLHA 4M9ZA 3M0EA 1N32M 2O01F 2Z7JA 4P17A 4UN2B 2R4EA 4LF8M 3UK6A 2HAKA 2NQ8C 1XXHA 2FFJA 2QP9X 2V6ZM 2DAGA 2XF3A 2OPFA 1HQYE 2DENA 4IBKA 1D0MA 1ZMUA 3GLGA 3PNVA 2C99A 4L78A 1TF0B 1JR3E 4NL4H 2APLA 2KEBA 3FTEA 2JY7A 4B3MM 4FCTA 1IN7A 3I04M 1I94M 2LXEA 4AG6A 3FTFA 4JI6M 1G8PA 4PT5A 4HEOA 4NXMM 3L25A 3H4JA 3ZC7B 1K3WA 2JUJA 3GLIE 2UU9M 5DFLA 2FOIC 3T6PA 3HHZA 1T43A 1P3QQ 2CRUA 2I7NA 4RF0A 1IN5A 1SXJE 3U6DA 1I4WA 1QUSA 2VQEM 1NV9A 4FCVA 4OW0A 2KRUA 1D0LA 2XFTA 2R62A 2BNKA 1DGHA 3SATA 3U6PA 5ITXE 2KRKA 3IHPA 1HT1E 4LJ8A 5ITRA 1L2CA 3FTDA 3AOGA 4DR7M 2LH0A 1KSFX 3VK8A 3MK6A 4OVZA 4B7FA 2L6OA 2MH8A 3FUWA 5FTJA 4LZZA 4MH0E 5EP2A 1XB2B 2EKKA 4IBEA 4DUZM 3I51A 3M7GA 5KPRA 1RU3A 1UFZA 2V1CA 2QNJA 2Z8YM 1KFVA 2C5RA 2ZTDA 2LHGA 4GC5A 1TH3A 3PFIA 4GC9A 2LNHC 3KS4A 3IG5A 2UXDM 3THGA 1DGBA 3KSXA 4LJAA 1V33A 2FS1A 2XZUA 1N77A 1NSFA 4KODA 4Q7JA 3VDUA 5BR8M 4DUYM 2CV0A 4NXNM 5EQTA 3J80S 3U60B 3SYKA 4CIZA 4IBIA 2ZM6M 3Q8GA 5DYIA 2CWBA 1Z59A 1TH4A 1WR1B 5EXXA 1JR3A 1WJ7A 1ZV1A 4M0WA 5EJCA 1Z5AA 4JI1M 2CP8A 3K1JA 2YQZA 1FJGM 2HKJA 5JI2E 2XZFA 3QYBA 4IBFA 3U6LA 4IBBA 3RE8A 5C1BA 1PJTA 3GQ3A 2UUCM 4KO8A 3T38A 1SXJA 3K2LA 1EE8A 1Y8GA 4PDGA 2DVWB 3C3EA 1WHCA 3IECA 2KW0A 3NBXX 3TWKA 3JR5A 3GLFA 2UXCM 2MR9A 4GHLA 5ITXA 4YY3M 3AOEA 2FE8A 1IXRC 2ZTCA 5KO3A 5FLXS 1T6OA 3GQ5A 2LTUA 3HHXA 2KZSA 3KFUG 2Y21A 3PVSA 4X65M 2R65A 2Y0TA 2G5GX 4MGHA 2KNZA 1VDLA 4DR4M 1VEKA 4PD2A 2DNAA 3U6QA 3GLHB 1K3XA 1WGLA 4M9SA 3K9OA 3SYLA 2L4EA 1XMOM 3HU1A 2AHMA 1GKIA 4XBOA 1PJSA 3M6AA 4HL4A 3D8BA 5E6JA 3VK7A 2UXBM 2DZLA 2HL7A 2ERCA 3QYEA 2JZ1A 3LQRA 4NSRA 4RNAA 3HZJA 3WHKA 3UMMA 2DWMA 2QBYB 2O25A 2KHHA 2OO9A 3KOZE 1NY5A 4LGMA 1W5TA 3TL4X 4BBAA 1J5EM 3CF0A 2D7HA 1GJSA 5F3WA 2R18A 1NNJA 2ZAOA 2M5ZA 3CTWB 1OJLA 4FCWA 3KOYE 3GRUA 1NJGA 3LVWA 4IBCA 1R2ZA 4MGKE 3GP1A 3KVWA 5LMNM 1JR3D 1VQ1A 4OU7A 3SARA 2EKFA 2CEAA 4L4UA 1G41A 1Q3BA 3KSJA 3WHLA 3U60A 1L1TA 2X8AA 3DFZA 1NHWC 3B7QA 3W68A 3E9SA 5ITTA 4Z6YA 1C1KA 3D8LA 5ITUA 3U5ZB 2VQFM 1QANA 3E4RA 3H4MA 4R7GA 1VEJA 2CHQA 1QUTA 1XXHE 2D7GA 4G4QA 2R4JA 2QSFX 1DO0A 2I7PA 3IG8A 2QBYA 1AIPC 1IM2A 1HNZM 2L09A 2LVNC 1TDZA 1DO2A 5FTMA 4KLNA 2G8LA 1W5SA 5KQ8A 3F92A 4G3OA 4LF4M 2XEPA 4B3RM 3BOSA 4S12A 4Y28F 1NNUC 1L2DA 2HHHM 2DHRA 1Q3CA 3KOXE 5EP4A 2F5PA 2CV1A 1E94E 1IQPA 2CHVA 2L4FA 2OOAA 2R0IA 4XGIA 2MGWA 1Z6TA 4LZJA 3TPZA 2DZOB 3W0LB 3FUTA 3AFHA 1L8QA 2N35A 4DV5M 1YUBA 2F5QA 3L27A 1D2NA 3AJIB 1OAOC 4AZFA 1PJIA 1QZMA 4QNMA 3OTOM 1NJFA 2RKOA 1NY6A 1X37A 7CATA 2XLJA 2WSEF 1R5LA 1GL6A 3LW5F 4GHAA 3Q8XA 3AV0A 3GO8A 1OIZA 4ZPXA 1DGHB 3I4YA 4DR1M 2EJSA 3TWLA 4CHTB 1J7KA 2BJWA 3MMPA 3QWLA 2JP7A 4GH9A 3J27B 3SC3A 4MM3B 2C9CA 3L28A 3SHFA 3GLFE 4IBDA 3HGIA 4W5WA 4OX9M 1QAMA 1D0KA 3HU2A 3RFWA 1IY2A 2L7HA 3ZCBB 1SXJC 4A3VB 1GLNA 3HWSA 3LCUA 1XHBA 4NRVA 4LJ5A 5H37D 1XC8A 2G3QA 3FD9A 5EXPA 3CF6E 2QHOB 1G4AE 2V1UA 2A5YB 2Z4SA 3GLIB 4DR5M 3L26A 2LBCA 3UZUA 3HJQA 1VG5A 1PJJA 4NC6A 4X62M 4R71A 4LGYA 4G4NA 3HU3A 4LJ6A 2JNHA 1OQYA 5EXTA 1ZMWA 1HR0M 3W67A 5JI3E 1G59A 5KPTA 4JI0M 4JI5M 1Z5BA 4DV0M 2VDBB 2VF8A 5DYGA 2DI0A 4GRIA 2Z4RA 4M9XA 2L7IA 3PNYA 4MB7A 5KPZA 4GEWA 4QHSA 2JWSA 1IN4A 4YHHM 5IWAM 4I8OA 1XMQM 3NWLA 2KA6B 3NBIA 2LVQD 2Y20A 1CUKA 4OVZB 4B7GA 1JQJC 3MHVC 2XGNA 5GKNA 1TR8A 4JI4M 1MN3A 1QQWA 2F4VM 2JXNA 4KHPM 3J7AS 1PJQA 3GQ4A 1Q02A 1SG9A 3HX3A 4AG5A 5FTNA 4AQYM 1LV7A 5E26A 1QAQA 3ZH9B 5A2QS 5LMUM 3QAUA 1R2YA 4WP2A 3FRIA 2DKLA 1V92A 4FW9A 1JB0F 3MJ5A 4EIWA 1A5TA 1R6BX 2WSCF 3GRVA 2C98A 3SAWA 1R4GA 1MU5A 5IZ7D 4HLQA 3K9PA 1IY1A 4LG2A 1DGGA 4B3SM 1GABA 4LFAM 4G4RA 3E46A 4D82A 3U6CA 1WXQA 1WIVA 1HT2E 3ZQJA 3C3DA 1N75A 4ANRA 3UGJA 3U6SA 3W0FA 2QQ8A 1H6UA 4AW4A 4LF5M 3VKGA 2YR0A 3VDPA 4G4OA 3K92A 2MJ5B 2CE7A 4DV1M 2JY6B 3TE6A 3GRRA 4PCZA 1HQCA 2R46A 4NSOB 2Z3XA 3L2AA 3RGPA 1IXSB 2B3TA 1GVNA 2LVOC 4M0DA 1PGYA 2X4AA 3B9PA 4LJ7A 2DWLA 1DV0A 4AKIA 1N36M 3SHGB 2WZJA 5EXSA 5FTKA 2DWNA 3BXWA 1E32A 3GLFB 3T1YM 2WSFF 5IT9S 3BBZA 4JN6A 4CISA 1XNQM 2KNVA 3SAUA 3A45A 1OFIA 3DZDA 4BB9A 1IXSA 1MJGM 1TDHA 2LWXA 5EP3A 2KDLA 3KP1E 3SASA 2UUBM 3A42A 4QNRA 1KYIA 1AUAA 2EA0A 1GL7A 3HY5A 2KZUA 2QZ4A 3DOAA 5ITYA 1TH2A 1IFYA 2DZNB 2JA2A 2DHYA 2RGOA 4B7HA 2BWEA 4MGYE 3JR4A 3GLGE 2Q2EB 3FTCA 4LF7M 1ORYB 4L8RC 2KNAA 4GITA 4I5SA 4CJ6A 3J7BA 1HJPA 3U6MA 1Q39A 2DAKA 4G6ZA 3U6EA 4R3DA 3GLHE 1NO1A 4LJ9A 3J81S 3VKHA 3R9XB 3FUVA 1GJTA 3SAVA 4NRWA 1MX0A 3TWMA 4DR2M 4DV6M 2H1RA 4X64M 4MGZE 2ZAMA 2RRUA 3GRYA 1F4IA 2JY8A 3LQQA 3LVVA 4AKGA 3HHWA 3GPUA 2GNOA 3SBJA 4LF9M 2MROB 1GO5A 1SXJD 2OQ4A 2DAEA 4IBJA 1N78A 4AI6A 2CFOA 4FWDA 4WW0A 1G3IA 4GKKM 2DAMA 1OIPA 3T15A 3LCVB 3HHYA 3VLFB 1E9RA 2L2DA 5FTLA 2HWJA 2QENA 3PXGA 3B7NA 1IXZA 1E9SA 3LMMA 3SFZA
chains in the Genus database with same CATH topology
1QZEA 4GEWA 4UN2B 2DZLA 2DAIA 2HAKA 3E21A 2JZ1A 2DAGA 1HQYE 2K9DA 2LVQD 2O25A 1CUKA 2KHHA 2DENA 2OO9A 3FE3A 1ZMUA 1TR8A 1MN3A 1JR3E 2JY7A 1Q02A 1SG9A 4HEOA 3H4JA 2JUJA 3GLIE 1C7YA 5DFLA 3T6PA 1YLAA 1T43A 1P3QQ 1VQ1A 1BVSA 4WP2A 3FRIA 2DKLA 2EKFA 1G41A 1V92A 1A5TA 1R4GA 1NV9A 3K9PA 2K0BX 1OAIA 3IHPA 1HT1E 3E46A 1VEJA 1WIVA 1HT2E 1XXHE 2BWBA 4DBGB 1VEGA 1DO0A 2QSFX 1AIPC 1IM2A 2LVNC 1DO2A 1OTRA 1XB2B 2MJ5B 2EKKA 3F92A 4G3OA 2JY6B 1TTEA 4F2LA 1E94E 1UFZA 2LVOC 2B3TA 2L4FA 2OOAA 1EFUB 1PGYA 2QNJA 2MGWA 2R0IA 2ZTDA 1DV0A 2WZJA 2LVPC 2OOBA 3B89A 3BBZA 3FRHA 2KNVA 4Q7JA 1IXSA 1NV8A 1KYIA 1IFYA 4F1IA 2DHYA 2CWBA 3GLGE 2BWEA 2EJSA 1WR1B 1WJ7A 1ZV1A 2KNAA 3MMPA 2JP7A 1HJPA 2CP8A 2DAKA 3GLHE 5JI2E 3GLFE 2LVAA 3LCUA 1Y8GA 2RRUA 1WHCA 1F4IA 1ZMVA 2G3QA 2JY8A 3IECA 2JZ0A 1WGNA 1G4AE 2QHOB 2MR9A 2MROB 1GO5A 1OKSA 2LBCA 2DAEA 2ZTCA 1VG5A 1T6OA 2JY5A 2LTUA 4R71A 1G3IA 2DAMA 2JNHA 1OQYA 1ZMWA 3LCVB 2KNZA 1VDLA 1VEKA 2L2DA 2DNAA 1WGLA 3K9OA 2HWJA 2L4EA 2DI0A 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  4GEW A;  4UN2 B;  2DZL A;  2DAI A;  2HAK A;  3E21 A;  2JZ1 A;  2DAG A;  1HQY E;  2K9D A;  2LVQ D;  2O25 A;  1CUK A;  2KHH A;  2DEN A;  2OO9 A;  3FE3 A;  1ZMU A;  1TR8 A;  1MN3 A;  1JR3 E;  2JY7 A;  1Q02 A;  1SG9 A;  4HEO A;  3H4J A;  2JUJ A;  3GLI E;  1C7Y A;  5DFL A;  3T6P A;  1YLA A;  1T43 A;  1P3Q Q;  1VQ1 A;  1BVS A;  4WP2 A;  3FRI A;  2DKL A;  2EKF A;  1G41 A;  1V92 A;  1A5T A;  1R4G A;  1NV9 A;  3K9P A;  2K0B X;  1OAI A;  3IHP A;  1HT1 E;  3E46 A;  1VEJ A;  1WIV A;  1HT2 E;  1XXH E;  2BWB A;  4DBG B;  1VEG A;  1DO0 A;  2QSF X;  1AIP C;  1IM2 A;  2LVN C;  1DO2 A;  1OTR A;  1XB2 B;  2MJ5 B;  2EKK A;  3F92 A;  4G3O A;  2JY6 B;  1TTE A;  4F2L A;  1E94 E;  1UFZ A;  2LVO C;  2B3T A;  2L4F A;  2OOA A;  1EFU B;  1PGY A;  2QNJ A;  2MGW A;  2R0I A;  2ZTD A;  1DV0 A;  2WZJ A;  2LVP C;  2OOB A;  3B89 A;  3BBZ A;  3FRH A;  2KNV A;  4Q7J A;  1IXS A;  1NV8 A;  1KYI A;  1IFY A;  4F1I A;  2DHY A;  2CWB A;  3GLG E;  2BWE A;  2EJS A;  1WR1 B;  1WJ7 A;  1ZV1 A;  2KNA A;  3MMP A;  2JP7 A;  1HJP A;  2CP8 A;  2DAK A;  3GLH E;  5JI2 E;  3GLF E;  2LVA A;  3LCU A;  1Y8G A;  2RRU A;  1WHC A;  1F4I A;  1ZMV A;  2G3Q A;  2JY8 A;  3IEC A;  2JZ0 A;  1WGN A;  1G4A E;  2QHO B;  2MR9 A;  2MRO B;  1GO5 A;  1OKS A;  2LBC A;  2DAE A;  2ZTC A;  1VG5 A;  1T6O A;  2JY5 A;  2LTU A;  4R71 A;  1G3I A;  2DAM A;  2JNH A;  1OQY A;  1ZMW A;  3LCV B;  2KNZ A;  1VDL A;  1VEK A;  2L2D A;  2DNA A;  1WGL A;  3K9O A;  2HWJ A;  2L4E A;  2DI0 A;  2H5X A; 
#chains in the Genus database with same CATH topology
 1NVM A;  1QZE A;  3FYC A;  1YSY A;  4LRT A;  3AOE C;  3CF2 A;  4LFB M;  4II7 A;  2DAI A;  4L15 A;  4QOS A;  4IIW A;  2CV2 A;  4ITQ A;  3E21 A;  2LHC A;  2EO2 A;  1IBL M;  5C18 A;  2F5N A;  3B7Z A;  5FSW A;  2K9D A;  1S3S A;  1V34 A;  4DR3 M;  3GLI A;  4LCB A;  2R44 A;  3FE3 A;  4DV4 M;  2FNA A;  1QAO A;  2X49 A;  1IN8 A;  4I4L A;  5EP1 A;  2C9O A;  2ZBK B;  4JI7 M;  3FKE A;  2CUZ A;  4DR6 M;  2Y0Q A;  4TUW A;  2K6B A;  4QOZ C;  8CAT A;  4P16 A;  1QDT A;  3EIH A;  4LJ4 A;  4DV7 M;  1C7Y A;  1LTM A;  2BJV A;  2M60 A;  1YLA A;  2VII A;  4BLC A;  2O5R A;  1BVS A;  3FUX A;  4FD2 A;  1IN6 A;  4XK8 F;  3UJN A;  3C58 A;  3T1H M;  3JAM S;  3U61 A;  2XSZ A;  3CGW A;  1SXJ B;  2F5S A;  3J2P B;  2DXI A;  4I81 A;  4REZ A;  4AKH A;  1Z5C A;  2K0B X;  3RGS A;  1OAI A;  1N34 M;  3SMS A;  5DNY A;  2XFS A;  2D7E A;  2BWB A;  4Z8X A;  4DBG B;  1PRB A;  2KXE A;  2ZAN A;  1VEG A;  1FNN A;  2FH0 A;  1EIJ A;  1NHG C;  4LY6 A;  4X66 M;  2UUA M;  2XH9 A;  2J7N A;  2GQF A;  2EUC A;  2J5Y A;  3R8F A;  2QPA A;  1OTR A;  1QDR A;  1N33 M;  4MGI E;  1UM8 A;  4RF1 A;  3A98 B;  4FWG A;  1G71 A;  2YNM D;  4DV2 M;  5BPV A;  3B74 A;  1TTE A;  4F2L A;  3GPY A;  4LFC M;  3KDS E;  1K82 A;  2HCB A;  1EFU B;  1ZQ9 A;  3KP0 E;  3KW6 A;  3KXE C;  3HJ8 A;  2W82 A;  2LVP C;  3C9P A;  3KOW E;  2OOB A;  2E5L M;  3B89 A;  4LF6 M;  1DGF A;  2K47 A;  3U6O A;  1T3T A;  3FRH A;  2VF7 A;  1VDD A;  2YFQ A;  3AL0 C;  1XNR M;  1NV8 A;  3U61 B;  1QVR A;  3AKZ A;  4NOO B;  1TGU A;  3K8Z A;  4GMQ A;  2XSZ D;  4RKU F;  4F1I A;  1PM5 A;  3GLG B;  1L1Z A;  4WUR A;  3VFD A;  4IBG A;  4K0K M;  1XWI A;  4DV3 M;  5KQD A;  1IBM M;  1YE9 A;  2P5T A;  4D81 A;  1XXH B;  4KT0 F;  3A46 A;  1IBK M;  3TQS A;  4JXJ A;  2DWZ B;  5IRE B;  3DA1 A;  4QHT A;  4CGY B;  4IJF A;  1IY0 A;  1J09 A;  4L6V 6;  2R45 A;  3KS8 A;  4L16 A;  4B3T M;  1OFH A;  3FYD A;  4D80 A;  4GIP A;  1ZMV A;  4FVM A;  4JYA M;  1ZAE A;  2JZ0 A;  4LRS A;  1WGN A;  5ITQ A;  2QCU A;  3HKP A;  4JI8 M;  4IJE A;  3L29 A;  4JI3 M;  1OKS A;  4B08 A;  2C96 A;  2JY5 A;  2J7O A;  2RGH A;  3I4V A;  4JI2 M;  1HNW M;  3SMP A;  1L2B A;  4GKJ M;  4JV5 M;  2CHG A;  5L8R F;  3HJS A;  3ILK A;  3EIE A;  1QYR A;  3GPX A;  2R6F A;  3I01 M;  4FWH A;  3U5Z A;  4PDI A;  1R7R A;  1HNX M;  3GPP A;  2LVA A;  2H5X A;  3FUU A;  3V76 A;  2F5O A;  3GLH A;  4M9Z A;  3M0E A;  1N32 M;  2O01 F;  2Z7J A;  4P17 A;  4UN2 B;  2R4E A;  4LF8 M;  3UK6 A;  2HAK A;  2NQ8 C;  1XXH A;  2FFJ A;  2QP9 X;  2V6Z M;  2DAG A;  2XF3 A;  2OPF A;  1HQY E;  2DEN A;  4IBK A;  1D0M A;  1ZMU A;  3GLG A;  3PNV A;  2C99 A;  4L78 A;  1TF0 B;  1JR3 E;  4NL4 H;  2APL A;  2KEB A;  3FTE A;  2JY7 A;  4B3M M;  4FCT A;  1IN7 A;  3I04 M;  1I94 M;  2LXE A;  4AG6 A;  3FTF A;  4JI6 M;  1G8P A;  4PT5 A;  4HEO A;  4NXM M;  3L25 A;  3H4J A;  3ZC7 B;  1K3W A;  2JUJ A;  3GLI E;  2UU9 M;  5DFL A;  2FOI C;  3T6P A;  3HHZ A;  1T43 A;  1P3Q Q;  2CRU A;  2I7N A;  4RF0 A;  1IN5 A;  1SXJ E;  3U6D A;  1I4W A;  1QUS A;  2VQE M;  1NV9 A;  4FCV A;  4OW0 A;  2KRU A;  1D0L A;  2XFT A;  2R62 A;  2BNK A;  1DGH A;  3SAT A;  3U6P A;  5ITX E;  2KRK A;  3IHP A;  1HT1 E;  4LJ8 A;  5ITR A;  1L2C A;  3FTD A;  3AOG A;  4DR7 M;  2LH0 A;  1KSF X;  3VK8 A;  3MK6 A;  4OVZ A;  4B7F A;  2L6O A;  2MH8 A;  3FUW A;  5FTJ A;  4LZZ A;  4MH0 E;  5EP2 A;  1XB2 B;  2EKK A;  4IBE A;  4DUZ M;  3I51 A;  3M7G A;  5KPR A;  1RU3 A;  1UFZ A;  2V1C A;  2QNJ A;  2Z8Y M;  1KFV A;  2C5R A;  2ZTD A;  2LHG A;  4GC5 A;  1TH3 A;  3PFI A;  4GC9 A;  2LNH C;  3KS4 A;  3IG5 A;  2UXD M;  3THG A;  1DGB A;  3KSX A;  4LJA A;  1V33 A;  2FS1 A;  2XZU A;  1N77 A;  1NSF A;  4KOD A;  4Q7J A;  3VDU A;  5BR8 M;  4DUY M;  2CV0 A;  4NXN M;  5EQT A;  3J80 S;  3U60 B;  3SYK A;  4CIZ A;  4IBI A;  2ZM6 M;  3Q8G A;  5DYI A;  2CWB A;  1Z59 A;  1TH4 A;  1WR1 B;  5EXX A;  1JR3 A;  1WJ7 A;  1ZV1 A;  4M0W A;  5EJC A;  1Z5A A;  4JI1 M;  2CP8 A;  3K1J A;  2YQZ A;  1FJG M;  2HKJ A;  5JI2 E;  2XZF A;  3QYB A;  4IBF A;  3U6L A;  4IBB A;  3RE8 A;  5C1B A;  1PJT A;  3GQ3 A;  2UUC M;  4KO8 A;  3T38 A;  1SXJ A;  3K2L A;  1EE8 A;  1Y8G A;  4PDG A;  2DVW B;  3C3E A;  1WHC A;  3IEC A;  2KW0 A;  3NBX X;  3TWK A;  3JR5 A;  3GLF A;  2UXC M;  2MR9 A;  4GHL A;  5ITX A;  4YY3 M;  3AOE A;  2FE8 A;  1IXR C;  2ZTC A;  5KO3 A;  5FLX S;  1T6O A;  3GQ5 A;  2LTU A;  3HHX A;  2KZS A;  3KFU G;  2Y21 A;  3PVS A;  4X65 M;  2R65 A;  2Y0T A;  2G5G X;  4MGH A;  2KNZ A;  1VDL A;  4DR4 M;  1VEK A;  4PD2 A;  2DNA A;  3U6Q A;  3GLH B;  1K3X A;  1WGL A;  4M9S A;  3K9O A;  3SYL A;  2L4E A;  1XMO M;  3HU1 A;  2AHM A;  1GKI A;  4XBO A;  1PJS A;  3M6A A;  4HL4 A;  3D8B A;  5E6J A;  3VK7 A;  2UXB M;  2DZL A;  2HL7 A;  2ERC A;  3QYE A;  2JZ1 A;  3LQR A;  4NSR A;  4RNA A;  3HZJ A;  3WHK A;  3UMM A;  2DWM A;  2QBY B;  2O25 A;  2KHH A;  2OO9 A;  3KOZ E;  1NY5 A;  4LGM A;  1W5T A;  3TL4 X;  4BBA A;  1J5E M;  3CF0 A;  2D7H A;  1GJS A;  5F3W A;  2R18 A;  1NNJ A;  2ZAO A;  2M5Z A;  3CTW B;  1OJL A;  4FCW A;  3KOY E;  3GRU A;  1NJG A;  3LVW A;  4IBC A;  1R2Z A;  4MGK E;  3GP1 A;  3KVW A;  5LMN M;  1JR3 D;  1VQ1 A;  4OU7 A;  3SAR A;  2EKF A;  2CEA A;  4L4U A;  1G41 A;  1Q3B A;  3KSJ A;  3WHL A;  3U60 A;  1L1T A;  2X8A A;  3DFZ A;  1NHW C;  3B7Q A;  3W68 A;  3E9S A;  5ITT A;  4Z6Y A;  1C1K A;  3D8L A;  5ITU A;  3U5Z B;  2VQF M;  1QAN A;  3E4R A;  3H4M A;  4R7G A;  1VEJ A;  2CHQ A;  1QUT A;  1XXH E;  2D7G A;  4G4Q A;  2R4J A;  2QSF X;  1DO0 A;  2I7P A;  3IG8 A;  2QBY A;  1AIP C;  1IM2 A;  1HNZ M;  2L09 A;  2LVN C;  1TDZ A;  1DO2 A;  5FTM A;  4KLN A;  2G8L A;  1W5S A;  5KQ8 A;  3F92 A;  4G3O A;  4LF4 M;  2XEP A;  4B3R M;  3BOS A;  4S12 A;  4Y28 F;  1NNU C;  1L2D A;  2HHH M;  2DHR A;  1Q3C A;  3KOX E;  5EP4 A;  2F5P A;  2CV1 A;  1E94 E;  1IQP A;  2CHV A;  2L4F A;  2OOA A;  2R0I A;  4XGI A;  2MGW A;  1Z6T A;  4LZJ A;  3TPZ A;  2DZO B;  3W0L B;  3FUT A;  3AFH A;  1L8Q A;  2N35 A;  4DV5 M;  1YUB A;  2F5Q A;  3L27 A;  1D2N A;  3AJI B;  1OAO C;  4AZF A;  1PJI A;  1QZM A;  4QNM A;  3OTO M;  1NJF A;  2RKO A;  1NY6 A;  1X37 A;  7CAT A;  2XLJ A;  2WSE F;  1R5L A;  1GL6 A;  3LW5 F;  4GHA A;  3Q8X A;  3AV0 A;  3GO8 A;  1OIZ A;  4ZPX A;  1DGH B;  3I4Y A;  4DR1 M;  2EJS A;  3TWL A;  4CHT B;  1J7K A;  2BJW A;  3MMP A;  3QWL A;  2JP7 A;  4GH9 A;  3J27 B;  3SC3 A;  4MM3 B;  2C9C A;  3L28 A;  3SHF A;  3GLF E;  4IBD A;  3HGI A;  4W5W A;  4OX9 M;  1QAM A;  1D0K A;  3HU2 A;  3RFW A;  1IY2 A;  2L7H A;  3ZCB B;  1SXJ C;  4A3V B;  1GLN A;  3HWS A;  3LCU A;  1XHB A;  4NRV A;  4LJ5 A;  5H37 D;  1XC8 A;  2G3Q A;  3FD9 A;  5EXP A;  3CF6 E;  2QHO B;  1G4A E;  2V1U A;  2A5Y B;  2Z4S A;  3GLI B;  4DR5 M;  3L26 A;  2LBC A;  3UZU A;  3HJQ A;  1VG5 A;  1PJJ A;  4NC6 A;  4X62 M;  4R71 A;  4LGY A;  4G4N A;  3HU3 A;  4LJ6 A;  2JNH A;  1OQY A;  5EXT A;  1ZMW A;  1HR0 M;  3W67 A;  5JI3 E;  1G59 A;  5KPT A;  4JI0 M;  4JI5 M;  1Z5B A;  4DV0 M;  2VDB B;  2VF8 A;  5DYG A;  2DI0 A;  4GRI A;  2Z4R A;  4M9X A;  2L7I A;  3PNY A;  4MB7 A;  5KPZ A;  4GEW A;  4QHS A;  2JWS A;  1IN4 A;  4YHH M;  5IWA M;  4I8O A;  1XMQ M;  3NWL A;  2KA6 B;  3NBI A;  2LVQ D;  2Y20 A;  1CUK A;  4OVZ B;  4B7G A;  1JQJ C;  3MHV C;  2XGN A;  5GKN A;  1TR8 A;  4JI4 M;  1MN3 A;  1QQW A;  2F4V M;  2JXN A;  4KHP M;  3J7A S;  1PJQ A;  3GQ4 A;  1Q02 A;  1SG9 A;  3HX3 A;  4AG5 A;  5FTN A;  4AQY M;  1LV7 A;  5E26 A;  1QAQ A;  3ZH9 B;  5A2Q S;  5LMU M;  3QAU A;  1R2Y A;  4WP2 A;  3FRI A;  2DKL A;  1V92 A;  4FW9 A;  1JB0 F;  3MJ5 A;  4EIW A;  1A5T A;  1R6B X;  2WSC F;  3GRV A;  2C98 A;  3SAW A;  1R4G A;  1MU5 A;  5IZ7 D;  4HLQ A;  3K9P A;  1IY1 A;  4LG2 A;  1DGG A;  4B3S M;  1GAB A;  4LFA M;  4G4R A;  3E46 A;  4D82 A;  3U6C A;  1WXQ A;  1WIV A;  1HT2 E;  3ZQJ A;  3C3D A;  1N75 A;  4ANR A;  3UGJ A;  3U6S A;  3W0F A;  2QQ8 A;  1H6U A;  4AW4 A;  4LF5 M;  3VKG A;  2YR0 A;  3VDP A;  4G4O A;  3K92 A;  2MJ5 B;  2CE7 A;  4DV1 M;  2JY6 B;  3TE6 A;  3GRR A;  4PCZ A;  1HQC A;  2R46 A;  4NSO B;  2Z3X A;  3L2A A;  3RGP A;  1IXS B;  2B3T A;  1GVN A;  2LVO C;  4M0D A;  1PGY A;  2X4A A;  3B9P A;  4LJ7 A;  2DWL A;  1DV0 A;  4AKI A;  1N36 M;  3SHG B;  2WZJ A;  5EXS A;  5FTK A;  2DWN A;  3BXW A;  1E32 A;  3GLF B;  3T1Y M;  2WSF F;  5IT9 S;  3BBZ A;  4JN6 A;  4CIS A;  1XNQ M;  2KNV A;  3SAU A;  3A45 A;  1OFI A;  3DZD A;  4BB9 A;  1IXS A;  1MJG M;  1TDH A;  2LWX A;  5EP3 A;  2KDL A;  3KP1 E;  3SAS A;  2UUB M;  3A42 A;  4QNR A;  1KYI A;  1AUA A;  2EA0 A;  1GL7 A;  3HY5 A;  2KZU A;  2QZ4 A;  3DOA A;  5ITY A;  1TH2 A;  1IFY A;  2DZN B;  2JA2 A;  2DHY A;  2RGO A;  4B7H A;  2BWE A;  4MGY E;  3JR4 A;  3GLG E;  2Q2E B;  3FTC A;  4LF7 M;  1ORY B;  4L8R C;  2KNA A;  4GIT A;  4I5S A;  4CJ6 A;  3J7B A;  1HJP A;  3U6M A;  1Q39 A;  2DAK A;  4G6Z A;  3U6E A;  4R3D A;  3GLH E;  1NO1 A;  4LJ9 A;  3J81 S;  3VKH A;  3R9X B;  3FUV A;  1GJT A;  3SAV A;  4NRW A;  1MX0 A;  3TWM A;  4DR2 M;  4DV6 M;  2H1R A;  4X64 M;  4MGZ E;  2ZAM A;  2RRU A;  3GRY A;  1F4I A;  2JY8 A;  3LQQ A;  3LVV A;  4AKG A;  3HHW A;  3GPU A;  2GNO A;  3SBJ A;  4LF9 M;  2MRO B;  1GO5 A;  1SXJ D;  2OQ4 A;  2DAE A;  4IBJ A;  1N78 A;  4AI6 A;  2CFO A;  4FWD A;  4WW0 A;  1G3I A;  4GKK M;  2DAM A;  1OIP A;  3T15 A;  3LCV B;  3HHY A;  3VLF B;  1E9R A;  2L2D A;  5FTL A;  2HWJ A;  2QEN A;  3PXG A;  3B7N A;  1IXZ A;  1E9S A;  3LMM A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 1QZE A;  4GEW A;  4UN2 B;  2DZL A;  2DAI A;  2HAK A;  3E21 A;  2JZ1 A;  2DAG A;  1HQY E;  2K9D A;  2LVQ D;  2O25 A;  1CUK A;  2KHH A;  2DEN A;  2OO9 A;  3FE3 A;  1ZMU A;  1TR8 A;  1MN3 A;  1JR3 E;  2JY7 A;  1Q02 A;  1SG9 A;  4HEO A;  3H4J A;  2JUJ A;  3GLI E;  1C7Y A;  5DFL A;  3T6P A;  1YLA A;  1T43 A;  1P3Q Q;  1VQ1 A;  1BVS A;  4WP2 A;  3FRI A;  2DKL A;  2EKF A;  1G41 A;  1V92 A;  1A5T A;  1R4G A;  1NV9 A;  3K9P A;  2K0B X;  1OAI A;  3IHP A;  1HT1 E;  3E46 A;  1VEJ A;  1WIV A;  1HT2 E;  1XXH E;  2BWB A;  4DBG B;  1VEG A;  1DO0 A;  2QSF X;  1AIP C;  1IM2 A;  2LVN C;  1DO2 A;  1OTR A;  1XB2 B;  2MJ5 B;  2EKK A;  3F92 A;  4G3O A;  2JY6 B;  1TTE A;  4F2L A;  1E94 E;  1UFZ A;  2LVO C;  2B3T A;  2L4F A;  2OOA A;  1EFU B;  1PGY A;  2QNJ A;  2MGW A;  2R0I A;  2ZTD A;  1DV0 A;  2WZJ A;  2LVP C;  2OOB A;  3B89 A;  3BBZ A;  3FRH A;  2KNV A;  4Q7J A;  1IXS A;  1NV8 A;  1KYI A;  1IFY A;  4F1I A;  2DHY A;  2CWB A;  3GLG E;  2BWE A;  2EJS A;  1WR1 B;  1WJ7 A;  1ZV1 A;  2KNA A;  3MMP A;  2JP7 A;  1HJP A;  2CP8 A;  2DAK A;  3GLH E;  5JI2 E;  3GLF E;  2LVA A;  3LCU A;  1Y8G A;  2RRU A;  1WHC A;  1F4I A;  1ZMV A;  2G3Q A;  2JY8 A;  3IEC A;  2JZ0 A;  1WGN A;  1G4A E;  2QHO B;  2MR9 A;  2MRO B;  1GO5 A;  1OKS A;  2LBC A;  2DAE A;  2ZTC A;  1VG5 A;  1T6O A;  2JY5 A;  2LTU A;  4R71 A;  1G3I A;  2DAM A;  2JNH A;  1OQY A;  1ZMW A;  3LCV B;  2KNZ A;  1VDL A;  1VEK A;  2L2D A;  2DNA A;  1WGL A;  3K9O A;  2HWJ A;  2L4E A;  2DI0 A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...