1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
3K7AH 3MR2A 2MUTB 1VQEA 1R4GA 3TS2A 2N49A 2V4QA 3C23A 4LZDA 3GV7B 5E7NA 1XSPA 2JZ1A 4XIGS 5D49A 4DL3A 5FLXc 5J2GA 4Q8EA 5J0QA 3A0JA 4DR4Q 1G3IA 2JZBA 5KFJA 4DLEA 2KNVA 2F1JA 3UE0A 4Y52H 4ECVA 1EOVA 1Y8GA 1Q8KA 1PZNA 1E24A 3HOZH 3B89A 3K81C 2YTVA 4GKJQ 3UDFA 4NXMQ 4UN2B 4QW9A 4JV5L 4GNXB 5L1KA 3PUYA 9ICAA 2LVQD 4NXZA 4M47A 1C9OA 7ICUA 4X5VA 4LF9Q 4FS2A 1WI5A 4FBUA 2D62A 3CPWA 3JPQA 5IP9G 1G6PA 2JZBB 4IQVA 3HX0A 2OOBA 3MDAA 4GKKQ 1VQ8A 3AUOA 1W2BA 2EIFA 1Q12A 4F4KA 3GTLH 3G6VA 2B3GA 3KJOA 3T1HL 4F8RA 5DB6A 3PO2H 2UUCL 2BPCA 3PO3H 3K9PA 1A0IA 2JA6G 5IYDH 4A3IG 2PI4A 2K5VA 8ICOA 3G48A 4KLSA 1CSPA 1JJCB 4J15A 2P6UA 2MQHA 1J6QA 1BBUA 1V92A 5K36G 1Z47A 2CKZB 4K4HA 1TXYA 3PCOB 4RUCA 2VQFL 3RH5A 1U47A 4KTQA 9ICMA 2NVXH 1EYGA 3F8TA 4M6WA 3BQ2A 3TQ1A 4JI5L 1Z00A 8ICPA 2BDPA 3GLHE 4C3HH 3C5GA 5IYBG 1YIJA 3B0YA 2B63H 5GROA 2QEXA 3NENA 4LFAQ 4I28A 4KN4A 4HIKA 9ICNA 3MR5A 1M1KC 2LTUA 2JA5G 4PH5A 1PH9A 4IPCA 3RBEA 4LF5Q 1MN3A 1K3RA 1YI2A 3BQ0A 4EBDA 1JXLA 3ZDCA 1ZQEA 3RB3A 4F93B 1SROA 2HIVA 1HR0L 2VA8A 1PH5A 3EYZA 2OTLA 4R4QA 2IY5B 1Y14B 1T9HA 1GO5A 3J81j 4GKJL 3UXPA 3T1YQ 4IPGA 5KFLA 5IIMA 1XNQL 3WWVA 2J6TA 3ZDDA 1XPRA 2XY6A 3RH6A 5EOZA 1KAWA 4UP9A 1ZYQA 8ICRA 1X55A 5FLMG 3TREA 4F4YA 2R0IA 8ICMA 1OXSC 4KN7A 1L3TA 1AE3A 2E5LQ 1DV0A 4DR2Q 5DB8A 3M9BA 4EX5A 4I2FA 2I0QA 3MEFA 4DV6Q 4YMNA 3KHRA 3PMLA 4QWCA 3ERSX 2JK8A 4J9PA 1X56A 3B0XA 1U9LA 4A3GG 3NTUA 5KFPA 4CCHA 1WOCA 1AROP 1EUJA 2R7ZH 1KD1C 2HT1A 1D9FA 4O3SA 5KFWA 4H02A 1U0LA 4PHPA 7ICJA 1T8EA 1N8RC 1SZPA 2BCUA 1VQ4A 4HJ5A 1AE2A 4DQRA 2VW9A 1NMGA 3PVXA 1ZJMA 2HHQA 4XUSA 1HNXQ 3PIOA 2JEGA 5KFDA 4DR3Q 2KNZA 2HWJA 3W5OA 5LMUQ 1VEKA 1SE8A 5CJ7A 5C44G 5IIOA 1VQBA 4DQSA 3K8AA 3SGIA 4BBSG 4BY7G 2MAXA 1FVIA 1ZQXA 4OWWB 9ICFA 1XO1A 5DFLA 4OWTB 1BBWA 2KHJA 8ICWA 2BQRA 4QWAA 8ICFA 2RCNA 4IQWA 3T1YL 4K0KL 5KFEA 1ZQOA 2DAGA 4XQ8A 5C5JA 3I7FA 5M5XH 1HZAA 5KT5A 3PO3G 3H15A 4YWKA 1ZQQA 1NJWA 1N34Q 3RN5A 1MKHA 5IILA 1TK5A 2PNHA 2LSSA 4IOAA 4POFA 4DV0L 1YHBA 2LXKA 1KC8C 1MJCA 3BZCA 3EPIA 4QL5A 1PH3A 3HP6A 4F1IA 1IZ6A 4PG3A 1NJIC 4ED3A 5J2DA 2WAQG 2OQ0A 4WJ3M 4DOAA 4ECQA 1ZQGA 9ICXA 3PV8A 5M3FG 2JA7H 3S17H 4HIOA 1Y1WH 4Z6DA 2W9AA 3K80C 4GOPC 2DENA 3H8JA 1OTCA 2A8VA 4TURA 1WCNA 1H95A 2BH8A 4BDPA 3THVA 2PFOA 3GTJH 2BCQA 4X62Q 4DR1L 3ISCA 3M9MB 2AMCB 4LF6Q 4GLVB 1S3OA 1CKOA 1NK6A 2GN5A 4RQ2A 2BPGA 2ZUCA 1S0MA 1XSLA 1NTGA 3SV3A 2BGWA 5HGQA 4M9LA 2UXBL 3GTQH 3ZD9A 7ICNA 1ZMUA 2ES2A 1X3FA 3KF8B 3CCMA 1XMQQ 3A5ZB 4HJ8A 2J6UA 4B9LA 5KFSA 1N48A 2UVUA 1ZQIA 3RH4A 3S1RH 1SLJA 3I56A 4MNOA 3Q8RB 4ELTA 4G3IA 2I9GA 1Z00B 4YMMA 3A5UA 3CC7A 2JEBI 2MNAA 1S77D 4ED0A 3M4PA 4LUOA 3OGUA 4B3SL 2XCAA 1UEBA 2BQ3A 4RU9A 4J9OA 1QVCA 4BBSH 2WAQE 4NM1A 4A3BG 4EZ6A 4RT3A 5KFTA 4B3TQ 4JBWA 5M5WH 1G41A 2AU0A 1VDLA 1EQQA 4QQBX 3TARA 5J2EA 4ECRA 4JI0Q 1ZQWA 4EZ9A 2UVWA 2ZM6L 1YHAA 5J2FA 4RQ4A 3OTOL 1JMCA 4DV1L 4QZDA 4RPZA 5GQOA 2UUAL 3GIMA 3H0GG 2DHYA 3C1ZA 4QWDA 1EIFA 1BPBA 3RJJA 4UB4A 2HIXA 1B70B 1UA1A 4A3DG 3JPSA 4GS3A 4IPDA 4YR0A 2PFNA 5GAEC 1CKMA 1L3UA 4KLFA 9ICOA 5CR0A 3QEBZ 5KG3A 2F1IA 4BA2I 1SKSA 3SZ2A 1N9WA 2XCPA 5DKWA 4B9TA 4BXOA 1LV5A 5L1JA 2KFNA 2R8HA 1QSLA 7ICHA 3V6JA 4P72A 2K9DA 3GDXA 2ZJRA 2JEIA 4ED6A 3RB0A 1S10A 1NMFA 1TK8A 2Y1IA 1ZQAA 3A74A 1RPLA 2I5LX 4C2MH 1TR8A 4NLNA 4R4IA 2ISOA 5KFNA 4YP3A 2V4RA 4I2GA 5J0SA 3RRHA 4DV2Q 3FHWA 2XGPA 1T7PA 4GN3B 1ZQYA 4O3NA 5M3MG 3JAMi 4AH6A 5J2JA 1YHQA 2ZJAA 3OSPA 4LFBQ 3HFZB 5BR8Q 1TVAA 2C28A 4FBTA 4RQ1A 5KFRA 8ICZA 2R6GA 4QZEA 4IJHA 2RF4A 3I4MG 3DM3A 5KFMA 2AKWB 2IT1A 3OHAA 4JI0L 4WJ4A 3KDFA 3HOWH 2VL6A 3V7KA 2C2RA 2BR0A 1K8AC 3OTOQ 4AQYL 4QZ8A 4QZGA 4F5NA 3V6KA 9ICRA 1ZQFA 5J2AA 2YV5A 3GIJA 5CB1A 5J0PA 3FKIH 4GOPB 5EWFA 1RYRA 4J9KA 4FO6A 1XU4A 1G4AE 2KCMA 3OYYA 1E94E 1HT1E 2RRUA 3I4OA 3ZDBA 2NVQH 2BWBA 4PGXA 2XY5A 8ICQA 3GFKB 2AWNA 3Q8LA 3I2ZA 2CQOA 4A3IH 5JUMA 1MQ3A 3CC2A 1RXVA 4A3FH 4C8OA 4ECYA 4QIWE 4DL5A 1X3GA 8ICUA 1XMOL 4YD1A 3RAXA 4DL2A 2R8IA 4F50A 4DUZQ 4MFAA 3T3FA 2QHOB 4QJFA 4C3JH 3Q8PB 4JI1Q 2ASLA 4K4GA 3AU6A 2IX0A 1NKCA 3MFHA 1BPXA 4YQWA 4X66L 4DQPA 4DV3L 1X2IA 1K1SA 4J9SA 1DGSA 2UU9Q 2UXDL 3AQQA 5J29A 3K4GA 7ICSA 2IBKA 4POGA 2XGTA 2WZJA 1ZQLA 3QE9Y 3F2BA 5DLGA 1MC8A 3H40A 5KFVA 3KHGA 4YMOA 4MEYA 1XC9A 5DBCA 5J2CA 3H8WA 4GN5A 2HHUA 3GQCA 1TWGH 3CW2C 4QWEA 1VQKA 2EKKA 5TZVA 3PGZA 4AIMA 1KQSA 5JJKA 1E22A 1YLAA 2YTXA 4I2AA 4NB3A 1G291 4DKAC 3KJPA 3FKIG 5HHHA 5DBBA 2AHOB 1TTEA 2DAMA 1X9SA 2R93G 4YHHQ 2BWEA 4F5RA 4A76A 3STBD 4L5TA 1GKHA 3PR4A 2LBCA 3S16H 1HNZL 1JXEA 1WJ7A 1HJPA 1D8YA 2XTIA 2DNAA 3K75D 4ED1A 5IIJA 3RR7A 2QGQA 4DAYB 4DR4L 1VQ5A 2VUMG 1X9NA 2OCEA 3S24A 8ICJA 3HKSA 1IFYA 2UXCL 3MFIA 4JUZA 9ICCA 4TQRA 4DR2L 5F9NA 2HHSA 3RTVA 3JAMc 1A76A 1V9PA 2B3TA 1P8LA 4C8MA 5CHGA 1PH2A 5L1IA 3J81i 4DV6L 4PGYA 5JJLA 2PQAA 1ZQDA 4OWXB 1RYSA 2Q2IA 3LDAA 3RN2A 7ICVA 1TAUA 4HJ9A 2ZJQA 2CWAA 2DFLA 1JMSA 8ICGA 4LF8L 3OHBA 4X64L 1H38A 4WP2A 4DWIA 2KZMA 4R4TA 4JI7L 3C2MA 1WJJA 5AJ3Q 3ULPA 1MIUA 1X9MA 2E8GA 1Z9FA 2F1HA 1JB7A 4A93G 4X65L 4DR5Q 3TFRA 1E1OA 4DO9A 4O0AA 2JY6B 2UUBL 4Z6EA 2DAKA 4B9NA 2ZUBA 1A63A 4NLZA 1QSYA 4A3BH 2Q2TA 2JEJA 9ICSA 5HMMA 1YJNA 3Q8QB 2KHHA 2ID0A 3J81c 1E1TA 3U58A 1QZGA 5KFQA 4A3JG 3MDCA 3KFUA 2DZLA 4F92B 3JPNA 3H0GH 4A3KH 1ZMWA 4JI8L 2IHNA 3F2DA 4RMFA 3TI0A 3PF4A 4JYAQ 3S1NH 4KLUA 2KENA 1HNZQ 4BXXH 1VQMA 1HUZA 1WCMH 4P71A 4GC7A 2ZJ8A 4DR1Q 4KLKA 4DV5Q 3HOYH 4XTCS 3OW2A 5JEAG 4DFPA 2L15A 3PX4A 2M9NA 1BPDA 1Y1VG 1N34L 4UPAA 1WYDA 2HAKA 4O5KA 1SR3A 2ASDA 1Q1BA 1PVOA 1BPEA 4JWMA 1CSQA 3RAQA 4BBRH 2RHSB 2NN6G 2JEFA 4DV4L 5JI2E 3PO2G 5C4JH 4UAYA 3C2KA 4DUYQ 1AIPC 2F4VL 2VY3A 4YD2A 2ZUDA 5J0RA 3GLIE 1U49A 4QZCA 2XC9A 5IP9H 4JI2Q 2ZTEA 2EJSA 3I4NG 4KLQA 1VQ9A 3CMEA 3JPOA 3ORYA 2RHQB 4BWJA 9ICGA 7ICFA 4DQIA 1IBKL 4UB3A 2VZAA 4O3QA 4JI3L 1V1QA 4YR2A 4F4XA 2BCRA 2K5HA 2NRTA 2I5HA 5IE8A 1VEJA 5L1LA 4J9LA 3E0EA 3BZKA 3TFSA 1VQPA 3M8RA 2B63G 7ICGA 3HOZG 3RJEA 4F2LA 4P2HA 2EXDA 1K73C 3H7IA 8ICXA 4R8UA 4MF2A 1X54A 1QZEA 4ECWA 3ICEA 3F1ZA 1PGYA 4DR7Q 5KFZA 3M7NA 4JI4Q 4O3PA 3UDIA 4DFJA 4YCXA 2HHHL 4DAMA 1WCLA 5IWAL 1Q81C 5JEAJ 5M5YH 4ECXA 7ICTA 4I2CA 1VQFA 1B7YB 3UPQA 1PH8A 4B3MQ 3I4NH 3U4ZA 3SYZA 2K4KA 5DQGA 5KFBA 5J2BA 1P16A 7ICEA 1ASZA 4P4OA 2JY7A 5HP4A 5DGBA 1I94L 2W8KA 4R64A 3UQ2A 4JOIA 2LVNC 3H3VH 3W1BA 2FMQA 1X9WA 1ZQBA 5KT4A 2K50A 1XNQQ 2VNUD 2JA9A 2OWOA 3T5JA 3FRHA 3KYHC 5J0XA 1P3QQ 4RQ8A 2WB1E 3CXCA 2ASJA 4YWLA 5J0UA 4DV2L 3EN2A 2AGPA 1OAIA 4L5RC 2VA3A 3K7UC 1OXUA 2GVBA 4JK1A 3HOYG 1SG9A 3RJKA 3IECA 2L2DA 3JPPA 2A1JA 3H8SA 4KI0A 2BH2A 4O3RA 4OONA 1NK9A 4OX9Q 4GNXC 5HY6A 1KTQA 5GADC 3UQ0A 5KG5A 1CEZA 4ECTA 1QSSA 3HOXH 4RG1A 1UE1A 4EYHB 1NKBA 4APVA 1EQRA 5IYCG 4B9SA 3IRBA 2ZTDA 4EEYA 2VQEQ 2XGQA 3ULLA 1QZHA 5C3EG 1RIPA 2W8LA 1WGNA 4O5EA 1T4GA 1LYLA 4O5CA 3KHHA 4R66A 2MFIA 4RZRA 2KZ3A 4M2YA 4DL6A 5LMNQ 1HZBA 4JWNA 3MR6A 3V7JA 2R8JA 4XA5A 5ELNA 1LUZA 1K9MC 4DSFA 2IA6A 1KLNA 4OO1G 3T5LA 3GTKH 4NXNQ 2R93H 4HYKA 4I2HA 2JZ0A 9ICJA 4DFKA 4DSJA 2UXBQ 4A3KG 8ICCA 4MFFA 1I6HH 1XWLA 1MJEA 2PMZE 2Q2HA 2MJ5B 1VQ6A 3K0XA 3TAQA 4TUSA 3NBHB 2OOAA 3LCVB 4QZFA 4YCWA 4YVZA 3M4QA 3SV4A 4R1JA 4F2RA 3UE1A 3PIPA 2PXIA 2D0PA 5KFAA 3EZ5A 4ED2A 4PHEA 1PHJA 1K0RA 4DK6C 2JA7G 2E2JH 1BKBA 2NVYH 1NV8A 4A3MH 3PUXA 5DB7A 4LF4Q 2FPKA 5KFKA 2QA4A 2VANA 4LF7Q 1KYIA 1XS9D 2DUDA 5KG1A 1XXHE 1SMXA 3AYHB 3N97B 2B21A 2AQ4A 2BA1A 2BPFA 4AYBE 2DI0A 5HHIA 1NK7A 4IOCA 3D0FA 3AU2A 1SL2A 1KL9A 3CP0A 3HOUG 1J5EL 3G71A 4RNOA 3LCUA 4IFDI 3FYHA 4ECSA 8ICHA 3B6YA 4UB5A 4J9MA 4YN4A 2E2IH 5IIKA 3G4SA 2LYHA 3V72A 4JI5Q 1ZQRA 3ZDEA 4GXJA 2YU9H 2P66A 2IX1A 1IYJB 2JA6H 1QLNA 4JV5Q 1B43A 2V9WA 2FLLA 4JBMA 1U48A 1L3SA 4YY3Q 4DV3Q 1YJ9A 3V6HA 1WIVA 2ALYB 1O7IA 4MZ9A 2UU9L 3JPTA 4MFCA 5J0YA 1VQ7A 1AH9A 5M3FH 2RDIA 4ED8A 2XY7A 2UXCQ 4GKKL 4QZIA 5KFXA 4IR9A 4YWMA 1SRUA 4R8UB 1CKNB 3BBZA 2ATLA 2ISPA 4TUPA 2UUCQ 3RR8A 2W9BB 3H4BA 3TANA 8ICEA 5CP2A 3H4JA 1UE7A 2AGQA 3RJGA 4NXML 1FL0A 3HKZE 5DQHA 1SL0A 2N8NA 4GXIA 3HT3A 2KZZA 4LFBL 8ICNA 3OSNA 1NK8A 1K83H 1VQOA 2ZJ5A 3ULJA 1OKSA 1YVCA 1XNRQ 1M90C 2A19A 2D0OA 5DDYA 1VQGA 5ELOA 1VCIA 5M3MH 5FJ8G 2JY8A 3KTQA 1N33Q 1BVSA 5C44H 3PW5A 1S40A 5DG8A 4DK3C 1N56A 1LM0A 1VQCA 3PNCA 4BXXG 2Q0ZX 3QZ7A 4DV7Q 5J0TA 2PFPA 2IHMA 1JJ2A 5DG7A 4JI8Q 5GAHC 4F4WA 4GOPA 3E21A 4RNMA 5BOMA 4RPYA 1YITA 3OJSA 5DLFA 1TKDA 1BPZA 3GTGH 2PI2E 4TQSA 3BU2A 4J9RA 2FMSA 1NJYA 5KFGA 2N78A 3E46A 3HOVH 5IYBH 7ICOA 2DAIA 4DR6L 3TQYA 1NOMA 4LF5L 4RUAA 1ZMVA 5AJ3L 2KBNA 3J80i 4OXPA 2NRWA 1IM4A 2L4EA 3PMNA 4KLHA 4JI6L 4Q8FA 2UUBQ 1EXNA 4OO1I 4DV4Q 1G51A 7ICQA 1XTDA 4DFMA 1JX4A 2HVHA 5HNKA 4JOIC 2XO7A 4UAZA 4M9JA 4A4IA 1EFUB 1OQYA 2R7FA 2KHIA 5KFOA 3H3VI 2FLNA 8ICSA 4UBBA 1WHCA 1QTMA 4O9MA 2MUTA 1S72A 3HPOA 4RQ3A 8ICYA 5D46A 3PUWA 3LWLA 1KFTA 3VDYA 1X65A 4QZBA 5KFYA 3JC66 3RJHA 3S2DH 4LFCQ 3RNUA 1JIHA 1ASYA 2JY5A 5KFCA 2NRZA 4F5PA 4DV7L 1TFRA 4YXJA 5KT3A 2Y1JA 4B9MA 1NV9A 4UY8C 4K0KQ 4DL4A 3IHQB 1T3NA 2P6RA 1RL2A 3CF5A 1WR1B 3E9HA 2KTQA 3LWMA 5FJ8H 4KLIA 2MR9A 4I2IA 2W9CA 1VQIA 9ICHA 3AEVA 1FJGQ 4UP7A 4YXMA 4DUZL 4GLAC 3PO4A 5KFIA 2YTYA 3CCLA 2W9MA 1NJXA 4LUZA 4Q44A 4KHPQ 2N3SA 4JC0A 1C0AA 3ZDAA 4JI7Q 1TWAH 4R63A 2C22A 3CCEA 5J0WA 3C5FA 7ICIA 2YYZA 1IL2A 4RNNA 4AQYQ 4Q45A 1HR0W 4JBJA 2VUMH 2H5XA 1QVFA 3G6XA 2HHVA 1ZV1A 2RDJA 4NPSA 4DOBA 3GDEA 3S1MH 3HWTA 7ICRA 4QZHA 1OXXK 1Q7YC 1FGUA 1QUQA 2BQUA 3PW4A 2HHHQ 3GV8B 5BOLA 4BXOB 4DEZA 4QZAA 1GD7A 2HQLA 4AYBG 2BKEA 3RZDH 5DDMA 4KLOA 3W1GA 7ICPA 5CWRA 4B3ML 1A77A 2I1QA 4F3OA 3F92A 5KFUA 1N32Q 1RZTA 2DAEA 2K5NA 1KIXA 2OO9A 2JNHA 1XMQL 5IINA 1MQ2A 1EWIA 1A62A 2ZJPA 1PYSB 4O2DA 3RLFA 5GAGC 2LVPC 2AWOA 1JN3A 4LF6L 3HOWG 3KF6B 3KHLA 4B3SQ 3BJUA 3PUVA 1FJGL 2KNAA 4B3RQ 4DS5A 1YNXA 2J6SA 4RPXA 3E2EA 5EWEA 2F52A 5IP7H 4KLJA 3AFQA 3S14H 4DPGA 1E3PA 3J80c 3BDPA 9ICEA 5DB9A 3T1HQ 4J9NA 1CKNA 5IT9c 1T43A 3IM1A 2F4VQ 4NM2A 2UVRA 3E9IA 1OXTA 1E7ZA 4A3CG 1NY4A 5IIIA 4BY7H 4JI2L 3FRIA 3GIKA 1OXVA 2NZOA 3T5KA 1D9DA 5C4XG 2PI5A 2DPIA 5J2KA 2K75A 4C8LA 4R71A 1IBKQ 2FLPA 4A3EH 4A93H 4A3CH 3PY8A 4C3IH 3U50C 1TV9A 3H4DA 3ZJYC 2Y0SE 3MGHA 2GVAA 3PO5A 3Q8DA 9ICKA 4DOCA 5IP7G 5CA7A 2PI2A 3QEAZ 4DSKA 3GLGE 9ICVA 2DGYA 1L2FA 1KSPA 5KFHA 3N4MB 4Q7JA 3S1QH 1Q82C 4DL7A 4ECZA 1IBLQ 1VQLA 3UXNA 2JP7A 4P74A 2MGWA 4J9QA 1HH2P 2A1JB 2FXQA 3MR3A 5J2IA 1K1QA 1DO0A 1PH1A 1L1OA 4JV1A 2KCTA 5EAYA 1HZ9A 4IRKA 2CP8A 1TWFH 4XRHA 4F2SA 4LZGA 4YY3L 1ZJNA 2LVAA 4Z6FA 1XMOQ 5L9XA 4QGUA 1Y88A 1SFOH 3DLLA 4DQQA 3GTMH 2JUJA 1I94Q 2E5LL 2W9CB 1NK4A 2A1AA 2K0BX 1N36L 1TAQA 3T5HA 4DF4A 4X66Q 1COOA 4X65Q 2AQ0A 1TWHH 3D31A 4M6WB 4JG2A 4G3OA 5IY0A 3S15H 9ICIA 2HHXA 4MEXA 2NRVA 1ZETA 1KRPA 2BCVA 5JJIA 3CMAA 3FE3A 2ZM6Q 4I29A 7ICLA 4OX9L 3PX0A 2Z6KC 2O25A 4IFDJ 1IBML 3GTPH 4NLKA 1C7YA 4MF8A 3ISDA 4IQUA 4DNIA 1S9FA 1HNXL 4BBRG 1HQYE 3HW8A 4GN4B 4YCVA 1SKWA 2KN7A 1D8LA 3RR5A 1HZCA 1L5UA 3C1YA 2JE6I 3MBYA 5KTQA 1HUOA 1SL1A 4P73A 3Q8KA 4JV0A 2ALZA 4DSLA 4Y7NH 4UB2A 1VQNA 4LWCA 4F5QA 5KT7A 4L5QA 4ELUA 3CC4A 4JBKA 4A75A 4R4CA 1V43A 4Q43A 4GXKA 4UP8A 3I4MH 2R92G 1PH7A 4I2BA 7ICKA 1PFSA 4DUYL 3LGJA 1Q86C 2IHFA 1S0OA 1X6OA 4L5SA 5HMLA 4RQ6A 2BA0A 3RBDA 4IRDA 2BHNA 3ZD8A 2HVIA 5DQIA 2C35B 2KFZA 1XNRL 1GVPA 4TQUS 4EBEA 1L0WA 4JI3Q 3GO5A 5DG9A 5KFFA 1VG5A 1HT2E 3JPRA 4I27A 5DLQE 2E2HH 1Q46A 3RZOH 3RRGA 4A3FG 1ZQNA 3M85A 4P75A 1B22A 1S0NA 3STBC 1L3VA 4IFDG 3RLOA 3PW2A 2R8GA 3UDGA 1VQJA 4LW1A 2ASBA 1PYBA 4KHZA 4QY7A 3MMPA 3PW7A 2JA8G 2HHTA 4X62L 4I2DA 1NKEA 1T6OA 1RXWA 4YR3A 1KHIA 1DO2A 5KG2A 4GEWA 3BJYA 4X6AH 3T6PA 1WCMG 1IM2A 4KLDA 2R7DA 2AGOA 3L7ZC 1Y1WG 1F4IA 5LMUL 2VQFQ 5DBAA 1WFQA 4JYAL 5BPCA 3MXNB 4IQTA 5KG6A 5D4BA 3RJIA 4O0IA 1R9TH 1KFDA 3QZ8A 2CCZA 5C0XJ 1A8VA 3KF6A 1I50H 4JI6Q 5J2HA 3L0OA 1QVGA 1KRSA 1NE3A 4M0AA 4X64Q 4JV2A 4M9NA 4QW8A 1L1OB 1YZ6A 1YBYA 4FDBA 3S2HH 4ME3A 5F9LA 3PSIA 2R8KA 4Z6CA 4O3OA 3PW0A 2L4FA 4K4IA 1BGXT 1SN8A 3EBEA 9ICWA 2DPJA 4IR1A 4JCVE 4PZ6A 4DR5L 2AJQA 2JA8H 5C3EH 4KITB 2MO1A 1UFZA 1BPYA 1CUKA 4F5OA 4DV0Q 2PFQA 2NVTH 4B9VA 5DGAA 5IYDG 4KHPL 3C21A 4UAWA 1JJGA 1B8AA 2VQEL 3GD7A 4DV1Q 1XB2B 3PV0A 4IPHA 5C4XH 4DF8A 4LF8Q 1EIYB 4QZ9A 3MGIA 2EKFA 5KT2A 5BR8L 3CQZH 4PPXA 3LK9A 2LXJA 1Q02A 1Q1EA 4YFKA 4YG2A 4LFAL 4ELVA 3KDFB 3NEMA 4IO9A 3EIVA 1VQHA 1ZQVA 4ED7A 2OTJA 4KLGA 8ICLA 2JJQA 3GIIA 8ICBA 1N32L 3PF5A 5C0XG 3EWAA 1HR0Q 4RT2A 3ISBA 3MABA 4FS1A 4M04A 8ICAA 9ICPA 4QWBA 1YJWA 4DBGB 4UB1A 5LMNW 4HIMA 3PX6A 1JR3E 4P4MA 1I3QH 1ZQTA 1VQDA 2C2DA 1UA0A 2UVVA 9ICBA 2WFWA 4C8NA 3TEHB 3J7A5 1UT8A 3KLWA 4BY1H 5FLMH 1ZQJA 1SKRA 3OJUA 4YCUA 1IXSA 4GNXA 2W9BA 1KDHA 3HKZG 3L2PA 2VS1A 1S76D 9ICUA 4B3RL 3BQTA 1NK5A 2HHWA 4EQ5A 2K14A 4TUQA 2Z6KA 8ICIA 3C2LA 3TRZA 1S0VA 1ZQCA 2ATWA 4HJ7A 1ZQPA 3AFPA 4BGDA 3Q8MA 1VS0A 4PMWA 4LNQA 2UXDQ 2Z0SA 1QUQB 1J5EQ 4EBCA 4TVAB 4DLGA 1YEZA 2WB1G 3KOJA 3M9OB 4A3MG 1U45A 4PZ8A 4I2EA 3ER0A 4P4PA 1TK0A 3RLNA 2QSFX 4NLGA 3CCVA 4RQ5A 3V7LA 5IWAQ 2Y0SG 1NK0A 8ICKA 5KG4A 3Q8SB 2MO0A 3CAMA 4DS4A 4DR3L 1N33L 4ZH4A 3M4OH 4DV5L 4KLLA 4PZ7A 3EPGA 3CPFA 2VA2A 1NJZA 1IBLL 3IHPA 4YHHL 3M8SA 3K9OA 2WTFA 5KG0A 4GC6A 2ZTCA 4NXNL 4LUVA 1I5FA 3M9NB 1IXRA 2NN6I 3BQ1A 1PH6A 1W3SA 4HJAA 1UT5A 4PHAA 1HNWL 4DR7L 4IRCA 3RB4A 3HOUH 1GM5A 1VQ1A 2FPMA 1U5KA 3M3YH 9ICQA 3CCQA 2CWBA 1ZQUA 4PGQA 2FMPA 4A3GH 2HW3A 2MROB 1UE6A 1PH4A 4A3LH 3F2CA 1Z3EB 1XSNA 5IYCH 1WGLA 3FDSA 4PHDA 1K8GA 2Q2UA 2R7ZG 1Y1VH 3EW9A 1N36Q 4KMUA 4RQ0A 4A3EG 2R92H 1ZQHA 2DKLA 2WP8J 2GWSA 1JT8A 4IJLA 1KRTA 3FP9A 3CCUA 5EWGA 1KEJA 4BWMA 2C2EA 5LMNL 3TS0A 4LF4L 2JEAI 4BY1G 3I55A 3SI8A 4KLTA 4I2JA 1LTLA 1ZQZA 3U4VA 1ZQKA 3G6EA 4B9UA 8ICTA 2FPLA 3NELA 8ICVA 3GILA 2LVOC 1ZQMA 4LVSA 1MSWD 4JI4L 2IMWP 1NBWA 4ECUA 4M9GA 3TAPA 3RJFA 1KXLA 3HOVG 1TWCH 2BCSA 4KLMA 2PQAB 2NZHA 4DR6Q 4LFCL 1VQAA 3CCRA 4BA1I 4UBCA 4F4ZA 5KT6A 1UWVA 4EYIB 4F91B 5J3BA 4A3JH 2G3QA 1HNWQ 3HOXG 1VEGA 9ICLA 2CWPA 3CCJA 1S97A 4KLEA 4DSEA 1A5TA 4JI1L 4M9HA 4RQ7A 2IHEA 4E0DA 5H1SE 4GLXA 1DOQA 4UQGA 1PA6A 4DSIA 1KFSA 4C8KA 3CD6A 4LF9L 4LF7L 3UDXA 1OTRA 3GV5B 3G6YA 4NY8A 2NRXA 2F3IA 4ALPA 1X3EA 3PR5B 2EQSA 3CCSA 1GO3E 1IBMQ 5C0XI 3UXOA 9ICTA 4B3TL 1U4BA 1JE5A 7ICMA 2QNJA 5J0OA 1LB2B 3ETLA 2JQOA 3J7ZC 4R65A 3PUZA 3NGDA 1ZQSA 2V1CC 1EFWA 3GTOH 4R4OA 1XJVA 1L1OC 1PV4A 4A3LG 1D7QA 2JA5H 5KG7A 2K52A 1XPUA 2OQKA 3GLFE 4HIDA 2I5MX 1UE5A 2UUAQ 2CFMA 2B29A 1XPOA 4HEOA 4MTNA 4A3DH 3RB6A
chains in the Genus database with same CATH superfamily
3L5KA 3MR2A 3K7AH 2MUTB 1NJFA 3QX7A 1TF0B 3JR5A 3BG3A 4AKGA 2F5QA 1VQEA 1R4GA 5KYLA 5CV5A 1OFIA 3TS2A 2N49A 4X3SA 2V4QA 1CI3M 2HDLA 3C23A 4U7CA 2O5IC 4LZDA 1YNJD 3GV7B 5E7NA 1JQYD 3CF6E 1JR3A 3C1FA 1XSPA 2JZ1A 1X40A 3I3CA 3QNMA 3FPPA 1TS4A 2RQ5A 1EZ8A 3K1JA 2E1EA 4XIGS 4LJXA 4AP9A 5D49A 2WF5A 2JR5A 4DL3A 5FLXc 5J2GA 1OXJA 4Q8EA 5J0QA 1I3QB 2LY7A 3A0JA 1EIGA 1PK1A 4DR4Q 5G3LF 1G3IA 3RMHA 2JZBA 1ZRMA 5KFJA 5JAVA 2CUZA 4DLEA 2KNVA 2F1JA 3UE0A 2FFJA 1Q3LA 3J80c 4Y52H 1R2ZA 4NW2A 3MFYA 1Y8NB 4ECVA 1EOVA 1B0XA 1Y8GA 1Q8KA 2K5QA 4QF4A 1IG6A 1PZNA 3PIP3 1E24A 1U4MA 3HOZH 5AM4A 1AZQA 3HHZA 3FUVA 3B89A 3K81C 1JALA 2YTVA 4GKJQ 4AYBF 3UDFA 2ZIWB 1BCPD 1GL6A 2Y0TA 3TE6A 1BUVT 1HFGA 4IBGA 2ESEA 4NXMQ 4UN2B 4QW9A 4JV5L 2NTTA 1SNMA 3N52A 2KW0A 3CNHA 5ISRA 3HILA 4QIWB 3PFIA 4GNXB 3ED5A 4EQNA 5L1KA 3PUYA 4B3RM 2HUGA 4B08A 9ICAA 4CDFC 2LVQD 3T56B 2YMMA 4NXZA 3IKJA 4LZJA 4M47A 2KNJA 4IBJA 4X5VA 7ICUA 1C9OA 4FS2A 1T5XD 4FBUA 1WI5A 2D62A 3KLSA 3CPWA 4CNQA 3JPQA 5IP9G 2JZBB 5IT9E 1WD0A 1DRGA 4DF7A 1G6PA 4R7GA 4NJ8A 4IQVA 3I76A 3HX0A 3Q6SA 4KLNA 2OOBA 5DNFA 3MDAA 4EQOA 1VQ8A 3AUOA 4AKHA 4GKKQ 1LTAD 2R6FA 1OIPA 2QARA 3KS8A 4KMOB 2EIFA 1W2BA 2K6BA 3NHHA 1Q12A 3HZXA 3DFZA 4F4KA 2V6ZM 3GTLH 3SAHA 3G6VA 2B3GA 3KJOA 2GH1A 3T1HL 4F8RA 5EP1A 5DB6A 3PO2H 2KQ3A 2UUCL 2BPCA 1B3AA 3PO3H 3K9PA 1QYRA 2WF8A 1A0IA 1EY8A 2KXEA 1LTSD 4EELA 2Y0SB 2PI4A 4A3IG 2HCCA 5DYIA 8ICOA 2K5VA 3VA7A 5JVG3 3NASA 2DNEA 4KLSA 3G48A 5D65A 1CSPA 1S4ZA 2B63B 1JJCB 5GKNA 2L6OA 4J15A 1HNXM 3KP1E 3U6QA 2P6UA 3S14B 2MQHA 1J6QA 1BBUA 1V92A 4F72A 4K8IA 5K36G 3AOGA 1Z47A 2CKZB 3Q23A 1ET9A 4K4HA 4RCOA 1TXYA 3DWPA 3PCOB 4MGIE 4RUCA 3OIQA 2VQFL 5F2DA 4QUFA 3RH5A 4DV4M 1U47A 4KTQA 9ICMA 1EYDA 2NVXH 1FFUA 5ITTA 1PTOF 1SE3A 5DM63 1EYGA 4LGMA 1SYCA 3F8TA 3A8IE 5CYUA 4M6WA 3BQ2A 3TQ1A 1EU4A 4PL1A 4JI5L 1Z00A 2IWHA 8ICPA 2BDPA 1V1OA 4DXGA 5KQ8A 1HTLD 3GLHE 4C3HH 4FNFA 4HN7A 4KY5A 3C5GA 5IYBG 1YIJA 3B0YA 2B63H 5GROA 3B7NA 1I4HA 2QEXA 4A93B 1HHVA 3FC4A 1A15A 4I28A 4KN4A 3NENA 4LFAQ 4HIKA 4J8QA 9ICNA 4KV6A 3GRUA 5BN3A 3MR5A 1M1KC 1RYUA 2LTUA 2JA5G 1F5SA 4PH5A 3M7DA 1UM8A 1PH9A 4IPCA 3RBEA 1TH2A 2CHGA 1MN3A 2FJ6A 1EEID 1K3RA 2Z8LA 4LF5Q 1DGFA 3AB9A 1I4XA 1YI2A 3KK7A 4ODGA 4LCBA 3BQ0A 2F0KA 5E79U 4EBDA 3DUZA 1JXLA 3ZDCA 3GLGA 1ZQEA 1EOTA 1YT3A 3RB3A 2K8AA 4F93B 1SROA 2HIVA 1HR0L 2VA8A 1NY5A 4GITA 1QQ5A 3EYZA 1PH5A 2OTLA 3E4RA 4R4QA 3NBHA 2IY5B 2L7IA 1Y14B 1T9HA 1X3PA 1JE4A 3T1YM 3KKAA 1IBMM 1GO5A 3J81j 4DGZA 3UXPA 1BCPB 3T1YQ 4IPGA 4GKJL 5KFLA 3GP7A 1K0SA 1CA6A 1NNJA 5IIMA 1PRTB 1Y1VB 2EJGC 3WWVA 1STGA 1XNQL 2J6TA 3ZDDA 1LKYB 1XPRA 4PNYA 1N78A 2XY6A 3RH6A 3PNVA 3I73A 2VF8A 3TQSA 2Q4TA 5EOZA 1KAWA 1I4WA 2KCNA 1ZYQA 4UP9A 1Z5BA 2E76C 3BDLA 8ICRA 1X55A 4BBAA 3TREA 1KW4A 2E3TA 5FLMG 5IZ7D 2F3NA 4A3VB 4F4YA 3VYTA 2CFOA 2R0IA 8ICMA 1AE3A 4KN7A 1L3TA 1OXSC 1UEAB 1B3QA 4F71A 2F0IA 4I8OA 4QHTA 1DV0A 2E5LQ 4DR2Q 4EENA 3OW7A 1CHQD 5DB8A 3HZJA 3SHGB 3SFZA 2K4EA 2B2YC 2RSOA 3CRKC 4I2FA 3M9BA 4EX5A 3S1MB 4JMUA 2I0QA 3MEFA 4DV6Q 4YMNA 5FO9B 2ERCA 3KHRA 1F0MA 3QU4A 3UGJA 3PMLA 3R8FA 4LF4M 4QWCA 1FFVA 2JK8A 4J9PA 1X56A 2CH4W 3E0JA 3B0XA 1U9LA 3IV6A 1A3TA 3QOLA 2JA6B 4A3GG 1B2TA 3NTUA 1B44D 3QR8A 3DOAA 5KFPA 4CCHA 3S1NB 1WOCA 1TGUA 3OSOA 1AROP 1EUJA 3NTIA 5KL1B 3QIAA 5CV7A 2KEYA 2FINB 4C4RA 4HMJA 3ITPA 2LS01 3K5LA 2E2IB 5GTIU 2R7ZH 3AOEA 3HGIA 4Q0FA 1KD1C 2HT1A 2R62A 1QAOA 1D9FA 4O3SA 2NVYB 3WKDA 5KFWA 4C3JB 3WDNA 3P20A 2OHFA 4H02A 1U0LA 4XT1B 4PHPA 1S5FD 1PFNA 1QH9A 7ICJA 5AKEA 4GH9A 1MA7A 1T8EA 3D6CA 2Z1CA 1YNNC 3QO2A 1SZPA 2BCUA 5IIFA 4HJ5A 1VQ4A 1N8RC 1AE2A 4DQRA 4DR1M 1DGBA 1NMGA 2VW9A 3PVXA 1ZJMA 4XQJA 2EY6A 2HHQA 4XUSA 1SNOA 3RFAA 2HBJA 4G7ZC 2RBMA 1HNXQ 1Z59A 2LMRA 2JEGA 1Z6HA 5AIBA 5KFDA 2VF7A 2KNZA 1D5MC 1LT5D 4R8NA 2HWJA 4DNTB 4DR3Q 1IW7C 1B9MA 3W5OA 4IIWA 1VEKA 4UB8U 1SE8A 2F3WA 2M9VA 5LMUQ 1VJ5A 3CTWB 1SXDA 1DONA 3NRWA 5HR6A 4CDGA 3BOSA 5CJ7A 2XVTA 2L55A 3SK8A 2HBLA 2AHMA 5IREB 2SEBD 1LO5D 3U5ZA 5IIOA 1NHWC 4DQSA 1UUPA 1VQBA 3K8AA 5C44G 3SGIA 4BBSG 4HAEA 4BY7G 2OT2A 2MAXA 2SOBA 4ZK9B 2NVQB 5KL8B 1FVIA 1ZQXA 2LKVA 2GO7A 9ICFA 1SZHA 1XO1A 2D9UA 4OWWB 1IKMA 3KBXA 5DFLA 4OWTB 1BBWA 4C1NI 1N32L 1JI7A 2KHJA 1SV0C 1CRXA 1QOHA 8ICWA 1OFHA 3A46A 2BQRA 4QWAA 3PSPA 8ICFA 3VKGA 2DKXA 4IQWA 1CK1A 2A6HC 2W3SA 5KFEA 2RCNA 4MB7A 5BPVA 2ZM6M 1RQNA 3WKBA 1ZQOA 4LF9M 2DAGA 4XQ8A 5C5JA 4L8RC 2EYPA 2K01A 3I7FA 4KY6A 1BXTA 3HG9A 5M5XH 1HZAA 5KT5A 3PO3G 3H15A 3RZDB 4DR5M 2PQEA 2UUAM 2I6XA 5AKGA 4ZLTF 1O08A 1VF5C 4K2KA 5ALYA 4YWKA 1ZQQA 1XWEA 2HOQA 1SB3C 5H37D 1NJWA 1ICFB 2HD3A 3R2IA 3X3MA 3K6OA 1N34Q 3RN5A 1MKHA 1SAPA 3IFTA 5IILA 1TK5A 2PNHA 2LSSA 4IOAA 2WHEA 1GL7A 1Y1WB 4OIJA 4POFA 5I6WA 4DV0L 1YHBA 2LXKA 1KC8C 1MJCA 1Q3BA 2KVMA 4TVAB 3CU7A 3BZCA 3EPIA 2LBOA 3H94A 4FXGC 4IUVA 3KOZE 2DGZA 4QL5A 3EIEA 2ZIUB 4AZFA 1PH3A 4ABNA 1NSFA 3HP6A 1PYWD 2NBFA 4F1IA 4TSSA 2NZ1D 1IZ6A 4PG3A 1NJIC 1YNJC 4ED3A 2KDLA 4KO8A 5J2DA 2C5CA 2OQ0A 3GLGB 3GRRA 2EA0A 2B0CA 2YN4A 2WAQG 2XSCA 4DOAA 4ECQA 4HAIA 1ZQGA 9ICXA 3PV8A 3FUUA 1ENAA 1PVRA 3AMZA 3HOYB 3BVMA 5M3FG 3FUXA 2JA7H 3S17H 3F2UA 4IBBA 3KVWA 5AIAA 4HIOA 1Y1WH 4Z6DA 2W9AA 3K80C 4GOPC 3MA2B 2DENA 1COKA 4B7GA 3H8JA 1OTCA 2A8VA 4TURA 1WCNA 1H95A 2D7HA 3T1YL 2BH8A 3RF9A 3L28A 4BDPA 2YR0A 1K3BC 3THVA 2PFOA 2D3DA 1BCPF 1A2UA 1Y8PB 3DEPA 3GTJH 3QU2A 1SWWA 2BCQA 4X62Q 1T94A 2YB4A 4DR1L 3ISCA 3M9MB 4DK1A 2AMCB 4LF6Q 2AQ3B 2F0WA 4GLVB 1KQQA 1S3OA 3QWLA 1CKOA 3VC8A 1SEBD 5EE9A 5ALJA 1NK6A 2L9HA 3OOCA 1J09A 2GN5A 4ID6A 1GUGA 1SDFA 4RQ2A 3I90A 2QKQA 2BPGA 1MU5A 1X6IA 2G08A 2ZUCA 1XSLA 1S0MA 3WOEA 1NTGA 3SV3A 3D8LA 2BGWA 5HGQA 2CV1A 2W7PA 1R6BX 3K57A 4M9LA 2UXBL 1XHBA 3GTQH 3ZD9A 7ICNA 4KJNA 4DR4M 3QYBA 2F0HA 2CEAA 1FEZA 1ZMUA 2ES2A 3L2PA 2EJMA 4NSRA 1O7ZA 3RZOB 1X3FA 3KOYE 3KF8B 3NWSA 3CCMA 5KO3A 3A5ZB 4HJ8A 2J6UA 2YMQA 3HU2A 3GRVA 5KFSA 4B9LA 2F0NA 5KIXA 2EZVA 1N48A 5EJWA 2JHDA 2UVUA 1ZQIA 1L8OA 3RH4A 3S1RH 4L15A 1SLJA 3I56A 2KA7A 4MNOA 3Q8RB 4ELTA 2KJ5A 4G3IA 2NV3A 2I9GA 1Z00B 4DV1M 5H2FU 4YMMA 3A5UA 1V38A 4L16A 2RDHA 3QWNA 2WAQF 2H3FA 2JEBI 3CC7A 1MN8A 4FF2A 2MNAA 1S77D 2F0JA 1PJQA 4ED0A 4CDCC 1YNND 3M4PA 4LUOA 3OGUA 5D3DA 3K2LA 2XCAA 1UEBA 3K1RB 4B3SL 2BQ3A 4RU9A 4Y2SA 4J9OA 1IXSB 1QVCA 1U4LA 4YY3L 3T16A 2F0SA 2KVSA 1FNNA 1OIZA 4NM1A 2WAQE 4JK1C 5JEAH 3MAQA 4BBSH 3KLSX 5ELDA 4EZ6A 4A3BG 4RT3A 2PW5A 3QU7A 5KFTA 2B8GA 3SAFA 2F77X 1I50B 4B3TQ 4JBWA 5M5WH 4ACOA 1G41A 2AU0A 1VDLA 3GLHA 3KFUG 5EKLA 4A3MB 1JB3A 1EFID 1EQQA 5AM1A 3MVVA 5JPMC 4ZYSA 4QQBX 1DZ1A 2K1BA 3TARA 2QP9X 1H9SA 2NYZD 2JYOA 5J2EA 4HMIA 4L63B 4ECRA 3VR2A 4JI0Q 2EYJA 1ZQWA 4EZ9A 2UVWA 1LV7A 2RDFA 1PM5A 2ZM6L 4GIPA 1YHAA 1S5LU 5J2FA 4RQ4A 1HXYD 5ALFA 3KSXA 3OTOL 4DUYM 1JMCA 2Z6BA 4DV1L 4DUZM 1QUTA 4QZDA 4RPZA 1F44A 5GQOA 1PDQA 3GIMA 2A6EC 3H0GG 2UUAL 4PCZA 2DHYA 3C1ZA 4QWDA 1EIFA 1BPBA 1AFPA 3RJJA 4UB4A 4E6IA 1S5BD 2EVBA 3DWAA 2HIXA 3S6JA 1B70B 1LTBD 3C46A 5C3XA 3FTFA 3MEHA 1UA1A 2L7HA 1ZQ9A 1N33M 3KOXE 1MSGA 1TDHA 1KTKA 2F0GA 4A3DG 3JPSA 4GS3A 1N36M 4IPDA 2VIIA 4YR0A 2PFNA 5GAEC 1V85A 1CKMA 2B2TC 3MJ5A 2CRXA 1C4QA 2Z4HA 3SARA 4PL2A 1L3UA 4KLFA 9ICOA 2QBYA 1DXMA 2P5ZX 2E5SA 1A0PA 5KG3A 5CR0A 3QEBZ 1LTTD 5LHY1 1DYQA 2F1IA 4BA2I 1PZID 1SKSA 2JSOA 2B39A 1N32Q 3SZ2A 3QUBA 2EYHA 1N9WA 3AFHA 5DKWA 2XCPA 4B9TA 4BXOA 1X3QA 4X3KA 1QQ7A 3A0HU 5L1JA 1LV5A 2KFNA 3SDZA 2NVTB 5J8YC 2L09A 2R8HA 2E8OA 1QSLA 7ICHA 3VR4A 5A0LA 3V6JA 1S5CD 4P72A 1NR4A 2K9DA 3U6DA 3KLRA 2VXWA 1H9MA 1PRTF 3HRZC 3GDXA 2C9CA 2ZJRA 2JEIA 1AP0A 4ED6A 3RB0A 1S10A 1NMFA 2X69A 3TSSA 2R4JA 1TK8A 2Y1IA 1ZQAA 1T3TA 1J9OA 1K8MA 1RPLA 2PZWA 3A74A 3HKZC 2I5LX 1LT4D 2B2WC 4C2MH 3SBJA 3A7AB 1TR8A 4NLNA 4ILWA 4R4IA 2YY6A 5AKLA 5KFNA 4YP3A 2ISOA 2D5DA 3S2HB 2V4RA 1L7OA 4I2GA 2F5OA 3FTEA 1VDVA 5J0SA 3RRHA 1QJOA 4DV2Q 3FHWA 2XGPA 1T7PA 2Q8RE 1SYDA 2RKSA 4GN3B 4OIKA 2L5TA 2Z4SA 1ZQYA 4O3NA 5HURA 1VDZA 5M3MG 4F87A 2RQXA 2B2YA 3NP8A 4AH6A 4EGVA 5K5PA 3JAMi 5J2JA 3OPOA 2PMZF 3QAUA 2ZJAA 5AKIA 3OSPA 1YHQA 4KN7C 4LFBQ 3MZ5A 3HFZB 3SYLA 4RGMA 5BR8Q 1TVAA 3IAYA 4IBCA 2XLJA 2C28A 4NXNM 4FBTA 4IUPA 4RQ1A 1ENCA 5KFRA 8ICZA 2R6GA 4QZEA 4IJHA 4RGOS 1WVLA 2RF4A 5FLXL 4OJOA 3TBIB 3P1HA 3I4MG 4LJAA 3DM3A 3GLIA 5EP3A 4DR6M 4Y2VA 5KFMA 2B8FA 1ZYRD 2AKWB 2IT1A 3OHAA 4O42A 3URYA 5IOCA 4JI0L 3VDPA 3KDFA 2MPMA 3TP8A 4C2MB 2VL6A 2R18A 1L2BA 3V7KA 2C2RA 2BR0A 4H13C 3OTOQ 1K8AC 4AQYL 4QZ8A 4PT5A 4QZGA 4F5NA 3V6KA 9ICRA 1ZQFA 5J2AA 2DZOB 2XZUA 2YV5A 3GIJA 3I91A 4DNRB 2G09A 5CB1A 5J0PA 1W6KA 3FKIH 1Z6TA 2R46A 5EWFA 5C3EB 1RYRA 3K5NA 4J9KA 3FDTA 4GOPB 2K32A 3DA1A 4FO6A 1XU4A 1G4AE 1F9SA 2KCMA 1OAOC 3OYYA 1E94E 1IN6A 1HT1E 2CHQA 2RRUA 3I4OA 1D8BA 3ZDBA 2NVQH 2Z4RA 3FD9A 1PZKD 2BWBA 4PGXA 3N28A 2XY5A 8ICQA 3GFKB 1F2YA 3WK4A 1CM9A 2AWNA 2O5RA 3Q8LA 1E2VA 2CQOA 3I2ZA 2B2UA 1IN5A 3NRZA 5M5WB 5JUMA 3DV9A 4A3IH 1MQ3A 3CC2A 4KN4C 4IURA 1K82A 1X6JA 3WK9A 1RXVA 3G6JB 4A3FH 2HCIA 4FZNA 4C8OA 4ECYA 3B74A 4DL5A 1X3GA 4QIWE 5KQDA 8ICUA 4RCNA 1XMOL 1Z1BA 2YX8A 4YD1A 3RAXA 4A3EB 2GQFA 2Y21A 1UPHA 2R8IA 4F50A 4DL2A 4MFAA 3LX0A 4DUZQ 1HFNA 1CZWA 3T3FA 1TWCB 3BYYB 2QHOB 1ESRA 4X3UA 4QJFA 5DNYA 4MTKA 4C3JH 3Q8PB 4JI1Q 2ASLA 4K4GA 3AU6A 2IX0A 1NKCA 1OW5A 3MFHA 1BPXA 3L3OC 5E4WC 3I28A 3GLIB 3PVSA 2XVSA 4CBVA 5C44B 4YQWA 3KZIU 2VDBB 2EY2A 2PZTA 4X66L 4DQPA 3S16B 4M0WA 4DV3L 1X2IA 2N1RA 3T4AC 4DK0A 5C4JB 2SDFA 1K1SA 4J9SA 1DGSA 3PQIA 2K05A 2UU9Q 2UXDL 3AQQA 1I6HB 5J29A 4Y28F 3MK6A 1NVMA 2NB0A 3K4GA 2EZZA 7ICSA 2IBKA 1X66A 4I7ZC 2XGTA 2WZJA 2RA4A 2LYAA 3MFGA 2BNKA 3K8ZA 4IBKA 1ZQLA 5JI3E 3QE9Y 3L27A 1BR9A 5LL6X 3F2BA 2C98A 5DLGA 1MC8A 3H40A 2XSZA 5KFVA 3KHGA 4YMOA 4MEYA 4X65M 1GHKA 1XC9A 5DBCA 3A98B 1Z5CA 3H8WA 5J2CA 4GN5A 2HHUA 2K8BB 5EXXA 4CISA 3GQCA 2J7OA 1TWGH 2RCFA 4RNAA 3CW2C 3FRPB 4QWEA 4USAA 3JAML 1VQKA 4NSOB 3PNYA 2ZIWA 2EKKA 1JOOA 5TZVA 3PGZA 4AIMA 1T5EA 1G2SA 1QG7A 3ERSX 3TWLA 5I2XA 1KQSA 3Q22A 3A45A 1E22A 3GQBA 1YLAA 2NO5A 2WB1F 4C3JG 2YTXA 5JJKA 4I2AA 2RP5A 1QILA 4NB3A 1NI3A 1G291 1LLRD 4CJ0B 4DKAC 1IN7A 3GO8A 3HHXA 2YB1A 4UAUA 3WU2U 5CORA 5CBEE 3KJPA 3FKIG 1URJA 5HHHA 2AHOB 5DBBA 1TTEA 1V8QA 3SHLA 5AI8A 5E4XA 4XQQA 2DAMA 2HBKA 1X9SA 2Q2EB 4EEKA 4ZKBB 4YHHQ 2R93G 4UB6U 4KY7A 3A8KE 1XC8A 2BWEA 4F5RA 1SYGA 2D2CC 2H1EA 2MHVA 1ENFA 3NXWA 4L5TA 3STBD 5ALNA 1GKHA 3PR4A 2LBCA 3FUTA 2F4VM 3I4LA 3GTPB 3S16H 1HNZL 4DV0M 1JXEA 1WJ7A 2HCFA 1HJPA 1D8YA 1F2LA 1MI2A 1XXGA 2DNAA 4LJ7A 3K75D 2XTIA 1IV8A 5EBDA 4Q5VA 1R5LA 4ED1A 5IIJA 1UAPA 3NTHA 5E26A 2BE5C 3RR7A 2QGQA 4OGQC 3R93A 4DAYB 4DR4L 1Z19A 4QOZC 1MBYA 4CGZA 3H4MA 1X9NA 1VQ5A 2VUMG 3SAGA 1RTOA 3D2QA 2OCEA 3S24A 3PO3B 5AKJA 2X6GA 2KSOA 8ICJA 4JXJA 3HKSA 4HCSA 4M9XA 1IFYA 2EYFA 2UXCL 4Z9CB 2FMCA 4RAUC 3M0EA 3MFIA 4C56C 2F76X 4CE6A 3NPPA 2VJ5A 4JUZA 3N7SC 9ICCA 3DEOA 5DYGA 5ELFA 4FW9A 4FVMA 2BDUA 1ET6A 2QILA 4GC9A 4TQRA 4DR2L 5F9NA 3JAME 2HHSA 2M0NA 3RTVA 4U68A 1A76A 1V9PA 2B3TA 1P8LA 4P2CB 2M5ZA 4C8MA 5CHGA 5ALRA 1PH2A 5L1IA 3J81i 4DV6L 4PGYA 5JJLA 1KN5A 4BUGA 2PQAA 5BR8M 3SK4A 1B50A 1RODA 2ZXOA 1ZQDA 4OWXB 3U26A 3PXGA 1RYSA 2Q2IA 3LDAA 3HX3A 3RN2A 7ICVA 1TAUA 3Q24A 4HJ9A 2ZJQA 2E8MA 2CWAA 1QDTA 2DFLA 4LRSA 1JMSA 8ICGA 5LMUM 2IL8A 2V1CA 2VKQA 2IPKD 1LVHA 3S1RB 4LF8L 3OHBA 4X64L 4JI8M 1H38A 4WP2A 4DWIA 2KZMA 1EYAA 3NTKA 4R4TA 4JI7L 3QU9A 3C2MA 3NUQA 1WJJA 2KSOB 5AJ3Q 1MGSA 3ULPA 1MIUA 4QCLA 1X9MA 1A3VA 5EPLA 2BCOA 2E8GA 5JOBA 4B9WA 1K5OA 1Z9FA 2F1HA 3T1HM 1JB7A 4A93G 2HHHM 2A5YB 4X65L 2F5NA 4DR5Q 3TFRA 1E1OA 4DO9A 4O0AA 3BZDB 2JY6B 2UUBL 4P17A 4Z6EA 2DAKA 4B9NA 2ZUBA 1FYCA 4QMGA 5ALMA 2J7ZA 4NLZA 1QSYA 2J4XA 1G71A 2NUCA 3GU3A 1IQPA 1EWHA 2Q2TA 3HJEA 3T51B 2JEJA 4A3BH 2BJWA 9ICSA 4IN3A 1HNWM 2LH0A 5HMMA 1YJNA 3Q8QB 3SHFA 2ZIXA 2KHHA 5CMDA 2ID0A 4UARA 3SK6A 3J81c 1ZD5A 4FCWA 2K89A 1E1TA 2WINB 3J80L 4FF1A 5EQTA 1LTMA 3U58A 4OVZA 2KICA 3ALRA 5JTIA 3UI2A 1QZGA 5KFQA 5CV6A 2KV2A 1KLGD 3ICXA 3MDCA 2DZLA 5EE1A 1QAQA 4F92B 2JXMB 4JW0A 3JPNA 5FTLA 3H0GH 4KKTA 4A3KH 1HA6A 1ZMWA 3DZDA 8CATA 2EANA 1QB5D 4JI8L 5AKZA 3X3NA 4JI7M 1HUMA 1D2NA 2IHNA 3F2DA 3AN1A 1PTOD 3TI0A 4RMFA 3PF4A 4JYAQ 3CF0A 4KHPM 1TIID 3S1NH 3UMGA 1TY0A 2XNAC 3BVZA 2FOIC 2VIXA 4GFJA 5EXSA 5ALTA 4KLUA 2KENA 2CW0C 2WB1B 1HNZQ 1ZOLA 1HUZA 1WCMH 1VQMA 4BXXH 4P71A 2QW7A 4GC7A 2ZJ8A 4DR1Q 1D0LA 2WF7A 1EY5A 4PDIA 1H9JA 4KLKA 5C5LA 4DV5Q 3HOYH 4G7HC 2G0AA 3MWYW 4XTCS 3OW2A 2XWBB 1RJTA 3DDHA 4Y2UA 1GUTA 2KCCA 5FKAC 5KNBA 5JEAG 2L0CA 1JB0F 1SBBB 4M8AA 4DFPA 2WSFF 4QNRA 5ALKA 3PX4A 2HQEA 2M9NA 2L15A 1BPDA 2E2HB 1Y1VG 1N34L 4Y2QA 1MJGM 4UPAA 1R2YA 2HAKA 1WYDA 5C18A 3D6JA 4O5KA 1SR3A 2ASDA 2A68D 1R7RA 1IY2A 1GUWA 1Q1BA 3IP4B 2EE1A 1PVOA 2F0UA 4JI6M 1BPEA 3TP7A 1W6JA 2Y20A 4KHVA 1M6YA 4JWMA 1CSQA 3RAQA 1ECWA 2X49A 3A42A 3R9XB 5GTHU 4BBRH 1GOZA 2RHSB 2NN6G 2JEFA 4HR7B 3K0YA 5JI2E 4DV4L 5A2QS 3PO2G 5C4JH 4UAYA 5FLXS 3SMPA 4BJQA 3C2KA 4DUYQ 4BX9C 3NQTA 1AIPC 1S3SA 2F4VL 4LJ9A 4FZLA 3CHBD 2G07A 3AQEA 4YD2A 2ZUDA 2VY3A 1ZRNA 5J0RA 3GLIE 1U49A 1SJED 3SR1A 4QZCA 3CGWA 4B3SM 2XC9A 1BNZA 5IP9H 2GOLA 2ZTEA 4JI2Q 3MXPA 2EJSA 4KMUC 4KLQA 4CDEC 1VQ9A 2ES6A 2XGNA 3A7LA 3TKAA 3CMEA 3I4NG 3I4MB 2J5YA 4J6HA 3JPOA 3ORYA 2RHQB 4LJ6A 4BWJA 9ICGA 7ICFA 4DQIA 3BVGA 2IX3A 1IBKL 1QDRA 4CJ1B 4UB3A 2F0DA 5ELCA 2ICIA 4O3QA 3FYCA 2VZAA 4JI3L 3H0RB 1V1QA 4YR2A 4K0KL 4F4XA 1TS5A 2BCRA 2K5HA 2W11A 2I5HA 2NRTA 5IE8A 1VEJA 5L1LA 2LYBA 5AKHA 2A5HA 2R61A 4J9LA 3E0EA 3BZKA 2XN9C 3WOFA 2C96A 3TFSA 1VQPA 2R65A 2YFQA 4QHSA 1E32A 2CN1A 2W82A 1QNUA 2UXCM 3M8RA 1QNKA 2B63G 7ICGA 3HOZG 3TDQA 3RJEA 1L1ZA 5FTNA 2MRLA 3R8BA 5ALVA 4F2LA 2XEPA 4P2HA 2QDLA 2EXDA 2LWXA 3FKIB 3H7IA 8ICXA 1K73C 4R8UA 4CF3A 4MF2A 1X54A 4IUUA 2EPBA 3BS5A 1QZEA 3UJNA 4ECWA 3VYUA 3F1ZA 3LQRA 3ICEA 1PGYA 2W3RA 1JR0D 3FUWA 2D7GA 5KFZA 1VMCA 4DR7Q 5J8YA 3M7NA 3ZH9B 1L0XB 1ILPA 2A6ED 4JI4Q 4O3PA 3UDIA 4DFJA 2HDMA 4YCXA 1XWIA 4KX3A 1JWMD 2KECA 1WWUA 5ALZA 3DXJC 4DAMA 2HHHL 1WCLA 5IWAL 1Q81C 5JEAJ 4OO1J 4B7FA 3BDCA 5M5YH 4ECXA 1EE8A 2ZXRA 4A3FB 3E0FA 7ICTA 2HKJA 5AI6A 4I2CA 1B7YB 1VQFA 3M4YA 3UPQA 3E9SA 2B2TA 4I5SA 1PH8A 4MGKE 1B4FA 2EQYA 4B3MQ 3I4NH 4OJ5A 5ALOA 3U4ZA 2WFAA 3SYZA 5DQGA 3B7ZA 5KFBA 5J2BA 1P16A 3M6AA 2K4KA 2XRSD 4QIWC 4KJOA 2C5RA 3WK8A 7ICEA 3IG8A 3R2TA 1ASZA 4P4OA 1RF2D 1NZBA 2JY7A 2RVLA 2X4AA 5HP4A 4FWHA 5DGBA 1I94L 4NL4H 1RM6C 2W8KA 5FTMA 1NO1A 4R64A 5AK5A 2UXDM 1NR2A 3UQ2A 4IBIA 3WKAA 4JOIA 2LVNC 3H3VH 4JBMA 4B9XA 4PDGA 3W1BA 2QZ4A 4A3KB 3W0FA 2FMQA 1X9WA 1ZQBA 4Y2TA 3AM9A 5KT4A 2K50A 3NVYA 4AYBB 2D7EA 1XNQQ 2VNUD 1Z1VA 3MC0B 1VDDA 2OWOA 3T5JA 2JA9A 1PUZA 1HQCA 3FRHA 2FFKB 3KYHC 3OTQA 3MC1A 5J0XA 1P3QQ 1DGJA 4RQ8A 1LTRD 2WB1E 2ASJA 3TP5A 3CXCA 4YWLA 1WWVA 3H3VC 5J0UA 2ZT9C 4DV2L 3EN2A 4IUTA 2AGPA 4WRDA 1OAIA 4L5RC 4IBDA 2VA3A 3K7UC 1OXUA 2GVBA 4JK1A 3LNNA 1SG9A 4TUWA 3RJKA 5IGDA 3HOYG 3IECA 5I2YA 2L2DA 3JPPA 2A1JA 2WB1C 3H8SA 2JP1A 4O3RA 4KI0A 4OONA 1NK9A 4OX9Q 4GNXC 2BH2A 5HY6A 3SE0A 1KTQA 3H8MA 3LWEA 5GADC 2EAOA 3UQ0A 5KG5A 3H91A 4KODA 1CEZA 4FF4A 2KEDA 3B9JA 2XZFA 4ECTA 1QSSA 1H9KA 3HOXH 4GHAA 4RG1A 5E6JA 2XICA 2PW7A 5AM2A 4EYHB 4Z8XA 1NKBA 1PK1B 2DUYA 1EQRA 2QARB 4B9SA 1UE1A 2B2UC 2ZTDA 3IRBA 5IYCG 4EEYA 2VQEQ 2XGQA 2FE8A 4OX9M 3ULLA 1QZHA 5HGTA 5C3EG 1G8ZD 1RIPA 2W8LA 1WGNA 4O5EA 2O01F 1TS3A 1T4GA 1LYLA 5CRXA 4O5CA 3KHHA 2ZAOA 4R66A 1V1PA 4RZRA 2MFIA 2KZ3A 4C4SA 5FO8B 1II3A 1K28A 2B6GA 4M2YA 4DL6A 5T1IA 4JWNA 1HZBA 4DN4M 3MR6A 5LMNQ 3V7JA 2Z4IA 5EE3A 2R8JA 5TSSA 4YIJA 1N5XA 2LXEA 1SJHD 1KDCA 4RGNA 1I4PA 1RG6A 1PJJA 4XA5A 1E0BA 3JR4A 2JGAA 1LUZA 2KUMA 5ELNA 5EXPA 1K9MC 4DSFA 4HCEA 2IA6A 3S1QB 1KLNA 4F88A 5E1FA 4OO1G 2UUCM 3T5LA 1XMQM 4IUQA 4IUNA 4NXNQ 4HYKA 3GTKH 2R93H 4OJLA 4I2HA 2JZ0A 1EYCA 4C3IB 3N7RC 1IW7D 2KKPA 4RF1A 2AH5A 2QF7A 4NOOB 1H9SB 3SD7A 9ICJA 2R7ZB 4DFKA 1QQWA 4QNLA 2HCBA 3C58A 4DSJA 2XRQD 2UXBQ 4A3KG 8ICCA 5TISU 3D3RA 2W7OA 1PRTC 4MFFA 1I6HH 1XWLA 4FCVA 1EY6A 4OELB 2PMZE 1MJEA 3GTOB 4O3MA 2Q2HA 1QWYA 4D81A 2FDRA 2Q8TA 2PPBC 4M1UB 2MJ5B 3GQ3A 1VQ6A 1E9SA 4ITQA 1CTMA 3K0XA 1QE6A 3TAQA 2WKDA 4TUSA 4C3IG 3NBHB 1C1KA 1ZQ1C 2YNMD 3TP6A 5ITQA 2OOAA 3LCVB 4JB3A 4CF5A 4QZFA 4YVZA 4YCWA 2OQ4A 4IS7A 1EZ6A 2NWGA 3M4QA 3SV4A 3WKCA 4R1JA 4F2RA 3UE1A 3PIPA 3QJYA 5F3WA 5AI0A 2HOIA 4LK1C 5FO7B 2YQEA 2PXIA 1DOKA 4HL4A 2D0PA 4YCUA 5KFAA 3EZ5A 1Y69U 4ED2A 4PHEA 1PHJA 5ALIA 1SIJA 2APLA 1BNPA 1LT6D 4M9ZA 1K0RA 4DK6C 5IGFA 2GNOA 2JA7G 3HOVB 1YZ7A 3KS4A 3U6MA 1BKBA 2E2JH 1HRJA 4OU7A 2NVYH 2XFTA 3KZXA 2W03A 1NV8A 2FH0A 5ALQA 3I8ZA 3I4VA 3G7LA 4A3MH 4DR3M 5M3FB 3PUXA 2DJGC 3C3LA 1L8LA 3TACB 5FTJA 2A6HD 1G59A 3BS1A 5DB7A 4LF4Q 2F0FA 4IFDH 2FPKA 5KFKA 2QA4A 4POGA 3D4DA 2VANA 4LF7Q 1KYIA 1XS9D 2DWQA 2DUDA 5KG1A 3GTKB 1ILQA 1SE2A 1XXHE 1SMXA 2MP1A 3AYHB 3M1YA 2EH9A 3QYPA 2B21A 3N97B 4JI1M 2AQ4A 1XTCD 4I65A 2BA1A 2BPFA 4AYBE 2DI0A 5HHIA 1NK7A 4IOCA 3D0FA 4ZCKA 1KDAA 3AU2A 1SL2A 1KL9A 4IJEA 1J7KA 4OHJA 3CP0A 3HOUG 2VQFM 1L7NA 1J5EL 1F2MA 5KPTA 1BNOA 4RNOA 1TR5A 2E1FA 3LCUA 3G71A 1PJTA 3FYHA 2Y0QA 4ECSA 8ICHA 3B6YA 1RDPD 4IFDI 1RDFA 2KJ9A 2SNMA 4D82A 2L4NA 2OEOA 2Z9HA 4XK8F 2G9DA 5ITXA 3BXWA 3L29A 3QUTA 4UB5A 4J9MA 1ZD2P 4NV0A 4YN4A 2E2IH 2EZYA 5DEHA 2EAPA 1SV0A 1SGGA 1AUAA 5IIKA 3G4SA 2LYHA 3KBBA 3MHBA 3QXGA 3V72A 4JI5Q 2ZXPA 2L12A 1ZQRA 1IN4A 1Z4OA 1A6SA 3ZDEA 4GXJA 2F0EA 2F0LA 3AKZA 2P66A 3K59A 2YU9H 3S17B 2IX1A 1IYJB 2JA6H 1QLNA 2PMZB 4JV5Q 1NUCA 3PO2B 1B43A 2RSNA 3RUZA 4OD0A 2V9WA 3AJIB 4F8MA 2FLLA 1TH3A 1U48A 1L3SA 1ICWA 1IKLA 2XIWA 4L6TB 5CV4A 4YY3Q 5C4XB 3ZC7B 3W68A 4DV3Q 1STAA 3V6HA 1SXEA 4OEMB 1WIVA 1YJ9A 3BQ7A 1PFMA 2ALYB 4LFBM 1O7IA 1ML0D 4MZ9A 2UU9L 3R3OA 3KUPA 1WTHA 2E5LM 3L26A 3JPTA 4MFCA 5J0YA 1TWAB 2OXPA 1VQ7A 1AH9A 3A0BU 2ZIVA 3LMMA 2RDIA 5M3FH 4ED8A 4OW0A 1PTOH 2XY7A 1AZPA 4GKKL 2UXCQ 1XMQQ 4QZIA 3TZUA 5KFXA 3HY5A 2YMPA 4IR9A 1F9QA 2EZXA 1XYIA 3L25A 4YWMA 1SRUA 1V33A 2F2AB 4R8UB 1CKNB 3BBZA 3AOEC 1KDBA 2ATLA 4RKLA 4C3HB 2ISPA 1IYVA 4TUPA 2UUCQ 4Y2RA 3RR8A 2G5GX 2W9BB 4P0PB 1EY0A 4XXEA 3H4BA 3TANA 8ICEA 5CP2A 1FR3A 1SYEA 3H4JA 4H44C 1UE7A 2AGQA 2E2DC 1BDOA 1PJSA 3RJGA 1Q39A 3Q8XA 1STBA 2LFNA 4NXML 3HOWB 2HMXA 4WFN3 4PJ0U 1FL0A 1ZXIA 2R4EA 1BO0A 1B4OA 1D1IA 2G5DA 4LFCM 3HKZE 5DQHA 1SL0A 2N8NA 4GXIA 3AU7A 1ZXTA 3HT3A 4DXFA 5AI4A 2KZZA 3I04M 8ICNA 1UNSA 1S8OA 4LFBL 2NN6H 3OSNA 3GLHB 1NK8A 1K83H 1VQOA 3AMUA 4I81A 2VQEM 3HJSA 4DU9A 2ZJ5A 2B2VA 4K0KM 3ULJA 1OKSA 1YVCA 4UAVA 1XNRQ 2LHGA 1K83B 1STHA 1M90C 4JV5M 2A19A 3AV0A 2D0OA 1DGHA 3RE8A 5DDYA 1VQGA 3ND8A 4DR5L 4BLCA 2WF6A 2O2LD 5ELOA 3TL4X 1VCIA 1X42A 5M3MH 1MD2D 4FP5D 1KABA 2EDUA 1SMYC 5FJ8G 1HPCA 1WD1A 2JY8A 3KTQA 1N33Q 1BVSA 3C1EA 3T13A 5C44H 3HRDD 3PW5A 1S40A 4PD2A 5DG8A 4DK3C 1N56A 1D0KA 3L3FX 1LM0A 1Q8IA 1VQCA 1W5SA 4NLBA 3NBIA 1EU3A 4RA8A 4ANRA 3PNCA 3C9PA 4BXXG 2Q0ZX 3QZ7A 4MH0E 3J7BA 3L9AX 4US9A 4DV7Q 5J0TA 2PFPA 2IHMA 4JN6A 5AK6A 5DG7A 1XO0A 5C3WA 1JJ2A 4JI8Q 5GAHC 4F4WA 4P0QB 4GOPA 3E21A 2WSCF 4RNMA 4MN3A 1DCZA 1SWVA 5BOMA 1GJTA 2CV0A 2MUYA 3NSWA 3P75A 4RPYA 2ZXHA 4RHSA 2QB0A 5A2QL 1YITA 4AG5A 1X37A 4RQMA 3OJSA 1O7YA 5DLFA 3F5AA 1TKDA 1BPZA 5DAUA 4B3TM 2PI2E 3GTGH 1WXQA 4TQSA 3BU2A 4J9RA 2GLEA 4FE3A 1Q90A 5KYIA 3R9KA 2BJVA 2FMSA 1NJYA 5KFGA 2N78A 3E46A 4CJ2C 1QCKA 3HOVH 5IYBH 2QENA 2DAIA 7ICOA 3D4RA 2Y9TA 4DR6L 4OO1H 3TQYA 1NOMA 5ALHA 5IT9L 2KP7A 3BYTB 5AM0A 2PYKA 1TDZA 5KAIU 4LF5L 4RUAA 1ZMVA 1CT1D 1CZGA 1DGHB 5AJ3L 1GABA 1SNCA 2EYLA 3H09A 1WG8A 4AYBC 3U6EA 2CHBD 2KBNA 3J80i 4X66M 3U6SA 2QBYB 4OXPA 3EJIA 2NRWA 1IM4A 2A74C 4MHEA 2L4EA 1J5EM 1PZJD 3PMNA 3GTJB 4KLHA 1N75A 1WTPA 4JI6L 1G2TA 4Q8FA 4FF3A 2UUBQ 2JMGA 2CPRA 4KD4A 2KHVA 1EXNA 4CGYB 1PVQA 3DWQA 4GRIA 4DV4Q 4OO1I 2F0MA 2DKZA 1G51A 7ICQA 1XTDA 4DFMA 1JX4A 1TAMA 3M3YB 1X32A 2HVHA 4FXKC 5HNKA 3N7PD 4G4OA 1SV4A 4DV7M 4YHHM 4UAZA 2XO7A 4M9JA 4JOIC 4A4IA 1GJSA 1EFUB 1MSHA 2BZFA 1OQYA 1JC7A 4ULLA 2WIIB 2R7FA 2O6KA 2KHIA 5KFOA 1PLFA 1WCMB 1N2XA 2R45A 1OUQA 1PTOC 3H3VI 3EUB2 2FLNA 8ICSA 2R93B 1TWGB 2W55A 3ZI4A 5CC4A 1STEA 4UBBA 1XNQM 1WHCA 1QTMA 4O9MA 2MUTA 4FZMA 3GP1A 1S72A 2OEHA 3IDWA 3HPOA 4QB4A 4RQ3A 2D6FC 8ICYA 3J27B 4I4LA 5D46A 2W54A 3J81S 3PUWA 3UM9A 3LWLA 1KFTA 2F0OA 3VDYA 1SXTA 1X65A 3DHQA 1V34A 4R3DA 4EIWA 2K03A 4XQNA 2E2JB 4QZBA 3PSTA 3QUQA 5KFYA 1EY4A 2F03A 4V190 1NNXA 4MGYE 3JC66 3RJHA 3ILKA 1ZEQX 5J22A 2F0VA 4LJ5A 3J7AV 3S2DH 4LFCQ 4A3JG 3RNUA 1JIHA 1ASYA 4N9TA 2JY5A 5KFCA 2NRZA 4F5PA 4FO2A 2XFSA 4DV7L 2WAQB 3OMCA 1TFRA 4YXJA 4KX5A 3W0LB 5KT3A 2Y1JA 4I7AA 2R3ZA 1QANA 3UK6A 4B9MA 1NJGA 3W2DA 3N6RA 1NV9A 3OMGA 4UY8C 4K0KQ 4DL4A 3IHQB 4DAYA 3SAVA 1T3NA 3FMCA 2P6RA 2Y9UA 5EP2A 4AG6A 1RL2A 3CF5A 4CKEA 2F44A 2LKYA 5I9PA 1EL0A 4L78A 3NE5B 2CVRA 4Y2JA 5DM73 3K58A 2K4PA 3OTOM 1WR1B 2XIDA 3E9HA 1ZD4A 2F1MA 2KTQA 4GIBA 3LWMA 4G7OC 5FJ8H 4DR7M 1WTQA 1NZPA 3T79A 4KLIA 4WJWA 2MR9A 4I2IA 2W9CA 3V76A 1VQIA 4C4TA 3MHVC 9ICHA 3AEVA 3NWLA 2N55A 4IZ8A 1IXZA 2ZG6A 5AKYA 1TKWB 5EPJA 1FJGQ 4UP7A 1EIJA 4YXMA 1E2WA 3HGBA 3RFWA 5KNCA 4DUZL 3ZCBB 3KD3A 4GLAC 2QLTA 3PO4A 4RKUF 5KFIA 5ITRA 2YTYA 1ED1A 1PRTD 4LJZC 3E5SA 3CCLA 2W9MA 1NJXA 4LUZA 4Q44A 4KHPQ 4QOSA 3U9SA 2N3SA 4JC0A 1C0AA 3H0LB 3KOOA 3ZDAA 3HOUB 4JI2M 4JI5M 4JI7Q 1TWAH 3A56A 3I51A 1PRBA 1XNRM 3KKAC 5AM3A 4R63A 2C22A 4NWIA 3CCEA 4A8EA 5ITXE 1O7LA 2QPAA 4YY3M 5J0WA 4AKIA 3C28A 2CHVA 3U6CA 3C5FA 4DFDA 7ICIA 2AUKA 2YYZA 4ZUIA 4RNNA 1IL2A 2O4XA 4AQYQ 4Q45A 2EYOA 1SSOA 4G6ZA 4JBJA 2NQ8C 1KFVA 2H5XA 1HR0W 2VUMH 1QVFA 3SR6A 4DAPA 3G6XA 2Z7JA 3SENA 2HHVA 2HOFA 2DWLA 1ZV1A 3F5EA 2RDJA 4NPSA 1L2DA 3IN5A 4DOBA 5T1GA 3GDEA 4CDDC 3KBGA 2F4IA 2JA8B 4LJ8A 3U6OA 2Y0SC 3S1MH 2DZNB 2VB3X 4PZNA 3FVQA 5IODA 3HWTA 2H1RA 4QZHA 7ICRA 1OXXK 1GJXA 1Q7YC 1FGUA 1QUQA 3HP3A 2BQUA 4LAAA 3PW4A 2HHHQ 2XI9A 3GV8B 5BOLA 1HA5A 2CW0D 4BXOB 4II7A 2OPFA 1T3QA 4PZOA 4DEZA 4QZAA 5C0YA 1GD7A 4LF7M 2KKVA 2HQLA 2I07B 4AYBG 2CH4A 1SFOB 2BKEA 4APVA 5DDMA 4KLOA 3W1GA 3RZDH 3SMVA 5CWRA 7ICPA 3OWFA 2J7NA 4B3ML 2G8LA 4CKCA 2ODGA 1A77A 2I1QA 4F3OA 1N63A 4P16A 3F92A 3SC3A 1N32M 5AKXA 4WURA 5KFUA 4G57A 1RZTA 2FE9A 2DAEA 4X64M 1K3XA 3I4YA 3H0MB 2JN4A 2K5NA 4H7BA 3M6KA 3JAMc 1KIXA 2OO9A 3CQZB 4A3GB 4FWDA 3HS0C 2JNHA 3GPPA 3I01M 5IINA 1MQ2A 1EWIA 1XMQL 1SYFA 4K2LA 4ZOHC 3WK6A 1A62A 3HWSA 2ZJPA 5F3XB 1PYSB 4O2DA 1KAAA 1KBUA 2A69D 2L5YA 3RLFA 2EJFC 5GAGC 3K92A 2W04A 2KRUA 2X8AA 3E3XA 3EVQA 5ALGA 5C0XH 2JA2A 2LVPC 5ALLA 2AWOA 3SVMA 1JN3A 4KKUA 1YSYA 4LF6L 3HOWG 2KE7A 1GO3F 1TY2A 3KF6B 2WF9A 3KHLA 1KLUD 4B3SQ 4ZKCB 1L2CA 3BJUA 3PUVA 3U5ZB 3M6ZA 1AEXA 1FJGL 5I6YA 4RGTA 1HQRD 2IJ0A 2GA4B 2E8NA 2KNAA 5CBAE 4B3RQ 3S2DB 4DS5A 1L1TA 1YNXA 2J6SA 4RPXA 2MA1A 5EXTA 3E2EA 1YUBA 5EWEA 2F52A 5COYA 5FOBB 5IP7H 4KLJA 1J2NA 2LI6A 1TVXA 3AFQA 4DPGA 4NXMM 3S14H 5EQ0A 1E3PA 5BN5A 3BDPA 9ICEA 4CHTB 3LYSA 4UASA 4R9WA 2G5HB 3VYRA 3B7QA 5DB9A 1I6VC 4J9NA 1CKNA 5IT9c 1T43A 1O03A 3IM1A 3T1HQ 1F2ZA 2FJ2A 4NM2A 1IY1A 2UVRA 2F4VQ 3E9IA 3CYMA 1QQ6A 1D5XC 1OXTA 1E7ZA 2PCFB 2SNSA 5AI9A 4A3CG 1NHGC 1NY4A 5IIIA 4BY7H 5G3LD 4JI2L 3FRIA 3GIKA 2UXBM 1SMYD 1OXVA 3J7AF 1RHPA 2NZOA 3T5KA 1D9DA 1WTWA 2PI5A 2DPIA 5C4XG 2XF3A 4CRXA 5J2KA 1XX8A 2K75A 3CRXA 1IIPA 4C8LA 4R71A 2QKIC 1IBKQ 2FLPA 4A3EH 4A93H 2HSZA 3L2AA 1R9TB 2KEBA 4A3CH 3PY8A 4C3IH 1DM0B 2N88A 3LWUA 3U50C 2RGOA 1UHUA 1TV9A 3HHYA 3L4PA 2AXTU 2JXNA 4Y7NB 3H4DA 1BBXC 3ZJYC 2KEEA 4OVZB 2HDOA 2Y0SE 4GKKM 3MGHA 1EQVA 1X9XA 2GVAA 3K5OA 4JVZA 1I4QA 4ME5A 4UDUC 3NVZA 3PO5A 3Q8DA 9ICKA 4DOCA 1A2TA 5C6AA 5IP7G 3KDSE 2G9HD 3UMMA 5CA7A 3Q8GA 3VR6A 2WV6D 1JOKA 2BDOA 2PI2A 3QEAZ 5M3MB 4DSKA 3GLGE 9ICVA 2DGYA 1L2FA 1LABA 1KSPA 4RF0A 1JWUD 5KFHA 3N4MB 4Q7JA 2M00A 4ZUJA 3S1QH 1GHJA 1IBLM 2N35A 4OL7A 1Q82C 4L6V6 2KHQA 4ECZA 4DL7A 1IBLQ 1VQLA 4ICAA 1D6EC 3UXNA 2DN8A 2JP7A 1FD7D 5A35A 2DJFC 4P74A 4A3BB 3T53B 2MGWA 3J7AS 2KIWA 2JXJA 2J0TD 3MGVA 1IXRC 4J9QA 1HH2P 2A1JB 1SNDA 4FD2A 2FXQA 3MR3A 5J2IA 1K1QA 1HR0M 1FGBD 1DO0A 3BDOA 4QJFB 1J97A 4XT3B 4V0BA 1JQJC 3HJQA 2DXIA 1PH1A 5KGUA 3SYKA 1L1OA 4JV1A 1GVNA 2KCTA 1RQLA 2W43A 1HZ9A 1MX0A 4IRKA 5EAYA 4Y2XA 2CP8A 2RGHA 4XRHA 4F2SA 5AK3A 1TWFH 4LZGA 3QB3A 1ZJNA 2LVAA 4Z6FA 1D1KA 4CF4A 3QOJA 4K8JA 5LL6S 3NS1A 4DA2A 5L9XA 4QGUA 1Y88A 1MHWC 3V96A 5IGCA 1SFOH 5NUCA 4OJ6A 1E2ZA 3DMUA 4LZZA 3VK7A 1N34M 3DLLA 4DQQA 3GTMH 2JUJA 1I94Q 2E5LL 2W9CB 4JI0M 2FS1A 3HU3A 3D6WA 1NK4A 5ALEA 2A1AA 4XYOA 1WTVA 1AW7A 2K0BX 5FTKA 1CFMA 3SK5A 1SXJD 1N36L 1TAQA 3T5HA 1F9RA 4DF4A 3HOZB 4X66Q 1YE9A 1COOA 4UAIA 4X65Q 3KFUA 1Q3UA 3HOXB 2AQ0A 2AUJD 1TWHH 3D31A 1JOQA 4CKBA 3KSJA 5K36H 1JR3D 3O0FA 4M6WB 4JG2A 4G3OA 3HU1A 1RTNA 5IY0A 3S15H 1GLNA 5ALXA 9ICIA 3U61A 2HHXA 4MEXA 1PK3A 2NRVA 5L1MA 1ZETA 1K8OA 2L11A 1SXJB 2K04A 3U60B 1KRPA 5IYDH 3TADA 2BCVA 5K4LA 3S15B 5JJIA 3CMAA 3T15A 1WTOA 5FP0A 3FE3A 3SATA 2ZM6Q 4I29A 7ICLA 2MU2A 5C5MA 2KJ8A 1I4RA 4OX9L 3PX0A 4IBFA 2Z6KC 3NWTA 5ITYA 5AHXA 2O25A 1PXUA 4PV1C 3J7YW 4IFDJ 4G4KA 1IBML 3GTPH 1SE4A 3FKEA 4NLKA 2ICEC 1C7YA 4MF8A 2D8CA 3ISDA 2QEJC 4NMZA 4IQUA 4DNIA 5M5XB 3P7JA 1S9FA 2ZIVB 1LACA 1TQOA 3THGA 2IOHA 4L4UA 4XBOA 3TPZA 1N77A 1HNXL 4EX7A 1ZYRC 3WHKA 4FXDA 1EY7A 4BBRG 1HQYE 3HW8A 3BS5B 4GN4B 1SKWA 4YCVA 1NNUC 5FK9C 2K4HA 1NNLA 5G5HA 2KN7A 1D8LA 2BDNA 2F0TA 2O5JC 3RR5A 1RU3A 1HZCA 3D2NA 1L5UA 3C1YA 2DQNB 2NYVA 4FWGA 3MBYA 5KTQA 2JE6I 2KHSA 1C8CA 1NY6A 1PTOB 1VF7A 3SEIA 5EE0A 3KF8A 1HUOA 2XH9A 1SL1A 4PMBA 4P73A 4DAVA 3VCBA 1GXDC 3Q8KA 1OO9B 3UMBA 3SQIA 4JV0A 2ALZA 4NLCA 4DSLA 5IGGA 4UB2A 4Y7NH 2X6LA 1VQNA 1QCBD 4LWCA 1HIWA 4F5QA 1SNPA 1BF4A 1PFBA 5KT7A 4L5QA 4ELUA 3CC4A 4JBKA 4A75A 4G9BA 3NVVA 4R4CA 5EGTA 1XNSA 1V43A 3FM9A 5I9OA 4Q43A 1RCVD 4GXKA 4UP8A 4IL6U 3PIOA 2ZANA 3KOWE 2FNAA 1ESFA 2PO4A 4DR2M 2R92G 1D0MA 1PH7A 2F5PA 4I2BA 7ICKA 1PFSA 4DUYL 3LGJA 2CRUA 1Q86C 4QUCA 4BY7B 2E8PA 2IHFA 4LJ4A 2IOFK 1S0OA 1X6OA 2P35A 4L5SA 2K47A 5HMLA 4RQ6A 4G4NA 1DD2A 1N61A 1FNVA 1IHZA 4RWSC 2BA0A 4C7ZA