1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
b'MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
1MJEA 1G51A 1BPEA 5IYDG 4KHPQ 3MR2A 2VY3A 4EBCA 4DV2L 1H95A 4DV6L 1Y1WH 2XC9A 1T43A 4UB4A 1VEJA 3J81j 5CHGA 1E1OA 3HKZG 1L1OB 1YVCA 1VQ1A 2JY6B 3QZ8A 3H7IA 2ALYB 3HOZH 3K7AH 4XUSA 4J9LA 4B3MQ 3BBZA 9ICNA 3IHQB 1NJXA 1U5KA 2EKFA 1TKDA 5KFDA 5HNKA 2JEFA 2IHEA 4YWLA 1W2BA 4JBJA 5EOZA 4IQUA 5HP4A 1ZQZA 3AFPA 2UXCQ 1PH3A 3AU6A 3B6YA 1TK0A 4GLVB 1HNWL 4QW9A 4LNQA 2RRUA 9ICRA 1ZQOA 5L9XA 2AU0A 4JI1Q 1TXYA 2OTJA 1GVPA 4IJHA 2H5XA 4IR9A 2PQAB 2A1JA 5IWAL 3PR5B 1GD7A 4FBUA 1KFDA 5JUMA 3CMAA 3JPSA 1HR0L 2WFWA 1U48A 1JMSA 1HH2P 4RQ7A 2MJ5B 1KXLA 1LM0A 5KT3A 1HZAA 4PPXA 4ELTA 1ZQAA 2XCAA 4X5VA 1Y1VH 3TFSA 1OXXK 1B70B 2JP7A 5KT7A 3C5GA 2BCSA 1U9LA 2UUCQ 1PGYA 4LUZA 3I4NH 2R92H 3OHBA 3RBDA 1XXHE 3THVA 4DR5Q 2IY5B 4IPGA 2DNAA 1B7YB 4JI7L 4YG2A 1G4AE 3GQCA 1I3QH 2DAMA 1K83H 3ZDBA 1TK8A 4EYHB 4A3GH 4F8RA 8ICJA 4C3IH 3LDAA 4QZ9A 4LF5Q 2ZJ5A 1HUZA 3HOYH 4YCVA 1PH5A 2FMQA 2LVQD 4BXXH 1MQ2A 2AQ0A 4DV3L 2R8HA 4KN7A 4O5KA 2N78A 4TQSA 5KT5A 1UE5A 3J81c 1Z9FA 4DFPA 2BWEA 3SYZA 9ICAA 4KLFA 4ECRA 4DQSA 4A3MG 2D0PA 2KENA 2MUTB 5LMNQ 4DR4Q 4FS2A 5EWFA 2VANA 4LF7Q 4RPXA 1KL9A 3PV0A 4BBSH 4A93H 1COOA 2WAQE 4CCHA 4LUVA 4R63A 5C3EG 1WGNA 2LTUA 1QLNA 3AU2A 1P16A 4O5EA 5GAGC 5IP7G 1KAWA 1IZ6A 2B63G 4TQUS 4BY1G 7ICPA 3G6VA 3M9OB 1VQHA 1S0NA 2C2DA 2PFOA 1C9OA 3B0YA 4KN4A 3CQZH 4EBDA 3Q8DA 1TTEA 1IL2A 3MR5A 1N36Q 4KLIA 4RMFA 4KHZA 4KHPL 5D46A 4Q44A 3STBD 1SKSA 7ICJA 4BXOB 1D9DA 4HYKA 2L15A 4R4IA 4DUYQ 3JPTA 4ECVA 2ZTDA 1PZNA 3M3YH 1UA1A 4Q7JA 4B9NA 1ZQBA 4B3ML 2NRVA 2F4VL 5IIKA 2E2IH 1X9SA 2F3IA 3PO3H 1ZQNA 1UFZA 3K8AA 2ZUCA 4KLQA 4B3SQ 1U4BA 1ZQQA 1HJPA 1WCNA 2FMSA 9ICWA 3KDFA 1NBWA 1NTGA 2BKEA 2KTQA 4J9NA 5BR8Q 2LBCA 4PGQA 2YTVA 2F1HA 2L4EA 4O9MA 5J3BA 4P4PA 4FBTA 3H15A 3TI0A 3L0OA 8ICNA 5FLMH 1Y88A 1NMFA 7ICRA 4K4GA 4KLUA 3G48A 5HGQA 1G41A 1NJIC 1IBKL 4YD2A 1SKRA 5IIMA 3RB3A 5M5YH 4YFKA 2UUAL 1VQPA 4GLAC 3AFQA 3BU2A 2ASJA 7ICSA 1PH4A 3S1RH 3FE3A 3OW2A 3CCMA 1CKOA 4Z6EA 1NKBA 2JY8A 1MIUA 4AYBE 9ICMA 1Z00B 4DR5L 1YEZA 1ZQSA 4DL3A 8ICKA 3PUWA 1U49A 7ICEA 1NJYA 2JA6G 5JEAG 5IYBG 1S77D 5F9NA 2QNJA 3F2CA 2HHSA 3I7FA 3PO5A 3I4OA 4LF5L 1JXLA 3RLNA 2ZTEA 3S2DH 5DBAA 2XY7A 4TURA 2LXKA 1D7QA 2HHWA 4Z6FA 5DQIA 2MGWA 2HHTA 1BBWA 2ID0A 1ZQVA 2BPGA 2JA8G 4M9GA 3T6PA 4DK3C 3LCVB 4M9JA 2R7ZG 1BPYA 4P72A 4J15A 2VZAA 4BDPA 3KLWA 1DOQA 4RUAA 2DAEA 5KG2A 2ZJRA 4ED8A 4YWKA 1MSWD 5LMNL 4DR4L 2OO9A 3PW5A 2KNAA 4XQ8A 4RUCA 2NVYH 4KTQA 2MNAA 4QGUA 3S2HH 1A5TA 1VDLA 4GXKA 1EYGA 1EXNA 1TK5A 4M2YA 4DL7A 2KZ3A 9ICIA 4DLEA 3GTMH 1S40A 1IBLQ 4M0AA 5KFNA 2OQKA 5FJ8G 1D9FA 1PH9A 3K81C 4JBKA 2CWAA 3M8RA 2JJQA 2VQEQ 4QZAA 1YJ9A 5KFRA 4DQQA 1EUJA 4KITB 4TUSA 1TAUA 2E5LL 2AGOA 4YQWA 4X6AH 1GO3E 2V1CC 4DKAC 3K80C 1JMCA 2UVUA 1N36L 2GWSA 3ER0A 1XSPA 2UU9Q 2BPCA 3PMLA 1KD1C 3M4OH 2LVAA 2HT1A 4UB5A 2XGTA 3KHHA 1FL0A 1KDHA 4YP3A 3J7ZC 5AJ3Q 4IQWA 2CFMA 1QVGA 3PSIA 1ZQRA 5C44H 4DUYL 4WJ3M 5J2KA 4A3IH 3I4MH 1HZBA 8ICRA 1OTCA 4YWMA 2R8KA 3GO5A 5D49A 7ICHA 1ZJMA 4PHPA 4RNOA 3PF4A 2ZM6Q 1CSQA 1KFSA 2E8GA 1B43A 4F5PA 5TZVA 5KTQA 5DLQE 4GS3A 2NZOA 4EZ6A 4B9SA 3G6EA 4B9VA 4R8UB 2EJSA 1KRSA 3ERSX 4LF8L 4P4OA 1SKWA 1HZCA 4QL5A 4Q8EA 4ECWA 1L3VA 3ZDEA 1NK5A 5BR8L 1RYRA 1XNRQ 4MZ9A 1AE2A 2AQ4A 7ICMA 2M9NA 5KFHA 1S76D 3GILA 4X65Q 5DB8A 2RHSB 2ZUDA 3Q8QB 1NE3A 1WOCA 4J9KA 1AIPC 1VEKA 2CCZA 4O3OA 4NLKA 3RRHA 4GNXC 3JPNA 3ZDCA 3T5KA 2XGPA 5KT6A 4NXNQ 3PF5A 4GXIA 4UP8A 1EOVA 4M6WA 4DR3Q 4DF4A 1Q12A 3F2DA 9ICTA 4F5OA 1P3QQ 1A76A 3UDGA 1VQ5A 4JC0A 2HIXA 4PMWA 4DR6Q 4YCWA 5M3MG 1LUZA 3ISDA 1CKNA 3S15H 5IIOA 4C8OA 3BQ0A 3ZDDA 1VQEA 2BR0A 4A3LG 1KIXA 2VA3A 3S1MH 4BY7H 3RB0A 4LWCA 1YJWA 4RQ4A 2AMCB 2K0BX 3FKIG 3BDPA 4QZFA 3PW7A 4LFBQ 3EWAA 5KFEA 3MR3A 3E46A 4A3DG 1VQ9A 2B3TA 4JK1A 3W5OA 3UXOA 3BJUA 1E24A 3M9BA 2GVAA 4A3EG 8ICBA 2BA0A 4I2EA 5J29A 2I5HA 3TREA 3MDAA 2VUMG 1HT2E 2E2JH 2KNVA 4I2DA 4PZ6A 5KFVA 3W1BA 5KFIA 1ZQUA 3UE0A 3RJKA 2ASBA 2RHQB 3K0XA 4O0IA 4YR2A 4I2IA 1WJ7A 4JI3Q 4I2JA 5KG0A 1NV8A 1CEZA 4GNXB 4KLDA 3CC2A 4AIMA 4R65A 1O7IA 5JI2E 5J2BA 2N8NA 5DBCA 3GIKA 3TQ1A 1IBLL 2YV5A 4OWWB 1UA0A 1H38A 1XB2B 3UDFA 4HIMA 8ICXA 2I9GA 3MEFA 4KLEA 2A8VA 3DM3A 1S0MA 4G3IA 8ICGA 2R8JA 1XJVA 5M5WH 1YBYA 4KLMA 1NY4A 2R93G 1VQBA 4RPZA 3K9OA 5KFLA 2UU9L 2A19A 3CF5A 2JY7A 4YMOA 2CKZB 2JA5H 4GLXA 4LF9L 4JYAQ 2DAGA 2DAKA 3TQYA 5CJ7A 1JT8A 1X56A 3HKZE 3NELA 4PH5A 2Z6KC 2LVPC 2W8KA 3DLLA 1NK4A 3NTUA 4L5TA 4F4WA 4ALPA 1N34Q 2ZM6L 2QSFX 4IO9A 4JI8Q 4WP2A 3G6XA 3E9HA 3V6KA 1VCIA 4DAYB 3HP6A 4P71A 1K0RA 2ZJQA 5KFZA 4HEOA 3HOVG 3I2ZA 1WHCA 4IRDA 4C3HH 2JEGA 3OSPA 2KFZA 4ELVA 3H4DA 4O3SA 1IYJB 5KFPA 3S1QH 4UB1A 2JZBB 2NN6I 4A3CH 1L3UA 1RXWA 1XNRL 5DBBA 4OWXB 3CMEA 2QHOB 4YD1A 5L1JA 2EIFA 1KLNA 2Z6KA 4DV5Q 3PX4A 2I5LX 4QZDA 3CC7A 3LWLA 4RQ0A 2FLNA 1N33Q 3RB4A 1ZQJA 2W9MA 1GO5A 1OAIA 1MN3A 4IQTA 4NXNL 4F91B 5D4BA 4A3BG 1EFUB 4DR3L 2D62A 1XNQQ 9ICGA 5J2JA 4A76A 1S0OA 3RN5A 4M47A 2BDPA 4R4QA 4DR6L 4ECYA 3TFRA 2Y1IA 1SLJA 2PXIA 4J9MA 5C4XH 1K8AC 1X65A 3VDYA 2MROB 1GKHA 2AWOA 4JI2Q 4PHAA 3RJJA 3MXNB 4F2RA 4UPAA 2IX1A 1SZPA 3PO2G 4GKKQ 2ZJ8A 2W9CA 7ICLA 3PO4A 4F5QA 1JXEA 1M90C 1XS9D 3CP0A 1NK8A 1XMQQ 1VQNA 1WIVA 1KQSA 3PX6A 1NV9A 2UUBL 2FXQA 1JIHA 3AEVA 4JCVE 4DQIA 5DQGA 1VQDA 1PYSB 2JA7H 2Y0SG 4M9HA 5ELNA 2FMPA 4A3JH 1K3RA 4RPYA 5J2IA 2VQFQ 4R64A 4WJ4A 3Q8LA 2Q2HA 8ICAA 1RIPA 3EPIA 3S16H 2N49A 2A1JB 1Q02A 4JI3L 4YHHQ 5KG5A 1T3NA 2UXDQ 3H4JA 3C1ZA 3GTLH 5LMNW 5J0WA 3CC4A 3TANA 4RU9A 3NEMA 4RT3A 5IP9G 4DUZQ 1XTDA 5C5JA 3PW0A 4DV4Q 4A3FH 4EYIB 2I1QA 1FVIA 2DAIA 4GOPC 2HHUA 5J2EA 2B3GA 5DB7A 5J2CA 4PHEA 3J81i 1NMGA 5KFMA 1MC8A 4OWTB 4GN5A 1E22A 2ASLA 2NZHA 5JJKA 3N4MB 2YTYA 4KLOA 1U45A 1QSLA 1WFQA 2MR9A 1KRTA 1DGSA 5IINA 2MO0A 1SFOH 1VQCA 3C2MA 5DDMA 4B9TA 4JYAL 3TRZA 4DR2Q 5KFBA 2CP8A 4R71A 5EWGA 1UWVA 5DGAA 4K0KQ 5KG7A 1XC9A 4JV1A 3HOUG 3PVXA 2UXBQ 4DQRA 3FDSA 1UT8A 9ICVA 5KFWA 1PHJA 4DOAA 1ZQYA 4BWMA 4ECXA 5KFCA 5L1KA 5C0XI 4RQ1A 4DOCA 1GM5A 1S10A 1N34L 4GOPA 3HFZB 4JI8L 3JAMi 8ICOA 1JN3A 5BOLA 3NENA 1Y1WG 3MABA 5LMUQ 3C2KA 5C0XJ 2IHMA 4IOAA 1X54A 1E7ZA 3S17H 4F4ZA 4DS5A 3PNCA 1ZQGA 3CD6A 3HOZG 5F9LA 9ICCA 3EW9A 2XCPA 4HJ5A 4KLHA 1VS0A 3NBHB 5IY0A 5CA7A 3ZD9A 3JAMc 4ED0A 1OXVA 4QZ8A 4YY3Q 3MFIA 4KI0A 3OJUA 3H3VH 4HIDA 4DSEA 4QJFA 4DV7Q 3M7NA 1N33L 1PA6A 2BCVA 2JZ1A 9ICHA 1DV0A 5J0UA 3A5ZB 2BGWA 9ICSA 3GD7A 5J0SA 4RQ2A 4RG1A 3N97B 4NY8A 1XNQL 4JV0A 2YU9H 3W1GA 1ZQHA 1BGXT 1JJCB 7ICFA 4JI0Q 1V92A 3UDIA 4P74A 3G71A 3F2BA 5J2DA 2ZJPA 1J6QA 1Y8GA 3JPQA 3H40A 1BVSA 2PNHA 2UXCL 1Y1VG 4JI2L 4RZRA 3TS2A 4GKKL 3PGZA 3G4SA 4JI1L 4MF8A 3KHLA 4OXPA 3V7LA 1B8AA 8ICMA 3C5FA 2JEJA 2JEIA 4HJ7A 4BBRH 1VQMA 1XMQL 4AQYQ 2DI0A 3BZCA 4F3OA 2R92G 4JBWA 1AE3A 5HHIA 5KFKA 4DSLA 1X3FA 3HOWH 2HHXA 4JI6Q 3U58A 5CWRA 1L5UA 2WAQG 5C0XG 4A3GG 1MQ3A 2OWOA 4Q43A 3HOYG 1KYIA 3IECA 4DR1Q 5J2AA 3K4GA 2R8GA 1OTRA 4BXXG 3KDFB 2EKKA 4RQ3A 8ICSA 4ME3A 4YHHL 4O3QA 4EBEA 4GN4B 4QW8A 1G6PA 4TQRA 5KFOA 2UXDL 2BH8A 4O3RA 4RQ6A 2UUCL 1E3PA 4B9LA 4DUZL 3D31A 8ICZA 4DV4L 1A63A 1ZQCA 1S3OA 3RTVA 2MAXA 3JPOA 2J6TA 4DLGA 1KTQA 5DDYA 3V7JA 4DFKA 1B22A 2WB1E 4JOIC 2CWBA 2HAKA 4BBSG 4C8MA 1SL2A 5FLXc 5E7NA 4A93G 8ICTA 1BKBA 5JJIA 1SMXA 4DR2L 5DG7A 3AUOA 3ETLA 4K0KL 4DBGB 5DB6A 5KFXA 2ZJAA 2UXBL 1IBMQ 5BPCA 2BCRA 3GLIE 4I2BA 1QUQA 3GTGH 2JEAI 3OYYA 3QEBZ 1D8YA 1JX4A 1XWLA 1RYSA 5IYCH 4LF7L 3KOJA 4M9LA 1XMOQ 1BPBA 1N32Q 5M3FH 2XTIA 5HMLA 4JOIA 2JQOA 4IFDI 3FHWA 5LMUL 4MFCA 4K4HA 1YHAA 2OCEA 4C2MH 2Q2IA 2I5MX 4IRKA 3WWVA 4DSIA 4UQGA 5KG1A 4I2CA 4IFDJ 2VNUD 4PHDA 2JUJA 3FRHA 3BZKA 4YY3L 5IILA 2K5HA 3PO3G 5GAEC 1A0IA 4F4YA 1DO2A 3PCOB 2WP8J 3F92A 4DV7L 1R4GA 2VS1A 1TR8A 4O5CA 4O0AA 3K75D 4OX9Q 4B3TQ 2OOBA 2KNZA 1EIFA 4NM1A 3CCVA 4NLZA 3GIJA 1ZETA 1U47A 3Q8KA 4EZ9A 4F4XA 5FLMG 4JI0L 4MF2A 4DV1Q 2C22A 2VL6A 2J6UA 4HJ9A 4J9PA 3J7A5 1N9WA 4I28A 2IT1A 4ED2A 2AJQA 1S9FA 1C0AA 4QWCA 3OHAA 4B3SL 5KFSA 3LWMA 4NLNA 4A3KH 1QZEA 3LK9A 5L1IA 3H0GH 2MQHA 4DFMA 3M4PA 3MFHA 5DKWA 2K14A 5DLGA 4J9SA 1Z47A 2HHQA 3KF6A 3M4QA 4K4IA 1X3GA 4AQYL 4YXJA 4J9QA 3UPQA 2ASDA 2PI5A 1WCMH 1XPOA 4JI6L 1LB2B 4L5RC 2ALZA 1XU4A 8ICWA 1UEBA 4MEXA 1HNXQ 3Q8SB 4DR1L 3RAXA 4JI5Q 2B29A 1Q81C 3V6JA 2K4KA 5J0OA 2E2HH 2Q2UA 1VQOA 4IFDG 1ZQDA 1K73C 3HPOA 2KHIA 1ZQXA 5KFUA 4LZDA 4XTCS 2LSSA 4JG2A 9ICQA 2NVTH 4GEWA 1X2IA 1A8VA 4I29A 1VQLA 4FS1A 3HOXH 3IHPA 4EX5A 4DEZA 1LYLA 5DLFA 3QE9Y 1AH9A 4ECZA 5GQOA 2BHNA 4I2AA 1Q8KA 3M9NB 1SE8A 2ATLA 1IXSA 1Q46A 4M6WB 1UE1A 4DWIA 1IFYA 2FPMA 4UB3A 1CKNB 8ICQA 2RF4A 5IYDH 4IRCA 4I2HA 3ZJYC 2K9DA 1J5EQ 3GLFE 3M9MB 4I2FA 1NJWA 2KHJA 1IBML 4DSFA 4NPSA 1WGLA 2XGQA 3MDCA 2W9BA 4B9UA 1X55A 4F50A 2IA6A 4RT2A 2G3QA 3PMNA 4JUZA 1QVFA 3T1HQ 3PUYA 5J0TA 3D0FA 4P4MA 8ICCA 2NVQH 4O3NA 4J9OA 1ZQLA 1N32L 1NKCA 3AQQA 3H8WA 5C44G 2PFPA 4A3IG 1N8RC 3I4MG 2XY5A 3GDEA 1Q82C 2VQEL 4QZHA 1M1KC 2BPFA 3T1YQ 4DL6A 3U4ZA 1BPDA 1MJCA 4FO6A 3EIVA 4YMNA 3LGJA 1VQJA 5CB1A 3GV7B 2F1JA 4ECSA 1NK6A 2FLPA 4J9RA 3QEAZ 4QQBX 1SL1A 2JNHA 1I5FA 2DGYA 3GTQH 4ECUA 3GTOH 4YN4A 4OX9L 3OSNA 4X66Q 4B3TL 4BGDA 5AJ3L 1VQ4A 2MO1A 4HJ8A 3AYHB 2BCUA 4Q45A 1YHBA 3TARA 3FYHA 3EYZA 4DQPA 3GTPH 2KZZA 2BQ3A 4YXMA 3RJIA 2HW3A 1V1QA 3PUZA 4DV1L 1VQ7A 1CKMA 3PW2A 5IE8A 2RDJA 2PFQA 2A1AA 3RBEA 3T5HA 1N48A 2OOAA 4XA5A 4Z6DA 2DKLA 3M8SA 1YJNA 5DB9A 9ICKA 2I0QA 1UT5A 1S72A 1BBUA 4O2DA 2XO7A 3UQ0A 4IPDA 4PG3A 1VQ6A 2HVIA 2BQRA 2HHHQ 3CPWA 4UN2B 1QTMA 1VQKA 4UP9A 2FLLA 2N3SA 2ZTCA 4X65L 2AWNA 3SV3A 1WJJA 1ZQKA 1YZ6A 5GADC 3RNUA 5L1LA 2R7DA 4BY7G 3IM1A 4QIWE 3T5JA 3K9PA 1PFSA 4F4KA 2VA8A 4HJAA 1L1OA 1MKHA 4I2GA 1SROA 4X62Q 4JI5L 2YTXA 4UAWA 4PZ8A 4A3MH 3GIMA 4DS4A 4L5SA 1OXSC 1ZJNA 4P2HA 3GIIA 4UP7A 2BQUA 1L3SA 1EFWA 3SGIA 7ICIA 4DV0Q 4P75A 4QY7A 2HQLA 4TVAB 3SI8A 4KLSA 3C2LA 4NB3A 8ICYA 1I6HH 8ICHA 1RPLA 4NXZA 3CCLA 3CXCA 1BPXA 1DO0A 1SL0A 2KHHA 7ICOA 5C3EH 2HWJA 5CR0A 1L0WA 2PQAA 3K7UC 2KN7A 3F8TA 5IP7H 2B63H 1W3SA 4DL4A 5DG8A 4BY1H 1F4IA 8ICFA 1NK0A 3MR6A 1HNZQ 8ICPA 2F4VQ 3BJYA 1I50H 1WYDA 3MGIA 2BA1A 5IT9c 4LFBL 3E21A 2DZLA 5KFTA 3EN2A 4QWAA 1D8LA 3EBEA 2AHOB 4KLKA 1QZHA 4F93B 4IPCA 3RZDH 1Q1EA 9ICXA 4R4CA 1G291 3HX0A 1YIJA 4F2LA 1PV4A 1J5EL 2Q0ZX 4APVA 3A5UA 3MGHA 1WI5A 2V9WA 3JPPA 3T3FA 2JK8A 3HKSA 3CAMA 3M85A 2W9CB 8ICIA 3EPGA 2FPLA 3CCQA 2JA5G 9ICFA 3T1HL 5M5XH 4RNMA 4PGYA 4UBBA 2LYHA 4IQVA 2IHFA 2NN6G 1BPZA 1TVAA 4R4TA 4JBMA 1YITA 4MTNA 4O3PA 1IBKQ 2NVXH 2DHYA 4KLJA 3T1YL 1XPUA 4E0DA 2UUAQ 1XSLA 5C4JH 1KC8C 1K9MC 2QEXA 4LF4Q 9ICLA 2AGQA 1ASZA 4QWEA 3GTKH 5J0YA 3ULJA 1QZGA 1K1QA 4IR1A 4JWNA 2L2DA 9ICUA 4MFAA 3L2PA 4X66L 4UAZA 1X3EA 3HW8A 1HZ9A 1YI2A 4A3CG 2MUTA 3OJSA 1ZMVA 5GAHC 1NJZA 1XO1A 2OQ0A 4YMMA 1LTLA 3UXNA 3RH4A 4LF6Q 3PR4A 2CWPA 1ZQEA 4PZ7A 4QZCA 1VQGA 8ICUA 4Y7NH 4POGA 2V4QA 4LUOA 1ZQMA 1TWFH 3B89A 4ECQA 2C35B 1ASYA 3STBC 2DUDA 4HIKA 2JA6H 5IYBH 1T6OA 1JB7A 1VG5A 2HHHL 4Y52H 3U50C 4GOPB 1KEJA 4DV5L 5C4XG 2RCNA 2O25A 4NM2A 1X6OA 5EWEA 4BXOA 1Z3EB 4LFCQ 2F1IA 3Q8PB 2ZUBA 2WTFA 5H1SE 4JV5Q 4QZEA 2JA8H 2R7ZH 5ELOA 4IJLA 4X62L 4NLGA 1X9NA 2E5LQ 3GTJH 3KF8B 1ZQTA 1PYBA 1EIYB 5KT4A 4DV0L 3TEHB 1X9WA 4X64Q 2NRXA 1S97A 4B9MA 5K36G 7ICQA 1LV5A 2JA7G 3PV8A 1KFTA 3GDXA 2W8LA 3ZD8A 3CCRA 4A3JG 1KHIA 4IPHA 3GLHE 2R0IA 3H3VI 5JEAJ 5FJ8H 7ICKA 1Q86C 1KRPA 4QWDA 2KCMA 3TAPA 3RR7A 3S24A 1L2FA 4DK6C 4GXJA 3PW4A 4KMUA 1ZYQA 1SR3A 1HNZL 4F5RA 2KFNA 3OTOQ 1TWHH 1E1TA 3I4NG 1VQIA 2IBKA 2J6SA 2AGPA 4A3FG 3BQ2A 3Q8MA 3RH6A 1CUKA 3RRGA 1N56A 5DFLA 3RZOH 4OONA 1T9HA 2LXJA 4LF8Q 1T4GA 5EAYA 2NRZA 4C8NA 3S1NH 2VQFL 4B3RQ 2K50A 2R6GA 4TUQA 3RAQA 2R7FA 2ES2A 4BA1I 3CCJA 1Z00A 3I55A 4JI4Q 4LFAQ 2DPIA 2QA4A 4DR7Q 2NRTA 4DSKA 2PI4A 1L3TA 2GN5A 5J2FA 1T7PA 1WCLA 3F1ZA 1I94Q 4XIGS 4F2SA 4Q8FA 4LZGA 2RDIA 3V6HA 1K8GA 4LF4L 3JC66 4QZIA 4YR0A 9ICEA 5DG9A 3C1YA 1QVCA 3UDXA 2BH2A 9ICOA 1V43A 4ELUA 2B21A 3PIOA 4RQ5A 4YCXA 3E2EA 3PY8A 4NXMQ 1K1SA 3SV4A 2GVBA 4M9NA 9ICBA 2HVHA 1EQRA 5KFGA 1OXUA 1YLAA 3KTQA 1U0LA 1PH7A 2JY5A 4HIOA 7ICGA 4YCUA 4LF6L 1SRUA 1A77A 1QSSA 3HWTA 1RZTA 2C2RA 3RLFA 3UXPA 5M3MH 4F1IA 4DNIA 3PX0A 2V4RA 4IOCA 2EXDA 4UY8C 4A3LH 2K5VA 1EQQA 2UVRA 5J2GA 4UBCA 4TUPA 2MFIA 4F92B 4QZBA 1G3IA 1QUQB 4F5NA 2CQOA 3FKIH 4KLTA 4I27A 4EEYA 1ZMWA 3B0XA 4ED7A 3L7ZC 4A3DH 3TAQA 4QZGA 1YNXA 1JR3E 3KFUA 9ICPA 4LFCL 4AYBG 1XPRA 8ICLA 3Q8RB 7ICNA 1NK9A 4A3EH 4OO1I 4JV5L 1IM4A 2VA2A 2P6RA 2VUMH 1FJGQ 2LVNC 5KG6A 4GC6A 2IX0A 4BBRG 3ISBA 4C3JH 1FGUA 3V7KA 5JJLA 2DPJA 1A62A 2WB1G 5KFYA 4DSJA 3HOWG 2DENA 1UE7A 4X64L 2UVWA 3CPFA 3ZDAA 2C2EA 4LF9Q 3RJGA 3OGUA 4P73A 2FPKA 4R8UA 5IIIA 3RH5A 3FRIA 3CCEA 3RR8A 3JPRA 3EZ5A 4DF8A 4BWJA 4DPGA 4JV2A 4ZH4A 9ICJA 1Q1BA 2IMWP 4R4OA 4YR3A 4LW1A 3GFKB 2PMZE 2VW9A 3J80i 3TS0A 5J0RA 3QZ7A 2BWBA 4C8KA 5GROA 2AKWB 4UAYA 2K5NA 3OTOL 1WR1B 2LVOC 4DL5A 5J2HA 2R93H 1HQYE 3CCSA 1OKSA 1ZQIA 1JJGA 1C7YA 4JWMA 4H02A 2C28A 7ICVA 4DOBA 2L4FA 2JEBI 1Y14B 3J80c 3V72A 1CSPA 1ZQPA 1TWAH 4B3RL 2PFNA 4C8LA 8ICVA 4GKJQ 1HUOA 3ICEA 3GLGE 4EQ5A 3KF6B 1OQYA 2EQSA 2F52A 1Q7YC 7ICTA 4JI4L 2UVVA 5IIJA 3MBYA 4LFAL 1RXVA 3C21A 4L5QA 4DV2Q 5KT2A 4DV6Q 5KFJA 3KHGA 1XSNA 1HR0W 4DR7L 3FP9A 3HOVH 4R66A 3RN2A 1PH1A 1I94L 5KG4A 1SG9A 5IYCG 5J0PA 5J0QA 1VEGA 3NGDA 4OO1G 3UQ2A 2JE6I 5M3FG 2JZ0A 4Z6CA 3KYHC 4QWBA 2K75A 4MNOA 5HMMA 2JA9A 2R8IA 1RL2A 2YYZA 3MMPA 4AH6A 4ECTA 4POFA 1PH6A 2NRWA 4ED3A 4NXML 3ISCA 3I56A 1HNWQ 4LVSA 5DQHA 3CCUA 3RJEA 1KSPA 1TWGH 3ULLA 3H8JA 1E94E 2WZJA 5KFFA 2KZMA 5IWAQ 3ULPA 1ZQFA 4GNXA 1YHQA 1S0VA 3RJFA 4A3BH 1HR0Q 1VQ8A 2UUBQ 3BQ1A 4ED6A 3G6YA 3KJOA 3U4VA 4DL2A 2Z0SA 1XMOL 4GC7A 3ORYA 1TV9A 4KLGA 3UE1A 1TAQA 5CP2A 8ICEA 4XRHA 1TFRA 2PI2A 2ISOA 3C23A 3PUXA 1JJ2A 2KBNA 3PO2H 2ATWA 1ZV1A 3E0EA 2DFLA 4GN3B 1PVOA 3T5LA 2W9BB 3PIPA 3RR5A 2Q2TA 3CW2C 4A4IA 3IRBA 4RQ8A 4DAMA 1IXRA 1PH8A 2P66A 2QGQA 1UE6A 3H8SA 1V9PA 4A3KG 1ZQWA 2Y1JA 4JI7Q 4KLLA 2ISPA 3H0GG 1FJGL 1IM2A 1P8LA 1VQFA 3PUVA 2BCQA 5J0XA 4BA2I 5KFQA 3LCUA 2OTLA 3RJHA 4FDBA 3HT3A 1WCMG 4DV3Q 1R9TH 7ICUA 2D0OA 3BQTA 5HY6A 1TWCH 1QSYA 1L1OC 3A0JA 1EWIA 3GV5B 3RLOA 3E9IA 2IHNA 4M04A 1JE5A 1PH2A 3SZ2A 5IP9H 2W9AA 5DGBA 1SN8A 2JZBA 4DO9A 4MFFA 5BOMA 4MEYA 3GV8B 1HT1E 1ZMUA 3KHRA 2PI2E 4A75A 5KG3A 4ED1A 1T8EA 3HOXG 4YVZA 2HIVA 2KCTA 4G3OA 2Y0SE 3A74A 4UB2A 2HHVA 4DFJA 1X9MA 1HNXL 2K52A 2P6UA 2XY6A 3RB6A 4RNNA 3H4BA 3HOUH 1NOMA 5HHHA 4R1JA 1AROP 4GKJL 3KJPA 1NK7A 5KFAA 4PGXA 1OXTA 3S14H 1NKEA 1VQAA
chains in the Genus database with same CATH superfamily
1G51A 3LX0A 2DWMA 3L5KA 2VY3A 3NQIA 4A3MB 4IN3A 1H95A 4DV6L 3MXNA 2XH9A 4UB4A 2GLEA 1VQ1A 3QZ8A 1WD0A 2ZIXA 4B3MQ 3KS8A 5D65A 1W5SA 1XXHA 1TKDA 4B6JA 5EXSA 2JEFA 4K6DA 4TRDA 3AFPA 1R2ZA 3B6YA 4LNQA 1SSOA 1ZQOA 2UUBM 1TXYA 2OTJA 1GVPA 1Y8PB 2H5XA 2PQAB 4KKTA 3PR5B 1GD7A 3SK8A 3JPSA 1WTOA 3G6JB 5ELFA 2DXIA 2A6ED 3AN1A 2MJ5B 1LM0A 1N60A 1L2BA 4GHAA 1HZAA 2IOFK 3B7NA 1K0SA 2XCAA 3E0FA 4X5VA 3TFSA 1OXXK 3QR8A 1UM8A 5DYIA 2BCSA 1U9LA 3I4NH 2DNAA 2F0KA 3PZPA 1G4AE 3GQCA 2K33A 1QE6A 1XO0A 4C3IH 4ZKBB 4F8MA 1HUZA 1STHA 1PH5A 2FMQA 1KTKA 4ZRZA 4B08A 4DV3L 4KN4C 4JMUA 4XBOA 4DFPA 2E76C 2LH0A 2MUTB 5ALOA 3KDSE 4BS9A 2N1RA 2CV0A 2EAPA 2A5HA 2HMXA 2Y0SF 3QYBA 1KL9A 3PV0A 2B6GA 4CCHA 1P16A 3NVVA 4AYBC 5IP7G 1WTWA 4BY1G 1K8OA 4L6V6 4KN4A 3CQZH 4RMFA 5AKKA 3CQZB 5D46A 3HZJA 2QILA 1R4PB 3JPTA 4ECVA 1FYCA 1PZNA 3TWKA 2IW3A 3M3YH 1AN8A 3UZUA 4B3ML 2NRVA 2UXCM 5ELEA 3P20A 2G5GX 2HL7A 2WIIB 3J81E 3M3YB 3A8KE 1UFZA 2K5WA 1QAOA 2WF5A 3JAMS 1ZQQA 2KTQA 2CRUA 5AKYA 2K4PA 2WSFF 3L0OA 8ICNA 5K5PA 1NMFA 4RAUC 2YMMA 1YNNC 1G41A 3V76A 2C99A 2UUAL 4GLAC 3AFQA 3BU2A 2AQ1B 4E6IA 1NKBA 2ZIUB 9ICMA 2LMCB 4DL3A 1F2YA 5JEAG 4EIWA 1S77D 5F9NA 4HCSA 3SAFA 3F2CA 3I7FA 3RLNA 3NRZA 3VCBA 2XY7A 4TURA 4IFDH 5DQIA 2MGWA 2A74C 1PTOF 4MHVA 5LMNM 1D6EC 4DK3C 3T6PA 4M9GA 2E8NA 1BPYA 4J15A 1ZQ1C 4G4NA 4FP5D 4RUAA 5KG2A 4LF7M 2ZXOA 3PW5A 4EVOA 2MNAA 4DL7A 5GTHU 9ICIA 4RNAA 3D4WA 2QENA 1IBLQ 2OQKA 2E5LM 2I7PA 3K81C 2DWZB 2CWAA 2JJQA 1N36M 2VQEQ 1EY5A 1STYA 4QZAA 5KFRA 1EUJA 4DKAC 3C3EA 3ER0A 4CKBA 3SAVA 3M4OH 3FVQA 2HT1A 2XGTA 1FL0A 3ND9A 1HUNA 2ZBKB 4IQWA 5ALIA 2CFMA 2GQFA 3M4OB 3I4MH 1OIZA 5DNFA 5FLXE 5E79U 8ICRA 4RNOA 3PF4A 2ZM6Q 5ALFA 4L4UA 5TZVA 2NZOA 4B9SA 2KE7A 3G6EA 5BR8M 1SWVA 1Z5BA 2R93B 4K5XA 4QL5A 5EJWA 4ECWA 1L3VA 4MZ9A 1AE2A 2V4DA 1S76D 4X65Q 5DB8A 2RHSB 2HCCA 4MGYE 3M1YA 1AIPC 2CCZA 3W0LB 3QX7A 1EIHA 3RRHA 3L4PA 3ZDCA 3T5KA 4JK1C 4DF4A 2F3WA 4F5OA 5C5LA 1A76A 3UDGA 1VQ5A 4JC0A 2HIXA 2HSZA 5KL8B 4ZK9B 4YCWA 3S15H 3I3CA 3IV6A 4OU7A 2RKOA 1N61A 4A3LG 1RQNA 2VA3A 4BY7H 1AUAA 2AMCB 3FKIG 3BDPA 3G7LA 4CBVA 1IXRC 2H1RA 1IHZA 4JK1A 3W5OA 3KOWE 2K01A 2BA0A 3AOEC 2E2JH 2KNVA 3DZDA 3BS7A 4I2DA 4PZ6A 1X42A 2XICA 1ZQUA 3UE0A 4GRIA 4LJ9A 3KLSX 4CDFC 4O0IA 2E2JB 4GNXB 3J80L 4AIMA 3HEJA 1O7IA 5JI2E 5J2BA 2N8NA 5DBCA 1IBLL 2F0WA 8ICXA 2RLTA 3MEFA 3FEWX 4KLEA 1S0MA 2UU9M 2RBMA 4KLMA 4FE3A 3AOEA 5ALGA 2J7ZA 3CF5A 3GPUA 3EUB2 2JY7A 4YMOA 2F0LA 4GLXA 3TQYA 2BJWA 1X56A 2OM6A 2NN6H 4PH5A 2LVPC 2W8KA 1NK4A 1DOMA 3NTUA 1JWUD 5D3IB 4ALPA 2ZM6L 2SDFA 4RA8A 3E9HA 2F1MA 4DAYB 3HP6A 2F2AB 3KFUF 2PW7A 4HEOA 3RFWA 3I2ZA 1KAAA 1WVLA 2Q4TA 1IYJB 5AIAA 3S1QH 5JVG3 2N35A 2MP1A 1QANA 4PDIA 3L3OC 3CMEA 2EH9A 1B44D 4YD1A 1KLNA 1L0XB 3CC7A 2KMDA 2NYVA 2FLNA 4DR3M 2LKYA 2RSNA 3DUZA 1OAIA 5DM73 1MN3A 4DR6M 4MHEA 9ICGA 3PIP3 5CBAE 2BDPA 2WFAA 4ECYA 3TFRA 2Y1IA 4J9MA 3VDYA 2O01F 1GKHA 4JI2Q 4PHAA 4UPAA 3PO2G 2W9CA 7ICLA 1N2XA 5FO8B 3TADC 3GZFA 4DQIA 5K36H 1VQDA 5ELCA 1BDOA 4JI3M 1K3RA 2VQFQ 3Q8LA 8ICAA 4JVZA 2N49A 1D1KA 4ANRA 1N78A 2K8BB 5ITXE 3GTLH 5ALZA 4RU9A 1URJA 2BZFA 1LV7A 5C5JA 2YX8A 3PW0A 1STNA 4DV4Q 3TADA 4EYIB 2I1QA 4TKOB 2QKIC 5I2YA 5IT9S 5ALQA 4OWTB 5IODA 2VF7A 2NZHA 3N4MB 1U45A 1QSLA 5IINA 1VQCA 2DF4B 5C3XA 5EWGA 1UWVA 3HOYB 2KEYA 4L16A 1N34M 4MGHA 5ALNA 3PVXA 2XEPA 4RF1A 1SAPA 3H6MA 1UT8A 2CH4A 4DOAA 4ECXA 1S10A 3HFZB 2VJ5A 4RCOA 1EY4A 2AXTU 3HILA 3NENA 5LMUQ 3C2KA 4IOAA 1ZQGA 3I4LA 1JWSD 3VYSA 4H44C 3CHBD 4A93B 1XWEA 4ED0A 1S8OA 3K57A 4JN6A 4QZ8A 2RGOA 3HGBA 3A45A 4KI0A 4HIDA 2KVSA 2BCVA 3SBJA 1XNQM 1PVPA 5J0UA 3A5ZB 1LO5D 1II3A 3N97B 2VIIA 3NASA 3E4RA 4ITQA 2YU9H 3W1GA 4LGMA 1JJCB 3C28A 4JI0Q 4P74A 3F2BA 5J2DA 2ZJPA 2PNHA 5KQ8A 2YMQA 1ZD2P 4M9SA 2YU9B 5AK3A 4JI2L 1JR0D 1XMQM 3I51A 3PGZA 2L5YA 4JI1L 4MF8A 3J81L 3V7LA 8ICMA 3C5FA 3I90A 4Y2XA 1E9SA 2DI0A 3FUTA 1EIJA 2HHXA 2EZXA 4JI6Q 2WKDA 3CTWB 4C3IG 4YHHM 1SNPA 2FHTA 1MQ3A 2EUCA 2NQ8C 4DR1Q 2UXDM 1OTRA 4IQZA 4CHTB 2UUCM 2B2YA 4RGNA 3KDFB 5KRUA 3V2TA 3E0JA 4BBAA 3SXHA 4O3RA 2OPFA 4B9LA 1BCPB 1JOQA 8ICZA 4DV4L 1A63A 1S3OA 1LT5D 2J6TA 2A6HD 4DFKA 2WV6D 2F76X 2HAKA 2VF8A 3HKPA 1WTRA 2R6FA 5C4HA 2UXBM 1IN4A 1RG6A 2K5DA 3SARA 2ICIA 4I4LA 3S2DB 1S5BD 2WKCA 1HA5A 5IYCH 3I8ZA 4OO1H 1N32Q 5M3FH 1OJLA 5HMLA 5LMUL 2XF3A 4FXGC 3RUZA 1YHAA 2QDLA 1JQJC 4C2MH 4YY3M 2Q8RE 3RF9A 5M3FB 3VR6A 5KG1A 5I9PA 2VNUD 4PL2A 3BZKA 4C2MB 3O13A 1A0IA 1SDFA 1DO2A 1VF5C 5FSWA 4O5CA 2NTSA 3P7JA 3TWMA 1EFID 1PK3A 3VA5A 4IBCA 2KNZA 1VDZA 3CCVA 4GZYC 2HOIA 1U47A 2XZFA 4JI0L 2VL6A 2J6UA 2L55A 4J9PA 3J7A5 1N9WA 2IT1A 4ED2A 1S9FA 4B3SL 5FTLA 1QAQA 4DFMA 4XT1B 4K4IA 4YXJA 4FWHA 1S5FD 1WCMH 3QOJA 4JI6L 8ICWA 4MEXA 4OJLA 3ZC7B 3FUUA 2XSZA 1XXGA 4DR1L 3RAXA 5C3WA 1WCMB 3V6JA 1SXJD 3IG8A 1VQOA 4IFDG 4AYBF 3HPOA 5KFUA 1KDAA 4O42A 2ZIWA 1FNUA 9ICQA 4GEWA 4FS1A 4DEZA 3QXGA 1SE8A 3D2QA 4JW0A 4MM3B 1UE1A 2SNMA 2R62A 3S1MB 1I4QA 1IFYA 4K8JA 4D82A 1CI4A 8ICQA 1RKNA 1AZQA 4KTAA 4IRCA 3J80S 5EE0A 3M9MB 4DSFA 2DL0A 4QIWC 1KW4A 2NYZD 2W9BA 1X55A 1PXUA 4RT2A 3T1HQ 5J0TA 1RDFA 2LM4A 1N32L 4M1UB 3H8WA 4C4RA 3I4MG 3VR4A 2NO4A 2XY5A 1C8CA 4QZHA 2KG5A 2FNAA 4DL6A 1SBBB 3OWEB 3EIVA 5CB1A 3ONNA 2EOTA 4Z6YA 3EROA 2LHGA 5KL1B 3NTHA 5LL6S 3AJIB 4ECUA 4YN4A 4X66Q 4MN3A 4CJ6A 2BCUA 1YHBA 4DN4M 3GTPH 4YXMA 3DOAA 1QDRA 1VQ7A 2RDJA 2PFQA 4TSSA 2KEBA 3GTPB 4ZAIA 1YJNA 3F53A 1S72A 1BBUA 4O2DA 2XO7A 4PG3A 1VQ6A 3CPWA 1ZOLA 2QB1A 4UP9A 2N3SA 2F0JA 2CEAA 2W3RA 3TDQA 5GADC 4BY7G 1Q90A 4ZQ3A 1LACA 4HJAA 2ZXIA 4ICAA 1MKHA 1SROA 1ZYRC 1JOOA 4X3SA 3BXWA 3GIIA 1DOKA 1EFWA 4DV0Q 4QY7A 4RHSA 3C2LA 2EJFC 5I2XA 4GH9A 3CCLA 3DFZA 3TACB 3CXCA 4LFBM 1BPXA 2F0FA 5C3EH 1L0WA 3VLFB 3NRWA 2PQAA 2KN7A 2B63H 2X6LA 4DL4A 5DG8A 1F4IA 8ICFA 2F4VQ 3BJYA 1I50H 4IBDA 3J7YW 3EBEA 3RZDH 9ICXA 3HU2A 1VDDA 1G291 1I50B 5A35A 1PV4A 2Q0ZX 4HAEA 3MGHA 5BN3A 2FE8A 2KJ5A 1WI5A 2V9WA 3VR2A 1T5EA 1RTOA 3RZDB 1CHQD 2JK8A 2FPLA 3MHVC 5AKGA 3T1HL 4RNMA 4NC6A 4UBBA 2KUMA 3T1YM 4MTKA 2L12A 5HURA 2NN6G 1G59A 1TY2A 1YITA 4MTNA 4O3PA 1IBKQ 3B74A 3ONAB 2NVXH 1XPUA 4E0DA 1K9MC 9ICLA 4LRSA 1TE2A 1ASZA 1JRPA 5J0YA 1L6NA 4JWNA 9ICUA 3S9WA 4X66L 4NRWA 1HA6A 2MUTA 4CNQA 3E5SA 1NJZA 1XO1A 4YMMA 4FCVA 2Z6BA 3PR4A 4PZ7A 4QZCA 2KA6B 3IRUA 4EENA 4POGA 3GQBA 1TWFH 4ECQA 2DUDA 2LM1A 1JB7A 3ALRA 1D1IA 3NWTA 1TWFB 1Z1VA 2CW0D 2M00A 3U50C 3KBXA 5JVH3 3SEIA 1KNEA 4OJOA 4RGMA 3VDPA 4CF4A 3Q22A 2JA8H 3CF6E 2R7ZH 4BWGB 3C1FA 4OELB 3CKIB 1TS3A 5ALUA 1WTVA 3KF8B 1ZQTA 1Q3BA 1SNQA 2JA8B 5KT4A 4DV0L 2R7ZB 4X64Q 1S97A 5K36G 4QJFB 3KD3A 1KHIA 4K2LA 4IPHA 3GLHE 2R0IA 1TS5A 4Y2PA 2M2LA 3FUXA 4GXJA 4N9PA 1SR3A 2QPAA 2KFNA 1B9NA 2K8AA 4S12A 1SYFA 2AGPA 1G6ZA 2L09A 3RRGA 3Q8XA 5DFLA 1EWCA 3LMMA 4LF8Q 1T4GA 3S1NH 4QOZC 3HOWB 1ZKOA 2R6GA 4KY7A 4IUPA 2ZIUA 3S1NB 3DEEA 4JI4Q 4LFAQ 2XIDA 3SR1A 4LF4M 4US9A 4DR7Q 1QDTA 4NV0A 3M6KA 1L3TA 4A3VB 5J2FA 1T7PA 1WCLA 3AB9A 1JR3A 4YR0A 2OXPA 1BUVT 9ICEA 4A8EA 2O5JC 4YCXA 3E2EA 3PY8A 2Z8LA 5CV6A 2DBYA 3TQSA 4M9NA 2YY6A 2HVHA 1OXUA 1YLAA 1U0LA 1PH7A 4HIOA 2DUYA 5AM0A 1SRUA 4LK1C 2EYMA 1F2ZA 3HWTA 2XI9A 2AUKA 4FZLA 3TBIB 3RLFA 2F5QA 3UXPA 1X6JA 1PUZA 4F1IA 3FYDA 3U5ZB 2V4RA 4IOCA 4J8QA 2EXDA 4UY8C 1EY9A 4TUPA 2MFIA 4F92B 4QZBA 4AP9A 4LFCM 4I27A 2CXYA 4EEYA 1Z4NA 2BDUA 5AKHA 4A3DH 4C1NI 1EYCA 1RODA 1IM4A 2VA2A 2P6RA 3A0BU 2CV2A 4A3DB 5CV9A 1FGUA 2OH2A 2DPJA 1A62A 2WB1G 2EQYA 1PMRA 4DSJA 2KOLA 2KCNA 2FINB 4X64L 3CNHA 2C2EA 4LF9Q 4WW0A 3RH5A 2W43A 3CRKC 3JPRA 1QQ5A 5ALPA 2IMWP 4YR3A 2PQEA 1RTNA 5J0RA 3QZ7A 4UAYA 2K5NA 3QYPA 1SYDA 4DL5A 1R2YA 1ZQIA 1C7YA 2C28A 3Q23A 2R65A 4Y2JA 7ICVA 1Y14B 1EU3A 3V72A 2KW0A 5AKLA 2R4EA 4I7AA 3MWYW 2K6AA 2QF7A 3ICEA 3KF6B 2F52A 3VYRA 4JI4L 4LFAL 1B2TA 1RXVA 4L5QA 4DV2Q 5KT2A 4EQNA 3KHGA 1HR0W 4DR7L 3KXEC 3VC8A 2ICEC 1PH1A 5IYCG 3SHFA 5J0QA 1MSHA 1VEGA 2K4EA 3HOXB 3L27A 4OO1G 1LKYB 1XNSA 5M3FG 2JZ0A 1QUSA 2E1EA 2K75A 5ALSA 2JA9A 1TIID 4HR7B 5ELBA 2YYZA 3MMPA 3KKAC 3HY5A 1PH6A 3CCUA 1J09A 5DQHA 3RJEA 4NL9A 3WHLA 2KZMA 1X3QA 4EX7A 1ZQFA 4GNXA 1IXSB 4GC9A 3RJFA 4A3BH 1LV9A 2UUBQ 1L7OA 1QUTA 4EGVA 3UE1A 4R3DA 3NBXX 1HRJA 2ZAOA 5IGFA 2ATWA 1ZV1A 3KKAA 2RVLA 1QB5D 3PIPA 4RQ8A 3VYUA 1LTMA 2K60A 2AUJD 1Y8NB 1PZID 2BCQA 3C3DA 5KFQA 3RJHA 3H91A 5COYA 3U6OA 4DAYA 1WCMG 1IY2A 1QSYA 4CDCC 5AM2A 1PH2A 1ET6A 2W9AA 4O3MA 1SB3C 2O5RA 4LJAA 3QU7A 2B39A 5EE9A 4DO9A 5BOMA 3GV8B 1SMYC 5KG3A 3ZI4A 2KCTA 2Y0SE 1TAMA 4GKJM 2B2WA 3H4BA 3HOUH 1CZWA 1F9SA 4R1JA 4PGXA 2XNAC 1NKEA 1BPEA 3HOUB 2CPRA 2R18A 3MR2A 4DV2L 1BXTA 1DJRD 1EOTA 1VEJA 3J81j 1B4FA 1I4XA 1RHPA 1PRTB 2EZZA 3D6CA 1OXJA 2F0PA 3BBZA 3HX3A 3IHQB 2XRQD 1NJXA 2D6FC 2M5ZA 1W2BA 2WF7A 4IQUA 2UXCQ 3CRLC 5EXXA 1XC8A 1TK0A 4GLVB 1HR0M 5L9XA 2AU0A 4IJHA 1D0LA 4IR9A 4CJ0B 1N75A 3CMAA 2WFWA 3U61B 3NK9A 2OQ4A 4RQ7A 1KXLA 1G8PA 5KT3A 3J7AS 4HSVA 4G7ZC 1K3XA 1IKLA 2C5RA 5JI3E 2MUYA 1NZBA 1I4GA 4JI7M 1CFMA 3UMMA 4LUZA 3OHBA 1NNXA 2IY5B 4IPGA 2X8AA 2PZWA 4YG2A 1I3QH 1NSFA 5C0XH 8ICJA 3LDAA 2ZJ5A 1BNPA 4YCVA 5E4WC 4BXXH 1I3QB 3SATA 2Q2EB 3UJNA 2HOQA 4KN7A 1PVRA 2F0NA 1Z9FA 2BWEA 3SENA 3SYZA 5G3LF 4ECRA 4DQSA 5A0LA 5LMNQ 2J7NA 4ZUIA 2F8LA 1BR9A 2VANA 4UW9A 4LF7Q 4RPXA 4BBSH 3IDWA 3GLHB 2WAQE 4WFN3 5C3EG 1WGNA 2LTUA 1QLNA 5GAGC 1KAWA 1IZ6A 2B63G 4TQUS 4BBSB 1VQHA 3K1ZA 1C9OA 4EBDA 3Q8DA 1D2BA 1N36Q 2DWLA 2YNMD 3L26A 2I6XA 3AMZA 4Q44A 1SKSA 4D80A 1D9DA 1JWMD 4HYKA 2EVBA 5KEEA 3OIQA 1R4QB 2ZXPA 2HBLA 3JR4A 1ZQBA 4EELA 2F0MA 2E2IH 1X9SA 1X40A 1WUDA 4KLQA 2DWNA 2PYKA 4DAVA 1TWHB 1U4BA 2E2IB 1WCNA 9ICWA 3KDFA 1NTGA 2BKEA 5BR8Q 2AQ2B 1MU5A 4PGQA 4P4PA 3H15A 4K4GA 5EJCA 5HGQA 4WRDA 5BPVA 3JAME 4PL1A 3HG9A 1SKRA 5IIMA 1F2MA 5EQ0A 1VQPA 7ICSA 3KBGA 3K8ZA 3IL8A 3J7AF 5ITUA 3SMPA 3WK7A 1YEZA 4LF5M 1U49A 4H7BA 1NJYA 2HHSA 1GOZA 1H9MA 2D5DA 2ZTEA 4ILWA 1D7QA 2W82A 2ID0A 2RKSA 2JA8G 2L11A 4DR4M 1QQ7A 4M9JA 2R7ZG 4P72A 2HKJA 4ED8A 1MSWD 5LMNL 2OO9A 1QYRA 2KNAA 4RUCA 2NVYH 4KTQA 3RD4A 1VDLA 4GXKA 1TK5A 3GTMH 4LCBA 2NVYB 5HR7A 1D9FA 1PH9A 2GO7A 2LMRA 4PZNA 3X3MA 2A69D 2H3FA 4KITB 3U6PA 5KNCA 2E5LL 1GO3E 3A54A 3K80C 2UVUA 1N36L 1XSPA 2UU9Q 1KD1C 1Q3VA 2LVAA 4UB5A 2KHQA 5BN4A 3KHHA 3W2DA 4YP3A 3J7ZC 2HBJA 2DNEA 2D7EA 4QB4A 1X66A 1QVGA 3PSIA 4KX3A 1ZQRA 5CV5A 5C44H 3FTEA 1LTRD 2JA2A 5J2KA 3WDNA 1LTSD 1OTCA 4YWMA 3SVMA 5D49A 5ALJA 4PHPA 2E8GA 5C44B 2F5NA 1I4WA 3PIO3 5KTQA 4GS3A 4FD2A 2EJSA 2EZYA 1JOKA 1SKWA 4Q8EA 5BR8L 2XSZD 2K28A 7ICMA 2KQ3A 4FF3A 3EIHA 4HAIA 3N52A 1NE3A 3OOCA 1J7KA 1KBUA 4J9KA 1TWAB 2Q8TA 3OIPA 3IP4B 2XGPA 5KT6A 4GXIA 1EOVA 4DR3Q 1Q12A 1B4OA 1P3QQ 5FOBB 4FCWA 3HOVB 4DR6Q 5A2QS 1JROA 3BQ0A 1X37A 2Z4HA 3MFGA 3RB0A 3KVWA 1RQLA 5IGGA 5KFEA 4A3DG 2CE7A 1TH3A 2E5SA 5L8RF 4I2EA 2BOSA 3TREA 5KFVA 5KFIA 3RJKA 2RHQB 1PZKD 5EPLA 4GC5A 3K6OA 2J5YA 4I2JA 5KG0A 1CEZA 5G3LD 4JI3Q 4PZOA 4R65A 3NTKA 4IALA 4OWWB 3UDFA 1PJTA 2I9GA 1C4QA 1D5ZC 2R8JA 5M5WH 5KAIU 1VQBA 4RPZA 5KFLA 2UU9L 1P7DA 3DEPA 5M5WB 1JT8A 4CDEC 3DLLA 1R9TB 2ZXRA 4FWGA 1TWCB 4L5TA 1N34Q 4B9XA 2ZJQA 5KFZA 2J0TD 1XNRM 2XZUA 3OSPA 5JPNC 3H4DA 4O3SA 5KFPA 2JZBB 1L3UA 2QHOB 5L1JA 4DV5Q 4QZDA 3LWLA 2W54A 4W5WA 3GRVA 2KA7A 5D4BA 4A3BG 4DR3L 2D62A 1XNQQ 1EQVA 5ITXA 2NO5A 4A76A 1S0OA 3RN5A 4R4QA 4DR6L 5C4XH 1K8AC 1X65A 2MROB 4NL4H 3RJJA 2XRSD 1QWYA 1TGUA 4GIPA 1JXEA 1Q3CA 2G5IB 1M90C 3B7ZA 1XS9D 1NK8A 3KZXA 1XMQQ 1VQNA 2PCFB 1KQSA 2CHGA 4JCVE 1N63A 3OTQA 4M9HA 4F87A 4NLBA 2APLA 1LTBD 4RPYA 5J2IA 3WU2U 4WJ4A 1B0XA 1RIPA 2A1JB 4JI3L 4YHHQ 2UXDQ 4RQMA 2JWSA 5J0WA 3TANA 1QJOA 1XTDA 4G7HC 5J2EA 5DB7A 3J81i 5KFMA 4B7FA 1MC8A 2R92B 4JYAM 5JJKA 3BDCA 4WURA 1STGA 1DGSA 1KRTA 1O78A 5CEHA 1DOLA 2WAQB 3PFIA 2R61A 4A3GB 3C2MA 5DDMA 3TRZA 3H3VC 5KFBA 4JV1A 3HOUG 2VIXA 2UXBQ 5IT9E 2QB0B 1DD2A 5KFWA 1PHJA 5L1KA 1BO0A 1L8LA 4DOCA 1N34L 1JN3A 5BOLA 4U68A 5AK5A 2KZUA 4BLCA 1G8ZD 2IHMA 1X54A 1Z6TA 3PNCA 4IUNA 3CD6A 9ICCA 4WJWA 2XCPA 3KF8A 1VS0A 5ISRA 5CA7A 3ZD9A 1OXVA 5EGTA 5JTIA 4YY3Q 3MFIA 2LHTA 4QJFA 2KV2A 2QZ4A 1IN8A 2JZ1A 9ICSA 2KRKA 4RQ2A 4RG1A 1H9SB 1XNQL 4LJ8A 1V97A 1ZQHA 3SK4A 1V92A 4XK8F 3G71A 1Y8GA 4RZRA 1IW7D 5DAUA 3G4SA 5AFWA 3FPPA 4OXPA 1B8AA 1GL7A 4OGQC 4LZZA 1XMQL 4HJ7A 4BBRH 1VQMA 5KAFU 3A8IE 5KFKA 1X3FA 1WG8A 3KOXE 1S5ED 5C0XG 4BBRB 4Q43A 3C1EA 1PK1B 4BXXG 2EKKA 2K04A 8ICSA 3P1HA 2IL8A 4O3QA 4YHHL 4GN4B 4QW8A 1TS4A 1G6PA 5KFOA 2UXDL 2UUCL 5JU5A 3K5MA 1D5MC 3RTVA 3JPOA 4EEKA 4KX5A 3V7JA 4DR2M 4NWIA 4JOIC 4BBSG 1NY5A 3SMSA 4C8MA 1SL2A 4K0KM 5FLXc 5E7NA 1BKBA 2B2TC 4OEMB 2MH8A 3AUOA 3U5ZA 4DBGB 2ZJAA 4DXGA 2UXBL 5BPCA 2XFTA 3GLIE 4I2BA 2DKXA 2OEOA 1YUBA 3QB3A 3QEBZ 1RYSA 5LHY1 1DXMA 3KOJA 4M9LA 2XTIA 4JOIA 3T79A 2JQOA 4IFDI 3TKAA 3NTIA 2B2TA 2Q2IA 3I76A 2I5MX 3WWVA 5EPKA 4DSIA 3HHXA 4UQGA 5FLXS 4IFDJ 2JUJA 3FRHA 5FTJA 4YY3L 2WP8J 1TR8A 1MGSA 3HU1A 5KO3A 3MXUA 3H0MB 2DZOB 2CRXA 3SAUA 4NM1A 1TQOA 4K2KA 1LVHA 5I4DA 4L6TB 3EQLC 1U9RA 3FTDA 2EXZA 2AJQA 3SK5A 2Y21A 3OHAA 4A3KH 4AQYM 3LK9A 5C5MA 2F0GA 5L37A 5ALWA 1LTID 3KF6A 4R7GA 1L1ZA 4A3KB 1I4PA 2O6KA 4LJXA 2F5OA 2ASDA 2PI5A 4L5RC 1BF4A 1XU4A 1UEBA 1HNXQ 4RF0A 3F2UA 5H2FU 2F0OA 1Q81C 2K4KA 5J0OA 2E2HH 1LKYA 2WF8A 1ZQDA 1DCZA 2LSSA 4FXKC 2R4JA 2NVTH 4BB9A 1IY0A 1A8VA 1VQLA 2E2HB 1LYLA 5DLFA 3QE9Y 2LHCA 4G4KA 2NVTB 1KDBA 3M9NB 2ATLA 1IXSA 1TY0A 1Q46A 2KVCA 4M6WB 5K4LA 2QQ8A 2ODGA 1IBMM 1BCPF 1FFVA 4UB3A 1CKNB 4UB8U 5IYDH 4I2HA 1UCVA 2L7HA 1NJWA 1JCKB 2HI0A 1GJXA 5JPMC 1WGLA 4PNYA 1F5SA 4F50A 2I46A 3PMNA 2HD3A 4JUZA 3AQFA 4LJ4A 3D0FA 4Y2VA 5EXPA 1ZAEA 4J9OA 2VQEM 5GKNA 1ZQLA 3FPUB 3J80E 5C44G 2PFPA 1W5TA 3V96A 3GDEA 1Q82C 3T1YQ 1VQJA 1MJGM 1NK6A 4B3TM 4QQBX 4DFDA 1PFMA 2DGYA 4QNRA 3A55A 2Z4RA 5AJ3L 7CATA 4Q45A 4DV1M 2CV1A 1G91A 2BQ3A 1C48A 1V1QA 1J2MA 4QIWB 1PRTC 2A1AA 4B9WA 4XA5A 4Z6DA 2DKLA 1Z5AA 2WHEA 1IL8A 1W6KA 4OJ5A 4IPDA 1FFUA 1ZD4A 1QTMA 1VQKA 2ZTCA 1WJJA 3AQEA 1YZ6A 4JI5M 3IM1A 4PJ0U 4F4KA 2VA8A 4I2GA 2YTXA 4UAWA 4PZ8A 4A3MH 2KEEA 4L5SA 1OXSC 1ZJNA 4P2HA 4K5VA 4UP7A 5AI8A 2BQUA 1YNJD 4PQXA 2O4XA 2HQLA 4TVAB 4KLSA 3LWEA 8ICYA 1EE8A 4B7HA 4RQNA 2A6EC 1SL0A 2KHHA 2DGZA 2GA4B 5CR0A 1X9XA 1W3SA 5E3FA 1NK0A 4LFBL 3E21A 2DZLA 3EN2A 3U61A 1J5EM 1D8LA 1QZHA 2H3ZA 1NO1A 4IPCA 1Q1EA 4UDUC 2YFQA 1YIJA 1QVRA 3WOEA 3F5EA 1V85A 3GQ4A 1RU3A 3CAMA 1LABA 1JB3A 1HQRD 5M5XH 2LYHA 2IHFA 2DY7A 3KLRA 1BPZA 2HCFA 2MSNA 4K5WA 1Q3LA 5D3DA 5M5XB 2W11A 3T1YL 4KKUA 2UUAQ 1XSLA 1IXZA 4LF4Q 1IG6A 1LTTD 1QZGA 3GPXA 2Z4IA 4MFAA 3AU7A 5JJZA 5GAHC 1BBXC 3HJ8A 3ETRA 1DGHB 3UXNA 3RFAA 4V190 1NAPA 1ZQEA 1MN8A 1QILA 3GLHA 1JQYD 5IT9L 4RKLA 4CISA 4LUOA 1ZQMA 4ULLA 3QU2A 1XX8A 4HIKA 2JA6H 2YMLA 3L3FX 3S17B 3BDOA 5C4XG 2RCNA 2L7IA 2JA6B 1SV4A 1X6OA 4X62M 4LFCQ 2F1IA 3MAQA 5J39A 4KMUC 2KRUA 2WTFA 3IFDA 5H1SE 4QZEA 2X4AA 3FDTA 4N9TA 5JOBA 1X9NA 2RP5A 5B5EU 2Z8YM 3MC1A 1L8OA 5EKIA 3H8MA 3LVVA 3TEHB 2QCUA 2K5QA 3DEOA 4IBGA 1LV5A 3GDXA 3ZD8A 1VLBA 2O2LD 1Z59A 3SYLA 5FJ8H 7ICKA 3TAPA 4DK6C 3D6WA 4KMUA 1EEFD 2F0IA 3DWQA 1E1TA 3WK4A 2F44A 1CUKA 2VQFM 3UK6A 4US8A 2BNKA 1BCPD 5EAYA 4C8NA 4KJOA 4C0ZA 2MA1A 4TUQA 2LKVA 2CUZA 2DPIA 1H9KA 1G2SA 1FNWA 3GLIB 5C4ZA 4DSKA 2PI4A 2RDFA 2GN5A 3MC0B 3A46A 3V6HA 1K8GA 4LF4L 3JC66 2AQ3B 5DG9A 2BH2A 1V43A 4ELUA 2B21A 3PIOA 3WKBA 4RQ5A 2Z4SA 1NNJA 2JXNA 4NRVA 1K1SA 1LTGD 4LF6M 4KO8A 1GUSA 1JALA 5KFGA 4MGZE 3J2PB 4ZLTF 1AZPA 3K0YA 7ICGA 2H3QA 1A77A 2L0CA 3MXPA 3MXGA 4XXEA 4IBFA 4Y2YA 2G9HD 5J2GA 4UBCA 3H0RB 4RH6A 5E4XA 2CQOA 3B0XA 2ZXHA 2Z9HA 3L7ZC 4LFCL 1XPRA 3Q8RB 4OO1I 1FO4A 2WSEF 4BBRG 3ISBA 4OO1J 5KNBA 4D81A 2UVWA 4MGKE 3ED5A 3ZDAA 3RJGA 4RGTA 1FGBD 4QUCA 2FPKA 3FRIA 5ALKA 4DPGA 2F4IA 1WTQA 1MBYA 1ESRA 2PMZE 3GV3A 4P0PB 5GROA 1WTPA 4I8OA 3S6JA 3M6AA 1E2VA 5J2HA 2R93H 1HQYE 5CV4A 4XYOA 5AI5A 4F71A 1JJGA 3H0GB 4B3RM 1L1TA 5I6WA 3KSJA 5IGBA 2JEBI 1YSYA 3MGVA 1ZQPA 4C8LA 4GKJQ 1XYIA 3GLGE 4EQ5A 2BCOA 1Q7YC 3NP8A 3PQIA 1I94M 3C21A 2XFSA 1HFGA 2HOFA 1XSNA 1NNUC 4R66A 4DNTB 2MPMA 1SG9A 5J0PA 3VKGA 3GP7A 1KLGD 4MB7A 1Y69U 3KYHC 2L1BA 1RL2A 2NRWA 4ED3A 3I56A 4L78A 1TH2A 4REZA 3QOLA 1OFHA 4BX9C 2Y0SC 4M8AA 4B7GA 1E94E 1ZRMA 2WZJA 2IPKD 3ULPA 1HR0Q 1VQ8A 3BQ1A 3U4VA 4HL4A 3BDLA 2Z0SA 1XMOL 1HIWA 1T94A 4XRHA 4IJFA 2KHVA 5H37D 1RJTA 2ISOA 2DFLA 4GN3B 3RR5A 1IXRA 1PH8A 1FJGM 4G7OC 2P66A 1EYDA 4A3KG 5IOCA 4IUUA 4JI7Q 2ISPA 3NUQA 1IM2A 1P8LA 5J0XA 2HCIA 3LCUA 2OTLA 5AKEA 3HT3A 3BQTA 4C7YA 1L1OC 2Z1CA 3GV5B 3E9IA 1JE5A 3HU3A 1U4MA 5IP9H 2C9OA 1ECWA 4P2CB 3W68A 2JZBA 4P16A 4MFFA 1HT1E 2PI2E 1GLNA 2K32A 3SR6A 4ED1A 4H0LC 3QUTA 4YVZA 2HHVA 1SYCA 2XY6A 4GKJL 1D0MA 1DYQA 5KFAA 1OXTA 3S14H 5IYDG 4H13C 1PVQA 1K8MA 2E75C 2F77X 2VKQA 1Y1WH 2XC9A 3S14B 5AKIA 4UARA 1E1OA 1YVCA 2JY6B 1AQ6A 4J9LA 2VXWA 1I6HB 3FUWA 1Y1WB 9ICNA 1CT1D 2X49A 2FMCA 2FH0A 2EKFA 5KFDA 1HNWM 5HNKA 3FUVA 2V1UA 5HP4A 1PH3A 1HUMA 5IWAM 1S5CD 4PD2A 2EY1A 4QW9A 2RRUA 1J97A 2WAQC 4JI1Q 4DK1A 4NOOB 1HXYD 1HQCA 2A1JA 3J7AV 1HR0L 2ZT9C 1U48A 2ZANA 2W03A 2G07A 3N7PD 4PPXA 1GUWA 4ELTA 1PTOD 4XGIA 3B7QA 2AHMA 3SMVA 2JP7A 1Z7TA 3C5GA 1PGYA 3SD7A 3RBDA 3THVA 5C4JB 5AI9A 3HRZC 1B7YB 4JI7L 2QB0A 1TK8A 3AL0B 4F8RA 2KXEA 4LF5Q 3HOYH 2LVQD 2QEJC 2EYOA 1MQ2A 2AQ0A 2W7OA 1XTCD 5KT5A 3D4DA 3X3NA 5ITYA 2F5PA 9ICAA 3K2LA 4KLFA 4AZFA 4AG5A 4A3MG 2D0PA 2KENA 1C1KA 4DR4Q 4RKBA 3MZ5A 5EWFA 2QBYB 1GUOA 2X6GA 4A93H 1GHKA 2CQAA 4LUVA 4R63A 4LJ7A 3AU2A 4O5EA 4U673 4LJ5A 1H9SA 3M9OB 2C2DA 3B0YA 3NHHA 4KHPM 1TTEA 1IL2A 3MR5A 4KLIA 2B2VC 5DYGA 2VB3X 4UAIA 2BE5D 1PJIA 5KYLA 3GTJB 3STBD 2E3TA 5ALLA 4BXOB 2F4VM 2L15A 4R4IA 4KK7A 2F0DA 1UA1A 4Q7JA 4B9NA 5IIKA 2LFNA 2F3IA 2CFOA 2EY6A 4Z9CB 3K8AA 2ZUCA 3R8BA 4HMIA 4B3SQ 3V05A 3RE8A 5TISU 1PK1A 1PRTF 1HJPA 2FMSA 3NE5B 1NBWA 2F0TA 2LBCA 4CF3A 2A5YB 2F1HA 1BNOA 4O9MA 2A6HC 2KICA 4FBTA 1IYUA 5FLMH 1IBKM 1Y88A 1KKXA 7ICRA 3I73A 4YD2A 4YFKA 4DR5M 2ASJA 1PH4A 2MRLA 3OW2A 3CCMA 2EYPA 4Z6EA 3C2PA 1NJFA 1EYAA 1Z00B 4Y2QA 8ICKA 5JAVA 1J8IA 7ICEA 3OWFA 2JA6G 1K3WA 4LF5L 1JXLA 1SNDA 3S2DH 2LXKA 1QH9A 4Z6FA 1QAMA 1SXDA 1ZQVA 3LCVB 2VZAA 3KLWA 2DAEA 1ESFA 1AP0A 4DR4L 4OCZA 4XQ8A 3KSXA 1QG7A 3U6LA 2HCBA 4QGUA 3S2HH 1WYGA 2RDGA 1A5TA 1O08A 3AMUA 5C1BA 4M2YA 2KZ3A 3A42A 4M0AA 5KFNA 5FJ8G 4JBKA 3S2HB 3M8RA 2RGHA 2PMZB 4DQQA 1EY7A 4TUSA 1TAUA 4QCLA 1NZPA 4X6AH 1IV8A 2V1CC 1JMCA 1KFVA 2A68D 2GWSA 3QG1A 3SAWA 2BPCA 3PMLA 1SJHD 5J1ZA 2CHVA 4DUYM 3DWAA 3K5NA 1F44A 2LWXA 4UHVA 4WJ3M 4A3IH 1HZBA 2R8KA 3GO5A 3GLGB 1ZJMA 1CZGA 1CSQA 1KFSA 1F2LA 4F5PA 1KN5A 1X32A 4A3IB 1NR2A 4LF8M 2V1CA 1D0KA 5DLQE 3M4YA 2LY7A 4EZ6A 4B9VA 3WK9A 4R8UB 2DJFC 2K7VA 2I07B 3ERSX 2H1EA 1K82A 1HZCA 3O0FA 1CHPD 4OIJA 1RYRA 1XNRQ 3I4VA 2AQ4A 2M9NA 2ZUDA 5EPJA 1VEKA 1SGGA 4O3OA 4FF1A 4PCZA 2W7PA 3PF5A 3GPYA 4UP8A 4M6WA 4FZMA 3F2DA 4DFAA 1LUZA 3QUCA 1CKNA 3ICXA 1VQEA 3NS1A 4GHLA 3UM9A 3S1MH 3R93A 2NV3A 4RQ4A 4QZFA 3PW7A 5AI6A 3EWAA 3MR3A 2ESEA 2B3TA 3UXOA 5A2QE 2F0QA 3M9BA 1TWGB 5J29A 1HT2E 3QUQA 2K03A 3W1BA 4R9WA 2F0SA 4LAAA 3I4YA 3URYA 1IIPA 3BS5B 3U6MA 1SWWA 4YR2A 1NV8A 2H3IA 4KLDA 3CC2A 3PSTA 3N28A 1EL0A 1DGBA 5T1GA 3TQ1A 1A15A 2R46A 1H38A 1XB2B 4HIMA 3C3LA 1ZRNA 2G9DA 1DXSA 2A8VA 3DM3A 2EDUA 4CF5A 1XJVA 2F0EA 1YBYA 1NY4A 2FMMA 4LF9M 1U4PA 5EBCA 2R93G 2D9UA 2B8FA 2FDRA 4IURA 3U9OA 1PM5A 1UNSA 2JA5H 1IYVA 4G57A 4JYAQ 3MFYA 1NI3A 2GH1A 3L9AX 3HKZE 3NELA 2KP7A 4NSOB 2Z6KC 2JA5B 4K14A 1A2UA 4PMBA 4F4WA 2QSFX 1E0BA 4WP2A 3G6XA 1NUCA 3V6KA 3HJSA 4P71A 1DGFA 1NY6A 1WHCA 5ALYA 4NKLA 2JEGA 2KFZA 4ELVA 3I04M 2XSCA 4A3CH 2KK0A 1RXWA 1XNRL 3R2TA 4OWXB 5EP2A 2EIFA 2KJXA 2Z6KA 3PX4A 2I5LX 4NXNM 1KDCA 3ND8A 4K8IA 2W9MA 4IBKA 5KIXA 4LJ6A 1WTXA 4OJ6A 4JPBW 5J2JA 4M47A 1ET9A 3ZCBB 3AFHA 5E1FA 1SLJA 2PXIA 1NVMA 1ENCA 5FO9B 4F2RA 2IX1A 1VMCA 3PO4A 1XHBA 3MEHA 3CP0A 3FM9A 1NV9A 1OIPA 2FXQA 1JIHA 5DQGA 2FMPA 4A3JH 1KNAA 2DHRA 3KP1E 2Q2HA 3S16H 1STAA 1Q02A 2VB2X 4A3JB 2L4NA 1DGJA 5LMNW 2F3NA 5C6AA 3S16B 3NEMA 5IP9G 2YQZA 2F5SA 3SDZA 3CP8A 1OO9B 1FVIA 2DAIA 2HHUA 4XT3B 4PHEA 2DQNB 1NMGA 1B1ZA 5ITRA 1DGHA 3I4NB 4GN5A 5FO7B 2ASLA 1WFQA 2MR9A 1L7MA 3EA6A 4B9TA 4JYAL 4C3IB 2CW0C 4DR2Q 4S3SA 4R71A 5DGAA 4K0KQ 1WWUA 2OHFA 1XC9A 3BZDB 4JI8M 4G6ZA 2KSOB 3FDSA 1ENAA 9ICVA 1K3BC 4IUVA 3R9KA 5KFCA 5C0XI 1GM5A 2JXMB 1F9RA 3JAMi 2EANA 8ICOA 1Y1WG 2LI6A 3MABA 5C0XJ 1E7ZA 4F4ZA 3D4RA 4DS5A 1EEID 5F9LA 3EW9A 4HJ5A 4KLHA 3NBHB 5IY0A 3AKZA 3JAMc 1N33M 1SE3A 3H3VH 3M7NA 1GL6A 2E2DC 2M60A 1PA6A 9ICHA 1DV0A 3GD7A 5NUCA 4NY8A 1J9OA 3E6ZX 3SYKA 4JV0A 7ICFA 1DK2A 3LQRA 4GKKM 1J6QA 3JPQA 3H40A 4OIKA 1BVSA 4M9ZA 5J22A 3TS2A 2BJVA 1STEA 1PJQA 1SXEA 1OAOC 1OUQA 2JEJA 2JEIA 1L0YB 4AQYQ 3BZCA 4F3OA 4JBWA 3H09A 4DSLA 5KPTA 4Y2TA 3HOWH 2HQEA 3U58A 3GLIA 2OWOA 3HOYG 3IECA 5J2AA 3WK6A 2YR0A 4DUZM 2FS1A 1MX0A 4TQRA 2BH8A 3U6SA 1F9QA 2MAXA 1KTQA 2WB1E 3NWLA 3PXGA 2XIWA 1ZXIA 4A93G 8ICTA 5JJIA 1YNND 1FIQA 4DR2L 3UMBA 5DG7A 1GABA 2CHBD 1NR4A 3ETLA 4K0KL 3QYEA 3IKJA 3RMHA 5DB6A 3T13A 1IBMQ 1PDQA 2BCRA 3L28A 3GTGH 2JEAI 3EIEA 4I7ZC 1JX4A 4ME5A 2WAQF 1A3UA 1BPBA 3GTGB 3FHWA 4K4HA 3SK6A 3QNMA 4IRKA 4DV7M 4PHDA 2QW7A 5IILA 2K5HA 3F92A 2VS1A 4O0AA 4B3TQ 2OOBA 2F0UA 1M4VA 3L2AA 3ZYYX 2KOBA 2KIWA 4P0PA 4NLZA 3GIJA 4LZJA 5FLMG 4MF2A 4DV1Q 3DWPA 4HJ9A 3I4MB 2YQEA 2KEDA 5KFSA 3LWMA 1QZEA 2MQHA 5DKWA 2K14A 2WF9A 1Z47A 2HHQA 1N62A 1X3GA 4AQYL 3LYSA 3NPPA 4J9QA 4L63B 3DXJC 3UPQA 4X3UA 2KDLA 1XPOA 1LB2B 4HEDA 3CYMA 3Q8SB 3F5AA 4JI5Q 3CF0A 2B29A 4M9XA 3GQ5A 2Q2UA 2MHVA 4KMOB 1K73C 4CJ2C 2KHIA 1ZQXA 4M0DA 4JG2A 5AKZA 4J6HA 1X2IA 3HOXH 4OJPA 3IHPA 2L9HA 2LXEA 1H6UA 1IN6A 1A6SA 3S15B 3UGJA 4BY7B 2GOLA 3KOZE 3DDHA 2K9DA 1J5EQ 3GLFE 3I72A 4I2FA 4FVMA 1IBML 3LVWA 4NPSA 5A2QL 2HBKA 1XMOM 2XGQA 2IA6A 2G3QA 4EQOA 5GTIU 4O3NA 3HKZB 4A3IG 3T4AC 1GO3F 3HS0C 1Y8OB 2VQEL 2BPFA 3U4ZA 4FZNA 1MJCA 4FO6A 3LGJA 3GRRA 3GPPA 1JICA 4OX9M 4AW4A 1GUGA 3LQQA 3UMCA 2A3VA 1SL1A 1QZMA 3GTOH 4B3TL 4NMZA 4BGDA 3SQIA 1VQ4A 2MO1A 2FE9A 3K92A 3TARA 3FYHA 3EYZA 3GRYA 3OSOA 3GTOB 3N7SC 1HCZA 2HW3A 3PUZA 4F88A 4DV1L 4FF2A 1CKMA 3PW2A 5IE8A 3T5HA 2K05A 2B2UC 5DB9A 9ICKA 1UT5A 2NZ1D 3UQ0A 5AI4A 4N8X1 2HVIA 2BQRA 2W55A 4UN2B 4CDDC 3D2SA 2HBMA 2MU2A 3VK8A 4X65L 5TSSA 1ZQKA 1JI7A 3S1QB 3RNUA 5L1LA 3K9PA 4UAUA 1PFSA 2E8MA 1B50A 4X62Q 4JI5L 2XGNA 4IS7A 2B2UA 7ICIA 3C29A 1SJED 5IGDA 4P75A 1ILQA 3SI8A 1C20A 4NB3A 2KHSA 3GV6A 8ICHA 1HPCA 1RPLA 5AK6A 1DGGA 2WACA 1DO0A 7ICOA 4N8FA 1YZ7A 3F8TA 5KYIA 3MR6A 8ICPA 1WYDA 3MGIA 5IT9c 4QWAA 2E1FA 2AHOB 3AL0C 4XYQA 4F93B 3J27B 5T1IA 3HX0A 1J5EL 1FNNA 1FR3A 3T3FA 2Z7JA 3HKSA 3M85A 1CA5A 2EY2A 3PSFA 8ICIA 5ELDA 3CCQA 4IIWA 2JA5G 1CQFA 1TS2A 3FC4A 1IKMA 2K8CB 4C4TA 3W3AA 4JBMA 4DK0A 1DM0B 3GTLB 1KC8C 4Y2UA 4G4QA 2ERCA 3ULJA 3Q6SA 4IR1A 2EJMA 2L2DA 4C7ZA 3L2PA 4UAZA 1SXTA 2MGSA 1CM9A 2NTTA 3BYTB 3HW8A 1HZ9A 1YI2A 4A3CG 1ED1A 3OJSA 3RGSA 2B0CA 2LBOA 1LTLA 2PZTA 2QBYA 3RH4A 2FJ2A 4LF6Q 1CRXA 5CMDA 2OXOA 4QF4A 3PNVA 4LGYA 2HHHM 3TSSA 4KD4A 2C35B 1GHJA 2IX3A 3TPZA 4DV5M 5IYBH 3NXWA 1T6OA 3FTFA 2DJGC 3EVQA 2JYOA 3A7LA 4Y52H 5EP4A 3GP1A 3M7GA 4QIWF 4GOPB 1DONA 1VDVA 4BXOA 1DRGA 1A3VA 3DHQA 3Q8PB 3VR5A 5EP3A 1H9RA 4X62L 2E5LQ 1EIYB 2HDMA 2NRXA 3FYCA 3PV8A 2Y9TA 2W8LA 3CCRA 4A3JG 1HNZM 2B2YC 5JEAJ 1FEZA 3OW7A 3PW4A 3FRPB 1HTPA 1TWHH 3HZXA 4NSRA 2HUGA 3I4NG 1BQQT 2IBKA 2J6SA 3NVYA 3Q8MA 1N56A 3RZOH 2E8PA 3BOSA 1T9HA 2DZNB 2NRZA 5I9OA 2WB1B 2VQFL 3WHKA 4B3RQ 4QNLA 2K50A 3RZOB 3KK7A 2R7FA 4BA1I 2OEHA 3CCJA 1Z00A 1TDZA 4KV6A 1GJSA 3KS4A 2NRTA 4CGZA 2G5DA 2EYFA 4AKGA 1I94Q 4XIGS 4F2SA 4Q8FA 1R5LA 4QZIA 4QHTA 2PMZC 3C1YA 1QVCA 9ICOA 2LNHC 2EY5A 2BDNA 3SV4A 2GVBA 1EQRA 3KTQA 2R3ZA 2JY5A 2PKEA 4PT5A 4YCUA 4LF6L 2A69C 1LTAD 5M3MH 2N55A 2OT2A 4DNIA 5DEHA 3PX0A 2RRDA 2K4HA 4QNMA 2K5VA 1EQQA 2UVRA 1HHVA 5M3MB 1G3IA 1QUQB 4F5NA 4KLTA 3MVVA 3ZH9B 4JV5M 1M8AA 1YNXA 1MA7A 9ICPA 1KQQA 7ICNA 4A3EH 1PRBA 2VUMH 1FJGQ 4PV1C 2LVNC 4GC6A 3GLGA 4C3JH 4K6LA 3V7KA 5JJLA 4A3EB 4RKUF 5KFYA 2VUMB 3HOWG 3KUPA 2DENA 2WINB 3CPFA 3EFXD 3OGUA 4P73A 4P0QB 5FLXL 4R8UA 5IIIA 4C3JB 3EZ5A 3RR8A 4BWJA 4JV2A 4ZH4A 3OTOM 4BJQA 9ICJA 1RDPD 4R4OA 1PJJA 4LW1A 1OW5A 4UATA 2WSCF 3EJIA 1GJTA 3J80i 4C8KA 2AKWB 2JH7A 1Q8IA 5HGTA 3CCSA 1RCVD 4H02A 5LL6X 2L4FA 3J80c 4I5SA 4RFBA 3C58A 1TWAH 4B3RL 2PFNA 2RCFA 1HUOA 2IJ0A 1OQYA 3NBIA 7ICTA 4DAPA 2UVVA 3GLFB 2Y0TA 4UAVA 3MBYA 3CF2A 2G5HB 1GVNA 3FP9A 3HOVH 3ZQJA 5KPZA 3RN2A 1O7LA 1I94L 5KG4A 3NGDA 3ILKA 2PO4A 2LS01 4NXMM 4Z6CA 3SAGA 4QWBA 3U6EA 2M9VA 4LY6A 4POFA 3A98B 1HNWQ 4LVSA 3VYTA 3BS5A 5IWAQ 5AM3A 1YHQA 1S0VA 1SE2A 3N7RC 4ED6A 5AKXA 1H9JA 4DL2A 1V1PB 4GC7A 3ORYA 4NJ8A 1TAQA 5ALEA 1SNMA 4RHRA 4IBJA 1SXJE 2PI2A 3C23A 3PUXA 4DNRB 3T5LA 2Q2TA 3IRBA 2AH5A 4DAMA 1ZD5A 5CGKA 3H8SA 5FTKA 3U26A 2Y1JA 4KLLA 2EO2A 1FJGL 3WKCA 1ZEQX 3FTCA 3PUVA 3BQ7A 4I65A 2Y0SB 3KOYE 1R9TH 7ICUA 2D0OA 5HY6A 1TWCH 1AW7A 2VDBB 3A0JA 3RLOA 4M04A 3SZ2A 5DGBA 4FYDA 2SEBD 3LNNA 2JHDA 4Z8XA 5IREB 3KHRA 2C98A 1HNXM 4A75A 3KBBA 1PYWD 4DXFA 1T8EA 2RQ5A 3HOXG 3IN5A 3A74A 4UB2A 4DFJA 1ONLA 2K52A 3RB6A 1NOMA 3KJPA 4DV6M 1VQAA 1MJEA 1FD7D 5IGCA 5HR6A 4KHPQ 4C1NK 5AM1A 4EBCA 1T43A 5AI0A 2DKZA 3Q8GA 5CHGA 3HKZG 4OHJA 3TP8A 1L1OB 3OHXC 1A3TA 3H7IA 2ALYB 3HOZH 3T16A 3K7AH 2J7OA 4XUSA 5ALMA 2NB0A 1B3AA 1U5KA 4I81A 5C3EB 2IHEA 4YWLA 3I70A 4JBJA 5EOZA 1ZQZA 3WK8A 3HOZB 2B63B 3K7AB 1ZYRD 4XDXA 2P35A 3K5OA 3AU6A 4IBEA 1HNWL 3QU5A 5E26A 1NSNS 9ICRA 5FP0A 1WTHA 5IWAL 4FBUA 1KFDA 5JUMA 4OW0A 2QARB 1JMSA 1HH2P 5EXTA 4ODGA 1ZQAA 4FNFA 1F77A 4KY5A 5KNDA 1G2TA 1Y1VH 4IZ8A 4PDGA 1PTOH 1B70B 5KT7A 3D6JA 4AKHA 2UUCQ 1Y1VB 2NVXB 2R92H 4NP5A 1XXHE 1PTOB 4DR5Q 2NWGA 2QKQA 2KSOA 2DAMA 1K83H 3ZDBA 3TP5A 4EYHB 4A3GH 1JUDA 3U60B 4QZ9A 4DV3M 2D7GA 1TF0B 5CBEE 2RQXA 4KD3A 1K83B 3CGWA 2V6ZM 5EE1A 2R8HA 4O5KA 2N78A 4TQSA 1UE5A 3J81c 3NBHA 4CIZA 4FS2A 4ZPXA 1Z4OA 2D2CC 3T53B 1TH4A 2DN8A 1UEAB 4F72A 2TSSA 3DV9A 1COOA 4FCTA 2L6OA 5CR3A 4QMGA 7ICPA 3G6VA 1L7NA 1S0NA 2PFOA 1IW7C 5ALRA 4KHZA 2DNCA 3LWUA 4KHPL 3J81S 1EY6A 3U