1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
4ED1A 3CCRA 1VQ5A 1SKSA 4GLVB 4B9LA 3TARA 1EQQA 5KFNA 5KG6A 1Y1VH 4DL4A 2DUDA 2JY6B 8ICYA 2HQLA 3GTGH 3FKIH 4UBCA 4F4XA 4G3IA 2N3SA 1IBLL 4DUYQ 5C3EH 1IBKQ 3RLNA 4R66A 2C28A 2AHOB 4M04A 2Q2UA 2V4QA 2WB1G 5KFAA 1KL9A 5DG9A 4HJ9A 5IINA 4DL7A 4HJ5A 1NKCA 1T4GA 4RNMA 2DFLA 4BXXG 9ICLA 1VS0A 5JUMA 3JPRA 4M2YA 3MEFA 2JEGA 1AH9A 4M6WA 1XS9D 8ICCA 2AKWB 3CW2C 4UQGA 4C8NA 2QGQA 4NXNL 1RYRA 1UEBA 1PYBA 5KFWA 2UXBL 5KFSA 4DBGB 5KG5A 4DL5A 7ICEA 1UT5A 3ZD9A 3OSPA 3BQTA 2R6GA 1Q7YC 1G51A 4AYBG 4LF7Q 1LV5A 1FJGL 4KLGA 1N48A 4J9PA 1N56A 3CC7A 4JI3Q 4QWDA 3S24A 2E2JH 1UFZA 1TXYA 4JI1Q 1ASYA 3T1YL 5DDMA 3UDIA 4JWMA 1K3RA 1XXHE 1NOMA 3EN2A 4IFDI 3ETLA 4PHAA 8ICQA 3RH6A 3F8TA 3KOJA 5LMNW 3S1QH 4PPXA 2K5NA 1JT8A 1KRSA 1HNXQ 3EPIA 2JNHA 4IRKA 4JV2A 4LF5L 1T3NA 4J9RA 7ICKA 1C7YA 4GXKA 3T1HQ 4BY7H 1OAIA 3NBHB 4DOAA 5CJ7A 3H4BA 4JYAQ 4I29A 1MIUA 2QSFX 3PGZA 1H38A 3NENA 1N33L 4LZGA 3TANA 1VQ4A 1SL1A 4YP3A 3G6VA 2F3IA 5GAGC 2FLLA 2JA8H 1IFYA 4ECSA 4PZ7A 9ICXA 5D46A 1MQ3A 3MBYA 1XMQQ 1Q1BA 1XSPA 5BOMA 1ZQEA 3PMLA 3Q8MA 1F4IA 3MXNB 4HIKA 4JI0Q 9ICHA 3E21A 2OQ0A 2PI2A 2OCEA 3V7LA 4DFMA 4NB3A 5LMUQ 1SKRA 3CCUA 1XNRQ 4DSIA 2XCPA 4DQQA 1I5FA 2MGWA 4I2BA 2R93H 4GEWA 3AU6A 4YHHL 4JK1A 1P3QQ 2B3GA 4B3SL 1ASZA 2ID0A 2ASBA 2MQHA 2ASDA 4I2GA 2I0QA 2JA6H 5EWEA 3PUVA 3FE3A 3RH4A 2VL6A 2KZ3A 4IJHA 4DR4Q 2KBNA 3G71A 9ICUA 3CMAA 1HR0Q 3RRGA 5M5XH 2KHJA 2JA5G 4JUZA 4LF6Q 3M4PA 3K9OA 3KYHC 2N8NA 1QZGA 1ZQHA 4IPGA 1NJIC 5DB9A 1HZ9A 2JEBI 4LFAQ 3RR5A 3RB4A 3SGIA 5IYBG 4X62L 1IL2A 4RQ4A 1Y8GA 1ZQOA 3HOWG 4P4PA 2LXKA 1Q82C 2R92G 1PH5A 3UXOA 7ICLA 3UPQA 2UUBQ 5LMNQ 1KIXA 4KLOA 1ZQFA 2FPMA 3T3FA 1SZPA 1BPZA 1PHJA 4K4HA 1QSLA 4L5RC 1VQBA 4TQSA 3PW0A 3GIMA 4Q8FA 4GXJA 1RZTA 1G4AE 8ICWA 3KF6B 3PW2A 5HMLA 1LYLA 2MAXA 4A3CG 1QVGA 3KHGA 1ZQJA 3H8JA 3CQZH 2LBCA 1Z3EB 1YJWA 2I5LX 2KCTA 1ZQDA 2IT1A 1G3IA 3NELA 4KI0A 4DR3L 9ICCA 2UU9L 3I4MH 5IP9G 1PH9A 4F93B 1SE8A 4UAYA 1BGXT 4KLMA 4TQRA 1B7YB 4MZ9A 4RU9A 4BXXH 3M3YH 4QZHA 3NGDA 2AGQA 1SL0A 1YHAA 4DR6Q 3TREA 3C5FA 1OXXK 3CF5A 3GLIE 3MMPA 2IA6A 4YWLA 1A0IA 1EWIA 3OSNA 4JBJA 2LXJA 2VZAA 4DFKA 5GAEC 3KF6A 5J2EA 2GWSA 2PNHA 1CKMA 4A3EG 1KEJA 3PUXA 1UE7A 2R8JA 1TR8A 1VQHA 1UE1A 4B3MQ 3EIVA 4A76A 1WOCA 5JEAG 5J2JA 3JPQA 1VQKA 4K0KL 4UY8C 2BWBA 5J29A 2LYHA 4YMMA 4KLQA 8ICIA 3GD7A 2Y0SG 1QUQB 4PHPA 4QZAA 5D4BA 2CQOA 4A93G 4LFCL 3MFIA 3UDGA 5L9XA 2A1JA 2W8KA 4G3OA 5KT2A 1PH4A 1EXNA 1NTGA 2FPLA 4DR7L 1NV9A 1PGYA 2JZBA 4QW9A 2HHHQ 4P74A 9ICSA 2ZUDA 4M9LA 2LTUA 1N36Q 1QVCA 4AQYQ 1Q02A 3I4OA 2VQFL 1UWVA 1B43A 1CSQA 5GROA 5E7NA 4F91B 3BZCA 4KLTA 2B63G 4LW1A 1P8LA 3ISDA 2MROB 2PFNA 4TURA 1RL2A 2PXIA 2ES2A 2KHHA 2GVAA 5L1KA 1Y1WG 3AYHB 2CKZB 1BPYA 5GADC 3KTQA 2RCNA 3Q8LA 3T5LA 2ASLA 2J6SA 2WB1E 1V9PA 3C2KA 2Q2TA 5DFLA 4TUPA 1ZQTA 1XPUA 1MKHA 2VANA 2BQRA 4DV1L 5KT4A 4DV5Q 3K0XA 2YYZA 2VA8A 1X55A 2BCRA 1D9FA 4DS5A 3U58A 3RJGA 3M8SA 4KLEA 3GLHE 2HHWA 1SLJA 1NE3A 1VG5A 4ECVA 3HFZB 5DGAA 4UB2A 4UB1A 1B70B 5KFBA 3RJIA 4JBWA 4NLKA 4F2RA 4IOCA 2N49A 4C8OA 1SR3A 3EPGA 3T5HA 4AYBE 4ALPA 2DZLA 2JK8A 2JA5H 1TK5A 4I27A 3HOXG 3VDYA 1IBMQ 5DQIA 2F1HA 3FDSA 4JOIA 2R8HA 5GQOA 4O5CA 3GIIA 1ZQYA 1WJ7A 1N9WA 2WZJA 3OJUA 5KT7A 5IYCG 1D9DA 4AIMA 4J9NA 3HOWH 2R92H 5KFHA 4DSEA 4J9QA 4JI0L 2ZM6Q 4LF8Q 2YU9H 1ZJMA 5LMUL 3I56A 5DB8A 4LF4Q 3L7ZC 4DUZQ 7ICFA 7ICVA 3E0EA 8ICLA 3E46A 3KJOA 3PX6A 1NJWA 3KJPA 4A3KG 3GIJA 4A3CH 1ZQPA 3RBEA 1S40A 5KT5A 5KT3A 2DGYA 3IHPA 2BPCA 5KFVA 1WHCA 3RLFA 4IPHA 4DFJA 3PCOB 2XCAA 4UBBA 2QEXA 2NRVA 4FDBA 3W1BA 4I2CA 3GTPH 1VQJA 4A3FG 2BH8A 3L0OA 1HNZQ 4DR4L 2VA3A 1I6HH 2A8VA 9ICEA 2HVIA 2F4VQ 3CC2A 5IP9H 2LVOC 5DG7A 4LUOA 2BCQA 1OTRA 4P2HA 1UE6A 4ED7A 4DV6L 5DQHA 2C35B 4LF6L 3RAQA 1Q46A 1KRPA 5J0WA 2WTFA 1VQLA 3PUYA 2KZMA 4DSKA 3OW2A 2LVPC 1SL2A 4LUVA 5IT9c 4HIOA 3TRZA 1E94E 2KCMA 2P6RA 1I94Q 5KG3A 3H3VI 8ICRA 2E2IH 1HUOA 9ICTA 5C44H 2OTJA 2UUBL 3GTMH 2OO9A 5F9NA 4TUQA 5KG7A 4B9UA 1JXEA 3HOYH 2D62A 4UPAA 4MEYA 4PZ6A 3Q8PB 4P71A 5FJ8H 1EQRA 4YN4A 4A3EH 3PSIA 5JJKA 4RQ3A 3G6YA 3D0FA 4BY1G 3GQCA 4M9JA 5K36G 2UXDL 2BHNA 1X2IA 3N4MB 1V1QA 9ICVA 4JOIC 2XGPA 4KITB 4P4MA 5H1SE 1P16A 3PO3G 3ORYA 1HZBA 4A3BG 2R8GA 4R64A 4ME3A 5J2IA 4DF4A 1X3GA 4B9NA 4R1JA 3TEHB 1R9TH 3K9PA 1L5UA 4M6WB 1DV0A 3RJHA 2FLNA 1HJPA 2BDPA 2QA4A 3UQ0A 3TS2A 5FLMG 1YHBA 3LK9A 5KG4A 4QZCA 4NY8A 4O3OA 2C2EA 1HT2E 2NRTA 2KFNA 5HGQA 3RLOA 4IQWA 5BR8Q 3MR5A 3HOVG 4LFBQ 1V92A 3H4JA 1J5EL 3RJJA 4R65A 2ZJQA 3PW7A 3BQ0A 3RH5A 1Y1WH 4HJ8A 5AJ3Q 1NK6A 4DV3L 4QWCA 3BQ1A 3A5ZB 2VQEQ 2JEFA 3B89A 5IYDH 4JI5L 1XNQL 4F4YA 2NZHA 4F5OA 4ED8A 4RZRA 1A8VA 2HWJA 1PH7A 4B3ML 4A3DH 2FXQA 4JI7Q 4IOAA 2KZZA 4NM1A 3SYZA 3JAMc 1MQ2A 5KFPA 2B21A 2B29A 1LM0A 3PNCA 4DQRA 2D0OA 1U0LA 3CCMA 1B8AA 1EFUB 5TZVA 1D8YA 1TTEA 3K80C 5KFTA 1SMXA 2EXDA 4BWJA 4XIGS 3GIKA 4B9MA 4GKJQ 3PF4A 1QSYA 9ICAA 2E2HH 8ICTA 1BBWA 2DAEA 4DLGA 2IBKA 3BBZA 1TV9A 1BKBA 1S3OA 5KG2A 1L3UA 2DPIA 1VEGA 5J2DA 1RXVA 9ICJA 2E5LL 3SV3A 1TAUA 5KFKA 4LNQA 1PH1A 1EIFA 3PO2H 3C1ZA 3HW8A 2Y0SE 2F1IA 3H8SA 4LUZA 3PV8A 4GC7A 4DS4A 5IYCH 4FS1A 1HZAA 4UP9A 2AQ4A 4B3RQ 2YV5A 2VUMG 1N34Q 4L5SA 2KNZA 3GFKB 1XSNA 2QHOB 4IQVA 3ER0A 1NKEA 5C0XJ 3AEVA 4JI4L 3KDFB 4C3HH 4JI2L 2XGTA 1BBUA 1SKWA 4NLNA 2R7ZG 3STBC 4ED2A 2AQ0A 4DSJA 2NRWA 3THVA 2DAMA 4A3KH 3H7IA 4NM2A 4YD1A 1LUZA 4PMWA 4HYKA 1KDHA 2HIVA 1XPRA 2JE6I 4NLGA 2ALYB 1PA6A 3CCLA 4JC0A 1NK9A 2O25A 4A3FH 1NK8A 1SN8A 3ICEA 1XMOQ 1D7QA 2R7FA 2YTVA 4O0AA 8ICBA 3S2DH 1YBYA 4EBDA 4YCUA 4OX9L 2JA9A 2UUCQ 3CXCA 4Z6EA 5HHIA 4UB4A 3MFHA 1MSWD 2RF4A 2PI2E 2CP8A 4DFPA 4DR1Q 4C8MA 1YJNA 5J3BA 4JV1A 1YI2A 4BBSH 5J2KA 4GKKL 1E1OA 3ZDDA 3KDFA 3I55A 5CP2A 1ZQKA 1R4GA 4Q43A 4PGYA 1HQYE 4IO9A 3HPOA 5DB6A 4I28A 4DNIA 4B3TQ 1KFSA 1WGLA 3G4SA 5F9LA 4A3JG 1A63A 2EIFA 1JR3E 1Q12A 2ZJ5A 2ZTDA 4AH6A 3GLFE 4YXMA 2K50A 3HOUH 2BR0A 5BPCA 2NVXH 4UB3A 4I2EA 2HT1A 5KFYA 5DBCA 4OONA 7ICQA 4BY1H 1YHQA 2EJSA 4X64Q 4IQTA 2B3TA 5IIJA 4MFAA 1S97A 5J0TA 4QJFA 3NTUA 9ICKA 4MEXA 5J2CA 5DLFA 4XA5A 1HUZA 4ZH4A 3TAQA 2PFOA 2ATLA 1HNZL 8ICVA 3G48A 1KYIA 5KFXA 8ICUA 3T5KA 4B9SA 3SI8A 4WJ3M 2DNAA 4BGDA 4A3LG 2HHSA 4F5RA 2FLPA 2EKKA 5KFJA 7ICTA 5IWAQ 2C22A 4POGA 2I9GA 3J81j 4DV7L 2BA1A 4KLSA 1N32L 1TWHH 9ICQA 3GDXA 5DBAA 2WAQG 2FPKA 1EYGA 5HP4A 4LF9Q 4ECYA 1VEKA 3JPNA 3KHHA 5KFUA 1ZQLA 4R63A 3S1MH 4JI6L 4YY3L 1V43A 1EIYB 2RDIA 2JEIA 4UB5A 1U49A 4EQ5A 5IIIA 1L3TA 2BCVA 2P6UA 1NKBA 4XUSA 1ZQUA 4FO6A 4DV4L 3JPTA 2A1JB 4F4ZA 2NVYH 3IRBA 1JMSA 3PW4A 3PV0A 3B6YA 1VQ8A 4KLJA 1U4BA 2D0PA 4DSFA 1VQPA 4DV0Q 3BDPA 1CUKA 3CD6A 2JZBB 5IILA 2ZUCA 1TWAH 4QWEA 8ICFA 1BPEA 4KHPL 4KLHA 1JE5A 4JI8L 1KC8C 3GTOH 3UQ2A 2LVQD 2W9MA 4I2DA 2R0IA 2Y1IA 1S76D 4F8RA 5EOZA 4Q8EA 3PIOA 3V6JA 2V9WA 1CKOA 3HOZG 4DV2Q 4IPDA 2K52A 4MF8A 3K81C 4EYIB 3T6PA 1RYSA 4QY7A 1ZETA 1ZQWA 3MDAA 4OWTB 2K5HA 3GTKH 5CHGA 2L4FA 4DLEA 3ULPA 4KLFA 2PFPA 4NXMQ 1PH8A 2VY3A 4YD2A 3K4GA 3V6KA 2HAKA 3F92A 1WGNA 3FP9A 4GN3B 1X9SA 2IHNA 4WJ4A 2C2RA 4ED6A 4HIMA 2DKLA 1IBLQ 4X65Q 1G6PA 2JUJA 4ELVA 2NRXA 1TK0A 7ICJA 4QZBA 3RB0A 1K8GA 5AJ3L 1ZQXA 4DUYL 3Q8QB 2VQEL 1IBKL 1X9MA 2N78A 3I4NG 3RJFA 1QTMA 1LB2B 8ICGA 3FYHA 1VQIA 4C3JH 2ISOA 4JI7L 1QSSA 3DM3A 3H0GG 4YMNA 1U48A 1BPBA 3J7ZC 2R7ZH 4J9LA 4NXNQ 2BWEA 2CWBA 3A0JA 4F5NA 3J80c 3LCUA 4J15A 2UXBQ 1PH6A 3M9MB 4QZ9A 3RN5A 2RHQB 5J2AA 4QZGA 3BJYA 2NRZA 2L15A 2YTXA 2PI4A 4QWBA 4ELTA 1OXVA 1L3SA 2VW9A 3S2HH 1QZEA 3V7JA 1NV8A 4LF7L 2AWOA 4WP2A 1ZQNA 3BJUA 2XY7A 3CCVA 5KFRA 4JI3L 5KFGA 3FKIG 5KG0A 1VQDA 2I5HA 2XGQA 2DI0A 1U45A 4OWXB 1UA1A 3UXPA 4IR1A 4JI1L 2F52A 5C3EG 1KFTA 4O5EA 9ICBA 4YXJA 4B3RL 1K1SA 1N34L 4QWAA 1HNXL 4RQ5A 3DLLA 1MJEA 2UVWA 4O3SA 4UP8A 4HEOA 2KN7A 3CPFA 3PIPA 4F4KA 4I2AA 3BQ2A 1VQFA 4A3JH 4DQIA 1U5KA 3T1HL 4TQUS 1Q81C 3FRHA 4JYAL 1NJZA 2G3QA 1XB2B 3F2CA 8ICZA 3FRIA 5EWFA 7ICRA 1VQ1A 1MJCA 1ZMWA 2FMPA 9ICOA 2HHUA 1G41A 1T6OA 5KG1A 2BA0A 3IECA 4BA1I 1A5TA 2DAGA 3S16H 1DOQA 1MC8A 4O3QA 5IYBH 4QGUA 2LSSA 2W9CB 4F92B 3GV7B 1ZQSA 4QW8A 1XMQL 3ULLA 5C0XG 4MTNA 4R4IA 2KNVA 1WCNA 4RMFA 5KFOA 4C3IH 3TFSA 4M0AA 4DKAC 2MNAA 1XNRL 4QZEA 2KTQA 4APVA 5IIOA 4YHHQ 5IIMA 5M5WH 3HWTA 3PF5A 3OTOQ 1KD1C 4B3SQ 3ZDCA 4K4IA 2OQKA 4DR1L 4QZIA 4NLZA 3F2DA 1GM5A 3M7NA 4X6AH 3RB3A 4BBRG 1J6QA 2A1AA 3RN2A 1U9LA 1UT8A 5IIKA 3KF8B 3RR7A 3PUZA 4BY7G 5J0PA 3CCJA 4A4IA 4B3TL 4I2IA 4P75A 2I1QA 2Q2HA 2W9BA 8ICSA 1HR0L 1UA0A 1SFOH 5DKWA 1WCMG 3QEAZ 4UAWA 1QZHA 2ZTEA 4FBUA 4ED0A 4KN4A 1WI5A 1ZJNA 3LWMA 2W9CA 1PH2A 5L1IA 3RBDA 2RHSB 2BH2A 5BOLA 1XJVA 4XTCS 4LFAL 5DBBA 4DK3C 3E9IA 2NVQH 9ICGA 3TFRA 3PUWA 1YVCA 4RPYA 4YVZA 2XO7A 2IX1A 1KTQA 3Q8SB 2BGWA 4PGQA 2HIXA 5LMNL 1GO5A 3ISCA 3HKZG 1ZQZA 3LCVB 3HX0A 2VA2A 5KFMA 2R93G 3GLGE 4RPZA 5DQGA 1VCIA 3HOZH 2CWPA 3JC66 1NJYA 3H3VH 1L1OA 4QZDA 3RAXA 3J81c 1A62A 1T9HA 3PX0A 1PFSA 4RPXA 1WYDA 2OWOA 1JX4A 4DK6C 2CCZA 2IHMA 3K75D 4M9HA 5DDYA 4RUCA 2IX0A 4Q44A 5D49A 1TKDA 2Y1JA 2WP8J 3AUOA 1TAQA 2UU9Q 2K9DA 7ICPA 4A93H 5KTQA 5JJIA 4XRHA 7ICGA 1KSPA 4JV0A 3SZ2A 4KTQA 4Y7NH 5CR0A 2RDJA 5L1LA 3JPSA 2CWAA 3ULJA 3I4NH 1KHIA 4Z6DA 4KLKA 4RQ1A 1K0RA 4QQBX 3GTLH 1C0AA 4BDPA 4X66Q 2UVVA 4UP7A 1Z47A 2WAQE 4DV0L 3ZD8A 5C5JA 4J9OA 2R7DA 4DR6L 3PW5A 5HNKA 4JBMA 1NMGA 1YJ9A 2HHVA 3U50C 1D8LA 1K83H 4I2HA 5J0YA 4A3MG 1K9MC 2B63H 1A77A 2Q0ZX 4NPSA 1CSPA 5KFIA 1NY4A 4DQSA 2M9NA 1KFDA 1IYJB 4DAYB 4GLXA 5J0RA 3UDFA 5KFEA 1VQ7A 5DLQE 2K4KA 7ICOA 3RZOH 1VQEA 2HHTA 2AJQA 2JJQA 3C23A 4NXZA 3NEMA 4K0KQ 5KFCA 2XY6A 5C4JH 4UN2B 4NXML 2IHEA 3CCQA 4EEYA 2ZTCA 4X5VA 4P72A 8ICPA 4LFCQ 3I4MG 4X65L 4P4OA 1S0MA 1ZMUA 5J0OA 4DR7Q 4DOCA 4CCHA 4R4QA 2BQUA 5HMMA 1XWLA 2V4RA 3G6XA 4KLDA 1GVPA 3KLWA 3F2BA 2HHHL 4IJLA 5KT6A 2MO1A 1E24A 2VQFQ 2FMQA 4A75A 3H8WA 2BPGA 1N36L 4RT3A 4ECRA 3TI0A 1L1OC 4AQYL 4LWCA 4M47A 3L2PA 2JY8A 4ECQA 3EYZA 1FGUA 4GOPB 1RXWA 5L1JA 3HOXH 4DPGA 4F2LA 2PQAB 4J9SA 2ATWA 4YR0A 4LVSA 3JAMi 5C0XI 2K75A 5J2GA 3PO4A 5M5YH 5M3FG 1HR0W 4GN4B 3STBD 3UE0A 5JJLA 2JY5A 3MR2A 4QZFA 3AQQA 4JG2A 4Z6CA 3TQYA 4DV1Q 1DO2A 1M90C 1OXSC 4GXIA 4BWMA 5ELNA 1N8RC 1XPOA 4JBKA 4M9GA 4JV5Q 2UUAQ 3FHWA 1S0VA 5DG8A 1PZNA 3E2EA 4A3IG 4DV5L 1HNWQ 3SV4A 1Z00B 3UXNA 1TFRA 2GN5A 2I5MX 2JZ1A 1PH3A 5IE8A 1YLAA 4BXOB 1WR1B 5CA7A 2J6UA 1JMCA 2UXCQ 1VEJA 8ICHA 4YWMA 3UDXA 4BBRH 4LZDA 4DEZA 4C8LA 2K14A 1E3PA 4DOBA 1NMFA 3CAMA 4O5KA 2AGOA 2AU0A 9ICIA 7ICSA 4A3GG 4RT2A 4O0IA 5J2HA 4IFDJ 1LTLA 3IHQB 1Q8KA 2QNJA 4ECWA 8ICOA 1ZQIA 4DWIA 3RB6A 4GOPA 2XY5A 3Q8DA 2VNUD 1VQGA 5KFZA 4Y52H 1S0OA 4DO9A 2PQAA 4PGXA 4EZ9A 1NK7A 4GNXB 3CMEA 1WCMH 2DAIA 2JZ0A 4EX5A 1UE5A 5C4XG 1ZV1A 1ZQQA 5IP7G 1IBML 1VDLA 1O7IA 2V1CC 3HP6A 3ZDEA 5KFQA 1HT1E 4KLUA 7ICHA 5ELOA 4PH5A 3C5GA 1WIVA 2MFIA 1CEZA 4R4OA 1OTCA 3TQ1A 1S10A 4TUSA 4F5QA 4F4WA 9ICMA 1T7PA 2E8GA 3RZDH 5KFDA 4HJAA 1Z00A 1XC9A 2ZM6L 3MABA 4EBEA 2JQOA 4GS3A 3S17H 4LF8L 4LF4L 4BXOA 2OTLA 4R71A 4DUZL 3QZ8A 3F1ZA 9ICNA 5DGBA 1VQOA 1JB7A 3OTOL 1A76A 1AE2A 3G6EA 3M85A 1TVAA 4DF8A 2JEAI 3GV5B 3LDAA 1BPDA 3MR6A 2JA7G 1Q1EA 1PVOA 4L5QA 1AE3A 1YNXA 4GLAC 8ICXA 2ZJPA 1TWFH 4GNXA 2H5XA 1Y14B 3PO3H 1ZQBA 4DL2A 1SRUA 3GV8B 4A3BH 5CB1A 3H40A 4HJ7A 1TK8A 1VQCA 2GVBA 1JJGA 3PO5A 4DV6Q 1QLNA 1XTDA 2F4VL 4OWWB 4EYHB 3PY8A 1X56A 2BPFA 3LGJA 4DR2Q 2FMSA 4H02A 1T43A 1XSLA 1IZ6A 1ZYQA 3OHAA 4YCXA 1IM2A 2MR9A 1X3FA 5FLMH 4F1IA 2UVRA 4ECUA 4R4CA 1M1KC 4O3NA 4IRCA 2A19A 4IQUA 4RQ6A 2ASJA 4B9TA 1I94L 1ZMVA 1ZQCA 1VQAA 1KRTA 2WFWA 3HOVH 3RJEA 3QZ7A 4A3MH 3T5JA 2KNAA 1VQ9A 3GDEA 4KLIA 9ICRA 3E9HA 3CP0A 2K0BX 1IXRA 2ZUBA 4MFFA 4RQ0A 1WCLA 3MR3A 2IY5B 2JY7A 4YG2A 4GOPC 2UXDQ 2AGPA 2NVTH 3GO5A 4O3PA 3Q8RB 4O2DA 1X54A 3M9NB 3K7UC 5FLXc 3GTQH 3B0XA 3TS0A 5KFFA 1JJCB 4BA2I 4DAMA 1TWGH 4Z6FA 4FS2A 2LVNC 4DR5Q 4OXPA 3RNUA 1KAWA 2HHXA 1GKHA 2AWNA 3OYYA 3HKZE 2P66A 4IRDA 5J2FA 1S0NA 7ICUA 5M3MG 1X3EA 3MDCA 4KHZA 1PV4A 7ICNA 4OO1G 5J0XA 2L2DA 2BCSA 3CCSA 2J6TA 4X66L 1BVSA 3JPOA 1T8EA 3KHLA 9ICFA 2Q2IA 5C44G 3W5OA 1J5EQ 1X9NA 1CKNB 2IHFA 1E7ZA 5BR8L 3WWVA 2KFZA 1I50H 1K8AC 1Z9FA 2NN6G 4LFBL 3HOYG 2L4EA 4PHDA 1SG9A 5J0SA 4DV3Q 4YWKA 5M3FH 1JIHA 5J0UA 2BKEA 4QL5A 2NZOA 1GO3E 2Z0SA 1NK0A 5FJ8G 1NJXA 1YEZA 3LWLA 1S9FA 4JI5Q 1XNQQ 2IMWP 4RG1A 4GNXC 1KXLA 3EBEA 3JPPA 2DAKA 2VUMH 4MF2A 2ALZA 5J2BA 2XTIA 8ICEA 3OJSA 3M4OH 5EWGA 1L0WA 3CC4A 4QZ8A 4PHEA 8ICKA 2PFQA 3A74A 4A3IH 3PVXA 1Q86C 3I2ZA 1ZQMA 4KN7A 1IXSA 1AIPC 4I2FA 3RRHA 1VQNA 3A5UA 3CCEA 1GD7A 1JJ2A 2Z6KA 1FVIA 4PG3A 3I7FA 4E0DA 4R8UB 4GKJL 4A3GH 1X9WA 3EW9A 1CKNA 4MNOA 1Y88A 4K4GA 3HKSA 2E5LQ 1MN3A 1FJGQ 3M8RA 1Y1VG 4R4TA 5C4XH 3ERSX 2HVHA 2EKFA 3EWAA 5IP7H 2JEJA 3EZ5A 4RNNA 2R8IA 3T1YQ 3GTJH 4KMUA 3AFPA 1YIJA 2MUTB 3PR5B 4YQWA 4GC6A 1WJJA 5IYDG 1W2BA 2KHIA 1JN3A 3J80i 3QE9Y 4JI4Q 1L3VA 4LF5Q 2ISPA 4TVAB 4EZ6A 1QUQA 4JI2Q 4A3DG 4YR3A 4XQ8A 4JV5L 2UUAL 3S1RH 2KENA 8ICNA 1EUJA 1S77D 3V72A 1EOVA 1HNWL 2C2DA 5GAHC 2K5VA 5EAYA 1HZCA 2ZJRA 1DGSA 3KHRA 1N33Q 1OXUA 1K73C 3C1YA 1BPXA 3S1NH 1OKSA 2PMZE 1U47A 1AROP 3S15H 2UXCL 2W9BB 3Q8KA 4R8UA 1YZ6A 3M4QA 2W9AA 2JA7H 2ZJ8A 3IM1A 3MGIA 2XC9A 1XU4A 4ECZA 5DLGA 2DHYA 7ICMA 3H15A 3PX4A 4UAZA 1E22A 3B0YA 4ELUA 4F5PA 4IR9A 4M9NA 1XMOL 4OX9Q 5JI2E 1VQMA 4YR2A 1OXTA 5KFLA 2UVUA 3M9OB 3PO2G 2MUTA 4A3LH 4GN5A 2UUCL 1YITA 2EQSA 1JXLA 2OOAA 1TWCH 2YTYA 2F1JA 5HHHA 1W3SA 3GILA 4GKKQ 1DO0A 1S72A 5HY6A 3K8AA 2HW3A 3D31A 1L1OB 4C2MH 4MFCA 3AFQA 1C9OA 1VQ6A 3M9BA 1KLNA 1NBWA 4IFDG 2HHQA 1G291 4PZ8A 1RIPA 3QEBZ 5IY0A 3C2MA 4DSLA 3K7AH 2Z6KC 4J9MA 1QVFA 1HH2P 3BU2A 1E1TA 3BZKA 4RUAA 1OQYA 2JA8G 3C21A 2PI5A 3RTVA 3CPWA 4X62Q 4HIDA 3AU2A 4X64L 1ZQVA 7ICIA 1IM4A 1NK5A 3J7A5 2RRUA 4JWNA 2CFMA 4IPCA 1RPLA 1H95A 3TAPA 5J0QA 2AMCB 4ED3A 1X6OA 4OO1I 4RQ2A 4JCVE 3C2LA 3MGHA 3V7KA 1X65A 1I3QH 4L5TA 5M3MH 3RR8A 4F2SA 4YCWA 4DV7Q 1ZQAA 4DR2L 2JP7A 3ZDAA 1N32Q 9ICWA 4C8KA 3N97B 4Q7JA 2NN6I 1B22A 5IWAL 1ZQRA 8ICMA 1XO1A 4RQ8A 2W8LA 4YCVA 2LVAA 4BBSG 4FBTA 1K1QA 1NK4A 4EBCA 3UE1A 4LF9L 2OOBA 4POFA 4KLLA 2JA6G 3PR4A 4B9VA 3ZDBA 3OGUA 1ZQGA 3U4VA 4JI6Q 4YY3Q 3W1GA 4DR3Q 3V6HA 3HT3A 4DL3A 8ICJA 2MJ5B 2BQ3A 3U4ZA 3H4DA 3HOUG 4I2JA 5CWRA 4J9KA 4YMOA 8ICAA 2ZJAA 4DV4Q 4P73A 1FL0A 4DQPA 9ICPA 2DPJA 4YFKA 4F3OA 3OHBA 4RQ7A 5JEAJ 3PMNA 2VS1A 3J81i 4KHPQ 2MO0A 1SROA 4QIWE 4JI8Q 2BCUA 4RNOA 3H0GH 4Q45A 4ECXA 4O3RA 4ECTA 3ZJYC 1COOA 4DR5L 4F50A 5DB7A 3ISBA 3KFUA 1WFQA 4DL6A 3S14H 1PYSB 1L2FA 1EFWA 2R8KA 3RJKA 1KQSA 2DENA 4DV2L 4O9MA
chains in the Genus database with same CATH superfamily
4ED1A 3CCRA 1BOSA 2NB0A 5KFNA 4DL4A 8ICYA 3FM9A 1R9TB 4F4XA 2N3SA 4DUYQ 2E8OA 3K0YA 3GTLB 3BOSA 4FZNA 4DL7A 2L09A 3DUZA 4BXXG 5I6WA 3JPRA 4K5WA 2XICA 1AH9A 2AKWB 4Z8XA 2RP5A 1SMYC 1PYBA 1S5CD 4DBGB 5AKXA 5KAIU 1STAA 4LJ6A 5AK6A 3Q8XA 3S24A 3WKDA 2SOBA 2A6ED 4CBVA 3UDIA 4JWMA 1NOMA 8ICQA 1E9SA 2EO2A 1KRSA 3TKAA 2E2HB 1HRJA 3SAVA 2JNHA 1AFPA 4K2LA 3GLFB 4B7GA 3NBHB 5KQ8A 1R2ZA 4JYAQ 1MIUA 1H38A 1ET6A 1TU2B 1EYDA 2F3IA 3HWSA 2JA8H 1IFYA 4PZ7A 4GC9A 2F0VA 5D46A 4IUTA 3PMLA 4JI0Q 2OQ0A 3V7LA 5LMUQ 1XNRQ 1GHKA 4AKIA 2MGWA 2LNHC 5FO7B 2B3GA 4B3SL 4CKEA 2ID0A 4P0QB 1QUSA 2I0QA 4A3FB 2JA6H 3UMBA 2VL6A 5G3LD 3QUBA 2KBNA 3G71A 4US8A 1HR0Q 2KHJA 3SAWA 1UUPA 2F0EA 3KYHC 5EXSA 1HZ9A 2WF9A 3RB4A 3SGIA 4RQ4A 1ZQOA 3HOWG 2KEEA 3UXOA 2UUBQ 1UPHA 1ZQFA 4C3IG 1VDVA 1BPZA 3HOUB 2NVXB 2KKVA 4X3KA 4XGIA 4GXJA 1G4AE 3PW2A 2MAXA 3WKAA 1IY2A 1QVGA 3ICXA 3H8JA 1YJWA 2KCTA 2UU9M 4CDGA 4Y2SA 2EZVA 4ZLTF 3IDWA 5KGUA 1SE8A 5IGCA 5A2QS 4KLMA 2O4XA 4RU9A 3M3YH 1SL0A 1J09A 1GUSA 1BUVT 3T79A 1H6UA 2KMDA 4JK1C 4LFBM 1JQYD 3DMUA 4LZJA 3L5KA 5CV7A 3KF6A 5J2EA 4A3EG 1JROA 2NVYB 2FNAA 4PL1A 1UE1A 5D65A 4XQNA 3EIVA 1D0MA 1TWAB 1WOCA 5J2JA 3KSXA 3JPQA 4K0KL 3SHFA 5J29A 4G4NA 4YMMA 4LFCM 1OXJA 1ENAA 3Q6SA 1NCVA 4PHPA 2K6AA 5D4BA 3HHWA 3W68A 5L9XA 1NTGA 1A2TA 3RFAA 4GKJM 1PM5A 4G6ZA 9ICSA 4PDGA 3OMGA 1XNSA 1Q02A 4FYDA 1B9NA 2VQFL 3BZCA 4KX5A 1EWHA 3ISDA 1KW4A 2WSFF 4NSRA 2GVAA 4R3DA 1Y1WG 3AYHB 2RCNA 4EQNA 2ASLA 4DV1M 2MA1A 1SXJD 4JV5M 4EVOA 5KT4A 4GMQA 2YYZA 3VR4A 1D9FA 4HN7A 3U58A 3M8SA 4KLEA 2HHWA 3FUXA 1NE3A 4EX6A 4ECVA 4ZKCB 5DGAA 3TE6A 1MI2A 3TQSA 1B70B 3NVVA 4F2RA 4CE6A 2N49A 4C8OA 2F3NA 4XQJA 3EPGA 3T5HA 4FZMA 2D7GA 2DZLA 2BDOA 3CHBD 3SAHA 2D9UA 2IPKD 4NW2A 3VDYA 1IBMQ 2J4XA 4JOIA 1GABA 2R8HA 1WJ7A 1A15A 1N9WA 1TIID 1I4XA 4X3TA 4J9NA 2R92H 2QILA 3HILA 3VYUA 4LF8Q 2YU9H 1ZJMA 4LF4Q 5DB8A 3L7ZC 4QB4A 2Z6BA 8ICLA 3E46A 4EQOA 3L3OC 3FTEA 2DF4B 4A3KG 2PW7A 4A3CH 1ZQPA 3WK6A 1J2MA 5KT3A 2DGYA 2OH2A 3GP1A 3RLFA 2JMGA 4DFJA 1N62A 2QEXA 4I2CA 2BH8A 4C3IB 1HNZQ 4DR4L 9ICEA 4DV6M 2E74C 5IP9H 4QNLA 1YNJC 4P0PB 5DG7A 2BCQA 1OTRA 5M5WB 3U5ZA 4LF6L 1Q46A 4XYOA 1KRPA 1VQLA 4DSKA 3OW2A 2LVPC 1BO0A 1SL2A 2LHTA 2EAOA 5KG3A 3SHGB 2E2IH 4LCBA 3FDTA 4TUQA 5KYLA 1PUZA 4B9UA 3VA5A 3HOYH 1F9PA 3Q8PB 5FJ8H 1EQRA 4YN4A 3PSIA 3D0FA 2IOFA 5K36G 1SYBA 2YB1A 1V1QA 2HD3A 3N7PD 4P4MA 5H1SE 1ZD4A 1HZBA 4A3BG 2OHFA 2R8GA 2EJMA 1QDTA 1Z5BA 2ZIXB 4GIBA 1ZD5A 3WK4A 5ALUA 2LWXA 3K9PA 2QCPX 5CBAE 4LJZC 2BDPA 1B50A 4K6LA 4Y2UA 2C9OA 5FLMG 5KG4A 5CRXA 3DWPA 3TMEA 1V97A 2LYBA 1X3QA 3H4JA 2SDFA 1J5EL 5EXPA 2Q8RE 2K7VA 4J03A 4TSSA 1DM0B 1TE2A 4IUNA 1CK1A 4JI5M 1NK6A 5AJ3Q 1SMYD 4FCVA 1A8VA 2K1BA 4A3DH 5KFPA 4NWIA 2B21A 1K83B 1LM0A 1RTOA 1U0LA 1B8AA 1H9MA 1TTEA 3R2IA 3K80C 4BWJA 4B9MA 3NK9A 3PF4A 1QSYA 9ICAA 1BBWA 4DLGA 3BBZA 3U61B 2E5LM 2EAPA 1FJGM 2QLTA 5KG2A 2DPIA 2B2YC 5J2DA 5KRUA 1BNPA 5KFKA 2PO4A 2OEHA 2BJWA 3PV8A 1SGGA 1HZAA 5JOBA 3PQIA 5AIAA 3GFKB 1XSNA 4JI4L 1RDFA 4C3JG 3KDFB 4C3HH 4JI2L 1BBUA 2K4EA 1SKWA 3NP8A 4NLNA 2R7ZG 2BDUA 1C8CA 4YD1A 3WK8A 1KDHA 1XPRA 3OOCA 4NLGA 4A8EA 1D8BA 3R9XB 3UMGA 3OTQA 5KQDA 2Y0SF 1XMOQ 1JUDA 4QJFB 3S2DH 5TISU 3SMPA 2WF8A 3R8BA 4OX9L 2UUCQ 3S6JA 4Z6EA 3MFHA 1MSWD 2HL7A 5JTIA 4DR1Q 3GV6A 4HMJA 2MGSA 3H09A 4ABNA 2H3VA 5AM2A 2D5DA 3QU4A 1R4GA 2F3VA 4XQQA 1HQYE 2YNMD 4B3TQ 1KFSA 1W5TA 2E8PA 2RRDA 5ALDA 4YXMA 3SAGA 4C1NK 2KCNA 5EP2A 7ICQA 4BY1H 1YHQA 4X62M 2HCIA 2B3TA 1S97A 4IN3A 1XHBA 1B3QA 3RZDB 1SE3A 3J80E 9ICKA 4AG5A 3S17B 4XA5A 4ZH4A 4REZA 3T5KA 3SI8A 4WJ3M 4A3LG 1N32M 2HCBA 2KP7A 2I9GA 3J81j 4DV7L 2BA1A 2W7OA 1TWHH 2LH0A 4DCCA 1EYGA 5HP4A 3NQIA 2BDNA 5CV4A 4QOSA 2LM4A 4DR3M 4R63A 2K04A 1EIYB 2RDIA 3T4AC 2E1FA 4XUSA 1ZQUA 4DV4L 3HZXA 2A1JB 1VQ8A 1JMSA 3B6YA 1OUQA 4KLJA 1VQPA 4DV0Q 1HCZA 5IILA 2ZUCA 4FWGA 3PIP3 4A3MB 3GTOH 2B2VC 2ESEA 4Y2VA 4I2DA 2Y1IA 4F8RA 1QE6A 5EOZA 4KJNA 3PIOA 2HCCA 3GQ4A 4IPDA 4MF8A 4FZLA 4EYIB 4QY7A 2NVTB 3MDAA 2YMMA 2L4FA 1HUMA 4ME5A 2VY3A 1Y69U 1DK3A 2RKSA 1PZJD 4X65Q 2JUJA 4DUYM 5DEHA 4QZBA 3RB0A 5BN3A 1CHPD 1ZQXA 1DJRD 3Q8QB 1X9MA 2KA6B 3VFDA 8ICGA 3VR6A 2QCUA 3P20A 3H0GG 3J7ZC 1I50B 5DAUA 2XSCA 1JALA 3J80c 3LCUA 4J15A 1PH6A 2F1MA 2K8CB 3RN5A 3BJYA 1KLUD 4QOZC 4OJ6A 1I4HA 4QWBA 4OJ5A 2E8NA 2JWSA 2WF7A 3V7JA 1NV8A 2ZXRA 5KFRA 1UA1A 3UXPA 3L9AX 4U673 4GRIA 1Q90A 4O5EA 9ICBA 4FFDA 4B3RL 1K1SA 4RQ5A 4UP8A 2KN7A 4F4KA 4I2AA 4JYAM 1VQFA 4DQIA 1U5KA 3T1HL 3DM1A 2ZAOA 3I04M 3F2CA 4IC9A 5EWFA 7ICRA 1MJCA 3A46A 3GTJB 2FMPA 9ICOA 1T3TA 1BXTA 3PVSA 1AQ6A 2I7PA 3S16H 1MC8A 5IYBH 4QGUA 2KD1A 4JI0M 2W9CB 4F92B 3GV7B 1ZQSA 1XMQL 1G8ZD 5LMUM 3ULLA 1AN8A 1XNRM 1ICWA 3TFSA 4M0AA 3B9PA 1E9RA 1B3AA 3QOJA 3HU2A 3MHBA 3HWTA 4CKBA 4B3SQ 3OTOQ 3I01M 3FC4A 2A1AA 5KYIA 5IIKA 3KF8B 3OPXA 1PJSA 1KBUA 5J0PA 1HR0M 1KFVA 1MN8A 1O7ZA 3L25A 1J8IA 5AKKA 2Q2HA 3SE0A 1K82A 5DKWA 3BVGA 4NMZA 5C1BA 3LWMA 5BOLA 4AKGA 4DK3C 3E9IA 3RD4A 9ICGA 2KJXA 2NQ8C 2CHBD 2UUBM 2DUYA 4KHVA 4RPYA 5ALTA 4XXEA 3Q8SB 2BGWA 5I4DA 1TDZA 1DGJA 3HKZG 3CYMA 5KFMA 1VCIA 5DQGA 2G9DA 3HRZC 1L1OA 4QZDA 2PQEA 3RAXA 1RODA 4OO1J 1O78A 1PFSA 3IFTA 3C1FA 4R9WA 2OWOA 3OHXC 4WRDA 3A8KE 5JEAH 3RE8A 5ITYA 2Y1JA 2WP8J 1TAQA 1NSNS 7ICPA 3AN1A 5KTQA 2WHEA 1I3QB 3BYYB 7ICGA 1KSPA 3SZ2A 1NJGA 4KLKA 1K0RA 3QWNA 4KY6A 4X66Q 4UP7A 4RKLA 3VYTA 3PW5A 4JBMA 1NR2A 1NMGA 1YJ9A 2WACA 2EYMA 2DZOB 1D8LA 1QYRA 1A77A 1CSPA 1NY4A 3K5NA 5CV8A 1KFDA 4V0BA 1KNAA 4FXDA 5DLQE 3RZOH 3TZUA 1EZ8A 3QWLA 3DEEA 4K0KQ 5C4JH 1IN8A 4UN2B 1STNA 2DHRA 1XXHB 4RCOA 4KN4C 4EEYA 4P72A 5DYGA 5C3XA 4P4OA 3S14B 2PNRC 4BS9A 3MVVA 4CCHA 5HMMA 3IL8A 5I9PA 3KFUF 1MSGA 4RKUF 1GVPA 3FUVA 3F2BA 1ZYRD 2MO1A 1OFHA 2VQFQ 4HCEA 4LJXA 2A69D 2BPGA 4RT3A 4ECRA 3TI0A 4AQYL 1V1PA 4M47A 3L2PA 1VDDA 3EYZA 1LTMA 3GTGB 3LVWA 2PQAB 2B8GA 3PO4A 2Z3XA 1W5SA 5M5YH 5ITXE 5JJLA 2JY5A 3J80S 2F8LA 3MR2A 4QZFA 4A3DB 4AKHA 3CF2A 3BDCA 5C0XH 1DO2A 4BWMA 5ELNA 3NWSA 1UEAB 4A3IG 1SIJA 4DV5L 1HNWQ 1Z00B 2M9VA 3UXNA 1TFRA 2BNKA 3UZUA 4UAVA 5IE8A 1YLAA 4BXOB 1JMCA 3UDXA 4HTHA 2FJ2A 4BBRH 1K3WA 2W82A 4DOBA 1MHWC 3CAMA 2CVRA 3SMVA 1Q8KA 2QNJA 4ECWA 2F0SA 2H3IA 1ZQIA 4GOPA 4DWIA 3IV6A 3RB6A 1S5BD 2RGOA 4ID6A 4Y52H 3KOYE 1IBMM 2E2JB 3CMEA 1WCMH 4EX5A 1Y8NB 4K14A 4GHLA 1S3SA 5C4XG 1ZQQA 5KFQA 4FW9A 2C9CA 2MFIA 1Z7TA 3KK7A 5KFDA 2ZM6L 3MABA 4OELB 4DUZL 1B1ZA 5AI6A 2R4JA 3EA6A 5DGBA 3CKIB 5H37D 3M85A 1TVAA 3D2NA 2JEAI 3WKEA 1PZKD 3LDAA 1BPDA 3A45A 2W7PA 2O6KA 2F0OA 4L5QA 1O80A 4GLAC 1HNZM 2KOLA 1SRUA 4HJ7A 3K5OA 1VQCA 4CJ1B 4LK1C 2F4VL 3H0LB 1DYQA 4PD2A 4EYHB 2DWMA 4MGZE 4ODGA 3RMHA 4NL9C 4H02A 4KKSA 2WSEF 1ZYQA 2R45A 3D4WA 3OHAA 3ETRA 2IOFK 4YCXA 4F1IA 4ECUA 1M1KC 2A19A 4IQUA 4RQ6A 2FMMA 4B9TA 1I94L 1ZMVA 5CV9A 3HOVH 5AIBA 2IWHA 4IBDA 3CP0A 5BPVA 1HFGA 3IN5A 4RQ0A 1IKLA 1QUTA 4KKTA 5EPJA 1Z4NA 2VB3X 4CISA 4O2DA 1X54A 3M9NB 4N8X1 3GTQH 1CHQD 1PK1B 5KFFA 1O03A 1ML0D 4BA2I 4DAMA 4IL6U 4FS2A 4DR5Q 4S12A 3HKZE 4EQPA 4IRDA 7ICUA 1P7DA 4KKUA 2Z1CA 3GRRA 4GITA 4OO1G 2XWJB 2BCSA 4W5WA 2J6TA 5G5HA 1SXJA 2Q2IA 5C44G 3W5OA 1J5EQ 2XIDA 2KICA 4ZPXA 4LFBL 2Y21A 5ELEA 1SG9A 2RDHA 2QP9X 4QL5A 1YE9A 4IALA 2IMWP 1PZID 5AI9A 3JPPA 2KVCA 2KIWA 2D6FC 3CC4A 3I70A 1Q86C 3CF0A 1ZQMA 1CI4A 3R3OA 4LGMA 1LTRD 5HGTA 2F8KA 4PCZA 3QJYA 5E1FA 5JVG3 1LTID 3GU3A 2MHVA 4GKJL 5JRTA 4A3GH 2P5ZX 3EW9A 4DGZA 4MNOA 5H2FU 1Y88A 2HMXA 4BWGB 3F5AA 1IG6A 2NTTA 2JEJA 2JGAA 3EZ5A 5AM4A 3VLFB 3T1YQ 2Z8YM 3T13A 4GC6A 5IYDG 1W2BA 4JI4Q 4LF5Q 2N35A 1H9JA 3GLHA 4JI2Q 4XQ8A 4JV5L 2ODGA 1EUJA 2C2DA 1HZCA 2K28A 2B2WA 1OXUA 4CDCC 1K73C 1DGHB 3SHLA 5AK3A 2XH9A 3QYPA 3DDHA 3Q8KA 1L7OA 2ZJ8A 1FFUA 5ITUA 2Z4IA 3NTIA 7ICMA 1D1KA 1YNNC 2XEPA 3B0YA 4G7ZC 2Z4RA 4IR9A 4OX9Q 5JI2E 3K1RB 2Z4HA 4YR2A 1OXTA 2UUCM 3QO2A 3PO2G 4DR1M 2EQSA 2YTYA 1W3SA 1HXYD 3K8AA 4FWDA 4B3TM 3M9BA 1KLNA 1NBWA 1PRBA 1DGGA 2PMZF 1RIPA 2B0CA 1KSFX 1Q8IA 3E9SA 3K7AH 2Z6KC 4J9MA 1HH2P 1E1TA 3JAME 2ZIWA 4UDUC 3HJQA 4RUAA 2PYKA 2JA8G 5EXTA 2KUMA 3CPWA 1VF7A 4HIDA 2W54A 1ZQVA 1IM4A 3J7A5 2K32A 4JWNA 5IREB 2AMCB 1XX8A 3C2LA 3A55A 4RA8A 1L8QA 4DV7Q 1ZQAA 2JP7A 1OIPA 4C8KA 4Q7JA 1ZQRA 8ICMA 4IIWA 4YCVA 4NV0A 1GL7A 5EE0A 1NK4A 4XK8F 3GTPB 3KLSX 4OVZA 4KLLA 1JE4A 2JA6G 4B9VA 3GO8A 4AYBC 2NN6H 1RD9D 3W1GA 2HDMA 4DL3A 2MJ5B 2BQ3A 2X69A 3HHYA 2ICIA 2CV1A 4DV4Q 4KD3A 1LACA 4P73A 4UW9A 4DQPA 9ICPA 3QAUA 3GV3A 3HU3A 4F3OA 4DV0M 2VS1A 5C44B 1STYA 4ECXA 4O3RA 2TSSA 1COOA 4ZKBB 3ERQA 4CF5A 4G4QA 4IJEA 2NUCA 1L2FA 1EFWA 1LT6D 1VQ5A 4GLVB 4B9LA 1EQQA 4D81A 3UK6A 1Y1VH 2Y0SB 2DUDA 3CRXA 2JY6B 2HQLA 4FO2A 4DXFA 2L0CA 4X65M 3FKIH 1KLGD 4UBCA 1IBLL 5EBCA 5CR3A 1PK3A 4R66A 2C28A 4QIWF 4M04A 2Q2UA 5DNFA 1KL9A 5DG9A 1SBBB 2CXYA 2K5DA 3BYTB 5IINA 1NKCA 4RNMA 2DFLA 4HL4A 4M2YA 2G08A 1CZWA 1K28A 5L37A 4M6WA 1XS9D 8ICCA 4KTAA 3CW2C 4C8NA 4F7XA 5IIFA 1DRGA 2CW0C 2FINB 5KFWA 2B39A 5KG5A 7ICEA 1UT5A 3ZCBB 1Q7YC 2YN4A 1G51A 2EY5A 1FJGL 1N48A 4J9PA 5DM63 2ZBKB 1JCKB 1UFZA 3ZC7B 3K1JA 5FTLA 3EN2A 4IFDI 4G4OA 5IODA 1JT8A 5B66U 1RU3A 4NLCA 4IRKA 4JV2A 5AM1A 3QU7A 3WKBA 4AP9A 1T3NA 1C7YA 4GXKA 3T1HQ 1O7YA 1OAIA 2KKPA 4V190 2ZXOA 3PO2B 1PFBA 1L7NA 1DGFA 1TAMA 1VQ4A 4YP3A 3G6VA 3I3CA 2P5TA 2FLLA 1X37A 1HTLD 4FE3A 2DN8A 9ICXA 1XMQQ 1TH3A 1MQ3A 1ZQEA 1F4IA 2OCEA 4DFMA 4NB3A 1SKRA 3HJSA 4DQQA 3TN2A 4B3SM 3OTOM 1FYCA 4YHHL 2DXIA 2KRUA 4JK1A 3QU5A 3GLFA 1LO5D 2MQHA 3J27B 3NBHA 2Q8TA 3FE3A 2KZ3A 4IJHA 4MGHA 4USAA 3CMAA 1QCKA 3RRGA 3VR3A 1URJA 4A3VB 4B6JA 3D2SA 2Y0SC 3K9OA 2KEYA 3HEJA 5DB9A 5ALLA 2JEBI 1ZRNA 3KSJA 4X62L 2ZANA 2R92G 1TR5A 5KPZA 4OD0A 2MUYA 2FPMA 5KL1B 3T3FA 1SZPA 1JOOA 4L5RC 1VQBA 3PW0A 3GIMA 2HQEA 4Q8FA 1FNUA 1QH9A 4OL7A 1QAOA 4AG6A 2RDGA 4A3CG 3KFUG 2X8AA 3AOEC 1ZQJA 3CQZH 3FYDA 3W0FA 1Z3EB 1ZQDA 3GRUA 4DR3L 5E26A 5IP9G 4F93B 4PZOA 5KNCA 1B2TA 2H3ZA 3WHKA 4X66M 3TREA 4KODA 3AOGA 4ZK9B 5FTKA 1A0IA 1GKIA 1IL8A 3LMMA 3OSNA 2LXJA 4IBBA 2JN4A 2VZAA 3LNNA 5GAEC 2JRZA 2LHCA 1Q3LA 2PNHA 3KDSE 4IBEA 1CKMA 1KEJA 4X3UA 4OW0A 2R8JA 1TR8A 3R2TA 4B3MQ 1VQKA 3UMCA 2CRXA 1EWCA 4LJ9A 3JR5A 2FFKB 4L78A 2CQOA 4A93G 4IBCA 3I4YA 4IBKA 5IT9L 2W8KA 4RAUC 4HSPA 1EXNA 2FPLA 4NC6A 4DR7L 2ZUDA 2VQFM 2LTUA 4AQYQ 3E5SA 3HHZA 3I4OA 1UWVA 5GROA 2FDRA 5E7NA 4LW1A 3VK7A 4L8JA 2PXIA 1ZOLA 1BPYA 3Q8LA 1V9PA 3C2KA 5DFLA 4TUPA 1ZQTA 1XPUA 3J81E 2VANA 4DV5Q 1HNWM 2RDFA 5ALQA 2BCRA 5AKZA 2F5SA 1YNND 1IN7A 1DXMA 3HFZB 4Y2RA 4UB1A 2EOTA 5KFBA 3RJIA 3SVMA 3S2HB 3D3RA 4ALPA 1BCPF 2JK8A 2FS1A 1E2WA 2JA5H 4I27A 2XGNA 5DQIA 2F1HA 2K6BA 5GQOA 3GIIA 1ZQYA 1X32A 2WZJA 3OJUA 1B9MA 1R5LA 2ZIVB 3N6RA 4DSEA 2E8MA 4JI0L 2ZM6Q 1BQQT 3GLGB 4A3JB 5LMUL 3FMCA 2WKDA 4CRXA 1L0XB 4DUZQ 3FUWA 7ICFA 3NWLA 3KJOA 3PX6A 3E3XA 1NO1A 1NJWA 3GIJA 5KT5A 3SAUA 1XO0A 2RQ5A 4UBBA 2NRVA 3L0OA 2EJFC 2HVIA 2F4VQ 2SNSA 4H44C 4U68A 2ICEC 1SNMA 4JN6A 2KECA 3RAQA 1N60A 3MK6A 5J0WA 1ZD2P 2KZMA 1EL0A 1WWUA 4LUVA 4HIOA 4ZUJA 2XSZD 2P6RA 1I94Q 4I8OA 2UUBL 1HQCA 2HBLA 3GTMH 4B7FA 3U6EA 5KG7A 5E3FA 1JXEA 2KEBA 4MEYA 2B2YA 2EY2A 3E6ZX 5JJKA 3GPYA 3G6YA 4BY1G 1PTOF 2NVQB 1EY6A 4ILWA 2DY8A 3N4MB 1PRTF 3AMUA 3P75A 2K03A 1NJFA 4KITB 2KA7A 3MXPA 3HZJA 1P16A 3PO3G 4DR5M 4KX3A 8CATA 3D4RA 4DF4A 4B9NA 3HOZB 5AKJA 3TEHB 1R9TH 1L5UA 1A2UA 1DV0A 3RJHA 3LWUA 1HJPA 3UQ0A 1YHBA 3LK9A 3FYCA 2NRTA 1JB3A 3RLOA 1J5EM 1H9RA 3OWFA 2BE5D 1LV7A 1RJTA 1NNXA 4LFBQ 1V92A 3CU7A 3R8FA 4A93B 4R65A 4IUVA 4ITQA 4E6IA 3RH5A 3BQ0A 3VCBA 4HJ8A 4C4RA 3I4NB 4QWCA 1Z19A 1D5XC 3B89A 2K47A 5ALZA 4EELA 2QPAA 4F4YA 2NZHA 3CRLC 2LY7A 4ED8A 4RZRA 1PH7A 2HWJA 4O3MA 3HGIA 4JI7Q 3DEOA 4NM1A 2ZIXA 2DVWB 1QCBD 1NZPA 2B29A 3SD7A 4DQRA 3CCMA 2H4OA 1D8YA 1EOTA 3WOEA 5KFTA 1JWSD 2EXDA 1CA5A 2A74C 4XIGS 3GIKA 4GKJQ 5I6YA 5ALNA 2E2HH 2E3TA 2YR0A 1BKBA 1L3UA 1RXVA 4DAYA 1D2BA 1EE8A 3T1YM 5C4HA 2KV2A 2KW0A 2G5GX 4GC7A 3IG8A 3T56B 5IYCH 4FS1A 1YUBA 4UP9A 4JI4M 2JSOA 2VUMG 4LF5M 1Z1BA 2KNZA 3ER0A 5C0XJ 2XGTA 3BG3A 4US9A 3TP8A 5ALVA 3FPPA 2HOFA 2AQ0A 2NRWA 4DSJA 4NM2A 1LUZA 1E32A 2K33A 2YY6A 3QIAA 1UNSA 5KNIA 2HIVA 3U61A 3OSOA 3KW6A 2ALYB 5CV6A 3CCLA 5IGEA 4HEDA 3FTCA 1FIQA 4A3FH 3ICEA 4OX9M 2GNOA 2R7FA 2YTVA 4O0AA 1F2MA 8ICBA 4YCUA 5C5LA 3D8GA 3GRVA 1LTTD 2JA9A 3PIO3 3AMZA 2CP8A 2B2VA 4C8MA 5J3BA 4JV1A 1YI2A 1E1OA 3ZDDA 3KDFA 2DKZA 3U26A 1JR3E 5ALEA 3HOUH 2NVXH 4UB3A 3NVWA 4I2EA 5EP4A 5DBCA 2IJ0A 1QQ5A 4MFAA 2B2UC 5J0TA 4QJFA 2Z7JA 4MEXA 5AM5A 1HUZA 2K4PA 1HNZL 2ATLA 2D7HA 4QUFA 4B9SA 1CFMA 2DNAA 4BGDA 1LTGD 4DV7M 4PMCA 2FLPA 4RH6A 2C22A 5E4WC 4KLSA 2WAQG 3GDXA 1ILQA 3PO3B 1QNUA 1A3VA 1V43A 2M2LA 2JEIA 3I51A 4EQ5A 4DV4M 3KLSA 5IIIA 1NKBA 4FO6A 1X3PA 2H1RA 2NVYH 3IRBA 3KZXA 4F87A 1XWEA 2DL0A 2YMLA 3SMSA 4CJ6A 1D0KA 2N88A 3CD6A 1TWAH 3NRWA 4KLHA 3NTHA 4JI8L 1F9RA 1KC8C 3UQ2A 3K6OA 4I4LA 3GRYA 2V9WA 2CUZA 1RYSA 3ULPA 1RYUA 5KO3A 4NXMQ 2F0LA 1JOKA 1TWGB 3C1EA 5IGDA 5C6AA 1WGNA 1NSFA 2KZUA 3FP9A 4B9XA 3SYLA 1X9SA 2IHNA 2DKLA 1IBLQ 2JP1A 2NRXA 2L55A 5AJ3L 5FTMA 2KVSA 3SEIA 3Q24A 2XRQD 3RJFA 1VLBA 5CEHA 3FYHA 1VQIA 1E0BA 1I4GA 2J7ZA 5AI0A 4YMNA 2PMZB 4J9LA 4FXKC 3U6LA 3A98B 5M3FB 4F5NA 4JPBW 4DAPA 2RHQB 3BS1A 4QZGA 4Q5VA 2VUMB 4CDEC 3ONAB 1GJSA 2PI4A 2LKYA 2VW9A 2DBYA 1U4RA 2AWOA 3BJUA 1TS5A 5KFGA 1VQDA 1U45A 2DI0A 1BNOA 4IR1A 1NAPA 4JI1L 2F52A 5C3EG 1D6EC 1CTMA 2I6XA 2NO5A 5EP3A 1Y8PB 1LT5D 3TZDA 4YXJA 5A2QE 3UMMA 4QWAA 3AB9A 1ZQ9A 5GKNA 3T1HM 1MJEA 1JQJC 2UVWA 4O3SA 5FTJA 3L29A 5ALIA 2HBJA 3BS7A 1WTWA 2G3QA 1XB2B 8ICZA 1VQ1A 3NQTA 2BA0A 1A3UA 1Q39A 3IECA 2DAGA 4K2KA 3U5ZB 4QNMA 1DOQA 4O3QA 5EKKA 3D4DA 2L7IA 3MC0B 2PCFB 5C0XG 3S1RB 4MTNA 2VDBB 2QENA 4C3IH 4DKAC 2R18A 3HG9A 2A5YB 4QZEA 2KJ9A 3S1NB 5IIOA 4YHHQ 5M5WH 3S15B 2ZIUA 3ZDCA 4K4IA 5M9OA 4DR1L 2EZZA 2JA7B 2F0PA 3M7NA 4BBRG 1J6QA 5JAVA 1GL6A 3FTDA 3QYEA 4BY7G 2ENBA 1EIJA 2VJ4A 1X9XA 3CCJA 4B3TL 4I2IA 4P75A 1KABA 8ICSA 1UA0A 1TS3A 4NSOB 3V2TA 1WCMG 1SWVA 4C7ZA 1R2YA 1QZHA 1TWCB 1QZMA 4KN4A 4QIWB 2W9CA 1EQVA 3RBDA 3A7AB 1XJVA 4C2MB 1FNWA 1BDOA 2KZSA 2KRKA 3PUWA 2ES6A 5EKLA 2IX1A 1II3A 4RHRA 5LMNL 4ACOA 3ISCA 3LCVB 2R93G 1H9SB 1IKMA 3W3AA 2EYOA 2TMPA 3JC66 3HRDD 1WD0A 3SATA 1WYDA 3KF8A 2UXDM 1NNJA 2IHMA 3BXWA 3MFGA 3AUOA 3SK6A 3NS1A 2VF7A 3PSFA 5JJIA 1L1TA 4XRHA 5M3MB 4JV0A 3MC1A 3JPSA 2CWAA 4BBAA 4C0ZA 4IUUA 5D3IB 2WAQE 4DV0L 2R7DA 5HNKA 1PVQA 2HHVA 3I90A 1K83H 4I2HA 2K01A 4DQSA 4DV3M 5J0RA 4RGTA 4I65A 4BUGA 7ICOA 2HHTA 1KTKA 2AJQA 5FO9B 4B3MM 4IBIA 3SBJA 2JJQA 3TADC 5KFCA 1NY6A 3Q0AA 2IHEA 1I4PA 1X6JA 1IQPA 2GLEA 3I4MG 1GUOA 2JYOA 4N8FA 4X65L 4F88A 4Y2PA 1S0MA 5J0OA 4DR7Q 4DOCA 2NO4A 1QNKA 3G6XA 4KLDA 1VF5C 2KDLA 5KT6A 4AQYM 1E24A 4LMQD 1N36L 2QBYB 2RGHA 4ECQA 5AI8A 3PNYA 1RXWA 1RM6C 2ATWA 5C3EB 1STEA 2K75A 5J2GA 5FLXL 3M7DA 1HR0W 3TL4X 2GA4B 3KVWA 3C3DA 3AQQA 3F53A 1M90C 1XXHA 1N8RC 4DV5M 4NL9A 4QIWC 2KSOA 2UUAQ 3FHWA 3J7AF 1HHVA 2LI6A 2ZXIA 1BBXC 5CA7A 4YWMA 4LZDA 1I4RA 1NMFA 1ZAEA 2AGOA 3LYSA 4R8NA 2J7OA 4A3GG 4O0IA 1DGBA 3IHQB 5EQTA 2XY5A 3Q8DA 1VQGA 4DO9A 2PQAA 3A7LA 3DFZA 2DAIA 2JZ0A 1JB0F 1ZV1A 3S1QB 1O7IA 3HP6A 3M6ZA 7ICHA 5I9OA 3C5GA 5KAFU 1WIVA 3VKGA 4DFDA 2O5JC 3TQ1A 2ZM6M 4F5QA 4F4WA 4BY7B 1T7PA 3RZDH 5FSWA 2F0GA 1Z00A 2JQOA 4DUZM 3S17H 4ANRA 3QU2A 2L4NA 4BXOA 2OTLA 4UB6U 4K5XA 1VQOA 3OTOL 1JR3A 1AE2A 3G6EA 2QARB 1KDBA 4DF8A 4K5VA 2BJVA 1L6NA 1SNQA 8ICXA 2FMCA 1R6BX 1EY5A 2F4VM 1Y14B 3GV8B 4A3BH 3H40A 5FOBB 1JJGA 1PJIA 2B6GA 4KY7A 2LYAA 4RF0A 3PY8A 3LGJA 2KIVA 4DR2Q 1ONLA 1T43A 1IZ6A 2MR9A 2YMPA 1I94M 5FLMH 2EAMA 2UVRA 3N28A 4IRCA 3C3LA 3VDUA 3U6MA 1ZQCA 1L8LA 4JI6M 5CMDA 4A3MH 3T5JA 1VQ9A 5JPNC 1IXRA 4PV1C 1WCLA 3RUZA 2IY5B 2JY7A 4YG2A 1G2SA 2J7NA 2NVTH 3GO5A 4ZYSA 3M0EA 4FCTA 2XIWA 4Z6FA 3CGWA 1KAWA 1GKHA 2AWNA 2P66A 1X3EA 1L2BA 1PFMA 2CV2A 1RHPA 3ED5A 3CCSA 4X66L 2M0NA 3KHLA 1X9NA 1WTHA 1CKNB 2IHFA 1BCPB 1E7ZA 3WWVA 2KFZA 1I50H 1Z9FA 2NN6G 5ITQA 4HMIA 5ALYA 5J0UA 4PQXA 1GO3E 2GH1A 2DAKA 4OGQC 1PK1A 4JI7M 3SC3A 2XTIA 3M4OH 3OJSA 5EWGA 1L0WA 4PHEA 4FCWA 3T16A 3HKZF 4FXGC 1PFNA 3PVXA 5HR6A 4L16A 4CJ2C 1QVRA 1IXSA 1IN5A 1VQNA 2DWQA 3A5UA 3CCEA 2Z6KA 3I7FA 4E0DA 4R8UB 3U6CA 3IKJA 4LF7M 1MN3A 1Y1VG 4R4TA 2F0HA 1UAPA 2EKFA 5IP7H 4KY5A 2R8IA 5KL8B 2AQ3B 3GTJH 3K8ZA 2E75C 3AFPA 1YIJA 2MUTB 2IL8A 4YQWA 1V33A 1WJJA 3WHLA 3MTSA 1JN3A 5AK4A 1CQFA 1QUQA 3EVQA 4Y2TA 3KOZE 2KENA 1SYEA 1S77D 3V72A 1HNWL 1NHGC 1MGSA 2K5VA 1DGSA 3KHRA 1N33Q 1SEBD 4GHAA 2QKIC 2VIIA 3V05A 1PTOB 5NUCA 2Q4TA 5AKYA 5DLGA 2DHYA 1JICA 3U6OA 3QXGA 1PRTB 4UAZA 4F5PA 4NL4H 2NWGA 1NY5A 2K60A 3ZQJA 5ITRA 4A3LH 2Y20A 1YITA 2XNAC 5IOCA 3PZPA 2F1JA 5AFWA 2F5QA 4I7ZC 1DO0A 5TSSA 3D31A 1L1OB 4MFCA 1VQ6A 2HHQA 1G291 1A6SA 3C2MA 4DSLA 4LJ4A 1WTRA 1NHWC 5AM3A 1QVFA 5KNDA 1BCPC 1GUTA 3VYRA 1A6XA 2DNCA 2EY6A 3HOWB 4Z6YA 1EQTA 4X64L 1Z1VA 2VF8A 4M9ZA 4KMOB 2CFMA 1H95A 2X49A 4ED3A 4OO1I 2C96A 3V7KA 1HA5A 1I3QH 2EANA 2WSCF 5IGGA 3ZI4A 2EYFA 3HJ8A 3LQQA 4RQ8A 2W8LA 4BBSG 3TPZA 3DV9A 1K1QA 4MH0E 3A54A 3IAYA 4EBCA 1F5SA 5KIXA 4LF9L 1I6HB 2WF6A 3DXJC 5J8YA 1CT1D 3V6HA 2K8AA 3HT3A 8ICJA 3H4DA 5CWRA 2D8CA 4GIPA 2RCFA 5EPKA 2RKOA 4EGVA 1RCVD 1HPCA 1SROA 2F0WA 4NOOB 4JI8Q 1CRXA 3H0GH 4Q45A 4LY6A 3DHQA 2L9HA 1SDFA 4ECTA 4DR5L 3M6KA 4F50A 1F2YA 2Z9HA 4A3EB 3S14H 3RJKA 4DV2L 4XYQA 5ELDA 5KPRA 4K8JA 1G59A 4NXMM 3I91A 5KG6A 3JR4A 4DXGA 1PTOC 1AUAA 2YMQA 4RNAA 3TP5A 1IBLM 3GTGH 2CHGA 3IFDA 1OJLA 1M6YA 3AL0B 4R7GA 3RLNA 2AHOB 2WB1G 5KFAA 2EUCA 2HHHM 2YQEA 4HJ9A 4FP5D 4HJ5A 3LX0A 3BVZA 2G9HD 3SR6A 5EJWA 3KP1E 3C46A 1N61A 5AKHA 4UQGA 1WTQA 1VMPA 2QGQA 1QB5D 1Y1WB 4NXNL 1C20A 3NXWA 1NR4A 2DY7A 2EH9A 2UXBL 2X4AA 4P2CB 3ZD9A 2XVSA 4YIJA 1ESFA 3BQTA 2W55A 4AW4A 2LKVA 3SK4A 3UM9A 4KLGA 4KLNA 2J0TD 2E2JH 4B08A 1ESRA 4JI1Q 3A42A 1ZYRC 3T1YL 1F0MA 1SV4A 3ETLA 4PHAA 3F8TA 4CKCA 5LMNW 3KOJA 2A69C 1K3XA 3O0FA 2NYZD 4LF5L 7ICKA 4GFJA 4DOAA 1FO4A 1Z6HA 1NNLA 3PGZA 3AOEA 3AQFA 2E5SA 3NENA 4LZGA 3TANA 1SL1A 5LL6X 1ZXIA 4ECSA 5EP1A 4N9PA 3MBYA 5BOMA 2MU2A 3T15A 3Q8MA 3MXNB 9ICHA 2G8LA 2PI2A 1LKYB 1EYAA 3CCUA 2XCPA 1I5FA 4YHHM 4GEWA 4G7HC 4A3KB 2PZUA 2ERCA 2E2DC 1JC7A 2R65A 1ASZA 4G9BA 3T53B 5ALRA 3FUTA 2ASDA 3C58A 5EWEA 3HKPA 1SNCA 4U6PA 5M5XH 2JA5G 4LG2A 4JUZA 3M4PA 2N8NA 3W67A 5F2DA 4IPGA 1NJIC 1N5XA 4FVMA 2AHMA 3AU7A 1IL2A 3M7GA 3AL0C 4P4PA 2LXKA 2FI1A 3UPQA 5LMNQ 2V6ZM 1SXJB 1DOMA 1PHJA 4K4HA 1QSLA 4TQSA 5EE3A 1RZTA 8ICWA 3RFWA 4PL2A 3KHGA 1LABA 2NV3A 1SZHA 2LBCA 2I5LX 4A3BB 3Q8GA 1G3IA 4KI0A 4OJPA 9ICCA 1PH9A 2FH0A 1V8QA 3NVYA 3HHXA 1PYWD 4PZNA 4MZ9A 5ALPA 2XZUA 3NGDA 3K5MA 1OXXK 3CF5A 3GLIE 5BR8M 2IA6A 2APLA 2MPMA 2C99A 3S1MB 1N2XA 1EWIA 4FF1A 4JBJA 2GWSA 3DZDA 3SQIA 1SXJE 1T5EA 3I8ZA 1HFNA 3NASA 4A76A 3AQEA 4UY8C 2BWBA 4IQZA 2LYHA 5FKAC 4KLQA 3GD7A 2QKQA 1ILPA 3UDGA 4DR7M 4G3OA 5KT2A 1PH4A 3IG5A 3WK7A 2JZBA 4QW9A 3H6MA 1QOHA 1IW7C 3GTKB 2EXZA 4M9LA 1N36Q 2RSOA 3D8BA 2ZXHA 3FAHA 3K1ZA 1CSQA 1EEID 5IT9E 1DD2A 4KLTA 2B63G 1P8LA 2MROB 2PFNA 2IW3A 1RL2A 2DKXA 2FHTA 3L2AA 2KXEA 2KHHA 4KV6A 2AH5A 5GADC 3KTQA 2C5RA 5ALXA 2HBMA 3M4OB 4C3JB 2WB1E 2Q2TA 2UUAM 2BQRA 1Q3BA 2R7ZB 2F0TA 2G09A 1X55A 1D5ZC 1L1ZA 4MTKA 4DS5A 4C1NI 1SNOA 3RJGA 2JXMB 3GLHE 2O2LD 2C5CA 5C3WA 1IV8A 4UB2A 2ZIWB 4NLKA 5AM0A 5HR7A 3RF9A 4CDDC 3L27A 1SNDA 2PPBC 1B44D 3HOXG 1AP0A 4NJ8A 3FDSA 4OCZA 4O5CA 5EE1A 3J7BA 4KJOA 5KT7A 5IYCG 3JAML 1BCPD 3QYBA 3BS5A 1PJTA 3I56A 7ICVA 3E0EA 3TP6A 4RF1A 3QG1A 2BPCA 4DAVA 1WHCA 4IPHA 3PCOB 2XCAA 2I07B 4FDBA 3W1BA 3GTPH 1VQJA 4A3FG 3F5EA 2VA3A 2A8VA 3CC2A 2LVOC 4LUOA 4ED7A 4DR2M 1SYDA 4M1UB 3PUYA 3CNHA 1GUNA 2HOQA 5IT9c 3TRZA 5F3WA 1E94E 2KCMA 3GLGA 1R4QB 3H3VI 8ICRA 2YTUA 1HUOA 3T51B 5C44H 4TUWA 2OTJA 1A3TA 3C28A 4CF3A 1SFOB 1GUGA 4UPAA 4PZ6A 4OJOA 3FTFA 2AQ1B 4RQ3A 3QNMA 3KP0E 4PJ0U 4M9JA 2UXDL 2BHNA 1WYGA 9ICVA 3PMFA 2NTSA 3FRPB 4ME3A 3C9PA 3MEHA 1X3GA 3MXUA 3BZDB 3HJEA 1PTOD 1AW7A 4M6WB 3KBGA 4JW0A 1S8OA 1PRTD 2QA4A 1F2ZA 4H13C 3TS2A 4QZCA 4O3OA 2C2EA 1HT2E 4IQWA 2OQ4A 1UHUA 2F3WA 5C5MA 1PLFA 2F0DA 2KOBA 3PW7A 4Y7NB 5E6JA 4ZAIA 4DV3L 2XRSD 3A5ZB 2VQEQ 5CYUA 2Q8IB 5IYDH 1OIZA 1XNQL 4B3ML 3H0GB 2JXJA 2FXQA 4IOAA 2KZZA 1VMCA 5T14A 3SYZA 2KK0A 2D0OA 2B63B 2CV0A 1EFUB 3OWEB 2HCFA 1SMXA 2BOSA 3MGVA 2XN9C 2RHFA 2VKQA 1I4QA 3VDPA 2DJGC 2E76C 2NZ1D 2IBKA 1S3OA 2PZTA 1VEGA 1WD1A 3SV3A 1TAUA 2B2UA 4LNQA 1EIFA 3PO2H 3C1ZA 5J22A 4QCLA 4LUZA 1L7PA 4DS4A 2AQ4A 2YV5A 1N34Q 4IQVA 1NKEA 4DK0A 3GPUA 2VJ5A 2G5DA 2BCOA 3VA7A 1N33M 3HOXB 2L5TA 4HAEA 2F5PA 3FUUA 3V96A 4ED2A 2FE9A 3THVA 2DAMA 3G6JB 2F0QA 2JE6I 3OMCA 1PA6A 2RQXA 5G5GA 2L7HA 3CP8A 1NK9A 4DA2A 2KG5A 2KNJA 4LJ8A 1D7QA 1LT4D 1W6KA 3A56A 3WDNA 1TY2A 3CXCA 5HHIA 3LWEA 2F0KA 3CF6E 1YJNA 5CBEE 4GKKL 3I55A 2BZFA 5CP2A 1LT3D 3PSTA 4PGYA 2AQ2B 4IO9A 5DB6A 4I28A 3G4SA 5F9LA 2GOLA 1Q12A 2ZJ5A 3GLFE 2K50A 2KHQA 2R46A 4ZRZA 1AEXA 4UAUA 5KFYA 1D5MC 4X64Q 5IIJA 2KVMA 3AM9A 3NTUA 5J2CA 5DLFA 3HKZB 3TAQA 2PFOA 5ALSA 1EU3A 3G48A 4F71A 3U60B 1V38A 3IP4B 4D82A 1SXTA 5KFJA 2JHDA 7ICTA 4POGA 2F0IA 2F76X 2EA0A 3T38A 4PMBA 2FPKA 4LF9Q 1VEKA 2XI9A 5IT9S 1TWFB 5ALOA 5KFUA 1ZQLA 4BB9A 2NYVA 5M5XB 4JI6L 4YY3L 1EY9A 2WFAA 4UB5A 1U49A 2KE7A 4EX7A 1L3TA 2BCVA 4RFBA 1JOQA 3JPTA 4F4ZA 2D0PA 4DSFA 4JI8M 1CUKA 4FWHA 1BPEA 4KHPL 1S5LU 2JA2A 3GLIA 4HAIA 4DV2Q 1FGBD 2K52A 2XFTA 3R93A 3K57A 3QX7A 4S3SA 1PMRA 2PFPA 1KN5A 1SNPA 1PH8A 5K5PA 1IW7D 1J7KA 1YZ7A 3EUB2 1F9SA 4ED6A 3DWAA 2M00A 3KOWE 4GH9A 2L1BA 5LL6S 1G6PA 3HP3A 1IBKL 3SENA 2N78A 1QTMA 2Y9TA 1LB2B 1DZ1A 5E4XA 2OM6A 2ISOA 3I1YA 4JI7L 4QF4A 1BPBA 3J81L 1L2DA 3MZ5A 4NXNQ 4UAIA 2CWBA 2ZG6A 3A0JA 2UXBQ 3QUTA 2NBFA 2YTXA 2J5YA 2OXOA 4PNYA 3UI2A 1IXRC 2F4IA 2EQYA 3S2HH 4A3IB 4LF7L 4WP2A 1ZQNA 1X40A 2XY7A 2CQAA 4JI3L 4JI1M 1O7LA 1ORYB 1RQLA 3HKZC 3I4VA 1SJED 2K5QA 3S9WA 1HNXL 4M9SA 3DLLA 1K0SA 4HEOA 3CPFA 4II7A 4A3JH 4TQUS 5C4XB 3FRHA 2OT2A 5AKGA 4JXJA 3FRIA 1ZMWA 4PT5A 2HHUA 1G41A 1T6OA 1J9OA 5KG1A 1SV0C 4BA1I 1A5TA 2LSSA 1XC8A 5EPLA 3H0RB 1KNEA 4QW8A 2YB4A 1W6JA 4R4IA 4RMFA 5KFOA 1V34A 1WVLA 5I2XA 1AZQA 1B53A 2KTQA 1UM8A 3PF5A 1KD1C 2OQKA 2VB2X 4X6AH 3RB3A 3ZH9B 1U9LA 4AYBF 4NP5A 3WK5A 3RR7A 1C48A 3U9SA 4A4IA 4RGNA 2I46A 3TADA 2W9BA 3DA1A 2KHVA 3B7ZA 3LVVA 2ZTEA 1WI5A 1MX0A 2EZXA 3SAFA 1BNZA 2RHSB 2BH2A 4LFAL 5DBBA 2NVQH 1S4ZA 3KXEC 5LMNM 1YVCA 1KTQA 4PGQA 1GO5A 1ZQZA 1GOZA 2VA2A 4RPZA 3HOZH 3H3VH 3A0HU 1A62A 1T9HA 1CI3M 4RPXA 1JX4A 3SK5A 4DK6C 2CCZA 1FNNA 3K75D 5DDYA 4Q44A 5D49A 1TKDA 3EJIA 4Y28F 3BDLA 2K9DA 4A93H 1HTPA 2R61A 5CR0A 2RDJA 3I4NH 5L1MA 1TS2A 4RQ1A 1C0AA 2UVVA 2QEJC 1Z47A 2D7EA 5C5JA 1GXDC 3WU2U 4DR6L 5KNBA 1H9SA 1X66A 3U50C 2XVTA 4A3MG 1K9MC 1HQRD 4NPSA 3L3FX 5KFIA 2M9NA 4DAYB 2G07A 4IS7A 3J7AV 2K4KA 1VQEA 3L4PA 3AFHA 2XY6A 4WORA 4NXML 3HU1A 8ICPA 5ITTA 4D80A 4Q0FA 3SDZA 4G4RA 3SARA 2WAQF 2RVLA 2BE5C 1TF0B 2V4RA 2RSNA 3KLWA 4XBOA 2HHHL 1N36M 5CV5A 1L0YB 2HI0A 1RDPD 2RLTA 1OO9B 4UB8U 5L1JA 1YT3A 4DPGA 4YR0A 4LVSA 3OW7A 3JAMi 5C0XI 5J8YC 3OIPA 5GTIU 3MHVC 3LQRA 3TQYA 2EE1A 4GXIA 4C80A 4M9GA 1S0VA 3E2EA 1QDRA 2RA4A 3SXHA 2JZ1A 3ONNA 3E0FA 1PH3A 5FLXE 3PXGA 3I28A 2UXCQ 4DEZA 4C8LA 2K14A 5JPMC 5DYIA 4O5KA 4IBFA 5DM73 5CC4A 2AU0A 4XDXA 2QBYA 5J2HA 2VXWA 1S5DD 5ALGA 5AI5A 2VNUD 1S0OA 1NK7A 4GNXB 3SFZA 4LGYA 1MU5A 5IP7G 2V1CC 2B2TA 5ELOA 4KLUA 4RGOS 2FOIC 1J2NA 1CEZA 1IYUA 9ICMA 3F2UA 4HJAA 2DNEA 4GS3A 2AXTU 4R71A 3QZ8A 2JA8B 1A76A 2F77X 1EIGA 4IJFA 3GV5B 2I7NA 3MR6A 4LZZA 1Q1EA 1PVOA 1AE3A 2OF1A 1TQOA 3PO3H 1FD7D 5CB1A 1TK8A 1M4VA 1XTDA 3BQ7A 4OWWB 4M0DA 4LRTA 2Q2EB 1X56A 4LJAA 3A8IE 5ALWA 4O42A 1UCVA 1IM2A 1X3FA 2JA6B 4R4CA 2QZ4A 3UGJA 1KRTA 2WFWA 3RJEA 3GDEA 4KLIA 2QQ8A 4J6HA 4JB3A 3E9HA 2FJ6A 2ZUBA 2QARA 2A3VA 4P0QA 3MR3A 1X6IA 3KKAC 2UXDQ 2AGPA 3E4RA 1IYVA 2XZFA 5FLXc 3TS0A 1JJCB 1TWGH 3K2LA 2LVNC 4OXPA 3RNUA 4NLBA 1F77A 2JH1A 5J2FA 1ZEQX 1S0NA 4KHZA 1PV4A 1KAAA 2R44A 5J0XA 2L2DA 1NUCA 2L5YA 1T8EA 1ENCA 1T3QA 3KUPA 3MAQA 1KDCA 5BR8L 1RTNA 3HOYG 2OPFA 2QB1A 2H3QA 2W3SA 4DV3Q 4YWKA 5M3FH 1JIHA 2Z0SA 2VQEM 5FJ8G 1NK0A 1NJXA 1YEZA 3LWLA 3CRKC 3UJNA 1S9FA 1XNQQ 4RG1A 4DFAA 4GNXC 1KXLA 2VUMH 3K92A 3M3YB 4MF2A 2ALZA 5J2BA 3A74A 4KT0F 3I2ZA 3B7QA 3SYKA 1AIPC 5C18A 4WFN3 3V76A 1TT2A 3TDQA 3NWTA 1JJ2A 4PG3A 2MH8A 1CKNA 5DNYA 1MJGM 4DN4M 3HKSA 5A2QL 3M8RA 1GO3F 4PDIA 3L28A 4RNNA 2SEBD 1GJXA 1TH2A 1N34M 2JR5A 1BR9A 5A35A 2KHIA 2ZIUB 3QE9Y 1L3VA 4Z9CB 2ISPA 4A3DG 4ZUIA 1SXDA 2H1EA 2A6HC 4NRVA 3S1RH 2UUAL 5GTHU 1HEKA 8ICNA 1EOVA 4XT3B 1ZKOA 5BN4A 5EAYA 4HR7B 3S1NH 1OKSA 1U47A 3S15H 4R8UA 1N78A 3M4QA 4GZYC 2W9AA 2JA7H 3IM1A 5EGTA 1LTAD 5EXXA 3VKHA 3H15A 3QUQA 3KBXA 4ELUA 3TWLA 2W04A 1VQMA 3M9OB 2Z4SA 2MUTA 3M4YA 1TWCH 3GILA 1YNJD 3P1HA 4GKKQ 1UQVA 1Q3VA 3MWYW 2HW3A 1NNUC 2O01F 3KOXE 4C2MH 2Y0QA 4KN7C 2F2AB 2F44A 4C3HG 3QEBZ 5ELFA 1PJQA 2F0NA 2XF3A 1OQYA 4I7AA 2QB0B 4X64M 2EDGA 2PI5A 3NSWA 2R92B 2F0UA 3AU2A 2GO7A 3K59A 2YU9B 1RPLA 4KMUC 5J0QA 1X6OA 4WURA 4RQ2A 3MGHA 1NVMA 5M3MH 3L26A 4DR2L 3ZDAA 9ICWA 3N97B 2NN6I 3DWQA 5IWAL 2CRUA 1XO1A 4LF9M 2LVAA 1H9KA 1EY8A 3UE1A 4POFA 3PR4A 3ZDBA 3OGUA 1ZQGA 2WV6D 1Z4OA 3U4VA 4JI6Q 4YY3Q 3PNVA 3U4ZA 2G5HB 4I2JA 4J9KA 3E58A 8ICAA 2ZJAA 2DPJA 3OHBA 2R6FA 5JEAJ 2E2IB 4KHPQ 3J81i 4P0PA 4FF3A 2BCUA 4RNOA 2F03A 5FLXS 5JJZA 3HOYB 5DB7A 3EIHA 3ISBA 4NKLA 1WFQA 4DV2M 3B9JA 2YFQA 3GPPA 2LHGA 4O9MA 1XYIA 1SKSA 3TARA 2KSOB 4G3IA 5C3EH 1IBKQ 4OU7A 1O08A 2DGZA 2V4QA 3TSSA 1MSHA 2GQFA 3NTKA 2IOHA 1T4GA 1K8OA 1SYFA 9ICLA 1VS0A 5JUMA 3MEFA 2JEGA 4C7YA 5EBDA 4NXNM 2UXBM 2KJ5A 1RYRA 3FEWX 1UEBA 5KFSA 4DL5A 3OSPA 2R6GA 4AYBG 4LF7Q 1LV5A 2EYLA 5HURA 5EKIA 3VK8A 1N56A 3CC7A 4JI3Q 5ISRA 4QWDA 1V1OA 4LRSA 1TXYA 1ASYA 3CTWB 5DDMA 1K3RA 1XXHE 3S1QH 3RH6A 2EYHA 3BDOA 4PPXA 2K5NA 1HNXQ 1EY0A 3EPIA 3DEPA 1E2ZA 2AUJD 4J9RA 2KEDA 4IFDH 4BY7H 5CJ7A 1ZQ1C 3H4BA 2CH4A 4I29A 2QSFX 1WTVA 1N33L 3NBXX 5GAGC 1WTXA 1SJHD 4TKOB 1Q1BA 1XSPA 3URYA 4Y2YA 1NZBA 1QILA 4HIKA 3E21A 1G71A 4C3HB 4LF8M 1DCZA 4LF4M 4DSIA 3Q22A 2VIXA 1WUDA 5G3LF 2N1RA 4I2BA 2R93H 4EEKA<