1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
4LFAQ 2F4VQ 3S24A 2VQEQ 2ZTEA 2KNAA 4C3IH 3PR4A 2JUJA 3UXNA 3I4MH 4QL5A 3RBDA 2MO0A 4A3KH 2B63G 3CCLA 1IBML 9ICRA 4F5RA 4NM1A 1B70B 4C8MA 2QHOB 1HNWL 1MQ3A 3UXPA 1KRTA 4P75A 3CP0A 4TUPA 3MXNB 2R8IA 1A76A 4HYKA 2UUBQ 4DSEA 5FLMH 4DV3L 5J2DA 4QZEA 1VQ9A 3S15H 3GTJH 3GTLH 3CQZH 1S76D 1Y8GA 5KFCA 3CF5A 4HJ5A 1J5EL 1ZQVA 2RHSB 3PV8A 9ICWA 2LYHA 5J0RA 2BR0A 3TS0A 3K9OA 3PMNA 7ICJA 3HOXG 1N9WA 2BCUA 2C35B 2ZJRA 5J2AA 9ICJA 3EBEA 3H8JA 3BZKA 2XGPA 7ICNA 2A8VA 3SZ2A 4EBDA 1ZQFA 3ZD9A 2HIXA 4QZIA 5GAGC 2A1JB 4DR1Q 2Y1IA 1J5EQ 4IPHA 5IILA 1NKEA 1MQ2A 4JI3L 5DLGA 3PUZA 3TQYA 1NJIC 2AHOB 4KLEA 3PO4A 3PX0A 3QEAZ 2MR9A 4ECSA 1E22A 2XTIA 3C23A 4BXOA 1WHCA 3GTOH 1ZQIA 3PW7A 2JEBI 2HHTA 1XPOA 4JI5L 3M9BA 4DFKA 3I4MG 8ICVA 4GOPB 5IYCG 4NPSA 2IHFA 8ICNA 4L5SA 4ECUA 3AUOA 1PV4A 4M6WA 1ZQTA 4O3PA 1AE2A 3T1YL 4J15A 1KL9A 4QZAA 2DHYA 5D4BA 2R8KA 4HIOA 4DAYB 2NRZA 3LWMA 4ED3A 3KDFA 2KNVA 4JI2Q 4DNIA 1BVSA 2W9BB 4GLXA 1VQAA 3H0GH 4KHPL 5DB8A 4RQ7A 2CKZB 3TI0A 4M9NA 4ELVA 4K0KQ 4RNOA 4OXPA 4APVA 2NRTA 2KN7A 4I2IA 2LXKA 2C2RA 1TVAA 2HHHL 2ASBA 4JI8Q 5DDYA 2BKEA 1WYDA 2AGPA 4RG1A 1P8LA 4Z6CA 2JQOA 3H8SA 3UDIA 3HKZE 3H15A 1V1QA 5KG2A 4RQ5A 2CCZA 1SN8A 1L1OA 1AE3A 2HHXA 2KFZA 4HIDA 1RYSA 4I2GA 4KLLA 5BR8Q 3DLLA 1U48A 2BCRA 4A3IH 2HVHA 2CP8A 4F4KA 1Y1VG 1EQQA 2WAQE 4O0AA 2VQFQ 3RJFA 2MFIA 3GQCA 3HOVH 7ICIA 4ECYA 4DV1L 3OGUA 1WOCA 2WAQG 4F2SA 4RQ1A 7ICPA 1U49A 1UFZA 3SV3A 2BDPA 1K1SA 1K8AC 1QUQB 5KFJA 2C2EA 1Q81C 5C4JH 2MUTB 4POGA 1L0WA 2JA7H 4A3CH 1HZ9A 1VQOA 3HKZG 1WCLA 4AQYQ 1PA6A 1HNZL 3MR2A 7ICHA 3K80C 4O5CA 3AU6A 4X66L 3MFHA 5DBBA 4B3TQ 4EBEA 1J6QA 5J29A 5J0OA 4GLAC 4R66A 3CAMA 4R65A 2BPFA 3EW9A 3NENA 1L2FA 2IT1A 3RB6A 4I2AA 2XGQA 4JI6Q 1ZQNA 3EZ5A 2DAEA 1KC8C 2QNJA 3H4JA 2Y1JA 5F9NA 3TAQA 1QZGA 3F2BA 5C4XG 4M9JA 3MEFA 4J9OA 4LFCL 2ZJPA 1U47A 1S0MA 3M4QA 4IQVA 4DR7Q 1N36L 4C8KA 1KXLA 4JI1Q 5DB7A 4F2LA 3C2KA 3ZDCA 5IYBH 4LF8Q 3K0XA 4Z6FA 3C5FA 2GWSA 4O0IA 2KZ3A 4JK1A 7ICLA 4DK6C 2Z6KC 4O3OA 4F4YA 1CSPA 4IPCA 8ICEA 2AU0A 1PFSA 1U45A 2FXQA 4MZ9A 4R4IA 1H95A 1ZQUA 1BKBA 4LNQA 2JZ0A 2VS1A 4H02A 1B7YB 7ICKA 9ICHA 4DL4A 1MC8A 5EOZA 4HIKA 2I9GA 3RBEA 5KFDA 2VANA 1NK4A 2YTXA 4DV5Q 3ULPA 4R8UA 2ATWA 1WR1B 2LVPC 1F4IA 2BCVA 2E2JH 1R4GA 1PH1A 1WCMG 1LTLA 1CSQA 2R7ZH 1BPDA 2XGTA 3RN2A 2Q0ZX 4IOCA 1R9TH 4ME3A 4QW8A 4UAYA 1NK5A 2AQ0A 4UB4A 5IP7G 3S14H 5KFZA 2AGQA 3H3VH 4QZDA 3PO3H 5LMNW 1VDLA 4LWCA 2B3GA 3BQTA 4GKKQ 3CCEA 1ZQXA 3OJSA 4YFKA 4YMMA 4UAZA 4YXJA 4YWLA 4PHAA 4TUQA 1NK7A 1X56A 4DFJA 3K8AA 3G48A 5JJLA 2ZJAA 3S16H 2PQAA 5ELNA 1D8YA 5KT2A 4UY8C 1Z9FA 5IWAQ 5DB9A 2WB1E 1XMOL 2RRUA 1ZQHA 1X9NA 2DAGA 4K4IA 3T3FA 1ZQWA 3SGIA 5KFFA 4JBJA 2XCAA 4GXKA 2IHNA 3Q8DA 2VA8A 5DBCA 1ZETA 1JB7A 8ICJA 4GLVB 4GKKL 4AIMA 4F4WA 1DO0A 4DWIA 8ICHA 1VQFA 4DF8A 2K5VA 3RTVA 1YBYA 3T1YQ 1GO5A 1VEKA 1ZQKA 1VQPA 4LF8L 1A8VA 4LZDA 1Q46A 4BY1G 1QTMA 5DLQE 5KG7A 3BDPA 1V92A 4YCWA 1Z00A 3PR5B 5M3MG 5M5XH 4DV6L 1VQKA 3HOUH 1B22A 4X6AH 1Z47A 5IYDG 2K50A 4GC6A 5JEAJ 3Q8MA 1WI5A 4M6WB 2L4FA 4J9LA 3OTOQ 5EWFA 4J9KA 1VEGA 4RUAA 4LF6Q 4QWCA 3UE0A 1UT8A 1IBMQ 1Y1VH 3KDFB 1G3IA 4UB1A 3K4GA 1D9DA 3RJHA 2EKFA 1SZPA 4QY7A 3MDAA 3FKIG 2VZAA 4LUVA 2A1JA 2KTQA 4QWBA 3GD7A 1NK0A 5J3BA 4RNMA 5KT7A 5CA7A 5J2IA 1Q8KA 5AJ3Q 3UDXA 2EQSA 4I28A 9ICFA 1Q82C 2AJQA 1L3TA 5DG8A 3RZDH 1IXRA 3S1NH 1TWAH 4DR2L 3RB3A 4B3RQ 2FMSA 1C9OA 5DQIA 1SFOH 4A3BG 1D9FA 4IO9A 2ZM6L 1VCIA 4RUCA 4IR9A 2UUAL 4F5NA 4LF7L 1BPBA 4X5VA 5M3MH 4DR3Q 4R8UB 4G3IA 4DL6A 4I2HA 1Y1WG 1M90C 1VQ5A 1SE8A 4WP2A 3KHLA 1ZQPA 5BR8L 3Q8SB 3LCUA 1X3FA 2BPGA 4QZCA 2ISPA 4A3GG 3GILA 4JI7Q 2I5LX 1NMGA 5FJ8H 1TK0A 3S2DH 3V6JA 1KFDA 1VQBA 3RJGA 3T6PA 5DG7A 3A5UA 2UXCL 3CCUA 1S0NA 4GS3A 3ER0A 1HUOA 3U4VA 2UUAQ 2NVXH 5KT6A 4GNXA 3HWTA 8ICAA 5JI2E 4M04A 3PCOB 3H8WA 3M4PA 3M7NA 3SV4A 4MEXA 2KHIA 1PHJA 3G6VA 4DSKA 4DV0Q 3KJPA 3GIIA 1KRSA 1KRPA 3F92A 3MR5A 3HOZH 3PO3G 2KHJA 5KFYA 3RAQA 5IINA 4OWXB 4M9GA 4B3SL 3KFUA 5AJ3L 2HAKA 4B9UA 4BXXH 2D62A 3PUYA 1CKMA 3CCVA 2QGQA 1JXEA 3C1YA 4JYAQ 1ZQRA 2UXBQ 1I94L 2W8LA 2R7ZG 1WCNA 4JWNA 3GV5B 1QSYA 1KEJA 1A62A 2IHEA 4UP9A 1I3QH 1HZAA 1RL2A 1DOQA 3NBHB 2L15A 4IPDA 1OAIA 4I2FA 4A3GH 2VQFL 5HGQA 4B3MQ 2AMCB 1VQ8A 4DLGA 2DPJA 1Q86C 4YG2A 3PF5A 1P3QQ 4C8OA 2R0IA 5C0XG 4MF2A 5DG9A 4O3RA 1YHBA 2AWNA 4DL2A 3HPOA 3LCVB 2Z6KA 1IM2A 1KIXA 1BPEA 1EYGA 2UVRA 5BPCA 4X64Q 2QEXA 2JY7A 4LF9L 4F8RA 4YR0A 4L5RC 4BBSH 4NXML 4A3BH 2ZUBA 5KT5A 3PUXA 1ZQCA 4DLEA 4HEOA 1UT5A 4KLKA 2JNHA 4DQSA 1VQJA 1KD1C 1TXYA 3JPOA 2CFMA 4YP3A 4DOCA 2R6GA 4F5PA 3J7ZC 3TQ1A 1E7ZA 4DUZL 2UVVA 1SROA 4JI3Q 3V72A 4DUYL 1EIYB 3EPIA 4KI0A 3J80i 1HNXQ 2PQAB 4MEYA 1XJVA 1L1OB 5KG6A 2D0PA 3H0GG 4GN3B 1YNXA 9ICMA 2E2IH 1PZNA 4ED7A 4B9NA 1N33Q 3QEBZ 2YTYA 5KFIA 4F3OA 2OQ0A 4A3FG 1NV9A 4J9SA 4O2DA 5GADC 5C0XJ 1T8EA 4J9MA 2E8GA 3JAMc 4ED1A 3KF8B 1PVOA 8ICMA 3L7ZC 3EN2A 5EWGA 5D46A 1HR0Q 4QWEA 1C0AA 3NGDA 3JC66 3OYYA 5GAEC 3ULJA 2I5HA 5J2FA 1K3RA 4OO1I 1YLAA 4DR5Q 4LF4L 1JN3A 1EOVA 2FPMA 1KYIA 3J7A5 1TV9A 1VQMA 3CMEA 3UQ2A 4B3ML 2UXCQ 1RYRA 3RJKA 4P74A 4OWTB 1T7PA 2I1QA 4GOPC 4IQTA 3B6YA 3IHPA 5HY6A 2F1IA 4LFAL 1RPLA 3A74A 2VUMH 2NVYH 1ZQGA 3SI8A 1K9MC 4YXMA 3LWLA 4YVZA 4PH5A 1AROP 3MGIA 1HR0L 4DOBA 3KHGA 1HT1E 2BCSA 5KG4A 3AFQA 3UXOA 3QE9Y 3LGJA 2JA5H 4DL5A 2H5XA 2KCTA 1JJ2A 2KZZA 1TR8A 3UDGA 3T1HQ 1XMQL 3I56A 4DV0L 4A3DG 3SYZA 1NJWA 3M4OH 2MO1A 3CXCA 1OTCA 9ICAA 3JPNA 4EZ9A 4QIWE 3M9MB 4IRKA 4EQ5A 2FLLA 3GIMA 5KG3A 1XO1A 4KLDA 1M1KC 2JY5A 5BOLA 3GDXA 1NJZA 4LF6L 2FPLA 1K1QA 3CCRA 4MFCA 4KLGA 3DM3A 3RH6A 4GC7A 3K81C 2RDJA 3KJOA 2A1AA 5KFPA 3ZD8A 2OCEA 4PPXA 2JA6G 1VQDA 4KLUA 4P2HA 3V6KA 4P4OA 2C28A 2K14A 3GDEA 2V4QA 4ECWA 4HJ7A 1Q1BA 4YY3L 3T1HL 1XMQQ 4J9RA 4B9TA 1QVCA 4C2MH 4ECTA 1FJGQ 3AFPA 1BGXT 1QZHA 3E9HA 1ZQOA 9ICGA 2JA9A 3ULLA 3G4SA 1HUZA 4YMNA 5J0TA 1PH6A 4Q8EA 4MF8A 4LFBQ 1SG9A 2ZJ5A 2NN6I 4O9MA 1Q12A 1NK9A 1ZQYA 3KTQA 7ICOA 2KNZA 5F9LA 3F2CA 2YU9H 3BQ2A 2UUBL 9ICKA 3I4NH 1KDHA 1NMFA 3I7FA 2UU9Q 1FL0A 1SMXA 3PX6A 2DNAA 5KFVA 1VQ1A 4P71A 3TEHB 2B21A 1X2IA 3RJEA 2FLNA 5KFQA 3GLHE 4DUYQ 2ZUCA 2JEAI 4DV7L 2F3IA 3E2EA 2BGWA 5KFWA 1OXTA 4ELTA 4R63A 5FLXc 4A3DH 5IIJA 4YWMA 4KN4A 5C3EH 5C44H 3HOWG 3RH5A 4RMFA 4K0KL 5DGBA 2JEFA 4NY8A 1SKSA 2JEIA 2JA8G 2DAIA 1X6OA 8ICBA 2OOAA 4NXNL 2LVOC 4JC0A 1MJEA 2PXIA 5M3FH 3E0EA 4R71A 5FJ8G 2DPIA 2ZTDA 4GNXC 3ERSX 3PGZA 2ASJA 4TVAB 2LSSA 1NJXA 1EUJA 4BXXG 5KFOA 1IL2A 4YR2A 1L1OC 4EEYA 4EBCA 1ZYQA 4BWMA 4BY1H 4BXOB 9ICBA 3W5OA 3B0XA 1IBLQ 4DV2L 3PO2H 2VA2A 8ICYA 4DS5A 5HP4A 4DR6L 4B3SQ 2HIVA 2ZJQA 4GXIA 4C3JH 1HZCA 4I2CA 3G71A 3JAMi 1G4AE 1XSLA 3K7UC 1D8LA 3RB4A 1G291 1XNRQ 4UN2B 2RDIA 2UVUA 4YN4A 3EPGA 4IQUA 2W9CA 3HOYG 8ICGA 4ALPA 2FMQA 2VY3A 8ICLA 2VW9A 5IYBG 3JPTA 2ASLA 7ICFA 2QA4A 1Z3EB 2CWAA 4HJ9A 4K4GA 3S1MH 2NZOA 1JX4A 4P4MA 2XY7A 1WGLA 4DR1L 2ZTCA 1TAQA 4DSFA 5IYCH 2PNHA 3RNUA 2ALYB 3MFIA 9ICCA 4UP7A 2DZLA 4A3KG 1N48A 7ICQA 2ATLA 4F2RA 3RZOH 2OTJA 4JOIA 1I6HH 2XY5A 4JI4L 4XIGS 2GN5A 5KG1A 1NBWA 4KLHA 4IJLA 4ECZA 1YJ9A 4M2YA 3PIOA 2KENA 3S1RH 3OSNA 4YCVA 1GVPA 4OONA 1Z00B 7ICRA 4YY3Q 1DV0A 1E3PA 4KN7A 2BH2A 4NXZA 5J0PA 4JWMA 1XPUA 1WCMH 2K0BX 5J2GA 1KAWA 8ICUA 2PFQA 4DV3Q 3PO2G 4A3EG 3E9IA 4RQ0A 1S0VA 1VQ4A 3TREA 3PVXA 1UE7A 4L5QA 1HNXL 1S77D 1I94Q 1JE5A 4UAWA 3B0YA 3LK9A 3ETLA 3VDYA 1NK6A 3EYZA 4F4XA 1YI2A 4GN5A 3V7LA 4EYIB 3A0JA 1VQ6A 4AH6A 4DR6Q 1ZJNA 1XSPA 1LYLA 4UB5A 4AQYL 3TFRA 4JI2L 1G51A 2PI2A 3GO5A 5J2JA 4BY7H 8ICWA 2FMPA 3OHBA 3H3VI 1PYBA 3ISBA 1XSNA 4KHPQ 5JEAG 5EAYA 2VUMG 2PI2E 2R8GA 5KFHA 2N8NA 4ED8A 2N78A 2V4RA 4DV5L 4DQQA 2Y0SE 1ZJMA 4M0AA 4DV4Q 1SKWA 9ICUA 3RH4A 1V9PA 4GN4B 2CWPA 5LMUL 4RPYA 2ZM6Q 4F5QA 1VQHA 4A3JG 1MIUA 4I29A 5CR0A 4RQ6A 3M9NB 2JZ1A 2MAXA 3KHRA 4NXMQ 4QW9A 4R1JA 3CPFA 4ED0A 4DV6Q 2K75A 4P72A 3WWVA 4PGQA 1TK8A 4BGDA 5LMNL 2C22A 3PW2A 4JG2A 3HX0A 3V7JA 5M5YH 1PH8A 4RQ2A 2W9AA 1QUQA 5M3FG 3C5GA 2UUCL 3GLIE 1ASYA 2LXJA 3OTOL 9ICPA 4O5EA 1SR3A 3PO5A 3CPWA 3PIPA 1XTDA 4LF5L 5KFXA 2AGOA 2NZHA 2NN6G 3D31A 2UXDQ 4XTCS 2IHMA 5IE8A 3RJIA 4MFAA 1ZQZA 5J2CA 4YD1A 3BQ0A 3RAXA 4NM2A 3Q8QB 3FKIH 9ICIA 1JXLA 4QZHA 1UE5A 1BBUA 3PV0A 8ICZA 3HKSA 3PNCA 2JEJA 4YMOA 1TWGH 1BPYA 3GTKH 1X54A 1YVCA 4FDBA 4LF5Q 3V7KA 1KFSA 3IHQB 4YWKA 1QZEA 3GTMH 5DGAA 2R7FA 3W1GA 1PGYA 1MKHA 4JI5Q 3Q8RB 4UPAA 1NK8A 2M9NA 2C2DA 3RN5A 5HHHA 3M3YH 5CB1A 3E21A 1CKNB 3FHWA 4DR3L 4JV5Q 4JI4Q 4GEWA 4GKJL 5DQHA 2Q2IA 2WFWA 2FPKA 3HOXH 4DV1Q 4ECXA 5J2BA 4RNNA 1WGNA 1N33L 3Q8LA 5D49A 1LM0A 4LVSA 1RXWA 1H38A 5IY0A 1EWIA 4F50A 5L9XA 3GV8B 1HZBA 1IBLL 3N4MB 1VG5A 3OJUA 3QZ7A 3H7IA 2J6TA 1GKHA 2JA6H 1BBWA 3ZDAA 3STBD 3ZDBA 4A3MH 4J9NA 1TAUA 4B3TL 2K9DA 5KFTA 5DLFA 7ICEA 9ICSA 1CUKA 2D0OA 1RXVA 1LV5A 1JMCA 2JJQA 4UB2A 4F4ZA 1GM5A 2Q2HA 2VNUD 4QQBX 2NVTH 4JUZA 3GLGE 3MDCA 4DQRA 2ZJ8A 4XUSA 4RT3A 4C8NA 3GIJA 3OSPA 3T5KA 8ICSA 5KT3A 5HHIA 2GVBA 3KF6A 5C5JA 2LBCA 4DSIA 4KLTA 4CCHA 4GNXB 1YZ6A 2UXBL 1QSLA 2YYZA 4GOPA 4I2EA 4LFCQ 5HMLA 5CWRA 1ZQSA 4A75A 1VEJA 1PH9A 2NRVA 2K5HA 4B9LA 2B29A 5IP9H 3GV7B 2WB1G 3ORYA 4DV4L 4LW1A 4QZGA 4R64A 5IIOA 2DKLA 4RPZA 4IJHA 2VL6A 4M47A 3GIKA 4R4OA 4XA5A 2HW3A 5DBAA 4M9HA 3KYHC 2PFNA 3C2LA 3FDSA 1HNZQ 1XWLA 4RQ3A 1YJNA 3PW4A 2BWBA 4BDPA 4DQPA 1VQGA 2CWBA 4I2BA 1XB2B 3GTPH 5GAHC 5J2KA 4MFFA 5KFSA 1NJYA 1KLNA 4A3EH 1E1TA 1UA1A 8ICTA 3CCSA 1TFRA 3M8SA 4JI0L 3GFKB 2PI5A 4FS2A 1CKOA 2F1JA 4RT2A 5JJKA 2JEGA 1NTGA 1RIPA 4Q45A 4IFDJ 3IRBA 2A19A 5ELOA 1X3GA 1U9LA 3HOUG 2ISOA 4Q44A 4EZ6A 4B9VA 5KFRA 4J9PA 1YJWA 4DOAA 3F1ZA 2IX0A 1JT8A 1ZV1A 3CC4A 2MUTA 3STBC 4KLJA 4BBRG 4DSLA 3ZDEA 2R92G 4FO6A 4DAMA 2HHSA 2KHHA 1QSSA 2GVAA 2HHUA 3TS2A 3RR7A 4L5TA 1NOMA 1SL2A 1WJJA 5KFGA 2N49A 1TKDA 1WJ7A 1XU4A 1Y14B 4Z6EA 2HHVA 2K4KA 3BJYA 1SL1A 2HT1A 1L3SA 1A0IA 4X65Q 4JI8L 4IOAA 1VQNA 1JJCB 5J2HA 3BQ1A 4I27A 2BCQA 1HQYE 1Y1WH 4EYHB 4DL7A 2IMWP 1N34L 4I2DA 3BBZA 4FBTA 4YQWA 4R4CA 3THVA 1S9FA 1N36Q 3T5LA 3PF4A 4F1IA 4I2JA 1VQCA 1L5UA 1Y88A 2PI4A 1U0LA 5KFUA 3E46A 1PH5A 1HJPA 4NLKA 3HOZG 1ZQEA 3CW2C 3G6YA 2Q2TA 5EWEA 4K4HA 4PZ8A 2F1HA 1NE3A 2EXDA 3U50C 1KHIA 5DFLA 1TTEA 5IIKA 7ICMA 1X9SA 5CHGA 2OWOA 1K73C 1IZ6A 3MMPA 4UP8A 1YITA 4XRHA 3RRHA 2R93H 4FS1A 2AKWB 4A93G 1IM4A 1UEBA 7ICSA 5KTQA 1YHQA 4LUOA 4JV5L 5DKWA 4YD2A 5HNKA 2J6UA 1D7QA 5IP7H 5IIMA 1ZQDA 5GQOA 1DO2A 4R4QA 3EIVA 5KFAA 1OTRA 5J0XA 4Q8FA 4ELUA 4X62Q 2HHQA 4KLMA 1K0RA 3S17H 9ICXA 4QJFA 4ECRA 1OXSC 1AH9A 3K9PA 4F92B 2P66A 1PH4A 4DS4A 1VQLA 4DBGB 8ICRA 5M5WH 2JK8A 2DGYA 1ZQQA 2ALZA 1L3VA 4RPXA 4DV2Q 3PY8A 1U4BA 4TQUS 1YHAA 3KHHA 3BJUA 3J81j 4GXJA 1SKRA 3RLFA 3MGHA 1QVGA 3GLFE 3I55A 3JPRA 4KTQA 3OW2A 4QZFA 1XNRL 5LMNQ 4RQ8A 1K83H 4OX9Q 1XNQL 3HW8A 4DFPA 3QZ8A 1N8RC 4LZGA 3AU2A 3UQ0A 2AWOA 1E24A 4IRCA 1C7YA 2BPCA 4XQ8A 1JIHA 3D0FA 3PW5A 2XY6A 5JJIA 4UQGA 3FE3A 1UWVA 3B89A 8ICFA 4LF9Q 1EXNA 3I2ZA 3T5HA 3PW0A 3J81c 2JA8H 2RF4A 3FRHA 1DGSA 1NKCA 4G3OA 3C2MA 8ICPA 4JI1L 3RLNA 4B9MA 3TFSA 2WP8J 3CCJA 2PMZE 1N56A 3IECA 4UBCA 4IR1A 1T43A 5DDMA 1X55A 4IFDG 1XC9A 1ZMUA 5C4XH 4HJ8A 5KFKA 4OWWB 1T3NA 1B8AA 1B43A 2EIFA 4DKAC 3PMLA 1XS9D 4DL3A 2Y0SG 4JI7L 4Q7JA 3UDFA 2MROB 1EQRA 3AQQA 3PX4A 4AYBE 2R8JA 2UVWA 3I4NG 1VS0A 3CD6A 5TZVA 4E0DA 4KMUA 4POFA 4X66Q 8ICXA 1GO3E 4KLIA 8ICKA 2R92H 4Q43A 3J80c 2HWJA 2DENA 2F4VL 1S40A 4KLFA 4JV1A 3RLOA 3I4OA 3C21A 2R8HA 3RRGA 4DO9A 5C3EG 5C44G 1K8GA 1Q1EA 2E5LL 2BA1A 1EFUB 4KITB 1HNWQ 4ECVA 3PUWA 1FJGL 4C3HH 2AQ4A 1U5KA 3NEMA 3KLWA 3MR3A 3TAPA 1HH2P 4DR7L 1S10A 2BQUA 1LB2B 1IBKQ 2JA5G 3RR8A 4ED6A 1ZQJA 2XC9A 1A5TA 1IXSA 2LVQD 3JPSA 4F91B 4PGYA 4DUZQ 1W2BA 4JI0Q 9ICTA 2KZMA 3MABA 1NKBA 1S97A 4JBMA 4UB3A 4O3SA 4A3LG 1JJGA 3LDAA 3N97B 1JMSA 3ISCA 2YTVA 2V1CC 4QGUA 2LVNC 2R7DA 4HIMA 1TWCH 3HP6A 2XO7A 3U4ZA 4F5OA 4YHHQ 5KG5A 1X3EA 9ICNA 3TANA 3OHAA 4IFDI 4R4TA 4BWJA 1ZQMA 2V9WA 9ICVA 3W1BA 2WZJA 1IFYA 4DV7Q 4C8LA 4DFMA 4DQIA 1UA0A 4B9SA 1NY4A 4LF4Q 4LUZA 4DEZA 4JI6L 1FGUA 1S0OA 2PFOA 3JPPA 1TK5A 2JE6I 4OX9L 1XNQQ 1N32Q 3FYHA 5DQGA 1OXXK 4X65L 2Z0SA 2W9CB 4Y52H 2BA0A 5IIIA 5KFLA 2NRXA 1E1OA 2JA7G 2DI0A 4YCUA 1S72A 1WFQA 5J0YA 5C0XI 3KOJA 2IX1A 5IYDH 2HHWA 4ED2A 1JR3E 3IM1A 4LFBL 5H1SE 2JY8A 2EKKA 2E5LQ 4RU9A 4UBBA 2ZUDA 2KCMA 1EIFA 3L2PA 1PH3A 1YEZA 4X62L 4KLSA 1A77A 5L1JA 2IA6A 1PH2A 3MBYA 2YV5A 4TUSA 1XXHE 4BA2I 4M9LA 4QWDA 2EJSA 4DR4L 4JCVE 1BPXA 4DSJA 4A3FH 7ICVA 2HHHQ 5KFEA 3S2HH 5L1LA 3F8TA 4AYBG 4O5KA 4A3LH 1I50H 4NLNA 1OXUA 3FRIA 4PHPA 3UPQA 4A76A 2B3TA 3JPQA 8ICOA 2BQ3A 2IBKA 1IYJB 4BY7G 4DPGA 1UE6A 4GKJQ 4TURA 5E7NA 3H4BA 4RQ4A 3ZJYC 4A4IA 4YCXA 4B3RL 2UXDL 3H40A 1T4GA 3MR6A 3K75D 4QZ8A 1FVIA 3J81i 2KFNA 1QLNA 2MGWA 1G6PA 1SRUA 4WJ4A 3GTQH 3NTUA 1SL0A 4JOIC 1E94E 4FBUA 2W8KA 2O25A 2I5MX 3CMAA 2OO9A 3CC7A 3AEVA 4YR3A 2BH8A 3HOVG 2VA3A 1RZTA 1ZMVA 3Q8KA 1UE1A 3HOYH 2NVQH 4A3IG 5J0WA 2JZBA 4O3QA 1BPZA 4NB3A 4PG3A 2JY6B 3TARA 2BQRA 2HVIA 2IY5B 3TRZA 1XPRA 7ICGA 2ES2A 3RB0A 1L3UA 1NV8A 3V6HA 1MSWD 2Q2UA 3H4DA 4EX5A 5BOMA 9ICQA 5IP9G 4DR5L 5J0SA 2RHQB 2VQEL 1MN3A 4DR2Q 4QZ9A 4P4PA 1HT2E 1GD7A 3CC2A 4MTNA 1COOA 5L1KA 1ZQLA 4BA1I 1ZQAA 2W9BA 2OQKA 4Z6DA 3AYHB 2K5NA 2I0QA 2G3QA 3M8RA 8ICIA 5J0QA 9ICLA 1HR0W 4NXNQ 3T5JA 8ICCA 1T6OA 3ZDDA 4RZRA 4PHEA 3G6EA 2MQHA 4DK3C 2ID0A 2N3SA 2F52A 5LMUQ 5GROA 2JP7A 3S1QH 5J0UA 4PZ6A 2JZBB 5IWAL 1XMOQ 4A3MG 1OXVA 3PUVA 4MNOA 5KT4A 3M85A 1VQIA 3M9OB 1X9MA 5DB6A 4IQWA 9ICOA 2MNAA 1TWFH 2DAKA 4ECQA 2HQLA 2CQOA 2FLPA 5CJ7A 4Y7NH 3GTGH 1T9HA 1ZMWA 3C1ZA 3G6XA 2P6RA 4PHDA 4X64L 3RJJA 3F2DA 2WTFA 3L0OA 2LVAA 5K36G 2OOBA 4IPGA 3HOWH 5CP2A 4ZH4A 1W3SA 5J2EA 1TWHH 4DF4A 2BWEA 4A3JH 3CCMA 2MJ5B 1X65A 4JBWA 3KF6B 4A3CG 9ICEA 4DR4Q 4LF7Q 4WJ3M 3ICEA 3FP9A 3K7AH 1G41A 1CEZA 4F93B 2NRWA 1ZQBA 1CKNA 2E2HH 3PSIA 4JBKA 4JV0A 3NELA 3CCQA 2L2DA 4PZ7A 2QSFX 1VQEA 4KLQA 4NLGA 3U58A 2ASDA 4IRDA 1A63A 1SLJA 4P73A 4PGXA 5FLMG 4J9QA 1YIJA 5KG0A 4HJAA 2R93G 1N34Q 1EFWA 4NLZA 1Q02A 1I5FA 5IT9c 1LUZA 1MJCA 1OKSA 5KFBA 1QVFA 2J6SA 1PYSB 4JV2A 2B63H 4KLOA 1VQ7A 5HMMA 3ISDA 4PMWA 2OTLA 2P6UA 2LTUA 1PH7A 2UU9L 3HFZB 1KSPA 4KHZA 2L4EA 2K52A 1V43A 2BHNA 1N32L 5KFNA 1AIPC 2DAMA 5L1IA 4OO1G 1IBKL 1KFTA 4TQRA 4QWAA 3RR5A 1WIVA 1O7IA 1P16A 3Q8PB 4O3NA 8ICQA 1OQYA 2UUCQ 2PFPA 3HT3A 2KBNA 3UE1A 3A5ZB 4A93H 7ICUA 1X9WA 2W9MA 4BBSG 4TQSA 1KTQA 1ASZA 3BZCA 3BU2A 1S3OA 3EWAA 4BBRH 7ICTA 5KFMA 2XCPA 1KQSA 4JYAL 2RCNA 1Q7YC 4QZBA 2DUDA 4YHHL 5JUMA 2DFLA
chains in the Genus database with same CATH superfamily
4LFAQ 5H37D 2F4VQ 3S24A 3J7BA 1GJSA 2ZTEA 3CP8A 2KNAA 3HP3A 2VQEQ 4C3IH 2QCPX 3U26A 2G9HD 1V8QA 3RZDB 2XIDA 3PR4A 4DK1A 5IGBA 2QILA 2DKXA 2JUJA 2RKOA 3UXNA 5FP0A 1HFGA 4QL5A 2EJMA 3RBDA 2MO0A 3I4MH 2R7ZB 4A3KH 1CHPD 2EYHA 1TS2A 2B63G 3CCLA 5C4XB 1BCPC 4FW9A 9ICRA 4CGYB 4F5RA 4C80A 4NM1A 1B70B 1IBML 4C8MA 2QHOB 1R9TB 1HNWL 4G4OA 3UXPA 1MQ3A 1SFOB 5FLXS 3CU7A 4FWGA 5BR8M 4TUPA 1GHJA 3CP0A 2R8IA 4RNAA 3I90A 1A76A 3KZIU 3MXNB 4HYKA 3SAHA 4LFCM 2UUBQ 3I4LA 4EQPA 2OXPA 4DSEA 1GUWA 5FLMH 3AV0A 5J2DA 4DV3L 4QZEA 3DEEA 3OMCA 2ZXIA 3U6SA 3ND9A 1VQ9A 3GTJH 5EE9A 3CRKC 3S15H 3GTLH 3CQZH 4KJOA 1S76D 1Y8GA 5KFCA 3A45A 2RA4A 1STBA 1LTID 1E9SA 5IOCA 3J81E 4HEDA 3CF5A 5C6AA 4HJ5A 1J5EL 2LKYA 3BVGA 4AQYM 3DFZA 1ZQVA 2RHSB 1DGBA 1S8OA 2L6OA 3PV8A 1RDPD 1NHWC 9ICWA 3K1RB 1DGHB 2LYHA 1H9RA 5J0RA 2BR0A 1TY0A 4OHJA 3TS0A 2R92B 3K9OA 4GH9A 1FO4A 3PMNA 3CKIB 7ICJA 3HOXG 5A2QE 4FCWA 1N9WA 2HI0A 4OW0A 2BCUA 2R45A 4KN4C 2C35B 2ZJRA 5J2AA 1TF0B 3T1HM 1GUGA 3JAML 3SASA 9ICJA 4QIWB 5C3XA 2JA5H 2VQEM 3EBEA 4Y2YA 1SXJB 3H8JA 3S2DB 3BZKA 1V38A 2XGPA 7ICNA 1O7YA 2A8VA 4CDCC 3SZ2A 1JALA 4EBDA 4UB6U 4MHEA 2R62A 3ZD9A 1ZQFA 2HIXA 4QZIA 2LKVA 2A1JB 2WB1B 1ZEQX 2Y1IA 3QR8A 5GAGC 4ZYSA 4DR1Q 4RGOS 1J5EQ 4IPHA 5IILA 1E0BA 4A3GB 1JRPA 1NKEA 5KNIA 1DOLA 1MQ2A 4JI3L 5DLGA 3PUZA 5I6WA 2WAQF 3TQYA 3ZH9B 3C58A 4CRXA 1G59A 5ALQA 1NJIC 4EELA 3QIAA 2AHOB 2B2WC 2Z9HA 1EY8A 4I7ZC 4KLEA 3PO4A 1QYRA 3PX0A 3QUTA 3QEAZ 1KKXA 1KTKA 1MSHA 5EE3A 4RHSA 1QOHA 4CNQA 1NSNS 1CRXA 3UMMA 3L5KA 5A35A 3WK6A 5DM63 3HU2A 2YQEA 2MR9A 2KHQA 4ECSA 1E22A 1EIGA 2XTIA 3DM1A 2EAPA 3C23A 4BXOA 1PRTC 2DJFC 1WHCA 3GTOH 1CFMA 1ZQIA 2EOTA 2AQ3B 3PW7A 4FZMA 3P7JA 4BBSB 2JEBI 2HHTA 4A3BB 5C5LA 1XPOA 5C0XH 1A3VA 1J97A 3GRRA 1LT3D 2F0PA 2I07B 4JI5L 1WTWA 2KK0A 2M9VA 2CH4W 3M9BA 3JAME 3CCJA 2EY2A 4PT5A 1Z1VA 4OJLA 1VDDA 4DFKA 4MB7A 3I4MG 1NSFA 4B7FA 1TS3A 3TE6A 2B2TA 4PMBA 8ICVA 1TWCB 5CBAE 5IYCG 3J7YW 4GOPB 2I6XA 1RDFA 4NPSA 2IHFA 8ICNA 1XYIA 1D0KA 4L5SA 3BOSA 2YY6A 3I76A 4ECUA 4RKBA 3AUOA 1PV4A 1SZHA 1RF2D 2F5NA 1T5XD 4M6WA 3VA7A 2KOBA 1ZQTA 4O3PA 3W2DA 1PTOB 3C9PA 1AE2A 3QB3A 3T1YL 4J15A 1KL9A 4QZAA 2QEJC 2IW3A 1STHA 2DHYA 3E58A 5D4BA 2R8KA 4DAYB 5JPMC 2NRZA 4HIOA 3LWMA 4ED3A 4J1MA 1DK2A 3KDFA 1SV0C 1EY0A 2LPEA 3X3NA 2KNVA 4K0KM 1CA6A 4JI2Q 1R6BX 4DNIA 2HBLA 1BVSA 4ZPXA 3FTCA 2LI6A 1H9KA 2O4XA 2C98A 2W9BB 2ZIVA 4GLXA 1VQAA 1TH2A 2HHHM 3H0GH 4KHPL 4CKCA 5DB8A 2K8CB 4RQ7A 2CKZB 3TI0A 4M9NA 2VJ4A 4ELVA 2L12A 3D3RA 4UY8C 3SENA 4RNOA 3D4WA 4K0KQ 1PJQA 4QJFB 4OXPA 3D2NA 4APVA 2NRTA 2KN7A 1U4PA 4I2IA 2LXKA 3V05A 3SC3A 2C2RA 1TVAA 1MHWC 2E8MA 5TSSA 4IIWA 4UAUA 4EIWA 4IBFA 5ALSA 2WV6D 1T94A 5DDYA 2JYOA 2BKEA 1KRTA 4JI8Q 3K59A 4P75A 3S1NB 1IN6A 2AGPA 1WYDA 3MHVC 4Z6CA 1ONLA 2Z3XA 2JRZA 3H8SA 2IOFA 1P8LA 2DHRA 1L7NA 1SYCA 1V1QA 3HKZE 4IBDA 3H15A 1BNZA 2L5YA 5KG2A 4RQ5A 4NXNL 1L8QA 2CCZA 1SN8A 4JI6M 1L1OA 2VUMG 2HHXA 2KFZA 1AE3A 4HIDA 1LT4D 2KECA 3S1QB 1RYSA 4I2GA 4KLLA 5BR8Q 3ZCBB 4GRIA 3DLLA 1U48A 3HOWG 4L6TB 2FJ6A 2BCRA 4A3IH 1V34A 2HVHA 2CP8A 3HJ8A 1ZD2P 2QARA 4F4KA 4WORA 1Y1VG 1EQQA 3RGSA 1AN8A 1K83B 2AUKA 2WAQE 3UMGA 4O0AA 2VQFQ 2JXNA 3RJFA 3GQCA 2MFIA 3HOVH 7ICIA 4ECYA 1STYA 5IT9S 4PMCA 4DV1L 3OGUA 1WOCA 2A5HA 4F2SA 4RQ1A 2WAQG 7ICPA 3KF8A 1U49A 1UFZA 1X6IA 4KT0F 4C4TA 3SV3A 5AI5A 1HPCA 2BDPA 1K1SA 2YB1A 2K4PA 4HLQA 1K8AC 5EXSA 1QUQB 5EXPA 5KFJA 2C2EA 1Q81C 5C4JH 2EUCA 4C3IG 2MUTB 4POGA 1L0WA 2K5QA 1DGFA 3K8ZA 2JA7H 4DR2M 4A3CH 3MFGA 1HZ9A 4CKEA 4IUTA 1QDRA 5M9OA 1VQOA 3FPPA 3HKZG 5IGDA 4OU7A 2F3NA 1JE4A 1PLFA 4RAUC 4P0PB 1WCLA 4AQYQ 1PA6A 4UAVA 4QMGA 1HNZL 5AI0A 2N1RA 1NUCA 3WKEA 4CJ2C 3MR2A 2Z6BA 3SK8A 2D5DA 7ICHA 2J5YA 3I91A 3K80C 2FE8A 1MX0A 4O5CA 3AU6A 1B2TA 1IXZA 4AG6A 2CH4A 3D6WA 4X66L 3MFHA 4AZFA 1TH4A 2WF9A 5AM5A 5DBBA 2MSNA 4B3TQ 4EBEA 1J6QA 5J29A 5J0OA 4GLAC 1XMQM 1EIHA 4R66A 1CI4A 1HQMC 3CAMA 3A56A 4R65A 2BPFA 3FYDA 2B8GA 1RJTA 3HKPA 3EW9A 3NENA 4B9WA 4JK1C 1EL0A 1L2FA 3H09A 2IT1A 1JJ2A 2G8LA 4DXGA 3RB6A 4I2AA 5E79U 2XGQA 4JI6Q 1ZQNA 2Y0SF 3GRYA 2Q8IB 3EZ5A 2DAEA 2KVMA 1KC8C 2QNJA 1HQCA 1YZ7A 1C4QA 3FVQA 4JYAM 3H4JA 2Y1JA 5F9NA 5FSWA 3TAQA 1QZGA 2CHGA 3F2BA 1DYQA 1PZKD 2HMXA 1EZ6A 4QUCA 5AIAA 4M9JA 2YNMD 1T3TA 4LJXA 5ALRA 4J9OA 2B2UC 2B2WA 3MEFA 4I7AA 1U47A 4LFCL 5CGKA 2F8LA 2ZJPA 3BS1A 4DR5L 1TKWB 1XC8A 1S0MA 2VUMB 1BNOA 3M6AA 1SNCA 3M4QA 1I4PA 3SMVA 4IQVA 4DR7Q 1N36L 4C8KA 3KW6A 1KXLA 4JI1Q 3KUPA 3S16B 5DB7A 1VF5C 4F2LA 4NKLA 4X3SA 3C2KA 1ZD5A 3ZDCA 5IYBH 1NR4A 1FIQA 1NY5A 1D1IA 5KAFU 4XGIA 3M7DA 2G06A 2AUJD 4LF6M 3ERQA 3K0XA 4Z6FA 3C5FA 2GWSA 3OWEB 4LF8Q 1I3QB 4O0IA 1KDAA 2OM6A 2KZ3A 4JK1A 2HUGA 7ICLA 4AKGA 3GQBA 4CHTB 3TPZA 3TKAA 4DK6C 2Z6KC 1F9RA 4O3OA 3GLIB 3S1RB 4F4YA 1CSPA 1Q3LA 8ICEA 4IPCA 2AU0A 2ENBA 4RHRA 1PFSA 1U45A 2FXQA 4MZ9A 4R4IA 5FO9B 3NVVA 1H95A 2KEBA 1ZQUA 2AH5A 2WAQC 1BKBA 4DNRB 4JI0Q 4L4UA 2KKPA 2JZ0A 2VS1A 4H02A 3VYUA 4LNQA 2OEHA 2SNSA 1B7YB 4ZUJA 1MJEA 7ICKA 1RKNA 9ICHA 4DL4A 1MC8A 3A0BU 1SXEA 5EOZA 1CTMA 1VMCA 2LM4A 2P35A 2I9GA 2XRSD 3RBEA 3TP7A 4HIKA 5KFDA 2R3ZA 2VANA 2F0JA 5ALKA 1AEXA 1Z5CA 4JN6A 1NK4A 1RD9D 2YTXA 4DV5Q 3ULPA 4R8UA 3NP8A 2ATWA 1WR1B 2LVPC 1F4IA 2ZAMA 2K05A 2BCVA 2A6HD 2E2JH 1R4GA 1PH1A 1L2DA 3VR4A 2Q2EB 4JI7M 1WCMG 1STNA 5KAIU 2OT2A 5F3XB 1CSQA 1JCKB 1LTLA 3AQEA 4F7XA 1YE9A 2R7ZH 1BPDA 2F4VM 2XGTA 3RN2A 2Q0ZX 4IOCA 1K28A 3EIEA 2D8CA 1GKIA 5KPTA 2D3DA 4DAVA 1R9TH 2ZXPA 4ME3A 3NBXX 1T3QA 2EDUA 5AKIA 4QW8A 2EZXA 1BR9A 2KHSA 4XQQA 4UAYA 1NK5A 2AQ0A 4CIZA 4UB4A 2B2YA 5IP7G 3S14H 3ONAB 1VJ5A 5KFZA 3SAFA 2AGQA 4G4RA 4QZDA 3H3VH 2KNJA 3PO3H 5LMNW 1VDLA 4KX3A 4BY7B 4LWCA 3HX3A 2B3GA 2Q4TA 3BQTA 3RLNA 4GKKQ 3CCEA 1ZQXA 1L6NA 5I6YA 3OJSA 5KL8B 2E5SA 4YFKA 4YMMA 4YXJA 4UAZA 1LTBD 4YWLA 4PHAA 4G4QA 4TUQA 1NK7A 4P17A 1X56A 4DFJA 1WTHA 3K8AA 2F8KA 3G48A 4CE6A 3KS4A 5JJLA 1N34M 2ZJAA 1HUMA 3FMCA 4PDGA 5AM4A 2C5RA 3JAMS 1QNKA 2PQAA 1D8YA 5ELNA 3S16H 2E5LM 2E8NA 5KT2A 1IY1A 4MM3B 1II3A 4CF4A 1Z9FA 2KQ3A 5IWAQ 5DB9A 2WB1E 1XMOL 2RRUA 2Q8TA 1QILA 2XI9A 1ZQHA 5CV6A 1X9NA 1HHVA 3SAVA 2DAGA 1FJGM 1DOKA 2WINB 4K4IA 2NO5A 1ZQWA 4LJ8A 3T3FA 2JHDA 3SGIA 5KFFA 1XHBA 4JBJA 5K36H 5C0YA 2XCAA 3F2UA 4GXKA 4LJAA 1OO9B 1Y69U 2IHNA 3Q8DA 2VA8A 3NASA 4OL7A 1MD2D 1GO3F 5IWAM 2EY6A 5DBCA 1O7ZA 1UEAB 1ZETA 2R6FA 2PO4A 1HA6A 1PK1B 1ZQ9A 1CM9A 1JB7A 1YNNC 4XYQA 2LM1A 8ICJA 4GLVB 4GKKL 4AIMA 4KHPM 1F0MA 4A3VB 1PTOD 4F4WA 1DO0A 4DWIA 2EYPA 8ICHA 1MGSA 1VQFA 3BVZA 4DF8A 2F0NA 4G9BA 1YUBA 2K5VA 3E9SA 4ANRA 3RTVA 1Z7TA 2NB0A 4IZ8A 5ALWA 2X69A 4CDEC 3C3DA 1YBYA 5E4WC 2KCCA 1SXJC 3LQQA 3MJ5A 1GO5A 1VEKA 2LWXA 1ZQKA 3T1YQ 1VQPA 4LF8L 1A8VA 5ITRA 4FF3A 4LZDA 1Q46A 3NVYA 2NO4A 1LVHA 1QTMA 2Q8RE 5DLQE 5KG7A 1ESFA 4BY1G 1D2BA 3BDPA 1V92A 4RCNA 1Z00A 3PR5B 4D80A 1F9QA 3BDCA 4YCWA 5M3MG 5M5XH 1GJXA 4DV6L 1X3QA 1VQKA 3HOUH 4P16A 1B22A 2VIIA 1FNUA 4X6AH 1Z47A 5DM73 5IYDG 4ABNA 2K50A 3GLGB 4GC6A 5M3FB 5JEAJ 1IBLM 3Q8MA 1A3TA 3HHWA 4JV5M 1G8ZD 4K5XA 3RZOB 1WI5A 4M6WB 2L4FA 4J9LA 1S4ZA 3PMFA 2RDFA 5EWFA 3OTOQ 4J9KA 4K6LA 3GTGB 1NJGA 2R18A 2E8PA 5J1ZA 5ALXA 4GC9A 4R7GA 5CEHA 1VEGA 2DQNB 4RUAA 4LF6Q 4ACOA 5KIXA 4QWCA 2A73B 3UE0A 5CORA 1UT8A 4Y2RA 1IBMQ 1PRTB 2F0OA 1S5LU 1Y1VH 3KDFB 1G3IA 4UB1A 3K4GA 1D9DA 3RJHA 2I7NA 3LWEA 4H0LC 2DUYA 2EYLA 4FF1A 2C9OA 2EKFA 1SZPA 3HOWB 4B08A 4P2CB 2K4HA 4QY7A 2HDMA 1TWHB 2L55A 4A3JB 2L4NA 3MDAA 3FKIG 2VZAA 4EX6A 5AM0A 3HU1A 3SMSA 4Y2SA 1ZYRC 4LUVA 2A1JA 4PD2A 2KTQA 4QWBA 2YFQA 1PUZA 3NS1A 1ZKOA 3FD9A 3GD7A 1NK0A 1I4WA 4X65M 1TT2A 3T51B 5AK6A 5J3BA 2WSCF 1IY0A 2MH8A 4B3MM 2KEYA 4RNMA 1QJOA 2PYKA 4DR1M 5KT7A 1TDHA 2XSZA 1Q8KA 5CA7A 5J2IA 2A68D 5AJ3Q 3UDXA 3L25A 4FZNA 2EQSA 2O5IC 4I28A 9ICFA 4KV6A 1Q82C 2L9HA 4RGTA 2AJQA 1L3TA 5DG8A 2G07A 3NUQA 1PTOF 2DF4B 4RCOA 1ICWA 4G7HC 3FTFA 4J6HA 3RZDH 1IXRA 3S1NH 2WFAA 1TWAH 1QAOA 4DR2L 3I4MB 1WG8A 3SEIA 2OQ4A 3RB3A 2HSZA 4X62M 2AQ2B 4B3RQ 2VF8A 4U6PA 2FMSA 1C9OA 1FYCA 2MU2A 1IBKM 3KOYE 4PZNA 4L15A 5DQIA 2PCFB 4C1NI 1R4QB 1SFOH 3DHQA 4P74A 1D9FA 2CE7A 2EANA 4IO9A 4A3BG 2E75C 3GLIA 1Q3CA 2ZM6L 2KJ5A 4IJFA 5FTJA 4A3IB 1VCIA 4RUCA 2Y21A 4B3RM 3MTSA 4IR9A 4RF0A 4F5NA 2UUAL 5AI8A 4LF7L 3TN2A 1BPBA 4X5VA 3KDSE 4LJ6A 3QWNA 5M3MH 1Y8OB 1I6HB 4JPBW 1DM0B 5FTKA 3WK4A 4IALA 1HR0M 4DR3Q 4R8UB 1I6VC 4G3IA 4DL6A 2H3FA 4I2HA 2SOBA 3HJQA 2MGSA 4KTAA 1Y1WG 4FF4A 4L8JA 1M90C 1VQ5A 1SE8A 4RF1A 2C5CA 1A0PA 4WP2A 5ALTA 4OJOA 4S12A 4Z6YA 1IIPA 1WTRA 3QYPA 1D2NA 3KHLA 4L6V6 1ZQPA 3TACB 1JB3A 1YNJD 3Q8SB 3LCUA 3ICXA 4IUUA 5BR8L 1WTXA 4YHHM 1X3FA 2BPGA 4QZCA 2ISPA 3TP8A 2WKDA 4A3GG 3GILA 1ICFB 4JI7Q 1KSFX 2R44A 4CISA 2BJVA 2N35A 4KD3A 1NAPA 4QUFA 2I5LX 1F9SA 3RFAA 2BJWA 5KPRA 4MN3A 1B0XA 3SD7A 2WF7A 1TK0A 1NMGA 5FJ8H 3V6JA 5IGGA 1R7RA 3S2DH 1KFDA 1VQBA 3RJGA 3T6PA 5DG7A 3A5UA 2UXCL 1GL6A 3CCUA 1S0NA 4GS3A 4KMOB 4DK0A 3ER0A 1IKMA 1HUOA 3U4VA 4B3SL 4DV5M 2UUAQ 3Q8XA 4KKTA 2NVXH 2UXCM 5KT6A 1DGHA 3UZUA 4P0QA 4GNXA 1H9JA 3MC0B 5M5YB 1OW5A 3HWTA 1IW7C 1NY6A 2NVTB 8ICAA 5JI2E 4M04A 3PCOB 3HRDD 3H8WA 2FDRA 5AIBA 3M4PA 4JW0A 3EJIA 2KEDA 3AOGA 3J80S 3SV4A 4MEXA 2KHIA 4GHAA 3L3OC 3M7NA 5G3LF 3G6VA 4DSKA 1PHJA 4DV0Q 3GLHB 3KJPA 2H3QA 5KRUA 3R3OA 4A3DB 5ITTA 2YMMA 3GIIA 5ELEA 2A3VA 3C29A 1KRSA 2PZUA 1KRPA 3F92A 3PVSA 1WTOA 1QG7A 3MR5A 3HOZH 3PO3G 2K8AA 2KHJA 5LMNM 1EU4A 5KFYA 3RAQA 5IINA 1NZBA 4M9GA 2JA2A 2EY5A 4LMQD 4OWXB 3HWSA 4UW9A 2VB2X 5AJ3L 2HAKA 4B9UA 3GPYA 1W5SA 4CJ6A 1C48A 2D62A 4BXXH 3JR4A 5AICA 1CKMA 2L09A 3VFDA 1TWFB 2FFKB 2QGQA 4LJ9A 3PUYA 3CCVA 1KLGD 5CR3A 5DYIA 1JXEA 2KA7A 3C1YA 4JYAQ 4BX9C 2ZAOA 1ZQRA 2UXBQ 1I94L 4R3DA 4AYBC 2KW0A 2W8LA 2R7ZG 1OIPA 1S5FD 1WCNA 3TL4X 1QAQA 1PTOH 4JWNA 3GV5B 2EE1A 3DWQA 1QSYA 1G2TA 1KEJA 1A62A 4CJ0B 1TWGB 2VF7A 3GTKB 1XNRQ 2IHEA 4UP9A 1I3QH 4DAPA 1EY4A 1AP0A 1HZAA 4NXMQ 1RL2A 5NUCA 5L1MA 1DOQA 3AL0C 2H3IA 3IL8A 3NBHB 1Z5AA 4KY7A 4GHLA 2L15A 1PFMA 4IPDA 4RQNA 1OAIA 5CV7A 4I2FA 4C3JB 4A3GH 2VQFL 5HGQA 4B3MQ 1IW7D 4GZYC 2AMCB 1VQ8A 1KW4A 4LF5M 3HU3A 4DLGA 1NNJA 3TZDA 2DPJA 1K82A 4PNYA 4YG2A 1FNWA 3R8BA 4DFDA 1Q86C 3SMPA 1ML0D 1P3QQ 1WWVA 3NRWA 2R0IA 2F5OA 4C8OA 5DG9A 4MF2A 5C0XG 3K2LA 1Z1BA 4O3RA 1MI2A 7CATA 5C4XG 2VQFM 4FCTA 2F5SA 1YHBA 2AWNA 3MXGA 4DL2A 3HPOA 5I2XA 3PNVA 3LCVB 3F5EA 1BOSA 2EAMA 2Z6KA 4N8FA 5AFWA 1IM2A 2ZXHA 3M4YA 3BXWA 1BPEA 1JROA 1N63A 2YR0A 3GQ3A 4ILWA 2Y0TA 3C1FA 2RDGA 3SYLA 1EYGA 2UVRA 3S1MB 5BPCA 1SE4A 3SK4A 4X64Q 2JY7A 1LKYA 1ENCA 4F8RA 2CPRA 4YR0A 2QEXA 4LF9L 4L5RC 4V190 3SATA 1QE6A 2BZFA 4NXML 4A3BH 4BBSH 2ZUBA 5KT5A 4PJ0U 3PUXA 4EQOA 2HDOA 1ZQCA 4DLEA 4HEOA 1UT5A 4KLKA 5BN5A 4FXGC 2JNHA 4DQSA 1VQJA 1S3SA 3W0FA 5C3WA 1KD1C 5LL6X 1TXYA 3JPOA 2CFMA 4YP3A 4NXMM 4DOCA 1A3UA 2DNCA 2R6GA 3IP4B 3AKZA 1R5LA 4F5PA 4G4KA 3J7ZC 5AKZA 1CZWA 3KOZE 2ZIUA 5KPZA 3TQ1A 5CRXA 1BUVT 1E7ZA 3GLGA 4DUZL 1HTPA 2UVVA 3J27B 1SROA 2FINB 4JI3Q 5EJWA 2YTVA 1Z6TA 2L7IA 5TISU 3V72A 3T79A 4DUYL 3EPIA 4KI0A 1EIYB 3J80i 3TWLA 1HNXQ 2PQAB 4MEYA 2JH7A 3ONNA 5AI4A 2OH2A 4A93B 1CZGA 1L1OB 4DUZM 1R4PB 1XJVA 5KG6A 5CMDA 2D0PA 3H0GG 1PZJD 1GLNA 1QDTA 1YNXA 4IBGA 9ICMA 4GN3B 2YTUA 3M7GA 1PZNA 2GLEA 4ED7A 4B9NA 2LHTA 2E2IH 1N33Q 2DZNB 4UDUC 5ALUA 4MH0E 1N2XA 3QEBZ 2YTYA 5KFIA 3K58A 3K1ZA 4FVMA 1LTTD 2JXMB 2PMZC 4F3OA 2OQ0A 4RGMA 3L26A 4A3FG 1NV9A 3H94A 4J9SA 3A55A 3K5MA 4O2DA 5GADC 1WCMB 5C0XJ 1PVPA 2SEBD 4TRDA 5CV5A 1T8EA 4J9MA 2E8GA 5DYGA 2A6HC 3JAMc 3C1EA 2XICA 4ED1A 3KF8B 1PVOA 8ICMA 3L7ZC 2NWGA 3EN2A 5EWGA 1K3XA 5D46A 1HQRD 4PL2A 1HR0Q 4QWEA 4C3IB 3QNMA 1C0AA 3NGDA 3JC66 2HDLA 3OYYA 4N8X1 5IT9L 4HMJA 3U9OA 5GAEC 3ULJA 4M1UB 2GQFA 3TP5A 2I5HA 5T1GA 5J2FA 3U60B 4R8IA 2V6ZM 2XSZD 1LKYB 1K3RA 4OO1I 1YLAA 3B9JA 4DR5Q 3FPUB 2HCFA 1JN3A 4LF4L 1EOVA 2FPMA 1SV4A 1KYIA 3QAUA 3J7A5 5KYLA 1TV9A 2LMCB 3J80L 5L8RF 1C8CA 3BS5B 2W82A 2CFOA 4J03A 2CW0D 1VQMA 3CMEA 3UQ2A 4B3ML 1X32A 4X66M 3KD3A 1RYRA 1O03A 4I4LA 3RJKA 1EFID 1T7PA 2F0UA 3MXPA 2I1QA 3NBHA 2K4EA 4P0PA 4OWTB 4ZUIA 5CV4A 4IQTA 3B6YA 3IHPA 4XQJA 4GOPC 5HY6A 2F1IA 1DGGA 2JA6B 4OIKA 4LFAL 1CA5A 1RPLA 2JH1A 3A74A 4HMIA 2VUMH 2QKQA 2LBOA 1N78A 2NVYH 1ZQGA 3SI8A 4FP5D 1K9MC 4YXMA 3LWLA 3WKDA 4YVZA 2OHFA 2QDBA 4PH5A 3I8ZA 1AROP 3MGIA 4F88A 1HR0L 1JQJC 3CF2A 4LFAM 2J4XA 4DOBA 1AW7A 2UXDM 2G5DA 2HL7A 3K5NA 3KHGA 1HT1E 2BCSA 1BQQT 5KG4A 5IGCA 2F0QA 3UXOA 3AFQA 3QE9Y 2WSFF 3UJNA 4DL5A 2H5XA 1ET6A 2KCTA 2VXWA 2KZZA 4I5SA 4BB9A 1TR8A 1E2WA 3Q23A 1SJED 4R8NA 4KKSA 3UDGA 3T1HQ 1XMQL 2ZANA 3I56A 4XT1B 4DV0L 4A3DG 3SYZA 1VDVA 1NJWA 3M4OH 3PZPA 2LHCA 2MO1A 3CXCA 3OTQA 2D7HA 1TU2B 2GNOA 5IGFA 4NW2A 1OTCA 9ICAA 3JPNA 4EZ9A 4QIWE 3M9MB 4CKBA 2Z4SA 4IRKA 3IFTA 1UM8A 3CNHA 2XH9A 2FLLA 1LACA 3GIMA 4EQ5A 4NWIA 5KG3A 3TP6A 1XWEA 2NYZD 4WJ3B 1XO1A 4KLDA 4Z9CB 5LL6S 2E76C 1M1KC 2JY5A 5BOLA 5H2FU 3GDXA 1NJZA 2OF1A 2FPLA 1AZQA 4LF6L 1E2ZA 1K1QA 1PZID 4MFCA 4KLGA 3DM3A 4L63B 3RH6A 4GC7A 3K81C 2RDJA 3KJOA 2A1AA 2JV3A 5KFPA 5EGTA 3NWLA 4OJ5A 2N88A 3ZD8A 3IG8A 4P0QB 2OCEA 4PPXA 1B9MA 2ESEA 5JEAH 3RFWA 2JA6G 1NZPA 4JB3A 1VQDA 4KLUA 1F9PA 4P2HA 1GABA 1TWAB 2XWJB 1N36M 4RKLA 1KN5A 4FNFA 3V6KA 1TS5A 4P4OA 2C28A 2K14A 1Q8IA 1WTVA 3PFIA 3KFUA 2TMPA 3OW7A 1SV0A 2R65A 2EO2A 4JI2M 3WK5A 2V4QA 4ECWA 1PDQA 3GDEA 1UHUA 3I70A 3I73A 4GIPA 3VDPA 1Q1BA 3TZUA 4YY3L 4HJ7A 3T1HL 1XMQQ 4J9RA 4B9TA 1QVCA 2XFTA 4Q5VA 4C2MH 4ECTA 3FDTA 1EEID 1FJGQ 3SYKA 4JI1M 2K8BB 1GOZA 4D82A 1RHPA 3AFPA 4FFDA 2EPBA 2A74C 1ENFA 3ED5A 3E0FA 4UARA 1W5TA 3PO3B 3LGJA 1BGXT 2L11A 1QZHA 3NPPA 3E9HA 2MPMA 1ZQOA 9ICGA 3VC8A 2JA9A 1QZMA 4EVOA 3ULLA 2HHHL 1HIWA 2ZXRA 3G4SA 2KA6B 2XLJA 2G5IB 1HUZA 4RA8A 4YMNA 3EROA 2XEPA 1SB3C 5J0TA 1PH6A 2H4OA 3EIHA 4Q8EA 1QUTA 2J7NA 3SDZA 4MF8A 2UUBM 4LFBQ 1SG9A 2A5YB 2ZBKB 2ZJ5A 4X3UA 3BQ7A 2NN6I 4O9MA 1Q12A 1NK9A 1ZQYA 3VYTA 3KTQA 3C3LA 3U9SA 1SXJA 2CRUA 2EY1A 7ICOA 2KNZA 1EWHA 5F9LA 4NJ8A 4B3SM 3F2CA 1F44A 3BQ2A 2DZOB 2UUBL 2YU9H 1D6EC 1AFPA 9ICKA 3I4NH 1KDHA 1NMFA 3I7FA 2UU9Q 2PMZB 4FXDA 1HCZA 2Z4RA 3WKCA 2DL0A 4EX7A 1FL0A 1SMXA 3PX6A 3M3YB 2DNAA 5KFVA 2EJGC 2JMGA 3B7QA 3P20A 1ZOLA 2KJ8A 3NVZA 4CBVA 1VQ1A 5EBCA 4P71A 1OFIA 3TEHB 2B21A 3U6PA 4C0ZA 2LMRA 1WYGA 1X2IA 1QUSA 3M6ZA 3RJEA 3HOXB 2FLNA 5KFQA 3GLHE 4BWGB 2ZUCA 4DUYQ 2JEAI 4DV7L 2F3IA 2L1BA 1L2BA 1QCKA 2VIXA 3E2EA 1F77A 3IG5A 1WTQA 3T13A 2BGWA 2AXTU 2RQ5A 5KFWA 4JXJA 1QVRA 2RGOA 2YMQA 3CRXA 3FYCA 4ELTA 4R63A 1OXTA 1PJSA 3EVQA 4FXKC 4V0BA 2F5QA 5IIJA 5FLXc 4A3DH 4YWMA 1NHGC 4KN4A 5C3EH 5C44H 4LF9M 2ICIA 2PZTA 1ZAEA 2FH0A 2F5PA 2QF7A 3HOZB 4HAEA 3RH5A 4RMFA 4K0KL 5DGBA 2JEFA 4NY8A 5KNBA 4Y2PA 1SKSA 2JEIA 2X49A 2F0IA 2IJ0A 2DAIA 4BUGA 1X6OA 3HZXA 8ICBA 2OOAA 4QOSA 1UQVA 2KHVA 5ALMA 2LVOC 5B66U 1MJGM 2PXIA 1EQTA 4JC0A 2G5HB 4R71A 3E0EA 2KUMA 3T4AC 2F0LA 3BVMA 5FJ8G 3PIP3 2DPIA 2ZTDA 3T1YM 4GNXC 4LJZC 3NTKA 1DCZA 3ERSX 3PGZA 2ASJA 4TVAB 2LSSA 4NXNM 2BDUA 1NJXA 3BYTB 1EUJA 4BXXG 5GKNA 1XNSA 5KFOA 3IFDA 5KNCA 1IL2A 1BBXC 4YR2A 2KV2A 1L1OC 4ZCKA 4EEYA 2XRQD 5G5GA 2DWLA 4EBCA 2A6ED 1ZYQA 4PQXA 3K57A 4BWMA 4BY1H 4QNMA 4BXOB 9ICBA 3B0XA 3W5OA 2K7VA 4DV2L 1IBLQ 3VCBA 2VA2A 2QDLA 3A8KE 8ICYA 3KOWE 3PO2H 4DS5A 5HP4A 2K5DA 5FK9C 3C2PA 3A8JE 4DR6L 4B3SQ 2HIVA 2HCBA 2ZJQA 1PJJA 4GXIA 2BNKA 1UPHA 1CHQD 1XO0A 4C3JH 1HZCA 4I2CA 1B3AA 3G71A 3JAMi 1G4AE 3LQRA 1XSLA 3D8LA 2Z4HA 5E6JA 2AQ1B 1D8LA 3RB4A 1G291 3K7UC 4UN2B 5C4HA 5L37A 2K04A 2RDIA 2UVUA 2CHVA 4YN4A 3EPGA 4IQUA 5AKEA 2W9CA 3P75A 3HOYG 2O01F 1QNUA 8ICGA 4BY7H 1Z4OA 4K8JA 4ALPA 2FMQA 2VY3A 2Y0QA 5AKGA 3U6QA 3J81S 8ICLA 1PTOC 2VW9A 5IYBG 4G4NA 3JPTA 4F87A 1N5XA 2ASLA 7ICFA 3OPOA 1Z3EB 2CWAA 3S9WA 2QA4A 4K4GA 4HJ9A 3S1MH 2NZOA 1JX4A 4O1NA 4P4MA 1Z5BA 3FEWX 2XY7A 1WGLA 4DR1L 1YNJC 5AM3A 1JWUD 5CBEE 2ZTCA 1IY2A 1TAQA 2KZUA 2YMPA 3C3EA 2XZUA 4DCCA 5AM2A 4DSFA 2PNHA 5IYCH 3HS0C 3RNUA 1KDBA 2ALYB 3MFIA 9ICCA 1IYUA 2DZLA 3LX0A 4UP7A 4U673 1N48A 4A3KG 2ZIWA 1Y8NB 7ICQA 1RU3A 2ATLA 2CXYA 3QUCA 4F2RA 3RZOH 5KEEA 2OTJA 4JOIA 4B3TM 4LRSA 3H3VC 4OJPA 2XY5A 3E4RA 3MVVA 5M3MB 3KXEC 1I6HH 4JI4L 2R93B 3RD4A 2EXZA 4RWSC 1YITA 3MEHA 4XBOA 2XZFA 3E3XA 3I4VA 1V97A 4XIGS 2D2CC 2GN5A 2ASBA 5KG1A 1NBWA 5F2DA 4KLHA 4B7HA 4IJLA 4UAIA 2ZM6M 4ECZA 1YJ9A 2RLTA 5AK5A 3N28A 4M2YA 2KENA 3PIOA 3S1RH 4LY6A 3OSNA 4YCVA 2E2IB 1GVPA 1SYGA 4OONA 1VMPA 2K28A 3H4MA 1Z00B 7ICRA 4RQMA 1QAMA 2WAQB 4YY3Q 1DV0A 3G7LA 1E3PA 4M9ZA 3VYSA 3KSJA 4KN7A 2BH2A 3K92A 1BO0A 1JUDA 3UDIA 3UM9A 4NXZA 5J0PA 2XFSA 4JWMA 1XPUA 1GUNA 1WCMH 3CTWB 3SEBA 2K0BX 5J2GA 1KAWA 1E32A 8ICUA 1A6XA 2PFQA 4DV3Q 3SAGA 3PO2G 2F44A 3KFUG 1B44D 3E9IA 4K14A 3KKAA 4L78A 4RQ0A 3NK9A 4A3EG 5EPKA 2NVXB 1S0VA 1VQ4A 1I4RA 3TREA 3PVXA 1B53A 4MGIE 1UE7A 4IN3A 1XNRM 4L5QA 1HNXL 1JI7A 1XWIA 1RTOA 2I46A 1J8IA 3H0MB 2M0NA 2R4JA 1S77D 1HTLD 1I94Q 1JE5A 2NV3A 3J7AS 3B0YA 4UAWA 3LK9A 3ETLA 3VDYA 4NL4H 1NK6A 2F3VA 1UCVA 3EYZA 4F4XA 1G2SA 1YI2A 5JAVA 4GN5A 3V7LA 1X9XA 2W04A 4EYIB 2DN8A 5J39A 3WK7A 3A0JA 1VQ6A 2DXIA 4A8EA 1ZJNA 1XSPA 3BJUA 4AH6A 4DR6Q 4HCSA 4X64L 1LYLA 4UB5A 4AQYL 3TFRA 4JI2L 1G51A 2PI2A 3GO5A 1B50A 5FOBB 5I9OA 1SWVA 5J2JA 3KBGA 2QB0A 8ICWA 3K1JA 2FMPA 3OHBA 2LNHC 3H3VI 3U6LA 1PYBA 3ISBA 1XSNA 1ESRA 4KHPQ 1HFNA 5JEAG 3V76A 3VYRA 1U4MA 1GUSA 5EAYA 1WXQA 4LJ5A 1L1TA 3KSXA 4IBBA 2WF8A 5EQ0A 3K5LA 2PI2E 3WHKA 3JR5A 2R8GA 3NUCA 4XT3B 5KFHA 2R46A 4MGHA 5AM1A 4BJQA 1I50B 3ND8A 2N8NA 4ED8A 2N78A 2V4RA 5EKKA 4DV5L 1V85A 4DQQA 3SHLA 2Y0SE 1ZJMA 4M0AA 2EZZA 4DV4Q 5EE1A 1SKWA 9ICUA 3RH4A 3CCRA 1V9PA 3GP7A 4M9SA 1OXJA 4GN4B 5C5MA 2CWPA 3QYBA 5LMUL 4RPYA 2ZM6Q 1Q39A 4F5QA 1VQHA 4A3JG 1MIUA 4I29A 5CR0A 4RQ6A 2QB1A 4IS7A 1A15A 3M9NB 1LO5D 1ILPA 2JZ1A 2MAXA 1NO1A 5EE0A 4QW9A 3KHRA 1JWSD 3H0LB 2NUCA 4R1JA 4XK8F 2DWNA 1SIJA 3V96A 1ZRNA 4ED0A 5LMUM 3CPFA 5C4ZA 4DV6Q 5ALOA 2HCCA 2K75A 4P72A 1YT3A 3TWKA 1LT5D 2B8FA 4LAAA 4KHVA 3WWVA 1MU5A 4N9TA 4WJWA 3GTQB 4QF4A 2LY7A 2SDFA 4PGQA 1TK8A 1Z4NA 4BGDA 5IP9G 5LMNL 3IN5A 2C22A 2GA4B 1L7OA 3PW2A 4JG2A 3HX0A 3V7JA 5M5YH 5E4XA 1PH8A 4RQ2A 3J81L 5JTIA 2W9AA 3VKGA 1QUQA 5ISRA 5M3FG 3C5GA 2KJ9A 2UUCL 4JI3M 3GLIE 2B6GA 1ASYA 4AG5A 2LXJA 5BN3A 2QQ8A 9ICPA 3DV9A 2K6AA 3OTOL 1TAMA 4O5EA 1KNAA 5CV8A 1SR3A 1I94M 3PO5A 3CPWA 3PIPA 1BF4A 1XTDA 2Y20A 3HJEA 4K5WA 4LF5L 5KFXA 1DZ1A 2AGOA 2FFJA 1BDOA 2KCNA 5ALPA 3ZC7B 2NZHA 4QNLA 2NN6G 3KK7A 4NDXA 3U61B 3AFHA 3FUWA 5ITXA 1XMOM 3D31A 3HRZC 3HOUB 2UXDQ 4XTCS 1JR3A 2K89A 4KODA 2IHMA 5IE8A 5ITUA 4HAIA 3RJIA 2RP5A 1DJRD 5K5PA 4MFAA 3QU9A 3LVWA 1ZQZA 4F72A 5J2CA 4YD1A 4AYBF 4KO8A 3BQ0A 2H3VA 3RAXA 1IXRC 4NM2A 3Q8QB 4DXFA 3BG3A 2APLA 3FKIH 5M3FH 9ICIA 1JXLA 4QZHA 2F0SA 1UE5A 1BBUA 3PV0A 8ICZA 4AKHA 3HKSA 3PNCA 2HOFA 1Y1VB 2JEJA 4YMOA 4GC5A 1BPYA 1TWGH 1SWWA 3SR6A 3GTKH 2AHMA 3FC4A 1Z59A 3MC1A 2RGHA 5AI6A 1X54A 1X40A 1YVCA 3SFZA 4FDBA 4LF5Q 1N75A 3V7KA 3PNYA 5JI3E 1KFSA 3I1YA 5JPNC 5EKLA 1LV7A 1N5WA 3IHQB 4YWKA 5HR6A 1E9RA 1G91A 1SNDA 1QZEA 3GTMH 5DGAA 4LF8M 2R7FA 3A7LA 3ITPA 4AKIA 1F2LA 1TH3A 3W1GA 5JOBA 1PGYA 1MKHA 2O5RA 1PM5A 5AI9A 3Q8RB 4JI5Q 4UPAA 1O78A 5E1FA 1NK8A 2M9NA 3QWLA 2C2DA 1O7LA 2KOLA 3RN5A 5AKHA 5HHHA 3M3YH 5CB1A 3BYYB 3E21A 4UATA 2KKVA 1CKNB 3FHWA 4DR3L 4BS9A 1PRTD 4KK7A 1EWCA 2E3TA 2BDOA 4JV5Q 4JI4Q 2WSEF 4GEWA 5M5WB 2EYFA 2W03A 3KLRA 4II7A 1XXHA 4NSRA 2WB1F 5DQHA 2Q2IA 2WFWA 2FPKA 2WF6A 3HOXH 3RUZA 1STGA 4IUNA 2KIVA 4DV1Q 2F3WA 4ECXA 1GXDC 3NTHA 1CT1D 5J2BA 4RNNA 1WGNA 3VR6A 3MWYW 2UXCQ 1D5XC 1N33L 3Q8LA 5D49A 1LM0A 4LVSA 1UUPA 1RXWA 1CI3M 4DR6M 1H38A 2NN6H 4J8QA 5IY0A 3T16A 2K33A 1EWIA 4OCZA 2M00A 1JQYD 4F50A 3FM9A 1L0YB 2NBFA 2LHGA 2B63B 3HKZF 5L9XA 3GV8B 1NNXA 1HZBA 1IBLL 3N4MB 2JQOA 4I65A 2JXJA 3UI2A 3I72A 2Z7JA 1VG5A 1X37A 4O3MA 3OJUA 5F3WA 3QZ7A 1QH9A 3H7IA 2J6TA 1GKHA 4LRTA 3R93A 4I81A 2JA6H 1Q3VA 2GO7A 3GRUA 2Y9UA 5IREB 3AM9A 1BBWA 3ZDAA 1JWMD 3STBD 4CDDC 3ZDBA 4A3MH 3GLFA 4IL6U 1AQ6A 2NVYB 4OJ6A 4J9NA 2UU9M 5AHXA 1TAUA 2SNMA 4B3TL 2K9DA 3OPXA 5KFTA 4ZQ3A 5DLFA 7ICEA 4FWDA 3HILA 9ICSA 3PQIA 1CUKA 1ZD3A 4QNRA 2D0OA 3KVWA 1URJA 1RXVA 1LV5A 1UNSA 3MXUA 1WTPA 1JMCA 3R9XB 2JJQA 4UB2A 1FR3A 2B0CA 4F4ZA 1GM5A 2Q2HA 1RQNA 3H0RB 5KO3A 2VNUD 4QQBX 2NVTH 2KICA 4JUZA 3GLGE 3MDCA 4DQRA 2ZJ8A 4QCLA 4XUSA 3V2TA 4RT3A 4C8NA 3GIJA 3OSPA 3T5KA 2F0TA 8ICSA 2PW7A 1SSOA 5KT3A 5HHIA 2EVBA 2K4IA 2GVBA 2K32A 5C5JA 3TADC 2LBCA 2K03A 3KF6A 1ZQ1C 3F5AA 4XQNA 2MRLA 2NYVA 4DSIA 4KLTA 4CCHA 4C1NK 3N7SC 3RF9A 4GNXB 1YZ6A 2F0EA 2UXBL 1QSLA 2YYZA 4GOPA 4I2EA 4IJEA 4LFCQ 5HMLA 5CWRA 1ZQSA 4A75A 3BDOA 1VEJA 4K2LA 3BZDB 4UB8U 1PH9A 2NRVA 1KDCA 2K5HA 3LNNA 4OELB 1YSYA 4B9LA 3LW5F 3DWAA 3I04M 2B29A 4IUPA 5IP9H 2D7GA 3GV7B 2WB1G 3ORYA 4H13C 4LW1A 4QZGA 4R64A 2CV2A 2DKLA 3UK6A 5IIOA 4ZRZA 3OIPA 5EQTA 4RPZA 4M0WA 4IJHA 2RHFA 1B1ZA 4DU9A 2VL6A 4M47A 3QXGA 3GIKA 4R4OA 1DXSA 2NTSA 4XA5A 2HW3A 4NC6A 2A69D 2KEEA 3OHXC 5DBAA 4M9HA 2DY8A 3KYHC 1WUDA 5ALDA 2PFNA 1CQVA 5AKXA 1SNOA 3C2LA 4ZAIA 3SE0A 3FDSA 1PJIA 1V1PA 1XWLA 4RQ3A 1YJNA 3PW4A 4PL1A 4C2MB 1HNZQ 2BWBA 1K3WA 4BDPA 4IFDH 4DQPA 1VQGA 2CWBA 4I2BA 2R61A 3S2HB 1XB2B 5EPLA 5GAHC 3GTPH 5J2KA 4MFFA 3R2IA 3R9KA 2KSOA 1JORA 5KFSA 4LCBA 1NJYA 1KLNA 1M6YA 4G57A 4A3EH 1E1TA 4GFJA 1UA1A 3Q24A 8ICTA 5EP3A 3CCSA 3K5OA 1RODA 2GH1A 1TFRA 3M8SA 4JI0L 4RH6A 3R2TA 4K6DA 2JA5B 3GFKB 2PI5A 4FS2A 1IKLA 2IL8A 5ALLA 3ZI4A 4OVZA 2F1JA 1C20A 1CKOA 1FGBD 1NJFA 4H44C 4RT2A 2CHBD 5JJKA 3N52A 5ITXE 2F76X 4DV3M 2JEGA 1NTGA 1RIPA 1KQQA 2YMLA 4Q45A 4IFDJ 3IRBA 2A19A 5ELOA 3C46A 2CRXA 3HJSA 1B4OA 2H1EA 1X3GA 1R2ZA 3I4NB 1ZRMA 3X3MA 2O2LD 2XF3A 4HSPA 1U9LA 3HOUG 1EIJA 3HEJA 2PW5A 2EH9A 4K5VA 2ISOA 2CN1A 3HKZC 3SAUA 4Q44A 4EZ6A 2E8OA 4YY3M 2DWZB 3FTEA 4B9VA 5KFRA 1D0MA 1ZYRD 4J9PA 4HR7B 3DXJC 3THGA 1YJWA 3WK8A 4DOAA 1TE2A 1UAPA 3VA5A 4Z8XA 3F1ZA 3A54A 3TMEA 1SYEA 4LZJA 2IX0A 1JT8A 1PVQA 1ZV1A 2ZIXB 3CC4A 4Y2VA 2MUTA 3GPUA 5ALZA 5ELDA 3QJYA 3STBC 4KLJA 5GTIU 1QWYA 4BBRG 3N7RC 4DSLA 4QIWC 1NNUC 3ZDEA 5D3DA 2UUCM 1FFVA 4A3KB 2R92G 1W6JA 1J09A 3OTOM 1R2YA 1KIXA 3B7NA 1LLRD 2Y9TA 4FO6A 2HHSA 4DAMA 4FF2A 5BN4A 2KHHA 1P7DA 1QSSA 2GVAA 2HHUA 4JMUA 3SR1A 1DK3A 3TS2A 2EDGA 5B5EU 3RR7A 3L4PA 4L5TA 1NOMA 1SL2A 1WJJA 3M1YA 1SXJD 5KFGA 2N49A 1TKDA 3IRUA 4JI5M 1WJ7A 3M0EA 4KJNA 1BCPD 4EQNA 2F1MA 1XU4A 1Y14B 3CQZB 3W0LB 2Y0SB 4Z6EA 3J7AF 2HHVA 2K4KA 3VK8A 4EEKA 2LXEA 3BJYA 1SL1A 2HT1A 1L3SA 2VKQA 1A0IA 4Y7NB 1DOMA 2ZXOA 4OIJA 4X65Q 4JI8L 2X8AA 4NV0A 4QB4A 1SXJE 2XNAC 1GHKA 2O6KA 1SE3A 3NE5B 1U9RA 2KP7A 3PSTA 4IOAA 3QU2A 1VQNA 1JJCB 5J2HA 3HHXA 4XYOA 3BQ1A 5ALIA 4I27A 2WKCA 2BCQA 1HQYE 1TDZA 1Y1WH 3E0JA 4EYHB 4DL7A 1XTCD 4JI8M 4MTKA 1PFBA 2CHQA 2IMWP 1N34L 4BY1B 2JWSA 4I2DA 3GLHA 3BBZA 4FBTA 4YQWA 4R4CA 2HKJA 3VKHA 3UMBA 4ZOHC 1J7KA 1QB5D 3ETRA 3HG9A 5E26A 1HXYD 4K2KA 3THVA 4QHTA 1S9FA 3T5LA 1D1KA 1EYAA 1OJLA 1N36Q 3PF4A 2E2HB 4F1IA 1WD1A 3WK9A 2Z8YM 4I2JA 1VQCA 3RGPA 3GO8A 1Y88A 5K4LA 1L5UA 1NVMA 2PI4A 4ICAA 3G6JB 1U0LA 5KFUA 2JP1A 4DF7A 3O0FA 2BCOA 3KOXE 4OO1J 4DAYA 4DV2M 4KX5A 2RQXA 3RMHA 3E46A 2OEOA 1PH5A 4I8OA 1HJPA 4NLKA 3HOZG 2KXEA 2W7PA 1O80A 2XIWA 2X4AA 1IV8A 2RCFA 1BCPB 1ZQEA 5C44B 5C3EB 3KZXA 3SAWA 3CW2C 2PNRC 3G6YA 2Q2TA 5EWEA 2XWBB 4K4HA 4PZ8A 1AUAA 2F1HA 1NE3A 2EXDA 1VDZA 3U50C 4C4RA 2V4DA 1L7MA 4BBAA 3U5ZA 1KHIA 5DFLA 1IN8A 3W3AA 1QQ6A 4A3FB 1TTEA 3SBJA 5IIKA 3EFXD 7ICMA 1X9SA 4B6JA 5CHGA 2OWOA 1OAOC 4HL4A 4GKJM 1K73C 4PZOA 1A6SA 3MMPA 1ECWA 3M6KA 1IZ6A 4XRHA 2HOQA 1SGGA 3RRHA 3TADA 4UP8A 1XXHB 2R93H 5EJCA 4FS1A 2VB3X 3SHFA 2AKWB 4A93G 1IM4A 1UEBA 7ICSA 1K5OA 4IBKA 5KTQA 3L9AX 2KE7A 1YHQA 1Z19A 1K0SA 4LUOA 3DMUA 4JV5L 5DKWA 1X42A 1F2MA 4LK1C 4YD2A 5HNKA 4DN4M 2FMMA 2ICEC 2J6UA 1IL8A 1D7QA 2VJ5A 5IP7H 2RKSA 4WFN3 3HHZA 4C7ZA 5IIMA 1ZQDA 1SNPA 2P5ZX 5GQOA 1DO2A 4R4QA 4ODGA 3M4OB 2FHTA 1SXDA 3U6DA 3SVMA 3EIVA 3GPXA 2IWHA 5KFAA 1OTRA 3T38A 5J0XA 4Q8FA 4ELUA 4JI4M 3A98B 2NQ8C 3J80E 1TGUA 1EQVA 1KLUD 1C1KA 2HHQA 3D4DA 3KS8A 3GRVA 2IOHA 4KLMA 1K0RA 2ES2A 3S17H 1DONA 2QBYB 2M5ZA 4DV1M 9ICXA 4QJFA 3VR2A 2OXOA 2FMCA 3U6EA 4ECRA 2Y0SC 1OXSC 4G7ZC 1AH9A 3K9PA 1HUNA 4TKOB 3MHBA 1FNNA 3HKZB 2W55A 4F92B 2P66A 3FKEA 4GKJL 1PH4A 4DS4A 1PK3A 4RKUF 8CATA 1VQLA 4DBGB 3AJIB 4LFBM 8ICRA 2DGYA 2JK8A 5M5WH 2X6GA 1ZQQA 4USAA 2ALZA 1L3VA 3IKJA 2DJGC 1I4HA 4NSOB 3HOYB 4RPXA 2EQYA 2NVQB 1GJTA 2M60A 4U7CA 1U4BA 3PY8A 2LS01 4X62Q 2KMDA 4DV2Q 4TQUS 5FKAC 4LF7M 4LJ7A 5J8YA 1YHAA 1KFVA 1HNZM 3KHHA 2EYJA 1TS4A 2EZYA 4IBEA 2G5GX 4PCZA 3J81j 4GXJA 3MGHA 1SKRA 2K47A 3GLFE 3DEOA 4QHSA 3RLFA 3VLFB 3JPRA 3I55A 1K3BC 1CQFA 3AMZA 3NTIA 3LMMA 4KTQA 2F4IA 5G5HA 4C3JG 5E3FA 3OW2A 1V1PB 2MA1A 4QZFA 1HNXM 1XNRL 1J2NA 2VDBB 5LMNQ 4RQ8A 1K83H 4OX9Q 1XNQL 3HW8A 1L8LA 4DFPA 4HTHA 3WDNA 2E1FA 4L8RC 4S3SA 2CV1A 2G09A 1K8MA 3QZ8A 3OOCA 1N8RC 4A3MB 4LZGA 3D2SA 1IBMM 3AU2A 3UQ0A 2AWOA 1E24A 4IRCA 4KD4A 2QCUA 1C7YA 1XNQM 2BPCA 2YB4A 4XQ8A 3KBXA 2K60A 4ME5A 1JIHA 2YQZA 3D0FA 3WU2U 3Q22A 5ELCA 3PSFA 3PW5A 2EYOA 2XY6A 5JJIA 3D4RA 4DV0M 4UQGA 3FE3A 3GV6A 3QO2A 5C4JB 1UWVA 2DWMA 1S5ED 4FYDA 3B89A 3AB9A 8ICFA 2YU9B 4CF3A 3R8FA 1I4QA 2RBMA 3QG1A 2DWQA 3B9PA 1EY6A 4KKUA 1EXNA 4LF9Q 2DBYA 1LT6D 3DEPA 3I2ZA 3T5HA 3ALRA 2EAOA 1ILQA 3MXNA 3ZYYX 3PW0A 1BXTA 4NLBA 3J81c 2JA8H 1MBYA 1EEFD 3FTDA 1SNQA 2HD3A 2RF4A 5CV9A 2F0HA 2Z4IA 3FRHA 1DGSA 2B39A 5JVG3 2E2JB 1HEKA 4QOZC 2RRDA 3QU5A 2DVWB 1NKCA 1FNVA 4G3OA 4REZA 3GQ5A 1L2CA 2QB0B 4FZLA 3C2MA 3AOEA 4B9MA 3TFSA 8ICPA 2KRKA 5C1BA 1CK1A 1NR2A 2PMZE 2WP8J 3BDLA 5G3LD 1DD2A 4JI0M 2K01A 3PIO3 4US8A 1G71A 1N56A 2FJ2A 2L0CA 1JB0F 1EU3A 3NVWA 3IECA 4UBCA 4IR1A 1ZXTA 3PXGA 3A7AB 4MIUA 1JOQA 1T43A 3J2PB 4N9PA 3CYMA 5DDMA 1X55A 2QLTA 4IBIA 1XC9A 1VF7A 1ZMUA 2K1BA 5C4XH 4IFDG 4UASA 1GL7A 4HJ8A 5KFKA 1Q90A 4OWWB 1T3NA 1B8AA 1B43A 1LTRD 1OIZA 3PMLA 2EIFA 1XS9D 3OMGA 4DKAC 4DL3A 2Y0SG 3GV3A 4JI7L 4Q7JA 4ITQA 2ZT9C 5FTLA 5HGTA 3OIQA 5AKKA 2F0WA 3BS7A 1N61A 3UDFA 2MROB 1IG6A 3QUBA 1EQRA 1TY2A 3AQQA 3MGVA 4KY6A 1D0LA 1JICA 4EENA 3PX4A 3MAQA 3S6JA 2F03A