1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
3LWLA 1DGSA 3CCLA 2KHHA 5L1KA 1NTGA 3HPOA 2AWNA 1P8LA 3I7FA 1SL1A 2V1CC 1JXLA 1OXVA 1B22A 4NLKA 4RZRA 2BGWA 4TQRA 4L5SA 2QA4A 4DV6L 1ZQRA 2LVOC 1BBWA 2K5NA 4PZ6A 5CHGA 3UDFA 5IP7G 4A3EH 3TQ1A 1N56A 1ZQQA 4B3RL 4KHPL 3JPOA 1CSQA 2BH2A 1IBKL 5J0PA 2ZJRA 3A0JA 2QHOB 4A3EG 3JAMc 3K4GA 2JK8A 3PY8A 2ZJ8A 2PQAA 3NTUA 2XCAA 4F5RA 2VNUD 1NJYA 4QWCA 1EQQA 5LMUQ 5BOLA 3MGHA 1WCLA 5J2KA 4HJAA 1EIYB 3Q8LA 5GAGC 2IY5B 8ICNA 4WP2A 5KFBA 5J0OA 1Q1BA 5J2AA 4F1IA 4KTQA 1RXVA 5KG4A 2VQFL 2OTJA 3M9BA 4DLGA 2PFPA 3A5UA 4XA5A 1OXXK 1YNXA 3S15H 3KHRA 1JIHA 4XUSA 1RYRA 4YCUA 5IIKA 7ICLA 2JA6H 3KFUA 1CKOA 3PV0A 4Q45A 3GDXA 3AUOA 3I4OA 1XU4A 1FL0A 4HIMA 3K75D 5KG6A 2MFIA 4UAWA 1MKHA 4KN4A 2LXJA 2NVYH 2F1HA 3HOVH 4DR6L 2AGQA 4IOCA 1DO2A 1NJXA 4B9UA 4LF6Q 1ZQVA 1N32Q 4LF8Q 3T5LA 4YMNA 2JEAI 2KNZA 1L3VA 5KFWA 5CWRA 4QY7A 5DLQE 4BXXG 4DUYL 2UUCQ 3BZCA 4GOPB 2JEGA 4NM2A 4HEOA 4IR9A 2ID0A 2UVRA 1NK0A 3CAMA 2DNAA 2YU9H 9ICNA 4LF5L 4K0KL 4KN7A 1XO1A 2HHVA 3RJEA 1NMFA 4R1JA 2R7FA 4J15A 2ES2A 8ICYA 2HQLA 4LF4L 1X3GA 2C2DA 4DOAA 4NXZA 3K9OA 4RQ1A 5KFKA 1T7PA 3VDYA 4LFCQ 3GTQH 4QZEA 3C5FA 5IYBH 2FPLA 4JI3Q 2XO7A 2PNHA 4F8RA 4P2HA 1PZNA 2OO9A 2VUMG 3F2CA 2UXBQ 4OONA 1T4GA 2BCQA 3OYYA 4YP3A 4M9LA 4JI5L 2IMWP 5K36G 5IYDG 5LMNL 3GTJH 2HHHQ 4PHPA 4LZGA 4NXML 1S0MA 3RAQA 4PGQA 4KMUA 3D31A 1XMQL 3V7LA 2UU9L 2K5VA 4DFKA 4NM1A 1QSSA 3I2ZA 1Q02A 2AKWB 2LVAA 2HHTA 3S1NH 2K0BX 5KFGA 4B3TQ 1VQHA 1T3NA 2UXDQ 2JA7G 3B89A 2AU0A 4GLAC 1X65A 4HJ7A 2MJ5B 4B3MQ 3J80i 1K9MC 4C8MA 1KRTA 1MQ3A 2AWOA 4GKJQ 4LUOA 1E7ZA 3T3FA 4EYIB 2XY6A 2NN6I 4UN2B 2PFNA 1YJWA 5DLGA 5J2FA 2JA8G 3KDFB 4NPSA 2O25A 2F4VQ 4DL6A 5DGBA 1SL0A 4BBRH 2IHMA 3JPRA 4LW1A 1RIPA 4J9RA 1HNWQ 4JI8Q 2NVTH 2BA1A 3PUYA 3CCUA 1A0IA 4ECQA 2ZJQA 4DEZA 4B9SA 4RNOA 2F1IA 2AQ0A 4ECRA 1VQ5A 1XNQL 3PMNA 1X3EA 4DR2L 3OGUA 3FRHA 2JZ1A 8ICOA 8ICBA 4NLNA 1R4GA 1ZQXA 3PUXA 3PF4A 1WCNA 2Q2HA 2G3QA 4HJ9A 3OTOQ 3RJIA 2BDPA 4B3RQ 4KHPQ 3M8SA 3CD6A 1EXNA 2RDIA 4NLGA 1HNZQ 5KFMA 4UBCA 5GADC 5KFZA 4KI0A 2BA0A 3RB6A 1K0RA 1AIPC 3GIIA 1U45A 3RJFA 3Q8SB 5GROA 3TFRA 3HP6A 4B3ML 2CCZA 1F4IA 4IQTA 8ICFA 3QEBZ 3PMLA 2JEIA 4KLKA 1NKEA 2NZOA 2A1JA 2BPGA 4ECZA 1T6OA 3KLWA 4YHHQ 4RQ2A 2KHJA 7ICPA 3PO3H 1DOQA 2B29A 5DB6A 1V92A 1S76D 1NOMA 1O7IA 4BA2I 2AMCB 3FHWA 3U4VA 3BDPA 1E1TA 4JI8L 9ICJA 5EOZA 5IIIA 4IPHA 4A3BH 9ICTA 1H95A 1I5FA 4Q8EA 4BXOB 3UQ0A 3ZDDA 4OX9Q 5KG1A 3CQZH 1BKBA 3CF5A 4QZHA 1IZ6A 4B9TA 3U4ZA 1NK6A 4J9OA 4X62L 5J0QA 3H15A 4OWXB 4JV5L 1XSPA 1N34L 4JI7Q 9ICHA 4LF7Q 3ZD8A 4RNNA 4IPDA 5DKWA 3AQQA 3KDFA 1DO0A 1D8LA 1WGNA 3U50C 4KLGA 3S17H 4DO9A 4BGDA 1QTMA 4YG2A 2DKLA 1SL2A 1ZQTA 1A63A 2C2RA 1SN8A 2P6UA 4RT3A 3UE1A 7ICRA 5DB9A 3MR2A 8ICAA 4LFAQ 1VQAA 1GD7A 4EBEA 5HNKA 2I0QA 1JR3E 5CA7A 4ECWA 2MUTA 4JI2Q 4A3MG 1MJEA 4NLZA 3UQ2A 3OSPA 1Z9FA 2JA6G 4A3DG 2EKKA 2PFQA 5KFYA 2KFNA 2MO0A 3NEMA 1JMSA 5KG0A 1VQPA 4GC6A 5E7NA 1CKNB 4YD2A 3K81C 2BPFA 4POFA 4I2HA 4JYAQ 4GOPA 4RPYA 2VQEQ 2ATWA 8ICXA 2ZM6L 1VQ4A 4L5RC 4GN5A 1K8AC 1U4BA 1U0LA 2E2JH 2KN7A 4RMFA 5J0XA 4DKAC 4DR5L 5DB7A 2J6TA 2HHWA 1N34Q 4JI7L 1ZQIA 4LF7L 5J2CA 1NK9A 5D46A 2Q2IA 4ED7A 4O5KA 3UPQA 3IM1A 5DG7A 1PH9A 3T1HQ 4UB4A 4QZ8A 1SRUA 5C44G 2RRUA 4A3JH 2R93G 2N8NA 1YITA 5IINA 2LYHA 1D9FA 5L1LA 3PUVA 5IYBG 1HR0Q 1B43A 2HIXA 1TK5A 3GLFE 4GNXA 3HOYG 1NK7A 4QGUA 3TS0A 1NV8A 2KBNA 3C5GA 2VW9A 3RZDH 2PQAB 2RDJA 2L4EA 1KEJA 2UUAQ 4A3CH 5D49A 1N32L 3OSNA 4O3QA 2V4RA 4M04A 4MTNA 4DR7L 1S0OA 1VQJA 2R8GA 2JEJA 8ICQA 1R9TH 5F9LA 2BWEA 1VQCA 3OTOL 2B3GA 2OCEA 1Q12A 1CEZA 4RUCA 1X9SA 2Q2TA 5H1SE 5KFJA 2I5LX 5KFVA 2JE6I 1WCMH 3EW9A 4B9MA 4DOCA 3L7ZC 3GTLH 3UDXA 3H3VI 4B3SQ 1OXTA 3F8TA 4R71A 4CCHA 3HOZH 2UVUA 1WJ7A 2OTLA 1Q82C 3BU2A 2K14A 1RXWA 1UE7A 4LWCA 1ASYA 5FJ8H 1ZV1A 4LFBL 1S77D 4O3SA 1WIVA 4DK6C 3PVXA 2OQKA 1YJNA 5KFRA 2E2IH 2HHSA 2UUCL 1XSLA 3MGIA 1X9NA 1U9LA 4DPGA 2EJSA 5EWFA 4MFAA 1IFYA 1YHBA 3S1QH 5C0XG 3GTOH 4YWLA 3FP9A 4I2IA 1K1QA 2GVAA 5KFOA 3UXOA 1ZETA 2W8KA 2ASBA 2Q0ZX 3PX0A 3ZDCA 1UE5A 2W9CB 4YCXA 5JEAJ 2UUAL 5KT6A 3C1YA 4F4KA 2PFOA 3GV5B 5BR8Q 3TS2A 2R0IA 1TWGH 4QW8A 2JY7A 2AQ4A 7ICTA 3PIOA 2JNHA 3J7A5 4JWMA 3Q8RB 1E1OA 5HMLA 5J2BA 1EIFA 4KLEA 1MQ2A 3BQ2A 9ICUA 3KF6A 1KLNA 1VQ7A 4MEXA 4JI6Q 5DBBA 1X55A 4JI5Q 4DNIA 4M9JA 4MNOA 1OQYA 4J9SA 5IYCH 4A3IG 4DF4A 2MO1A 3Q8KA 5JJKA 3C1ZA 2K4KA 5IILA 4LFBQ 8ICRA 2VUMH 1Q46A 1HNXL 4JBJA 4RU9A 4IQVA 1LYLA 1K3RA 2PI2E 4YXJA 2PXIA 5CJ7A 3CP0A 4ELVA 1G3IA 2HHXA 5KFSA 1BPBA 1L5UA 9ICPA 2R92H 1MC8A 4A3KG 3ULJA 5EAYA 3U58A 5J2DA 2C2EA 2D62A 5J2IA 4P4MA 2JJQA 5DQGA 4LNQA 1ASZA 4EQ5A 3HOYH 4I27A 2RCNA 4Q44A 4MFCA 1YBYA 1XPRA 4R4CA 2HW3A 3GLGE 4ECVA 4POGA 4QZCA 3C21A 4MF8A 3A74A 5CP2A 9ICSA 5EWEA 3G6XA 3RZOH 4A3IH 4JBMA 5C4XH 2W8LA 4IQUA 2XC9A 1SMXA 5AJ3L 1COOA 4OXPA 1UT8A 1UA0A 4UBBA 1WFQA 2JUJA 4Z6EA 2WB1G 4O3OA 5D4BA 1U47A 2PI4A 1PH2A 4YY3L 4K4IA 1IBLQ 4ZH4A 3B0YA 1X56A 1TFRA 3S2HH 3J81c 2CWBA 4R63A 1VQMA 5J0WA 1TAQA 5EWGA 2KZ3A 4BY1H 3UXPA 7ICMA 3MFHA 3PO3G 2ASLA 1G291 2R8KA 2AHOB 1JXEA 1TAUA 2F52A 1J5EL 4BWJA 3BZKA 4I2CA 1WHCA 5IP9H 4YD1A 1BPDA 4QZBA 1TWFH 1VQLA 2DFLA 1BPEA 4PGXA 3JPTA 4BA1I 2K9DA 4IOAA 1ZQNA 1NY4A 1Q1EA 1N8RC 3PX6A 1QVCA 4J9PA 3CXCA 1HZ9A 2H5XA 2KCTA 1XWLA 4YHHL 2JEFA 4C2MH 4B9NA 1HQYE 4QWDA 4NXNL 1QZEA 4F5NA 4ELUA 4KLDA 5KT5A 3IHQB 3JPQA 1V9PA 1C0AA 2IX1A 2V4QA 4Y7NH 1G41A 4GC7A 4A4IA 1S97A 1G51A 2BH8A 4DSEA 5LMNW 1SG9A 1S0NA 5M3MG 1NJZA 1LM0A 2BCUA 4GLXA 4JWNA 2JA5H 2B21A 3HT3A 5FLXc 3CPFA 1VQNA 2ZTCA 4NB3A 4PGYA 3PO4A 9ICIA 4JBKA 5F9NA 4J9LA 5J2JA 4EBCA 5L1IA 4R64A 1KDHA 3E9IA 4WJ3M 2B3TA 2KZMA 1KD1C 3TARA 2RHQB 1H38A 5L9XA 3I4MG 4KLSA 3C2LA 2W9AA 4X64L 1D7QA 1IM4A 4IJLA 3RH4A 4EEYA 1Y1VG 4AQYL 3T6PA 5GQOA 3DM3A 5J0RA 2PMZE 4DV1L 1L3SA 1ZJMA 4KLUA 3G6YA 4OO1G 4K4HA 2E5LL 1JMCA 5BR8L 3UDGA 3GFKB 3PCOB 3MBYA 4LFAL 8ICPA 2OOBA 4X66L 4LVSA 2FMPA 2NRZA 4Z6CA 4Q7JA 1EWIA 4F4XA 1MN3A 1UE6A 3UXNA 1XJVA 4LF5Q 5GAEC 5C44H 4JV0A 2YTVA 3RH5A 4P74A 4TQUS 1VQ1A 4JUZA 7ICUA 3MR3A 5J0TA 2W9CA 3HKSA 4R66A 1L1OC 2FMQA 1Y1WG 1TR8A 4EZ6A 4DS5A 2E2HH 4O0IA 2ISOA 1N48A 3S16H 2VA2A 5C4XG 2WAQG 4M9GA 1KAWA 4DL7A 4LF6L 5KFNA 1B8AA 3S1RH 4DAMA 2WZJA 2D0PA 4YR2A 3B6YA 3BJUA 1TVAA 3KYHC 5DG8A 1GKHA 4A76A 3HOWG 3CW2C 4I28A 4C3JH 3HOUG 4QW9A 4QQBX 3E9HA 4ECSA 3SZ2A 1OXSC 3HOVG 3H8SA 1PA6A 4I2DA 1FGUA 4DL3A 2LVPC 5KFEA 1ZQFA 5FLMG 4A3MH 2JZBA 2N3SA 2YV5A 4L5TA 4YCWA 4KITB 3T5KA 2QNJA 1D9DA 3TI0A 1UFZA 1TXYA 1PH7A 1Y14B 5IIJA 2CP8A 2LSSA 5KG2A 4YN4A 5DB8A 2DPJA 4UAZA 3ER0A 1X2IA 2ZJPA 7ICGA 4FS1A 3AU2A 2MAXA 5IWAL 1VCIA 4P73A 1T9HA 2VQFQ 4JI1Q 4DV6Q 1VQEA 1IBML 2JY5A 3C2KA 1NKBA 3NENA 3E0EA 1BPXA 5IYDH 4RQ7A 1Q81C 5DGAA 3EN2A 3ULPA 1ZQZA 5KFLA 4A3BG 2R8HA 2QSFX 4F2SA 4YWMA 4B3TL 4LZDA 3AU6A 4QZIA 5M3FH 2UXCQ 4RPZA 4HIDA 4IRDA 3CC7A 3OW2A 4IPGA 2QEXA 1K8GA 1ZQKA 1ZQEA 3CPWA 3RNUA 4GKJL 1TKDA 2KHIA 2A1AA 4OWWB 3I4NH 5HHIA 4JI0Q 4A3DH 2GVBA 4BBSH 4F4WA 8ICCA 4MFFA 4DV5L 8ICVA 3SV4A 1JT8A 1HNWL 3RJGA 4JC0A 3BJYA 2R7DA 4DL5A 1WJJA 3ZDBA 4C3HH 3N4MB 4YXMA 8ICIA 3JC66 4A3GG 1GM5A 1WGLA 4ECXA 4DR6Q 5DDMA 5DG9A 1SZPA 5IIMA 1PGYA 2FLNA 4HJ8A 5DQHA 3GILA 2CWPA 3H7IA 4JI1L 3RB4A 5C3EH 4J9MA 4NY8A 1PH3A 9ICWA 3PW0A 3JAMi 4LF9Q 2A19A 1YJ9A 3TAPA 2C28A 4GKKL 4DUZQ 4F4ZA 7ICVA 4PZ8A 4JI4L 2EXDA 3NBHB 2JP7A 4BY7G 1QSLA 3GLHE 3ISDA 1A8VA 1PH4A 3L0OA 1YI2A 1HT2E 1TWCH 7ICHA 3JPPA 1ZMUA 4JV5Q 1S9FA 4DSJA 3HX0A 5J0UA 4DFPA 5BPCA 3E2EA 3KOJA 2FMSA 4A3FG 1YEZA 2CKZB 2AGOA 1G6PA 1ZQCA 3HKZE 4DL2A 2CWAA 4DV2Q 4I2JA 4X65L 1Z00A 1N33Q 3ISBA 2KFZA 1C9OA 5LMNQ 1XMOQ 2WB1E 2B63G 4GXKA 2I9GA 1L3TA 3M9NB 3PV8A 3AFQA 1RZTA 4UP7A 3PO2G 3GO5A 1UT5A 2L2DA 9ICGA 1J5EQ 1ZQLA 2IBKA 2R8JA 2ZUBA 4X62Q 4QWAA 3RJKA 1MIUA 5CB1A 4RNMA 5AJ3Q 2XGTA 7ICEA 4PHAA 9ICAA 4JV2A 3T1YQ 1SR3A 5KG5A 4YY3Q 4DUZL 1QZHA 1U48A 3S2DH 3RLFA 4A93G 1VG5A 2ZM6Q 1VQIA 3HWTA 4EX5A 1JB7A 1Y88A 2E8GA 2BHNA 2GN5A 2IHFA 3RN2A 1HNZL 5J29A 1IXSA 1X6OA 3M3YH 1BPYA 4BY7H 3E46A 4DSKA 3W5OA 1JJGA 4UP8A 4OO1I 4A3LH 3GV8B 4QJFA 5KT3A 1QZGA 2JA5G 4RG1A 3BQ1A 8ICGA 1XNQQ 4DR2Q 4DV3Q 3KJOA 4F2RA 1PH6A 1T8EA 3RLNA 1VEGA 3SI8A 3PUWA 2UVWA 2XGPA 3RB0A 1XPOA 2PI5A 2KENA 4AIMA 1Z47A 5J3BA 1VEKA 4DFJA 4GN4B 1A5TA 5KFPA 4C8KA 4IRCA 4DR5Q 4RQ8A 2BR0A 4IFDG 1BPZA 4JV1A 3NELA 4HJ5A 8ICKA 1YIJA 2PI2A 4DR7Q 2UXCL 2VY3A 1EFUB 2CQOA 4RQ4A 1VQ9A 2A8VA 1NBWA 1X9MA 4DSIA 3RJHA 4X66Q 1BVSA 5DFLA 4GS3A 3RBEA 2Y0SG 5KFFA 3MXNB 1ZQSA 4Q43A 3M85A 1KC8C 2JY6B 1S0VA 2ALYB 3MABA 3LDAA 1PVOA 2HIVA 4GN3B 4YQWA 4FO6A 8ICJA 3EPGA 3M4OH 3CCSA 4K4GA 1WOCA 1A77A 1EQRA 3OJSA 2Z0SA 1SFOH 3RR8A 3HOZG 4AQYQ 2D0OA 1DV0A 2UUBQ 5KT2A 1HUZA 4DQSA 4ELTA 5C4JH 3ULLA 1ZQJA 4I2AA 1WYDA 3K7UC 4DL4A 4DV3L 1VQKA 1KFSA 1NJWA 2HWJA 5KG7A 4F5OA 2ASJA 4I29A 1HT1E 2XY7A 1GO5A 5DBCA 4R65A 3EIVA 1KL9A 1HZCA 4IQWA 3PX4A 2MUTB 4R4OA 3H0GH 3K0XA 1HZAA 1NJIC 3MMPA 1YHAA 1A62A 3CCMA 1EYGA 3E21A 1VQ6A 4UAYA 2MGWA 1OAIA 3Q8PB 2XGQA 3GTPH 3I56A 3QE9Y 2HVHA 3PW7A 1CKMA 3PNCA 3F1ZA 3FDSA 1TWHH 5IY0A 3HOWH 4DV7L 2P66A 2BPCA 4A3CG 3ZDEA 3T5JA 3EZ5A 3EYZA 2GWSA 3G48A 1KTQA 3V7KA 4C8LA 5IYCG 1CSPA 4DR3Q 5IWAQ 1FJGQ 5TZVA 4UY8C 1N33L 3G4SA 1I3QH 4ED0A 1XMOL 2FXQA 8ICZA 3GTMH 3TREA 3GTGH 4F5QA 1HZBA 1B7YB 4P4OA 1IXRA 1VS0A 5HHHA 4DR1L 4Q8FA 3ZDAA 2DZLA 2FLPA 2MNAA 3PW4A 1XC9A 4PG3A 1ZQGA 4YFKA 5KFHA 5KG3A 1PH1A 4P71A 2KNAA 3PGZA 1Y1WH 2HAKA 2Y1JA 3GV7B 2VA3A 4MF2A 4QZ9A 5IP9G 3RB3A 4BWMA 3ZD9A 4BDPA 5DBAA 3TANA 4ECTA 2BCRA 8ICWA 4XTCS 4GLVB 3KHLA 1TK0A 2KNVA 2JA9A 1NV9A 2ZJ5A 2OQ0A 4DOBA 3SYZA 3I4MH 3N97B 3H4DA 3HOXH 2KTQA 1ZQUA 1FVIA 4Z6DA 5HMMA 1HNXQ 3S24A 5KTQA 1PH5A 3CC2A 1HR0W 3STBC 1UEBA 2I5MX 2NZHA 4DS4A 1Y1VH 1KIXA 5KFIA 5M5WH 4O3RA 1IBLL 3WWVA 2UXBL 4GXJA 4ED6A 3TFSA 4UB1A 4LUVA 2CFMA 3LCUA 1TWAH 5C3EG 4A3FH 2IT1A 4TUSA 4J9QA 5M5YH 4I2GA 2L4FA 3PR5B 5IIOA 4P72A 1SKWA 2BQRA 2NN6G 1XMQQ 4DV0Q 4BXXH 4IFDJ 4YR3A 2FPKA 4JI0L 2DUDA 4LF9L 4JOIC 1IBKQ 8ICLA 1TV9A 2YTXA 4A3GH 1EUJA 4GKKQ 4DQRA 4G3OA 4QZDA 3CMAA 4KLIA 2R92G 1I94Q 2WFWA 1ZQWA 1L1OB 2WP8J 5HP4A 7ICKA 5KT7A 3V6JA 2ZTDA 4PH5A 4QZAA 2ATLA 1ZYQA 3LGJA 1E94E 1ZQAA 4IO9A 1RPLA 4F93B 1GVPA 3V6KA 4LUZA 1QUQB 1UA1A 3PSIA 4A3KH 2DAMA 3HOUH 4ED8A 2NRWA 4I2EA 1X54A 4TVAB 5C0XI 5JI2E 3FKIG 1HJPA 4UB2A 4LF4Q 4DSFA 4XIGS 1BGXT 4ALPA 4RPXA 3RRGA 4X5VA 1T43A 7ICJA 1Y8GA 4EBDA 2IHEA 4LFCL 2BKEA 9ICRA 1NK8A 4JI3L 3K7AH 2EIFA 2C22A 4P75A 4DLEA 3I4NG 4O0AA 4DUYQ 2N78A 4PMWA 1EFWA 1M1KC 1ZQYA 3BBZA 4NXNQ 4X64Q 1ZJNA 2ASDA 1G4AE 4P4PA 2NRVA 3S14H 1TTEA 3FYHA 3H3VH 2DAKA 5J2GA 5ELNA 1I94L 3C2MA 3GIMA 4OWTB 3QZ7A 4QZGA 3AYHB 1SKSA 4OX9L 3Q8QB 4BXOA 2KZZA 2R7ZG 1PYSB 3J81i 4B9LA 2JEBI 4R8UA 3H4JA 1L2FA 1SLJA 3RBDA 2K75A 2C35B 2IA6A 2BCVA 4EYHB 3K8AA 5IT9c 2JA8H 4DWIA 4M6WA 3GIKA 4KLQA 3STBD 1V1QA 3RR5A 4QWBA 1S10A 4O9MA 1NKCA 4B9VA 4R4IA 5DDYA 1NE3A 1IL2A 3THVA 4M2YA 1C7YA 1X9WA 4TUQA 3HKZG 3PIPA 4JG2A 4KHZA 1RYSA 1S40A 1KSPA 5M3MH 2YTYA 3ISCA 1U5KA 1WI5A 2R93H 2ZTEA 3EPIA 2F4VL 3CCEA 2HT1A 4IFDI 3GIJA 4ECYA 2MQHA 2L15A 4RQ0A 4AYBG 5KFXA 2WAQE 4YR0A 2M9NA 1ZQHA 1ZMWA 2DPIA 2ZUDA 3J7ZC 2MROB 3PW5A 4ED2A 1PHJA 1ZMVA 1VQOA 1LTLA 3RR7A 4YCVA 1K1SA 5J2HA 2WTFA 1KXLA 1UWVA 4PZ7A 4F5PA 5J0YA 4EZ9A 4TURA 4RQ5A 2EQSA 4RQ3A 1Q7YC 4KLJA 2R8IA 1XPUA 3DLLA 1VQ8A 1XS9D 2P6RA 1J6QA 2R7ZH 3OHAA 9ICVA 1E24A 1K73C 3KF6B 1XSNA 2VS1A 3I55A 4DV4L 1E3PA 2NRXA 2K52A 4ED3A 2UUBL 4E0DA 1SE8A 1SROA 3CCVA 1M90C 1Z00B 4YMMA 3UDIA 3M4QA 3MDCA 1YVCA 4DV0L 7ICFA 5KT4A 1AE2A 2JQOA 2VQEL 4GEWA 2OWOA 3JPSA 1AE3A 3KTQA 3ZJYC 4F92B 1HUOA 3ETLA 2ZUCA 1L0WA 3ERSX 1JJ2A 5J0SA 2E5LQ 4O2DA 2VA8A 3TRZA 3RAXA 7ICIA 3HFZB 4L5QA 1VDLA 4RQ6A 3V6HA 1S3OA 4UP9A 4R4QA 3HOXG 3H4BA 2XTIA 2F1JA 1JN3A 1IBMQ 2ISPA 4YWKA 2BWBA 2Y0SE 4B3SL 1P16A 3LCVB 4DR3L 3C23A 1XNRL 5IE8A 4JK1A 4QWEA 2ALZA 4TUPA 1QLNA 2AGPA 3FRIA 2NVXH 5KFDA 4C8NA 3NGDA 3M8RA 1QUQA 1E22A 3TQYA 4GOPC 1JJCB 3IHPA 1I6HH 4DR1Q 4Y52H 3W1GA 4DF8A 1CUKA 5KFTA 5DLFA 4AH6A 3GTKH 3SGIA 8ICMA 3CC4A 4IR1A 4M0AA 1TK8A 2F3IA 1YLAA 4M47A 8ICSA 4DFMA 4G3IA 4YMOA 1UE1A 1ZQDA 3OHBA 4KLLA 3V7JA 4X6AH 3K9PA 4I2FA 1PYBA 4PPXA 1IM2A 1GO3E 1FJGL 4JI4Q 4DSLA 4GNXB 2NVQH 1KRPA 1W3SA 4UB3A 4DQIA 2EKFA 5LMUL 3PUZA 4LF8L 4FBUA 4JOIA 3A5ZB 1S72A 4QIWE 3H40A 3Q8MA 3IRBA 2Z6KA 1CKNA 5L1JA 1XTDA 4JI2L 1VQBA 7ICOA 2DENA 4K0KQ 3ORYA 3FE3A 4KLHA 2DHYA 3MFIA 1NK5A 1YHQA 9ICMA 3T1HL 4DV2L 1XXHE 2JZBB 3RRHA 9ICEA 3CCRA 4APVA 2OOAA 3KHGA 3M9MB 1OKSA 5KFAA 1XNRQ 1LV5A 2B63H 4YVZA 3AEVA 3MEFA 9ICCA 2W9BB 1OXUA 1IYJB 4ME3A 1Z3EB 4JYAL 3RLOA 1HR0L 4KLOA 1JE5A 3H8WA 3CCJA 3TEHB 4UQGA 4FS2A 1VQGA 2BQUA 4Z6FA 2VZAA 2Q2UA 2AJQA 3LWMA 3KHHA 1WCMG 3OJUA 2W9MA 3AFPA 3L2PA 3RH6A 4DAYB 1AH9A 3RTVA 3GDEA 4PHEA 3CCQA 1OTCA 7ICSA 2LVQD 2Y1IA 4UPAA 3EBEA 4HIOA 3H0GG 4A93H 5KFQA 2MR9A 3J81j 1LUZA 4IRKA 3PR4A 4DR4Q 5M5XH 5DQIA 2N49A 2DI0A 4DK3C 2K50A 4H02A 1KFDA 2UXDL 2BQ3A 3MR6A 1KHIA 1L3UA 4F3OA 2LXKA 1VEJA 4ECUA 3M7NA 2LTUA 2J6UA 3T5HA 4DQPA 5M3FG 4IJHA 4TQSA 4C8OA 1YZ6A 9ICFA 5ELOA 3LK9A 2IHNA 1JX4A 1VQFA 3PW2A 3RN5A 5J2EA 4DBGB 4O5CA 1K83H 3M9OB 1ZQBA 2LVNC 3PO2H 5GAHC 4F91B 1D8YA 4NXMQ 4JCVE 4F50A 2FLLA 3F2DA 4BBSG 4M9NA 1Q8KA 5IP7H 3PO5A 1BBUA 1PV4A 4DV5Q 5JJLA 1KFTA 3IECA 3SV3A 9ICOA 5KFUA 1QSYA 4KLMA 1MJCA 2XCPA 3KJPA 2I1QA 4XQ8A 1OTRA 1MSWD 3HW8A 2BCSA 4M9HA 4J9NA 7ICNA 2LBCA 1LB2B 2IX0A 2HHQA 9ICXA 5BOMA 1ZQPA 4BBRG 3F92A 4UB5A 4X65Q 4A75A 3QEAZ 3D0FA 4C3IH 4RT2A 2Z6KC 8ICHA 2XY5A 4WJ4A 4MZ9A 1Q86C 2RHSB 4QZFA 2A1JB 2HHUA 4M6WB 1W2BA 2K5HA 4ED1A 1PFSA 2V9WA 3G71A 4R8UB 3RJJA 2VANA 4A3LG 3K80C 1P3QQ 2YYZA 2DGYA 5HY6A 3ICEA 4A3JG 8ICEA 4GNXC 3V72A 1I50H 1WR1B 2JZ0A 1NMGA 1XB2B 1X3FA 1PH8A 4QL5A 3PF5A 3TAQA 3T1YL 3H8JA 3KF8B 8ICUA 2R6GA 2JA7H 2NRTA 1ZQMA 4RUAA 2FPMA 5KFCA 4JI6L 4IPCA 4MEYA 3MDAA 1KYIA 1L1OA 4HIKA 4DQQA 3BQ0A 4F2LA 8ICTA 3S1MH 4DV7Q 4O5EA 1N36L 4F4YA 4BY1G 3BQTA 3UE0A 5JJIA 9ICQA 2JY8A 2VL6A 3J80c 2DAGA 3Q8DA 3B0XA 3M4PA 3MR5A 2J6SA 1SKRA 5C5JA 3F2BA 4O3NA 1B70B 2HVIA 4JBWA 1ZQOA 2RF4A 7ICQA 3EWAA 5HGQA 2HHHL 2W9BA 3JPNA 3GQCA 1NK4A 5FJ8G 2QGQA 1KQSA 5JEAG 4DV1Q 4J9KA 2UU9Q 4R4TA 2ZJAA 9ICKA 1EOVA 3G6EA 9ICLA 1N9WA 1HH2P 5C0XJ 4FBTA 3QZ8A 3FKIH 1A76A 3GLIE 2DAEA 3GD7A 4DV4Q 4AYBE 4GXIA 4KLTA 4O3PA 5JUMA 4I2BA 1VQDA 3CMEA 1AROP 3G6VA 4FDBA 2I5HA 9ICBA 1QVFA 2UVVA 5CR0A 2KCMA 5FLMH 1KRSA 1V43A 4DR4L 1U49A 4XRHA 1RL2A 4HYKA 2DAIA 4KLFA 1QVGA 3W1BA 1N36Q 4PHDA
chains in the Genus database with same CATH superfamily
3HHXA 4II7A 1DGSA 4PZOA 3LWLA 3CCLA 4C3JG 2DBYA 2KHHA 4LGMA 5L1KA 3LWUA 4HEDA 1NTGA 1ENFA 1Q3VA 3HPOA 2AWNA 2X6LA 5E4WC 1P8LA 2KEBA 2KIVA 3I7FA 1SL1A 1F5SA 2V1CC 3HGBA 1JXLA 1J5EM 1OXVA 1B22A 4NLKA 4RZRA 3QU5A 2BGWA 4TQRA 1QJOA 3HOZB 3PXGA 4L5SA 2KSOB 2QA4A 4DV6L 1JROA 1ZQRA 1BCPB 3U61B 1GOZA 2LVOC 4ID6A 1BBWA 2K5NA 4PZ6A 5CHGA 3UDFA 5IP7G 4A3EH 1Z4OA 3TQ1A 2F5PA 2YMLA 1N56A 4LCBA 4C7ZA 4JMUA 1ZQQA 3A8JE 4BY1B 4B3RL 4KHPL 3JPOA 4IUUA 1CSQA 2BH2A 3HS0C 3U61A 1L2DA 5J0PA 1PTOD 3H0GB 4RGMA 5IWAM 1XWEA 4CKBA 1ZEQX 3A0JA 2ZJRA 2JH1A 4BB9A 2Z3XA 5M5WB 2EYOA 2QHOB 1BNOA 2Y9TA 4A3EG 3JAMc 3K4GA 2JK8A 3PY8A 1DXSA 1BO0A 2ZJ8A 2ZG6A 2R46A 2YMQA 4WJ3B 2PQAA 3NTUA 2XCAA 4F5RA 2VNUD 4UAVA 1NJYA 4QWCA 2F0IA 4HCSA 1EQQA 2HKJA 5BPVA 2UXDM 1MHWC 3I76A 5LMUQ 5BOLA 3MGHA 1WCLA 1V85A 5J2KA 1ET6A 2EE1A 4HJAA 1EIYB 3GTKB 3C28A 1H6UA 3Q8LA 3KLRA 2BCOA 5GAGC 3I04M 2IY5B 4RCNA 1ONLA 2HOFA 5GTIU 4WP2A 5KFBA 5J0OA 3N28A 8ICNA 1Q1BA 5AI0A 3NWTA 5J2AA 3IDWA 3KBGA 5ALEA 4F1IA 4KTQA 1RXVA 3NBXX 5KG4A 1LT4D 1HNWM 2VQFL 5EP3A 1RM6C 2OTJA 3SAUA 3M9BA 5C4ZA 1IKLA 4DLGA 4UHVA 2PFPA 4O3MA 3A5UA 4D82A 4MM3B 4XA5A 1S5BD 2HOQA 4DFDA 1OXXK 3ZI4A 1SXJC 2OXPA 1YNXA 2JXMB 1JUDA 1WTQA 3KOOA 3S15H 2E2IB 1QQWA 1JIHA 4LFCM 4XUSA 3KHRA 1RYRA 3NQTA 4YCUA 5IIKA 7ICLA 2JA6H 3KFUA 1CKOA 3PV0A 4Q45A 3GDXA 3AUOA 1QNKA 3I4OA 2WF6A 1XU4A 1FL0A 5EJCA 3C3LA 4HIMA 3K75D 1QZMA 1BXTA 5KG6A 1R6BX 2MFIA 4F88A 2FINB 1NNXA 4UAWA 3QUQA 2EQYA 1MKHA 4KN4A 5EXXA 5KNIA 2LXJA 2NVYH 2F1HA 1CA5A 3HOVH 4DR6L 2AGQA 4IOCA 1D5MC 1DO2A 1NJXA 1S40A 4B9UA 4MB7A 4LF6Q 2EO2A 1ZQVA 1J2NA 4LF8Q 2CV2A 3T5LA 4YMNA 3GRRA 2AQ3B 2EY2A 2TSSA 3BVGA 2Z8YM 2JEAI 4M0WA 4L8RC 2KNZA 4N8FA 4RKBA 3JAML 5C5LA 4LJ9A 1L3VA 5KFWA 5CWRA 4QY7A 5DLQE 5ALGA 2JA6B 4IUQA 5FP0A 4DUYL 2UUCQ 3BZCA 4GOPB 2JEGA 4F7XA 2C99A 4GKKM 5J8YC 4NM2A 4HEOA 4IR9A 4K8JA 2ID0A 2UVRA 1FIQA 5ALOA 1NK0A 2RQXA 2DNAA 3CAMA 5ALRA 9ICNA 4C4TA 2NUCA 2ZXPA 4DXGA 2YU9H 4KN7A 4LF5L 4K0KL 1XO1A 2HHVA 3RJEA 1JRPA 1NMFA 3VDUA 5CV8A 3HX3A 4R1JA 2W55A 4RWSC 2R7FA 2WINB 4J15A 2ES2A 1RHPA 8ICYA 2M60A 2R62A 1GLNA 2KKVA 2C2DA 2O5RA 1X3GA 2F0SA 2HQLA 2J0TD 2F0HA 3KZIU 3UM9A 4DOAA 3K5MA 3WDNA 4NXZA 5I9PA 4NW2A 1AP0A 3K9OA 1FYCA 3RGSA 4RQ1A 4G57A 1TGUA 1QB5D 5KFKA 1T7PA 3VDYA 4LFCQ 1JE4A 3GTQH 4QZEA 3FAHA 2HMXA 1EY5A 3GTJB 4PDIA 3SARA 4TSSA 3C5FA 3TWKA 5IYBH 2FPLA 2VF7A 4JI3Q 1F2MA 2XO7A 2EJMA 4JI4M 2XIWA 2R3ZA 2PNHA 3L9AX 4F8RA 2R4EA 2R6FA 4P2HA 1SNOA 2Z9HA 1PZNA 2Q8TA 2OO9A 2VUMG 3F2CA 1DCZA 5D3DA 5BN4A 1GUOA 2KSOA 1XYIA 3KD3A 3MGVA 2BE5D 4OONA 5AIAA 4C3JB 2UXBQ 1FR3A 1T4GA 2BCQA 3OYYA 4RH6A 2O2LD 4YP3A 4M9LA 3UJNA 4JI5L 4A93B 2IMWP 5K36G 5IYDG 5LMNL 3GTJH 2HHHQ 1WG8A 1TVXA 4PHPA 4LZGA 2NQ8C 4NXML 1S0MA 2XZFA 3RAQA 3L29A 1SMYC 1QQ7A 4PGQA 1PFMA 1MSHA 4KMUA 3D31A 3A7LA 1DOLA 3V7LA 1XMQL 2OYYA 2UU9L 2K4HA 3ED5A 3SR6A 2L6OA 1KLUD 2K5VA 4DFKA 4LMQD 1T3TA 4NM1A 3A8IE 4DNTB 2WKCA 3RD4A 1IBLM 4P17A 3GRUA 1QSSA 3I2ZA 3WOEA 2R7ZB 1JR3D 1Q02A 2AKWB 1PH1A 2LVAA 3MEHA 4DUYM 1JR3A 4G4RA 1IXSB 2CHVA 2K0BX 2HHTA 5KFGA 3CF0A 1I4RA 4B3TQ 3S1NH 3PSTA 1VQHA 1T3NA 2UXDQ 2EZZA 2JA7G 3B89A 2AU0A 2SDFA 3RF9A 4A3VB 4GLAC 1X65A 4HJ7A 2MJ5B 4B3MQ 1EIGA 2O4XA 3EIHA 3FD9A 3U6LA 3DV9A 1JWUD 4M9XA 3J80i 2E8PA 1K9MC 4C8MA 3GQ3A 3D2SA 3TQSA 1MQ3A 2AWOA 1Q39A 2LNHC 3A7AB 5CV4A 4ZRZA 4EIWA 2JXJA 3TWMA 1SNDA 4ZYSA 4NV0A 4GKJQ 4LUOA 1H9SA 1E7ZA 3T3FA 2QKIC 4EYIB 3I90A 2XY6A 4WRDA 2MUYA 2NN6I 4C3IG 4UN2B 2PFNA 3VR6A 1YJWA 2OF1A 4FFDA 1C1KA 5DLGA 1PJTA 1TS5A 5J2FA 1J09A 2JA8G 2ZIUB 2CFOA 3KDFB 4NPSA 5FLXS 2O25A 2F4VQ 1HUNA 4DL6A 5DGBA 2CN1A 1SL0A 2IHMA 3JPRA 3IFTA 4LW1A 4BBRH 1RIPA 2X6GA 4J9RA 1HNWQ 2E1FA 2SOBA 4JI8Q 2BA1A 3PUYA 2NVTH 2L0CA 4LJZC 3CCUA 4CE6A 3M4OB 2HCIA 1A0IA 4ECQA 2ZJQA 4DEZA 4GKJM 4PNYA 3E0JA 4B9SA 3D6WA 2DJFC 4RNOA 2F1IA 2AQ0A 4ECRA 1LV9A 3J80E 1VQ5A 1XNQL 1UNSA 4CGZA 2E5LM 1D0KA 3PMNA 1GUTA 1X3EA 4ZUJA 4K5XA 4DR2L 3OGUA 3FEWX 3MVVA 4AYBF 1F2YA 3FRHA 4CJ6A 2JZ1A 2DF4B 4EENA 3KP0E 8ICOA 1JB3A 8ICBA 4LRSA 1KDAA 3SR1A 4NLNA 1R4GA 4DV5M 1GJTA 4JI1M 1N34M 1ZQXA 4H13C 3SBJA 3NVWA 1F2ZA 3PUXA 1WCNA 2Q2HA 2G3QA 4HJ9A 3OTOQ 3PF4A 3TPZA 4B3TM 2VJ5A 2ZXIA 3RJIA 2BDPA 3DM1A 4B3RQ 4PQXA 4KHPQ 1JB0F 2KMDA 3M8SA 2KDLA 1EXNA 2RDIA 4NLGA 1LTID 1TQOA 2DN8A 3CD6A 1ZYRD 2WP8J 1HNZQ 5KFMA 2VIIA 3F53A 1GO3F 2MU2A 4RQMA 1GKIA 1SXJA 3LQQA 5KFZA 4UBCA 1LTAD 4DGZA 4USAA 4KI0A 2EJFC 3FUTA 2BA0A 4L8JA 3RB6A 4RF1A 3U6MA 2FFKB 3G6JB 1K0RA 2KCCA 4PL2A 1AIPC 2C98A 1K3XA 1IIPA 2A69C 3GIIA 1U45A 1L7OA 2LPEA 3L3OC 4IBDA 3NTKA 5FTKA 3RJFA 3A0BU 3Q8SB 4FNFA 5GROA 1IHZA 3KLSA 3J7YW 3LX0A 3TFRA 3LVVA 1HA6A 3HP6A 4B3ML 2CCZA 1F4IA 2Y0SF 1O7YA 2IX3A 1RDFA 1SV0C 4IQTA 8ICFA 1ICWA 3QEBZ 1II3A 4FF3A 3PMLA 3AU7A 4XDXA 5DAUA 4EEKA 2KK0A 3C58A 2JEIA 4KLKA 1NKEA 5AKKA 3C3EA 2A1JA 2BPGA 1TIID 2NZOA 4ECZA 2K01A 1T6OA 1H9SB 2X69A 2ZANA 3KLWA 1NJFA 3C1FA 4YHHQ 1JOOA 4ABNA 2UXCM 4U7CA 4RQ2A 2KHJA 5IYCG 3KLSX 7ICPA 3SK5A 3PO3H 1DOQA 4C7YA 3CU7A 3KS8A 2G5IB 4IL6U 1PUZA 2B29A 2O6KA 5DB6A 3QIAA 1V92A 1S76D 2G5GX 1NOMA 1O7IA 2LKVA 4DAVA 4UASA 2AMCB 4P0QB 4BA2I 3FHWA 3L28A 3BDPA 1V33A 2DNCA 2JWSA 3O0FA 2KA7A 2QDLA 2N55A 3U4VA 5D14A 1E1TA 3G7LA 4JI8L 9ICJA 1ICFB 5EOZA 1ORYB 1I3QB 1U4MA 1PJSA 5JRTA 1SXTA 4REZA 2HD3A 5CV7A 3K2LA 3D8LA 5ITRA 3D3RA 4EELA 3R3OA 4DAYA 5IIIA 2OM6A 4IPHA 5KNDA 9ICTA 3S9WA 4A3BH 1I5FA 1ZXTA 2QCPX 3NRWA 5EKIA 1H95A 5EP1A 4Q8EA 2FH0A 5BN3A 4BXOB 3UQ0A 1W6JA 3ZDDA 2W54A 2XWBB 5KG1A 3CQZH 4OX9Q 2HCBA 1B2TA 1BKBA 1TWAB 3GPXA 3CF5A 4QZHA 1IZ6A 4UB8U 1L7PA 4B9TA 3QWLA 3U4ZA 1N60A 2EY1A 1NK6A 3FYCA 4J9OA 1V8QA 4X62L 5J0QA 3H15A 2KA6B 4OWXB 4JV5L 1XSPA 1N34L 4JI7Q 9ICHA 4LF7Q 3GLFB 3ZD8A 4RNNA 3BYYB 4IPDA 3AM9A 5DKWA 4NMZA 2AHMA 3L5KA 2HSZA 1PXUA 1DO0A 2W43A 1SEBD 3AQQA 3KDFA 1D8LA 3D2QA 1UHUA 4Y2PA 1ENAA 2EAPA 1WGNA 3W67A 1D5XC 2B2TC 3U50C 4KLGA 4XQNA 2JA7B 3S17H 1PJQA 2P5TA 5AKGA 2KIWA 4DO9A 4B3SM 4BGDA 2VJ4A 5EXTA 4YG2A 2DKLA 1QTMA 2ZXRA 1SL2A 3CQZB 4KN4C 2L1BA 4CJ0B 1R7RA 4OGQC 1ZQTA 1XNRM 1A63A 3CKIB 2C2RA 1SN8A 2P6UA 1LTGD 3SMVA 2EANA 4RT3A 1T5EA 3UE1A 2H1RA 2A74C 1SZHA 3U26A 7ICRA 5DB9A 4PT5A 2DWLA 2MHVA 3UMGA 4M8AA 4DR3Q 2G0AA 2O5IC 2LHGA 3MR2A 8ICAA 1LABA 4LFAQ 1FJGQ 1KXLA 2DZNB 3BVZA 1VQAA 1GD7A 4EBEA 5HNKA 1LKYA 2KD1A 2I0QA 1JR3E 5CA7A 4ECWA 2MUTA 4JI2Q 1Y8OB 2GNOA 1Z5BA 1EY0A 4A3MG 1MJEA 4NLZA 4D80A 2AXTU 3NSWA 5EGTA 3UQ2A 1NNJA 3OSPA 1Z9FA 1GUWA 2JA6G 1PMRA 4A3DG 5AHXA 1C20A 3M6AA 1VMCA 2EKKA 2B8GA 3AL0B 2PFQA 5KFYA 2KFNA 5ALLA 2L7HA 1JMSA 2MO0A 3NEMA 5KG0A 5EBDA 3UE0A 3AB9A 1B9MA 4GC6A 1J9OA 2XVSA 1H9MA 2ZIVA 5E7NA 4FWGA 1VJ5A 1CKNB 4YD2A 1S5DD 3K81C 5C4HA 2BPFA 1PVQA 4POFA 4OJ6A 1KBUA 4I2HA 1RTNA 4JYAQ 1J2MA 4GOPA 2NN6H 4DR1L 4DV4M 4RPYA 1OW5A 1QAQA 1GUNA 2VQEQ 2ATWA 1J8IA 8ICXA 2ZM6L 1VQ4A 4L5RC 3KOZE 1IV8A 3T38A 4GN5A 1K8AC 1N33M 3A0HU 1U4BA 1U0LA 4JK1C 2E2JH 3SAVA 1XMOM 1IY1A 2KN7A 4RMFA 5J0XA 3U6SA 2K7VA 2NBFA 4DKAC 3GQ4A 4DR5L 5DB7A 5JEAH 2J6TA 3GPUA 2HHWA 1NR2A 1N34Q 2RQ5A 4JI7L 4GIPA 1ZQIA 5J2CA 1OUQA 4LF7L 1NK9A 5D46A 2Q2IA 4KV6A 4ED7A 5DM63 1GABA 4O5KA 4RCOA 1AQ6A 3GU3A 3UPQA 3IM1A 4DR1M 3S1MB 5DG7A 3OIPA 3T1HQ 3D8GA 4UB4A 1PH9A 3BS5A 4QZ8A 1SRUA 1CI3M 2CHBD 5ITTA 1X66A 5C44G 2K05A 2RRUA 2A6HD 4IUPA 1UAPA 3DOAA 4JI5M 3T16A 4A3JH 3AQEA 1DOMA 2KVMA 2UUCM 2N8NA 2R93G 1YITA 4RHSA 2F5NA 5IINA 2CVRA 4AI6A 2LYHA 1FNVA 3QO2A 4JPBW 4NXMM 1D9FA 3RUZA 1QYRA 1XXHB 2Y9UA 5L1LA 3PUVA 5C0XH 5IYBG 1HR0Q 1JOQA 4GC9A 1B43A 2HIXA 2V6ZM 3GLFE 1TK5A 4GNXA 3HOYG 4BXXG 1IYVA 1NK7A 4QGUA 3TS0A 2F0QA 1NV8A 2KBNA 4ZLTF 3C5GA 2VW9A 3IG8A 3RZDH 2Z6BA 2PQAB 2RDJA 1HRJA 4G4OA 1LTSD 1TH2A 3E58A 1E2VA 3X3NA 2QBYA 2VQEM 2L4EA 1PM5A 1KEJA 1WCMB 3ITPA 4FYDA 3C9PA 1SAPA 2UUAQ 4A3CH 3J2PB 4GFJA 4IC9A 5D49A 3OSNA 4O3QA 2V4RA 4M04A 2F0DA 4MTNA 4C1NK 4DR7L 1N32L 3T79A 1S0OA 1VQJA 4W5WA 4RHRA 2R8GA 4CIZA 2JEJA 8ICQA 4KTAA 5F9LA 5KGUA 1R9TH 2JA5G 1X3QA 2BWEA 1SV0A 4US8A 1VQCA 3OTOL 5I4DA 2B3GA 2OCEA 3V05A 4KJOA 3K8ZA 1Q12A 1CEZA 4PMCA 3SENA 3GPPA 3PSFA 3SHGB 4RUCA 1X9SA 3QUBA 4C3HB 1VDDA 3SK8A 2Q2TA 1VLBA 3M7DA 1GUGA 1O7ZA 4FO2A 5KFJA 1COKA 2I5LX 5H1SE 3RGPA 5KFVA 2PCFB 5A35A 2JE6I 1QCBD 1WCMH 1FNUA 1YNND 2L9HA 3EW9A 4B9MA 4DOCA 3CRKC 3L7ZC 3GTLH 3U6QA 2KVCA 1TWCB 2F8KA 1U9RA 3UDXA 4B3SQ 2EA0A 3H3VI 2I7PA 2XSZA 1OXTA 3GLFA 4U6PA 3F8TA 4R71A 4CCHA 5C3WA 1VF5C 2H3IA 2UVUA 2WSFF 2DY8A 5IT9L 3HOZH 3ZC7B 3J27B 1WJ7A 1HCZA 5KYLA 1Q82C 3BU2A 3GQBA 4LF7M 1MSGA 4KKTA 4A3EB 2OTLA 2K14A 3TSSA 5J22A 3N7SC 1SMYD 4JI0M 3GP1A 1RXWA 1UE7A 3D2NA 4LWCA 5BR8M 1Z6TA 1ASYA 1S3SA 3U6EA 1WD0A 4DR3M 1ZV1A 5ALFA 2G9HD 3AKZA 5FJ8H 3GLIB 4X66M 4FF1A 4LFBL 1S77D 4NKLA 4WFN3 4O3SA 2VL6A 3VKGA 1WIVA 4DK6C 1G8PA 2YQZA 3PVXA 2C9CA 2OQKA 1YJNA 1WTXA 3HHZA 5KFRA 2E2IH 2PMZF 3QU9A 2LKYA 2HHSA 3PFIA 1XSLA 2UUCL 3MGIA 2CW0D 2C5RA 1UUPA 5EQ0A 1X9NA 1U9LA 3HKZF 4DPGA 3QUCA 2EJSA 3HOWB 5EWFA 4MFAA 3QX7A 1IFYA 1EY6A 1YHBA 2LY7A 5C0XG 1K3BC 3GTOH 3S1QH 2HCFA 3VC8A 5ALXA 1MBYA 2QB0A 4YWLA 5G3LD 3FP9A 2B2UC 3QJYA 4I2IA 1K1QA 3CP8A 1P7DA 4Y2VA 3R8FA 3WKEA 2DJGC 5KFOA 2GVAA 3UXOA 2XRSD 2Q4TA 1ZETA 2W8KA 2ASBA 2Q0ZX 3PX0A 3ZDCA 1UE5A 2W9CB 4YCXA 2NWGA 5JEAJ 2UUAL 5KT6A 3ONNA 1IN7A 3OPOA 5KO3A 3C1YA 4F4KA 3LVWA 2PFOA 2AH5A 3GV5B 5BR8Q 3TS2A 2M2LA 2R0IA 1TWGH 4QW8A 2B2WC 2RP5A 2F0NA 2JY7A 2RGHA 3KSJA 1A3VA 5LL6X 3IG5A 4QNLA 4NLBA 2AQ4A 4IBFA 7ICTA 3PIOA 2JNHA 3J7A5 3HJSA 4JWMA 3Q8RB 1E1OA 3E5SA 2RSNA 3EROA 4XXEA 5HMLA 1HQMC 1HR0M 5J2BA 3SMSA 5AM4A 1SBBB 1EIFA 4KLEA 5DYIA 2X8AA 1MQ2A 3BQ2A 5EKKA 2VXWA 9ICUA 3KF6A 1KLNA 1SE2A 1VQ7A 2YMMA 4MEXA 5E3FA 3MXPA 4JI6Q 5DBBA 2LHCA 4OJOA 2A6HC 1X55A 2GH1A 4JI5Q 4DNIA 2F4IA 4M9JA 4DCCA 1CZWA 3K1JA 4HAEA 1OQYA 2G9DA 1CRXA 1S5CD 3ND8A 4J9SA 4MNOA 5FKAC 3D6CA 5IYCH 1EY8A 3CF6E 1Z1VA 5ALYA 4DF4A 2F0KA 4A3IG 3T1HM 1B4OA 4LJ6A 1NO1A 4DV2M 2MO1A 3PIO3 3Q8KA 5JJKA 5G5HA 1X37A 1KAAA 1BBXC 3C1ZA 2K4KA 5IILA 3GLGB 4LFBQ 8ICRA 2VUMH 4QHSA 1Q46A 5AICA 2NYVA 1HNXL 1WYGA 4P0QA 4JBJA 3E3XA 5ELBA 4RU9A 4IQVA 1DK2A 1K3RA 2H3ZA 1LYLA 1TS4A 1FD7D 2PI2E 1MX0A 3OTQA 4HCEA 4YXJA 2PNRC 1CM9A 2PXIA 5CJ7A 3CP0A 4ELVA 1R2ZA 1G3IA 5FO7B 2HHXA 3J7BA 2UXBM 5KFSA 3SAGA 1BPBA 2FI1A 1L5UA 2XN9C 2XSZD 9ICPA 5ALUA 1MC8A 4A3KG 2R92H 3ULJA 5EAYA 3U58A 3I1YA 5J2DA 2ZIVB 3JAMS 4P4MA 5J2IA 2C2EA 4RKUF 2K89A 5DQGA 2D62A 2JJQA 3VR4A 3M3YB 4LNQA 1ASZA 1UEAB 4Z6YA 1Y8PB 4EQ5A 1N33L 3HOYH 1SJED 1PZJD 4I27A 5I9OA 2F0PA 3JR5A 4K5WA 2RCNA 1A2UA 4EGVA 3F5EA 1VQLA 4Q44A 1IY2A 5AKIA 1DGHA 1VDVA 4CNQA 4MFCA 1QVRA 2B2TA 1YBYA 5JJZA 1WTVA 1XPRA 4DR6M 3W0LB 3FUVA 1LLRD 4R4CA 2CEAA 2HW3A 3GLGE 4C3HG 4XT1B 4ECVA 3J80L 4POGA 5AK3A 4QZCA 1C48A 3C21A 4MF8A 3A74A 4Y2SA 5CP2A 9ICSA 5EWEA 3G6XA 1NHWC 3LMMA 5CORA 4A3IH 4JBMA 3RZOH 5C4XH 2W8LA 4DXFA 4IQUA 2XC9A 2BDOA 1SMXA 2X4AA 5AJ3L 1COOA 2R18A 3OHXC 1LT5D 1UT8A 4OXPA 1UA0A 4IS7A 4A3MB 4UBBA 1WFQA 2JUJA 4Z6EA 2WB1G 4O3OA 5D4BA 1QAOA 3KDSE 1U47A 3HZXA 2KHQA 4LF5M 2PI4A 3R2IA 2WSEF 2WFAA 2R61A 5E79U 4K4IA 4YY3L 1WTOA 1PH2A 4ZH4A 1IBLQ 3FKEA 3FUWA 3L27A 3B0YA 4NDXA 1ESRA 1M4VA 1X56A 3GTLB 1TFRA 2OQ4A 3GTOB 3S2HH 1GHJA 3J81c 2CWBA 4LF4M 4R63A 4K2KA 1VQMA 5C4XB 5J0WA 1V1PB 1TAQA 5EWGA 2KZ3A 1V97A 3FKIB 4BY1H 3KW6A 1SNMA 2VB2X 3JR4A 3UXPA 1MI2A 7ICMA 5IT9E 3H94A 3HGIA 3MFHA 4C3IB 3PO3G 2ASLA 1G291 4BUGA 2R8KA 3I01M 2AHOB 1L8OA 1TF0B 1JXEA 1TAUA 2F52A 2KOLA 5FTMA 4BWJA 1J5EL 2Z4SA 3BZKA 1PJJA 4I2CA 3LW5F 1STYA 3K57A 5L8RF 1WHCA 3DEOA 5ELCA 5IP9H 4YD1A 1BPDA 4QZBA 3E0FA 1DK3A 5EE0A 4B6JA 2DFLA 2WHEA 3QU7A 1TWFH 1BPEA 1PFBA 4PGXA 1G6ZA 3JPTA 4BA1I 2K9DA 1X9XA 4L63B 1H9RA 2F0GA 3ONAB 4IOAA 2L7IA 3DHQA 1ZQNA 1NHGC 1KRTA 2Y0SB 1NY4A 4NRWA 4LFAM 3R9KA 2FOIC 2JR5A 1Q1EA 1O7LA 3U9OA 1N8RC 3PX6A 1QVCA 4J9PA 3H6MA 3CXCA 5AKHA 2NB0A 3VYRA 3ICXA 1HZ9A 1YE9A 2H5XA 2KE7A 5AIBA 2KCTA 1XWLA 2EY5A 2JEFA 4HR7B 4DF7A 4YHHL 5H37D 4C2MH 4DA2A 1QCKA 4B9NA 1XMQM 4Q0FA 1HQYE 4QWDA 2WF8A 4NXNL 3PNVA 1QZEA 4F5NA 1B44D 3D4RA 4ELUA 4KLDA 5KT5A 3C1EA 4KD3A 5EJWA 2QQ8A 1NI3A 4RQNA 3HKZC 3HJQA 3IHQB 3QU4A 3JPQA 2F3VA 1I94M 3SATA 1V9PA 2E3TA 2G06A 1RJTA 2ZIWA 1C0AA 1G91A 2IX1A 2QZ4A 1U4LA 4CF4A 2V4QA 4Y7NH 4G7OC 4QUCA 1G41A 4GC7A 4KD4A 4A4IA 1S97A 4B3RM 4KHPM 1G51A 3H3VC 2BH8A 5ALVA 1Z5CA 4DSEA 5LMNW 4GIBA 2EPBA 1SG9A 2SNSA 1S0NA 2JA2A 5M3MG 1NJZA 3T51B 1G59A 2D6FC 1F44A 1LM0A 4A3IB 1WTPA 3SC3A 5AI6A 2BCUA 2K4IA 4GLXA 4ZPXA 4JWNA 2V1CA 1KTKA 2JA5H 2B21A 3HT3A 2DZOB 3CPFA 4FXKC 5FLXc 1VQNA 3X3MA 4MGYE 3PO2B 2ZTCA 3S2DB 5D3IB 4NB3A 4PGYA 3PO4A 4KY7A 9ICIA 1M8AA 4JBKA 1RQNA 5F9NA 4J9LA 1CHQD 4KKSA 5J2JA 4EBCA 2HI0A 1EYDA 2FMMA 5L1IA 2R65A 4R64A 1KDHA 1SSOA 3CTWB 3E9IA 1XO0A 2B3TA 2KZMA 5JAVA 1KD1C 4WJ3M 3TARA 2K8CB 2RHQB 3TP5A 1XHBA 1H38A 5L9XA 5IOCA 3I4MG 3KOYE 4KLSA 3C2LA 1JWSD 2QB1A 2W9AA 2RDGA 4X64L 1D7QA 3SDZA 1IM4A 2NO4A 2M5ZA 2AQ1B 3UMCA 3RH4A 4EEYA 4G4KA 4IJLA 3TDQA 1Y1VG 4AQYL 3T6PA 5EXPA 3DM3A 1IXRC 5J0RA 5GQOA 2PMZE 2F0OA 3K59A 1K8OA 1BQQT 2HBMA 1IG6A 4KLNA 3FPUB 4DV1L 2KZUA 1ZJMA 1L3SA 1SV4A 3H0MB 4KLUA 3G6YA 4OO1G 4K4HA 2ZIXA 2LFNA 5BN5A 4UDUC 3BS7A 2NTSA 1JMCA 3KZXA 2HOIA 1STGA 2E5LL 1HIWA 1SXDA 2OPFA 5BR8L 3UDGA 4P16A 4PL1A 3GFKB 3KS4A 3MBYA 3A55A 3PCOB 8ICPA 2OOBA 4X66L 4LVSA 2FMPA 2NRZA 4Z6CA 5M5XB 4X3TA 4Q7JA 1DM0B 1EWIA 3QYBA 4F4XA 3HOYB 4JB3A 1MN3A 1OXJA 3UXNA 1UE6A 1TWHB 4IZ8A 1MD2D 4RAUC 2B63H 4QF4A 2E8NA 1C4QA 3Q8XA 1XJVA 4LF5Q 3PQIA 2E8MA 5GAEC 5LMUM 2D7HA 4NSRA 5AM5A 4JV0A 1HFGA 1LTRD 2RBMA 3RH5A 4IJEA 3W68A 2DL0A 3MEFA 4P74A 4NXNM 1KFVA 4TQUS 4ULLA 3S2HB 1VQ1A 4JUZA 3C3DA 7ICUA 3MR3A 3WK9A 5J0TA 2W9CA 1PVPA 3HKSA 4R66A 2FMQA 1L1OC 5KAFU 2LS01 1Y1WG 1TR8A 2B39A 4LF4L 4EZ6A 4DS5A 3F5AA 2E2HH 5FTLA 4O0IA 3H0RB 1N48A 2ISOA 4ZQ3A 3TMEA 3I4VA 2HDLA 5CR3A 3S16H 2KOBA 3SYKA 2VA2A 3ZYYX 3BOSA 5C4XG 3PF5A 1TAMA 3VK8A 4M9GA 4DL7A 1KAWA 2B2YA 5KFNA 2WAQG 4LF6L 1HNXQ 1B8AA 3ERQA 4NJ8A 3S1RH 4DAMA 2WZJA 2D0PA 4YR2A 2HHHM 2K8AA 3B6YA 3BJUA 3KKAC 4AZFA 2UUBM 1TVAA 3KYHC 5DG8A 1GKHA 1DOKA 4A76A 3HOWG 3CW2C 3N6RA 2ZAOA 4I28A 4C3JH 1IYUA 4QW9A 3HOUG 3E9HA 4QQBX 1NAPA 2GLEA 4ECSA 3SZ2A 1OXSC 5IIFA 3HOVG 2EAOA 1KNEA 3H8SA 1PA6A 2XGNA 2W04A 4I2DA 2R44A 3CF2A 3KVWA 4KMOB 3GTQB 4JI2M 3GO8A 2QBYB 1FGUA 1YZ7A 2LVPC 2RRDA 4DL3A 2D2CC 2EAMA 2K6AA 1GUSA 4RGTA 1N32Q 5KFEA 1ZQFA 5FLMG 2DWNA 1X32A 3B7ZA 2G07A 1KABA 2PKEA 4A3MH 2F76X 3V76A 2JZBA 1ESFA 1TS3A 2ERCA 2K5QA 5JTIA 2N3SA 1SYGA 3QUTA 1Y69U 5KPTA 2YV5A 5E1FA 3KXEC 2WKDA 4L5TA 1EYAA 3S17B 3GLIA 2XWJB 4YCWA 4KITB 3T5KA 2QNJA 1D9DA 1JOKA 4X3SA 3U60B 1L1ZA 1UFZA 3NVZA 3TI0A 5CBAE 3GTGB 1TXYA 2JXNA 1UPHA 4U673 4KMUC 1PH7A 1MGSA 3TADA 1Y14B 3I28A 5IIJA 2CP8A 2LSSA 4A3FB 3B9PA 4J6HA 1CA6A 5KG2A 3L26A 1LT3D 5K5PA 1ILPA 3BDOA 4YN4A 5DB8A 2DPJA 4V190 1FFUA 4UAZA 2OT2A 3ER0A 1X2IA 1KSFX 1FFVA 4LRTA 2ZJPA 7ICGA 3SD7A 2G08A 4FS1A 1IBKM 3AU2A 2MAXA 5IWAL 1VCIA 4P73A 1T9HA 5ELEA 2K28A 2VQFQ 4AKHA 1RYUA 3BDLA 4FCVA 3U60A 4QNMA 1Z19A 3H4MA 1I4QA 4QMGA 5JVG3 4JI1Q 2NYZD 1AUAA 3HRDD 5C44B 2F8LA 4DV6Q 1VQEA 5FSWA 5AKZA 1IBML 3S1NB 2JY5A 2E74C 4LJXA 1H9JA 3C2KA 4QIWC 1NKBA 2KEDA 3IV6A 4H44C 3NENA 2VF8A 4NWIA 3E0EA 1BPXA 5IYDH 1KNAA 4RQ7A 1RU3A 1W5SA 4FCWA 1Q81C 5DGAA 3EN2A 3ULPA 1ZQZA 5KFLA 3TBIB 4A3BG 3I4MB 2IL8A 2H3VA 2NV3A 2QSFX 2R8HA 1I4WA 4MGZE 1OFIA 4F2SA 2QEJC 3IFDA 4YWMA 3S16B 5ELFA 2LI6A 4X3KA 1GHKA 4B3TL 2F0JA 4LZDA 1BUVT 1EY4A 1F9SA 2MP1A 1X6IA 3AU6A 1AZQA 2BE5C 3J7AS 5C5MA 3BS5B 1GJXA 4QZIA 2F03A 5M3FH 2UXCQ 4RPZA 3ZQJA 4IRDA 4HIDA 1F9PA 2CH4W 3D4DA 1PTOB 1BDOA 3BDCA 3CC7A 3OW2A 4IPGA 4FXGC 2QEXA 2ZT9C 4IFDH 5EP2A 2OH2A 2HBLA 1PVRA 1ZQKA 3FYDA 1K8GA 2VIXA 1ZQEA 2H3QA 1LV7A 1TKWB 3CPWA 3RNUA 4GKJL 1XXGA 1TKDA 2QARB 3KBBA 2KHIA 2A1AA 4OWWB 1BCPD 3I4NH 5HHIA 4JI0Q 4EQPA 2GVBA 4A3DH 4B3MM 3IP4B 1KDBA 4BBSH 4F4WA 1DXMA 8ICCA 5ITXA 4MFFA 4DV5L 8ICVA 3RFAA 3SV4A 1JT8A 4K6LA 4DNRB 3EUB2 2VQFM 3RJGA 1HNWL 4JC0A 4R8NA 3B7NA 3AOEC 3BJYA 2R7DA 4DL5A 1WJJA 3ZDBA 4H0LC 1BCPF 1NNLA 4C3HH 3N4MB 4IBCA 4YXMA 8ICIA 4KHVA 3JC66 2X49A 4A3GG 4AP9A 1WGLA 3SFZA 1GM5A 3AJIB 4TKOB 4ECXA 1XNQM 4DR6Q 3I4NB 1KN5A 5DDMA 5DG9A 2A5YB 1SZPA 5IIMA 1PGYA 2FLNA 2XLJA 1TH3A 4FZLA 4HJ8A 3J7AV 5DQHA 3GILA 2CWPA 1L2BA 4WORA 3H7IA 1N78A 1V1OA 2ICIA 2PQEA 2RDHA 4PV1C 3DWAA 4CBVA 1X40A 5G3LF 4JI1L 1PJIA 3RB4A 4DAPA 4KODA 3A42A 2DWQA 5C3EH 2PMZC 4J9MA 4NY8A 4IALA 4TRDA 1PH3A 1Z4NA 9ICWA 3H91A 3PW0A 1SWVA 2LMRA 1DGGA 3JAMi 2JN4A 1PRTC 4PD2A 4LF9Q 2A19A 3HOUB 1SXJE 4NSOB 3TAPA 1K28A 1V1PA 4UATA 1ED1A 1YJ9A 5FLXE 2C28A 3MTSA 4DUZQ 4GKKL 4F4ZA 7ICVA 3J81S 1EWCA 2K32A 4PZ8A 1L0XB 1B3AA 3U5ZB 1X42A 2FE9A 4CRXA 5CV5A 4JI4L 2NVXB 2EXZA 2EXDA 3NBHB 4KJNA 2JP7A 3VA7A 4F71A 1QSLA 3GLHE 1T3QA 4BY7G 1D2BA 3ISDA 1XX8A 1A8VA 1PH4A 3M1YA 3QR8A 3K1ZA 3LYSA 3L0OA 4BLCA 4H7BA 4LY6A 1HT2E 1NY6A 7ICHA 1TWCH 5IREB 5IGGA 3JPPA 4JI8M 2VB3X 1ZMUA 1QUTA 2M00A 4JV5Q 4AW4A 1S9FA 4DSJA 3HX0A 2PZWA 5J0UA 4DFPA 5BPCA 3E2EA 4JI6M 1AN8A 1EEFD 2PW7A 3KOJA 2FMSA 1PFNA 1TWFB 5ALTA 3FDTA 4A3FG 2G09A 1EU3A 1YEZA 4R8IA 3J7AF 4CDFC 2IWHA 2CKZB 1R2YA 1NCVA 2AGOA 1GL7A 4C0ZA 1G6PA 2EZXA 1ZQCA 4DL2A 2CWAA 3HKZE 4DV2Q 2ZIWB 4I2JA 4X65L 4HLQA 1Z00A 2WIIB 3NWSA 3FM9A 5CMDA 1N33Q 4OJ5A 3ISBA 2KFZA 2KJ5A 2FJ6A 1C9OA 4GC5A 5LMNQ 1XMOQ 5EBCA 2WB1E 2AUKA 2B63G 1A3TA 4GXKA 2I9GA 1L3TA 3C2PA 3M9NB 1WTHA 3PV8A 2O5JC 5ITQA 2ZAMA 1RZTA 2A3VA 3AFQA 4UP7A 3PO2G 1ENCA 3GO5A 1UT5A 2L2DA 9ICGA 4V0BA 1YT3A 4CHTB 4F8MA 4OJLA 2A6EC 5L37A 1D0MA 1J5EQ 1KKXA 4XT3B 5IODA 1TT2A 1ZQLA 2CV0A 1JI7A 1NZBA 3DZDA 2IBKA 2ZUBA 4OJPA 2R8JA 2IPKD 1WXQA 4QWAA 4X62Q 4NC6A 2ZIUA 4LG2A 3RJKA 2WB1F 1MIUA 4JV5M 5CB1A 2D8CA 1QQ5A 1S4ZA 4RNMA 5AJ3Q 4B7GA 2XGTA 2DNEA 7ICEA 3UK6A 1IN4A 3MC0B 2L11A 3T56B 2KJXA 3AMUA 5KPRA 1N61A 1O08A 1I50B 5A2QE 4PHAA 5T1IA 1GVNA 9ICAA 4I8OA 4JV2A 4DK1A 3T1YQ 5B66U 2VUMB 3SHFA 5KG5A 1SR3A 4YY3Q 1RG6A 2BJVA 2JV3A 4DUZL 1QZHA 4CF5A 5ITUA 1U48A 3S2DH 3RLFA 4A93G 1GXDC 1VG5A 2ZM6Q 1VQIA 3HWTA 4EX5A 1Y1WB 2EYMA 1JB7A 2WAQC 1Y88A 2E8GA 3TZUA 4L15A 2BHNA 2GN5A 1DRGA 2IHFA 4OEMB 5CV6A 5GADC 3RN2A 1DGBA 2Y21A 5J29A 1O03A 1HNZL 1IXSA 2Y20A 5KRUA 1X6OA 1PTOC 3Q8GA 3P20A 3M3YH 5JI3E 1BPYA 2DGZA 1DGJA 1TDZA 4BY7H 4I81A 3PZPA 2JHDA 4LAAA 5CYUA 3E46A 5AM1A 4DSKA 5GKNA 3MC1A 3SYLA 1Z6HA 4UP8A 1NUCA 3W5OA 4OO1I 4A3LH 1JJGA 3GV8B 4M1UB 4QJFA 5KT3A 1QZGA 3WHLA 2D7GA 5ALQA 1TR5A 2B2YC 2Z4IA 4RG1A 3TADC 3N7RC 3BQ1A 1HPCA 1EWHA 4EQNA 5IGEA 8ICGA 2RVLA 1XNQQ 4A3DB 2FS1A 2YQEA 2XH9A 2EYJA 1F9QA 2CUZA 4DR2Q 5KIXA 1PK1A 1BNPA 3WK7A 2WB1B 4DV3Q 1EE8A 3QAUA 4IBKA 3K0YA 2OHFA 2PW5A 3KJOA 4F2RA 4OVZA 1ILQA 1PH6A 1NVMA 3KOXE 1T8EA 3RLNA 3E9SA 1VEGA 1TY2A 3SI8A 3PUWA 2UVWA 2XGPA 2IOFA 3RB0A 1XPOA 3TWLA 5CC4A 3THGA 2PI5A 2JMGA 2KENA 3MXNA 1KDCA 1L2CA 3PNYA 4KY6A 4AIMA 1Z47A 1L1TA 1VEKA 5J3BA 4DFJA 4C3IH 4GN4B 1RODA 1QDRA 5AKJA 1W6KA 1A5TA 2YR0A 5KFPA 4C8KA 1PYWD 2KCNA 4K8IA 5I2YA 4IRCA 4DR5Q 5IT9S 3P7JA 2G8LA 8CATA 4RQ8A 2BR0A 4IFDG 3KKAA 3VK7A 3PSPA 1BPZA 4JV1A 2PYKA 3NELA 4HJ5A 3R9XB 1ZRNA 8ICKA 1YNJC 1YIJA 2PI2A 5DYGA 4DR7Q 2UXCL 4PDGA 2VY3A 3GLHB 3FRPB 1EFUB 1D5ZC 4RQ4A 2CQOA 1VQ9A 2A8VA 1NBWA 2EZYA 1X9MA 3RZOB 1TE2A 2WACA 3M6KA 4DSIA 2V1UA 3RJHA 4X66Q 2N88A 1BVSA 5DFLA 2W82A 2E5SA 4QOZC 4FVMA 4GS3A 3HU3A 2DUYA 3RBEA 5KFFA 2Y0SG 3MXNB 1ZQSA 4Q43A 3DFZA 3L25A 4IN3A 4O1NA 3M85A 1KC8C 1B50A 2K5WA 2JY6B 2JRZA 1S0VA 4QNRA 2ALYB 3MABA 3LDAA 1IW7C 1Q3BA 1PVOA 2HIVA 4GN3B 1EOTA 4Y7NB 1CZGA 4L78A 3I51A 2CE7A 4YQWA 4FO6A 2LM1A 8ICJA 3EPGA 4K5VA 2F1MA 3T13A 4K4GA 3CCSA 1WOCA 1A77A 1SWWA 1EQRA 4C56C 1CHPD 3OJSA 4X62M 2B2VC 3GLGA 3CNHA 2QCUA 1Q3CA 2Z0SA 4B7HA 4K2LA 3RR8A 1SFOH 4AQYQ 3HOZG 3KFUF 1DV0A 2D0OA 3QU2A 2UUBQ 1FNWA 3KUPA 3MXUA 5KT2A 2HDMA 1HUZA 2QLTA 4DQSA 4ELTA 5C4JH 3ULLA 1ZQJA 1STEA 3NBIA 4J1MA 4OD0A 3HY5A 3SEIA 3BZDB 3SK6A 1DGFA 4NL9C 4I2AA 1WYDA 4DL4A 2ICEC 3K7UC 3MWYW 4DV3L 1VQKA 3FTEA 4GZYC 1GL6A 1A0PA 1HXYD 1KFSA 4ZUIA 2KECA 1NJWA 2HWJA 2B2WA 5KG7A 2Z4RA 4F5OA 2ASJA 4I29A 1IXZA 5ALNA 1HT1E 2OXOA 1GO5A 4MHVA 5DBCA 4R65A 2XY7A 1ET9A 3M4YA 3MZ5A 2W11A 5K4LA 3EIVA 5M9OA 1KL9A 1HZCA 4IQWA 3PX4A 2MUTB 2EYLA 3IKJA 1ZAEA 3C29A 3Q23A 4R9WA 1SYCA 4R4OA 2D9UA 3H0GH 3K0XA 2QB0B 1HZAA 1N77A 3PIP3 1NJIC 3DMUA 3MMPA 2G5HB 1FO4A 1B53A 1NR4A 1YHAA 1N36M 2KNJA 1A62A 3CCMA 1EYGA 3VFDA 5FK9C 3E21A 3BQ7A 1CFMA 1VQ6A 4UAYA 2MGWA 1OAIA 4GHAA 3Q8PB 3DWPA 2LMCB 3QXGA 2XGQA 3GTPH 1RCVD 2CHQA 4HSPA 5E6JA 3I56A 3QE9Y 3VLFB 2HVHA 3PW7A 1JQYD 3I4YA 2P35A 5ALHA 3PNCA 1CKMA 3F1ZA 3FDSA 2I6XA 1TWHH 1HTLD 5IY0A 3L3FX 2O01F 5CGKA 3GTMB 3HOWH 4DV7L 1FNNA 2P66A 1SNCA 2F5QA 2EY6A 1YI2A 2BPCA 1C8CA 4A3CG 2NVTB 3ZDEA 3T5JA 1LT6D 4F87A 1NSNS 2D3DA 5FO9B 4YHHM 3EZ5A 4LJ4A 3EYZA 1HQCA 2GWSA 2WB1C 2B0CA 3G48A 2R92B 1KTQA 3V7KA 1QWYA 5KEEA 5F3WA 3EJIA 4C8LA 1WWUA 1CSPA 4KO8A 4QUFA 1O78A 5IWAQ 2KICA 2YN4A 5AKXA 5TZVA 2MPMA 3G4SA 4UY8C 4Y2UA 4BS9A 1I3QH 4ED0A 4EVOA 3SVMA 1XMOL 2FXQA 4BX9C 2F0TA 4C80A 8ICZA 4A8EA 4PZNA 3SAWA 3TREA 3GTMH 3GTGH 2F3WA 1U4PA 4Y28F 4F5QA 4CKCA 1HZBA 4UAUA 1B7YB 1J7KA 2DWZB 2ZBKB 2IOHA 4CKEA 4P4OA 3AQFA 1IXRA 1VS0A 3P75A 3HWSA 3WOFA 2LBOA 4XYQA 1PRBA 4D81A 5HHHA 1LTTD 2L55A 2DY7A 3CHBD 4Q8FA 4AYBC 3ZDAA 4PCZA 5H2FU 2DZLA 4RF0A 2FLPA 4BWGB 4DV3M 3PW4A 2MNAA 5LMNM 1SE3A 3D6JA 1B0XA 1XC9A 2C5CA 1ZQGA 4PG3A 4K6DA 2ZIXB 4YFKA 1E9RA 2H3FA 5KG3A 5KFHA 1STBA 2CW0C 2KNAA 4IJFA 4XK8F 3SASA 2G5DA 3DEPA 3PGZA 2HAKA 2Y1JA 4NP5A 1Y1WH 3TN2A 3GV7B 2VA3A 4MF2A 4QZ9A 2F0UA 2QILA 2JGAA 3AN1A 5IP9G 4XQJA 4UW9A 5K36H 3RB3A 4BWMA 4GRIA 1WWVA 2YU9B 3ZD9A 5AKLA 4DR4M 1HNXM 5C44H 4BDPA 5DBAA 3TANA 4KX5A 4ECTA 1NJGA 2BCRA 8ICWA 2RKSA 3VDPA 2ZXOA 4GLVB 4XTCS 2F0WA 3KHLA 1L7MA 1TK0A 2KNVA 2K47A 1NV9A 2ZJ5A 2JA9A 2OQ0A 4DOBA 1Q90A 1WTRA 1XXHA 4LJ8A 3ND9A 3CRLC 3SYZA 3VYTA 3I4MH 3OMGA 2B63B 3N97B 1WVLA 3H4DA 1XC8A 3HOXH 2Y0SC 1ZQUA 1ECWA 2KTQA 1EQTA 1FVIA 2XF3A 1E32A 1OIPA 4JXJA 4E6IA 3DDHA 4Z6DA 3HEJA 5HMMA 2MJ8A 2BNKA 3F2UA 4FW9A 5KTQA 2CRXA 3W3AA 3S24A 5M3FB 1PH5A 1HR0W 3CC2A 3STBC 1UEBA 2I5MX 4DV6M 2A69D 2I7NA 2K60A 2NTTA 4DS4A 1CI4A 1Y1VH 2DKXA 2NZHA 1KIXA 1V34A 5AI8A 2EOTA 3H09A 5KFIA 4IUNA 5M5WH 4G4NA 1SYEA 4OELB 4O3RA 1IBLL 3WWVA 4AKGA 4GXJA 5HGTA 3HKZB 4ED6A 2UXBL 3TFSA 1IL8A 3DA1A 4UB1A 4LUVA 2CFMA 3LCUA 1EQVA 1TWAH 3Q24A 4HL4A 5C3EG 1E2ZA 2PMZB 4A3FH 3HOXB 2IT1A 4TUSA 2DHRA 2W03A 2M0NA 4J9QA 5M5YH 2CQAA 4C1NI 4M9ZA 4I2GA 2D5DA 2QENA 2L4FA 1NZPA 5ALZA 3PR5B 5IIOA 2EDGA 4P72A 1SKWA 1DZ1A 2BQRA 3SMPA 2YB4A 4CGYB 2NN6G 1F9RA 4DV0Q 1XMQQ 4BXXH 4IFDJ 3FMCA 4YR3A 2FFJA 2FPKA 4JI0L 2DUDA 1B3QA 1BOSA 4LF9L 4JOIC 4CDEC 1LVHA 2FNAA 5B5EU 8ICLA 1IBKQ 4OHJA 2MSNA 1TV9A 2YTXA 4A3GH 1EUJA 1JCKB 4GKKQ 4DQRA 4G3OA 4QZDA 3CMAA 3C46A 4KLIA 1PZKD 4HMJA 2R92G 1I94Q 3GRVA 3OW7A 2WFWA 1ZQWA 1L1OB 3HJEA 2JSOA 2QF7A 1SXEA 5HP4A 7ICKA 2J5YA 2D7EA 1OIZA 3KOWE 2LHTA 5KT7A 3V6JA 1EZ6A 2RA4A 2V4DA 4Y2JA 4HMIA 3OWFA 1L8LA 4HAIA 2ZTDA 4PH5A 4QZAA 2ATLA 1ZYQA 3LGJA 2N1RA 1Z5AA 1E94E 2LM4A 1ZQAA 4IO9A 1RPLA 3IL8A 4F93B 1GVPA 2A6ED 3V6KA 3GV3A 1IN6A 4LUZA 5CRXA 1E2WA 3NS1A 1QUQB 3MA2B 1NNUC 1UA1A 2RSOA 3PSIA 4MHEA 1K5OA 2DAMA 4A3KH 3M7GA 5EP4A 4BBAA 4ED8A 2FJ2A 3HOUH 1N63A 5C1BA 2NRWA 2XSCA 4L6TB 4I2EA 2HQEA 1DD2A 3VCBA 2YB1A 1X54A 4RA8A 1W5TA 4TVAB 5EPLA 5C0XI 5JI2E 2UUAM 1E9SA 1LO5D 3FKIG 5EPKA 1HJPA 1K8MA 2NZ1D 4UB2A 1G8ZD 4LF4Q 4DSFA 2H4OA 3B74A 4LJAA 1SIJA 1BGXT 4XIGS 4ALPA 4RPXA 3RRGA 3K1RB 5C0YA 3ILKA 2E2DC 3I3CA 4B9XA 5KQDA 3MHBA 5IGBA 4X5VA 1T43A 5CBEE 1TU2B 7ICJA 1Y8GA 2Z7JA 2M9VA 1G2SA 3HU1A 4RGOS 4AG6A 4EBDA 2RHFA 1Y8NB 1PK1B 2IHEA 4LFCL 1AZPA 1F0MA 3W2DA 3QOLA 2MA1A 2BKEA 2GQFA 5AI9A 2F5OA 4GMQA 9ICRA 1NK8A 4LJ5A 3S14B 1PZID 4JI3L 3K7AH 4MTKA 5AFWA 2EIFA 2YMPA 4QJFB 2C22A 1HUMA 4P75A 4DLEA 3I4NG 4IBEA 3D4WA 3GZFA 4O0AA 2F0VA 2L12A 2Z1CA 4AQYM 1KQQA 4DUYQ 2K33A 1WTWA 1LTMA 2N78A 4PMWA 1VDZA 1S5FD 1EFWA 1M1KC 1ZQYA 2KZSA 3BBZA 5KAIU 3LWEA 5AI5A 3A56A 2WSCF 1YNNC 4UAIA 4MIUA 3IN5A 4X64Q 4NXNQ 1ZJNA 2ASDA 1G4AE 4P4PA 3I4LA 2NRVA 2XI9A 3S14H 1TTEA 4IBIA 3FYHA 3H3VH 5M5YB 4L16A 2F0FA 4JYAM 5AM2A 2DAKA 5J2GA 5ELNA 1I94L 4Z8XA 3GIMA 3C2MA 1Z59A 4OWTB 2MGSA 3GLHA 3QZ7A 4QZGA 3AYHB 1SKSA 3NK9A 3FTCA 4OX9L 3Q8QB 5IZ7D 4BXOA 2KZZA 2R7ZG 2W3SA 4ME5A 1E0BA 1PYSB 3J81E 2F0MA 5LL6S 3J81i 4B9LA 2JEBI 2MRLA 2K6BA 4R8UA 3H4JA 4QIWB 1L2FA 1SLJA 3RBDA 2K75A 4MGKE 3FC4A 1VMPA 2IA6A 2BCVA 2C35B 2F0LA 5M3MB 2DWMA 4EYHB 4IBJA 3K8AA 5I6WA 2K8BB 4DWIA 5IT9c 3IAYA 2JA8H 4QCLA 4M6WA 3GIKA 4ANRA 4KLQA 3STBD 1V1QA 3RR5A 4QWBA 3TKAA 5AM0A 1S10A 4O9MA 1R4QB 1U4RA 4HSVA 4TUWA 1NKCA 2RKOA 1DONA 4B9VA 1OAOC 4CDGA 5DDYA 4R4IA 1NE3A 4DV0L 1IL2A 2KRKA 3THVA 1RQLA 1YNJD 4M2YA 1ZOLA 1M6YA 1C7YA 1L7NA 2KKPA 2BZFA 1X9WA 1RDPD 3NUQA 3NVVA 4OCZA 1HQRD 5D65A 4TUQA 4IBGA 3A45A 3EIEA 4MGIE 1N2XA 4US9A 3HKZG 4JG2A 1RYSA 4KHZA 3PIPA 2KEYA 1KSPA 5HURA 2R4JA 1SXJB 3I91A 4CDCC 2YNMD 5JPMC 1IN8A 5M3MH 2JA8B 4DV0M 3PVSA 4HTHA 4FD2A 3U6DA 2C96A 1I6VC 3ISCA 2YTYA 1Y1VB 3R93A 5J1ZA 4OW0A 1U5KA 1WI5A 2ZTEA 2R93H 3EPIA 4LJ7A 4DV1M 1FGBD 2BDNA 2XIDA 2F4VL 3H8MA 1ZYRC 5HR7A 4OL7A 1EIHA 3CCEA 2HT1A 2ODGA 4ZOHC 4IFDI 2LYAA 5T1GA 3GIJA 3V96A 4ECYA 1IW7D 4FWHA 1R5LA 2L15A 4RQ0A 2MQHA 4AYBG 5KFXA 3WKAA 3U6CA 4YR0A 2WAQE 2CRUA 2M9NA 5L1MA 5AK6A 1ZQHA 1JWMD 3UI2A 3MJ5A 3M0EA 1ZMWA 2DPIA 3NXWA 2ZUDA 1SFOB 2UU9M 5A2QL 3J7ZC 2MROB 2QW7A 3EVQA 3PW5A 4YIJA 4ED2A 1PRTB 1PHJA 2R93B 1ZMVA 1B9NA 1LTLA 4HN7A 1VQOA 3RR7A 4L6V6 4YCVA 1K1SA 5J2HA 2WTFA 3VR3A 4CDDC 1OJLA 5ALSA 1UWVA 3KSXA 1K3WA 4F5PA 4PZ7A 4A3KB 5J39A 1D8BA 5J0YA 4EZ9A 2R45A 3UGJA 4TURA 3O13A 4RQ5A 5A2QS 3U5ZA 1ZRMA 2EQSA 4CJ2C 4RQ3A 4N9PA 4C2MB 1L8QA 2KP7A 4KLJA 1Q7YC 4ILWA 2IOFK 3RMHA 3QYPA 4I7ZC 2R8IA 5KNBA 4IURA 1XPUA 3DLLA 4YY3M 1VQ8A 4FWDA 4WW0A 1XS9D 2P6RA 4N8X1 3K5LA 1J6QA 3A54A 1MJGM 4BBRB 3OHAA 1BR9A 5ALMA 2R7ZH 9ICVA 1E24A 2RCFA 4NRVA 2WAQB 3MFGA 2EVBA 3FTDA 4I5SA 4FE3A 3KF6B