1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
4I2BA 4P74A 4JI6L 2MUTB 1Q7YC 4RQ7A 1BKBA 3PW5A 4F5OA 4KLTA 4RNNA 1WJJA 1X3GA 2BQUA 1GVPA 5J2IA 4LF9Q 2K0BX 4LF4L 4KITB 5KG4A 2BQRA 5CP2A 4BBRG 3C2LA 4DWIA 3ER0A 4C8KA 3H8JA 1TAUA 2JA9A 3CXCA 2Z6KC 1WGNA 4RQ3A 1HQYE 4J9KA 5HP4A 4X62L 1KL9A 2ISOA 1ZQFA 5DQHA 1CKOA 4J9SA 3BJYA 4GN4B 4TVAB 1T8EA 4PG3A 2L4FA 5KFCA 2IT1A 2R7ZG 4UN2B 1PH9A 3V7JA 2VQEL 4EZ9A 4OONA 1A0IA 1VQ1A 3CCQA 3D0FA 3THVA 4BXOA 3I2ZA 1VQ5A 3K9OA 3M9BA 4Y52H 4R65A 4F4YA 4LFBQ 4NXZA 1TK0A 4Z6CA 3K7AH 3RB4A 2AKWB 3PO2H 4RNOA 1YHAA 5GAHC 4IFDJ 3GV8B 1WI5A 5DLGA 4RQ5A 4P4OA 1X3FA 1YIJA 1IXSA 4K4HA 3NEMA 5DG9A 5L1IA 1BPZA 2XY6A 7ICVA 2OQKA 3GTJH 4DV6Q 1G291 4PMWA 3TI0A 5IINA 3L0OA 5KT4A 4PPXA 4M9JA 3PF5A 3KJPA 1KAWA 1VQ9A 4DR2L 5IIOA 3TANA 1PH1A 2IHNA 3HFZB 3T1HL 1QUQB 1XNRL 1TWCH 2DHYA 3M8SA 3F92A 3PO4A 1ZQIA 3I4MH 5DG8A 4KLOA 3KDFB 1JT8A 5DQGA 1N8RC 5C44G 4DL7A 3SV3A 4MF2A 4JBWA 1XXHE 5KG5A 5D49A 2MO1A 2VQFL 2ALYB 3PX0A 1AH9A 1HNWQ 4IQTA 1S9FA 3PUZA 4TUPA 4JC0A 4JYAQ 1WCLA 4C8OA 4BBSH 9ICHA 3K9PA 2XCAA 9ICWA 4LF6Q 2R8HA 4YMOA 2HHVA 1WOCA 3AYHB 5IYBG 1AROP 3CCEA 5CB1A 1VQ6A 5KFFA 3H0GG 2UVUA 4B9LA 3M9NB 4DUYQ 4IPCA 2W9CA 5KFIA 2QGQA 1XSNA 1KRTA 1PA6A 1ZQQA 4KLHA 2R8KA 3I4NH 2F1HA 1PHJA 2ZJQA 2BDPA 3SZ2A 3OW2A 1VQ8A 1A62A 1SL1A 2GVBA 3GV5B 7ICSA 3PUXA 2HT1A 4IRDA 3RJJA 4DSJA 4RQ6A 4BY1H 7ICJA 1OTRA 4AH6A 4GOPA 2XC9A 4I2AA 2JA7H 1XMOL 3GDEA 1YI2A 4DR3Q 1Q82C 4DR1Q 4LFBL 4QWEA 4E0DA 1PH8A 3V6KA 1T4GA 1SL0A 2UXBQ 3PR4A 2PXIA 3CD6A 2W9BB 4DO9A 5J2HA 4OO1G 5IILA 5LMNW 1ZQOA 4MTNA 4DV6L 4YVZA 1DO2A 5KFPA 5DLQE 3PO5A 2AHOB 3LGJA 3U4ZA 4PHPA 7ICUA 1U45A 7ICGA 2PI2A 7ICKA 1K73C 3JPQA 4YCXA 2HHTA 4GN3B 1SE8A 4YWKA 2VUMG 2AGOA 3CCSA 8ICOA 1A8VA 3GTPH 5KFQA 3RLOA 4R8UB 2JA5G 3CCRA 1XJVA 4Q7JA 9ICTA 4RT2A 3ISBA 3TFSA 5EAYA 3PO2G 3GILA 3MFHA 4BA2I 4ELVA 5HGQA 2ES2A 4YY3Q 4KLQA 1U0LA 2YTXA 4R4IA 1GO5A 1HNWL 2IMWP 1RPLA 2GWSA 1WFQA 4A3IH 1ZQWA 1W2BA 4ELTA 4BXOB 1ZMWA 1PH6A 1S0OA 2P6UA 3G6XA 2IHMA 4NLNA 4LF6L 1QZEA 4YG2A 4MEYA 4EBEA 2V1CC 4ECYA 9ICRA 1OXTA 3LWLA 1ZQTA 2P66A 4DUYL 2ASBA 1WCNA 1EIYB 5J2GA 1OTCA 1UWVA 3H4DA 2BWEA 2HHXA 4KI0A 4DKAC 8ICTA 1FL0A 5J0YA 3CPFA 4KHPL 4AIMA 2E2IH 2AGPA 4QZEA 4M47A 3HOZH 1PH7A 4JOIA 5JI2E 2JY8A 4NPSA 4YMMA 3K81C 4DR3L 4WJ3M 3M4OH 4EBCA 2B3GA 2YYZA 3S2HH 1Q1EA 2C22A 2DNAA 1VQNA 4I2HA 2UXBL 2UUCL 1BGXT 2HHSA 2H5XA 1ZQVA 1NMGA 1ZQLA 5DBCA 4DV0Q 9ICOA 3EPGA 3AQQA 2JNHA 4I27A 2ZTDA 3BQ0A 4C3JH 1JJCB 4PGXA 3I4NG 3CMEA 4DOBA 2ID0A 4O0IA 3GO5A 4GKJQ 4KLGA 2R6GA 4LW1A 3UE1A 5D4BA 4RQ1A 2DAMA 4X6AH 4BWJA 4LUOA 5BOMA 8ICVA 1OXUA 4BY1G 3HKZE 3EYZA 1A5TA 4IPHA 4JI4Q 2MNAA 2JA7G 2W9CB 3EWAA 4M9NA 1KRPA 2KNZA 2IA6A 3C2KA 3PY8A 5ELOA 3E46A 2VA2A 2F52A 1VQIA 2WZJA 3TARA 1U5KA 2DI0A 2WB1E 2XCPA 1LV5A 1NKBA 9ICVA 1XPOA 3C1YA 4YY3L 4B9SA 2VA3A 7ICQA 2XGQA 5J0UA 1JE5A 4GOPB 4JG2A 1JB7A 4O5CA 2I5MX 3RTVA 5HHHA 4QW9A 2Q2TA 3Q8LA 1HT2E 2KHIA 5DKWA 4FS1A 1HR0L 1TV9A 3HP6A 5L1LA 4HIMA 3HWTA 2NZHA 4JV2A 3WWVA 1PH3A 2OOAA 3RH6A 4YXMA 2O25A 4KLSA 3L7ZC 2BCRA 4PZ8A 5KFMA 4XIGS 4QZCA 4YWMA 2B29A 2UVRA 3CCMA 2CP8A 3E21A 4G3OA 2WTFA 4GNXC 2FPKA 4FDBA 1EIFA 5J0TA 1LM0A 3OSNA 3UPQA 2J6SA 1NJXA 4DBGB 4UPAA 5L1KA 5J2FA 2HIVA 1QSLA 3FP9A 1ZQCA 2JEAI 2XO7A 8ICWA 4KLLA 4DK3C 2D62A 4M9LA 4A3IG 4POFA 4A3KG 1TKDA 3N4MB 4RQ2A 4JV1A 4Z6DA 2ALZA 4O3NA 4NXNQ 4NXMQ 3QEAZ 4F1IA 2AWNA 1N9WA 3HOYG 2WAQG 2EQSA 4DV0L 5FLXc 1L0WA 1XB2B 3MGIA 2ASLA 2LTUA 4JI1Q 2DFLA 1BPXA 4MEXA 3ZD8A 1PZNA 1VQKA 4ED6A 2KBNA 1S40A 4GKJL 2DAKA 4A3MH 4LUZA 3HX0A 1N56A 2Y0SG 3M4QA 1KFSA 2K14A 3GIMA 5IYDH 4P4PA 4Q8EA 1OXSC 4DL2A 3HOZG 3F2DA 1TWHH 4JI4L 1YITA 4RQ8A 1RIPA 5KT5A 4EZ6A 2ZTEA 3K80C 3FRIA 4PGQA 4Z6EA 3Q8QB 2XTIA 3RZDH 4GLVB 1VCIA 1SLJA 1NKEA 1YZ6A 4QWBA 4KN4A 4DQQA 2YTYA 4A3LH 2LVNC 4O3OA 1MC8A 3V7LA 3QZ7A 1S0NA 1Y1WH 1UE1A 2IY5B 1JXLA 3OSPA 2FXQA 4C8NA 4LFCQ 4ED7A 4QY7A 4G3IA 1ZQXA 2Q2UA 2D0PA 4UBCA 4A3EH 1VQAA 4RG1A 1ZQUA 3JAMi 3RH4A 1SKRA 4FBUA 4EYIB 3NTUA 2AWOA 4M0AA 4UY8C 3M9MB 2DZLA 4JI0Q 5K36G 1UT5A 3KF6B 2B3TA 4IQVA 4B9TA 2DENA 1YJWA 1HZAA 1IBMQ 4X62Q 1SN8A 1QSSA 4J9OA 2A19A 4NXNL 4A3CH 4NXML 1UFZA 3ZD9A 4KLKA 2CWPA 1ZQRA 1LTLA 1D7QA 5J0RA 7ICHA 4UB3A 5L9XA 4M04A 5JUMA 1MIUA 2ZM6L 2KZMA 4JI1L 4KLMA 4YP3A 4JK1A 1OXVA 2GN5A 4I2GA 4YD2A 5M5XH 4X66Q 1XSPA 4RQ0A 4ECTA 5CWRA 1MQ3A 1WYDA 9ICXA 3C21A 3SV4A 2F1IA 1X54A 5GADC 4QQBX 2KCTA 4GLAC 2J6UA 2JJQA 3H8WA 3E0EA 3BU2A 3M7NA 4YXJA 2K5NA 4QZDA 4AQYQ 4YCUA 3GTLH 3Q8DA 3G6YA 4P75A 5HHIA 1Q02A 4DSLA 4DFPA 4WP2A 4DR2Q 1EFWA 1NK9A 3GTKH 4A3JH 2F3IA 1K9MC 4A3BH 2QNJA 1X56A 1CKNA 1CKMA 3BZCA 4GN5A 1NKCA 3J81j 1HH2P 4LZDA 4BWMA 5IIJA 4UAYA 4MFCA 1GD7A 2K4KA 1ZQZA 4ECSA 3MDCA 1L3TA 1PYSB 1PH5A 3SYZA 3JPNA 3UE0A 3HOUH 3BBZA 5IYDG 2R7FA 4B3TL 2VQFQ 4LFCL 2RDJA 5JEAJ 2PI4A 4DF8A 5IY0A 1D9DA 1PV4A 4PHDA 5EOZA 5DFLA 2HVHA 9ICIA 3G4SA 5KFBA 3TREA 4OX9Q 5LMNQ 9ICSA 3ERSX 3CPWA 1JXEA 5IE8A 4PH5A 5IP7G 1KD1C 2N78A 3RR8A 1YHQA 4JI0L 4Z6FA 2KFZA 4J9PA 3GDXA 1JMSA 2NN6G 3I4OA 4DOAA 4NY8A 1IBML 1KIXA 1D9FA 4ECVA 3S17H 2LXKA 5AJ3L 2C28A 3FYHA 4A3LG 4DV1Q 1Y1WG 3G6EA 1L3VA 7ICIA 2CWAA 4AYBE 2FLNA 1AE3A 5DBBA 3W1GA 4JUZA 3T1YL 4K0KL 1HNXQ 3HPOA 3RLNA 3BJUA 3CC7A 4A3EG 4DSEA 3PX4A 1ZQPA 2ZUBA 3IRBA 1XMOQ 2ZUDA 2MROB 5KFYA 4X66L 1HZ9A 1JMCA 1ZQHA 1S97A 4EQ5A 4GC6A 3IHQB 7ICPA 4ECRA 4Q45A 2NRXA 5JEAG 1TR8A 1D8LA 3OHBA 3HOXH 3VDYA 3JAMc 1VEGA 3JPRA 4AQYL 2Y1JA 2R92H 4ELUA 4DR7Q 1PH4A 4DS4A 5GAEC 4UQGA 3OYYA 5DQIA 1B8AA 4OWXB 4M6WA 1M1KC 4IJHA 3H15A 2FPLA 3BQ2A 8ICGA 3H4JA 1KHIA 4QWCA 1NJZA 4DQSA 1ZV1A 4Q44A 5KT2A 3V6HA 1RZTA 1WCMG 3M3YH 3EPIA 2DUDA 9ICPA 2NVXH 9ICBA 3RBDA 5KFKA 4I2CA 5LMNL 2UUAL 4OX9L 1U49A 4HIOA 1IBKQ 1IM2A 3L2PA 2ATLA 3GTOH 1LUZA 3KOJA 4UB5A 4GNXA 4XQ8A 1K0RA 4IFDG 1WHCA 5KG3A 5KFXA 3B89A 2CWBA 3H40A 4YR3A 4A3JG 4A3BG 4JI3Q 1OKSA 5J2CA 4L5SA 4PHEA 4HJ8A 3PO3H 4R4OA 3F2BA 4KLEA 3RRGA 3OJSA 2Q0ZX 1BPDA 5DLFA 2HHWA 4DV1L 2HWJA 5J0XA 8ICSA 4JI8L 1N36Q 4MNOA 4B3SL 4KHPQ 4TQRA 2GVAA 2IX0A 4PZ6A 4C3HH 4DFJA 3NENA 3ZDDA 3UXNA 1HNXL 2BCQA 4NLKA 3S16H 2PI5A 2PI2E 3RJGA 1VQ4A 3RB6A 2ZJAA 5IWAL 1KFTA 1W3SA 4X64L 4RPYA 4QZBA 9ICEA 4BDPA 2UUCQ 1AIPC 7ICLA 4JCVE 3GTGH 4F4KA 4HIDA 4Q8FA 5C4XH 4F2RA 3JPOA 1WJ7A 4FBTA 2LSSA 1VEJA 5J0QA 5M3MH 5M3FH 2UUBQ 4A3FH 2PNHA 4DR7L 2AMCB 3PSIA 4GEWA 5C5JA 1NK6A 2BPFA 3A5ZB 4DLGA 4KLJA 5C0XI 2E2JH 1VQEA 4GXIA 2V9WA 4O9MA 1MKHA 2JK8A 1VQCA 5KFEA 3GIKA 4IQWA 3F1ZA 4LF8L 4ED8A 1U4BA 4F5RA 3C5FA 2NRVA 3GFKB 2JUJA 1UA0A 4MF8A 2XY7A 1G6PA 3PUVA 4DF4A 1XPRA 1VQ7A 2MGWA 3HOXG 1F4IA 4QWDA 4IPDA 1KXLA 2DAEA 1KC8C 3H3VH 1IBKL 3Q8MA 3MABA 2R92G 1HT1E 4F2LA 3GLGE 2V4QA 2UXDL 4UB2A 1CSPA 1TTEA 1HR0Q 2HHHL 4I28A 2E8GA 4QZFA 2NVTH 4JI3L 2ASJA 4A3DH 3MR5A 3H3VI 2HQLA 4DV5Q 4LVSA 3I4MG 4RU9A 3E9HA 8ICCA 4P72A 1VQGA 3OHAA 3NBHB 1N33Q 2C2RA 3KJOA 1X3EA 1N36L 1FGUA 2PFNA 3BZKA 1RXWA 4NB3A 5KG0A 3MR2A 2KZZA 8ICJA 4H02A 3UQ2A 4M6WB 2MJ5B 4BXXH 8ICNA 4OWTB 3CF5A 4UP8A 3LWMA 2OCEA 2FLPA 3J7A5 4RNMA 4KLIA 5C0XJ 2BPGA 4EEYA 3GIIA 4QZGA 1PFSA 1IBLQ 1AE2A 3ZJYC 3TS0A 4C8MA 3EIVA 1HUZA 2AU0A 1S76D 5DB9A 9ICUA 4BBSG 1A63A 4QZ8A 4QGUA 4LFAL 3ORYA 2PFQA 1MN3A 3BDPA 2NVYH 4O2DA 4EX5A 3PO3G 2MQHA 2AGQA 4YFKA 4DL3A 4M9GA 2UUBL 1SRUA 3M8RA 1V1QA 3ZDEA 1SR3A 4QZ9A 2RHSB 4B9MA 3A5UA 1Y1VH 1I6HH 1L5UA 3ULJA 1R9TH 1ZQKA 4DEZA 4ZH4A 1UEBA 3FE3A 1I50H 4K4GA 5KT7A 1O7IA 3BQ1A 3S1MH 4XRHA 2XGTA 3ZDBA 4R66A 1ZQGA 5KFGA 1ZETA 5HY6A 4YD1A 5C4XG 1ZQMA 2N49A 1XC9A 5L1JA 5M3MG 5M3FG 2ZJ5A 3MR6A 4X65Q 2QEXA 4A3FG 4JI2Q 7ICNA 5J2DA 2KHJA 1JN3A 3HKSA 5BPCA 3UDXA 4C2MH 2OTJA 1NY4A 3CAMA 4YHHQ 3EN2A 4DV5L 5KFLA 5J0SA 3JPSA 2Z6KA 1UT8A 5IP9H 5DBAA 1N33L 3TS2A 3S2DH 2YV5A 2R0IA 4L5TA 9ICJA 1VQFA 4R71A 2LVAA 3TRZA 1ZJMA 2ZUCA 2DGYA 2WP8J 5J2BA 7ICMA 4IOAA 3PMLA 1K3RA 2E5LQ 1L2FA 4MZ9A 4KMUA 1IBLL 1RYSA 1CUKA 1VEKA 1SKSA 3K4GA 1VQPA 1E22A 2JZ1A 1CEZA 4JI7Q 1ZQJA 1E7ZA 3AUOA 5J2JA 4JV5Q 1TFRA 2ZM6Q 8ICBA 3KHRA 2YTVA 2RRUA 2R93H 3Q8KA 2JA8H 8ICZA 1NMFA 4HJ7A 2PQAA 1K1QA 4YMNA 2KN7A 4IJLA 1XPUA 4P71A 4FO6A 8ICXA 1T3NA 2Q2IA 4MFFA 4KLFA 3J80i 4BXXG 1IXRA 3TEHB 2E2HH 1PVOA 2NZOA 5IIKA 4DR6Q 1TWFH 4RMFA 2EKKA 3QE9Y 4IOCA 4RQ4A 1KSPA 9ICMA 7ICFA 4DR4Q 3FKIH 4DAMA 4B3RQ 3Q8RB 4P4MA 4F5PA 4KLDA 3AU6A 5KFVA 1XTDA 3DM3A 1X9NA 1GM5A 1OQYA 1Z00A 1FJGQ 5GQOA 3H7IA 3RAXA 3MEFA 2JA6H 4X65L 1TWGH 4A76A 4JI2L 4UB1A 4L5QA 3UQ0A 3ULPA 1Y1VG 2NRWA 4BY7H 1NV8A 2UU9Q 2KNAA 4B3TQ 1MQ2A 1NTGA 5KFHA 4ECXA 1KRSA 1QZGA 4YHHL 1L3SA 2OWOA 9ICQA 2BPCA 4ECQA 3AEVA 4YN4A 4QL5A 4J9RA 4NLGA 2F4VL 3G71A 1NK7A 4IRKA 1XMQQ 1RXVA 5KFSA 3GIJA 2IX1A 4OWWB 2RDIA 1L3UA 3T5JA 4F5NA 1H95A 4TQUS 4HJ5A 7ICEA 1TK5A 3MDAA 2N3SA 2R7ZH 3IM1A 4IR1A 4M9HA 4F50A 3S14H 4B9UA 1MJCA 2E5LL 2LVOC 4ED1A 3W1BA 3PUWA 1B43A 5J3BA 4DV2L 4J9LA 4DLEA 5AJ3Q 3MXNB 1K1SA 3TAQA 4DQPA 3KF8B 3RR7A 4XTCS 4JI7L 3GLIE 1G3IA 1L1OC 3I7FA 1A77A 4JV5L 3RJFA 3KHLA 1XU4A 3T1YQ 5DDYA 4QW8A 1NE3A 1YNXA 4K0KQ 1T9HA 1JJ2A 2DPIA 3F8TA 4DUZQ 2ZJPA 3HT3A 1SMXA 1A76A 4DOCA 2A8VA 9ICKA 3MGHA 2FMSA 3PIPA 4UBBA 2RHQB 3MBYA 3PIOA 4I2EA 5IT9c 2N8NA 1KTQA 5FLMH 2AQ0A 1V92A 1SG9A 2BWBA 1VQHA 5C4JH 4QJFA 1GKHA 4IPGA 3OGUA 1YEZA 4PGYA 2BA1A 2I5HA 4LF7Q 2MR9A 4ECUA 2MAXA 4DR6L 3KLWA 3ZDCA 1T7PA 2WAQE 1OAIA 3UXOA 4UP7A 5C44H 2HHUA 3RN2A 3UDIA 4DR4L 4B3RL 2LXJA 1VS0A 3GLHE 1C7YA 3A74A 4QZIA 5DDMA 5EWGA 1FJGL 2R93G 3SI8A 4R4CA 2Y0SE 2J6TA 1ZYQA 4B9NA 2Z0SA 4DFMA 4B3ML 1ASYA 1EOVA 2VY3A 4JWMA 1YJNA 1NOMA 4A3MG 5DB6A 4JWNA 1GO3E 4IO9A 4UAWA 3KHGA 2UU9L 4NM1A 4NLZA 5IYBH 1B70B 3H0GH 4O5EA 8ICHA 1ZQNA 3CCUA 4HJAA 1C0AA 3JPTA 1IZ6A 1QLNA 3W5OA 3KFUA 2PQAB 5H1SE 1XMQL 2UUAQ 4J9NA 5HNKA 2BR0A 2BCVA 1CSQA 2DKLA 1NJWA 3RN5A 5C3EH 3M9OB 3RJKA 3KYHC 2KTQA 5F9LA 3FKIG 5JJKA 1XNQQ 3J80c 2W9BA 4YCWA 4DK6C 4JBMA 3RNUA 4OXPA 1V43A 2BHNA 2B63H 1Y88A 2JA6G 1ZQBA 4B9VA 5KG1A 1X2IA 1NJIC 4DL6A 3PW4A 4F8RA 3RJHA 4JI8Q 4IQUA 4QZHA 1TWAH 4R63A 4BY7G 4RT3A 2I1QA 4B3SQ 2FLLA 1LYLA 1SKWA 1E94E 3BQTA 1S0VA 2DPJA 4GC7A 4R4TA 4C3IH 5KTQA 1Z00B 4DUZL 2L2DA 2K75A 9ICLA 5IWAQ 4R8UA 5E7NA 2AJQA 3U50C 4X64Q 1VQJA 1S0MA 1EQQA 1VDLA 4NM2A 2PFOA 4OO1I 2JEIA 4KTQA 4DS5A 3GTMH 3CCJA 9ICFA 2VUMH 4LF7L 5DB7A 2LYHA 2OTLA 8ICLA 4QZAA 4I2JA 1JJGA 4YR0A 1EQRA 2JA5H 8ICAA 1S3OA 4HYKA 4A3CG 4P2HA 2PMZE 5IYCH 2L4EA 3PVXA 3RZOH 4DQRA 5HMMA 2MFIA 1NK0A 1VQBA 2R8IA 5KFRA 5J29A 4RZRA 2DAIA 2EIFA 4LZGA 4M2YA 3OJUA 1BVSA 2W9MA 4LF8Q 2VW9A 1EFUB 2DAGA 1E1OA 4DV7Q 3UDFA 2G3QA 3RB3A 3U58A 3RJEA 1I94L 4J9MA 4APVA 4DV4Q 3S1QH 5FLMG 1MSWD 2R8JA 2BH8A 1KEJA 4PHAA 3PCOB 1HZBA 4Q43A 5BOLA 2V4RA 3S1NH 5DGAA 3RRHA 2UXDQ 3STBC 3CP0A 3CW2C 3S24A 2HHHQ 8ICYA 2CQOA 1XNQL 3CC4A 2KFNA 2K52A 7ICTA 2HW3A 3KTQA 4F2SA 2FMPA 1HJPA 4LF9L 2OO9A 3PW0A 3UXPA 3GV7B 3QEBZ 4HIKA 3C5GA 7ICOA 5F9NA 1KQSA 3HOUG 2JEGA 1KDHA 8ICKA 5GROA 1S72A 4HEOA 3T6PA 2BCUA 3A0JA 8ICUA 1CKNB 2JEFA 5J0WA 2JQOA 2Y1IA 4P73A 3MR3A 4GXJA 9ICCA 3Q8PB 2A1AA 3I56A 3RJIA 5C3EG 5KFUA 3E9IA 4LFAQ 4ECZA 5EWEA 3Q8SB 3J81c 3PW7A 1UE6A 1WR1B 1DO0A 1E3PA 2JY7A 3PMNA 1QVFA 5JJIA 3S15H 1RYRA 1P8LA 3ISCA 1PH2A 2B63G 4JV0A 1X9WA 1TAQA 1DV0A 2KCMA 4EBDA 3RBEA 1TK8A 3HKZG 2EXDA 2W9AA 1NK4A 4DFKA 2I5LX 4A93H 3B0YA 4F4WA 1ZQYA 4BA1I 2JY6B 1ZQSA 1KLNA 3GTQH 1C9OA 4UAZA 5J0OA 2JEJA 4FS2A 1TXYA 2C2EA 1HUOA 1UE5A 4YCVA 4R4QA 5FJ8H 2WB1G 3DLLA 4DV7L 2RCNA 1XS9D 2JEBI 2R7DA 3ZDAA 1NV9A 2D0OA 1ZQDA 4DV4L 1G41A 4TUSA 1UA1A 1X9SA 5KFJA 4F4ZA 4UB4A 3N97B 4X5VA 1NBWA 4GLXA 3H4BA 1YLAA 3CCVA 7ICRA 3M85A 1N48A 1UE7A 2F1JA 3LDAA 1K8GA 2A1JA 5IYCG 1WIVA 3LCUA 4F92B 1IFYA 3NELA 4JBJA 3PW2A 2ZJRA 1BPEA 1BBUA 1KFDA 5CA7A 4O3RA 2VNUD 3OTOQ 1HZCA 4A3KH 4JYAL 4DSIA 3TQ1A 4HJ9A 3IHPA 1BPYA 1VQLA 2LVPC 5KT3A 3K75D 1VG5A 1Q1BA 8ICFA 5BR8Q 1YJ9A 3T5KA 3HOYH 1PGYA 5KFNA 2K5HA 1L1OA 1VQDA 4GS3A 3C23A 4LWCA 4PZ7A 5IIIA 4R64A 4ED0A 1E1TA 3TAPA 2LBCA 1JR3E 5EWFA 1ZMVA 3ISDA 5KFTA 8ICEA 4YQWA 2MO0A 3AFPA 5CJ7A 1SL2A 1J6QA 3H8SA 2UVVA 4XUSA 1EXNA 4CCHA 4I2IA 5CHGA 3NGDA 3RH5A 4RUCA 4DSKA 4JBKA 5KFZA 5KG2A 3EW9A 1S77D 4DR1L 2KENA 2QA4A 4DV3Q 2KZ3A 1Q46A 1HNZQ 2CFMA 1T43A 3T5LA 2BH2A 4LNQA 3U4VA 2K9DA 4GNXB 2PFPA 2LVQD 2ZTCA 1D8YA 5KG7A 4C8LA 4ED2A 2XGPA 3GLFE 1SROA 4KN7A 3CQZH 3HOWH 3PF4A 2KHHA 3S1RH 5KFDA 3ULLA 2UVWA 2FPMA 4RPZA 2W8KA 1EWIA 2RF4A 3KF6A 2JZBA 4L5RC 9ICNA 3CMAA 2HIXA 1T6OA 4YWLA 1X9MA 1N34Q 3C2MA 5C0XG 2VS1A 4R1JA 1COOA 1S10A 2VA8A 3T3FA 2IHFA 1PYBA 1SFOH 3V6JA 1IYJB 4A93G 1RL2A 2EKFA 5DG7A 4K4IA 3KHHA 1QTMA 4LF5Q 2I9GA 3EBEA 3JC66 2Q2HA 2P6RA 4A3GH 3LCVB 3OTOL 4A75A 5FJ8G 4J9QA 4POGA 4IRCA 4XA5A 2F4VQ 2QHOB 3LK9A 3RR5A 5DB8A 2C35B 1QVCA 8ICRA 2CCZA 1Z9FA 1R4GA 5BR8L 3PGZA 4O3PA 4ED3A 5DGBA 4DL5A 4DR5Q 4WJ4A 1X55A 4BGDA 1Q86C 1J5EQ 4GKKQ 3ICEA 5HMLA 1IL2A 3D31A 2UXCQ 3FRHA 5M5YH 4DV2Q 1Z3EB 1U47A 2QSFX 3CCLA 2NRTA 4ECWA 1NJYA 1QSYA 5GAGC 4J15A 1Q12A 3QZ8A 1I3QH 4O5KA 5M5WH 2JE6I 3GQCA 5LMUQ 3C1ZA 1KYIA 8ICQA 4A3DG 3B6YA 2AQ4A 3T5HA 2ISPA 4DV3L 2OQ0A 4YR2A 4TUQA 2HAKA 4I2FA 8ICIA 1HNZL 1G4AE 1JX4A 2KNVA 2ATWA 2A1JB 1U48A 4JI5Q 5D46A 2MUTA 1I5FA 3HW8A 1MJEA 4F5QA 1DOQA 4GOPC 2HHQA 3PUYA 4QWAA 2W8LA 3STBD 2JZ0A 3J7ZC 5KG6A 5KFOA 3HOVH 4DSFA 1ASZA 3PNCA 1HR0W 1BBWA 2BKEA 4ALPA 1P3QQ 4F91B 2VZAA 3M4PA 2VANA 1L1OB 1FVIA 5KFWA 3K7UC 9ICGA 3AU2A 4DL4A 1N34L 1N32Q 1B7YB 3SGIA 3B0XA 5J2AA 1ZQAA 2R8GA 4B3MQ 1BPBA 5TZVA 5J0PA 1YHBA 4BBRH 1YVCA 2IBKA 5IP7H 2I0QA 3JPPA 4EYHB 2L15A 3PX6A 4O0AA 2JP7A 3TFRA 4LF5L 4DNIA 2NRZA 4UP9A 1VQMA 3IECA 2ZJ8A 2BA0A 1IM4A 1Y14B 4I2DA 1K8AC 5KFAA 2IHEA 3HOWG 3RLFA 1TVAA 4F93B 2NN6I 2YU9H 1X65A 3G48A 3F2CA 4DR5L 1ZJNA 4JI6Q 3FDSA 1QZHA 2B21A 3PV8A 2K50A 1J5EL 1YBYA 4GKKL 3PV0A 4TURA 2UXCL 2BQ3A 5J2KA 4AYBG 5J2EA 4IR9A 4LF4Q 1E24A 3V7KA 3V72A 1Q8KA 1JIHA 1H38A 4ME3A 5CR0A 1V9PA 3TQYA 2JZBB 4RUAA 3AFQA 1QUQA 1G51A 5JJLA 9ICAA 5LMUL 1M90C 1X6OA 1EYGA 5KT6A 2BCSA 2M9NA 4A3GG 3KDFA 3FHWA 1P16A 5IP9G 2JY5A 4TQSA 2OOBA 4DQIA 4JI5L 1SZPA 4RPXA 8ICMA 4KLUA 2CKZB 1XWLA 4KHZA 4A4IA 4O3QA 2HVIA 1EUJA 4QIWE 2XY5A 4JOIC 3RAQA 1XO1A 2WFWA 2VQEQ 1Y8GA 4GXKA 2VL6A 5ELNA 4F3OA 1OXXK 3CC2A 1K83H 3G6VA 4DPGA 1U9LA 4Y7NH 1B22A 1WGLA 3GD7A 3UDGA 2C2DA 1LB2B 3K8AA 2BGWA 3K0XA 3I55A 2ASDA 2NVQH 3MFIA 1ZQEA 1WCMH 3ETLA 1VQOA 1N32L 4LUVA 2JA8G 2FMQA 2EJSA 1ZMUA 3EZ5A 1NK5A 1I94Q 4O3SA 4MFAA 4F4XA 3J81i 3MMPA 1QVGA 5IIMA 4DAYB 1Z47A 3T1HQ 8ICPA 2K5VA 1XNRQ 1XSLA 1Q81C 1DGSA 1NK8A 3E2EA 3HOVG 3RB0A 4I29A 3PR5B 4IFDI
chains in the Genus database with same CATH superfamily
4I2BA 2LHCA 1LT3D 4JI6L 4RQ7A 1ZYRC 2EJFC 1PM5A 3OTQA 5AKKA 3TWKA 1T5EA 1X3GA 2K0BX 4LF4L 1JI7A 2XI9A 4DWIA 1R2ZA 3ER0A 4C8KA 1TAUA 3CXCA 4DAVA 2BDOA 2Z6KC 1WGNA 5HP4A 1KL9A 1ZQFA 4AKHA 3WDNA 3KP1E 4TVAB 2IT1A 5DNFA 4UN2B 3V7JA 5LMNM 5FOBB 4OONA 3D0FA 1BCPC 4BXOA 4N9PA 3M9BA 4F4YA 3K5MA 5AM1A 3LQQA 2B2YC 5GAHC 3BS1A 1WI5A 4C3HB 5DLGA 5CV5A 2QENA 4RQ5A 4P4OA 3S16B 1IXSA 2B2VC 2YQZA 3OPXA 4JI8M 1BPZA 3GTJH 4PMWA 3TI0A 2DUYA 4PPXA 4M9JA 3PF5A 3KJPA 4DR2L 3M8SA 3F92A 3S15B 3I4MH 5M3FB 4ACOA 4A3FB 1QQ7A 5DQGA 1OIZA 5C44G 4DL7A 4MF2A 4JBWA 2VQFL 1QE6A 3U6OA 3GTQB 1HNWQ 4IQTA 1S9FA 3K9PA 2HDLA 1WOCA 1MU5A 4B9LA 3BQ7A 4G4NA 2LI6A 1KRTA 4NL9A 4CF3A 2BDPA 2CVRA 1LTSD 1V33A 1SL1A 3GV5B 3C1FA 2OXPA 3PUXA 2HT1A 4RQ6A 2F0UA 4BY1H 1OTRA 5A0LA 2XC9A 1IBKM 3GDEA 5ELFA 4QIWF 4LFBL 4E0DA 3QB3A 3WHKA 1SL0A 5G5GA 1NCVA 4C3IG 4JK1C 4WRDA 5J2HA 1ZQOA 2LKYA 3KFUF 4YVZA 3VKGA 3U4ZA 2RKSA 7ICGA 3DFZA 4IBEA 4GN3B 2XSCA 1SE8A 3BYTB 4PMBA 2AGOA 8ICOA 3GTPH 3CCRA 3KP0E 1XJVA 1Y8OB 5AHXA 3ISBA 3PO2G 3GILA 3MFHA 2EZXA 4YY3Q 1U0LA 4R4IA 3D8LA 2EOTA 2BDNA 4A3IH 1I50B 2L0CA 1U4MA 2IHMA 2JH1A 4NLNA 4D82A 2WAQC 4EBEA 1HA6A 3QU9A 3NK9A 2P66A 3KOOA 3H4DA 4KI0A 1WTHA 2Y0SC 4Q5VA 2AGPA 1MBYA 4M47A 3GLGA 1RYUA 1SZHA 5JI2E 4NPSA 4YMMA 3K81C 3DUZA 2HDOA 3M4OH 2B3GA 3DWPA 3U6QA 3AMZA 1VQNA 4CKBA 2HHSA 2QB0A 1ZQVA 3EPGA 2K7VA 1G8PA 3BQ0A 4WURA 2C99A 3I4NG 1WD1A 3HGBA 2R6GA 4Z8XA 5D4BA 4X6AH 1IQPA 2R93B 4AKGA 1D1KA 1GJXA 4QHTA 2H3QA 1XXHB 2GA4B 4M9NA 2CW0D 1X66A 2XSZD 2EPBA 1LTGD 2LBOA 1TAMA 3HHXA 4ZUIA 1XPOA 3G7LA 1GUGA 4JG2A 4O5CA 2I5MX 2KZSA 5ISRA 1TWFB 4CE6A 4QW9A 1HQCA 1HT2E 4FS1A 1TV9A 3OMGA 3FKIB 4CJ0B 3HWTA 3NRWA 1XO0A 5CR3A 2XSZA 4JMUA 2O25A 5KPRA 2F0HA 4ZLTF 4YWMA 2B29A 4CGZA 3CCMA 3I90A 4G3OA 2MGSA 1LM0A 2J6SA 2Y21A 4DBGB 2HIVA 3URYA 4DK3C 1QYRA 5ALVA 4A3KG 1TKDA 4RQ2A 4Z6DA 5EKKA 3NE5B 2B2TC 2EQSA 5FLXc 1Z4NA 1XB2B 3MGIA 2JXMB 1NNJA 4JI1Q 4N8X1 4V0BA 5DEHA 4GIPA 4GKJL 4RGNA 4A3MH 1QOHA 4FZLA 1KFSA 2J7NA 1U4LA 3E5SA 4DV2M 3HOZG 3F2DA 4FCWA 2VF7A 1RIPA 5KT5A 4CJ2C 4LMQD 4JB3A 4JV5M 4Z6EA 3NVVA 4GLVB 1R4QB 4J03A 5C4JB 2YMLA 3IFDA 4EIWA 1II3A 2YB4A 2DJFC 3GP7A 1YZ6A 4C3JG 1V38A 4A3LH 3K59A 1UE1A 3SAWA 1KSFX 2F2AB 1S3SA 4C8NA 2P35A 4UBCA 1MGSA 5AI9A 3U9OA 3UMGA 4RG1A 1ZQUA 4FBUA 1SKRA 4B3RM 4EYIB 3NTUA 5I2XA 4M0AA 2DZLA 5K36G 2KVSA 5JEAH 4IQVA 2ESEA 2DENA 3T16A 4X62Q 4J9OA 4A3CH 1ESFA 1LTLA 3TBIB 1D7QA 5J0RA 4R3DA 1BDOA 2K33A 2KZMA 4R8IA 3I1YA 4YD2A 3KUPA 2K4EA 2W82A 3I4LA 5M5XH 4X66Q 5G3LD 5CRXA 2KOBA 2K04A 2F1IA 5GADC 3U6EA 2Z8YM 1EYCA 2KJ5A 2J6UA 3U6LA 1I4GA 3M7NA 1Q39A 4AQYQ 2Y0QA 3G6YA 1QCBD 4P75A 1Q02A 4WP2A 1D0MA 2IOHA 1NK9A 4A3BH 2QNJA 2VUMB 2WV6D 4GN5A 1HH2P 3KLSA 1GABA 3MDCA 3K7AB 3RZOB 3SYZA 3IV6A 3QUQA 1RJTA 5IYDG 5EP4A 5CMDA 3HS0C 4LFCL 4EQPA 3GZFA 1QZMA 5EOZA 3VK7A 5DFLA 9ICIA 3CP8A 1OFIA 3ERSX 2LKVA 5IE8A 4JI0L 2C98A 1JMSA 3GDXA 1JR0D 2CN1A 3I4OA 2NUCA 4NY8A 4OHJA 1D9FA 4EENA 4ID6A 2CQAA 1L0YB 1B50A 2LXKA 4GITA 4Y2JA 3FYHA 1Y1WG 3G6EA 1L3VA 3GQBA 3ICXA 1B4OA 4S3SA 3J81S 1HNXQ 3CC7A 4DSEA 3PX4A 1ZQPA 2ZUDA 1EY8A 1ECWA 4L15A 1XNQM 3T79A 3IHQB 7ICPA 4DU9A 3BG3A 4LF9M 2NRXA 5ALKA 2IL8A 3P1HA 2FFJA 3J27B 3IAYA 3JPRA 2R92H 4UQGA 1B8AA 1XWEA 3U6MA 2EY5A 1VMPA 4IJHA 4M9ZA 3H15A 2FPLA 2KHVA 2HKJA 4A93B 4QWCA 1NJZA 3SK6A 1EEID 1HXYD 1RZTA 3M3YH 1JICA 1IKMA 9ICPA 2NVXH 3SHGB 5KFKA 4RGMA 4Q0FA 5AI8A 1TS4A 5KFXA 4A3JG 4DV7M 4JI3Q 1WUDA 4QNMA 1CK1A 1EOTA 3OJSA 2Q0ZX 1BPDA 1RHPA 2K28A 3R3OA 1RODA 1IYVA 3CYMA 4KHPQ 4HL4A 1PDQA 4PZ6A 5H2FU 4DFJA 3NENA 3UXNA 1KABA 2BCQA 4NLKA 4XQQA 1VQ4A 5I4DA 2R4JA 1W3SA 5EE0A 4RPYA 9ICEA 2FJ2A 3HOYB 3TQSA 1SWVA 4F4KA 4HIDA 2KUMA 5C0XH 5J0QA 5G3LF 5ALRA 2Z8LA 2ZAOA 4CJ1B 1SYGA 1NK6A 4NLBA 2BPFA 2E2JH 4GXIA 1G8ZD 3FUWA 4C1NK 4O9MA 1MKHA 2JK8A 1VQCA 4IQWA 4CGYB 3F1ZA 2QZ4A 3I76A 3C5FA 2NRVA 3A98B 4YIJA 1TGUA 4G9BA 4DR1M 4DF4A 1D5ZC 1XPRA 2MGWA 4QIWC 3HOXG 2HD3A 4QWDA 4IPDA 3J7BA 2BE5D 2SNMA 1URJA 1TTEA 1MJGM 1GOZA 4FWGA 2B8FA 3TDQA 2ASJA 3H3VI 2HQLA 1IXSB 1PZKD 4AYBB 1DGJA 4P72A 1SE3A 3H91A 2C2RA 1A2TA 1SFOB 3DWQA 1N36L 1FGUA 2EY6A 4HSVA 4NB3A 2DZNB 3MR2A 2KZZA 4G7OC 3UQ2A 4UP8A 7CATA 3BDCA 4RNMA 2BPGA 3MWYW 1PFSA 3ZJYC 3EUB2 5FO8B 5DB9A 4BBSG 1TR5A 4QGUA 3ORYA 2PFQA 3I8ZA 3K1JA 4ZOHC 5FLXS 2E5SA 4M9GA 2UUBL 1SRUA 3M8RA 1F77A 2FDRA 4QZ9A 4M9SA 4KODA 5EXTA 5M5WB 3BS7A 3D2NA 3ULJA 1ZQKA 4DEZA 1TE2A 1L1TA 1LKYB 1B4FA 2HCIA 4K4GA 3MXNA 1QAMA 3QWNA 1WTXA 2MH8A 2CH4W 3PNYA 3EA6A 2AQ2B 3NTHA 5KFGA 2N49A 1X40A 1XC9A 1HNZM 4O3MA 2YY6A 4CJ6A 5M3FG 2E2DC 4A3FG 1SYBA 1R2YA 3FPUB 2I07B 4DAPA 3PVSA 1Z6HA 3UDXA 1NY4A 3CAMA 4YHHQ 5KIXA 3GU3A 3FM9A 3S2DH 3CKIB 3RGPA 2R0IA 1SV0C 1VQFA 5IGGA 4ZPXA 2WP8J 3KBGA 5J2BA 7ICMA 3PMLA 1K3RA 4MZ9A 1IBLL 1B9NA 1E22A 1STBA 2JZ1A 3BYYB 4JI7Q 3AUOA 3RMHA 1TFRA 2ZM6Q 3KHRA 2A6HC 2LM1A 5AIBA 4A3EB 2WSEF 2PQAA 5KPZA 1K1QA 4YMNA 4DR5M 1D1IA 2E2HH 1PVOA 3SQIA 2LHTA 5IIKA 1SNPA 4US9A 2EKKA 4IOCA 2X6LA 1KSPA 1COKA 9ICMA 4IBDA 1SE4A 4DAMA 4P4MA 3AU6A 5KFVA 1XTDA 1GM5A 5EKLA 1Z00A 1FJGQ 5GQOA 3H7IA 4X65L 1V1OA 3SAGA 3J81E 3ULPA 1EIJA 1NV8A 2QB0B 1X37A 1K8MA 1MQ2A 4UW9A 2FI1A 2OWOA 1RDPD 4YN4A 3BDLA 4PL1A 2FJ6A 1E2WA 4OD0A 3WKEA 4HJ5A 7ICEA 3MDAA 3IM1A 3U60B 1MJCA 2KEYA 2E5LL 1B43A 3KKAA 4J9LA 1PTOF 1JB0F 5K4LA 1AZPA 1Z59A 1T5XD 3TSSA 1RF2D 1ESRA 1A77A 4M0DA 3RJFA 2KMDA 1GUTA 1XU4A 3T1YQ 1JJ2A 3DV9A 2ZJPA 1OXJA 1SMXA 4JI6M 3K6OA 3GLFB 2N8NA 5FLMH 1V92A 4LF4M 3FVQA 2BA1A 3MTSA 2MR9A 4ECUA 2MAXA 4DR6L 2ZIVA 3HU1A 4UP7A 5C44H 1C4QA 2LXJA 3B7QA 2OQ4A 3BXWA 4QZIA 2R93G 3FD9A 1GL6A 1ZYQA 4B3ML 1OJLA 3H0MB 2SEBD 1YJNA 4JWNA 4IO9A 3D8BA 4NLZA 1G6ZA 3KSJA 4L63B 4HJAA 1IZ6A 3GTJB 2PQEA 3A8IE 5HNKA 2BCVA 3RN5A 2R65A 3M9OB 3RJKA 4DXGA 4DFDA 3FKIG 3J80c 3RNUA 4OXPA 3I4MB 2ZIUA 1I94M 4ZKCB 3F53A 1EY6A 4JI8Q 1TWAH 4R63A 2IOFA 4NJ8A 2FLLA 3QAUA 2CW0C 1SKWA 2R61A 1E94E 3BQTA 4C3IH 5CV7A 3O13A 4DUZL 2K75A 3THGA 4R8UA 3U50C 1CA6A 3B74A 2VQFM 1S0MA 1VDLA 2DHRA 1JWSD 1H9SB 3GTMH 3CCJA 1B1ZA 2F3VA 4LF7L 3D4WA 2LYHA 1F9QA 4U6PA 1ICFB 3LW5F 4I2JA 1JJGA 4YR0A 1EQRA 2JYOA 5GTIU 2FS1A 4OJLA 4EEKA 1VQBA 4IUVA 2YN4A 1PK1A 4BY1B 4RZRA 2DAIA 2EIFA 4LZGA 1BVSA 1SJED 2BNKA 4CDGA 3RB3A 2KW0A 1M6YA 4DV4Q 2RBMA 4KKUA 4FO2A 2R8JA 2BH8A 3SVMA 4LFBM 1HUNA 2DWLA 2V4RA 5AM0A 5DGAA 2UXDQ 5JI3E 1ZOLA 3CP0A 3CW2C 2P5ZX 3S24A 2HHHQ 8ICYA 2CQOA 1N5XA 1ET9A 2AXTU 5FK9C 1HJPA 3GTPB 3C5GA 1TDZA 1SDFA 3HOUG 3TZDA 1TVXA 3LYSA 1KKXA 3UK6A 2M60A 1S5LU 3A0JA 8ICUA 2JEFA 4A3IB 1JWMD 3IG8A 2JQOA 2KQ3A 2G5GX 3MR3A 2M9VA 5CEHA 1SYDA 1PZJD 3E9IA 4ECZA 5A2QS 4OEMB 3Q8SB 5AKZA 3C3EA 1UE6A 4JYAM 1HQRD 1E3PA 2JY7A 4MGKE 5JJIA 1P8LA 3FTCA 2YQEA 1DV0A 3MHBA 2KCMA 3M6AA 2EXDA 3TMEA 2Y9TA 5LL6S 3B0YA 3A0BU 4BA1I 1KLNA 1C9OA 2RQXA 4UAZA 4FS2A 4R4QA 3DLLA 3M4OB 5BN4A 1XS9D 2JEBI 3RUZA 3ZDAA 2D0OA 3N97B 1UQVA 2VF8A 3HKPA 2RLTA 1EY4A 3NVWA 1N48A 1K8GA 4KX3A 4GIBA 1R6BX 2HBMA 1IFYA 1BPEA 3OIPA 4O3RA 4UB8U 1SBBB 1HZCA 4A3KH 1LVHA 1QILA 5BR8Q 3T5KA 4K6LA 4GS3A 4IUUA 3C23A 4ED0A 1HIWA 2P5TA 4Y2RA 1EY7A 5EWFA 4HCSA 4PL2A 3AFHA 5CJ7A 2UVVA 2F0EA 5CHGA 3NGDA 3RH5A 4DSKA 2PMZB 4JBKA 2R45A 5KFZA 3EW9A 1OUQA 3V2TA 4DV3Q 3SAFA 2BH2A 4LNQA 3U4VA 3HJQA 2PFPA 2ZTCA 1D8YA 3R2TA 5ELCA 3PFIA 1YUBA 2XGPA 3GLFE 5CV9A 4KN7A 3DXJC 3HOWH 3PF4A 3V76A 2UVWA 4RPZA 2JZBA 3PIO3 3A7AB 2EDGA 1JALA 1D8BA 2PYKA 3OWFA 2VA8A 1PYBA 8CATA 4A3MB 4A93G 5K36H 2Q2HA 2P6RA 4A3GH 1MD2D 3OTOL 1CHQD 4GKJM 1STNA 1ZD2P 2QHOB 5DB8A 2C35B 4ZUJA 1Z9FA 3PGZA 3RFAA 5EE1A 5DGBA 3DA1A 1Q86C 1KFVA 3D6WA 4RKBA 5HMLA 1YT3A 5M5YH 4DV2Q 1Z3EB 1JRPA 1U47A 3CCLA 2NRTA 5AK6A 4ECWA 1Q12A 4O5KA 5ALLA 3D4RA 3J7AS 4A3DG 2CUZA 1DD2A 2AQ4A 3T5HA 2OQ0A 4Y2UA 4I2FA 3QYPA 1G4AE 1B9MA 4JI5Q 3UI2A 2MUTA 4K2KA 2EO2A 3NQTA 1MJEA 1WD0A 2EZYA 2WF9A 3STBD 2VKQA 2F76X 2ZXRA 1ASZA 3PNCA 1BBWA 4ALPA 1YSYA 1L1OB 1Q3CA 1FVIA 1D2BA 4CKEA 1WTRA 5KFWA 3K7UC 1N34L 2ZBKB 2A6EC 5IREB 3SFZA 1B7YB 1JCKB 4CHTB 3I73A 5M5XB 5TZVA 5J0PA 4BBRH 4DF7A 4EYHB 4O0AA 1PJQA 3T56B 3NWLA 3TFRA 3A56A 1IM4A 1Y14B 1QQ6A 5AM2A 3RLFA 2DXIA 4F93B 3FUUA 5AFWA 4GKKL 3PV0A 4A3BB 3PSFA 2UXCL 2W3SA 5J2KA 4AYBG 4IR9A 4IIWA 1E24A 3V7KA 3DOAA 1Q8KA 4LJZC 5CR0A 4HN7A 2Q8RE 1X6OA 1EYGA 5KT6A 4J6HA 2LFNA 2OOBA 5KNBA 1I4WA 4LFCM 4RPXA 2C5CA 2CKZB 4PDGA 3JR4A 4JOIC 1L2BA 3RAQA 2BE5C 4L8JA 1Y8GA 4FVMA 1OXXK 3G6VA 3ITPA 5AICA 2NBFA 1U4PA 4JI0M 1B22A 1TF0B 3U6DA 1N61A 2F0JA 2C2DA 1XC8A 3TP7A 2NVQH 1WWVA 1ZQEA 3ETLA 1PFNA 1PTOC 1N32L 3IFTA 2PPBC 1NK5A 3D3RA 4O3SA 5COYA 4G4OA 3IRUA 2Z4HA 3T1HQ 8ICPA 2DN8A 3VR3A 4C80A 1S5BD 1XNRQ 2YR0A 1XSLA 1DGSA 1NK8A 5A2QE 1LTRD 3S9WA 3PR5B 2R92B 2XN9C 3BVMA 5ELEA 1T3TA 3L4PA 2PO4A 2EYPA 2KICA 4ANRA 4KLTA 2OT2A 4RNNA 1WJJA 2X69A 2F4IA 1GVPA 4LF9Q 1Z6TA 3K5NA 3QOJA 5KG4A 4NC6A 3NHHA 5HR6A 2LH0A 3M3YB 4OO1H 2NVXB 3ZQJA 3BJYA 2VJ5A 2XWBB 4GN4B 4FXKC 1G2TA 2QARA 5AKIA 5FTMA 3SEIA 4EZ9A 5AI4A 2K6AA 3F5EA 2L55A 1VQ5A 4R65A 1QVRA 4K5VA 1YHAA 3SD7A 4CKCA 1N5WA 1YIJA 4DV6Q 1G291 5KT4A 1ZD5A 4XK8F 2L6OA 1KAWA 3VFDA 3HFZB 1TWCH 3PO4A 1N77A 1NR2A 3KDFB 1X6JA 4KMOB 4JVZA 5JAVA 4IUQA 2E2JB 1AH9A 3RF9A 4TUPA 1Z5BA 1G91A 3Q23A 1RD9D 4C8OA 4BBSH 2XCAA 4YMOA 2Q4TA 1VQ6A 4IBIA 3H0GG 2JRZA 3M9NB 4DUYQ 3W0FA 4IPCA 2W9CA 1FO4A 2YFQA 5IGFA 2ZJQA 3SZ2A 4C0ZA 1VQ8A 3MEHA 2FE8A 1A62A 2GVBA 7ICSA 4IRDA 4DSJA 7ICJA 2E76C 3KKAC 1XMOL 4DR3Q 5FSWA 1IY2A 4DR1Q 3MAQA 2KSOA 1IN5A 3V6KA 1T4GA 2UXBQ 4GHAA 3PR4A 1Q3VA 3CD6A 1ZD3A 4DO9A 2FE9A 4BWGB 1N36M 4MTNA 4X3KA 2B2UA 1DO2A 3AKZA 5KFPA 4NW2A 2AHOB 7ICUA 2Z9HA 2PI2A 1TY0A 2EUCA 7ICKA 1N60A 1ED1A 1DRGA 1PLFA 5KFQA 4R8UB 4Q7JA 9ICTA 4RT2A 2K05A 5F2DA 4BA2I 4P0PB 2W7PA 2UUBM 4KLQA 1I4QA 3I91A 1HNWL 1RPLA 1YNJD 1ZMWA 4O42A 3E0JA 2O5IC 1QZEA 2VDBB 4ECYA 1OXTA 1MX0A 1PK1B 1ZQTA 5J2GA 4UATA 5KNDA 2BWEA 4RGOS 4DKAC 2TSSA 3R9XB 2R62A 2KIVA 2N55A 2XFSA 1GLNA 3KXEC 4EBCA 2YYZA 5E1FA 3S2DB 2C22A 2DNAA 2K4IA 1LV7A 2KDLA 2H5XA 3L5KA 1ZQLA 4DV0Q 5EQ0A 9ICOA 5ALZA 4CRXA 1ZYRD 1SB3C 4L16A 2IX3A 4DOBA 4O0IA 3GO5A 1O08A 1PFBA 3D8GA 4RQ1A 4AP9A 5KYLA 1IBLM 4BY1G 1RDFA 1A5TA 4IPHA 4JI4Q 2H1EA 2MNAA 1Z1BA 3C2KA 3UJNA 5DAUA 1U5KA 4MM3B 2WB1E 3Q8GA 2MU2A 1SGGA 9ICVA 4YY3L 4B9SA 3KS8A 4GOPB 5J0UA 2E2HB 2XH9A 2Y20A 1JB7A 3A46A 3RTVA 1I4HA 4CNQA 2WINB 3HP6A 3WWVA 4KLSA 4YXMA 2BCRA 4QZCA 3RGSA 4H44C 3E21A 1I4RA 1SJHD 4FDBA 3OSNA 3WKAA 3UPQA 1H6UA 1NJXA 4UPAA 4AI6A 4X65M 5J2FA 3FP9A 1QSLA 4KLLA 3TPZA 2D62A 4A3IG 3QUBA 3N4MB 4GMQA 4IQZA 4NXNQ 2EH9A 2AWNA 1N9WA 2B2YA 2ASLA 2LTUA 2AQ1B 3JAML 3DMUA 1VQKA 3C58A 4K6DA 2DAKA 3HX0A 1C20A 3QU2A 2K14A 2E5LM 1NZPA 1HTLD 4RQ8A 4EZ6A 2O6KA 4PGQA 2OEOA 3I3CA 3J7AF 2YTUA 1NKEA 3Q8XA 1J2MA 3U61A 4DQQA 2YTYA 4O3OA 2MA1A 2VJ4A 5C44B 1JXLA 5EQTA 2D3DA 4DR6M 2MPMA 4QY7A 1ZQXA 2D0PA 2SOBA 1PRTB 4C4RA 2F8KA 2AWOA 1QG7A 3MGVA 5AKXA 2OHFA 3SK8A 4B9TA 4B3MM 4LRTA 4NLCA 2A68D 1QSSA 4GRIA 1ZQRA 4M04A 5JUMA 1MIUA 1N78A 1J7KA 4JI1L 4KLMA 4Y2SA 2GN5A 4JK1A 3BOSA 2VB3X 1KNAA 1PFMA 1XSPA 4R7GA 1TWAB 3Q22A 1MQ3A 2BDUA 2K4PA 3C21A 3SV4A 1X54A 4C3IB 1XHBA 2KCTA 3GLIA 2F5NA 3BU2A 4D81A 4YXJA 2K5NA 3Q8DA 4U7CA 4DSLA 4DR2Q 3GTMB 4DUZM 3GTKH 1JUDA 4DCCA 1K0SA 4KN7C 2WB1F 4UAYA 5C5MA 2K4KA 1ZQZA 1L3TA 3AL0C 3HOUH 4LF7M 2R7FA 4B3TL 2VQFQ 5E4XA 1J8IA 2PI4A 3TP6A 1PV4A 2WF8A 4PHDA 1IHZA 1S4ZA 4OX9Q 3CPWA 2N78A 1YHQA 5L8RF 4Z6FA 2KFZA 4G57A 3TP8A 4DOAA 3GRYA 4C4SA 1QNUA 1EIHA 4ECVA 4KX5A 2ODGA 2C28A 4A3LG 3FDTA 4DV1Q 2CWAA 2FLNA 2D7HA 3H6MA 4JUZA 3W3AA 3SDZA 4K0KL 3RLNA 1F2ZA 2MROB 4X66L 1JMCA 4EQ5A 4QCLA 5KAFU 4Q45A 5JEAG 5HURA 2QP9X 2NQ8C 5KNCA 1VEGA 4AQYL 2Y1JA 4ELUA 4DR7Q 3CHBD 4M6WA 1IXRC 2RA4A 1BQQT 1M1KC 2F0IA 5JRTA 3OMCA 3BQ2A 1LTAD 1NY6A 3H4JA 1F5SA 3BS5A 4Q44A 1STGA 5KT2A 1WCMG 1CM9A 3C1EA 2WSFF 1U49A 1EFID 3GTOH 1STAA 1K0RA 3B89A 2CWBA 4A3BG 2E8NA 4MGIE 4L5SA 4PHEA 4HJ8A 3PO3H 1FNNA 1WWUA 4Y2XA 3RRGA 3ALRA 2HWJA 5J0XA 8ICSA 3M4YA 4LGYA 4B3SL 2B2TA 2JXJA 4TQRA 3ZDDA 1HNXL 4A3KB 3RB6A 5IWAL 4X64L 1K3XA 2EAMA 3GTGH 5ALOA 4F71A 4QB4A 3F5AA 5C4XH 4KHVA 2ZXOA 4FBTA 4QNRA 5M3MH 3SMPA 2CPRA 2PNHA 2AMCB 3PSIA 4GEWA 4IBFA 2EE1A 1NVMA 4LJ8A 3KOWE 1U4BA 2ZIXB 2L09A 2VB2X 5JTIA 2LYAA 1B3AA 3QR8A 1PVPA 3PUVA 1G71A 2NYVA 1VQ7A 1HFNA 1F4IA 1GO3F 5J8YC 3HOWB 2K5WA 5ITXA 1KC8C 3H3VH 2R92G 4F2LA 2E75C 1CSPA 1E2ZA 1H9RA 4I28A 4JI3L 2KJ8A 1GXDC 4A3DH 3MR5A 4DV5Q 4LVSA 2QLTA 5ALPA 1VQGA 3NTIA 3NBHB 1N33Q 1GUSA 4RHSA 1GHKA 2NWGA 3L25A 4KLNA 1DGFA 4BXXH 1TS2A 4OWTB 2MRLA 3LWMA 4A3GB 1ENFA 2K6BA 3ZI4A 4KLIA 3GIIA 4HAIA 3TS0A 3EIVA 1S76D 5IT9L 3EIHA 4LFAL 1A2UA 2NVYH 4O2DA 3OTOM 3PZPA 3SC3A 3AQFA 2D5DA 5M5YB 4YFKA 5ITYA 3KZIU 1V1QA 1OAOC 3ZDEA 1SR3A 4KY7A 2D8CA 4B9MA 1Y1VH 1I6HH 4OIKA 4A3VB 1R9TH 2KZUA 2F0SA 3GPPA 4ZH4A 3FE3A 2IW3A 3AM9A 5KT7A 4XRHA 2RDHA 2I46A 4B7FA 2RCFA 3OHXC 3LWUA 2JSOA 5AKGA 3T15A 3I28A 2ZJ5A 5C4HA 4LY6A 2Z4RA 4JI2Q 5ALUA 2Z3XA 3Q0AA 2KHJA 1JN3A 4QOSA 1IL8A 4C2MH 1IN7A 1X9XA 4IBJA 3WK7A 4JXJA 3JPSA 1UT8A 4OVZB 3K1RB 4BBRB 3NWTA 2EQYA 3QX7A 4R71A 1N34M 2ZUCA 2DGYA 4LGMA 4JW0A 4IOAA 1EWHA 3L3OC 1L2FA 3H94A 1K28A 2Y0TA 2LNHC 3RD4A 4FWDA 3K4GA 1E7ZA 2OF1A 1STYA 5ALTA 8ICBA 2RRUA 1SMYD 8ICZA 1I4PA 3WK4A 4IJLA 3KOYE 1OIPA 8ICXA 4GKKM 4OELB 2Q2IA 2UXCM 4MFFA 3VA5A 1QCKA 4Y2QA 2NZOA 3FUXA 3A0HU 4RQ4A 7ICFA 4DR4Q 4F5PA 1IN4A 1ONLA 3WKBA 1X9NA 1SXJB 3MEFA 2MJ8A 2JA6H 4QF4A 4A76A 4L5QA 3UQ0A 1JOQA 1E0BA 1HUMA 4KKSA 4UDUC 2UU9Q 4I7ZC 1KDCA 2NVQB 4CDFC 2CEAA 4ECXA 3SAVA 1CTMA 4YHHL 9ICQA 3AEVA 2HBLA 2F4VL 1NK7A 1XMQQ 2E74C 1L3UA 1NHGC 4TQUS 5F3XB 1N32M 2G5HB 4X3SA 4M9HA 3U6PA 4ED1A 4DLEA 1K1SA 3RR7A 4JI7L 1L1OC 4WJ3B 3VYRA 3I7FA 1D5MC 2XNAC 5DDYA 1YNXA 3F8TA 5NUCA 1DXMA 2A8VA 4HAEA 9ICKA 2K5DA 1ILPA 2AQ0A 4GFJA 4IPGA 2IOFK 3OGUA 1YEZA 4PGYA 5M9OA 3KLWA 2KA6B 3W0LB 2I7PA 3U5ZB 2CE7A 2HHUA 3ZC7B 3KD3A 3GLHE 5ALEA 5EWGA 1FJGL 3SI8A 2EYHA 2BJWA 4DGZA 1BCPB 4C1NI 5E79U 1NOMA 5DB6A 2E8PA 1TQOA 1B70B 3H0GH 4O5EA 8ICHA 3A7LA 3JPTA 3KFUA 2CRUA 5DNYA 2JXNA 1FIQA 5C3EH 1JB3A 4P16A 1TWCB 4YCWA 3L27A 1V43A 4IC9A 1NAPA 2K60A 5KG1A 5EPLA 4DL6A 3HEJA 4F8RA 4IQUA 4QZHA 2EZVA 4USAA 1DGHB 1UHUA 5AKLA 2EYMA 2WB1C 5KTQA 3JR5A 2L2DA 2NTTA 2KA7A 1LT5D 3I72A 5E7NA 4A8EA 4BBSB 3SR1A 4OO1I 3J7AV 5CYUA 9ICFA 5DB7A 1MN8A 3PVXA 2R8IA 5KFRA 4G7HC 1B2TA 4B6JA 2G3QA 3FTDA 2V1UA 3U58A 4D80A 1I94L 3NXWA 2M00A 5ALQA 1JROA 1AUAA 5FLMG 1XMOM 1KEJA 3PCOB 2F44A 3RRHA 2A6HD 2L1BA 3FYCA 1SV0A 3ERQA 3M7GA 3SXHA 3CC4A 4QJFB 5AI6A 4F2SA 2FMPA 2F1MA 3GLIB 5ALFA 1ZXIA 4CIZA 3UXPA 3GRVA 1QWYA 4HIKA 3MXUA 2F5QA 4KKTA 7ICOA 4V190 4Y2TA 2RSOA 2JEGA 4P17A 3NPPA 8ICKA 4HEOA 3HHZA 2K5QA 4KO8A 5L37A 4P73A 3AN1A 1HNWM 2WAQB 3J81c 2LXEA 1WR1B 1DO0A 1QVFA 3S15H 1RYRA 3ISCA 1X9WA 1RM6C 4EBDA 3HKZG 1HA5A 2W9AA 4CF4A 2Y0SB 1KW4A 2F3NA 3GTQH 3R8FA 2JEJA 3H4MA 1TXYA 1XNSA 1UE5A 4XT1B 4YCVA 1N2XA 2XRSD 4AZFA 1NV9A 3MJ5A 4DV4L 1G41A 3UMBA 2A68C 5KFJA 4F4ZA 2F0VA 4CBVA 1YLAA 7ICRA 2A1JA 2A69C 5E4WC 2EJGC 1SXJE 1WIVA 4P0QA 4IBBA 1L8OA 2KEBA 3NELA 4JBJA 3PW2A 1BBUA 3KZXA 4G4RA 4FCTA 3MXPA 4JYAL 1JORA 5KT3A 3K75D 1VG5A 5C6AA 3LMMA 1YJ9A 3DHQA 4FD2A 1JR3D 1STEA 1E1TA 1KQQA 1JR3E 2ENBA 4YY3M 2MO0A 3AFPA 2CV2A 3I51A 1LABA 3PSTA 4RUCA 2FHTA 2NO5A 2KENA 1Q46A 2L5YA 1JR3A 2K01A 1EZ8A 3K0YA 5KG7A 4C8LA 1AZQA 3MFYA 2K32A 3QYBA 2QDBA 3S1RH 5KFDA 3ULLA 3MK6A 1TS3A 1V1PA 3N7RC 2RF4A 4L5RC 5JPMC 2HIXA 4YWLA 1TS5A 1F9SA 2LS01 2VS1A 4R1JA 1COOA 1S10A 2IHFA 2OM6A 1IYJB 2EKFA 5FP0A 5DG7A 4LF5Q 3EBEA 3JC66 3N6RA 5BN3A 2D7EA 1FGBD 4POGA 4XA5A 5D3DA 1QVCA 4R8NA 3SMSA 2D2CC 2L11A 5BR8L 4WJ4A 4BGDA 1IN8A 1J5EQ 3ICEA 5KYIA 1IL2A 3D31A 5EE9A 3FRHA 1NR4A 1PXUA 1CI3M 2QSFX 4N9TA 1NJYA 3BVZA 5GAGC 2Y9UA 2JE6I 2D7GA 5LMUQ 3C1ZA 1CQVA 2ISPA 4C7YA 1QDRA 1KDAA 4DV3L 4YR2A 2HAKA 1DZ1A 5T1IA 1JX4A 2JGAA 4RFBA 4MN3A 1CA5A 3VYTA 3FTEA 4GOPC 4QWAA 2W8LA 2YNMD 5KQDA 5GTHU 4AKIA 3CRKC 1HR0W 3AOEA 5ALDA 1P3QQ 1S5FD 2VZAA 2RQ5A 2O2LD 3DEOA 4JN6A 2N35A 4DL4A 3B0XA 5J2AA 2R8GA 4B3MQ 1A15A 1BPBA 2KCCA 1L0XB 4WORA 3QUCA 2L15A 3N52A 2JP7A 4JI1M 1V97A 3IECA 2ZJ8A 2BA0A 4I2DA 4P2CB 2IHEA 3HOWG 2B0CA 1PUZA 2YU9H 3G48A 3F2CA 2B21A 3PV8A 2K50A 3GTKB 1YBYA 2AHMA 5JPNC 1PJSA 3V72A 1H38A 3R9KA 3HOUB 1Z1VA 3TQYA 3E4RA 4RUAA 2QPAA 4A3GG 5IP9G 3L29A 4DQIA 3FPPA 4B3TM 4JI5L 1QQWA 2HVIA 1Q8IA 2XY5A 3I04M 2VQEQ 4FF3A 2VL6A 5ELNA 4G6ZA 4K8IA 5L1MA 1K83H 4DPGA 3ND9A 4FF4A 3NBIA 3JAMS 3UDGA 1ZQ1C 5F3WA 3K8AA 2O5JC 3U6CA 2ASDA 1WCMH 1VQOA 1ZXTA 2JA8G 1PTOH 2FMQA 4MFAA 4F4XA 4K0KM 3MMPA 2W03A 4DAYB 1Z47A 1LT6D 1EU3A 1IW7D 4X66M 2M0NA 2GQFA 2HDMA 1RTOA 5TSSA 1A3TA 2GOLA 4XBOA 4KT0F 4G7ZC 3HZJA 4F5OA 2KK0A 4LJ5A 4AQYM 1VJ5A 2BQUA 5J2IA 2WHEA 4IUNA 2QBYB 1BNPA 2MP1A 4BBRG 2TMPA 1FNUA 1FNVA 3C2LA 1HHVA 4BS9A 2A73B 2JA9A 1X3QA 1EQTA 4J9KA 1HQYE 3WKCA 2ISOA 4L8RC 3GTOB 3BVGA 4Z6YA 2R7ZG 1PH9A 3I01M 2NYZD 3PO3B 1A0IA 3THVA 3TADA 3E3XA 1TK0A 5CBEE 4Z6CA 3K7AH 3RB4A 2AKWB 2N88A 4RNOA 5FKAC 4IFDJ 3GV8B 2HQEA 3CF0A 1SSOA 3NWSA 4K4HA 3NEMA 5DG9A 4LAAA 3W68A 4B3SM 5IINA 4NRWA 1HNXM 3GTGB 4MIUA 3TANA 1PH1A 3T1HL 3QOLA 1QUQB 1GJTA 1XNRL 5C4XB 5IWAM 3NS1A 1F9RA 4X64M 5M3MB 1W5SA 3GQ5A 1LLRD 1G2SA 4ZK9B 4DNTB 1SMYC 1XXHE 1TIID 5D49A 2ALYB 4F7XA 3EVQA 3ND8A 4NMZA 3PUZA 4JC0A 4FXDA 4IBGA 1DOKA 9ICHA 4MHVA 4LF6Q 2R8HA 2HHVA 3AYHB 1AROP 3CCEA 4GH9A 5KFFA 2E3TA 2RGHA 5KFIA 4QIWB 1XSNA 2DBYA 1ZQQA 4KLHA 2R8KA 2QEJC 1PHJA 3X3MA 1WYGA 1SXEA 2A6ED 5KQ8A 5FLXL 3RJJA 2O4XA 2EYLA 2XF3A 4A3DB 1DOMA 4I2AA 5CV6A 2JA7H 1YI2A 1Q82C 5JVH3 5AM3A 2BCOA 1EY9A 1F2MA 1J97A 4JI3M 2IJ0A 4EELA 2YMMA 4OO1G 5IILA 2QW7A 4DV6L 3A42A 5C4ZA 3LGJA 4PHPA 5EPJA 2NVYB 3JPQA 4HSPA 1YNND 4YWKA 4EQOA 3CCSA 1A8VA 4LFAM 2E8OA 3RLOA 2JA5G 3TFSA 5EAYA 1I6HB 1W6KA 5IODA 4ELVA 1R9TB 2ES2A 2E1EA 2YTXA 2HL7A 2GWSA 1W2BA 4BXOB 5EJCA 4YG2A 2EANA 4PNYA 4DUYL 2ASBA 1OTCA 4R9WA 3UMCA 3K5OA 2Z6BA 1TH4A 2HHXA 8ICTA 1FL0A 1PTOD 2F5PA 5J0YA 3WOFA 5AK3A 2XZUA 4C2MB 4QZEA 5FO7B 1PH7A 4JOIA 4RNAA 2DZOB 4DR3L 3PXGA 4DFAA 1Q1EA 4I2HA 2UXBL 2UUCL 4OL7A 1BGXT 4Y2YA 1NMGA 1Y8NB 5DBCA 1YZ7A 3AQQA 4I27A 2ZTDA 2R44A 4PGXA 4GZYC 3CMEA 2ID0A 3T53B 3SMVA 2DAMA 4BWJA 5BOMA 8ICVA 1OXUA 1IY1A 3HU2A 3EYZA 1HRJA 1SE2A 4FNFA 1KRPA 2IA6A 4I4LA 3NBXX 3PMFA 3KF8A 2WZJA 3CF2A 3IN5A 2DI0A 1LV5A 1NKBA 3KBXA 3C1YA 1UNSA 2EVBA 1VF7A 3O0FA 2YB1A 2JN4A 5HHHA 2YMPA 5DKWA 1HR0L 5L1LA 4HIMA 4PZOA 4JV2A 3JAME 1PH3A 2OOAA 3L7ZC 2FOIC 1B0XA 4HTHA 4PZ8A 4XIGS 2JA6B 5EXXA 2CHVA 2WTFA 4GNXC 3BDOA 2FPKA 4CISA 2FH0A 2G5DA 1ZQCA 2JEAI 8ICWA 3MC1A 4M9LA 4POFA 1ENAA 3AOGA 4RQMA 4O3NA 1UAPA 4NXMQ 3QEAZ 4YHHM 2G09A 5ALHA 2WAQG 3D6JA 4DV0L 3D4DA 2F4VM 1ORYB 1BPXA 4MEXA 1CRXA 3SHLA 1S40A 4ED6A 1LTBD 3OWEB 1N56A 2Y0SG 3KVWA 3L26A 3M4QA 3OPOA 4BB9A 3GIMA 4P4PA 1OXSC 4DL2A 1EWCA 2L7HA 1TWHH 4JI4L 1YITA 4JI7M 2XIWA 2JP1A 3Q8QB 5AKJA 3RZDH 1VCIA 2NN6H 2RSNA 2ICEC 4BJQA 3GLGB 3R2IA 3SHFA 4QWBA 4KN4A 2RHFA 1MC8A 2WACA 1C48A 2IY5B 3I70A 3OSPA 1QNKA 2JA2A 3IP4B 5CBAE 4ED7A 4G3IA 2Q2UA 1SYEA 1SNQA 1ILQA 4A3EH 5GKNA 3JAMi 2HSZA 3VDPA 3M9MB 1FJGM 3H0GB 4K5WA 1HZAA 1WVLA 1IBMQ 5E6JA 1SN8A 3HJ8A 4II7A 2A19A 4NXNL 1UFZA 5C3EB 3ZD9A 4KLKA 5C1BA 2CWPA 5BPVA 3T51B 4PCZA 7ICHA 4UB3A 5L9XA 2RVLA 1U9RA 1OXVA 4PV1C 3Q6SA 4RQ0A 1O03A 4ECTA 5CWRA 1WYDA 4AG5A 9ICXA 4JPBW 4LZZA 2KP7A 2CRXA 4QQBX 4GLAC 2JJQA 2F3WA 2W7OA 4QZDA 3ONNA 1AFPA 4IFDH 3TWLA 5EPKA 4RF1A 1K9MC 1QUTA 2F0KA 1CKMA 1CZWA 1L1ZA 4PMCA 1NKCA 1GD7A 4ECSA 2F0QA 2F0LA 4C4TA 1PYSB 3UE0A 3PQIA 3QU5A 4IL6U 2RDJA 5JEAJ 2SDFA 1J2NA 1SEBD 4RH6A 4MH0E 5KFBA 2EYFA 5LMNQ 9ICSA 1JXEA 1SNMA 2APLA 5IP7G 1KD1C 3BZDB 1L2DA 1L8QA 4ZAIA 2F5SA 2I6XA 1L7NA 2H3ZA 2HOFA 5AJ3L 5A2QL 5ALSA 4AYBE 2EXZA 4KMUC 5AKYA 5DM63 1XMOQ 2ZUBA 5KFYA 4RCOA 1ZQHA 1KTKA 4KTAA 1SXDA 5KO3A 1S97A 2IPKD 3KK7A 1AP0A 1RQNA 2JMGA 1O78A 1D8LA 1UCVA 4H0LC 2NB0A 2DL0A 2YMQA 3WK9A 2EDUA 5GAEC 3OYYA 3NQIA 4IJEA 1OFHA 3V05A 4U673 2F0PA 3WHLA 3IDWA 1K3BC 3AOEC 1E2VA 1QUSA 2CV0A 8ICGA 2G8LA 4UASA 1SAPA 4MTKA 4DQSA 3EPIA 4XXEA 3AU7A 4I2CA 4OX9L 2UUAL 2WF5A 4HIOA 1IBKQ 1IM2A 3L2PA 1BF4A 2ATLA 4UB5A 5KG3A 1S8OA 3H40A 4YR3A 1TH3A 5J2CA 2RGOA 3F2BA 1LKYA 4DV4M 2HHWA 1QH9A 4DV1L 3A54A 2GVAA 1CHPD 1MSGA 2XFTA 2RRDA 2K8BB 2UXDM 3RJGA 1QB5D 1XYIA 2ZJAA 5AKHA 1D0LA 2HHHM 1R4PB 1DOLA 1AIPC 4JCVE 4Q8FA 3EIEA 4F2RA 3JPOA 1WJ7A 3EROA 1VEJA 1C1KA 4XYOA 4UARA 4DR7L 2FMCA 3A5ZB 2JV3A 4KLJA 2V9WA 3AB9A 5EXPA 4LF8L 2QCUA 2HBJA 4ED8A 2F0DA 1PZID 2JUJA 2XY7A 1G6PA 1ZRMA 5AI5A 5IT9E 1KXLA 3FTFA 2AUKA 3TACB 3S1RB 1SV4A 3MABA 3GLGE 2V4QA 3CNHA 4UB2A 4ICAA 4B9XA 2E8GA 4QZFA 2NVTH 4TKOB 2QILA 4AG6A 1AN8A 4L6TB 3GRUA 8ICCA 4IALA 3F2UA 3OHAA 5EP3A 1X3EA 3KJOA 4L4UA 1RXWA 4DXFA 4Y2VA 8ICJA 8ICNA 2OCEA 1BXTA 4LG2A 2FLPA 3PSPA 4XYQA 3J7A5 5C0XJ 2PNRC 4AYBF 3CGWA 1HUZA 2AU0A 3N7SC 4QZ8A 2B2WC 1IW7C 1MN3A 1PMRA 4EX5A 3PO3G 2MQHA 2XWJB 1G59A 5BR8M 3A5UA 4UAIA 3VDUA 3FUTA 2AH5A 3U60A 4EVOA 1LO5D 2F0MA 1D6EC 4C56C 3TADC 3U9SA 1UEBA 3C46A 3QJYA 4HLQA 1O7IA 3BQ1A 3S1MH 2XGTA 4R66A 3PIP3 1BR9A 1ZETA 4DV3M 5C4XG 1ZQMA 1JC7A 5L1JA 5M3MG 2QEXA 3MR6A 3SASA 7ICNA 3GLFA 5J2DA 4IJFA 4OIJA 3J80L 2OTJA 5DYIA 4DV5L 4RQNA 5J0SA 2J7ZA 3HILA 3ED5A 5IP9H 5DBAA 1N33L 3TS2A 3C29A 3C28A 9ICJA 3U26A 2NTSA 2V6ZM 1ZJMA 1W6JA 3EJIA 2BZFA 3VKHA 1RYSA 2NZ1D 2YU9B 4ME5A 3FKEA 1CEZA 2HMXA 5J2JA 4JV5Q 2YTVA 3Q8KA 1NSNS 2JA8H 4HJ7A 3KFUG 4FYDA 2KN7A 3X3NA 4P71A 4FO6A 3VR4A 1VDZA 3KSXA 2C5RA 4RAUC 3W67A 4BXXG 1EZ6A 1FNWA 1IXRA 3TEHB 1X3PA 1ZQ9A 3WKDA 2Z4IA 4B3RQ 3Q8RB 4LK1C 2F0TA 1OQYA 1K83B 1KLGD 2J0TD 3RAXA 4XDXA 4JI5M 1TWGH 5ALXA 4JI2L 4UB1A 3IG5A 1Y1VG 4BY7H 3A45A 1H9SA 5IOCA 3MVVA 4B3TQ 1NTGA 5KFHA 1QZGA 1WCMB 4ECQA 2YX8A 3HHYA 1IN6A 1PTOB 1HFGA 4IRKA 1RXVA 3GIJA 4OWWB 5C0YA 2RDIA 3T5JA 3AMUA 4F5NA 4K14A 4NOOB 1TK5A 1DGGA 2R7ZH 1KBUA 4F50A 3S14H 3W1BA 2EY2A 1YE9A 1ZD4A 1O7LA 2K47A 3MXNB 1S5ED 1YNNC 3TAQA 4DQPA 3KF8B 5C3WA 1MA7A 4XTCS 3A8JE 5E3FA 3HWSA 4QW8A 1NE3A 3UZUA 4K0KQ 1T9HA 3HT3A 1A76A 4DOCA 1M8AA 2OH2A 1FYCA 2FMSA 3PIPA 4UBBA 3MBYA 3PIOA 4I2EA 1RQLA 2ES6A 1KTQA 3FC4A 1SG9A 2BWBA 1VQHA 1XX8A 4L78A 3IL8A 2I5HA 1OAIA 4HCEA 5ITUA 3RN2A 4DR4L 3W2DA 3HHWA 3EFXD 2KHQA 2X49A 4HEDA 3GPUA 4BLCA 1NHWC 4R4CA 1NO1A 4DFMA 5J8YA 1ASYA 1EOVA 4PT5A 2BOSA 4JWMA 3QO2A 4UAWA 3KHGA 2UU9L 2V1CA 5AIAA 4ZYSA 1IYUA 2PQAB 3FEWX 1XWIA 1XMQL 2DGZA 1CSQA 2DKLA 1NJWA 5F9LA 5JJKA 1OO9B 1XNQQ 2W9BA 5ALYA 4DK6C 2BHNA 2B63H 3CTWB 1Y88A 2JA6G 1ZQBA 3T1HM 4LJ9A 1XNRM 2I1QA 4B3SQ 1DCZA 1LTTD 2DPJA 4GC7A 2F0WA 1Z00B 2QB1A 2L4NA 2EAPA 5J22A 5IWAQ 5AK4A 2AJQA 4X64Q 5IIFA 1VQJA 1EQQA 2PFOA 2JEIA 2DQNB 1Z4OA 5C5LA 4OCZA 2RP5A 8ICLA 4QZAA 2KVMA 2JA5H 8ICAA 4HYKA 5EE3A 4P2HA 2KEEA 2PMZE 5IYCH 2K1BA 5HMMA 2MFIA 1NK0A 1XXGA 2JA7B 5IGDA 2W9MA 4LJ6A 2VW9A 1E1OA 4DV7Q 1ZKOA 3UDFA 3S1QH 4OJ6A 1Q3UA 1MSWD 1NY5A 4PHAA 1HZBA 4Q43A 1ZAEA 4DN4M 4S12A 3S1NH 1EYDA 2QKIC 2DF4B 4RGTA 4DV6M 1TDHA 4F72A 1JQJC 3Q24A 1B53A 4KN4C 2ZIVB 3VYUA 3PW0A 2R4EA 3GV7B 2CHBD 3NUCA 2PZUA 2HCFA 5GROA 2KJ9A 2ZG6A 2KEDA 4GXJA 2A1AA 9ICCA 3A8KE 3RJIA 2FINB 5C3XA 4GC5A 5C3EG 5KFUA 4LFAQ 3PW7A 5ALMA 3PMNA 2WFAA 1WTQA 2DJGC 5I6YA 3FRPB 4JV0A 1TAQA 3RBEA 1NK4A 4DFKA 2I5LX 4DUYM 4F4WA 1ZQYA 2JY6B 5H37D 3K1ZA 4DK0A 1LACA 4QUFA 1DXSA 2C2EA 5FJ8H 2ZIUB 2A5YB 2RCNA 1PVQA 1ZQDA 1HEKA 1X9SA 3KS4A 3SE0A 4DR3M 1NBWA 4FF1A 3CCVA 3H3VC 3M85A 5D14A 1UE7A 2UXBM 2UUCM 3TZUA 2F1JA 1JOOA 4LJXA 3LCUA 4F92B 4Z9CB 1SYFA 1L7MA 3CRXA 3WK5A 2VNUD 4KJNA 4HJ9A 3IHPA 1BPYA 1VQLA 5J39A 3LQRA 5C18A 2H4OA 5KFNA 2K5HA 1L1OA 1VQDA 1WTVA 2ZIWA 1WXQA 4FFDA 4PZ7A 5IIIA 4R64A 2LBCA 4ULLA 3ISDA 4YQWA 5LHY1 4K5XA 1Q90A 2GO7A 1SL2A 1J6QA 1L6NA 3R93A 2KRKA 2J5YA 2HOIA 1UPHA 1EXNA 3DDHA 2G9DA 2D9UA 3B7ZA 1T3QA 5KG2A 2QA4A 1SNOA 3UGJA 1HR0M 1HNZQ 3NSWA 2CFMA 4FZNA 3NVZA 2LVQD 4I81A 4C3HG 2LPEA 4ED2A 3GQ3A 2PMZF 4NSRA 1SROA 2G5IB 3CQZH 2KHHA 2G9HD 1MI2A 2W8KA 3KF6A 9ICNA 3CMAA 3HG9A 1T6OA 4AYBC 1X9MA 2H3FA 2H1RA 4MGYE 1KN5A 3V6JA 4DV0M 1N75A 1RL2A 5I9PA 1NSFA 3H0LB 4K4IA 2I9GA 1TWHB 3LCVB 4A75A 1I6VC 4IRCA 2KKVA 3QG1A 2F4VQ 3LK9A 2RDFA 3RR5A 2AQ3B 3TKAA 8ICRA 1W5TA 2KCNA 3RZDB 5ALWA 4F88A 4JI4M 4DR5Q 1UUPA 1X55A 1EY5A 2DKXA 1R7RA 1A0PA 2J4XA 2R46A 2R6FA 3EQLC 3QZ8A 1I3QH 4ZKBB 2DWZB 1PJTA 1KYIA 8ICQA 3B6YA 5EBDA 4NL9C 1SXTA 3NRZA 4TUQA 4B7GA 4UAUA 3CRLC 3HW8A 2XVSA 2HHQA 1GUOA 2JZ0A 1DJRD 5KG6A 1NJGA 4NP5A 3HOVH 5FO9B 4DSFA 2R18A 2BKEA 1A6SA 1GUWA 1Y8PB 2QQ8A 3SAHA 4OJPA 2OPFA 4NXNM 1ZQAA 1CZGA 3M1YA 1O7YA 5KPTA 2I0QA 5IP7H 1VDVA 3JPPA 3PX6A 4LF5L 4UP9A 1K8AC 5KFAA 3KLSX 3SR6A 3D2SA 1QANA 2W43A 2QDLA 2NN6I 4JI6Q 2XIDA 1ZJNA 1QZHA 1J5EL 3R8BA 4LF4Q 4BX9C 4I7AA 3MFGA 4ME3A 1Z5AA 3AL0B 2JZBB 3AFQA 1G51A 1L8LA 5LMUL 4NKLA 1M90C 1E32A 2M9NA 3LVWA 2JH7A 3KDFA 3FHWA 1OW5A 4X3TA 2KD1A 8ICMA 1XWLA 4A4IA 4O3QA 2KVCA 5KRUA 2A69D 2OYYA 4GXKA 4OU7A 1U9LA 3HKZB 4Y7NH 1WGLA 3TN2A 3GD7A 4I5SA 3GV6A 2BGWA 3K0XA 3MFIA 1NNUC 4HMIA 4I65A 4LUVA 4B7HA 3N28A 1H9JA 2HOQA 1ZMUA 3EZ5A 2B39A 2W54A 1I94Q 1HCZA 4IN3A 5IGBA 3J81i 3K58A 5CORA 3E2EA 4AW4A 1WG8A 3RB0A 1WTOA 4E6IA 4I29A 4IFDI 4RKUF 1I4XA 4P74A 2MUTB 4QMGA 2KNJA 1Q7YC 1BKBA 3PW5A 1NNLA 3QU7A 2LMCB 5G5HA 4KITB 4DR2M 1E9RA 2BQRA 5CP2A 1STHA 2EYOA 3H8JA 5AM5A 2F8LA 1ZRNA 4RQ3A 4X62L 5DQHA 1CKOA 4GC9A 4J9SA 4PZNA 1J09A 1FEZA 1T8EA 4PG3A 2L4FA 5KFCA 4P0PA 5I6WA 2VQEL 4DNRB 4OX9M 2UUAM 3CCQA 1VQ1A 2DY7A 3I2ZA 3K9OA 4Y52H 4LFBQ 5EKIA 4NXZA 1CT1D 3TL4X 3E6ZX 3PO2H 4NDXA 1X3FA 4DV1M 3ZCBB 3IKJA 5L1IA 3D2QA 2XY6A 7ICVA 2OQKA 1IXZA 2F0GA 1IIPA 3L0OA 2KXEA 1H9KA 3KLRA 1VQ9A 5ELDA 1PVRA 3HJEA 5IIOA 2IHNA 1GL7A 3SENA 2DHYA 1ZQIA 5DG8A 4KLOA 3NP8A 1Z19A 3C9PA 3CF6E 3VYSA 1JT8A 5FLXE 1N8RC 5D65A 3SV3A 2E8MA 1BUVT 5KG5A 2MO1A 3PX0A 5J1ZA 5E26A 4OO1J 4DR7M 4JYAQ 1WCLA 4B08A 9ICWA 4QHSA 4C7ZA 4NV0A 5IYBG 5CB1A 4LF8M 2UVUA 2W04A 2QGQA 1HQMC 1PA6A 4I8OA 3I4NH 2F1HA 1NNXA 3OW2A 5IGCA 5IZ7D 2KKPA 1LV9A 2NVTB 4AH6A 4GOPA 4QWEA 1BNOA 1PH8A <