1BVSA

Ruva complexed to a holliday junction.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
183
Chain Sequence
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPVNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEATSSALRAALSLLGKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an octameric RuvA-Holliday junction complex.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Dna binding protein
molecule keywords PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
total genus 33
structure length 183
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1bvsA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1bvsA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bvsA01
3NBHB 3HOXH 1XTDA 4JI6L 8ICHA 4DV2Q 1Y14B 4DV3Q 1IBMQ 1U45A 4F2LA 4A93G 3V72A 2PQAB 4ECXA 4UAWA 5KG1A 3T1YQ 1JB7A 1UA1A 4JI3Q 2VA8A 1EWIA 2Q0ZX 1HNWQ 2F1HA 3WWVA 4A3EH 3KHGA 4A3LG 2R7FA 4R8UA 3AYHB 4C3JH 3S1QH 3HOZH 1VQ8A 4YD1A 4R4IA 3CD6A 1GO5A 4QZBA 1K3RA 1TR8A 5CJ7A 1LV5A 4A3MH 3PMNA 4R64A 3KHLA 4DV5Q 3UXOA 4YR2A 1L1OB 1J5EQ 3W1BA 2ZUDA 2VANA 1SROA 2QA4A 5IYCG 4JG2A 1QUQB 4HJ9A 9ICAA 2QSFX 4C8OA 7ICKA 3PIPA 1G51A 1L5UA 1CUKA 4X64Q 4A3JG 2WZJA 4I2EA 3F92A 3BQ2A 4DEZA 2ID0A 2DKLA 3KOJA 5GAHC 3RLOA 3M4OH 3UPQA 2NZOA 2ISOA 2R92G 2UVRA 2PI5A 3MFIA 4YMNA 2UUCQ 1NKEA 4X66Q 5IINA 2Z6KC 2V4QA 1MC8A 1KSPA 1NE3A 4I28A 3STBD 3RJJA 1ZQHA 4R65A 2N78A 2N49A 1K1SA 4J9LA 1RYRA 4JBMA 2WTFA 5KFUA 3EPIA 2ALZA 3F2BA 1X9NA 3F2DA 3E2EA 1XMOL 4YHHQ 3PO5A 1AE2A 5KFMA 3PNCA 9ICVA 1VQKA 3HOUG 3C2KA 3CPFA 4JI2L 2PI2A 1HQYE 1CKNA 2E8GA 5H1SE 2G3QA 1O7IA 4OX9L 2H5XA 1XO1A 3CCMA 3BQ1A 4DFMA 5CHGA 4DOAA 4LNQA 4ED3A 4PZ8A 1YJ9A 4DF4A 1PFSA 1V1QA 1SR3A 4QWAA 1NKBA 1XXHE 2A1AA 2QHOB 4I2JA 4HIMA 1YIJA 4BY1G 1EQQA 3ISCA 4X62L 1X55A 5DBCA 1U0LA 1IM4A 2NRZA 1VQ6A 2B63G 1L1OA 3VDYA 5DLFA 2BPCA 4B3SL 1Q1BA 4F1IA 3TQ1A 4Z6DA 1S0MA 4KLOA 4KLSA 4IQWA 2MNAA 4DV4Q 1XNQQ 3GV7B 3FRHA 2C2EA 1WCLA 1VDLA 3EN2A 3GTOH 4B9VA 5DLQE 3SV4A 1I5FA 3IM1A 4NLZA 8ICEA 4QWBA 2HHXA 3GO5A 2UVWA 2K5VA 4O0IA 3PIOA 4A3KH 1JJ2A 7ICGA 2K5HA 4PGQA 3RBDA 5DDYA 2Y0SE 3M9OB 5HGQA 1OQYA 2Q2HA 1S77D 4KLUA 4R4TA 2KZMA 3IHQB 2ZTDA 4YXMA 5J2DA 3I4MG 4LFAQ 1SZPA 2VA3A 1SL0A 4KLQA 3JPNA 4F4YA 1WJ7A 5IY0A 1KHIA 3GTMH 5LMUQ 2RF4A 4OO1I 2UXDL 4IRKA 3M9BA 4DFJA 2VQFL 4MTNA 4M6WB 7ICJA 1TWHH 1YVCA 4IPHA 4JI8L 4EBEA 3T1HL 1L3TA 5EAYA 3PR4A 2K5NA 5BPCA 1OTRA 1YITA 5HP4A 5KFAA 4IFDJ 5J2AA 1ASYA 5IP7G 1JJCB 5J2IA 5JEAG 3UDIA 2OWOA 9ICMA 2IHFA 4PGYA 1IBKQ 2WB1G 3EIVA 2XGTA 4F91B 1A76A 5KFZA 2PI2E 4KHPL 3HWTA 5J0XA 4UAYA 1Z3EB 3T1HQ 2YTVA 2BR0A 5HY6A 4GNXC 3EBEA 2CFMA 4O3NA 4OONA 1RYSA 5C44H 3T5HA 2MROB 4NLKA 4QJFA 1S10A 3HKZG 2DUDA 2BA0A 3G6EA 4A3EG 4DNIA 4QQBX 4O3SA 1BPDA 1K83H 1Y1WH 4OWXB 1SL1A 2KBNA 4B3RQ 4A3IG 4GOPA 7ICVA 4BGDA 3PF5A 4JV2A 5LMNL 4O5CA 1TFRA 5J0OA 4APVA 1MSWD 1W2BA 3AU2A 4RQ7A 1D9DA 4RZRA 1T3NA 5F9NA 2GVAA 1ZQRA 2N8NA 2R8GA 1UE6A 4DR2Q 1ZQBA 4F4KA 4UB5A 1OAIA 1YHBA 4P2HA 4C3IH 5J3BA 3RNUA 3ULLA 3HW8A 4QWEA 3JC66 3I7FA 2EQSA 4TQUS 1TAQA 4H02A 1OXSC 4RQ0A 2HAKA 4EX5A 1P16A 2UXCL 5KFDA 7ICLA 3J81c 3OTOL 4POGA 4DL3A 5KFIA 3K7UC 4BBSG 3GIIA 3THVA 4I2DA 3M3YH 3FDSA 1ZQDA 4RUAA 1TV9A 1RIPA 4GOPC 4UBCA 4Z6EA 4QZDA 3N4MB 1JMSA 5L1IA 4ED6A 3PX4A 1SLJA 1RPLA 4TUSA 1SRUA 1UEBA 1YJWA 4BXOB 7ICMA 3GDXA 2NN6G 1CKOA 1U47A 5DB7A 1X3EA 1NMFA 4QZFA 2JA7G 2QNJA 4MF8A 1G41A 2W9BA 1M1KC 4DR6Q 5JJLA 4B9LA 5IILA 1S72A 2HVHA 1AH9A 2N3SA 4OWTB 4BY7H 4PZ7A 3JPPA 3C1YA 4JI5Q 1A8VA 4LF4Q 4FO6A 3C5FA 4OO1G 3NEMA 2K52A 4F8RA 4LF6Q 4P75A 2K4KA 5J2KA 4TUQA 1EFUB 8ICFA 2HWJA 2VUMH 3ZDBA 2KHHA 4RG1A 4A3BG 1B7YB 3Q8KA 4NXNQ 1Z00B 4LZDA 3RBEA 4TQRA 2DPIA 3UXNA 3W5OA 1KEJA 4PGXA 4GEWA 2ATWA 2F4VQ 3U4ZA 4KLDA 1KFTA 1R9TH 4PMWA 2OOBA 2C2DA 4A3KG 3PVXA 4KLKA 3ZDAA 5D49A 4F92B 4A4IA 2UUCL 1D7QA 4DQRA 1TWCH 3V6HA 4X65Q 4DQIA 3JPRA 1ZQZA 2W8LA 3HFZB 1QZGA 1K8GA 1C0AA 2GVBA 2BCRA 5KT5A 3K7AH 2FPLA 2MO1A 2XY6A 1BKBA 1DV0A 1S76D 3GTPH 3FYHA 4GN5A 4LF7Q 4A3FG 3PX6A 1RXWA 3IRBA 3RLNA 2D62A 4JYAL 4MEYA 1NK6A 1P3QQ 4RQ4A 4KLMA 3RJGA 2UXBQ 4PG3A 4DBGB 5EOZA 3AFQA 1TWAH 4HEOA 4Z6FA 8ICRA 3PUXA 1PH5A 4F93B 1EFWA 4DF8A 8ICSA 2IX1A 1SL2A 1VQ4A 1NK5A 2JZ1A 1BBWA 4DQPA 1T43A 4LF5Q 1DO0A 8ICWA 3KDFA 2XGPA 4I2BA 2JE6I 5DB9A 2DZLA 3G48A 4LVSA 4X66L 4WP2A 2W9CA 4IPDA 2JZBB 2JY6B 1VQDA 2MR9A 2XC9A 4KMUA 4F5QA 4MEXA 5GADC 3TI0A 4DQSA 4F5RA 3TARA 5DQIA 2KZZA 4YXJA 2C28A 4R4OA 4NXNL 7ICIA 3H8JA 4DUYQ 2ZJRA 4YQWA 3HKZE 5HMMA 1E94E 2JA8G 4C2MH 1WCMH 1PH3A 2M9NA 2Q2IA 1KFDA 2UVVA 5IP9G 3MR3A 1PVOA 2HHWA 4DL7A 4RQ3A 2JA5G 4NXZA 3RJIA 1E3PA 2BCVA 1QTMA 3T5JA 4B9MA 3U58A 4DSIA 3S24A 3L2PA 1OXUA 7ICRA 4I27A 2JNHA 4A3CH 5KTQA 3NELA 4F5NA 2WAQG 4NM1A 2EKFA 1G3IA 3GV8B 4DSLA 1HT1E 4A75A 3KTQA 4DPGA 1H95A 4EEYA 2AGQA 2DPJA 3C1ZA 3I56A 4BBSH 5DDMA 5CP2A 3M7NA 2VY3A 4LFBL 4I2FA 1JMCA 2ASJA 4F4ZA 5J0UA 3IECA 4JV0A 1P8LA 3LWMA 5KT7A 1ZYQA 1LB2B 4O3QA 2RDIA 4JK1A 4FBUA 3UDFA 3TAPA 9ICSA 3BBZA 3CAMA 3T6PA 5DBBA 4DV7Q 5KT2A 3RJEA 4O5EA 4DSEA 3RB3A 3PUVA 4A93H 4J15A 3CCJA 4RNMA 3J81i 3FHWA 4GLVB 2UU9Q 3RB0A 4RMFA 3PCOB 3FKIG 1X65A 2BQUA 4P4OA 3MMPA 5C4XH 3HPOA 1XSLA 5JJIA 1ZQOA 1QSLA 3OSPA 4MFFA 4ECQA 2PQAA 3GILA 2NRXA 1JN3A 4UPAA 1WI5A 5C44G 1S40A 1HH2P 1Q46A 3UQ2A 2BHNA 1XC9A 2MAXA 1VQNA 1TKDA 4QY7A 1DGSA 4KLTA 1IZ6A 2JJQA 1F4IA 2I5HA 3V6KA 4NLGA 2B29A 4UB1A 5KFJA 2PI4A 3V6JA 5E7NA 2NVQH 1ZQYA 7ICOA 5KT4A 3FP9A 8ICBA 4P71A 2DAMA 2ZJAA 9ICFA 1TAUA 4NLNA 1XWLA 2FLNA 4M0AA 1GVPA 3K75D 2K0BX 2DI0A 4B3ML 1D9FA 4ECTA 2LYHA 2L4FA 4PZ6A 4JWNA 3JAMc 1GO3E 1EIYB 2JP7A 3GIJA 1BPZA 4AH6A 4ED7A 1ZMVA 3K9PA 1K1QA 4QIWE 2ZM6Q 1Y88A 1I6HH 4WJ4A 2J6TA 2QEXA 1ZQCA 3RH5A 9ICXA 2DGYA 3CCUA 3JAMi 4ECSA 4A3JH 4E0DA 2FXQA 5C0XG 4DKAC 2KTQA 4JYAQ 3ISBA 9ICTA 4JBJA 4QL5A 3KJPA 3RAXA 2KHIA 2YV5A 1BVSA 4DL4A 5KG0A 3F2CA 4NXML 4JOIC 3TQYA 5J2JA 5C4XG 4B3MQ 5IE8A 4Z6CA 3ZDEA 4QZ9A 3A5ZB 4DFPA 8ICKA 3PO2H 4L5QA 1MJEA 4B9NA 2CWAA 4P4MA 9ICWA 3E0EA 2P6RA 3GLFE 4NY8A 2C35B 3SYZA 1NV9A 2BCQA 5GAEC 1S0NA 3BJUA 2W9MA 4ELUA 3K81C 3BDPA 5C3EG 1ZQEA 4YCXA 4NM2A 5J0PA 1NJIC 1QLNA 1ZQMA 4DV1L 3S15H 2C2RA 4ZH4A 5J2HA 1OTCA 8ICVA 4YY3Q 3QZ8A 3GLGE 4UBBA 3LCUA 1IBLQ 5KFNA 4XUSA 2UXCQ 4DUYL 2HW3A 3H0GG 5IYBH 4DSKA 4LUZA 1S0VA 1FJGQ 2LXJA 5AJ3Q 1BGXT 4C8MA 4DLGA 3UQ0A 3Q8LA 2JEBI 2I9GA 4YCVA 4KHPQ 1YBYA 2JEJA 1UE7A 1ZV1A 5KFSA 3IHPA 5KFTA 2BQ3A 3KDFB 1A62A 1C7YA 3T5KA 1PH7A 2NRTA 5DGAA 2HVIA 1XMQL 3J80i 4C3HH 4KLGA 1VQ9A 2JA6G 3GD7A 1B43A 1HZ9A 2NRVA 1HT2E 3L0OA 4DR2L 2AJQA 5HMLA 4DR1Q 2UUBQ 7ICFA 4LF7L 5IIOA 4RUCA 1X9SA 1NK9A 3H4DA 5LMUL 2WAQE 2OQKA 3CPWA 3C23A 1NJWA 4YD2A 1E24A 3F1ZA 4LFBQ 2MGWA 1T9HA 1JJGA 4YR0A 4Q43A 3EZ5A 2HIVA 5FJ8H 4AYBG 1T8EA 3CCQA 4QWDA 4A3CG 4DR1L 2UUBL 4DS4A 2ASDA 5FLMH 1K8AC 4DR7L 4DO9A 3HOVH 4IPGA 5M3MG 3L7ZC 2MUTA 3EW9A 4J9NA 4DL5A 1L2FA 3PW0A 1B8AA 1SFOH 1KL9A 1TVAA 5J0TA 1VQLA 3GTGH 1UA0A 1PYSB 4ED8A 2GN5A 5KFFA 3HP6A 4QZIA 3H3VH 3RR7A 1IBLL 4O5KA 1EXNA 4GN3B 4Q45A 4I2GA 4GKJQ 1NOMA 5IIMA 4IFDI 5KT6A 2IT1A 5KFEA 4JV5Q 2E2HH 2HQLA 3M8SA 1KQSA 2XCAA 4B9UA 4Q8EA 4DSFA 2OCEA 8ICLA 2FMQA 1NJXA 3CCLA 4RPYA 3G6YA 2JEFA 4HJAA 4P74A 1KYIA 1Y8GA 1VQAA 4IRCA 1CEZA 2AWNA 4DQQA 3Q8MA 3RH6A 3FRIA 4UN2B 2BCUA 1MIUA 4GLXA 2XGQA 4EBDA 2EIFA 4OX9Q 4GLAC 3GLHE 1KLNA 1N9WA 1S3OA 3LGJA 1JIHA 4LF8Q 1YZ6A 3KLWA 1KRSA 3S17H 4DAYB 1QVGA 4F2RA 2BWBA 4RU9A 3MEFA 1TXYA 3PUZA 7ICQA 3PO2G 2R0IA 2VS1A 4J9QA 3C5GA 1S0OA 4HYKA 5FJ8G 4OXPA 4X62Q 3CQZH 1IXSA 4MZ9A 3EPGA 3ZD9A 3ULPA 2BWEA 2R8KA 3DM3A 4KN4A 4J9RA 1NY4A 5HNKA 4QZAA 1FVIA 3RN2A 3M4QA 2KN7A 2WB1E 1VS0A 4GKKQ 2C22A 5KFLA 2XY7A 3B6YA 1QVCA 2CP8A 3RJFA 4IFDG 4A3MG 2KFNA 3H4BA 4F5PA 2JEAI 4BXXG 1AROP 1JT8A 4R66A 3S16H 4PHPA 4A3LH 4M6WA 2XTIA 1WR1B 4BXOA 4KLEA 4YVZA 4JI1Q 3ZDDA 1M90C 3DLLA 1X3FA 2A8VA 2UXBL 2NZHA 3RR5A 4YHHL 4RNNA 1JR3E 4TQSA 4LF9L 1QZEA 3RZDH 3QEAZ 2JY8A 3KF8B 1KIXA 3OSNA 3HX0A 2BCSA 2VZAA 3PMLA 8ICUA 1NK8A 4UB2A 4JI5L 2FPMA 4QZCA 4YFKA 4JI0L 2V1CC 1U48A 3UE0A 1N32Q 1I94Q 8ICTA 7ICSA 3UDXA 4M2YA 2BGWA 3CCVA 4DR6L 3HOXG 1U4BA 1Y1VH 4K0KL 1KD1C 4POFA 3H0GH 5IYBG 1ASZA 3BZKA 4RQ6A 4YWKA 4JCVE 1XPOA 2ISPA 1E22A 9ICEA 4DR7Q 1DOQA 5IYDH 2UU9L 4Q44A 1I94L 1N32L 2R7DA 3CC7A 5J0YA 2RHSB 4JI2Q 1I3QH 4LF6L 3OHBA 1WHCA 1GD7A 4DV7L 4A3DG 3S2HH 4DAMA 4B3RL 2AMCB 4JI7Q 4DV0Q 4IPCA 2F1JA 1A63A 1VQFA 4DL6A 3SZ2A 1N56A 1KRTA 1PZNA 1EOVA 4DR3L 5M5WH 5J0WA 1GM5A 2AWOA 1HNXQ 1VQBA 2JA9A 3MR6A 4M9HA 1QSYA 2ZJPA 1VQJA 4GNXA 4LF4L 5C0XI 5J2EA 1HUOA 3PW5A 2PFQA 2D0PA 1NK0A 4IQTA 5CR0A 3RB4A 4DV4L 3KHRA 3MXNB 2R93H 4ED1A 4X6AH 3TANA 8ICGA 4BY7G 5KG2A 4BY1H 1BPEA 3N97B 5DB6A 4JV1A 4IR9A 3AU6A 5DQHA 3PR5B 3MBYA 1XPRA 3JPTA 4J9SA 3KYHC 3GFKB 5CB1A 3KJOA 4GKJL 4HIDA 3PF4A 2W9BB 3H4JA 4RT3A 3U50C 2FMSA 2AQ0A 5EWGA 4YCUA 4LUVA 3OGUA 1PH4A 4BBRH 4JBWA 4YMOA 1EQRA 2FMPA 3CF5A 2HHSA 9ICBA 4HIOA 3G4SA 3GLIE 4Q8FA 1T4GA 4K4HA 5M5XH 4HJ7A 1WJJA 4JWMA 3OTOQ 1L3SA 7ICTA 5M3FG 2ES2A 4M47A 5KFKA 5KG7A 8ICQA 1U49A 4BWMA 3SV3A 1HR0L 1PA6A 3B89A 4DV3L 3RR8A 2VQEL 2RCNA 3CP0A 1YI2A 4YG2A 3K0XA 4IJLA 4J9PA 5GAGC 5L1JA 1ZQTA 4LUOA 4IQUA 4PHAA 2EJSA 2WP8J 1ZQKA 5J0QA 4O3OA 2NVYH 1K0RA 5C0XJ 2JA8H 4DV0L 4M9LA 3MR2A 3J80c 3TREA 1NK7A 2L4EA 3E9HA 5KFPA 3GTQH 1RL2A 4BA2I 1ZQFA 1IXRA 4UB3A 5L1KA 2KCMA 3HKSA 2LTUA 1VQ7A 4DLEA 1Q7YC 3S1RH 4O9MA 1X3GA 4GNXB 2ALYB 3TEHB 5KG5A 3HOYG 5AJ3L 4B3TL 2YTXA 3I2ZA 4NPSA 3GQCA 4L5RC 2IY5B 3ULJA 1LTLA 2IBKA 5KFYA 5J29A 4A3DH 1A0IA 2VQFQ 2E5LQ 2XO7A 3M8RA 3AUOA 4J9KA 4HJ8A 2RRUA 2F1IA 5EWEA 4DWIA 1UFZA 1FGUA 4ECVA 2ZTCA 1E1OA 4IO9A 9ICNA 1Q02A 3S2DH 2FPKA 2NVTH 3CXCA 4GS3A 2HIXA 4JI4L 3J7A5 2JY7A 4QZGA 4J9OA 2ZUBA 4IOCA 5M3FH 5TZVA 2IX0A 4AYBE 4A3IH 5KFQA 1AIPC 3ISDA 4X5VA 1SE8A 4HJ5A 1YHQA 5DB8A 3W1GA 3AQQA 4YWLA 5FLXc 2V9WA 2KHJA 4JI3L 4B9TA 1XMQQ 3T1YL 5KG4A 1N8RC 4MFCA 1UWVA 4QZ8A 1LYLA 4EBCA 1G291 4JI1L 5J2FA 3NENA 2PFNA 1ZQGA 1VCIA 3CCEA 4YP3A 4GC6A 2YTYA 3JPSA 2JY5A 9ICGA 4RQ5A 1VEKA 1MQ3A 3E46A 4RQ1A 1K73C 1NV8A 1ZQUA 2E2IH 1KDHA 2UUAQ 1HNWL 4UAZA 4GOPB 1X9MA 1E1TA 2PFPA 1VQEA 1FJGL 2PFOA 1ZJNA 5GROA 2XY5A 1TWFH 1Y1WG 3TRZA 2HHHQ 2BQRA 1N33Q 1JE5A 3AFPA 1PH6A 4A3GH 1JX4A 3J81j 3EYZA 4PHDA 3OJUA 2ATLA 1E7ZA 1Q8KA 4DOCA 4ECUA 4EQ5A 5J2GA 2MQHA 1NBWA 4MNOA 1PH1A 2Q2TA 4YY3L 3SI8A 2L15A 3ETLA 1C9OA 3PUYA 4M9NA 2PNHA 2VUMG 2F3IA 7ICNA 2I5MX 4B3SQ 2JK8A 5D46A 4BDPA 4AQYL 1JXEA 8ICPA 1Q1EA 3H3VI 4LW1A 1U5KA 4P73A 5K36G 4R8UB 3KF6B 5JJKA 3BJYA 3ZD8A 3KHHA 5C5JA 1G4AE 1VQCA 4ECRA 2W8KA 1J6QA 1MJCA 1VQ5A 2R8JA 2K75A 3E21A 2R92H 1WIVA 3HOWG 3FKIH 2R8IA 4K4IA 3K80C 2B3TA 4DV2L 5JUMA 3Q8RB 4IJHA 9ICUA 3ZJYC 4R71A 4JI6Q 4CCHA 4A76A 5J2CA 3FE3A 4TUPA 3CCRA 3UDGA 2JZ0A 4O3PA 2DAKA 2KNVA 5DQGA 3SGIA 5IP9H 3CC4A 3BZCA 3RH4A 3PUWA 4AQYQ 5IYCH 3H40A 5D4BA 4JI7L 3GTLH 2J6SA 1UT8A 1T7PA 4A3BH 2K9DA 3ICEA 2QGQA 4UY8C 1GKHA 5C3EH 1ZMWA 2RHQB 1VQMA 3HOYH 4FS2A 4F3OA 4J9MA 1ZQIA 4YMMA 1XNRQ 5L9XA 2JA7H 2B3GA 2ZJ5A 1D8YA 8ICCA 2D0OA 1XS9D 2LVNC 3CC2A 2JEIA 4I2HA 4K0KQ 1KC8C 3TS2A 2UUAL 3PGZA 4LF5L 4AIMA 1SKWA 2EKKA 1Z00A 1ZQJA 4TURA 2UXDQ 2AHOB 1X9WA 1ZJMA 3K9OA 7ICUA 3Q8DA 4DK3C 4F5OA 2AU0A 2AGPA 1ZQSA 3PSIA 4A3GG 2LSSA 4ED2A 2OOAA 4QWCA 3B0YA 2CWPA 2LVPC 4Y52H 4KITB 2ASBA 3PV0A 2B63H 1FL0A 3CW2C 4HIKA 4O2DA 1BPXA 4DR3Q 1Q12A 2BPGA 2PMZE 3QE9Y 3G6VA 1XB2B 1RXVA 5BOLA 8ICXA 4O3RA 2W9CB 2OTJA 3HOWH 4GXKA 3S1NH 3I4NG 3Q8PB 4JOIA 1HNZQ 4XA5A 3PW7A 4DV5L 3HT3A 3BQTA 4X65L 2ZJQA 1EIFA 4FDBA 3TS0A 3RJHA 4Y7NH 1WGNA 3C2LA 4KLIA 3PW2A 4FBTA 2LXKA 5IWAL 3LCVB 4NB3A 2W9AA 2JUJA 4PH5A 5CA7A 2A19A 4L5TA 9ICHA 3OJSA 4X64L 2GWSA 2R8HA 3K4GA 4DR5Q 4IOAA 2I5LX 1YNXA 4F4XA 4JC0A 1HZAA 9ICKA 1LM0A 1EUJA 5KT3A 5JI2E 4RQ8A 4EYHB 3J7ZC 1VG5A 1XSPA 1WYDA 1I50H 4F50A 2HHUA 1HZCA 4I2AA 4JBKA 3PV8A 3Q8QB 1XSNA 1BPYA 4K4GA 2IHEA 4QZEA 1HUZA 1TTEA 1NTGA 4LF8L 3F8TA 2HHQA 5M5YH 1QVFA 4ECZA 2MFIA 1X6OA 4KN7A 5KFGA 4RNOA 3GTKH 2A1JB 5HHHA 1BBUA 1KTQA 3HOVG 1D8LA 1L3VA 3TFSA 3PW4A 4YR3A 3D31A 4R4CA 4PPXA 2I0QA 4RPZA 3MDAA 2LBCA 3MFHA 1OXXK 3MABA 5KG6A 3D0FA 4YN4A 1ZQXA 1HNXL 3OW2A 2CWBA 3CMAA 3M85A 1ZQAA 2AQ4A 9ICCA 1PH8A 1L0WA 4XRHA 1QUQA 3RN5A 5DGBA 2HHHL 4DR5L 1MQ2A 1N33L 2HT1A 9ICRA 1OKSA 2DFLA 4JV5L 1KAWA 2NRWA 5KFVA 4KLLA 2ZM6L 4KHZA 3QEBZ 5CWRA 2MJ5B 2HHTA 1B70B 1B22A 4R4QA 4OWWB 5HHIA 4DS5A 3V7KA 8ICAA 5IIKA 2Y0SG 2OO9A 2R7ZG 2VNUD 3AEVA 2LVAA 4ECYA 5ELNA 2V4RA 1ZETA 1NKCA 3OHAA 3CMEA 4B9SA 3C2MA 5DKWA 4ELVA 2Z6KA 5DG9A 5DLGA 4LFCL 4R63A 1UE1A 4Q7JA 1NMGA 1YHAA 3T3FA 4UP9A 4KTQA 1T6OA 1ZQWA 4UP8A 2KFZA 4KLHA 1ZQLA 3PY8A 3I4MH 2IMWP 3PO4A 1N48A 8ICOA 2Q2UA 2KENA 9ICIA 2BDPA 1OXVA 9ICPA 2JQOA 1N36Q 2AKWB 2CCZA 4DFKA 1NJZA 3M9NB 4FS1A 9ICJA 5KFOA 1N34Q 1WGLA 2E2JH 4I2CA 2ZJ8A 2B21A 2DAGA 1QZHA 1WFQA 4G3OA 4M04A 5EWFA 5IWAQ 3RJKA 5F9LA 4MFAA 1V92A 1PH2A 4DL2A 2E5LL 2WFWA 4JI0Q 1SMXA 4QW9A 4DR4L 4IRDA 1OXTA 4M9GA 1DO2A 5KFRA 5IIJA 3A0JA 4KLJA 4ME3A 5KFXA 4EZ6A 3PX0A 2DENA 3GV5B 2KNZA 3K8AA 1R4GA 4KLFA 1CSQA 3H15A 2AGOA 3CCSA 2ZTEA 2LVOC 3A5UA 1H38A 3H7IA 1Q86C 1IM2A 2I1QA 1S97A 4RPXA 3MDCA 2FLLA 4L5SA 4GN4B 4BBRG 3V7JA 3E9IA 2VQEQ 1XNRL 1J5EL 4DV1Q 1YLAA 2PXIA 1X54A 2J6UA 1A5TA 2O25A 3NTUA 3RTVA 1Y1VG 4LFCQ 3S14H 5DFLA 1YEZA 8ICZA 3I4OA 5FLMG 3LWLA 2NVXH 2IHMA 1Z47A 2ZUCA 1K9MC 2IA6A 4UQGA 2BKEA 1Z9FA 1HR0W 4ALPA 4G3IA 3ERSX 1Q82C 2YU9H 2LVQD 5BOMA 5LMNQ 3BQ0A 2EXDA 1NK4A 3A74A 1SN8A 4DOBA 3H8WA 4NXMQ 2DAIA 4GXIA 1VQ1A 4QW8A 4C8KA 4C8LA 7ICHA 4QZHA 1YJNA 1XNQL 1IL2A 1W3SA 4UP7A 4DSJA 1Q81C 3B0XA 1TK0A 2OQ0A 2R93G 4ED0A 1S9FA 1QSSA 1RZTA 1IFYA 5C4JH 3GTJH 1WCNA 3T5LA 3LDAA 5BR8L 1CKMA 2KCTA 5ELOA 5DG7A 3RRGA 4JUZA 1VEJA 3OYYA 1JXLA 4BA1I 1VEGA 2UVUA 3GIKA 3GDEA 5J0RA 5LMNW 1BPBA 4IQVA 1A77A 5KFCA 3G71A 3KF6A 1ZQVA 2ASLA 2R7ZH 4UB4A 4BWJA 1VQHA 4DR4Q 3JPOA 1HZBA 2K14A 9ICQA 5GQOA 3STBC 1COOA 5IYDG 1PGYA 1N36L 4DK6C 2R6GA 2F52A 2FLPA 2Y1IA 2MO0A 3ZDCA 5JEAJ 1PH9A 2BH2A 1MKHA 1HNZL 2VA2A 5KG3A 4YWMA 5KFBA 3NGDA 4ELTA 1VQPA 4YCWA 1N34L 3QZ7A 1WOCA 3LK9A 2VL6A 2YYZA 1XMOQ 8ICNA 3ORYA 1ZMUA 1G6PA 5DG8A 3JPQA 3TFRA 1ZQNA 3HOUH 3KFUA 4M9JA 1MN3A 4JI4Q 9ICOA 3V7LA 1IYJB 4B3TQ 1TK8A 4DUZQ 7ICEA 1L3UA 2CQOA 1HJPA 3GIMA 2KNAA 3MGIA 1KFSA 1XPUA 2HHVA 8ICJA 2JZBA 3ER0A 1X56A 8ICMA 1V43A 1IBKL 1TWGH 2JA6H 8ICIA 4C8NA 3TAQA 5J2BA 2A1JA 3RB6A 1CSPA 1KXLA 1XU4A 2JEGA 2BPFA 2JA5H 1XJVA 4GXJA 4ECWA 3RAQA 2F4VL 4DUZL 1KRPA 3PO3H 3UE1A 4XQ8A 3U4VA 2XCPA 5M3MH 1ZQQA 4JI8Q 1NJYA 3C21A 1SKRA 5IIIA 3EWAA 5DBAA 1PYBA 4LF9Q 1PHJA 4O0AA 2KZ3A 5KFWA 1UT5A 4EZ9A 4F4WA 3HOZG 2MUTB 3MR5A 4GC7A 1ZQPA 1V9PA 4R1JA 5BR8Q 1SG9A 3BU2A 4LFAL 4P4PA 2DHYA 4RQ2A 4A3FH 2DNAA 2VW9A 5IT9c 1HR0Q 3UXPA 3RRHA 3RLFA 4F2SA 3RZOH 5KFHA 4XIGS 3M4PA 3Q8SB 1WCMG 1U9LA 4MF2A 4LWCA 1SKSA 2OTLA 3S1MH 4LZGA 4WJ3M 4QGUA 1L1OC 2CKZB 2L2DA 2RDJA 4GKKL 4RT2A 5L1LA 4PHEA 1VQOA 3M9MB 1X2IA 1IBML 5IP7H 3I55A 2DAEA 9ICLA 2BH8A 4P72A 5J0SA 2BA1A 2K50A 4XTCS 2Z0SA 4BXXH 4DV6L 2P6UA 4I29A 3MGHA 2P66A 1EYGA 1UE5A 1TK5A 2NN6I 1VQIA 3H8SA 3PO3G 4TVAB 4I2IA 8ICYA 3G6XA 1AE3A 4KI0A 1LUZA 2Y1JA 4IR1A 1PV4A 1VQGA 7ICPA 4DV6Q 2IHNA 1CKNB 3I4NH 4EYIB
chains in the Genus database with same CATH superfamily
3KS8A 3LQRA 1SV4A 3NBHB 3HOXH 1XTDA 2JA8B 4JI6L 4XGIA 3NVZA 8ICHA 1XXGA 4DV2Q 2FNAA 2RRDA 1Y14B 4DV3Q 1U45A 4F2LA 2FDRA 1SNPA 3UJNA 2F3VA 4X3SA 1IBMQ 4A93G 4F8MA 5ALZA 3NUCA 3V72A 2PQAB 4ECXA 3ED5A 4UAWA 5KG1A 4Y2VA 1U4LA 3PIO3 1CQFA 3T1YQ 1JB7A 1UA1A 2LMCB 4JI3Q 3AL0C 1I4GA 2VA8A 1EWIA 1PTOC 1MU5A 2Q0ZX 3L29A 4FZNA 1HNWQ 3GLFA 2F1HA 3WWVA 3K57A 1PTOH 3KHGA 3SYKA 4A3EH 3VDUA 5KNBA 3J7AV 4A3LG 2R7FA 4R8UA 3AYHB 4C3JH 5M5WB 3S1QH 2EYFA 3EVQA 3HOZH 1VQ8A 4XQQA 4YD1A 4R4IA 3CD6A 1GO5A 3SENA 4QZBA 2PZTA 1EY8A 2GLEA 1K3RA 2CW0D 1XPUA 1TR8A 5CJ7A 1LV5A 4A3MH 1FGBD 4M9ZA 3PMNA 1X9XA 4R64A 3KHLA 4DV5Q 3UXOA 1EQTA 4YR2A 1L1OB 4FO2A 4HSPA 3W1BA 1J5EQ 2ZUDA 2VANA 3D4DA 1SROA 3S1NB 2QA4A 1R9TB 4OELB 4AKHA 5IYCG 3U60B 1N5WA 4QHTA 4OJ6A 3HHZA 3HRDD 5TSSA 3JAML 3L3FX 3HGBA 4JI5L 2V6ZM 3TN2A 4BBRB 4JG2A 1QUQB 1Y8PB 3NTKA 4HJ9A 9ICAA 1GJTA 2GH1A 1ENFA 2QSFX 3ZI4A 4C8OA 7ICKA 3PIPA 1G51A 1TH2A 2EZZA 1V33A 4HL4A 1CUKA 1L5UA 4UPAA 3AU7A 2R46A 5KPTA 4X64Q 2EYPA 4A3JG 2WZJA 1UHUA 2BZFA 4I2EA 3F92A 3BQ2A 4DEZA 2ID0A 4RH6A 2DKLA 2WSEF 3AOEC 3GLHB 3J2PB 3LQQA 3KOJA 5GAHC 1Q39A 2N35A 4NDXA 3RLOA 4B3SQ 3M4OH 4M0WA 3UPQA 5J39A 2NZOA 2OM6A 2ISOA 1D1KA 2UVRA 1B9MA 2PI5A 2R92G 1ZOLA 2XF3A 4OCZA 3MFIA 4YMNA 2UUCQ 4NXNM 1NKEA 3E5SA 4X66Q 3GLIB 3IKJA 1GJXA 5IINA 2Z6KC 2V4QA 1MC8A 1KSPA 2V1CA 3J7YW 2DJFC 1F2ZA 1SYEA 1D6EC 5AICA 1NE3A 4I28A 3STBD 3RJJA 1ZQHA 4P0QB 5ELBA 5ISRA 2MU2A 4R65A 1F9RA 2N78A 3NSWA 3C29A 4HSVA 1GVNA 3L5KA 3ILKA 5E26A 2N49A 2NB0A 1K1SA 4J9LA 1RYRA 2CH4A 2B2UC 2I07B 1N36Q 2WTFA 5KFUA 2FHTA 1YNJC 3EPIA 2ALZA 4JBMA 3F2BA 4A93B 1X9NA 3F2DA 2W04A 4OJOA 3E2EA 1U4RA 4YHHQ 1XMOL 3PO5A 1G2SA 3ERQA 5K5PA 1AE2A 2DKXA 4F7XA 2LY7A 4K4GA 4QNRA 5KFMA 3PNCA 9ICVA 1DGHA 1NZBA 1JC7A 2HCFA 2KHVA 1VQKA 3HOUG 4BUGA 3C2KA 3DA1A 1WWVA 1Z6HA 2WACA 3CPFA 1X66A 5EJCA 2PI2A 4JI2L 4ACOA 2K03A 1PJIA 1FNUA 1HQYE 1CKNA 2A6HC 2E8GA 2W11A 5H1SE 2G3QA 1N75A 2O5RA 1O7IA 1R6BX 1QB5D 1RKNA 5T14A 4OX9L 2EYJA 2H5XA 1XO1A 4B9WA 2FS1A 3BQ1A 4DFMA 1K8MA 5CHGA 4DOAA 2HD3A 4K6DA 3AV0A 4G4NA 4LNQA 3KKAA 4ED3A 4PZ8A 3NBIA 3KFUF 1YJ9A 4DF4A 4CKCA 4ZKCB 1PFSA 1NJFA 2KCCA 3PNYA 1RQNA 4HCEA 1E2WA 1V1QA 1SR3A 4QWAA 4Q5VA 1NKBA 1XXHE 1RODA 2A1AA 2QHOB 4I2JA 4HIMA 3QYEA 1A2UA 3CP8A 4QUFA 1CQVA 3W3AA 1YIJA 2R18A 3H0GB 4BY1G 2E1EA 4AP9A 3GTMB 1EQQA 3A8JE 3FD9A 3OHXC 1HA6A 5EE3A 3ISCA 4X62L 2CHBD 4JW0A 1X55A 3HJQA 5BN5A 5DBCA 1U0LA 1XMQM 2KP7A 3B7ZA 1IM4A 1XO0A 2NRZA 1TVXA 1VQ6A 4IUTA 2DZNB 4MH0E 1IG6A 1L1OA 2B63G 3VDYA 5DLFA 5L1MA 4BLCA 2BPCA 5ALLA 4V190 2JA2A 4O1NA 4B3SL 1WCMB 4KLOA 4F1IA 3TQ1A 4Z6DA 3T79A 1S0MA 4C4SA 1Z5BA 4KLSA 1ESFA 1I4XA 4IQWA 2MNAA 1C8CA 5LMUM 3A0BU 1GKIA 4DV4Q 1XNQQ 3GV7B 3FRHA 2C2EA 3H91A 4A3VB 1VDLA 1WCLA 3EN2A 3GTOH 4B9VA 5DLQE 3SV4A 3L2AA 1I5FA 3GTLB 3IM1A 1C48A 1JE4A 1V1PA 3A7LA 4HLQA 4NLZA 5KNCA 1GABA 1STYA 8ICEA 4QWBA 2GQFA 2HHXA 2LKVA 3HOXB 3GO5A 3FTEA 2ESEA 2UVWA 1SBBB 2K5VA 1TQOA 2EY6A 4O0IA 3KUPA 3GLHA 2WFAA 1MSGA 5KNDA 4WW0A 3PIOA 3R8BA 4A3KH 1SNOA 1JJ2A 1IW7D 7ICGA 2K5HA 3FVQA 3AJIB 4PGQA 5AFWA 5HR6A 3RBDA 2E74C 2CXYA 4KHVA 5DDYA 5FLXS 3VK7A 5ITXE 1GLNA 2Y0SE 4X64M 3M9OB 3VR5A 5HGQA 1OQYA 2Q2HA 4PMBA 1S77D 4KLUA 4R4TA 3GQBA 4RWSC 1G6ZA 2KZMA 3IHQB 3SK6A 2G9HD 4FXDA 1EIHA 3MC0B 2B2VA 2ZTDA 5ALOA 2XNAC 1PM5A 1D0KA 4YXMA 5J2DA 3I4MG 2MUYA 4QIWB 3MAQA 5AM2A 1IBLM 1DOMA 4LFAQ 1SZPA 2VA3A 1BNZA 2DWZB 1N62A 1SL0A 1BXTA 4KLQA 4FXKC 3JPNA 4F4YA 1WJ7A 5IY0A 2DWMA 1KHIA 5LMUQ 4D80A 2KEYA 3QR8A 1PJQA 2DL0A 4G4OA 1Z4OA 1LABA 3M1YA 1LT6D 2RF4A 4DAVA 3C3LA 4OO1I 2UXDL 1JB3A 2GOLA 4IRKA 3M9BA 3F2UA 4DFJA 1Z1BA 1DONA 2AUJD 1Y8NB 4ZCKA 2VQFL 1TWHB 4M6WB 2F0TA 7ICJA 4MTNA 1TWHH 1YVCA 4O3MA 4IPHA 3FKIB 4JI8L 4JI4M 1MX0A 2EJMA 4EBEA 5ITTA 1L3TA 3T1HL 5EAYA 1S40A 2JA6H 3PR4A 5C3EG 1F9QA 1TAMA 2K5NA 5BPCA 1OTRA 1UAPA 2KV2A 1K0SA 1YITA 1HIWA 5KFAA 5HP4A 4IFDJ 3AQEA 5J2AA 1ASYA 5IP7G 3I73A 1P7DA 3TQSA 5J2IA 1JJCB 3UDIA 2OWOA 9ICMA 5JEAG 4X62M 2CVRA 3T1YM 2IHFA 5EKIA 4PGYA 2M5ZA 2EAPA 2W7OA 2VQEM 1IYUA 2DWLA 1A3VA 2V4DA 2WB1G 2XGTA 3EIVA 1IBKQ 4F91B 2R4EA 1A76A 3JR5A 5KFZA 2MSNA 1HNXM 2PI2E 3DM1A 5EXPA 4KHPL 5GTIU 4A3EB 5AI8A 3HWTA 5J0XA 5DNFA 1QCKA 4CDFC 2Y0TA 4UAYA 1STGA 1Z3EB 4UAUA 3T1HQ 3UZUA 1NZPA 2YTVA 4GH9A 2BR0A 5HY6A 4GNXC 3EBEA 4K5XA 2EZYA 2CFMA 1NO1A 2F0EA 2QDBA 3URYA 1WTHA 4DR5M 4O3NA 4CBVA 4OONA 3NHHA 1RYSA 2KJ8A 3T5HA 5C44H 5EE9A 2MROB 4NLKA 2QCPX 2P35A 4QJFA 4RGNA 1S10A 1KABA 2X6LA 3HKZG 2DUDA 1EZ8A 2BA0A 2JYOA 2OF1A 4JV5M 1SXEA 2HBJA 3G6EA 4IJFA 2DVWB 4DNIA 3I4NB 3GZFA 2ZM6M 4O3SA 3DEEA 4QQBX 1BPDA 3DHQA 1XXHA 3SK8A 1K83H 1Y1WH 4OWXB 1ILPA 3E9SA 1SL1A 2KBNA 1TWAB 2WIIB 4A3IG 4B3RQ 4GOPA 7ICVA 3UMMA 4BGDA 3PF5A 1Z6TA 1ZAEA 4JV2A 5EJWA 5LMNL 1VLBA 3RD4A 4O5CA 3CYMA 1TFRA 5J0OA 3WOEA 4APVA 1MSWD 1F9SA 4F88A 1W2BA 3AU2A 4RQ7A 1D9DA 4RZRA 1PVQA 1T3NA 1C20A 4DV1M 5F9NA 2GVAA 3ITPA 1ZQRA 5ALSA 2BOSA 4B7FA 2R8GA 2N8NA 5LL6S 1EY4A 1KLUD 2ERCA 1OFHA 2F0PA 4DAYA 3AKZA 2IJ0A 1UE6A 4DR2Q 2JP1A 3NXWA 3AQFA 1ZQBA 5ALRA 4F4KA 2ZXPA 1SXJA 4UB5A 1OAIA 1XX8A 1KTKA 2AHMA 1J2NA 1YHBA 2ZAMA 3KDSE 2LMRA 4P2HA 2EYOA 3GLGA 3A98B 4LJ9A 5J3BA 4C3IH 4OW0A 3RNUA 3ULLA 1URJA 3IG8A 4QWEA 4RQNA 3HW8A 4P0PB 3JC66 3OIQA 4LJZC 3VA7A 5ITUA 3I7FA 5K4LA 1YZ7A 2EQSA 2K5QA 4TQUS 1IN5A 1N34M 1TAQA 2EY5A 4CF4A 1E2ZA 4H02A 1OXSC 3A45A 5ITRA 4FZMA 4RQ0A 1XNSA 2HAKA 2F4IA 3X3NA 1P16A 4EX5A 5KFDA 3EIHA 2R44A 2UXCL 3M7DA 7ICLA 3J81c 3OTOL 4POGA 4DL3A 3OMCA 5KFIA 2KQ3A 2QKIC 3DDHA 3GIIA 3THVA 3K7UC 4I2DA 1RM6C 4I65A 3M3YH 4BBSG 3FDSA 5B66U 2Z4SA 3KS4A 1YNJD 3WK4A 4LF4Q 1ILQA 1ZQDA 4RUAA 2WAQB 1TV9A 4Y2UA 1RIPA 3DUZA 3SE0A 4GOPC 4PMCA 2K4IA 4UBCA 4Z6EA 3U60A 3SASA 4QZDA 3N4MB 1KNAA 1JMSA 5L1IA 4MGHA 4ED6A 3PX4A 2R61A 2C5RA 1SLJA 4C3IB 4HMIA 3VDPA 1R2ZA 4P16A 2VJ5A 1RPLA 2VUMB 5ALDA 1DOKA 3A56A 2CHVA 2EAOA 2A6ED 1ET9A 3FUTA 3VFDA 3K1RB 4TUSA 2EYHA 2HDLA 1SRUA 4H13C 5M5YB 1UEBA 4UHVA 4BXOB 1YJWA 7ICMA 3OOCA 4X3TA 5J1ZA 3GDXA 1H9RA 2F4VM 2PMZB 2QKQA 2NN6G 2F8KA 2L1BA 3H0MB 1PZJD 1CKOA 4PNYA 1U47A 5DB7A 5FTLA 2V1UA 5ALIA 1NMFA 1X3EA 3QU2A 4QZFA 2Q8TA 2JA7G 4QCLA 2QNJA 4MF8A 2EZVA 1TS4A 1QILA 1G41A 2W9BA 5CEHA 1M1KC 4DR6Q 5JVG3 1TIID 3BS1A 4RKBA 3HILA 5JJLA 4IALA 4L8RC 3QU7A 3VR3A 4D81A 1SE3A 4DXFA 1IKMA 4B9LA 4ZLTF 2ZXIA 5DM63 5IILA 4CF5A 1S72A 2HVHA 2B63B 2ZIUA 2C5CA 2HCCA 5C4ZA 1AH9A 4DR1M 2UUBM 2N3SA 2WV6D 4OWTB 4PZ7A 4BY7H 3U6LA 3JPPA 3I91A 3TZDA 3C1YA 2LBOA 2EY2A 4Y2XA 1A8VA 4FZLA 4UB6U 4FO6A 2Z4HA 3D4RA 4BWGB 3AOEA 3QX7A 5E4WC 2HKJA 3C5FA 1I94M 4OO1G 3NEMA 4IBBA 4YY3M 4F8RA 2K52A 1JWMD 1PLFA 4LF6Q 1KFVA 4P75A 2K4KA 5J2KA 4TUQA 5JAVA 1EFUB 4IBDA 2NUCA 8ICFA 2HWJA 1PFNA 3ZDBA 1S4ZA 2KHHA 1UNSA 4RG1A 2YFQA 4B3RM 1B7YB 4A3BG 3Q8KA 4X66M 1ICFB 2KW0A 1Z00B 4NXNQ 2W43A 4LZDA 3RBEA 1I4QA 4TQRA 2DPIA 3UXNA 2G9DA 1KEJA 4PGXA 4GEWA 1SSOA 3W5OA 3L4PA 4L63B 2ATWA 5IOCA 2F4VQ 1TF0B 3C2PA 2KZUA 2W54A 3N52A 4DN4M 3U4ZA 1EWHA 2BDUA 4KLDA 4DK1A 1WTQA 1CA5A 3EJIA 4QIWC 5C1BA 1KFTA 2PQEA 1R9TH 3KP1E 4ZOHC 1B3QA 3DFZA 1SAPA 3HJSA 2OOBA 2C2DA 5E79U 4OEMB 4PMWA 1ZEQX 2SEBD 4A3KG 3PVXA 1VMPA 5KIXA 1BNOA 4X3KA 3J80L 2Y0QA 4KLKA 3ZDAA 2AXTU 3NASA 5D49A 2NV3A 5I2XA 4DV2M 1IL8A 1SXJB 4II7A 2PZWA 4CDCC 4F92B 4A4IA 3HJEA 3MXGA 1RD9D 3KOOA 2UUCL 1U4PA 4ME5A 1K3BC 2D7GA 1D7QA 3H0RB 4AG5A 2K1BA 4DQRA 2X8AA 1TWCH 3V6HA 2LFNA 4WORA 3R8FA 4LZJA 4X65Q 4P0PA 1LKYA 1SWWA 4DQIA 3JPRA 1ZQZA 2W8LA 3HFZB 5E4XA 1QZGA 1LTSD 2GVBA 1K8GA 1C0AA 4K2LA 1GL6A 3ONNA 3NUQA 4GFJA 2BCRA 3GLFB 5KT5A 2N55A 3SAUA 3K7AH 4C3HG 3I04M 2FPLA 2MO1A 2PMZC 4OHJA 1FEZA 4Y2RA 2XY6A 1DV0A 1BKBA 2F0WA 2TSSA 3S9WA 3QU5A 1S76D 3GTPH 3FYHA 4GN5A 3K1JA 4LF7Q 1NNXA 2CCZA 4A3FG 3PX6A 1RXWA 4AG6A 3IRBA 1S5CD 3RLNA 5I2YA 3R3OA 4DGZA 2YNMD 2D62A 4EQNA 4JYAL 4MEYA 1NK6A 1A6SA 1P3QQ 5BR8M 3J7BA 4RQ4A 3G7LA 4KLMA 5F2DA 3RJGA 1MSHA 4XT3B 3S17B 5JRTA 2UXBQ 2KOBA 4PG3A 4DBGB 1Q3LA 2LSSA 2H3FA 5EOZA 3AFQA 3FKEA 5T1GA 3D0FA 1TWAH 2W3RA 4HEOA 4Z6FA 8ICRA 3PUXA 3D3RA 5EP3A 4KY7A 2WF5A 1PH5A 4F93B 3GV3A 3BQ7A 1EFWA 2R92B 3KZXA 2DXIA 3CU7A 2XSZA 4DF8A 8ICSA 2IX1A 3M4YA 1CZWA 1SL2A 3AB9A 4A3JB 1VQ4A 4GIPA 1NK5A 2JZ1A 1BBWA 3KZIU 4B7GA 4DQPA 1T43A 4MGIE 4LF5Q 2I7NA 1DO0A 8ICWA 3KDFA 2E2JB 4DCCA 4LF8M 2AH5A 2XGPA 4I2BA 4JXJA 4CF3A 3SHLA 4A3BB 2JE6I 5DB9A 1LTID 2DZLA 1STHA 3W68A 1CHPD 4U673 2H1RA 2D6FC 2RBMA 3B7QA 1AN8A 4C3IG 5FLXL 3MJ5A 1CTMA 3QUCA 3G48A 4LVSA 2XFSA 1J8IA 5KL8B 4X66L 4WP2A 1UPHA 2NYVA 4RGOS 2W9CA 1VF5C 4IPDA 4WJWA 4LRTA 2JZBB 2ZIWA 2JY6B 2ZIUB 5ALYA 1IXSB 4DV3M 3IG5A 2KG5A 1VQDA 2MR9A 2A68D 2XC9A 2ZANA 4RKLA 2X69A 3UI2A 4KMUA 4F5QA 4MEXA 3R93A 5GADC 3TI0A 4DQSA 4F5RA 4UAVA 2QW7A 4MGKE 5C0YA 2GA4B 1DJRD 2C99A 2Y0SF 3SXHA 4BBSB 3TARA 4MHEA 4NMZA 1X6IA 1FFUA 5DQIA 4KV6A 2KZZA 4KODA 4YXJA 3D2SA 3GTGB 2C28A 4R4OA 4NXNL 3IV6A 3VYUA 5C3EB 7ICIA 3H8JA 3W2DA 3M6AA 2KMDA 4DUYQ 4MTKA 2ZJRA 4YQWA 5KPRA 3OTQA 4OJPA 1E94E 4DV5M 5HMMA 1BCPB 3HKZE 2JA8G 4C2MH 1EZ6A 1WCMH 1PH3A 3RE8A 2M9NA 2Q2IA 2F2AB 4FW9A 1KFDA 2UVVA 1EIGA 4U7CA 3MR3A 5IP9G 3DEOA 2Z8YM 2HHWA 4IUQA 4DL7A 1ENCA 4IBGA 4C7YA 4RQ3A 2JA5G 1TH4A 1L8OA 2RP5A 1JR3A 4NXZA 4EELA 1L0XB 3RJIA 1E3PA 2BCVA 4GRIA 1ZQ1C 1QTMA 4QOZC 3T5JA 4B9MA 3K7AB 1PTOD 4DSIA 3S24A 3U58A 1QQ7A 3CKIB 4EX6A 4O42A 1OXUA 1ORYB 3L2PA 4WFN3 7ICRA 1XMOM 4I27A 2JNHA 3S14B 4G57A 5KTQA 2E8OA 3QUTA 1KN5A 2G08A 1NJGA 4F5NA 3NELA 4A3CH 5C4XB 3L28A 2E76C 2RLTA 2WAQG 4NM1A 2EKFA 1G3IA 3GV8B 4DSLA 1HT1E 4A75A 3KTQA 3ONAB 4DPGA 3WKEA 5L37A 1WTPA 1H95A 3HHWA 4FWDA 4EEYA 2AGQA 2DPJA 3WK9A 2BE5D 2D9UA 3S2DB 3C1ZA 4ILWA 2HCIA 3I56A 1WTXA 4BBSH 1HA5A 5DDMA 2FFKB 2PCFB 3UK6A 5CP2A 2CQAA 2QARA 2KEEA 4K0KM 3M7NA 2VY3A 1PRTC 2NZ1D 4XYQA 4I2FA 2ICIA 3VA5A 1JMCA 2HCBA 2YB1A 5CV8A 4LFBL 2ASJA 4NW2A 1DGGA 4D82A 4F4ZA 5J0UA 1ASZA 3IECA 4JV0A 2JHDA 4OX9M 1I4WA 1P8LA 3A8KE 4HN7A 5HURA 3LWMA 2KEDA 5KT7A 2UU9M 3I4LA 2EA0A 3QXGA 1ZYQA 1LB2B 3L9AX 1X32A 4A3DB 4MGZE 2W82A 2NYZD 3HWSA 4O3QA 1JQYD 4PQXA 2RDIA 4JK1A 1DK2A 4FBUA 3MEHA 3TSSA 2YR0A 3S16B 2ZIXA 3FUVA 4RQMA 3UDFA 2KRUA 3R2IA 3TAPA 9ICSA 1EEFD 3BBZA 3CAMA 1O08A 3T6PA 3ZH9B 2YN4A 5DBBA 1SNCA 4BBAA 4DV7Q 3SEIA 2QPAA 3BDOA 5KT2A 3RJEA 4O5EA 4DSEA 3RB3A 4G7OC 3PUVA 4CDEC 3TPZA 1JRPA 1XTCD 4J15A 4B08A 2KA7A 1LLRD 3S1RB 2M2LA 3CCJA 3PO3H 4A93H 4RNMA 4A3GB 3J81i 4NL4H 4LJ5A 4NLBA 3FHWA 4GLVB 2EYMA 3K0YA 2UU9Q 1EOTA 2LYBA 2K8BB 3RB0A 4RMFA 3PCOB 1LV9A 4KO8A 3FKIG 2RSOA 2R6FA 1X65A 2FMMA 4P17A 2B2VC 2BQUA 2EJGC 4P4OA 3MMPA 2E5LM 3TKAA 3HPOA 5C4XH 3HHXA 1LTTD 1XSLA 3C1EA 1ZQOA 5FKAC 5JJIA 1QSLA 1SV0A 3OSPA 2ODGA 2XFTA 4ECQA 4MFFA 1STBA 3TL4X 2PQAA 3H4MA 3GILA 2JR5A 2NRXA 1JN3A 3HU1A 1WI5A 2JH1A 3OWFA 5EE0A 1HH2P 1Q46A 3UQ2A 1FJGM 5EP4A 3VYTA 5FSWA 2BHNA 1XC9A 2MAXA 1IHZA 4OU7A 1L7OA 4RCNA 1SNQA 4MB7A 1VQNA 4I7AA 1TKDA 1BDOA 3NP8A 1GOZA 4QY7A 1DGSA 1LACA 3QOLA 4KLTA 2XGNA 3HS0C 4C3JB 1IZ6A 2MA1A 2JJQA 5C5MA 3Q8GA 1LT4D 1QQWA 3BS7A 4C0ZA 3KOYE 3WHKA 1F4IA 2I5HA 2Y20A 4KK7A 1GHJA 3V6KA 3I4VA 4NLGA 2L11A 3QIAA 2B29A 5JOBA 4UB1A 2CRUA 3E0EA 5KFJA 2PI4A 1J5EM 4CJ6A 2A69C 3D2QA 4BX9C 3V6JA 1O7ZA 1O7YA 4GKJM 2L4NA 3FRPB 1ZQYA 5E7NA 2NVQH 1Z59A 2NVTB 7ICOA 5KT4A 1EYCA 3E58A 1KNEA 4EIWA 3FP9A 3KP0E 2M0NA 8ICBA 1SYDA 4P71A 5D14A 2DAMA 2ZJAA 3NPPA 5J8YC 9ICFA 2XLJA 1TAUA 4NLNA 2F0FA 3MXNA 5LHY1 4A3EG 4QF4A 4LFBM 1N61A 4E6IA 3I01M 1XWLA 2FLNA 4M0AA 1DGFA 1ZQ9A 2PKEA 1GVPA 3K75D 2K0BX 2DI0A 5ALXA 3QO2A 3A46A 1D9FA 4ECTA 4B3ML 4CE6A 2LYHA 4NC6A 4ZRZA 2L4FA 3GP7A 3PIP3 1EE8A 2QENA 2B2WC 3U6CA 2UXDM 4PZ6A 4JWNA 3JAMc 3FYDA 2VQFM 2K04A 1Z1VA 1GO3E 3U9OA 1ZD4A 5A2QE 1EIYB 2JP7A 3GIJA 1BPZA 4HAIA 4ED7A 1ZMVA 1F2YA 4AH6A 3K9PA 3GTMH 3TP7A 1K1QA 4QIWE 2QDLA 2NVXB 2ZM6Q 1Y88A 1I6HH 4OVZB 2NBFA 1Q3CA 2J6TA 2OT2A 1ZQCA 2QEXA 1IN8A 3QAUA 4WJ4A 3RH5A 9ICXA 2DGYA 2EYLA 3KF8A 3MK6A 2W55A 4ABNA 1OIPA 3JAMi 4ECSA 3CCUA 4E0DA 3V05A 5IGDA 4A3JH 2FXQA 5CORA 5C0XG 2G0AA 1M8AA 4DKAC 3C58A 2KTQA 4QJFB 1OUQA 4HCSA 3K2LA 2LM1A 4JYAQ 3ISBA 9ICTA 5AI5A 2Z8LA 2FMCA 4JBJA 1AFPA 5AKEA 4QL5A 3KJPA 4S3SA 1B44D 3RAXA 1X37A 4OJLA 2KHIA 4LGYA 2RA4A 3A0HU 1QANA 3IDWA 2YV5A 1BVSA 4KHPM 4KLNA 4DL4A 2IW3A 4BY1B 3MWYW 4EQPA 1A6XA 5IGEA 5KG0A 3F2CA 4NXML 3SHGB 4IBFA 4JOIC 5J2JA 3TQYA 3NBXX 1SMYC 3KLSA 1A2TA 5CBAE 4B3MQ 5C4XG 1G71A 2GO7A 2VIXA 1JUDA 2CHQA 2VIIA 2D8CA 3EQLC 3IP4B 1GO3F 1PTOF 4Z6CA 5IE8A 3EROA 1WTRA 4L78A 3ZDEA 4DR4M 4QZ9A 4KTAA 2J5YA 3A5ZB 4DFPA 8ICKA 3PO2H 1GHKA 1X40A 3F5EA 4L5QA 2DF4B 1D0LA 1MJEA 1RJTA 4YIJA 4B9NA 4K8JA 4DAPA 2G5IB 4P4MA 1J97A 1IXRC 1NY5A 4B6JA 9ICWA 4IC9A 2CWAA 1WUDA 2FE8A 5AKLA 1LTAD 5EXXA 1LVHA 1ZXIA 2P6RA 3IL8A 4KX3A 2CW0C 1C1KA 3GLFE 4NY8A 2C35B 5B5EU 3SYZA 2UUAM 1STNA 2F0UA 1RG6A 1NV9A 1KQQA 2BCQA 1S0NA 3BJUA 2W9MA 3S6JA 1HXYD 4LMQD 5GAEC 1V38A 4ELUA 1TR5A 2VF7A 2Y21A 3F5AA 4JPBW 3K81C 1NY6A 3BDPA 1ZQEA 4YCXA 4NM2A 5J0PA 1EEID 1QLNA 1ZQMA 1QNKA 3MTSA 5FO7B 4DV1L 2C2RA 4ZH4A 3S15H 5J2HA 5AKIA 5AKGA 1OTCA 2CRXA 3SMPA 8ICVA 2OPFA 3QWLA 1T3QA 1ZYRC 3QZ8A 3QWNA 4YY3Q 1H9KA 3GLGE 2HI0A 4UBBA 1SEBD 3LCUA 1IBLQ 5KFNA 2YX8A 4XUSA 3J81S 4XQJA 4DUYL 3MHBA 2DY8A 2UXCQ 1K8OA 2HW3A 1BR9A 1V97A 3GTOB 3RZOB 5DNYA 4OIJA 3FTDA 4RNAA 2CV0A 3NVYA 5ALUA 3DWQA 1B3AA 2IWHA 2XSCA 2L7HA 2ICEC 3BDCA 3H0GG 4DSKA 3BG3A 5CMDA 5IYBH 2HSZA 2N88A 4B3MM 4LUZA 3VKHA 1S0VA 2IX3A 1FJGQ 2F44A 2LXJA 3BYTB 5AJ3Q 1BGXT 4C8MA 2APLA 3L25A 3HRZC 3OPXA 4DLGA 3UQ0A 3Q8LA 3KFUG 2I9GA 1QDTA 2R62A 1B4OA 1YBYA 1PFBA 2JEBI 4YCVA 2JEJA 4I5SA 1TE2A 4KHPQ 1UE7A 3OTOM 2RQXA 4CJ2C 1ZV1A 1D0MA 3IHPA 5KFTA 5KFSA 4EVOA 3DZDA 2BQ3A 1QNUA 3KDFB 1K3XA 4EQOA 4KY6A 3HOUB 7CATA 1UUPA 5IZ7D 1A62A 1C7YA 3U9SA 2XRSD 3T5KA 1LTRD 4K5VA 1PH7A 2CPRA 2E2DC 2MGSA 5KGUA 2FOIC 2E2IB 2BJVA 1L2CA 4NRVA 2NRTA 3WK8A 2DNEA 5DGAA 2HVIA 2KJ5A 1XMQL 3J80i 4C3HH 4KLGA 3Q22A 1VQ9A 2QZ4A 2JV3A 2JA6G 3GD7A 1B43A 2ZG6A 1HZ9A 3MFYA 4G4QA 2ZIWB 3R2TA 2NRVA 1HT2E 4KX5A 1T5EA 2AJQA 5HMLA 3L0OA 4DR1Q 3SR6A 2PO4A 2UUBQ 3CHBD 5AM5A 4DUZM 7ICFA 4LF7L 5IIOA 4RUCA 1X9SA 5CV7A 1IY0A 1NK9A 3H4DA 5LMUL 1PRTD 2WAQE 1M4VA 5IGCA 4GC5A 2OQKA 3SK5A 3C23A 1NJWA 4IN3A 3CPWA 4YD2A 1E24A 3F1ZA 3J27B 4LFBQ 4A3FB 1QUSA 4FD2A 4HEDA 4PL2A 3H0LB 4KKTA 2MGWA 1T9HA 1JJGA 3Q23A 3LVWA 1YT3A 4YR0A 4Q43A 3FUUA 1D2BA 3EZ5A 2JRZA 2HIVA 5EBCA 3CTWB 5FJ8H 4DNRB 2A6HD 3AOGA 4R9WA 1B1ZA 1T8EA 4AYBG 3GRYA 4RKUF 5ALWA 4QWDA 1IY1A 2EXZA 1F0MA 4GITA 2KHQA 3N6RA 4M8AA 4DR1L 2UUBL 4A3CG 4DS4A 1HHVA 2VDBB 5AK6A 2ASDA 1SYGA 5H2FU 5FLMH 1K8AC 4CDGA 4DO9A 2ZIVB 3HOVH 4DR7L 4A3DH 5IGBA 4IPGA 2OTJA 5ITQA 1DM0B 5M3MG 1HFNA 3L7ZC 2MUTA 1YNNC 4N9PA 3WKDA 3EW9A 4WJ3B 4J9NA 4DL5A 1DGHB 3PW0A 1B8AA 1L2FA 4HR7B 3VKGA 1SFOH 1N36M 2LKYA 3N7SC 1KL9A 5AIAA 1TVAA 3NE5B 1GUNA 1JALA 2KXEA 5J0TA 1VQLA 3K5NA 3GTGH 4NL9C 2K47A 1UA0A 1PZKD 1PYSB 4ED8A 5TISU 2GN5A 3HX3A 5KFFA 3HP6A 4QZIA 5KPZA 3RR7A 1EY0A 4J8QA 3H3VH 2R4JA 4LK1C 4O5KA 1IBLL 1EXNA 3V2TA 1BUVT 4GN3B 4Q45A 3FM9A 3H8MA 1NOMA 4I2GA 3PQIA 2F03A 5IIMA 4GKJQ 1PV4A 1QAMA 4IFDI 2L6OA 3WKBA 4ZUIA 5KT6A 2IT1A 4S12A 4FCVA 5KFEA 4JV5Q 3O13A 3TMEA 1IIPA 1H9MA 2A73B 2E2HH 2HQLA 3M8SA 2F0GA 1KQSA 3FDTA 1D8BA 1NNLA 2XCAA 5HGTA 4B9UA 3NWTA 1N8RC 1VMCA 4Q8EA 3QB3A 3SVMA 4DSFA 4FF3A 2OCEA 2E8NA 8ICLA 1WG8A 3UMCA 3T1HM 1NJXA 2FMQA 4K8IA 5G3LD 1WD1A 3CCLA 2DJGC 2UXBM 3QYBA 4RPYA 3G6YA 2JEFA 1DOLA 4I7ZC 4R7GA 4HJAA 2O01F 1JI7A 5C4JB 3F53A 5KYIA 2RGHA 4P74A 1KYIA 1Y8GA 1G59A 4LF9M 2ZIXB 4EEKA 1VQAA 4IRCA 1CEZA 2AWNA 5COYA 4DQQA 3Q8MA 4AZFA 3RH6A 1SDFA 1TDZA 1N63A 3FRIA 4MGYE 2NO5A 4UN2B 2BCUA 3WHLA 3U61B 4REZA 1K28A 3LW5F 4LGMA 4JI7M 3V76A 1MIUA 4GLXA 1HFGA 4QNLA 1EY5A 2KVCA 2XGQA 4EBDA 2F5SA 4NL9A 2EIFA 5ELFA 4GLAC 4OX9Q 2MJ8A 3GLHE 4JYAM 1A0PA 1KLNA 1N9WA 1S3OA 4JI0M 3QOJA 4Z6YA 3LGJA 2GNOA 1JIHA 3OSOA 4LF8Q 1YZ6A 3KLWA 1ZKOA 1KRSA 3S17H 4Y2SA 2B2WA 3QU9A 2J4XA 4DAYB 2O6KA 1QVGA 3MVVA 5E6JA 3NQTA 4F2RA 2BWBA 4RU9A 3MA2B 1TXYA 3MEFA 3PUZA 4C1NI 7ICQA 1T3TA 4NJ8A 1OXJA 2JXMB 3OW7A 5J22A 3PO2G 2R0IA 2A68C 4J9QA 2L0CA 4LFCM 1II3A 2VS1A 3C5GA 4RAUC 4IJEA 1S0OA 4HYKA 4Y7NB 2E5SA 4DXGA 2EVBA 2BDNA 3GQ4A 2G5DA 5FJ8G 3D8BA 4OXPA 4X62Q 4LFAM 3CQZH 4C56C 3ETRA 2KRKA 1IXSA 1J7KA 2JXNA 2W7PA 2HDOA 2G07A 2PYKA 4WRDA 2A3VA 4MZ9A 3EPGA 2P5ZX 3ZD9A 3ULPA 3FTFA 2BWEA 3HU2A 3U6PA 5IODA 2R8KA 2F0JA 4OVZA 3DM3A 4KN4A 4J9RA 5IGFA 2XWJB 1N32M 5HNKA 1NY4A 2EY1A 5M3FB 4QZAA 1FVIA 3ND8A 4IUUA 3AL0B 3RN2A 3M4QA 2KN7A 1KDCA 2QQ8A 2WB1E 2LHCA 1EU3A 1ML0D 4NLCA 2L5YA 1HTPA 1VS0A 2J7ZA 3D8GA 4NP5A 4GKKQ 2C22A 2QCUA 5KFLA 2VB3X 2XY7A 4KY5A 4KJOA 3NTHA 4DF7A 3B6YA 1BF4A 1QVCA 2L7IA 2CP8A 3RJFA 1SYCA 4G4RA 4A3MG 2AQ3B 4IFDG 2VJ4A 4OD0A 2KFNA 1PXUA 1TS2A 3PVSA 2JXJA 2LM4A 3H4BA 3NVWA 4DR3M 4F5PA 1CI3M 2MP1A 2JEAI 4BXXG 4IBJA 1AROP 1JT8A 2KJXA 2ZT9C 2QB0B 4R66A 3S16H 4PHPA 4A3LH 4M6WA 3K5MA 2XTIA 1WR1B 3HGIA 4DV6M 4YVZA 4BXOA 3ZDDA 4KLEA 5EPJA 4JI1Q 3DLLA 1M90C 1PVRA 1S5FD 4Z9CB 4DA2A 1KKXA 1BQQT 1N77A 1X3FA 1VJ5A 2PW7A 5ELDA 2A8VA 2UXBL 3M7GA 3CRXA 5D3DA 2NZHA 4LF4M 3RR5A 1EY7A 3GRRA 1XHBA 1M6YA 3QU4A 5ALEA 4PJ0U 1FYCA 2J0TD 2OEHA 2WKCA 4YHHL 4RNNA 1JR3E 4TQSA 1E2VA 4LF9L 2RKSA 4RF1A 4CISA 1QZEA 2ZXRA 2LYAA 3RZDH 3GLIA 3QEAZ 2JY8A 4N9TA 3KF8B 1KIXA 1NCVA 2F5QA 3OSNA 1COKA 3T15A 1XYIA 3HX0A 5GKNA 2BCSA 2VZAA 2QARB 2DNCA 3PMLA 3MFGA 1EFID 8ICUA 1NK8A 5C3XA 5DYGA 4UB2A 4QMGA 4ZQ3A 2FPMA 5EPLA 1R7RA 4JI6M 4QZCA 4YFKA 5T1IA 2V1CC 4JI0L 1U48A 3UE0A 1N32Q 5CV5A 1QUTA 1I94Q 8ICTA 4FF1A 2F4VL 2Q8RE 1S5BD 7ICSA 3UDXA 3GP1A 4M2YA 2BGWA 3CCVA 3M6ZA 4DR6L 3R9XB 4BS9A 3HOXG 2VB2X 1JR3D 1YSYA 1U4BA 2R65A 1Y1VH 1TS5A 4NSRA 4ULLA 2YY6A 4K0KL 3N7RC 1KD1C 3L26A 2DQNB 3PSTA 3H0GH 4M0DA 3BZKA 4POFA 5IYBG 4RQ6A 1QCBD 4YWKA 4JCVE 4OO1J 2K6AA 2ISPA 1XPOA 5KRUA 1E22A 9ICEA 4DR7Q 1DOQA 1SE4A 1QWYA 2DBYA 4HMJA 3TBIB 5IYDH 3IFDA 3FUXA 3BXWA 2UU9L 2KZSA 4Q44A 2H4OA 3OIPA 1I94L 4RHRA 1N32L 3KBBA 2R7DA 3CC7A 5J0YA 1EU4A 2RHSB 4JI2Q 1I3QH 4OGQC 5IIFA 4IBEA 1SNDA 3MGVA 4LF6L 3OHBA 5M5XB 1WHCA 3K1ZA 2F0HA 1GD7A 1SXJD 4DFDA 4DV7L 4DAMA 2KD1A 2KIVA 4A3DG 3S2HH 1GL7A 2K4PA 4B3RL 2AMCB 4JI7Q 1CRXA 3SQIA 4ZYSA 3B9PA 3OPOA 3T13A 4IPCA 2F0KA 4DV0Q 2F1JA 4A3MB 1A63A 1XNQM 4N8X1 1VQFA 4DL6A 3SZ2A 3HHYA 1N56A 2F0MA 1KRTA 5JEAH 1PZNA 4N8FA 1EOVA 4DR3L 2HDMA 2L55A 2K33A 5M5WH 2KA6B 1F5SA 5J0WA 1GM5A 2AWOA 2D2CC 2E8MA 2WSFF 4IURA 2A6EC 1Q3VA 3N28A 1CI4A 2WAQF 4UW9A 1STAA 1VQBA 2O2LD 3ZCBB 2JA9A 1T94A 3IFTA 3MR6A 4M9HA 1QSYA 1HQMC 3NK9A 1VQJA 2ZJPA 2IOFA 1RF2D 3PXGA 4IBCA 3U26A 2NTTA 4GNXA 4DV0M 4UDUC 2UUCM 1G91A 2B8FA 4LF4L 1YE9A 5C0XI 4M9XA 5J2EA 1HUOA 4NV0A 1K3WA 3VYRA 3PW5A 1YUBA 2PFQA 2PNRC 2D0PA 1NK0A 1DGJA 4IQTA 4W5WA 5CR0A 4RA8A 2D3DA 3RB4A 3QG1A 4L6V6 4C4TA 1K83B 3KHRA 4DV4L 4V0BA 3MXNB 2R93H 2YMPA 4ED1A 4X6AH 2OH2A 1SXDA 3DMUA 4IQZA 4NSOB 3I90A 3TANA 8ICGA 4BY7G 2BE5C 3SMSA 5KG2A 4BY1H 1BPEA 3KSXA 4JI5M 3N97B 2WINB 5EPKA 5E1FA 3BOSA 5DB6A 4JV1A 2WB1F 4IR9A 3AU6A 1DCZA 5DQHA 4KKUA 3PR5B 3SD7A 2AQ2B 3GTKB 4Y28F 1IYVA 3KD3A 3PSFA 3HEJA 4K5WA 3MBYA 1XPRA 3JPTA 4J9SA 3KYHC 3GFKB 2H3VA 3WK6A 5CB1A 3KJOA 3GPYA 1HTLD 1B53A 3KLSX 1CZGA 5ALKA 4GKJL 3OWEB 4HIDA 2K05A 2W9BB 3H4JA 4RT3A 1H6UA 2X6GA 5FK9C 3PF4A 1KBUA 3U50C 5AM3A 3VC8A 4DR6M 2FMSA 1LTGD 2AQ0A 2D7EA 2M60A 5EWGA 4Y2TA 3H09A 4YCUA 3X3MA 5AI4A 3KXEC 2MPMA 3WK5A 4LUVA 3SR1A 4F72A 4CRXA 5CV6A 3OGUA 1PH4A 3JAMS 2OQ4A 4BBRH 4JBWA 5DEHA 4YMOA 4ZAIA 4FFDA 1EQRA 2B6GA 1NR4A 2EQYA 3O0FA 2YQEA 5ALQA 3WKAA 2FMPA 2HHSA 9ICBA 1S8OA 2ZXOA 3MZ5A 3CF5A 4HIOA 2CEAA 3GLIE 3G4SA 4Q8FA 3BS5A 1T4GA 4ANRA 3HZJA 4K4HA 1ICWA 5M5XH 4HJ7A 1WJJA 4LCBA 4JWMA 3OTOQ 1L3SA 7ICTA 5M3FG 3A7AB 2ES2A 1TKWB 4M47A 5KFKA 5KG7A 4Q0FA 4LRSA 3U6DA 4BJQA 3I72A 1J2MA 5KQDA 4OL7A 2YMLA 8ICQA 1U49A 2F0VA 4BWMA 3SV3A 1QAQA 1JOOA 3C9PA 1HR0L 1IKLA 2EDUA 1PA6A 3B89A 4DV3L 4LJ6A 2EZXA 1IBKM 3RR8A 4AYBC 2VQEL 2PMZF 3S1QB 2RCNA 3CP0A 1S5LU 4YG2A 4TKOB 1YI2A 3CQZB 3K0XA 3IN5A 3KSJA 4J9PA 4IJLA 2H1EA 5GAGC 3U6EA 1W6JA 5L1JA 4FE3A 3PO2B 1ZQTA 1L8LA 4LUOA 4US9A 4IQUA 5KL1B 1SJED 1WTOA 2XVTA 5KAFU 4PHAA 2QBYB 2EJSA 2WP8J 1ZD3A 1ZQKA 5J0QA 2Z9HA 4O3OA 5EE1A 2NVYH 2R3ZA 1K0RA 3KBGA 3SK4A 5M3MB 5C0XJ 2K4EA 3VCBA 2JA8H 4DV0L 4FWGA 3MR2A 4M9LA 1ZYRD 3J80c 3TREA 2J7OA 1HNWM 1L2BA 3HU3A 5EKLA 1NK7A 2EANA 4HAEA 2F3NA 4G4KA 1Z5AA 2L4EA 3E9HA 3FPPA 1KLGD 4IZ8A 5AK4A 5KFPA 3GTQH 1S3SA 5AKXA 1RL2A 4XBOA 4BA2I 3AFHA 1IXRA 4LY6A 4UB3A 4DV4M 1ZQFA 5L1KA 1TWGB 2KCMA 2LTUA 3GV6A 3HKSA 3T51B 3LVVA 4RGTA 4K6LA 1HNXQ 4JMUA 5AM4A 4DLEA 1BNPA 2IPKD 2PW5A 4H7BA 1R4QB 3I76A 1VQ7A 4R3DA 1NHGC 1Q7YC 1AUAA 3S1RH 5H37D 4O9MA 1X3GA 5I6WA 4GNXB 2ALYB 3W0FA 5L8RF 3PSPA 4NWIA 3TEHB 3KOWE 4G9BA 5EXTA 5KG5A 1XXHB 1K82A 5KNIA 3HOYG 5AJ3L 5AK3A 4M9SA 4B3TL 2YTXA 3I2ZA 4NPSA 3GQCA 5FP0A 1RCVD 4L5RC 2IY5B 3ULJA 5F3WA 4AQYM 2IBKA 5KFYA 2RKOA 5J29A 2J7NA 1LTLA 1QOHA 2XN9C 1A0IA 2RVLA 1FFVA 2VQFQ 4DUYM 2E5LQ 2XO7A 1VDDA 3M8RA 1L7NA 3AUOA 2A5HA 3D4WA 1SE2A 3G6JB 3VLFB 4J9KA 4DNTB 4HJ8A 1LT3D 3CRLC 2KJ9A 2RRUA 2F1IA 5EWEA 4FCTA 1G8ZD 2R45A 4X3UA 3KBXA 5IT9S 1UFZA 1RQLA 4LJXA 2G8LA 2W3SA 4ECVA 3TWLA 4DWIA 1FGUA 3OMGA 2ZTCA 1PJSA 1E1OA 2SNSA 2KK0A 4IO9A 4NOOB 1Q02A 2G5HB 9ICNA 4KN7C 3S2DH 3GLGB 1I3QB 2FPKA 2NVTH 3CXCA 5CC4A 4GS3A 3KVWA 4B7HA 3MC1A 2HIXA 4JI4L 3J7A5 3SEBA 2JY7A 4GC9A 2Y0SC 4QZGA 2ZUBA 4J9OA 4IOCA 5M3FH 3HOYB 5TZVA 3I4YA 2IX0A 4AYBE 4A3IH 2OXPA 2EO2A 5KFQA 4IFDH 1AIPC 3ISDA 4X5VA 1SE8A 1GUSA 4HJ5A 1YHQA 5DB8A 1HR0M 1IN7A 1TT2A 1F2MA 3W1GA 3AQQA 4CKEA 4YWLA 2R7ZB 4ID6A 4MIUA 3CGWA 2HMXA 2V9WA 2KHJA 5FLXc 4QB4A 4JI3L 2BJWA 2Y9UA 4B9TA 1JOKA 2F0SA 3T1YL 1XMQQ 4USAA 3AMUA 3TADC 3N7PD 2F5NA 5KG4A 4QZ8A 2XZFA 1Z19A 1DK3A 4MFCA 4EBCA 1ENAA 2K6BA 4PZNA 1G291 1I6VC 1LYLA 3DEPA 4KJNA 1PK1B 5J2FA 4JI1L 3RMHA 2XICA 5AI9A 2PFNA 1ZQGA 4JN6A 2KIWA 1VCIA 1BCPF 3NENA 3CCEA 4YP3A 5J8YA 2RHFA 4GC6A 2YTYA 3JPSA 2JY5A 2KDLA 1N60A 9ICGA 5CRXA 4PD2A 4RQ5A 4L6TB 1VEKA 1MQ3A 4RGMA 5EGTA 3E46A 4XK8F 4RQ1A 1K73C 1NV8A 1ZQUA 2QB0A 2MH8A 1KDHA 1K5OA 2E2IH 1PVOA 1VDVA 2UUAQ 3TP8A 4L15A 3H94A 1HNWL 4UAZA 3KK7A 1X9MA 1E1TA 3HZXA 2PFPA 3TZUA 4C7ZA 4GOPB 1VQEA 4QNMA 1FJGL 3E0JA 2PFOA 1ZJNA 4EENA 5ALFA 5GROA 3HKZC 1IY2A 2XY5A 1TWFH 3NQIA 1Y1WG 3TRZA 2JA6B 3FUWA 3HJ8A 4A3KB 3RZDB 2QILA 1VF7A 2HHHQ 4TUWA 2BQRA 3P20A 1N33Q 4UB8U 4IUNA 2RDHA 4CJ0B 1Z4NA 1JE5A 3AFPA 2JA7B 2EPBA 1PH6A 4A3GH 5FOBB 1JX4A 3J81j 3EYZA 4PHDA 1UCVA 3OJUA 5FTNA 1Q8KA 2ATLA 1E7ZA 2K5DA 2HBKA 4DOCA 1A3TA 5C6AA 4ECUA 4EQ5A 5CR3A 4LF5M 5J2GA 1SZHA 1EQVA 1NBWA 2WF6A 2MQHA 2BNKA 3SBJA 1O78A 4MNOA 1PH1A 2Q2TA 2ZBKB 1B0XA 3SI8A 4YY3L 4IL6U 2L15A 3ETLA 1C9OA 3PZPA 1WXQA 2VKQA 2JN4A 4M9NA 2PNHA 3PUYA 4ZKBB 2VUMG 1XC8A 3GPUA 3U6QA 5FTJA 7ICNA 2F3IA 1JROA 5D46A 5ALHA 4BDPA 2I5MX 2G5GX 1JXEA 4Y2QA 2RQ5A 3CF6E 8ICPA 1D1IA 1ESRA 1Q1EA 4TSSA 4LW1A 4CKBA 4CGYB 1U5KA 4P73A 2O5IC 3H3VI 5EP2A 4R8UB 3T56B 5K36G 3J80S 3I70A 1J09A 1I4HA 1ZXTA 3KF6B 5JJKA 1A15A 2JSOA 5CBEE 3BJYA 3ZD8A 2YMQA 3KHHA 2F3WA 1FIQA 5C5JA 5DAUA 1G4AE 3D8LA 1VQCA 4ECRA 2W8KA 1J6QA 1MJCA 1VQ5A 1EL0A 2K8AA 4P2CB 2X49A 1QH9A 2R8JA 2DY7A 2K75A 1X6JA 2AQ1B 3E21A 2R92H 4ITQA 1WIVA 3VK8A 3A55A 2PPBC 3HOWG 3FKIH 2R8IA 1MI2A 4K4IA 3K80C 3HOVB 2B3TA 4DV2L 5JUMA 4DK0A 3Q8RB 4IJHA 3M0EA 1PRBA 4R71A 9ICUA 4IUPA 3ZJYC 4CCHA 4US8A 1SFOB 4JI6Q 4A76A 1WWUA 5J2CA 3FE3A 3U6OA 1EYDA 4C1NK 3BVZA 1QJOA 2VXWA 1F44A 4AKIA 2DKZA 2KICA 4TUPA 3CCRA 1BCPD 2QB1A 1TS3A 4FWHA 3UDGA 2JZ0A 1SNMA 2B39A 2LWXA 4IBIA 4O3PA 5AHXA 5NUCA 2DAKA 2KNVA 1FD7D 2MRLA 4RF0A 5DQGA 5ALNA 3SGIA 5IWAM 1I4PA 5IP9H 3CC4A 1JB0F 3BZCA 3RH4A 3PUWA 4AQYQ 5IYCH 3CF0A 3H40A 5D4BA 3HOZB 3I3CA 4JI7L 5I4DA 2F0DA 4RFBA 2ENBA 2J6SA 3GTLH 1JCKB 1UT8A 1T7PA 2IL8A 4A3BH 2K9DA 3ICEA 2QGQA 4NXMM 1ED1A 4UY8C 1GKHA 1F9PA 3ZYYX 5C3EH 2F1MA 1ZMWA 1JOQA 2RHQB 1VQMA 3AM9A 3HOYH 4FS2A 4BB9A 4F3OA 5CV9A 2RSNA 2CV2A 3QUQA 4J9MA 1ZQIA 4YMMA 3J81E 5L9XA 2B2UA 1XNRQ 1ONLA 2B2YC 1X42A 2KVSA 4KKSA 2B3GA 4C3JG 2JA7H 4JI2M 5IT9L 2ZJ5A 3HKZB 3SAGA 1HUMA 1D8YA 8ICCA 2D0OA 3KOZE 2LVNC 1XS9D 1EY6A 2B2TA 3CC2A 5KQ8A 4I2HA 1R2YA 5FTMA 3WU2U 2JEIA 1RDFA 4K0KQ 1KC8C 1G8PA 3TS2A 1EIJA 1L7MA 1UEAB 2QEJC 1SIJA 1RTOA 2Z4IA 1B4FA 4FNFA 2UUAL 3PGZA 4LJ4A 3UMGA 4AKGA 4LF5L 4AIMA 1SKWA 1L8QA 2EKKA 1LV7A 5A2QS 1Z00A 1ZQJA 2KKVA 4TURA 2UXDQ 2AHOB 1UM8A 1R5LA 5JI3E 1X9WA 1ZJMA 1QYRA 3K9OA 7ICUA 3A54A 3Q8DA 2XI9A 1MBYA 4F5OA 3VYSA 4DK3C 1I6HB 2AU0A 4NKLA 3DOAA 3EIEA 4CHTB 2AGPA 1RU3A 3JAME 3GTPB 1B9NA 1ZQSA 3PSIA 1KDBA 2Z7JA 2B0CA 4A3GG 2E8PA 1HCZA 3C28A 4AI6A 2OOAA 4QWCA 3SAHA 3B0YA 4ED2A 1H9JA 1L7PA 3ND9A 3D6CA 1V34A 2CWPA 2LVPC 4Y52H 4TRDA 4KITB 2ASBA 3PV0A 1C4QA 2WF9A 2B63H 1FL0A 4EGVA 3U5ZB 3CW2C 4HIKA 4O2DA 1BPXA 4DR3Q 4A3IB 1Q12A 1FNWA 2BPGA 2E75C 2H3IA 3QE9Y 2PMZE 3G6VA 1XB2B 1RXVA 5BOLA 4I8OA 4B3SM 5KAIU 4O3RA 2W9CB 2Q4TA 8ICXA 3WOFA 3CCMA 4JK1C 2B8GA 2L5TA 3QJYA 4LF8L 5AKZA 4UAIA 4GXKA 5AKKA 3RF9A 3S1NH 1AP0A 3I4NG 1SMYD 3Q8PB 2ZAOA 1MGSA 4JOIA 1HNZQ 2DWNA 2NVQB 3K8ZA 2HHHM 1N33M 2WHEA 4XA5A 3PW7A 2D5DA 1X3QA 3S15B 4DV5L 1Z5CA 3HT3A 3BQTA 1IV8A 4X65L 2ZJQA 5ALMA 1D2NA 1EIFA 2OXOA 1AW7A 1QG7A 1LTBD 3RJHA 4FDBA 2B2YA 4Y7NH 3TS0A 1WGNA 5DYIA 2FJ6A 3C2LA 4KLIA 1HPCA 3E3XA 4CIZA 3PW2A 4FBTA 1DXMA 3K58A 2LXKA 2RDGA 4JB3A 5IWAL 4UARA 3R9KA 3LCVB 5D3IB 4C4RA 2DUYA 1HR0Q 4NB3A 1HQCA 4Y2PA 2W9AA 2C9CA 1PYWD 2JUJA 2ZXHA 4PH5A 1FNVA 5CA7A 4OJ5A 2A19A 4L5TA 5F3XB 5JPMC 4LF7M 9ICHA 5BN3A 3UMBA 3OJSA 3AN1A 3DWAA 4X64L 2GWSA 4PT5A 3K4GA 2R8HA 3MXPA 4DR5Q 4FF2A 2M00A 2L12A 1ZRMA 1O7LA 5EQ0A 4IOAA 2VF8A 3HKPA 4MHVA 5JTIA 1YNXA 4F4XA 2I5LX 3M3YB 4JC0A 1SXJC 1Q3UA 5EBDA 1U9RA 4CDDC 3I1YA 4KD3A 4PDIA 5ELEA 1BBXC 1F77A 2KECA 1HZAA 9ICKA 4DU9A 2HL7A 1WTVA 2R93B 2FJ2A 1LM0A 3B7NA 1NUCA 3TP5A 2JA5B 1EUJA 2MHVA 1N2XA 3A8IE 3GRUA 3T53B 5CYUA 5KT3A 2WKDA 5JI2E 4RQ8A 4EYHB 1EY9A 2F0OA 1SJHD 2JGAA 3J7ZC 1VG5A 4HTHA 1XSPA 5I9PA 1NI3A 1I50H 1WYDA