1IXSA

Structure of ruvb complexed with ruva domain iii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
b'ESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQDLIKEALKRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Holliday junction DNA helicase ruvA
molecule tags Hydrolase
source organism Thermus thermophilus
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
total genus 16
structure length 50
sequence length 50
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07499 RuvA_C RuvA, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ixsA00
1XXHE 2QNJA 3T6PA 3GLIE 1WGNA 1DO2A 2KHHA 1T6OA 1NV8A 2EKKA 2DNAA 2LVAA 1HT1E 1NV9A 2BWEA 1WGLA 2EJSA 1ZMWA 2DKLA 2OO9A 2G3QA 4F1IA 1E94E 1HQYE 2MR9A 1BVSA 2O25A 1G3IA 1MN3A 2DZLA 1DV0A 3K9OA 1JR3E 2R0IA 1VEKA 3IHPA 2JUJA 1IM2A 2LTUA 5JI2E 2JP7A 2K9DA 2HAKA 3B89A 3LCVB 2ZTDA 2KNAA 3FRHA 3MMPA 1EFUB 2DAKA 1WIVA 1OTRA 2KNVA 2ZTCA 1YLAA 1VQ1A 1TTEA 1UFZA 1DO0A 1VDLA 4DBGB 2JY7A 4WP2A 2CWBA 2L2DA 2LVNC 4G3OA 1WJ7A 4R71A 2MROB 2L4FA 2OOAA 2JY6B 2K0BX 2LBCA 1OKSA 1SG9A 4F2LA 3F92A 1HJPA 2B3TA 1TR8A 2MJ5B 2H5XA 1F4IA 1OAIA 1OQYA 2QSFX 2HWJA 1C7YA 3K9PA 5DFLA 2MGWA 3GLFE 3E46A 2RRUA 4Q7JA 3GLGE 1WHCA 1ZV1A 2JY8A 2WZJA 1ZMUA 4GEWA 2JZ0A 2EKFA 1VG5A 2JZ1A 1HT2E 2QHOB 1VEJA 3H4JA 1VEGA 1G4AE 2DHYA 2DENA 1XB2B 4UN2B 2CP8A 1ZMVA 2OOBA 3FE3A 1T43A 2LVPC 1Y8GA 1R4GA 1GO5A 1CUKA 2JY5A 1IXSA 4HEOA 1AIPC 2DI0A 3FRIA 2BWBA 2DAGA 1IFYA 2DAMA 3BBZA 1QZEA 1WR1B 1KYIA 1A5TA 2LVOC 1V92A 3E21A 2JNHA 2L4EA 1PGYA 3GLHE 2LVQD 1G41A 1Q02A 2DAEA 3IECA 1P3QQ 2KNZA 3LCUA 2DAIA
chains in the Genus database with same CATH superfamily
1OFHA 2KEBA 5EP1A 2DWLA 2QQ8A 2V6ZM 1IY1A 1WGNA 2R4EA 3U60B 1HNXM 4RF1A 2Y20A 4PDGA 2XH9A 4B08A 3GLGB 4FCWA 3J27B 4JV5M 1Q39A 1PJIA 1IXZA 2UUCM 4XBOA 2QCUA 3U6SA 3TL4X 2QENA 1WXQA 3NBXX 1NV9A 2JWSA 3J80S 4DR1M 2RKOA 2XEPA 2EJSA 1I4WA 3PXGA 5ITTA 2EO2A 3GLIA 2OO9A 3GLHB 3Q8GA 5BR8M 4DV5M 3FKEA 1HQYE 2MR9A 3PNYA 1BVSA 4IBIA 2F5OA 4NL4H 3A42A 2LNHC 4FW9A 3FUWA 3JAMS 1XC8A 5ITXA 1NHGC 1Q3CA 3GPYA 2L09A 3VLFB 2YQZA 2JUJA 4FWDA 5JI2E 3HZJA 4X66M 2ERCA 3SARA 2HAKA 5EXTA 3LCVB 4P17A 1XMOM 1GKIA 2XLJA 3FTFA 2ZTDA 2KNAA 4JI1M 4B7HA 2DAKA 1WIVA 3FTCA 4K0KM 1NVMA 1YLAA 2APLA 1VQ1A 1UFZA 1OFIA 3TE6A 4DBGB 2KRUA 2JY7A 1EE8A 1OIPA 3HGIA 3QYBA 3UMMA 5A2QS 1VDDA 4G3OA 1TH2A 1R6BX 2JY6B 2XFSA 2LBCA 2R18A 3OTOM 3HJQA 1SG9A 2Y0QA 2Z8YM 4DR6M 4TUWA 1TDZA 2L7IA 3LMMA 3SFZA 1KSFX 1QZMA 4RKUF 3LVVA 4Z6YA 3U6LA 4NXMM 3AL0C 4GH9A 3R9XB 2QSFX 3U61A 4AKHA 5BPVA 1HR0M 2MGWA 3KOXE 2JXNA 1QDTA 2LH0A 1R2YA 3GLGE 3SC3A 1WHCA 1ZV1A 2JY8A 2YNMD 1ZMUA 1N78A 4II7A 5EXXA 2JZ0A 4LFCM 1ZAEA 1QDRA 2JZ1A 4OU7A 3B9PA 3SBJA 2R65A 3U5ZA 2UXDM 3L25A 1VEGA 4IJFA 3SATA 2DENA 3HHYA 4LG2A 3RGSA 5JI3E 2F5SA 3TQSA 4UN2B 4X64M 3E4RA 2OOBA 4OX9M 1GL7A 2LVPC 2X8AA 3I51A 1R4GA 4PT5A 1GO5A 2G8LA 2L7HA 4ITQA 3PNVA 1IXRC 1DGGA 2UU9M 3GLHA 3MJ5A 1SXJC 5EP4A 1K82A 4JXJA 2W82A 3BOSA 3CGWA 3IG8A 3K2LA 4OW0A 3M0EA 1Z5AA 1AUAA 4DUYM 4IBDA 1QZEA 4B7FA 3IG5A 4LF6M 3FYCA 3K1JA 1KYIA 5LMNM 1IBKM 3SYLA 1A5TA 5FTKA 3GRYA 2UXCM 4BBAA 1QYRA 3NBIA 4OVZA 1Q02A 3R8FA 1XMQM 3SMPA 1P3QQ 3F92A 4LJ8A 4Y28F 1IY0A 4DV1M 1TH4A 1XXHE 1SXJD 4HL4A 1SXJA 2QPAA 4MGYE 1T6OA 1PJTA 3GLGA 1NJFA 4B7GA 3GPUA 1NV8A 4QNMA 3GLFA 2Y0TA 4KT0F 3UJNA 4MGHA 3EIHA 1PJQA 2CHQA 4QNRA 2BWEA 4NOOB 2MH8A 4IBJA 4DV6M 1QANA 1NNUC 3AKZA 2I7NA 1E94E 4DV7M 1K3XA 2KRKA 3HHWA 3KP1E 5EP3A 4DV3M 4WW0A 2DZLA 4BLCA 4QOSA 1RU3A 4PD2A 3J2PB 3FYDA 3VKHA 1NO1A 4FWGA 3LQRA 2P5TA 4JI4M 4EIWA 1IM2A 2LTUA 3HJSA 2JP7A 1QUTA 2K9DA 3K92A 2HCBA 5E6JA 4LFAM 3U6DA 1E9RA 1Z6TA 2C99A 3A45A 3DOAA 3L29A 8CATA 3GQ3A 4AZFA 4KHPM 1D0MA 1MX0A 4IBEA 1IQPA 4B3MM 4IBCA 2KNVA 2ZTCA 3TPZA 5ITXE 1EIJA 4L8RC 3JR5A 1DO0A 2HL7A 3VKGA 5ITUA 5FTLA 2WSCF 4WP2A 2E5LM 3I4YA 2R6FA 4LGYA 4ZPXA 1KFVA 2L4FA 2OOAA 3U6CA 4QOZC 4GKKM 3KSXA 2R4JA 5IT9S 2D7GA 1TR8A 4KODA 4RF0A 3U6EA 4DV0M 4DR4M 4AQYM 3KDSE 3QAUA 4MB7A 2V1UA 1OAIA 3DZDA 2EA0A 1C1KA 3U5ZB 1UM8A 4JYAM 1J09A 1XXHA 4LJ7A 5DFLA 5FTMA 3GPPA 1SXJB 2D7EA 3E46A 3W67A 1GVNA 4LZZA 1L2CA 2DXIA 3TWKA 3H4MA 4GEWA 1G8PA 5KPZA 1VG5A 2CV0A 1PJSA 4KLNA 1I94M 3DFZA 4S12A 2CHGA 2QHOB 2XSZD 3A98B 3GLIB 1N77A 4JI8M 1GJSA 2J7OA 3AFHA 4IIWA 1TGUA 1ZMVA 2UXBM 1W5TA 3C58A 3FE3A 5IREB 3FUUA 2Z3XA 4I5SA 2J7NA 1DGHB 2JY5A 1IXSA 2OPFA 1IY2A 4G4QA 1IN6A 1GL6A 2DZNB 2X4AA 2LHCA 1AIPC 2DI0A 3AJIB 2BWBA 1N33M 3HJ8A 3FD9A 2VQFM 3HU3A 4REZA 1YUBA 5L8RF 3BBZA 3HU1A 1IFYA 1WR1B 4GHAA 5KPRA 2DVWB 3C9PA 2XZUA 1LV7A 1QAMA 2LHGA 1XWIA 5EP2A 1V92A 2Z4SA 3W0LB 2ZAOA 2JNHA 3THGA 4LF4M 2F5QA 2CUZA 3HWSA 3GLHE 2LVQD 2ZM6M 5FLXS 2EUCA 2K47A 3B7NA 3FUXA 5ITRA 2CEAA 3BXWA 3IECA 4LRSA 2DWZB 3T6PA 5KO3A 1IN5A 3GRRA 3E9SA 2QNJA 2ZAMA 3KOZE 3ZH9B 4GRIA 3TWMA 3FUVA 4LZJA 2KHHA 4NSRA 5DNYA 3PVSA 1L8QA 2K6BA 3T1YM 3GPXA 3AV0A 1JQJC 3VDPA 1NJGA 1HQCA 2EKKA 1G71A 4R7GA 4LJ6A 3FUTA 1GABA 1PM5A 2DNAA 4HLQA 4GC9A 2LVAA 3SHFA 4L16A 3UK6A 1IN8A 4LJ5A 3GP1A 3V76A 4AI6A 1SXJE 2X49A 4LY6A 3D8BA 3LVWA 4IBGA 2G3QA 2AHMA 4F1IA 1NHWC 5ITQA 4W5WA 4FCVA 2F5NA 4KO8A 2O25A 5E26A 1G3IA 1MN3A 1D0LA 4M9SA 3WHKA 3KW6A 4XGIA 4D82A 3C3EA 1DV0A 3J7AS 1N32M 3SASA 1OJLA 1JR3E 2FNAA 2QP9X 2QBYB 2R0IA 1XHBA 3ZC7B 3KS4A 3KP0E 4JI7M 1IN7A 2FOIC 1G59A 1GLNA 3W68A 4G4OA 2HHHM 4CGYB 2UUAM 1FJGM 3U6PA 4G4RA 4I8OA 1QVRA 4GKJM 5EXPA 4D80A 1OTRA 1MJGM 1TTEA 4CHTB 3J81S 1D2NA 3M6AA 3FTEA 1R2ZA 1DGHA 1JB0F 1GJTA 1WJ7A 4CISA 4BB9A 2C9OA 3GQ5A 3T1HM 1L1ZA 1OKSA 1ORYB 3U6MA 4F2LA 4YY3M 1HJPA 3KXEC 4LF8M 2F5PA 5KQ8A 5LMUM 4MGZE 2DWNA 1TH3A 4LJ4A 2MJ5B 4OVZB 4DV4M 1Z5CA 3L27A 4FCTA 4NRVA 1OQYA 2XZFA 2F4VM 3ZQJA 7CATA 1C7YA 3SAVA 4AKGA 3HKPA 4GITA 3HX3A 2FH0A 5EXSA 4R3DA 3GLFE 2KZSA 2KA6B 2L6OA 4LF5M 3QWLA 2WZJA 4LJAA 4L78A 1YE9A 2RGOA 2XF3A 2Y21A 3FTDA 4GIPA 4PCZA 3L28A 2R46A 1L1TA 4MGKE 1N34M 1JR3D 1VEJA 3B7QA 1G4AE 2DHYA 1XB2B 2FFJA 2H1RA 5KQDA 1E32A 2CP8A 2DHRA 4MM3B 5ITYA 1NNJA 3B7ZA 3EIEA 1T43A 4DV2M 1OAOC 3MK6A 2C5RA 1T3TA 4DR5M 1X37A 1DGBA 3RFWA 2WSFF 3RE8A 1XXHB 5IZ7D 2Z4RA 4JI3M 4CJ6A 1PJJA 2CV2A 1N36M 3AOGA 1QAOA 4B3TM 4QHTA 2DZOB 4CIZA 4IBFA 3A46A 1Z5BA 1QUSA 2VIIA 1S3SA 3FRIA 2DAGA 2DAMA 4I4LA 2KW0A 5C1BA 1E9SA 4LRTA 4FWHA 4G6ZA 3T15A 5DYGA 3JR4A 2KDLA 4JI5M 2LVOC 3E21A 3M7GA 4JI0M 2BNKA 1L2DA 2GNOA 4G4NA 2LWXA 2R62A 4B3RM 1V33A 4JI6M 3QYEA 4L4UA 4QHSA 2WSEF 2DAEA 1HNZM 2KNZA 1R5LA 3LCUA 2DAIA 2J5YA 3LW5F 4AKIA 3GLIE 2GQFA 2Z7JA 3LQQA 5DYIA 2UUBM 1DO2A 2VF8A 3KFUG 4GMQA 3TWLA 5EJCA 2CRUA 3U60A 3Q8XA 2JA2A 4NC6A 3HHXA 4DR7M 2M5ZA 4M9XA 2KZUA 3W0FA 3SAWA 1L2BA 1HT1E 4DR3M 5KPTA 1H6UA 1WGLA 2I7PA 3GRVA 3I04M 4M9ZA 3GQ4A 5IWAM 4RNAA 2C9CA 1ZMWA 2DKLA 4LF9M 2CHVA 2LXEA 5F3WA 4M0DA 4FVMA 2VDBB 4JI2M 1FNNA 3VK8A 1NY6A 3SMSA 2NQ8C 2QBYA 3KS8A 3NWLA 3KOWE 3AOEC 4D81A 1HNWM 3K9OA 3ZCBB 3GO8A 3RGPA 3UZUA 4DUZM 3MHVC 1VEKA 3IHPA 2O01F 2ZANA 4L6V6 4Z8XA 1LTMA 1IXSB 4MGIE 3PFIA 5EQTA 3B89A 4ANRA 5C18A 3T38A 3FRHA 3MMPA 1EFUB 3AOEA 2HKJA 3DA1A 3VFDA 2KXEA 3I4VA 4AW4A 1ZQ9A 1JR3A 3VK7A 1VDLA 4X62M 2CFOA 4LF7M 2OQ4A 2FS1A 3HY5A 2CWBA 2L2DA 2LVNC 2XSZA 3GRUA 4R71A 2DWMA 2VF7A 2MROB 2BJWA 2K0BX 4M0WA 4MH0E 2FE8A 3CF2A 3I01M 2B3TA 1N75A 2ZBKB 3SHGB 2Q2EB 2V1CA 4B3SM 1J7KA 1R7RA 2N35A 4FD2A 5FSWA 2H5XA 1F4IA 4PDIA 1TDHA 1NSFA 1J5EM 1W5SA 4AG5A 2HWJA 3CF0A 3K9PA 2M60A 3VDUA 4L15A 1IN4A 3KVWA 3U6QA 3U6OA 1PRBA 2RRUA 4GC5A 2C96A 1OIZA 4Q7JA 5FTNA 4NXNM 2VQEM 4IBKA 3C3DA 3UGJA 2R44A 4X65M 4LCBA 2EKFA 3L2AA 2RGHA 3CF6E 1HT2E 1NY5A 3HHZA 3U61B 1YSYA 1MU5A 1XNRM 3H4JA 1XNQM 3K8ZA 2O5RA 3SYKA 4YHHM 2YFQA 2XGNA 1Y8GA 4GHLA 1CUKA 3CTWB 4I81A 4NSOB 2CV1A 4NRWA 2YR0A 3KSJA 1V34A 4HEOA 2G5GX 5H37D 4IBBA 2CE7A 5GKNA 1IBMM 4XK8F 1D0KA 2A5YB 2D7HA 3HU2A 2BJVA 1K3WA 4A3VB 3J7BA 4JN6A 1Q3BA 3WHLA 3L26A 1IBLM 1QQWA 3GLFB 4IJEA 4LJ9A 2R45A 2C98A 4DR2M 3B74A 4LGMA 4AG6A 2QZ4A 1QAQA 2L4EA 4WURA 1PGYA 3SAUA 1G41A 4P16A 5FTJA 2XFTA 4LFBM 3ILKA 3D8LA 1TF0B 3KOYE 1DGFA 1Z59A
chains in the Genus database with same CATH topology
1XXHE 2QNJA 3T6PA 3GLIE 1WGNA 1DO2A 2KHHA 1T6OA 1NV8A 2EKKA 2DNAA 2LVAA 1HT1E 1NV9A 2BWEA 1WGLA 2EJSA 1ZMWA 2DKLA 2OO9A 2G3QA 4F1IA 1E94E 1HQYE 2MR9A 1BVSA 2O25A 1G3IA 1MN3A 2DZLA 1DV0A 3K9OA 1JR3E 2R0IA 1VEKA 3IHPA 2JUJA 1IM2A 2LTUA 5JI2E 2JP7A 2K9DA 2HAKA 3B89A 3LCVB 2ZTDA 2KNAA 3FRHA 3MMPA 1EFUB 2DAKA 1WIVA 1OTRA 2KNVA 2ZTCA 1YLAA 1VQ1A 1TTEA 1UFZA 1DO0A 1VDLA 4DBGB 2JY7A 4WP2A 2CWBA 2L2DA 2LVNC 4G3OA 1WJ7A 4R71A 2MROB 2L4FA 2OOAA 2JY6B 2K0BX 2LBCA 1OKSA 1SG9A 4F2LA 3F92A 1HJPA 2B3TA 1TR8A 2MJ5B 2H5XA 1F4IA 1OAIA 1OQYA 2QSFX 2HWJA 1C7YA 3K9PA 5DFLA 2MGWA 3GLFE 3E46A 2RRUA 4Q7JA 3GLGE 1WHCA 1ZV1A 2JY8A 2WZJA 1ZMUA 4GEWA 2JZ0A 2EKFA 1VG5A 2JZ1A 1HT2E 2QHOB 1VEJA 3H4JA 1VEGA 1G4AE 2DHYA 2DENA 1XB2B 4UN2B 2CP8A 1ZMVA 2OOBA 3FE3A 1T43A 2LVPC 1Y8GA 1R4GA 1GO5A 1CUKA 2JY5A 1IXSA 4HEOA 1AIPC 2DI0A 3FRIA 2BWBA 2DAGA 1IFYA 2DAMA 3BBZA 1QZEA 1WR1B 1KYIA 1A5TA 2LVOC 1V92A 3E21A 2JNHA 2L4EA 1PGYA 3GLHE 2LVQD 1G41A 1Q02A 2DAEA 3IECA 1P3QQ 2KNZA 3LCUA 2DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXH E;  2QNJ A;  3T6P A;  3GLI E;  1WGN A;  1DO2 A;  2KHH A;  1T6O A;  1NV8 A;  2EKK A;  2DNA A;  2LVA A;  1HT1 E;  1NV9 A;  2BWE A;  1WGL A;  2EJS A;  1ZMW A;  2DKL A;  2OO9 A;  2G3Q A;  4F1I A;  1E94 E;  1HQY E;  2MR9 A;  1BVS A;  2O25 A;  1G3I A;  1MN3 A;  2DZL A;  1DV0 A;  3K9O A;  1JR3 E;  2R0I A;  1VEK A;  3IHP A;  2JUJ A;  1IM2 A;  2LTU A;  5JI2 E;  2JP7 A;  2K9D A;  2HAK A;  3B89 A;  3LCV B;  2ZTD A;  2KNA A;  3FRH A;  3MMP A;  1EFU B;  2DAK A;  1WIV A;  1OTR A;  2KNV A;  2ZTC A;  1YLA A;  1VQ1 A;  1TTE A;  1UFZ A;  1DO0 A;  1VDL A;  4DBG B;  2JY7 A;  4WP2 A;  2CWB A;  2L2D A;  2LVN C;  4G3O A;  1WJ7 A;  4R71 A;  2MRO B;  2L4F A;  2OOA A;  2JY6 B;  2K0B X;  2LBC A;  1OKS A;  1SG9 A;  4F2L A;  3F92 A;  1HJP A;  2B3T A;  1TR8 A;  2MJ5 B;  2H5X A;  1F4I A;  1OAI A;  1OQY A;  2QSF X;  2HWJ A;  1C7Y A;  3K9P A;  5DFL A;  2MGW A;  3GLF E;  3E46 A;  2RRU A;  4Q7J A;  3GLG E;  1WHC A;  1ZV1 A;  2JY8 A;  2WZJ A;  1ZMU A;  4GEW A;  2JZ0 A;  2EKF A;  1VG5 A;  2JZ1 A;  1HT2 E;  2QHO B;  1VEJ A;  3H4J A;  1VEG A;  1G4A E;  2DHY A;  2DEN A;  1XB2 B;  4UN2 B;  2CP8 A;  1ZMV A;  2OOB A;  3FE3 A;  1T43 A;  2LVP C;  1Y8G A;  1R4G A;  1GO5 A;  1CUK A;  2JY5 A;  1IXS A;  4HEO A;  1AIP C;  2DI0 A;  3FRI A;  2BWB A;  2DAG A;  1IFY A;  2DAM A;  3BBZ A;  1QZE A;  1WR1 B;  1KYI A;  1A5T A;  2LVO C;  1V92 A;  3E21 A;  2JNH A;  2L4E A;  1PGY A;  3GLH E;  2LVQ D;  1G41 A;  1Q02 A;  2DAE A;  3IEC A;  1P3Q Q;  2KNZ A;  3LCU A;  2DAI A; 
#chains in the Genus database with same CATH topology
 1OFH A;  2KEB A;  5EP1 A;  2DWL A;  2QQ8 A;  2V6Z M;  1IY1 A;  1WGN A;  2R4E A;  3U60 B;  1HNX M;  4RF1 A;  2Y20 A;  4PDG A;  2XH9 A;  4B08 A;  3GLG B;  4FCW A;  3J27 B;  4JV5 M;  1Q39 A;  1PJI A;  1IXZ A;  2UUC M;  4XBO A;  2QCU A;  3U6S A;  3TL4 X;  2QEN A;  1WXQ A;  3NBX X;  1NV9 A;  2JWS A;  3J80 S;  4DR1 M;  2RKO A;  2XEP A;  2EJS A;  1I4W A;  3PXG A;  5ITT A;  2EO2 A;  3GLI A;  2OO9 A;  3GLH B;  3Q8G A;  5BR8 M;  4DV5 M;  3FKE A;  1HQY E;  2MR9 A;  3PNY A;  1BVS A;  4IBI A;  2F5O A;  4NL4 H;  3A42 A;  2LNH C;  4FW9 A;  3FUW A;  3JAM S;  1XC8 A;  5ITX A;  1NHG C;  1Q3C A;  3GPY A;  2L09 A;  3VLF B;  2YQZ A;  2JUJ A;  4FWD A;  5JI2 E;  3HZJ A;  4X66 M;  2ERC A;  3SAR A;  2HAK A;  5EXT A;  3LCV B;  4P17 A;  1XMO M;  1GKI A;  2XLJ A;  3FTF A;  2ZTD A;  2KNA A;  4JI1 M;  4B7H A;  2DAK A;  1WIV A;  3FTC A;  4K0K M;  1NVM A;  1YLA A;  2APL A;  1VQ1 A;  1UFZ A;  1OFI A;  3TE6 A;  4DBG B;  2KRU A;  2JY7 A;  1EE8 A;  1OIP A;  3HGI A;  3QYB A;  3UMM A;  5A2Q S;  1VDD A;  4G3O A;  1TH2 A;  1R6B X;  2JY6 B;  2XFS A;  2LBC A;  2R18 A;  3OTO M;  3HJQ A;  1SG9 A;  2Y0Q A;  2Z8Y M;  4DR6 M;  4TUW A;  1TDZ A;  2L7I A;  3LMM A;  3SFZ A;  1KSF X;  1QZM A;  4RKU F;  3LVV A;  4Z6Y A;  3U6L A;  4NXM M;  3AL0 C;  4GH9 A;  3R9X B;  2QSF X;  3U61 A;  4AKH A;  5BPV A;  1HR0 M;  2MGW A;  3KOX E;  2JXN A;  1QDT A;  2LH0 A;  1R2Y A;  3GLG E;  3SC3 A;  1WHC A;  1ZV1 A;  2JY8 A;  2YNM D;  1ZMU A;  1N78 A;  4II7 A;  5EXX A;  2JZ0 A;  4LFC M;  1ZAE A;  1QDR A;  2JZ1 A;  4OU7 A;  3B9P A;  3SBJ A;  2R65 A;  3U5Z A;  2UXD M;  3L25 A;  1VEG A;  4IJF A;  3SAT A;  2DEN A;  3HHY A;  4LG2 A;  3RGS A;  5JI3 E;  2F5S A;  3TQS A;  4UN2 B;  4X64 M;  3E4R A;  2OOB A;  4OX9 M;  1GL7 A;  2LVP C;  2X8A A;  3I51 A;  1R4G A;  4PT5 A;  1GO5 A;  2G8L A;  2L7H A;  4ITQ A;  3PNV A;  1IXR C;  1DGG A;  2UU9 M;  3GLH A;  3MJ5 A;  1SXJ C;  5EP4 A;  1K82 A;  4JXJ A;  2W82 A;  3BOS A;  3CGW A;  3IG8 A;  3K2L A;  4OW0 A;  3M0E A;  1Z5A A;  1AUA A;  4DUY M;  4IBD A;  1QZE A;  4B7F A;  3IG5 A;  4LF6 M;  3FYC A;  3K1J A;  1KYI A;  5LMN M;  1IBK M;  3SYL A;  1A5T A;  5FTK A;  3GRY A;  2UXC M;  4BBA A;  1QYR A;  3NBI A;  4OVZ A;  1Q02 A;  3R8F A;  1XMQ M;  3SMP A;  1P3Q Q;  3F92 A;  4LJ8 A;  4Y28 F;  1IY0 A;  4DV1 M;  1TH4 A;  1XXH E;  1SXJ D;  4HL4 A;  1SXJ A;  2QPA A;  4MGY E;  1T6O A;  1PJT A;  3GLG A;  1NJF A;  4B7G A;  3GPU A;  1NV8 A;  4QNM A;  3GLF A;  2Y0T A;  4KT0 F;  3UJN A;  4MGH A;  3EIH A;  1PJQ A;  2CHQ A;  4QNR A;  2BWE A;  4NOO B;  2MH8 A;  4IBJ A;  4DV6 M;  1QAN A;  1NNU C;  3AKZ A;  2I7N A;  1E94 E;  4DV7 M;  1K3X A;  2KRK A;  3HHW A;  3KP1 E;  5EP3 A;  4DV3 M;  4WW0 A;  2DZL A;  4BLC A;  4QOS A;  1RU3 A;  4PD2 A;  3J2P B;  3FYD A;  3VKH A;  1NO1 A;  4FWG A;  3LQR A;  2P5T A;  4JI4 M;  4EIW A;  1IM2 A;  2LTU A;  3HJS A;  2JP7 A;  1QUT A;  2K9D A;  3K92 A;  2HCB A;  5E6J A;  4LFA M;  3U6D A;  1E9R A;  1Z6T A;  2C99 A;  3A45 A;  3DOA A;  3L29 A;  8CAT A;  3GQ3 A;  4AZF A;  4KHP M;  1D0M A;  1MX0 A;  4IBE A;  1IQP A;  4B3M M;  4IBC A;  2KNV A;  2ZTC A;  3TPZ A;  5ITX E;  1EIJ A;  4L8R C;  3JR5 A;  1DO0 A;  2HL7 A;  3VKG A;  5ITU A;  5FTL A;  2WSC F;  4WP2 A;  2E5L M;  3I4Y A;  2R6F A;  4LGY A;  4ZPX A;  1KFV A;  2L4F A;  2OOA A;  3U6C A;  4QOZ C;  4GKK M;  3KSX A;  2R4J A;  5IT9 S;  2D7G A;  1TR8 A;  4KOD A;  4RF0 A;  3U6E A;  4DV0 M;  4DR4 M;  4AQY M;  3KDS E;  3QAU A;  4MB7 A;  2V1U A;  1OAI A;  3DZD A;  2EA0 A;  1C1K A;  3U5Z B;  1UM8 A;  4JYA M;  1J09 A;  1XXH A;  4LJ7 A;  5DFL A;  5FTM A;  3GPP A;  1SXJ B;  2D7E A;  3E46 A;  3W67 A;  1GVN A;  4LZZ A;  1L2C A;  2DXI A;  3TWK A;  3H4M A;  4GEW A;  1G8P A;  5KPZ A;  1VG5 A;  2CV0 A;  1PJS A;  4KLN A;  1I94 M;  3DFZ A;  4S12 A;  2CHG A;  2QHO B;  2XSZ D;  3A98 B;  3GLI B;  1N77 A;  4JI8 M;  1GJS A;  2J7O A;  3AFH A;  4IIW A;  1TGU A;  1ZMV A;  2UXB M;  1W5T A;  3C58 A;  3FE3 A;  5IRE B;  3FUU A;  2Z3X A;  4I5S A;  2J7N A;  1DGH B;  2JY5 A;  1IXS A;  2OPF A;  1IY2 A;  4G4Q A;  1IN6 A;  1GL6 A;  2DZN B;  2X4A A;  2LHC A;  1AIP C;  2DI0 A;  3AJI B;  2BWB A;  1N33 M;  3HJ8 A;  3FD9 A;  2VQF M;  3HU3 A;  4REZ A;  1YUB A;  5L8R F;  3BBZ A;  3HU1 A;  1IFY A;  1WR1 B;  4GHA A;  5KPR A;  2DVW B;  3C9P A;  2XZU A;  1LV7 A;  1QAM A;  2LHG A;  1XWI A;  5EP2 A;  1V92 A;  2Z4S A;  3W0L B;  2ZAO A;  2JNH A;  3THG A;  4LF4 M;  2F5Q A;  2CUZ A;  3HWS A;  3GLH E;  2LVQ D;  2ZM6 M;  5FLX S;  2EUC A;  2K47 A;  3B7N A;  3FUX A;  5ITR A;  2CEA A;  3BXW A;  3IEC A;  4LRS A;  2DWZ B;  3T6P A;  5KO3 A;  1IN5 A;  3GRR A;  3E9S A;  2QNJ A;  2ZAM A;  3KOZ E;  3ZH9 B;  4GRI A;  3TWM A;  3FUV A;  4LZJ A;  2KHH A;  4NSR A;  5DNY A;  3PVS A;  1L8Q A;  2K6B A;  3T1Y M;  3GPX A;  3AV0 A;  1JQJ C;  3VDP A;  1NJG A;  1HQC A;  2EKK A;  1G71 A;  4R7G A;  4LJ6 A;  3FUT A;  1GAB A;  1PM5 A;  2DNA A;  4HLQ A;  4GC9 A;  2LVA A;  3SHF A;  4L16 A;  3UK6 A;  1IN8 A;  4LJ5 A;  3GP1 A;  3V76 A;  4AI6 A;  1SXJ E;  2X49 A;  4LY6 A;  3D8B A;  3LVW A;  4IBG A;  2G3Q A;  2AHM A;  4F1I A;  1NHW C;  5ITQ A;  4W5W A;  4FCV A;  2F5N A;  4KO8 A;  2O25 A;  5E26 A;  1G3I A;  1MN3 A;  1D0L A;  4M9S A;  3WHK A;  3KW6 A;  4XGI A;  4D82 A;  3C3E A;  1DV0 A;  3J7A S;  1N32 M;  3SAS A;  1OJL A;  1JR3 E;  2FNA A;  2QP9 X;  2QBY B;  2R0I A;  1XHB A;  3ZC7 B;  3KS4 A;  3KP0 E;  4JI7 M;  1IN7 A;  2FOI C;  1G59 A;  1GLN A;  3W68 A;  4G4O A;  2HHH M;  4CGY B;  2UUA M;  1FJG M;  3U6P A;  4G4R A;  4I8O A;  1QVR A;  4GKJ M;  5EXP A;  4D80 A;  1OTR A;  1MJG M;  1TTE A;  4CHT B;  3J81 S;  1D2N A;  3M6A A;  3FTE A;  1R2Z A;  1DGH A;  1JB0 F;  1GJT A;  1WJ7 A;  4CIS A;  4BB9 A;  2C9O A;  3GQ5 A;  3T1H M;  1L1Z A;  1OKS A;  1ORY B;  3U6M A;  4F2L A;  4YY3 M;  1HJP A;  3KXE C;  4LF8 M;  2F5P A;  5KQ8 A;  5LMU M;  4MGZ E;  2DWN A;  1TH3 A;  4LJ4 A;  2MJ5 B;  4OVZ B;  4DV4 M;  1Z5C A;  3L27 A;  4FCT A;  4NRV A;  1OQY A;  2XZF A;  2F4V M;  3ZQJ A;  7CAT A;  1C7Y A;  3SAV A;  4AKG A;  3HKP A;  4GIT A;  3HX3 A;  2FH0 A;  5EXS A;  4R3D A;  3GLF E;  2KZS A;  2KA6 B;  2L6O A;  4LF5 M;  3QWL A;  2WZJ A;  4LJA A;  4L78 A;  1YE9 A;  2RGO A;  2XF3 A;  2Y21 A;  3FTD A;  4GIP A;  4PCZ A;  3L28 A;  2R46 A;  1L1T A;  4MGK E;  1N34 M;  1JR3 D;  1VEJ A;  3B7Q A;  1G4A E;  2DHY A;  1XB2 B;  2FFJ A;  2H1R A;  5KQD A;  1E32 A;  2CP8 A;  2DHR A;  4MM3 B;  5ITY A;  1NNJ A;  3B7Z A;  3EIE A;  1T43 A;  4DV2 M;  1OAO C;  3MK6 A;  2C5R A;  1T3T A;  4DR5 M;  1X37 A;  1DGB A;  3RFW A;  2WSF F;  3RE8 A;  1XXH B;  5IZ7 D;  2Z4R A;  4JI3 M;  4CJ6 A;  1PJJ A;  2CV2 A;  1N36 M;  3AOG A;  1QAO A;  4B3T M;  4QHT A;  2DZO B;  4CIZ A;  4IBF A;  3A46 A;  1Z5B A;  1QUS A;  2VII A;  1S3S A;  3FRI A;  2DAG A;  2DAM A;  4I4L A;  2KW0 A;  5C1B A;  1E9S A;  4LRT A;  4FWH A;  4G6Z A;  3T15 A;  5DYG A;  3JR4 A;  2KDL A;  4JI5 M;  2LVO C;  3E21 A;  3M7G A;  4JI0 M;  2BNK A;  1L2D A;  2GNO A;  4G4N A;  2LWX A;  2R62 A;  4B3R M;  1V33 A;  4JI6 M;  3QYE A;  4L4U A;  4QHS A;  2WSE F;  2DAE A;  1HNZ M;  2KNZ A;  1R5L A;  3LCU A;  2DAI A;  2J5Y A;  3LW5 F;  4AKI A;  3GLI E;  2GQF A;  2Z7J A;  3LQQ A;  5DYI A;  2UUB M;  1DO2 A;  2VF8 A;  3KFU G;  4GMQ A;  3TWL A;  5EJC A;  2CRU A;  3U60 A;  3Q8X A;  2JA2 A;  4NC6 A;  3HHX A;  4DR7 M;  2M5Z A;  4M9X A;  2KZU A;  3W0F A;  3SAW A;  1L2B A;  1HT1 E;  4DR3 M;  5KPT A;  1H6U A;  1WGL A;  2I7P A;  3GRV A;  3I04 M;  4M9Z A;  3GQ4 A;  5IWA M;  4RNA A;  2C9C A;  1ZMW A;  2DKL A;  4LF9 M;  2CHV A;  2LXE A;  5F3W A;  4M0D A;  4FVM A;  2VDB B;  4JI2 M;  1FNN A;  3VK8 A;  1NY6 A;  3SMS A;  2NQ8 C;  2QBY A;  3KS8 A;  3NWL A;  3KOW E;  3AOE C;  4D81 A;  1HNW M;  3K9O A;  3ZCB B;  3GO8 A;  3RGP A;  3UZU A;  4DUZ M;  3MHV C;  1VEK A;  3IHP A;  2O01 F;  2ZAN A;  4L6V 6;  4Z8X A;  1LTM A;  1IXS B;  4MGI E;  3PFI A;  5EQT A;  3B89 A;  4ANR A;  5C18 A;  3T38 A;  3FRH A;  3MMP A;  1EFU B;  3AOE A;  2HKJ A;  3DA1 A;  3VFD A;  2KXE A;  3I4V A;  4AW4 A;  1ZQ9 A;  1JR3 A;  3VK7 A;  1VDL A;  4X62 M;  2CFO A;  4LF7 M;  2OQ4 A;  2FS1 A;  3HY5 A;  2CWB A;  2L2D A;  2LVN C;  2XSZ A;  3GRU A;  4R71 A;  2DWM A;  2VF7 A;  2MRO B;  2BJW A;  2K0B X;  4M0W A;  4MH0 E;  2FE8 A;  3CF2 A;  3I01 M;  2B3T A;  1N75 A;  2ZBK B;  3SHG B;  2Q2E B;  2V1C A;  4B3S M;  1J7K A;  1R7R A;  2N35 A;  4FD2 A;  5FSW A;  2H5X A;  1F4I A;  4PDI A;  1TDH A;  1NSF A;  1J5E M;  1W5S A;  4AG5 A;  2HWJ A;  3CF0 A;  3K9P A;  2M60 A;  3VDU A;  4L15 A;  1IN4 A;  3KVW A;  3U6Q A;  3U6O A;  1PRB A;  2RRU A;  4GC5 A;  2C96 A;  1OIZ A;  4Q7J A;  5FTN A;  4NXN M;  2VQE M;  4IBK A;  3C3D A;  3UGJ A;  2R44 A;  4X65 M;  4LCB A;  2EKF A;  3L2A A;  2RGH A;  3CF6 E;  1HT2 E;  1NY5 A;  3HHZ A;  3U61 B;  1YSY A;  1MU5 A;  1XNR M;  3H4J A;  1XNQ M;  3K8Z A;  2O5R A;  3SYK A;  4YHH M;  2YFQ A;  2XGN A;  1Y8G A;  4GHL A;  1CUK A;  3CTW B;  4I81 A;  4NSO B;  2CV1 A;  4NRW A;  2YR0 A;  3KSJ A;  1V34 A;  4HEO A;  2G5G X;  5H37 D;  4IBB A;  2CE7 A;  5GKN A;  1IBM M;  4XK8 F;  1D0K A;  2A5Y B;  2D7H A;  3HU2 A;  2BJV A;  1K3W A;  4A3V B;  3J7B A;  4JN6 A;  1Q3B A;  3WHL A;  3L26 A;  1IBL M;  1QQW A;  3GLF B;  4IJE A;  4LJ9 A;  2R45 A;  2C98 A;  4DR2 M;  3B74 A;  4LGM A;  4AG6 A;  2QZ4 A;  1QAQ A;  2L4E A;  4WUR A;  1PGY A;  3SAU A;  1G41 A;  4P16 A;  5FTJ A;  2XFT A;  4LFB M;  3ILK A;  3D8L A;  1TF0 B;  3KOY E;  1DGF A;  1Z59 A; 
#chains in the Genus database with same CATH homology
 1XXH E;  2QNJ A;  3T6P A;  3GLI E;  1WGN A;  1DO2 A;  2KHH A;  1T6O A;  1NV8 A;  2EKK A;  2DNA A;  2LVA A;  1HT1 E;  1NV9 A;  2BWE A;  1WGL A;  2EJS A;  1ZMW A;  2DKL A;  2OO9 A;  2G3Q A;  4F1I A;  1E94 E;  1HQY E;  2MR9 A;  1BVS A;  2O25 A;  1G3I A;  1MN3 A;  2DZL A;  1DV0 A;  3K9O A;  1JR3 E;  2R0I A;  1VEK A;  3IHP A;  2JUJ A;  1IM2 A;  2LTU A;  5JI2 E;  2JP7 A;  2K9D A;  2HAK A;  3B89 A;  3LCV B;  2ZTD A;  2KNA A;  3FRH A;  3MMP A;  1EFU B;  2DAK A;  1WIV A;  1OTR A;  2KNV A;  2ZTC A;  1YLA A;  1VQ1 A;  1TTE A;  1UFZ A;  1DO0 A;  1VDL A;  4DBG B;  2JY7 A;  4WP2 A;  2CWB A;  2L2D A;  2LVN C;  4G3O A;  1WJ7 A;  4R71 A;  2MRO B;  2L4F A;  2OOA A;  2JY6 B;  2K0B X;  2LBC A;  1OKS A;  1SG9 A;  4F2L A;  3F92 A;  1HJP A;  2B3T A;  1TR8 A;  2MJ5 B;  2H5X A;  1F4I A;  1OAI A;  1OQY A;  2QSF X;  2HWJ A;  1C7Y A;  3K9P A;  5DFL A;  2MGW A;  3GLF E;  3E46 A;  2RRU A;  4Q7J A;  3GLG E;  1WHC A;  1ZV1 A;  2JY8 A;  2WZJ A;  1ZMU A;  4GEW A;  2JZ0 A;  2EKF A;  1VG5 A;  2JZ1 A;  1HT2 E;  2QHO B;  1VEJ A;  3H4J A;  1VEG A;  1G4A E;  2DHY A;  2DEN A;  1XB2 B;  4UN2 B;  2CP8 A;  1ZMV A;  2OOB A;  3FE3 A;  1T43 A;  2LVP C;  1Y8G A;  1R4G A;  1GO5 A;  1CUK A;  2JY5 A;  1IXS A;  4HEO A;  1AIP C;  2DI0 A;  3FRI A;  2BWB A;  2DAG A;  1IFY A;  2DAM A;  3BBZ A;  1QZE A;  1WR1 B;  1KYI A;  1A5T A;  2LVO C;  1V92 A;  3E21 A;  2JNH A;  2L4E A;  1PGY A;  3GLH E;  2LVQ D;  1G41 A;  1Q02 A;  2DAE A;  3IEC A;  1P3Q Q;  2KNZ A;  3LCU A;  2DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...