1IXSA

Structure of ruvb complexed with ruva domain iii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
ESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQDLIKEALKRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Holliday junction DNA helicase ruvA
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
total genus 16
structure length 50
sequence length 50
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07499 RuvA_C RuvA, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ixsA00
3F92A 3K9PA 2LTUA 2OOBA 3FE3A 1G4AE 2L4EA 3GLHE 2JY6B 1ZMWA 1SG9A 1G41A 3GLFE 2KHHA 1XXHE 1UFZA 1YLAA 3FRIA 1F4IA 1DO0A 1WIVA 1IXSA 2LVPC 2RRUA 2DAKA 2DHYA 1P3QQ 2LBCA 1V92A 2DAEA 3MMPA 1GO5A 3K9OA 1DO2A 2EKKA 2DNAA 1HT2E 2QHOB 1IM2A 2JY7A 2QNJA 5JI2E 2H5XA 2LVNC 2MROB 2KNAA 1WGLA 2DAGA 2KNVA 1OQYA 1WHCA 2JUJA 1ZMUA 1WGNA 2MJ5B 2JY5A 1T43A 2MGWA 2DAIA 3FRHA 2DENA 2DAMA 2MR9A 3IHPA 1PGYA 2K9DA 2L2DA 2DZLA 3BBZA 3E21A 1TR8A 1BVSA 1VEKA 2JP7A 1VEJA 1VEGA 2OOAA 1HT1E 1OAIA 4F2LA 2JY8A 4Q7JA 4WP2A 1HQYE 2BWEA 1ZV1A 1XB2B 1WJ7A 1MN3A 2KNZA 1KYIA 3H4JA 1QZEA 1AIPC 1NV8A 2WZJA 3T6PA 2HWJA 1Q02A 2ZTCA 1OTRA 1C7YA 1E94E 2ZTDA 2BWBA 2G3QA 4UN2B 1T6OA 2QSFX 2K0BX 2OO9A 1EFUB 1WR1B 1Y8GA 4F1IA 2B3TA 2JZ1A 2DKLA 1IFYA 3LCUA 2DI0A 3E46A 3GLGE 4GEWA 1VDLA 2LVOC 2JZ0A 1NV9A 1TTEA 2CP8A 5DFLA 2JNHA 2LVAA 1A5TA 3B89A 1G3IA 2HAKA 4DBGB 3IECA 1HJPA 1JR3E 2O25A 1OKSA 1ZMVA 3LCVB 4G3OA 2CWBA 1VQ1A 2EKFA 1DV0A 2EJSA 4HEOA 2LVQD 1R4GA 1CUKA 3GLIE 2L4FA 1VG5A 2R0IA 4R71A
chains in the Genus database with same CATH superfamily
2R4EA 3K9PA 3NBXX 5EQTA 4I5SA 1G4AE 3SMSA 3AL0C 5EXSA 2R65A 5EP3A 3KS4A 4GIPA 3ZCBB 4R7GA 3T15A 3GLFE 2EA0A 1K3WA 1NNUC 3A45A 2CHVA 4FW9A 1I94M 1GVNA 3HHWA 1JR3A 2Y0QA 4X66M 4DV2M 3FUWA 1KFVA 1V92A 4DR6M 4KLNA 4DR4M 3GPYA 3U6PA 1VDDA 2DWLA 3AKZA 4IBFA 4LF6M 2J7OA 4P17A 4BB9A 3FUTA 4X62M 2CV2A 1K3XA 1NY6A 2UUBM 2H5XA 2LVNC 3KDSE 2UXBM 4B08A 3U6DA 3CF0A 3GQ3A 3KOWE 4B7GA 4X64M 1QUSA 2M5ZA 2JUJA 4AW4A 5DYGA 5FLXS 3C3EA 4JN6A 2CFOA 4JI7M 4LFAM 3VFDA 3U5ZB 2GQFA 2DZOB 2JY5A 2MJ5B 3E9SA 1T43A 1IN4A 1D0LA 2DAIA 5EP1A 1Q39A 3UZUA 2MR9A 1LV7A 3VDUA 1PGYA 1T3TA 2ZAMA 2Q2EB 1R2ZA 2LHGA 4LFBM 2L2DA 1NHGC 3GLHB 3I4VA 2V1UA 4LG2A 3VK8A 4NSOB 2WSFF 1VEJA 4L78A 1GL7A 1PJIA 2KXEA 4JYAM 1N78A 3L27A 1OAIA 4F2LA 3LQRA 1Z5CA 2JY8A 3RGPA 1DGHB 4MM3B 5FSWA 3GP1A 1ZV1A 3TWLA 1HQCA 1HR0M 2CV1A 7CATA 2KZUA 4IBKA 1YSYA 1KYIA 3SAUA 4LF9M 1G71A 1NNJA 3WHLA 3AOEC 3H4JA 4FD2A 2CV0A 4AI6A 1AIPC 2WZJA 1GKIA 3B7QA 3LVWA 4JI5M 3C58A 2HWJA 4QNRA 3TPZA 3HU2A 5BPVA 3L28A 3UK6A 1E9SA 3CF6E 3PVSA 2ZTDA 1E9RA 4JI0M 2V1CA 2CHQA 3HJQA 1SXJC 1R7RA 1T6OA 2FOIC 4NL4H 1QYRA 2CE7A 2QSFX 2OO9A 3A98B 2YFQA 1Y8GA 4B7HA 2C98A 4QHTA 2XZFA 3Q8GA 1L8QA 1OFHA 1PM5A 3GLGA 2CEAA 4TUWA 2QPAA 4OVZB 5EXTA 4MGYE 4LGYA 4RKUF 3E46A 3U6SA 3KFUG 3UGJA 4FWHA 3GPUA 1I4WA 5ITQA 2O01F 1NV9A 1TGUA 1TTEA 3B7ZA 4LF8M 3SARA 2J7NA 4PT5A 3ZH9B 2Y20A 5ITTA 1NHWC 2F5OA 4HL4A 1RU3A 2D7GA 3LW5F 1Q3CA 3L26A 1IQPA 1A5TA 1KSFX 3HJ8A 3I04M 2HAKA 2R46A 2O25A 5C1BA 1OKSA 1OIZA 1PRBA 4D82A 5EP2A 5C18A 2CWBA 1VQ1A 2X4AA 3FD9A 4JI3M 1ZAEA 2LVQD 3NBIA 1L2BA 1XNQM 2J5YA 1VG5A 1SXJD 5L8RF 4XBOA 3U61A 3I51A 3I01M 5ITUA 2UU9M 3THGA 3U6MA 4LF5M 1IN8A 4M9XA 3GLHE 4JI4M 2JY6B 2YQZA 3J7BA 3J81S 1SG9A 3U6EA 2O5RA 2K6BA 2KHHA 3J80S 3KOYE 3KVWA 1NY5A 1YLAA 3GQ4A 3B9PA 3FUUA 3EIHA 2F5SA 3VLFB 1WIVA 1QQWA 3GLGB 1IBLM 2LVPC 2RRUA 4RF0A 3PXGA 4DV0M 3U5ZA 1GO5A 3HKPA 2QBYA 1H6UA 3L2AA 2DNAA 3DOAA 3AJIB 1HT2E 2QHOB 3HX3A 3VDPA 2JY7A 1UM8A 1W5SA 3CGWA 3GRUA 4LF4M 2QZ4A 1QAMA 2MROB 3K8ZA 2JA2A 2KNAA 1WGLA 3GLHA 1D0KA 4M9SA 3FTDA 4MB7A 1QDRA 4L16A 1WXQA 1ZMUA 3LMMA 4GRIA 5LMNM 3SAVA 3KOZE 2MGWA 1DGHA 4FCVA 4GH9A 3SYLA 4Z6YA 1EIJA 1J09A 4KO8A 1XMOM 2Y0TA 2F5NA 3IHPA 1XNRM 4G4OA 2HHHM 2K9DA 5KPTA 3U61B 2R18A 1IBMM 1VEKA 2JP7A 3W0LB 3KOXE 3RGSA 3MJ5A 4D81A 3QYBA 3HY5A 4ZPXA 1L2DA 2DVWB 4M9ZA 2F5PA 1Z5BA 4DV1M 3VKHA 2UUAM 4PDGA 5BR8M 3IG8A 4G4QA 4LCBA 1XMQM 4MGIE 3GQ5A 2KNZA 4JV5M 3UMMA 1DGFA 1IN7A 4B3TM 1G8PA 2QBYB 4MGHA 1N36M 2VQFM 1N34M 1EE8A 2G5GX 2FFJA 4IIWA 3B74A 4OVZA 5KQ8A 1V33A 4DR2M 1Q02A 1PJTA 2XEPA 2ZTCA 1OTRA 3HWSA 1E94E 2VDBB 1R6BX 2DWNA 4EIWA 4LY6A 3PFIA 2K0BX 3SYKA 4MGZE 1LTMA 2XSZA 3U6CA 4G4NA 1PJJA 2M60A 1IY2A 1WR1B 1X37A 1Q3BA 2FNAA 2H1RA 4AKIA 3W68A 2VF7A 3M0EA 3TL4X 4F1IA 2B3TA 2C9OA 1L1TA 2LWXA 2D7EA 4NRVA 4YY3M 3KW6A 3UJNA 3BOSA 2DKLA 3VKGA 4IBEA 4BBAA 4GITA 3T1HM 1IFYA 1N77A 3TWKA 4DUZM 3GLGE 2L7HA 4RNAA 1FNNA 4LJ5A 1W5TA 2QQ8A 1VDLA 3FYCA 4YHHM 4GC5A 4AKHA 2F4VM 5DFLA 1IY1A 3D8LA 3DA1A 2JNHA 4OU7A 3FYDA 3SHFA 1OJLA 1QVRA 2KEBA 2C9CA 5KO3A 3FUVA 5FTJA 1G59A 3SC3A 2VQEM 1G3IA 4DBGB 4G4RA 1HJPA 4DR7M 3LCVB 4L6V6 3JR4A 4IBGA 3JAMS 2BJVA 2EO2A 1HNWM 1DV0A 4LJ8A 2EJSA 1SXJB 4HEOA 1D2NA 1NVMA 5DNYA 4AQYM 1R4GA 3GLIE 5IWAM 2L4FA 3ZC7B 2KRUA 5F3WA 2R0IA 2I7PA 4IBIA 4M0DA 4DV7M 2XFTA 3F92A 4REZA 3TWMA 3U6LA 3FE3A 4DR3M 2L4EA 4FWGA 1XXHA 2LH0A 4DV6M 4OX9M 1ZMWA 3HJSA 2N35A 4GKJM 1G41A 3GRYA 2QP9X 1YE9A 4WURA 1UFZA 1F4IA 2HKJA 4JI8M 4NXMM 3Q8XA 3DFZA 3SFZA 1MU5A 3SATA 3D8BA 2DHYA 3MMPA 2DAEA 2EUCA 1GJTA 1GJSA 4IBCA 3GLIA 1C1KA 5FTNA 1Z6TA 1TDZA 1IM2A 3LVVA 2QNJA 2LNHC 2JXNA 2APLA 1MJGM 1J7KA 1QDTA 3SBJA 4QOSA 1Z59A 2DAGA 4NC6A 2C5RA 2KNVA 1OQYA 3FKEA 4LFCM 1QAQA 4II7A 1JR3D 3EIEA 1IN5A 1WGNA 2CUZA 2QENA 4QNMA 3FTFA 4GHLA 1PJQA 2DZNB 3ILKA 2DENA 3CTWB 1XC8A 4B3RM 4JI1M 1E32A 4LRTA 3KS8A 4XK8F 4LZZA 3NWLA 4AG6A 4AZFA 1JQJC 4Z8XA 4FVMA 3E21A 1TR8A 1BVSA 2W82A 2VIIA 3M7GA 3PNYA 4DV3M 3K2LA 3AV0A 2OOAA 1HT1E 1XXHB 2BNKA 2LXEA 4KT0F 1QAOA 1NO1A 4Q7JA 2F5QA 1HQYE 1N33M 3BXWA 5KPZA 1IBKM 4GMQA 5GKNA 1MN3A 2WSEF 2MH8A 5IREB 4JI2M 3K92A 2DWMA 2Z7JA 2ZM6M 2OQ4A 4DV5M 4GHAA 3HHXA 1QANA 4X65M 3W67A 3KXEC 2R62A 4I8OA 4IJEA 3J27B 3A42A 1SXJE 5DYIA 4G6ZA 3T6PA 3GLIB 4IBJA 2CRUA 4ANRA 4IBDA 3SAWA 4CGYB 2KZSA 1C7YA 2X49A 2RGHA 1NJFA 2ZANA 1NSFA 4UN2B 3TE6A 3L25A 2NQ8C 4PDIA 1DGBA 4L4UA 3AOGA 3GRRA 1QUTA 5EJCA 3CF2A 3M6AA 4LJAA 2KW0A 2Z4SA 3AOEA 2JWSA 2JZ1A 4IJFA 5KPRA 3OTOM 3HU1A 1R5LA 4DR1M 4JI6M 4DR5M 3LCUA 3J7AS 2XZUA 1N75A 2ERCA 1XHBA 2XGNA 3HU3A 5EP4A 3LQQA 1SXJA 3KSJA 1J5EM 4L8RC 3SHGB 3E4RA 4GC9A 1R2YA 1QZMA 1ORYB 8CATA 2CHGA 2LVAA 5IT9S 4QHSA 3W0FA 2DXIA 4I4LA 3HZJA 1TDHA 3IECA 4L15A 1TH3A 1ZMVA 1V34A 2EKFA 3QWLA 3HHYA 3R9XB 1IN6A 4D80A 4KHPM 1GLNA 2D7HA 4LGMA 4AG5A 3HHZA 4R3DA 2DHRA 1N32M 1JB0F 2L7IA 2LTUA 2OOBA 5A2QS 3GLFA 1IXRC 2C99A 3V76A 4NXNM 4HLQA 4LRSA 4P16A 2V6ZM 2R6FA 1XXHE 2G8LA 2K47A 4RF1A 4S12A 1TF0B 3U6QA 3FRIA 3IG5A 1DO0A 3KSXA 1XWIA 4WW0A 1OAOC 3SASA 4ITQA 1IXSA 3B7NA 3T38A 4XGIA 1NJGA 2DAKA 2LBCA 1P3QQ 2Z8YM 4DV4M 3FTEA 3DZDA 3K9OA 1D0MA 2QCUA 2YR0A 1YUBA 2RKOA 1DO2A 2EKKA 2Z4RA 2ZAOA 5ITXE 2UXDM 2LHCA 2I7NA 5JI2E 3GO8A 2R45A 4DUYM 2XFSA 4JXJA 4R71A 3A46A 1IY0A 1S3SA 2YNMD 4M0WA 3KP1E 4MH0E 3ZQJA 1FJGM 3MHVC 2UXCM 4MGKE 1L1ZA 1WHCA 3QYEA 2C96A 4PCZA 4LJ9A 3QAUA 4QOZC 5EXPA 4PD2A 3C3DA 2WSCF 2Y21A 3GPXA 3L29A 3FRHA 2FS1A 2DAMA 2OPFA 4LJ6A 4Y28F 2Z3XA 2HCBA 5E26A 5ITXA 2FE8A 2R44A 2DZLA 3BBZA 2KRKA 4CHTB 2XLJA 4LZJA 4LF7M 4OW0A 3RE8A 3GLFB 2VF8A 5FTMA 4FCWA 1VEGA 4NOOB 3I4YA 1GABA 3H4MA 4WP2A 4IBBA 2DWZB 1GL6A 2BWEA 3HGIA 5FTKA 4FCTA 1WJ7A 1XB2B 5ITRA 1HNXM 1HNZM 3U60A 1DGGA 5EXXA 2P5TA 3T1YM 4NRWA 4AKGA 1IXSB 2HL7A 3FUXA 2XH9A 1TH4A 1QZEA 1NV8A 2A5YB 2L6OA 1OIPA 5FTLA 4GKKM 4LJ7A 3K1JA 4LJ4A 3SMPA 3JR5A 2BWBA 3RFWA 2G3QA 2AHMA 2X8AA 3KP0E 2KDLA 1EFUB 2L09A 3FTCA 4BLCA 1Z5AA 2ZBKB 3PNVA 4FWDA 3MK6A 3AFHA 3WHKA 1L2CA 3R8FA 3GPPA 4B7FA 2E5LM 2DI0A 2KA6B 3GRVA 4CJ6A 5JI3E 3J2PB 4GEWA 2LVOC 1OFIA 4CIZA 2JZ0A 3VK7A 1PJSA 2CP8A 1IXZA 2XSZD 3C9PA 2GNOA 2XF3A 5E6JA 4I81A 3B89A 3U6OA 4W5WA 1JR3E 2FH0A 5ITYA 3TQSA 4K0KM 2RGOA 1TH2A 4G3OA 3U60B 1AUAA 2UUCM 4NSRA 1K82A 5H37D 2BJWA 5IZ7D 4KODA 1CUKA 5LMUM 1MX0A 5KQDA 4B3SM 2R4JA 4B3MM 1ZQ9A 4CISA 4A3VB
chains in the Genus database with same CATH topology
3F92A 3K9PA 2LTUA 2OOBA 3FE3A 1G4AE 2L4EA 3GLHE 2JY6B 1ZMWA 1SG9A 1G41A 3GLFE 2KHHA 1XXHE 1UFZA 1YLAA 3FRIA 1F4IA 1DO0A 1WIVA 1IXSA 2LVPC 2RRUA 2DAKA 2DHYA 1P3QQ 2LBCA 1V92A 2DAEA 3MMPA 1GO5A 3K9OA 1DO2A 2EKKA 2DNAA 1HT2E 2QHOB 1IM2A 2JY7A 2QNJA 5JI2E 2H5XA 2LVNC 2MROB 2KNAA 1WGLA 2DAGA 2KNVA 1OQYA 1WHCA 2JUJA 1ZMUA 1WGNA 2MJ5B 2JY5A 1T43A 2MGWA 2DAIA 3FRHA 2DENA 2DAMA 2MR9A 3IHPA 1PGYA 2K9DA 2L2DA 2DZLA 3BBZA 3E21A 1TR8A 1BVSA 1VEKA 2JP7A 1VEJA 1VEGA 2OOAA 1HT1E 1OAIA 4F2LA 2JY8A 4Q7JA 4WP2A 1HQYE 2BWEA 1ZV1A 1XB2B 1WJ7A 1MN3A 2KNZA 1KYIA 3H4JA 1QZEA 1AIPC 1NV8A 2WZJA 3T6PA 2HWJA 1Q02A 2ZTCA 1OTRA 1C7YA 1E94E 2ZTDA 2BWBA 2G3QA 4UN2B 1T6OA 2QSFX 2K0BX 2OO9A 1EFUB 1WR1B 1Y8GA 4F1IA 2B3TA 2JZ1A 2DKLA 1IFYA 3LCUA 2DI0A 3E46A 3GLGE 4GEWA 1VDLA 2LVOC 2JZ0A 1NV9A 1TTEA 2CP8A 5DFLA 2JNHA 2LVAA 1A5TA 3B89A 1G3IA 2HAKA 4DBGB 3IECA 1HJPA 1JR3E 2O25A 1OKSA 1ZMVA 3LCVB 4G3OA 2CWBA 1VQ1A 2EKFA 1DV0A 2EJSA 4HEOA 2LVQD 1R4GA 1CUKA 3GLIE 2L4FA 1VG5A 2R0IA 4R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F92 A;  3K9P A;  2LTU A;  2OOB A;  3FE3 A;  1G4A E;  2L4E A;  3GLH E;  2JY6 B;  1ZMW A;  1SG9 A;  1G41 A;  3GLF E;  2KHH A;  1XXH E;  1UFZ A;  1YLA A;  3FRI A;  1F4I A;  1DO0 A;  1WIV A;  1IXS A;  2LVP C;  2RRU A;  2DAK A;  2DHY A;  1P3Q Q;  2LBC A;  1V92 A;  2DAE A;  3MMP A;  1GO5 A;  3K9O A;  1DO2 A;  2EKK A;  2DNA A;  1HT2 E;  2QHO B;  1IM2 A;  2JY7 A;  2QNJ A;  5JI2 E;  2H5X A;  2LVN C;  2MRO B;  2KNA A;  1WGL A;  2DAG A;  2KNV A;  1OQY A;  1WHC A;  2JUJ A;  1ZMU A;  1WGN A;  2MJ5 B;  2JY5 A;  1T43 A;  2MGW A;  2DAI A;  3FRH A;  2DEN A;  2DAM A;  2MR9 A;  3IHP A;  1PGY A;  2K9D A;  2L2D A;  2DZL A;  3BBZ A;  3E21 A;  1TR8 A;  1BVS A;  1VEK A;  2JP7 A;  1VEJ A;  1VEG A;  2OOA A;  1HT1 E;  1OAI A;  4F2L A;  2JY8 A;  4Q7J A;  4WP2 A;  1HQY E;  2BWE A;  1ZV1 A;  1XB2 B;  1WJ7 A;  1MN3 A;  2KNZ A;  1KYI A;  3H4J A;  1QZE A;  1AIP C;  1NV8 A;  2WZJ A;  3T6P A;  2HWJ A;  1Q02 A;  2ZTC A;  1OTR A;  1C7Y A;  1E94 E;  2ZTD A;  2BWB A;  2G3Q A;  4UN2 B;  1T6O A;  2QSF X;  2K0B X;  2OO9 A;  1EFU B;  1WR1 B;  1Y8G A;  4F1I A;  2B3T A;  2JZ1 A;  2DKL A;  1IFY A;  3LCU A;  2DI0 A;  3E46 A;  3GLG E;  4GEW A;  1VDL A;  2LVO C;  2JZ0 A;  1NV9 A;  1TTE A;  2CP8 A;  5DFL A;  2JNH A;  2LVA A;  1A5T A;  3B89 A;  1G3I A;  2HAK A;  4DBG B;  3IEC A;  1HJP A;  1JR3 E;  2O25 A;  1OKS A;  1ZMV A;  3LCV B;  4G3O A;  2CWB A;  1VQ1 A;  2EKF A;  1DV0 A;  2EJS A;  4HEO A;  2LVQ D;  1R4G A;  1CUK A;  3GLI E;  2L4F A;  1VG5 A;  2R0I A;  4R71 A; 
#chains in the Genus database with same CATH topology
 2R4E A;  3K9P A;  3NBX X;  5EQT A;  4I5S A;  1G4A E;  3SMS A;  3AL0 C;  5EXS A;  2R65 A;  5EP3 A;  3KS4 A;  4GIP A;  3ZCB B;  4R7G A;  3T15 A;  3GLF E;  2EA0 A;  1K3W A;  1NNU C;  3A45 A;  2CHV A;  4FW9 A;  1I94 M;  1GVN A;  3HHW A;  1JR3 A;  2Y0Q A;  4X66 M;  4DV2 M;  3FUW A;  1KFV A;  1V92 A;  4DR6 M;  4KLN A;  4DR4 M;  3GPY A;  3U6P A;  1VDD A;  2DWL A;  3AKZ A;  4IBF A;  4LF6 M;  2J7O A;  4P17 A;  4BB9 A;  3FUT A;  4X62 M;  2CV2 A;  1K3X A;  1NY6 A;  2UUB M;  2H5X A;  2LVN C;  3KDS E;  2UXB M;  4B08 A;  3U6D A;  3CF0 A;  3GQ3 A;  3KOW E;  4B7G A;  4X64 M;  1QUS A;  2M5Z A;  2JUJ A;  4AW4 A;  5DYG A;  5FLX S;  3C3E A;  4JN6 A;  2CFO A;  4JI7 M;  4LFA M;  3VFD A;  3U5Z B;  2GQF A;  2DZO B;  2JY5 A;  2MJ5 B;  3E9S A;  1T43 A;  1IN4 A;  1D0L A;  2DAI A;  5EP1 A;  1Q39 A;  3UZU A;  2MR9 A;  1LV7 A;  3VDU A;  1PGY A;  1T3T A;  2ZAM A;  2Q2E B;  1R2Z A;  2LHG A;  4LFB M;  2L2D A;  1NHG C;  3GLH B;  3I4V A;  2V1U A;  4LG2 A;  3VK8 A;  4NSO B;  2WSF F;  1VEJ A;  4L78 A;  1GL7 A;  1PJI A;  2KXE A;  4JYA M;  1N78 A;  3L27 A;  1OAI A;  4F2L A;  3LQR A;  1Z5C A;  2JY8 A;  3RGP A;  1DGH B;  4MM3 B;  5FSW A;  3GP1 A;  1ZV1 A;  3TWL A;  1HQC A;  1HR0 M;  2CV1 A;  7CAT A;  2KZU A;  4IBK A;  1YSY A;  1KYI A;  3SAU A;  4LF9 M;  1G71 A;  1NNJ A;  3WHL A;  3AOE C;  3H4J A;  4FD2 A;  2CV0 A;  4AI6 A;  1AIP C;  2WZJ A;  1GKI A;  3B7Q A;  3LVW A;  4JI5 M;  3C58 A;  2HWJ A;  4QNR A;  3TPZ A;  3HU2 A;  5BPV A;  3L28 A;  3UK6 A;  1E9S A;  3CF6 E;  3PVS A;  2ZTD A;  1E9R A;  4JI0 M;  2V1C A;  2CHQ A;  3HJQ A;  1SXJ C;  1R7R A;  1T6O A;  2FOI C;  4NL4 H;  1QYR A;  2CE7 A;  2QSF X;  2OO9 A;  3A98 B;  2YFQ A;  1Y8G A;  4B7H A;  2C98 A;  4QHT A;  2XZF A;  3Q8G A;  1L8Q A;  1OFH A;  1PM5 A;  3GLG A;  2CEA A;  4TUW A;  2QPA A;  4OVZ B;  5EXT A;  4MGY E;  4LGY A;  4RKU F;  3E46 A;  3U6S A;  3KFU G;  3UGJ A;  4FWH A;  3GPU A;  1I4W A;  5ITQ A;  2O01 F;  1NV9 A;  1TGU A;  1TTE A;  3B7Z A;  4LF8 M;  3SAR A;  2J7N A;  4PT5 A;  3ZH9 B;  2Y20 A;  5ITT A;  1NHW C;  2F5O A;  4HL4 A;  1RU3 A;  2D7G A;  3LW5 F;  1Q3C A;  3L26 A;  1IQP A;  1A5T A;  1KSF X;  3HJ8 A;  3I04 M;  2HAK A;  2R46 A;  2O25 A;  5C1B A;  1OKS A;  1OIZ A;  1PRB A;  4D82 A;  5EP2 A;  5C18 A;  2CWB A;  1VQ1 A;  2X4A A;  3FD9 A;  4JI3 M;  1ZAE A;  2LVQ D;  3NBI A;  1L2B A;  1XNQ M;  2J5Y A;  1VG5 A;  1SXJ D;  5L8R F;  4XBO A;  3U61 A;  3I51 A;  3I01 M;  5ITU A;  2UU9 M;  3THG A;  3U6M A;  4LF5 M;  1IN8 A;  4M9X A;  3GLH E;  4JI4 M;  2JY6 B;  2YQZ A;  3J7B A;  3J81 S;  1SG9 A;  3U6E A;  2O5R A;  2K6B A;  2KHH A;  3J80 S;  3KOY E;  3KVW A;  1NY5 A;  1YLA A;  3GQ4 A;  3B9P A;  3FUU A;  3EIH A;  2F5S A;  3VLF B;  1WIV A;  1QQW A;  3GLG B;  1IBL M;  2LVP C;  2RRU A;  4RF0 A;  3PXG A;  4DV0 M;  3U5Z A;  1GO5 A;  3HKP A;  2QBY A;  1H6U A;  3L2A A;  2DNA A;  3DOA A;  3AJI B;  1HT2 E;  2QHO B;  3HX3 A;  3VDP A;  2JY7 A;  1UM8 A;  1W5S A;  3CGW A;  3GRU A;  4LF4 M;  2QZ4 A;  1QAM A;  2MRO B;  3K8Z A;  2JA2 A;  2KNA A;  1WGL A;  3GLH A;  1D0K A;  4M9S A;  3FTD A;  4MB7 A;  1QDR A;  4L16 A;  1WXQ A;  1ZMU A;  3LMM A;  4GRI A;  5LMN M;  3SAV A;  3KOZ E;  2MGW A;  1DGH A;  4FCV A;  4GH9 A;  3SYL A;  4Z6Y A;  1EIJ A;  1J09 A;  4KO8 A;  1XMO M;  2Y0T A;  2F5N A;  3IHP A;  1XNR M;  4G4O A;  2HHH M;  2K9D A;  5KPT A;  3U61 B;  2R18 A;  1IBM M;  1VEK A;  2JP7 A;  3W0L B;  3KOX E;  3RGS A;  3MJ5 A;  4D81 A;  3QYB A;  3HY5 A;  4ZPX A;  1L2D A;  2DVW B;  4M9Z A;  2F5P A;  1Z5B A;  4DV1 M;  3VKH A;  2UUA M;  4PDG A;  5BR8 M;  3IG8 A;  4G4Q A;  4LCB A;  1XMQ M;  4MGI E;  3GQ5 A;  2KNZ A;  4JV5 M;  3UMM A;  1DGF A;  1IN7 A;  4B3T M;  1G8P A;  2QBY B;  4MGH A;  1N36 M;  2VQF M;  1N34 M;  1EE8 A;  2G5G X;  2FFJ A;  4IIW A;  3B74 A;  4OVZ A;  5KQ8 A;  1V33 A;  4DR2 M;  1Q02 A;  1PJT A;  2XEP A;  2ZTC A;  1OTR A;  3HWS A;  1E94 E;  2VDB B;  1R6B X;  2DWN A;  4EIW A;  4LY6 A;  3PFI A;  2K0B X;  3SYK A;  4MGZ E;  1LTM A;  2XSZ A;  3U6C A;  4G4N A;  1PJJ A;  2M60 A;  1IY2 A;  1WR1 B;  1X37 A;  1Q3B A;  2FNA A;  2H1R A;  4AKI A;  3W68 A;  2VF7 A;  3M0E A;  3TL4 X;  4F1I A;  2B3T A;  2C9O A;  1L1T A;  2LWX A;  2D7E A;  4NRV A;  4YY3 M;  3KW6 A;  3UJN A;  3BOS A;  2DKL A;  3VKG A;  4IBE A;  4BBA A;  4GIT A;  3T1H M;  1IFY A;  1N77 A;  3TWK A;  4DUZ M;  3GLG E;  2L7H A;  4RNA A;  1FNN A;  4LJ5 A;  1W5T A;  2QQ8 A;  1VDL A;  3FYC A;  4YHH M;  4GC5 A;  4AKH A;  2F4V M;  5DFL A;  1IY1 A;  3D8L A;  3DA1 A;  2JNH A;  4OU7 A;  3FYD A;  3SHF A;  1OJL A;  1QVR A;  2KEB A;  2C9C A;  5KO3 A;  3FUV A;  5FTJ A;  1G59 A;  3SC3 A;  2VQE M;  1G3I A;  4DBG B;  4G4R A;  1HJP A;  4DR7 M;  3LCV B;  4L6V 6;  3JR4 A;  4IBG A;  3JAM S;  2BJV A;  2EO2 A;  1HNW M;  1DV0 A;  4LJ8 A;  2EJS A;  1SXJ B;  4HEO A;  1D2N A;  1NVM A;  5DNY A;  4AQY M;  1R4G A;  3GLI E;  5IWA M;  2L4F A;  3ZC7 B;  2KRU A;  5F3W A;  2R0I A;  2I7P A;  4IBI A;  4M0D A;  4DV7 M;  2XFT A;  3F92 A;  4REZ A;  3TWM A;  3U6L A;  3FE3 A;  4DR3 M;  2L4E A;  4FWG A;  1XXH A;  2LH0 A;  4DV6 M;  4OX9 M;  1ZMW A;  3HJS A;  2N35 A;  4GKJ M;  1G41 A;  3GRY A;  2QP9 X;  1YE9 A;  4WUR A;  1UFZ A;  1F4I A;  2HKJ A;  4JI8 M;  4NXM M;  3Q8X A;  3DFZ A;  3SFZ A;  1MU5 A;  3SAT A;  3D8B A;  2DHY A;  3MMP A;  2DAE A;  2EUC A;  1GJT A;  1GJS A;  4IBC A;  3GLI A;  1C1K A;  5FTN A;  1Z6T A;  1TDZ A;  1IM2 A;  3LVV A;  2QNJ A;  2LNH C;  2JXN A;  2APL A;  1MJG M;  1J7K A;  1QDT A;  3SBJ A;  4QOS A;  1Z59 A;  2DAG A;  4NC6 A;  2C5R A;  2KNV A;  1OQY A;  3FKE A;  4LFC M;  1QAQ A;  4II7 A;  1JR3 D;  3EIE A;  1IN5 A;  1WGN A;  2CUZ A;  2QEN A;  4QNM A;  3FTF A;  4GHL A;  1PJQ A;  2DZN B;  3ILK A;  2DEN A;  3CTW B;  1XC8 A;  4B3R M;  4JI1 M;  1E32 A;  4LRT A;  3KS8 A;  4XK8 F;  4LZZ A;  3NWL A;  4AG6 A;  4AZF A;  1JQJ C;  4Z8X A;  4FVM A;  3E21 A;  1TR8 A;  1BVS A;  2W82 A;  2VII A;  3M7G A;  3PNY A;  4DV3 M;  3K2L A;  3AV0 A;  2OOA A;  1HT1 E;  1XXH B;  2BNK A;  2LXE A;  4KT0 F;  1QAO A;  1NO1 A;  4Q7J A;  2F5Q A;  1HQY E;  1N33 M;  3BXW A;  5KPZ A;  1IBK M;  4GMQ A;  5GKN A;  1MN3 A;  2WSE F;  2MH8 A;  5IRE B;  4JI2 M;  3K92 A;  2DWM A;  2Z7J A;  2ZM6 M;  2OQ4 A;  4DV5 M;  4GHA A;  3HHX A;  1QAN A;  4X65 M;  3W67 A;  3KXE C;  2R62 A;  4I8O A;  4IJE A;  3J27 B;  3A42 A;  1SXJ E;  5DYI A;  4G6Z A;  3T6P A;  3GLI B;  4IBJ A;  2CRU A;  4ANR A;  4IBD A;  3SAW A;  4CGY B;  2KZS A;  1C7Y A;  2X49 A;  2RGH A;  1NJF A;  2ZAN A;  1NSF A;  4UN2 B;  3TE6 A;  3L25 A;  2NQ8 C;  4PDI A;  1DGB A;  4L4U A;  3AOG A;  3GRR A;  1QUT A;  5EJC A;  3CF2 A;  3M6A A;  4LJA A;  2KW0 A;  2Z4S A;  3AOE A;  2JWS A;  2JZ1 A;  4IJF A;  5KPR A;  3OTO M;  3HU1 A;  1R5L A;  4DR1 M;  4JI6 M;  4DR5 M;  3LCU A;  3J7A S;  2XZU A;  1N75 A;  2ERC A;  1XHB A;  2XGN A;  3HU3 A;  5EP4 A;  3LQQ A;  1SXJ A;  3KSJ A;  1J5E M;  4L8R C;  3SHG B;  3E4R A;  4GC9 A;  1R2Y A;  1QZM A;  1ORY B;  8CAT A;  2CHG A;  2LVA A;  5IT9 S;  4QHS A;  3W0F A;  2DXI A;  4I4L A;  3HZJ A;  1TDH A;  3IEC A;  4L15 A;  1TH3 A;  1ZMV A;  1V34 A;  2EKF A;  3QWL A;  3HHY A;  3R9X B;  1IN6 A;  4D80 A;  4KHP M;  1GLN A;  2D7H A;  4LGM A;  4AG5 A;  3HHZ A;  4R3D A;  2DHR A;  1N32 M;  1JB0 F;  2L7I A;  2LTU A;  2OOB A;  5A2Q S;  3GLF A;  1IXR C;  2C99 A;  3V76 A;  4NXN M;  4HLQ A;  4LRS A;  4P16 A;  2V6Z M;  2R6F A;  1XXH E;  2G8L A;  2K47 A;  4RF1 A;  4S12 A;  1TF0 B;  3U6Q A;  3FRI A;  3IG5 A;  1DO0 A;  3KSX A;  1XWI A;  4WW0 A;  1OAO C;  3SAS A;  4ITQ A;  1IXS A;  3B7N A;  3T38 A;  4XGI A;  1NJG A;  2DAK A;  2LBC A;  1P3Q Q;  2Z8Y M;  4DV4 M;  3FTE A;  3DZD A;  3K9O A;  1D0M A;  2QCU A;  2YR0 A;  1YUB A;  2RKO A;  1DO2 A;  2EKK A;  2Z4R A;  2ZAO A;  5ITX E;  2UXD M;  2LHC A;  2I7N A;  5JI2 E;  3GO8 A;  2R45 A;  4DUY M;  2XFS A;  4JXJ A;  4R71 A;  3A46 A;  1IY0 A;  1S3S A;  2YNM D;  4M0W A;  3KP1 E;  4MH0 E;  3ZQJ A;  1FJG M;  3MHV C;  2UXC M;  4MGK E;  1L1Z A;  1WHC A;  3QYE A;  2C96 A;  4PCZ A;  4LJ9 A;  3QAU A;  4QOZ C;  5EXP A;  4PD2 A;  3C3D A;  2WSC F;  2Y21 A;  3GPX A;  3L29 A;  3FRH A;  2FS1 A;  2DAM A;  2OPF A;  4LJ6 A;  4Y28 F;  2Z3X A;  2HCB A;  5E26 A;  5ITX A;  2FE8 A;  2R44 A;  2DZL A;  3BBZ A;  2KRK A;  4CHT B;  2XLJ A;  4LZJ A;  4LF7 M;  4OW0 A;  3RE8 A;  3GLF B;  2VF8 A;  5FTM A;  4FCW A;  1VEG A;  4NOO B;  3I4Y A;  1GAB A;  3H4M A;  4WP2 A;  4IBB A;  2DWZ B;  1GL6 A;  2BWE A;  3HGI A;  5FTK A;  4FCT A;  1WJ7 A;  1XB2 B;  5ITR A;  1HNX M;  1HNZ M;  3U60 A;  1DGG A;  5EXX A;  2P5T A;  3T1Y M;  4NRW A;  4AKG A;  1IXS B;  2HL7 A;  3FUX A;  2XH9 A;  1TH4 A;  1QZE A;  1NV8 A;  2A5Y B;  2L6O A;  1OIP A;  5FTL A;  4GKK M;  4LJ7 A;  3K1J A;  4LJ4 A;  3SMP A;  3JR5 A;  2BWB A;  3RFW A;  2G3Q A;  2AHM A;  2X8A A;  3KP0 E;  2KDL A;  1EFU B;  2L09 A;  3FTC A;  4BLC A;  1Z5A A;  2ZBK B;  3PNV A;  4FWD A;  3MK6 A;  3AFH A;  3WHK A;  1L2C A;  3R8F A;  3GPP A;  4B7F A;  2E5L M;  2DI0 A;  2KA6 B;  3GRV A;  4CJ6 A;  5JI3 E;  3J2P B;  4GEW A;  2LVO C;  1OFI A;  4CIZ A;  2JZ0 A;  3VK7 A;  1PJS A;  2CP8 A;  1IXZ A;  2XSZ D;  3C9P A;  2GNO A;  2XF3 A;  5E6J A;  4I81 A;  3B89 A;  3U6O A;  4W5W A;  1JR3 E;  2FH0 A;  5ITY A;  3TQS A;  4K0K M;  2RGO A;  1TH2 A;  4G3O A;  3U60 B;  1AUA A;  2UUC M;  4NSR A;  1K82 A;  5H37 D;  2BJW A;  5IZ7 D;  4KOD A;  1CUK A;  5LMU M;  1MX0 A;  5KQD A;  4B3S M;  2R4J A;  4B3M M;  1ZQ9 A;  4CIS A;  4A3V B; 
#chains in the Genus database with same CATH homology
 3F92 A;  3K9P A;  2LTU A;  2OOB A;  3FE3 A;  1G4A E;  2L4E A;  3GLH E;  2JY6 B;  1ZMW A;  1SG9 A;  1G41 A;  3GLF E;  2KHH A;  1XXH E;  1UFZ A;  1YLA A;  3FRI A;  1F4I A;  1DO0 A;  1WIV A;  1IXS A;  2LVP C;  2RRU A;  2DAK A;  2DHY A;  1P3Q Q;  2LBC A;  1V92 A;  2DAE A;  3MMP A;  1GO5 A;  3K9O A;  1DO2 A;  2EKK A;  2DNA A;  1HT2 E;  2QHO B;  1IM2 A;  2JY7 A;  2QNJ A;  5JI2 E;  2H5X A;  2LVN C;  2MRO B;  2KNA A;  1WGL A;  2DAG A;  2KNV A;  1OQY A;  1WHC A;  2JUJ A;  1ZMU A;  1WGN A;  2MJ5 B;  2JY5 A;  1T43 A;  2MGW A;  2DAI A;  3FRH A;  2DEN A;  2DAM A;  2MR9 A;  3IHP A;  1PGY A;  2K9D A;  2L2D A;  2DZL A;  3BBZ A;  3E21 A;  1TR8 A;  1BVS A;  1VEK A;  2JP7 A;  1VEJ A;  1VEG A;  2OOA A;  1HT1 E;  1OAI A;  4F2L A;  2JY8 A;  4Q7J A;  4WP2 A;  1HQY E;  2BWE A;  1ZV1 A;  1XB2 B;  1WJ7 A;  1MN3 A;  2KNZ A;  1KYI A;  3H4J A;  1QZE A;  1AIP C;  1NV8 A;  2WZJ A;  3T6P A;  2HWJ A;  1Q02 A;  2ZTC A;  1OTR A;  1C7Y A;  1E94 E;  2ZTD A;  2BWB A;  2G3Q A;  4UN2 B;  1T6O A;  2QSF X;  2K0B X;  2OO9 A;  1EFU B;  1WR1 B;  1Y8G A;  4F1I A;  2B3T A;  2JZ1 A;  2DKL A;  1IFY A;  3LCU A;  2DI0 A;  3E46 A;  3GLG E;  4GEW A;  1VDL A;  2LVO C;  2JZ0 A;  1NV9 A;  1TTE A;  2CP8 A;  5DFL A;  2JNH A;  2LVA A;  1A5T A;  3B89 A;  1G3I A;  2HAK A;  4DBG B;  3IEC A;  1HJP A;  1JR3 E;  2O25 A;  1OKS A;  1ZMV A;  3LCV B;  4G3O A;  2CWB A;  1VQ1 A;  2EKF A;  1DV0 A;  2EJS A;  4HEO A;  2LVQ D;  1R4G A;  1CUK A;  3GLI E;  2L4F A;  1VG5 A;  2R0I A;  4R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...