1IXSA

Structure of ruvb complexed with ruva domain iii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
ESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQDLIKEALKRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Holliday junction DNA helicase ruvA
total genus 16
structure length 50
sequence length 50
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07499 RuvA_C RuvA, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1ixsA00
1V92A 2JNHA 4G3OA 2QHOB 2EKKA 2JP7A 1NV9A 2KHHA 2ZTDA 3BBZA 1OKSA 3MMPA 2K0BX 2QNJA 2B3TA 1SG9A 2DZLA 2JZ1A 1HJPA 2LTUA 1E94E 1JR3E 2KNVA 1OQYA 2DNAA 2EJSA 3K9PA 1WGLA 2BWBA 1WHCA 2CWBA 2MJ5B 4WP2A 2DAIA 2LBCA 2LVOC 1DV0A 2KNAA 2R0IA 1WR1B 3K9OA 4GEWA 4HEOA 2L4EA 1T43A 1KYIA 3GLFE 1Q02A 1XXHE 1VDLA 5JI2E 1VEJA 1TR8A 1T6OA 1IXSA 4DBGB 2DAEA 2JY7A 2MR9A 2OOAA 1EFUB 1Y8GA 1XB2B 3GLIE 2JY6B 1CUKA 2DAGA 2JY8A 2LVQD 1ZMWA 2JZ0A 1BVSA 1G41A 1VQ1A 2RRUA 5DFLA 2MROB 3F92A 4F1IA 2DAKA 3IHPA 4Q7JA 2OOBA 1IFYA 1MN3A 1DO2A 1QZEA 1YLAA 1G3IA 2L2DA 1UFZA 2G3QA 3B89A 1TTEA 3LCUA 2ZTCA 1PGYA 1GO5A 2HAKA 2MGWA 1IM2A 1OAIA 1P3QQ 3FE3A 1HT1E 2LVPC 2EKFA 1AIPC 3GLGE 2QSFX 2LVNC 2DI0A 1DO0A 2DKLA 2KNZA 2L4FA 1HQYE 3E21A 2HWJA 1F4IA 2CP8A 4UN2B 1ZV1A 1WJ7A 4F2LA 1ZMUA 4R71A 2K9DA 2DAMA 1G4AE 1ZMVA 2OO9A 1OTRA 3FRHA 1WGNA 1HT2E 2O25A 3E46A 1VEGA 1VEKA 2WZJA 2JUJA 3FRIA 1VG5A 1R4GA 2JY5A 2BWEA 3IECA 2DHYA 2LVAA 1NV8A 3LCVB 3GLHE 1A5TA 3T6PA 1C7YA 2DENA 3H4JA 1WIVA 2H5XA
chains in the Genus database with same CATH superfamily
3DOAA 2UXBM 2EKKA 2ZTDA 2DWMA 1OJLA 4ZPXA 3TL4X 3PNVA 3GQ4A 4DV4M 2KRKA 1MX0A 1QYRA 2J7NA 1NJFA 2BJWA 4GRIA 1OFIA 1TDZA 1N32M 4DR1M 1N36M 1OQYA 4JI3M 3HHYA 4L16A 1N34M 1WGLA 2BWBA 1WHCA 3J27B 5KQDA 3VK7A 3W67A 2F5NA 5EXTA 3I51A 4FWGA 2BJVA 4DR2M 1L2CA 3T15A 4LF5M 1OIZA 3UJNA 3U6LA 4B08A 3PFIA 3GPYA 3MHVC 3GLFE 1E32A 1N78A 1NY6A 5H37D 2F4VM 4LFCM 8CATA 4PD2A 3HU1A 1PJIA 4LY6A 1PJTA 1IXSA 3JR4A 2Z4RA 4NL4H 4QOSA 1GL6A 3BOSA 4DV3M 2DAEA 3W0FA 3AFHA 4JYAM 2VF7A 1EFUB 3SASA 1C1KA 3VDPA 4PDIA 2OQ4A 4OVZB 1Z6TA 3HJQA 4LF9M 1JR3D 2JY6B 1FJGM 2X8AA 2KZSA 1IN5A 1L1TA 2L09A 2VF8A 2LVQD 1ZMWA 3ZH9B 2RRUA 1G41A 4G4NA 1L1ZA 2YFQA 1W5TA 1XHBA 1IN8A 3D8LA 5IREB 3IHPA 1E9SA 2YNMD 2Y0QA 4Q7JA 4AI6A 1DO2A 3SAUA 1YLAA 3PNYA 2W82A 3WHKA 3C9PA 2UUAM 2ZBKB 3B9PA 3I4VA 2K47A 1SXJA 2QP9X 4AZFA 2G3QA 2EUCA 1XWIA 1TTEA 4CGYB 3GLFA 1QAOA 3KOWE 2A5YB 4M0DA 3SFZA 2M60A 2G5GX 4IBGA 1NJGA 2V1CA 5DYGA 3A98B 3W68A 1L8QA 4GH9A 4OW0A 3FD9A 1S3SA 2J5YA 1ZAEA 1OAIA 2XZUA 3K92A 3R8FA 2Q2EB 4B7GA 2XH9A 4DR3M 4DUZM 3SYKA 2KA6B 5ITRA 1KFVA 2D7HA 3I4YA 4QNRA 3GLGE 4LGYA 3GLGB 1JB0F 2R18A 3J7AS 1LTMA 2XGNA 1SXJE 1T3TA 3GQ3A 3L26A 2M5ZA 4UN2B 2P5TA 3C3DA 1ZV1A 4JN6A 3TPZA 4KHPM 3QYBA 4KT0F 4K0KM 4F2LA 1YUBA 2K9DA 2DAMA 4GMQA 3W0LB 2LH0A 1HNWM 4YHHM 2UUCM 1G59A 2WSCF 1WGNA 5GKNA 1OFHA 3E46A 2HL7A 3B74A 1R5LA 3Q8GA 3SARA 1VEGA 1VEKA 2C96A 2CV2A 4I81A 4R3DA 5E6JA 3KOYE 4FWHA 1XMOM 4FW9A 5L8RF 3IG8A 3GLIB 4AKGA 2J7OA 4B7HA 5FTKA 2Y0TA 5IWAM 3T1HM 1QVRA 3GPPA 1NNJA 4DR6M 1TH2A 2UUBM 2R45A 3IECA 2DHYA 2LVAA 1D0MA 4P16A 2QBYA 1MU5A 3KDSE 4LJ6A 1JQJC 1IN7A 1A5TA 2C99A 4KLNA 3AOEC 1R2ZA 4AG5A 3SATA 3DZDA 3GPUA 5FTLA 4X65M 3T1YM 1TDHA 5A2QS 1V92A 3LW5F 2JNHA 3TE6A 1NVMA 3KSXA 2JP7A 2F5QA 3GLHB 3BBZA 1OKSA 3CF2A 3L2AA 2CV0A 1AUAA 5KO3A 3LVVA 2K0BX 2QNJA 2F5OA 2B3TA 3M6AA 4TUWA 2DZLA 2JZ1A 3KP0E 3R9XB 2EO2A 1HJPA 1JR3E 2I7NA 2DNAA 4KODA 3A45A 3GLFB 2CRUA 1EE8A 3JR5A 2CWBA 2MJ5B 1YSYA 5EQTA 3U6PA 3AV0A 2CFOA 4GITA 3GRYA 1DV0A 4GEWA 1N75A 1R2YA 3L25A 1NNUC 3AOEA 1HR0M 4MB7A 4LZZA 1XXHE 3D8BA 3VKGA 4Z8XA 1GLNA 1E9RA 4LJ7A 4DR5M 4AKIA 2JY7A 2CHVA 4I4LA 3FUXA 4OVZA 3SHGB 3AJIB 1Y8GA 4XGIA 2VDBB 1TH3A 2OPFA 2FH0A 2BNKA 2L6OA 4PT5A 3RGPA 3UZUA 1CUKA 1XNQM 3WHLA 3E9SA 2K6BA 1H6UA 3FKEA 4FCTA 2JZ0A 4IBEA 1VQ1A 2Z7JA 1J5EM 3F92A 4AG6A 2KXEA 4F1IA 2VIIA 5FSWA 1QDRA 3LQQA 3FTEA 3SYLA 2EA0A 3J81S 1GJTA 3FUUA 3AKZA 1N77A 1GJSA 2R4EA 1HNXM 1QZEA 3M0EA 2ERCA 4L6V6 1L2BA 1N33M 3GP1A 3IG5A 2RKOA 5FTMA 3LCUA 3M7GA 2XSZD 4MGHA 3ZCBB 4L4UA 3HX3A 4GC9A 2QQ8A 4NXNM 2HAKA 5ITXA 5EP3A 5BR8M 2MGWA 2QZ4A 1DGHA 1XC8A 2JXNA 3TWLA 4LG2A 3FE3A 1Q39A 4MGIE 4LJ9A 1HT1E 2LVPC 1LV7A 3K2LA 1NO1A 2QSFX 1NY5A 2DI0A 2XFSA 4D80A 4QHSA 2KNZA 2L4FA 4REZA 2Z8YM 2DZNB 1F4IA 4L8RC 1IN6A 3U61A 4FCVA 1IBMM 3K8ZA 4R71A 2LNHC 1G4AE 5C1BA 4D82A 2OO9A 4HLQA 3CTWB 4IBFA 1OTRA 4FCWA 3DFZA 5ITTA 4L15A 5ITYA 5EP4A 5LMUM 2X49A 4LF8M 4G4QA 2WZJA 2JUJA 4L78A 2HKJA 4WURA 3UK6A 3E4RA 1ZQ9A 2UXCM 4LFBM 3SMPA 2Z4SA 2C9CA 1ORYB 2JY5A 4BBAA 3FTDA 1PJSA 4DV2M 5EP2A 2F5PA 4DR4M 1OIPA 3H4MA 1QANA 4LGMA 4MGKE 1Z59A 3LCVB 4ANRA 2R6FA 3FUWA 3GLHE 2LHCA 4B7FA 1SXJD 3T6PA 2DENA 3HU3A 3KS4A 5C18A 5EP1A 3U6DA 1WIVA 1IN4A 3B7NA 4CJ6A 4JI6M 1IXRC 4G3OA 3KSJA 4IBIA 2QCUA 5EXPA 3J80S 3RE8A 2KHHA 1YE9A 2DWLA 3U60B 2CUZA 3VLFB 4AW4A 3ZQJA 3DA1A 3U5ZA 3QYEA 4LRTA 3GPXA 1DGGA 3GLGA 2VQEM 1XNRM 3L29A 5BPVA 4IBBA 5KPRA 4M0WA 3AOGA 4GC5A 4DUYM 2CHGA 4B3TM 1HNZM 2KNVA 3PXGA 1IY0A 2EJSA 2O01F 2QPAA 2YQZA 4CIZA 4RNAA 1PJJA 4MH0E 2JA2A 2DAIA 2D7GA 4LJAA 3HHWA 2E5LM 2LBCA 3GLIA 1NHGC 1W5SA 3JAMS 1D0LA 2FFJA 1WR1B 2R0IA 3HGIA 3K9OA 2L4EA 3UGJA 4X64M 1EIJA 2R65A 4G4RA 3KOXE 5FLXS 2N35A 1FNNA 1Q02A 2XLJA 2C5RA 4P17A 1X37A 2LXEA 1VEJA 2RGOA 2L7IA 3SC3A 5KQ8A 2XEPA 3HZJA 4KO8A 3RGSA 4S12A 3CF0A 1OAOC 4YY3M 1QAMA 2MR9A 3B7QA 1J7KA 3FUTA 2OOAA 3SHFA 1SXJC 3HU2A 3VK8A 1QZMA 5IT9S 4JXJA 1GKIA 4LF6M 2V1UA 2JWSA 3GLIE 1IXZA 4R7GA 1D0KA 2CEAA 1I4WA 4LFAM 2KW0A 1Z5CA 4M9ZA 1BVSA 4LJ4A 4PDGA 4DV7M 5DFLA 2MROB 3RFWA 4QNMA 4NC6A 2Y20A 3EIHA 4M9XA 3T38A 4B3SM 2MH8A 2OOBA 4II7A 1NSFA 4MM3B 2DWNA 4B3MM 1PJQA 1G3IA 3C58A 1VDDA 4I8OA 1SXJB 1TH4A 3GRUA 4CHTB 2G8LA 1UFZA 1V33A 3CGWA 4LJ5A 4G6ZA 2R46A 4QOZC 1PGYA 4FD2A 4NOOB 3GRVA 3Q8XA 4HL4A 2ZAMA 2QENA 1TGUA 1IM2A 2APLA 4MGZE 2ZAOA 3THGA 4DV6M 3QAUA 4ITQA 4RKUF 1AIPC 5JI3E 2NQ8C 2LVNC 2DVWB 3NWLA 5F3WA 1NHWC 4JI8M 1HQYE 3TQSA 4QHTA 2UXDM 2HCBA 2C98A 2CP8A 3TWKA 2CHQA 5IZ7D 1ZMUA 4AKHA 4X62M 1ZMVA 4NXMM 3FRHA 4LF7M 3SMSA 2O25A 1D2NA 1L2DA 1RU3A 1G71A 4IBJA 1XMQM 3FRIA 1Z5BA 4IIWA 3KS8A 1QUTA 1XXHA 1IQPA 2DWZB 1I94M 4BB9A 2RGHA 1Z5AA 4JI4M 4IBKA 1K3WA 3I01M 2BWEA 3LQRA 1QUSA 1UM8A 4EIWA 3KW6A 4NRWA 2XZFA 1C7YA 4IJFA 2DXIA 3H4JA 4GIPA 4X66M 1QAQA 1PRBA 1G8PA 2QHOB 3U6OA 3U61B 2L7HA 1NV9A 4FVMA 4JI0M 1GL7A 4CISA 4DR7M 1PM5A 3LVWA 3MMPA 4RF0A 3UMMA 3NBIA 4NSRA 2YR0A 1SG9A 2LTUA 1E94E 3GLHA 3C3EA 4PCZA 3U6MA 1WXQA 4DV0M 2XSZA 1K3XA 2KRUA 4NRVA 2FNAA 3J7BA 5DYIA 3K9PA 5ITXE 1K82A 4OX9M 4Z6YA 3U6QA 2DZOB 4WP2A 3B7ZA 3A46A 2XF3A 2LVOC 5FTJA 2KNAA 4HEOA 1GABA 4Y28F 4A3VB 4JI7M 4D81A 2CV1A 3KOZE 5EXSA 2R4JA 1KYIA 1T43A 2C9OA 3HY5A 4I5SA 4W5WA 5LMNM 1VDLA 5JI2E 3AL0C 1TR8A 2Z3XA 1T6OA 3SAVA 3K1JA 4DBGB 3GO8A 3U6EA 1R7RA 1MJGM 3VKHA 3ILKA 3L28A 4IBDA 2CE7A 3KP1E 3V76A 1XB2B 2R62A 3ZC7B 2O5RA 3CF6E 2QBYB 1IXSB 2DAGA 2JY8A 3KVWA 3OTOM 5ITQA 2XFTA 2FE8A 4RF1A 2DAKA 2LWXA 5FTNA 3SAWA 3FYCA 4LZJA 1QQWA 3L27A 4XBOA 4DV5M 1IBKM 3I04M 3HJ8A 4LJ8A 1IFYA 2WSEF 2WSFF 1MN3A 4LRSA 1QDTA 4JV5M 2F5SA 3EIEA 5EXXA 2L2DA 3VFDA 2FS1A 3KFUG 4FWDA 1IBLM 3NBXX 1IY2A 2KEBA 1V34A 2Y21A 3HWSA 3B89A 3VDUA 3FUVA 2ZTCA 1J09A 2VQFM 2KZUA 1GO5A 1DGHB 1HQCA 2GNOA 1R6BX 3U5ZB 3FYDA 2R44A 2GQFA 4GKKM 1P3QQ 3U60A 2KDLA 3HKPA 2DHRA 3KXEC 5KPTA 2UU9M 2EKFA 4WW0A 2ZANA 3BXWA 1DO0A 2DKLA 2D7EA 5E26A 3TWMA 5EJCA 3GQ5A 5DNYA 3E21A 4GKJM 2HWJA 3LMMA 4GHLA 1WJ7A 4JI1M 1XXHB 4LF4M 2ZM6M 4GHAA 5ITUA 4G4OA 2HHHM 4JI5M 2I7PA 1Q3BA 3FTCA 4IJEA 1HT2E 3A42A 3HHZA 3HJSA 3J2PB 4AQYM 2X4AA 2H1RA 4MGYE 3MJ5A 1VG5A 1R4GA 1IY1A 3U6SA 1DGBA 1TF0B 2LHGA 4BLCA 4XK8F 3GRRA 5KPZA 1Q3CA 1DGFA 2V6ZM 4IBCA 3HHXA 4LCBA 4M9SA 1NV8A 4OU7A 3QWLA 4NSOB 1GVNA 4JI2M 1JR3A 1KSFX 3MK6A 4DV1M 2FOIC 3PVSA 3FTFA 7CATA 3SBJA 3U6CA 2H5XA 4B3RM 2AHMA
chains in the Genus database with same CATH topology
1V92A 2JNHA 4G3OA 2QHOB 2EKKA 2JP7A 1NV9A 2KHHA 2ZTDA 3BBZA 1OKSA 3MMPA 2K0BX 2QNJA 2B3TA 1SG9A 2DZLA 2JZ1A 1HJPA 2LTUA 1E94E 1JR3E 2KNVA 1OQYA 2DNAA 2EJSA 3K9PA 1WGLA 2BWBA 1WHCA 2CWBA 2MJ5B 4WP2A 2DAIA 2LBCA 2LVOC 1DV0A 2KNAA 2R0IA 1WR1B 3K9OA 4GEWA 4HEOA 2L4EA 1T43A 1KYIA 3GLFE 1Q02A 1XXHE 1VDLA 5JI2E 1VEJA 1TR8A 1T6OA 1IXSA 4DBGB 2DAEA 2JY7A 2MR9A 2OOAA 1EFUB 1Y8GA 1XB2B 3GLIE 2JY6B 1CUKA 2DAGA 2JY8A 2LVQD 1ZMWA 2JZ0A 1BVSA 1G41A 1VQ1A 2RRUA 5DFLA 2MROB 3F92A 4F1IA 2DAKA 3IHPA 4Q7JA 2OOBA 1IFYA 1MN3A 1DO2A 1QZEA 1YLAA 1G3IA 2L2DA 1UFZA 2G3QA 3B89A 1TTEA 3LCUA 2ZTCA 1PGYA 1GO5A 2HAKA 2MGWA 1IM2A 1OAIA 1P3QQ 3FE3A 1HT1E 2LVPC 2EKFA 1AIPC 3GLGE 2QSFX 2LVNC 2DI0A 1DO0A 2DKLA 2KNZA 2L4FA 1HQYE 3E21A 2HWJA 1F4IA 2CP8A 4UN2B 1ZV1A 1WJ7A 4F2LA 1ZMUA 4R71A 2K9DA 2DAMA 1G4AE 1ZMVA 2OO9A 1OTRA 3FRHA 1WGNA 1HT2E 2O25A 3E46A 1VEGA 1VEKA 2WZJA 2JUJA 3FRIA 1VG5A 1R4GA 2JY5A 2BWEA 3IECA 2DHYA 2LVAA 1NV8A 3LCVB 3GLHE 1A5TA 3T6PA 1C7YA 2DENA 3H4JA 1WIVA 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V92 A;  2JNH A;  4G3O A;  2QHO B;  2EKK A;  2JP7 A;  1NV9 A;  2KHH A;  2ZTD A;  3BBZ A;  1OKS A;  3MMP A;  2K0B X;  2QNJ A;  2B3T A;  1SG9 A;  2DZL A;  2JZ1 A;  1HJP A;  2LTU A;  1E94 E;  1JR3 E;  2KNV A;  1OQY A;  2DNA A;  2EJS A;  3K9P A;  1WGL A;  2BWB A;  1WHC A;  2CWB A;  2MJ5 B;  4WP2 A;  2DAI A;  2LBC A;  2LVO C;  1DV0 A;  2KNA A;  2R0I A;  1WR1 B;  3K9O A;  4GEW A;  4HEO A;  2L4E A;  1T43 A;  1KYI A;  3GLF E;  1Q02 A;  1XXH E;  1VDL A;  5JI2 E;  1VEJ A;  1TR8 A;  1T6O A;  1IXS A;  4DBG B;  2DAE A;  2JY7 A;  2MR9 A;  2OOA A;  1EFU B;  1Y8G A;  1XB2 B;  3GLI E;  2JY6 B;  1CUK A;  2DAG A;  2JY8 A;  2LVQ D;  1ZMW A;  2JZ0 A;  1BVS A;  1G41 A;  1VQ1 A;  2RRU A;  5DFL A;  2MRO B;  3F92 A;  4F1I A;  2DAK A;  3IHP A;  4Q7J A;  2OOB A;  1IFY A;  1MN3 A;  1DO2 A;  1QZE A;  1YLA A;  1G3I A;  2L2D A;  1UFZ A;  2G3Q A;  3B89 A;  1TTE A;  3LCU A;  2ZTC A;  1PGY A;  1GO5 A;  2HAK A;  2MGW A;  1IM2 A;  1OAI A;  1P3Q Q;  3FE3 A;  1HT1 E;  2LVP C;  2EKF A;  1AIP C;  3GLG E;  2QSF X;  2LVN C;  2DI0 A;  1DO0 A;  2DKL A;  2KNZ A;  2L4F A;  1HQY E;  3E21 A;  2HWJ A;  1F4I A;  2CP8 A;  4UN2 B;  1ZV1 A;  1WJ7 A;  4F2L A;  1ZMU A;  4R71 A;  2K9D A;  2DAM A;  1G4A E;  1ZMV A;  2OO9 A;  1OTR A;  3FRH A;  1WGN A;  1HT2 E;  2O25 A;  3E46 A;  1VEG A;  1VEK A;  2WZJ A;  2JUJ A;  3FRI A;  1VG5 A;  1R4G A;  2JY5 A;  2BWE A;  3IEC A;  2DHY A;  2LVA A;  1NV8 A;  3LCV B;  3GLH E;  1A5T A;  3T6P A;  1C7Y A;  2DEN A;  3H4J A;  1WIV A;  2H5X A; 
#chains in the Genus database with same CATH topology
 3DOA A;  2UXB M;  2EKK A;  2ZTD A;  2DWM A;  1OJL A;  4ZPX A;  3TL4 X;  3PNV A;  3GQ4 A;  4DV4 M;  2KRK A;  1MX0 A;  1QYR A;  2J7N A;  1NJF A;  2BJW A;  4GRI A;  1OFI A;  1TDZ A;  1N32 M;  4DR1 M;  1N36 M;  1OQY A;  4JI3 M;  3HHY A;  4L16 A;  1N34 M;  1WGL A;  2BWB A;  1WHC A;  3J27 B;  5KQD A;  3VK7 A;  3W67 A;  2F5N A;  5EXT A;  3I51 A;  4FWG A;  2BJV A;  4DR2 M;  1L2C A;  3T15 A;  4LF5 M;  1OIZ A;  3UJN A;  3U6L A;  4B08 A;  3PFI A;  3GPY A;  3MHV C;  3GLF E;  1E32 A;  1N78 A;  1NY6 A;  5H37 D;  2F4V M;  4LFC M;  8CAT A;  4PD2 A;  3HU1 A;  1PJI A;  4LY6 A;  1PJT A;  1IXS A;  3JR4 A;  2Z4R A;  4NL4 H;  4QOS A;  1GL6 A;  3BOS A;  4DV3 M;  2DAE A;  3W0F A;  3AFH A;  4JYA M;  2VF7 A;  1EFU B;  3SAS A;  1C1K A;  3VDP A;  4PDI A;  2OQ4 A;  4OVZ B;  1Z6T A;  3HJQ A;  4LF9 M;  1JR3 D;  2JY6 B;  1FJG M;  2X8A A;  2KZS A;  1IN5 A;  1L1T A;  2L09 A;  2VF8 A;  2LVQ D;  1ZMW A;  3ZH9 B;  2RRU A;  1G41 A;  4G4N A;  1L1Z A;  2YFQ A;  1W5T A;  1XHB A;  1IN8 A;  3D8L A;  5IRE B;  3IHP A;  1E9S A;  2YNM D;  2Y0Q A;  4Q7J A;  4AI6 A;  1DO2 A;  3SAU A;  1YLA A;  3PNY A;  2W82 A;  3WHK A;  3C9P A;  2UUA M;  2ZBK B;  3B9P A;  3I4V A;  2K47 A;  1SXJ A;  2QP9 X;  4AZF A;  2G3Q A;  2EUC A;  1XWI A;  1TTE A;  4CGY B;  3GLF A;  1QAO A;  3KOW E;  2A5Y B;  4M0D A;  3SFZ A;  2M60 A;  2G5G X;  4IBG A;  1NJG A;  2V1C A;  5DYG A;  3A98 B;  3W68 A;  1L8Q A;  4GH9 A;  4OW0 A;  3FD9 A;  1S3S A;  2J5Y A;  1ZAE A;  1OAI A;  2XZU A;  3K92 A;  3R8F A;  2Q2E B;  4B7G A;  2XH9 A;  4DR3 M;  4DUZ M;  3SYK A;  2KA6 B;  5ITR A;  1KFV A;  2D7H A;  3I4Y A;  4QNR A;  3GLG E;  4LGY A;  3GLG B;  1JB0 F;  2R18 A;  3J7A S;  1LTM A;  2XGN A;  1SXJ E;  1T3T A;  3GQ3 A;  3L26 A;  2M5Z A;  4UN2 B;  2P5T A;  3C3D A;  1ZV1 A;  4JN6 A;  3TPZ A;  4KHP M;  3QYB A;  4KT0 F;  4K0K M;  4F2L A;  1YUB A;  2K9D A;  2DAM A;  4GMQ A;  3W0L B;  2LH0 A;  1HNW M;  4YHH M;  2UUC M;  1G59 A;  2WSC F;  1WGN A;  5GKN A;  1OFH A;  3E46 A;  2HL7 A;  3B74 A;  1R5L A;  3Q8G A;  3SAR A;  1VEG A;  1VEK A;  2C96 A;  2CV2 A;  4I81 A;  4R3D A;  5E6J A;  3KOY E;  4FWH A;  1XMO M;  4FW9 A;  5L8R F;  3IG8 A;  3GLI B;  4AKG A;  2J7O A;  4B7H A;  5FTK A;  2Y0T A;  5IWA M;  3T1H M;  1QVR A;  3GPP A;  1NNJ A;  4DR6 M;  1TH2 A;  2UUB M;  2R45 A;  3IEC A;  2DHY A;  2LVA A;  1D0M A;  4P16 A;  2QBY A;  1MU5 A;  3KDS E;  4LJ6 A;  1JQJ C;  1IN7 A;  1A5T A;  2C99 A;  4KLN A;  3AOE C;  1R2Z A;  4AG5 A;  3SAT A;  3DZD A;  3GPU A;  5FTL A;  4X65 M;  3T1Y M;  1TDH A;  5A2Q S;  1V92 A;  3LW5 F;  2JNH A;  3TE6 A;  1NVM A;  3KSX A;  2JP7 A;  2F5Q A;  3GLH B;  3BBZ A;  1OKS A;  3CF2 A;  3L2A A;  2CV0 A;  1AUA A;  5KO3 A;  3LVV A;  2K0B X;  2QNJ A;  2F5O A;  2B3T A;  3M6A A;  4TUW A;  2DZL A;  2JZ1 A;  3KP0 E;  3R9X B;  2EO2 A;  1HJP A;  1JR3 E;  2I7N A;  2DNA A;  4KOD A;  3A45 A;  3GLF B;  2CRU A;  1EE8 A;  3JR5 A;  2CWB A;  2MJ5 B;  1YSY A;  5EQT A;  3U6P A;  3AV0 A;  2CFO A;  4GIT A;  3GRY A;  1DV0 A;  4GEW A;  1N75 A;  1R2Y A;  3L25 A;  1NNU C;  3AOE A;  1HR0 M;  4MB7 A;  4LZZ A;  1XXH E;  3D8B A;  3VKG A;  4Z8X A;  1GLN A;  1E9R A;  4LJ7 A;  4DR5 M;  4AKI A;  2JY7 A;  2CHV A;  4I4L A;  3FUX A;  4OVZ A;  3SHG B;  3AJI B;  1Y8G A;  4XGI A;  2VDB B;  1TH3 A;  2OPF A;  2FH0 A;  2BNK A;  2L6O A;  4PT5 A;  3RGP A;  3UZU A;  1CUK A;  1XNQ M;  3WHL A;  3E9S A;  2K6B A;  1H6U A;  3FKE A;  4FCT A;  2JZ0 A;  4IBE A;  1VQ1 A;  2Z7J A;  1J5E M;  3F92 A;  4AG6 A;  2KXE A;  4F1I A;  2VII A;  5FSW A;  1QDR A;  3LQQ A;  3FTE A;  3SYL A;  2EA0 A;  3J81 S;  1GJT A;  3FUU A;  3AKZ A;  1N77 A;  1GJS A;  2R4E A;  1HNX M;  1QZE A;  3M0E A;  2ERC A;  4L6V 6;  1L2B A;  1N33 M;  3GP1 A;  3IG5 A;  2RKO A;  5FTM A;  3LCU A;  3M7G A;  2XSZ D;  4MGH A;  3ZCB B;  4L4U A;  3HX3 A;  4GC9 A;  2QQ8 A;  4NXN M;  2HAK A;  5ITX A;  5EP3 A;  5BR8 M;  2MGW A;  2QZ4 A;  1DGH A;  1XC8 A;  2JXN A;  3TWL A;  4LG2 A;  3FE3 A;  1Q39 A;  4MGI E;  4LJ9 A;  1HT1 E;  2LVP C;  1LV7 A;  3K2L A;  1NO1 A;  2QSF X;  1NY5 A;  2DI0 A;  2XFS A;  4D80 A;  4QHS A;  2KNZ A;  2L4F A;  4REZ A;  2Z8Y M;  2DZN B;  1F4I A;  4L8R C;  1IN6 A;  3U61 A;  4FCV A;  1IBM M;  3K8Z A;  4R71 A;  2LNH C;  1G4A E;  5C1B A;  4D82 A;  2OO9 A;  4HLQ A;  3CTW B;  4IBF A;  1OTR A;  4FCW A;  3DFZ A;  5ITT A;  4L15 A;  5ITY A;  5EP4 A;  5LMU M;  2X49 A;  4LF8 M;  4G4Q A;  2WZJ A;  2JUJ A;  4L78 A;  2HKJ A;  4WUR A;  3UK6 A;  3E4R A;  1ZQ9 A;  2UXC M;  4LFB M;  3SMP A;  2Z4S A;  2C9C A;  1ORY B;  2JY5 A;  4BBA A;  3FTD A;  1PJS A;  4DV2 M;  5EP2 A;  2F5P A;  4DR4 M;  1OIP A;  3H4M A;  1QAN A;  4LGM A;  4MGK E;  1Z59 A;  3LCV B;  4ANR A;  2R6F A;  3FUW A;  3GLH E;  2LHC A;  4B7F A;  1SXJ D;  3T6P A;  2DEN A;  3HU3 A;  3KS4 A;  5C18 A;  5EP1 A;  3U6D A;  1WIV A;  1IN4 A;  3B7N A;  4CJ6 A;  4JI6 M;  1IXR C;  4G3O A;  3KSJ A;  4IBI A;  2QCU A;  5EXP A;  3J80 S;  3RE8 A;  2KHH A;  1YE9 A;  2DWL A;  3U60 B;  2CUZ A;  3VLF B;  4AW4 A;  3ZQJ A;  3DA1 A;  3U5Z A;  3QYE A;  4LRT A;  3GPX A;  1DGG A;  3GLG A;  2VQE M;  1XNR M;  3L29 A;  5BPV A;  4IBB A;  5KPR A;  4M0W A;  3AOG A;  4GC5 A;  4DUY M;  2CHG A;  4B3T M;  1HNZ M;  2KNV A;  3PXG A;  1IY0 A;  2EJS A;  2O01 F;  2QPA A;  2YQZ A;  4CIZ A;  4RNA A;  1PJJ A;  4MH0 E;  2JA2 A;  2DAI A;  2D7G A;  4LJA A;  3HHW A;  2E5L M;  2LBC A;  3GLI A;  1NHG C;  1W5S A;  3JAM S;  1D0L A;  2FFJ A;  1WR1 B;  2R0I A;  3HGI A;  3K9O A;  2L4E A;  3UGJ A;  4X64 M;  1EIJ A;  2R65 A;  4G4R A;  3KOX E;  5FLX S;  2N35 A;  1FNN A;  1Q02 A;  2XLJ A;  2C5R A;  4P17 A;  1X37 A;  2LXE A;  1VEJ A;  2RGO A;  2L7I A;  3SC3 A;  5KQ8 A;  2XEP A;  3HZJ A;  4KO8 A;  3RGS A;  4S12 A;  3CF0 A;  1OAO C;  4YY3 M;  1QAM A;  2MR9 A;  3B7Q A;  1J7K A;  3FUT A;  2OOA A;  3SHF A;  1SXJ C;  3HU2 A;  3VK8 A;  1QZM A;  5IT9 S;  4JXJ A;  1GKI A;  4LF6 M;  2V1U A;  2JWS A;  3GLI E;  1IXZ A;  4R7G A;  1D0K A;  2CEA A;  1I4W A;  4LFA M;  2KW0 A;  1Z5C A;  4M9Z A;  1BVS A;  4LJ4 A;  4PDG A;  4DV7 M;  5DFL A;  2MRO B;  3RFW A;  4QNM A;  4NC6 A;  2Y20 A;  3EIH A;  4M9X A;  3T38 A;  4B3S M;  2MH8 A;  2OOB A;  4II7 A;  1NSF A;  4MM3 B;  2DWN A;  4B3M M;  1PJQ A;  1G3I A;  3C58 A;  1VDD A;  4I8O A;  1SXJ B;  1TH4 A;  3GRU A;  4CHT B;  2G8L A;  1UFZ A;  1V33 A;  3CGW A;  4LJ5 A;  4G6Z A;  2R46 A;  4QOZ C;  1PGY A;  4FD2 A;  4NOO B;  3GRV A;  3Q8X A;  4HL4 A;  2ZAM A;  2QEN A;  1TGU A;  1IM2 A;  2APL A;  4MGZ E;  2ZAO A;  3THG A;  4DV6 M;  3QAU A;  4ITQ A;  4RKU F;  1AIP C;  5JI3 E;  2NQ8 C;  2LVN C;  2DVW B;  3NWL A;  5F3W A;  1NHW C;  4JI8 M;  1HQY E;  3TQS A;  4QHT A;  2UXD M;  2HCB A;  2C98 A;  2CP8 A;  3TWK A;  2CHQ A;  5IZ7 D;  1ZMU A;  4AKH A;  4X62 M;  1ZMV A;  4NXM M;  3FRH A;  4LF7 M;  3SMS A;  2O25 A;  1D2N A;  1L2D A;  1RU3 A;  1G71 A;  4IBJ A;  1XMQ M;  3FRI A;  1Z5B A;  4IIW A;  3KS8 A;  1QUT A;  1XXH A;  1IQP A;  2DWZ B;  1I94 M;  4BB9 A;  2RGH A;  1Z5A A;  4JI4 M;  4IBK A;  1K3W A;  3I01 M;  2BWE A;  3LQR A;  1QUS A;  1UM8 A;  4EIW A;  3KW6 A;  4NRW A;  2XZF A;  1C7Y A;  4IJF A;  2DXI A;  3H4J A;  4GIP A;  4X66 M;  1QAQ A;  1PRB A;  1G8P A;  2QHO B;  3U6O A;  3U61 B;  2L7H A;  1NV9 A;  4FVM A;  4JI0 M;  1GL7 A;  4CIS A;  4DR7 M;  1PM5 A;  3LVW A;  3MMP A;  4RF0 A;  3UMM A;  3NBI A;  4NSR A;  2YR0 A;  1SG9 A;  2LTU A;  1E94 E;  3GLH A;  3C3E A;  4PCZ A;  3U6M A;  1WXQ A;  4DV0 M;  2XSZ A;  1K3X A;  2KRU A;  4NRV A;  2FNA A;  3J7B A;  5DYI A;  3K9P A;  5ITX E;  1K82 A;  4OX9 M;  4Z6Y A;  3U6Q A;  2DZO B;  4WP2 A;  3B7Z A;  3A46 A;  2XF3 A;  2LVO C;  5FTJ A;  2KNA A;  4HEO A;  1GAB A;  4Y28 F;  4A3V B;  4JI7 M;  4D81 A;  2CV1 A;  3KOZ E;  5EXS A;  2R4J A;  1KYI A;  1T43 A;  2C9O A;  3HY5 A;  4I5S A;  4W5W A;  5LMN M;  1VDL A;  5JI2 E;  3AL0 C;  1TR8 A;  2Z3X A;  1T6O A;  3SAV A;  3K1J A;  4DBG B;  3GO8 A;  3U6E A;  1R7R A;  1MJG M;  3VKH A;  3ILK A;  3L28 A;  4IBD A;  2CE7 A;  3KP1 E;  3V76 A;  1XB2 B;  2R62 A;  3ZC7 B;  2O5R A;  3CF6 E;  2QBY B;  1IXS B;  2DAG A;  2JY8 A;  3KVW A;  3OTO M;  5ITQ A;  2XFT A;  2FE8 A;  4RF1 A;  2DAK A;  2LWX A;  5FTN A;  3SAW A;  3FYC A;  4LZJ A;  1QQW A;  3L27 A;  4XBO A;  4DV5 M;  1IBK M;  3I04 M;  3HJ8 A;  4LJ8 A;  1IFY A;  2WSE F;  2WSF F;  1MN3 A;  4LRS A;  1QDT A;  4JV5 M;  2F5S A;  3EIE A;  5EXX A;  2L2D A;  3VFD A;  2FS1 A;  3KFU G;  4FWD A;  1IBL M;  3NBX X;  1IY2 A;  2KEB A;  1V34 A;  2Y21 A;  3HWS A;  3B89 A;  3VDU A;  3FUV A;  2ZTC A;  1J09 A;  2VQF M;  2KZU A;  1GO5 A;  1DGH B;  1HQC A;  2GNO A;  1R6B X;  3U5Z B;  3FYD A;  2R44 A;  2GQF A;  4GKK M;  1P3Q Q;  3U60 A;  2KDL A;  3HKP A;  2DHR A;  3KXE C;  5KPT A;  2UU9 M;  2EKF A;  4WW0 A;  2ZAN A;  3BXW A;  1DO0 A;  2DKL A;  2D7E A;  5E26 A;  3TWM A;  5EJC A;  3GQ5 A;  5DNY A;  3E21 A;  4GKJ M;  2HWJ A;  3LMM A;  4GHL A;  1WJ7 A;  4JI1 M;  1XXH B;  4LF4 M;  2ZM6 M;  4GHA A;  5ITU A;  4G4O A;  2HHH M;  4JI5 M;  2I7P A;  1Q3B A;  3FTC A;  4IJE A;  1HT2 E;  3A42 A;  3HHZ A;  3HJS A;  3J2P B;  4AQY M;  2X4A A;  2H1R A;  4MGY E;  3MJ5 A;  1VG5 A;  1R4G A;  1IY1 A;  3U6S A;  1DGB A;  1TF0 B;  2LHG A;  4BLC A;  4XK8 F;  3GRR A;  5KPZ A;  1Q3C A;  1DGF A;  2V6Z M;  4IBC A;  3HHX A;  4LCB A;  4M9S A;  1NV8 A;  4OU7 A;  3QWL A;  4NSO B;  1GVN A;  4JI2 M;  1JR3 A;  1KSF X;  3MK6 A;  4DV1 M;  2FOI C;  3PVS A;  3FTF A;  7CAT A;  3SBJ A;  3U6C A;  2H5X A;  4B3R M;  2AHM A; 
#chains in the Genus database with same CATH homology
 1V92 A;  2JNH A;  4G3O A;  2QHO B;  2EKK A;  2JP7 A;  1NV9 A;  2KHH A;  2ZTD A;  3BBZ A;  1OKS A;  3MMP A;  2K0B X;  2QNJ A;  2B3T A;  1SG9 A;  2DZL A;  2JZ1 A;  1HJP A;  2LTU A;  1E94 E;  1JR3 E;  2KNV A;  1OQY A;  2DNA A;  2EJS A;  3K9P A;  1WGL A;  2BWB A;  1WHC A;  2CWB A;  2MJ5 B;  4WP2 A;  2DAI A;  2LBC A;  2LVO C;  1DV0 A;  2KNA A;  2R0I A;  1WR1 B;  3K9O A;  4GEW A;  4HEO A;  2L4E A;  1T43 A;  1KYI A;  3GLF E;  1Q02 A;  1XXH E;  1VDL A;  5JI2 E;  1VEJ A;  1TR8 A;  1T6O A;  1IXS A;  4DBG B;  2DAE A;  2JY7 A;  2MR9 A;  2OOA A;  1EFU B;  1Y8G A;  1XB2 B;  3GLI E;  2JY6 B;  1CUK A;  2DAG A;  2JY8 A;  2LVQ D;  1ZMW A;  2JZ0 A;  1BVS A;  1G41 A;  1VQ1 A;  2RRU A;  5DFL A;  2MRO B;  3F92 A;  4F1I A;  2DAK A;  3IHP A;  4Q7J A;  2OOB A;  1IFY A;  1MN3 A;  1DO2 A;  1QZE A;  1YLA A;  1G3I A;  2L2D A;  1UFZ A;  2G3Q A;  3B89 A;  1TTE A;  3LCU A;  2ZTC A;  1PGY A;  1GO5 A;  2HAK A;  2MGW A;  1IM2 A;  1OAI A;  1P3Q Q;  3FE3 A;  1HT1 E;  2LVP C;  2EKF A;  1AIP C;  3GLG E;  2QSF X;  2LVN C;  2DI0 A;  1DO0 A;  2DKL A;  2KNZ A;  2L4F A;  1HQY E;  3E21 A;  2HWJ A;  1F4I A;  2CP8 A;  4UN2 B;  1ZV1 A;  1WJ7 A;  4F2L A;  1ZMU A;  4R71 A;  2K9D A;  2DAM A;  1G4A E;  1ZMV A;  2OO9 A;  1OTR A;  3FRH A;  1WGN A;  1HT2 E;  2O25 A;  3E46 A;  1VEG A;  1VEK A;  2WZJ A;  2JUJ A;  3FRI A;  1VG5 A;  1R4G A;  2JY5 A;  2BWE A;  3IEC A;  2DHY A;  2LVA A;  1NV8 A;  3LCV B;  3GLH E;  1A5T A;  3T6P A;  1C7Y A;  2DEN A;  3H4J A;  1WIV A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...