3T1HM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1hM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1hM02
1Q39A 1R2YA 5ITQA 5IT9S 1TDHA 1N33M 3U6QA 1HNXM 1IBMM 4JI2M 4DR2M 1XMOM 1PJJA 1FJGM 1XNRM 2XZFA 4YY3M 2ZBKB 1L1ZA 3JAMS 4DV6M 1XMQM 2UXBM 2OPFA 1NNJA 3GPPA 5FLXS 4MB7A 4X66M 4PCZA 2HKJA 3TWKA 3U6EA 3DOAA 1N34M 4DR7M 4OX9M 3VK7A 4X62M 4PDGA 3SAUA 1HR0M 2UUBM 1EE8A 4YHHM 2HHHM 4B3TM 5ITRA 4LF5M 1K3XA 3GQ4A 3JR4A 3OTOM 4K0KM 1MU5A 4PD2A 1HNZM 1PM5A 3TWMA 5LMNM 3J7AS 4DR1M 1R2ZA 4LF7M 4LF8M 4JI3M 4DV4M 3SATA 3GQ5A 1L2CA 4AQYM 1XC8A 4B3SM 1HNWM 4G4QA 4GKKM 4X65M 2EA0A 3U6DA 2F5OA 1L2DA 1Z59A 4ITQA 4JI5M 4JI6M 5ITYA 3GO8A 3GPXA 4G4OA 3J80S 5LMUM 2VQEM 4DV3M 4DR3M 4NXMM 3GQ3A 1PJIA 4KHPM 4DV2M 2UUCM 3SARA 1L2BA 3VK8A 4JYAM 1IBKM 1IBLM 2VQFM 4B3MM 4DUZM 4X64M 4B3RM 4JI1M 4DR4M 5BR8M 2XZUA 3GPYA 5ITTA 1K82A 1KFVA 4JI4M 4G4RA 4DR5M 2UXDM 4NRVA 4NXNM 1Z5BA 4DV1M 2F5NA 3GPUA 1XNQM 4PDIA 4G4NA 4NRWA 3C58A 4JI7M 3W0FA 3JR5A 2OQ4A 1MX0A 3U6PA 1N36M 1J5EM 1Z5CA 3A42A 4GKJM 2F5QA 5A2QS 4JI8M 2UXCM 3U6LA 4LFCM 2F4VM 3U6OA 3U6SA 3SASA 4LF4M 4DUYM 5ITXA 5ITUA 4LFAM 3J81S 3GP1A 5ITXE 4LF6M 3U6CA 4DV0M 4JV5M 1L1TA 3SAWA 1N32M 4CISA 1Q3BA 1TDZA 2E5LM 4DR6M 2ZM6M 4DV7M 3T1YM 2UUAM 5IWAM 1Q3CA 1K3WA 4LFBM 3A45A 2Q2EB 4LF9M 3U6MA 2F5PA 3TWLA 1I94M 3T1HM 4JI0M 3A46A 3SBJA 2F5SA 2UU9M 4DV5M 1Z5AA 3SAVA
chains in the Genus database with same CATH superfamily
2R45A 4FWDA 4IBKA 4D81A 2D7HA 1V33A 2Z4RA 4QHTA 4JI2M 3GLIA 1XMOM 4EIWA 1FJGM 4IBBA 3UGJA 3TL4X 5DFLA 3AOGA 4YY3M 2LVAA 3JAMS 4DV6M 2RGHA 3D8LA 2DZNB 2I7PA 4FCWA 4LJ6A 1IXRC 2LVNC 3GPPA 3W68A 4MB7A 3U5ZB 5C1BA 1N34M 1E32A 4OX9M 4RNAA 3UJNA 2KRKA 1QDRA 3HU1A 1EE8A 4YHHM 3KFUG 5DNYA 2KDLA 4B3TM 2Z4SA 1VQ1A 4DBGB 1OIZA 1HQYE 3C3DA 4L6V6 3HGIA 1JB0F 1OJLA 1NHGC 2KRUA 2LHCA 3OTOM 3R8FA 3LMMA 4K0KM 1VDDA 2OOBA 1DO2A 4IBIA 3J7AS 2BJWA 2DHYA 2C5RA 1QZMA 1XB2B 3H4MA 1D0LA 1L2CA 4MH0E 3LCVB 4ANRA 4KT0F 4CJ6A 3HY5A 4X65M 2A5YB 2CHGA 2LNHC 2EA0A 3U60A 1IN4A 2H5XA 3SFZA 3GO8A 3SMSA 2QPAA 3GLGB 4DV3M 4DR3M 4NXMM 1QANA 3KP0E 1PJIA 3TQSA 4KHPM 2D7EA 4GIPA 1W5TA 1GLNA 2CWBA 3VKHA 1NSFA 1NVMA 3CF6E 4REZA 5IZ7D 2VQFM 4B3MM 1QUSA 3Q8GA 1GABA 1DGHA 1DGFA 1NHWC 4OU7A 1ZQ9A 5F3WA 5FTKA 4IBDA 4GC9A 3HHXA 2JA2A 2BJVA 1QYRA 1QUTA 2YQZA 4MGHA 3GPYA 4I5SA 2XZUA 3AL0C 2VIIA 3J7BA 1QAQA 2LBCA 2Z7JA 3AV0A 3FUTA 2EKKA 4DV1M 1NV9A 1G3IA 2F5NA 2XF3A 2QENA 3GPUA 2X4AA 4B7HA 2ZTCA 3GLFA 1R6BX 3QWLA 2RKOA 3U6PA 1XXHA 2LHGA 3KW6A 5FTJA 1Z5CA 3A42A 4GKJM 1DGBA 1TTEA 2F5QA 2DZLA 1YSYA 3U6SA 4LJ4A 4LF4M 4IIWA 5ITXA 1SG9A 3HU3A 1YLAA 3I04M 4W5WA 4HLQA 3U6CA 3M7GA 1G59A 4JV5M 3SAWA 1QZEA 3H4JA 2E5LM 1TGUA 3DZDA 1BVSA 3KDSE 4FCTA 2ZM6M 1G8PA 1YUBA 4DV7M 4L4UA 2UUAM 5IWAM 1Q3CA 2J7NA 3HU2A 1XWIA 4II7A 5EP4A 1AUAA 2YR0A 2JZ0A 1UFZA 2R0IA 1QAMA 3ZC7B 1I94M 3LQRA 2HCBA 3DA1A 4JI0M 2F5SA 1HJPA 2UU9M 2LVQD 3AJIB 3C3EA 2DWLA 3SAVA 1L8QA 3RGSA 1IBMM 2C99A 3K2LA 2FNAA 1N78A 2FS1A 2WSEF 4GC5A 1IM2A 2QQ8A 3U61A 3KOWE 2ZTDA 1IN5A 3PNVA 2O01F 3GRYA 4LRTA 4CGYB 2C98A 3E46A 2QBYA 1WIVA 4PCZA 1PJQA 2HKJA 4BBAA 2JY7A 3QAUA 5DYGA 3TWKA 3VLFB 4CHTB 3U6EA 2MROB 4DR7M 2DVWB 3I51A 3L25A 3E4RA 1VEKA 1IXZA 2OO9A 4PT5A 3GLGE 3AFHA 1IXSA 4UN2B 3L29A 2QHOB 2KNZA 1W5SA 3F92A 2HHHM 3B89A 2HL7A 2V1CA 2R46A 3B74A 4LF5M 4NOOB 3HJQA 2CEAA 3GRVA 4IJEA 5KO3A 1SXJA 2XFTA 2C96A 4F2LA 3GQ4A 3JR4A 2KNVA 5FTLA 3FTEA 1IY1A 2XSZD 1KSFX 1LTMA 4RF1A 4AW4A 4PD2A 1IN7A 4HL4A 3HX3A 4DR1M 5KPRA 1PRBA 4IBEA 2KXEA 2G3QA 3AOEC 3VFDA 5EQTA 2DWZB 2DZOB 2X49A 1R2ZA 1ZMUA 2R4JA 1XC8A 3LW5F 4AKIA 2DXIA 2RRUA 1L2DA 2EUCA 3FYDA 4NSRA 5GKNA 4LJ9A 1PGYA 5LMUM 3BOSA 3HHZA 2VQEM 3GLFE 3EIHA 2BWEA 4FVMA 2KW0A 3GQ3A 4LF7M 3I4VA 2VDBB 4Z8XA 1QAOA 3KVWA 1IY2A 4DV2M 1L2BA 3SARA 4JYAM 1KYIA 3BBZA 3IHPA 2L4FA 1G4AE 3Q8XA 2JY5A 4ZPXA 4B3RM 4JI1M 4GEWA 4M0WA 3KXEC 2HWJA 3RE8A 4DR4M 4FWGA 3LCUA 4D80A 4IBGA 1WXQA 5JI2E 3U5ZA 2MGWA 3ZH9B 5ITTA 4IJFA 4TUWA 3WHLA 4G4RA 4DR5M 4P16A 2XFSA 3SHGB 2JUJA 4NXNM 1Z5BA 2AHMA 2J5YA 2JZ1A 4LGMA 2N35A 3T15A 4AG6A 4MGIE 5FTMA 1JR3A 1ZV1A 4GMQA 2DAIA 2ZANA 2DAEA 4G4NA 3U60B 1WHCA 4AZFA 1K3XA 4JI8M 2R44A 2V1UA 3U6LA 1WR1B 2GQFA 3FTCA 2RGOA 3HHWA 1JR3D 5KQDA 2R18A 1GJTA 1NJGA 3W0LB 2LVPC 3B7ZA 2WZJA 3GLHA 3NBXX 3UZUA 2KZUA 1DGHB 2EO2A 4MGYE 4I8OA 1NJFA 1R5LA 2KHHA 1DO0A 3J27B 5BPVA 3L2AA 3K92A 1TDZA 3KS8A 4DR6M 2G5GX 2R65A 4IBFA 4LCBA 4G3OA 2DWNA 3T1YM 4LG2A 2FOIC 2WSCF 1IN6A 3KOYE 4A3VB 1GVNA 3ILKA 4LFBM 3A45A 4B7FA 1E9RA 2DNAA 2JY6B 3LQQA 1XHBA 2MR9A 4L15A 4DV5M 1OFHA 1Z5AA 4Y28F 1PM5A 3GLFB 1Q39A 1S3SA 5ITQA 1R2YA 1AIPC 2CV0A 2FE8A 1XXHB 1OAOC 4D82A 1G71A 3VDUA 4AI6A 5EXTA 3HJSA 1XNRM 3DFZA 4KODA 2ZBKB 3GLIE 1QQWA 4XK8F 1L1ZA 3B9PA 3TPZA 4FCVA 1VG5A 1XMQM 4AKGA 2CHQA 2QSFX 2UXBM 2OPFA 4KLNA 2KA6B 1VEJA 2G8LA 2GNOA 2BNKA 3GRRA 4X66M 4I81A 1IY0A 3FD9A 4FD2A 3DOAA 4MGKE 3HKPA 1TH3A 2R6FA 3FKEA 4X62M 2JP7A 1YE9A 3SAUA 1V92A 1OAIA 8CATA 1TR8A 3K9PA 2VF7A 3K8ZA 1Y8GA 4M9SA 2CV2A 4L16A 3SYKA 4NSOB 1HQCA 1MU5A 1VDLA 4QNMA 3TWMA 2B3TA 2CRUA 4OVZB 1F4IA 3GRUA 2L4EA 1TF0B 3FUWA 4JI3M 4Z6YA 3RFWA 4DV4M 3HZJA 3THGA 2Z3XA 1IQPA 2CE7A 3K1JA 2BWBA 1R7RA 4AQYM 4WP2A 4XGIA 5EP2A 3U61B 1HNWM 4GKKM 4LZZA 3KOXE 2I7NA 2O25A 4NC6A 4ITQA 3B7NA 4JI5M 1Z6TA 2K9DA 4JI6M 1WGLA 2C9OA 2DAKA 5ITYA 2QBYB 1C7YA 4G4OA 3J80S 2DWMA 4BLCA 4RKUF 1T3TA 3M6AA 1HT2E 4GITA 4M9ZA 4G6ZA 1IXSB 2UUCM 3I01M 4QOZC 1IBKM 1IBLM 5L8RF 2MH8A 4X64M 3FUVA 4GH9A 2R62A 3T6PA 4R71A 2R4EA 4LJAA 2L2DA 4MM3B 4LRSA 3FUXA 3L27A 4IBCA 2DENA 1J7KA 1GKIA 1ZAEA 3QYBA 4QOSA 4P17A 2D7GA 1TH2A 2XEPA 3IECA 3VKGA 3GLIB 4AKHA 1LV7A 4FWHA 4CIZA 2DAMA 2UXDM 1EFUB 1P3QQ 1SXJD 4NRVA 5JI3E 1T6OA 3PNYA 1N77A 4M9XA 3I4YA 4PDIA 2O5RA 5KPTA 4LZJA 1MN3A 2OQ4A 1MX0A 1J5EM 2QZ4A 3WHKA 5EXSA 3PXGA 5A2QS 2DHRA 1XXHE 2LH0A 5EJCA 5KQ8A 2UXCM 2M60A 2W82A 1ZMVA 1H6UA 3SASA 3V76A 1HT1E 5ITUA 1DV0A 5ITXE 1D2NA 4LF6M 1NY5A 2C9CA 2JNHA 1EIJA 1N32M 1NO1A 4CISA 1Q3BA 1UM8A 3QYEA 3HHYA 3W67A 3TE6A 3FTFA 3CF0A 4L78A 2NQ8C 2YFQA 1CUKA 5EXXA 1X37A 3A98B 3CGWA 2Q2EB 2LWXA 5E6JA 3U6MA 2Y0QA 4Q7JA 1D0KA 4S12A 3NBIA 3HWSA 1OQYA 3T1HM 3A46A 3SBJA 2JWSA 5C18A 4JXJA 5IT9S 2Z8YM 3UMMA 1GJSA 1TDHA 2Y20A 3KSXA 3U6QA 1HNXM 1N33M 1ORYB 1I4WA 1ZMWA 3FUUA 4DR2M 2YNMD 1Q02A 1PJJA 3R9XB 2XZFA 1OTRA 2XLJA 1FNNA 3PVSA 4OW0A 4IBJA 4KO8A 2KEBA 3E9SA 3SHFA 2CV1A 3GLHB 2K6BA 4GHAA 1NNJA 5FLXS 3FE3A 3D8BA 2K47A 4LJ7A 5DYIA 2KZSA 3GLGA 2CUZA 2J7OA 2ZAMA 3SC3A 3RGPA 1QVRA 1IN8A 3E21A 3VK7A 3L28A 3NWLA 4PDGA 1NY6A 2JY8A 1HR0M 4LGYA 2UUBM 3EIEA 5IREB 2L7HA 3KS4A 3AKZA 1GL7A 1E94E 3MK6A 5EP3A 1WJ7A 1SXJC 3SMPA 2XGNA 5ITRA 3ZQJA 3BXWA 7CATA 4M0DA 2L6OA 3CTWB 3T38A 1IFYA 1HNZM 1SXJE 3KOZE 2DKLA 4WURA 5LMNM 1NNUC 1T43A 1R4GA 4R7GA 4LF8M 3K9OA 2K0BX 3HJ8A 3KSJA 3SATA 4GHLA 3GQ5A 1J09A 2LVOC 4LJ8A 3AOEA 4B3SM 5FTNA 4QNRA 4G4QA 2CFOA 2CHVA 5E26A 3U6DA 2VF8A 4BB9A 1Z59A 2ZAOA 2F5OA 1E9SA 4I4LA 3B7QA 4JN6A 2L09A 3GPXA 4AG5A 2APLA 3CF2A 1QDTA 1C1KA 2QCUA 4HEOA 2HAKA 2LTUA 3SYLA 2MJ5B 4R3DA 5FSWA 3VK8A 4LJ5A 5EXPA 1G41A 4B08A 4DUZM 4GRIA 3J2PB 3L26A 1GO5A 5EP1A 2V6ZM 1DGGA 4B7GA 2FFJA 5BR8M 1PJTA 1K82A 1GL6A 1KFVA 3M0EA 2X8AA 2Y21A 4JI4M 3FTDA 2M5ZA 1A5TA 1NV8A 3MJ5A 2L7IA 1V34A 3MHVC 4XBOA 1RU3A 2FH0A 1XNQM 1OKSA 4NL4H 4NRWA 3C58A 1JR3E 1WGNA 2LXEA 3W0FA 3JR5A 2OOAA 4JI7M 1N36M 3FRIA 1N75A 4OVZA 4LFCM 2F4VM 3C9PA 3U6OA 4DUYM 4LFAM 3MMPA 4LY6A 2H1RA 2JXNA 2CP8A 2P5TA 3J81S 3GP1A 3LVWA 4DV0M 1SXJB 3KP1E 5KPZA 1L1TA 3GLHE 2EKFA 1VEGA 1OFIA 3IG8A 2QP9X 3IG5A 3LVVA 2DI0A 4F1IA 4L8RC 1JQJC 4FW9A 2EJSA 1K3WA 2XSZA 3FRHA 1MJGM 4LF9M 2QNJA 2F5PA 4QHSA 1D0MA 4WW0A 1OIPA 1TH4A 3TWLA 2ERCA 2Y0TA 3PFIA 3ZCBB 1PJSA 3UK6A 3FYCA 2KNAA 3VDPA 2WSFF 5H37D 2XH9A 4MGZE 2DAGA 4RF0A
chains in the Genus database with same CATH topology
2R45A 4FWDA 4IBKA 4D81A 2D7HA 2Z4RA 4QHTA 4JI2M 3GLIA 1XMOM 4EIWA 2XH9A 4IBBA 3UGJA 3TL4X 1FJGM 3AOGA 4YY3M 3JAMS 4DV6M 2RGHA 3D8LA 2DZNB 2I7PA 4FCWA 4LJ6A 1IXRC 3GPPA 4MB7A 3U5ZB 5C1BA 1N34M 1E32A 4OX9M 4RNAA 3UJNA 2KRKA 3HU1A 1EE8A 4YHHM 3KFUG 5DNYA 4B3TM 2Z4SA 1HQYE 3HGIA 1OJLA 2KRUA 1NHGC 3OTOM 3R8FA 3LMMA 4K0KM 1VDDA 1DO2A 4IBIA 3J7AS 2BJWA 2C5RA 1QZMA 3H4MA 1L2CA 4MH0E 4X65M 2EA0A 2A5YB 2CHGA 2LNHC 3U60A 1IN4A 3SFZA 3GO8A 3SMSA 2QPAA 3GLGB 4DV3M 4DR3M 4NXMM 1QANA 3KP0E 1PJIA 3TQSA 4KHPM 2D7EA 4GIPA 1W5TA 1GLNA 3VKHA 1NSFA 1NVMA 3CF6E 4REZA 5IZ7D 2VQFM 4B3MM 1DGHA 1DGFA 1NHWC 4OU7A 1ZQ9A 5F3WA 5FTKA 4IBDA 4GC9A 3HHXA 2JA2A 2BJVA 1QYRA 2YQZA 4MGHA 3GPYA 4I5SA 2XZUA 3AL0C 2VIIA 3J7BA 1QAQA 2Z7JA 3AV0A 3FUTA 4DV1M 1G3IA 2F5NA 2XF3A 2QENA 3GPUA 2X4AA 4B7HA 3GLFA 1R6BX 3QWLA 2RKOA 3U6PA 1XXHA 3KW6A 5FTJA 1Z5CA 3A42A 4GKJM 1DGBA 2F5QA 1YSYA 3U6SA 4LJ4A 4LF4M 4IIWA 5ITXA 4W5WA 4HLQA 3U6CA 3M7GA 1G59A 4JV5M 3SAWA 2E5LM 1TGUA 3DZDA 3KDSE 4FCTA 2ZM6M 1G8PA 1YUBA 4DV7M 4L4UA 2UUAM 5IWAM 1Q3CA 2J7NA 3HU2A 1XWIA 4II7A 5EP4A 2YR0A 1QAMA 3ZC7B 1I94M 3LQRA 2HCBA 3DA1A 4JI0M 2F5SA 2UU9M 3AJIB 2DWLA 3SAVA 1L8QA 3RGSA 1IBMM 2C99A 3K2LA 2FNAA 1N78A 4GC5A 1IM2A 3U61A 3KOWE 1IN5A 3PNVA 3GRYA 4LRTA 4CGYB 2C98A 2QBYA 4PCZA 4BBAA 2HKJA 3QAUA 5DYGA 3TWKA 3VLFB 4CHTB 3U6EA 4DR7M 3L25A 3I51A 2DVWB 3E4RA 1IXZA 4PT5A 3AFHA 3L29A 1W5SA 2HHHM 2HL7A 2V1CA 2R46A 4LF5M 4NOOB 3HJQA 2CEAA 3GRVA 4IJEA 5KO3A 1SXJA 2XFTA 2C96A 3GQ4A 3JR4A 3FTEA 5FTLA 1IY1A 2XSZD 1KSFX 4PD2A 4RF1A 4AW4A 1IN7A 4HL4A 4DR1M 1R2ZA 5KPRA 4LF7M 4IBEA 2KXEA 3VFDA 3AOEC 5EQTA 2DWZB 2DZOB 2X49A 2R4JA 1XC8A 4AKIA 2DXIA 1L2DA 2EUCA 3FYDA 4NSRA 5GKNA 4LJ9A 5LMUM 3BOSA 3HHZA 2VQEM 3EIHA 4FVMA 2KW0A 3GQ3A 3I4VA 4Z8XA 4DV2M 1QAOA 3KVWA 1IY2A 1L2BA 3SARA 4JYAM 1KYIA 3Q8XA 1G4AE 4B3RM 4ZPXA 4JI1M 4M0WA 3KXEC 3RE8A 4DR4M 4FWGA 3U5ZA 4D80A 4IBGA 1WXQA 5JI2E 3ZH9B 5ITTA 4IJFA 4TUWA 3WHLA 4G4RA 4DR5M 4P16A 2XFSA 3SHGB 4NXNM 1Z5BA 2AHMA 4LGMA 3T15A 4AG6A 4MGIE 5FTMA 1JR3A 4GMQA 3U60B 2ZANA 4G4NA 4AZFA 1K3XA 4JI8M 2V1UA 3U6LA 3FTCA 2RGOA 3HHWA 1JR3D 5KQDA 2R18A 3W0LB 1NJGA 3GLHA 3UZUA 2KZUA 1DGHB 2EO2A 4MGYE 4I8OA 1NJFA 3J27B 4DR6M 1DO0A 5BPVA 1TDZA 3L2AA 3K92A 3KS8A 2G5GX 2R65A 4IBFA 4LCBA 2DWNA 4LG2A 3T1YM 2FOIC 1IN6A 3KOYE 4A3VB 1GVNA 3ILKA 4LFBM 3A45A 4B7FA 1E9RA 3LQQA 1XHBA 4L15A 4DV5M 1OFHA 1Z5AA 1PM5A 3GLFB 1Q39A 1S3SA 5ITQA 1R2YA 2CV0A 2FE8A 1XXHB 4D82A 3VDUA 5EXTA 3HJSA 1XNRM 3DFZA 4KODA 2ZBKB 1QQWA 1L1ZA 3B9PA 3TPZA 4FCVA 4AKGA 1XMQM 2CHQA 2UXBM 2OPFA 4KLNA 2KA6B 2G8LA 2BNKA 3GRRA 4X66M 4I81A 1IY0A 3FD9A 4FD2A 3DOAA 4MGKE 3HKPA 1TH3A 3FKEA 4X62M 3SAUA 1YE9A 8CATA 3K8ZA 4M9SA 2CV2A 4L16A 3SYKA 4NSOB 1HQCA 1MU5A 4QNMA 3TWMA 4OVZB 3GRUA 3FUWA 4JI3M 4Z6YA 3RFWA 4DV4M 2Z3XA 3THGA 1IQPA 2CE7A 3K1JA 4AQYM 1R7RA 4XGIA 5EP2A 3U61B 1HNWM 4GKKM 4LZZA 3KOXE 2I7NA 4ITQA 4JI5M 1Z6TA 4JI6M 2C9OA 5ITYA 2QBYB 4G4OA 3J80S 2DWMA 4BLCA 1T3TA 3M6AA 1HT2E 4GITA 4M9ZA 4G6ZA 1IXSB 2UUCM 4QOZC 1IBKM 1IBLM 4X64M 3FUVA 4GH9A 2R62A 2R4EA 4LJAA 4MM3B 4LRSA 3FUXA 3L27A 4IBCA 1J7KA 1GKIA 1ZAEA 4QOSA 2D7GA 1TH2A 2XEPA 3VKGA 3GLIB 4AKHA 1LV7A 4FWHA 2UXDM 4NRVA 1SXJD 5JI3E 3PNYA 1N77A 4M9XA 3I4YA 4PDIA 2O5RA 5KPTA 4LZJA 2OQ4A 1MX0A 1J5EM 2QZ4A 3WHKA 5EXSA 3PXGA 5A2QS 2DHRA 2LH0A 5EJCA 5KQ8A 2UXCM 2M60A 2W82A 3SASA 1H6UA 1HT1E 5ITUA 5ITXE 1D2NA 4LF6M 1NY5A 2C9CA 1N32M 4CISA 1Q3BA 1UM8A 3HHYA 3TE6A 3FTFA 3CF0A 4L78A 2NQ8C 2YFQA 5EXXA 1X37A 3A98B 2Q2EB 2LWXA 5E6JA 3U6MA 2Y0QA 4S12A 3NBIA 3HWSA 3T1HM 3A46A 3SBJA 5C18A 4JXJA 5IT9S 3UMMA 1TDHA 2Y20A 3KSXA 3U6QA 1HNXM 1N33M 1ORYB 1I4WA 3FUUA 4DR2M 2YNMD 1PJJA 3R9XB 2XZFA 2XLJA 1FNNA 3PVSA 4OW0A 4IBJA 4KO8A 2KEBA 3E9SA 3SHFA 2CV1A 3GLHB 4GHAA 1NNJA 5FLXS 3D8BA 2K47A 4LJ7A 5DYIA 2KZSA 3GLGA 2CUZA 2J7OA 2ZAMA 3SC3A 3RGPA 1QVRA 1IN8A 3VK7A 3L28A 3NWLA 4PDGA 1NY6A 1HR0M 2UUBM 4LGYA 4AI6A 3EIEA 5IREB 2L7HA 3KS4A 3AKZA 1GL7A 1E94E 3MK6A 5EP3A 3SMPA 1SXJC 2XGNA 5ITRA 7CATA 4M0DA 2L6OA 3CTWB 3T38A 1HNZM 1SXJE 3KOZE 4WURA 5LMNM 1NNUC 4R7GA 4LF8M 3KSJA 3HJ8A 3SATA 4GHLA 3GQ5A 1J09A 4LJ8A 3AOEA 4B3SM 5FTNA 4QNRA 4G4QA 2CFOA 2CHVA 5E26A 3U6DA 2F5OA 4BB9A 1Z59A 2ZAOA 1E9SA 4I4LA 4JN6A 2L09A 3GPXA 4AG5A 3CF2A 1C1KA 2QCUA 3SYLA 4R3DA 5FSWA 3VK8A 4LJ5A 5EXPA 1G41A 4B08A 4DUZM 4GRIA 3J2PB 3L26A 5EP1A 2V6ZM 1DGGA 4B7GA 2FFJA 5BR8M 1K82A 1GL6A 1KFVA 3M0EA 2X8AA 2Y21A 4JI4M 3FTDA 2M5ZA 3MJ5A 2L7IA 3MHVC 4XBOA 1XNQM 4NL4H 4NRWA 3C58A 2LXEA 3W0FA 4JI7M 3JR5A 1N36M 1N75A 4OVZA 4LFCM 2F4VM 3U6OA 4DUYM 4LFAM 4LY6A 3J81S 2H1RA 3GP1A 2P5TA 4DV0M 3LVWA 1SXJB 3KP1E 5KPZA 1L1TA 1OFIA 3IG8A 2QP9X 3IG5A 3LVVA 4L8RC 1JQJC 4FW9A 1K3WA 2XSZA 4LF9M 2F5PA 4QHSA 4WW0A 1TH4A 3TWLA 2ERCA 2Y0TA 3PFIA 3ZCBB 3UK6A 3VDPA 3FYCA 5H37D 3HU3A 4MGZE 4RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q39 A;  1R2Y A;  5ITQ A;  5IT9 S;  1TDH A;  1N33 M;  3U6Q A;  1HNX M;  1IBM M;  4JI2 M;  4DR2 M;  1XMO M;  1PJJ A;  1FJG M;  1XNR M;  2XZF A;  4YY3 M;  2ZBK B;  1L1Z A;  3JAM S;  4DV6 M;  1XMQ M;  2UXB M;  2OPF A;  1NNJ A;  3GPP A;  5FLX S;  4MB7 A;  4X66 M;  4PCZ A;  2HKJ A;  3TWK A;  3U6E A;  3DOA A;  1N34 M;  4DR7 M;  4OX9 M;  3VK7 A;  4X62 M;  4PDG A;  3SAU A;  1HR0 M;  2UUB M;  1EE8 A;  4YHH M;  2HHH M;  4B3T M;  5ITR A;  4LF5 M;  1K3X A;  3GQ4 A;  3JR4 A;  3OTO M;  4K0K M;  1MU5 A;  4PD2 A;  1HNZ M;  1PM5 A;  3TWM A;  5LMN M;  3J7A S;  4DR1 M;  1R2Z A;  4LF7 M;  4LF8 M;  4JI3 M;  4DV4 M;  3SAT A;  3GQ5 A;  1L2C A;  4AQY M;  1XC8 A;  4B3S M;  1HNW M;  4G4Q A;  4GKK M;  4X65 M;  2EA0 A;  3U6D A;  2F5O A;  1L2D A;  1Z59 A;  4ITQ A;  4JI5 M;  4JI6 M;  5ITY A;  3GO8 A;  3GPX A;  4G4O A;  3J80 S;  5LMU M;  2VQE M;  4DV3 M;  4DR3 M;  4NXM M;  3GQ3 A;  1PJI A;  4KHP M;  4DV2 M;  2UUC M;  3SAR A;  1L2B A;  3VK8 A;  4JYA M;  1IBK M;  1IBL M;  2VQF M;  4B3M M;  4DUZ M;  4X64 M;  4B3R M;  4JI1 M;  4DR4 M;  5BR8 M;  2XZU A;  3GPY A;  5ITT A;  1K82 A;  1KFV A;  4JI4 M;  4G4R A;  4DR5 M;  2UXD M;  4NRV A;  4NXN M;  1Z5B A;  4DV1 M;  2F5N A;  3GPU A;  1XNQ M;  4PDI A;  4G4N A;  4NRW A;  3C58 A;  4JI7 M;  3W0F A;  3JR5 A;  2OQ4 A;  1MX0 A;  3U6P A;  1N36 M;  1J5E M;  1Z5C A;  3A42 A;  4GKJ M;  2F5Q A;  5A2Q S;  4JI8 M;  2UXC M;  3U6L A;  4LFC M;  2F4V M;  3U6O A;  3U6S A;  3SAS A;  4LF4 M;  4DUY M;  5ITX A;  5ITU A;  4LFA M;  3J81 S;  3GP1 A;  5ITX E;  4LF6 M;  3U6C A;  4DV0 M;  4JV5 M;  1L1T A;  3SAW A;  1N32 M;  4CIS A;  1Q3B A;  1TDZ A;  2E5L M;  4DR6 M;  2ZM6 M;  4DV7 M;  3T1Y M;  2UUA M;  5IWA M;  1Q3C A;  1K3W A;  4LFB M;  3A45 A;  2Q2E B;  4LF9 M;  3U6M A;  2F5P A;  3TWL A;  1I94 M;  3T1H M;  4JI0 M;  3A46 A;  3SBJ A;  2F5S A;  2UU9 M;  4DV5 M;  1Z5A A;  3SAV A; 
#chains in the Genus database with same CATH topology
 2R45 A;  4FWD A;  4IBK A;  4D81 A;  2D7H A;  1V33 A;  2Z4R A;  4QHT A;  4JI2 M;  3GLI A;  1XMO M;  4EIW A;  1FJG M;  4IBB A;  3UGJ A;  3TL4 X;  5DFL A;  3AOG A;  4YY3 M;  2LVA A;  3JAM S;  4DV6 M;  2RGH A;  3D8L A;  2DZN B;  2I7P A;  4FCW A;  4LJ6 A;  1IXR C;  2LVN C;  3GPP A;  3W68 A;  4MB7 A;  3U5Z B;  5C1B A;  1N34 M;  1E32 A;  4OX9 M;  4RNA A;  3UJN A;  2KRK A;  1QDR A;  3HU1 A;  1EE8 A;  4YHH M;  3KFU G;  5DNY A;  2KDL A;  4B3T M;  2Z4S A;  1VQ1 A;  4DBG B;  1OIZ A;  1HQY E;  3C3D A;  4L6V 6;  3HGI A;  1JB0 F;  1OJL A;  1NHG C;  2KRU A;  2LHC A;  3OTO M;  3R8F A;  3LMM A;  4K0K M;  1VDD A;  2OOB A;  1DO2 A;  4IBI A;  3J7A S;  2BJW A;  2DHY A;  2C5R A;  1QZM A;  1XB2 B;  3H4M A;  1D0L A;  1L2C A;  4MH0 E;  3LCV B;  4ANR A;  4KT0 F;  4CJ6 A;  3HY5 A;  4X65 M;  2A5Y B;  2CHG A;  2LNH C;  2EA0 A;  3U60 A;  1IN4 A;  2H5X A;  3SFZ A;  3GO8 A;  3SMS A;  2QPA A;  3GLG B;  4DV3 M;  4DR3 M;  4NXM M;  1QAN A;  3KP0 E;  1PJI A;  3TQS A;  4KHP M;  2D7E A;  4GIP A;  1W5T A;  1GLN A;  2CWB A;  3VKH A;  1NSF A;  1NVM A;  3CF6 E;  4REZ A;  5IZ7 D;  2VQF M;  4B3M M;  1QUS A;  3Q8G A;  1GAB A;  1DGH A;  1DGF A;  1NHW C;  4OU7 A;  1ZQ9 A;  5F3W A;  5FTK A;  4IBD A;  4GC9 A;  3HHX A;  2JA2 A;  2BJV A;  1QYR A;  1QUT A;  2YQZ A;  4MGH A;  3GPY A;  4I5S A;  2XZU A;  3AL0 C;  2VII A;  3J7B A;  1QAQ A;  2LBC A;  2Z7J A;  3AV0 A;  3FUT A;  2EKK A;  4DV1 M;  1NV9 A;  1G3I A;  2F5N A;  2XF3 A;  2QEN A;  3GPU A;  2X4A A;  4B7H A;  2ZTC A;  3GLF A;  1R6B X;  3QWL A;  2RKO A;  3U6P A;  1XXH A;  2LHG A;  3KW6 A;  5FTJ A;  1Z5C A;  3A42 A;  4GKJ M;  1DGB A;  1TTE A;  2F5Q A;  2DZL A;  1YSY A;  3U6S A;  4LJ4 A;  4LF4 M;  4IIW A;  5ITX A;  1SG9 A;  3HU3 A;  1YLA A;  3I04 M;  4W5W A;  4HLQ A;  3U6C A;  3M7G A;  1G59 A;  4JV5 M;  3SAW A;  1QZE A;  3H4J A;  2E5L M;  1TGU A;  3DZD A;  1BVS A;  3KDS E;  4FCT A;  2ZM6 M;  1G8P A;  1YUB A;  4DV7 M;  4L4U A;  2UUA M;  5IWA M;  1Q3C A;  2J7N A;  3HU2 A;  1XWI A;  4II7 A;  5EP4 A;  1AUA A;  2YR0 A;  2JZ0 A;  1UFZ A;  2R0I A;  1QAM A;  3ZC7 B;  1I94 M;  3LQR A;  2HCB A;  3DA1 A;  4JI0 M;  2F5S A;  1HJP A;  2UU9 M;  2LVQ D;  3AJI B;  3C3E A;  2DWL A;  3SAV A;  1L8Q A;  3RGS A;  1IBM M;  2C99 A;  3K2L A;  2FNA A;  1N78 A;  2FS1 A;  2WSE F;  4GC5 A;  1IM2 A;  2QQ8 A;  3U61 A;  3KOW E;  2ZTD A;  1IN5 A;  3PNV A;  2O01 F;  3GRY A;  4LRT A;  4CGY B;  2C98 A;  3E46 A;  2QBY A;  1WIV A;  4PCZ A;  1PJQ A;  2HKJ A;  4BBA A;  2JY7 A;  3QAU A;  5DYG A;  3TWK A;  3VLF B;  4CHT B;  3U6E A;  2MRO B;  4DR7 M;  2DVW B;  3I51 A;  3L25 A;  3E4R A;  1VEK A;  1IXZ A;  2OO9 A;  4PT5 A;  3GLG E;  3AFH A;  1IXS A;  4UN2 B;  3L29 A;  2QHO B;  2KNZ A;  1W5S A;  3F92 A;  2HHH M;  3B89 A;  2HL7 A;  2V1C A;  2R46 A;  3B74 A;  4LF5 M;  4NOO B;  3HJQ A;  2CEA A;  3GRV A;  4IJE A;  5KO3 A;  1SXJ A;  2XFT A;  2C96 A;  4F2L A;  3GQ4 A;  3JR4 A;  2KNV A;  5FTL A;  3FTE A;  1IY1 A;  2XSZ D;  1KSF X;  1LTM A;  4RF1 A;  4AW4 A;  4PD2 A;  1IN7 A;  4HL4 A;  3HX3 A;  4DR1 M;  5KPR A;  1PRB A;  4IBE A;  2KXE A;  2G3Q A;  3AOE C;  3VFD A;  5EQT A;  2DWZ B;  2DZO B;  2X49 A;  1R2Z A;  1ZMU A;  2R4J A;  1XC8 A;  3LW5 F;  4AKI A;  2DXI A;  2RRU A;  1L2D A;  2EUC A;  3FYD A;  4NSR A;  5GKN A;  4LJ9 A;  1PGY A;  5LMU M;  3BOS A;  3HHZ A;  2VQE M;  3GLF E;  3EIH A;  2BWE A;  4FVM A;  2KW0 A;  3GQ3 A;  4LF7 M;  3I4V A;  2VDB B;  4Z8X A;  1QAO A;  3KVW A;  1IY2 A;  4DV2 M;  1L2B A;  3SAR A;  4JYA M;  1KYI A;  3BBZ A;  3IHP A;  2L4F A;  1G4A E;  3Q8X A;  2JY5 A;  4ZPX A;  4B3R M;  4JI1 M;  4GEW A;  4M0W A;  3KXE C;  2HWJ A;  3RE8 A;  4DR4 M;  4FWG A;  3LCU A;  4D80 A;  4IBG A;  1WXQ A;  5JI2 E;  3U5Z A;  2MGW A;  3ZH9 B;  5ITT A;  4IJF A;  4TUW A;  3WHL A;  4G4R A;  4DR5 M;  4P16 A;  2XFS A;  3SHG B;  2JUJ A;  4NXN M;  1Z5B A;  2AHM A;  2J5Y A;  2JZ1 A;  4LGM A;  2N35 A;  3T15 A;  4AG6 A;  4MGI E;  5FTM A;  1JR3 A;  1ZV1 A;  4GMQ A;  2DAI A;  2ZAN A;  2DAE A;  4G4N A;  3U60 B;  1WHC A;  4AZF A;  1K3X A;  4JI8 M;  2R44 A;  2V1U A;  3U6L A;  1WR1 B;  2GQF A;  3FTC A;  2RGO A;  3HHW A;  1JR3 D;  5KQD A;  2R18 A;  1GJT A;  1NJG A;  3W0L B;  2LVP C;  3B7Z A;  2WZJ A;  3GLH A;  3NBX X;  3UZU A;  2KZU A;  1DGH B;  2EO2 A;  4MGY E;  4I8O A;  1NJF A;  1R5L A;  2KHH A;  1DO0 A;  3J27 B;  5BPV A;  3L2A A;  3K92 A;  1TDZ A;  3KS8 A;  4DR6 M;  2G5G X;  2R65 A;  4IBF A;  4LCB A;  4G3O A;  2DWN A;  3T1Y M;  4LG2 A;  2FOI C;  2WSC F;  1IN6 A;  3KOY E;  4A3V B;  1GVN A;  3ILK A;  4LFB M;  3A45 A;  4B7F A;  1E9R A;  2DNA A;  2JY6 B;  3LQQ A;  1XHB A;  2MR9 A;  4L15 A;  4DV5 M;  1OFH A;  1Z5A A;  4Y28 F;  1PM5 A;  3GLF B;  1Q39 A;  1S3S A;  5ITQ A;  1R2Y A;  1AIP C;  2CV0 A;  2FE8 A;  1XXH B;  1OAO C;  4D82 A;  1G71 A;  3VDU A;  4AI6 A;  5EXT A;  3HJS A;  1XNR M;  3DFZ A;  4KOD A;  2ZBK B;  3GLI E;  1QQW A;  4XK8 F;  1L1Z A;  3B9P A;  3TPZ A;  4FCV A;  1VG5 A;  1XMQ M;  4AKG A;  2CHQ A;  2QSF X;  2UXB M;  2OPF A;  4KLN A;  2KA6 B;  1VEJ A;  2G8L A;  2GNO A;  2BNK A;  3GRR A;  4X66 M;  4I81 A;  1IY0 A;  3FD9 A;  4FD2 A;  3DOA A;  4MGK E;  3HKP A;  1TH3 A;  2R6F A;  3FKE A;  4X62 M;  2JP7 A;  1YE9 A;  3SAU A;  1V92 A;  1OAI A;  8CAT A;  1TR8 A;  3K9P A;  2VF7 A;  3K8Z A;  1Y8G A;  4M9S A;  2CV2 A;  4L16 A;  3SYK A;  4NSO B;  1HQC A;  1MU5 A;  1VDL A;  4QNM A;  3TWM A;  2B3T A;  2CRU A;  4OVZ B;  1F4I A;  3GRU A;  2L4E A;  1TF0 B;  3FUW A;  4JI3 M;  4Z6Y A;  3RFW A;  4DV4 M;  3HZJ A;  3THG A;  2Z3X A;  1IQP A;  2CE7 A;  3K1J A;  2BWB A;  1R7R A;  4AQY M;  4WP2 A;  4XGI A;  5EP2 A;  3U61 B;  1HNW M;  4GKK M;  4LZZ A;  3KOX E;  2I7N A;  2O25 A;  4NC6 A;  4ITQ A;  3B7N A;  4JI5 M;  1Z6T A;  2K9D A;  4JI6 M;  1WGL A;  2C9O A;  2DAK A;  5ITY A;  2QBY B;  1C7Y A;  4G4O A;  3J80 S;  2DWM A;  4BLC A;  4RKU F;  1T3T A;  3M6A A;  1HT2 E;  4GIT A;  4M9Z A;  4G6Z A;  1IXS B;  2UUC M;  3I01 M;  4QOZ C;  1IBK M;  1IBL M;  5L8R F;  2MH8 A;  4X64 M;  3FUV A;  4GH9 A;  2R62 A;  3T6P A;  4R71 A;  2R4E A;  4LJA A;  2L2D A;  4MM3 B;  4LRS A;  3FUX A;  3L27 A;  4IBC A;  2DEN A;  1J7K A;  1GKI A;  1ZAE A;  3QYB A;  4QOS A;  4P17 A;  2D7G A;  1TH2 A;  2XEP A;  3IEC A;  3VKG A;  3GLI B;  4AKH A;  1LV7 A;  4FWH A;  4CIZ A;  2DAM A;  2UXD M;  1EFU B;  1P3Q Q;  1SXJ D;  4NRV A;  5JI3 E;  1T6O A;  3PNY A;  1N77 A;  4M9X A;  3I4Y A;  4PDI A;  2O5R A;  5KPT A;  4LZJ A;  1MN3 A;  2OQ4 A;  1MX0 A;  1J5E M;  2QZ4 A;  3WHK A;  5EXS A;  3PXG A;  5A2Q S;  2DHR A;  1XXH E;  2LH0 A;  5EJC A;  5KQ8 A;  2UXC M;  2M60 A;  2W82 A;  1ZMV A;  1H6U A;  3SAS A;  3V76 A;  1HT1 E;  5ITU A;  1DV0 A;  5ITX E;  1D2N A;  4LF6 M;  1NY5 A;  2C9C A;  2JNH A;  1EIJ A;  1N32 M;  1NO1 A;  4CIS A;  1Q3B A;  1UM8 A;  3QYE A;  3HHY A;  3W67 A;  3TE6 A;  3FTF A;  3CF0 A;  4L78 A;  2NQ8 C;  2YFQ A;  1CUK A;  5EXX A;  1X37 A;  3A98 B;  3CGW A;  2Q2E B;  2LWX A;  5E6J A;  3U6M A;  2Y0Q A;  4Q7J A;  1D0K A;  4S12 A;  3NBI A;  3HWS A;  1OQY A;  3T1H M;  3A46 A;  3SBJ A;  2JWS A;  5C18 A;  4JXJ A;  5IT9 S;  2Z8Y M;  3UMM A;  1GJS A;  1TDH A;  2Y20 A;  3KSX A;  3U6Q A;  1HNX M;  1N33 M;  1ORY B;  1I4W A;  1ZMW A;  3FUU A;  4DR2 M;  2YNM D;  1Q02 A;  1PJJ A;  3R9X B;  2XZF A;  1OTR A;  2XLJ A;  1FNN A;  3PVS A;  4OW0 A;  4IBJ A;  4KO8 A;  2KEB A;  3E9S A;  3SHF A;  2CV1 A;  3GLH B;  2K6B A;  4GHA A;  1NNJ A;  5FLX S;  3FE3 A;  3D8B A;  2K47 A;  4LJ7 A;  5DYI A;  2KZS A;  3GLG A;  2CUZ A;  2J7O A;  2ZAM A;  3SC3 A;  3RGP A;  1QVR A;  1IN8 A;  3E21 A;  3VK7 A;  3L28 A;  3NWL A;  4PDG A;  1NY6 A;  2JY8 A;  1HR0 M;  4LGY A;  2UUB M;  3EIE A;  5IRE B;  2L7H A;  3KS4 A;  3AKZ A;  1GL7 A;  1E94 E;  3MK6 A;  5EP3 A;  1WJ7 A;  1SXJ C;  3SMP A;  2XGN A;  5ITR A;  3ZQJ A;  3BXW A;  7CAT A;  4M0D A;  2L6O A;  3CTW B;  3T38 A;  1IFY A;  1HNZ M;  1SXJ E;  3KOZ E;  2DKL A;  4WUR A;  5LMN M;  1NNU C;  1T43 A;  1R4G A;  4R7G A;  4LF8 M;  3K9O A;  2K0B X;  3HJ8 A;  3KSJ A;  3SAT A;  4GHL A;  3GQ5 A;  1J09 A;  2LVO C;  4LJ8 A;  3AOE A;  4B3S M;  5FTN A;  4QNR A;  4G4Q A;  2CFO A;  2CHV A;  5E26 A;  3U6D A;  2VF8 A;  4BB9 A;  1Z59 A;  2ZAO A;  2F5O A;  1E9S A;  4I4L A;  3B7Q A;  4JN6 A;  2L09 A;  3GPX A;  4AG5 A;  2APL A;  3CF2 A;  1QDT A;  1C1K A;  2QCU A;  4HEO A;  2HAK A;  2LTU A;  3SYL A;  2MJ5 B;  4R3D A;  5FSW A;  3VK8 A;  4LJ5 A;  5EXP A;  1G41 A;  4B08 A;  4DUZ M;  4GRI A;  3J2P B;  3L26 A;  1GO5 A;  5EP1 A;  2V6Z M;  1DGG A;  4B7G A;  2FFJ A;  5BR8 M;  1PJT A;  1K82 A;  1GL6 A;  1KFV A;  3M0E A;  2X8A A;  2Y21 A;  4JI4 M;  3FTD A;  2M5Z A;  1A5T A;  1NV8 A;  3MJ5 A;  2L7I A;  1V34 A;  3MHV C;  4XBO A;  1RU3 A;  2FH0 A;  1XNQ M;  1OKS A;  4NL4 H;  4NRW A;  3C58 A;  1JR3 E;  1WGN A;  2LXE A;  3W0F A;  3JR5 A;  2OOA A;  4JI7 M;  1N36 M;  3FRI A;  1N75 A;  4OVZ A;  4LFC M;  2F4V M;  3C9P A;  3U6O A;  4DUY M;  4LFA M;  3MMP A;  4LY6 A;  2H1R A;  2JXN A;  2CP8 A;  2P5T A;  3J81 S;  3GP1 A;  3LVW A;  4DV0 M;  1SXJ B;  3KP1 E;  5KPZ A;  1L1T A;  3GLH E;  2EKF A;  1VEG A;  1OFI A;  3IG8 A;  2QP9 X;  3IG5 A;  3LVV A;  2DI0 A;  4F1I A;  4L8R C;  1JQJ C;  4FW9 A;  2EJS A;  1K3W A;  2XSZ A;  3FRH A;  1MJG M;  4LF9 M;  2QNJ A;  2F5P A;  4QHS A;  1D0M A;  4WW0 A;  1OIP A;  1TH4 A;  3TWL A;  2ERC A;  2Y0T A;  3PFI A;  3ZCB B;  1PJS A;  3UK6 A;  3FYC A;  2KNA A;  3VDP A;  2WSF F;  5H37 D;  2XH9 A;  4MGZ E;  2DAG A;  4RF0 A; 
#chains in the Genus database with same CATH homology
 2R45 A;  4FWD A;  4IBK A;  4D81 A;  2D7H A;  2Z4R A;  4QHT A;  4JI2 M;  3GLI A;  1XMO M;  4EIW A;  2XH9 A;  4IBB A;  3UGJ A;  3TL4 X;  1FJG M;  3AOG A;  4YY3 M;  3JAM S;  4DV6 M;  2RGH A;  3D8L A;  2DZN B;  2I7P A;  4FCW A;  4LJ6 A;  1IXR C;  3GPP A;  4MB7 A;  3U5Z B;  5C1B A;  1N34 M;  1E32 A;  4OX9 M;  4RNA A;  3UJN A;  2KRK A;  3HU1 A;  1EE8 A;  4YHH M;  3KFU G;  5DNY A;  4B3T M;  2Z4S A;  1HQY E;  3HGI A;  1OJL A;  2KRU A;  1NHG C;  3OTO M;  3R8F A;  3LMM A;  4K0K M;  1VDD A;  1DO2 A;  4IBI A;  3J7A S;  2BJW A;  2C5R A;  1QZM A;  3H4M A;  1L2C A;  4MH0 E;  4X65 M;  2EA0 A;  2A5Y B;  2CHG A;  2LNH C;  3U60 A;  1IN4 A;  3SFZ A;  3GO8 A;  3SMS A;  2QPA A;  3GLG B;  4DV3 M;  4DR3 M;  4NXM M;  1QAN A;  3KP0 E;  1PJI A;  3TQS A;  4KHP M;  2D7E A;  4GIP A;  1W5T A;  1GLN A;  3VKH A;  1NSF A;  1NVM A;  3CF6 E;  4REZ A;  5IZ7 D;  2VQF M;  4B3M M;  1DGH A;  1DGF A;  1NHW C;  4OU7 A;  1ZQ9 A;  5F3W A;  5FTK A;  4IBD A;  4GC9 A;  3HHX A;  2JA2 A;  2BJV A;  1QYR A;  2YQZ A;  4MGH A;  3GPY A;  4I5S A;  2XZU A;  3AL0 C;  2VII A;  3J7B A;  1QAQ A;  2Z7J A;  3AV0 A;  3FUT A;  4DV1 M;  1G3I A;  2F5N A;  2XF3 A;  2QEN A;  3GPU A;  2X4A A;  4B7H A;  3GLF A;  1R6B X;  3QWL A;  2RKO A;  3U6P A;  1XXH A;  3KW6 A;  5FTJ A;  1Z5C A;  3A42 A;  4GKJ M;  1DGB A;  2F5Q A;  1YSY A;  3U6S A;  4LJ4 A;  4LF4 M;  4IIW A;  5ITX A;  4W5W A;  4HLQ A;  3U6C A;  3M7G A;  1G59 A;  4JV5 M;  3SAW A;  2E5L M;  1TGU A;  3DZD A;  3KDS E;  4FCT A;  2ZM6 M;  1G8P A;  1YUB A;  4DV7 M;  4L4U A;  2UUA M;  5IWA M;  1Q3C A;  2J7N A;  3HU2 A;  1XWI A;  4II7 A;  5EP4 A;  2YR0 A;  1QAM A;  3ZC7 B;  1I94 M;  3LQR A;  2HCB A;  3DA1 A;  4JI0 M;  2F5S A;  2UU9 M;  3AJI B;  2DWL A;  3SAV A;  1L8Q A;  3RGS A;  1IBM M;  2C99 A;  3K2L A;  2FNA A;  1N78 A;  4GC5 A;  1IM2 A;  3U61 A;  3KOW E;  1IN5 A;  3PNV A;  3GRY A;  4LRT A;  4CGY B;  2C98 A;  2QBY A;  4PCZ A;  4BBA A;  2HKJ A;  3QAU A;  5DYG A;  3TWK A;  3VLF B;  4CHT B;  3U6E A;  4DR7 M;  3L25 A;  3I51 A;  2DVW B;  3E4R A;  1IXZ A;  4PT5 A;  3AFH A;  3L29 A;  1W5S A;  2HHH M;  2HL7 A;  2V1C A;  2R46 A;  4LF5 M;  4NOO B;  3HJQ A;  2CEA A;  3GRV A;  4IJE A;  5KO3 A;  1SXJ A;  2XFT A;  2C96 A;  3GQ4 A;  3JR4 A;  3FTE A;  5FTL A;  1IY1 A;  2XSZ D;  1KSF X;  4PD2 A;  4RF1 A;  4AW4 A;  1IN7 A;  4HL4 A;  4DR1 M;  1R2Z A;  5KPR A;  4LF7 M;  4IBE A;  2KXE A;  3VFD A;  3AOE C;  5EQT A;  2DWZ B;  2DZO B;  2X49 A;  2R4J A;  1XC8 A;  4AKI A;  2DXI A;  1L2D A;  2EUC A;  3FYD A;  4NSR A;  5GKN A;  4LJ9 A;  5LMU M;  3BOS A;  3HHZ A;  2VQE M;  3EIH A;  4FVM A;  2KW0 A;  3GQ3 A;  3I4V A;  4Z8X A;  4DV2 M;  1QAO A;  3KVW A;  1IY2 A;  1L2B A;  3SAR A;  4JYA M;  1KYI A;  3Q8X A;  1G4A E;  4B3R M;  4ZPX A;  4JI1 M;  4M0W A;  3KXE C;  3RE8 A;  4DR4 M;  4FWG A;  3U5Z A;  4D80 A;  4IBG A;  1WXQ A;  5JI2 E;  3ZH9 B;  5ITT A;  4IJF A;  4TUW A;  3WHL A;  4G4R A;  4DR5 M;  4P16 A;  2XFS A;  3SHG B;  4NXN M;  1Z5B A;  2AHM A;  4LGM A;  3T15 A;  4AG6 A;  4MGI E;  5FTM A;  1JR3 A;  4GMQ A;  3U60 B;  2ZAN A;  4G4N A;  4AZF A;  1K3X A;  4JI8 M;  2V1U A;  3U6L A;  3FTC A;  2RGO A;  3HHW A;  1JR3 D;  5KQD A;  2R18 A;  3W0L B;  1NJG A;  3GLH A;  3UZU A;  2KZU A;  1DGH B;  2EO2 A;  4MGY E;  4I8O A;  1NJF A;  3J27 B;  4DR6 M;  1DO0 A;  5BPV A;  1TDZ A;  3L2A A;  3K92 A;  3KS8 A;  2G5G X;  2R65 A;  4IBF A;  4LCB A;  2DWN A;  4LG2 A;  3T1Y M;  2FOI C;  1IN6 A;  3KOY E;  4A3V B;  1GVN A;  3ILK A;  4LFB M;  3A45 A;  4B7F A;  1E9R A;  3LQQ A;  1XHB A;  4L15 A;  4DV5 M;  1OFH A;  1Z5A A;  1PM5 A;  3GLF B;  1Q39 A;  1S3S A;  5ITQ A;  1R2Y A;  2CV0 A;  2FE8 A;  1XXH B;  4D82 A;  3VDU A;  5EXT A;  3HJS A;  1XNR M;  3DFZ A;  4KOD A;  2ZBK B;  1QQW A;  1L1Z A;  3B9P A;  3TPZ A;  4FCV A;  4AKG A;  1XMQ M;  2CHQ A;  2UXB M;  2OPF A;  4KLN A;  2KA6 B;  2G8L A;  2BNK A;  3GRR A;  4X66 M;  4I81 A;  1IY0 A;  3FD9 A;  4FD2 A;  3DOA A;  4MGK E;  3HKP A;  1TH3 A;  3FKE A;  4X62 M;  3SAU A;  1YE9 A;  8CAT A;  3K8Z A;  4M9S A;  2CV2 A;  4L16 A;  3SYK A;  4NSO B;  1HQC A;  1MU5 A;  4QNM A;  3TWM A;  4OVZ B;  3GRU A;  3FUW A;  4JI3 M;  4Z6Y A;  3RFW A;  4DV4 M;  2Z3X A;  3THG A;  1IQP A;  2CE7 A;  3K1J A;  4AQY M;  1R7R A;  4XGI A;  5EP2 A;  3U61 B;  1HNW M;  4GKK M;  4LZZ A;  3KOX E;  2I7N A;  4ITQ A;  4JI5 M;  1Z6T A;  4JI6 M;  2C9O A;  5ITY A;  2QBY B;  4G4O A;  3J80 S;  2DWM A;  4BLC A;  1T3T A;  3M6A A;  1HT2 E;  4GIT A;  4M9Z A;  4G6Z A;  1IXS B;  2UUC M;  4QOZ C;  1IBK M;  1IBL M;  4X64 M;  3FUV A;  4GH9 A;  2R62 A;  2R4E A;  4LJA A;  4MM3 B;  4LRS A;  3FUX A;  3L27 A;  4IBC A;  1J7K A;  1GKI A;  1ZAE A;  4QOS A;  2D7G A;  1TH2 A;  2XEP A;  3VKG A;  3GLI B;  4AKH A;  1LV7 A;  4FWH A;  2UXD M;  4NRV A;  1SXJ D;  5JI3 E;  3PNY A;  1N77 A;  4M9X A;  3I4Y A;  4PDI A;  2O5R A;  5KPT A;  4LZJ A;  2OQ4 A;  1MX0 A;  1J5E M;  2QZ4 A;  3WHK A;  5EXS A;  3PXG A;  5A2Q S;  2DHR A;  2LH0 A;  5EJC A;  5KQ8 A;  2UXC M;  2M60 A;  2W82 A;  3SAS A;  1H6U A;  1HT1 E;  5ITU A;  5ITX E;  1D2N A;  4LF6 M;  1NY5 A;  2C9C A;  1N32 M;  4CIS A;  1Q3B A;  1UM8 A;  3HHY A;  3TE6 A;  3FTF A;  3CF0 A;  4L78 A;  2NQ8 C;  2YFQ A;  5EXX A;  1X37 A;  3A98 B;  2Q2E B;  2LWX A;  5E6J A;  3U6M A;  2Y0Q A;  4S12 A;  3NBI A;  3HWS A;  3T1H M;  3A46 A;  3SBJ A;  5C18 A;  4JXJ A;  5IT9 S;  3UMM A;  1TDH A;  2Y20 A;  3KSX A;  3U6Q A;  1HNX M;  1N33 M;  1ORY B;  1I4W A;  3FUU A;  4DR2 M;  2YNM D;  1PJJ A;  3R9X B;  2XZF A;  2XLJ A;  1FNN A;  3PVS A;  4OW0 A;  4IBJ A;  4KO8 A;  2KEB A;  3E9S A;  3SHF A;  2CV1 A;  3GLH B;  4GHA A;  1NNJ A;  5FLX S;  3D8B A;  2K47 A;  4LJ7 A;  5DYI A;  2KZS A;  3GLG A;  2CUZ A;  2J7O A;  2ZAM A;  3SC3 A;  3RGP A;  1QVR A;  1IN8 A;  3VK7 A;  3L28 A;  3NWL A;  4PDG A;  1NY6 A;  1HR0 M;  2UUB M;  4LGY A;  4AI6 A;  3EIE A;  5IRE B;  2L7H A;  3KS4 A;  3AKZ A;  1GL7 A;  1E94 E;  3MK6 A;  5EP3 A;  3SMP A;  1SXJ C;  2XGN A;  5ITR A;  7CAT A;  4M0D A;  2L6O A;  3CTW B;  3T38 A;  1HNZ M;  1SXJ E;  3KOZ E;  4WUR A;  5LMN M;  1NNU C;  4R7G A;  4LF8 M;  3KSJ A;  3HJ8 A;  3SAT A;  4GHL A;  3GQ5 A;  1J09 A;  4LJ8 A;  3AOE A;  4B3S M;  5FTN A;  4QNR A;  4G4Q A;  2CFO A;  2CHV A;  5E26 A;  3U6D A;  2F5O A;  4BB9 A;  1Z59 A;  2ZAO A;  1E9S A;  4I4L A;  4JN6 A;  2L09 A;  3GPX A;  4AG5 A;  3CF2 A;  1C1K A;  2QCU A;  3SYL A;  4R3D A;  5FSW A;  3VK8 A;  4LJ5 A;  5EXP A;  1G41 A;  4B08 A;  4DUZ M;  4GRI A;  3J2P B;  3L26 A;  5EP1 A;  2V6Z M;  1DGG A;  4B7G A;  2FFJ A;  5BR8 M;  1K82 A;  1GL6 A;  1KFV A;  3M0E A;  2X8A A;  2Y21 A;  4JI4 M;  3FTD A;  2M5Z A;  3MJ5 A;  2L7I A;  3MHV C;  4XBO A;  1XNQ M;  4NL4 H;  4NRW A;  3C58 A;  2LXE A;  3W0F A;  4JI7 M;  3JR5 A;  1N36 M;  1N75 A;  4OVZ A;  4LFC M;  2F4V M;  3U6O A;  4DUY M;  4LFA M;  4LY6 A;  3J81 S;  2H1R A;  3GP1 A;  2P5T A;  4DV0 M;  3LVW A;  1SXJ B;  3KP1 E;  5KPZ A;  1L1T A;  1OFI A;  3IG8 A;  2QP9 X;  3IG5 A;  3LVV A;  4L8R C;  1JQJ C;  4FW9 A;  1K3W A;  2XSZ A;  4LF9 M;  2F5P A;  4QHS A;  4WW0 A;  1TH4 A;  3TWL A;  2ERC A;  2Y0T A;  3PFI A;  3ZCB B;  3UK6 A;  3VDP A;  3FYC A;  5H37 D;  3HU3 A;  4MGZ E;  4RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...