3T1HM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
molecule tags Ribosome/antibiotic
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1hM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1hM02
1Z5BA 3TWLA 1L1TA 1HR0M 3C58A 4DR7M 4MB7A 4DV5M 4K0KM 4B3MM 1TDHA 4NRWA 4DR5M 2UU9M 1XNQM 5LMUM 2VQEM 3A45A 4G4RA 4GKJM 5FLXS 1Z59A 1Q3BA 3T1HM 4DV3M 4DR2M 2UXCM 4JI5M 2OQ4A 4DV6M 4JI8M 3J81S 3VK7A 2XZFA 2UUBM 4CISA 5ITRA 4JI7M 1HNWM 4JYAM 5IWAM 1FJGM 4DUYM 4JI2M 2F5OA 3GQ5A 3SASA 4X66M 2HHHM 1MX0A 4NXNM 1L2BA 1EE8A 1HNXM 3A46A 4YY3M 4DR1M 3SAUA 1L2DA 3GPYA 5IT9S 1N33M 3TWKA 5BR8M 3GPUA 4LF9M 3SAWA 1Z5AA 2F4VM 3U6EA 4LF4M 4LF6M 4G4NA 5A2QS 4YHHM 4X62M 3U6DA 3TWMA 1K82A 3GQ3A 1XC8A 1I94M 4DUZM 4LFAM 2UUAM 2F5NA 2F5QA 3J7AS 3DOAA 3U6QA 4B3RM 4AQYM 3U6OA 1R2YA 3GPXA 4DV4M 5ITQA 3OTOM 4DV7M 1N36M 4DV1M 4PDGA 4X65M 3JR5A 4NXMM 1HNZM 1R2ZA 3SATA 4JV5M 2HKJA 4NRVA 1PM5A 1XMQM 4JI0M 4X64M 4JI6M 3A42A 1Z5CA 2Q2EB 1N32M 5ITUA 4DR3M 3SAVA 3SBJA 1TDZA 3W0FA 5ITXE 3JR4A 3JAMS 2VQFM 5LMNM 1IBLM 4DR4M 3GP1A 2E5LM 1IBMM 4LFBM 2ZM6M 3T1YM 3GQ4A 1XMOM 1PJJA 4G4OA 2F5PA 1J5EM 3U6LA 3J80S 1N34M 1XNRM 4KHPM 2F5SA 3U6CA 4LF8M 1L2CA 4B3TM 4ITQA 3U6MA 1NNJA 3GO8A 1KFVA 5ITTA 3U6SA 2UXDM 5ITXA 3VK8A 1L1ZA 4LFCM 4DV0M 4PDIA 4JI3M 4PCZA 4G4QA 2UUCM 4PD2A 2OPFA 1K3XA 4LF7M 4OX9M 4LF5M 3GPPA 4DV2M 1Q3CA 5ITYA 2XZUA 1K3WA 1IBKM 4GKKM 4DR6M 2UXBM 1PJIA 4JI1M 2ZBKB 1Q39A 2EA0A 3U6PA 1MU5A 4B3SM 3SARA 4JI4M
chains in the Genus database with same CATH superfamily
4GH9A 3TWLA 2JZ0A 3C58A 1G59A 4GC9A 4IBBA 4QHSA 2BJWA 1VDLA 1WGNA 2R18A 2V1UA 2DWNA 4B3TM 2C9CA 2LHCA 1XNQM 3FRIA 2L4EA 4GRIA 2XSZA 2VQEM 5FTMA 4GKJM 2FNAA 2C99A 2DAMA 4MGYE 4DR2M 2UXCM 5KQDA 3TL4X 1JR3D 4JI5M 3KS4A 3BXWA 4CHTB 5FSWA 2OQ4A 3HWSA 2KHHA 2K9DA 4LGMA 2XZFA 4R3DA 5ITRA 4GIPA 3MHVC 4NC6A 4NSOB 4OVZA 2VF8A 4DUYM 2DWZB 1IXSA 2QENA 2R46A 3AV0A 4LJ4A 3SASA 1HJPA 2L09A 1VEJA 1L2BA 2EKFA 1TH3A 1GO5A 1HNXM 1L2DA 1N33M 4CGYB 3HJQA 3L28A 5BR8M 4DBGB 2LHGA 2AHMA 2ZTDA 1ZQ9A 2WZJA 1G41A 4G4NA 3FD9A 4MH0E 1K82A 2JY8A 3NBIA 4L15A 4LFAM 3H4MA 3J7BA 4IBDA 2KEBA 2YNMD 3K1JA 3MK6A 3THGA 3J7AS 4B3RM 3V76A 4AI6A 2O5RA 1R2YA 4ITQA 2KNVA 3QAUA 2FS1A 5DYGA 4Y28F 1R7RA 1IN4A 3ILKA 4X65M 1EFUB 4D81A 4JV5M 5KQ8A 4LJ9A 2LVQD 1DGGA 4X64M 3DZDA 1UFZA 2L4FA 4KT0F 1R5LA 2BJVA 2LVOC 3T15A 1QAMA 2XGNA 2Z3XA 3KP1E 2G3QA 2QP9X 4AKGA 2GQFA 2R62A 2APLA 3HY5A 3SAVA 1TDZA 2JZ1A 5ITXE 1IBLM 1NV8A 2CWBA 4XK8F 5JI2E 4GEWA 1IBMM 4LJAA 4D80A 2XFSA 4IBCA 1JR3A 3HHYA 2FH0A 4Z6YA 3GQ4A 3VFDA 1XMOM 2JWSA 1PJJA 1J5EM 4L8RC 4KHPM 1XHBA 3QWLA 5L8RF 2N35A 1T3TA 2HL7A 2CHVA 4KODA 3BBZA 1L2CA 2R6FA 2R45A 4LF8M 3DFZA 1IY0A 2HWJA 2XSZD 1V92A 2X49A 3R9XB 1VEKA 3SC3A 2KZUA 4LFCM 5F3WA 1PRBA 4JI3M 4PCZA 3ZCBB 2EKKA 2GNOA 3CGWA 3GRYA 4QNMA 5GKNA 2OOAA 2OPFA 1K3XA 1QAQA 4LF7M 4OX9M 1FNNA 2DAEA 3MJ5A 2C98A 1V34A 3IECA 2Y20A 2H1RA 1DGFA 4RF1A 1K3WA 4QOZC 2CFOA 4IBFA 4B3SM 1MU5A 1IY1A 1SXJD 4FD2A 4F1IA 3HU2A 2KW0A 1QDTA 1Z5BA 4MM3B 1GL7A 2VF7A 1QUSA 1P3QQ 3VKGA 4DR7M 3HHZA 2JA2A 4DV5M 4K0KM 2CRUA 4M9XA 2EO2A 3J27B 2RGHA 4NRWA 3LCUA 4L4UA 1ZMVA 3B9PA 3B7NA 4FWHA 1PJQA 2MJ5B 4RF0A 2EJSA 3B7ZA 2I7PA 4HLQA 2JUJA 2MGWA 5IZ7D 1DO2A 2KDLA 5E6JA 4LJ7A 1D2NA 3D8BA 1GL6A 3HGIA 5FTLA 3AJIB 2NQ8C 3H4JA 4FW9A 1Z6TA 1A5TA 1FJGM 1L8QA 2G8LA 3HJSA 4JI2M 3KFUG 1J7KA 4FCWA 1QZMA 2LTUA 4Z8XA 1EE8A 3UJNA 3A46A 1SXJE 4YY3M 3PVSA 3GRUA 2DAKA 4XGIA 2QCUA 4II7A 2RKOA 3UZUA 4LF9M 2VDBB 1WHCA 1NHGC 3KOZE 4NL4H 2XLJA 4GC5A 3U6EA 3SAWA 1IXRC 2FE8A 2HCBA 4LF4M 3TWMA 3GLHE 3AOGA 4FCTA 3L27A 3GQ3A 2Y0TA 4M0WA 1I94M 4GHLA 1VG5A 3TE6A 1WIVA 4R7GA 4EIWA 3WHLA 2F5QA 2DHRA 3DOAA 3GRRA 2V1CA 2X4AA 2LBCA 3U6OA 5KPZA 1D0KA 3GPXA 1OQYA 1NNUC 2FOIC 3LMMA 3W68A 5ITQA 1S3SA 4F2LA 4DV7M 2HAKA 1TH4A 3FUTA 1OFHA 3GLFE 4NXMM 3VDUA 4I8OA 3JR5A 4KLNA 3IG5A 1HNZM 3SYLA 1W5SA 4NRVA 1NVMA 3FRHA 4A3VB 1IQPA 3U5ZB 4B7FA 2JY5A 1DGBA 2R4EA 4JI6M 3A42A 5IREB 1ZAEA 3HJ8A 2K0BX 1NJFA 1QUTA 1SG9A 8CATA 5ITUA 2MROB 1YUBA 2DAIA 4LZJA 1H6UA 3JR4A 5LMNM 1NJGA 3GP1A 1OIPA 1VEGA 4LGYA 2E5LM 2CV1A 3GLHA 1QQWA 2ZM6M 3T1YM 2Y21A 5EP3A 4AW4A 4B7HA 1ZMUA 4JN6A 2CV0A 3FKEA 4Q7JA 1G4AE 1N34M 2F5SA 1NSFA 4OVZB 2DZNB 3U6CA 3L2AA 2ERCA 3SYKA 1YLAA 3U6MA 1NNJA 3C3DA 1RU3A 2H5XA 3E21A 4M0DA 3U6SA 2UXDM 1N75A 2JNHA 4IBIA 1ORYB 3FTDA 4IBGA 5EXPA 4S12A 3SFZA 2KRKA 3ZH9B 3VK8A 2MH8A 1HT1E 2LVAA 3GLGA 1L1ZA 2M60A 3E46A 1EIJA 1DO0A 3PNVA 1MJGM 2O25A 1XXHB 3CF2A 3U60B 3M6AA 3T6PA 1MN3A 3KW6A 3I51A 5ITYA 1IBKM 3FTCA 4GHAA 1Q39A 1Y8GA 2K47A 4WP2A 1GVNA 1N77A 2OO9A 3SARA 4JI4M 1E9RA 2WSFF 3AOEC 4AKHA 4FWDA 1L1TA 2Z4SA 2B3TA 2VIIA 2RGOA 3UGJA 1J09A 4B3MM 3A98B 4AG6A 1KYIA 1WJ7A 1QANA 3EIHA 1XXHE 1NV9A 3GLIB 1NO1A 4HEOA 5JI3E 2C5RA 2CP8A 3SHFA 2UU9M 2QBYB 2J7NA 1IN7A 3FUVA 1ZV1A 1Z59A 1Q3BA 1QAOA 3T1HM 4DV3M 1DV0A 3KSXA 1TGUA 1I4WA 1TTEA 3KDSE 1LV7A 3BOSA 4AZFA 3U61B 2Z8YM 4DV6M 3VLFB 4JI8M 3D8LA 1JB0F 1E94E 3FYCA 3HU1A 3SMSA 4AG5A 1OJLA 4IIWA 4CISA 2DZOB 5IWAM 2BWBA 3DA1A 4I5SA 5FTNA 4L6V6 4OU7A 4LZZA 5EJCA 2HHHM 1MX0A 5EP4A 4NXNM 1OAIA 4NOOB 2DENA 3SAUA 3GPYA 5DNYA 1G71A 2D7HA 5IT9S 2P5TA 3FUXA 2DVWB 3TWKA 3I4YA 3GPUA 2C96A 1GJSA 2KNZA 4G3OA 2F4VM 4IBKA 4LF6M 1XB2B 1Q02A 1GKIA 3HZJA 1BVSA 4X62M 5A2QS 3U6DA 1XXHA 2L7HA 2DHYA 2XEPA 1XC8A 4DUZM 1IXSB 2F5NA 2J7OA 4M9ZA 2CE7A 1T43A 4ANRA 3U6QA 3PXGA 3W67A 3GLHB 3L26A 3SMPA 4DV4M 2C9OA 4W5WA 2KRUA 2V6ZM 2WSEF 2O01F 4FCVA 3TQSA 7CATA 4IBEA 3U60A 4MGHA 4OW0A 1QYRA 3B89A 1W5TA 5FTKA 3W0LB 4XBOA 3M7GA 1G3IA 3SATA 2HKJA 2Z7JA 4JXJA 4B08A 3FTFA 4TUWA 1PM5A 2G5GX 5EXXA 1XMQM 1ZMWA 2CUZA 3HU3A 2XFTA 4P16A 3ZC7B 2Q2EB 4CIZA 2YQZA 3AOEA 2QNJA 4I4LA 4DR3M 2R44A 3SBJA 2LWXA 3W0FA 1QVRA 5DFLA 1IM2A 3JAMS 3CF0A 4FWGA 1C1KA 2VQFM 1N78A 1T6OA 1IFYA 2CHQA 2LXEA 3LVVA 1DGHA 4KO8A 2CV2A 2DAGA 3UMMA 1D0MA 2F5PA 3LCVB 3U6LA 3HX3A 4BB9A 1YSYA 2L2DA 2L6OA 1HQYE 3M0EA 2DWMA 3GO8A 2R0IA 5ITTA 5EXSA 5ITXA 2ZTCA 4WW0A 4D82A 3KSJA 1R6BX 4DV0M 1IN6A 2DWLA 1JR3E 4CJ6A 2KA6B 3LQQA 3RE8A 2D7EA 3I01M 1NY6A 2L7IA 2DKLA 1NHWC 2JXNA 4LF5M 4MGIE 2QPAA 4GKKM 4DR6M 2UXBM 5EP2A 4ZPXA 4JI1M 5EXTA 1VDDA 2ZBKB 3K9OA 1R4GA 4LJ8A 3RGSA 5E26A 3U6PA 3U5ZA 3QYEA 1TR8A 4HL4A 1TH2A 4B7GA 4IJFA 2KNAA 1AUAA 3GLIE 3SHGB 5H37D 2EUCA 1YE9A 1HR0M 1OTRA 3C3EA 1X37A 1PJSA 2J5YA 2QQ8A 4MB7A 1IN5A 3R8FA 3FUUA 1TDHA 2DI0A 2YFQA 1OIZA 3HHXA 3K2LA 4DR5M 4MGZE 1QDRA 1JQJC 5LMUM 4LCBA 3A45A 4G4RA 5DYIA 4LG2A 3QYBA 3F92A 3KXEC 5FLXS 1WGLA 1IXZA 2QZ4A 4PT5A 3T38A 4RNAA 4REZA 4L16A 2M5ZA 3KOWE 3FUWA 2R65A 3K8ZA 2JP7A 2BNKA 3J81S 3VK7A 2LH0A 2ZANA 2R4JA 2UUBM 1E9SA 3IHPA 4JI7M 1HNWM 4JYAM 1WR1B 1C7YA 2QSFX 2F5OA 3AL0C 3GQ5A 4X66M 3CF6E 2A5YB 3HKPA 3LW5F 3I04M 4LJ6A 4QNRA 1F4IA 1XWIA 4DR1M 3EIEA 2Y0QA 3C9PA 3LQRA 4MGKE 2QBYA 3FTEA 2FFJA 3GLIA 2K6BA 4P17A 1Z5AA 3GLFB 1V33A 4R71A 3L25A 4BLCA 5BPVA 3I4VA 2W82A 1OKSA 4YHHM 1QZEA 5KPRA 5KO3A 3E4RA 3GRVA 2UUAM 2ZAMA 5C18A 2LVPC 2DNAA 3Q8GA 1GJTA 1SXJA 4AQYM 3FE3A 3PFIA 1D0LA 2D7GA 4G6ZA 3KP0E 4FVMA 4IJEA 1SXJB 2XF3A 2Z4RA 2KZSA 3OTOM 5EQTA 2QHOB 1IY2A 1WXQA 1VQ1A 1LTMA 1N36M 1OFIA 3K92A 4LRTA 4PDGA 4DV1M 3NBXX 2WSCF 2CHGA 3VDPA 3AKZA 2XH9A 3KOYE 2MR9A 4QOSA 4LRSA 1R2ZA 3RGPA 1HT2E 4LY6A 2BWEA 4JI0M 4BBAA 3U61A 3Q8XA 1Z5CA 2OOBA 3K9PA 1N32M 4GITA 4QHTA 3IG8A 3E9SA 4LJ5A 1CUKA 3KVWA 5FTJA 3GLFA 3RFWA 2RRUA 1SXJC 4DR4M 4IBJA 2DXIA 1OAOC 1KSFX 3L29A 2YR0A 5EP1A 4UN2B 1HQCA 4M9SA 5C1BA 4LFBM 1E32A 4G4OA 2KXEA 2ZAOA 2CEAA 3KS8A 3J80S 3ZQJA 1XNRM 2JY7A 1AIPC 2LNHC 3CTWB 4I81A 2I7NA 1GABA 4AKIA 3B7QA 2LVNC 1KFVA 3VKHA 3HHWA 3GLGB 1G8PA 1TF0B 3LVWA 4GMQA 1UM8A 3KOXE 4PDIA 4G4QA 2UUCM 4L78A 3UK6A 4PD2A 2JY6B 1GLNA 1NY5A 3FYDA 1PGYA 3J2PB 3WHKA 2X8AA 3TPZA 3GPPA 4DV2M 1Q3CA 3AFHA 1IN8A 1DGHB 3B74A 3MMPA 2DZLA 4NSRA 2XZUA 1PJIA 4RKUF 3NWLA 3PNYA 4WURA 2EA0A 5KPTA 3GLGE 1PJTA
chains in the Genus database with same CATH topology
4GH9A 3TWLA 1G59A 3C58A 4GC9A 4IBBA 4QHSA 2BJWA 2R18A 2V1UA 2DWNA 2C9CA 1XNQM 4GRIA 2XSZA 2VQEM 5FTMA 4GKJM 2FNAA 2C99A 4MGYE 4DR2M 2UXCM 5KQDA 3TL4X 1JR3D 4JI5M 3KS4A 4CHTB 5FSWA 2OQ4A 3HWSA 4LGMA 2XZFA 4R3DA 5ITRA 4GIPA 3MHVC 4NSOB 4OVZA 4DUYM 2DWZB 2QENA 2R46A 3AV0A 4LJ4A 3SASA 2L09A 1L2BA 1TH3A 1HNXM 1L2DA 1N33M 4CGYB 3HJQA 3L28A 5BR8M 2AHMA 1ZQ9A 4G4NA 1G41A 3FD9A 4MH0E 1K82A 3NBIA 4L15A 4LFAM 3H4MA 3J7BA 4IBDA 2KEBA 2YNMD 3K1JA 3MK6A 3THGA 3J7AS 4B3RM 4AI6A 2O5RA 1R2YA 3QAUA 5DYGA 1R7RA 1IN4A 3ILKA 4X65M 4D81A 4JV5M 5KQ8A 4LJ9A 1DGGA 4X64M 3DZDA 2BJVA 3T15A 1QAMA 2XGNA 2Z3XA 3KP1E 2QP9X 4AKGA 2R62A 3SAVA 1TDZA 5ITXE 1IBLM 5JI2E 1IBMM 4LJAA 4D80A 2XFSA 4IBCA 1JR3A 3HHYA 4Z6YA 3GQ4A 1XMOM 3VFDA 1PJJA 4L8RC 1J5EM 4KHPM 1XHBA 3QWLA 1T3TA 4LF8M 2HL7A 2CHVA 4KODA 1L2CA 2R45A 3DFZA 1IY0A 2XSZD 2X49A 3R9XB 3SC3A 2KZUA 4LFCM 5F3WA 4JI3M 4PCZA 3ZCBB 3GRYA 4QNMA 5GKNA 2OPFA 1K3XA 1QAQA 4LF7M 4OX9M 1FNNA 3MJ5A 2C98A 2Y20A 2H1RA 1DGFA 4RF1A 1K3WA 4QOZC 2CFOA 4IBFA 4B3SM 1MU5A 1IY1A 1SXJD 4FD2A 3HU2A 2KW0A 1Z5BA 4MM3B 1GL7A 3VKGA 4DR7M 3HHZA 2JA2A 4DV5M 4K0KM 4M9XA 2EO2A 3J27B 2RGHA 4NRWA 4L4UA 3B9PA 4FWHA 4RF0A 2I7PA 4HLQA 5IZ7D 1DO2A 5E6JA 4LJ7A 1D2NA 3D8BA 1GL6A 3HGIA 5FTLA 3AJIB 2NQ8C 4FW9A 1Z6TA 1FJGM 1L8QA 2G8LA 3HJSA 4JI2M 3KFUG 1J7KA 4FCWA 1QZMA 4Z8XA 1EE8A 3UJNA 3A46A 1SXJE 4YY3M 3PVSA 3GRUA 4XGIA 2QCUA 4II7A 2RKOA 3UZUA 4LF9M 3KOZE 1NHGC 4NL4H 2XLJA 3U6EA 4GC5A 3SAWA 4LF4M 1IXRC 2FE8A 2HCBA 3TWMA 4GHLA 3AOGA 4FCTA 3L27A 3GQ3A 2Y0TA 4M0WA 1I94M 3TE6A 4R7GA 4EIWA 3WHLA 2F5QA 2DHRA 3DOAA 3GRRA 2V1CA 2X4AA 3U6OA 5KPZA 3GPXA 1NNUC 2FOIC 3LMMA 5ITQA 1S3SA 4DV7M 1TH4A 3FUTA 1OFHA 4NXMM 3VDUA 4I8OA 3JR5A 4KLNA 3IG5A 1HNZM 3SYLA 1W5SA 4NRVA 1NVMA 4A3VB 3U5ZB 1IQPA 4B7FA 1DGBA 2R4EA 4JI6M 3A42A 5IREB 1ZAEA 3HJ8A 1NJFA 8CATA 5ITUA 1YUBA 4LZJA 1H6UA 3JR4A 5LMNM 1NJGA 3GP1A 2E5LM 4LGYA 2CV1A 3GLHA 1QQWA 2ZM6M 3T1YM 2Y21A 5EP3A 4AW4A 4B7HA 4JN6A 2CV0A 3FKEA 1N34M 1G4AE 2F5SA 1NSFA 4OVZB 2DZNB 3U6CA 3L2AA 2ERCA 3SYKA 3U6MA 1NNJA 4B3TM 4ITQA 3U6SA 4M0DA 2UXDM 1N75A 4IBIA 1ORYB 3FTDA 4IBGA 5EXPA 4S12A 3SFZA 2KRKA 3ZH9B 3VK8A 1L1ZA 1HT1E 3GLGA 2M60A 1DO0A 3PNVA 1XXHB 3CF2A 3U60B 3M6AA 3KW6A 3I51A 5ITYA 1IBKM 3FTCA 4GHAA 1Q39A 2K47A 1GVNA 1N77A 3SARA 4JI4M 1E9RA 3AOEC 4AKHA 4FWDA 1L1TA 2Z4SA 2VIIA 2RGOA 3UGJA 1J09A 4B3MM 3A98B 4AG6A 1KYIA 3EIHA 1QANA 3GLIB 5JI3E 2C5RA 3SHFA 2QBYB 2UU9M 2J7NA 1IN7A 3FUVA 1Z59A 1Q3BA 1QAOA 3T1HM 4DV3M 3KSXA 1TGUA 1I4WA 3KDSE 4AZFA 1LV7A 3BOSA 3U61B 4DV6M 3VLFB 4JI8M 3D8LA 1E94E 3FYCA 3HU1A 3SMSA 4AG5A 1OJLA 4IIWA 4CISA 2DZOB 5IWAM 3DA1A 4I5SA 5FTNA 4OU7A 4LZZA 5EJCA 2HHHM 1MX0A 5EP4A 4NXNM 4NOOB 3SAUA 3GPYA 5DNYA 2D7HA 5IT9S 2P5TA 3FUXA 2DVWB 3TWKA 3I4YA 3GPUA 2C96A 2F4VM 4IBKA 4LF6M 1GKIA 5A2QS 4X62M 3U6DA 1XXHA 2L7HA 2XEPA 1XC8A 4DUZM 1IXSB 2F5NA 2J7OA 4M9ZA 2CE7A 3U6QA 3PXGA 3GLHB 3L26A 3SMPA 4DV4M 2C9OA 4W5WA 2KRUA 2V6ZM 4FCVA 3TQSA 7CATA 4IBEA 3U60A 4MGHA 4OW0A 1QYRA 1W5TA 5FTKA 3W0LB 4XBOA 3M7GA 1G3IA 3SATA 2HKJA 2Z7JA 4JXJA 4B08A 3FTFA 4TUWA 1PM5A 2G5GX 5EXXA 1XMQM 2CUZA 3HU3A 2XFTA 4P16A 3ZC7B 2Q2EB 2YQZA 3AOEA 4I4LA 4DR3M 3SBJA 2LWXA 3W0FA 1QVRA 1IM2A 3JAMS 3CF0A 4FWGA 1C1KA 2VQFM 1N78A 3LVVA 2CHQA 2LXEA 1DGHA 4KO8A 2CV2A 2F5PA 3UMMA 3U6LA 4BB9A 1YSYA 2L6OA 1HQYE 3M0EA 2DWMA 3GO8A 5ITTA 5ITXA 4WW0A 4D82A 3KSJA 1R6BX 4DV0M 1IN6A 2DWLA 2KA6B 3LQQA 3RE8A 2D7EA 1NY6A 2L7IA 1NHWC 4LF5M 4MGIE 2QPAA 4GKKM 4DR6M 2UXBM 5EP2A 4ZPXA 4JI1M 5EXTA 1VDDA 2ZBKB 3RGSA 4LJ8A 5E26A 3U6PA 3U5ZA 4HL4A 4B7GA 1TH2A 4IJFA 3SHGB 5H37D 2EUCA 1YE9A 1HR0M 1X37A 4MB7A 1IN5A 3R8FA 3FUUA 1TDHA 2YFQA 3HHXA 3K2LA 4DR5M 4MGZE 1JQJC 5LMUM 4LCBA 3A45A 4G4RA 5DYIA 4LG2A 5FLXS 3KXEC 2QZ4A 1IXZA 4PT5A 3T38A 4RNAA 4REZA 4L16A 2M5ZA 3KOWE 3FUWA 2R65A 3K8ZA 3J81S 2BNKA 3VK7A 2LH0A 2ZANA 2R4JA 2UUBM 1E9SA 4JI7M 1HNWM 4JYAM 2F5OA 3AL0C 3GQ5A 4X66M 3CF6E 2A5YB 3HKPA 4LJ6A 4QNRA 1XWIA 4DR1M 3EIEA 2Y0QA 4MGKE 3LQRA 2QBYA 3FTEA 2FFJA 3GLIA 3GLFB 1Z5AA 3L25A 4BLCA 5BPVA 3I4VA 2W82A 4YHHM 5KPRA 5KO3A 3E4RA 3GRVA 2UUAM 2ZAMA 5C18A 1SXJA 4AQYM 3PFIA 2D7GA 4G6ZA 3KP0E 4FVMA 4IJEA 1SXJB 2XF3A 2Z4RA 2KZSA 3OTOM 5EQTA 1IY2A 1WXQA 1N36M 1OFIA 3K92A 4LRTA 4PDGA 4DV1M 2CHGA 3VDPA 3AKZA 2XH9A 3KOYE 4QOSA 1R2ZA 4LRSA 3RGPA 1HT2E 4LY6A 4BBAA 4JI0M 3U61A 3Q8XA 1Z5CA 1N32M 4GITA 4QHTA 3IG8A 3E9SA 4LJ5A 3GLFA 3KVWA 5FTJA 3RFWA 1SXJC 4DR4M 4IBJA 2DXIA 3L29A 1KSFX 2YR0A 5EP1A 1HQCA 4M9SA 5C1BA 4LFBM 1E32A 4G4OA 2KXEA 2ZAOA 2CEAA 3KS8A 3J80S 1XNRM 3CTWB 4I81A 2LNHC 4AKIA 2I7NA 1KFVA 3VKHA 3HHWA 3GLGB 1G8PA 3LVWA 4GMQA 1UM8A 3KOXE 4PDIA 4G4QA 2UUCM 4L78A 3UK6A 4PD2A 1GLNA 1NY5A 3FYDA 3J2PB 3WHKA 2X8AA 3TPZA 3GPPA 4DV2M 1Q3CA 3AFHA 1IN8A 1DGHB 2XZUA 4NSRA 1PJIA 3NWLA 3PNYA 4WURA 2EA0A 5KPTA 5EXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5B A;  3TWL A;  1L1T A;  1HR0 M;  3C58 A;  4DR7 M;  4MB7 A;  4DV5 M;  4K0K M;  4B3M M;  1TDH A;  4NRW A;  4DR5 M;  2UU9 M;  1XNQ M;  5LMU M;  2VQE M;  3A45 A;  4G4R A;  4GKJ M;  5FLX S;  1Z59 A;  1Q3B A;  3T1H M;  4DV3 M;  4DR2 M;  2UXC M;  4JI5 M;  2OQ4 A;  4DV6 M;  4JI8 M;  3J81 S;  3VK7 A;  2XZF A;  2UUB M;  4CIS A;  5ITR A;  4JI7 M;  1HNW M;  4JYA M;  5IWA M;  1FJG M;  4DUY M;  4JI2 M;  2F5O A;  3GQ5 A;  3SAS A;  4X66 M;  2HHH M;  1MX0 A;  4NXN M;  1L2B A;  1EE8 A;  1HNX M;  3A46 A;  4YY3 M;  4DR1 M;  3SAU A;  1L2D A;  3GPY A;  5IT9 S;  1N33 M;  3TWK A;  5BR8 M;  3GPU A;  4LF9 M;  3SAW A;  1Z5A A;  2F4V M;  3U6E A;  4LF4 M;  4LF6 M;  4G4N A;  5A2Q S;  4YHH M;  4X62 M;  3U6D A;  3TWM A;  1K82 A;  3GQ3 A;  1XC8 A;  1I94 M;  4DUZ M;  4LFA M;  2UUA M;  2F5N A;  2F5Q A;  3J7A S;  3DOA A;  3U6Q A;  4B3R M;  4AQY M;  3U6O A;  1R2Y A;  3GPX A;  4DV4 M;  5ITQ A;  3OTO M;  4DV7 M;  1N36 M;  4DV1 M;  4PDG A;  4X65 M;  3JR5 A;  4NXM M;  1HNZ M;  1R2Z A;  3SAT A;  4JV5 M;  2HKJ A;  4NRV A;  1PM5 A;  1XMQ M;  4JI0 M;  4X64 M;  4JI6 M;  3A42 A;  1Z5C A;  2Q2E B;  1N32 M;  5ITU A;  4DR3 M;  3SAV A;  3SBJ A;  1TDZ A;  3W0F A;  5ITX E;  3JR4 A;  3JAM S;  2VQF M;  5LMN M;  1IBL M;  4DR4 M;  3GP1 A;  2E5L M;  1IBM M;  4LFB M;  2ZM6 M;  3T1Y M;  3GQ4 A;  1XMO M;  1PJJ A;  4G4O A;  2F5P A;  1J5E M;  3U6L A;  3J80 S;  1N34 M;  1XNR M;  4KHP M;  2F5S A;  3U6C A;  4LF8 M;  1L2C A;  4B3T M;  4ITQ A;  3U6M A;  1NNJ A;  3GO8 A;  1KFV A;  5ITT A;  3U6S A;  2UXD M;  5ITX A;  3VK8 A;  1L1Z A;  4LFC M;  4DV0 M;  4PDI A;  4JI3 M;  4PCZ A;  4G4Q A;  2UUC M;  4PD2 A;  2OPF A;  1K3X A;  4LF7 M;  4OX9 M;  4LF5 M;  3GPP A;  4DV2 M;  1Q3C A;  5ITY A;  2XZU A;  1K3W A;  1IBK M;  4GKK M;  4DR6 M;  2UXB M;  1PJI A;  4JI1 M;  2ZBK B;  1Q39 A;  2EA0 A;  3U6P A;  1MU5 A;  4B3S M;  3SAR A;  4JI4 M; 
#chains in the Genus database with same CATH topology
 4GH9 A;  3TWL A;  2JZ0 A;  3C58 A;  1G59 A;  4GC9 A;  4IBB A;  4QHS A;  2BJW A;  1VDL A;  1WGN A;  2R18 A;  2V1U A;  2DWN A;  4B3T M;  2C9C A;  2LHC A;  1XNQ M;  3FRI A;  2L4E A;  4GRI A;  2XSZ A;  2VQE M;  5FTM A;  4GKJ M;  2FNA A;  2C99 A;  2DAM A;  4MGY E;  4DR2 M;  2UXC M;  5KQD A;  3TL4 X;  1JR3 D;  4JI5 M;  3KS4 A;  3BXW A;  4CHT B;  5FSW A;  2OQ4 A;  3HWS A;  2KHH A;  2K9D A;  4LGM A;  2XZF A;  4R3D A;  5ITR A;  4GIP A;  3MHV C;  4NC6 A;  4NSO B;  4OVZ A;  2VF8 A;  4DUY M;  2DWZ B;  1IXS A;  2QEN A;  2R46 A;  3AV0 A;  4LJ4 A;  3SAS A;  1HJP A;  2L09 A;  1VEJ A;  1L2B A;  2EKF A;  1TH3 A;  1GO5 A;  1HNX M;  1L2D A;  1N33 M;  4CGY B;  3HJQ A;  3L28 A;  5BR8 M;  4DBG B;  2LHG A;  2AHM A;  2ZTD A;  1ZQ9 A;  2WZJ A;  1G41 A;  4G4N A;  3FD9 A;  4MH0 E;  1K82 A;  2JY8 A;  3NBI A;  4L15 A;  4LFA M;  3H4M A;  3J7B A;  4IBD A;  2KEB A;  2YNM D;  3K1J A;  3MK6 A;  3THG A;  3J7A S;  4B3R M;  3V76 A;  4AI6 A;  2O5R A;  1R2Y A;  4ITQ A;  2KNV A;  3QAU A;  2FS1 A;  5DYG A;  4Y28 F;  1R7R A;  1IN4 A;  3ILK A;  4X65 M;  1EFU B;  4D81 A;  4JV5 M;  5KQ8 A;  4LJ9 A;  2LVQ D;  1DGG A;  4X64 M;  3DZD A;  1UFZ A;  2L4F A;  4KT0 F;  1R5L A;  2BJV A;  2LVO C;  3T15 A;  1QAM A;  2XGN A;  2Z3X A;  3KP1 E;  2G3Q A;  2QP9 X;  4AKG A;  2GQF A;  2R62 A;  2APL A;  3HY5 A;  3SAV A;  1TDZ A;  2JZ1 A;  5ITX E;  1IBL M;  1NV8 A;  2CWB A;  4XK8 F;  5JI2 E;  4GEW A;  1IBM M;  4LJA A;  4D80 A;  2XFS A;  4IBC A;  1JR3 A;  3HHY A;  2FH0 A;  4Z6Y A;  3GQ4 A;  3VFD A;  1XMO M;  2JWS A;  1PJJ A;  1J5E M;  4L8R C;  4KHP M;  1XHB A;  3QWL A;  5L8R F;  2N35 A;  1T3T A;  2HL7 A;  2CHV A;  4KOD A;  3BBZ A;  1L2C A;  2R6F A;  2R45 A;  4LF8 M;  3DFZ A;  1IY0 A;  2HWJ A;  2XSZ D;  1V92 A;  2X49 A;  3R9X B;  1VEK A;  3SC3 A;  2KZU A;  4LFC M;  5F3W A;  1PRB A;  4JI3 M;  4PCZ A;  3ZCB B;  2EKK A;  2GNO A;  3CGW A;  3GRY A;  4QNM A;  5GKN A;  2OOA A;  2OPF A;  1K3X A;  1QAQ A;  4LF7 M;  4OX9 M;  1FNN A;  2DAE A;  3MJ5 A;  2C98 A;  1V34 A;  3IEC A;  2Y20 A;  2H1R A;  1DGF A;  4RF1 A;  1K3W A;  4QOZ C;  2CFO A;  4IBF A;  4B3S M;  1MU5 A;  1IY1 A;  1SXJ D;  4FD2 A;  4F1I A;  3HU2 A;  2KW0 A;  1QDT A;  1Z5B A;  4MM3 B;  1GL7 A;  2VF7 A;  1QUS A;  1P3Q Q;  3VKG A;  4DR7 M;  3HHZ A;  2JA2 A;  4DV5 M;  4K0K M;  2CRU A;  4M9X A;  2EO2 A;  3J27 B;  2RGH A;  4NRW A;  3LCU A;  4L4U A;  1ZMV A;  3B9P A;  3B7N A;  4FWH A;  1PJQ A;  2MJ5 B;  4RF0 A;  2EJS A;  3B7Z A;  2I7P A;  4HLQ A;  2JUJ A;  2MGW A;  5IZ7 D;  1DO2 A;  2KDL A;  5E6J A;  4LJ7 A;  1D2N A;  3D8B A;  1GL6 A;  3HGI A;  5FTL A;  3AJI B;  2NQ8 C;  3H4J A;  4FW9 A;  1Z6T A;  1A5T A;  1FJG M;  1L8Q A;  2G8L A;  3HJS A;  4JI2 M;  3KFU G;  1J7K A;  4FCW A;  1QZM A;  2LTU A;  4Z8X A;  1EE8 A;  3UJN A;  3A46 A;  1SXJ E;  4YY3 M;  3PVS A;  3GRU A;  2DAK A;  4XGI A;  2QCU A;  4II7 A;  2RKO A;  3UZU A;  4LF9 M;  2VDB B;  1WHC A;  1NHG C;  3KOZ E;  4NL4 H;  2XLJ A;  4GC5 A;  3U6E A;  3SAW A;  1IXR C;  2FE8 A;  2HCB A;  4LF4 M;  3TWM A;  3GLH E;  3AOG A;  4FCT A;  3L27 A;  3GQ3 A;  2Y0T A;  4M0W A;  1I94 M;  4GHL A;  1VG5 A;  3TE6 A;  1WIV A;  4R7G A;  4EIW A;  3WHL A;  2F5Q A;  2DHR A;  3DOA A;  3GRR A;  2V1C A;  2X4A A;  2LBC A;  3U6O A;  5KPZ A;  1D0K A;  3GPX A;  1OQY A;  1NNU C;  2FOI C;  3LMM A;  3W68 A;  5ITQ A;  1S3S A;  4F2L A;  4DV7 M;  2HAK A;  1TH4 A;  3FUT A;  1OFH A;  3GLF E;  4NXM M;  3VDU A;  4I8O A;  3JR5 A;  4KLN A;  3IG5 A;  1HNZ M;  3SYL A;  1W5S A;  4NRV A;  1NVM A;  3FRH A;  4A3V B;  1IQP A;  3U5Z B;  4B7F A;  2JY5 A;  1DGB A;  2R4E A;  4JI6 M;  3A42 A;  5IRE B;  1ZAE A;  3HJ8 A;  2K0B X;  1NJF A;  1QUT A;  1SG9 A;  8CAT A;  5ITU A;  2MRO B;  1YUB A;  2DAI A;  4LZJ A;  1H6U A;  3JR4 A;  5LMN M;  1NJG A;  3GP1 A;  1OIP A;  1VEG A;  4LGY A;  2E5L M;  2CV1 A;  3GLH A;  1QQW A;  2ZM6 M;  3T1Y M;  2Y21 A;  5EP3 A;  4AW4 A;  4B7H A;  1ZMU A;  4JN6 A;  2CV0 A;  3FKE A;  4Q7J A;  1G4A E;  1N34 M;  2F5S A;  1NSF A;  4OVZ B;  2DZN B;  3U6C A;  3L2A A;  2ERC A;  3SYK A;  1YLA A;  3U6M A;  1NNJ A;  3C3D A;  1RU3 A;  2H5X A;  3E21 A;  4M0D A;  3U6S A;  2UXD M;  1N75 A;  2JNH A;  4IBI A;  1ORY B;  3FTD A;  4IBG A;  5EXP A;  4S12 A;  3SFZ A;  2KRK A;  3ZH9 B;  3VK8 A;  2MH8 A;  1HT1 E;  2LVA A;  3GLG A;  1L1Z A;  2M60 A;  3E46 A;  1EIJ A;  1DO0 A;  3PNV A;  1MJG M;  2O25 A;  1XXH B;  3CF2 A;  3U60 B;  3M6A A;  3T6P A;  1MN3 A;  3KW6 A;  3I51 A;  5ITY A;  1IBK M;  3FTC A;  4GHA A;  1Q39 A;  1Y8G A;  2K47 A;  4WP2 A;  1GVN A;  1N77 A;  2OO9 A;  3SAR A;  4JI4 M;  1E9R A;  2WSF F;  3AOE C;  4AKH A;  4FWD A;  1L1T A;  2Z4S A;  2B3T A;  2VII A;  2RGO A;  3UGJ A;  1J09 A;  4B3M M;  3A98 B;  4AG6 A;  1KYI A;  1WJ7 A;  1QAN A;  3EIH A;  1XXH E;  1NV9 A;  3GLI B;  1NO1 A;  4HEO A;  5JI3 E;  2C5R A;  2CP8 A;  3SHF A;  2UU9 M;  2QBY B;  2J7N A;  1IN7 A;  3FUV A;  1ZV1 A;  1Z59 A;  1Q3B A;  1QAO A;  3T1H M;  4DV3 M;  1DV0 A;  3KSX A;  1TGU A;  1I4W A;  1TTE A;  3KDS E;  1LV7 A;  3BOS A;  4AZF A;  3U61 B;  2Z8Y M;  4DV6 M;  3VLF B;  4JI8 M;  3D8L A;  1JB0 F;  1E94 E;  3FYC A;  3HU1 A;  3SMS A;  4AG5 A;  1OJL A;  4IIW A;  4CIS A;  2DZO B;  5IWA M;  2BWB A;  3DA1 A;  4I5S A;  5FTN A;  4L6V 6;  4OU7 A;  4LZZ A;  5EJC A;  2HHH M;  1MX0 A;  5EP4 A;  4NXN M;  1OAI A;  4NOO B;  2DEN A;  3SAU A;  3GPY A;  5DNY A;  1G71 A;  2D7H A;  5IT9 S;  2P5T A;  3FUX A;  2DVW B;  3TWK A;  3I4Y A;  3GPU A;  2C96 A;  1GJS A;  2KNZ A;  4G3O A;  2F4V M;  4IBK A;  4LF6 M;  1XB2 B;  1Q02 A;  1GKI A;  3HZJ A;  1BVS A;  4X62 M;  5A2Q S;  3U6D A;  1XXH A;  2L7H A;  2DHY A;  2XEP A;  1XC8 A;  4DUZ M;  1IXS B;  2F5N A;  2J7O A;  4M9Z A;  2CE7 A;  1T43 A;  4ANR A;  3U6Q A;  3PXG A;  3W67 A;  3GLH B;  3L26 A;  3SMP A;  4DV4 M;  2C9O A;  4W5W A;  2KRU A;  2V6Z M;  2WSE F;  2O01 F;  4FCV A;  3TQS A;  7CAT A;  4IBE A;  3U60 A;  4MGH A;  4OW0 A;  1QYR A;  3B89 A;  1W5T A;  5FTK A;  3W0L B;  4XBO A;  3M7G A;  1G3I A;  3SAT A;  2HKJ A;  2Z7J A;  4JXJ A;  4B08 A;  3FTF A;  4TUW A;  1PM5 A;  2G5G X;  5EXX A;  1XMQ M;  1ZMW A;  2CUZ A;  3HU3 A;  2XFT A;  4P16 A;  3ZC7 B;  2Q2E B;  4CIZ A;  2YQZ A;  3AOE A;  2QNJ A;  4I4L A;  4DR3 M;  2R44 A;  3SBJ A;  2LWX A;  3W0F A;  1QVR A;  5DFL A;  1IM2 A;  3JAM S;  3CF0 A;  4FWG A;  1C1K A;  2VQF M;  1N78 A;  1T6O A;  1IFY A;  2CHQ A;  2LXE A;  3LVV A;  1DGH A;  4KO8 A;  2CV2 A;  2DAG A;  3UMM A;  1D0M A;  2F5P A;  3LCV B;  3U6L A;  3HX3 A;  4BB9 A;  1YSY A;  2L2D A;  2L6O A;  1HQY E;  3M0E A;  2DWM A;  3GO8 A;  2R0I A;  5ITT A;  5EXS A;  5ITX A;  2ZTC A;  4WW0 A;  4D82 A;  3KSJ A;  1R6B X;  4DV0 M;  1IN6 A;  2DWL A;  1JR3 E;  4CJ6 A;  2KA6 B;  3LQQ A;  3RE8 A;  2D7E A;  3I01 M;  1NY6 A;  2L7I A;  2DKL A;  1NHW C;  2JXN A;  4LF5 M;  4MGI E;  2QPA A;  4GKK M;  4DR6 M;  2UXB M;  5EP2 A;  4ZPX A;  4JI1 M;  5EXT A;  1VDD A;  2ZBK B;  3K9O A;  1R4G A;  4LJ8 A;  3RGS A;  5E26 A;  3U6P A;  3U5Z A;  3QYE A;  1TR8 A;  4HL4 A;  1TH2 A;  4B7G A;  4IJF A;  2KNA A;  1AUA A;  3GLI E;  3SHG B;  5H37 D;  2EUC A;  1YE9 A;  1HR0 M;  1OTR A;  3C3E A;  1X37 A;  1PJS A;  2J5Y A;  2QQ8 A;  4MB7 A;  1IN5 A;  3R8F A;  3FUU A;  1TDH A;  2DI0 A;  2YFQ A;  1OIZ A;  3HHX A;  3K2L A;  4DR5 M;  4MGZ E;  1QDR A;  1JQJ C;  5LMU M;  4LCB A;  3A45 A;  4G4R A;  5DYI A;  4LG2 A;  3QYB A;  3F92 A;  3KXE C;  5FLX S;  1WGL A;  1IXZ A;  2QZ4 A;  4PT5 A;  3T38 A;  4RNA A;  4REZ A;  4L16 A;  2M5Z A;  3KOW E;  3FUW A;  2R65 A;  3K8Z A;  2JP7 A;  2BNK A;  3J81 S;  3VK7 A;  2LH0 A;  2ZAN A;  2R4J A;  2UUB M;  1E9S A;  3IHP A;  4JI7 M;  1HNW M;  4JYA M;  1WR1 B;  1C7Y A;  2QSF X;  2F5O A;  3AL0 C;  3GQ5 A;  4X66 M;  3CF6 E;  2A5Y B;  3HKP A;  3LW5 F;  3I04 M;  4LJ6 A;  4QNR A;  1F4I A;  1XWI A;  4DR1 M;  3EIE A;  2Y0Q A;  3C9P A;  3LQR A;  4MGK E;  2QBY A;  3FTE A;  2FFJ A;  3GLI A;  2K6B A;  4P17 A;  1Z5A A;  3GLF B;  1V33 A;  4R71 A;  3L25 A;  4BLC A;  5BPV A;  3I4V A;  2W82 A;  1OKS A;  4YHH M;  1QZE A;  5KPR A;  5KO3 A;  3E4R A;  3GRV A;  2UUA M;  2ZAM A;  5C18 A;  2LVP C;  2DNA A;  3Q8G A;  1GJT A;  1SXJ A;  4AQY M;  3FE3 A;  3PFI A;  1D0L A;  2D7G A;  4G6Z A;  3KP0 E;  4FVM A;  4IJE A;  1SXJ B;  2XF3 A;  2Z4R A;  2KZS A;  3OTO M;  5EQT A;  2QHO B;  1IY2 A;  1WXQ A;  1VQ1 A;  1LTM A;  1N36 M;  1OFI A;  3K92 A;  4LRT A;  4PDG A;  4DV1 M;  3NBX X;  2WSC F;  2CHG A;  3VDP A;  3AKZ A;  2XH9 A;  3KOY E;  2MR9 A;  4QOS A;  4LRS A;  1R2Z A;  3RGP A;  1HT2 E;  4LY6 A;  2BWE A;  4JI0 M;  4BBA A;  3U61 A;  3Q8X A;  1Z5C A;  2OOB A;  3K9P A;  1N32 M;  4GIT A;  4QHT A;  3IG8 A;  3E9S A;  4LJ5 A;  1CUK A;  3KVW A;  5FTJ A;  3GLF A;  3RFW A;  2RRU A;  1SXJ C;  4DR4 M;  4IBJ A;  2DXI A;  1OAO C;  1KSF X;  3L29 A;  2YR0 A;  5EP1 A;  4UN2 B;  1HQC A;  4M9S A;  5C1B A;  4LFB M;  1E32 A;  4G4O A;  2KXE A;  2ZAO A;  2CEA A;  3KS8 A;  3J80 S;  3ZQJ A;  1XNR M;  2JY7 A;  1AIP C;  2LNH C;  3CTW B;  4I81 A;  2I7N A;  1GAB A;  4AKI A;  3B7Q A;  2LVN C;  1KFV A;  3VKH A;  3HHW A;  3GLG B;  1G8P A;  1TF0 B;  3LVW A;  4GMQ A;  1UM8 A;  3KOX E;  4PDI A;  4G4Q A;  2UUC M;  4L78 A;  3UK6 A;  4PD2 A;  2JY6 B;  1GLN A;  1NY5 A;  3FYD A;  1PGY A;  3J2P B;  3WHK A;  2X8A A;  3TPZ A;  3GPP A;  4DV2 M;  1Q3C A;  3AFH A;  1IN8 A;  1DGH B;  3B74 A;  3MMP A;  2DZL A;  4NSR A;  2XZU A;  1PJI A;  4RKU F;  3NWL A;  3PNY A;  4WUR A;  2EA0 A;  5KPT A;  3GLG E;  1PJT A; 
#chains in the Genus database with same CATH homology
 4GH9 A;  3TWL A;  1G59 A;  3C58 A;  4GC9 A;  4IBB A;  4QHS A;  2BJW A;  2R18 A;  2V1U A;  2DWN A;  2C9C A;  1XNQ M;  4GRI A;  2XSZ A;  2VQE M;  5FTM A;  4GKJ M;  2FNA A;  2C99 A;  4MGY E;  4DR2 M;  2UXC M;  5KQD A;  3TL4 X;  1JR3 D;  4JI5 M;  3KS4 A;  4CHT B;  5FSW A;  2OQ4 A;  3HWS A;  4LGM A;  2XZF A;  4R3D A;  5ITR A;  4GIP A;  3MHV C;  4NSO B;  4OVZ A;  4DUY M;  2DWZ B;  2QEN A;  2R46 A;  3AV0 A;  4LJ4 A;  3SAS A;  2L09 A;  1L2B A;  1TH3 A;  1HNX M;  1L2D A;  1N33 M;  4CGY B;  3HJQ A;  3L28 A;  5BR8 M;  2AHM A;  1ZQ9 A;  4G4N A;  1G41 A;  3FD9 A;  4MH0 E;  1K82 A;  3NBI A;  4L15 A;  4LFA M;  3H4M A;  3J7B A;  4IBD A;  2KEB A;  2YNM D;  3K1J A;  3MK6 A;  3THG A;  3J7A S;  4B3R M;  4AI6 A;  2O5R A;  1R2Y A;  3QAU A;  5DYG A;  1R7R A;  1IN4 A;  3ILK A;  4X65 M;  4D81 A;  4JV5 M;  5KQ8 A;  4LJ9 A;  1DGG A;  4X64 M;  3DZD A;  2BJV A;  3T15 A;  1QAM A;  2XGN A;  2Z3X A;  3KP1 E;  2QP9 X;  4AKG A;  2R62 A;  3SAV A;  1TDZ A;  5ITX E;  1IBL M;  5JI2 E;  1IBM M;  4LJA A;  4D80 A;  2XFS A;  4IBC A;  1JR3 A;  3HHY A;  4Z6Y A;  3GQ4 A;  1XMO M;  3VFD A;  1PJJ A;  4L8R C;  1J5E M;  4KHP M;  1XHB A;  3QWL A;  1T3T A;  4LF8 M;  2HL7 A;  2CHV A;  4KOD A;  1L2C A;  2R45 A;  3DFZ A;  1IY0 A;  2XSZ D;  2X49 A;  3R9X B;  3SC3 A;  2KZU A;  4LFC M;  5F3W A;  4JI3 M;  4PCZ A;  3ZCB B;  3GRY A;  4QNM A;  5GKN A;  2OPF A;  1K3X A;  1QAQ A;  4LF7 M;  4OX9 M;  1FNN A;  3MJ5 A;  2C98 A;  2Y20 A;  2H1R A;  1DGF A;  4RF1 A;  1K3W A;  4QOZ C;  2CFO A;  4IBF A;  4B3S M;  1MU5 A;  1IY1 A;  1SXJ D;  4FD2 A;  3HU2 A;  2KW0 A;  1Z5B A;  4MM3 B;  1GL7 A;  3VKG A;  4DR7 M;  3HHZ A;  2JA2 A;  4DV5 M;  4K0K M;  4M9X A;  2EO2 A;  3J27 B;  2RGH A;  4NRW A;  4L4U A;  3B9P A;  4FWH A;  4RF0 A;  2I7P A;  4HLQ A;  5IZ7 D;  1DO2 A;  5E6J A;  4LJ7 A;  1D2N A;  3D8B A;  1GL6 A;  3HGI A;  5FTL A;  3AJI B;  2NQ8 C;  4FW9 A;  1Z6T A;  1FJG M;  1L8Q A;  2G8L A;  3HJS A;  4JI2 M;  3KFU G;  1J7K A;  4FCW A;  1QZM A;  4Z8X A;  1EE8 A;  3UJN A;  3A46 A;  1SXJ E;  4YY3 M;  3PVS A;  3GRU A;  4XGI A;  2QCU A;  4II7 A;  2RKO A;  3UZU A;  4LF9 M;  3KOZ E;  1NHG C;  4NL4 H;  2XLJ A;  3U6E A;  4GC5 A;  3SAW A;  4LF4 M;  1IXR C;  2FE8 A;  2HCB A;  3TWM A;  4GHL A;  3AOG A;  4FCT A;  3L27 A;  3GQ3 A;  2Y0T A;  4M0W A;  1I94 M;  3TE6 A;  4R7G A;  4EIW A;  3WHL A;  2F5Q A;  2DHR A;  3DOA A;  3GRR A;  2V1C A;  2X4A A;  3U6O A;  5KPZ A;  3GPX A;  1NNU C;  2FOI C;  3LMM A;  5ITQ A;  1S3S A;  4DV7 M;  1TH4 A;  3FUT A;  1OFH A;  4NXM M;  3VDU A;  4I8O A;  3JR5 A;  4KLN A;  3IG5 A;  1HNZ M;  3SYL A;  1W5S A;  4NRV A;  1NVM A;  4A3V B;  3U5Z B;  1IQP A;  4B7F A;  1DGB A;  2R4E A;  4JI6 M;  3A42 A;  5IRE B;  1ZAE A;  3HJ8 A;  1NJF A;  8CAT A;  5ITU A;  1YUB A;  4LZJ A;  1H6U A;  3JR4 A;  5LMN M;  1NJG A;  3GP1 A;  2E5L M;  4LGY A;  2CV1 A;  3GLH A;  1QQW A;  2ZM6 M;  3T1Y M;  2Y21 A;  5EP3 A;  4AW4 A;  4B7H A;  4JN6 A;  2CV0 A;  3FKE A;  1N34 M;  1G4A E;  2F5S A;  1NSF A;  4OVZ B;  2DZN B;  3U6C A;  3L2A A;  2ERC A;  3SYK A;  3U6M A;  1NNJ A;  4B3T M;  4ITQ A;  3U6S A;  4M0D A;  2UXD M;  1N75 A;  4IBI A;  1ORY B;  3FTD A;  4IBG A;  5EXP A;  4S12 A;  3SFZ A;  2KRK A;  3ZH9 B;  3VK8 A;  1L1Z A;  1HT1 E;  3GLG A;  2M60 A;  1DO0 A;  3PNV A;  1XXH B;  3CF2 A;  3U60 B;  3M6A A;  3KW6 A;  3I51 A;  5ITY A;  1IBK M;  3FTC A;  4GHA A;  1Q39 A;  2K47 A;  1GVN A;  1N77 A;  3SAR A;  4JI4 M;  1E9R A;  3AOE C;  4AKH A;  4FWD A;  1L1T A;  2Z4S A;  2VII A;  2RGO A;  3UGJ A;  1J09 A;  4B3M M;  3A98 B;  4AG6 A;  1KYI A;  3EIH A;  1QAN A;  3GLI B;  5JI3 E;  2C5R A;  3SHF A;  2QBY B;  2UU9 M;  2J7N A;  1IN7 A;  3FUV A;  1Z59 A;  1Q3B A;  1QAO A;  3T1H M;  4DV3 M;  3KSX A;  1TGU A;  1I4W A;  3KDS E;  4AZF A;  1LV7 A;  3BOS A;  3U61 B;  4DV6 M;  3VLF B;  4JI8 M;  3D8L A;  1E94 E;  3FYC A;  3HU1 A;  3SMS A;  4AG5 A;  1OJL A;  4IIW A;  4CIS A;  2DZO B;  5IWA M;  3DA1 A;  4I5S A;  5FTN A;  4OU7 A;  4LZZ A;  5EJC A;  2HHH M;  1MX0 A;  5EP4 A;  4NXN M;  4NOO B;  3SAU A;  3GPY A;  5DNY A;  2D7H A;  5IT9 S;  2P5T A;  3FUX A;  2DVW B;  3TWK A;  3I4Y A;  3GPU A;  2C96 A;  2F4V M;  4IBK A;  4LF6 M;  1GKI A;  5A2Q S;  4X62 M;  3U6D A;  1XXH A;  2L7H A;  2XEP A;  1XC8 A;  4DUZ M;  1IXS B;  2F5N A;  2J7O A;  4M9Z A;  2CE7 A;  3U6Q A;  3PXG A;  3GLH B;  3L26 A;  3SMP A;  4DV4 M;  2C9O A;  4W5W A;  2KRU A;  2V6Z M;  4FCV A;  3TQS A;  7CAT A;  4IBE A;  3U60 A;  4MGH A;  4OW0 A;  1QYR A;  1W5T A;  5FTK A;  3W0L B;  4XBO A;  3M7G A;  1G3I A;  3SAT A;  2HKJ A;  2Z7J A;  4JXJ A;  4B08 A;  3FTF A;  4TUW A;  1PM5 A;  2G5G X;  5EXX A;  1XMQ M;  2CUZ A;  3HU3 A;  2XFT A;  4P16 A;  3ZC7 B;  2Q2E B;  2YQZ A;  3AOE A;  4I4L A;  4DR3 M;  3SBJ A;  2LWX A;  3W0F A;  1QVR A;  1IM2 A;  3JAM S;  3CF0 A;  4FWG A;  1C1K A;  2VQF M;  1N78 A;  3LVV A;  2CHQ A;  2LXE A;  1DGH A;  4KO8 A;  2CV2 A;  2F5P A;  3UMM A;  3U6L A;  4BB9 A;  1YSY A;  2L6O A;  1HQY E;  3M0E A;  2DWM A;  3GO8 A;  5ITT A;  5ITX A;  4WW0 A;  4D82 A;  3KSJ A;  1R6B X;  4DV0 M;  1IN6 A;  2DWL A;  2KA6 B;  3LQQ A;  3RE8 A;  2D7E A;  1NY6 A;  2L7I A;  1NHW C;  4LF5 M;  4MGI E;  2QPA A;  4GKK M;  4DR6 M;  2UXB M;  5EP2 A;  4ZPX A;  4JI1 M;  5EXT A;  1VDD A;  2ZBK B;  3RGS A;  4LJ8 A;  5E26 A;  3U6P A;  3U5Z A;  4HL4 A;  4B7G A;  1TH2 A;  4IJF A;  3SHG B;  5H37 D;  2EUC A;  1YE9 A;  1HR0 M;  1X37 A;  4MB7 A;  1IN5 A;  3R8F A;  3FUU A;  1TDH A;  2YFQ A;  3HHX A;  3K2L A;  4DR5 M;  4MGZ E;  1JQJ C;  5LMU M;  4LCB A;  3A45 A;  4G4R A;  5DYI A;  4LG2 A;  5FLX S;  3KXE C;  2QZ4 A;  1IXZ A;  4PT5 A;  3T38 A;  4RNA A;  4REZ A;  4L16 A;  2M5Z A;  3KOW E;  3FUW A;  2R65 A;  3K8Z A;  3J81 S;  2BNK A;  3VK7 A;  2LH0 A;  2ZAN A;  2R4J A;  2UUB M;  1E9S A;  4JI7 M;  1HNW M;  4JYA M;  2F5O A;  3AL0 C;  3GQ5 A;  4X66 M;  3CF6 E;  2A5Y B;  3HKP A;  4LJ6 A;  4QNR A;  1XWI A;  4DR1 M;  3EIE A;  2Y0Q A;  4MGK E;  3LQR A;  2QBY A;  3FTE A;  2FFJ A;  3GLI A;  3GLF B;  1Z5A A;  3L25 A;  4BLC A;  5BPV A;  3I4V A;  2W82 A;  4YHH M;  5KPR A;  5KO3 A;  3E4R A;  3GRV A;  2UUA M;  2ZAM A;  5C18 A;  1SXJ A;  4AQY M;  3PFI A;  2D7G A;  4G6Z A;  3KP0 E;  4FVM A;  4IJE A;  1SXJ B;  2XF3 A;  2Z4R A;  2KZS A;  3OTO M;  5EQT A;  1IY2 A;  1WXQ A;  1N36 M;  1OFI A;  3K92 A;  4LRT A;  4PDG A;  4DV1 M;  2CHG A;  3VDP A;  3AKZ A;  2XH9 A;  3KOY E;  4QOS A;  1R2Z A;  4LRS A;  3RGP A;  1HT2 E;  4LY6 A;  4BBA A;  4JI0 M;  3U61 A;  3Q8X A;  1Z5C A;  1N32 M;  4GIT A;  4QHT A;  3IG8 A;  3E9S A;  4LJ5 A;  3GLF A;  3KVW A;  5FTJ A;  3RFW A;  1SXJ C;  4DR4 M;  4IBJ A;  2DXI A;  3L29 A;  1KSF X;  2YR0 A;  5EP1 A;  1HQC A;  4M9S A;  5C1B A;  4LFB M;  1E32 A;  4G4O A;  2KXE A;  2ZAO A;  2CEA A;  3KS8 A;  3J80 S;  1XNR M;  3CTW B;  4I81 A;  2LNH C;  4AKI A;  2I7N A;  1KFV A;  3VKH A;  3HHW A;  3GLG B;  1G8P A;  3LVW A;  4GMQ A;  1UM8 A;  3KOX E;  4PDI A;  4G4Q A;  2UUC M;  4L78 A;  3UK6 A;  4PD2 A;  1GLN A;  1NY5 A;  3FYD A;  3J2P B;  3WHK A;  2X8A A;  3TPZ A;  3GPP A;  4DV2 M;  1Q3C A;  3AFH A;  1IN8 A;  1DGH B;  2XZU A;  4NSR A;  1PJI A;  3NWL A;  3PNY A;  4WUR A;  2EA0 A;  5KPT A;  5EXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...