3T1HM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1hM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1hM02
4AQYM 1XNRM 3GPUA 3GPXA 4DV4M 5ITTA 3VK7A 1HNXM 1XC8A 4LF9M 3J80S 4DUZM 4LFAM 1XMOM 2VQFM 4B3SM 5ITYA 4DR5M 3SAVA 3U6SA 2HKJA 2XZUA 4LF4M 2F5PA 2UUCM 4DV7M 4JI3M 5ITQA 1N32M 4X65M 3T1YM 1FJGM 1HNWM 4DUYM 1IBKM 3J81S 3W0FA 3U6PA 1XMQM 1HR0M 4JI4M 1N34M 4JI1M 4LF5M 1HNZM 1K82A 2F5NA 1PM5A 1MX0A 3TWKA 5ITRA 4G4NA 1Z5CA 2XZFA 2UXBM 5IWAM 5LMNM 4X62M 3TWMA 3GPPA 1TDHA 4B3TM 3GP1A 4B3MM 2ZBKB 1N36M 4ITQA 1MU5A 4NXNM 3U6LA 1Q39A 4X66M 3GQ4A 4DV0M 1EE8A 3U6CA 3A45A 1L1TA 4G4RA 4CISA 3C58A 3SARA 4YHHM 4DV2M 3SASA 2VQEM 2F5SA 4LF8M 1XNQM 3J7AS 4DV3M 1NNJA 3JR4A 3TWLA 3GPYA 4X64M 4YY3M 2ZM6M 4DR7M 1L1ZA 1Z59A 5ITUA 2EA0A 1L2DA 2UUAM 5IT9S 4GKKM 2UXCM 1TDZA 1R2ZA 4PD2A 1Z5AA 4DV5M 2Q2EB 1Q3CA 3U6OA 4DR4M 3T1HM 4MB7A 4NRWA 4JV5M 4DR1M 1Q3BA 4PDIA 1K3XA 3GQ3A 2UXDM 4LFBM 5FLXS 4JI0M 4K0KM 4PDGA 4JI2M 4LF6M 4B3RM 2OQ4A 4DV1M 3OTOM 5BR8M 4G4OA 2F5OA 2UU9M 5ITXA 4PCZA 1J5EM 3VK8A 3A42A 4JYAM 3U6MA 1IBMM 3JAMS 5LMUM 4DR3M 1Z5BA 4G4QA 2E5LM 4LF7M 4GKJM 3A46A 1I94M 2F5QA 2UUBM 4DV6M 2F4VM 1PJJA 1K3WA 3SBJA 3U6EA 1IBLM 2HHHM 1L2BA 3SAUA 4KHPM 3SATA 4NRVA 3GO8A 4DR2M 4NXMM 3U6QA 4JI5M 4OX9M 1KFVA 3DOAA 4JI8M 5A2QS 1R2YA 1L2CA 4LFCM 3SAWA 3JR5A 4JI6M 4DR6M 1N33M 5ITXE 2OPFA 3GQ5A 4JI7M 3U6DA 1PJIA
chains in the Genus database with same CATH superfamily
1WR1B 3EIHA 3LQQA 3K92A 1XNRM 3K9OA 3V76A 1QAOA 2R65A 2XEPA 3CF0A 4LFAM 1JQJC 4DUZM 2R4EA 1XMOM 4P16A 3CGWA 3DA1A 3FTDA 3HU3A 3PNVA 2DWNA 4B3SM 5ITYA 2LH0A 1LTMA 2RKOA 2XFSA 1YLAA 1FNNA 1EFUB 4JN6A 4QOSA 3IHPA 2XZUA 1QDTA 4MH0E 5F3WA 4BB9A 2CHGA 2C5RA 4AKHA 4AW4A 1X37A 3AOGA 1NY6A 2CHQA 2DZLA 3L29A 3NBXX 4IBDA 2APLA 3W0FA 3VKHA 4FWDA 3SFZA 1BVSA 3I01M 3PXGA 1S3SA 1JB0F 4JI4M 4LJ7A 3LQRA 1HNZM 3HHXA 3PNYA 1PM5A 1QAQA 1R5LA 1T3TA 2L2DA 4I8OA 5IWAM 5LMNM 1IN8A 3TWMA 3CTWB 3GPPA 1TDHA 2VIIA 4A3VB 3L25A 3FUTA 3B74A 4B3MM 2ZBKB 2JXNA 4Z6YA 3HHWA 2JY7A 4EIWA 2R6FA 2WSEF 3VDUA 2C96A 1IN7A 2DWMA 1EE8A 1J7KA 1Y8GA 7CATA 4D82A 2Z3XA 1L1TA 4G4RA 2R0IA 4CISA 4GC5A 1VDDA 2F5SA 4LF8M 3J7AS 4AI6A 2EKKA 3BOSA 2MH8A 3GRRA 3TWLA 3DZDA 1TTEA 3FYCA 4YY3M 2L4EA 4DBGB 3MK6A 1TH3A 4DR7M 4MGKE 4BBAA 2CV2A 2D7GA 8CATA 5IT9S 4GKKM 4XGIA 2UXCM 1WIVA 1R2ZA 2QPAA 2XGNA 1DGHA 3E21A 3GLIE 1D2NA 2R18A 3KW6A 3M6AA 3U5ZB 3GLIB 1Q3CA 2M5ZA 4D81A 3KOZE 3KP1E 3GRYA 2MROB 1IXZA 5KO3A 2CRUA 5E6JA 1N32M 2LVNC 1WHCA 1AIPC 5EQTA 4PDIA 3UMMA 1K3XA 2GQFA 3SYLA 1G41A 5FLXS 2CWBA 1V33A 2KHHA 2OQ4A 2OOAA 2F5OA 4M0DA 3M7GA 2YR0A 4PCZA 1QYRA 3VK8A 4CHTB 1SXJE 4R71A 1IBMM 2KZSA 3H4MA 3HX3A 1Z5BA 1G8PA 2XF3A 1N75A 4G6ZA 2DAIA 5FTKA 2DVWB 4CJ6A 3Q8GA 1GLNA 4BLCA 1XXHB 2YQZA 1HQCA 4GH9A 4ANRA 4NOOB 3SAUA 3E4RA 2KNZA 4NL4H 4NRVA 3SATA 2CHVA 1Q02A 1OIPA 5EXTA 5IZ7D 4F2LA 1NJGA 2QQ8A 2R44A 4ZPXA 3U61B 1P3QQ 3MMPA 4FWGA 4IBCA 4B7HA 1MJGM 1NV9A 3AL0C 1QQWA 4RKUF 4JI6M 2M60A 4B7FA 2WSFF 5ITXE 3HHZA 2JY5A 3HY5A 2OPFA 1VEKA 3E9SA 1TH2A 2YFQA 3U6DA 3GLFB 2UUAM 4KO8A 4AQYM 4B08A 2R4JA 4LZJA 1F4IA 1QDRA 3GLGE 2H1RA 1HNXM 2HWJA 1GABA 1IY2A 1PJTA 3NBIA 4LF9M 4NSRA 3J80S 2O5RA 2XSZA 3FUXA 4IBFA 5EXXA 2DZOB 2DHYA 2ZANA 2JZ0A 3L26A 2G5GX 4XBOA 4OW0A 2QBYA 4FD2A 3B89A 3I4YA 1DGBA 3ZH9B 3U5ZA 2UUCM 2JY8A 1XXHA 4HEOA 3RGSA 4F1IA 2DWLA 4X65M 2V6ZM 3H4JA 2JZ1A 4LGMA 2LVQD 4L4UA 2BWBA 1IN5A 3QAUA 3KOWE 1OAOC 4IIWA 4OU7A 2XH9A 2KW0A 2KA6B 1D0KA 1G71A 4S12A 4JI1M 3GLGA 4LF5M 2LWXA 3TWKA 1Z5CA 4AG5A 4X62M 3T6PA 3W68A 4B3TM 2Y20A 1KSFX 3GP1A 1WGLA 3IG5A 1MU5A 4IBKA 1G3IA 3BBZA 2Z8YM 4LJ5A 3CF6E 2Y21A 4X66M 3C9PA 3FUWA 2K0BX 4KLNA 1LV7A 3B7QA 1OIZA 2V1CA 4M0WA 3SARA 5IREB 3SASA 4GITA 3F92A 1GJSA 1NNJA 5FTMA 4X64M 2ZM6M 4NC6A 4QNMA 3HKPA 4UN2B 4OVZA 3FTCA 3SHGB 2DENA 1Z59A 3W0LB 2EA0A 1TGUA 1TDZA 4KT0F 2LHCA 1NNUC 2X4AA 4LJ9A 4LY6A 2XFTA 4QNRA 3UJNA 4DV5M 5JI3E 5KQ8A 4LG2A 2QCUA 1A5TA 4IBJA 3T1HM 4MB7A 2XSZD 3LCVB 3KVWA 4L15A 1IM2A 4CIZA 1Q3BA 3L27A 5DNYA 1OFHA 3I4VA 3C3DA 4AG6A 3SYKA 3GQ3A 2CEAA 4LFBM 2HAKA 4JI0M 1MN3A 2EKFA 4PDGA 1N77A 4Y28F 2NQ8C 2QSFX 4LF6M 2I7PA 3OTOM 1ZMWA 3KXEC 1GVNA 2GNOA 3AOEC 3B7NA 4GEWA 2DI0A 5C1BA 4LJ6A 4JYAM 2VDBB 3KS4A 2FH0A 3PVSA 5E26A 2KNVA 4DR3M 4G4QA 3SC3A 2LVPC 4GKJM 3A46A 5EXSA 4KODA 2ZTCA 4DV6M 1KYIA 3I04M 3HZJA 1K3WA 2KZUA 3U6EA 1R7RA 2DAMA 3SMPA 1WXQA 4QHSA 4KHPM 1GJTA 1QUSA 1VDLA 3HJSA 3LCUA 3GO8A 4WURA 3K9PA 3AKZA 1V92A 3TQSA 4JI5M 3DOAA 5A2QS 1L2CA 4FCVA 3SAWA 4AKGA 2O25A 2K47A 3D8BA 4GIPA 4DR6M 2D7EA 3TL4X 1SXJB 1XWIA 1VG5A 1SG9A 4LCBA 3NWLA 4I4LA 3EIEA 3GQ5A 1JR3E 1W5TA 3GRVA 4LGYA 2FE8A 4II7A 3W67A 2X8AA 4JXJA 4WW0A 3GPUA 1PRBA 4DV4M 1IXSA 3J7BA 5ITTA 3AOEA 1ORYB 3U60A 2QBYB 1N78A 1GO5A 1JR3A 3LVWA 1VEGA 4D80A 2G3QA 3KDSE 2VQFM 3IG8A 1ZMVA 2DNAA 5GKNA 3SAVA 3KSJA 5EP2A 3J27B 2DZNB 3GLIA 2DHRA 2HKJA 1C7YA 1OAIA 1IY1A 4LF4M 2F5PA 1RU3A 2ZTDA 5DYIA 4JI3M 3ILKA 2K6BA 1OTRA 1VEJA 2W82A 1GL7A 1KFVA 1IBKM 3LMMA 1NV8A 3U6PA 4QOZC 4B7GA 2BJVA 4CGYB 4DR2M 1IQPA 2QENA 4I81A 1R4GA 2DAEA 1HR0M 1R6BX 1N34M 3WHKA 1PGYA 2F5NA 1MX0A 1DO0A 1ZV1A 2ZAMA 2LNHC 2OOBA 1EIJA 1HQYE 3TE6A 3AFHA 4GHLA 2LHGA 3SMSA 3UZUA 3PFIA 1N36M 2DAKA 4ITQA 3U61A 4NXNM 1YE9A 2ERCA 1Q39A 3KSXA 3U6LA 1H6UA 3GQ4A 4M9XA 1HT1E 4REZA 1NHGC 3FRIA 4IBBA 4YHHM 2KRUA 1XNQM 2AHMA 2JWSA 1HJPA 4PT5A 3GPYA 3FTFA 2MR9A 1OFIA 1L1ZA 4MGHA 2HCBA 5KPZA 1WGNA 1UM8A 1XB2B 1E94E 2HL7A 2K9DA 2Z7JA 5ITUA 3FD9A 4Z8XA 4PD2A 3GLFA 4RF0A 3A98B 1YUBA 4W5WA 1Z5AA 2C9CA 1V34A 2BJWA 3GLHA 3U6OA 3I51A 2CUZA 2L7IA 1PJSA 1DGHB 1D0LA 1OQYA 2D7HA 4LJ4A 1C1KA 3HU2A 3AV0A 3HU1A 2UXDM 3QYEA 1Z6TA 2JP7A 5H37D 1D0MA 1SXJA 2CV0A 2I7NA 4B3RM 5BR8M 4G4OA 2BNKA 5ITXA 2J7NA 1UFZA 3VLFB 1J5EM 1ZAEA 3THGA 3Q8XA 3JAMS 4XK8F 1OJLA 2JNHA 3MJ5A 2E5LM 4LF7M 1I94M 3R9XB 1XXHE 1I4WA 3FYDA 5EP4A 2UUBM 1QZEA 1VQ1A 4GHAA 2F4VM 1ZQ9A 1PJJA 5BPVA 3WHLA 1NHWC 2WSCF 3U60B 4L78A 1HT2E 3GRUA 4FVMA 1IBLM 2HHHM 4NSOB 3ZC7B 1QVRA 3B7ZA 2RGOA 3HHYA 3UGJA 1GL6A 3U6QA 2P5TA 4OX9M 1E32A 4G3OA 4P17A 2L7HA 2LBCA 2FNAA 3GLHE 3IECA 5FTJA 2R46A 5FSWA 2L6OA 3M0EA 1XHBA 2JUJA 1T6OA 4OVZB 3JR5A 2JA2A 3UK6A 2V1UA 4L8RC 3GLFE 1IN6A 5FTNA 2B3TA 2MJ5B 4WP2A 1IXRC 3KFUG 1PJIA 1E9RA 2R45A 1OKSA 1JR3D 3K8ZA 3RFWA 3L28A 5KQDA 3GPXA 1WJ7A 3VK7A 5EJCA 4FW9A 2QNJA 1XC8A 3K2LA 5EP1A 2OO9A 1DGGA 2H5XA 1QUTA 3MHVC 3K1JA 5EXPA 2LVAA 3AJIB 3B9PA 4M9SA 4AZFA 4DR5M 2CV1A 5DFLA 3U6SA 4IBEA 3VKGA 5C18A 2L4FA 2LXEA 3GLHB 1IN4A 4M9ZA 4DV7M 5ITQA 2N35A 3KOXE 4FCWA 2FOIC 3R8FA 3KS8A 1FJGM 3T1YM 1HNWM 4GC9A 4LRSA 4DUYM 3J81S 4Q7JA 1QANA 4MGIE 5EP3A 4MGZE 1XMQM 2YNMD 3HGIA 1QAMA 2XLJA 3E46A 3FE3A 1K82A 1TF0B 2BWEA 1W5SA 5ITRA 4G4NA 4FCTA 2XZFA 2UXBM 4LZZA 1TH4A 5L8RF 3RGPA 2CE7A 4LJAA 1SXJD 3HJQA 3C3EA 4RNAA 4L16A 2DAGA 2O01F 2Y0QA 2KXEA 3KP0E 4DV0M 1NO1A 3U6CA 2L09A 3A45A 1G4AE 3DFZA 1QZMA 3C58A 4DV2M 2Y0TA 2RGHA 2VQEM 4R7GA 2C9OA 2Z4SA 4DV3M 1CUKA 1G59A 2X49A 4LRTA 3JR4A 3CF2A 4IBGA 3T38A 2QP9X 4HLQA 2EUCA 3HJ8A 1IXSB 2DKLA 2FS1A 4IJEA 5FTLA 1L2DA 1E9SA 3LW5F 2LVOC 3QYBA 2RRUA 2WZJA 3BXWA 4FWHA 5JI2E 3TPZA 1DGFA 1YSYA 2KDLA 2EO2A 2Q2EB 1J09A 4DR4M 2CFOA 2DWZB 2EJSA 4L6V6 1T43A 1IFYA 2KEBA 4NRWA 4JV5M 3VFDA 4DR1M 2MGWA 4IJFA 2KRKA 3L2AA 3HWSA 3FRHA 3VDPA 1NY5A 1SXJC 2VF8A 2A5YB 4K0KM 4JI2M 2CP8A 2R62A 3LVVA 2VF7A 4DV1M 4GMQA 4MM3B 1GKIA 2QHOB 2C98A 2G8LA 2UU9M 2QZ4A 5KPTA 2J5YA 3A42A 3FUUA 4MGYE 1AUAA 2Z4RA 3U6MA 4GRIA 2C99A 5LMUM 4IBIA 1NSFA 2F5QA 1PJQA 3T15A 1ZMUA 2J7OA 3GLGB 3ZCBB 4TUWA 5DYGA 3ZQJA 3SBJA 3KOYE 1L2BA 2ZAOA 4I5SA 1NVMA 4NXMM 4LJ8A 1DV0A 2DXIA 2FFJA 2JY6B 1L8QA 4JI8M 4LFCM 2KNAA 1R2YA 3D8LA 1TR8A 1IY0A 3SHFA 5KPRA 4AKIA 3FKEA 2LTUA 1N33M 3RE8A 3FUVA 3J2PB 3QWLA 4HL4A 1DO2A 4JI7M 3FTEA 4R3DA 4RF1A 4QHTA 1NJFA
chains in the Genus database with same CATH topology
3EIHA 3LQQA 3K92A 1XNRM 1QAOA 2R65A 2XEPA 3CF0A 4LFAM 1JQJC 4DUZM 2R4EA 1XMOM 4P16A 3FTDA 3DA1A 3PNVA 3HU3A 2DWNA 4B3SM 5ITYA 2LH0A 2RKOA 2XFSA 1FNNA 4JN6A 4QOSA 2XZUA 5F3WA 4MH0E 4BB9A 2CHGA 2C5RA 4AKHA 4AW4A 1X37A 3AOGA 1NY6A 2CHQA 3L29A 4IBDA 3W0FA 3VKHA 4FWDA 3SFZA 3PXGA 1S3SA 4JI4M 4LJ7A 3LQRA 1HNZM 3HHXA 3PNYA 1PM5A 1QAQA 1T3TA 4I8OA 5IWAM 5LMNM 1IN8A 3TWMA 3CTWB 3GPPA 1TDHA 2VIIA 4A3VB 3L25A 3FUTA 4B3MM 2ZBKB 4Z6YA 3HHWA 4EIWA 3VDUA 2C96A 1IN7A 2DWMA 1EE8A 1J7KA 7CATA 4D82A 2Z3XA 1L1TA 4G4RA 4CISA 4GC5A 1VDDA 2F5SA 4LF8M 3J7AS 4AI6A 3BOSA 3GRRA 3TWLA 3DZDA 3FYCA 4YY3M 3MK6A 1TH3A 4DR7M 4MGKE 4BBAA 2CV2A 2D7GA 8CATA 5IT9S 4GKKM 4XGIA 2UXCM 1R2ZA 2QPAA 2XGNA 1DGHA 1D2NA 2R18A 3KW6A 3M6AA 3U5ZB 3GLIB 1Q3CA 2M5ZA 4D81A 3KOZE 3KP1E 3GRYA 1IXZA 5KO3A 5E6JA 5EQTA 3UMMA 4PDIA 1K3XA 3SYLA 1G41A 5FLXS 2OQ4A 2F5OA 4M0DA 3M7GA 2YR0A 4PCZA 1QYRA 3VK8A 4CHTB 1SXJE 1IBMM 2KZSA 3H4MA 1Z5BA 1G8PA 2XF3A 1N75A 4G6ZA 5FTKA 2DVWB 1GLNA 4BLCA 1XXHB 2YQZA 1HQCA 4GH9A 4NOOB 3SAUA 3E4RA 4NL4H 3SATA 4NRVA 2CHVA 5IZ7D 5EXTA 3U61B 1KFVA 1NJGA 4ZPXA 4FWGA 4IBCA 4B7HA 3AL0C 1QQWA 4JI6M 2M60A 4B7FA 5ITXE 3HHZA 2OPFA 3E9SA 2YFQA 1TH2A 3U6DA 3GLFB 2UUAM 4KO8A 4AQYM 4B08A 2R4JA 4LZJA 2H1RA 1HNXM 1IY2A 3NBIA 4LF9M 4NSRA 3J80S 2O5RA 2XSZA 3FUXA 4IBFA 5EXXA 2DZOB 2ZANA 3L26A 2G5GX 4XBOA 4OW0A 2QBYA 4FD2A 3I4YA 1DGBA 3ZH9B 3U5ZA 2UUCM 1XXHA 2DWLA 3RGSA 4X65M 2V6ZM 4LGMA 4L4UA 1IN5A 3QAUA 3KOWE 4IIWA 4OU7A 2XH9A 2KW0A 2KA6B 4S12A 4JI1M 3GLGA 4LF5M 2LWXA 3TWKA 1Z5CA 4AG5A 4X62M 4B3TM 2Y20A 1KSFX 3GP1A 3IG5A 1MU5A 4IBKA 1G3IA 4LJ5A 3CF6E 2Y21A 4X66M 3FUWA 4KLNA 1LV7A 3SARA 2V1CA 4M0WA 5IREB 3SASA 4GITA 1NNJA 5FTMA 4X64M 2ZM6M 4QNMA 3HKPA 4OVZA 3FTCA 3SHGB 1Z59A 3W0LB 2EA0A 1TGUA 1TDZA 1NNUC 2X4AA 4LJ9A 4LY6A 2XFTA 4QNRA 3UJNA 4DV5M 5JI3E 5KQ8A 4LG2A 2QCUA 4IBJA 3T1HM 4MB7A 2XSZD 3KVWA 4L15A 1IM2A 1Q3BA 3L27A 5DNYA 1OFHA 3I4VA 4AG6A 3SYKA 3GQ3A 2CEAA 4LFBM 4JI0M 4PDGA 1N77A 2NQ8C 4LF6M 2I7PA 3OTOM 3KXEC 1GVNA 3AOEC 5C1BA 4LJ6A 4JYAM 3PVSA 3KS4A 5E26A 4DR3M 4G4QA 3SC3A 4GKJM 3A46A 5EXSA 4KODA 4DV6M 1KYIA 1K3WA 2KZUA 3U6EA 1R7RA 3SMPA 1WXQA 4QHSA 4KHPM 3HJSA 3GO8A 4DR2M 4WURA 3AKZA 3TQSA 4JI5M 3DOAA 5A2QS 1L2CA 4FCVA 3SAWA 4AKGA 2K47A 3D8BA 4GIPA 4DR6M 2D7EA 3TL4X 1SXJB 1XWIA 4LCBA 3NWLA 4I4LA 3EIEA 3GQ5A 1W5TA 3GRVA 4LGYA 2FE8A 4II7A 2X8AA 4JXJA 4WW0A 3GPUA 4DV4M 5ITTA 3J7BA 1N78A 3AOEA 1ORYB 3U60A 2QBYB 1JR3A 3LVWA 4D80A 3KDSE 2VQFM 3IG8A 5GKNA 3SAVA 3KSJA 5EP2A 3J27B 2DZNB 3GLIA 2DHRA 2HKJA 1IY1A 4LF4M 2F5PA 5DYIA 4JI3M 3ILKA 2W82A 1GL7A 1IBKM 3LMMA 3U6PA 4QOZC 4B7GA 2BJVA 4CGYB 1IQPA 2QENA 4I81A 1HR0M 1R6BX 1N34M 3WHKA 2F5NA 1MX0A 1DO0A 2ZAMA 2LNHC 1HQYE 3TE6A 3AFHA 4GHLA 3SMSA 3UZUA 1N36M 3PFIA 4ITQA 3U61A 4NXNM 1YE9A 2ERCA 1Q39A 3KSXA 3U6LA 1H6UA 3GQ4A 4M9XA 1HT1E 4REZA 1NHGC 4IBBA 4YHHM 2KRUA 1XNQM 2AHMA 4PT5A 3GPYA 3FTFA 1OFIA 1L1ZA 4MGHA 2HCBA 5KPZA 5ITUA 1UM8A 2HL7A 1E94E 2Z7JA 3FD9A 4Z8XA 4PD2A 3GLFA 4RF0A 3A98B 1YUBA 4W5WA 1Z5AA 2C9CA 3GLHA 2BJWA 3U6OA 3I51A 2CUZA 2L7IA 1DGHB 2D7HA 4LJ4A 1C1KA 3HU2A 3AV0A 3HU1A 2UXDM 1Z6TA 5H37D 1SXJA 2CV0A 2I7NA 4B3RM 5BR8M 4G4OA 2BNKA 5ITXA 2J7NA 3VLFB 1J5EM 1ZAEA 3THGA 3Q8XA 3JAMS 1OJLA 3MJ5A 2E5LM 4LF7M 1I94M 3R9XB 1I4WA 3FYDA 5EP4A 2UUBM 4GHAA 2F4VM 1ZQ9A 1PJJA 5BPVA 3WHLA 1NHWC 3U60B 4L78A 1HT2E 3GRUA 4FVMA 1IBLM 2HHHM 4NSOB 3ZC7B 1QVRA 3HHYA 2RGOA 3UGJA 1GL6A 3U6QA 2P5TA 4OX9M 1E32A 2L7HA 5FSWA 2FNAA 5FTJA 2R46A 3JR5A 2L6OA 3M0EA 1XHBA 4OVZB 2V1UA 4L8RC 2JA2A 3UK6A 1IN6A 5FTNA 1IXRC 3KFUG 1PJIA 1E9RA 2R45A 3K8ZA 1JR3D 3RFWA 3L28A 5KQDA 3GPXA 3VK7A 5EJCA 4FW9A 1XC8A 3K2LA 5EP1A 1DGGA 3MHVC 3K1JA 5EXPA 3B9PA 3AJIB 4AZFA 4M9SA 4DR5M 2CV1A 3U6SA 4IBEA 3VKGA 5C18A 3GLHB 2LXEA 4M9ZA 1IN4A 4DV7M 1N32M 5ITQA 4FCWA 3KOXE 2FOIC 3R8FA 3KS8A 1FJGM 3T1YM 1HNWM 4GC9A 4LRSA 4DUYM 3J81S 1QANA 4MGIE 5EP3A 4MGZE 1XMQM 2YNMD 3HGIA 1QAMA 2XLJA 1K82A 1W5SA 5ITRA 4G4NA 4FCTA 2XZFA 2UXBM 4LZZA 1TH4A 3RGPA 2CE7A 4LJAA 1SXJD 3HJQA 4RNAA 4L16A 2Y0QA 2KXEA 3KP0E 4DV0M 3U6CA 2L09A 3A45A 1G4AE 3DFZA 1QZMA 3C58A 4DV2M 2Y0TA 2RGHA 2VQEM 4R7GA 2C9OA 2Z4SA 4DV3M 1G59A 2X49A 4LRTA 3JR4A 3CF2A 4IBGA 3T38A 2QP9X 4HLQA 2EUCA 3HJ8A 1IXSB 4IJEA 5FTLA 1L2DA 1E9SA 5JI2E 4FWHA 3TPZA 1DGFA 1YSYA 2EO2A 2Q2EB 1J09A 4DR4M 2CFOA 2DWZB 2KEBA 4NRWA 4JV5M 3VFDA 4DR1M 4IJFA 2KRKA 3L2AA 3HWSA 3VDPA 1NY5A 1SXJC 2A5YB 4K0KM 4JI2M 2R62A 3LVVA 4DV1M 4GMQA 4MM3B 1GKIA 2C98A 2G8LA 2UU9M 2QZ4A 5KPTA 3A42A 3FUUA 4MGYE 2Z4RA 3U6MA 4GRIA 2C99A 5LMUM 4IBIA 1NSFA 2F5QA 3T15A 2J7OA 3GLGB 3ZCBB 4TUWA 5DYGA 3SBJA 3KOYE 1L2BA 2ZAOA 4I5SA 1NVMA 4NXMM 4LJ8A 2DXIA 2FFJA 4JI8M 1L8QA 4LFCM 1R2YA 3D8LA 1IY0A 3SHFA 5KPRA 4AKIA 3FKEA 1N33M 3RE8A 3FUVA 3J2PB 3QWLA 4HL4A 1DO2A 4JI7M 3FTEA 4R3DA 4RF1A 4QHTA 1NJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY M;  1XNR M;  3GPU A;  3GPX A;  4DV4 M;  5ITT A;  3VK7 A;  1HNX M;  1XC8 A;  4LF9 M;  3J80 S;  4DUZ M;  4LFA M;  1XMO M;  2VQF M;  4B3S M;  5ITY A;  4DR5 M;  3SAV A;  3U6S A;  2HKJ A;  2XZU A;  4LF4 M;  2F5P A;  2UUC M;  4DV7 M;  4JI3 M;  5ITQ A;  1N32 M;  4X65 M;  3T1Y M;  1FJG M;  1HNW M;  4DUY M;  1IBK M;  3J81 S;  3W0F A;  3U6P A;  1XMQ M;  1HR0 M;  4JI4 M;  1N34 M;  4JI1 M;  4LF5 M;  1HNZ M;  1K82 A;  2F5N A;  1PM5 A;  1MX0 A;  3TWK A;  5ITR A;  4G4N A;  1Z5C A;  2XZF A;  2UXB M;  5IWA M;  5LMN M;  4X62 M;  3TWM A;  3GPP A;  1TDH A;  4B3T M;  3GP1 A;  4B3M M;  2ZBK B;  1N36 M;  4ITQ A;  1MU5 A;  4NXN M;  3U6L A;  1Q39 A;  4X66 M;  3GQ4 A;  4DV0 M;  1EE8 A;  3U6C A;  3A45 A;  1L1T A;  4G4R A;  4CIS A;  3C58 A;  3SAR A;  4YHH M;  4DV2 M;  3SAS A;  2VQE M;  2F5S A;  4LF8 M;  1XNQ M;  3J7A S;  4DV3 M;  1NNJ A;  3JR4 A;  3TWL A;  3GPY A;  4X64 M;  4YY3 M;  2ZM6 M;  4DR7 M;  1L1Z A;  1Z59 A;  5ITU A;  2EA0 A;  1L2D A;  2UUA M;  5IT9 S;  4GKK M;  2UXC M;  1TDZ A;  1R2Z A;  4PD2 A;  1Z5A A;  4DV5 M;  2Q2E B;  1Q3C A;  3U6O A;  4DR4 M;  3T1H M;  4MB7 A;  4NRW A;  4JV5 M;  4DR1 M;  1Q3B A;  4PDI A;  1K3X A;  3GQ3 A;  2UXD M;  4LFB M;  5FLX S;  4JI0 M;  4K0K M;  4PDG A;  4JI2 M;  4LF6 M;  4B3R M;  2OQ4 A;  4DV1 M;  3OTO M;  5BR8 M;  4G4O A;  2F5O A;  2UU9 M;  5ITX A;  4PCZ A;  1J5E M;  3VK8 A;  3A42 A;  4JYA M;  3U6M A;  1IBM M;  3JAM S;  5LMU M;  4DR3 M;  1Z5B A;  4G4Q A;  2E5L M;  4LF7 M;  4GKJ M;  3A46 A;  1I94 M;  2F5Q A;  2UUB M;  4DV6 M;  2F4V M;  1PJJ A;  1K3W A;  3SBJ A;  3U6E A;  1IBL M;  2HHH M;  1L2B A;  3SAU A;  4KHP M;  3SAT A;  4NRV A;  3GO8 A;  4DR2 M;  4NXM M;  3U6Q A;  4JI5 M;  4OX9 M;  1KFV A;  3DOA A;  4JI8 M;  5A2Q S;  1R2Y A;  1L2C A;  4LFC M;  3SAW A;  3JR5 A;  4JI6 M;  4DR6 M;  1N33 M;  5ITX E;  2OPF A;  3GQ5 A;  4JI7 M;  3U6D A;  1PJI A; 
#chains in the Genus database with same CATH topology
 1WR1 B;  3EIH A;  3LQQ A;  3K92 A;  1XNR M;  3K9O A;  3V76 A;  1QAO A;  2R65 A;  2XEP A;  3CF0 A;  4LFA M;  1JQJ C;  4DUZ M;  2R4E A;  1XMO M;  4P16 A;  3CGW A;  3DA1 A;  3FTD A;  3HU3 A;  3PNV A;  2DWN A;  4B3S M;  5ITY A;  2LH0 A;  1LTM A;  2RKO A;  2XFS A;  1YLA A;  1FNN A;  1EFU B;  4JN6 A;  4QOS A;  3IHP A;  2XZU A;  1QDT A;  4MH0 E;  5F3W A;  4BB9 A;  2CHG A;  2C5R A;  4AKH A;  4AW4 A;  1X37 A;  3AOG A;  1NY6 A;  2CHQ A;  2DZL A;  3L29 A;  3NBX X;  4IBD A;  2APL A;  3W0F A;  3VKH A;  4FWD A;  3SFZ A;  1BVS A;  3I01 M;  3PXG A;  1S3S A;  1JB0 F;  4JI4 M;  4LJ7 A;  3LQR A;  1HNZ M;  3HHX A;  3PNY A;  1PM5 A;  1QAQ A;  1R5L A;  1T3T A;  2L2D A;  4I8O A;  5IWA M;  5LMN M;  1IN8 A;  3TWM A;  3CTW B;  3GPP A;  1TDH A;  2VII A;  4A3V B;  3L25 A;  3FUT A;  3B74 A;  4B3M M;  2ZBK B;  2JXN A;  4Z6Y A;  3HHW A;  2JY7 A;  4EIW A;  2R6F A;  2WSE F;  3VDU A;  2C96 A;  1IN7 A;  2DWM A;  1EE8 A;  1J7K A;  1Y8G A;  7CAT A;  4D82 A;  2Z3X A;  1L1T A;  4G4R A;  2R0I A;  4CIS A;  4GC5 A;  1VDD A;  2F5S A;  4LF8 M;  3J7A S;  4AI6 A;  2EKK A;  3BOS A;  2MH8 A;  3GRR A;  3TWL A;  3DZD A;  1TTE A;  3FYC A;  4YY3 M;  2L4E A;  4DBG B;  3MK6 A;  1TH3 A;  4DR7 M;  4MGK E;  4BBA A;  2CV2 A;  2D7G A;  8CAT A;  5IT9 S;  4GKK M;  4XGI A;  2UXC M;  1WIV A;  1R2Z A;  2QPA A;  2XGN A;  1DGH A;  3E21 A;  3GLI E;  1D2N A;  2R18 A;  3KW6 A;  3M6A A;  3U5Z B;  3GLI B;  1Q3C A;  2M5Z A;  4D81 A;  3KOZ E;  3KP1 E;  3GRY A;  2MRO B;  1IXZ A;  5KO3 A;  2CRU A;  5E6J A;  1N32 M;  2LVN C;  1WHC A;  1AIP C;  5EQT A;  4PDI A;  3UMM A;  1K3X A;  2GQF A;  3SYL A;  1G41 A;  5FLX S;  2CWB A;  1V33 A;  2KHH A;  2OQ4 A;  2OOA A;  2F5O A;  4M0D A;  3M7G A;  2YR0 A;  4PCZ A;  1QYR A;  3VK8 A;  4CHT B;  1SXJ E;  4R71 A;  1IBM M;  2KZS A;  3H4M A;  3HX3 A;  1Z5B A;  1G8P A;  2XF3 A;  1N75 A;  4G6Z A;  2DAI A;  5FTK A;  2DVW B;  4CJ6 A;  3Q8G A;  1GLN A;  4BLC A;  1XXH B;  2YQZ A;  1HQC A;  4GH9 A;  4ANR A;  4NOO B;  3SAU A;  3E4R A;  2KNZ A;  4NL4 H;  4NRV A;  3SAT A;  2CHV A;  1Q02 A;  1OIP A;  5EXT A;  5IZ7 D;  4F2L A;  1NJG A;  2QQ8 A;  2R44 A;  4ZPX A;  3U61 B;  1P3Q Q;  3MMP A;  4FWG A;  4IBC A;  4B7H A;  1MJG M;  1NV9 A;  3AL0 C;  1QQW A;  4RKU F;  4JI6 M;  2M60 A;  4B7F A;  2WSF F;  5ITX E;  3HHZ A;  2JY5 A;  3HY5 A;  2OPF A;  1VEK A;  3E9S A;  1TH2 A;  2YFQ A;  3U6D A;  3GLF B;  2UUA M;  4KO8 A;  4AQY M;  4B08 A;  2R4J A;  4LZJ A;  1F4I A;  1QDR A;  3GLG E;  2H1R A;  1HNX M;  2HWJ A;  1GAB A;  1IY2 A;  1PJT A;  3NBI A;  4LF9 M;  4NSR A;  3J80 S;  2O5R A;  2XSZ A;  3FUX A;  4IBF A;  5EXX A;  2DZO B;  2DHY A;  2ZAN A;  2JZ0 A;  3L26 A;  2G5G X;  4XBO A;  4OW0 A;  2QBY A;  4FD2 A;  3B89 A;  3I4Y A;  1DGB A;  3ZH9 B;  3U5Z A;  2UUC M;  2JY8 A;  1XXH A;  4HEO A;  3RGS A;  4F1I A;  2DWL A;  4X65 M;  2V6Z M;  3H4J A;  2JZ1 A;  4LGM A;  2LVQ D;  4L4U A;  2BWB A;  1IN5 A;  3QAU A;  3KOW E;  1OAO C;  4IIW A;  4OU7 A;  2XH9 A;  2KW0 A;  2KA6 B;  1D0K A;  1G71 A;  4S12 A;  4JI1 M;  3GLG A;  4LF5 M;  2LWX A;  3TWK A;  1Z5C A;  4AG5 A;  4X62 M;  3T6P A;  3W68 A;  4B3T M;  2Y20 A;  1KSF X;  3GP1 A;  1WGL A;  3IG5 A;  1MU5 A;  4IBK A;  1G3I A;  3BBZ A;  2Z8Y M;  4LJ5 A;  3CF6 E;  2Y21 A;  4X66 M;  3C9P A;  3FUW A;  2K0B X;  4KLN A;  1LV7 A;  3B7Q A;  1OIZ A;  2V1C A;  4M0W A;  3SAR A;  5IRE B;  3SAS A;  4GIT A;  3F92 A;  1GJS A;  1NNJ A;  5FTM A;  4X64 M;  2ZM6 M;  4NC6 A;  4QNM A;  3HKP A;  4UN2 B;  4OVZ A;  3FTC A;  3SHG B;  2DEN A;  1Z59 A;  3W0L B;  2EA0 A;  1TGU A;  1TDZ A;  4KT0 F;  2LHC A;  1NNU C;  2X4A A;  4LJ9 A;  4LY6 A;  2XFT A;  4QNR A;  3UJN A;  4DV5 M;  5JI3 E;  5KQ8 A;  4LG2 A;  2QCU A;  1A5T A;  4IBJ A;  3T1H M;  4MB7 A;  2XSZ D;  3LCV B;  3KVW A;  4L15 A;  1IM2 A;  4CIZ A;  1Q3B A;  3L27 A;  5DNY A;  1OFH A;  3I4V A;  3C3D A;  4AG6 A;  3SYK A;  3GQ3 A;  2CEA A;  4LFB M;  2HAK A;  4JI0 M;  1MN3 A;  2EKF A;  4PDG A;  1N77 A;  4Y28 F;  2NQ8 C;  2QSF X;  4LF6 M;  2I7P A;  3OTO M;  1ZMW A;  3KXE C;  1GVN A;  2GNO A;  3AOE C;  3B7N A;  4GEW A;  2DI0 A;  5C1B A;  4LJ6 A;  4JYA M;  2VDB B;  3KS4 A;  2FH0 A;  3PVS A;  5E26 A;  2KNV A;  4DR3 M;  4G4Q A;  3SC3 A;  2LVP C;  4GKJ M;  3A46 A;  5EXS A;  4KOD A;  2ZTC A;  4DV6 M;  1KYI A;  3I04 M;  3HZJ A;  1K3W A;  2KZU A;  3U6E A;  1R7R A;  2DAM A;  3SMP A;  1WXQ A;  4QHS A;  4KHP M;  1GJT A;  1QUS A;  1VDL A;  3HJS A;  3LCU A;  3GO8 A;  4WUR A;  3K9P A;  3AKZ A;  1V92 A;  3TQS A;  4JI5 M;  3DOA A;  5A2Q S;  1L2C A;  4FCV A;  3SAW A;  4AKG A;  2O25 A;  2K47 A;  3D8B A;  4GIP A;  4DR6 M;  2D7E A;  3TL4 X;  1SXJ B;  1XWI A;  1VG5 A;  1SG9 A;  4LCB A;  3NWL A;  4I4L A;  3EIE A;  3GQ5 A;  1JR3 E;  1W5T A;  3GRV A;  4LGY A;  2FE8 A;  4II7 A;  3W67 A;  2X8A A;  4JXJ A;  4WW0 A;  3GPU A;  1PRB A;  4DV4 M;  1IXS A;  3J7B A;  5ITT A;  3AOE A;  1ORY B;  3U60 A;  2QBY B;  1N78 A;  1GO5 A;  1JR3 A;  3LVW A;  1VEG A;  4D80 A;  2G3Q A;  3KDS E;  2VQF M;  3IG8 A;  1ZMV A;  2DNA A;  5GKN A;  3SAV A;  3KSJ A;  5EP2 A;  3J27 B;  2DZN B;  3GLI A;  2DHR A;  2HKJ A;  1C7Y A;  1OAI A;  1IY1 A;  4LF4 M;  2F5P A;  1RU3 A;  2ZTD A;  5DYI A;  4JI3 M;  3ILK A;  2K6B A;  1OTR A;  1VEJ A;  2W82 A;  1GL7 A;  1KFV A;  1IBK M;  3LMM A;  1NV8 A;  3U6P A;  4QOZ C;  4B7G A;  2BJV A;  4CGY B;  4DR2 M;  1IQP A;  2QEN A;  4I81 A;  1R4G A;  2DAE A;  1HR0 M;  1R6B X;  1N34 M;  3WHK A;  1PGY A;  2F5N A;  1MX0 A;  1DO0 A;  1ZV1 A;  2ZAM A;  2LNH C;  2OOB A;  1EIJ A;  1HQY E;  3TE6 A;  3AFH A;  4GHL A;  2LHG A;  3SMS A;  3UZU A;  3PFI A;  1N36 M;  2DAK A;  4ITQ A;  3U61 A;  4NXN M;  1YE9 A;  2ERC A;  1Q39 A;  3KSX A;  3U6L A;  1H6U A;  3GQ4 A;  4M9X A;  1HT1 E;  4REZ A;  1NHG C;  3FRI A;  4IBB A;  4YHH M;  2KRU A;  1XNQ M;  2AHM A;  2JWS A;  1HJP A;  4PT5 A;  3GPY A;  3FTF A;  2MR9 A;  1OFI A;  1L1Z A;  4MGH A;  2HCB A;  5KPZ A;  1WGN A;  1UM8 A;  1XB2 B;  1E94 E;  2HL7 A;  2K9D A;  2Z7J A;  5ITU A;  3FD9 A;  4Z8X A;  4PD2 A;  3GLF A;  4RF0 A;  3A98 B;  1YUB A;  4W5W A;  1Z5A A;  2C9C A;  1V34 A;  2BJW A;  3GLH A;  3U6O A;  3I51 A;  2CUZ A;  2L7I A;  1PJS A;  1DGH B;  1D0L A;  1OQY A;  2D7H A;  4LJ4 A;  1C1K A;  3HU2 A;  3AV0 A;  3HU1 A;  2UXD M;  3QYE A;  1Z6T A;  2JP7 A;  5H37 D;  1D0M A;  1SXJ A;  2CV0 A;  2I7N A;  4B3R M;  5BR8 M;  4G4O A;  2BNK A;  5ITX A;  2J7N A;  1UFZ A;  3VLF B;  1J5E M;  1ZAE A;  3THG A;  3Q8X A;  3JAM S;  4XK8 F;  1OJL A;  2JNH A;  3MJ5 A;  2E5L M;  4LF7 M;  1I94 M;  3R9X B;  1XXH E;  1I4W A;  3FYD A;  5EP4 A;  2UUB M;  1QZE A;  1VQ1 A;  4GHA A;  2F4V M;  1ZQ9 A;  1PJJ A;  5BPV A;  3WHL A;  1NHW C;  2WSC F;  3U60 B;  4L78 A;  1HT2 E;  3GRU A;  4FVM A;  1IBL M;  2HHH M;  4NSO B;  3ZC7 B;  1QVR A;  3B7Z A;  2RGO A;  3HHY A;  3UGJ A;  1GL6 A;  3U6Q A;  2P5T A;  4OX9 M;  1E32 A;  4G3O A;  4P17 A;  2L7H A;  2LBC A;  2FNA A;  3GLH E;  3IEC A;  5FTJ A;  2R46 A;  5FSW A;  2L6O A;  3M0E A;  1XHB A;  2JUJ A;  1T6O A;  4OVZ B;  3JR5 A;  2JA2 A;  3UK6 A;  2V1U A;  4L8R C;  3GLF E;  1IN6 A;  5FTN A;  2B3T A;  2MJ5 B;  4WP2 A;  1IXR C;  3KFU G;  1PJI A;  1E9R A;  2R45 A;  1OKS A;  1JR3 D;  3K8Z A;  3RFW A;  3L28 A;  5KQD A;  3GPX A;  1WJ7 A;  3VK7 A;  5EJC A;  4FW9 A;  2QNJ A;  1XC8 A;  3K2L A;  5EP1 A;  2OO9 A;  1DGG A;  2H5X A;  1QUT A;  3MHV C;  3K1J A;  5EXP A;  2LVA A;  3AJI B;  3B9P A;  4M9S A;  4AZF A;  4DR5 M;  2CV1 A;  5DFL A;  3U6S A;  4IBE A;  3VKG A;  5C18 A;  2L4F A;  2LXE A;  3GLH B;  1IN4 A;  4M9Z A;  4DV7 M;  5ITQ A;  2N35 A;  3KOX E;  4FCW A;  2FOI C;  3R8F A;  3KS8 A;  1FJG M;  3T1Y M;  1HNW M;  4GC9 A;  4LRS A;  4DUY M;  3J81 S;  4Q7J A;  1QAN A;  4MGI E;  5EP3 A;  4MGZ E;  1XMQ M;  2YNM D;  3HGI A;  1QAM A;  2XLJ A;  3E46 A;  3FE3 A;  1K82 A;  1TF0 B;  2BWE A;  1W5S A;  5ITR A;  4G4N A;  4FCT A;  2XZF A;  2UXB M;  4LZZ A;  1TH4 A;  5L8R F;  3RGP A;  2CE7 A;  4LJA A;  1SXJ D;  3HJQ A;  3C3E A;  4RNA A;  4L16 A;  2DAG A;  2O01 F;  2Y0Q A;  2KXE A;  3KP0 E;  4DV0 M;  1NO1 A;  3U6C A;  2L09 A;  3A45 A;  1G4A E;  3DFZ A;  1QZM A;  3C58 A;  4DV2 M;  2Y0T A;  2RGH A;  2VQE M;  4R7G A;  2C9O A;  2Z4S A;  4DV3 M;  1CUK A;  1G59 A;  2X49 A;  4LRT A;  3JR4 A;  3CF2 A;  4IBG A;  3T38 A;  2QP9 X;  4HLQ A;  2EUC A;  3HJ8 A;  1IXS B;  2DKL A;  2FS1 A;  4IJE A;  5FTL A;  1L2D A;  1E9S A;  3LW5 F;  2LVO C;  3QYB A;  2RRU A;  2WZJ A;  3BXW A;  4FWH A;  5JI2 E;  3TPZ A;  1DGF A;  1YSY A;  2KDL A;  2EO2 A;  2Q2E B;  1J09 A;  4DR4 M;  2CFO A;  2DWZ B;  2EJS A;  4L6V 6;  1T43 A;  1IFY A;  2KEB A;  4NRW A;  4JV5 M;  3VFD A;  4DR1 M;  2MGW A;  4IJF A;  2KRK A;  3L2A A;  3HWS A;  3FRH A;  3VDP A;  1NY5 A;  1SXJ C;  2VF8 A;  2A5Y B;  4K0K M;  4JI2 M;  2CP8 A;  2R62 A;  3LVV A;  2VF7 A;  4DV1 M;  4GMQ A;  4MM3 B;  1GKI A;  2QHO B;  2C98 A;  2G8L A;  2UU9 M;  2QZ4 A;  5KPT A;  2J5Y A;  3A42 A;  3FUU A;  4MGY E;  1AUA A;  2Z4R A;  3U6M A;  4GRI A;  2C99 A;  5LMU M;  4IBI A;  1NSF A;  2F5Q A;  1PJQ A;  3T15 A;  1ZMU A;  2J7O A;  3GLG B;  3ZCB B;  4TUW A;  5DYG A;  3ZQJ A;  3SBJ A;  3KOY E;  1L2B A;  2ZAO A;  4I5S A;  1NVM A;  4NXM M;  4LJ8 A;  1DV0 A;  2DXI A;  2FFJ A;  2JY6 B;  1L8Q A;  4JI8 M;  4LFC M;  2KNA A;  1R2Y A;  3D8L A;  1TR8 A;  1IY0 A;  3SHF A;  5KPR A;  4AKI A;  3FKE A;  2LTU A;  1N33 M;  3RE8 A;  3FUV A;  3J2P B;  3QWL A;  4HL4 A;  1DO2 A;  4JI7 M;  3FTE A;  4R3D A;  4RF1 A;  4QHT A;  1NJF A; 
#chains in the Genus database with same CATH homology
 3EIH A;  3LQQ A;  3K92 A;  1XNR M;  1QAO A;  2R65 A;  2XEP A;  3CF0 A;  4LFA M;  1JQJ C;  4DUZ M;  2R4E A;  1XMO M;  4P16 A;  3FTD A;  3DA1 A;  3PNV A;  3HU3 A;  2DWN A;  4B3S M;  5ITY A;  2LH0 A;  2RKO A;  2XFS A;  1FNN A;  4JN6 A;  4QOS A;  2XZU A;  5F3W A;  4MH0 E;  4BB9 A;  2CHG A;  2C5R A;  4AKH A;  4AW4 A;  1X37 A;  3AOG A;  1NY6 A;  2CHQ A;  3L29 A;  4IBD A;  3W0F A;  3VKH A;  4FWD A;  3SFZ A;  3PXG A;  1S3S A;  4JI4 M;  4LJ7 A;  3LQR A;  1HNZ M;  3HHX A;  3PNY A;  1PM5 A;  1QAQ A;  1T3T A;  4I8O A;  5IWA M;  5LMN M;  1IN8 A;  3TWM A;  3CTW B;  3GPP A;  1TDH A;  2VII A;  4A3V B;  3L25 A;  3FUT A;  4B3M M;  2ZBK B;  4Z6Y A;  3HHW A;  4EIW A;  3VDU A;  2C96 A;  1IN7 A;  2DWM A;  1EE8 A;  1J7K A;  7CAT A;  4D82 A;  2Z3X A;  1L1T A;  4G4R A;  4CIS A;  4GC5 A;  1VDD A;  2F5S A;  4LF8 M;  3J7A S;  4AI6 A;  3BOS A;  3GRR A;  3TWL A;  3DZD A;  3FYC A;  4YY3 M;  3MK6 A;  1TH3 A;  4DR7 M;  4MGK E;  4BBA A;  2CV2 A;  2D7G A;  8CAT A;  5IT9 S;  4GKK M;  4XGI A;  2UXC M;  1R2Z A;  2QPA A;  2XGN A;  1DGH A;  1D2N A;  2R18 A;  3KW6 A;  3M6A A;  3U5Z B;  3GLI B;  1Q3C A;  2M5Z A;  4D81 A;  3KOZ E;  3KP1 E;  3GRY A;  1IXZ A;  5KO3 A;  5E6J A;  5EQT A;  3UMM A;  4PDI A;  1K3X A;  3SYL A;  1G41 A;  5FLX S;  2OQ4 A;  2F5O A;  4M0D A;  3M7G A;  2YR0 A;  4PCZ A;  1QYR A;  3VK8 A;  4CHT B;  1SXJ E;  1IBM M;  2KZS A;  3H4M A;  1Z5B A;  1G8P A;  2XF3 A;  1N75 A;  4G6Z A;  5FTK A;  2DVW B;  1GLN A;  4BLC A;  1XXH B;  2YQZ A;  1HQC A;  4GH9 A;  4NOO B;  3SAU A;  3E4R A;  4NL4 H;  3SAT A;  4NRV A;  2CHV A;  5IZ7 D;  5EXT A;  3U61 B;  1KFV A;  1NJG A;  4ZPX A;  4FWG A;  4IBC A;  4B7H A;  3AL0 C;  1QQW A;  4JI6 M;  2M60 A;  4B7F A;  5ITX E;  3HHZ A;  2OPF A;  3E9S A;  2YFQ A;  1TH2 A;  3U6D A;  3GLF B;  2UUA M;  4KO8 A;  4AQY M;  4B08 A;  2R4J A;  4LZJ A;  2H1R A;  1HNX M;  1IY2 A;  3NBI A;  4LF9 M;  4NSR A;  3J80 S;  2O5R A;  2XSZ A;  3FUX A;  4IBF A;  5EXX A;  2DZO B;  2ZAN A;  3L26 A;  2G5G X;  4XBO A;  4OW0 A;  2QBY A;  4FD2 A;  3I4Y A;  1DGB A;  3ZH9 B;  3U5Z A;  2UUC M;  1XXH A;  2DWL A;  3RGS A;  4X65 M;  2V6Z M;  4LGM A;  4L4U A;  1IN5 A;  3QAU A;  3KOW E;  4IIW A;  4OU7 A;  2XH9 A;  2KW0 A;  2KA6 B;  4S12 A;  4JI1 M;  3GLG A;  4LF5 M;  2LWX A;  3TWK A;  1Z5C A;  4AG5 A;  4X62 M;  4B3T M;  2Y20 A;  1KSF X;  3GP1 A;  3IG5 A;  1MU5 A;  4IBK A;  1G3I A;  4LJ5 A;  3CF6 E;  2Y21 A;  4X66 M;  3FUW A;  4KLN A;  1LV7 A;  3SAR A;  2V1C A;  4M0W A;  5IRE B;  3SAS A;  4GIT A;  1NNJ A;  5FTM A;  4X64 M;  2ZM6 M;  4QNM A;  3HKP A;  4OVZ A;  3FTC A;  3SHG B;  1Z59 A;  3W0L B;  2EA0 A;  1TGU A;  1TDZ A;  1NNU C;  2X4A A;  4LJ9 A;  4LY6 A;  2XFT A;  4QNR A;  3UJN A;  4DV5 M;  5JI3 E;  5KQ8 A;  4LG2 A;  2QCU A;  4IBJ A;  3T1H M;  4MB7 A;  2XSZ D;  3KVW A;  4L15 A;  1IM2 A;  1Q3B A;  3L27 A;  5DNY A;  1OFH A;  3I4V A;  4AG6 A;  3SYK A;  3GQ3 A;  2CEA A;  4LFB M;  4JI0 M;  4PDG A;  1N77 A;  2NQ8 C;  4LF6 M;  2I7P A;  3OTO M;  3KXE C;  1GVN A;  3AOE C;  5C1B A;  4LJ6 A;  4JYA M;  3PVS A;  3KS4 A;  5E26 A;  4DR3 M;  4G4Q A;  3SC3 A;  4GKJ M;  3A46 A;  5EXS A;  4KOD A;  4DV6 M;  1KYI A;  1K3W A;  2KZU A;  3U6E A;  1R7R A;  3SMP A;  1WXQ A;  4QHS A;  4KHP M;  3HJS A;  3GO8 A;  4DR2 M;  4WUR A;  3AKZ A;  3TQS A;  4JI5 M;  3DOA A;  5A2Q S;  1L2C A;  4FCV A;  3SAW A;  4AKG A;  2K47 A;  3D8B A;  4GIP A;  4DR6 M;  2D7E A;  3TL4 X;  1SXJ B;  1XWI A;  4LCB A;  3NWL A;  4I4L A;  3EIE A;  3GQ5 A;  1W5T A;  3GRV A;  4LGY A;  2FE8 A;  4II7 A;  2X8A A;  4JXJ A;  4WW0 A;  3GPU A;  4DV4 M;  5ITT A;  3J7B A;  1N78 A;  3AOE A;  1ORY B;  3U60 A;  2QBY B;  1JR3 A;  3LVW A;  4D80 A;  3KDS E;  2VQF M;  3IG8 A;  5GKN A;  3SAV A;  3KSJ A;  5EP2 A;  3J27 B;  2DZN B;  3GLI A;  2DHR A;  2HKJ A;  1IY1 A;  4LF4 M;  2F5P A;  5DYI A;  4JI3 M;  3ILK A;  2W82 A;  1GL7 A;  1IBK M;  3LMM A;  3U6P A;  4QOZ C;  4B7G A;  2BJV A;  4CGY B;  1IQP A;  2QEN A;  4I81 A;  1HR0 M;  1R6B X;  1N34 M;  3WHK A;  2F5N A;  1MX0 A;  1DO0 A;  2ZAM A;  2LNH C;  1HQY E;  3TE6 A;  3AFH A;  4GHL A;  3SMS A;  3UZU A;  1N36 M;  3PFI A;  4ITQ A;  3U61 A;  4NXN M;  1YE9 A;  2ERC A;  1Q39 A;  3KSX A;  3U6L A;  1H6U A;  3GQ4 A;  4M9X A;  1HT1 E;  4REZ A;  1NHG C;  4IBB A;  4YHH M;  2KRU A;  1XNQ M;  2AHM A;  4PT5 A;  3GPY A;  3FTF A;  1OFI A;  1L1Z A;  4MGH A;  2HCB A;  5KPZ A;  5ITU A;  1UM8 A;  2HL7 A;  1E94 E;  2Z7J A;  3FD9 A;  4Z8X A;  4PD2 A;  3GLF A;  4RF0 A;  3A98 B;  1YUB A;  4W5W A;  1Z5A A;  2C9C A;  3GLH A;  2BJW A;  3U6O A;  3I51 A;  2CUZ A;  2L7I A;  1DGH B;  2D7H A;  4LJ4 A;  1C1K A;  3HU2 A;  3AV0 A;  3HU1 A;  2UXD M;  1Z6T A;  5H37 D;  1SXJ A;  2CV0 A;  2I7N A;  4B3R M;  5BR8 M;  4G4O A;  2BNK A;  5ITX A;  2J7N A;  3VLF B;  1J5E M;  1ZAE A;  3THG A;  3Q8X A;  3JAM S;  1OJL A;  3MJ5 A;  2E5L M;  4LF7 M;  1I94 M;  3R9X B;  1I4W A;  3FYD A;  5EP4 A;  2UUB M;  4GHA A;  2F4V M;  1ZQ9 A;  1PJJ A;  5BPV A;  3WHL A;  1NHW C;  3U60 B;  4L78 A;  1HT2 E;  3GRU A;  4FVM A;  1IBL M;  2HHH M;  4NSO B;  3ZC7 B;  1QVR A;  3HHY A;  2RGO A;  3UGJ A;  1GL6 A;  3U6Q A;  2P5T A;  4OX9 M;  1E32 A;  2L7H A;  5FSW A;  2FNA A;  5FTJ A;  2R46 A;  3JR5 A;  2L6O A;  3M0E A;  1XHB A;  4OVZ B;  2V1U A;  4L8R C;  2JA2 A;  3UK6 A;  1IN6 A;  5FTN A;  1IXR C;  3KFU G;  1PJI A;  1E9R A;  2R45 A;  3K8Z A;  1JR3 D;  3RFW A;  3L28 A;  5KQD A;  3GPX A;  3VK7 A;  5EJC A;  4FW9 A;  1XC8 A;  3K2L A;  5EP1 A;  1DGG A;  3MHV C;  3K1J A;  5EXP A;  3B9P A;  3AJI B;  4AZF A;  4M9S A;  4DR5 M;  2CV1 A;  3U6S A;  4IBE A;  3VKG A;  5C18 A;  3GLH B;  2LXE A;  4M9Z A;  1IN4 A;  4DV7 M;  1N32 M;  5ITQ A;  4FCW A;  3KOX E;  2FOI C;  3R8F A;  3KS8 A;  1FJG M;  3T1Y M;  1HNW M;  4GC9 A;  4LRS A;  4DUY M;  3J81 S;  1QAN A;  4MGI E;  5EP3 A;  4MGZ E;  1XMQ M;  2YNM D;  3HGI A;  1QAM A;  2XLJ A;  1K82 A;  1W5S A;  5ITR A;  4G4N A;  4FCT A;  2XZF A;  2UXB M;  4LZZ A;  1TH4 A;  3RGP A;  2CE7 A;  4LJA A;  1SXJ D;  3HJQ A;  4RNA A;  4L16 A;  2Y0Q A;  2KXE A;  3KP0 E;  4DV0 M;  3U6C A;  2L09 A;  3A45 A;  1G4A E;  3DFZ A;  1QZM A;  3C58 A;  4DV2 M;  2Y0T A;  2RGH A;  2VQE M;  4R7G A;  2C9O A;  2Z4S A;  4DV3 M;  1G59 A;  2X49 A;  4LRT A;  3JR4 A;  3CF2 A;  4IBG A;  3T38 A;  2QP9 X;  4HLQ A;  2EUC A;  3HJ8 A;  1IXS B;  4IJE A;  5FTL A;  1L2D A;  1E9S A;  5JI2 E;  4FWH A;  3TPZ A;  1DGF A;  1YSY A;  2EO2 A;  2Q2E B;  1J09 A;  4DR4 M;  2CFO A;  2DWZ B;  2KEB A;  4NRW A;  4JV5 M;  3VFD A;  4DR1 M;  4IJF A;  2KRK A;  3L2A A;  3HWS A;  3VDP A;  1NY5 A;  1SXJ C;  2A5Y B;  4K0K M;  4JI2 M;  2R62 A;  3LVV A;  4DV1 M;  4GMQ A;  4MM3 B;  1GKI A;  2C98 A;  2G8L A;  2UU9 M;  2QZ4 A;  5KPT A;  3A42 A;  3FUU A;  4MGY E;  2Z4R A;  3U6M A;  4GRI A;  2C99 A;  5LMU M;  4IBI A;  1NSF A;  2F5Q A;  3T15 A;  2J7O A;  3GLG B;  3ZCB B;  4TUW A;  5DYG A;  3SBJ A;  3KOY E;  1L2B A;  2ZAO A;  4I5S A;  1NVM A;  4NXM M;  4LJ8 A;  2DXI A;  2FFJ A;  4JI8 M;  1L8Q A;  4LFC M;  1R2Y A;  3D8L A;  1IY0 A;  3SHF A;  5KPR A;  4AKI A;  3FKE A;  1N33 M;  3RE8 A;  3FUV A;  3J2P B;  3QWL A;  4HL4 A;  1DO2 A;  4JI7 M;  3FTE A;  4R3D A;  4RF1 A;  4QHT A;  1NJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...