3T1HM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1hM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1hM02
1HR0M 4YY3M 4DV6M 4DV5M 3TWKA 1TDZA 4B3SM 2F5QA 2F5OA 2F5NA 1Z59A 2ZBKB 3J7AS 1XMQM 4DR1M 3VK7A 4B3TM 3OTOM 3U6CA 3T1YM 1Q3CA 1I94M 1J5EM 4JI8M 2UUAM 4LF9M 2XZFA 1Z5AA 4GKJM 4JI7M 4DR5M 1R2YA 4LF8M 3VK8A 4DV7M 3GPXA 4PD2A 2Q2EB 5FLXS 4JI2M 3A46A 4B3MM 1HNXM 4LF4M 4G4RA 1K3WA 1L1ZA 4YHHM 4DV4M 3GPYA 4DR2M 3TWLA 2F5PA 4MB7A 4KHPM 2UUCM 4AQYM 3T1HM 2UXDM 4G4OA 3U6OA 4JI0M 1TDHA 2VQFM 2XZUA 4DV1M 1PJIA 3SATA 4ITQA 1Q39A 4DR4M 5ITUA 3TWMA 2UXCM 1Q3BA 3DOAA 1L2BA 4DV0M 1FJGM 1PM5A 3GQ5A 3GQ3A 3JR4A 3U6SA 1PJJA 2VQEM 4JV5M 5IT9S 5ITQA 3GP1A 4LF7M 4NRWA 1IBLM 3GPUA 3JR5A 2OQ4A 4X66M 4NXNM 4DUYM 3A45A 1EE8A 5BR8M 2ZM6M 4B3RM 2UXBM 1K82A 4DR6M 2UU9M 1R2ZA 3JAMS 4PDIA 4G4QA 4LF6M 4LFBM 1N33M 1L2CA 3U6PA 5ITXA 1N32M 5ITTA 5ITXE 4DR3M 3U6LA 4JI4M 5ITYA 4DUZM 4X64M 4G4NA 1XC8A 3A42A 5LMNM 3SAUA 1XNRM 4DR7M 1Z5BA 4LFCM 4JYAM 3SASA 1XNQM 3SAVA 1MU5A 2UUBM 4JI3M 3GPPA 4PDGA 3C58A 4NRVA 3J81S 1MX0A 4PCZA 2F4VM 3U6MA 5LMUM 4OX9M 1K3XA 4CISA 4X62M 1Z5CA 3U6DA 1L2DA 3GQ4A 1HNWM 5IWAM 3U6EA 4DV2M 3SAWA 1HNZM 5A2QS 3U6QA 2HHHM 4JI5M 3SBJA 1XMOM 2E5LM 3GO8A 4JI1M 4LF5M 4GKKM 5ITRA 1N34M 4DV3M 4NXMM 4K0KM 1L1TA 1KFVA 3J80S 4LFAM 1NNJA 4X65M 3W0FA 1N36M 1IBMM 2HKJA 2OPFA 2F5SA 1IBKM 3SARA 4JI6M 2EA0A
chains in the Genus database with same CATH superfamily
2DNAA 3KP1E 4DV6M 1OJLA 3HGIA 2ERCA 4DV5M 1TDZA 3LW5F 4AG6A 4L8RC 2F5OA 2R6FA 1Z59A 2VIIA 2ZBKB 1IY1A 4LJ8A 3T6PA 4M9ZA 1GVNA 4XGIA 4DR1M 3BOSA 1Q3CA 1I94M 1IN5A 4JI8M 4GRIA 2LVPC 1IXRC 2OOBA 5EP1A 2FH0A 2UUAM 4LJAA 2WZJA 4LF9M 4FVMA 7CATA 2JY5A 3GLGA 4FW9A 4DR5M 2XH9A 4GKJM 1X37A 2R0IA 5KQDA 3KSJA 2KDLA 4D82A 3GLHA 4RKUF 1DO2A 2LVOC 1PJTA 2XLJA 4G4RA 1K3WA 2OO9A 2DWZB 5BPVA 2Y0QA 4ZPXA 4YHHM 4GITA 3SHFA 3HX3A 1GL7A 2CWBA 3CF6E 1N78A 1W5TA 1D0LA 3UMMA 2RGHA 4L15A 3U5ZB 5L8RF 2CEAA 4M0WA 2C9OA 3T1HM 3K9OA 2UXDM 2DHYA 3U6OA 3CGWA 2GQFA 3I04M 3KVWA 2LHCA 3TWMA 1WGNA 2DWLA 2D7GA 1Q3BA 2QZ4A 1TF0B 1VDDA 1WHCA 4GHLA 1FJGM 3GQ5A 3JR4A 3QYBA 1PJJA 1QAOA 5DYIA 4AKIA 2KRKA 2DAEA 2HAKA 4HLQA 2CFOA 4B7HA 2EKKA 2O5RA 3E46A 3LVVA 4IBCA 4NRWA 1QYRA 1GL6A 3U5ZA 3FTEA 2XFTA 4IJFA 4G6ZA 3KFUG 2D7HA 2QQ8A 4NXNM 2LBCA 3C3DA 1EE8A 1QANA 2V6ZM 2ZM6M 4B3RM 2XF3A 2DAMA 4S12A 4DR6M 1QZMA 3TQSA 1DGHB 3FTFA 3VDUA 1IXZA 2FNAA 4LFBM 4HL4A 1XHBA 5ITXA 4R3DA 5ITTA 2BWBA 2BJVA 3MHVC 2W82A 3THGA 2B3TA 5ITYA 3H4JA 3EIHA 2XFSA 1TTEA 2L7HA 1XC8A 4EIWA 1XNRM 4DR7M 3IG5A 3TE6A 3SC3A 4AG5A 4LFCM 2HWJA 3C9PA 3SASA 2BJWA 2KNVA 4B08A 2WSFF 3EIEA 3SAVA 1VG5A 3WHLA 2LWXA 1ZV1A 4PDGA 3J81S 3GPPA 3FRHA 1BVSA 4REZA 1G59A 1IM2A 4IBKA 1DGHA 2C96A 3GRYA 5EXPA 3KOZE 4CIZA 4X62M 1Z5CA 2EJSA 1TH2A 3LCUA 4FWDA 4WP2A 4M0DA 2L2DA 4DV2M 2FFJA 3U6QA 2MH8A 2JUJA 4QOSA 2CV0A 3AJIB 4GH9A 4PT5A 5FTMA 4W5WA 3GO8A 1TGUA 3L27A 4JI1M 2MROB 3ZQJA 4GKKM 5ITRA 1EFUB 2QENA 2L09A 4IBEA 2G5GX 2YQZA 3U61B 1G4AE 1LV7A 4LFAM 3UZUA 4X65M 3QYEA 1N36M 2HKJA 1E9RA 4QHTA 2JY7A 2F5SA 1IBKM 3KXEC 4FWHA 4M9SA 4LZJA 1HQCA 4OVZB 3V76A 2APLA 2R18A 3FUVA 3J7AS 1SG9A 3OTOM 3T1YM 2QSFX 1ZMWA 2DAGA 2N35A 3L26A 1MJGM 1J5EM 1VEGA 2EUCA 4A3VB 5EP2A 3PVSA 2CV1A 3GLIE 3K1JA 2DXIA 1R2YA 2YR0A 1IXSB 4DV7M 3GPXA 2J7NA 4PD2A 5FLXS 4JI2M 3MK6A 3A46A 1XB2B 3HU3A 4LF4M 4LJ7A 3FUUA 1L1ZA 3KDSE 2MGWA 1IFYA 3GPYA 1N77A 1HJPA 1XXHB 4OVZA 3T15A 4KHPM 1HQYE 5IREB 2DI0A 4AQYM 1F4IA 1S3SA 1TDHA 2Y0TA 4DV1M 4ITQA 5ITUA 1IXSA 4AKGA 2UXCM 3SYKA 3DOAA 3HKPA 1ZMUA 4G3OA 4DV0M 1PM5A 4JXJA 3SMSA 2JY6B 3GQ3A 3GRRA 4CGYB 3RE8A 3U6SA 2DAKA 2KHHA 3IG8A 2K47A 2LTUA 2XSZD 4IBIA 1XXHA 2JXNA 3GP1A 4FCVA 4MGYE 2V1UA 1E32A 4MM3B 1SXJE 2KZUA 3JR5A 3CF0A 1GLNA 3C3EA 2OQ4A 4AKHA 4MGIE 4X66M 2CHVA 5EP3A 1Q02A 3B89A 4DUYM 2UXBM 2XEPA 3B7QA 5DYGA 4AW4A 1OQYA 1K82A 3JAMS 1WXQA 4PDIA 4LG2A 4BB9A 1V34A 1JR3E 1VDLA 4MGHA 3GLFB 1YLAA 4RNAA 2LVAA 4DR3M 1NSFA 3GRVA 1YE9A 3J27B 2CP8A 4IBJA 4G4NA 5FTKA 3KP0E 4Z8XA 5LMNM 5EXXA 3FUXA 1Z5BA 2KA6B 2OOAA 1QUSA 2KXEA 4GMQA 2VDBB 3GRUA 3Q8GA 2LHGA 3L2AA 1XNQM 2CHGA 1MU5A 4GEWA 2UUBM 1QDTA 3B9PA 5FTNA 5JI3E 5DNYA 3FYCA 3J2PB 4PCZA 5KO3A 4FD2A 2YFQA 2QCUA 3HJQA 3L29A 4I5SA 2RGOA 3U6MA 3U60B 3UGJA 1NY5A 2D7EA 2RKOA 1H6UA 3GLFA 4BLCA 1HNWM 1WR1B 3VFDA 1GO5A 3T38A 2WSEF 2KZSA 3U6EA 1I4WA 4UN2B 1HNZM 1NVMA 1IY0A 4LY6A 3SBJA 1WJ7A 4JI5M 2I7PA 3LCVB 3PXGA 1DO0A 1IN4A 4I81A 5F3WA 4LF5M 2R4EA 1N34M 1UM8A 4DV3M 3AOGA 2C5RA 2KNZA 3LQRA 4GC5A 4M9XA 1KFVA 4RF1A 2C98A 4L78A 4P16A 2K0BX 1IBMM 1R7RA 3E21A 5H37D 3KSXA 1N75A 1G3IA 2C9CA 3MMPA 3RGSA 3U60A 4JI6M 2NQ8C 4IJEA 3HU2A 4MGZE 4QNMA 2JA2A 4LGYA 3A98B 3WHKA 3TWKA 5C18A 2DZLA 4YY3M 5KPZA 3HWSA 2F5QA 2DKLA 2DVWB 2F5NA 2QBYB 4WURA 3VK7A 1FNNA 1V92A 3I4YA 4B3TM 3W0LB 1YSYA 4L16A 1T43A 5FSWA 2MJ5B 1QZEA 4NC6A 2XZFA 3HHXA 1OAIA 4Y28F 4GHAA 2P5TA 3BXWA 4IBGA 4XBOA 3TL4X 3GLGE 4L6V6 4F2LA 3VK8A 3M6AA 4LF8M 3SYLA 3L25A 2Q2EB 4LRSA 5EXTA 2JY8A 3GLHE 3FTCA 1DGFA 1HNXM 1ZAEA 2HL7A 3I4VA 1VEJA 3I51A 2GNOA 2HCBA 4DR2M 3TWLA 2CE7A 2F5PA 4MB7A 1T3TA 1ZQ9A 3SHGB 3B74A 1E94E 1V33A 2QBYA 1PJSA 4Q7JA 5GKNA 1HR0M 4QOZC 4Z6YA 1DGBA 5KPRA 2Z4RA 3DZDA 4IIWA 4JI0M 2VQFM 2XZUA 4IBDA 3SATA 4WW0A 4DR4M 2EO2A 1RU3A 4LJ5A 3KS4A 1YUBA 3HHYA 3HJSA 4IBBA 4NSOB 2KRUA 1OTRA 4GIPA 4AI6A 1ORYB 1LTMA 1OKSA 2LVNC 2G3QA 2VQEM 1Z6TA 3KS8A 2KNAA 3B7NA 5KPTA 1TR8A 5ITQA 3FTDA 5EQTA 2CRUA 1EIJA 2FOIC 2VF7A 5E26A 4NL4H 2X4AA 1DGGA 4GC9A 1OIZA 4TUWA 3HJ8A 1IN7A 3SMPA 3KOYE 1R2ZA 1PGYA 2Y20A 4G4QA 3NWLA 1SXJD 2LNHC 4NOOB 1QAMA 1L2CA 3U6PA 3AV0A 2KW0A 2L7IA 1R5LA 4FWGA 3HY5A 5ITXE 3ZCBB 3U6LA 2BWEA 3ZH9B 4X64M 3K92A 2M60A 1D0MA 2DHRA 2QP9X 1TH4A 3ILKA 3SAUA 1TH3A 1MN3A 4R7GA 1JR3D 3M0EA 3TPZA 4JYAM 3HHWA 1G71A 1NV8A 1QVRA 3K8ZA 1D0KA 3D8LA 1NHWC 3NBXX 4I8OA 4RF0A 1C7YA 4JI3M 3E9SA 4NRVA 2R65A 2R4JA 2VF8A 4P17A 1J09A 4BBAA 2F4VM 2RRUA 1XWIA 4XK8F 3VKGA 3VDPA 4OX9M 1K3XA 5JI2E 3KOXE 2Z7JA 3GQ4A 5IWAM 1KSFX 1R4GA 1IN8A 3KOWE 4FCWA 2Y21A 3W68A 1XMOM 1IN6A 4FCTA 2C99A 5IZ7D 2E5LM 1OAOC 3F92A 2LH0A 3RGPA 1R6BX 1AIPC 2XGNA 3GLIB 2LVQD 2CUZA 4LZZA 2QHOB 4NXMM 4K0KM 1CUKA 1L1TA 2DZNB 3LMMA 1DV0A 3VLFB 2ZAMA 3IECA 3W0FA 2R46A 3PNVA 4KLNA 4II7A 1NJGA 1QDRA 4D80A 2OPFA 2DWNA 1PRBA 4LJ4A 3CF2A 2O25A 2EA0A 1G41A 3ZC7B 2ZTDA 4LF6M 4B3SM 3LVWA 3NBIA 1T6OA 2JNHA 1QUTA 1OFHA 1XMQM 3J7BA 2WSCF 2K6BA 3U6CA 3FRIA 2FS1A 1HT1E 3FKEA 5EXSA 3GLIA 1Z5AA 4F1IA 2Z3XA 4LJ9A 4JI7M 4MGKE 1GJTA 1PJQA 1C1KA 5KQ8A 4QNRA 3UJNA 2DWMA 1IY2A 4B3MM 1AUAA 2EKFA 3AL0C 3FD9A 3H4MA 2LXEA 4DV4M 3DFZA 2X8AA 4CJ6A 1ZMVA 1UFZA 2O01F 2Z4SA 2ZANA 4OU7A 1OFIA 2A5YB 1NHGC 1L8QA 1SXJB 2H5XA 3FYDA 3QAUA 2UUCM 3M7GA 2H1RA 3PNYA 4CHTB 4KODA 2JZ1A 3AOEA 3HHZA 4G4OA 1NO1A 2BNKA 2JZ0A 2V1CA 3BBZA 1PJIA 4B7FA 4L4UA 1NJFA 2KEBA 1D2NA 1Q39A 2DENA 4D81A 4IBFA 8CATA 1GJSA 1L2BA 2M5ZA 5C1BA 1KYIA 3PFIA 4KT0F 1QAQA 4JV5M 5IT9S 1VQ1A 2CHQA 2FE8A 2JP7A 2Z8YM 3B7ZA 1XXHE 4LF7M 5FTJA 3CTWB 1SXJA 1IBLM 4LRTA 5E6JA 3RFWA 3GPUA 1HT2E 1IQPA 3AFHA 3L28A 3QWLA 3FE3A 1QQWA 3A45A 5BR8M 2CV2A 1G8PA 1WGLA 2ZTCA 1NNUC 2JWSA 2QNJA 2G8LA 3K2LA 5EJCA 4HEOA 3AOEC 3DA1A 3AKZA 3SFZA 2UU9M 3FUWA 1JR3A 4KO8A 1N33M 3Q8XA 2XSZA 3HU1A 1N32M 3R9XB 2DZOB 2L6OA 3LQQA 4OW0A 4JI4M 4DUZM 1NY6A 4B7GA 3A42A 2R62A 1JB0F 5FTLA 4LCBA 3FUTA 4JN6A 4QHSA 3I01M 1E9SA 3E4RA 1A5TA 4I4LA 2DAIA 1VEKA 3C58A 4LGMA 5EP4A 1P3QQ 1SXJC 4R71A 3VKHA 1MX0A 2L4EA 1W5SA 3D8BA 2L4FA 5LMUM 1JQJC 4LJ6A 3R8FA 1GABA 4CISA 2J5YA 4AZFA 3U6DA 3GLFE 3MJ5A 1L2DA 2QPAA 4NSRA 4MH0E 2I7NA 3SAWA 5A2QS 2HHHM 3IHPA 3W67A 4DBGB 5DFLA 3U61A 1Y8GA 2YNMD 3GLGB 2R45A 1J7KA 2K9DA 2MR9A 2ZAOA 1WIVA 3K9PA 3GLHB 3J80S 1NNJA 2J7OA 3KW6A 1GKIA 2X49A 3UK6A 2R44A 3HZJA 1OIPA 3SARA 1NV9A 2AHMA 4ANRA
chains in the Genus database with same CATH topology
3KP1E 1HR0M 4DV6M 1OJLA 3HGIA 2ERCA 4DV5M 1TDZA 4TUWA 4AG6A 4L8RC 2F5OA 1Z59A 2VIIA 2ZBKB 1IY1A 4LJ8A 4M9ZA 1GVNA 4XGIA 4DR1M 3BOSA 1Q3CA 1I94M 1IN5A 4JI8M 4GRIA 2UUAM 1IXRC 5EP1A 4LF9M 4LJAA 4FVMA 7CATA 3GLGA 4FW9A 4DR5M 2XH9A 4GKJM 1X37A 5KQDA 3KSJA 4D82A 3GLHA 1DO2A 2XLJA 4G4RA 1K3WA 2DWZB 5BPVA 2Y0QA 4ZPXA 4YHHM 4GITA 3SHFA 1GL7A 3CF6E 1N78A 1W5TA 3UMMA 2RGHA 4L15A 3U5ZB 2CEAA 4M0WA 2C9OA 3T1HM 2UXDM 3U6OA 3KVWA 3TWMA 2DWLA 2D7GA 1Q3BA 2QZ4A 1VDDA 4GHLA 1FJGM 3GQ5A 3JR4A 1PJJA 1QAOA 5DYIA 4AKIA 2KRKA 4HLQA 2CFOA 4B7HA 2O5RA 3LVVA 4NRWA 4IBCA 1QYRA 1GL6A 3U5ZA 3FTEA 2XFTA 4IJFA 4G6ZA 3KFUG 2D7HA 4NXNM 2ZM6M 1EE8A 1QANA 2V6ZM 4B3RM 2XF3A 4S12A 4DR6M 1QZMA 3TQSA 1DGHB 3FTFA 3VDUA 1IXZA 2FNAA 4LFBM 4HL4A 1XHBA 5ITXA 4R3DA 5ITTA 2BJVA 3MHVC 2W82A 3THGA 5ITYA 3EIHA 2XFSA 2L7HA 1XC8A 4EIWA 1XNRM 4DR7M 3IG5A 3TE6A 3SC3A 4AG5A 4LFCM 3SASA 2BJWA 4B08A 3SAVA 3EIEA 3WHLA 4PDGA 2LWXA 3GPPA 3J81S 4REZA 1G59A 1IM2A 4IBKA 1DGHA 2C96A 3GRYA 5EXPA 3KOZE 4X62M 1Z5CA 1TH2A 4FWDA 4M0DA 4DV2M 2FFJA 3U6QA 4QOSA 2CV0A 3AJIB 4GH9A 4PT5A 5FTMA 4W5WA 3GO8A 1TGUA 3L27A 4JI1M 4GKKM 5ITRA 2QENA 2L09A 4IBEA 2G5GX 2YQZA 3U61B 1G4AE 1LV7A 4LFAM 3UZUA 4X65M 1N36M 2HKJA 1E9RA 4QHTA 2F5SA 1IBKM 3KXEC 4FWHA 4M9SA 4LZJA 1HQCA 4OVZB 2R18A 3FUVA 3J7AS 3OTOM 3T1YM 3L26A 1J5EM 2EUCA 4A3VB 5EP2A 3PVSA 2CV1A 3K1JA 2DXIA 1R2YA 2YR0A 1IXSB 4DV7M 3GPXA 2J7NA 4PD2A 5FLXS 4JI2M 3MK6A 3A46A 3HU3A 4LF4M 4LJ7A 3FUUA 1L1ZA 3KDSE 3GPYA 1N77A 1XXHB 4OVZA 3T15A 4KHPM 1HQYE 5IREB 4AQYM 1S3SA 1TDHA 2Y0TA 4DV1M 4ITQA 5ITUA 4AKGA 2UXCM 3SYKA 3DOAA 3HKPA 4DV0M 1PM5A 4JXJA 3SMSA 3GQ3A 3GRRA 4CGYB 3RE8A 3U6SA 3IG8A 2K47A 2XSZD 4IBIA 1XXHA 3GP1A 4FCVA 4MGYE 2V1UA 1E32A 4MM3B 1SXJE 2KZUA 3JR5A 3CF0A 1GLNA 2OQ4A 4AKHA 4MGIE 4X66M 2CHVA 5EP3A 4DUYM 2UXBM 2XEPA 4AW4A 5DYGA 1K82A 3JAMS 1WXQA 4PDIA 4LG2A 4BB9A 4MGHA 3GLFB 4RNAA 4DR3M 1NSFA 3GRVA 1YE9A 3J27B 4IBJA 4G4NA 5FTKA 3KP0E 4Z8XA 5LMNM 5EXXA 3FUXA 1Z5BA 2KA6B 4GMQA 2KXEA 3GRUA 3L2AA 1XNQM 2CHGA 1MU5A 2UUBM 3B9PA 5FTNA 5JI3E 5DNYA 3FYCA 3J2PB 4PCZA 5KO3A 4FD2A 2YFQA 2QCUA 3HJQA 3L29A 4I5SA 2RGOA 3U6MA 3U60B 3UGJA 1NY5A 2D7EA 2RKOA 1H6UA 3GLFA 4BLCA 1HNWM 3VFDA 3T38A 3U6EA 2KZSA 1I4WA 1HNZM 1NVMA 1IY0A 4LY6A 3SBJA 4JI5M 2I7PA 3PXGA 1DO0A 1IN4A 4I81A 5F3WA 4LF5M 2R4EA 1N34M 1UM8A 4DV3M 3AOGA 2C5RA 3LQRA 4GC5A 4M9XA 1KFVA 4RF1A 2C98A 4L78A 4P16A 1IBMM 1R7RA 5H37D 3KSXA 1N75A 1G3IA 2C9CA 3RGSA 3U60A 4JI6M 2NQ8C 4IJEA 3HU2A 4MGZE 4QNMA 2JA2A 4LGYA 3A98B 3WHKA 3TWKA 5C18A 4YY3M 2F5QA 5KPZA 3HWSA 2DVWB 2F5NA 2QBYB 4WURA 3VK7A 1FNNA 3I4YA 4B3TM 3W0LB 1YSYA 4L16A 5FSWA 2XZFA 3HHXA 4GHAA 2P5TA 4IBGA 4XBOA 3TL4X 4LF8M 3VK8A 3M6AA 3SYLA 3L25A 2Q2EB 4LRSA 5EXTA 3FTCA 1DGFA 1HNXM 1ZAEA 2HL7A 3I4VA 3I51A 2HCBA 4DR2M 3TWLA 2CE7A 2F5PA 4MB7A 1T3TA 1ZQ9A 3SHGB 1E94E 2QBYA 5GKNA 4QOZC 4Z6YA 1DGBA 5KPRA 2Z4RA 3DZDA 4IIWA 4JI0M 2VQFM 2XZUA 4IBDA 3SATA 4WW0A 4DR4M 2EO2A 4LJ5A 3KS4A 1YUBA 3HHYA 3HJSA 4IBBA 4NSOB 2KRUA 4GIPA 4AI6A 1ORYB 2VQEM 1Z6TA 3KS8A 5KPTA 5ITQA 3FTDA 5EQTA 2FOIC 5E26A 4NL4H 2X4AA 1DGGA 4GC9A 3HJ8A 1IN7A 3SMPA 3KOYE 1R2ZA 2Y20A 4G4QA 3NWLA 1SXJD 2LNHC 4NOOB 1QAMA 1L2CA 3U6PA 3AV0A 2KW0A 2L7IA 4FWGA 5ITXE 3ZCBB 3U6LA 3ZH9B 4X64M 3K92A 2M60A 3ILKA 2DHRA 2QP9X 1TH4A 3SAUA 1TH3A 4R7GA 1JR3D 3M0EA 3TPZA 4JYAM 3HHWA 1QVRA 4RF0A 3K8ZA 3D8LA 4I8OA 1NHWC 4JI3M 3E9SA 4NRVA 2R65A 2R4JA 1J09A 4BBAA 2F4VM 1XWIA 3VKGA 3VDPA 4OX9M 1K3XA 5JI2E 3KOXE 2Z7JA 3GQ4A 5IWAM 1KSFX 1IN8A 3KOWE 4FCWA 2Y21A 1XMOM 1IN6A 4FCTA 2C99A 5IZ7D 2E5LM 3RGPA 2LH0A 1R6BX 2XGNA 3GLIB 2CUZA 4LZZA 4NXMM 4K0KM 1L1TA 2DZNB 3LMMA 3VLFB 2ZAMA 3W0FA 2R46A 3PNVA 4KLNA 4II7A 1NJGA 2OPFA 4D80A 2DWNA 4LJ4A 3CF2A 2EA0A 4LF6M 1G41A 3ZC7B 4B3SM 3LVWA 3NBIA 1XMQM 1OFHA 3J7BA 3U6CA 1HT1E 3FKEA 5EXSA 3GLIA 1Z5AA 2Z3XA 4LJ9A 4JI7M 4MGKE 1C1KA 5KQ8A 4QNRA 3UJNA 2DWMA 1IY2A 4B3MM 3AL0C 3FD9A 3H4MA 2LXEA 4DV4M 3DFZA 2X8AA 2ZANA 2Z4SA 4OU7A 1OFIA 2A5YB 1NHGC 1L8QA 1SXJB 3FYDA 3QAUA 2UUCM 3M7GA 2H1RA 3PNYA 4CHTB 4KODA 3AOEA 3HHZA 4G4OA 2BNKA 2V1CA 1PJIA 4B7FA 4L4UA 1NJFA 2KEBA 1D2NA 1Q39A 4D81A 4IBFA 8CATA 1L2BA 2M5ZA 5C1BA 1KYIA 3PFIA 1QAQA 4JV5M 5IT9S 2CHQA 2FE8A 4LF7M 5FTJA 3CTWB 1SXJA 1IBLM 4LRTA 5E6JA 3RFWA 3GPUA 1HT2E 1IQPA 3AFHA 3L28A 3QWLA 1QQWA 3A45A 5BR8M 2CV2A 1G8PA 1NNUC 3K2LA 2G8LA 2UU9M 5EJCA 3AOEC 3DA1A 3AKZA 3SFZA 3FUWA 1JR3A 4KO8A 1N33M 3Q8XA 2XSZA 3HU1A 1N32M 3R9XB 2DZOB 2L6OA 3LQQA 4OW0A 4JI4M 4DUZM 1NY6A 4B7GA 3A42A 2R62A 5FTLA 4LCBA 3FUTA 4JN6A 4QHSA 1E9SA 3E4RA 4I4LA 3C58A 4LGMA 5EP4A 1SXJC 3VKHA 1MX0A 1W5SA 3D8BA 5LMUM 1JQJC 4LJ6A 3R8FA 4CISA 4AZFA 3U6DA 1L2DA 3MJ5A 2QPAA 4NSRA 3SAWA 2I7NA 5A2QS 2HHHM 3U61A 2YNMD 3GLGB 2R45A 1J7KA 2ZAOA 3GLHB 3J80S 1NNJA 2J7OA 3KW6A 1GKIA 2X49A 3UK6A 3SARA 4MH0E 2AHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 M;  4YY3 M;  4DV6 M;  4DV5 M;  3TWK A;  1TDZ A;  4B3S M;  2F5Q A;  2F5O A;  2F5N A;  1Z59 A;  2ZBK B;  3J7A S;  1XMQ M;  4DR1 M;  3VK7 A;  4B3T M;  3OTO M;  3U6C A;  3T1Y M;  1Q3C A;  1I94 M;  1J5E M;  4JI8 M;  2UUA M;  4LF9 M;  2XZF A;  1Z5A A;  4GKJ M;  4JI7 M;  4DR5 M;  1R2Y A;  4LF8 M;  3VK8 A;  4DV7 M;  3GPX A;  4PD2 A;  2Q2E B;  5FLX S;  4JI2 M;  3A46 A;  4B3M M;  1HNX M;  4LF4 M;  4G4R A;  1K3W A;  1L1Z A;  4YHH M;  4DV4 M;  3GPY A;  4DR2 M;  3TWL A;  2F5P A;  4MB7 A;  4KHP M;  2UUC M;  4AQY M;  3T1H M;  2UXD M;  4G4O A;  3U6O A;  4JI0 M;  1TDH A;  2VQF M;  2XZU A;  4DV1 M;  1PJI A;  3SAT A;  4ITQ A;  1Q39 A;  4DR4 M;  5ITU A;  3TWM A;  2UXC M;  1Q3B A;  3DOA A;  1L2B A;  4DV0 M;  1FJG M;  1PM5 A;  3GQ5 A;  3GQ3 A;  3JR4 A;  3U6S A;  1PJJ A;  2VQE M;  4JV5 M;  5IT9 S;  5ITQ A;  3GP1 A;  4LF7 M;  4NRW A;  1IBL M;  3GPU A;  3JR5 A;  2OQ4 A;  4X66 M;  4NXN M;  4DUY M;  3A45 A;  1EE8 A;  5BR8 M;  2ZM6 M;  4B3R M;  2UXB M;  1K82 A;  4DR6 M;  2UU9 M;  1R2Z A;  3JAM S;  4PDI A;  4G4Q A;  4LF6 M;  4LFB M;  1N33 M;  1L2C A;  3U6P A;  5ITX A;  1N32 M;  5ITT A;  5ITX E;  4DR3 M;  3U6L A;  4JI4 M;  5ITY A;  4DUZ M;  4X64 M;  4G4N A;  1XC8 A;  3A42 A;  5LMN M;  3SAU A;  1XNR M;  4DR7 M;  1Z5B A;  4LFC M;  4JYA M;  3SAS A;  1XNQ M;  3SAV A;  1MU5 A;  2UUB M;  4JI3 M;  3GPP A;  4PDG A;  3C58 A;  4NRV A;  3J81 S;  1MX0 A;  4PCZ A;  2F4V M;  3U6M A;  5LMU M;  4OX9 M;  1K3X A;  4CIS A;  4X62 M;  1Z5C A;  3U6D A;  1L2D A;  3GQ4 A;  1HNW M;  5IWA M;  3U6E A;  4DV2 M;  3SAW A;  1HNZ M;  5A2Q S;  3U6Q A;  2HHH M;  4JI5 M;  3SBJ A;  1XMO M;  2E5L M;  3GO8 A;  4JI1 M;  4LF5 M;  4GKK M;  5ITR A;  1N34 M;  4DV3 M;  4NXM M;  4K0K M;  1L1T A;  1KFV A;  3J80 S;  4LFA M;  1NNJ A;  4X65 M;  3W0F A;  1N36 M;  1IBM M;  2HKJ A;  2OPF A;  2F5S A;  1IBK M;  3SAR A;  4JI6 M;  2EA0 A; 
#chains in the Genus database with same CATH topology
 2DNA A;  3KP1 E;  4DV6 M;  1OJL A;  3HGI A;  2ERC A;  4DV5 M;  1TDZ A;  3LW5 F;  4AG6 A;  4L8R C;  2F5O A;  2R6F A;  1Z59 A;  2VII A;  2ZBK B;  1IY1 A;  4LJ8 A;  3T6P A;  4M9Z A;  1GVN A;  4XGI A;  4DR1 M;  3BOS A;  1Q3C A;  1I94 M;  1IN5 A;  4JI8 M;  4GRI A;  2LVP C;  1IXR C;  2OOB A;  5EP1 A;  2FH0 A;  2UUA M;  4LJA A;  2WZJ A;  4LF9 M;  4FVM A;  7CAT A;  2JY5 A;  3GLG A;  4FW9 A;  4DR5 M;  2XH9 A;  4GKJ M;  1X37 A;  2R0I A;  5KQD A;  3KSJ A;  2KDL A;  4D82 A;  3GLH A;  4RKU F;  1DO2 A;  2LVO C;  1PJT A;  2XLJ A;  4G4R A;  1K3W A;  2OO9 A;  2DWZ B;  5BPV A;  2Y0Q A;  4ZPX A;  4YHH M;  4GIT A;  3SHF A;  3HX3 A;  1GL7 A;  2CWB A;  3CF6 E;  1N78 A;  1W5T A;  1D0L A;  3UMM A;  2RGH A;  4L15 A;  3U5Z B;  5L8R F;  2CEA A;  4M0W A;  2C9O A;  3T1H M;  3K9O A;  2UXD M;  2DHY A;  3U6O A;  3CGW A;  2GQF A;  3I04 M;  3KVW A;  2LHC A;  3TWM A;  1WGN A;  2DWL A;  2D7G A;  1Q3B A;  2QZ4 A;  1TF0 B;  1VDD A;  1WHC A;  4GHL A;  1FJG M;  3GQ5 A;  3JR4 A;  3QYB A;  1PJJ A;  1QAO A;  5DYI A;  4AKI A;  2KRK A;  2DAE A;  2HAK A;  4HLQ A;  2CFO A;  4B7H A;  2EKK A;  2O5R A;  3E46 A;  3LVV A;  4IBC A;  4NRW A;  1QYR A;  1GL6 A;  3U5Z A;  3FTE A;  2XFT A;  4IJF A;  4G6Z A;  3KFU G;  2D7H A;  2QQ8 A;  4NXN M;  2LBC A;  3C3D A;  1EE8 A;  1QAN A;  2V6Z M;  2ZM6 M;  4B3R M;  2XF3 A;  2DAM A;  4S12 A;  4DR6 M;  1QZM A;  3TQS A;  1DGH B;  3FTF A;  3VDU A;  1IXZ A;  2FNA A;  4LFB M;  4HL4 A;  1XHB A;  5ITX A;  4R3D A;  5ITT A;  2BWB A;  2BJV A;  3MHV C;  2W82 A;  3THG A;  2B3T A;  5ITY A;  3H4J A;  3EIH A;  2XFS A;  1TTE A;  2L7H A;  1XC8 A;  4EIW A;  1XNR M;  4DR7 M;  3IG5 A;  3TE6 A;  3SC3 A;  4AG5 A;  4LFC M;  2HWJ A;  3C9P A;  3SAS A;  2BJW A;  2KNV A;  4B08 A;  2WSF F;  3EIE A;  3SAV A;  1VG5 A;  3WHL A;  2LWX A;  1ZV1 A;  4PDG A;  3J81 S;  3GPP A;  3FRH A;  1BVS A;  4REZ A;  1G59 A;  1IM2 A;  4IBK A;  1DGH A;  2C96 A;  3GRY A;  5EXP A;  3KOZ E;  4CIZ A;  4X62 M;  1Z5C A;  2EJS A;  1TH2 A;  3LCU A;  4FWD A;  4WP2 A;  4M0D A;  2L2D A;  4DV2 M;  2FFJ A;  3U6Q A;  2MH8 A;  2JUJ A;  4QOS A;  2CV0 A;  3AJI B;  4GH9 A;  4PT5 A;  5FTM A;  4W5W A;  3GO8 A;  1TGU A;  3L27 A;  4JI1 M;  2MRO B;  3ZQJ A;  4GKK M;  5ITR A;  1EFU B;  2QEN A;  2L09 A;  4IBE A;  2G5G X;  2YQZ A;  3U61 B;  1G4A E;  1LV7 A;  4LFA M;  3UZU A;  4X65 M;  3QYE A;  1N36 M;  2HKJ A;  1E9R A;  4QHT A;  2JY7 A;  2F5S A;  1IBK M;  3KXE C;  4FWH A;  4M9S A;  4LZJ A;  1HQC A;  4OVZ B;  3V76 A;  2APL A;  2R18 A;  3FUV A;  3J7A S;  1SG9 A;  3OTO M;  3T1Y M;  2QSF X;  1ZMW A;  2DAG A;  2N35 A;  3L26 A;  1MJG M;  1J5E M;  1VEG A;  2EUC A;  4A3V B;  5EP2 A;  3PVS A;  2CV1 A;  3GLI E;  3K1J A;  2DXI A;  1R2Y A;  2YR0 A;  1IXS B;  4DV7 M;  3GPX A;  2J7N A;  4PD2 A;  5FLX S;  4JI2 M;  3MK6 A;  3A46 A;  1XB2 B;  3HU3 A;  4LF4 M;  4LJ7 A;  3FUU A;  1L1Z A;  3KDS E;  2MGW A;  1IFY A;  3GPY A;  1N77 A;  1HJP A;  1XXH B;  4OVZ A;  3T15 A;  4KHP M;  1HQY E;  5IRE B;  2DI0 A;  4AQY M;  1F4I A;  1S3S A;  1TDH A;  2Y0T A;  4DV1 M;  4ITQ A;  5ITU A;  1IXS A;  4AKG A;  2UXC M;  3SYK A;  3DOA A;  3HKP A;  1ZMU A;  4G3O A;  4DV0 M;  1PM5 A;  4JXJ A;  3SMS A;  2JY6 B;  3GQ3 A;  3GRR A;  4CGY B;  3RE8 A;  3U6S A;  2DAK A;  2KHH A;  3IG8 A;  2K47 A;  2LTU A;  2XSZ D;  4IBI A;  1XXH A;  2JXN A;  3GP1 A;  4FCV A;  4MGY E;  2V1U A;  1E32 A;  4MM3 B;  1SXJ E;  2KZU A;  3JR5 A;  3CF0 A;  1GLN A;  3C3E A;  2OQ4 A;  4AKH A;  4MGI E;  4X66 M;  2CHV A;  5EP3 A;  1Q02 A;  3B89 A;  4DUY M;  2UXB M;  2XEP A;  3B7Q A;  5DYG A;  4AW4 A;  1OQY A;  1K82 A;  3JAM S;  1WXQ A;  4PDI A;  4LG2 A;  4BB9 A;  1V34 A;  1JR3 E;  1VDL A;  4MGH A;  3GLF B;  1YLA A;  4RNA A;  2LVA A;  4DR3 M;  1NSF A;  3GRV A;  1YE9 A;  3J27 B;  2CP8 A;  4IBJ A;  4G4N A;  5FTK A;  3KP0 E;  4Z8X A;  5LMN M;  5EXX A;  3FUX A;  1Z5B A;  2KA6 B;  2OOA A;  1QUS A;  2KXE A;  4GMQ A;  2VDB B;  3GRU A;  3Q8G A;  2LHG A;  3L2A A;  1XNQ M;  2CHG A;  1MU5 A;  4GEW A;  2UUB M;  1QDT A;  3B9P A;  5FTN A;  5JI3 E;  5DNY A;  3FYC A;  3J2P B;  4PCZ A;  5KO3 A;  4FD2 A;  2YFQ A;  2QCU A;  3HJQ A;  3L29 A;  4I5S A;  2RGO A;  3U6M A;  3U60 B;  3UGJ A;  1NY5 A;  2D7E A;  2RKO A;  1H6U A;  3GLF A;  4BLC A;  1HNW M;  1WR1 B;  3VFD A;  1GO5 A;  3T38 A;  2WSE F;  2KZS A;  3U6E A;  1I4W A;  4UN2 B;  1HNZ M;  1NVM A;  1IY0 A;  4LY6 A;  3SBJ A;  1WJ7 A;  4JI5 M;  2I7P A;  3LCV B;  3PXG A;  1DO0 A;  1IN4 A;  4I81 A;  5F3W A;  4LF5 M;  2R4E A;  1N34 M;  1UM8 A;  4DV3 M;  3AOG A;  2C5R A;  2KNZ A;  3LQR A;  4GC5 A;  4M9X A;  1KFV A;  4RF1 A;  2C98 A;  4L78 A;  4P16 A;  2K0B X;  1IBM M;  1R7R A;  3E21 A;  5H37 D;  3KSX A;  1N75 A;  1G3I A;  2C9C A;  3MMP A;  3RGS A;  3U60 A;  4JI6 M;  2NQ8 C;  4IJE A;  3HU2 A;  4MGZ E;  4QNM A;  2JA2 A;  4LGY A;  3A98 B;  3WHK A;  3TWK A;  5C18 A;  2DZL A;  4YY3 M;  5KPZ A;  3HWS A;  2F5Q A;  2DKL A;  2DVW B;  2F5N A;  2QBY B;  4WUR A;  3VK7 A;  1FNN A;  1V92 A;  3I4Y A;  4B3T M;  3W0L B;  1YSY A;  4L16 A;  1T43 A;  5FSW A;  2MJ5 B;  1QZE A;  4NC6 A;  2XZF A;  3HHX A;  1OAI A;  4Y28 F;  4GHA A;  2P5T A;  3BXW A;  4IBG A;  4XBO A;  3TL4 X;  3GLG E;  4L6V 6;  4F2L A;  3VK8 A;  3M6A A;  4LF8 M;  3SYL A;  3L25 A;  2Q2E B;  4LRS A;  5EXT A;  2JY8 A;  3GLH E;  3FTC A;  1DGF A;  1HNX M;  1ZAE A;  2HL7 A;  3I4V A;  1VEJ A;  3I51 A;  2GNO A;  2HCB A;  4DR2 M;  3TWL A;  2CE7 A;  2F5P A;  4MB7 A;  1T3T A;  1ZQ9 A;  3SHG B;  3B74 A;  1E94 E;  1V33 A;  2QBY A;  1PJS A;  4Q7J A;  5GKN A;  1HR0 M;  4QOZ C;  4Z6Y A;  1DGB A;  5KPR A;  2Z4R A;  3DZD A;  4IIW A;  4JI0 M;  2VQF M;  2XZU A;  4IBD A;  3SAT A;  4WW0 A;  4DR4 M;  2EO2 A;  1RU3 A;  4LJ5 A;  3KS4 A;  1YUB A;  3HHY A;  3HJS A;  4IBB A;  4NSO B;  2KRU A;  1OTR A;  4GIP A;  4AI6 A;  1ORY B;  1LTM A;  1OKS A;  2LVN C;  2G3Q A;  2VQE M;  1Z6T A;  3KS8 A;  2KNA A;  3B7N A;  5KPT A;  1TR8 A;  5ITQ A;  3FTD A;  5EQT A;  2CRU A;  1EIJ A;  2FOI C;  2VF7 A;  5E26 A;  4NL4 H;  2X4A A;  1DGG A;  4GC9 A;  1OIZ A;  4TUW A;  3HJ8 A;  1IN7 A;  3SMP A;  3KOY E;  1R2Z A;  1PGY A;  2Y20 A;  4G4Q A;  3NWL A;  1SXJ D;  2LNH C;  4NOO B;  1QAM A;  1L2C A;  3U6P A;  3AV0 A;  2KW0 A;  2L7I A;  1R5L A;  4FWG A;  3HY5 A;  5ITX E;  3ZCB B;  3U6L A;  2BWE A;  3ZH9 B;  4X64 M;  3K92 A;  2M60 A;  1D0M A;  2DHR A;  2QP9 X;  1TH4 A;  3ILK A;  3SAU A;  1TH3 A;  1MN3 A;  4R7G A;  1JR3 D;  3M0E A;  3TPZ A;  4JYA M;  3HHW A;  1G71 A;  1NV8 A;  1QVR A;  3K8Z A;  1D0K A;  3D8L A;  1NHW C;  3NBX X;  4I8O A;  4RF0 A;  1C7Y A;  4JI3 M;  3E9S A;  4NRV A;  2R65 A;  2R4J A;  2VF8 A;  4P17 A;  1J09 A;  4BBA A;  2F4V M;  2RRU A;  1XWI A;  4XK8 F;  3VKG A;  3VDP A;  4OX9 M;  1K3X A;  5JI2 E;  3KOX E;  2Z7J A;  3GQ4 A;  5IWA M;  1KSF X;  1R4G A;  1IN8 A;  3KOW E;  4FCW A;  2Y21 A;  3W68 A;  1XMO M;  1IN6 A;  4FCT A;  2C99 A;  5IZ7 D;  2E5L M;  1OAO C;  3F92 A;  2LH0 A;  3RGP A;  1R6B X;  1AIP C;  2XGN A;  3GLI B;  2LVQ D;  2CUZ A;  4LZZ A;  2QHO B;  4NXM M;  4K0K M;  1CUK A;  1L1T A;  2DZN B;  3LMM A;  1DV0 A;  3VLF B;  2ZAM A;  3IEC A;  3W0F A;  2R46 A;  3PNV A;  4KLN A;  4II7 A;  1NJG A;  1QDR A;  4D80 A;  2OPF A;  2DWN A;  1PRB A;  4LJ4 A;  3CF2 A;  2O25 A;  2EA0 A;  1G41 A;  3ZC7 B;  2ZTD A;  4LF6 M;  4B3S M;  3LVW A;  3NBI A;  1T6O A;  2JNH A;  1QUT A;  1OFH A;  1XMQ M;  3J7B A;  2WSC F;  2K6B A;  3U6C A;  3FRI A;  2FS1 A;  1HT1 E;  3FKE A;  5EXS A;  3GLI A;  1Z5A A;  4F1I A;  2Z3X A;  4LJ9 A;  4JI7 M;  4MGK E;  1GJT A;  1PJQ A;  1C1K A;  5KQ8 A;  4QNR A;  3UJN A;  2DWM A;  1IY2 A;  4B3M M;  1AUA A;  2EKF A;  3AL0 C;  3FD9 A;  3H4M A;  2LXE A;  4DV4 M;  3DFZ A;  2X8A A;  4CJ6 A;  1ZMV A;  1UFZ A;  2O01 F;  2Z4S A;  2ZAN A;  4OU7 A;  1OFI A;  2A5Y B;  1NHG C;  1L8Q A;  1SXJ B;  2H5X A;  3FYD A;  3QAU A;  2UUC M;  3M7G A;  2H1R A;  3PNY A;  4CHT B;  4KOD A;  2JZ1 A;  3AOE A;  3HHZ A;  4G4O A;  1NO1 A;  2BNK A;  2JZ0 A;  2V1C A;  3BBZ A;  1PJI A;  4B7F A;  4L4U A;  1NJF A;  2KEB A;  1D2N A;  1Q39 A;  2DEN A;  4D81 A;  4IBF A;  8CAT A;  1GJS A;  1L2B A;  2M5Z A;  5C1B A;  1KYI A;  3PFI A;  4KT0 F;  1QAQ A;  4JV5 M;  5IT9 S;  1VQ1 A;  2CHQ A;  2FE8 A;  2JP7 A;  2Z8Y M;  3B7Z A;  1XXH E;  4LF7 M;  5FTJ A;  3CTW B;  1SXJ A;  1IBL M;  4LRT A;  5E6J A;  3RFW A;  3GPU A;  1HT2 E;  1IQP A;  3AFH A;  3L28 A;  3QWL A;  3FE3 A;  1QQW A;  3A45 A;  5BR8 M;  2CV2 A;  1G8P A;  1WGL A;  2ZTC A;  1NNU C;  2JWS A;  2QNJ A;  2G8L A;  3K2L A;  5EJC A;  4HEO A;  3AOE C;  3DA1 A;  3AKZ A;  3SFZ A;  2UU9 M;  3FUW A;  1JR3 A;  4KO8 A;  1N33 M;  3Q8X A;  2XSZ A;  3HU1 A;  1N32 M;  3R9X B;  2DZO B;  2L6O A;  3LQQ A;  4OW0 A;  4JI4 M;  4DUZ M;  1NY6 A;  4B7G A;  3A42 A;  2R62 A;  1JB0 F;  5FTL A;  4LCB A;  3FUT A;  4JN6 A;  4QHS A;  3I01 M;  1E9S A;  3E4R A;  1A5T A;  4I4L A;  2DAI A;  1VEK A;  3C58 A;  4LGM A;  5EP4 A;  1P3Q Q;  1SXJ C;  4R71 A;  3VKH A;  1MX0 A;  2L4E A;  1W5S A;  3D8B A;  2L4F A;  5LMU M;  1JQJ C;  4LJ6 A;  3R8F A;  1GAB A;  4CIS A;  2J5Y A;  4AZF A;  3U6D A;  3GLF E;  3MJ5 A;  1L2D A;  2QPA A;  4NSR A;  4MH0 E;  2I7N A;  3SAW A;  5A2Q S;  2HHH M;  3IHP A;  3W67 A;  4DBG B;  5DFL A;  3U61 A;  1Y8G A;  2YNM D;  3GLG B;  2R45 A;  1J7K A;  2K9D A;  2MR9 A;  2ZAO A;  1WIV A;  3K9P A;  3GLH B;  3J80 S;  1NNJ A;  2J7O A;  3KW6 A;  1GKI A;  2X49 A;  3UK6 A;  2R44 A;  3HZJ A;  1OIP A;  3SAR A;  1NV9 A;  2AHM A;  4ANR A; 
#chains in the Genus database with same CATH homology
 3KP1 E;  1HR0 M;  4DV6 M;  1OJL A;  3HGI A;  2ERC A;  4DV5 M;  1TDZ A;  4TUW A;  4AG6 A;  4L8R C;  2F5O A;  1Z59 A;  2VII A;  2ZBK B;  1IY1 A;  4LJ8 A;  4M9Z A;  1GVN A;  4XGI A;  4DR1 M;  3BOS A;  1Q3C A;  1I94 M;  1IN5 A;  4JI8 M;  4GRI A;  2UUA M;  1IXR C;  5EP1 A;  4LF9 M;  4LJA A;  4FVM A;  7CAT A;  3GLG A;  4FW9 A;  4DR5 M;  2XH9 A;  4GKJ M;  1X37 A;  5KQD A;  3KSJ A;  4D82 A;  3GLH A;  1DO2 A;  2XLJ A;  4G4R A;  1K3W A;  2DWZ B;  5BPV A;  2Y0Q A;  4ZPX A;  4YHH M;  4GIT A;  3SHF A;  1GL7 A;  3CF6 E;  1N78 A;  1W5T A;  3UMM A;  2RGH A;  4L15 A;  3U5Z B;  2CEA A;  4M0W A;  2C9O A;  3T1H M;  2UXD M;  3U6O A;  3KVW A;  3TWM A;  2DWL A;  2D7G A;  1Q3B A;  2QZ4 A;  1VDD A;  4GHL A;  1FJG M;  3GQ5 A;  3JR4 A;  1PJJ A;  1QAO A;  5DYI A;  4AKI A;  2KRK A;  4HLQ A;  2CFO A;  4B7H A;  2O5R A;  3LVV A;  4NRW A;  4IBC A;  1QYR A;  1GL6 A;  3U5Z A;  3FTE A;  2XFT A;  4IJF A;  4G6Z A;  3KFU G;  2D7H A;  4NXN M;  2ZM6 M;  1EE8 A;  1QAN A;  2V6Z M;  4B3R M;  2XF3 A;  4S12 A;  4DR6 M;  1QZM A;  3TQS A;  1DGH B;  3FTF A;  3VDU A;  1IXZ A;  2FNA A;  4LFB M;  4HL4 A;  1XHB A;  5ITX A;  4R3D A;  5ITT A;  2BJV A;  3MHV C;  2W82 A;  3THG A;  5ITY A;  3EIH A;  2XFS A;  2L7H A;  1XC8 A;  4EIW A;  1XNR M;  4DR7 M;  3IG5 A;  3TE6 A;  3SC3 A;  4AG5 A;  4LFC M;  3SAS A;  2BJW A;  4B08 A;  3SAV A;  3EIE A;  3WHL A;  4PDG A;  2LWX A;  3GPP A;  3J81 S;  4REZ A;  1G59 A;  1IM2 A;  4IBK A;  1DGH A;  2C96 A;  3GRY A;  5EXP A;  3KOZ E;  4X62 M;  1Z5C A;  1TH2 A;  4FWD A;  4M0D A;  4DV2 M;  2FFJ A;  3U6Q A;  4QOS A;  2CV0 A;  3AJI B;  4GH9 A;  4PT5 A;  5FTM A;  4W5W A;  3GO8 A;  1TGU A;  3L27 A;  4JI1 M;  4GKK M;  5ITR A;  2QEN A;  2L09 A;  4IBE A;  2G5G X;  2YQZ A;  3U61 B;  1G4A E;  1LV7 A;  4LFA M;  3UZU A;  4X65 M;  1N36 M;  2HKJ A;  1E9R A;  4QHT A;  2F5S A;  1IBK M;  3KXE C;  4FWH A;  4M9S A;  4LZJ A;  1HQC A;  4OVZ B;  2R18 A;  3FUV A;  3J7A S;  3OTO M;  3T1Y M;  3L26 A;  1J5E M;  2EUC A;  4A3V B;  5EP2 A;  3PVS A;  2CV1 A;  3K1J A;  2DXI A;  1R2Y A;  2YR0 A;  1IXS B;  4DV7 M;  3GPX A;  2J7N A;  4PD2 A;  5FLX S;  4JI2 M;  3MK6 A;  3A46 A;  3HU3 A;  4LF4 M;  4LJ7 A;  3FUU A;  1L1Z A;  3KDS E;  3GPY A;  1N77 A;  1XXH B;  4OVZ A;  3T15 A;  4KHP M;  1HQY E;  5IRE B;  4AQY M;  1S3S A;  1TDH A;  2Y0T A;  4DV1 M;  4ITQ A;  5ITU A;  4AKG A;  2UXC M;  3SYK A;  3DOA A;  3HKP A;  4DV0 M;  1PM5 A;  4JXJ A;  3SMS A;  3GQ3 A;  3GRR A;  4CGY B;  3RE8 A;  3U6S A;  3IG8 A;  2K47 A;  2XSZ D;  4IBI A;  1XXH A;  3GP1 A;  4FCV A;  4MGY E;  2V1U A;  1E32 A;  4MM3 B;  1SXJ E;  2KZU A;  3JR5 A;  3CF0 A;  1GLN A;  2OQ4 A;  4AKH A;  4MGI E;  4X66 M;  2CHV A;  5EP3 A;  4DUY M;  2UXB M;  2XEP A;  4AW4 A;  5DYG A;  1K82 A;  3JAM S;  1WXQ A;  4PDI A;  4LG2 A;  4BB9 A;  4MGH A;  3GLF B;  4RNA A;  4DR3 M;  1NSF A;  3GRV A;  1YE9 A;  3J27 B;  4IBJ A;  4G4N A;  5FTK A;  3KP0 E;  4Z8X A;  5LMN M;  5EXX A;  3FUX A;  1Z5B A;  2KA6 B;  4GMQ A;  2KXE A;  3GRU A;  3L2A A;  1XNQ M;  2CHG A;  1MU5 A;  2UUB M;  3B9P A;  5FTN A;  5JI3 E;  5DNY A;  3FYC A;  3J2P B;  4PCZ A;  5KO3 A;  4FD2 A;  2YFQ A;  2QCU A;  3HJQ A;  3L29 A;  4I5S A;  2RGO A;  3U6M A;  3U60 B;  3UGJ A;  1NY5 A;  2D7E A;  2RKO A;  1H6U A;  3GLF A;  4BLC A;  1HNW M;  3VFD A;  3T38 A;  3U6E A;  2KZS A;  1I4W A;  1HNZ M;  1NVM A;  1IY0 A;  4LY6 A;  3SBJ A;  4JI5 M;  2I7P A;  3PXG A;  1DO0 A;  1IN4 A;  4I81 A;  5F3W A;  4LF5 M;  2R4E A;  1N34 M;  1UM8 A;  4DV3 M;  3AOG A;  2C5R A;  3LQR A;  4GC5 A;  4M9X A;  1KFV A;  4RF1 A;  2C98 A;  4L78 A;  4P16 A;  1IBM M;  1R7R A;  5H37 D;  3KSX A;  1N75 A;  1G3I A;  2C9C A;  3RGS A;  3U60 A;  4JI6 M;  2NQ8 C;  4IJE A;  3HU2 A;  4MGZ E;  4QNM A;  2JA2 A;  4LGY A;  3A98 B;  3WHK A;  3TWK A;  5C18 A;  4YY3 M;  2F5Q A;  5KPZ A;  3HWS A;  2DVW B;  2F5N A;  2QBY B;  4WUR A;  3VK7 A;  1FNN A;  3I4Y A;  4B3T M;  3W0L B;  1YSY A;  4L16 A;  5FSW A;  2XZF A;  3HHX A;  4GHA A;  2P5T A;  4IBG A;  4XBO A;  3TL4 X;  4LF8 M;  3VK8 A;  3M6A A;  3SYL A;  3L25 A;  2Q2E B;  4LRS A;  5EXT A;  3FTC A;  1DGF A;  1HNX M;  1ZAE A;  2HL7 A;  3I4V A;  3I51 A;  2HCB A;  4DR2 M;  3TWL A;  2CE7 A;  2F5P A;  4MB7 A;  1T3T A;  1ZQ9 A;  3SHG B;  1E94 E;  2QBY A;  5GKN A;  4QOZ C;  4Z6Y A;  1DGB A;  5KPR A;  2Z4R A;  3DZD A;  4IIW A;  4JI0 M;  2VQF M;  2XZU A;  4IBD A;  3SAT A;  4WW0 A;  4DR4 M;  2EO2 A;  4LJ5 A;  3KS4 A;  1YUB A;  3HHY A;  3HJS A;  4IBB A;  4NSO B;  2KRU A;  4GIP A;  4AI6 A;  1ORY B;  2VQE M;  1Z6T A;  3KS8 A;  5KPT A;  5ITQ A;  3FTD A;  5EQT A;  2FOI C;  5E26 A;  4NL4 H;  2X4A A;  1DGG A;  4GC9 A;  3HJ8 A;  1IN7 A;  3SMP A;  3KOY E;  1R2Z A;  2Y20 A;  4G4Q A;  3NWL A;  1SXJ D;  2LNH C;  4NOO B;  1QAM A;  1L2C A;  3U6P A;  3AV0 A;  2KW0 A;  2L7I A;  4FWG A;  5ITX E;  3ZCB B;  3U6L A;  3ZH9 B;  4X64 M;  3K92 A;  2M60 A;  3ILK A;  2DHR A;  2QP9 X;  1TH4 A;  3SAU A;  1TH3 A;  4R7G A;  1JR3 D;  3M0E A;  3TPZ A;  4JYA M;  3HHW A;  1QVR A;  4RF0 A;  3K8Z A;  3D8L A;  4I8O A;  1NHW C;  4JI3 M;  3E9S A;  4NRV A;  2R65 A;  2R4J A;  1J09 A;  4BBA A;  2F4V M;  1XWI A;  3VKG A;  3VDP A;  4OX9 M;  1K3X A;  5JI2 E;  3KOX E;  2Z7J A;  3GQ4 A;  5IWA M;  1KSF X;  1IN8 A;  3KOW E;  4FCW A;  2Y21 A;  1XMO M;  1IN6 A;  4FCT A;  2C99 A;  5IZ7 D;  2E5L M;  3RGP A;  2LH0 A;  1R6B X;  2XGN A;  3GLI B;  2CUZ A;  4LZZ A;  4NXM M;  4K0K M;  1L1T A;  2DZN B;  3LMM A;  3VLF B;  2ZAM A;  3W0F A;  2R46 A;  3PNV A;  4KLN A;  4II7 A;  1NJG A;  2OPF A;  4D80 A;  2DWN A;  4LJ4 A;  3CF2 A;  2EA0 A;  4LF6 M;  1G41 A;  3ZC7 B;  4B3S M;  3LVW A;  3NBI A;  1XMQ M;  1OFH A;  3J7B A;  3U6C A;  1HT1 E;  3FKE A;  5EXS A;  3GLI A;  1Z5A A;  2Z3X A;  4LJ9 A;  4JI7 M;  4MGK E;  1C1K A;  5KQ8 A;  4QNR A;  3UJN A;  2DWM A;  1IY2 A;  4B3M M;  3AL0 C;  3FD9 A;  3H4M A;  2LXE A;  4DV4 M;  3DFZ A;  2X8A A;  2ZAN A;  2Z4S A;  4OU7 A;  1OFI A;  2A5Y B;  1NHG C;  1L8Q A;  1SXJ B;  3FYD A;  3QAU A;  2UUC M;  3M7G A;  2H1R A;  3PNY A;  4CHT B;  4KOD A;  3AOE A;  3HHZ A;  4G4O A;  2BNK A;  2V1C A;  1PJI A;  4B7F A;  4L4U A;  1NJF A;  2KEB A;  1D2N A;  1Q39 A;  4D81 A;  4IBF A;  8CAT A;  1L2B A;  2M5Z A;  5C1B A;  1KYI A;  3PFI A;  1QAQ A;  4JV5 M;  5IT9 S;  2CHQ A;  2FE8 A;  4LF7 M;  5FTJ A;  3CTW B;  1SXJ A;  1IBL M;  4LRT A;  5E6J A;  3RFW A;  3GPU A;  1HT2 E;  1IQP A;  3AFH A;  3L28 A;  3QWL A;  1QQW A;  3A45 A;  5BR8 M;  2CV2 A;  1G8P A;  1NNU C;  3K2L A;  2G8L A;  2UU9 M;  5EJC A;  3AOE C;  3DA1 A;  3AKZ A;  3SFZ A;  3FUW A;  1JR3 A;  4KO8 A;  1N33 M;  3Q8X A;  2XSZ A;  3HU1 A;  1N32 M;  3R9X B;  2DZO B;  2L6O A;  3LQQ A;  4OW0 A;  4JI4 M;  4DUZ M;  1NY6 A;  4B7G A;  3A42 A;  2R62 A;  5FTL A;  4LCB A;  3FUT A;  4JN6 A;  4QHS A;  1E9S A;  3E4R A;  4I4L A;  3C58 A;  4LGM A;  5EP4 A;  1SXJ C;  3VKH A;  1MX0 A;  1W5S A;  3D8B A;  5LMU M;  1JQJ C;  4LJ6 A;  3R8F A;  4CIS A;  4AZF A;  3U6D A;  1L2D A;  3MJ5 A;  2QPA A;  4NSR A;  3SAW A;  2I7N A;  5A2Q S;  2HHH M;  3U61 A;  2YNM D;  3GLG B;  2R45 A;  1J7K A;  2ZAO A;  3GLH B;  3J80 S;  1NNJ A;  2J7O A;  3KW6 A;  1GKI A;  2X49 A;  3UK6 A;  3SAR A;  4MH0 E;  2AHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...