3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
3DMGA 3OFJA 3CGGA 1L1EA 5C1IA 2VDVE 4U7TB 4HG2A 3NMUF 2BR5A 4E31A 3GRZA 4M37A 5GP1A 4MIKA 2O0LA 1KP9A 2V74B 2ZCJA 5LQUA 2PLWA 3P8ZA 2EG5A 3IYLW 3B5IA 5FQOA 1WG8A 3OZSA 1XXLA 3MCZA 4RTKA 5GM1A 3I9FA 3SX0A 3A26A 3EGIA 3FZGA 5LQAA 3DLIA 3GWZA 5EVJA 4DKJA 3BGDA 5IKMA 5K03A 3MTIA 1YFJA 3UJDA 1L3CA 1JSZA 1XDZA 1D2HA 3BWCA 4NECA 2AOUB 4EKGA 3O31A 5HZMA 3UBTA 5LQKA 4X41A 4RTPA 3SSOA 3I58A 5E9JA 5HILA 3PS9A 1JG4A 3KQTA 1OR8A 5DPMA 1L3IA 3C6MA 1JG1A 4EMSA 4YUYA 4R8RA 3NW9A 1AQJA 3KQPA 1HNNA 3C3YA 1SQFA 3SMQA 5K09A 5DX0A 1NV8A 2UZ4A 3KPWA 1DL5A 2NP7A 3LL7A 1NW8A 4HC4A 4OQDA 3A27A 1WS6A 3KQWA 5EC8A 4ER6A 1QAMA 4RTNA 1QAOA 3CJQA 2B78A 5JUWA 5CD1A 2XYQA 1R00A 3IHTA 5DRYA 3RIEA 1KYWA 3FUUA 2B9EA 2ZIGA 4PCAA 3ME5A 4WVLA 5E2AA 4KIFA 5ICFA 5CCXA 3B3JA 4RTMA 3VSEA 4YUVA 4EVIA 1H1DA 3TOSA 3DH0A 4DF3A 4QDJA 3G7UA 3TRKA 3ELUA 3OCJA 3GO4A 5KYGA 1WXWA 2PX8A 1R8YA 4P7GA 4HTFB 3TQSA 1DUSA 3L8DA 1B42A 1TW3A 3SSMA 2PXCA 4PNEA 5KQSA 1V39A 3HP7A 3HA7A 3I5UA 4P7KA 4PWYA 5K0CA 2P1DA 1MJFA 3KKZA 3CJRA 3BGVA 3ERCA 5E1DA 4QVGA 3SVZA 1WZNA 3DMFA 3EEYA 1UFKA 2O07A 3G2QA 2KW5A 2ZTHA 4RVHA 2XBMA 4YUXA 4B17A 3E23A 4GF5A 8MHTA 1SG9A 1G38A 3E7PA 1R8XA 2Y1WA 3HVHA 4AUKA 2FYTA 4A6EA 9MHTA 2B25A 2ZLBA 5HIIA 1INLA 3AWIA 1QYRA 3BKXA 5DX8A 4EQZA 3NWEA 3X0DA 3A25A 2FRXA 4MQ4A 2CMGA 3KQQA 5F2NA 1NV9A 1SUIA 4GC9A 2IP2A 2AVNA 5EMMA 2PVCA 5H02A 1PJZA 5GINE 3I53A 3P2KA 5K0FA 3TLJA 4F86A 1P1BA 3GDHA 3KPUA 5EZSA 3HCFA 1JTFA 4C06A 3LPMA 2PSSA 4PONA 4RTQA 4IV8A 4KWCA 1Q0TA 3UWPA 3NVMB 1KR5A 3TMAA 2PWYA 4QVKA 3T7SA 1JQ3A 1XCLA 5CCBA 3P2EA 2C7RA 2NXEA 5ERGB 1P39A 3OZRA 3FRIA 3Q87B 5CM2Z 4E70A 1NKVA 5EQJB 3HEMA 3FTFA 2R6ZA 5EIFA 3C3PA 4RVFA 5LQNA 3NVKI 3EVAA 5LQCA 2VDWA 4OBXA 3MAGA 2ZW9A 1FP2A 1JG2A 4XUCA 2FK8A 4DCGA 5KVAA 4G56A 3C0KA 3P71T 1VP3A 2JG3A 5T64A 3UJ8A 1RJEA 1VBFA 5BXYA 3K0BA 4LWOA 2ERCA 1KPGA 3B3GA 4AZVA 5EMJA 1JR4A 3CJTA 5BW4A 5FHQA 2BR3A 3PFHA 3P9KA 1IM8A 4M36A 4CKBA 3LDGA 3P9NA 5K01A 3G8BA 3GGDA 2I62A 3BWBA 5FTWA 5K0NA 1PRYA 3MQ2A 3REOA 4OA8A 2PX4A 2YUIA 4C03A 4CTKA 1KIAA 2NXCA 1AF7A 5DRTA 3VC1A 1YF3A 2GAFA 3UJAA 3DMHA 2ONYA 3GIWA 3OZTA 5LSAA 1RI3A 3LSTA 2AN5A 4LG1A 2XVMA 4FR0A 4GOOD 5DTRA 2O05A 3FUXA 3V97A 4AZTA 2ONZA 7MHTA 2PBFA 2GS9A 5FUBA 2ZVJA 3NDJA 4WXHA 2Z6AA 2NXJA 2WA1A 1MHTA 1D2CA 3M4XA 1X1BA 2OZVA 3NJRA 4GOND 3M6UA 3KR0A 4RTLA 1KPIA 1VIDA 5DWQA 4Z2YA 3HCCA 1IXKA 1RJGA 3TR6A 2C7QA 1O54A 4AX8A 5DM2A 1BKYA 4GQBA 5FCDA 1NW3A 4DA4A 2QE6A 2CL5A 5K0JA 3JWHA 2HR1A 3KPYA 2V7EA 4PIPA 2JJQA 3ER8A 2ZZMA 2HNKA 4MWZA 4PIMA 4X61A 2Y1XA 1R6AA 3OPNA 4E2YA 1I1NA 3DOUA 3T7RA 3U81A 1QAQA 3KQMA 4RTSA 2QY6A 2UYHA 3V8VA 1RJDA 3BT7A 3PLAE 5E1OA 3AXSA 3AJDA 1FPQA 1YB2A 5DSXA 5GOZA 3F4KA 3QOWA 1KHHA 3VYWA 3BWYA 4P7JA 3FPEA 2PY6A 1ZGJA 3AXTA 5FULA 2AN3A 3KQYA 4YV1A 3LGAA 5HIMA 2VZ9A 2ZBRA 2PXAA 1U2ZA 2JHAA 3CVOA 1FBNA 3DXZA 3P97A 4PYMA 2H00A 2CKDA 2AOXA 1VL5A 1P91A 3E05A 3OFKA 1JG3A 5DXJA 3TKAA 2QRVB 1ZGAA 4PYJA 5K8VA 3FYCA 2OKCA 4RWZA 3THSA 3UJ9A 2ZIFA 4KDRA 2XVAA 3LCVB 4R6XA 4ZTBA 1JQDA 4AZSA 4KIGA 3GNLA 2A14A 4RX1A 5EMKA 3CC8A 3PX2A 4GOLD 2AZTA 4GC5A 1G8SA 1VPTA 3BXOA 3EVCA 1EJ0A 1XVAA 1N7JA 2JH8A 4PYOA 5C0OE 3JWJA 4P58A 3RW9A 2BZGA 2B2CA 2K4MA 2NXNA 4F85A 5E1MA 2ESRA 1G55A 4XUEA 2H1RA 2G70A 2IIPA 3TM4A 2IGTA 2YX1A 5FA8A 1R74A 4FT2A 3QV2A 2UYCA 3WSTA 4ER5A 1BOOA 2EJUA 4PCLA 5E8JA 1BHJA 4BLUA 2UYOA 3OU2A 4CKEA 4E32A 3GRUA 1N7IA 3GRVA 2QM3A 1NE2A 2HWKA 2WK1A 5K0GA 4EKIA 5K0EA 2PXXA 3EGEA 5EOVA 1RJFA 5GM2A 1T43A 3RODA 4YUWA 5K0BA 4JXJA 1BC5A 1O9HA 2UYQA 4PINA 4HGZA 3FRHA 4HSGA 5BP7A 1L3BA 4GUAA 4E33A 5E8RA 4YMGA 3G88A 2YTZA 3PFGA 1JTEA 3M33A 4P7FA 2YXLA 3O4FA 2P35A 2ZULA 3T7TA 4ER3A 3EVGA 3SM3A 1AQIA 3FTCA 4OQEA 4X63A 4C05A 2PGXA 3ELYA 3P9IA 5EMLA 4PYLA 5KQRA 3FTEA 5GIPE 5LQRA 3HVJA 3LECA 2IDJA 5P8WA 1N2XA 10MHA 2DULA 3SXJA 1M0EA 3FUVA 4PYQA 4YUZA 4C04A 2BM9A 2AOTB 5G02A 5EGSA 4XCXA 2ZWAA 5FQNA 3T0IA 3DLCA 1YFLA 3EVBA 3SR4A 4QPPA 5FA5A 2IH2A 3HVIA 3HNRA 1NBIA 2JHCA 3MHTA 3CKKA 5EPEA 2AR0A 2PWPA 1JQEA 3G2PA 5GIOE 3AY0A 3FYDA 3B3FA 4RTRA 5CIYA 3G2MA 2IH5A 3R0QA 3PVCA 5DM0A 3EMDA 4YMHA 2IDKA 4U7PB 3TM5A 1JSXA 1SQGA 3EVFA 1QZZA 3M6XA 1XDUA 2EX4A 2GA9A 3KR2A 3LKDA 2PT9A 1G60A 3HA3A 1DCTA 2Q41A 4HGYA 1R18A 3ANXA 3PTAA 3KPVA 3MERA 4E2WA 4CTJA 2VP3A 3BUSA 3FUWA 4DQ0A 2P40A 5EKXA 1NT2A 2NYUA 3UJCA 2I6GA 3GU3A 3PX3A 4MHTA 3UJ7A 3R6TA 4E2ZA 2R3SA 5B1SA 3HTXA 5FWAA 2JH9A 4V0QA 5ICEA 4KDCA 5CVEA 2IFTA 2YVLA 4E30A 1I4WA 3DXYA 4F84A 5FADA 4R6WA 3SGLA 3P2IA 1XJ5A 4FSXA 1SUSA 4HRAA 2FK7A 1YZ3A 3UZUA 3GCZA 3THRA 1YUBA 2G72A 2FHPA 1EG2A 3EVDA 2BH2A 2EJTA 1Z3CA 4HH4A 5DXAA 3TKYA 2Z6UA 3JWGA 1RI4A 1M6EX 2OO3A 3CBGA 3I64A 3M6VA 2G1PA 5KS2A 3OU7A 1AV6A 1EIZA 5GWXA 1ZQ9A 5EKUA 2B3TA 3BKWA 4KRGA 2DPMA 2P3OA 1RI1A 1D2GA 5MHTA 4BLWA 3K6RA 3LKZA 2PKWA 2P3LA 4ER7A 4IKPA 1IY9A 3KPJA 5HOQA 3DUWA 3BGIA 3HVKA 3G2OA 1F38A 4O29A 4QQKA 3UFBA 3NDIA 3PB3A 2IPXA 4POOA 1XCJA 3A4TA 4H0NA 4R05A 5BW5A 2CMHA 4GEKA 4LECA 3MCTA 2PX2A 4XUDA 1FP1D 5EEGA 4DZRA 3KHKA 3MTEA 2NP6A 2XYVA 3R9XB 5C9ZA 3R3HA 3Q7EA 1YZHA 4QTTB 5DT2A 2P3QA 3LX6A 5CVJA 2JHPA 2FPOA 3ELDA 3HCDA 1SVUA 3HM2A 3FPHA 1ORHA 5DM4A 5IH3A 4BP1A 4BY9E 4QDKA 4C07A 3A7EA 3DULA 4MTLA 4Y2HA 3FUTA 1X1CA 3JWIA 4X60A 3G8AA 4ATNA 3FPJA 4PGHA 3DTNA 3ORHA 1NW7A 4AZWA 2C7PA 2ZZKA 4PYKA 3FTDA 2GH1A 3EGVA 3LCUA 2ZWVA 5HIJA 3B89A 4YV2A 5F2KA 3ID6C 2AS0A 4K6MA 2GB4A 2Z6QA 2YR0A 3OE5A 4V0RA 4DCMA 1X1AA 1RI2A 4KVZA 3EVEA 1TW2A 1F3LA 1NBHA 2G71A 2P8JA 1KYZA 4EK9A 2VS1A 3ELWA 3IV6A 5D1NA 5DLYA 2AVDA 2ZBPA 4CXMA 1TPYA 2H11A 4FT4A 2AOUA 1KXZA 2VDUE 3KR9A 3TFWA 2FCAA 2YXDA 4QTUB 3GRYA 5DX1A 3M6WA 4R8SA 4IWNA 5M5BA 2ADMA 2AOVA 2LD4A 4FS8A 4GOMD 3KR1A 1EJ6A 4OA5A 3CCFA 2C7OA 2ZZNA 5HIKA 2AN4A 3G89A 3EMBA 2EFJA 3GJYA 2YQZA 1QANA 2WA2A 4PGGA 3UA4A 2IBTA 4YV0A 2AOWA 3BZBA 1SKMA 5JR3A 1X19A 4BLVA 2QYOA 2E5WA 1ZG3A 5EEHA 5EZQA 2IH4A 4RTJA 5E1BA 3SSNA 5LR6A 3GXOA 3B7PA 1G6Q1 3P9CA 2OBFA 4RYLA 1KPHA 1NW6A 4CKCA 3TPZA 1M6YA 1ZKDA 2G8NA 2XYRA 3EVZA 3KQOA 3LHDA 4GBED 4QQNA 2OB1A 4PYNA 4C08A 1WXXA 1Q0SA 4FGZA 3UJ6A 3A7DA 1L9KA 2QRVA 3HA5A 5K05A 3QOXA 3FPGA 1VLMA 4CWAA 2P7HA 4KW7A 1XTPA 5D1HA 3UA3A 5EIWA 3NWBA 3O7WA 4RV9A 2I7CA 5EHIA 4IV0A 3NTVA 1G8AA 5T6BA 3LDFA 3MGGA 4L7VA 3GRRA 4RSRA 2PX5A 4HTFA 5CVVA 3UJBA 5LQJA 3G5TA 2OXTA 3HCBA 3LCCA 1Y8CA 3LDUA 5T67A 5E2BA 2HMYB 2ZBQA 2O57A 2ZIEA 3FPFA 4E2XA 4ER0A 2PV0A 3D2LA 1ZHFA 3KQSA 3C6KA 4OX9Y 5DTQA 4LWPA 2ORED 1EAMA 5CVDA 1O9GA 3DXXA 5K0LA 2CWWA 1I9GA 2OY0A 3E8SA 3KU1A 3KQVA 2HTEA 5U4XA 3IEIA 2O06A 5HEKA 4A6DA 2GLUA 1RI5A 3OU6A 3PT9A 5CUQA 4PYIA 4M38A 2GPYA 2YXEA 3LBFA 1VQ1A 3M70A 2NNWB 2N47A 3H2BA 1WY7A 3R24A 3ER9A 2P7IA 2ZFUA 5ICCA 4C4AA 5DSTA 1NW5A 3EEOA 5FHRA 2BR4A 3G5LA 4BP3A 1VE3A 5E9WA 2PJDA 3HCAA 4FSDA 3S68A 5ICGA 4FZVA 4QPNA 2OYRA 5EHGA 4X1OA 5HFJA 5CVUA 2OB2A 1P1CA 4UOEA 3EPPA 2I9KA 2PT6A 3OE4A 2HV9A 1X1DA 2ZSUA 3HCEA 2BM8A 5DM1A 5EG5A 4DMGA 4M7RA 4RVGA 4RTOA 1FJXA 1UIRA 1UWVA 1EQAA 5F2OA 1HMYA 3DP7A 4DM3A 5DTMA 4OBWA 5E9QA 4ISCA 1XDSA 3LBYA 1ORIA 1VP9A 2OPBA 2P41A 3BWMA 4RVDA 5FWDA 3VC2A 2IBSA 2F8LA 2AOTA 4FP9A 3MB5A 3DR5A 4Y30A
chains in the Genus database with same CATH superfamily
1UWLA 1GSIA 1IUNA 4HDAA 2RK3A 5AOVA 2ZBGA 3EC2A 1E2PA 2R4TA 5E4YA 3C45A 3ISVA 1ISPA 3VU1A 1B0UA 2W2TA 2IOQA 1EE2A 3IURA 2YJZA 3WSWA 1HF3A 3VOSA 4BZXA 1Q92A 3E1GA 2W2XA 4WDRA 1KZ7B 4HC4A 4AZ3B 2R7AA 1KK0A 3WB0A 1XR3A 5D3KA 2C5FA 4WN3A 3VU8A 5CK4A 4KO1S 1TKAA 4YCDA 4W8GA 3TOZA 1OKSA 4TLDA 2GN1A 3GAMA 3TGPA 1GAEO 3BYZA 4M46A 3G2LA 1FUYB 3NUQA 4MUMA 4D8UA 3GPBA 1PL7A 4E7PA 5TARA 1AC5A 4AYTA 5IT5A 3I53A 3O84A 1H2YA 4URYR 2WQ6A 3GA5A 1F20A 1PL8A 3MTQA 1U0HC 2NXEA 1PRBA 1VE9A 4H0CA 4UEQA 4E1BA 3PJGA 1FP2A 4ICIA 3D4NA 1T5TA 4P32A 3GJXC 4ERNA 1RWXA 5EWJB 3CX8A 2QAGA 4MGZE 4WY8A 4XD2A 2ZB4A 3KEFA 3VZCA 2B5VA 1D2CA 2OCAA 3R76A 1OBOA 2PGNA 4WLUA 2JLBA 3PRKE 4OEHA 4OU4A 4P4UA 1HO3A 1CRLA 3JWHA 1SXJD 1X8JA 3JZDA 3OPNA 1CHDA 1X87A 3SJZA 3NQ41 4Q3BA 2MU1A 5L9AA 4X3OA 2XT9A 1IUPA 2KSQA 3P97A 2JHAA 4JI5M 1GGJA 5C4GB 5IANA 3RRYA 1N6LA 1LDGA 5F52A 5K0TA 2PO7A 5BN3A 3DONA 5IP5A 4I50A 1Z39A 1W9MA 4BO9A 3BWEA 5JC1A 2GXAA 1VA5A 5AKZA 3OT1B 2PPLA 4EKIA 4C5AA 2ZB2A 1IXSA 4Q4JB 3HO6A 1Q91A 4P7FA 3PDJA 5M34A 4PHFA 2CMKA 1YQUA 4KPUB 2BFMA 5B2EA 4OJYA 3NBYC 5C32A 3PJRA 4F2HA 1DBWA 2HHHM 2A0UA 2AE1A 5BW6B 5K8JB 3R0QA 1YHNA 3KOMA 1QRSA 2ZBFA 3BGOS 3OCXA 5TPWB 3PE6A 4RNAA 1OKKD 4F7WA 5HZKA 2C8LA 3P7MA 4BKUA 2GN8A 4HH4A 4CMHA 4LJ6A 1DG9A 3GL9A 1Y3FE 3PNPA 1USGA 4IHJA 4BP8A 4FFNA 1NNUA 5JRZA 2JJ2A 3R20A 5IHPA 3AR8A 1SCDA 1IN7A 2VJBA 5EIXA 3RGSA 1I4LD 4O5AA 2YY5A 1N1DA 1YL6A 3E7DA 2EKKA 2ZZKA 4F0JA 5JYCA 1DIAA 3AFMA 4LK3A 3T4UA 1TQHA 1JKJB 4H27A 1EDEA 5AJUA 3GJRA 2NUAB 3OM8A 3A0UA 1PNVA 3B5JA 4NENB 4OOEA 2AOVA 1GDDA 1AHPA 4ASUD 2DFNA 3CZ5A 3H17A 4FDVA 3F1LA 1DP4A 1NG9A 3SHFA 4QM7A 3CF6R 1UJNA 1SMKA 4L74A 4IO1A 3WQHA 1MVNA 4D4GA 4I9UA 4JI4M 3CU5A 6LDHA 2CVHA 2O06A 4I4TA 1JV2B 4ZU1X 2H1IA 3OJOA 3HKDB 1PG2A 4U4AA 2PU5A 4YJDA 1GQFA 3M6IA 2D2IA 3A4VA 2UVDA 2BY4A 4L5IA 3PNSA 3SYTA 1NUHA 3NWPA 2O8EB 1ECBA 3VAAA 3TXYA 4MAMA 3E3AA 2FWRA 2OG2A 5DGXA 2A9RA 4DIBA 1DKNA 2YASA 4B6JA 3F67A 2WYWA 2PSDA 3I30X 4CKEB 2G80A 3GJ8A 3I83A 1JIIA 4OX9M 2XSZA 5MFPA 1E8NA 2GN4A 3ZIAA 1WXFA 2Q3EA 3EXG1 1N57A 3QVVA 3AJRA 5ICMA 1OFUX 1JA1A 1XL0A 2KNVA 3GBSA 3N5KA 3UKDA 3U39A 2XGJA 3HA7A 3CJRA 1NNI1 4CIVA 3G2QA 2LGJA 2QR3A 1DXQA 3F9IA 2G04A 3GVPA 1XQ9A 4TMZA 3U3ZA 5DX8A 2GD6A 4G84A 1KYTA 2R79A 3WGUA 1H23A 3CH4B 1FMLA 3PRYA 2WU4A 4UDOA 1R16A 1EVIA 4MA5A 4DRZA 4W9MC 4JZKA 2L4EA 2Q1TA 4KQGA 4ZOQI 1JXAA 4UVDA 3NJ8A 4RPCA 5IZ4A 5JO0A 3NOVA 4Z5XA 1M2VA 1XMJA 3PUIA 4P84A 3A9CA 5DNUA 3VSBA 5IJXA 3KWLA 4WY2A 3C15C 3UUFA 2IHJA 1FSSA 4UULA 3L8GA 2YWBA 4YRJA 1F4PA 4OXRA 3IEVA 4JI2M 1DDGA 1W93A 5AVQA 2CSXA 3KEGA 5DM2A 3S7TA 1LBEA 3H75A 2HA2A 2Y1XA 2GPNA 2WF7A 2PY6A 4OHZA 2QXYA 3HKEB 4ZOCA 1X77A 5ALOA 2ZYUX 3R7DA 1I3MA 1X1EA 1OLXB 1TJ5A 4YRZA 3CT4A 4R3UC 1DV2A 1HNZB 2IYUA 4KMRA 1XVAA 1D1TA 2D1RA 1A5BB 5LLDA 2QHOB 1N2ZA 1R12A 5DN6A 5DMXA 3W6OA 4B6RA 3HL4A 1CZNA 3OJXA 3AMVA 1G41A 4FTWA 1UJCA 4ZA2A 4HLUA 3UAYA 4P08A 1P6QA 4IJQA 3V4PB 1G5RA 4Z0TA 1AQUA 1OLSA 3DKVA 4TVKA 4EY6A 3ZEAA 4N03A 3C74A 3BD9A 4D98A 5BWBA 5BQ3A 3N7UA 2JFVA 2PRZA 4IIJB 1ZWKA 1K9VF 3ELBA 4ZVNA 3HSYA 3IUYA 1QH8B 4DQ0A 1R0RE 2VDOB 4Q9HA 3MWKA 4E2ZA 5JSKA 2FP3A 1ZM3A 5DNAA 3H1TA 4HNQA 3ZBUA 1LI7A 2J31A 4RPIA 4FOSA 1EG2A 2IEYA 4O33A 3SMSA 2EZ4A 4IOLA 4JLBA 4I55A 4TLCA 5H68A 1DJLA 3QPCA 1C1DA 1XN4A 3IELA 2Z8XA 3DUWA 4R1SA 1E0JA 4D9NA 1JLLB 2YV3A 2J7KA 2OXIA 3BFPA 4OG2A 2YN0A 4KXMA 3LX6A 5MN5A 3PGMA 4HEHA 2DUJA 5EXTA 3VFDA 3MSXA 5BR4A 1VSTA 1VIAA 3ET5A 4MMYB 3Q98A 3ZCRA 5DLYA 3QJYA 1U7DA 3GRYA 4QODA 3GLTA 3WI7A 4F56A 2DTDA 4D79A 4KVAA 1PZXA 4J4TA 2EW1A 3ZZNA 3IH5A 1FXWA 1TEXA 3DWEX 4EYOA 4RYLA 4TV8A 3K9LA 3R7LA 1Q0SA 1RWVA 3WE7A 1YI1A 1CQIB 5KOIA 2QMEA 4W7SA 1KJWA 4NS1A 4HQRA 1KFCB 2O57A 4IFBA 2JIMA 1XWFA 3RS9A 5A5VA 4RH0A 2G83A 3DXXA 4OXYA 3BJRA 1WGLA 2IXEA 3ASYA 5C8YF 1KL7A 1I36A 1WHSA 1H4SA 2X9GA 2V7GA 2PS3A 4RK1A 3A8TA 2R60A 1KGSA 5K3AA 2QJRA 2TSYB 5D6NA 2J3DA 3TNJA 4RKYA 1YRWA 3UXEA 3OJWA 4Q7QA 5IKMA 4WMLA 3L6DA 4IDQA 3G17A 2ZR8A 3MYRA 1FRZA 3TBKA 2V4ZA 4DQKA 2D8MA 1KYWA 4BYMA 1KXJA 3ME5A 1EFPB 1V2HE 2CXHA 1G5IA 3NHFA 4FGKA 3OX3A 3TAHA 1Q3TA 5CVCA 2BKVA 2HRRA 3PFCA 4ABYA 4CQMD 2QAJA 5K3FA 1O8CA 4GPBA 5IDWA 1CUZA 3M8KA 2BGTA 1KZ1A 3E7PA 2FYTA 1N32M 4OGLA 4N40A 1V96A 1W5AA 3FDJA 4TKVB 1WUTA 3HCFA 1F2TB 3V1NA 4E7OA 4Z4IA 5KNDA 1MOZA 1P1FA 1ZHHA 3F8WA 4A16A 1DV0A 2FJPA 4DV5M 1O89A 3W34A 2ZYRA 1VE1A 2QZ9A 1QXSA 4PZ0A 4F21A 3EEIA 1OF1A 2E49A 1QDUA 4LS3A 3OQHA 2AUTA 2NU7B 1RAAA 4PSCA 3TIXB 1Y8ZA 2IYLD 1TUBA 1QP7A 2NUBA 5BN5B 4KGVA 5IW8A 2N46A 1LS6A 1IQPA 2DF8A 3BJZA 2QE6A 3MMNA 1GVNA 3FHJA 3ZS8A 1OX4B 2VT6A 4YK7A 4NJEB 5DBGA 1L1FA 3BFXA 1XTRA 1UDAA 1HNXB 2JFXA 5HUHA 5IAEA 3G0CA 3K09C 4DQDA 2EKBA 1R8JA 4NWIA 3RARA 1NUQA 1YB7A 4GVXA 5AUPB 2XQVA 2GYVA 2FXVA 4LYHA 1KEZA 3O83A 2CC2A 1AB6A 1W76A 3UHJA 4OO3A 4KFSA 2AZ4A 4B7UA 1PCXA 3ESQA 3QVGA 3T7AA 5U1PA 3QPAA 1UP6A 2JCYA 2F5PA 2CJWA 10MHA 2EKFA 1K3FA 3ZTWA 3UB2A 1S2LA 2PRKA 3NHJA 3L7JA 1L4LA 3PC6A 3G2MA 5F2EA 2O0JA 1CK4A 1YDMA 3A31A 3UXHA 3AF2A 3PX3A 3QVMA 2QTFA 4EG4A 3JQ8B 4ZQFA 4QPCA 3VNSA 4R6WA 2VSXA 2YWCA 3UWKA 3GPXA 3ESCA 4L4YA 2LCQA 4ZIRA 4DBVO 2L4FA 1X3LA 1J8QA 4NYJQ 1K4YA 3BE6A 2XWPA 1Q12A 1Y5LA 1OZGA 1WWKA 5BWLA 4LE0A 3AR9A 2VAPA 1AKMA 4YCAA 4ZDKA 1J39A 4AG5A 1JAIA 1JSCA 1FRNA 3INRA 5DLQC 1IOVA 2VHUA 4G0MA 4YPOA 4MYCA 2NUTB 4DILA 2PUWA 3LZDA 3RRNA 3AL3A 1CR1A 4DVJA 4P5EA 5ALTA 3GH3A 4RVNA 4UU1A 4AF6A 1SVMA 5BN4B 5EL0A 2IXAA 4ZDWA 3AR3A 4OYYA 4MQBA 4TL7A 3OZWA 4EB3A 1NPTO 1DKOA 3TW8B 4HQNA 1JR2A 3L0CA 4B3JA 4JI8B 4DPMA 4QREA 2I3DA 4IJWA 1PFWA 5K0SA 3MSCA 3OETA 1SG0A 4O3MA 2XNHA 5ENDA 3C4VA 4C3UA 2A3NA 2O0HA 1R8QA 3OQBA 1QZUA 4F3YA 4PSVA 2C42A 2E48A 5KDLA 3ROKA 1EQAA 3V4SA 3GD7A 1G7CA 2Z30A 3BWMA 4RORA 4KITB 3HV2A 3T8YA 2VAMA 3ODPA 2OOSA 4K2AA 3GRPA 1SULA 4LX0A 5A03A 2V97A 1ZMTA 1K27A 3I72A 1WHTA 3H1FA 1L2TA 4Q9LA 3Q10A 3SSOA 3QRWA 4IH4A 2W6JA 1WVMA 2VG8A 4FFMA 1UJMA 3ROEA 3P96A 4YCBA 2C4WA 4F46A 4RTNA 4OM8A 3I01M 3H9QA 2VQFM 3ZE8A 2VZLA 4XLZA 1NVEA 3GMIA 1KFKB 5FBRB 3FVVA 3NHWA 2QZPA 3U4GA 4OTZA 3LUPA 1D04A 1JECA 5TPZA 4H16A 1E9AA 4XVCA 2E1PA 2PGOA 4UQLA 2VK2A 3HJQA 2IEAA 1TJ4A 5HIIA 3FAKA 2WNSA 4MQ4A 2XQGA 1XPUA 3RV3A 3A4IA 1PLKA 2Q7XA 2QWXA 1U1EA 3WKDA 4MS3A 4Q9DA 3OI7A 5BRNA 1TJYA 1C7RA 2HKJA 1RQNA 1KH2A 3QITA 2QAIA 1NATA 3QHPA 4B3BA 1WR8A 1FRFS 2Y20A 2X4DA 4ZT7A 1QZTA 2QQ5A 4WBSA 1FDWA 2A2ZA 1COWD 1OD6A 3G8BA 2AK2A 4CUZA 5IHXA 2ONYA 3EPRA 3UY4A 4EIWA 4QARA 1J00A 1QFMA 1X1BA 2DAGA 3FCAA 1ZEMA 4BFSA 2PK3A 5HKBA 2QDXA 5AKGA 4E2YA 1M5TA 1N9ZA 1NYLA 4I36A 4K9NA 1P0IA 3JPYA 4UNQA 4P7JA 1U8FO 5B55A 4IFEA 4FFOA 4ZWNA 5JBQA 1ZM7A 4AQYM 3P2MA 1IQRA 3L7YA 2J67A 3DQQA 9ATCA 1LU9A 4G6ZA 5E8JA 2NZ8A 4HAXA 4AF7A 4DXDA 4EHBA 3WXMA 3PU6A 2X76A 5BQPA 1FF9A 3FRHA 4JJ7A 4E33A 4DZZA 3SEZA 1YD7A 3JWPA 3R44A 4RD2A 1IAQA 1XU4A 1YRHA 5AKIA 5T4HA 5HRCA 1NBIA 4MYDA 1AX9A 3SG0A 2IOFK 2LNHC 3U6OA 5KDDA 2RGUA 5MGBA 1X8LA 1FDTA 5HKAA 4QBHA 2AZMA 4KHZA 4C4SA 5BRAA 1ZKMA 4E30A 2R44A 4CZ2A 2NVWA 3AV3A 1BD3A 1JQLB 1FDSA 5LB2A 4I5FA 3JYHA 4ENVA 1ISSA 1EIZA 3REFA 2QYHA 4IIJF 3Q7RA 3S1SA 5C46F 1FSGA 5JBNA 3G2OA 4EG0A 1T5SA 4GLJA 4C22A 5G4LA 1SPXA 4HUQA 4WFKA 4Y9DA 4PGMA 3OKFA 4GLBA 1N0WA 1EKXA 3B52X 3VDXA 2VUSA 5LDDC 5I47A 2COEA 2BGWA 2GH1A 1OV4A 3PXGA 3EA4A 5C2JB 3O4RA 5E6UA 2VDUE 4PSKA 2C95A 2OOAA 4AWAA 1Y6FA 3NXKA 4LJ9A 1VE7A 1U9CA 4N82A 1WUKS 4E1VA 2HK8A 4EZIA 3DBRA 3W3AA 2LVBA 1NC1A 3UNXA 2P2LA 3NYQA 1PL6A 4BHTA 2B69A 1WQ1R 1IDN1 5JRDS 2QTTA 2ZJ8A 3HV0A 2WNIA 3DWIA 1EHCA 3WICA 5A5FA 1YQXA 3B1VA 1LTMA 4NU8X 4DMFA 2NNWB 4HRYA 5FWXA 5C1BA 1K5DA 3RC9A 4XBOA 4RGVA 4P6VF 2CE2X 4JP5A 3VUEA 4JD5A 1OT3A 1P1CA 5EG5A 5FOXA 2JRCA 3M34A 2OCPA 2OPBA 3KXLA 4GWKA 2XKKA 2OR3A 3PL5A 5G0TA 3OOWA 2WUGA 3VKGA 4DEXA 1OQAA 3P45A 3IQFA 3OLYA 1YFJA 2LW7A 5SYMA 1O0BA 1F9AA 3DEZA 1PJSA 3D4PA 4JLJA 4DG8A 3EIOA 1HYGA 4IRUB 4ZCQA 2FGKA 5T4EA 3HJCA 5CD9A 3HUDA 3E53A 2B0CA 4CEJA 4F6RB 3TI9A 1ZI6A 4XB1A 3CZ4A 3ILYA 4PCZA 1TQ8A 2F43B 1ZD5A 4LISA 3O8OB 3SJBA 5IKXA 1W59A 1Y5IA 3SSMA 2F17A 3O4GA 2PG3A 3VU9B 5IC5A 4I0WB 1I2DA 1M8PA 3RAFC 4DSUA 3IP7A 4YJGA 4DVGA 2G0AA 2RBGA 4QQFA 1RWKA 2IX9A 3W5CA 1O94C 2OC4A 2FG7C 4B6FA 1H6UA 2A5GA 3JR7A 1KI7A 5M29A 4GLFA 3AR7A 4CN8A 1OUMA 1H5UA 4D9HA 4MS4A 2QPAA 2ADFA 3QKUA 5CCDA 2XF3A 2VSYA 4G0OA 2XIQA 1IHYA 3NOXA 2PLNA 1MDFA 1VDMA 3T7EA 5KAMA 1SXJA 1V8OA 3PWTA 2ZTSA 4IXWA 2UAGA 1YZQA 3AJDA 4CUKA 3KVYA 4J0DA 4BKQA 4P5DA 4IDBA 3LRXA 4MRAA 1JHAA 3THGA 1UOEA 3D7RA 3CW9A 4KIWA 2FEXA 1D07A 1JLSA 1QQAA 4QGFA 5ES4B 4CIAA 2RGDA 1WVIA 4E5MA 3Q9NA 3GDFA 5CX4A 3F9RA 4I14A 3TSWA 2WKQA 4NBUA 4UQOA 2JFZA 2RFLA 5B1HA 2X1HA 1G71A 3A9WA 4DR3M 1CQXA 3FYUB 3TLCA 4B9AA 2AOTB 4INPA 4MKXA 4QPPA 2IH2A 3DWGA 2GJ4A 3HNRA 3DKKA 5BO5A 3GJ5A 1NXSA 5JS2A 1EWYA 2HK7A 2WMNB 2FFRA 1KO7A 3W4IA 1NMSA 2P0EA 2XGSA 2PKXA 3D0KA 3GROA 3RTBA 1UPTA 4ZVLA 2BWBA 3JWGA 2JZNA 2F5OA 4GGOA 3BM5A 3P27A 1IXRC 1RKVA 3VVMA 2RDMA 1UOQA 2Y0QA 2UZ0A 4ETMA 1UEJA 4F9TA 1T3GA 4DIUA 4H1WA 3OZBA 3TBHA 1ULUA 1TX4B 5AI6A 1DFHA 2BDTA 1BE8A 3OY2A 4I6GA 1FUUA 3VR6A 3HWWA 1SB8A 3E9YA 1KY3A 4EOGA 4KUGA 5IREB 1LS1A 4IWNA 3ANLA 3KC2A 4CU5A 3UTDA 1WEKA 1PGQA 4G4SO 1GKYA 1CNFA 5CEJA 5AVWA 5HJ5A 3PEFA 3BS4A 3KDPA 3CNOA 1C81A 3U7QA 1G8AA 4W6ZA 3DBVO 3SS8A 4BQEA 1TF0B 1N6PA 3ZZMA 3Q3VA 1XTKA 3EFOA 4FFSA 4RFSB 2UZAA 4JX9A 4IXTA 2XTAA 4MV3A 3D31A 1A88A 2DX7A 3BMCB 2C88A 1YA4A 5AICA 3TWOA 3C8DA 2ZE7A 2QBYB 2Y99A 1NXQA 4E46A 1GLNA 5CW1A 1ZCBA 4BQFA 4DV2B 3BORA 1SZCA 3V3TA 4LK2A 1LJUA 1WS6A 5G0SA 3AHHA 4HPJB 1O6CA 2CEAA 1UJ6A 1L2BA 2Y0PA 1JR3D 4KQFA 5KOHB 5J9FA 3K1AA 3PUZA 1MX9A 4R31A 1FZQA 2JLZA 4R1TA 2VYNA 1NUSA 4KXXA 4ZO8A 1VZ2A 2IDMA 1TQDA 1KZHA 2Q5HA 3E27A 2H3EA 3DAYA 1T9DA 4PPNA 4YRNA 2WHYA 3HXQA 3KQQA 1LQ2A 4WKNA 2VPQA 2D8AA 5KYKA 5KX5B 4NHEA 1B6RA 2JGAA 3T7SA 4EO9A 2D5IA 1U1CA 1Q0LA 5CM2Z 2HN9A 1NQ5A 5DYYA 4XVUA 2VDWA 1VGQA 4KQWA 1CQZA 4G56A 5T3UA 3QX8A 4JP3A 1BXRA 1EJ2A 1C3LA 3G0IA 1KAHA 3K0FA 4J7XA 4WH0A 3WDLA 4M0LA 4YP5A 1Z35A 4X84A 3OEED 2QLMA 2YV4A 1CEQA 1W6RA 2O05A 4WXYB 4DA0A 3MCAA 3OIWA 3B36A 3ZTYA 4NSNA 4Y9RA 3HI4A 5A6VA 4KNVA 3FAZA 1R4GA 1E18A 3B85A 4M7PA 2HU2A 1MG0A 3H2YA 1MTZA 3WL7A 4J0KA 4GX1A 3AM5A 2VSOA 4XEUA 1L5KA 4DEVA 1ZITA 4ZKDA 7AT1A 2H5JA 1UMCB 3IXLA 4J16A 1ZGJA 2OWEA 5K2MA 4HWKA 4II3A 1DKRA 5BUCA 4AKEA 2BGNA 3KZ1E 2FE8A 3PUHA 1V5EA 3UG6A 5ALDA 4WBXC 1CF2O 3NAMA 2GAJA 3S5JA 4IINA 3BN3A 3PCXA 2JKYA 4MQEA 4D82A 3UF0A 4BNWA 1D0KA 4AIIA 1H94A 2CXTA 2O5CA 1E89A 4YFVA 2PUJA 1KAMA 1QHFA 2CNNA 3S1AA 5F98A 4A8JA 2CF5A 3IMKA 1WB5A 2JGNA 4N47A 1ZRSA 3GF4A 1XCGB 1C7ZA 2D7EA 3KKLA 2WWWA 2PJZA 1OH5A 4NATA 4E2WA 3LUKA 3J7BA 3OTOM 2ZUCA 4EEKA 2UUOA 4M9ZA 2QP3A 1E6KA 3SBEA 4G09A 5ITSA 5TVGA 2GKSA 2OAEA 4INJA 3LKZA 1T1GA 3LYUA 3K73O 1X1QA 4O29A 3PXAA 1OXVA 2V7XA 2C9ZA 2CLSA 3P9PA 5FPSA 3A9RA 1FP1D 2UVPB 3C4JA 4OJTA 4JP8A 1BH2A 3R3HA 5U4QA 2MYUA 2AQIA 2P6NA 5K4GA 2RCNA 3LHIA 2FF5A 1JLHA 5EZYB 3LYAA 5BMVA 1J7KA 3DPSA 4AMBA 4JDPA 3IHPA 1VKJA 4QTXA 3DS8A 4XX0B 2YUTA 5KBYA 4M9RA 4ZTZB 4TVOA 4L16A 2ZUBA 1QLHA 3D5QA 3KR9A 2JEOA 4KLNA 4B33A 5H80A 4O6VA 1XRRA 5KPRA 3F6PA 4MV9A 1NIPA 3AKCA 1OXXK 3SSNA 5B6PA 3DOFA 3D02A 1H93A 3WJ2A 4PYJA 3T3PB 2VJLA 4MB6A 4A03A 1WXXA 2XMCA 1S2GA 4C2BA 2UUCM 2C5AA 3RTDA 2GM3A 4JQYA 1THMA 3UWOA 1IBLM 4GMXA 3I5XA 1SHLA 4RETA 3K53A 4ER0A 5TS2A 2X3UA 2GN6A 3M4ZA 3SWWA 2LWXA 4QOHA 3PPIA 4CM8A 1DNPA 1RE1A 1MVLA 5FFMA 3VGJA 1ZK0A 4R2WA 4Y2YA 1UMBB 3AHEA 4M7OA 5LFAA 2FJ0A 4NZYA 2XE4A 1P0FA 1FIUA 3EXFB 4R9RA 3UM9A 4XKJA 3QYPA 3VKHA 2GKOA 3P20A 3AK4A 4HB3A 2E87A 4QEDA 5HK8A 1U3DA 4JL6A 2JJ8A 3NWJA 3K6SB 2P4HX 1J0AA 3ICVA 3R7WB 1CDDA 5DCYA 1NJ5A 1W48A 1TMOA 4IOKA 3E7FA 3V4LA 2GTHA 2PZJA 1I7LA 4B7GA 4BMNA 2C82A 4P3XA 1A1SA 1GKKA 4YRGA 5HILA 2FWMX 1UFVA 5FUYA 3IBFA 2QTRA 3WWDA 3GEGA 2C1EA 3A27A 1EGHA 1V8PA 3NWOA 3D8HA 3C3DA 1ESDA 1Z36A 4LJ8A 5E2AA 1JJBA 1W8DA 2YVKA 4BB0A 3FJYA 4NOKA 4CQMA 2XXBA 4KN8A 2VJAA 3KJFA 2XFTA 2OAP1 5A0TA 1WZNA 3O2JA 2ZSJA 5DNDA 1YR9A 1LPNA 1MF7A 3IECA 4I2VA 4D9MA 1AV7A 4ITVA 2PZEA 1U90A 2G40A 3OCUA 2PWYA 1JQ3A 4UHCA 3CRZA 4BPBA 1UWKA 3V4RA 5EIFA 1D8TA 1UODA 1YMUA 3LWDA 3KO8A 1VP3A 4L3WA 3L7IA 1SWVA 5DCWA 5A6SB 4AAYA 3PPVA 3DB1A 3M82A 2I62A 3G9TA 3B9RA 4PC1A 1FYEA 1AUOA 2QTAA 2F5SA 1HA3A 3FSGA 4IY1A 3L7CA 5JVDA 5KTRA 1L8AA 1M1YE 3IQGX 4ZCPA 5ITZA 5E7QA 4RMNA 3M6UA 3M6AA 3T1YM 5FPHA 1Y1KE 4KR2A 3PEUA 1TO2E 2J3EA 2N42A 1FPQA 4Q6BA 2BP7A 3ICCA 3WGIA 3H8WA 3FPEA 1JHUA 4GDMA 4CKCB 2G9UA 3X3HA 5FULA 3ZLTA 3E9DA 4B7HA 4KXQA 2WIFA 2FJUA 3COWA 1NP6A 3B2QA 2O2XA 3C8UA 4NY1A 3F4BA 1G66A 1WZEA 4PN7A 4Z9BA 1H4VB 1JLKA 2AYZA 2N75A 1XRSB 1S01A 1UK8A 1GP2A 4KTVE 1TMKA 3FWPA 4IDAA 1F1BA 3QWFA 4NS4A 3ZC7B 1DMSA 2CSUA 2R87A 5CYPA 3A6KA 4X92A 1XKXA 4XR4A 2GEJA 1HG1A 1Z5BA 4PHTA 4NZOA 2JGMA 2IBMA 1G59A 1G60A 1AIPA 5ARBA 1KO5A 3KB1A 4EDHA 2PH1A 1V7ZA 1RAIA 3QE9Y 4JLUA 2LIPA 1XJ5A 3ZHYA 1KKMA 3USZA 2REQB 1EK2A 1UDXA 2W4MA 2V7BA 5LMNB 5EKUA 2W37A 2RSLA 2IXTA 2I76A 1HE8B 1N6RA 2H4WA 2YVQA 3Q1LA 1RAFA 2ZTLA 3V1KA 5DBHX 2WP8J 3B7ZA 2XZDA 2PX2A 1HPLA 5IXYA 2C83A 1KO8A 3J81S 1UL1X 4HFMA 3DFFA 3FPHA 2K7FA 5DM4A 1VEJA 4MIYA 4QDKA 1DPFA 4E0BA 1PUJA 4OKNA 3W5HA 3EA0A 4HXEB 3LOPA 2VJMA 4ZYLA 5E38A 3F46A 3GA7A 4HPWA 4BVGA 4PVCA 3K3PA 4JOCA 5JCPA 5AW7A 1EZ1A 1R2QA 2ZWPA 2RG1A 2QPOA 2VHEA 1D4FA 5ETJA 3A9VA 3EPHA 3PXBA 3ZH9B 1NI4A 1TZ2A 2QORA 3EZ2A 3OVMA 5G40A 1GZ6A 2XHZA 2BMWA 3QPWA 5EUBA 2XQIA 3DL2A 1DTWA 4OL9A 2DE0X 1KAEA 1ZU4A 2J3IA 4WNCA 5HSGA 2POQX 1XTJA 1SD5A 4PSUA 3MPUA 2H5IA 2F62A 4WKCA 1TYAE 3SJAA 4DWOA 4PYIA 4W5OA 3COZA 3M70A 2Y4NA 1C1HA 1QF6A 1KOJA 4H1TA 8ABPA 5C4MA 5KPZA 1UT6A 2B8NA 2QTGA 4CG3A 1K63A 1DAEA 1V1MA 2AXQA 4YR7A 3ZC3A 3I4YA 1N0VC 3L4JA 3GR6A 3V34A 5M3BA 1N0HA 3A4NA 2E18A 5L45A 2X2FA 3MMSA 4M37A 4P86A 3GLGA 4YECA 4XIYA 4I6JA 1F6DA 4DOMA 3UOGA 1L3CA 3DVLA 4C9BA 1JG4A 4X0EA 2ISQA 1XO1A 3B1KA 1HNNA 3KYBA 2ECFA 3KPWA 3UH0A 5DIFA 5E4FA 3LPLA 3FWZA 1ISFA 2WJHA 2XZTA 2FUCA 1QRTA 2GBPA 4ZPJA 1R8YA 1H0KA 3ITNA 2ZCUA 2NSDA 2W6CX 3E21A 4I9NA 4Z8YA 3K70B 3ZWNA 5LZ9A 1ZK4A 4YJKA 1UBNA 3TAUA 1WJ7A 3U4AA 1LLQA 3SEAA 2FRXA 2H4XA 2X1VA 1PHRA 1VLLA 2YXNA 2F4VB 1JPVA 1GNLA 2QQFA 4X65B 1A72A 3QYEA 2ORWA 4I8XA 2NIPA 3TSYA 4PLCA 2IHTA 2HM7A 5E0KB 4D6PA 2NU8A 4YMUA 1T6OA 5LQCA 4Z0HO 3UUWA 3NT5A 2ZXFA 4N3CA 4U7GA 1QIJA 1COWA 5EJMA 2RGCA 2QV7A 3REOA 5KX5F 3GVXA 3VC1A 4J07A 1DGHB 2YFQA 1EX9A 3U3MA 4EGJA 2CK3A 1MP0A 2O8DA 2P4EA 1QQTA 1T3SA 4KYVA 5TB5A 5TVKA 4PIPA 3ILHA 4DSTA 4R7TA 4DNQA 2CHGA 3P5SA 1K2VN 2C2YA 1HC7A 3RIMA 5EQTA 4IDHA 1VDZA 1I1HA 1JU3A 2XE8A 4C0KA 2C7BA 4LNAA 2YZGA 3O2QB 2REBA 3U4DA 4AYWA 2DPLA 4RA6B 4YT4A 1VYUA 5IAGA 4CM7A 1OLUB 1BS9A 4ER5A 1O03A 1WXQA 2QVYX 1X37A 5DYGA 3THXA 3T5PA 2PXXA 3H5IA 2AXPA 4OXXA 5EA2A 4ISBA 1V9SA 3I0MA 5LC1A 4CLRB 3CH7A 1J0BA 2R4QA 2LVNC 4AQDA 2JLAA 1O5IA 3FY4A 1QOZA 3OEHD 4LFCB 2PMWB 3RQIA 3CH6A 4LZAA 4D56A 1TO1E 5P21A 4WCFA 2HHLA 3C16C 4X7PA 2FFJA 1QHNA 2G17A 2XB4A 2GA9A 1N77A 3PTAA 1PT6A 1KEEB 2PXHA 3DAPA 3D6TB 3VH3A 4PZLA 1ATZA 3PENA 4JLSA 4V0QA 2CBZA 3DXYA 5DGCA 2JNHA 1UXKA 3P2IA 5IKEA 5JQWA 2IYSA 1Z8DA 2F3UA 3GC6A 2OLEA 1N6OA 5ALHA 2CUNA 2R62A 4IGFA 3PFNA 4KV9A 4DBGB 3ETLA 3VX3A 3OF3A 3DC7A 3FVWA 3DDNA 3CKMA 3BBZA 3O1HB 4FGJA 4IEFB 3ES9A 1ORHA 3A7EA 1CS4C 2Q5LA 3G7NA 3WL8A 1BGWA 3EZLA 4RACA 2AC4A 4PYKA 1KDYA 221PA 1TQ4A 1M2WA 1O77A 1MAHA 4M89A 2NO9A 3IV6A 3WKEA 4EG3A 2GRJA 2NM0A 4TKMA 3WMXA 3WS7A 2CLEB 3FJ1A 5JZBA 1EZ4A 2EO2A 2P6OA 3LT1A 5JYDA 3A6JA 1ECFA 2ZJ4A 4U39A 1WMDA 3PUXA 4BAGA 5EZYF 1GL3A 2DWPA 2I8AA 4P4LA 1L9KA 4TROA 2FS1A 3BEOA 3QEJA 2PYDA 1U4NA 1D6JA 4KXYA 5L95A 4E2XA 4N6GA 1FU7A 3SARA 5K0LA 4D8XA 4IDEA 1I9GA 5AKJA 1I7SB 5KC9A 4U6SA 1E63A 5EQFA 4WPGA 1GR1A 1OROA 1NUAA 3DP7A 2FW1A 3U13A 1ZH0A 4RKEA 3N2YA 2V03A 1Y1PA 2VBFA 1MRNA 3IYLW 3SX0A 2A0FA 1CF9A 3E22B 5FOVA 5THXA 4NP6A 2OM6A 3I2JA 2FE4A 2R45A 4NSRA 5I7EA 4H7FA 2JFFA 1SC4A 1C0LA 1NMXA 2PDAA 3L05A 4DV0M 2YMLA 3K0EA 1NMYA 5AVJA 1HRDA 1AB5A 2FPSA 2ZPUA 5IN5A 2GAOA 2D4AA 1E5LA 4DF3A 3PJEA 3OCJA 5C5DA 3HB4X 1WGNA 3SIRA 1YBHA 4WJLA 4U7WA 3Q5DA 3D9QX 2L69A 1L5MA 3CWQA 1SCAA 2FG6C 2EX0A 4HH1A 4RL6A 1KDZA 5DDIP 3UXYA 4AMYA 2Z56A 3CA8A 4YVFA 3DLBA 1I94B 3CM0A 3AJIB 3NVMB 4H3SA 5HBRA 3SATA 3CR8A 4DMLA 1Y80A 3H5TA 3N86A 3Q85A 3U6SA 4DLKA 4JGBA 4HXGA 2ZGVA 2ZYHA 2FEKA 2QGFA 5AI5A 1CDZA 2JG3A 4M8KA 5JC8A 4M0PA 2XGNA 3VO8A 1XD8A 4LY3A 4TOIA 5T57A 3LDGA 3NKVA 2IP1A 3Q7IA 4EARA 2YUIA 1WQ4A 4MR7B 5LVAA 5BQFA 3ZX4A 2WWTA 1DAOA 2VHXA 2FSUA 3UWSA 3NJRA 1EM8A 2HL6A 3G1TA 4Z0NA 4Q05A 3RNOA 4A23A 4Z8XA 1YDWA 2ZTDA 1EXWA 5HCIA 1CLUA 3HRHA 1J8FA 5AW0A 2EG9A 3VZDA 1ISJA 5HIAA 4N41A 5I9NA 2HPHA 2IV7A 3E6AA 2AJBA 3I5YA 1YIOA 4BO0A 2X0IA 4L9RA 1ETHA 3WK8A 3NU1A 3RVNA 4NMWA 1U9ZA 3DOIA 2K2WA 2R7NA 5CH8A 2V8BA 2FN4A 3MJTA 4OHCA 1DUIA 2ONKA 4R2XA 1DIOB 1MT3A 4PC2A 5I7SA 1NR5A 3DYBA 2H1VA 2R1ZA 1NF3A 3ZJ4A 2G6TA 2G5PA 5FO1A 3OA2A 5DASA 1C7JA 5DMHA 4OW0A 1TU4A 5GMOA 4HDKB 5JYEA 1W35A 4N7MA 4JELA 1HYHA 2XEDA 1XEXA 3KOXE 5KWJA 3DMDA 1Y4AE 5JNRA 1E1KA 4IZIA 1H3FA 4LVCA 2FWIA 2ZB3A 1NI3A 1UP4A 3UO8B 4PFSA 4HAOA 1GRVA 4K0RA 1ZSVA 4Q16A 4H0NA 2ZTMA 4B85A 1JEJA 1ZH6A 1Y1SA 4R51A 2I7TA 3BWXA 1E9RA 1DX9A 1IM5A 1RRVA 2F67A 5TS3A 3BGWA 2WFZA 3UMYA 1KSFX 3AR5A 4LGCA 2HMAA 3RJMA 2R0QC 2WTMA 3W8NA 3PKJA 5ITUA 5CXUA 1YVPA 2VSNA 2GB4A 1SUDA 5IBRA 3BICA 4WJZA 4WKOA 1B1CA 4QYWA 1ZICA 1PYOA 2C2MA 1KRWA 3FGZA 4RANA 2WA2A 3GJ0A 3WWCA 2VK8A 4BRWA 4WY5A 1RWBA 1XMQM 3SM9A 4MMZB 4FGZA 1NVMA 4Q82A 2CYAA 4HQ0A 1G291 2ODAA 3DT8A 3STHA 1Q3KA 4RIFA 1W4CA 4QATA 5T7BA 1ULBA 4B3SB 2AFVA 3MK6A 4UNNA 3QU2A 3N0WA 1B8PA 4IZHA 5CT8A 1BKSB 1E60A 2LUOA 4HQ6A 4G2NA 1PLLA 2KZSA 4V1CB 5GGXA 5KHAA 5H9WA 4MGYR 5KQGA 4YR9A 4RELA 4A8PA 2OGTA 3DJYA 3LS2A 3H16A 3IAS1 3NMUF 1SU6A 3WHIA 1A1VA 5L3QB 1OAAA 2UUAM 2EKZA 3O31A 1TH3A 1MZVA 3DNPA 3BBPA 4OM7A 4OOFA 2Q8QA 3H99A 4B35A 4YJ3B 4EJSB 1HETA 2BOVA 1JR3A 4KKXB 4L4ZA 2Q46A 4QEKA 2JCBA 2XUPA 1ND6A 3TOSA 3SDBA 3VUFA 1DRJA 5HA5A 1SM4A 4JLPA 1ULAA 3IIIA 4BZQA 2FA9A 5G3ZA 5KQPA 3AFGA 4ZT4A 3TDNA 3PDUA 1QPBA 2PU7A 4MR9B 1PR4A 5F2NA 1Y37A 3CPEA 3A3YA 4OU5A 5K0FA 1WD5A 2R68A 4ES6A 2R85A 3TLGA 3GAAA 5LQNA 4TXHA 5HX7A 4XUCA 1QLWA 3RWOA 4MWTA 3EH1A 4REQB 1AHIA 5JAOA 3LPNA 2Y77A 4YJ2A 1BW9B 1W85A 2QI9C 1M6VA 3AUSA 4PDIA 3PL1A 1WP9A 1NOJA 2QW8A 2CN1A 2MROB 1U7HA 1ULHA 3G23A 4UBOA 1NJFA 2LCIA 3IO5A 2HSZA 5FTMA 1GN8A 2QZSA 3KZMA 1TYDE 3EA5A 1BHSA 2V7EA 1JEYB 1G9XA 1GRNA 1GLGA 4IF4A 1OZHA 4QE3A 3AXSA 4TYWA 3OE1A 3LOUA 5LZ4A 3PIDA 4NNPA 1FFHA 5ESRA 3OFKA 4MQMA 4FFLA 4JY7A 4QYSA 1Q83A 2M6LA 5EI5A 2GJ8A 1X2EA 1XDGA 2Q2EB 1DELA 1GUAA 2IGTA 4FT2A 4GYKA 5JSFA 1RQRA 1NU8A 3DXFA 1ZUNA 2QM3A 3K05A 4BZWA 5DHTA 4DDUA 3PDHA 2IXGA 3AUXA 3T7TA 5AJTA 4KTTE 2YBDA 2R5NA 2GJKA 4I46A 4I8IA 3EISA 1LWNA 1QFJA 2IOFA 3C3MA 2PCLA 4P0PB 1L5YA 1JHDA 4UFNA 1ADBA 1ZISA 4X66M 1ENOA 4ZMBA 1K6EA 4TYMA 3M83A 1AV6A 3OU7A 3PEYA 4OGFA 4MUHA 4EQ6A 3T0GA 4LRYA 3N2NA 4B47A 3WQQA 3AESA 2H18A 3R0IA 3TVYA 1TDHA 3CX6A 1AKWA 5A2QA 3TQTA 1I3CA 4E4YA 1MNAA 1W5EA 3S2YA 1BU5A 3DOOA 5FEMA 3X43A 4HGNA 3ORHA 1HM5A 4YJHA 3VKFA 3KT8A 4HEJA 4G4QA 4AUEA 4FDMA 1JQKA 1M8JA 1KE2A 1NG1A 4BB9A 4QTUB 2XTMA 1TL7C 2ZYWX 4BDSA 4JVNA 5I8ZA 4DMRA 1P2TA 5I6DA 3PWKA 2DR2A 4M1WA 3I92A 5JR3A 4IMJB 4OB8A 4ITUA 3CUYA 3IAS6 2Z04A 4Q9JA 2LH0A 5AXBA 2PSFA 4JT8A 1ZVMA 1EP2B 4WWHA 5JMPA 2C07A 1LF0A 3WY9A 5U9CA 3JSXA 3LVFO 2ZBQA 3HRKA 1V95A 3KQSA 1Z06A 3NBXX 2GEKA 1I24A 3GLRA 1MEEA 5G0WA 4I81A 1VMDA 1KC1A 3R8XA 1D2NA 1EDDA 3ER9A 3V5NA 3Q8XA 1E66A 2VH1A 1FC0A 4NJMB 3HP1A 1TD1A 4HADA 1W88B 1XA3A 1AUQA 4KJZA 5DTMA 2CJPA 3VC2A 2R66A 3NS7A 4F8EA 2GCPA 4HDRA 3QKIA 5BN1A 4P8RA 1M7HA 1ZQ1A 4HI0E 1KK3A 4OVZA 4WEOA 4G97A 3K35A 3UBTA 3G0OA 3KQTA 2WSCF 2HAKA 1YA6A 1VPWA 3CMMA 3LF2A 4Q9NA 3VTFA 3LL7A 1O08A 3AKYA 4UE2A 1YJXA 5JD6A 1BFKA 1PV1A 4L57A 2LXNA 4Z99A 4OXIA 1EX7A 3OT5A 1BG6A 3FPLA 5CA1B 1HJPA 4XSGA 4F6CA 1T9BA 4Y0AA 1ZA2A 1JVBA 4CT0A 1VGRA 3PC3A 2R65A 3HP7A 3I5UA 4FHFA 4ZHQA 2QTMA 3R9XA 2PUTA 3HGQA 4YWJA 1IK4A 4RULA 3VISA 3AR6A 1OH7A 4OJQA 3BMOB 2UDPA 1N2GA 2VA9A 5GJBA 5KYWA 5IT9S 4FOTA 1NHGC 3RSZA 5K3OA 5JU6A 4ZK2A 2NTEA 2R4EA 1AZWA 4NRVA 5KUTA 4QUEA 3Q15C 1FL9A 2IE0A 4TSRA 5JS8A 4UC0A 2J3QA 2FSPA 2BR3A 5K01A 1IHUA 3CF6E 4Y1GA 1XELA 1KIFA 4QDZA 4YCJA 2GLXA 5SYAA 3C58A 1W1UA 1RXVA 4D42A 4EFLA 1N5IA 3EW9A 2H9AA 2DKNA 3GJ3A 3DOUA 2UYHA 1CULC 1LKZA 4MO9A 2P9YA 2EU8A 2ZBDA 5BQ5A 5FPYA 4LRTB 2D2EA 5K8VA 1JG3A 1J99A 3JZAA 4FJ0A 5B3JA 2NV2B 4BL5A 3JXEA 2RGAA 2A14A 3UHPA 4CIWA 3W6ZA 4TXLA 2XBLA 1K3XA 2EOAA 2IHBA 1XKQA 1WCIA 2GCOA 4IX9A 1LK7A 1N4AA 2PMCA 2VH5R 2AFIA 5K0EA 5FNVB 3CR3C 2Z95A 1GSAA 3RJTA 4LBZA 2VJQA 5E8RA 2B92A 4QJ3A 3QLVA 4V02A 3PQFA 1H2XA 1ORYB 1J1ZA 2C3YA 3ZBTA 1JQ5A 4Q24A 1DPGA 2FRVA 4E14A 2PJRA 4NV1A 1YWGO 4KFTA 2XNKA 4XYEA 2Y93A 4EG6A 1PD0A 1YULA 4CIZA 3TIGA 1NULA 3MMZA 2IYTA 2OENG 4AWBA 2VA8A 1AZTA 4HTAA 2CUKA 3DNMA 4E5SA 3FDFA 4OBBA 2WZDA 4LE1A 2P3LA 4JAVC 4R9SA 4NMLA 5DHSA 1IBMM 1CQJB 2O7VA 5IYZB 4UTPA 4G5OA 3JAKB 2RJOA 3LT0A 1L4KA 3MYYA 4NICA 2CUTA 3JY6A 3WGHA 3WRXA 1WMFA 3DF7A 4W6QA 5HE9A 1OGYA 4OD0A 1N5LA 4UM9D 2JBAA 4E09A 2GPSA 2C2ZA 4FLFA 4WLVA 3ABQB 1ANKA 2IVFA 2QTBA 2E5LB 2WILA 3EDMA 1SKYE 3MTBA 5JD3A 2IUUA 2O52A 2WVHA 2I7DA 4EG7A 5DBIA 3GPIA 4O2LA 2GM4A 1IHPA 3O0DA 3QX9A 3KQOA 4CGZA 4J9VA 2B9VA 5HWSA 5AUNB 4EX7A 2FPLA 4IV0A 2PS1A 5ER9A 1DO0A 3RYFA 4P4SA 1NWCA 3NHMA 4O4JB 2C0PA 1YSCA 5CCEA 2P67A 5EAIA 3RU2A 3W2GA 4M98A 3SHOA 3EPPA 2A0YA 2HIAA 1XOIA 1CJVC 1ZH4A 2IC5A 3KZXA 3HZZA 4DM4A 4S2UA 1H9BA 4MW5A 5C5CA 3CEPB 2YS6A 2CDRA 1TB4A 2BC9A 2CNOA 2I2CA 2L82A 4O08A 2NNLD 3ESDA 3K6JA 3AP2A 1KSJA 1FJGM 3EFBA 4XB6B 4N7JA 1UMDB 4HH3C 3KP1A 2R6R1 1DHTA 2Y4OA 4RZXA 4NH4A 3QEMA 4Q6WA 4UZEA 4PO9A 2D4HA 4IFIA 2MJ5B 1E1CB 1F4LA 3ELUA 4GL2A 4HTFB 2XR1A 1ODFA 3QLUA 3QXSA 5AVVA 5FUQA 2HDWA 2SNIE 1TTTA 4YJ3F 1INLA 2H6EA 3AOGA 4IIEA 2AUNA 4RHCA 5BVHB 4PX5A 3UWPA 4E5KA 3D5TA 4CG0A 4ALIA 1Q1AA 2OD9A 2BZ0A 5ERGB 4QIHA 1F7UA 4KACA 2H29A 3V6MA 4EGCB 2HSWA 1USUA 5A4FS 4CQLA 1LY1A 2W90A 3AKEA 4MUNA 5CYOA 3M4JA 3AVTA 4AO8A 2J0EA 1U9JA 4UUNA 1LC3A 2O6LA 1ZIYA 2WFAA 2OLKA 3TRFA 1OKKA 2GCGA 3K8YA 4FR0A 3UHFA 3E61A 4RLSA 1M1YB 2BJVA 3LA6A 2EJVA 4YLEA 4Z2YA 3E8MA 4P2GA 3P9YA 3CF4A 4NBNA 5ERYA 3OCYA 3U1TA 4NOOB 5IF3A 2YICA 4HUTA 5KYYB 5JMTA 1SIBE 3RE8A 3DVSX 2XKJE 4Z7OB 5JMWA 4WFQA 4NZ9A 2ATEA 1KMIY 3FYCA 2ZIFA 1PWHA 1C0EA 3PX2A 1V5IA 1Z0KA 3WHPA 2HF8A 2EJBA 1MOPA 3LMMA 1QIFA 2YHAA 4Z9XA 4P53A 3EFHA 4ASUA 2XEXA 2FSVA 3QU7A 4PTZA 2VUHB 3P9SA 4LOKA 3QFTA 2X6TA 4HNAB 4D3SA 1H5NA 1ZHOA 1XQ6A 3JALB 3OTGA 2F6RA 1QGAA 1CDEA 4L07A 5JZMA 4BNXA 2ZDGA 4IYRA 3W0FA 3STTA 1GWNA 1WDTA 5L7WA 4EI7A 4UTRA 3U6QA 1PKEA 1HDGO 3KR2A 3LPAA 1DCTA 3HYNA 3SYNA 4KBFA 5KOJA 4TM7A 4FI3F 5D5HA 2N1MA 3ZCBB 1SZJG 5CYFA 5H83A 3GLHA 2DHEA 2PKCA 4FNGA 2HQ1A 1N1GA 2JGDA 2X58A 2VI5A 2TECE 3DBOB 4RNDB 4AICA 1NP3A 1MJNA 4G0YA 4CV0A 5LWQA 3KXKA 1V16B 2E4XA 4ZC8A 5IT0A 2FW9A 3K0CA 2ZWIA 4GEKA 1T9GS 5EEGA 1HTBA 1HL7A 4B4VA 1UKVY 2WU3A 1RKBA 2YINC 1Y8QA 1XJCA 3FOAA 4X60A 2BAGA 4NZMA 2M32A 4TSFD 2DUNA 4G8CA 4P98A 2RARA 4X3CA 4M0CA 5I4BA 4BJ6A 2A88A 3W1WA 3UYLA 3WJAA 3SFVA 3GQVA 4F38A 1MB0A 2WQZA 1Q39A 3X1DA 4FLEA 3NAQA 1WO8A 5E1BA 4OHVA 1KMHB 4OMCA 3P0FA 1BYIA 1XB2B 3E0XA 4KPFC 1IY0A 3MTAA 3Q7SA 3AIMA 3OOYA 1UAYA 2EKLA 2BJWA 4DA9A 5LQJA 1ZJZA 5B1IA 3P5BA 1IZ0A 2FF7A 2OORC 1YE9A 2Q1UA 1X38A 2QTCA 2HTEA 5U4XA 5EJ6A 4DV7B 1ETUA 2H9YA 4FHDA 4U7FA 1N5KA 1A7AA 3S70A 2UU9M 2C7VA 4BGEA 1Q74A 3WWYA 1RMTA 3D8RA 3M4NA 1P2BA 3FZEA 2OPHA 1NOKA 4HXFB 1XDSA 1SK9A 1TZMA 3Q5EA 1CBUA 5IDYA 1JE0A 4MW7A 3EJ6A 3K2LA 2WEKA 3PGLA 4XA8A 5G41A 4UNRA 2DY0A 1AS2A 4GEWA 3V8PA 4EY7A 5GM1A 4XQ0A 2X8LA 4PLGA 3L6RA 3JRXA 1EM6A 2QENA 3SS9X 3I6IA 4D9EA 4LCJA 3TEMA 4CMEA 4QQRA 4BNFA 2VLIA 5J43A 1RQ2A 3EDOA 1ARZA 4EI2A 1CJCA 2DPXA 1LTHR 2JLUA 1U6KA 4MWDA 1EXNA 1XQVA 3G7UA 3PR3A 3ST7A 3JQ9A 1GRRA 3I6YA 2UUBM 4MB7A 2OYCA 2BONA 4I2NA 5IKOA 3HKCA 3WHLA 3IQDB 1R8XA 5D3MB 5CVTA 3AWIA 3I9JA 1J21A 3E81A 3K1TA 3DHEA 3A45A 1Q0ZA 4KBYA 1XVLA 2E4UA 2FLVA 5CA1F 1JVNA 4KDFA 4BKMA 1GFWA 3PKZA 3RH0A 2NUPA 5H37D 3VVLA 2BPOA 1WF6A 1BJRE 1N8KA 5ELMA 2ZREA 3S81A 4G2TA 3WZ2A 3QPVA 2Y9MB 5LMZA 3NRBA 4J6FA 3D3EA 3LHSA 4TLAA 1L5QA 4DY4A 3Q6MA 1B8VA 4O2BA 3CWCA 2EZ9A 2J46A 3DMHA 3V97A 1K7CA 3WIVA 1SO8A 4HBZA 5CURA 2IWHA 4K6CA 1OE0A 3RHFA 3IE2A 1G18A 4CU2A 3U9LA 4Z1MD 1OIVA 3N58A 1G5QA 3MTJA 2F8MA 3ER8A 1IZYA 5J3JA 4P54A 4RY0A 2F64A 3FB1A 4A27A 3A6PC 2RC6A 2D00A 3Q12A 3EXHC 3V1UA 3TJRA 4D0RA 2WF9A 4S3MA 4QWWA 2G3QA 2QRVB 4TXJA 2PAFA 2QRHA 4BJHB 4Q7KA 3UYKA 1DLJA 5T3YA 3WGGA 4LF9B 2BMJA 3P0EA 1XRLA 3VV3A 1BOOA 2QB5A 3CX4A 4J1QA 5IWAM 3WVNA 3AP3A 2DFKB 1NSYA 3ZVKA 4X63A 2EBFX 4UEKA 4HK4A 2EL7A 3SF8A 1KEPA 2J45A 3H2GA 4YDQA 1OX6A 1G2OA 4ZQHA 1UFQA 2GPTA 2Z1DA 3VR5D 3QH4A 2VDQB 4KLCA 4G5QA 5FNVF 3JASB 3T5BA 4UM5A 2HPVA 1CZOA 3UJCA 2D0OB 3F0TA 2HGSA 1GGKA 2YVLA 2VYCA 2C9DA 4UAGA 2OFOA 3JVIA 4UTOA 1TTEA 3KTDA 4FEAA 4ILKA 1QO7A 1VC2A 4Y6GB 1UZAA 4QFCA 4L08A 4NPAA 3BGIA 2PUEA 1IN1A 4IG9A 3GN1A 1N1EA 4AU1A 1B41A 5AUQA 3A2MA 2VRWA 3FF1A 3MTDA 5IXJA 1DIRA 3BQ9A 4FYYA 2HK9A 5LXTA 2I99A 4JN6B 1XWIA 4Y6LA 2QLTA 2Z57A 3NUGA 1ZRHA 3MINA 4TTJA 4EB6A 1O94D 1ZN8A 3BF8A 5IYZF 3IVRA 5EVCA 2EKPA 4BXOA 1GEEA 4P38A 4B71A 5AD1A 1ODKA 1H4QA 1QDRA 4B3FX 1V4VA 1XEAA 4BNDA 4FEEA 1SU7A 2OD7A 5AI4A 2WWRA 1M8KA 4RV4A 3ORYA 4NG4A 1G8MA 2G5GX 2P79A 2VHQA 4E21A 1Z0JA 4QU5A 3GZNB 3RBXA 4LWPA 3ETEA 1V5WA 3AETA 1QGED 3U09A 3G6KA 3ZHOA 2V6ZM 2N47A 3ON5A 4C4AA 1E3IA 3FM9A 4Q1EA 3B82A 4IDPA 3TE7A 1XLTC 3AHFA 4OBWA 5KNBH 2ATXA 1T2CA 2SHKA 2GUWA 2PL5A 1QIKA 4KG7A 2ZATA 4FP9A 5CBPA 2C4UA 4ID9A 5FOUA 4CDRA 3CGGA 5LP6C 2BM1A 4O4JF 1VJRA 2XBUA 4OH1A 1J5PA 4A6PA 5HZMA 2R11A 4YDSA 1ZDMA 3H1GA 2OHVA 5JPDA 2X42A 5EYPA 4LZPA 1A9ZA 1V11A 3WBJA 3E2PA 4JVLA 2IY9A 1UM9B 3G1WA 1Z37A 4PRYA 1OTYA 1UBRS 3MHVC 3RIEA 2DECA 4NXMM 3NHSA 1C29B 1DBQA 3P4UA 3UGKA 1DJOA 1WSWA 2LHGA 4TTAA 1SRRA 5D7BA 3FLBA 2GZ2A 1K4MA 5B58T 3SAJA 2H4HA 3OPXA 4RK7A 3WGJA 5D3ZA 2QVLA 3HXTA 1L7RA 4AKIA 4R40A 1TTQB 2XRFA 3ZV5A 3SC2B 1YRBA 4REOA 1DEHA 3DV0A 4QVKA 3ANMA 4HLQB 2NTJA 4DA7A 1U8EA 4F93B 2ZUUA 5TRTA 3NVKI 2JLWA 3CZAA 1E6CA 1WSDA 1WPQA 3PC7A 4F04A 4GW3A 2CNDA 2CVOA 4MV0A 1D4AA 3TTWA 2UXCM 4YRFA 4C7MA 3KYDA 5YASA 3PHBE 3KUXA 3VHXA 1FB5A 4RQAA 5B12A 4Q7MB 1J0XO 4KSYA 1M1NA 1PQYA 3G6WA 4MLDA 3F5FA 2ZAGA 3STVA 4OFWA 3WKCA 4X61A 4DSAA 2XCOA 4L8FA 5HBGA 4CMCA 2WJGA 1WXHA 1S8NA 2QEQA 3VYWA 3V8BA 4HN4B 1X14A 4QAJA 1AA9A 3OX1A 4A5OA 4CUJA 1UK9A 2CKMA 4JB0A 4V3BA 5COBA 3U6DA 1OWOA 4B3RB 2PRYA 2X6QA 2JH8A 4M55A 2W2NA 3JARA 5IAJA 5MF6A 3PDIA 1PQUA 2XRYA 4MV5A 3KLBA 4KXVA 2ILTA 2Y1EA 1J90A 3V00A 2EL9A 1KDPA 2PV7A 3MRXA 4MUAA 3BXPA 3I8XA 4KXWA 3WLTA 5F7JA 4GOJA 3RODA 3V2UA 1FYDA 1CB7A 3UCEA 4R71A 1L4GA 1FP7A 2M9MA 2W2VA 3G0GA 3ZYZA 2IU0A 4N12A 4RQBA 4P9NA 1I32A 5A4MS 3DNFA 3FYSA 3HKBA 3FZQA 2ZSFA 3UEOA 3EGDA 3A2KA 1Z5ZA 1FQOA 3IUPA 3BH7A 1L1TA 4CG1A 3U62A 4FWHA 1QGYA 5TIIA 4QNRA 1DKUA 1KC3A 1VIVA 1JDUA 3KHUA 4RHFA 2YJ5A 3URKA 4JB3A 4LOAA 1J9GA 3GVHA 2PKYX 2IUFA 1C3XA 3RIYA 4JJ8A 1KMMA 1A97A 1NVVR 3LUHA 4NR0A 2QTLA 4ZYXA 3O74A 5H16A 1GPDG 3HM2A 4BP1A 3KB8A 4AURA 2RBKA 5ITXE 3M1AA 3HLKA 3FZNA 2I71A 1QC5A 3OPYB 1I80A 3EVEA 1RYDA 4MR8B 1VYVA 1QRAA 2Q8PA 3Q8LA 5AK4A 4FT4A 4G0NA 2GHQA 3CXRA 5JI2E 1SKQA 4JNCA 1IEWA 2KB0A 3IG5A 1ZLXA 4YO7A 3TPCA 5DOVA 3VNVA 2XE6A 2H3HA 4C1NA 2QMYA 4GEGA 3L7NA 2IPLA 2OMEA 2W2PA 2BFFB 4WURA 5IN4A 3CF4G 2G07A 3KOYE 1MO5A 3QPUA 1RKXA 4RSRA 4BE4A 2OVBA 1EUDB 2I2XB 4JB2A 4MQFB 2CDNA 3VJKA 2CJFA 1CJSA 3ZHZA 4MINA 5E9WA 4TSKA 5D51S 4P3YA 3NHRA 2QLLA 4KAJA 1KJIA 1WDMA 2OG1A 4N39A 4LHSA 1TCBA 3O95A 4IJMA 1B8OA 3IJEB 5C8VA 1HE1C 3PPXA 1E59A 3FNEA 1L1EA 1DDOA 2VDVE 2XAUA 4RVUA 5GP1A 1G4AE 2ZDQA 2WJ6A 3ZE1B 5JFTA 3B5IA 4PLWA 2XQKA 3IQHX 1RTKA 3NEYA 3OOHA 4S1PA 1R9NA 3ZGLA 3L1UA 1V0JA 2B37A 1AQJA 1VJ5A 2IS6A 4U00A 2C54A 4M9CA 5DW3A 2P5TA 1SQ5A 4QFDA 5JAQA 4ZYWA 3N2GA 2WC1A 4G41A 1EK5A 3BTVA 3UPDA 3ZDRA 3GO4A 5HOEA 1A4XA 4IDGA 1S2IA 2ZB7A 4TTTS 2QMQA 4BJ1A 1ZD2P 1I3KA 3O2NA 1ZD9A 4LOHA 4A6EA 1AQLA 4F5ZA 5CA0B 2O3RA 2OV2A 5HCNA 5TJHA 1OASA 1JHXA 2PVCA 4CNQA 2GN9A 2PEYA 2BTQA 2AFHA 5BSWA 2FXIA 1M6HA 1WZIA 2OMKA 1F0PA 4EHDA 4FBMA 9LDBA 1Z13A 4CV2A 2PUBA 3FHCB 2ODEA 5BV0A 5FO0A 4LWOA 4DNOA 2DBYA 3JAWB 3UIEA 1QH1B 4OA8A 2XCLA 3QM1A 2NQ8C 4ARSA 1QFSA 2AN5A 4CMAA 4EAQA 4RJTA 2DWNA 3OSZA 4GOND 3PA8A 1WCV1 5DWQA 1E96A 4QYIB 4HVCA 2YMPA 1O97C 4DNFA 3V42A 1R88A 3VI4B 2BLNA 3MS4A 3J2PB 3I51A 4G65A 1BCSA 1P4JA 1XBTA 4MZDA 3FG9A 2CXOA 2ZCVA 3B5EA 4D3DA 4UMFA 1KK1A 1P33A 3MWLA 2Y1GA 5FFFA 5DHFA 4WK4B 3GRVA 2O2CA 1GTSA 2VF4X 3V4ZA 5LKRA 4GG1A 1M66A 1FFCA 2YTZA 1HXHA 4YY3M 2ZYSA 3FHOA 1KI2A 4W5RA 3TW0A 2QSZA 4YRLA 3IUMA 1JHOA 4O2AB 3FKEA 2M2IA 4DWWA 5EKTA 1VMAA 4PYRA 3GPYA 3CVVA 3AHGA 3IEXA 3EVFA 1SJ9A 3V7WA 2XCQA 4RGYA 5KDOA 1SU4A 4BU0A 3USES 3EDCA 4YQYA 3NANA 4D4KA 4GM1A 2GKGA 1K7XB 4QOZC 2WHEA 2OO7A 4KRGA 4AS2A 4E07A 4GR9A 4UPVA 4XVQA 1LRKA 3A58B 4R5HA 4ZI7A 1AN0A 1N33B 4RA9A 4BDTA 4TS1A 5FXMA 5EJ9A 1H0RA 1SVUA 1XI2A 2QQ0A 3EAFA 4KE8A 1J24A 2Q2VA 3OHSX 3DO5A 3OQIA 2JDID 4Q1BA 2A3RA 1FFWA 2JLRA 4XIGS 2XVZA 2C5RA 4TQ9A 3OE5A 3S4YA 4BO7A 5LMUB 4ZVSA 3GCGA 2JY8A 4EJ0A 4I9HA 1NSTA 3LW7A 3IRUA 2QRGA 5AW2A 3KR1A 4ZQIA 1JA9A 3L49A 4Q1DA 3VOAA 5I7OA 4L50A 4N0PA 3LCRA 2VCEA 4LDNA 2HHAA 2EA0A 2BH9A 4ND4A 4GBED 1SVKA 4WN9A 1L5LA 4E1AA 1H8ED 4RS4A 2QAGB 2ZM6B 3L6EA 3Q6NA 1FOEB 1LVGA 3VR5H 1WULS 4L5JA 2ORED 1SEVA 4N8EA 4K9MA 4X8HA 2BEVA 3GJ6A 1K66A 2PYZA 1IUOA 2KXEA 1ADYA 1MG5A 2IY7A 4DMGA 4CLOA 5F2OA 1QGDA 1GPMA 3SYMA 4OP2A 1R4MA 3CPHA 1RYMA 5C1IA 1NN5A 1QRDA 4QDUA 3K96A 4UEOA 3K09A 1H9CA 2R8ZA 4TQGA 3V6LA 5BN3B 3PICA 4FEYA 4MYHA 1V1RA 2VUTA 1XLVA 1KA9H 2QQGA 3WK5A 3THYA 5SICE 1SA0A 2B1GA 1ZJ5A 4RZIA 3RKSA 1IXSB 2QTWB 5I4CA 1QAOA 3IPRA 4G0XA 2AD5A 2B7CA 1YZNA 4TT8A 5H3HA 1NO1A 1TLFA 3ADPA 2DYKA 3TLYA 2FVXA 1NXWA 1VJ0A 4PNEA 2XMBA 5DU2A 2QDKA 4EYKA 1US8A 2IEGA 2BFWA 5FPTA 1P74A 1O2DA 4JP1A 1C7IA 1T4BA 2HHJA 4CR6A 3NBIA 4KWCA 3HJHA 1YZUA 3KFUG 1SC9A 5CCBA 5AO9A 4U8GA 1GYPA 1ESEA 2VEDA 4IHJB 1PQWA 3P71T 5T64A 2HHCA 1FP4A 4JQCA 4J1NA 1PJ4A 4ANFA 1QZMA 3OY7A 2ZKIA 3D7SA 5L7TA 1WKBA 3HB5X 5CH3A 5NULA 4OB7A 4GE3A 1GPH1 3TE6A 1Z5WA 4RZ3A 1R3UA 4QC2A 1RJGA 4LN1A 3ZXUB 1LI4A 3U81A 4GMFA 3X1KA 3PLAE 3VAZA 1BD4A 3QXXA 2XUHA 1C7QA 3ZGYA 1AF4A 4DT1A 1FBNA 2ZEJA 1E9VA 1MJ5A 2OGWA 1E7MA 3V1YA 5ILGA 3MLAA 3AYZB 2WP0A 4FVTA 4KUEA 2FX2A 3BWDD 4PGAA 4AY3A 5ISMA 2IKSA 3WB1A 1C5KA 1IPEA 4I4TB 2YWGA 4M76B 4MX8A 2GILA 5K9ZA 5JCXA 4HWOA 5H59A 1YRLA 1SCJA 1IJFA 3T12A 1U99A 4PQGA 2QCUA 3HVJA 4NONA 4WXEA 4BMDA 1UXGA 4PZAA 5LZ8A 2OT3B 3HWX1 1AHNA 4MPPA 2VJYA 1U3WA 5KTTA 3HJNA 2IL1A 2BKXA 2A5DA 3AUKA 3UAGA 3MUEA 1RKQA 1CC1S 4TXMA 3Q9LA 2R751 2XUQA 2XMZA 4FSXA 2XMRA 3A1DA 2W71A 1B2LA 2XTJA 1Z3CA 2XVXA 4ETIA 1B0PA 4B83A 1IY9A 4TWIA 5AHXA 1VYTA 3WTCA 1OI2A 1E3WA 3K9QO 5EJIA 3NT4A 3BXEA 2GYYA 2GCNA 2VYQA 3IOYA 1W581 2PRJA 3MJCA 1PT5A 2GCEA 2QW0X 4HNVA 4F5WA 2NYVA 3SQXA 4L4UA 3QBDA 3ZKWA 3N6VA 1GQOA 4TZTA 1YK1A 2P4UA 2AVDA 4YASA 1YJCA 3DZJA 4OHUA 1SKYB 1FDRA 1JJFA 3W3ZB 2DUMA 1E5DA 3CEJA 4JC8A 3AI1A 3HWRA 3LE8A 1PR6A 4KMSA 2IW3A 2HYDA 2NSYA 3ZV3A 2P9HA 1IAVA 2WKSA 2OB1A 3SXUA 4R8VA 2OXEA 2XB2A 1M2VB 3HA5A 3H4IA 1JKIA 4KW7A 1JYSA 3UA3A 2WG0A 3O7WA 4FDAA 3RVMA 2QQ8A 4LRWA 3RRXA 3RFWA 1WF3A 3ITDA 1K0UA 3KSMA 4CFYA 1P72A 3I01A 3TWKA 4N01A 3MCUA 4BUZA 1RI5A 2PFSA 3VXKA 1WY7A 3H8SA 1IEVA 4FZVA 4DJTA 1JDNA 3MRVA 3OD5A 4V0LA 2TYSB 4RVGA 3UH1A 4RTOA 1OIXA 5JISA 3INTA 3OEEA 4JOSA 2ZYGA 2ZRMA 4Y6QA 1PR9A 3LOQA 4LF8B 2M5ZA 3QIVA 5IK2D 3KOZE 5JAIA 4IX1A 3OMXA 1PSDA 5F12A 4XDYA 3UC9A 3TZKA 1SY7A 1GY8A 2YJTD 3VU3A 1P29A 2WWGA 3DHYA 1DBRA 2Q6TA 1QHGA 5AW1A 4WQMA 4EP1A 3SNKA 3A05A 4EW1A 4FK8A 4LDAA 1OLSB 2KMLA 4LJKA 3VSEA 1M7BA 4M60A 3VKUA 3T4EA 1D0LA 2OHIA 4IH1A 2Y68A 4DLLA 3DE3X 5BQOA 4IM7A 4YP0A 1V39A 2FLKA 2P1DA 3KKZA 5CG1A 2PANA 3FUCA 4CF4A 2OUKA 4K3UA 4CLXA 3RTCA 4G81A 1MGOA 3LUAA 3C3JA 1P19A 1J1UA 1JP7A 1YBVA 4FHGA 2ZJ7A 1N5RA 2W0MA 1OXTA 4C7KA 1DC8A 2D5CA 4RK0A 4I55B 1W0JD 1AXRA 4EECA 4ZT2A 1NKVA 1LBIA 3DOCA 1C1DB 3IKJA 4NRWA 1V3TA 4MUGA 5CP8A 1LSSA 1PJLA 1F8UA 4F4FA 1O97D 5CA0F 3DCIA 5GGYA 5A5GA 3ESZA 1JQJC 3G68A 1BDBA 2H1CA 5F3WA 3PHGA 4EA7A 1ZAEA 4KKVA 4ZEWA 2HZ7A 3OZTA 4ZVPA 4J8PA 3LO5A 4KQJA 2BKEA 3D0QA 3HYSA 4KCGA 1FFEA 2XECA 5HNKA 2HSGA 4AL4A 1WTCA 3IUBA 2AT1A 3RU7A 3RUFA 2PGLA 4R16A 4DMKA 4QULA 1GJRA 4G1UC 4MKHA 3ZHTA 2I7XA 5C18A 1KHHA 4TV8B 1J1IA 2WICA 2PUDA 3H1BA 4Y2UA 4ZYZA 2VL7A 4NE9A 5HKLA 4BNMA 2PHZA 1ZOIA 4QHYA 4Z3DA 2UYCA 4JMPA 3UJHA 3RBAA 5K0GA 1QK3A 1T43A 2DLNA 3LXRA 2RD2A 2WHXA 3IO3A 4UATA 2G8LA 1GL9B 1WHSB 3B74A 4OQEA 3ELYA 4WKPA 5EMLA 3O5AA 1N2XA 4DNXA 1HWYA 1TCAA 3EZFA 3KXPA 3GLGE 3KYJB 3WLQA 1FFDA 4PF1A 4HDCA 1SN7A 2EGUA 3IPLA 3B7NA 1A5TA 1M6WA 1XJQA 1K06A 4FFDA 3L1VA 3DF9A 2WWHA 3ZEIA 4MW0A 3W2FA 3IKLA 5L51A 5FIUA 1NQAO 3TQIA 4O2AF 4KK4A 4Q7JA 1EVKA 1QPZA 1L7OA 4UCXA 5GWXA 3S7ZA 2FUEA 1QMPA 4LYEA 4CM4A 1J8DA 1N5MA 4DR4M