3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
1U2ZA 4QQKA 4FS8A 2V7EA 4AZVA 1AQIA 3PB3A 2C7QA 2G1PA 2PX4A 3FUXA 3DMHA 4YUXA 5DX0A 4PYKA 2ZZKA 4YUVA 2G70A 2YXDA 5E8JA 4EQZA 2FPOA 2IPXA 3C3YA 3DH0A 3TOSA 3S68A 2IH4A 5EEGA 3B3JA 1P39A 2XBMA 5K0EA 1SUIA 2Z6QA 1RJDA 2AOUB 3FUTA 3HVHA 3LDUA 1RI4A 1SQFA 2JHPA 1INLA 2AOUA 3DXXA 5D1NA 3BWBA 5DT2A 4XUCA 1EJ0A 3DMFA 5DM0A 5FA8A 2JHCA 2Y1WA 3REOA 3PVCA 2NP6A 5CVUA 1D2GA 2G8NA 5HILA 2ZBQA 1M6EX 2WA2A 3BGVA 1I4WA 4LWPA 2AVNA 3OZRA 3KR1A 5LQUA 3T7SA 3PX3A 2QRVB 3O31A 1I1NA 1HMYA 4H0NA 4RVHA 1JSXA 3LHDA 3OZTA 1QAMA 4QTUB 2QRVA 2ZCJA 2E5WA 1G8AA 3BWMA 5FWDA 4R6XA 1KYZA 2IBSA 3ANXA 4EKIA 3HCCA 3EEYA 4C08A 1ZGJA 3DMGA 5U4XA 3T7TA 2UYCA 2P1DA 3FPFA 4QVGA 3SSNA 4BP1A 2ZVJA 4DZRA 4FSXA 3G5TA 4P7JA 4DM3A 1NT2A 3GDHA 4U7TB 1FP2A 3LCCA 1Y8CA 2IDJA 5DLYA 2I62A 4A6EA 1B42A 2HNKA 2P41A 5LQCA 2ZIGA 1DUSA 2B2CA 4X1OA 2GAFA 1JR4A 5M5BA 3R9XB 2PT6A 2YUIA 5BP7A 2NP7A 1O54A 2ORED 3ELYA 3KU1A 2C7OA 2F8LA 7MHTA 2HTEA 1R18A 1X1DA 2AN5A 3LECA 3M6VA 5FQOA 3HEMA 3HCFA 3UA3A 2QY6A 2WK1A 4PCLA 5EOVA 3AJDA 3EVBA 5GOZA 3MHTA 2ZZMA 2GH1A 3G5LA 4M38A 1N7JA 2IP2A 3HCDA 4L7VA 1SUSA 5K01A 4OA5A 2P3LA 3KPWA 4RV9A 2OPBA 1VP9A 3M4XA 4V0QA 3UJBA 3P8ZA 2AOVA 5E1BA 4E2XA 8MHTA 1KYWA 3OE5A 1RI5A 3EPPA 4GC5A 4CWAA 4F84A 2ADMA 2JHAA 3O7WA 3KR2A 4RVGA 5H02A 3OFJA 3A27A 4KW7A 4X61A 2B3TA 3OPNA 4PGGA 1R8YA 3R3HA 2EG5A 5DX1A 3QOXA 4LECA 5EC8A 4RTKA 1IXKA 2JG3A 1ZG3A 1XCJA 2VP3A 3FPEA 3CJQA 4UOEA 3KKZA 3NDIA 5K8VA 5CCBA 10MHA 3TR6A 2FHPA 2OB1A 2ZIFA 3A7DA 4U7PB 3SX0A 3UJCA 4DCMA 3M33A 4RVDA 4E2WA 3NMUF 3KR0A 4R6WA 2C7RA 2AOTB 1L3BA 2VDVE 3RIEA 3EVCA 1WG8A 5EZQA 1QZZA 5ICEA 1V39A 3THSA 3G89A 5CD1A 1FBNA 2HV9A 4GQBA 3SVZA 4YV0A 3R0QA 3VC1A 1G8SA 4PYIA 4ER7A 3FRIA 4FR0A 4RWZA 5E9WA 4Z2YA 4AZTA 5DPMA 1ORIA 1ZGAA 5GIPE 4DMGA 3LSTA 1L3IA 3SSOA 3LCUA 1UWVA 5EMLA 3UJ6A 1NE2A 3C6KA 5CIYA 2OBFA 3UWPA 2FRXA 4EVIA 1XDSA 1ZHFA 2ONZA 2XYVA 2ZBPA 2YXEA 1VPTA 4RTMA 1RJFA 2PWPA 3P2IA 4C05A 4C4AA 3FTEA 4QVKA 5IKMA 4E30A 5KYGA 2QYOA 3V97A 2HWKA 3PFGA 4RYLA 1MHTA 5K03A 2ZW9A 3DTNA 4GOOD 1G55A 5DTMA 3FPHA 3G88A 2BR3A 2P3OA 3KQQA 3P2KA 4FP9A 3HTXA 1VP3A 2CWWA 2O06A 1KHHA 3MCZA 3MTEA 5DRTA 3GRZA 4QDKA 1EG2A 3EMBA 3G2PA 5FHRA 3HCAA 2NNWB 3B89A 4GF5A 5DM1A 3MCTA 2QE6A 4ER0A 1O9GA 3EVZA 1L1EA 2NXNA 5E8RA 2XYRA 4KDCA 4MTLA 4P7KA 4RTPA 2CKDA 4XUEA 2PXCA 3GO4A 4R8RA 5EMKA 3F4KA 5HIKA 3GRVA 4MIKA 3BKWA 2K4MA 1EQAA 4P58A 2P40A 3DR5A 4HTFA 3NVMB 1YF3A 2ZIEA 4MQ4A 4QDJA 3DLIA 4PYLA 1G6Q1 3CJTA 3E7PA 4POOA 3NDJA 2VDWA 4NECA 2YXLA 5BW5A 3G8AA 3LL7A 1NBHA 3E05A 4C03A 5E1DA 4K6MA 3CKKA 5HEKA 2BR5A 3OFKA 2NYUA 2UYQA 5E2BA 1X1CA 4RTRA 3A26A 1MJFA 3PFHA 4X41A 3LX6A 4X60A 3TFWA 5LQJA 3H2BA 2YTZA 2ONYA 3CC8A 1WS6A 4E32A 4E2ZA 3GNLA 4EKGA 4PYJA 5LSAA 1P1CA 2H00A 3I5UA 3GIWA 2AZTA 3HA7A 3DULA 5EQJB 1M0EA 2G72A 2ZWVA 3HVJA 5G02A 1G38A 3HVKA 1AF7A 1RI2A 3IHTA 3PX2A 5KQSA 3IYLW 4RSRA 2YQZA 1KR5A 1XDUA 4OQDA 5DXAA 1P1BA 5C0OE 2PX5A 5ICGA 4M7RA 3JWIA 2B25A 1YFLA 5EKXA 2OY0A 1RJEA 4PGHA 2IFTA 2XYQA 2LD4A 3G2OA 5K09A 1KPIA 4ER6A 5LR6A 3JWJA 3L8DA 3CGGA 3EVAA 1NW5A 3KQWA 2OKCA 5CVJA 1R00A 4PNEA 3KPVA 2CMHA 3M6WA 4QTTB 5HZMA 1M6YA 5DRYA 5HFJA 4FZVA 5FTWA 3UJDA 2ZZNA 1L3CA 1O9HA 2ZLBA 3C3PA 3MB5A 3SM3A 4IV0A 4OBWA 4DKJA 3MERA 3TKYA 2GLUA 2BH2A 4AX8A 1N7IA 4PONA 5KVAA 3P9NA 3AY0A 5IH3A 2P7HA 3I9FA 3GRYA 3BGDA 2FYTA 3QOWA 1VQ1A 4WXHA 1IM8A 5GM1A 5CM2Z 1D2CA 5ICCA 3BUSA 2ZWAA 2JH8A 3ELDA 5FCDA 4MHTA 5K0BA 5K0GA 1ORHA 4CKBA 5HOQA 3JWGA 2CMGA 1SG9A 3V8VA 5LQNA 1KP9A 1NW7A 2I6GA 4R05A 1AV6A 4QPPA 3AXTA 3OZSA 3FPGA 3KQSA 4PIMA 1KPGA 1R8XA 3OE4A 3B7PA 4HG2A 4OA8A 1IY9A 4FSDA 4BLUA 2IGTA 4R8SA 2Z6UA 3FTCA 3SSMA 4HRAA 5KS2A 1VBFA 3K6RA 3I53A 4M36A 4E33A 5HIMA 3OU2A 4CXMA 3MGGA 3D2LA 3KR9A 1NW8A 5T64A 3TM4A 4RVFA 2DPMA 2PBFA 5EIWA 2BZGA 3HA3A 1XJ5A 5JR3A 2H11A 4CKCA 3HNRA 3BZBA 2JH9A 5EHGA 4BLWA 1JTFA 3ERCA 3THRA 1R74A 3GU3A 2OZVA 3B3GA 2AS0A 1XCLA 3C0KA 3R24A 3SXJA 3FUVA 4F86A 2PWYA 4C04A 3NVKI 3ER8A 3LDFA 5EIFA 3NWEA 1WZNA 2ERCA 3HA5A 5F2OA 4QQNA 4BY9E 5D1HA 1OR8A 2GPYA 3EGEA 2OXTA 4AZSA 2AN4A 1VE3A 1UFKA 3E23A 3GJYA 1DL5A 2JJQA 3O4FA 2P3QA 2BM8A 2GS9A 3PS9A 4LG1A 5JUWA 3KQPA 3DLCA 4DCGA 4PYMA 3M6UA 5EPEA 4V0RA 4RTSA 1QANA 2HMYB 2YVLA 3OU6A 3VSEA 4RTOA 1NW3A 1ZQ9A 4EMSA 4YMGA 3ER9A 2ZFUA 5FUBA 3M70A 3G7UA 4PCAA 1TW3A 1NV8A 3P71T 4RTQA 3LBFA 5EMMA 4M37A 2FK8A 4YUYA 4KWCA 2GA9A 3FTFA 5EG5A 2AOWA 3SR4A 4DQ0A 4KDRA 3KQYA 1NKVA 4XCXA 2OO3A 3P2EA 3P97A 3VYWA 4HTFB 5DTQA 4GOND 5LQKA 2O0LA 1BHJA 2AN3A 3G2QA 3KQMA 4RTLA 3T0IA 3EGVA 3FZGA 4G56A 1PJZA 3TQSA 3E8SA 4HSGA 3FYCA 2VDUE 2UZ4A 5CVVA 3UJ9A 2H1RA 4EK9A 3TLJA 2IIPA 4OBXA 3BGIA 4QPNA 3Q87B 2UYOA 1FP1D 5FWAA 4E31A 1BKYA 1X19A 3LCVB 2EJTA 5E9QA 5F2KA 4YUWA 4RTNA 3DOUA 2EX4A 1BOOA 3KQTA 4HC4A 1YB2A 2AVDA 3Q7EA 4KIFA 4KRGA 5DM4A 4E70A 2P35A 2NXEA 1WXXA 3CJRA 4Y2HA 1SKMA 1FJXA 2PVCA 2IBTA 2Q41A 1JG2A 1P91A 2YR0A 1QAQA 2EFJA 4HH4A 3ORHA 4HGZA 3TRKA 4P7FA 4GUAA 5C9ZA 5CUQA 4C06A 2PY6A 3P9IA 3HM2A 3GRRA 3IV6A 2AOXA 4MWZA 5KQRA 1NV9A 2PKWA 1JTEA 1TPYA 3KPUA 5BW4A 5LQAA 5E2AA 1QYRA 4CTKA 3UJ7A 5GIOE 5CCXA 4PYNA 4ER5A 1XTPA 2FK7A 4C07A 5DM2A 1G60A 5E1OA 1JQEA 3BKXA 1VLMA 3MTIA 1VIDA 4PINA 5FULA 3PT9A 5GWXA 4CKEA 3ME5A 1Z3CA 2V74B 3MAGA 2UYHA 3PTAA 2B9EA 4OX9Y 3B3FA 4FT4A 1YZ3A 2I7CA 2WA1A 3HCEA 4FT2A 4GOLD 5FA5A 3LGAA 3KQOA 1R6AA 4B17A 4OQEA 3CVOA 3T7RA 1JQ3A 3HCBA 5B1SA 3UJ8A 2VZ9A 3ELUA 1BC5A 3HP7A 4YV2A 3BXOA 3QV2A 3A25A 3RODA 2XVMA 4XUDA 2PJDA 4JXJA 3OU7A 3GRUA 5EEHA 4BLVA 3R6TA 2PXAA 4GOMD 5E9JA 4F85A 2B78A 1FPQA 5MHTA 4DF3A 3WSTA 3VC2A 2Z6AA 9MHTA 3G8BA 2PGXA 2VS1A 4O29A 3TKAA 2A14A 5K0JA 2NXCA 3BWCA 5EHIA 2FCAA 3U81A 5DSTA 2R3SA 3RW9A 3TM5A 1WXWA 2PV0A 5LQRA 3EEOA 1X1BA 2PSSA 3NJRA 2YX1A 3NW9A 5K0LA 1QAOA 4BP3A 3DXZA 3G2MA 3GCZA 1EAMA 1XVAA 3EVEA 2PXXA 1ZKDA 2P7IA 3EMDA 4RTJA 2IDKA 3FUWA 5ICFA 4ER3A 4WVLA 1I9GA 4KVZA 2IH5A 4CTJA 1X1AA 5FHQA 2OYRA 4RX1A 3K0BA 5K05A 4E2YA 3I58A 3FUUA 1D2HA 5EGSA 4Y30A 4A6DA 3BWYA 5F2NA 1SVUA 3ID6C 3BT7A 4GC9A 1TW2A 3NTVA 3CBGA 1HNNA 2XVAA 5DTRA 4FGZA 3SMQA 2OB2A 2AR0A 4HGYA 5DWQA 3LDGA 4LWOA 1NW6A 5E1MA 4P7GA 1JG4A 5EVJA 3JWHA 1YFJA 1SQGA 5K0NA 3PLAE 2QM3A 4PYOA 5GP1A 2ZULA 2HR1A 3UBTA 3DXYA 4GBED 1RI1A 1WY7A 2DULA 1F3LA 1PRYA 2PLWA 3M6XA 3EGIA 2NXJA 3LKZA 3EVDA 3P9KA 2O07A 2EJUA 2ZBRA 3UFBA 1DCTA 2I9KA 4YMHA 2IH2A 3AWIA 5K0CA 3KPJA 3FTDA 4KIGA 5ERGB 5K0FA 1EJ6A 1H1DA 2ESRA 3A4TA 3LBYA 3LPMA 1JG1A 5DSXA 5DX8A 5EMJA 5C1IA 3A7EA 2BM9A 2ZTHA 1F38A 1Q0SA 2AOTA 3DUWA 2R6ZA 4GEKA 3AXSA 3FRHA 4IV8A 1KPHA 1UIRA 2O05A 3UA4A 4IWNA 2C7PA 5GINE 1RI3A 2BR4A 3HVIA 5FQNA 3GWZA 3X0DA 2ZSUA 4DA4A 3B5IA 3UJAA 3TPZA 5FADA 5HIIA 5EZSA 1N2XA 4AUKA 4IKPA 2GB4A 3DP7A 4ZTBA 2PX8A 3EVFA 4X63A 1T43A 5DXJA 3KQVA 3OCJA 4ISCA 4PWYA 3SGLA 1XDZA 3CCFA 4ATNA 3ELWA 1RJGA 5HIJA 2KW5A 2PX2A 3MQ2A 4PYQA 3P9CA 5EKUA 4AZWA 3IEIA 3C6MA 5P8WA 1EIZA 4YUZA 1YUBA 1NBIA 3FPJA 2G71A 5CVEA 2Y1XA 3GXOA 5T67A 1Q0TA 3FYDA 2PT9A 5GM2A 1JSZA 2N47A 5T6BA 5CVDA 5BXYA 3KPYA 3GGDA 3TMAA 1AQJA 3EVGA 1JQDA 3UZUA 4YV1A 1YZHA 2CL5A 1L9KA 3I64A 4PIPA 1KIAA 1XXLA 3LKDA 1KXZA 2O57A 1VL5A 3KHKA 3NWBA 2P8JA 1JG3A
chains in the Genus database with same CATH superfamily
3SCZA 1ODFA 2ZJZA 2EDAA 3DMHA 2EO2A 2Q4BA 3D0QA 1JSRA 2PQ6A 3FYUB 1RRVA 4FZ5A 3ETLA 1PRBA 4XOUA 4WTOA 3CEPB 4HNAB 2XNDA 1YKGA 2QX4A 1CSEE 1FU4A 4I5FA 1JHRA 2CDCA 4KNYA 2ASVA 4DNPA 1JU9A 2YYYA 4IH4A 2IVZA 1BVRA 2J7NA 5MF6A 1V8OA 1GM5A 1FJ2A 3BHJA 1MCZA 5E7MA 3U49A 2DTDA 3U3XA 3ZDAA 1MMFB 2IOFK 1NFFA 4BJ3A 3RGWS 3COZA 4DBVO 1E60A 4OGWA 2W0MA 4UM9B 2VYVA 1P1KA 4GGOA 2QY6A 1FNCA 4PHTA 4YDHB 4DDMA 3WRYC 4KR9A 1B14A 5K8VA 3VPDA 1W47A 3RVMA 1SJ9A 1FMJA 5JPCA 4F38A 2K87A 4CLHA 3BZWA 3G89A 4MCAA 1FBNA 4G9EA 3P45A 4NRWA 2HM7A 4GMKA 4XWKA 2X1LA 1F14A 3WB0A 1W0CA 3U19A 3HQ4O 2R00A 3A2MA 3QFFA 3ZLUA 4R71A 4N48A 1HDZA 4X1IB 3TG2A 3WFJA 1HRKA 3PUJA 1VI5A 2CWWA 5KQMA 3I2HA 1I1QB 1FYEA 4UN2B 5IAGA 2Q1WA 5LA6A 1EWRA 4MLDA 4L8RC 1SCNE 3H5WA 2WAAA 4U5XA 3LGSA 3CKKA 4N12A 5CLIA 3Q8GA 4NBSA 3G5MA 1Q44A 2NZWA 1RI2A 3P52A 2DQKA 1IZYA 1P19A 1Y6ZA 4ZHQF 5AVSA 1T8WA 4Z3KA 1EFKA 3KVWA 4YAKA 1H42A 3ORQA 2EL9A 1A9PA 5ABPA 2H0RA 1R6VA 4OQQA 2ZRQA 3GO8A 1JIUA 1EWVA 3ELDA 1JGTA 4LK2A 3JQ7B 3G13A 1LLFA 3MJHA 1K3FA 1WX1A 3R5KA 3BGOS 4PLCA 5JQGA 3V8EA 5J9FA 4D8XA 4DUGA 5CNKA 4HQRA 4DM4A 4ZAGA 3JARA 3MJDA 2QVGA 4TRRA 4D0GA 3WMEA 5HQTA 1FSZA 3ESRA 5JSKA 5K3BA 3ER8A 1T9DA 3HJCA 2RGBA 3ZCQA 1Y7IA 1CUEA 1JE1A 1CUCA 3U6QA 3IVGA 1PV2A 1AHIA 4MV9A 2WI8A 2ZXEA 1Z15A 3ETJA 2WT8A 2W6JA 3RSLA 5A6VA 1PS0A 2R7MA 1WDWB 2HSWA 3RHFA 2G67A 4P98A 2J85A 5JNLA 4MIYA 2IDMA 1M66A 2E5FA 4AJ2A 3Q10A 3VJMA 2WWVD 2W2LD 3K0HA 2V54A 4L6IA 5JISA 2B1IA 4YALA 1XKTA 4ZAZA 3EWSA 2JCSA 1RRPA 4BE9A 1TVEA 2HZ7A 1NVTA 2B9EA 4OB6A 4OX9Y 4BJ5A 2GPNA 1YB1A 3PC8C 2Q8NA 3I3SR 3E15A 3CHYA 3E0XA 2DPGA 1D6MA 4D6XA 3Q3JB 4M1TA 3GN1A 3HRKA 4PN7A 4BFUA 1Z16A 1MO3A 2BRUC 1SOAA 5DSTA 5LQRA 2JFNA 3RK0A 1Y5LA 3PDIB 3WYBA 2EJSA 3FPCA 3R9IA 4GUDA 4OMCA 2HNBA 3CEAA 3EC2A 5K8IA 3UW1A 3HKEA 4ZP1A 4P7GA 4ZVLA 1JH9A 1J22A 3TLCA 1THTA 4LFAM 1W0JD 3ICPA 4I4NA 2GGSA 2W2KA 5A3SA 1GGKA 3O47A 4UPEA 1EPUA 4YMUA 2XRYA 1Z5NA 3ANYB 4DA4A 4ZI5A 5TMBA 4G1FA 5DXJA 2VNKA 4QX6A 3SZLA 1N6NA 5BNIA 1T29A 4R2MA 5CVEA 1GQSA 2ICAA 5BXYA 4ITVA 3OWOA 1TUIA 1TEHA 1S2NA 1EE2A 1D6NA 1EVEA 4REZA 5M29A 1WXGA 4OY3A 3INNA 3KEOA 1ZD3A 1TJ3A 3AG6A 1SQFA 3GA7A 2FWPA 3ICVA 1OB5A 4LKOA 2CVQA 3ZYZA 5MN6A 2POCA 4EG8A 3O82A 4GH9A 4JSYA 1CY4A 4ZIRA 3DJYA 2CB9A 4FWIB 4L8YA 2AX3A 4FB5A 4TV8B 3U7EB 4N7BA 1XMSA 4LK3A 3PEEA 1LPNA 4BKOA 3CRW1 4X1OA 2OAGA 1YCGA 2WZBA 2AC2A 3ELYA 1E4EB 3Q7SA 1UJ2A 3UOAB 5T4HA 2JHAA 2DENA 4WACA 2BTEA 1MC8A 3DZ8A 4WFJA 1EVLA 1IXKA 3CLVA 4XVUA 3PXBA 2XRFA 1JRLA 4EKIA 3B9PA 2PR2A 1UBMS 2ZQYA 4YUAA 1EX1A 3R0QA 2CYAA 3ZQ6A 1A9OA 3RJZA 2BE9A 1L3IA 2R46A 4J90A 2BMVA 3LVRE 4M8KA 1FUEA 2ZDQA 1S3SA 3WKDA 4CETA 4BECA 2YVUA 3QOFA 4X8HA 4CPDA 3ILYA 3DG9A 3MCZA 4IL5A 4TQ9A 3WGUA 4EW2A 3O90A 3IQXA 4XUEA 3G6WA 4PHHA 3HXOA 3OZGA 3H9CA 2PTGA 4GLLA 1U3VA 1YHYA 1KDPA 2CHVA 5I7UA 2HADA 4P36A 1GQ2A 2OYCA 1ZIOA 1R0KA 1NC3A 3BMNB 3WMRA 2FXVA 1OUMA 3AHIA 3KVYA 2XQVA 4EJSA 1HH4A 1YVUA 4UW9A 1NW5A 3IEXA 5ALRA 1R00A 2DSTA 2FSVA 4LHWA 3LDAA 3T0FA 5BMVA 1Y34E 1O9HA 5C46F 5LBUA 1YS4A 2COKA 3KQNA 1PX2A 4MUHA 1N2CE 5TE9A 4EHFA 3GA5A 5JNUA 5HR5A 3V4RA 3CV3A 2O2XA 5KQ8A 3TFOA 1O96A 4AJNA 1TVCA 1DRKA 1TKRA 1Q5PA 1RJ9B 4ZICA 2DPMA 1ZOOA 4ZYWA 3DWEX 2GO7A 1J9GA 4RYDA 4LNUB 4CN9A 4HWTA 1QQBA 4H9GA 5IFKA 4CV1A 3RGSA 5IXSA 3N0RA 1A9QA 1Z4JA 1OAOC 3KKEA 2P9BA 2EVWX 4WZ6A 1R9MA 4HH0A 4JASB 5JZSA 2TMGA 3PD1A 1SKBA 1VE9A 5EWMA 3QVTA 2GCOA 2F48A 4JZYA 3CLUD 1EE9A 3UMMA 4U2DA 2Q5CA 2HWYA 1UMCA 4C20A 5IVDA 5D3ZA 1E2BA 1OTXA 2GEBA 4E70A 3SQOA 2QL7A 3M49A 2O8DB 5G40A 3RC2A 4PPFA 4XLLA 5DT9A 1GTSA 2NVUB 5JT1A 3ETEA 3A1UA 1YE3A 2IE0A 4EA9A 3PQ3A 3DDNA 4E15A 1CQIB 1SRRA 1Q16A 4TT8A 4XW2A 1NASA 2FRDA 3RSGA 3WSTA 2P4UA 2ASEA 3USES 2GFQA 4O4LA 3OLQA 2IYQA 1R0CA 4JI1M 3ENVA 3NVDA 4QJIA 3TLXA 1YL7A 1OXUA 2QQEA 2BCEA 2B4QA 4DIBA 3CBGA 1V2GA 4HAXA 1GG5A 2QD2A 4MQMA 3D02A 3ROFA 1A8PA 4D1YA 5I8WA 2V7UA 4YV7A 1L6IA 1WXEA 1AKMA 4M1WA 3D6AA 2PL9A 1J8YF 3GVPA 3CRZA 4OIMA 2IY8A 3IXLA 4IZ6A 1F8UA 2ZSUA 1OU0A 1ZN2A 3UHPA 3FVRA 1GPDG 1V5EA 4Q0MA 3WWCA 2APJA 3C3JA 3FYDA 2NVOA 4ZD6A 3TUIC 4CKYA 4X7RA 4ECAA 2IHZA 4KE7A 3C70A 1Z07A 4B73A 1GNQA 2ZUDA 4DZZA 3AKEA 1EEXB 1U8ZA 1QJ4A 2A84A 3JD3A 3QELB 5EAIA 3FSRA 3SZGA 4MULA 5KU1A 2JHPA 5IFLA 5DT2A 2L42A 1N32B 2XKJE 2L17A 2ORYA 2HRBA 2D0PB 2COEA 3O83A 3OD5A 4PZYA 2QN7A 3I0ZA 1PR6A 4JH0A 1W94A 3EEYA 2OO5A 4WLNA 1M34E 5HZHA 2GK3A 3D5QA 4NATA 3J7BA 4H7KA 1L7EA 4U1RA 1Z2EA 3NM5A 4R81A 4MUKA 4OF4A 3LECA 5C3MA 1NRWA 1JHZA 2PLNA 4S0XA 1FRQA 2I7VA 3P27A 3AZOA 4BZWA 2HQBA 3V1KA 2XCLA 1C0IA 2Y1LA 3KR2A 1NAIA 1ZH6A 5IKOA 2PEYA 4GICA 4B31A 3IMCA 2O3JA 1PJ3A 3FPEA 2H7VA 4JS0A 3KKZA 3TR6A 4MAMA 4G8BA 2M6SA 5KQDA 4OREX 4BU1A 2OV2A 4JYPA 4YA6A 4DDHA 5F7XA 4G4OA 1ESEA 1UKAA 1XHFA 3PI6A 4X1YA 3FTEA 4UTPA 3T15A 3JAWA 1T9BA 2HMVA 4WBNF 2LTAA 5AKJA 1HJPA 4RVNA 1FVFA 1CJTC 5BV2P 2I4NA 3DC2A 2P5UA 3UQZA 3F46A 1LFDB 3F49S 5I7EA 1XYVA 5K8LA 3PL5A 5HMMA 4QBHA 5DASA 3GHYA 2WWWA 1FJHA 1HNWM 5C0OE 3ZKWA 1A3CA 4BNDA 2I6FA 3UWKA 3L8CA 5U1PA 1XK7A 5KTSA 1WO8A 1EFPA 4J03A 1KFJB 2PH3A 3HSYA 4TYYA 5SICE 4QREA 1KFCB 2G83A 4LPSA 3LP6A 2G1AA 1GYPA 5IU6A 2XRMA 3B7PA 4G0UA 2Z6UA 1NXVA 3NUZA 3STVA 4JBXA 3EDRA 5I01A 1DJLA 3TLAA 2AWNA 3AEQB 4X20B 1MEEA 3ZZUA 3IAXA 5C31A 4C04A 1OREA 4NX2A 4OD0A 3HA5A 5CDFA 3LC0A 2C95A 3TIVA 4AZSA 5DBIA 4NDAA 1IBKB 3R23A 2QGFA 2Y77A 1QYXA 5J4LA 2XTJA 1WUIS 1JEQA 2LNDA 2I9PA 5EJIA 4HK4A 1RE0A 5F3DA 1X94A 1NQWA 1X8XA 3FCCA 3KTDA 2WAOA 4MJXA 2V6MA 1TIPA 4QASA 2DECA 4HZUA 1I14A 1JYEA 4K9SA 1TIKA 2JFZA 4M8IA 3DJFA 3JWEA 5AI9A 1U99A 2VWPA 3U61B 1L5YA 5KYUA 1LCIA 3OUUA 3KAJA 4EARA 2ORWA 1CE8A 2M60A 5IM4A 3THYA 1TH2A 3LY5A 1SG0A 3ZQUA 1GZVA 4IBIA 4UCXA 2R6AA 4Z6KA 4TKLA 4ZV4A 3NT2A 1B8PA 3EMDA 5EJMA 3KFLA 4B6PA 4CTJA 4XUGB 4WOCA 1ZD5A 5EXPA 4TVSA 5J3JA 1TUBB 1OH8A 1YDHA 4M88A 1EDEA 3TAUA 3WICA 2I2XB 1Z5GA 3VKGA 3A2NA 3AXSA 2QI9F 4CF3A 5E4YA 5JE8A 3AJRA 3IHPA 2J9GA 1YR9A 2KYRA 3IEUA 3D6JA 4MVJA 3AVYA 2IZ7A 1E2PA 3KJZA 3W2FA 1PR9A 3CNHA 5LMNM 1XKQA 1U5BA 1KIAA 4E1VA 1XZGA 3NWBA 4FHFA 2KX7A 5DWDA 3B74A 4O5OA 1HKUA 2WC1A 2R4JA 1C4XA 4PAGA 2FX5A 3DH0A 3L26A 2D3WA 2C97A 3T35A 2P6MA 1NLUA 4L7QA 1FVXA 3HJGA 2PQMA 3DE3X 2QXYA 2UVPB 3WSWA 1XF1A 4DZTA 4HV4A 4OHWA 2HT1A 2IYYA 4JHXA 2F5PA 2RGNA 4ENWA 5LXTF 4RKYA 5LQCA 1YA6A 3TE6A 3P9PA 4BN4A 7REQB 2H07A 3KYIB 4L0MA 3KSBC 1YRLA 2ZZMA 3WLIA 4B3TM 3BD8A 4F84A 3HO8A 1PHPA 1MIOA 4IMPA 3IALA 4I5DA 3Q8LA 1JHUA 3UWSA 2P91A 3ESAA 4N5IX 1KWGA 1L1QA 1WR8A 3FI9A 1TAQA 4R16A 3VZRA 4BUCA 4Y2YA 4X45A 4OSPA 3GCGA 5IJWA 2ISQA 2XYVA 3NIWA 2PZGA 5B37A 3GYBA 5DTMA 1YZQA 4E94A 3AJAA 3V8NA 3IUPA 1RYMA 1KHHA 2CXRA 4ZYLA 2IZOA 1RPJA 2WJIA 3NLLA 4KAJA 5LU9A 3ZXIA 1N1GA 1OIZA 1RHUA 3L5OA 1VLLA 5LZ5A 2WFAA 3FFTA 1CG6A 2R1VB 2OG2A 4ZARA 1TRHA 2C84A 3KE9A 1J90A 3IA7A 1VB5A 2Q1YA 4RSRA 4NCAA 2Q4RA 2I87A 3RT7A 4M7RA 4EJ0A 3M5CA 5D5HA 5BUZA 4RSHA 5KYYA 4CDRA 3GQVA 3TECE 5AVZA 2CLCX 3D6HA 3T8YA 5LDDC 4QOZC 2BBTA 3HUFA 2PKCA 3ISJA 3NIDB 2HD4A 5H80A 1ZGZA 4IBDA 4NMWA 3JQ6A 1X37A 2O01F 3UUEA 1JQKA 2X5OA 4J3NA 2A9FA 4G0WA 2DHCA 3GZNB 4DLTA 3AZQA 4V0ME 5C32A 4L16A 3GJ0A 4GX1A 1FQWA 3LUPA 4YS6A 1U7UA 2R7NA 4HAVA 5HQJA 4R68A 1Z7YA 2EL7A 4BY9E 5BQOA 4GZLA 1K27A 1ULTA 4YRGA 3I5AA 1Z06A 1SKYE 4BLSA 4LOIA 1UZNA 5FPKA 3UC9A 2TECE 1THGA 4CMEA 3D4LA 3NHMA 3HKDB 3ZIAA 4F8EA 5KJFA 4DIFA 1M1NB 5KSWB 3KS8A 5DHTA 1LRJA 5GONB 3BVPA 1YRQA 4OU4A 1WU8A 3WFZA 5IM5A 4WW0A 3TLJA 2HRCA 4OSEA 1DPFA 2PSDA 3NV9A 4Y2XA 1C7FA 3U4DA 1KAHA 3R0VA 3NX4A 4RY9A 3K6SA 1MLDA 1G20E 1EGAA 4LOLA 2GA8A 3A28A 5LZ4A 1EIJA 3RSZA 3JAMS 3D54D 1QMPA 2BL4A 3C7AA 4NOMA 1CK4A 3DO8A 3GP8A 4XVQA 4HBZA 3W3AH 5ALVA 5A2GA 1DDGA 1TJ5A 3M1AA 5F2NA 3K71B 4F2LA 2X5JO 4F9GA 4Z53A 4PG5A 3JU3A 1V4VA 3U2QA 4XYBA 4ZKDA 4TX1A 1WY7A 1DQZA 1E4VA 4QUDA 4Y0AA 3SE0A 1VYUA 4HD8A 2KE5A 4X62M 2B99A 3LPMA 1UJ5A 1QJCA 4NZNA 3FBWA 4J43A 1VSTA 1OLUB 4TN1A 1XROA 4NCXA 4L6V6 1LTKA 3IQZA 2QE7D 2YN4A 2IW1A 1SRQA 1KJZA 2FWBA 2WYOA 5EJ7A 1OC2A 3L25A 1XD9A 4PO9A 3LYAA 5K99A 5DI3A 2ZE8A 2HPZA 4V1CA 1H8HA 3IRVA 3EF0A 3E70C 2FMTA 4JFRA 2R4EA 2I6XA 4LCEA 5JD5A 1W76A 2PBZA 3EF1A 3W8RA 1FLNA 2HREA 2OSBA 3ND7A 3NOVA 2W43A 4Q9NA 3SIPA 4NYJR 1QU3A 4GM1A 3QWBA 1LI4A 1O94D 4BBPA 2YH2A 2YBEA 4XJVA 4G5RA 4IHJA 2XLJA 4AP5A 3LCCA 1JECA 3FI0A 2ZIGA 3T5TA 2Q6LA 4H4DA 4EH1A 3DZHA 1O54A 1YQXA 2HTEA 4U7HA 2V55B 2GN6A 2ONKA 3MBKA 4BQPA 1T4MA 4HUTA 3GDGA 4RS3A 2ADMA 3N1UA 2GN9A 4CKWA 3EJ6A 3H65A 3NAGA 4R1NA 2QTTA 3C3CA 1N6KA 1XAGA 3E8MA 4B40A 1XZMA 4Q6BA 3LFUA 4YCNA 5IW8A 5KTKA 4D2IA 1YDEA 4UMFA 1Z33A 2W0SA 5KTOA 1LQUA 4N54A 2AZDA 3T38A 1W5FA 3S40A 1NXSA 4J16C 5EKDA 3LG2A 4NZPA 3UOWA 3A06A 2Y1EA 4KO1S 3IRUA 3CLRC 1GPAA 2NXNA 1IOLA 5DP2A 5LN1A 4RNAA 4C4ZA 3ONDA 1RE1A 3JPYA 2I7DA 5JXHA 1U7XA 4DR1B 4MPJA 3OJCA 1QIJA 4A4DA 3EAFA 2YDXA 4KPYA 1PKEA 3NBMA 1K3UB 1TA0A 1Z6AA 4C7BA 2WAYA 5GGYA 3PVZA 1GL7A 3TQTA 3K9HA 3G68A 5AVKA 5HX7A 4ARSA 4O4JB 2QAJA 1VCNA 5DN6A 2JVIA 4MMZB 1QV6A 2VTEA 1XFDA 2IW3A 4GBGA 3VC3A 2J5BA 2UXDM 4ESOA 1RXWA 4NZZA 4LJ6A 2EIXA 1LXCA 5AOVA 2W93A 5KOIA 2OZVA 4ZOAA 3ZG6A 4JB3A 3NALA 2RGYA 1BVHA 3C5EA 4MRRA 5DMHA 5A6SA 3BQNB 3LPNA 4DN6A 2YV3A 4NOKA 4D3FA 1RLIA 2BFFB 2VTBA 4KXXA 2I4MA 1D2RA 1YE5A 4P2GA 4JEMA 2OO3A 1YB4A 4HDMA 4DMUB 2CNOA 3Q87B 4YLGA 2NZUG 3RVDA 2A4KA 5DM4A 4IDOA 5BW6B 1M2EA 4P34A 1NUHA 4YMVA 5KU7A 2WU0A 3W6ZA 1MBZA 2BTQB 3OQHA 2NV2B 2P67A 3RSCA 4B0PA 2DVWB 1V0JA 3CVOA 3KEFA 3FKSA 3BSFA 4KAAA 1CJCA 1E1QA 1UXKA 1TK2A 5NLLA 2ENWA 4C7MA 4XGRA 1KFBB 3GFSA 2GRJA 4R1UA 4V03A 4E4TA 4PFQA 2VFAA 2WV9A 3KV1A 421PA 5HE9A 3UCFA 2XSZA 3RT9A 2AR0A 4L9AA 3GLHE 1REQA 3U6KA 1RYHA 3RC3A 1KU0A 1LK7A 2EKPA 4YJHB 4Q48A 4MV3A 3CKMA 3IPCA 3GNSA 2QSYA 1LUAA 1NOJA 4DRXA 1DX9A 2Y93A 2I3BA 5JZMA 3SS9X 2CEAA 1RACA 4AS1A 4KQCA 3Q3EA 5K8JB 1H5UA 1YC2A 1D5CA 2Y3IA 3KYCA 1E6MA 3C58A 3HCWA 4DB4A 2OLEA 2UYGA 3CUWA 2HV8A 4XLTA 3DVRX 4WJZA 5K4GA 4JI8B 2XCIA 3V80A 3HS3A 2KLHA 4LXYA 1YFZA 1U6IA 3MWDA 4LYJA 2XMSA 3GARA 3VOAA 3WB2A 4MR7A 5K6TA 3H8WA 3STTA 3QHQA 5LQUA 1MQSA 1AZTA 3K9CA 1T8YA 2ZCJA 4DDVA 1J39A 1V43A 3A14A 1RQNA 2JI6A 1GL9B 2JGKA 3PUHA 3G2KA 1Z22A 4L5CA 2BP7B 2ZOSA 1PNTA 4ESHA 3N2IA 4XPZA 3LI2A 5T7BA 4CQMB 3TI9A 5L4LA 4R2IA 3LRTA 2IY9A 2WIAA 4HJXA 1XELA 1GZDA 3UIEA 4M0WA 1RLTA 2VH5R 1FYVA 4J0JA 4H15A 2LVBA 1VMDA 2IOQA 2OQIA 2O2HA 3UT5A 4IIXA 3RV3A 1SXHA 4BQFA 2O1XA 4JNCA 1FVHA 3T3OA 3UJ6A 1WL8A 2I3GA 3ZE9A 4BEVA 2V6IA 4QVKA 1NP6A 1G55A 2UYYA 3UN1A 3O73A 1OAIA 5DRTA 4W7SA 1PDWA 2SKEA 1T0PA 2XE4A 1V7PC 5HIKA 3WTBA 3ZVMA 2ZWIA 2GI4A 2ZIEA 2QU7A 5J5CA 3QMVA 1ZD8A 3FB4A 4DCSA 2OCKA 5HJ5A 1FRNA 4B2PA 1RWKA 2ID7A 3O9MA 1P81A 3GEPA 1VJ5A 4N3NA 1NHGA 1WB4A 2J9FA 4AECA 2XAAA 4Q3CA 3R7NA 1JHAA 3C5HA 2YZKA 3KYBA 3MLAA 5HFJA 1RPZA 5D7NA 3SR3A 2ECPA 3I9LA 4JLBA 1JUDA 3QOWA 1MU5A 4IS2A 4WADA 2A94A 4U8GA 2H9IA 1UBUS 1IHXA 3MWEA 1B16A 1WXIA 2V5AA 4B7ZA 3OESA 1YZLA 4ZI7A 3DEJA 4KFTA 1FYWA 5COBA 1ENOA 5B1EA 3QEBZ 1SIUA 2Q5FA 3K2QA 2I4IA 3EXEA 3U40A 1SA0A 3S1AB 3DWIA 4DR1M 4BEBA 3RQIA 2AN4A 1YS1X 1U80A 2BEJA 4DCGA 1A95A 4Y2VA 2NG1A 4B76A 2I4LA 1TTHA 2C00A 3V4ZA 4EVSA 2O0LA 1TTQB 1OX5A 2AHOA 4ABYA 4PLFA 5KCMA 4TV8F 1HDXA 3AI1A 1N6IA 4LQ4A 2EGGA 1FQKA 1XAHA 4QXPA 1YE8A 5FI1B 1XQVA 5JJ5A 5FBLB 1DC4A 4XB2A 4Q05A 1KQGA 3T4UA 1PT8A 2YZMA 1OXBB 8LDHA 2JAPA 1DQYA 3QVOA 4JWTA 3L7MA 3ZK8A 5FULA 1QR2A 1ISMA 5TSDA 4OQEA 1Z12A 1WGNA 5IT9S 1GFWA 4P16A 5F2EA 3UHAA 4H17A 3AINA 5CG2A 2LDXA 3JQBA 1XLUA 2HFKA 1QYCA 2J6HA 3RCBA 4DLKA 4KN5A 3ZEAA 4H3SA 3EX7C 1SHZA 4KB5A 1A72A 2ODPA 2XNJA 3DW3X 4IHKA 5FLYA 4ITQA 3B1ZA 4LJ7A 3IOCA 5FT9A 4IIJB 3TVDA 3PIDA 2DWPA 4O4HB 1ZW6A 5FEMA 3LIPA 3KSDO 3RQSA 4K5QA 2NW6A 3L8HA 2KW5A 3AVTA 3IEIA 5T67A 2W6ZA 5FLXA 3B60A 4PIVA 2CFRA 2Z8XA 2A30A 3ZWDA 2FQWA 3PQ2A 1Y7PA 3AJEA 2G40A 2REQB 1WA5A 3NYWA 4U7GA 4ND8B 2ZJ2A 3ZJVA 3HI6A 5BQ3A 3OEWA 4Y9TA 1D1PA 3LDUA 1NVMA 2VYCA 4OMUA 1R50A 3K9WA 1T34A 5JAQA 5E4JA 1YV9A 1SCBA 2FMFA 2VR1A 4M87A 1HORA 4R5MA 1MRZA 1MR3F 3RBAA 4YJ2A 2HQRA 1BWPA 4DCOA 1HE5A 1B7GO 4CLRB 3COSA 3I4CA 4RK4A 4D41A 3P2MA 3W06A 3KS9A 3FOCA 1PL8A 4H7PA 4RV9A 2J31A 4OQXA 5SY6A 2ZJYA 5EUQB 4JP1A 2OSVA 2PU5A 4CIAA 5JAUA 4G0VA 4HQNA 2R6R1 1POXA 1PWYE 4JXXA 1W4CA 5LOVB 3U6CA 5C7OO 3FMOB 2JVJA 1SUFA 3AV0A 3OA2A 4JJ7A 2NO0A 3DAPA 2P6UA 2JZ0A 4I50B 2IHKA 3IQGX 1LDYA 4D43A 2F1HA 1TAUA 2DPYA 4BQEA 2GDZA 3MGBA 4U3JB 1C1DB 4I81A 1KR2A 1M2OB 4J2TA 5E4TA 2R65A 4CI0B 2XFSA 4WX2B 5DHPA 3TOZA 3KOXA 1B41A 1OFUX 1RRGA 2X4AA 1UCFA 1Q7EA 3IB6A 4KH0A 4CT4B 3CXUA 1WQ3A 2EZ4A 1FDIA 3W5HA 4Q1CA 3CVWA 3ZCTA 2A58A 2B25A 1E6UA 1H2XA 1II9A 2QNJA 1FNBA 3I83A 1TYAE 4BDSA 4GE0A 1W75A 4KPUA 3I9FA 3EY4A 1DARA 1E79A 3GLVA 2OCBA 5ALFA 4GFDA 3HJSA 4Z3DA 3EIXA 3CZPA 2D2FA 2I6GA 1QDEA 4C30A 4RKFA 3O1JC 1GVHA 2R1UA 1U4NA 1FFDA 4RZIA 3EODA 5BR1A 1A8IA 5DK6A 1HC7A 4RCYA 1WVMA 1QCDA 3MCAA 5TRTA 3EPJA 4GNKA 4GXTA 1BH6A 1KSJA 1H3EA 9GPBA 4C0XA 2RGCA 3EDQA 5SYAA 1XNGA 1VYHA 3H2YA 2N75A 1OH6A 3JQGB 3EW7A 2VLBA 2ZWPA 3L6DA 3OZCA 3ANNA 2OCGA 5IABA 3IBGA 4R3UC 1NXOA 5DP1A 2A9KA 5EIBC 4DSNA 1YJ8A 1I4EB 2WKQA 3NYQA 3CJRA 3UC5A 2D7CA 1P6QA 1NQ5A 3ZWPA 1HTBA 1JPUA 4L73A 1YBFA 2WWTA 1JQEA 1JSCA 1Q3TA 3ND8A 1DOZA 1OI4A 4PX5A 4P3NA 3TXXA 2RBEA 4HXFB 3EZXA 1KBQA 2GZMA 4RZQA 3NW9A 4IIEA 3W2TA 1XX6A 4DG8A 3OTWA 1KDVA 2H85A 5GY7A 3ZNOA 4O1IA 3AVXA 3EWIA 5A3QA 4FIZA 2R97A 3KKOA 2PRYA 2JARA 1E89A 1ZJYA 3UHOA 5CXQA 1NBAA 2WUFA 3R3JA 3DP9A 3GEBA 1EJ2A 3VYVA 3ZE8A 5JCJD 2FN9A 1QE0A 5K0FA 1L7DA 5K45A 2YXNA 1QS0A 2C3PA 2NU8A 3E3AA 4LFBM 2Q6VA 4ZTBA 3OQMA 1L0BA 5J43A 1PJJA 3AM3A 1R2YA 5KYXA 4JQCA 3TK1A 1MJGA 1KSGA 2VNSA 4P4UA 2IOYA 1LDEA 1I4LD 4FONA 5MN5A 3DVAA 3NORA 3TEJA 1QRDA 3HU5A 3MT8A 4FDVA 4ACAA 1K2WA 3PX7A 1L4KA 1CJVC 4AZVA 3HHYA 1YB5A 3AF2A 1IU9A 3VYRB 1SCKA 1KETA 1SUIA 4PFSA 3WL7A 1MDBA 2VOEA 2R4QA 5FI0B 1WHSB 1KH3A 1U02A 4MVJG 2I4OA 3R3XA 1KEEB 2JGRA 2C03A 1GRQA 3LPAA 3JYLA 2IL1A 4UMDA 2GHQA 4Y6LA 2ZB8A 3WWPA 1Q6YA 4NIMA 3BXWA 2F8LA 4LMRA 2Y0CA 4RVUA 3UJBA 4XGKA 3AHDA 3W7AA 5BYJA 1G6HA 4I6GA 1E3TA 1A2OA 3KWLA 4PLWA 4RKWA 1LPOA 2NVBA 5E3JA 2ZRHA 3IP9A 1TA9A 1ZVVA 4DL9A 5CD1A 4PYIA 1D8TA 1S1CA 1QDTA 4IJ6A 2FPGA 1UT5A 1CV2A 5DTIA 1BS9A 4BJ6A 3LZ6A 4QRDA 2O8VA 5A5DA 4N7JA 1EG2A 5GV8A 2ZE6A 5HGXA 3D59A 3I0NA 4IDEA 4ZYXA 4DMLA 1IULA 1FYFA 2Y76A 4NS1A 2JWSA 1T9ZA 3JALB 4RD1A 3PXDA 3KETA 3AMVA 4Y2QA 2OHJA 4E88A 3SC3A 3TFWA 4J2HA 1KI6A 1FP7A 2D7DA 4GOJA 4I1RA 3TNJA 3E48A 3H1BA 3QRWA 2RGRA 2X0FA 2L18A 2J6CA 2ZLBA 3H13A 2PBRA 3QV1A 2WD7A 5FL3A 3RTEA 3O8DA 1CR6A 1Z75A 2C78A 1YCFA 4BQQA 3KZ1E 2AE1A 4D96A 4UEKA 2WLTA 2BKEA 1GWNA 2ZKLA 4CHGA 3VPBA 2PWYA 3CSDA 1JDJA 4B85A 1H4VB 3ZCXA 2PVSA 2RK6A 4F92B 3S7ZA 1V5GA 3ER9A 4PRKA 5I8ZA 3EZ9A 4ZU1X 2ODWA 1YR1A 3AHCA 1TFUA 4BO6A 4CEJA 2PT5A 3AP3A 2JIZA 4UQLA 1TEZA 4BIMA 2X6TA 2ZTCA 4YWHA 1C9NA 1MIHA 1A50B 1UZLA 4NYMR 4EJFA 4PZ0A 3F98A 1GVNA 4GXNA 1RZRA 5D5QA 4UARA 3JYQA 4FYIA 5LQAA 1PQYA 4X00A 3BXFA 4IQGA 5H9VA 1A5SB 1KZYC 3HB0A 3T9FA 4UE2A 3GRUA 1RCTE 1D0VA 3O9VA 3WGVA 3WJ7A 4C14A 2H2FA 2A14A 1HUQA 2UXCB 1TEXA 2VT2A 2F43A 4YQZA 1EAMA 4KPFC 5PNTA 4IJUA 3VH2A 2WTAA 4IDPA 4UEJA 4XAQA 3MF4A 1FMLA 4G1UC 3E61A 4HB2A 3WL8A 1D9ZA 4ZVOA 1NVFA 3WJ2A 3G9QA 1DG1G 3R2JA 1CY8A 2LGJA 3GPDG 1ZK3A 4GAEA 1E66A 3R3VA 3ICCA 3VDRA 4E5YA 2R6HA 2YWJA 1ZMVA 1I80A 5IJAA 4I9NA 2YZ7A 1ZNQO 2YFKA 4TLLB 1ZA2A 1R5NA 2HKIA 1L9KA 5CB4B 4LG2A 2JJMA 3VR5H 1LC0A 3WHIA 1LVGA 1VKHA 2XW6A 4MIEA 3KHUA 2UAGA 3NNDA 3LOUA 2Y2VA 5DJ5A 1W96A 1YHNA 3GFTA 4YNBA 2XITA 1PO7A 4R2HA 4DR4B 2I7NA 1DUVG 3DBHA 1DGGA 4JENA 4P3PA 3Q5DA 4LXUA 1QAMA 2H1FA 4RJIA 1ZGJA 2ID9A 2ZVJA 2C1EA 1O95C 1Q20A 2NTEA 3JQFA 3HU3A 2PPVA 3Q7RA 4ZZIA 2Q9CA 4KO4S 1Z26A 5C7YA 2PUAA 1PQPA 1R18A 2PYIA 3TUJC 1XVTA 1G2IA 2HJRA 1PEDA 2H17A 4ENQA 2HWWA 4FUQA 2KJQA 4RU1A 1M1YA 1JHPA 3SPXA 4IZHA 2ODNA 5GONF 5LP6B 2YZNA 3NB0A 1T5HX 4J7AA 2Q3LA 3UH1A 4KVFA 4FDLA 1SD1A 2YWGA 4GZ6A 4I6JA 3HWSA 4HUJA 3PFNA 3N2YA 3I34X 4EO9A 2YXEA 2PWPA 4RIEA 4AO8A 4JL6A 2HLNA 4URHA 1ESDA 4EA6A 4NC9A 3U1VA 3GRZA 4URYR 3ZCVA 4EG0A 3I32A 4R1TA 1F2TB 4B7XA 5LB4A 5DYGA 3QTBA 4TYWA 3BKWA 2P40A 5FTMA 2M5ZA 3LOPA 3W67A 4BNGA 5AVJA 1H2YA 4K6FA 2UYQA 4N8DA 2YTZA 1J8VA 5IUNC 3ACDA 1ZGHA 1T8TA 2DHEA 5ECWA 2R45A 2QUZA 4J4TA 4W63A 4WINA 1FNSA 3JWIA 3PWTA 2PH7A 1EA5A 5B3JA 2YJTD 1EDBA 3D4PA 4RFVA 2VYFA 1BXZA 1VE6A 2FUNB 3VM6A 1KWKA 3GJ6A 4P32A 5BPFA 3TKYA 2PGIA 3MK31 1NT4A 5HBGA 3H4IA 4OOFA 4WXHA 2IYVA 3PFFA 1P62B 3ZH2A 2HHCA 3OICA 2YJ5A 3FKQA 1WUJS 2XGNA 3AB8A 4D25A 1NW7A 3GD7A 3TD6A 3LHFA 4JA0A 4JMLA 1NONA 3HFGA 2R8ZA 3EARA 3I39X 1WCIB 4F12A 4IZOA 4CN8A 4ALIA 4QNRA 4P81A 5HS4A 1UJNA 2OO7A 2JH9A 3M6FA 3THRA 4QGHA 1HLFA 4J76A 3R24A 1UZMA 1IXSB 4RUKA 3NVKI 1LV7A 1N3BA 4V2UA 5ALOA 2PMEA 2QW8A 4MVYA 5BNFA 1JKMA 3QLVA 4EG1A 2Z5VA 1RYFA 2W11A 2HU7A 4I9HA 1QIIA 1V34A 4K40A 1NJ1A 4OGKA 4XVCA 2F5SA 3GFGA 3WLSA 3VGPA 5CDFE 3FVQA 1U2DA 1WV1A 2QTFA 2JLXA 2UYOA 3EZLA 2PUGA 3L46A 3N2EA 1PSDA 5DLEA 1JG2A 1BMDA 4FN5A 2HA6A 4Q7QA 3PA6A 1D0IA 3CLRD 1Q1EA 4O08A 3C1TA 3U7RA 2W5UA 2IA5A 1M10A 1Z3CA 3JRNA 2WWIA 2WDZA 3U31A 3UMYA 4Z1MD 3OMXA 3ZD7A 1JYSA 2B78A 2FW9A 1I32A 3X1KA 2HQSA 2ZYWX 2CJPA 5A1JA 5CD9A 4MWTA 4RJTA 4OSOA 3FDFA 2AG5A 3WGOA 4F21A 2EU8A 2O1SA 5CLQA 1B23P 4XQGA 3UWMA 2RAUA 4G5FA 4PRZA 2A5FA 4K26A 2BMFA 3MPUA 2A8YA 1WXDA 3C7KA 4IIDA 1RKQA 3LKZA 1R6BX 3AB7A 4FDTA 3QMMA 4GR5A 1N6PA 1E9SA 2O7NA 5ALQA 1OQYA 3E3MA 1E3WB 1S8OA 2RONA 2XYHA 2ZAIA 3UV7A 2NO6A 4MUEA 2P1RA 2WU1A 4EY4A 1L4NA 2FGKA 4TTSA 4QJ3A 4PZLA 2XGGA 5EHQA 1XXLA 1Z37A 4YJFB 2UXCM 1QZUA 5B30A 3FETA 1WUHS 1P0PA 4O4JF 2FPOA 2ETVA 3C3YA 1LTQA 4H16A 1Z08A 1SKAA 4MA0A 3ORSA 4LQLA 3WNZA 4Z4FA 4DPKA 3AEYA 4CODB 4C2UA 4K03A 1QE3A 2HPAA 1UP6A 1TCVA 4OHVA 2OZLB 5ECGC 4ZDIA 3DE4X 3ANXA 1UK6A 4ARIA 4ZCIA 1X7WA 2UYCA 5JASA 4LDJA 1ZJWA 2I1QA 3F3MA 3KT8A 5TARA 1ZZGA 3WK5A 4PSUA 2X4DA 4BZZA 1H9CA 1DKPA 2FSPA 3DUFB 3ZE7A 4YCBA 3BSYA 1T4GA 1G8MA 4EELA 1C50A 1S3IA 2A5LA 1BMFD 4PLVA 4U7PB 3C87A 2OXEA 4ESVA 4YV0A 2JD1A 4Z2YA 1GQYA 2RG7A 4EX7A 2H1VA 2BBSA 2B9VA 2NSJA 2ONZA 4NMLA 1EB8A 1VGRA 3M6IA 4YRPA 4HYEA 2OEPA 4I4TB 3NDBB 1N57A 2X0JA 1WIVA 3VKFA 4D9EA 4V3CA 3I0MA 1E2DA 2BISA 4C0WA 4EJ6A 2BFBA 2HWJA 2A7XA 1MJFA 2V96A 1KYXA 4JKOA 3GMSA 5IMBA 3TL2A 5BOVA 4N41A 1X1EA 3DEIA 3PD0A 4FZ3A 4B3MB 2Q3MA 2HBQA 2WSIA 3WK7A 1DRVA 4NH4A 5LNK1 1P33A 3ILVA 2RGAA 3GRYA 3I1FA 2RJ3A 3U7QA 3OPQA 2GCPA 2CMGA 2QMYA 1ZSVA 5LQNA 3EMVA 3K1AA 4NV0A 1C9JA 3RTBA 3HHEA 3M1YA 4E33A 2XF3A 3N7UA 4ZJZA 2Z6VA 4HR7A 1ML4A 2AXQA 3A98B 4JV5B 3FLBA 2G06A 1YQEA 3TR5A 4H6XA 4A36A 3GJ3A 3UH0A 2J7PD 1T2DA 4E5KA 2DCMA 4B6SA 1JKJA 4XR4A 2XZTA 3TQRA 4JYBA 8ABPA 1P1RA 1PK9A 3WXBA 2XE8A 4I8DA 1VJ0A 3UGJA 1SUEA 3PHHA 1OWOA 2JAUA 4MO2A 2ZQZA 4BAGA 4CCSA 1JVBA 4QLAA 1IDN1 3WYAA 1JDSA 1JQBA 1PZEA 1K8QA 5FWAA 1XRPA 5F2KA 5L3SB 3EYAA 1CDZA 1C8LA 2G88A 5CGZA 1SKMA 4LYDA 4D6YA 1JILA 3NP7A 1LKZA 3EISA 5A9RA 1A8UA 3QPCA 1C2YA 3W68A 4UU1A 4MV8A 2QX9A 4IS3A 2WSLA 3ZD8A 3QF4B 4AMYA 1N6HA 2PXAA 2LKDA 4NRDA 4G1MB 5FUXA 4FDUA 3DTVD 3GXBA 3LLUA 4KOEC 4WN9B 1R15A 3OFVA 4FLFA 1T5LA 1SBCA 3SP1A 3HFRA 3G2MA 2BTOA 2C9BA 2A1TR 4ENRA 3A8TA 5AI4A 2VWHA 4ZEWA 4MPDA 3VAYA 1TAHA 4BMNA 1ZSNA 3FPBA 4GL2A 3R7DA 1TQ8A 1NUSA 3LDHA 4FHGA 3E9CA 2X15A 3CRMA 3KPJA 3GF4A 5DX8A 1IUPA 3UW3A 3P32A 1IEXA 2ZUWA 5IEJA 1BYUA 2EUCA 3KV3O 1N32M 5CR9A 4DV4B 3WYCA 3H5OA 1T43A 3H8VA 1XDZA 3ROQA 5IRCD 2QR3A 1QKIA 1OB2A 2D2EA 3DNMA 3WO1A 4U63A 1JSZA 3V4FA 1VPDA 4MZDA 4DIUA 4J8PA 1I3OA 4ED9A 2HCBA 4JT2A 2SKDA 4QQKA 4EPXA 3DCYA 4IJWA 4PSDA 4W5RA 1Z2AA 5FAXA 1GLGA 3S27A 2Z6QA 2X8LA 3GAAA 1IN5A 2RDMA 4OI4A 1VLJA 3QXHA 1I1NA 3N6XA 1HMYA 3ACCA 4C08A 1MOQA 4CUKA 2WJPA 2QRKA 1EUQA 2Y1CA 1R4NA 5DLYA 3V7NA 3O0DA 5CA0B 2IYFA 4YMTA 4RIHA 2PT6A 4MKRA 1YZYA 2GPWA 1O77A 3O21A 4ZYTA 3M7GA 2CHFA 2WWXA 4H59A 4BCDA 4F6RB 2DX7A 3WMGA 4RJLA 3TUZC 3GJZA 4JJ4A 4YREA 3Q5GA 2YVAA 3PRKE 1MAVA 2JFVA 5L8VA 2QCUA 5KMGB 1PJCA 3NMUF 4GP6A 2CV0A 3K0CC 4JYCA 1V7CA 3TZEA 3B5EA 1WDKA 1MAHA 2W6MA 4KXUA 6YASA 1M2WA 3GJ4A 3P2KA 1GYRA 3MS2A 1UM9B 3OCYA 3O8BA 1GITA 4MUYA 5G41A 4HTAA 5BOSA 1TCCA 1Y89A 5BSUA 4P58A 2PWBA 1CJUC 3NU1A 4MLZA 3TNYA 3LL7A 3WP0A 1I0IA 2CUKA 2ZE7A 4L85A 4MR8A 1PGJA 3G9ZA 4MZXA 3D9QX 1P1CA 5EQJB 3SBEA 1U1GA 4HADA 1CUYA 3HJRA 5DVZA 4WDQA 2CHQA 4EHDA 3WA6A 1V4NA 2NPFA 4YGYA 4KYIB 3K32A 2FRVA 1X8LA 4WZBE 4JL8A 3WX0A 3I4FA 4IIJF 3F0TA 1IBKM 3OOHA 1JR3D 1QH8A 4KR0A 4OMDA 4O4HF 4UULA 2AK3A 2KM1A 2NO9A 4Z1OA 2DBRA 2AC7A 1HDRA 4W4TA 4R8SA 5KJEA 1I2CA 4LOKA 3RVLA 1PI3A 2CV1A 2R8PA 2FH0A 1VRVA 4PICA 5JSFA 4GR9A 3A1SA 1L5SA 2WU8A 2OFFA 4FYPA 1IOWA 2GN0A 4JVNA 4J0KA 3ET4A 1P0QA 4TZKA 1LB1B 1GU1A 4U0KA 5A02A 2GN4A 1IDOA 4OU5A 4PE5B 1QRAA 1BGXT 3VDMA 4TKVA 3PI7A 4H1UA 3FDZA 4BGIA 1BX0A 4BVEA 1HURA 2VH1A 1KEUA 1GA6A 2FA9A 4DVGA 4YJKA 2XZFA 1ZXLA 4RD2A 2HK7A 2H1RA 4MUGA 5EYPA 2EJTA 2AUTA 1TM1E 1EP9A 4QBTA 2OP0A 3UV6A 2Q0SA 1LEHA 4IF4A 4KXQA 5T8KA 3V55A 3ZE1B 1JLSA 4AY6A 3THXB 4XASA 4ZEOA 2QNRA 1QYVA 5JSZB 2R84A 5K0JA 2D62A 5LOVF 4NV3A 2HDWA 2NXWA 1E64A 4KE6A 2HCFA 5FOTA 5AKGA 1CHDA 3E81A 4FEAA 4GYWA 2A1UA 3S55A 4PV7A 4XD7D 4I50F 1BDBA 1R27A 1XMXA 4UBLA 3ANLA 1Q6ZA 4FKBA 2CNLA 3VAAA 4IJMA 3MK6A 1NM5C 3ZV4A 3E7DA 4MNTA 3NEYA 4JLOA 5DGXA 1WW8A 3NHBA 4WIAA 1F2UB 3DOEA 2QDKA 2XJ9A 3TMYA 2P6RA 2YHIA 2VJMA 2D4HA 2WSFF 5JH7A 2G71A 1ZVJA 3FWZA 3JTMA 2ZT5A 1M0SA 1OVGA 2RB5A 7AT1A 1QG4A 5D3MA 3L1JA 1Z74A 2YHSA 4FYYA 1NX6A 4F71A 4H27A 4ZVVA 1P1JA 3HHPA 5LBTA 1R6DA 1JBKA 3KYDB 2ZBEA 3G9TA 2YWBA 3EQ6A 2GLXA 4Y1RB 4EW3A 5BPHA 3WFIA 3FX2A 4L3OA 4LSZA 3U3ZA 3C85A 4NG5A 4X7BA 3ET5A 4A3SA 1ECGA 4C4RA 4MSUA 3CO5A 5EIBD 2OV1A 5JDIA 1FXWA 3R5JA 5F3WB 1U0SY 4GXQA 2D8MA 4Q4JB 3FHTA 4LQDA 4LRQA 3LC7O 1XRQA 1B6TA 4DV4M 1T26A 2GAFA 2D1YA 4II3A 1DZ3A 3KJHA 3B36A 1IC6A 1HWYA 1Q77A 4UXHA 4MAFA 4XSVA 2LXEA 4KBFA 5E3HA 4OA5A 4Z6YA 1IUOA 1HX7A 3GBSA 1EWQA 4OGLA 2QT9A 5F1OA 2BC9A 3AK4A 2JHFA 3B6KA 3Q3GE 2YINC 1VCMA 4AYTA 4QXMA 5E0OA 4Q7JA 4F9TA 3AHEA 1XL0A 3TDKA 4KRXA 4MHSA 2V8OA 1US8A 4OGFA 1N6LA 4KR7A 5I9SA 4K9MA 3AM4A 2MCFA 5FFFA 3QXGA 3MCTA 3B6EA 4GLJA 4XBOA 2FX2A 2I80A 1U3CA 4NULA 1DU4A 1KI1A 4N7MA 1BJTA 1HLDA 1LS1A 1FJGB 1YQ9A 3LW8A 4MWSA 1L5NA 4X60A 2QA5A 1QGUB 4D44A 1FRZA 2V1UA 2Z4RA 1MP0A 3EXFB 5KSOA 3C14C 3A0UA 3KEGA 5IZCC 3QEAZ 2WF6A 3LK6A 2IS2A 4MJ3A 3PHCA 5K3FB 4B32A 4WDRA 1Y6RA 2NZXA 2XMDA 2DAKA 1DXHA 5JNRA 3JATA 4TWAA 4PPQA 4KMRA 4ZJUA 5BVGA 3F7MA 4W5QA 3ONFA 3T0GA 1VKOA 5H59A 4CXMA 1HZZA 3R8CA 4UNQA 1T1RA 2GD6A 3ZU5A 1EXMA 1KY5A 1HQDA 1UBTS 3LF2A 1XRMA 2JFPA 4C6TA 2XOKD 3RRYA 2K7ZA 1AUOA 3LHKA 3QKRB 3HY3A 2AFHA 3K8OE 2H4ZA 1PV4A 3JWPA 4EENA 4ZVKA 3FTFA 3GQ5A 5HQ3A 1WSBA 4ENUA 1GNPA 3OSUA 1Z56C 1HYHA 3RS7A 3TQSA 4EDHA 3QJGA 4UVDA 3W0FA 4AVYA 4E31A 1R0RE 3KZNA 4Q4AA 1O0SA 1FW6A 1QAQA 3IE1A 1R12A 5EL0A 1EM6A 1T8RA 2R0IA 4G23A 1DX6A 4J07A 1O6FA 2HEIA 1E5QA 1R37A 2RJNA 4A82A 4FX2A 3QNWA 4B84A 3QE2A 1WGLA 2X13A 3RODA 3VO2A 2LVOC 4ZJYA 2J7OA 1FPQA 5TMDA 4DHWA 4AG5A 1LX7A 4JN6B 1UINA 1J2TA 4PLTA 4KWHA 3AKZA 3DLBA 1OBHA 1L8XA 4IVNA 4P3OA 5H3CA 1D2HA 3O95A 2XWQA 1N92A 1UIMA 1C7EA 4HGYA 3FFXA 1JQ5A 3PNOA 3D6VA 4P82A 2XY4A 2VIIA 2GJSA 4AJLA 3AR8A 4CJ6A 3TRJA 3A4TA 4FB4A 2HGSA 1GN8A 2ZS9A 3M1IA 2DQ4A 2W6ID 4DRYA 1E9RA 3SGLA 3ROEA 4LJYA 3SIXA 1GEEA 4EY5A 2BFEA 4KFSA 5JW6A 5ALIA 1L7RA 4N65A 3ZTTA 3BTOA 1VSBA 4PIPA 1G59A 2X7HA 3EGDA 4NSRA 2GZSA 1RKXA 4C4PA 1DZIA 3D3EA 4TN5A 3A6JA 3PE3A 3EPHA 1ZGCA 1SU6A 3IQEA 1I13A 4XIFA 1ZCJA 1N8KA 2NSDA 4LBYA 5SYMA 5IANA 4UFOA 2AOUA 1U1IA 4NZMA 5D84A 1JT9A 1E0SA 2CMFA 4M0UA 1L7QA 2QQ8A 3OI7A 2Q49A 2HNAA 1I2MA 3LQKA 3KKMA 1I6LA 3QX7A 3M0EA 4QEDA 3PCXA 4BO0A 1ORYB 3I61A 3ZLJA 1PK7A 4H0FA 2WNIA 4EHHA 4DR7B 4Y9SA 4JR2A 2Y4NA 3THGA 2D2XA 3L7OA 4K05A 5FUQA 3I92A 3HYLA 1JPNA 3H7IA 1JKFA 2ANCA 4KEAA 5JMTA 1MB4A 2Y71A 2I7TA 5FSWA 3M33A 3QAUA 4R6WA 2BUBA 4HLCA 4UM7A 4BWYA 4TUYB 2NPOA 1H3FA 2I55A 4E30A 3I01M 5HXAA 4ESEA 3ZW8A 2CK3A 3ZDEA 4YMIA 3KQQA 5IAJA 1N2HA 5AW2A 1UEJA 1ZIXA 2GYVA 3EVZA 1ISRA 2H7XA 1L6RA 1X87A 4L0QA 3HKCB 1FFXB 3L49A 2WG2A 3P4UA 2MSWA 2C1XA 3NJ4A 3W7BA 4R7GA 2IXBA 2Z98A 5CG1A 1ID8A 3A1TA 3NTQA 4BLOA 1ML3A 3E9QA 4YAWA 4TRMA 2MWMA 2FZKA 1ODTC 1GKKA 1NYRA 5EKSA 3VTZA 4KQKA 3TS1A 5K0SA 2C4TA 5IHXA 5JFTA 3AQ4A 4FHDA 2Y0EA 4CM6A 5KPRA 3SM3A 3WISA 5KNBD 1DGHA 4NNPA 4ZZ0A 3OZAA 4D02A 3IXQA 1LWOA 4H2DA 1T2CA 2EERA 2OXCA 5G0SA 3V48A 2HF9A 2VP0A 5ICSA 3FGOA 1O95D 1EVQA 3OPYI 5CB4F 1XD2B 4AC9A 4IMIB 2JCXA 4LXQA 3VZQA 2ZAOA 3GYGA 4IDCA 1SVOA 5LXTA 1JLMA 4FFRA 2GPAA 3TVTA 4PYMA 5IWCA 1UXHA 2LVAA 1DFIA 1Y3FE 4R31A 4DV2B 4MUBA 4YUYA 3C8UA 5IZ4A 4LRXA 1B6RA 1KE1A 3D43A 4JYZA 2QS9A 1BX3A 4QPZA 2FB9A 3EGVA 5ETJA 5ALTA 1LF0A 1J0DA 3Q8KA 1OV6A 3DF7A 2ZXUA 3J81k 5K3SA 4CM7A 3TXYA 5ESXA 1D0SA 2Q3CA 5J2UA 3T9AA 2R4UA 4HGZA 1OIXA 2RBGA 3P9RA 2V6FA 2JIOA 2V0NA 3OCCA 4HAWA 3QX9A 4DXAA 5AW0A 4AS2A 4EMTA 3QIVA 1Z18A 2X8JA 1R6AA 4FOSA 4A92A 1BHQ1 2B6HA 5CDUA 5LP6F 3E18A 3SQDA 3AU9A 3H2HA 2RH4A 1MH1A 1AHPA 2UV8A 4QT4A 4P54A 1JV2B 1TZMA 3WOHA 5TQJA 4WASA 1UEIA 5E1MA 1KYYA 1PQWA 4ZJPA 1P4RA 2C9YA 4JI8M 3N2NA 3IPRA 4ON9A 5LD2C 1YCHA 1YULA 2ZJ7A 1NLFA 1BDIA 4OFZA 2FUG6 2JZOA 4GRDA 1I8TA 5H4GA 4UMEA 4AUKA 2P0YA 4RMHA 4XQ9A 1HDYA 1ZM9A 1BFDA 3P4XA 2WSMA 5K3OA 1DINA 4YJ3A 4CCYA 2GWHA 3KPYA 1H8ED 4B79A 2XNKA 2YIMA 1SD5A 3TWMA 2OUKA 2VA9A 3ZK7A 3OPMA 1QYIA 4ZRNA 2I33A 5DX0A 2PGLA 3LZCA 1NLMA 1WNTA 4ZN6A 3CRQA 3D8TA 5D6OA 2H54A 1VI2A 4DQKA 4E5VA 1UFOA 1ULAA 1ZP6A 3ZIDA 1SXJA 4GR4A 1ESCA 2VYNA 1CIVA 13PKA 3ZUGA 4QO7A 4ML3A 3NBYC 3E1SA 5C3UA 4QGBA 3VOBA 2WVGA 4F3CA 1UWLA 4AN1A 4UBOA 3P9ZA 1OI2A 3SX4A 1T6XA 1F20A 2ST1A 4PCLA 1E1RA 1UOPA 1OI3A 1S0UA 2PRJA 1N2OA 2HSEA 4A8HA 3EIWA 2RI0A 3BXHA 1NMZA 3EXHC 5ELMA 3CTMA 3HJBA 2PO7A 1ONSA 1Y3HA 3EGXB 4W7HA 2JLVA 2CZQA 4WERA 4K87A 2AUMA 3MTDA 1NNEA 1NQVA 3CLKA 3GIDA 1JFVA 4L28A 4AMVA 1PSWA 4CV0A 3KIPA 4RD6A 2WBLC 5B1DA 5G2OA 3EG9A 4ZZ2A 4CIBA 4WQMA 1HV8A 3D8SA 4WK2B 2PGJA 2X4LA 2WILA 1LD3A 5DLQC 5HEKA 4IGEA 1H22A 4OHMA 5ALPA 2V7QA 4DIOA 5DXAA 4RQBA 2CUNA 2Q3HA 2LD4A 4TLMB 1U0TA 3H97A 2OUIA 4PNEA 2ZWMA 5AXAA 1FSGA 4BX0A 4R3NA 1QLHA 2FSSA 1F7UA 1ZNZA 3NHKA 3R74A 2B7LA 3GJ8A 2FGJA 1UKEA 1SZCA 3PWZA 3TWKA 1CQWA 2WM9B 1AV6A 3SSMA 4YRSA 3VHXA 4DBLC 2HIMA 1CUJA 1W8IA 3NPAA 4KFUA 5KIAA 5BN5B 2XUIA 3AERB 5H68A 4KJZA 1CLUA 1XEXB 3D7NA 4FYJA 4FEEA 2Z08A 3TR0A 1GZ7A 4QFBA 5HCIA 2F1KA 2GSWA 3IMGA 3KT6A 2FN3A 2XEPA 3CNEA 3TTWA 4URVR 4JGBA 3VQTA 4NYIR 4GIPA 3Q8XA 1U2QA 2J5QA 2ZR8A 2PUVA 2ZJBA 3B7NA 2Z3XA 3HXKA 1H65A 2X8BA 3ZEIA 4MLCA 2VPIA 3OCZA 3LYHA 4DLWA 1QVRA 4YAOA 4GDFA 4TMTA 3EXIA 4YROA 3GK3A 4YRAA 5JCOA 4DV2M 1JAXA 3PXUA 4PZEA 4S1PA 1PJAA 2FZEA 5DBOA 1DMRA 4Z8YA 4C0QC 4YHBA 3PF8A 3HCPA 4A8JB 2XVAA 4I4TF 1OY1A 1Q12A 3GV0A 1RRCA 4P4SB 3QFHA 1YIDA 1YNSA 4R2JA 4BKMA 1LV8A 3ONEA 1U65A 1G7CA 4HRYA 5LQDA 2XXAB 1A7JA 3T6KA 3SI7A 3BK7A 4FNOA 3N07A 1I3CA 5I5GA 3R5XA 4S2UA 5SZJA 1G2OA 5FBWB 1RLMA 4AT1A 5IJ9B 1FLAA 1XNJA 2I6TA 1Q3HA 2YUTA 3HN7A 3TI7A 3A4IA 4KLRA 3DAGA 1G5PA 1TF0B 3MWYW 2NU9A 2FS1A 3FYUA 1W85A 1U94A 2YJ4A 3TGWA 4X66B 1KF0A 4YN3A 1PDVA 4FNAA 1FFYA 3FNEA 1DEXA 1KBZA 3DA1A 4QNMA 2VCEA 3R5HA 4HNSA 3ZLVA 2H5EA 4YAGA 2Q3EA 4RD3A 2H5XA 4LDZA 2B7CA 2XI4A 3PC4A 2RC5A 1E3QA 2DJIA 3LT4A 3K73O 1E2FA 4L78A 3FDXA 1U7HA 5CT5A 4LZZA 3IMKA 1X1DA 5FL7A 4H6WA 3W4JA 3T1YB 2GHIA 2G0TA 4MHOA 2KWIA 1FXUA 4DBZA 2CD7A 3DOIA 2PCJA 1KDRA 2XTNA 1Z45A 1N0WA 1YJXA 2CT8A 3SX0A 1KXJA 1M8FA 1N2BA 3FYSA 1R88A 4IOMA 4Q9DA 5CNJA 3PRYA 5D7BA 1EFLA 5L3QB 3L3BA 4V0SA 4HVCA 4PXSA 1L5VA 4MYHA 3BOSA 5EMLA 4CMGA 3PT5A 3UWPA 3BTUA 4J2OA 4JC8A 2I2FA 2YZGA 3WO0A 1EESA 4QRIA 1C0EA 3RSOA 1YZTA 5JO0A 4FW9A 3U13A 2R79A 3X2FA 5CFOA 1SHKA 3RVQA 1JHMA 3GG2A 1MHPA 3WB1A 3DLIA 3CY6A 2NUAB 1L5QA 3A4VA 5EQTA 1R5LA 3KDPA 3B9BA 2NYUA 2Y1OA 4YONB 3KCNA 3KOYA 1FQJA 1I2AA 3QXXA 3PX2A 5B3LA 4JFAA 4QICA 1MDFA 4NXNB 2QMZA 4NEGA 2R1ZA 1UJCA 4S0ZA 1YA8A 1Z8NA 3NH6A 1XZHA 4O63O 1MX3A 1WJGA 4MI6A 4GT1A 4PXAA 4FI3F 4HRVA 2MINB 4YCAA 1UXIA 4AW4A 3JQ7A 1P77A 3L82B 3GT3A 1J33A 3Q15C 3ROMA 3UVEA 2GCGA 1YR2A 2VDPB 1GARA 3LNTA 4RV4A 3C97A 4J1TC 5TS2A 5K6AA 1K6XA 2AI3A 2QQGA 2V59A 4XVRA 4FINA 1EZ4A 3RIMA 5CB8A 1TLLA 4OYYA 4B82A 3SG0A 3TEFA 1OR8A 4LJAA 2GO1A 2JGEA 1Q2XA 3OIVA 5TT1A 1POWA 1DC3A 2IYAA 2Y67A 3OQVA 3O3OB 1N1EA 4EQ6B 2B8TA 1OXMA 4U2EA 3ZY6A 4XCXA 3P2EA 2QRJA 1AN0A 4RTLA 2X1HA 3ZR4B 3AW8A 1VPVA 3T0IA 2NSHA 4G0YA 1UT8A 3MUOA 4BO4A 4NBTA 4UZEA 1RHJA 3AM1A 2GN8A 4ND5A 1PG5A 1RXCA 3ZV6A 2Z9CA 4HC4A 1G2QA 1IB6A 1CRQA 5CA0F 3PJFA 3GFBA 4UNRA 3LH5A 4ALKA 2XMGA 1IE3A 1CR0A 2NQTA 1FNDA 4PZCA 4L50A 5KVCA 1GCUA 4KIWA 1M2VB 1GRVA 2V8BA 4HHEA 1MENA 3MAGA 3HPRA 1D7OA 3R7AA 2GYYA 3AQIA 3HP7A 4RK6A 4JI4B 4CTNA 3PNVA 3OZBA 4XDGA 1JH8A 4O29A 3MGCA 2OWDA 2QW1A 4YECA 5T41A 5C8YB 4BYGA 4ZI3A 4UZFA 4HEJA 3UMGA 3UCXA 4F7DA 2DERA 1BZYA 2OD9A 1U31A 4LVUA 1HNNA 3PL1A 3DGEC 2WFLA 3IVRA 1PRYA 2G28A 1U5AA 3KP1A 2GD1O 3WRXA 5UKDA 2DAPA 1ISPA 3EOAI 2AOTA 5E8JA 3EPKA 1RD4A 1VB3A 4UDOA 1B15A 5LZ8A 4Q93A 4CM9A 3RKRA 1TT7A 3P7MA 3RIGA 3CG0A 2NO7A 1S2LA 3P9CA 4JJEA 3NIGB 4PO1A 2Y66A 5TQVA 3I8XA 5LKRA 5GAJA 3L4EA 4YXWD 3V1MA 1BH2A 1BVYF 1DLJA 4OP3A 4ZVNA 5JPIA 2C7QA 1IXRC 3S68A 5TVKA 5KO3A 1E2JA 4J1SA 2R6FA 4N3GA 2A92A 2JFUA 5HILA 1PJBA 3F7OA 1OXXK 1JSXA 3HL0A 4I66A 1X7ZA 4FFDA 1AO3A 3EJWA 4RBNA 3QVSA 3T95A 4DM7A 5DN9A 3WKBA 1OIWA 1XQ1A 1NN3A 5TPWB 3D7SA 3DC7A 4UUQA 2QMOA 1TADA 5BNZA 2B2CA 5I9MA 4XPIA 2Q1XA 1E6LA 1ZMOA 5CFRA 4ZO9A 5AJZA 3D3QA 2ZUEA 2DFTA 3M6VA 1JHQA 2VUSA 4QLBA 2WK1A 3LTNC 4W1RA 3ORYA 2JIQA 3SZMA 4KWEA 1ID1A 4EA8A 4AKGA 1QX3A 3GRCA 1H23A 1ZI9A 3TSOA 4RPKA 3LY9A 1Y7TA 3RLIA 5EJ6A 2VJKA 4ASUA 4X66M 4BNVA 5DPMA 4HPXB 5HTKA 1LPAB 4LNHA 1QG0A 3V97A 4NNOA 3A04A 3U1BA 4KQGA 2G0AA 2DQZA 4CU5A 1DRJA 2QR2A 1O9GA 1VPLA 4UTXA 3TGPA 2GZ1A 2C61A 4K0RA 2O1EA 2OR3A 1HNZB 4UHJA 5JSQA 3MW8A 4MGZR 1XQ6A 5I8PA 2PMWB 2JGAA 2REXB 3AOEC 2AXNA 2KNAA 1SXGA 4WA8A 1W44A 4BGDA 2ZPAA 5HSGA 2QN3A 16PKA 5H81A 1CS4C 1EP2B 1VEGA 4MPPA 2G9QA 3AJIB 1AV7A 1YKFA 3EVAA 4P4LA 2C9CA 1U3DA 4NDNE 3QENA 5FTWA 4OK6A 1DJNA 4MHTA 1DTWB 3BMCB 4UEOA 4LC0A 5ILGA 5FOUA 5BWOA 2O52A 3O94A 4CBVA 2QRUA 5CFNA 1IXZA 3GVHA 4XX0B 5BNTA 2VJPA 4KMMA 1Z0UA 3QK7A 3JYOA 4HNRA 2W82A 2BUAA 1K8ZB 5KOJA 1R8JA 1H0HA 2IU6A 2E4AA 1JQLB 3F5MA 1RWVA 1SBQA 3H9JA 4WCFC 3CWQA 3V3KA 3PUZA 2HGZA 4LG1A 4ENTA 4FS3A 4NXNM 1VG9B 3GD5A 1VJTA 4ZU3A 3RLFA 5JAOA 3KQMA 4OOEA 4R8MA 2XQGA 3N2GB 2Z30A 3DPUA 4V3BA 4XYMA 1PZGA 2WTNA 3PCRB 4YDQA 5ALYA 3QNMA 1BOOA 2DFPA 2OKGA 4G86A 2G6TA 1RAAA 2H9AA 3KLOA 1DXOA 2D5AA 2PHZA 3CN9A 2YWHA 2WVHA 3G0HA 2YOHA 4LHYA 1EX6A 3CRVA 2G09A 2A9JA 4C06A 1P80A 3C3XA 2DKFA 2ZUBA 2GKSA 4MVJE 3V7UA 2EX1A 4GEGA 5E4FA 4B17A 4IUDS 3A25A 2P2NA 1Z5OA 3H5NA 4HBGA 4JIMA 2QTGA 3KKQA 2VS1A 4Z86A 4D9FA 1XVVA 1VI6A 3RM3A 3N74A 3B2EA 4CFYA 2G6BA 1CS0B 2IHTA 3I76A 4EI2A 3OF2A 3AR5A 5F7JA 1YFJA 3BHMA 5HWSA 1RI1A 1NHWC 1II8A 5A7FA 4I08A 2HUNA 1MB9A 3F6PA 1H1DA 1NVVR 3R3WA 3CPSA 3A7EA 4O5AA 5CDSA 3AB3A 3KB2A 3QVVA 3JW8A 3GWZA 4G97A 4DR4M 2FF7A 3EIHA 3WAGA 1NR1A 4QARA 2Q6TA 4RESA 4B7AA 1A69A 3ND6A 3MQ2A 1Y9EA 1AIPA 3RH0A 2QNIA 4H7IA 1R4GA 4JI4M 3AFIA 4WZAB 2Q2QA 5AM2A 1T5OA 4R2XA 1OYOA 1U0NA 5CRIA 3LMMA 1ODIA 4I55B 1NO1A 1LI7A 1Z2DA 4GG1A 2IIQA 3I3OA 3OTGA 3QELA 3BHNA 5CIWA 1NZDA 2QM7A 1RXIA 4KI0A 2XZDA 5E6RB 1XDDA 5F5LA 4KN9S 4WRRA 2EHDA 2FAXA 3F9RA 3FUCA 4MJ7A 1X1QA 3BIJA 5AQEA 3BD9A 1E2MA 1Y5IA 3E3LA 2E4WA 1OOEA 2FI1A 4GMQA 2AMYA 3I1YA 3FJ1A 1NNSA 5F5XA 4BVKA 4GI7A 2BHTA 3LPDA 2F5OA 3E46A 2BI8A 3DZBA 4U7JA 1YZFA 3LWBA 5AJYA 4AMZA 3SZRA 2ZBUA 3R3YA 1KSFX 1XHLA 4NCKA 3WLRA 5E26A 2CFTA 3KOWA 4LGVA 3CF2A 2MYUA 5DZSA 1IOZA 1WTCA 1AK1A 1YL5A 3QTLA 2R6GA 4LOAA 3HY5A 2JBAA 4ER7A 1NRXA 1NYQA 2B3DA 4LTNA 1OFIA 2VJDA 2ZS8A 3L6RA 1MABB 4QJBA 2FWMX 1E7YA 2L0XA 3OEHA 5KCZA 1EK0A 3F8WA 1HQYE 4ER0A 3RK4A 3K2BA 2BH9A 1GXSA 1ONBA 2I2CA 1EFTA 1L4EA 3NDJA 3RVPA 3KJGA 1WBJB 1X1CA 3MB8A 4BMCA 3BILA 3VHRA 2JIMA 2WUDA 5L7WA 5EP1A 1QKKA 4QOFA 1ICEA 4ZMBA 1P4JA 1LGYA 5AM1A 2F1IA 3QW4B 4O3FA 1O89A 5LR6A 4P4TA 2OKCA 3R7BA 4XFKA 4QWMA 1F5SA 3EDCA 4G26A 1GDHA 3GFFA 1ODJA 2BZ1A 3K09A 4PONA 3L01A 4J1QA 3RI3A 2HYDA 3AHJA 4TS4A 4N40A 3Q88A 2D6FA 3TAXA 5KYVA 5J47A 4PIMA 4BLUA 1A9XB 4PC1A 5BRAA 1Q7BA 2VNAA 1PQ4A 5EVCA 2CNDA 4Y1GA 4R9VA 1GUBA 3QQPA 4CM8A 3H6KA 2W2MA 4ZHQA 4TWZA 1E4YA 3FUVA 5JADA 4I8IA 5G4KB 3SKYA 2ATVA 2QG4A 2JJQA 2AJCA 5AM0A 1G8YA 3EQ7A 2BGUA 1V33A 1KJJA 1M1ZA 2YYSA 1HG0A 3GVIA 4QHSA 3RJTA 3SJUA 5C1BA 2N3ZA 1A4IA 3C98A 3VGJA 3PC3A 4RE5A 3RE8A 3B6IA 2JCVA 3R6DA 4ND4A 5CVVA 1VKNA 3VKUA 1U1DA 4PPNA 4DLUA 1Y48E 3TSYA 1YQGA 3BL6A 3RHTA 5CBPA 2PY6A 2BKUA 4PPYA 5HKLA 3DS8A 3NBZC 4MUNA 2ZAMA 3PYXA 1U5CA 3K31A 4RHYA 1ONNA 3WLFA 4MCHA 4CKZA 3VYSB 1AQUA 4OQLA 3ILXA 2WA1A 4CTMA 4RACA 3RF6A 3BXGA 4TL9A 4ENPA 3P96A 1AUPA 2JC3A 1QF9A 4JC4A 2ZI9A 4UNSA 2DFLA 4QXQA 3FHLA 2FWAA 1YO6A 4TUYF 1MQ9A 1F0YA 2P7IA 2GFHA 3VC7A 2CVZA 4C6RA 3CUEF 3M83A 2IZ5A 3EIEA 1WCYA 3EBPA 3I9NA 1B0ZA 1TUBA 1TNDA 3SDBA 2VF5X 1J42A 3GA0A 3OCWA 2C8KA 1ST2A 2HK6A 3RRBA 3RABA 1HMPA 3EH2A 3L7YA 1ZUD1 1UPCA