3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
2ZZMA 3SSOA 2B9EA 5K0GA 4OQEA 4C08A 2PT9A 3JWGA 4E32A 4L7VA 3E7PA 2OKCA 2YX1A 1F38A 3LDGA 2G72A 4PGGA 2IFTA 4HSGA 4E2ZA 4AUKA 1KPIA 3BWCA 1O54A 1G55A 2GLUA 4EKGA 4AX8A 5GOZA 5GM2A 5EEGA 3FUTA 2ZLBA 3MQ2A 3OU7A 3EVBA 1YFJA 3UJ9A 3BWMA 4Y30A 5HZMA 5KS2A 1RJDA 3B7PA 5DT2A 2XYVA 2WA1A 4LWOA 5EKXA 4CKCA 5K01A 3GRYA 1JG3A 5FA8A 1Q0SA 4GOMD 5DXAA 1QYRA 1BKYA 1RI5A 4GOND 4E70A 4RTMA 1XJ5A 2PSSA 3T0IA 10MHA 1DCTA 3RIEA 3HM2A 3ER9A 4FP9A 3ID6C 2FK7A 4IKPA 1ZKDA 2GH1A 2AZTA 5E9JA 4BLWA 3G8AA 5GIPE 2FPOA 3FTDA 3P2IA 3C0KA 1P91A 4RV9A 1YZHA 3PX2A 3RODA 4PCAA 2IH2A 3HA3A 2GAFA 5FHQA 3V97A 3M6WA 2VDWA 2V7EA 2PKWA 4FT4A 3TFWA 1DL5A 5DSXA 1EJ6A 3LCVB 2ZBQA 3C3PA 3G2OA 3P2EA 3P2KA 3LX6A 4KRGA 2ONYA 2AVNA 5EHGA 2C7QA 1YZ3A 3BWYA 3CVOA 2N47A 4KDRA 2OXTA 5DM2A 3CCFA 1FP1D 5M5BA 4EMSA 3BT7A 1RJEA 4IV8A 1SKMA 3KQOA 3K6RA 3QOWA 3THSA 4XUEA 4C04A 4YV1A 3DH0A 5EC8A 5HIKA 1MHTA 2QY6A 3BXOA 1JTEA 5BP7A 5LQUA 4DMGA 1D2CA 4RTPA 5CVEA 1VP3A 3D2LA 5LQCA 3HCAA 5E9QA 1XCJA 3MCZA 3O7WA 4FR0A 5E8JA 4CTKA 1M6YA 1X1BA 5K0JA 4RTRA 2P3QA 3GWZA 1WZNA 5ERGB 4FGZA 4MQ4A 5CVUA 3MGGA 4BP1A 4RVFA 4C03A 3KR1A 4PONA 4PYJA 4NECA 4KDCA 2UYHA 4HGZA 4RX1A 2PV0A 3B3FA 5K8VA 5DLYA 2IP2A 3OE4A 4CKBA 1G8AA 1XDUA 2AOTA 2O57A 3KU1A 2BM9A 2ZBPA 1G60A 2FRXA 3KQVA 3M6VA 3PFGA 5IKMA 2IBSA 3KPUA 5P8WA 3HP7A 3PFHA 3M6UA 5F2NA 1Z3CA 1G38A 3FZGA 5LQAA 1ZG3A 2HWKA 2ZSUA 3BKXA 1L3IA 2GS9A 4ZTBA 4KWCA 3TM4A 3LL7A 1SQFA 3MB5A 5K0LA 4YUXA 2AS0A 3DXZA 5BW5A 1JSXA 2V74B 3OU6A 4P7KA 3C6KA 4H0NA 2ZULA 3HCBA 2AN5A 5BW4A 3KQMA 1JQDA 4IV0A 3F4KA 2IH4A 1RJFA 1FP2A 2YR0A 3C6MA 3M70A 4YUYA 2YVLA 4CTJA 1UWVA 4DKJA 1AV6A 4PINA 1Y8CA 4G56A 4PCLA 3EVFA 5T67A 3MTIA 2HMYB 2OPBA 3G5TA 3KR2A 4GQBA 2OY0A 3ELUA 1KP9A 1XCLA 1VQ1A 2YXLA 3S68A 1IXKA 2HNKA 3P8ZA 3FRIA 5DM4A 4WVLA 1P1CA 2ERCA 1L1EA 2GPYA 3KQSA 2YUIA 3M33A 5K0NA 1ZGJA 3HNRA 3TMAA 4U7PB 3TM5A 1P1BA 4RTJA 5EMLA 1SVUA 1TW3A 3EVAA 3PVCA 3T7RA 1X1DA 4PIPA 5KVAA 1YF3A 4QQKA 1L3BA 2IDKA 2QRVA 1NV8A 3I58A 5HOQA 2CMGA 2F8LA 2PLWA 3LHDA 3OFKA 1I4WA 3KQWA 2AOTB 1N2XA 3A25A 4RTKA 3MHTA 8MHTA 1WY7A 3ANXA 1VE3A 3EVGA 7MHTA 5E1OA 2IPXA 5ICFA 2PY6A 4PYLA 4E2XA 1EIZA 2AOWA 2ZWAA 4FSXA 5FWDA 4X60A 1EJ0A 4OA5A 2XVMA 5CCBA 2PBFA 3QOXA 5B1SA 2CL5A 4PYNA 3NJRA 1KYWA 5E1DA 4A6DA 3G5LA 3E23A 4YUWA 3ER8A 3UJ7A 1NW8A 3OFJA 1TPYA 4GUAA 3FTCA 3FUVA 1SQGA 3LKZA 3MAGA 4AZVA 3FUXA 2B3TA 4E2WA 2YXEA 2PWYA 2XYQA 4LG1A 5DTMA 3FPHA 3KQQA 4HTFB 2UYCA 2UYOA 4OBXA 4PIMA 4BY9E 2OZVA 3KR9A 3ME5A 4YUVA 2Z6QA 5FHRA 5EMKA 3DOUA 3E8SA 3HVKA 1EAMA 3AY0A 4WXHA 5DRYA 5EZSA 5C9ZA 4E33A 4EVIA 2XVAA 1EQAA 2NYUA 2OBFA 2QYOA 5JUWA 1ZQ9A 1JSZA 5IH3A 1RI4A 5K03A 5DRTA 5KQRA 3UJDA 1JR4A 3MCTA 3SR4A 2ZZNA 4PYQA 5DSTA 3FPFA 2P7IA 3UBTA 2ADMA 1QAMA 4QQNA 1JQEA 1DUSA 3G7UA 4MTLA 3BWBA 4M7RA 3BKWA 2JJQA 4QPPA 3NVKI 5HEKA 4MIKA 1M6EX 2O0LA 2G71A 3AXTA 4HH4A 2JHPA 3P9NA 2OB1A 3GJYA 1YUBA 3UJCA 1U2ZA 3V8VA 5CVVA 3CKKA 1AF7A 2IGTA 3R24A 5EVJA 5BXYA 2JG3A 4GC5A 2ZIGA 1AQIA 2EG5A 1OR8A 4DCGA 5CUQA 3CJRA 3LPMA 2FHPA 1RI3A 3GGDA 3LBFA 3GNLA 3UFBA 4ER3A 1XTPA 5EHIA 1NBHA 3TRKA 1NV9A 4HG2A 4ER5A 4KVZA 2BH2A 2XBMA 3EEYA 3BGVA 5CM2Z 5E2BA 2ONZA 3GIWA 3EVCA 3ELWA 3TPZA 1T43A 1VP9A 3DUWA 2AN3A 3HCDA 3P9CA 5EPEA 5FQOA 3UJAA 5LQRA 2Y1WA 5DTQA 5EIFA 5FA5A 1L9KA 2QE6A 2NXCA 1R00A 4F86A 3EGEA 5T64A 4CXMA 5D1HA 5DX0A 1ZHFA 5LR6A 3IV6A 5LSAA 2Y1XA 3ERCA 5KYGA 3NWEA 4Z2YA 3LBYA 2P3OA 4RTLA 4F84A 5EQJB 4RTQA 1RI2A 3LCUA 2K4MA 4PYKA 2ZZKA 2FCAA 3SSMA 3KR0A 3EVZA 3DMHA 1NKVA 4HGYA 4A6EA 1ZGAA 3JWJA 2PX4A 3HCFA 5FQNA 3QV2A 3IYLW 2B25A 3DXXA 3G2MA 4P7FA 2OYRA 3VC2A 2Z6UA 3NDJA 1P39A 1MJFA 2DULA 1N7IA 1JQ3A 3DMFA 4M37A 3LDUA 4RVGA 2BR3A 1JG1A 3SGLA 2DPMA 3I64A 3DR5A 4CKEA 1HMYA 4C06A 1UFKA 2ZIFA 1R8XA 5DPMA 4DF3A 3O31A 3FYCA 3UZUA 3OE5A 4OBWA 1KHHA 3DP7A 3LSTA 3SSNA 2H00A 1WG8A 3DLCA 1EG2A 1JG4A 2A14A 3CJQA 1INLA 3T7TA 3NWBA 3TKAA 1L3CA 2R3SA 2FYTA 3HCCA 2BM8A 3O4FA 5E8RA 4UOEA 1KIAA 3HVHA 2PX2A 2VDUE 5EGSA 2P3LA 2ZW9A 4XCXA 1VLMA 3GRVA 4GEKA 3A27A 4V0QA 1VPTA 4P58A 2Q41A 3U81A 3AWIA 1KR5A 3BUSA 3DLIA 3LECA 3JWIA 3PB3A 4M36A 5D1NA 4EKIA 1SG9A 2NNWB 3CJTA 2G1PA 3JWHA 3B5IA 2NXJA 2ZFUA 5FCDA 3OU2A 2AR0A 2BZGA 3LKDA 3HCEA 4GOOD 5E1BA 4K6MA 3PS9A 4R6WA 5DM1A 5DX1A 4DZRA 1FBNA 3E05A 5HFJA 2AOXA 3M4XA 3Q87B 5K05A 1RI1A 2B2CA 2QRVB 3EGIA 2VZ9A 4PWYA 4RYLA 2KW5A 3WSTA 9MHTA 5EKUA 5HIJA 3CC8A 3FPGA 3GDHA 3P9KA 1NBIA 3DTNA 5FADA 3GO4A 1VIDA 4X41A 3PT9A 3SX0A 3TKYA 1XDZA 2OB2A 2JHCA 5K0CA 1YFLA 4YV0A 3EGVA 2YTZA 2P41A 3GCZA 3BGDA 3CGGA 5EG5A 2IH5A 3SM3A 1TW2A 3A26A 4EK9A 3FUUA 4ATNA 2ORED 4BP3A 3HVIA 2EX4A 3FPEA 2PJDA 4FT2A 5EOVA 3DMGA 1M0EA 3SVZA 2CKDA 2PVCA 2JH9A 3G89A 1D2GA 4X61A 5CVDA 4OQDA 2NXNA 3FTEA 3HA5A 4ISCA 2CMHA 3R0QA 4E31A 3HTXA 2NP7A 2BR4A 2H1RA 3I9FA 1XVAA 3VC1A 2ZWVA 4MWZA 1BC5A 3KPYA 1ORHA 3EMDA 5ICCA 1R18A 3EVDA 3TQSA 4R05A 3CBGA 2O06A 1SUIA 3ORHA 4O29A 3P97A 2EFJA 3NDIA 5DWQA 4HC4A 3RW9A 4P7JA 3KQYA 3VSEA 4F85A 4P7GA 3NMUF 2EJTA 2LD4A 3NTVA 2PXAA 3FUWA 3G2PA 4GBED 3PLAE 3R6TA 1X19A 4DQ0A 2O07A 5MHTA 4GC9A 2GA9A 1NE2A 3HEMA 1B42A 3LGAA 4PYOA 4BLUA 2JHAA 1I9GA 3FTFA 2IIPA 3IEIA 4HRAA 4POOA 1G8SA 2PGXA 4R6XA 4YUZA 2C7OA 2P40A 4LWPA 4FSDA 3UWPA 5GM1A 4YMHA 2G70A 3FRHA 3KPWA 1H1DA 1VBFA 4XUCA 2B78A 3EPPA 2OO3A 1O9HA 3KPVA 4GOLD 4U7TB 5K09A 1BOOA 3C3YA 4QTTB 4RWZA 4HTFA 1O9GA 4GF5A 4YMGA 3BZBA 2PX5A 4PGHA 3A4TA 1F3LA 1WXWA 3P71T 1NW3A 5ICGA 4IWNA 4OA8A 5C1IA 4B17A 1RJGA 2E5WA 3EMBA 4QVGA 5FWAA 4RSRA 1HNNA 3FYDA 5CIYA 1FPQA 5GP1A 4QPNA 4EQZA 1YB2A 4RTNA 5DXJA 3NVMB 5DX8A 1WXXA 5ICEA 1X1CA 1N7JA 2VP3A 3DXYA 4QVKA 4AZWA 2I9KA 3PX3A 2PWPA 1NW5A 3I5UA 3MERA 5FULA 3TLJA 5K0FA 5LQNA 2UZ4A 4PYMA 3MTEA 2VDVE 3GRRA 3G88A 4JXJA 5CD1A 1JTFA 2AOVA 3SXJA 3B3JA 1AQJA 2WK1A 2YXDA 3FPJA 4X63A 3PTAA 2AVDA 3TR6A 2XYRA 1X1AA 2ESRA 2ZBRA 3ELDA 3KKZA 1Q0TA 3GXOA 2HR1A 2ZIEA 4XUDA 4DM3A 4OX9Y 4V0RA 2VS1A 4RTOA 4FS8A 5EMMA 5F2KA 3THRA 3SMQA 3AXSA 5E9WA 1PRYA 3UJ8A 4X1OA 1SUSA 1I1NA 2HV9A 3T7SA 3UJBA 3A7DA 3I53A 5F2OA 3H2BA 4C07A 3LDFA 2ZVJA 5E1MA 3OZRA 4KW7A 5HIMA 5GINE 5C0OE 2FK8A 2GB4A 3HVJA 4YV2A 2I6GA 4MHTA 3B3GA 3OZTA 5K0EA 2BR5A 1QZZA 3R3HA 5EIWA 4Y2HA 4C05A 1KPGA 1R6AA 1ORIA 1IM8A 1R8YA 1BHJA 5DM0A 4ER6A 3BGIA 3OPNA 3P9IA 2HTEA 2P7HA 3KHKA 4RVDA 5FUBA 5KQSA 5FTWA 3L8DA 2JH8A 3G2QA 5EZQA 2P1DA 4E30A 1QAOA 4R8SA 3LCCA 3KQTA 5E2AA 3UA4A 2ZTHA 1QANA 3K0BA 2Z6AA 5U4XA 4R8RA 3B89A 4QTUB 4QDKA 4BLVA 2WA2A 3REOA 1D2HA 4CWAA 5K0BA 3OCJA 4FZVA 2EJUA 1KPHA 3Q7EA 2C7RA 2UYQA 4DCMA 5DTRA 4RVHA 4QDJA 1NW7A 3ELYA 3GRUA 2AOUB 1R74A 2CWWA 2G8NA 4KIFA 5HIIA 2P35A 5LQKA 4AZSA 3VYWA 3DULA 4AZTA 3EEOA 1NW6A 3KPJA 1XDSA 1KYZA 1G6Q1 5EEHA 5LQJA 1NT2A 3R9XB 2C7PA 3TOSA 1VL5A 4C4AA 2IDJA 5HILA 2O05A 2R6ZA 5G02A 5JR3A 4ER0A 4E2YA 3UA3A 4PNEA 1WS6A 4M38A 4DA4A 3GU3A 3M6XA 2P8JA 1FJXA 3KQPA 3G8BA 3NW9A 2QM3A 5H02A 3UJ6A 2AOUA 4PYIA 2H11A 5CCXA 2PXCA 2PX8A 3AJDA 1IY9A 1KXZA 2ZCJA 2AN4A 5T6BA 2NXEA 1QAQA 4KIGA 5GIOE 1XXLA 2YQZA 3EVEA 5EMJA 1JG2A 2I7CA 2IBTA 2PT6A 3A7EA 1V39A 4RTSA 3GRZA 5GWXA 2NP6A 2I62A 1PJZA 2PXXA 3OZSA 3HA7A 4LECA 5CVJA 4ER7A 3X0DA 1UIRA 3IHTA
chains in the Genus database with same CATH superfamily
2X4GA 1VE5A 1W36D 4G0QA 2AI1A 4OQEA 1T8YA 3BIJA 4E32A 4GGMX 3SBEA 4ZV4A 2BGTA 1PLKA 1W5SA 3AV0A 1Z08A 3UUEA 3V6LA 1TT5B 4JEUA 4DIKA 1VTKA 1HFEL 3LT0A 4QGBA 4C6RA 5FYQA 1KPIA 3PGMA 4DG5A 4Q7LA 3TW8B 1HYGA 3CF4G 4EKGA 3HJSA 2FW8A 4X90A 3R3YA 1MG0A 3ACDA 4UN2B 3D6VA 5KOIA 1YFJA 4PS1A 3ZWBA 3R77A 4EMTA 4BQOA 2ECKA 4JY7A 3MWKA 1Q1BA 1NXPA 4W63A 2EX0A 5DT2A 2F62A 2BRUA 2FLWA 4ZODA 5DWVA 5IARA 3REFA 3RVDA 2DR2A 1A4RA 3O91A 1ZAKA 4PTYA 5CFOA 5KOHA 3UK6A 2ZJBA 2BUBA 3V48A 4LGMA 1GFSA 3GVPA 5LJIA 2JCSA 3A1UA 1P0FA 2PUDA 4DQXA 4GPEA 5FYDA 1TDJA 5E9JA 1ZKDA 1D6SA 2HA6A 4M3NA 2I9PA 5HMMA 4ZEVA 5AQ1A 4ENPA 2OSBA 2JK0A 2XNDA 3BICA 4B2IA 4NLLA 4L8YA 4CF3A 1ODLA 5AM1A 1TD1A 3GCDA 3P0FA 1WTCA 5COAA 4DW8A 5DLQC 1PR1A 1SHLA 1W1WA 4LF6B 2OVBA 2V7EA 2PKWA 2VP6A 3U6KA 2NO6A 3W0LB 1XPUA 1MW9X 3MD0A 4UUQA 5C7LO 2JIQA 1EJ6A 5EFZA 2H1FA 2ZBQA 3I2GA 3T8YA 1JX6A 3ZY3A 1M5UA 2P9YA 5ARCA 3OEHA 5DO9A 1TUGA 2N47A 2ZTVA 4GR5A 1TNDA 1E6KA 1DJPA 5JNUA 4YXWA 2CKMA 4JA2A 3WNCA 3QOWA 4HK4A 2JHGA 1CUXA 3EGCA 5BN5B 3V42A 4RJKA 1E2EA 4MUNA 4UCWA 1AUQA 2RBGA 1KMHB 3Q10A 4UEJA 3D2LA 4URYR 1LRLA 2OQ4A 2ZUCA 3AJ8A 1SBTA 3BD7A 4IDHA 5FFFA 1C0IA 3WMEA 4EA7A 5COQA 5CBKA 3BD9A 3MGGA 4UZEA 5B3AA 5BQPA 3WZLA 2EBUA 1KK1A 2JJ8A 1RLMA 3B20A 4P2GA 3B3QA 4NZ9A 4DKXA 1BE1A 3KU1A 3U40A 2HYIC 2JFVA 1N3IA 2N3ZA 2WB2A 2D7HA 3C3KA 3L04A 5H83A 4C2BA 2E4AA 5KTKA 2XMPA 1P75A 2LVAA 2OQIA 2X8JB 1G38A 2R68A 3GEDA 3DLPX 5EY5B 4FSHA 3SX2A 3OZEA 3NNDA 3TM4A 5KAMA 3FMGA 3CH6A 2HSGA 2V74B 1ECPA 1BEEA 1C8LA 2ZULA 4LCJA 1UM8A 1EHIA 3INYA 1ZIOA 3C5WP 3FNIA 3L7DA 1PGNA 4DNPA 5JJBA 4DEXA 1HSZA 3SYMA 3GLIA 1F4LA 1NVDA 1Z12A 2KMLA 3ESXA 5DGXA 2TMDA 3TLXA 1TYCA 1DEKA 4JI6M 4J2TA 4PCLA 3VR1A 3RFWA 5EKTA 3QQ5A 2H7YA 2B7LA 2DNAA 1L8AA 2G28A 2NADA 2VK2A 3WWZA 4DZTA 4ANRA 2CL6X 2RHWA 3HP1A 3Q6MA 2YXLA 4JKYA 4KGXA 1YTLA 4F2GA 4LFBM 1NVMB 3LUCA 1T0PA 4FZJA 3NT2A 1G8GA 2C3PA 5HGXA 3KKMA 4I8DA 3FRIA 5JAPA 1MFPA 3L6CA 4IG4A 4FVTA 4RCYA 4TYWA 2OCBA 4O1HA 2YUIA 3LUGA 3OT1B 4Q21A 1LLDA 2O4CA 4U7PB 4Z5XA 1VGVA 1OGYA 2FFJA 2IOFA 2JGFA 2QTVA 3QBDA 4EJFA 4DTCA 4YUAA 5CB6A 4IJWA 2V9PA 4EABA 2Q5OA 4DOMA 3CVXA 2JLYA 1CNMA 1T6ZA 3GRKA 1XTRA 4R84A 4NJMA 4LF9B 3T3OA 2YZNA 4EO7A 1LLUA 3EVGA 4IW3B 5BWCA 3OSUA 3P9QA 4KPGA 5JZVA 7MHTA 2WD7A 2ZTDA 2PH3A 3KJQA 5TDHA 4TKMA 5AUNB 1RWKA 2R44A 1T5HX 1US8B 2AOWA 2MROB 3DG9A 2O7SA 5DGHA 4B3XA 3V4SA 2HU2A 1MJ5A 5B6JA 2W42A 3ICPA 4JLJA 4HXGA 3F67A 4D0NA 2YV2A 2O7NA 1TPYA 2WG1A 3UMCA 4WI1A 2RH9B 3TRFA 4E2WA 3FTCA 3DDHA 2VQSA 1MKYA 2LNHC 4Q66C 1LSUA 1VJCA 3F5MA 4AJKA 4ETMA 3WYEA 3MOIA 3KUXA 1OWPA 1I7NA 1TTTA 2IIBA 3BSFA 4M0CA 4MLPA 4KI7A 1Y34E 3RGPA 3AU9A 3TIIA 3VNUA 3MMXA 1Z34A 3CZCA 1KY4A 4NF2A 5C9ZA 3DW3X 3LLSA 3UWDA 1VPDA 2XVAA 3HCNA 2X0JA 1P45A 3IAEA 3UW1A 621PA 3VVCA 3PYXA 4AZ3A 2YVAA 2VDKB 4WKBA 2VH1A 5U4QA 5IF3A 1H1TA 2G3YA 4FWGA 1I7SB 4L3OA 3IXLA 2VUSA 2VSFA 1XTBA 2AL7A 3JQAB 3PUYA 4I9GA 2YASA 4PN3A 2ZRFA 3HEBA 2QUJA 1NQUA 3DOJA 4G85A 4URVR 2X1LA 5TF0A 4BMDA 3FUCA 4FE3A 2EVWX 2Q6VA 1KARA 2Y0EA 3BFXA 3NHRA 2KSQA 1G3QA 2F48A 2C4UA 3O2JA 1OT5A 2B61A 3B7NA 5CW2A 3P9NA 4UREA 3I2KA 4ZVKA 4GKJB 2C2MA 3QV1A 1AXRA 3MIIA 1GL6A 2C5RA 2C2KA 4Q4DA 3AVWA 3RSQA 4DJFC 4HPWA 3OZUA 1EDOA 5A4JA 5ITWA 1SXJC 2EG5A 2C82A 2ZUTA 5EWJB 1OKKA 2DBZA 4QGGA 5F33A 2XBMA 1U0GA 1JLRA 2AEEA 4FSDA 4G81A 2O2XA 3CONA 2DUNA 3NP9A 3AR5A 2BE9A 4ML3A 5IXSA 2O2SA 5FPHA 5TMDA 5JJKA 2YL2A 1Q7TA 3NTLA 4BHTA 2X4IA 5DTQA 3HADA 3OT1A 1JEOA 4KXWA 4OJNA 2NXCA 2ZSDA 4LJYA 4OP1A 5FA5A 1O8BA 2QBYA 2JY8A 1HTWA 2OGTA 4D74A 4JGIA 4LC0A 1FRZA 3N7AA 4TL8A 5M34A 3QNUA 5KNLA 1OAAA 3FSGD 1Y6JA 3VQTA 3KFLA 1GGEA 3HU1A 1K1EA 1T5TA 2PZMA 1KO4A 1CJSA 4CFSA 1D4AA 2ZR7A 5FBWB 1T0HB 1WGNA 2HHLA 2XE4A 1C7JA 2D1QA 4WCFA 2GBLA 1HDXA 4IZIA 2HO5A 4PYKA 4EWLA 2BFOA 4UHFA 3GUUA 1OV6A 5DGCA 1J6UA 2GCEA 2IY9A 1R0WA 3H42B 3DMHA 2QTWB 3JD0A 1Y5RA 3A4IA 1THTA 1TYZA 1XL0A 4TTRA 1CULC 4CQLA 2NU8B 3W5CA 1ZUNB 3M3HA 3ZQKA 3BTUA 2GJ9A 5JAIA 3KM0A 2R65A 1WOYA 1Z8FA 3VKFA 2CGEA 4HNRA 1W44A 2OYRA 3SS8A 1T3GA 1Z0ZA 1JHMA 6Q21A 4G01B 4KFTA 1LBIA 2BMEA 5DW3A 4OI4A 4B6EA 2A0UA 3ORRA 1SCUA 5K8UA 3D7RA 5KSZA 3EX7C 3I61A 2ECFA 5EZYF 3NLLA 4KEAA 1IHOA 4DREA 1S9HA 3UUGA 2SICE 3LZCA 1J25A 5CLLA 1JXAA 5IBPA 5JZBA 3OE5A 3OJXA 2CUTA 4KQEA 3ZHUA 4K0RA 3RABA 1N5IA 2HU7A 3OZAA 2W6PA 5DMXA 3ADKA 3RU7A 4ARSA 1KYVA 5T3UA 4BLOA 4EY4A 4D4GA 4NJEB 4M9ZA 4EVRA 4KO2S 5CH8A 5FL7D 1MT0A 2VCEA 2KE5A 1TK2A 4L3WA 3MTJA 1Z2PX 3F3YA 2V6ZM 3SJZA 4TMVA 3A27A 3NIBA 4Q24A 5KNBH 1VPTA 1ZK2A 2FFQA 3ZEAA 4C0QC 2IQIA 4L4YA 1QX4A 2OBNA 2Y71A 5DI3B 5KNBD 1SG9A 1H8HD 5KREA 2H2DA 5H7XA 5T8KC 3VMMA 2Y1CA 2KLHA 3I01M 1P7CA 4DWJA 3DMNA 4KV9A 3WGZA 4JR0A 4CHTB 1ZUD1 4EGQA 4WN3A 1USWA 5E1BA 1TCVA 2VN8A 3L8ZA 4R1MA 4YPFA 3THGA 1C3XA 3COZA 5F5LA 3E05A 1PKXA 2AOXA 1G6OA 3RAGA 5FNVA 2VDBB 3TRHA 1U0EA 2GD1O 2ARKA 1OVGA 2B8JA 2ETXA 4MGHA 1Z59A 1RAEA 1RWWA 2YW2A 5AKKA 4G0VA 2DVMA 3AHJA 4WNCA 3FVWA 1E96A 3VO9A 1NMQA 1AUAA 2C8KA 1VIDA 2WSBA 3GO4A 3PF9A 3O73A 1IRIA 2JHCA 2DY0A 2NZ8A 2YBDA 1CT9A 4MKFA 2QXUA 1WE2A 2CWBA 2X58A 3IODA 4DBZA 2HAKA 5C5EA 1AUVA 2Q0XA 2K0BX 3C3AA 1X39A 1Y6FA 3CU5A 1TR8A 1AX9A 1NLMA 2FV8A 3G0IA 5EA2A 1QBGA 5DNYA 1JIQA 2XB4A 5K3SA 5IT4A 1A7AA 2AUNA 4LHZA 5JSZB 3IQZA 4P32A 3OPXA 1QYVA 1W5AA 4G6ZA 2D1FA 3P0RA 4ILKA 1GXSB 4OQDA 5I9TA 2ACEA 4MQEA 4A2CA 4TS1A 2KXEA 1CUUA 1DJLA 1XTUA 2DU8A 3HTXA 2IGBA 1R0KA 2H1IA 4GMHA 3EB9A 3RHFA 2Q1XA 3PUKA 1SAYA 1L4YA 1OV4A 4ANFA 2RGRA 3L02A 5K2MA 3KJEA 2IHKA 4JNKA 1PJ8A 3QNWA 5F5XA 3N0VA 2HJWA 4OOFA 5BT9A 1CR6A 2IEZA 3S70A 2J30A 5EZ6B 2Y1LA 2X42A 3L07A 3QKSB 2IW3A 4RSMA 4P7JA 3VH1A 6REQB 1YT5A 3RYIB 3VO1A 4P7GA 2OFWA 3W6ZA 4B79A 4CMIA 3KZMA 4ZMRA 5CB8A 4M9XA 1HT3A 3F5FA 4N7RA 4BJ6A 2IXBA 5I7OA 1Q1NA 2DSTA 2W6QA 3GJ7A 3KAPA 3O8NA 3JYOA 5JCJD 3JATB 1QIGA 3FTFA 4LRTA 5SYMA 2NVBA 4HRAA 1PE0A 1QV9A 1WB5A 5ITZA 2DH5A 4OHVA 1GO2A 4LWPA 5SY4A 4B4OA 4XQ0A 1UKCA 5SY9A 9GPBA 2TMYA 2KI5A 4ZI7A 4E5VA 4NSRA 4RHTA 4F1KA 1Z0SA 2R5FA 1P7ZA 1A9YA 4FCVA 2B34A 5JZMA 5BQ3A 2MTBA 2C2WA 4M0UA 4XZ3A 4ETNA 1BQ4A 2A8YA 3IUSA 3BDIA 2ASEA 2Y67A 3UGQA 1XMPA 3CUKA 5BV8A 3HJRA 1MUUA 4MWDA 1HLGA 3H2JA 4GF5A 5CVTA 3BZBA 2PX5A 4TSRA 1COWD 3RFFA 3AOEA 2AJ8A 1GZVA 2EEPA 4Q1BA 2LTUA 1KGSA 4R3UC 3IILA 2ORWA 3PFNA 1P9NA 3EAFA 5C1IA 3M8KA 5L3QB 4IBGA 1WDWB 1E6UA 4KNWA 3OZWA 4CR6A 3MLBA 1OTRA 2WIKA 4JMLA 1TDZA 3RBXA 3SFVA 4ZOQI 4HL6A 5ICEA 1R6XA 3KSXA 1KVUA 2QG9A 3PIDA 5M04A 4KPUB 1V9SA 2QVYX 3GPIA 5DN9A 3IQXA 1U6IA 4BNDA 2WC1A 1JAZA 2FH0A 3I4VA 5I7WA 1LH0A 5SICE 1S2DA 2O14A 2QSFX 1B41A 3IELA 1AQJA 4NXMB 5AP9A 1XVVA 3TX6A 2JNHA 1VKJA 1IDN1 3F1KA 3G1TA 4F4DA 1QSGA 3WLFA 4AG3A 1UZLA 2R47A 4FS8A 3RG2A 3SHWA 3VRHA 2LCFA 2OHOA 1SU6A 3F6PA 5C8YA 2HV9A 1TA4A 4P83A 2O8EA 3FAZA 2HWJA 3VH3A 5HIMA 2O01F 2AD5A 1F5NA 1EMDA 3HKBB 4F38A 1O0CA 3J2PB 2XNHA 5ALEA 3BH7A 3ZXIA 2II6A 4JLNA 5AKEA 3RANA 3PWKA 4DWWA 5K0TA 1XZPA 4B81A 4F56A 3TQTA 5EIWA 1D1TA 4OKNA 3RARA 1L4BA 2Q4TA 3CIFA 3IXQA 4CF5A 2XUIA 4NZNA 1Y9AA 1MAUA 1YCHA 1XK6A 4BRSA 3SC3A 3UWOA 3RCBA 3E3NA 2DPYA 3R76A 4PRLA 3L8DA 3EHDA 3FTPA 3MUFA 1VMAA 3KQTA 4QTUB 3ZNPA 3U4DA 421PA 2ZRHA 2ODBA 2ZRQA 1XR3A 2LRHA 3GGJA 2QMEA 2OFOA 1M67A 1VYTA 2FN9A 4BWFB 5A5FA 4OVKA 2GZSA 2W2KB 4EKEA 1BXGA 2OHXA 3B1ZA 4IOKA 2VVTA 4R9UC 1XZIA 2GN6A 5FJIA 4FLEA 2OPFA 2C5LA 4NJOA 4QFCA 2G8NA 1XRMA 4AZSA 2E9SA 1LKZA 2GD0A 1R4ZA 2IEBA 3H05A 3RV4A 4JI2B 3CIOA 2OO5C 2H3EA 4C4TA 5FP0A 4BBJA 2G9RA 3K0AB 4C4AA 4MAAA 4EY6A 5AK5A 2PAFA 4PANA 1GPUA 1KJJA 4GOKA 2OA0A 1GZ6A 5FTJA 2OV3A 1BVHA 3A1CA 5AKLA 4RGQA 3STHA 4L5AA 3ADDA 1T1EA 5G40A 4II2A 2I6UA 4KNVA 1NAIA 5KINB 3TEMA 3DOOA 4I9NA 5CH5A 2B4KA 2NXEA 1JJFA 1SGWA 5D2CA 1XYYA 3WRYA 1TMYA 1RXVA 4IF4A 4BAGA 1PJZA 2QAIA 3M3PA 4FGWA 4QPDA 4EHAA 1CETA 2NQ8C 4B0PA 4FMDF 3DM5A 2XWQA 4KYTA 3VYSB 2UZ1B 3U19A 1E66A 4FLFA 3IHTA 1IEVA 2UAGA 4NICA 1YVDA 5JY6A 2I2BA 3V7FA 5AKIA 4BPBA 1MHPA 3EIHA 3FKSA 4FZRA 4LDJA 4WBXC 4CDRA 1FXSA 5ALRA 2XOXA 3WMRA 4IJ5A 2HKJA 3KVYA 5CNJA 1GQFA 3CNQS 1TCBA 4OYYA 1KNXA 1PZEA 3KFUG 3I6ZA 4OAPA 4NRVA 4R83A 4LJ8A 4B33A 1ZESA 1LPNA 2J3IA 1OYWA 1V6CA 2YWXA 4I8IA 3GJZA 4Q6WA 4FWDA 4C0BA 1YOBA 2IDMA 5GV7A 2PKYX 1MQ8B 3WLQA 3QYFA 3NBIA 1FFCA 4JQZA 3T5AA 2NM0A 3B7PA 4UFOA 3U4MA 2JRLA 2XA9A 2GF0A 4NAVA 1M2VA 3MS7A 2P68A 1MC8A 1W2WB 1FU7A 1P5RA 1YCGA 4I1RA 1KOGA 1LF0A 1W8DA 1UJNA 4W6ZA 2PBRA 2RKBA 4GSYA 5TGTA 4U3JA 2ZEJA 3N76A 1OH6A 1SURA 1DCTA 1J8FA 2H4YA 4IQ4A 5KVCA 3DJFA 3F4LA 4RKWA 3GA5A 1RPZA 2CE7A 3ZY6A 4BIMA 3TE6A 1F8YA 1ZN7A 2XDAA 2F9MA 4I5FA 1CUYA 1HE5A 1QE5A 4Y2RA 8LDHA 1T9BA 3IIJA 5IZ7D 3OI7A 5FHQA 1U1FA 1Y9ZA 1W6UA 4NU0A 3TR0A 2O48X 3KSUA 1NUSA 1QRRA 1KP2A 4DJAA 5EKDA 1OXUA 1MJGM 1LBHA 2SBTA 4C4OA 2XNKA 3JZDA 3E4DA 1DGGA 4XJVA 5TV2A 3MWJA 3NHPA 3NBAA 4Q5IA 1A9XA 3EH1A 3FMVA 2BGLA 4PC2A 1UBLS 5AVSA 1M6VB 5EGSA 1BGWA 2G82A 4KN8A 3VR4H 4WCVA 1T9DA 4R01A 1MHTA 1ULBA 2PO7A 1GQYA 2BC9A 3OX3A 5FO1A 5C8XA 3CRNA 5EHZA 2KZUA 1MN3A 4FU0A 1IC6A 4GG1A 4HKTA 2NW6A 4UHKA 5HZKA 5J23A 2X49A 2BGNA 5E8JA 1QHHA 2A6PA 3VNSA 5G4LA 4YXWD 2P3QA 3PTLA 5H1YA 2XYPA 2O1WA 3PFIA 3ZJYA 3K0FB 1RJWA 1ZIDA 1KEUA 1OBOA 4N41A 1FSGA 1JU3A 3BMCA 5ARDA 2AG5A 1MF7A 4I4LA 3B3FA 3MQFA 1TEHA 1M2EA 3AT1A 1I24A 4WKOA 4WFQA 2GYVA 1CQJB 1DS6A 1NBME 5FX2A 2BM9A 3ZWOA 1I4OA 3IDZA 4NNJA 3VU9A 5BN5A 5KZMB 1GSOA 2IEGA 1JEJA 1B8OA 3PFHA 1QZXA 2IHUA 2Y0QA 2W7TA 1KMHA 3SATA 3PXEA 2Q7XA 4JLMA 1DKOA 4U39A 4UZSA 3FZGA 4OI0A 2NNLD 3BK1A 3T1OA 1KSHA 1MDFA 3U49A 5A03A 4JDPA 4BNYA 1ZMBA 5CAEA 2BFFA 4D4MA 5A9RA 2Q1SA 4R2KA 2YYAA 2UUPA 3C7TA 1NDUA 2EJBA 2H2IA 2PLAA 3DQZA 2X8WA 2ATCA 2HXYA 3GJSA 1VM6A 2AQIA 3HJ8A 2OORC 3A9WA 4MR7B 4IEIA 3RPEA 4U6QA 1BVSA 3M70A 5AK0A 4ZGGA 3C1AA 3RIYA 2DQKA 3FLAA 1ND6A 2VAMA 4G56A 3QXHA 2GPTA 5LUBA 1RYMA 1KEVA 2JCYA 3D4IA 4GQBA 1OGIA 1TCCA 3KR2A 1RIIA 1PP4A 1YOVA 2YVUA 3CM0A 4NATA 2POQX 5D7NA 1SUBA 4B71A 2I3AA 4Q02A 4DA8A 2XF2A 5BYJA 1YTUA 4KOAA 1TZJA 1NM5C 3PG5A 2CXUA 2XBLA 2CV0A 1MJGA 3HV2A 3M33A 1CX9B 3JWEA 4TSFD 4TXNA 3JYHA 4RTJA 3VM6A 1XDGA 3IUEA 1KZGB 2QV0A 2X3FA 4EL0A 1P2SA 2K87A 3WJAA 1JA9A 4IXNA 1CQJA 1USKA 4MUIA 1RBYA 3FCOA 4C0XA 1DX6A 3VKHA 4EW1A 4DDWA 4BO5A 4N54A 1V7CA 4P81A 1ZSYA 1EIZA 5F1YA 1QQTA 2VZLA 3LQKA 3KU4A 2EJWA 1GTRA 1EJ0A 5FKJA 2C8LA 4UQOA 4V2IA 1Z74A 1HKUA 2IXGA 3OOSA 2QW1A 2VJMA 2B6HA 3VVMA 2ZR8A 2FEKA 3CSDA 4M0DA 2G25A 3K4PA 4YY3B 3FUVA 3U6SA 5IULC 3IHPA 5AD1A 2PS3A 4PNPA 4ZI5A 4X62M 4MGKE 1HNZM 3RRFA 3LY7A 3QI7A 3S2UA 4BO0A 1EESA 2RGHA 1R88A 2YWJA 4G5GA 1U04A 3JCZA 2QTGA 3K71B 1M8KA 1C1HA 3K0FA 2P3SA 3MINA 3DOUA 1MIOB 3WLAA 3NWJA 1EAMA 4A3SA 1TGVA 4UBMA 3H1AA 4E33A 2B9VA 3AESA 3U7RA 2R6DA 4UEQA 2VYNA 2XMGA 5HQJA 1S8OA 1ZQ9A 1VECA 3LC2O 3QLVA 3OJEA 1O6ZA 2V7UA 3K5HA 4L75A 2YN4A 2VRCA 2R6JA 1DO2A 3HWX1 3BPSA 4JS0A 1RXCA 4BE4A 3E27A 2QX8A 4FXPA 1M8GA 4TTAA 3GEHA 4BTVA 3CPSA 4GPD1 4MTLA 5A3SA 1XQYA 2C9YA 3OX4A 4A91A 3FE2A 3UB2A 2QN8A 5C1OA 4DMFA 3WQSB 2AYYA 5CYPA 5EYPB 2QOEA 2YBEA 1ZICA 2GZ1A 4G37A 4A2QA 5CVVA 3HK2A 1GG9A 3QMVA 2IUEA 1B3BA 2BGJA 1VFPA 3V1TC 2PV7A 2KX7A 1JU4A 1QORA 2M32A 3N75A 2NSYA 5EHIA 4B3CA 1GN9A 1UOPA 4GGOA 1AUPA 4RHEA 4YRIA 2JIOA 1PJSA 4QGHA 1QK3A 2GYUA 4G1UC 4UM9B 3ZH9B 2I87A 2OFXA 1LB1B 3B6MA 1LV7A 3ND7A 4K81B 4LPKA 1VYHA 5EIFA 3TWMA 2WZDA 3G8CA 4QX6A 3ZNNA 5BR7A 4WZBB 3DLBA 1PR9A 1RYDA 3P19A 3STYA 1I2CA 3EG9A 1XF9A 4J29A 4PGAA 5DYIA 3OQ1A 1T2EA 4FOLA 1NI5A 4FPXA 1P9LA 3I3OA 5I4BA 5J4HA 3K8QA 1DLIA 1FLVA 1BFDA 3B6ZA 4DEVA 4YRZA 3EGDB 1KVSA 1ZHHA 1P31A 3OOJA 4FFNA 4BKQA 1F6WA 1WD7A 4RTLA 1L7EA 4F84A 3FDZB 5IWAB 1SC6A 3PFBA 2ZM6B 1GZUA 3QF4A 5JI2E 1LDEA 4J1SA 4KK3A 3KXLA 2GESA 3TEJA 3KXKA 3KX2A 4Z9AA 3GBVA 3FYHA 2UXDM 4X8HA 2GOYA 3OPQA 4IYRA 4JAVC 1CS0A 4XWAA 4F91B 5A4DA 3IYLW 5AWFC 5EJ8A 3EZXA 4PHFA 1IZ7A 5JWOA 3MGKA 4IIJA 1PFWA 1P39A 4DA6A 3AHDA 5DHQA 2NPIA 4TQ9A 1ES9A 3QWIA 4J1NA 4NEQA 1FFBA 3DR5A 4CDNA 1UOQA 2J08A 3SLGA 4MULA 4C7VA 4NWIA 1PWHA 4K9RA 4HEA6 4IEEA 1UFKA 1FE8A 1UKAA 4LSGA 3OF5A 3UMGA 4CNQA 1NNEA 2UV8A 3AESB 3SSNA 4YPVA 4CGYA 2LWIA 1JG4A 3A3PA 3IMKA 4CPDA 3NWBA 3TKAA 1GGHA 2QNRA 4MMXB 4QO7A 3VPBA 1EYZA 1VSVA 2R3SA 3G9UA 4JLBA 4MVCA 4OP2A 4DCTA 1XK7A 3BF7A 1N6KA 3KXPA 1OAOA 2X5KO 1C3EA 5A0FA 3FMPB 1RTTA 3AG5A 1FA9A 1QB7A 5TMEA 2X9LA 3KT6A 2Q41A 1KBOA 4ZO6A 4DLAA 3HR7A 3HGTA 3ROFA 3AB8A 4FDUA 1V3UA 2ZFUA 3P1JA 2VWHA 3IAS1 3SIPA 2L69A 3F96A 4HP8A 1PFVA 2GD2A 4KE7A 2GFIA 1OA0A 4U02A 4DHEA 4NENA 3T3MB 5K3EA 2GKSA 2P9JA 1D4ZA 2H52A 1O77A 1SB8A 4IDCA 3WOVA 1TD9A 2KRKA 1HC7A 2YS6A 4EX7A 3M81A 3CVWA 1RI1A 3K8OE 2FOLA 1VHLA 1NU6A 3WL5A 4EBFA 1FZTA 2XX3A 3TWKA 2KBFA 3TKLA 1NBIA 4BFXA 4D9FA 1B6GA 3A46A 4RUKA 2EO2A 1V8ZA 2X86A 3SX0A 3WP1B 1J97A 4ENQA 5JW6A 1QUTA 1NVTA 3VNQA 5EGNA 3TE7A 1J0BA 3WISA 1BXKA 4EHKA 3KZKA 2PKQP 2YHUA 2P41A 4L95C 3ZYZA 1JLSA 1V35A 4A8PA 4BEJA 4X8LA 1A76A 2C42A 3VSAA 2AE2A 3FWNA 4UBLA 3W6OA 5KWSA 2YZGA 4BP3A 3DBRA 4YAKA 2YUTA 1IUKA 5DVZA 5FPTA 2EX4A 2VNAA 1JBKA 1CUDA 4XGRA 5HE8A 2R11A 3UAGA 1ML4A 1M0EA 2IHBA 2ISCA 3MMZA 1Z4QA 3ZYCA 1X7YB 3WWYA 2CKDA 3OM8A 4X61A 1F1BA 4D46A 3V3KA 4RY2A 4EKYA 2VDWB 3IBGA 2XNCA 4YALA 5BRNA 1MQSA 1RWBA 4AIIA 4YRKA 4K28A 4ZJPA 3U6BA 1FFYA 1QHSA 3ITKA 2AJDA 3VC1A 3CH7A 1VDZA 3AQ4A 3B85A 3K9CA 3O1IC 2B6NA 2MWMA 1LK0A 2NG1A 3NNNA 3AR7A 3A2MA 2DAMA 4JLPA 2AZ4A 2HRRA 2QA5A 4OHFA 4R05A 4B6OA 3HVRA 3SQWA 3EZLA 1R6BX 3HSYA 1J7JA 3RIMA 2AKEA 3I32A 2KS6A 2VATA 3AOEC 2AA3A 3U6DA 2ZE7A 3FB4A 1X19A 3GDGA 4Q12A 4YRLA 5ALPA 2C9OA 4NMLA 1G41A 2FRDA 2J09A 4E09A 3QYEA 2BMJA 4XDZA 2B1JA 1I9GA 2ZU0C 1AZSC 2N0SA 3BULA 4OHBA 3I01A 1QIEA 5JCOA 2WAOA 4F4HA 2OILA 2QRNA 3NG1A 1I10A 1EK1A 4EFLA 5AI6A 2QRQA 3PQEA 4OHCA 5GM1A 3GQ4A 2PRSA 1X7ZA 3PGA1 1XLWA 2EGGA 4GR4A 3NEAA 1VIAA 4NRWA 4IDNA 5F23A 4PBTA 4CMKA 2BM1A 1T3LA 1XRNA 4LXTA 1GTJ1 5DHPA 3AW8A 4U6SA 1XZLA 3SEAA 3QPDA 4EW6A 2BBSA 1NZDA 4H4EA 3KB8A 1HX7A 2IOQA 3GGOA 5GY7A 5DM60 4BN0A 1QYIA 1OH8A 3P71T 3FNFA 4QO8A 1BKSB 2JZNA 1ISMA 4TL6A 2R48A 4JQSA 1J8QA 1QNLA 2NVWA 4EJ2A 1COWA 1Y6RA 2FVYA 3PP8A 2PQMA 1UPAA 5KQMA 1SELA 1CYDA 1Z28A 2LW7A 3IAM6 4MI6A 2AIRA 2XUDA 2VP3A 2CHGA 3HJQA 1BXRA 2WOOA 4QDZA 3USCS 4IIBA 3LRXA 4I4TF 4BDSA 4UMDA 4ZC1A 3GUHA 5CNKA 2JLQA 4RQBA 3U7JA 2RAFA 1QR6A 4OYRA 2CFRA 4R1TA 1DFHA 1XBTA 3Q3JB 5KTPA 4YVFA 4G89A 2P78A 4GSKA 1I3MA 4Q7KA 1F4VA 1UKBA 1KFEB 1Q0HA 2OFPA 3ESYA 3PJEA 4JVOA 5AKXA 3UENA 2GN0A 3B3AA 4A5OA 1DCMA 2KZSA 1E2DA 4AYWA 3HWWA 1J8VA 1NA5A 5ITXE 4FQ8A 4LVUA 2RSLA 5HRCA 3ILYA 2O0HA 1J42A 1MCZA 1O7JA 2P77A 1JZSA 2VF2A 2ZIUB 2HPVA 3OIDA 3OTOB 5CB0A 3ZY4A 2QU8A 4GX2A 1CEQA 3RYCA 2J5BA 2XIJA 4V38A 2PLRA 1KAGA 1DXOA 4LOKA 2O52A 4CHGA 4MHTA 2W2NA 1DJNA 2H4ZA 2GERA 2W00A 5DULA 2COEA 3LT5A 3MF4A 4RABA 4WKGA 1SKYB 1R5OA 2XKAA 4B32A 5JMWA 2G9ZA 1BHJA 2A33A 1C2TA 1TU4A 1GPLA 2BBTA 2P7HA 2I2CA 3W2HA 4UTPA 1BMFA 1KEWA 3THWB 4O8CA 2K2WA 1U6KA 2CZCA 5EUQB 4D0LB 3G2QA 3PV0A 1HT1E 1H2HA 1JR3A 4MVWA 3PFCA 5AOBA 3I8SA 4HD8A 5DNVA 2H0RA 4K88A 4OIMA 5C7IO 3PT5A 3PDJA 4F5EA 2YC4C 4NC6A 1NVBA 4KQCA 3I6QA 4CWAA 4OJKA 2W2LD 4OHRA 3Q7EA 3HYNA 1RYYA 1JVNA 5EE1A 3JYNA 2V59A 3E8XA 4NABA 4QDJA 5NULA 1UBHS 4KPYA 3NOVA 1H8EA 2PA3A 2G6TA 4G65A 4L0CA 5KJ1A 3DBLA 1GNVA 1V8FA 3CINA 3V8MA 4RW0A 5IXYA 1YR7A 1SWVA 4PT5A 4M1MA 1ENYA 1SBZA 3AHCA 2CWWA 1R8SA 3B2NA 1OBCA 5HGJA 4OFXA 3QEMA 3VYWA 1ZEMA 2BGIA 3CPEA 1CUHA 3TRIA 4B09A 1YO6A 4OREX 3UGKA 1UT5A 4YRNA 3CS3A 3R9XB 1UXJA 3RK0A 3KSBC 5JRZA 1XXHA 1I3NA 2DQZA 3LW7A 1CJCA 1CKEA 3T3GA 5CCEA 4GXNA 2Z5VA 1FC0A 2HX1A 5EFOA 4A0GA 3PNVA 4ZT6A 1GQRA 4YJ3A 2QM3A 4GI7A 5TS2A 2MSEB 2TS1A 1ZJYA 3GN1A 4QE3A 4WY2A 4YCCA 1V9LA 1WHTA 3D9QX 4U9IS 1Y81A 1OLUB 1SB9A 1V26A 4EI2A 2NO7A 5EJ5A 3EVEA 5DYWA 4ZIRA 1KEEB 2JZCA 3VKUA 3ZWYA 3S3TA 4F46A 2QW8A 1Q17A 3UOWA 3D4PA 4B7UA 1ZMTA 5CVJA 4F04A 1P2GA 1RD4A 2ZCVA 2W6ID 3TSCA 4D92A 4NEHB 2ZZMA 4RVSA 3NBUA 4JZYA 1OAKA 1UQTA 1IJFA 2POCA 2YWHA 3RV3A 3AIIA 1TFUA 3TIVA 3T7KA 2NUTA 1U0FA 1XKXA 4KQMA 1YGPA 3DWFA 4EYOA 2FG6C 2GILA 1G55A 1R0ZA 1GAWA 2GLUA 3QLVC 1GCOA 3DGFC 2DHEA 1LS6A 1R4NA 3HMQA 1O6GA 1OD6A 2CJYA 2PZ8A 3O3CA 2W58A 3TZEA 1ID1A 2DEUA 1VDDA 4MX8A 1XMOM 1HWYA 2ZJ6A 3D1VA 5ALYA 3KOZE 4U0KA 2WDZA 4V1CI 4LG2A 2H65A 3DEFA 3VU8A 1C7RA 4K6OA 4G5HA 1I7PA 3HL0A 3KKKA 4PBRA 5FI3A 4C4ZA 4PG8A 5JD3A 1UK9A 2PSSA 3VR5A 1OFIA 4EHDA 3ZE1B 2W6OA 1MO2A 1XX6A 3HNOA 2FK7A 3PYMA 2ZTUA 3EF0A 1PVOA 3PPVA 4C1BA 2C29D 3G8AA 4E21A 2FPOA 4L6V6 4OHYA 1UJ5A 2O8NA 1M1NB 4MGYR 3QTTA 3VDNB 3EA5A 1LZKA 4ZKDA 1E1MA 3LGSA 3WLSA 1NWCA 3IT3A 2YMLA 3UT6A 3DZ8A 3WHPA 2VYQA 2WAXA 1D0VA 3S81A 5LVAA 4MARA 1FYVA 2J46A 5A05A 1C8BA 4KXYA 2V3CC 3SD7A 1K3UB 3P2KA 2FN7A 3O84A 2PS9A 4EY7A 5LA6A 2VPZA 1HLPA 1P2VA 5KUTA 2B1GA 1NLFA 1H65A 1NULA 2ID4A 3I8OA 1ZNYA 3KD2A 3QZUA 4PLGA 8ATCA 2PD4A 3R9XA 1Y9EA 1TKAA 1X80B 4UUBA 1XXHB 1S3SA 1VMEA 4TTJA 3T4PA 2NUTB 4A16A 3RRXA 3FOFC 3BT7A 1SEPA 4U2FA 3PKJA 1NX9A 3RS8A 4YV1A 5EC8A 2QY6A 3GYBA 3OG9A 4HEA1 1UPFA 2V3VA 4LPSA 3AUUA 1F2TB 4F9FA 4YT2A 1X1BA 3AR9A 3NAMA 3BMQA 2Z2IA 3S6JA 5B58T 1LBTA 1YS2X 4XW2A 4X7MA 3I23A 4GX0A 1TMKA 3ZHYA 3ROTA 4DCJA 4DLBA 4YO8A 2OECA 4HEJA 4YMIA 2PV0A 2RI0A 1XCBA 3U56A 1DGFA 2VRCD 3EXG1 3IP8A 1G8AA 4LVOA 2O57A 3TTWA 1SIWA 3FOCA 4HJRA 2Y4NA 4J6FA 1IY0A 2Z8XA 1DKRA 3F6EX 4UBIA 3SEQA 5F2NA 2QN7A 3FCYA 5JFTA 4XCVA 1UZNA 1WQ3A 4GZ5A 3IERA 3ZE2B 3L4KA 3EDOA 2GCNA 3JTEA 1IBRA 5TQ2B 4B4DA 2C9DA 2YJ6A 3AR8A 1L3IA 3T3EA 4KWCA 5BW6B 3AY6A 4PW0A 4URHA 3HM9A 3TTYA 1N1GA 4AG5A 1FW6A 2RHTA 4ZYZA 4LI0A 3GDWA 4U7JA 2G80A 4PQGA 2C58A 1WKVA 2M6RA 3AFGA 4Q1AA 2PH5A 1GLGA 1ZL2A 1P3QQ 2IUYA 3I2JA 2YR0A 4QGFA 4R1UA 1QYWA 1DKQA 1ZSNA 1SUCA 2C61A 2UYGA 4FCCA 4GLBA 5ALIA 4BVEA 1FJGB 2RJOA 4TXJA 3DTTA 4JXKA 3OJ0A 3N3AC 4HLUA 2HGSA 4WASA 2QPOA 2OO9A 1NP7A 3J7AS 3IAXA 1XVUA 3I05A 3QE2A 1F0PA 1G64A 2G7MC 3M1YA 3STWA 4RGYA 1EFPB 3LIPA 2CF6A 1K4MA 1K2VN 3JZIA 3MBKA 3NORA 2FF5A 3LKVA 4I1IA 4J8PA 4WBNF 2HH9A 1ZA1A 4OB6A 5FBZA 1IBKM 1VI2A 2C5AA 2WYVA 3KQSA 4INAA 4RY9A 4U0JA 5KWJA 5J2TA 3C98A 3PVCA 2XY4A 1QE3A 1XPJA 1ZL0A 4LJ7A 3I58A 2OQVA 1V96A 3S1AA 3RSGA 3J7AC 2QRLA 5EXPA 1FSFA 2D7GA 2H1VA 1RQPA 3K0CA 1I4WA 1YOVB 3MLAA 3OETA 4TKZA 5EXEA 5BSMA 4D97A 2NVOA 5H59A 1XAGA 1XEXA 2ZIAA 4RK7A 4WKCA 1R66A 1TZ2A 3PC4A 5ICFA 3U2QA 1QLHA 1HFWA 1NXOA 1X3SA 2YJTD 4BNGA 1GSHA 1KDPA 2M98A 4XVQA 2C88A 3FBGA 1K5HA 5E1DA 1TH3A 2WYHA 1QIKA 3E23A 4BNMA 4X54A 2DLCX 3K8ZA 4Q05A 4ETWA 1SQGA 4YQFA 1M1YA 1T3TA 3EXEA 2B3TA 4MH0R 4RK1A 2R1VB 4DTIA 4JBNA 5L7TA 1JJBA 3ZQ6A 2CHUA 3KSMA 2KNZA 1ZCZA 5J4YA 2LCIA 4MV8A 3GLUA 4XWGA 3E5RA 2AH5A 1JHXA 1YRHA 2XD4A 3AB7A 1ULZA 1PFGA 2Y21A 1E1RD 4LF7B 3DEYX 4KQ1A 4HDMB 2PJRA 5C18A 1E69A 3AFIA 3EDMA 2HTFA 2WF8A 4QHTA 1R37A 1VLZA 3COSA 3D5QA 3IMCA 1IWPB 3IESA 4L8GA 4RNDB 4ALLA 1QGYA 1FFXA 1OY1A 4B3TB 5DSTA 1TA9A 3DMPA 1HXHA 2CDBA 1NNUA 1H22A 5IKEA 1W25A 3Q41A 2Q6KA 1PHRA 3STVA 2RIRA 1V8BA 3PD7A 2H57A 3L3BA 2XV1A 3JRXA 1AKUA 2AFHB 1M74A 2R9VA 2YNMD 2XZTA 1LC0A 1AKNA 2N9UA 2ZKLA 3ESBA 2A9RA 1VJ1A 1BQ3A 1O97D 4HMQA 4RMIA 3TJRA 4DR6B 4BS9A 3IT1A 2PBLA 1OR8A 3P9YA 2Q1UA 1JIXA 2EFYA 2GEFA 4KX3A 4B9EA 2AN1A 4HV4A 3MWEB 1NBHA 4NOLA 1XNRB 1AZWA 3O95A 3WKDA 3CW9A 5FOVA 4EYGA 5BSVA 2CMDA 1Q2XA 1YJ5A 4M1QA 1G21B 3PZRA 4HX5A 5CM2Z 1NIJA 4FEYA 5IU6A 1V1RA 5GAJA 4ZN6A 2DTXA 2VKTA 4R2WA 2L7HA 3ZDDA 3HH8A 3JQPA 1LLFA 1UMCB 3G8DA 3EGEA 1OYVA 1N36B 1YZNA 3LGXA 2HMWA 3ROXA 5D1HA 5DX0A 1FXWF 2A0KA 3DCYA 5L7YA 5C5DA 4KPEC 3UPUA 1UOEA 2ID8A 1NN5A 5D3MB 1NY5A 3IHLA 4QNNA 3N0WA 3I39X 3PR1A 4YRPA 3RS3A 3Q3VA 2FFBA 1N2HA 3IBCA 1XNGA 1RXSA 1ISIA 4UASA 4X44A 5KAPA 3HHZA 2MR6A 3L84A 2A7QA 2RFLA 4B85A 3Q7SA 1FMTA 3D8HA 1XFDA 1XZDA 3LKBA 3ZCVA 2P4EA 1DX9A 1PJIA 3GHYA 3RHTA 1NDQA 3I62A 2VH5R 3MCAA 3ZQ4A 1RWPA 2H18A 5KHAA 3JQAD 4H31A 3BGSA 4HXYA 4TV8F 4QA9A 1JWAB 1U99A 3ZXSA 4GXTA 4C30A 2R1VA 4AY4A 5A4IS 4BO3A 5T4EA 3DMFA 1XMQB 3DNMA 4UPVA 1KJZA 3EW7A 4CLOA 2NU7B 2YFKA 3NBQA 3KQHA 4X91A 4ZQIA 4EA6A 2I54A 3CRVA 1SQ6A 4ZHQF 1WZCA 4HWSA 2Q1YA 3U4CA 1WTAA 1OPXA 2YQ4A 4Y67A 2ZXUA 3OJFA 3W67A 1B0PA 1HMPA 1J9GA 4CV1A 2FYTA 3LUBA 3C87A 4H7FA 6ADHA 5LM3A 3IEUA 1PJBA 2QVCA 4IIJB 2VO1A 3K2BA 4QDOA 4CZ2A 5ITRA 1RPJA 2G1AA 2Z4TA 2ZYDA 1HNWB 3WBJA 1YAJA 2JK1A 2WUFA 4TXHA 1SCUB 2ZRBA 4ZCQA 4JQYA 5IK2D 3CRZA 2FSVA 3DA1A 2ZI6A 4GOXA 3ZLUA 4W5QA 1K68A 5AM4A 1P4HA 3EIUA 5EJCA 3CJTA 1G2IA 2F4VM 4L0QA 1JXQA 3VFDA 4S1NA 5BWLA 2WQ6A 2WZJA 2IYQA 3GPXA 5EIBC 2BI4A 3A6PC 2I6XA 3PK0A 1SA0B 2C97A 1EP3B 3HCEA 2FP3A 2I2AA 4FFVA 4Z3OA 2E4UA 2XB9A 3SZOA 3M2PA 5DX1A 1G8PA 2Z04A 2F5PA 2OESA 1E2BA 3NEPX 1UDXA 1E5QA 3GJ5A 4TWIA 3W3ZB 2C0QA 4E5SA 3CF2A 2R1TB 2D5CA 1B26A 4UHEA 2HUNA 3KC2A 1H2YA 1Z6GA 5AOCA 3V9AA 2VT2A 2MYTA 1GGJA 1WV0A 2PPVA 3DTNA 4WLOA 5ALFA 1NMYA 3BORA 4Z0PA 3SVTA 2FN8A 2DR3A 5G0UA 5A6SB 3TG8A 1FDUA 4WGFA 3WNVA 2R62A 2X8AA 1ETHA 1OHHA 2H5IA 3MPOA 4OHKA 3RSOA 3S8EA 3QNMA 5CLJA 1XTIA 4AICA 3VDUA 2C94A 3Q0EA 4AY2A 3D8TA 1DPFA 1HLDA 3C3DA 2J33A 3FIUA 3HVIA 5B4UA 4DV0B 4O2AB 5ED4A 1FIUA 4Z0NA 4B6SA 2QDKA 3NHZA 3C5VA 4INPA 3SKYA 4V0OA 3LXUX 2AZXA 5TB5A 2HXSA 1SBCA 1BHQ1 3HBNA 5H16A 3JASB 4UMEA 1GNSA 4M46A 2UXCM 2BWJA 3UJHA 4KRFA 2R7MA 4RLQA 1QIDA 3B9RA 5ITVA 2GRUA 1KC1A 1FP6A 4LJ5A 2BZ0A 5KNDD 4UOQA 1C3LA 1OBFO 1XMVA 1FMCA 3AOGA 4DAEA 5ICCA 1WVIA 5G0WA 5HZGA 1SUIA 1YU9A 1T9AA 4H4DA 4XR9A 2IX9A 4U2BA 4L5CA 3ZBTA 3RW9A 4XXHA 1W0KD 5LZ2A 3RBZA 3H65A 4IBOA 3PXCX 3IMGA 2D8AA 4F85A 1CDZA 2PANA 2Y1OA 4LZNA 1N92A 1KI6A 3G2PA 2LBCA 3L4SO 4O2AF 3GBPA 3R6TA 1C3JA 2OZPA 1GXSA 2GQFA 4GC9A 3U3OA 2YRWA 4TT3A 4K86A 1W36C 2G1UA 1R5JA 5AICA 1NXXA 1ZR4A 2NV0A 1Q02A 2AYXA 4J43A 3UHOA 3T7CA 3T3NA 4IHJB 1YZLA 4JB2A 2ANBA 2X23A 2XFSA 2QQ5A 2XUHA 3C7AA 2F90A 3NHJA 3RVPA 5IT0A 4UUNA 3K9GA 1YB1A 2NTEA 4K87A 3M7GA 2WWRA 1WW8A 1A82A 2YJNA 4LQDA 4MVJG 2ATVA 2B78A 4CR7A 1TM5E 1EUZA 4GOLD 3KPVA 4MW7A 5AJZA 3U9TA 1EK6A 4M1OA 4RWZA 1DC8A 2FSUA 1XQ1A 4N5HX 3BRWD 5ELMA 4B3FX 1F3LA 4PICA 4RJJA 4YI5A 5J2UF 4IIWA 5HG0A 5ICGA 3N2EA 1SXGA 3RRJA 4K5QA 4G4IA 1IJEA 2IXDA 4NESA 1C9EA 3I1FA 3B9QA 3K73O 2ZYUX 5EIAA 2JZ1A 4HNTA 4JI5M 2VBCA 3DZKA 4ZI7B 4JODA 4C0WA 5L3SA 3T3IA 2ZSFA 4UTOA 3EEFA 3SR0A 4J03A 1W52X 4JI1B 2AKAB 2MSCB 2YMMA 4MV4A 4RK4A 5AOAA 5K0FA 2DHQA 1PFQA 4MZDA 1VEGA 1RHUA 2ZP1A 2INGX 3DQQA 1IBLB 1L5LA 4M8LA 5C1PA 4HNGA 5BV7A 4Q1CA 2WHQA 2RHMA 1XZEA 2WK1A 2AE1A 2Z8YA 3ND9A 3UAOA 4D4KA 3FKEA 2XYRA 1VI5A 2ESRA 4HGRA 3GLGE 1L5HB 5ALMA 1X0XA 4IIUA 4R9NA 3DHYA 4ZHSA 3HFSA 3PKIA 4QQ8A 4K0KB 3R5HA 5EQTA 4N8SA 1KH3A 3TUZC 4RJ2A 3T7DA 3UJBA 3A7DA 4N7MA 1Y4UA 2I6TA 2ZRKA 2FMTA 3AUXA 4OOEA 1VSUA 3AEZA 3I0ZA 2X0NA 4O4IF 4QATA 3RIXA 4A92A 3R3HA 3ETNA 1DAKA 4E3WA 2HA4A 3RE8A 3OPYB 2OBYA 3SIRA 3HYRA 2HTEA 2XXJA 1D2AA 2VP9A 3MTQA 4FYVA 3FFTA 4GPIB 4H08A 3ICWA 4X24A 3CURA 5DV9A 1V4BA 1TJYA 2DR0A 1V34A 3G8YA 2O9JA 3L1UA 3LQFA 1TQHA 4MJ3A 4OK3A 1PJ3A 3G2IA 3T38A 1U7PA 1Z6TA 3ED5A 1E59A 5HCNA 4DLKA 4CKBB 1Y5LA 2X2EA 3NYWA 4E6PA 1YVPA 4A10A 5EWLB 3MCWA 3LVFO 3PXAA 2EJUA 1E9VA 5B4TA 4UUAA 1IBKB 4EELA 1E9SA 1K0FA 4IHJA 4DV6B 2OCIA 1YQDA 2L82A 4DCOA 2A58A 2C5EA 4IRUB 2W2LA 3B60A 1PL7A 4W5TA 1L2TA 1R9GA 2W98A 4CL8A 1L5HA 1F6DA 2YXBA 4TZTA 4AZTA 3U0BA 1K3TA 2PIAA 3OE7A 5D5QA 3SKVA 1G1MA 1YBMA 3CLHA 4NRDA 4P4SA 4IHKA 4E1BA 2QAGC 4PZDA 5G02A 4B87A 3ONEA 1ODTC 3TX2A 4ARVA 2C4VA 3G8BA 2HQ1A 3RLIA 3TZBA 2BSXA 5IYZA 4RE5A 1LQUA 5DZSA 4EG0A 5K51A 4MITA 4RD6A 5ADWA 2ICAA 1UBUS 3ROGA 1QAQA 5JRDS 3P2JA 4F72A 5K0SA 1HK7A 1Z2NX 5AHRA 3GRZA 5D01A 1A1SA 1YZYA 2H1SA 5HHTA 2V65A 3O21A 1PFYA 5KSWB 3WA7A 2XXAA 1I8TA 4UQLA 1G7SA 2PUCA 1PYOA 4KXMA 3L28A 1KC3A 3HXKA 4IIDA 3BF8A 3SLRA 4E15A 2QJOA 3HDVA 5E9AA 2W4QA 4QKQA 1Z4LA 2AXNA 1QOZA 4ZK2A 2HU5A 4QM7A 5BPVA 2JC3A 3DNFA 1NQWA 3O8RA 4ESEA 3QTLA 3L77A 1NL3A 4C6TB 3ZK9A 3NATA 4ZTUB 1MR3F 3MK31 1LPBB 1M1ZA 3DE3X 1H6DA 5TT0A 5GM2A 3CR3C 2ECPA 1I94B 2DJ5A 4L7QA 2WPDD 5LDGA 2FZLA 3O2NA 3UJ9A 4ZXFA 4RHXA 3OQJA 5BSGA 2F00A 4BGIA 3D7LA 4CV0A 2FE8A 4B4WA 3WLJA 4DIEA 5KWEA 1WCIA 4J7AA 1UC5B 4DLVA 3G0HA 2JVKA 1CEXA 4PE5B 4GVLA 5BWBA 3LFHA 4HLDA 4Q4AB 1OZGA 3AGQA 3PSHA 1ZH4A 1DBRA 1DHTA 1PYGA 2XVYA 1B6SA 3PUVA 4GVPA 5AQEA 1EUDA 3VTAA 3AP2A 4Q7QA 3L49A 3SZRA 1WHSA 2H16A 2IYWA 3N1UA 1AUOA 1DQNA 2BE7A 1GZ4A 3IP9A 1NMEA 4TV8A 4HNVA 3II6X 4ALNA 1I0LA 4QLBA 2D5BA 2E4VA 2ZDQA 3KOXE 2WNIA 3PX2A 4IBBA 2GASA 4N5MA 3SF8A 2AWNA 2GAFA 3AKEA 3PJFA 1RPAA 4IFEA 1D9ZA 1Z5NA 3GAMA 1QP7A 1V5WA 4FT4A 5K8CA 4FWBA 1AG9A 4ACBA 4YT4A 3SQXA 3PL1A 1UH5A 1HDZA 1M75A 2ODNA 4HUQA 4UU0A 4E94A 2XTZA 3DAYA 4JI4M 1Y33E 3LHSA 4MDYA 4X00A 4NSOB 1NMZA 3KYJB 8OHMA 4DG8A 5EXTA 3CCFA 3DFMA 4QECA 5ER6A 3W5AA 2Z6VA 1ZHOA 3C7DB 4F6CA 4ZCSA 4G3OA 3R8FA 1SHZA 4JUAA 1RQRA 3D8NA 4WK4B 2QVGA 4P0QB 4OMDA 4DMGA 4ZZ3A 4EHLA 2D3WA 1CVIA 1TKRA 4WA7A 1A9SA 4CV3A 5FFNA 1PNQA 3WHLA 2NV2B 4RTRA 5F3WA 1HNZB 2M6LA 1T2FA 4MJ7A 3KR1A 3T5CA 3LW8A 2JCVA 4PYJA 3BIFA 3AJ9A 4HGZA 5SZKB 4YQZA 1E0SA 3KBBA 3N28A 5KYXA 3CX3A 4YAOA 1YNSA 3J7TA 1GNTA 1RM0A 2ST1A 3T9AA 4GECA 5I3ZA 1ULHA 3H0EA 3OHSX 2F5NA 3KB6A 1YS6A 3U4HA 5HM6A 1IHPA 3N86A 4BFSA 2FKNA 1LRKA 4Y2UA 1J0DA 3MWDB 4X7PA 4TV8B 1X13A 4H0CA 2GAAA 2H07A 3LL7A 5I4IA 2BAGA 4JJFA 2IQ5A 4LE1A 4UDNA 3RTCA 4HYQA 3V8PA 1A8HA 1CY1A 3GRPA 3JQ6A 4G4RA 2HF8A 1MG5A 2BFBA 3CZQA 4DB4A 2QR3A 3CR8A 1FUEA 3WZ2A 5T3YA 3CKMA 2ZSEA 2ZANA 4KGZA 1CRWG 3EZYA 3KVRA 4ZOBA 4ZJZA 2NX2A 1ISHA 3D31A 4O33A 4O0MA 3TW8A 2V1XA 4N9WA 2ZUBA 1J2UA 4NPAA 4W8OA 3ELUA 2R1UA 1XCLA 4MH0E 2EV9A 1XUOA 1ZAEA 4LQCA 2DZLA 3PL5A 1XMOB 2GWRA 2NTJA 2VNJA 2P6PA 3AI3A 2F9LA 1R6VA 2WINI 3BIOA 3O8OA 3Q8XB 4OSEA 1Y7LA 2O5EA 3KDSE 3HHXA 4DSZA 4IS3A 3EF1A 1NR1A 4P38A 4WLUA 1WHSB 4LHEA 4F2WA 4JC5A 1VFNA 2WKQA 4IPTA 4S1TA 2JD2A 2Z2KA 3QEMB 5KVAA 1X1DA 4G41A 5JNWA 4YRDA 2VAWA 4QQKA 3QEKA 1VB5A 3QVUA 1A9PA 4BE9A 2R84A 4AZ0B 1TIKA 2F5OA 1NW9B 2FUG1 2MINA 2W6MA 2AEMA 1EVLA 1TL7C 4I9HA 4X8OA 1M2JA 1XG5A 2RH5A 5CBPA 4LOIA 1E2UA 3QU4A 4ZRMA 4TTIA 3EFHA 1NBMA 2HUPA 2QY9A 3L8YA 2WJ4A 3EXHB 3LIIA 3KZVA 1HZJA 1VOTA 4WNAA 4BFUA 3A1WA 1W4BA 4FSXA 5K1ZA 1NPYA 2RHJA 5JAHA 5CCBA 2R0QC 4R81A 1TYAE 3GJ6A 3ITNA 3RWMB 4UZFA 2ZJ8A 2VQEM 4M0WA 3QX3A 4D7AA 1E2HA 1VE6A 4U2DA 1LBSA 1XTZA 4JGBA 3FUXA 3RJ9A 1JI0A 5C1DA 5DTMA 4IMJB 2H54A 2VZ0A 3KQQA 2JS7A 4DLYA 4FDTA 1ZD9A 5JJCA 1H93A 1BE0A 1XQ6A 1YJBA 2JGDB 3I04M 4K0KM 1F3OA 3CG4A 2NXWA 2PL5A 3TVDA 4NCBA 1T35A 3IKLA 2IRWA 3KOYA 1EUCA 2IZOA 1NF2A 3AY0A 5EINA 3BTOA 2J6BA 2SCUB 5DFLA 1Z29A 2ZQZA 4MGIR 2VJNA 5JVDB 2V6FA 2QYOA 2UZIR 4BFCA 2VQEB 4FBLA 4P5EA 4E11A 3NTQA 1EWVA 4YRCA 3NXKA 4J76A 3ROEA 3EXEB 3ML1A 4IJMA 4F9TA 3PTZA 1G8YA 5DIFA 2CNKA 1P8AA 3H6KA 2ZI5A 4B3HA 1U1GA 2WYIA 5BSTA 3DL7A 2JFWA 3HUEA 5KKAA 1LSSA 1XMJA 4QAQA 1W35A 3G6KA 2VSXA 3P94A 3O5AA 1JRLA 2HRBA 2O0LA 4IICA 4BJ1A 4DXAA 3CNNA 4ZVPA 2V7BA 1WLYA 2NZ2A 4V0SA 1GNRA 4B9AA 5HJ2A 5TX7A 4PHHA 3R3WA 4RZHA 4RZQA 3UJCA 1ABFA 4Q4CA 5JSYA 1YHYA 4N7BA 4CN9A 3H3XA 4PFSA 4KT0F 2ZIGA 4AJHA 3U09A 1KMNA 1P17A 3HP4A 4DLNA 3K72B 2JKYA 3LX5A 4WK6A 4BQEA 4XH9B 1JKIA 3ZGYA 2D62A 3ULKA 5DIZA 3ORSA 5EUMA 5FBQB 3AR6A 1MH1A 3HJAA 1LNZA 4R1PA 4P3KA 4YX9A 2WABA 1BX0A 2EZ4A 2OV6A 2MSWA 1O9BA 3F74A 3GIWA 3GELA 4N5IX 4GYWA 4BP8A 2AFHA 4EO9A 5BR1A 1XFAA 3U6CA 4M2LA 2HPAA 1PFUA 3VAAA 4FW8A 3IBSA 4DCSA 3NH6A 3EH2A 1U3GA 3GCWA 4K03A 4V0ME 2PO5A 5HQTA 1BNCA 4NBUA 1B00A 1PN3A 1U5AA 2FUCA 5KYGA 4U7DA 3B8HA 3CLSC 3NANA 1C9KA 4PG7A 2G4CA 1W0JA 5EE5B 1WZIA 1KSJA 1BCSA 2B7BA 3LYAA 3MWEA 1NLUA 2QRUA 4MUAA 4ZI7F 4DV7B 3LT2A 4HFJA 2FW0A 3G59A 5JXWA 3FB1A 2GNOA 3ILVA 3SPXA 1Z18A 1O1YA 2RCYA 4LDNA 4MWOA 1ZVVA 3WGGA 2HI0A 3KKLA 5EJ6A 3ZTTA 4DC9A 3MS4A 1XKLA 4MKGA 1U31A 4UHBA 2FPUA 4WZBA 1G17A 3ZGXA 3H1EA 2WM8A 3HPQA 1J22A 1PLJA 2X8BA 4J1TA 4ZVMA 2C2OA 2HSWA 3PICA 4FNOA 5BNTA 3HHWA 4YRQA 4O02B 4DT1A 3FPAA 1XDDA 4K46A 4B6JA 2CHQA 4BFLA 5I9SA 4KN9S 1W59A 2CJXA 1LJLA 1K3WA 1EX9A 1HMYA 3UMVA 1EB8A 1VJ0A 3PXXA 4JYAB 4TZ6A 2YXPX 3NHLA 5CW1A 1KJWA 1F2UA 1H23A 2DC1A 4P1ZA 3I42A 4QNRA 1O3YA 1QXSA 3GFOA 3DLCA 2XVXA 1EG2A 2WJAA 4RD3A 1KFCB 4JI3M 1FMFA 4OVZA 4AO7A 1KETA 2FPXA 5AW8A 3GPBA 4BIIA 3KZNA 3KKQA 1T6XA 3H3FA 2VYFA 3IC5A 4PR0A 4TRRA 4CQMB 6GPBA 2DJIA 5DTJA 1M66A 3T5DA 1M8JA 4WIAA 5EZYA 5KTSA 4EB8A 5DB4A 4R41A 2ZRNA 1DT5A 3DLIA 3ADCA 4R3NA 1YS4A 3JWIA 1DC7A 2IOFK 1VB3A 2NNWB 4KUHA 3MK6A 1A72A 2HRDA 3V8BA 3WGVA 4EENA 4JLDA 3SU8A 2MSDB 1PJTA 1QCYA 5FCDA 4L5YA 4D1YA 2I65A 4LJ4A 3D3JA 3LKDA 4QD3A 2ZAIA 3HJCA 1I7LA 4US2R 1WB9A 2FSPA 4X8MA 4YB8A 2RK4A 1U9JA 3D3KA 4EZIA 2P75A 3OBIA 5IZCC 2GPAA 2IW1A 5HFJA 5K2OA 1KJ8A 4B46A 2JFYA 3DL0A 3Q87B 5EI5A 4PWYA 5B3JC 5C8ZA 1MV5A 1HYBA 4I0WB 3UKOA 1M34B 2O2GA 3GD7A 3OUUA 4PDGA 3FLBA 1I4EB 4ID3A 2J9GA 4TKVA 4B3MB 1OUMA 1I01A 2BZSA 4Z7JA 2FJ0A 2GNAA 1C4OA 2JAXA 4NULA 3VUFA 5DYYA 3BGDA 3EXIA 2QVXX 4BE7B 4E5YA 4EJMA 5JHHB 2GDJA 4MUJA 4YASA 1T5DX 3F71A 4LNAA 4KLZA 3I9V1 1A9QA 1F9EA 3GH1A 4WBNA 2CBGA 1EX1A 2F3QA 1ZXXA 3JQGB 3N74A 2HNBA 4Y7DA 5CVCA 3GV0A 3NIFB 3BEDA 3VHXB 4B5LA 2CDRA 3O75A 1Z0DA 5K8IA 4FD3A 1PDWA 4RCVA 1ZLXA 4MQLA 1O6FA 4UATA 2NXNA 2FQWA 3N3BC 1W87A 3HA5A 1X3LA 3H2GA 3A3NA 1PLLA 2BR4A 1AB6A 5F1KA 5FAXA 1T6YA 4MV9A 2IC5A 1B6TA 3F1LA 1V5IA 3DOHA 5JSFA 1PUJA 1WGLA 5BVGA 2P9EA 1ZA2A 4DUZM 1E18A 2JFZA 1J00A 4J16A 1TTEA 5LU8A 3I5MA 5IFLA 4C0SA 2DKFA 4BX8A 5JANA 3KQYA 4NQZA 5BUQA 3DM9B 3VR2D 3H6GA 3WR5A 1L4LA 3M2TA 1WMSA 2HRZA 3ITDA 3DZCA 2W2OA 1KMIY 2XEDA 3DTVB 5K5EA 1GPBA 3ESDA 1NE2A 3QHPA 4HFRA 4BRWA 2Z5LA 4Y6LA 3TYXA 3LMKA 3AI7A 5REQB 1FVOA 4NI5A 1JSCA 4UVDA 2B8NA 4A3VB 1EGQA 3S2ZA 1QNFA 4JGGA 1AIPA 2FNAA 4RA6A 4DB2A 1BHSA 5CT4A 1SBQA 1YR9A 1GQQA 4HDAA 1N6HA 4BGEA 1IEQA 2Y92A 3WRVA 3LCMA 2DT8A 4XUCA 1C30A 4D9NA 4DQUA 4KN6A 2NN3C 3GLVA 5DN6A 4CF4A 4ZEMA 2L7IA 3N2ZB 5BSFA 1ORVA 1HEIA 2IYZA 1JNXX 4LF4B 4ZEWA 1WU7A 4Q0MA 5HKKA 4OG2A 1HT2E 1E7WA 4JFAA 3T3DA 2WM2A 1CEYA 3GW8A 3ZHRA 3HXOA 4DR3B 1GKUB 1CUCA 2Q50A 4J7XA 3ZDRA 3IKMB 3LE8A 4JC0A 1N33M 3E53A 3F92A 3AMVA 4FGSA 1JMYA 3ZQUA 4X6YA 4HNUA 5KCZA 3U16A 1ZI8A 2XXBA 6NULA 4URWR 1LGYA 3GARA 5AVXA 2HIHA 1NW5A 1HOTA 3TLJA 4WOJA 4PYMA 2VSOA 2ATIA 2VJAA 5F51A 1KI9A 2H2FA 1Z47A 1FTNA 1FMLA 2IPLA 1Z9BA 5IVDA 5AVYA 5CD1A 3KP0E 2C03A 4N40A 3RJ5A 2XNSA 1ORWA 4RE6A 3WGQA 1APBA 3WGIA 4BQQA 5A9SA 1E77A 2C7GA 3KKZA 1C0LA 3ELDA 4IGAA 4NNOA 5FRDA 1G5QA 2ZIEA 3IE2A 5TXGA 1N0WA 4YJDA 2RG7A 1H3NA 3A3KA 2JA2A 3QY9A 4M0EA 1XLUA 5F35A 4DMHA 1DRJA 1SU7A 1PRYA 3DDOA 4DXDA 3L6OO 4NYJQ 1TU3A 2HREA 1XO1A 1YE9A 2DFPA 2VLBA 3OQIB 2LXNA 3PDIA 3MG9A 1ADYA 1Z7YA 4G09A 4HVTA 4H35A 5AOVA 5FR1A 3I0MA 1NMSA 4KAJA 4LRSA 4LXXA 5E1MA 3GLGB 4TV9B 4YWJA 3ND8A 4CKCB 4ITVA 1G66A 3ZDZB 5FOQA 1KEZA 3VX3A 4MP8A 1MAAA 4GHWA 1C1KA 1UAAA 4WZAB 1ZZGA 1YL5A 4LRWA 4WLEA 1QZUA 3KFXA 1ECJA 2HT1A 3GFFA 3HA2A 1IM8A 2HT6A 7AT1A 3QPWA 2ZRJA 5KDOA 2DLNA 3TTUA 3BMOB 4K6HA 4MA0A 3L6EA 4MIYA 3PFKA 2DRIA 4N3NA 4ENRA 4OCZA 4D8YA 4Q48A 2G0TA 3AVOA 2CXHA 3MLEA 3UA4A 4KWTA 3TTSA 3WO1A 2LH0A 3QTBA 4N0PA 2I33A 1PUXA 1M83A 3IV9A 3ZKWB 1CUVA 1GUZA 2QMQA 1ZRSA 2VWQA 1MX3A 1Z5WA 2OC4A 3C14C 1RSZA 3NHUA 2P6RA 1JDJA 5DCUA 1NW7A 1D2NA 5E4YA 1EJ2A 4BGDA 3GJ4A 1SC4A 4P4LA 1XA4A 1YV9A 1R74A 3FCCA 3PHIA 4IQ8A 4DYVA 4E0BA 1Q0RA 1VXOA 3AO0B 3JATA 4PN7A 2Y93A 2DAGA 1Z75A 3VLFB 4RM3A 5DNYB 1Y6QA 4DC1A 3W2TA 3ONWA 4H6XA 3KSJA 1XDSA 5JFGA 1QC5A 1U9IC 1WXFA 4FNGA 5DMHA 4TQUS 3PHCA 5H3HA 2C3UA 5IXJA 3B2EA 1Q7BA 2E49A 3IG5A 1OI2A 3MRVA 1H05A 4KJZA 1I36A 5H02A 2Z8YM 1B8PA 2AOUA 2OWEA 1UINA 4YY3M 1LK5A 3OJOA 4C6SA 4QAJA 2FWIA 2VK4A 5ECDA 2WJVA 4ECAA 4D25A 2WDPA 4I4IA 4OHOA 2E2WA 2K7FA 4XFJA 5LZ8A 1NXQA 2Q2NA 4YJ3F 2LPMA 1YB6A 1P2TA 1DOZA 1ONOA 1R9NA 2I62A 2MYNA 2P9BA 2JJ2D 1VMKA 1L4UA 1T5BA 2CVOA 2P2CA 3GFVA 3M3DA 5KSOA 2G9VA 4MWSA 1OTHA 3TIFA 1E0KA 3AFHA 4BKOA 4CUZA 4LNHA 1F4IA 2Z3VA 5CD9A 4ZDKA 3PC6A 3PJGA 3PR2B 3JWGA 3KTOA 1P4AA 2R8YA 3KELA 3X1ZA 4B7CA 2K9DA 5C52B 4ZQHA 4ND8A 1JHRA 1ZWLA 1W2GA 3QRWA 1W1IA 4LF7M 1G20E 2W6IA 2IFTA 5ALZA 1Q7RA 5IMBA 5D84A 5TPZA 4LC1A 3O1LA 4J3FA 3WVNA 3WWEA 2VF5X 4HEQA 5IDYA 4PLZA 4UPEA 3R5SA 2R6GA 3W9UA 2BFEB 3LPNA 3AVXA 1T8TA 1T2NA 5B7QA 5LWHA 4QNMA 1L5KA 1PTJA 1ZINA 3KK0A 3O82A 3BWMA 3DFUA 4JP3A 5JVDF 2JWSA 3RSCA 3OUTA 1NBEA 2G9UA 3D0QA 4JP2A 5K01A 3AEYA 1V7QA 2NVUA 3QBVA 5FA8A 1CR1A 1D1QA 4GEGA 3ZHXA 2X4LA 1QYRA 1ST3A 1THMA 4LF5B 2HF7A 1K98A 1MABA 1A2OA 1OAIA 1PVVA 1JL3A 2XLBA 2D7DA 3EXAA 3H5AA 4DR7M 1N0HA 3EPKA 4ES6A 1AZTA 3CZ5A 3TH5A 4IRMA 3VR6D 4AJOA 1CF2O 2HHJA 2BCGY 1ZD2P 2BPOA 1ZGHA 1LVGA 5SZIA 2FQQA 3PQFA 3I37X 1XALA 4WWHA 4E22A 3OZFA 4F5ZA 4HQFA 4JOCA 4FHFA 1W94A 4S1PA 4UDXX 1QPZA 4CJXA 1RWVA 5BOVA 4BCCA 4E1VA 1KZ9A 1Q12A 1U3VA 2C95A 1JEYB 3K53A 1EUDB 2A1TR 3OIVA 4MQBA 4WA8A 5CK5A 5EHGA 1T26A 1KQPA 1KDTA 4OF4A 5AVVA 4EMSA 2NQ2C 3MYRA 3IDFA 2ZT7A 4FI3F 5I7RA 1P2FA 1SKMA 4II7A 1ZO8A 2ODWA 4NK5A 1ZJ6A 3QPAA 2CEAA 1IONA 1W1UA 1U9IA 1YJ8A 4NAUA 1JTEA 4AQDA 3ADPA 5JHGB 4LX8A 2KWIA 3VO8A 3V76A 1XCJA 5K0JA 1M6YA 3Q9NA 2EYQA 3ISVA 4CEIB 1OLXA 5CDHA 1YE5A 4TL7A 5JI3E 5FWYA 2J3LA 2H7CA 1FBTA 4MKHA 1Q77A 1BVYF 4FBGA 3CUWA 3A0UA 2HJ9A 3PIIA 1E1NA 1I6LA 3SR3A 1C80A 3TWOA 3DFKA 3JX9A 5HKLA 3INTA 3NV9A 3W2GA 1JG7A 1WKBA 3FOBA 4XKJA 3H2HA 4HH0A 4QEDA