3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
4FR0A 5T67A 2EJUA 2GPYA 2HV9A 3D2LA 4LWPA 2ZVJA 3EVDA 4QPNA 3A26A 5KVAA 3M6VA 3JWHA 1KYWA 3BZBA 3R24A 4OQEA 3PT9A 3KPJA 1BHJA 3HVIA 1ZGJA 3UJAA 3A25A 2FK7A 1SUIA 3TM4A 3DMFA 3MTEA 4X63A 2BH2A 2AN4A 3GRUA 4E2WA 3FTDA 2YVLA 5K0LA 1M6EX 5EZSA 1ORIA 1DL5A 3C6MA 5FWDA 1MJFA 5EEGA 4PYNA 4RV9A 5K03A 2FRXA 1EJ0A 2CMHA 2EFJA 2PV0A 2ZIEA 3UBTA 3CGGA 3TRKA 3LL7A 3PVCA 4GOND 4DM3A 2NP6A 4CTKA 1Z3CA 3LECA 2YR0A 3CCFA 2ZLBA 2OB1A 3KPWA 3IHTA 5E1OA 4ATNA 7MHTA 2ZBPA 3E23A 1JG3A 4RTPA 5CM2Z 2ORED 3REOA 4YUZA 2IDKA 4EKIA 2VZ9A 3HA3A 3BWMA 3M6WA 3THRA 3SM3A 2ZTHA 5GIOE 5DWQA 4RTOA 1M6YA 5HEKA 3FUVA 1Q0SA 2A14A 2NXJA 1QANA 2QE6A 4KIFA 4XUEA 4Y30A 2Y1XA 5E8RA 3LSTA 1ZHFA 3KU1A 1XCJA 3MCZA 5FCDA 1KP9A 4YUXA 2XBMA 4BP3A 3FPFA 2R6ZA 3UFBA 2PWYA 5FULA 1QAOA 4FZVA 4KW7A 3UWPA 2H1RA 3HCBA 2GB4A 3LKDA 1INLA 2WA2A 2PGXA 4ISCA 3G7UA 5EEHA 2PX2A 3G8BA 1O9GA 3G2OA 4GQBA 3DH0A 1L1EA 3HCAA 5CD1A 4LECA 1NT2A 2UYQA 3FYDA 1BC5A 2ZIFA 3BUSA 3M33A 4PYMA 1TW3A 2GLUA 2OO3A 4QTTB 5EOVA 3KQWA 3CKKA 3DLCA 3GDHA 3BGIA 2H00A 3OU6A 4AZVA 2P40A 2CL5A 4IWNA 3GU3A 4DCMA 5BXYA 5F2NA 3DULA 5K8VA 4AX8A 4CKEA 2XVAA 4YV1A 2HR1A 2PX8A 2PBFA 2GA9A 3O4FA 1R6AA 3E05A 1YZHA 2ZBRA 2FPOA 2ZZKA 2IH5A 1D2CA 2QRVA 3I9FA 4PCAA 3RODA 1EAMA 2AR0A 5DXAA 3P9CA 2YXDA 1XTPA 4ER5A 2K4MA 4PYKA 5CUQA 4P7FA 4YMGA 1IM8A 5BW4A 2OPBA 1MHTA 3NWEA 1AQIA 1L3BA 2ZBQA 3ER8A 3TR6A 2I6GA 3BWCA 3MB5A 3GIWA 3LDFA 5DM1A 5LQJA 3KQYA 2AOXA 2PLWA 4ER7A 3P9NA 2I9KA 4CTJA 2G1PA 1ZG3A 2ADMA 2NYUA 4R6WA 5DSXA 3A4TA 2BZGA 3EMBA 3OZSA 4XUCA 1NV9A 2O0LA 2DPMA 5DLYA 4B17A 3NMUF 1X1AA 1L3IA 2N47A 2ESRA 5FQOA 2PXXA 1QZZA 3EMDA 3SSNA 1QYRA 1ZGAA 4OBXA 4DZRA 1H1DA 1T43A 5CCXA 4RVGA 2VP3A 3GCZA 1X1CA 2WK1A 3IYLW 1FBNA 2QRVB 4R8SA 3TKYA 4A6EA 3PX2A 3R9XB 3EEYA 4HGYA 5K0EA 3ERCA 4C07A 5JR3A 5C1IA 4RTKA 2AOUA 3CJTA 4GC5A 4FT2A 2YXLA 4BLWA 1XDUA 2CKDA 4PWYA 5T64A 3OFJA 4DF3A 1YFLA 5EVJA 1FJXA 1AF7A 2IH4A 4ER6A 1U2ZA 2IPXA 5DRTA 3EVFA 1KPIA 3EVZA 3G5TA 4HGZA 3QOWA 3LCUA 4C4AA 4ZTBA 1YUBA 1VIDA 3HNRA 3KQPA 2H11A 4BLUA 1R8YA 3I5UA 3P2KA 3KPUA 5EMLA 10MHA 3FUUA 2V74B 5HIKA 2G8NA 2P7IA 2YTZA 1ORHA 3SSMA 5D1HA 4QQNA 2AS0A 4UOEA 2NNWB 3G2QA 3UA3A 4CKBA 1V39A 5LQAA 1NW5A 5K0GA 1SQFA 2NXEA 3LDGA 1YZ3A 5FADA 3BKWA 4HTFB 4MQ4A 5CIYA 5K0FA 3CJRA 3HCFA 3KQMA 4P7JA 5E9JA 5GINE 1SVUA 3DMGA 5DPMA 3B3JA 3B3FA 3FPJA 1KXZA 5B1SA 4BY9E 5CVVA 3DR5A 1RI4A 3ORHA 3LHDA 4RVFA 4PNEA 4YV2A 3NWBA 4E2ZA 1KPGA 5DT2A 1VP9A 1KYZA 2P1DA 2C7QA 4OBWA 3B7PA 5GOZA 3FUWA 5EQJB 3NVKI 4RVDA 5DM2A 2GAFA 1OR8A 2EJTA 4GUAA 4Y2HA 3TOSA 4CWAA 3UZUA 3NJRA 2XYRA 1L3CA 2KW5A 3NW9A 2QY6A 3BGDA 2ERCA 1JQEA 2HWKA 1X19A 2GS9A 3PFGA 4FP9A 4X60A 4RX1A 4RTMA 2ZZNA 1HMYA 1UFKA 1YF3A 1R18A 3E7PA 1QAQA 3K0BA 5FHRA 3UJ8A 3JWIA 3DMHA 3G2PA 3NVMB 4GOOD 2OB2A 4M7RA 4YMHA 3NTVA 1VLMA 5LQCA 2B3TA 1SUSA 4EVIA 1QAMA 1XDSA 4QTUB 4C05A 5LR6A 2IFTA 3TLJA 3EGVA 2PJDA 1D2GA 1JG2A 5KQSA 4KIGA 4OX9Y 4HH4A 1IY9A 2AOTA 2UYCA 5EGSA 3T7RA 5ICCA 5CVEA 5GP1A 5FHQA 2NP7A 3BWBA 2Q41A 1UWVA 3DUWA 4PYJA 1O54A 3PLAE 3UA4A 3ME5A 2VS1A 3MTIA 3O7WA 3UJ7A 1NW6A 1P39A 5EMJA 4CXMA 1X1BA 1KPHA 4MHTA 1VE3A 2EG5A 3A7DA 2DULA 3JWJA 5DTQA 1EQAA 1NBIA 3UJBA 5CCBA 2B25A 3PTAA 3P9KA 3BXOA 3LBFA 5HFJA 3FZGA 1I9GA 3C3YA 5EMKA 1XDZA 3GRYA 2ONYA 4RTSA 2PX4A 3C6KA 2R3SA 1Y8CA 1IXKA 5EZQA 2B9EA 3ID6C 3HP7A 3GWZA 3FRHA 2LD4A 1RJGA 5DSTA 3LCVB 4CKCA 2JHAA 3RIEA 5HIJA 4E33A 1PRYA 3ANXA 4QVKA 1PJZA 3Q87B 3LKZA 3HCEA 3CBGA 4HTFA 2O07A 2JJQA 3ER9A 3DLIA 2JHCA 2P3LA 4LWOA 3EVBA 4E30A 2AOTB 2BM8A 2OYRA 5DRYA 4GF5A 5KQRA 1M0EA 2C7OA 3THSA 5U4XA 4GEKA 3Q7EA 4RVHA 4AZSA 4QVGA 2V7EA 3DP7A 5DM4A 4Z2YA 2YXEA 3PS9A 1BKYA 2B78A 1G55A 2OKCA 3FPEA 3CC8A 1KR5A 2AOVA 3G89A 4FSXA 3T0IA 2P3OA 3AXTA 3DXZA 2ZWVA 2ZW9A 3FTCA 5EC8A 3ELUA 4RTNA 3MQ2A 2HMYB 5EKXA 3KR1A 4PIPA 5FWAA 3V8VA 4DCGA 3KQQA 3U81A 4WXHA 3TQSA 3OE4A 3QOXA 3FPGA 3HCCA 3R0QA 1TW2A 5DTRA 1DCTA 4E32A 5D1NA 3B3GA 3HCDA 4YUWA 1I1NA 3P71T 3KQVA 3L8DA 3BT7A 2AVDA 2HNKA 3HVJA 1AQJA 3M6XA 2O06A 4HSGA 2UZ4A 1JG4A 3HM2A 3T7TA 4MIKA 2AN5A 2AZTA 5EIWA 5E9QA 1XXLA 2XVMA 5DX0A 3GXOA 3SXJA 1G6Q1 5KS2A 2PKWA 5DX1A 4DA4A 2FHPA 2IIPA 3HA5A 4XUDA 4NECA 2IH2A 9MHTA 4GOMD 3C0KA 3EVAA 5JUWA 1WXXA 5E8JA 2P3QA 5K0NA 1VBFA 4MTLA 5E2AA 3HVKA 5K0JA 3BKXA 4P7KA 3M70A 4FS8A 3I53A 1XVAA 3MERA 3UJCA 4R8RA 1R00A 5CVDA 5ICEA 4V0QA 5ICGA 3DOUA 2AVNA 3AJDA 1WG8A 3TPZA 3ELDA 2QM3A 3HTXA 3KKZA 3NDIA 2IGTA 1JTFA 3SR4A 4R05A 3B5IA 4A6DA 5C9ZA 3HVHA 5C0OE 3FRIA 5KYGA 3NDJA 1NV8A 3KPVA 3KQSA 1EIZA 3UJDA 3O31A 4O29A 3LCCA 3OPNA 4C08A 3I58A 4GC9A 3PX3A 1UIRA 4HG2A 2PX5A 4JXJA 4QPPA 4BLVA 3MHTA 5CVUA 3GRVA 3OFKA 2FCAA 3P8ZA 4E2XA 2YQZA 1JSZA 1RJFA 4OQDA 1R74A 4HC4A 1N7IA 5K05A 1SKMA 5P8WA 2PSSA 2ZCJA 1XJ5A 1G60A 3TM5A 2G72A 2PVCA 3HEMA 1JTEA 5LSAA 2UYHA 4PYLA 4WVLA 2JH9A 1FPQA 4EK9A 3VC1A 3LX6A 2CMGA 3P97A 4GOLD 4H0NA 2Y1WA 4F86A 2VDVE 5HOQA 4FSDA 1RI2A 5K09A 4RTLA 2PWPA 5E1BA 3MAGA 2GH1A 4X1OA 2NXNA 5F2KA 3A27A 1N7JA 1RI5A 3P2EA 1ZQ9A 3LPMA 5BW5A 3SSOA 4EKGA 8MHTA 1VQ1A 5GM2A 3FTFA 1F3LA 3DXYA 4PCLA 2B2CA 4EMSA 2FYTA 2OBFA 1FP2A 4QDKA 1I4WA 2I7CA 4DQ0A 4FT4A 3GRZA 2F8LA 1P91A 2ZWAA 1EJ6A 3G2MA 4MWZA 4QQKA 3S68A 2Z6QA 4IV8A 3TKAA 5H02A 4KDRA 2JH8A 3GJYA 3OU7A 4X61A 5E9WA 5HIIA 5DM0A 2BR3A 3OE5A 4C04A 4PGGA 5MHTA 2PXCA 5BP7A 3R6TA 4AZWA 3A7EA 3AWIA 4K6MA 4RTQA 3EVCA 4IV0A 3WSTA 1XCLA 1RI1A 1JSXA 3EGEA 3KQOA 5FQNA 5LQRA 4KRGA 1VPTA 3LBYA 2Z6AA 2ZIGA 4KWCA 4YV0A 5GWXA 3M6UA 5DTMA 5HIMA 3SVZA 1SQGA 2O57A 3DXXA 4PONA 3IEIA 3P9IA 5IKMA 1FP1D 3I64A 4KVZA 1R8XA 3OCJA 3BWYA 2FK8A 2IBSA 5EHGA 3EVGA 2UYOA 5E2BA 3OZRA 3GGDA 4AUKA 5LQNA 3EVEA 4RTJA 3VSEA 1WXWA 4F84A 4OA5A 3P2IA 4RWZA 3X0DA 4L7VA 5DX8A 2C7RA 4PGHA 3H2BA 3EPPA 5EHIA 3CJQA 4AZTA 3KR9A 4IKPA 2PY6A 5F2OA 2I62A 1NW8A 3VYWA 3K6RA 3BGVA 5CVJA 4YUYA 2AN3A 2AOUB 1NBHA 4YUVA 2WA1A 1SG9A 3OU2A 5HZMA 4G56A 4PINA 1N2XA 3E8SA 4GBED 5M5BA 5ICFA 1NE2A 4ER0A 5LQKA 2EX4A 1P1CA 2PT9A 4P58A 3ELYA 3KR0A 2BM9A 5IH3A 3AXSA 1G38A 5HILA 3FUXA 1JR4A 3G8AA 3KHKA 3MGGA 3FYCA 1D2HA 2BR4A 4F85A 2JG3A 2OY0A 4HRAA 2VDWA 1RJEA 1NKVA 2NXCA 1VP3A 4X41A 2CWWA 3KPYA 2PT6A 1F38A 3CVOA 4PYQA 3JWGA 4LG1A 5E1DA 4BP1A 5E1MA 4RSRA 5EMMA 3EEOA 5K01A 1KIAA 3GNLA 1JG1A 3SGLA 3UJ9A 2ZZMA 5EPEA 4R6XA 2IP2A 4M38A 4PYOA 2YUIA 4U7TB 3FTEA 5FUBA 1NW7A 3M4XA 1TPYA 1VL5A 4P7GA 3TMAA 3UJ6A 4U7PB 3FUTA 5GIPE 2Z6UA 1YFJA 1RJDA 3EGIA 3B89A 1EG2A 3KQTA 1AV6A 2PXAA 4E31A 1P1BA 1WZNA 1YB2A 3GO4A 1WY7A 2XYVA 2AOWA 1L9KA 4PIMA 5LQUA 2C7PA 2OZVA 1KHHA 3LDUA 4FGZA 2IBTA 4DKJA 2IDJA 5EG5A 3TFWA 2ONZA 4M36A 5DXJA 5G02A 3ELWA 4C06A 1Q0TA 3PB3A 3FPHA 3VC2A 5FA5A 2XYQA 4PYIA 4ER3A 1O9HA 3SMQA 1NW3A 3HA7A 4M37A 5FTWA 2OXTA 1X1DA 5EKUA 3RW9A 4POOA 3G5LA 2VDUE 2BR5A 4OA8A 1ZKDA 5FA8A 3MCTA 3F4KA 4E2YA 1DUSA 2YX1A 1RI3A 5K0CA 2HTEA 2G70A 3GRRA 1B42A 2O05A 3LGAA 3SX0A 3T7SA 4RTRA 1G8AA 1G8SA 2ZFUA 2P35A 2QYOA 2G71A 2JHPA 2P41A 2ZULA 4XCXA 4E70A 1JQ3A 3V97A 3OZTA 4EQZA 3QV2A 3R3HA 1JQDA 3IV6A 4KDCA 1BOOA 2P7HA 3DTNA 4QDJA 4RYLA 5GM1A 4V0RA 5ERGB 5K0BA 2E5WA 2ZSUA 5T6BA 3PFHA 1WS6A 3AY0A 3C3PA 5EIFA 1HNNA 2P8JA 3G88A 4C03A 3KR2A 4DMGA
chains in the Genus database with same CATH superfamily
4GH9A 1Q5PA 1VB5A 4FGUA 5CW2A 1TAGA 2HV9A 3AT1A 4PZDA 2QG9A 2UU9B 3KKNA 3ZHSA 3MSXA 2FWIA 3KX2A 2JAPA 3ZHCA 2IU6A 5JO9A 3MFYA 3ND7A 3VVMA 4D9IA 7MDHA 5K5EA 4CMBA 5DFAA 2YOFA 3AFHA 2YRXA 2CKMA 2P9TA 1H8ED 4IEEA 1R2ZA 4XJVA 1M6VA 3GZJA 4Z4CA 4EBBA 4JLAA 3T5AA 2ZRGA 5J2TB 1KEVA 1XVLA 5EZSA 4FWDA 2V1UA 1LJUA 2OORC 1LK5A 4RD1A 5HF6A 1MJFA 4MO2A 9LDBA 5JY1A 2CWBA 4W5QA 2OCBA 3U0VA 4CHGA 2OQ2A 4JYAM 1UBUS 3EIFA 1T8TA 1V5WA 2VZ8A 1ZCAA 4D2IA 3QU7A 4P0TA 3GVXA 2G67A 1KXJA 4AZFA 2HEGA 5CB4A 2G6BA 1Z5WA 4D98A 3CCFA 1X0VA 1ZIDA 3ILVA 4JQYA 3VTKA 3IG8A 5ENZA 2H6EA 2QXYA 3E23A 3LVBA 5H8WA 3UKJA 1XDGA 4INZA 4YUZA 4FYJA 2RHMA 1K6JA 2IDKA 5C8YB 4FLMA 4IBEA 1C9EA 5DWQA 1AUXA 2NO0A 3A1WA 1IN4A 1H1TA 4ZT2A 2YC4C 2I8AA 1MORA 1ADJA 1WEKA 4N49A 2DR0A 4QUDA 2Y9PB 3USZA 4NENB 3IIKA 4JKOA 4R0NA 3CRW1 4Q1CA 1M6WA 4LX8A 3HABA 4L16A 4MUYA 4URVR 4DPKA 3ITDA 2VPWA 1G71A 5A5EA 5J3JA 3C87A 4ZOCA 1PV1A 1L4EA 3FNBA 3OLYA 1BFKA 4PLTA 2C07A 3L4EA 2DLCX 3PUYA 2QX8A 4J1TC 1US8B 3IL2A 2PS3A 1XMJA 3GUCA 4KNVA 4X6LA 3EZ2A 2QQ5A 3F9IA 3FNGA 5MDHA 3ZJ4A 5AVZA 1DBRA 1OFIA 1NPYA 2DLDA 3G9XA 3HGTA 1MIHA 3H97A 3ZWQA 1N5KA 1YNSA 2DB3A 2WKWA 1NT2A 3DE0X 5ALSA 4OD0A 2PQ6A 4A73A 3W5SA 4C5AA 2FE1A 2C4WA 5JC1A 2QAGA 3K73O 1POWA 2I29A 4K05A 3CSSA 4RACA 3R3JA 4C20A 2R8YA 5BW8A 5BWOA 2P5UA 1VKJA 2JD2A 2YNMC 3GU3A 4Q7KA 4KO8A 4S1OA 4LZOA 3UXYA 3K70C 1OB2A 2VTDA 1GZHB 1QTQA 3CH4B 4N7BA 3TVYA 4OCZA 4D02A 1VSBA 2D8AA 1UJNA 2XITA 1RPAA 3CW8X 4QC2A 2IOFK 5DGTA 4QGSA 2B99A 4QRHA 1R6BX 1WXFA 2RMKA 3DEAA 3KQUA 3N8DA 3AUSA 1L5RA 3P9CA 4UDYX 4ZQEA 2DAKA 1REQA 3LCRA 4E5VA 1BXRB 4TROA 2FJPA 1LV7A 1GUDA 4TYPA 4WASA 2X0IA 2Q50A 1H6UA 3FF4A 3IDAA 3IPYA 1LF5A 2JD1A 3P0FA 3DNFA 3VTZA 2O3UA 1Z39A 5KSPA 4Q93A 1F4VA 3U1BA 3C5EA 3DZ8A 4PQRA 1FTGA 4QFBA 5KVQA 2W6OA 1IJEA 2O0LA 2WV7A 3RC3A 4BC0A 5MF6A 4Z3OA 3COJA 1PV2A 3CPHA 2DENA 1QZZA 4XFJA 5KZMB 2E18A 1R6TA 4OBXA 5FYQA 4UULA 2FP4A 3DEKA 4IZIA 2ZM6M 4MLPA 3DOAA 3AF5A 2A1UB 3EXEA 2IEIA 4B87A 5SZJA 2WFLB 3D5QA 1EFAA 3WLJA 7ABPA 1JQKA 2FRVA 4IH4A 2KDLA 1EM6A 4GC5A 2F48A 4FT2A 4M9CA 4QXMA 2YMMA 1M54A 1TM3E 2DM6A 1GNRA 3PKIA 1ZJ4A 5H70A 4K9MA 1U3DA 3EVFA 2MH8A 1EK0A 3PGLA 3PFWO 4ZTBA 1F0PA 4PG4A 1ZCBA 3TE6A 2I7DA 2LBCA 3PCXA 1WL8A 2IEGA 1COZA 5SYAA 3RIYA 3ZQUA 4IXTA 4FFMA 4JC0A 4DLRA 4ECEA 3U44A 2K2QB 4JASB 5LXTB 3N05A 1C3JA 3ZIDA 1EIJA 3RYTC 1ODCA 4N5MA 1JDBC 1GYQA 1SXJB 1C7YA 1W47A 1LDMA 4IJFA 3GQ4A 1C81A 1ZUNB 2OFPA 5AOCA 3BB3A 3DFUA 3L7YA 2J5KA 3I5MA 2GYVA 2WTNA 2ZB3A 1WB4A 2Q3MA 1S8OA 3H99A 1Q3HA 1VJ5A 1L7NA 2DCMA 4WCFC 3PV0A 3KQMA 4UM5A 1SU8A 3IESA 3HKCB 3W1EA 1QP8A 4MYCA 1PG5A 3FNEA 3L05A 2Z4RA 4Z7NB 1FDTA 1TA9A 4LXGA 4R54A 4PY2A 1GRRA 2ZRPA 2R6R1 2VBIA 3D6AA 2O8BB 1R7RA 1L4GA 1G98A 4LJAA 1UXKA 2O7NA 2FUG1 3EWNA 4RVDA 2OCAA 4PTYA 4DDHA 5HZKA 3PXGA 3RE8A 1ZP6A 1UUFA 1YFKA 2BSAA 2EC5A 3FYHA 3MJHA 4JJEA 1KDYA 3BA6A 4MO9A 4WNAA 3GROA 4AJLA 2C3YA 1THZA 5BPVA 1UFKA 5KQLA 3CE6A 2EKQA 1JR2A 1Y5LA 1P9NA 3OLQA 4R1TA 4AWAA 2LHCA 4MVJD 3UJ8A 3OJEA 4PDGA 4R1LA 3W6OA 2JGMA 2MYPA 4ZVLA 3STUA 3KB1A 4FOOA 4HQOA 5CFNA 4U0KA 2WU0A 2A4KA 4EJSA 2Q5CA 4C1NA 5IDWA 2YJ5A 1R8JA 1JFVA 4H15A 1XEAA 1DBQA 2XMZA 1CUGA 5KU7A 3W8RA 1SN7A 7AT1A 2PH7A 3CN9A 3UMSA 3TQQA 5KVSA 4AQ7A 2ZUEA 5KTNA 3OE1A 4IJMA 1MA3A 1OI4A 1TIKA 4I8XA 2AHOA 3NPAA 4DUZB 1USIA 4J2OA 1GXSB 4QOFA 5D7BA 5DLQC 2XMRA 1MJGA 1T3TA 1UANA 2FR8A 1GAXA 4J2HA 2DZOB 1KJNA 1WSBA 1X1BA 1ATIA 1G20A 1R6DA 1YGYA 2DAEA 1TQHA 4UD2A 4BJ1A 4AY5A 4X66B 1URPA 4JXKA 4PN7A 3LFTA 3RHFA 1CP2A 5C5EA 2H0RA 5HFJA 3H83A 4M22A 5CXUA 1E99A 1EGVB 3GRYA 2ONYA 1W7AA 3P9XA 3C70A 1FOEB 4DC0A 2YMPA 1MJ5A 1GGHA 1QIIA 3CZPA 4L2IA 4C0KA 1OIZA 1HEYA 4NCAA 1W85A 4TYMA 3LRTA 1EVQA 1LPOA 1CT9A 5G0UA 5FEMA 4A91A 1IBKM 4AQYM 1E8NA 1OAOA 1TKBA 2AT1A 2X1HA 5FTMA 2OSBA 2ZR9A 4LRTA 1A7KA 1DXQA 2WMDA 2UV8A 1J39A 1PFUA 5HIJA 3M4YA 1VJRA 2ZJ5A 2FSVC 4RF4A 2O01F 4Z4QA 2E4XA 1QOQB 4H7EA 4AP6A 1DAFA 3HE3A 5HP4A 1MVNA 4P38A 3WHPA 3PR1A 5LZ7A 3FNIA 4I1VA 4NEHB 3U6SA 5JPDA 1XU9A 1GKYA 1XTSA 4Z2YA 3GLIA 2F1JA 1NLUA 3ANLA 3PS9A 2OTCA 2QGZA 2WJJA 3AM3A 4HX2A 2XWQA 4NDAA 4PHFA 4WUVA 1EDDA 1KI6B 2WJAA 3C58A 4EW6A 5JNRA 3KYJB 2XE8A 3OJLA 3BULA 4W1RA 1FSSA 3BS4A 3RVBA 2CNKA 3T38A 2XGJA 2WU8A 1AXRA 1LS1A 3KD2A 1KOFA 1GCGA 3M34A 1O9BA 3GLFA 1G3MA 1K7CA 4CHTB 2FH5B 2Q3DA 2BI8A 3F71A 4M9SA 2W43A 5IYZF 1DPFA 4C4ZA 2HF2A 3ROEA 1TYBE 4M60A 2CXTA 1UJMA 5DHQA 2FWAA 1W5BA 5EXTA 3F6BX 3SJBA 3DL4A 5B7QA 1NR7A 3LZDA 2ISQA 1I4DD 1UXJA 2A9KA 2FPPB 2C97A 4TGLA 4X95A 1YJBA 2VNKA 4ITUA 3RC1A 2Y4NA 1GTG1 1Z45A 5LNK1 3S8MA 4I1IA 1QK3A 2VUSA 3KXKA 4LISA 2KM1A 3ONFA 1J70A 3C98A 4U2FA 4W1PA 5E9QA 1CX9B 4CIZA 1CTQA 2XVMA 5DX0A 4XSVA 3H1AA 3SXJA 1ZNZA 2CLEB 1DAKA 1DZ3A 2HDNB 1G19A 2XTZA 4K6CA 1KWGA 3RSSA 3I4LA 1Q2XA 3C1UA 4MUBA 1WMFA 2AMFA 1QGED 1C2YA 1IATA 4LOHA 4ICIA 4Q34A 4BWVA 3H4MA 2CFCA 2PTHA 4YPVA 2ZREA 4DNPA 1YTLA 4AJOA 2DHQA 1X6VA 3TLZA 4XWWA 4H7PA 2BP7B 2YNMA 1NLFA 1YZYA 2HNAA 2ZB4A 3WJ2A 5K4HA 4Q4AB 4BNNA 3ORQA 3T3IA 3L79A 2WIAA 2XTAA 2R11A 4M0WA 3TB4A 3I39X 3NHJA 1I0LA 4TQGA 5H81A 3O31A 3QE0A 1OH6A 1D9ZA 3LX4A 4TV8A 4DV4B 1ZD4A 1KORA 1PFKA 3T7DA 1PYOA 4I8DA 2B5WA 4HLCA 1S02A 3G59A 4ZQCB 1QGYA 2I80A 1X70A 3HKBA 4QTZA 1Z2PX 2BEUB 3K9NA 3X44A 2VDVE 1W35A 2I3ZA 2X7HA 3AG5A 3FCEA 3IIEA 4HEA6 1KAHA 3CQ9A 4KLRA 2O2CA 2PWPA 1EFDN 3QF7A 1Z0UA 3V80A 4DPMA 4B3BA 1SCQA 3HGIA 1V3QE 5F2KA 4N8DA 4R71A 4XVUA 1DELA 2WD9A 4R1NA 3DMPA 1R6UA 3IP3A 4OHUA 1GL6A 4PRYA 5IYZB 1H4SA 1R4AA 3K7EA 3FYUC 1X77A 2FUCA 5B1YA 1WP9A 4ZDKA 4OP1A 1U3UA 2DWOA 4FT4A 4AYXA 1P91A 4B09A 5FL7D 1Z37A 4TZKA 2JFOA 5LLSA 4CI0B 2X13A 2ZT8A 1WR8A 3F5FA 1MG0A 2A5YB 2VSOA 2W2VA 4KQKA 4V24A 3R7DA 1G8JA 3PI6A 4AS3A 1WXIA 3OE5A 2WRZA 3KZ1E 4TQ9A 3UICA 5MHTA 3BWVA 1Q1QA 2FSFA 2ZE5A 4FOTA 1EXVA 3H5TA 4H7DA 2XUIA 5DEOA 4Q16A 1FVOA 3TSWA 3L7JA 4M1YA 4BFXA 4LJ5A 3AETA 4FPXA 1SD2A 4RJ2A 4E14A 1SH7A 1B41A 3C6XA 4C3ZA 4GKKB 1XCOA 5ALKA 5EE9A 4OHFA 3JWEA 3UOAB 2VT6A 2BEJA 2RB4A 1OJ7A 3I09A 4BNKA 3VYTB 2OCDA 3D6VA 1Q02A 4UVGA 3OCJA 4OYRA 2I1VB 1NNJA 1CZHA 2VHXA 3FCAA 1BEEA 2EW2A 3D31A 4JDUA 4A3VB 4M55A 1Z22A 4ZVKA 1G1AA 4Q1EA 3THYB 2X86A 4AJNA 1XZGA 3AY6A 1ZIXA 5EN4A 4HNRA 5CT6A 2GO1A 4HD8A 4TRNA 4WH0A 4KOEC 3CJQA 5EPUA 3QX9A 3WGYA 3WAGA 3RPEA 1FX1A 4BO5A 4PLCA 2RHCA 4DQUA 4ZK6A 3O0DA 4YUYA 1SVKA 4JELA 2FQXA 4V03A 5ALOA 1XHEA 3AJAA 3D4NA 2AEJA 5L9AA 4G0XA 2J4DA 1N2XA 4Q3NA 4D0NA 4H1WA 3C3BA 4RO0A 1BKSB 3ZYZA 2AEFA 3DB1A 3DDSA 3AOEC 1M8FA 1P33A 2Q62A 2QD3A 4CQMA 4TZ6A 1HJPA 1QWSA 3OH8A 2H1WA 4B3TB 1AD2A 5INTA 4GOJA 1Q22A 1BRMA 1Z15A 4FCWA 4HN9A 2QBYB 1I33A 1X1SA 4KIWA 3O75A 2WVGA 3LPAA 2OHXA 2I87A 1ENYA 2LE0A 4X41A 4MI6A 2E87A 5BNZA 5EWLA 3AV3A 3UBMA 4BQFA 4DG8A 4HNGA 2DE0X 5DTIA 4EI9A 5L53A 3ZIAD 4N5HX 1H3NA 1KYXA 2P11A 1CUYA 4TTIA 1WTCA 2LWIA 5DO9A 3LC1O 3WGLA 4EB0A 3W4KA 5C3MA 4GX1A 4GDFA 4MWGA 4MZXA 4RPLA 5DMHA 3FUTA 4Z7QB 5FH9A 4M0EA 1NZFA 1H2YA 1JNYA 4HWOA 4QU0A 1KRWA 1Q3TA 1WY7A 4WLOA 1TMGE 2X49A 3CONA 3PL1A 4HV4A 4PO9A 4DIKA 4D6YA 5H59A 2ZAOA 1M33A 5K3BA 5YASA 4OREX 5AFSA 2GPBA 2ONZA 4M36A 1VEKA 1Q0TA 3DO6A 3C8HA 5ULLA 4ASUA 2IUEA 2DBVO 5SICE 3OY7A 4FMBB 3FOCA 4LX0A 4MJXA 3JVDA 5BN5A 2QN2A 2Z30A 5L6MB 1PJ3A 4TUYB 2IRWA 1SD1A 4NDNE 1W29A 4UOQA 1GM5A 2VSNA 5FO0A 2CLMB 4DSOA 1RI3A 1MTOA 1T25A 3L4BC 2PUFA 3A37A 2JLBA 2HWJA 1K66A 1XIVA 2WHXA 1WB6A 1TF0B 1T36A 2C4KA 2HWWA 3BFKA 4HZIA 1QHHA 3UFXB 4DRXA 3IKVA 2PA0A 4KH1A 4E4YA 4OQLA 3ZWOA 3IV6A 3OCYA 3PZBA 1T9KA 4B85A 1EP1B 1KMQA 1Z2NX 4IGIA 4ZOQI 5ERGB 4L4XA 3TQHA 1OX4A 4ITVA 5ERXA 3GLHA 1DQZA 2VTEA 1Q1EA 3AYXB 5DSZA 3U9TA 1TAUA 2RGGA 3DE4X 3KWFA 1RKQA 5A71A 4HMPA 2N3ZA 2XH9A 4JI1M 2BF4A 4I0WB 3VI3B 4P36A 3K5WA 1B1CA 4GKJM 1AXEA 1DWOA 1NYRA 2W37A 3GA5A 3BWEA 3TTVA 4B3FX 3HWX1 4HYTA 1TIBA 4NMHA 3HMKA 4QUAA 1PR5A 3NG1A 4AF8A 4AS1A 1H0HA 1DEOA 4MKZA 3RU3A 1SUIA 3QQPA 4M9QA 1N57A 4FDAA 2P4UA 2PU5A 3GRUA 4RM3A 4UNIA 2YRFA 4B6EA 1J2JA 3D64A 4NAVA 4YAGA 3DTTA 2A5LA 3LE8A 3ONEA 1SBIA 1ZXBA 2C42A 4UTPA 4NESA 5F9MA 3AERB 5FNVA 1KA9H 3DZFA 5AM2A 4TKVB 1A8PA 1FUYB 2IKQA 1PUIA 4N6OA 1UBRS 1WVMA 1KC3A 4FX5A 4ZJZA 4K6GA 1Y1PA 5TT1A 1KK3A 4I3HA 1Z3IX 3OP1A 4KYTA 4GPIB 4CMGA 3FD8A 1QYCA 1K2WA 1USUA 3FKJA 1YR9A 3SC3A 4DY6A 4HADA 4U7JA 5HS6A 4BQEA 1PUXA 4EZEA 4Z1OA 1E5TA 1FFCA 3OE7D 5HEKA 2A14A 1MA0A 4H7JA 1V5IA 3AFOA 3IALA 2BMJA 5I7VA 1RAHA 4A0SA 4BDTA 3HJBA 4ZDWA 2C29D 1EHIA 1Z7YA 1J42A 3MBIA 4D6XA 3TI9A 5GOTA 3KT3A 2QQ0A 1KY5A 4XQCA 4FZVA 4K88A 3RBAA 2Q28A 2V6JA 3WIUA 1TMOA 3TWLA 2M1XA 4J16C 3KS8A 2Q2WA 3B8EA 3ED5A 3V33A 3ZGLA 2C2GA 2PBLA 1MC8A 1W0KD 2AC7A 2VHJA 3PNSA 4ZJUA 1V8OA 4PO3X 5KAPA 1YZGA 2QG6A 1BMDA 4BZPA 4HBZA 4DG9A 3ZD9A 1J8FA 3GPUA 3U26A 1JXQA 1MD9A 2XCRB 1ZL0A 1OLUB 3EUWA 3N5KA 3TEFA 1QYDA 2OCYC 1Q11A 3LI2A 2FZLA 2AI3A 5BNFA 4B1FA 1M34B 3K1AA 3Q1LA 3R6LA 1II9A 4LHEA 2H00A 3JQAB 2CHUA 2PGDA 4OXQA 3RUAA 2OQIA 3B13B 3SQLA 3AF0A 3ZKWA 3ZR4B 5BXYA 1Q0QA 5DI9A 3OJCA 4AX8A 1MFZA 3GEHA 2PRSA 3G5UA 1BVYF 2PBFA 1JLMA 1Y1QA 2C9YA 1DQPA 3E05A 4MWBA 1W88A 1RLMA 2F3TA 1II0A 5DB4A 3DW1X 5FL3A 4LCBA 3RODA 1VDMA 5EJAA 1AZTA 3ISTA 2H0AA 4LHVA 2C9MA 3E6AA 4IR7A 4PX9A 5CUQA 3WK8A 1QLJA 4YHHM 1LB1B 1MDFA 1V11A 1EUDB 2IZ6A 8LDHA 1FFEA 4RD4A 4RIGA 2ZBQA 2PUGA 3QGMA 2I6GA 3W5AA 1LDEA 3D3KA 1K0UA 3PDWA 4WK0B 3D8TA 3NGMA 4Y6SA 3FCCA 2FEOA 3BE5A 2V96A 2G1PA 2D62A 1D4AA 1GG8A 2VHWA 1W4CA 3QP9A 4R6WA 3UYLA 1CEXA 4O4IB 1ND6A 1VMKA 3F1LA 2CBZA 3NMUF 2P4HX 1EDOA 1CRPA 3QEMB 1Y4ZA 3JYPA 1SBQA 1KP2A 4IBBA 1WZUA 3WL5A 3ZC7B 4UQPA 2V98A 5LWHA 2OV1A 4CMIA 1P0FA 4NU5A 1FUIA 1W6UA 3MUNA 4RZSA 1T43A 4FZRA 2SHKA 1T9BA 1MGOA 1YL7A 1DWQA 4WK4B 5SY4A 2HK9A 3QXJA 4BP9A 5I7HA 2HL6A 4P4LA 3REQB 4R8KA 1NXSA 3RV4A 4MW1A 5C1IA 3BSSA 4FE4A 1FYWA 2Z7JA 3V2HA 2ZUTA 1DEHA 1IQUA 1R3DA 1E2MA 1N2EA 5CDFE 2IH4A 3WGZA 5JPCA 5KTOA 3HFRA 5CBPB 3TCXB 3LCUA 3M4ZA 4QOGA 4W8OA 2ATEA 4B6PA 4CEIB 1EFUB 1R8YA 2P2SA 1LBIA 1ISSA 5JCJD 3I01A 4H4DA 3O8CA 1C8KA 2GQ0A 3E9MA 3U13A 4L50A 2YZNA 2V9PA 2ANCA 3GDOA 3ZV5A 1XALA 4RK0A 5LP6A 3V8QA 2X9QA 4XYBA 5G1PA 1X0XA 1QDRA 1NW5A 1TF5A 2AYZA 4KPYA 4KAJA 2R1VB 5WRFA 4G5FA 1VA5A 1OOEA 2J0UA 4U2CA 4AECA 4TWJA 5E9JA 3LRXA 3DMGA 4TSFD 4FOPA 4DFDA 2M5ZA 3T4UA 1Q92A 4XW2A 1C3OA 3NWLA 3MRVA 1BS9A 1BD4A 1YU9A 1NONA 2VDRB 2VF7A 5E6UA 3TO5A 4LGYA 3B7PA 3TWMA 2WNHA 2W82A 2POCA 2C99A 5GOZA 4BVEA 2KSQA 4C7JA 1AH2A 2QT0A 4JI7M 2ZK7A 2D5IA 4IVNA 3TQRA 1T34A 4K0RA 4P4UA 1NJGA 1Z9BA 1WXEA 2D2IA 3UK1A 1VYHA 3HRHA 3G9TA 3NASA 2C5SA 3E7PA 3E5RA 3OEEA 3IVCA 1M2NA 2BFCB 1ECLA 4MITA 2QWXA 5B58T 1LX7A 4ZK2A 1T36B 4L8VA 1RPJA 3NTVA 4V2UA 4ZVUA 1HNWB 3CWCA 4AYTA 1XDSA 2HKJA 1UQRA 3DE7X 3JATA 2C5EA 4WZBE 2LKDA 5CJJA 5COQA 5KQSA 2ZP1A 4QODA 1B2RA 4NDZA 1F9AA 5FR1A 2AOTA 2DMRA 4EAQA 4JQOA 2F9LA 4TUYA 2QRMA 2G9NA 4Z1MA 2WF9A 3WYEA 3CLTD 1XLWA 1DJLA 3B6ZA 3L4BA 4BFSA 5JVDB 3BJMA 3EGCA 4EPXA 4BZWA 1U5AA 2FN9A 2GJSA 1ICIA 4L6V6 4Q7JB 3W8DA 5DTQA 1VIYA 3JALA 4Q9LA 1JU3A 2IBMA 3PTAA 1Z88A 1ZISA 2IOQA 2OOSA 3BXOA 4MRMB 4Q82A 1LBTA 3IAS1 3IEXA 4D46A 5HF9A 4CUZA 1LRLA 1PJLA 3ICQB 4WOJA 3TFQA 5EZQA 1IIRA 4KLAA 1GZ4A 3PRKE 2XLBA 4F4HA 5BYAA 1TEZA 4IMRA 1VI5A 2QSZA 1E3WA 5DCUA 3RC8A 3GPYA 4LYHA 2H7VA 3HVUA 3LW7A 4MP8A 1AIPA 4H0FA 1Z5BA 1NQOA 1IN5A 1QRSA 2ZRLA 5A0FA 1QQTA 2DHEA 5KNCH 4NXNB 1H5NA 3GJTA 5BR7A 4IF6A 2MSCB 3U7FB 3DT9A 1ZRMA 5DIFA 4E51A 3K0EA 4I19A 4DA0A 4LYAA 5AJYA 5LBIA 4XTCS 3E53A 3NXKA 1PQ4A 3REFA 3T7IA 2YXEA 2ZWPA 3AUFA 5AO9A 5F4ZA 2HA6A 2OLEA 4I8IA 2VEDA 3M2TA 4CPDA 2IWRA 1AE1A 2WPDD 3WOVA 2W42A 1UMDB 7YASA 3GFSA 1EMDA 2QE7A 3EW7A 3N2KA 1M5RA 2BMAA 4NSNA 4Q9NA 4QKQA 4PAMA 3WI7A 2WEKA 4B2LA 2HHHM 4WLFA 3FYTA 1LJ8A 4F6LA 3TQSA 1H05A 2QRLA 2PDAA 3OE4A 4MVJG 3RAPR 4ARZB 1KSHA 3HCCA 2YY5A 4J0KA 3U0BA 5GVSA 3SQWA 5K3DA 3TIXB 1IHPA 2QUHA 1K88A 4F60A 1Z73A 4NICA 1QQ6A 5AUQA 1V96A 3IT2A 3RCBA 4E94A 1PSWA 4R2HA 4AJ9A 4JENA 3U3KA 2A1TS 1ZJ6A 5ESDA 5CLJA 5FDFA 3L6RA 3ZI7A 2GXAA 1FMFA 4Z51A 4GR4A 4OQMA 4G0MA 5C1OA 1LQTA 1YRWA 2OHHA 3ENVA 3RSZA 1FNSA 1P7PA 1QUTA 2R8RA 4ZV9A 5AKYA 4EELA 5F5LA 2NU9B 1SUWA 2VTKA 1QG4A 5C8XA 3EZLA 4EG7A 5FWXB 3GGSA 1RBYA 4MRRA 3U3DA 4EG5A 4TM8A 1WDKA 3QU4A 3JQ9A 5CEJA 3ER6A 3IUJA 5JH7F 2UUCM 4O4IF 1OE0A 2Q07A 3ENKA 5K0JA 1USVA 4TKZA 2AJBA 3SYRA 2VUIB 1NR1A 1ZN2A 3I53A 1NNSA 3MLEA 1Z0DA 4JV5B 2W00A 2OXEA 4OSPA 2H1SA 3C7AA 5IJXA 4D41A 5K4GA 2RG1A 3O2SB 1IJFA 1TMYA 4DQDA 3NGXA 3A98B 5JC8A 2Z83A 4A5OA 5K8TA 5C0OE 3X2SA 4JNKA 3WDSA 4KTTE 1IFXA 1L7DA 1FU4A 1ZONA 3GUYA 2ECKA 3NM4A 4YMIA 1FE8A 2DPHA 2Z95A 2DAGA 3U49A 4ZMBA 1H9AA 2I99A 2X0RA 4N12A 3SQOA 3KQNA 3L6EA 5L8RF 3ESDA 3LMKA 1G42A 2ACEA 4EA7A 3OFKA 1HTBA 2WYUA 1JSZA 1SEPA 3FX2A 4HC4A 5K6AC 3KNZA 4RH3A 4LK2A 2ZCJA 5FBQB 3UAWA 3EARA 2ONCA 1IMJA 1DGHB 2JCYA 4LXYA 3R74A 2QPTA 2X3FA 4GOLD 1Z0ZA 3A46A 1ENOA 4CKXA 3LGSA 4FSDA 4I5DA 2IYTA 1K7FB 2HO5A 1SQSA 3DLAA 3KZVA 4QDUA 4U4AA 4YI3A 3CR8A 4L15A 3GRPA 4ME6A 4LMAA 3JYQA 3KHUA 4I4LA 4HLUA 3HJAA 2ZRNA 3F0TA 4K1LA 4YP9A 3V4RA 1DTWB 2VK2A 4AURA 2UAGA 1HMPA 1K6IA 3TZLA 2J4CA 2UUPA 1B3BA 2P78A 1ZCZA 3D3WB 4FGKA 2AG1A 5KAMA 4BUCA 1M1ZA 3CKLA 5JNSA 1X7XA 4R9VA 1K7XB 3CUEF 3H2ZA 3ZHYA 2BELA 2ZWAA 4MWZA 3HZOA 2NW6A 3JQ8A 3UMYA 2AXQA 4M21A 1RQ7A 4DLTA 4RHFA 5KYUB 1QB7A 3H8WA 2YC2C 2NUTA 5LMNM 1QK5A 3HXLA 3U4GA 1R0RE 2RBKA 3EF3A 2W2MA 4FW9A 4NP6A 4O1IA 2XE4A 1P4HA 1JMYA 3D8SA 3HS3A 3T1YM 4CM1A 1F8FA 4IV0A 1OFUX 3ZHXA 4AQDA 1Z5UA 3MJ5A 4TV9A 4B33A 1GWNA 2DPLA 1M74A 1Z2EA 1Q14A 1TEXA 2AW5A 4NC6A 2P9YA 3M6UA 4IWYA 4WXPA 4RU1A 2BRUA 5M3BA 3RSLA 4QG3A 4NHOA 4HDCA 2XEDA 5BYBA 1U3CA 1JVNA 4Z4GA 2BMWA 1ZEJA 4A36A 5TPZA 3OIDA 2DWPA 5K9ZA 3L4KA 1SHKA 3M9LA 4G9GA 4QA9A 1VG1A 1O77A 4FJ2A 2Q49A 4XDYA 4ZD6A 2B1QA 2VDJA 4KRXA 5BSRA 2D59A 1JHUA 3RSOA 1GYRA 4YXWA 1PWEA 1Y1LA 3R7NA 1N6IA 1XZCA 2D5CA 4E09A 3U7IA 5KC9A 3GLFB 1Y6JA 2VXYA 4GS5A 4HEA1 3KKOA 4L51A 3IVGA 4ZYTA 1MU5A 2AJDA 1GUZA 4PE5B 5AK5A 5IVPA 1VCHA 1CRWG 1CUAA 2NGRA 3S44A 1L1TA 1P0QA 3H1FA 3NDPA 4U6SA 5EJ9A 1EA5A 1KO8A 3TSZA 4EBFA 1NVVR 2A9JA 4PLPA 1JDZA 1XYYA 4OO3A 2WJIA 1LS6A 5C8YF 1EIWA 1P7ZA 2Z8YA 1AG9A 4BU1A 3HYSA 2BM9A 3KEOA 5EERA 1PNVA 3JQPA 4KDEA 5KKCA 3WB9A 3H6KA 4XB2A 5LB2A 1AK9A 3OZXA 2I8CA 2JAOA 1S01A 2IDMA 5C4MA 5IWCA 2X2FA 2XECA 3L9WA 1YDMA 5IFKA 1BA3A 1N33B 2WUFA 3SARA 3DFFA 2WT4A 1MFPA 2H29A 2ORWA 3I5AA 1YC5A 2INGX 2RHLA 4PO1A 2N35A 1F38A 4P98A 4ZVRA 1U7WA 3VOBA 4KQMA 4A2PA 4BP1A 4WESA 4IUDS 4K6FA 4RSRA 5E38A 4F1IA 4YCMA 1VHQA 2MINB 1U8AA 3I6YA 3ZQKA 4BRZA 1CUVA 1YZTA 4TRJA 4U7TB 4Z0TA 1W85B 2EW1A 1Z06A 3JS5A 2B1JA 1EPUA 2Z6UA 1PW5A 4QYIA 5JW6A 4CQLA 1GO2A 2G0TA 2GILA 3ANNA 1BCRB 2MWMA 3WGKA 2H4WA 2J41A 1TTPB 3OPXA 4NYIR 4RW0A 2R4EA 3C24A 3HJGA 3ASVA 4MIOA 5JNVA 3LDUA 1P17A 2Z5FA 4OHOA 3M5PA 3GV0A 2E4ZA 2OAQ1 3IUBA 1DAIA 4BO7A 4Z54A 1PTKA 1H4TA 2XYQA 1GXSA 3SMQA 4K6HA 3MT9A 1DLIA 2EKZA 1T3HA 4OHZA 3K9LA 4LV8B 1GUFA 2ZJAA 3TDMA 2QMQA 4MV8A 1RIFA 4IBDA 4PLYA 2GOYA 3U09A 1VL8A 3IMGA 4X44A 5FOWA 1X9GA 5SY9A 2V0CA 3KQHA 4XYEA 1O2DA 1CNEA 2P35A 2QYOA 3PDIA 3Q3GE 3G1WA 3FOZA 1DAHA 3CPEA 1Q7BA 4HFMA 2ZULA 4GX2A 3K9BA 4MRPA 3Q88A 2W8BB 1E1MA 2G7MC 1QHXA 1SKBA 2P7HA 2R5WA 1GCIA 3H16A 2C94A 1XN1A 1EFPB 2F5QA 1W2GA 2BBWA 2GFHA 2NYRA 2QU8A 3I0ZA 2AG5A 3O73A 3AHFA 1NFQA 2G9ZA 3R40A 4S35A 1N2JA 4X1IA 4BGDA 3SVTA 2J9ZB 5EIFA 1T5LA 1CDDA 4BKRA 2ZSKA 3DE6X 4HGNA 5FUVA 1OKKA 3M6LA 3UCXA 2EAUA 1EX6A 2CNLA 4PHHA 1BRTA 3G0DA 2ZVJA 3SMPA 4UDXX 1NASA 1D3AA 1L7RA 1TJ5A 1GRVA 3JWHA 3NNNA 4OXXA 4IKOA 5KVAA 3RVMA 4F9EA 4LOIA 4UHCA 5BR8M 3SU8A 2C5RA 2ZETA 5BYJA 4EO7A 5IKPA 1V71A 2O2IA 3E3AA 3TNJA 2RH8A 3EWSA 1Y7PA 3CIOA 1U6IA 4WIAA 3W79A 1UOPA 1SU7A 5ITYA 2UUBM 2PQ0A 2QENA 2XF8A 2YVLA 2LCIA 2Z43A 3AEUA 1ZH6A 3DTYA 2JVJA 2ZRKA 1B74A 1S89A 4HH0A 3ZG6A 2X3UA 3CNBA 3PC8C 5FTKA 2PV0A 4XVHA 3UBTA 3GLGE 1LLDA 1OXVA 5IHPA 1PHRA 1KY2A 3K4HA 4R8MA 4N3AA 4BNFA 2QZ4A 2BFEB 2LIVA 5D7NA 1R0LA 2B20A 1WZEA 3X43A 5LKRA 4R3UC 4YRIA 1GG2A 1WZ2A 1OGIA 3ABSB 7MHTA 1U5BB 2AXPA 2ZUVA 3LT2A 1W0CA 3QSGA 3QVOA 3VTAA 5CM2Z 2C3OA 3ZDZB 1PLLA 2PGJA 1FJ2A 3BQNB 2DLNA 4HI0E 4GLBA 3ZWXA 2WVAA 2XVZA 3GJ7A 3HA3A 4MLZA 3GB9A 1QANA 1NN1A 5HM8A 4DBZA 2WVHA 2AFVA 3FCOA 1K86A 5B7GA 2HHAA 5JZ9A 2CFIA 5CYFA 1DNPA 4A03A 4P81A 1VHJA 2IHTA 5AVXA 3W2TA 2FMTA 5CEEA 1KYTA 2OE2A 3H2HA 3P2OA 5BWBA 5I45A 2HW8A 2Z3WA 1T6NA 1LDBA 3L5OA 4M1MA 1NSYA 3U6MA 1GG5A 121PA 2A3NA 4DR5M 4DCPA 2PJRA 4FFBB 4TYYA 1C3XA 4W5RA 4B5LA 1XC8A 4X7BA 3N1UA 4G4GA 4ERNA 4F38A 1I94B 1AURA 3NBZC 2XKKA 3E2IA 4UEQA 4BNZA 1MZPA 3G2OA 1C8LA 1XYVA 1HLFA 3W06A 4KIUA 4XARA 2HCRA 3ZD8A 1NF9A 2W2KA 4EWLA 4J7CA 2GZ2A 3ZVKA 1SCUB 4MGYE 3ET5A 4DYDA 4QTTB 1KJJA 1YQWA 3ACBA 3ZX5A 4NV1A 2QTLA 3GFOA 4LAFA 5JISA 2GAAA 4XRGA 5DT9A 1N3LA 3N39C 2X6RA 1P1KA 3MB8A 4L0DA 1L7MA 2CJXA 1OXKB 2BWBA 3HY6A 4UUPA 5AM5A 2R2AA 4IZHA 1DMSA 3RFVA 3R23A 4KZPA 2G9QA 1FL9A 4LHWA 2G4VA 3P9YA 1KZHA 2P5TA 2IH5A 5DF1A 3KDAA 3PUJA 1E9DA 3TSAA 2P9CA 1QDTA 1CY2A 5HGJA 2ZUWA 3FIJA 3LA8A 4RJIA 2PWBA 5I9TA 5G4KA 4PM4A 3V6MA 5JMWA 2GMWA 2DU8A 2XGOA 3PQEA 4M9RA 3BWCA 5BSHA 3ZDEA 1ZGGA 3KQYA 2PLWA 4LF8M 4UJ3A 3ADDA 1RXUA 1YGPA 2XODA 1QIEA 3UW3A 1Y6FA 5DSXA 1SVIA 3L1UA 2LIPA 3QWIA 1D0SA 1H2EA 2ZI4A 2XF3A 4X65B 2BGGA 1DAOA 3BORA 3H65A 1ADBA 2UUAB 4EJSC 1X1AA 2F1RA 1VLHA 2J3KA 4FWHA 3CRMA 1PR0A 4C21A 4EMTA 1UPUA 5L6LB 3BSFA 5MFZA 1EZ1A 2I78A 1NZJA 3PQ2A 1KEZA 1JP7A 2VNAA 2VPIA 3IYLW 2E1RA 3MAAC 3VFDA 4LGMA 4DIUA 5G4LA 4CNQA 4BFUA 1IN6A 4ZT4A 2O8DA 3VYRB 2WYOA 1OFTA 4IDNA 4OGLA 1VRCA 1FDSA 3OFJA 4FB4A 4S24A 2YV1A 3NWPA 1RIIA 2GZHA 3WBBA 1M1NA 2Q3JA 4JR1A 2IYQA 1TH3A 2JCXA 1A8QA 2ATXA 3H5OA 4JQZA 4EX6A 2AJ8A 2ISCA 3K70D 3U31A 3TQIA 5EMLA 4UNPA 1RMYA 1E0AA 3OOEA 1A9RA 1ORHA 2ID9A 2GNAA 4MPJA 4O1MA 1EHCA 3FVQA 4PR0A 5IAGA 4UOEA 4B3SM 3AVUA 3WNBA 2VPTA 1XVIA 2FSSA 1DZIA 3QTBA 4Z8YA 1J0BA 3LDGA 1ODIA 3Q3VA 2CXHA 1PUJA 2RH9B 3DAHA 3E9ZA 4TSKA 3Q0IA 5TPZD 4N0DA 4P7JA 1C7FA 4BB5A 2FKNA 3H5LA 4B3XA 2GJAA 4CQNA 4ZAXA 3KZMA 3OJXA 2XXAA 1ZN9A 1Z2CA 3DHWC 3LTEA 2D3WA 1Q21A 1ILWA 3IR5A 4I3FA 1CHNA 2CDRA 4JSYA 4F4CA 2NAFA 1KS9A 2EZTA 1PJBA 3RUIA 3FUWA 1WBDA 4GZ3A 4MQMA 1T9ZA 1MO3A 5TMEA 5IAAA 3L1KA 1Z0IA 4RQUA 4TV8F 1X19A 1VDLA 4NU0A 2GXUA 5TF0A 3PK0A 4ALKA 4Y6PA 3GFTA 1YJCA 1Y9AA 3GR6A 3E3OA 1R37A 4L7QA 2W5UA 4FYXA 4LDNA 4Y2SA 1GRQA 3MRTA 4ENPA 3IGFA 3G2PA 4EA8A 4Q9IA 3AQ4A 4YMHA 2H2IA 2FR8C 4EJ6A 4Q66C 2F55A 2EYUA 4GZLA 4OK6A 4EVIA 1DMRA 4N6NA 2IFTA 4P35A 2DUMA 3TRIA 2J8ZA 4DV0B 1M2EA 1JWAB 4M1OA 2HF8A 2KBEA 3SXUA 3IDQA 3VSAA 3WGHA 4ARUA 3G2NA 4M99A 3GG2A 4Q02A 3TTYA 7CATA 5DBFA 4M1QA 3D81A 1LNZA 3HN7A 1JJ7A 1SKYE 1STOA 1D1TA 2RIRA 3FMFA 3I76A 3UH1A 4YDRA 3X3HA 1ZM2A 4PLGA 5C1BA 1HE1C 1RWQA 3EJWA 1NXPA 1EXMA 2E3JA 2G5PA 2C4VA 3OWHA 4IX1A 4AXXA 2E5LB 4W5OA 1V8FA 4D9CA 4EUNA 4XB1A 1SBYA 4TT8A 1H0RA 2BMDA 3JQBC 5ALVA 3AVXA 2CEAA 3GBVA 2AXEA 3E3NA 2QRNA 1BQ3A 4MGZE 1HFKA 4GZ5A 4HAUA 4RLFA 4WQMA 1DINA 4FIDA 1HG1A 3OPQA 3ID6C 2DVMA 3HUEA 3VAZA 1AY0A 1YS7A 1CS0B 1PGOA 1UXIA 3OM1A 3OT1B 4QYMA 1UAGA 1HRKA 2NV0A 8ADHA 2Q1UA 2XXAB 1TNDA 3RIEA 1ZKMA 3JYHA 4K9NA 2VYFA 1GZ5A 3PKJA 3TIGA 2B82A 3AIIA 4WBNB 3MTGA 3SQDA 1VL1A 1DKQA 1GYPA 2NSDA 3OLZA 3OBBA 3Q87B 1C41A 2O07A 4M6WB 1GRCA 1WB5A 3HHWA 4OPMA 5F77A 3ER9A 4MVJP 1XKXA 3OCUA 5CLLA 4F45A 3EG5A 4E11A 1UFOA 1PJRA 5AXBA 4EMUA 1PKEA 4D42A 1VB3A 4GSKA 3I2YX 4LNUB 2NVBA 4FHEA 4D4LA 3B74A 2ZT7A 5AKEA 3AOGA 4FWTA 2RHDA 2RD2A 3JD2A 2UYYA 1GZVA 2BH9A 2FZKA 3LUBA 3TW8A 1G3RA 3VMFA 4BNVA 4D4GA 5KYKA 1WXDA 1DEAA 4L73A 2CCJA 2JHFA 3DBLB 4WMLA 2EOAA 2P3OA 3CMCO 5ADVA 3HHXA 2BSQA 1KSJA 3UJ7A 1FVHA 1QSGA 3GEDA 4RXMA 1J22A 4Y9RA 4B8YA 2V5AA 4RA9A 1JWLA 1UBHS 1OC2A 1CQPA 1YRBA 2VNJA 2JCGA 4XXHA 4TLDA 2M6RA 4KE9A 1SXGA 2Q3CA 1LCIA 1V8BA 2AWNA 4WXHA 1RBZA 3CVJA 2WWWA 4RHYA 4DLZA 2JLWA 4KXMA 1LPPA 4L07A 2ZYVX 4N8SA 5DTRA 3VJLA 1OH5A 1FMTA 1E89A 1TJPB 3MIZA 3LRPA 2GKOA 2I9PA 4HLDA 1I1NA 3LBAA 3WNZA 4OJQA 4PX5A 3A2KA 1AQJA 4MEJA 3WBKA 2R18A 1EVJA 4YRZA 4X7MA 1ULUA 2X6QA 4AKHA 1NVWQ 2PZAA 3HG7A 3J27B 1LBSA 2W9XA 3O2NA 3SP1A 4CT0A 4AN0A 5DX1A 4PBSA 4CKBB 1WB9A 1TYAE 3HA5A 3DBRA 1CERA 3AF2A 1NRJB 4LQ4A 1RACA 4YONB 4CU5A 1HNWM 3B48A 3M1IA 4FFLA 5D6OA 4FDTA 4ZV4A 5JRZA 4QNMA 2O2EA 1NNEA 1T2FA 5THXA 5AOBA 4CKCB 1IXSA 3A1NA 1ZUD1 4UE3S 2WY2D 4YRMA 2P5TB 3QXSA 4DC1A 1HLDA 5FUMA 3FNFA 4WT7A 4IQ0A 1QPBA 3AJDA 3ELDA 4G97A 2P0YA 3M3HA 2KW0A 2D1SA 3SYTA 4O4HB 1J56A 5DNDA 1T1EA 3UOWA 2CMFA 3EA0A 4I3GA 3LP5A 3WO1A 3TSYA 1QB8A 3UJDA 4GMDA 3L49A 4V38A 3KS4A 1R3UA 2W2KB 4KTVE 4R9RA 4JXJA 4X8MA 1JIVA 4U9UA 5CJ2A 3X1WA 3O9VA 4YLGA 5JJIA 3TECE 2QTMA 4LQDA 1M2OB 5EP4A 1QBKC 2G04A 1ZOLA 4IPTA 4DM7A 5D5QA 1JYSA 4DM4A 2P2CA 5DNEA 1KDOA 4C4TA 5B55A 3KB2A 3FYUA 3Q7QA 3PXEA 4QGGA 4TVBA 5CT9A 3OCCA 1U8TA 3VOTA 1EWKA 5AVJA 4YV7A 4F86A 4RF3A 1YB5A 4Y2GA 3ZDXB 3AOEA 3TQCA 4X20B 5EIBD 3G85A 5JH7A 4D9EA 5DHRA 2A78A 4D9BA 4KX5A 1L4FA 4HYQA 1PWXA 5BWNA 1QCDA 3V4VB 4OHMA 3FR7A 4P7BA 2IHNA 3SY8A 3RSCA 2QR3A 4CN8A 1M76A 1XJWA 4QUJA 5CG2A 5IP5A 1F20A 4OGWA 3O3NB 2JFBA 2Q45A 4I9FA 3WRXC 2VUUA 5AW1A 2XMPA 1UODA 3PU6A 1I7NA 3DC2A 3DJFA 2OCIA 2OZPA 3GJYA 4G1UC 4HZUA 1KH3A 3K0CA 4C87A 1CUHA 2PVPA 1Z75A 3VPDA 3W77A 4GMGA 2OO9A 1XRQA 3D8BA 3HNOA 1X42A 3E21A 3L7BA 3NONA 3DMTA 3CRNA 5AW5A 2KB0A 4E3ZA 4JXZA 1IBLM 4E6PA 1MIOA 4LJSA 2JLQA 3TX2A 4EG8A 4DSTA 1A98A 4UARA 3EFBA 1X7YB 4O5AA 4YNBA 3LBYA 5TB5A 3AV0B 2GJ9A 2ZSEA 3FDXA 2HN9A 3FOAA 3EGWA 1DCFA 4HFJA 1KQNA 2NVUB 1KDVA 2Y21A 3CG0A 2QT1A 3T35A 3BWYA 1QTRA 1DIGA 2CP8A 1JKJB 2UYOA 3HDQA 2X6TA 3MJFA 4BAUA 5FWYB 3B6EA 5KYTA 3V76A 2UU9M 4M83A 1KOLA 1H6BA 4LOKA 5AW4A 3HFSA 4I1YA 1KETA 3VBCA 4X3CA 1LBEA 1P62B 1Z8NA 1C1HA 3OLWA 4O5OA 4AZTA 1NI4A 4S12A 2J5BA 4JI6B 1YSYA 2I62A 4ZC8A 5B6IA 1F2UB 4Z7OB 4D80A 1EFPA 1N1EA 2ECPA 4RMJA 4DIEA 1KTIA 2EGHA 3AC0A 3DPUA 1SKAA 3BTSA 3QPBA 4A8JA 1YB1A 5JPIA 4UE2A 3MJTA 4ZAZA 4HAOA 5KPJA 3C6ZA 3E8SA 4R2MA 1YRQA 4NCJA 4XLTA 3LC0A 2B7BA 3UC5A 2I7XA 2QQEA 4KFRA 4S1PA 4WL0A 5E4TA 4X66M 1QCYA 2GFIA 1C3VA 2RHHA 2WJHA 3G8AA 3OCVA 1OLOA 3B6JA 3JPWA 4RS3A 3OPMA 1WUTA 1OIXA 3U7RA 4FI3F 4KQJA 2OK7A 4Y6LA 4EENA 2OPFA 4Y9UA 3CVOA 2QVLA 5EMMA 2FMUA 1XOIA 1E8MA 4BN4A 3BMCA 1T2EA 3N0XA 1NLZA 2Q0QA 1OXUA 4UUMA 1YCFA 5EHXA 4H3KB 1H6DA 1XSEA 1OXSC 1EINA 1EX9A 2D5LA 3PHCA 3U3XA 1PFWA 3UJ6A 1DTSA 1BCRA 1YHNA 1V7CA 3MC1A 4PHTA 1DSSG 1UXGA 3NIDB 4R81A 4WFKA 5DOZA 3X1ZA 5KINB 2UVPB 1ZIOA 4NEQA 3HXPA 4YDSA 2OZVA 4Q4DA 1F06A 2BV3A 3U1TA 4JT2A 5EZYA 2V6FA 3DE5X 1MAUA 4TMYA 2FOXA 4EQ6A 4CGZA 4C06A 1CZUA 5G02A 4GQAA 3PENA 3WX0A 3KOYA 4DLWA 3RAEC 5A4DA 3DOIA 3G82C 3HN6A 1X1DA 4IVRA 2FE4A 3ZUGA 2BBSA 1V34A 3ILHA 3AILA 2VDUE 2BR5A 2FZCA 2XZTA 4PGAA 5HQTA 3R5KA 4XCQA 1DPGA 5E4YA 1WUYA 3RUFA 4CW7A 3T52A 1WXQA 2OZKA 4GI2A 1OSNA 1PQYA 1G8YA 2P9BA 4BV2A 1FNNA 4ND8B 3PGXA 3KK0A 3NHKA 1X7GA 2HSWA 4G0ZA 3RC7A 1P61B 1G8SA 2BZ1A 3MS2A 5AKIA 4TYWA 1SOVA 1V7QA 4RGVA 1WF6A 1J90A 3PFIA 2FSIA 2HJHA 1E1RD 1I36A 4QJ4A 3LLSA 1W5FA 3GPIA 3KDPA 2WPNA 4LN1A 5JDCA 5JO0A 4BKQA 4HXEB 3PHGA 4KDCA 3GZ4A 1IEVA 4RYLA 2H1LA 5BN3A 2VT7A 2X1VA 1F4IA 2GD6A 1N2CB 2ZJ2A 3HB7A 4QAQA 3KOWE 4BV9A 5CAEA 2JASA 2I6TA 1JHDA 2OVFA 3KP0E 2IE0A 3RGPA 2E6UX 2WC1A 3KLMX 4X3OA 4C3VA 5IVHA 1KMIY 2JIBA 2HJVA 2WSSA 3OM0A 3ROZA 2DAIA 3JQ6A 3CXUA 4HDNB 3QVKA 2C1ZA 2V7PA 3MS7A 4PTLA 1T1GA 1B15A 1YR6A 4G4IA 3JYOA 4K5QA 1X7ZB 2X23A 4LWPA 4QPNA 4RAOA 3TRDA 3WK9A 2WP8J 3ZV6A 4DV6M 1GJRA 3VR3A 1H3EA 3PT9A 3U3JA 1B6GA 4PZ0A 4DDWA 3TLGB 1I3MA 3HBAA 2FG7C 3T3EA 1S1MA 2ZYTX 4WZ6A 1PR2A 2HWUA 4PO8A 2CJFA 3PDCA 5JASA 4G1MB 1N2SA 4CTNA 4IBFA 4X63A 3E0XA 4LY0A 2QLTA 1OAIA 3MUFA 4KWIA 3S2ZA 2OQRA 3QY9A 4B6SA 4TKUA 2ZM6B 1ORIA 4BLQA 2FZGA 5FSWA 3SNKA 1O97D 2EJBA 4NS1A 4OXKA 1WM1A 1HKHA 2WT9A 3BBPA 2NVOA 4W4TA 1UM9A 4P3XA 3SDSA 2EDAA 4B3GA 2E7ZA 1QNLA 4RDCA 2JFFA 4FVMA 1WMAA 1AVTA 421PA 3D6HA 1Y81A 1PZNA 3UATA 5KYUA 4CNBA 4M8KA 2Y77A 4PRLA 3JZDA 4HNTA 5CT4A 2FZWA 4J16A 2QEQA 4QECA 1WAMA 2QD4A 2KRUA 4AG5A 1ODSA 1XEWY 4TX1A 1EUZA 4LI3X 3UMMA 2QUZA 3AG6A 4CM6A 3VBEA 4D3SA 2V54A 1I7QB 3CZ9A 1YQXA 2I4NA 3C6YA 3Q2OA 1QV6A 4JAVC 1LA2A 4J0JA 4PLWA 3VH1A 1M1XB 1VCOA 5KQ8A 1PAUA 3WHKA 1J06A 2IF0A 1WZIA 3RFCA 3WHIA 4H1HA 4N76A 3LSTA 2QHXA 3ASZA 3RSQA 4PXSA 5LOVB 2R4TA 3R9KA 1GFSA 1W19A 3BMXA 3AEXA 4KW7A 3K92A 5I9IA 1ZOSA 1G8MA 3NEJA 5CK4A 5AP9A 4DJFC 4ZCRA 5K0ZA 4QXAA 2X1MA 3ZLTA 3WIDA 4LTDA 5CB0A 3FB1A 4B73A 3INYA 3HJTA 3OFSA 3W3AH 2GJ8A 4REOA 1O9GA 1RXIA 4NCHA 4XOIA 3SAVA 3PPYA 1YNOA 3EZFA 4URWR 1XC7A 2Q6IA 3O3OB 4GOKA 4PT5A 1D0VA 1EGHA 1M2VA 1OD6A 3AUJB 4JI2M 3O3MB 1OB5A 3DLCA 3U80A 1YJQA 3BGIA 1EUYA 2QSUA 2L4EA 4LDRA 5NULA 3U39A 4FN4A 4LSZA 4EQ6B 5F2NA 2RGRA 1UDAA 3EGXA 3ES9A 3U7QB 3WJ1A 1FJGM 3A4YA 4LE1A 3AR6A 4X64B 1NI5A 5BVGA 2KE5A 4WLUA 1P8AA 1PLKA 3E27A 3IKMB 5DGCA 2GVNA 3CKYA 3HUDA 4FHZA 4UCXA 5KC8A 2QRVA 4IUYA 5A5VA 1A4IA 3WK6A 1U0RA 2RGWA 1MV5A 3VLFB 3WWPA 5CA1F 3ZHQA 3NWEA 2QX4A 2ZIXA 2C54A 1DC3A 2EDCA 5BT8A 4TSRA 4R4JA 3TR6A 2QI9F 4DKXA 3UMCA 5KCZA 1EEXB 3MGKA 2RFLA 1KNXA 1UWKA 2B8EA 2C5FA 2C8JA 3L93A 3P9NA 1UEJA 4JFAA 4LCJA 4CTJA 1O94D 1UDWA 1J20A 2D4HA 4XUCA 1I7SB 2IXTA 2BCGY 2H54A 2ZTVA 2X8JA 4AZ0A 4NS4A 1YVEI 3R7WB 3AVQA 1UCFA 1Z62A 2RJ3A 4FDVA 2BWJA 3CEAA 1VE6A 1P74A 2JBHA 4F97A 2OT3B 5I01A 1CW2B 3FXAA 4L9RA 3CE9A 4I2NA 2QVZX 4BOYA 4DWJA 1G20E 1L8LA 5ALZA 2P4QA 3ICEA 1TTQB 1L9XA 3QLTA 3D6FA 2H48A 2R97A 2Z9DA 5LP6C 1TCCA 1PF7E 2R7LA 3BH7A 4P08A 4CF6A 4TTAA 4XIJA 3KKEA 3O95A 3QOFA 2IIVA 3ESQA 4PZZA 1TI7A 1U2ZA 3A3KA 5AVSA 4LGVA 3K9CA 3KWLA 1MVOA 3NV7A 5EE5B 4ZU3A 1VDZA 5IBRA 4LHYA 4REMA 3M49A 3SJAA 4LWZA 1ZUIA 1JT2A 1X14A 3BRQA 4JT4A 1TTEA 1K3XA 5FNVF 3BGWA 2ILVA 3SSMA 1LSJA 4QIHA 1RXSA 2WE7A 1ORVA 4BVFA 4ZYLA 5I9LA 3QVXA 1AKYA 3CB4A 3U6DA 1RC1A 1L5WA 2D2VA 4H1VA 4XDZA 2BE7A 1DFIA 2L19A 2F5PA 1OV4A 4KFSA 4WN3A 3ZOKA 1FQOA 3IG5A 5EP3A 4MB7A 2EQAA 3SFVA 1VCIA 4N54A 4I6EA 1SHUX 4CU2A 3B3JA 1UADA 3QKIA 3ANMA 4HGPA 1TO2E 2ONKA 3RTEA 1YVUA 1JRLA 1P2UA 4YV2A 2JGIA 3COWA 4CUJA 3R8FA 4E2ZA 3L41A 1L5VA 3OBIA 3HU3A 3QMVA 4BYMA 4RD3A 4BGUA 2JAXA 3IKJA 2IBTA 2I6SA 3GPBA 1PFGA 5L8VA 1I6MA 4MRNA 2NYAA 2ZTUA 2ZUDA 3L7IA 2EJTA 2AG6A 2OHJA 1XRRA 4CMEA 5B1IA 3RGWS 1YMUA 2BEVA 2QUBA 5JS1A 4G4QA 1NP3A 2JLVA 4UM8B 4M0MA 1HM5A 4JJFA 5FTNA 3MK31 2QZJA 3CNEA 1UBTS 4JQSA 3K0BA 5FHRA 3OTHA 2F1IA 1JFLA 3D4OA 1E1LA 4KXLA 2D7JA 2HH9A 5LDHA 2VVTA 1L5ZA 1VLMA 1G64A 3GT4A 3E9DA 3TLJA 2AMJA 4HAYA 2UXCB 2WJVA 2R1TB 3OMLA 4FW8A 1KFKB 2G09A 2IXGA 3IO5A 3KSXA 1V5GA 3Q15C 1FVXA 2FRDA 1BW9B 3AJ9A 1NDQA 4WI1A 4TXHA 2OR3A 4EUKA 5CITA 5JHGB 1V4VA 1PJ4A 2WW8A 2ZVQX 3L0IB 2GXSA 3N28A 3KIPA 1H2ZA 4TTVA 3VZRA 4BLTA 4A92A 2OK8A 4WW0A 4FE3A 3F4BA 5IABA 2AEMA 3FSRA 4AJ2A 1O54A 4WBNF 1Z2DA 1ZJJA 4WFJA 4BQIA 2BEWB 2VS1A 1KK2A 6NULA 5EMJA 1Q7EA 2BJWA 1K8RA 3FZQA 4PFSA 1YB4A 2C4HA 4KQXA 2HBRA 5CCBA 2GBCA 3WNCA 5FT9A 1TB4A 3WV4A 1I5RA 3FH0A 2FFQA 3I32A 1FS4A 3WLMA 4KITB 4D4HA 5LFAA 5ILOA 5KJ6A 1VMIA 4NK5A 5JBNA 1T1IA 2F6RA 2I03A 3NS7A 2JFGA 3U62A 2GASA 2QYTA 3L84A 2D7EA 3CHYA 1L5MA 5E3HA 1X7WA 2PLFA 4N7JA 1BDBA 1ZM4A 1N3BA 1BMTA 1BHO1 2BUCA 3LCVB 3A9VA 4BLOA 2W7TA 2CFTA 4IF4A 4CKCA 4S1TA 3DLTA 3ETGA 2HO4A 3S7TA 1UDRA 2J0UB 3LKZA 1YKFA 3CBGA 5TSDA 1VCMA 4FOLA 1NURA 1K8QA 3AL2A 3FKQA 2BM8A 4DNXA 2JS7A 5ITXA 1AO3A 2DFVA 3NUGA 1EVKA 4BJ5A 4F1WA 2E1PA 1RWMA 2EZ9A 3K72B 3JR7A 1E9BA 1ZVKA 2H1CA 4FYMA 1XI2A 2VA9A 3H4IA 1KHTA 2PK3A 3HBFA 4AZ3B 1DJPA 1FRFS 1LI5A 2CFRA 2PYIA 2P75A 3L0OA 5DM4A 4EPTA 3CC8A 5BSMA 2FQQA 4B5KA 4EVSA 1MVLA 1R5NA 3F47A 1TYDE 3HFGA 3DWFA 1TAHA 3GAAA 1OBOA 2ORYA 4NHEA 5EC8A 4ALIA 3ELUA 4OQNA 2BTEA 1BAPA 2ECOA 3NANA 1F8GA 4DLKA 2Z1DA 3QKTA 4LYGA 1YO6A 1MABB 1IBRA 2H08A 1KDRA 3HGQA 3QX7A 4IHAA 2Z04A 1PVDA 4IQGA 5AVOA 2WYIA 1Y80A 5K0BA 1MOZA 2JFYA 4F3CA 1SUCA 3REQA 3KUUA 3R0QA 1YASA 3TPFA 5CA0F 4LGCA 4AYWA 5KOJB 4WACA 1D5WA 1TM5E 4B2PA 3KUKA 3OFND 4M9UA 3BE8A 4CMIB 1OHHA 3JRXA 4IIVA 1WNTA 5FFMA 4DR3B 4A6PA 2HNKA 4BB6A 1E3LA 4R2WA 1RU3A 3AVPA 2WSBA 1WDLA 2D1TA 4DSAA 4K6OA 4M7PA 4R2XA 2PUTA 2GAOA 3MQ4A 4RSHA 1DBWA 4JBLA 1QVWA 1W5SA 3GQ5A 2BUAA 2EATA 3GAZA 4RPHA 5DCYA 4AO6A 1SWVA 2XNSA 4B46A 2PKWA 4BMPB 1QE3A 1P4GA 1T8YA 5KS2A 5GZ6A 3JQ9C 2IH2A 1BU5A 1BHSA 3EQ9A 1GAJA 5DV9A 4GX5A 4D8UA 4DV3M 3JWPA 1EUDA 5MGNA 1EK1A 4JR2A 5DIZA 4U00A 3C4JA 4GMQA 1FTSA 2J5RA 4OAQA 3Q8GA 1NYLA 1R00A 4LC9A 1A4UA 2V59A 3CPSA 2COUA 5LCXA 3WA6A 3D3EA 2O4CA 3LU1A 3G79A 3G6WA 1YBAA 4B3CA 1TZCA 5TLSA 1ZW1A 3M5CA 1VE9A 2G4LA 2NVWA 2ERYA 3NDJA 1XWIA 3HYCA 5E7JA 4AFNA 5C5IA 2I2DA 5MN6A 2C4NA 2A86A 3PX3A 2RJOA 5KQDA 1EWQA 4OH7A 4WOCA 2VF4X 1B14A 1TYZA 1DJOA 1W6RA 1WCV1 1PU2A 3WSVA 4U3JB 4TL7A 1X9HA 2D06A 2HF7A 2FMIA 2I91A 4JP5A 2O20A 1XZNA 4LC0A 3OIFA 5FX2A 1GPH1 2OV8A 2WABA 3R5TA 4I1OA 4N5DA 1L5KA 1SC3A 3AR7A 3TNDA 2JI4A 2HZBA 1CZKA 4OU7A 2FW1A 3U6LA 1N36M 3P97A 5E0OA 4F7DA 4QLBA 4WJLA 5HOQA 3FBTA 1F4PA 1QYXA 3MAGA 2RGDA 5THKA 1XCPA 4U7FA 2G5GX 1KVQA 2ZITA 3OQ1A 1Q17A 1QHIA 1T6XA 4EHAA 3HO1A 3U48A 1TCBA 1XMXA 3A4MA 1UKYA 4MKXA 5KOJA 3ZY2A 2B2CA 3UUWA 5D8DA 3UK0A 5JS8A 4ZEWA 2XSZD 3DQZA 3KOOA 3R41A 3RS7A 4N39A 2KBFA 1RFGE 2DZDA 2OG1A 2RCYA 3LVQE 4PWZA 4R2LA 3S68A 1K5PA 5AVQA 5LD2C 1H6AA 4X61A 1CXZA 2GPNA 2WTEA 4RY8A 1N0WA 2PMFA 3DZIA 3HPQA 4RHUA 2W2NA 1UJBA 4TRMA 4UHEA 4KE7A 3F74A 4CL0A 2GBIA 1VG9B 3I05A 3NAGA 4MYUA 3L07A 3SASA 2R45A 3ZXXA 3V2UA 1FW6A 4RMHA 5A06A 2YDXA 1YQ9A 3GDFA 4K9DA 3TJMA 1N2CE 1B8UA 1R12A 2XE7A 1T9GR 4PHCA 5D6NA 3VMMA 5LQRA 3OZ7A 4NXMB 1DT3A 4LJ8A 3F5DA 3PHLA 5EINA 1GGKA 3VI4B 3ZEIA 2XEXA 2ZRBA 3I6QA 3DXXA 3OIYA 4ZCPA 2J32A 3KC2A 4XGNA 2YWJA 3ZJVA 2Y92A 4P54A 4EYEA 1ZV1A 5DYIA 1P45A 3PIDA 1EWTA 4NONA 4M1WA 3Q8LA 1Y8GA 3GGDA 3SQMA 4H0CA 4RTJA 3R8CA 4X90A 4WZAA 1EDEA 4FINA 5I6DA 5DOVA 3D6UA 5JSYA 4INAA 1GGJA 3FYSA 3KR9A 4ZALA 2Q5EA 2GBLA 1WHTB 3I51A 3ZGNA 3MQFA 1SG9A 1QRRA 4HL4A 1NVXQ 5LZ2A 1DIRA 1GVHA 2BEWA 4XSGA 1QHHB 3C7TA 1JPUA 1PWHA 3UFXA 1XZPA 5KNCA 2C4MA 3N0WA 3CEMA 4MR8A 5K2MA 4RJKA 1E4VA 2VK1A 2WHQA 3DR3A 4URUR 2W2OA 2YCBA 1NQVA 5BOSB 1SY7A 4TRRA 1L8QA 1QGOA 1QUEA 4LVNA 3NIFB 1BW9A 3I5YA 1RKVA 3CPJB 1E58A 1Z08A 3Q6IA 4D3XA 1M73E 1ZNYA 5IJZA 4JI0B 2YQ4A 3B52X 2R1TA 1DGQA 2ZI5A 1K7EB 2NXCA 1IMOA 2B5VA 3OTWA 4X8OA 2RH5A 5IUNC 2VNIA 2V6ZM 4ZRMA 2GPJA 2XVYA 2BN4A 3NAZA 4I9NA 2IODA 5K6RA 5CNJA 2NTJA 3DTVA 5TQJA 2O19A 4JP8A 2L2QA 3NKFA 1PT5A 1XLVA 1OGYA 1YK0A 3BIJA 3GQBB 4P84A 5EKTA 5JSHA 3AY3A 3K5IA 4P7GA 3MS4A 4GRAA 1CJMA 1EVLA 3EF0A 2QX7A 3PBKA 4TMTA 5F1PA 1YB2A 5BQPA 4O2AF 2KEBA 3GCXA 3ETLA 5BV2P 1JEOA 2F5SA 4TQUS 1OZ0A 2VJMA 2WF7A 4RIHA 4WA8A 1NBWB 4WZBA 3URKA 3SHFA 4YCLA 5C81A 1KY4A 5IAKA 4E1BA 4HEOA 4OM7A 1UBJS 2W11A 4HS4A 5HK8A 4ZC1A 4A0QA 2G1UA 5EWLB 3VC2A 2IPAB 3IMKA 1N9ZA 3ZBPA 4DVGA 1T8PA 1EXWA 5LJIA 5D5PA 1ZKDA 3RK1A 1PCXA 1ONOA 1MB9A 3F4KA 4WEQA 1KZYC 2I4MA 3FFBA 4JVOA 3DGFC 3G9UA 4P1ZA 3DO5A 2VHQA 1Z6ZA 2KLHA 3E8MA 1YHYA 2JK1A 5B36A 2IEDA 1KFEB 3HBNA 3K0FA 3PQ8A 4GL2A 1MJHA 2B4YA 4ARAA 3C6BA 1TM2A 4DPLA 1Z5AA 2Q2EB 4BP8A 4UOZA 5C7YA 1ZU4A 1WDTA 4BCDA 2ET6A 5TV2A 3Q8XB 1AKQA 1MC5A 3CW2A 4WA7A 3PPXA 2W2TA 4RQTA 5T8KA 4DOMA 1DKMA 1ZRNA 2ZDHA 3NO4A 4CLOB 1B76A 1AQLA 3EUEA 1CUFA 1UINA 3ML1A 5EHQA 3PFHA 2QM7A 4EH1A 5L95A 4YHHB 3NTQA 4X91A 4TL9A 4DL9A 1QIFA 2EW8A 3JASA 3BB1A 3G88A 1KU6A 1KE1A 1PEAA 4LZZA 1ZMXA 1LLCA 2EJUA 2FEWB 1VXRA 3RS8A 1E4EA 4BMOB 4IBGA 1T4MA 4AI6A 1UDBA 2A33A 1QH1B 3N8KA 4KBYA 4KI7A 5E9AA 1G3UA 4OFWA 5KO2A 2RBGA 2B4QA 3SDZA 1E2PA 3OX2A 2AGVA 5KHAA 2CGEA 1UC4B 5L7YA 4DIBA 1UMKA 2X8JB 4WJKB 2ERXA 3HH8A 2VOEA 5D3QA 3UJAA 2EKFA 1IWPB 4DDUA 4L5AA 4ZREA 1N3IA 1JA1A 4OYHA 4BLPA 3EEQA 1CD5A 2QLFA 2Y0DA 3OQVA 1UKZA 1CNFA 1ZINA 2GA8A 2Q2VA 4ZT3A 1WV1A 5LA6A 4MVCA 4KG7A 3UK6A 4DV4M 4J8PA 1Q1BA 3SLRA 4DILA 2QN9A 1QDEA 4BMYA 2CEKA 2NNLD 2PE5A 5F3WB 4HFNA 4NATA 3U4MA 1NRIA 4IGKA 2QYSA 3HZJA 3ACDA 2IS4A 3PKZA 2JIOA 3KSAC 1EWRA 3EIHA 4IDBA 4HB2A 1DG1G 1ODTC 3B1FA 3RFUA 1XAHA 1Y63A 1Q7RA 3II6X 3NHBA 4II3A 3WVNA 1D4ZA 1HXHA 1Z35A 2ODQA 3ABQB 5KTKA 2WU1A 2RGOA 3OESA 1BZYA 2VCEA 3O9ZA 1ZGBA 4FEAA 2XUPA 3RABA 3CO0S 1L7OA 1JEQB 4B3DA 4AX4A 5E4JA 4UAVA 2O3JA 2ZBVA 1U94A 2CXOA 1FFSA 1GITA 4WKBA 1IPEA 3PNPA 4QX6A 3ZJUA 2JLYA 5L3SB 4Q7QA 4KSBA 2I4IA 3H87A 1PZMA 3P9PA 5CYOA 2BEUA 2GB4A 4GP6A 4JBHA 2Q6VA 2H57A 3PDIB 9LDTA 2JK0A 1K5HA 5DKFA 1XRSB 2ABWA 4MWCA 3W9SA 3JVUA 4URXR 1DG3A 3MT0A 4L78A 2FWBA 3THWA 4LQCA 5FLYA 3DBVO 5BO5A 3S28A 1BA2A 3V8BA 1HK7A 3VPGA 3V42A 2QUJA 2X76A 3OLCX 1HORA 3JQRA 5ITWA 1YA6A 3M1LA 1ESCA 2A0UA 1H0SA 3G1TA 4II2A 4C9BA 5AW0A 3TYXA 3RUEA 1PGQA 1FDWA 3CKKA 1BCSA 1G7SA 1H93A 1ZK4A 2H3HA 3IQFA 4D97A 4IWNA 4DCMA 1R5LA 1AKTA 1VKNA 1IVYA 4MQUA 4P86A 3KS9A 3RTAA 4CKEA 3BF8A 3AZOA 1G5PA 1E5QA 4TTSA 3RLIA 3IDSA 2CN1A 1I4LD 1SKYB 4F06A 2DGDA 4ZN6A 3PQFA 5ALUA 1U3WA 4XTRA 5BSUA 4YAKA 3E81A 1Z83A 3TUZC 4CMJA 4FTWA 2K4MA 3CLTC 3NBQA 3TUJC 5DK6A 3NQ41 4A0HA 4BIMA 2WFMA 1WJ7A 2NZUG 1S1CA 2VJCA 1YCDA 3DPIA 3EXHB 2L0XA 3JZMA 3LG2A 3D0KA 2WZCA 3RH0A 2GUGA 4CYMA 6YASA 1A3CA 4JLPA 3PF9A 3SS8A 3GEPA 1A69A 1UZLA 2I4OA 4TKMA 1NR5A 1YKGA 2VJPA 1L4BA 2W6CX 1ZFNA 3A1FA 4QHTA 1WOYA 2O2HA 3NHAA 2AW3A 3NV9A 3O1IC 5G53C 4MVJM 1YCHA 1G3IA