3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
4X1OA 2P40A 3LCVB 3PB3A 4YMHA 2Z6QA 3B7PA 1RJFA 3HCCA 4CXMA 4C05A 1VE3A 3BGIA 4RTOA 1DUSA 4F85A 3M70A 1WZNA 2HTEA 3KQTA 2AS0A 3UFBA 3DMFA 3MHTA 1WG8A 2NXEA 4QVGA 2R3SA 3EVDA 4C08A 2UYHA 5K03A 3M6WA 2BR4A 5CM2Z 2P35A 4BP1A 3DLIA 1RJDA 2OKCA 2YXLA 1B42A 4HGZA 3HM2A 4X63A 4CKEA 2YX1A 3T7SA 2HR1A 3AXTA 2FK8A 3EVEA 3FPFA 3R3HA 4E30A 4F86A 3TOSA 1X1DA 3ELYA 5E1OA 1Y8CA 2VZ9A 2WK1A 4EVIA 2EG5A 3GU3A 3TPZA 5DSXA 4RTRA 2E5WA 2AN5A 2I6GA 1PJZA 3C0KA 2ZULA 4R8RA 1KYWA 10MHA 3DR5A 3ORHA 2KW5A 1MHTA 4RYLA 1XJ5A 2Y1WA 2YVLA 4DM3A 5GM1A 4HSGA 1RJEA 1R74A 4KWCA 1BHJA 2BR3A 5E9WA 4C04A 4RWZA 4CWAA 1KPHA 1IY9A 3G7UA 1RI4A 1R6AA 3G8BA 4DCMA 3JWJA 4YV0A 3T7TA 2IDJA 2PX4A 4PYOA 1KPGA 3FPJA 2YTZA 3EVCA 2HWKA 3O4FA 2PXXA 3H2BA 4QQKA 4OQDA 1NW8A 2ZWAA 3C3YA 5LQNA 4QTUB 3VSEA 3CC8A 2Q41A 3HVJA 1I1NA 4MIKA 3GRRA 1NE2A 1XCJA 3KPYA 4QDJA 5FUBA 5CIYA 5DTRA 1JQ3A 4RSRA 3M6UA 3TMAA 4P7JA 3OFKA 3UBTA 2AOTA 2XVMA 2YXEA 1FPQA 1R00A 3UJ8A 1I9GA 2VS1A 4R05A 4YUWA 1EQAA 5K0LA 3P2EA 4F84A 4DZRA 5E1MA 5C1IA 4ER0A 2AOUB 3HVKA 5CCBA 5DM2A 1SQGA 2OB1A 3G8AA 4IWNA 1PRYA 4KIFA 3RODA 4RVHA 5F2KA 2ZFUA 3UJ7A 4ER3A 2HV9A 3UJ6A 5K0FA 3ANXA 3G2OA 5K8VA 1UFKA 3KQOA 2VDVE 5DM1A 1P1CA 1R8XA 1NW6A 2B9EA 5GWXA 5BW5A 3K0BA 3MQ2A 4IV0A 1D2HA 3KPJA 5E8RA 2O06A 5K09A 3DMGA 1G6Q1 2ZBQA 1KR5A 5GIPE 3AJDA 5M5BA 2PGXA 2ZIEA 3FUUA 5DRTA 2CMGA 3I9FA 1YZHA 4YUXA 4RTKA 2PXAA 5HFJA 2QM3A 1SQFA 3FTEA 1VBFA 4M37A 3ELDA 1BKYA 3I53A 2AVNA 3O7WA 1JG4A 1KIAA 2YXDA 3B3FA 3QV2A 2ONYA 4M36A 4PNEA 1DCTA 2C7PA 3DTNA 1NT2A 2ZLBA 1I4WA 5H02A 5K0BA 2WA2A 1X1BA 3HP7A 3JWIA 3KR2A 3THSA 4PYQA 1ORHA 2AR0A 2XYRA 5CVJA 1M6EX 5DXAA 3SXJA 2UYOA 3G2QA 2FK7A 1VL5A 2ZBPA 1X1CA 3MTIA 3PLAE 2ZIFA 3V97A 2AOWA 4R8SA 3NTVA 3X0DA 4CTJA 1JTEA 2YR0A 2ZTHA 5FADA 5FULA 4ZTBA 2CMHA 4DF3A 1IM8A 4HG2A 2F8LA 2H1RA 4FGZA 2CWWA 3EGEA 4IV8A 5EIFA 4E2ZA 5ICCA 3NWBA 2UYQA 4HRAA 5DTQA 4EK9A 2I9KA 2ZZNA 2FHPA 3KHKA 4CTKA 2PKWA 3F4KA 1SVUA 5E2AA 2ADMA 2BM9A 1VP3A 2N47A 2QRVB 4HGYA 5EC8A 2PX2A 3LPMA 3S68A 4XUEA 1G38A 4BY9E 4BLUA 1FP1D 3KQSA 3GRYA 5KVAA 4C4AA 3M4XA 4KIGA 3JWGA 5MHTA 2PWYA 3GRUA 3ER9A 3UA4A 2ZZMA 3GRZA 3LKZA 3C6KA 2XYVA 3AXSA 3E8SA 3REOA 4FSXA 3LCCA 5EKUA 3ELUA 3FUXA 3NJRA 9MHTA 2UZ4A 2BR5A 2OB2A 2V7EA 2QYOA 1VLMA 4GEKA 4YUYA 1H1DA 1VIDA 4U7PB 3HA7A 5E1DA 4C06A 3B5IA 2JH8A 3I64A 3R9XB 1RJGA 2EJUA 4HTFA 2B3TA 3LSTA 4BLVA 3G2PA 2ZSUA 3ELWA 3OCJA 3OE5A 2DPMA 1O54A 3IEIA 1SG9A 4U7TB 5T64A 3Q87B 1EJ0A 2GPYA 2PY6A 3BT7A 2XBMA 3KQQA 4FP9A 3DXZA 4E2YA 1N2XA 1JR4A 4AUKA 3CJTA 4ER7A 5DRYA 1D2CA 3HVHA 1U2ZA 5HIKA 5K05A 5KQRA 3CVOA 4E32A 3P2IA 3GCZA 2LD4A 1JG2A 3GNLA 2ZW9A 1AQIA 1L9KA 3EMBA 3GJYA 3CGGA 2O0LA 5EHIA 2ZZKA 3ME5A 3GGDA 2QE6A 1P39A 2XVAA 1TW3A 5KS2A 1YB2A 1Q0TA 5KQSA 3DH0A 2P7HA 5HIJA 5EEHA 5F2NA 3EEYA 3DULA 3UZUA 3KQVA 3SVZA 1AV6A 3HNRA 4RTLA 3KKZA 3KQWA 2IDKA 2B25A 4M7RA 1VPTA 3HEMA 2P3LA 3PFGA 3L8DA 5EOVA 1G55A 3NDJA 4GF5A 4MQ4A 4ISCA 5B1SA 1G60A 2IBTA 1NV8A 3GDHA 3M6VA 3KR9A 4QTTB 4RTJA 3PTAA 4PINA 1ZGJA 2OZVA 2VP3A 2G70A 3E05A 4AZVA 3ER8A 2Z6AA 3A7EA 1XTPA 5GIOE 2GAFA 1QAMA 2JJQA 2PX5A 3G89A 2G8NA 4FT2A 3RIEA 4UOEA 3B3JA 3Q7EA 2ZBRA 5C9ZA 3CCFA 3DOUA 3P97A 5FTWA 4E2WA 4HH4A 5IKMA 5CVEA 1XCLA 2UYCA 1QAQA 1R8YA 5DXJA 2PX8A 4YV1A 5ICGA 5HIMA 4Y30A 5FA8A 4KDRA 3SR4A 5DX1A 3TR6A 4AZWA 3EGVA 4X41A 1ZG3A 3BWBA 5EMMA 3TQSA 4EQZA 3LKDA 3EGIA 5EZQA 5LQJA 5LR6A 5E1BA 4KW7A 1NV9A 1WY7A 3R6TA 5FHRA 3HCDA 4MWZA 5CVUA 5DTMA 3UJBA 3FPEA 5CVDA 2XYQA 4PCLA 1DL5A 1JG3A 4DCGA 2OO3A 3LCUA 3LDGA 1BOOA 4LECA 1G8AA 3AY0A 5DWQA 3KQPA 1EAMA 3HCFA 5LQAA 5JR3A 3NVKI 3SGLA 3G2MA 4GOND 3EPPA 3UWPA 3EEOA 5CUQA 2IFTA 3FTCA 5K0CA 5LSAA 3ERCA 4YMGA 4A6EA 5T67A 3UJCA 3G5TA 3FUVA 3M33A 3TLJA 1INLA 1D2GA 3FRIA 3NVMB 1TW2A 5EMLA 4EKIA 5BXYA 2BH2A 2K4MA 1JSZA 3SM3A 3PX2A 3ID6C 3UJDA 2I7CA 4LWPA 1MJFA 5D1NA 4PYNA 2AOTB 2PVCA 2OBFA 4CKBA 3BGVA 2O05A 1UIRA 3LL7A 5EGSA 3U81A 3GWZA 3E23A 5HIIA 3RW9A 2IH5A 1YF3A 1ORIA 4C03A 5HEKA 3A7DA 3MCZA 5EPEA 5EMKA 2ZCJA 2VDUE 4KDCA 4P7FA 5FCDA 2G1PA 3LDFA 5GP1A 1FJXA 3FYCA 3QOXA 1KHHA 3BUSA 4PGGA 3UA3A 3V8VA 3BKWA 3IYLW 3CBGA 1RI5A 3FUWA 2AZTA 3P8ZA 2P8JA 4WXHA 4O29A 2NYUA 3O31A 3FUTA 3FTFA 4X61A 3K6RA 1KP9A 1Q0SA 2GLUA 1M0EA 4RTSA 5BW4A 3G88A 5FQNA 5EEGA 5P8WA 1N7JA 5DX0A 1XDUA 4RVDA 2OXTA 4EMSA 4YUVA 2HNKA 4DA4A 5K0JA 1O9GA 3MAGA 2GA9A 3C3PA 3SSNA 3P9NA 1X19A 4GQBA 2PBFA 1F38A 4WVLA 3C6MA 5E9JA 4ER6A 4MHTA 2AN4A 4B17A 4LG1A 2EX4A 2FPOA 5F2OA 2NXCA 1VP9A 2PSSA 2JHPA 3BWCA 1VQ1A 3SSMA 2IBSA 4PYMA 1QYRA 3P9KA 1EG2A 1WXWA 5EG5A 2AVDA 3I5UA 5EIWA 3KPVA 4L7VA 1V39A 2PT9A 4OA5A 2NP7A 3IV6A 2ORED 3SX0A 2OPBA 5DLYA 1WXXA 3R0QA 3EVZA 5DM4A 2IH2A 3DUWA 3M6XA 2ONZA 3EVFA 1SUIA 5FHQA 3CKKA 4E2XA 5JUWA 5EKXA 5GINE 1NKVA 2JG3A 2BZGA 1ZKDA 3VC2A 2QY6A 3LECA 4DQ0A 4OBWA 3SMQA 2NXNA 4A6DA 1NBIA 1F3LA 3DXYA 4RTMA 5K0NA 2YQZA 2EJTA 1G8SA 4JXJA 1HMYA 1JQDA 4G56A 4HC4A 3VC1A 1JQEA 3LBYA 2OY0A 5EVJA 1L3BA 3EMDA 5DX8A 4PCAA 2NNWB 1OR8A 3KR0A 4OA8A 2PWPA 4QDKA 2PT6A 5EQJB 2AOXA 4POOA 5K0EA 2PV0A 3BGDA 3OU6A 2B2CA 3KQMA 4PONA 4OQEA 3EVAA 4QVKA 2PXCA 4GBED 2IPXA 3OU2A 2NXJA 3EVGA 2GH1A 2G72A 5D1HA 4PYKA 5EMJA 1QAOA 1KXZA 3OZTA 4FR0A 5DT2A 3BXOA 2BM8A 4HTFB 4ATNA 4E31A 5HZMA 4RTPA 1YFLA 4QPPA 2PLWA 4OX9Y 1NW3A 2GS9A 2DULA 2AN3A 3VYWA 1N7IA 2I62A 3BZBA 3OFJA 2AOUA 3DLCA 3DXXA 5K01A 5LQUA 3A25A 2Z6UA 3A27A 3FRHA 2ZWVA 1SKMA 3T7RA 1YUBA 1P91A 4PIMA 4BP3A 1XDSA 1TPYA 4AZTA 5E2BA 2IH4A 3R24A 3OZRA 2A14A 4R6XA 3TFWA 3QOWA 4RV9A 2IGTA 3BWYA 1WS6A 3D2LA 5E9QA 3UJ9A 1O9HA 3G5LA 2JHAA 3DP7A 4K6MA 3PX3A 4NECA 1KYZA 3PVCA 5EZSA 5BP7A 4Y2HA 4PWYA 3SSOA 2G71A 5LQRA 3MGGA 2ERCA 4PYLA 1T43A 3HCEA 4PIPA 4GC5A 2O07A 1XVAA 5HILA 1NW5A 2GB4A 4QQNA 3I58A 2AOVA 2FYTA 3LDUA 3OPNA 3GIWA 2OYRA 5LQCA 2IP2A 5CVVA 5C0OE 1XXLA 2CL5A 3MERA 4P7KA 5U4XA 3HA3A 3TKYA 4E33A 2VDWA 4PGHA 4RX1A 2FRXA 4FS8A 3HCBA 1JTFA 3BKXA 4PYJA 3CJQA 5T6BA 3A4TA 2Y1XA 4DMGA 8MHTA 1KPIA 4KRGA 3KR1A 2ZVJA 4RTQA 3OE4A 3HTXA 4Z2YA 5CCXA 4GOOD 1L1EA 1X1AA 2P1DA 2H00A 4GOLD 2C7QA 2NP6A 2ZIGA 1BC5A 1EJ6A 1RI2A 3B89A 3HA5A 4BLWA 2R6ZA 4CKCA 3MCTA 4OBXA 3B3GA 3PT9A 3A26A 1YFJA 3TRKA 3T0IA 3KU1A 5ICFA 5ICEA 2QRVA 3LX6A 4XUDA 2EFJA 3MB5A 5LQKA 1L3IA 5GM2A 4LWOA 4GC9A 1NW7A 4KVZA 1AQJA 4AX8A 3OU7A 5FA5A 3TM5A 1QANA 3GO4A 3JWHA 4FT4A 7MHTA 2CKDA 1SUSA 1XDZA 5GOZA 4E70A 3NDIA 2WA1A 4V0RA 4FSDA 3TM4A 5DPMA 3GXOA 4GUAA 1JG1A 4P58A 5FWDA 2H11A 3DMHA 3P2KA 2PJDA 1M6YA 4AZSA 1FBNA 5KYGA 1HNNA 3FPHA 1ZQ9A 3KPWA 1P1BA 4ER5A 5EHGA 1JSXA 3HVIA 4RTNA 4DKJA 1YZ3A 3WSTA 1ZHFA 2P7IA 2C7OA 1EIZA 3KQYA 4R6WA 3NWEA 5G02A 3P71T 3FZGA 5DSTA 1RI1A 3FPGA 3OZSA 2IIPA 5CD1A 1QZZA 2O57A 3LHDA 1AF7A 3GRVA 1R18A 3BWMA 3PS9A 4IKPA 4P7GA 4X60A 1IXKA 3P9CA 3TKAA 2B78A 4FZVA 2P3QA 3LBFA 4GOMD 4XCXA 5E8JA 3NMUF 3NW9A 4H0NA 3FYDA 5FWAA 4MTLA 3HCAA 4YUZA 2P41A 2JHCA 5FQOA 5IH3A 2V74B 4V0QA 2P3OA 4YV2A 5HOQA 5K0GA 3CJRA 3PFHA 3KPUA 3THRA 3LGAA 3AWIA 3MTEA 2JH9A 4PYIA 4EKGA 1L3CA 3E7PA 5ERGB 1ZGAA 1Z3CA 4XUCA 1FP2A 4M38A 2FCAA 2C7RA 2ESRA 2HMYB 3P9IA 3EVBA 4QPNA 4RVGA 4C07A 1NBHA 4RVFA 1UWVA 5DM0A 3FTDA 3UJAA 2YUIA 3IHTA 1RI3A
chains in the Genus database with same CATH superfamily
2YC4C 1G2PA 3GOHA 1ZXLA 2BJVA 5D8DA 2ODNA 1W6UA 1QIJA 3OQBA 2JBHA 4RXUA 5F77A 2ZR0A 4M0WA 4ZOQI 1Z75A 3M5PA 3ZK8A 2VZ9A 2GK6A 1MZPA 4EHHA 3HBJA 3GFPA 2J3DA 4TS1A 4FDLA 3WLEA 2NWQA 1X14A 5JNLA 4UPDA 3F47A 1Z34A 2CLDX 2FWJA 3D7RA 2MU1A 3FM9A 3PSAA 3OI7A 1Z2DA 2Q41A 2QNRA 1M10A 5KKCA 2JF0A 5MN5A 4PLFA 1CLEA 3LS2A 3OTWA 2DR0A 5F2KA 2EP8A 3ANXA 1SU4A 1OLUB 4MWOA 3PFBA 2XUHA 2N0SA 3TNFA 2JCBA 2C2BA 2AN1A 5KNCA 4HWGA 5HFJA 1WB4A 2G7ZA 13PKA 2VH1A 1KIAA 3NRBA 2PTHA 2HXGA 1F4PA 1KO7A 4BHTA 2GPBA 2I8AA 3F8SA 1DKRA 3GQBA 4TYNA 4DDVA 3N8KA 4WLEA 3PWZA 5EP1A 1KQPA 2WF6A 3FBWA 3ZXXA 3OEED 3JS5A 1YGYA 4ZYYA 1H8HD 4K0KB 1U3UA 1A9QA 2FW7A 4NZMA 3TBHA 3OCJA 4M1WA 5E6UB 1ODJA 4KQKA 2VP4A 2H2AA 3ORRA 1EG7A 3N9IA 3OFSA 2Z30A 4KTTE 1NN1A 2NO6A 2GJ9A 4YP6A 3FSRA 1JNYA 2PKQP 5L95A 1H0RA 1ZW6A 2CLEB 1NSYA 2W2KB 2JCXA 4B3SM 3DH0A 4IXMA 3JZMA 3IPAA 1LB1B 3PNQA 3FOWA 2J0QA 5EHZA 1R4ZA 3FOZA 3C1AA 1I4TD 3KO8A 4ETMA 1DSSG 4DIFA 5DTJA 4JJKA 3UMYA 1SOUA 4TT8A 5C9ZA 4K9KA 4DV4M 4C0JA 1PO7A 2M9MA 1I6LA 1QUFA 4BQSA 2I3DA 4LXXA 4TRNA 1UWLA 2C2MA 3G8DA 1NUQA 3OC0A 2J45A 2NV0A 2J9ZB 1DRUA 1JIUA 4R7ZA 1SMKA 4R40A 1R8QA 3A7DA 2ZUCA 2QN7A 3WDLA 3KVWA 4MWTA 3QYEA 4ESVA 1UZNA 5JWOA 3NHRA 1BFDA 4UBNA 5AUQA 2FN3A 3TLGA 2EW1A 2QZZA 2OORA 3D8SA 2IUSA 2IW1A 2R4JA 3W5CA 4R1LA 1C8VB 2BFBA 3PC6A 4XVHA 4D4IA 1QUEA 5IP5A 2X19A 1BU5A 1K7YA 3RFFA 4B3RB 1P1JA 2PBRA 3FPLA 4RH1A 3KS4A 5CTJA 5EQJB 5BQXA 1OX4A 1E61A 2QPLA 2V7XA 3IBTA 1NLUA 1P2UA 2YVKA 3OKAA 5C3MA 4O59O 2W48A 3ZWBA 5LZ5A 1H2YA 1ODFA 2J3IA 4R3NA 1BG6A 2EJWA 2AN3A 4BGIA 3RVOA 3AFMA 3GQ3A 4FEYA 4U0KA 3ZCUA 5CX4A 3ZD8A 3WWDA 2QAGC 5IPFA 2KZUA 1I2BA 4CMEC 3J80S 3WWYA 1EXDA 4ECAA 5HQ3B 3JYLA 4IIJF 3GFVA 2KXEA 1X70A 4YRPA 2X41A 4NC9A 2Y1XA 4HTAA 4KRGA 2FW9A 1J1ZA 4QICA 1DINA 2Z56A 1W2HA 3PT9A 1QUTA 5DHSA 2C7BA 5LQKA 3BMQB 2O0MA 4E5MA 1DDIA 3OOYA 1ND6A 2FS1A 2QU7A 3DMHA 1M6YA 3E2MA 3JQDA 4WESB 4DKJA 2P7IA 3WGVA 4FLFA 2IYXA 2LBPA 4OAPA 5E8JA 1XZNA 1QH8B 3P45A 2XCTB 1SAYA 1ECCA 3CQ9A 4N3NA 4RHEA 4MO2A 3HBLA 3NO4A 2B0JA 3ZIUA 1VFPA 4PTZA 2Z3VA 2CNKA 3KJIA 1QYWA 3K8ZA 3ZKWB 3U0BA 2AFHA 4B3TB 5K03A 1GO2A 3V9PA 1ODIA 1XZGA 3LGXA 5AW6A 4CNQA 2UZ1B 1PK7A 2IYZA 1X7XB 4KUEA 4BZXA 3O3MB 3EHEA 1Q02A 2GNAA 3WYAA 3SD7A 3PJEA 4RVCA 3TN7A 4IXDA 5IASA 1K4YA 3GT0A 2PS0A 1S6YA 4ESHA 5DTRA 1YMQA 4FOOA 1QKJA 2JB9A 4Y7CA 2VDKB 3FB1A 4DBZA 3FR7A 4E21A 5KHOC 1FU8A 3O0DA 1BVRA 4HRVA 3LP8A 2YH2A 4HVAA 4QWMA 3DKPA 3UGJA 1LBTA 4CGYA 5T8KC 2K6BA 5JG7A 4FE7A 4R2KA 1V2HE 1XRSB 1O6CA 4F4HA 1WHSA 2F3PA 2YWJA 1WCXA 2I67A 3K7EA 4Y2QA 1C9YA 2GQ0A 1M8KA 1GYQA 4GMXA 5B1HA 2X5JO 2PGNA 4UFNA 1MIOB 2E4ZA 3HX3A 2IYVA 4PZUA 5JCJD 4Z2AA 4HWTA 2XE6A 3Q7RA 2ODAA 4DB2A 4XWKA 3AVOA 3MN1A 2P5YA 1GYRA 1P1RA 3UXYA 5LMUB 1ZS9A 3BN3A 1OTRA 5JJKA 3DDCA 4PZCA 3ZLBA 4BLSA 8ADHA 1I4LD 4MYSA 1G18A 4FMCB 3UATA 4JVMA 5C52B 5BVGA 3UK0A 3AK4A 3EODA 3F5FA 2XQKA 3CM0A 2XDQB 1DRJA 3K5WA 1X7YB 1AKMA 2A4MA 3R9WA 2DUJA 5CXQA 3IMCA 2IZZA 4EMUA 1E2LA 1FLAA 3L5OA 1SXJD 3C58A 4WZAE 3TTVA 3MAGA 3R5TA 1J8VA 2ERXA 3LOPA 4WCFB 1PT9A 4CDGA 5CPFA 3TX6A 4LE2A 5EIWA 4S1NA 5AUPB 4FCWA 4X5OA 5LUAA 4Y0VA 3WBFA 1Z4LA 2ORVA 4OBWA 1CB7A 1Z7GA 1NBIA 2JH3A 4HH3C 2LCFA 2EJTA 1QOPB 1XIVA 1DEXA 1VYUA 4DMHA 2OHJA 1U3VA 1UBHS 2QLLA 4PYKA 4ATNA 4Z7OB 4LK2A 4HDNB 5IN5A 2LBCA 2AOUA 5KOJA 4Q6WA 1PTKA 3A27A 4XDYA 1YUBA 3SQNA 5IVIA 1Y4SA 3HKPA 4DKXA 4DIMA 3EGCA 2Q8NA 1JFLA 4FFNA 3HCEA 1ZA1A 4CR6A 4DSUA 4JN6B 3H2SA 4HPJB 4IIXA 1HG0A 4MS3B 4RK0A 4XTRA 1MORA 4XRRA 4PHTA 3NB0A 4QD3A 2GM5A 3ZH9B 1U2TA 3TRKA 5JC1A 4MKRA 4XUDA 1HOXA 1GL6A 5B64A 3NYQA 2OOAA 3O92A 4NJEB 3IBFA 4IUCS 1V7PC 4GQIA 2Z9BA 2FW6A 3VVMA 1AT1A 3P2MA 1HC7A 5BV1A 3MGBA 4CMHA 1NPYA 1LC3A 3E9QA 1CQZA 5ULLA 2JLCA 1R4MB 4UAVA 5HCUA 1JPUA 4HEA6 3VZDA 4PX2A 3FETA 3BK7A 1K4KA 3UWKA 3T99A 2P2YA 3E46A 1E1RA 2OAEA 1DUSA 3IKVA 3I09A 3MCUA 3HYNA 4O2BF 4US0R 2FGJA 4IQ4A 2O8FB 4ZT7A 4QNRA 1YI0A 3DFMA 3OPYA 1RRVA 1IN1A 2GAJA 3MBIA 1PJZA 4R8RA 1OWLA 2V45A 1UK6A 5AM0A 4IW3B 3FVTA 4MGEA 2IU0A 3UAGA 1NAHA 4TTRA 3IXMA 1F2UA 5EUBA 2HWKA 1LZLA 1VE5A 3IODA 4ZZIA 1GQQA 3PDIA 1P7YA 2SKCA 3PGJA 3ZVRA 3AQIA 5LBUA 4MI9A 4A7PA 4R7TA 1NXXA 2QJRA 1QF7A 1Z62A 1G6Q1 2VVTA 2AHOA 1NI5A 1NJ6A 1H4TA 1DUIA 1J56A 2PUAA 1A95A 4U39A 1E7SA 1XXHA 4H1WA 3DKKA 3ZV5A 2QJFA 2QRQA 2ZE7A 3U61B 2VWQA 1J2YA 3AINA 3CE9A 3DUFA 5IDYA 4D8UA 1IM8A 1NIJA 2VZLA 2QRVB 2PX2A 1LX6A 1PJJA 3SZOA 4KE8A 1N5DA 2Q3EA 4TTTS 5KSYA 3B5EA 3DHVA 4KMOA 3IH5A 4O25A 4F12A 1K8ZB 3Q7TA 4WNAA 4G3XA 1DHRA 1R88A 1YJQA 3OQOA 3S8MA 4F9GA 4CFYA 1AKQA 2I87A 1X8JA 1MNAA 1QWSA 5HTKA 3EZLA 1L5HA 3SVLA 2G77B 4X1YB 4EI9A 2R48A 1SFRA 3CISA 1OAAA 2J3EA 4KVAA 4UJ3A 3RH0A 3HEMA 2CNWD 2AV6A 4PR3A 4YRDA 3C8MA 3GLGA 1KVRA 1Q3TA 3SXPA 4TYMA 4QUGA 3RUDA 4CHTB 1I5EA 1VBKA 3ZVNA 4M0LA 4N49A 4PTYA 2RGXA 4OU5A 4X41A 2JFXA 4C4PA 4MO9A 4Y6SA 1Y6RA 1UDXA 1XF9A 4C2UA 2XD4A 5D6NA 4XDGA 1JQ5A 2PVCA 5FBKA 1FZQA 2DBZA 1WXQA 4P31A 3WXBA 2FF5A 2RARA 4F3NA 4YJFA 2VDUE 3RSCA 1K5HA 2IXDA 3FUTA 2LP4Y 4C0QC 4GX5A 5MDHA 2OBXA 1BS1A 1XJCA 2E87A 1CJCA 4K46A 1DG3A 2JI9A 3AB8A 4GMQA 1AZWA 4Q19A 4WNYA 2VF5X 4CR7A 4YIKA 1SZCA 2OGWA 1RFGE 2ONZA 2JG3A 3INTA 5AK5A 3GNTA 3QHPA 4Z5XA 1DFGA 4DDTA 1YLAA 2FN7A 2BL4A 2PCLA 1JQEA 1Q16A 3KFXA 5JTUA 4YUAA 3CGWA 1PLJA 4DQVA 3PC4A 3N2ZB 1YFLA 4Y1RB 2DBQA 2GS9A 2BUCA 2VK4A 1SKMA 5BN3A 3J81A 3OZRA 5FFNA 1CY2A 3G5LA 3ZX5A 1L5OA 5E7MA 1VDLA 4TUYF 4I2NA 2JY7A 4G4JA 3BHMA 1NVWQ 2VDNB 2IP2A 1G20A 2FW0A 1DGHB 4E33A 2C4HA 1NGSA 1Y6QA 1XTTA 3UK1A 4CZ2A 4EKNB 1PDVA 1V1JA 2QA5A 4GOOD 1PGYA 1C9MA 2Q62A 3NOQA 2C82A 3RVPA 4OBXA 3EIWA 4KGVA 4AKTA 4HQ6A 2CNBA 2R7AA 1K8XB 2IXTA 1YS4A 4UZEA 5ITVA 4P17A 5KJ1A 4C4YA 4GPD1 3RO7A 2X0IA 2POCA 4TXJA 2KI5A 1CF2O 1E9RA 4IIFA 4BWYA 1OX5A 4FZVA 1E0KA 5IH3A 1U6IA 4YQFA 1U1CA 2P8SA 3FZYA 2FCAA 2FPUA 5LN1A 2AYXA 5D5PA 3SLGA 5FOSA 1E1CB 3MAJA 1PW5A 1EZZA 3DWEX 2HBRA 3WHKA 3TMYA 3UJ3X 4K28A 1JA1A 1A3CA 3ABOB 5C7YA 5I8WA 2WYHA 3RNOA 3D8TA 3GQ4A 4N0MA 3EQ2A 1QIFA 4B6PA 1QONA 2I6GA 3OEYA 2HRRA 4YJHB 4BVAA 4FQ7A 3S3TA 3WHIA 3B13B 3LYUA 3SAVA 3ZXYA 5GY7A 1KARA 2V7PA 3N70A 4JEHA 1BE1A 2HJWA 4NOLA 1BKDR 3NC1C 5EZYF 1UPAA 2C97A 2CL6X 4G5RA 2L2DA 4F5WA 2QQFA 2WU0A 1XQ9A 2ZFUA 2IYQA 1A2OA 3PVZA 3B1KA 1FSFA 2A9KA 3UWMA 2GASA 2UVQA 2W8ZA 4PCZA 3ZR4B 1TF0B 2ZEJA 2WT8A 4AKSA 5K6AC 4DFDA 2AKEA 3HK2A 4DPLA 1LPAB 3HWX1 3X0DA 3FMIA 2Q9UA 1QDLB 2W6OA 3TDNA 3HJHA 1ZUWA 4EK9A 2A5YB 5BSVA 1YL5A 5LCXA 3KKPA 4NYJR 1ZXXA 4OXYA 4MGZE 1JJBA 5AKXA 4Q39A 2CMFA 3MJFA 1XZBA 1RZRA 3EJWA 2Z8ZA 2BFCA 4BV9A 1SG9A 1IIBA 3A0RB 4DV0B 5DV9A 3BEDA 4P3XA 4OSPA 2Q1TA 1W85B 3MIZA 4G8BA 4P8RA 5TJ9A 1XPUA 3PPVA 2IP4A 3CSUA 1OAOA 1EQUA 3H17A 3BD8A 4JI7M 3MCAA 1Z5BA 1JJVA 4P22A 4QYXA 2IHJA 2PKEA 1FMTA 1IOZA 3KEQA 3V4OA 4KLRA 2BW0A 2OWEA 4P3KA 4Y30A 1O4WA 3N2KB 1ZJJA 2Q2VA 3K3PA 1TC2A 2O52A 3DFIA 5FUQA 4S24A 2Y66A 3ORYA 3DBLB 3EXHA 4YJKA 1M2OB 2JFQA 4TL7A 4CUZA 4E2FA 4DR1M 3H1PA 1GL3A 1N2ZA 2E85A 1LKZA 4EG8A 3KB8A 4C21A 1L5YA 4H27A 1I5OA 4QBHA 2Q2OA 4OP1A 1C1XA 2WWVD 4TMXA 3UTDA 3OCZA 5H9VA 1QGDA 2R46A 4ZODA 2I4TA 2NZWA 4GKKB 2RRUA 3UKDA 3CKLA 1NYTA 1X92A 1JEJA 3NKVA 1PJSA 4LV6A 3C74A 1BRTA 4OD0A 4RTPA 1GUZA 2Y77A 2GDJA 3ZHCA 3OM0A 5IYZF 3WL3A 4K5QA 2RJOA 5DN6D 5CBPA 2JHAA 4BDSA 3IUYA 2O2HA 4XE5A 3CF0A 1EXVA 5FBQB 1DWQA 2VJPA 3LA8A 1GA4A 5C0OE 4GI7A 3TNJA 4E3ZA 4C2BA 3F73A 3LLSA 1TOAA 2UUPA 3QELB 2V6IA 2MTBA 4MP6A 4LZNA 4Z9FA 4RTQA 2ZU0C 2RGAA 1FVXA 1GLNA 1MH9A 2D1FA 4XYLA 5H9WA 2RHMA 3HKDB 1VECA 4EHDA 1K5PA 4GGMX 3JYOA 5G4LA 4XIGS 5EPOA 3PFCA 1QJCA 1D2NA 3Q6IA 2P2ZA 4PLGA 3L1IA 4V1CI 4NCIA 4CMJA 4ZT3A 5DGCA 2NPIA 2AFHE 4DGQA 1WU8A 3SS7X 5DSZA 5CFQA 1B8OA 3BQMB 1T6NA 4V38A 2XZUA 2I7DA 5IC5A 2QD1A 2BFDB 2JKZA 2AS0A 1UOEA 2R60A 1RAAA 3ROMA 3KU4A 4BMPB 5CM2Z 3DLIA 4YDHB 3E21A 3TOSA 1WXHA 2C9ZA 3AESA 3O73A 5HJ2A 5L3ZA 3GVXA 4TVOA 2HU5A 3WICA 3SQOA 3BB1A 2W43A 1SH7A 1J07A 3B6KA 3H2BA 3SXUB 1XCJA 2GM3A 4C1NA 3WRYA 4LZPA 3M6UA 3EXAA 5HS4A 2CNLA 2VHVA 4F92B 3U6KA 3AL2A 1GKUB 1ZIOA 2R6CA 1N2EA 3MD0A 3CX6A 1JLHA 3R74A 1S2IA 2VK2A 3K0BA 4KT0F 3K5PA 2ZBQA 4G0OA 2GPTA 3VYSB 1P60A 3BFKA 1JG4A 3T3MB 4M36A 3NBMA 4P5DA 1SCKA 3C98A 4DR2B 1XPJA 1BXGB 4GYKA 3TKLA 3Q5GA 2YKGA 4W9RA 4XK8F 4DEYA 1ZPDA 4M0UA 1S8NA 3HZOA 4IGKA 5IF3A 121PA 2VT6A 3C6KA 2YZ2A 1GG2A 3KQNA 2YFKA 2AQKA 4ZCRA 3THWA 2OB2A 3AI3A 4DARA 4Q3EA 1P17A 1G1AA 4IOJA 3CRRA 3PUVA 1T9ZA 4X1KA 4W8GA 1N2XA 1OVGA 2IE8A 1V43A 5IFLA 1SC4A 2GZRA 1XZKA 2QCUA 3DG9A 2X1LA 4EO9A 2IXFA 3KQVA 3VV3A 5BMVB 5LP6A 1Z5AA 4IPTA 3EIFA 5B1SA 5COQA 2QMOA 3VAAA 4H1UA 3KUXA 3RRJA 2PYDA 1EGAA 3U6PA 4NCAA 5BUCA 4F5DA 1V3TA 3QXSA 2HCRA 1KH2A 2IPAB 5KTOA 4EW3A 4W99A 3KXPA 4JX9A 2R8EA 1VSUA 4KWEA 1KFVA 2LCQA 5D6OA 1NY6A 3TLXA 2X9QA 3Q6NA 2B94A 2Y2VA 4AQDA 5FBWB 2QX4A 5KYWA 1D9ZA 1UIRA 2YYYA 1Q91A 2VWGA 3O75A 1XKQA 1T3TA 4P35A 3ZV4A 5FQNA 3PT5A 1TH2A 5DNUA 3S2GA 3F90A 3DBHA 3TLAA 3B6ZA 2JIMA 3BRWA 4BO7A 1XELA 3LF2A 2HMTA 3ZI0A 3MOSA 3VH4A 1LW6E 4OA5A 2QROA 4WOBA 3VC2A 2QQ5A 3PJDA 1U98A 1ADJA 4OHYA 1F12A 3H6HA 2YL2A 3VHLB 4BVKA 3K2IA 5DYGA 2G72A 1DWPA 2LHCA 1NU6A 1K6IA 4JCCA 4IGAA 1ISGA 5DHTA 2OZLB 3OZXA 1HTWA 1KJ9A 3BWYA 1NIPA 4E13A 4M0CA 5B6JA 4TLDA 5JNVA 4GUDA 3I34X 3L4KA 1CNFA 3LLMA 3B1XA 3MLEA 2OBMA 2YXBA 1FSGA 4DV5M 3KR1A 4PSKA 2UVPA 4HGNA 3AI7A 4K26A 1QX4A 3D6NB 5TB5A 1YHNA 4OHWA 4X7PA 2WA1A 5KJEA 2EX0A 4P58A 4KV7A 4Q24A 4HD8A 5DTIA 5BT9A 5LB2A 3FFBA 3D7KA 4Z3KA 2XLJA 5AIBA 2IZ0A 5E7QA 2UVDA 3FYDA 4RWEA 1WDKA 2JHCA 1WD7A 1QORA 3KYBA 5C37A 3ZIAD 1IY2A 3N2GA 2FH5B 1IY1A 3EX7C 2GN1A 1N34B 4BO2A 4EG7A 3ZIDA 3U3RA 1RAHA 4B4VA 1G3RA 4W9MC 4OBBA 4L8RC 2E5FA 3HJ8A 4FBLA 3A2MA 4OH1A 1FFWA 1FXWF 3KQUA 1HOTA 3MHPA 1UJNA 3LO5A 3BHIA 1KJZA 4CMGA 1TM5E 2FFAA 2ZULA 2G3QA 3SZRA 3N5CA 5JARA 1GXSA 1QQ5A 2XJ9A 3ASZA 1H2RS 3C3MA 5AQEA 2XE7A 2B35A 1L8OA 3UKJA 5M3BA 4I4NA 3OVMA 2L19A 5I48A 3RIXA 3IC5A 1IBKB 1ZM7A 2D1TA 2HPVA 5C1IA 1F4IA 4HNGA 1B43A 1I2DA 1XXHE 3RODA 5DM60 3G2KA 1W2GA 4KR3A 4Z54A 5E3IA 4UQOA 5DHQA 3VNSA 4KAXA 1Z13A 5B7NA 2ZATA 1TJ3A 1GTJ1 4WXRA 4CUKA 1N33M 2WJYA 2LDBA 4N6GA 1RXCA 2WIAA 2LXEA 3RSOA 2IXEA 1M6EX 1NR5A 3LBHA 1K27A 3PLAE 2H1RA 2O19A 4HRAA 3UG6A 3QY9A 5FPYA 4ETNA 1Z29A 4LYYA 1DZIA 3DC7A 4IBOA 1MGOA 3Q1KA 4EG4A 1HEYA 2XRYA 4DY6A 5FOTA 4HTFA 2RHLA 1Q20A 3AJEA 2ZJFA 4PCUA 3LUJA 3HCWA 1U8AA 2EWVA 3GLGE 1GO5A 3HCNA 4ICIA 4P81A 2LD4A 4DC1A 4G6ZA 1YDWA 2OP0A 1YZLA 2CV0A 2B21A 3QEJA 1ONSA 2FVXA 2GD6A 3U4GA 4I3FA 1GFSA 2YJ3A 2LIVA 3QVKA 1EX6A 3TLZA 2WUGA 3GLFB 5FTWA 2ZRLA 3HMQA 3FYUC 5HIMA 2QR3A 5JYCA 5EMMA 2C1EA 4HWKA 2QUBA 4O3FA 3UWPA 1JAHA 4LF4M 2VSXA 4B80A 3P4UA 1DLJA 1ONNA 4I55A 1FFSA 3NWLA 1Y7HA 5JY1A 4GKJB 1Y1LA 2UUAM 4LZOA 4ZEOA 2ZQZA 3NV7A 1WZ2A 5FUYA 3ECCA 3O21A 3P20A 5TV2A 1MMFB 3JZFA 2ACWA 2HB6A 4I66A 5ALWA 5EQFA 5DZSA 4MPJA 4B7FA 5FHQA 1A71A 3GLIA 3L7MA 4G1CA 3CZQA 3PE6A 3B8EA 4TV9B 4S0ZA 2NXWA 1PX2A 3LZCA 3ND5A 2XCSB 3W3AD 1W0KA 3OE7A 2R84A 4IHQA 3OU2A 2B6HA 1XRJA 3QHQA 1ZI8A 4TKUA 1G20E 2WWWA 5E9QA 3QUQA 4YECA 1GSOA 2VZ0A 4MV4A 2JL1A 3SHOA 4YALA 5LQCA 5FA6A 3GF4A 4UXJA 3IGFA 2VDWA 1HE8B 1CW2B 2E2WA 3KVVA 4G3OA 3V1KA 1OZFA 3O8DA 5KNBD 2ZB4A 1N6OA 3U7EB 5IBQA 1ESMA 1RZVA 4E70A 3BXEA 1UMCA 5FWDA 1SVMA 1SXJC 5KYGA 4ZQGA 1IRXA 4XOUA 4DSZA 2Q50A 1M5RA 1Z59A 2P6PA 4BO1A 4TMTA 3CPHA 2V74B 2BWEA 3OQ1A 3FNHA 3TGPA 4PAQA 2X8AA 3NOOA 1UWVA 2E3JA 4MMZB 2HWUA 3ZW8A 1AE1A 1RXVA 1HNXB 3P0HA 4AMZA 4AMVA 2J9FA 3BREA 1Y8CA 3QIVA 2FN4A 3UPDA 1MZVA 2DH5A 3OOWA 4KEAA 2Z95A 2Y1DA 2VF7A 1T4DA 3WJ1A 1M8FA 1MR3F 5EE1A 1Z9BA 1ZOPA 2BZ1A 5LIPA 1C5KA 5JXJA 1A9TA 2X40A 1RAEA 3A6PC 5BOSB 2QRPA 1B2RA 3S7ZA 1FNSA 3WBBA 5HF6A 2VHWA 3V9AA 1O6GA 3GYBA 1RPJA 4RSMA 5DGHA 5KCMA 3WDMA 1GAJA 3PE3A 5KVVA 3QX8A 1CV2A 4A03A 3BRQA 3HZHA 4N5IX 2X49A 2OBYA 2L09A 4GRIA 4CKCB 3W2IA 3ND8A 5JBIA 1SA0B 1VPDA 5IM4A 3OKPA 4U7GA 3A6LA 4FSXA 4E4TA 5ILQA 3KQLA 2BP7A 3LVQE 4QLAA 5EHXA 1PZXA 3DLBA 4DV2B 3TUJC 3LWZA 3PNOA 5DNDA 6Q21A 3GL9A 2VUSA 1OC2A 3JYNA 3LPLA 2DPMA 4OREX 3FKSA 1U7UA 1UFVA 4Q1EA 4HDSB 2GILA 4A2CA 2QEQA 4NZNA 2ON6A 3TFOA 2QP3A 2NLOA 4ZMRA 1P39A 1Z4KA 2IPLA 5KQSA 2WTUA 1HG1A 3K53A 2KNZA 3K0HA 3HGQA 3FCUB 3B85A 2DCUA 2PL1A 5LFAA 2B2NA 4PPQA 2FCRA 2CW5A 2PMKA 2GA8A 1J5PA 4LS3A 4DPKA 3QPDA 1NUPA 2HFJA 4O2RA 4PLHA 4B76A 3T5DA 4AVYA 3D4OA 4I8XA 2JLQA 4GKAA 3IQFA 3RV3A 2RI6A 4JS0A 5L53A 2QUAA 2VOEA 4TSRA 1VMAA 4UMEA 4MR8A 3SIPA 1T8RA 4Q7MB 1FTWA 4HFRA 1M6VB 4MVXA 1Z08A 1VRVA 3QFFA 1AIPC 2YJGA 4JI3B 3GEEA 1PFGA 2RDMA 2E4YA 4HXEB 4NI5A 4ZVTA 4KE9A 2F2TA 3OLZA 4HDKA 2PNFA 1W0CA 3IQHX 4Q4JB 2EW8A 1QVAA 1VIVA 2JGMA 2VO1A 1JPJA 4G0MA 4NSRA 1X7ZA 2F5NA 3W5SA 4CIVA 4LMRA 3KOMA 1TF7A 4J0JA 3WGHA 3OT5A 1H05A 4L4ZA 3A42A 3FMFA 4R5MA 2CRUA 2NV2B 1ZITA 4Y0AA 1GR0A 1J8QA 2PRJA 3RU7A 3QFRA 1QE0A 4TMKA 1QGUA 3BZBA 1ZH8A 5B1YA 2HGSA 1XFAA 4MR7A 1VJ0A 5KB3A 3MWYW 5DT9A 2HMWA 2QIPA 2E18A 3KTAB 4MH0R 4D4HA 4X64M 2OV4A 5ERYA 1DDOA 3QBJA 3PYLA 1ZVVA 4FMPA 1NVEA 4MGYE 3ADDA 3LPNA 4V39A 2DWPA 2ZSAA 3TRFA 5EJFA 1E2EA 4OFBA 4B5KA 3HLTA 3G68A 1VXOA 4NOKA 3T3PB 4RMJA 3IDOA 1RRPA 2QN2A 1MVLA 4UBKA 2IU4A 4DM4A 3UB4A 4GUAA 3DO6A 4GNKA 4Z51A 3VSBA 3AETA 1VMDA 2GUWA 1FYXA 5G3YA 2GCOA 2VDBB 5I47A 1RHRA 1L1QA 4F7WA 3LBNA 3LMMA 2WTMA 3Q9SA 1PAUA 1JU4A 4F6RA 4LRSA 4RV4A 2VZ8A 4AJEA 4JLMA 3FE3A 2O23A 1JQAA 3Q0IA 1ELOA 5HFAA 3I5MA 2ZAYA 2IX3A 1VYTA 4D6PA 1I8TA 2B92A 2AXPA 4WZAB 3VGPA 1QC5A 1YZKA 3HUEA 1MO4A 3GHHA 2IDZA 2F67A 2P5UA 1S3IA 4OI4A 4WLUA 4UKDA 2QXYA 1SVOA 4WMLA 4KWIA 3HVJA 4E12A 2OMEA 1Z07A 5C5DA 3IIEA 1A0OA 3E18A 1S4MA 1M73E 4BNDB 1DTEA 1F6DA 4GM1A 1IULA 3OJLA 5ERXA 1UC4B 1N9ZA 4ZOAA 4AY5A 3L0ZA 3EQ8A 1OLSB 6AT1A 2OGZA 4KZKA 1FS4A 3OT4A 3A31A 2O6LA 4MVJE 2YOFA 3IR6A 5I7RA 5KWJA 2WWIA 2QD4A 2HLNA 4RK1A 5IF9A 5J2UF 5T8KA 1C9JA 3L77A 1Y1TA 2FE4A 4UTOA 2XYVA 3NM6B 3CURA 2WV7A 1AGRA 2WVJA 5EZ6B 3E5MA 5HCIA 4HSEA 2FFJA 3ROXA 3CN7A 3H3JA 1SBCA 4J07A 3DOHA 1JBKA 5ILOA 1I7QB 3EMBA 1L9KA 3A1WA 4OJYA 4OV6B 1ZICA 1E2BA 5I9BA 3IURA 2UXCB 1WF6A 1HLGA 4BB5A 3GXBA 2X1VA 5ED0A 2PZLA 1P9OA 4O3MA 2C5BA 2A2ZA 2CVPA 3B74A 2KJQA 1XMQB 1NWCA 5KTKA 4R9NA 4BNHA 1VBMA 1QFSA 3V8RA 1D4FA 3T9FA 3H9BA 2PM8A 5CTAA 3FUVA 4U7FA 2C9YA 1GUYA 1C2YA 3SM3A 1T10A 1CE8B 4H15A 5JANA 2NZ2A 4A4DA 5AESA 1YL7A 2HHHM 4ZVOA 1CEYA 1FEZA 3V4SA 5L8RF 4AROA 3M4JA 3QKUA 1PHRA 4NWIA 3GRFA 1E4VA 5J1TB 3L7IA 2G1JA 3I8SA 2B1GA 3G0GA 4GAEA 1CQIA 4PS0A 4JB3A 5AO9A 4B2PA 3RAEC 3EZ9A 1IBLB 3D6VA 4O4HA 5DM4A 2XUAA 4HBZA 4AURA 5CLLA 1KJYA 3H83A 2XF8A 3E15A 4Q3AA 2FKAA 3BTSA 2HF2A 3FI0A 2A0YA 1RC0A 3K72B 2KWIA 3ROGA 5SYNA 4QXAA 1Z06A 4II3A 1RCFA 3MBOA 4MWDA 2QORA 4F1IA 5CJ2A 1L2BA 4E0BA 3X2FA 2FPGA 1XVAA 4LSZA 1G8MA 2D2VA 4TGLA 2XMRA 1BWPA 5EWMA 5H59A 2UUCM 4DCSA 3ZD6A 2IOYA 3MRSA 2X9GA 3IUMA 2WNHA 2OK7A 2WY2D 4GOLD 1MO2A 3NR2A 4LF7M 5KO3A 1QRUA 4NMWA 2HO5A 5DPMA 5B12A 4LHZA 2RH5A 3WIDA 1YKGA 3ZU6A 2HZBA 5LMCA 1E1LA 2W0SA 3ZK7A 4AKHA 2QL5A 5LMZA 3HNPA 4YACA 1A82A 1F6BA 3CV3A 3IILA 5TMDA 4MCHA 3WL4A 1RQNA 3WV4A 2Y4OA 4UQPA 4HAXA 2FPRA 2C5SA 2VDLB 1ORTA 2ZITA 2KMLA 1I33A 3TIIA 2HGZA 1XCMA 1D2RA 4Y6GB 4E7OA 3VU9A 3TEMA 5HDQA 1ZOIA 2BBSA 3FD9A 1UFQA 3HY4A 4AW4A 3LIIA 2O2YA 2OL4A 1HDYA 4M87A 4P7JA 1IM2A 3N74A 4JXZA 1XTIA 3WDSA 1LK7A 1Z7YA 5JZOA 3LDAA 1CETA 4KYTA 2Q6IA 3SQWA 4IMJB 4BFCA 5KSWB 4CQLB 3HRIA 1JNXX 3B70A 1QUSA 3RYCA 3OZAA 3Q8XB 1QFJA 5DOZA 3GGJA 3WSVA 4ND3A 4RJIA 3C3XA 1ZIDA 1KEUA 1ULTA 4OSOA 3SZLA 1BYUA 3MJCA 3PHHA 4PBTA 3HKEA 3NWBA 4Q3OA 2YV3A 2NU9A 4HPWA 4FKMA 2AEFA 1CP3A 4Q48A 1NTOA 5JU6A 3ZGNA 1D6JA 1Z0DA 5F3DA 4EM6A 1R4GA 4B45A 3DNFA 4D8WA 2XX3A 3LHIA 3PNKA 5JOQA 3IDSA 2I34A 4BNNA 3O4HA 2Z8XA 2QZSA 3JARA 2XZTA 5ALZA 2PL5A 1WPRA 2OHHA 3BFXA 1LLUA 3C7CB 3C43A 3F8WA 5DB4A 1DTWB 1OXSC 4H59A 4B43A 3OCUA 2W4IA 3D8LA 1H1LB 4AP9A 2V1UA 5A4IS 1OASA 2DG2A 4JVLA 5EPUA 1NVXQ 4TZ0A 3IQIX 4G0WA 1WBDA 4KG7A 4NFSA 1EK5A 2ONCA 2BEUA 2I33A 1EFUA 4F9TA 3W4KA 4X93A 1SQ5A 1XAIA 2DT5A 5HRUA 4NATA 4RZ3A 4UPVA 1GTMA 2D00A 5JDIC 4RIEA 2H2FA 2F59A 3NHAA 4OLBA 2AXEA 5BYBA 4Y2UA 4C0SA 4Z9XA 3NRJA 4JI2B 1VB5A 1HR0B 3ID6C 1AKEA 1Z5VA 2W6IA 3JWPA 1L7MA 3EZ2A 4F4UA 3OLXA 1TR8A 1KDOA 2V98A 1FJXA 4FC6A 4LRQA 1CKEA 1XDDA 1O8BA 2HDHA 2GLUA 2VNHA 4JQOA 2ZPAA 1GILA 3JQBC 5AI9A 4B82A 3GLIE 5H81A 5JYDA 3NX4A 1O6ZA 4IDBA 1EG2A 1UPTA 4B7UA 2AA3A 1P0IA 2C2GA 3N75A 4OKNA 3GQBB 3DE5X 3MTDA 3A4IA 3ETGA 4RHXA 1CERA 2UXBM 2PX0A 5FFFA 2P5TA 3MMPA 5MN4A 4MDFA 3V76A 4BZPA 3OQIA 4DA9A 3ZCSA 4RLQA 1LI4A 4HH1A 4J6FA 4YT5A 1EMDA 3E5HA 3OLQA 3QKWA 2OKGA 3RG8A 4LJ5A 1D0MA 3ETCA 3TUIC 2VDOB 2CFTA 2GDZA 4HWSA 5TPZD 4IIYA 1W5EA 1UEJA 3GJ7A 4LFAM 1GSHA 1K66A 5U4XA 4URXR 1E3EA 3EBLA 1RFLA 4L8WB 1ZD4A 3L7YA 2O2EA 2HDWA 2PZKA 4G07A 4YRLA 1CR2A 5D3ZA 1OA1A 4AN0A 4UHHA 5C80A 2ZE5A 1Y9ZA 4YMTA 1DQRA 3JQAA 3O7MA 4YP0A 3FPHA 4X62B 2BFPA 5CD1A 5M04A 4NXNB 2Y1LA 5JCOC 1GTRA 5AHWA 4CQJA 2L0XA 1R9GA 1Y5RA 1U0BB 1FC0A 3PGXA 3THRA 5BSUA 4FYIA 1C7EA 3SF0A 4JBGA 3MWJA 2F9LA 1QRSA 4YJ3F 1KYTA 4PC7A 2HIAA 2VUIB 3LFHA 1ZN8A 3TLGB 1GOTA 4URZR 1ZU4A 2PEYA 2YNMA 2F7SA 4HLNA 4CV1A 3T7IA 2BFBB 4HNVA 1RHUA 4L74A 3KW6A 2HK8A 4IS2A 2GD1O 3EULA 3VTFA 1GUFA 3TXYA 3OM8A 4D3YA 1Q1ZA 2JLBA 1IZ8A 4F7DA 3R1IA 1P2TA 3EIEA 4ACAA 2F90A 5L6MB 2FQXA 2R97A 3H04A 1OX4B 2DFPA 1AV7A 3DT9A 4BMNA 2WJVA 2A9VA 1DJNA 4YCAA 2BMVA 2WE8A 3OFKA 5EFZA 1NAIA 2XB8A 2QVGA 1KQFA 3GARA 1H2EA 2W71A 2IEBA 4FOSA 2IV2X 1JHDA 1U4SA 3B2NA 3S2ZA 2LCIA 1Y4AE 4A8TA 2IITA 4GT1A 3TCXB 4HYTA 1IRIA 1ZK2A 5A9SA 1ISIA 1P0PA 2QL9A 1WW3A 3CRNA 3HR7A 1UJ4A 4U02A 3RADC 5K6AA 3JYHA 4J43A 5HDBB 1KNQA 4YT2A 3MLBA 4WNIA 2OGTA 4XUEA 3AOEA 4TVBA 4Q18A 4A0GA 3K31A 1B73A 3HUTA 3BH6A 2GNOA 3PQFA 1QHIA 5KBYA 3JZDA 3ZHRA 3HA7A 1KVUA 3RS5A 3CUWA 2G25A 3NIDB 9GPBA 4CT4B 3MJ5A 4JDPA 4HX2A 5K05A 3FYTA 2JPDA 4IRUB 4MYUA 2OXCA 4QPCA 3COJA 2RBGA 1YGPA 1XP5A 4P2GA 5DU2A 1OH8A 1WUTA 1TC1A 1UMBA 2AFHB 1XO1A 3DJYA 3RD5A 2LXNA 3TNLA 1XTPA 2FN8A 1WOYA 4KK3A 5ESDA 4Q3CA 3NDPA 1H0KA 2QN8A 1WXGA 1LFAA 4WJKB 1GCAA 2QRKA 4MVJM 4NYMQ 4GOND 2FR1A 4MEAA 3BL8A 5B30A 2G4CA 5BY2A 4PD2A 4HDOB 2X15A 3KVYA 1J90A 5C8ZA 2DOKA 2ZVQX 4XVCA 1YO6A 3N7TA 3B51X 4LF5M 5ABPA 4FEAA 4CM9A 5LWQA 1NOJA 5F2EA 5SV2A 1BFKA 3IG8A 1PLKA 2C84A 1ZK1A 4CG1A 4EY8A 4CGYB 1WXWA 4L7VA 2IZ1A 2HCBA 4UM9D 3PR2B 3HA2A 3L4EA 3DWGA 1N4DA 4ASUD 2IPNA 1ZCAA 3WHLA 3HJBA 2OCBA 1WHSB 3TSCA 5CIQA 1R5NA 5JMOA 1VZ3A 2ZB2A 5AJYA 5HP4A 4IDHA 2FQQA 2ID9A 1RWXA 4NXMB 4BLTA 1UK9A 2FU5C 2IQ5A 4A15A 4BX8A 2ZWVA 4EO4A 2C0PA 3MUEA 3HDVA 2A14A 4KAAA 2EFHB 1MG5A 3RWOA 2PBLA 1FA9A 4NV1A 5GPBA 2BKAA 4DG5A 5KREA 4WFQA 3C48A 4CDMA 2FHSA 4M1SA 2CL5A 5H5JA 3H05A 2HF8A 2WYWA 2QMEA 4FGLA 4KYIB 3QVVA 3U5TA 1ZUD1 5LDDC 3CRQA 1XJ0A 3LX6A 3S70A 1L5ZA 4LOIA 3GUHA 5A4JA 2CK3A 5BVGB 1A5BB 4M83A 3K4HA 3KQYA 2XWJI 3KJGA 1VCNA 1A97A 3KWMA 3FWYA 1L2DA 2D7DA 4XEHA 2JS7A 1ZX1A 3U5ZA 2QX8A 3I4FA 2ILTA 4P80A 3HWRA 4RMHA 4NEGA 5IKXA 1IHYA 1D6MA 1YIOA 3ICPA 5JZBA 1KEWA 1UBRS 1DJPA 1Y0BA 1JG7A 1HNWM 4FKBA 3J7AS 2AWNA 2Q4OA 3VBCA 3AXTA 3OEHD 4ZOEA 1HDGO 4HAIA 5FBZA 2F62A 4MUHA 3PXEA 5CPBA 2GEDA 3BVPA 5DLQC 3I23A 4CN8A 2WTNA 3ZWXA 3NT5A 1R00A 3F7TA 3ZXSA 4CEHA 3KWFA 1QZ3A 4U8GA 2Q5JA 4Q3NA 2AOUB 4EJ6A 5KOJB 1HO3A 2MSKA 2QL7A 2ECPA 3U6DA 4HHEA 2R65A 5HKBA 3H1BA 2F9FA 3WNBA 5IBRA 4Z4CA 3RHTA 2ZKIA 5CMLA 3DGEC 4L50A 4URHA 1HL7A 1C0IA 1PNRA 5DHAA 1XAHA 3MTIA 3UMSA 2ONJA 1R0KA 4WXMA 4BVFA 1OKSA 5CA0F 5CNJA 3ON5A 2XIQA 2XZFA 2D0PB 1Z82A 1RNLA 4F11A 3EWSA 4B3SB 3U16A 2R47A 2P6NA 3FUXA 2I2FA 1B8UA 1A7JA 3O6VA 1U1FA 5G1NA 1M1YA 4RDHA 3MINA 3PQ2A 3S8YA 1C4WA 1KJ8A 4ETIA 3RFTA 4FOTA 4D43A 4DV4B 5LWHA 1U11A 3UF0A 3KXIA 4JL5A 3IA7A 3SF8A 3AC0A 4RE5A 1FLDA 1T1GA 5IZ7D 1CYDA 4Z9YA 3HHYA 1Y8GA 2XAAA 1TFRA 1EE2A 2CHQA 3UZUA 2O3RA 2OQ2A 2MGWA 5KVSA 3D6AA 1RWQA 3W77A 4F96A 4C7XA 2OZVA 1XJQA 4EY7A 2F43A 3OPYB 1JUDA 2EOAA 4XM0A 3AR2A 2FPIA 1YZVA 1JJFA 1H0SA 4CFSA 3EGVA 1LPNA 2Q2EB 2RC6A 1RHQA 1W5AA 3RS9A 3KOWA 1EWVA 3PFFA 3RJMA 4XLTA 3FPEA 4AYWA 2OO3A 4E6PA 3FCAA 1F2UB 3SHFA 4A6EA 4ZARA 3TR5A 1A27A 4ZO8A 4DE5A 4RK4A 4WY5A 3PDIB 2IPMA 5EJIA 3T61A 4EB8A 5FDFA 2ZCVA 1D6SA 1O6BA 4DWVA 3O31A 1VZ2A 3EF1A 3NHFA 4X6LA 2QXTA 2WFAA 2WYVA 4MA4A 4NRVA 3GP5A 4PXYA 1XXHB 1MA3A 4LCBA 5CYFA 3KP1A 3CEJA 1SCJA 4BTEA 4QECA 2OV1A 1KFKB 3DUFB 2GUGA 2L69A 5IJWA 5HM6A 3ZWQA 2NW6A 5EN4A 3U4AA 4XDZA 4S2UA 2WT4A 1H8HA 1KMMA 3NAZA 3ACCA 3KZXA 4IJ6A 2FGKA 2WAXA 3KV1A 1RWBA 4ADSG 3RREA 4WNAB 2XOEA 3MZ0A 2AHMA 3PDUA 1KVTA 4LI0A 1NF9A 3WLNA 5BW5A 1N5OX 1DXYA 4BZZA 2VI5A 1EFVA 3BXHA 2YOGA 3ZJ5A 2YFHA 3U4DA 1L5HB 1FP7A 4HZUA 1NP3A 1YJ5A 3B1VA 4WERA 4GC5A 4RKQA 1XWFA 4D97A 2WHPA 1LF0A 2I0FA 3HHPA 3GLGB 3V1LA 4ZEWA 4PZ0A 4DIUA 2FSGA 1S8AA 3TEFA 1X1AA 2GFIA 4YCMA 1D4AA 4WKOA 5DGTA 1K3TA 3GC6A 4J1TC 2VIIA 1KS9A 5HKAA 1ZMRA 3DLTA 3HUUA 1SHTX 5I51A 1A76A 1ZEMA 4P0PB 4S35A 3FOFC 4LKRA 4B9EA 1T6ZA 1UC8A 1XZHA 4PG8A 4V0OA 3VOAA 2WKRA 5I7UA 1BVSA 2XTAA 1CX9B 1PEKE 4YJFB 3GNSA 5HOQA 3S55A 3OICA 4MVJA 4M38A 4C4SA 1U9JA 3ADCA 2P40A 1CY1A 3VPAA 3RVQA 4WKCA 3NVAA 2GM4A 4ESOA 5JSFA 5C7IO 1AY0A 1G3QA 2GTPA 1QWOA 3W6NA 3U60A 3OOJA 3CXUA 3MD9A 4R3WA 5GKNA 4JJ4A 3ZWMA 3PNMA 2XT9A 3HDYA 1LPBB 1QO0D 4ZTZB 3FYSA 4FGSA 3OY7A 4UU7A 2W6QA 4ZAGA 3RC2A 4FR2A 2VS1A 5D3MA 4W6QA 3S44A 2H4XA 2JVIA 1L8QA 5BN3B 1MEJA 4FWHA 1YFZA 3WLPA 4INJA 4MWSA 3KL2A 1ZJ4A 3CX4A 2JY8A 4EP1A 2Z3WA 2O7QA 1G20B 3G79A 1YE3A 2HZ7A 3U7IA 3F7OA 2QPTA 4AIRA 3PXGA 3NTVA 4WNCA 2V4ZA 3VTZA 1W47A 1HXHA 4QQ8A 1QCZA 5CURA 2XV1A 1YH3A 2GF0A 4F9EA 3AXSA 4PAOA 5JFOA 3E4DA 1HTTA 4JEIA 3MWFA 5AI5A 4FN4A 4M0DA 5AVRA 1CZUA 3AVUA 2MYPA 1XRRA 1TA0A 4XFKA 1O54A 4YX9A 1WMEA 4RF0A 4IIHA 1U1IA 5IJAA 4BASA 4I8DA 1PD1A 1XA3A 5FJIA 2WU4A 1PJCA 1FQWA 3MTGA 5KS2A 1E98A 3EA5A 1P4HA 2X4AA 5CD9A 4EY5A 2CXTA 3OETA 1WCIA 3W5UA 1GJTA 3E9NA 1QGOA 1WNTA 1Z4OA 3NDJA 4MV8A 2HCTA 4FHGA 3HB1A 4UCFA 2JCGA 3TZKA 2BBOA 2R5FA 3WBKA 3OUTA 1PZGA 1D6NA 2WD7A 4M88A 1MTZA 3K92A 1ZESA 1GGVA 2KBEA 3FYUA 4HQLA 3GLVA 3O84A 3QG5A 2OTCA 1O97D 3DOFA 4UXIA 3QYBA 4R2LA 3HDGA 2OVFA 3K0FA 2HV8A 3FMOB 3SMPA 5A71A 2HCJB 4OQXA 5D01A 4EFLA 1GTZA 3OPMA 4YCBA 4L6AA 4AAYA 4I2VA 3EA4A 4FWTA 1YQQA 1OT3A 1W6RA 5A04A 2F8TA 1U3TA 1O58A 1Q0UA 1E3QA 3PFNA 4B6SA 2C4WA 3P96A 4Z9BA 3IESA 3DUWA 3TTTA 5L8VA 3H4IA 4K6OA 1AOXA 2BHNA 2ZRFA 4NBRA 4BMVA 4V0KA 4WOKA 3D2BA 1G59A 1FLNA 4X65M 2ZUFA 2A1UA 3ADKA 1J39A 4NARA 4QVKA 1JIJA 5JCJA 3KXDA 4UTZA 3QUSA 3J81S 1YJCA 5TGDA 4MB0A 3EARA 2JASA 3FHTA 2BFCB 2IQIA 4GGOA 4JKOA 4CODB 3AHDA 1PEAA 1SUDA 2H9YA 3FCCA 1USUA 4B35A 5JD5A 1HSOA 1ZZEA 2CC2A 3WJ7A 4LJYA 3PQ7A 1R0SA 4INPA 2QVZX 4AN4A 3W90A 4P3NA 4XPIA 5E6RA 4XD7D 4I1SA 2PSDA 3AWDA 1J2TA 3GVHA 3SJBA 5SZHB 4N54A 5ICFA 1E69A 1E0AA 4DCCA 1ZR4A 1JKMA 5HQTA 5C4MA 3C45A 2JVJA 1AHNA 3CMCO 2WJWA 2HQRA 4KDEA 5DNCA 3KPWA 4NPAA 3VNAA 3VKHA 2DPXA 2WV9A 1O2DA 4ZGWA 2IHUA 1L4UA 1R18A 3EXHB 3P9CA 2DVMA 1KYVA 1QGZA 1BW9A 5AXBA 3X44A 4GZMA 4MW5A 2XD9A 2RAPA 3A4YA 4OQFA 1AS2A 1H69A 1WV1A 4U6NA 3DAYA 3G2JA 4KMRA 6LDHA 1TTHA 3DTVD 2VBCA 4JBWA 5E2IA 1W29A 2XFTA 3HCCA 1VE3A 5T7BA 5JLJA 1C9DB 4R69A 2ZRPA 4XKJA 3M6WA 1ZC4A 4EW6A 1AA9A 1QHFA 4RHFA 3U7JA 1C1XB 3IUEA 2AN5A 1CIVA 3E0XA 1X38A 1VPVA 3AV0A 4FOLA 3FJOA 1PGQA 5BNTA 2CFRA 4C04A 5K8CA 4FDUA 1FXSA 1EH5A 4BLOA 1APBA 4IDGA 1NE2A 1IOWA 1YXMA 1S7GA 2PU5A 4LXYA 4BRUA 1WD5A 4L8LA 3LJKA 4P82A 3G0BA 5CBPB 3CIFA 4KIUA 5CLGA 1DVRA 4YK7A 4YY3M 2ALJA 3AM3A 2QX6A 1GGNA 3Q1LA 2G0TA 4QU8A 3C3EA 1NVVQ 1YBMA 3FTEA 1GPH1 3L0SA 1TZJA 5DWVA 3DTNA 4TOIA 2RD2A 1I4WA 2B9VA 3RSZA 1R5LA 2UAGA 4ZJPA 3HG7A 4MW7A 1JTEA 1RIIA 5BPVA 5AW1A 1MB4A 4OF4A 4RABA 3ROTA 3LE8A 3HR8A 3OWHA 2DMRA 4BC0A 2M5ZA 4WX2B 3ZY5A 3U3XA 4CG0A 1LNSA 1Y3DE 2DJ5A 1LA2A 2JLYA 5B4TA 2B3TA 3IAM1 3N2NA 2WIFA 4CTOA 1WABA 4MWGA 5CXXA 5T64A 2GYVA 2E55A 4I4IA 4MUAA 2BSQA 4IFTA 3PDJA 3H4TA 1NUAA 2Y67A 4NTZA 1JVNA 5KQMA 2VQFM 3L18A 3H7IA 4D9IA 1A5TA 1AV6A 4E4YA 3CEMA 1E6KA 4N0EA 2ZJ7A 1I6KA 2HA2A 2PMWB 2PRIA 2X1MA 3KZKA 4U63A 1U4OA 3OTIA 2J3LA 3LP6A 2HKJA 4POAA 1QAMA 2H1LA 1JE0A 2C9CA 1U8CB 2UYCA 1I94M 3PVSA 3AESB 1R0LA 5BSMA 2LVQD 3U3KA 2FRDC 3JXEA 1AQYA 4RD4A 4XJTA 3GFFA 2IYYA 3DKIA 2H5XA 4QTZA 3PZRA 3SOZA 4RD2A 3D7LA 3X3HA 4DIEA 1W9MA 5EPEA 3U4QA 3RGGA 3Q3EA 1SG6A 4M1YA 4HR7A 2WVHA 1V2GA 1AIPA 2C4TA 2JNWA 2XHZA 1PFQA 1YBHA 3DKVA 3FPBA 1M1ZA 2SKDA 2ZI4A 3H8JA 2Y93A 4CF5A 4DCOA 2W2PA 3P9KA 2JJ1D 4Y1GA 1FDIA 5LD2C 2FZCA 3TWLA 2O54A 4RLFA 4V02A 4QGBA 3A3OA 3C5CA 3HBAA 4GYJA 4DQ0A 3ZEIA 4D44A 2R68A 3ROFA 3CPEA 1S2GA 1K92A 4R9VA 3Q2OA 3THWB 1ZIPA 4PONA 2E49A 2P91A 2V8BA 4JI8M 3G6WA 5EJ9A 3K32A 3PCTA 4X1KB 5A7HA 1F14A 4L0DA 3U39A 2CNWA 2DRIA 1YQUA 1JR3D 1RMQA 3ZY4A 3U60B 3VOSA 3VX3A 4AP5A 5A5EA 5LP6B 4OO3A 1J06A 2JFOA 3HRKA 2I8CA 3C9PA 3X1JA 2KB0A 1L1FA 2CXRA 3OH8A 2XMBA 3LUDA 1EDDA 4XWOA 4QREA 4IWXA 1QDEA 3ZGYA 4BKQA 4PAGA 1ZHFA 5KJCA 5KYWB 2O0HA 4UVEA 3TZEA 1IXKA 1NUHA 1DV0A 1JF8A 1KZ7B 1Y9JA 3ICVA 1QO9A 4TN5A 1HKHA 2X0RA 3B9QA 3DL7A 3OCXA 3SK0A 4LNUA 2NACA 2O4UX 3UAZA 5IUKC 4RIGA 3DBHB 4LRYA 3E70C 4EF4A 3S2YA 4C6TA 4JUAA 3U3MA 1IK4A 5L4SA 4RGVA 1KZ9A 1JWBB 5E0OA 4BKMA 3ITEA 1SUBA 5ALIA 5J1SB 1YA8A 3U2QA 3CLHA 2QOEA 1QRTA 2IA5A 2WU8A 1ETUA 4MQFA 2FN9A 1PTJC 4TS9A 1AGYA 3K30A 3WOVA 4EPVA 1A4XA 1N3IA 2GFQA 4JZKA 3VSEA 4BGEA 1V8ZA 3H18A 5K3BA 5AXAA 2AOTA 1J8MF 4P53A 3OC6A 1W94A 3G8AA 1J24A 5AD1A 3KQOA 1HDXA 3LNTA 1D2HA 4JC4A 3TSYA 4INOA 3KJNA 1Y63A 3NGLA 5L40A 4NBTA 1LV7A 3K0EA 3GJ3A 3QWHA 1T2DA 4YCCA 5H82A 4KXFB 5FB3A 5DXAA 4NCNA 1N6LA 3UQZA 3Q7PA 4A5OA 2BGNA 3ILVA 2UVPB 4WV3A 4WDRA 4IX9A 5JMPA 1HLPA 1V0JA 1M1YE 4Y6PA 2QGFA 3AVQA 4F2HA 5TS3A 1ZMUA 2IXGA 3SEAA 2QL6A 3NJRA 3VR6D 1WMFA 4JI7B 2D7EA 2QN1A 1I7SB 2ID8A 2GHIA 3WIVA 3NOVA 1E1QD 1LGYA 1CS4C 2XAUA 3K4QA 4NX2A 2UZAA 6PFKA 3N2GB 3RJ9A 3QY0A 3O1JC 1DAEA 2HDOA 5C8VA 2H07A 4REZA 3KOWE 4S1OA 4OMDA 3IOMA 4Q3DA 3EAQA 1XTSA 4A2QA 1R8YA 3W7AA 1SPBS 3VUEA 4ZA2A 4AZWA 2QAGA 1GXSB 5EUCA 4CMEA 2BGTA 2G07A 1KMNA 2Q6LA 1DL5A 1H2BA 3RS0A 2I6TA 2QP9X 4PEVA 4N39A 1IMOA 2YZNA 2XUOA 4RGBA 2W2XA 3L6UA 4NG5A 3K2EA 2JGNA 2ET6A 2D8MA 3U7QA 3WRWA 3KP1E 2H6EA 1ZNXA 2D2FA 3ILXA 2ZYSA 1THTA 4FNMA 4ER6A 5AI8A 2VUTA 1Z7EA 2A9QA 2OCKA 4RCYA 2C9BA 2VHYA 2PUEA 2QY6A 3I0ZA 1U6KA 1GKIA 4MJLA 3TLMA 4PRZA 3REGA 3G02A 2JLAA 3U9LA 4ZRMA 4HTFB 4S04A 3IDZA 1NSTA 2XUQA 1L7QA 1V5EA 4AUNA 4MRNA 1PDWA 1YAHA 4AZTA 3I4YA 2EV9A 1HDRA 3GRPA 2R00C 2DZNB 3ETEA 1T5OA 2QRGA 6GPBA 3DOJA 1POXA 3KIPA 1PYGA 1NPTO 1YULA 4WOCA 4G5HA 4Y2TA 1K06A 4C2AA 4IIJA 4BNXA 4G65A 4Z2YA 4KQXA 2HI0A 2PDAA 3HHWA 3AT1A 3UN1A 3D2AA 4FFMA 4FT4A 2L6OA 5AK3A 2FFHA 2R8PA 4KFTA 3EEFA 2YCLA 3LVBA 4AZSA 3S4YA 2HADA 3O8NA 3ZDZB 4ARAA 3D64A 2D74A 1F48A 1ODTC 2J7NA 4I55B 2OWDA 2K2QB 5JFTA 2XA9A 4YASA 2W90A 1U8UA 4XM1A 3VTAA 3LGAA 3V7UA 3R9KA 2XY4A 5MGBA 1SRRA 2WVAA 3LH5A 1AXGA 3LCVB 5JAHA 3B7PA 4CQMD 5ITYA 1HNZM 8OHMA 1LS6A 2UXDM 2B20A 3FFXA 3MA0A 5EXXA 2GEFA 1LRJA 5AKGA 2DTEA 3GLIB 4MTCA 2OD9A 3ORHA 4R2XA 4B3FX 2Q0HA 1PW7A 1U94A 1DKOA 1CUHA 3FKQA 4DN6A 1PLLA 4OXIA 4GLJA 3LZDA 3CC8A 2ATXA 5F3WA 2RCNA 4TKUB 1YUNA 4NONA 2D0DA 2NO9A 3WK7A 5C51B 3H1FA 3NTOA 2BCGY 2V6JA 4UHDA 3D6TB 1EX1A 4M37A 4MKZA 4F2LA 3TW0A 5KPTA 4Q3KA 3AR5A 2OHVA 3T7DA 1BDJA 2DUNA 2VDWB 5K7SA 3P4YA 3AUFA 2ZB8A 2WUWE 1YRAA 3HXKA 3X2EA 1K86A 4UZSA 1OIZA 4XYEA 3KQSA 3WL6A 4GP7A 4XGRA 2VR1A 1UMCB 3I72A 1VLVA 3WK5A 4ZYWA 1HL3A 3E84A 5AKIA 4YGXB 4YDRA 1U2QA 4MGKR 2W58A 8ATCA 2XNDD 3UW1A 3ELWA 2P9BA 1U5AA 3IEIA 3I8XA 2XBMA 3QSGA 1L7VC 5B57C 3K1JA 3DWIA 4C3ZA 4IFEA 3R8FA 3OMXA 2W2LD 3FW1A 4NE7A 3I2GA 3V42A 5AVXA 4C6HA 4BQPA 3M6VA 1GGKA 3HDHA 4ZXFA 1IOVA 2J9FB 5KJFA 3O38A 1KYQA 4NBUA 2K9DA 4BVHA 3EGDA 1AK1A 4E4RA 4JKYA 4JBIA 1VE6A 1GVNA 2D6FA 3DO5A 1DZ3A 4HZGA 1X8LA 3AJAA 3OJEA 1OOEA 1DXOA 3PX2A 4MNTA 4WLFA 3D5EA 2D1YA 4TROA 2G1PA 3EH2A 3IYLW 4J7AA 4QYWA 1USVA 4R1PA 1TQ6A 3JCZA 5DFAA 3KSBC 1VLQA 2G17A 3JQBA 1JXMA 4OQLA 4P33A 5HF9A 1N6IA 2HJRA 3HVUA 3SMQA 1DBRA 4XGQA 1SIUA 2CVOA 4UASA 1L3BA 1KA9H 3DZDA 2BP7B 4UC0A 4OHUA 1GQSA 1ZFNA 3P2YA 1QHEA 4I0WB 4Q9IA 4DV5B 4NBWA 3X43A 3H0KA 3IULA 4E31A 1QZMA 4MR9A 5TMPA 2CUZA 3BTVA 2I9PA 1E3WA 3L4JA 1MW8X 1NNEA 3QOWA 2GKGA 2NZUG 1GUBA 2SICE 1WSWA 4EUSA 1W48A 1OZ0A 1MJGM 3WYDA 3L0OA 4RESA 2G08A 1FMLA 4L51A 2C2WA 2NO5A 3ZD9A 4IMRA 1E3DA 5E4YA 2PJRA 4ZRNA 2AT1A 3B3GA 3MIIA 4YR9A 3EYAA 3C6QA 4R0VA 4I19A 3LWBA 2G7MC 2YUTA 5K20A 3V3TA 1YJBA 1YS2X 1JSRA 3H5VA 1GGHA 4KO4S 2IVZA 4MR8B 4PQEA 4H0NA 5FWAA 3WMRA 4ZTUB 5JCOA 4YMVA 4GMFA 2A0UA 3V2HA 3DV0A 4EZIA 3DZBA 1RKXA 5A3JA 2BBWA 2BT4A 4AY6A 4H3VA 2IOHA 4AFNA 4HDKB 2I1WA 5HE9A 2IS1A 4YWHA 1GAXA 1UPBA 2ORYA 2V65A 4O2BA 3DWFA 5DSXA 1P45A 1X7ZB 3QWAA 4DMLA 3YASA 2J1LA 1N33B 2A5FA 5ALGA 3AVVA 1QGAA 1L7EA 1WRBA 1SZPA 2HWJA 2BHLA 4XX0A 4IJKA 5JXGA 3IUPA 5K5EA 3S5JA 3RVDA 1QGUB 3IBSA 1TMGE 1W96A 4ROSA 4D9EA 4JOSA 2C8KA 2QD2A 4MR7B 3FIJA 2H0QA 4J9UE 3RK1A 4P2BA 4PLWA 3ENWA 4CEJA 1R0RE 5TNXA 2ZREA 5MF6A 4QE3A 3SAWA 4EHFA 1C7RA 3GX1A 3PICA 2FNAA 1E92A 3LCJA 4C4ZA 1V3VA 3JYQA 4J0HA 3ZNQA 1RWWA 2VAVA 4BVLA 1O5IA 4JB0A 4L9WA 3LWDA 3G8CA 2NADA 3AHHA 2PZAA 5EL0A 3WLAA 4D5GA 1YNSA 4W1SA 1B7GO 2ZSEA 1G5RA 1Z0AA 4LJ6A 1KAEA 1H1DA 3ZIAA 1FS5A 1TAHA 4Q1VA 3AETB 4IBFA 4II7A 1X9IA 2GCOB 3DS8A 4ZOLF 2C5AA 1H1TA 4DRXA 3TTUA 4EKDA 4LVNA 3GI1A 1RD4A 1KAHA 2CHGA 1TT7A 1ZYUA 1XNHA 4LF4B 4OGFA 1THMA 3R7NA 4F6RB 4LRSB 3EEYA 4RKFA 1WETA 2C61A 1YRBA 4NMHA 4AQ7A 3CVJA 1ENPA 3F3KA 4KN6A 1JHRA 3GDHA 4DV6M 2C3UA 4XPZA 4K9LA 3PUKA 4ILKA 2UUAB 3RYFA 2XWPA 1JDTA 3JD1A 1PR2A 5F7OA 3NEYA 2ZYRA 1QC5B 5A4FS 2VYCA 4LJ7A 4YV1A 2EZ8A 4DC9A 4EA8A 2V5UA 4GECA 2ATEA 5BYJA 1U7WA 2EG9A 2GK7A 4JYZA 2CE2X 2DQZA 1Q7CA 1OWMA 3EIHA 4F04A 2JCVA 4CKBA 2WHXA 5ENZA 1C0EA 2H0AA 4BJHB 4HGRA 4UEJA 1YU9A 5ELMA 2AZTA 3WL7A 1HYBA 4ABYA 4FDAA 3OFND 2XGGA 1QYCA 1XI2A 4DLTA 4K05A 1CUWA 5IDQA 3N86A 2VHCA 2PTGA 4Q21A 2AZDA 2MSDB 4NQRA 3D6HA 1L4NA 5D7NA 2I2BA 5FP0A 1K98A 4G1BA 2ZYVX 5ALRA 2IWHA 2NQTA 5DLYA 3GT7A 3DCNA 3AHJA 1RPTA 1Y7LA 3FWPA 4NMLA 3DOEA 3B2EA 3KFUG 2H1WA 4H1TA 4EF5A 1PQUA 2IPXA 3GEBA 1ZKMA 3DGFC 4Z0HO 4PLVA 5FXMA 2XTMA 3T1YM 1TJ4A 4RO0A 4I4TF 2O1SA 1HI9A 1MO6A 1J70A 1DQYA 4L7QA 3NFRA 4FCCA 2XODA 2CUKA 3MQFA 3WXMA 3OPNA 4DY4A 2OXRA 4TUYA 2QYHA 1CWUA 1O97C 4PYJA 2H4WA 4JBNA 1LNZA 1PI3A 3GJQA 4PY2A 1KHTA 3ESDA 4TWZA 3FNGA 1T8PA 1H5QA 1P72A 1AQJA 3KB1A 5B53A 1V5FA 3G0OA 1RRKA 4AECA 4B6RA 3WBJA 1DBWA 4HP8A 1LBSA 1M67A 3G2IA 4OYRA 1E7QA 4QU9A 1G7TA 1R3UA 3O4VA 5K45A 4MUBA 5LJLA 1J2UA 2P3OA 2CVZA 4JEUA 2Z58A 2HK9A 4HT3B 2H54A 5ERGB 2EDAA 4LNHA 4D0RA 2D5IA 1LJ8A 3KSUA 2IEIA 1IHDA 1Z0ZA 5JNRA 1B8NA 2IF2A 2E9SA 2XKKA 1CQIB 4B4OA 3WL8A 2CDNA 2JLZA 1SVIA 3ELYA 1R4AA 3W3AA 2Z7JA 4OGLA 3NHMA 4J0EA 2G0NA 3IELA 1ZAYA 4O4HB 4L78A 4NOMA 1Q5PA 5TF4A 1YRWA 2PEZA 2AC4A 4V0LA 3JWJA 4B1FA 1M2HA 3FPJA 3WAKA 2IODA 2IKQA 4E08A 2RI1A 3B7GA 4QO8A 3UV3A 2MOKA 3T4XA 5K0LA 3SBDA 4PZ9A 4ZO9A 2KHHA 3E0QA 4GPIB 4GXNA 2GTIA 3FSJX 5D2CA 2G88A 5AWFC 3QX7A 5EZYA 3N28A 2I71A 2BKXA 4UBIA 3TQQA 1J22A 4K6CA 2FPGB 1ADYA 1A8PA 1GVNB 2WQ7A 4ENWA 1G1MA 2Z9DA 4E5PA 4JY7A 5KNBA 4DJFC 2O59A 1BWRA 2W82A 5FLKA 3FFTA 3CWQA 5EA2A 5EWMB 4FNAA 4H35A 4N5NA 4R1NA 2WF5A 2JLWA 4CI9A 1CZKA 1WO8A 1XVUA 1FIUA 3EDRA 4WK4B 3PUHA 5FTNA 3ZX4A 5THXA 4O8CA 3QJGA 2VTDA 1MJGA 2CYAA 4F6LA 3FF1A 3E8SA 3T12A 4S1WA 4JGGA 4GQAA 3RUAA 1VHJA 4MPDA 1W36D 1SKBA 5I4CA 1DIRA 1Y6FA 1FFHA 3WY9A 1CJSA 2JFYA 2C8VA 2ZS7A 1XKTA 3QYFA 1LDEA 4XSHA 1Y8ZA 5JI2E 3Q6MA 1P31A 1PDOA 4D6XA 2ZIWB 2I7TA 3OSUA 3IBGA 2IYTA 4RH3A 3W5HA 1LJUA 2HMSA 1J0EA 4QTTB 3OF2A 4PINA 2EGUA 4MAFA 4TS4A 4MVJG 3E1KA 3IAS1 5TX7A 4ARBA 1G5HA 2B1RA 3L46A 1COWD 4XYGA 3VU9B 3FJYA 4I14A 1E1MA 2YVUA 1WY7A 1SCIA 3NJ8A 1IZ9A 3UC9A 3LTNC 3D0QA 4D4JA 4YV7A 4JCOA 5KTSA 2YZGA 3W9BA 3WYBA 2OBFA 3F6CA 4O2LA 3CUKA 5SZIA 4ZYVA 1DC3A 2QKYA 4G0UA 1R15A 3E03A 2CDCA 1SC6A 3EUAA 4C4RA 1SQ0A 4UMVA 3P2JA 5HVNA 1X19A 1EVLA 3N8HA 1RR6A 2XYPA 1CJBA 5E3HA 3RYCB 3I42A 1BX1A 3UMCA 5TGTA 3EC1A 3PTZA 5J2TF 3HKEB 1SUIA 5U1PA 1JMKC 5HFNA 2XUPA 2NU9B 1LZKA 4X64B 2IOFA 3GPYA 2QGZA 1ABFA 4LDAA 4KE7A 5GVSA 3DAOA 4AJJA 1U3DA 2B8WA 4Q16A 1WDTA 2FUG1 3JARB 4L5BA 4ARSA 3HCOA 2DB3A 1UJCA 3AYZB 3N8NA 1KS2A 4EG0A 3ESZA 2Z57A 4O4IA 1NI3A 5IYZA 2DFNA 4NENA 2D7CA 1NMSA 4L15A 3EVTA 4H7HA 4YLGA 4B6JA 3DB1A 1LLFA 5JDCC 2EKQA 2J08A 4QXOA 4JB8A 4F45A 2PT5A 5A2GA 3D8NA 3MM4A 2BEUB 4R1QA 1EFUB 1DELA 4GPTA 1JKXA 3IB3A 1E1YA 3I62A 3RVLA 1DG9A 2Q7OE 4S0XA 2H1SA 4QOZC 1P1IA 4MQUA 3L2OB 2RC5A 1JPVA 5J3JA 4KFCA 3DZKA 3UMGA 4QM6A 4U2DA 3BWMA 5BSEA 1XCGB 3KD2A 4OKSA 3TAUA 3M34A 1XAGA 4HUQA 5E6SA 3ILSA 5JAZA 3SEZA 1OAKA 4I6JA 1Z15A 2H4YA 4QDUA 4G81A 2P9YA 3FGOA 4PLTA 4R68A 1KP2A 2I4LA 4Q7JA 4OHOA 4L9SA 5G1OA 2QF7A 1TMYA 3HM2A 2J3KA 2VXYA 4BGDA 1J2RA 1QK5A 3GVPA 1B8VA 2C96A 3KYIB 4Y9UA 4JSTA 2P5TB 3T1QA 3G7UA 3DONA 4Z4GA 3H0EA 3A36A 3BG5A 2Q4TA 4QA9A 3BOSA 1X1TA 3DVSX 2CLOB 3U6LA 3FDIA 3D8RA 5EP2A 3OQIB 1F5NA 5FUBA 1Z22A 3ZI4A 4QYTA 1R7RA 3ZJTA 2NZYA 1GPDG 2YXNA 1OXBB 1P1HA 5E1MA 5F7XA 3VZQA 2J5BA 2YS7A 1K68A 2CJYA 3SZUA 3MHVC 1ZSNA 2GRAA 4B48A 2J4DA 4F3RA 1Y82A 3I01M 4JWTA 5GMOA 1PWZA 2ZZNA 1A96A 1KFBB 1XNJA 1FFGA 1FF9A 2DU8A 3ST7A 2J5YA