3GRUA

Crystal structure of the complex between amp and methanocaldococcus jannaschi dim1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gruA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gruA01
2BM9A 1SQGA 3H2BA 2Z6UA 1VLMA 1QAMA 5K0CA 3ME5A 1XVAA 3CCFA 4MHTA 1U2ZA 4E32A 1KXZA 3KPVA 4PCLA 2I7CA 3THRA 4QDJA 3TR6A 3VC1A 1ZQ9A 3LPMA 1RJFA 4Z2YA 1AV6A 5DM2A 1XCJA 2OZVA 3KQSA 2AN5A 3NDJA 4PWYA 3MTIA 2CWWA 3P71T 4AZTA 2BM8A 2PX8A 3GIWA 3S68A 1VP9A 1DUSA 1VPTA 3R3HA 1EJ0A 2GS9A 4PIMA 2IH2A 1XDUA 3RIEA 1EG2A 4DF3A 5DTMA 2PWYA 4YUXA 4PYMA 3O4FA 3LECA 1KPGA 3EVFA 2IH5A 1V39A 1FP2A 1PRYA 2PVCA 2PXXA 3M4XA 5G02A 3QOWA 5K0NA 4C07A 4YV2A 4Y2HA 5E1DA 3MTEA 2AOXA 4FR0A 5LQCA 1AQJA 3ID6C 4EVIA 2FHPA 3FUVA 1IY9A 2ZIGA 4DZRA 1G55A 4XUDA 2ZFUA 3DOUA 3BKWA 1VP3A 1RI3A 3LCUA 1RI2A 3B3FA 4OBXA 1L9KA 1JQEA 4BP3A 2HV9A 2BR5A 2ZSUA 5DXAA 4HG2A 5EOVA 3TKAA 2R6ZA 2AOTB 2HNKA 5EMLA 2O57A 3B89A 2HWKA 5D1HA 5ICGA 3LKZA 5MHTA 3A7DA 3K0BA 4PYIA 4LECA 4PYQA 3FYCA 1G38A 1VIDA 4B17A 4RTLA 4DA4A 2JHPA 1O9HA 3AJDA 5DTQA 3A7EA 3OZSA 3LX6A 5GM1A 1RJGA 4FT4A 1ZKDA 3ANXA 3P2KA 4RVGA 4PONA 5E9WA 3GJYA 1P1CA 5HIKA 3ER8A 5EKXA 2WA1A 3Q7EA 2AVNA 2PX2A 4ER5A 4GOND 3BGDA 2ZZMA 3ELUA 5FUBA 1R8XA 4XUEA 1P1BA 2ZBRA 3G2QA 3HCEA 5C9ZA 3A26A 2AN3A 3G2PA 2C7QA 3K6RA 3LCVB 5FA8A 1G6Q1 2PT6A 3DMGA 5GWXA 3FUTA 2BR3A 2Z6QA 2Z6AA 4KW7A 1X1BA 2G1PA 3LKDA 4QDKA 4QPNA 3T0IA 4GOLD 2ZIFA 4DM3A 3LBFA 1JG2A 2OYRA 4A6EA 1L3CA 3DXXA 3OU2A 1Q0TA 2OO3A 3FTCA 5T6BA 5CM2Z 1WS6A 3M33A 3UZUA 5EC8A 3GDHA 2IDJA 2E5WA 5DLYA 2YXDA 4F86A 1JSXA 2JH9A 2DPMA 2V7EA 4HGYA 3NDIA 3HP7A 2XBMA 5EEHA 2ZCJA 3ORHA 5KYGA 3DH0A 3UJ9A 3SVZA 2FK8A 2PSSA 1D2CA 1UIRA 1YUBA 3M70A 2YUIA 3C6KA 4PYLA 5K0BA 4CKEA 1EAMA 4OQDA 3P97A 3JWHA 4FP9A 2DULA 3KR0A 5E8RA 1WY7A 1WZNA 3A27A 5EVJA 4C4AA 3IV6A 4RTNA 3G88A 3UJBA 5E1BA 4YUZA 1JR4A 2EFJA 2ORED 5F2NA 2I62A 2EJUA 2PLWA 5GP1A 2OB2A 3MCTA 4CKBA 3C0KA 2IPXA 3DLIA 3THSA 3IYLW 4RVFA 3FPEA 5HIIA 3UJ6A 3UFBA 2CL5A 4RYLA 3IHTA 3C3YA 3VYWA 3GRYA 2GLUA 3GWZA 1NKVA 4ER7A 1EIZA 4KDRA 3HA3A 2QE6A 1O9GA 5FHRA 3PFGA 3R24A 3BT7A 3GGDA 5DM4A 3L8DA 2ZBQA 4FZVA 3NWEA 1VQ1A 5FWDA 5F2OA 2B25A 4C04A 3KPWA 4PYOA 5C1IA 4QQNA 3OCJA 3UJDA 1I4WA 3V97A 1QYRA 5CVEA 3NVKI 3CJTA 4V0RA 5EMKA 4FS8A 4KVZA 2I9KA 1H1DA 5K0FA 4GBED 5H02A 4RTOA 1YFLA 3ELYA 1L1EA 3NJRA 3NTVA 1KPIA 4E33A 3SX0A 4RTKA 2HR1A 3JWIA 2VP3A 3G89A 3KR2A 5DM0A 4YUVA 4AZVA 2O06A 3EEOA 4PNEA 3KQOA 5DPMA 5DXJA 2NNWB 5K8VA 3KKZA 3SSOA 1X1DA 3PX2A 1QANA 3I9FA 3DULA 3DUWA 3HVHA 4FSDA 2ADMA 3LCCA 4K6MA 4P58A 1TW3A 2P40A 4OA8A 4EK9A 3I5UA 3JWGA 5DRTA 2OPBA 4F84A 3FTDA 4U7TB 3TPZA 3AY0A 5E1OA 2G70A 3KPUA 5LSAA 5LQKA 4RVDA 3PLAE 4PGHA 1BKYA 2P1DA 3HVJA 1VBFA 4E30A 5HFJA 2QM3A 5DX8A 3TMAA 5K0GA 4RTQA 4RWZA 3EVZA 5FQOA 3B3GA 3HTXA 3E23A 3M6UA 5EKUA 3G8BA 2PGXA 4RV9A 5LQNA 1RI1A 4HTFB 4KIFA 4P7JA 3HA5A 2XVMA 1P91A 1BC5A 3HEMA 4HSGA 2PKWA 1WG8A 3HA7A 4M38A 4E2ZA 1M0EA 3AXTA 2QRVA 3HCCA 2OY0A 4QTTB 5ICEA 1R18A 2AOUB 3ELWA 5CUQA 5BP7A 1BHJA 1TPYA 3KQMA 1N7IA 5HZMA 3FYDA 5LQUA 5EG5A 4KIGA 2BZGA 3LBYA 4PYKA 3DXZA 3MAGA 1PJZA 1ORIA 3B3JA 5GIOE 5CD1A 3SM3A 4CKCA 3HCDA 5JR3A 5FULA 4FSXA 4X1OA 1ZHFA 4GOMD 5ERGB 3C3PA 2P3QA 1DCTA 4H0NA 1JG1A 3TOSA 3KQTA 3M6WA 1KYWA 1M6EX 1FJXA 2R3SA 4RTRA 1R8YA 2O0LA 1NW3A 1R6AA 2QYOA 2OKCA 5KQRA 3BZBA 4E2XA 5K0EA 1WXXA 2UYHA 4BP1A 1D2HA 3E8SA 3I58A 4LG1A 5HIMA 3GRUA 3KPJA 1XJ5A 1INLA 4BLVA 4E2WA 3RODA 2AOWA 5EZQA 5HIJA 5EMJA 4YV1A 5K03A 2UZ4A 1QAQA 3G8AA 1IM8A 5IH3A 4IV0A 2ZVJA 4P7GA 5K05A 1RI5A 5DT2A 3M6VA 3NVMB 4AZWA 2OBFA 5E2AA 2P35A 2JJQA 3UA3A 4HH4A 1SKMA 1NV9A 2GAFA 2P8JA 3G2OA 2VS1A 3KR1A 5FTWA 2C7OA 3RW9A 5CCBA 1AQIA 1Y8CA 2PX5A 1T43A 3FPHA 4JXJA 4IV8A 3EMDA 4P7KA 2ZWVA 2FRXA 3BWYA 3OFKA 4M7RA 3QOXA 5EHGA 5FWAA 2O05A 5U4XA 2BR4A 2H1RA 4R8RA 4F85A 3LDFA 5FADA 5KVAA 2CKDA 3X0DA 3GU3A 2B78A 3UA4A 1B42A 2ZZKA 5HOQA 2ZULA 3P8ZA 4V0QA 4R05A 1ZGJA 4DCGA 4C08A 3G5LA 1BOOA 3LL7A 1R00A 3P2EA 5CVVA 5K0LA 3VC2A 2AOVA 2A14A 3MGGA 2IIPA 3EVEA 4U7PB 2ESRA 4CTJA 1R74A 4MQ4A 3BWMA 3HCBA 2IFTA 3EVGA 5LR6A 2ZBPA 2B9EA 2YVLA 2HTEA 3BGVA 4CWAA 4IWNA 5B1SA 4GC9A 1EJ6A 2PXCA 3FUXA 2ZWAA 3CVOA 3KU1A 3BKXA 5E8JA 4AZSA 5K01A 2P41A 1QZZA 3PB3A 4DKJA 4X60A 2XYQA 2I6GA 4GUAA 5EQJB 1RJEA 1RJDA 3OU7A 4GQBA 3T7TA 5CIYA 1YB2A 2XVAA 3UJAA 4RTPA 2VZ9A 4RTSA 3P9KA 5HEKA 2G8NA 4Y30A 5FA5A 1FPQA 2AOTA 1IXKA 2EG5A 3MQ2A 4FGZA 4QTUB 5T64A 2VDWA 2CMHA 2PX4A 4RX1A 5FQNA 3ER9A 4CXMA 2JG3A 5CVDA 4G56A 3EGIA 2IH4A 5BXYA 1SUIA 2P7IA 5E9QA 3REOA 5E9JA 5KQSA 3HCAA 2UYCA 2PXAA 1JTFA 2PY6A 5GM2A 1VL5A 3SSMA 4RTMA 3EVDA 3CJQA 9MHTA 5EEGA 5ICFA 5EHIA 3TM5A 10MHA 2OXTA 2UYOA 3O7WA 1QAOA 2VDUE 1MJFA 1NW5A 2AOUA 3UJCA 5ICCA 3T7RA 3CBGA 4DMGA 3NMUF 4X63A 1Z3CA 3OE4A 3LDUA 2PT9A 3LGAA 1JQDA 3R0QA 3BXOA 5CVJA 2P3LA 4BLWA 2ZZNA 5GOZA 1NE2A 3KHKA 3SR4A 4KWCA 4YMHA 2NP6A 3NW9A 2UYQA 4HRAA 5DTRA 3U81A 4O29A 2AZTA 3G2MA 3WSTA 4QVKA 2IBSA 5GINE 3I64A 3DLCA 5DSXA 4E70A 4EQZA 2BH2A 2EJTA 2ZIEA 1D2GA 1N7JA 4MTLA 2P3OA 1XCLA 2IDKA 3TKYA 2KW5A 3P9NA 1X19A 3EVCA 1NW7A 1OR8A 3F4KA 4POOA 2FPOA 3R9XB 5JUWA 2GPYA 1YFJA 2VDVE 4XUCA 1G60A 4ER0A 2ERCA 3KQPA 4HC4A 2B2CA 2GA9A 3P9CA 1G8SA 3BGIA 4EMSA 1YZ3A 3GRVA 1NV8A 3EGEA 3EVBA 5LQRA 4BY9E 3KQVA 1G8AA 3TFWA 1NBHA 2JHCA 4E31A 2AR0A 2NP7A 2AVDA 3EEYA 4X41A 1HMYA 5F2KA 1ZG3A 1KHHA 4MWZA 3FRHA 3TRKA 3GXOA 1ZGAA 1UWVA 1I1NA 2GH1A 3AWIA 3EVAA 1DL5A 3E05A 3OZTA 1JG4A 3TM4A 3KQQA 3EPPA 4ER3A 1KPHA 3KQYA 4YMGA 2XYVA 3FTFA 3E7PA 3GRRA 5DSTA 5GIPE 5IKMA 3FTEA 1VE3A 3CC8A 3SSNA 3OE5A 3A4TA 4M37A 4NECA 2H00A 2IBTA 4RVHA 1L3IA 3T7SA 2NXNA 1HNNA 2LD4A 1SQFA 3EGVA 3PVCA 2EX4A 3IEIA 2G72A 3MB5A 3LSTA 1X1AA 3QV2A 4C05A 2C7RA 1EQAA 4ISCA 2Y1WA 3TQSA 1KR5A 2YX1A 2ZW9A 2QRVB 4WVLA 4OA5A 3VSEA 4C06A 1SUSA 3MHTA 3MCZA 2IP2A 2B3TA 1XDSA 2PV0A 1UFKA 4YV0A 1Q0SA 1P39A 5HILA 1ORHA 1RI4A 2IGTA 5EIFA 3DR5A 4ZTBA 4AUKA 4P7FA 2WK1A 5DX1A 2Y1XA 3SXJA 3DXYA 4KDCA 1M6YA 3DTNA 5EGSA 4R6WA 3UJ8A 2GB4A 3B5IA 2HMYB 5EZSA 7MHTA 1XDZA 4M36A 4R8SA 4AX8A 2K4MA 2AS0A 3PS9A 1NBIA 5LQJA 3LDGA 3G7UA 1FP1D 1KP9A 4QVGA 5BW5A 2OB1A 4R6XA 3UWPA 5DX0A 4DCMA 1YZHA 3G5TA 1NW8A 2P7HA 4QPPA 5DM1A 5LQAA 4OX9Y 2FYTA 3PTAA 1KYZA 2H11A 3HVIA 3Q87B 1O54A 2ZLBA 2JH8A 3FPFA 3HM2A 3KQWA 1WXWA 4EKIA 4PIPA 4DQ0A 5FHQA 2Q41A 4HTFA 3OPNA 2NXEA 3BUSA 4GOOD 2JHAA 3CKKA 3SMQA 8MHTA 3LHDA 3FPGA 2NYUA 3OU6A 3FRIA 1NT2A 4E2YA 1SG9A 3JWJA 4BLUA 5FCDA 5KS2A 1JG3A 3A25A 3SGLA 4YUWA 5BW4A 4OBWA 1N2XA 3KR9A 2FK7A 1AF7A 1JQ3A 5DRYA 3M6XA 4RSRA 2N47A 4PINA 1KIAA 4L7VA 2ONZA 1TW2A 4PGGA 2O07A 3D2LA 3DMFA 5EPEA 1XXLA 5K09A 1XTPA 4UOEA 2YXLA 1FBNA 3FZGA 5P8WA 1JSZA 3TLJA 3HVKA 4A6DA 1JTEA 3GO4A 2QY6A 2PJDA 2NXCA 3EMBA 3PFHA 3P9IA 2FCAA 4CTKA 2PWPA 5EIWA 1I9GA 2C7PA 4IKPA 3PX3A 4ER6A 1F3LA 3P2IA 5DWQA 2WA2A 3GRZA 5K0JA 4OQEA 5CVUA 2YXEA 2F8LA 4EKGA 2V74B 5T67A 1NW6A 4QQKA 2XYRA 4GF5A 4RTJA 4GC5A 1F38A 3UBTA 2ZTHA 4GEKA 5M5BA 3DMHA 3BWCA 3OFJA 2PBFA 3FPJA 3C6MA 4FT2A 3GCZA 5E2BA 4PYJA 2NXJA 3UJ7A 4C03A 5CCXA 2ONYA 3ELDA 3CGGA 3KPYA 5E1MA 3NWBA 3OZRA 4WXHA 1YF3A 3FUUA 2YQZA 3MERA 4PCAA 4ATNA 3BWBA 4LWOA 2YR0A 3AXSA 2AN4A 1X1CA 3O31A 4KRGA 3HCFA 3HNRA 1L3BA 2YTZA 3R6TA 5D1NA 4LWPA 4YUYA 2G71A 1SVUA 3PT9A 4PYNA 3ERCA 3V8VA 3GNLA 1MHTA 3FUWA 4MIKA 4HGZA 5EMMA 5C0OE 3B7PA 3I53A 3CJRA 4X61A 3DP7A 4XCXA 2CMGA
chains in the Genus database with same CATH superfamily
4DV3M 1SHLA 3ESRA 5DHFA 1FRZA 2NX2A 1L8XA 3H2BA 3I04A 4EG3A 3HKCB 3VJRA 2DSTA 1QGED 3OCVA 1YIAA 3FOWA 5JROA 1BW9B 3QVTA 2P2NA 1HT3A 1NSFA 1RXEA 4YRDA 5LBIA 3FHJA 1U94A 3OIYA 1FIUA 1VG5A 4FBMA 4ETMA 2P6PA 3JYQA 2GLXA 3EDQA 3W8RA 1ZJ4A 3BH0A 2H48A 3D0KA 4YP1A 5A3VA 3NCTA 3GIWA 1CNFA 2IQ5A 4F7WA 1RYBA 4YMSA 1MNQA 5B1DA 4JR0A 1IOVA 1XD9A 2VYVD 2VK8A 1KPGA 4BQFA 1IYZA 1OE0A 3ZJVA 3GNSA 1CB7A 1PRYA 5LZ9A 2VT6A 1N6RA 1K9SA 2QPTA 4KMRA 4AS2A 1CUBA 121PA 3AFHA 1N2HA 2PNFA 2O2YA 3F5MA 1G3UA 2MROB 3AFNA 2QTGA 4Q4JA 2B8JA 2VK4A 4IUYA 3NHMA 2YZ7A 4Q93A 3KL4A 4B71A 2GAOA 2XTMA 2VA9A 2XITA 3WVNA 4W1SA 1J9EA 3EYAA 4AQYM 5HQ3B 2O2JA 3WHIA 5FLEX 3L7OA 4UMFA 2HV9A 2ZSUA 3MUNA 3LBIA 5F33A 1L7QA 4FJ0A 2IYUA 3Q7QA 2ON6A 5DHSA 4DG8A 5KNDH 1SCJA 2JA1A 2IVFA 3FGOA 2RRUA 1HDEA 2BF4A 4KDFA 4OPMA 3WIEA 2O2HA 1F2VA 4C87A 2L7HA 4V1CB 2GUGA 5JSZA 1HI9A 4KLAA 4B6FA 2JVKA 2Y0QA 2Z0MA 3CO0S 1KDVA 3ZEAA 1L4FA 4HWKA 1RYHA 2D74A 5CD9A 3HBNA 2A9JA 1E5DA 3IEXA 1EE9A 1Z0UA 1TD1A 2GFIA 4G4SO 1G4AE 3GJYA 4RVGA 1OLSA 1KZHA 3JCZA 4NJMB 5CH3A 4ITRC 2YXNA 5I4CA 2BISA 1Z73A 1GJTA 4WZBB 1AQ6A 1YI1A 2V8OA 4L4XA 2XYPA 3U80A 4E6PA 4KYTA 1XDDA 1FFBA 2O2GA 2LCQA 1XDWA 2OBYA 3AO0B 1NF2A 4JJ8A 2ZUTA 4LE2A 3DBLB 4C0SA 3GVHA 3LU1A 5K3OA 3K53A 4UU1A 2X7HA 2PNJA 4RHCA 1QHHB 1KDOA 4YI3A 4ZI7A 1ULUA 4A6XA 4MUAA 5JLJA 1IE3A 4ZCIA 2QQ0A 4WIAA 3WLEA 4M87A 2LGJA 4F5EA 3HKPA 7YASA 4Q01A 4MP6A 3QUTA 4M76B 5LMCA 3KP1A 1XNHA 4J1NA 4MPJA 3UZUA 3DZKA 2E5WA 3P9SA 4Q3OA 3DDOA 3L8YA 3RWBA 1ND5A 4DLXA 4ZCQA 3CTWB 3B2QA 5CRIA 5BR4A 3N2KB 4LHSA 3G8YA 4INPA 1T4DA 1VHQA 4O4IF 1GCOA 1SCAA 2JCYA 3E7WA 3VZQA 4BVLA 2GCEA 1NBOA 2CNBA 5INTA 5JTTA 4R16A 1GDTA 1CVIA 1ZK4A 2E18A 1RKXA 1QFYA 1UZAA 4Y8VA 1RQ7A 3VNVA 2A1UB 5HKKA 3WKAA 1XK6A 4RW0A 2EW8A 4K9RA 1Y8RB 4QOHA 2YS6A 4NV1A 1E1QD 3AYXB 3OTHA 1I3MA 3SY8A 4XM0A 3VHXA 1IEWA 2J3QA 2O6HA 2ZIZA 4MZXA 4P34A 1EEHA 3ZIDA 4BNVA 4CEJA 4CNQA 4OW0A 1UBJS 3HO1A 2EIXA 1AUOA 3M1AA 1OROA 1VYHA 4J9UE 1ILEA 3C5VA 1MHPA 3HA3A 1XRJA 5FHRA 4B3SM 1ELOA 3LF2A 2L4EA 5ECGC 1MU0A 5BOSB 5B7QA 4KQ6A 5LP1A 2QNIA 3A2NA 3HDTA 3M81A 3MWFA 4KL8S 4N7RA 3SLRA 4DJDC 2QLNA 2B25A 1HDXA 4PC1A 1A8SA 4PYOA 2YNMC 4S2EA 1KBOA 2AT1A 2J09A 3GFFA 2HK8A 2EKPA 1RRFA 3GRFA 4OJMX 3E9QA 1U9YA 4DLTA 4Q7EA 3SX2A 3ND6A 2FZ4A 2WZQA 4S1TA 4B5LA 1LSUA 3E18A 5K4GA 4NMWA 3NVKI 4AB1A 3HJBA 1MH9A 1BH2A 2IP1A 3CPEA 1G9TA 3HJGA 1Z2AA 3MRXA 3ELYA 4UHHA 2BZSA 3BA1A 3RGWS 3TI9A 3ZGOA 4BGEA 4G24A 4RVNA 5JVDF 1XCMA 1Z88A 3N0VA 4N8DA 4UBNA 5ESRA 3DHVA 3JWIA 2O7NA 4G0XA 4EVSA 4I5IA 1TYAE 2WJGA 2M9MA 3OQVA 2ORWA 4J4BA 5IAKA 2NZUG 2E3JA 3HGIA 1T35A 3D54D 3ZWBA 3INGA 1DO0A 3KKZA 3CIOA 3QHQA 3PX2A 3Q9SA 1SQ0A 1W5AA 4OYHA 1YRYE 2JK0A 2OCKA 3H6KA 3WTBA 2G76A 2KPOA 3ZOZA 3T4EA 4O33A 4Q12A 2ZM5A 1WMBA 4YASA 4D4LA 3GLIE 4AU1A 2G70A 4OP2A 2QE7A 4EY7A 1W35A 1U2TA 3SC2A 4A2PA 2EBWA 3AVUA 1P4AA 3D8LA 3VHLB 5ICMA 2JIOA 3V00A 4MVYA 1UKBA 4PLHA 1S2LA 1GFIA 3L8HA 3QU7A 2P6RA 3IP8A 5SY4A 3VK8A 2P2CA 2QVCA 1H0KA 4RV9A 1ESDA 3UKOA 4JGBA 5LQNA 1QRRA 2DWOA 2E48A 5K99A 4MQEB 4R83A 4W8GA 3JYHA 4NI5A 3DQZA 2ENUA 4C7JA 1G1MA 2DU8A 2ZBUA 3PNOA 5ICSA 1HE4A 1JDJA 1VG9B 1R18A 4QTTB 3ELWA 4IICA 2GGSA 1KYVA 1MB9A 1HUQA 3ZDAA 4PLTA 5HBGA 5LNK1 4A2QA 1OC2A 2HSWA 4F9GA 2C2OA 3LH5A 1B26A 2HUNA 4JIMA 5IXJA 2K7ZA 1N5KA 2H7CA 2PKCA 4GOMD 5EUQB 1ZS9A 4RC9A 1NURA 1Z8DA 2PO5A 4H0NA 2J32A 2VLIA 1DKMA 5F3RA 1TEXA 1G4HA 1FJXA 2C7BA 3LHFA 3STWA 4CMCA 5DEIA 4NYMR 4JR1A 5H4GA 1FVFA 4B3MB 2MOKA 3FRJA 3IMFA 4LFBM 2O01F 3FMFA 5JMTA 5KYXA 5K0EA 1Z8FA 2QP3A 3O91A 4LYGA 3DMYA 4Q34A 5EWLA 3BDVA 3OZEA 4JBYA 4R41A 5FFFA 3RC2A 4YAGA 5K3DA 2DBRA 2D1FA 5EXXA 4JJIA 4L8WB 5IYZF 2QPLA 4Y2SA 3L0IB 3UG6A 1G9XA 2VHXA 1XJ5A 1ZI9A 4LJ6A 4J7AA 1VHDA 2VBFA 2PGNA 1E3TA 2OE2A 3ZYCA 2OCBA 4WY5A 4EMBA 2KRUA 3DJYA 1I7LA 3OIVA 4IAOA 2A4KA 2QE7D 4HRXA 1M2NA 3K9CA 3UCXA 4DM4A 4DYVA 4FILA 4YPOA 5ALSA 1JDBC 2QTWB 2VQ3A 3T7IA 1LXCA 2IXDA 1JEAA 2QNBA 1Z5WA 1IDN1 2V5UA 4HXYA 5HQJA 3D3NA 4HN9A 1TO1E 1ENZA 1DGGA 3BJZA 3I9V1 4MWDA 3RLIA 2YHIB 4KBGA 4K0KB 4ZVQA 4BNDA 4IFBA 1YASA 2QENA 1Z82A 3QG1A 2H4ZA 5DMHA 2VS1A 4G8CA 1BCSB 2QRKA 1EFRD 3GLFE 3K31A 4OBEA 3FPHA 2B1GA 5G3YA 3W4JA 3OCWA 4N3BA 2YJZA 2P27A 1AUQA 2H9IA 4G1MB 2OQ2A 1E9EA 4K9DA 3WOVA 1C3VA 4CKEB 3AKYA 3ZXXA 4I8OA 2RGCA 4OMDA 1H6CA 4NNOA 2GJAA 2IC5A 2HFJA 2V59A 3HLYA 4E5PA 1VHTA 1MFZA 3QIVA 4DLWA 1Y6GA 4YS6A 4R7GA 4RE6A 5BQ5A 2H0RA 1T4BA 4MR8B 3QEKA 2YWXA 4JELA 5C34B 1YHYA 3HKBB 3Q0TA 3WGVA 2Z8ZA 3P0RA 1W5BA 2EQ5A 2OCLA 5DK4A 4DUGD 4CWAA 4PM4A 4OVZB 4OCZA 3N7TA 5JATA 2MSNA 3MLEA 3V2UA 4MUJA 1F06A 1ZIOA 2Q0HA 4X3OA 5EQJB 3SOPA 4G07A 1RJDA 3ORYA 1A5TA 2I2DA 4NR0A 3GDGA 5CXXA 2PZ8A 1N8NA 4BGUA 1XTRA 2XD9A 3ENWA 4IJEA 4KQ9A 3HB9A 2MGWA 1MRZA 4DG9A 4MOWA 5E4JA 1BEZA 1IXKA 3RKSA 3U3DA 3ER9A 5GV7A 2G36A 5TT1A 3RYCB 2JG3A 2VLBA 2CLDX 2MHCA 5DNEA 2EU8A 4DMRA 3RVMA 3GFQA 4J3JA 2YVKA 3RYFB 4QKQA 2DI0A 3E4CA 1UBRS 2K7FA 1HA3A 4I50A 2V7PA 5KHLB 5LZ7A 1V33A 2VJKA 5FH9A 1J5EB 1I2ZA 5TF4A 3SHOA 2X19A 1TVMA 2FWIA 1ZX1A 1J25A 4D9IA 4FU0A 3ZV3A 1P2FA 4I5DA 2VZ0A 2XOXA 4WESB 4Y2YA 5ICFA 3AP3A 2Y66A 4HL6A 5T4FA 1SJ9A 1YBFA 2NU9B 2ZG6A 5MGNA 1NHWA 1PG2A 3KELA 1VIMA 4GI1A 1SWWA 2VSFA 2X76A 5ITXA 4E7OA 3MELA 2C7VA 3F6EX 3QY0A 4QELA 5J2UB 1KNXA 3VYRB 4BASA 4CT0A 2NO5A 3U62A 2J0QA 1P33A 5LP6B 4KGDA 3N7AA 3BRWA 4AJLA 1LLDA 3W6ZA 1Q15A 2ZTVA 3PPVA 1G5IA 4FR5A 3UBMA 4EHFA 2OAQ1 4MEJA 3OF2A 1Z6TA 1ADJA 5GINE 2X9VA 1IN1A 1M7BA 2EJTA 2VUHB 2XMSA 4MTLA 1EFVB 1Q50A 4MVWA 3JWPA 1X19A 2HPAA 3AU8A 3A9CA 1O8CA 3WYGA 3ZU6A 4W1RA 4EW1A 3SHVA 1CUAA 4JI6B 2JLSA 2Y1KA 1GL7A 1F0PA 1R15A 2NT3A 2P0EA 3KQPA 5F7XA 4TYYA 3MFYA 2CRUA 1U28A 3KZMA 3QVWA 3F4BA 2QUAA 1G8SA 3OIFA 3UHJA 5HZHA 4A3SA 1NV8A 1W5EA 1NDQA 2J5RA 4KXFB 5H16A 2F8MA 4JY7A 2ZRGA 2EP8A 4D6YA 1REQA 4IVPA 4DJ5X 1UP7A 2GNOA 2XMGA 4DIFA 1PW7A 1EM8B 1HTWA 1M1YE 2Z83A 1SVMA 3FWNA 4CDNA 4IIGA 3LVBA 3OFNA 3AWIA 4PQGA 4AY5A 1DRJA 2L0XA 2C2ZA 1PGNA 2VO1A 3EPPA 4TV8B 1T4CB 2WNIA 3NC0C 1PO7A 2UXCB 5FBZA 4A03A 4ZYYA 5G40A 2HFKA 1DIOB 4JHLA 2W8ZA 3FCAA 3WBJA 2XKJE 1Q44A 3BXZA 4YDRA 2H00A 2FP4B 1N1MA 2PLAA 3LWZA 4KXXA 1R6XA 4KNYA 1JWBB 1T5TA 2AIRA 3RSGA 2QTTA 3HSSA 4TKUA 1PJCA 4FWGA 3D8SA 4B35A 2VAWA 3Q8XA 4IO0A 2BFAA 4D9JA 2VPXA 1I0IA 3VK7A 1FYFA 1ZMRA 2Q1TA 3I2FA 1NRWA 3MB5A 1V26A 3KEQA 2PA3A 4CHGA 2NIPA 3O2QB 4U2CA 4EA7A 3IA7A 4H9GA 4OFWA 2ZW9A 5EP2A 4GBGA 1T4MA 4WVLA 3FYUB 3TDKA 1R6UA 2O3JA 1SUSA 3IEVA 3CZ4A 1P18A 5DBEX 1DDOA 3CXRA 2J0UA 3MTBA 2QSUA 1OT5A 3H5AA 4ZVSA 1R64A 4Q0MA 3BS4A 5HILA 1AN0A 1V4BA 3T1YB 1ZRSA 3IXQA 1D2MA 2VPPA 2G3QA 1Z7BA 3BTUA 3KYDB 3TLMA 4DC9A 3LY9A 4YFVA 3NG1A 5CW2A 2RGUA 3IDSA 4GHLA 2WDPA 2O25A 3R3SA 3RGSA 3JATB 3WP0A 1FZQA 4AX8A 2JY5A 1GIAA 1K5HA 2PBRA 3OAAA 3OLQA 4QDOA 4QO7A 2ZT5A 4TWAA 2ZRAA 2NQTA 4UD2A 1MAWA 1N2CB 4DYDA 1RTKA 1ZYUA 4JFAA 1QDUA 5CIWA 2V1UA 1YSCA 5LQAA 5EE9A 1JIUA 5C2JB 4J6FA 3SLKA 1OVMA 1U8FO 1HT0A 2WFLB 4W7SA 4MUEA 3KS8A 2XX3A 5CDHA 1UBUS 3NBKA 1IIBA 4U2BA 2EAUA 5BSUA 2I6SA 2OK8A 5CFMA 4KQMA 1UMDA 5FHQA 2KEBA 4A4DA 1A8IA 4IZOA 4W5WA 4CG3A 1SELA 4I1RA 1T6YA 4NNJA 4Q6BA 1AMUA 3PJEA 1ZHOA 4TT8A 3LHDA 1ZAYA 4BWGA 5KYWA 4GL4A 3GGGA 2JIDA 4CEIB 1BVRA 5KUTA 5EAIA 4J1TC 1T8PA 4LHEA 5FUQA 4PQEA 4C0AC 2FK7A 2POQX 2RBEA 3E70C 3IILA 1D1PA 1BDBA 3PXEA 2EFEB 2ZS9A 5DNDA 3WGQA 5IWAB 4RZ3A 1B0UA 1XC7A 4BX2A 3PGXA 5FX2A 1KEKA 3PQCA 4Z3OA 1F6DA 4D3DA 5KMGB 2HBQA 1L5NA 3ILHA 1VCOA 4WESA 4DRZA 5A5EA 4BLRA 2X6TA 3LRXA 4KR7A 1UINA 5JD3A 4OHXA 1T0UA 1VCMA 1WVIA 3IFSA 4LYJA 4PBSA 4BQOA 2QZZA 5H37D 4CTKA 4NL4H 3NPMA 3TQHA 1CQXA 2BGTA 3FPCA 4L0CA 4IX9A 1TMOA 3SIPA 1KTIA 1UJBA 2Q46A 1F3LA 4ON9A 5H68A 1PFUA 4TSRA 2LCFA 4C5CA 5K0JA 2P6OA 2QS9A 1M74A 1ULTA 4PHCA 5JARA 3J81k 1A5AB 1WJGA 1UZNA 2BFFB 2Z2XA 3CPHA 3KFXA 4Z4IA 1J5XA 1SC1A 2CXHA 4CCYA 1G2PA 1DUVG 3GQBB 3CUEF 5FTLA 4K1LA 4YJFA 3V9AA 3TRDA 1ZNQO 3LHIA 3U3JA 1FLNA 4YNBA 1QRDA 5F3WB 3O0TA 4ZT5A 3VDXA 3AEUA 3T3GA 1I36A 2C4MA 3BWBA 2E2WA 3BXEA 1X37A 2R6CA 2H57A 3WDSA 3WBKA 1Q0QA 1I13A 4GRIA 1OMOA 3B8HA 1TUBB 2SCUB 4QFDA 3U6PA 4B3XA 1PL0A 3V8VA 3JS5A 3R0VA 4MAMA 4QQ8A 2BTEA 4G4NA 3WLNA 1OLUB 2R60A 4HLUA 1YO6A 2ACVA 2X6QA 3W79A 3MWDA 4RSGA 1Z4IA 2A35A 1A5ZA 3I2JA 3KAPA 4MHTA 4UJ3A 4YXWA 3CLRD 3FFTA 2JHFA 5AVKA 3ZE8A 1BVSA 3CMMA 3L6BA 1TA4A 3GZNB 5K1ZA 2X1MA 3KIPA 3LBNA 3PVZA 4QICA 2DHDA 4AY4A 1N5JA 1Y5RA 2AG6A 1H2FA 3ONNA 2FXVA 1ID8A 3FNHA 1U7UA 1PQYA 2EWVA 4OQ4A 4R01A 4AZTA 3ZHTA 2DEUA 3MMZA 2FPWA 2YINC 3GG9A 3I2HA 1L5HA 2EKFA 4EVQA 3N2KA 2CUZA 4JUFA 3N58A 2VWQA 3VR4H 1JVSA 3CNOA 4PC6A 3BQNB 2PVCA 4C07A 1XROA 2CJYA 2UV8A 3GDWA 4YXWD 2XSZA 1T0JB 2FHPA 1G1AA 2F3UA 2Y3IA 3Q11A 4NHOA 4BQQA 1GT6A 1YJ5A 3HHPA 2XCRB 3MTJA 4HI0E 1OBOA 3ZU5A 1AK1A 1YKGA 3JQPA 5J23A 5KC9A 1LFDB 2IXFA 4AS1A 2FSFA 2W6ID 1L7VC 5AP9A 4J4TA 4PZEA 5EMLA 4OU7A 3L46A 4URYR 4B4VA 3BMCB 1ZJJA 3I3OA 2WHPB 3QLTA 2YRFA 4FNOA 4RF5A 1XC8A 3A6LA 1BMQA 5HKKD 1F51E 1SOUA 1O9HA 1DBQA 1P2BA 4PT5A 4DJJA 2Y21A 5KPTA 1V9SA 1P1JA 4OGFA 4QATA 1A9YA 1JWLA 3WKDA 1DJMA 1JHAA 1UK7A 1VJDA 3F1KA 2GRJA 1A9QA 4JROA 3MWEA 2ZPAA 2HH9A 2XADA 4ER5A 3EJ6A 1EE2A 1PSZA 4EG4A 2XB9A 1P7YA 1P1BA 1UDWA 1NQWA 2IGBA 4I0WB 4D7AA 3N3AC 4DL9A 3JQ9A 1DOAA 1UC5B 3UMSA 2CWDA 4HPWA 4X71A 1H93A 5J3JA 1RPZA 2QTRA 5FTJA 5H3HA 1G8KA 5BUCA 5E6SB 1J07A 4X6XA 5EWJA 4UKDA 4AG3A 1EPUA 2Y0PA 1JLMA 1JQLB 2ODBA 2QTVB 3OMXA 4EW2A 3RAFC 1JFTA 2ZYVX 3IEKA 3T9AA 3TIGA 4RXUA 2C96A 4KKXB 4NAVA 1R9NA 2Y8EA 2XAUA 3FN4A 3MINB 4HFRA 4XWAA 1KVRA 3SFTA 1E32A 3DZIA 4F86A 5KX5B 1KNQA 5L9AA 1GY8A 1I0LA 3F3SA 3ORHA 2BKAA 1WU8A 3EXIA 1J5PA 3UJ9A 2PSSA 2WOJA 3DAFA 4YJHB 2FH0A 1RM5A 2YNMD 2RGWA 4C4AA 4BB9A 1C8BA 1L2CA 3N2EA 4C7BA 5K0SA 5JMOA 1TC2A 4CCYB 4UM5A 4C6TB 4DV3B 3HBMA 3L82B 3JD1A 3R3XA 1U02A 5C1OA 3KJGA 3P27A 1CR4A 2QGFA 3PNSA 5GP1A 2HW8A 3JD4A 1P5RA 2D5AA 3AVTA 4ND8B 1RCTE 2R6HA 3BXPA 1O1YA 3G02A 1UCFA 1C0LA 4EUKA 3C8MA 2BELA 1XEFA 2WG1A 4PPQA 3DDWA 2UZ0A 2XODA 1EIZA 2R1TA 3GC6A 3STXA 3PD7A 4KFTA 1BCRB 4Z86A 4ER7A 4ZDJA 1BRTA 1RTTA 3LYHA 3GGDA 1NBAA 2WLSA 3NWEA 4TLCA 3RH0A 2H52A 2V7XA 1BEUB 1LTKA 4P22A 4YMIA 5SZKB 1XP5A 2G9NA 3KYJB 4LZZA 1THGA 2B2NA 1OV4A 3AJAA 1ZD1A 1QH8A 3HDJA 4K6OA 4MJXA 5A5VA 2PX0A 2V97A 5CBPA 2QRQA 4ZVRA 2F1HA 2VTBB 4GKBA 4ZVVA 1QYRA 4H7KA 1TF2A 3OZWA 5LLTA 3MJDA 2QX7A 1Z6PA 3AF2A 3IQFA 3V2HA 4ZJUA 3BERA 5EJ4A 5HS4A 5JOQA 4NULA 3KP1E 1UKAA 1XOIA 5H02A 3SDZA 1RWNA 3IVAA 5JQGF 1V7ZA 4H0CA 5ALQA 1WGNA 2EA0A 1P2TA 2RAUA 5DNWA 5IBPA 1JYFA 3GEGA 4MNTA 3IIMA 1T9GS 4BEJA 1NXQA 2WLTA 1MC8A 2EATA 3NC4A 3OA2A 2QLMA 1NQ5A 2EF0A 4UEWA 1MMFB 1QK4A 5FL3A 3RVBA 4AJKA 4QZVA 2JIZD 3M4YA 4OKIA 1TAUA 1XGKA 2XZDA 1UBNA 2FKNA 1GGMA 2OP0A 3LBHA 3OFND 4LUCA 3QTLA 5DIFA 1E1QA 1SK9A 4RVDA 3ZH2A 1G5HA 3HVJA 1ISPA 3KOWA 2NUAB 4YN3A 3SQNA 3GQ5A 2ZTUA 4Y0AA 2B34A 4Q9LA 1JA9A 4TXJA 2PTGA 3M6UA 1HYGA 3Q0EA 4IHJF 1Q39A 2C57A 1JT9A 1U8YA 2QT1A 3K5WA 5DNVA 4BLTA 4CEHB 5KU1A 1T8TA 5HHTA 2REBA 4ND6A 5LB4A 4WP2A 1J2TA 3QK7A 1QZXA 3NIFB 3PHCA 5K05A 5CUQA 2OZLA 4OBBA 8GPBA 2XZOA 1VJ1A 1ABFA 2NAFA 2JLCA 4J16A 3ROGA 2DZOB 4DA7A 1W94A 4UM9B 2VRNA 4UTVA 1LVGA 4YP9A 1X74A 2HLDA 1ZM7A 1GYPA 1QDEA 1Z0DA 3GO8A 2ZSHA 4P9NA 1EX6A 2JFPA 3UHAA 621PA 4R84A 3OP1A 5EFOA 3FMIA 4XM1A 3U7FB 4LF9M 3VI4B 3QXGA 2CHUA 2WSYB 3TTXA 2BEWB 4UE6A 4QNRA 1QGYA 2HXGA 2V5AA 521PA 2W70A 4ZEMA 4DV1M 2RG1A 3QYBA 3QU9A 4HNTA 3LM8A 3E82A 3L79A 1GXSB 3KE9A 3NKLA 2OKCA 5ALYA 1KR2A 1W36D 1XTVA 2R2GA 5EGNA 5TT0A 3D4NA 2HO4A 3U09A 1V16A 4X45A 3MS7A 4LRUA 2FZ5A 5CITA 2ZCVA 2X6RA 1ZW1A 4RCYA 3FB1A 4GPEA 4K81B 1RAHA 5EMJA 1N7GA 4MINA 3INYA 2QQEA 1NATA 2FPXA 2FN3A 2C8KA 1OIPA 3I4LA 3PQFA 4QBGB 5DK6A 4U8GA 1IUOA 1F0NA 5IH3A 2FX2A 3OTQA 5D51S 1QDRA 1DEAA 3LA8A 2BFEB 2Q5JA 1DC5A 1JXMA 4R4JA 2ZKLA 2BKUA 3E81A 4NC6A 1O7JA 4PAWA 4R8LA 2XYGA 1UK8A 4LBZA 4IDNA 1O6FA 4RHUA 2P1RA 5E6UA 1L8QA 2GAFA 4FOLA 2YDXA 4JI0M 4QARA 2WIGA 2BKVA 1KJ8A 3IKLA 4DFDA 1IMOA 1RT9A 2A0XA 2IXTA 1PFVA 4TTTS 2D7GA 1C4OA 4MB6A 3NI2A 3DBOB 3NUZA 3RJ9A 3RTDA 3JQ8A 3ZZ0A 3C7TA 2VA8A 2WIBA 3OURA 2NZYA 3PT5A 1J2YA 4B7AA 2CKDA 5IC6A 5JEEA 5CHYA 5AM1A 2B78A 1E77A 1XTQA 3RSLA 2JEOA 3C97A 4AMBA 2RG7A 3BMOB 3HHEA 3KUUA 3O84A 4DLUA 3QLEA 2O48X 4NZ9A 5G53C 2DAGA 4IPTA 5BWCA 5BUQA 4EY3A 4BO4A 2X4GA 2IFTA 3FOZA 1RHUA 5FPTA 5LR6A 1Z68A 4FGSA 2QUZA 3VO9A 3QOFA 1G17A 4N3GA 3ZV7A 3F1LA 1AKYA 1RACA 2CHFA 4NCIA 1JHQA 2AQHA 2PXCA 4G5RA 2RD2A 4L6V6 1G3QA 1ZDMA 4JJEA 5J5AA 1II8B 4C7VA 4M1QA 1HQCA 4IIVA 1YB2A 2XVAA 1W1UA 2G07A 5B3JA 1W36B 4DG5A 4D6PA 3VFDA 4RV4A 5T64A 2AOTA 3ZI7A 5FP0A 4YJ2F 1OB5A 1QHEA 3BAZA 2YIDA 4GNKA 2ZI7A 2ZXEA 5EVCA 3RB8A 1W9HA 3DOAA 1OLXB 3MT8A 4X6UA 1SD1A 3T0FA 2ZTMA 3CF0A 1ZUIA 1VLJA 3EQ6A 4GYKA 5THQA 3FMGA 1IBMM 3GJ3A 3UT5A 3PD0A 3E35A 3PNPA 1GYRA 1I7NA 3PXAA 4AKIA 1JHDA 1JPNA 5EHIA 2X0EA 1EVEA 3FVVA 3QXJA 1QH0A 4W1QA 2ES4A 2VHCA 4IRUB 4ALLA 4FCCA 5HOEA 1IZ9A 2VBIA 2EKQA 4DMGA 4X63A 1Z3CA 3LDUA 1Z5CA 5IK2D 1ZONA 1GPYA 1NE2A 1U7WA 2W2NA 3SR4A 1YE9A 4EHKA 1BDJA 1N6LA 2UYQA 2WJ4A 1PDWA 2VDQB 4UU7A 5G4LA 1HC7A 4OSOA 3I05A 3RBVA 3KB8A 3PFNA 4NEQA 2DKOA 3A2LA 4YQZA 4L4UA 4P82A 1N3IA 3TW4A 3BWDD 1WO8A 2VQFM 2FTKE 2WFLA 3WJ2A 1CZHA 2ID8A 2BCJQ 3K5PA 1EVQA 3R7NA 1Y7PA 4DA0A 3PR2B 5I01A 1J24A 1I2MA 4GI2A 4EMSA 3H6HA 1P1KA 1KI3A 3IHWA 4JI1M 4DSOA 2ZB2A 1KQNA 1BG6A 2VYND 4I55A 2FW6A 2JHCA 2XUFA 4BO5A 2AR0A 1NRIA 2OZPA 2X49A 1WU7A 4OB7A 3H2KA 3SYRA 1I24A 1HQKA 3DEAA 5F2KA 1NWHA 3GLSA 1KHHA 2V4ZA 3IXMA 4P08A 2QTAA 1OFGA 1X1EA 2JCVA 3SNKA 3GP8A 3ZE7A 2JI7A 4AN1A 1IXSA 1CR0A 1NKSA 1X7YA 4LRQA 1HG0A 2HRZA 1QFZA 2XYVA 3AGPA 4OAPA 5HM6A 5B7NA 1ORRA 3O82A 5LYJA 1RMTA 1UBSB 1NBMD 3FCSB 2PVSA 2IBTA 4XIIA 4DWVA 1TD9A 2QTZA 3DE6X 2Y1EA 4NAHA 3TTSA 2VPQA 1V3UA 1VMDA 1XRQA 3W2HA 4G8JA 4JVSB 2NLOA 2OL4A 2WMNB 2WVGA 2Y1WA 3GN1A 4RV5A 4ZEOA 2X5JO 3CWCA 1M2OA 2P2DA 3DKIA 3MMPA 5ITSA 4R9RA 1IUNA 4OHWA 4D96A 1VDDA 3A6FA 1PK7A 2AFHE 4COOA 2XNKA 2PV0A 4CTOA 4KHPB 2LRHA 1A4RA 4RS3A 4AO8A 3H75A 3NFRA 5B1YA 1WHTB 2XWQA 3A3YA 4RD2A 4GEGA 2QK4A 4NJEB 2DB3A 4NYMQ 2DHEA 3L06A 1L4BA 1EIJA 1EJBA 2QXUA 3HXQA 1MJGA 2H4JA 2QW0X 2YICA 3CZPA 3GRCA 3QJYA 1UEIA 2JAPA 2YQ4A 3KJFA 3R6WA 1NFFA 4G8BA 4HWPA 4WLEA 3BIWA 2Z2KA 4MV9A 4S24A 2QRNA 3PJDA 3TNFA 3ZDZB 2RBKA 3OZ7A 4AP6A 4F3RA 1M8KA 4HBGA 5CCDA 1Z9BA 2M1ZA 4GYJA 4DR6B 4U2EA 3D4BA 4GMQA 5LDHA 3ED1A 2GPBA 5L3RA 4YCCA 1MX3A 4B47A 4BN0A 3R7BA 1U4SA 2P9TA 2WT8A 3EGWA 1IMJA 3AZOA 3N5CA 1DLIA 1KYZA 1YHNA 3DVAB 3Q87B 1O54A 4U6SA 5AI4A 2ZLBA 3FPFA 1T5DX 3ZGLA 2WP0A 2EYUA 3CZRA 1M6VB 2VEOA 1T9GR 3I28A 3B7NA 2DLNA 1XU9A 1O6ZA 3E5HA 3WAGA 4BNNA 3LLMA 1OI2A 2BRUC 2PGLA 4PG6A 2OYCA 2KLBA 3PDIA 3NNDA 3RK1A 2F5SA 1DQRA 5KS2A 1QORA 2AF3C 3RIHA 3A25A 3I45A 2NADA 3D7SA 3HY5A 1UPXA 2VC2B 3L7BA 2R7LA 4RJLA 4I7EA 1P3JA 2Z98A 3NBFA 4OQNA 3MBIA 1P73A 1W36C 4IW3B 4F1KA 4L7VA 1AO0A 1C1DB 4RQUA 3D2LA 2ISQA 3ZD8A 2RGYA 5A4JA 5BQPA 4ARIA 2O5RA 3WISA 5CJJA 1XTPA 4D99A 1CK4A 5IRCD 1WDKA 2ODWA 3UV7A 1TPZA 2JAUA 1DC4A 3LI2A 4H7PA 5A6SB 4B9AA 4KN6A 4FNAA 3SQMA 4B43A 3H16A 1ZQ1A 4GITA 3KT3A 2X40A 1A9ZA 4H08A 5HE9A 3S2ZA 4D2IA 5JT1A 5EUCA 1T8YA 3BJRA 5JRJA 2RGBA 3A4VA 4IKPA 1TH3A 5K6TA 3T1YM 4J8PA 4O4HB 1BKSB 1DZIA 3JX9A 4TZKA 5EHXA 2O7QA 5KOHA 2F8LA 5MDHA 4GKKB 2PPVA 3AWDA 1CV2A 2X7JA 4JI6M 2BMAA 4YMUA 3CUUA 3QVLA 4I4IA 4CIDA 4CKBB 2C5BA 4EUEA 1QO0D 2WHPA 1G66A 2F9MA 2FUCA 4CKCB 3NUGA 5KTPA 1HDYA 4MICA 3TEJA 4Y9SA 4ZZIA 2XNDA 3F97A 3RU7A 1R0XA 3QWBA 2G9ZA 3WV5A 3RRJA 3KPYA 4BMZA 5HZKA 1JJBA 3FUUA 4ZVLA 2KRKA 5BSFA 4CUZA 5BWMA 3MJFA 2QUIA 5AQEA 4EMUA 2AN4A 2IYQA 5BUSA 4RYDA 5LUBA 3KOZA 3WYBA 3FM9A 4A92A 1V1RB 3MS2A 4W7HA 2JBWA 3I9NA 5IN5A 1UC8A 1WMEA 2W6OA 2ZJOA 3OOEA 3ORQA 3LV8A 2EHDA 1Q0RA 2OBNA 3HV0A 4MIKA 5DISB 1KDZA 1IY0A 2PAAA 4OF4A 4RH1A 5UKDA 3I53A 3RV4A 2Y27A 1ULHA 4D4JA 2OO7A 1LF5A 4R1TA 3HVRA 1AGRA 4NBRA 1CS0A 4PLFA 3AVVA 3L7CA 3HE3A 4E32A 2XCLA 3AKEA 3B6JA 3THRA 4ZICA 4X5OA 4N5MA 2WUDA 3NDJA 2J9YB 4QUDA 4JN6A 3MTIA 3HGQA 1SVNA 1T2VA 2PX8A 4MWTA 4MW5A 5JDIC 2C42A 1Q77A 5JXIA 1IWOA 4QLBA 2C3PA 3K1ZA 1C7RA 4Y2JA 4UNSA 1Y8ZA 2J0SA 3EXIB 2Z9CA 4M1EA 5LZ5A 3I04M 1US8A 3GLKA 3SN6A 3S44A 2G08A 2W90A 5IZ7D 1A2OA 1XG5A 1P31A 2FG6C 4R2IA 2NUTA 1OGYA 3OLCX 2RJOA 2Z4RA 1DKQA 1XQ1A 1Q2XA 2ZYAA 5KZMB 3O1IC 1E92A 2YYZA 3ONDA 2RGNA 2YJ3A 1NJ2A 2GN9A 2P2YA 4L8YA 1DGHA 4NCKA 3JZFA 3UMBA 2HU5A 1U4OA 1RI3A 4IQ4A 3D0QA 4G1UC 4RJKA 4BKQA 4BRZA 4P33A 1ZBDA 4HADA 1JBKA 1Q11A 4PN7A 2HNKA 1ONSA 2J5QA 2Q9UA 1LPSA 3AETA 3ECAA 1ZRNA 1MV8A 4M8KA 3SEAA 1OYYA 1ETHA 5BORA 1EFCA 1O95C 2VCEA 1ZRHA 2JHPA 3DZCA 3LIIA 3QX8A 4HDNB 5CMLA 4ASUD 2OGUA 4X54A 5FBVB 5F1PA 3NX4A 3RE1A 1RABA 2ZSKA 1RBQA 1YOVB 1NPYA 3FKSD 4DCNA 3C7KA 3NGLA 1Z2OX 1K97A 1V5GA 1XFAA 1XVUA 4JJZA 3D5TA 3QXSA 2AVNA 1UMCA 3QKRB 4FMDB 1G2IA 2P91A 2QN2A 1AKEA 1PWXA 1QG2A 3WGYA 2ZZMA 4G4IA 4BRUA 4Q4AB 4AKHA 4R3DA 3KCNA 1MLDA 1G20A 2RH4A 3MOIA 3GWGA 3PEVA 3R1IA 3DMGA 5G1NA 2HJHA 1Q20A 1ZGZA 4M0CA 1OVGA 1GPH1 5KPRA 2CUTA 2RHCA 4MWSA 5KSOA 1MGPA 2ISCA 4Q9AA 2OPFA 4R1OA 2PU7A 3OQJA 3VC3A 1CD5A 3VU8A 4A6EA 1ZN8A 4IFTA 2WMDA 1T2NA 1W4LA 4B46A 3EGOA 2AMVA 2EGUA 2NGRA 2J7PD 5CM2Z 4LCBA 2P90A 3M33A 2QN6A 3B36A 3PJFA 3BILA 3SZRA 3ZI0A 3LQQA 3OFVA 3KW6A 5C1PA 4Q00A 4KT0F 3NDIA 4FLEA 3CCBA 2JGNA 1KTVA 2J6BA 4O2BA 1UOOA 3TRJA 4OGLA 1U0JA 4DZRA 3TNLA 1HTTA 3N28A 3ASUA 1DC7A 4JAVC 5KQPA 5FFMA 1U2RA 1QH9A 3B78A 3THGA 3MGAA 2EFJA 2OFFA 3VYVA 2EJUA 4U2KA 1JIXA 1PNTA 2KW0A 1QHNA 5AHRA 4JP8A 1Q12A 2QXTA 1Q7EA 4G0OA 221PA 5D7NA 1DBIA 1LBTA 2XECA 5CDSA 4O8CA 1VJTA 1KI8A 5H83A 3C3YA 3S27A 4I3HA 3TPCA 4OHMA 4E08A 4J7XA 4B85A 2WKQA 3B2EA 4CL8A 4P6VF 2WU4A 1X7GA 3GI1A 1EHIA 4MKHA 3R24A 5FSWA 3GHYA 3BIFA 1Q16A 2BWBA 2O1SA 4JI7M 3JAKA 3VNAA 4KXWA 4LK2A 1R0BA 4CTMA 3DMRA 2WM3A 2R97A 3L77A 4G5FA 1BVYF 5ITXE 2BCEA 2AEEA 1I4WA 3CLUD 4PLPA 3PGJA 5CVEA 1F2TA 4V0RA 4BFUA 2DG2A 1THZA 1Y8GA 4QWWA 3U17A 3FMPB 4C6RA 3OJEA 3I9OA 2PRSA 2CUKA 1ST3A 1N8KA 4HLDA 3HGMA 2HK9A 1PKEA 1IJFA 1Z8HA 3QVOA 4NV0A 1M5UA 3DVLA 1Q3CA 1TGVA 1MO2A 2XXJA 2XJ9A 4R9UC 4YUVA 1WMFA 2O06A 4MMZB 2X4IA 4K9PA 3S5JA 4OXQA 2WDZA 1QP8A 2IZ1A 2Q1YA 3A4IA 1NYLA 3AESA 3T7EA 1Q14A 1MVLA 2QRPA 3F7MA 1QANA 1GZ7A 3N8HA 4D8XA 3NIDB 1R3UA 4GRDA 4EK9A 3RFWA 1ISGA 3BBZA 1M2OB 1ZMVA 5H59A 3VAZA 4ALKA 3WQQA 4L6IA 2E6KA 1Y33E 3ENNA 4LFAM 3EH2A 2OC4A 5LSAA 3GEIA 2YJ6A 4US2R 3KYCA 1M0SA 3KSXA 2WR8A 1KAOA 1O03A 1NKTA 3EXEB 4HOYA 3LFHA 3RS7A 5K0GA 1JDNA 821PA 2VKQA 2O5CA 1HDOA 5EIHA 4IBFA 2PGOA 2P4UA 4KPUA 4OATA 5BYKA 1E6EA 3GCWA 1RHQA 2FRDA 2GK3A 2Q5OA 3G6WA 1YOVA 3AEQA 1GEGA 3E5MA 3K5HA 4GKJM 4A5OA 3CRVA 2FN7A 3VH3A 4C5AA 2VQ6A 2QZ4A 2X22A 2MINA 1BSVA 2FZWA 4IEFB 5TEWA 5CEJA 3G0HA 4AKSA 2ZI4A 1I32A 4E12A 2JCBA 4PS0A 4X8HA 1BN6A 3LZCA 5GZ3A 1D6JA 2FV8A 1D7OA 1U5BB 4UDXX 2GX6A 2QLLA 3AUAA 3DXZA 4QC2A 3G2HA 1Z6QA 2H2IA 3W5IA 3U61B 2Q9BA 3PNVA 3CKMA 1SC9A 3DBHB 4QAJA 1E1RA 5SY6A 3AF6A 5KKCA 1U3GA 5EIEA 3ZJ5A 1A4XA 3OOSA 4MS3B 1M6EX 5AVXA 4LMAA 1CRZA 2EFGA 2Y1LA 4JBWA 4QUAA 4PZPA 4JUAA 4H4EA 3S55A 2OOSA 1HFEL 1CUJA 2Q7XA 5K0TA 2J85A 4PSUA 1E2HA 3T52A 1VEJA 4P92A 3ZWMA 4Q5IA 2APJA 4JNKA 4Z0TA 3REQB 3TB4A 5JY6A 3ZDCA 1X38A 1ZKMA 4ZJPA 4QSMA 3PXGA 2YWHA 4WKOA 2IOQA 3DUFB 3EMVA 1D09A 1NVXQ 4KUHA 5IVIA 5TQ0B 4BN5A 4TLBA 5HIJA 3G2LA 3TSZA 5K03A 4MPRA 4X97A 4BKMA 3OPYA 1XKTA 4WFIA 4WNCA 5ALWA 1DQZA 3E48A 3P9QA 1SBIA 1CDDA 2GMWA 1ZZEA 3TTUA 3Q85A 4C22A 2Z58A 3HG7A 2A0UA 2R2AA 3H4TA 4LEIA 4BIMA 2VF5X 4LOJA 3MQ4A 1TDZA 3BSSA 3IH5A 1Q1BA 3Q4GA 1VYVA 1CJMA 2Y9MB 3QI2A 4CLDA 4F8JA 5ILGA 5FV4A 1SKMA 2DTEA 2JANA 2ZWOA 2C2GA 1GVNB 3MJHA 4YQFA 2F4VB 2PX5A 4LJ8A 2BC9A 3WJ1A 2F3SA 1R0RE 1ENPA 1XI2A 4EW3A 1JDZA 1K6XA 3OBIA 1QF9A 1FNMA 3OFKA 5L3SA 2PUFA 2B7LA 4TTSA 2DT5A 2HRBA 4E07A 1U31A 3LE8A 1O96B 3D3QA 3UA4A 3G5MA 4D8TA 2ZULA 1I6LA 4KE6A 3TMYA 4YRIA 2W6JD 4X66M 1PYDA 5AUOB 3P2EA 4LN1A 4PBTA 4S2UA 4YO8A 1MXHA 3N2LA 3ZXUB 2R751 3S1AB 1UAAA 1FTNA 3WRXC 3WLKX 3E1GA 1YR3A 4MR8A 2H1SA 3O4RA 3SR3A 3QE9Y 1JVBA 2PRYA 1KQFA 4UOQA 2PLNA 1TTEA 1ZR4A 1RWPA 2IXEA 5TY0A 4ZHQA 1H1TA 1IHXA 1GQSA 3IEPA 3O3OB 3W6UA 4CQMD 3E3NA 1PBNA 1QHHA 2ZB4A 4AQDA 5IWAM 3PB3A 1QP4A 1CQZA 5F9MA 1YS4A 3GYGA 4D4KA 5B7GA 2V0GA 4PXYA 3IVCA 4RTSA 2N35A 1NX9A 3LT1A 2QVBA 2ZJZA 4IXMA 2B1RA 3ICVA 4A23A 3O3MB 4I9NA 5BSGA 5JS8A 1QZEA 1ZJ5A 3CW9A 4EEKA 2G5CA 2CYBA 4C4YA 1O87A 1IEVA 4HNGA 2O2DA 2KBEA 2F8SA 3DEKA 2XQJA 3GFSA 2HJGA 3F67A 1DIGA 5LU9A 5A1TA 3ZDDA 3UAWA 4MR9B 2FCRA 4BQEA 4LF6M 2AKEA 4KRFA 1NIJA 1S2DA 2ATIA 3NGMA 3A28A 4HVAA 4BBPA 2A5YB 2H29A 1Y1TA 3CJQA 4EF4A 4ZO4A 4I6JA 3OMLA 1ZM9A 4MUYA 1B2LA 3ICWA 3IQEA 4M88A 1PVDA 5DBHX 2OXTA 4ES6A 4UVGA 4GZ3A 3HBJA 4Q9NA 1PR1A 3SHQA 1Q95A 3TDMA 4IQ8A 5BSRA 3LGAA 4R2JA 4GE0A 3QHPA 4PPGA 4XCQA 4I6EA 1TQDA 3D3EA 1MP0A 3BFVA 2O2EA 2QRMA 3D6MA 3IS3A 1Y0BA 1RYEA 3WSTA 1CEEA 2ZSAA 5KOYA 4IOMA 2JL1A 2BH2A 2CLOB 2VT7A 4LDJA 2WU1A 3QMPA 4PNZA 4POOA 3UAZA 3HDQA 3Q0IA 1N7JA 5CURA 3WGKA 2NUAA 3EVCA 2VJBA 4CVNA 4I4TF 1K6JA 5HSGA 1YU6A 1XIVA 4ZOLF 1ZN9A 3DVAA 3ADCA 3DFUA 2Q1WA 5HF6A 2BEUA 3HL4A 3L1VA 1GZUA 4LPSA 3QG5A 2H18A 4HO1X 4R8MA 5AHWA 3EGEA 1JT2A 1KVSA 1X86B 3UOGA 1QIJA 3GR6A 3MT9A 1FUEA 3IBGA 3KYIB 4LF7B 1WIVA 2DC1A 2HAEA 3UXYA 4DUZB 3FRHA 5AHOA 3WNZA 2CDNA 2AE1A 2FSUA 4M6WB 3JQ6A 5DTIA 2XOKA 4MCAA 3I5XA 4C9BA 1WNTA 5CLHA 3D6HA 1RYMA 3FPKA 2ZPTX 5JADA 5CA1B 4KSCA 1VPWA 1U1IA 4MVJH 1GNLA 4PRYA 4IH4A 4K9KA 4D3XA 3QFTA 4X7BA 3RFXA 3O21A 4J1TA 1W581 1XWFA 2G63A 3EZYA 1JHVA 3OJOA 3EGVA 1P9OA 3EXHC 4BNFA 4UCQA 1XP8A 1VPEA 2C77A 2EEZA 1RAGA 4TKLA 4RL6A 1EFAA 4LSGA 2ZDQA 1EQAA 1UM9A 3HO6A 2YX1A 2QRVB 3PUWA 3QKSA 4C06A 1VSQA 3RQSA 3TBKA 1MZPA 4KN8A 4NIMA 1E5QA 1WTAA 1BXGB 2W8BB 4XGNA 5JSUA 4BCBA 2WQ6A 4LJ9A 1C50A 1Q0SA 1J42A 4NEGA 3PEWA 5TGDA 4RK7A 5FTNA 4FDTA 3U60A 2RHOA 4G09A 3OD1A 1CR6A 1GR1A 4YWHA 2W6IA 3DR5A 2PIAA 1HRKA 4JK3A 5FUWA 1U2GC 1BHO1 4RHTA 2YHUA 2ZGVA 1CZUA 1K06A 3IOEA 3UQZA 5HUQA 3FPSA 4O6VA 2JFOA 4U2GA 1CEQA 3LA6A 4CQLB 7MHTA 2D7HA 3MF4A 2QAJA 3OHMA 5B30A 4IDOA 2OAEA 4LTNA 1C2YA 3PIDA 4B4WA 3LDGA 2JFBA 4TZ6A 4NOMA 2JH3A 3PJRA 4BNXA 1T36B 1FDSA 1T9BA 2C4VA 2HV8A 1C7QA 5DX0A 3NONA 3EFEA 3W05A 5C4MA 2OO5C 4B8WA 4GIPA 3GRPA 4PLYA 5KTRA 1WOMA 2ASVA 4GLFA 3EHDA 4X7RA 1AUXA 4JQYA 1A2QA 1L4HA 2O0MA 1JILA 3RVDA 2QIPA 2W22A 3GA5A 4YXFA 2FMFA 1WXGA 2C0CA 3T7JA 4L4SA 3CLRC 3A3OA 4KB5A 3M3HA 3OSUA 4D74A 4C1NA 3A6PC 1Y1KE 3SS7X 1A5SB 3W3AH 3D6UA 3F5FA 3T54A 2CMFA 4OHKA 2VQSA 3Q3JB 3QVXA 4RJTA 1DV2A 4IIDA 4H59A 4Q3BA 1DWOA 4LCEA 2VRBA 1R4NA 2CF5A 3JARB 1E2IA 4YJ2B 1SBQA 3F92A 4FGWA 1I0ZA 3FFWA 3HJCA 3KVVA 1AY0A 3DOFA 4WHMA 5SYAA 4CUKA 4TLEA 5I4BA 4EKDA 2N1MA 2A9RA 5FEMA 3GOQA 3NHFA 4A6DA 1ONNA 1DQYA 2REQA 4TL6A 1V34A 1G21B 3MLBA 2G0AA 1OUMA 2ZXFA 2B94A 1E1CA 3T1NA 2AI3A 4X64B 4BO8A 2J46A 5BN5A 5AM3A 3OOJA 4OUDA 1MNAA 4OHBA 3D7LA 4JUDX 1TA0A 1IN8A 1Z5PA 4WE3A 3VPDA 3H42B 5ESXA 3ZWPA 1DBVO 4KO3S 1NVVQ 1DAEA 2IXGA 2V55B 3CUWA 4ZO7A 2YVAA 4XGRA 3BXHA 2FPIB 2X9GA 4INJA 4ZOLA 2NXJA 2GEVA 4AMZA 3WL5A 4KREA 1N34B 2F5NA 4EX6A 4QPDA 1TCUA 4ILEA 5G0TA 1PS9A 1NM5A 2DWLA 1U1CA 2OXEA 4KQ2A 4B3FX 2GZRA 3DMTC 4UCFA 2A0KA 3P19A 2AHOA 1Y1PA 1EGHA 4QGHA 1S3GA 2YJNA 3G0IA 4MW4A 2X14A 3IMCA 3U4CA 3ERCA 1NHWC 4UXHA 1FMJA 4IS3A 2XMZA 5LD2B 5JJLA 1T0HB 4HGZA 1M1YB 2ICAA 2Y0CA 2DWCA 3DBRA 1OOEA 3TJMA 2BZ1A 1WLSA 3E58A 3H65A 3NT2A 2XOEA 4IFEA 1Q2UA 2FW0A 5KYUA 2FE4A 1A50B 4N49A 3G59A 2WYWA 2Z6UA 1WUIS 3IC5A 2BE7A 5K0CA 1XVAA 2Y2UA 3T7AA 1UPFA 2VPTA 3LRPA 2C5GA 3SASA 1DC6A 4KLNA 5KX5F 3CKYA 4KAAA 4BAZA 2H5IA 4H18A 4OYRA 1FLDA 5K3FB 1UXJA 1YDEA 3HZRA 3QUAA 4C7XA 1DUSA 1XCPA 1OWPA 2XIJA 1UM9B 5IMBA 4DF3A 1G6KA 2IU0A 4PYMA 4D4GA 5JCXA 2UXCM 2G77B 5U9CA 4K9QA 3IQXA 5AT1A 4CM7A 4CKWA 2BGWA 4QYTA 2C5LA 1Z22A 4H1VA 4A1FA 1X70A 2CNNA 4EHJA 4CI0B 2PUAA 4KTVE 1JHPA 1DBRA 3ZCRA 3ESZA 4WKNA 1S8OA 4LG2A 2PH3A 2ZIGA 2E7ZA 4TRRA 3RCBA 1X8XA 5IABA 1SHTX 4JBHA 1ZD9A 4KXYA 5EI5A 5JSQA 1TH4A 2PWBA 5J2UA 2E9SA 2H7VA 2OORA 2PGAA 2A57A 2ZTSA 3IT2A 3RYCA 5FD8A 1PNOA 4FTWA 4TROA 4WKBA 5KYYA 2P30A 5ICGA 3IXLA 2GWHA 3LKZA 4QXMA 4TXLA 2QX4A 4PCZA 3W5UA 3VKHA 1EVYA 3BOSA 4JCOA 4LTMA 4PQRA 4PRZA 2B4QA 4B17A 5CVTA 4DMKA 1TU4A 5HS6A 3QGMA 4UHCA 3O8RA 4NZYA 5E4YA 4FT4A 3IOMA 4ZRMA 4BVKA 4OIMA 5I9SA 3K70C 2GZHA 1KKLA 2PPLA 5EFZA 1H8HD 1G8MA 5JRDS 5DYNA 3R0ZA 1UKYA 3AM3A 1P0MA 1R0KA 1GNVA 3THXA 4TTJA 2ZDGA 3NEYA 1YE5A 4RLQA 3HB0A 1SBTA 3WYEA 2HYIC 3QWAA 4LF7M 1T2EA 4LS3A 2OQ4A 4CFSA 1QF6A 2WM8A 2FPMA 1W8DA 2VDNB 5EY5B 3WZMA 1Y7HA 2DH5A 1FTQA 2VDMB 2WW8A 1USGA 2XVZA 4JJ7A 2CJFA 5E6SA 1ZLXA 1J5EM 3KSAC 5LMNM 3F6YA 1X42A 5KWIA 2ZI3A 1IB6A 2ZJ7A 4GQAA 4MKGA 4ZA2A 4FIDA 1OC4A 3HKBA 1RZRA 2WVHA 1SBZA 1R5OA 1DC3A 3RVRA 4Q4CA 2Q2QA 4LOIA 3VSAA 1KZ6A 2VSNA 3WYCA 2B82A 4ID9A 4TMZA 2GD6A 2JFXA 5KYGA 3DW1X 3NYIA 1QIHA 2CGEA 5M3BA 3R74A 4YR9A 1JEQA 3ABRB 4DR1M 1UIRA 2B61A 1TLTA 4Y9RA 4MGHA 4CPDA 1W2WB 1WZNA 1OAIA 3OAAD 2XTZA 3I9MA 1XJQA 3TUZC 3OM0A 1RLJA 4FC6A 3ZY6A 4NBWA 5IJ9A 4WNAA 5EZ6B 2OB2A 4L0DA 2O0JA 4MLPA 2YVUA 1TFUA 3FPEA 4N3AA 3U3ZA 4N8SA 1RM3A 4NVRA 4F4CA 3LY5A 3UFBA 3BMQA 2AR9A 3CINA 5FKJA 1G6HA 4N5DA 5EQDA 4WKGA 3II6X 3K9LA 1UUFA 3RYHA 3CX6A 1RXWA 1O4WA 2XGMA 1G18A 3F3YA 3PYMA 1Y81A 3IQZA 1O9GA 3W1WA 2GWRA 4S1OA 3ZBQA 1KC1A 4V1CI 3L8DA 1GTG1 2XT6A 4L9WA 2JJ1A 3FYUA 2QVLA 4D9NA 1DTSA 1C9EA 5L45A 2OQVA 3RNLA 3TIXB 4ANFA 5BQXA 3NVDA 4AWXA 1PS0A 1TCCA 3O74A 1F48A 4QXRA 2IHNA 4XTRA 3VQTA 3K70D 4LVCA 3V97A 1UQUA 3WIUA 1EK6A 4EFNA 1RLTA 2Z3VA 4IXWA 1F20A 2XEXA 3PGA1 1H4QA 3TF5A 3UGKA 3T5AA 4PZLA 5DCLA 3PNBA 4XA8A 5KYWB 1E9DA 1FCJA 1DXOA 3ZOKA 4X93A 4XJSA 4OI2A 1YQUA 1EVIA 3UAVA 1JVNA 3UT6A 3ZV4A 1EM6A 3B82A 3D64A 4CYMA 3L7NA 4TYQA 3KKEA 4PR3A 5ALOA 3DO5A 3ETDA 3ZHQA 5KNDD 1MR3F 2V1XA 4HWOA 2FLKA 4BAUA 2NO4A 4DR2M 2V6JA 4HUTA 3C3MA 1L1ZA 2C4UA 4LDRA 3ZS9A 5BRAA 3IPCA 1REQB 1TCVA 3DULA 1Z2DA 3KVOA 4IXDA 3Q88A 4TQ9A 1QQAA 1WCXA 3UH1A 1WDLA 3QKSB 3VR6H 2X0IA 3VTKA 4AURA 3I01A 4ARBA 5JVDA 4NYIR 5F77A 2JUJA 2Q5FA 3VNRA 3KPUA 5ETJA 2HJVA 4ZV7A 4G41A 4ZV4A 3PENA 2P1DA 4GAEA 4QUBA 4R8VA 1UANA 2WF8A 3GH3A 2YV1A 1N9GB 3AUFA 3B5JA 3LLCA 4I9FA 2PGIA 1VBMA 3GCXA 3QVKA 4RWZA 1T3LA 1KERA 1O6CA 4FLMA 2BFFA 4MCJA 4NK4A 3DHNA 5IBQA 1QGUB 4JVLA 3LHSA 2JK1A 4QBTA 3V8BA 4XR4A 1JHZA 5D86A 4K6HA 3LC1O 1HYQA 2YZGA 3CR7A 4JQSA 3WG9A 5IEBA 3HCCA 2GI4A 3W5SA 4YMLA 1H3EA 2AXNA 1PEAA 1TU3A 3QFHA 5LYJF 3LW5F 4JLBA 3J80A 2JFZA 4DR4M 2BZGA 3RT9A 1QV7A 4DUYB 3NTOA 1CIVA 3TW0A 1EH5A 1BN7A 5FQOA 3IL2A 5T5QA 3G17A 1LBSA 1ZHFA 2C2WA 4TUWA 4LJ5A 2WBLC 3QLJA 1D2RA 4K2AA 5DCUA 3QE3A 4AYXA 4CCSA 3KQTA 4EHNA 2E21A 1RLOA 3AHCA 5EP3A 4CEJB 4JLKA 2ENWA 3L8MA 4YACA 5HKOA 5I7SA 2NG1A 5F98A 5LA6F 4ZT2A 1OQAA 3BZBA 4E2XA 1EHYA 3W5JA 3HB5X 6GPBA 3VOBA 2HYDA 4I4LA 4EX7A 2XCUA 1D2HA 1DKNA 3LQYA 2IU4A 1FBTA 2GM9A 1B7GO 2MH8A 2HWWA 4B4DA 1GPDG 3OLYA 2MYTA 1G63A 2YOHA 3I5MA 4BLVA 4R54A 5T7BA 5ELXA 1MAHA 1GU7A 2BKEA 2XMBA 4KNVA 2JIMA 4UU0A 4YV1A 4PSCA 4E4RA 1OXTA 2BE9A 3Q9NA 4N6GA 1SPXA 5IT5A 4M1OA 4UHBA 4TTAA 3SPXA 2Z2YA 1WDWB 3HJUA 3G8AA 2FR8A 3TVTA 3NASA 3W8NA 5L7WA 1JEYB 3K32A 3IMEA 3ITEA 1LUAA 2F6RA 4HGOA 3VR4A 4GG1A 5IAEA 3LC2O 5EJ7A 4R40A 3WKCA 2QTNA 1K4YA 2JJQA 5ITUA 4Z9AA 5ITQA 3TK1A 3ZXIA 3LVVA 2Q1SA 4DV2B 5CH5A 1WW2A 2COEA 3HNPA 3EMDA 3FAZA 3H13A 3ZJUA 1ZL2A 1KXJA 1IQUA 2MIIA 3FCXA 4HLNA 1SBYA 1HZJA 3ONVA 4JD5A 4XFDA 4RPJA 5FADA 2LHCA 3INTA 5KREA 1CETA 1ZAKA 1EB8A 3OETA 4TTIA 2Y05A 1TUEA 3IQIX 2DFPA 1Z37A 1ZGJA 1H94A 4DNPA 3EWSA 1VA5A 4BO7A 4C08A 1ZZGA 1W46A 1P8JA 1WMSA 2BFBA 2PFGA 3UC5A 3OHPA 3N2YA 4U7PB 4HXEB 3TGLA 5EINA 4XBOA 3B7QA 3HCBA 1K4MA 1Y4UA 2BMVA 2R7NA 3KLOA 5TMEA 3U16A 2GD0A 3H1EA 3OTIA 2CXPA 2HEIA 4GFDA 1JN0A 5DGDA 3WO1A 1ACJA 3BQ9A 5C8ZA 4P0TA 4IJUA 3UIEA 4M9ZA 5EXTA 3AEUB 5DN9A 4GC9A 1JDUA 2A9VA 3TVYA 5JNWA 4AZSA 3BKXA 1Y1QA 1QZZA 3GGOA 4X60A 3TQIA 5BXQC 5JI2E 5JSZB 5A62A 4JYPA 3OWHA 3L0OA 4AXXA 3QOYA 4U5QA 2AMJA 3OZVA 3QMVA 4TRNA 1ZD5A 3PWZA 2IYSA 3PEEA 4KVGA 4HUQA 4QJIA 2BEVA 4GM1A 1NXWA 1PSWA 1ULZA 1G5QA 2EC5A 2FQ1A 2Q7OE 4KZKA 1NF3A 4QPJC 1HE8B 4V0KA 2P7IA 1TK9A 3DHWC 1PM5A 3DG9A 3T1TA 2INGX 4HB3A 1QJCA 4WDRA 1G7RA 3OTWA 3R44A 3F0TA 2UUCM 2PXAA 2Q8PA 3CH6A 3EF1A 4LXGA 1JTFA 5GM2A 5T8KC 1MO5A 4WV3A 3J7BA 2A5DA 4PGFA 3N76A 3VVLA 5ISMA 4W9RA 4Y9DA 1V7QA 1ONBA 4HMPA 4GSKA 1J2RA 1MU5A 4C6TA 4OB8A 1BMFD 4RA9B 4IBCA 4F06A 5LJLA 3KRTA 1MJFA 4GU5A 3SZ3A 1SNYA 4CQNA 1Y8AA 2NM0A 2IRWA 3OPQA 4ITUA 2NTJA 1ZINA 1TM1E 1AOXA 2PSFA 2J8ZA 4FHFA 3FJ1A 3K1AB 1KKUA 2HCTA 5EKDA 1OTHA 1F1JA 2V8BA 2P2SA 4G1FA 4J6EA 5PNTA 2GN6A 2KM1A 3DLCA 2C8LA 3E1KA 4MQBA 5ILQA 4X6YA 4RGQA 1VJRA 3RC7A 5B36A 1PKXA 3MJCA 4M9QA 4YRNA 3RS2A 3PE3A 4DLZA 5JPCA 1PJSA 2G7ZA 3TLEA 2G9QA 2B2CA 1NBEA 2XMCA 1RAEA 1U0TA 3AZQA 4AK9A 1TGUA 1HNZM 3N2NA 3T7DA 1NNI1 3EVBA 3IHLA 4FX2A 4V0LA 3RS3A 2VP2A 2A84A 3K09C 1CIPA 4N9QA 4TZTA 1SVKA 4LJYA 4S04A 1V6SA 4LXIA 2IS1A 3O3NB 1MW9X 1X2EA 4IINA 2HBRA 3A10A 4MWZA 3TD9A 9LDTA 1N0VC 4D4HA 1MC1A 3E05A 3D4PA 5FAKA 5JNRA 2IOFA 3RTAA 2EP7A 2PM8A 3KKLA 1KP3A 3HBAA 1PEYA 1CRQA 3PC3A 3V9PA 4AJ4A 3I4VA 1B8OA 5KO2A 5LYYA 2LP4Y 3I52A 3IAM6 1VPDA 1XFDA 1FUIA 2YZKA 4YRMA 721PA 3DQQA 1JH9A 2CCKA 1C3EA 2REOA 1SQFA 4HMQA 2VTBA 2F43B 1AM4D 3RS0A 3IEIA 3NKVA 5FPSA 3VR2A 4C05A 4DGQA 1G21A 3KOXE 1TUGA 4ZYLA 2C7RA 1QQ7A 4BLQA 4YV7A 1AB6A 5B58C 1FE8A 3DT8A 4DB2A 1BIFA 2I9PA 3GXBA 4KJXA 2YC4C 1RXYA 1U1FA 3DAGA 5B58T 4BAGA 4A0QA 1IY8A 3HJHA 4DR5M 4MJ7A 3F7OA 1XHLA 3LO8A 1EUDA 1YB5A 3B7ZA 4OG2A 4WBNF 2IGTA 4ZC1A 4N6NA 1E61A 1O89A 4XYLA 1ZFNA 1NQUA 4J0GA 5EIFA 2IYZA 3Q9LA 3W8DA 1USIA 2YMPA 4UFOA 2FEWB 3ULKA 4DR1B 2WF5A 5AIAA 2D3WA 3I2IA 4GYWA 5LZ4A 1XQYA 3OCUA 1BQEA 1V41E 2Q1XA 1K9VF 4CL0A 4FYVA 2K4MA 2DF8A 4G4JA 4RGYA 5BW5A 2MYNA 4IVNA 1V6AA 3QW2A 4X8LA 1Z2PX 5C35A 1VPLA 3VR3D 2C78A 1JDPA 4YRQA 1WUKS 3MQFA 2FOIC 2VPWA 3EGXA 2XGSA 1L4EA 5HTOA 1KBZA 4NPAA 2PXHA 1PGOA 1KRWA 1TQ4A 4H6XA 4LHVA 1JXOA 4MV3A 3SE7A 2CW5A 3B51X 4BLSA 3KSZO 4LKRA 1OKSA 1JXQA 3H8JA 4ARAA 3OPNA 3DKKA 1TL7C 4A3VB 3E5RA 2FUNB 1NFQA 4NH0A 3AERA 1LJ8A 4FKMA 5E38A 2C5AA 3V48A 3SYTA 5FCDA 3IT0A 1G3MA 2ZT8A 4URHA 4YJ3B 2AKAB 2QV0A 4QYIB 3DR3A 1O8BA 4D42A 2J59A 4PINA 3IMGA 4N0MA 1JFSA 5DYGA 5EPEA 2O07A 3BWEA 3NIWA 4IOKA 4BP9A 1XXLA 5K8TA 1UBMS 1H2AS 5AXBA 4B87A 1E58A 3M49A 5EJAA 3CV3A 3DQPA 3TLJA 5MFZA 3WLLA 2A78A 3EDMA 3GO4A 3TSYA 4KKVA 4FFPA 3TCKA 1P2SA 1SOMA 2YIVX 3ZZMA 1U0BB 3BCHA 1XEWY 2BMEA 3EDCA 4LW8A 1KI1A 4CIXA 4ER6A 5IT0A 3SZUA 4TZ0A 3DEIA 3GLRA 4JLAA 1FSSA 1UQTA 4TV8A 3ZY5A 4JI4M 1GLNA 2IITA 2DJIA 1VSTA 3L40A 3TINA 2HWUA 1M75A 4EJMA 1Q1AA 3F8TA 1L2DA 4GF5A 4G1EB 2BH9A 2O3SA 5TS3A 5JBIA 2D6FA 1K0FA 5FJJA 1CT9A 2XDQA 5ELMA 3MUFA 3BORA 2GYVA 1N75A 2V7TA 1SVLA 2BBOA 1ONOA 3UJ7A 1WETA 4FWIB 3N59A 4JLWA 4P83A 2X23A 4AIRA 4K88A 3HYLA 2PUGA 1EVLA 5TXGA 4B3BA 3TXXA 1PDVA 3O31A 2JGFA 4BNZA 5CJ2A 2Y71A 3ZVNA 3HFJA 3NCHA 1YRWA 5CT4A 4JBIA 4LNUB 1KZ1A 4BB5A 4F56A 3U37A 4EMTA 1G8HA 1L5QA 4FHCA 4NRDA 2WWIA 4L5BA 4OKNA 1Y3FE 1ZY2A 2WJ3A 4J3FA 4FINA 3HYCA 4NSNA 4YUAA 2ZRCA 3KSUA 1G3RA 4BNGA 3CJRA 3I6MA 5HK8A 3LLSA 5GJBA 2OM2A 2IF0A 1CUUA 2JFUA 3IAEA 4JLSA 5LQMA 2I7PA 4N3CA 3QLVA 1YZVA 4G63A 3OP4A 2VXOA 4BS9A 2C2XA 4DVJA 5L6LB 3Q15C 4F72A 4D9EA 1ISMA 1YZUA 3ZZNA 5DHRA 1K7XB 5CLGA 5CB8A 1EUCB 1OAAA 2GBCA 3KXDA 2G40A 2CLMB 5IWCA 4KLZA 1GCIA 2PUDA 1EX9A 5DASA 1UJCA 4F5WA 2QL6A 5BNIA 2CVQA 4G0ZA 3I39X 4ILKA 4RCVA 4PYRA 1LBIA 3V33A 5KTYA 5K2MA 3SEZA 2ODEA 2PWYA 2ZJ6A 4LBYA 5TPWA 4CF7A 4FX5A 1R66A 4RF0A 3CR8A 4U6QA 4CQJA 1XU4A 3EVFA 4B7UA 2XMPA 4ENTA 4ZVMA 3HB7A 2ZAMA 1GJSA 1Z2EA 2I6UA 5B6IA 4TYWA 2NUTB 2SKEA 5JAMA 5ED0A 1GN8A 1DG1G 1TMKA 4OOFA 5LQCA 2PE5A 4HF7A 3NV9A 1Z26A 4L74A 4XJXA 1GP2A 3BULA 1DKRA 3BKWA 4B5KA 2PJZA 4OBXA 4AUNA 5ALJA 2ACEA 4J07A 1GQRA 5JY1A 3D6JA 1JLLA 4RAQA 1KVUA 1JR3D 1O77A 2WKSA 3EB9A 4QGBA 1N5DA 3U4DA 2DAEA 3WGZA 3F71A 4Y0NA 1TNDA 4R2MA 4O63O 1TA9A 3MYYA 3HXMA 4DNQA 4UMVA 1AZSC 1XA0A 5EJ9A 2W2QA 2QTHA 1WMAA 4FXPA 1CY4A 1U8AA 3A14A 4U7WA 5DTQA 1MOQA 4ZOEA 4PR0A 3UAOA 5JZ9A 1XBTA 3GG2A 3GA0A 4UTPA 3OM1A 4P3NA 5JD6A 3TW6A 3VYUB 3FVRA 4OGGA 3K4HA 4PONA 3KJEA 4I1YA 1QX3A 4LX8A 1SCUB 1GTZA 4OJYA 4MS4A 3K0SA 2K6GA 1P80A 4DY4A 4LZOA 5PGMA 1T1RA 2UKDA 3DDCA 5EJGA 4MYSA 3CRMA 2D2XA 4MA5A 4DT1B 2C83A 1U5CA 3X43A 2BR3A 2VDPB 3H3FA 5HKBA 2VJPA 5LP6A 3UB2A 3NHWA 1NJ6A 3IPLA 4W4TA 2R79A 4QDKA 4U3JA 4Z1MA 4RIGA 5DBIA 1DQSA 2G0TA 3TFQA 3UGQA 4QU8A 1W47A 8ABPA 2BP7B 3K0FA 1WIWA 1ZWKA 2FEPA 1HYEA 2O3RA 3JQ9C 5T6BA 2FFBA 1X39A 4FEGA 5B2ZA 2XCQA 4WZAA 5LXTF 3F98A 3QF4A 1M72A 2PQMA 1L7RA 3DNPA 1QTNA 2RH8A 1QUEA 4O8ZA 2WM9B 2QDKA 3DTVD 4ZQBA 1TRHA 2O4UX 4F3NA 3NLLA 2A30A 4QPZA 1P9NA 1C3OA 4IZIA 1G59A 3VZSA 1SOWA 4WBNB 3GLGA 2GM5A 4GPAA 1KMCA 1BXGA 3B9RA 4OQDA 3PQ7A 4EZEA 3WWCA 4Q3CA 3MGBA 2JY7A 2VWHA 2ZBFA 3H9CA 1OH7A 5BPFA 1JSLA 5ALXA 1EK0A 3NHAA 1CQIA 3AF1A 2F7SA 2XUHA 3AETB 4AW4A 5KIAA 5DF1A 3CEMA 4BNYA 4ERNA 2GVDC 1SN7A 3C6QA 3ZDXB 1V37A 2JATA 4IDAA 1NZJA 4LXUA 5CU7A 4BZZA 3SVLA 1TQ8A 1UXKA 4ML3A 3CNQS 4Y18A 1ABBA 1TAGA 3ODGA 4HP8A 3ZE0B 2QE6A 2ZB3A 2J0VA 1KDRA 3PFGA 3BQMB 4WASA 2DPYA 1DRKA 4OUDB 1SY7A 3IPRA 4FZVA