2JZ0A

Dsx_short
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 19
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz0A00
1OQYA 3B89A 3E21A 1VQ1A 2LVQD 4DBGB 1VG5A 3GLIE 2BWEA 2B3TA 2ZTDA 2EKKA 2L4FA 2QNJA 3T6PA 1ZV1A 3K9OA 1T6OA 1ZMUA 1MN3A 2EKFA 2JNHA 1SG9A 1DO0A 1VEKA 2DAKA 2L4EA 1IM2A 4HEOA 1R4GA 1PGYA 1HQYE 2RRUA 2ZTCA 3E46A 1HJPA 4Q7JA 2DAMA 1BVSA 2DZLA 2DAIA 3IHPA 1WR1B 1F4IA 1XXHE 3H4JA 1OAIA 2CP8A 4F1IA 2KNZA 2LVNC 2JY8A 2O25A 2DI0A 3MMPA 2QSFX 3LCUA 3IECA 2MR9A 2DAGA 2BWBA 2L2DA 3GLGE 1P3QQ 1TTEA 1Y8GA 2EJSA 1OKSA 2LBCA 1HT1E 2K0BX 5DFLA 1CUKA 2WZJA 1TR8A 1JR3E 1ZMVA 2OOBA 3F92A 1XB2B 1WHCA 1OTRA 2MJ5B 2DENA 4GEWA 3GLHE 1VDLA 2JY5A 3FRHA 2H5XA 1ZMWA 2HWJA 3LCVB 1C7YA 1WJ7A 1UFZA 1GO5A 3BBZA 2R0IA 2MROB 1E94E 1V92A 4R71A 4G3OA 1WIVA 1A5TA 1T43A 1WGLA 2G3QA 2LVOC 5JI2E 1AIPC 4WP2A 1IFYA 2MGWA 2JUJA 2JZ0A 1NV8A 2HAKA 1G3IA 2LVAA 2KNAA 1KYIA 2LTUA 1WGNA 1QZEA 3FE3A 4UN2B 2DKLA 1G4AE 2DHYA 3K9PA 2JY6B 3GLFE 1VEGA 1G41A 1IXSA 2OO9A 2CWBA 2LVPC 3FRIA 2JP7A 2JZ1A 2KHHA 1Q02A 2KNVA 2OOAA 4F2LA 1YLAA 1DO2A 1VEJA 2DAEA 2DNAA 2JY7A 2K9DA 1NV9A 1EFUB 2QHOB 1DV0A 1HT2E
chains in the Genus database with same CATH superfamily
3QYBA 3PVSA 3E21A 3SASA 4JI8M 4LCBA 4ZPXA 5IT9S 2LVQD 1YUBA 2UXCM 1VG5A 2L6OA 2ZTDA 3R9XB 2EKKA 4LJ6A 3T6PA 4OX9M 5FLXS 3U6DA 3U5ZB 4R7GA 3VDPA 3VKHA 4DV4M 3AKZA 3I4VA 1TH2A 4LF6M 3B74A 3J7AS 4DR1M 1R4GA 1HQYE 4IJEA 3RE8A 2EO2A 1QQWA 2BNKA 4IBKA 4LF5M 3L25A 3IHPA 2DZOB 3TWKA 3I4YA 2D7HA 4KO8A 3LVVA 1QAMA 1OAIA 1Z6TA 4GMQA 4PD2A 4CHTB 3KSXA 2LVNC 2Z4RA 3UJNA 3GLIB 2VDBB 4S12A 2JXNA 3LCUA 2LHGA 3LW5F 4L15A 2MR9A 4Z8XA 1C1KA 3FTCA 1GABA 2L2DA 1QAQA 2BJWA 1PJSA 1Z5BA 5C18A 2R44A 3KXEC 3FTFA 5EP2A 4JN6A 3IG8A 2LBCA 3Q8XA 3HHYA 1R7RA 5DFLA 1CUKA 2QCUA 2V6ZM 3PNYA 2WZJA 2V1UA 3KSJA 3FKEA 4I81A 2WSEF 3AJIB 4X65M 2V1CA 5EP4A 2FH0A 1FJGM 4B7FA 3SAWA 4GEWA 5EXPA 1H6UA 2XEPA 1ZMWA 1XXHB 2N35A 4IIWA 4QNMA 5EXTA 1TF0B 3U6EA 2Z8YM 3U61B 4GKJM 1WJ7A 2VF7A 2Y20A 4L4UA 3CF0A 1IN8A 1UFZA 3FUUA 2KZUA 1L2CA 2F5SA 3VDUA 3GLGA 1SXJB 1E94E 3AV0A 5IZ7D 1V92A 4LRSA 3A46A 1SXJE 1TDHA 3K1JA 1D2NA 2CUZA 4LJAA 2OQ4A 3VK7A 7CATA 3CTWB 2KDLA 2G3QA 5KQDA 4AG6A 3GRVA 1GJTA 2CHQA 2F5NA 3GLHA 4DV5M 1OIPA 4XBOA 2DWLA 2G5GX 4AKHA 2JUJA 5KPTA 1NNJA 2LXEA 1NV8A 1SXJC 3K92A 2GQFA 1KSFX 3FYCA 1N32M 3K8ZA 1R2YA 1OAOC 2LTUA 2I7PA 4NRVA 3KS8A 3GPUA 5ITQA 1XMOM 2LH0A 1W5SA 3E4RA 4NSRA 1R6BX 3MJ5A 1TGUA 4NXMM 3PFIA 1IXSA 4JI6M 1VDDA 2X8AA 1J5EM 1JR3A 3KOYE 3C3EA 2JZ1A 4BBAA 1IQPA 2FS1A 4FW9A 2C9CA 4IBBA 1YLAA 4DV7M 5F3WA 3TPZA 3HX3A 4L6V6 5FTNA 5LMUM 4JV5M 1QAOA 1J7KA 4MGHA 1EFUB 1UM8A 4YY3M 4WURA 4X66M 2ZM6M 4MM3B 5ITYA 1VQ1A 3FUVA 4DBGB 4HLQA 3DOAA 3GLFB 2VQEM 2B3TA 3U60A 1EE8A 2XZUA 1Q39A 4D80A 1IY0A 3LVWA 2ZAMA 3EIEA 1T6OA 2C96A 4TUWA 1ZMUA 4MGYE 3U6OA 2APLA 1N77A 4B3MM 2JNHA 1SG9A 4IBFA 5A2QS 2DAKA 1IBKM 1S3SA 5EXXA 3L26A 3SC3A 2RRUA 3E46A 4FCTA 3AFHA 3DZDA 4FVMA 2OPFA 2Z3XA 2DZLA 5EJCA 3KS4A 4PDIA 2XF3A 4JI5M 1QZMA 1WR1B 1F4IA 1GVNA 2YNMD 3FUXA 5FTMA 1DGBA 2K47A 1XNQM 3DFZA 3FUWA 4F1IA 3GPXA 1IN6A 2KNZA 3VK8A 2YR0A 1ORYB 2DI0A 5ITTA 3UMMA 2XSZD 4JI7M 4K0KM 4AKGA 5GKNA 2BWBA 2CRUA 3HU3A 2XFSA 4G4QA 1P3QQ 1TTEA 4G4RA 1PJJA 2Y0QA 3FTEA 1N78A 3D8BA 1TH3A 3J80S 4B08A 3T1HM 2KRUA 4GKKM 1JR3E 3HY5A 2QPAA 2HL7A 2RGHA 4KT0F 4RF0A 3U6QA 4KLNA 3TQSA 3GQ3A 1Q3CA 2FFJA 4QHSA 3SHFA 2X4AA 3SYKA 1VDLA 3FRHA 3LCVB 2H5XA 1QVRA 2HWJA 2I7NA 3KOZE 1C7YA 1G71A 3RFWA 3HHZA 3NBIA 1RU3A 3IG5A 1OFHA 4GC5A 4LF4M 1D0LA 3J81S 2UUAM 3NWLA 4B3TM 4AZFA 1JQJC 5LMNM 2KXEA 3ILKA 3HJQA 5FTKA 5EQTA 4FWHA 3MHVC 2MH8A 2Z4SA 3HZJA 4G3OA 4IJFA 3SAUA 1HR0M 4CGYB 2LVOC 1V33A 3DA1A 2R6FA 1JR3D 3HHXA 3L27A 3KW6A 4I8OA 1AIPC 4CISA 1DGGA 3CF6E 1QUSA 2MGWA 1IFYA 4AG5A 3U6PA 3HU1A 1G3IA 4Z6YA 4OVZB 3B7ZA 3TE6A 2F5OA 2LVAA 4DR7M 4GRIA 4MGKE 5JI3E 4DV6M 1KYIA 1WGNA 4II7A 3FE3A 2BJVA 4UN2B 1XWIA 1IN7A 4JI3M 4A3VB 2K6BA 2D7GA 2QQ8A 1G41A 2XSZA 2OO9A 2AHMA 2C5RA 4KHPM 2CHGA 4L78A 1AUAA 3THGA 1XC8A 2KHHA 4AW4A 3CF2A 1Q02A 5BPVA 5E26A 1XMQM 1L1TA 1NY6A 2OOAA 4M9XA 1DGHA 1QUTA 3GP1A 4DV3M 4LZZA 1DO2A 1VEJA 3ZCBB 4NRWA 4JYAM 2DWZB 2R4JA 2K9DA 3BOSA 4IBJA 3T38A 3GO8A 4LJ9A 5DYIA 2KZSA 3GPPA 2QHOB 4KODA 3ZQJA 2J5YA 3JAMS 1DV0A 1HT2E 2CFOA 3B89A 2R45A 4PT5A 1Z59A 2R62A 4DV2M 4LJ8A 4QOZC 2UUBM 1NY5A 2L4FA 2L7HA 2QENA 3GRYA 3KOWE 2ZBKB 4PCZA 4G4OA 4G4NA 4GH9A 3SATA 3K9OA 2O5RA 1GL6A 1D0MA 2QBYA 2EKFA 3V76A 1J09A 4MGZE 3KFUG 1ZAEA 4FWDA 1IM2A 3MK6A 3A42A 2C98A 1PGYA 5KPRA 1HJPA 3QWLA 2DAMA 3A98B 1BVSA 1Q3BA 4P17A 2CV1A 2DAIA 3UZUA 4DUZM 3L28A 1QYRA 3C3DA 2VIIA 1DGFA 3TWLA 5KPZA 2WSFF 4XK8F 1T3TA 4Y28F 3H4JA 3KP0E 3SMPA 3TWMA 3KP1E 3UGJA 2J7OA 2VF8A 4B7GA 3U5ZA 3MMPA 2XLJA 4L16A 2DZNB 4GITA 3IECA 4FCVA 2DAGA 3EIHA 3GLGB 2R4EA 4REZA 3LMMA 1ZQ9A 3GLGE 1Y8GA 4M0DA 4LJ5A 3KOXE 4PDGA 2FNAA 1HT1E 4LG2A 1GJSA 1E9RA 1IBLM 1ZMVA 3W0LB 2OOBA 1XB2B 3M7GA 1WHCA 4AKIA 2UU9M 1NO1A 2C9OA 3GLHB 1OTRA 5EP3A 5FTJA 2DWNA 2F5QA 2MJ5B 2DENA 3FD9A 2L7IA 3GLHE 2JY5A 4LFAM 3GLIA 2EUCA 3B7QA 4HL4A 1LTMA 2R65A 2RGOA 1GO5A 2Y0TA 1R5LA 3E9SA 3BBZA 3J7BA 2R0IA 2MROB 1EIJA 1PJIA 2EA0A 5ITXA 3AOGA 4B3RM 4JXJA 1OIZA 3VFDA 1K3WA 2HHHM 1WIVA 1IN5A 4NXNM 3BXWA 1A5TA 1T43A 4QNRA 1IXRC 1JB0F 2ZAOA 1IXSB 3HWSA 4GC9A 4RF1A 3W68A 2DWMA 1MJGM 1N34M 4QHTA 3W0FA 8CATA 1FNNA 2JZ0A 4MH0E 3T15A 4JI2M 1XXHA 3I04M 4ANRA 3U61A 3FTDA 3AOEC 1G8PA 3GQ4A 3H4MA 4JI0M 5EP1A 2KNAA 1MX0A 1QZEA 2KA6B 3VKGA 2CE7A 1SXJA 3LQRA 3ZC7B 5EXSA 1G4AE 2H1RA 2LHCA 4IBDA 2D7EA 3W67A 3K9PA 1X37A 5FTLA 1G59A 2CV0A 3JR5A 1QDRA 4YHHM 4AI6A 2P5TA 4G6ZA 1NVMA 2LWXA 3U60B 1IN4A 3SAVA 2CWBA 3J27B 4FD2A 2LVPC 3FRIA 3PNVA 5E6JA 2JP7A 4LRTA 3SFZA 2C99A 4GHLA 2KNVA 4F2LA 3HU2A 2R46A 4DR2M 2XFTA 3QAUA 2CV2A 3AL0C 3HGIA 2DAEA 2DNAA 4NOOB 2JY7A 1PJQA 2M60A 1NV9A 2YFQA 5BR8M 4BB9A 2GNOA 1HNWM 3VLFB 1L1ZA 1OQYA 2VQFM 3QYEA 3U6SA 4ITQA 1YSYA 1N75A 4LZJA 3C58A 3WHLA 4GHAA 2W82A 3U6CA 3GLIE 2BWEA 3SBJA 2DXIA 3GQ5A 4MGIE 1D0KA 2QNJA 2ZANA 3PXGA 4X64M 3GRRA 1ZV1A 2F4VM 4IBCA 1MN3A 1Z5AA 1OFIA 1W5TA 4LJ4A 1IY2A 5DYGA 5FSWA 1DO0A 1GL7A 1VEKA 2KW0A 2L4EA 4MB7A 4HEOA 5ITXE 1K3XA 2HKJA 4NC6A 1L2DA 4DR5M 2ZTCA 1I94M 3GRUA 3OTOM 4R3DA 4IBGA 4DR3M 4Q7JA 1L2BA 4LGMA 4CIZA 5KQ8A 1HNZM 3L2AA 2F5PA 2JA2A 4JI4M 5L8RF 1NJFA 4M9SA 1XXHE 2Y21A 2WSCF 3M6AA 2XH9A 3GLFA 4LF8M 2CP8A 2RKOA 3SHGB 2JY8A 2O25A 3GPYA 4LF9M 1I4WA 4FCWA 3U6LA 2QSFX 1IY1A 5IREB 1KFVA 2UUCM 4JI1M 1Z5CA 2LNHC 3B9PA 3L29A 2Q2EB 2QZ4A 3JR4A 2G8LA 4CJ6A 4D82A 2EJSA 1OKSA 2L09A 3HJSA 4LFBM 2DHRA 5ITUA 2K0BX 3TL4X 4RNAA 4W5WA 1TR8A 1NNUC 1NJGA 3F92A 1GLNA 4LFCM 3HJ8A 3I01M 4LGYA 1XNRM 2O01F 1PM5A 4FWGA 2R18A 3K2LA 4XGIA 4GIPA 3UK6A 2A5YB 1MU5A 2KRKA 4OW0A 3FYDA 4IBIA 4QOSA 4RKUF 4OU7A 1R2ZA 4EIWA 2CEAA 5ITRA 3AOEA 3LQQA 1SXJD 1QDTA 2DVWB 3Q8GA 4B3SM 1PRBA 1N33M 1TH4A 3T1YM 4B7HA 1E32A 4P16A 2E5LM 1LV7A 3J2PB 3SARA 1L8QA 3HKPA 2NQ8C 3HHWA 5KO3A 4R71A 2X49A 4AQYM 1N36M 1NHGC 4LF7M 2XGNA 1WGLA 2M5ZA 4X62M 3A45A 5JI2E 1YE9A 3D8LA 1V34A 5C1BA 2XZFA 1TDZA 3ZH9B 4WP2A 1IBMM 3I51A 3R8FA 3M0EA 2HAKA 4IBEA 4NL4H 2FE8A 2KEBA 1DGHB 4M9ZA 2UXDM 4LJ7A 3SYLA 3C9PA 3RGSA 1HQCA 2Z7JA 3SMSA 2UXBM 3WHKA 1E9SA 1WXQA 2FOIC 4I4LA 4WW0A 4BLCA 3RGPA 1HNXM 2ERCA 1IXZA 1K82A 2HCBA 1NSFA 2DKLA 2DHYA 1PJTA 4DUYM 2JY6B 2JWSA 2YQZA 3KDSE 1VEGA 5DNYA 3GLFE 3U6MA 3KVWA 4DR4M 4DV1M 1NHWC 3CGWA 3FUTA 1GKIA 4NSOB 2QP9X 3NBXX 5H37D 4LY6A 4D81A 3B7NA 2QBYB 5IWAM 4OVZA 4I5SA 1QANA 4DR6M 2J7NA 1XHBA 2CHVA 1OJLA 4L8RC 4M0WA 4DV0M
chains in the Genus database with same CATH topology
1OQYA 3B89A 3E21A 1VQ1A 2LVQD 4DBGB 1VG5A 3GLIE 2BWEA 2B3TA 2ZTDA 2EKKA 2L4FA 2QNJA 3T6PA 1ZV1A 3K9OA 1T6OA 1ZMUA 1MN3A 2EKFA 2JNHA 1SG9A 1DO0A 1VEKA 2DAKA 2L4EA 1IM2A 4HEOA 1R4GA 1PGYA 1HQYE 2RRUA 2ZTCA 3E46A 1HJPA 4Q7JA 2DAMA 1BVSA 2DZLA 2DAIA 3IHPA 1WR1B 1F4IA 1XXHE 3H4JA 1OAIA 2CP8A 4F1IA 2KNZA 2LVNC 2JY8A 2O25A 2DI0A 3MMPA 2QSFX 3LCUA 3IECA 2MR9A 2DAGA 2BWBA 2L2DA 3GLGE 1P3QQ 1TTEA 1Y8GA 2EJSA 1OKSA 2LBCA 1HT1E 2K0BX 5DFLA 1CUKA 2WZJA 1TR8A 1JR3E 1ZMVA 2OOBA 3F92A 1XB2B 1WHCA 1OTRA 2MJ5B 2DENA 4GEWA 3GLHE 1VDLA 2JY5A 3FRHA 2H5XA 1ZMWA 2HWJA 3LCVB 1C7YA 1WJ7A 1UFZA 1GO5A 3BBZA 2R0IA 2MROB 1E94E 1V92A 4R71A 4G3OA 1WIVA 1A5TA 1T43A 1WGLA 2G3QA 2LVOC 5JI2E 1AIPC 4WP2A 1IFYA 2MGWA 2JUJA 2JZ0A 1NV8A 2HAKA 1G3IA 2LVAA 2KNAA 1KYIA 2LTUA 1WGNA 1QZEA 3FE3A 4UN2B 2DKLA 1G4AE 2DHYA 3K9PA 2JY6B 3GLFE 1VEGA 1G41A 1IXSA 2OO9A 2CWBA 2LVPC 3FRIA 2JP7A 2JZ1A 2KHHA 1Q02A 2KNVA 2OOAA 4F2LA 1YLAA 1DO2A 1VEJA 2DAEA 2DNAA 2JY7A 2K9DA 1NV9A 1EFUB 2QHOB 1DV0A 1HT2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  3B89 A;  3E21 A;  1VQ1 A;  2LVQ D;  4DBG B;  1VG5 A;  3GLI E;  2BWE A;  2B3T A;  2ZTD A;  2EKK A;  2L4F A;  2QNJ A;  3T6P A;  1ZV1 A;  3K9O A;  1T6O A;  1ZMU A;  1MN3 A;  2EKF A;  2JNH A;  1SG9 A;  1DO0 A;  1VEK A;  2DAK A;  2L4E A;  1IM2 A;  4HEO A;  1R4G A;  1PGY A;  1HQY E;  2RRU A;  2ZTC A;  3E46 A;  1HJP A;  4Q7J A;  2DAM A;  1BVS A;  2DZL A;  2DAI A;  3IHP A;  1WR1 B;  1F4I A;  1XXH E;  3H4J A;  1OAI A;  2CP8 A;  4F1I A;  2KNZ A;  2LVN C;  2JY8 A;  2O25 A;  2DI0 A;  3MMP A;  2QSF X;  3LCU A;  3IEC A;  2MR9 A;  2DAG A;  2BWB A;  2L2D A;  3GLG E;  1P3Q Q;  1TTE A;  1Y8G A;  2EJS A;  1OKS A;  2LBC A;  1HT1 E;  2K0B X;  5DFL A;  1CUK A;  2WZJ A;  1TR8 A;  1JR3 E;  1ZMV A;  2OOB A;  3F92 A;  1XB2 B;  1WHC A;  1OTR A;  2MJ5 B;  2DEN A;  4GEW A;  3GLH E;  1VDL A;  2JY5 A;  3FRH A;  2H5X A;  1ZMW A;  2HWJ A;  3LCV B;  1C7Y A;  1WJ7 A;  1UFZ A;  1GO5 A;  3BBZ A;  2R0I A;  2MRO B;  1E94 E;  1V92 A;  4R71 A;  4G3O A;  1WIV A;  1A5T A;  1T43 A;  1WGL A;  2G3Q A;  2LVO C;  5JI2 E;  1AIP C;  4WP2 A;  1IFY A;  2MGW A;  2JUJ A;  2JZ0 A;  1NV8 A;  2HAK A;  1G3I A;  2LVA A;  2KNA A;  1KYI A;  2LTU A;  1WGN A;  1QZE A;  3FE3 A;  4UN2 B;  2DKL A;  1G4A E;  2DHY A;  3K9P A;  2JY6 B;  3GLF E;  1VEG A;  1G41 A;  1IXS A;  2OO9 A;  2CWB A;  2LVP C;  3FRI A;  2JP7 A;  2JZ1 A;  2KHH A;  1Q02 A;  2KNV A;  2OOA A;  4F2L A;  1YLA A;  1DO2 A;  1VEJ A;  2DAE A;  2DNA A;  2JY7 A;  2K9D A;  1NV9 A;  1EFU B;  2QHO B;  1DV0 A;  1HT2 E; 
#chains in the Genus database with same CATH topology
 3QYB A;  3PVS A;  3E21 A;  3SAS A;  4JI8 M;  4LCB A;  4ZPX A;  5IT9 S;  2LVQ D;  1YUB A;  2UXC M;  1VG5 A;  2L6O A;  2ZTD A;  3R9X B;  2EKK A;  4LJ6 A;  3T6P A;  4OX9 M;  5FLX S;  3U6D A;  3U5Z B;  4R7G A;  3VDP A;  3VKH A;  4DV4 M;  3AKZ A;  3I4V A;  1TH2 A;  4LF6 M;  3B74 A;  3J7A S;  4DR1 M;  1R4G A;  1HQY E;  4IJE A;  3RE8 A;  2EO2 A;  1QQW A;  2BNK A;  4IBK A;  4LF5 M;  3L25 A;  3IHP A;  2DZO B;  3TWK A;  3I4Y A;  2D7H A;  4KO8 A;  3LVV A;  1QAM A;  1OAI A;  1Z6T A;  4GMQ A;  4PD2 A;  4CHT B;  3KSX A;  2LVN C;  2Z4R A;  3UJN A;  3GLI B;  2VDB B;  4S12 A;  2JXN A;  3LCU A;  2LHG A;  3LW5 F;  4L15 A;  2MR9 A;  4Z8X A;  1C1K A;  3FTC A;  1GAB A;  2L2D A;  1QAQ A;  2BJW A;  1PJS A;  1Z5B A;  5C18 A;  2R44 A;  3KXE C;  3FTF A;  5EP2 A;  4JN6 A;  3IG8 A;  2LBC A;  3Q8X A;  3HHY A;  1R7R A;  5DFL A;  1CUK A;  2QCU A;  2V6Z M;  3PNY A;  2WZJ A;  2V1U A;  3KSJ A;  3FKE A;  4I81 A;  2WSE F;  3AJI B;  4X65 M;  2V1C A;  5EP4 A;  2FH0 A;  1FJG M;  4B7F A;  3SAW A;  4GEW A;  5EXP A;  1H6U A;  2XEP A;  1ZMW A;  1XXH B;  2N35 A;  4IIW A;  4QNM A;  5EXT A;  1TF0 B;  3U6E A;  2Z8Y M;  3U61 B;  4GKJ M;  1WJ7 A;  2VF7 A;  2Y20 A;  4L4U A;  3CF0 A;  1IN8 A;  1UFZ A;  3FUU A;  2KZU A;  1L2C A;  2F5S A;  3VDU A;  3GLG A;  1SXJ B;  1E94 E;  3AV0 A;  5IZ7 D;  1V92 A;  4LRS A;  3A46 A;  1SXJ E;  1TDH A;  3K1J A;  1D2N A;  2CUZ A;  4LJA A;  2OQ4 A;  3VK7 A;  7CAT A;  3CTW B;  2KDL A;  2G3Q A;  5KQD A;  4AG6 A;  3GRV A;  1GJT A;  2CHQ A;  2F5N A;  3GLH A;  4DV5 M;  1OIP A;  4XBO A;  2DWL A;  2G5G X;  4AKH A;  2JUJ A;  5KPT A;  1NNJ A;  2LXE A;  1NV8 A;  1SXJ C;  3K92 A;  2GQF A;  1KSF X;  3FYC A;  1N32 M;  3K8Z A;  1R2Y A;  1OAO C;  2LTU A;  2I7P A;  4NRV A;  3KS8 A;  3GPU A;  5ITQ A;  1XMO M;  2LH0 A;  1W5S A;  3E4R A;  4NSR A;  1R6B X;  3MJ5 A;  1TGU A;  4NXM M;  3PFI A;  1IXS A;  4JI6 M;  1VDD A;  2X8A A;  1J5E M;  1JR3 A;  3KOY E;  3C3E A;  2JZ1 A;  4BBA A;  1IQP A;  2FS1 A;  4FW9 A;  2C9C A;  4IBB A;  1YLA A;  4DV7 M;  5F3W A;  3TPZ A;  3HX3 A;  4L6V 6;  5FTN A;  5LMU M;  4JV5 M;  1QAO A;  1J7K A;  4MGH A;  1EFU B;  1UM8 A;  4YY3 M;  4WUR A;  4X66 M;  2ZM6 M;  4MM3 B;  5ITY A;  1VQ1 A;  3FUV A;  4DBG B;  4HLQ A;  3DOA A;  3GLF B;  2VQE M;  2B3T A;  3U60 A;  1EE8 A;  2XZU A;  1Q39 A;  4D80 A;  1IY0 A;  3LVW A;  2ZAM A;  3EIE A;  1T6O A;  2C96 A;  4TUW A;  1ZMU A;  4MGY E;  3U6O A;  2APL A;  1N77 A;  4B3M M;  2JNH A;  1SG9 A;  4IBF A;  5A2Q S;  2DAK A;  1IBK M;  1S3S A;  5EXX A;  3L26 A;  3SC3 A;  2RRU A;  3E46 A;  4FCT A;  3AFH A;  3DZD A;  4FVM A;  2OPF A;  2Z3X A;  2DZL A;  5EJC A;  3KS4 A;  4PDI A;  2XF3 A;  4JI5 M;  1QZM A;  1WR1 B;  1F4I A;  1GVN A;  2YNM D;  3FUX A;  5FTM A;  1DGB A;  2K47 A;  1XNQ M;  3DFZ A;  3FUW A;  4F1I A;  3GPX A;  1IN6 A;  2KNZ A;  3VK8 A;  2YR0 A;  1ORY B;  2DI0 A;  5ITT A;  3UMM A;  2XSZ D;  4JI7 M;  4K0K M;  4AKG A;  5GKN A;  2BWB A;  2CRU A;  3HU3 A;  2XFS A;  4G4Q A;  1P3Q Q;  1TTE A;  4G4R A;  1PJJ A;  2Y0Q A;  3FTE A;  1N78 A;  3D8B A;  1TH3 A;  3J80 S;  4B08 A;  3T1H M;  2KRU A;  4GKK M;  1JR3 E;  3HY5 A;  2QPA A;  2HL7 A;  2RGH A;  4KT0 F;  4RF0 A;  3U6Q A;  4KLN A;  3TQS A;  3GQ3 A;  1Q3C A;  2FFJ A;  4QHS A;  3SHF A;  2X4A A;  3SYK A;  1VDL A;  3FRH A;  3LCV B;  2H5X A;  1QVR A;  2HWJ A;  2I7N A;  3KOZ E;  1C7Y A;  1G71 A;  3RFW A;  3HHZ A;  3NBI A;  1RU3 A;  3IG5 A;  1OFH A;  4GC5 A;  4LF4 M;  1D0L A;  3J81 S;  2UUA M;  3NWL A;  4B3T M;  4AZF A;  1JQJ C;  5LMN M;  2KXE A;  3ILK A;  3HJQ A;  5FTK A;  5EQT A;  4FWH A;  3MHV C;  2MH8 A;  2Z4S A;  3HZJ A;  4G3O A;  4IJF A;  3SAU A;  1HR0 M;  4CGY B;  2LVO C;  1V33 A;  3DA1 A;  2R6F A;  1JR3 D;  3HHX A;  3L27 A;  3KW6 A;  4I8O A;  1AIP C;  4CIS A;  1DGG A;  3CF6 E;  1QUS A;  2MGW A;  1IFY A;  4AG5 A;  3U6P A;  3HU1 A;  1G3I A;  4Z6Y A;  4OVZ B;  3B7Z A;  3TE6 A;  2F5O A;  2LVA A;  4DR7 M;  4GRI A;  4MGK E;  5JI3 E;  4DV6 M;  1KYI A;  1WGN A;  4II7 A;  3FE3 A;  2BJV A;  4UN2 B;  1XWI A;  1IN7 A;  4JI3 M;  4A3V B;  2K6B A;  2D7G A;  2QQ8 A;  1G41 A;  2XSZ A;  2OO9 A;  2AHM A;  2C5R A;  4KHP M;  2CHG A;  4L78 A;  1AUA A;  3THG A;  1XC8 A;  2KHH A;  4AW4 A;  3CF2 A;  1Q02 A;  5BPV A;  5E26 A;  1XMQ M;  1L1T A;  1NY6 A;  2OOA A;  4M9X A;  1DGH A;  1QUT A;  3GP1 A;  4DV3 M;  4LZZ A;  1DO2 A;  1VEJ A;  3ZCB B;  4NRW A;  4JYA M;  2DWZ B;  2R4J A;  2K9D A;  3BOS A;  4IBJ A;  3T38 A;  3GO8 A;  4LJ9 A;  5DYI A;  2KZS A;  3GPP A;  2QHO B;  4KOD A;  3ZQJ A;  2J5Y A;  3JAM S;  1DV0 A;  1HT2 E;  2CFO A;  3B89 A;  2R45 A;  4PT5 A;  1Z59 A;  2R62 A;  4DV2 M;  4LJ8 A;  4QOZ C;  2UUB M;  1NY5 A;  2L4F A;  2L7H A;  2QEN A;  3GRY A;  3KOW E;  2ZBK B;  4PCZ A;  4G4O A;  4G4N A;  4GH9 A;  3SAT A;  3K9O A;  2O5R A;  1GL6 A;  1D0M A;  2QBY A;  2EKF A;  3V76 A;  1J09 A;  4MGZ E;  3KFU G;  1ZAE A;  4FWD A;  1IM2 A;  3MK6 A;  3A42 A;  2C98 A;  1PGY A;  5KPR A;  1HJP A;  3QWL A;  2DAM A;  3A98 B;  1BVS A;  1Q3B A;  4P17 A;  2CV1 A;  2DAI A;  3UZU A;  4DUZ M;  3L28 A;  1QYR A;  3C3D A;  2VII A;  1DGF A;  3TWL A;  5KPZ A;  2WSF F;  4XK8 F;  1T3T A;  4Y28 F;  3H4J A;  3KP0 E;  3SMP A;  3TWM A;  3KP1 E;  3UGJ A;  2J7O A;  2VF8 A;  4B7G A;  3U5Z A;  3MMP A;  2XLJ A;  4L16 A;  2DZN B;  4GIT A;  3IEC A;  4FCV A;  2DAG A;  3EIH A;  3GLG B;  2R4E A;  4REZ A;  3LMM A;  1ZQ9 A;  3GLG E;  1Y8G A;  4M0D A;  4LJ5 A;  3KOX E;  4PDG A;  2FNA A;  1HT1 E;  4LG2 A;  1GJS A;  1E9R A;  1IBL M;  1ZMV A;  3W0L B;  2OOB A;  1XB2 B;  3M7G A;  1WHC A;  4AKI A;  2UU9 M;  1NO1 A;  2C9O A;  3GLH B;  1OTR A;  5EP3 A;  5FTJ A;  2DWN A;  2F5Q A;  2MJ5 B;  2DEN A;  3FD9 A;  2L7I A;  3GLH E;  2JY5 A;  4LFA M;  3GLI A;  2EUC A;  3B7Q A;  4HL4 A;  1LTM A;  2R65 A;  2RGO A;  1GO5 A;  2Y0T A;  1R5L A;  3E9S A;  3BBZ A;  3J7B A;  2R0I A;  2MRO B;  1EIJ A;  1PJI A;  2EA0 A;  5ITX A;  3AOG A;  4B3R M;  4JXJ A;  1OIZ A;  3VFD A;  1K3W A;  2HHH M;  1WIV A;  1IN5 A;  4NXN M;  3BXW A;  1A5T A;  1T43 A;  4QNR A;  1IXR C;  1JB0 F;  2ZAO A;  1IXS B;  3HWS A;  4GC9 A;  4RF1 A;  3W68 A;  2DWM A;  1MJG M;  1N34 M;  4QHT A;  3W0F A;  8CAT A;  1FNN A;  2JZ0 A;  4MH0 E;  3T15 A;  4JI2 M;  1XXH A;  3I04 M;  4ANR A;  3U61 A;  3FTD A;  3AOE C;  1G8P A;  3GQ4 A;  3H4M A;  4JI0 M;  5EP1 A;  2KNA A;  1MX0 A;  1QZE A;  2KA6 B;  3VKG A;  2CE7 A;  1SXJ A;  3LQR A;  3ZC7 B;  5EXS A;  1G4A E;  2H1R A;  2LHC A;  4IBD A;  2D7E A;  3W67 A;  3K9P A;  1X37 A;  5FTL A;  1G59 A;  2CV0 A;  3JR5 A;  1QDR A;  4YHH M;  4AI6 A;  2P5T A;  4G6Z A;  1NVM A;  2LWX A;  3U60 B;  1IN4 A;  3SAV A;  2CWB A;  3J27 B;  4FD2 A;  2LVP C;  3FRI A;  3PNV A;  5E6J A;  2JP7 A;  4LRT A;  3SFZ A;  2C99 A;  4GHL A;  2KNV A;  4F2L A;  3HU2 A;  2R46 A;  4DR2 M;  2XFT A;  3QAU A;  2CV2 A;  3AL0 C;  3HGI A;  2DAE A;  2DNA A;  4NOO B;  2JY7 A;  1PJQ A;  2M60 A;  1NV9 A;  2YFQ A;  5BR8 M;  4BB9 A;  2GNO A;  1HNW M;  3VLF B;  1L1Z A;  1OQY A;  2VQF M;  3QYE A;  3U6S A;  4ITQ A;  1YSY A;  1N75 A;  4LZJ A;  3C58 A;  3WHL A;  4GHA A;  2W82 A;  3U6C A;  3GLI E;  2BWE A;  3SBJ A;  2DXI A;  3GQ5 A;  4MGI E;  1D0K A;  2QNJ A;  2ZAN A;  3PXG A;  4X64 M;  3GRR A;  1ZV1 A;  2F4V M;  4IBC A;  1MN3 A;  1Z5A A;  1OFI A;  1W5T A;  4LJ4 A;  1IY2 A;  5DYG A;  5FSW A;  1DO0 A;  1GL7 A;  1VEK A;  2KW0 A;  2L4E A;  4MB7 A;  4HEO A;  5ITX E;  1K3X A;  2HKJ A;  4NC6 A;  1L2D A;  4DR5 M;  2ZTC A;  1I94 M;  3GRU A;  3OTO M;  4R3D A;  4IBG A;  4DR3 M;  4Q7J A;  1L2B A;  4LGM A;  4CIZ A;  5KQ8 A;  1HNZ M;  3L2A A;  2F5P A;  2JA2 A;  4JI4 M;  5L8R F;  1NJF A;  4M9S A;  1XXH E;  2Y21 A;  2WSC F;  3M6A A;  2XH9 A;  3GLF A;  4LF8 M;  2CP8 A;  2RKO A;  3SHG B;  2JY8 A;  2O25 A;  3GPY A;  4LF9 M;  1I4W A;  4FCW A;  3U6L A;  2QSF X;  1IY1 A;  5IRE B;  1KFV A;  2UUC M;  4JI1 M;  1Z5C A;  2LNH C;  3B9P A;  3L29 A;  2Q2E B;  2QZ4 A;  3JR4 A;  2G8L A;  4CJ6 A;  4D82 A;  2EJS A;  1OKS A;  2L09 A;  3HJS A;  4LFB M;  2DHR A;  5ITU A;  2K0B X;  3TL4 X;  4RNA A;  4W5W A;  1TR8 A;  1NNU C;  1NJG A;  3F92 A;  1GLN A;  4LFC M;  3HJ8 A;  3I01 M;  4LGY A;  1XNR M;  2O01 F;  1PM5 A;  4FWG A;  2R18 A;  3K2L A;  4XGI A;  4GIP A;  3UK6 A;  2A5Y B;  1MU5 A;  2KRK A;  4OW0 A;  3FYD A;  4IBI A;  4QOS A;  4RKU F;  4OU7 A;  1R2Z A;  4EIW A;  2CEA A;  5ITR A;  3AOE A;  3LQQ A;  1SXJ D;  1QDT A;  2DVW B;  3Q8G A;  4B3S M;  1PRB A;  1N33 M;  1TH4 A;  3T1Y M;  4B7H A;  1E32 A;  4P16 A;  2E5L M;  1LV7 A;  3J2P B;  3SAR A;  1L8Q A;  3HKP A;  2NQ8 C;  3HHW A;  5KO3 A;  4R71 A;  2X49 A;  4AQY M;  1N36 M;  1NHG C;  4LF7 M;  2XGN A;  1WGL A;  2M5Z A;  4X62 M;  3A45 A;  5JI2 E;  1YE9 A;  3D8L A;  1V34 A;  5C1B A;  2XZF A;  1TDZ A;  3ZH9 B;  4WP2 A;  1IBM M;  3I51 A;  3R8F A;  3M0E A;  2HAK A;  4IBE A;  4NL4 H;  2FE8 A;  2KEB A;  1DGH B;  4M9Z A;  2UXD M;  4LJ7 A;  3SYL A;  3C9P A;  3RGS A;  1HQC A;  2Z7J A;  3SMS A;  2UXB M;  3WHK A;  1E9S A;  1WXQ A;  2FOI C;  4I4L A;  4WW0 A;  4BLC A;  3RGP A;  1HNX M;  2ERC A;  1IXZ A;  1K82 A;  2HCB A;  1NSF A;  2DKL A;  2DHY A;  1PJT A;  4DUY M;  2JY6 B;  2JWS A;  2YQZ A;  3KDS E;  1VEG A;  5DNY A;  3GLF E;  3U6M A;  3KVW A;  4DR4 M;  4DV1 M;  1NHW C;  3CGW A;  3FUT A;  1GKI A;  4NSO B;  2QP9 X;  3NBX X;  5H37 D;  4LY6 A;  4D81 A;  3B7N A;  2QBY B;  5IWA M;  4OVZ A;  4I5S A;  1QAN A;  4DR6 M;  2J7N A;  1XHB A;  2CHV A;  1OJL A;  4L8R C;  4M0W A;  4DV0 M; 
#chains in the Genus database with same CATH homology
 1OQY A;  3B89 A;  3E21 A;  1VQ1 A;  2LVQ D;  4DBG B;  1VG5 A;  3GLI E;  2BWE A;  2B3T A;  2ZTD A;  2EKK A;  2L4F A;  2QNJ A;  3T6P A;  1ZV1 A;  3K9O A;  1T6O A;  1ZMU A;  1MN3 A;  2EKF A;  2JNH A;  1SG9 A;  1DO0 A;  1VEK A;  2DAK A;  2L4E A;  1IM2 A;  4HEO A;  1R4G A;  1PGY A;  1HQY E;  2RRU A;  2ZTC A;  3E46 A;  1HJP A;  4Q7J A;  2DAM A;  1BVS A;  2DZL A;  2DAI A;  3IHP A;  1WR1 B;  1F4I A;  1XXH E;  3H4J A;  1OAI A;  2CP8 A;  4F1I A;  2KNZ A;  2LVN C;  2JY8 A;  2O25 A;  2DI0 A;  3MMP A;  2QSF X;  3LCU A;  3IEC A;  2MR9 A;  2DAG A;  2BWB A;  2L2D A;  3GLG E;  1P3Q Q;  1TTE A;  1Y8G A;  2EJS A;  1OKS A;  2LBC A;  1HT1 E;  2K0B X;  5DFL A;  1CUK A;  2WZJ A;  1TR8 A;  1JR3 E;  1ZMV A;  2OOB A;  3F92 A;  1XB2 B;  1WHC A;  1OTR A;  2MJ5 B;  2DEN A;  4GEW A;  3GLH E;  1VDL A;  2JY5 A;  3FRH A;  2H5X A;  1ZMW A;  2HWJ A;  3LCV B;  1C7Y A;  1WJ7 A;  1UFZ A;  1GO5 A;  3BBZ A;  2R0I A;  2MRO B;  1E94 E;  1V92 A;  4R71 A;  4G3O A;  1WIV A;  1A5T A;  1T43 A;  1WGL A;  2G3Q A;  2LVO C;  5JI2 E;  1AIP C;  4WP2 A;  1IFY A;  2MGW A;  2JUJ A;  2JZ0 A;  1NV8 A;  2HAK A;  1G3I A;  2LVA A;  2KNA A;  1KYI A;  2LTU A;  1WGN A;  1QZE A;  3FE3 A;  4UN2 B;  2DKL A;  1G4A E;  2DHY A;  3K9P A;  2JY6 B;  3GLF E;  1VEG A;  1G41 A;  1IXS A;  2OO9 A;  2CWB A;  2LVP C;  3FRI A;  2JP7 A;  2JZ1 A;  2KHH A;  1Q02 A;  2KNV A;  2OOA A;  4F2L A;  1YLA A;  1DO2 A;  1VEJ A;  2DAE A;  2DNA A;  2JY7 A;  2K9D A;  1NV9 A;  1EFU B;  2QHO B;  1DV0 A;  1HT2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...