2JZ0A

Dsx_short
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Protein doublesex
total genus 19
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz0A00
1DO2A 1OTRA 3B89A 3GLHE 1ZMWA 2KHHA 3GLFE 1VDLA 3GLGE 2LVOC 1OQYA 1ZMVA 1CUKA 1GO5A 1KYIA 1G3IA 3IHPA 2EJSA 4F2LA 1NV9A 1XB2B 4G3OA 2WZJA 2LVNC 1WR1B 2DAIA 3E21A 1T6OA 1T43A 3K9PA 2LVQD 2RRUA 2O25A 1BVSA 2DZLA 3E46A 1IXSA 2MROB 3FRHA 2QHOB 1ZV1A 2EKFA 2OOBA 2R0IA 1Y8GA 3F92A 3T6PA 3BBZA 2DAEA 4GEWA 1F4IA 2KNVA 1V92A 2JP7A 1QZEA 1HT1E 2L4EA 1IM2A 2CWBA 3LCVB 1EFUB 4HEOA 2LVAA 2MJ5B 1JR3E 4DBGB 4F1IA 1G4AE 1OAIA 1DV0A 1WHCA 1AIPC 2DAGA 1VEJA 1YLAA 2DI0A 3FE3A 2ZTDA 1WJ7A 1WGNA 1UFZA 1TR8A 1Q02A 2BWBA 1MN3A 1HT2E 1SG9A 2QNJA 3GLIE 3IECA 3FRIA 2KNAA 1G41A 2HWJA 1HJPA 1WGLA 2BWEA 2JY8A 2L2DA 2MR9A 1R4GA 1DO0A 2EKKA 2MGWA 2K9DA 2JY7A 4R71A 2JUJA 3K9OA 1OKSA 3LCUA 1E94E 5JI2E 2JNHA 1TTEA 1C7YA 2HAKA 1WIVA 1XXHE 2JZ1A 2LVPC 2G3QA 4UN2B 2KNZA 2H5XA 2JY6B 2DAKA 2LTUA 2OOAA 5DFLA 2DHYA 2QSFX 1PGYA 3MMPA 1VQ1A 2CP8A 1IFYA 2OO9A 2DKLA 2DNAA 2ZTCA 2L4FA 4WP2A 2K0BX 3H4JA 1HQYE 1VEKA 2DAMA 2JZ0A 1NV8A 2B3TA 1P3QQ 1VEGA 2DENA 2LBCA 1VG5A 1ZMUA 1A5TA 2JY5A 4Q7JA
chains in the Genus database with same CATH superfamily
4QOSA 1N32M 1OTRA 5DNYA 3AV0A 3JAMS 3R8FA 3GLHE 2KHHA 4WURA 5E6JA 5ITYA 3SC3A 1PJJA 4QHSA 4GH9A 1PJSA 4JI2M 1L2CA 2CHVA 3UGJA 4OU7A 4DR5M 4YY3M 1G3IA 1IN8A 3WHLA 1K82A 1NV9A 1OIPA 4NSOB 3HHYA 1J7KA 2O01F 1D0LA 2R4EA 3PNVA 4DR1M 3E21A 3FUVA 4OX9M 4QHTA 1XNQM 1QUSA 1GKIA 4DV7M 2LVQD 2ZAOA 4NXMM 2MROB 3FRHA 1QQWA 3KVWA 2QHOB 3TPZA 4LZZA 2FE8A 1TH4A 3U6LA 3R9XB 3VK8A 2CHGA 2L09A 5FLXS 3SBJA 5F3WA 5LMNM 2Z4RA 1OFIA 4JI3M 1GJTA 4G4OA 3DFZA 3ZCBB 2VDBB 4IJEA 4M9XA 3U6CA 1L2DA 1V92A 5EXSA 2L4EA 4S12A 2JWSA 1EFUB 3HHWA 3CF0A 4DV2M 4F1IA 1JR3E 3TE6A 4IBCA 3ILKA 1OAIA 1PJTA 3GP1A 3QYBA 2QPAA 1AIPC 4XGIA 2R18A 2ZTDA 3RFWA 5C1BA 3UZUA 5GKNA 4JI5M 3U61A 4B3RM 4JV5M 3U6OA 5EQTA 2X4AA 3IG8A 4JI6M 2KNAA 1G8PA 3QAUA 4L6V6 1WGLA 3CGWA 1QAMA 3TQSA 3LW5F 1MU5A 1NHWC 1Z5AA 3Q8GA 3NBXX 2K9DA 2CV0A 1S3SA 5EXTA 4D81A 3OTOM 3CTWB 4B3MM 1OKSA 5FTJA 4NRVA 2MH8A 3PNYA 1NVMA 1OIZA 1E94E 2C98A 2JNHA 5BPVA 2X8AA 1C7YA 2YQZA 3LQRA 1WIVA 3M6AA 3SASA 3J7AS 2LXEA 1AUAA 3KDSE 1VDDA 1IXRC 2G3QA 4FCWA 1E9RA 4HLQA 3SHGB 2CE7A 3EIEA 2F4VM 1JR3D 4LJ5A 3CF6E 4RKUF 2V1UA 4FCVA 4L16A 1IBMM 2OOAA 3DZDA 1NY6A 3EIHA 3KP0E 2CP8A 2R45A 3B7NA 4LRSA 3MHVC 1XXHB 2D7EA 2DNAA 2L4FA 1H6UA 8CATA 3U60B 3E4RA 1DGBA 1N75A 3FD9A 1HQYE 2KZSA 4B3SM 3SAVA 1QZMA 3I4VA 2GQFA 2B3TA 3GRYA 4QNRA 3W0LB 2RKOA 4P16A 3K2LA 1LTMA 5KPZA 3TWKA 3TWLA 3GLGB 4JYAM 1P3QQ 1HNXM 4GHLA 5A2QS 3AOGA 2Y21A 1ZMUA 1XXHA 4FWGA 1DGFA 1GL6A 2JY5A 1XMOM 4Q7JA 3VKGA 1QAOA 1NJGA 5ITUA 1DO2A 2A5YB 1PJIA 1L8QA 3SAUA 3GLGE 1VDLA 2I7NA 2D7HA 3KS4A 4JXJA 2R65A 4LFBM 2LVOC 2CUZA 1OQYA 1ZMVA 1CUKA 3L29A 1G59A 1GO5A 2YR0A 3PVSA 3Q8XA 1IBLM 2BJWA 2QQ8A 4TUWA 4F2LA 3A42A 5FTMA 2WZJA 2LVNC 4OW0A 2L7IA 4ITQA 4R7GA 2DAIA 4G6ZA 4P17A 3GRRA 4FVMA 4K0KM 4LJ7A 4LFCM 3GLHB 4I8OA 4LRTA 3GPYA 3M7GA 2O25A 1EIJA 4JI8M 4IIWA 3UK6A 3W67A 3KFUG 5LMUM 1ZV1A 2R4JA 3PFIA 1Q3BA 3VFDA 4II7A 1JR3A 5H37D 3BBZA 4DV3M 1D2NA 2UUBM 4CIZA 3SFZA 3WHKA 4B7FA 1D0MA 4GEWA 1TGUA 4IJFA 2NQ8C 2DZOB 4L78A 1J5EM 2VIIA 4XK8F 3GLFA 2WSEF 3KOZE 4R3DA 4HL4A 4X65M 3FTCA 4JI7M 1GL7A 5KQ8A 2UUCM 2XF3A 5EP3A 4AKIA 1IM2A 2C9OA 3B7QA 5EP4A 1Z59A 2M5ZA 2VF8A 4LZJA 4MM3B 4RNAA 1I94M 3KW6A 1DV0A 2V1CA 1IN5A 4XBOA 5DYIA 4YHHM 1WGNA 2LHCA 2XEPA 4D80A 1K3XA 4M9SA 1TR8A 1TH3A 1Q02A 4KO8A 1HT2E 2LNHC 2QNJA 4RF0A 3J2PB 3SYKA 1IY2A 2MR9A 5FTKA 1IN7A 3U5ZB 3U6QA 4GHAA 4LJ4A 1ZAEA 2JY7A 2E5LM 2Q2EB 4R71A 5E26A 2JUJA 4DV6M 4MGIE 2JA2A 3UMMA 3LCUA 4AG5A 2CEAA 3J7BA 3L28A 3GLIB 4LGYA 3J80S 3JR4A 2FNAA 2FS1A 3KOXE 1TTEA 4M0WA 2R46A 2VQEM 3U6SA 2H1RA 3LVVA 4LGMA 3FTEA 2QBYA 3DOAA 4IBBA 4NXNM 1R2ZA 1FNNA 2HCBA 2KZUA 2F5PA 1PRBA 2GNOA 4IBJA 2DWZB 2AHMA 4FW9A 1XWIA 4PCZA 4JI1M 4CGYB 5IT9S 2EA0A 4GKJM 2DHYA 2QSFX 1XHBA 3HU2A 4DV5M 2DVWB 1PGYA 1IFYA 3AL0C 4OVZB 2OO9A 2DKLA 2UXCM 4IBKA 3HY5A 4DV1M 2DWMA 4DUYM 2K0BX 1Z5BA 2Z8YM 3B74A 3H4JA 3KOWE 3W0FA 3U6MA 1NNJA 4DUZM 4BLCA 1I4WA 5KPTA 2DWLA 4LJAA 2QBYB 3SMSA 3QYEA 1RU3A 5FTLA 2R44A 2QCUA 1V34A 2CFOA 4DV4M 1A5TA 2HL7A 1L2BA 1QAQA 4NOOB 2C5RA 1QDRA 2Z7JA 3AOEA 2Y0QA 3SHFA 2ZM6M 2J7OA 1QVRA 4X64M 4NRWA 3GPXA 4IBFA 4LF5M 1R5LA 2ERCA 1QUTA 4AQYM 1N34M 1YUBA 3HZJA 3K8ZA 1ZMWA 2K6BA 3SATA 2XSZD 2G8LA 2KEBA 3JR5A 3BOSA 4JI4M 3L25A 3HHXA 1IY0A 4NSRA 4PD2A 2XLJA 1KYIA 2F5SA 3FYCA 4M0DA 1N36M 2EJSA 4BBAA 2CV1A 3ZQJA 3L2AA 1WR1B 1MX0A 1NO1A 3HKPA 4FWDA 2RRUA 2YNMD 3B7ZA 4GC9A 1BVSA 2P5TA 3E9SA 3NBIA 3E46A 1QANA 4KLNA 3HWSA 3SAWA 1SXJE 2OOBA 2R0IA 3FUXA 3F92A 3T6PA 4G4NA 3V76A 2FOIC 1OAOC 1NSFA 3VK7A 1HQCA 3J27B 2JXNA 2J7NA 2WSFF 2XH9A 3A98B 3AFHA 4MGHA 5BR8M 5IZ7D 2CV2A 5DYGA 4GRIA 1F4IA 1K3WA 2X49A 3MJ5A 2KNVA 1IXZA 3FYDA 2JP7A 4QNMA 4L8RC 2J5YA 1E9SA 1QZEA 2APLA 1TF0B 1G71A 3LCVB 4HEOA 2R62A 3GRVA 1DGHA 3M0EA 3HHZA 2MJ5B 2QP9X 4DBGB 3BXWA 1G4AE 3C58A 2F5QA 4PDGA 1W5SA 1FJGM 2UXDM 2DAGA 3W68A 1YLAA 1ORYB 2DI0A 3FE3A 5ITRA 1WJ7A 1HNZM 1N33M 3LVWA 5EP2A 1UFZA 2UXBM 4W5WA 2BWBA 1MN3A 1SG9A 1JQJC 2XGNA 1OJLA 4PT5A 4LJ8A 3GLIE 4LF7M 3I04M 1G41A 2DHRA 1HJPA 4AW4A 5C18A 4G4RA 2JY8A 4JN6A 2O5RA 2XSZA 3VDUA 4LF6M 3K1JA 3FTFA 2EKKA 1IXSB 1SXJB 4GKKM 3D8LA 3I4YA 1Q3CA 5KO3A 3GLIA 3QWLA 2BJVA 4I4LA 3K9OA 2YFQA 5EXPA 4KHPM 3GO8A 1R6BX 4DV0M 2XFSA 1T3TA 4L4UA 4MH0E 1QYRA 4DR6M 3HGIA 4IBDA 2OQ4A 4KODA 4CJ6A 3LMMA 3U5ZA 4AZFA 1GABA 1XXHE 2JZ1A 2CRUA 1SXJC 2G5GX 4LCBA 1DGGA 4B7GA 4UN2B 3TWMA 1GVNA 3A45A 1NJFA 3KOYE 2VF7A 4GC5A 4M9ZA 3U6DA 2L7HA 2KNZA 2RGOA 4ZPXA 4MGZE 1KFVA 4B08A 2KXEA 4KT0F 1DGHB 1NHGC 2JY6B 3U6EA 2LTUA 1R7RA 5DFLA 2LH0A 2RGHA 3HX3A 3KXEC 3RE8A 3FTDA 3MMPA 2XZFA 3SMPA 5IREB 5FTNA 1WXQA 1PM5A 3KSJA 4WP2A 4AI6A 1XNRM 2Z3XA 2L6OA 1NV8A 4X62M 1TDHA 1IN6A 1IN4A 3FUWA 4MGYE 1L1ZA 1XC8A 4GMQA 3GLFB 3GPPA 1VEGA 2DENA 3B9PA 2C96A 2LBCA 3HU1A 3K92A 2D7GA 2FH0A 2QZ4A 2F5NA 4ANRA 4NC6A 2Z4SA 4MB7A 1UM8A 2Y20A 3HJQA 1LV7A 1MJGM 5JI3E 3GRUA 4FWHA 4Z6YA 2FFJA 2EO2A 1SXJD 3B89A 3D8BA 3SARA 4B3TM 4B7HA 1IQPA 4LFAM 3GLHA 4PDIA 3GLFE 4FD2A 2LHGA 2Y0TA 3T1YM 4DR2M 1V33A 3VLFB 3AOEC 4LG2A 3VDPA 4D82A 2KRKA 3IHPA 2WSCF 3UJNA 1XB2B 2QENA 4G3OA 3THGA 2N35A 3U6PA 4GIPA 4JI0M 4L15A 1T6OA 1N77A 1T43A 3K9PA 3HJ8A 2DZLA 4Y28F 1ZQ9A 3RGSA 1IXSA 1SXJA 4BB9A 2VQFM 3KS8A 5IWAM 2CHQA 2EKFA 2C9CA 2OPFA 1QDTA 1Y8GA 1GLNA 2BNKA 3ZC7B 3T1HM 1YSYA 2DAEA 2W82A 3TL4X 4A3VB 3GQ4A 2DWNA 5FSWA 3GQ5A 4RF1A 4DR3M 1IY1A 1NY5A 1R2YA 4LY6A 1KSFX 3GLGA 4IBEA 3KP1E 3L26A 4MGKE 1HT1E 3AJIB 3FUTA 2CWBA 2K47A 3C9PA 4LF8M 3U60A 3GPUA 4LF4M 3L27A 2UUAM 2LVAA 3NWLA 3ZH9B 2HHHM 4IBGA 5ITTA 4FCTA 2M60A 1WHCA 2C99A 4IBIA 1VEJA 1XMQM 5EJCA 2KW0A 1OFHA 3HJSA 3RGPA 3DA1A 1W5TA 4AKHA 4G4QA 4WW0A 3IECA 3FRIA 1GJSA 3I51A 3FKEA 4DR4M 2HWJA 4NL4H 4AKGA 2BWEA 2HKJA 3C3DA 2L2DA 1TH2A 1R4GA 5EXXA 5KQDA 1DO0A 2MGWA 3CF2A 3KSXA 4Z8XA 7CATA 4GITA 2XFTA 4I5SA 3H4MA 5JI2E 2R6FA 4REZA 3J81S 3T38A 3FUUA 4LJ6A 2UU9M 4AG6A 2V6ZM 4CHTB 1TDZA 2F5OA 2LWXA 2HAKA 2LVPC 1C1KA 1HR0M 3AKZA 1HNWM 1D0KA 1L1TA 2KDLA 1Z5CA 1X37A 5EP1A 1JB0F 2H5XA 3HU3A 3I01M 3MK6A 1J09A 3U61B 3IG5A 2DAKA 2KA6B 5L8RF 2ZANA 1VQ1A 3SYLA 3LQQA 4LF9M 4CISA 4QOZC 2ZTCA 1PJQA 3PXGA 1NNUC 2ZAMA 1VEKA 1Z6TA 2DAMA 2JZ0A 4DR7M 1Q39A 5KPRA 2EUCA 1YE9A 5ITQA 3VKHA 2ZBKB 5ITXA 2XZUA 2DXIA 1IBKM 3GQ3A 1E32A 1VG5A 3A46A 2DZNB 4OVZA 1N78A 2I7PA 4EIWA 4X66M 1EE8A 4I81A 4LJ9A 3T15A 5ITXE 3C3EA 2KRUA
chains in the Genus database with same CATH topology
1DO2A 1OTRA 3B89A 3GLHE 1ZMWA 2KHHA 3GLFE 1VDLA 3GLGE 2LVOC 1OQYA 1ZMVA 1CUKA 1GO5A 1KYIA 1G3IA 3IHPA 2EJSA 4F2LA 1NV9A 1XB2B 4G3OA 2WZJA 2LVNC 1WR1B 2DAIA 3E21A 1T6OA 1T43A 3K9PA 2LVQD 2RRUA 2O25A 1BVSA 2DZLA 3E46A 1IXSA 2MROB 3FRHA 2QHOB 1ZV1A 2EKFA 2OOBA 2R0IA 1Y8GA 3F92A 3T6PA 3BBZA 2DAEA 4GEWA 1F4IA 2KNVA 1V92A 2JP7A 1QZEA 1HT1E 2L4EA 1IM2A 2CWBA 3LCVB 1EFUB 4HEOA 2LVAA 2MJ5B 1JR3E 4DBGB 4F1IA 1G4AE 1OAIA 1DV0A 1WHCA 1AIPC 2DAGA 1VEJA 1YLAA 2DI0A 3FE3A 2ZTDA 1WJ7A 1WGNA 1UFZA 1TR8A 1Q02A 2BWBA 1MN3A 1HT2E 1SG9A 2QNJA 3GLIE 3IECA 3FRIA 2KNAA 1G41A 2HWJA 1HJPA 1WGLA 2BWEA 2JY8A 2L2DA 2MR9A 1R4GA 1DO0A 2EKKA 2MGWA 2K9DA 2JY7A 4R71A 2JUJA 3K9OA 1OKSA 3LCUA 1E94E 5JI2E 2JNHA 1TTEA 1C7YA 2HAKA 1WIVA 1XXHE 2JZ1A 2LVPC 2G3QA 4UN2B 2KNZA 2H5XA 2JY6B 2DAKA 2LTUA 2OOAA 5DFLA 2DHYA 2QSFX 1PGYA 3MMPA 1VQ1A 2CP8A 1IFYA 2OO9A 2DKLA 2DNAA 2ZTCA 2L4FA 4WP2A 2K0BX 3H4JA 1HQYE 1VEKA 2DAMA 2JZ0A 1NV8A 2B3TA 1P3QQ 1VEGA 2DENA 2LBCA 1VG5A 1ZMUA 1A5TA 2JY5A 4Q7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO2 A;  1OTR A;  3B89 A;  3GLH E;  1ZMW A;  2KHH A;  3GLF E;  1VDL A;  3GLG E;  2LVO C;  1OQY A;  1ZMV A;  1CUK A;  1GO5 A;  1KYI A;  1G3I A;  3IHP A;  2EJS A;  4F2L A;  1NV9 A;  1XB2 B;  4G3O A;  2WZJ A;  2LVN C;  1WR1 B;  2DAI A;  3E21 A;  1T6O A;  1T43 A;  3K9P A;  2LVQ D;  2RRU A;  2O25 A;  1BVS A;  2DZL A;  3E46 A;  1IXS A;  2MRO B;  3FRH A;  2QHO B;  1ZV1 A;  2EKF A;  2OOB A;  2R0I A;  1Y8G A;  3F92 A;  3T6P A;  3BBZ A;  2DAE A;  4GEW A;  1F4I A;  2KNV A;  1V92 A;  2JP7 A;  1QZE A;  1HT1 E;  2L4E A;  1IM2 A;  2CWB A;  3LCV B;  1EFU B;  4HEO A;  2LVA A;  2MJ5 B;  1JR3 E;  4DBG B;  4F1I A;  1G4A E;  1OAI A;  1DV0 A;  1WHC A;  1AIP C;  2DAG A;  1VEJ A;  1YLA A;  2DI0 A;  3FE3 A;  2ZTD A;  1WJ7 A;  1WGN A;  1UFZ A;  1TR8 A;  1Q02 A;  2BWB A;  1MN3 A;  1HT2 E;  1SG9 A;  2QNJ A;  3GLI E;  3IEC A;  3FRI A;  2KNA A;  1G41 A;  2HWJ A;  1HJP A;  1WGL A;  2BWE A;  2JY8 A;  2L2D A;  2MR9 A;  1R4G A;  1DO0 A;  2EKK A;  2MGW A;  2K9D A;  2JY7 A;  4R71 A;  2JUJ A;  3K9O A;  1OKS A;  3LCU A;  1E94 E;  5JI2 E;  2JNH A;  1TTE A;  1C7Y A;  2HAK A;  1WIV A;  1XXH E;  2JZ1 A;  2LVP C;  2G3Q A;  4UN2 B;  2KNZ A;  2H5X A;  2JY6 B;  2DAK A;  2LTU A;  2OOA A;  5DFL A;  2DHY A;  2QSF X;  1PGY A;  3MMP A;  1VQ1 A;  2CP8 A;  1IFY A;  2OO9 A;  2DKL A;  2DNA A;  2ZTC A;  2L4F A;  4WP2 A;  2K0B X;  3H4J A;  1HQY E;  1VEK A;  2DAM A;  2JZ0 A;  1NV8 A;  2B3T A;  1P3Q Q;  1VEG A;  2DEN A;  2LBC A;  1VG5 A;  1ZMU A;  1A5T A;  2JY5 A;  4Q7J A; 
#chains in the Genus database with same CATH topology
 4QOS A;  1N32 M;  1OTR A;  5DNY A;  3AV0 A;  3JAM S;  3R8F A;  3GLH E;  2KHH A;  4WUR A;  5E6J A;  5ITY A;  3SC3 A;  1PJJ A;  4QHS A;  4GH9 A;  1PJS A;  4JI2 M;  1L2C A;  2CHV A;  3UGJ A;  4OU7 A;  4DR5 M;  4YY3 M;  1G3I A;  1IN8 A;  3WHL A;  1K82 A;  1NV9 A;  1OIP A;  4NSO B;  3HHY A;  1J7K A;  2O01 F;  1D0L A;  2R4E A;  3PNV A;  4DR1 M;  3E21 A;  3FUV A;  4OX9 M;  4QHT A;  1XNQ M;  1QUS A;  1GKI A;  4DV7 M;  2LVQ D;  2ZAO A;  4NXM M;  2MRO B;  3FRH A;  1QQW A;  3KVW A;  2QHO B;  3TPZ A;  4LZZ A;  2FE8 A;  1TH4 A;  3U6L A;  3R9X B;  3VK8 A;  2CHG A;  2L09 A;  5FLX S;  3SBJ A;  5F3W A;  5LMN M;  2Z4R A;  1OFI A;  4JI3 M;  1GJT A;  4G4O A;  3DFZ A;  3ZCB B;  2VDB B;  4IJE A;  4M9X A;  3U6C A;  1L2D A;  1V92 A;  5EXS A;  2L4E A;  4S12 A;  2JWS A;  1EFU B;  3HHW A;  3CF0 A;  4DV2 M;  4F1I A;  1JR3 E;  3TE6 A;  4IBC A;  3ILK A;  1OAI A;  1PJT A;  3GP1 A;  3QYB A;  2QPA A;  1AIP C;  4XGI A;  2R18 A;  2ZTD A;  3RFW A;  5C1B A;  3UZU A;  5GKN A;  4JI5 M;  3U61 A;  4B3R M;  4JV5 M;  3U6O A;  5EQT A;  2X4A A;  3IG8 A;  4JI6 M;  2KNA A;  1G8P A;  3QAU A;  4L6V 6;  1WGL A;  3CGW A;  1QAM A;  3TQS A;  3LW5 F;  1MU5 A;  1NHW C;  1Z5A A;  3Q8G A;  3NBX X;  2K9D A;  2CV0 A;  1S3S A;  5EXT A;  4D81 A;  3OTO M;  3CTW B;  4B3M M;  1OKS A;  5FTJ A;  4NRV A;  2MH8 A;  3PNY A;  1NVM A;  1OIZ A;  1E94 E;  2C98 A;  2JNH A;  5BPV A;  2X8A A;  1C7Y A;  2YQZ A;  3LQR A;  1WIV A;  3M6A A;  3SAS A;  3J7A S;  2LXE A;  1AUA A;  3KDS E;  1VDD A;  1IXR C;  2G3Q A;  4FCW A;  1E9R A;  4HLQ A;  3SHG B;  2CE7 A;  3EIE A;  2F4V M;  1JR3 D;  4LJ5 A;  3CF6 E;  4RKU F;  2V1U A;  4FCV A;  4L16 A;  1IBM M;  2OOA A;  3DZD A;  1NY6 A;  3EIH A;  3KP0 E;  2CP8 A;  2R45 A;  3B7N A;  4LRS A;  3MHV C;  1XXH B;  2D7E A;  2DNA A;  2L4F A;  1H6U A;  8CAT A;  3U60 B;  3E4R A;  1DGB A;  1N75 A;  3FD9 A;  1HQY E;  2KZS A;  4B3S M;  3SAV A;  1QZM A;  3I4V A;  2GQF A;  2B3T A;  3GRY A;  4QNR A;  3W0L B;  2RKO A;  4P16 A;  3K2L A;  1LTM A;  5KPZ A;  3TWK A;  3TWL A;  3GLG B;  4JYA M;  1P3Q Q;  1HNX M;  4GHL A;  5A2Q S;  3AOG A;  2Y21 A;  1ZMU A;  1XXH A;  4FWG A;  1DGF A;  1GL6 A;  2JY5 A;  1XMO M;  4Q7J A;  3VKG A;  1QAO A;  1NJG A;  5ITU A;  1DO2 A;  2A5Y B;  1PJI A;  1L8Q A;  3SAU A;  3GLG E;  1VDL A;  2I7N A;  2D7H A;  3KS4 A;  4JXJ A;  2R65 A;  4LFB M;  2LVO C;  2CUZ A;  1OQY A;  1ZMV A;  1CUK A;  3L29 A;  1G59 A;  1GO5 A;  2YR0 A;  3PVS A;  3Q8X A;  1IBL M;  2BJW A;  2QQ8 A;  4TUW A;  4F2L A;  3A42 A;  5FTM A;  2WZJ A;  2LVN C;  4OW0 A;  2L7I A;  4ITQ A;  4R7G A;  2DAI A;  4G6Z A;  4P17 A;  3GRR A;  4FVM A;  4K0K M;  4LJ7 A;  4LFC M;  3GLH B;  4I8O A;  4LRT A;  3GPY A;  3M7G A;  2O25 A;  1EIJ A;  4JI8 M;  4IIW A;  3UK6 A;  3W67 A;  3KFU G;  5LMU M;  1ZV1 A;  2R4J A;  3PFI A;  1Q3B A;  3VFD A;  4II7 A;  1JR3 A;  5H37 D;  3BBZ A;  4DV3 M;  1D2N A;  2UUB M;  4CIZ A;  3SFZ A;  3WHK A;  4B7F A;  1D0M A;  4GEW A;  1TGU A;  4IJF A;  2NQ8 C;  2DZO B;  4L78 A;  1J5E M;  2VII A;  4XK8 F;  3GLF A;  2WSE F;  3KOZ E;  4R3D A;  4HL4 A;  4X65 M;  3FTC A;  4JI7 M;  1GL7 A;  5KQ8 A;  2UUC M;  2XF3 A;  5EP3 A;  4AKI A;  1IM2 A;  2C9O A;  3B7Q A;  5EP4 A;  1Z59 A;  2M5Z A;  2VF8 A;  4LZJ A;  4MM3 B;  4RNA A;  1I94 M;  3KW6 A;  1DV0 A;  2V1C A;  1IN5 A;  4XBO A;  5DYI A;  4YHH M;  1WGN A;  2LHC A;  2XEP A;  4D80 A;  1K3X A;  4M9S A;  1TR8 A;  1TH3 A;  1Q02 A;  4KO8 A;  1HT2 E;  2LNH C;  2QNJ A;  4RF0 A;  3J2P B;  3SYK A;  1IY2 A;  2MR9 A;  5FTK A;  1IN7 A;  3U5Z B;  3U6Q A;  4GHA A;  4LJ4 A;  1ZAE A;  2JY7 A;  2E5L M;  2Q2E B;  4R71 A;  5E26 A;  2JUJ A;  4DV6 M;  4MGI E;  2JA2 A;  3UMM A;  3LCU A;  4AG5 A;  2CEA A;  3J7B A;  3L28 A;  3GLI B;  4LGY A;  3J80 S;  3JR4 A;  2FNA A;  2FS1 A;  3KOX E;  1TTE A;  4M0W A;  2R46 A;  2VQE M;  3U6S A;  2H1R A;  3LVV A;  4LGM A;  3FTE A;  2QBY A;  3DOA A;  4IBB A;  4NXN M;  1R2Z A;  1FNN A;  2HCB A;  2KZU A;  2F5P A;  1PRB A;  2GNO A;  4IBJ A;  2DWZ B;  2AHM A;  4FW9 A;  1XWI A;  4PCZ A;  4JI1 M;  4CGY B;  5IT9 S;  2EA0 A;  4GKJ M;  2DHY A;  2QSF X;  1XHB A;  3HU2 A;  4DV5 M;  2DVW B;  1PGY A;  1IFY A;  3AL0 C;  4OVZ B;  2OO9 A;  2DKL A;  2UXC M;  4IBK A;  3HY5 A;  4DV1 M;  2DWM A;  4DUY M;  2K0B X;  1Z5B A;  2Z8Y M;  3B74 A;  3H4J A;  3KOW E;  3W0F A;  3U6M A;  1NNJ A;  4DUZ M;  4BLC A;  1I4W A;  5KPT A;  2DWL A;  4LJA A;  2QBY B;  3SMS A;  3QYE A;  1RU3 A;  5FTL A;  2R44 A;  2QCU A;  1V34 A;  2CFO A;  4DV4 M;  1A5T A;  2HL7 A;  1L2B A;  1QAQ A;  4NOO B;  2C5R A;  1QDR A;  2Z7J A;  3AOE A;  2Y0Q A;  3SHF A;  2ZM6 M;  2J7O A;  1QVR A;  4X64 M;  4NRW A;  3GPX A;  4IBF A;  4LF5 M;  1R5L A;  2ERC A;  1QUT A;  4AQY M;  1N34 M;  1YUB A;  3HZJ A;  3K8Z A;  1ZMW A;  2K6B A;  3SAT A;  2XSZ D;  2G8L A;  2KEB A;  3JR5 A;  3BOS A;  4JI4 M;  3L25 A;  3HHX A;  1IY0 A;  4NSR A;  4PD2 A;  2XLJ A;  1KYI A;  2F5S A;  3FYC A;  4M0D A;  1N36 M;  2EJS A;  4BBA A;  2CV1 A;  3ZQJ A;  3L2A A;  1WR1 B;  1MX0 A;  1NO1 A;  3HKP A;  4FWD A;  2RRU A;  2YNM D;  3B7Z A;  4GC9 A;  1BVS A;  2P5T A;  3E9S A;  3NBI A;  3E46 A;  1QAN A;  4KLN A;  3HWS A;  3SAW A;  1SXJ E;  2OOB A;  2R0I A;  3FUX A;  3F92 A;  3T6P A;  4G4N A;  3V76 A;  2FOI C;  1OAO C;  1NSF A;  3VK7 A;  1HQC A;  3J27 B;  2JXN A;  2J7N A;  2WSF F;  2XH9 A;  3A98 B;  3AFH A;  4MGH A;  5BR8 M;  5IZ7 D;  2CV2 A;  5DYG A;  4GRI A;  1F4I A;  1K3W A;  2X49 A;  3MJ5 A;  2KNV A;  1IXZ A;  3FYD A;  2JP7 A;  4QNM A;  4L8R C;  2J5Y A;  1E9S A;  1QZE A;  2APL A;  1TF0 B;  1G71 A;  3LCV B;  4HEO A;  2R62 A;  3GRV A;  1DGH A;  3M0E A;  3HHZ A;  2MJ5 B;  2QP9 X;  4DBG B;  3BXW A;  1G4A E;  3C58 A;  2F5Q A;  4PDG A;  1W5S A;  1FJG M;  2UXD M;  2DAG A;  3W68 A;  1YLA A;  1ORY B;  2DI0 A;  3FE3 A;  5ITR A;  1WJ7 A;  1HNZ M;  1N33 M;  3LVW A;  5EP2 A;  1UFZ A;  2UXB M;  4W5W A;  2BWB A;  1MN3 A;  1SG9 A;  1JQJ C;  2XGN A;  1OJL A;  4PT5 A;  4LJ8 A;  3GLI E;  4LF7 M;  3I04 M;  1G41 A;  2DHR A;  1HJP A;  4AW4 A;  5C18 A;  4G4R A;  2JY8 A;  4JN6 A;  2O5R A;  2XSZ A;  3VDU A;  4LF6 M;  3K1J A;  3FTF A;  2EKK A;  1IXS B;  1SXJ B;  4GKK M;  3D8L A;  3I4Y A;  1Q3C A;  5KO3 A;  3GLI A;  3QWL A;  2BJV A;  4I4L A;  3K9O A;  2YFQ A;  5EXP A;  4KHP M;  3GO8 A;  1R6B X;  4DV0 M;  2XFS A;  1T3T A;  4L4U A;  4MH0 E;  1QYR A;  4DR6 M;  3HGI A;  4IBD A;  2OQ4 A;  4KOD A;  4CJ6 A;  3LMM A;  3U5Z A;  4AZF A;  1GAB A;  1XXH E;  2JZ1 A;  2CRU A;  1SXJ C;  2G5G X;  4LCB A;  1DGG A;  4B7G A;  4UN2 B;  3TWM A;  1GVN A;  3A45 A;  1NJF A;  3KOY E;  2VF7 A;  4GC5 A;  4M9Z A;  3U6D A;  2L7H A;  2KNZ A;  2RGO A;  4ZPX A;  4MGZ E;  1KFV A;  4B08 A;  2KXE A;  4KT0 F;  1DGH B;  1NHG C;  2JY6 B;  3U6E A;  2LTU A;  1R7R A;  5DFL A;  2LH0 A;  2RGH A;  3HX3 A;  3KXE C;  3RE8 A;  3FTD A;  3MMP A;  2XZF A;  3SMP A;  5IRE B;  5FTN A;  1WXQ A;  1PM5 A;  3KSJ A;  4WP2 A;  4AI6 A;  1XNR M;  2Z3X A;  2L6O A;  1NV8 A;  4X62 M;  1TDH A;  1IN6 A;  1IN4 A;  3FUW A;  4MGY E;  1L1Z A;  1XC8 A;  4GMQ A;  3GLF B;  3GPP A;  1VEG A;  2DEN A;  3B9P A;  2C96 A;  2LBC A;  3HU1 A;  3K92 A;  2D7G A;  2FH0 A;  2QZ4 A;  2F5N A;  4ANR A;  4NC6 A;  2Z4S A;  4MB7 A;  1UM8 A;  2Y20 A;  3HJQ A;  1LV7 A;  1MJG M;  5JI3 E;  3GRU A;  4FWH A;  4Z6Y A;  2FFJ A;  2EO2 A;  1SXJ D;  3B89 A;  3D8B A;  3SAR A;  4B3T M;  4B7H A;  1IQP A;  4LFA M;  3GLH A;  4PDI A;  3GLF E;  4FD2 A;  2LHG A;  2Y0T A;  3T1Y M;  4DR2 M;  1V33 A;  3VLF B;  3AOE C;  4LG2 A;  3VDP A;  4D82 A;  2KRK A;  3IHP A;  2WSC F;  3UJN A;  1XB2 B;  2QEN A;  4G3O A;  3THG A;  2N35 A;  3U6P A;  4GIP A;  4JI0 M;  4L15 A;  1T6O A;  1N77 A;  1T43 A;  3K9P A;  3HJ8 A;  2DZL A;  4Y28 F;  1ZQ9 A;  3RGS A;  1IXS A;  1SXJ A;  4BB9 A;  2VQF M;  3KS8 A;  5IWA M;  2CHQ A;  2EKF A;  2C9C A;  2OPF A;  1QDT A;  1Y8G A;  1GLN A;  2BNK A;  3ZC7 B;  3T1H M;  1YSY A;  2DAE A;  2W82 A;  3TL4 X;  4A3V B;  3GQ4 A;  2DWN A;  5FSW A;  3GQ5 A;  4RF1 A;  4DR3 M;  1IY1 A;  1NY5 A;  1R2Y A;  4LY6 A;  1KSF X;  3GLG A;  4IBE A;  3KP1 E;  3L26 A;  4MGK E;  1HT1 E;  3AJI B;  3FUT A;  2CWB A;  2K47 A;  3C9P A;  4LF8 M;  3U60 A;  3GPU A;  4LF4 M;  3L27 A;  2UUA M;  2LVA A;  3NWL A;  3ZH9 B;  2HHH M;  4IBG A;  5ITT A;  4FCT A;  2M60 A;  1WHC A;  2C99 A;  4IBI A;  1VEJ A;  1XMQ M;  5EJC A;  2KW0 A;  1OFH A;  3HJS A;  3RGP A;  3DA1 A;  1W5T A;  4AKH A;  4G4Q A;  4WW0 A;  3IEC A;  3FRI A;  1GJS A;  3I51 A;  3FKE A;  4DR4 M;  2HWJ A;  4NL4 H;  4AKG A;  2BWE A;  2HKJ A;  3C3D A;  2L2D A;  1TH2 A;  1R4G A;  5EXX A;  5KQD A;  1DO0 A;  2MGW A;  3CF2 A;  3KSX A;  4Z8X A;  7CAT A;  4GIT A;  2XFT A;  4I5S A;  3H4M A;  5JI2 E;  2R6F A;  4REZ A;  3J81 S;  3T38 A;  3FUU A;  4LJ6 A;  2UU9 M;  4AG6 A;  2V6Z M;  4CHT B;  1TDZ A;  2F5O A;  2LWX A;  2HAK A;  2LVP C;  1C1K A;  1HR0 M;  3AKZ A;  1HNW M;  1D0K A;  1L1T A;  2KDL A;  1Z5C A;  1X37 A;  5EP1 A;  1JB0 F;  2H5X A;  3HU3 A;  3I01 M;  3MK6 A;  1J09 A;  3U61 B;  3IG5 A;  2DAK A;  2KA6 B;  5L8R F;  2ZAN A;  1VQ1 A;  3SYL A;  3LQQ A;  4LF9 M;  4CIS A;  4QOZ C;  2ZTC A;  1PJQ A;  3PXG A;  1NNU C;  2ZAM A;  1VEK A;  1Z6T A;  2DAM A;  2JZ0 A;  4DR7 M;  1Q39 A;  5KPR A;  2EUC A;  1YE9 A;  5ITQ A;  3VKH A;  2ZBK B;  5ITX A;  2XZU A;  2DXI A;  1IBK M;  3GQ3 A;  1E32 A;  1VG5 A;  3A46 A;  2DZN B;  4OVZ A;  1N78 A;  2I7P A;  4EIW A;  4X66 M;  1EE8 A;  4I81 A;  4LJ9 A;  3T15 A;  5ITX E;  3C3E A;  2KRU A; 
#chains in the Genus database with same CATH homology
 1DO2 A;  1OTR A;  3B89 A;  3GLH E;  1ZMW A;  2KHH A;  3GLF E;  1VDL A;  3GLG E;  2LVO C;  1OQY A;  1ZMV A;  1CUK A;  1GO5 A;  1KYI A;  1G3I A;  3IHP A;  2EJS A;  4F2L A;  1NV9 A;  1XB2 B;  4G3O A;  2WZJ A;  2LVN C;  1WR1 B;  2DAI A;  3E21 A;  1T6O A;  1T43 A;  3K9P A;  2LVQ D;  2RRU A;  2O25 A;  1BVS A;  2DZL A;  3E46 A;  1IXS A;  2MRO B;  3FRH A;  2QHO B;  1ZV1 A;  2EKF A;  2OOB A;  2R0I A;  1Y8G A;  3F92 A;  3T6P A;  3BBZ A;  2DAE A;  4GEW A;  1F4I A;  2KNV A;  1V92 A;  2JP7 A;  1QZE A;  1HT1 E;  2L4E A;  1IM2 A;  2CWB A;  3LCV B;  1EFU B;  4HEO A;  2LVA A;  2MJ5 B;  1JR3 E;  4DBG B;  4F1I A;  1G4A E;  1OAI A;  1DV0 A;  1WHC A;  1AIP C;  2DAG A;  1VEJ A;  1YLA A;  2DI0 A;  3FE3 A;  2ZTD A;  1WJ7 A;  1WGN A;  1UFZ A;  1TR8 A;  1Q02 A;  2BWB A;  1MN3 A;  1HT2 E;  1SG9 A;  2QNJ A;  3GLI E;  3IEC A;  3FRI A;  2KNA A;  1G41 A;  2HWJ A;  1HJP A;  1WGL A;  2BWE A;  2JY8 A;  2L2D A;  2MR9 A;  1R4G A;  1DO0 A;  2EKK A;  2MGW A;  2K9D A;  2JY7 A;  4R71 A;  2JUJ A;  3K9O A;  1OKS A;  3LCU A;  1E94 E;  5JI2 E;  2JNH A;  1TTE A;  1C7Y A;  2HAK A;  1WIV A;  1XXH E;  2JZ1 A;  2LVP C;  2G3Q A;  4UN2 B;  2KNZ A;  2H5X A;  2JY6 B;  2DAK A;  2LTU A;  2OOA A;  5DFL A;  2DHY A;  2QSF X;  1PGY A;  3MMP A;  1VQ1 A;  2CP8 A;  1IFY A;  2OO9 A;  2DKL A;  2DNA A;  2ZTC A;  2L4F A;  4WP2 A;  2K0B X;  3H4J A;  1HQY E;  1VEK A;  2DAM A;  2JZ0 A;  1NV8 A;  2B3T A;  1P3Q Q;  1VEG A;  2DEN A;  2LBC A;  1VG5 A;  1ZMU A;  1A5T A;  2JY5 A;  4Q7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...