2JZ0A

Dsx_short
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 19
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz0A00
1R4GA 1VG5A 2QNJA 1ZMWA 2JY7A 3IECA 3E21A 2KNAA 3FRHA 3GLIE 1HT1E 3K9OA 1T6OA 3FE3A 3MMPA 2OOBA 2JY8A 2JZ0A 2LTUA 3H4JA 1WJ7A 4F2LA 1SG9A 1IFYA 5DFLA 2BWEA 2QHOB 1V92A 2G3QA 1QZEA 1AIPC 2LVPC 2DZLA 1XB2B 2L4EA 2JUJA 2DHYA 1WGLA 2MR9A 3E46A 1NV9A 2DAGA 2CP8A 3GLHE 2H5XA 3F92A 2BWBA 4Q7JA 2L4FA 3T6PA 2LVAA 1HT2E 1WIVA 1EFUB 1Q02A 1P3QQ 3IHPA 1BVSA 2OO9A 1ZV1A 2DNAA 4UN2B 3LCUA 1MN3A 2R0IA 3LCVB 1NV8A 2KNVA 2K9DA 2HAKA 2JNHA 1UFZA 1VQ1A 5JI2E 1DO0A 1PGYA 2B3TA 2EJSA 1VEKA 2WZJA 4DBGB 2ZTCA 2EKKA 2JZ1A 2JP7A 1OTRA 4R71A 4HEOA 1YLAA 2EKFA 1OQYA 4G3OA 4WP2A 4F1IA 1G3IA 3B89A 2JY6B 1DV0A 2RRUA 2CWBA 1TR8A 2HWJA 2DAKA 2DAMA 1T43A 3K9PA 1F4IA 3FRIA 1XXHE 1OAIA 2LVQD 1WHCA 1ZMUA 1VEJA 1GO5A 1IXSA 2KNZA 1HJPA 1JR3E 2JY5A 1DO2A 1HQYE 2DKLA 3GLFE 2QSFX 2ZTDA 1E94E 2LBCA 1TTEA 1G41A 1WGNA 2DAEA 2KHHA 3BBZA 4GEWA 2DENA 3GLGE 2K0BX 1KYIA 1OKSA 1ZMVA 2L2DA 2MJ5B 2O25A 2MROB 2LVNC 1Y8GA 1C7YA 2MGWA 2DI0A 1VDLA 2OOAA 1CUKA 1A5TA 1G4AE 1WR1B 2LVOC 2DAIA 1IM2A 1VEGA
chains in the Genus database with same CATH superfamily
4M0DA 2MH8A 4LJ6A 4MH0E 3GLHB 3IECA 3VKGA 2C5RA 2DZOB 2ZANA 3IG8A 3GLIE 4JI5M 4OX9M 1T6OA 1QUTA 1HR0M 2O01F 3MMPA 4IBIA 4KT0F 4Y28F 2OOBA 2JY8A 2JZ0A 4F2LA 1SG9A 3SARA 2D7HA 5JI3E 1QUSA 4NOOB 1G59A 2G8LA 1YE9A 2FH0A 2R62A 4DR4M 3TQSA 4IJEA 2DWLA 4QOZC 1J7KA 3VKHA 3PNVA 5FLXS 1TH3A 3U6LA 1N34M 3HJQA 2F4VM 4GIPA 3LQRA 3GLIA 4OU7A 1IY2A 4LF8M 1NV9A 1J5EM 2CP8A 3J27B 3QYBA 2KRUA 3I01M 2UXBM 1N78A 2KXEA 2Y21A 2Z4RA 3KOYE 2QQ8A 2XH9A 5C1BA 3RGPA 4GMQA 1W5SA 4X65M 4JI1M 3QWLA 1WIVA 4XK8F 5C18A 5IZ7D 2Z8YM 1EFUB 4KLNA 3ZCBB 3DA1A 2E5LM 2C9OA 1OFHA 4DV2M 2M5ZA 1BVSA 2OO9A 1TH2A 2W82A 3SHFA 1JR3D 4DV7M 3U6DA 2DNAA 4LZZA 3MJ5A 2F5OA 4UN2B 3RGSA 4QNRA 1SXJA 3GPUA 3KP1E 1HNZM 3KDSE 3PVSA 3Q8XA 2JNHA 1UFZA 1VQ1A 1PGYA 2KRKA 3SAWA 4JI2M 1DGHA 1QVRA 2EKKA 2DVWB 3FUWA 5EQTA 3U60B 1Z5BA 5EXXA 1V33A 3I4VA 2Q2EB 4FW9A 4IBKA 3J7AS 1OQYA 1GJSA 5IT9S 3FD9A 1C1KA 1I4WA 2WSCF 1NO1A 2Y0TA 4DV0M 2CWBA 1TR8A 3RE8A 2HWJA 2C98A 2O5RA 3HKPA 4PDIA 3KS4A 3L26A 1R2YA 4K0KM 4LJ7A 4IBJA 3K9PA 3KOXE 4X64M 1T3TA 3CF6E 1XXHE 1OAIA 4MGIE 4L78A 3W68A 4BBAA 3U6EA 1WHCA 4GKKM 4WW0A 1YUBA 1KFVA 1Z5AA 1IN6A 3AOGA 4RF0A 1HJPA 1PJQA 3CF2A 1FJGM 2R6FA 1Q3CA 4CJ6A 3GQ5A 1XNQM 3Q8GA 3GLFE 2ZTDA 3B7QA 5E6JA 3GLGA 1KSFX 2CV2A 4JV5M 1XNRM 3GQ3A 4BB9A 2QENA 3M7GA 1WGNA 2DAEA 4GEWA 4L4UA 2XSZD 4AKHA 1R2ZA 1V34A 3U5ZA 4AKIA 1OKSA 4REZA 2L2DA 4KHPM 5KQ8A 2MROB 2LXEA 1XXHA 2JWSA 4DR3M 3FUUA 4L6V6 4PD2A 1XC8A 4BLCA 1XMOM 3NBXX 4KO8A 4LRTA 2OOAA 3VDUA 4FWDA 1CUKA 1QAOA 1TDHA 2RGOA 3SHGB 1TDZA 1IBLM 4LF9M 3AOEC 3KP0E 5KPTA 1N36M 1WR1B 3HX3A 4DUZM 4JI0M 1XWIA 1IM2A 4CISA 1R5LA 1VEGA 5LMUM 1TGUA 1R4GA 1VG5A 2QNJA 1DGBA 1ZMWA 2DWMA 4MGZE 1IN8A 3K2LA 1NJGA 4IBCA 4M9ZA 5ITXE 3SC3A 3K9OA 3SBJA 3FE3A 1GL6A 1FNNA 4HLQA 2KZSA 4AQYM 1OJLA 2LHCA 2R4EA 1WJ7A 2YR0A 1XMQM 4NRWA 1GKIA 3WHKA 1IFYA 4LRSA 3T38A 3TWLA 4JYAM 3IG5A 2QHOB 3FYDA 8CATA 4HL4A 2I7PA 1V92A 5FTMA 2UXDM 3M0EA 2G3QA 4B3RM 3UK6A 5BR8M 5EP3A 2L4EA 1IBKM 3W67A 4LJ8A 4MM3B 3L27A 1IXSB 1E9SA 5ITXA 2MR9A 1PJIA 5BPVA 3U6CA 2QPAA 3GLHE 3CGWA 3TE6A 3F92A 2OPFA 1D0LA 2BNKA 2Z7JA 4JI7M 3BXWA 1NSFA 3AKZA 4DV5M 3U61B 2LVAA 4YHHM 1IXRC 4IBGA 5FSWA 1HT2E 1N75A 4CHTB 1HNWM 2FOIC 1J09A 2FFJA 2APLA 5KQDA 1PJTA 4DV1M 3EIEA 1P3QQ 3IHPA 4KODA 4NL4H 2GQFA 4B08A 4DV4M 1ZV1A 5ITTA 4OVZB 4M0WA 3VFDA 5LMNM 4LF6M 1Q3BA 3FTDA 4IBDA 4MGHA 3H4MA 1NV8A 3LCVB 4D81A 2XZFA 2KNVA 3GRRA 4MB7A 3GLHA 3PXGA 2HAKA 4LF5M 4QOSA 4JI4M 5JI2E 4LY6A 2B3TA 2AHMA 2XGNA 1SXJE 1VEKA 5ITYA 1QDTA 4LFBM 4DBGB 2N35A 4ZPXA 4LJ4A 3BOSA 3E9SA 1YLAA 1NY6A 4HEOA 4LGMA 3NBIA 2ZM6M 3U6PA 1L1ZA 2CRUA 2XZUA 1IN4A 4WP2A 1OIPA 1G3IA 1PJSA 2CHQA 3B89A 1QAQA 2JY6B 1NJFA 2RRUA 5EP4A 4NSOB 4LF7M 2L6OA 2X8AA 3KW6A 2UUBM 1H6UA 5H37D 4JI6M 2QZ4A 4B7GA 3GPYA 3ZQJA 1D0KA 1ZMUA 2J5YA 2J7OA 5KO3A 1N77A 4FCTA 4OW0A 2Y0QA 4L15A 2KNZA 1Z59A 3FUXA 3ZH9B 4G6ZA 2K47A 2JY5A 1DGFA 4JI3M 1HQYE 2DKLA 3I04M 4F1IA 2QSFX 4MGYE 4AW4A 1E94E 1NNUC 4IBBA 1K82A 1TF0B 3HJSA 4NC6A 3WHLA 4DV3M 2ERCA 3SYKA 3GLGE 2LHGA 4B3SM 1RU3A 2MJ5B 3HJ8A 1AUAA 3GRVA 3GP1A 3AJIB 3FTFA 4CIZA 5F3WA 1C7YA 1K3WA 2MGWA 2DI0A 3LVVA 1G8PA 1VDLA 4LCBA 4X66M 1IQPA 3C3EA 2DAIA 4WURA 2XFTA 4JI8M 1W5TA 2C99A 2YFQA 3MHVC 2R45A 2CE7A 5EP2A 4G4QA 2OQ4A 5FTNA 1JB0F 4DV6M 4I5SA 4L16A 2JY7A 3E21A 3KSXA 3JR5A 3U60A 5EXTA 3FRHA 3FUVA 2FNAA 1VDDA 4AKGA 1IN7A 1L2CA 3AL0C 3HWSA 4QHSA 2LTUA 2DWNA 5ITQA 5EJCA 3JAMS 5IWAM 1IN5A 3KVWA 5DFLA 5ITUA 1QZMA 2KZUA 2XF3A 4PCZA 3DZDA 2DXIA 4IBFA 4XGIA 2I7NA 4LJ9A 4P16A 3SATA 4I8OA 2KW0A 3I4YA 1AIPC 3J81S 3KFUG 3VK7A 3PNYA 3KXEC 2DZLA 7CATA 1XB2B 3HHYA 3V76A 2V1UA 5FTJA 2CV0A 3GLFB 2XEPA 2R46A 2VQFM 1JQJC 4AI6A 2H1RA 2YNMD 3UGJA 2QBYB 2DAGA 3EIHA 4GC5A 3TPZA 2CUZA 4I81A 2C9CA 3LVWA 4B7HA 2WSFF 4NRVA 2UXCM 2UUAM 1Z5CA 2Z3XA 4RKUF 1SXJC 1NHGC 4DR5M 1E9RA 2C96A 4S12A 4GHAA 3R9XB 4D80A 3RFWA 2G5GX 4AZFA 5EXPA 2X4AA 1MN3A 3LQQA 5EXSA 4GRIA 1PM5A 3KSJA 2CHGA 3HZJA 3J7BA 2K9DA 5FTKA 2UU9M 4JN6A 3FUTA 3SYLA 2X49A 3U6MA 3L25A 4LG2A 1R7RA 2ZTCA 2JZ1A 1PJJA 4PT5A 2JP7A 1OTRA 2LWXA 1ORYB 5E26A 3GO8A 4LF4M 2L7IA 2R4JA 4XBOA 4D82A 1IY0A 4G3OA 1K3XA 2CV1A 5KPZA 3UMMA 4GHLA 4G4NA 2RGHA 1QANA 3L28A 4LJAA 4LZJA 3C3DA 3KS8A 3CF0A 2R65A 5KPRA 2VF8A 3LW5F 2P5TA 3C58A 2LVQD 3GRUA 3TL4X 2KEBA 5FTLA 1WXQA 4QNMA 3C9PA 5IREB 1VEJA 3KOWE 1IXSA 2EO2A 2VQEM 1S3SA 1JR3E 1MX0A 1DO2A 2RKOA 1OAOC 2JXNA 4B7FA 2L09A 4B3MM 1G71A 2LBCA 4A3VB 3GLIB 1G41A 1NHWC 3U61A 2NQ8C 1XHBA 1GLNA 1QAMA 3PFIA 4GKJM 2KHHA 3HGIA 4TUWA 4M9SA 3K92A 2DENA 2Y20A 2EUCA 2K0BX 3GRYA 1HQCA 1KYIA 1MJGM 2CEAA 2O25A 2XLJA 3NWLA 2LVNC 4LFCM 2D7GA 3HU2A 4M9XA 2R18A 1L2BA 3MK6A 4OVZA 3HHWA 3ZC7B 4NXNM 3KOZE 3FKEA 4X62M 3E4RA 3VDPA 1A5TA 1QYRA 1G4AE 4LJ5A 1JR3A 4L8RC 3L2AA 1MU5A 2HL7A 1X37A 2VDBB 2FS1A 1SXJB 1NY5A 3AFHA 2HHHM 4FCWA 3AOEA 2FE8A 2KDLA 3FYCA 4DR1M 4NXMM 4LFAM 3B9PA 3FTEA 2KNAA 3B7ZA 2EA0A 1HT1E 1IY1A 4QHTA 1DGHB 3B74A 3DOAA 3J2PB 4FD2A 4P17A 3A42A 2M60A 4W5WA 2A5YB 2ZAOA 3H4JA 1ZQ9A 4FVMA 5A2QS 1I94M 4EIWA 2QCUA 1NVMA 2QP9X 2JA2A 2BWEA 2DWZB 4CGYB 1DGGA 2LH0A 4DR7M 3DFZA 3SAUA 2VF7A 1QZEA 4IBEA 3HHXA 2LNHC 4ANRA 2LVPC 1SXJD 2HCBA 2CFOA 3B7NA 4G4OA 3L29A 1NNJA 2F5NA 3SFZA 3SMSA 2JUJA 2DHYA 1WGLA 1L8QA 2BJWA 3E46A 3AV0A 3FTCA 1LV7A 2H5XA 1LTMA 3K8ZA 2BWBA 4Q7JA 2L4FA 3GLGB 3HY5A 3T6PA 3GPXA 1L2DA 2F5SA 4ITQA 2XSZA 3T1YM 4GITA 1GL7A 3M6AA 4FWGA 4Z6YA 4DUYM 3A45A 2VIIA 1QDRA 4I4LA 2Z4SA 2KA6B 4MGKE 3U5ZB 2K6BA 1Q02A 3THGA 3HHZA 4IIWA 1XXHB 2V1CA 2ZAMA 4R3DA 1OFIA 2DZNB 3SMPA 4RNAA 3LCUA 2R0IA 2WSEF 3W0LB 2L7HA 1EIJA 1TH4A 2F5PA 3CTWB 2BJVA 5DYIA 5EP1A 3VLFB 3UZUA 3R8FA 3D8LA 3I51A 1DO0A 1E32A 2EJSA 3GPPA 4FCVA 5GKNA 2WZJA 2YQZA 1D2NA 3D8BA 2GNOA 2F5QA 1GABA 4R71A 3QAUA 3JR4A 2EKFA 1N33M 3HU3A 4G4RA 5L8RF 1DV0A 4Z8XA 4RF1A 3T1HM 2DAKA 2DAMA 1T43A 4GH9A 3W0FA 4LGYA 1F4IA 1GVNA 3FRIA 3QYEA 4GC9A 1IBMM 5DNYA 4FWHA 2CHVA 4II7A 3TWMA 2R44A 2V6ZM 2ZBKB 3GLFA 3U6SA 1GO5A 4IJFA 4NSRA 1OIZA 2DHRA 2QBYA 4DR6M 2D7EA 1PRBA 3SASA 1D0MA 1TTEA 2XFSA 4JXJA 2UUCM 1GJTA 3K1JA 3UJNA 1UM8A 5ITRA 1QQWA 3J80S 3BBZA 1R6BX 4DR2M 4PDGA 3LMMA 4YY3M 1L1TA 3OTOM 5DYGA 1ZMVA 3HU1A 1Z6TA 3T15A 3U6OA 1Y8GA 3A98B 2HKJA 1HNXM 2J7NA 3ILKA 1IXZA 1Q39A 4R7GA 3VK8A 3GQ4A 3TWKA 1YSYA 4AG6A 4B3TM 2LVOC 1EE8A 3SAVA 1ZAEA 3A46A 3U6QA 1N32M 4AG5A
chains in the Genus database with same CATH topology
1R4GA 1VG5A 2QNJA 1ZMWA 2JY7A 3IECA 3E21A 2KNAA 3FRHA 3GLIE 1HT1E 3K9OA 1T6OA 3FE3A 3MMPA 2OOBA 2JY8A 2JZ0A 2LTUA 3H4JA 1WJ7A 4F2LA 1SG9A 1IFYA 5DFLA 2BWEA 2QHOB 1V92A 2G3QA 1QZEA 1AIPC 2LVPC 2DZLA 1XB2B 2L4EA 2JUJA 2DHYA 1WGLA 2MR9A 3E46A 1NV9A 2DAGA 2CP8A 3GLHE 2H5XA 3F92A 2BWBA 4Q7JA 2L4FA 3T6PA 2LVAA 1HT2E 1WIVA 1EFUB 1Q02A 1P3QQ 3IHPA 1BVSA 2OO9A 1ZV1A 2DNAA 4UN2B 3LCUA 1MN3A 2R0IA 3LCVB 1NV8A 2KNVA 2K9DA 2HAKA 2JNHA 1UFZA 1VQ1A 5JI2E 1DO0A 1PGYA 2B3TA 2EJSA 1VEKA 2WZJA 4DBGB 2ZTCA 2EKKA 2JZ1A 2JP7A 1OTRA 4R71A 4HEOA 1YLAA 2EKFA 1OQYA 4G3OA 4WP2A 4F1IA 1G3IA 3B89A 2JY6B 1DV0A 2RRUA 2CWBA 1TR8A 2HWJA 2DAKA 2DAMA 1T43A 3K9PA 1F4IA 3FRIA 1XXHE 1OAIA 2LVQD 1WHCA 1ZMUA 1VEJA 1GO5A 1IXSA 2KNZA 1HJPA 1JR3E 2JY5A 1DO2A 1HQYE 2DKLA 3GLFE 2QSFX 2ZTDA 1E94E 2LBCA 1TTEA 1G41A 1WGNA 2DAEA 2KHHA 3BBZA 4GEWA 2DENA 3GLGE 2K0BX 1KYIA 1OKSA 1ZMVA 2L2DA 2MJ5B 2O25A 2MROB 2LVNC 1Y8GA 1C7YA 2MGWA 2DI0A 1VDLA 2OOAA 1CUKA 1A5TA 1G4AE 1WR1B 2LVOC 2DAIA 1IM2A 1VEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4G A;  1VG5 A;  2QNJ A;  1ZMW A;  2JY7 A;  3IEC A;  3E21 A;  2KNA A;  3FRH A;  3GLI E;  1HT1 E;  3K9O A;  1T6O A;  3FE3 A;  3MMP A;  2OOB A;  2JY8 A;  2JZ0 A;  2LTU A;  3H4J A;  1WJ7 A;  4F2L A;  1SG9 A;  1IFY A;  5DFL A;  2BWE A;  2QHO B;  1V92 A;  2G3Q A;  1QZE A;  1AIP C;  2LVP C;  2DZL A;  1XB2 B;  2L4E A;  2JUJ A;  2DHY A;  1WGL A;  2MR9 A;  3E46 A;  1NV9 A;  2DAG A;  2CP8 A;  3GLH E;  2H5X A;  3F92 A;  2BWB A;  4Q7J A;  2L4F A;  3T6P A;  2LVA A;  1HT2 E;  1WIV A;  1EFU B;  1Q02 A;  1P3Q Q;  3IHP A;  1BVS A;  2OO9 A;  1ZV1 A;  2DNA A;  4UN2 B;  3LCU A;  1MN3 A;  2R0I A;  3LCV B;  1NV8 A;  2KNV A;  2K9D A;  2HAK A;  2JNH A;  1UFZ A;  1VQ1 A;  5JI2 E;  1DO0 A;  1PGY A;  2B3T A;  2EJS A;  1VEK A;  2WZJ A;  4DBG B;  2ZTC A;  2EKK A;  2JZ1 A;  2JP7 A;  1OTR A;  4R71 A;  4HEO A;  1YLA A;  2EKF A;  1OQY A;  4G3O A;  4WP2 A;  4F1I A;  1G3I A;  3B89 A;  2JY6 B;  1DV0 A;  2RRU A;  2CWB A;  1TR8 A;  2HWJ A;  2DAK A;  2DAM A;  1T43 A;  3K9P A;  1F4I A;  3FRI A;  1XXH E;  1OAI A;  2LVQ D;  1WHC A;  1ZMU A;  1VEJ A;  1GO5 A;  1IXS A;  2KNZ A;  1HJP A;  1JR3 E;  2JY5 A;  1DO2 A;  1HQY E;  2DKL A;  3GLF E;  2QSF X;  2ZTD A;  1E94 E;  2LBC A;  1TTE A;  1G41 A;  1WGN A;  2DAE A;  2KHH A;  3BBZ A;  4GEW A;  2DEN A;  3GLG E;  2K0B X;  1KYI A;  1OKS A;  1ZMV A;  2L2D A;  2MJ5 B;  2O25 A;  2MRO B;  2LVN C;  1Y8G A;  1C7Y A;  2MGW A;  2DI0 A;  1VDL A;  2OOA A;  1CUK A;  1A5T A;  1G4A E;  1WR1 B;  2LVO C;  2DAI A;  1IM2 A;  1VEG A; 
#chains in the Genus database with same CATH topology
 4M0D A;  2MH8 A;  4LJ6 A;  4MH0 E;  3GLH B;  3IEC A;  3VKG A;  2C5R A;  2DZO B;  2ZAN A;  3IG8 A;  3GLI E;  4JI5 M;  4OX9 M;  1T6O A;  1QUT A;  1HR0 M;  2O01 F;  3MMP A;  4IBI A;  4KT0 F;  4Y28 F;  2OOB A;  2JY8 A;  2JZ0 A;  4F2L A;  1SG9 A;  3SAR A;  2D7H A;  5JI3 E;  1QUS A;  4NOO B;  1G59 A;  2G8L A;  1YE9 A;  2FH0 A;  2R62 A;  4DR4 M;  3TQS A;  4IJE A;  2DWL A;  4QOZ C;  1J7K A;  3VKH A;  3PNV A;  5FLX S;  1TH3 A;  3U6L A;  1N34 M;  3HJQ A;  2F4V M;  4GIP A;  3LQR A;  3GLI A;  4OU7 A;  1IY2 A;  4LF8 M;  1NV9 A;  1J5E M;  2CP8 A;  3J27 B;  3QYB A;  2KRU A;  3I01 M;  2UXB M;  1N78 A;  2KXE A;  2Y21 A;  2Z4R A;  3KOY E;  2QQ8 A;  2XH9 A;  5C1B A;  3RGP A;  4GMQ A;  1W5S A;  4X65 M;  4JI1 M;  3QWL A;  1WIV A;  4XK8 F;  5C18 A;  5IZ7 D;  2Z8Y M;  1EFU B;  4KLN A;  3ZCB B;  3DA1 A;  2E5L M;  2C9O A;  1OFH A;  4DV2 M;  2M5Z A;  1BVS A;  2OO9 A;  1TH2 A;  2W82 A;  3SHF A;  1JR3 D;  4DV7 M;  3U6D A;  2DNA A;  4LZZ A;  3MJ5 A;  2F5O A;  4UN2 B;  3RGS A;  4QNR A;  1SXJ A;  3GPU A;  3KP1 E;  1HNZ M;  3KDS E;  3PVS A;  3Q8X A;  2JNH A;  1UFZ A;  1VQ1 A;  1PGY A;  2KRK A;  3SAW A;  4JI2 M;  1DGH A;  1QVR A;  2EKK A;  2DVW B;  3FUW A;  5EQT A;  3U60 B;  1Z5B A;  5EXX A;  1V33 A;  3I4V A;  2Q2E B;  4FW9 A;  4IBK A;  3J7A S;  1OQY A;  1GJS A;  5IT9 S;  3FD9 A;  1C1K A;  1I4W A;  2WSC F;  1NO1 A;  2Y0T A;  4DV0 M;  2CWB A;  1TR8 A;  3RE8 A;  2HWJ A;  2C98 A;  2O5R A;  3HKP A;  4PDI A;  3KS4 A;  3L26 A;  1R2Y A;  4K0K M;  4LJ7 A;  4IBJ A;  3K9P A;  3KOX E;  4X64 M;  1T3T A;  3CF6 E;  1XXH E;  1OAI A;  4MGI E;  4L78 A;  3W68 A;  4BBA A;  3U6E A;  1WHC A;  4GKK M;  4WW0 A;  1YUB A;  1KFV A;  1Z5A A;  1IN6 A;  3AOG A;  4RF0 A;  1HJP A;  1PJQ A;  3CF2 A;  1FJG M;  2R6F A;  1Q3C A;  4CJ6 A;  3GQ5 A;  1XNQ M;  3Q8G A;  3GLF E;  2ZTD A;  3B7Q A;  5E6J A;  3GLG A;  1KSF X;  2CV2 A;  4JV5 M;  1XNR M;  3GQ3 A;  4BB9 A;  2QEN A;  3M7G A;  1WGN A;  2DAE A;  4GEW A;  4L4U A;  2XSZ D;  4AKH A;  1R2Z A;  1V34 A;  3U5Z A;  4AKI A;  1OKS A;  4REZ A;  2L2D A;  4KHP M;  5KQ8 A;  2MRO B;  2LXE A;  1XXH A;  2JWS A;  4DR3 M;  3FUU A;  4L6V 6;  4PD2 A;  1XC8 A;  4BLC A;  1XMO M;  3NBX X;  4KO8 A;  4LRT A;  2OOA A;  3VDU A;  4FWD A;  1CUK A;  1QAO A;  1TDH A;  2RGO A;  3SHG B;  1TDZ A;  1IBL M;  4LF9 M;  3AOE C;  3KP0 E;  5KPT A;  1N36 M;  1WR1 B;  3HX3 A;  4DUZ M;  4JI0 M;  1XWI A;  1IM2 A;  4CIS A;  1R5L A;  1VEG A;  5LMU M;  1TGU A;  1R4G A;  1VG5 A;  2QNJ A;  1DGB A;  1ZMW A;  2DWM A;  4MGZ E;  1IN8 A;  3K2L A;  1NJG A;  4IBC A;  4M9Z A;  5ITX E;  3SC3 A;  3K9O A;  3SBJ A;  3FE3 A;  1GL6 A;  1FNN A;  4HLQ A;  2KZS A;  4AQY M;  1OJL A;  2LHC A;  2R4E A;  1WJ7 A;  2YR0 A;  1XMQ M;  4NRW A;  1GKI A;  3WHK A;  1IFY A;  4LRS A;  3T38 A;  3TWL A;  4JYA M;  3IG5 A;  2QHO B;  3FYD A;  8CAT A;  4HL4 A;  2I7P A;  1V92 A;  5FTM A;  2UXD M;  3M0E A;  2G3Q A;  4B3R M;  3UK6 A;  5BR8 M;  5EP3 A;  2L4E A;  1IBK M;  3W67 A;  4LJ8 A;  4MM3 B;  3L27 A;  1IXS B;  1E9S A;  5ITX A;  2MR9 A;  1PJI A;  5BPV A;  3U6C A;  2QPA A;  3GLH E;  3CGW A;  3TE6 A;  3F92 A;  2OPF A;  1D0L A;  2BNK A;  2Z7J A;  4JI7 M;  3BXW A;  1NSF A;  3AKZ A;  4DV5 M;  3U61 B;  2LVA A;  4YHH M;  1IXR C;  4IBG A;  5FSW A;  1HT2 E;  1N75 A;  4CHT B;  1HNW M;  2FOI C;  1J09 A;  2FFJ A;  2APL A;  5KQD A;  1PJT A;  4DV1 M;  3EIE A;  1P3Q Q;  3IHP A;  4KOD A;  4NL4 H;  2GQF A;  4B08 A;  4DV4 M;  1ZV1 A;  5ITT A;  4OVZ B;  4M0W A;  3VFD A;  5LMN M;  4LF6 M;  1Q3B A;  3FTD A;  4IBD A;  4MGH A;  3H4M A;  1NV8 A;  3LCV B;  4D81 A;  2XZF A;  2KNV A;  3GRR A;  4MB7 A;  3GLH A;  3PXG A;  2HAK A;  4LF5 M;  4QOS A;  4JI4 M;  5JI2 E;  4LY6 A;  2B3T A;  2AHM A;  2XGN A;  1SXJ E;  1VEK A;  5ITY A;  1QDT A;  4LFB M;  4DBG B;  2N35 A;  4ZPX A;  4LJ4 A;  3BOS A;  3E9S A;  1YLA A;  1NY6 A;  4HEO A;  4LGM A;  3NBI A;  2ZM6 M;  3U6P A;  1L1Z A;  2CRU A;  2XZU A;  1IN4 A;  4WP2 A;  1OIP A;  1G3I A;  1PJS A;  2CHQ A;  3B89 A;  1QAQ A;  2JY6 B;  1NJF A;  2RRU A;  5EP4 A;  4NSO B;  4LF7 M;  2L6O A;  2X8A A;  3KW6 A;  2UUB M;  1H6U A;  5H37 D;  4JI6 M;  2QZ4 A;  4B7G A;  3GPY A;  3ZQJ A;  1D0K A;  1ZMU A;  2J5Y A;  2J7O A;  5KO3 A;  1N77 A;  4FCT A;  4OW0 A;  2Y0Q A;  4L15 A;  2KNZ A;  1Z59 A;  3FUX A;  3ZH9 B;  4G6Z A;  2K47 A;  2JY5 A;  1DGF A;  4JI3 M;  1HQY E;  2DKL A;  3I04 M;  4F1I A;  2QSF X;  4MGY E;  4AW4 A;  1E94 E;  1NNU C;  4IBB A;  1K82 A;  1TF0 B;  3HJS A;  4NC6 A;  3WHL A;  4DV3 M;  2ERC A;  3SYK A;  3GLG E;  2LHG A;  4B3S M;  1RU3 A;  2MJ5 B;  3HJ8 A;  1AUA A;  3GRV A;  3GP1 A;  3AJI B;  3FTF A;  4CIZ A;  5F3W A;  1C7Y A;  1K3W A;  2MGW A;  2DI0 A;  3LVV A;  1G8P A;  1VDL A;  4LCB A;  4X66 M;  1IQP A;  3C3E A;  2DAI A;  4WUR A;  2XFT A;  4JI8 M;  1W5T A;  2C99 A;  2YFQ A;  3MHV C;  2R45 A;  2CE7 A;  5EP2 A;  4G4Q A;  2OQ4 A;  5FTN A;  1JB0 F;  4DV6 M;  4I5S A;  4L16 A;  2JY7 A;  3E21 A;  3KSX A;  3JR5 A;  3U60 A;  5EXT A;  3FRH A;  3FUV A;  2FNA A;  1VDD A;  4AKG A;  1IN7 A;  1L2C A;  3AL0 C;  3HWS A;  4QHS A;  2LTU A;  2DWN A;  5ITQ A;  5EJC A;  3JAM S;  5IWA M;  1IN5 A;  3KVW A;  5DFL A;  5ITU A;  1QZM A;  2KZU A;  2XF3 A;  4PCZ A;  3DZD A;  2DXI A;  4IBF A;  4XGI A;  2I7N A;  4LJ9 A;  4P16 A;  3SAT A;  4I8O A;  2KW0 A;  3I4Y A;  1AIP C;  3J81 S;  3KFU G;  3VK7 A;  3PNY A;  3KXE C;  2DZL A;  7CAT A;  1XB2 B;  3HHY A;  3V76 A;  2V1U A;  5FTJ A;  2CV0 A;  3GLF B;  2XEP A;  2R46 A;  2VQF M;  1JQJ C;  4AI6 A;  2H1R A;  2YNM D;  3UGJ A;  2QBY B;  2DAG A;  3EIH A;  4GC5 A;  3TPZ A;  2CUZ A;  4I81 A;  2C9C A;  3LVW A;  4B7H A;  2WSF F;  4NRV A;  2UXC M;  2UUA M;  1Z5C A;  2Z3X A;  4RKU F;  1SXJ C;  1NHG C;  4DR5 M;  1E9R A;  2C96 A;  4S12 A;  4GHA A;  3R9X B;  4D80 A;  3RFW A;  2G5G X;  4AZF A;  5EXP A;  2X4A A;  1MN3 A;  3LQQ A;  5EXS A;  4GRI A;  1PM5 A;  3KSJ A;  2CHG A;  3HZJ A;  3J7B A;  2K9D A;  5FTK A;  2UU9 M;  4JN6 A;  3FUT A;  3SYL A;  2X49 A;  3U6M A;  3L25 A;  4LG2 A;  1R7R A;  2ZTC A;  2JZ1 A;  1PJJ A;  4PT5 A;  2JP7 A;  1OTR A;  2LWX A;  1ORY B;  5E26 A;  3GO8 A;  4LF4 M;  2L7I A;  2R4J A;  4XBO A;  4D82 A;  1IY0 A;  4G3O A;  1K3X A;  2CV1 A;  5KPZ A;  3UMM A;  4GHL A;  4G4N A;  2RGH A;  1QAN A;  3L28 A;  4LJA A;  4LZJ A;  3C3D A;  3KS8 A;  3CF0 A;  2R65 A;  5KPR A;  2VF8 A;  3LW5 F;  2P5T A;  3C58 A;  2LVQ D;  3GRU A;  3TL4 X;  2KEB A;  5FTL A;  1WXQ A;  4QNM A;  3C9P A;  5IRE B;  1VEJ A;  3KOW E;  1IXS A;  2EO2 A;  2VQE M;  1S3S A;  1JR3 E;  1MX0 A;  1DO2 A;  2RKO A;  1OAO C;  2JXN A;  4B7F A;  2L09 A;  4B3M M;  1G71 A;  2LBC A;  4A3V B;  3GLI B;  1G41 A;  1NHW C;  3U61 A;  2NQ8 C;  1XHB A;  1GLN A;  1QAM A;  3PFI A;  4GKJ M;  2KHH A;  3HGI A;  4TUW A;  4M9S A;  3K92 A;  2DEN A;  2Y20 A;  2EUC A;  2K0B X;  3GRY A;  1HQC A;  1KYI A;  1MJG M;  2CEA A;  2O25 A;  2XLJ A;  3NWL A;  2LVN C;  4LFC M;  2D7G A;  3HU2 A;  4M9X A;  2R18 A;  1L2B A;  3MK6 A;  4OVZ A;  3HHW A;  3ZC7 B;  4NXN M;  3KOZ E;  3FKE A;  4X62 M;  3E4R A;  3VDP A;  1A5T A;  1QYR A;  1G4A E;  4LJ5 A;  1JR3 A;  4L8R C;  3L2A A;  1MU5 A;  2HL7 A;  1X37 A;  2VDB B;  2FS1 A;  1SXJ B;  1NY5 A;  3AFH A;  2HHH M;  4FCW A;  3AOE A;  2FE8 A;  2KDL A;  3FYC A;  4DR1 M;  4NXM M;  4LFA M;  3B9P A;  3FTE A;  2KNA A;  3B7Z A;  2EA0 A;  1HT1 E;  1IY1 A;  4QHT A;  1DGH B;  3B74 A;  3DOA A;  3J2P B;  4FD2 A;  4P17 A;  3A42 A;  2M60 A;  4W5W A;  2A5Y B;  2ZAO A;  3H4J A;  1ZQ9 A;  4FVM A;  5A2Q S;  1I94 M;  4EIW A;  2QCU A;  1NVM A;  2QP9 X;  2JA2 A;  2BWE A;  2DWZ B;  4CGY B;  1DGG A;  2LH0 A;  4DR7 M;  3DFZ A;  3SAU A;  2VF7 A;  1QZE A;  4IBE A;  3HHX A;  2LNH C;  4ANR A;  2LVP C;  1SXJ D;  2HCB A;  2CFO A;  3B7N A;  4G4O A;  3L29 A;  1NNJ A;  2F5N A;  3SFZ A;  3SMS A;  2JUJ A;  2DHY A;  1WGL A;  1L8Q A;  2BJW A;  3E46 A;  3AV0 A;  3FTC A;  1LV7 A;  2H5X A;  1LTM A;  3K8Z A;  2BWB A;  4Q7J A;  2L4F A;  3GLG B;  3HY5 A;  3T6P A;  3GPX A;  1L2D A;  2F5S A;  4ITQ A;  2XSZ A;  3T1Y M;  4GIT A;  1GL7 A;  3M6A A;  4FWG A;  4Z6Y A;  4DUY M;  3A45 A;  2VII A;  1QDR A;  4I4L A;  2Z4S A;  2KA6 B;  4MGK E;  3U5Z B;  2K6B A;  1Q02 A;  3THG A;  3HHZ A;  4IIW A;  1XXH B;  2V1C A;  2ZAM A;  4R3D A;  1OFI A;  2DZN B;  3SMP A;  4RNA A;  3LCU A;  2R0I A;  2WSE F;  3W0L B;  2L7H A;  1EIJ A;  1TH4 A;  2F5P A;  3CTW B;  2BJV A;  5DYI A;  5EP1 A;  3VLF B;  3UZU A;  3R8F A;  3D8L A;  3I51 A;  1DO0 A;  1E32 A;  2EJS A;  3GPP A;  4FCV A;  5GKN A;  2WZJ A;  2YQZ A;  1D2N A;  3D8B A;  2GNO A;  2F5Q A;  1GAB A;  4R71 A;  3QAU A;  3JR4 A;  2EKF A;  1N33 M;  3HU3 A;  4G4R A;  5L8R F;  1DV0 A;  4Z8X A;  4RF1 A;  3T1H M;  2DAK A;  2DAM A;  1T43 A;  4GH9 A;  3W0F A;  4LGY A;  1F4I A;  1GVN A;  3FRI A;  3QYE A;  4GC9 A;  1IBM M;  5DNY A;  4FWH A;  2CHV A;  4II7 A;  3TWM A;  2R44 A;  2V6Z M;  2ZBK B;  3GLF A;  3U6S A;  1GO5 A;  4IJF A;  4NSR A;  1OIZ A;  2DHR A;  2QBY A;  4DR6 M;  2D7E A;  1PRB A;  3SAS A;  1D0M A;  1TTE A;  2XFS A;  4JXJ A;  2UUC M;  1GJT A;  3K1J A;  3UJN A;  1UM8 A;  5ITR A;  1QQW A;  3J80 S;  3BBZ A;  1R6B X;  4DR2 M;  4PDG A;  3LMM A;  4YY3 M;  1L1T A;  3OTO M;  5DYG A;  1ZMV A;  3HU1 A;  1Z6T A;  3T15 A;  3U6O A;  1Y8G A;  3A98 B;  2HKJ A;  1HNX M;  2J7N A;  3ILK A;  1IXZ A;  1Q39 A;  4R7G A;  3VK8 A;  3GQ4 A;  3TWK A;  1YSY A;  4AG6 A;  4B3T M;  2LVO C;  1EE8 A;  3SAV A;  1ZAE A;  3A46 A;  3U6Q A;  1N32 M;  4AG5 A; 
#chains in the Genus database with same CATH homology
 1R4G A;  1VG5 A;  2QNJ A;  1ZMW A;  2JY7 A;  3IEC A;  3E21 A;  2KNA A;  3FRH A;  3GLI E;  1HT1 E;  3K9O A;  1T6O A;  3FE3 A;  3MMP A;  2OOB A;  2JY8 A;  2JZ0 A;  2LTU A;  3H4J A;  1WJ7 A;  4F2L A;  1SG9 A;  1IFY A;  5DFL A;  2BWE A;  2QHO B;  1V92 A;  2G3Q A;  1QZE A;  1AIP C;  2LVP C;  2DZL A;  1XB2 B;  2L4E A;  2JUJ A;  2DHY A;  1WGL A;  2MR9 A;  3E46 A;  1NV9 A;  2DAG A;  2CP8 A;  3GLH E;  2H5X A;  3F92 A;  2BWB A;  4Q7J A;  2L4F A;  3T6P A;  2LVA A;  1HT2 E;  1WIV A;  1EFU B;  1Q02 A;  1P3Q Q;  3IHP A;  1BVS A;  2OO9 A;  1ZV1 A;  2DNA A;  4UN2 B;  3LCU A;  1MN3 A;  2R0I A;  3LCV B;  1NV8 A;  2KNV A;  2K9D A;  2HAK A;  2JNH A;  1UFZ A;  1VQ1 A;  5JI2 E;  1DO0 A;  1PGY A;  2B3T A;  2EJS A;  1VEK A;  2WZJ A;  4DBG B;  2ZTC A;  2EKK A;  2JZ1 A;  2JP7 A;  1OTR A;  4R71 A;  4HEO A;  1YLA A;  2EKF A;  1OQY A;  4G3O A;  4WP2 A;  4F1I A;  1G3I A;  3B89 A;  2JY6 B;  1DV0 A;  2RRU A;  2CWB A;  1TR8 A;  2HWJ A;  2DAK A;  2DAM A;  1T43 A;  3K9P A;  1F4I A;  3FRI A;  1XXH E;  1OAI A;  2LVQ D;  1WHC A;  1ZMU A;  1VEJ A;  1GO5 A;  1IXS A;  2KNZ A;  1HJP A;  1JR3 E;  2JY5 A;  1DO2 A;  1HQY E;  2DKL A;  3GLF E;  2QSF X;  2ZTD A;  1E94 E;  2LBC A;  1TTE A;  1G41 A;  1WGN A;  2DAE A;  2KHH A;  3BBZ A;  4GEW A;  2DEN A;  3GLG E;  2K0B X;  1KYI A;  1OKS A;  1ZMV A;  2L2D A;  2MJ5 B;  2O25 A;  2MRO B;  2LVN C;  1Y8G A;  1C7Y A;  2MGW A;  2DI0 A;  1VDL A;  2OOA A;  1CUK A;  1A5T A;  1G4A E;  1WR1 B;  2LVO C;  2DAI A;  1IM2 A;  1VEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...