2JZ0A

Dsx_short
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
b'GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein doublesex
molecule tags Transcription
source organism Drosophila melanogaster
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
total genus 19
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz0A00
3E21A 1G41A 3F92A 2KNVA 2KHHA 2QNJA 1UFZA 1SG9A 2CP8A 4Q7JA 2QHOB 2K9DA 4UN2B 1V92A 1NV8A 3LCVB 3FRIA 2MGWA 1VDLA 2L2DA 1DV0A 2LVPC 1G3IA 2K0BX 1OQYA 2BWBA 1BVSA 2JY8A 2DAKA 2LVAA 3T6PA 2B3TA 1R4GA 2JUJA 1EFUB 3FRHA 3K9OA 4G3OA 2L4EA 1VEGA 1XXHE 2JY6B 1F4IA 3BBZA 1HJPA 4F2LA 2WZJA 1OTRA 1CUKA 1TR8A 1VQ1A 1WIVA 2LVNC 2CWBA 1OAIA 1P3QQ 2LBCA 4HEOA 1QZEA 4WP2A 4F1IA 4DBGB 3H4JA 1ZV1A 1JR3E 3GLIE 2MR9A 3IECA 1WGLA 1KYIA 2LTUA 2DHYA 1PGYA 2DAMA 3GLFE 1IM2A 2OOAA 3LCUA 3FE3A 1NV9A 2JY5A 1ZMVA 2BWEA 2OO9A 2DNAA 2H5XA 2JY7A 2L4FA 5DFLA 4R71A 2OOBA 2KNAA 3E46A 1Y8GA 2LVOC 1DO0A 3IHPA 1WJ7A 2JNHA 1TTEA 1VEJA 2G3QA 1E94E 2DKLA 3GLGE 2HAKA 3B89A 1T6OA 1WHCA 2DAGA 1IXSA 2JP7A 2MROB 2QSFX 2LVQD 1VG5A 3MMPA 2DI0A 2R0IA 1HQYE 2MJ5B 1A5TA 2ZTCA 2ZTDA 1IFYA 1WR1B 1T43A 1HT2E 2JZ0A 1C7YA 1OKSA 1ZMWA 1XB2B 2KNZA 1YLAA 2O25A 1ZMUA 2DZLA 3K9PA 1AIPC 1G4AE 1DO2A 2DAIA 1GO5A 2JZ1A 1MN3A 2DENA 2HWJA 1Q02A 5JI2E 4GEWA 3GLHE 2EKKA 2EJSA 1VEKA 1HT1E 2DAEA 2RRUA 2EKFA 1WGNA
chains in the Genus database with same CATH superfamily
1OIZA 1G41A 1PJIA 3A98B 1L1TA 3FYCA 5KPRA 1N78A 2QNJA 1JR3A 3J2PB 3GLIA 2LWXA 2QCUA 2V1CA 3KSJA 1XMOM 3SHFA 1QUTA 4OW0A 1OJLA 4D80A 3M0EA 4AQYM 1HNXM 3U5ZA 4XK8F 3GLFA 1J5EM 2QBYA 1AUAA 1KSFX 4QNMA 1OFHA 3PNVA 3J7AS 2QENA 4IBEA 5C18A 1DV0A 1XNRM 3U6QA 1SXJD 1OQYA 2BWBA 3T1HM 1J09A 2JWSA 2JY8A 1YSYA 1IBMM 2LVAA 2I7NA 4L4UA 5GKNA 3ZC7B 3U6SA 2HHHM 3T6PA 4PD2A 1IN8A 1QYRA 3Q8GA 1Z5CA 3D8LA 3HU3A 1R4GA 5EXXA 2CE7A 4L78A 4JI8M 3FRHA 2L4EA 2R4JA 3UMMA 4LZJA 1VEGA 3CGWA 1NVMA 2D7GA 2DWZB 1XXHB 2X8AA 3BBZA 3FKEA 4B7HA 3T1YM 1XMQM 2Q2EB 3SMPA 3HKPA 3BXWA 4LF4M 1OTRA 2OQ4A 2KZSA 1XC8A 3ILKA 3TWMA 4REZA 3L27A 2VQEM 1TR8A 1N32M 2C5RA 5EP1A 4G4OA 2G8LA 2A5YB 4OVZA 4RF1A 4LJ7A 1P3QQ 3K8ZA 5E26A 3AKZA 3GO8A 1K3WA 3D8BA 2F4VM 5BPVA 3NBIA 2Z8YM 3GQ3A 4CIZA 2UUCM 2UXBM 3K92A 4AW4A 3T15A 4G4RA 3E4RA 4FD2A 1IM2A 3AL0C 3U6PA 3LVWA 2DZOB 4QHSA 3L25A 5IZ7D 2C99A 1IXRC 2JY7A 5FTNA 3JR4A 4JI6M 4LF6M 3SMSA 3HJQA 1W5SA 4K0KM 2XEPA 4JYAM 1MU5A 2Y0QA 4DR1M 1Y8GA 2DHRA 4JXJA 2LVOC 3SAWA 1QAOA 2XFSA 4LJ9A 3RGPA 4FCWA 3GPUA 3GLHB 1IN5A 5FTLA 1VEJA 2XSZA 3DFZA 2FS1A 3TPZA 5KO3A 1VDDA 4R7GA 5EXSA 2JXNA 5ITUA 1T6OA 5LMUM 1WHCA 3I01M 2XZUA 2DWNA 3E9SA 2JP7A 4ITQA 2FH0A 4IJFA 3HHXA 4M9ZA 3KOWE 2L7IA 4X62M 3HHZA 5F3WA 1K3XA 3HJ8A 2DI0A 2LNHC 4IBJA 1ORYB 3W67A 1HQYE 1S3SA 1R2ZA 1TDZA 4NSOB 4NSRA 2UXCM 2YNMD 1OFIA 3GRYA 3LW5F 4LY6A 3WHLA 2VDBB 4DV5M 2RGOA 3DZDA 3KVWA 1T43A 4MGIE 3LMMA 5EP4A 1C1KA 4DV1M 4GHLA 1WXQA 1DGGA 4KHPM 5L8RF 4LF7M 1DGFA 1AIPC 3FUVA 2X49A 5JI2E 1Q02A 5A2QS 2C9CA 4IBDA 4GKJM 4L15A 3NBXX 3U60B 2EKKA 2L6OA 4LFAM 3L26A 4L6V6 1IN6A 1Z5AA 4GKKM 4LGYA 2LVQD 2UXDM 5E6JA 4MGYE 5IT9S 1FNNA 1NHGC 1GJSA 1R7RA 4LCBA 5KQ8A 2CP8A 4PDGA 1N77A 1EIJA 5ITYA 3UK6A 3U6CA 1GL6A 1V92A 2W82A 4JI2M 4GC9A 5FLXS 1IBKM 1QUSA 2V6ZM 3SYKA 4G4NA 1VDLA 3C9PA 3U61B 4LFBM 4DR6M 1BVSA 3HJSA 4MH0E 4GH9A 1PJSA 3FTEA 3R9XB 2ZM6M 1E9SA 2B3TA 3U6EA 4IIWA 3U60A 4AKGA 3QAUA 3VKGA 3LQRA 1QAMA 4G3OA 3GQ4A 4I5SA 4LG2A 3RFWA 3VK7A 2Z7JA 2CUZA 3SFZA 1HR0M 4JI5M 4PT5A 4OU7A 2UU9M 4KT0F 3I04M 4JI3M 4DR4M 3GRUA 3GRRA 2GQFA 2DVWB 2YQZA 3ZCBB 4Z6YA 4GHAA 1Q3CA 2LVNC 3AOEA 2CWBA 3AV0A 1MX0A 1QVRA 3KOYE 1HNZM 5DYGA 2Y21A 3HHWA 2KA6B 4DBGB 3CTWB 4AG6A 1JR3E 2R65A 3KDSE 3LQQA 3FUUA 2QBYB 1JB0F 4GIPA 1ZAEA 5EXPA 2Z3XA 3MJ5A 1G8PA 2OOAA 3QYBA 1LV7A 2Z4SA 2APLA 2CV1A 2N35A 2OO9A 4IBCA 2L4FA 4R71A 4X64M 3OTOM 4JV5M 3C3EA 4EIWA 3E46A 2CHVA 5BR8M 1QQWA 3CF0A 3SASA 1IBLM 4MGZE 3FTFA 2FFJA 4M0WA 3KSXA 4LJ5A 4CHTB 1NJFA 1DO0A 2XSZD 1WJ7A 2Y0TA 3IHPA 5EP3A 2CHQA 2JNHA 1TTEA 5FTJA 1OAOC 3THGA 1QAQA 4GMQA 1NY6A 2MROB 2QSFX 4IBKA 1J7KA 1NY5A 3HWSA 1Z5BA 3C3DA 2P5TA 3CF6E 4NXMM 2KEBA 4MB7A 2WSEF 4RKUF 2J5YA 1L8QA 1DGHA 1SXJE 2ZTDA 4B3SM 4AI6A 3RE8A 1XB2B 3WHKA 3I4VA 1ZQ9A 2KNZA 2R44A 5KQDA 2O25A 1HNWM 4QOZC 4CGYB 2O01F 4LJAA 1XXHA 2VF8A 1FJGM 2JZ1A 2DENA 4LJ8A 4FWHA 2CFOA 1DGHB 4GEWA 4LGMA 3MHVC 4DR7M 4YHHM 3R8FA 2H1RA 2BJWA 4X66M 2YFQA 1WGNA 1EE8A 2EA0A 4NRWA 4B7FA 1IY1A 1TGUA 3E21A 2AHMA 2FNAA 4B08A 4TUWA 3F92A 4DR2M 2KNVA 2QPAA 1N33M 1UFZA 1SG9A 2F5SA 4L8RC 4PDIA 1XNQM 4Q7JA 2QHOB 4KODA 2VIIA 4FCVA 1TH3A 2D7HA 3M7GA 5C1BA 4L16A 4UN2B 2M5ZA 1HQCA 1NV8A 2FE8A 2K47A 3TQSA 2XZFA 4AZFA 3SC3A 4GITA 4R3DA 2MGWA 2L2DA 4RF0A 1D0MA 3HU1A 1GVNA 4LRSA 2K0BX 1L2CA 2V1UA 4AG5A 3KW6A 2KW0A 3L28A 2HCBA 2Y20A 5EXTA 2LHCA 3UGJA 2HKJA 2KRKA 3B7QA 4CJ6A 1G71A 3J27B 1IY2A 3GLGA 3AOGA 1XXHE 4DV2M 4DV7M 2JY6B 4X65M 1W5TA 3K2LA 5FSWA 2DWMA 2C9OA 3B7NA 1HJPA 2WZJA 3FTDA 1QDRA 3GQ5A 1OIPA 4BBAA 1N75A 4DV3M 3A46A 4DUYM 1PM5A 1Z6TA 2XF3A 3A45A 2ZAOA 3PVSA 2R46A 4WURA 3KP1E 4S12A 2F5PA 4LFCM 4RNAA 1GL7A 3LVVA 2R45A 1QZEA 4WP2A 2OPFA 3H4JA 5IWAM 1ZV1A 3PFIA 3W0FA 4NC6A 4FW9A 1WGLA 2R62A 4NL4H 2G5GX 4CISA 1LTMA 7CATA 1H6UA 3SAVA 3GRVA 3ZQJA 3VFDA 2VF7A 2K6BA 3HU2A 3GLHA 4AKHA 3KOZE 4QOSA 1NV9A 3U61A 3W0LB 2Z4RA 2JY5A 2C96A 2XFTA 3IG8A 2BWEA 4HLQA 2M60A 2H5XA 5DFLA 5JI3E 2CRUA 2OOBA 1E32A 3FTCA 4LF8M 4BB9A 3T38A 4QHTA 5EQTA 4D81A 4JI4M 3TWLA 1NSFA 3HX3A 1Q39A 3GP1A 1L2DA 1TF0B 1TH2A 1E94E 2DKLA 1X37A 2L7HA 3W68A 2VQFM 2HAKA 3KFUG 2DAGA 3KS8A 1T3TA 2JA2A 4FWGA 4OVZB 3ZH9B 1TH4A 2R6FA 3GPXA 3GLFB 2DWLA 3VDPA 1PJTA 2ZAMA 3GPPA 3CF2A 3MMPA 3JAMS 4LF9M 3DOAA 2R0IA 4JN6A 3EIHA 1IXSB 2MJ5B 1A5TA 3J80S 1IFYA 2QP9X 2WSCF 4P17A 2X4AA 3SHGB 1WR1B 4G6ZA 1C7YA 1I4WA 1NJGA 5IREB 4IBIA 1YLAA 2RGHA 5EJCA 1PRBA 3VDUA 4I81A 5FTKA 4DV0M 4GRIA 2QZ4A 4KLNA 3HHYA 4B3TM 2F5OA 4W5WA 1RU3A 1PJJA 1K82A 3IG5A 2MH8A 3SARA 1GO5A 1DO2A 2DAIA 4AKIA 1NNJA 1V34A 3FYDA 1L1ZA 1IXZA 4IBGA 2F5NA 4OX9M 3JR5A 2EJSA 1Q3BA 1VEKA 4IBBA 4ZPXA 3V76A 4NRVA 2DAEA 2RRUA 3J81S 4D82A 5KPTA 1SXJC 4KO8A 5KPZA 3TE6A 2XH9A 3K1JA 1NHWC 4A3VB 2KHHA 3AJIB 5ITXE 3DA1A 3HY5A 4PCZA 1F4IA 1KFVA 1PJQA 1JR3D 3QYEA 4LZZA 3QWLA 4M9SA 3SYLA 2XLJA 2K9DA 2UUBM 2J7OA 2KXEA 2BNKA 2YR0A 2QQ8A 3LCVB 3SBJA 3KOXE 1R2YA 3L2AA 2NQ8C 3FRIA 4NOOB 2GNOA 5H37D 1IN7A 2LVPC 3VK8A 1G3IA 3U6OA 2XGNA 2WSFF 1SXJA 2LXEA 4WW0A 2DAKA 4M0DA 3KXEC 2ZBKB 3RGSA 4DUZM 5ITTA 3L29A 5EP2A 2CHGA 1QZMA 3FUXA 1IN4A 2BJVA 4LJ6A 1IQPA 1YE9A 2JUJA 4GC5A 1EFUB 4ANRA 4MGKE 4BLCA 3KS4A 2L09A 3K9OA 3U6MA 3FD9A 2UUAM 1TDHA 4Z8XA 3U6DA 4FCTA 1G59A 2RKOA 5ITRA 3I4YA 2HL7A 1NO1A 4FVMA 2D7EA 4F2LA 1JQJC 3HGIA 3TWKA 1CUKA 2DXIA 2CV0A 4LF5M 2O5RA 1VQ1A 3GPYA 2R4EA 1Z59A 1WIVA 4I4LA 4P16A 2ERCA 1OAIA 1L2BA 2LBCA 1E9RA 4HEOA 4F1IA 4M9XA 2R18A 1UM8A 3PNYA 3GLIE 4B7GA 2F5QA 1I94M 2MR9A 3IECA 3SAUA 1KYIA 2LTUA 2DHYA 1PGYA 2J7NA 1XWIA 2DAMA 3KP0E 3GLFE 3SATA 2CV2A 4LJ4A 3LCUA 3C58A 1SXJB 4DV6M 3FE3A 4NXNM 1D0LA 2EUCA 4JI1M 1N34M 1ZMVA 4DR5M 2DNAA 1MJGM 1GABA 2KNAA 2CEAA 4B3MM 3AOEC 4JI7M 5ITXA 2KZUA 3U5ZB 4II7A 4DV4M 2FOIC 2LH0A 2G3QA 3FUWA 3MK6A 2DZNB 3GLIB 3GLGE 3B89A 3TL4X 1YUBA 1IXSA 2LHGA 3EIEA 3HZJA 3B74A 1GLNA 1D0KA 2KRUA 3VLFB 1DGBA 4IBFA 8CATA 4G4QA 1VG5A 2ZANA 2KDLA 3A42A 4MM3B 2E5LM 4MGHA 1NNUC 3BOSA 4IJEA 3PXGA 4Y28F 3H4MA 5DNYA 2C98A 1IY0A 2ZTCA 3B9PA 3J7BA 5FTMA 1HT2E 2JZ0A 1OKSA 1ZMWA 1QANA 2I7PA 5DYIA 1N36M 3Q8XA 4XBOA 2EO2A 3B7ZA 1ZMUA 4B3RM 2DZLA 1V33A 3AFHA 4FWDA 1XHBA 4YY3M 1QDTA 1GJTA 3FUTA 1R6BX 3I51A 3K9PA 3M6AA 1GKIA 5LMNM 3NWLA 4QNRA 1G4AE 3UZUA 3VKHA 3UJNA 1MN3A 3GLGB 1D2NA 2HWJA 3U6LA 4HL4A 3GLHE 4LRTA 1HT1E 1R5LA 4XGIA 4JI0M 4DR3M 5ITQA 4I8OA 2EKFA
chains in the Genus database with same CATH topology
3E21A 1G41A 3F92A 2KNVA 2KHHA 2QNJA 1UFZA 1SG9A 2CP8A 4Q7JA 2QHOB 2K9DA 4UN2B 1V92A 1NV8A 3LCVB 3FRIA 2MGWA 1VDLA 2L2DA 1DV0A 2LVPC 1G3IA 2K0BX 1OQYA 2BWBA 1BVSA 2JY8A 2DAKA 2LVAA 3T6PA 2B3TA 1R4GA 2JUJA 1EFUB 3FRHA 3K9OA 4G3OA 2L4EA 1VEGA 1XXHE 2JY6B 1F4IA 3BBZA 1HJPA 4F2LA 2WZJA 1OTRA 1CUKA 1TR8A 1VQ1A 1WIVA 2LVNC 2CWBA 1OAIA 1P3QQ 2LBCA 4HEOA 1QZEA 4WP2A 4F1IA 4DBGB 3H4JA 1ZV1A 1JR3E 3GLIE 2MR9A 3IECA 1WGLA 1KYIA 2LTUA 2DHYA 1PGYA 2DAMA 3GLFE 1IM2A 2OOAA 3LCUA 3FE3A 1NV9A 2JY5A 1ZMVA 2BWEA 2OO9A 2DNAA 2H5XA 2JY7A 2L4FA 5DFLA 4R71A 2OOBA 2KNAA 3E46A 1Y8GA 2LVOC 1DO0A 3IHPA 1WJ7A 2JNHA 1TTEA 1VEJA 2G3QA 1E94E 2DKLA 3GLGE 2HAKA 3B89A 1T6OA 1WHCA 2DAGA 1IXSA 2JP7A 2MROB 2QSFX 2LVQD 1VG5A 3MMPA 2DI0A 2R0IA 1HQYE 2MJ5B 1A5TA 2ZTCA 2ZTDA 1IFYA 1WR1B 1T43A 1HT2E 2JZ0A 1C7YA 1OKSA 1ZMWA 1XB2B 2KNZA 1YLAA 2O25A 1ZMUA 2DZLA 3K9PA 1AIPC 1G4AE 1DO2A 2DAIA 1GO5A 2JZ1A 1MN3A 2DENA 2HWJA 1Q02A 5JI2E 4GEWA 3GLHE 2EKKA 2EJSA 1VEKA 1HT1E 2DAEA 2RRUA 2EKFA 1WGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E21 A;  1G41 A;  3F92 A;  2KNV A;  2KHH A;  2QNJ A;  1UFZ A;  1SG9 A;  2CP8 A;  4Q7J A;  2QHO B;  2K9D A;  4UN2 B;  1V92 A;  1NV8 A;  3LCV B;  3FRI A;  2MGW A;  1VDL A;  2L2D A;  1DV0 A;  2LVP C;  1G3I A;  2K0B X;  1OQY A;  2BWB A;  1BVS A;  2JY8 A;  2DAK A;  2LVA A;  3T6P A;  2B3T A;  1R4G A;  2JUJ A;  1EFU B;  3FRH A;  3K9O A;  4G3O A;  2L4E A;  1VEG A;  1XXH E;  2JY6 B;  1F4I A;  3BBZ A;  1HJP A;  4F2L A;  2WZJ A;  1OTR A;  1CUK A;  1TR8 A;  1VQ1 A;  1WIV A;  2LVN C;  2CWB A;  1OAI A;  1P3Q Q;  2LBC A;  4HEO A;  1QZE A;  4WP2 A;  4F1I A;  4DBG B;  3H4J A;  1ZV1 A;  1JR3 E;  3GLI E;  2MR9 A;  3IEC A;  1WGL A;  1KYI A;  2LTU A;  2DHY A;  1PGY A;  2DAM A;  3GLF E;  1IM2 A;  2OOA A;  3LCU A;  3FE3 A;  1NV9 A;  2JY5 A;  1ZMV A;  2BWE A;  2OO9 A;  2DNA A;  2H5X A;  2JY7 A;  2L4F A;  5DFL A;  4R71 A;  2OOB A;  2KNA A;  3E46 A;  1Y8G A;  2LVO C;  1DO0 A;  3IHP A;  1WJ7 A;  2JNH A;  1TTE A;  1VEJ A;  2G3Q A;  1E94 E;  2DKL A;  3GLG E;  2HAK A;  3B89 A;  1T6O A;  1WHC A;  2DAG A;  1IXS A;  2JP7 A;  2MRO B;  2QSF X;  2LVQ D;  1VG5 A;  3MMP A;  2DI0 A;  2R0I A;  1HQY E;  2MJ5 B;  1A5T A;  2ZTC A;  2ZTD A;  1IFY A;  1WR1 B;  1T43 A;  1HT2 E;  2JZ0 A;  1C7Y A;  1OKS A;  1ZMW A;  1XB2 B;  2KNZ A;  1YLA A;  2O25 A;  1ZMU A;  2DZL A;  3K9P A;  1AIP C;  1G4A E;  1DO2 A;  2DAI A;  1GO5 A;  2JZ1 A;  1MN3 A;  2DEN A;  2HWJ A;  1Q02 A;  5JI2 E;  4GEW A;  3GLH E;  2EKK A;  2EJS A;  1VEK A;  1HT1 E;  2DAE A;  2RRU A;  2EKF A;  1WGN A; 
#chains in the Genus database with same CATH topology
 1OIZ A;  1G41 A;  1PJI A;  3A98 B;  1L1T A;  3FYC A;  5KPR A;  1N78 A;  2QNJ A;  1JR3 A;  3J2P B;  3GLI A;  2LWX A;  2QCU A;  2V1C A;  3KSJ A;  1XMO M;  3SHF A;  1QUT A;  4OW0 A;  1OJL A;  4D80 A;  3M0E A;  4AQY M;  1HNX M;  3U5Z A;  4XK8 F;  3GLF A;  1J5E M;  2QBY A;  1AUA A;  1KSF X;  4QNM A;  1OFH A;  3PNV A;  3J7A S;  2QEN A;  4IBE A;  5C18 A;  1DV0 A;  1XNR M;  3U6Q A;  1SXJ D;  1OQY A;  2BWB A;  3T1H M;  1J09 A;  2JWS A;  2JY8 A;  1YSY A;  1IBM M;  2LVA A;  2I7N A;  4L4U A;  5GKN A;  3ZC7 B;  3U6S A;  2HHH M;  3T6P A;  4PD2 A;  1IN8 A;  1QYR A;  3Q8G A;  1Z5C A;  3D8L A;  3HU3 A;  1R4G A;  5EXX A;  2CE7 A;  4L78 A;  4JI8 M;  3FRH A;  2L4E A;  2R4J A;  3UMM A;  4LZJ A;  1VEG A;  3CGW A;  1NVM A;  2D7G A;  2DWZ B;  1XXH B;  2X8A A;  3BBZ A;  3FKE A;  4B7H A;  3T1Y M;  1XMQ M;  2Q2E B;  3SMP A;  3HKP A;  3BXW A;  4LF4 M;  1OTR A;  2OQ4 A;  2KZS A;  1XC8 A;  3ILK A;  3TWM A;  4REZ A;  3L27 A;  2VQE M;  1TR8 A;  1N32 M;  2C5R A;  5EP1 A;  4G4O A;  2G8L A;  2A5Y B;  4OVZ A;  4RF1 A;  4LJ7 A;  1P3Q Q;  3K8Z A;  5E26 A;  3AKZ A;  3GO8 A;  1K3W A;  3D8B A;  2F4V M;  5BPV A;  3NBI A;  2Z8Y M;  3GQ3 A;  4CIZ A;  2UUC M;  2UXB M;  3K92 A;  4AW4 A;  3T15 A;  4G4R A;  3E4R A;  4FD2 A;  1IM2 A;  3AL0 C;  3U6P A;  3LVW A;  2DZO B;  4QHS A;  3L25 A;  5IZ7 D;  2C99 A;  1IXR C;  2JY7 A;  5FTN A;  3JR4 A;  4JI6 M;  4LF6 M;  3SMS A;  3HJQ A;  1W5S A;  4K0K M;  2XEP A;  4JYA M;  1MU5 A;  2Y0Q A;  4DR1 M;  1Y8G A;  2DHR A;  4JXJ A;  2LVO C;  3SAW A;  1QAO A;  2XFS A;  4LJ9 A;  3RGP A;  4FCW A;  3GPU A;  3GLH B;  1IN5 A;  5FTL A;  1VEJ A;  2XSZ A;  3DFZ A;  2FS1 A;  3TPZ A;  5KO3 A;  1VDD A;  4R7G A;  5EXS A;  2JXN A;  5ITU A;  1T6O A;  5LMU M;  1WHC A;  3I01 M;  2XZU A;  2DWN A;  3E9S A;  2JP7 A;  4ITQ A;  2FH0 A;  4IJF A;  3HHX A;  4M9Z A;  3KOW E;  2L7I A;  4X62 M;  3HHZ A;  5F3W A;  1K3X A;  3HJ8 A;  2DI0 A;  2LNH C;  4IBJ A;  1ORY B;  3W67 A;  1HQY E;  1S3S A;  1R2Z A;  1TDZ A;  4NSO B;  4NSR A;  2UXC M;  2YNM D;  1OFI A;  3GRY A;  3LW5 F;  4LY6 A;  3WHL A;  2VDB B;  4DV5 M;  2RGO A;  3DZD A;  3KVW A;  1T43 A;  4MGI E;  3LMM A;  5EP4 A;  1C1K A;  4DV1 M;  4GHL A;  1WXQ A;  1DGG A;  4KHP M;  5L8R F;  4LF7 M;  1DGF A;  1AIP C;  3FUV A;  2X49 A;  5JI2 E;  1Q02 A;  5A2Q S;  2C9C A;  4IBD A;  4GKJ M;  4L15 A;  3NBX X;  3U60 B;  2EKK A;  2L6O A;  4LFA M;  3L26 A;  4L6V 6;  1IN6 A;  1Z5A A;  4GKK M;  4LGY A;  2LVQ D;  2UXD M;  5E6J A;  4MGY E;  5IT9 S;  1FNN A;  1NHG C;  1GJS A;  1R7R A;  4LCB A;  5KQ8 A;  2CP8 A;  4PDG A;  1N77 A;  1EIJ A;  5ITY A;  3UK6 A;  3U6C A;  1GL6 A;  1V92 A;  2W82 A;  4JI2 M;  4GC9 A;  5FLX S;  1IBK M;  1QUS A;  2V6Z M;  3SYK A;  4G4N A;  1VDL A;  3C9P A;  3U61 B;  4LFB M;  4DR6 M;  1BVS A;  3HJS A;  4MH0 E;  4GH9 A;  1PJS A;  3FTE A;  3R9X B;  2ZM6 M;  1E9S A;  2B3T A;  3U6E A;  4IIW A;  3U60 A;  4AKG A;  3QAU A;  3VKG A;  3LQR A;  1QAM A;  4G3O A;  3GQ4 A;  4I5S A;  4LG2 A;  3RFW A;  3VK7 A;  2Z7J A;  2CUZ A;  3SFZ A;  1HR0 M;  4JI5 M;  4PT5 A;  4OU7 A;  2UU9 M;  4KT0 F;  3I04 M;  4JI3 M;  4DR4 M;  3GRU A;  3GRR A;  2GQF A;  2DVW B;  2YQZ A;  3ZCB B;  4Z6Y A;  4GHA A;  1Q3C A;  2LVN C;  3AOE A;  2CWB A;  3AV0 A;  1MX0 A;  1QVR A;  3KOY E;  1HNZ M;  5DYG A;  2Y21 A;  3HHW A;  2KA6 B;  4DBG B;  3CTW B;  4AG6 A;  1JR3 E;  2R65 A;  3KDS E;  3LQQ A;  3FUU A;  2QBY B;  1JB0 F;  4GIP A;  1ZAE A;  5EXP A;  2Z3X A;  3MJ5 A;  1G8P A;  2OOA A;  3QYB A;  1LV7 A;  2Z4S A;  2APL A;  2CV1 A;  2N35 A;  2OO9 A;  4IBC A;  2L4F A;  4R71 A;  4X64 M;  3OTO M;  4JV5 M;  3C3E A;  4EIW A;  3E46 A;  2CHV A;  5BR8 M;  1QQW A;  3CF0 A;  3SAS A;  1IBL M;  4MGZ E;  3FTF A;  2FFJ A;  4M0W A;  3KSX A;  4LJ5 A;  4CHT B;  1NJF A;  1DO0 A;  2XSZ D;  1WJ7 A;  2Y0T A;  3IHP A;  5EP3 A;  2CHQ A;  2JNH A;  1TTE A;  5FTJ A;  1OAO C;  3THG A;  1QAQ A;  4GMQ A;  1NY6 A;  2MRO B;  2QSF X;  4IBK A;  1J7K A;  1NY5 A;  3HWS A;  1Z5B A;  3C3D A;  2P5T A;  3CF6 E;  4NXM M;  2KEB A;  4MB7 A;  2WSE F;  4RKU F;  2J5Y A;  1L8Q A;  1DGH A;  1SXJ E;  2ZTD A;  4B3S M;  4AI6 A;  3RE8 A;  1XB2 B;  3WHK A;  3I4V A;  1ZQ9 A;  2KNZ A;  2R44 A;  5KQD A;  2O25 A;  1HNW M;  4QOZ C;  4CGY B;  2O01 F;  4LJA A;  1XXH A;  2VF8 A;  1FJG M;  2JZ1 A;  2DEN A;  4LJ8 A;  4FWH A;  2CFO A;  1DGH B;  4GEW A;  4LGM A;  3MHV C;  4DR7 M;  4YHH M;  3R8F A;  2H1R A;  2BJW A;  4X66 M;  2YFQ A;  1WGN A;  1EE8 A;  2EA0 A;  4NRW A;  4B7F A;  1IY1 A;  1TGU A;  3E21 A;  2AHM A;  2FNA A;  4B08 A;  4TUW A;  3F92 A;  4DR2 M;  2KNV A;  2QPA A;  1N33 M;  1UFZ A;  1SG9 A;  2F5S A;  4L8R C;  4PDI A;  1XNQ M;  4Q7J A;  2QHO B;  4KOD A;  2VII A;  4FCV A;  1TH3 A;  2D7H A;  3M7G A;  5C1B A;  4L16 A;  4UN2 B;  2M5Z A;  1HQC A;  1NV8 A;  2FE8 A;  2K47 A;  3TQS A;  2XZF A;  4AZF A;  3SC3 A;  4GIT A;  4R3D A;  2MGW A;  2L2D A;  4RF0 A;  1D0M A;  3HU1 A;  1GVN A;  4LRS A;  2K0B X;  1L2C A;  2V1U A;  4AG5 A;  3KW6 A;  2KW0 A;  3L28 A;  2HCB A;  2Y20 A;  5EXT A;  2LHC A;  3UGJ A;  2HKJ A;  2KRK A;  3B7Q A;  4CJ6 A;  1G71 A;  3J27 B;  1IY2 A;  3GLG A;  3AOG A;  1XXH E;  4DV2 M;  4DV7 M;  2JY6 B;  4X65 M;  1W5T A;  3K2L A;  5FSW A;  2DWM A;  2C9O A;  3B7N A;  1HJP A;  2WZJ A;  3FTD A;  1QDR A;  3GQ5 A;  1OIP A;  4BBA A;  1N75 A;  4DV3 M;  3A46 A;  4DUY M;  1PM5 A;  1Z6T A;  2XF3 A;  3A45 A;  2ZAO A;  3PVS A;  2R46 A;  4WUR A;  3KP1 E;  4S12 A;  2F5P A;  4LFC M;  4RNA A;  1GL7 A;  3LVV A;  2R45 A;  1QZE A;  4WP2 A;  2OPF A;  3H4J A;  5IWA M;  1ZV1 A;  3PFI A;  3W0F A;  4NC6 A;  4FW9 A;  1WGL A;  2R62 A;  4NL4 H;  2G5G X;  4CIS A;  1LTM A;  7CAT A;  1H6U A;  3SAV A;  3GRV A;  3ZQJ A;  3VFD A;  2VF7 A;  2K6B A;  3HU2 A;  3GLH A;  4AKH A;  3KOZ E;  4QOS A;  1NV9 A;  3U61 A;  3W0L B;  2Z4R A;  2JY5 A;  2C96 A;  2XFT A;  3IG8 A;  2BWE A;  4HLQ A;  2M60 A;  2H5X A;  5DFL A;  5JI3 E;  2CRU A;  2OOB A;  1E32 A;  3FTC A;  4LF8 M;  4BB9 A;  3T38 A;  4QHT A;  5EQT A;  4D81 A;  4JI4 M;  3TWL A;  1NSF A;  3HX3 A;  1Q39 A;  3GP1 A;  1L2D A;  1TF0 B;  1TH2 A;  1E94 E;  2DKL A;  1X37 A;  2L7H A;  3W68 A;  2VQF M;  2HAK A;  3KFU G;  2DAG A;  3KS8 A;  1T3T A;  2JA2 A;  4FWG A;  4OVZ B;  3ZH9 B;  1TH4 A;  2R6F A;  3GPX A;  3GLF B;  2DWL A;  3VDP A;  1PJT A;  2ZAM A;  3GPP A;  3CF2 A;  3MMP A;  3JAM S;  4LF9 M;  3DOA A;  2R0I A;  4JN6 A;  3EIH A;  1IXS B;  2MJ5 B;  1A5T A;  3J80 S;  1IFY A;  2QP9 X;  2WSC F;  4P17 A;  2X4A A;  3SHG B;  1WR1 B;  4G6Z A;  1C7Y A;  1I4W A;  1NJG A;  5IRE B;  4IBI A;  1YLA A;  2RGH A;  5EJC A;  1PRB A;  3VDU A;  4I81 A;  5FTK A;  4DV0 M;  4GRI A;  2QZ4 A;  4KLN A;  3HHY A;  4B3T M;  2F5O A;  4W5W A;  1RU3 A;  1PJJ A;  1K82 A;  3IG5 A;  2MH8 A;  3SAR A;  1GO5 A;  1DO2 A;  2DAI A;  4AKI A;  1NNJ A;  1V34 A;  3FYD A;  1L1Z A;  1IXZ A;  4IBG A;  2F5N A;  4OX9 M;  3JR5 A;  2EJS A;  1Q3B A;  1VEK A;  4IBB A;  4ZPX A;  3V76 A;  4NRV A;  2DAE A;  2RRU A;  3J81 S;  4D82 A;  5KPT A;  1SXJ C;  4KO8 A;  5KPZ A;  3TE6 A;  2XH9 A;  3K1J A;  1NHW C;  4A3V B;  2KHH A;  3AJI B;  5ITX E;  3DA1 A;  3HY5 A;  4PCZ A;  1F4I A;  1KFV A;  1PJQ A;  1JR3 D;  3QYE A;  4LZZ A;  3QWL A;  4M9S A;  3SYL A;  2XLJ A;  2K9D A;  2UUB M;  2J7O A;  2KXE A;  2BNK A;  2YR0 A;  2QQ8 A;  3LCV B;  3SBJ A;  3KOX E;  1R2Y A;  3L2A A;  2NQ8 C;  3FRI A;  4NOO B;  2GNO A;  5H37 D;  1IN7 A;  2LVP C;  3VK8 A;  1G3I A;  3U6O A;  2XGN A;  2WSF F;  1SXJ A;  2LXE A;  4WW0 A;  2DAK A;  4M0D A;  3KXE C;  2ZBK B;  3RGS A;  4DUZ M;  5ITT A;  3L29 A;  5EP2 A;  2CHG A;  1QZM A;  3FUX A;  1IN4 A;  2BJV A;  4LJ6 A;  1IQP A;  1YE9 A;  2JUJ A;  4GC5 A;  1EFU B;  4ANR A;  4MGK E;  4BLC A;  3KS4 A;  2L09 A;  3K9O A;  3U6M A;  3FD9 A;  2UUA M;  1TDH A;  4Z8X A;  3U6D A;  4FCT A;  1G59 A;  2RKO A;  5ITR A;  3I4Y A;  2HL7 A;  1NO1 A;  4FVM A;  2D7E A;  4F2L A;  1JQJ C;  3HGI A;  3TWK A;  1CUK A;  2DXI A;  2CV0 A;  4LF5 M;  2O5R A;  1VQ1 A;  3GPY A;  2R4E A;  1Z59 A;  1WIV A;  4I4L A;  4P16 A;  2ERC A;  1OAI A;  1L2B A;  2LBC A;  1E9R A;  4HEO A;  4F1I A;  4M9X A;  2R18 A;  1UM8 A;  3PNY A;  3GLI E;  4B7G A;  2F5Q A;  1I94 M;  2MR9 A;  3IEC A;  3SAU A;  1KYI A;  2LTU A;  2DHY A;  1PGY A;  2J7N A;  1XWI A;  2DAM A;  3KP0 E;  3GLF E;  3SAT A;  2CV2 A;  4LJ4 A;  3LCU A;  3C58 A;  1SXJ B;  4DV6 M;  3FE3 A;  4NXN M;  1D0L A;  2EUC A;  4JI1 M;  1N34 M;  1ZMV A;  4DR5 M;  2DNA A;  1MJG M;  1GAB A;  2KNA A;  2CEA A;  4B3M M;  3AOE C;  4JI7 M;  5ITX A;  2KZU A;  3U5Z B;  4II7 A;  4DV4 M;  2FOI C;  2LH0 A;  2G3Q A;  3FUW A;  3MK6 A;  2DZN B;  3GLI B;  3GLG E;  3B89 A;  3TL4 X;  1YUB A;  1IXS A;  2LHG A;  3EIE A;  3HZJ A;  3B74 A;  1GLN A;  1D0K A;  2KRU A;  3VLF B;  1DGB A;  4IBF A;  8CAT A;  4G4Q A;  1VG5 A;  2ZAN A;  2KDL A;  3A42 A;  4MM3 B;  2E5L M;  4MGH A;  1NNU C;  3BOS A;  4IJE A;  3PXG A;  4Y28 F;  3H4M A;  5DNY A;  2C98 A;  1IY0 A;  2ZTC A;  3B9P A;  3J7B A;  5FTM A;  1HT2 E;  2JZ0 A;  1OKS A;  1ZMW A;  1QAN A;  2I7P A;  5DYI A;  1N36 M;  3Q8X A;  4XBO A;  2EO2 A;  3B7Z A;  1ZMU A;  4B3R M;  2DZL A;  1V33 A;  3AFH A;  4FWD A;  1XHB A;  4YY3 M;  1QDT A;  1GJT A;  3FUT A;  1R6B X;  3I51 A;  3K9P A;  3M6A A;  1GKI A;  5LMN M;  3NWL A;  4QNR A;  1G4A E;  3UZU A;  3VKH A;  3UJN A;  1MN3 A;  3GLG B;  1D2N A;  2HWJ A;  3U6L A;  4HL4 A;  3GLH E;  4LRT A;  1HT1 E;  1R5L A;  4XGI A;  4JI0 M;  4DR3 M;  5ITQ A;  4I8O A;  2EKF A; 
#chains in the Genus database with same CATH homology
 3E21 A;  1G41 A;  3F92 A;  2KNV A;  2KHH A;  2QNJ A;  1UFZ A;  1SG9 A;  2CP8 A;  4Q7J A;  2QHO B;  2K9D A;  4UN2 B;  1V92 A;  1NV8 A;  3LCV B;  3FRI A;  2MGW A;  1VDL A;  2L2D A;  1DV0 A;  2LVP C;  1G3I A;  2K0B X;  1OQY A;  2BWB A;  1BVS A;  2JY8 A;  2DAK A;  2LVA A;  3T6P A;  2B3T A;  1R4G A;  2JUJ A;  1EFU B;  3FRH A;  3K9O A;  4G3O A;  2L4E A;  1VEG A;  1XXH E;  2JY6 B;  1F4I A;  3BBZ A;  1HJP A;  4F2L A;  2WZJ A;  1OTR A;  1CUK A;  1TR8 A;  1VQ1 A;  1WIV A;  2LVN C;  2CWB A;  1OAI A;  1P3Q Q;  2LBC A;  4HEO A;  1QZE A;  4WP2 A;  4F1I A;  4DBG B;  3H4J A;  1ZV1 A;  1JR3 E;  3GLI E;  2MR9 A;  3IEC A;  1WGL A;  1KYI A;  2LTU A;  2DHY A;  1PGY A;  2DAM A;  3GLF E;  1IM2 A;  2OOA A;  3LCU A;  3FE3 A;  1NV9 A;  2JY5 A;  1ZMV A;  2BWE A;  2OO9 A;  2DNA A;  2H5X A;  2JY7 A;  2L4F A;  5DFL A;  4R71 A;  2OOB A;  2KNA A;  3E46 A;  1Y8G A;  2LVO C;  1DO0 A;  3IHP A;  1WJ7 A;  2JNH A;  1TTE A;  1VEJ A;  2G3Q A;  1E94 E;  2DKL A;  3GLG E;  2HAK A;  3B89 A;  1T6O A;  1WHC A;  2DAG A;  1IXS A;  2JP7 A;  2MRO B;  2QSF X;  2LVQ D;  1VG5 A;  3MMP A;  2DI0 A;  2R0I A;  1HQY E;  2MJ5 B;  1A5T A;  2ZTC A;  2ZTD A;  1IFY A;  1WR1 B;  1T43 A;  1HT2 E;  2JZ0 A;  1C7Y A;  1OKS A;  1ZMW A;  1XB2 B;  2KNZ A;  1YLA A;  2O25 A;  1ZMU A;  2DZL A;  3K9P A;  1AIP C;  1G4A E;  1DO2 A;  2DAI A;  1GO5 A;  2JZ1 A;  1MN3 A;  2DEN A;  2HWJ A;  1Q02 A;  5JI2 E;  4GEW A;  3GLH E;  2EKK A;  2EJS A;  1VEK A;  1HT1 E;  2DAE A;  2RRU A;  2EKF A;  1WGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...