2JZ0A

Dsx_short
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein doublesex
publication title Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jz0A00
3F92A 3FE3A 2MGWA 2EKFA 1DO2A 1PGYA 1ZMUA 1WR1B 2CWBA 1OTRA 3GLGE 4WP2A 1HT1E 1VG5A 2O25A 2JNHA 2G3QA 2DI0A 1OAIA 1IM2A 1TR8A 1G4AE 1ZV1A 3K9PA 2OOAA 2LVAA 1GO5A 3GLFE 1IXSA 2MR9A 1ZMVA 1NV9A 1VEKA 1DO0A 3LCUA 1HQYE 3H4JA 2R0IA 4R71A 2H5XA 2KNZA 2JP7A 2BWEA 1BVSA 2OO9A 1AIPC 2DAGA 2KHHA 1YLAA 1KYIA 1G41A 1WGLA 2CP8A 3FRHA 3GLHE 3K9OA 2QNJA 2K0BX 1HJPA 2LVPC 2ZTCA 2DHYA 2L4FA 2DAIA 5JI2E 1R4GA 1OKSA 2MJ5B 2LTUA 1MN3A 2DAEA 1T6OA 1NV8A 1E94E 4DBGB 1JR3E 2KNAA 2DENA 2KNVA 2B3TA 2DZLA 2EKKA 3LCVB 3FRIA 1VEJA 1SG9A 2MROB 3B89A 1Y8GA 2L4EA 2JZ1A 1WGNA 4F1IA 2JY6B 4Q7JA 4F2LA 1XB2B 1CUKA 4GEWA 1DV0A 2JY5A 2K9DA 2WZJA 2ZTDA 2EJSA 1QZEA 2HAKA 1P3QQ 1T43A 1C7YA 2QSFX 4G3OA 2LVOC 4HEOA 1VEGA 1WJ7A 2JZ0A 1VQ1A 1XXHE 2HWJA 2LBCA 1WHCA 2JY7A 1TTEA 2DAMA 1UFZA 5DFLA 2DKLA 2JY8A 2RRUA 1A5TA 3IHPA 3E21A 2QHOB 2BWBA 3E46A 2DAKA 3GLIE 1Q02A 2L2DA 1HT2E 1ZMWA 1EFUB 1G3IA 2DNAA 3IECA 3BBZA 2JUJA 2LVNC 4UN2B 3T6PA 1V92A 1OQYA 1WIVA 1VDLA 2LVQD 1IFYA 1F4IA 3MMPA 2OOBA
chains in the Genus database with same CATH superfamily
3AV0A 1IY2A 1NSFA 4Z6YA 2CHQA 2ERCA 1R7RA 5DYGA 1G71A 2CWBA 3W0LB 2XZFA 5IT9S 1OTRA 3C3DA 3LW5F 1EE8A 2UUBM 3QYBA 4MGZE 4WP2A 4LFBM 3CF6E 1G59A 1ZQ9A 1VG5A 5KO3A 1E32A 3K2LA 3KVWA 3T1HM 4DR5M 1QAOA 4P17A 1IBKM 4FD2A 1IM2A 1TR8A 1NNJA 1Z59A 2UXDM 2UUCM 2P5TA 3K9PA 3HKPA 4AKIA 3GRRA 5GKNA 4R7GA 3J7AS 1N34M 2UXCM 2EO2A 3GPXA 4R3DA 3JAMS 1DO0A 3J7BA 3DZDA 3QYEA 1JR3A 4W5WA 3GLGB 3SARA 2F5QA 2R0IA 2H5XA 2QENA 4WW0A 3GRVA 1ORYB 4PD2A 2JP7A 1I94M 3EIEA 4KT0F 4MGHA 4ZPXA 1V34A 2DAGA 2KHHA 2Z8YM 1WXQA 3L2AA 3TL4X 4AG6A 1G41A 3GLHA 2K0BX 2CHVA 1DGBA 1QYRA 1QZMA 3ILKA 4QNMA 5FLXS 2A5YB 2Z7JA 3VK7A 2W82A 3RE8A 3B7QA 2DAIA 3DA1A 5KQDA 4DV0M 2G8LA 5C18A 5EP2A 1J7KA 3GQ5A 1W5SA 2YFQA 4GC9A 4KODA 3UMMA 1PJTA 1NV8A 3KP1E 3AJIB 2KNVA 3L27A 4XGIA 1N77A 4LF8M 2OPFA 2UU9M 4B08A 5ITXA 1H6UA 3LMMA 4IBJA 4LG2A 5KQ8A 2QZ4A 1IN4A 4IBGA 5LMUM 2LXEA 2Z4RA 3SAUA 1XB2B 2DHRA 5JI3E 1OIZA 4CIZA 1TF0B 3J27B 3W67A 3SASA 3GRYA 4M9SA 2KDLA 2WZJA 4JI3M 1R2YA 2JWSA 4RF0A 1ZAEA 2QP9X 5EJCA 2EJSA 2HAKA 3J80S 1LV7A 3FTCA 5IREB 3KOXE 1L1TA 4G3OA 3FUVA 5EP4A 2LVOC 3D8BA 2ZAMA 1XXHA 1VQ1A 2LBCA 3K92A 2R4EA 3GLHB 3HJSA 4JXJA 4L6V6 3TWKA 3BOSA 1PJQA 1LTMA 1NHGC 1OIPA 2JY8A 3I51A 1A5TA 2C9OA 2KZUA 3QWLA 4L16A 4NC6A 3E21A 3LVWA 4I5SA 5ITUA 5DNYA 4AKGA 1KFVA 2AHMA 3GLIA 4B7GA 3E46A 3I4YA 1L2BA 1IN5A 1Q02A 4FWHA 1GL7A 1NNUC 4DR6M 1EFUB 2DNAA 2CV1A 1S3SA 3BBZA 2FFJA 2R4JA 3KW6A 4LJ6A 3GPPA 4NOOB 3FUUA 3VDPA 4PDGA 2DWNA 1GKIA 2DZOB 4M9ZA 1TH4A 2BJVA 2LVQD 4OX9M 3LQQA 5EP1A 1SXJD 2C98A 5FTKA 3TE6A 2FOIC 3KS8A 4K0KM 3VKHA 2XGNA 2ZM6M 2APLA 1QUSA 3F92A 2MGWA 3FE3A 3MHVC 4GC5A 3UJNA 2Y0QA 5F3WA 4OVZA 4PCZA 3A42A 1PGYA 1D0MA 4AI6A 1PJSA 4JI0M 2QQ8A 2WSFF 2K47A 4IBEA 3TWLA 4RKUF 1L8QA 2J5YA 4I8OA 3U6SA 4D81A 2O25A 3GPYA 2JNHA 3THGA 4L8RC 1OAIA 4FVMA 1G4AE 3FYCA 1XXHB 2YQZA 1SXJA 3GLFA 2X49A 3SAVA 2L7HA 1C1KA 2MR9A 5KPRA 3KS4A 3KSXA 3LVVA 3TWMA 1W5TA 3LCUA 4B3TM 4KO8A 3VLFB 2DWLA 1G8PA 3GQ4A 3GLIB 1Z5AA 4LJ7A 4LJ4A 3FYDA 3HY5A 4S12A 1PJJA 4DR3M 1JR3D 1BVSA 1R6BX 5H37D 2BJWA 5EXTA 1NY6A 3FTEA 3OTOM 2I7PA 3WHLA 3NBIA 4X62M 1IBMM 2K6BA 2C5RA 1HNWM 2CP8A 2CUZA 3FRHA 5E26A 4B7FA 3U6MA 1FNNA 2QNJA 4NXMM 1HJPA 2XEPA 4LF5M 4RF1A 2DHYA 4GITA 3FD9A 1HNZM 4JI5M 1YSYA 1GJTA 4JN6A 3D8LA 4OVZB 2Y20A 1QUTA 1N75A 1OAOC 3B7ZA 2MJ5B 2G5GX 2LTUA 1NHWC 3SMSA 4GKKM 1HNXM 4DBGB 4LRSA 2FS1A 1IY1A 2DENA 2ZANA 4D80A 2B3TA 2DVWB 4GKJM 1EIJA 1Q39A 2F5NA 1SG9A 2CEAA 3AKZA 2CRUA 2H1RA 2KZSA 5DYIA 1GVNA 1N78A 4F1IA 1D0KA 1SXJB 3GLFB 3I01M 3T1YM 4CISA 4F2LA 1SXJC 2CV2A 3KFUG 1HR0M 1T3TA 3KDSE 1CUKA 4M0WA 5FTNA 1V33A 2JXNA 3HJ8A 3R9XB 3U6QA 5FTMA 1IBLM 4AKHA 3QAUA 3FTDA 4XK8F 4LF9M 1DV0A 3B9PA 1DGHA 2R44A 3GO8A 4MGYE 1QZEA 2HKJA 2LH0A 4IIWA 2R18A 3U61A 3ZC7B 3AOGA 2V1UA 2HHHM 4DV6M 4B7HA 2EUCA 4DUZM 5FTLA 2JZ0A 2DXIA 2HWJA 1Q3BA 3J2PB 3JR5A 1WHCA 1E9RA 2JY7A 4FWGA 3U6OA 2LHGA 1TTEA 4LZZA 3FUWA 4YY3M 3FTFA 3HHZA 3HU2A 2D7HA 2QHOB 4HL4A 3K1JA 3MJ5A 1NO1A 2YNMD 3J81S 3CTWB 2L2DA 2FE8A 1ZMWA 4Y28F 2GQFA 3SYLA 3PNVA 2KA6B 4IBDA 4MM3B 1Z5BA 4REZA 1K3XA 4AZFA 4X66M 3T6PA 2XH9A 1WIVA 3ZQJA 5ITRA 4X64M 1GLNA 3MMPA 4FCTA 1OJLA 1NJGA 4JI8M 2LNHC 3L26A 3U6LA 2V6ZM 4BLCA 2L6OA 3EIHA 3FUXA 1DO2A 3NWLA 3PFIA 2XLJA 2ZBKB 3UZUA 2J7NA 2J7OA 5IZ7D 1KSFX 1ZMUA 4G6ZA 1J5EM 4DR1M 4KHPM 2HCBA 4NL4H 3HX3A 1TGUA 1DGHB 2KRKA 3ZCBB 3SATA 1N36M 4FCVA 3SC3A 2R46A 3U61B 1UM8A 2G3QA 3B7NA 2DI0A 1IXRC 4DV3M 4GHLA 4G4RA 3GQ3A 2OOAA 2LVAA 3R8FA 3L28A 1TH3A 2EA0A 1IXSA 4AG5A 5ITQA 4JI7M 2DZNB 3PVSA 4IJEA 2M60A 3PXGA 4Z8XA 1HQYE 3HHWA 3U6DA 2FH0A 4BBAA 4B3MM 4R71A 2CFOA 2KNZA 3B74A 2MH8A 4MGIE 4L78A 5IWAM 4CHTB 5EQTA 2C99A 3E4RA 4JV5M 4WURA 3SHGB 3I04M 1YUBA 2OO9A 4DV5M 1QANA 1K3WA 1J09A 1YLAA 2O5RA 4DR2M 4QHTA 3BXWA 4BB9A 2F4VM 4DR4M 1WGLA 5EXPA 3LQRA 3GLHE 3K9OA 4NSOB 5FTJA 1N32M 2KXEA 2X4AA 1L2CA 4IBIA 4P16A 4GHAA 3A98B 1IN6A 1MU5A 1NJFA 2ZTCA 2QPAA 3M6AA 3W0FA 4LY6A 5JI2E 1QQWA 1IN8A 4IBKA 4LFCM 1JB0F 3A46A 4GH9A 1XHBA 4QOZC 4LFAM 1QVRA 2RGOA 2Y0TA 3SHFA 1IN7A 2XF3A 4GRIA 2DWMA 2X8AA 3SAWA 4A3VB 5BPVA 2Z4SA 2N35A 2WSCF 4QNRA 3LCVB 1VEJA 4D82A 5KPTA 3B89A 1Y8GA 2I7NA 5ITXE 3AOEA 3KSJA 4X65M 3HWSA 1WGNA 1HQCA 2JY6B 3IG8A 4Q7JA 3PNYA 4NXNM 4G4QA 1IXSB 1K82A 4G4NA 2F5SA 2RGHA 2LWXA 4OU7A 4DV7M 2KEBA 4FW9A 1Z5CA 2JY5A 5E6JA 4LGYA 5L8RF 3RGSA 2ZAOA 3VK8A 4IJFA 1TH2A 3GP1A 1C7YA 2QSFX 3U5ZA 1I4WA 4I81A 3AFHA 3UK6A 4DUYM 2UXBM 1L2DA 4JI4M 1FJGM 1VEGA 1WJ7A 4DV1M 1D0LA 2VQEM 1XXHE 3T38A 3GPUA 2D7EA 2KRUA 1D2NA 1Q3CA 2DAMA 1UFZA 5EXXA 3I4VA 5DFLA 2CV0A 1XC8A 1XNRM 3IHPA 3SMPA 4LCBA 7CATA 4RNAA 2XFSA 4NSRA 4IBCA 4AW4A 3GLIE 1VDDA 2FNAA 2CHGA 3CGWA 1G3IA 2O01F 2VF7A 3IECA 4PT5A 1Z6TA 2M5ZA 2BNKA 2JUJA 2Q2EB 3HGIA 2LVNC 3KOYE 4UN2B 4PDIA 3C3EA 2LHCA 3FUTA 3E9SA 1VDLA 1AUAA 3U60A 2UUAM 4NRVA 1IFYA 2OOBA 3KXEC 1XMOM 4L4UA 4L15A 3AOEC 3VFDA 4QOSA 2QBYA 1XNQM 2EKFA 4LF7M 4KLNA 4JI6M 3M7GA 2L7IA 4B3SM 2R45A 3SFZA 5LMNM 4M0DA 3U6EA 3Q8GA 1WR1B 1PM5A 4YHHM 1QDTA 5KPZA 3DOAA 3GLGE 4M9XA 1HT1E 4FCWA 2DWZB 3C9PA 4I4LA 5FSWA 4GMQA 2R62A 3NBXX 3C58A 3U5ZB 3TQSA 5EXSA 1ZV1A 4G4OA 1GO5A 2XFTA 1SXJE 4HLQA 3GLFE 1QDRA 3DFZA 1ZMVA 1NV9A 1VEKA 2VIIA 4IBBA 1RU3A 3KOWE 3FKEA 4ITQA 4CGYB 1IXZA 3H4JA 4AQYM 2WSEF 4JI2M 4IBFA 1QAMA 2BWEA 4EIWA 2NQ8C 1R5LA 2YR0A 1AIPC 4JYAM 1MX0A 4XBOA 1KYIA 3K8ZA 1X37A 3M0EA 4LZJA 4LRTA 1JQJC 1TDZA 5ITYA 8CATA 3V76A 3U60B 3TPZA 2XSZD 3IG5A 1IY0A 2LVPC 2QBYB 2L4FA 3WHKA 3VDUA 1DGFA 1R4GA 4LJ8A 1OKSA 3W68A 3RFWA 2F5PA 4II7A 1QAQA 1MN3A 3HZJA 3HHYA 2V1CA 2DAEA 1E94E 1T6OA 2R6FA 3ZH9B 1JR3E 2KNAA 2R65A 2Y21A 2XZUA 4JI1M 3L29A 4LF6M 4NRWA 2DZLA 1YE9A 2EKKA 2HL7A 4GIPA 3FRIA 2MROB 3AL0C 3HJQA 4LJ9A 2L4EA 4LF4M 2JZ1A 5ITTA 1GJSA 1OFIA 2GNOA 4OW0A 2OQ4A 2XSZA 3MK6A 5C1BA 2C96A 3KOZE 1XMQM 3U6PA 2VQFM 3RGPA 5EP3A 1R2ZA 4GEWA 1TDHA 2Z3XA 2VDBB 1L1ZA 1GABA 2K9DA 2ZTDA 2CE7A 3HHXA 1NY5A 3SBJA 1N33M 1P3QQ 2RKOA 1T43A 3CF2A 3SYKA 4CJ6A 4ANRA 1E9SA 2C9CA 3VKGA 4HEOA 3H4MA 2VF8A 1OFHA 1PRBA 3CF0A 2QCUA 3HU1A 3JR4A 2JA2A 2L09A 1GL6A 4DR7M 3HU3A 4LJAA 2DKLA 3T15A 2RRUA 4B3RM 4TUWA 3GLGA 4MH0E 1XWIA 4DV4M 2BWBA 2DAKA 4MGKE 1HT2E 5A2QS 4DV2M 1DGGA 4LJ5A 4QHSA 5BR8M 4MB7A 4FWDA 2KW0A 3KP0E 1NVMA 2F5OA 3GRUA 1IQPA 1PJIA 1MJGM 1V92A 3UGJA 3Q8XA 1OQYA 3U6CA 3L25A 3A45A 1F4IA 4LGMA 2D7GA 2E5LM
chains in the Genus database with same CATH topology
3F92A 3FE3A 2MGWA 2EKFA 1DO2A 1PGYA 1ZMUA 1WR1B 2CWBA 1OTRA 3GLGE 4WP2A 1HT1E 1VG5A 2O25A 2JNHA 2G3QA 2DI0A 1OAIA 1IM2A 1TR8A 1G4AE 1ZV1A 3K9PA 2OOAA 2LVAA 1GO5A 3GLFE 1IXSA 2MR9A 1ZMVA 1NV9A 1VEKA 1DO0A 3LCUA 1HQYE 3H4JA 2R0IA 4R71A 2H5XA 2KNZA 2JP7A 2BWEA 1BVSA 2OO9A 1AIPC 2DAGA 2KHHA 1YLAA 1KYIA 1G41A 1WGLA 2CP8A 3FRHA 3GLHE 3K9OA 2QNJA 2K0BX 1HJPA 2LVPC 2ZTCA 2DHYA 2L4FA 2DAIA 5JI2E 1R4GA 1OKSA 2MJ5B 2LTUA 1MN3A 2DAEA 1T6OA 1NV8A 1E94E 4DBGB 1JR3E 2KNAA 2DENA 2KNVA 2B3TA 2DZLA 2EKKA 3LCVB 3FRIA 1VEJA 1SG9A 2MROB 3B89A 1Y8GA 2L4EA 2JZ1A 1WGNA 4F1IA 2JY6B 4Q7JA 4F2LA 1XB2B 1CUKA 4GEWA 1DV0A 2JY5A 2K9DA 2WZJA 2ZTDA 2EJSA 1QZEA 2HAKA 1P3QQ 1T43A 1C7YA 2QSFX 4G3OA 2LVOC 4HEOA 1VEGA 1WJ7A 2JZ0A 1VQ1A 1XXHE 2HWJA 2LBCA 1WHCA 2JY7A 1TTEA 2DAMA 1UFZA 5DFLA 2DKLA 2JY8A 2RRUA 1A5TA 3IHPA 3E21A 2QHOB 2BWBA 3E46A 2DAKA 3GLIE 1Q02A 2L2DA 1HT2E 1ZMWA 1EFUB 1G3IA 2DNAA 3IECA 3BBZA 2JUJA 2LVNC 4UN2B 3T6PA 1V92A 1OQYA 1WIVA 1VDLA 2LVQD 1IFYA 1F4IA 3MMPA 2OOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F92 A;  3FE3 A;  2MGW A;  2EKF A;  1DO2 A;  1PGY A;  1ZMU A;  1WR1 B;  2CWB A;  1OTR A;  3GLG E;  4WP2 A;  1HT1 E;  1VG5 A;  2O25 A;  2JNH A;  2G3Q A;  2DI0 A;  1OAI A;  1IM2 A;  1TR8 A;  1G4A E;  1ZV1 A;  3K9P A;  2OOA A;  2LVA A;  1GO5 A;  3GLF E;  1IXS A;  2MR9 A;  1ZMV A;  1NV9 A;  1VEK A;  1DO0 A;  3LCU A;  1HQY E;  3H4J A;  2R0I A;  4R71 A;  2H5X A;  2KNZ A;  2JP7 A;  2BWE A;  1BVS A;  2OO9 A;  1AIP C;  2DAG A;  2KHH A;  1YLA A;  1KYI A;  1G41 A;  1WGL A;  2CP8 A;  3FRH A;  3GLH E;  3K9O A;  2QNJ A;  2K0B X;  1HJP A;  2LVP C;  2ZTC A;  2DHY A;  2L4F A;  2DAI A;  5JI2 E;  1R4G A;  1OKS A;  2MJ5 B;  2LTU A;  1MN3 A;  2DAE A;  1T6O A;  1NV8 A;  1E94 E;  4DBG B;  1JR3 E;  2KNA A;  2DEN A;  2KNV A;  2B3T A;  2DZL A;  2EKK A;  3LCV B;  3FRI A;  1VEJ A;  1SG9 A;  2MRO B;  3B89 A;  1Y8G A;  2L4E A;  2JZ1 A;  1WGN A;  4F1I A;  2JY6 B;  4Q7J A;  4F2L A;  1XB2 B;  1CUK A;  4GEW A;  1DV0 A;  2JY5 A;  2K9D A;  2WZJ A;  2ZTD A;  2EJS A;  1QZE A;  2HAK A;  1P3Q Q;  1T43 A;  1C7Y A;  2QSF X;  4G3O A;  2LVO C;  4HEO A;  1VEG A;  1WJ7 A;  2JZ0 A;  1VQ1 A;  1XXH E;  2HWJ A;  2LBC A;  1WHC A;  2JY7 A;  1TTE A;  2DAM A;  1UFZ A;  5DFL A;  2DKL A;  2JY8 A;  2RRU A;  1A5T A;  3IHP A;  3E21 A;  2QHO B;  2BWB A;  3E46 A;  2DAK A;  3GLI E;  1Q02 A;  2L2D A;  1HT2 E;  1ZMW A;  1EFU B;  1G3I A;  2DNA A;  3IEC A;  3BBZ A;  2JUJ A;  2LVN C;  4UN2 B;  3T6P A;  1V92 A;  1OQY A;  1WIV A;  1VDL A;  2LVQ D;  1IFY A;  1F4I A;  3MMP A;  2OOB A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  1IY2 A;  1NSF A;  4Z6Y A;  2CHQ A;  2ERC A;  1R7R A;  5DYG A;  1G71 A;  2CWB A;  3W0L B;  2XZF A;  5IT9 S;  1OTR A;  3C3D A;  3LW5 F;  1EE8 A;  2UUB M;  3QYB A;  4MGZ E;  4WP2 A;  4LFB M;  3CF6 E;  1G59 A;  1ZQ9 A;  1VG5 A;  5KO3 A;  1E32 A;  3K2L A;  3KVW A;  3T1H M;  4DR5 M;  1QAO A;  4P17 A;  1IBK M;  4FD2 A;  1IM2 A;  1TR8 A;  1NNJ A;  1Z59 A;  2UXD M;  2UUC M;  2P5T A;  3K9P A;  3HKP A;  4AKI A;  3GRR A;  5GKN A;  4R7G A;  3J7A S;  1N34 M;  2UXC M;  2EO2 A;  3GPX A;  4R3D A;  3JAM S;  1DO0 A;  3J7B A;  3DZD A;  3QYE A;  1JR3 A;  4W5W A;  3GLG B;  3SAR A;  2F5Q A;  2R0I A;  2H5X A;  2QEN A;  4WW0 A;  3GRV A;  1ORY B;  4PD2 A;  2JP7 A;  1I94 M;  3EIE A;  4KT0 F;  4MGH A;  4ZPX A;  1V34 A;  2DAG A;  2KHH A;  2Z8Y M;  1WXQ A;  3L2A A;  3TL4 X;  4AG6 A;  1G41 A;  3GLH A;  2K0B X;  2CHV A;  1DGB A;  1QYR A;  1QZM A;  3ILK A;  4QNM A;  5FLX S;  2A5Y B;  2Z7J A;  3VK7 A;  2W82 A;  3RE8 A;  3B7Q A;  2DAI A;  3DA1 A;  5KQD A;  4DV0 M;  2G8L A;  5C18 A;  5EP2 A;  1J7K A;  3GQ5 A;  1W5S A;  2YFQ A;  4GC9 A;  4KOD A;  3UMM A;  1PJT A;  1NV8 A;  3KP1 E;  3AJI B;  2KNV A;  3L27 A;  4XGI A;  1N77 A;  4LF8 M;  2OPF A;  2UU9 M;  4B08 A;  5ITX A;  1H6U A;  3LMM A;  4IBJ A;  4LG2 A;  5KQ8 A;  2QZ4 A;  1IN4 A;  4IBG A;  5LMU M;  2LXE A;  2Z4R A;  3SAU A;  1XB2 B;  2DHR A;  5JI3 E;  1OIZ A;  4CIZ A;  1TF0 B;  3J27 B;  3W67 A;  3SAS A;  3GRY A;  4M9S A;  2KDL A;  2WZJ A;  4JI3 M;  1R2Y A;  2JWS A;  4RF0 A;  1ZAE A;  2QP9 X;  5EJC A;  2EJS A;  2HAK A;  3J80 S;  1LV7 A;  3FTC A;  5IRE B;  3KOX E;  1L1T A;  4G3O A;  3FUV A;  5EP4 A;  2LVO C;  3D8B A;  2ZAM A;  1XXH A;  1VQ1 A;  2LBC A;  3K92 A;  2R4E A;  3GLH B;  3HJS A;  4JXJ A;  4L6V 6;  3TWK A;  3BOS A;  1PJQ A;  1LTM A;  1NHG C;  1OIP A;  2JY8 A;  3I51 A;  1A5T A;  2C9O A;  2KZU A;  3QWL A;  4L16 A;  4NC6 A;  3E21 A;  3LVW A;  4I5S A;  5ITU A;  5DNY A;  4AKG A;  1KFV A;  2AHM A;  3GLI A;  4B7G A;  3E46 A;  3I4Y A;  1L2B A;  1IN5 A;  1Q02 A;  4FWH A;  1GL7 A;  1NNU C;  4DR6 M;  1EFU B;  2DNA A;  2CV1 A;  1S3S A;  3BBZ A;  2FFJ A;  2R4J A;  3KW6 A;  4LJ6 A;  3GPP A;  4NOO B;  3FUU A;  3VDP A;  4PDG A;  2DWN A;  1GKI A;  2DZO B;  4M9Z A;  1TH4 A;  2BJV A;  2LVQ D;  4OX9 M;  3LQQ A;  5EP1 A;  1SXJ D;  2C98 A;  5FTK A;  3TE6 A;  2FOI C;  3KS8 A;  4K0K M;  3VKH A;  2XGN A;  2ZM6 M;  2APL A;  1QUS A;  3F92 A;  2MGW A;  3FE3 A;  3MHV C;  4GC5 A;  3UJN A;  2Y0Q A;  5F3W A;  4OVZ A;  4PCZ A;  3A42 A;  1PGY A;  1D0M A;  4AI6 A;  1PJS A;  4JI0 M;  2QQ8 A;  2WSF F;  2K47 A;  4IBE A;  3TWL A;  4RKU F;  1L8Q A;  2J5Y A;  4I8O A;  3U6S A;  4D81 A;  2O25 A;  3GPY A;  2JNH A;  3THG A;  4L8R C;  1OAI A;  4FVM A;  1G4A E;  3FYC A;  1XXH B;  2YQZ A;  1SXJ A;  3GLF A;  2X49 A;  3SAV A;  2L7H A;  1C1K A;  2MR9 A;  5KPR A;  3KS4 A;  3KSX A;  3LVV A;  3TWM A;  1W5T A;  3LCU A;  4B3T M;  4KO8 A;  3VLF B;  2DWL A;  1G8P A;  3GQ4 A;  3GLI B;  1Z5A A;  4LJ7 A;  4LJ4 A;  3FYD A;  3HY5 A;  4S12 A;  1PJJ A;  4DR3 M;  1JR3 D;  1BVS A;  1R6B X;  5H37 D;  2BJW A;  5EXT A;  1NY6 A;  3FTE A;  3OTO M;  2I7P A;  3WHL A;  3NBI A;  4X62 M;  1IBM M;  2K6B A;  2C5R A;  1HNW M;  2CP8 A;  2CUZ A;  3FRH A;  5E26 A;  4B7F A;  3U6M A;  1FNN A;  2QNJ A;  4NXM M;  1HJP A;  2XEP A;  4LF5 M;  4RF1 A;  2DHY A;  4GIT A;  3FD9 A;  1HNZ M;  4JI5 M;  1YSY A;  1GJT A;  4JN6 A;  3D8L A;  4OVZ B;  2Y20 A;  1QUT A;  1N75 A;  1OAO C;  3B7Z A;  2MJ5 B;  2G5G X;  2LTU A;  1NHW C;  3SMS A;  4GKK M;  1HNX M;  4DBG B;  4LRS A;  2FS1 A;  1IY1 A;  2DEN A;  2ZAN A;  4D80 A;  2B3T A;  2DVW B;  4GKJ M;  1EIJ A;  1Q39 A;  2F5N A;  1SG9 A;  2CEA A;  3AKZ A;  2CRU A;  2H1R A;  2KZS A;  5DYI A;  1GVN A;  1N78 A;  4F1I A;  1D0K A;  1SXJ B;  3GLF B;  3I01 M;  3T1Y M;  4CIS A;  4F2L A;  1SXJ C;  2CV2 A;  3KFU G;  1HR0 M;  1T3T A;  3KDS E;  1CUK A;  4M0W A;  5FTN A;  1V33 A;  2JXN A;  3HJ8 A;  3R9X B;  3U6Q A;  5FTM A;  1IBL M;  4AKH A;  3QAU A;  3FTD A;  4XK8 F;  4LF9 M;  1DV0 A;  3B9P A;  1DGH A;  2R44 A;  3GO8 A;  4MGY E;  1QZE A;  2HKJ A;  2LH0 A;  4IIW A;  2R18 A;  3U61 A;  3ZC7 B;  3AOG A;  2V1U A;  2HHH M;  4DV6 M;  4B7H A;  2EUC A;  4DUZ M;  5FTL A;  2JZ0 A;  2DXI A;  2HWJ A;  1Q3B A;  3J2P B;  3JR5 A;  1WHC A;  1E9R A;  2JY7 A;  4FWG A;  3U6O A;  2LHG A;  1TTE A;  4LZZ A;  3FUW A;  4YY3 M;  3FTF A;  3HHZ A;  3HU2 A;  2D7H A;  2QHO B;  4HL4 A;  3K1J A;  3MJ5 A;  1NO1 A;  2YNM D;  3J81 S;  3CTW B;  2L2D A;  2FE8 A;  1ZMW A;  4Y28 F;  2GQF A;  3SYL A;  3PNV A;  2KA6 B;  4IBD A;  4MM3 B;  1Z5B A;  4REZ A;  1K3X A;  4AZF A;  4X66 M;  3T6P A;  2XH9 A;  1WIV A;  3ZQJ A;  5ITR A;  4X64 M;  1GLN A;  3MMP A;  4FCT A;  1OJL A;  1NJG A;  4JI8 M;  2LNH C;  3L26 A;  3U6L A;  2V6Z M;  4BLC A;  2L6O A;  3EIH A;  3FUX A;  1DO2 A;  3NWL A;  3PFI A;  2XLJ A;  2ZBK B;  3UZU A;  2J7N A;  2J7O A;  5IZ7 D;  1KSF X;  1ZMU A;  4G6Z A;  1J5E M;  4DR1 M;  4KHP M;  2HCB A;  4NL4 H;  3HX3 A;  1TGU A;  1DGH B;  2KRK A;  3ZCB B;  3SAT A;  1N36 M;  4FCV A;  3SC3 A;  2R46 A;  3U61 B;  1UM8 A;  2G3Q A;  3B7N A;  2DI0 A;  1IXR C;  4DV3 M;  4GHL A;  4G4R A;  3GQ3 A;  2OOA A;  2LVA A;  3R8F A;  3L28 A;  1TH3 A;  2EA0 A;  1IXS A;  4AG5 A;  5ITQ A;  4JI7 M;  2DZN B;  3PVS A;  4IJE A;  2M60 A;  3PXG A;  4Z8X A;  1HQY E;  3HHW A;  3U6D A;  2FH0 A;  4BBA A;  4B3M M;  4R71 A;  2CFO A;  2KNZ A;  3B74 A;  2MH8 A;  4MGI E;  4L78 A;  5IWA M;  4CHT B;  5EQT A;  2C99 A;  3E4R A;  4JV5 M;  4WUR A;  3SHG B;  3I04 M;  1YUB A;  2OO9 A;  4DV5 M;  1QAN A;  1K3W A;  1J09 A;  1YLA A;  2O5R A;  4DR2 M;  4QHT A;  3BXW A;  4BB9 A;  2F4V M;  4DR4 M;  1WGL A;  5EXP A;  3LQR A;  3GLH E;  3K9O A;  4NSO B;  5FTJ A;  1N32 M;  2KXE A;  2X4A A;  1L2C A;  4IBI A;  4P16 A;  4GHA A;  3A98 B;  1IN6 A;  1MU5 A;  1NJF A;  2ZTC A;  2QPA A;  3M6A A;  3W0F A;  4LY6 A;  5JI2 E;  1QQW A;  1IN8 A;  4IBK A;  4LFC M;  1JB0 F;  3A46 A;  4GH9 A;  1XHB A;  4QOZ C;  4LFA M;  1QVR A;  2RGO A;  2Y0T A;  3SHF A;  1IN7 A;  2XF3 A;  4GRI A;  2DWM A;  2X8A A;  3SAW A;  4A3V B;  5BPV A;  2Z4S A;  2N35 A;  2WSC F;  4QNR A;  3LCV B;  1VEJ A;  4D82 A;  5KPT A;  3B89 A;  1Y8G A;  2I7N A;  5ITX E;  3AOE A;  3KSJ A;  4X65 M;  3HWS A;  1WGN A;  1HQC A;  2JY6 B;  3IG8 A;  4Q7J A;  3PNY A;  4NXN M;  4G4Q A;  1IXS B;  1K82 A;  4G4N A;  2F5S A;  2RGH A;  2LWX A;  4OU7 A;  4DV7 M;  2KEB A;  4FW9 A;  1Z5C A;  2JY5 A;  5E6J A;  4LGY A;  5L8R F;  3RGS A;  2ZAO A;  3VK8 A;  4IJF A;  1TH2 A;  3GP1 A;  1C7Y A;  2QSF X;  3U5Z A;  1I4W A;  4I81 A;  3AFH A;  3UK6 A;  4DUY M;  2UXB M;  1L2D A;  4JI4 M;  1FJG M;  1VEG A;  1WJ7 A;  4DV1 M;  1D0L A;  2VQE M;  1XXH E;  3T38 A;  3GPU A;  2D7E A;  2KRU A;  1D2N A;  1Q3C A;  2DAM A;  1UFZ A;  5EXX A;  3I4V A;  5DFL A;  2CV0 A;  1XC8 A;  1XNR M;  3IHP A;  3SMP A;  4LCB A;  7CAT A;  4RNA A;  2XFS A;  4NSR A;  4IBC A;  4AW4 A;  3GLI E;  1VDD A;  2FNA A;  2CHG A;  3CGW A;  1G3I A;  2O01 F;  2VF7 A;  3IEC A;  4PT5 A;  1Z6T A;  2M5Z A;  2BNK A;  2JUJ A;  2Q2E B;  3HGI A;  2LVN C;  3KOY E;  4UN2 B;  4PDI A;  3C3E A;  2LHC A;  3FUT A;  3E9S A;  1VDL A;  1AUA A;  3U60 A;  2UUA M;  4NRV A;  1IFY A;  2OOB A;  3KXE C;  1XMO M;  4L4U A;  4L15 A;  3AOE C;  3VFD A;  4QOS A;  2QBY A;  1XNQ M;  2EKF A;  4LF7 M;  4KLN A;  4JI6 M;  3M7G A;  2L7I A;  4B3S M;  2R45 A;  3SFZ A;  5LMN M;  4M0D A;  3U6E A;  3Q8G A;  1WR1 B;  1PM5 A;  4YHH M;  1QDT A;  5KPZ A;  3DOA A;  3GLG E;  4M9X A;  1HT1 E;  4FCW A;  2DWZ B;  3C9P A;  4I4L A;  5FSW A;  4GMQ A;  2R62 A;  3NBX X;  3C58 A;  3U5Z B;  3TQS A;  5EXS A;  1ZV1 A;  4G4O A;  1GO5 A;  2XFT A;  1SXJ E;  4HLQ A;  3GLF E;  1QDR A;  3DFZ A;  1ZMV A;  1NV9 A;  1VEK A;  2VII A;  4IBB A;  1RU3 A;  3KOW E;  3FKE A;  4ITQ A;  4CGY B;  1IXZ A;  3H4J A;  4AQY M;  2WSE F;  4JI2 M;  4IBF A;  1QAM A;  2BWE A;  4EIW A;  2NQ8 C;  1R5L A;  2YR0 A;  1AIP C;  4JYA M;  1MX0 A;  4XBO A;  1KYI A;  3K8Z A;  1X37 A;  3M0E A;  4LZJ A;  4LRT A;  1JQJ C;  1TDZ A;  5ITY A;  8CAT A;  3V76 A;  3U60 B;  3TPZ A;  2XSZ D;  3IG5 A;  1IY0 A;  2LVP C;  2QBY B;  2L4F A;  3WHK A;  3VDU A;  1DGF A;  1R4G A;  4LJ8 A;  1OKS A;  3W68 A;  3RFW A;  2F5P A;  4II7 A;  1QAQ A;  1MN3 A;  3HZJ A;  3HHY A;  2V1C A;  2DAE A;  1E94 E;  1T6O A;  2R6F A;  3ZH9 B;  1JR3 E;  2KNA A;  2R65 A;  2Y21 A;  2XZU A;  4JI1 M;  3L29 A;  4LF6 M;  4NRW A;  2DZL A;  1YE9 A;  2EKK A;  2HL7 A;  4GIP A;  3FRI A;  2MRO B;  3AL0 C;  3HJQ A;  4LJ9 A;  2L4E A;  4LF4 M;  2JZ1 A;  5ITT A;  1GJS A;  1OFI A;  2GNO A;  4OW0 A;  2OQ4 A;  2XSZ A;  3MK6 A;  5C1B A;  2C96 A;  3KOZ E;  1XMQ M;  3U6P A;  2VQF M;  3RGP A;  5EP3 A;  1R2Z A;  4GEW A;  1TDH A;  2Z3X A;  2VDB B;  1L1Z A;  1GAB A;  2K9D A;  2ZTD A;  2CE7 A;  3HHX A;  1NY5 A;  3SBJ A;  1N33 M;  1P3Q Q;  2RKO A;  1T43 A;  3CF2 A;  3SYK A;  4CJ6 A;  4ANR A;  1E9S A;  2C9C A;  3VKG A;  4HEO A;  3H4M A;  2VF8 A;  1OFH A;  1PRB A;  3CF0 A;  2QCU A;  3HU1 A;  3JR4 A;  2JA2 A;  2L09 A;  1GL6 A;  4DR7 M;  3HU3 A;  4LJA A;  2DKL A;  3T15 A;  2RRU A;  4B3R M;  4TUW A;  3GLG A;  4MH0 E;  1XWI A;  4DV4 M;  2BWB A;  2DAK A;  4MGK E;  1HT2 E;  5A2Q S;  4DV2 M;  1DGG A;  4LJ5 A;  4QHS A;  5BR8 M;  4MB7 A;  4FWD A;  2KW0 A;  3KP0 E;  1NVM A;  2F5O A;  3GRU A;  1IQP A;  1PJI A;  1MJG M;  1V92 A;  3UGJ A;  3Q8X A;  1OQY A;  3U6C A;  3L25 A;  3A45 A;  1F4I A;  4LGM A;  2D7G A;  2E5L M; 
#chains in the Genus database with same CATH homology
 3F92 A;  3FE3 A;  2MGW A;  2EKF A;  1DO2 A;  1PGY A;  1ZMU A;  1WR1 B;  2CWB A;  1OTR A;  3GLG E;  4WP2 A;  1HT1 E;  1VG5 A;  2O25 A;  2JNH A;  2G3Q A;  2DI0 A;  1OAI A;  1IM2 A;  1TR8 A;  1G4A E;  1ZV1 A;  3K9P A;  2OOA A;  2LVA A;  1GO5 A;  3GLF E;  1IXS A;  2MR9 A;  1ZMV A;  1NV9 A;  1VEK A;  1DO0 A;  3LCU A;  1HQY E;  3H4J A;  2R0I A;  4R71 A;  2H5X A;  2KNZ A;  2JP7 A;  2BWE A;  1BVS A;  2OO9 A;  1AIP C;  2DAG A;  2KHH A;  1YLA A;  1KYI A;  1G41 A;  1WGL A;  2CP8 A;  3FRH A;  3GLH E;  3K9O A;  2QNJ A;  2K0B X;  1HJP A;  2LVP C;  2ZTC A;  2DHY A;  2L4F A;  2DAI A;  5JI2 E;  1R4G A;  1OKS A;  2MJ5 B;  2LTU A;  1MN3 A;  2DAE A;  1T6O A;  1NV8 A;  1E94 E;  4DBG B;  1JR3 E;  2KNA A;  2DEN A;  2KNV A;  2B3T A;  2DZL A;  2EKK A;  3LCV B;  3FRI A;  1VEJ A;  1SG9 A;  2MRO B;  3B89 A;  1Y8G A;  2L4E A;  2JZ1 A;  1WGN A;  4F1I A;  2JY6 B;  4Q7J A;  4F2L A;  1XB2 B;  1CUK A;  4GEW A;  1DV0 A;  2JY5 A;  2K9D A;  2WZJ A;  2ZTD A;  2EJS A;  1QZE A;  2HAK A;  1P3Q Q;  1T43 A;  1C7Y A;  2QSF X;  4G3O A;  2LVO C;  4HEO A;  1VEG A;  1WJ7 A;  2JZ0 A;  1VQ1 A;  1XXH E;  2HWJ A;  2LBC A;  1WHC A;  2JY7 A;  1TTE A;  2DAM A;  1UFZ A;  5DFL A;  2DKL A;  2JY8 A;  2RRU A;  1A5T A;  3IHP A;  3E21 A;  2QHO B;  2BWB A;  3E46 A;  2DAK A;  3GLI E;  1Q02 A;  2L2D A;  1HT2 E;  1ZMW A;  1EFU B;  1G3I A;  2DNA A;  3IEC A;  3BBZ A;  2JUJ A;  2LVN C;  4UN2 B;  3T6P A;  1V92 A;  1OQY A;  1WIV A;  1VDL A;  2LVQ D;  1IFY A;  1F4I A;  3MMP A;  2OOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...