4LJ6A

Clpb nbd2 from t. thermophilus in complex with amppcp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj6A01
2F1HA 1N6OA 4OHXA 4G0NA 2OLJA 1IY0A 3IO5A 1O87A 2EFCB 2GCOA 1CRQA 1ZU5A 4Q7KA 4UNPA 1P4SA 2YVUA 3TAHA 4HYYA 1UPTA 1A1VA 1CULC 1TNDA 1VHLA 3GLGA 3R8FA 3CM0A 5DN6A 5FR2A 3U3MA 3BFXA 4B43A 3PENA 3ZIAA 2FMXA 3PUVA 5J40A 1RRCA 4UJ5A 4BZXA 4O2LA 4QNMA 1NY5A 1II9A 4B3BA 4RZ2A 1T3SA 4ESVA 4PQFA 1E1RA 2B8WA 2F6RA 1Z22A 4W5JA 1E4YA 1GL6A 2ZS7A 3A4MA 3HP1A 2QQEA 4TN1A 4D26A 1C1KA 2CJWA 5KHOC 1YRBA 3WNDA 5J4YA 4QHSA 4NDZA 4Q48A 4TTQA 4UXHA 5ANRB 5JLJA 4KJZA 1D8TA 1NP6A 1ZUIA 2QTHA 1G64A 4RZ3A 5GJBA 4LPSA 3IPXA 4TL6A 4EFMA 2KJQA 4FD2A 1SHZA 5FI0B 1N6PA 2YOFA 3GLIE 3BXZA 3PVSA 4V03A 1SVKA 3LXRA 3LA6A 5E95A 3V4RA 1CJUC 1XEXB 2EFDB 3EZFA 1KO7A 4MGIR 3TR0A 4BRUA 2W0SA 4Q4AA 2DB3A 3MFYA 2WOJA 1BYUA 2ZR9A 1MV5A 4X8OA 2ZITA 4KV9A 3CZPA 1KO8A 3EC2A 3BAFA 1UDXA 3QXHA 4HAVA 4LSGA 1MR3F 4NCJA 3PR1A 5K8TA 3AVVA 3SJBA 3PIRA 1JQJC 4B2IA 1AQUA 4G5GA 1GSIA 2P6RA 3DPUA 1KHTA 4GP7A 1VCIA 1F6BA 2WJYA 1E2GA 4B6FA 4HLUA 1GTVA 5CB6A 2C2HA 4NYJQ 5L3QB 3EA0A 4Y0VA 3QKUA 3NIBA 4PFSA 4BRWA 1IHUA 4ZCIA 3TJZA 3IGFA 1W0JD 1AQYA 2OFXA 2REOA 2CL6X 5F2EA 4PANA 1HE1C 1XF9A 4PPGA 1OV4A 2JLQA 4H1VA 4U00A 3AH8A 4OI1A 4ZIRA 3CWQA 2BJWA 1GWNA 3KJIA 2WSSA 1OXUA 3K0FB 5A5GA 4URVR 2GF0A 5A0FA 3CUEF 1NVVQ 2PMDA 1U9IC 1CEEA 1OIXA 4EPRA 2BCGY 2ZRDA 2OESA 5DI9A 1N25A 3GLIB 2ZRMA 4DSUA 2BHRA 4QBFA 4A2QA 3CF6R 4ZDKA 1P2SA 2AFHE 1ZVQA 2F3TA 1XDBA 3I61A 1EFHA 4OK6A 5EXSA 1Z3IX 1YZQA 4B3CA 1ZU4A 4JBYA 4IDOA 4RCYA 3NXSA 1T3LA 4HZIA 5AJWA 5TARA 4BFXA 2GEVA 2REBA 2QT1A 1T0HB 4C4PA 1LTQA 1XEXA 4NYIQ 4QOSA 1KI7A 3N2EA 3O8DA 2WWXA 2ZSDA 3BJIC 4MITA 5DYIA 1NL3A 2BCJQ 2FFHA 1F3OA 4HUQB 1X37A 3K8YA 4U7DA 4Q01A 2IS4A 4B44A 2JJ1D 1FOEB 2GBLC 1J99A 1Q1QA 2IYXA 3PEYA 1UBGA 2J41A 4R2HA 3T15A 2QP9X 4V0MA 1XXHE 2G77B 5CITA 3X1YA 2PJRA 1UBFA 3K70D 1Z47A 4IHQA 2ZJOA 3CO5A 3RC3A 1UBCA 421PA 2CHGA 3THWA 2ODNA 1LS6A 1FL9A 3B85A 5EP4A 1E9RA 1PUIA 5JJKA 1P62B 2Z83A 2H7VA 4M1SA 2NIPA 3UG6A 2P5SA 2RHDA 4URXR 1RPZA 1DAFA 1E94E 4G5SA 3FB4A 1U8ZA 4EPWA 3K9LA 1Q1ZA 3QPUA 3ADDA 3C14C 4LV5B 2NMVA 1RJ9B 5HZHA 4LJ7A 2BIFA 4FW9A 2P65A 1IY1A 5FI1B 2FDCA 2Q0HA 4HLCA 2G0NA 5FUVA 2FU5C 2BMJA 2ZYVX 2YINC 1VG9B 2QM7A 3CPEA 4BECA 5AUPB 5BYKA 4Q4HB 1TUEA 4FI3C 1UEJA 4DIEA 5JHHB 4MDEA 2QUZA 2JLVA 1WP9A 2FWRA 2GCPA 3HR8A 1W5SA 1JEEA 2WWGA 2WWFA 3WRYC 3KUCA 2ZE5A 1LB1B 4P31A 3U7EB 3B9QA 3K0EA 2XSZA 4TMTA 1W0KA 1RYFA 3PJRA 1UAAA 1DAMA 3D7MA 3GJXC 5EJEA 3B1WA 3SNHA 5AR1A 4NBSA 2ZEJA 3RDPA 5JS7A 1N6LA 1YZNA 5FFMA 1XTRA 3R7WB 3ZVRA 2DFNA 4GZLA 4CEHB 4PZYA 1TF7A 3EA5A 1YE8A 5CJPA 5KO2A 2O8DB 4XWAA 2WMOB 3C4JA 1S4QA 3LVRE 2VPPA 1VTKA 3I8SA 1XXHB 4JYBA 4FXPA 1LS1A 1A7JA 2H17A 4MUAA 5FOXA 5BQ5A 5SZHB 5FPHA 2OHFA 3PUYA 3SC3A 3QSYA 4DCTA 1KSJA 2R6CA 2WPDA 3DEFA 1E3MA 1AS0A 1KZGB 3QEJA 1JALA 3OE7D 1W36B 5E7IA 3GFTA 1ZD9A 1ZCBA 4ZI3A 3R9IA 2D3WA 2FH5B 1SULA 2GJAA 2WAXA 2OCYC 4JJKA 1RZ3A 4KYUA 3UMRA 1E2KA 3Q85A 1EWRA 3U44A 2DYKA 1E2NA 3RSLA 4OBEA 1WMSA 5EE5B 3BBPA 3BRWD 3QKSB 1M7GA 2BKUA 2Z43A 4BFWA 4HB4A 721PA 3PCRB 1TUIA 1JAIA 1QHYA 3CX6A 2ZI5A 1FTSA 1G17A 2A30A 1VHTA 2HF8A 3PG5A 4FCVA 2O8EA 4HAUA 1IOZA 3L0SA 1E2FA 2NZJA 3SFZA 1P60A 2WJGA 4A3VB 1G6OA 2N1BA 2OV2A 4JL6A 2QY9A 2YWFA 1CXZA 4DLRA 2J7PD 2ZRIA 4PO9A 4P0TA 3PXGA 3WP1B 4W7SA 4B48A 2Q9BA 1ZBDA 2UVQA 3GJ4A 4QXAA 3CPHA 4KVAA 2DR3A 1Q20A 4NPHA 1SXJC 2ZIAA 1GKYA 2GJSA 2VYFA 3O47A 3QG1A 4IW3B 4PAOA 5B58C 1F2UA 1HUQA 2ZRHA 3BS4A 2C03A 2J0UA 3RSOA 4ZO4A 4A0HA 1ZRHA 1GL9B 5BN3A 3RLFA 4XWKA 2RGXA 2Z4SA 3KFVA 5FTNA 1JPJA 1Z0AA 4JVSB 3G0HA 4PR0A 3QQ5A 3NDBB 2VEDA 2WTUA 1US8A 5EP3A 3LVQE 4BFTA 1ZC3A 1FTNA 3H2YA 5SZJA 2XNSA 4HB2A 1IXZA 2YOHA 4FWGA 2G6BA 4KLZA 3B8HA 4Q1DA 1GG2A 2H1LA 2DPXA 1IN5A 1QHNA 3PITA 3W9YA 2GEDA 2V7QD 3T5GA 4EQ6A 5JHGB 4URZR 4BFUA 5C2JB 4OQMA 4Q9JA 5GADl 4Q7MB 2FPKA 3NEJA 2QNRA 3FDIA 2DZNB 2A5GA 5EUQB 4MDFA 4ABYA 1NKTA 3THYB 3P4XA 5G53C 5JECA 5KSPA 4DSNA 3HU3A 1UKYA 2OFOA 4TYNA 1N5LA 4MYUA 4TZ0A 1DBSA 2WV9A 3GLFB 4A82A 4RD4A 1OXXK 1IM2A 5HPYB 2CVHA 5L3VA 5GJCA 1L7VC 2FJUA 2ERXA 4QJ3A 2FSIA 3LAWA 3FMFA 2V4ZA 3OIWA 1KMHA 4H1UA 5CJ2A 3RRNA 1E6CA 3HJNA 3EAQA 4LUCA 1G5RA 2JDID 1S2MA 3QKSA 4PSAA 3Q8XB 4F4CA 1NNEA 4DRZA 1N0WA 3OHMA 2HLDD 2A9KA 2J46A 2YNMA 3UIEA 5J5CA 4OJQA 4CEIB 2CLSA 1ZD1A 5KOYA 1TQDA 1W0JA 1KO1A 3U4QB 2NO9A 3LDAA 2C9YA 4BLPA 3W5IA 2WBLC 2BMEA 2E1RA 3TUZC 4FMDB 2O0KA 4IDNA 1XPRA 1JECA 5D3QA 3KX2A 2V54A 1G18A 2G1JA 4TZ6A 4F92B 3CRW1 3QXCA 3WNBA 1ZNWA 4BWYA 2PMKA 4ESHA 3AVWA 5JJIA 4CEJA 1U0LA 4JKYA 1UKEA 1U98A 1WRBA 4JLKA 2E87A 2XTMA 3TSWA 4AG5A 5EE9A 2Z4RA 5B2ZA 2O8FA 2IXGA 2ZJYA 2ZJAA 2AWOA 3AKDA 2NPFA 2VTKA 1HE8B 4HAYA 2O8CB 1OYWA 3RS5A 4BE7B 1OH5A 4POAA 3KW6A 3U5ZB 2H8KA 2O52A 4LC1A 4DCSA 3SS8A 5J4VA 2KSQA 1IBRA 2IYYA 2ZRGA 1E0SA 4S35A 5CK5A 1ZD8A 3CB4A 4QNRA 1UEIA 4IOLA 1UFQA 2GILA 5BXQC 2B8TA 1R10A 2G88A 4JBWA 4EFLA 1DADA 1A2KC 4CVNA 1PLLA 2CNWA 2WIBA 5B57C 3AVQA 2YWHA 1BMFA 1AN0A 1Z28A 4QJ4A 1KDTA 4QGFA 4MUBA 2B21A 3UWKA 4KYIB 1W5TA 1S9DA 2W6ID 2XOKD 2OO7A 1XEFA 4IDHA 2QENA 1QF9A 4C30A 4TT3D 3VR3A 1ZIPA 4AD8A 4NMMA 5KSYA 4A36A 2BC9A 4EFNA 1ZJ6A 3I4LA 1OXSC 2YJTD 1II0A 3IILA 1T3HA 4IVPA 2CE7A 1BOFA 1Q1EA 1R4AA 2EYUA 2AXPA 4ZCLA 1N6NA 2ZRPA 3NEYA 4Q5IA 3RS2A 1HH4A 4HAXA 3FTQA 2BBWA 3VLFB 2MMGA 3RWMB 2QBYB 5JCPA 5CK4A 3SBEA 1NLFA 2ZE7A 3CF2A 2DZOB 4Z1MD 3BB3A 3R20A 4QJ5A 4ZPXA 1XTSA 1X86B 1KJWA 5FPTA 4JL5A 2IA5A 4V0KA 1P61B 3VQTA 5JI2E 1FX0B 4BFVA 4BQSA 1R8SA 5FBWB 1Q0UA 3SFVA 4DBLC 1J90A 2C9CA 3DM5A 4Y0AA 3FFBA 1R5OA 2IHBA 4M1YA 4NE2A 3SR0A 2A3RA 3E1SA 2MSCB 4TSFA 4FWHA 2JASA 3EPJA 1G7TA 2FF7A 4A0FA 4D2IA 3TAUA 2BVNA 1E1QA 3AB3A 1QHHB 1ZAKA 4MH0R 2IWHA 1KYIA 1XWIA 4B2LA 1U81A 1G1MA 2ERYA 1ANKA 4GOXA 2PX3A 4XD7D 2HDNB 2O8CA 1HQYE 3KB2A 1OB5A 3BH6A 1XP8A 1SQ5A 5C4GB 1Z0FA 2QPTA 2IBMA 1N2CE 1D2MA 3X1DA 2AN9A 1DPFA 3MWLA 4ILEA 3PEVA 1KGDA 5J4LA 5JRZA 3SQXA 4I1SA 4FMCB 3LXXA 2FPMA 3AVTA 4JSTA 2ANCA 4LYHA 3LH5A 1XD8A 2C78A 2PZGA 5DI3B 2QEQA 4G3XA 1OJLA 1E2DA 2ZPTX 1G3QA 2JJ2D 3QKRA 1II8B 3T1QA 1CIPA 2XZOA 4G1UC 2OBLA 4IDPA 3LO5A 2ZI7A 1G7SA 1NN1A 3KQKA 2YKGA 2W2XA 3IPYA 4DB4A 2QAGA 821PA 4OYHA 2P6UA 3B1YA 4PHGA 3MG9A 1XTKA 1NBME 2N46A 4B35A 1T0JB 1GNRA 1YRAA 1ZUNB 1CTQA 4NYJR 3OE7A 1JJ7A 4FMDF 6Q21A 3B1ZA 2AXNA 5FBLB 3C8UA 2DWPA 4OHZA 3ZYCA 3TRFA 2X2FA 3VR1A 3A36A 1N5IA 3CRVA 2RGDA 4R2IA 2WKRA 4PC7A 3EC1A 2WM9B 1LFDB 3WP0A 1X8KA 2JLZA 4WXRA 1NI3A 5DSZA 2O0HA 3ZLJA 2DWZB 1W4RA 1R8QA 1NVVR 2LKCA 2GCOB 4NHOA 3I62A 2V1XA 1XJ0A 3I8XA 3VNVA 2FPLA 4BASA 3T61A 1IONA 1GRRA 2BJVA 4MA4A 4Q4JA 4PSKA 2J7PA 1VG1A 4PHFA 3T34A 4PC3A 2Y8EA 3TE6A 1OB2A 2QORA 2IS2A 2I1QA 3NC0C 2BBSA 1JR6A 1NIPA 4AIIA 3QPWA 3U7GA 5KTYA 2BV3A 5L3SA 4B47A 1ZC4A 2Q9AA 3CW2A 1P2VA 1RRGA 2EVWX 1U99A 5JSZA 2CJWB 4Q21A 2AR7A 3T1VA 1IY2A 1GAJA 2GXUA 4L5BA 4LHZA 4TYPA 5K8IA 3KQLA 1G4AE 2NTYC 2WKQA 1EG7A 2VP9A 2DWOA 2AKAB 1Q1BA 4AY2A 3RNLA 2A5FA 5TXGA 3LFUA 4GBMA 3ZVMA 1M2OB 5JI3E 3T06B 5KPDA 5G3ZA 4CW7A 1GOTA 4AWXA 1II8A 4Q19A 4QBHA 2WAYA 3LV8A 2QROA 4F4JA 1AM4D 1P72A 3NBYC 2VSFA 2OZEA 2XGJA 2CCGA 4Q4AB 2V7QA 2XZPA 4OJKA 1G7RA 3B1XA 3L82B 3NC1C 2XXAA 4KITB 3AF2A 1NG1A 4LWZA 3DMNA 1PLJA 3BB4A 221PA 1AIPA 2YWEA 2OBNA 1G8PA 3KJEA 4BEJA 2F1RA 2XTNA 4BLSA 3MSXA 4DLYA 1LVGA 2IF2A 2JLSA 3THOA 1G3MA 2KE5A 4K46A 5FOVA 2G83A 1Q21A 4WVFA 1Y3AA 1G16A 5TMPA 3ADBA 4E09A 3M1IA 4RZUA 1N6RA 2JDIA 4DDUA 4TYWA 1Z07A 2XX3A 1GNQA 3AF1A 1YHNA 2WJVA 4Q1AA 1MABB 3VKWA 1YZTA 4URUR 1KI9A 2QTFA 3U61B 1TEVA 2FE4A 2HV8A 2W00A 3QKTA 1XEWX 2VA8A 2ZJBA 4HLUC 4RFVA 4S2EA 4ZIRB 2CEAA 2B7BA 4FMCF 5FL7D 4UJ3A 1G3UA 3AP1A 4LHYA 2A5YB 2RKOA 1UF9A 4MGYR 2JLUA 3FMIA 4G01B 4FWTA 2GJ9A 1FFHA 1OHHD 2BM1A 3X1XA 1H65A 2X2EA 2A5JA 1FP6A 3U3KA 1G5TA 2JJ8A 2Q21A 1X1SA 2QM8A 3DOEA 3M0EA 4RJLA 3U7FB 3TGPA 2ODBA 2QA5A 1NN0A 4X8HA 5FUWA 5JBQA 3LBHA 1MRSA 2OLKA 1SVWA 3LD9A 1U0JA 3H0KA 3A4NA 5K8UA 1Q22A 621PA 5KDOA 3B7GA 2V6ZM 2ZYTX 5FL3A 4HSEA 3A1WA 1JXMA 1E2MA 3QXJA 1G9XA 1CRPA 3QE0A 1E96A 2NO7A 2C95A 4Q47A 1GRNA 1VCOA 4KODA 1NBMA 2JIZD 5FPSA 4BGDA 3UMSA 4U02A 3LLMA 4X8LA 1W49A 4ACBA 4UNSA 2PCJA 1UADA 3UMFA 1R5NA 1ZW6A 2CL7X 3X1ZA 3GJ0A 1XBTA 4OI2A 1VDZA 2W6JA 3DO6A 3IBYA 4HZUA 5E4FA 2NO1A 3B2EA 2VIIA 1XU4A 1YZUA 2OAQ1 5EP2A 3EZ2A 3VFDA 2OCPA 5JFGA 3Q7QA 4KO8A 4M2LA 4MKIA 3T12A 2VP6A 2NO0A 4TMWA 1LY1A 4LPKA 3OEHD 3VR2A 3QF4A 2IYLD 1LF5A 3Q7PA 3K9GA 1KK3A 4V0LA 2XOKA 1M6NA 4A8JB 5F3WB 1F60A 1W4BA 1W4CA 4FMBB 4HDCA 2GZAA 1AZTA 2RGGA 3TIFA 5P21A 4DWJA 2LCFA 3OESA 3H86A 3F3YA 1KAOA 3OEED 1HQCA 1RVDA 5JMTA 1CS4C 1EK0A 3THWB 3QENA 1F2TA 2ORVA 4HB0A 4I1UA 2F55A 4FCTA 4NYMQ 4AKHA 4D25A 2CLCX 1T5LA 4GMXA 3ND8A 4Z51A 1MABA 3WYFA 1BS1A 2QRZA 2J59A 1FNMA 1G20E 2NZ8A 3PUXA 3BIFA 2C96A 4W9MC 3AF0A 5KNDA 1DO2A 4DC9A 2DFKB 2OUKA 4IXMA 3GEIA 3ZDQA 1COWA 4LYFA 4MKGA 4MRVA 1XD2A 2F3RA 2ZI9A 4A6XA 3WY9A 1XMIA 5F9HA 1RRPA 4IEIA 5HTKA 1SXJD 4PX9A 3MJRA 4XTCS 2QMUA 1J8MF 4OL0A 3CR8A 2PEZA 3R8CA 3A4LA 4RD0A 4M9QA 3EPKA 1CJVC 1S8FA 2H92A 2C98A 2V55B 2ZUDA 4KAXA 1G8YA 2ZE8A 5FPYA 3FFAA 4PZLA 3EASA 2FA9A 1TADA 4XD7A 3CKLA 2ZJ8A 1E32A 4GL2A 4LJAA 1RIFA 2KBEA 2XTZA 2IXFA 4C0KA 3NTUA 4C7OA 3C5HA 3SN6A 3ZZ0A 5FTJA 2H16A 4HUTA 1TU3A 3CNLA 2FV8A 1YR6A 2AHOA 2VRWA 1CR4A 2A7QA 4O0MA 1CU1A 4XVQA 2D74A 1EFRA 5F98A 4YDSA 4DHEA 1QBKC 2R62A 2ZETA 3GMTA 1NVUQ 4DLTA 1W2GA 5HE9A 1I2DA 2IT1A 2VQSA 2VP5A 1D9ZA 2G0TA 3TW8B 3MWKA 1I2MA 5JZVA 1GVNB 3HU2A 3L8YA 1KJYA 2HJGA 2IW3A 1AJEA 4URYR 4V0NA 2TMKA 3CPJB 4A8JA 3MWYW 3K53A 3H4MA 3DZ8A 3AM1A 1N5KA 4QBIA 2PEYA 3U44B 3A8TA 1D2NA 2GXSA 2IYSA 5KSZA 3IHLA 2V6JA 4FWDA 3OFNA 5IK2D 1Z6XA 2VHQA 4D0NA 1S0UA 2R65A 1Z08A 4ASUD 2H18A 2GCNA 4IRUB 1W47A 2ZI4A 1Z6AA 1ZUHA 5TV2A 3MD0A 5E7MA 4QGGA 1XCGB 2G9NA 1X8LA 3VHLB 1DAKA 3QBVA 2IS1A 1QDEA 3RRMA 3MJHA 2O8EB 2G3YA 2ZM5A 1ESNA 1B23P 1J70A 4WIAA 2H5EA 3RABA 3CX7A 3K1JA 2X19A 3QJYA 4EAQA 1EESA 1G291 5CYOA 3V00A 4X8MA 2NG1A 3DHWC 5FR1A 2C9OA 3ETLA 4E22A 3AF3A 3GLHA 2C04A 3LRPA 5AJYA 4CDGA 3MRSA 3THXA 3K09C 1KDRA 3WXMA 1G8FA 4YXWA 5LB4A 3KQNA 2X8AA 2VH5R 4R98A 1NIJA 2BDTA 1P5ZB 2IUSA 2R6GA 4Q4LA 1EFUA 1KDOA 5EXXA 3OF5A 5TB5A 1KJZA 3W5JA 3V9PA 1DG1G 2D62A 1F2UB 1RYHA 1W48A 1Z0JA 3NH9A 4WBSA 2ATXA 2J0UB 1IXRC 1E9BA 2FFQA 2XNDD 1R0XA 5EE1A 3TR5A 4UXJA 2AK2A 4C0HA 3FVQA 5CB8A 1C9KA 2IHYA 1KI3A 2ANBA 4RFSA 1NY6A 4BFSA 1US8B 2NQ2C 4HDQB 4DUGD 5FOSA 3KXIA 3UXMA 5J47A 2F1JA 1D9XA 1SXJE 2QI9C 4C9BA 5BW8A 1H8ED 4YMWA 2KI5A 4KCGA 3GJ5A 3UK6A 1TQ4A 4F91B 3DVLA 1Z6GA 2AD5A 3G82C 3HPQA 3KKMA 5FUXA 2MSDB 1N5JA 4EQ6B 3BC1A 4B33A 2GDJA 2QMOA 4DT1A 4FINA 2ZRFA 3T35A 5GJWC 3I92A 1SVLA 3OZXA 3RHFA 3A1SA 4MYHA 4UNNA 2OG2A 3GJ3A 2LWIA 5AJXA 3QVVA 2OCAA 3V4FA 1MRNA 2REXB 1G3IA 1R0ZA 2BM0A 4IJMA 4TL9A 2FEMA 3CH4B 1E2QA 4L4UA 1P9RA 2J5XA 3Q9LA 3A1TA 1KI8A 3X2SA 1KMHB 3WBJA 2GESA 4I99A 2ATVA 4AKGA 3B78A 1GIAA 3Q5EA 3HYRA 1OKKD 4F7WA 1W36C 2NOAA 4NCHA 2E9SA 3QF7A 2FFBA 3MCAA 3ZZTA 2R6DA 3K0AA 2RHMA 4IFBA 3LQRA 3W8RA 4DDTA 1JJVA 5KYKA 5FTKA 4XVUA 3UWOA 3BFKA 5DGXA 1FP7A 3QY0A 5J4KA 5JEEA 3BERA 2F1IA 3VR5A 3ECCA 4BLRA 1FQKA 1MO6A 4TYQA 2F43A 5BN4A 1A4RA 5B30A 4V02A 2XAUA 3T1TA 2BOVA 1FQJA 2QP3A 4A1FA 1NMYA 1E2HA 2WJHA 4TLCA 5CIWA 2J0SA 4M1WA 5SZIA 2JCSA 1KNXA 3B9PA 2HCBA 5KDLA 5FL7A 3LX8A 2JEOA 2AK3A 3ONWA 2HXYA 1MO5A 2W2TA 4CEJB 4GOKA 3BOSA 1ELOA 1KI4A 4L9SA 2O8FB 3FMPB 1HEIA 1DAHA 1T4GA 4LJ5A 1G21E 4TLAA 1KI1A 5D3MA 3T5DA 2GETA 4LBYA 1C4OA 1N3BA 3KZ1E 3QXXA 3LY5A 1XNJA 1DAIA 1SHKA 2IYRA 2OE2A 3HDTA 1E9SA 2XEXA 4US1R 1NRJB 1RFLA 3REGA 5JWHA 4UNRA 521PA 1L8QA 1M1YE 2ZXUA 4JLPA 1E98A 1SKYE 3KL4A 4HEJA 2PL3A 1AKEA 2QTVB 1OXTA 3K9HA 3KTAA 3W90A 1OYYA 4B34A 1DTSA 3EZ6A 5BN5A 4XSHA 1XRJA 4JT4A 3AVOA 4JLOA 4FWIB 2JATA 1IN4A 1DEKA 3FWYA 4KBFA 4N1AA 4PTLA 1YR8A 1VG8A 1FPMA 3SQWA 2ONKA 4OHVA 4OQFA 3OEHA 3L0OA 4YC7A 3NBZC 1OH6A 4XH9B 2IF0A 4LRSA 2CCKA 4YLGA 5EZ5A 2OAP1 2WMNB 5AJVB 1E2PA 2ASEA 3AKYA 1MO3A 4DCNA 1PJRA 1Z2CA 2YHSA 4M1KA 2CBZA 3OEEA 2MSEB 2QE7D 3I73A 4PHHA 3TVDA 2P5TB 4JLJA 4D4JA 1TPZA 2DWQA 2WJJA 2BMDA 3PV0A 4QG7A 3KJGA 1TF5A 2OBMA 2QP4A 1E2EA 2IK8A 4JT2A 4ZV4A 4JMPA 4DDWA 3CRMA 2PZEA 2GTPA 2ZAMA 3MAAC 2GXAA 4L15A 1TQ6A 2DY1A 2D2FA 3M6AA 1AGPA 4TLEA 1S3SA 2Z6VA 4AI6A 2L0XA 2VSOA 2P0EA 2RGBA 4JLMA 1KDPA 3AP2A 4XVRA 3LX5A 3VX3A 2PH1A 4A0GA 2CLDX 1EXMA 2ZRAA 3I5YA 1SXJA 2OFWA 3O8RA 3K0CA 1J7KA 4MRNA 2CVFA 1T6NA 3L0PA 2RMKA 4TQAA 1IXSB 3WHLA 2GAAA 4WAUA 1NLZA 1ZYUA 4PPFA 5IRCD 3KFXA 1SKYB 5DN6D 3W3ZB 4DEXA 2IX3A 4TMZA 2I1VB 2J7KA 2FX3A 5JCZA 1L2TA 3KJHA 2GZHA 1W46A 4JJZA 1E9CA 2OILA 4RD3A 3CONA 2PX0A 4RD1A 1XEWY 2PLFA 1KTVA 3ZZUA 4IVQA 2QSZA 2ZROA 1WA5A 3QKRB 1NKSA 4MRRA 4RCZA 3GFPA 4PAMA 2QQ0A 4U5XA 1CKEA 1T8TA 5FPKA 2JLYA 3ICQB 1R7RA 4RKEA 4TLBA 2QAGB 3KQUA 3ZVNA 2PLRA 4LCBA 1ZMXA 2ZANA 2JJ1A 4M22A 3BH0A 4XSGA 3EPHA 2JLWA 2DBYA 1FZQA 4KVGA 4MKFA 1N0VC 4CT4B 2H57A 2GWHA 3QOFA 3ASYA 5TY0A 5DISB 3U3OA 2QAGC 4QL3A 2W83A 4B3DA 5KDDA 4TMVA 3DMDA 4GT1A 1SVMA 5IK2A 1IAQA 4EIWA 2FZ4A 1JAHA 4HB3A 4HLQB 3RYTC 1EFTA 2V6IA 3DKPA 3RAPR 2OXRA 4P33A 1P9WA 3K9NA 4RD6A 5H68A 3KQHA 5IHPA 1TL7C 4Q9IA 4LY6A 1R0WA 1OFIA 1GM5A 1CF4A 5EUMA 3ZS9A 5C1BA 2JLRA 1QRAA 2XJ9A 5SZKB 1Z0IA 2C77A 2UKDA 1OPXA 3NG1A 3QEOA 4I1OA 4LJ9A 4Q4JB 1KO5A 1PZNA 5EXPA 2OEPA 2PCLA 2IUUA 4C0AC 3BWDD 4R7ZA 3S1AA 2XJ4A 3ZQJA 5EE0A 2QG6A 3FHTA 2AX4A 1YR9A 2Q6TA 3DKVA 1E79D 3QNUA 2R6FA 3AKEA 4HATA 4OQLA 4UNQA 2MMCA 2OCBA 5L3SB 5B64A 2F7SA 1NMZA 1RKBA 2WJIA 2WSSD 4DJTA 2P6NA 1JB1A 1K8RA 5JSZB 4G5QA 1ZNYA 3B5JA 3ZQ6A 4Q00A 2P3SA 4WZBE 4N3NA 3VAAA 3FGNA 5KPJA 3RS7A 2QT0A 5JWOA 4B6EA 3AVPA 3TUJC 3BH7A 3P20A 4YMVA 4XWOA 5JRJA 1YVDA 4MYCA 1XMSA 1H8EA 1HY3A 2VF7A 3AGPA 4LHXA 4PC1A 4JLVA 4N0DA 3C41J 1W1WA 4OK5A 5TVKA 1VMAA 1LV7A 3AUXA 4Q9HA 2OXCA 2ZRCA 3AEZA 4C2UA 4WA7A 4QM7A 2PT5A 1GUAA 3EZ9A 1ONBA 1YU9A 1E9DA 1HTWA 1H8HD 2W2VA 4PHTA 2XXAB 4PPQA 2V9PA 4EKDA 5FOWA 3F8TA 2WWYA 4KHZA 4NTZA 4NYMR 4C0BA 1VYTA 1GILA 2GJ8A 2YOGA 1P3JA 4XTRA 4RY2A 2ZU0C 4TMKA 3A1UA 4EPXA 2BEJA 2J3EA 3M4YA 4B76A 1AKYA 3CX8A 1KAGA 2BWJA 5H1YA 3EZ7A 1XZPA 1OKKA 3RS3A 2IYVA 2YWGA 1KY2A 2RGAA 3QXSA 1XTQA 1GFIA 2J0VA 4M9ZA 3Q72A 1XJQA 4TTRA 1OFTA 2AL7A 1M34E 1JPNA 2VF8A 5JWRA 4IFEA 5EP1A 1KMQA 1Q3TA 2DFTA 2V8OA 1FNNA 1TQ2A 3CRRA 5DIFA 2C99A 2ECKA 2VHJA 4MQBA 4PZZA 4M1MA 3MGCA 1OXVA 1ZM3A 2YC4C 1Z0KA 1YQTA 1P6XA 1U90A 2DVWB 2VL7A 1UKVY 3R9WA 1Y63A 2IYQA 1CR1A 3W6PA 4AC9A 2UZIR 4QKQA 5C46F 4Q66C 3NBXX 2QMEA 1FUKA 1G8GA 1GITA 2CHQA 2ODWA 1G6HA 4JBXA 1KSGA 2JLXA 2C8VA 4UKDA 2ZJ2A 3PUZA 3DM9B 3WBKA 4A4DA 4B73A 1E0KA 1OSNA 1QHIA 2D7CA 3CIOA 3BD9A 1NG9A 5CIQA 2WVJA 1ZNXA 2KBFA 2WIAA 5DE3A 3SYNA 4OK3A 4D0LB 3PQCA 3GFOA 1Z8FA 1DG3A 3EPLA 3FYHA 1M74A 3IUYA 3GEHA 2EFHB 3TSZA 1HT1E 2XSZD 3P1JA 3GJ7A 1MT0A 1NVWQ 1W0KD 4HZUB 1LNZA 4M9XA 3TW4A 3W34A 2GVZC 2B6HA 4A2WA 4JVNA 2GVDC 5FTMA 1OLOA 3WMFA 2EQBA 5JS8A 5FOTA 2P67A 4OQNA 4W5WA 3AF4A 1VKJA 2FG5A 2IYWA 1W4AA 2QSYA 1IN7A 3QF4B 5LD2B 4ERNA 4KXFB 2VO1A 5C18A 5H70A 1U94A 4A0RA 2VSXA 4AG6A 4Z8XA 1HT2E 4D82A 1ZINA 2D06A 2FFAA 4PPNA 5AJZA 4KLNA 3BE4A 2ZVPX 2QGZA 3AJIB 1C1YA 1F2TB 4ZDJA 3EX7C 5M04A 3CRQA 2GNOA 4E07A 3C5CA 4DVGA 3GP8A 4RVCA 4GP6A 3AVYA 2HLDA 2QE7A 1AA9A 2WICA 2ZI6A 4Q03A 4DIDA 3FE2A 1SVSA 3SHFA 2V3CC 3TNFA 5A4JA 2HT6A 1QVRA 2EYQA 4WZAE 4KFUA 2YZ2A 4TQ9A 3OIYA 2FGKA 5DLQC 1I4DD 1XD2B 1ETUA 4GSYA 2ORWA 1G4UR 2ZJ5A 2IEYA 2NGRA 3H1TA 4EJSA 1ZIOA 3WMEA 5CDFE 2ZI3A 4TMXA 4BFYA 1UKZA 4M21A 4UXIA 3UPUA 3VKHA 4AURA 2ZAOA 1N6HA 3AVUA 3CBQA 5JEDA 3CH5A 1WCV1 3U3RA 4C0SA 3PEWA 2QAJA 3GLHE 3WNCA 1DARA 3P26A 4QFMA 3TUIC 2GK7A 3IKJA 1VYUA 1KK0A 1QG4A 2BBOA 4LGMA 2YV5A 1W44A 4IOJA 1E2IA 2EWVA 3OIUA 1D6JA 1CP2A 5AK0A 2CHVA 4M1OA 2F9LA 4OHYA 4C7OB 4ARZA 3VX4A 2QRNA 4O25A 4NZYA 4AYXA 3OIVA 5AWFC 3VNUA 2IS6A 1AK2A 4JLDA 2FZLA 4GI7A 2QL6A 1SGWA 1CR2A 1Q44A 4H9GA 2A5DA 1X6VA 2ZRJA 3BGWA 4DKXA 3IEVA 4B3GA 3RWOA 1BIFA 4LI0A 4CF7A 4K8OA 1KNQA 4FCWA 1I4LD 2I3BA 3D31A 3MUFA 4B32A 3ICEA 2W6IA 1U2RA 1B0UA 1N6KA 4BPBA 4CT5A 1XCPA 4TT3A 1Z6TA 3SDZA 2PJZA 4ZKEA 4KFSA 1ODFA 3KXKA 3REFA 2YC2C 1XB2A 2VP0A 2EW1A 2R9VA 4I1VA 5AUQA 2RGNA 1W36D 1CJMA 1WQ1R 3KXLA 1WXQA 3I32A 4Q1BA 4DB2A 4A8JC 1TMKA 3BK7A 4DCVA 3ZGXA 3MHVC 1E99A 4Z1MA 2QPAA 3IIJA 4QM6A 2QZ4A 2CL0X 2Z5FA 4FN5A 2QGNA 4PSVA 4ACAA 2BEKA 5CM8B 3BB1A 2VP2A 4JVMA 5CLLA 3CZQA 2IUTA 3GLHB 3IHWA 2J1LA 2ZSFA 3NWJA 4NP6A 4TYYA 2AFIE 3THXB 2ZVQX 1OF1A 3P32A 5UKDA 1XFAA 4L16A 1E9AA 5E7JA 1AS3A 2VHTA 3SYLA 1WB9A 1FMJA 5H8WA 2HUPA 4UQOA 3EIHA 4A2PA 1QG2A 1WF3A 2RCNA 3FKQA 3TLXA 3D8BA 4CRWB 4R9UC 5EE3A 1E79A 1HYQA 4KU4A 3U6KA 4TL8A 5GJVC 4CYMA 1O3YA 4RFSB 4XJXA 1BKDR 2R8RA 1X1RA 1T8UA 4W5HA 3GCGA 5FOUA 2ZREA 2B7CA 4TL7A 4LX0A 4NU0A 3D3QA 4Q1CA 4Q7LA 1OFHA 4HI0E 3HWSA 2IL1A 5FBRB 3AP3A 3SJCA 1XX6A 1WDTA 2GAOA 4AK9A 2JJ2A 4HLDA 1Q12A 1U8YA 1U0HC 4IOMA 1CJKC 4DT1B 2IEZA 4PXAA 3EW9A 1IQPA 2IYZA 1DS6A 1VPLA 1OE0A 1P2TA 2AKYA 4NONA 1H8HA 1OIVA 1EX7A 4RKFA 2CNWD 5G3YA 2D7DA 2ZYUX 1BMFD 1PUJA 1PV4A 3OAAD 2GJKA 3IQWA 1ZCAA 1G5PA 3B60A 3EWAA 5CM9C 5DHFA 3SOPA 3FOZA 1YR7A 1J2JA 4LZZA 3IO3A 2X77A 3NKVA 3AKCA 1R6BX 3K0AB 2WOOA 3TSOA 5DNYB 4WOPA 3C7KA 1XTIA 1P73A 5HE8A 4Q1EA 4QHTA 5CDFA 3QIAA 1E4VA 2Q3FA 4B71A 2GKSA 1FW6A 3GJ6A 3PEUA 3L43A 3W6NA 1R0YA 2F43B 1KI6B 2ZSAA 1MH1A 4DLSA 2WWWA 4QGAA 3ADKA 2ONJA 1Z29A 1GP2A 2Z0MA 5FUYA 4Q1FA 1S1CA 2OT3B 5L3QA 5KSOA 2Q3HA 1HURA 3Q5DA 1BH2A 3U6BA 4TLDA 1KY3A 2ZE6A 1IJFA 3UKDA 4JL8A 2QU8A 3W8NA 3QBTA 4C0QC 4BZPA 4ZCMA 4P4UA 2FSGA 1GRQA 4NL4H 4TSFD 1U9IA 4TTPA 4JLAA 4DSTA 4M4SA 3SZRA 5HCIA 1NJGA 3B13B 4FIDA 5D3MB 1DAEA 3DZDA 3K0FA 1E1QD 2OM2A 1WE2A 4QGHA 3U3JA 3GPLA 2GA8A 3IQXA 4MRSA 3NH6A 2Q9CA 2HYIC 4WZ6A 3T1OA 2ZUBA 1SVIA 1JNYA 3UG7A 4E5UA 4LDJA 1DAGA 1K5DA 2ZTSA 2CK3D 3KKPA 1Z5ZA 3GLIA 4G5RA 3AUYA 4BEBA 5DO9A 3KTAB 4NH0A 4DSOA 4OI0A 2FEOA 1G7CA 2C5LA 3CF0A 1AZSC 1AGRA 3QVUA 3A37A 2A2ZA 3VHXA 4F4IA 1ZM9A 4LRWA 3LW8A 4M8NE 3TVTA 2GBLA 3LBNA 1RW4A 1JQLB 1L4YA 2R44A 1ZM4A 3NHBA 3R9XA 4C0JA 1TTTA 1NLYA 3Q3JB 1EFCA 4ON9A 1XPOA 3B6EA 4DLUA 5AUNB 1UDWA 2VHCA 3A6PC 4ITRC 3LW7A 4B74A 1F5NA 3P27A 4HUQA 4LV8B 3O8CA 4GRAA 4K81B 3BFVA 5IDVA 3WHKA 1ESMA 1VYVA 4L8GA 3JZAA 2K5UA 1KI6A 5EZ6B 3G5UA 3EXAA 1J8YF 2LKDA 5DYGA 2FN4A 3NBFA 3SE0A 4ZI2A 4US2R 3TKLA 4ZDIA 1NJFA 1OFUX 1D2EA 1YKSA 2AD1A 1T91A 2GHIA 1CJTC 1KZ7B 4BLQA 1EGAA 2QMHA 3AQ4A 3E2IA 3GLFE 1JR3D 3B1VA 4V0OA 3U60B 3K09A 1KI2A 1IJEA 3LLUA 4GZMA 3NVAA 2ZRBA 1SXJB 2CMKA 1OHHA 3F5FA 3RS4A 3DL0A 3SJAA 3FKSD 1W7AA 1WBDA 4OKSA 5CLQA 1RJ9A 1E9FA 5HZKA 1DO0A 1Z63A 2G1KA 2XB4A 4Q18A 3WMGA 4G5OA 4O3MA 1NF3A 1ZM2A 4L9WA 5L3RA 3C15C 4BFZA 4Z8YA 5F9FA 3CNNA 3K0CC 2OSBA 3GD7A 4D4KA 4Q4HA 4US0R 3VKGA 2DFLA 1R2QA 4BUJA 4D0GA 4EPVA 5HKKD 1UJ2A 4IDQA 4D6PA 2JIZA 2ZRKA 3QPVA 4JS0A 4NCIA 3DOFA 1G8HA 3ASZA 3JVUA 4LBZA 4DEYA 4F93B 3I1FA 2XZLA 1Z83A 1EWQA 1NSTA 1N0UA 3RC8A 3ZVLA 3U2QA 2VBCA 5KNCA 3R7WA 4CEHA 4CGZA 3QI2A 4YONB 2ZR7A 1SVOA 3CWZA 2O8DA 1DVRA 3MMPA 1CLUA 3L2OB 2NO6A 4JLNA 1XXHA 3WYGA 4IXNA 3F0TA 4QHYA 5EQTA 2VLIA 2YYZA 3NHAA 1V43A 3K70B 2IXEA 1KK2A 4YMUA 3EARA 1U8AA 1GZSA 4EPYA 3QUSA 3ZD7A 2BBTA 4LJYA 3TQFA 1Q3HA 1VECA 3PFIA 1NMXA 2ZQ5A 4IOKA 2WHXA 4RZXA 3K70C 2FGJA 5EXTA 2N42A 4EDHA 3TQCA 1NSFA 2J0QA 2SHKA 3JVVA 5DH9A 4M0LA 4PC6A 4DZZA 1CBUA 4P4SB 3WYAA 5FBVB 4IKEA 4TQUS 2WWIA 4PO1A 5FTLA 3AGQA 1X3SA 4JYCA 4DLXA 2F9MA 1M8PA 3VU9B 2W0MA 4LYJA 3CLVA 3S1AB 1GKIA 3HR7A 2WSMA 3LQQA 3VMFA 3MLEA 4Q9LA 1YZLA 4EPTA 1NVMA 1ZNZA 3EWSA 4TWZA 2JA1A 5LB2A 1UBEA 2HCJB 1GNPA 5GVRA 2O0JA 2A78A 1N6IA 1Q57A 3ZIAD 4B2PA 4GMDA 1P2UA 1T5IA 1X8JA 3RRYA 2HYDA 1IN6A 5C4MA 3KKOA 1JR3E 4PQRA 4KFRA 1E1RD 1XD9A 3CNOA 4E03A 1E69A 4HAWA 1TF2A 3LWNA 4N0EA 4P3YA 1LF0A 3I3SR 1G19A 1UM8A 3E5HA 4JN6A 2GZDA 1PLKA 2KB0A 2PBRA 1KKMA 1S9HA 4LJ8A 3SJZA 1TEXA 4DCUA 2ZUCA 2RGCA 4A9AA 1KKLA 1IN8A 5AUOB 4GOJA 1A5TA 4II7A 4ZDWA 1NBMD 4LHWA 1Z2AA 8OHMA 3HPRA 1ZP6A 2DHRA 1DELA 3RANA 3RS0A 4YDHB 4DLVA 4WW0A 2HJVA 2W6JD 1M7BA 2HEIA 2PT7A 4YMTA 3KDSE 3OAAA 1LW7A 2CDNA 1TU4A 1DE0A 3IBGA 3SU8A 1KK1A 1S1MA 3THYA 1E9EA 1OT3A 4ASUA 1EX6A 4O2RA 4XOIA 5G40A 1JI0A 1L4UA 2VHUA 3GLFA 1S96A 1KO4A 3ZS8A 5IT5A 1VCMA 2CE2X 1NN3A 2FSFA 1CR0A 1Z6YA 1Z0DA 4B3XA 3KUDA 2RB4A 2EFGA 1JEDA 3HYTA 2ZRLA 4P4SA 4HAZA 4GFDA 2GK6A 5LDDC 3FPAA 3EIQA 4IEEA 4PQYA 3SI7A 4I4LA 1K5GA 2RGEA 3VU9A 4ZKDA 2NPIA 5HCNA 2JAQA 3FHOA 3FHCB 2XITA 2FNAA 4XIGS 3RRZA 3H84A 4CZ2A 1NN5A 2V1UA 2HXSA 4CEIA 2O8BB 3W6OA 3ZJYA 1WBBA 4QC2A 4NKRA 1XTJA 2GXQA 1T9HA 3TMKA 2WKPA 1COWD 4LHVA 3U4QA 1XMJA 2RH5A 1GL7A 4RSGA 1G3RA 4LC0A 1OIWA 3HU1A 2XNDA 2ZYWX 3TH5A 5TDHA 3TK1A 1XZQA 2I4IA 3EG5A 2VP4A 4QBGB 1QHGA 1YZGA 4LOAA 4MKHA 3A1VA 4I81A 1RC8A 4DUGA 1PVOA 3SHWA 4J0QA 4BLTA 3AVXA 3N2IA 3ND9A 5BYJA 1MKYA 1FUUA 1XJCA 3GQBA 1KSHA 1NVXQ 4CIDA 2GEUA 3A58B 2AWNA 4IVRA 3C16C 4Q02A 1JBKA 5L8VA 5GVSA 2CK3A 2FOLA 4URWR 3GLGE 4M1TA 2ZSBA 3NDPA 4QRHA 4P32A 4AKEA 3AV0B 4KSBA 4LBVA 1VG0B 3X1WA 1YJ5A 2IC5A 3KKNA 4Q9KA 3I5XA 1F48A 1EFRD 1RRFA 3MWJA 3I72A 3UATA 3IIKA 2DCUA 3E70C 4JVLA 1MOZA 5LBIA 1A82A 3N70A 1QHSA 4KBGA 5ELXA 3SYKA 1XCMA 2WWHA 1P9NA 2UZ3A 4D4LA 1I4TD 2ODEA 5E3HA 4C0LA 4D4MA 3SEAA 4KFTA 1GDDA 2ZU6A 5G41A 2QN6A 1S3GA 1QZMA 2B92A 3B82A 2BKEA 3L0IB 3KKQA 1KSFX 4LBWA 1XMVA 4D81A 3WRXC 3W3AA 4A6PA 1RE0A 2Q3MA 4LJ4A 3FMOB 3LNCA 3IEUA 3OFND 2CXXA 1KOFA 2ZR0A 3LBIA 4EUNA 1SZPA 2QBYA 2D4HA 4M53A 4JSYA 1MO4A 3O8BA 4DLWA 4GPTA 4RD2A 1JXOA 2KRKA 2X1VA 4PO8A 4GNKA 3VTKA 2CCJA 4JKIA 4EJSB 4BLOA 1FX0A 4WXPA 2RAPA 2XB2A 2O8BA 4MRPA 4PC2A 1JR3A 2EWWA 2EFEB 3CR7A 3TBKA 3D6TB 1VIYA 2J45A 4AYWA 1V5WA 4MGKR 4YXWD 121PA 3FKSA 5KU1A 2ZS9A 4OQXA 1G41A 4YMSA 4Z54A 5K8LA 4LRTA 4EJSC 3IIMA 3GLGB 1ZM7A 1FMLA 2ZSEA 5CYPA 5LPNA 1D5CA 3GJ8A 4M9SA 4DLZA 5FBQB 1QHHA 4ARZB 4AYTA 1M7HA 1E2JA 1HA3A 1Z06A 4MGZR 1A2BA 2QPOA 4JZKA 4D80A 4KI0A 3ADCA 3DDCA 3P4YA 3QG5A 3SBDA 2ZJZA 4Q7JB 4F38A 3BORA 1W2HA 3UANA 4JLBA 5HKKA 3K0SA 1R5BA 3J81k 4NCNA 1TAGA 4PAQA 3JZMA 4NYIR 3RVBA 4C2TA 1QVAA 1P75A 1BO6A 4LYAA 3ZD6A 4OI4A 4GITA 2HF9A 3PUWA 5DI3A 1XPUA 1QZXA 4A15A 4A92A 4KSCA 5JJLA 1E0AA 3N5CA 4B3FX 2IWRA 4MYTA 4DXAA 2WZQA 3VR4A 2WPDD 1DOAA 1VCNA 4LK2A 1KIMA 1GKUB 1OW3B 4LJ6A 2PZFA 5KNBA 4C3ZA 2D2EA 5LD2C 3EIEA 3IDQA 1P7CA 5IF9A 3ZH9B 2KWIA 2P2LA 4LV6A 5J4HA 2ZRNA 2ORIA 2FSHA 4YQFA 1YZKA 4AKIA 5BWMA 5FH9A 5KUTA 3U7HB 2HT1A 3VR6A 1OH7A 2R6AA 2O5VA 4HDOB 1OH8A 1SKQA 2RGNC 2EU8A 3L8ZA 1E2LA 1HV8A 4JIMA 2J9RA 2W58A 4NCKA 5HR5A 2BMFA 4BZQA 4R71A 4P4TA 4DDVA 2JGNA 2R2AA 1QHXA 1AS2A 2GF9A 3KB1A 1K6MA 2IYUA 2J87A 4B75A 2IYTA 4OHWA 4GDFA 1TX4B 1BYIA 2ZS8A 2GRJA 3GEEA 4V0ME 5DHAA 1VIAA 1E0JA
chains in the Genus database with same CATH superfamily
3JR7A 5JQGF 3TAHA 4HWSA 1CULC 1QV9A 3VO8A 2FMXA 2HIAA 3PS9A 2BSQA 4ESVA 1XN1A 2JD1A 1EUYA 2QQEA 3ESAA 2IDMA 5EUCA 4TLMB 1NP6A 5G0SA 3VUEA 1IRXA 3ZCSA 3LA6A 1XEXB 3GJQA 1NQOA 2XF8A 3TR0A 2DB3A 2B1IA 5BMVA 1VPVA 4LSGA 2P7IA 1D2HA 3U6CA 1K75A 1VJ1A 2G4LA 3QJGA 4DV6B 3A7DA 3QKUA 1ZH6A 1K6JA 2I76A 3F2VA 1AGNA 3C3AA 1WOYA 3LCJA 3N8GA 4M1QA 1V8DA 1VA4A 3G23A 4D3YA 1RAHA 1Y98A 2ZUWA 2Z3WA 3OFKA 4N82A 2ZT6A 4J2HA 3Q8GA 3PI7A 5IH7A 3OA0A 4RA9A 1L8OA 4G5FA 2C58A 4NYIQ 2EKKA 3G0CA 4ICIA 4UDXX 1BE1A 1JMVA 2V8BA 2OCKA 2JBHA 1GCUA 5CBKA 3BCRA 421PA 2CHGA 3THWA 5SY6A 1MNQA 1E9RA 4BKUA 3D2BA 3ZJTA 4F2LA 4ZT5A 3EG9B 1WR1B 3QNMA 4CMHA 4LN1A 3PNSA 3KL2A 3UB2A 3PKJA 3L0DA 4NSRA 4Q4HB 1TUEA 5IAGA 2VI5A 1F8XA 2HDOA 2GYVA 3VH1A 4JI8B 5KQDA 3CKYA 4RACA 2QYOA 4TMTA 1W0KA 1RYFA 5CNJA 3RCBA 3LK6A 3RDPA 3ZBUA 1BQ4A 4KXYA 3M6XA 3R7WB 5H0IA 2BEVA 3LIIA 4EX7A 5KO2A 1O89A 3OZTA 1GNTA 5E7IA 1JHQA 1WZUA 1V2HE 3EUAA 3RRJA 1Z18A 4MDHA 3D02A 1B2LA 1MB3A 4G67A 4MEBA 3QHPA 3WGHA 2HF8A 4PNEA 4HAUA 3V4VB 1G6OA 3PXGA 1SOWA 3FCOA 1ECBA 2AFHA 3U4AA 1JZQA 4H3KB 3GGDA 4DANA 3HLKA 5AKHA 3AEQA 1JFRA 4JN6B 1OVMA 2AF4C 1JPJA 1Z0AA 2OO3A 2B8EA 3NANA 5SZJA 2G6BA 1TRKA 3X1JA 1UQUA 1IL0A 3EMVA 4AY4A 3NAZA 4OQMA 1LFAA 5EUQB 4ZVVA 3ELDA 4II3A 1PX2A 4JXJA 1DUSA 1U7OA 3AX6A 5DWQA 4P3KA 1NJSA 1UOQA 1OIZA 1Z36A 4KVFA 4RD4A 1UWCA 1V5FA 2V4ZA 4LUCA 4PGMA 3QKSA 4LWQA 5L7WA 1I7DA 5DMXA 3UIEA 3UPDA 3H9BA 2FR8C 2OQIA 4CM9A 1JDBB 5E1DA 3A6FA 1EPUA 2KM1A 2Q6OA 3P9PA 1YRWA 1C0EA 5CVDA 1RJDA 2AWOA 3TFWA 3T4UA 1D4ZA 2DPLA 2FUCA 2DKLA 3HCDA 3VA7A 2DF8A 4EFLA 1DADA 3D8HA 4JB8A 4BFLA 3KDAA 5FD8A 3OZWA 3AHJA 4D9CA 1OXSC 1T3HA 3UAVA 3GFBA 1Q1EA 2ZRPA 4FEAA 4URFA 1D4FA 1JKXA 5IMBA 3CF2A 2QTBA 4RJIA 1P61B 3LZCA 4TS9A 4LXXA 3VR4H 3FFBA 1QSGA 2PVCA 2W42A 4O4JA 2JASA 2M60A 4LRTB 1CIJA 3R5FA 1ZXXA 3OCWA 3DXFA 2PSSA 1YQXA 4HYTA 5AK5A 4LAFA 4RMHA 1SC1A 2PX6A 5JSHA 1U4SA 1TIPA 1NDUA 4E2XA 5C31A 3SR3A 2C78A 4YJ3A 3GHYA 4DJ5X 3T41A 5BSHA 4YJHB 1N2HA 2CP8A 1VL5A 3IPYA 3CQ9A 1E18A 4H7PA 1EQUA 3AEXA 3MJCA 1L7MA 5EZQA 3C8UA 3WLAA 4EMBA 2I4OA 1T36B 1LFDB 2X8JA 5P8WA 1N1EA 2R6HA 3L7NA 4UUNA 2X0EA 1FFXB 4IFTA 1PP4A 1TVEA 4OGWA 2QORA 1DRUA 3NC0C 1VA5A 5TVGA 2PSHA 2XVZA 2GXUA 5K8IA 4NCBA 3KKKA 1G4AE 1QZUA 1MUUA 3NWEA 5TC4A 3LFUA 3T06B 2G76A 5G3ZA 3V5NA 4Q19A 1MJ5A 3F74A 2CXNA 4UMFA 2PVSA 1XZDA 4QG3A 1G7RA 3F6SA 3EFHA 1M0WA 3EGOA 4JYMA 1YWGO 4QBKA 2W8BB 3GO4A 4Z2YA 2OBNA 4BEJA 1GV1A 2D1RA 2JDIA 4YYZA 4MR8B 2Q1SA 1YDGA 1YHNA 1MABB 4ZARA 3VZCA 2Q28A 4X5OA 3U61B 1JQDA 4GLJA 1JHZA 1V48A 4CQJA 2BKXA 1VJCA 4LHYA 2RKOA 4G3OA 3H3XA 2BM1A 3X1XA 2B7LA 4EB0A 4UCQA 4C3VA 2Q21A 1NMQA 2BLNA 1V25A 1T5BA 4S1OA 1UDCA 1P33A 3LD9A 5K4HA 2J7NA 4F60A 1W85B 1GA1A 1NQ5A 4RIHA 3ZX5A 2Z5VA 3PRJA 5I01A 2XMDA 3K2BA 4ACBA 2MT9A 3QOXA 1R5NA 3BTSA 3P0EA 5ARDA 4ND6A 3EF3A 3EZ2A 4DMLA 2BEUB 2O01F 4HS4A 4Z49A 2X40A 3CKKA 2HA6A 1XZJA 4MDYA 2DWMA 4GMXA 4Z51A 1Y6JA 4C6TB 1ZGCA 3R0QA 2HA0A 4OU7A 1SU7A 2BZGA 2C96A 2W70A 4RJJA 1EYZA 3VDUA 2GGSA 2R5FA 5FLYA 3OWXA 1YE5A 2C8KA 4M9QA 5EGNA 3RYFB 4NZOA 3AUFA 2ZE8A 2FA9A 2D00A 4LMRA 4LJAA 1H5NA 2FMTA 1D0LA 4AWBA 5FTJA 4EY5A 2NP7A 3HRHA 3D9QX 3FYUA 1ZMWA 4KUEA 4H3HB 2IT1A 5CA0A 4LF5B 2IW3A 2FHSA 3JCZA 3VBCA 3A8TA 2QXTA 3N0XA 4UPEA 1G20B 5KSZA 3KSBC 3DEYX 1GPKA 4EKIA 3TEFA 1DAKA 4LY3A 1ESNA 5JCJD 1B6RA 4WA8A 2PYIA 2YIMA 3NEAA 1JSZA 1RYHA 1IXRC 4JJEA 1NRWA 3O92A 2GPWA 3EUEA 2DU8A 5L9AA 4LJRA 1EFAA 3I5AA 4H18A 3KYCA 2JJQA 4I9UA 1QFMA 4WDQA 4DKJA 1MPTA 2QMOA 4EI2A 3NZEA 3DVSX 3RHFA 3MMZA 5IYZA 1ZL0A 5ALXA 1IHYA 4BC0A 4CQLA 2E7ZA 1PFGA 1IATA 3SX4A 1UK9A 4B6SA 1FP7A 1LPOA 1QGED 1SU8A 3FGOA 4QYXA 1I24A 5DOZA 2X7XA 4M1WA 2JCSA 2AK3A 1MO5A 3UF0A 3H5IA 4NU6A 3VU8A 2Z7JA 3ZLVA 2LCQA 5C5EA 2XYRA 1SHKA 3CT4A 3U56A 4US1R 2RH8A 4GX0A 3M9XA 1M1YE 3LP5A 4JLPA 4XJVA 3K9HA 4D98A 1GAEO 3HCCA 4BY9E 4XYGA 4ZI7F 2WWTA 4YAKA 1IBKB 2OCIA 4K9LA 2VC2B 1R6TA 2BW0A 2IF0A 3VI3B 4CM4B 3AKYA 4WERA 2PANA 1B8PA 4D4JA 5EMNA 3NHKA 5LQSA 2UXBM 4JMPA 1RQPA 1H2FA 3W5CA 1KDPA 1KGSA 3ROEA 2PH1A 3ZHUA 4KQGA 2BFCB 2FEAA 2BONA 1B3BA 1V8PA 2GAAA 5LA6B 3VVLA 1YBHA 5FI3A 4Q93A 3PBKA 1JDUA 1ONPA 3J7AS 4Q3DA 4IVQA 3KQYA 4PG4A 1AVTA 4GBGA 1THZA 2OCLA 1SU6A 3ZNPA 2DUJA 1UM9A 2Q3CA 3H5LA 4ECEA 3N3AC 4L4XA 2ZUVA 4KVGA 4MZDA 2YN0A 1G5FA 3ASYA 2FWMX 1SAYA 1QJ4A 2W83A 4ZJUA 5C80A 1CVIA 3IAEA 4OFWA 2Z3XA 4KDRA 1WJGA 3AW9A 2JLRA 1GPWB 3A9CA 2W48A 1L5HA 1YFZA 2I22A 5EE0A 4FC7A 2O06A 2QG6A 2E5LM 2GBCA 1JFVA 1NWHA 2W2PA 2DENA 1QUFA 2C54A 1PDOA 4K26A 2F90A 2GD1O 3T3MB 5ERYA 2NYRA 5KPJA 4ZOBA 5LMZA 2WUDA 4QATA 2MSWA 4S12A 3F5QA 3ZCVA 3C41J 2QTCA 4QM7A 3CUKA 2CNLA 5DBHX 3EXEA 5KKNB 4B3JA 3A9RA 4EO4A 2DI0A 4PZPA 2ZU0C 1AKYA 5J2TB 1XZPA 3KWMA 3B7ZA 3Q72A 2A9JA 2XKKA 1VJGA 1FNNA 4M1MA 5H7XA 3QWHA 4N6OA 3GFQA 1P6XA 1TQHA 2FPWA 2VL7A 3ZEAA 1HDRA 2J5YA 3OX1A 2FWIA 1DDOA 1Z7BA 1IHXA 1BD3A 3BD9A 5BNTA 5KNDH 1U2GC 1F4VA 3P9QA 1PM5A 2M6SA 3IUYA 3W34A 7ABPA 4TTAA 1OLOA 1H2YA 3AFGA 2K9DA 1SHTX 3H1EA 4C2BA 5ITZB 2GD2A 2P67A 3DTYA 1GNLA 2VTVA 5T3UA 2ISCA 1CQWA 1ULBA 4F86A 3EVAA 1TCAA 1THTA 1YOVB 5F7JA 4AU1A 4DWWA 5AI0A 3H4TA 2XE7A 1PJLA 1X7YA 3T7JA 4A1OA 4C06A 5IBRA 1VLLA 1XZIA 2IUYA 4JUAA 1ADGA 1EM8B 3L4KA 4IGAA 2IS6A 4OXIA 1SGWA 3ZCQA 4E2YA 1JE0A 4A8HA 4Z0HO 1E7MA 4YRPA 4B09A 3LDFA 4R31A 4CT5A 1ABFA 5KX5F 1WS6A 5FWYA 1IFXA 5ALRA 5E26A 4Q1BA 1DKQA 3KHTA 5INTA 5DB4A 4K6FA 3BSSA 3U9TA 4GU5A 2ZWMA 4BVEA 5DULA 4CMGA 4F4DA 3EGXB 4OVZB 5AJUA 4L16A 1E9AA 3QVSA 4ZYXA 3GPDG 5IU6A 4R9UC 2R4JA 3MTDA 4MWEA 5TPZD 4CETA 2WJAA 3C8ZA 4XJXA 2J6CA 2R8RA 1HE3A 1HE2A 1JPUA 2B7CA 3H9UA 2PPLA 2WTBA 1WU8A 1NJ8A 3BTUA 3AR5A 3CMCO 4MIYA 4OHUA 3WL8A 5KJ1A 2EKPA 1ULAA 3CEJA 1MMFB 3IQWA 4J0DA 1MNAA 3JYLA 2HU7A 3TSOA 5E1MA 1JSXA 2NW6A 5KQRA 4BTVA 2H0AA 3RC1A 4YJ2B 4KGZA 1OTYA 2Z0MA 1J00A 4U9IS 1ZS9A 5A62A 3U6BA 4HYQA 1ZI9A 1ZA2A 3GIDA 1ZHHA 3UOAB 2EJVA 1JFLA 1E7SA 1OFVA 1E1QD 1X0XA 3AIOA 3K15A 4WZ6A 4JI3M 1SVIA 1SXQA 4GPAA 3O4GA 5A2QA 2YFHA 3ZBPA 4NH0A 1AZSC 1M1ZA 3V34A 5G0UA 1XQWA 3VHXA 4F4IA 1ZM9A 5G0TA 1QRSA 1UAYA 2R0QC 5HIIA 3RFFA 1J2RA 1I4OA 3P9CA 3G1WA 1G5IA 1XOIA 2DT5A 3GG2A 4Y9UA 1PS9A 3IECA 3CUTA 3HB0A 2HWYA 3NNDA 2X9GA 2AF3C 2B98A 1U0GA 2JI4A 5CD1A 1KRWA 1O6GA 5JNSA 1E8NA 1V16A 2JH8A 3GLFE 1C1DA 3U60B 3HVJA 3ROQA 3H8SA 2WZDA 4DABA 5AW7A 1FFDA 2X5KO 3TNJA 4D4KA 1R2QA 1QGAA 1JS1X 4EPVA 3B7NA 1Y6QA 3VTAA 5KC8A 2FPIB 1Z83A 4X71A 4OLBA 3ZVLA 2PU7A 5ICEA 3F2IA 4BBPA 1SVOA 2ATCA 2O8DA 1BCSA 3H5NA 2I7XA 2WIDA 2XVAA 4IXNA 5EQTA 1A76A 4XFJA 5T41A 4WY5A 4U8HA 4EPYA 5F7OA 3L7MA 3TOXA 1LX6A 4OHCA 2Y1GA 2L2DA 2IW1A 5KVCA 4DZZA 4P4SB 1QJCA 4RV9A 1CE8A 2P9CA 4C4SA 3V46A 2ACEA 3SMVA 4PS1A 1QQTA 2AN3A 4CF5A 1YD7A 1GNPA 3T9FA 4C5BA 2QN1A 4INZA 3H1PA 4DY4A 3T5BA 4WASA 3P0FA 3LUHA 4Z99A 1FYDA 3LWNA 2P11A 2IHZA 1INLA 4K2HA 1DKMA 2XFSA 1Z16A 3NV7A 1DFHA 3BA1A 2HWUA 3EQ8A 3DYIA 3ZW8A 1ZP6A 4O1IA 4GW3A 4OIMA 4KTVE 4BRZA 5A3QA 4JXKA 4EL5A 1EE1A 4C5CA 4RVHA 4KH0A 2XR1A 5JCXA 4I4LA 3IP1A 2ZOSA 4YP0A 4CEIA 2ECPA 3ZJYA 1H66A 1E20A 3TH5A 3TK1A 5DVZA 1JMYA 3AVXA 2RJOA 3ND9A 1FYXA 2VPIA 3CEHA 4BNJA 4LZLA 2AWNA 1JBKA 2PZLA 1HQKA 5EAIA 3SX0A 4M1TA 4ZMSA 3ASUA 3NDPA 4QRHA 1Q74A 3B3QA 4MQ6A 4N5MA 3F78A 2WSLA 1HSZA 3D54D 3I72A 3NV9A 2OO5C 3SBXA 3UUFA 3ZYZA 5JMPA 2VYNA 1S3GA 2B92A 2GYWA 3GFVA 4XR4A 4EW1A 1NT2A 4ZO7A 4CU2A 5KJ6A 3T6KA 2FE8A 1SZPA 2C4NA 1V95A 1BVRA 3IJEB 3OZSA 5TMBA 2X1VA 4RENA 5A7HA 3R7AA 4A03A 3DNMA 5I7EA 3BHNA 1RRKA 3LT2A 3ONDA 4B1FA 4BVKA 5KQ8A 2GMWA 3ZVKA 2WU1A 4OQXA 3W1WA 8AT1A 1OLXA 3IIMA 2I2XB 4AYTA 4G8JA 1HDXA 3GNTA 3E7PA 3FTDA 3L7KA 4UUAA 2C5EA 1KIMA 2ZVDA 2QZSA 4MJXA 1QOZA 2W22A 5FH9A 4CM5A 1B1AA 3VR6A 4QUJA 4DV0M 4NCKA 4XFKA 4R71A 1R4NA 3FZGA 2IYUA 1YJBA 3FBTA 4OHXA 1TMOA 4G0NA 3IO5A 2Y1XA 1MIOA 1MVNA 1ISHA 1SQSA 3PFCA 2YVUA 1M73E 3U3MA 4MP6A 1OI7A 3VYSB 4PYRA 4EH1A 4MQEB 4TN1A 3E58A 1E4OA 2Q5HA 1G64A 4MRAA 1TCUA 2PUTA 4MW1A 4BGEA 3EZFA 1KO7A 4PCVA 4BX9A 2ZBPA 4INAA 3EXIB 1MV5A 4YUXA 2D1TA 3CV3A 4PFJA 1R64A 1JQJC 2P6RA 2UYCA 2C00A 1SUWA 5ALSA 4HLUA 3C8DA 3WFIA 4EG3A 1BG6A 4ZCIA 2IBSA 1Z5BA 3L4JA 1MVOA 1QLWA 4Y1GA 3JD0A 4F4HA 4P98A 2HLHA 3TRDA 1V3TA 3AJ8A 3T7SA 5DI9A 1MU0A 2ZRMA 3CF6R 2F3TA 2W2OA 1USIA 4I3HA 2YDXA 3HMKA 3I0ZA 5AJWA 4B6PA 1T3LA 1WSWA 5IABA 4MB6A 4MJ3A 1LTQA 1TH2A 1UXOA 2AUMA 3G0GA 3E3MA 1SKAA 4LQDA 2DQSA 1SWVA 5HGXA 3N58A 2ZIFA 2IYXA 3T15A 4OMUA 5L51A 4YR7A 2CDBA 4TS1A 1TO2E 3F8WA 3AR2A 3MMSA 4YAIA 3K9LA 1Z7EA 3C14C 4HH1A 4FW9A 1B26A 4I50A 2JFGA 5F1KA 1C9YA 2QW0X 4FI3C 5JHHB 3WLFA 3WRYC 1PSZA 3JWPA 1DSSG 3IT3A 4L6IA 5A4AA 2YZGA 3C4JA 1BE6A 1KY5A 1K1EA 1XXHB 1LS1A 4FPXA 1N3YA 5K8VA 2DBVO 1O0SA 2I6XA 2QD5A 3GV0A 3ENZA 3DEFA 4MIKA 3BCSA 1GVNA 1ZCBA 4M8LA 2BFBB 2VXOA 2BKUA 3PCRB 4FDAA 2QZPA 1JAIA 3KBOA 5TPWB 1NYTA 4CR8A 2B4TO 4MNTA 1MT3A 4XIJA 2PMBA 3KB8A 2OV2A 4M6WB 5COQA 4W9NA 2Z1NA 4BGVA 1OI2A 1ILWA 4HGNA 4D8WA 1FLAA 2ZRHA 1V1MA 3BX1A 3FNBA 2VEDA 3ZQUA 3GAMA 1M2EA 1PE0A 4LG1A 1DGGA 1XNGA 3D6HA 3JPYA 4LF7M 2WU3A 4L8VA 3P4XA 1IVNA 3KS8A 3OOWA 4U5QA 5T4HA 4XX0A 1KDZA 4ZHQA 2GPAA 2JIOA 1ATZA 2WNHA 4ZODA 1EINA 1QIKA 3ELBA 3MTIA 1ZVMA 1JQAA 5GMOA 1Q0PA 4ZQFA 3FWNA 2XXJA 1UPAA 4BO1A 1PT9A 2GRUA 4BLPA 2C9YA 5ALOA 5JY1A 2JVJA 6GPBA 1G18A 5B37A 5BSMA 2LTUA 1RMQA 2F67A 1H3EA 2ZJAA 2NPFA 4FR5A 4G0XA 4G4NA 2K4MA 2FZCA 1A88A 2BHLA 3GYBA 4OM8A 3F5DA 3OZ7A 4IS3A 1R10A 3WFJA 4EYEA 1MAUA 4IBIA 5LJLA 4GAEA 3R3UA 1R2ZA 2WK1A 5FDFA 3I2JA 5KVQA 2XCUA 1CRZA 4V38A 4JT8A 1J0BA 3IILA 4GIBA 1BOFA 2VQFM 4N65A 3ZJUA 5EIHA 4WJKB 4KPUB 1X86B 2R00A 2EARA 3DM5A 4NQRA 4N41A 3KK0A 4TSFA 1Z5AA 4FWHA 4G0PA 4HPWA 4MH0R 4B2LA 1G1MA 1T5DX 4KTTE 4Z9FA 2CXOA 3ROZA 2Y92A 2QPTA 2I3AA 3X1DA 1NF2A 3PEVA 3A70A 4RXUA 5B1DA 1XD8A 2XZOA 1RYYA 3RG8A 3TSAA 2ZI7A 3TR6A 3KQKA 1KORA 1TCBA 2D0PB 1W6UA 821PA 4FR0A 4L4SA 2O3UA 4BNDA 3DEHA 1NC1A 4ROTA 2AXNA 1X87A 5IWAM 5FBLB 2DWPA 3N39C 4KNVA 3PWSA 1XCJA 4IFIA 3EBLA 4ZP1A 1WMFA 1T10A 3HGTA 1GU1A 3I62A 2JY7A 5BURA 3Q6MA 1GRRA 2QUHA 1M6HA 3TE6A 3TJMA 1KTIA 4JI1M 2BV3A 1WXIA 4B47A 1ZC4A 4ZYLA 2Q1TA 5B3AA 4ITVA 4JR2A 3LT1A 5BWOA 2BH2A 3X44A 2WKQA 2KPOA 4UTPA 2A5FA 5EYPB 3PXCX 2DX7A 3BXFA 3KOMA 3GRUA 2P1RA 3R6WA 1A9RA 3ADOA 1ZA1A 2Z8YA 3R9KA 4DCJA 4BL5A 1IK6A 2I2WA 4MYDA 1XYYA 2XT9A 1Q21A 2PMCA 2O0LA 3ADBA 3C3WA 3LRXA 2WJVA 3AR7A 2CFCA 4URUR 4FSDA 1PJQA 4DR5M 2ZJBA 3OLQA 4ZIRB 2YXPX 2A5YB 2J4FA 1QWSA 4Q3EA 2IH2A 4CMEC 4V1CA 2QM8A 1GPJA 1A1SA 1CIVA 4CKEB 2C4TA 5FUWA 1ZFNA 1K82A 4KN9S 5KDOA 1NRIA 2KS6A 5LQMA 4J07A 2NO7A 2C95A 2I2FA 4E5SA 3LS2A 4UZFA 4X8LA 1JQBA 2I5PO 2NZXA 1YZUA 2YRWA 2VS1A 5JFGA 4KO8A 5K6TA 2WFMA 3ACBA 1KK3A 1M6NA 3FPFA 1Q0LA 5CDTA 4AZVA 3LZ6A 4DWJA 3G2NA 3WGVA 1J07A 3D0QA 4RA6B 3RM3A 3IESA 2Y2UA 5K2MA 1O58A 1Y8QB 1CVRA 1RJGA 1XMIA 3K0KA 4W8GA 4RF1A 2CDCA 3JQGB 3E8MA 2X5JO 3SYRA 1GPLA 1R0RE 2JBAB 3FFAA 2EWMA 3ZOKA 1C30B 1SVUA 3IKMB 3FUTA 4YP5A 3TLYA 3WZLA 3MJEA 2IU0A 3MLAA 2RFLA 1I2DA 3AO0B 1NATA 1D9ZA 3MWKA 1JG2A 4P7BA 4V0NA 4A8JA 3AM1A 1WBJB 3U44B 4RHFA 3OEYA 1Z74A 2GCNA 1XCGB 3VHLB 2IS1A 1J70A 3FBGA 1SG6A 4J0EA 2XADA 3KHUA 3R09A 3KE9A 4L5YA 2EO2A 1DRKA 2NAFA 1AK1A 3EXG2 1XMQB 2ATXA 3WLRA 4Y1RA 5FOQA 4GOND 4C0HA 1KI3A 4QAQA 1JEQB 3FCSB 1TJ4A 5CB0A 2DHCA 3DVLA 1Z6GA 4MPJA 1T9CA 5CMLA 1F9EA 2IPLA 1W35A 3ZG6A 1XHFA 2Z5GA 4DT1A 4GPBA 3QLVA 4KREA 2I2CA 1RSZA 5IJXA 1IY9A 3JAWB 2R6DA 3LPMA 3LQRA 1QX4A 2AFIA 2WQZA 1JJVA 5KYKA 1YB7A 5LMUB 2HJWA 3BERA 1U0NA 3JRXA 2PRJA 1YRHA 2J0SA 4HXEB 1NX9A 4DCCA 4NV3A 3IEMA 3E9NA 2OMKA 1YASA 4BX8A 2RHRA 4ZQEA 4JU8A 3W2EA 5JD5A 1DAIA 2VJDA 4XAQA 4F3TA 1U3GA 1M66A 2Z04A 5CB4A 4LXYA 2PFSA 1SKYE 4A5OA 1RQXA 2A9OA 4PTLA 2WUFA 2UUAB 1VG8A 3UHAA 1QH1A 1O6FA 2G7ZA 2WTNA 5E6SA 5H3LA 3ORQA 1Y4AE 4UM7A 2YHSA 1JB9A 3I73A 4TUYA 2XWQA 2LNDA 4DQXA 1EQAA 3LC0A 4HH4A 1B8NA 4JXXA 1E64A 4G0VA 3IDFA 3HKCA 3CT6A 4Y2UA 3OJFA 4GGPA 1SKUA 2MROB 1EFVB 4WAUA 3DPSA 1WQ3A 2DBQA 3C5WP 1PT7A 4DEXA 4C21A 4K9QA 3ET4A 5DX0A 3DE3X 5AI8A 3QEAZ 1JVBA 5LM3A 4GX2A 4ZICA 2Q5CA 2X1MA 1WCXA 5ALZA 4UQLA 4RH0A 4D96A 2JJ1A 3ZJ4A 1B43A 2AC4A 1UJ5A 1AH2A 5MF6A 4I3FA 1NQTA 2DHEA 2L7HA 2YS7A 4MAAA 2VOEA 2OFPA 1LU9A 5ITVA 1A04A 1Z0IA 1C1HA 3NG1A 1KO5A 3L4EA 3NP9A 3ZQJA 2C4WA 1UKBA 4AZSA 2XXBA 4UNQA 4CNQA 2OCBA 5L3SB 1SOVA 2P6NA 1ZNYA 3AHCA 1UAGA 4MCJA 1TUBA 1TIKA 1ZMVA 2HXGA 1THGA 4YMVA 3L02A 2LNHC 1HT3A 3ISJA 4Q9HA 1YU9A 1RHMA 2GT1A 1YVPA 3K9OA 2CLLB 3GZNB 2HAEA 4JR1A 1DMRA 5ENZA 3I9JA 2XDQA 1IVSA 1Y33E 2O3QA 2R8PA 1NUPA 2ECKA 2YC4C 4F3NA 1GJSA 1N2CB 4LQ4A 3DZJA 4QKQA 3BJZA 4ILKA 2DSTA 4Q66C 2C7OA 2PUBA 1KZYC 1AV6A 4EB6A 4B5KA 2OZKA 3CIOA 3UWMA 1SMKA 3PDIA 4QQRA 4I4TF 4RL6A 1ZNXA 3V4OA 3I2FA 3BZWA 4FYYA 1DT3A 3TSZA 5F64A 2X4LA 1RI2A 1WJ7A 3VNAA 3PWZA 2SCUB 3G9UA 4W5WA 1VKJA 1EZ4A 1JBQA 3N0WA 3IQDB 4A0RA 5GWXA 2K0BX 4L1KA 1AXEA 3WRXA 2I1LA 4C4AA 5M5BA 4KLNA 3BE4A 4DZRA 2JGFA 1MAWA 1UOEA 1BSVA 4F2HA 3LSYA 3AVYA 2WICA 2GBFA 4GYJA 1ZZGA 3MINB 3SHFA 2NXEA 4NHEA 2JHFA 2RIRA 3HK2A 1G4UR 3EJWA 4WZBA 3AR6A 4UXIA 3UPUA 5CA1B 2ZAOA 1LWNA 5HK8A 1RU3A 1QLJA 1ZXLA 1EDBA 1ISFA 3PLNA 3IKJA 1CP2A 3WGYA 2F9LA 5EHZA 3G02A 4B45A 1L4BA 1VKOA 3C3XA 1FIUA 2IOQA 3HUTA 2HSDA 4CF7A 4K8OA 2C61A 4FCWA 1A50B 4KZKA 3NWPA 2XQVA 3JZIA 3WIUA 2O25A 1TZMA 2Z4TA 1EXDA 3KE8A 2PGAA 5EWJA 1VJ5A 1UFZA 1WXQA 5ALMA 2BTQB 1JG1A 3K1AB 3ZGXA 3OKCA 4K6CA 1ZI8A 4ACAA 1RBZA 5EIWA 1O5OA 5HF6A 2P75A 3NWJA 3A45A 2AFIE 1PZFA 2WE7A 3L7YA 3SKXA 1WB9A 3ZC3A 1E8MA 5E6UA 3JQBA 1XTZA 1QLHA 1VG5A 4RFSB 3O5AA 1UUFA 2HMVA 1Q2UA 3GCGA 4D02A 4RJ2A 2ZREA 1PGYA 1BTOA 1LDMA 1NVBA 3ZY6A 2GAOA 2OVBA 3G2HA 5BR8B 2JJ2A 1Q12A 1U0HC 5IC6A 3QX8A 2IOHA 9LDBA 2AKYA 1W5EA 4NONA 4QPJC 1TVCA 4KRYA 3IAS1 2WFAA 1FBNA 2L2QA 2OC4A 5JH7A 3RSGA 1XCOA 2JCVA 2EUCA 5LQUA 2RGOA 2Q3FA 3L43A 3FIUA 3LMKA 3ADKA 4DHWA 3I05A 2WMDA 4JB2A 2UUPA 2OT3B 3QZUA 4YAFA 5JD3A 4MA0A 4C0WA 1A9OA 3QYJA 2JGKA 3R23A 1NJGA 4WOJA 3GPLA 4AZ0B 2ARKA 1YDFA 1AQIA 1DC5A 2AMVA 3PSAA 3CLRC 2CB9A 5DO9A 5HBRA 3QVUA 3T1HM 4RVOA 3TVTA 2CWBA 4MGKE 3SAVA 2G40A 4C0JA 4BVHA 2ZYHA 2PL5A 2AG5A 4ON9A 2FOIA 4YCDA 4LV8B 3O8CA 4MGZE 3CE6A 2X14A 4BMXA 2HC9A 5LYJA 1EIZA 2G8NA 4AJHA 3V8PA 2FN4A 4N6NA 1EVYA 1CJTC 2H3EA 2GSWA 4LS3A 3PQ2A 2OM6A 3IMCA 3HACA 1W7AA 4EECA 3HDHA 2FJPA 3E9CA 5DHTA 3IJRA 1M2NA 3WMGA 4MUIA 4HNQA 4BFZA 2OSBA 5LIRA 4IZ6A 1TK9A 5T67A 4EDFA 4LBZA 1H6BA 3A3KA 4AP5A 4GEGA 2VBCA 3IHPA 3P45A 2ZZKA 3C1UA 3GVIA 4MAMA 3H11B 5AJTA 4NK5A 5IFKA 4UOZA 5JLAA 1Y89A 3DBRB 2YIVX 1BW9A 3QUSA 3OHPA 2G4VA 4HK4A 3TLGA 5L7TA 4UATA 3KU4A 2H2WA 3QX9A 4Z4QA 3B9RA 1UBKS 2R7KA 2PD3A 2A33A 2BUBA 3JTEA 3E7FA 3CLSC 4IDDA 1N6IA 4UBJA 5YASA 3QX7A 1XRQA 1FP4A 4HAWA 1LDYA 3PPXA 4ISCA 4TMFA 3JD1A 1NBMD 3KS9A 1Z2AA 1BGWA 1LLFA 2BGGA 2Y99A 3BT7A 3RANA 2ZAIA 3LRTA 4MWTA 4RDXA 3LUBA 1M7BA 1TU4A 4BO0A 1TVKB 5A6VA 3THYA 1THMA 3BDAA 4UHKA 1O6CA 2RB4A 4A26A 1KFCB 2H65A 3FPAA 5JDCC 3P9IA 2B25A 3KXPA 5LSAA 2DWNA 5HOQA 5KNBH 2YY5A 4B4UA 2G5TA 3L92A 1R0BA 1ZG3A 1J49A 2FUKA 1AQ6A 1JZSA 2VP4A 3A1VA 1RBQA 3ME5A 1Y4UA 3DGFC 2DZDA 2ZK7A 3CY6A 4Q02A 4O2BA 3DDOA 3R7FA 3BMQB 2IFTA 1OXBB 5ICMA 1GEGA 4M8SA 2VDMB 4R8RA 4WSOA 1RHUA 3VU1A 1P91A 4J29A 2Y20A 2FPXA 2Q2EB 3LBIA 3Q88A 5AVZA 1FS6A 1KQPA 3O8BA 4RGVA 4DLWA 5CXUA 3ETDA 3KTFA 4E5PA 1VGQA 1FX0A 2XB2A 3MK6A 5BSUA 4WJZA 3TBKA 1A4UA 3QLUA 1QC5A 3FKSA 5KYXB 1XRSB 3QOYA 3GJ8A 1Q3CA 3O4FA 1CUHA 1J5PA 1Z06A 4IHAA 3T9DA 4C7KA 3SBDA 5EZYB 2XGOA 5FULA 5HKKA 1Y3DE 4AW9A 3J81A 5CFMA 3SS9X 2M32A 2ZPAA 3KD3A 4XWGA 1GXSA 3HSYA 3PUWA 3ENVA 2X7JA 2LD4A 5C8YB 1YJXA 5JJLA 1ZGJA 5AM5A 1W93A 3ZHQA 4WRRA 4HG2A 4UVIA 4LV6A 3FLAA 2ZUEA 1QH8A 1YL5A 3W9UA 1DXHA 4HDOB 1U3DA 4ES6A 2Q3BA 1WCYA 1PQYA 3VDPA 4ZVPA 5D86A 1UPCA 3Q8LA 3WIOA 3RSZA 2HU5A 5B7PA 4HYYA 2OCXA 1R16A 1DL5A 1ZIYA 2AQHA 3OE5A 3BFXA 4F5WA 1WUYA 3VYUB 3QYFA 2W71A 4PCLA 2NU8B 5CT9A 3AJAA 5KU7A 3U6QA 3OT5A 2WDPA 4E6PA 1G66A 4QHSA 4UXHA 4LZAA 1R9NA 4MTLA 1I94M 3IQIX 4FVTA 5AI4A 4RAOA 1BX0A 3TZQA 4ZOQI 2NVUA 4WZAB 4X8OA 2ZITA 4FFMA 3JTMA 2DBZA 3EGDB 2GRAA 4B7HA 4M87A 5FYQA 2G6TA 5K8TA 3EEFA 1JG4A 4G4JA 2KW0A 2ZQYA 4MVJA 1E2GA 4X61A 3ZC7B 4D9GA 1QPBA 4NYJQ 5L3QB 2QVLA 4OVKA 1MQ8B 4BRWA 4FFBA 5CEJA 3U40A 3M83A 2N35A 2CL6X 1RBYA 3AH8A 3ACDA 1P81A 2P8SA 1WKBA 4K9OA 3PNVA 1U6IA 4U4AA 3CEAA 5H3CA 2WKSA 3H97A 2AFHE 1M8KA 4X45A 2WEKA 3AU9A 5LP6A 4HZIA 2WSEF 1KEEB 2R18A 1CEXA 5AW8A 1PR9A 1XEXA 4E5VA 3DWFA 4ND1A 4B44A 1E3IA 2W93A 2EX4A 1R6XA 2G77B 4R3UC 3TJRA 2F1KA 5DOVA 4BNVA 3O0TA 3W2IA 4AN4A 1NJ1A 1DBIA 3TOCA 4H7DA 1G59A 1H1DA 3ZDFA 3S2EA 3UNXA 2D5BA 5EPUA 4EHJA 2BMJA 1OAIA 1SZDA 5JVDB 1MLDA 2WP8J 3FHJA 2ZE5A 1YL6A 3GJXC 1ZEMA 3CXRA 3QMPA 4C89A 5AR1A 4NBSA 3ZHCA 4DR7M 1YE3A 1PNRA 4PZYA 4U1RA 4C6SA 1YE8A 3DEJA 1F9AA 3FSRA 4UBMA 2H17A 4Q34A 1G9SA 2OECA 4HMQA 2QR2A 1NX6A 3OE7D 1Y6RA 1YA8A 5B6IA 4L0CA 1EGMB 2XUPA 2YJ6A 4C2AA 1WCIA 5JCOC 1WDKA 2P69A 4OBXA 2GN1A 4PAWA 3PKIA 4M99A 1UBOS 3C3CA 2OR3A 4J2OA 4OH1A 2R8OA 1P60A 2UUCM 3V7WA 2QMQA 4P0TA 3WP1B 3LWBA 2AG8A 4HXYA 4N18A 2Y1EA 3PNKA 3HWWA 5I7RA 3DV2A 3DMRA 2EFYA 2EEPA 2IHNA 2G1PA 2YHAA 3U26A 3RYCA 4Y6PA 4P17A 1B4DA 1JHUA 1L9XA 3A1FA 1VLVA 4JBLA 4DCGA 2V7QD 2ZZMA 4Q7MB 4ABYA 1ORDA 2WV9A 3KPVA 4UVEA 4A0SA 3NNNA 4QJ3A 4QTZA 1E6CA 3HJNA 2XZTA 2BP7A 3LCRA 1PJTA 2I67A 3OHMA 1GPNA 4U2GA 3D4OA 3G2LA 2QVBA 4OJQA 4QUGA 2VNIA 4ZQHA 3MK31 3EUFA 3LX4A 1EDZA 3KYIB 3LDAA 1FB5A 1Z82A 3EVFA 2O7RA 3TUZC 2ZDGA 3QY9A 3W3AH 4NU8X 4F0JA 1T4DA 2Q8NA 4IMJB 3WAJA 4TROA 2P27A 3FFWA 1WRBA 4X66B 3KIPA 2W2KA 4GRDA 4R5MA 5D00A 1YT5A 2H8KA 1I5EA 3GC6A 5DTQA 4IPTA 2L4EA 3H8WA 5L4LA 1FFGA 3IDAA 2AVNA 3M4JA 1O97D 1GYPA 5K0CA 5IAEA 2FQQA 5K1ZA 4MWZA 3K05A 2GPSA 3SHGB 3NALA 4NMMA 4BMOB 1ORHA 3UK0A 1TM2A 4HAXA 3FTQA 4Z4EA 1Q39A 3KQPA 3WWCA 3SBEA 3MGGA 4XDGA 1R00A 3EY4A 2P5TA 2XE8A 1RADA 3GGJA 4V0KA 3GYGA 2CUZA 3K4HA