4LJ6A

Clpb nbd2 from t. thermophilus in complex with amppcp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
b'HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
molecule tags Chaperone
source organism Thermus thermophilus
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj6A01
4EPYA 2SHKA 1XXHB 2WV9A 4O0MA 1V43A 3TMKA 4O2RA 5D3QA 4JSTA 5AJWA 3EA0A 3PEUA 4KU4A 3OAAA 4LZZA 2BOVA 3E2IA 2XGJA 5CJPA 3AP1A 2CHGA 2A5YB 2OLKA 5E4FA 2QMEA 4DDWA 2BIFA 3CNNA 1UBGA 1IONA 3ICQB 2G88A 2JLYA 3LQQA 2F1IA 2IT1A 1GM5A 3GJXC 2DVWB 4GFDA 1Q3HA 3UMRA 1W5TA 3LLUA 3MGCA 2N1BA 4LYHA 4DJTA 4E22A 2CJWB 4B3CA 4IKEA 1XEXB 3O8RA 4HATA 4IVQA 2VEDA 2YOFA 3U7EB 4DLXA 5EJEA 4WZ6A 4LHYA 1ESMA 3QKSA 1MV5A 3PEVA 5CIWA 4B35A 1P2SA 4DC9A 4YDSA 1EFRD 2OAQ1 3D7MA 3TR0A 1AZSC 2HEIA 5GJCA 3O8DA 1LF5A 1XEWX 2ZRAA 4KFTA 1E2EA 4AC9A 1KDPA 1IXRC 1P3JA 2J87A 3TVTA 4AIIA 1CIPA 1RVDA 3AF4A 4FMCF 4P3YA 3U61B 2C99A 1GZSA 4W5HA 1TQ6A 1F5NA 2FN4A 2QQ0A 2Z0MA 2IYXA 4TMKA 3GP8A 1W4BA 4DLRA 4HI0E 3Q85A 1UKEA 5JHGB 5TMPA 4D4JA 3ASYA 1WRBA 3MLEA 2CLDX 1YZNA 4E03A 2GBLC 3CWQA 1SQ5A 3AP2A 4XOIA 2IEZA 3HR8A 1SVWA 5CB8A 4LJ4A 1KHTA 5FOXA 4F4JA 2IX3A 4Q01A 5IDVA 1D2MA 1G3MA 5BYJA 4DBLC 1G5TA 1JB1A 2QUZA 4NU0A 1CRQA 1HEIA 1S4QA 3ZH9B 2RB4A 2YWHA 3NTUA 4JLOA 1ZD8A 4Y0AA 2PX3A 5B57C 1TUIA 3PFIA 3I62A 2ZU6A 4LYFA 3KQLA 4M9QA 5HKKD 4C2UA 3AVOA 4I1UA 4PTLA 2YOHA 5B58C 4N3NA 2VF8A 3RS4A 4UXIA 3GLIB 3IO3A 4KSCA 4A82A 3CPHA 4YDHB 2RAPA 1QHYA 2QTFA 4LUCA 4LV5B 4PC6A 5TV2A 2CE2X 4BZXA 2F6RA 2G0TA 3CBQA 1O3YA 3EZ9A 1JALA 5BWMA 4DB2A 3VX3A 1NMZA 2QMUA 3GLFA 4RD1A 1PJRA 4FW9A 5JEDA 4XD7D 4AK9A 3HU2A 3O47A 4JMPA 2GXAA 3TK1A 3BXZA 4HDQB 4HAWA 1WXQA 4QG7A 2X8AA 4Q9IA 3KQUA 3OEHA 5JLJA 3GEIA 3CIOA 1AKYA 4N1AA 2IUSA 4QBFA 5BN5A 1G20E 2QP4A 1KSJA 2IUUA 1OKKD 1V5WA 4BQSA 4EFLA 5B64A 2VSFA 1QG2A 3SN6A 2O8EB 1TQDA 3PCRB 1GP2A 4A0GA 4M22A 5LD2B 3SQXA 3GLHE 2A30A 4PHTA 4OHYA 3THOA 3Q8XB 3RWMB 1ZYUA 3FB4A 3GQBA 2GEUA 4QHYA 3KX2A 4W5WA 1XCGB 1ZU4A 2BBOA 3CR7A 3CF6R 2BKEA 1YVDA 1NRJB 4S2EA 5J5CA 3NBYC 4AWXA 1U9IA 4RD3A 2OM2A 1KI9A 1S2MA 2R6DA 3A1VA 4R98A 4TL6A 5AK0A 2IHYA 1QBKC 3T1TA 2IYWA 3K9HA 2XNDD 3DOFA 1SHKA 2D3WA 5TY0A 2KB0A 4NP6A 4MKIA 1GL6A 1NP6A 3KUCA 1XEWY 3GFOA 2RH5A 4M1KA 4ZV4A 2BM1A 1EGAA 3UXMA 4ZI2A 2OT3B 4BEJA 4DDTA 3OIYA 5AUPB 3F8TA 4M1OA 821PA 2W83A 4G5OA 2GWHA 4ESHA 2Q21A 4B47A 4CW7A 3PUWA 3Q3JB 5KYKA 3W3AA 5HZHA 2RMKA 4A4DA 2NGRA 2ZR0A 3C7KA 3PXGA 1FZQA 4WBSA 1W4AA 4GOKA 2Q3HA 1FNNA 2VTKA 2ZS7A 3NC1C 4KJZA 3GPLA 4QFMA 4OL0A 1ZCAA 2J1LA 4ZDJA 2AKYA 1X1SA 3AM1A 2BBSA 3B78A 4Z8XA 1JQLB 3QVVA 2ZETA 3IO5A 5G40A 1A1VA 3NBFA 3SBDA 3SYNA 1XPUA 2PLRA 1SXJE 3D6TB 3V00A 2FDCA 1VG1A 3UMFA 2CL0X 4FD2A 1E79D 1XJ0A 3C15C 1UKZA 3RRYA 2QBYB 1MRNA 3W5IA 2V6JA 3LBHA 4D2IA 1W0JD 1NLZA 4IEIA 3QPWA 2VP9A 1OYWA 4JKYA 5C4MA 2ONKA 4Q7KA 3FHTA 1XJQA 3PITA 2VHUA 2XZLA 1RZ3A 2IYYA 3I92A 5JBQA 2RGXA 4KXFB 2GILA 2W6JD 5L3QA 3CRW1 3DZDA 2HJGA 1P9WA 2ZJ2A 3Q5DA 3GLIE 1Z28A 1XXHA 1N5IA 4LWZA 3B1WA 4OK6A 4X8MA 4C0LA 2YOGA 2BJWA 2C9CA 5KU1A 3ETLA 2W00A 3EXAA 3R9IA 1NKTA 4ZCMA 3WNDA 3SBEA 2VP2A 1AKEA 3SYLA 5FUXA 4D82A 1FQKA 4LOAA 4DUGD 4ZIRA 1II8A 1AIPA 1Q57A 1E1QD 4JIMA 3K1JA 2X19A 5FUYA 1BH2A 1E32A 2G0NA 4QGGA 2GCPA 2IA5A 1GDDA 2ZYTX 4MKGA 2EFHB 2IUTA 2QL6A 1D2NA 4HLQB 1NLFA 2LKDA 3DDCA 3WNCA 1EFUA 1WF3A 1X3SA 4BE7B 1NL3A 4C2TA 1Z0FA 3SNHA 3A37A 5JSZA 4LBWA 4YONB 4YMVA 1Q20A 1ZUNB 4DVGA 521PA 3H1TA 2D06A 1ZW6A 1GUAA 2GAOA 4EIWA 3NEJA 3AVXA 3TW8B 4DDVA 1XEFA 1ZD1A 3ZD6A 4G5SA 3GLIA 4BASA 2D2EA 3THWA 2AD1A 5DI9A 5FR1A 2J9RA 1SXJC 4YXWD 4JLVA 1MO5A 2CK3A 3C5HA 1KDRA 3K09A 2AL7A 4TN1A 4BGDA 1G21E 1AGPA 2JCSA 2ZS9A 2C78A 4JZKA 1Z0DA 2UVQA 4KYUA 4OQFA 1Z0AA 1J99A 1KSFX 4C9BA 3THXB 2IYSA 1TTTA 1YR9A 1W2GA 4KFUA 2KWIA 3KJIA 1FTNA 3VQTA 4HAXA 4D81A 3OIUA 3TSWA 1W0JA 2WPDD 1F48A 4FN5A 4LHZA 3W8RA 2FFAA 4V0NA 4ACAA 4DIEA 2O8EA 1TQ4A 2FG5A 1GKYA 2P6NA 5FI0B 5FL3A 2WBLC 3LY5A 4B34A 4B3XA 2ERYA 3BFVA 3GJ0A 5JJKA 2O0KA 3A6PC 1QHXA 2QPOA 3TBKA 3UANA 4C0JA 4PO1A 2HDNB 4C0QC 5J4LA 3EIQA 3QPUA 4LJ6A 5IHPA 2QPTA 4M53A 3U4QB 1HV8A 2VSXA 3KKOA 1NVVR 2F9LA 2H1LA 5J4VA 2AK3A 4ZI3A 1OSNA 2BWJA 3Q9LA 4JSYA 1SGWA 5F9FA 4G5GA 1D9ZA 4LJAA 1CXZA 2Y8EA 1NSTA 3QKSB 4E09A 1G3RA 4KV9A 1Q12A 3CX7A 1CR1A 3R7WB 3F5FA 3QXHA 1CBUA 1G8PA 2ZYWX 2QU8A 4JLJA 4DUGA 1Q1BA 4B3DA 2GKSA 3U4QA 5K8LA 2RGGA 4R7ZA 3KKPA 1MT0A 1N6RA 3SS8A 4JLNA 5KDOA 1RC8A 2ZRMA 3QPVA 4GOJA 3FHCB 4CYMA 1RKBA 4IW3B 2YKGA 4L16A 2DZNB 2IYRA 4UKDA 4DLWA 3FDIA 2ZAMA 1F2UA 3GJ8A 3JVVA 5HTKA 2IYUA 1J70A 3WMGA 1N6KA 4M0LA 5GADl 3SC3A 2PT5A 4KAXA 4QBHA 1FMJA 1E9DA 2ZIAA 1E2PA 2CEAA 3B5JA 2WTUA 3AVUA 1NMXA 2D62A 1KO7A 3REFA 3EC2A 4GDFA 3P26A 3MRSA 5DO9A 4AYWA 4KVGA 5LPNA 1JR6A 1CR2A 1G9XA 2ZI9A 3QBTA 4K46A 5AUQA 4BECA 3N70A 4LJYA 1P2VA 5KPJA 4A8JA 2W2VA 1J8MF 4G01B 1QHHB 2E1RA 3X1WA 1BOFA 4NONA 1FQJA 2X2EA 3VR2A 2ZJZA 121PA 1CJUC 1OV4A 3VNUA 5HCNA 4W7SA 4P0TA 3ZLJA 1F3OA 5IT5A 3ADDA 4QNRA 3OEHD 4PQFA 1ZC3A 1E96A 3ZZ0A 1SVLA 3H0KA 2D7DA 4B33A 3WYFA 3AJIB 1OXSC 3C16C 3B7GA 3QEOA 2GXQA 1WE2A 1N2CE 5LB4A 3RRMA 4MDEA 4N0DA 3AF1A 1W4CA 3U3JA 1W48A 4JVLA 2O8CA 2FGJA 4EAQA 4RD2A 4LCBA 1N6OA 1XRJA 2VQSA 2ZI7A 3DMNA 3IPXA 5M04A 2O8DA 1QRAA 4A2QA 4DLUA 1US8B 1KI6A 4Q03A 3I72A 2YC4C 5DGXA 1M8PA 1EG7A 4OQMA 4BFWA 1I4DD 1E6CA 4ZIRB 2JLVA 1EFHA 1KY2A 2KI5A 4GNKA 4TMWA 3TQFA 2OESA 1VPLA 3U3OA 2EFCB 4LYAA 4GP7A 3BOSA 3PEYA 1JEEA 2VHQA 2KRKA 4ZKEA 3LFUA 4B76A 2KE5A 3IQXA 4FMDB 4OYHA 2ZYUX 3CUEF 4UJ3A 4FI3C 4URWR 1ZBDA 3GEHA 3RC3A 3EASA 1R0YA 3FFBA 421PA 4B74A 2ZRDA 4BFVA 2V1UA 1FNMA 3W5JA 5JI2E 1UDWA 5L3QB 4NKRA 4IXMA 2N42A 3VKHA 2NTYC 4TSFA 1N6NA 5LB2A 5J4HA 2F1RA 3HU3A 5H70A 1R8SA 1R10A 4LSGA 1HQCA 2ZRJA 1OT3A 2C5LA 1OYYA 2ZRKA 2DFNA 1G41A 4MYHA 4Q48A 4QM7A 1WP9A 1KJWA 5JI3E 4JT2A 3B1VA 2WJIA 2V1XA 4M21A 4US0R 1T0HB 2ANCA 2IXFA 3BC1A 3SJAA 3X1YA 2BEJA 3DPUA 5JS8A 1E9SA 3A36A 3LNCA 1G19A 1M6NA 3DZ8A 3LX5A 2FSHA 2VIIA 1OLOA 5EE1A 4UJ5A 1T8TA 4NYMR 1VTKA 2BBTA 4TYNA 4FINA 5H8WA 5FOWA 1NBMA 4DXAA 2OE2A 2C77A 2XAUA 2OBNA 4US2R 2R44A 3GLGA 2CHQA 2ZROA 3G82C 3P20A 4DB4A 2FU5C 2IS6A 1J2JA 2ZI3A 4FMDF 3IEVA 1T8UA 3K70D 4PO9A 2NPIA 4NMMA 3C4JA 2PJZA 4P4SA 1ELOA 3U5ZB 2FZ4A 2VPPA 4NYIQ 3CW2A 2ZSDA 2QT0A 2P67A 3ND9A 2GF0A 4RZXA 4LPKA 1LY1A 4U7DA 3N5CA 1Q3TA 4ACBA 2IWRA 2JLRA 2V8OA 1YRAA 1NVUQ 5E7JA 4NYJQ 5FR2A 5FTLA 2A5DA 1T91A 2Z83A 5DISB 1G4AE 2YWGA 4UNNA 4Q19A 3U44A 2B8TA 3AB3A 1Q1EA 5GJBA 3FVQA 4URZR 4ILEA 4TZ6A 4A1FA 1CRPA 3SQWA 3K9GA 2CL6X 3KJHA 3B82A 1QHSA 4RD6A 4XSGA 1Q1QA 2CK3D 3QBVA 1W36D 3IIKA 4PO8A 1I2MA 1U8ZA 4EDHA 1E9FA 1UFQA 3CZPA 1ZC4A 4DT1B 1L4UA 1JR3E 2OSBA 2OHFA 4NYIR 1WBDA 5EZ6B 2GXSA 2VO1A 3EWSA 3QF7A 1TAGA 4JLMA 5HE8A 4TYYA 1M2OB 1FFHA 4YXWA 4LI0A 3LX8A 4F38A 1KKLA 4A0HA 2ZPTX 1RJ9A 3W6PA 2RGEA 1IY2A 4JVNA 4PAMA 1IY0A 4U00A 1G3UA 221PA 2ZUBA 2OEPA 3CRVA 4KLZA 2GHIA 4D25A 3KB1A 1D5CA 3TGPA 5H68A 2FMXA 4C0HA 8OHMA 1ZM7A 2IYTA 2IYQA 1HH4A 4HSEA 1E1QA 3BBPA 4R2HA 2WHXA 3BIFA 4MUBA 2GBLA 3EIHA 5SZJA 3EAQA 2DWOA 4A3VB 621PA 2XTZA 1UDXA 2XOKA 5CJ2A 1VCIA 2CCJA 1W0KD 1E3MA 4FWGA 1R5NA 1QHGA 2W6IA 2H16A 4F92B 1UPTA 1U98A 2UKDA 3IILA 4G5RA 3AKYA 4IXNA 2DWQA 2QROA 1ZM2A 4L15A 1CJKC 2A3RA 2O0HA 4Q1DA 3T5GA 2CLSA 4D0NA 5AWFC 1S9HA 1XTKA 3NHAA 3ZYCA 1Z83A 4CEJA 2DWZB 3B1ZA 1EWRA 2F3TA 1OIXA 2QMOA 1ZUHA 2ZSAA 3GCGA 1JQJC 1OH6A 1G6HA 4OJQA 5KSPA 3CF0A 4JLDA 1IOZA 4GOXA 4LBZA 3R9WA 3QJYA 4EKDA 4QOSA 2XJ9A 3F0TA 3QQ5A 1G16A 1W46A 4TLAA 1JJ7A 5FTMA 3VLFB 2XTNA 3D3QA 4IFBA 3IEUA 3LV8A 2DCUA 2XXAB 3LDAA 4JVSB 2PZEA 2JASA 4MITA 5CYOA 1N0WA 1Z0JA 2IS2A 1KI3A 2A5JA 2HCJB 3QOFA 3GFTA 1BIFA 3LBNA 1COWA 5AJYA 4RCZA 4CIDA 5K8IA 4LHXA 1SKQA 1WA5A 5BN4A 4JJKA 2J5XA 2MMCA 2GJKA 3AKDA 4B71A 1U0JA 2ZE7A 2H92A 1NN5A 1XNJA 4W9MC 4CZ2A 3SJCA 1DAGA 1VECA 2ZRBA 4MDFA 1W44A 1FOEB 4MKFA 3S1AB 1EX6A 1L8QA 3TNFA 3TSZA 3K70B 1W47A 2WJHA 1QDEA 4GMDA 4CGZA 5FPKA 2XB2A 3IIMA 1Q22A 1ZJ6A 1II9A 2WJYA 3H2YA 4RFSB 2ANBA 2OLJA 1ZMXA 1LF0A 3UG6A 4UNRA 3O8CA 3VKGA 4Z8YA 4EJSB 3SDZA 1S0UA 2XSZD 1M7HA 1XEXA 3WMFA 2I1VB 1Q0UA 2YWFA 3B6EA 5H1YA 2L0XA 3KZ1E 2VF7A 3CX6A 1MO6A 4Z1MA 3RSOA 5E3HA 3CLVA 4TQ9A 2LWIA 4PC1A 2WZQA 1ZIPA 5G3YA 4F7WA 2GJAA 3DMDA 2BBWA 5IK2A 3B9PA 1OH5A 1JPJA 2ZVPX 4A92A 4TMTA 1S8FA 5CM9C 2GJ9A 1OHHD 2FZLA 4DEYA 3U7HB 3RRZA 4DLVA 2WIBA 5FOSA 5F3WB 4IDQA 1KZGB 1T9HA 3B60A 1Z5ZA 3BJIC 4MYUA 3VR1A 1CJMA 1UKYA 4DLYA 4I4LA 2PCJA 3A58B 3OIWA 2DHRA 3KFXA 5DSZA 1Z22A 3P4YA 2HT6A 2FA9A 4HLDA 3PR1A 1E4VA 3BWDD 4JKIA 1N5KA 3DKVA 2WWGA 5JWRA 1US8A 4QC2A 1DO0A 2P5TB 2QEQA 5CB6A 2ZI5A 4QNMA 4FWDA 2F43A 2XOKD 3GLHB 1IM2A 3MUFA 4URVR 4CEIA 2JJ1A 1G7TA 1R0WA 2J41A 4XWAA 4A9AA 3KXIA 5KSYA 1G64A 2EYUA 1E2LA 1MRSA 1K6MA 2JLZA 2CJWA 1FW6A 4PPQA 4MGIR 3EX7C 5C1BA 4Q7JB 2NZJA 3P4XA 3T5DA 4P4UA 1OB2A 3AQ4A 4XVRA 5DYIA 1K8RA 4DSNA 4GSYA 1DOAA 4R9UC 2W2TA 5A5GA 1MABB 1NJFA 1WDTA 3D31A 2WKPA 3B8HA 4AI6A 1EFTA 1KGDA 2PEZA 3PG5A 3WBJA 2Z5FA 2FGKA 3ZVRA 2R6FA 2R6AA 4IEEA 1RRCA 1SVSA 2HF9A 2ASEA 4ZDKA 1PZNA 5FOTA 4Q1BA 2V3CC 4PR0A 2GEVA 3I73A 3LW8A 3ZQ6A 2G1KA 4B73A 3HP1A 4XIGS 4DLSA 3THYA 2OFOA 5JCPA 4P4TA 2MSCB 3B13B 4TTQA 2NO0A 4Q4AB 1KAOA 2NQ2C 3RVBA 2WPDA 2FV8A 2EFGA 3ZS8A 1R0ZA 1KZ7B 4B44A 5AJVB 1AQUA 5JEEA 1GSIA 2ZREA 3LRPA 4ZCLA 3W8NA 2GVZC 1YR6A 5KNCA 3L82B 2WJJA 4LX0A 5J4YA 3WP1B 4MGKR 1T3HA 1BMFA 1T6NA 3MSXA 2AFHE 2W0SA 3A1UA 4M9SA 5AJXA 3CF2A 2OXCA 4B32A 1GIAA 1C1KA 3W6OA 1SULA 3KKQA 2REOA 4JL5A 2ORVA 3AEZA 4X8HA 4WVFA 2FFHA 4XJXA 1IHUA 4JYCA 3ECCA 5FBRB 3ZGXA 4BLRA 4OHWA 4C3ZA 1YE8A 2AFIE 1E99A 1BYIA 4GBMA 1MABA 3IIJA 1IJEA 2W58A 1BO6A 2ZUCA 1C9KA 4UXJA 3UWOA 2QM7A 3RWOA 1GL9B 1L4YA 1XPRA 2NO1A 4AURA 1XD2B 1G3QA 4BFTA 3FPAA 2H7VA 5JRJA 5ELXA 1WBBA 2FEMA 2JLSA 3TSOA 2DYKA 2HV8A 1D2EA 1JI0A 1R0XA 3BGWA 2GCNA 3W90A 2YC2C 4EFNA 3U7GA 2ODWA 2WMNB 1D8TA 1U0HC 3LD9A 2V55B 3EA5A 3KW6A 1UKVY 1Z0IA 1AGRA 3SE0A 3AGPA 4BFSA 4ASUD 4IDOA 1NG9A 1W1WA 1ESNA 1OHHA 5IF9A 3GFPA 3JZMA 1KKMA 5TARA 5EP2A 1XMSA 2OZEA 1TUEA 5DHFA 1ZP6A 5EP4A 5AR1A 1GRNA 4DCNA 4PPNA 2EW1A 5CITA 3R8FA 1P9RA 4TTRA 3TAUA 1A7JA 1HURA 3GMTA 2OBMA 4F93B 2Q9AA 1N3BA 2GA8A 3K09C 2OG2A 4PFSA 5DHAA 5HR5A 2PEYA 4TYPA 2C95A 2Q3FA 1FX0A 2IF2A 3TH5A 2ATXA 5AJZA 1P62B 2E9SA 4PSVA 4HDOB 1NVWQ 3ZZTA 4F4CA 4WZAE 1Y3AA 4CF7A 5DNYB 3G0HA 2CHVA 3NBZC 1AA9A 1XZQA 2BMEA 3L8ZA 1U8AA 4LV6A 5KSZA 1VHLA 3EPKA 2HUPA 1HA3A 1Z08A 4CEIB 4AYXA 4RFSA 4JN6A 3OEED 2AXPA 3IPYA 2J7PD 1DVRA 3NVAA 4KVAA 1OFUX 3N2EA 1KMHB 4OK5A 4TTPA 3S1AA 4IHQA 2H57A 1WQ1R 1E2KA 5CM8B 2ZU0C 5FTNA 5KDLA 1KK0A 2GNOA 2QENA 1G8YA 3L0PA 1DG3A 1NY5A 4D80A 3VR6A 3K8YA 4LY6A 2BMJA 1MOZA 2WAYA 3UWKA 1XTQA 4FWIB 2E87A 2ZJBA 2NMVA 2GXUA 1TADA 3E1SA 3FE2A 1FMLA 4QGAA 2PCLA 4IVRA 3EZ2A 1HE1C 2BKUA 4PSAA 4DZZA 4JYBA 4FIDA 4IDPA 1VCOA 3A4MA 5HZKA 4PQRA 1TPZA 3KQKA 1GVNB 1N5LA 4TWZA 3DEFA 3DM9B 2UZ3A 4NCHA 4ZCIA 1W36C 2V6IA 2ZRFA 2FPMA 1VKJA 4ARZB 4GT1A 4PAQA 3UG7A 4JT4A 1A4RA 1CR4A 2YWEA 4YC7A 5KOYA 4CEJB 2V7QD 5TDHA 3L8YA 2P65A 3CZQA 4Q18A 2W6ID 3KKMA 4PZLA 3FMOB 1HT2E 5KNBA 4I99A 5FTKA 3WNBA 4Z1MD 1GG2A 3I61A 4A36A 5KHOC 2WAXA 1NKSA 1YZGA 5F98A 1KOFA 2R65A 2Z43A 3EPHA 4LHWA 2IYLD 4V0MA 3WRYC 4RZ3A 3U60B 4JVMA 3CWZA 3PVSA 4QM6A 1X86B 4PZYA 2IS1A 2GJ8A 2A7QA 3EW9A 1VYVA 2ZRCA 5D3MA 2FJUA 2FSIA 2AHOA 4TL8A 1E1RD 3RAPR 3CB4A 1EX7A 3VHLB 5JMTA 4QGFA 4MYTA 2G9NA 2NOAA 5EQTA 4TQUS 2O8CB 1KK1A 2ONJA 3AH8A 4MGYR 1GRQA 3I4LA 3RNLA 4M9XA 5GJWC 2CMKA 2ZJOA 4UNPA 4L8GA 1IQPA 1QHNA 4LDJA 1Z3IX 2EWWA 3WHLA 3MWJA 2BHRA 4I1VA 4AG6A 1RE0A 3Q7PA 1YZLA 4ZKDA 3RC8A 3LQRA 3VTKA 3M0EA 2JJ2A 2VRWA 4NCKA 5SZKB 1MH1A 1DS6A 4JJZA 4LJ7A 2G3YA 3SI7A 4UQOA 4GL2A 1J90A 3KTAB 3NC0C 1OXVA 4ASUA 1S1MA 2ZSEA 3K0SA 1XPOA 1OFTA 5E7MA 2HT1A 1SVMA 3AVYA 5EUMA 2ZM5A 4NCJA 3FMIA 2RGBA 5BQ5A 2BV3A 721PA 1ZD9A 3MAAC 4RZ2A 5FL7A 2QE7A 2DPXA 4V02A 4G3XA 4Q66C 4Q1CA 1ZCBA 1UEIA 3OZXA 2JEOA 1ZNZA 2FPKA 2B7BA 3ZVNA 3O8BA 3BB4A 3U3MA 4QKQA 1CF4A 2DR3A 3SYKA 1ZNXA 5F2EA 4U02A 1RFLA 4RFVA 5EE5B 1VYTA 4WW0A 1CS4C 1JXOA 2YHSA 1G4UR 2OXRA 1AM4D 3RDPA 1KMQA 4PZZA 4KYIB 4A15A 3OFND 2OCYC 2MSDB 3B1YA 4QJ4A 1IN6A 3AKEA 1R5OA 3SHWA 2JDIA 2JDID 2IHBA 1NIPA 2OBLA 2ZE5A 2ZRLA 2PJRA 2BMDA 2RCNA 4PPFA 3ICEA 2PMDA 4TLEA 3HR7A 1T0JB 1W4RA 4OBEA 4ZO4A 2HCBA 5FPSA 5KO2A 2RGNC 4KHZA 2Q9BA 3EC1A 4OI0A 2FF7A 4EPVA 1TQ2A 4EUNA 3NH6A 1EK0A 5BN3A 4MH0R 1X37A 1P5ZB 4DCVA 1XZPA 2ZR9A 2ZVQX 1XTSA 4TSFD 3WY9A 1DG1G 4FCVA 4ARZA 4MQBA 2CCGA 4RZUA 1AZTA 1IJFA 4BLPA 1H65A 4GITA 2HLDA 3OE7A 4IFEA 2ORIA 4M1WA 1BMFD 3Q5EA 2CNWD 4TLDA 1H8HA 1H8HD 2QBYA 1KJZA 3T06B 4XTCS 1DPFA 1Z8FA 2XX3A 3ADKA 3LW7A 2WICA 2REXB 3FKQA 4GI7A 4Q4JA 3IBGA 2BEKA 4YMWA 3EWAA 4RKEA 3EG5A 3WBKA 4F4IA 1U2RA 4C4PA 1RYHA 3PQCA 4HYYA 3HU1A 3PUZA 4LRTA 1S3SA 2GZDA 2FNAA 3TVDA 1NIJA 2DB3A 4RJLA 2BJVA 2AK2A 1E2QA 2WWFA 4ZDIA 2PT7A 2QP3A 3TIFA 2WSMA 4H1UA 1XD8A 3I8XA 3V4RA 3IDQA 4HAVA 3CPEA 4YMTA 1E0JA 3LVQE 4RVCA 6Q21A 3U6BA 2GK7A 1OXTA 3RYTC 2P0EA 4D0LB 2QRZA 1IN7A 2JIZD 3NEYA 1NBMD 4US1R 3QF4A 1Z47A 3MFYA 1E1RA 4JL6A 2QSYA 5J4KA 3FMFA 2C96A 1G8FA 3IGFA 3B2EA 4TZ0A 3DO6A 1VG8A 2PX0A 4NTZA 3UK6A 4QBIA 5C46F 2QGZA 4CEHA 3B85A 1QF9A 2F1JA 3SEAA 3VR4A 3VAAA 4Q1AA 4M8NE 3WHKA 1CR0A 2ATVA 2RHDA 3BFKA 3LA6A 1EWQA 4DCTA 3A1SA 5L3RA 2XJ4A 1E2NA 1QZMA 2JATA 2XNSA 2EFEB 2XNDA 3ZS9A 3MG9A 2J7KA 4BUJA 4DDUA 1BS1A 2ZRIA 3FGNA 4FWTA 3AGQA 3SJZA 1E9EA 2OFWA 3T35A 4PSKA 4C30A 3ADCA 1XCMA 2YINC 3DM5A 3LAWA 1KO1A 1G6OA 2A5FA 4Q4JB 4DKXA 4AKEA 1E0AA 3GLFE 3K70C 1JEDA 1KI6B 1AJEA 4LRSA 1YU9A 1OXXK 2Q3MA 5EXXA 4NBSA 4FCTA 4QJ5A 4L4UA 4R2IA 4A0RA 4BLQA 3AV0B 2ZXUA 4EPWA 4KITB 2JJ2D 1L2TA 2R2AA 1Z0KA 1CULC 3L0IB 3BRWD 3K53A 2FEOA 1N5JA 1XMVA 2RGAA 2ZRPA 3W34A 4A0FA 4AKIA 4OQXA 2YV5A 5JRZA 1C4OA 3THYB 3HPRA 2JLUA 1LV7A 2J59A 1P75A 4PPGA 4HLUC 3QXSA 5CDFA 4BWYA 3GLFB 2D2FA 2C03A 5EE0A 4Q7LA 1TF2A 3WYAA 4DSUA 1KSGA 3RANA 1DE0A 3HWSA 3WP0A 4M4SA 1JNYA 1YJ5A 1R4AA 4XD7A 2UZIR 1XB2A 5BYKA 2QY9A 4KCGA 1CLUA 3MJRA 4IDHA 3PJRA 2C8VA 1W2HA 3MCAA 3GD7A 3IUYA 3K0AA 5CYPA 5P21A 1G8GA 1Q44A 1ETUA 1B0UA 1NI3A 1GFIA 1IN4A 1KTVA 2Z4SA 3VX4A 1XMJA 2EVWX 1DAMA 4MRSA 4BEBA 2Z6VA 4OQLA 5LBIA 4NPHA 5SZHB 1P61B 1CEEA 1Z6YA 2ZJAA 3CM0A 3QXCA 5FFMA 1ZUIA 4Z51A 5FBLB 1XU4A 1COWD 1QHIA 3DKPA 5DI3B 4KBGA 4JS0A 3G5UA 4CVNA 4CRWB 1G5RA 3ONWA 1N6LA 2DBYA 3TE6A 2RGCA 1VCNA 4PHHA 4Q9JA 1GITA 2GEDA 1OFIA 2WJVA 1IY1A 1T3SA 2HXSA 4FMCB 5EUQB 3H84A 2A78A 4WIAA 5FI1B 3ZZUA 3NXSA 2AD5A 4Q4AA 4B3FX 1T5LA 3LXRA 2YJTD 3TUJC 2XTMA 1ZNWA 3KFVA 1UJ2A 5K8TA 1R2QA 2IYZA 2R8RA 3QI2A 1RIFA 4UNQA 1GAJA 2I1QA 2O8BB 3AF3A 2MSEB 1HQYE 1G1MA 2WVJA 3AUYA 2MMGA 2G77B 4PANA 1E0SA 3K0AB 3IHWA 1FP7A 2J45A 2F55A 2Z4RA 4PC2A 2GESA 2VP5A 1DO2A 4URUR 4LHVA 4M1SA 2QM8A 1UBCA 1XXHE 5TB5A 2P6UA 4HUQA 4TLCA 2J0SA 2C98A 2B8WA 2X77A 1LB1B 2OAP1 2QTVB 4YMSA 4LRWA 3VHXA 1KSHA 1IAQA 1ODFA 1PUIA 2V9PA 5AUNB 2ZI4A 1XTIA 5JWHA 5J47A 4PHFA 1YRBA 3C41J 3U6KA 3EPJA 2NIPA 1BYUA 1NN0A 4OI2A 2PBRA 4GP6A 3AVTA 1RRPA 2CBZA 3VR5A 3QIAA 2OCAA 1SVKA 3OIVA 3GLHA 2F43B 1K5DA 2GZHA 4ZPXA 2GVDC 2ZANA 4XWKA 1E2JA 1EFCA 5D3MB 1SXJB 4A6XA 3CPJB 1LTQA 4BRWA 4I81A 1LS1A 2WKQA 4M1MA 2WWHA 2CE7A 2DY1A 2P2LA 1S1CA 4YMUA 5JFGA 5FTJA 3Q72A 2Q9CA 4BZPA 3P27A 5HKKA 4D4KA 3AUXA 3THXA 2GRJA 5FBWB 3WMEA 2XITA 1E9BA 4TL9A 3CX8A 1CJVC 3SHFA 1SKYE 3WYGA 3NDBB 4DT1A 2OCBA 2ZSFA 4DHEA 1GNQA 5KUTA 3BH6A 3M1IA 4MKHA 4O2LA 1R7RA 5C18A 1U8YA 1QG4A 4XVQA 1A2KC 3KTAA 5KSOA 3MWYW 2CNWA 2ZJ5A 4BFZA 2VHTA 4LBVA 5K8UA 5DH9A 4JL8A 3TKLA 1EXMA 2YZ2A 4QHSA 3KQHA 5E95A 4B75A 1E4YA 2YNMA 1D9XA 1XJCA 4UXHA 4FXPA 1UADA 2H17A 1YZQA 3AP3A 4K81B 1U94A 1DBSA 4L9WA 3E5HA 1ZM9A 3RS5A 4Q9HA 2AXNA 1JBKA 1XTRA 4BFYA 5B30A 1IN8A 4Q9LA 4TYWA 4JBXA 2IF0A 3HJNA 1YZTA 3M6AA 4P4SB 2ZJ8A 2HYIC 4A8JC 1J8YF 4LK2A 4NZYA 5FOVA 1NSFA 1IBRA 3J81k 1KDOA 5CLLA 2PLFA 3A8TA 2K5UA 2O8FB 4OHVA 4JLPA 4HLUA 4M1TA 2QORA 4GRAA 1KMHA 2NZ8A 5EP3A 2Q0HA 1Q1ZA 1G17A 1NMYA 1G7CA 2O52A 2F9MA 1LS6A 1K5GA 1VHTA 5C4GB 3WXMA 4QXAA 3PUYA 1G7SA 1S96A 5HCIA 1GKUB 1UAAA 1R6BX 2BM0A 1SXJD 2QAJA 2V4ZA 3IBYA 3V4FA 5EXSA 3GLGE 2QT1A 3RS3A 1S9DA 3K0FA 3ADBA 2JLWA 3T15A 1RJ9B 1N6IA 5GJVC 2VP4A 3BH0A 3C14C 3SR0A 3K0CC 2D74A 2QAGA 4MA4A 1TF5A 2DFTA 4CT4B 2EQBA 4WOPA 1KNXA 2ZITA 1Z2AA 2KJQA 1XDBA 2VHCA 2ODNA 4Q4HA 5ANRB 5SZIA 3T34A 1XCPA 1LW7A 4BPBA 1G8HA 4GPTA 3I8SA 2NG1A 2QI9C 1PVOA 2IXEA 4PQYA 3AF0A 1H8EA 1SHZA 1ZM3A 4URYR 2XZOA 2DFLA 2WKRA 2GJSA 4V0OA 5HE9A 2QA5A 1DAHA 3QG1A 1ONBA 3QSYA 1QVRA 1NN3A 1E0KA 5FPTA 4QL3A 4WXRA 1P73A 3SFVA 3U44B 3TQCA 2GF9A 3MHVC 3U7FB 2ZAOA 3KUDA 5EE9A 3PUXA 2V54A 2BVNA 1CJTC 1XBTA 3KJEA 2GTPA 2N46A 1XX6A 3VNVA 2FE4A 1GRRA 3DL0A 2REBA 4W5JA 1YR8A 4AKGA 1AS3A 5L3SA 3AVPA 2CXXA 4QBGB 3NKVA 5BXQC 3I5XA 2RKOA 4KFRA 4IDNA 2LKCA 3LO5A 5EP1A 2VP6A 3FFAA 5FUWA 3H86A 3MWKA 5KNDA 4HUQB 3QY0A 1ZU5A 1LFDB 1PLJA 1II0A 2JJ1D 4WXPA 2ZE6A 4EPXA 4II7A 3ZD7A 2F3RA 3SFZA 1JR3D 2DZOB 1H8ED 4Q00A 2JA1A 4MRRA 2GAAA 3AF2A 2V7QA 3LXXA 3P32A 3N2IA 1KK2A 5KDDA 3KDSE 5EXTA 5L3VA 1M34E 1E2GA 3W3ZB 1DEKA 1DTSA 2HYDA 3C8UA 1N0UA 3KXLA 4C0AC 4MYCA 1W49A 3UMSA 2WSSD 2F1HA 5HPYB 2PZGA 4TMXA 3K0EA 2A9KA 1SXJA 1SKYB 2BCJQ 4NDZA 4XWOA 1OF1A 5FPHA 2VBCA 3EPLA 3LLMA 3TW4A 5IK2D 3QNUA 5DI3A 4A2WA 2ZUDA 1JPNA 4H1VA 4HZUB 1FL9A 4TMZA 2JLXA 4B48A 1OKKA 1AS0A 2WOOA 1LNZA 4WZBE 3ZIAD 1S3GA 2QP9X 4PC7A 2IEYA 1IXSB 3B1XA 3BS4A 1XD2A 1T3LA 4DIDA 3VKWA 4AG5A 4RY2A 3R7WA 1KI1A 1E98A 2A5GA 2O8FA 1P9NA 4V0ME 3RS2A 4XTRA 3TRFA 2C04A 3QG5A 4KI0A 1AS2A 4OKSA 3FYHA 3RS0A 2VP0A 4LJ9A 1NVVQ 3FTQA 4MRPA 2IS4A 4Q47A 2QNRA 3C5CA 1VYUA 3PENA 4JLAA 2X2FA 4NHOA 1MR3F 2OILA 1CP2A 4LBYA 3I1FA 3KB2A 3L43A 2QRNA 3IKJA 5CDFE 4LPSA 3FWYA 4M9ZA 2QE7D 4EQ6B 3ZJYA 2ECKA 5UKDA 1XD9A 2FOLA 3E70C 1OW3B 1U9IC 1YZUA 4RSGA 1Z6AA 4DLTA 1SZPA 3EZ7A 1OXUA 4TLBA 3QXXA 3CRRA 2J0QA 3H4MA 1E94E 1E9RA 1E2FA 1Z6XA 4Q9KA 2B7CA 1VG9B 4TT3D 2CLCX 4B3BA 2GZAA 4F91B 2HLDD 1GOTA 3OE7D 1WB9A 3MD0A 1HUQA 2FPLA 2ODBA 5DLQC 4RD4A 2O0JA 4C7OA 5TVKA 3X1ZA 2ODEA 2J46A 1M7GA 1HTWA 3W9YA 4QRHA 3VU9B 4P33A 1NLYA 1KY3A 3KQNA 4HAZA 2JLQA 3U3KA 1M1YE 1F2UB 1T5IA 2G1JA 3BE4A 1T4GA 4PXAA 2IXGA 5G53C 1F6BA 1HY3A 1I4TD 4LC1A 5EE3A 1OIWA 1PLKA 4CDGA 2BMFA 5KTYA 2AX4A 4V0KA 3RRNA 1KI7A 1Y63A 4EFMA 4N0EA 3NH9A 3R9XA 4FMBB 5GVSA 4QHTA 1LVGA 4NYMQ 5DYGA 4B2IA 1ZM4A 2D4HA 5FH9A 3ASZA 3HDTA 4S35A 1MKYA 1TU4A 3VMFA 2LCFA 3UPUA 1KI8A 4NCNA 1JXMA 3JVUA 4B6FA 3CONA 1P4SA 4DCUA 2QZ4A 1FUUA 1RW4A 2DFKB 3CNLA 1DAIA 1QHHA 5FL7D 2OCPA 4A8JB 3BB3A 4ERNA 3T12A 2R9VA 4E07A 4IVPA 3A4LA 3V9PA 4O25A 1ZAKA 2ZYVX 3R20A 1G5PA 2WWXA 4HZUA 1MO3A 1KO4A 1NF3A 4LJ5A 1SVIA 2BC9A 2R6CA 3FHOA 1NVMA 4U5XA 4DWJA 1TX4B 4GZLA 3L2OB 1P2UA 5CLQA 4ON9A 1R8QA 4M1YA 4J0QA 2W0MA 4Y0VA 4AKHA 2W6JA 3W6NA 5JECA 4ZDWA 4DSOA 3NDPA 3SJBA 1A82A 1XTJA 3CNOA 5JCZA 1F60A 4CEHB 4FCWA 4EPRA 3A4NA 1ZRHA 2NPFA 1G3IA 1GL7A 3QEJA 1J7KA 3LH5A 4IJMA 4OJKA 4TMVA 3GEEA 2H18A 1WCV1 2J3EA 1G18A 2ZEJA 3VR3A 2DWPA 4DCSA 4G1UC 2QMHA 4EJSA 3FMPB 4HEJA 2AR7A 4G5QA 4XH9B 2GDJA 2IW3A 4NCIA 4B2LA 2PH1A 4BRUA 3U2QA 5AUOB 2GCOB 2HXYA 2RGDA 1P72A 1R5BA 1L7VC 2TMKA 2ZRGA 5LD2C 2BDTA 3LVRE 1EESA 1NG1A 3TLXA 5EXPA 2IK8A 1VDZA 2ZSBA 2AWNA 1XWIA 3BD9A 4IOLA 1WMSA 4OHXA 1VIAA 3MJHA 1U99A 5A0FA 1NJGA 3K9NA 2WWIA 5KPDA 2R62A 3QUSA 1F2TB 3P1JA 4D26A 5F9HA 2FWRA 3ZIAA 4E5UA 1OE0A 3CRQA 4KFSA 1OFHA 1ZVQA 2A2ZA 2OFXA 1II8B 1E2IA 3CO5A 4Q5IA 3BK7A 1PUJA 3CKLA 3UIEA 1TEVA 2W2XA 4BLTA 1CTQA 1RPZA 4ESVA 1W36B 1E2HA 1GNRA 2B21A 3ZQJA 5FPYA 2IL1A 5LDDC 3BB1A 4AD8A 1G7RA 1N6HA 1P7CA 2ZI6A 3KKNA 1GILA 5JJIA 3QVUA 4Q4LA 2IC5A 4WAUA 3QKUA 2ZRNA 1W5SA 3K0CA 3BH7A 1KNQA 4KBFA 4YLGA 4OHZA 5CK5A 4BFXA 3X1XA 1RRFA 1DAFA 2H5EA 2ZR7A 1W0KA 1JR3A 2GETA 4PX9A 3I5YA 1Q21A 2RHMA 4I1OA 1C1YA 4V03A 1U90A 3K0FB 5FOUA 2AWOA 1OPXA 1AN0A 4HZIA 3NIBA 3DHWC 1ZINA 4KODA 1I2DA 3QF4B 2NO7A 2BCGY 3GJ4A 2FFQA 3EZ6A 2QAGC 1IXZA 2V6ZM 3GJ6A 3ND8A 2QGNA 5JWOA 1N25A 2EFDB 4AY2A 5J40A 2Q6TA 3F3YA 2JIZA 3EZFA 4XVUA 4A2PA 5A4JA 2PZFA 2WOJA 3FKSD 1XFAA 2I4IA 2G6BA 5DE3A 2KBEA 4D0GA 5EZ5A 2JAQA 4EPTA 2VA8A 4NH0A 3FOZA 3A1TA 1XF9A 2X1VA 5DN6D 2AN9A 1A2BA 1Z63A 4MRVA 4C0KA 3KJGA 3IHLA 1KO8A 1CU1A 4HLCA 2OV2A 3RSLA 1TF7A 2NO6A 4I1SA 2XXAA 4L5BA 1JAIA 3QE0A 2F7SA 4Q1EA 1QZXA 4KLNA 1KJYA 1E2DA 2JGNA 2J0UB 3HPQA 5CIQA 2J0UA 3CR8A 4TT3A 3GJ7A 3D8BA 1KIMA 4HB2A 1BKDR 4LC0A 2CCKA 4M2LA 5JZVA 2NO9A 3EIEA 1UEJA 2EU8A 1B23P 4AYTA 1AK2A 3ZDQA 1E69A 1OH7A 5L8VA 1DARA 1KI2A 1M7BA 1XMIA 2QTHA 4DSTA 3FKSA 2J0VA 4R71A 3VFDA 1X8KA 4H9GA 1NN1A 4Q7MB 1EFRA 2VLIA 3T61A 4IOJA 3NG1A 4RCYA 1P2TA 5FUVA 3QKTA 1VCMA 4NE2A 3UATA 3JZAA 5JHHB 5TXGA 5GVRA 1FUKA 1UF9A 4PHGA 1JECA 3X1DA 3ZVMA 3CH4B 1GNPA 3GJ3A 2OUKA 1UM8A 3OHMA 1HT1E 3T1QA 2QQEA 1Z6TA 2WWWA 4JBYA 3UKDA 4NYJR 5C2JB 2D7CA 2XB4A 1TNDA 3OFNA 3OESA 4TQAA 4NL4H 4X8LA 4P31A 1FP6A 4POAA 1JJVA 1GTVA 2KBFA 2C9OA 5IRCD 1HE8B 1YR7A 4HB3A 4HUTA 3IQWA 3OAAD 3REGA 4RD0A 1VG0B 3CRMA 1FPMA 4DRZA 4X8OA 2ZQ5A 3TAHA 1W7AA 1YQTA 1A5TA 1GKIA 1KDTA 1Z07A 3QENA 1VMAA 5BW8A 5B2ZA 1YZKA 3RS7A 2FX3A 4IRUB 1KK3A 4PAOA 3L0SA 3VU9A 2P5SA 3NHBA 1OJLA 3CH5A 1KO5A 4LJ8A 2O8BA 2B6HA 4EJSC 3HYTA 2QPAA 3TUIC 3AVQA 4C7OB 2C9YA 1D6JA 3AKCA 2I3BA 1OB5A 3R8CA 2IWHA 4ITRC 3NWJA 2HF8A 3DOEA 4QJ3A 1E2MA 4ABYA 4TL7A 5DN6A 4FWHA 4V0LA 4URXR 4KSBA 1FTSA 1ANKA 4WA7A 4O3MA 4TYQA 5JJLA 2VYFA 3ZVLA 3MWLA 1OIVA 1E9CA 1G291 1XP8A 4BLOA 1E9AA 1RYFA 2C2HA 1DADA 4L9SA 1AQYA 2QSZA 2ERXA 3EARA 4B3GA 2CVFA 1NVXQ 4HB4A 2RGNA 3DVLA 4CT5A 1X8JA 1X8LA 1SVOA 2IBMA 2ZTSA 3GJ5A 4EQ6A 4Q1FA 4LV8B 1TMKA 4Z54A 4B2PA 2OO7A 2ZRHA 3WRXC 1VIYA 1ZIOA 4GZMA 3TJZA 3AVVA 3MMPA 1CKEA 2CDNA 3I3SR 3TR5A 3B9QA 2PMKA 4D6PA 2QG6A 4IOKA 1OH8A 4DLZA 1JAHA 5CK4A 4D4MA 1NY6A 3PV0A 3K9LA 3RLFA 4LYJA 4KO8A 3BAFA 4JLBA 2FSGA 4HDCA 4UNSA 3T1OA 2FSFA 2P3SA 3BORA 3RHFA 1DELA 1O87A 4Q4HB 2ORWA 2WM9B 4XSHA 5DIFA 3T1VA 4DEXA 4YQFA 1TL7C 4LGMA 4HAYA 2QAGB 1DAKA 2JJ8A 2WSSA 4C0BA 1PLLA 1DAEA 2CVHA 2G83A 3QKRB 1N6PA 2VL7A 4B6EA 4G0NA 1UBEA 4QGHA 2PL3A 4JBWA 4Q02A 1PV4A 2EYQA 1Z29A 2WWYA 1I4LD 4GMXA 1U0LA 3QKRA 2YYZA 3AVWA 1F2TA 2KSQA 1KAGA 1KYIA 1RRGA 2GK6A 1Z2CA 3I32A 4BZQA 1UBFA 4BLSA 1MO4A 4P32A 2HJVA 4OQNA 5FBVB 1P6XA 1P60A 2WMOB 2H8KA 4C0SA 3PUVA 3GLGB 1M74A 4A6PA 4HB0A 2XSZA 1E79A 4D4LA 3RABA 1YKSA 1NBME 2P6RA 2WJGA 2J7PA 2XZPA 3THWB 1IN5A 3A1WA 3LBIA 3BFXA 4OK3A 2O5VA 1KI4A 2GCOA 2O8DB 3L0OA 1GWNA 4HAUA 2AKAB 4RKFA 1TU3A 2ZS8A 4OI1A 2FFBA 4B43A 3SU8A 5JSZB 3OEEA 3PIRA 1X6VA 1QVAA 4JLKA 1N0VC 3HYRA 2WIAA 1TEXA 1Z6GA 5L3SB 5FBQB 1Z06A 3SOPA 1NNEA 2VSOA 2IYVA 5G3ZA 5G41A 3TUZC 1FX0B 3U3RA 2QN6A 2B92A 4IOMA 2XEXA 2ZE8A 5E7IA 3SZRA 3KXKA 2ZJYA 4PC3A 4MUAA 2EWVA 4Q21A 3X2SA 1ZNYA 4BFUA 1HYQA 1X1RA 3OF5A 3KL4A 3Q7QA 1U81A 5JS7A 4MGZR 2YVUA 4OI4A 3NBXX 2VH5R 1YHNA 3PEWA 3QXJA 2FH5B 3M4YA 4K8OA 2R6GA 2CL7X 4MRNA 3LWNA 3BERA 2VHJA
chains in the Genus database with same CATH superfamily
4BIIA 3EVTA 3TW0A 4KPEC 1MX0A 3C5WP 1V43A 3EF1A 3UQZA 3OKCA 2GO7A 2HO4A 1TO1E 4CM3A 2H00A 2XIJA 1ZZGA 4I55B 1GGHA 2A92A 4KU4A 3WDMA 4IUCS 1Z5BA 3MERA 3ILVA 2HRBA 3MK31 3AP1A 1DOHA 2OLKA 4IGIA 5CJPA 1SHJA 4DDWA 2BIFA 1UBGA 3CTWB 1J07A 2VRCA 4ZYTA 1L6RA 5BSFA 1GM5A 3R7DA 5C7LO 3BGDA 4GFDA 1MEEA 2N1BA 3NGMA 4LYHA 4ODIA 4IBEA 4DREA 4E22A 4B3CA 1HYBA 4MICA 4DA9A 4X64B 3FZYA 2VZ9A 5IXYA 1YS7A 1QNLA 4GLLA 4IVQA 2VEDA 2YOFA 3F47A 4X3OA 1MP0A 3RIXA 5EJEA 4QEZA 1ESMA 4LJRA 1Z2DA 3C1OA 2QD3A 3QYAA 1WPRA 3KZKA 1JXQA 4NJEB 4YDSA 3QUAA 1L4NA 3D7MA 4FC7A 1H6CA 1H5UA 4R2MA 3TR0A 3UB2A 4BX0A 4QT4A 2BTQA 1XEWX 5I7EA 2C94A 1IXRC 1P3JA 5IBQA 4OGGA 2V5VA 4AIIA 4BMPB 2LIVA 3OU6A 4P3YA 3C7DB 1LRLA 4FBMA 4Y2QA 3U1TA 2XKAA 5KOIA 2QQ0A 2FN4A 4TMKA 5D3ZA 3AYXB 1GPKA 2C1EA 1UP6A 4DLRA 1JIQA 3LKZA 1UKEA 4CF4A 4CKEB 4D4JA 1I80A 4CDNA 1WRBA 4Y7CA 3UEOA 2PD4A 2HMAA 1RMYA 5D6NA 5LVAA 3ONVA 1PZMA 4R5HA 4RVSA 2JP7A 1XDZA 2BD0A 2OC4A 4AN0A 3WNVA 3D3JA 5SV2A 3W8EA 2IEZA 1SVWA 3HY6A 4YIKA 1N34B 1C7JA 1KHTA 2WHRA 1O4VA 2IX3A 4RGBA 5IDVA 5BYJA 1QVVA 2IYAA 3FPSA 1RACA 4MQEB 1NNLA 4ZZ2A 3CZ4A 2O8NA 3DDOA 5D51S 3CE6A 3MB8A 4YJHB 1P29A 1K6EA 3G2NA 1HEIA 1S4QA 3ZH9B 2YWHA 5KO3A 3OT1B 4IJ6A 2F8TA 2UZ1A 5B57C 3PFIA 1H6UA 1C3VA 4HEA1 3FCOA 2PV7A 2ZAYA 3L7KA 2EG9A 3AVOA 4QYSA 2LHGA 2VF8A 1DTEA 5F2OA 3PUJA 2NVUB 3IO3A 3ANTA 1SUDA 3EXEB 3ZXSA 4A82A 4YR9A 5JDCA 5LDHA 2R8BA 3SHOA 4FXOA 3VVMA 3FLEA 3WGVA 1RQLA 5BWMA 4UAJA 4KR7A 4RD1A 1PJRA 4NARA 4OQEA 4FGLA 3HU2A 4PSCA 3FPFA 1PT9A 4HDQB 3MLBA 1DI0A 3VSCA 3IMEA 3QKWA 3KQUA 2HPVA 2QLJA 3KYCA 4MA0A 1UMCB 3CMMA 4WZAB 3GEIA 4M3NA 3IHPA 4QBFA 2IUSA 3OBIA 5BN5A 5JLJA 2P35A 4KGDA 3NRCA 4W1SA 3EW7A 4UTVA 4N5HX 4E21A 4GSKA 1R16A 3EF3A 3LCJA 4MVJI 4EATA 2FVXA 3E23A 3KYDB 3PCRB 4NU6A 4A0GA 2D5BA 3BIWA 2C7BA 3OETA 3H87A 4P81A 4QQNA 4BVEA 2J4CA 5D7BA 3OQHA 5LD2B 2XRFA 4ZQFA 1ATIA 1LRJA 3GLHE 1TZBA 1ZG3A 3DUWA 4PHTA 4HVCA 1DZIA 1YQ9A 3I2FA 4P8RA 5ESWA 5FQOA 3MOGA 3RWMB 3TL3A 3FBGA 4IDEA 2NSHA 5CXSA 3PHCA 1ZU4A 2BBOA 2EO2A 1JW9B 3QJ5A 3UT5B 2LV8A 5J5CA 3A4IA 1PNOA 3VK7A 2OM2A 3A9TA 1S2MA 4NDAA 3A1VA 2Z5VA 1B1AA 3AB8A 4HQNA 4TL6A 1RBZA 5AK0A 3KC2A 1EWKA 3KO8A 4P2BA 3F97A 2OYRA 4RANA 2IYWA 1A27A 2YUIA 3K9HA 3DOFA 3JQPA 3OWOA 3OX1A 3UKOA 9MHTA 5IUNC 2KB0A 4NP6A 3AILA 4RK4A 1NP6A 2Q4BA 3DWEX 5HIIA 4P53A 5COQA 1GPAA 2FWJA 4GRDA 5HQTA 4YMIA 1JR4A 1JEJA 3UXMA 1LWNA 4ZI2A 1SELA 3MBIA 4OJTA 1UOPA 821PA 1N2OA 4G5OA 3VVLA 1JLRA 5CNIA 4L6AA 3WLPA 4B47A 4CW7A 3ILKA 3OFSA 3NBMA 5ALUA 4OBWA 5KYKA 3J7AC 1SUWA 5E0KB 1CERA 3JATA 2FQWA 2R45A 2C7VA 1VXRA 1QONA 1W73A 1ADCA 1Y8QA 1YR3A 3B7PA 3R3VA 3C7KA 4H60A 3PXGA 4IP0A 4WBSA 1HL3A 4GOKA 1SURA 2Q3HA 1CWUA 4OFWA 3HEMA 4QFMA 4WERA 1P3QQ 2O2JA 1RJDA 4MYSA 3I12A 3O6VA 4MMXB 4OL0A 2J1LA 4ZDJA 3AM1A 1X1SA 4FMPA 4BNVA 1JQLB 2E4AA 3QVVA 1N77A 5F4ZA 2EAUA 3FOBA 1A1VA 2WJPA 3NBFA 3CO0S 2ECPA 2PQMA 1E1NA 2PLRA 3TCNA 1H05A 1MC8A 2BEVB 4GPIB 4EA7A 4HBGA 2I8AA 3D6TB 3O9MA 5KNBA 4L3WA 4R1NA 4MWBA 5LMCA 1TT5A 4E46A 2J5QA 4ZV7A 1CP3A 1LVHA 2CL0X 3UMFA 4ZZ3A 3WDLA 2WG0A 5AW1A 4KTTE 1U2SA 3O0DA 4QASA 2F17A 1OLSA 3SIWA 3WTCA 3GC6A 5K09A 1YDWA 2EJBA 3DTVB 4HWSA 5L6LB 3JD4A 3AUUA 1HTBA 1QK5A 2XIQA 3E1KA 5C4MA 4W4TA 1LI5A 5LZ5A 3H1BA 5IT0A 1XJQA 5T4HA 3FHTA 1DINA 1X7GA 2IQ5A 2JHGA 3ZE7A 1FMTA 1X7YB 2AEEA 2BR5A 1E1LA 3HTXA 3L05A 1DKRA 3S7ZA 2W6JD 1ABEA 4HOYA 3F6CA 4QDOA 2DJ5A 2WHYA 5LZ2A 1XCBA 1P9WA 4TTIA 5HG0A 4EKYA 2V7EA 1CVRA 1H6AA 1XXHA 2JF0A 2ZIFA 3B1WA 4OK6A 4X3PA 4C0LA 4ZYYA 5GADl 3FCXA 2C0CA 2C3UA 3ZKWA 2BISA 3U9TA 1KYWA 2X8BA 3B5IA 3WC4A 3ETLA 2DU8A 2W00A 1J1IA 2X1MA 1Y5IA 3EXAA 4MQFA 4UE6A 4BQIA 4YVFA 5K8CA 5EJAA 3SBEA 4MYRA 3MS2A 1XJWA 1F2DA 2DPGA 2C5HA 2NSJA 2DH5A 3HJQA 4D9MA 1SU8A 3L18A 2HCRA 3D8UA 3N3AC 1NVDA 5GGXA 4P3KA 4FNAA 3P9IA 4ZIRA 1OX6A 5ESXA 1BXGB 3EQ2A 3PUHA 2I2WA 3E03A 1IJBA 2JFZA 1E1QD 1FFDA 3L7IA 4J6FA 5I7SA 3K1JA 1C7QA 1RWWA 3T4UA 3T3EA 1G71A 5TC4A 1GDDA 4K2HA 2Y1DA 2P7HA 2IUTA 3ZK9A 5IH7A 1RXWA 3JAKA 3G5MA 4RXUA 2NV0A 5EZYB 2JZNA 3AUKA 2L09A 3HUTA 3KM0A 2BGUA 5FOQA 1G8JA 5ITYA 1JHAA 5LC1A 3SNHA 1VM6A 4F1WA 1UKCA 3R6GA 4D7AA 2WM2A 2L7IA 3DFZA 2P2GA 3H1TA 2D06A 3FI0A 4GYYA 3ZY2A 1ZW6A 4ZOAA 5JANA 4BP3A 4EIWA 2G8NA 1O54A 1V35A 3CLUD 4FJ1A 3U26A 3ZBUA 1AU9A 3GLIA 1DAOA 3DEYX 1Q02A 3KCNA 4UBJA 3HCWA 2PXAA 4PONA 4UNIA 5DI9A 4JA2A 1ZLXA 1HLGA 5JROA 3C5HA 1KH1A 4MUJA 3ZDEA 1DC5A 1EIZA 3MS7A 4MUKA 1PYGA 1AGPA 1ECPA 1XVIA 1P5RA 5TPWA 1NHGC 2DKLA 5KI6A 3A6DA 2OKGA 4OGFA 3PRKE 2JVIA 2VT2A 1J99A 3FDZA 3QMPA 4GECA 3ZWAA 2IYSA 3FOFC 1YFJA 1SXHA 3V8MA 3PQDA 3ZV7A 3QWFA 5BSHA 2H65A 3LBAA 3OIUA 4LN1A 3UB3A 2WYOA 4D42A 5I6DA 1F48A 4ZT2A 4DIEA 4OLBA 2FFAA 3V42A 2WF9A 1E8MA 1JP7A 2FG5A 3A28A 5D2CA 2C84A 4OY3A 3TLZA 1JLHA 4MV0A 5G0SA 2HL7A 2GCEA 2WBLC 5BOSB 3PYLA 4YP0A 2XFSA 2CXUA 2N75A 1ULBA 5T4FA 3K9WA 3TL6A 1DGFA 4MZXA 4ZANA 5LXTA 4PO1A 4LG2A 1XPJA 3MAGA 2AC7A 1YS2X 4Q1VA 3R5JA 2LW7A 2O3UA 3LECA 4GR4A 5DYTA 4E4RA 4UOZA 2I22A 3WIDA 1QU2A 4MVJG 5ALFA 2X6RA 2AUMA 4ZODA 1VPWA 4JUIA 4OX9M 1WTCA 5FYDA 1OSNA 1CS0B 2BWJA 4PDIA 2GLXA 4ZT7A 4JSYA 2HO5A 2IZ1A 1ES9A 2NVUA 1D9ZA 3N2YA 4IIJB 3ZTWA 4BB0A 1G3RA 1J2TA 2I4LA 2DLDA 3OPVA 3CX7A 2PWZA 1IJKA 1KYQA 4Q7JA 3HRHA 1CBUA 2BGMA 2AFIB 2XYVA 4HHEA 2IV2X 1YU6A 5IEJA 5I7OA 2E0IA 2GKSA 1TK3A 5U9CA 4M7PA 3PGVA 3ZD6A 3DDWA 1MT0A 4JYMA 2B8EA 2VRCD 2UVPA 4KK3A 1NFRA 4ZA2A 1RTKA 2ZRMA 2WIFA 1PJBA 3QPVA 4ZAGA 1N9KA 3EEBA 1CNFA 3RUHA 3ER8A 1RC0A 3GCWA 4LF4M 2FE8A 1MX3A 4GYKA 3FDIA 4IGFA 1V5IA 1D2GA 3R5XA 4QARA 4S24A 1J70A 2V5UA 4RJIA 5HTKA 4BO3A 3SC3A 4LY9A 4F46A 2PT5A 4KAXA 2YR0A 4QBHA 5AVQA 4DV7B 4D9IA 1E9DA 2GK3A 3QU4A 3KVOA 2JD1A 1E2PA 2CEAA 4DV4M 4S05A 2D62A 1KXJA 1GZ7A 4RV4A 3MAJA 4XFDA 1TFUA 3REFA 3P26A 5TIIA 1UZNA 1EP1B 3PSAA 5DO9A 4AYWA 1JR6A 3UGKA 4G8DA 3ZGNA 5AFSA 4YCNA 4J0EA 1ECJA 4L3OA 4YBZA 3O26A 3LRTA 2VPIA 4LJYA 3OPYB 3V4PB 2TMDA 2QTAA 3KZCA 4YJ3F 5JECA 4A8JA 1Q83A 4G01B 2AXQA 3EPRA 4RE6A 5CX1A 4RTRA 3HM9A 2DHDA 4NJEA 4W7SA 4WZBB 1XI2A 5D86A 3RUIA 5E6RB 1EM8B 3AF6A 2AKEA 3QVSA 3NIFB 1LPOA 3NOOA 1X94A 4PQFA 1ZC3A 2H1WA 2PVSA 3ZZ0A 3PHJA 2APJA 1U28A 2P4SA 5L7WA 3JQEA 2I0FA 1NZFA 4YXFA 1Y4SA 1AT1A 4UARA 3UMGA 1DIGA 1VEJA 3H0KA 4X00A 3S2YA 1CUIA 2ERCA 4JI2B 2WP8J 3FPCA 2OUIA 3OCJA 3ETGA 1M10A 3C16C 4HNAB 1SUBA 4CNQA 5JSUA 3H3JA 3PFCA 3R9XB 2PGDA 3F9IA 3K71B 3FD8A 2B5OA 2VNIA 1N2CE 5G1OA 4WX2B 4EYKA 1TM5E 4N0DA 3U3JA 4JI1M 1SK9A 1W48A 4JVLA 1ZX1A 3TQIA 2FGJA 2O8CA 5DHRA 2YS6A 1N6OA 4M8LA 1WG8A 5M04A 5DFLA 1EYZA 1WXEA 2R1UA 4HPJB 4HQFA 4A2QA 4DLUA 4YCLA 4HMOA 3Q3HA 3S70A 3I72A 1FLDA 4FSHA 5L4LA 4TWJA 4BFWA 1GTSA 3ELBA 3N0TA 4GBJA 4BVKA 4ZIRB 1Z8HA 4TMWA 5AMXA 4W5OA 4H59A 4IZ6A 1EVLA 4BWGA 4WNAB 2GD1O 3S4YA 4CU5A 5A5DA 1I7QB 1NULA 3H13A 3CJTA 4ONEA 3RIHA 2EFCB 2GPAA 2GEFA 4HGQA 4AJKA 2E4YA 2VHQA 1Q0TA 4ZKEA 3GY0A 3LFUA 1YVUA 2XUOA 2ZDHA 4FMDB 4L9AA 4UMEA 5TS3A 2ZYUX 1YMUA 3WAKA 3IBTA 1K7CA 5EIAA 4N0MA 3ZXIA 1JE1A 1JEYB 2ZYGA 2ZUWA 1ZBDA 5IANA 2MCFA 3FFBA 4B74A 4BFVA 1FC0A 4GPD1 2V1UA 1KMMA 4O1HA 5AHKA 5LZ7A 3W5JA 2Q1SA 3RGGA 4DUZM 1PR5A 3GFSA 3MQ4A 4L51A 4WZZA 5EAIA 4OOEA 4IBCA 4YAKA 3IECA 4LSGA 4MINA 3FUWA 2BN4A 4TXMA 4LDAA 2JGEA 1HQCA 3OP4A 1OT3A 3UFXB 3FFXA 2Q28A 1JVBA 1K6JA 1OYYA 5H9WA 3JZDA 4MYHA 4Q48A 3URMA 1XNRM 2AUTA 4QJBA 3WLKX 5HM6A 5JI3E 4JT2A 1MC1A 1N2JA 4R8RA 5FNZA 1W85A 2WJIA 3F46A 3HVRA 3V4OA 5AH0A 4G37A 2IXFA 2GVNA 3DPUA 3QEMB 2OMKA 1J8QA 2V65A 1AKMA 1AURA 1E9SA 3A36A 3LQYA 4MAMA 1CETA 4M36A 2FSHA 5K6AC 4MCIA 3UJBA 2ZYSA 1VTKA 3Q8KA 4LZJA 3OLQA 3FOAA 3R6WA 5C35A 1MJGA 3FB1A 3CUUA 4XCQA 2LVOC 1Q0LA 3WLFA 3U3ZA 2NAPA 4DXAA 3HCFA 3FGZA 3KS9A 1QIEA 2CNDA 5DGIA 2A59A 2FKNA 5DNVA 4DA7A 3NZEA 3GLGA 2ZROA 3ZDYB 2GYVA 2RIRA 4NAVA 2HW8A 4BNXA 1JHOA 1J2JA 1E3WB 1Z39A 3IEVA 1T8UA 1I3CA 1SKMA 1N32B 2NM0A 1OV6A 2FQXA 2NPIA 3KKZA 1TRHA 3C4JA 2PJZA 1GCAA 4B83A 3OTQA 4CNBA 1ELOA 4R9SA 1XROA 3WIUA 4FYIA 3SYMA 4XVHA 4UTPA 4ZVPA 4F2LA 3VI4B 3M6UA 3ZE1B 1XALA 2GF0A 3DE5X 4U3JA 4RYLA 3SEQA 3HDQA 2O19A 4FB4A 3EY4A 1DDGA 1WZEA 3KDPA 5H3LA 4E0BA 4U7DA 1DKPA 2YN0A 4NFLA 3HNRA 1PDVA 3RHSA 2YJ3A 5JQGB 4ZOLB 2YWGA 4Q19A 1E3TA 4V2IA 5EWMB 5ERXA 3C6KA 1Q1EA 3Q40A 3TLAA 2PWYA 1P0IA 2O50A 3I5AA 2GR9A 3FVQA 4MROA 4PLVA 4A1FA 2PX4A 3K9GA 4F2WA 2CL6X 1JHXA 4TVKA 4U63A 3E58A 3B82A 2V9ZA 4WCDA 4C4SA 3L8HA 2GHQA 2FE1A 3QBVA 4YPFA 2C7GA 1U8ZA 1BEZA 3VMMA 2O54A 3D0KA 4I2NA 1E9FA 3BKWA 1JSCA 3LDFA 3D4IA 1UFQA 3QOYA 4JC4A 5F78A 2GQ0A 1SVUA 3IOCA 2WIKA 1L4UA 1NYLA 2JFFA 1A50B 1H0KA 2QVXX 2X0KA 4EA9A 2KX7A 1BA2A 2FLWA 4JXXA 1N7GA 4QTTB 2NZVG 3GT7A 1QORA 4ZAZA 3LX8A 2IIQA 4LE0A 4CN8A 4F38A 3LYUA 4FB5A 4B7UA 3NHYA 3OM8A 1SG0A 3LT0A 1LI7A 4FOOA 2ZATA 1VBKA 3HMKA 3WBBA 3UPTA 3RSGA 1IY0A 1J2RA 1D1TA 2RARA 1PGOA 3GLQA 3QVXA 4I5EA 3ZWPA 1MNQA 2AOVA 2G7ZA 3QFFA 2ZUBA 4C2BA 1EWTA 1UJCA 4ND7A 4CCYA 2I2AA 4DNPA 5C53B 2FTKE 2ZYIA 3CRVA 3HVHA 4Y98A 4BE4A 4PHCA 3VZPA 3K1TA 4TV8B 2FDXA 4M7RA 4CTNA 2W8BB 5LLDA 1A7KA 3NNNA 4E3ZA 5I7FA 1LNSA 4ZXPA 1RC1A 3CLRC 4HSEA 1E1QA 1J0XO 2PVPA 1EJBA 1GO2A 3AJEA 1Z5CA 3BIFA 1BHSA 4FDVA 4MUBA 2J9XB 5D85A 3EIHA 3S2FA 2GFIA 2QTVA 4F2HA 1XVUA 4OM7A 3BHJA 5BV7A 1UDXA 1YD7A 3H1AA 2AOUA 5CJ2A 3KQOA 1VCIA 2CCJA 2OBBA 1W0KD 2H1IA 1R5NA 1KGSA 3RYHB 2VWHA 4E14A 2RDMA 3O2QB 4RTNA 1UPTA 3L7DA 2UKDA 3ZGLA 1IHYA 3IILA 1ZJZA 2L69A 3IUJA 3R6DA 3AKYA 1K3UB 1OAAA 1XNQM 4G5HA 2FEKA 2ZTUA 3QEMA 4L8LA 1CJKC 3HHEA 3ITNA 4Q1DA 4F4DA 2HRQA 1JQ5A 3EF0A 5AWFC 5ED4A 1O58A 2DWZB 4DNFA 3TDNA 1ENOA 2QMOA 1ZUHA 4OG2A 1JQJC 3ZJ5A 5KSPA 4ZRDA 2VXYA 1HFKA 1JVNA 2ODTX 3CJQA 4GOLD 3VDMA 2HKJA 3PQ3A 3QVTA 2GN1A 5I8PA 1ZN7A 3TQSA 4BLUA 2W6OA 2XJ9A 3QQ5A 5BP7A 4HUJA 5FTMA 2XTNA 3D3QA 4IIGA 3ZQKA 3IEUA 2X4DA 2DCUA 3KHSA 3LY9A 4ZK6A 2HA2A 2XXAB 4UQPA 4OBXA 1E89A 2QTRA 2JASA 1E58A 5EJFA 1Z0JA 2B4YA 4NSRA 2IS2A 1KI3A 2A5JA 2OV4A 3GFTA 4DA0A 3LBNA 5K8IA 4MS4B 2R0QC 1SKQA 1WA5A 3L5KA 3NNSA 2C54A 4H4CA 4MW1A 4YDRA 3ZW9A 5DM60 2QVBA 4FN4A 1QO9A 4RSHA 1HDYA 2NZYA 1OLUB 1ZN9A 1U2TA 2ZP1A 4WNAA 2H92A 2WB4A 1LJLA 5FLEX 3S99A 4ES6A 1TJPB 2ZRBA 5A3RA 1U7ZA 1VDDA 3KOZE 1N3IA 3E3NA 5FKJA 4LF9B 3D2LA 1L8QA 3OJFA 3TNFA 1U3DA 1UBRS 3OIDA 3IP6A 3ZCTA 2WJHA 4GMDA 4N3AA 1BCSB 4EHJA 2XB2A 5E2AA 3HCBA 2H4YA 1HRKA 1FRVA 1NT2A 4NEQA 1QP7A 2WJYA 1Y8QB 2JIBA 4L0DA 1O5OA 4JQZA 3U7RA 5C9ZA 3ROMA 3VKGA 4ZQGA 1TLLA 1EB8A 2VDWA 1DWQA 2NUBA 3AR6A 3GGGA 3Q3CA 3O03A 1D6NA 4C78A 1IMJA 2NZUG 2XSZD 2NVBA 2YJ5A 1K3XA 1TIBA 4ZEMA 1SD5A 4NOLA 1C9MA 1MNAA 3OWXA 4HNAA 3CX6A 4LYYA 3O4HA 3L7YA 4LXUA 3ZPXA 1OLXB 4AJHA 2R96A 3EH1A 4PC1A 4U7TB 2UXDM 5KQGA 2X76A 1XTZA 1PJCA 3I9LA 1ZH8A 1JDNA 1VJRA 1D6SA 1EAYA 3OJCA 4FS3A 4U7FA 1FVHA 4LZWA 2YHIA 5E6RA 4N5MA 3ZWKA 1JPJA 4A92A 3C0KA 1MX1A 3FR8A 5CM9C 4YFYA 2HQOA 1RWNA 1FFGA 2FW0A 4RHTA 4C7XA 2SECE 1OI7A 3CC8A 5F3WB 3Q12A 1M5RA 2X8LA 1KZGB 5DTIA 3RBXA 5FBKA 5KYYB 1CJMA 3I4FA 1GGKA 1UKYA 3D6NB 3NLLA 4DNXA 1IYZA 1RP1A 1XOIA 4O4JA 2DHRA 2OORA 3A6FA 3IALA 2OZLB 4EP1A 1ICEA 2BFCB 2G71A 3GF4A 3P4YA 2L4FA 4IGEA 2NVWA 3BWDD 3TM5A 1JIVA 1FVFA 1YQEA 3KYDA 3PNOA 3Q88A 2XMPA 3DKVA 2WWGA 3O21A 4I5GA 5ALHA 3WRVA 2BGLA 1DO0A 1WWKA 4G23A 5I4IA 1RYEA 2ZI5A 1QH8A 4GOOD 5C8ZA 4HGPA 1J4AA 1Y1QA 1M67A 3MUFA 1IM2A 4ZI5A 2P6OA 2EG5A 2JJ1A 4RXMA 2J41A 3E9DA 3VPAA 2LH0A 3OPNA 2OD9A 3KOXA 3KXIA 5J2TA 3OC6A 4ZU3A 1NP7A 2JLZA 4HWOA 2YN2A 3B5EA 2JGJA 5F64A 1FW6A 4MGIR 1JAZA 2GMWA 3SYTA 4BBZA 1N2CB 1J0AA 2DE0X 1GVHA 2NZJA 3DBHA 5T5QA 4P4UA 2WB2A 1KAMA 1MH9A 4CMCA 1VIMA 3AQ4A 5EIXA 1K8RA 2O9JA 2RFLA 1UK6A 1Q77A 2IHJA 4IFTA 2DKFA 2W2TA 3PYMA 5ICFA 1WDTA 4CT0A 5A5GA 2OOKA 1NUPA 1O4WA 3AV3A 4I9GA 4TS3A 1KZHA 5DXFA 2Z5FA 3ZVRA 1SVSA 5G0TA 4C05A 4P7FA 2AR9A 3LMKA 4I3HA 2X5KO 3U5TA 2VJKA 3PQ8A 3H05A 4OSPA 4PR0A 4INZA 3LUKA 4K6CA 2G1KA 4KR3A 1QYXA 2KNVA 4YQEA 3F9RA 4BHTA 2I7PA 5JCPA 3Q8LA 1EXDA 1Z0SA 1X1CA 2JFBA 4B7FA 1T1JA 1VLZA 1ZIXA 2AMVA 2PRZA 4Q4AB 1KA9H 4LZAA 1C7ZA 4RXTA 3SZMA 3RVBA 4DC0A 3C3BA 2WPDA 1USWA 2ZUVA 2EFGA 2V7WA 1R0ZA 1KZ7B 1PZEA 1Y34E 2BGWA 4RENA 1GHTA 2GASA 4UPVA 1AUXA 4DR3M 5JEEA 2NUTA 2ZIUB 3LRPA 3QVLA 4ZCLA 5IX8A 3SFTA 2IH2A 1WU8A 2SCUA 5BN1A 3DL4A 4MGKR 2DBQA 1CUJA 3OQJA 2FRVA 3RIGA 1U0OC 2ACEA 3AHHA 2CB9A 4IIEA 1PT7A 1GIAA 4Y9UA 1T2UA 2EDCA 4XUCA 4Y2XA 2ZXEA 3KKQA 4OQZA 5H7XA 3W6OA 2ORVA 1QGED 1J09A 2UXCM 5JAMA 2QJTA 4MHSA 4JI0B 4X8HA 3RIYA 4LMAA 1YOVA 4ZT6A 4AJPA 1IHUA 4JKOA 4LRXA 5E4TA 4JYCA 5THXA 5BR7A 4BBJA 2UUPA 3ZGXA 4ENUA 3VNQA 2XNJA 1PDWA 1YE8A 2AFIE 4RPGA 1E99A 4GBMA 4WN3A 4DV0B 1MABA 1TD1A 1XU7A 3DGFC 5KQMA 4UXJA 1SKAA 4CCAA 2Y0PA 1GL9B 5TS2A 4BFTA 2FJPA 4GVXA 4LMRA 3UT6A 1PG2A 4YJFA 4MI3A 1C9JA 2FEMA 5DTQA 1AHNA 1EB9A 3U39A 1RCUA 2DYKA 1A7AA 2Q4RA 3HR4A 1D2EA 1LLCA 1W5AA 1JHQA 4V3CA 5LWHA 3BGWA 1RXYA 2DLCX 1NA5A 1C4KA 4XKJA 2GCNA 3LQFA 1TDZA 1DPGA 1E5VA 2QNIA 5JZOA 1A3CA 4J6EA 4RMHA 1RD4A 2WMNB 2FPGA 3NDJA 3NTLA 5EZSA 3VJLA 3HACA 1WHSA 3LD9A 3PR2B 5DHSA 3EA5A 3EG9A 5HUQA 1IOLA 3G9TA 4X64M 1HKUA 5DFAA 4K9PA 1ICIA 4PLWA 4TV9F 3MCTA 2P68A 4BFSA 1F4LA 3BQ9A 3EC7A 4Z9YA 2EBFX 4YPVA 1W1WA 2HDOA 1T2CA 4GGMX 2CSXA 4O8ZA 4RVGA 5BR8B 4AX4A 1TAQA 5EP2A 5JBIA 3AUAA 1X92A 4JCCA 1TUEA 3BMQA 4MJ3A 2DVMA 4PPNA 4HTFB 2VNKA 3C98A 1VB5A 4IX9A 8ATCA 1N8KA 4KNWA 3VISA 1SXGA 1UJ6A 1EE9A 5CITA 4FOSA 5KYVA 5B4UA 1ZAYA 2O20A 1L4GA 1CNMA 1HURA 2OBMA 3DE0X 4XEUA 4F93B 1N3BA 1Z6PA 1W5FA 3NPAA 4QEDA 5DOZA 5A4KA 1Y89A 1CY6A 2C95A 2P2SA 3SNKA 1FX0A 2IF2A 3TXYA 3PSHA 3SCZA 4QQRA 2ATXA 3G79A 1TAHA 4DPKA 1TMOA 3C45A 3QUQA 4GX5A 4JENA 1O6ZA 3KU4A 4BNNA 1BW9B 4CIYA 4MUEA 4B6PA 5AOBA 1Y3AA 2D5LA 3F96A 4UE3S 4RSMA 3GUZA 4E5VA 1GGFA 1GY8A 4FE7A 4HO1X 3E9ZA 1Z08A 2WU8A 4HH3C 5JMWA 1U8XX 3OO0A 4Y2RA 5A4MS 3C7AA 3DBLB 2PDAA 4EM6A 1JSRA 1KVTA 2A3NA 4TTPA 2H57A 1UZLA 3G59A 1SKBA 2QTWB 4QYIA 1POXA 1ONNA 3FXAA 4FFOA 1L7QA 3L0PA 3HZZA 4UEJA 1RBYA 4RMJA 1IXSA 3D8TA 3VR6A 1T15A 2WTAA 3IELA 1MOZA 3RBVA 1GSHA 4RPKA 2I71A 3ACBA 4CQNA 2JGAA 3E1SA 3FE2A 1FMLA 1PR9A 4JB2A 3SAJA 2OORC 1QX4A 1N9GB 2X4LA 2QLNA 5FEUA 2DBZA 4IVRA 4I4TB 4EMBA 4KO4S 5HF9A 1XN1A 2BKUA 4PSAA 4DZZA 4NMXB 4ZHQF 3I6QA 1C41A 5A9TA 4U0KA 4JBLA 2YHIB 3ETNA 3MJSA 2QL7A 4X85A 2D6FA 3FBTA 3D9QX 4JOBA 4YQZA 3DEFA 4DAEA 4RF1A 3DM9B 2O2HA 1O95D 4X1IA 4YJ2B 4UHHA 2Q3BA 3SZLA 1EVZA 1MQ8B 1VKJA 2QDXA 3PNQA 1BX3A 3T3IA 4AUNA 1YMVA 2YFYA 3RFFA 4JEIA 1CR4A 3UAVA 3UG7A 5BR8M 1MORA 1TU0A 3WGNA 2GERA 1TMGE 5DTJA 4C6RA 2HADA 3JWJA 3K7EA 5JXJA 4AF7A 3CZQA 4Q18A 3NRJA 4X24A 1HT2E 1YV9A 2CBGA 4QO8A 1JTFA 3KSDO 3DVRX 4PYNA 1B2LA 2G76A 4YTEA 3VO9A 1Y8CA 2ATIA 2PBZA 4ZAYA 1HNWB 4U6QA 2R7MA 1RLIA 5IZCA 1KOFA 2PKQP 1NOJA 4H3VA 1MJ5A 4WBNF 1FP1D 3BILA 3EPHA 3EMDA 3OZAA 3BA1A 3N0XA 2IYLD 4V0MA 4BUCA 1NXOA 3U60B 1CY1A 1GL3A 3PVSA 1ZMRA 2Q6LA 3CWZA 3FLAA 3OOSA 4JVMA 4ZVSA 1KWKA 2GJ8A 1XQ1A 2A7QA 2GBIA 3EW9A 1R74A 4KWEA 5A3JA 2AHOA 1HQKA 2Q62A 3SATA 3TIVA 1VSTA 4I2VA 5ALSA 4QULA 2NOAA 2J31A 3OECA 2OYCA 2X6QA 3RKSA 4GQAA 2ONJA 4BKOA 2DSTA 1USKA 2RRUA 1A76A 3IAXA 3W68A 4QO7A 4QPCA 5JD3A 3I4LA 4G6ZA 2XCRB 5CH3A 3QU9A 4YUVA 3THSA 2CMKA 4MEAA 1ADGA 3KV3O 3R8XA 1Y9AA 4C7JA 4CL2A 3NETA 1IQPA 2BJHA 4OU4A 2C1ZA 2EWWA 3MWJA 3ZCPA 2REQA 1PZHA 5F5XA 1KMIY 3QPDA 1RE0A 1MC5A 3Q7PA 4ZKDA 4HAIA 3LQRA 3ESBA 3TCKA 1FRNA 3M0EA 2JJ2A 1HE5A 1TUBA 3AUFA 3CX4A 1BDMA 4IMIB 4X1OA 1MH1A 1DS6A 2G5TA 1YUMA 1CQIA 2NNLD 5GM2A 5EJMA 4UQOA 4BMDA 3O8NA 4YRBA 5JYDA 1IHDA 2FRXA 2HU2A 4LWQA 4GL2A 4K9LA 3NC0C 2B9EA 2C2WA 3G2QA 2IKSA 2YH2A 2GZ3A 3RFCA 5KVCA 5JH7B 2FSUA 2ZSEA 1KOLA 1XPOA 1H1LA 1IZYA 3UY4A 4NXMB 3Q2IA 4YRFA 1ZISA 2CZGA 2YV2A 1QP8A 3IAM1 1CZHA 3ZVKA 3PZRA 4Z0HO 4NCJA 3RTBA 4IJUA 3C7TA 4DM7A 4QEKA 1VLLA 1QWOA 4U8HA 1Q11A 2Z7JA 5JSKA 5ALRA 2B0CA 3TQRA 4I1PA 4KWHA 1RRMA 5E3JA 5I7RA 5FL7A 3SICE 1L2BA 4BX8A 2QE7A 5JV5A 1DP4A 2I34A 2WSEF 2BHSA 4G3XA 1D7OA 4Q1CA 1OMOA 2NYAA 1M2KA 3RGWS 3SEZA 5K6TA 4Z4GA 1Z5PA 4C6TA 4XVCA 1B0PA 1X39A 2B7BA 1YVEI 1A9XA 3ZVNA 1EGVB 3CW8X 3SYKA 1YUBA 2I3DA 3HWX1 3NUQA 4N6GA 4HLQA 1VC2A 3X0DA 5BR4A 5EE5B 1VYTA 4WW0A 2XR1A 5IC4A 2X13A 4TRMA 1CUSA 3S1SA 2YHSA 1KBQA 4X6LA 3JQGB 1WU7A 4K9NA 5C5DA 2R87A 3GPDG 1ZI9A 3OFND 1P1JA 3IAUA 4XLLA 5TX7A 3AKEA 3SHWA 1N0HA 4AS3A 1I2BA 2JDID 3CLTC 3T9CA 3RK1A 2OBXA 1ONOA 1NIPA 3LQ2A 1GUZA 2OBLA 3H2GA 2ZRLA 2XZTA 2YZ7A 2RCNA 4PPFA 2B8JA 3RR2A 3UGQA 5BOVA 4F6CA 3ICEA 3PWSA 1Z4JA 1B15A 2GKGA 3K9QO 4TLEA 4OBEA 2FPUA 5K05A 3RE1A 5KO2A 2RGNC 4GZ5A 2Q9BA 4KHZA 5FPPA 4HDMB 1ZMTA 3GOHA 4DKJA 1TQ2A 3EXG2 1EK0A 5BN3A 1KP2A 4FR2A 3MTBA 4XQEA 1C7EA 5GMOA 1I6MA 4DG9A 3QWLA 3INGA 3JQBC 3BRQA 3G8CA 3KQQA 3OIGA 4PE5B 1C50A 4AJOA 4RZUA 1C2YA 2FPPB 3D1JA 3J80A 1IJFA 2W93A 3AETA 4GITA 2HLDA 2WIGA 1BTOA 4IFEA 4S1WA 3VDNB 4HXYA 3FNQA 2CRUA 1J24A 4OGLA 1OI3A 4XB1A 4FOPA 1FJHA 1H8HA 2QBYA 1S02A 3T06B 4XTCS 4U3JB 4E32A 3UVEA 1UDBA 1USIA 2XXJA 1JE0A 4JGBA 3LUCA 2WICA 3LW7A 1WMAA 2YYSA 4GI7A 3SIPA 4I9FA 4W63A 5BQFA 5KWSA 5CTJA 4H7KA 2X9QA 2HSDA 5K3EA 2H1SA 1R6TA 3NW9A 4RJLA 2AK2A 4CMGA 4HWKA 4JUFA 4O33A 1F8XA 3W5AA 2CHFA 2WSMA 3IUMA 4MR9A 1FQWA 4D9CA 1XD8A 3JASA 3UYLA 4AXBA 3V4RA 3NAMA 4B6OA 3O1JC 2R4JA 3ER6A 4P84A 2A14A 4DIKA 1RJWA 5ALYA 3AR2A 4RVCA 1YL6A 3RYTC 3V8PA 2WWRA 1VE6A 3DH0A 1IN7A 1MENA 2JIZD 3NEYA 4US1R 1O89A 3R6TA 2ID7A 3RTAA 1MPXA 5ALMA 2Y0DA 1Z47A 1E1RA 1E6UA 1PJLA 1PSWA 1W85B 4Y2VA 4Y9SA 2IU4A 3FHLA 2CD9A 1FDVA 3EGDB 3EGDA 1BW9A 2Q7XA 2R4UA 3FGPA 4RKRA 3AHIA 1TR8A 1VG8A 3FIJA 3SSAA 5KNBH 1I94M 1PQYA 2II6A 2QIPA 4CEHA 5CBPB 3ZEAA 3PUIA 1VHQA 4UUBA 2NYUA 3SEAA 4IBIA 2P9QA 3ERCA 4L78A 1CR0A 2GPTA 2RHDA 4FOLA 3SOZA 2GN6A 3T5AA 2LDBA 2WJAA 2Q5QA 2R751 2CXOA 2DHYA 1SCBA 1V5EA 2VDVE 2Z8ZA 2X9VA 5L3RA 1SXQA 5I8WA 3H6KA 1QZMA 4GKJM 2JATA 1NWCA 2I4TA 4RCVA 3VGJA 4BUJA 1BS1A 4ISBA 2E48A 4FWTA 3KB8A 4L4RA 3SJZA 5DK4A 3C5VA 1P5JA 2FUEA 2J4DA 4UHJA 2WZDA 4RFLA 2XE4A