4LJ6A

Clpb nbd2 from t. thermophilus in complex with amppcp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj6A01
2QZ4A 1DPFA 2W6JD 1G8HA 3U44B 2KJQA 3NTUA 4LSGA 4D82A 1XJQA 1XXHA 2B21A 4KLZA 3SJCA 1NVWQ 1XZQA 3DPUA 2VEDA 4PZYA 3DL0A 5EUQB 2WV9A 2VLIA 5F3WB 4B35A 3Q3JB 4R7ZA 1VPLA 4JT4A 4G5SA 4DT1B 2F1HA 4IW3B 5A5GA 4L9WA 4PSAA 2VP4A 1VDZA 1Q3HA 5DI3B 3ZVRA 4UKDA 4QOSA 4A8JC 2BIFA 3MLEA 2XOKD 2NZJA 3WNDA 4W9MC 1E98A 1KJWA 5FPKA 1PLLA 3ZD6A 5J4VA 3G5UA 5FTKA 1FZQA 1G5RA 1EWQA 4Q02A 3VAAA 3PJRA 5FFMA 1CR1A 2XSZD 1WB9A 1SXJA 1KZGB 2ZU0C 3QXSA 5DN6A 3TUZC 5FBRB 4W5JA 1Q1EA 1ETUA 2ZROA 1KNXA 2C77A 3OFNA 3U3JA 1E2NA 1VECA 3IHWA 3IO3A 3WYFA 1CEEA 2EW1A 4EPVA 4LJAA 1NSTA 1GAJA 5GJCA 1KSFX 2CXXA 4D6PA 1VCIA 4IOJA 2CJWB 4KLNA 3T34A 3CX6A 3A6PC 1RZ3A 3MJHA 3GEIA 4MKFA 4AG5A 1RIFA 2H7VA 4XVRA 4AC9A 3HPQA 3OAAA 2F1RA 4EFMA 2OG2A 3EWSA 1ZRHA 1ESNA 3TK1A 2QAGA 4BGDA 3WMEA 3OEED 2ZU6A 1EWRA 3LWNA 2UZ3A 3KKNA 2D74A 5L8VA 4WXPA 4DBLC 5SZJA 3HU2A 3W3ZB 5KOYA 4RCYA 3VU9A 1G8FA 4XJXA 2QT1A 3IIMA 3OEHA 1BH2A 5E7IA 4D2IA 4XD7D 1MO4A 2HLDA 1E1QA 3R8FA 3UANA 4JSTA 1OSNA 2IEZA 3IQWA 4DXAA 2O5VA 4HYYA 4HDCA 1E9RA 1I4TD 2RGNA 4R9UC 5C4GB 1L4YA 1NMZA 4Z1MD 1DAMA 3C5CA 5HKKD 2GXUA 3OE7D 1GWNA 3ND9A 2DR3A 2GZHA 4HB2A 1WP9A 1SXJE 4EJSA 1E1RA 4BLTA 1XPRA 3BFXA 1T9HA 4GRAA 1CF4A 1MKYA 4P4SA 1DOAA 4PC3A 5DHAA 5UKDA 1ZD1A 4NYMQ 3ZVMA 1QBKC 1FQKA 3CRMA 4PHHA 1GSIA 5L3SB 1M7GA 3X1XA 3PEUA 1ZYUA 2GRJA 2GVDC 3WMFA 3U4QB 2GXAA 4A9AA 1OFHA 1ELOA 4JYCA 4P4TA 1XP8A 1ZJ6A 1DVRA 3U7EB 1J90A 2FSIA 1II9A 3E5HA 4PR0A 3T5GA 4AD8A 1EK0A 4X8OA 1NSFA 4WA7A 4DSOA 5ELXA 1OH6A 3I61A 4LJ4A 1XU4A 1ZM3A 3SYLA 2I1VB 4BFSA 1JB1A 1Q21A 1R5BA 1NL3A 4B32A 2ZRIA 1GFIA 1UKZA 3AF1A 2ZXUA 4DEXA 3TAUA 4B74A 2PCLA 3ZH9B 3FMPB 1GKUB 3E2IA 1T5LA 1NBMA 5IRCD 3QJYA 3S1AB 4C2TA 4D81A 1E2DA 1Z3IX 3LA6A 4WZAE 4PX9A 3NIBA 2Z83A 2FSHA 2BCGY 2WZQA 1R8SA 5BN5A 1QDEA 1Z0DA 5JRZA 2ZE5A 2ZRJA 2WBLC 1O3YA 2F43A 4BFUA 2CBZA 5K8UA 3P32A 5KSZA 2QSYA 2CHVA 4XH9B 2VHTA 3TKLA 3SC3A 4BRUA 5D3MA 4AYXA 2OT3B 3THYA 1RPZA 1AIPA 2EFCB 3UWKA 4ZIRB 1ZBDA 4F4IA 2ZSAA 4RD4A 4DVGA 1XJCA 3LW8A 621PA 3SFVA 4PO1A 1ZIPA 5E95A 1NRJB 1QHIA 5K8LA 1T91A 1QZMA 1XD8A 1UPTA 2IX3A 3JVUA 2V55B 4TMTA 1W36B 4CDGA 1EESA 4A3VB 5C2JB 1PJRA 2P6NA 3PUYA 4F4CA 2FDCA 2ZSBA 4F92B 2HCBA 2CJWA 1OW3B 1EX7A 4MH0R 4DCUA 3SDZA 4DLSA 3IKJA 4FWGA 2ZITA 3CNOA 3VMFA 4ACBA 4M1SA 4PQFA 3KQLA 1CBUA 3NEJA 1D2EA 2A5JA 4Y0VA 2WTUA 4CEHA 3AUXA 2OBNA 1X1RA 3RS5A 1G3UA 4BFYA 5KNDA 3GLHE 1XCPA 2XXAB 3UMRA 2OUKA 3KTAA 1S96A 5DISB 3RANA 5IHPA 3RRNA 3QKSB 3EPJA 1SXJD 2ZJ8A 3AM1A 2FG5A 5DN6D 1AGRA 5DIFA 3KJIA 2OFOA 5KNCA 5JI2E 1NBME 4DRZA 2KB0A 4PQYA 2GZAA 2Q9CA 2O8FA 4EPXA 3PUZA 4TYYA 5TARA 2QMUA 4OI0A 3AVTA 1UEJA 2OBLA 3VLFB 4AY2A 1G20E 1KK2A 4A8JB 1NF3A 4KODA 4JIMA 3LBIA 4S2EA 3THWA 4IVQA 1CLUA 1NNEA 1CJKC 4ZDIA 2F1IA 2VF8A 3GFOA 4Z8YA 3RVBA 3EIHA 2FSGA 2J46A 2GK7A 1IJFA 2OESA 3CRVA 4UXIA 4JLMA 5JJLA 2DFTA 1DE0A 4URXR 2G0TA 4IDHA 5C46F 2LKDA 2OLJA 2OCPA 3OIWA 3GQBA 2YC2C 4V0OA 3KQUA 1ZW6A 1LS6A 4UNPA 3PR1A 1OXUA 2OCAA 4V0ME 4AYTA 1G3IA 1KY3A 3VR3A 3OEHD 1P5ZB 4A0HA 3HR7A 3B9PA 5TMPA 3NHBA 1E1QD 4L9SA 4OJQA 3D7MA 3NVAA 3AVUA 1IOZA 2P5TB 2O0KA 2HT6A 5KTYA 1BKDR 4BZPA 4MRNA 3ZQ6A 2Z0MA 1UBFA 5EP2A 3T1VA 1KOFA 4QC2A 1WQ1R 3TSOA 1Z6TA 2ZETA 4KBGA 1GP2A 3HJNA 3Q5EA 4Z54A 2IYYA 2J3EA 4YC7A 1LF0A 2C9YA 4JSYA 5EE0A 2FFHA 4FINA 3WMGA 1D2MA 1E1RD 3QE0A 4IVPA 1L4UA 1Z5ZA 3LV8A 2RHMA 3ZQJA 5FR1A 4PANA 1VCOA 2PH1A 4Q4JB 3B1YA 5BW8A 4D4KA 2V6ZM 4JLKA 3O8CA 3AVQA 4YMTA 1U8ZA 3A1VA 3AVOA 4LWZA 1TX4B 5FBLB 3S1AA 3NG1A 1US8B 1LS1A 1GKIA 1P2VA 3BRWD 3VKHA 2RH5A 2ODNA 3A1TA 2RKOA 4GBMA 4NONA 4G5QA 1G8GA 3LH5A 3QF7A 3X1YA 4FMCB 4Y0AA 1SKYB 3R9IA 4DHEA 3CRW1 3W5JA 121PA 1ZUNB 5B2ZA 1HA3A 5GJWC 1QHXA 3O8BA 3ZJYA 2GEUA 2ZUBA 1QVAA 3BH6A 4G0NA 1KKMA 4KHZA 2JLZA 5SZKB 1G16A 1JI0A 2NPIA 5J4KA 2EU8A 3Q5DA 1DAHA 2VP5A 4HUQB 1PZNA 1KDPA 5AJYA 1GUAA 1NBMD 4DCSA 2N42A 1VMAA 2V8OA 3SS8A 5HZKA 3K0CC 1XFAA 1HV8A 4OHWA 1KK3A 2O8EB 4LYFA 4XVQA 5BN3A 2G3YA 1OXXK 4MGIR 1WE2A 2GBLA 1GL6A 1H8HD 3ZZ0A 2NG1A 1WBBA 1C4OA 4FWDA 1F60A 4URWR 3CO5A 4BFTA 5FL7A 1P2UA 3ZGXA 2JATA 3GCGA 3ZIAA 1G5PA 4D80A 3K0AB 1YRAA 4LHZA 3WP0A 4PAOA 3ND8A 4FN5A 4V0LA 4UJ3A 1SXJC 3PG5A 4Q1CA 4RD0A 4PHFA 2XXAA 3UXMA 4XTCS 2XZLA 2V1UA 1XRJA 5HE8A 4DLXA 3TNFA 1BO6A 3QKSA 1VIYA 4TQ9A 1P62B 3THXB 1AN0A 2IYLD 3DMDA 4MGZR 5CLLA 5AJXA 3P27A 2O0JA 4ESHA 4QHTA 2BMJA 1AZSC 1RC8A 1W0KA 3LBHA 2N46A 3DKPA 4LPSA 2FWRA 4TWZA 3GLGB 2WWXA 3QKRA 2EFGA 1BOFA 4DSTA 2JCSA 3AB3A 1J70A 4YDSA 4NYIR 1XB2A 2Z4SA 4N3NA 5J47A 2IHBA 5JSZB 1K6MA 2ZJ5A 4EKDA 5LB4A 3L2OB 4LC0A 5JRJA 2BOVA 2FGJA 4RZ3A 2PLRA 2NO6A 2MMCA 1E4YA 3EG5A 2JLSA 2W83A 4ESVA 4BLOA 3UKDA 4A36A 1L7VC 5TV2A 5C4MA 1W0JA 3GEEA 1TEXA 3ETLA 1X8KA 4Q4AB 1W1WA 3NEYA 4CW7A 2FOLA 3HPRA 4HAZA 4CVNA 3BGWA 1NVMA 4HB3A 1HH4A 2XNSA 4M4SA 4BWYA 1W46A 3CH5A 1R10A 4IXMA 4HDQB 3RYTC 3FFBA 1IAQA 2VBCA 3QBTA 2VPPA 4OK3A 1XWIA 4WIAA 4YDHB 2R65A 4EJSC 2ZSDA 1UKYA 4X8LA 1ZM7A 2B8WA 2JLXA 1D8TA 1JR6A 3PVSA 3UG7A 3PCRB 4RFSA 1KI8A 2KSQA 5KPJA 2P65A 1OV4A 2ZJOA 3K9GA 1F2TB 4M1YA 4X8MA 2AK2A 3GJXC 3GMTA 2VYFA 3CKLA 2GCPA 2QTVB 4Q01A 5TDHA 4Q1FA 2WHXA 2XNDA 4Q9HA 1GM5A 4AKHA 4GI7A 2RGAA 2V4ZA 3DMNA 3EX7C 2IF2A 3AVXA 1RRCA 4HI0E 1R6BX 1A2BA 4YMWA 2IYUA 2IBMA 3T1OA 4M22A 1ZNYA 4RKEA 3C14C 4C0JA 4FI3C 5FOTA 1X8JA 1PUIA 3TRFA 2F3TA 3DOFA 2YVUA 5FTLA 1KIMA 2GZDA 4JZKA 4QBHA 3RSLA 2DFKB 5AUOB 4URYR 1V43A 4F93B 1E2LA 1XCMA 1G1MA 2FU5C 3OIVA 2DWOA 4TLDA 3N2EA 3G0HA 1FNNA 4HLUA 1COWA 1Q12A 2HXSA 2ZAMA 1YZUA 3F0TA 3CF6R 4TQAA 4D25A 4OJKA 4V0KA 2ZJAA 2QGNA 3FPAA 5CDFA 2GF0A 2J7KA 2WWIA 3NBYC 3P4XA 4I99A 4QGFA 1SQ5A 5DE3A 2FE4A 1KI2A 3KXKA 4M1MA 4OQFA 4QGHA 3SZRA 5L3QA 2O8EA 3AVVA 3PUWA 1JEEA 1VHTA 4CZ2A 1XEXB 3P1JA 3SJZA 4F91B 1B23P 1X86B 3B7GA 3LO5A 2IYTA 2C03A 3WXMA 2JLVA 1W4RA 5AUQA 3IQXA 2ZS9A 1P75A 2GTPA 3X2SA 2NO7A 3QXCA 4FD2A 1D2NA 1TF2A 4F38A 1AS3A 4D26A 2BV3A 4MDEA 2FX3A 4US2R 1IN7A 3L0IB 1KI6B 3NC1C 4LY6A 8OHMA 2GJ9A 2WPDA 4IOKA 3B1VA 1R0XA 4IDOA 2ONJA 5F2EA 1QZXA 4Q9IA 3DZ8A 3B1ZA 1RKBA 2Q3HA 1IXSB 1KDTA 3NC0C 521PA 1SHKA 2W0SA 3SI7A 3BB1A 1ZNZA 2CVHA 4KFTA 2Q9BA 1UBEA 1KK1A 5KDOA 5FL7D 2FH5B 5HTKA 1N6IA 3H86A 3ZIAD 4P32A 1RRFA 3TUJC 4MKGA 1FUKA 5JSZA 2O0HA 4B6FA 4PSVA 1TQ2A 2J87A 1K5DA 2BBTA 2JGNA 4Q48A 3K1JA 1E9DA 3QBVA 4CEJB 3ZS8A 1Z47A 3LRPA 4S35A 3L0OA 4YONB 4CT4B 4NCKA 3BFVA 2F1JA 4OI1A 3H2YA 1U90A 1XNJA 2PJZA 2WVJA 1OH7A 2ZRHA 4PQRA 4GZMA 2V7QA 4DKXA 1NY6A 3VQTA 3K70D 3I92A 4HZUB 4L15A 4NYIQ 2A3RA 1W0KD 1TUEA 1XTIA 2D2FA 4JL5A 1G6HA 1NN0A 2PLFA 2LKCA 2IA5A 3QENA 1DO2A 3A4LA 1DO0A 1PLKA 2QG6A 4IRUB 1C1KA 1P60A 1OB2A 4RCZA 1R2QA 1DAFA 3EA0A 2CDNA 4MUBA 2QU8A 2W2XA 3R7WA 2OILA 4GP7A 2XITA 3QXHA 3AV0B 4JL6A 4TT3A 5K8IA 1E32A 3CF0A 4M0LA 1ZIOA 4QFMA 1ODFA 1R5OA 4LYHA 4LRTA 2CL7X 2JLWA 1W0JD 5J40A 4JVSB 1LNZA 3A1SA 2HJVA 4Q1AA 2IYVA 2BHRA 4D4MA 2QRZA 1EX6A 4BASA 4ILEA 1UFQA 2AXNA 4HDOB 1YKSA 4KFRA 4Q7JB 3SFZA 4OQMA 5HZHA 4NYMR 1WRBA 4BLRA 5IK2A 2EWVA 2AWNA 3IEUA 4MQBA 3MFYA 2JDIA 2V6IA 3ZZTA 221PA 1NG1A 4CRWB 4H9GA 1GG2A 2PL3A 1T3HA 4IFBA 4TLEA 2OXRA 4P4UA 3FB4A 2C96A 1KJYA 3AGPA 2YZ2A 3L0SA 3LY5A 1RFLA 3R20A 3DM5A 1S9HA 2YOGA 5CIQA 1TUIA 2WJHA 4TYPA 2IYRA 3BH0A 2G9NA 1U0LA 4QL3A 1YZTA 2GEDA 1A1VA 2AR7A 4QBIA 3R8CA 4B2LA 3EARA 4TSFA 5SZIA 3ICQB 5CIWA 1JXMA 3U61B 5LBIA 1W7AA 4UNQA 2H1LA 3SYNA 3H0KA 3QPUA 4POAA 4Z51A 1SVOA 1XEXA 4FMBB 5FBQB 3F5FA 2VRWA 2GK6A 4MRSA 3F3YA 4N1AA 3GJ6A 3ZS9A 4TL7A 3QG1A 1W4BA 1Q3TA 3FKSA 3PV0A 4IDNA 5BXQC 3EPLA 1COWD 2O8BA 3CF2A 1S1CA 2GKSA 3C5HA 2VTKA 5E4FA 2VSFA 3GLFB 3L8ZA 2ZE6A 2VHQA 2ZRPA 3ASYA 5BWMA 2FJUA 4MYCA 2CCKA 2IC5A 2V6JA 3CR7A 2OE2A 1KO5A 4HZIA 4R98A 4TQUS 4MA4A 3AVYA 3TIFA 1FP7A 1QHHA 2P67A 1KZ7B 1HY3A 1E0JA 4O2RA 4BEBA 1G41A 4U02A 721PA 4RD1A 1NMYA 3QSYA 3EC2A 1A7JA 1BYUA 1XF9A 3K0EA 2QTFA 1G8YA 4JLOA 5TB5A 1X1SA 3VR2A 1S0UA 3BFKA 2HEIA 5CK5A 5JEDA 3RC3A 1G5TA 4DCNA 5GVRA 4AYWA 2WPDD 3SOPA 4C7OA 4CEJA 2D3WA 1ZCBA 1OIXA 2WM9B 2XEXA 3K70C 1NLYA 1XMIA 2ZVQX 3ADKA 3KZ1E 4TN1A 5FOUA 2R6CA 3PENA 1MT0A 5GADl 2QT0A 2YOFA 2AX4A 4EQ6A 1G7RA 2PT5A 2JLQA 4NBSA 4QJ3A 3AF3A 1CRPA 4ZKDA 3H4MA 3LQRA 2G0NA 2D7DA 4FXPA 3VR1A 1G17A 1W4AA 2YJTD 3FTQA 4OL0A 2LWIA 3CX8A 4I1UA 2QPAA 3DZDA 2XGJA 2C5LA 1XEWY 1F48A 2PX3A 2MSEB 1XTRA 1NJGA 2CL6X 1KHTA 1XXHE 3A1WA 3CNNA 4KU4A 2PT7A 4RSGA 3GJ5A 1UKVY 3WP1B 2JJ2A 2R62A 4ZO4A 3CZQA 4GOKA 2KE5A 4G3XA 2V7QD 4W5WA 3MWJA 4AIIA 3REFA 2GDJA 1AS0A 4PO9A 4EPTA 1TEVA 2J7PA 3K0SA 1XCGB 4Q4LA 1F2UA 2HT1A 4PC7A 2DB3A 2XJ9A 2NGRA 4TMKA 2W58A 3FYHA 3EC1A 2ANCA 2ZI3A 2ZR0A 4M53A 1OFUX 4B75A 3FGNA 4EUNA 2ORWA 4QBGB 4B3XA 2ZYUX 3ZVNA 3PXGA 2H8KA 2WJVA 5GVSA 4P3YA 2QTHA 3K0FA 1L8QA 4OQNA 1BIFA 1N6KA 2Z5FA 4KFUA 1NN1A 4TT3D 4RZUA 3KFXA 4DDUA 1MV5A 4Q19A 2IWHA 3UIEA 2P6RA 3TAHA 1G6OA 3NKVA 1FMJA 4LJ6A 3B2EA 3SJAA 3FMOB 1JEDA 4BEJA 1HT2E 2J45A 1K8RA 4LJ7A 4NTZA 2EQBA 3ADCA 4ITRC 5KO2A 2CE7A 3FDIA 1E3MA 3T61A 3TJZA 1VG9B 4Q03A 2P0EA 3ADBA 1MRNA 1Q44A 1RJ9A 5IK2D 5B58C 1YZQA 2JDID 2GCOB 3EPHA 2EYUA 5FPTA 2L0XA 4MKIA 1Q22A 5G3ZA 3Q72A 4WOPA 1U9IA 3X1DA 4DB4A 1HUQA 3U44A 2IT1A 4PFSA 1AS2A 1CTQA 5AK0A 1WDTA 2MSCB 3B13B 3B6EA 3OIYA 1NY5A 4W7SA 1HEIA 3U3RA 2GXSA 1OHHD 2DBYA 4YMSA 4OHVA 3G82C 1ZP6A 3BB4A 1VYUA 1JPNA 4URZR 4I1VA 4DLUA 1JAHA 3RS2A 4B48A 4Q4HB 4DT1A 1NP6A 1KO4A 5H70A 4NMMA 5CJPA 5HPYB 4F7WA 4DLTA 1KMHB 3BBPA 5DI3A 4BE7B 1ZUIA 3WHLA 4BUJA 1R4AA 4PXAA 4OQLA 4B3DA 5ANRB 1N6RA 2IYXA 5DO9A 3AP2A 3LAWA 4US1R 2RB4A 3TMKA 1M7HA 4URVR 4M9SA 1KO7A 2KRKA 1KO8A 4QBFA 3T12A 4G5RA 4B76A 1WMSA 2I1QA 5JBQA 4IEIA 2IYQA 4DIEA 2WSMA 1IXRC 3EZ9A 2FV8A 2FSFA 2F7SA 1OT3A 2NZ8A 2OO7A 2ODEA 3N2IA 3V4RA 3U5ZB 2H57A 4MUAA 5LPNA 3AEZA 5FOWA 1SVWA 3MWKA 4JL8A 2NOAA 4ZKEA 4PC1A 4TMVA 4DC9A 3KL4A 1P9RA 4FIDA 4FW9A 1TAGA 4AK9A 3IUYA 1GDDA 4DB2A 2AWOA 1KAGA 1M2OB 4V02A 1VCNA 3VHLB 4YMVA 1VYTA 4EPRA 1C1YA 1HQCA 4WW0A 1T3LA 2JIZA 5EZ6B 2DPXA 3TH5A 2PZGA 1DEKA 3MGCA 5CM8B 4B3FX 3O8RA 4PPGA 1KYIA 2R6AA 1OFTA 1NKTA 4M1OA 1FMLA 3QOFA 1VKJA 3UG6A 2W2TA 2BBWA 2ZI4A 1D9XA 4GPTA 2X19A 3OFND 4HLQB 4MYHA 5H68A 3U3KA 4B73A 1GILA 2AHOA 1TTTA 3WYAA 3NHAA 3U6KA 4TZ0A 2QORA 3AF2A 4JJZA 1BMFA 1ZMXA 5H8WA 3CONA 3D8BA 4NDZA 4EDHA 3AKEA 2RCNA 5FOSA 1FTSA 1E9FA 3VTKA 1E2GA 4M1KA 1N3BA 2RGEA 4ZDJA 1QHNA 3VKGA 3IGFA 4MRRA 3OAAD 4FMCF 1YR8A 5EXPA 2BMDA 2BBOA 2ZEJA 4L8GA 1TU4A 3RLFA 1OKKA 2AKYA 2X2EA 4C0LA 3VHXA 3LNCA 2QGZA 4RD3A 1KDOA 2I4IA 1M1YE 1E69A 3QKTA 5JJIA 2ZYTX 2GILA 2D62A 4Z8XA 2J59A 1CJTC 2BM1A 3FHCB 2E9SA 3KKMA 5JCPA 1YHNA 5L3SA 1AQUA 2HLDD 1S3SA 2C99A 1UDXA 3LQQA 2GJKA 4Q9JA 4A4DA 2H92A 1EG7A 4BQSA 3QXXA 3N5CA 1A2KC 3BORA 3LD9A 4I4LA 3EPKA 3U4QA 3ADDA 4RKFA 1NIJA 3LXRA 1TU3A 1V5WA 4FWHA 2WWFA 1PUJA 4LC1A 3NXSA 4QHSA 4BLPA 3I62A 3GFTA 1GVNB 3QKUA 1P61B 4M1TA 2VF7A 4A0GA 1R5NA 1N6PA 3EAQA 2QQ0A 2IS6A 1TPZA 4QJ5A 1JQLB 4GP6A 2PEZA 1KY2A 4JLDA 4M9XA 1MR3F 3RS7A 3QNUA 4Q5IA 4A1FA 3DOEA 3U7FB 1PVOA 1U81A 2E1RA 3L0PA 1AKYA 1SVLA 4K8OA 2V54A 4UXJA 4A6PA 4LDJA 4L4UA 2AKAB 2ZTSA 5G3YA 4DLWA 4LRSA 4BECA 3PEYA 4MDFA 5FH9A 4OK6A 1IN6A 5KSYA 3SHWA 2J5XA 2WKPA 1NVUQ 4Q4HA 4LHVA 3DO6A 3SE0A 1W49A 3JZMA 1U2RA 4GMXA 1G3QA 1G9XA 3FHTA 1NLFA 1WF3A 2J0UB 1M74A 5FOXA 1E99A 1H65A 1NKSA 1U0JA 5FBWB 2DYKA 4HUTA 1LTQA 2P2LA 2Q3FA 5EE3A 1HE8B 1BS1A 3L82B 3WY9A 1MH1A 2GWHA 3TQFA 1EFUA 5KSPA 1G7CA 1OF1A 2CCJA 3CRRA 4ZIRA 3MMPA 4KVGA 1N5LA 3RHFA 1AZTA 4K81B 4O25A 1Z29A 2WAXA 3B85A 2R2AA 4Q18A 4XWOA 4JBXA 4B6EA 2HF9A 4FCWA 3HU3A 3SBDA 1LV7A 3BWDD 3VNVA 4G01B 1GKYA 4KJZA 5EE9A 2SHKA 4DCVA 3B1XA 1G3RA 1Q1QA 3CPEA 4NE2A 5JHHB 1G18A 4G5GA 4DDVA 2XTNA 4AWXA 1E2HA 2IUTA 1D9ZA 2IYSA 4XWKA 2BKEA 4GT1A 1ZNWA 4B3BA 4EAQA 2FFQA 3L43A 4DSNA 5L3VA 3AGQA 1AM4D 4YMUA 2YNMA 4ZI3A 2QPTA 3T15A 1KSHA 1Q20A 2FA9A 5FR2A 1ZD9A 3CRQA 2ZREA 2IK8A 3QPVA 4BZXA 1TF7A 3N70A 4OI4A 1E9CA 3AUYA 1Y3AA 2WJJA 3PITA 4EPWA 5E7MA 5H1YA 4A8JA 4DIDA 1C9KA 2QAGC 3RWMB 2JIZD 2CMKA 2FPLA 2CVFA 3TGPA 2QE7A 5FPSA 2JA1A 4C0SA 2A30A 1P6XA 1JAIA 2VHCA 1XBTA 3K9LA 3MAAC 3KUDA 1PV4A 1RW4A 1G19A 1EFRA 1E2EA 1ZUHA 3CH4B 2LCFA 3ZDQA 5AUNB 2AFIE 4C0BA 5JS7A 4ERNA 5B64A 4OHZA 1VG1A 1XTSA 4ASUA 4A2QA 1BMFD 5EZ5A 3QVVA 2OFXA 2W2VA 2WMNB 3GLIB 5AJZA 2RGNC 3GD7A 1X8LA 3IBYA 5FUVA 1XPOA 4LBWA 3EIQA 1P9NA 4HAUA 2A78A 3HDTA 2J0VA 3MG9A 1IY2A 1NI3A 4MYUA 3IIKA 5IDVA 3LFUA 1SGWA 4ZPXA 2QBYB 2ZS8A 2QL6A 4DLVA 2OCYC 5FTJA 1OKKD 2H18A 3MJRA 4JS0A 3I1FA 2ZRCA 4Q00A 4URUR 1XMSA 5AJWA 5JS8A 1DS6A 1M8PA 2DVWB 2ECKA 4PO8A 1T8UA 2V9PA 3K9NA 1T5IA 2ZVPX 4KFSA 4Q4JA 1Z83A 4QM7A 2XB2A 2IS1A 1DAKA 4AKIA 3AP1A 2RGCA 5JHGB 1NVXQ 4WZBE 1JALA 4RZ2A 1SZPA 1YR9A 3I5XA 2CHQA 1F6BA 4GZLA 4Q7MB 5EE5B 3IILA 3T06B 3KKOA 3KJEA 3C8UA 1XEWX 4HEJA 4OYHA 1US8A 3J81k 4TYNA 4IDPA 5FUXA 4CF7A 1DADA 1NN5A 3BOSA 1YU9A 4HATA 2A7QA 3QF4B 4JT2A 4Q1DA 4ZV4A 1E6CA 1NVVR 3ZYCA 3P4YA 4LV8B 2RGXA 2GCNA 2X1VA 4FWIB 2HXYA 2DZNB 2BEKA 1LY1A 1J7KA 2R44A 3WNCA 3I8SA 3AVPA 3I8XA 1ZC3A 3RRMA 2WKRA 4HUQA 4PZZA 4MYTA 5JMTA 3QY0A 1KI3A 5HE9A 1X37A 1MABB 2A5DA 3U6BA 1WXQA 3B82A 5GJVC 1EFTA 4FMDB 4LOAA 1QHYA 3DM9B 5JCZA 3U7HB 4LBVA 1ZVQA 1T0HB 1BYIA 4HAVA 2X2FA 3C41J 2VSOA 3K0AA 4C30A 4Q21A 3KQHA 4F4JA 4KVAA 4IEEA 4TLBA 3ZLJA 3LDAA 4N0DA 2ZR9A 3OZXA 2JJ8A 4TL8A 3X1ZA 1KKLA 3FFAA 1JBKA 5IT5A 4C0KA 1VTKA 1G21E 4UJ5A 1PLJA 3THXA 5DSZA 2QN6A 1GRRA 3KUCA 3QEOA 2EFHB 3BAFA 2XZPA 1YE8A 3T35A 3NDPA 4M21A 2DZOB 1CRQA 2GETA 2XOKA 3THOA 1W36D 2REBA 4HAWA 4LI0A 1SULA 3UATA 4D4JA 4DDTA 1QF9A 1M6NA 3VNUA 4GOJA 4ACAA 5EJEA 1CULC 2FMXA 3GLGA 4NCHA 3W5IA 1GOTA 4JBWA 2DFNA 2VHJA 4TYQA 5F9FA 1SKYE 2NMVA 3PFIA 2HCJB 4B47A 1HQYE 4RVCA 2OAQ1 4DLRA 2AD1A 2ZRKA 2QENA 4KSBA 3DHWC 1Z6YA 2GF9A 1VG0B 2IEYA 2WMOB 1ZC4A 3IHLA 2D4HA 3KXLA 1SHZA 5CDFE 3E1SA 2IF0A 1KNQA 3KX2A 3MRSA 1IONA 1FUUA 4JVMA 4Q4AA 4NCIA 4TL6A 1DAGA 1P3JA 3ICEA 1JJ7A 3GJ7A 4A15A 4KYIB 4QHYA 3CW2A 1I2DA 3LXXA 2R9VA 4MGKR 3ASZA 3SQWA 4RY2A 3GPLA 4XSGA 1SXJB 5KYKA 1S8FA 2QE7D 5CYPA 1S1MA 4DDWA 1IBRA 2QBYA 1AJEA 5L3RA 2BJVA 4B71A 1Z8FA 4JLPA 4KV9A 2IYZA 1NMXA 2ZRAA 5E3HA 1FFHA 2RHDA 3L8YA 1YVDA 3UWOA 2OAP1 4BZQA 2QM8A 3PQCA 4C4PA 1F2TA 4AKEA 1TF5A 1VHLA 3IPYA 4PSKA 2QA5A 1IHUA 4U7DA 4ASUD 1EFCA 1T0JB 1P73A 4MGYR 5CYOA 2ZM5A 1YQTA 2OSBA 4NP6A 1G7SA 3Q9LA 2XB4A 2QAGB 5JEEA 4Z1MA 2C9OA 3GLGE 4PHTA 1XMVA 4PAQA 2FPMA 3CB4A 3B60A 3AQ4A 4CEIB 3D6TB 2ZI9A 3DEFA 4V0NA 1CU1A 5KHOC 1D6JA 5GJBA 2P5SA 3SHFA 1IY1A 4KO8A 1L2TA 2V1XA 1P7CA 1KSJA 2ERXA 4X8HA 2P3SA 3KKPA 2AXPA 1B0UA 3HYTA 1E79A 1KAOA 5EXSA 1Z08A 2Z43A 4LBZA 1XX6A 1W44A 4JVNA 4BFVA 3B5JA 1XTJA 4QNMA 2QMOA 4KAXA 1GRQA 1TL7C 2BVNA 4BLSA 3DVLA 2IXEA 1CJUC 2XNDD 1NN3A 2JEOA 3RS3A 3VR5A 4CGZA 2EWWA 3BS4A 3OF5A 5BQ5A 4L5BA 1N5JA 1YR7A 2K5UA 1HT1E 4GL2A 1N0UA 2HV8A 2YV5A 1Z2AA 1GNQA 1NVVQ 2BJWA 821PA 2GA8A 1Z6XA 3BH7A 4EJSB 3F8TA 1E4VA 5M04A 3FOZA 4JVLA 1FOEB 2VA8A 4MRVA 2ZRLA 3M0EA 3CM0A 3SJBA 3IEVA 2CL0X 2B7CA 1S2MA 3K8YA 1KI6A 1G64A 5JFGA 2VHUA 2ZIAA 4JYBA 3ZVLA 3SEAA 1Z6AA 1Z0AA 5DYIA 2GBLC 4RZXA 2YYZA 2C2HA 5BYKA 4WZ6A 3IBGA 5JJKA 4JN6A 2YOHA 1Z6GA 4R71A 1Z07A 3O47A 4FWTA 3RC8A 2REXB 3HR8A 2CNWA 4GFDA 1DAEA 1R0YA 3GLHB 2UZIR 2Y8EA 3HYRA 2FFBA 3WYGA 2WJYA 1M7BA 5FBVB 2WSSA 3AF4A 3IPXA 3QEJA 1U99A 2ERYA 1OE0A 4OKSA 3K53A 4Q1EA 2IWRA 4Q1BA 5A0FA 2PX0A 4O2LA 1SVSA 3GJ4A 5EQTA 2QPOA 2ZJZA 4P33A 3NBZC 2ZRMA 4E09A 3BIFA 1UDWA 2ZPTX 1II8B 2YHSA 4MRPA 3SNHA 4NL4H 1E9BA 1ZM4A 2J0QA 1KMQA 1U98A 4I81A 3K0CA 1W2HA 2ZRNA 4P31A 3TW4A 2ZRGA 1W4CA 3K09A 1MO6A 4NYJR 4R2HA 1KSGA 4U5XA 3KFVA 4HZUA 2F43B 3RWOA 1RRPA 5BN4A 2OBMA 1DG1G 2NTYC 1ONBA 5D3MB 3SU8A 3THYB 1I4DD 4CT5A 4QJ4A 3CBQA 4OQXA 4C0QC 1GIAA 4PPQA 5HR5A 5A4JA 5KDLA 3EXAA 3TBKA 1JECA 4ZI2A 4DLZA 3CIOA 4H1VA 4XSHA 5JWOA 1VG8A 1TNDA 4UXHA 2CLDX 3GJ3A 1VYVA 3Q7PA 3OESA 4GSYA 5FPHA 1G8PA 1WBDA 3RDPA 3JZAA 2A5FA 4Q9KA 2JASA 5CLQA 1J8YF 1GNPA 3AKYA 4HB0A 2ATVA 1ZM2A 4N0EA 4Q9LA 4BRWA 4CEHB 1SVMA 1CS4C 1G7TA 4IOMA 2ONKA 2H16A 4TMXA 5CB6A 1XEFA 3KTAB 3PUXA 4IJMA 3PEVA 1FTNA 4Q47A 4WVFA 2O8DB 1MOZA 2ZSFA 2VQSA 3A8TA 4CEIA 3IDQA 5LB2A 2OV2A 1IXZA 3HWSA 3SN6A 4AI6A 2FFAA 3VKWA 3CZPA 3VX3A 2VSXA 2WKQA 1JJVA 1E2PA 2O8FB 3AF0A 1XZPA 2FPKA 1OXSC 2VL7A 3KDSE 3BB3A 4NCJA 2BBSA 1S4QA 2Q9AA 1XMJA 3B9QA 1MRSA 4ON9A 1UM8A 3THWB 3AJIB 1Y63A 4ZCMA 1NJFA 2VP2A 2W6IA 1N6HA 2AL7A 3GJ0A 2ZJ2A 4XTRA 4FCVA 5JI3E 2WJGA 1XPUA 2H17A 4HLCA 2B8TA 1DARA 1E0SA 4A6XA 2QSZA 4U00A 5C18A 1XD2B 4TLAA 2B7BA 2DCUA 2G1KA 4EFNA 3SQXA 4HAYA 3CNLA 1IJEA 4HLUC 1N0VC 3W8NA 2CK3A 3NBFA 4EFLA 5TXGA 2BDTA 1E79D 4B2PA 4DUGA 3QUSA 4HLDA 1OB5A 1JR3A 1T8TA 4HAXA 3UK6A 1CKEA 2VIIA 3GLFA 3Q85A 3I5YA 1NG9A 2OFWA 4M1WA 1E2IA 4KSCA 2IUUA 5EP3A 2QMHA 2OXCA 4HB4A 1IN4A 4UQOA 2F3RA 2XAUA 3TUIC 3LX8A 4TSFD 4A0RA 2GAOA 2FF7A 3E70C 3O8DA 4LYAA 2QNRA 2HYIC 3M6AA 3LW7A 3GLHA 3T1TA 2FEOA 4JKYA 4PC2A 2X77A 4D4LA 2Z6VA 1Z06A 1ZNXA 2ZS7A 1E94E 3I72A 4A82A 1RYHA 1X3SA 2B92A 4US0R 5FUWA 1Q1BA 2Q6TA 3FKSD 4JLNA 3ZZUA 1MO5A 2AD5A 3W34A 3REGA 2XJ4A 2IUSA 3EIEA 4LX0A 4LJ9A 1E2FA 3C7KA 4II7A 1OJLA 2J0SA 2YINC 2QP9X 1II8A 2VP6A 3BD9A 1H8HA 2WOOA 2C9CA 4OI2A 3KJHA 3TSWA 3W3AA 1E0AA 1YRBA 3VFDA 1QG2A 2KI5A 2GESA 3FHOA 1A5TA 3VR4A 1KI7A 5B57C 4LYJA 2D2EA 3TR5A 2CNWD 1GL7A 3K9HA 3TE6A 1ANKA 2PZFA 3I3SR 4R2IA 4JLVA 4TTRA 2WSSD 2GXQA 1A82A 3MWLA 1HE1C 2R8RA 2EYQA 4LV6A 3RABA 2JJ1A 1FNMA 2FZLA 3TQCA 1JR3E 1K5GA 2WWWA 1GRNA 4MKHA 5IF9A 2C04A 4V0MA 1DELA 4A2WA 4NYJQ 4TMWA 3W9YA 5B30A 5BYJA 4DWJA 3GLFE 3D31A 1E0KA 3AH8A 1OFIA 4NU0A 1GL9B 1LF5A 1MO3A 5G41A 2WOJA 4RFVA 5DHFA 4IVRA 5JECA 5CITA 5EXXA 1JPJA 1U8AA 5FPYA 1KTVA 1RE0A 1YZNA 4FCTA 2FEMA 5HCIA 1N2CE 2IS2A 3KW6A 4YQFA 2ZJYA 3BK7A 1U8YA 2J1LA 2MMGA 3MSXA 4A0FA 1J2JA 2BM0A 4ARZB 2IS4A 5J5CA 4KBFA 3W6PA 2FGKA 2O8DA 2F55A 4G5OA 4HSEA 1DAIA 1W5TA 1F5NA 1UEIA 1VCMA 5KDDA 3K70B 2G88A 2QP3A 4KXFB 1AQYA 3NH6A 1ZD8A 4XOIA 2JJ2D 2C98A 3IIJA 5CJ2A 4IKEA 4NZYA 2C95A 1LW7A 2BWJA 3QKRB 3EASA 3VX4A 2Q21A 2J7PD 2GJSA 2YWEA 3FVQA 4WAUA 1E2JA 2CE2X 2RGBA 5P21A 1CJVC 3WRXC 3UMSA 4WBSA 3EZ2A 2BC9A 5FOVA 3PIRA 1SVKA 1J8MF 1XDBA 2R6DA 3MWYW 5AUPB 1Z63A 3C4JA 1GITA 1XD2A 1KI1A 3AKDA 1Z22A 2GCOA 2YWFA 3B8HA 1DG3A 2FNAA 4W5HA 4B44A 2PBRA 3CPJB 4IDQA 3RSOA 3TVDA 2A9KA 1P72A 4JBYA 2DY1A 3RS4A 3QXJA 1Q57A 3RRZA 3OIUA 4QXAA 5EE1A 2ZUDA 3BERA 3M1IA 1II0A 4LGMA 2D06A 1H8EA 1UBCA 1N25A 1FP6A 1TQ6A 2W6ID 5F9HA 1R7RA 5J4HA 5E7JA 1E96A 2AN9A 4NKRA 2HDNB 5DYGA 5HCNA 5CK4A 2WIAA 3VR6A 2NIPA 1QG4A 2QP4A 1KK0A 1KMHA 1OPXA 1CJMA 3PUVA 1YJ5A 3SBEA 4AKGA 4J0QA 4RFSB 1UF9A 3LX5A 2MSDB 4D0NA 2CK3D 5J4LA 3AVWA 3EZ6A 2IW3A 4ZDWA 5G40A 3W6NA 4TZ6A 1RYFA 3GFPA 4DUGD 1FX0B 2ZI5A 1YR6A 3KXIA 1JR3D 1FQJA 2DFLA 3P26A 4CIDA 1YZGA 1KJZA 1TQ4A 2C78A 1DBSA 3B1WA 3KKQA 5J4YA 3EZFA 2F6RA 1XJ0A 1G291 1KO1A 4DZZA 2DWPA 4DCTA 4LUCA 1XD9A 4UNNA 1FL9A 2GEVA 2Z4RA 2QROA 2QRNA 2ZYVX 4KYUA 1IN8A 4JKIA 2ODWA 5DH9A 4LRWA 5FTMA 3AP3A 2Q0HA 4OHXA 4LCBA 2ORIA 2WIBA 1IN5A 4YXWA 1QVRA 2A5YB 1WCV1 3Q7QA 3ECCA 3GP8A 4ZDKA 1G4AE 4GITA 1P2TA 3R9XA 1E2QA 1Q0UA 1T4GA 4C0HA 1JXOA 1G3MA 2G83A 3U7GA 3BC1A 2GVZC 5L3QB 1Z2CA 2EFDB 3QPWA 3K09C 3UPUA 1CR0A 2IHYA 2QAJA 1R0WA 1E9EA 4Q7LA 3R9WA 4OHYA 2YWHA 3TW8B 3NWJA 4JMPA 1KDRA 2IL1A 4PPFA 4PTLA 3P20A 1IQPA 3GEHA 1NLZA 1CR4A 4NPHA 3SR0A 2UVQA 2JLYA 3CPHA 5KU1A 5EUMA 3LLUA 1OYYA 3CUEF 4ARZA 2WAYA 1ZAKA 4LJYA 3KB2A 1X6VA 2OLKA 2JJ1D 2J41A 3ONWA 5KPDA 1I4LD 2X8AA 2R6GA 2FZ4A 2W00A 4B43A 1OYWA 5LD2C 5C1BA 1VIAA 3RAPR 4H1UA 2REOA 3UMFA 3NBXX 3LVQE 3A36A 4A92A 3RS0A 5DGXA 5EXTA 2OZEA 4M8NE 3X1WA 3NH9A 3W8RA 1M34E 2ZI7A 1W2GA 5FTNA 5KNBA 3TSZA 4O3MA 2O8CB 2PMDA 4IXNA 4DEYA 4XVUA 4FMDF 5JWRA 1TQDA 2HUPA 2ZJBA 2CEAA 3GJ8A 4RD6A 5K8TA 5DI9A 2ORVA 2G1JA 421PA 1Z0KA 4P0TA 1T3SA 4E07A 2I3BA 5DNYB 4G1UC 4UNSA 3W6OA 4BPBA 3QI2A 2GJAA 4I1OA 2YKGA 2ATXA 3M4YA 3DDCA 2ZUCA 3A58B 1Z28A 1UADA 2AFHE 5CM9C 3FMIA 3RNLA 3TVTA 5JZVA 4WXRA 5KSOA 4XIGS 4BFZA 2G77B 4C9BA 4JLJA 1HURA 1OIWA 5KUTA 1AA9A 3A37A 4TMZA 1Q1ZA 4Q66C 1ESMA 1LFDB 4GOXA 2GHIA 2ZANA 2CLCX 2FN4A 2IYWA 3MUFA 3R7WB 1QHSA 4GMDA 1ZM9A 4V03A 2TMKA 1AKEA 1KI4A 1U9IC 2PCJA 4M9ZA 5TVKA 2A5GA 2XZOA 1E2KA 4OBEA 2J0UA 4TTQA 4ABYA 2ZRBA 5JWHA 4PC6A 4LBYA 2A2ZA 2JLRA 5TY0A 4AURA 3B78A 2PZEA 4JLBA 2N1BA 4DJTA 3PEWA 1FX0A 2BCJQ 2J9RA 3MHVC 3FMFA 4C0AC 4DLYA 1XTKA 4LV5B 2V3CC 1IY0A 4B3CA 1SVIA 3WRYC 1H8ED 1N5KA 1DTSA 4M2LA 2ZAOA 1YZLA 4B33A 3EA5A 4XWAA 1N6NA 2IXFA 4BFXA 2BMEA 2EFEB 2RGGA 3FKQA 3U60B 2W6JA 2WWGA 2ZE8A 4CYMA 3FE2A 2OCBA 2VP9A 2OEPA 3WHKA 4LK2A 3A4MA 5D3QA 1N6OA 2G6BA 1GTVA 1OLOA 3QG5A 1O87A 5EP1A 5FUYA 2HF8A 3BXZA 3EWAA 1N0WA 3HP1A 3LBNA 3BE4A 5SZHB 4QNRA 2ZRFA 5CB8A 2WICA 3V9PA 2OHFA 4RD2A 1J99A 3KB1A 2XTZA 2R6FA 3U3OA 2RAPA 1LVGA 1I2MA 3RRYA 4E22A 1ZCAA 1QHGA 1NIPA 1WA5A 1E9AA 2HYDA 5G53C 1HTWA 3TR0A 3MCAA 4IFEA 2BMFA 4MITA 2NQ2C 3MD0A 1N5IA 2VO1A 1YZKA 4QM6A 2GJ8A 1OXTA 2WJIA 6Q21A 2DWZB 3IO5A 1Z0FA 2ZQ5A 2F9MA 1E9SA 2XX3A 1F3OA 1U94A 4KI0A 4ZCLA 2W0MA 1RRGA 3V00A 3V4FA 2O8BB 1SKQA 1XXHB 3D3QA 3H84A 4NCNA 2EVWX 2QQEA 2BKUA 2QY9A 4Q7KA 4RJLA 2XSZA 2ZYWX 4EPYA 4YXWD 4AG6A 1S9DA 1RVDA 3LLMA 1UJ2A 1IM2A 1XTQA 3I32A 4PAMA 3U3MA 4IHQA 3QQ5A 1QHHB 2CHGA 3EZ7A 1OH8A 4QRHA 2IXGA 3WNBA 2OM2A 4JJKA 1OXVA 3DKVA 2PMKA 1JQJC 2ANBA 2QM7A 3A4NA 3CR8A 3QVUA 2YWGA 4JLAA 3KQKA 1P2SA 2VP0A 2YC4C 3QIAA 2WWYA 4PHGA 4GDFA 1EFHA 2UKDA 2GNOA 1A4RA 1EXMA 2O8CA 1P4SA 4LJ5A 3C16C 4NH0A 3GLIA 1U0HC 1Z0IA 4A2PA 2NO0A 3OEEA 2KBFA 5FI1B 2RGDA 4DSUA 3SYKA 1R0ZA 4OK5A 4C7OB 4M9QA 3I73A 4B3GA 1KI9A 3WBJA 4TYWA 2ODBA 4NHOA 4TL9A 2ZSEA 4LJ8A 4D0LB 1CXZA 1UBGA 1T6NA 3CLVA 3I4LA 4LPKA 4YLGA 4LHWA 1W5SA 4O0MA 5AJVB 4EQ6B 1GZSA 2ASEA 1D5CA 4LHYA 1EFRD 2QEQA 3C15C 4KCGA 4XD7A 1OH5A 3W90A 1GNRA 4EIWA 2VH5R 3HU1A 2DHRA 2JAQA 2B6HA 4K46A 2WWHA 2ZRDA 4LZZA 4GNKA 4QGGA 3H1TA 4B34A 3KQNA 1TMKA 2E87A 5DLQC 5HKKA 2NPFA 2RMKA 3OE7A 1CP2A 3OHMA 3Q8XB 2QMEA 3JVVA 2CLSA 5AWFC 4L16A 1AGPA 3T1QA 2GAAA 4D0GA 2D7CA 5FL3A 1JNYA 3CX7A 4UNRA 1R8QA 3QF4A 2Q3MA 3VU9B 5LD2B 1P9WA 1UAAA 2XTMA 5FI0B 3TLXA 3T5DA 2ZI6A 1E2MA 1N6LA 2DWQA 4PZLA 2JLUA 3CWZA 1UKEA 1F2UB 4B2IA 1CR2A 3EW9A 4ZCIA 2KBEA 5EP4A 5F98A 4TLCA 2F9LA 1TADA 2PJRA 1W48A 4E03A 2AK3A 3WBKA 4BLQA 2BEJA 1CIPA 2QUZA 4KITB 3GLIE 5LDDC 2NO9A 1MABA 3K0FB 1QRAA 1LB1B 2HJGA 1Z0JA 1AK2A 2CCGA 3KJGA 4PPNA 2KWIA 3U2QA 4E5UA 2ZR7A 3CWQA 1OIVA 2ZE7A 1ZU5A 3FWYA 1FPMA 3ZD7A 2C8VA 4QG7A 3BJIC 3NDBB 4P4SB 1KGDA 1OHHA 2NO1A 2O52A 1HYQA 5AR1A 1FW6A 3A1UA 4TTPA 4I1SA 1ZU4A 1W47A 3AKCA 5JLJA 1S3GA 4BFWA 1ZINA 4QGAA 1W36C 1RJ9B 4QKQA 2P6UA 1EGAA 2H5EA 3LVRE 4C3ZA 4IOLA 2QI9C 1G4UR 4C2UA 2PEYA 4LHXA
chains in the Genus database with same CATH superfamily
4J94A 5D5HA 3PDJA 2KJQA 1GL3A 1VB5A 4AJPA 1PJSA 1KA9H 2YNMC 3K4PA 5L53A 2CY0A 2FRDA 3UENA 4KL8S 2AE2A 4OOEA 2F1HA 3HB4X 4JP8A 1VDZA 2WUDA 2K9DA 3VJRA 3PR3A 5KQDA 4C20A 2YZ7A 3SQDA 1JBQA 3WK6A 4AUNA 3GRPA 1ZR2A 1LBTA 3NM6B 1SXJA 1JBEA 3KP0E 1ETUA 3G5MA 1VECA 3IO3A 4RPGA 1NSTA 4E11A 2COUA 3BL8A 4HXGA 1LBEA 3T34A 4DCOA 1Y5RA 2H7CA 2I5PO 3HPQA 4RHXA 3WMEA 1GPLA 4ZN6A 4A6EA 3ORQA 5SZJA 1N2ZA 4Y9UA 2DT5A 4RXMA 3ED5A 3P2JA 1YB2A 2QT1A 2X15A 1FFCA 3OT4A 1RLOA 3A9WA 3L5KA 5KVQA 4BNIA 1XPRA 3AUJB 1TRHA 2GK4A 4Y28F 4YREA 3U6OA 1ZYUA 3K9FC 5L6LB 2I3AA 3H4IA 4UTOA 2XE7A 1FY2A 2FLVA 1F5SA 1WDKA 2NSDA 2YICA 4B74A 1QANA 2BR3A 2MSWA 4OOFA 2VOEA 3CIFA 3HRKA 5FQNA 2VWPA 2FW8A 1G20A 4JI0B 2ZRJA 4H0FA 4ND5A 2OT3B 1C3XA 3D4BA 5AW5A 4G0VA 4CPDA 1LNSA 4MB2A 4E5VA 4TMTA 4ZQHA 2F8TA 2FP4B 4IX1A 4OQDA 4CEHA 1PWHA 5A9SB 4G0QA 1MJGM 2XXAB 3V8NA 2NU8A 4L08A 3ZIUA 4D43A 3LXUX 1EIZA 3L0DA 2Q9CA 2A0KA 1E7RA 2OV8A 3HFJA 5BMVA 4LA4A 4WCDA 2B4KA 4NNJA 2F1IA 3EIHA 4RE6A 4K9OA 4YWJA 2MSNA 1CIVA 1VSVA 1SWVA 6PFKA 4CIYA 3CJQA 5CR9A 2Z9BA 5LCXA 3OEHD 4AJHA 4GPIB 1ZD4A 4Z53A 2XYQA 5EP2A 3OQHA 5EVCA 4QC2A 4BQEA 1TFUA 4WSOA 2IYYA 1T9GS 4JSYA 1E1RD 1Z5ZA 1MGPA 5B1HA 4F5ZA 2ZT5A 4Q4JB 4Y9RA 4EI7A 3O8CA 1PFQA 4WUVA 2ODNA 2PKXA 3X1YA 3GUHA 4J7XA 1DC8A 2ZUBA 4TYMA 1YRWA 5AJUA 2X8WA 3MM4A 1MHTA 4BJ1A 1I3CA 4QTZA 5HZKA 1KP9A 4LNAA 1OI2A 2Z57A 5F12A 2FP4A 3CO5A 3GCGA 4Y0NA 3ZIAA 3NBIA 1UK7A 2XXAA 3CKMA 3EQ8A 3THXB 4L8RC 3F6EX 1RHRA 2AGVA 5AJXA 1MIOA 1W0KA 3LVVA 1E1CB 4Y30A 3MTQA 3SAVA 5T8KA 4EKDA 1PT5A 3L04A 2P1RA 3N2GB 5JRJA 2BOVA 1JSXA 2PLRA 3H9GA 3PQ8A 2FW1A 4JUFA 1EQ2A 2FOLA 2X2OA 2FHPA 4DR3M 4RA6A 1XWIA 4YDHB 3ZV6A 4JV5B 4WECA 4JJ6A 1GUFA 3C1AA 4J0EA 4Q39A 4P6VF 1YKFA 2NXJA 4XI9A 3U17A 3SOZA 5TDHA 1N8TA 3VR3D 5B7PA 4DJ5X 3T1OA 5K0SA 1U4SA 5K0FA 3HUDA 1Q5PA 4D9MA 3MRXA 2I80A 2IODA 4K6MA 4NQZA 3JTMA 1FNNA 3NHUA 3LX6A 1UPXA 2CUNA 3QH4A 1K08A 5CDFA 4K9RA 4MIOA 3T9DA 1XEXB 4LZNA 1O0SA 3HZRA 1X86B 3B7GA 3PQEA 4MULA 1OY1A 1RHKA 1NXVA 4G4SO 3A2KA 4L5AA 5ETJA 4DGSA 3NC0C 1Z3CA 4PLZA 3K0HA 2RSLA 4NX2A 1E1CA 5B3LA 2YQZA 4JXKA 4WACA 2QR3A 4AZ3B 5C7OO 3RNOA 3TI9A 1UQTA 4ZVPA 3K70D 2IH4A 2A3RA 2CW5A 1F1BA 1MN6A 4ITUA 3O92A 1GQRA 1OB2A 3EA0A 3WDSA 2HNAA 2O4CA 1C30B 4P36A 3DUFA 1IBMB 4M0LA 2O3UA 4DQXA 3HADA 3IOCA 2FAXA 3GAMA 2W22A 2NO5A 3HB1A 4CIZA 7CATA 1RLMA 4Z3DA 4BBZA 3W67A 2FSUA 3LP5A 2C97A 1F7VA 5TF4A 4ZGWA 5CIYA 4Z4CA 4TYPA 2VJMA 4P3XA 4K40A 1A1VA 3OZSA 4RK7A 4MGHA 1XEXA 3TLYA 4Z0HO 3QFTA 1FW8A 4QEZA 3TIGA 1Q3TA 3JTEA 1QDUA 1CUCA 1W75A 2J5YA 3H75A 1ATZA 2O4UX 4B87A 4HBGA 2V6JA 4C21A 2ZFUA 1H3NA 4JJGA 5JPIA 1XDDA 2ZK7A 4N8DA 4O6VA 4C7OA 4CLEA 1NNSA 5E4YA 4KR6A 2QT0A 4NBSA 4QJ3A 2GUWA 2TRSB 1SRRA 4MVJE 3I51A 2V3WA 4ZPJA 3LWDA 3TZLA 3DOIA 1F48A 3QWLA 1NJGA 4OMDA 2NZXA 3H2KA 1C30A 1Z7WA 4DUZM 3ELWA 4M7RA 4N6GA 1KJNA 1AXGA 2WR8A 2QWXA 2I2AA 5ICCA 2OGUA 1KZ1A 3BIJA 2WG2A 3NHPA 2R00A 4MUXA 3BSWA 3TE7A 5E9JA 1MV5A 3MJEA 5A7HA 2JLBA 3ZHQA 4LJ6A 3KP1A 3IELA 2XHZA 3ZUGA 1I24A 5KO2A 5AI4A 2QUIA 3D4LA 1E3MA 1FMCA 4H7JA 5CDUA 5KWJA 2W4QA 1RBYA 4BUCA 1O96A 1VYUA 3JAKA 2VJOA 4TTJA 5LDHA 4RTMA 4C0WA 5DRYA 2HPHA 3ISVA 1QMPA 4ARIA 5KBYA 5EVJA 3S2SA 3PWTA 2BHSA 4US1R 2XOEA 4EB8A 4WINA 3H04A 1Y9DA 2D0PB 2WSMA 2B8EA 1AQIA 3UJ8A 1UPBA 3DTYA 3AXTA 3QMVA 4BP8A 3U5ZB 1EGQA 4JL8A 2HM7A 3U6PA 3GHHA 3U7QB 4AJ9A 1VYTA 3MQFA 4E2YA 2H06A 2LVOC 2CJPA 3TMYA 2C9ZA 4GC9A 4HPWA 3HBNA 1NYTA 3ZWYA 4HT3B 4N7JA 4GPTA 3T7CA 4B73A 3OPXA 4L4RA 2MROB 4YAFA 1CYEA 4TV9B 2VAXA 3LYUA 3FUXA 3ETCA 3ZKWB 3FIJA 1C7JA 3JQFC 1FTSA 1PQWA 3E5MA 1NXQA 3E7XA 2H07A 3ST7A 4XM0A 2NU9B 2RHGB 3H6KA 7YASA 4UTPA 3SHVA 2O7QA 1UOQA 1XALA 2FSSA 3S3TA 3ZZNA 3Q2IA 2WQZA 4QFDA 4RQBA 1MFPA 2O05A 2UV8A 3KETA 2JBWA 4DLWA 4JOQA 5CPBA 2IOYA 3FHTA 4GS5A 5HZMA 5KC9A 3TTWA 3IP9A 3AR3A 3BHMA 2OHHA 2VBFA 4XGIA 5FI5A 1U3FA 4ZMRA 1D4ZA 4TOIA 2IPAB 1JDZA 5JSYA 4BRZA 3B85A 4Z9YA 4OQEA 3U5ZA 2C92A 4FCWA 5JQWA 3BWDD 2F4VM 4NE2A 1RXUA 4QUEA 2WG0A 4GGMX 4HMQA 4PBTA 4KX3A 2QYSA 1Q20A 1Q16A 3Q11A 1Y9ZA 3Q7RA 4TV9A 1MXFA 2DQYA 3ZKWA 3FWPA 1V37A 3UZUA 2PUJA 3E61A 4B3SB 2FMTA 2OWEA 2CMKA 2QE7A 1Q15A 1EBBA 1PFYA 4NJOA 3J81S 3N2YA 5JS7A 2PBLA 1E7MA 3J80A 4UUQA 2O3QA 2N75A 2Q0XA 1P3Y1 3IQHX 1X8LA 3EJ6A 5DT9A 4MYUA 1QQWA 2J0VA 2Z5LA 4DLVA 2QZSA 2H18A 2AYYA 3SY8A 4OA5A 4IQ8A 2G04A 3OPMA 4TTTS 4FSDA 5AK5A 3KJEA 3DC7A 1T9GR 5ALPA 1OIZA 6REQB 4F2LA 4S05A 2QL9A 3I8SA 1FJGB 3PGA1 4LOAA 1QHYA 5EIXA 3W1VA 2WB2A 4YI5A 1T0HB 1V8DA 2X2FA 3C41J 4GKBA 2VSOA 3FA2A 3LDAA 3D4PA 3CX3A 4O5OA 3LECA 4QQNA 2EGUA 4PG5A 4Z6YA 4B40A 5CVDA 3ZE9A 2IGTA 1P7VA 3MB8A 3ZJ5A 5HQJA 4QG3A 3OTHA 4LDAA 3DHWC 4INOA 1CUBA 2PG3A 3AERB 2CZCA 2SBTA 1DAGA 4DOMA 3ON5A 1YBAA 1EAMA 2WJ3A 5KYKA 4FLFA 4EYKA 3EGEA 1IBRA 1Y8RA 3H5WA 5E3HA 3UWOA 4HJXA 4YQZA 1F2TA 2ZYRA 4MVXA 2P9GA 2ZM5A 4HH3C 5CYOA 3UAGA 2IFTA 4NP6A 1XMVA 4A3SA 4HWSA 3OO1A 6REQA 2AXPA 2QW8A 3SXJA 1W44A 3RU2A 4H08A 5TT1A 1KC3A 5KTNA 3TR6A 1ZRSA 4YAKA 2B9EA 2BGLA 1NVVQ 2BJWA 3H6GA 2GA8A 4O4HB 5A9RA 3A9TA 4MRVA 3M5PA 2E82A 3K8YA 1PSWA 1Z0AA 2C4KA 3IBGA 2O8NA 5FIUA 2WFLB 4YIHA 1R0YA 3WYGA 1AOXA 4MVJM 4JJ8A 1IJKA 2QPOA 5LJLA 3S0JA 5C52B 2ZPTX 3WLMA 3N59A 2WJ4A 3U6MA 1PU2A 3EXFB 4NYJR 2VAPA 4V1CB 4HEA6 1S8AA 4RX1A 5FB3A 3THYB 3ZXYA 4F12A 1V16B 5JWOA 1STOA 1SXHA 3GO8A 1ZGCA 2XNJA 1G8PA 3CH6A 4Q9KA 1T2FA 3VO8A 3PUXA 3L4JA 1QIKA 4M49A 1OBHA 3U4CA 3HJGA 4IH4A 4I2VA 4JYMA 1WP4A 3VKWA 4DV0M 3VX3A 3E9CA 4HH1A 1DCMA 3GJ0A 3B53X 2AYXA 1H5QA 1PV1A 4A16A 2DCUA 1YR1A 1GXSA 3JQ7A 2KZSA 2VDBB 4BVLA 2F5PA 3DE7X 4LWOA 1B8UA 4FGSA 1J20A 1E79D 1Z4MA 4HNRA 4EL5A 1MXHA 4HG2A 1NNI1 3LC1O 2E6UX 3Q7TA 5HF6A 2OFWA 2V6BA 2RK6A 4IJ5A 3JD3A 1JAXA 5AI8A 4UFNA 2WFLA 4HH0A 2GBPA 5T4EA 2WZJA 4GXTA 3T1TA 4PC2A 1IVYA 1QB7A 4M0MA 2E55A 4BS9A 4F21A 2CZQA 1RWMA 2IUSA 5D00A 3GVHA 3UQZA 3U6DA 4F56A 3KJHA 1PWEA 1SR8A 3B9BA 4IIJF 2KI5A 3EXFA 4V38A 4U0KA 1NE2A 5B4TA 5J2TA 3UHFA 2PZFA 1TB4A 3GQ4A 4KIJA 3SX4A 3L7KA 2XKJE 3PVZA 4URFA 2JJ1A 4CHGA 1KF0A 3MGAA 3D31A 1WU8A 5DHFA 3C39A 4IVRA 3ZJ4A 3O0TA 1MW9X 3FOCA 5ECYA 4MTLA 2JGLA 1DOZA 1UZUA 4HO1X 4NSOB 3R3JA 2QX9A 4XOIA 2K2WA 2C98A 3ROGA 4ZRNA 2P41A 2QYTA 1OZAA 5BV7A 3MXTA 2Q21A 3GPIA 3K1AB 2Y77A 4UPEA 3LVWA 4MCAA 3ORYA 3UA4A 4JBYA 1Q57A 2VXCA 1E4EB 3WIEA 3VR4H 4HDAA 2O7SA 1EFVA 1B76A 1USUA 5CNIA 1TLLA 2MGWA 2HPZA 2LWXA 1RHMA 2VXOA 3EBOA 1CJMA 1CP3A 1YJ5A 3PUVA 2VT2A 5TGTA 2YYAA 2PNJA 2HSGA 3KXIA 2DFLA 2C78A 3E81A 3LGXA 1TTPB 2YDYA 5EGSA 2ZUTA 4K28A 3R1IA 5J59A 4GIPA 2QROA 2YDXA 1RS0A 4G63A 5FTMA 3AP3A 4MI3A 4YXWA 1U0RA 4GITA 2V5VA 3RBVA 1Q0UA 1JHDA 1UXJA 4G2TA 1XFDA 2IHYA 1R0WA 3RGGA 5CAEA 1IQPA 4NPHA 2JLYA 1KYVA 4AX8A 1IZ0A 3CUSA 3ZCBB 1Q50A 2P79A 3S2FA 4D3YA 4GYJA 3OZVA 1CSEE 3CC8A 4RTQA 3LVQE 3A36A 5EXTA 1P4JA 1M34E 5JADA 2YWDA 5CJJA 4QPNA 3K1AA 1JG4A 2HUPA 3I6QA 1IOLA 5DI9A 1CRWG 4G1UC 1TVEA 4QU9A 3PP8A 4HWGA 3RFTA 1A96A 4RFLA 1E4EA 2IOFA 4MWCA 1ZR4A 4FR5A 4CMEA 3BM5A 4FBMA 5TVKA 1MB9A 1GTMA 2VF2A 1E1MA 4KQIA 2EJBA 3UJCA 3H0CA 4FDUA 3F49S 2PYIA 1DIOB 1N5KA 2L4EA 2I76A 4EO4A 1E5DA 1X0VA 4W4TA 3HSKA 2I3ZA 5IKPA 2D7JA 3TAXA 1LX6A 5JNWA 1ZMVA 5CA0F 1NIPA 1E9AA 3EOAI 1KGSA 2ID7A 2BMFA 2WHYA 3ER8A 4NBUA 3L3BA 4O4IB 3M83A 1HMYA 3K5IA 2G9QA 5ICEA 4YV2A 3QVUA 2XTJA 4PAGA 4C7BA 4PHGA 3T7JA 2QHXA 3N0VA 4NV1A 3AHDA 1EYZA 3KLPX 4MZDA 1BVYF 1CXZA 4LPKA 4GZ5A 1EFRD 5AVRA 4EI2A 2HEGA 2W48A 2BUAA 1RR6A 4WLNA 4RJTA 4AUEA 5BURA 3OHMA 3W4KA 1U28A 2Z08A 3FD9A 1Y6QA 4HGQA 5AWFC 3DV9A 4HFJA 4LYEA 4NCXA 4YMHA 3B7NA 3L7AA 1U8TA 3DMGA 4ODIA 2JLUA 4FHGA 4N7RA 4ZCIA 2KBEA 3ZGOA 1V5GA 2F9LA 2A92A 2VSQA 2C2XA 2NT3A 5FNVA 2CMDA 1ZEJA 1I6KA 3ABRB 4CMCA 3KJGA 4QAQA 3BPSA 4GIBA 4E5UA 4EMBA 1L6RA 4Y1EA 5C51B 3R75A 1Z45A 3EK2A 2O5EA 4ZVSA 3ROTA 4ZEWA 1G4UR 1I4WA 2RD2A 4R2LA 4LKOA 5JOQA 4FGUA 3QOXA 4KQKA 2CLLB 1ESCA 2JJYA 2B21A 3D3EA 5TS2A 3K5HA 5EUQB 2P3OA 4JX8A 2VLIA 3DDWA 1HDGO 1MTOA 4MMZB 4B35A 3STUA 5DM70 4IW3B 4COOA 1YS7A 2OAGA 4R69A 5E38A 3FYCA 4W9MC 3BL5A 3QFSA 1KJWA 3T99A 5FPKA 3T3GA 3QVGB 1ISSA 3AIMA 4CV1A 4H7EA 1DBIA 3MPOA 1E2NA 3IHWA 4E2WA 2PX4A 3KQYA 1DPGA 3G17A 1XRLA 2UYQA 4MKXA 5G2OA 3GOQA 1U8EA 2XEPA 1JDJA 2ES4A 3IC5A 3BX1A 1TZCA 4WH0A 4UTXA 1IZ7A 1Y8QA 4E31A 3GYGA 1LPOA 3OEHA 4UCFA 3GFRA 2D5BA 2C4HA 1G2PA 3D6AA 1QPGA 1MAWA 1LTKA 4IQ4A 1TECE 4XXHA 1NRIA 1E1RA 3EFHA 4PC3A 4B31A 1X8XA 2G76A 1A7AA 3HB0A 1NW8A 1IUKA 1XMOM 5AHWA 4AJ2A 1D07A 3GRRA 4UEWA 4DEXA 1V5IA 2FUG1 4DABA 4OHFA 4EITA 4D81A 3ZDCA 3D3WA 2BCGY 4KQHA 3DNFA 3FCYA 3OJOA 3EF0A 2MHCA 5A03A 1USKA 4NXMM 3ZDRA 3QVGA 4ZI7A 1QIJA 1R50A 5TF0A 1EFDN 5E95A 3TOCA 5KOHB 5KPRA 3FRHA 2P6NA 2I65A 4EYSA 4FFWA 2PD3A 3KQLA 1NT2A 4PZAA 2OVFA 4Z4FA 1S01A 3TZBA 4DA7A 1J1IA 1P1RA 3OD5A 3TLKA 4CR6A 1ZH2A 3KSRA 2AC2A 3WQHA 1FFYA 4Y2XA 1I7SB 2P1ZA 4OB7A 4EHFA 1RWKA 2C1EA 4ZOAA 5BT8A 3RVBA 2J46A 2PGOA 5JD5A 3EXG1 3CRVA 1WXIA 1PR3A 5DTJA 1FYEA 3FJYA 1T2EA 2OCPA 3WGOA 4OMUA 1UM9A 3KSUA 2IU6A 3VR3A 3P96A 3UB3A 4EA8A 3D7MA 2EFYA 3ZEAA 1HPLA 1P0FA 2O0KA 1GPJA 2VDWA 5TQ0A 1RI2A 4DG5A 3DPSA 3TSOA 3V5NA 1E7WA 1P7WA 4I55F 1LF0A 1MA0A 2WJWA 4G3OA 5EE0A 3PGMA 3Q9NA 3QE0A 1GSOA 2HU7A 3TKYA 4L3WA 1JKJA 3K96A 1P17A 2XYRA 2E85A 1MGOA 3LH5A 4Y0AA 3CRW1 5B2ZA 1ADBA 3H97A 5HKOA 1CQIB 2O2JA 1PZNA 2GD0A 4K8RB 4KZPA 1E92A 5KOHA 4YAEA 1KK3A 1IZZA 2PH5A 3OA2A 3PQ2A 1P2UA 3LCRA 1SK9A 4IIBA 2L19A 1WMBA 4ZQBA 4FN5A 1I4EB 1J0DA 2GMWA 5E6UA 3G2QA 3C8DA 1XRJA 1OIPA 2JGMA 1CUVA 1P62B 3EZXA 5CLLA 4EG1A 4OQPA 1TH3A 2I9KA 1B8PA 2BMJA 4B82A 5B1YA 1O4VA 3QKRA 4CL2A 4BVHA 1J70A 1M2VA 3EGVA 3BK1A 3PFBA 4XYGA 2NO6A 1E4YA 2MYPA 2BONA 3UKDA 1L7VC 1D4OA 4B4KA 3FAZA 2JBAB 3GEEA 3FGPA 1U0FA 3O83A 4HAZA 2UYCA 2AMLA 2ZVJA 2ZB8A 4WIAA 2R65A 3OJXA 1SCDA 1M2NA 5BW6B 1GYPA 1P0QA 3PCRB 2Q5CA 2HJSA 3H9QA 1BZYA 2AK2A 3GMTA 2GCPA 2XNDA 3QLEA 1Z4JA 2RGAA 3DMNA 1R6BX 4LXYA 4RNAA 4KYTA 4C0JA 3L8GA 3MW8A 3B8EA 3BXOA 2FU5C 3N2EA 1QXSA 3I0ZA 3FR7A 4X62M 4HAIA 3R7SA 3I45A 3GPUA 1UKCA 1XTUA 4L0CA 2H9YA 4MDEA 4A03A 2BV3A 2Z1MA 2PUHA 2XRZA 2WSYB 1JB0F 2BLNA 4GW3A 5F4ZA 5J23A 2AR0A 3GLTA 521PA 3LHKA 5IVIA 3X44A 5I9MA 1JDVA 2BCEA 5HTKA 1JIIA 3G2HA 1RRFA 2PMFA 5HJ5A 1JHQA 4BMYA 3KPJA 5KX5B 3QBVA 4YONB 2H00A 2NSHA 3BFVA 4OL9A 4L15A 3G0GA 2BGRA 1DO0A 2QG6A 3AUFA 4RACA 4EVRA 3HWWA 2A3NA 2VSNA 1DAFA 2HQOA 5AVXA 4OH1A 5K8IA 4IBCA 2POQX 1G8AA 3F6BX 3T4UA 1ILWA 4HDOB 4NYMR 2C57A 4HRAA 3ESDA 4X24A 4IFBA 1SZJG 3EW7A 4L0QA 3OE4A 4IMPA 3DM5A 1FLAA 4H6VA 1ID1A 4D9FA 2A1UB 3EFOA 3CSSA 5CXSA 1ST2A 1XJWA 5E2AA 2D0IA 3CO0S 3CLRD 3R23A 5YASA 1W7AA 2NVBA 3KSMA 1V4BA 4EEZA 4YRZA 4EG0A 2C3YA 3ULKA 4ZQEA 3OBIA 4WV3A 3LXMA 5E4FA 3I53A 1DDOA 5HUJA 2ZE6A 2VHQA 4RNCA 1OX6A 4IUBS 1GU0A 4MIYA 3IRUA 4MR8A 1JAYA 1POWA 2LR0A 3ZHXA 1VXRA 3BYZA 3RC3A 2R4TA 1BAPA 4MPDA 2D3WA 1GPH1 3OLYA 2WNHA 3KZ1E 1WKBA 4UM5A 5K5EA 1W6UA 6ABPA 1EM8A 4BP9A 3LQRA 4C06A 4FXPA 5CXQA 2XVZA 3FTQA 5KJ1A 1ZGZA 3JS5A 4L6IA 2PX3A 2MSEB 5IUKC 1KHTA 2FX2A 4W1QA 1ZOLA 2JJ2A 4ZO4A 2PKEA 3BRSA 5CXUA 1IBCA 5AHRA 1I7NA 3W7VA 5GQSA 3DQPA 3EA4A 5IT9S 1QTRA 3NKVA 3PT9A 5FUMA 1HXHA 2J45A 3O2JA 4E21A 3CMMA 2A1UA 5AI5A 4ZOLA 5HIJA 1EXWA 4KR0A 3HY4A 4Y1FA 3DULA 2GERA 2IXAA 4OYYA 2QNIA 2OM6A 1K68A 2IT1A 4PFSA 3H3XA 5TR9A 3G0OA 5AKEA 1H6CA 3V3TA 1OHHD 3EOZA 1RM3A 5I9SA 1JAHA 3OM1A 4IBKA 1F14A 1I2ZA 2HQBA 1Q02A 3MERA 4Y18A 4ILKA 4F7WA 3WFJA 1UAYA 3BQMB 4GICA 5C1OA 4CISA 1W59A 4XDZA 1IXRC 3EZ9A 3K8ZA 4AF6A 3PQ3A 1JDPA 1WR8A 2VDNB 3TZQA 2IH2A 3AEZA 3MWKA 4JQSA 3KB6A 4PC1A 1P9RA 2R47A 5K0TA 1DEKA 3H11B 3QOFA 2WB4A 5EKSA 1AB6A 2FPIB 1D9XA 5HFJA 1ABFA 2Z58A 1LWOA 4JJZA 3R6LA 3A6DA 3AKEA 1E9FA 3DE0X 2QQ8A 3OAAD 4FMCF 3FTCA 4HTFA 2V1CA 3AF5A 5DHQA 1ZO8A 4J0JA 1DIAA 3CLTC 2AKYA 3BDIA 4TKLA 1JQEA 3RUCA 1VHQA 4RK0A 2ZQYA 1AQUA 1Q0PA 4DM4A 2NTJA 4ZCRA 4OVZA 1QRRA 5C1PA 2J31A 2WWFA 3QKUA 3RROA 4A0GA 3EAQA 1G6Q1 2YMLA 2P2SA 3NEPX 1LRKA 3SNKA 1IVNA 2IHJA 4G81A 4PF1A 4L4UA 4I2NA 3F5QA 4UOQA 3LKZA 5B7NA 2QK4A 4LHVA 4DY4A 1THMA 5AK6A 4PLFA 4UN2B 2BE9A 2DYKA 1FFXB 1OF1A 3NP7A 4ZIRA 4I6EA 4KVGA 1T34A 3RREA 2XMRA 1TC2A 4QTXA 4BCBA 1VPTA 4D44A 3EVNA 4D8VA 4DCVA 5JD6A 1PRYA 1E2HA 1GCAA 5TJHA 4CN9A 5L3VA 4YMUA 1NBAA 2LDXA 3N70A 3ICOA 4BGEA 4XD2A 1C9KA 3LRTA 2V5AA 1L4FA 13PKA 3M2TA 2PX5A 5ALXA 1RXCA 3HN7A 4IBGA 1FU7A 4LCEA 4WHMA 2PO7A 4I9GA 3NHWA 3C5WP 1TMOA 1P31A 4JH0A 3IIKA 2ZIEA 1I8TA 2I0FA 1T5OA 3TKAA 2X4GA 4J2OA 1RI5A 4WGFA 2PLWA 2IS1A 4QM7A 5FLXS 1FLDA 1QB8A 4RZ2A 4BTEA 1PP4A 3L1JA 1F6BA 3ICVA 4Q7MB 3IILA 4XUDA 2PQ2A 4HEJA 4OYHA 3I04M 4CF7A 3BOSA 3CNHA 3NI2A 4OP2A 4EX7A 2HZBA 3P4UA 3QF4B 3QK7A 5DOZA 3DZFA 4NAUA 2ADFA 5GIPE 2XLCA 2IY8A 1YONA 3VTZA 2HXYA 1FFXA 1D0KA 2Y99A 2JIOA 4UOZA 2YMQA 2CZGA 1QV7A 4ES6A 4FB5A 5GJVC 1EFTA 5DGTA 3D3NA 3QVXA 3WQSB 3RRXA 1TCBA 1A2QA 1E3DA 1FDUA 1D0VA 1PJ8A 2VZ8A 3TLGB 2XZPA 4RIGA 4EY4A 3NDPA 3PUKA 4IH1A 2Z8YA 5EJEA 2GEJA 3MGKA 4QPJC 2BISA 2ZYSA 1UKAA 2NMVA 3PFIA 2C9MA 1NU8A 2ZRKA 2P9YA 2RAVA 4B84A 4NRWA 3ROEA 4HP8A 1HDEA 3WLHA 2XVXA 4PLWA 3GMIA 1QE0A 2F00A 2GPJA 4DQUA 4RY2A 4U4AA 1SXJB 4RJKA 3GRUA 2PBFA 5I7EA 2UAGA 4D79A 4B71A 2FSPA 2HFJA 2ZIXB 2HA2A 5EEHA 3OPQA 1VHLA 4P5PA 1D1QA 1T0JB 1OYOA 3AK4A 4Z1MA 1I0ZA 3QWAA 1FTGA 3CB4A 4JBIA 4V0NA 3JQGA 4QYIA 2AKEA 4NOLA 4CN8A 1E79A 3WS7A 1L7PA 1B8OA 3HWX1 2F5QA 4KAXA 3E3AA 1CJUC 1DQSA 3UW1A 2EWWA 5KPZA 3FNQA 1PGNA 1N0IA 3N28A 3RSGA 7MHTA 3WBFA 4JT9A 1UBUS 1Z8HA 2PRIA 3ZWBA 4BLUA 3IBTA 2W2NA 3UXYA 4KW7A 1VL2A 4G1VA 1YB6A 1U8FO 5CT6A 2KNAA 1QPBA 1O94C 1Z07A 1DAEA 3JRWA 1GT91 2RAUA 2RB5A 1LLQA 4FEYA 4KN5A 2P78A 1TZBA 2HIGA 3D8NA 4ZAYA 1OE0A 1S2DA 3CU5A 1AC5A 2ZB2A 4IWXA 2ENUA 3OSZA 1UJNA 4B6SA 1HDIA 2ATIA 4HUJA 1G20B 2HR1A 4I81A 4O4JF 1YNSA 1NAHA 4HZUA 3RWOA 1RRPA 1EK2A 4BMOB 1I4DD 1W5AA 1BX1A 5KSWB 1ICIA 3D8TA 3CIOA 3VR5H 2ZIXA 3OESA 4FZ5A 1S2LA 2WM2A 3RJMA 3R2JA 3RDPA 3TWMA 2C0PA 3DVRX 1Q0LA 5CDHA 4BTVA 4CEHB 2CJFA 5CX4A 2NU8B 3D43A 2OZKA 4Q47A 1QG0A 3HCNA 2XVMA 4V0QA 4C7MA 3SN6A 4AI6A 2FFAA 1E2PA 2FPKA 1DL5A 2IXTA 4ON9A 1UM8A 4EB3A 5BMVB 4BIIA 4ZCMA 4R1UA 1DRVA 4LRQA 4FCVA 5IWAM 1HL7A 4OUKX 4UDOA 1N5MA 1XD2B 3NTRA 1N0VC 2VQDA 2R751 1E3IA 3TQRA 2ZDHA 5JG7A 2ZTLA 3I5YA 1NG9A 1W29A 3WLJA 4UQOA 1W8DA 4E6PA 3DYIA 5HBGA 3KZCA 2HLPA 4TUYF 4FDTA 5FD8A 3RUDA 3OD1A 1QF7A 2JPDA 1PJZA 4WESA 1A5TA 3RW9A 4ZVMA 2YXNA 3FPSA 3KVRA 2IOHA 3N8DA 3R24A 5JXHA 3NVMB 5HQ3B 5KJCA 1WU7A 2EYQA 3BAZA 3UT6A 2C04A 2PGNA 3WB1A 3R74A 2A58A 2WOJA 4KXYA 1W9HA 5EKXA 3C85A 3UQYS 4JYAB 2WTNA 4IKOA 1VJ0A 2CWDA 1HDCA 4R1OA 5KDDA 1MIOB 4D42A 4EEKA 1KERA 1J1UA 2ZAIA 3QHQA 1PJLA 4N39A 1GYRA 2I8LA 4RU1A 3FDXA 3WJ2A 5FOVA 2R6DA 1NXSA 3C4JA 3OQVA 1GITA 1XD2A 3VO2A 4B7FA 3DXXA 3TL6A 4TKMA 4QXAA 2PD4A 5JROA 4MVCA 3PC3A 1FP6A 3CGGA 3PE3A 4RA6B 5H59A 4NKRA 5A4MS 1KK0A 3HRHA 4QTUB 4FD3A 2FFRA 2JH9A 1U6IA 2GASA 1DAOA 3U0BA 3F4KA 2Z2KA 1FQJA 3E7FA 2A9RA 1CNFA 4M8SA 2ENWA 4ESEA 2A7XA 5JSQA 1C9DB 4BYMA 3Q6MA 4M87A 1JDBB 3N2KA 4IV8A 3M3HA 5HQ3A 1QVRA 4EMSA 1EVZA 5J1SB 2FZGA 3PGVA 3ITNA 4IQ0A 3NWJA 4CQMD 1KDRA 2H9IA 1L7QA 2DPLA 4C87A 1MC4A 1NQOA 2B8JA 3DSRA 3D02A 1T6YA 4YFYA 1ZOPA 1P19A 3NBXX 1E6UA 4GD3Q 5FUQA 4TWBA 3CTMA 3OZDA 2PSFA 3PDCA 1TQDA 2B1IA 5DSXA 2Q7DA 2ZG6A 1Z8NA 2G28A 2ZWAA 4BMXA 4RC9A 3I23A 4WXRA 3OOEA 4PYQA 3A37A 1Q1ZA 4JI8B 5AM0A 4EZEA 4CHTB 2BGIA 2R8YA 1RZRD 1AKEA 4YP5A 1U9IC 3DUFB 2VNIA 1VB3A 1RE1A 3KFUG 5FHQA 1JN0A 1VKNA 1VPWA 1SN7A 3FMFA 4EBBA 4DJAA 1F0KA 1XTKA 4RF0A 1YZLA 3RVOA 4YCMA 2E5FA 4KXUA 3NO4A 3B5IA 3V6MA 4R1NA 3KRTA 3Q3VA 1EJ6A 4XOUA 4D6XA 1DHTA 1JQBA 3M2PA 2VJMB 4KO4S 4EUKA 3U3OA 4E22A 2HYDA 5JATA 3F46A 1SA0A 3Q7IA 4QM6A 4MUNA 2DWZB 1UPCA 4MA0A 1FRNA 1I2BA 2I6SA 3VPBA 1RWQA 2JCYA 4N5MA 1UMKA 1IM2A 3LQKA 3RT9A 3DVSX 3OPYA 3OCJA 3PXXA 4BATA 1P2SA 4OQ4A 1Z0IA 1WW8A 2KBFA 3AFIA 2Q0SA 2WU4A 4C7OB 3ZCQA 1NBOA 5B1DA 1MQ8B 3OUZA 5L40A 4BMNA 1KPIA 1W5SA 4O0MA 1JKIA 2GSDA 5EYPA 5I7AA 1AZLA 1YJCA 5DP1A 3L79A 4H0NA 3E9DA 3PFNA 4CHTA 3DBVO 5BWOA 1PR6A 2K2QB 4E1VA 2P6MA 4GWKA 5AOAA 3WK4A 1NUQA 3FYUC 3VU9B 4H18A 4E5YA 2ZYAA 3HB9A 2VLBA 1CR2A 5DBGA 3GHYA 2AK3A 4CM8A 1NXWA 3TL3A 3QLUA 4P53A 3PUJA 3BJIC 2NNWB 3LPDA 4I1SA 3A4VA 2Y9PB 2AMYA 5BQXA 3O84A 4RK1A 4C2UA 2RGYA 2W6JD 1BW9A 2YWRA 7ADHA 3DFUA 1L5WA 1O96B 1K3XA 2ZJ7A 3B7WA 3JAKB 4EB0A 3S99A 3AFGA 1D1PA 2E18A 4G5SA 3ROPA 4J76A 3KTFA 1CF2O 3HA7A 4FZRA 1XOIA 4UD2A 5HW0A 4A8JC 2BIFA 2NZ2A 2H6EA 3IJ5A 3EB9A 2NU6A 3OURA 1MIHA 1FZQA 1NW6A 3KSDO 3BFJA 2PXAA 4WKNA 5TIIA 3MEQA 4LJAA 4IH9A 4E5KA 2XUOA 3QPAA 3LUAA 3IQDB 2M60A 2R8ZA 1BFUA 4ZZ1A 3DE1X 5AM2A 4JGBA 3LDGA 1TMGE 2QNBA 4KO1S 4DV5B 2C82A 4I50B 4BB0A 3EHEA 3VU9A 1YV9A 4CCWA 3UUFA 1EX1A 3IQWA 5HBRA 5LQCA 1AV6A 4YO7A 4AWBA 2HWKA 4CKCB 1MZPA 3RC9A 2AUTA 8ATCA 1QBKC 1FQKA 2PZMA 1YZFA 4A9AA 4JYCA 4DR2B 3U7EB 1CETA 1NOIA 2P4HX 3KS8A 2JCXA 2IPXA 3AF1A 2Q5QA 5FA6A 4UDNA 4LZJA 2FPGA 3PX7A 4R2JA 3UW3A 1Z3IX 1OUMA 3SS7X 2Z83A 1TVMA 2WP0A 2WBLC 3OOWA 1AXRA 1PO7A 1ML4A 4AYXA 1KRXA 3IVAA 3DR5A 2EFCB 2IZ1A 3C6YA 3UMCA 2XMQA 1B7GO 5DLDA 3HCOA 4QYSA 1QZMA 2V55B 4LMPA 4RF5A 4F4CA 3ZHSA 4HN4B 1XA0A 1EX7A 4PQFA 2FQQA 4QGBA 4JC0A 1ZMOA 1USWA 2Q6IA 2B25A 1FVOA 4RPLA 1N9ZA 2R7MA 4IG4A 3ELDA 4I50A 3WLRA 4OI0A 2XWSA 3ANLA 1IOVA 1PK7A 3L84A 1KETA 2OHIA 3TOSA 3M34A 5EQJB 1HOTA 1ZK0A 1E5QA 4CKCA 2PFGA 3IL2A 1B3RA 1SHTX 1UPFA 1SRQA 3H3FA 5PGMA 3A2MA 1CY6A 3URKA 1N3IA 3U6SA 3ZQ6A 2WHQA 3V4OA 1A0OA 4HNSA 2NVUB 2X0FA 2AUNA 5I9BA 2IOFK 3UUEA 4UU7A 4ZVRA 1Q19A 4A2CA 4DR4M 5BRNA 4DUYB 4W5RA 4PRYA 1UAGA 1U8ZA 1N32M 3A1VA 4HVCA 2BM9A 4QRIA 3E8XA 3SXUA 1UH5A 1DWOA 1QHXA 4J0FA 1KKMA 3TG2A 1JZTA 3KR1A 2EU8A 2C3PA 3RRFA 5AJYA 1GU1A 1NBMD 4CKWB 2PVPA 2GBLA 3ROFA 4B8ZA 2IEAA 5HSGA 1YRAA 3AI7A 3WP0A 1AF7A 3PSAA 4RTSA 2ZUSA 2DH6A 2PS9A 3LQYA 4RKYA 4J1TC 4GG1A 4N0MA 4I0WB 4WA8A 5LB4A 1NJ2A 4AS3A 4RZ3A 3U6EA 2OYRA 4Y6QA 2MMCA