4LJ6A

Clpb nbd2 from t. thermophilus in complex with amppcp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj6A01
2OZEA 2PEYA 4LHZA 1WMSA 4DB2A 2VSFA 1ZM9A 5B30A 1G7RA 1G18A 1MO6A 2B8WA 2FEMA 4IKEA 2VF8A 4TMXA 4B35A 4WAUA 2W6JA 1NJFA 4V0LA 3ZS9A 4NYJQ 1E4YA 3AVTA 2J0QA 2GXSA 4M0LA 1LS1A 1SXJC 4MQBA 1AGPA 3NBZC 4Q19A 1XXHB 4RFVA 1RYHA 4GDFA 2R6DA 1O3YA 1X8KA 4HATA 2VA8A 4MYCA 3L82B 5KNDA 3IQWA 1P9RA 1RZ3A 3AVPA 5LDDC 5EXSA 3CF2A 2NGRA 3CLVA 3K0FA 1KDTA 1W7AA 1DELA 1DAEA 1Z83A 1XD2B 1L4YA 3BXZA 1OPXA 4IEIA 4UNNA 5FR1A 3SI7A 4HUQA 2FDCA 4TYYA 1UKEA 3NDPA 2JAQA 4NHOA 3Q5EA 1KMHA 4S35A 5FH9A 5EP3A 1QF9A 4B71A 3AF4A 2ZROA 1XMVA 1E69A 1YR6A 4JVLA 3MSXA 4A0RA 2B6HA 4ZIRB 1OB5A 4U5XA 3AGPA 1PLLA 2YWGA 3E5HA 4W5HA 3TQFA 1R7RA 1IY0A 3WNCA 1KK2A 5HPYB 3GJ0A 4M1YA 1P9WA 4KITB 1YZNA 1T0JB 1Z6XA 3MAAC 1E9BA 1P2SA 3D8BA 4HLUC 3RSOA 2X8AA 2LCFA 1Z2CA 1CR1A 3B1YA 3Q8XB 2DWPA 4M22A 3T1QA 1CULC 2G3YA 1US8A 2RGEA 5EE9A 2O8BA 1AS2A 1X1SA 3NBFA 4BRUA 3U3OA 3LX5A 2ZRNA 1Q3HA 4J0QA 4RD6A 1E9SA 3K0AA 3DKPA 4QJ4A 2ZQ5A 2HV8A 2PLFA 4Q7MB 1W5TA 4JYCA 1T91A 4NCHA 1YKSA 2WWGA 1MO3A 4D82A 3GLFB 4D0LB 4TLBA 3WRYC 3U3JA 2OXCA 1I4DD 3GJ7A 1NBMD 2NIPA 1R6BX 1VG1A 1DBSA 1ZNZA 4NE2A 3CPEA 4JLMA 4JKYA 1VYUA 2FSHA 3ICQB 2ZAOA 3OEHD 3W3AA 4HB2A 3L0PA 3LBIA 2Q0HA 2WWIA 4G5OA 1ZAKA 4G5GA 1EX6A 3PUZA 2WHXA 3KZ1E 3T5DA 3PJRA 5JEDA 3AV0B 3RS7A 2O8FB 3ZYCA 3K9LA 4UXJA 3IGFA 3QF7A 2WPDD 4H9GA 5CITA 2ODBA 3EC1A 4CZ2A 1MABB 3KKNA 2P3SA 2QROA 3BFKA 3BAFA 1AS0A 1OSNA 1W46A 3B85A 4MYTA 2VYFA 1YRBA 2X1VA 3FKQA 3TSWA 4BQSA 1XB2A 5KSYA 2GZDA 3CNOA 2GNOA 2FSIA 4B2PA 2REXB 3FE2A 3PUWA 4HZUB 4KVAA 3BIFA 1G19A 4M9ZA 2OE2A 3OEHA 2ZVPX 1F2UA 3C16C 3H0KA 4PC3A 2NOAA 1JQLB 1C9KA 3PUYA 4HLCA 2EYUA 3GJ6A 4CGZA 2H17A 4B48A 4LGMA 2EFEB 2NO1A 5EQTA 2WPDA 3GJXC 5BQ5A 3KFVA 1AN0A 1XEXB 1XTJA 2FSFA 3W6OA 4OQMA 2XZLA 5E95A 2GJ9A 4RD4A 4CVNA 1WQ1R 4Z8XA 1U90A 4LJ8A 1IBRA 4UJ5A 4DCUA 5JMTA 4M8NE 1ZD9A 3JVVA 4FWDA 4OQFA 2YJTD 2QUZA 2D2EA 1CR2A 3B1XA 1W49A 4PO1A 3SJCA 3QG1A 4MRVA 1G7SA 5F98A 1NLZA 3EZFA 5ANRB 4DSOA 1SGWA 4NPHA 1D2MA 4PPFA 4RCYA 4TQ9A 1FTSA 4XVRA 1M74A 4NYMQ 4HDQB 3TLXA 3UWOA 3SU8A 1N0VC 2O8CB 4E07A 1WB9A 1T3HA 1OXTA 2NZ8A 4WZBE 1HQCA 3VU9A 3FB4A 1JNYA 1T3SA 3VAAA 3K9HA 4OHXA 1YRAA 3U4QA 1WBBA 1OFHA 4KO8A 2WWFA 4LDJA 2QBYB 4MYHA 4A6XA 2J0VA 3THYA 3AP3A 4OQLA 3OE7D 2YWEA 3WYAA 4Q9HA 4B44A 3O8CA 1FQKA 2GAOA 2IYWA 4PO9A 3UG7A 2V6JA 4M1SA 3EG5A 3REGA 3CR7A 2YINC 4C9BA 1NVVQ 1HYQA 1KZGB 3FPAA 3VKWA 4JT4A 2R6CA 4L8GA 1U98A 3UPUA 1E2PA 3B78A 1U0LA 4Q4HA 2NO9A 2C2HA 3DDCA 5KTYA 3GLGB 3R8FA 1E2QA 2GJAA 3GLIB 4PPNA 3LVQE 3CRVA 1KZ7B 4CW7A 1FX0A 3ZGXA 5EP1A 4Q00A 4I81A 2I1QA 4M53A 4B33A 1E1QD 1XD9A 1TAGA 4LCBA 4KFSA 4XVQA 1CP2A 3ZVNA 4PC7A 4YC7A 5HKKA 3OE7A 3QXXA 4KYIB 1ZM2A 2WOJA 4QNMA 4C0HA 5DNYB 4R9UC 2NO0A 4JBXA 3S1AA 4H1VA 5J40A 3CW2A 2ZE5A 2GJKA 1II8B 1Q1ZA 1UBFA 2FPLA 5FBWB 3VTKA 1OT3A 4V0NA 2ZJAA 2CL0X 2XNDD 4LJYA 2Q6TA 4URXR 3RYTC 2A9KA 2JLWA 2E1RA 4GP6A 4RZ2A 1JJ7A 1RKBA 2DZNB 3SJBA 4EQ6B 1N5LA 4XVUA 5FL7D 1XWIA 2ZPTX 1QBKC 4X8LA 1S1CA 2JDID 4GMXA 1G17A 5A0FA 3Q72A 1P75A 2GEVA 2EWVA 1IN6A 3U2QA 1F2TB 4BE7B 1KI6B 2GZAA 1Y3AA 2PMDA 3AKCA 5DISB 4ZO4A 3MFYA 1E1QA 4LYFA 3EC2A 2PJRA 1AQYA 2WJVA 1RIFA 5D3MA 2RHMA 4LJ7A 2W6ID 3QKTA 1BO6A 4Q02A 2CNWD 4JLBA 3NEYA 2FPMA 4OQNA 3PIRA 4LC1A 5AJVB 3U7GA 1VHTA 4JL5A 5JLJA 5LD2B 2XNDA 4DLXA 3BH6A 1UEIA 4YXWD 1KHTA 2YOFA 5FL7A 1RRPA 2IUSA 3ICEA 2JDIA 2O5VA 4CT4B 2CMKA 2J3EA 4M4SA 2RHDA 4DDWA 2FZ4A 2BCJQ 2WBLC 3LRPA 1XTQA 4TL9A 3VLFB 3MHVC 1GKYA 1OF1A 4TL8A 4O25A 1TQDA 3A8TA 3VNUA 1L7VC 2FFHA 5HTKA 3ZZTA 5LD2C 1QVRA 2W00A 2W6IA 4I1OA 1VG0B 4UXIA 5HCIA 2CNWA 1R8SA 4BRWA 2REBA 1XBTA 4C0QC 3BGWA 2CE2X 4C0BA 4M1TA 2QU8A 3SE0A 3DO6A 4YDSA 2XSZD 3QXCA 5GVSA 1XDBA 4YXWA 1YHNA 3AF2A 1E2LA 1GFIA 4ITRC 1JR3D 4US0R 2BBTA 4IOJA 3WNDA 3LD9A 1S1MA 4DBLC 1XTRA 3C15C 3P27A 3HU1A 1JALA 2I3BA 4GZLA 4JJZA 5EXPA 1OH6A 1IY1A 3TGPA 1GNPA 5IHPA 3VR6A 3HYTA 1YVDA 4MRRA 4KLZA 2F55A 4W5WA 1J99A 2E87A 4LI0A 4MKGA 2CBZA 2VIIA 2VBCA 3SEAA 1ZYUA 4JN6A 1P9NA 4TLCA 1JBKA 5K8TA 1EK0A 1NBME 3FYHA 3QF4B 4LV6A 5DN6A 1Z6AA 4XTRA 3BK7A 2F1HA 3JVUA 3R7WA 4AKIA 2ZITA 1P60A 1HE8B 4JMPA 2J41A 1HQYE 2XSZA 1CIPA 1CKEA 2F7SA 2H16A 3L43A 1K5GA 4CT5A 1NKSA 1ZVQA 1JR3A 3A1UA 3B5JA 1W4CA 1ZCAA 3WP1B 5JBQA 3EZ2A 5JZVA 1A4RA 1KSHA 2ZYWX 3T34A 5HZKA 4ZDJA 1F3OA 1Z8FA 1F5NA 2IHYA 2KRKA 3I8XA 1G3MA 3THWB 1QZXA 1PZNA 4JLOA 4UXHA 3UXMA 1SHKA 3GEHA 3TIFA 5C1BA 4H1UA 5FPTA 1N2CE 2DYKA 4Q5IA 4ABYA 1CJUC 1OIVA 4TTPA 1IM2A 2R6FA 4L9SA 2W58A 2EYQA 1PLKA 3RAPR 2ZRIA 1OXUA 4LBYA 1P2TA 2GTPA 1GG2A 5FI1B 4POAA 5FOVA 1YR9A 5CJPA 1VIAA 3D31A 5BYKA 3AB3A 3W3ZB 1E2KA 2LKCA 1UFQA 4FCTA 5CDFA 4RZXA 1GVNB 3GP8A 1XZPA 1NY6A 5EUMA 5JSZB 4QHSA 3SDZA 2YC2C 4NCNA 4Z51A 4L16A 4CF7A 4ESVA 2EQBA 3RWOA 2ZJYA 4I99A 2I1VB 3KJHA 2QEQA 2OUKA 4Q4JA 2ZI9A 2GVDC 2QMUA 3AH8A 4BLPA 4Q7KA 1XFAA 3I1FA 3O8DA 3G82C 2RAPA 4PANA 3KJIA 3CNLA 4LPKA 5TVKA 3AVVA 4PSAA 2WJGA 5EP4A 2XJ9A 3FKSD 2IS2A 1IN8A 3KDSE 3HP1A 1KSFX 3TK1A 5GJBA 5JEEA 3ZD7A 1GL9B 4TZ0A 1NNEA 3PR1A 1TL7C 2QTHA 2OBMA 5C18A 3IIKA 1ZP6A 1FW6A 1NVXQ 1I2DA 2MMCA 4KSBA 4XH9B 2ZUCA 1U81A 1R0YA 4DUGD 1G5RA 4JKIA 3OFND 2IYQA 1W36B 4B3GA 4QOSA 1YZUA 3QPWA 1FNMA 4R2IA 4WIAA 1MT0A 5HE9A 4OK3A 3NVAA 1E9CA 2MMGA 2ZJZA 1JJVA 4MRSA 5AUQA 3SJZA 3X1WA 2QQ0A 2PZGA 4TN1A 3VX3A 3WXMA 5J5CA 2GZHA 4E5UA 1E2DA 3ZVLA 1D9ZA 1ZC4A 5AUNB 2IWHA 4IJMA 1GKUB 3AM1A 2O0JA 3QKSA 3U6KA 1NG1A 2JJ2D 2XZPA 3FKSA 3W8NA 2UZ3A 3R20A 3U44A 1Z0KA 2CDNA 4LRSA 2HF9A 1E9RA 4LYHA 4XWOA 2N1BA 2GK7A 1W36C 4RFSA 4URUR 3BH0A 2FEOA 1N3BA 4NKRA 1XZQA 3A4NA 1D2NA 2A5FA 3IKJA 1K5DA 1G16A 3VMFA 1EFTA 3NIBA 1DO2A 1TU3A 4DUGA 1XTIA 5L3QA 3OFNA 1P4SA 4BLTA 2J46A 2NO6A 4Q1CA 2VSOA 1AM4D 4G3XA 1FQJA 3KJGA 5J4HA 3EPKA 2A5YB 4C4PA 5CB6A 4JLJA 2OCPA 4DT1A 2WIBA 3OHMA 5IRCD 1NG9A 3C41J 5E3HA 4DLRA 3CIOA 3OESA 4Q4AB 4D25A 1SXJD 2ZRJA 1IQPA 2JJ2A 4A8JB 1EFCA 2HEIA 2V6IA 2OEPA 2GHIA 3DL0A 4A0HA 3KFXA 2H92A 3U7FB 3KJEA 4NP6A 2GWHA 1QG2A 4PFSA 1U99A 1YZQA 2BVNA 2O8EB 2IHBA 3D3QA 3QJYA 1CRPA 3HR7A 2YV5A 1PUJA 2OAP1 1B0UA 4QBIA 3REFA 3WBKA 5JJLA 1SVWA 1Z0DA 4YMWA 1XEWY 2BV3A 1CXZA 3UKDA 1E2IA 4FCVA 1OHHD 4BECA 3CH4B 4PZLA 2R9VA 2ZAMA 2QT0A 4PAOA 4A8JC 1RYFA 5LB4A 4PTLA 2D74A 4GOJA 4WXPA 2FJUA 4LY6A 1MR3F 1TQ4A 4IDHA 4TMVA 3FHCB 4A15A 1SXJA 2WTUA 4M21A 2BBSA 1SZPA 3VR5A 1JPNA 4TZ6A 4C0KA 1W4AA 5JS7A 3ND9A 1LTQA 2DB3A 2Q9AA 4JS0A 2IYUA 3AKEA 4NH0A 1LS6A 4URZR 3BB4A 3ZVMA 1COWD 1MV5A 1KK1A 4A3VB 3SYNA 1XRJA 3UANA 2GEDA 5EXXA 1KJYA 4Q01A 3PITA 3I32A 3QPUA 5DSZA 4BFWA 2PX0A 2BBOA 1J90A 2Z83A 2ERXA 1Q0UA 5JI2E 4BGDA 1OHHA 2AHOA 4N0DA 3FTQA 1U0JA 4NCIA 3KXLA 1XXHA 5FR2A 3JZMA 2Q3FA 5AUPB 1RC8A 2WJYA 4ZDWA 3W90A 3GEEA 4EPRA 4AYXA 1HE1C 4ZI3A 1AQUA 5AJWA 1JR3E 2ZI6A 4GNKA 4Q4LA 1D9XA 3A1TA 1E3MA 4BEJA 1XD2A 3MMPA 4P4UA 4UNRA 2G88A 1CF4A 3BB1A 3ZH9B 2XAUA 4URYR 4AK9A 4EJSB 3EPHA 3EA0A 4PQYA 4C0JA 1COWA 1F48A 3BH7A 2ZRFA 1V5WA 2JEOA 5TDHA 1B23P 2QSYA 1QHSA 1JEDA 2ZR0A 1G9XA 1DG1G 3AKYA 3FOZA 4ZIRA 4FINA 2FV8A 2HJGA 2RCNA 1NMZA 4Q48A 4GITA 3CRMA 3B6EA 3K70B 1CJMA 2RGDA 1SVLA 1FZQA 5FTMA 2FU5C 2CHGA 2H5EA 4QXAA 2ZSEA 3AUYA 1NN5A 2DWOA 3THXB 3HR8A 3A1SA 5D3QA 4EJSC 3A58B 4M1MA 5FPKA 4FIDA 4PPQA 1WBDA 2W0MA 5CDFE 1EG7A 4LJ9A 3TJZA 5FOXA 3P1JA 2DCUA 3KTAB 5DI3B 3VR4A 3X1DA 2C9YA 5J4KA 1Z0FA 4EPVA 2BCGY 2KE5A 4LBZA 2JA1A 1WF3A 3K0CC 1AK2A 1W4BA 2FZLA 5EZ5A 3K70C 2XJ4A 1OKKD 3MCAA 3GLFA 5HCNA 5SZIA 2X2EA 1N5JA 4E09A 1M7HA 1XEFA 2OFXA 2V6ZM 1TUIA 2XTZA 1GOTA 1Z6TA 2AFHE 2AKAB 1DAFA 1WCV1 3OAAD 4QGFA 3DOFA 3LDAA 1NRJB 4WVFA 4ZKEA 2IUTA 1R4AA 4U02A 3TH5A 4OHYA 4IDPA 1E0SA 1HURA 1BYUA 2ASEA 4B43A 3A1VA 3NHBA 2QPAA 3AUXA 3NTUA 2W2XA 1XP8A 3B13B 1RRCA 2XITA 1XCPA 2OBLA 2V7QD 5FBRB 3WYGA 5FBVB 4DKXA 2WVJA 3BE4A 2O8FA 2HLDD 1KIMA 2CLCX 2PT5A 4JLKA 1TUEA 2VSXA 1MABA 2C9OA 1ESNA 4FI3C 1A5TA 1OYWA 3AJIB 1GP2A 1ZC3A 1TF5A 2EW1A 4DIEA 1OKKA 2OG2A 3I92A 3LVRE 4M1WA 2ZS8A 3OAAA 4HZIA 2AK2A 4LJ5A 2XB4A 3X1ZA 5CM8B 2IXGA 2W2VA 1JEEA 4GOKA 4HZUA 3AQ4A 4RZ3A 2ATVA 1NSTA 1S3SA 2VHQA 3IIJA 3QNUA 1YR8A 2QMEA 1UPTA 2P6RA 1SKQA 1KK0A 3CPJB 1XJQA 1GITA 4PAMA 1OFUX 4FMDB 3GFOA 1IY2A 2JLQA 1W5SA 2OV2A 2V7QA 4TMKA 1CJTC 4EFNA 2Z4RA 4BFZA 4EUNA 2HLDA 3NBXX 5E7JA 1E0JA 4O3MA 5C46F 1R10A 4RD1A 4AG5A 5HZHA 1P3JA 1KKLA 3ZD6A 5JHGB 4RD2A 1M7GA 2QM8A 1Z29A 5L3VA 3AVWA 2D3WA 2GRJA 1VG8A 2YYZA 4DB4A 3BORA 1G8YA 4XTCS 2R62A 2AD5A 1UBGA 4LPSA 1ZW6A 4P4SB 3SYLA 1M34E 1TNDA 3IHLA 4RD3A 2BMDA 5GVRA 3FVQA 1G3UA 1J8MF 1GIAA 3F0TA 3GJ5A 3ND8A 2VP0A 1P73A 2D4HA 1M8PA 2WIAA 1OV4A 3GCGA 5SZKB 2YWHA 4PHGA 5C4MA 4RKFA 4F91B 2Q3HA 2KI5A 4E22A 2ANCA 2J0UB 3B2EA 3KB2A 2QBYA 4B6FA 3ASZA 4WW0A 2F3TA 4FWGA 2QN6A 3RDPA 4A9AA 3IDQA 3EAQA 1Q12A 2EFDB 1SVMA 5GJVC 4LUCA 1FUUA 1QRAA 3AP2A 4GPTA 2AN9A 3PEVA 3K9GA 1FTNA 1A2KC 2PX3A 1Z0IA 3P32A 2FSGA 3LFUA 5BW8A 3X1YA 1RJ9B 1UBEA 4TYPA 3TRFA 2GK6A 1ZD1A 5CLQA 4OJQA 2IL1A 1C1YA 3ADCA 4CEHB 4MITA 2ZUDA 1SXJE 3DZ8A 4KCGA 2JJ8A 3L0SA 5SZJA 3GLGA 2WOOA 5JWRA 1NN1A 4G0NA 1H8HD 2WWHA 3SS8A 3GLIA 2GAAA 3V4RA 1U8ZA 1NI3A 2REOA 2VEDA 2OCAA 2VHCA 2B7CA 3VKGA 2IYTA 1GZSA 4G1UC 3FWYA 2UZIR 1E32A 3KKMA 3MLEA 1FP6A 3DM5A 1W44A 1ZD8A 2HCJB 4Q1DA 2B92A 3PUVA 4AD8A 4RCZA 1NMYA 3WHLA 2GCOB 3J81k 4NTZA 3K09C 4NCJA 3VR3A 5KUTA 4UJ3A 3IILA 4DJTA 1II8A 1XXHE 5BN5A 4AG6A 4QM7A 3PQCA 2VL7A 1XMJA 4BZQA 5F3WB 3H1TA 4IOMA 5LBIA 4LOAA 3VX4A 1ONBA 4TMTA 4B6EA 4EQ6A 2W0SA 1GUAA 1NVWQ 1W1WA 1ZIOA 1UJ2A 1X6VA 1H8HA 4S2EA 4D4KA 3FHTA 4RD0A 3AP1A 2WJJA 2V4ZA 2Z6VA 3CZPA 1F2TA 4NYIR 1KI6A 2AWOA 6Q21A 3M6AA 1LB1B 5KU1A 1SKYE 3EX7C 3HDTA 4ON9A 1R0WA 3BC1A 4ZV4A 1OFIA 1NN3A 4L9WA 2CCJA 1GILA 1OE0A 3K9NA 5JFGA 2RB4A 3RRZA 3SQWA 1NSFA 4Y0AA 1GL7A 1Z22A 3NEJA 4B3CA 1UKVY 2GESA 4A2WA 4C7OB 3A4MA 1EGAA 2OO7A 1G41A 3FFBA 2DHRA 1QHHB 1AA9A 2IYYA 4FMCF 4HAYA 1KI9A 5HKKD 2ZU0C 5JWHA 1G8HA 1KJWA 2FMXA 1U94A 3TVDA 3CBQA 3L8ZA 4TLEA 5DLQC 4EFMA 4FCWA 4PC2A 5TV2A 5TMPA 3QI2A 4DVGA 2HXSA 5GJCA 3DKVA 4EAQA 1G4AE 1DEKA 4MRPA 5EP2A 2C77A 1LVGA 4UNSA 4EPXA 2AR7A 1PJRA 1P72A 4PC6A 1E9EA 1FP7A 5BN4A 4US1R 1IONA 5FFMA 2WZQA 2CE7A 2ZYTX 5GJWC 1TF2A 1EFUA 2VRWA 4JVNA 1CEEA 2YHSA 2P6NA 3I4LA 2ZJ5A 4K8OA 1X8LA 1BIFA 2ZREA 2BIFA 3E1SA 2EU8A 3CM0A 1S9DA 2ZYUX 2BDTA 2CHQA 1QG4A 1JAHA 3OZXA 3ADKA 1G291 1N6KA 2DFNA 4URWR 4OL0A 2PLRA 2AKYA 3B7GA 1CRQA 2WMOB 3A37A 3THOA 2ZI4A 2IS6A 4KYUA 4ZDKA 2Z0MA 2ZJ2A 5EE3A 3TKLA 2EFGA 1JXMA 3TR0A 1J70A 1GTVA 2W2TA 3EZ7A 3QBTA 4GFDA 1G8PA 5IT5A 4B3BA 2DR3A 4TTQA 5G41A 1N6RA 1G5PA 4GZMA 3QEOA 2WWYA 4Q1BA 5EXTA 1M7BA 4YMTA 5B58C 3CWZA 3QF4A 4HB3A 5TY0A 3LY5A 1T6NA 2ZS9A 2JLZA 2CL6X 2KWIA 1IN4A 1J8YF 4O0MA 4EPTA 1RW4A 4CDGA 4TWZA 4DEXA 4AWXA 2KB0A 4DLTA 3BD9A 2VH5R 4JBYA 3MJRA 5E4FA 4LK2A 4DZZA 1DARA 1VCNA 2ZSBA 2C95A 3RHFA 4F4JA 5AJXA 4ZCMA 2OHFA 1MO4A 5FOSA 2IUUA 4F93B 5KO2A 3LH5A 4G5RA 5FI0B 3ZLJA 5AJZA 1N6OA 1W2HA 1NF3A 2OXRA 1HT1E 3EIHA 5FBLB 2P2LA 2DWZB 3THWA 2RGXA 5B2ZA 2WKRA 3KXKA 2R2AA 4UNPA 2XNSA 5KDDA 1E79A 1NMXA 2IC5A 3LXRA 4KVGA 2G0TA 2ZI3A 1PUIA 2RGNC 4OI4A 4X8OA 3R9XA 2IA5A 4RVCA 4KHZA 1SVKA 4C2UA 3C14C 5DYIA 4RJLA 1XU4A 4BFSA 1OH7A 1KI3A 2CJWA 3TMKA 3SHFA 1VPLA 2R6GA 2VQSA 5CK4A 4RY2A 1XX6A 2IBMA 3VU9B 421PA 3A6PC 1X3SA 3LLMA 2IK8A 2C98A 3LV8A 4QGAA 2WSSD 4Q9KA 3QENA 1OXVA 1ZM4A 3RC3A 2V8OA 3PENA 2ZJ8A 3CPHA 5DN6D 4XJXA 1NP6A 4B2IA 4AI6A 621PA 1WDTA 2AXPA 2H57A 3IO5A 3V00A 3GQBA 4ACAA 1W36D 3ONWA 5H70A 1N6IA 1TPZA 3K53A 1BS1A 1J7KA 3EZ9A 4DLWA 2BBWA 1IXZA 2AK3A 5DHFA 1U9IC 2C78A 4JSTA 5FUWA 1G7CA 3CONA 2QRNA 3RSLA 3LQQA 3QEJA 4JLPA 4TLAA 3ZQJA 3UK6A 2OT3B 2VHTA 1R8QA 4AKEA 1IXSB 2P5SA 4BFTA 3I61A 3TAUA 3HPQA 2V3CC 4KFTA 2G83A 2IEZA 3SHWA 2O8DB 3GLGE 2WSSA 5KDLA 3GLIE 2O52A 3AF1A 3QVUA 4PAQA 1OYYA 2CL7X 3EPJA 2IYSA 1KDRA 4L5BA 4HSEA 3H86A 3N70A 2LWIA 2CCKA 5HE8A 4TYQA 2WWXA 4KSCA 5DYGA 3VHLB 3C7KA 5FPSA 1G5TA 1CJKC 4BEBA 1OIXA 2CHVA 2ZR9A 4DDUA 3SFVA 1LY1A 1LF5A 2XEXA 4OHZA 4GSYA 2MSDB 4XIGS 4MH0R 2BJWA 2JLSA 2IXFA 4JLDA 3P4YA 4B3XA 4D80A 3EPLA 3AVXA 1NVUQ 4PC1A 1DG3A 3T5GA 5CLLA 2ZE7A 4F4CA 3EZ6A 4NDZA 3RWMB 3W6NA 1S96A 2Q9BA 3F5FA 2LKDA 4M1KA 4EFLA 4YMSA 3H4MA 1G8FA 1HT2E 2YVUA 4IXNA 1N6PA 1T0HB 2JIZD 2RKOA 4DDVA 2BMFA 1TQ2A 2ZANA 1JXOA 4LC0A 3LBHA 2ZTSA 3MWKA 2ORVA 2C5LA 3L0OA 1MRSA 3EWAA 4CEIA 2QMOA 3SJAA 5DGXA 2QTFA 4LV8B 2WMNB 5F9FA 1ODFA 2YOGA 5TXGA 4XSHA 2ZSAA 2ZE6A 3KL4A 2C8VA 4BLOA 4Q4AA 3P26A 4TSFD 3BWDD 4A8JA 2D06A 3I5XA 1KO1A 1DO0A 1EWRA 1VECA 1CBUA 2ZRCA 2B7BA 1KO7A 3M0EA 1T8TA 3I72A 1E98A 4QGHA 4EPYA 2H7VA 1E6CA 2JIZA 4WOPA 4DC9A 3FHOA 4G01B 3TUJC 1T9HA 3TVTA 2O8EA 2DVWB 1M1YE 2OAQ1 4MKFA 1Z5ZA 1G3IA 3OIYA 3V9PA 1GRQA 4B74A 2NTYC 4Q9LA 5JJIA 2OLJA 1DAGA 2OFOA 2D7DA 2ZXUA 1D8TA 1DAHA 5FBQB 2QP3A 3VR2A 5KNBA 2VPPA 4NYJR 4JIMA 2NG1A 2J1LA 5CM9C 1P7CA 2VF7A 4FWTA 3KUDA 4BUJA 3IUYA 4ZCIA 1UM8A 1GNRA 3FFAA 2ONKA 1Z2AA 2IX3A 4LBWA 2QAJA 2VP4A 2OCYC 2QQEA 4TSFA 2XXAB 3G5UA 4L4UA 4GRAA 4V0MA 2QMHA 4QHTA 1XCMA 4DLVA 1KY2A 1NIPA 4QRHA 3TE6A 1ZBDA 2IYLD 1DPFA 4YLGA 3CKLA 4KBFA 2N46A 1K8RA 1GM5A 3KQUA 3HPRA 1OFTA 4GBMA 1VYTA 5LPNA 1G6HA 4A2QA 3DVLA 3Q85A 4M2LA 4O2LA 1CR0A 3C8UA 3SBEA 3KQLA 1KO5A 2FFBA 4P31A 3PEYA 2F9MA 4ARZB 3TSZA 3FDIA 1YQTA 3QBVA 2J7PD 2QORA 2RMKA 4KFRA 1P5ZB 4MGYR 4DSTA 5J4YA 4Z54A 1SVIA 2BEKA 5K8LA 3OF5A 1AGRA 5L3RA 4Q1EA 2KJQA 1QHXA 2G6BA 3PEUA 4IHQA 1U8AA 4LYAA 1G6OA 4OHWA 2ODWA 3RRMA 4TLDA 2DPXA 1G64A 5G3ZA 2CVFA 1J2JA 3IQXA 2WKQA 3GLHA 1YE8A 2GVZC 3A1WA 5EUQB 4MKHA 4Q7LA 4QBHA 4EPWA 2B21A 3CRW1 4D0NA 1KMQA 4TQUS 3H84A 2C9CA 1UBCA 3CNNA 2ZU6A 3BJIC 4NU0A 3K0CA 4LJAA 4LBVA 2J7PA 3B8HA 1E9FA 1E9DA 2GJSA 3O8BA 1ZCBA 4JL6A 4KFUA 1I4LD 1OH5A 2FNAA 1Q57A 3OEED 3THXA 3EASA 3K1JA 1DAMA 1KDPA 2AX4A 3ZDQA 5IDVA 3LXXA 5JWOA 1NVMA 1GRNA 2PBRA 2YC4C 5AR1A 1KKMA 3LNCA 4OKSA 1Q1BA 2K5UA 5DO9A 2QGZA 2QSZA 3MD0A 3TBKA 1W4RA 3AVQA 3CRQA 3GPLA 2NO7A 2ZRGA 3AF0A 5FPHA 4ASUD 1GNQA 1EFHA 1DS6A 3MGCA 2A78A 3KTAA 5DI3A 4CRWB 1FPMA 4PSKA 1DADA 1EX7A 2J45A 4HEJA 4R98A 4KBGA 3IPYA 2CK3D 2C03A 3I62A 4V03A 2GF0A 2P5TB 1Z3IX 2PCJA 2Z43A 3LAWA 1KY3A 2BEJA 3IEUA 3QXSA 4LHWA 2Z5FA 3T06B 3HU3A 2QAGB 5E7MA 1XD8A 5CB8A 4DWJA 3OEEA 5HR5A 1LF0A 4ESHA 3RLFA 2VP2A 4OQXA 5FOUA 4D6PA 2IXEA 3AVUA 1UEJA 4KAXA 4JVMA 4YMVA 2ZYVX 1A1VA 3CH5A 3NDBB 1FOEB 4ASUA 1P2UA 3M1IA 4RSGA 3QKUA 4EDHA 1IAQA 3KB1A 2NQ2C 3GJ8A 3C5HA 221PA 5SZHB 3DZDA 4JBWA 4D26A 5AWFC 3MG9A 2WV9A 2CK3A 4KI0A 2IYXA 2QAGC 2QTVB 3RABA 1ZMXA 2BMEA 4B73A 2ZETA 2IYRA 4UNQA 4HAVA 2UKDA 4IOKA 3LLUA 4HLUA 4YMUA 3UWKA 4B47A 2UVQA 3K8YA 4DSUA 5J47A 1BH2A 2F43B 2IF0A 1T5IA 2HXYA 4MYUA 2P0EA 2ZS7A 2CCGA 2RGGA 1XPRA 3WP0A 1ZINA 4MRNA 3CO5A 4NYMR 4DDTA 2V9PA 4OK6A 4JLNA 2C96A 4IXMA 4DCSA 1ZJ6A 4U00A 3W9YA 3PFIA 1KK3A 4MGZR 2PMKA 3U3MA 2GETA 5KYKA 1E2EA 1FUKA 5TB5A 4LRTA 3C4JA 3VFDA 3CWQA 4B32A 4MA4A 3W8RA 1XF9A 3CUEF 1TX4B 3H2YA 1W2GA 4GMDA 2JLRA 2WJHA 4Q1FA 4X8MA 4FMCB 3SYKA 4HB0A 5M04A 2HJVA 2QZ4A 3HU2A 3MRSA 1NVVR 4P4SA 1EXMA 2ZJOA 2A5JA 3EARA 3LO5A 4P0TA 3U6BA 3AGQA 2MSCB 4KODA 3WRXC 4JL8A 2JJ1D 3DEFA 5EE0A 4M1OA 3UG6A 3D7MA 4PSVA 1S0UA 4LZZA 2QG6A 4P33A 1BMFD 3ZVRA 1GRRA 1VTKA 2J0UA 3N2EA 4BZPA 1JAIA 4CEJB 4Q66C 1KSGA 2FA9A 4OBEA 2W83A 1ZUNB 3GEIA 3LA6A 5JCPA 2Q21A 2G9NA 2XB2A 4MDFA 1YZLA 4PXAA 3RVBA 2MSEB 1RJ9A 3LX8A 4OHVA 5JECA 3CRRA 3K09A 1KO8A 1G1MA 1S8FA 3QKRB 3CX6A 4G5QA 3T12A 4CEHA 1ZU4A 3IO3A 4MDEA 4KU4A 4HDOB 5LB2A 3HWSA 2BMJA 4V0ME 1CJVC 5H8WA 2ZEJA 2JJ1A 1AZTA 3BFXA 4W7SA 3SNHA 3ZS8A 4TYWA 3ZQ6A 4PPGA 3IPXA 5K8UA 2C99A 1BMFA 3BRWD 1W47A 2F1JA 4F92B 1VYVA 1S3GA 4I4LA 1KAOA 1RVDA 4FWHA 3QXJA 4NBSA 2FH5B 2X77A 2GCOA 3P4XA 3IIMA 1R5OA 3PUXA 3TUIC 3QXHA 5L3SB 1JECA 2J5XA 821PA 1X8JA 2P6UA 4F38A 1D6JA 4BFVA 2GKSA 1XCGB 3UMFA 1NLFA 1DTSA 1D2EA 4DCTA 2F1IA 1XEXA 2KBFA 2WICA 5J4VA 3TSOA 5JJKA 1QDEA 1ZUHA 1ZNYA 3NBYC 2GILA 3LQRA 2ZRBA 4L15A 4QM6A 4LHXA 1ZM3A 1SKYB 4HUTA 4Q03A 1YZGA 2CEAA 4RKEA 1E2GA 1XMIA 1QVAA 2QI9C 3GLHE 1OXXK 3U7EB 2BWJA 4QJ3A 4EIWA 4HAWA 4LJ4A 1Q3TA 5H68A 2GJ8A 3L0IB 2O8CA 1U2RA 2PZEA 1QHYA 4QBFA 5C2JB 3ECCA 3RNLA 2GBLC 3GJ4A 4UKDA 3SQXA 3UMRA 4C7OA 4R71A 1QHHA 1N25A 3R8CA 4JZKA 1TF7A 1XPOA 5FUVA 1KOFA 1NKTA 3KKOA 1OB2A 1Z08A 3PV0A 4G5SA 4B3FX 2XX3A 3EXAA 2HYDA 4LHVA 2FF7A 2IWRA 1IN5A 3RS0A 4ZCLA 3BS4A 1DAKA 3VQTA 4KV9A 4PHTA 2YWFA 1PLJA 2V54A 4II7A 3T15A 1PVOA 1LV7A 3KKPA 4OI2A 4WZ6A 1ETUA 4XWAA 2AXNA 3FMPB 4QC2A 4TMZA 4WA7A 4IOLA 2R6AA 4IEEA 3WHKA 2G1JA 4U7DA 3I73A 1JQJC 3CF0A 1TADA 4QG7A 1E99A 4M9QA 2GXUA 1FL9A 1LFDB 1VG9B 1OIWA 4URVR 4C2TA 1E2JA 1KO4A 1YU9A 1Q20A 2ZR7A 4E03A 3B1WA 4HYYA 1JB1A 1KI7A 3N5CA 2A3RA 2HF8A 3JZAA 3K0FB 4V0OA 2QNRA 4IDQA 3I3SR 1W0JD 3BERA 3G0HA 1CR4A 1NBMA 4RZUA 3RANA 5P21A 4HUQB 4Z1MD 3WYFA 1KMHB 3BFVA 2QENA 3GMTA 5BXQC 4Q1AA 1A2BA 2YZ2A 3K0EA 3M4YA 3RRYA 4DHEA 1P62B 1BKDR 2HT6A 4A92A 2ANBA 1W0KD 1H8ED 4TL7A 3ZIAD 2RGNA 1F60A 2OM2A 3DHWC 4IDOA 3Q7QA 5K8IA 3WY9A 1HH4A 2JLYA 3O47A 5KSOA 1FMLA 1W48A 1N0WA 1II0A 2FFAA 2PL3A 3QG5A 5FPYA 1VMAA 2ZRKA 4JSYA 4NZYA 1Q21A 3NXSA 4BASA 1UDWA 4GI7A 4GL2A 3ZJYA 1UKYA 2VHUA 1JPJA 1R5NA 4FD2A 1LW7A 2A5GA 2PZFA 4LSGA 4NL4H 4QL3A 1RRFA 3DMDA 1EESA 1W0JA 4ZDIA 1US8B 2PH1A 2O8BB 4LV5B 1CLUA 5C4GB 1DVRA 1M6NA 1OLOA 4Z1MA 3K0AB 3FMIA 1L4UA 1E2HA 4ZPXA 4PHFA 5EE5B 4B34A 1RPZA 2ZRDA 2X2FA 5FTNA 3SZRA 3NHAA 3ASYA 1W0KA 1H8EA 3QE0A 3ZIAA 1U9IA 4I1VA 2DY1A 2DFLA 5G40A 2BJVA 1FMJA 4IVRA 2ORIA 2O0KA 4TMWA 1Y63A 2VP5A 4FWIB 4XD7D 4D81A 2ZSFA 5AK0A 4D4MA 4TYNA 3GLFE 3EWSA 1OXSC 4P3YA 4JLAA 4JT2A 5A5GA 5B64A 4BFUA 1AJEA 3RS3A 2QA5A 1A82A 4N1AA 2WSMA 1KTVA 4B75A 2E9SA 2QPOA 5FUYA 3TW4A 4HB4A 3WNBA 2ZJBA 2H1LA 5FTJA 1MH1A 2CLSA 5EE1A 3SFZA 1SQ5A 2AFIE 1TQ6A 2ZVQX 5CIWA 1T4GA 1XPUA 2PJZA 2J0SA 3QY0A 4I1SA 1NN0A 3B1ZA 3R9WA 3KXIA 4DCVA 4N3NA 5JS8A 1E0AA 3ETLA 4QNRA 5FTLA 4ILEA 1X37A 1GWNA 3NC0C 2ZRMA 2BKEA 4XD7A 2RGBA 4NMMA 4QGGA 1E79D 2O8DA 3GFTA 1JI0A 3TQCA 3BBPA 4FN5A 1VCMA 2J59A 1X1RA 5B57C 4YDHB 3UATA 1F2UB 4QHYA 3BOSA 1G20E 3U3RA 4A4DA 3ZZUA 5TARA 2ZRLA 1X86B 4MGKR 4JJKA 5BN3A 4LJ6A 2G0NA 4B76A 2WAXA 2JASA 2ODEA 4NONA 1R2QA 3U3KA 2A7QA 3SOPA 4AIIA 3B82A 4LX0A 4IFEA 1YZTA 2Z4SA 1KJZA 3MWJA 4A6PA 4YQFA 4DLUA 521PA 5UKDA 1UKZA 2V55B 1GKIA 3Q3JB 3OIUA 4GOXA 5KPJA 1XEWX 2ZSDA 3QIAA 3KQNA 1U0HC 2Y8EA 4FMDF 3U7HB 3E2IA 3LW8A 1Q1QA 4IVQA 3MUFA 1AZSC 4PQRA 1VIYA 4ERNA 1WE2A 2X19A 5CIQA 4FMBB 3ADBA 1GAJA 5G53C 1C4OA 2Q3MA 1IJEA 2ZRPA 1HTWA 2OSBA 1T8UA 3TUZC 5JHHB 3U4QB 4GT1A 2HCBA 3AEZA 4B3DA 3Q5DA 3E70C 4IFBA 5L8VA 3K0SA 2XGJA 2WWWA 3CR8A 2GCNA 3DM9B 1HEIA 3IHWA 4BWYA 1XJCA 3THYB 4OI0A 3MWYW 1Q44A 1MRNA 2JLXA 2PT7A 3AF3A 3BB3A 5JSZA 2AWNA 1XTSA 3CZQA 1FFHA 1G8GA 4DLZA 3T1VA 4AY2A 2EVWX 3R9IA 4AKGA 4C30A 5BWMA 4DCNA 4TTRA 1HY3A 5IK2D 5CK5A 1CS4C 1KI2A 1D5CA 5JI3E 4M9SA 2V1UA 4Q4HB 2QP4A 3LW7A 1KSJA 1ZRHA 3X2SA 1E9AA 2D62A 4DEYA 1AIPA 1I4TD 2FX3A 2G77B 5FOWA 3P20A 1G3RA 4PQFA 3KQHA 1F6BA 4OK5A 5EZ6B 2J87A 2BM0A 1XJ0A 3OIVA 3SC3A 1FX0B 3CF6R 1Z06A 1L2TA 4V0KA 1IJFA 1EWQA 1PV4A 2FGJA 2KBEA 1I2MA 2RGAA 4US2R 1JR6A 4BPBA 4I1UA 3S1AB 4WBSA 3PCRB 1AS3A 1Q22A 2RH5A 1ZM7A 2B8TA 5J4LA 4TL6A 4Q9JA 1WXQA 1MO5A 2XXAA 1N5KA 2PCLA 2XTNA 3FMFA 3L2OB 5IK2A 2ECKA 3A36A 3FGNA 4FW9A 4ACBA 2ZRHA 2QPTA 4XWKA 2QL6A 1SVOA 3T1OA 1HA3A 4OI1A 3RS2A 2OCBA 1II9A 4PZYA 1QHGA 2QE7D 4GP7A 2YKGA 2ONJA 1L8QA 3VR1A 1TEVA 4IDNA 4BFYA 2R65A 2N42A 4MGIR 4ARZA 3RS4A 2IEYA 3UIEA 2R44A 5D3MB 4OYHA 1Z0AA 3DOEA 2CVHA 5AUOB 2H8KA 1N5IA 5JCZA 3U61B 2VLIA 2WKPA 3I8SA 1UADA 2WM9B 4MUAA 3W5IA 3EA5A 3F8TA 1MKYA 3AKDA 1KI1A 1SVSA 4BFXA 4XSGA 3U60B 4HAUA 4X8HA 2BHRA 3QSYA 2OESA 3EIEA 3W34A 2QRZA 2EFHB 3RC8A 4XOIA 5KPDA 4D2IA 2FPKA 4Z8YA 4HLDA 1QHNA 4M9XA 4V02A 2QE7A 2CXXA 2FN4A 2ZIAA 4NYIQ 4N0EA 2J9RA 1DOAA 1EFRD 1BOFA 2CJWB 1O87A 2OBNA 4JVSB 3LWNA 2GEUA 4TQAA 2NPFA 4BLRA 1E0KA 4HLQB 2V1XA 1N6NA 1IN7A 1FNNA 5FL3A 3RRNA 4CYMA 3B1VA 3T35A 5FUXA 1N6LA 4D0GA 2BKUA 2FFQA 2QGNA 4DRZA 2IYVA 3CX8A 1AKEA 1OW3B 3QVVA 3B9QA 1KAGA 4MKIA 4DXAA 1P61B 121PA 1S4QA 4IVPA 4K46A 2AL7A 1DAIA 5F2EA 1H65A 2R8RA 8OHMA 1ANKA 5KOYA 3KX2A 2VO1A 4Q7JB 2RGCA 5DH9A 1U8YA 3W5JA 2ZRAA 1SHZA 5JRJA 4A2PA 2QP9X 3AVYA 1EFRA 1E2FA 3GJ3A 1M2OB 4NCKA 4PX9A 2IYZA 2VP6A 4QBGB 1Z63A 4QFMA 3QOFA 5DI9A 3O8RA 5CJ2A 2IS4A 2TMKA 1Z0JA 4R2HA 2JLVA 2QAGA 5F9HA 1QHIA 2ZUBA 2FOLA 1YJ5A 2JGNA 3MJHA 1A7JA 4LHYA 2GXQA 721PA 3CB4A 2NPIA 2FG5A 3R7WB 5IF9A 1KDOA 1VHLA 2H18A 2VTKA 3ADDA 3ZZ0A 1WRBA 3K70D 5CYPA 4AYTA 2HYIC 1TU4A 1HV8A 2A30A 2F3RA 1NJGA 2I4IA 1E2NA 1KYIA 1NY5A 1KNXA 5DE3A 3WMGA 3GFPA 2XTMA 4A1FA 2G1KA 3U5ZB 3KKQA 3TAHA 2ORWA 2P67A 1TMKA 3PVSA 5CYOA 2BC9A 1E96A 2O0HA 1LNZA 2F6RA 2XOKD 2CLDX 2HDNB 3NKVA 3SN6A 4F4IA 1T5LA 4EJSA 5KHOC 4MUBA 1NLYA 3KW6A 4PO8A 4B2LA 4W9MC 3PG5A 2PEZA 4WZAE 1RRGA 2F43A 2IW3A 4C0LA 2C04A 4DSNA 5FOTA 4A36A 5GADl 1T3LA 1Z07A 4A0FA 2DWQA 3QUSA 4ZKDA 3TNFA 4CEIB 4TT3D 3D6TB 1VCOA 1XMSA 3L8YA 4PHHA 2OLKA 1Q1EA 1MOZA 1E2MA 4Q21A 1IXRC 3WMFA 1ZU5A 2QT1A 1UAAA 2OFWA 3B9PA 3WBJA 4F7WA 1TEXA 4PZZA 3NH9A 1KI8A 1GSIA 2D2FA 4A82A 1IHUA 2A5DA 1CTQA 3SBDA 2XOKA 1UDXA 3W6PA 2VP9A 1WP9A 4Q18A 2NZJA 4HDCA 4BZXA 1R0XA 2Q9CA 3NG1A 4KLNA 3TW8B 4Q4JB 3IBGA 1N0UA 4KJZA 1Z28A 5G3YA 2KSQA 5EJEA 1S2MA 4C0SA 4UQOA 5JRZA 2FWRA 1XTKA 3B60A 1R5BA 4KXFB 3QPVA 5H1YA 3T61A 4O2RA 4TT3A 4IW3B 3VHXA 4QKQA 2F1RA 2IS1A 2ZM5A 1NIJA 4IRUB 2D7CA 2DFTA 1RFLA 2DBYA 4HI0E 1AKYA 1YR7A 1GDDA 5DIFA 4CEJA 5BYJA 3WMEA 4EKDA 1BYIA 2GXAA 2GA8A 1KGDA 3VNVA 2EFCB 2JATA 1G4UR 3TR5A 1SULA 1NL3A 5KNCA 1KI4A 1QZMA 2SHKA 3FMOB 1VDZA 3DPUA 3HJNA 4BLSA 2NMVA 1E94E 3QKRA 5KSPA 1WA5A 2BOVA 3NH6A 2OILA 5KDOA 3IEVA 2VHJA 1HUQA 4ZI2A 2BM1A 3A4LA 4DLSA 4PR0A 2JLUA 1RE0A 3EIQA 3QKSB 4DLYA 2A2ZA 2F9LA 4Q9IA 3U44B 3PXGA 2YNMA 2FGKA 5FTKA 3LBNA 3VKHA 1VKJA 4AYWA 4RFSB 5AJYA 3T1TA 3Q7PA 3V4FA 1UF9A 1XNJA 3OIWA 5DHAA 1KNQA 1S9HA 4JYBA 3I5YA 5L3SA 3F3YA 1E1RD 5L3QB 1OJLA 3KUCA 2L0XA 4FXPA 1ZNWA 5E7IA 3X1XA 2IF2A 2P65A 3N2IA 3NWJA 1GL6A 3KQKA 1YZKA 4C3ZA 2JCSA 4AURA 2J7KA 4D4LA 4P4TA 4HAZA 5ELXA 2GDJA 4DT1B 1ELOA 4K81B 1N6HA 4HAXA 4JLVA 1ZIPA 2GBLA 1Z47A 2WJIA 3GLHB 4OJKA 4Q47A 3EW9A 1Z6YA 4LRWA 4W5JA 1OH8A 1P2VA 2IT1A 3CX7A 1ESMA 2ERYA 2ZE8A 2HUPA 2QY9A 5KSZA 2AD1A 4R7ZA 1TTTA 3MWLA 1C1KA 2WAYA 2HT1A 3NC1C 1K6MA 3DMNA 4AKHA 3IBYA 4WXRA 1E4VA 4QJ5A 1CU1A 4CIDA 4BLQA 3AVOA 3QQ5A 3C5CA 5A4JA 1G7TA 3SR0A 1DE0A 1E1RA 2DZOB 4YONB 2W6JD 2YOHA 2FE4A 3UMSA 4D4JA 2EWWA 3Q9LA 1P6XA 1R0ZA 1G3QA 2DFKB 4LYJA 4DIDA 4A0GA 3HYRA 3GD7A 4C0AC 1SXJB 1IOZA 2ATXA 2GCPA 2ZI7A 2ZI5A 1Z6GA 2XZOA 3PEWA 4AC9A 1ZNXA 4LWZA 4Y0VA 2ODNA 1VCIA 2GF9A 4P32A 1V43A 1G21E 1ZUIA 3RS5A 2QM7A
chains in the Genus database with same CATH superfamily
5EN4A 1QQ5A 1PL0A 3WB9A 1D0VA 1A7AA 4TMXA 1E3SA 3ZC3A 5EQFA 4Y7CA 4ER3A 3WAGA 1PR3A 3NBZC 2JLBA 3OFKA 3L82B 3OLCX 1B15A 2HMSA 4G4SP 4ZVQA 4LWPA 3T9CA 3SP1A 3GGCA 4UTRA 5B37A 5C81A 4J1TC 4WMLA 1UZUA 4W5HA 1NR1A 1JIUA 2YMLA 1Z6XA 3OOJA 1R5LA 1JFVA 2D2VA 4EO7A 5DJ5A 1KQGA 1FXWA 2ZDHA 3TTTA 1WXEA 1SXHA 4CFYA 4D82A 3GT4A 3FTNA 5ITSA 4D3DA 2NIPA 4JOQA 4LNAA 2O8VA 1NFRA 3ICQB 4PE5B 5GKNA 2WWRA 4RKYA 3HUTA 1X3LA 1Z75A 5HF6A 1XROA 1D6MA 4DPMA 4BLCA 1V96A 1XTVA 3OEHA 1NXVA 3FD9A 5BSTA 1EA5A 3EHEA 2EFEB 5KTMA 1RWMA 1L5SA 3OZTA 4OQFA 1R0LA 1W49A 3LK7A 4LSZA 4NPHA 2VBIA 4B85A 1M74A 1NDQA 3SU8A 1N0VC 2O8CB 4E07A 2OQVA 3I1IA 3VAAA 4X44A 4UZSA 4KO8A 4LDJA 1P77A 1E5VA 1IUPA 5C35A 3QK7A 1HOTA 5DPMA 4PO9A 5BSUA 2HSDA 3FPAA 3RYCB 4L22A 4XQCA 1U0LA 1QP7A 3E8XA 1H3EA 2G04A 1TR8A 1HTTA 2GPYA 2I34A 4KFSA 4KDRA 2B36A 4FR5A 1PJ3A 1KVQA 4RVDA 1GEEA 5PNTA 3T41A 4X7RA 1XHEA 2LNHC 2XNDD 4RZ2A 3JQ8A 1G17A 4C20A 3TLCA 5IJ9B 3Q7IA 3E22B 2PMDA 1ZAYA 1U1EA 4CHGA 1L7NA 1QYRA 5KTTA 4J0GA 4JL5A 4WCDA 1PQUA 4PLWA 1G2PA 2O7VA 1A2OA 3V8RA 7ADHA 1QVWA 1S3FA 3S70A 2IVFA 2RHDA 4U2FA 2JAOA 5CUQA 4RK0A 5AKZA 3RS8A 5LD2C 1NJ2A 4WY8A 1EFUB 2YBDA 3EGEA 2REBA 5FP0A 2A0WA 5ITZB 4L85A 3AF2A 1JR3D 3WNDA 3OT1B 1XTRA 1TYDE 3MTIA 1UOEA 5CAEB 1OH6A 3G9ZA 4G1FA 2F55A 3DAFA 4KLZA 4GSLA 3SEAA 4IR7A 4ANFA 4TLCA 2I80A 3DE3X 5IAGA 4AKIA 4LG1A 4CT5A 4WURA 4XYGA 2HU8A 3P4UA 5DBHX 3V1KA 1Z8FA 2NXNA 3PVCA 1VMDA 4UXHA 3E5RA 2GLXA 1VHJA 3FN4A 3ZGNA 4JEIA 1IIBA 3CX4A 3MAGA 3CVXA 2XA1A 4J7CA 3M83A 2WSYB 1NBAA 1E2KA 4L2IB 1XZPA 1NY6A 3MOIA 3WK6A 1XK6A 2BGJA 3OTQA 1F6WA 2YC2C 2RK6A 3UKOA 2O2DA 2ZWMA 4M76B 3DAYA 1HFWA 4I99A 2OUKA 4YBRA 3MJVA 2YHIA 3CEAA 3GCZA 4LVCA 5TVKA 4PSAA 4OU7A 2P2DA 1S8NA 3KDSE 3WL5A 1Z88A 4FFNA 1Q7EA 1ZH6A 4KR7A 4D6XA 3TIXB 4HJXA 1W36B 1RPTA 1E9CA 4MARA 4EY6A 1W5EA 5C4IA 2XYGA 4MPTA 1M1ZA 2IDMA 4LYHA 2EHJA 5GOZA 4NKRA 3CS3A 3URKA 3T99A 5B1YA 4KTTE 4K9LA 1VLLA 5J4HA 3AK4A 4RGBA 1D1TA 2C97A 5E3HA 4ZU1X 2IVZA 3ZCPA 1QIFA 2GYYA 4UM7A 2DOKA 4HSGA 1CDZA 2OAP1 1ZH0A 4UMEA 5B4TA 2Q29A 5LB4A 4EJMA 2X1LA 4ZZ3A 2X8JA 4DR5M 2D1FA 2YL2A 4QU8A 4MR9A 4XX0B 3VU3A 5BNIA 4MMYB 4L6CA 2IYUA 3PNKA 3OHSX 4L8VA 4A3VB 1GA6A 3GU3A 2GEDA 1Q5PA 3I32A 1VCHA 3WO0A 4K9OA 4REQA 2VDBB 4GKKB 3F5QA 2GN8A 4OHFA 1FNBA 3USCS 1HE1C 2ZI6A 4GNKA 3UOWA 4P4UA 2G88A 4EJSB 2WYIA 1HWYA 1LKZA 5TPZA 1DG1G 1RQ7A 1TXGA 4FINA 5BY2A 3B6EA 3I53A 2RGDA 1BVYF 4ZVLA 1Z7BA 2H1IA 1OWNA 4FM9A 4FYIA 2Y0TA 3NUGA 5HUJA 1R8YA 3SIXA 3LI2A 1WF3A 1AK2A 3GLFA 3GRVA 3N07A 4E09A 5A3SA 2HO4A 1FBNA 4TV9A 5BSHA 1OLXB 2H9YA 2IUTA 5K03A 1U0TA 3NTUA 3PI7A 3QTTA 1QPBA 5AXBA 1V9SA 5EWMB 2WE8A 3H11B 2MCFA 1TUEA 2JY7A 1OYWA 1GP2A 1WPXA 5LP6B 1DIGA 5B4VA 1B41A 4KE9A 2C0PA 3D4NA 2XB4A 3EGWA 3SYMA 2ZBKB 3HA5A 1SAYA 4NBNA 1W5SA 1V9LA 4WOBA 5J2UB 2WJ6A 4EUNA 3NBXX 1SCDA 1Z8HA 4WY2A 3RF7A 3D2LA 1USIA 4JV5M 3BORA 4PZPA 5EJCA 4UVHA 1UMKA 4XKJA 3CVVA 5GVRA 4G23A 4DWVA 1K27A 3MINB 3U1TA 4GLBA 4CR6A 1QBGA 4BL5A 4LYGA 3A28A 4GBGA 4E22A 2J0UB 2QBYA 4MAMA 3ASZA 3EN0A 4NY1A 3RDPA 4GH9A 3M7IA 3MUOA 1GR1A 1RLOA 4DV0M 1V4NA 5FHQA 4OJQA 1ENZA 2Z9BA 2DAKA 1FDSA 4KN9S 1AV6A 2QPLA 3T3EA 5EJFA 1F8GA 5JT1A 4LMBA 3KZVA 3N3AC 5E2AA 3WHLA 1MENA 5EMHA 1N32B 4V1CI 1O95C 5FULA 2V3WA 4Q15A 4OPMA 3KLBA 4JUAA 1GUAA 1UJ2A 3V8PA 3T7CA 4JQOA 2OHXA 3AOGA 4BO3A 1CW2B 1M76A 6Q21A 5JJCA 1KFVA 1RWXA 3W2GA 4L9WA 1OE0A 2JVIA 2RB4A 2WT9A 3V46A 1GL7A 2E21A 2OO7A 3NT2A 4DV5M 3RARA 2DAEA 3F8SA 4FTWA 1X7XB 5GJCA 1M1YA 1H5UA 4OFBA 4DR6B 1EINA 3FZYA 4LTMA 1J8DA 2WHPB 2JCGA 3CFYA 4AXXA 1ISJA 2IY7A 2AOXA 5D6OA 3VOTA 2D00A 1JBEA 2AKYA 1NATA 1U0BB 4EYSA 1IBLM 2ZI4A 2OCKA 4JJ6A 1ISPA 4B3BA 1PT9A 1Q91A 3S6JA 1N2EA 2KWIA 3J7AC 4O0MA 2NQTA 1RW4A 4WDQA 3UA3A 1UT5A 3GFBA 4UEJA 4OHPA 5KO2A 3TOVA 2RAFA 3RU3A 1HT1E 3CEPB 3A7EA 4KB5A 2QTZA 4UHJA 3Q98A 4NE7A 4U63A 1NMXA 4R3NA 2BI4A 1TLFA 4YRMA 3OQIB 3U13A 4BFSA 2OMEA 1VP9A 4RLFA 4RY2A 5LQUA 2IBMA 5IMSA 3A6PC 1VHQA 3LV8A 2GRUA 1BXGB 1MQ8B 3KM0A 5CIYA 1M5RA 3RGSA 4ZCQA 3RAJA 2TSYB 1W36D 2HIHA 4CM9D 5KHAA 3FWPA 3AR2A 1T3TA 4Y8VA 1WETA 1GPWB 1W59A 4KXLA 1UDAA 1V0JA 3GLGE 3NASA 1KU0A 5AYVA 3A9SA 3N70A 2LWIA 3GMDA 2GD0A 4BB5A 3A14A 1LY1A 4I19A 4FNAA 1U9JA 5FUBA 2MSDB 3WFJA 1IZ0A 3W06A 3P4YA 4YCJA 1C9EA 3OZAA 5DZSA 3T5GA 5BQOA 4U7JA 3QUQA 4KMOA 1J20A 4I1YA 4TKUB 1J07A 1ZRMA 4EKEA 4N5IX 3FKJA 1I4OA 1ARZA 5B12A 3TOZA 2CXRA 4QELA 1MRSA 3HNOA 3EWAA 1VJ5A 3ZKAA 4CEIA 5TR9A 4W1SA 1W2WB 4GX2A 1ZVJA 3K2IA 4RU1A 2EQ5A 3CKYA 3KBOA 5TT0A 1F38A 1ZPDA 4EPYA 2H7VA 4DC9A 5ERYA 3KJQA 3TVTA 2DVWB 5ARCA 1Z5ZA 4NXNB 4GUDA 1A69A 2ZXUA 1NF2A 3WYEA 2A6PA 5LMNB 3IT3A 1GNRA 4JP8A 1Z6QA 2QMHA 4DABA 1JG6A 3R74A 1H0KA 1QQ6A 1GM5A 4DF3A 4GBMA 5LPNA 3Q85A 3KQLA 3MF4A 2HM7A 1ADCA 3TSZA 1PYOA 3QYAA 1E1MA 3ZI0A 3ND7A 1XGKA 4L4XA 4TLDA 3OCYA 2CSUA 3A1WA 1YE8A 2IEGA 3F6RA 3FWKA 5TEVA 2FN7A 3GPCA 4DYVA 4AUNA 3K0CA 1NKVA 5KDDA 2XUAA 3O8BA 2GJSA 1I4LD 5HFAA 2HCFA 3CRQA 4EAAA 2ZIXA 3LS2A 3U62A 1ZJ5A 2X0RA 4F5ZA 3L02A 1NI5A 4XK8F 3TX6A 4IJ5A 3KLOA 3D7RA 5EWLB 4DWJA 4EITA 5LQJA 4PTYA 3RLFA 1Q17A 2IZ0A 4KXQA 2EKPA 3BICA 2XD4A 1FOEB 2P8JA 2RE8A 2RH8A 3GJ8A 221PA 4D26A 2IJGX 1TA0A 4L6IA 1VC2A 4KPYA 1RM3A 1PR0A 2GWRA 4BRZA 1ULZA 3NM4A 5CTJA 1PFKA 2XUDA 5EA2A 4AZSA 4MHTA 3L7LA 3S5UA 3W9YA 4FSDA 4MGZR 4DC0A 5KWVA 3FSGD 3GLSA 3GB9A 4K9DA 1XLTA 4UM8B 3ZE8A 3PXDA 2Q5LA 4X61A 5JQWA 1Q7RA 5HVNA 3P94A 1TJNA 5HKAA 1O0BA 4M1OA 1THTA 1GRRA 1BXRB 1IC6A 4C89A 5MN6A 4QYXA 4IQ0A 2X8JB 4JGIA 2XB2A 4ITUA 3REQA 2QQGA 3RVBA 1Q92A 1ZKDA 2HWWA 2PLWA 3BXGA 3KAJA 2EEZA 3HWSA 5YASA 2BMJA 4REQB 4EI7A 4UPVA 4CLEA 1NUAA 5KYTA 1XCGB 5K3SA 1D3AA 2CMHA 1YNOA 5TGZA 2WUVA 3ZU4A 4RH3A 2WUFA 4HFRA 4M1ZA 4HYTA 1U2RA 3ZC7B 1KAQA 2VH1A 4HGYA 1UPAA 4JNKA 4LGYA 4B3FX 3GPBA 5JLAA 3SFTA 1PBNA 4LVUA 4AECA 4KV9A 4OVZA 3U6LA 1O6GA 2R1VB 3O73A 3T15A 4IV0A 2EF1A 2CWWA 4RF5A 1JH9A 2RAUA 2JIPA 1ETUA 5DV9A 2QW0X 2ZJ7A 4OVKA 3A2LA 2N0SA 4EUEA 5DTJA 4Q12A 5I7UA 4C2TA 2ZR7A 2IZ7A 2Y1EA 3N5CA 1XZAA 2QNRA 2BSQA 2HFKA 1E5DA 3DZBA 3B8EA 5L7YA 1MDBA 1ZHFA 1WUHS 4A92A 1QIJA 4N18A 1X7WA 1JG7A 1FJ2A 2GH1A 5F1KA 4FD3A 3O47A 1LPOA 4LDAA 5DP1A 1JIVA 2N9UA 1PYGA 2A5GA 4E1AA 1EE1A 1TU0A 4LV5B 1B93A 1M6NA 4V1CB 2B3DA 3TLAA 1BRMA 3J27B 1Y63A 4TYNA 4JT2A 5B64A 1I5OA 2PAAA 4CGYB 4K6GA 1JB0F 1BN7A 4DDHA 3FZNA 4RMGA 4MOWA 4HB4A 4WJLA 3I30X 1LTKA 2A9JA 4K0KM 1WO8A 4IBIA 9ATCA 2P9QA 2P7IA 2YCBA 5ALXA 3T3PB 2H06A 4IICA 1A9XA 4ER5A 3WLHA 3OPNA 3RUHA 521PA 4KEAA 4EYEA 4KIGA 1XEWX 1FXUA 4I4IA 2FK8A 5CHEA 3SD7A 1HFKA 5CNMA 1XMQM 2X0NA 3U16A 5CVJA 5G53C 3UM9A 2OSBA 2XMQA 4HFNA 1MRNA 1NW9B 1A8UA 2EVWX 2FW8A 2ECQA 1NNSA 3BWXA 3FLAA 4EHKA 3L7DA 4CWAA 1DWUA 1DC8A 2PNJA 3LW7A 3UW1A 3CRZA 1G3RA 3ZWAA 4ER0A 4M3NA 1BJTA 4KAJA 2CFOA 2L69A 2SECE 1Y4ZA 1IXYA 2WJ3A 2EBWA 2VHYA 5C1DA 4PNPA 3OOYA 3VU8A 4OXKA 3RFXA 5TQ2B 2ECKA 4LXTA 2CRUA 3HXTA 2IYPA 2QL6A 4HVAA 1LQUA 3EOAI 1ZRNA 3RBXA 1FZTA 3EQ6A 4O2AA 2P9EA 3G68A 4MGIR 2JWSA 3ONDA 5JCZA 3SHVA 2XYPA 3ZWXA 1CE8A 3SHQA 5E7QA 1SVSA 2X5KO 2YWJA 3QSYA 2ZBDA 2RIRA 3W34A 2HD4A 1B0AA 4NC9A 4V02A 2QE7A 3IJRA 3LUFA 3ZJUA 5CT4A 5C53B 1VLZA 3L49A 1UAGA 2O0MA 4PYNA 1E0KA 1AG9A 2CXNA 5EJ2A 4HWOA 1B8OA 3H6HA 1E61A 3DBVO 4WBNF 4B6GA 3KG2A 3QE4A 5E2BA 2HK8A 4K46A 3QY9A 1X7DA 3QMWA 1H65A 5KOYA 2AHMA 1MVNA 5THXA 1L7DA 2N35A 4PX9A 3W05A 2A9RA 4KPFC 1OREA 1QHIA 4KNVA 3G9QA 3ADDA 2VTKA 3S8YA 4Z4EA 1TO6A 3HBJA 4LCJA 1N5DA 1LI5A 5DE3A 1MIHA 3TAHA 1PGQA 3VSBA 2B78A 3KW6A 2VH2A 2UUCB 4ZT3A 2IW3A 4OGFA 3KPJA 5M2QA 1B1CA 3UMYA 1H9AA 4AX4A 1AN9A 3QUSA 4CEIB 1SUFA 5HRUA 4IJEA 2BGRA 4BZWA 3BE6A 5KB3A 3HDJA 5JNLA 1HYGA 2VKQA 1R0XA 3NP7A 3HRIA 3RBZA 4R2XA 2P0YA 1GDDA 3H17A 1SUBA 5HOQA 1RSZA 1SUEA 1PEAA 3V7UA 3U7QA 2DT8A 2WNIA 3EGCA 1MJFA 1NL3A 5KNCA 1O97C 2QX7A 4EI2A 5KSPA 3EVNA 2BM1A 4RV9A 3OWHA 4Z86A 3OMXA 5FLXA 1AE1A 1GGJA 3NHMA 2HLPA 3FYUB 4CHTB 2B99A 1DTWB 4RJKA 9GPBA 4UUBA 3EC7A 1DOZA 5CCDA 3NWJA 4UBNA 2DAIA 4AURA 2AE1A 1ELOA 3AJ9A 2XBUA 1AUAA 3K1AA 5GM1A 2NQ8C 1OH8A 1T4BA 2O54A 8AT1A 1O95D 4IZIA 3BXPA 1B3BA 4DIUA 2E6UX 1AQ6A 1CUFA 3OX3A 3AI7A 1QSGA 2VTVA 4MCIA 4ES6A 4BGVA 2GHRA 3MWKA 2IIVA 4D9JA 4FYHA 2QRKA 2B8WA 2IHTA 2VYNA 1L8LA 1T8RA 4GECA 3HDQA 4I55F 3EHDA 4DGSA 2FG7C 2EKBA 3H9BA 5KNDA 4LOHA 2B34A 1UBSB 1RJGA 4GO1A 4DG8A 2EAUA 2EKKA 5F3WA 4ZAZA 2HRBA 2AI2A 4KXVA 4A0RA 2B6HA 4HWRA 1XZ8A 2XF2A 3CWCA 5EEGA 3LSTA 3UB2A 3T95A 3VOAA 1JEAA 4UOZA 1T4CA 2B82A 4MW1A 3DKPA 1NHGC 4EVIA 3A3NA 4JYCA 4ZAXA 1IUOA 1YKSA 2WWGA 5FB3A 1H6AA 4GQIA 1DO8A 2ZAOA 1FVXA 3VBEA 2OV6A 3B48A 2EGHA 1U3FA 3E3LA 4FFBB 3C6QA 1LLUA 4FJ1A 3WZLA 4GKBA 1MABB 4INAA 3CSSA 3FW1A 3QLUA 1XKTA 1FTGA 3DFZA 3K5WA 2LV8A 3DW3X 3B70A 1CQJB 3FBGA 1YRYE 4KVAA 4GE0A 2PRYA 3H9QA 3L5KA 1SCIA 2AQHA 2XTAA 4HEA1 3DLBA 4CGZA 3A9VA 3N2ZB 5JPIA 3PPVA 3RROA 2F5SA 4FWDA 4QECA 2QQ8A 3ILXA 1U7PA 4NZMA 4PPFA 5D51S 3G17A 1OV6A 1Q2UA 1SBZA 2EBHX 3LPAA 2Z2IA 3B1JA 3THYA 1LC0A 1QE0A 2FXIA 4PXSA 3JWEA 2ORED 4JT4A 3JQGA 3A6ZA 2P41A 2A94A 1KZ7B 2QN1A 3ZGXA 2I1QA 3QOYA 3CJTA 2HPHA 5JS6A 1II8B 1EEXB 4MUEA 2NSJA 1XZHA 3IE0A 4EQ6B 3NMUF 2DXIA 5C8YF 3MB5A 3CTMA 2QM0A 1ZICA 4PEVA 3S8EA 2PJRA 4CDRA 4ERXA 1ACJA 2BP7B 5F3RA 3H1PA 4LC1A 1AKTA 5JLJA 2XNDA 2VP3A 3Q0TA 4ZWNA 1UEIA 3P0IA 1EFVA 2X6QA 4M4SA 4DDWA 4FYWA 5FTWA 3I2HA 5IKXA 1OF1A 1YCFA 4KXXA 3OP4A 1LPAB 8ADHA 2PD4A 2O3TA 3JTEA 5DXJA 3L06A 4QUJA 4B3RM 4CMCA 3BEDA 4M1TA 3SE0A 3DO6A 5C5DA 3ZCSA 4PZ9A 4GBED 4ENSA 3BREA 1PQ4A 4UAJA 3KXEC 5KWSA 1M0EA 5GIOE 3NW9A 4QTZA 2BFAA 1BA2A 1Z6AA 3JVUA 3R7WA 4HDNA 2BEUA 3FBWA 2J41A 4QEKA 1FRNA 3CA8A 1ZESA 4ZK2A 1JR3A 5AQ1A 5DX1A 1AUQA 4OTZA 2DULA 3ZH2A 3GEHA 3NPMA 1T6YA 4IMIB 1IEXA 3LBAA 4OJTA 4KIUA 1F7UA 1IM2A 4L9SA 3LQ4A 5CEFA 1FMFA 2PUBA 3PJGA 3JZIA 5CP8A 5H59A 1P1IA 1UFQA 1GQYA 5AESA 4M9CA 1XQ1A 3RAFC 3LVVA 4YT8A 4AZ3A 4CF7A 1PE0A 2ZWVA 2WHEA 2GO7A 2QJTA 3RWOA 2Q46A 1QG6A 2WTAA 2GVDC 4QT4A 2ZBPA 5F2KA 3K2LA 1XQ9A 1GNSA 3IIKA 3JR7A 4PCZA 4J0HA 4YAGA 3UY4A 4N8SA 4L4ZA 3TNYA 1M0WA 3VH2A 4HLNA 1MNAA 3R5JA 4G65A 1I2ZA 2GJ4A 4E5UA 5DTIA 1QLJA 4ZP1A 2JJ2D 5DXFA 3BH0A 4P22A 2A5FA 3QZUA 4MA0A 2B37A 3GY0A 3NORA 1M0TA 4RENA 5M7EA 1EVIA 2VPYA 3PC7A 1HF3A 3NIWA 4FR2A 2OG1A 4JLJA 4FN4A 2JGEA 5E9JA 3K92A 1QG2A 3V34A 4D98A 3U09A 3D3QA 1CRPA 1B0UA 4JI6M 4AQYB 3WBKA 4J16A 1G66A 1CXZA 2DWLA 1E2IA 4QVKA 4BECA 4A8JC 3IESA 1REQB 2FJUA 1E3JA 1TQ4A 4Z4IA 5D2CA 1GXSB 2HI0A 2DB3A 1T1EA 4O4JF 6ADHA 2QJFA 1RBZA 4Q01A 1YMQA 4NJOA 4TWIA 1J90A 3G7NA 3UK1A 1H85A 4OHBA 3L4JA 2WVAA 3ZEIA 5FR2A 2NU8B 1GN9A 3WIDA 1Q3CA 3K9OA 3MQ4A 5AJWA 5B6PA 5IH3A 4UNRA 4E5MA 3RB8A 1TM4E 4N6NA 3Q9UA 1BXZA 1WXFA 1B23P 3T8YA 1LNQA 2HQRA 4UHHA 1TZKA 3M6LA 4UUNA 5ENVA 4F9GA 1CJMA 4MGHA 4ZHQB 1HSOA 4PG7A 2CHGA 3PKIA 1VLVA 3AUYA 3DA1A 1NN5A 1JF8A 5G0VA 4FEYA 1QGDA 4MQ6A 2WI8A 1WBDA 3N2LA 1N5MA 2PSEA 2BCGY 2DLDA 2FZLA 1WDKA 1TMOA 1XEFA 1Y8RB 4JITA 4B1FA 3LLSA 5CFZA 4OHYA 1WDWB 3O0TA 4DMHA 1JQ3A 4ND7A 3U7QB 2VDWB 3UMCA 1RRCA 3WYGA 1OTHA 2Y4NA 5THKA 4U2CA 3BSYA 1WVMA 4P7BA 2IXGA 3AQ4A 4D8UA 5FNZA 2Y6UA 3QVWA 2BWEA 4ZVVA 4DIBA 5KQPA 3R7NA 1CJTC 3LHIA 1TM3E 4BFZA 1VEJA 4AG5A 5HZHA 9LDTA 3K16A 5L3VA 2P40A 2J5YA 3PC2A 1TM5E 3HXQA 1HYBA 3IVCA 1UBGA 1W5BA 1S2OA 2Q50A 2GBPA 3WK5A 3OM9A 3FFTA 3JD0A 4TQGA 5EVCA 2GVNA 3R5KA 5AW6A 1XHBA 3WAKA 3H2KA 1KH1A 5LMCA 3ELWA 3DMPA 2IOFK 3O0DA 4E08A 3B7WA 4FWGA 3CVWA 2AFIB 4QOHA 2CD7A 2FSGA 4TYPA 3RYCA 3K9QO 1TIPA 1Z74A 2G4VA 1R6AA 3V8MA 4LTDA 5DNUA 2XZUA 1MMFB 2GAAA 4OKIA 1P1FA 1LVUA 1P5RA 3UC5A 4BUZA 3G8BA 2B92A 2HZBA 2VBGA 4MVXA 4GMFA 5F3WB 3H1TA 3UFXB 1U8XX 4TMTA 1P1BA 3R2JA 4Q4CA 4JC5A 4B4WA 5JYEA 2V4ZA 3E22A 2AWOA 4RIGA 2VHVA 1XZMA 4PD2A 2G6TA 4ME6A 3QITA 2AS0A 1V16A 1XMOB 1NZDA 4HP8A 1Z22A 2GM5A 3U1BA 3A4MA 1EGAA 4YCCA 4HAYA 3SHOA 3PDUA 3UT6A 4AQ7A 3VYWA 3FPSA 4DVGA 2HXSA 3SK0A 4YMHA 3UJ6A 1LVGA 1P72A 5EWJA 2PZJA 4CV1A 4F96A 1TF2A 1EFUA 3I4LA 2RHJA 2ZREA 1JDBB 4FHFA 3OZXA 3TCNA 4MCJA 3PFWO 5ITZA 2VKTA 3T7SA 2QX6A 3DW1X 3B7GA 4JUFA 3OT1A 3ODPA 4IO0A 3UJ3X 5CAEA 3QBTA 3D1JA 5K0NA 1RABA 1N6RA 2RB5A 4X85A 3G2HA 3LXMA 1J8YF 4GU5A 1DQRA 2WJ4A 3JQ6A 4JBYA 1VCNA 3RHFA 1MO4A 3CCCA 4H7IA 2LVQD 4R9SA 3VYVA 5AHRA 2WKRA 3IEXA 4UNPA 4X71A 4X3CA 1CD5A 2ZBRA 4ALKA 1VPLA 5B7NA 5EAIA 1P33A 1MVOA 2IK8A 3IDAA 3HVIA 1JJIA 3ZX4A 2ZJ8A 4L2IA 1BWPA 4YUYA 1GL3A 3WGZA 5DHFA 5FUWA 3JQGB 1XLWA 2DKLA 1IM5A 3LUHA 4IV8A 5I8ZA 5K0LA 3BWVA 4HNQA 4HUJA 1YA6A 2O52A 4PAQA 1OYYA 2CL7X 1ZOOA 2WWXA 4KSCA 2NUAB 1G5TA 2ZIVB 4PINA 1MOQA 4CM9A 2XEXA 3OTWA 1G0OA 1WW8A 2BZ1A 4PC1A 3JYPA 4AY6A 5D7NA 1QR6A 4EG0A 1GHTA 3GFGA 4G0WA 2R4JA 3RWBA 3RD5A 3H4MA 2YVUA 2BMFA 2AEJA 2ZANA 1P8AA 1O97D 2G4CA 2QXTA 4MZXA 1P4RA 5LM3A 3QMMA 4KUEA 1BQEA 1HE5A 3SSOA 3MCWA 3EK2A 2KHZA 1P29A 4JP1A 3ENKA 4P58A 1Z15A 4QPCA 1GRQA 1UJNA 2XH9A 4G0UA 1FPQA 2E0IA 3IMCA 4R1SA 5CM9C 1HDRA 4D3ZA 4LMAA 5ALQA 1NZJA 3QBDA 1HORA 1OIPA 2OCYC 3OT5A 4XX0A 5JNUA 3SJUA 3H5IA 1XCMA 4RTMA 1GABA 1SOAA 3MA0A 4GGPA 1EXVA 1R0CA 4B7FA 4M2LA 4HDNB 1UJ5A 1QE3A 1YQTA 2J7PD 1J8FA 1QAMA 4MYDA 3NTOA 3S55A 2GZSA 4JSRA 4LXGA 3VSCA 2BGKA 1ECFA 2J4DA 3CRW1 2OV8A 4QE3A 2YRXA 1E9DA 4PFJA 3ZDQA 3HSKA 3M9LA 1KKMA 3LNCA 2K5UA 4AZ3B 5AKJA 3TBKA 1JYSA 3GPLA 1GNQA 4MUFA 4CRWB 4PSKA 4DANA 1Y9JA 1V92A 4HEJA 4R98A 3WFZA 4BV9A 4MP8A 3CCFA 2X9LA 2Z43A 3AL3A 3PRYA 1OLXA 1KR5A 3W5SA 1PBTA 2BHLA 2PYZA 3ZLUA 5JSUA 2OXFA 3M1IA 3EIUA 5EWMA 1NVGA 3WDLA 4YAUA 4JBWA 2P2CA 5LP6A 2IYRA 2IP4A 1P2DA 5A9RA 3BTUA 4GVXA 2J0EA 4CMAA 3S2ZA 4IXMA 5J2UA 2KEBA 1WSBA 2J6BA 5J5VA 2YIJA 2QJOA 1B0PA 4GMDA 1AKQA 2HK7A 4AW4A 2Z04A 1EUYA 3D3NA 3WRXC 4IDCA 3MINA 2D0OB 1V35A 4EMTA 3ZVRA 2J0UA 4FC6A 2P62A 5A5FA 3HEMA 3FSGA 3M6UA 3F9IA 2NUPB 3EDYA 1CSEE 3RK1A 4Y6GB 3ETJA 3NTVA 3COJA 4YJ2A 3BZWA 4FWHA 3PNVA 4F38A 2NTVA 5ABPA 4DCTA 1GGMA 4KQ9A 2D3TA 1HQKA 4EUSA 2IOYA 2CXHA 5I7VA 4ZAWA 5HCUA 3GA5A 1ATIA 3ESYA 4Q03A 4B2YA 5CVEA 3AQIA 1ZVVA 1Q3TA 3NHRA 2P4EA 4EMSA 3RNLA 4UKDA 3R8CA 4CDNA 4JZKA 2L82A 2ATEA 3EIWA 4N76A 1X7XA 2GD2A 1H23A 2IWRA 1D04A 2YVKA 1H2ZA 3C8MA 4MYSA 4FSXA 1UJ4A 2WHPA 2Y1KA 1CVIA 4G1CA 4I46A 4ZQGA 3UN1A 1EIZA 4F4DA 1EHCA 3KCNA 3NTXA 1EK1A 4JBHA 3OZBA 4B0OA 2B83A 3ETEA 1YJXA 4Y1GA 1TADA 2PFSA 2XFTA 1LFDB 4P7KA 2QDKA 3OKAA 4YRAA 4W63A 5P21A 1Q1GA 1N36M 5KCMA 3M4YA 4MEBA 1J9ZA 1XVUA 5KWIA 3QSGA 4TL7A 1T2UA 1JSXA 1PZFA 2KNAA 2J31A 2PL1A 1FJXA 1YV9A 4AJHA 4JSYA 3IPAA 4O08A 1R9MA 1AV7A 2VHUA 1R5NA 1JU3A 1LW7A 1NNUA 4BNWA 8GPBA 1RRFA 4ENTA 1JEOA 2FWIA 3V8VA 3EXFA 4B34A 3OQIA 2X2FA 1EVJA 3TB4A 4NOKA 3UCEA 2V45A 1BXGA 4IKOA 2O7NA 4JLAA 4ROTA 3DJYA 4TS3A 4E7PA 4OGKA 1JWAB 3OCCA 1EIWA 2E9SA 5JPDA 2I6XA 1XZDA 1IVSA 2QT9A 5KBYA 4HC4A 4ZPJA 5A9TA 4ARSA 2OQ4A 3M1AA 1E0AA 4O2BB 4KDEA 1T5DX 2FN3A 2I9PA 3G23A 2ZSKA 3HJTA 5LMUB 3U3KA 1WKCA 3IJ5A 5EIBC 1RQ2A 4OAQA 2NSDA 4DLUA 4HHEA 3VNSA 3D8HA 4TKUA 1GA4A 3BXXA 3TWMA 2NLOA 4HBZA 1V16B 1LZKA 1SY7A 5T4FA 4ZGBA 4LI3X 5LZ7A 3DM9B 2MH8A 2M6LA 3LCRA 3VPBA 3RRBA 3DBIA 4F3TA 1CS4C 5EWJB 5FI5A 4JAVC 3ZV4A 2EGUA 2B5VA 2AMFA 3OY2A 1XWFA 4V0KA 2EFJA 4Z0TA 1EWQA 1I2MA 4XDYA 1M2KA 1Q22A 4BOYA 1T1GA 1YFLA 2XTNA 3A36A 3DV0B 1QF6A 1KZYC 2WMDA 4FNGA 3T1OA 2ZYAA 3K71B 2FXVA 2FSSA 1YCGA 2KYRA 2Y99A 3DGFC 5ALKA 1TEVA 5BNFA 4IZ6A 4DCGA 1ZVMA 2WTBA 2X4LA 2H8KA 3JXEA 2KNZA 3SLRA 3W5IA 2FJPA 2JARA 4J0EA 2OO5C 1XCLA 2HF7A 4L5AA 4R83A 3PWSA 1D2GA 4EATA 2AOWA 4LF4B 2DWNA 1MA0A 3PXUA 4L8WB 4FFDA 3DEIA 3FPGA 4B0PA 4CIAA 1YZYA 5FUXA 1D2RA 2AL7A 1A27A 3W7VA 2G80A 1RR6A 4YJHB 3CXRA 3ORSA 5DH9A 4A2PA 2O4UX 3OF3A 5CJ2A 4MS4A 3SBJA 1IHYA 3JQ9C 4TMYA 4I4NA 5EWLA 2JBWA 5F4BA 3N0WA 2HJ9A 1TW3A 4Z4GA 4X95A 4MB2A 2Z8ZA 4BWFB 1XMPA 4U6SA 3I6YA 3EUEA 3OQBA 3P2OA 3QP9A 2C2KA 2NNWB 4IJFA 1T5LA 4B3JA 4W9MC 4E7OA 4BO1A 2LRHA 5C80A 4LF8B 1CUHA 1HLDA 1KJIA 1N92A 4TT3D 4DVJA 2I6FA 1RDFA 3SX2A 2E4VA 1T8WA 2D5AA 1TEXA 1RQNA 1C80A 1PP4A 4D4GA 1FDOA 2PX2A 4HGZA 1BKYA 4EGJA 4WZZA 3T61A 4Q4DA 2YNMD 1NU8A 4U39A 1BXRA 4Y2TA 1F2VA 1BDMA 1IOVA 1OTRA 4NDAA 1VDZA 3BE8A 1L5VA 2VHJA 3LP8A 4MQEB 5T5QA 2A2ZA 2QKYA 5FTKA 4P86A 1VKJA 4RY9A 4RFSB 2CFTA 3V4FA 1KNQA 3ZWPA 3LC0A 3F3YA 2L0XA 4FXPA 2IF2A 2PXHA 3HJUA 2INGX 5I9MA 2WJIA 3SCZA 4LRWA 1Z6YA 1P2VA 2IT1A 3ZTWA 2OGTA 1CUGA 2HT1A 2I1LA 3JW8A 3L92A 3ZOZA 3CJRA 1BGWA 2KLBA 2DZOB 4KBYA 3SQLA 4NV0A 5JXHA 4WE3A 3HI6A 2J48A 4FDUA 4E3ZA 4KUGA 2AW5A 5B1HA 3JWJA 1VCIA 2R1VA 1O95A 3U6QA 2ORYA 3EC1A 2DWUA 2QM7A 3N74A 4DB2A 5BRAA 2PUEA 4LXXA 2J3HA 4RHYA 2GXSA 4X41A 1U2TA 5EJ7A 2HHAA 3AEYA 5IVPA 3W2HA 1P9RA 2FMKA 3CLVA 1GNTA 1XD2B 2GEBA 1TB4A 5J1TB 5J23A 4NHOA 1PGNA 2Y1FA 5AKEA 2HMUA 4YIHA 3AF4A 1RI1A 4MS3B 4AG3A 3EVDA 4ZIRB 4U5XA 5ICCA 3RU7A 4PW0A 4QICA 3JYLA 2BWBA 3W3AD 3N0TA 5I9LA 3DMRA 3NBFA 3U3OA 4RD6A 2ZQ5A 4BEVA 4V1CA 2C1EA 5F78A 5KNCH 4TLBA 3E4RA 4QLOA 1VG1A 1ZNZA 3FVWA 4MEJA 2FSHA 4Z4FA 4CGYA 2FSUA 1N2IA 3M9XA 2PL9A 1MX1A 2WPDD 3NYWA 1OSNA 3QVKA 5M29A 4YJ2B 3V32A 2GZ1A 1MX0A 1ZY2A 3JAMA 1G6Q1 3CLTC 1C9KA 1GFWA 5BVHB 3GEGA 3GGGA 1T2DA 5EFOA 1U90A 3P0JA 3F97A 3JVVA 2IX9A 3TDNA 4MRVA 4XZ3A 1G4HA 4WZBE 4QDTA 5LQCA 2X2PA 1U3GA 1FDIA 1O9HA 4U8HA 4MYHA 3ZE1B 1Z0SA 4B44A 2X4DA 1UMDB 3HGIA 2GAOA 2JY6B 3EUWA 3R76A 1DGBA 4R5MA 3Q3HA 3P9PA 4YHBA 2H2IA 4BNTA 1PDWA 3I4YA 5KNDH 3GLGB 4ZAYA 3PIIA 1JHOA 3UBMA 4CPDA 3N6VA 1W6UA 4WCFC 1XD9A 5JNRA 4LCBA 4JI0B 3MD9A 1IOWA 2ODTX 2FY8A 3IA2A 4C7MA 5TQ2A 3OPQA 2Q6TA 2A9KA 1HYEA 3SJBA 3OZUA 5I8WA 1SC6A 4CIWA 1MX9A 3RVRA 2WJVA 2RHMA 2ZBUA 4JP2A 4WFIA 3TE7A 4JLBA 3H2JA 1T2AA 5LD2B 3NWEA 1VMKA 1R4MB 4DZTA 3FOWA 2I9KA 4DLXA 1SC3A 3W2EA 2Q8PA 3EXFB 3R09A 4EG1A 2DKFA 1A9ZA 5AHWA 3ZHXA 3LRPA 1K4MA 3GNTA 1QYDA 4TL8A 4O25A 1EWTA 3FHJA 1L7VC 1A76A 3ESCA 5FAKA 3G7UA 4C0QC 3FRIA 4HEA6 4G86A 1KTIA 8MHTA 4E0BA 2X42A 5TQVA 2FZKA 3LC2O 3UMGA 4TVKA 4OV6B 3A1DA 1OTXA 2G82A 4W5WA 3IQHX 1ZYUA 3GRZA 1XAGA 1VDLA 1NBME