4LJ6A

Clpb nbd2 from t. thermophilus in complex with amppcp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
323
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGELLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 108
structure length 323
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj6A01
5C18A 2QN6A 3KJGA 4CEHB 3FOZA 3WBKA 1J8YF 2FEMA 4QHSA 4YMVA 1QVAA 1ZC4A 2KBEA 2KI5A 2ONJA 1Z63A 2P67A 2CCJA 4V0NA 2V4ZA 1JQLB 1JB1A 3VR6A 1G8HA 4DLRA 1CTQA 1V43A 4Z51A 1J2JA 2IL1A 2A3RA 2WHXA 4IOMA 4OKSA 1E2LA 5JCZA 5D3QA 4KFUA 2FSIA 1R2QA 1DBSA 3LQQA 5L3SA 2B8WA 3B1YA 2VHQA 1P9RA 4JLJA 4BRWA 3PEWA 5FUXA 3LRPA 1AZTA 1UBGA 2FSFA 3BD9A 3CRRA 3FTQA 3ZQ6A 4DLYA 1XNJA 3THXB 2VSOA 2EWWA 2IUSA 3LW7A 4Q02A 1DE0A 4V0ME 1X6VA 5L3VA 4B48A 1Z0FA 2EFHB 4GOJA 3QQ5A 1J99A 1YR8A 2L0XA 1IN4A 2D2EA 3VR3A 1PUJA 1UADA 3TSZA 1YRBA 3TUJC 5G3ZA 1X37A 1J8MF 5JFGA 2OLJA 2ZJ5A 4LHWA 3K9NA 2HJVA 3VNUA 1Z6AA 2B8TA 3LDAA 1EFCA 2ZRGA 3A8TA 3T5DA 4F7WA 1N6RA 2PMDA 4PQFA 1HQYE 3NH6A 2Q21A 1UBFA 1UEJA 1DARA 1VYVA 2ANCA 3SFVA 3M4YA 1XCMA 5A5GA 3PEYA 4NCNA 1MV5A 2F43B 1IOZA 2QAGB 3VQTA 4C0QC 1L4YA 3PCRB 4IEIA 1SVOA 2W6JA 3D6TB 2QP9X 3ZZUA 1N5LA 3SNHA 1PUIA 2IF0A 1T0HB 5FOSA 1OKKD 3NHAA 2ZI3A 4M8NE 2EFEB 3KTAB 4CYMA 3P4XA 1V5WA 4CGZA 1XEWY 1R4AA 2A5JA 4FWGA 3CR7A 3K9LA 3PEUA 4DLZA 2NIPA 3D31A 3VKGA 3RS3A 2YWEA 4BFSA 2F1IA 2G0NA 4B44A 1IXSB 4MRSA 4OHXA 1S9DA 4P4TA 4WIAA 3UWOA 3M6AA 4BFVA 2MSDB 2QQEA 3ZDQA 4BEBA 2DY1A 5H68A 2ONKA 2CE2X 1NIPA 4QBIA 2F9LA 3MRSA 5KSOA 1OV4A 3LO5A 4IOLA 4B73A 4TL6A 3AM1A 1BKDR 5DIFA 3U44B 5FUYA 4LBYA 1A4RA 5A0FA 4QFMA 2OFWA 1AZSC 1NBMA 3VR1A 1BOFA 3AH8A 5CJPA 2G0TA 4EDHA 1E0SA 4B43A 1CR1A 3EPKA 4PZLA 4PQRA 5HCIA 1E69A 2V6JA 1TAGA 3LW8A 5B30A 4FI3C 1O87A 1E1QD 3KQLA 1R0XA 3B5JA 4HUQA 1ZNZA 2C2HA 4I1VA 4DLSA 1G6HA 2OCAA 4JLBA 3TSWA 1E2MA 2F1JA 3K70C 3I5XA 4R7ZA 1KKLA 4TTQA 5F9HA 4JLKA 2P65A 1AJEA 4AYTA 1SXJD 1XMVA 2QGNA 4TQ9A 1SVMA 2J7PD 1KYIA 1RFLA 1IJFA 5EE9A 2JJ2D 3Q5DA 3DVLA 4BLRA 3QKRA 4EFNA 4MYHA 4ZDJA 1P61B 5CM9C 1EFRD 3OAAA 2ZAMA 1EFRA 1EX6A 1ZM2A 2OCPA 1G8YA 2PX0A 2J0UB 2YYZA 1Z0IA 2O8DA 4Z1MA 4LJ6A 1RJ9B 1EGAA 1C1KA 4Q9HA 1AKYA 1E9RA 1DOAA 3B8HA 1R10A 2BEJA 1KI6B 1BMFD 2H57A 2REOA 2IXFA 2FWRA 1ZD9A 1GKIA 5FL3A 1T3LA 1VG0B 1FQJA 4BECA 3W34A 3L0PA 2FA9A 5K8IA 4OHYA 1GAJA 3MWYW 4Z8XA 3RRMA 3TQFA 3BE4A 5EE1A 3VMFA 4B3CA 2NMVA 1ZU4A 3EC1A 3OE7D 4DUGD 2P6RA 4LJYA 3CH4B 3O8RA 3VKWA 1OSNA 4EFMA 1ZW6A 1YZUA 4NP6A 1A5TA 4ZDIA 1JJVA 3T12A 1IY2A 5DLQC 3W6PA 2VH5R 1EXMA 1JAHA 1LS6A 1UBCA 1G41A 5AR1A 2YKGA 4F92B 3QI2A 1YZNA 4QBGB 2P5SA 3UXMA 2G3YA 3WXMA 421PA 3PJRA 1Q20A 3ZLJA 2WTUA 4AKGA 2EVWX 4BPBA 3TK1A 3UMFA 4C4PA 5DGXA 2ZUCA 2GAOA 1FPMA 3GJ7A 2REBA 1W48A 2XB4A 4KCGA 4MUBA 3QXHA 1Z6YA 4LGMA 1TF5A 3CNLA 2FJUA 2GTPA 1JR6A 2ERXA 1OT3A 3R9IA 4LRSA 1CR4A 3KJIA 2OBNA 2YOGA 4GP7A 4M4SA 1OJLA 3AF0A 5EE0A 1GL9B 2W6JD 2YC2C 4FD2A 2ORVA 4DIDA 2OT3B 1Z2CA 1UKVY 4PZZA 2WSMA 4ASUD 4V03A 3THYB 5BN4A 1P2TA 3KQUA 3U44A 1OLOA 2WKRA 3SBDA 5DN6D 3CW2A 4HAWA 2ZE7A 2A5GA 3BOSA 1Z47A 3BJIC 2RHMA 1QHXA 5LBIA 1M74A 4DCSA 3MCAA 1T5LA 2IYXA 3A1UA 2WOJA 4XOIA 1RYFA 1S9HA 3RS5A 3SOPA 4AKHA 2A7QA 4IDQA 1CIPA 3FPAA 1BYIA 5JSZA 2WM9B 3MFYA 4Q4LA 2Q9CA 2N42A 2AD5A 4K46A 3KKOA 4E5UA 1JXMA 4EIWA 1XTRA 2WJHA 3EZFA 1TX4B 1GIAA 1WB9A 4G5QA 2HEIA 1X8LA 5IDVA 3BK7A 3QXSA 4Q9IA 2VSXA 2OCBA 3FMFA 3TQCA 4NZYA 3UKDA 3T15A 5EXSA 2GEUA 4JIMA 1Z2AA 3B1XA 2FMXA 3BFKA 4UJ5A 2E87A 1R0ZA 3ZS9A 1B23P 1S3SA 3KTAA 3AKDA 2C96A 4IVRA 5JBQA 3D3QA 3TW8B 5L3QA 2CHVA 3B78A 3RSOA 1WXQA 5TB5A 2AKAB 2AN9A 2QTFA 3HPRA 5ELXA 3RRNA 2VEDA 3H4MA 4QHYA 2CL6X 5JI2E 5B2ZA 1W4BA 5JWHA 4KFSA 4M21A 3C5CA 4LHVA 4M9QA 1G20E 3N70A 4A82A 1OFUX 3ETLA 4DDTA 2DFTA 3UMSA 3LWNA 2ZUDA 5KDLA 3DZDA 3SR0A 4XWOA 2J1LA 4WZ6A 4DZZA 3U60B 2QM7A 4BFUA 1GM5A 3JVVA 4OQLA 5DN6A 4EJSB 5F9FA 2BM0A 1AA9A 4YMUA 3CR8A 1KZ7B 4JLOA 4IFBA 2VP2A 2ZRJA 1RRCA 4L16A 5DYIA 2FZ4A 2CDNA 2PEZA 4KSBA 1Q1ZA 4LHZA 4IDPA 5EXTA 3GLIA 2DWPA 5FOWA 1XJ0A 3LVRE 4TMZA 1UJ2A 1ZCAA 2EWVA 2REXB 5G3YA 3KW6A 2GBLC 3GD7A 1WRBA 4IDNA 3GJ4A 3OIUA 1DAGA 4HUTA 3AVUA 2QTVB 1S0UA 1D2EA 1NN5A 1EG7A 2P0EA 3KB1A 4FWDA 4RKFA 4KJZA 4BEJA 2XTMA 1E2NA 3ZVLA 4ERNA 3BAFA 2QY9A 5FOUA 4KODA 3GLGB 3RRYA 3GFTA 3NC1C 3SE0A 4MDEA 5FR1A 5LB2A 2WWWA 4B2IA 4YLGA 5KUTA 2PBRA 4ZO4A 5GADl 3CZPA 3X1DA 2WSSA 4KVAA 5FOXA 2PJRA 2XJ4A 1M1YE 2CK3D 4Q1EA 2NTYC 4PHFA 1F5NA 4PC3A 1E2FA 2OLKA 2GRJA 4IKEA 2XGJA 1RYHA 2QA5A 1XFAA 1HYQA 1OXXK 2DYKA 1KKMA 4JYBA 5M04A 3CRVA 4JLAA 3ZVMA 3RS4A 2QGZA 5EP1A 1KZGB 3IIJA 4YMWA 1W7AA 1GKYA 4XD7A 4CW7A 2WJYA 5L3RA 2JLZA 1RPZA 1RW4A 1HY3A 2GAAA 3TGPA 2ZEJA 2O8CA 1Z07A 2IYUA 1Z6GA 5IK2A 1G5PA 3KKPA 3ASYA 2PEYA 3VR2A 2J41A 4RCYA 4FMCF 2C5LA 2IWHA 2VP5A 1P4SA 3E70C 1E79A 2XZOA 1HT2E 2ZRDA 2EFDB 2LKDA 3G5UA 3NXSA 5KHOC 1AS0A 3QKTA 3SJCA 1W0KA 5FI0B 5FTJA 1II8B 2RGGA 3K53A 2C8VA 2GILA 2JJ1A 4HEJA 4L9WA 3U7FB 2QT1A 5EUMA 2QEQA 3LLMA 2ZRNA 5EZ5A 1ZNYA 3CO5A 2JLYA 2ODWA 2DPXA 1QHHA 4Q7KA 3K0AA 3BRWD 4KXFB 2HF8A 4IOKA 2HDNB 4A0GA 1IM2A 1LS1A 3IPXA 4XH9B 1NIJA 4US2R 2JGNA 2VSFA 4Q47A 1KAOA 3SJBA 4BFXA 4OI0A 3IILA 2RGEA 1CJUC 2ZUBA 3AVWA 4JBYA 3GLGE 4KI0A 2ZS8A 2YV5A 1S3GA 1E1QA 1VCIA 2IW3A 4QC2A 4RKEA 4GITA 1OW3B 1SULA 3WYAA 1DAEA 1FW6A 2DB3A 1KI9A 1YRAA 4IW3B 4PC1A 1WBDA 3W9YA 4UNSA 3C16C 1PLKA 2NPFA 1Q44A 2P6NA 5HPYB 1QG4A 1US8B 2QQ0A 2ODNA 3K1JA 3DMNA 1ZVQA 1GFIA 1KI3A 4GSYA 2JAQA 2XOKA 3ZIAD 1DTSA 5SZHB 1VKJA 4V0OA 1LFDB 1YZQA 4UJ3A 1S8FA 2CVHA 2I1QA 5BQ5A 3B7GA 4LX0A 2EQBA 2I1VB 4MITA 3T1QA 3DOEA 2X19A 3ZYCA 1R0WA 3TSOA 2ZPTX 2Q3MA 2ZQ5A 4HI0E 2J59A 1GDDA 1U9IA 3FKSA 4LPKA 2ZAOA 2GA8A 2R6AA 4QGAA 3R7WB 4D4LA 2H18A 3HWSA 1EFHA 2NO9A 1XU4A 2RGNC 4NCJA 4QJ4A 4ZI3A 4RFVA 1E0KA 4FMDF 3VR5A 3EIQA 4C2TA 2N1BA 1NMZA 3OEHD 3QPUA 4JKIA 4QKQA 1XMIA 1RZ3A 3F0TA 4XWKA 5AJWA 4TT3D 2NG1A 2VL7A 1EFTA 1MO4A 2Z4SA 1JAIA 1CXZA 3HR8A 3CRMA 1MH1A 3EWSA 3AVYA 2XZPA 3B9PA 5JCPA 3MWJA 1PV4A 5B58C 1WDTA 3LNCA 5G41A 1BH2A 2XNDA 2YHSA 3I5YA 2R6CA 3X1WA 1F2UB 4LY6A 2VQSA 1AGRA 1S2MA 2QSZA 1EWQA 1F3OA 5FPKA 2NOAA 4BFZA 2ZYWX 2IEZA 3THWA 3UATA 1XP8A 4Q01A 3OFND 3RS0A 4G5SA 2AKYA 2HYDA 3KKMA 4RVCA 2HYIC 4EQ6B 4S35A 5CB6A 3R9XA 4YXWA 2VHJA 2DZOB 3T1TA 3RWOA 1W1WA 1XEXA 3P32A 1W44A 2WIBA 1CJTC 1W5TA 4H1VA 4C30A 2DWQA 2I4IA 3PUXA 2RGAA 5KSPA 3GEIA 1DO0A 1LTQA 1OH5A 4DIEA 3X1ZA 4M1KA 5AWFC 2ZTSA 5BN3A 2P5TB 1NKTA 3KKNA 8OHMA 2NO7A 4F4IA 4Q4HA 5HTKA 4NYJQ 2C99A 3ND8A 1U94A 2JDID 4G01B 1XEFA 2GWHA 3GFPA 4DC9A 2KJQA 5FUWA 4NTZA 3KZ1E 3QUSA 5F3WB 1G18A 3CWQA 3DO6A 3LFUA 4Q5IA 2GDJA 4DLVA 2RGCA 2FH5B 1VG1A 1HV8A 3MWKA 4BFTA 4PZYA 1X1RA 4CDGA 1GNRA 2VLIA 3NEYA 3V00A 1LF5A 3F8TA 2EU8A 4JT4A 1WCV1 4RFSB 2ZITA 2OO7A 4ACAA 3O47A 2J9RA 4IEEA 1R5BA 4QBFA 2XXAA 3BXZA 4LYJA 1DAKA 1E2IA 1VMAA 2QMUA 3L0IB 2E1RA 1KSGA 1KTVA 1WF3A 3I61A 3W90A 3C4JA 1UM8A 4NDZA 2BBWA 5CK4A 2GNOA 2WKPA 1W36B 4HZUB 1IN6A 4TMKA 3NG1A 4P4SB 3T61A 4D82A 4CRWB 4DJTA 3C41J 4PHGA 1T8UA 3VTKA 1YKSA 4NE2A 4DEXA 4F4CA 1TADA 2WMOB 3M1IA 1E9SA 3AF2A 4HLQB 1NVXQ 2D74A 3EC2A 4J0QA 4EJSC 4KYIB 5P21A 3A1WA 3UWKA 3ZD7A 1QRAA 1W4AA 5DISB 4PHHA 3IEVA 4JJKA 5IHPA 3NIBA 1Z06A 4U5XA 1Z0AA 5JWOA 3TNFA 4NCIA 4RZ3A 4Q4JA 3WNDA 4AK9A 4PFSA 2PLFA 1KSHA 3GLGA 2C9YA 2DR3A 2CEAA 3LH5A 4LSGA 3SFZA 2ZSDA 4G5RA 2IYWA 1GP2A 3VAAA 4C0HA 5B64A 3QKSA 4C7OA 1E1RA 3L2OB 4RSGA 2QMHA 3ADDA 4P0TA 1PLJA 5KDOA 3U7HB 1KNQA 4LJ9A 1LF0A 2CXXA 1MRSA 4TYPA 4LCBA 1E2HA 1HT1E 1L4UA 3IQXA 3P4YA 4BLQA 4E07A 1MO5A 1T9HA 2IUUA 3QPVA 3AP3A 1QF9A 3FKQA 1P9NA 4P33A 2AXPA 2WICA 4CZ2A 4Q1DA 2FE4A 4DXAA 4HDCA 3EW9A 1CJVC 2FX3A 2MSEB 1VG9B 2YZ2A 3K70B 4URYR 2P6UA 2CLSA 3THOA 4DSTA 4AKIA 4R2HA 4GI7A 5D3MB 2H1LA 1OFTA 1QZXA 3C7KA 5DI9A 5FL7D 821PA 2WJJA 1EK0A 3CUEF 1XMJA 2A2ZA 1F6BA 1LNZA 2ZSFA 4BFYA 1TUEA 1XB2A 4HZUA 3CF6R 3IEUA 2QBYA 1FMLA 3F3YA 1E3MA 1G9XA 1G1MA 4A8JB 4WBSA 4ESVA 2PZEA 1GWNA 4HB0A 1R7RA 2WVJA 2R65A 1KMHA 4HB4A 4M22A 3EIHA 3QXCA 2QRZA 4HAUA 3QSYA 2QP4A 4LBZA 1PJRA 4Q1FA 4ZCMA 2FPKA 3IPYA 1S1CA 2J87A 4ZDWA 3AGQA 1SKQA 3DZ8A 4NYMQ 5J40A 4XTCS 1IONA 4PC6A 5TVKA 3RC3A 1NVWQ 3AVPA 4O2RA 4UXJA 1X8KA 4FMCB 1SVSA 2ZE5A 2OE2A 5CITA 1TQDA 1XTKA 5HKKD 4GL2A 3CONA 2GETA 2ZRHA 2HT1A 2QTHA 1ESNA 1NN1A 4PPQA 3NH9A 3O8CA 2RAPA 1ZD1A 3AP2A 2MSCB 3AP1A 4UNPA 4W5WA 4W5JA 3BORA 3SYKA 3K09A 2XX3A 4NYIR 1K5DA 4NHOA 3WMFA 1Q0UA 3QBVA 4M53A 4A92A 4X8LA 5TDHA 3LX5A 4RZXA 2OSBA 4MKIA 1VTKA 3T1OA 2WWYA 1R8QA 2FSGA 2NO0A 3IIMA 2VP0A 5DSZA 1TMKA 3BERA 5JSZB 3CF0A 4KV9A 2D7DA 1I2MA 1KHTA 3CNOA 2VBCA 1C1YA 3BWDD 4RD4A 1E0AA 4AG6A 2Q0HA 2VHTA 4JLDA 4NPHA 3DL0A 4JYCA 2OV2A 4Q19A 4BLSA 4Q7JB 5C2JB 2IS1A 5J4VA 1R0YA 1NP6A 2D4HA 2VF8A 4DDUA 3K0SA 3WMGA 4A8JA 2W6ID 1XJQA 4R2IA 3IHWA 1SZPA 2QG6A 2DBYA 2QE7D 2ZE6A 3OE7A 3ONWA 4HAVA 2AK3A 4P4UA 5KPJA 1IN7A 4LZZA 4A6PA 4LYHA 4XIGS 1F2UA 2IK8A 1LB1B 4G3XA 3FE2A 4BLPA 1QHIA 1UKEA 1YZGA 2A30A 3SI7A 2QL6A 1Z29A 2AHOA 2XZLA 4DWJA 2BM1A 3QIAA 1L2TA 4S2EA 3I4LA 3HU2A 2FSHA 1VPLA 4Q48A 5FOTA 3SHFA 2X2FA 2IWRA 3PITA 3EAQA 3VHXA 2B6HA 1XD8A 3X2SA 3NBXX 1C9KA 1IAQA 2D3WA 2JLSA 4LYFA 2BMDA 2J0SA 3X1XA 3SZRA 4KFTA 5L3SB 3CIOA 4QGFA 2AXNA 1KI2A 2VO1A 1HE1C 1CLUA 3JVUA 2D06A 4WVFA 2XSZD 1Q1QA 4D0NA 4HYYA 2JATA 3AVXA 4C0SA 3I1FA 4DSNA 3CKLA 1OFIA 3KJEA 4DLUA 2RCNA 4R98A 3FMIA 4HLUC 5JS8A 3FVQA 1F48A 2IHBA 3WBJA 2WWGA 3RDPA 3ZZ0A 4DLTA 2YNMA 4GRAA 4K8OA 3VX3A 4EUNA 2VYFA 3O8DA 4TLAA 5TARA 3MG9A 3ICQB 3GP8A 2P3SA 4Q66C 3KFVA 4P32A 3ADBA 3HU3A 3VLFB 4Q1BA 2O8DB 3I92A 4Q4AA 4MH0R 4TLBA 5FTMA 1ZP6A 3NBYC 1P62B 2FPMA 1P60A 2AWNA 3IQWA 2YOFA 3ZD6A 3PG5A 4N0DA 3QKRB 1MOZA 1CU1A 1IJEA 2O0HA 2R62A 1FMJA 4JLVA 1D9XA 2GK7A 4EPWA 4PPNA 3B6EA 4P4SA 3SC3A 1TU3A 5FPTA 1Z0KA 2GBLA 3CPJB 3ZIAA 1E2KA 1G21E 2BHRA 4IXNA 4JMPA 1K8RA 3PXGA 1MR3F 4OI4A 4PPFA 1COWA 1P2VA 2CJWB 4Q21A 5FL7A 1TEVA 1FUUA 5TMPA 4W9MC 3QBTA 3I72A 4BE7B 1SVIA 1ZUNB 2WWIA 2Z83A 1Q3HA 3PEVA 1RRFA 221PA 4Q00A 2WWFA 1QHHB 3M0EA 1UDXA 4RFSA 1NSTA 4DEYA 1CR2A 1R5NA 3Q9LA 1BMFA 3AKCA 4UXIA 3W8NA 5A4JA 2H7VA 1GRNA 4IDOA 4BZXA 3A1VA 3WMEA 3EX7C 3ZVNA 2GJ9A 1XTSA 2ECKA 3PVSA 1XD2A 1R8SA 5AK0A 3DOFA 1MO6A 1CRQA 2GCNA 3RS2A 3BIFA 3LQRA 4LUCA 2ZI9A 2LWIA 5BYJA 1G8FA 1OH6A 1KY2A 4IVQA 4B34A 5LD2B 2ATXA 3A4MA 1E9DA 4YDSA 3FHCB 2ZRKA 1OH7A 2HT6A 4KLZA 3I8SA 4MQBA 2IF2A 2YVUA 1T91A 3PFIA 2PZFA 2QP3A 4DT1A 1YZKA 1N6PA 4OYHA 1E4YA 3AVTA 1U2RA 3H1TA 1W0KD 4FW9A 4ZKDA 1HEIA 4B3XA 1P9WA 1W46A 3K0FB 2WJIA 2ZR9A 3NDPA 3H0KA 1F2TA 1H8ED 4BQSA 2ZM5A 2GHIA 1BS1A 2F43A 2QAGA 3KXKA 5IF9A 4TMVA 1HUQA 2AL7A 2WIAA 3NEJA 2QENA 3R8CA 5TV2A 1W2HA 1H8HD 4LV5B 1NG1A 1NL3A 3GLFE 5KO2A 1BO6A 4DCUA 4URZR 4ARZA 3QXXA 1AQYA 1S4QA 3BH7A 4FWTA 1ZC3A 2FFAA 4AIIA 1E96A 2CHQA 2KBFA 4KITB 1FL9A 1KMQA 1E99A 1RKBA 2GF0A 4M9ZA 3VU9B 2PCLA 3VX4A 1QHSA 3THXA 1L8QA 4M1YA 2BBTA 4RZUA 2JJ8A 2CK3A 1KGDA 3CX8A 4B35A 2O5VA 1GRRA 2IEYA 3FMPB 1QVRA 4BLOA 3GLIB 4L15A 4U7DA 2HXSA 3IIKA 1VHLA 2FPLA 4RD3A 1TUIA 1XTJA 2DCUA 2ZROA 3UIEA 5KDDA 4A15A 3FKSD 4WA7A 4N1AA 3EPHA 2ZANA 5FBVB 4IFEA 1WMSA 2OM2A 2IYSA 3R7WA 4I1OA 4RD0A 3U6KA 3RC8A 1UBEA 5H1YA 3UK6A 1OE0A 3LY5A 5SZJA 5KTYA 1U90A 1I4TD 4OI2A 4B74A 1YZLA 1GTVA 2EYQA 2YINC 1KAGA 1VIYA 1P2UA 4B2LA 2B7BA 3IDQA 3K9HA 3A37A 1IY0A 4CEHA 2H17A 1I4LD 2G9NA 3ICEA 1ZM7A 4JSTA 2V7QA 1DO2A 4DB4A 3GJ6A 4FIDA 3CLVA 3GLFB 3CPHA 1OHHD 2FG5A 4AC9A 1TL7C 3TAUA 2IS4A 1C4OA 1JJ7A 2JEOA 5KSZA 4A2PA 4FCTA 2QSYA 3K0FA 4TYYA 1GNQA 3B1ZA 4W5HA 5DO9A 2R6GA 4NCHA 1N25A 1KJWA 4NL4H 4DT1B 4FXPA 1G3MA 3ECCA 1G8GA 3KKQA 2QM8A 1NLZA 4B76A 4O3MA 4E09A 3QF7A 4U02A 3KXLA 4PHTA 4D6PA 2IXEA 2X1VA 2ANBA 2AR7A 1ZIPA 4GOKA 2PT7A 3A1TA 3AGPA 1M34E 2GVDC 4PPGA 1XDBA 2CCGA 1H8HA 4YC7A 2LKCA 3L82B 2DZNB 2JIZA 1P5ZB 1GL7A 4G1UC 4JN6A 1TF2A 4WZBE 4LHXA 5CB8A 3TUZC 3R8FA 2ZSBA 2YWFA 1FUKA 4OK3A 1RC8A 2BJWA 1II8A 2GESA 4NCKA 2IA5A 3GEHA 2VHCA 1D8TA 5KPDA 4B2PA 2CJWA 5IT5A 2JLWA 2G1KA 3CH5A 5GJVC 1OF1A 3FB4A 1U99A 4HDOB 4TT3A 1T0JB 2CE7A 5CLLA 5AUQA 3RWMB 4BZQA 3PUYA 5CDFE 5AJYA 3MJRA 3QENA 1Z28A 2XEXA 4OQMA 2GEVA 2ZS9A 4MUAA 3EASA 4C0JA 4GNKA 5GJBA 1CP2A 1G7CA 1U81A 5GJCA 2FDCA 5B57C 1ZU5A 3KXIA 1R5OA 4F93B 4OQNA 1UAAA 4PO1A 1PLLA 1MABA 1TQ4A 2BCJQ 4P31A 1YVDA 4Q4AB 5BW8A 1NVVR 1VIAA 5KNBA 2QRNA 1KDOA 5EJEA 1M2OB 4MRNA 2J5XA 3BB1A 3OHMA 4Z8YA 3KUCA 4LBVA 3VHLB 2JLRA 3DKVA 3IO3A 2OAP1 3TIFA 4L4UA 3TKLA 3WNCA 4Z54A 621PA 5EXPA 1G7RA 1QG2A 2GCOA 1OXSC 2J46A 2OBLA 2OBMA 2ZREA 4GT1A 4BWYA 4Q18A 4C0KA 4Q9JA 4LOAA 4ESHA 1I4DD 2Y8EA 4FMBB 2ZI7A 4O2LA 4AI6A 1JR3A 1VCNA 2BCGY 2QU8A 4JL8A 2IS2A 2BMEA 4NYMR 2Q9AA 5FBWB 1PVOA 4HAYA 2FEOA 2GXSA 5SZKB 2DHRA 2H16A 3TAHA 5HCNA 3G82C 4GDFA 2B92A 2DFNA 4PAOA 3U2QA 3NWJA 2F3RA 4PO8A 3SJZA 5KSYA 1YJ5A 1W0JD 3LX8A 2VRWA 2AX4A 4B47A 4UXHA 2Z4RA 5BWMA 3A4LA 5DHFA 2W0MA 2RHDA 3L8ZA 4TTPA 5DYGA 4I99A 3GFOA 4JS0A 3Q7PA 2PL3A 1E9BA 1N6NA 4GZLA 2QAJA 4LJ7A 1G3UA 1AK2A 3TUIC 4CEIA 2RGBA 1KIMA 4IRUB 4EJSA 2C95A 2BKUA 4LJAA 1Q21A 1TQ2A 4DLWA 2WZQA 4LI0A 1UPTA 4AG5A 3QE0A 1KO5A 2GEDA 4FMDB 4V02A 2ZRAA 2ZR0A 4HLUA 2UVQA 4DDWA 1WBBA 1ZUHA 3OESA 3IBYA 1OFHA 2MMCA 2BWJA 2H92A 2IC5A 1XTIA 1G3QA 2F9MA 1NVMA 3QEJA 3U5ZB 4TMXA 2OXCA 4MA4A 1ZJ6A 1D5CA 3AQ4A 3H84A 2IHYA 1AIPA 2J7PA 3AUYA 3ADKA 2O52A 1JALA 4RD1A 2CMKA 1AGPA 1T3HA 3QNUA 5IK2D 4RCZA 1OPXA 1DAIA 4CEJB 2WAYA 4LWZA 4Y0VA 2HLDA 4A2WA 2Z6VA 4A3VB 4JBXA 1XZQA 2R44A 3ZJYA 1J70A 1DG3A 5EUQB 5KNCA 3K0CA 1G6OA 4D25A 4B32A 3RABA 3LBHA 1GITA 4Q1AA 3RHFA 2RGDA 1M8PA 3TBKA 2JA1A 4JVMA 1SXJA 3LBNA 4YMSA 3BBPA 2ZSEA 1E2DA 2DFLA 1IXRC 5KU1A 4M1OA 3A6PC 5BN5A 2IYVA 4NU0A 2F7SA 3RRZA 5E3HA 3G0HA 1SXJB 1XTQA 1IHUA 2FU5C 4MKFA 4MYTA 2EFGA 3I3SR 1U8ZA 4N3NA 5EQTA 3OF5A 1W0JA 4FWIB 3SHWA 2QUZA 4KHZA 2CBZA 1CULC 2NPIA 3LVQE 4KLNA 1E2QA 4M1MA 4QXAA 2WV9A 2WPDA 2BJVA 2Q6TA 4TTRA 4HB3A 5C1BA 4TL8A 4EPXA 3B9QA 1EWRA 1D2MA 1Q1BA 2NQ2C 4RD6A 1XPRA 2QROA 2QPOA 2DFKB 4LJ8A 2FFBA 1KI1A 2YJTD 1RE0A 1ZM3A 3QF4B 4GPTA 1QHYA 1XPOA 4TYWA 5JI3E 4PR0A 3FWYA 4ASUA 2V3CC 2TMKA 2OEPA 2BDTA 4FCWA 1AQUA 4EPYA 1NKSA 4YMTA 2VP4A 2J3EA 2PT5A 3U4QB 4CT4B 2ZJOA 4PTLA 1U0LA 2OCYC 1YR6A 1G3IA 2AWOA 2VA8A 4C2UA 1CEEA 1QDEA 1T5IA 1VHTA 2WWHA 4OHWA 2IYRA 1IN5A 2J0VA 3D7MA 5JECA 1MKYA 3L0OA 1E2PA 4CF7A 3PUWA 2RMKA 2YOHA 4E03A 4QL3A 4CEIB 1A2BA 2BV3A 4ZCLA 5FBRB 4A6XA 1E98A 1UDWA 4D2IA 3V4RA 3BH6A 3HPQA 3MJHA 1MT0A 2Z0MA 1TNDA 2N46A 4BZPA 1GOTA 3BB3A 5GVRA 4V0KA 3TH5A 4YONB 4TL9A 2ZSAA 3MUFA 3EG5A 1DPFA 1A1VA 2W2VA 2BMJA 2BEKA 2ERYA 4MRPA 4EFLA 2QMOA 4YXWD 4K81B 3TRFA 5J4KA 5TY0A 1A2KC 3QKSB 2ZRPA 3B2EA 3MLEA 4DDVA 3TMKA 1E94E 4KBFA 5EE5B 2ZJ8A 4DVGA 4YDHB 1GZSA 4XSGA 4MKHA 2JJ2A 3U7GA 5CYOA 2GVZC 3AF4A 3U3OA 3GJ0A 1N6KA 3V9PA 4A0FA 4D4MA 4TQUS 3IO5A 2ZVQX 3U61B 4Z1MD 3H2YA 1S96A 4ACBA 3B1WA 4KU4A 4CIDA 2GXUA 1RJ9A 2IYTA 5C46F 4A8JC 3EWAA 1Z8FA 1ZM4A 5UKDA 1NMXA 4URVR 1US8A 4ZKEA 4D26A 2QMEA 1GG2A 4JKYA 3FGNA 1NRJB 4Q9LA 5TXGA 4HLCA 2G88A 4US1R 3C14C 5JRZA 1E32A 1XZPA 2JIZD 2R6DA 1JECA 4JLNA 5DI3A 3ZQJA 2O8EA 4M9SA 1E2GA 5FOVA 2WSSD 1KJYA 1O3YA 2ZRCA 2V55B 3Q8XB 3DM5A 1KOFA 2GXQA 2R9VA 3QEOA 3GJ8A 1D6JA 1DAFA 3DKPA 2NO1A 5AJVB 5H70A 4ZIRA 3REFA 4OK5A 1W36D 3QG5A 4DHEA 1CJMA 3KB2A 4JL5A 4CT5A 2EW1A 1ESMA 4LJ5A 2CNWD 3K8YA 3MSXA 4LHYA 1VG8A 3K70D 1Z6TA 3B60A 2XXAB 5E95A 2GKSA 2W58A 2OZEA 5FTKA 4ZCIA 4EKDA 2HF9A 5EZ6B 3T35A 2AK2A 3RYTC 5JMTA 2HCJB 1W5SA 1K6MA 2JLVA 3AF3A 2A5FA 3WHLA 4OQFA 1GRQA 3T5GA 4DCVA 5E7IA 1N5IA 1SGWA 2VF7A 5G40A 4BLTA 1UEIA 2YWHA 2H5EA 3TE6A 1EESA 1P6XA 4HATA 1ZD8A 5DH9A 4AD8A 4F91B 1E9FA 4B6EA 2OAQ1 1KK0A 4UNRA 2KWIA 3I73A 3EIEA 6Q21A 4QNRA 2O8CB 4PSAA 2BC9A 2LCFA 1FP7A 1CF4A 1M6NA 1OKKA 2C77A 2P2LA 1CR0A 2VTKA 3P20A 3EA0A 3IKJA 2JLXA 3GCGA 2KSQA 3BB4A 4AY2A 2W83A 3DEFA 2Z5FA 2CVFA 3N5CA 4A1FA 1OIXA 5GVSA 5J4LA 4XVQA 4TLCA 4NH0A 1II0A 1XBTA 1CKEA 2CLCX 4FWHA 3KQNA 4IHQA 3T1VA 1NI3A 3GLFA 3V4FA 1KNXA 4PQYA 3LXRA 5K8UA 1XD9A 5AJZA 3N2EA 4PSVA 2IYLD 5ANRB 1NMYA 1OH8A 2ZYVX 4XVRA 5FBLB 1XXHA 2A5DA 3SJAA 3VR4A 1OIVA 3AF1A 4N0EA 2CHGA 3IBGA 1J7KA 2ZRLA 1KY3A 1YU9A 4NYIQ 1TTTA 1QZMA 3O8BA 4TLEA 5FPYA 3E1SA 3REGA 4OHZA 1NY5A 1DVRA 1JEDA 4QBHA 4UKDA 1QHGA 2W2XA 4KFRA 3VNVA 1Q3TA 2WKQA 1XEWX 4JBWA 4BASA 4JLMA 4ABYA 1UKZA 721PA 3SYNA 4WAUA 3U3JA 2ZIAA 4PAQA 2CLDX 2K5UA 2PH1A 1GILA 2HCBA 2SHKA 2XNDD 2C98A 3GLHA 4LRTA 4Q03A 2A78A 4FN5A 5JLJA 1JEEA 1NLFA 2F6RA 3CZQA 5E7JA 1LV7A 2C9OA 1FX0B 4TLDA 5IRCD 2PJZA 4G5GA 4LPSA 1ZRHA 3KUDA 1GL6A 2ORIA 1E79D 1VCMA 3Q3JB 1NVVQ 1JXOA 1ZIOA 5DNYB 1Q57A 2ZVPX 2AFIE 4OHVA 2B7CA 2BIFA 1E2EA 1E9CA 4BRUA 4B3BA 3GPLA 3UPUA 3GQBA 5EP3A 1G7SA 3FYHA 4LK2A 4WOPA 3AVOA 1NBMD 1YR9A 5EP4A 1KO4A 5FUVA 3OEHA 4MRVA 3GEEA 2QORA 1FNMA 2UKDA 3GLHB 3ADCA 3AKYA 4OK6A 4GZMA 2ZI4A 3ND9A 3SEAA 3W8RA 5C4MA 2ZJYA 1DADA 2ZJZA 5JEDA 3C8UA 1ZNWA 2MMGA 2UZ3A 4YQFA 2J45A 3GJ5A 4QG7A 4XVUA 4PANA 3OEEA 2F3TA 5FTNA 1N6OA 3QVUA 3FHTA 4NONA 4ZPXA 2OHFA 2ZU0C 4IVPA 4A0RA 1SHKA 4G0NA 3A58B 3OIWA 1Q12A 2D62A 3LA6A 3DHWC 1D2NA 4HLDA 2GZDA 2XOKD 2VIIA 1XXHB 3DMDA 4M9XA 2V7QD 1W2GA 5KYKA 2ZRFA 4HDQB 2IYQA 1VCOA 3AVQA 3EPLA 1HQCA 1ZCBA 1BIFA 4XJXA 2RGXA 2PMKA 2G77B 2V6IA 2IBMA 1U8AA 2V9PA 2WPDD 1NVUQ 2ASEA 2GJAA 3LBIA 3UANA 5JHGB 1XD2B 3PUZA 1DELA 4PC7A 5HKKA 1X86B 2QPAA 4LDJA 4U00A 4C3ZA 1JR3D 3HJNA 1Z5ZA 5EXXA 5FBQB 1P75A 1ZMXA 3S1AA 3WRYC 1AN0A 4UNQA 5KOYA 4TYQA 4M1TA 4QM6A 3WYFA 3C5HA 2BBSA 1G17A 1AKEA 2O0KA 2Q9BA 5AUOB 4F38A 3EZ9A 2XNSA 5CYPA 3L0SA 1LW7A 2PCJA 1U9IC 2QI9C 3CRW1 2CCKA 4QJ3A 3OEED 1OXUA 3AV0B 5J4HA 4DSOA 3THYA 4IOJA 1T4GA 3DPUA 1KI7A 3PV0A 5E7MA 3FFAA 2OESA 4NKRA 2ZXUA 3KX2A 1DAHA 2ZETA 5JEEA 1P2SA 4PX9A 5JJKA 1BYUA 4D0GA 4GBMA 1KSFX 4M0LA 4A4DA 5F2EA 5JZVA 2W00A 4R9UC 2F1HA 5KNDA 1OIWA 4A9AA 3KQKA 3IUYA 2NGRA 1UFQA 2XJ9A 3MHVC 2D2FA 1GSIA 2F55A 1XJCA 4LBWA 4GFDA 3HR7A 5LPNA 2A5YB 2XTZA 2ODBA 4RZ2A 5DI3B 2O8EB 3OFNA 4Q7MB 5JS7A 1E9AA 2OFXA 1RRPA 1KJZA 2ZU6A 2Q3HA 3FMOB 2CL0X 1KO7A 2C04A 4NMMA 4FCVA 1WA5A 2KB0A 2RH5A 4HZIA 3I62A 4KVGA 4LV6A 2JCSA 1XPUA 3MWLA 1F60A 2FN4A 1II9A 4XWAA 5CM8B 3F5FA 1ZUIA 2QZ4A 1N2CE 3QKUA 4RD2A 3WP1B 1Z0JA 1NF3A 5BXQC 1CRPA 1KI8A 1AS3A 2V1XA 5FR2A 3A1SA 4D80A 1N6LA 4AKEA 4WXRA 3CRQA 2W2TA 2J7KA 3PQCA 3Q72A 4GP6A 2QPTA 5CJ2A 5AJXA 2BBOA 1YE8A 4LYAA 5JJIA 1P72A 2J0UA 4D0LB 1SQ5A 1Z08A 3QPWA 3BGWA 3P26A 5HR5A 2HJGA 1U0HC 3RVBA 1KK2A 1FX0A 1KDTA 1JBKA 1VYUA 1TEXA 2PLRA 3CWZA 2IS6A 4QJ5A 1OXVA 4KYUA 1Z22A 4DB2A 4URWR 3RSLA 4EPVA 2G1JA 3B1VA 4URUR 1XX6A 1Z83A 4JL6A 1E2JA 3TR0A 1FTSA 3NVAA 1EX7A 1SHZA 3NKVA 1FNNA 5L3QB 1DG1G 1J90A 2ZS7A 4DUGA 2IX3A 3GMTA 2X2EA 4V0MA 1XMSA 1ONBA 4JLPA 4I1UA 2IT1A 4JVNA 2G83A 1FFHA 1KK3A 4GOXA 5FTLA 1G4AE 2QT0A 5EE3A 1ETUA 4UNNA 5FPSA 4ZDKA 3UG7A 4HB2A 1W36C 1G7TA 2C78A 3AVVA 1SVKA 3W6OA 2HLDD 3WHKA 1KO8A 4JT2A 2CL7X 4Q9KA 1FZQA 3I8XA 1IXZA 1ZYUA 4OQXA 1X8JA 1P3JA 1SVLA 1NJGA 1W47A 2DWOA 5AUPB 1HTWA 4TN1A 1LVGA 3SS8A 4C0AC 4KO8A 4M1WA 1T3SA 1SXJE 1VDZA 2FGJA 3EARA 3J81k 5FFMA 3B85A 3K9GA 3KJHA 3CNNA 5LB4A 1LY1A 3ASZA 1WP9A 2GF9A 2WWXA 3AEZA 3P27A 3Q85A 3T06B 3U3MA 5AUNB 4NBSA 2ODEA 4WW0A 1KMHB 3BS4A 3CX6A 1N6IA 2QBYB 4LJ4A 2O8BB 3GLHE 4ON9A 3KL4A 3WYGA 4W7SA 4A2QA 2O8FA 3C15C 1TPZA 2WMNB 3LLUA 3PR1A 2KRKA 3SYLA 4MGKR 4MGIR 3W3ZB 5D3MA 3A4NA 5BYKA 4IXMA 2QNRA 4R71A 4LC1A 3ZZTA 2ZJ2A 3D8BA 1W4CA 1COWD 4L9SA 4OI1A 2W6IA 2WAXA 4LRWA 2V6ZM 3EZ2A 4TZ6A 4ZIRB 2C9CA 3EA5A 4GMDA 3TVTA 3AUXA 4X8MA 3BFVA 2GZHA 4O0MA 3W3AA 1B0UA 3SDZA 4XTRA 5FH9A 1CJKC 1G19A 2KE5A 5CIQA 2V54A 1NNEA 3QG1A 5SZIA 2OILA 1G291 4OJKA 2OFOA 3UG6A 4EPTA 5C4GB 5EP2A 4DRZA 1DAMA 2GZAA 3NC0C 1K5GA 4M2LA 1WE2A 1JQJC 3PUVA 4TSFA 3SQXA 1CS4C 3WP0A 3U7EB 4TSFD 5HZHA 1OB2A 2YC4C 1M7GA 4Q7LA 2ZJBA 1NN0A 3N2IA 1YQTA 2VPPA 4Q4JB 1G8PA 1KI6A 1G4UR 3TR5A 2DVWB 4TWZA 1TF7A 5CK5A 2WOOA 1W49A 2IXGA 1Q1EA 4QOSA 4C7OB 3EZ7A 2A9KA 4PAMA 2R2AA 5DE3A 1X3SA 5JWRA 3ZGXA 2HXYA 5CDFA 4XSHA 3Q5EA 2GCOB 2JJ1D 3SU8A 3HP1A 4C0BA 2HV8A 1H8EA 5JJLA 2I3BA 3NTUA 3EZ6A 5FI1B 2ZRBA 1DEKA 1E4VA 3R20A 3RNLA 3TVDA 4DCNA 2GJSA 2PX3A 4JVLA 1HE8B 4MKGA 1OXTA 3PENA 4HUQB 3ZS8A 4MDFA 4B71A 3A36A 1Z0DA 4D81A 2GCPA 2H8KA 4AWXA 4QNMA 4URXR 2AD1A 2ZRMA 1YZTA 3LV8A 4B75A 2O8FB 5E4FA 3U4QA 1FOEB 1MO3A 1NSFA 3RS7A 2O8BA 4A0HA 1HURA 3TJZA 1D9ZA 2ATVA 2EFCB 2JLUA 1X1SA 3QF4A 2GXAA 1N5KA 1XXHE 3NBFA 5LDDC 1KDPA 1G16A 4MGZR 2V8OA 1MRNA 1NLYA 1JNYA 2OUKA 4X8HA 3NDBB 2XTNA 1KI4A 3L8YA 2PZGA 3QVVA 4PXAA 4EAQA 3CPEA 3I32A 4Y0AA 1NN3A 1GUAA 4CVNA 3LAWA 1OYWA 4TYNA 2JASA 3LD9A 5K8TA 3SBEA 1XEXB 3K09C 2FNAA 1OYYA 2NO6A 1GNPA 3BH0A 2QAGC 4EQ6A 1A82A 2C03A 3CB4A 4AYWA 2ZJAA 2FV8A 1Q22A 2NZJA 3MD0A 4Q4HB 3CX7A 2J0QA 1ZBDA 3OIYA 3MGCA 4H9GA 3W5IA 3X1YA 4PSKA 3FHOA 1G64A 4TMTA 3U3RA 2F1RA 2ZI5A 5J5CA 3U6BA 1XCGB 3MAAC 2VP6A 5FPHA 4C0LA 1NJFA 1W4RA 2VP9A 2XB2A 3L43A 2JLQA 4CEJA 4QGHA 4O25A 1XRJA 2RGNA 4IDHA 1NY6A 3VFDA 2IYZA 2B21A 3AB3A 5F98A 2IYYA 3CBQA 2RKOA 2GJ8A 1KO1A 1EFUA 121PA 4ILEA 4L5BA 5J4YA 3RLFA 3WY9A 1CBUA 4RY2A 4DLXA 1L7VC 1N0UA 5K8LA 3THWB 1E9EA 2CNWA 4ITRC 2EYUA 4B3GA 4B33A 2R8RA 1XF9A 3HYTA 2FGKA 4OJQA 4QGGA 5LD2C 3AKEA 1QBKC 3Q7QA 4B6FA 3JZAA 3K0CC 1P73A 2ZE8A 4OL0A 4JJZA 2ZI6A 2BMFA 4BFWA 2BKEA 3HU1A 5HE9A 1U8YA 2OXRA 3B82A 4HAXA 1N3BA 1TU4A 4TMWA 1AS2A 3GJ3A 1NG9A 1JI0A 1ELOA 1N0WA 2OG2A 2R6FA 1S1MA 1M7BA 2Z43A 4AURA 1H65A 1FQKA 2ZYUX 2FOLA 1FP6A 1XWIA 2FF7A 4MYCA 4V0LA 3P1JA 3FFBA 4AYXA 2VHUA 1DS6A 1SXJC 1JPJA 2XSZA 4JVSB 4A36A 3KFXA 3VU9A 5JHHB 3K0EA 3QXJA 1Y3AA 4E22A 1YHNA 4MYUA 4IJMA 1N0VC 4WXPA 2HUPA 4OBEA 2GK6A 4WZAE 1E1RD 1KDRA 3WRXC 4I4LA 1ZINA 3TLXA 3ZVRA 3ZH9B 2WJVA 4DSUA 4M1SA 3T34A 4ARZB 1AM4D 1WQ1R 1P7CA 1GVNB 2QE7A 4GMXA 521PA 4BGDA 4D4KA 1T6NA 3CF2A 2UZIR 3E2IA 4PO9A 3W5JA 2ZR7A 1JPNA 3HYRA 4D4JA 1RVDA 3EXAA 1NBME 2RB4A 4NYJR 3OZXA 4QHTA 1F2TB 5J47A 2Q3FA 3HDTA 1YR7A 3OIVA 1FTNA 4I81A 1MABB 4XD7D 1OHHA 4TZ0A 3KQHA 1KK1A 1ZAKA 3B13B 1IY1A 2D7CA 5GJWC 4B3DA 4TQAA 1QHNA 2FFHA 2ZRIA 2O0JA 1GKUB 2WJGA 5DHAA 1M7HA 1XCPA 2E9SA 3QOFA 4PC2A 4BUJA 5HZKA 5H8WA 1VECA 3KDSE 3BC1A 3MMPA 1PZNA 1UF9A 4B3FX 2BVNA 4TL7A 5G53C 4KSCA 3RANA 2DWZB 1G5TA 5CIWA 3GLIE 3RAPR 2X8AA 3K0AB 1ANKA 3FDIA 4C9BA 1HA3A 1A7JA 4P3YA 3VKHA 4RJLA 4Q1CA 1KSJA 3E5HA 3S1AB 1G3RA 1U0JA 1UKYA 1HH4A 3QY0A 4G5OA 3NBZC 1SKYB 4L8GA 2WBLC 2BOVA 1RIFA 2ZYTX 4POAA 3AJIB 1G5RA 4DBLC 2V1UA 1N5JA 2GJKA 4UQOA 3NHBA 2FZLA 2AFHE 2XAUA 3IHLA 3TW4A 1Z6XA 5JRJA 1JR3E 3CM0A 1Z3IX 3W6NA 4MRRA 4H1UA 2IUTA 1T8TA 4HSEA 1U98A 3DDCA 4LC0A 4ZV4A 3JZMA 4MGYR 1SVWA 4X8OA 1IQPA 3GJXC 4DKXA 3R9WA 3BFXA 4F4JA 4LV8B 2FFQA 1Y63A 4JZKA 1OB5A 5L8VA 4II7A 2X77A 1TQ6A 3H86A 3U3KA 1E0JA 3EPJA 2W0SA 4DCTA 3UMRA 4I1SA 1RRGA 3SN6A 2NZ8A 3IGFA 1E6CA 1N6HA 1IN8A 4KBGA 4QM7A 3SQWA 1ZM9A 2ORWA 1VYTA 3QJYA 4ZI2A 3PIRA 5CLQA 3DM9B 1I2DA 4US0R 2JDIA 3WNBA 1ODFA 2G6BA 3OAAD 2XITA 1IBRA 1SKYE 4JSYA 4KAXA 4EPRA 2YWGA 5HE8A 4FINA 1ZNXA 4HAZA 4QRHA 3LXXA 1R6BX
chains in the Genus database with same CATH superfamily
3BD8A 4LXQA 1TEHA 5F76A 3IMKA 3FOZA 5A1TA 4EF5A 3M4NA 1J8YF 3KXDA 4FR0A 4G8BA 2DZDA 2FEMA 4XAQA 1IH8A 1QVAA 3QW2A 1Q6YA 1OCEA 3NYRA 1ISMA 4FP9A 4XE5A 3M3DA 3ZE9A 5CXXA 5A4FS 2O01F 3BXHA 3JV7A 2CCJA 3EXFA 1VE3A 3HBAA 2CJYA 3ITKA 1KAEA 3EUWA 1J1ZA 3GQBB 4L2IB 2XVZA 5KNDH 3KQVA 1CTQA 4YRFA 2JFGA 2IL1A 3P5BA 5JCZA 2JI7A 2B2XA 2EC5A 4MDYA 4MWGA 4IIUA 4WNIA 1XZHA 5EY5B 2FSIA 1VE5A 3TRJA 1IFXA 3R4VA 3LQQA 1F0KA 2YFKA 1S2LA 2R18A 5L3SA 2B8WA 1C8BA 2VHQA 4IQ8A 4DYDA 5IFLA 5JH7A 3TGLA 1QYXA 3P97A 4LTMA 2W37A 5GM1A 2QRMA 1IOVA 4C4ZA 3PEWA 1U0GA 5FUXA 4MS1B 1PS0A 4C1NA 4MV7A 5FPQA 4ER6A 3RGPA 3E1KA 5TQ0B 3BD9A 3FTQA 2Q7DA 4CKYA 3THXB 2ZBUA 1XNJA 1N2GA 2R3SA 5TGDA 3WRVA 4NCAA 1WVMA 2IUSA 1T2UA 5F5XA 1T8YA 2Q46A 4KHPM 1XAHA 1X6VA 3RS8A 2G8NA 3ETJA 1ADFA 1Z0FA 1YOVA 5KQ8A 2E3JA 4GOJA 4QASA 2DWCA 3NWOA 2QUKA 4TROA 5DSTA 3B1KA 1R0KA 2X1LA 5HEKA 1GYPA 1MVNA 3T3GA 1TAQA 4DA7A 4EABA 3EUFA 5JFGA 2VPQA 3K9NA 5FWYB 2ZUVA 4IIEA 1Z6AA 1K4YA 4U6QA 1OAKA 1U3FA 3A8TA 2FPUA 2QOEA 1U3TA 1EVIA 2PMDA 3ROZA 2QG9A 1NXPA 1UXOA 2ADFA 1DARA 2FMIA 1XCMA 2JGJA 2IVZA 2QAGB 2Q41A 3VQTA 1V16A 3B51X 3GQ5A 2Q4BA 3PCRB 4O4JA 1U7UA 3FGPA 4P82A 2IOHA 1N5LA 3UWDA 3SNHA 4EZEA 1E2BA 3R6WA 2IF0A 4YO7A 3F2VA 2ZWMA 3GVIA 4LYYA 2P27A 1FLAA 3NHAA 4M8NE 4R01A 2EFEB 1HEUA 5DNCA 4QPZA 3P4XA 4CGZA 5A4AA 4Q6WA 2A5JA 1DCTA 1E3IA 3R6LA 4PVDA 4XBOA 1EYZA 3D31A 3HSSA 4ZVUA 2D0IA 2YWEA 3AILA 4FEYA 2X5JO 4HH3C 4BFSA 3GMIA 3CEJA 4WN9A 3F6SA 1R27A 2MTBA 2XBLA 4MRSA 1Z4KA 1Y8QA 4WIAA 4E2ZA 3CEPB 4BNXA 4JU8A 4HNUA 2QQEA 3UTCA 4MGHA 3ZCXA 3LZ6A 5C8ZA 4PONA 4P9NA 1NP7A 2PRKA 3EMKA 5KSOA 3JSAA 1OV4A 3N6XA 4IOLA 1L7OA 2C2MA 4RENA 1LBTA 4B73A 3RNOA 5JYEA 2Y21A 5DIFA 2WSEF 3DDSA 3LL4A 1QC5A 4L8YA 5FUYA 3WZMA 2PGXA 2R48A 3GEGA 2YXNA 2B4QA 5KX5F 1FDSA 1Z13A 1XHFA 1H1TA 3SXUB 2GRUA 5TT1A 5AW0A 1E0SA 1JF8A 1MXHA 2YQ5A 3HY6A 4LXTA 4OGWA 1XL1A 1D4OA 4XUDA 1TT5B 2IZ7A 2E4XA 1E69A 3NAQA 3K6RA 3WLAA 1WU8A 4HQOA 4BTEA 4D97A 4EHLA 5B30A 1FJXA 1O87A 1E1QD 1RHRA 1C3OB 2IHKA 4IH1A 3U6MA 3B5JA 5IC4A 5J58A 2AF3C 2HRQA 3MTGA 1R00A 1JQAA 2TSYB 3ISJA 1ZGHA 2V74B 1G2QA 4J0CA 3TXYA 3K70C 1N36M 1K8ZB 1U0RA 3JTEA 5KNCH 1UBJS 3MF4A 3R0IA 3DHYA 5HJEA 4FFOA 3HFSA 1PK8A 1SXJD 5HGJA 1JEQB 5FQOA 4AYTA 1DV2A 1T1SA 1XMVA 1WSDA 2R8BA 1OQYA 1PR0A 3GGPA 1ZVJA 3GCZA 4RA9B 1RFLA 3DMGA 3H5WA 4NVRA 4LY9A 4C1BA 1GJSA 5H83A 1QK5A 3Q5DA 4EFNA 4EQZA 3ZLVA 1RZRD 2QK4A 3QEMB 2MROB 3QSGA 3VDPA 3IPCA 1PYOA 4H0FA 1EFRD 1MFZA 1RP7A 3GRRA 2Y1XA 1B76A 2ZAMA 1SCUA 1EX6A 1ZM2A 4PGFA 2J0UB 4J1SA 3VZRA 1E1MA 1MTOA 1CDEA 2CNNA 1D07A 2EJWA 3JATA 5LQCA 1RJ9B 1C1KA 2EHDA 2HCFA 1CHNA 2KYRA 1DOAA 1AQLA 2GZMA 1GU7A 4LECA 3N0VA 4KQ1A 3BUSA 4C07A 1H3NA 5K0JA 5A3SA 3NB0A 1L2DA 1BMFD 3GCDA 2H57A 3TTUA 2P0YA 2IXFA 2V5AA 4WWHA 1GKIA 3IXQA 3ISTA 2FA9A 3DFMA 1MV8A 1LFAA 3LXUX 2CDBA 4WGGA 3A31A 3U3DA 4AZFA 3CTPA 4RK0A 1T3ZA 1M9NA 1ZU4A 2BDUA 2XGMA 4WK0B 2A1TR 4YTEA 2PSHA 1E4EA 3V34A 1Z37A 3CH4B 4PCVA 3WS7A 1OSNA 1JVSA 4JGIA 3L7AA 3ZJTA 4TS1A 1YZUA 1PFKA 5D3ZA 4KXVA 3L7IA 2A4KA 3KR1A 1Z56C 2J3QA 2VH5R 4F5WA 1EXMA 2JHAA 4A6EA 1C8KA 1YIOA 1J39A 1QZZA 1OYOA 2VHVA 2JI6A 4J16A 3UB2A 5HX7A 4MVJH 4ZTBA 4C04A 3E84A 2GFQA 1UC8A 1IZ8A 4MW6A 4TV9B 1SBYA 1VZ3A 2G3YA 4FN4A 3RC3A 1Q20A 1PJBA 2WTUA 4BPBA 3KOZE 4G86A 4C4PA 2PV0A 2QW1A 5I7EA 3KUXA 2RHCA 4QJBA 3QI7A 1ISSA 1W48A 2NU9A 3ZEAA 3U7FB 2OSVA 1N2SA 3QXHA 3NXKA 2HBRA 3X3HA 3HKPA 1Z6YA 2WJZB 3HVIA 2F48A 1E6LA 1I3OA 1USKA 3MTBA 1WCYA 4YJKA 4R81A 4EB6A 2D5AA 4LRSA 1CR4A 1Q0RA 2ZUUA 4O1IA 3I52A 4HWTA 4WBNA 2BGUA 3UW3A 3OPMA 1AUQA 2Q1YA 4A8TA 2XCOA 1Z5NA 4KE8A 3IVMA 4ZU3A 4TXJA 3PX7A 5EJ8A 1B0AA 2W6JD 2LRHA 2ORVA 4FE3A 3AUKA 3JALB 3D5TA 5JISA 5AFSA 2FR0A 1QMGA 2H4FA 2VYNA 2WSMA 3O2JA 4IP0A 4L7QA 4FBGA 4E4YA 3J81A 2GGSA 2PRJA 2WD8A 3R5JA 4FYWA 5A3RA 1JIKA 2H2AA 4I4NA 2PQ6A 1TW2A 4CIYA 1EK5A 3HCAA 1TRKA 4HMQA 3U44A 4LMBA 4HAWA 4P1ZA 3NDRA 4M54A 2IUEA 4U8HA 2DQZA 3ME5A 4RFLA 2MCFA 4GP9A 1O9GA 2KS6A 3D6JA 4OMFG 3RHZA 3PC4A 4DLAA 3MS7A 3OM9A 5IBCA 1M74A 3MCAA 5EI5A 3KL2A 2GPSA 2RONA 4INZA 4QWMA 1X7WA 3KOMA 2BPOA 3A1UA 3OM1A 4P36A 5F78A 5EJ5A 1S9HA 4S12A 4I4TA 3UBTA 3RS5A 3WGGA 2BELA 4R1MA 1SELA 1Z5AA 4TQGA 2HFJA 1BYIA 4N7JA 3HO1A 1L1QA 2MYUA 4N3CA 2PYDA 3HL4A 3MFYA 3BXOA 3QK7A 2J4CA 2B2CA 4JBLA 4ENUA 2VJAA 3MM4A 4FHDA 5B7QA 1XR3A 3DUFA 1XTRA 1PRBA 4W6QA 3EZFA 3OZGA 2W2LD 1GIAA 3OX2A 5C31A 1D0SA 3RC1A 3VU1A 4PG8A 4Y6RA 5BSFA 1DWOA 1X8LA 1HDIA 4HNAA 2APLA 1P91A 2VSXA 2AG1A 3TQCA 4NZYA 1C7RA 3AHCA 3T15A 1LA2A 2VJPA 4GWLA 4NBVA 3AM3A 5B6PA 2VP3A 5LD2C 1B8UA 4HEA6 4UJ5A 2YQ4A 3ZWXA 4NJEB 3AR7A 4K7JA 3AKDA 2C96A 5JBQA 5FWXA 3JQEA 1F0YA 4P83A 3S29A 5CW1A 5L3QA 1QIFA 2IZ1A 4KNWA 1YJXA 3DVQX 2XDQB 1CDOA 3HPRA 4GKBA 1C4KA 1PFYA 3IOCA 2DKFA 3N8IA 4Z4CA 3RRNA 3IB6A 3R5XA 2QV7A 4AF6A 1FIUA 2ACEA 3IG8A 3H1PA 4BMPB 4IBGA 3RK4A 2WP0A 3OE4A 1W4BA 4EVQA 3RT7A 4KFSA 1OAIA 4M21A 3FD9A 4M9QA 5LUAA 1THTA 3RSCA 1G20E 3N70A 4K9DA 3TGWA 3L6EA 5ALIA 2JFNA 3MELA 3EGVA 3VZQA 3RUDA 4D9NA 3I64A 3NCHA 4UTNA 2H0RA 2NX2A 3DZDA 2WLTA 2XR1A 2QTMA 1A88A 4UQLA 2R7MA 2V7WA 3U1BA 2WU1A 4JI7B 2AE1A 2G17A 4E30A 6LDHA 3JVVA 3BWBA 3NIWA 5LOVA 1GM5A 4W5TA 5IAKA 5DN6A 4BWGA 5F7XA 3PHBE 4EJSB 1FMFA 2X0EA 1ADBA 1N2XA 2PUTA 2ZRJA 3NVDA 4EW6A 2PSDA 5L45A 1H2RS 4IHKA 3F4LA 2PEZA 2VJYA 3D6FA 3D43A 3T7IA 4LHZA 3WNQA 1T35A 2P4QA 5EXTA 3GLIA 2DWPA 3V33A 2MYPA 3WISA 3WIVA 5FOWA 1XJ0A 1YR1A 2YUIA 3LYUA 1UJ2A 4IILA 5SY4A 4B45A 2EWVA 4MW7A 3RGWS 2UUCB 1UPUA 5JBNA 4QUDA 4A0QA 3ADPA 3KPWA 1B73A 5ERGB 2ZBGA 2ZIUB 2A9PA 2W4IA 1T5DX 4R1UA 5IH7A 1J9GA 1S0UA 1YKGA 2JCYA 1EG7A 3SX2A 4BEJA 2FKNA 3B6JA 1AGXA 2B1IA 2XTMA 4MV5A 1E2NA 1ODLA 2Q5EA 3NT5A 2QY9A 4RNCA 2NNWB 1THMA 3DAPA 4KODA 1Q16A 1FRFS 3GD5A 3ZLUA 3WDMA 4UPEA 3VR5H 5FR1A 3W2EA 3FVWA 1UZNA 2WWWA 1TDHA 3PGLA 1Z75A 1FB5A 4NY1A 3PFNA 4KVAA 1EUZA 2H7YA 3SVLA 4JI2B 1JLLB 2CK3D 3T99A 5LQSA 4PC3A 1E2FA 2OLKA 2F8SA 2JAPA 3BZBA 4DR2M 3PVCA 4C3UA 4OHPA 1GGVA 2QA5A 1VOTA 3P9CA 3IBFA 3AIKA 5JXIA 1NXXA 3CN7A 1GA1A 4OUKX 1F14A 4AMBA 2GWRA 5C3MA 2AHRA 2FPOA 3O2NA 3IIJA 3G1WA 4PLTA 4BV3A 3AXTA 2WJYA 9LDTA 3Q40A 2WTEA 2X5NA 1YU6A 4QDOA 3K9BA 3HJHA 3WO0A 2R0QC 1HY3A 2HA6A 1FEZA 4OHRA 5A4KA 1GV0A 1IIRA 3RI3A 3DFKA 4LXXA 3ASYA 5A9TA 3EXHC 4E12A 2J41A 1EFDN 4KGZA 1AF7A 4FMCF 4M8IA 2CDRA 2C7QA 3TX6A 1XMOB 4BBAA 1P4SA 1T6YA 2O06A 4MQUA 6ABPA 3E70C 4IWXA 2X3YA 3KM0A 2XE6A 1NMEA 1CCWA 1X42A 3DZFA 2HGSA 1DQZA 2WD7A 3L7KA 4TKMA 5DNAA 5IT9S 3GPPA 1AS0A 1Z0ZA 3A1CA 3JTMA 1JHAA 4H0NA 5FI0B 3SJCA 1L8XA 3KZNA 2C8VA 3FYUA 3IBSA 4HDSB 4DIBA 2ZRNA 2M60A 5HMMA 2V97A 3W1EA 1MG0A 1U1DA 4Z6KA 4JODA 3DAHA 2ZTHA 3K0AA 5LZ7A 4KXFB 2HDNB 1ARZA 1ONSA 3P8ZA 3DMFA 4US2R 3BK1A 2JGNA 1TKRA 1H94A 4XR9A 2QSUA 2RHRA 2VJOA 2JXNA 4MQFA 3SJBA 4OI0A 1ZOPA 1CJUC 1M72A 3V4SA 3V1MA 1ESCA 1UJCA 2C88A 4KI0A 3SQLA 1YQQA 2AMVA 3KHKA 1VPEA 1S3GA 4BMSA 3G6WA 1BEUB 1VCIA 3HKDB 3IAM1 4DR7M 4XCQA 4FQ8A 3C8HA 5JQWA 4GITA 1GA4A 2HGZA 1QGUA 2O2SA 4MH0E 4DGQA 1FW6A 5B1DA 2DB3A 5TLSA 1SC3A 4X97A 1WBDA 4HRVA 4ISCA 1JBEA 2Z3WA 5F1KA 5DHTA 3UGTA 2X22A 3VU8A 4Q7QA 2X4IA 4WKCA 2V45A 2EP8A 3WKAA 4B6GA 4DXDA 5HJ7A 1N8KA 4HNGA 3RRXA 1ZVQA 3HGQA 4YRKA 5CB4B 3B70A 1KI3A 4C22A 3AUAA 3ZKAA 2LR0A 2HR1A 4X1IA 2L7HA 1UBRS 3LTEA 2DPGA 3S68A 4FILA 4OSEA 4BMZA 4D1YA 1VKJA 1PL0A 3FRHA 1S8FA 2CVHA 5BQ5A 5TS3A 3B7GA 2OECA 4L4ZA 1YRWA 2ES4A 4XFJA 3S2GA 2I1VB 5MGNA 1VDMA 1G38A 3DOEA 2B4TO 4R1SA 3QWIA 3KTDA 5DCWA 2ZPTX 2ZQ5A 4ZALA 1QQAA 3EULA 1Y8CA 1V6SA 5JPDA 1J00A 2KZSA 3MB5A 1UWLA 1GDDA 3FKSA 1HFJA 3C3CA 5TQJA 2R8XA 2RHHA 4D4LA 2LDBA 3PDIB 4EJ2A 2ZPAA 1YIAA 5JROA 4Q4DA 3IQFA 3HYSA 2QX8A 4YRDA 4RFVA 3CV3A 2ZAYA 4HAOA 4C2TA 1MA0A 1OA1A 2N1BA 3OEHD 3GN1A 4JKIA 5EMJA 3G9XA 1XMIA 2DLDA 1PU2A 3GRAA 3QELA 2IOFA 4RF2A 1KJ8A 3JD1A 1C50A 3EN0A 3VTFA 2BHTA 1GU1A 2QL9A 4IJ6A 1VKRA 3MGGA 3OLQA 2NG1A 1G5FA 2I6UA 4BKQA 1YI0A 1ZH8A 1JAIA 1CXZA 3ONFA 1MH1A 3F4KA 5AW5A 2B9VA 2I54A 3AVYA 5DV9A 4ZO6A 4EFKA 1VE1A 3RYCB 1RYDA 3MLBA 1T8RA 5JCPA 1EDEA 1EZ1A 3C1OA 5F52A 2CDAA 1PV4A 1ORRA 4X3OA 5I7HA 2FZKA 4ZO9A 3VHRA 2GRAA 4KX3A 2R6CA 3DS8A 2W82A 3X1WA 1CDDA 3QQPA 1Z6QA 1S2MA 4MV8A 4WLEA 4RU1A 1JDSA 1LQ2A 2J3MA 1F3OA 2ZZKA 3FJOA 3M9XA 3NHMA 1X77A 4XYGA 2IEZA 3T3OA 3THWA 4ARSA 4HGOA 4Y1RA 1RJEA 1XP8A 1CY4A 3HBFA 4Q01A 3SXPA 4MUKA 1SXGA 3BEOA 4G5SA 2HYDA 4AMGA 1I94B 1U6JA 1ACJA 1P3Y1 2DCMA 5CB6A 2M2IA 5CB4A 5H9VA 3FMVA 1P17A 3ICOA 1ZK4A 1W1WA 3T1TA 3P32A 3VGJA 1PCXA 1W5TA 2HOQA 1VBNA 3MOIA 3U39A 4BQEA 2NTVA 5CFPA 2XKKA 3SQMA 4H7HA 5EESA 2A9QA 2XQFA 2C7RA 3R0VA 4JEMA 2G1PA 2J33A 1TDZA 1FFXB 1XI2A 3DTTA 4PRKA 2XECA 3R5TA 1CUXA 3V2GA 3NETA 2P5TB 2NO7A 4R2WA 4EHAA 5AHXA 5HTKA 1V47A 2C99A 1SB8A 2J5BA 1OIZA 2JDID 3EGEA 3GLRA 3ND8A 4ZMSA 1XEFA 2GWHA 3GFPA 4J9UE 5K0LA 3ROPA 3CH6A 2BD0A 3FX2A 1DEOA 3KZ1E 3QUSA 5CG2A 5I7FA 5FJIA 2XA9A 3FTNA 3UY4A 1G18A 4AJKA 5KNBH 3FBGA 4Q5IA 2HPVA 2RGCA 4Q9DA 5GWXA 4PNZA 5TT0A 4DLVA 1VG1A 5E1OA 1YA6A 3MN1A 3MWKA 2JUJA 5L4SA 3R41A 1BN6A 2WQ6A 3AX6A 2OZLB 4COKA 4L50A 3LVVA 2VLIA 3NEYA 5HM8A 2G40A 4Q34A 1PR3A 1W8DA 4LEIA 1LF5A 2G76A 3AFOA 3F8TA 4CEHB 4KO1S 1K68A 4WT7A 4EG5A 1E3TA 1RI2A 4ACAA 3ICPA 2YXDA 3W6UA 3OOSA 1EE2A 4QBFA 1A96A 4OYYA 1DAKA 4AO8A 4P4NA 1VMAA 1XZAA 3KAJA 1IBKM 3K9WA 5AI5A 5G0VA 4F46A 3JAMS 1K7FB 2FPGA 4X93A 3GOHA 3T54A 3W90A 1L1EA 4NDZA 1ZEJA 3I61A 2QSJA 2BAGA 5J9FA 4CIZA 2P9YA 3QV1A 5F51A 3S2UA 3L07A 1XOIA 4D82A 4CG3A 3KKLA 1WIWA 1T1GA 1ETHA 3C41J 3W2TA 3ENQA 5I8PA 3MJFA 1FS4A 4CFYA 4NU6A 5AW4A 4RVSA 4WFKA 1TFRA 1GA6A 2FQ1A 3WQBA 1DQRA 4BP1A 2WMOB 4ER7A 4BNTA 4F2LA 1E9SA 1EPUA 3K1ZA 3NUQA 1NVXQ 4HLQB 5CNIA 3ZK9A 2YICA 4EJSC 4Z3KA 4NRDA 1RMYA 3NYIA 3LQYA 4FUQA 3A1WA 4TLLB 1UR5A 3IBTA 1QRAA 2F8LA 4NBKA 4LDRA 4EB6B 1VEKA 2PA3A 2DERA 4LA4A 4E5YA 3OI7A 2KNVA 1BQEA 3OSUA 4FNAA 4IZ6A 4U5XA 4Y9UA 5A6SB 4R5MA 4WNAA 1RABA 4G4OA 3MUEA 1NP3A 4FEEA 3V46A 5AW3A 1EP2B 1KSHA 1OIPA 3GLGA 1O96A 2I7TA 2J31A 3N8KA 3LH5A 4YCLA 2MU1A 4G5RA 4ZCPA 3S6JA 3VAAA 3AM5A 4J90A 4YP9A 5BRAA 3NDJA 4ML3A 2BI4A 4RSGA 2P3OA 2PNJA 5FOQA 1CS0A 3EF3A 3ADDA 2GBPA 3GZ4A 1SKMA 2DG2A 2QN8A 1QO9A 3EIUA 2AEJA 5KDOA 2OFPA 3CJTA 3HG7A 1T36B 4O4IA 1E2HA 1HT1E 2OA0A 4BNHA 2BEUA 3WZLA 3E7PA 2CYBA 2H1OA 2BE7A 5KVAA 2ORYA 3OF2A 1YLAA 5LWHA 2I3AA 4N0PA 2OQRA 2WICA 1CUAA 1EGMB 1GADO 1J4AA 2H0AA 2XXJA 4L8LA 4FONA 4HDCA 4QQNA 3UOGA 3BAZA 3VPHA 1NBHA 1M2OA 4NATA 5B3LA 3EW9A 3H9GA 2ICAA 1VG9B 2W48A 4ALJA 1OXMA 1NHWA 3K70B 1JLRA 2GPBA 4GX1A 2BI7A 1PQUA 4NESA 2I4LA 4KMSA 1RBQA 3GGSA 3PRKE 4UBMA 4PM4A 1UEXC 4AKIA 1C9JA 2DAEA 3L7LA 4GX0A 4JP2A 4O59O 4TM7A 1NQUA 1EE9A 1T34A 2IODA 4DV2M 1M1ZA 1Z5UA 3I2GA 4ZVQA 4FNMA 5D6NA 1EK0A 1CQXA 3IB3A 5F7OA 4Y0NA 4BFYA 2ZSFA 3FR8A 4X92A 1PGJA 5F2NA 1OX6A 2Q29A 3Q6MA 3E9CA 4YWHA 4A8JB 1SVUA 2H1SA 1ENOA 2BTQA 3KBOA 4L27A 1GWNA 4WBSA 4HB4A 4M22A 4EHFA 2EAUA 2JFQA 1IZ0A 2VOEA 3CRNA 3MZ0A 4QDTA 3LDFA 3FNFA 1QIKA 1RMTA 1ECCA 1XNRM 3AZOA 3ROFA 1NPDA 1IY9A 2P3LA 4IH4A 4P0QB 3QYFA 1RXSA 2MJ5B 4MAAA 2C4MA 3IECA 5BSRA 2GA9A 4ZDWA 3R7FA 1PL7A 3AGQA 4DUYM 1XRNA 4L8FA 1MXFA 4YT2A 4DDMA 2JD0A 2GTHA 1YCHA 4YRJA 2XDYA 3KJFA 2B1RA 5KTPA 5IULC 1SVSA 4D96A 2OE2A 5CITA 1V34A 1FNDA 2RK6A 3O8CA 1XZLA 1E3EA 3ONNA 3AP1A 1YJQA 2P9CA 3E48A 2ZQZA 4UVGA 1ZMUA 2W7TA 3BORA 3HADA 1BXGA 1I0IA 2MHCA 3FDXA 3NT4A 3ONEA 4GI5A 1K5DA 3WMFA 1Q0UA 2JHFA 4J16C 3B6IA 3VI3B 1TPYA 3OZUA 4DJDC 4MGYE 4QOGA 1ZD3A 3MTQA 3V80A 7YASA 4K05A 3IIMA 2VP0A 4R68A 1TMKA 5DSZA 5FSWA 5TX7A 4E5KA 4ND7A 3CF0A 4XM2A 1QGED 3EBPA 4JU9A 1NR7A 3BL5A 4Q3KA 5EXEA 2BHSA 2Z4TA 1H42A 1UKBA 3F9RA 3H97A 2EJTA 2WZCA 3MQFA 1E6MA 4JV5B 3QLVA 5MGBA 2OV2A 3PD1A 4O4HB 4RXMA 3UV6A 3WYEA 4H7DA 1R0YA 1YS4A 1NP6A 2WE8A 3ZC3A 1L5MA 2PD4A 1XRLA 1KDYA 2UU9B 2D1YA 3L01A 4A8JA 3SWWA 1XJQA 1IHDA 2EP5A 3WADA 1LTHR 2QG6A 1P31A 2QE7D 3AR8A 3PTAA 3OP4A 3L27A 3P2EA 3GFBA 1Q7GA 4LXYA 2A14A 4G09A 2GF2A 1JAXA 1WXGA 4LYHA 4XIGS 2ZM6M 1F2UA 1LB1B 3LC1O 4G3XA 2O3RA 1NXTA 2XMBA 2YBDA 1NC3A 2PGJA 5AJTA 4NFHA 3ACCA 3D4LA 3U37A 1ATIA 5EOVA 1GTSA 3HXPA 3KVVA 1NRIA 1T43A 4H77A 2PK3A 4QSMA 1K7CA 3WB1A 3U81A 3HCOA 2D2VA 1COZA 4OM7A 3HVUA 1XLUA 3G8AA 3P2KA 1NI5A 3TMYA 1YB1A 4NZMA 3HU2A 1VPLA 2P6PA 1HOTA 1TM7E 2JRLA 4PBRA 2V1CA 3SHFA 3E1GA 4Q48A 3PWTA 4WCDA 1QE3A 3GEMA 3VHXA 3WV4A 3TJRA 5F21A 1TCUA 2GOYA 2D4AA 3DWFA 2IOYA 2PT6A 4LYFA 3T38A 1BJKA 2D3WA 2JLSA 3DO8A 5HZKA 1HG0A 2LD4A 3UKJA 4CISA 1O0SA 3SZRA 1BGWA 2JFOA 3UAOA 5L3SB 4O4IB 2NXWA 2WF6A 4EG6A 1Y9JA 4QGFA 1GCOA 1GQQA 4DM4A 3U56A 2P30A 1CLUA 3JVUA 5C7OO 3RJ5A 4WEOA 2R0IA 2Y0CA 2Y0PA 4DPMA 2JATA 4P34A 5BUCA 1NQTA 4TRNA 3AVXA 1YT5A 1TJ5A 2RJOA 3CKLA 1OFIA 4DLUA 5HS4A 1N3LA 4XGIA 3UPTA 1SQFA 3SEFA 5FUQA 4B8ZA 3GF4A 1O96B 4UEOA 2WWGA 4QVIA 1ORIA 3TS1A 2VNSA 3SPXA 1T4CA 5E2AA 4CF4A 5BSVA 1YBVA 3O0DA 1F6DA 4E3WA 3DR3A 4X6UA 4EUNA 5IT0A 2ECQA 2R85A 1O58A 2DLNA 5TARA 2G9UA 3MG9A 3OU7A 3KLBA 2HNKA 1SG0A 3A06A 2X13A 4Q66C 3KFVA 4P32A 2RHOA 3AHIA 4DZTA 5EHZA 2UUAM 2FUEA 3D2BA 3HU3A 3JATB 3VLFB 3V8NA 2HWKA 4N3BA 2O48X 1QVWA 1Q0ZA 4BNDB 2YV4A 2H1HA 5IXSA 2LVBA 3OU6A 4X84A 3LCVB 1P62B 1VMEA 3GT7A 2ZWVA 1R50A 3L06A 1T2EA 3RUAA 1ST3A 1QLJA 2TMYA 1PDVA 4H60A 3R7DA 1CU1A 1UDRA 2R62A 4KXNA 5TF0A 1JILA 3UJCA 5E6SB 5C8VA 2VCHA 4TWJA 3AIIA 1MW8X 2GK7A 4EPWA 1UXIA 1EINA 3R3WA 5CD1A 1V1MA 1PQWA 2VZ9A 1Z0KA 3GA0A 1RP1A 4FYPA 2NACA 4V0RA 5EZSA 3HP4A 3TZHA 1I6KA 3DF9A 1DQPA 1E2KA 3PWKA 5CX4A 3K7EA 1G21E 1CD5A 4ID9A 3I6IA 2BHRA 3OUUA 3CZCA 3OY7A 3QLUA 4OI4A 1P5HA 4PPFA 1LDGA 1COWA 1P2VA 4Q21A 1DXHA 1FUUA 1TEVA 3BWYA 3I72A 2YHUA 3MJEA 4DUZM 3PEVA 4RMIA 5JSKA 1RRFA 3ZY2A 2F55A 5K51A 3M0EA 2VRBA 1CR2A 3PZBA 2PO5A 3W8NA 5A4JA 1MAAA 2H7VA 3WLSA 1SD5A 2XQVA 3TLMA 5U1PA 4BZXA 1A9YA 1A04A 4OU4A 2ENUA 3GHHA 1KXZA 1CRLA 2ECKA 1XD2A 5AK0A 2IE8A 1B4DA 4HLNA 1LEHA 2J4DA 4DR5B 3LQRA 1NVFA 1QQ7A 2W9XA 2HRRA 1B8NA 4LUCA 4EHHA 1WWKA 5CVUA 4CMEC 1B8VA 1U8CB 3UJPA 2F90A 2B1GA 2JGIA 1KY2A 3PU6A 4IVQA 4DSAA 5LD2B 5B4TA 3FHCB 5FAKA 1RTTA 3GQ4A 2B2NA 3KELA 1T26A 1JLSA 4DT1A 3IULA 4M8SA 3PUHA 4A73A 2GR9A 3OZTA 1NQAO 1GNVA 4B3RM 1W46A 3IODA 4K9OA 4NJMA 3ZX5A 1K6EA 2WJIA 2ZR9A 3GJQA 1GRVA 2ACKA 3NDPA 5REQB 4D4IA 1X7DA 4X1YB 2GHIA 3GPBA 1SEPA 2QAGA 1UPXA 2I6FA 4HX9A 1ZY2A 4RH1A 4Y6LA 1YR2A 2AL7A 1GTJ1 1UXHA 4HWPA 5MDHA 1DNPA 2QENA 1ULUA 4DV1M 4LJLA 3SZLA 2W2NA 3L5KA 5JC8A 1ZD2P 5JANA 5DULA 1W2HA 5EA2A 4LV5B 2I65A 2IZ0A 4M76B 1NL3A 1Y9DA 4QU5A 1VLLA 5KO2A 2OM6A 4H17A 4N0MA 4URZR 3QXXA 1ID1A 2H08A 1RLUA 1VJCA 1ZKMA 2JEYA 2PR7A 3EDOA 1ZC3A 3TQTA 2FFAA 4IHJF 3VV2A 4AIIA 4D9FA 1EFAA 2YHBA 1HZZC 3EGXB 2I29A 3D6UA 4KITB 1FL9A 5HF8A 2G8LA 4PCAA 4OB8A 1KOGA 2QTVA 3VU9B 1Y6ZA 3N6RA 5KJCA 2C8KA 2BNKA 5CYGA 2LTAA 4L6V6 3THXA 1L8QA 1PJQA 2BBTA 2GMWA 2JLBA 3A0RB 3AI3A 3OMWA 3WGHA 4B35A 1PNVA 2PKQP 3BE5A 1GRRA 1N2ZA 2GARA 2Q5FA 1ZICA 4BLOA 5LXTF 3A3NA 1YFZA 1ZOOA 4U7DA 4MCIA 5IJWA 1VHLA 2FPLA 4PIMA 1AURA 2DCUA 1L9KA 1SQ6A 3EWNA 4I14A 3TINA 4E14A 5K0EA 4IFTA 3RW9A 4N1AA 1FDTA 2QTTA 2ZANA 3QOWA 4QUEA 3EPHA 1GNTA 4GMQA 2IYSA 3PHHA 3U60A 5JNLA 1QFSA 1U2ZA 1XAIA 5H1YA 4GMFA 1N5RA 2JHGA 1P1JA 2HSJA 2QD1A 2PLNA 3I2YX 3NTOA 4OHOA 4WLFA 2ZIFA 4B74A 4XK8F 1WXIA 3BQNB 1WZIA 1C4WA 5CVEA 3TW0A 1HT0A 3ELDA 2PR2A 3A37A 1LJLA 2YFQA 4DV4M 3GX1A 2H17A 3KB8A 3SZGA 4E4TA 3QUTA 3S81A 4JSTA 1DO2A 4B9AA 4JUAA 1PT7A 3GJ6A 3VO2A 3CLVA 4QULA 4R0VA 3VPXA 3CPHA 5KVSA 3INRA 2WSLA 1S89A 3HA7A 2FG5A 4MXDA 3I51A 1JJ7A 1XDZA 2NUBA 3DDZX 4JA0A 4YWJA 1WQ3A 5REQA 1LX7A 1AO3A 3PUKA 2AN5A 2PSFA 2VF4X 3B1ZA 3CLRD 5F35A 4NMWA 3WA7A 3Q6IA 4W5HA 2R6GA 3HJSA 4YHBA 4V2IA 1X7ZA 2OHIA 5EXDA 3ZOZA 2OPFA 4DR7B 4FGZA 3TTYA 1IHPA 4F5ZA 4IJ5A 1NQVA 1OT5A 2ZR8A 1Y3BE 3B5EA 1XHLA 2H7CA 4WBXC 2Q27A 1DCFA 1GPMA 2UZAA 1P74A 3OLZA 1C9NA 1RBMA 2DLCX 4U02A 1K6XA 1SC6A 4MJLA 3PLAE 2IXEA 1RXUA 4BO7A 2BEWA 1NI4B 2PTGA 4CMEA 3AGPA 5J2UB 1DHRA 4ZJZA 2JC3A 3L82B 2DZNB 2L4EA 1DQYA 1P5ZB 3FBWA 3AEUB 3G1UA 5EJ2A 3SMPA 2DBQA 2DP4E 3KD3A 2X9NA 3ECAA 4WZBE 4KDCA 3G1TA 1OGYA 3GZJA 3TUZC 2XUQA 1QO7A 5LNK1 1XTPA 1XDSA 2WZBA 3KPJA 4DG8A 2Z8XA 3B38A 2BJWA 3D0QA 4R6WA 3VC7A 1RXIA 2O3SA 4EI2A 3RFCA 3F8SA 3PKZA 5EHIA 5DNDA 4OATA 2FI1A 1YASA 1YJCA 1J8DA 5KPDA 5E8JA 1OWLA 5IT5A 1NW4A 4UM9B 3CH5A 4JBIA 4BVHA 2Q2WA 1OF1A 3FB4A 4HDOB 4BQIA 4TT3A 1T0JB 3PQ3A 5CLLA 5AUQA 3RWMB 4OVZA 4N39A 4B84A 1HMYA 1RJDA 1ZK2A 3TIVA 3MILA 3HL0A 5J2TF 2GHQA 1TZJA 2PH3A 3GFRA 4MR7A 4KOAA 2XFSA 1FU7A 3VDNB 1BHJA 1T6XA 3QENA 1OBOA 4G9GA 4UBJA 4A2CA 2X49A 2G3QA 4LZJA 1QGAA 4ZQHA 2BGJA 3KCNA 5COAA 3TKYA 2E89A 2QX4A 1I1QB 3ZGNA 4POOA 5BP7A 3DA8A 1U81A 5GJCA 5IFKA 3IXLA 2JS7A 1TUGA 2UYCA 3KXIA 2V96A 3UNXA 2RD2A 4GKKB 2XUGA 4CMGA 3C45A 4P31A 3MK6A 2AOTB 2B61A 3K0BA 4DR6M 2JGDB 3D7LA 5B1EA 5BW8A 3I6MA 3MW8A 3LI2A 4HWSA 1DBVO 5KNBA 4LZWA 1KDOA 2X9GA 5CBPA 4DF3A 2AOUA 2Y0TA 3OHMA 1F9AA 3VHLB 3AOEA 1I9GA 3IO3A 3TIFA 1QTQA 4Z54A 2RE8A 3A11A 1Q1NA 2C0CA 4O4LF 4UEJA 3GRPA 4F3CA 1IHXA 1QG2A 1ZA2A 2J46A 2OBLA 2OBMA 2ZREA 3I37X 4C0KA 3CSSA 4Q18A 5CM2Z 4ESHA 5K8JB 2JEZA 2Y8EA 2CHFA 3DFFA 1V39A 4GPIB 5AK4A 4O2LA 2VBIA 4AI6A 1JR3A 1QS0A 4BBJA 4U9HS 3RG2A 4I8DA 2BMEA 3VISA 5FBWB 2GFHA 1YGPA 2FEOA 2GXSA 3LSTA 1UJMA 5HCNA 2PZBA 4N8EA 1GGKA 3DPSA 5DYYA 1KBOA 1WBJB 3PYLA 1C3XA 2I03A 1HQDA 1IPHA 5EJCA 2BMWA 3NWJA 4MMYB 4UD2A 5KSYA 4RESA 4LG2A 1HDRA 1R0CA 1F8FA 1VRCA 1WM1A 2GCGA 5IF3A 2AX4A 4QATA 4MQEB 5ELMA 2VK2A 1UL1X 2YFHA 2HB6A 3JQ9A 3CFYA 1G59A 3QIVA 1DGFA 3NDIA 4ID3A 4I99A 3FE3A 5DNUA 3GFOA 4CF3A 5K6AA 3Q7PA 1E9BA 1N6NA 2DE0X 2QAJA 1K63A 3PKJA 1RTKA 1HDXA 5GZ3A 1OYVA 3W4JA 4IRUB 4EJSA 2CXQA 4OYRA 3NU1A 4GXTA 5BYBA 1BC5A 1QPBA 1Q21A 4GWGA 3S27A 2A0FA 3VYTB 4Z99A 4B4UA 4FMDB 1C0LA 2GEDA 1KQNA 3F5MA 2VS1A 2ZR0A 4DDWA 2UVQA 1N75A 2MMCA 4IRMA 1DC6A 2H92A 2IC5A 1XTIA 4N5DA 4WECA 1PRYA 2WKSA 3GFFA 3FWZA 1RPNA 5D87A