4AZFA

Human dyrk2 in complex with leucettine l41
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
409
structure length
404
Chain Sequence
b'HHHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYRK2 DUAL-SPECIFICITY TYROSINE-PHOSPHORYLATION REGULATED KI
publication title Selectivity, Co-Crystal Structures and Neuroprotective Properties of Leucettines, a Family of Protein Kinase Inhibitors Derived from the Marine Sponge Alkaloid Leucettamine B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 404
sequence length 409
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4azfA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4azfA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4azfA02
1J91A 1Q4LA 3EKNA 3R7YA 2XNGA 2HZ4A 4CKIA 4MD7E 5GZAA 3MN3A 5D12A 4BBEA 3ZFXA 3RMFA 1UV5A 2C6IA 2YDKA 2QO9A 1OGUA 3F3UA 4BKZA 4RVMA 5EW9A 4FTCA 1OIQA 3LLTA 5ICPA 4C4EA 5IQAA 3D94A 3MVLA 4XOYA 4EC8A 4HYUA 4OBPA 5AA9A 4F65A 5DVRA 1ZAOA 4YURA 4ID7A 2HZ0A 4A9YA 4MYGA 4PDSA 1U59A 4H3QA 3R01A 3LMHA 3SXFA 4L7FA 3CQWA 2XCKA 3RP9A 3FYJX 4OW8A 4W8DA 3LCDA 4EEVA 3PVGA 2W05A 3PUPA 4L6QA 4ZSAA 3EJ1A 4R3CA 5GINE 2PE2A 3DTCA 4FNWA 2IW9A 3VUDA 1UKHA 2WTKC 4JG7A 2WMTA 1YXSA 4YTCA 5IPJA 3PXQA 3FL5A 2PUUA 1AGWA 4RQKA 2JAMA 5EI6A 1O6YA 4GVJA 4APCA 3ZSHA 3M11A 4FMQA 5HIBA 3H30A 4QYGA 3P79A 3VUKA 3RTPA 3OMVA 3RINA 4K33A 5ETIA 3MJ1A 2PUPA 4QQTA 3C1XA 4YHTA 3RAHA 3BZ3A 2ETKA 3MV5A 1H1PA 4C58A 4YZCA 3AG9A 3DOGA 4U44A 3RVGA 3O8PA 4PX6A 3VS3A 2G2FA 3AD5A 3PJ2A 3D9VA 5CY3A 2OIDA 4F09A 4YGAA 4X7QA 2QHNA 3WE4A 1W7HA 4DEAA 3E7VA 5A6OA 5LVMA 2XIYA 3NR9A 3OUKA 3R8ZA 5CU3A 3V5PA 4GH2A 2R0UA 4AFEA 5JT2A 3LFQA 3ULIA 4D1SA 4RX9A 3BGQA 4FSNA 4M67A 4DEDA 3QQKA 5KZIA 3BIZA 4KSPA 3F5XA 1VYWA 5BYYA 3NS9A 3DDQA 4W4VA 5EHYA 4II5A 4MX9A 2UW7A 3GGFA 3UODA 3KK8A 4FV0A 4BCJA 3H0ZA 3PRFA 3W8QA 3W32A 3ODYX 5HLPA 4RX8A 1ZOGA 2Z7LA 1WBOA 2B53A 3IONA 4R6VA 4DF3A 2Y4IB 3VC4A 5BVNA 2ZYBA 2UW9A 3C51A 2OZAB 3GCSA 4LM5A 4WUNA 3EIDA 5DR2A 3DB8A 4JNWA 4MD8E 2BKZA 5JGBA 3OCTA 5L8JA 5E90A 2R3FA 1OPLA 5JZJA 3HP5A 3U9CA 3VAPA 3VBXA 3SOAA 2PUNA 5KCVA 3G9LX 5H8GA 3BEAA 4B4LA 4CYIA 4OAUC 4AOTA 4DFNA 4EUUA 1ZZLA 4X0MA 3TCPA 5AAEA 3R9NA 3EZRA 3ET7A 4YBJA 3COIA 2C4GA 4NW6A 5CS6A 4NT4A 2WNTA 4XG4A 3E8CA 2IZSA 1KE9A 3S2PA 4GSBA 3PZEA 5HNGA 4GKHA 2IJMA 3R8VA 4J98A 4BDDA 5EYCA 2IVUA 2J9MA 3UVQA 4GKIA 3BBWA 4PDPA 5E4HA 3QKKA 2IW8A 4I5HA 2WTKB 3UO6A 2BTRA 4PP7A 4KINA 3W8LA 5AAGA 4O0RA 3QL8A 2BRHA 5JN2A 3ORIA 4DT8A 3PXKA 3Q5ZA 3DK6A 3LPBA 4P5QA 3POZA 1P4OA 5M4FA 4O0TA 4UWCA 3UOLA 5T6KA 3ROYA 4KBCA 3NIEA 3FI4A 4GIHA 3BWFA 5I9VA 2GSFA 1OL2A 3KK9A 4Y5QA 5IKWA 3D0EA 3L9LA 3ZEPA 4DG2E 4EBVA 5B2MA 5A54A 4P90A 4O7WA 2R7IA 3S00A 2H96A 4YC3A 4JI9A 4DH7A 4AGWA 4QTAA 3PE2A 2OJGA 4KIKB 3ENMA 5FUTA 4FKQA 5ETAA 4QMUA 4ZIMA 5FTQA 3PVUA 4ZLYA 3O0GA 3VRZA 2V7OA 4B7TA 2HZNA 4TYEA 5DRDA 4C59A 5J1VA 4L3JA 4XBRA 4HYIA 5AP7A 3OBJA 3QD0A 4W9WA 4E8AA 4EQMA 4ZY4A 4JLCA 2WFYA 2XM8A 1KOAA 3EKKA 4W8EA 1H4LA 1XH8A 2Z7RA 4YZBA 3VS2A 4P4CA 4XG6A 2QOHA 5IQDA 3R9HA 4FT5A 4Q9SA 1M14A 3D2IA 3BE2A 3IS5A 4JG8A 3CTQA 3TG1A 2YAAA 3GCQA 1GNGA 2VWBA 3A4PA 2ZAZA 3IW6A 2IPXA 2UW6A 2WQEA 1OMWA 3EL8A 4TW9A 3VS5A 2P2HA 3RAIA 2DS1A 4QPSA 3G0EA 3E5AA 2F7ZE 4LGGA 2VNYA 2UZLA 4WHZA 4YTIA 3UG1A 5JK3A 3UZTA 3DLSA 3QCYA 5EH0A 2ZVAA 3E7OA 3HKOA 3T3VA 2BHHA 3R28A 2VO7A 4D2TA 3O96A 1KE8A 4U81A 5D9HA 4JAJA 4D1ZA 4HCVA 3PDTA 2ZM3A 2WMWA 3MFSA 2PZRA 3K5UA 3HAMA 5H3QA 1TVOA 2BVAA 1SYKA 3H9FA 3LQ5A 2C0IA 3RK9A 4EOLA 4PMPA 4EBWA 2O63A 2OXXA 4M84A 4PMTA 5DI1A 3ZUTA 2XF0A 3EFJA 4TY1A 3HMIA 5CSHA 2ZMCA 3ALOA 5AIRA 4RZVA 3VJOA 4CTCA 4CKJA 3WE8A 3LM0A 3MY0A 4LRKA 2PZ5A 4FVRA 4IAYA 4IACA 3HV4A 3E64A 3IW4A 2VWWA 3E62A 2GDOA 4UZHA 4DE4A 1SNUA 2C3KA 1QPJA 4E26A 4WG4A 5A3XA 2YCRA 4JL9A 4YZMA 5A46A 4NJ3A 2GTNA 4A4OA 5AIKA 2XIXA 4QMPA 3HMMA 5HGIA 5L2TA 4IX6A 4WNPA 4EKKA 4YHFA 1YXUA 5E8YA 2WOUA 4RIYA 3DBDA 3HGKA 3R9RA 4NUSA 1P14A 2JFLA 4I94A 4ZSEA 4PUZA 4FK3A 3AOXA 4ZEGA 4LGHA 3EN5A 3LCTA 2CHLA 2VWIA 4G9RA 4PPCA 3MTLA 4ZTLA 4DTBA 2IZUA 3F9NA 5KMKA 4I21A 1UNHA 4D2WA 2ZV2A 3WZJA 3A62A 3AT4A 1H1SA 4NH1A 5CTPA 4KA3A 5CXHA 5DT4A 4BTFA 3LFCA 3IKAA 3MH3A 2G15A 5KX8A 1ND4A 4IVDA 5HG8A 5L2WA 3SXRA 4C57A 2B9IA 3JVSA 4XLIA 2BZKB 2PZPA 4J8NA 4ASEA 3BHTA 3TTJA 1LR4A 5EM5A 4EZ5A 3E93A 4BF2A 3KC3A 2ACXA 3HA6A 3QFVA 3V8SA 2ETRA 3FLZA 3G33A 2WQOA 2ZV9A 4O0XA 2X8DA 3E3BX 4QP1A 5AM6A 4YU2A 4USEA 2CKQA 2XKDA 5C4LA 2VTQA 1KE6A 1U54A 4AZWA 4B8MA 2BTSA 5IEVA 2AC5A 3SD0A 3ZOSA 3O8TA 4EOPA 5C27A 4FT3A 1OKVA 1TQMA 3K2LA 3FMDA 5E8SA 2Y9QA 1ZWSA 4QQCA 4Y46A 1JPAA 4DLIA 3Q9XA 4OTDA 1SZMA 4DTKA 3HX4A 1KOBA 4QQ5A 3NW7A 5FDXA 2JDVA 5TR6A 2WIHA 1OITA 4BDHA 4Z7GA 3NGAA 5CVGA 4BCQA 4GU9A 4RIXA 3RWQA 3NUSA 4ZTRA 3A8WA 2UZTA 2XB7A 4IZAA 4EORA 4YR8A 4ANMA 1YHWA 3LJ1A 1DAYA 5I4NA 4OTIA 3TI1A 1Y6BA 3AC3A 3OWKA 4KIOA 4AP7A 3R02A 3QXOA 3TXOA 3P08A 2GMXA 3BELA 4IZ5A 1PXMA 5M51A 2YFXA 4BTKA 5FBNC 5IQEA 4FIGA 4BI0A 5EHLA 4IB3A 5ETCA 2VWVA 3EQIA 1O6KA 4CXAA 5L8LA 3HV7A 1ZMVA 2Y7JA 2JITA 4J52A 4DYMA 2WMSA 1S9IA 4FV9A 3HEGA 1Q3DA 2PMIA 3A2CA 2R3MA 3QTQA 2PVFA 2X7FA 2BRMA 3ZXTA 1NY3A 4AS0A 5AP1A 2W9FB 4AZSA 4IVBA 4APPA 3FBVA 3Q96A 4A7CA 3W55A 4KIPA 4G1WA 3ACKA 5FEDA 2B9HA 4ZLOA 5KMMA 3EQDA 1NXKA 2AUHA 4DG3E 5AA8A 5IA3A 4KWPA 4YHJA 4X3JA 2WB8A 2X9EA 3SV0A 3QQJA 2HZIA 2HOGA 4CV8A 2QURA 2ZDTA 3CCNA 4C35A 4U8ZA 3PG1A 4FVPA 4DGGA 5A6NA 1W0XC 2UZVA 4I5CA 2UVXA 3FC1X 4B6LA 1PXIA 4OT6A 4E4NA 4BCOA 4D4RA 5ACBC 4OTGA 4V04A 5TOZA 4FV7A 2WMRA 3FSFA 1MRVA 1Q8ZA 2RFNA 3EQGA 1YI3A 4D55A 5HTCA 4JX3A 5EG3A 4F9BA 3QQHA 2DYLA 4RRVA 4XMOA 2VU3A 2WEIA 3VQUA 2XNNA 2UW0A 3EYHA 2QC6A 4S33A 5LMKA 2YHVA 5DNRA 1YHVA 3KCFA 5CF8A 3F2AA 4D9TA 5CSWA 5KO1A 2JEDA 5CZHA 5LVLA 2I7QA 3MY5A 4QO9A 2PE0A 4HGEA 4AF3A 3ZM4A 1M2RA 3PSBA 4DFZE 4J8MA 3CD3A 3IK3A 2UW3A 3CP9A 1ZOHA 4IX5A 1YOLA 2FSLX 4FKPA 3RJCA 4BDAA 4NSTA 4D28A 4ZSLA 2CNUA 3O71A 3Q6WA 5BYLA 4QMMA 2CLQA 4XYFA 5HG5A 2W1GA 4IAIA 3F7ZA 5FXSA 1JWHA 4HZRA 3DTWA 3D5WA 4AW1A 1U54B 1OKZA 4FG8A 2HYYA 2P55A 2YERA 4RMZA 1YDSE 4HGTA 4YSJA 5L2QA 3VNTA 4EI4A 4NL0A 3PP1A 2GPHA 4FTNA 5FDPA 2YZAA 3H9OA 4Y83A 3V3VA 3CJGA 2OIQA 4G16A 3NLBA 4EQUA 2C3JA 5HTIA 2JGZA 1PXKA 3LFNA 1BKXA 1WAKA 5E8TA 4QP7A 1ERKA 2I1MA 4O84A 2CKEA 3S0OA 4ZZNA 4RIXB 4JAIA 3OFMA 3BYSA 4N4SA 4HVDA 1YHSA 4MQ2A 4QTBA 1JNKA 3UIUA 3VIDA 4AT4A 4O0VA 2NPQA 4BHNA 4YJUA 4BIEA 5HX8A 4ACGA 4FTIA 4AZFA 2HY0A 2JC6A 4WRGA 4XV2A 5J8IA 3V8TA 3SG8A 5EYMA 2KTYA 4ASZA 2OGVA 4UYNA 4AAAA 3Q04A 3HP2A 4D2RA 3O8UA 4FTTA 4WNKA 4E4LA 3R73A 4NZWB 4EL9A 1NVQA 4ZY5A 3M1SA 4YSMA 4UBAA 2W1IA 2LAVA 1ZOEA 3G90X 3OBGA 3NUNA 5AUVA 4ZLZA 4PDYA 3KXHA 4XP3A 4Z3VA 4BVUA 1U4DA 4CSVA 4L7SA 4MKCA 2VUWA 4J97A 3AMAA 1J7IA 3C50A 1ZRZA 4EWHA 4XNEA 4MWIA 3RZBA 4AT5A 4F0GA 5JFXA 1VJYA 1BX6A 1ZMUA 4MNFA 2VX1A 4K9YA 5M53A 5FBOA 4C7TA 2JKQA 4WNMA 3QUEA 5AP0A 5LVPA 2X39A 3A7HA 4IM0A 5KZ0A 2XBAA 2VTHA 3V5LA 1DM2A 4FTQA 4CFFA 4B0GA 1EH4A 3DAKA 3Q9YA 4HNFA 4I0RA 4DH8A 5BYZA 4BDFA 4MXOA 3R7OA 3ZO1A 5FXRA 4BI2A 3MVJA 1LEWA 3F66A 2QO2A 3HUBA 2XYNA 3G6GA 4FT0A 4O7ZA 1PHKA 5CF6A 3MIAA 5EM8A 5C4KA 2JD5A 3JY9A 4ITIA 5E92A 5FLFA 2BR1A 1Y6AA 3WYYA 4C37A 1PXOA 5GJDA 3FLYA 4BDKA 4C3FA 3KL8A 5BVDA 3BEGA 1AD5A 5CAPA 4G17A 4L00A 2XKEA 4YJOA 3L8PA 5AP2A 3RPSA 5TT7A 3PVWA 2PVMA 3FWQA 3NCGA 3UG2A 3C0HA 2C6EA 2PTKA 4CFVA 4RLKA 4RC4A 4CQEA 5M08A 5DR6A 5D1JA 5EQEA 5IH6A 2X8IA 4I24A 4DGOA 4CD0A 2O5KA 2QI8A 3OCSA 3UJGA 2IVTA 3PPJA 3THBA 1M7QA 3HZTA 4YTHA 5D41A 3ZFMA 4C36A 4EOSA 5IISA 3FZTA 3ZLSA 3WZEA 2EXCX 3UMXA 1ATPE 2W5HA 2Z8CA 2OZOA 5FEEA 1GZOA 2ITOA 2ZDUA 3I6WA 5AUTA 2G1TA 2Z60A 4AW5A 2E9VA 4CTBA 1XJDA 5HBHA 4AACA 4ZTNA 4GW8A 3I1AA 2O8YA 4IC8A 4NCTA 5JQ5A 5CEKA 2C6TA 2XJ0A 3P7BA 4BKJA 4DFUA 4ZMFA 2QG5A 4AUAA 3KEXA 4OTQA 3MFUA 3U9NA 4B99A 2YCQA 1NT2A 4QMWA 1X8BA 4L3LA 1J1BA 5AEPA 5HVKA 4O86A 3QQLA 4X3FA 3RWPA 3BYUA 3LAUA 4NFMA 2YIXA 5DR9A 4QQJA 3REPA 2OJJA 2XH5A 4RJ4A 1H25A 3Q3BA 5LCJA 2CMWA 1V0BA 5HG7A 2ERZE 4CVAA 3QCSA 5HLNA 4RIWA 4B9DA 3H0YA 4LOQA 3P1AA 2ITTA 1B39A 5HOAA 5K3YA 3MVMA 4GT4A 4XS2A 2EUFB 4ZAUA 3BQCA 4RFYA 3PA3A 4O83A 2W1FA 2OKRA 2A19B 4FSMA 5A4TA 3LLAA 3G9NA 5J5SA 4I4FA 5AP5A 2H9VA 5LARA 5ANKA 1MQ4A 3LXNA 4O0SA 1TKIA 3P7AA 4NM5A 3RPVA 2P0CA 2VGOA 2Z7SA 3QLGA 5CENA 3VUTA 1T45A 4BCKA 4ENXA 3C4CA 4EZ3A 5IH5A 1PMNA 3PP0A 4U80A 2GS6A 2ZV8A 5M55A 5LMAA 4HYHA 3DQWA 1IG1A 4MH7A 4X3FC 4M69B 3PXYA 4PTCA 4RJ3A 3RPYA 3R8MA 2IWIA 4M97A 2W99B 2PMNX 2YN8A 1OKYA 2RFDA 4OBOA 3EZVA 3LFFA 4U43A 4H3PA 5EQPA 3MS9A 1LPUA 2QO7A 4RX7A 1JSVA 5FEQA 4EOIA 4RQVA 4RJ5A 3ZHPC 1YRPA 3F69A 1K2PA 4BN1A 4HVSA 3ID6C 4G3CA 4HGSA 4FGRA 2VO3A 4O38A 3AXWA 3FAAA 4UMUA 2UVZA 4WOVA 5GJGA 3PJ3A 5BQ0A 3FEGA 4O91A 4QT1A 4F64A 4GUBA 4EH5A 4BIBA 4NM0A 1PXLA 5JKGA 4GUEA 2YAKA 3C7QA 3NIZA 4M3QA 3ZH8A 3QLFA 3KXXA 3QYWA 4JXFA 5CYIA 3UOJA 5HEZA 4Z16A 4ITHA 5EDQA 3QKMA 4QP3A 2WMAA 1CKJA 2YM6A 4ITJA 1YOMA 4L46A 5J87A 2XNMA 1PW2A 3UQGA 5A9UA 5HLWA 4EHVA 3QX4A 3C4FA 3I0OA 4WBOA 5C03A 1GY3A 5HO7A 1GJOA 3WI6A 3N4UA 4X2GA 4F08A 4O7VA 4O96A 1YI6A 3COKA 4OGRA 4YO4A 4TN6A 4U42A 2YIWA 3GBZA 4G6NA 4NW5A 3ZLWA 5D11A 4QYEA 4FL2A 3F3VA 3FMHA 4M12A 2WTWA 3QXPA 3DBFA 4DC2A 3CC6A 4X21A 4KIQA 4K1BA 2J7TA 5B7VA 2ITWA 3DB6A 3KA0A 4YO6A 2C1AA 5EOBA 4C4GA 4C2WA 2R3GA 4YJRA 4FX3A 3CQUA 4IX3A 4DH3A 5CF5A 1GZKA 2QOFA 1SNXA 3NNVA 2YA9A 3I5ZA 4KIKA 5JFVA 3DZQA 4RLLA 2OXYA 2CPKE 1OL7A 3B8RA 3W33A 4QTEA 5HX6A 5CAOA 4O6LA 3C4EA 3FI8A 3UBDA 4EWQA 2QG7A 4FZFB 4GCJA 3QTRA 3ORMA 2XNBA 4FKLA 4N6YA 4I0TA 5I9UA 5AR4A 3Q9WA 4YZNA 4YUQA 4E6CA 1PY5A 3EQPA 3MB6A 1PMVA 4MD9E 3DZOA 4MHAA 3NYVA 5CSVA 1KE7A 4O0UA 3F2NA 4X3FB 5DBXA 4AGUA 2W4JA 4ALUA 3CKXA 3EN9A 3OXZA 3QC4A 4FG9A 4HPTE 4ACHA 3TKHA 3UP7A 2P4IA 4NKAA 3F5GA 3KXNA 1NVSA 4O82A 4RIWB 4FYNA 5HD7A 5D7AA 3I79A 3FLWA 4I0SA 4RWIA 3K3JA 4X2KA 2A2AA 5HVJA 5E1SA 2YM8A 4DFYA 2C6DA 5M44A 2Y6MA 1P5EA 3HDMA 3RK5A 3E88A 2UVYA 5GHVA 4J96A 4MNEB 5HICA 3ZFYA 4BGQA 1CM8A 3R83A 1JVPP 1YI4A 3KY2A 3VUIA 3A61A 3HRBA 5HNBA 2ITXA 3ZZWA 4QMZA 4CMUA 3VO3A 4FTKA 5BVEA 5AR5A 3IDBA 3KF7A 3QAME 3P86A 1O9UA 5C8NA 3QCQA 2BMCA 5C26A 3VN9A 5CEOA 3F88A 4KNBA 2BRBA 2IVSA 3B2TA 4BY9E 4TL0A 4ZY6A 3UIXA 3L8XA 4RVLA 2WELA 3PY1A 4ZSJA 5CU6A 1PF8A 2X4FA 3OXTA 2UZDA 1XBBA 1PXJA 1H0VA 4MWHA 2WQBA 4PWNA 4RC3A 3VULA 2XNPA 4G3GA 3VWAA 1QCFA 4FVQA 5B2KA 4WUAA 4C02A 4TZRA 2J2IB 4LL5A 2A4LA 2XIRA 3R8UA 3TUCA 4MXCA 2VWUA 3MGYA 3N4TA 3CGFA 1U46A 2XP2A 4MEDA 1PYEA 4UWYA 3FQSA 3ZM9A 4IAAA 2C47A 4FNXA 4S32A 5K4IA 4KSQA 3PA4A 4F6SA 4G34A 2E9UA 3EL7A 4NTSA 4K11A 4PL4A 2B9FA 4FF8A 3MH2A 3ANRA 2BIKB 2VTJA 2BAKA 3Q4ZA 4PP9A 3TZMA 4QOXA 3BU3A 3TT0A 3ZO3A 2W0JA 3EH9A 3DLZA 3KMMA 1T46A 1YXVA 4FNYA 4W4XA 5DA3A 5HBJA 3A60A 3TUBA 2FB8A 3BHYA 2C5OA 5HE1A 3RNYA 2OICA 3JUHA 3NPCA 1Q99A 4EK5A 5ACKA 2XBJA 4CLIA 5CEPA 3MTFA 3BRBA 1ZY5A 3C13A 4DFBA 3PIXA 3QCXA 4FGBA 4ANSA 3SVVA 3DJ5A 4I93A 4IB0A 4QMXA 4DFLA 2XA4A 2A27A 4L3PA 5EQYA 2X0GA 5L2SA 2CKOA 3TKIA 3NUUA 5AWMA 1ZZ2A 4RA4A 3NSZA 4MAOA 4XP0A 1YXXA 5DH3A 4OT5A 3PSCA 4X2JA 5CEQA 2YDJA 3SRVB 5KMOA 5L3AA 3V5WA 4QP8A 4CQGA 3HMPA 3KVXA 4TYHB 3ZBXA 4XCUA 4ZSGA 5IQBA 5GIOE 4PNKA 4ZK5A 3WARA 3DQXA 3F61A 2JBPA 3ETAA 3BQRA 2V7AA 1G3NA 3NAXA 3R1NA 2PVYA 2FVDA 4N70A 3LIJA 3FC2A 4FKSA 1HCLA 2VWZA 3F82A 5GJFA 3QHRA 1QPEA 4BGGA 4HW7A 2R0IA 4D5KA 3Q4UA 4TXCA 2GCDA 5JH6A 1IRKA 3FZOA 4LYNA 3DJ7A 4EJNA 4ANQA 1MQBA 1OL6A 2X6DA 2QU6A 3I0QA 1IA8A 2CGXA 5FG8A 5IA1A 3JY0A 3KXGA 4U5JA 1JKKA 3KU2A 4BWXA 4FIJA 4FV3A 1H1WA 3FMJA 2WXVA 3PPKA 2XJ2A 5TE0A 3F3TA 4AA0A 4YJTA 3R1QA 4C38A 5DN3A 5JGDA 2F4JA 2ITNA 4X2NA 2BPMA 4E6QA 4J95A 5L6WL 5BUJA 2V5QA 4O0YA 5HESA 3EQHA 4F7SA 3W16A 3QZHA 3IDCA 3QRJA 4R7BA 3DJ6A 2C69A 4FKTA 4BDGA 4XV3A 3P23A 3W1FA 4ZJVA 4TPTA 3DNEA 2UZOA 4DFXE 5C8MA 3MPTA 4RA5A 4M14A 1M52A 4IAFA 3OXIA 2WZJA 4GFGA 5HBEA 3U55A 3RGFA 4LV8A 2XRWA 3DY7A 4E4XA 4I20A 4D0XA 4EHEA 4F1TA 4WSYA 4AXAA 5LQFA 3UVRA 2PZYA 1RJBA 2GNGA 3FI2A 4LUEA 2C30A 5LOHA 3S4QA 3U51A 5KMIA 5KE0A 2LGCA 2WKMA 4K18A 3GFEA 2KULA 4IMYA 2AC3A 4F1OA 4Y72A 4NK9A 3C0IA 1CKIA 3WZUA 5CAVA 4KBKA 4ONAA 5DFPA 3TJCA 3ZC5A 2A1AB 4QTDA 2XIZA 2W1EA 3MA6A 1W84A 3Q9ZA 4NEUA 4WO5A 5E8XA 5FTOA 5JFWA 4I41A 5FWKK 3AC4A 4IJ9A 3FE3A 3FKNA 4FSTA 5IDNA 1K3AA 3RM7A 4QP2A 1M7NA 2UW5A 3H3CA 3ZS5A 4EQCA 3BI6A 1ZY4A 4KD1A 1OPJA 2R3NA 3FKLA 3AMYA 4GJ3A 4AGDA 3E8NA 2PMLX 3OOMA 4ANOA 2BUJA 2V62A 4IX4A 4NM3A 4FTRA 4O7TA 4U79A 1GAGA 5F9EA 4ASDA 4BB4A 2CGVA 3OG7A 4AN9A 2OSCA 3VW8A 2JBOA 4AE6A 3VUHA 1QL6A 2F2CB 3AD6A 3W2QA 4C2VA 3C5UA 2AYPA 4LMNA 3NX8A 1LUFA 3UP2A 2FYSA 3LHJA 4EONA 5M57A 4BZOA 1A48A 5KMLA 3Q6UA 1WMKA 3W10A 5CLPA 3RALA 4EYMA 4F9YA 3BU5A 2YCFA 1KE5A 3WF7A 5CQWA 1XBCA 1DI9A 4MBIA 3CIKA 4C61A 3UQFA 1F3MC 5JEBA 4N57A 4W9XA 1KV2A 5EKOA 5AR2A 3SHEA 2QONA 5ANEA 1FVTA 4TNBA 4DEIA 3OCBA 3RAKA 3OWLA 3HNGA 3CBLA 3IGGA 3O51A 3VBTA 2BRNA 3VF8A 4EK6A 1L3RE 3QGYA 4FV6A 4JR7A 4PL5A 2G9XA 4GIIA 3I6UA 1JSTA 5HCZA 2WOTA 3GQIA 5J9LA 5I9WA 4AN3A 4HZSA 4XBUA 2ZM4A 5HVYA 3RHKA 2PHKA 3KF4A 2VAGA 5TF9A 2C3LA 5FGKA 3QC9A 3VRYA 4PTEA 4ZJJA 5LJJA 4U97A 3SC1A 3DS6A 4BC6A 3UIBA 2X9FA 3FMKA 4HVGA 1JAMA 3N4VA 1KWPA 3OHTA 4QMOA 5IQGA 4GYIA 3DK3A 3VBYA 5EYDA 1Q41A 2X6EA 1URWA 2EXEA 4Q2AA 2YLFA 5G1XA 3BPRA 3NEWA 1FQ1B 4WG5A 3OW4A 2QOIA 4QD6A 3VS0A 4UN0C 1SVGA 3D14A 4OTPA 1UNGA 3EFKA 3OP5A 4O7NA 2YJSA 2UV2A 2PULA 4AW2A 3RBWA 3TNHA 4GV1A 3F3ZA 3GC8A 3KN6A 5AADA 3GOPA 3KULA 2VZ6A 4K77A 5KNJA 2XS0A 3NMUF 3OY1A 4QP6A 3BYMA 5IA5A 3BU6A 4XX9A 3SGCA 4GL9A 2W96B 4V05A 3SOCA 5IA2A 5AR3A 1GIJA 3FI3A 4FV8A 3EQFA 4AGCA 2UW4A 3OTUA 2B52A 3UE4A 1YXTA 3C9WA 3KXZA 3HV5A 3Q32A 2OF2A 2C3IB 1WBSA 2JKOA 2R3QA 2HENA 4H36A 2ITYA 3IOKA 3RNIA 2VTPA 4MCVA 3SX9A 2QNJA 4S2ZA 1S9JA 5CI7A 4AFJA 2VTMA 4C4FA 4K2RA 4G3DA 3DKCA 3BYVA 5E8VA 4AOJA 4F4PA 1OL1A 4RWLA 1YWVA 3PFQA 3HV6A 2BHEA 3LQ8A 4RWJA 3E87A 2Q0NA 3WIKA 5L6PA 2CCIA 5K9IA 4RC2A 5LCKA 4CMTA 3G0FA 4RWKA 4IANA 2F7XE 4CNHA 3E8EA 2CLXA 5CU4A 3WF5A 4DEBA 2F57A 4U7ZA 1R39A 3VS7A 4LUDA 4FEQA 4C3RA 4XV9A 3Q4TA 4RGJA 4IC7A 4WIHA 1VYZA 3W2SA 1MUOA 4J71A 3QRUA 4WSQA 4C4JA 4ZTHA 3QD2B 5I9YA 3F7WA 4IZ7A 3JXWA 4RZWA 4GT5A 3TUDA 2XCHA 2YWVA 2OFVA 2HXQA 1NVRA 3R7IA 2QVSE 3R6XA 4U9AA 4DEGA 3ZMMA 4C0TA 3KREA 3LFAA 4DGMA 2C6MA 4JIKA 4DTAA 4I92A 4KAOA 2J4ZA 5CANA 2PYWA 4KUJA 2XIKA 1R78A 3ORNA 3DXQA 2NNWB 2W4OA 3NUPA 4YC6A 5EHOA 4YLLA 3FJQE 3A99A 4R1VA 3N51A 3BBTB 3NNWA 4ALWA 1KSWA 1FMKA 3CPCA 5FM2A 5BVOA 3VHEA 2W1CA 4PTGA 4CRSA 2RFEA 4QMLA 2C68A 2CCHA 4FV2A 1U5RA 4FV4A 3CLYA 2UW8A 5EW8A 1URCA 2Z2WA 3HMNA 5J9YA 4BCGA 4F99A 5B2LA 3RK7A 4F6UA 1BL6A 3LXPA 1Z57A 3R8PA 4CGAA 1H0WA 4CFNA 4FEXA 3FZPA 2B7AA 3LFBA 5CT0A 4E20A 4YLJA 2W4KA 4GG7A 1JSUA 3PLAE 1UWJA 4JVGA 1YVJA 4KS7A 2VTTA 4FTOA 3ZCLA 4F7JA 4D1XA 4IXPA 2W5BA 2BDJA 3Q60A 3EHAA 3R04A 3VQHA 3PY3A 3ROCA 3TNWA 2SRCA 4Y95A 4M0YA 4XEYA 1OECA 4BCPA 1Q62A 1Q8TA 2O3PA 1A06A 2QLQA 2GQGA 2XRUA 2XUUA 1RW8A 4DG0E 3BV2A 5F20A 5K0XA 4CFXA 1IAJA 4FEVA 4ORKA 4L01A 3CGOA 4LRMA 4FE2A 1W8CA 2B55A 2YABA 4EC9A 3TM0A 3CKWA 3CQEA 1FOTA 3VBWA 4O1OA 3VJNA 4KBAA 5GIPE 4CCUA 4JRNA 2R3KA 5KHXA 4Z9LA 1QMZA 1Y57A 4DAWA 4ZZOA 4LG4A 4O1PA 3KULB 1XKKA 4RBLA 4TWOA 3IQ7A 3LJ0A 4JQEA 2JKKA 2OWBA 5A4EA 3LFDA 3BE9A 3R1YA 4FTLA 5CU2A 5BMSA 1Q61A 1Q8WA 3BHUA 3F5PA 3OD6X 3Q52A 4M13A 4OTRA 4X6QC 4BTJA 4BZNA 5A4CA 2WTVA 4UV0A 3QRTA 4FKWA 4FKOA 3GU5A 3RAWA 3ACJA 4V0GB 3D7ZA 2WMXA 1AQ1A 3I5NA 4G3FA 2H34A 2HK5A 2IW6A 2R5TA 2W5AA 3CD8A 3LE6A 4HCTA 5M4CA 4QMVA 4IB5A 4D4VA 3KRRA 4JIAA 4OLIA 2C0TA 1IR3A 4M69A 4GU6A 3U87A 2ESMA 4TRLA 2C0OA 4A06A 3LW0A 3RCDA 4CEGA 2X8EA 4QP4A 4QMNA 2PU8A 5FRIA 4JBOA 4C34A 4E4MA 3QZIA 4FL1A 3GI3A 4LGDA 4D2SA 1OPKA 2XEYA 3QYZA 5IA4A 1Q97A 1XHAA 2WPAA 4YLKA 3IO7A 5AP6A 4QPAA 4FODA 4PY1A 4CV9A 5JRQA 2O0UA 2XZSA 2GTMA 3COMA 2WQMA 4IWDA 5M4IA 1QPDA 4TWCA 3R9OA 4M68A 3TZ8A 2YACA 1WBVA 5H2UA 3WYXA 5KMNA 4F7NA 3FLQA 1JKLA 2R2PA 3L9NA 4FTJA 4O2PA 3A7IA 2Y8OA 2YM3A 3P9JA 4U3ZA 3GXLA 3P5KA 2VV9A 4MF1A 1F5QA 4XG8A 1UVRA 2JDTA 3ZO4A 1XH7A 2ITZA 5HORA 2CDZA 5HTBA 4GYGA 4EZ7A 3NNUA 3KXMA 4A9RA 4LL0A 1Z9XA 3HYHA 4F0FA 4X6RA 4EH2A 2E9OA 4DEHA 3DXPA 5LWNA 1UU8A 4MXZA 3PJCA 4JQ7A 4N0SA 4RFZA 1BI8A 2EB3A 2VWXA 4K6ZA 1GIHA 1PKDA 5E1EA 3SQQA 3C0GA 4D2VA 4E5AX 5L2IA 2GHLA 2QLUA 2R4BA 2X2KA 4YBKA 2OJFE 3D4QA 3QA8A 4DEEA 4FA2A 2E9PA 2JDRA 2GFSA 3EFLA 2WQNA 4CFMA 3LMIA 2PY3A 4FV5A 1SVEA 2GHMA 3R63A 1UU7A 5FD2A 2Q0BA 5JSMA 2O64A 3L8VA 5AR8A 5CX9A 3ZRLA 3Q2MA 2OBJA 3O50A 4FKVA 2PZIA 4HVHA 3U6HA 4WRSA 5DOSA 3W2CA 3PPZA 4KS8A 3SW7A 4BYIA 3R0TA 4MQ1A 3V01A 1JQHA 1CTPE 3C4ZA 4U41A 5HD4A 2J90A 3PXFA 4PNIA 3QTIA 4PQNA 2YLEA 3IDPA 2V55A 3SG9A 3R30A 2BZHB 3PTGA 4F9AA 5E91A 4JOAA 4CT2A 4Z7HA 4F9WA 2R3OA 5I9ZA 2W9ZB 4IZYA 2H6DA 2YIQA 3MDYA 4H3BA 5EK7A 1P4FA 5CWZA 3W18A 2RIOA 3GB2A 4HPUE 5D7VA 4L45A 2RG5A 3LCOA 3D5VA 4IAZA 2PVNA 1GZNA 2C5NA 2PL0A 2QR8A 2YDIA 3O17A 3O7LD 5DE2A 4DHFA 1OKWA 5M06A 5AX9A 2ITUA 5BVWA 4EK4A 4LV5A 3ZLXA 3V8WA 3WBLA 2XK7A 1GIIA 4FIFA 2G2IA 4MXYA 1XQZA 3EB0A 3U4UA 4ASXA 4Q5HA 3CXWA 1XR1A 3F6XA 3IGOA 2X4ZA 3P78A 4I3ZA 4HYSA 1V0OA 2QODA 3EQRA 3KKVA 3MA3A 4JQ8A 1Z5MA 4MNEA 3RHXA 3FPMA 5EKNA 2VX3A 5JRSA 4RG0A 3ZO2A 4IDTA 1Q8YA 4EK8A 2XKCA 5CT7A 3FMLA 4HJOA 3ZTXA 5K4JA 3KVWA 3DXNA 4DBNA 4FTAA 3FYKX 5CI6A 4HCUA 4O0WA 2RFSA 4BKYA 5GZ9A 2ZB1A 4XRJA 2F2UA 3TNIA 4K0YA 4AOIA 4QTCA 1VR2A 2JIVA 5IUIA 5AAFA 2UZBA 4ZXTA 4BRXA 3WF9A 4BBMA 4IQ6A 4D4SA 4R77A 3C5IA 2QCSA 3MI9A 4IW0A 2X2MA 4YJQA 3SW4A 4BWKA 2CNVA 3NW5A 1YWNA 4IWOA 5F95A 3GENA 3W2OA 3UTOA 3NDMA 3DA6A 4O2ZA 3FXXA 3FY0A 3PVBA 2BROA 2B1PA 2DQ7X 2WGJA 4C4HA 3LQ3A 1Y8GA 3BV3A 3GU8A 3IPHA 3UPZA 2V22A 1U5QA 3I60A 3KMWA 4CYJA 2XMYA 5IEXA 2J5FA 1YW2A 3LFSA 1WBTA 2OH4A 1MRYA 4A07A 3B8QA 3FZSA 4NTTA 1TQPA 5JZNA 1IASA 3ORKA 2IZTA 2QOCA 1H01A 1QPCA 2X81A 4IADA 4E7WA 3AC5A 5IH4A 3UNKA 4TYGA 3ZEWA 1J7UA 3DBQA 2QOLA 3F5UA 4JRVA 3HLLA 4IBMA 2FSOX 3KRXA 1KV1A 4I6HA 4C33A 2FO0A 2VO0A 5FP6A 4JBVA 3QUPA 4BCFA 1XH4A 1F0QA 1VZOA 4TWPA 3TV7A 3ORLA 3HECA 3HRCA 4QNAA 3VS1A 3UZPA 5ANOA 2WHBA 3ZONA 5J7HA 2VTIA 3BGPA 3H10A 3RKBA 3D2KA 3EWHA 3N9XA 4G6LA 4NYEA 2WU7A 4RT7A 4FT9A 3DKGA 3MW1A 1O6LA 3EMGA 3II5A 5IQCA 1YWRA 5CASA 5EDPA 3C4XA 2J6MA 4MBJA 4B8LA 4BR3A 4EH9A 3LMGA 3G6HA 4IVAA 3A7FA 3TZ9A 3NUAA 2OO8X 5ANDA 4AZVA 2WAJA 4UXLA 5HO8A 4O81A 2I0YA 3VUMA 4D0WA 4FR4A 4USFA 2CGUA 4DT9A 1P2AA 1ZMWA 5IF1A 4PPBA 3KCKA 3SRVA 3G15A 3GUBA 1OIRA 2QU5A 3AD4A 4DGNA 5AUWA 4ENYA 2EB2A 5E7RA 3GOKA 4TYHA 2YZLA 2P33A 3DBEA 4I23A 5GZ8A 3D5XA 2BKKA 5K0KA 3MH1A 4EH6A 3VF9A 5F4NA 4WNOA 1IA9A 2JDSA 4CRLA 3KRLA 4FBXA 4A4LA 3UYSA 4EOKA 2GS7A 4L42A 4NIFB 3ATSA 4F63A 4Y73A 4YJVA 4RIOA 1Q5KA 4QMTA 2QOQA 4L43A 5DEYA 4M15A 3GCPA 3PY0A 2BZIB 4KB8A 4JBPA 1FINA 3OEZA 3QTZA 1FGIA 5ANJA 3D7TA 3CR0A 3OROA 4BZDA 5IUHA 2O2UA 4IHPA 5CAQA 4GK4A 3O23A 4ZTQA 3MIYA 4PRJA 1ZYDA 2ZM1A 4XJ0A 5HZNA 5IQFA 1JBPE 4L8MA 4OR5A 3CY3A 3F2RA 4YJSA 2XK9A 3PYYA 4F1MA 4BICA 1G8AA 4JT3A 1OVEA 4WA9A 4YNOA 2R7BA 3ZRMA 1M2QA 2YCSA 3T8OA 3VUGA 4UXQA 5DIAA 3PIZA 5JQ8A 5IZFA 4CG9A 2UZWE 1XO2B 4QYYA 3QU0A 4YJPA 3O2MA 3U8WA 4RX5A 5CALA 4R5SA 3MSSA 5HO6A 4L67A 2HELA 1R1WA 3GT8A 4PL3A 3OVVA 1UU9A 3QD4A 5AUUA 5BUIA 5HU9A 4IB1A 1GZ8A 4ALVA 5A4LA 4IIRA 1RDQE 3QALE 2O65A 4FUYA 2Q83A 4Q5EA 2B9JA 3SKCA 3L9MA 4EKLA 1R0PA 2PMOX 4BCNA 4BI1A 4ZS4A 1WBWA 3CY2A 4Y85A 2W1DA 3S1HA 4ERWA 5IQIA 3FZRA 3GC0A 4M66A 3AGMA 4H39A 5D10A 4BYJA 3GCVA 4FTMA 4GJ2A 4S31A 4D2PA 3FHRA 5CSXA 3OWPA 3P7CA 5HE0A 4BL1A 4DINA 5ITAA 4AQCA 3PJ8A 1H07A 3LFEA 3BWJA 3MWUA 4MXAA 5AUXA 2XM9A 2JDOA 2XYUA 3TWJA 4UWBA 4ARKA 1FBNA 4O21A 4UZDA 3ORXA 4L68A 2I6LA 3QBNA 3DAEA 3OUNB 1M2PA 1E9HA 3C4WA 3I7CA 3EQCA 4JBQA 4BCIA 1UU3A 1OIUA 1W82A 4WD5A 4I5MA 4IEBA 2PUIA 3PSDA 1R0EA 4AA4A 4CMOA 4D9UA 3Q4CA 2NP8A 3NUXA 2WMUA 5J7BA 3OT8A 3FPQA 3P4KA 3VHKA 1FVRA 3GNIB 1H8FA 4EHZA 4E6DA 4BWPA 5AV2A 2YIYA 3NVMB 4R3PA 2PE1A 2ONLA 3OCGA 4L52A 3UNZA 2QOKA 4S30A 2VNWA 4TTHB 3VBVA 4XG2A 1J7LA 3ZLYA 3ITZA 3KRWA 5HNIX 3TZ7A 3FZ1A 4M8TA 1WZYA 4FKGA 4BFMA 1ZXEA 2I40A 4BBFA 2EVAA 4XH6A 3MYGA 4J7BA 4EK3A 3FQHA 1BYGA 5H8EA 1OM1A 4LFIA 2R3PA 2VX0A 5AV1A 1W83A 3I81A 4RVKA 3PXZA 2R3HA 2F49A 4LMUA 3K5VA 3T9TA 4U45A 5DYJA 3EOCA 3HMOA 4RVTA 3V6SA 3QKLA 2J0MB 5JGAA 3TV4A 2GNLA 2FSMX 4JR3A 3SA0A 2I0EA 1CMKE 1SM2A 2OF4A 4OBQA 4JJRA 5TKDA 4CKRA 4JX7A 1OL5A 2WU6A 2GHGA 2W1ZA 1REKA 3Q5IA 3UO4A 3FXWA 4RJ8A 2ONLC 5CZIA 2YM5A 3FY2A 4XV1A 3D15A 4QP9A 2XK8A 4BCHA 3TIZA 4YTFA 3GQLA 3KRJA 5IU2A 4FIEA 2CSNA 3BX5A 3NNXA 4FZAB 2R3LA 3AC2A 4F6WA 1CSNA 3D7TB 3RM6A 3ZDUA 4BIDA 3A4OX 2HAKA 3UC4A 1H00A 3FLSA 2ERKA 1BL7A 2GFCA 5BVFA 1ZYJA 3NYOA 5DT0A 4R78A 2B54A 2C5YA 2C6KA 2J5EA 2JLDA 4AG8A 3BGZA 1W98A 3FSKA 2X7OA 2ITQA 3NAYA 4E73A 1UA2A 1FPUA 1APME 5HU3A 4UMTA 2PVHA 1OUKA 2E2BA 4MK0A 5IMXA 3V5JA 4R5YA 1E1XA 1OUYA 2BALA 2QKWB 3A7GA 3FKOA 5E8UA 3UPXA 5HKMA 2VWYA 4U6RA 4UMRA 3IG7A 3ORTA 4FICA 4BDJA 2GQSA 2JIIA 3BLQA 3HL7A 4KKHA 3EYGA 4J53A 5DGZA 5BUEA 5IUGA 2CJMA 5LWMA 4HGLA 5AP4A 1BI7A 1Q24A 3NW6A 4GFMA 2QQ7A 4PPAA 4DGLC 4ANBA 3OZ6A 4IDVA 4Y8DA 2XVDA 2QR7A 1RE8A 3R7UA 3UZRA 2BRGA 4DH5A 4GVAA 4IVCA 4ACMA 2G2HA 3TJDA 4FUXA 5HE2A 4QYHA 4GMYA 4EH7A 5K5NA 2WEVA 2OU7A 4NWMA 4TYJA 4FEUA 4I6QA 2VRXA 3R8LA 2X1NA 3ZSIA 4CZUA 5IG1A 4I6BA 5KMJA 2Y6OA 4KABA 4JDIA 2CN8A 3UDBA 1KUTA 2PVJA 5IMEA 4A9SA 3ODZX 4AW0A 3W2PA 4DCEA 4EJ7A 3IW5A 4IE9A 3PA5A 3GCUA 2J0IA 5J95A 3OTVA 4FSYA 2BZJA 1PYXA 4QNYA 3DPKA 3POOA 4XRLA 5E9EA 3COHA 4QMSA 3BHVA 2WD1A 3NUYA 2VTNA 3MPAA 3JVRA 3W2RA 5KBRA 5CU0A 2IZRA 4AZTA 2UZNA 4QYFA 4AN2A 2XK6A 4PF4A 4R7IA 4WG3A 1NW1A 3RI1A 2NRUA 1BLXA 3UOKA 5CNNA 3ZRKA 3G5DA 2R9SA 2W1HA 4DCAA 3B2WA 5EYKA 4XG7A 2ZJWA 3PLSA 4XP2A 5F1ZA 5BMMA 3QA0A 4EOQA 4EH8A 1A9UA 5CQUA 3R7VA 3DGKA 1CKPA 3MFTA 3G2FA 3KFAA 2HIWA 2WMQA 3LVPA 1TQIA 4FSZA 1IEPA 3OS3A 5T68A 3DU8A 3UO5A 5A14A 3Q53A 3HUCA 3OT3A 2Z7QA 2FA2A 4RFMA 2C5XA 5EM6A 2GNFA 1NA7A 5HCYA 3FXZA 3LXKA 1BMKA 4YMJA 1CDKA 5C1QB 3UQCA 5IEYA 4FOBA 1UKIA 3PG3A 4NKSA 4R1YA 3VW6A 1Q8UA 4AE9A 2RG6A 3BLRA 5DT3A 4CLJA 2J0LA 5HIEA 1HCKA 2EXMA 2JKMA 3G51A 3JYAA 3CPBA 2C6OA 2VTAA 4HNIA 1Y91A 2QD9A 1G5SA 3FMMA 4LRJA 1DAWA 3ALNA 3V5TA 3TDWA 4I4EA 5FQDC 3MVHA 4IH8A 3S3IA 2OG8A 4FSUA 1YQJA 5ANIA 3LZBA 5EI8A 4BDBA 3FDNA 3ERKA 3PJ1A 1YDRE 3R71A 3BHHA 1REJA 3AGLA 1L8TA 2GU8A 4FSQA 4IM2A 3TACA 4AU8A 4EOMA 4WBBB 2YIRA 2Z02A 2ETMA 4NM7A 3I4BA 2Y0AA 2GNJA 3AT3A 5ETFA 4FL3A 2JIUA 5HIDA 3SAYA 2RL5A 2W7XA 3AQVA 5M09A 4OUCA 3V04A 2OJIA 2VD5A 2PPQA 2WMBA 2BFYA 5DLSA 3WIGA 4E1ZA 3QWKA 5DPVA 4D58A 5M4UA 4YZDA 4OAVB 3DDPA 5CVHA 3GFWA 3VS4A 4QMQA 3U4WA 2JAVA 2VGPA 4KKEA 2C6LA 4UEUA 4BCMA 3KQ7A 5I0BA 3D83A 4IFGA 2FGIA 4N6ZA 4V0GA 4EOJA 4WKQA 3IECA 4CFWA 3KGAA 1YOJA 3NYNA 3PXRA 3H4JA 4RPVA 4F9CA 4C62A 2OIBA 1DS5A 5DRBA 2OFUA 2PSQA 2YEXA 5DWRA 2ITPA 3AT2A 3MFRA 1OIYA 5CXZA 5LXMA 3NVKI 4BDCA 4FV1A 5F94A 4OTHA 3MH0A 2CN5A 4LOOA 4ACDA 5H9BA 5G6VA 4FKJA 5EI2A 4CT1A 2XEZA 2XNOA 3QRIA 4FI1A 4G9CA 3VS6A 2PVLA 3AMBA 4L44A 3SDJA 1SMHA 4XOZA 2HCKA 4DITA 4G6OA 5I5ZA 3M42A 3MBLA 4OTWA 2PWLA 1FGKA 3NCZA 5DHJA 4RJ6A 4PV0A 4S34A 5GNKA 1V1KA 4R7HA 4FKIA 5HG9A 1WVXA 4O22A 4QRCA 3A7JA 3OY3A 3U54A 2VTRA 4NFNA 3QRKA 2OI4X 3CEKA 3TDVA 3ENHA 3WZDA 3A8XA 3ZZEA 4ZS0A 4RIYB 2RKUA 5J1WA 1WCCA 2B0QA 2ZOQA 3CTJA 4E5WA 3QHWA 1STCE 1LEZA 3GVUA 1H08A 1PXNA 4A4XA 3FHIA 4FZ7A 2R3IA 3ANQA 3R00A 2Y4PA 4IAKA 4FKRA 5LMBA 4BTMA 3JR1A 4F0IA 2YWPA 2OJ9A 3HV3A 4R3RA 4DN5A 3QQUA 4GT3A 4MXXA 5FXQA 5EFQA 4FZ6A 3WF8A 5I3RA 3DAJA 4FG7A 3OW3A 4O7LA 3ELJA 4G31A 1WVWA 4LI5A 2NRYA 4HOKA 3ZDIA 4O7YA 4RSSA 2QOOA 4TYIA 3UYTA 2F9GA 5C9CA 2PK9A 5IA0A 4JDJA 2R3JA 5DMZA 1K9AA 4MVFA 3BLHA 4IJPA 3ZC6A 4E93A 3T9IA 4I22A 5L4QA 3L9PA 4W4YA 4MF0A 2XK4A 3PRIA 3OOGA 3R7GA 2VTLA 4C8BA 3IW7A 5EDRA 3ORZA 3HAVA 3D5UA 3TV6A 2IG7A 5AFVA 3QQGA 3VVHA 3RCJA 4XLVA 3MESA 4NJDA 4A9UA 2FSTX 4L53A 3DCVA 4YJNA 5KKRC 3ZUUA 4TT7A 3QX2A 4UB7A 4FT7A 5HI2A 2ZV7A 2VTOA 4J99A 4CZYB 5LMKC 3LM5A 5HE3A 5CEMA 2W06A 1H28A 3QZGA 5T3QA 3KN5A 2WTJA 3E3PA 1PMUA 5IQHA 4TWNA 2BCJA 3ZXZA 1OBGA 2I0HA 4C4IA 2BFXA 3BYOA 4H1MA 5BX0A 4E6AA 3BKBA 1V0PA 5E8ZA 3DT1A 3QF9A 4YNEA 4LQMA 3KMUA 4YP8A 5AV0A 1OBDA 5FM3A 1ZARA 3LXLA 1H26A 1LP4A 3DV3A 5CNOA 2GNHA 5I9XA 4L9IA 4J1RA 1XH9A 4C3PA 5L6OA 3ORPA 2PVKA 4FNZA 4AA5A 5BNJA 4F7LA 2WMVA 3NWWA 3QTUA 4BGHA 5JFSA 3MB7A 5FP5A 5H8BA 3FUPA 4FEWA 4P7EA 3T3UA 4ERKA 5J9ZA 1ZYSA 4BDIA 2UUEA 1FMOE 1UWHA 3QQFA 1IAHA 2ZMDA 5DEWA 2FUMA 3DNDA 4G3EA 1G8SA 4GEOA 2BAJA 3JS2A 2BIYA 1UNLA 5BVKA 4UYAA 1JOWB 4M0ZA 4FSRA 5HQ0A 3RPRA 4DH1A 4M7IA 3QTWA 4EOOA 3GU7A 5EM7A 3TL8A 5AX3A 4UMQA 4ZTSA 2RGPA 3FV8A 4RJ7A 3TN8A 5CSPA 3SXSA 5M07A 1ZLTA 4Z55A 1J1CA 3MJ2A 3TIYA 4GK2A 4GG5A 5JMSA 3UNJA 2UZUE 2CNQA 3AC8A 5M56A 4EYJA 5E8WA 3PWYA 4U3YA 2GQRA 5CF4A 2J0JA 4LOPA 3VBQA 2W17A 2H8HA 2QOBA 3DKOA 4R8QA 4O7SA 1PRYA 4EHGA 5B0XA 4YZ9A 3DFAA 4XHKB 3K3IA 4GS6A 3NZ0A 4KKGA 2E9NA 3L1SA 4UALA 4ZJIA 4A9TA 4WT6A 3ZSGA 3FMNA 2DUVA 3H9RA 5LVOA 2I0VA 2OW3A 2WTCA 1XH6A 3WZKA 2G01A 5EW3A 2EU9A 4CG8A 2OK1A 4AT3A 2XKFA 2HW6A 3E8DA 5AMNA 4O7RA 4FOCA 1PKGA 3DBCA 3MPMA 4I6FA 3TTIA 1BUHA 3V51A 5AR7A 5KKRB 3WF6A 1XBAA 3HRFA 4EUTA 4NU1A 4O27B 3M2WA 4X2FA 5AM7A 2IVVA 3I7BA 2JFMA 4GRBA 4JDKA 2XK3A 3GU4A 1JLUE 4TNDA 2EWAA 1MP8A 5DG5A 4ACCA 3UGCA 3LOKA 1YKRA 1MRUA 4P2KA 4DBXA 3TNPC 2R64A 4CFUA 3OWJA 4XUFA 4E3CA 4QPMA 3EN4A 3EQBA 3QTSA 2QKRA 3GP0A 1B6CB 1H1RA 1XH5A 1PJKA 1ZYCA 3OEFX 4PDOA 4AX8A 2OLCA 3Q2JA 2CGWA 2WO6A 2X7GA 4FYOA 1XWSA 3CE3A 4K8AA 4FKUA 5A4QA 2YM4A 2X2LA 3HA8A 3E63A 3R21A 4FZDB 3R9DA 3CJFA 3UVPA 4ANLA 4BDEA 5TO8A 2OXDA 2YISA 3E92A 4MTAA 3HDNA 3ATTA 4IWPA 3CSVA 4GFOA 3UMWA 3IW8A 3R2YA 2IO6A 3GU6A 5EOLA 3PE1A 1GOLA 2GS2A 2HWPA 3RZFA 3PWDA 3GC9A 3TEIA 1J3HA 2DWBA 3CTHA 5AV3A 3V6RA 4NIFA 5J79A 4JS8A 2VO6A 2ITVA 4CZTA 3ULZA 1Q3WA 1OZ1A 2HY81 3WILA 3DK7A 1FVVA 1PXPA 1PMEA 4FSWA 4FIHA 2V0DA 4FIIA 1WFCA 1RQQA 2RF9A 3NRMA 4CCBA 3F3WA 1OB3A 3DFCB 3GC7A 4QMYA 3UIMA 4D5HA 2P3GX 2J0KA 4V01A 2VN9A 3K54A 5AUYA 4YC8A 4Y5HA 1ZYLA 3OF0A 4JDHA 4OTFA 1I09A 1E1VA 4FK6A 5BPYA 2XJ1A 3KB7A 5KBQA 3UOHA 1H24A 4W4WA 2FH9A 3FQEA 3R1SA 2QHMA 4EH3A 4H58A 3P0MA 4PMSA 4JG6A 1M17A 5HCXA 3WOWA 4AWIA 3AC1A 3ZBFA 5IDPA 4MBLA 3FL4A 3O7LB 3PZHA 4TKSA 1WBPA 5ANGA 3HVCA 4XG3A 4YPDA 5C01A 4E5BA 4ZTMA 4KRDA 2RSVA 4H05A 3EN7A 3QD3A 4PMMA 4ZZMA 3LJ2A 2P2IA 2OH0E 2CKPA 3TKUA 3QZFA 2WTDA 3S95A 2HWOA 3EN6A 4P5ZA 3LCKA 1I44A 3FMEA 3QUDA 4NCTC 1Y8YA 1DI8A 2C5VA 2BDFA 3DKFA 4IFCA 2GNIA 2VTSA 4O6EA 3ZUVA 4HVIA 2YJRA 3UC3A 4Q9ZA 3LKMA 1WVYA 2HW7A 4I5PA 3LCSA 2REIA 3RPOA 2WIPA 4IWQA 4G2FA 3R22A 4UMPA 2J50A 2J51A 3JPVA 3U6JA 5CAUA 5AJQA 2ZB0A 2F7EE 2XNEA 1B38A 2A0CX 2B4SB 4G5PA 1H1QA 5AP3A 5C8KA 3PIYA 5AUZA 3MY1A 3CS9A 3EFWA 3R7EA 4EH4A 2NO3A 1JKSA 1OI9A 3R2BA 3L8SA 5KHWA 2PVRA 2BILB 1H27A 1R3CA 1YDTE 2BDWA 3V5QA 4BHZA 2WTIA 2OZAA 3ZYAA 5KUPA 2IN6A 5K5XA 5LVNA 4GK3A 1JKTA 5CVFA 4G5JA 4ZMEA 4YPSA 2YITA 5CEIA 1SVHA 4USDA 2UZEA 4ZOGA 1VEBA 3OC1A 4H1JA 4ZP5A 4U40A 4F70A 5FTGA 3QTXA 4FTUA 3NYXA 2BAQA 4XG9A 4UX9A 1WBNA 4DLJA 3GEQA 2YM7A 3SLSA 4ANNA 3IOPA 3FLNC 4KRCA 4IM3A 4FC0A 5L8KA 3U6IA 4U0IA 3ZU7A 4AZEA 2C1BA 2HXLA 4D4YA 2R3RA 4I1ZA 1HOWA 3QWJA 4UY9A 5I3OA 5J5TA 4DA5A 5AV4A 3BCEA 3TNQB 5HHWA 3QGWA 2Y4IC
chains in the Genus database with same CATH superfamily
3R7YA 2XNGA 1NY6A 4CKIA 3C9PA 5D12A 1YLAA 2C6IA 1OGUA 5EW9A 1OIQA 3LLTA 4XOYA 3QWLA 4DV5M 4EC8A 1ZAOA 4ID7A 4MYGA 4PDSA 4H3QA 2CHGA 3LMHA 3MJ5A 2W05A 3PUPA 4L6QA 5GINE 3DTCA 2IW9A 2WTKC 4YTCA 5IPJA 3FL5A 4APCA 4L8RC 3GPUA 3MJ1A 3W68A 4C58A 3RVGA 3PJ2A 5LVMA 2XIYA 3OUKA 2R0UA 5JT2A 3ULIA 4D1SA 3BGQA 4M67A 4DEDA 3QQKA 5KZIA 4KSPA 3T38A 3KK8A 4FV0A 3W8QA 3W32A 1TDZA 1WBOA 2ZYBA 3EIDA 4JNWA 5L8JA 1OPLA 2XFSA 3HP5A 3U9CA 3LQ3A 3G9LX 4AOTA 2P5TA 4YBJA 4GSBA 1XB2B 4GKIA 2DWZB 3BBWA 3UO6A 4O4CA 3QL8A 5JN2A 1OJLA 1P4OA 4O0TA 4UWCA 3ROYA 3BWFA 3S00A 2H96A 3HGIA 5LMNM 1K3XA 4ZIMA 3O0GA 2V7OA 2HZNA 1GABA 4L3JA 4HYIA 2CE7A 4ZY4A 3EKKA 4XG6A 2QOHA 4FT5A 3CTQA 3A4PA 1OMWA 3VS5A 2Z8YM 3E5AA 4WHZA 2VNYA 2ZVAA 3R28A 2VO7A 4U81A 4JAJA 4HCVA 5H3QA 2BVAA 1SYKA 4EOLA 2F5OA 2O63A 2OXXA 4DUYM 4TY1A 5CSHA 5AIRA 4CTCA 4RZVA 4CKJA 3LM0A 3MY0A 3HV4A 1NV9A 1SNUA 5H37D 2C3KA 2YCRA 5AIKA 2XIXA 3HMMA 5HGIA 4EKKA 2WOUA 2QSFX 2D7HA 3DBDA 1P14A 4I94A 4PUZA 1TH3A 4ZEGA 4PPCA 3MTLA 3F9NA 4D2WA 3AT4A 4DR5M 3LFCA 3MH3A 5HG8A 4JXJA 2B9IA 2K0BX 3E93A 4G4RA 3KC3A 3V8SA 2ETRA 4O0XA 2ZV9A 5C4LA 2ZM6M 1U54A 1Q3BA 3GLHB 3FTDA 4EOPA 5C27A 4LG2A 3FMDA 4Y46A 2YFQA 5TR6A 2WIHA 4OVZA 3NGAA 1G8KA 3B7QA 4ANMA 3LJ1A 1Y6BA 4RF0A 4L6V6 4GC5A 3P08A 3QXOA 3TXOA 3AKJA 2YFXA 5FBNC 5EHLA 3EQIA 1O6KA 2I7PA 3HV7A 2Y7JA 2JITA 1WIVA 4FV9A 3QTQA 1Z5AA 2X7FA 4AZSA 2XGNA 4APPA 3W55A 3EQDA 5AA8A 5IA3A 3CCNA 4C35A 4DGGA 4E4NA 4OT6A 4D4RA 5ACBC 3AOGA 5TOZA 1MRVA 1YI3A 3CF2A 1N32M 3QQHA 2VU3A 2UW0A 3KCFA 3W0NA 4D9TA 1R6BX 5CZHA 4D81A 3ZM4A 1M2RA 4DFZE 4J8MA 3VK8A 3A42A 4L16A 2FSLX 3RJCA 4QMMA 4XYFA 4L15A 3QYBA 1JWHA 2CP8A 4AW1A 4GHAA 2YERA 4HGTA 2JWSA 2FS1A 5FDPA 3CJGA 2JGZA 4QP7A 4AT4A 2NPQA 4BHNA 4YJUA 3GLIE 4BIEA 4ACGA 3RGPA 4AZFA 2KTYA 4X64M 2OGVA 4AAAA 3R73A 4ZY5A 4UBAA 2W1IA 3NUNA 3KXHA 4XP3A 1U4DA 4MKCA 1J09A 4EWHA 3RZBA 4AT5A 2VX1A 2JKQA 1XNQM 2X39A 3A7HA 5KZ0A 1DM2A 3Q9YA 4MXOA 3MVJA 1X37A 4FT0A 1PHKA 5CF6A 2BR1A 3WYYA 4C37A 4LGYA 4BDKA 3FYDA 1AD5A 5CAPA 4G17A 2XKEA 3L8PA 5TT7A 3C0HA 4QDVA 2QENA 3PPJA 3THBA 3HZTA 5IISA 3HJSA 2G1TA 3TMOA 4CTBA 3SHGB 4AACA 1XHBA 5GKNA 3I1AA 4DFUA 4BKJA 3U9NA 1X8BA 3W0MA 5AEPA 4O86A 2OQ4A 3RWPA 4RJ4A 2CMWA 1V0BA 4RIWA 4LOQA 5EXXA 5K3YA 4GT4A 4XS2A 4O83A 3PA3A 4FSMA 4FWHA 2H9VA 5LARA 3LXNA 3P7AA 3QLGA 5CENA 5DYIA 5M55A 5LMAA 4HYHA 1I94M 4PTCA 4RJ3A 3R8MA 2W99B 3EZVA 3LFFA 4H3PA 1JSVA 4HVSA 4G3CA 4FGRA 2KDLA 4QT1A 4F64A 1PXLA 5JKGA 4GUEA 3ZH8A 3LMMA 4L46A 3UQGA 2XNMA 5HLWA 2J7OA 3C4FA 2JY5A 3N4UA 4O7VA 1YI6A 2YIWA 2LXEA 4LJ5A 4NW5A 4QYEA 3F3VA 2WTWA 4X21A 4KIQA 4K1BA 2J7TA 3KA0A 4C4GA 4C2WA 4DH3A 4FX3A 3CQUA 1SNXA 3NNVA 5JFVA 3DZQA 2WSEF 1IXZA 3FI8A 4EWQA 4GCJA 2R4JA 3MB6A 3EQPA 4MHAA 5IMXA 3DZOA 4O0UA 4X3FB 3VLFB 4ALUA 3CKXA 3EN9A 3QC4A 2P4IA 3F5GA 3T1YM 2A2AA 2C6DA 3U5ZA 5GHVA 2UVYA 1QANA 4MNEB 3R83A 1YI4A 5HNBA 3ZZWA 3VO3A 4FTKA 5BVEA 3P86A 5C26A 3AOEA 4BY9E 3B2TA 2HL7A 3UIXA 3PY1A 1MJGM 3OXTA 2UZDA 1XBBA 1PXJA 4RC3A 4PWNA 3VULA 1OIZA 4WUAA 3TWLA 4LL5A 2A4LA 2XIRA 3TUCA 1AUAA 3N4TA 4FNXA 5K4IA 4F6SA 1JB0F 3EL7A 2VTJA 2BAKA 3TZMA 3KXEC 3TT0A 3KMMA 3RNYA 2CFOA 3JUHA 3NPCA 2XBJA 2LVAA 1ZY5A 3C13A 3PIXA 3QCXA 4I93A 4IB0A 2CKOA 3TKIA 3PSCA 4X2JA 4QP8A 4TYHB 3ZBXA 5GIOE 4PNKA 3DQXA 3BQRA 2V7AA 3R1NA 4PCZA 2FVDA 4N70A 1HCLA 2VWZA 3F82A 2MJ5B 3CGWA 4D5KA 2GCDA 3FZOA 4EJNA 4FWGA 2X6DA 2QU6A 1IA8A 2DWNA 3PPKA 5TE0A 2WXVA 3F3TA 3R1QA 2BPMA 2V5QA 5HESA 3QZHA 1G8PA 4BDGA 4G4OA 3W1FA 4M14A 2WZJA 4GFGA 3RGFA 4LV8A 4EHEA 4F1TA 4WSYA 4AXAA 2KNAA 1IN5A 4LUEA 5LOHA 2LGCA 2WKMA 3GFEA 4IMYA 2AC3A 1CKIA 1DGFA 2A1AB 2W1EA 3Q9ZA 1W84A 3RM7A 1M7NA 3ZS5A 1ZY4A 3FKLA 2PMLX 2B3TA 2BUJA 1GAGA 4ASDA 2CGVA 3UGJA 2JBOA 4AE6A 1QL6A 4C2VA 3W2QA 1WGLA 3Q6UA 3KP1E 4MBIA 5EKOA 3U61B 3OCBA 3CBLA 2BRNA 4FV6A 2UUCM 4GIIA 1JSTA 5HVYA 5TF9A 5LJJA 2VAGA 4GH9A 1GJSA 4PTEA 4BC6A 3DS6A 2DAEA 3FMKA 3SAWA 3FRIA 4DV7M 5IQGA 2X6EA 1URWA 4Q2AA 1FQ1B 4WG5A 3OW4A 4QD6A 3VS0A 4OTPA 1UNGA 3EFKA 1TFFA 4CHTB 3GOPA 3KULA 4K77A 3NMUF 3BYMA 3SGCA 4V05A 2M5ZA 3EQFA 3OTUA 3UE4A 3HV5A 1WBSA 2C3IB 2JKOA 2HENA 4H36A 3IOKA 4MCVA 4S2ZA 4IBFA 1S9JA 5CI7A 2VTMA 4G3DA 1UFZA 5E8VA 3JAMS 3HX3A 2K47A 3E87A 5L6PA 5K9IA 4RC2A 1XMMA 2W82A 4CMTA 3G0FA 2ZAOA 4DEBA 1R39A 3VS7A 4WIHA 1VYZA 3W2SA 1MUOA 3F7WA 3JXWA 4RZWA 1NVRA 4U9AA 4IIWA 4GC9A 2C6MA 4I92A 4KAOA 2PYWA 4CISA 2NNWB 3HWSA 3A99A 4ALWA 3U60B 1KSWA 1FMKA 5FM2A 3VHEA 2RFEA 4QMLA 2C68A 3CLYA 2UW8A 4B08A 2BWBA 3HMNA 5J9YA 3LXPA 1H0WA 5FLXS 4CFNA 2FFJA 4LZJA 3U6MA 3ZCLA 4FTOA 4IXPA 2BDJA 3Q60A 3EHAA 3VQHA 3ROCA 1Q62A 2QLQA 5K0XA 4DG0E 1RW8A 4FEVA 2B55A 4KBAA 5GIPE 2R3KA 1Y57A 4TWOA 3IQ7A 4JQEA 5A4EA 4AAYA 1QZEA 3R1YA 5CU2A 1Q61A 1Q8WA 4M13A 2JA2A 2WMXA 3I5NA 3VHKA 3CD8A 2IW6A 5M4CA 3LE6A 4IB5A 4OLIA 1IR3A 4M69A 4GU6A 4CEGA 4TRLA 4LJ9A 5FRIA 4C34A 3QZIA 4FL1A 1PJQA 1Q97A 2O0UA 1T6OA 2XZSA 2GTMA 2WQMA 1MN3A 3SYKA 5H2UA 1JKLA 3L9NA 3A7IA 4U3ZA 3P5KA 4XG8A 1UVRA 2JDTA 1XH7A 4FCTA 5HORA 3SHFA 5HTBA 4GYGA 3KXMA 1Z9XA 1D0MA 1UU8A 4RFZA 4K6ZA 5L2IA 5EP1A 4YBKA 2OJFE 3D4QA 2JDRA 1E9SA 3EFLA 2WQNA 3LMIA 1SVEA 4YHHM 1UU7A 5FD2A 2Q0BA 3L8VA 3Q2MA 2A5YB 4FKVA 2C9OA 3SW7A 3LVVA 3PXFA 4PNIA 2YLEA 3FTCA 4JOAA 5CWZA 2LWXA 3L2AA 3O7LD 1GLNA 4AQKA 3NBIA 3E4RA 1HT2E 2X4ZA 3MA3A 4JQ8A 1ST0A 3AKLA 2VX3A 5JRSA 4B3RM 4IDTA 1Q8YA 4HJOA 3ZTXA 4FTAA 3FYKX 5CI6A 4O0WA 4QTCA 2JIVA 3WF9A 3C5IA 2QCSA 3UTOA 3NDMA 4O2ZA 3FXXA 2BROA 2B1PA 2DQ7X 1Y8GA 3GU8A 3LFSA 1WBTA 4B7FA 3FZSA 2IZTA 1H01A 3AC5A 4DV2M 4JRVA 3HLLA 3I4YA 5FP6A 2WHBA 2VTIA 3BGPA 3D2KA 4G6LA 2WU7A 3MW1A 1O6LA 1YWRA 5CASA 4IVAA 5ANDA 4AZVA 4UXLA 4D0WA 3SRVA 2QU5A 4DGNA 5FTJA 5E7RA 5GZ8A 5K0KA 3VF9A 4DV0M 3FTFA 4FBXA 4NIFB 2LVPC 1Q5KA 4QMTA 3W0FA 2QOQA 5DEYA 3PY0A 2BZIB 4JBPA 5ANJA 3OROA 4GK4A 3MIYA 3I51A 5IQFA 3CY3A 3PYYA 4BICA 1G8AA 4LCBA 5JQ8A 1XO2B 4AXEA 3U8WA 2HELA 3GT8A 5HU9A 2V1CA 3TE6A 4IB1A 1PGYA 4WURA 3L9MA 4EKLA 3RE8A 4ERWA 4M66A 3AGMA 5JI2E 4BL1A 4DINA 1H07A 1R2ZA 4O21A 4UZDA 1E9HA 4XK8F 1W82A 2HWJA 4I5MA 3PSDA 4AA4A 4G3OA 3W0RA 3OT8A 3GRUA 3UNZA 1J7LA 3ZLYA 4AKHA 4M8TA 4AKIA 4BFMA 4BBFA 2DZLA 3MYGA 4J7BA 4EK3A 3I81A 3K5VA 5DYJA 3V6SA 3QKLA 2J0MB 3TV4A 3SA0A 4OBQA 2WU6A 3Q5IA 2MH8A 2ONLC 5CZIA 4XV1A 2KRUA 2DHYA 3BX5A 4F6WA 3D7TB 3UC4A 4FVMA 1NO1A 2GFCA 2JLDA 4E73A 1FPUA 2E2BA 1C1KA 4R5YA 4ARKA 4UMRA 5AP4A 3KSJA 2XF3A 3OZ6A 2XVDA 1RE8A 4IJFA 4ANRA 1XXHA 2G2HA 3TJDA 2OU7A 4FEUA 2RRUA 2VRXA 4CZUA 2X1NA 2Y6OA 2CN8A 5IMEA 4A9SA 4EJ7A 3IW5A 5J95A 3DPKA 3POOA 5E9EA 3BHVA 1PJTA 3JVRA 2IZRA 4QYFA 1NW1A 2NRUA 3UOKA 5CNNA 3F92A 4EH8A 3MFTA 2HIWA 3LVPA 4FSZA 3DU8A 5A14A 4DGOA 3HUCA 4RFMA 5EM6A 3FXZA 1NA7A 1N78A 1CDKA 5C1QB 1UKIA 4R1YA 5DT3A 1HCKA 3G51A 4HNIA 4LRJA 3JYAA 3CPBA 1OQYA 2QD9A 4P17A 3S3IA 2OG8A 5EI8A 4BDBA 3ERKA 1YDRE 1L8TA 4FSQA 1G59A 4EOMA 2YIRA 2OOBA 2GNJA 1SXJB 5HIDA 3QWKA 3GFWA 3VS4A 3U4WA 4KHPM 2VGPA 4UEUA 2C6LA 4BCMA 5I0BA 2FGIA 3PXRA 2PSQA 3AT2A 5CXZA 1OIYA 5BPVA 1H6UA 5H9BA 4FKJA 1W2CA 2XEZA 2XNOA 4G9CA 2PVLA 4L44A 1SMHA 2LHGA 4XOZA 4AG5A 4G6OA 3MBLA 4OTWA 2PWLA 3KDSE 5DHJA 4RJ6A 4FKIA 2G3QA 3U6EA 3TDVA 3ENHA 2B0QA 1WCCA 1KFVA 1H08A 4A4XA 3FHIA 3I04M 5LMBA 4BTMA 4AI6A 3JR1A 2YWPA 2CUZA 2GNOA 4R3RA 5I3RA 4FG7A 3OW3A 3ELJA 1OIPA 1WVWA 5DMZA 2R3JA 4I22A 4MF0A 2XK4A 3PRIA 4C8BA 3HAVA 3QQGA 3RCJA 4D80A 4L53A 4JI2M 2BCJA 1TH2A 4E6AA 3BKBA 3DT1A 4YNEA 3KMUA 5AV0A 3LXLA 1LP4A 5I9XA 4J1RA 4C3PA 3ORPA 2PVKA 4F7LA 4BGHA 4FEWA 4P7EA 4ERKA 1ZYSA 2UUEA 1FMOE 2CRUA 3DNDA 4GEOA 2BAJA 2BIYA 4UYAA 1V33A 3RPRA 4B7GA 4M7IA 5EM7A 4UMQA 2RGPA 1J1CA 4GK2A 5JMSA 4EYJA 4DV1M 3VBQA 2W17A 3DKOA 2QOBA 3DFAA 4XHKB 3NZ0A 3L1SA 4ZJIA 2DUVA 3H9RA 5LVOA 3WZKA 2G01A 2EU9A 2HW6A 5AMNA 4FOCA 4I6FA 1BUHA 5AR7A 3W2PA 5AM7A 3GLGB 2XK3A 2H5XA 1MRUA 4DBXA 4BJJA 3EN4A 2QKRA 3GP0A 2OLCA 1ZYCA 2CGWA 4FYOA 3HA8A 3CSVA 4GFOA 4FWDA 3IW8A 2IO6A 2HWPA 1J3HA 2ITVA 4CZTA 1Q3WA 1PXPA 4NC6A 1WFCA 2RF9A 2LVOC 3F3WA 4D5HA 5AUYA 3K54A 1ZYLA 2FNAA 5BPYA 2XJ1A 5KBQA 3R1SA 4PMSA 4JG6A 4AWIA 3AC1A 5C01A 4ZTMA 2JP7A 3EN7A 2P2IA 4Z8XA 3TKUA 2WTDA 1DGHB 1DI8A 2BDFA 3ZUVA 4QOZC 2VTSA 4Q9ZA 3UC3A 2VDBB 4I5PA 1IY1A 2WIPA 2XSZA 4IWQA 2J51A 5AJQA 2ZB0A 2XNEA 5AP3A 3MY1A 3L8SA 1YDTE 5K5XA 5LVNA 1JKTA 2YITA 1SVHA 4U40A 5FTGA 2QBYA 4B7HA 2BAQA 5EP2A 2YM7A 3SLSA 5L8KA 4U0IA 3U6PA 2HXLA 4DA5A 2R3RA 3QWJA 5I3OA 5HHWA 1Q4LA 5GZAA 3F3UA 4RVMA 4DDGA 4B3TM 5AA9A 4LF5M 3R01A 4L7FA 4ZSAA 3EJ1A 4R3CA 3VUDA 1Q02A 4JI8M 4RQKA 3ZSHA 3M11A 3H30A 3P79A 3RTPA 3OMVA 3RINA 3RAHA 1L1TA 3VS3A 5CY3A 4X7QA 5A6OA 3NR9A 3R8ZA 3V5PA 4GH2A 4AFEA 4RX9A 4FSNA 1VDDA 3VDUA 4MX9A 4DDIA 4BCJA 4FD2A 3IONA 5BVNA 3VC4A 4WUNA 5DR2A 2J5YA 4MD8E 2BKZA 3OCTA 5C18A 1G4AE 3IG8A 3SOAA 4AXFA 4B4LA 4OAUC 1LTMA 3EZRA 2C4GA 5CS6A 4MGIE 4GKHA 3R8VA 4J98A 2IVUA 2J9MA 4PDPA 3QKKA 2BTRA 5AAGA 2BRHA 3LPBA 4P5QA 3UOLA 4GIHA 3KK9A 5B2MA 3L9LA 5A54A 4P90A 4JI9A 4DH7A 4AGWA 2OJGA 3ENMA 5ETAA 4QMUA 5DRDA 5J1VA 1XXHE 3QD0A 4W9WA 4EQMA 3GP1A 2XM8A 1KOAA 1H4LA 4YZBA 4Q9SA 3HHWA 2VWBA 1N33M 2UW6A 4TW9A 1NY5A 2F7ZE 4LGGA 2UZLA 3QCYA 5EH0A 3T3VA 4D2TA 4M9XA 3PDTA 3MFSA 4PMPA 1TVOA 2C0IA 4EBWA 2FH0A 4M84A 3ALOA 2PZ5A 2L4FA 4UZHA 1QPJA 4WG4A 4JL9A 4A4OA 3KOZE 4IX6A 4WNPA 1YXUA 4RIYA 4NRWA 4LGHA 4AKGA 4ZTLA 4DTBA 5KMKA 1UNHA 3WZJA 3A62A 4NH1A 1H1SA 5KX8A 2DZOB 3SXRA 4XLIA 1E94E 2PZPA 4J8NA 4ASEA 3BHTA 3TTJA 4DV4M 4EZ5A 2ACXA 1WJ7A 3G33A 4QP1A 5AM6A 2CKQA 2XKDA 3J81S 4AZWA 2AC5A 3ZOSA 4REZA 4FT3A 1TQMA 4DTKA 1SZMA 1GL7A 1KOBA 4QQ5A 1OITA 4Z7GA 4GU9A 3RWQA 2XB7A 1YHWA 3GRRA 4OTIA 4AP7A 3MHVC 1D2NA 2BWEA 4BTKA 4PDGA 4BI0A 1F4IA 4DYMA 3EIEA 1Q3DA 3A2CA 2PVFA 1NHWC 2BRMA 1NY3A 2W9FB 4IVBA 1DGBA 3Q96A 4KIPA 4I4LA 1NXKA 2UXDM 4X3JA 4YHJA 4X65M 2WB8A 2X9EA 4CV8A 3CTWB 3PG1A 4FVPA 1IXSA 4B6LA 4BCOA 4OTGA 3FSFA 2WSFF 5DNYA 4F9BA 4RRVA 3VQUA 2YHVA 5DNRA 5CF8A 5LVLA 3MY5A 4HGEA 3PSBA 1PJJA 2UW3A 3CP9A 4O4DA 5BYLA 3BL9A 5HG5A 4IAIA 4TUWA 3D5WA 1U54B 2HYYA 4EI4A 3PP1A 1GL6A 2OIQA 4EQUA 2C3JA 1ERKA 4O84A 4N4SA 3OFMA 4HVDA 3PUFC 3B7NA 4FTIA 5J8IA 4XV2A 4ASZA 4D2RA 3I4VA 4WNKA 4E4LA 4QHTA 4W5WA 3M1SA 1ZOEA 3OBGA 4ZLZA 4Z3VA 4BVUA 4CSVA 5FTNA 2VUWA 3AMAA 3C50A 1ZMUA 4MNFA 4K9YA 5M53A 3ZCBB 4IM0A 4CFFA 1EH4A 4BDFA 3ZO1A 1LEWA 2XYNA 3G6GA 4O7ZA 1IBMM 2EA0A 3J7AS 2JD5A 4IBEA 4C3FA 5EXPA 5AP2A 3PVWA 3FWQA 3NCGA 3UG2A 2PTKA 4CFVA 4RLKA 5M08A 2X8IA 1P3QQ 3UJGA 3T15A 1M7QA 4YTHA 4C36A 4QEBA 3FZTA 3ZLSA 2RGHA 3UMXA 4LFCM 2Z60A 4YY3M 1NNUC 1XNRM 3P7BA 4ZMFA 2QG5A 4AUAA 2X0QA 3GQ4A 4OTQA 3MFUA 4B99A 1L2CA 4L3LA 3BYUA 4QQJA 3REPA 1H25A 5HG7A 5HLNA 3H0YA 3U6SA 2JZ1A 2W1FA 1CUKA 2OKRA 2A19B 5AP5A 5ANKA 1MQ4A 4O0SA 1TKIA 4BCKA 4EZ3A 3C4CA 4U80A 2WSCF 2ZV8A 1QZMA 3DQWA 1IG1A 4M97A 3RFWA 2PMNX 1LPUA 1YRPA 1K2PA 3ID6C 4O38A 3FAAA 4UMUA 2UVZA 3FEGA 4O91A 4GUBA 4NM0A 2YAKA 4M3QA 3QLFA 3KXXA 5CYIA 4Z16A 4ITHA 5EDQA 2WMAA 1CKJA 4ITJA 1PW2A 4X62M 5C03A 4P16A 1GJOA 4F08A 4O96A 4OGRA 4YO4A 5D11A 4FL2A 3QXPA 4DC2A 3DB6A 4YO6A 2DNAA 1GZKA 2QOFA 2YA9A 3I5ZA 2CPKE 3W33A 5HX6A 4O6LA 3UBDA 4FZFB 3ORMA 4FKLA 4YUQA 1PY5A 4MD9E 1KE7A 4ACHA 1HNXM 4O82A 4RIWB 4FYNA 5D7AA 3I79A 3FLWA 4X2KA 5HVJA 1XMLA 5E1SA 5M44A 4BGQA 1L2BA 3HKPA 3A61A 3HRBA 2XSZD 4QMZA 4IBBA 4JI3M 5C8NA 2BMCA 5CEOA 3F88A 4KNBA 2IVSA 4ZY6A 2WELA 4ZSJA 3SATA 1PF8A 5CU6A 4MWHA 1QCFA 4FVQA 5B2KA 4TZRA 3CGFA 1U46A 2XP2A 1PYEA 4QNRA 4IAAA 2C47A 4S32A 4I5SA 3C58A 4NTSA 4FF8A 3ANRA 1E32A 3L29A 3BU3A 4W4XA 3A60A 3U6OA 2VF8A 4NSRA 5CEPA 2KA6B 3BRBA 4FGBA 4ANSA 3SVVA 3DOAA 4DFLA 4QMXA 2A27A 5EQYA 2X0GA 3NUUA 5JI3E 3GLHA 1PJSA 4XP0A 2YDJA 3HMPA 4XCUA 4ZSGA 4ZK5A 3WARA 2JBPA 1G3NA 4FKSA 1QPEA 4BGGA 4HW7A 4M0WA 5JH6A 1IRKA 3DJ7A 1OL6A 5IA1A 3I0QA 2CGXA 5FG8A 1TGUA 3KU2A 4BWXA 4FIJA 4FV3A 1H1WA 2XJ2A 3U5ZB 2ITNA 4E6QA 4J95A 4F7SA 3W16A 3IDCA 3QRJA 4R7BA 2C69A 4ZJVA 4TPTA 3DNEA 4DFXE 4RA5A 2XRWA 4D0XA 5DYGA 2PZYA 2C30A 3S4QA 3U51A 5KMIA 4F1OA 4Y72A 4KLNA 1YSYA 5BR8M 3C0IA 3IHPA 4KBKA 4ONAA 5DFPA 2F4VM 3TJCA 5FTOA 4NEUA 2V6ZM 5JFWA 4IJ9A 3FE3A 4FSTA 1K3AA 2X0PA 4EQCA 4KD1A 4GJ3A 3AMYA 3E8NA 4ANOA 4NM3A 4FTRA 4U79A 4BB4A 3OG7A 2OSCA 1BVSA 5FTMA 1YE9A 3L27A 2AYPA 4LMNA 2FYSA 4EONA 1IY2A 3GLFB 4BZOA 1A48A 5KMLA 1WMKA 2YCFA 1TR8A 1XBCA 3UQFA 1KV2A 5AR2A 2QONA 4TNBA 4DEIA 3RAKA 3OWLA 3HNGA 3IGGA 3VF8A 1G8JA 2WOTA 4AN3A 4XBUA 3RHKA 3KF4A 4U97A 4HVGA 1JAMA 1KWPA 3OHTA 4QMOA 3DK3A 5EYDA 1Q41A 5G1XA 3BPRA 3NEWA 2QOIA 3D14A 4O7NA 2UV2A 3TNHA 4QDEA 2LNHC 5AADA 3F3ZA 5IA5A 3BU6A 4XX9A 5IA2A 5AR3A 1GIJA 4FV8A 2UW4A 2B52A 1YXTA 3KXZA 3RNIA 1GVNA 4C4FA 3DKCA 4F4PA 1OL1A 4RWLA 3HV6A 5LCKA 4RF1A 4RWKA 1QUTA 4CNHA 3E8EA 1T3TA 3WF5A 4RGJA 3JR4A 4WSQA 4ZTHA 3R7IA 2QVSE 3R6XA 3ZMMA 2J4ZA 5CANA 4KUJA 3ORNA 3VKHA 3NUPA 5EHOA 2L6OA 3N51A 3NNWA 3QAUA 5BVOA 2W1CA 4PTGA 4CRSA 4FV2A 2Z2WA 5FTLA 4BCGA 5IWAM 5B2LA 1BL6A 4JI6M 3R8PA 4CGAA 3FZPA 4G6ZA 3LFBA 5CT0A 3PLAE 1UWJA 4JVGA 1R5LA 1YVJA 2L7HA 4BCPA 2O3PA 1IAJA 4CFXA 4L01A 3CGOA 4LRMA 2YABA 4EC9A 3TM0A 4JRNA 5KHXA 3KULB 2OWBA 3LFDA 3AKKA 5BMSA 3Q52A 5A4CA 4BZNA 3V76A 4UV0A 4G3FA 2W5AA 2R5TA 1ORYB 4D4VA 3KRRA 2C0TA 2C0OA 3RCDA 4QMNA 2X8EA 4JBOA 4LGDA 4D2SA 5FSWA 1XHAA 4YLKA 3IO7A 5AP6A 4QPAA 3GQ3A 3COMA 1OAIA 2YACA 1WBVA 3WYXA 1WXQA 4O2PA 2Y8OA 2VV9A 4MF1A 5KQDA 1F5QA 2CDZA 3HYHA 2DAMA 4M0DA 4X6RA 4Z6YA 4EH2A 5LWNA 4N0SA 5E1EA 1GIHA 3SQQA 4E5AX 2GHLA 2QLUA 3QA8A 4Y28F 3ILKA 2GHMA 4LF9M 5JSMA 2O64A 2Z3XA 3E46A 3O50A 3FRHA 2O5RA 4U41A 2J90A 3DFZA 4PQNA 3IDPA 3SG9A 3PTGA 4CT2A 4Z7HA 5I9ZA 4G4QA 3W18A 3GB2A 5AX9A 2YDIA 5DE2A 4DHFA 1OKWA 4EK4A 4LV5A 3WBLA 1TZDA 2XK7A 2XZUA 4Q5HA 4M9SA 3IGOA 3EQRA 1Z5MA 4MNEA 5EKNA 3DXNA 4DBNA 2RFSA 5GZ9A 4XRJA 4AOIA 1VR2A 5IUIA 4IQ6A 4R77A 4IW0A 1YWNA 5F95A 3GENA 3DA6A