4AZFA

Human dyrk2 in complex with leucettine l41
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
409
structure length
404
Chain Sequence
HHHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYRK2 DUAL-SPECIFICITY TYROSINE-PHOSPHORYLATION REGULATED KI
publication title Selectivity, Co-Crystal Structures and Neuroprotective Properties of Leucettines, a Family of Protein Kinase Inhibitors Derived from the Marine Sponge Alkaloid Leucettamine B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 404
sequence length 409
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4azfA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4azfA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4azfA02
4DGLC 3LFNA 2BFXA 4F65A 3F3ZA 4FVPA 2PMNX 1IR3A 2E9VA 3NVKI 4QYYA 4G6OA 4JX7A 1SZMA 2VU3A 1KOAA 4PMTA 3AG9A 3LFEA 3S95A 4PDOA 5LCJA 2OO8X 2XK3A 4R7HA 4FA2A 4ZTQA 5J5TA 2WQOA 4ANQA 2R3FA 2UVXA 2GSFA 4NL0A 2C6DA 5BUJA 3UMXA 3CTQA 4XG3A 3AC4A 1QPEA 3BE9A 3BGPA 3BIZA 2G1TA 4RVMA 3VHEA 2O64A 4H1JA 2YZLA 2WU7A 4BFMA 3MVMA 3VIDA 4HGLA 5CF5A 4NTSA 3F3VA 5CU3A 3SXRA 3V5JA 4FTJA 5AADA 5L2IA 4E7WA 2OIBA 3L8VA 4F0GA 3QX4A 1OPLA 5KBRA 2Z7QA 1H24A 5EQYA 4EZ7A 3ZZWA 2OF4A 2WTJA 3G90X 4QQTA 4DGGA 2R3KA 3E3BX 2XK8A 5FLFA 5L2TA 4DN5A 2BDJA 4BN1A 3UNJA 1UWJA 3A7JA 2XH5A 5M51A 1UU9A 4G1WA 2UW5A 3AMBA 5LVLA 3D14A 5IA1A 3BU3A 2XKFA 3HV4A 3RPOA 1ZY4A 4O0TA 2VO3A 4WA9A 2UW3A 1YXSA 4LQMA 3THBA 4EOIA 4IVCA 1Z5MA 4O6EA 1P5EA 5EKNA 3MA6A 4LM5A 4C3RA 1O6YA 4D0WA 2ITNA 4NIFB 4JG7A 3FL4A 5FP6A 4DEGA 4W9WA 5JGBA 2VTPA 3FPQA 2WIPA 2WTDA 4FKOA 2QURA 3MVLA 4GKHA 4BCHA 3KB7A 3QF9A 4Y85A 3ZRKA 1Q62A 1J1BA 4O0VA 3ALNA 4S31A 3E8NA 4BDKA 3N4VA 4KKGA 3RPVA 4BIEA 3QYZA 3FHRA 3TKHA 4UMRA 1NVRA 4TRLA 2XIRA 2C4GA 3TJDA 5AA8A 5ITAA 3R0TA 4ONAA 3COHA 4S2ZA 3UG2A 3VS5A 1Q41A 4FSZA 5I3OA 2HYYA 4FTLA 2CNVA 2UZWE 3EKKA 3PSBA 3MWUA 5JGAA 4OAVB 4OBOA 3LOKA 4YMJA 4PF4A 4BI0A 4PNKA 3CQUA 3R7IA 3DAEA 4C3FA 2QR7A 2FSMX 3WIKA 2CGXA 4AF3A 2WMQA 5EW8A 3PVGA 3CSVA 3GBZA 3KFAA 3PA4A 4FUXA 1ZMWA 1XO2B 4FNWA 4PL3A 3KN6A 5DVRA 3ATTA 3QZGA 3O8TA 5B7VA 4EK5A 3IW4A 3RZBA 3V3VA 4BF2A 2A2AA 4H1MA 3CTJA 4QPSA 4U81A 3QBNA 1VYZA 4DAWA 4WBBB 4F0IA 3O2MA 4XLIA 3PZHA 5CU0A 4BIBA 3DBCA 3ACKA 5EHYA 5FQDC 3FMNA 4FZAB 4Q9SA 4U3YA 3F3WA 5CEMA 2I6LA 3BYMA 3G6GA 2QO7A 4MXYA 2XMYA 2QU6A 4QNAA 1OM1A 3UC4A 5DMZA 3F82A 4RX8A 3LFAA 3GB2A 4R1YA 1PHKA 4HYIA 4FSUA 4FX3A 4GT4A 3JY0A 2J7TA 1YW2A 4OR5A 2ZVAA 3H30A 4L8MA 3ZBXA 4Y46A 3BBTB 3D9VA 3LCTA 3VJOA 3IG7A 4Y72A 2UZLA 4WUNA 5L4QA 3G0EA 3ODZX 1W8CA 5BVKA 3RK9A 3RPSA 3II5A 3KU2A 4XOZA 1Q97A 3UODA 3SQQA 5KZIA 4AX8A 1PYEA 4IWQA 4USEA 2R7IA 4O7TA 4E5WA 3HMNA 5T68A 3C4ZA 1NY3A 1L8TA 2YZAA 2YM5A 5K3YA 5KZ0A 3EQDA 4FYNA 3VUMA 3ZEWA 5JK3A 1EH4A 1H27A 3VS1A 4F63A 3PJ8A 2QOFA 4CMOA 3O50A 5FXSA 1OKVA 2QLQA 3BYUA 3P08A 5HI2A 4DTAA 3GXLA 1JNKA 2P3GX 2FB8A 2ERKA 1FOTA 3Q6UA 4ERWA 2ZB0A 2F7ZE 5F95A 5FWKK 4OTRA 4L3JA 4TWOA 3R01A 4EK6A 4LFIA 5KUPA 2O5KA 4RT7A 1K2PA 3CY3A 2GMXA 3S3IA 4X6QC 3CS9A 4ZOGA 3WF6A 3HA8A 3OC1A 2IZSA 5CSHA 5EDPA 3ZYAA 5IQGA 2X9EA 4CYIA 3OP5A 4EUTA 2C6TA 3QYWA 3T3VA 1SYKA 4EH9A 4R3PA 1PMNA 2WMUA 4H58A 4CSVA 3VS0A 4DTBA 3QRJA 1MP8A 1YI3A 3R7YA 5CXZA 3DCVA 4FIJA 3I7BA 3LW0A 3QQJA 4HZRA 4AFEA 2WMBA 3NUXA 5DR9A 1CKJA 4G5PA 5J9ZA 3GT8A 3PLSA 1FMOE 5LMAA 4PL4A 5I9YA 5M55A 4NEUA 3WF7A 1I09A 3DFAA 2CMWA 2YCQA 3E8CA 4FTKA 4MWIA 5I9XA 1H25A 2BAQA 2R4BA 3DJ7A 5D7VA 4TYEA 1B39A 5A6OA 4BBFA 3G9LX 1H1RA 4KUJA 4O84A 2C1BA 2J0IA 4U5JA 1WAKA 2QOHA 5FGKA 1JSUA 2OXXA 2W4JA 2BUJA 3UQGA 3NYOA 2XKCA 2X6EA 2GFSA 3FI8A 4YUQA 1XBAA 5M44A 3OY3A 4U42A 3A62A 3BELA 5H8BA 3V6SA 2X0GA 4PPBA 3RINA 3I81A 2CHLA 3ET7A 4ANLA 3MFUA 2PE0A 3QTXA 4I6FA 4ACCA 4DG0E 4HVHA 1H0VA 3IGGA 4XV1A 4Y8DA 3VUKA 4GH2A 2ZM4A 4GEOA 4ID7A 4GV1A 3RZFA 4MXOA 3FQEA 5BUEA 2BILB 2X4FA 3QKMA 4J95A 3QTZA 5CEQA 3AGMA 5IZFA 4I22A 5GJDA 1M7QA 3F3TA 2OJ9A 4O91A 5DEYA 4IX6A 2AC3A 3DXPA 3AC3A 3ZO2A 4CV8A 5F1ZA 3O8UA 3V01A 4O7VA 1GZKA 3FXWA 3BU6A 5C03A 3QZHA 4I6QA 2IW8A 3MA3A 4RGJA 4ASDA 3VUHA 4L46A 1P4FA 2PL0A 2XRUA 3WE4A 3MSSA 2VNYA 4Q9ZA 3AXWA 4FBXA 4MXAA 4KKHA 4FTNA 5TT7A 5JFXA 2WELA 3QU0A 3NUUA 4K8AA 3W8QA 4WSYA 4DCAA 1RE8A 3UO5A 5AR2A 3ZC6A 4G6NA 3K2LA 1REJA 4I92A 2WOUA 2CKPA 4KBKA 4D5KA 1M14A 2UV2A 4CRSA 4BWKA 1WCCA 2BFYA 5HTBA 3ORZA 3P7BA 2X39A 5J7BA 3UNKA 2QR8A 3S2PA 5HBJA 4GUEA 5M56A 4ANNA 3PIXA 4PNIA 4ASZA 3D5UA 4M12A 4UX9A 3QQFA 4G17A 2UZTA 2ZV2A 1YWRA 2IWIA 2UW4A 4K6ZA 4AGWA 4MF1A 5EH0A 3VS4A 3FHIA 1PXPA 4YLLA 4YZ9A 5ANGA 2IG7A 1Y6AA 3MPMA 4L9IA 4D4RA 1U54B 1KSWA 2HZNA 3P79A 2ZAZA 2G2FA 5HTCA 4LL0A 4AOIA 3T9TA 3TZ7A 3P0MA 3FXXA 3HL7A 2X8DA 5E91A 1CSNA 2RG6A 2XNNA 2VWXA 3CC6A 4G9CA 2XK4A 3OOMA 4AGCA 4ZY5A 2WD1A 2YABA 3R1SA 4FTTA 2WU6A 4BCQA 4BVUA 4L68A 3QD4A 3M1SA 4CGAA 5IQFA 4C4JA 5LJJA 4FT9A 4MBIA 4EHEA 5BQ0A 4PP9A 4JR3A 3OUNB 4N4SA 4JRNA 3W2PA 1SM2A 3I79A 2H96A 2W9FB 4CFMA 3ULZA 4ZZOA 3DK7A 3LXPA 1A48A 4RWJA 4KBCA 3AMAA 3GU8A 2WMAA 2YM4A 4CFVA 1XQZA 4JG6A 1BMKA 1M2RA 3RHKA 4DHFA 3L9MA 4IFCA 1G3NA 4L45A 1MUOA 5DT4A 1Q3DA 3H0ZA 4P5QA 4A4LA 5M07A 4IX4A 4QTDA 4LMNA 1SNXA 5EYCA 4B8LA 1OBDA 3FYJX 1DS5A 4LG4A 4QP8A 4X3JA 3NNVA 5AX9A 4AA0A 4EKKA 4DFUA 1VEBA 3H9OA 2QD9A 2Y9QA 3F5XA 4FOCA 4USFA 4ZMEA 3PY0A 5HGIA 3TIZA 2DUVA 3T8OA 4L7SA 2YM7A 3BCEA 1ND4A 4C8BA 3P86A 3SX9A 3KY2A 1LP4A 5GHVA 4BICA 3R7VA 3R00A 1KUTA 3FMEA 2X7GA 4RZWA 4X2FA 3TV6A 2XIYA 3QQHA 4DEBA 3QGYA 3R2BA 4JVGA 1P2AA 2PUUA 4FUYA 1LEWA 3NAYA 4FSWA 1JAMA 5T6KA 4JXFA 2CKOA 3ENHA 3G9NA 4BDEA 5E8XA 4IJ9A 3DA6A 3WF5A 4FK6A 4EH3A 4CQGA 4EOQA 5HU3A 3UP2A 4MQ1A 3NYVA 4K9YA 4KA3A 2J4ZA 2QG5A 4M13A 1OUKA 1X8BA 3Q60A 3ZFXA 3ZSGA 1QL6A 2OF2A 4O81A 2W5BA 4X21A 3R7UA 2C3KA 4XRJA 3CBLA 3ZZEA 2F7XE 4J8MA 4HYUA 5M53A 3FZOA 2YHVA 4AE6A 3FJQE 2CLXA 2A27A 4C2VA 4I5MA 4CCUA 3CXWA 5M4FA 4FTAA 3FDNA 1H1WA 1IASA 3EQIA 3G5DA 3LHJA 3HECA 3TEIA 4BR3A 2C6LA 3C4WA 3FMKA 4EOLA 4UEUA 5GINE 3R21A 3RNYA 5KMOA 1NW1A 2PMOX 4NW5A 4K1BA 3JR1A 5DN3A 3W33A 4C35A 1PXKA 3KRXA 4MD7E 4YZDA 4ZTNA 4R78A 3PA5A 4RIWA 5H9BA 2YIQA 4EJNA 3KREA 1PXMA 1V0BA 5E1SA 4EKLA 3R22A 4ZJVA 2WPAA 3OUKA 1QPJA 2W4KA 2IZUA 4FKLA 5LMKC 5FRIA 2FSTX 4HNIA 4RIXB 3V8TA 3C7QA 2J0KA 3ENMA 3UIXA 3UG1A 1UV5A 3NW7A 5DT0A 4AN2A 3FMDA 4LOPA 5A6NA 1S9JA 3LCOA 2ZMDA 3IK3A 3UNZA 4DINA 3GGFA 1JQHA 3MBLA 3VWAA 4C3PA 5IH6A 3QFVA 3RWPA 2R3HA 5IA5A 3WE8A 2VD5A 3OTUA 4EORA 5AR3A 5HX8A 4FV2A 2J51A 4J97A 3AT3A 4ACGA 4ZIMA 2HZ4A 3C4FA 4U9AA 2OJIA 3R73A 3RAWA 4X2KA 3NPCA 1XBBA 2QU5A 3GQIA 4R77A 3QQLA 5KMIA 5M57A 3U6HA 4JBQA 4UWBA 3HV5A 4L42A 4YTCA 3O0GA 3ZSIA 3OEFX 1Y8GA 5HVYA 4F9AA 4ZY6A 3HGKA 2YEXA 2P2IA 4U97A 4C57A 4JDJA 3B2WA 5HORA 5HLWA 5C9CA 3R1QA 2O2UA 4TNBA 4YC3A 4BY9E 1XBCA 5EYMA 4ZLZA 2OU7A 3MIYA 1G8SA 2ZV9A 4IAFA 4XEYA 4K0YA 1ZZLA 3TNQB 2XNPA 4LYNA 1U46A 2UZEA 3FYKX 3AC2A 4H3BA 4GJ2A 3ZTXA 3Q9ZA 4GVJA 3TL8A 2ZDTA 5AUYA 1RJBA 3DBQA 4AT4A 2XCHA 4W4WA 3SLSA 3HRFA 3TZ8A 4F99A 3R9NA 4ZZMA 4AU8A 2YJSA 4CNHA 1E1VA 2DQ7X 4BWPA 4ZSJA 3OBGA 4LGDA 3KMMA 2BMCA 4E4MA 2O3PA 2XM9A 1E9HA 4MD9E 4HVSA 1YHVA 1DAYA 2PHKA 4EOKA 4YU2A 4MXXA 3R1NA 3OCGA 4GK4A 1Q8TA 1ZYJA 1J3HA 1TKIA 2QC6A 2YM3A 3Q5IA 3T3UA 3KGAA 3FXZA 3R7EA 5ANDA 5ICPA 3P4KA 2WTVA 3PG3A 2Y4PA 5C4LA 1F5QA 1H8FA 2VGPA 3CD8A 5LMKA 1Q99A 3VS2A 2ZM3A 4H39A 1GIHA 3OVVA 3MTFA 3TIYA 3ZSHA 3QCQA 1OIYA 2IVTA 2W1ZA 3GEQA 3P78A 5DFPA 5HCXA 4FV6A 4XMOA 2HW7A 2X8EA 4FSNA 3OTVA 2QODA 2W5HA 1PXOA 3KEXA 3LM0A 4RZVA 3HUCA 4BDFA 4A9SA 2W17A 4BBEA 5FD2A 3GVUA 5D1JA 5EOBA 4CCBA 4ZY4A 4TYHB 1YWNA 2QKRA 3I5NA 5KBQA 3QUDA 1YOJA 3LCDA 4C33A 3D2IA 3LLTA 4TXCA 2CGUA 2WTKC 2I1MA 5ANJA 3VRYA 4MNFA 3PP0A 4NKAA 3R9DA 3TT0A 4YHTA 5JZNA 2OZOA 3QZIA 5CU6A 3RJCA 3V51A 4AE9A 2HAKA 1NXKA 3RCDA 3F61A 4O0RA 4IB0A 5EI2A 3HZTA 4BTMA 4C62A 2HZ0A 5ETIA 3DTWA 4X3FC 2ONLC 1OPJA 2YITA 2XYNA 4FEUA 2JEDA 4BI1A 5DYJA 2R3RA 3K3IA 4IJPA 5H3QA 3Q53A 3E8EA 3UGCA 3JVRA 2PUNA 3JVSA 4EHZA 3AC5A 2VGOA 4PX6A 2JDSA 4AN3A 5CAOA 5I9UA 5L8JA 2RIOA 3K54A 4XUFA 2YAAA 4IZAA 4O2PA 2C5YA 3UYSA 5A4CA 3QA0A 4ITHA 2YERA 3ORNA 4YHFA 4AUAA 5DE2A 5CS6A 4FT0A 4JG8A 5FBNC 5CT7A 4DGMA 5LWNA 1XH8A 2YIXA 2C69A 1YDSE 2YDKA 2HZIA 3QRTA 5BYZA 3EQRA 5CALA 3OROA 5I9WA 2GU8A 3KMUA 4C61A 4FKGA 1Z57A 2HWOA 4RSSA 4EUUA 4GFGA 3NW6A 3ZLWA 2PVLA 3COMA 4H36A 1JVPP 4F6SA 4ZS4A 5EKOA 4JDHA 3GC0A 1PF8A 4YZMA 5A14A 4C4FA 2J2IB 4ANSA 5AJQA 4MYGA 3MS9A 5CI7A 3EKNA 4ITJA 5JFVA 2QO2A 2VX1A 1WBPA 3R71A 5J87A 3N9XA 5K4JA 3CPCA 4KWPA 3VC4A 2VNWA 3M2WA 2OJFE 2BRMA 4JRVA 2BZIB 5CSXA 3Q4TA 1OB3A 5GZ9A 2PVJA 4EONA 2CPKE 5LVMA 4NU1A 4QMSA 4YP8A 2BALA 4FKUA 4BHZA 2GQGA 4FKSA 1V0PA 3EN4A 4I94A 4RJ7A 5DRBA 5I9VA 2ITUA 1KE8A 3ZOSA 3A4PA 5CANA 1NT2A 4XG9A 4BI2A 1U5RA 4MXZA 4GU6A 4W9XA 4EHVA 4CKIA 4FTRA 4IAYA 3HP5A 3F6XA 4FI1A 5HE1A 2OIQA 2O65A 2GNLA 3HMPA 3F88A 3MY0A 4Z16A 3ZCLA 2PU8A 3ODYX 2VO6A 4MK0A 4FODA 3LFCA 3GFWA 2Y0AA 4IXPA 4JR7A 4S32A 4BDCA 4UXLA 2EUFB 5J8IA 4F4PA 3NNXA 3L9LA 1ZYSA 3FC2A 1YOMA 2JAVA 3MVHA 4X3FA 4JIKA 3TJCA 1IAHA 5EDQA 4GG7A 3MESA 1H07A 4XHKB 2QCSA 2ERZE 2UZDA 3E62A 4JIAA 5HNGA 2XA4A 5AUTA 2R3MA 3EFJA 4R6VA 5BYYA 4HPUE 3F2RA 3BLHA 3P23A 4YPSA 4FVRA 4LRJA 3SC1A 5DHJA 3IW7A 4JDKA 3TCPA 3UOKA 4S30A 4NM3A 3C9WA 4E4LA 2OGVA 1PKGA 1RW8A 3F69A 4RC3A 1SVGA 3SV0A 2FA2A 3BQRA 4AW5A 4AZWA 4ZTMA 2JDRA 2YFXA 5E9EA 4C02A 3KQ7A 2UW7A 3PJ2A 4FV1A 4CZTA 3FBVA 2QOIA 4G3DA 3DB8A 5F94A 4G3FA 4CTCA 3DTCA 3ZBFA 3GC7A 1CKIA 1KE6A 3DY7A 4RQVA 2YM6A 3TNWA 3QA8A 3DNEA 2E9UA 3O8PA 4RG0A 4YJTA 5LXMA 3SVVA 3QTQA 3OWKA 2UVYA 4QQ5A 2BKZA 2C6IA 4TNDA 3TTIA 4QMQA 2UZOA 4RX7A 1IAJA 1PMVA 3UVRA 4QP7A 4WIHA 1VR2A 3KVXA 2V22A 5FM3A 1M17A 4S33A 5C8MA 4EHGA 5EQEA 2UVZA 4EJ7A 1TQMA 3A2CA 4L3LA 3WF8A 3C51A 3O17A 4QP2A 4YJVA 4ANOA 5HQ0A 3KRJA 4UB7A 1KOBA 2WOTA 2AUHA 2F7EE 3DT1A 3UDBA 4DFYA 3F5PA 4IDVA 4GYGA 3LFFA 5C8KA 1SVEA 2VWWA 2VTLA 3FUPA 3DB6A 4JQ7A 1MRYA 4EC9A 3O71A 2H9VA 4GRBA 3OCTA 3Q4UA 4L00A 4BCJA 4KSQA 3ZM9A 5EOLA 4I24A 5KMLA 3L1SA 2JKOA 4GSBA 5BVDA 4K77A 4XLVA 2QNJA 4AW0A 2YLFA 3C0IA 2BRNA 3D5WA 3I6WA 3LFQA 5CNOA 5AR5A 5EW9A 4Y83A 3JXWA 4K11A 4UWYA 2H34A 4BKZA 4G3EA 5AFVA 2BROA 3MFTA 1JSVA 4HGSA 4KB8A 1BYGA 2IVSA 1Q8ZA 2H6DA 4EOJA 1OL5A 4F6WA 4NYEA 2VTNA 1FBNA 4R3RA 4EH2A 3CP9A 4FIFA 4PY1A 5L6WL 4R1VA 1ATPE 4MBLA 2A4LA 4PTGA 5L2WA 2VWZA 1FVTA 1Y6BA 1BX6A 3U55A 3R63A 3NNUA 2NP8A 1XWSA 2IN6A 3F5UA 4U43A 4TYIA 3QRKA 4FYOA 3UYTA 4M15A 4PMSA 3Q2JA 2YA9A 2HW6A 2ITZA 3HMOA 5AWMA 5H2UA 2RG5A 2VWUA 4AA5A 2XNGA 2SRCA 4D1XA 5F9EA 3ERKA 4QP3A 3M11A 4WBOA 3U9NA 3OHTA 1R78A 3PXFA 2V5QA 4RA5A 5JRSA 4EK8A 5HCYA 4GFMA 4O96A 2P55A 5HO7A 3UZTA 2W1GA 3H10A 2RFNA 5CVHA 5H8GA 4EEVA 1OZ1A 3IO7A 3GU7A 1L3RE 4LV5A 3RGFA 4O7RA 3NR9A 4FL2A 2GNIA 3PVUA 2IW9A 3MH2A 3G2FA 4WUAA 3D7ZA 4XJ0A 4RX5A 4K2RA 1LEZA 3E63A 3WYYA 4QMYA 3Q4CA 2ZOQA 5TO8A 4OTQA 4DBXA 3ZO4A 1LPUA 4O6LA 4I21A 3CKXA 4UBAA 1B6CB 3AOXA 3BHUA 3E7OA 3DJ5A 3MGYA 5LQFA 3KXGA 4FTOA 3FY2A 3GC8A 4XV2A 3UO6A 3PIZA 3BGZA 5M4UA 2BAJA 5EW3A 2WQEA 3TWJA 1R3CA 4U8ZA 3KULA 4RWKA 3QAME 3WBLA 4BCOA 2JKMA 4FL3A 5C8NA 3FLNC 4ASXA 1I44A 4ACMA 4CVAA 3ROCA 2OLCA 4NM0A 3QTIA 2J5EA 2ZYBA 4FTCA 3S4QA 5FEEA 4CXAA 3PLAE 2PTKA 4FICA 4FEXA 4PDPA 4F70A 3EWHA 3BEGA 4F9YA 2R3LA 3CR0A 4FZ7A 5D12A 2XK9A 5AAEA 4QMMA 4U6RA 1R39A 5HNIX 4ZLYA 5L3AA 4A4XA 3E93A 4L44A 4P5ZA 1YXXA 2WMSA 4O38A 4OTPA 4RIOA 4RPVA 5CX9A 3VBVA 3V8WA 5K0XA 3G6HA 1YXTA 4IDTA 4IWPA 1LUFA 3FLZA 1SNUA 4O21A 4PUZA 4RLKA 3R8PA 4DLIA 5IQBA 3WI6A 2FVDA 5EM6A 3UZPA 3JPVA 4BDHA 3CLYA 2C0IA 2XZSA 3BKBA 1E1XA 5A4QA 5FTQA 3OEZA 3ZFMA 4FKWA 1YVJA 2Q0NA 5FTGA 5IQDA 3LFDA 3P9JA 2JITA 3W32A 1OITA 4FSYA 4I5CA 3EH9A 4BGGA 5HIDA 3A7GA 4YBKA 3E7VA 4O0WA 4I20A 2VAGA 3K3JA 2ITWA 3MPAA 2G9XA 2X2KA 2R3PA 2YN8A 5LVPA 3SA0A 4FG8A 2W5AA 3DQWA 4D58A 4L3PA 5HNBA 4AP7A 3TI1A 3FI4A 3QXOA 5HVKA 3HX4A 2R0UA 3AC1A 2A19B 3VUTA 2C6OA 5CAVA 5FXRA 3TUCA 3PPZA 2W1FA 3L8XA 3NSZA 3KVWA 5LWMA 3EQFA 5AR7A 3OF0A 4AOJA 4DH3A 1HCLA 5CXHA 4UMUA 3EFLA 5KMKA 3BI6A 3PXYA 5E8ZA 3WOWA 1JLUE 2VN9A 4QP1A 4C36A 4IBMA 3VQHA 2B0QA 4QP4A 3MYGA 5CWZA 5FP5A 3PYYA 4M69B 5ETFA 3FLSA 2UW6A 4ZJIA 4DYMA 5IF1A 5IEVA 4N57A 4CT2A 4LV8A 4HZSA 1APME 4G3GA 2BDFA 2Y6OA 4WRSA 3GU6A 4PRJA 5AIKA 3F7WA 2XKDA 2WMRA 3OS3A 5EDRA 2E2BA 4AGUA 4D1SA 3EFKA 2CDZA 4FT7A 3DU8A 3QTUA 2GNGA 4WSQA 5FEQA 4MX9A 3B2TA 3ZHPC 5L8KA 5M08A 3R8ZA 4PDSA 5D41A 1WFCA 4AWIA 4B9DA 3ID6C 3EZVA 2QO9A 3I1AA 2W7XA 4LGHA 3DFCB 4UWCA 4XV9A 5KX8A 4K18A 2Z2WA 1BL6A 4UYAA 2FYSA 3ZFYA 3ZONA 2OZAA 4YJSA 1DAWA 2QONA 3ORXA 3EN5A 4TWNA 3KK8A 4XX9A 5AV0A 4QMNA 3GI3A 3AD6A 4TN6A 4BGQA 4U0IA 4DG3E 1J1CA 3KXNA 4FT5A 2HCKA 3COKA 4NJDA 3GENA 1YI6A 3A8WA 3DKCA 3HLLA 3PFQA 3QQKA 4UMTA 4F09A 4AXAA 4EQMA 5DIAA 4BZNA 3CY2A 1OUYA 3C4CA 3M42A 3UP7A 4I5PA 4UMQA 3QL8A 2VTIA 3ATSA 2Y6MA 3O96A 4UY9A 4RJ6A 5IG1A 2OI4X 2BRHA 3RTPA 4FEWA 3L8PA 5C1QB 1M7NA 2C30A 2BRBA 5AV1A 1XHAA 5IMEA 4XG4A 5HCZA 5AP6A 1Z9XA 4CLIA 3E5AA 4IMYA 1QCFA 1Y91A 3MB6A 3ZDIA 2JGZA 4D2PA 2CLQA 1YWVA 4J1RA 4W8DA 3FWQA 4HCTA 4F6UA 2NRUA 2PVFA 3UO4A 3RCJA 2JIVA 4S34A 3C4XA 3RNIA 4YJOA 4DH7A 4WG3A 5EM5A 4AZEA 5BNJA 3EB0A 3FC1X 1UNHA 5AM6A 4FEVA 2Q83A 4ALWA 4OTIA 3NZ0A 1FGKA 5K5NA 4RFYA 2PPQA 1T45A 5ANOA 3PG1A 2P0CA 4GIHA 3PP1A 4I4FA 4IW0A 3UTOA 2X2MA 1ZOHA 5GIPE 4Y73A 4FV5A 5TKDA 4BDGA 1IRKA 2VTOA 4QMZA 5HESA 5IQIA 4JQEA 4KABA 3AQVA 3DBFA 3R9OA 3UQCA 3KA0A 2C5VA 5LARA 2YCSA 4M97A 4E6AA 3OBJA 3GU4A 4Z3VA 3VBXA 3DQXA 5IUGA 4W4XA 1Q8WA 2F2CB 4TW9A 1U54A 3RI1A 4PV0A 1G5SA 5IISA 1V0OA 4AFJA 4RFMA 3IQ7A 3FSFA 2EWAA 3PIYA 3GU5A 2QKWB 3BRBA 3OCSA 4BTFA 3TKIA 2XNEA 2JIIA 3R1YA 4BWXA 5L6PA 1SVHA 5HO6A 4EWHA 4B99A 1WBSA 4FR4A 4TKSA 5EK7A 3ZLSA 5LMBA 3S00A 3MTLA 3DKOA 3TXOA 4BB4A 2XCKA 4OTFA 3BX5A 3SDJA 5ACBC 1PJKA 1FPUA 2VTQA 3U8WA 4WD5A 3A4OX 3A61A 4GKIA 3UIMA 5A4EA 4LI5A 3WIGA 2J0JA 4WOVA 2PULA 4KKEA 3PVBA 4E8AA 3F66A 3EN7A 5I9ZA 2ZB1A 4RIYA 4GVAA 4J98A 3FKOA 4CKRA 4FL1A 2PZPA 4X0MA 3IW5A 5HE2A 2XNOA 3QHWA 3EJ1A 4GCJA 1A9UA 5HLNA 2R3QA 4OTDA 5AP2A 1ZAOA 5KMJA 2JD5A 4QYHA 5JN2A 4I5HA 4ACHA 4CFXA 2AYPA 3D5XA 4C37A 5AA9A 5I4NA 2GHLA 4PQNA 4EQCA 2DS1A 4RBLA 3Q9YA 4AW2A 2RL5A 5K0KA 5HE0A 2OXDA 2W9ZB 5DR6A 5JKGA 4Q5HA 3CKWA 3LXNA 5CNNA 4A06A 1CM8A 1REKA 2PVKA 2PVHA 2R3GA 4O7NA 2HENA 1XH5A 4HCUA 5CEIA 1OVEA 3UE4A 4V0GA 3HAVA 2WTIA 3DPKA 5FDPA 4BCIA 4L67A 4BKJA 4ZSAA 5I5ZA 3ZDUA 4XYFA 2GHMA 2PWLA 3DZQA 3PY3A 4GK2A 4RX9A 4YLJA 4YHJA 2KTYA 1BKXA 1PY5A 1VZOA 1YKRA 3DXNA 3V6RA 3F9NA 2OW3A 3HRBA 4FIIA 3ORMA 1PXNA 4L53A 4G9RA 2PSQA 5JZJA 1J7IA 4F7NA 5J1VA 3CQEA 2F49A 4JS8A 2ITXA 2YAKA 3GCQA 3IOKA 4MTAA 2VTSA 4FIGA 2Y7JA 3VNTA 3O51A 2BVAA 4NFNA 4DFZE 3KCFA 4FKPA 5E92A 3VS7A 5IEYA 1Y8YA 2VWBA 4ZSGA 2PYWA 2XJ1A 2GTNA 3KXHA 2YCRA 1UU3A 4C4HA 3FMJA 2WEVA 2XBJA 4D2VA 1QPCA 1J7UA 2ETRA 4F7SA 3TM0A 3A99A 2HY81 3F7ZA 4NM5A 4D55A 3OD6X 3DJ6A 4IB5A 4F9CA 1MRUA 1XH7A 3PRIA 4LRKA 4RIWB 2QVSE 3EQBA 4RWLA 5AV2A 5HO8A 4GT3A 3DAJA 3PPJA 4D4SA 4P7EA 4GIIA 2R2PA 1KWPA 4YJNA 4YJPA 4ZTLA 2CNUA 5E8TA 2CN8A 3E87A 5IA4A 3NUYA 4QO9A 3OT8A 3QLGA 3LCKA 2PY3A 4C34A 3KKVA 4MKCA 5AUZA 2NNWB 2C6EA 3LQ8A 3H9FA 3RM6A 2ZM1A 3W10A 3UPXA 4CRLA 5GZ8A 2RSVA 2E9PA 3ORKA 3PA3A 4IH8A 4IVAA 3KC3A 5HICA 4DTKA 4CYJA 5IA0A 3NLBA 3W18A 2PUPA 4LGGA 3L9PA 5FEDA 2V7OA 2G15A 2G01A 4KAOA 4FT3A 1SMHA 4NJ3A 4Q2AA 3R04A 1GOLA 4IACA 1JBPE 4FV8A 4EBWA 3F3UA 4FZFB 4ZTRA 2E9OA 3E3PA 4F0FA 1HCKA 4D2TA 1O9UA 4MVFA 4O0SA 4E73A 3P5KA 4FSMA 3V5PA 3QHRA 4AN9A 2JIUA 4HCVA 2O63A 3FLWA 1F0QA 3EMGA 4IZYA 2R3JA 4M0ZA 3QC9A 5GNKA 3V8SA 4C7TA 5DOSA 4EYJA 5AIRA 4AZSA 1PXJA 2IPXA 1O6KA 1QMZA 4JQ8A 4D28A 5M4CA 3SRVA 4YTFA 3FI3A 4RRVA 4LL5A 3Q3BA 4TT7A 5EHOA 4F1MA 2VTJA 1AD5A 2E9NA 3HNGA 3MH3A 3LVPA 3P1AA 4U7ZA 4YO4A 1BLXA 4GS6A 5JH6A 1ZLTA 1H00A 4MBJA 4FOBA 4IX3A 4D9UA 1UNLA 2EXEA 1KV1A 4CG9A 4BL1A 3CEKA 3FPMA 4Y5QA 2JFLA 2PVMA 2QOLA 5F4NA 5AR4A 1BUHA 4EZ3A 1GZ8A 2GHGA 5CSPA 1T46A 2QOBA 3C5UA 5A4LA 4UALA 5CEPA 4YBJA 3U4WA 3D94A 1JSTA 2BCJA 4PP7A 2V55A 5K9IA 1UVRA 3UZRA 3VF9A 5L2SA 1DI9A 3PXKA 2XNBA 5CYIA 4DC2A 5IH4A 2ITOA 4NWMA 3I7CA 3ORTA 3Q52A 4TPTA 2Z60A 1OPKA 2IZRA 5J7HA 5JFSA 2B9IA 1Q4LA 5DH3A 2DWBA 5DT3A 2WO6A 4DGOA 5HZNA 3U6JA 3FY0A 3QALE 4LOQA 2JKQA 3MB7A 4CFNA 4I6BA 4LUEA 3QD0A 3BEAA 4KNBA 4M14A 3VO3A 3FV8A 4BCNA 3VBYA 4XH6A 4NT4A 2Z7RA 5CVFA 4F08A 5AUUA 4XBUA 5DNRA 1NVSA 4BDAA 2EXCX 2UW0A 4QMVA 4LRMA 4FG9A 4YZBA 3EYGA 4GL9A 4IFGA 2BKKA 3PTGA 3G0FA 3HMIA 4IX5A 4XS2A 1YQJA 4YLKA 2B54A 3ELJA 3HYHA 1W84A 4IC8A 2Y4IC 5LVNA 3ZUUA 4JLCA 2XYUA 3B8RA 3PWDA 4L6QA 5HIBA 4U80A 4J71A 4APPA 3QC4A 2ZV8A 4YC6A 3CD3A 3V5TA 4WG5A 3IW8A 4BTJA 5C4KA 4YPDA 3U6IA 4I1ZA 4R8QA 3OXZA 3BPRA 3R28A 2QOCA 2W06A 3R7OA 3ZO3A 2G2IA 2GQRA 2EB3A 2GNJA 1J7LA 4I0TA 4QQJA 4RWIA 2OJGA 3GOKA 4JBVA 1JPAA 2IVUA 3RAIA 2W1EA 4YC8A 3RVGA 5CEOA 1UU8A 4IAIA 3PSDA 4C38A 1K3AA 2B4SB 2WNTA 3CGFA 4JT3A 4D9TA 3LXLA 3QCYA 5AUVA 3TV4A 4O7ZA 4YZCA 4NM7A 2FO0A 3ZUTA 4EOOA 1KE7A 2CN5A 4IIRA 3H9RA 4KSPA 4TL0A 2B1PA 1XH4A 2X8IA 4RLLA 2IW6A 1LR4A 3CPBA 4M84A 4FF8A 2I0YA 5ETAA 4XNEA 4U45A 4XRLA 4WNPA 4F9BA 5IDNA 3TDWA 3REPA 4DCEA 5AV4A 3POOA 5BPYA 2WQMA 1WBTA 2Q0BA 3LIJA 3LCSA 3KXZA 2C6KA 2C0TA 3U87A 4AQCA 3RHXA 5M4IA 5BMSA 5ACKA 4L01A 3SAYA 2RGPA 2XF0A 4EH5A 4O27B 4JI9A 3HMMA 4M66A 2BIKB 3RPRA 3GCUA 1H4LA 5CY3A 3TNIA 5ANEA 5HOAA 3WILA 3ZS5A 4B7TA 4UV0A 4EZ5A 3LMIA 2J50A 5BYLA 1M2PA 4IM0A 2IVVA 1BI8A 1Q8YA 4DFXE 2X4ZA 1FVRA 4B4LA 3KF7A 4NW6A 2CGWA 2LAVA 3EQGA 4DFNA 1OMWA 3Q9WA 4YSMA 1H26A 1IA8A 2X7OA 2C3LA 4EK3A 4CKJA 4E6QA 2XVDA 4O7YA 3NGAA 4JBOA 3LMGA 3FLYA 4M7IA 4HOKA 2Z8CA 4MHAA 5HX6A 2XK6A 3VS6A 3DAKA 4FKIA 4HJOA 4ZK5A 3KK9A 4Z55A 3FI2A 2J6MA 4O7SA 2W05A 3FAAA 2X2LA 4FNXA 4WRGA 3TUDA 2JDVA 4Y95A 5HD4A 1F3MC 3PY1A 3LLAA 1OL2A 2ESMA 2HELA 3NEWA 4MNEA 2XKEA 3NWWA 5EYDA 3LE6A 2GTMA 2W1DA 3I0QA 4QYEA 2VWVA 4NUSA 4KIKA 4CZUA 2WTKB 3QKLA 4YURA 2FGIA 3ALOA 4FV3A 2P33A 4OBPA 3BYOA 4IWOA 4ZS0A 1UU7A 1WMKA 5DEWA 2ITVA 4Z9LA 1YDTE 1K9AA 4MH7A 3IGOA 3MY5A 2BHEA 2BAKA 3MW1A 2GS6A 3OZ6A 4O0YA 5KCVA 4YO6A 3DLSA 2GFCA 3ANQA 4X3FB 4FNYA 4DGNA 4M8TA 4MQ2A 1ZMUA 3HEGA 2HY0A 3Q5ZA 4DEAA 4APCA 1U59A 3UQFA 2FSOX 5CLPA 2VO0A 2Z02A 3HA6A 5E1EA 3C5IA 1OIQA 4DEHA 3DS6A 3FZ1A 4FTMA 2C3JA 1Q8UA 2YIRA 2C0OA 4JNWA 3BLQA 4EH8A 2J0MB 4GJ3A 4AT5A 1YI4A 5JQ5A 3DKGA 5IUHA 3KRWA 3HP2A 5LVOA 4YZNA 3CIKA 1OL1A 2OFVA 4QOXA 4R3CA 3F2AA 3Q9XA 5E8SA 4RA4A 4A9UA 3D7TA 5TE0A 4GUBA 1UNGA 3W2SA 3NAXA 4OBQA 5ANIA 3SOAA 2PVNA 2F4JA 2ZMCA 3HV3A 5DLSA 2VTHA 1M52A 4IQ6A 4ARKA 4BIDA 3NX8A 4N6ZA 5CU4A 4X7QA 3ZRLA 4QMXA 3AMYA 2YM8A 3NS9A 5J9YA 2WMVA 3G51A 3TNPC 3POZA 3LM5A 4FTQA 4YJUA 4FNZA 3UC3A 4WT6A 3K5UA 3U54A 4C58A 5FTOA 2XIKA 4YTIA 3W1FA 4DG2E 1QPDA 2ZDUA 4TYGA 4DA5A 4BRXA 2Z7LA 1ZRZA 2OJJA 3EL7A 4ZJJA 3U51A 1WZYA 3EIDA 5CI6A 2YACA 2OIDA 1R1WA 3PDTA 5DRDA 5IKWA 1FVVA 2PVYA 3LPBA 4OTWA 3BWFA 3CE3A 4Z7GA 5KMMA 1PW2A 3HVCA 3Q32A 2YDIA 4G5JA 4IHPA 4ZEGA 4BCKA 4TYJA 2C3IB 3ITZA 4F1TA 3FKNA 3NCGA 5D11A 3C13A 2GCDA 4XOYA 5FBOA 4B8MA 2GS7A 4JOAA 4QMUA 3RAHA 2X6DA 5AMNA 4A07A 4ZXTA 2BHHA 1PYXA 4ALUA 2JLDA 2XNMA 3NUNA 1WBVA 3JY9A 4PPAA 3SD0A 3W2CA 5H8EA 4FSTA 4UN0C 3PUPA 1WBOA 4O82A 5GIOE 3Q2MA 4XP3A 5CF4A 4OTHA 1GZNA 4FGRA 4E4XA 4UZHA 4PPCA 5D7AA 3CCNA 1H1PA 4NH1A 4A4OA 3EQCA 3O23A 4QMPA 3TN8A 2VTTA 3QCXA 4GFOA 5CU2A 4NIFA 1OBGA 4H3PA 4E6DA 2XS0A 4IEBA 4DFBA 2Z7SA 1H28A 2WMXA 2IZTA 4XV3A 4E4NA 3RWQA 4JJRA 4ANMA 1B38A 4MCVA 3HDNA 5AV3A 3BQCA 5EFQA 1J91A 1S9IA 4I23A 4KS8A 4MWHA 5IA2A 4FE2A 3A7FA 3QWKA 2IJMA 2OFUA 4UXQA 1H0WA 3PJ1A 4XP0A 3SW7A 4J53A 4QTBA 5C01A 4CV9A 2BTRA 2XJ2A 3B8QA 2ZV7A 5ANKA 4E20A 2QOQA 4IADA 4M67A 4ZAUA 2XIXA 4G2FA 2VTMA 3IDBA 5KHXA 3QRUA 1KE5A 3R02A 2C6MA 2XB7A 4GU9A 2J5FA 4MF0A 4PL5A 3BYVA 3EYHA 2FSLX 3BHHA 3FZPA 5HEZA 2BTSA 4HW7A 2BPMA 2I0VA 3RK7A 4HVGA 1R0EA 4O0UA 3OXTA 4KD1A 3MFSA 5CSVA 2JDOA 3GCVA 3N51A 3ZUVA 4QD6A 1ZY5A 5AP3A 1YXVA 3G15A 3LMHA 5E7RA 2WMTA 3OWPA 4O7WA 4HNFA 5JMSA 4PDYA 1YHWA 1ZZ2A 1VYWA 4OT5A 3LZBA 5EHLA 2AC5A 1PXLA 4ZTHA 4A9RA 3GP0A 2UW9A 3KULB 4M68A 3TV7A 1PKDA 2CCIA 1FGIA 2REIA 2WZJA 3OXIA 2UZBA 3VBQA 5HBHA 2QG7A 2HOGA 3MPTA 2JBOA 3SXSA 4MAOA 1XH6A 5LCKA 3EHAA 2PZIA 4WNMA 4B6LA 3LQ3A 4R7BA 1OL7A 2VRXA 3D2KA 3DDPA 3NDMA 3LQ5A 3PE2A 4NZWB 1RQQA 3C1XA 4DH5A 5J9LA 2PMLX 4YJQA 3AD5A 3UVPA 3LJ1A 3SXFA 5A54A 4JAIA 3Q04A 3NUSA 3D4QA 2H8HA 3FL5A 4BYJA 4D2SA 4I93A 3IDPA 5IU2A 3W16A 1OL6A 2WMWA 3NIEA 5KO1A 2WXVA 4K33A 4CFUA 5E90A 4DT8A 1UKHA 3OWLA 3KN5A 3UOJA 3QCSA 2XK7A 3GFEA 3MV5A 5K4IA 2ITTA 4AW1A 2WAJA 5B2KA 2JC6A 3ZXTA 4CEGA 2HWPA 2I40A 2PZYA 3QTRA 4G16A 3OMVA 4KINA 3R8VA 4EH7A 5KKRC 3MI9A 3NYNA 2QOOA 1GZOA 1R0PA 3BHYA 2WEIA 3IECA 3IS5A 5KNJA 3N4TA 2IO6A 4QPMA 2C1AA 5AP1A 2XJ0A 2W1CA 4YR8A 5AP4A 5IQEA 3S0OA 1CKPA 5HG7A 2PE2A 2XIZA 3BLRA 5AP7A 3I6UA 4PMPA 5BVFA 4E26A 3PXRA 4U79A 5AP0A 5LOHA 4G3CA 1BL7A 3SW4A 5IDPA 4QP9A 5FDXA 3U4UA 4C59A 4AS0A 2YWVA 1PXIA 1Q24A 3KMWA 4AA4A 4BZOA 3A7IA 2C47A 2GQSA 1OECA 2J90A 2QHNA 3GUBA 3PJCA 3AD4A 2B55A 4GT5A 2CJMA 4EC8A 1CTPE 3QLFA 3UIUA 3O7LD 4DH1A 5BVWA 3IW6A 5EI6A 2WHBA 2P2HA 4IAZA 2R5TA 2XUUA 3I5ZA 3BZ3A 3MH0A 4CQEA 4EQUA 2UW8A 4FKTA 1ZARA 2XM8A 3ACJA 3OT3A 1JKKA 2PMIA 5AP5A 4JAJA 5HE3A 5J1WA 3UIBA 4I3ZA 4KIQA 2R3OA 2B53A 4MEDA 4DE4A 4CT1A 3SKCA 4RJ5A 5TOZA 4X2NA 1JKSA 5E8UA 3C0GA 5CTPA 3OWJA 5IQAA 3BE2A 5K5XA 4OT6A 3H0YA 4D5HA 4Y5HA 1XR1A 2RFDA 4M69A 4JX3A 4RC4A 3NVMB 3HUBA 5E4HA 2O0UA 4F7LA 3OG7A 3VN9A 2V62A 4CFWA 4CG8A 4ERKA 5L6OA 1OKWA 4XG7A 5AUWA 4RQKA 5DA3A 3SG9A 4BDDA 5HTIA 3KRRA 2WTWA 5C27A 3AGLA 2OKRA 4FVQA 4MXCA 1W83A 2OZAB 3DBEA 3AC8A 1RDQE 3QQUA 3ZC5A 3NRMA 1G8AA 4Q5EA 4HVIA 2RFSA 4CMUA 3F2NA 3NNWA 3PXQA 3QRIA 3DKFA 4EWQA 2VO7A 5AAFA 2JBPA 2CNQA 3RK5A 3PVWA 3WF9A 3HAMA 1ZYLA 1KE9A 2YDJA 3GC9A 4HPTE 4QTAA 4H05A 3NW5A 2YWPA 1U4DA 3QUEA 4FIEA 4QP6A 4KIOA 3C4EA 1OKZA 2VUWA 3EQPA 5C26A 5KKRB 1TQPA 3Q4ZA 2RKUA 4AACA 4A9YA 5CAQA 4CFFA 3KF4A 2OICA 5IQHA 4CD0A 4QMWA 3V04A 2GPHA 3I0OA 3ORIA 3LAUA 4QYGA 3H3CA 1ZYDA 4M0YA 1HOWA 5HHWA 3KXXA 5HBEA 3UMWA 2BZHB 5G1XA 2P4IA 1UKIA 4FSRA 4N0SA 1P4OA 2YISA 3H4JA 4QMTA 4U41A 2GDOA 2W96B 3CJGA 3MFRA 4NKSA 5DGZA 2R64A 1ZMVA 3F5GA 2V0DA 4DFLA 3SGCA 5DBXA 3KCKA 2WKMA 4HYSA 4U3ZA 3OY1A 3R8UA 3NCZA 1URCA 4QMOA 3WZDA 4NSTA 4FKRA 3QKKA 3FE3A 3E92A 3AT2A 2PZRA 3PRFA 3UVQA 5HD7A 4EBVA 2OBJA 4G6LA 4QNYA 4RC2A 5F20A 4AZVA 2OWBA 3KRLA 5J79A 4UYNA 4BDIA 2R3IA 4F7JA 3ROYA 1MQ4A 2OH0E 4FV0A 2F2UA 2ETKA 5AM7A 3EOCA 4DT9A 3QQGA 5ETCA 4AZTA 3NMUF 3LJ0A 4J8NA 3VUIA 2W99B 3ZXZA 1H08A 3VJNA 1TVOA 3PPKA 2NPQA 2PK9A 2X81A 3UOHA 3OOGA 3EL8A 3P7CA 4JDIA 2WB8A 4X6RA 3BWJA 4HGTA 4BDJA 2OH4A 3BYSA 2WQBA 3DK3A 1MQBA 3UJGA 4F64A 4UMPA 2PE1A 1AQ1A 5A46A 1ZOEA 3CJFA 3D5VA 4AGDA 1GY3A 4ZSEA 5JQ8A 3IOPA 5CAUA 2W1IA 3EQHA 4F9WA 3QZFA 3I4BA 3ETAA 3VW8A 4PMMA 4FGBA 4IC7A 3COIA 4D4VA 4ZSLA 3W2OA 2WTCA 4EK4A 4J96A 4RIYB 3WYXA 3A7HA 1IG1A 2V7AA 4TY1A 2EXMA 4ORKA 2W0JA 4XG6A 2C5XA 3L8SA 4IB1A 4RVLA 1WBWA 2R7BA 2UZVA 4GMYA 3QD3A 3BU5A 3DOGA 4GW8A 5CQWA 3GOPA 4C0TA 3DV3A 3ORPA 3TZ9A 3W2RA 2QHMA 4CLJA 4BHNA 5CQUA 4O7LA 3IDCA 1JKLA 2XEZA 3Q96A 4FV4A 1FQ1B 3LJ2A 4P90A 5CAPA 4A9TA 5CF6A 5GZAA 2ITPA 2XRWA 3FMLA 3PSCA 3QD2B 4QT1A 4E6CA 2A1AB 1DM2A 1WVWA 3UBDA 4FIHA 4V0GB 2XEYA 2DYLA 3OW3A 5M09A 1YOLA 2C5OA 4WO5A 5AUXA 5HLPA 1WVXA 4IWDA 1TQIA 2VWYA 2J0LA 3C50A 4FKJA 4I6HA 4V04A 4R5SA 3PXZA 4L7FA 4TWCA 4AZFA 3NUPA 3HV6A 3QTSA 1VJYA 2VZ6A 3RPYA 4RVKA 4QTEA 4BDBA 5E8VA 2ACXA 4O1OA 3HV7A 4X2JA 3IONA 3ANRA 1A06A 3D83A 3TZMA 2VX0A 5GJGA 3R83A 1H1SA 2CCHA 3QX2A 4FSQA 3ZU7A 4RJ4A 5EQPA 5IQCA 3FZRA 2B9JA 1XKKA 5HG5A 4IAKA 4QMLA 1YXUA 3FLQA 1M2QA 3PWYA 3R6XA 4BCGA 2YJRA 4BCFA 4ZLOA 4EYMA 1YRPA 4C4GA 3TDVA 2RFEA 4BBMA 2EU9A 4ENYA 3WZKA 3RP9A 4NCTC 5L8LA 3E88A 2CKEA 4ZMFA 1ZOGA 1GJOA 2VTAA 4BYIA 5BVNA 2WGJA 2BZKB 4I0RA 5G6VA 1OGUA 4V05A 2OSCA 4FEQA 5E8WA 4D0XA 3BGQA 4CZYB 3MVJA 2WFYA 2JDTA 3G33A 3FEGA 1OIRA 3W2QA 4D2RA 5A4TA 4WHZA 4IAAA 3O7LB 5M06A 5JEBA 3ZRMA 2X1NA 4U44A 3TTJA 4J7BA 3ZH8A 3KXMA 4FKQA 4TTHB 2R3NA 5JGDA 4IM2A 5DPVA 5B0XA 4BCMA 2X9FA 4I41A 2I0EA 1DI8A 4I4EA 2FUMA 4QTCA 1JOWB 5EYKA 4E3CA 3DGKA 5FUTA 2XBAA 3KL8A 3FMHA 2BIYA 4RIXA 1Y57A 1JKTA 3SOCA 2OXYA 4H3QA 5KE0A 5JT2A 3JUHA 4RJ8A 2EB2A 3GCSA 5DI1A 2HIWA 5HIEA 4O22A 5EM7A 4QRCA 2X7FA 4XP2A 5A9UA 2OG8A 2O8YA 3RMFA 4FV9A 5E8YA 4L43A 3A8XA 1PMUA 3V5WA 4O86A 5IEXA 4TWPA 3PZEA 4WNOA 3D0EA 4A7CA 4BKYA 3E8DA 2HXQA 5FXQA 2F57A 4CMTA 3W55A 2FH9A 4EI4A 3VUDA 3RM7A 5B2MA 1NVQA 2NO3A 2ITQA 4IZ7A 4W4YA 1GIIA 4IVBA 4P2KA 4OTGA 4OLIA 2UUEA 4FKVA 4QQCA 5L2QA 2QQ7A 3SG8A 3QWJA 1FINA 2VTRA 4ACDA 3SRVB 4N70A 3WARA 2JAMA 4EOPA 4GG5A 5J5SA 5HU9A 4CTBA 5KHWA 2W4OA 3QTWA 2OK1A 4PWNA 2HXLA 4N6YA 4XCUA 3TKUA 4DITA 4USDA 1O6LA 3FQSA 2GNFA 2J9MA 3MDYA 3Q6WA 4C4EA 1FMKA 4NCTA 3TUBA 4DF3A 3FKLA 1Q61A 2UZUE 4R7IA 5BVEA 3R9HA 4ALVA 4AT3A 4DEDA 2C5NA 3FSKA 3IPHA 4OW8A 3CQWA 3CTHA 5EI8A 3WZUA 3GCPA 3DXQA 3QUPA 2F9GA 2ITYA 1W82A 3RALA 3S1HA 4BC6A 1GNGA 4D4YA 4IANA 4FG7A 4O2ZA 4XBRA 4HYHA 5CSWA 4NFMA 4DH8A 2G2HA 3K5VA 4RVTA 5JSMA 3R7GA 3HRCA 3VBTA 3ZM4A 2BR1A 4EH6A 1YHSA 2GS2A 3TG1A 4DEIA 5CENA 4W8EA 3MH1A 5I3RA 4U40A 2YCFA 5IUIA 4V01A 4GK3A 4EH4A 3CGOA 1WBNA 3MJ2A 4YGAA 3W8LA 3RKBA 1ZXEA 4F1OA 3QGWA 4FC0A 3VF8A 2YLEA 4B0GA 4IZ5A 3VAPA 4ANBA 5D9HA 2B9FA 4IE9A 4LOOA 5BUIA 5I0BA 5KMNA 1NA7A 1OKYA 3JYAA 4D2WA 2VV9A 4G34A 5CT0A 3NYXA 3VBWA 3U9CA 3P7AA 5HG8A 4TZRA 4BGHA 4KRDA 3DNDA 5A3XA 3UOLA 3VVHA 2GNHA 4TYHA 2HK5A 1PRYA 3AT4A 3NIZA 4RJ3A 4LUDA 2JKKA 2YIWA 4XG2A 3ULIA 4J99A 4Z7HA 1JWHA 5AR8A 5AAGA 4O83A 5CASA 4MD8E 4YNOA 3L9NA 4OUCA 4E93A 4W4VA 3RBWA 3VUGA 4O0XA 1GIJA 4HVDA 2VWIA 3ZMMA 4FK3A 3MN3A 3TNHA 3BHTA 2PUIA 2XP2A 1STCE 2QI8A 2QOKA 4FTUA 4QPAA 4KRCA 4YJRA 4ZTSA 3VS3A 5IH5A 5HG9A 5TR6A 1Q5KA 1U5QA 5HKMA 2B52A 3BV3A 4GYIA 4YSJA 3VW6A 4DEEA 5BX0A 3V5LA 3OFMA 3HKOA 5FG8A 2B7AA 4FZ6A 4ZP5A 1URWA 1YDRE 4O1PA 3VRZA 5CZHA 1WVYA 4G31A 2QLUA 2YIYA 5EG3A 3GNIB 1GAGA 2PZ5A 1CMKE 4X2GA 4ZZNA 3EZRA 4WKQA 3PE1A 4BTKA 3A60A 4RFZA 2Y8OA 1OI9A 4M3QA 3RAKA 1V1KA 3DZOA 4D1ZA 5BVOA 4FTIA 3I60A 2EVAA 4IVDA 4FZDB 4OGRA 3ZLXA 5JRQA 3LFSA 2VX3A 5TF9A 1UWHA 5EM8A 3FZSA 2BZJA 2NRYA 1BI7A 3QXPA 5CZIA 2CKQA 3N4UA 3C0HA 3R9RA 2RF9A 4C4IA 5JFWA 5BMMA 4NK9A 3T9IA 3NUAA 4C2WA 3MJ1A 3HDMA 2I0HA 3LFBA 4RMZA 3E64A 4KS7A 4UZDA 1KV2A 5D10A 1P14A 2A0CX 3ZO1A 1PMEA 1AGWA 4XG8A 5AEPA 2KULA 4I0SA 2C68A 4ITIA 4JBPA 5DG5A 2UZNA 3IKAA 3R8LA 3MIAA 4KIPA 3R2YA 2LGCA 4DLJA 5CF8A 4ENXA 3TACA 3DK6A 5J95A 5DR2A 4IM3A 2R9SA 4JL9A 4PTEA 2B9HA 3OCBA 3LKMA 3FZTA 2Y4IB 3BHVA 4FMQA 4AOTA 1W0XC 3FQHA 4II5A 3ORLA 3EN9A 4E5BA 2ZJWA 4PTCA 3D15A 1ZYCA 4J52A 5HVJA 1W98A 3PJ3A 4R5YA 4E1ZA 3FMMA 4MNEB 3VULA 1MRVA 3DDQA 3GQLA 1H1QA 3ZEPA 3DBDA 4KIKB 5CEKA 3BV2A 1ERKA 1XH9A 3ZLYA 4EOMA 2JFMA 4YNEA 3DLZA 4NTTA 2BRGA 4L52A 1OIUA 4AAAA 1H01A 2R0IA 3BBWA 3EN6A 2ETMA 3R8MA 4AG8A 5CVGA 5DWRA 1ZWSA 4HGEA 4P4CA 3JS2A 4IB3A 4E5AX 5FM2A 3OW4A 3WZEA 5B2LA 5IA3A 3EFWA 2WQNA 5AX3A 2I7QA 5IPJA 5T3QA 4FV7A 2WIHA 4WNKA 3VQUA 4LMUA 1IA9A 4BZDA 2CGVA 2ONLA 4KBAA 5GJFA 2PVRA 4EOSA 2BDWA 2W1HA 3MY1A 4YTHA 3R30A 4OAUC 3SHEA 4QYFA 2CSNA 1W7HA 1CDKA 5IMXA 3VHKA 4BCPA 3WZJA 4DBNA 1Q3WA 3UPZA 4WG4A 4ASEA 3D7TB 4EL9A 1XJDA 3V5QA 1IEPA 3LXKA 1UA2A
chains in the Genus database with same CATH superfamily
2BFXA 1IR3A 4QYYA 1KOAA 3AG9A 4ZTQA 4NL0A 1Z5BA 2G1TA 2WU7A 3VIDA 5CF5A 4NTSA 5CU3A 3SXRA 4FTJA 5L2IA 3VK8A 2OF4A 3G90X 4QQTA 2R3KA 3E3BX 3UNJA 1UWJA 2UW5A 2DAKA 2XKFA 3HV4A 1ZY4A 4O0TA 2UW3A 1QAMA 4C3RA 1O6YA 2BJVA 2ITNA 1IY1A 2WIPA 3U6LA 2QURA 4GKHA 4BCHA 1OJLA 3U6PA 3KB7A 3QF9A 4Y85A 3ZRKA 1J1BA 2C4GA 3TJDA 4ONAA 3UG2A 3VS5A 4FSZA 5I3OA 4FTLA 3UGJA 1UM8A 4OAVB 2YQZA 4YMJA 4PF4A 3HU3A 1W2DA 2IEWA 2WMQA 5EW8A 3PVGA 3CSVA 1PGYA 4PL3A 3ATTA 3IW4A 4U81A 5CU0A 4E4LA 5CEMA 3ACKA 3FMNA 4FZAB 4Q9SA 3F3WA 2QU6A 5DMZA 3F82A 3GB2A 4FSUA 3JY0A 2V1CA 1YW2A 3H30A 3LCTA 3VJOA 3IG7A 3ODZX 1W8CA 2ZTDA 4X66M 1PYEA 1OFHA 2R7IA 4O7TA 4E5WA 5T68A 3C4ZA 5DYIA 1XMQM 5KZ0A 4FYNA 4GITA 4F63A 4DV2M 1XXHA 3LW5F 5HI2A 1DGFA 2FB8A 3R01A 5KUPA 4QHTA 2O5KA 4RT7A 1K2PA 3S3IA 3CS9A 4GHLA 2IZSA 3OP5A 3PFYA 3T3VA 3DZDA 1PMNA 4H58A 1MP8A 3R7YA 3DCVA 3LW0A 3M6AA 5J9ZA 5LMAA 5M55A 2AQXA 4MWIA 4FTKA 1H25A 4BBFA 1WAKA 2OXXA 3NYOA 2XKCA 2GFSA 4YUQA 1XBAA 3RINA 3I81A 3ET7A 3MFUA 1UFZA 2PE0A 3QTXA 4ACCA 3IGGA 2ZM4A 3FUUA 3RZFA 4J95A 1M7QA 5DEYA 2AC3A 3DXPA 4CV8A 3V01A 4O7VA 1GZKA 3FXWA 4I6QA 3MA3A 2PL0A 3WE4A 3RE8A 2VNYA 2KZUA 1G4AE 3QU0A 3NUUA 3W8QA 3L2AA 3SYLA 4AG6A 4MUQA 2QR8A 3S2PA 5HBJA 4GUEA 3PIXA 4PNIA 1OGYA 4M12A 3QQFA 1GKIA 4AGWA 1J09A 4MF1A 5EH0A 3VS4A 5ANGA 2Y0QA 3P79A 2HZNA 2ZAZA 4LL0A 1GO5A 2XNNA 2VWXA 4G9CA 2XK4A 3OOMA 4ZY5A 2Y0TA 4BVUA 4L68A 3QD4A 2CE7A 4C4JA 5LJJA 4PP9A 2C9OA 2W9FB 3ULZA 1A48A 4RWJA 2YM4A 1BMKA 1M2RA 1Q3DA 3H0ZA 1SXJD 5EYCA 3FYJX 4X3JA 1VEBA 2QD9A 4LDTA 4ZMEA 3TIZA 2DUVA 1ND4A 2YM7A 5GHVA 1NHGC 2X7GA 1NJFA 1Q39A 3QGYA 4CIZA 3ENHA 3G9NA 4MQ1A 3NYVA 2QG5A 4X65M 1R4GA 4X21A 2C3KA 3ZZEA 2F7XE 4C2VA 5M4FA 3FDNA 1F4IA 1IASA 3EQIA 4BR3A 5KMOA 2PMOX 1PXKA 4MD7E 4RIWA 4EJNA 1PXMA 3R22A 4XGIA 4FKLA 5FRIA 2FSTX 4RIXB 2J0KA 3NW7A 5DT0A 3FMDA 3AKZA 1S9JA 3LCOA 2ZMDA 4DINA 4C3PA 3QFVA 3WE8A 4EORA 3AT3A 4ACGA 4U9AA 2QU5A 3GQIA 3QQLA 3RFWA 3U6MA 4L42A 5HVYA 4YC3A 2OU7A 3MIYA 2CHVA 1ZZLA 4LYNA 3FYKX 5KO3A 4GVJA 3TL8A 3DBQA 2XCHA 3R9NA 4LGDA 2BMCA 1E9HA 4GK4A 1TKIA 3Q5IA 3R7EA 5ANDA 5ICPA 3P4KA 2Y4PA 2VGPA 2ZM3A 3MTFA 2IVTA 5HCXA 2HW7A 2QODA 5FD2A 5D1JA 1YWNA 3D2IA 3LLTA 4TXCA 2CGUA 2I1MA 3VRYA 4MNFA 3R9DA 1G41A 2HAKA 3GRRA 5EI2A 2HZ0A 3B7ZA 2VGOA 5I9UA 2XANA 2WSFF 2C5YA 4JI6M 4YHFA 2Y20A 5CT7A 2YDKA 5FTNA 3EQRA 2GU8A 3KMUA 5EKOA 3GC0A 1PF8A 5A14A 3MS9A 1PJSA 3M2WA 2OJFE 2BRMA 2JP7A 2BZIB 5GZ9A 5LVMA 4DUZM 4YP8A 2DNAA 3CF2A 3M7GA 4I94A 4RJ7A 5DRBA 4XG9A 4CKIA 4IAYA 3HP5A 4FI1A 2OIQA 3U5ZB 3L9LA 3FC2A 3MVHA 1YOMA 4JIKA 3TJCA 4GG7A 2ERZE 1TDHA 2XA4A 2R3MA 3EFJA 1E9RA 4FVRA 3SC1A 5DHJA 3IW7A 3UOKA 1ST0A 2OGVA 3SV0A 4AW5A 3AKLA 3FBVA 5F94A 1HT1E 3DTCA 3ZBFA 3DY7A 3TNWA 3DNEA 2E9UA 4DR5M 5LXMA 4YJTA 4QMQA 2C6IA 2R6FA 3UVRA 4QP7A 4DDIA 1M17A 3L29A 5EQEA 1TQMA 2I7NA 3A2CA 3WF8A 3O17A 4QP2A 5HQ0A 2F7EE 3F5PA 3LFFA 2VTLA 4JQ7A 4XBOA 3O71A 3L1SA 2JKOA 4GSBA 2QNJA 3I6WA 3D5WA 5EW9A 4HGSA 2IVSA 4F6WA 3PFIA 1FBNA 3CP9A 4FIFA 2JZ0A 4R1VA 1ATPE 1Y6BA 1BX6A 4TYIA 3QRKA 4M15A 3QWLA 1HJPA 2RG5A 2VWUA 2XNGA 2V5QA 4EK8A 4O96A 2P55A 4AKIA 3H10A 2RFNA 3W0LB 1L3RE 4LV5A 4O7RA 4XJ0A 4RX5A 3QAUA 4OTQA 4DBXA 3HKPA 4DHIB 1B6CB 4FTOA 4XV2A 3UO6A 5EW3A 2WQEA 1R3CA 4RWKA 3QAME 1I44A 4II7A 2DHYA 4LFAM 2XGNA 2J5EA 4CXAA 4FEXA 2R3LA 2D7GA 2XK9A 5HNIX 4A4XA 4L44A 4RIOA 1YXXA 4OTPA 3VBVA 1YXTA 4IWPA 4PUZA 1SNUA 3CLYA 3BKBA 5FTQA 1YVJA 1D0KA 3P9JA 5BPVA 3EH9A 4YBKA 3K3JA 4BJJB 2YN8A 4FG8A 5HNBA 3AC1A 2A19B 5CAVA 5FXRA 2W1FA 5LWMA 4DH3A 4AOJA 3EFLA 5KMKA 5E8ZA 1JLUE 2VN9A 4IBJA 4M69B 3FLSA 4CT2A 4G3GA 4WRSA 3GU6A 4AGUA 1EE8A 2MROB 4WSQA 4AWIA 3ID6C 3EZVA 3I1AA 4LGHA 2W7XA 4K18A 1DAWA 3ML1A 4QMNA 4DUYM 3AD6A 4U0IA 1J1CA 3KXNA 2HCKA 3GENA 4AXAA 3C4CA 3M42A 3UP7A 1IY2A 2UUBM 2OI4X 5C1QB 2C30A 3E5AA 1QCFA 2JGZA 3CF6E 2CLQA 4P17A 2NRUA 4S34A 3EB0A 5AM6A 2Q83A 4ALWA 4OTIA 3NZ0A 2PPQA 3UTOA 4Y73A 5TKDA 4BDGA 2VTOA 4QMZA 5IQIA 4JQEA 3UQCA 5LARA 4M97A 3OBJA 3DQXA 5IUGA 4LCBA 1Q8WA 3RI1A 2QKWB 1IFYA 3R1YA 3SHFA 4OTFA 3T38A 1I4WA 3A4OX 3A61A 4GKIA 3UIMA 2LVAA 4WOVA 3WIGA 2PULA 4E8AA 3FKOA 5IZ7D 2PZPA 3QHWA 2JD5A 4I5HA 5AA9A 5I4NA 4PQNA 2DS1A 5F3WA 2QHOB 5DR6A 5JKGA 4LV7A 2WTIA 5FDPA 4ZSAA 5I5ZA 3ZDUA 1OIZA 3PY3A 4GEWA 4YHJA 4YLJA 2KTYA 1PY5A 4FIIA 3CQEA 4JS8A 3GCQA 2VTSA 4DFZE 3U6QA 3VS7A 4ZSGA 2PYWA 3KXHA 3FMJA 3LCUA 3TM0A 3A99A 2K47A 5E6JA 4NM5A 3CF0A 4F9CA 1MRUA 1XH7A 3PRIA 4ITQA 4GT3A 3DAJA 3PPJA 4P7EA 1KWPA 2CN8A 4D80A 5AUZA 2NNWB 3RM6A 3ORKA 3PA3A 5IA0A 2G01A 2LVNC 4ZTRA 4FZFB 1HCKA 2H1RA 1O9UA 1VG5A 4HCVA 2O63A 3EMGA 2R3JA 4EYJA 2IPXA 4D28A 5M4CA 4TT7A 4LL5A 5EHOA 4F1MA 3SC3A 2VTJA 1BLXA 4GS6A 1H00A 4MBJA 4FOBA 4D9UA 1UNLA 3CEKA 2JFLA 1HR0M 5AR4A 2QOBA 3C5UA 5CEPA 2V55A 5L2SA 5IH4A 2ITOA 3ORTA 2Z60A 5DH3A 3U6JA 3FY0A 4LOQA 4I6BA 3VO3A 3BEAA 4BCNA 3VBYA 4NT4A 5AUUA 4XBUA 5DNRA 4LRMA 2Z4RA 4YZBA 4GL9A 2BKKA 1W84A 4IC8A 2XYUA 3B8RA 1VEGA 3CD3A 4WG5A 4BTJA 2QOCA 2W06A 1IXRC 3ZO3A 4I0TA 4RWIA 4JBVA 4YC8A 5CEOA 3RVGA 2B4SB 4JT3A 1NO1A 5AUVA 2CN5A 4TL0A 2B1PA 3HU2A 2I0YA 5ETAA 5IDNA 5AV4A 2C6KA 1EIJA 3U87A 3RHXA 3SAYA 4EH5A 1SXJA 3GCUA 5HOAA 4UV0A 1M2PA 2IVVA 4WP2A 2CGWA 3Q9WA 4YSMA 2XVDA 4O7YA 3NGAA 4JBOA 3FLYA 5HX6A 2XK6A 4FKIA 4ZK5A 3BLAA 1N34M 3U6OA 3LLAA 2FE8A 3VLFB 2XKEA 3W0NA 5EYDA 4NUSA 3QKLA 3ALOA 1YE9A 2CV1A 2P33A 3BYOA 4IWOA 1WMKA 3MW1A 2BAKA 3DLSA 2GFCA 3ANQA 4FNYA 4DGNA 1ZMUA 5E1EA 4IBBA 4TUWA 4FTMA 2C0OA 2J0MB 4AT5A 4YZNA 1E9SA 3UMMA 4QOXA 5C1BA 5ANIA 2F4JA 5DLSA 2VTHA 3NX8A 5CU4A 4QMXA 5J9YA 3G51A 4FTQA 4YJUA 1TGUA 4WT6A 3K5UA 3U54A 1QPDA 1AIPC 4FWDA 4BRXA 3E9SA 2OJJA 4ZJJA 2YACA 2X0OA 5IKWA 4Z7GA 1FVVA 4JI1M 2PVYA 3LPBA 4OTWA 3BWFA 1LTMA 4G5JA 3HHYA 3FKNA 1DGGA 3C13A 4XOYA 4B8MA 4QMUA 2BHHA 4FSTA 4OTHA 3EQCA 3O23A 3TN8A 4GFOA 4NIFA 4DFBA 1H28A 2IZTA 3RWQA 4JJRA 4ANMA 3HDNA 4MWHA 3T6PA 1DGHA 3PJ1A 4J53A 3RGPA 1C7YA 4M67A 4ZAUA 2XIXA 2VTMA 3IDBA 2XB7A 3EYHA 4HW7A 2BWBA 3RK7A 4HVGA 3GPPA 3GCVA 3ZUVA 4QD6A 4P16A 3G15A 2WMTA 4PDYA 4OT5A 5EHLA 4GC5A 4A9RA 3KULB 2UW9A 1FGIA 2WZJA 3OXIA 3SXSA 4MAOA 2PZIA 4R7BA 3LQQA 4BYJA 1N77A 4I93A 1OL6A 1N78A 1L8QA 2ITTA 4AW1A 5B2KA 2JY6B 4EH7A 3OMVA 3MI9A 3NYNA 5KNJA 2W1CA 4DV7M 5AP7A 4G3CA 4QP9A 5FDXA 3FRHA 1Q24A 2GQSA 4EC8A 4DH1A 5BVWA 5EI6A 4IAZA 2XUUA 4NRVA 1JKKA 2PMIA 4JAJA 4I3ZA 4KIQA 2R3OA 4MEDA 4DE4A 5ITYA 3C0GA 5CTPA 3OWJA 1QZEA 5K5XA 4D5HA 4Y5HA 3KFUG 2RFDA 5E4HA 1R2ZA 3HUBA 2V62A 1OKWA 5DA3A 3SG9A 3AOEC 2JY8A 1XNQM 2WTWA 2OKRA 4FVQA 4LF4M 1RDQE 3FTEA 3QRIA 1ZYLA 1KE9A 5EXTA 3KDSE 4YHHM 5KKRB 4CFFA 3KF4A 2OICA 3UDSA 3I0OA 1HOWA 5HBEA 2P4IA 1P4OA 4U41A 3CJGA 1GL6A 3F5GA 2WKMA 4U3ZA 3NCZA 4QMOA 3NBXX 3E92A 4RC2A 2G8LA 5J79A 4G6ZA 4REZA 4BDIA 3ROYA 4AZTA 3NMUF 3VJNA 2X81A 4DHZA 3OOGA 3EL8A 4F64A 4UMPA 1AQ1A 3D5VA 4GKKM 5CAUA 4PMMA 4D4VA 4EK4A 4RIYB 1IG1A 2EXMA 2W0JA 2C5XA 4RVLA 2UZVA 5CQWA 3DV3A 3ORPA 3W2RA 5CAPA 2XRWA 3UBDA 3OW3A 5HLPA 3PXZA 3GLGB 1VJYA 4BDBA 4O1OA 1A06A 3D83A 4RJ4A 3U6EA 5HG5A 1M2QA 4C4GA 1IM2A 3QYEA 1ZOGA 1GJOA 4I0RA 1OGUA 4V05A 2M5ZA 4CZYB 3G33A 3TL4X 1NY6A 5M06A 5JEBA 4TTHB 4FKQA 2R3NA 3FYCA 4PDIA 4QTCA 1JOWB 5EYKA 2OXYA 5KE0A 3JUHA 2X49A 4O22A 5EM7A 3K9PA 2X7FA 4M9SA 2OG8A 4L43A 5IEXA 4TWPA 2HXQA 5FXQA 2F57A 4EI4A 3VUDA 5B2MA 2ITQA 4IZ7A 4W4YA 1GIIA 4IVBA 4P2KA 3GLGE 4CTBA 2W4OA 4PWNA 2J7OA 3FQSA 4MGZE 4C4EA 4NCTA 5BVEA 1Q61A 2UZUE 3R9HA 1SXJC 3QUPA 3RALA 4D4YA 4IANA 5CSWA 3HRCA 3VBTA 3ZM4A 2BR1A 2GS2A 5CENA 4W8EA 5I3RA 4U40A 1WBNA 3MJ2A 4LF6M 5FTLA 4B0GA 4ANBA 5D9HA 2CRUA 4QOZC 3NYXA 5A3XA 2GNHA 3NIZA 4EIWA 2JKKA 1JWHA 3B89A 5AAGA 4YNOA 3L9NA 4OUCA 4W4VA 3RBWA 4O0XA 2VWIA 3ZMMA 3BHTA 2QOKA 4KRCA 2NYAA 2ERCA 3T1HM 4YSJA 3OFMA 2C9CA 4ZP5A 1URWA 5CZHA 2YIYA 5EG3A 3GLFA 4X2GA 4ZZNA 1V1KA 4D1ZA 4JI4M 2IF8A 4FZDB 3ZLXA 2BZJA 3QXPA 3N4UA 4IBCA 4C4IA 5JFWA 1OAIA 1TR8A 4RMZA 4KS7A 4UZDA 1VDDA 1P14A 1PMEA 2C68A 2UZNA 3IKAA 3R8LA 2LGCA 3TACA 5J95A 4JL9A 3OCBA 4II5A 2ZJWA 3NFGB 2DXIA 4R5YA 2FS1A 2M60A 3VULA 3DDQA 3GQLA 3BV2A 3ZLYA 1OTRA 4EOMA 2JFMA 4YNEA 3EN6A 3R8MA 5DWRA 3RGSA 3OW4A 3VKGA 3WZEA 2WQNA 2XEPA 5FLXS 2J5YA 4LMUA 1IA9A 2ONLA 2PVRA 4EOSA 2CSNA 3VHKA 4OVZB 3UPZA 1XJDA 1UA2A 4DGLC 3LFNA 3F3ZA 2PMNX 5ITXE 1SZMA 2VU3A 4PDOA 3GLIA 2OO8X 1T43A 5J5TA 4FA2A 5BUJA 5EP4A 3UMXA 4XG3A 1QPEA 4L78A 3BE9A 4RVMA 3VHEA 3MVMA 3V5JA 3F3VA 2OIBA 4F0GA 1OPLA 2MGWA 2R46A 4DN5A 2BDJA 1UU9A 4G1WA 3D14A 1WGLA 1D0LA 4IVCA 5EKNA 4DEGA 5JGBA 2WTDA 4FKOA 1Q62A 3E8NA 4BIEA 3FHRA 2XAOA 3P5JC 5AA8A 2DAMA 3R0TA 1Q41A 2HYYA 4LF8M 2CNVA 4MGHA 2UZWE 3EKKA 5JGAA 4PNKA 3R7IA 2CGXA 3IG5A 4DHJA 4JI2M 4FUXA 3PA4A 1XO2B 5DVRA 3QZGA 3O8TA 5B7VA 3RZBA 4WBBB 4NRWA 4XLIA 3PZHA 4U3YA 2I6LA 2QO7A 4MXYA 1OM1A 1PHKA 4FX3A 2J7TA 4L8MA 4Y46A 3BBTB 2UZLA 3G0EA 1OQYA 3RPSA 5KZIA 4AX8A 1NY3A 1L8TA 5K3YA 2VDBB 3EQDA 3VUMA 5JK3A 1EH4A 3C3DA 4JXJA 3O50A 5FXSA 2QLQA 2ERKA 5FWKK 2R44A 5F95A 4TWOA 4X6QC 4CYIA 1SYKA 4R3PA 3VS0A 1YI3A 4AFEA 3QQJA 5DR9A 4G5PA 1L2CA 1I09A 2L4EA 2BAQA 4O84A 2C1BA 1N32M 2J0IA 5FGKA 4CISA 4AXDA 3OY3A 4U42A 3A62A 2CHLA 4I6FA 4Y8DA 4GV1A 4JI8M 5BUEA 2BILB 3QTZA 5CEQA 2R65A 2OJ9A 3ZO2A 1PRBA 3GLHA 5F1ZA 3O8UA 1XMOM 3BU6A 5C03A 3QZHA 2IW8A 3F92A 4Q9ZA 3AXWA 4FBXA 1QUTA 2QP9X 4FTNA 2WELA 4DCAA 3ZC6A 4G6NA 4I92A 3Q8XA 1M14A 2UV2A 4BWKA 3ORZA 3P7BA 2X39A 4G17A 3QYBA 2YR0A 4YLLA 4YZ9A 1Y6AA 4L9IA 4D4RA 4JI3M 1N75A 5HTCA 3T9TA 3TZ7A 2RG6A 4AGCA 2WD1A 1QAOA 1TTEA 4FT9A 1JR3D 4JR3A 4N4SA 4CFMA 1SM2A 2H96A 3DK7A 1G71A 3RHKA 2DWLA 4L45A 1MUOA 5DT4A 4P5QA 3I04M 5AX9A 3H9OA 2Y9QA 3F5XA 4USFA 1QQWA 5IREB 3T8OA 4C8BA 3SX9A 3KY2A 3R7VA 4NXMM 3TV6A 3QQHA 3R2BA 4FSWA 2CFOA 5E8XA 3DA6A 4FK6A 4CQGA 4EOQA 3UP2A 3NBIA 4K9YA 2MR9A 3ZFXA 1X8BA 4O81A 2W5BA 4HYUA 3FJQE 2CLXA 4I5MA 4CCUA 3CXWA 1H1WA 4CJ6A 3G5DA 3LHJA 2EJSA 3FMKA 3U60A 4EOLA 4UEUA 5GINE 3R21A 1K82A 1NW1A 4QDVA 3UZUA 4R78A 2YIQA 5E1SA 1YSYA 3OUKA 1QPJA 2IZUA 5LMKC 4HNIA 3TWLA 3V8TA 3UIXA 3ENMA 1NHWC 3GGFA 3VWAA 3RWPA 3OTUA 5AR3A 4PCZA 3C4FA 2OJIA 3R73A 4X2KA 1T3TA 3O0GA 4U97A 1QANA 4BY9E 2O2UA 4TNBA 1MN3A 4H3BA 3Q9ZA 1RJBA 3KS8A 4AT4A 3TZ8A 4ZSJA 3OBGA 2QSFX 2O3PA 2XM9A 1TF0B 4HVSA 3R1NA 2VIIA 2YM3A 3PG3A 2WTVA 3CD8A 4H39A 3GEQA 4FV6A 2X8EA 3IG8A 2UU9M 3OTVA 2W5HA 4RZVA 4F1IA 4A9SA 5EOBA 4CCBA 3QUDA 3ZH9B 2WTKC 5ANJA 3PP0A 3TT0A 4YHTA 2OZOA 1OIPA 5CU6A 3V51A 4O0RA 5L8RF 3HWSA 4BB9A 2ONLC 3NWLA 1C1KA 5DYJA 5H3QA 4EHZA 4AN3A 4O2PA 5A4CA 1ZV1A 3ORNA 4FT0A 5FTJA 2HZIA 5CALA 4C61A 2WSEF 1Z57A 3GPYA 4EUUA 1NY5A 4H36A 4JDHA 2J2IB 4ANSA 2VX1A 1WBPA 3R71A 4RNAA 4GRIA 3KOZE 4JRVA 5CSXA 3B7QA 1OB3A 3Q4TA 3SMSA 4NU1A 2GQGA 3KSJA 2ITUA 1KE8A 5CANA 1NT2A 4BI2A 1U5RA 4MXZA 4GU6A 4W9XA 4FTRA 5HE1A 2GNLA 3F88A 2VO6A 4FODA 3GFWA 4IXPA 1ZYSA 4X3FA 4XHKB 4JIAA 1DGBA 5AUTA 5BYYA 3F2RA 1RW8A 3F69A 4RC3A 1SVGA 2JDRA 3PJ2A 4FV1A 4CZTA 2QOIA 4CTCA 3GC7A 4RG0A 3OWKA 2UVYA 4TNDA 5FM3A 3GQ3A 4EHGA 5C8MA 2DZOB 3C51A 4KHPM 2JY7A 4YJVA 4ANOA 3KRJA 2WOTA 2AUHA 4IDVA 3BXWA 5EP3A 5C8KA 1MRYA 3Q4UA 4L00A 4L8RC 5KMLA 2XZUA 5CNOA 3MFTA 4KB8A 4NYEA 4EOJA 1OL5A 2VTNA 1XMMA 4EH2A 1CUKA 3TQSA 5L6WL 2A4LA 1J5EM 4U43A 2A98A 5H2UA 2SRCA 4WBOA 3M11A 3U9NA 3OHTA 1R78A 2CUZA 4RA5A 2W1GA 3A45A 3RGFA 2GNIA 3PVUA 2IW9A 4K2RA 2DAGA 5TO8A 3W0FA 2ZM6M 3AOXA 3MGYA 3KXGA 3FY2A 2BAJA 4U8ZA 3MJ5A 3WBLA 4BCOA 3FLNC 4ACMA 2ZYBA 4FTCA 4PDPA 4F70A 3BEGA 4FZ7A 2L4FA 4U6RA 1R39A 5L3AA 1XC8A 4RPVA 4O21A 1LUFA 5EM6A 3UZPA 2XZSA 1E1XA 1L2BA 3ZFMA 5FTGA 3LFDA 5HIDA 3A7GA 4O0WA 4I20A 1K3XA 2ZFYA 2R3PA 3SA0A 2W5AA 3DQWA 4D58A 4AP7A 3TI1A 2R0UA 3TUCA 4O4BB 3NSZA 1HCLA 4UMUA 3BI6A 3PXYA 4C36A 3VQHA 4QP4A 3MYGA 4DYMA 4GH9A 4JMQA 4HZSA 5AIKA 3U61A 2E2BA 2W82A 3QTUA 3B2TA 1WFCA 4B9DA 3W68A 4XV9A 1BL6A 2FYSA 3ZFYA 3ZONA 4YJSA 3J81S 4TN6A 4FT5A 3COKA 1YI6A 3A8WA 3PFQA 4UMTA 2C98A 5DIAA 1OUYA 5JI3E 4UMQA 3QL8A 3JR4A 4FEWA 2BRBA 1XHAA 5IMEA 4XG4A 5AP6A 4CLIA 4D2PA 1IXZA 1YWVA 4W8DA 1W2FA 4F6UA 2PVFA 4DH7A 3RNIA 4AZEA 5BNJA 1T45A 4IJFA 5GIPE 2EKFA 4FV5A 2JA2A 1IN5A 4KABA 2Z8YM 4AW4A 4TW9A 2F2CB 1U54A 1G5SA 5IISA 4AFJA 4RFMA 3GU5A 3OCSA 4BTFA 3FUXA 5EK7A 3S00A 3TXOA 3SDJA 1PJKA 2VTQA 3U8WA 3PVBA 3F66A 3EN7A 2ZB1A 4J98A 4CKRA 5EXSA 1IQPA 2XNOA 4GCJA 3EJ1A 1A9UA 4OTDA 1ZAOA 5KMJA 4GKJM 2GHLA 4EQCA 4RBLA 4FWHA 4R3DA 2RL5A 4Y28F 2W9ZB 4Q5HA 2QBYA 5CNNA 4A06A 1REKA 1V92A 1OVEA 4V0GA 3DPKA 4BCIA 4BKJA 4LZZA 4GK2A 1VZOA 3F9NA 3HRBA 3HJQA 5JZJA 3GRVA 2F49A 3IOKA 3VNTA 2BVAA 4NFNA 3KCFA 5E92A 2VWBA 4RF0A 1QPCA 1J7UA 4D55A 3OD6X 4HLQA 4RWLA 2R2PA 5IA4A 3E87A 3QLGA 1IXSB 4C34A 3W10A 1QAQA 4CRLA 3W0MA 4IH8A 4CYJA 2HL7A 3W18A 4LGGA 2V7OA 4KAOA 4Q2AA 1HNZM 3R04A 4DR1M 1GOLA 5EXXA 4MVFA 4E73A 3LMMA 3P5KA 4DTBA 2LHCA 4RRVA 1AD5A 3HNGA 3P1AA 4U7ZA 5JH6A 3W0SA 4IX3A 2QOLA 3E46A 5F4NA 1GZ8A 4YBJA 3D94A 4PP7A 1UVRA 3VF9A 3PXKA 3B7NA 2XNBA 4F78A 2K6BA 4TPTA 3Q52A 5J7HA 5JFSA 5HZNA 4CFNA 3MB7A 2VF8A 2CV0A 1NVSA 2UW0A 4QMVA 3G0FA 4YLKA 1Z5AA 5KPZA 2Y4IC 4FCWA 4J71A 2ZV8A 5C4KA 3GO8A 2B3TA 3R28A 3R7OA 2GQRA 2GNJA 1J7LA 4QQJA 2W1EA 4IAIA 3PSDA 3CGFA 2RKOA 3LXLA 3QCYA 4O7ZA 4IIRA 3H9RA 1LR4A 3CPBA 4M84A 4FF8A 4XNEA 4XRLA 3TDWA 4DCEA 3POOA 1XHBA 5BMSA 5ACKA 4O27B 2Z7JA 4M66A 3RPRA 2BIKB 1H4LA 3SGCA 4B7TA 2J50A 3TE6A 4M0DA 4LJ6A 1FVRA 4B4LA 3KF7A 2LAVA 2LBCA 1H26A 1IA8A 4M9ZA 4M7IA 2C5RA 1I94M 4Z55A 3DAKA 2J6MA 2X2LA 4WRGA 2JDVA 5HD4A 3NEWA 3NWWA 3LE6A 4QYEA 3KP1E 2WTKB 2FGIA 3AKJA 3HY5A 2ITVA 1YDTE 3IGOA 4YO6A 4QNRA 4GMQA 4M8TA 4MQ2A 4DEAA 3Q5ZA 3UQFA 2FSOX 3HA6A 1OIQA 3DS6A 3FZ1A 2GQFA 4EH8A 3BLQA 4GJ3A 1YI4A 3HP2A 3CIKA 1OL1A 1G3IA 2EA0A 1L1TA 5TE0A 4OBQA 3GLIB 2ZMCA 3HV3A 4BIDA 4X7QA 3AMYA 3M0EA 3POZA 4FNZA 2XIKA 4YTIA 4TYGA 4DA5A 2Z7LA 4Z6YA 3EIDA 5CI6A 3SARA 5KMMA 3ITZA 5D11A