4AZFA

Human dyrk2 in complex with leucettine l41
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
409
structure length
404
Chain Sequence
HHHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DYRK2 DUAL-SPECIFICITY TYROSINE-PHOSPHORYLATION REGULATED KI
publication title Selectivity, Co-Crystal Structures and Neuroprotective Properties of Leucettines, a Family of Protein Kinase Inhibitors Derived from the Marine Sponge Alkaloid Leucettamine B.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 404
sequence length 409
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4azfA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4azfA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4azfA02
3ZSIA 3I6UA 4IC8A 3RBWA 2PMNX 5CAUA 5GINE 1P4OA 3PRFA 3MWUA 3RGFA 3WYYA 1T45A 2O2UA 3KB7A 5J5SA 4HCTA 2BIYA 3QQKA 2G1TA 3OW3A 3BHYA 4YZCA 4AXAA 3HRBA 1PYXA 4R7HA 3R6XA 1BI7A 3SA0A 3ANRA 3MIYA 4K33A 5BVEA 2IWIA 4MVFA 4JL9A 4EKLA 1SVEA 3MPAA 4RJ3A 2YM6A 5AAFA 4YTFA 3ODZX 3QRKA 2R3QA 2CLQA 5J7HA 5EQPA 3S3IA 3FQSA 4BCJA 5LVOA 3A7IA 3R8LA 4FC0A 2R3GA 3BI6A 5KX8A 5GJFA 3TIYA 5E7RA 2UW6A 3BLRA 3TACA 4FEXA 4DA5A 1ZZ2A 3NUXA 1YI3A 5IF1A 2WZJA 5J95A 1AQ1A 4DBNA 3L8PA 4HGLA 5AV0A 1ZZLA 4GEOA 4M7IA 3I60A 3K5VA 4PWNA 5KMOA 2PPQA 5E4HA 1VJYA 3DJ7A 1W83A 1FGIA 3I79A 2QOLA 3RAWA 2HY0A 2GHGA 4YZBA 3ZTXA 2PUNA 4PMMA 3AXWA 3BE2A 5K4JA 3BLQA 3KRWA 4W9WA 5HLNA 4RZWA 3GCSA 4QTCA 4HW7A 3C4XA 2ITOA 3MJ1A 5CU6A 4GS6A 2RFDA 4RX5A 3MESA 3GFEA 4ACCA 1GIJA 3WILA 2KTYA 3PJ2A 2CGVA 1KE9A 3WF9A 3QQHA 4FT5A 1JAMA 3QWJA 4ZIMA 4NW5A 1APME 2OFVA 4RFZA 5F94A 3LLAA 1J91A 5AP5A 4BI0A 5BNJA 3PXFA 1PF8A 1SNXA 1PW2A 2B9IA 1WBPA 2IVTA 3DTCA 5HKMA 4H1JA 4R77A 5AFVA 3LCKA 3Q4ZA 3VS6A 1JKSA 5G6VA 4FKTA 5HLPA 1WBVA 4QMWA 4FSQA 2UZLA 3KC3A 1STCE 2I1MA 3Q32A 5HGIA 2XK8A 4YPSA 3PRIA 5BYZA 5BMSA 5J79A 2VWXA 2QOIA 2VNWA 3HV7A 4CD0A 5H8GA 4K11A 1WBSA 4EUTA 4IVCA 4ZSGA 4NCTA 5I5ZA 3IG7A 3R7VA 4ALVA 2HZ0A 3R9NA 3PIXA 4AA0A 4H39A 1U46A 3MY1A 2XA4A 1ZY5A 4ANBA 3GC9A 3QUDA 1H1QA 3TTJA 1W7HA 4YO4A 4ANOA 3MDYA 5JFVA 3K3IA 2QONA 3PJ1A 3ZXTA 4YTIA 5JGDA 3OG7A 4FKUA 1WZYA 3CKXA 3QBNA 2C0IA 5F20A 2OJGA 4C4GA 3FMJA 2GDOA 5ETCA 3BRBA 3TNIA 4G34A 4ZS0A 2C68A 1OUYA 2BDFA 3CPCA 4GIIA 5HESA 4FA2A 5FXRA 1Y8YA 3PTGA 4E1ZA 5DRBA 4KRDA 5M44A 3Q52A 3C50A 4EC8A 1OVEA 1OB3A 3FY2A 4QRCA 3A7FA 3NAXA 4V0GA 4I6BA 3TUBA 1M52A 5LJJA 3R1QA 2VX1A 1FQ1B 4CQEA 4PP7A 5JN2A 3LHJA 4OLIA 4F7JA 4RVMA 2YIYA 3DKOA 4PPAA 4J8MA 3TT0A 3UC3A 4DEIA 2PVFA 5IA2A 2BAQA 2X39A 1IG1A 2UW9A 4IAZA 3DXQA 5CVGA 3KEXA 1URCA 4IM0A 4ZSAA 3NPCA 3PA5A 4O0XA 1OIRA 4O82A 3HMIA 3G2FA 2YN8A 3GU8A 3QD3A 4I4EA 1ZXEA 2FGIA 2E9VA 2B54A 3FDNA 5M06A 2YM3A 2W5BA 2WTWA 3IGGA 5AP1A 3FWQA 2J9MA 3UOJA 3TKIA 2G2HA 2WEVA 2VWUA 4ZXTA 5KHWA 2WB8A 2CNQA 2A0CX 3G15A 5K5NA 2RFEA 1H28A 1VYZA 1H8FA 3AC2A 3ORXA 5AR3A 4DFBA 4YHJA 4C59A 4DLJA 5CASA 4D1XA 2JDSA 3NUSA 3WF6A 4FEVA 4DLIA 3R7IA 3JPVA 4UWCA 2QO2A 3QRJA 4IC7A 2O64A 4JI9A 3ZOSA 4PTEA 3PA3A 4DEDA 4TTHB 3E7VA 2W96B 4YZDA 4ZSEA 4EH4A 4J95A 4E5AX 4PMSA 1WAKA 2B9JA 3GU6A 2PZIA 2VD5A 3H3CA 3FI4A 3F69A 4M67A 5IEVA 5IZFA 3KL8A 2GHLA 3NNVA 4FZ6A 2F49A 4AZTA 3QRIA 3O23A 2VAGA 1P4FA 1QPEA 3LW0A 3PP1A 4IE9A 4XOYA 5L4QA 3FMDA 2IZRA 2R3OA 3UP2A 3BKBA 3VBTA 5FTQA 5IDNA 5LWMA 3FSFA 3NEWA 2CGUA 1I09A 1PXIA 4GT5A 4R8QA 3ZCLA 3ZC5A 1KOAA 2VRXA 5EM5A 4GYGA 3OP5A 3VHKA 4B8LA 3QTZA 4PUZA 2WMTA 2H96A 4FKQA 5C26A 3GC7A 2YCRA 4RGJA 2H9VA 5C03A 4CRSA 4YR8A 4ZY4A 4TYHA 4N4SA 1H4LA 4GV1A 4MWHA 5FXQA 3OCTA 2VN9A 4M84A 5CSXA 4I3ZA 4TWCA 4FGRA 3A8XA 3R1SA 2YIRA 4YBKA 3CTQA 4I24A 3SAYA 3VO3A 4FTIA 5AV2A 2Y4PA 2YWPA 4S2ZA 3Q96A 5EYMA 3A2CA 4JAIA 3OEFX 5FP5A 4DC2A 1JWHA 5DWRA 2YM5A 3EMGA 5AV4A 4FICA 3B8QA 2QVSE 5ACBC 3JS2A 2OJ9A 4TWNA 2QKRA 4KIKA 4OW8A 3P1AA 2ZMDA 3PUPA 4W4WA 4BKYA 3Q6WA 3NUUA 1OKVA 1UNGA 3NCZA 3OMVA 4MK0A 4AP7A 4CMOA 5ANGA 2OF4A 3UNZA 4KSQA 2WFYA 5H9BA 4QTBA 4XG3A 4RJ4A 4DGGA 4FZDB 3D5UA 4GT3A 4BRXA 4NIFB 4CKIA 4QTEA 1PMEA 3QTSA 4BHNA 1ATPE 2E2BA 3PE1A 4DFUA 4RX9A 5E8WA 3HV6A 4R3PA 4TXCA 4IWPA 2VX0A 3OROA 4WIHA 1FGKA 3RM7A 2I0YA 2LAVA 1PXKA 4DH7A 1GIIA 5ETIA 2GS6A 5AX9A 4C4HA 4F1OA 5ETAA 2VTMA 2JLDA 2ZB0A 1OECA 4CSVA 3RP9A 4FT3A 4LV8A 4CTBA 4FT9A 3TKUA 3C4WA 2CCHA 2W7XA 3Q6UA 5AR7A 3UIBA 3FE3A 4DN5A 1F0QA 2YIWA 5K9IA 2UW0A 3ENMA 3CIKA 3BQCA 2HXLA 4P4CA 4QP7A 1K9AA 4X6QC 2UV2A 1UKHA 5CQUA 5L8JA 4AN3A 1OMWA 4CNHA 1A48A 4EH5A 2QC6A 2XRUA 3UVRA 4BCIA 1PRYA 4O0VA 4GH2A 4O0UA 5AM6A 4IW0A 1FVRA 1ZMWA 1M17A 1Q8YA 3GCPA 3QTIA 4L9IA 3VW8A 4RX7A 3IQ7A 3HMOA 1DI8A 5HG8A 4QOXA 3NNUA 4K18A 1E1XA 3DS6A 4V01A 3R7YA 5EOLA 4L67A 5HLWA 4MBJA 4ZTNA 4EOJA 2QQ7A 3DNEA 3HV3A 3N4VA 3VS7A 3N51A 4I0RA 4Y95A 3LFEA 4NEUA 3GGFA 3HYHA 2XIKA 4GJ3A 5AWMA 4RLLA 4MD9E 3Q3BA 4OTRA 3M11A 4FTCA 5M4CA 3DJ6A 4YC3A 4O0RA 3EFJA 4CFUA 3R04A 4JQ8A 4FK6A 2R3LA 2A27A 4FOCA 4BCOA 1CDKA 1FMOE 3C0GA 3FLSA 3PG1A 4U7ZA 3UE4A 3Q4TA 1REKA 4DYMA 4M97A 2RKUA 4MQ1A 2CKEA 4MXOA 4XG9A 3FI3A 5HCYA 5TR6A 3UMXA 2IO6A 2R4BA 4AGCA 1ZRZA 1DAWA 3EKKA 5H3QA 1O6LA 2REIA 4IAFA 4UBAA 4A7CA 4AT3A 4XS2A 3CBLA 3LXNA 3ZEPA 3QC9A 4CKRA 2PMLX 4L53A 2HENA 4R7IA 5EI2A 4FG8A 1JNKA 1YI4A 4YC6A 3MVHA 3MYGA 2BRNA 4BIBA 3EN5A 5LOHA 3R83A 3QGWA 1OIYA 4YTCA 4WG3A 5CTPA 3LPBA 3RAKA 4AW1A 3D2IA 2VTTA 4L42A 3GU5A 4FUXA 1RDQE 4X2KA 3JXWA 2UW3A 2ETMA 3WYXA 3TNPC 5GIOE 4YHFA 2YIXA 5A54A 5FGKA 1OIQA 3E5AA 1YXXA 3NDMA 4ZK5A 3QKLA 3NUPA 1W8CA 4HGSA 4H1MA 4UEUA 5H2UA 4RLKA 2YACA 3FBVA 5AR2A 2WQNA 3EN6A 3W2OA 4CZYB 3E8NA 3HMPA 3UNJA 2JGZA 5EK7A 4M69B 1WVXA 5BYYA 3MFTA 4AN9A 2RL5A 5E91A 5AUZA 4QP2A 5AJQA 4BKZA 3OD6X 5C4KA 4MD7E 3BLHA 3C7QA 2XVDA 5J9YA 4BCNA 2C6TA 2XK4A 4TYGA 4X21A 5E8ZA 5J87A 2W05A 3LZBA 5M55A 2B1PA 4B7TA 2RFNA 3ODYX 4D0WA 5DPVA 5AP2A 3SHEA 3S0OA 1U54B 4AUAA 3QRUA 3HA8A 1Y8GA 1BMKA 5L8KA 3UVPA 3OBGA 5D9HA 2PVMA 3DBFA 5C8KA 3ZUVA 4UYNA 3R30A 3ORIA 3PY0A 5DEWA 3DFCB 4ACHA 3UP7A 2OO8X 3T9IA 4BDDA 4FV2A 1QPCA 1H26A 3CCNA 2C3JA 1VYWA 4KBCA 2Z7RA 4Y73A 3TNQB 2GSFA 2WAJA 4U3ZA 1WVWA 3RAIA 3L1SA 5EYCA 4X3FA 3NUAA 4Z16A 2QLQA 3F3WA 1KUTA 1G8SA 4JVGA 2Q83A 3RPVA 3R7EA 1Q41A 3DBCA 2UZOA 3RPRA 4AFJA 3H9FA 3BX5A 4R6VA 4PMTA 2W1GA 4FT7A 5EOBA 3CY2A 5HCXA 4AZSA 1Z5MA 2VO7A 3FZTA 5DRDA 3UQFA 4CLIA 1G8AA 4D9TA 4L3JA 3VQUA 1JOWB 3UGCA 1XQZA 3NAYA 4EK4A 3UQGA 4Z3VA 1XH6A 3DA6A 3FLWA 3TM0A 2G01A 4YJPA 3FSKA 4W4VA 4DGNA 3OT8A 4AGUA 3F3VA 4B0GA 4MNFA 5J1VA 2DWBA 2ITUA 3R00A 1M7QA 4NSTA 4XV3A 3AGMA 5JT2A 3UPZA 2XKFA 3DDQA 3KCFA 3PG3A 2BRHA 3PXRA 3FV8A 3HAVA 4AZEA 4QMPA 4RWLA 4I6HA 1KE6A 3VBXA 5IQGA 2UZEA 2Y7JA 4Q2AA 3SXFA 4L44A 3T9TA 2XMYA 3MH1A 1E9HA 2EB3A 3DJ5A 3E8EA 4CMUA 2A2AA 3LIJA 3QCSA 4JBVA 4LRKA 4TN6A 2JIIA 4ALUA 3A62A 3KK9A 4O86A 3O50A 3FMKA 4G1WA 1PMUA 1ZYSA 3DLZA 3LCSA 4FV3A 3A4PA 2R3PA 3U9NA 1UA2A 3PZEA 3L9PA 1SYKA 3UNKA 2GNJA 2X7GA 5IH6A 3W2SA 5JQ5A 2X8IA 2I7QA 5KMLA 4DFZE 4CLJA 5DYJA 2V22A 4I93A 3FLYA 4KKGA 5AP0A 5EG3A 1M14A 1Q24A 2GNLA 2OJIA 3PPJA 4I23A 3GI3A 3QD2B 2J0KA 3C9WA 5LVLA 3DGKA 1Q4LA 4HZRA 2OJFE 4MEDA 3TJCA 5CAQA 2UZUE 3I1AA 2VTHA 2W4KA 4ITJA 5F1ZA 4BCFA 2J0LA 4HOKA 5HQ0A 1YW2A 2R3NA 1RE8A 3B2WA 3VBYA 5CU4A 1MUOA 2PVLA 2ZV2A 3WZKA 2PUUA 2PVHA 1OKYA 1Q3WA 4FTLA 4JR7A 4AU8A 4C36A 3U6IA 3I5ZA 1Q8UA 2NNWB 4I0SA 3OW4A 3QQUA 3ZFXA 4AGWA 4CG8A 4EK6A 1DS5A 2JKOA 5EH0A 3VJNA 3SRVB 3EFWA 1YOLA 1TQMA 2HWPA 3FKNA 4KABA 5LMKC 2PMIA 4NK9A 3IS5A 2ZM4A 3Q2MA 3VVHA 3LCDA 5M08A 3K5UA 4L8MA 1SZMA 4S31A 4G6LA 4P5ZA 2OSCA 5E9EA 4EJ7A 4GVAA 3VS1A 2OI4X 2W1FA 3DKFA 4HVIA 1KE7A 3ID6C 3R9HA 4RQVA 2XJ2A 4RIXB 4XX9A 4C2VA 3EN7A 2YLEA 4BWPA 2W1EA 1XBBA 3CS9A 5A4EA 2WXVA 4FL2A 1IASA 2W1DA 4ZTMA 1YKRA 4AA5A 5KMJA 2GQSA 1M7NA 1PXPA 1XBCA 2YIQA 4KUJA 4LL5A 4ZJIA 4AFEA 3C13A 1Q8WA 2EB2A 3P7AA 3NUNA 3O8UA 3ETAA 4BHZA 3I6WA 2WQOA 3LCTA 4CFXA 5IG1A 5HOAA 3PXYA 3ZUUA 3QU0A 4JIAA 1UU7A 4F9WA 2PL0A 4D55A 3PFQA 2OBJA 3TZMA 2BR1A 2PVRA 3FQEA 3WE4A 2I0HA 4YLLA 4UN0C 3O17A 3QA8A 5FDXA 5FDPA 4GVJA 5DH3A 3GU7A 5IU2A 4PPBA 5J9LA 3TDWA 5IDPA 2UW8A 3E92A 4GK3A 2ITQA 5HICA 2XRWA 3ALNA 3QQGA 5FG8A 2Z2WA 1R0EA 3COKA 1PXJA 4OR5A 4BBFA 3GNIB 3KF7A 3QKKA 4APCA 2C30A 1OL7A 3BV2A 3PVWA 3BQRA 3NYVA 3QZFA 2DYLA 5TOZA 4CYIA 4D2RA 4E7WA 4BWKA 4EZ5A 5JGBA 4BY9E 3NYXA 1ZOEA 3BBWA 2NPQA 4DFLA 4D2TA 4XRJA 1PXNA 3ORKA 3V5PA 3CEKA 4EHEA 4K2RA 1UU9A 4NM7A 3ALOA 1K2PA 2GNHA 5M4IA 4AE6A 3DAJA 3OY3A 5LMAA 3U6JA 3D14A 3UJGA 4O6LA 4EH3A 4DEBA 3MFUA 3SQQA 5KBQA 2O3PA 2J0MB 3DFAA 2GQGA 3CTHA 4FNYA 3TIZA 3P08A 4HNIA 3PXQA 4X3FB 4XG4A 4YC8A 3QALE 3ZRMA 2PZYA 4MXAA 3KMMA 4XG2A 1RJBA 3RHXA 3VNTA 2QCSA 1Q62A 4MCVA 2HW6A 3EFLA 3E7OA 3B8RA 5E8YA 4E6DA 4G3FA 5J9ZA 4OBQA 5CF8A 2JD5A 3BYUA 3E63A 1OPKA 1YRPA 3BHUA 4UY9A 3OUNB 4CFVA 3KREA 4XH6A 5EI6A 5ITAA 2EVAA 3SOAA 3LFBA 4G6NA 4OT5A 4W4YA 3ELJA 2J5EA 1ZYDA 2R3KA 2V7AA 3RAHA 3LFFA 4DFNA 3WOWA 1BL7A 2PULA 2PYWA 2ITYA 3CGOA 5EYKA 4U0IA 1SMHA 2Y9QA 2Y0AA 4OTGA 4U42A 3OCGA 4ALWA 4ASXA 5CEMA 4A4XA 3HZTA 2EXCX 3A7JA 1LR4A 3R73A 4BDFA 4QMNA 2WO6A 2VTNA 3KCKA 3QGYA 3E3BX 4PL4A 2OF2A 4AF3A 3U9CA 4NWMA 3ZEWA 4XLVA 3DXPA 2PSQA 4XV9A 4CMTA 4RX8A 4QYHA 3GCQA 3AC1A 4FTQA 2ZMCA 4RSSA 3SVVA 5G1XA 4IJ9A 4BCKA 3VJOA 3VC4A 4DG0E 4M0ZA 3PIZA 4BGQA 4FI1A 2QHNA 3G90X 5IQCA 2C6OA 2XYNA 1M2PA 3F2NA 5AA9A 3MW1A 2ONLA 2C6LA 4XBRA 3VBQA 4E5BA 3LCOA 2XJ0A 3FL5A 3DPKA 4E6CA 5IH5A 4ACDA 2WU7A 4H05A 4KINA 4UMTA 2C6MA 4MNEB 5HO6A 4D4YA 2A1AB 3QRTA 5CI6A 3KMUA 3AG9A 1BLXA 2JFLA 4EOLA 3UYSA 3MGYA 2IZUA 3Q60A 4G3DA 4NYEA 1XR1A 3DXNA 5J7BA 3WF7A 3C4CA 3KXNA 2ETKA 2XCKA 3MVMA 5HNGA 4AW2A 4FR4A 5HE1A 3H30A 4IDVA 3VW6A 4FIEA 1O6YA 2V62A 3P7BA 4IX3A 3F66A 5M56A 4JDKA 2ZVAA 4LUDA 3V5TA 4ANQA 3P79A 2QO9A 4GCJA 5HG7A 3W2RA 4F08A 4O7WA 3IGOA 3U8WA 5CALA 4FOBA 4FTUA 3FQHA 3R7OA 4E93A 5HTBA 3CQWA 4QP9A 3EHAA 4BZNA 5CAVA 2F4JA 4GMYA 3DB6A 1KWPA 4C4JA 3CY3A 2CLXA 5CSPA 3DDPA 4F4PA 4MXYA 1AD5A 4PV0A 4GT4A 3OCSA 2XKCA 3NNXA 4IX6A 4RIOA 3ZXZA 4FNZA 4Q5EA 1ZOGA 1WVYA 2CPKE 2R0IA 2YISA 4U81A 4C57A 1W98A 5DIAA 3OWKA 4FTTA 4XBUA 2VWYA 3EWHA 4USFA 3CPBA 4HYSA 4KNBA 3QD0A 5GJDA 4AWIA 3A7GA 4OTDA 5HZNA 4O2ZA 3AGLA 5D10A 2XK3A 4LGHA 4JDHA 2V7OA 5DR6A 4FVPA 4BI2A 4IAAA 5HO8A 3LXLA 4GKIA 2C0OA 3HMNA 3MY5A 4PDOA 5A4CA 4C4FA 3AOXA 3R01A 4O0WA 5D41A 5CVHA 3Q9YA 2C1AA 2JDVA 3UZPA 5IMXA 4IJPA 2VWBA 2Z7SA 4C8BA 3EQIA 5IKWA 5E8UA 2XS0A 3RZBA 5CQWA 2VTIA 3EJ1A 1LEZA 4FZAB 2WQEA 3DK7A 2VU3A 4RIYA 4EOSA 4F0GA 2B7AA 4E20A 2FA2A 3BYSA 3QXOA 4I41A 4C34A 5EW9A 2V5QA 3G9NA 1OI9A 3CTJA 5EKNA 3P0MA 2W4JA 5T68A 4EEVA 1FOTA 4QQTA 3MB6A 4EOIA 2J50A 4UYAA 5ETFA 4AN2A 4LL0A 1XWSA 4N0SA 3DY7A 2OXYA 4QYGA 3K2LA 4O38A 5A14A 3R7UA 4D9UA 3UO6A 5CS6A 4QMSA 4LG4A 4KIQA 5K5XA 5KUPA 2FO0A 4QMXA 4L68A 3DBEA 3ORMA 3OTVA 4FKSA 4J71A 1MRVA 4BBMA 1PXLA 2CGXA 2HCKA 4M8TA 3TV4A 3LQ5A 4E3CA 3TUCA 4CT1A 4YNEA 4U45A 3KXGA 4NM5A 5ANOA 4NTTA 4U8ZA 3ERKA 1GZOA 4XG8A 4I20A 1Q8TA 2OFUA 4X6RA 2IW9A 3TWJA 1MQBA 4IX5A 4UMUA 2ITNA 3HV5A 4QQJA 4S32A 3I4BA 1FVVA 3KN6A 4KKHA 5CI7A 4DITA 3V5WA 4R5YA 1IR3A 3W8QA 5JSMA 2HW7A 2YABA 4F6UA 2C6KA 5JH6A 4I5HA 2C6IA 3E64A 4NZWB 3OY1A 5JZJA 2C0TA 1Q61A 3IO7A 2VWVA 5GNKA 3A7HA 4X2NA 4IVDA 4M14A 3QKMA 5I9YA 4FKRA 4FEQA 2CMWA 2ITPA 3WZEA 3HNGA 5AA8A 3ZC6A 2C69A 3GQIA 4E8AA 4HVHA 5CAOA 5J5TA 5GHVA 4X7QA 4FV8A 3FEGA 2BRMA 4IZAA 4W8EA 4QMVA 5CY3A 4PY1A 5EHOA 4DT8A 3FI8A 3QHWA 3FYJX 4FGBA 3V51A 4O2PA 4I5MA 3C5IA 4BB4A 2X4ZA 2OU7A 3DQXA 5IUHA 5LMBA 3PDTA 4TT7A 4D58A 4YBJA 4EBWA 3VF8A 3FZ1A 4EQMA 3BGPA 3ACKA 3KKVA 3RMFA 4IH8A 4UZHA 4G5PA 1A06A 4GL9A 1DI9A 4J1RA 4EHGA 3LXKA 4DEAA 4BWXA 5L6OA 5C8MA 4HYIA 3BHHA 2Y6MA 1F5QA 1J7IA 1JKKA 5EHLA 1GJOA 5IQDA 2OZAA 2PK9A 2OH4A 4RFMA 4FBXA 4IEBA 4C58A 2ITZA 1XH4A 2E9UA 5FWKK 4DFYA 4YJUA 4ITIA 4MF0A 4YGAA 3WF8A 2G9XA 4XP0A 3OFMA 1R78A 3HECA 4FYNA 5AUVA 3EKNA 3IW7A 2BAKA 4JBOA 4MXCA 4ZY5A 1YHVA 3L9NA 4G3EA 3VWAA 5HBJA 3F2RA 2HZ4A 1YDRE 1YXUA 5IA4A 4WOVA 3Q4CA 1XH9A 5AEPA 4NFMA 5FEEA 5CNNA 4XG6A 4YUQA 2P33A 4G2FA 5GJGA 2WD1A 3LAUA 1Z9XA 5E1EA 5L6PA 3UO5A 3QZGA 3EQDA 2UW7A 4FIFA 3QF9A 4FTNA 4EH8A 5AP7A 2E9PA 5CLPA 4J8NA 3ZO2A 3KFAA 2XYUA 3MFSA 2OG8A 4M66A 4N70A 4QO9A 5E8TA 3TXOA 3JR1A 5BVFA 2ZV9A 4R1YA 4QMUA 1PMNA 4RMZA 2XIYA 3OCBA 1Q99A 3NRMA 4JT3A 1U5RA 2R3MA 2W0JA 2YLFA 2XNEA 4QMOA 5DVRA 3RK5A 5JEBA 4DF3A 3PSDA 2YDKA 5FUTA 2I6LA 1TVOA 2BZIB 5EHYA 3II5A 3FKOA 3AT2A 4KSPA 4Q9ZA 4MHAA 3RK7A 2ITWA 3G0FA 5ANEA 4C02A 2XEYA 2QODA 2QNJA 3MTFA 3H10A 3VRYA 5E8VA 3WZJA 3PVUA 4BGGA 5ACKA 2FB8A 2F2CB 1WCCA 3QYZA 2E9NA 3BEGA 3CJGA 4GFMA 3UIMA 3QQJA 1KE8A 1ZYCA 2DUVA 1W82A 3GUBA 3VHEA 4HYUA 3W33A 2B52A 2C6DA 4J52A 1ZMUA 5JRSA 3TZ9A 3UBDA 4CV8A 4ZTSA 3KVWA 4TKSA 4YP8A 4B99A 5BVKA 3GB2A 4EH6A 3GENA 4U6RA 1PXMA 3F9NA 2AUHA 3F5PA 4PRJA 2XUUA 3FL4A 3U6HA 3BU5A 4YSMA 1JSTA 2BRGA 3LMHA 2ERKA 3EQGA 4M15A 4UMQA 1OITA 5E90A 5C1QB 1RW8A 2PZ5A 3E8CA 3GXLA 3MFRA 3QL8A 4AS0A 5DR2A 2WMUA 2BDWA 3PWDA 2JKKA 4FVQA 3F5UA 3V5LA 4QTAA 2HK5A 4F99A 4GU9A 4OTWA 2XKEA 2ZB1A 3G6GA 3IOKA 5I9UA 4FEWA 4E4MA 2AC3A 3TTIA 4GW8A 3ZDIA 4EYMA 5L2IA 2WQMA 2WTVA 1W0XC 4A4OA 2YM8A 4AZVA 3C5UA 3TZ7A 2XNMA 4YZNA 2VGPA 2XBJA 3KU2A 4IACA 3ZDUA 5A4LA 3ATSA 3EB0A 5DI1A 2C5VA 3FXWA 3NIEA 4F9CA 4JIKA 5CEKA 4FE2A 1SVGA 4FNXA 2JBPA 1XH5A 4ZSLA 3P4KA 4O27B 3WI6A 1GZNA 5GZ8A 3VS3A 3HX4A 3QUPA 2G15A 4FTJA 3TNWA 3U4UA 1YXTA 2UW4A 5EW8A 3V6RA 4O21A 3QTUA 4ZTRA 3D7TA 3NYNA 4FSMA 3U4WA 2P2HA 3QCYA 2X1NA 3BBTB 2FVDA 1NA7A 4J7BA 4U3YA 4OAUC 1BL6A 3DZOA 2R3RA 2I0EA 4V0GB 4D1SA 4IZ5A 3UO4A 5AR8A 3G33A 4PDSA 4BZOA 1MP8A 5AP3A 3CD3A 4RJ5A 5TF9A 2WU6A 4R3RA 5KBRA 2HXQA 4HVGA 2ZOQA 5I3RA 4BTMA 3KRRA 4WD5A 1OL1A 3ZLXA 5DG5A 3M1SA 4KAOA 5CNOA 2XM9A 3MJ2A 3HA6A 4II5A 3UC4A 3RNIA 3BYOA 4Y5QA 5AUTA 4X3FC 3VUGA 2BTRA 4JDJA 2C1BA 3FY0A 3MS9A 2GS7A 2FSLX 4D2SA 2XIZA 2B9FA 1BI8A 3MTLA 4RT7A 5FRIA 5BVDA 2XF0A 1PYEA 1YVJA 3VN9A 4USEA 4F7NA 4RC3A 1ZYJA 1CMKE 2PTKA 1NY3A 3FAAA 4J53A 2VTOA 4MBIA 3EQFA 4XJ0A 5CXHA 2OW3A 2X4FA 3NYOA 4G3GA 4EL9A 5IQHA 4G17A 5AIKA 2W9FB 4NW6A 2OICA 2LGCA 3AD6A 3QA0A 4J97A 4XP3A 3MH0A 2W5AA 5JRQA 5M57A 4YTHA 2OLCA 4F7LA 1BX6A 4I4FA 3AC8A 4U44A 3RK9A 3RPYA 5M07A 4MXZA 5CEOA 2BIKB 2OZAB 5HU9A 3GCVA 5BUJA 4BBEA 1PMVA 2JIVA 5K3YA 1OL5A 1FPUA 1NVQA 3BGQA 4V05A 2P55A 4CQGA 5IA3A 4CCBA 1OPJA 3G5DA 4FKJA 4D28A 3CKWA 2QOHA 5HE3A 3I7CA 3COIA 4TWPA 4F9AA 3R71A 3V01A 4ASZA 4D2VA 1UV5A 5DBXA 5DT0A 5I9VA 2VTAA 5CXZA 3EFKA 3HL7A 3MH2A 4AA4A 5IMEA 2CNUA 2CN8A 2QU6A 3DAKA 3R2YA 3R63A 4EHZA 2ZJWA 5L2TA 2FSMX 3UG2A 3QQLA 3O96A 4H36A 3HMMA 4EOOA 4DBXA 4ZLYA 3OF0A 4FTOA 3V04A 2BAJA 2QO7A 3OOGA 3ZM9A 1XBAA 2OJJA 4IXPA 2ZM3A 4PL5A 4IANA 5AADA 4BIEA 4HGEA 4OTPA 3RPSA 3FI2A 3LFCA 5L2WA 1XJDA 3TDVA 2C5OA 2J90A 4TYHB 5FXSA 3VQHA 3PPZA 3WF5A 4U43A 5BVNA 2GNFA 3DZQA 3UOKA 3EQHA 3SXRA 2BZKB 2O5KA 3AT4A 1OZ1A 2XNBA 3D5VA 4QYYA 2XB7A 2Q0BA 4KB8A 1B39A 1H1PA 4FTMA 1HOWA 4BR3A 5EW3A 4N6ZA 1R3CA 3TNHA 4AACA 4UXQA 1J7UA 3W18A 2R3HA 2AYPA 4Y5HA 2WOUA 4UMPA 1XHAA 4JG8A 4KIKB 5A6OA 3EN4A 3WZDA 5HORA 3HKOA 3CJFA 3JYAA 1V0PA 2FUMA 3MIAA 4FKIA 2NRYA 3RHKA 4LMUA 2OGVA 1IEPA 4FYOA 4RIWA 3OHTA 5B2KA 5HIEA 2GQRA 3SC1A 2BZJA 3FZPA 4APPA 3R22A 1UWHA 4KA3A 3NR9A 5D11A 3W2CA 5CEQA 3RINA 1H1RA 2J6MA 4ZY6A 4TW9A 5AP4A 3HRFA 4JNWA 3UIUA 5I4NA 1QPJA 3R0TA 5AMNA 3V8TA 5JFWA 2IZTA 3OC1A 3PJ8A 4FV0A 2VWIA 3ZO3A 4OBPA 4QP1A 4BCGA 2QURA 4ENXA 5JK3A 3EL8A 2WMBA 5AIRA 1REJA 2JITA 4WG5A 3UIXA 3FZOA 3PXZA 1JQHA 5GZ9A 3W1FA 4ZTLA 3R1YA 4IM2A 4WO5A 4OTIA 2OXXA 5I3OA 2R7BA 4O0SA 5LCJA 4RC4A 3SW4A 2CKQA 1URWA 1BKXA 4HNFA 5CU0A 5I9ZA 4JJRA 4IHPA 1L3RE 3Q9WA 4FT0A 4L6QA 2JKQA 2VGOA 2X2MA 2WGJA 4BCQA 2WTKB 2X2LA 4OT6A 3UMWA 1WMKA 3QTXA 3S1HA 3ORTA 4ZTQA 4O81A 3HP5A 4YNOA 3PYYA 4QTDA 2C3LA 3E8DA 4O0TA 4XUFA 5BYLA 3O8TA 4MH7A 4ZLOA 3BPRA 4FZFB 3BGZA 2W99B 4H3BA 4QNYA 4QP6A 1J7LA 2ZAZA 3GCUA 4EUUA 2JBOA 3LFAA 1JPAA 4AOJA 3C0HA 1QPDA 4FKPA 4GG7A 4W9XA 5FLFA 5TKDA 3W2PA 3R9RA 3G6HA 5CVFA 4K6ZA 3F3TA 3I0OA 3KA0A 4WHZA 2WIHA 4XP2A 5HE2A 4LV5A 4B6LA 2CKOA 3WZUA 1YOJA 3O71A 3S2PA 3OBJA 3HVCA 4JRVA 2J2IB 3TI1A 4CFFA 4IQ6A 4BGHA 1P14A 3VS2A 1ZOHA 3LFDA 1SNUA 4FV6A 1KOBA 2WMVA 4DAWA 1IAHA 1V0BA 1Y6BA 4GFOA 4S33A 5J1WA 2B4SB 3FLZA 2BZHB 4ASDA 4IB1A 3WBLA 3ANQA 5L3AA 2R3FA 4O1PA 1FINA 4YLKA 3R9DA 4IZYA 4CGAA 1OL2A 1NT2A 3REPA 1UVRA 3Q5IA 4DG3E 4RJ7A 4C2WA 3GQLA 3QD4A 4BDAA 1YWNA 2XEZA 2UZNA 3POZA 3QTRA 2G2IA 2O63A 3NIZA 2CCIA 2CN5A 3DT1A 4FVRA 2WIPA 4RBLA 4Y8DA 4BN1A 4RVKA 1R0PA 4DEEA 4Z7GA 4O6EA 3VUDA 4EK8A 4E6QA 3QAME 1CKJA 1P2AA 2WMQA 5BMMA 4BF2A 4BI1A 5LQFA 3F88A 4O7LA 4GFGA 2B55A 2PVNA 2I0VA 3PIYA 3I7BA 4DH3A 3JY0A 1L8TA 1VR2A 2PHKA 4ITHA 3O7LB 4KIOA 4DCEA 3RVGA 3OTUA 4O83A 2UZVA 5AUXA 4IDTA 5FP6A 4ERKA 1V0OA 3P5KA 3QLGA 4U97A 3FLQA 4FV1A 4WSYA 3JVRA 1ND4A 3LMIA 5C27A 3F5XA 2BRBA 3F3ZA 5M4UA 4ZZMA 4Z9LA 3QTQA 2NO3A 3NWWA 2IPXA 5JMSA 4DGMA 1OGUA 4IX4A 2B53A 4GK2A 3QLFA 4I94A 3PLSA 3UPXA 5M09A 3NGAA 1R39A 2VO6A 4JOAA 4E73A 5KMIA 2BKKA 4R7BA 3ZLYA 3ORLA 3Q9XA 4USDA 4ACGA 3DB8A 3KXZA 5D1JA 1OBGA 2W4OA 1Q3DA 1YQJA 2ONLC 2PMOX 5IA5A 3ROCA 3L9MA 4M13A 2B9HA 4RJ8A 5ICPA 3WE8A 2GNGA 5IQEA 5EFQA 4A9RA 4C3RA 3R8PA 4RFYA 1NXKA 2BALA 4RPVA 3R8UA 3OUKA 3VBVA 3DKGA 3PPKA 2YEXA 4PF4A 5KO1A 4PDYA 1U4DA 4LRMA 5AUUA 2PU8A 2GTNA 2J4ZA 5J8IA 3MVLA 3P86A 5CEPA 4MAOA 2EWAA 3DK3A 3OEZA 2PWLA 4AQCA 4B9DA 4U80A 3ZMMA 4BIDA 5I0BA 4FNWA 4FSNA 4V04A 5HEZA 4U9AA 3HRCA 1OL6A 1H0WA 3ORZA 1Q8ZA 4R1VA 2X9EA 4AAAA 3HUCA 2YM7A 4FTKA 2J51A 1KV2A 1AGWA 3OXTA 4F0FA 2UZTA 4J96A 3Q2JA 1YXVA 3GOPA 5AP6A 4IMYA 3L8VA 4YZMA 4D1ZA 3TKHA 3HDMA 3R8MA 3KN5A 4I0TA 4CV9A 2QR7A 4QMLA 1GIHA 4CZUA 5GZAA 2C4GA 4G3CA 1VEBA 3FMMA 4TNDA 2HZIA 3BZ3A 4GJ2A 4WG4A 4X0MA 4ZEGA 3EQRA 5HNIX 3LJ1A 5M4FA 3AC4A 4JRNA 2UZBA 2HY81 3TCPA 5CT0A 3VS5A 4YU2A 3NS9A 4IAIA 2P3GX 5CSWA 5EYDA 4EKKA 2YITA 3PE2A 4L45A 2HWOA 3VS0A 2W17A 3EH9A 1BUHA 2XNOA 3R7GA 2DS1A 3BU3A 4BZDA 5CAPA 4Q9SA 4E4XA 4KRCA 4OUCA 2OWBA 2I40A 3V8SA 5BVOA 4DTAA 4F1MA 2VX3A 4NM3A 3DAEA 3D94A 2QOBA 3NSZA 4IWQA 2YM4A 3FMLA 4FTAA 4P2KA 3UQCA 4WUAA 4R5SA 3D83A 3QQFA 2E9OA 4YMJA 5IQAA 1LUFA 4C33A 4QQ5A 2H8HA 1RQQA 2RSVA 4C38A 1V1KA 3QX4A 4OAVB 3SKCA 4ACMA 2XK9A 4BYIA 3KGAA 3MSSA 4IM3A 2ZDUA 2WTDA 4U5JA 4BTFA 2WMWA 1UNHA 3U87A 2F7EE 2CKPA 5HBHA 5DT4A 3RZFA 2BROA 5FEQA 5CANA 3BCEA 4IZ7A 3QZIA 4KS7A 3DTWA 3MA6A 4XNEA 4DH8A 2XKDA 3P9JA 1JBPE 3RCJA 3EN9A 3HLLA 4TRLA 3D5XA 4EZ7A 4LM5A 4NCTC 5FTOA 4HJOA 2QG7A 5AUWA 4O96A 4XLIA 4O1OA 4ZJVA 2J5FA 4QMYA 4CT2A 1IRKA 4TZRA 5HVKA 2CGWA 2BDJA 4BCPA 2J7TA 4FKWA 2VTRA 4ENYA 5LWNA 2QKWB 1H25A 4G5JA 4HZSA 4S30A 4WKQA 4JX7A 5BUEA 3KULA 4ZS4A 3L8SA 4FKVA 5A46A 4UALA 4I92A 1YDTE 1H08A 2JAMA 3T8OA 5L6WL 4JBPA 5EM8A 1Q5KA 2GTMA 1EH4A 4H3PA 4K0YA 5AAEA 4OTHA 2VO0A 3LXPA 1YI6A 3CP9A 3C51A 3F5GA 4BC6A 3ZSGA 2IW8A 4RZVA 4CFWA 4UMRA 3F61A 4TPTA 5C01A 4CXAA 5ANDA 3ZLSA 4NKSA 1IAJA 1O9UA 3W32A 1UU8A 4LMNA 5EQEA 4CZTA 5FBOA 2OZOA 3LFSA 1LP4A 1FMKA 2A19B 3LOKA 3GVUA 3POOA 4TYEA 1ZY4A 2CJMA 2QI8A 1TKIA 4M12A 4ZSJA 3R8VA 3T3UA 1F3MC 3OVVA 1CKIA 2BMCA 4MD8E 4BDKA 3KRXA 3JUHA 5KMNA 4GKHA 4F6WA 3FXXA 5TE0A 2QG5A 3F82A 3FZSA 3LE6A 4NM0A 4QQCA 4JLCA 4BDEA 2BFYA 4F1TA 5DHJA 4F65A 3CC6A 4FSUA 5L2QA 4B4LA 2J0JA 5CU2A 2W1IA 3LFQA 3FJQE 4BCMA 3GT8A 2P4IA 5CZHA 4HPTE 4G6OA 4R3CA 1H07A 3NVKI 5JQ8A 4BCHA 5CF4A 2VWWA 5JFSA 2C5XA 2WQBA 4O7SA 2Z7QA 4OTFA 2CHLA 3EQBA 4IB3A 4DGOA 3GC8A 4OGRA 4XV1A 4RVTA 3ZU7A 1WBWA 4NIFA 4PMPA 5BVWA 4LYNA 2XK7A 3VS4A 4EH7A 5A4TA 4EOMA 1P5EA 3CXWA 4HCVA 4YPDA 3H9OA 2YCSA 4BKJA 3SW7A 4WNKA 1Y6AA 4EBVA 2GPHA 4A9TA 3H0YA 4WT6A 3U54A 3IDPA 5IUIA 1CTPE 4O7TA 4AX8A 3O7LD 3VUHA 2VWZA 3UOHA 2NP8A 5E1SA 2Z60A 4ZMEA 3EYHA 3P78A 3QX2A 4XG7A 4PP9A 5AUYA 5ANJA 4CVAA 5F95A 2UVXA 1NVSA 2Z02A 2QLUA 3QWKA 4PDPA 3ZO1A 4UX9A 2X0GA 4ONAA 3ZYAA 1YOMA 3COHA 3FYKX 3DV3A 4YO6A 2WEIA 5F4NA 3RI1A 4NJ3A 3W2QA 4A06A 4CTCA 4JAJA 3AC3A 4FV9A 3AQVA 2F2UA 4HCUA 3ZH8A 5HD4A 5IEXA 5K4IA 2C3IB 4LRJA 5EM7A 4YZ9A 3LFNA 4AZWA 3ZRKA 3LM0A 1GZ8A 4EZ3A 1IA8A 5CF5A 2X8EA 3LLTA 4UXLA 3C1XA 4FIHA 5DR9A 4IB5A 2XP2A 2JAVA 2ITTA 5K0XA 4GK4A 5FBNC 3IW8A 1KSWA 3UDBA 2OIDA 3TV7A 4EK5A 4H3QA 2YFXA 4E5WA 5DT3A 5AX3A 4DTBA 3EQCA 1Y91A 3MI9A 4WNOA 5ANIA 4EONA 3MPMA 5KKRC 5A9UA 3ZZWA 1H27A 2C3KA 2ITXA 4RWJA 5IA0A 3EL7A 4PTCA 4AW5A 2OK1A 3R21A 2HYYA 3RWQA 3VUIA 3HEGA 3TN8A 4HGTA 4C37A 4FKOA 4FV7A 4QNAA 1JSUA 3ZO4A 4BVUA 2OIBA 4NT4A 3QTWA 4BDBA 4P7EA 3V5JA 3WIGA 4DE4A 2VZ6A 3WARA 4PL3A 4WSQA 4DEGA 4F9YA 1BYGA 2R2PA 4YSJA 3MPTA 2PVJA 3C0IA 1JVPP 5M53A 1UKIA 3ZBXA 3RJCA 3HV4A 4L3PA 2RF9A 1M2QA 3E3PA 5IQFA 2WKMA 2W5HA 5I9XA 1XO2B 3UZTA 2PUPA 4RJ6A 4IB0A 2W1CA 3HAMA 1GNGA 4UV0A 5HHWA 1GZKA 3NMUF 4HPUE 1H01A 2JDRA 3JY9A 4J98A 4I5CA 3RTPA 5B7VA 3EOCA 4FZ7A 4QMMA 4DFXE 2WTKC 4ANLA 4LFIA 2R64A 2YAAA 3FMNA 3KK8A 4IWDA 4EI4A 4M69A 2BHHA 4UB7A 4XCUA 2YDJA 5FD2A 2YERA 3PA4A 5HCZA 3ZBFA 5AV1A 4CFNA 4CEGA 5HX6A 2XIXA 2X8DA 3KULB 3SG9A 3KY2A 2XJ1A 2ZYBA 3D15A 1J3HA 2P0CA 2YHVA 3EYGA 4BDIA 3FZRA 3V3VA 4C61A 4MYGA 4F0IA 1YHWA 1W84A 3CR0A 5BUIA 4O84A 3HGKA 2ZM1A 4W4XA 4F64A 2WMAA 3NNWA 2QOKA 3PVGA 4Y46A 3QCQA 4CFMA 4D2PA 4O7NA 4G9RA 2PE0A 2IG7A 4RC2A 3S4QA 1U54A 2CDZA 4A9YA 4FV4A 4ZZOA 4XMOA 1WBOA 4Q5HA 3VUKA 3FHIA 1LPUA 3SV0A 5KHXA 3K3JA 3FKLA 3HP2A 5HG5A 2YCQA 4EQCA 2WPAA 1PJKA 2OXDA 1Y57A 2GFSA 2VV9A 3EQPA 3FC1X 3KXMA 4O91A 4AOTA 4TWOA 2PVKA 4LUEA 3SGCA 5F9EA 1CSNA 3UYTA 3C4FA 4D5KA 4HYHA 5E92A 1OIUA 1QL6A 1DM2A 4L01A 3A60A 4AW0A 4D4VA 2FYSA 2VO3A 4KIPA 4LOOA 4RA4A 4BFMA 4ZAUA 4ZZNA 3LKMA 2EXMA 3CGFA 4IVAA 2WTCA 5DE2A 4C4EA 5FM2A 4TL0A 5D7AA 2CNVA 3UTOA 1SM2A 3BWJA 3QZHA 4DH1A 3PZHA 1PKDA 5CU3A 3IKAA 1O6KA 3G9LX 4O22A 3W55A 3C4EA 4FSWA 4CG9A 2Z8CA 3RM6A 1CKPA 4RIYB 4Z55A 2BHEA 4I21A 1ZYLA 4KWPA 5DEYA 3VUMA 5HO7A 4IVBA 2GCDA 4RA5A 4EOPA 5IUGA 5HVJA 1MRYA 1HCLA 4P90A 4EYJA 1UNLA 3LJ0A 5BPYA 2DQ7X 2FSTX 3UZRA 2RG6A 2Y4IB 3F7WA 3R28A 4C62A 4MTAA 3ZLWA 3H4JA 2ERZE 2R0UA 1M2RA 4FL3A 2YWVA 3CSVA 4NL0A 4JX3A 2R5TA 4W8DA 4NU1A 2WTIA 2EU9A 2W06A 2A4LA 3V6SA 4I6FA 4EJNA 3CQUA 4JQEA 3COMA 1UU3A 3DU8A 4I22A 4JS8A 4QP3A 4S34A 5FM3A 5HG9A 5HTCA 3GP0A 3R9OA 4QPAA 2UUEA 3KRLA 5KZ0A 2WELA 4QYEA 5E8SA 3D2KA 3NCGA 3ULZA 3ZSHA 4A9UA 4F63A 3QHRA 5IEYA 2VNYA 5CZIA 4QYFA 4XHKB 2HELA 2VTSA 4DH5A 3SG8A 3R1NA 3D0EA 2EUFB 5H8EA 4C0TA 3F3UA 4A4LA 5KNJA 3TEIA 1WBTA 3R02A 4C3FA 1H1SA 2FSOX 5CSHA 3D5WA 1I44A 3V8WA 2ESMA 2ITVA 3AC5A 4YURA 4D5HA 4FODA 4L3LA 1OKWA 2X6DA 2YCFA 5HX8A 5L2SA 4FL1A 2JIUA 2YJSA 5LXMA 3A61A 4D0XA 4QMTA 5KMMA 3LQ3A 3D7ZA 5IPJA 2VTLA 1ZARA 3DKCA 3TUDA 5IQBA 5JFXA 2RGPA 4M3QA 4NUSA 5KZIA 4JG6A 2WNTA 2EXEA 5EDPA 4FIJA 2BKZA 5DGZA 5EM6A 4LGDA 2BFXA 1OUKA 4XYFA 4UZDA 2KULA 4GSBA 3SD0A 4C7TA 4FKGA 3F6XA 3BIZA 5CX9A 3IOPA 3PY1A 4ERWA 4D4RA 4EH9A 2UZDA 3SRVA 4UWYA 5KE0A 4YJSA 1YDSE 3G0EA 3VF9A 2WMSA 1XKKA 4G9CA 4YJVA 2HOGA 3V5QA 3ROYA 3T3VA 4EHVA 3VUTA 3BU6A 3EIDA 3THBA 3UG1A 4FSRA 4KKEA 3BWFA 4DT9A 5B2LA 3GC0A 3IPHA 4G31A 4FMQA 4WBBB 3SLSA 4A9SA 2PUIA 3ET7A 5FTGA 2BILB 3MV5A 3PVBA 2ZV8A 4RIXA 4BL1A 2IVUA 2X2KA 3DBQA 4Y85A 4RWIA 2XNNA 3QCXA 4LQMA 3W16A 3JVSA 5HU3A 4N57A 1JLUE 4MKCA 4D2WA 4WRSA 3GEQA 3KF4A 3PSCA 4IAKA 5HIDA 4AGDA 2PZRA 2GHMA 3AT3A 3NLBA 1WFCA 5AV3A 3N9XA 5HD7A 1ERKA 2X7OA 4L43A 4QP4A 4YJNA 4QMQA 1ZLTA 3NVMB 1YXSA 3PLAE 2WHBA 2RFSA 3QXPA 2PZPA 5DMZA 4FTRA 3GU4A 4QPSA 3ENHA 3FPMA 3ZFYA 4O7ZA 2NRUA 4RRVA 4H58A 3R2BA 4I5PA 4O7YA 1YWRA 2HZNA 4GUBA 3DQWA 3A8WA 5C4LA 1T46A 4ORKA 4AG8A 5I9WA 4LI5A 4RWKA 3DNDA 5C9CA 5GIPE 3I0QA 4BTKA 1SVHA 3KRJA 3IDCA 5A3XA 2XH5A 4QD6A 4ID7A 5HI2A 1X8BA 3LMGA 5ANKA 4X2JA 3UVQA 3WIKA 4PTGA 1JKTA 4X2GA 1G3NA 1Z57A 2QOCA 3BHVA 4X2FA 4FF8A 2JEDA 3VIDA 3F7ZA 3OWPA 2W1HA 3CE3A 4WBOA 4MBLA 4XV2A 2X9FA 1OM1A 2ETRA 2XZSA 4MQ2A 3N4TA 4DG2E 2XNPA 3OZ6A 1GY3A 2GS2A 5KKRB 3Q9ZA 3BHTA 3Q53A 2PE1A 3OWJA 4UWBA 3RCDA 4GIHA 5T3QA 3I81A 4O7VA 3KXXA 5KCVA 4C3PA 4BDCA 3FMEA 3BEAA 5IISA 3M42A 3NW6A 3ORPA 3I5NA 5JZNA 2QOQA 4I1ZA 4X3JA 1PKGA 4BICA 3O2MA 5T6KA 4FIGA 5D12A 1G5SA 1KE5A 2YDIA 4RG0A 1YWVA 4WNPA 5HBEA 4NKAA 4MF1A 5CT7A 3OWLA 3OT3A 3BELA 4PQNA 5FEDA 5AM7A 1B38A 1Q97A 2WOTA 4MX9A 5CSVA 3CLYA 5A6NA 2JFMA 4I6QA 2R3IA 4FG7A 4ANSA 4XOZA 2CSNA 3IDBA 4FSYA 2V0DA 3E62A 2QD9A 5CWZA 5L8LA 1MQ4A 2J0IA 3SXSA 5JKGA 4LGGA 1XH8A 2GU8A 3OS3A 4FKLA 2WMRA 4WRGA 5CF6A 4ZOGA 4F6SA 3KVXA 3VULA 1FBNA 4DCAA 2ACXA 1ZWSA 2VTPA 3Q04A 4BDHA 4MWIA 2IN6A 3ZUTA 3RPOA 4F70A 4DHFA 1DAYA 3OXZA 5IA1A 4D4SA 3AMAA 4BDJA 4L52A 4TY1A 5CYIA 3KMWA 3P7CA 3C4ZA 4N6YA 4JBQA 1H0VA 3KXHA 2XIRA 2F9GA 4IAYA 4KS8A 1H00A 3PSBA 4TYIA 3UOLA 1WBNA 3D7TB 3ZONA 1GAGA 3PJ3A 4DGLC 1J1BA 5HTIA 3A4OX 3OOMA 4IWOA 4PPCA 4ZP5A 1KV1A 2O65A 2SRCA 5TO8A 1H1WA 3SX9A 5IQIA 3M2WA 2R7IA 3UODA 4MNEA 5BQ0A 4OBOA 3FXZA 4MXXA 5B0XA 3VAPA 4E6AA 1QCFA 3BE9A 4BYJA 5DLSA 3TG1A 1VZOA 4IFGA 5DOSA 4IIRA 5EDRA 2BPMA 4LOQA 3FPQA 3RALA 2GNIA 4IADA 4PX6A 4K9YA 2WMXA 5LVMA 4ARKA 2XK6A 5DFPA 3MA3A 1QMZA 1UWJA 3F2AA 1NW1A 3BYVA 3OXIA 4FSZA 4FEUA 2HAKA 3P23A 1E1VA 5CENA 4XEYA 4U79A 2C5NA 3ZRLA 4FK3A 4JDIA 4EK3A 3PY3A 5C8NA 2JKMA 4BDGA 4OTQA 3KQ7A 4EWQA 4KBAA 4CKJA 1CM8A 3IECA 3R8ZA 2RG5A 3W8LA 5IH4A 5LVPA 3FUPA 4AZFA 3QFVA 3H0ZA 4M68A 4WNMA 5HIBA 2F7ZE 2IW6A 2IZSA 3NW7A 4FIIA 4DEHA 5B2MA 4GG5A 4R78A 1PY5A 3Q4UA 3O0GA 2OIQA 4Y83A 2ZDTA 2JDTA 2Y8OA 5EDQA 5A4QA 3AD5A 2IVVA 5DN3A 4NTSA 2W1ZA 4FSTA 3FC2A 3RNYA 4ZMFA 3LQ8A 2VTQA 2IVSA 4GUEA 4FV5A 2X6EA 2G2FA 2RIOA 3PP0A 4QPMA 3O51A 1U59A 2PE2A 2QOFA 2X81A 1R1WA 3FMHA 3LJ2A 3O8PA 4O0YA 5AR4A 2YZAA 3IW4A 4AE9A 3NX8A 2XNGA 2Y6OA 1PHKA 2GFCA 4J99A 4WA9A 4L00A 2PVYA 1LEWA 4ZTHA 3Q5ZA 2BTSA 3FHRA 2Z7LA 3W10A 3D9VA 3GOKA 4AOIA 1GOLA 2C5YA 2FH9A 3E88A 3IONA 2UW5A 3NW5A 3QYWA 3VBWA 1IA9A 5HNBA 4Y72A 2PY3A 2UZWE 3PXKA 1H24A 3HUBA 3RKBA 2VUWA 4EH2A 3PWYA 4K77A 2BVAA 2JC6A 3ULIA 2W9ZB 1S9JA 1K3AA 3EZRA 4GRBA 3LM5A 4EWHA 1J1CA 3K54A 1FVTA 1JSVA 2OKRA 4K8AA 3DBDA 4M0YA 4QP8A 1OKZA 4NJDA 4GU6A 4ANNA 4KD1A 4WUNA 4G16A 3VRZA 4GYIA 5JGAA 1TQIA 1YHSA 4JR3A 2BCJA 2XM8A 4YJQA 3S95A 3ZS5A 2UVYA 3DCVA 1U5QA 5LVNA 2XCHA 4BTJA 5DA3A 3QC4A 3TV6A 4Z7HA 4DTKA 3G51A 4YLJA 5AAGA 3DK6A 1HCKA 1NVRA 3U51A 4F9BA 2QU5A 3H9RA 3U55A 4QMZA 2YAKA 5HE0A 4L7SA 2BUJA 2B0QA 2AC5A 4C35A 4NFNA 3LVPA 3QUEA 5AR5A 2O0UA 5LMKA 1B6CB 2IJMA 4RIWB 2C6EA 3IW6A 2X7FA 3B2TA 4EOKA 3N4UA 3PJCA 4EC9A 4QT1A 2JDOA 5CEIA 5LCKA 3SOCA 4C4IA 4O7RA 4ASEA 5TT7A 3RWPA 5K0KA 4RVLA 3DOGA 3TL8A 2VTJA 2H6DA 2V55A 2YJRA 5D7VA 3IK3A 3MB7A 5BX0A 4HVDA 3ORNA 3NUYA 4JG7A 5EI8A 4EQUA 4L46A 4KBKA 4YJTA 3A99A 3L9LA 5KMKA 3FLNC 2WTJA 3MBLA 3HDNA 4U40A 4CYJA 1OBDA 3BV3A 4IBMA 4FX3A 3TJDA 3ITZA 4P5QA 4LOPA 3ZHPC 3D4QA 2C47A 4IFCA 4PNIA 2HIWA 5H8BA 3ZZEA 2OH0E 4E4NA 3ZFMA 4CRLA 1A9UA 2H34A 4YJOA 2Q0NA 2P2IA 3BYMA 3E93A 3IW5A 5DNRA 4ANMA 2YZLA 1S9IA 2UVZA 3AMYA 3MY0A 4ZLZA 3GBZA 2QHMA 3ACJA 4F7SA 2QOOA 3CD8A 3NZ0A 3S00A 3AD4A 4AT5A 3GFWA 2R9SA 4CCUA 2F57A 4K1BA 5FQDC 3EZVA 3TZ8A 5LARA 1MRUA 3AMBA 3MN3A 3ZM4A 3ATTA 2QR8A 3CQEA 4ZJJA 3SDJA 4HVSA 1OPLA 4TYJA 4EORA 5M51A 4YHTA 2XBAA 3MVJA 4B8MA 1ZMVA 1JKLA 4E4LA 4XRLA 5E8XA 2YA9A 2O8YA 2F7XE 1TQPA 4F09A 3L8XA 4JXFA 4PNKA 1XH7A 5HVYA 4YJRA 4U41A 2Y4IC 4NH1A 4EOQA 3MH3A 4DINA 4RQKA 4L7FA 4A07A 5EKOA 1PXOA 2GMXA 4JQ7A 4AT4A 1ZAOA 2ZV7A 2R3JA 4FG9A 4FUYA 3E87A 4E26A 5EQYA 3DLSA 4TNBA
chains in the Genus database with same CATH superfamily
2PMNX 2Z3XA 5J5SA 4HCTA 1PYXA 4R7HA 3ANRA 1IFYA 4MVFA 1SVEA 4RJ3A 5J7HA 3ODZX 3QRKA 3S3IA 5LVOA 4JI8M 2A98A 3R8LA 5KX8A 3TIYA 5E7RA 2KNVA 4DA5A 3NUXA 5J95A 1AQ1A 4DBNA 3L8PA 4HGLA 2PPQA 3I60A 3K5VA 3M0EA 5LMUM 3KRWA 4W9WA 4O4DA 4QTCA 3MESA 5CU6A 4ACCA 1KE9A 3KOYE 4DV1M 4ZIMA 3TWKA 5BNJA 1SNXA 3LCKA 1OKSA 4FKTA 5HLPA 2UZLA 2I1MA 3Q32A 3PRIA 1QDTA 3HV7A 1FJGM 4IVCA 2DVWB 5I5ZA 3R7VA 4AA0A 4YO4A 4ANOA 5JFVA 1OJLA 3PJ1A 5JGDA 3CKXA 1NVMA 2BJVA 2GDOA 5ETCA 3TNIA 4G34A 5FXRA 1OUYA 3CGWA 2BDFA 3WHLA 5HESA 3GO8A 5DRBA 3Q52A 3C50A 4EC8A 1OB3A 3A7FA 2AHMA 4V0GA 5DNYA 3R1QA 5JN2A 4PP7A 2F5NA 4PPAA 3TT0A 1XC8A 5IA2A 2BAQA 3DXQA 4IM0A 3PA5A 1OIRA 5M06A 3IGGA 5AP1A 2CNQA 1OAIA 1V33A 3RGPA 3ORXA 4C59A 2DAEA 3JPVA 3GPPA 4UWCA 2QO2A 3QRJA 4IC7A 3ZOSA 4PTEA 4TTHB 2XFTA 2DZNB 1I4WA 3QRIA 3O23A 1G3IA 3FMDA 2IZRA 3BKBA 3VBTA 5FTQA 3FSFA 1IXSB 1PXIA 3OP5A 4PUZA 2WMTA 5C26A 4FKQA 3GC7A 4ZY4A 3BBZA 4GV1A 4MWHA 2VN9A 5CSXA 3D8BA 4FGRA 2YIRA 3SAYA 4I24A 4FTIA 2Y4PA 3A2CA 5AV4A 4FICA 2QVSE 2QKRA 2ZMDA 2UXDM 3Q6WA 4CMOA 3OMVA 4MK0A 2DENA 1MX0A 4RJ4A 2JZ0A 3HV6A 2VX0A 4WIHA 2LAVA 4C4HA 5ETAA 3DOAA 2G8LA 4AXCA 3TKUA 2W7XA 3ENMA 3CIKA 4QP7A 2HXLA 4P4CA 1UKHA 4EH5A 2G3QA 4IW0A 3GCPA 3HU3A 4RX7A 3IQ7A 5HG8A 4K18A 4V01A 4MBJA 3HV3A 3N4VA 4L16A 1YUBA 4NEUA 4MD9E 3EFJA 4JQ8A 4FK6A 2R3LA 4BCOA 3Q4TA 4MXOA 2CKEA 4XG9A 5TR6A 2IO6A 1OIPA 3LXNA 3QC9A 2PMLX 2HENA 1JNKA 3MYGA 2BRNA 3EN5A 5LOHA 1OIYA 5CTPA 4FUXA 4X2KA 5GIOE 3WYXA 3TNPC 4YHFA 1YXXA 4FCWA 3NUPA 3HJSA 1ZAEA 1XMOM 2BWBA 3E8NA 1W2DA 3BLHA 5J9YA 2C6TA 2XK4A 7CATA 4B7TA 2RFNA 3SHEA 3AFHA 3UVPA 4G3OA 3ZUVA 4UYNA 3R30A 3DFCB 3UP7A 2OO8X 1QPCA 1H26A 2C3JA 4KBCA 2Z7RA 8CATA 1BVSA 5EYCA 3F3WA 4JVGA 2Q83A 3R7EA 4AFJA 4AZSA 3FZTA 4D9TA 3UGCA 3FLWA 4YJPA 3U6PA 3OT8A 3F3VA 4MNFA 5J1VA 2ZFYA 5JT2A 3AGMA 3KCFA 3FV8A 2FE8A 1KYIA 3VBXA 3SXFA 1E9HA 2EB3A 3DJ5A 3E8EA 2JIIA 4NSOB 3FMKA 1ZYSA 2B3TA 1UA2A 4XGIA 1SYKA 3W2SA 4CLJA 2V22A 4I93A 4KKGA 5EG3A 3PPJA 2J5YA 4R7GA 4MEDA 3I1AA 4ITJA 2J0LA 2R3NA 2PVHA 4FTLA 1J7KA 3ZFXA 4CG8A 1TQMA 4M9SA 2ZM4A 3I01M 5E9EA 2OSCA 4EJ7A 3VS1A 2X0QA 4I81A 2CHGA 2XJ2A 4RIXB 4C2VA 3EN7A 2YLEA 2W1DA 2Y0TA 4AA5A 1M7NA 1XBCA 4KUJA 3C13A 2EB2A 5IG1A 3PXYA 2ZBKB 4JIAA 4KHPM 3TZMA 4YLLA 4GVJA 5DH3A 3GLIA 5J9LA 4GK3A 4BJJA 4C4GA 2C30A 4CYIA 3NYVA 4EZ5A 4D2TA 4EHEA 4K2RA 1K2PA 2GNHA 5M4IA 4AE6A 3OY3A 4DEBA 2R6FA 2QSFX 2J0MB 3K92A 4FNYA 1Q02A 3PXQA 4XG4A 4MXAA 1G8JA 4XG2A 1GJTA 2QCSA 3E7OA 5E8YA 4E6DA 2JD5A 3BYUA 4PT5A 3E63A 3OUNB 2DAKA 3LFBA 4G6NA 3WOWA 5DFLA 4OTGA 4ALWA 1HNXM 3E3BX 2OF2A 4RX8A 4QYHA 3GCQA 2DZLA 2ZMCA 2F4VM 1C7YA 4BCKA 3VJOA 3PIZA 2I7PA 3G90X 3MW1A 4XBRA 3VBQA 3LCOA 1UFZA 3DPKA 3QRTA 5CI6A 3AG9A 1BLXA 4EOLA 2IZUA 3Q60A 1XR1A 3C4CA 3KXNA 2XCKA 4JI5M 4IBKA 4IDVA 1O6YA 4FD2A 3V5TA 2N35A 3FUXA 4FOBA 2V1CA 4LFCM 3FQHA 1PJQA 2XALA 3EHAA 4OX9M 2Z8YM 4IJFA 4F4PA 4PV0A 2R4EA 2R65A 4LJ7A 4C57A 2R0IA 1W98A 4KNBA 2HWJA 3A7GA 5HZNA 2OOBA 2XK3A 4JDHA 5DR6A 5HO8A 4GKIA 4PDOA 4C4FA 4LV7A 3Q9YA 3UZPA 4IJPA 1V34A 2VWBA 2Z7SA 4C8BA 3EQIA 5CQWA 2WQEA 1T6OA 4EOSA 1ZV1A 3BYSA 4I41A 4C34A 3CTJA 4QNMA 5EKNA 5T68A 4QQTA 4EOIA 5ETFA 1G4AE 3K2LA 4O38A 5A14A 3R7UA 1XXHB 4QMSA 3VONA 2FO0A 4QMXA 1PXLA 2HCKA 3LQ5A 3TUCA 4NM5A 4NTTA 4QDVA 3ERKA 3C58A 4IX5A 2ITNA 4S32A 3W8QA 4R5YA 1IR3A 3PVSA 1R2ZA 4AKGA 2C6IA 2C0TA 4IVDA 3QKMA 4FEQA 2ITPA 5J5TA 5AA8A 4E8AA 5GHVA 4LZJA 1AIPC 2BRMA 1HNZM 5CY3A 4PY1A 5EHOA 4DT8A 3V51A 5IUHA 3DQXA 4D58A 3NFGB 4IH8A 4UZHA 1A06A 4EHGA 4BWXA 5L6OA 2OH4A 4B3RM 3PFYA 1R78A 5AUVA 3EKNA 4ZY5A 3L9NA 2HZ4A 3KP0E 1XH9A 4XG6A 2P33A 4LF4M 2WD1A 3PFIA 3LAUA 4FIFA 3QF9A 5AP7A 2C98A 3KFAA 5ITTA 2XYUA 4N70A 2OG8A 5E8TA 2ZV9A 1H6UA 4QMUA 2QCUA 5LMNM 4BDAA 2R3MA 4QMOA 2YLFA 5DVRA 2YDKA 1TVOA 5EHYA 2XZUA 5EP3A 2VQFM 4C02A 2ITWA 3VRYA 5E8VA 3PVUA 4I4LA 2FB8A 4JXJA 1WCCA 3QYZA 3MHVC 2E9NA 1W82A 3VHEA 3W33A 3UBDA 4CV8A 1PXMA 3F9NA 4PRJA 1NJFA 3U6HA 4YSMA 2BRGA 2ERKA 3GXLA 2H5XA 3MFRA 2BDWA 4QTAA 2OOAA 2HK5A 5I9UA 4FEWA 4GW8A 5L2IA 2KNZA 1W0XC 4A4OA 4YZNA 3KU2A 4IACA 4OW0A 1SVGA 1XH5A 3GLGA 5GZ8A 3GRUA 2G15A 3TNWA 1YXTA 3V6RA 2R44A 2P2HA 2X1NA 3BBTB 4J7BA 3DZOA 2R3RA 3UO4A 2HXQA 4HVGA 1OL1A 5CNOA 2XM9A 1D2NA 2KA6B 3BYOA 3PNYA 4X3FC 2C1BA 2XIZA 2DHYA 5BVDA 2X4FA 3VLFB 5IQHA 4G17A 4YY3M 2W9FB 3AD6A 2W5AA 1XNRM 2ERCA 4F7LA 1BX6A 3FTFA 5CEOA 5HU9A 3GCVA 2JIVA 4CQGA 4Z8XA 4CCBA 2VF8A 3CKWA 5HE3A 3R71A 1T3TA 4D2VA 3EFKA 3HL7A 3MH2A 4AA4A 2CNUA 3DAKA 3HZJA 4FCTA 3UG2A 3QQLA 3HMMA 3V04A 2OJJA 4OTPA 3RPSA 3FI2A 3VQHA 3WF5A 2GNFA 1XMMA 3SXRA 3D5VA 1HQCA 4KB8A 1H1PA 3TNHA 4AACA 4JG8A 1TZDA 2Z02A 4FKIA 2NRYA 4LMUA 3U6OA 4RIWA 4APPA 4KA3A 1H1RA 5AMNA 5JFWA 4Y28F 4OBPA 2QURA 3EL8A 4WG5A 2JITA 3PXZA 4HEOA 3R1YA 3W0SA 4RC4A 3SW4A 2CKQA 1URWA 4HNFA 4JJRA 4LRSA 2WGJA 4OT6A 1WMKA 3ORTA 5EP4A 2EJSA 3LVVA 2C3LA 4XUFA 4FZFB 3BGZA 4MGYE 3GCUA 2JBOA 1JPAA 5FLFA 3G6HA 3I0OA 5HE2A 2WIHA 4LV5A 4JRVA 3TI1A 4BGHA 1P14A 4FWGA 3LFDA 5EJCA 1Y6BA 4S33A 5J1WA 3WBLA 3ANQA 2R3FA 1IN7A 4IZYA 1UVRA 4IBIA 4AXDA 4C2WA 3FD9A 2UZNA 3QTRA 2G2IA 4RBLA 4Z7GA 3VUDA 4GFGA 1CUKA 2PVNA 3PIYA 1VR2A 3FKEA 3MMPA 2PHKA 4ITHA 4O83A 4IDTA 3FLQA 3F5XA 2BRBA 4ZZMA 2IPXA 3ZQJA 5KMIA 3ZLYA 4USDA 4ACGA 4AZTA 3ROCA 3WE8A 5IQEA 4C3RA 4PF4A 3KOXE 2PU8A 3MVLA 3P86A 5CEPA 2EWAA 3DK3A 3OEZA 4AQCA 4B9DA 3ZMMA 4FSNA 3HY5A 3HRCA 2F5SA 1H0WA 1KV2A 1AGWA 3OXTA 2DNAA 3FRIA 1QZEA 4IMYA 3L8VA 3HDMA 3R8MA 4TNDA 4GJ2A 4ZEGA 3EQRA 5M4FA 3TCPA 2HY81 5CSWA 4EKKA 3PE2A 3R7GA 2XNOA 2DS1A 4KRCA 3SAVA 2OWBA 2I40A 4F1MA 3DAEA 2QOBA 3NSZA 4P2KA 4FTAA 5IQAA 1QUTA 3KSXA 2H8HA 2RSVA 1V1KA 4ACMA 3MSSA 2ZDUA 3U87A 3RZFA 2FS1A 5CANA 4DH8A 4TRLA 4EZ7A 5AUWA 4CT2A 2CGWA 2J7TA 2VTRA 2QKWB 1H25A 4G5JA 3KULA 4ZS4A 3W67A 4UALA 4JBPA 1FNNA 5EM8A 1EH4A 3F61A 5ANDA 1IAJA 3LOKA 1N78A 3POOA 4TYEA 2CJMA 4M12A 4ZSJA 3R8VA 3OVVA 2R4JA 5KMNA 5TE0A 3FZSA 4F65A 4FSUA 2J0JA 2W1IA 3FJQE 4R3CA 4P16A 5CF4A 4OTFA 4NIFA 2L7HA 3CXWA 4YPDA 3H9OA 4EBVA 1Y6AA 2GPHA 4WT6A 3IDPA 1CTPE 4O7TA 1TFFA 3L28A 3P78A 4FRFA 2A5YB 4CVAA 5F95A 1NVSA 2IEWA 1YOMA 5F4NA 3KFUG 4JAJA 3AC3A 5HD4A 3AQVA 2F2UA 2XLJA 4YZ9A 3LM0A 1IA8A 3C1XA 2UUAM 4IB5A 5E26A 1KSWA 3UDBA 4H3QA 5AX3A 4DTBA 3EQCA 3MPMA 3SHFA 1H27A 4AW5A 5DYGA 3TN8A 4BDBA 1N34M 3WIGA 4DE4A 4WSQA 1XNQM 2R2PA 2PVJA 4GKJM 3C0IA 3RJCA 3HV4A 4L3PA 2W5HA 3UZTA 2W1CA 1GNGA 4HPUE 3JY9A 4J98A 4LFIA 4EI4A 5FD2A 3ZBFA 5HX6A 2XIXA 3Q8XA 4BDIA 1W84A 3CR0A 2ZM1A 4W4XA 2D7GA 2QOKA 3PVGA 4D2PA 4O7NA 4RC2A 3S4QA 1U54A 4ZZOA 4XMOA 1WBOA 3K9PA 2OXDA 2GFSA 4O91A 3FC1X 4DUYM 3SGCA 1CSNA 1ST4A 1DM2A 4L01A 4D4VA 2FYSA 4ZZNA 4KIPA 4LOOA 4RA4A 4BFMA 4ZAUA 2EXMA 4IVAA 4PCZA 2CNVA 2Z7JA 1SM2A 3QZHA 4FSWA 2Z8CA 4RIYB 2P5TA 4I21A 4IVBA 4RA5A 1UNLA 3LJ0A 4C62A 2DWNA 3H4JA 2YWVA 4NL0A 3U6CA 4JX3A 4I6FA 3CQUA 4FVMA 3B7QA 3DU8A 4I22A 4S34A 3GP0A 2UUEA 3GPXA 1YLAA 4QYEA 4F63A 3QHRA 2VNYA 4QYFA 2HELA 2VTSA 3R1NA 3QYEA 3TEIA 2FSOX 1WR1B 4FODA 5HX8A 4FL1A 2YJSA 3LQ3A 2VTLA 3A98B 4FJVA 5JFXA 2RGPA 4FIJA 2BKZA 3L26A 2UZDA 2RKOA 4UWYA 1YDSE 3ROYA 3BU6A 3IPHA 3SLSA 4WBBB 1OFIA 2BILB 3MV5A 4BL1A 4QNRA 2X2KA 3DBQA 5HU3A 3FUVA 3KF4A 3PSCA 2PZRA 3NLBA 3AT3A 5HD7A 4L43A 4QMQA 1YXSA 3QXPA 2NRUA 4O7YA 4GUBA 4AG8A 5I9WA 4REZA 5GIPE 4MB7A 1X8BA 3LMGA 4PTGA 3T1HM 1G3NA 1Z57A 3BHVA 4X2FA 2CUZA 4FF8A 4B3TM 3F7ZA 3CE3A 2X9FA 2ETRA 3Q9ZA 3Q53A 3RCDA 3I81A 3FMEA 3M42A 3ORPA 3I5NA 5JZNA 2QOQA 4X3JA 4FIGA 3U6MA 4WNPA 5CT7A 5A6NA 5ITUA 4FSYA 1D0KA 2QD9A 3AL0C 5CWZA 5JKGA 1XH8A 3KVXA 2VTPA 4GITA 3VK7A 3PSBA 1WBNA 3ZONA 4DGLC 1GAGA 1J1BA 3A4OX 4IWOA 4ZP5A 2SRCA 3SX9A 1IBLM 3M2WA 3UODA 4MNEA 5BQ0A 3FXZA 4E6AA 4BYJA 5DLSA 3TG1A 5DYIA 3FPQA 1IXRC 2WMXA 3OXIA 1TDHA 2HAKA 3P23A 3HWSA 2QP9X 5C8NA 2JKMA 4EWQA 4CKJA 3IECA 5IH4A 5LVPA 3H0ZA 4WNMA 5B2MA 4DV7M 1J09A 3Q4UA 1L8QA 5DN3A 4FSTA 1PJIA 3QYBA 2VTQA 2IVSA 4GUEA 3PP0A 2RIOA 1R1WA 2XNGA 2GFCA 4J99A 4WA9A 4L00A 2FH9A 3QYWA 1IA9A 4Y72A 3RKBA 2PY3A 2UZWE 4EH2A 3HHWA 3ULIA 2W9ZB 4GRBA 1OAOC 3K54A 4M0YA 4K8AA 4ANNA 4L6V6 2CWBA 2APLA 1YHSA 2XM8A 2AEGA 3ZS5A 2ZAMA 4YLJA 1HCKA 4F9BA 2YAKA 3L25A 4DV3M 2O0UA 2IJMA 3B2TA 1D0LA 4QT1A 5LCKA 5KQDA 3SOCA 4ASEA 4IIWA 2H6DA 2YJRA 3DA1A 5BX0A 4L46A 4KBKA 2WTJA 3MBLA 5LVMA 4LOPA 4E4NA 5FTMA 3ZFMA 4DHZA 2H34A 3IW5A 3BYMA 2YZLA 2UVZA 3GBZA 2QHMA 4DR2M 4NRVA 3GFWA 2KEBA 3ATTA 5L8RF 1OPLA 5M51A 4YHTA 2XBAA 2Q2EB 1JKLA 5E8XA 4PNKA 4NH1A 4A07A 4P17A 2GMXA 1Z5CA 2ZV7A 4FG9A 5EQYA 3I6UA 4IC8A 1K3WA 3PRFA 3MWUA 3RGFA 1XHBA 3QQKA 3J7BA 4YZCA 1IXSA 3R6XA 1BI7A 4K33A 4EKLA 2DKLA 2YM6A 3BXWA 3FQSA 2X49A 5BPVA 3A7IA 2R3GA 3BI6A 5GJFA 4ITQA 2UW6A 1ZZ2A 1RU3A 5IF1A 2WZJA 1ZZLA 3LQQA 4M7IA 1VJYA 3DJ7A 3I79A 3RAWA 4YZBA 3BE2A 5HLNA 4RZWA 2ITOA 3MJ1A 4RX5A 2AQXA 2KTYA 2CGVA 4FT5A 3GP1A 4NW5A 4RFZA 4BI0A 1PF8A 3DTCA 2B9IA 4R77A 2IVTA 3VS6A 1JKSA 5G6VA 5BMSA 5HGIA 2QOIA 2VNWA 3C3EA 4K11A 4EUTA 4NCTA 3IG7A 3PIXA 3MY1A 2XA4A 1ZY5A 3K3IA 5FTKA 1QAQA 4YTIA 2HKJA 3OG7A 4FKUA 3QBNA 5F20A 3AJIB 2OJGA 4LJAA 3CPCA 4GIIA 2XARA 3SAWA 3PTGA 2XSZA 3A42A 4QRCA 3GLFE 3TUBA 3AKJA 2VX1A 1FQ1B 1IBKM 2PVFA 2R62A 4IAZA 3HMIA 3G2FA 2YN8A 4I4EA 1TDZA 2FGIA 3KXEC 3EIEA 3FDNA 2YM3A 2WTWA 3FWQA 1SXJC 5KHWA 1H28A 1H8FA 3AC2A 4DLJA 5CASA 4D1XA 4FEVA 2QBYB 3PA3A 4FW9A 4ZSEA 4J95A 4PMSA 3FI4A 3FTDA 2VQEM 4XOYA 2FNAA 5LWMA 2LHGA 2CGUA 1I09A 4R8QA 2VRXA 5EM5A 4GYGA 3VHKA 2YCRA 5C03A 4YR8A 1XMQM 5FXQA 1H4LA 3OCTA 1WHCA 3A8XA 4YBKA 4DC2A 3OEFX 5FP5A 1JWHA 5ACBC 3JS2A 2OJ9A 4LFBM 1DGHB 3SATA 1OKVA 1UNGA 4AP7A 4Q7JA 2OF4A 3UNZA 2WFYA 4CKIA 1PMEA 1IY2A 4BHNA 1VLRA 4IWPA 1FGKA 3RM7A 1PXKA 5AX9A 4F1OA 2ZB0A 4FT9A 2CCHA 2UW0A 1K9AA 1OMWA 1A48A 2QC6A 3UVRA 1PRYA 4O0VA 4GH2A 1FVRA 1M17A 3QTIA 2W82A 3NNUA 1E1XA 3DS6A 4JI6M 5EOLA 3RE8A 4EOJA 2QQ7A 3VS7A 3N51A 3LFEA 3LVWA 4FTCA 3DJ6A 4CFUA 3R04A 2LWXA 4ANRA 1CDKA 1FMOE 3PG1A 3UE4A 1REKA 1G8KA 4M0DA 2R4BA 2JWSA 4AGCA 1DAWA 2REIA 4IAFA 4AT3A 4A7CA 3ZEPA 4FG8A 3MVHA 4BIBA 3R83A 4WG3A 3RAKA 4AW1A 1RDQE 3JXWA 2YIXA 1JR3D 2EKFA 5FGKA 3E5AA 4DHIB 3QKLA 4H1MA 4UEUA 4GIPA 2WQNA 5EK7A 3MFTA 4AN9A 5AUZA 4QP2A 4I5SA 5C4KA 3C7QA 3GLHE 4X21A 2D7EA 2W05A 5M55A 2B1PA 3ODYX 4D0WA 3QRUA 3HA8A 4IBBA 5D9HA 1X37A 5DEWA 4FV2A 3CCNA 1VYWA 4Y73A 2GSFA 4U3ZA 1WVWA 3RAIA 1UM8A 3DBCA 4OU7A 4R6VA 4PMTA 3CY2A 1G8AA 4EK4A 1XH6A 2G01A 2ITUA 4XV3A 3DDQA 2BRHA 4QMPA 4RWLA 5C18A 4I6HA 2UZEA 2Y7JA 4CMUA 2A2AA 3LIJA 3QCSA 3A62A 3KK9A 4O86A 4G1WA 4FV3A 3LCSA 3A4PA 3GQ3A 3U9NA 1GO5A 2GNJA 5JQ5A 5KMLA 4DFZE 3FLYA 1TH2A 3WARA 3QD2B 2UZUE 5F1ZA 1YW2A 3UGJA 5CU4A 3WZKA 1Q3WA 4JR7A 2NNWB 3OW4A 4AGWA 5BV3A 5EH0A 1YOLA 2LHCA 4NK9A 3VVHA 2OI4X 2W1FA 3DKFA 2G5GX 2W1EA 3CS9A 2WXVA 1YKRA 2GQSA 5KMJA 4LL5A 4ZJIA 2CHQA 4JYAM 3P7AA 3NUNA 3O8UA 3I6WA 4CFXA 5HOAA 3T6PA 1UU7A 2PL0A 4D55A 2PVRA 4AXEA 5FDXA 3U6LA 1L2CA 5IU2A 4PPBA 3TDWA 2UW8A 2J7NA 3QQGA 1PXJA 3HHZA 4OR5A 4D80A 1OL7A 3BQRA 4BWKA 4XRJA 2FOIC 4NM7A 3ALOA 3U6JA 3DAJA 3D14A 4O6LA 4B7GA 2O3PA 3CTHA 3P08A 4X3FB 3ZRMA 1PJSA 2PZYA 1RJBA 2HW6A 3B8RA 4G3FA 1TH4A 4OBQA 5KQ8A 1OPKA 1YRPA 3BHUA 3KREA 4CFVA 3ELJA 1ZYDA 4DFNA 2PULA 2Y9QA 3OCGA 4ASXA 4A4XA 3A7JA 1IQPA 1LR4A 3KCKA 4AF3A 3ZEWA 2PSQA 4XV9A 3AC1A 5G1XA 4IJ9A 4M0ZA 2QHNA 5IQCA 2C6OA 2XYNA 2C6LA 3FL5A 4E6CA 4H05A 2C6MA 3KMUA 3V76A 3UYSA 2GQFA 3WF7A 2ETKA 5HNGA 4AW2A 1IM2A 4LGMA 5HE1A 3VW6A 3P7BA 4IX3A 5M56A 4LUDA 3W2RA 4E93A 5HTBA 3CQWA 1NSFA 4C4JA 5FSWA 3CY3A 2CLXA 4GT4A 3OCSA 2XKCA 3NNXA 4IX6A 4RIOA 4FNZA 4Q5EA 4U81A 1TTEA 3OWKA 4FTTA 3EWHA 4HYSA 4AW4A 5C1BA 4O2ZA 4FVPA 4O0WA 5EQTA 5E8UA 3RZBA 3EJ1A 4DHJA 2VU3A 2FA2A 4GC9A 2W4JA 1FOTA 3MB6A 2J50A 4LL0A 1XWSA 4N0SA 4QYGA 3AOEA 3RFWA 4D9UA 3UO6A 3DBEA 3ORMA 4J71A 1MRVA 2CGXA 2OO9A 4M8TA 3TV4A 4CT1A 4YNEA 4U45A 5ANOA 1GZOA 2IW9A 1MQBA 4QQJA 4QEBA 4KKHA 4DITA 5JSMA 5JH6A 2HW7A 2YABA 2C6KA 3E64A 5JZJA 1Q61A 4DBGB 3IO7A 2VWVA 5GNKA 4X2NA 5CAOA 3ZC6A 2C69A 4HVHA 4W8EA 3FYJX 3ML1A 5KPTA 3C5IA 4BB4A 5LMBA 2OU7A 4TT7A 5IT9S 4EBWA 2XAOA 3RMFA 3NWLA 3W0RA 4J1RA 3LXKA 1JKKA 1GJOA 5IQDA 4DUZM 4O4CA 4RFMA 4IEBA 2ITZA 1XH4A 2E9UA 5FWKK 3WF8A 2F5OA 3IW7A 4G3EA 3VWAA 5HBJA 1YXUA 4WOVA 4NFMA 5FEEA 5CNNA 3UO5A 3EQDA 4FTNA 2E9PA 5BVFA 1PMNA 4RMZA 3TJCA 3OCBA 1U5RA 2W0JA 4DF3A 5FUTA 2I6LA 4Q9ZA 4MHAA 4DV2M 3UIMA 3QQJA 2DUVA 2C6DA 1ZMUA 3TZ9A 4GKKM 4B99A 3GB2A 3LMHA 3EQGA 3PWDA 2JKKA 4GU9A 4E4MA 2AC3A 3TE6A 3TZ7A 5A4LA 3ATSA 3EB0A 3NIEA 4F9CA 4FE2A 4FNXA 2Y20A 3WI6A 4ZSLA 4O27B 1GZNA 2UU9M 3VS3A 3U4UA 5EW8A 4O21A 3D7TA 3QCYA 4OAUC 5EXXA 1BL6A 2I0EA 4V0GB 4IZ5A 4JI7M 4PDSA 4BZOA 5AP3A 4RJ5A 2WU6A 3U6QA 5KBRA 2ZOQA 5I3RA 3ZLXA 5DG5A 4II5A 3HA6A 4Y5QA 3VUGA 3MS9A 3MTLA 1YVJA 2FH0A 1SG9A 1NY3A 3FAAA 2VTOA 3EQFA 2ZTDA 4LJ4A 3NYOA 5JRQA 4YTHA 3RK9A 5EP1A 3IG5A 5K3YA 2KRUA 1FPUA 1NVQA 1OL5A 5IA3A 3BGQA 4V05A 4D28A 3COIA 4QHTA 3E4RA 1UV5A 5I9VA 2VTAA 4EHZA 2ZJWA 2FSMX 4EOOA 4ZLYA 4IXPA 4PL5A 2ZM3A 4IANA 5AADA 2C5OA 5FXSA 3K8ZA 3PPZA 2X4AA 3DZDA 1B39A 5EXPA 2VF7A 3W18A 4LF6M 2AYPA 3TWMA 4PD2A 3WZDA 3CJFA 1V0PA 5B2KA 5HIEA 3R22A 3W2CA 5CEQA 3RINA 4ZY6A 2J6MA 4TW9A 5AP4A 4JNWA 3ZO3A 5ITXA 1R2YA 4QP1A 5JK3A 1REJA 2DHRA 4GC5A 5GZ9A 3W1FA 4WO5A 4OTIA 2OXXA 3Q8GA 1BKXA 5CU0A 5I9ZA 1L3RE 2VGOA 3IHPA 2X2LA 3UMWA 4O81A 4YNOA 4QTDA 4O0TA 4MH7A 4FKPA 4GG7A 4W9XA 3R9RA 3F3TA 3KA0A 3WZUA 3S2PA 3OBJA 4IQ6A 4FV6A 1W5SA 3FLZA 5L3AA 4YLKA 4O1PA 1FINA 1NT2A 3W0NA 3Q5IA 3GQLA 1YWNA 3POZA 2O63A 3NIZA 4FVRA 3DT1A 4Y8DA 4O6EA 4E6QA 3QAME 4BI1A 3W0LB 4DH3A 3O7LB 3RVGA 2UZVA 5FP6A 1ND4A 5C27A 1VDLA 5JMSA 4DGMA 1OGUA 4IX4A 2B53A 4GK2A 4I94A 3UPXA 1I94M 5M09A 3NGAA 2VO6A 3KXZA 5D1JA 2W4OA 1Q3DA 2ONLC 2PMOX 2GNGA 2BALA 3B74A 3OUKA 3VBVA 3DKGA 3PPKA 1U4DA 1NNJA 4JI3M 4U80A 4FNWA 5HEZA 1GKIA