4NSRA

Crystal structure of the immunity protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
89
structure length
89
Chain Sequence
VHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunity protein
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Protein binding
total genus 38
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsrA00
4NSOB 4NSRA 4NOOB
chains in the Genus database with same CATH superfamily
1SXJC 4GMQA 4PCZA 3JR5A 4R3DA 1E94E 2R65A 2VIIA 3LCUA 3VLFB 2DI0A 2UUAM 4WP2A 4IBIA 5ITTA 2UXBM 7CATA 2GQFA 4GRIA 4RF0A 2ZANA 2RRUA 1VDLA 1Z5AA 4I81A 4OVZA 2J7NA 5KQ8A 4DR3M 3TWMA 1H6UA 2Z4RA 3KVWA 3H4MA 3LQRA 2QSFX 2LVQD 3ZC7B 1IY2A 2C99A 3L26A 4AZFA 1ZMWA 4LF9M 2K47A 1G71A 1QAMA 1T3TA 3SAWA 1TH4A 4XK8F 3RGSA 3EIHA 2A5YB 2VF7A 1PJTA 2KZUA 2G5GX 2ZAOA 3GRUA 3J7BA 4G4NA 4JI1M 2VQEM 4AKGA 1X37A 2WSFF 1EE8A 1IXSB 3FUWA 1TH2A 3L27A 4P17A 3VKGA 4CISA 2HHHM 3Q8GA 1PJSA 2VQFM 1SXJD 4IBGA 3U60A 4X62M 4GHAA 4NOOB 2D7EA 1JR3E 1WJ7A 3KW6A 2KHHA 4GH9A 3GQ3A 1N78A 1C7YA 2K6BA 3L28A 4I8OA 2LVNC 3B7QA 4I5SA 3FTEA 3J81S 4DR6M 4GEWA 4EIWA 3FUXA 3ZQJA 4B3MM 4LJ9A 3WHKA 3UK6A 4KODA 4M0DA 3KXEC 1NV8A 5ITYA 2ZAMA 1Q39A 2CE7A 1SXJA 4DV1M 3KS4A 1NY6A 3U6MA 5LMNM 2FOIC 4XGIA 3J2PB 3HX3A 4REZA 5ITRA 2QQ8A 2R46A 1GJTA 1HJPA 4KT0F 3FE3A 4ZPXA 1JR3A 4B7FA 2XFTA 2ZTDA 2KA6B 1UM8A 3UGJA 4L6V6 2L4FA 3SYKA 4BBAA 5FTNA 4JI6M 4NXMM 4FW9A 2QNJA 1GJSA 1Q02A 4LJAA 2UUCM 5JI2E 3FD9A 1S3SA 1Z5CA 4LRSA 4DBGB 4JI8M 3M0EA 5ITUA 1E9RA 2UXCM 5E6JA 4Z6YA 1N32M 1QYRA 3I4VA 4Y28F 2XSZD 2C9OA 1QUSA 3K9PA 3IHPA 4MGYE 5EXSA 2FE8A 5FTKA 5IZ7D 4DR2M 3U61B 2XZFA 1EIJA 1F4IA 1IN6A 3SHGB 3KOZE 2JA2A 3AOGA 3B74A 2J7OA 2UUBM 4IJEA 3U6CA 3VDPA 3B89A 4NXNM 2DZOB 4LFCM 3TWKA 1C1KA 1N77A 3GQ5A 2KNZA 2XSZA 2DWNA 1WGLA 2J5YA 4K0KM 5L8RF 1D0MA 4W5WA 4LCBA 4AG5A 2K9DA 2QHOB 2CRUA 2MGWA 2QCUA 4KO8A 2V1CA 4D82A 2JY7A 5FLXS 1AUAA 4JI5M 4MGIE 2DVWB 1SG9A 3SMSA 1EFUB 3C58A 2WZJA 1HNZM 2YR0A 1MJGM 2R62A 2WSCF 2NQ8C 5JI3E 5EP4A 2DAEA 4A3VB 4KHPM 2CUZA 3B7ZA 2QBYA 3PFIA 3GP1A 5F3WA 3CF0A 2DHRA 4L4UA 5H37D 4FWHA 3K92A 1HT2E 3PXGA 2KDLA 3QYBA 1FNNA 4AKHA 4IBCA 3SYLA 4DR4M 2GNOA 3GLHA 1V34A 3VDUA 3GLFE 4DR1M 2Z7JA 2KNAA 4GHLA 1K3WA 3J7AS 3AOEA 1QAOA 1CUKA 2O5RA 4DV6M 5LMUM 2RKOA 3DA1A 5BR8M 1V92A 4M9ZA 8CATA 3V76A 5KO3A 4FVMA 3FYCA 1VQ1A 3U60B 1I94M 2V1UA 3BBZA 3K8ZA 3LCVB 3E4RA 3ZH9B 4PDGA 1HQCA 3SAUA 2CV2A 2DXIA 4LZZA 4AG6A 4QNRA 2XH9A 2HL7A 4R7GA 3TE6A 4OU7A 3NBXX 3SHFA 5EQTA 1PRBA 1FJGM 4FCVA 2R6FA 1NJFA 2R4EA 4MGZE 3RE8A 4FWDA 3SC3A 4UN2B 1SXJB 3GLFA 5EP2A 4ANRA 4X65M 2EUCA 2R44A 2Y0TA 3HJQA 4LJ6A 4PDIA 2FNAA 4BB9A 5DNYA 2C98A 3T1HM 1A5TA 2FS1A 4HLQA 1NHGC 2BWBA 1Z5BA 1IBMM 2X8AA 4GKKM 3HU2A 1QUTA 2EA0A 4DR5M 2JWSA 4PD2A 3Q8XA 5KPTA 3GLIA 1E9SA 2Z8YM 1PJJA 2R18A 1Z59A 3UZUA 1IN4A 5KPRA 5EXXA 3HHWA 2KNVA 3GLGA 5FTJA 3FUTA 4GC5A 2LBCA 3TQSA 4KLNA 3VK7A 4YHHM 3KDSE 4JI0M 2L4EA 1L1ZA 1YE9A 1YUBA 4BLCA 2CHVA 3RGPA 3OTOM 1QDTA 1QAQA 3GRRA 2EKFA 2CHQA 1N36M 1GLNA 3HHYA 4AW4A 3UJNA 3E46A 3T6PA 1IXZA 1KFVA 1XMOM 1E32A 3ILKA 3BXWA 4QOZC 2M5ZA 2LVOC 2VF8A 4AI6A 3R8FA 3D8BA 3L2AA 1HNXM 2G8LA 1IY1A 3K9OA 4LJ4A 3R9XB 1DGHA 1VEJA 3W68A 1RU3A 4S12A 4CGYB 3HY5A 3QWLA 3AV0A 3GRYA 4NSOB 1R2YA 3C9PA 2VDBB 2LHGA 2AHMA 3DOAA 2I7PA 3LQQA 3NBIA 4IBEA 1JR3D 2L7HA 4Z8XA 2XLJA 2HKJA 3FTCA 2L2DA 2LVPC 4CHTB 2OOBA 2LTUA 1T6OA 2EJSA 3PNVA 4LRTA 4LZJA 4DV3M 1DGBA 4D80A 3AKZA 3TWLA 2UXDM 2QBYB 4GIPA 3GPPA 4JN6A 3U6QA 2P5TA 4B3RM 1PGYA 1HR0M 4NSRA 1IN5A 5BPVA 1IY0A 2QP9X 3QAUA 2YFQA 2BWEA 2BJWA 3GLHB 1NJGA 3KSXA 3AFHA 3I51A 2F5QA 2CEAA 5DYIA 2DENA 4LGMA 2ZTCA 4CIZA 1N33M 3I01M 2L7IA 2HCBA 3AOEC 3KS8A 4DR7M 2DHYA 2DZNB 2JNHA 5KPZA 2JZ1A 1NV9A 1HQYE 2JP7A 3SMPA 2EO2A 1NNJA 3MMPA 1QDRA 3HHXA 4GC9A 4LY6A 3I04M 1DGGA 4WW0A 1Y8GA 5IT9S 4RKUF 1R4GA 2YNMD 1MN3A 1Q3BA 2MJ5B 3CGWA 3QYEA 2F5PA 1JB0F 4JI4M 4IJFA 3KFUG 4AKIA 3KOYE 2KZSA 2XZUA 1ZAEA 3H4JA 1R6BX 2UU9M 2CP8A 4B3TM 3IG5A 4LF6M 1XMQM 1TDZA 2X4AA 2Y0QA 1KYIA 1IN8A 3MK6A 4L16A 3HKPA 3J80S 1QANA 3W0FA 3SAVA 3SBJA 3L29A 1Q3CA 4ITQA 5FTLA 1TDHA 3M7GA 4OVZB 3GLIB 1WXQA 4FD2A 3LVVA 4F1IA 5IREB 2WSEF 4IBDA 5ITQA 3GLGB 1DO0A 3M6AA 3U6OA 1OQYA 2BJVA 4LJ8A 1VG5A 1TF0B 4LJ7A 2ZM6M 1TGUA 3SFZA 4LF4M 3MJ5A 1GVNA 4FCWA 4G4QA 1XC8A 3ZCBB 1TTEA 2Q2EB 4IIWA 3KOWE 1VEKA 2DAIA 1LV7A 3FTDA 4G4OA 2MROB 3B9PA 4DV7M 4LJ5A 5C1BA 1W5SA 4MM3B 2KEBA 1IFYA 4XBOA 2L6OA 2Z4SA 5E26A 1JQJC 1ZMUA 1IQPA 1DGHB 2G3QA 3KOXE 3VKHA 2DZLA 4OW0A 4G4RA 4JI7M 1UFZA 2F4VM 4M0WA 3W0LB 3E9SA 2FH0A 3T38A 4F2LA 3GPUA 2DNAA 1IN7A 2DWMA 2HWJA 1J09A 4PT5A 4NC6A 3U6SA 2OO9A 3W67A 3FTFA 4LFAM 1QVRA 4L15A 1MU5A 3WHLA 5EP1A 3KP0E 4IBFA 4DV2M 1XXHE 4NRWA 2JY5A 2HAKA 1NY5A 2DWZB 2H1RA 3I4YA 3LVWA 3HHZA 3HZJA 2D7GA 5EJCA 1T43A 3U61A 2CV0A 2O25A 3BOSA 4Q7JA 4QNMA 1OAOC 2KW0A 1PJIA 4JI2M 2ERCA 3FKEA 2LXEA 5DYGA 3U5ZA 2OPFA 1NNUC 5KQDA 4B3SM 1N75A 1GKIA 2R4JA 2OOAA 4JV5M 1P3QQ 3KP1E 2FFJA 1OAIA 4QHSA 5A2QS 3HJ8A 2B3TA 4I4LA 3SATA 3THGA 1XXHA 4IBKA 1IBLM 3T15A 2V6ZM 3IECA 2DAKA 1D2NA 1VEGA 4L8RC 2KRUA 2KXEA 1XB2B 4RF1A 4B7HA 1R2ZA 5EXPA 3GPXA 1N34M 4LF8M 3CF6E 3U6EA 4FWGA 2JY6B 3J27B 2Y21A 1GL7A 2APLA 3B7NA 2F5NA 4HL4A 4MGHA 2CHGA 1OIPA 3DZDA 3L25A 3A42A 3TL4X 1SXJE 4AQYM 1GABA 1WGNA 1L8QA 2DKLA 3KSJA 3LMMA 4M9SA 4CJ6A 3C3EA 4D81A 2OQ4A 1V33A 2I7NA 3VK8A 2C5RA 3FUUA 2R45A 3U6PA 4MB7A 2MH8A 2LVAA 2XF3A 4L78A 3GPYA 2O01F 1K82A 1L2BA 5ITXE 1HT1E 4LG2A 1PM5A 5FTMA 2XGNA 3K2LA 1HNWM 3K1JA 4DUYM 2DAGA 4P16A 4GKJM 1NHWC 3D8LA 3A98B 1MX0A 1XHBA 4YY3M 3EIEA 1ZQ9A 1QZMA 1W5TA 1G8PA 1ORYB 2CWBA 2QPAA 1ZMVA 2L09A 1WIVA 3SASA 2YQZA 4LF7M 4B7GA 1WHCA 2DAMA 3NWLA 4RNAA 5ITXA 3GQ4A 4HEOA 2BNKA 3PNYA 3GLFB 2C96A 4NL4H 4LF5M 2EKKA 3HJSA 2DWLA 1L2CA 4IBBA 1OTRA 3HU3A 3HWSA 2JUJA 1J7KA 1QZEA 1R7RA 1TH3A 4QOSA 4DV5M 2F5SA 2Y20A 3PVSA 1KSFX 4FCTA 1D0KA 4II7A 2QENA 2XEPA 3E21A 3HU1A 2K0BX 1OJLA 2R0IA 1XWIA 2KRKA 2RGOA 1K3XA 2M60A 3TPZA 2LHCA 3U5ZB 4G6ZA 2F5OA 4DV4M 3FRIA 4M9XA 1IXSA 1IXRC 3GO8A 2W82A 3MHVC 4JI3M 1VDDA 4LGYA 4QHTA 3U6LA 4LFBM 1NO1A 1OIZA 2N35A 4X64M 2JXNA 3GLHE 1Z6TA 3AJIB 2JZ0A 2XFSA 1OFIA 1YSYA 2MR9A 4JXJA 1GL6A 1L2DA 4NRVA 1XXHB 1PJQA 2Z3XA 1XNQM 1TR8A 4GITA 1AIPC 2LNHC 1NVMA 5EP3A 4DUZM 1DGFA 3VFDA 3CF2A 3FUVA 4B08A 2CV1A 1D0LA 1OKSA 2RGHA 1I4WA 3CTWB 5IWAM 2C9CA 4R71A 1G3IA 3JAMS 1G59A 3GRVA 1GO5A 1G41A 3IG8A 4MH0E 4IBJA 1WR1B 1DO2A 1ZV1A 3A46A 2QZ4A 4G3OA 1YLAA 5DFLA 3U6DA 4X66M 4JYAM 5GKNA 3UMMA 2ZBKB 3JR4A 1BVSA 3FRHA 3AL0C 2H5XA 4WURA 2D7HA 3LW5F 2CFOA 3F92A 4DV0M 4OX9M 1LTMA 1IBKM 1QQWA 3A45A 5FSWA 2LWXA 1J5EM 3SARA 1OFHA 3GLIE 4TUWA 3C3DA 1NSFA 3HGIA 3T1YM 3DFZA 3GLGE 5EXTA 3RFWA 1XNRM 2LH0A 1G4AE 1IM2A 2JY8A 1L1TA 2X49A 2E5LM 1DV0A 4MGKE 3FYDA 5C18A 1R5LA
chains in the Genus database with same CATH topology
1SXJC 4GMQA 4PCZA 3JR5A 4R3DA 1E94E 2R65A 2VIIA 3VLFB 2UUAM 4IBIA 5ITTA 2UXBM 7CATA 4GRIA 4RF0A 2ZANA 1Z5AA 4I81A 4OVZA 2J7NA 5KQ8A 4DR3M 3TWMA 1H6UA 2Z4RA 3KVWA 3H4MA 3LQRA 3ZC7B 1IY2A 2C99A 3L26A 4AZFA 4LF9M 2K47A 1QAMA 1T3TA 3SAWA 1TH4A 3RGSA 3EIHA 2A5YB 2KZUA 2G5GX 2ZAOA 3GRUA 3J7BA 4G4NA 4JI1M 2VQEM 4AKGA 1X37A 3L27A 1EE8A 1IXSB 3FUWA 1TH2A 3VKGA 4CISA 2HHHM 2VQFM 1SXJD 4IBGA 3U60A 4X62M 4GHAA 4NOOB 2D7EA 3KW6A 4GH9A 3GQ3A 1N78A 3L28A 4I8OA 4I5SA 3FTEA 3J81S 4EIWA 3FUXA 4B3MM 4LJ9A 3WHKA 3UK6A 4KODA 4M0DA 3KXEC 5ITYA 2ZAMA 1Q39A 2CE7A 1SXJA 4DV1M 3KS4A 1NY6A 3U6MA 5LMNM 2FOIC 4XGIA 4REZA 5ITRA 2R46A 4ZPXA 1JR3A 4B7FA 2XFTA 2KA6B 1UM8A 3UGJA 4BBAA 4JI6M 3SYKA 4NXMM 5FTNA 4FW9A 4LJAA 2UUCM 5JI2E 3FD9A 1S3SA 1Z5CA 4LRSA 4JI8M 3M0EA 5ITUA 1E9RA 2UXCM 5E6JA 4Z6YA 1N32M 1QYRA 3I4VA 2XSZD 2C9OA 4MGYE 5EXSA 5IZ7D 4DR2M 3U61B 2FE8A 5FTKA 2XZFA 1IN6A 3SHGB 3KOZE 2JA2A 3AOGA 2UUBM 2J7OA 4IJEA 3U6CA 3VDPA 4NXNM 2DZOB 4LFCM 3TWKA 1C1KA 1N77A 3GQ5A 2XSZA 2DWNA 4K0KM 4W5WA 4LCBA 4AG5A 2QCUA 4KO8A 2V1CA 4D82A 5FLXS 4JI5M 4MGIE 2DVWB 3SMSA 3C58A 1HNZM 2YR0A 2R62A 2NQ8C 5JI3E 5EP4A 4A3VB 4KHPM 2CUZA 2QBYA 3PFIA 3GP1A 5F3WA 3CF0A 2DHRA 4L4UA 5H37D 4FWHA 3K92A 1HT2E 3PXGA 4AKHA 1FNNA 4IBCA 3SYLA 4DR4M 3GLHA 3VDUA 4DR1M 2Z7JA 4GHLA 1K3WA 3J7AS 3AOEA 1QAOA 2O5RA 4DV6M 5LMUM 2RKOA 3DA1A 5BR8M 4M9ZA 8CATA 5KO3A 4FVMA 3FYCA 3U60B 1I94M 2V1UA 3K8ZA 3ZH9B 3E4RA 4PDGA 1HQCA 3SAUA 2CV2A 2DXIA 4LZZA 4AG6A 4QNRA 2XH9A 2HL7A 4R7GA 3TE6A 4OU7A 3SHFA 5EQTA 1FJGM 4FCVA 4MGZE 1NJFA 2R4EA 3RE8A 3SC3A 4FWDA 1SXJB 3GLFA 5EP2A 4X65M 2EUCA 2Y0TA 3HJQA 4LJ6A 4PDIA 2FNAA 4BB9A 5DNYA 2C98A 3T1HM 4GKKM 4HLQA 4DR6M 1NHGC 1IBMM 1Z5BA 2X8AA 3HU2A 2EA0A 4DR5M 4PD2A 3Q8XA 5KPTA 3GLIA 1E9SA 1PJJA 2R18A 1Z59A 3UZUA 1IN4A 5KPRA 5EXXA 3HHWA 3GLGA 5FTJA 3FUTA 4GC5A 3TQSA 4KLNA 3VK7A 4YHHM 3KDSE 4JI0M 1L1ZA 1YE9A 1YUBA 4BLCA 2CHVA 3RGPA 3OTOM 3GRRA 1QAQA 2CHQA 1N36M 1GLNA 3HHYA 4AW4A 3UJNA 1IXZA 1KFVA 1XMOM 1E32A 3ILKA 4QOZC 2M5ZA 4AI6A 3R8FA 3D8BA 3L2AA 1HNXM 2G8LA 1IY1A 4LJ4A 3R9XB 1DGHA 4S12A 4CGYB 3QWLA 3AV0A 3GRYA 4NSOB 1R2YA 2AHMA 3DOAA 2I7PA 3LQQA 3NBIA 4IBEA 1JR3D 2L7HA 4Z8XA 2XLJA 2HKJA 3FTCA 4CHTB 3PNVA 4LRTA 4LZJA 4DV3M 1DGBA 4D80A 3AKZA 3TWLA 2UXDM 2QBYB 4GIPA 3GPPA 4JN6A 3U6QA 2P5TA 4B3RM 1HR0M 4NSRA 1IN5A 5BPVA 1IY0A 2QP9X 3QAUA 2YFQA 3GLHB 2BJWA 3KSXA 1NJGA 3AFHA 3I51A 2F5QA 2CEAA 5DYIA 1N33M 4LGMA 2L7IA 2HCBA 3AOEC 3KS8A 4DR7M 2DZNB 5KPZA 3SATA 1HQYE 3SMPA 2EO2A 1NNJA 4LY6A 3HHXA 4GC9A 1DGGA 4WW0A 5IT9S 2YNMD 1Q3BA 2F5PA 4JI4M 4IJFA 3KFUG 4AKIA 3KOYE 2KZSA 2XZUA 1ZAEA 1R6BX 2UU9M 4B3TM 3IG5A 4LF6M 1XMQM 1TDZA 2X4AA 2Y0QA 1KYIA 1IN8A 3MK6A 4L16A 3HKPA 3J80S 1QANA 3W0FA 3SAVA 3SBJA 3L29A 1Q3CA 4ITQA 5FTLA 1TDHA 3M7GA 4OVZB 3GLIB 1WXQA 4FD2A 3LVVA 5IREB 4IBDA 5ITQA 3GLGB 1DO0A 3M6AA 3U6OA 2BJVA 4LJ8A 4LJ7A 2ZM6M 1TGUA 3SFZA 4LF4M 3MJ5A 1GVNA 4FCWA 4G4QA 1XC8A 3ZCBB 2Q2EB 4IIWA 3KOWE 1LV7A 3FTDA 4G4OA 3B9PA 4DV7M 4LJ5A 5C1BA 1W5SA 4MM3B 2KEBA 4XBOA 2L6OA 2Z4SA 5E26A 1JQJC 1IQPA 1DGHB 3KOXE 3VKHA 4OW0A 4G4RA 4JI7M 2F4VM 4M0WA 3W0LB 3E9SA 3T38A 3GPUA 1IN7A 2DWMA 1J09A 4PT5A 3U6SA 3FTFA 4LFAM 1QVRA 4L15A 1MU5A 3WHLA 5EP1A 3KP0E 4IBFA 4DV2M 4NRWA 1NY5A 2DWZB 2H1RA 3I4YA 3LVWA 3HHZA 5EJCA 2D7GA 3U61A 2CV0A 3BOSA 4QNMA 1PJIA 2KW0A 4JI2M 2ERCA 3FKEA 2LXEA 5DYGA 3U5ZA 2OPFA 1NNUC 5KQDA 4B3SM 1N75A 1GKIA 2R4JA 4JV5M 3KP1E 2FFJA 4QHSA 5A2QS 3HJ8A 4I4LA 3THGA 1XXHA 4IBKA 1IBLM 3T15A 2V6ZM 1D2NA 4L8RC 2KRUA 2KXEA 4RF1A 4B7HA 1R2ZA 5EXPA 3GPXA 1N34M 4LF8M 3CF6E 3U6EA 4FWGA 3J27B 2Y21A 1GL7A 2F5NA 4HL4A 4MGHA 2CHGA 3DZDA 3L25A 3A42A 3TL4X 1SXJE 4AQYM 1L8QA 3KSJA 3LMMA 4M9SA 4D81A 2OQ4A 2I7NA 3VK8A 2C5RA 3FUUA 2R45A 3U6PA 4MB7A 2XF3A 4L78A 3GPYA 1K82A 1L2BA 5ITXE 1HT1E 4LG2A 1PM5A 5FTMA 2XGNA 3K2LA 1HNWM 3K1JA 4DUYM 4P16A 4GKJM 1NHWC 3D8LA 3A98B 1MX0A 1XHBA 4YY3M 3EIEA 1ZQ9A 1QZMA 1W5TA 1G8PA 1ORYB 2QPAA 2L09A 3SASA 2YQZA 4LF7M 4B7GA 3GQ4A 3NWLA 4RNAA 5ITXA 2BNKA 3PNYA 3GLFB 2C96A 4NL4H 4LF5M 2DWLA 3HJSA 1L2CA 4IBBA 3HU3A 3HWSA 1J7KA 1R7RA 1TH3A 4DV5M 4QOSA 2F5SA 2Y20A 3PVSA 1KSFX 4FCTA 4II7A 2QENA 2XEPA 3HU1A 1OJLA 2RGOA 1XWIA 2KRKA 1K3XA 2M60A 3TPZA 3U5ZB 4G6ZA 2F5OA 4DV4M 4M9XA 1IXRC 3GO8A 2W82A 3MHVC 4JI3M 1VDDA 4LGYA 4QHTA 3U6LA 4LFBM 4X64M 1Z6TA 3AJIB 2XFSA 1OFIA 1YSYA 4JXJA 1L2DA 1GL6A 4NRVA 1XXHB 2Z3XA 1XNQM 4GITA 2LNHC 4DUZM 1NVMA 5EP3A 1DGFA 3VFDA 3CF2A 3FUVA 4B08A 2CV1A 2RGHA 1I4WA 3CTWB 5IWAM 2C9CA 1G3IA 3JAMS 1G59A 3GRVA 1G41A 3IG8A 4MH0E 4IBJA 1DO2A 3A46A 2QZ4A 3U6DA 4X66M 4JYAM 5GKNA 3UMMA 2ZBKB 3JR4A 3AL0C 4WURA 2D7HA 2CFOA 4OX9M 4DV0M 1IBKM 1QQWA 3A45A 5FSWA 2LWXA 1J5EM 3SARA 1OFHA 4TUWA 1NSFA 3HGIA 3T1YM 3DFZA 5EXTA 3RFWA 1XNRM 2LH0A 1G4AE 1IM2A 1L1TA 2X49A 2E5LM 4MGKE 3FYDA 5C18A 3J2PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSO B;  4NSR A;  4NOO B; 
#chains in the Genus database with same CATH topology
 1SXJ C;  4GMQ A;  4PCZ A;  3JR5 A;  4R3D A;  1E94 E;  2R65 A;  2VII A;  3LCU A;  3VLF B;  2DI0 A;  2UUA M;  4WP2 A;  4IBI A;  5ITT A;  2UXB M;  7CAT A;  2GQF A;  4GRI A;  4RF0 A;  2ZAN A;  2RRU A;  1VDL A;  1Z5A A;  4I81 A;  4OVZ A;  2J7N A;  5KQ8 A;  4DR3 M;  3TWM A;  1H6U A;  2Z4R A;  3KVW A;  3H4M A;  3LQR A;  2QSF X;  2LVQ D;  3ZC7 B;  1IY2 A;  2C99 A;  3L26 A;  4AZF A;  1ZMW A;  4LF9 M;  2K47 A;  1G71 A;  1QAM A;  1T3T A;  3SAW A;  1TH4 A;  4XK8 F;  3RGS A;  3EIH A;  2A5Y B;  2VF7 A;  1PJT A;  2KZU A;  2G5G X;  2ZAO A;  3GRU A;  3J7B A;  4G4N A;  4JI1 M;  2VQE M;  4AKG A;  1X37 A;  2WSF F;  1EE8 A;  1IXS B;  3FUW A;  1TH2 A;  3L27 A;  4P17 A;  3VKG A;  4CIS A;  2HHH M;  3Q8G A;  1PJS A;  2VQF M;  1SXJ D;  4IBG A;  3U60 A;  4X62 M;  4GHA A;  4NOO B;  2D7E A;  1JR3 E;  1WJ7 A;  3KW6 A;  2KHH A;  4GH9 A;  3GQ3 A;  1N78 A;  1C7Y A;  2K6B A;  3L28 A;  4I8O A;  2LVN C;  3B7Q A;  4I5S A;  3FTE A;  3J81 S;  4DR6 M;  4GEW A;  4EIW A;  3FUX A;  3ZQJ A;  4B3M M;  4LJ9 A;  3WHK A;  3UK6 A;  4KOD A;  4M0D A;  3KXE C;  1NV8 A;  5ITY A;  2ZAM A;  1Q39 A;  2CE7 A;  1SXJ A;  4DV1 M;  3KS4 A;  1NY6 A;  3U6M A;  5LMN M;  2FOI C;  4XGI A;  3J2P B;  3HX3 A;  4REZ A;  5ITR A;  2QQ8 A;  2R46 A;  1GJT A;  1HJP A;  4KT0 F;  3FE3 A;  4ZPX A;  1JR3 A;  4B7F A;  2XFT A;  2ZTD A;  2KA6 B;  1UM8 A;  3UGJ A;  4L6V 6;  2L4F A;  3SYK A;  4BBA A;  5FTN A;  4JI6 M;  4NXM M;  4FW9 A;  2QNJ A;  1GJS A;  1Q02 A;  4LJA A;  2UUC M;  5JI2 E;  3FD9 A;  1S3S A;  1Z5C A;  4LRS A;  4DBG B;  4JI8 M;  3M0E A;  5ITU A;  1E9R A;  2UXC M;  5E6J A;  4Z6Y A;  1N32 M;  1QYR A;  3I4V A;  4Y28 F;  2XSZ D;  2C9O A;  1QUS A;  3K9P A;  3IHP A;  4MGY E;  5EXS A;  2FE8 A;  5FTK A;  5IZ7 D;  4DR2 M;  3U61 B;  2XZF A;  1EIJ A;  1F4I A;  1IN6 A;  3SHG B;  3KOZ E;  2JA2 A;  3AOG A;  3B74 A;  2J7O A;  2UUB M;  4IJE A;  3U6C A;  3VDP A;  3B89 A;  4NXN M;  2DZO B;  4LFC M;  3TWK A;  1C1K A;  1N77 A;  3GQ5 A;  2KNZ A;  2XSZ A;  2DWN A;  1WGL A;  2J5Y A;  4K0K M;  5L8R F;  1D0M A;  4W5W A;  4LCB A;  4AG5 A;  2K9D A;  2QHO B;  2CRU A;  2MGW A;  2QCU A;  4KO8 A;  2V1C A;  4D82 A;  2JY7 A;  5FLX S;  1AUA A;  4JI5 M;  4MGI E;  2DVW B;  1SG9 A;  3SMS A;  1EFU B;  3C58 A;  2WZJ A;  1HNZ M;  2YR0 A;  1MJG M;  2R62 A;  2WSC F;  2NQ8 C;  5JI3 E;  5EP4 A;  2DAE A;  4A3V B;  4KHP M;  2CUZ A;  3B7Z A;  2QBY A;  3PFI A;  3GP1 A;  5F3W A;  3CF0 A;  2DHR A;  4L4U A;  5H37 D;  4FWH A;  3K92 A;  1HT2 E;  3PXG A;  2KDL A;  3QYB A;  1FNN A;  4AKH A;  4IBC A;  3SYL A;  4DR4 M;  2GNO A;  3GLH A;  1V34 A;  3VDU A;  3GLF E;  4DR1 M;  2Z7J A;  2KNA A;  4GHL A;  1K3W A;  3J7A S;  3AOE A;  1QAO A;  1CUK A;  2O5R A;  4DV6 M;  5LMU M;  2RKO A;  3DA1 A;  5BR8 M;  1V92 A;  4M9Z A;  8CAT A;  3V76 A;  5KO3 A;  4FVM A;  3FYC A;  1VQ1 A;  3U60 B;  1I94 M;  2V1U A;  3BBZ A;  3K8Z A;  3LCV B;  3E4R A;  3ZH9 B;  4PDG A;  1HQC A;  3SAU A;  2CV2 A;  2DXI A;  4LZZ A;  4AG6 A;  4QNR A;  2XH9 A;  2HL7 A;  4R7G A;  3TE6 A;  4OU7 A;  3NBX X;  3SHF A;  5EQT A;  1PRB A;  1FJG M;  4FCV A;  2R6F A;  1NJF A;  2R4E A;  4MGZ E;  3RE8 A;  4FWD A;  3SC3 A;  4UN2 B;  1SXJ B;  3GLF A;  5EP2 A;  4ANR A;  4X65 M;  2EUC A;  2R44 A;  2Y0T A;  3HJQ A;  4LJ6 A;  4PDI A;  2FNA A;  4BB9 A;  5DNY A;  2C98 A;  3T1H M;  1A5T A;  2FS1 A;  4HLQ A;  1NHG C;  2BWB A;  1Z5B A;  1IBM M;  2X8A A;  4GKK M;  3HU2 A;  1QUT A;  2EA0 A;  4DR5 M;  2JWS A;  4PD2 A;  3Q8X A;  5KPT A;  3GLI A;  1E9S A;  2Z8Y M;  1PJJ A;  2R18 A;  1Z59 A;  3UZU A;  1IN4 A;  5KPR A;  5EXX A;  3HHW A;  2KNV A;  3GLG A;  5FTJ A;  3FUT A;  4GC5 A;  2LBC A;  3TQS A;  4KLN A;  3VK7 A;  4YHH M;  3KDS E;  4JI0 M;  2L4E A;  1L1Z A;  1YE9 A;  1YUB A;  4BLC A;  2CHV A;  3RGP A;  3OTO M;  1QDT A;  1QAQ A;  3GRR A;  2EKF A;  2CHQ A;  1N36 M;  1GLN A;  3HHY A;  4AW4 A;  3UJN A;  3E46 A;  3T6P A;  1IXZ A;  1KFV A;  1XMO M;  1E32 A;  3ILK A;  3BXW A;  4QOZ C;  2M5Z A;  2LVO C;  2VF8 A;  4AI6 A;  3R8F A;  3D8B A;  3L2A A;  1HNX M;  2G8L A;  1IY1 A;  3K9O A;  4LJ4 A;  3R9X B;  1DGH A;  1VEJ A;  3W68 A;  1RU3 A;  4S12 A;  4CGY B;  3HY5 A;  3QWL A;  3AV0 A;  3GRY A;  4NSO B;  1R2Y A;  3C9P A;  2VDB B;  2LHG A;  2AHM A;  3DOA A;  2I7P A;  3LQQ A;  3NBI A;  4IBE A;  1JR3 D;  2L7H A;  4Z8X A;  2XLJ A;  2HKJ A;  3FTC A;  2L2D A;  2LVP C;  4CHT B;  2OOB A;  2LTU A;  1T6O A;  2EJS A;  3PNV A;  4LRT A;  4LZJ A;  4DV3 M;  1DGB A;  4D80 A;  3AKZ A;  3TWL A;  2UXD M;  2QBY B;  4GIP A;  3GPP A;  4JN6 A;  3U6Q A;  2P5T A;  4B3R M;  1PGY A;  1HR0 M;  4NSR A;  1IN5 A;  5BPV A;  1IY0 A;  2QP9 X;  3QAU A;  2YFQ A;  2BWE A;  2BJW A;  3GLH B;  1NJG A;  3KSX A;  3AFH A;  3I51 A;  2F5Q A;  2CEA A;  5DYI A;  2DEN A;  4LGM A;  2ZTC A;  4CIZ A;  1N33 M;  3I01 M;  2L7I A;  2HCB A;  3AOE C;  3KS8 A;  4DR7 M;  2DHY A;  2DZN B;  2JNH A;  5KPZ A;  2JZ1 A;  1NV9 A;  1HQY E;  2JP7 A;  3SMP A;  2EO2 A;  1NNJ A;  3MMP A;  1QDR A;  3HHX A;  4GC9 A;  4LY6 A;  3I04 M;  1DGG A;  4WW0 A;  1Y8G A;  5IT9 S;  4RKU F;  1R4G A;  2YNM D;  1MN3 A;  1Q3B A;  2MJ5 B;  3CGW A;  3QYE A;  2F5P A;  1JB0 F;  4JI4 M;  4IJF A;  3KFU G;  4AKI A;  3KOY E;  2KZS A;  2XZU A;  1ZAE A;  3H4J A;  1R6B X;  2UU9 M;  2CP8 A;  4B3T M;  3IG5 A;  4LF6 M;  1XMQ M;  1TDZ A;  2X4A A;  2Y0Q A;  1KYI A;  1IN8 A;  3MK6 A;  4L16 A;  3HKP A;  3J80 S;  1QAN A;  3W0F A;  3SAV A;  3SBJ A;  3L29 A;  1Q3C A;  4ITQ A;  5FTL A;  1TDH A;  3M7G A;  4OVZ B;  3GLI B;  1WXQ A;  4FD2 A;  3LVV A;  4F1I A;  5IRE B;  2WSE F;  4IBD A;  5ITQ A;  3GLG B;  1DO0 A;  3M6A A;  3U6O A;  1OQY A;  2BJV A;  4LJ8 A;  1VG5 A;  1TF0 B;  4LJ7 A;  2ZM6 M;  1TGU A;  3SFZ A;  4LF4 M;  3MJ5 A;  1GVN A;  4FCW A;  4G4Q A;  1XC8 A;  3ZCB B;  1TTE A;  2Q2E B;  4IIW A;  3KOW E;  1VEK A;  2DAI A;  1LV7 A;  3FTD A;  4G4O A;  2MRO B;  3B9P A;  4DV7 M;  4LJ5 A;  5C1B A;  1W5S A;  4MM3 B;  2KEB A;  1IFY A;  4XBO A;  2L6O A;  2Z4S A;  5E26 A;  1JQJ C;  1ZMU A;  1IQP A;  1DGH B;  2G3Q A;  3KOX E;  3VKH A;  2DZL A;  4OW0 A;  4G4R A;  4JI7 M;  1UFZ A;  2F4V M;  4M0W A;  3W0L B;  3E9S A;  2FH0 A;  3T38 A;  4F2L A;  3GPU A;  2DNA A;  1IN7 A;  2DWM A;  2HWJ A;  1J09 A;  4PT5 A;  4NC6 A;  3U6S A;  2OO9 A;  3W67 A;  3FTF A;  4LFA M;  1QVR A;  4L15 A;  1MU5 A;  3WHL A;  5EP1 A;  3KP0 E;  4IBF A;  4DV2 M;  1XXH E;  4NRW A;  2JY5 A;  2HAK A;  1NY5 A;  2DWZ B;  2H1R A;  3I4Y A;  3LVW A;  3HHZ A;  3HZJ A;  2D7G A;  5EJC A;  1T43 A;  3U61 A;  2CV0 A;  2O25 A;  3BOS A;  4Q7J A;  4QNM A;  1OAO C;  2KW0 A;  1PJI A;  4JI2 M;  2ERC A;  3FKE A;  2LXE A;  5DYG A;  3U5Z A;  2OPF A;  1NNU C;  5KQD A;  4B3S M;  1N75 A;  1GKI A;  2R4J A;  2OOA A;  4JV5 M;  1P3Q Q;  3KP1 E;  2FFJ A;  1OAI A;  4QHS A;  5A2Q S;  3HJ8 A;  2B3T A;  4I4L A;  3SAT A;  3THG A;  1XXH A;  4IBK A;  1IBL M;  3T15 A;  2V6Z M;  3IEC A;  2DAK A;  1D2N A;  1VEG A;  4L8R C;  2KRU A;  2KXE A;  1XB2 B;  4RF1 A;  4B7H A;  1R2Z A;  5EXP A;  3GPX A;  1N34 M;  4LF8 M;  3CF6 E;  3U6E A;  4FWG A;  2JY6 B;  3J27 B;  2Y21 A;  1GL7 A;  2APL A;  3B7N A;  2F5N A;  4HL4 A;  4MGH A;  2CHG A;  1OIP A;  3DZD A;  3L25 A;  3A42 A;  3TL4 X;  1SXJ E;  4AQY M;  1GAB A;  1WGN A;  1L8Q A;  2DKL A;  3KSJ A;  3LMM A;  4M9S A;  4CJ6 A;  3C3E A;  4D81 A;  2OQ4 A;  1V33 A;  2I7N A;  3VK8 A;  2C5R A;  3FUU A;  2R45 A;  3U6P A;  4MB7 A;  2MH8 A;  2LVA A;  2XF3 A;  4L78 A;  3GPY A;  2O01 F;  1K82 A;  1L2B A;  5ITX E;  1HT1 E;  4LG2 A;  1PM5 A;  5FTM A;  2XGN A;  3K2L A;  1HNW M;  3K1J A;  4DUY M;  2DAG A;  4P16 A;  4GKJ M;  1NHW C;  3D8L A;  3A98 B;  1MX0 A;  1XHB A;  4YY3 M;  3EIE A;  1ZQ9 A;  1QZM A;  1W5T A;  1G8P A;  1ORY B;  2CWB A;  2QPA A;  1ZMV A;  2L09 A;  1WIV A;  3SAS A;  2YQZ A;  4LF7 M;  4B7G A;  1WHC A;  2DAM A;  3NWL A;  4RNA A;  5ITX A;  3GQ4 A;  4HEO A;  2BNK A;  3PNY A;  3GLF B;  2C96 A;  4NL4 H;  4LF5 M;  2EKK A;  3HJS A;  2DWL A;  1L2C A;  4IBB A;  1OTR A;  3HU3 A;  3HWS A;  2JUJ A;  1J7K A;  1QZE A;  1R7R A;  1TH3 A;  4QOS A;  4DV5 M;  2F5S A;  2Y20 A;  3PVS A;  1KSF X;  4FCT A;  1D0K A;  4II7 A;  2QEN A;  2XEP A;  3E21 A;  3HU1 A;  2K0B X;  1OJL A;  2R0I A;  1XWI A;  2KRK A;  2RGO A;  1K3X A;  2M60 A;  3TPZ A;  2LHC A;  3U5Z B;  4G6Z A;  2F5O A;  4DV4 M;  3FRI A;  4M9X A;  1IXS A;  1IXR C;  3GO8 A;  2W82 A;  3MHV C;  4JI3 M;  1VDD A;  4LGY A;  4QHT A;  3U6L A;  4LFB M;  1NO1 A;  1OIZ A;  2N35 A;  4X64 M;  2JXN A;  3GLH E;  1Z6T A;  3AJI B;  2JZ0 A;  2XFS A;  1OFI A;  1YSY A;  2MR9 A;  4JXJ A;  1GL6 A;  1L2D A;  4NRV A;  1XXH B;  1PJQ A;  2Z3X A;  1XNQ M;  1TR8 A;  4GIT A;  1AIP C;  2LNH C;  1NVM A;  5EP3 A;  4DUZ M;  1DGF A;  3VFD A;  3CF2 A;  3FUV A;  4B08 A;  2CV1 A;  1D0L A;  1OKS A;  2RGH A;  1I4W A;  3CTW B;  5IWA M;  2C9C A;  4R71 A;  1G3I A;  3JAM S;  1G59 A;  3GRV A;  1GO5 A;  1G41 A;  3IG8 A;  4MH0 E;  4IBJ A;  1WR1 B;  1DO2 A;  1ZV1 A;  3A46 A;  2QZ4 A;  4G3O A;  1YLA A;  5DFL A;  3U6D A;  4X66 M;  4JYA M;  5GKN A;  3UMM A;  2ZBK B;  3JR4 A;  1BVS A;  3FRH A;  3AL0 C;  2H5X A;  4WUR A;  2D7H A;  3LW5 F;  2CFO A;  3F92 A;  4DV0 M;  4OX9 M;  1LTM A;  1IBK M;  1QQW A;  3A45 A;  5FSW A;  2LWX A;  1J5E M;  3SAR A;  1OFH A;  3GLI E;  4TUW A;  3C3D A;  1NSF A;  3HGI A;  3T1Y M;  3DFZ A;  3GLG E;  5EXT A;  3RFW A;  1XNR M;  2LH0 A;  1G4A E;  1IM2 A;  2JY8 A;  1L1T A;  2X49 A;  2E5L M;  1DV0 A;  4MGK E;  3FYD A;  5C18 A;  1R5L A; 
#chains in the Genus database with same CATH homology
 1SXJ C;  4GMQ A;  4PCZ A;  3JR5 A;  4R3D A;  1E94 E;  2R65 A;  2VII A;  3VLF B;  2UUA M;  4IBI A;  5ITT A;  2UXB M;  7CAT A;  4GRI A;  4RF0 A;  2ZAN A;  1Z5A A;  4I81 A;  4OVZ A;  2J7N A;  5KQ8 A;  4DR3 M;  3TWM A;  1H6U A;  2Z4R A;  3KVW A;  3H4M A;  3LQR A;  3ZC7 B;  1IY2 A;  2C99 A;  3L26 A;  4AZF A;  4LF9 M;  2K47 A;  1QAM A;  1T3T A;  3SAW A;  1TH4 A;  3RGS A;  3EIH A;  2A5Y B;  2KZU A;  2G5G X;  2ZAO A;  3GRU A;  3J7B A;  4G4N A;  4JI1 M;  2VQE M;  4AKG A;  1X37 A;  3L27 A;  1EE8 A;  1IXS B;  3FUW A;  1TH2 A;  3VKG A;  4CIS A;  2HHH M;  2VQF M;  1SXJ D;  4IBG A;  3U60 A;  4X62 M;  4GHA A;  4NOO B;  2D7E A;  3KW6 A;  4GH9 A;  3GQ3 A;  1N78 A;  3L28 A;  4I8O A;  4I5S A;  3FTE A;  3J81 S;  4EIW A;  3FUX A;  4B3M M;  4LJ9 A;  3WHK A;  3UK6 A;  4KOD A;  4M0D A;  3KXE C;  5ITY A;  2ZAM A;  1Q39 A;  2CE7 A;  1SXJ A;  4DV1 M;  3KS4 A;  1NY6 A;  3U6M A;  5LMN M;  2FOI C;  4XGI A;  4REZ A;  5ITR A;  2R46 A;  4ZPX A;  1JR3 A;  4B7F A;  2XFT A;  2KA6 B;  1UM8 A;  3UGJ A;  4BBA A;  4JI6 M;  3SYK A;  4NXM M;  5FTN A;  4FW9 A;  4LJA A;  2UUC M;  5JI2 E;  3FD9 A;  1S3S A;  1Z5C A;  4LRS A;  4JI8 M;  3M0E A;  5ITU A;  1E9R A;  2UXC M;  5E6J A;  4Z6Y A;  1N32 M;  1QYR A;  3I4V A;  2XSZ D;  2C9O A;  4MGY E;  5EXS A;  5IZ7 D;  4DR2 M;  3U61 B;  2FE8 A;  5FTK A;  2XZF A;  1IN6 A;  3SHG B;  3KOZ E;  2JA2 A;  3AOG A;  2UUB M;  2J7O A;  4IJE A;  3U6C A;  3VDP A;  4NXN M;  2DZO B;  4LFC M;  3TWK A;  1C1K A;  1N77 A;  3GQ5 A;  2XSZ A;  2DWN A;  4K0K M;  4W5W A;  4LCB A;  4AG5 A;  2QCU A;  4KO8 A;  2V1C A;  4D82 A;  5FLX S;  4JI5 M;  4MGI E;  2DVW B;  3SMS A;  3C58 A;  1HNZ M;  2YR0 A;  2R62 A;  2NQ8 C;  5JI3 E;  5EP4 A;  4A3V B;  4KHP M;  2CUZ A;  2QBY A;  3PFI A;  3GP1 A;  5F3W A;  3CF0 A;  2DHR A;  4L4U A;  5H37 D;  4FWH A;  3K92 A;  1HT2 E;  3PXG A;  4AKH A;  1FNN A;  4IBC A;  3SYL A;  4DR4 M;  3GLH A;  3VDU A;  4DR1 M;  2Z7J A;  4GHL A;  1K3W A;  3J7A S;  3AOE A;  1QAO A;  2O5R A;  4DV6 M;  5LMU M;  2RKO A;  3DA1 A;  5BR8 M;  4M9Z A;  8CAT A;  5KO3 A;  4FVM A;  3FYC A;  3U60 B;  1I94 M;  2V1U A;  3K8Z A;  3ZH9 B;  3E4R A;  4PDG A;  1HQC A;  3SAU A;  2CV2 A;  2DXI A;  4LZZ A;  4AG6 A;  4QNR A;  2XH9 A;  2HL7 A;  4R7G A;  3TE6 A;  4OU7 A;  3SHF A;  5EQT A;  1FJG M;  4FCV A;  4MGZ E;  1NJF A;  2R4E A;  3RE8 A;  3SC3 A;  4FWD A;  1SXJ B;  3GLF A;  5EP2 A;  4X65 M;  2EUC A;  2Y0T A;  3HJQ A;  4LJ6 A;  4PDI A;  2FNA A;  4BB9 A;  5DNY A;  2C98 A;  3T1H M;  4GKK M;  4HLQ A;  4DR6 M;  1NHG C;  1IBM M;  1Z5B A;  2X8A A;  3HU2 A;  2EA0 A;  4DR5 M;  4PD2 A;  3Q8X A;  5KPT A;  3GLI A;  1E9S A;  1PJJ A;  2R18 A;  1Z59 A;  3UZU A;  1IN4 A;  5KPR A;  5EXX A;  3HHW A;  3GLG A;  5FTJ A;  3FUT A;  4GC5 A;  3TQS A;  4KLN A;  3VK7 A;  4YHH M;  3KDS E;  4JI0 M;  1L1Z A;  1YE9 A;  1YUB A;  4BLC A;  2CHV A;  3RGP A;  3OTO M;  3GRR A;  1QAQ A;  2CHQ A;  1N36 M;  1GLN A;  3HHY A;  4AW4 A;  3UJN A;  1IXZ A;  1KFV A;  1XMO M;  1E32 A;  3ILK A;  4QOZ C;  2M5Z A;  4AI6 A;  3R8F A;  3D8B A;  3L2A A;  1HNX M;  2G8L A;  1IY1 A;  4LJ4 A;  3R9X B;  1DGH A;  4S12 A;  4CGY B;  3QWL A;  3AV0 A;  3GRY A;  4NSO B;  1R2Y A;  2AHM A;  3DOA A;  2I7P A;  3LQQ A;  3NBI A;  4IBE A;  1JR3 D;  2L7H A;  4Z8X A;  2XLJ A;  2HKJ A;  3FTC A;  4CHT B;  3PNV A;  4LRT A;  4LZJ A;  4DV3 M;  1DGB A;  4D80 A;  3AKZ A;  3TWL A;  2UXD M;  2QBY B;  4GIP A;  3GPP A;  4JN6 A;  3U6Q A;  2P5T A;  4B3R M;  1HR0 M;  4NSR A;  1IN5 A;  5BPV A;  1IY0 A;  2QP9 X;  3QAU A;  2YFQ A;  3GLH B;  2BJW A;  3KSX A;  1NJG A;  3AFH A;  3I51 A;  2F5Q A;  2CEA A;  5DYI A;  1N33 M;  4LGM A;  2L7I A;  2HCB A;  3AOE C;  3KS8 A;  4DR7 M;  2DZN B;  5KPZ A;  3SAT A;  1HQY E;  3SMP A;  2EO2 A;  1NNJ A;  4LY6 A;  3HHX A;  4GC9 A;  1DGG A;  4WW0 A;  5IT9 S;  2YNM D;  1Q3B A;  2F5P A;  4JI4 M;  4IJF A;  3KFU G;  4AKI A;  3KOY E;  2KZS A;  2XZU A;  1ZAE A;  1R6B X;  2UU9 M;  4B3T M;  3IG5 A;  4LF6 M;  1XMQ M;  1TDZ A;  2X4A A;  2Y0Q A;  1KYI A;  1IN8 A;  3MK6 A;  4L16 A;  3HKP A;  3J80 S;  1QAN A;  3W0F A;  3SAV A;  3SBJ A;  3L29 A;  1Q3C A;  4ITQ A;  5FTL A;  1TDH A;  3M7G A;  4OVZ B;  3GLI B;  1WXQ A;  4FD2 A;  3LVV A;  5IRE B;  4IBD A;  5ITQ A;  3GLG B;  1DO0 A;  3M6A A;  3U6O A;  2BJV A;  4LJ8 A;  4LJ7 A;  2ZM6 M;  1TGU A;  3SFZ A;  4LF4 M;  3MJ5 A;  1GVN A;  4FCW A;  4G4Q A;  1XC8 A;  3ZCB B;  2Q2E B;  4IIW A;  3KOW E;  1LV7 A;  3FTD A;  4G4O A;  3B9P A;  4DV7 M;  4LJ5 A;  5C1B A;  1W5S A;  4MM3 B;  2KEB A;  4XBO A;  2L6O A;  2Z4S A;  5E26 A;  1JQJ C;  1IQP A;  1DGH B;  3KOX E;  3VKH A;  4OW0 A;  4G4R A;  4JI7 M;  2F4V M;  4M0W A;  3W0L B;  3E9S A;  3T38 A;  3GPU A;  1IN7 A;  2DWM A;  1J09 A;  4PT5 A;  3U6S A;  3FTF A;  4LFA M;  1QVR A;  4L15 A;  1MU5 A;  3WHL A;  5EP1 A;  3KP0 E;  4IBF A;  4DV2 M;  4NRW A;  1NY5 A;  2DWZ B;  2H1R A;  3I4Y A;  3LVW A;  3HHZ A;  5EJC A;  2D7G A;  3U61 A;  2CV0 A;  3BOS A;  4QNM A;  1PJI A;  2KW0 A;  4JI2 M;  2ERC A;  3FKE A;  2LXE A;  5DYG A;  3U5Z A;  2OPF A;  1NNU C;  5KQD A;  4B3S M;  1N75 A;  1GKI A;  2R4J A;  4JV5 M;  3KP1 E;  2FFJ A;  4QHS A;  5A2Q S;  3HJ8 A;  4I4L A;  3THG A;  1XXH A;  4IBK A;  1IBL M;  3T15 A;  2V6Z M;  1D2N A;  4L8R C;  2KRU A;  2KXE A;  4RF1 A;  4B7H A;  1R2Z A;  5EXP A;  3GPX A;  1N34 M;  4LF8 M;  3CF6 E;  3U6E A;  4FWG A;  3J27 B;  2Y21 A;  1GL7 A;  2F5N A;  4HL4 A;  4MGH A;  2CHG A;  3DZD A;  3L25 A;  3A42 A;  3TL4 X;  1SXJ E;  4AQY M;  1L8Q A;  3KSJ A;  3LMM A;  4M9S A;  4D81 A;  2OQ4 A;  2I7N A;  3VK8 A;  2C5R A;  3FUU A;  2R45 A;  3U6P A;  4MB7 A;  2XF3 A;  4L78 A;  3GPY A;  1K82 A;  1L2B A;  5ITX E;  1HT1 E;  4LG2 A;  1PM5 A;  5FTM A;  2XGN A;  3K2L A;  1HNW M;  3K1J A;  4DUY M;  4P16 A;  4GKJ M;  1NHW C;  3D8L A;  3A98 B;  1MX0 A;  1XHB A;  4YY3 M;  3EIE A;  1ZQ9 A;  1QZM A;  1W5T A;  1G8P A;  1ORY B;  2QPA A;  2L09 A;  3SAS A;  2YQZ A;  4LF7 M;  4B7G A;  3GQ4 A;  3NWL A;  4RNA A;  5ITX A;  2BNK A;  3PNY A;  3GLF B;  2C96 A;  4NL4 H;  4LF5 M;  2DWL A;  3HJS A;  1L2C A;  4IBB A;  3HU3 A;  3HWS A;  1J7K A;  1R7R A;  1TH3 A;  4DV5 M;  4QOS A;  2F5S A;  2Y20 A;  3PVS A;  1KSF X;  4FCT A;  4II7 A;  2QEN A;  2XEP A;  3HU1 A;  1OJL A;  2RGO A;  1XWI A;  2KRK A;  1K3X A;  2M60 A;  3TPZ A;  3U5Z B;  4G6Z A;  2F5O A;  4DV4 M;  4M9X A;  1IXR C;  3GO8 A;  2W82 A;  3MHV C;  4JI3 M;  1VDD A;  4LGY A;  4QHT A;  3U6L A;  4LFB M;  4X64 M;  1Z6T A;  3AJI B;  2XFS A;  1OFI A;  1YSY A;  4JXJ A;  1L2D A;  1GL6 A;  4NRV A;  1XXH B;  2Z3X A;  1XNQ M;  4GIT A;  2LNH C;  4DUZ M;  1NVM A;  5EP3 A;  1DGF A;  3VFD A;  3CF2 A;  3FUV A;  4B08 A;  2CV1 A;  2RGH A;  1I4W A;  3CTW B;  5IWA M;  2C9C A;  1G3I A;  3JAM S;  1G59 A;  3GRV A;  1G41 A;  3IG8 A;  4MH0 E;  4IBJ A;  1DO2 A;  3A46 A;  2QZ4 A;  3U6D A;  4X66 M;  4JYA M;  5GKN A;  3UMM A;  2ZBK B;  3JR4 A;  3AL0 C;  4WUR A;  2D7H A;  2CFO A;  4OX9 M;  4DV0 M;  1IBK M;  1QQW A;  3A45 A;  5FSW A;  2LWX A;  1J5E M;  3SAR A;  1OFH A;  4TUW A;  1NSF A;  3HGI A;  3T1Y M;  3DFZ A;  5EXT A;  3RFW A;  1XNR M;  2LH0 A;  1G4A E;  1IM2 A;  1L1T A;  2X49 A;  2E5L M;  4MGK E;  3FYD A;  5C18 A;  3J2P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...