4NSRA

Crystal structure of the immunity protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
89
structure length
89
Chain Sequence
VHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunity protein
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 38
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsrA00
4NSRA 4NOOB 4NSOB
chains in the Genus database with same CATH superfamily
4QOZC 1IY2A 2LXEA 4NXNM 4TUWA 1H6UA 1R7RA 1QZMA 4NOOB 2K6BA 3U5ZB 3JR5A 3GLGB 3KOZE 2JY5A 3KVWA 4Z8XA 2QQ8A 3VDPA 4NRWA 1VEGA 2EKFA 2Y0TA 4XBOA 3J27B 2YQZA 8CATA 3T1HM 3NWLA 5ITUA 2UXBM 3W0LB 2VDBB 1JR3D 2CHGA 2KXEA 2F4VM 4AKIA 1XHBA 3SHGB 2DAIA 2D7EA 3MJ5A 3BOSA 3GLGA 3C58A 1T6OA 1GL6A 2L4FA 1OFIA 5DYIA 3SBJA 5EP4A 1HJPA 1PJIA 3VKGA 4MGYE 3LCVB 4F2LA 2Z4SA 2LVAA 2J5YA 4OW0A 2R4JA 4IBJA 2CRUA 3U6MA 3U6CA 4GHAA 3HGIA 2F5QA 1J5EM 2OOAA 4GC5A 4JI8M 1TH2A 3UK6A 4KODA 4M9ZA 4Q7JA 4AQYM 3KP1E 1DGFA 1NY6A 2H5XA 2CWBA 4BB9A 1PJJA 3J7BA 4LJ8A 2V6ZM 4RNAA 3VK7A 2AHMA 3KSXA 3FE3A 1NVMA 3SAVA 3VKHA 4AZFA 2JZ0A 1G8PA 2MR9A 4L78A 3ZC7B 1LV7A 1GJTA 1OTRA 3M0EA 4IBGA 1L1TA 2DAEA 5A2QS 5GKNA 2XSZA 5EP3A 1WIVA 2JUJA 3VDUA 3AKZA 1C7YA 1OIPA 3I51A 3QAUA 4GEWA 3T1YM 1L2DA 4KT0F 3DOAA 1Q39A 3FTFA 4P16A 3HHYA 1G4AE 3ZCBB 2V1CA 2BWEA 2HCBA 3LQRA 3CF0A 3FTDA 4K0KM 5ITXE 3HJQA 2K47A 2DZLA 2QBYB 1PJSA 4KO8A 4L16A 2QHOB 1QAQA 5KQDA 1DO0A 1W5TA 3IECA 3SATA 1BVSA 3ZH9B 3GQ5A 3GQ4A 4DV0M 2QBYA 3U60A 4D81A 5FLXS 4MGIE 3B9PA 3RGSA 1VDLA 4MB7A 3RFWA 3CF2A 5ITTA 3E9SA 3TQSA 4OU7A 1IXSB 1JB0F 1IXZA 1VDDA 1SG9A 1J09A 5ITRA 2R62A 3M6AA 1EIJA 3LMMA 4LY6A 4B7FA 3VFDA 1IBLM 3KXEC 1NJFA 3GRYA 1NNJA 1A5TA 1JR3A 4X64M 4G3OA 2EJSA 4IBIA 1E9RA 1OFHA 1JR3E 1K82A 3FUUA 2VQEM 3CTWB 3HHXA 5IREB 2Q2EB 4OVZB 2X4AA 5KPTA 4S12A 1Z5CA 2JY8A 2Y21A 1PJTA 2MROB 3BBZA 3TPZA 3FUVA 5JI3E 3VK8A 2ZAOA 2V1UA 1OJLA 1V34A 3T6PA 2K0BX 2JY7A 3HZJA 2R44A 4OVZA 4B3SM 1TGUA 2HWJA 4I4LA 1PRBA 3WHKA 4I8OA 2F5SA 2RKOA 2XH9A 3PFIA 3U6PA 2R0IA 3KSJA 1PJQA 4LFAM 1YSYA 1GO5A 2YFQA 4FVMA 1HNXM 1XB2B 3PNYA 4FW9A 3GP1A 1T3TA 1N33M 2C99A 3T15A 4I81A 4PCZA 4CISA 2KNAA 1IBMM 1SXJD 1IQPA 4B3RM 4NL4H 4QNMA 2CV1A 1WGNA 4RF0A 3B74A 3KS8A 2WZJA 4IBCA 5FTKA 3KOXE 4F1IA 1FJGM 1N75A 3THGA 4B3TM 3AOEA 1QDRA 4II7A 4GC9A 3Q8XA 4GIPA 4IBDA 5EJCA 1Z59A 3E46A 4RF1A 1GABA 1QZEA 4PT5A 2LNHC 4FWDA 4NRVA 2Z4RA 4LF6M 3PXGA 1DO2A 3A42A 4LF4M 3B7QA 4MGKE 5KPRA 4AI6A 3MHVC 3U6DA 4KHPM 1G59A 3HU2A 2XF3A 4QNRA 4QHTA 1E32A 2KW0A 3LQQA 4B08A 5H37D 2LHGA 1QUSA 3W68A 3UGJA 1VG5A 1Z5AA 2KDLA 1YUBA 3I01M 3TE6A 2NQ8C 4LRTA 4B7HA 1L8QA 3FTEA 2QSFX 1ZMWA 2C96A 2DAMA 3LCUA 3SARA 2J7OA 3KOWE 3I4VA 3EIHA 5EP2A 3GPYA 3GLFE 5DYGA 3E21A 2R18A 2Z3XA 3WHLA 2LWXA 4X66M 3UJNA 3TWLA 3W67A 2DAGA 2DHRA 3U6QA 1TF0B 2XGNA 3DA1A 2XFSA 3FRIA 4CGYB 1NHWC 4M0WA 1GLNA 3R9XB 2JZ1A 2Y20A 2JA2A 2CV0A 3E4RA 5JI2E 1XXHA 4M9XA 2VF8A 2DWZB 2RGHA 5EP1A 2F5PA 1C1KA 2APLA 3GPUA 2DWMA 3J2PB 1XXHE 2DENA 2Z8YM 3SHFA 4M0DA 3K9PA 1TDHA 2UUBM 1TH4A 5KPZA 2HKJA 1WR1B 4YY3M 1T43A 3HHWA 5E26A 4OX9M 3GRUA 1GL7A 2XEPA 3HJSA 2L4EA 3GPXA 1Z5BA 5FTMA 1SXJA 4LJAA 5LMUM 4DBGB 2G3QA 3AFHA 2LBCA 2L2DA 3GLIE 5ITXA 2JNHA 3LVVA 3C9PA 3HY5A 4JI3M 1SXJE 1WXQA 3PNVA 5BPVA 4G4OA 2CP8A 1N77A 3FYCA 2QZ4A 3CGWA 3DFZA 3JR4A 4ANRA 2DWNA 3J80S 4LG2A 3SMSA 4B7GA 3HKPA 1IN8A 4FWHA 3U60B 2HAKA 2EO2A 3B7ZA 4LJ7A 5FTJA 3J81S 3GO8A 3SAUA 1D0KA 1GKIA 3HU1A 2KRUA 4L15A 4B3MM 2DHYA 5EXTA 1XMQM 1ZMUA 2G8LA 5C1BA 3FD9A 2MJ5B 3Q8GA 2VQFM 1VQ1A 3ZQJA 3QYEA 1G3IA 4WP2A 1HT2E 3C3DA 1QVRA 1Q3BA 1V92A 4Y28F 2OPFA 4DR6M 3BXWA 3A98B 2JWSA 2QP9X 2ZANA 3L25A 1WHCA 4IJEA 1D0MA 3TWKA 1R6BX 2JXNA 2QCUA 5FSWA 2UXCM 4FCTA 4LF7M 4AKHA 1ZAEA 3OTOM 1S3SA 4XK8F 1KFVA 4LF5M 5EXSA 5IWAM 5EXXA 5C18A 4L8RC 1WGLA 3SC3A 3F92A 3KW6A 4DV6M 3GLHA 3SYLA 2CE7A 3TWMA 1QAMA 2FE8A 4D82A 1UM8A 2DXIA 2G5GX 3B7NA 2P5TA 2O5RA 3KOYE 3JAMS 4IJFA 4GKJM 3GLHE 4LFBM 2FH0A 3DZDA 3LW5F 5FTLA 2CV2A 1K3XA 2KZSA 2O01F 4W5WA 1TDZA 1MJGM 2BNKA 3SAWA 2JY6B 2F5NA 4PDIA 3HX3A 5BR8M 3HU3A 4PDGA 4NXMM 2ZBKB 1Q3CA 2DVWB 1HQCA 1DGHB 4G4QA 4DV7M 1QAOA 2R6FA 4LZZA 3FYDA 3UMMA 4DUZM 4DR3M 4GITA 4ZPXA 2J7NA 4DUYM 1DGHA 3FKEA 4IBBA 1N32M 4LRSA 4M9SA 3VLFB 3HHZA 4Z6YA 2C5RA 3SFZA 4UN2B 2LH0A 2X49A 1R4GA 2DNAA 2LVNC 4A3VB 2W82A 4R71A 2JP7A 4JI7M 2QNJA 4LF8M 2CHVA 4CHTB 2VIIA 1DGBA 1DV0A 2KHHA 1J7KA 1R2YA 1XWIA 3AOEC 2DI0A 4EIWA 4AG6A 5DNYA 1F4IA 2C9OA 4GMQA 5EXPA 4AG5A 5F3WA 1I4WA 2C98A 4LJ9A 2E5LM 3GLFB 1Z6TA 3EIEA 1OAIA 2HHHM 2N35A 4MGHA 1IY1A 2R45A 2FFJA 3L26A 4G4NA 4LFCM 2DZNB 4KLNA 4GKKM 2CEAA 3GLFA 3CF6E 1ZQ9A 1MN3A 2RRUA 1VEJA 3AL0C 4FCVA 3RE8A 4L4UA 4BBAA 1XMOM 2BJVA 3FUXA 4DV1M 3RGPA 3U61B 3AOGA 1HNWM 2K9DA 3L28A 4X65M 1L2CA 2F5OA 2CHQA 1NV8A 1LTMA 2ZTDA 2O25A 2DWLA 1QQWA 3A45A 2WSCF 3ILKA 1R5LA 3GPPA 4DV4M 1XXHB 3NBIA 3W0FA 4DR1M 2H1RA 3K2LA 3U61A 3M7GA 2ZM6M 1FNNA 2XZUA 4X62M 4D80A 1WJ7A 3U5ZA 2FOIC 3R8FA 3IG5A 4DR4M 3KDSE 4AKGA 1NO1A 4BLCA 3GLGE 1GVNA 2D7HA 1N36M 1VEKA 2EUCA 3UZUA 2LTUA 3SYKA 3GLIB 1ZV1A 2I7NA 1SXJB 4WURA 2FNAA 2OO9A 3T38A 3IG8A 1JQJC 3KP0E 3J7AS 4QHSA 1EE8A 4IBFA 1IN5A 3GLIA 2L7IA 1V33A 4FCWA 4LCBA 1UFZA 1IM2A 3GRRA 3U6LA 2L7HA 1W5SA 1AUAA 1QYRA 2OQ4A 2KEBA 4JI2M 3L2AA 1EFUB 4JYAM 2ZTCA 5L8RF 1MX0A 1IN7A 4LF9M 1D0LA 5KO3A 2M5ZA 3H4JA 4GRIA 2XFTA 1XNQM 1OQYA 4IIWA 1K3WA 3L29A 2BJWA 1SXJC 5DFLA 4LZJA 1Q02A 1DGGA 2EKKA 1IN4A 3I04M 3QWLA 2OOBA 4JXJA 2ZAMA 4DV5M 1L1ZA 4IBEA 2GQFA 3LVWA 4DV3M 2WSFF 4LGMA 1QUTA 2RGOA 1X37A 2DAKA 3PVSA 1KSFX 1PGYA 4QOSA 3QYBA 1QDTA 3K1JA 2Y0QA 2C9CA 4L6V6 5KQ8A 1NHGC 3C3EA 4JI6M 3GRVA 2KRKA 1IXRC 3GLHB 1PM5A 1OKSA 1L2BA 3H4MA 7CATA 1TH3A 1OIZA 2UUAM 4LJ6A 3U6EA 4REZA 4JI1M 2LHCA 1AIPC 2GNOA 3HWSA 4HL4A 1N78A 3SASA 1G71A 2XZFA 4MH0E 3K8ZA 3NBXX 2R4EA 4XGIA 1RU3A 3D8LA 1HT1E 5IZ7D 2LVPC 3FUWA 2YR0A 2XLJA 2L09A 1I94M 4NSOB 1N34M 1HR0M 4MGZE 1IBKM 1XNRM 3HJ8A 4ITQA 5IT9S 2A5YB 4GH9A 2UU9M 1E94E 2MGWA 1YE9A 4JN6A 4DV2M 1NY5A 2KNVA 4NC6A 2X8AA 1IXSA 1KYIA 1HQYE 3AV0A 3IHPA 3K92A 1XC8A 2UXDM 2UUCM 2HL7A 3B89A 3FRHA 4LJ5A 5LMNM 1P3QQ 1QANA 4JV5M 2VF7A 5FTNA 1ZMVA 1IN6A 4GHLA 1IFYA 1NJGA 1NNUC 1TR8A 4LJ4A 1GJSA 2BWBA 4NSRA 3MMPA 2LVQD 3MK6A 2CFOA 4MM3B 2DZOB 3D8BA 1E9SA 3KS4A 1NV9A 2DKLA 4JI5M 4R7GA 2KA6B 4G6ZA 4RKUF 2R46A 2I7PA 3GQ3A 2LVOC 5E6JA 2R65A 2L6OA 4JI4M 1HNZM 4LGYA 1TTEA 1CUKA 2B3TA 4IBKA 2ERCA 4FWGA 1YLAA 2XSZD 2M60A 3I4YA 4DR2M 2QPAA 2EA0A 3FTCA 4DR5M 4DR7M 3U6OA 2QENA 3L27A 4CIZA 4I5SA 3K9OA 1G41A 4P17A 3A46A 5ITYA 1MU5A 3TL4X 5EQTA 4CJ6A 2D7GA 2Z7JA 3FUTA 4PD2A 4G4RA 3SMPA 1Y8GA 3AJIB 2WSEF 4WW0A 1IY0A 1R2ZA 1OAOC 1NSFA 4AW4A 4HLQA 1D2NA 2CUZA 2KZUA 4HEOA 5ITQA 3KFUG 4YHHM 1ORYB 4JI0M 2FS1A 2KNZA 2YNMD 3U6SA 2MH8A 4FD2A 4R3DA 3V76A
chains in the Genus database with same CATH topology
4QOZC 1IY2A 2LXEA 4NXNM 1H6UA 1R7RA 1QZMA 4NOOB 3U5ZB 3JR5A 3GLGB 3KOZE 3KVWA 4Z8XA 3VDPA 4NRWA 2Y0TA 4XBOA 8CATA 3J27B 2YQZA 3T1HM 3NWLA 5ITUA 2UXBM 3W0LB 1JR3D 2CHGA 2KXEA 2F4VM 4AKIA 1XHBA 3SHGB 2D7EA 3MJ5A 3BOSA 3GLGA 3C58A 1GL6A 1OFIA 5DYIA 3SBJA 5EP4A 1PJIA 3VKGA 4MGYE 2Z4SA 4OW0A 2R4JA 4IBJA 3U6MA 3U6CA 4GHAA 3HGIA 2F5QA 1J5EM 4GC5A 4JI8M 1TH2A 3UK6A 4KODA 4M9ZA 4AQYM 3KP1E 1DGFA 1NY6A 4BB9A 1PJJA 3J7BA 4LJ8A 2V6ZM 4RNAA 3VK7A 2AHMA 3KSXA 1NVMA 3SAVA 3VKHA 4AZFA 4L78A 1G8PA 3ZC7B 1LV7A 3M0EA 4IBGA 1L1TA 5A2QS 5GKNA 2XSZA 5EP3A 3VDUA 3AKZA 3I51A 3QAUA 3T1YM 1L2DA 3DOAA 1Q39A 3FTFA 4P16A 3HHYA 1G4AE 3ZCBB 2V1CA 3LQRA 2HCBA 3CF0A 3FTDA 4K0KM 5ITXE 3HJQA 2K47A 2QBYB 4KO8A 4L16A 1QAQA 5KQDA 1DO0A 1W5TA 3SATA 3GQ5A 3ZH9B 3GQ4A 4DV0M 2QBYA 3U60A 4D81A 5FLXS 4MGIE 3B9PA 3RGSA 4MB7A 3RFWA 3CF2A 5ITTA 3E9SA 3TQSA 4OU7A 1IXSB 1IXZA 1VDDA 1J09A 5ITRA 2R62A 3M6AA 3LMMA 4LY6A 4B7FA 3VFDA 1IBLM 3KXEC 1NJFA 3GRYA 1NNJA 1JR3A 4IBIA 1E9RA 1OFHA 1K82A 3FUUA 2VQEM 3CTWB 3HHXA 5IREB 2Q2EB 4OVZB 2X4AA 5KPTA 4S12A 1Z5CA 2Y21A 3TPZA 3FUVA 5JI3E 3VK8A 2ZAOA 2V1UA 1OJLA 4OVZA 4B3SM 1TGUA 2F5SA 4I4LA 3WHKA 4I8OA 2RKOA 2XH9A 3PFIA 3U6PA 3KSJA 4LFAM 1YSYA 2YFQA 4FVMA 1HNXM 3PNYA 4FW9A 3GP1A 1T3TA 1N33M 2C99A 3T15A 4I81A 4PCZA 4CISA 1IBMM 4B3RM 1SXJD 1IQPA 4NL4H 4QNMA 2CV1A 4RF0A 3KS8A 5FTKA 4IBCA 3KOXE 1FJGM 1N75A 3THGA 4B3TM 3AOEA 4II7A 4GC9A 3Q8XA 4GIPA 4IBDA 5EJCA 1Z59A 4RF1A 4PT5A 2LNHC 4FWDA 4NRVA 2Z4RA 4LF6M 3PXGA 1DO2A 3A42A 4LF4M 4MGKE 5KPRA 4AI6A 3MHVC 3U6DA 4KHPM 1G59A 3HU2A 2XF3A 4QNRA 4QHTA 1E32A 2KW0A 3LQQA 4B08A 5H37D 3UGJA 1Z5AA 1YUBA 3TE6A 2NQ8C 4LRTA 4B7HA 1L8QA 3FTEA 2C96A 3SARA 2J7OA 3KOWE 3I4VA 3EIHA 5EP2A 3GPYA 5DYGA 2R18A 2Z3XA 3WHLA 2LWXA 4X66M 3UJNA 3TWLA 2DHRA 3U6QA 2XGNA 3DA1A 2XFSA 4CGYB 1NHWC 4M0WA 1GLNA 3R9XB 2Y20A 2JA2A 2CV0A 3E4RA 5JI2E 1XXHA 4M9XA 2F5PA 2DWZB 2RGHA 5EP1A 1C1KA 3GPUA 2DWMA 3J2PB 3SHFA 4M0DA 1TDHA 2UUBM 1TH4A 5KPZA 2HKJA 4YY3M 3HHWA 5E26A 4OX9M 3GRUA 1GL7A 2XEPA 3HJSA 3GPXA 1Z5BA 5FTMA 1SXJA 4LJAA 5LMUM 3AFHA 5ITXA 3LVVA 2UXCM 4JI3M 1SXJE 1WXQA 3PNVA 5BPVA 4G4OA 1N77A 4LG2A 3FYCA 2QZ4A 3DFZA 3JR4A 2DWNA 3J80S 3SMSA 4B7GA 3HKPA 1IN8A 4FWHA 3U60B 2EO2A 4LJ7A 5FTJA 3J81S 3GO8A 3SAUA 1GKIA 3HU1A 4L15A 2KRUA 4B3MM 5EXTA 1XMQM 5C1BA 2G8LA 3FD9A 2VQFM 1G3IA 1HT2E 1QVRA 1Q3BA 2OPFA 4DR6M 3A98B 2QP9X 2ZANA 3L25A 3TWKA 4IJEA 5FSWA 1R6BX 2QCUA 4FCTA 4LF7M 4AKHA 1ZAEA 3OTOM 1S3SA 1KFVA 4LF5M 5EXSA 5IWAM 5EXXA 5C18A 4L8RC 3SC3A 3KW6A 4DV6M 3GLHA 3SYLA 2CE7A 3TWMA 1QAMA 2FE8A 4D82A 1UM8A 2DXIA 2G5GX 2P5TA 2O5RA 3KOYE 3JAMS 4IJFA 4GKJM 4LFBM 3DZDA 5FTLA 2CV2A 1K3XA 2KZSA 4W5WA 1TDZA 2BNKA 3SAWA 2F5NA 4PDIA 5BR8M 3HU3A 4PDGA 4NXMM 2ZBKB 1Q3CA 2DVWB 1HQCA 1DGHB 4G4QA 4DV7M 1QAOA 4LZZA 3FYDA 3UMMA 4DUZM 4DR3M 4GITA 4ZPXA 2J7NA 4DUYM 1DGHA 3FKEA 4IBBA 1N32M 4LRSA 4M9SA 3VLFB 3HHZA 4Z6YA 2C5RA 3SFZA 2LH0A 2X49A 4A3VB 2W82A 4JI7M 4LF8M 2CHVA 4CHTB 2VIIA 1DGBA 1J7KA 1R2YA 1XWIA 3AOEC 4EIWA 4AG6A 5DNYA 2C9OA 4GMQA 5EXPA 4AG5A 5F3WA 1I4WA 2C98A 4LJ9A 2E5LM 3GLFB 1Z6TA 3EIEA 2HHHM 4MGHA 1IY1A 2R45A 2FFJA 3L26A 4G4NA 4LFCM 2DZNB 4KLNA 4GKKM 2CEAA 3GLFA 3CF6E 1ZQ9A 3AL0C 4TUWA 4FCVA 3RE8A 4L4UA 4BBAA 1XMOM 2BJVA 3FUXA 4DV1M 3RGPA 3U61B 3AOGA 1HNWM 3L28A 4X65M 1L2CA 2F5OA 2CHQA 2DWLA 1QQWA 3A45A 3ILKA 3GPPA 4DV4M 1XXHB 3NBIA 3W0FA 4DR1M 2H1RA 3K2LA 3U61A 3M7GA 2ZM6M 1FNNA 2XZUA 4X62M 4D80A 3U5ZA 2FOIC 3R8FA 3IG5A 4DR4M 3KDSE 4AKGA 4BLCA 1GVNA 2D7HA 1N36M 2EUCA 3UZUA 3SYKA 3GLIB 2I7NA 1SXJB 4WURA 2FNAA 3T38A 3IG8A 1JQJC 3KP0E 3J7AS 4QHSA 1EE8A 4IBFA 1IN5A 3GLIA 2L7IA 4FCWA 4LCBA 1IM2A 3GRRA 3U6LA 2L7HA 1W5SA 1QYRA 2OQ4A 2KEBA 4JI2M 3L2AA 4JYAM 1MX0A 1IN7A 4LF9M 5KO3A 2M5ZA 4GRIA 2XFTA 1XNQM 4IIWA 1K3WA 3L29A 2BJWA 1SXJC 4LZJA 1DGGA 1IN4A 3QWLA 4DV5M 4JXJA 2ZAMA 1L1ZA 4IBEA 3LVWA 4DV3M 4LGMA 2RGOA 1X37A 3PVSA 1KSFX 4QOSA 3K1JA 2Y0QA 2C9CA 5KQ8A 1NHGC 4JI6M 3GRVA 2KRKA 1IXRC 3GLHB 1PM5A 1L2BA 3H4MA 7CATA 1TH3A 2UUAM 4LJ6A 3U6EA 4REZA 4JI1M 4HL4A 3HWSA 1N78A 3SASA 2XZFA 4MH0E 3K8ZA 2R4EA 4XGIA 5IZ7D 3D8LA 1HT1E 2XLJA 3FUWA 2YR0A 2L09A 1I94M 4NSOB 1N34M 1HR0M 4MGZE 1IBKM 1XNRM 3HJ8A 4ITQA 5IT9S 2A5YB 4GH9A 2UU9M 1E94E 4JN6A 1YE9A 4DV2M 1NY5A 1XC8A 2X8AA 1KYIA 3K92A 1HQYE 3AV0A 2UXDM 2UUCM 2HL7A 4LJ5A 5LMNM 1QANA 4JV5M 5FTNA 1IN6A 4GHLA 1NJGA 1NNUC 4LJ4A 4NSRA 3MK6A 2CFOA 4MM3B 2DZOB 3D8BA 1E9SA 3KS4A 4JI5M 4R7GA 2KA6B 4G6ZA 2R46A 2I7PA 3GQ3A 5E6JA 2R65A 2L6OA 4JI4M 1HNZM 4LGYA 4IBKA 2ERCA 4FWGA 2XSZD 2M60A 3I4YA 4DR2M 2QPAA 2EA0A 3FTCA 4DR5M 4DR7M 3U6OA 2QENA 3L27A 4I5SA 1G41A 3A46A 5ITYA 1MU5A 3TL4X 5EQTA 2D7GA 2Z7JA 3FUTA 4PD2A 4G4RA 3SMPA 3AJIB 4WW0A 1IY0A 1R2ZA 1NSFA 4AW4A 4HLQA 1D2NA 2CUZA 2KZUA 5ITQA 3KFUG 4YHHM 1ORYB 4JI0M 2YNMD 3U6SA 4X64M 4FD2A 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSR A;  4NOO B;  4NSO B; 
#chains in the Genus database with same CATH topology
 4QOZ C;  1IY2 A;  2LXE A;  4NXN M;  4TUW A;  1H6U A;  1R7R A;  1QZM A;  4NOO B;  2K6B A;  3U5Z B;  3JR5 A;  3GLG B;  3KOZ E;  2JY5 A;  3KVW A;  4Z8X A;  2QQ8 A;  3VDP A;  4NRW A;  1VEG A;  2EKF A;  2Y0T A;  4XBO A;  3J27 B;  2YQZ A;  8CAT A;  3T1H M;  3NWL A;  5ITU A;  2UXB M;  3W0L B;  2VDB B;  1JR3 D;  2CHG A;  2KXE A;  2F4V M;  4AKI A;  1XHB A;  3SHG B;  2DAI A;  2D7E A;  3MJ5 A;  3BOS A;  3GLG A;  3C58 A;  1T6O A;  1GL6 A;  2L4F A;  1OFI A;  5DYI A;  3SBJ A;  5EP4 A;  1HJP A;  1PJI A;  3VKG A;  4MGY E;  3LCV B;  4F2L A;  2Z4S A;  2LVA A;  2J5Y A;  4OW0 A;  2R4J A;  4IBJ A;  2CRU A;  3U6M A;  3U6C A;  4GHA A;  3HGI A;  2F5Q A;  1J5E M;  2OOA A;  4GC5 A;  4JI8 M;  1TH2 A;  3UK6 A;  4KOD A;  4M9Z A;  4Q7J A;  4AQY M;  3KP1 E;  1DGF A;  1NY6 A;  2H5X A;  2CWB A;  4BB9 A;  1PJJ A;  3J7B A;  4LJ8 A;  2V6Z M;  4RNA A;  3VK7 A;  2AHM A;  3KSX A;  3FE3 A;  1NVM A;  3SAV A;  3VKH A;  4AZF A;  2JZ0 A;  1G8P A;  2MR9 A;  4L78 A;  3ZC7 B;  1LV7 A;  1GJT A;  1OTR A;  3M0E A;  4IBG A;  1L1T A;  2DAE A;  5A2Q S;  5GKN A;  2XSZ A;  5EP3 A;  1WIV A;  2JUJ A;  3VDU A;  3AKZ A;  1C7Y A;  1OIP A;  3I51 A;  3QAU A;  4GEW A;  3T1Y M;  1L2D A;  4KT0 F;  3DOA A;  1Q39 A;  3FTF A;  4P16 A;  3HHY A;  1G4A E;  3ZCB B;  2V1C A;  2BWE A;  2HCB A;  3LQR A;  3CF0 A;  3FTD A;  4K0K M;  5ITX E;  3HJQ A;  2K47 A;  2DZL A;  2QBY B;  1PJS A;  4KO8 A;  4L16 A;  2QHO B;  1QAQ A;  5KQD A;  1DO0 A;  1W5T A;  3IEC A;  3SAT A;  1BVS A;  3ZH9 B;  3GQ5 A;  3GQ4 A;  4DV0 M;  2QBY A;  3U60 A;  4D81 A;  5FLX S;  4MGI E;  3B9P A;  3RGS A;  1VDL A;  4MB7 A;  3RFW A;  3CF2 A;  5ITT A;  3E9S A;  3TQS A;  4OU7 A;  1IXS B;  1JB0 F;  1IXZ A;  1VDD A;  1SG9 A;  1J09 A;  5ITR A;  2R62 A;  3M6A A;  1EIJ A;  3LMM A;  4LY6 A;  4B7F A;  3VFD A;  1IBL M;  3KXE C;  1NJF A;  3GRY A;  1NNJ A;  1A5T A;  1JR3 A;  4X64 M;  4G3O A;  2EJS A;  4IBI A;  1E9R A;  1OFH A;  1JR3 E;  1K82 A;  3FUU A;  2VQE M;  3CTW B;  3HHX A;  5IRE B;  2Q2E B;  4OVZ B;  2X4A A;  5KPT A;  4S12 A;  1Z5C A;  2JY8 A;  2Y21 A;  1PJT A;  2MRO B;  3BBZ A;  3TPZ A;  3FUV A;  5JI3 E;  3VK8 A;  2ZAO A;  2V1U A;  1OJL A;  1V34 A;  3T6P A;  2K0B X;  2JY7 A;  3HZJ A;  2R44 A;  4OVZ A;  4B3S M;  1TGU A;  2HWJ A;  4I4L A;  1PRB A;  3WHK A;  4I8O A;  2F5S A;  2RKO A;  2XH9 A;  3PFI A;  3U6P A;  2R0I A;  3KSJ A;  1PJQ A;  4LFA M;  1YSY A;  1GO5 A;  2YFQ A;  4FVM A;  1HNX M;  1XB2 B;  3PNY A;  4FW9 A;  3GP1 A;  1T3T A;  1N33 M;  2C99 A;  3T15 A;  4I81 A;  4PCZ A;  4CIS A;  2KNA A;  1IBM M;  1SXJ D;  1IQP A;  4B3R M;  4NL4 H;  4QNM A;  2CV1 A;  1WGN A;  4RF0 A;  3B74 A;  3KS8 A;  2WZJ A;  4IBC A;  5FTK A;  3KOX E;  4F1I A;  1FJG M;  1N75 A;  3THG A;  4B3T M;  3AOE A;  1QDR A;  4II7 A;  4GC9 A;  3Q8X A;  4GIP A;  4IBD A;  5EJC A;  1Z59 A;  3E46 A;  4RF1 A;  1GAB A;  1QZE A;  4PT5 A;  2LNH C;  4FWD A;  4NRV A;  2Z4R A;  4LF6 M;  3PXG A;  1DO2 A;  3A42 A;  4LF4 M;  3B7Q A;  4MGK E;  5KPR A;  4AI6 A;  3MHV C;  3U6D A;  4KHP M;  1G59 A;  3HU2 A;  2XF3 A;  4QNR A;  4QHT A;  1E32 A;  2KW0 A;  3LQQ A;  4B08 A;  5H37 D;  2LHG A;  1QUS A;  3W68 A;  3UGJ A;  1VG5 A;  1Z5A A;  2KDL A;  1YUB A;  3I01 M;  3TE6 A;  2NQ8 C;  4LRT A;  4B7H A;  1L8Q A;  3FTE A;  2QSF X;  1ZMW A;  2C96 A;  2DAM A;  3LCU A;  3SAR A;  2J7O A;  3KOW E;  3I4V A;  3EIH A;  5EP2 A;  3GPY A;  3GLF E;  5DYG A;  3E21 A;  2R18 A;  2Z3X A;  3WHL A;  2LWX A;  4X66 M;  3UJN A;  3TWL A;  3W67 A;  2DAG A;  2DHR A;  3U6Q A;  1TF0 B;  2XGN A;  3DA1 A;  2XFS A;  3FRI A;  4CGY B;  1NHW C;  4M0W A;  1GLN A;  3R9X B;  2JZ1 A;  2Y20 A;  2JA2 A;  2CV0 A;  3E4R A;  5JI2 E;  1XXH A;  4M9X A;  2VF8 A;  2DWZ B;  2RGH A;  5EP1 A;  2F5P A;  1C1K A;  2APL A;  3GPU A;  2DWM A;  3J2P B;  1XXH E;  2DEN A;  2Z8Y M;  3SHF A;  4M0D A;  3K9P A;  1TDH A;  2UUB M;  1TH4 A;  5KPZ A;  2HKJ A;  1WR1 B;  4YY3 M;  1T43 A;  3HHW A;  5E26 A;  4OX9 M;  3GRU A;  1GL7 A;  2XEP A;  3HJS A;  2L4E A;  3GPX A;  1Z5B A;  5FTM A;  1SXJ A;  4LJA A;  5LMU M;  4DBG B;  2G3Q A;  3AFH A;  2LBC A;  2L2D A;  3GLI E;  5ITX A;  2JNH A;  3LVV A;  3C9P A;  3HY5 A;  4JI3 M;  1SXJ E;  1WXQ A;  3PNV A;  5BPV A;  4G4O A;  2CP8 A;  1N77 A;  3FYC A;  2QZ4 A;  3CGW A;  3DFZ A;  3JR4 A;  4ANR A;  2DWN A;  3J80 S;  4LG2 A;  3SMS A;  4B7G A;  3HKP A;  1IN8 A;  4FWH A;  3U60 B;  2HAK A;  2EO2 A;  3B7Z A;  4LJ7 A;  5FTJ A;  3J81 S;  3GO8 A;  3SAU A;  1D0K A;  1GKI A;  3HU1 A;  2KRU A;  4L15 A;  4B3M M;  2DHY A;  5EXT A;  1XMQ M;  1ZMU A;  2G8L A;  5C1B A;  3FD9 A;  2MJ5 B;  3Q8G A;  2VQF M;  1VQ1 A;  3ZQJ A;  3QYE A;  1G3I A;  4WP2 A;  1HT2 E;  3C3D A;  1QVR A;  1Q3B A;  1V92 A;  4Y28 F;  2OPF A;  4DR6 M;  3BXW A;  3A98 B;  2JWS A;  2QP9 X;  2ZAN A;  3L25 A;  1WHC A;  4IJE A;  1D0M A;  3TWK A;  1R6B X;  2JXN A;  2QCU A;  5FSW A;  2UXC M;  4FCT A;  4LF7 M;  4AKH A;  1ZAE A;  3OTO M;  1S3S A;  4XK8 F;  1KFV A;  4LF5 M;  5EXS A;  5IWA M;  5EXX A;  5C18 A;  4L8R C;  1WGL A;  3SC3 A;  3F92 A;  3KW6 A;  4DV6 M;  3GLH A;  3SYL A;  2CE7 A;  3TWM A;  1QAM A;  2FE8 A;  4D82 A;  1UM8 A;  2DXI A;  2G5G X;  3B7N A;  2P5T A;  2O5R A;  3KOY E;  3JAM S;  4IJF A;  4GKJ M;  3GLH E;  4LFB M;  2FH0 A;  3DZD A;  3LW5 F;  5FTL A;  2CV2 A;  1K3X A;  2KZS A;  2O01 F;  4W5W A;  1TDZ A;  1MJG M;  2BNK A;  3SAW A;  2JY6 B;  2F5N A;  4PDI A;  3HX3 A;  5BR8 M;  3HU3 A;  4PDG A;  4NXM M;  2ZBK B;  1Q3C A;  2DVW B;  1HQC A;  1DGH B;  4G4Q A;  4DV7 M;  1QAO A;  2R6F A;  4LZZ A;  3FYD A;  3UMM A;  4DUZ M;  4DR3 M;  4GIT A;  4ZPX A;  2J7N A;  4DUY M;  1DGH A;  3FKE A;  4IBB A;  1N32 M;  4LRS A;  4M9S A;  3VLF B;  3HHZ A;  4Z6Y A;  2C5R A;  3SFZ A;  4UN2 B;  2LH0 A;  2X49 A;  1R4G A;  2DNA A;  2LVN C;  4A3V B;  2W82 A;  4R71 A;  2JP7 A;  4JI7 M;  2QNJ A;  4LF8 M;  2CHV A;  4CHT B;  2VII A;  1DGB A;  1DV0 A;  2KHH A;  1J7K A;  1R2Y A;  1XWI A;  3AOE C;  2DI0 A;  4EIW A;  4AG6 A;  5DNY A;  1F4I A;  2C9O A;  4GMQ A;  5EXP A;  4AG5 A;  5F3W A;  1I4W A;  2C98 A;  4LJ9 A;  2E5L M;  3GLF B;  1Z6T A;  3EIE A;  1OAI A;  2HHH M;  2N35 A;  4MGH A;  1IY1 A;  2R45 A;  2FFJ A;  3L26 A;  4G4N A;  4LFC M;  2DZN B;  4KLN A;  4GKK M;  2CEA A;  3GLF A;  3CF6 E;  1ZQ9 A;  1MN3 A;  2RRU A;  1VEJ A;  3AL0 C;  4FCV A;  3RE8 A;  4L4U A;  4BBA A;  1XMO M;  2BJV A;  3FUX A;  4DV1 M;  3RGP A;  3U61 B;  3AOG A;  1HNW M;  2K9D A;  3L28 A;  4X65 M;  1L2C A;  2F5O A;  2CHQ A;  1NV8 A;  1LTM A;  2ZTD A;  2O25 A;  2DWL A;  1QQW A;  3A45 A;  2WSC F;  3ILK A;  1R5L A;  3GPP A;  4DV4 M;  1XXH B;  3NBI A;  3W0F A;  4DR1 M;  2H1R A;  3K2L A;  3U61 A;  3M7G A;  2ZM6 M;  1FNN A;  2XZU A;  4X62 M;  4D80 A;  1WJ7 A;  3U5Z A;  2FOI C;  3R8F A;  3IG5 A;  4DR4 M;  3KDS E;  4AKG A;  1NO1 A;  4BLC A;  3GLG E;  1GVN A;  2D7H A;  1N36 M;  1VEK A;  2EUC A;  3UZU A;  2LTU A;  3SYK A;  3GLI B;  1ZV1 A;  2I7N A;  1SXJ B;  4WUR A;  2FNA A;  2OO9 A;  3T38 A;  3IG8 A;  1JQJ C;  3KP0 E;  3J7A S;  4QHS A;  1EE8 A;  4IBF A;  1IN5 A;  3GLI A;  2L7I A;  1V33 A;  4FCW A;  4LCB A;  1UFZ A;  1IM2 A;  3GRR A;  3U6L A;  2L7H A;  1W5S A;  1AUA A;  1QYR A;  2OQ4 A;  2KEB A;  4JI2 M;  3L2A A;  1EFU B;  4JYA M;  2ZTC A;  5L8R F;  1MX0 A;  1IN7 A;  4LF9 M;  1D0L A;  5KO3 A;  2M5Z A;  3H4J A;  4GRI A;  2XFT A;  1XNQ M;  1OQY A;  4IIW A;  1K3W A;  3L29 A;  2BJW A;  1SXJ C;  5DFL A;  4LZJ A;  1Q02 A;  1DGG A;  2EKK A;  1IN4 A;  3I04 M;  3QWL A;  2OOB A;  4JXJ A;  2ZAM A;  4DV5 M;  1L1Z A;  4IBE A;  2GQF A;  3LVW A;  4DV3 M;  2WSF F;  4LGM A;  1QUT A;  2RGO A;  1X37 A;  2DAK A;  3PVS A;  1KSF X;  1PGY A;  4QOS A;  3QYB A;  1QDT A;  3K1J A;  2Y0Q A;  2C9C A;  4L6V 6;  5KQ8 A;  1NHG C;  3C3E A;  4JI6 M;  3GRV A;  2KRK A;  1IXR C;  3GLH B;  1PM5 A;  1OKS A;  1L2B A;  3H4M A;  7CAT A;  1TH3 A;  1OIZ A;  2UUA M;  4LJ6 A;  3U6E A;  4REZ A;  4JI1 M;  2LHC A;  1AIP C;  2GNO A;  3HWS A;  4HL4 A;  1N78 A;  3SAS A;  1G71 A;  2XZF A;  4MH0 E;  3K8Z A;  3NBX X;  2R4E A;  4XGI A;  1RU3 A;  3D8L A;  1HT1 E;  5IZ7 D;  2LVP C;  3FUW A;  2YR0 A;  2XLJ A;  2L09 A;  1I94 M;  4NSO B;  1N34 M;  1HR0 M;  4MGZ E;  1IBK M;  1XNR M;  3HJ8 A;  4ITQ A;  5IT9 S;  2A5Y B;  4GH9 A;  2UU9 M;  1E94 E;  2MGW A;  1YE9 A;  4JN6 A;  4DV2 M;  1NY5 A;  2KNV A;  4NC6 A;  2X8A A;  1IXS A;  1KYI A;  1HQY E;  3AV0 A;  3IHP A;  3K92 A;  1XC8 A;  2UXD M;  2UUC M;  2HL7 A;  3B89 A;  3FRH A;  4LJ5 A;  5LMN M;  1P3Q Q;  1QAN A;  4JV5 M;  2VF7 A;  5FTN A;  1ZMV A;  1IN6 A;  4GHL A;  1IFY A;  1NJG A;  1NNU C;  1TR8 A;  4LJ4 A;  1GJS A;  2BWB A;  4NSR A;  3MMP A;  2LVQ D;  3MK6 A;  2CFO A;  4MM3 B;  2DZO B;  3D8B A;  1E9S A;  3KS4 A;  1NV9 A;  2DKL A;  4JI5 M;  4R7G A;  2KA6 B;  4G6Z A;  4RKU F;  2R46 A;  2I7P A;  3GQ3 A;  2LVO C;  5E6J A;  2R65 A;  2L6O A;  4JI4 M;  1HNZ M;  4LGY A;  1TTE A;  1CUK A;  2B3T A;  4IBK A;  2ERC A;  4FWG A;  1YLA A;  2XSZ D;  2M60 A;  3I4Y A;  4DR2 M;  2QPA A;  2EA0 A;  3FTC A;  4DR5 M;  4DR7 M;  3U6O A;  2QEN A;  3L27 A;  4CIZ A;  4I5S A;  3K9O A;  1G41 A;  4P17 A;  3A46 A;  5ITY A;  1MU5 A;  3TL4 X;  5EQT A;  4CJ6 A;  2D7G A;  2Z7J A;  3FUT A;  4PD2 A;  4G4R A;  3SMP A;  1Y8G A;  3AJI B;  2WSE F;  4WW0 A;  1IY0 A;  1R2Z A;  1OAO C;  1NSF A;  4AW4 A;  4HLQ A;  1D2N A;  2CUZ A;  2KZU A;  4HEO A;  5ITQ A;  3KFU G;  4YHH M;  1ORY B;  4JI0 M;  2FS1 A;  2KNZ A;  2YNM D;  3U6S A;  2MH8 A;  4FD2 A;  4R3D A;  3V76 A; 
#chains in the Genus database with same CATH homology
 4QOZ C;  1IY2 A;  2LXE A;  4NXN M;  1H6U A;  1R7R A;  1QZM A;  4NOO B;  3U5Z B;  3JR5 A;  3GLG B;  3KOZ E;  3KVW A;  4Z8X A;  3VDP A;  4NRW A;  2Y0T A;  4XBO A;  8CAT A;  3J27 B;  2YQZ A;  3T1H M;  3NWL A;  5ITU A;  2UXB M;  3W0L B;  1JR3 D;  2CHG A;  2KXE A;  2F4V M;  4AKI A;  1XHB A;  3SHG B;  2D7E A;  3MJ5 A;  3BOS A;  3GLG A;  3C58 A;  1GL6 A;  1OFI A;  5DYI A;  3SBJ A;  5EP4 A;  1PJI A;  3VKG A;  4MGY E;  2Z4S A;  4OW0 A;  2R4J A;  4IBJ A;  3U6M A;  3U6C A;  4GHA A;  3HGI A;  2F5Q A;  1J5E M;  4GC5 A;  4JI8 M;  1TH2 A;  3UK6 A;  4KOD A;  4M9Z A;  4AQY M;  3KP1 E;  1DGF A;  1NY6 A;  4BB9 A;  1PJJ A;  3J7B A;  4LJ8 A;  2V6Z M;  4RNA A;  3VK7 A;  2AHM A;  3KSX A;  1NVM A;  3SAV A;  3VKH A;  4AZF A;  4L78 A;  1G8P A;  3ZC7 B;  1LV7 A;  3M0E A;  4IBG A;  1L1T A;  5A2Q S;  5GKN A;  2XSZ A;  5EP3 A;  3VDU A;  3AKZ A;  3I51 A;  3QAU A;  3T1Y M;  1L2D A;  3DOA A;  1Q39 A;  3FTF A;  4P16 A;  3HHY A;  1G4A E;  3ZCB B;  2V1C A;  3LQR A;  2HCB A;  3CF0 A;  3FTD A;  4K0K M;  5ITX E;  3HJQ A;  2K47 A;  2QBY B;  4KO8 A;  4L16 A;  1QAQ A;  5KQD A;  1DO0 A;  1W5T A;  3SAT A;  3GQ5 A;  3ZH9 B;  3GQ4 A;  4DV0 M;  2QBY A;  3U60 A;  4D81 A;  5FLX S;  4MGI E;  3B9P A;  3RGS A;  4MB7 A;  3RFW A;  3CF2 A;  5ITT A;  3E9S A;  3TQS A;  4OU7 A;  1IXS B;  1IXZ A;  1VDD A;  1J09 A;  5ITR A;  2R62 A;  3M6A A;  3LMM A;  4LY6 A;  4B7F A;  3VFD A;  1IBL M;  3KXE C;  1NJF A;  3GRY A;  1NNJ A;  1JR3 A;  4IBI A;  1E9R A;  1OFH A;  1K82 A;  3FUU A;  2VQE M;  3CTW B;  3HHX A;  5IRE B;  2Q2E B;  4OVZ B;  2X4A A;  5KPT A;  4S12 A;  1Z5C A;  2Y21 A;  3TPZ A;  3FUV A;  5JI3 E;  3VK8 A;  2ZAO A;  2V1U A;  1OJL A;  4OVZ A;  4B3S M;  1TGU A;  2F5S A;  4I4L A;  3WHK A;  4I8O A;  2RKO A;  2XH9 A;  3PFI A;  3U6P A;  3KSJ A;  4LFA M;  1YSY A;  2YFQ A;  4FVM A;  1HNX M;  3PNY A;  4FW9 A;  3GP1 A;  1T3T A;  1N33 M;  2C99 A;  3T15 A;  4I81 A;  4PCZ A;  4CIS A;  1IBM M;  4B3R M;  1SXJ D;  1IQP A;  4NL4 H;  4QNM A;  2CV1 A;  4RF0 A;  3KS8 A;  5FTK A;  4IBC A;  3KOX E;  1FJG M;  1N75 A;  3THG A;  4B3T M;  3AOE A;  4II7 A;  4GC9 A;  3Q8X A;  4GIP A;  4IBD A;  5EJC A;  1Z59 A;  4RF1 A;  4PT5 A;  2LNH C;  4FWD A;  4NRV A;  2Z4R A;  4LF6 M;  3PXG A;  1DO2 A;  3A42 A;  4LF4 M;  4MGK E;  5KPR A;  4AI6 A;  3MHV C;  3U6D A;  4KHP M;  1G59 A;  3HU2 A;  2XF3 A;  4QNR A;  4QHT A;  1E32 A;  2KW0 A;  3LQQ A;  4B08 A;  5H37 D;  3UGJ A;  1Z5A A;  1YUB A;  3TE6 A;  2NQ8 C;  4LRT A;  4B7H A;  1L8Q A;  3FTE A;  2C96 A;  3SAR A;  2J7O A;  3KOW E;  3I4V A;  3EIH A;  5EP2 A;  3GPY A;  5DYG A;  2R18 A;  2Z3X A;  3WHL A;  2LWX A;  4X66 M;  3UJN A;  3TWL A;  2DHR A;  3U6Q A;  2XGN A;  3DA1 A;  2XFS A;  4CGY B;  1NHW C;  4M0W A;  1GLN A;  3R9X B;  2Y20 A;  2JA2 A;  2CV0 A;  3E4R A;  5JI2 E;  1XXH A;  4M9X A;  2F5P A;  2DWZ B;  2RGH A;  5EP1 A;  1C1K A;  3GPU A;  2DWM A;  3J2P B;  3SHF A;  4M0D A;  1TDH A;  2UUB M;  1TH4 A;  5KPZ A;  2HKJ A;  4YY3 M;  3HHW A;  5E26 A;  4OX9 M;  3GRU A;  1GL7 A;  2XEP A;  3HJS A;  3GPX A;  1Z5B A;  5FTM A;  1SXJ A;  4LJA A;  5LMU M;  3AFH A;  5ITX A;  3LVV A;  2UXC M;  4JI3 M;  1SXJ E;  1WXQ A;  3PNV A;  5BPV A;  4G4O A;  1N77 A;  4LG2 A;  3FYC A;  2QZ4 A;  3DFZ A;  3JR4 A;  2DWN A;  3J80 S;  3SMS A;  4B7G A;  3HKP A;  1IN8 A;  4FWH A;  3U60 B;  2EO2 A;  4LJ7 A;  5FTJ A;  3J81 S;  3GO8 A;  3SAU A;  1GKI A;  3HU1 A;  4L15 A;  2KRU A;  4B3M M;  5EXT A;  1XMQ M;  5C1B A;  2G8L A;  3FD9 A;  2VQF M;  1G3I A;  1HT2 E;  1QVR A;  1Q3B A;  2OPF A;  4DR6 M;  3A98 B;  2QP9 X;  2ZAN A;  3L25 A;  3TWK A;  4IJE A;  5FSW A;  1R6B X;  2QCU A;  4FCT A;  4LF7 M;  4AKH A;  1ZAE A;  3OTO M;  1S3S A;  1KFV A;  4LF5 M;  5EXS A;  5IWA M;  5EXX A;  5C18 A;  4L8R C;  3SC3 A;  3KW6 A;  4DV6 M;  3GLH A;  3SYL A;  2CE7 A;  3TWM A;  1QAM A;  2FE8 A;  4D82 A;  1UM8 A;  2DXI A;  2G5G X;  2P5T A;  2O5R A;  3KOY E;  3JAM S;  4IJF A;  4GKJ M;  4LFB M;  3DZD A;  5FTL A;  2CV2 A;  1K3X A;  2KZS A;  4W5W A;  1TDZ A;  2BNK A;  3SAW A;  2F5N A;  4PDI A;  5BR8 M;  3HU3 A;  4PDG A;  4NXM M;  2ZBK B;  1Q3C A;  2DVW B;  1HQC A;  1DGH B;  4G4Q A;  4DV7 M;  1QAO A;  4LZZ A;  3FYD A;  3UMM A;  4DUZ M;  4DR3 M;  4GIT A;  4ZPX A;  2J7N A;  4DUY M;  1DGH A;  3FKE A;  4IBB A;  1N32 M;  4LRS A;  4M9S A;  3VLF B;  3HHZ A;  4Z6Y A;  2C5R A;  3SFZ A;  2LH0 A;  2X49 A;  4A3V B;  2W82 A;  4JI7 M;  4LF8 M;  2CHV A;  4CHT B;  2VII A;  1DGB A;  1J7K A;  1R2Y A;  1XWI A;  3AOE C;  4EIW A;  4AG6 A;  5DNY A;  2C9O A;  4GMQ A;  5EXP A;  4AG5 A;  5F3W A;  1I4W A;  2C98 A;  4LJ9 A;  2E5L M;  3GLF B;  1Z6T A;  3EIE A;  2HHH M;  4MGH A;  1IY1 A;  2R45 A;  2FFJ A;  3L26 A;  4G4N A;  4LFC M;  2DZN B;  4KLN A;  4GKK M;  2CEA A;  3GLF A;  3CF6 E;  1ZQ9 A;  3AL0 C;  4TUW A;  4FCV A;  3RE8 A;  4L4U A;  4BBA A;  1XMO M;  2BJV A;  3FUX A;  4DV1 M;  3RGP A;  3U61 B;  3AOG A;  1HNW M;  3L28 A;  4X65 M;  1L2C A;  2F5O A;  2CHQ A;  2DWL A;  1QQW A;  3A45 A;  3ILK A;  3GPP A;  4DV4 M;  1XXH B;  3NBI A;  3W0F A;  4DR1 M;  2H1R A;  3K2L A;  3U61 A;  3M7G A;  2ZM6 M;  1FNN A;  2XZU A;  4X62 M;  4D80 A;  3U5Z A;  2FOI C;  3R8F A;  3IG5 A;  4DR4 M;  3KDS E;  4AKG A;  4BLC A;  1GVN A;  2D7H A;  1N36 M;  2EUC A;  3UZU A;  3SYK A;  3GLI B;  2I7N A;  1SXJ B;  4WUR A;  2FNA A;  3T38 A;  3IG8 A;  1JQJ C;  3KP0 E;  3J7A S;  4QHS A;  1EE8 A;  4IBF A;  1IN5 A;  3GLI A;  2L7I A;  4FCW A;  4LCB A;  1IM2 A;  3GRR A;  3U6L A;  2L7H A;  1W5S A;  1QYR A;  2OQ4 A;  2KEB A;  4JI2 M;  3L2A A;  4JYA M;  1MX0 A;  1IN7 A;  4LF9 M;  5KO3 A;  2M5Z A;  4GRI A;  2XFT A;  1XNQ M;  4IIW A;  1K3W A;  3L29 A;  2BJW A;  1SXJ C;  4LZJ A;  1DGG A;  1IN4 A;  3QWL A;  4DV5 M;  4JXJ A;  2ZAM A;  1L1Z A;  4IBE A;  3LVW A;  4DV3 M;  4LGM A;  2RGO A;  1X37 A;  3PVS A;  1KSF X;  4QOS A;  3K1J A;  2Y0Q A;  2C9C A;  5KQ8 A;  1NHG C;  4JI6 M;  3GRV A;  2KRK A;  1IXR C;  3GLH B;  1PM5 A;  1L2B A;  3H4M A;  7CAT A;  1TH3 A;  2UUA M;  4LJ6 A;  3U6E A;  4REZ A;  4JI1 M;  4HL4 A;  3HWS A;  1N78 A;  3SAS A;  2XZF A;  4MH0 E;  3K8Z A;  2R4E A;  4XGI A;  5IZ7 D;  3D8L A;  1HT1 E;  2XLJ A;  3FUW A;  2YR0 A;  2L09 A;  1I94 M;  4NSO B;  1N34 M;  1HR0 M;  4MGZ E;  1IBK M;  1XNR M;  3HJ8 A;  4ITQ A;  5IT9 S;  2A5Y B;  4GH9 A;  2UU9 M;  1E94 E;  4JN6 A;  1YE9 A;  4DV2 M;  1NY5 A;  1XC8 A;  2X8A A;  1KYI A;  3K92 A;  1HQY E;  3AV0 A;  2UXD M;  2UUC M;  2HL7 A;  4LJ5 A;  5LMN M;  1QAN A;  4JV5 M;  5FTN A;  1IN6 A;  4GHL A;  1NJG A;  1NNU C;  4LJ4 A;  4NSR A;  3MK6 A;  2CFO A;  4MM3 B;  2DZO B;  3D8B A;  1E9S A;  3KS4 A;  4JI5 M;  4R7G A;  2KA6 B;  4G6Z A;  2R46 A;  2I7P A;  3GQ3 A;  5E6J A;  2R65 A;  2L6O A;  4JI4 M;  1HNZ M;  4LGY A;  4IBK A;  2ERC A;  4FWG A;  2XSZ D;  2M60 A;  3I4Y A;  4DR2 M;  2QPA A;  2EA0 A;  3FTC A;  4DR5 M;  4DR7 M;  3U6O A;  2QEN A;  3L27 A;  4I5S A;  1G41 A;  3A46 A;  5ITY A;  1MU5 A;  3TL4 X;  5EQT A;  2D7G A;  2Z7J A;  3FUT A;  4PD2 A;  4G4R A;  3SMP A;  3AJI B;  4WW0 A;  1IY0 A;  1R2Z A;  1NSF A;  4AW4 A;  4HLQ A;  1D2N A;  2CUZ A;  2KZU A;  5ITQ A;  3KFU G;  4YHH M;  1ORY B;  4JI0 M;  2YNM D;  3U6S A;  4X64 M;  4FD2 A;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...