4NSRA

Crystal structure of the immunity protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
89
structure length
89
Chain Sequence
VHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Protein binding
molecule keywords Immunity protein
total genus 38
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsrA00
4NSRA 4NOOB 4NSOB
chains in the Genus database with same CATH superfamily
5GKNA 3FRHA 1IY2A 3GLFA 1R7RA 4L8RC 3OTOM 4R7GA 1R4GA 2RGHA 1XMQM 3E21A 3W68A 5C18A 4L16A 1HNWM 4GKKM 4L78A 3AOEA 3FD9A 3GLIE 4QOSA 1P3QQ 1NJGA 3QAUA 4DV4M 2C99A 2Y21A 4LF6M 2APLA 4UN2B 2L7HA 1K82A 2R62A 1WGNA 4DV5M 4M0WA 4G4NA 2CV2A 2LVQD 2KNVA 3DFZA 5LMNM 2RRUA 3MK6A 4DR1M 4LG2A 3RFWA 5EXXA 4AKGA 8CATA 2QP9X 1HJPA 1Z6TA 3AOEC 2XH9A 1W5SA 2QQ8A 2MGWA 3KFUG 4NC6A 4AKIA 1PJSA 2V6ZM 3CF2A 3J81S 5ITUA 1SG9A 1I94M 2CV0A 3U6PA 4AZFA 4JI7M 3R9XB 2VF7A 3C3DA 4B3RM 4QHTA 2EA0A 3EIHA 4NSOB 1KYIA 1IBKM 1GKIA 2EKKA 4LGYA 1L2CA 2CP8A 1G41A 2BWEA 2YNMD 5F3WA 3W0FA 3U5ZA 4B7GA 3VK7A 2HWJA 3KW6A 1MN3A 3HGIA 2DAIA 2BJVA 3U6MA 3Q8GA 1E94E 1QAMA 2C9OA 4BBAA 3FTEA 3ZCBB 7CATA 2P5TA 1XC8A 2KW0A 1JQJC 2FE8A 2JXNA 4DV3M 3NWLA 1XNQM 2JP7A 5LMUM 4KLNA 3HKPA 3KSXA 4HEOA 2JY8A 3W0LB 3PVSA 3VKHA 3ZQJA 2LTUA 3LQQA 4WURA 3GRYA 2DAEA 2FS1A 3CF6E 4ITQA 4GMQA 1NO1A 1G71A 1G3IA 3KOYE 1PRBA 4NRVA 2LNHC 2UUAM 4KHPM 3KVWA 5EP3A 4DV1M 3HJQA 4BB9A 4D80A 1Q3CA 3HY5A 4B3SM 1NHWC 1AUAA 2O01F 2C9CA 4KT0F 3TL4X 2Z7JA 4IBIA 5E6JA 4AI6A 2F5QA 2K0BX 2V1CA 1BVSA 2R44A 2H1RA 1QUTA 1MX0A 4DR4M 4AW4A 1JR3D 3KOXE 3KS4A 2XZFA 3GPYA 2YQZA 4Y28F 3M6AA 3U60A 1YLAA 4X65M 1V34A 1ZQ9A 1E9RA 5KPTA 5FTNA 3B89A 3I04M 5DYGA 3FUXA 3UGJA 2VQFM 2C5RA 1W5TA 3T1YM 5KPZA 2Z8YM 3D8BA 3HZJA 4LJ4A 2XFTA 3TWMA 2XZUA 1ZMWA 1TH4A 2R6FA 5FTMA 5ITQA 2FFJA 1XXHA 4R71A 2K6BA 2CE7A 3GPPA 3FKEA 3LCVB 1OIZA 1OAOC 2G8LA 2XSZD 4S12A 3A42A 3PXGA 2R46A 2QBYA 4L15A 3SYLA 4MGKE 4RF1A 1XNRM 3TWKA 1LV7A 3L28A 1D0LA 3SFZA 1WIVA 2J7OA 3SMPA 3GO8A 3E9SA 4CHTB 1DGFA 1D0KA 3KP1E 4JXJA 1DGHA 4LJ5A 4LF7M 2L09A 1R6BX 2J7NA 4JI0M 4NXNM 2O5RA 4KODA 1TDHA 2JZ1A 2LBCA 3SAUA 4JI1M 3FRIA 1OAIA 4I8OA 3M7GA 2LVAA 1V33A 1HT2E 3AOGA 1WR1B 4LZJA 2MJ5B 1YE9A 2Y0QA 4P16A 4F2LA 1WXQA 2ZAMA 4R3DA 4HL4A 1CUKA 2CRUA 5FSWA 1TR8A 4LGMA 3DA1A 1NY6A 2HHHM 1GL6A 4DR5M 3C9PA 4G4OA 4II7A 1SXJA 2K47A 4FCTA 1KSFX 4IBCA 2V1UA 1WJ7A 1IM2A 4B7HA 5EP4A 4JV5M 2GNOA 1EE8A 4NOOB 4HLQA 4LRSA 1PGYA 1VDLA 2C98A 2JY5A 3BXWA 3LMMA 2JY7A 2BNKA 2ZAOA 3B7QA 3L2AA 1NSFA 4Z8XA 3T6PA 2DAGA 4DR3M 2Z4SA 1K3WA 1QAOA 4WW0A 5DFLA 1T3TA 3KS8A 5JI3E 1Y8GA 2D7GA 1SXJC 3GRUA 4IBJA 5DNYA 1HQYE 4DR7M 5E26A 3J7AS 4GEWA 2ERCA 4GITA 2L4EA 3GLHB 4G6ZA 4FWHA 2VDBB 2QCUA 4MB7A 4QNMA 2QBYB 3UMMA 5DYIA 4BLCA 2DXIA 2KA6B 1FJGM 1QZEA 4MGYE 3T38A 3R8FA 2MH8A 2EKFA 3SC3A 5ITRA 2C96A 3GQ4A 3TWLA 1TGUA 3U6SA 4JI5M 4LFBM 3C3EA 3NBIA 4GH9A 2OOBA 1TTEA 4IBKA 3M0EA 2NQ8C 4LJAA 5ITXA 3VK8A 3I4VA 1VDDA 4JI2M 3DOAA 3HWSA 4B3TM 3D8LA 3KSJA 1NNUC 3CF0A 5EJCA 2F5SA 4IBGA 4JI4M 4DV2M 4GC5A 4NL4H 1IN8A 4OW0A 2YFQA 5JI2E 3HHZA 2LH0A 1OFHA 2KNAA 4XBOA 3GLGE 4LF4M 3IHPA 3B7NA 4LF5M 2F5PA 3AJIB 3GQ5A 4JN6A 3HHYA 1N32M 3V76A 4IJEA 3GP1A 5KQ8A 2QZ4A 2R4JA 2Z4RA 2E5LM 3SAVA 3HU1A 2WSCF 2MR9A 2YR0A 3GLHA 5A2QS 4DV6M 3U61A 2DWLA 3GRVA 1IXZA 3UK6A 1I4WA 2XEPA 4I5SA 4DR2M 2CWBA 1LTMA 4DV0M 1WGLA 5KO3A 1IBMM 5IT9S 3QWLA 4B3MM 1MU5A 1L2DA 2WSEF 3IG5A 2R45A 4CISA 1GJTA 4NXMM 2X49A 1J7KA 2ZM6M 4EIWA 4LF8M 2ZTDA 4LY6A 3ZH9B 1WHCA 2K9DA 2D7EA 4D82A 3HJSA 5EP2A 1IY1A 2X8AA 3SHGB 4JYAM 3I01M 1QYRA 4ZPXA 3U6LA 3RE8A 4X62M 1NJFA 3W67A 2MROB 3L27A 2XSZA 5FTLA 3A46A 1ORYB 1TH3A 3FUUA 1GVNA 3SATA 1JR3E 3HHWA 1HQCA 4IBFA 1MJGM 3J2PB 4LJ8A 2UUCM 2XLJA 2CHVA 2XF3A 5L8RF 1X37A 3VLFB 4IJFA 1L1TA 3HU2A 4IIWA 4G4RA 2R65A 2ZTCA 2UXBM 1XXHB 2BJWA 1TH2A 2DI0A 3H4JA 3SYKA 2A5YB 3FUWA 3KOZE 4D81A 1G59A 1TDZA 2CHQA 2L4FA 1NHGC 5C1BA 1VEKA 3THGA 3ZC7B 1R5LA 1VQ1A 1Z5CA 1Z5AA 4LJ9A 4JI8M 2F4VM 1HR0M 2KNZA 1QQWA 4IBEA 3GLFE 1SXJE 3Q8XA 2N35A 3QYBA 4AG6A 4XK8F 3J7BA 2JA2A 2CEAA 2X4AA 4GC9A 1K3XA 2DWZB 1OJLA 4FVMA 4OVZA 5FTJA 3GQ3A 1J09A 1V92A 2UXDM 2OOAA 1DGHB 2WSFF 1IXRC 2D7HA 2LVPC 2LWXA 2QENA 1IQPA 4MM3B 5FTKA 3WHKA 1EFUB 1XWIA 2Q2EB 2DHRA 2EO2A 1N33M 1IBLM 2JUJA 3L29A 4FW9A 2OQ4A 2JNHA 3GPUA 3WHLA 1IXSB 4DUZM 2Z3XA 3HJ8A 4FCVA 2KZSA 3B74A 2KRKA 3FYCA 3KDSE 4G3OA 4QNRA 4Q7JA 2HL7A 3LVVA 3U5ZB 1OFIA 1Q3BA 4WP2A 5ITYA 4F1IA 2L2DA 4B08A 3PNYA 2R4EA 1R2YA 1Z59A 1D0MA 2KHHA 4W5WA 1XXHE 4IBDA 2UU9M 1Q39A 3UZUA 3LCUA 3VKGA 1QANA 3I51A 3KP0E 1N78A 2DAMA 2XGNA 2CUZA 5IREB 4GIPA 5BR8M 4REZA 4TUWA 3I4YA 3VDPA 4LCBA 3QYEA 4ANRA 3GRRA 3ILKA 3KXEC 3PFIA 4FD2A 3GLIA 1QDTA 1XHBA 5IZ7D 3T15A 2DZLA 4PCZA 3K9OA 2QNJA 1UFZA 4NSRA 3F92A 4OX9M 4A3VB 1D2NA 2L6OA 4DV7M 3CTWB 4KO8A 4YY3M 3K9PA 1T43A 1NNJA 4GKJM 4LJ6A 2RKOA 4RKUF 1PJQA 1FNNA 2OPFA 4XGIA 2FOIC 4DR6M 2LVOC 2R0IA 2VIIA 1E9SA 1G4AE 1GL7A 5EP1A 2LXEA 2DNAA 3LW5F 4LRTA 3SBJA 2H5XA 1DGGA 1HNXM 1PJIA 3KOWE 1OTRA 1L8QA 1ZAEA 1PJTA 4GRIA 5BPVA 4MGHA 1SXJD 2XFSA 3GLIB 3VFDA 3FYDA 4MGZE 3TPZA 1QZMA 2LVNC 2RGOA 2DZNB 4M9SA 3HU3A 4OU7A 3C58A 4LZZA 2DHYA 2G3QA 4L6V6 3JR5A 1N75A 2CV1A 3GPXA 1H6UA 2DZOB 2M60A 1OQYA 3U61B 3L25A 4I4LA 4X66M 3SHFA 4Z6YA 3FE3A 2HAKA 4NRWA 4FCWA 1GABA 4GHAA 4M0DA 4DBGB 1EIJA 1L1ZA 5EXSA 3CGWA 4CGYB 3BOSA 3U6EA 1XB2B 3MJ5A 4QOZC 3E46A 5EXTA 1IY0A 2F5OA 4LF9M 2FNAA 2Y20A 2DWMA 3A45A 4LJ7A 1QAQA 3K92A 4CIZA 4AQYM 3DZDA 1JB0F 4LFAM 2M5ZA 2BWBA 4FWGA 5KPRA 3RGPA 3SARA 3AFHA 1HT1E 2KDLA 4OVZB 2DKLA 2I7NA 1AIPC 1NV8A 5ITXE 2JWSA 1QUSA 1SXJB 1OIPA 3U6QA 2GQFA 1OKSA 2B3TA 3HX3A 2F5NA 2CFOA 5ITTA 4PD2A 1NV9A 1T6OA 3FTFA 2FH0A 1VG5A 3LVWA 1IN5A 3FTCA 3MHVC 4FWDA 3U6OA 3SAWA 3RGSA 2Y0TA 1YUBA 3SMSA 1UM8A 4P17A 4AKHA 1ZMUA 3IECA 1C7YA 4AG5A 4B7FA 4PT5A 3GLGB 3J27B 1XMOM 1R2ZA 4GHLA 1RU3A 2R18A 3FUTA 3FTDA 4DUYM 4PDIA 4JI3M 1PJJA 1HNZM 4CJ6A 2UXCM 1ZMVA 2HKJA 4M9XA 2KEBA 4RNAA 1GO5A 2O25A 1GJSA 4LFCM 2DWNA 2QPAA 3JAMS 2DVWB 3U60B 1N77A 4IBBA 3K8ZA 5H37D 3NBXX 2W82A 3TE6A 1QDRA 3PNVA 5KQDA 2LHCA 2UUBM 3B9PA 2LHGA 1TF0B 1NY5A 3MMPA 4PDGA 1C1KA 1DO0A 3GLFB 2VQEM 1NVMA 1KFVA 3HHXA 4K0KM 1QVRA 1DGBA 3GLHE 4M9ZA 1S3SA 1A5TA 1VEJA 2AHMA 2ZBKB 1IN4A 3UJNA 1F4IA 4MGIE 2L7IA 2KXEA 1G8PA 4I81A 5EXPA 3SASA 3K1JA 3LQRA 3B7ZA 1IN7A 2EJSA 2CHGA 3FUVA 1Q02A 2VF8A 4G4QA 3H4MA 1Z5BA 2DENA 1IXSA 2JZ0A 3JR4A 3J80S 3AV0A 4YHHM 3L26A 1GLNA 2KRUA 5EQTA 3TQSA 1N34M 1JR3A 1DV0A 2JY6B 3AKZA 4RF0A 5FLXS 1IN6A 2KZUA 1J5EM 1IFYA 1E32A 4X64M 2I7PA 1YSYA 3K2LA 3U6DA 1L2BA 4JI6M 2J5YA 4QHSA 3EIEA 1DO2A 2ZANA 3BBZA 3VDUA 3T1HM 1PM5A 4L4UA 2OO9A 4MH0E 2QSFX 5IWAM 1N36M 2G5GX 2QHOB 2EUCA 2WZJA 1VEGA 3U6CA 3AL0C 1ZV1A 2DAKA 3A98B 3IG8A 3GLGA 3E4RA 2HCBA
chains in the Genus database with same CATH topology
5GKNA 1IY2A 3GLFA 1R7RA 4L8RC 3OTOM 4R7GA 2RGHA 1XMQM 1HNWM 5C18A 4L16A 4GKKM 4L78A 3AOEA 3FD9A 4QOSA 1NJGA 3QAUA 4DV4M 2C99A 2Y21A 4LF6M 1K82A 2L7HA 2R62A 2CV2A 4DV5M 4M0WA 4G4NA 3DFZA 5LMNM 3MK6A 4DR1M 4LG2A 3RFWA 5EXXA 4AKGA 8CATA 2QP9X 3AOEC 1Z6TA 2XH9A 1W5SA 3KFUG 4AKIA 2V6ZM 3CF2A 3J81S 5ITUA 1I94M 2CV0A 3U6PA 4AZFA 4JI7M 3R9XB 4B3RM 4QHTA 2EA0A 3EIHA 4NSOB 1KYIA 1IBKM 1GKIA 4LGYA 1L2CA 1G41A 2YNMD 5F3WA 3W0FA 3U5ZA 4B7GA 3VK7A 3KW6A 3HGIA 3U6MA 2BJVA 3FTEA 4BBAA 1E94E 1QAMA 2C9OA 3ZCBB 7CATA 2P5TA 1XC8A 1JQJC 2FE8A 2KW0A 4DV3M 3NWLA 1XNQM 5LMUM 4KLNA 3HKPA 3KSXA 3W0LB 3VKHA 3PVSA 3LQQA 4WURA 3GRYA 3CF6E 4ITQA 4GMQA 3KOYE 1G3IA 4NRVA 2LNHC 2UUAM 4KHPM 3KVWA 5EP3A 4DV1M 3HJQA 4BB9A 4D80A 1Q3CA 4B3SM 1NHWC 2C9CA 3TL4X 2Z7JA 4IBIA 5E6JA 4AI6A 2F5QA 2V1CA 2H1RA 1MX0A 4DR4M 4AW4A 1JR3D 3KOXE 3KS4A 2XZFA 3GPYA 2YQZA 3M6AA 3U60A 4X65M 1ZQ9A 1E9RA 5KPTA 5FTNA 5DYGA 3FUXA 3UGJA 2VQFM 2C5RA 1W5TA 3T1YM 5KPZA 3D8BA 4LJ4A 2XFTA 3TWMA 2XZUA 1TH4A 5FTMA 5ITQA 2FFJA 1XXHA 2CE7A 3GPPA 3FKEA 2G8LA 2XSZD 4S12A 3A42A 3PXGA 2R46A 2QBYA 4L15A 3SYLA 4MGKE 4RF1A 1XNRM 3TWKA 1LV7A 3L28A 3SFZA 2J7OA 3GO8A 3SMPA 3E9SA 4CHTB 1DGFA 3KP1E 4JXJA 1DGHA 4LJ5A 4LF7M 2L09A 1R6BX 2J7NA 4JI0M 4NXNM 2O5RA 4KODA 1TDHA 3SAUA 4JI1M 4I8OA 3M7GA 1HT2E 3AOGA 4LZJA 1YE9A 2Y0QA 4P16A 1WXQA 2ZAMA 4R3DA 4HL4A 5FSWA 4LGMA 3DA1A 1NY6A 2HHHM 1GL6A 4DR5M 4G4OA 4II7A 1SXJA 2K47A 4FCTA 1KSFX 4IBCA 2V1UA 1IM2A 4B7HA 5EP4A 4JV5M 1EE8A 4NOOB 4HLQA 4LRSA 2C98A 3LMMA 1HR0M 2ZAOA 2BNKA 3L2AA 4DR3M 1NSFA 4Z8XA 1K3WA 2Z4SA 1QAOA 4WW0A 3KS8A 1T3TA 5JI3E 2D7GA 1SXJC 3GRUA 4IBJA 5DNYA 1HQYE 4DR7M 5E26A 3J7AS 2ERCA 4GITA 3GLHB 4G6ZA 4FWHA 2QCUA 4MB7A 4QNMA 2QBYB 3UMMA 5DYIA 4BLCA 2DXIA 2KA6B 1FJGM 4MGYE 3T38A 3SC3A 5ITRA 3GQ4A 2C96A 3TWLA 1TGUA 3U6SA 4JI5M 4LFBM 3NBIA 4GH9A 4IBKA 3M0EA 2NQ8C 4LJAA 5ITXA 3VK8A 3I4VA 1VDDA 4JI2M 3DOAA 3HWSA 4B3TM 3D8LA 3KSJA 1NNUC 3CF0A 5EJCA 2F5SA 4IBGA 4JI4M 4DV2M 4GC5A 4NL4H 1IN8A 4OW0A 2YFQA 5JI2E 3HHZA 2LH0A 1OFHA 4XBOA 4LF4M 4LF5M 2F5PA 3AJIB 3GQ5A 4JN6A 3HHYA 1N32M 4IJEA 3GP1A 5KQ8A 2QZ4A 2R4JA 2Z4RA 2E5LM 3SAVA 3HU1A 2YR0A 3GLHA 5A2QS 4DV6M 3U61A 2DWLA 3GRVA 1IXZA 3UK6A 1I4WA 2XEPA 4I5SA 4DR2M 4DV0M 5KO3A 1IBMM 5IT9S 3QWLA 4B3MM 1MU5A 1L2DA 3IG5A 2R45A 4CISA 4NXMM 2X49A 1J7KA 2ZM6M 4EIWA 4LF8M 4LY6A 3ZH9B 2D7EA 4D82A 3HJSA 5EP2A 2X8AA 1IY1A 3SHGB 4JYAM 1QYRA 4ZPXA 3U6LA 3RE8A 4X62M 1NJFA 3L27A 2XSZA 5FTLA 3A46A 1ORYB 1TH3A 3FUUA 1GVNA 3SATA 3HHWA 1HQCA 4IBFA 3J2PB 4LJ8A 2UUCM 2XLJA 2CHVA 2XF3A 1X37A 3VLFB 4IJFA 1L1TA 3HU2A 4IIWA 4G4RA 2R65A 2UXBM 1XXHB 2BJWA 1TH2A 3SYKA 4D81A 2A5YB 3FUWA 3KOZE 1G59A 1TDZA 2CHQA 1NHGC 5C1BA 3THGA 3ZC7B 1Z5CA 4JI8M 2F4VM 1Z5AA 4LJ9A 1QQWA 4IBEA 1SXJE 3Q8XA 4AG6A 3J7BA 2JA2A 2CEAA 2X4AA 4GC9A 1K3XA 2DWZB 1OJLA 4FVMA 4OVZA 5FTJA 3GQ3A 1J09A 2UXDM 1DGHB 1IXRC 2D7HA 2LWXA 2QENA 1IQPA 4MM3B 5FTKA 3WHKA 1XWIA 2Q2EB 2DHRA 2EO2A 1N33M 1IBLM 3L29A 4FW9A 2OQ4A 3GPUA 3WHLA 1IXSB 4DUZM 2Z3XA 3HJ8A 4FCVA 2KZSA 2KRKA 3FYCA 3KDSE 4QNRA 2HL7A 3LVVA 3U5ZB 1OFIA 1Q3BA 5ITYA 4B08A 3PNYA 2R4EA 1R2YA 1Z59A 4W5WA 4IBDA 2UU9M 1Q39A 3UZUA 3VKGA 1QANA 3I51A 3KP0E 1N78A 2XGNA 2CUZA 5IREB 4GIPA 5BR8M 4REZA 4TUWA 3I4YA 3VDPA 4LCBA 3GLIA 3GRRA 3ILKA 3KXEC 3PFIA 4FD2A 1XHBA 5IZ7D 3T15A 4PCZA 4NSRA 4OX9M 4A3VB 1D2NA 2L6OA 4DV7M 3CTWB 4KO8A 4YY3M 1NNJA 4GKJM 4LJ6A 2RKOA 2OPFA 4DR6M 1FNNA 4XGIA 2FOIC 2VIIA 1E9SA 1G4AE 1GL7A 5EP1A 2LXEA 4LRTA 3SBJA 1DGGA 1HNXM 1PJIA 3KOWE 1L8QA 1ZAEA 4GRIA 5BPVA 4MGHA 1SXJD 2XFSA 3GLIB 3VFDA 3FYDA 4MGZE 3TPZA 1QZMA 2RGOA 2DZNB 4M9SA 3HU3A 4OU7A 3C58A 4LZZA 3JR5A 1N75A 2CV1A 3GPXA 1H6UA 2DZOB 2M60A 3U61B 3L25A 4I4LA 4X66M 3SHFA 4Z6YA 4NRWA 4FCWA 4GHAA 4M0DA 1L1ZA 5EXSA 4CGYB 3U6EA 3BOSA 3MJ5A 4QOZC 5EXTA 1IY0A 2F5OA 4LF9M 2FNAA 2Y20A 2DWMA 3A45A 4LJ7A 1QAQA 3K92A 4AQYM 3DZDA 4LFAM 2M5ZA 5KPRA 4FWGA 3SARA 3RGPA 3AFHA 1HT1E 4OVZB 2I7NA 5ITXE 1SXJB 3U6QA 2F5NA 2CFOA 5ITTA 4PD2A 3FTFA 4FWDA 3MHVC 3LVWA 1IN5A 3FTCA 3U6OA 3SAWA 3RGSA 2Y0TA 1YUBA 3SMSA 1UM8A 4AKHA 4AG5A 4B7FA 4PT5A 3GLGB 3J27B 1XMOM 1R2ZA 4GHLA 2R18A 3FUTA 3FTDA 4DUYM 4PDIA 4JI3M 1PJJA 1HNZM 2UXCM 2HKJA 4M9XA 2KEBA 4RNAA 4LFCM 2DWNA 2QPAA 3JAMS 2DVWB 3U60B 1N77A 4IBBA 3K8ZA 5H37D 2W82A 3TE6A 3PNVA 5KQDA 2UUBM 3B9PA 3GLFB 1NY5A 4PDGA 1C1KA 1DO0A 2VQEM 1KFVA 1NVMA 3HHXA 4K0KM 1QVRA 1DGBA 4M9ZA 1S3SA 2AHMA 2ZBKB 1IN4A 3UJNA 4MGIE 2L7IA 2KXEA 1G8PA 4I81A 5EXPA 3SASA 3K1JA 3LQRA 1IN7A 2CHGA 3FUVA 4G4QA 3H4MA 1Z5BA 3JR4A 3J80S 3AV0A 4YHHM 3L26A 1GLNA 2KRUA 5EQTA 3TQSA 1N34M 1JR3A 3AKZA 4RF0A 5FLXS 1IN6A 2KZUA 1J5EM 1E32A 4X64M 2I7PA 1YSYA 3K2LA 3U6DA 1L2BA 4JI6M 4QHSA 3EIEA 1DO2A 2ZANA 3VDUA 1PM5A 3T1HM 4L4UA 4MH0E 5IWAM 1N36M 2G5GX 2EUCA 3AL0C 3U6CA 3GLGA 3A98B 3IG8A 3R8FA 3E4RA 2HCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSR A;  4NOO B;  4NSO B; 
#chains in the Genus database with same CATH topology
 5GKN A;  3FRH A;  1IY2 A;  3GLF A;  1R7R A;  4L8R C;  3OTO M;  4R7G A;  1R4G A;  2RGH A;  1XMQ M;  3E21 A;  3W68 A;  5C18 A;  4L16 A;  1HNW M;  4GKK M;  4L78 A;  3AOE A;  3FD9 A;  3GLI E;  4QOS A;  1P3Q Q;  1NJG A;  3QAU A;  4DV4 M;  2C99 A;  2Y21 A;  4LF6 M;  2APL A;  4UN2 B;  2L7H A;  1K82 A;  2R62 A;  1WGN A;  4DV5 M;  4M0W A;  4G4N A;  2CV2 A;  2LVQ D;  2KNV A;  3DFZ A;  5LMN M;  2RRU A;  3MK6 A;  4DR1 M;  4LG2 A;  3RFW A;  5EXX A;  4AKG A;  8CAT A;  2QP9 X;  1HJP A;  1Z6T A;  3AOE C;  2XH9 A;  1W5S A;  2QQ8 A;  2MGW A;  3KFU G;  4NC6 A;  4AKI A;  1PJS A;  2V6Z M;  3CF2 A;  3J81 S;  5ITU A;  1SG9 A;  1I94 M;  2CV0 A;  3U6P A;  4AZF A;  4JI7 M;  3R9X B;  2VF7 A;  3C3D A;  4B3R M;  4QHT A;  2EA0 A;  3EIH A;  4NSO B;  1KYI A;  1IBK M;  1GKI A;  2EKK A;  4LGY A;  1L2C A;  2CP8 A;  1G41 A;  2BWE A;  2YNM D;  5F3W A;  3W0F A;  3U5Z A;  4B7G A;  3VK7 A;  2HWJ A;  3KW6 A;  1MN3 A;  3HGI A;  2DAI A;  2BJV A;  3U6M A;  3Q8G A;  1E94 E;  1QAM A;  2C9O A;  4BBA A;  3FTE A;  3ZCB B;  7CAT A;  2P5T A;  1XC8 A;  2KW0 A;  1JQJ C;  2FE8 A;  2JXN A;  4DV3 M;  3NWL A;  1XNQ M;  2JP7 A;  5LMU M;  4KLN A;  3HKP A;  3KSX A;  4HEO A;  2JY8 A;  3W0L B;  3PVS A;  3VKH A;  3ZQJ A;  2LTU A;  3LQQ A;  4WUR A;  3GRY A;  2DAE A;  2FS1 A;  3CF6 E;  4ITQ A;  4GMQ A;  1NO1 A;  1G71 A;  1G3I A;  3KOY E;  1PRB A;  4NRV A;  2LNH C;  2UUA M;  4KHP M;  3KVW A;  5EP3 A;  4DV1 M;  3HJQ A;  4BB9 A;  4D80 A;  1Q3C A;  3HY5 A;  4B3S M;  1NHW C;  1AUA A;  2O01 F;  2C9C A;  4KT0 F;  3TL4 X;  2Z7J A;  4IBI A;  5E6J A;  4AI6 A;  2F5Q A;  2K0B X;  2V1C A;  1BVS A;  2R44 A;  2H1R A;  1QUT A;  1MX0 A;  4DR4 M;  4AW4 A;  1JR3 D;  3KOX E;  3KS4 A;  2XZF A;  3GPY A;  2YQZ A;  4Y28 F;  3M6A A;  3U60 A;  1YLA A;  4X65 M;  1V34 A;  1ZQ9 A;  1E9R A;  5KPT A;  5FTN A;  3B89 A;  3I04 M;  5DYG A;  3FUX A;  3UGJ A;  2VQF M;  2C5R A;  1W5T A;  3T1Y M;  5KPZ A;  2Z8Y M;  3D8B A;  3HZJ A;  4LJ4 A;  2XFT A;  3TWM A;  2XZU A;  1ZMW A;  1TH4 A;  2R6F A;  5FTM A;  5ITQ A;  2FFJ A;  1XXH A;  4R71 A;  2K6B A;  2CE7 A;  3GPP A;  3FKE A;  3LCV B;  1OIZ A;  1OAO C;  2G8L A;  2XSZ D;  4S12 A;  3A42 A;  3PXG A;  2R46 A;  2QBY A;  4L15 A;  3SYL A;  4MGK E;  4RF1 A;  1XNR M;  3TWK A;  1LV7 A;  3L28 A;  1D0L A;  3SFZ A;  1WIV A;  2J7O A;  3SMP A;  3GO8 A;  3E9S A;  4CHT B;  1DGF A;  1D0K A;  3KP1 E;  4JXJ A;  1DGH A;  4LJ5 A;  4LF7 M;  2L09 A;  1R6B X;  2J7N A;  4JI0 M;  4NXN M;  2O5R A;  4KOD A;  1TDH A;  2JZ1 A;  2LBC A;  3SAU A;  4JI1 M;  3FRI A;  1OAI A;  4I8O A;  3M7G A;  2LVA A;  1V33 A;  1HT2 E;  3AOG A;  1WR1 B;  4LZJ A;  2MJ5 B;  1YE9 A;  2Y0Q A;  4P16 A;  4F2L A;  1WXQ A;  2ZAM A;  4R3D A;  4HL4 A;  1CUK A;  2CRU A;  5FSW A;  1TR8 A;  4LGM A;  3DA1 A;  1NY6 A;  2HHH M;  1GL6 A;  4DR5 M;  3C9P A;  4G4O A;  4II7 A;  1SXJ A;  2K47 A;  4FCT A;  1KSF X;  4IBC A;  2V1U A;  1WJ7 A;  1IM2 A;  4B7H A;  5EP4 A;  4JV5 M;  2GNO A;  1EE8 A;  4NOO B;  4HLQ A;  4LRS A;  1PGY A;  1VDL A;  2C98 A;  2JY5 A;  3BXW A;  3LMM A;  2JY7 A;  2BNK A;  2ZAO A;  3B7Q A;  3L2A A;  1NSF A;  4Z8X A;  3T6P A;  2DAG A;  4DR3 M;  2Z4S A;  1K3W A;  1QAO A;  4WW0 A;  5DFL A;  1T3T A;  3KS8 A;  5JI3 E;  1Y8G A;  2D7G A;  1SXJ C;  3GRU A;  4IBJ A;  5DNY A;  1HQY E;  4DR7 M;  5E26 A;  3J7A S;  4GEW A;  2ERC A;  4GIT A;  2L4E A;  3GLH B;  4G6Z A;  4FWH A;  2VDB B;  2QCU A;  4MB7 A;  4QNM A;  2QBY B;  3UMM A;  5DYI A;  4BLC A;  2DXI A;  2KA6 B;  1FJG M;  1QZE A;  4MGY E;  3T38 A;  3R8F A;  2MH8 A;  2EKF A;  3SC3 A;  5ITR A;  2C96 A;  3GQ4 A;  3TWL A;  1TGU A;  3U6S A;  4JI5 M;  4LFB M;  3C3E A;  3NBI A;  4GH9 A;  2OOB A;  1TTE A;  4IBK A;  3M0E A;  2NQ8 C;  4LJA A;  5ITX A;  3VK8 A;  3I4V A;  1VDD A;  4JI2 M;  3DOA A;  3HWS A;  4B3T M;  3D8L A;  3KSJ A;  1NNU C;  3CF0 A;  5EJC A;  2F5S A;  4IBG A;  4JI4 M;  4DV2 M;  4GC5 A;  4NL4 H;  1IN8 A;  4OW0 A;  2YFQ A;  5JI2 E;  3HHZ A;  2LH0 A;  1OFH A;  2KNA A;  4XBO A;  3GLG E;  4LF4 M;  3IHP A;  3B7N A;  4LF5 M;  2F5P A;  3AJI B;  3GQ5 A;  4JN6 A;  3HHY A;  1N32 M;  3V76 A;  4IJE A;  3GP1 A;  5KQ8 A;  2QZ4 A;  2R4J A;  2Z4R A;  2E5L M;  3SAV A;  3HU1 A;  2WSC F;  2MR9 A;  2YR0 A;  3GLH A;  5A2Q S;  4DV6 M;  3U61 A;  2DWL A;  3GRV A;  1IXZ A;  3UK6 A;  1I4W A;  2XEP A;  4I5S A;  4DR2 M;  2CWB A;  1LTM A;  4DV0 M;  1WGL A;  5KO3 A;  1IBM M;  5IT9 S;  3QWL A;  4B3M M;  1MU5 A;  1L2D A;  2WSE F;  3IG5 A;  2R45 A;  4CIS A;  1GJT A;  4NXM M;  2X49 A;  1J7K A;  2ZM6 M;  4EIW A;  4LF8 M;  2ZTD A;  4LY6 A;  3ZH9 B;  1WHC A;  2K9D A;  2D7E A;  4D82 A;  3HJS A;  5EP2 A;  1IY1 A;  2X8A A;  3SHG B;  4JYA M;  3I01 M;  1QYR A;  4ZPX A;  3U6L A;  3RE8 A;  4X62 M;  1NJF A;  3W67 A;  2MRO B;  3L27 A;  2XSZ A;  5FTL A;  3A46 A;  1ORY B;  1TH3 A;  3FUU A;  1GVN A;  3SAT A;  1JR3 E;  3HHW A;  1HQC A;  4IBF A;  1MJG M;  3J2P B;  4LJ8 A;  2UUC M;  2XLJ A;  2CHV A;  2XF3 A;  5L8R F;  1X37 A;  3VLF B;  4IJF A;  1L1T A;  3HU2 A;  4IIW A;  4G4R A;  2R65 A;  2ZTC A;  2UXB M;  1XXH B;  2BJW A;  1TH2 A;  2DI0 A;  3H4J A;  3SYK A;  2A5Y B;  3FUW A;  3KOZ E;  4D81 A;  1G59 A;  1TDZ A;  2CHQ A;  2L4F A;  1NHG C;  5C1B A;  1VEK A;  3THG A;  3ZC7 B;  1R5L A;  1VQ1 A;  1Z5C A;  1Z5A A;  4LJ9 A;  4JI8 M;  2F4V M;  1HR0 M;  2KNZ A;  1QQW A;  4IBE A;  3GLF E;  1SXJ E;  3Q8X A;  2N35 A;  3QYB A;  4AG6 A;  4XK8 F;  3J7B A;  2JA2 A;  2CEA A;  2X4A A;  4GC9 A;  1K3X A;  2DWZ B;  1OJL A;  4FVM A;  4OVZ A;  5FTJ A;  3GQ3 A;  1J09 A;  1V92 A;  2UXD M;  2OOA A;  1DGH B;  2WSF F;  1IXR C;  2D7H A;  2LVP C;  2LWX A;  2QEN A;  1IQP A;  4MM3 B;  5FTK A;  3WHK A;  1EFU B;  1XWI A;  2Q2E B;  2DHR A;  2EO2 A;  1N33 M;  1IBL M;  2JUJ A;  3L29 A;  4FW9 A;  2OQ4 A;  2JNH A;  3GPU A;  3WHL A;  1IXS B;  4DUZ M;  2Z3X A;  3HJ8 A;  4FCV A;  2KZS A;  3B74 A;  2KRK A;  3FYC A;  3KDS E;  4G3O A;  4QNR A;  4Q7J A;  2HL7 A;  3LVV A;  3U5Z B;  1OFI A;  1Q3B A;  4WP2 A;  5ITY A;  4F1I A;  2L2D A;  4B08 A;  3PNY A;  2R4E A;  1R2Y A;  1Z59 A;  1D0M A;  2KHH A;  4W5W A;  1XXH E;  4IBD A;  2UU9 M;  1Q39 A;  3UZU A;  3LCU A;  3VKG A;  1QAN A;  3I51 A;  3KP0 E;  1N78 A;  2DAM A;  2XGN A;  2CUZ A;  5IRE B;  4GIP A;  5BR8 M;  4REZ A;  4TUW A;  3I4Y A;  3VDP A;  4LCB A;  3QYE A;  4ANR A;  3GRR A;  3ILK A;  3KXE C;  3PFI A;  4FD2 A;  3GLI A;  1QDT A;  1XHB A;  5IZ7 D;  3T15 A;  2DZL A;  4PCZ A;  3K9O A;  2QNJ A;  1UFZ A;  4NSR A;  3F92 A;  4OX9 M;  4A3V B;  1D2N A;  2L6O A;  4DV7 M;  3CTW B;  4KO8 A;  4YY3 M;  3K9P A;  1T43 A;  1NNJ A;  4GKJ M;  4LJ6 A;  2RKO A;  4RKU F;  1PJQ A;  1FNN A;  2OPF A;  4XGI A;  2FOI C;  4DR6 M;  2LVO C;  2R0I A;  2VII A;  1E9S A;  1G4A E;  1GL7 A;  5EP1 A;  2LXE A;  2DNA A;  3LW5 F;  4LRT A;  3SBJ A;  2H5X A;  1DGG A;  1HNX M;  1PJI A;  3KOW E;  1OTR A;  1L8Q A;  1ZAE A;  1PJT A;  4GRI A;  5BPV A;  4MGH A;  1SXJ D;  2XFS A;  3GLI B;  3VFD A;  3FYD A;  4MGZ E;  3TPZ A;  1QZM A;  2LVN C;  2RGO A;  2DZN B;  4M9S A;  3HU3 A;  4OU7 A;  3C58 A;  4LZZ A;  2DHY A;  2G3Q A;  4L6V 6;  3JR5 A;  1N75 A;  2CV1 A;  3GPX A;  1H6U A;  2DZO B;  2M60 A;  1OQY A;  3U61 B;  3L25 A;  4I4L A;  4X66 M;  3SHF A;  4Z6Y A;  3FE3 A;  2HAK A;  4NRW A;  4FCW A;  1GAB A;  4GHA A;  4M0D A;  4DBG B;  1EIJ A;  1L1Z A;  5EXS A;  3CGW A;  4CGY B;  3BOS A;  3U6E A;  1XB2 B;  3MJ5 A;  4QOZ C;  3E46 A;  5EXT A;  1IY0 A;  2F5O A;  4LF9 M;  2FNA A;  2Y20 A;  2DWM A;  3A45 A;  4LJ7 A;  1QAQ A;  3K92 A;  4CIZ A;  4AQY M;  3DZD A;  1JB0 F;  4LFA M;  2M5Z A;  2BWB A;  4FWG A;  5KPR A;  3RGP A;  3SAR A;  3AFH A;  1HT1 E;  2KDL A;  4OVZ B;  2DKL A;  2I7N A;  1AIP C;  1NV8 A;  5ITX E;  2JWS A;  1QUS A;  1SXJ B;  1OIP A;  3U6Q A;  2GQF A;  1OKS A;  2B3T A;  3HX3 A;  2F5N A;  2CFO A;  5ITT A;  4PD2 A;  1NV9 A;  1T6O A;  3FTF A;  2FH0 A;  1VG5 A;  3LVW A;  1IN5 A;  3FTC A;  3MHV C;  4FWD A;  3U6O A;  3SAW A;  3RGS A;  2Y0T A;  1YUB A;  3SMS A;  1UM8 A;  4P17 A;  4AKH A;  1ZMU A;  3IEC A;  1C7Y A;  4AG5 A;  4B7F A;  4PT5 A;  3GLG B;  3J27 B;  1XMO M;  1R2Z A;  4GHL A;  1RU3 A;  2R18 A;  3FUT A;  3FTD A;  4DUY M;  4PDI A;  4JI3 M;  1PJJ A;  1HNZ M;  4CJ6 A;  2UXC M;  1ZMV A;  2HKJ A;  4M9X A;  2KEB A;  4RNA A;  1GO5 A;  2O25 A;  1GJS A;  4LFC M;  2DWN A;  2QPA A;  3JAM S;  2DVW B;  3U60 B;  1N77 A;  4IBB A;  3K8Z A;  5H37 D;  3NBX X;  2W82 A;  3TE6 A;  1QDR A;  3PNV A;  5KQD A;  2LHC A;  2UUB M;  3B9P A;  2LHG A;  1TF0 B;  1NY5 A;  3MMP A;  4PDG A;  1C1K A;  1DO0 A;  3GLF B;  2VQE M;  1NVM A;  1KFV A;  3HHX A;  4K0K M;  1QVR A;  1DGB A;  3GLH E;  4M9Z A;  1S3S A;  1A5T A;  1VEJ A;  2AHM A;  2ZBK B;  1IN4 A;  3UJN A;  1F4I A;  4MGI E;  2L7I A;  2KXE A;  1G8P A;  4I81 A;  5EXP A;  3SAS A;  3K1J A;  3LQR A;  3B7Z A;  1IN7 A;  2EJS A;  2CHG A;  3FUV A;  1Q02 A;  2VF8 A;  4G4Q A;  3H4M A;  1Z5B A;  2DEN A;  1IXS A;  2JZ0 A;  3JR4 A;  3J80 S;  3AV0 A;  4YHH M;  3L26 A;  1GLN A;  2KRU A;  5EQT A;  3TQS A;  1N34 M;  1JR3 A;  1DV0 A;  2JY6 B;  3AKZ A;  4RF0 A;  5FLX S;  1IN6 A;  2KZU A;  1J5E M;  1IFY A;  1E32 A;  4X64 M;  2I7P A;  1YSY A;  3K2L A;  3U6D A;  1L2B A;  4JI6 M;  2J5Y A;  4QHS A;  3EIE A;  1DO2 A;  2ZAN A;  3BBZ A;  3VDU A;  3T1H M;  1PM5 A;  4L4U A;  2OO9 A;  4MH0 E;  2QSF X;  5IWA M;  1N36 M;  2G5G X;  2QHO B;  2EUC A;  2WZJ A;  1VEG A;  3U6C A;  3AL0 C;  1ZV1 A;  2DAK A;  3A98 B;  3IG8 A;  3GLG A;  3E4R A;  2HCB A; 
#chains in the Genus database with same CATH homology
 5GKN A;  1IY2 A;  3GLF A;  1R7R A;  4L8R C;  3OTO M;  4R7G A;  2RGH A;  1XMQ M;  1HNW M;  5C18 A;  4L16 A;  4GKK M;  4L78 A;  3AOE A;  3FD9 A;  4QOS A;  1NJG A;  3QAU A;  4DV4 M;  2C99 A;  2Y21 A;  4LF6 M;  1K82 A;  2L7H A;  2R62 A;  2CV2 A;  4DV5 M;  4M0W A;  4G4N A;  3DFZ A;  5LMN M;  3MK6 A;  4DR1 M;  4LG2 A;  3RFW A;  5EXX A;  4AKG A;  8CAT A;  2QP9 X;  3AOE C;  1Z6T A;  2XH9 A;  1W5S A;  3KFU G;  4AKI A;  2V6Z M;  3CF2 A;  3J81 S;  5ITU A;  1I94 M;  2CV0 A;  3U6P A;  4AZF A;  4JI7 M;  3R9X B;  4B3R M;  4QHT A;  2EA0 A;  3EIH A;  4NSO B;  1KYI A;  1IBK M;  1GKI A;  4LGY A;  1L2C A;  1G41 A;  2YNM D;  5F3W A;  3W0F A;  3U5Z A;  4B7G A;  3VK7 A;  3KW6 A;  3HGI A;  3U6M A;  2BJV A;  3FTE A;  4BBA A;  1E94 E;  1QAM A;  2C9O A;  3ZCB B;  7CAT A;  2P5T A;  1XC8 A;  1JQJ C;  2FE8 A;  2KW0 A;  4DV3 M;  3NWL A;  1XNQ M;  5LMU M;  4KLN A;  3HKP A;  3KSX A;  3W0L B;  3VKH A;  3PVS A;  3LQQ A;  4WUR A;  3GRY A;  3CF6 E;  4ITQ A;  4GMQ A;  3KOY E;  1G3I A;  4NRV A;  2LNH C;  2UUA M;  4KHP M;  3KVW A;  5EP3 A;  4DV1 M;  3HJQ A;  4BB9 A;  4D80 A;  1Q3C A;  4B3S M;  1NHW C;  2C9C A;  3TL4 X;  2Z7J A;  4IBI A;  5E6J A;  4AI6 A;  2F5Q A;  2V1C A;  2H1R A;  1MX0 A;  4DR4 M;  4AW4 A;  1JR3 D;  3KOX E;  3KS4 A;  2XZF A;  3GPY A;  2YQZ A;  3M6A A;  3U60 A;  4X65 M;  1ZQ9 A;  1E9R A;  5KPT A;  5FTN A;  5DYG A;  3FUX A;  3UGJ A;  2VQF M;  2C5R A;  1W5T A;  3T1Y M;  5KPZ A;  3D8B A;  4LJ4 A;  2XFT A;  3TWM A;  2XZU A;  1TH4 A;  5FTM A;  5ITQ A;  2FFJ A;  1XXH A;  2CE7 A;  3GPP A;  3FKE A;  2G8L A;  2XSZ D;  4S12 A;  3A42 A;  3PXG A;  2R46 A;  2QBY A;  4L15 A;  3SYL A;  4MGK E;  4RF1 A;  1XNR M;  3TWK A;  1LV7 A;  3L28 A;  3SFZ A;  2J7O A;  3GO8 A;  3SMP A;  3E9S A;  4CHT B;  1DGF A;  3KP1 E;  4JXJ A;  1DGH A;  4LJ5 A;  4LF7 M;  2L09 A;  1R6B X;  2J7N A;  4JI0 M;  4NXN M;  2O5R A;  4KOD A;  1TDH A;  3SAU A;  4JI1 M;  4I8O A;  3M7G A;  1HT2 E;  3AOG A;  4LZJ A;  1YE9 A;  2Y0Q A;  4P16 A;  1WXQ A;  2ZAM A;  4R3D A;  4HL4 A;  5FSW A;  4LGM A;  3DA1 A;  1NY6 A;  2HHH M;  1GL6 A;  4DR5 M;  4G4O A;  4II7 A;  1SXJ A;  2K47 A;  4FCT A;  1KSF X;  4IBC A;  2V1U A;  1IM2 A;  4B7H A;  5EP4 A;  4JV5 M;  1EE8 A;  4NOO B;  4HLQ A;  4LRS A;  2C98 A;  3LMM A;  1HR0 M;  2ZAO A;  2BNK A;  3L2A A;  4DR3 M;  1NSF A;  4Z8X A;  1K3W A;  2Z4S A;  1QAO A;  4WW0 A;  3KS8 A;  1T3T A;  5JI3 E;  2D7G A;  1SXJ C;  3GRU A;  4IBJ A;  5DNY A;  1HQY E;  4DR7 M;  5E26 A;  3J7A S;  2ERC A;  4GIT A;  3GLH B;  4G6Z A;  4FWH A;  2QCU A;  4MB7 A;  4QNM A;  2QBY B;  3UMM A;  5DYI A;  4BLC A;  2DXI A;  2KA6 B;  1FJG M;  4MGY E;  3T38 A;  3SC3 A;  5ITR A;  3GQ4 A;  2C96 A;  3TWL A;  1TGU A;  3U6S A;  4JI5 M;  4LFB M;  3NBI A;  4GH9 A;  4IBK A;  3M0E A;  2NQ8 C;  4LJA A;  5ITX A;  3VK8 A;  3I4V A;  1VDD A;  4JI2 M;  3DOA A;  3HWS A;  4B3T M;  3D8L A;  3KSJ A;  1NNU C;  3CF0 A;  5EJC A;  2F5S A;  4IBG A;  4JI4 M;  4DV2 M;  4GC5 A;  4NL4 H;  1IN8 A;  4OW0 A;  2YFQ A;  5JI2 E;  3HHZ A;  2LH0 A;  1OFH A;  4XBO A;  4LF4 M;  4LF5 M;  2F5P A;  3AJI B;  3GQ5 A;  4JN6 A;  3HHY A;  1N32 M;  4IJE A;  3GP1 A;  5KQ8 A;  2QZ4 A;  2R4J A;  2Z4R A;  2E5L M;  3SAV A;  3HU1 A;  2YR0 A;  3GLH A;  5A2Q S;  4DV6 M;  3U61 A;  2DWL A;  3GRV A;  1IXZ A;  3UK6 A;  1I4W A;  2XEP A;  4I5S A;  4DR2 M;  4DV0 M;  5KO3 A;  1IBM M;  5IT9 S;  3QWL A;  4B3M M;  1MU5 A;  1L2D A;  3IG5 A;  2R45 A;  4CIS A;  4NXM M;  2X49 A;  1J7K A;  2ZM6 M;  4EIW A;  4LF8 M;  4LY6 A;  3ZH9 B;  2D7E A;  4D82 A;  3HJS A;  5EP2 A;  2X8A A;  1IY1 A;  3SHG B;  4JYA M;  1QYR A;  4ZPX A;  3U6L A;  3RE8 A;  4X62 M;  1NJF A;  3L27 A;  2XSZ A;  5FTL A;  3A46 A;  1ORY B;  1TH3 A;  3FUU A;  1GVN A;  3SAT A;  3HHW A;  1HQC A;  4IBF A;  3J2P B;  4LJ8 A;  2UUC M;  2XLJ A;  2CHV A;  2XF3 A;  1X37 A;  3VLF B;  4IJF A;  1L1T A;  3HU2 A;  4IIW A;  4G4R A;  2R65 A;  2UXB M;  1XXH B;  2BJW A;  1TH2 A;  3SYK A;  4D81 A;  2A5Y B;  3FUW A;  3KOZ E;  1G59 A;  1TDZ A;  2CHQ A;  1NHG C;  5C1B A;  3THG A;  3ZC7 B;  1Z5C A;  4JI8 M;  2F4V M;  1Z5A A;  4LJ9 A;  1QQW A;  4IBE A;  1SXJ E;  3Q8X A;  4AG6 A;  3J7B A;  2JA2 A;  2CEA A;  2X4A A;  4GC9 A;  1K3X A;  2DWZ B;  1OJL A;  4FVM A;  4OVZ A;  5FTJ A;  3GQ3 A;  1J09 A;  2UXD M;  1DGH B;  1IXR C;  2D7H A;  2LWX A;  2QEN A;  1IQP A;  4MM3 B;  5FTK A;  3WHK A;  1XWI A;  2Q2E B;  2DHR A;  2EO2 A;  1N33 M;  1IBL M;  3L29 A;  4FW9 A;  2OQ4 A;  3GPU A;  3WHL A;  1IXS B;  4DUZ M;  2Z3X A;  3HJ8 A;  4FCV A;  2KZS A;  2KRK A;  3FYC A;  3KDS E;  4QNR A;  2HL7 A;  3LVV A;  3U5Z B;  1OFI A;  1Q3B A;  5ITY A;  4B08 A;  3PNY A;  2R4E A;  1R2Y A;  1Z59 A;  4W5W A;  4IBD A;  2UU9 M;  1Q39 A;  3UZU A;  3VKG A;  1QAN A;  3I51 A;  3KP0 E;  1N78 A;  2XGN A;  2CUZ A;  5IRE B;  4GIP A;  5BR8 M;  4REZ A;  4TUW A;  3I4Y A;  3VDP A;  4LCB A;  3GLI A;  3GRR A;  3ILK A;  3KXE C;  3PFI A;  4FD2 A;  1XHB A;  5IZ7 D;  3T15 A;  4PCZ A;  4NSR A;  4OX9 M;  4A3V B;  1D2N A;  2L6O A;  4DV7 M;  3CTW B;  4KO8 A;  4YY3 M;  1NNJ A;  4GKJ M;  4LJ6 A;  2RKO A;  2OPF A;  4DR6 M;  1FNN A;  4XGI A;  2FOI C;  2VII A;  1E9S A;  1G4A E;  1GL7 A;  5EP1 A;  2LXE A;  4LRT A;  3SBJ A;  1DGG A;  1HNX M;  1PJI A;  3KOW E;  1L8Q A;  1ZAE A;  4GRI A;  5BPV A;  4MGH A;  1SXJ D;  2XFS A;  3GLI B;  3VFD A;  3FYD A;  4MGZ E;  3TPZ A;  1QZM A;  2RGO A;  2DZN B;  4M9S A;  3HU3 A;  4OU7 A;  3C58 A;  4LZZ A;  3JR5 A;  1N75 A;  2CV1 A;  3GPX A;  1H6U A;  2DZO B;  2M60 A;  3U61 B;  3L25 A;  4I4L A;  4X66 M;  3SHF A;  4Z6Y A;  4NRW A;  4FCW A;  4GHA A;  4M0D A;  1L1Z A;  5EXS A;  4CGY B;  3U6E A;  3BOS A;  3MJ5 A;  4QOZ C;  5EXT A;  1IY0 A;  2F5O A;  4LF9 M;  2FNA A;  2Y20 A;  2DWM A;  3A45 A;  4LJ7 A;  1QAQ A;  3K92 A;  4AQY M;  3DZD A;  4LFA M;  2M5Z A;  5KPR A;  4FWG A;  3SAR A;  3RGP A;  3AFH A;  1HT1 E;  4OVZ B;  2I7N A;  5ITX E;  1SXJ B;  3U6Q A;  2F5N A;  2CFO A;  5ITT A;  4PD2 A;  3FTF A;  4FWD A;  3MHV C;  3LVW A;  1IN5 A;  3FTC A;  3U6O A;  3SAW A;  3RGS A;  2Y0T A;  1YUB A;  3SMS A;  1UM8 A;  4AKH A;  4AG5 A;  4B7F A;  4PT5 A;  3GLG B;  3J27 B;  1XMO M;  1R2Z A;  4GHL A;  2R18 A;  3FUT A;  3FTD A;  4DUY M;  4PDI A;  4JI3 M;  1PJJ A;  1HNZ M;  2UXC M;  2HKJ A;  4M9X A;  2KEB A;  4RNA A;  4LFC M;  2DWN A;  2QPA A;  3JAM S;  2DVW B;  3U60 B;  1N77 A;  4IBB A;  3K8Z A;  5H37 D;  2W82 A;  3TE6 A;  3PNV A;  5KQD A;  2UUB M;  3B9P A;  3GLF B;  1NY5 A;  4PDG A;  1C1K A;  1DO0 A;  2VQE M;  1KFV A;  1NVM A;  3HHX A;  4K0K M;  1QVR A;  1DGB A;  4M9Z A;  1S3S A;  2AHM A;  2ZBK B;  1IN4 A;  3UJN A;  4MGI E;  2L7I A;  2KXE A;  1G8P A;  4I81 A;  5EXP A;  3SAS A;  3K1J A;  3LQR A;  1IN7 A;  2CHG A;  3FUV A;  4G4Q A;  3H4M A;  1Z5B A;  3JR4 A;  3J80 S;  3AV0 A;  4YHH M;  3L26 A;  1GLN A;  2KRU A;  5EQT A;  3TQS A;  1N34 M;  1JR3 A;  3AKZ A;  4RF0 A;  5FLX S;  1IN6 A;  2KZU A;  1J5E M;  1E32 A;  4X64 M;  2I7P A;  1YSY A;  3K2L A;  3U6D A;  1L2B A;  4JI6 M;  4QHS A;  3EIE A;  1DO2 A;  2ZAN A;  3VDU A;  1PM5 A;  3T1H M;  4L4U A;  4MH0 E;  5IWA M;  1N36 M;  2G5G X;  2EUC A;  3AL0 C;  3U6C A;  3GLG A;  3A98 B;  3IG8 A;  3R8F A;  3E4R A;  2HCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...