4NSRA

Crystal structure of the immunity protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
89
structure length
89
Chain Sequence
VHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunity protein
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Protein binding
total genus 38
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsrA00
4NSOB 4NOOB 4NSRA
chains in the Genus database with same CATH superfamily
2UUBM 3HU3A 2LVAA 4L8RC 4OW0A 1VQ1A 3PXGA 1Z5BA 3Q8GA 1QUTA 1QYRA 1D0LA 2M60A 3SBJA 2R18A 3HHXA 2F5NA 2JY8A 3T6PA 2X8AA 1VDLA 3UMMA 2VQEM 5LMUM 5FTKA 5ITTA 3GLHA 3CTWB 3UJNA 3HZJA 4IBGA 2BNKA 5IT9S 1XHBA 1NNUC 4EIWA 3TWLA 2A5YB 4RNAA 4OVZB 1E9RA 2K9DA 2LHGA 1XXHA 1OJLA 5E6JA 4NC6A 2RKOA 1OFIA 3D8BA 4X64M 5FTNA 1NVMA 2YNMD 3LCVB 3EIEA 2WSCF 4LGYA 3RGSA 2L7HA 1VEJA 4QHTA 3HJ8A 2L2DA 3NBIA 4BBAA 4M0DA 2XSZA 4KT0F 3T38A 4HL4A 1OTRA 1G8PA 2V1CA 1N34M 2J7NA 2DWNA 1GABA 4WW0A 2KNZA 2Z3XA 1N36M 3AOGA 3LCUA 1K3XA 2F5PA 3GPYA 8CATA 1CUKA 2DNAA 1P3QQ 3FUTA 3VDUA 3AKZA 3GRVA 3AFHA 2FH0A 3F92A 3HU2A 1ZAEA 2MR9A 4JV5M 2BJWA 3B7NA 4S12A 2EUCA 1GO5A 2JUJA 4NXNM 1NSFA 1QZEA 3GPXA 2JY6B 1XNQM 1TDHA 4LJ9A 3GLIA 2DAIA 3U6MA 1VEGA 2WSFF 3GQ5A 1Y8GA 3WHKA 3Q8XA 2DAKA 2FE8A 4X65M 4DR2M 1GVNA 3CF0A 3FUXA 2CEAA 4XBOA 1QQWA 1GL6A 1N75A 1TGUA 4P16A 2LWXA 5BPVA 4QNRA 1GL7A 1NY5A 3UK6A 2ERCA 3U6PA 2EKKA 2O25A 4CHTB 5KQDA 3KSJA 3J80S 3MHVC 3C3DA 2Z8YM 4LY6A 3L26A 4TUWA 2OOAA 3LMMA 1XWIA 2P5TA 2W82A 3U61B 2DVWB 4MM3B 2UUCM 4LJ8A 4NSRA 4NRVA 2QCUA 2QBYB 1JR3D 4F2LA 3U6EA 3FTDA 1DO0A 4GKJM 1C7YA 2YR0A 2X49A 2CFOA 4FCVA 3W67A 4IBKA 4FD2A 2F5OA 4GH9A 2DENA 3KVWA 3UGJA 2EA0A 3I4YA 2CHGA 5IZ7D 1PJJA 3KFUG 4AKHA 4WURA 4DV6M 2HWJA 4LJAA 1Z59A 1T43A 2R4EA 1S3SA 2VF7A 1PJTA 5GKNA 1Q39A 2R44A 2CRUA 4DR4M 1E94E 3H4JA 4Y28F 1IN7A 3T1HM 2QHOB 4L15A 4CJ6A 4M9XA 1K3WA 1NJFA 2NQ8C 3U60A 5KPRA 4B3MM 3L2AA 2JZ0A 3B7QA 2XH9A 1IY1A 2WSEF 1TR8A 1YSYA 3AOEA 3TPZA 3ZH9B 4IBBA 2XEPA 4PT5A 4LZZA 3AOEC 2LTUA 3QYBA 4DV5M 1QDRA 4LJ7A 2GQFA 3C9PA 3LQRA 1TH2A 2QQ8A 1OQYA 3FYDA 2J5YA 1R5LA 4WP2A 3J2PB 4DV2M 2Z4SA 3LQQA 4MGZE 2H5XA 4D82A 1IN6A 2HKJA 3KW6A 2DAMA 3E9SA 5ITYA 4GMQA 3SARA 3U6QA 3FTFA 1OAIA 2KRKA 3K92A 1G4AE 1WJ7A 1IFYA 1PGYA 2Q2EB 2Z7JA 2JA2A 5C18A 1WXQA 2DXIA 2C9OA 4DR3M 4G4OA 3SATA 3L27A 4DUYM 3KSXA 2ZAOA 2L09A 2QPAA 3SMPA 4LF6M 2I7PA 1SXJA 3FE3A 3C58A 3K8ZA 4L78A 3KOXE 4X62M 1TDZA 1SXJC 1LV7A 1J09A 1TH4A 3I01M 3KP0E 1HQYE 4Q7JA 3FTCA 1FJGM 2C96A 3I04M 1L1TA 2UU9M 4NXMM 1IXZA 2LXEA 4XK8F 3I51A 2FS1A 3GLHE 4GIPA 4LJ5A 2Y0TA 2BWEA 4R3DA 1R2YA 1NNJA 3R9XB 4FWGA 1L8QA 2MJ5B 3QYEA 3GLGA 2OOBA 1HQCA 3WHLA 1XXHE 3V76A 4FCTA 1ZMUA 4FWHA 1I4WA 2EKFA 3B7ZA 4ANRA 1OIPA 3U5ZB 4L6V6 5H37D 3KOYE 2MGWA 5DYGA 1HJPA 2JNHA 2L4EA 5EXXA 3VLFB 3A42A 1MU5A 1L2DA 3K9OA 2R45A 1WR1B 3ILKA 3SHGB 1GJSA 1DGBA 1HT2E 3CF2A 4DR7M 4IJEA 1Q02A 2DZLA 3GP1A 1FNNA 4RF1A 1T3TA 4MH0E 3GPPA 2ZM6M 2LNHC 4P17A 1J5EM 1YLAA 4M9SA 3GLFA 2FNAA 1OAOC 3M7GA 3QWLA 4R7GA 3T15A 2EO2A 4AG6A 5C1BA 4GHAA 5EP3A 4L16A 4RKUF 3DZDA 4I8OA 4LJ6A 3GLIE 3FUUA 3KDSE 5BR8M 3FKEA 2DZOB 3M0EA 4PD2A 4IBEA 2LVPC 3JR5A 1V34A 2D7HA 4M9ZA 3U61A 4IBDA 3E21A 5EXTA 3RFWA 4DV4M 3D8LA 1LTMA 4DR6M 1T6OA 3GLHB 2DWLA 4G4NA 3KS8A 2CP8A 3B74A 4KODA 5EP1A 1K82A 4AQYM 3ZCBB 4PCZA 1N78A 4W5WA 3AV0A 1IXSB 2BJVA 1HNXM 1KYIA 2CWBA 2DAGA 4GKKM 4JI0M 3VK8A 4I81A 2LVNC 4GC5A 2M5ZA 3TL4X 1XMQM 1IQPA 3U6SA 4DR1M 4GHLA 1VEKA 3TE6A 5ITRA 3GPUA 3BBZA 2HHHM 2ZAMA 2DKLA 3PNYA 4KO8A 3SAVA 4DV1M 4JI2M 1OKSA 4ZPXA 1DGFA 3GQ3A 2LVQD 1IY2A 4GC9A 3SAWA 3FTEA 3U6LA 4B3TM 2I7NA 5KPTA 3FUVA 1Z6TA 3A45A 3EIHA 1D0KA 4M0WA 4JN6A 4MGYE 3SYKA 1R4GA 1W5TA 3TWMA 5FLXS 3FD9A 4NSOB 4LFBM 4B7HA 1IN5A 3GLIB 1YE9A 4DR5M 3IG8A 4PDGA 2JP7A 1SG9A 3FRIA 1GLNA 4FW9A 4ITQA 3VKGA 2N35A 4D81A 3SASA 2V6ZM 1G59A 2D7GA 1ZMVA 2KXEA 2R65A 1OIZA 2R62A 5EXSA 1D2NA 3NBXX 4JXJA 3H4MA 2E5LM 3E4RA 3FYCA 2JY5A 4GITA 1G41A 3OTOM 3LW5F 5ITXA 1PJSA 2R6FA 4JI7M 3FUWA 3R8FA 1OFHA 2XZUA 2G3QA 2GNOA 4AKGA 1PRBA 2CHQA 1QUSA 3J81S 1QAOA 3KP1E 1IM2A 2DAEA 2LBCA 3LVWA 1UM8A 1JB0F 2QNJA 2VDBB 1IBMM 3IECA 4B3RM 1Z5AA 2QZ4A 4B7FA 1SXJE 1QAMA 3A46A 1IN8A 1TF0B 4FCWA 3ZQJA 4JI6M 2APLA 1G3IA 1DGHB 1JR3A 4LZJA 4LRTA 4AKIA 2KNVA 1N77A 1DV0A 2VF8A 1TTEA 4L4UA 2ZANA 4MGHA 2K6BA 3HU1A 4JI4M 1EFUB 1ZMWA 3NWLA 2L6OA 1XMOM 3U60B 4OVZA 2UXBM 1KSFX 2Z4RA 3HJSA 5EXPA 4LFAM 5KO3A 3U5ZA 2CE7A 3HHYA 4G6ZA 3B89A 3U6CA 5ITQA 1EE8A 2QENA 5FTJA 1QAQA 2C5RA 2UUAM 2XSZD 2XFTA 3HWSA 3J27B 3DOAA 1QVRA 4G3OA 2ZBKB 3B9PA 1IBKM 3LVVA 4IBFA 3GLGE 2OO9A 4LF4M 2QP9X 1V33A 4AZFA 2JXNA 3J7BA 1GJTA 3K9PA 1NHGC 4AI6A 2R46A 5IREB 3AJIB 3L29A 4X66M 4R71A 1HR0M 4CISA 1F4IA 3VFDA 4F1IA 1L1ZA 2CV0A 2Y0QA 3HJQA 1BVSA 2DHYA 2R4JA 3GO8A 3THGA 1GKIA 4YY3M 2OQ4A 1JQJC 1XC8A 1E32A 4OU7A 1J7KA 3PFIA 4MB7A 1WHCA 1XNRM 4NL4H 2F4VM 5F3WA 4MGKE 4JI5M 2YFQA 2ZTCA 2C99A 1IN4A 2O5RA 4II7A 2RGHA 3GLFE 3SMSA 4JI8M 1SXJB 4HEOA 1YUBA 1NV9A 5FTLA 3RE8A 5FTMA 3GQ4A 2KHHA 3RGPA 5FSWA 3JR4A 4LG2A 4IIWA 7CATA 1V92A 4G4RA 5DNYA 1IXSA 2XZFA 1QZMA 3JAMS 4LF7M 1ZV1A 4LF5M 2WZJA 4GRIA 1R2ZA 1E9SA 2DWMA 1QANA 3FRHA 1ORYB 1R7RA 2MROB 2C98A 1Z5CA 2XF3A 3A98B 4I4LA 2JWSA 4LF8M 4CGYB 2X4AA 2QSFX 2QBYA 3GLGB 2KZSA 2F5QA 1G71A 2JY7A 4DV3M 4JI3M 1AIPC 3GRUA 1WGNA 4DV0M 1L2CA 2ZTDA 2RRUA 3MJ5A 2F5SA 1XXHB 4B3SM 1I94M 1KFVA 4BB9A 4IBJA 3HX3A 2DWZB 3HKPA 2VQFM 2KEBA 3UZUA 3U6DA 1Q3BA 4IJFA 3SC3A 5JI2E 1VG5A 1WGLA 2LVOC 2YQZA 1DO2A 2J7OA 2DHRA 1NJGA 1HT1E 1HNZM 2OPFA 3SFZA 5EQTA 1MX0A 3KOWE 5JI3E 2R0IA 2UXDM 3VKHA 4IBCA 2Y21A 3SYLA 1QDTA 2D7EA 2H1RA 2KA6B 4D80A 3GLFB 4K0KM 1MN3A 1WIVA 3IG5A 4QOZC 2B3TA 1PJIA 3KOZE 2LHCA 4OX9M 1R6BX 4UN2B 1A5TA 2KZUA 2DI0A 2C9CA 2KDLA 3W0FA 4B08A 4CIZA 3K2LA 5EP2A 2K0BX 2L4FA 4JI1M 2VIIA 4Z8XA 2KRUA 4BLCA 4QHSA 1NY6A 4NOOB 4AW4A 1IBLM 3QAUA 4AG5A 4B7GA 2V1UA 3L25A 1SXJD 3KXEC 4QOSA 2JZ1A 2MH8A 2G5GX 3MMPA 3ZC7B 4NRWA 3K1JA 2EJSA 1DGHA 5ITXE 3J7AS 1DGGA 1X37A 2FOIC 1C1KA 3DA1A 3TWKA 2O01F 4DUZM 4JYAM 2UXCM 5DFLA 4IBIA 2HAKA 3BXWA 1MJGM 1RU3A 4Z6YA 3IHPA 4G4QA 4HLQA 2XLJA 3CF6E 3TQSA 3DFZA 1NV8A 3GRRA 1HNWM 3M6AA 4PDIA 1D0MA 5L8RF 1XB2B 3U6OA 2CV1A 1IXRC 2BWBA 3I4VA 1IY0A 2L7IA 2XFSA 1JR3E 3CGWA 5IWAM 4LFCM 3GRYA 2CUZA 4LCBA 3E46A 3VDPA 4MGIE 1UFZA 2CV2A 3AL0C 3HHZA 3SAUA 2HCBA 5EP4A 4GEWA 1PM5A 5KPZA 3KS4A 4I5SA 3L28A 2KW0A 4KLNA 4LF9M 3BOSA 1N33M 4XGIA 5LMNM 3HY5A 2AHMA 1AUAA 1H6UA 2K47A 4LRSA 1N32M 1TH3A 1NHWC 2HL7A 4DBGB 2LH0A 2FFJA 2Y20A 4RF0A 2CHVA 4DV7M 3C3EA 1VDDA 3HGIA 3W0LB 5KQ8A 5ITUA 5A2QS 1PJQA 1L2BA 1Q3CA 2G8LA 4A3VB 4REZA 4KHPM 1W5SA 3HHWA 4QNMA 4LJ4A 3PVSA 3VK7A 2KNAA 3SHFA 2RGOA 4FWDA 4YHHM 2XGNA 3MK6A 3PNVA 5DYIA 3T1YM 5EJCA 1ZQ9A 4LGMA 4FVMA 1EIJA 5E26A 2DZNB 1NO1A 3W68A
chains in the Genus database with same CATH topology
2UUBM 3HU3A 4L8RC 4OW0A 3PXGA 1Z5BA 3SBJA 1QYRA 2M60A 2R18A 3HHXA 2F5NA 2X8AA 3UMMA 2VQEM 5LMUM 5FTKA 5ITTA 3GLHA 3CTWB 3UJNA 4IBGA 2BNKA 5IT9S 1XHBA 1NNUC 4EIWA 3TWLA 2A5YB 4RNAA 4OVZB 1E9RA 1XXHA 1OJLA 5E6JA 2RKOA 1OFIA 3D8BA 4X64M 5FTNA 1NVMA 2YNMD 3EIEA 4LGYA 3RGSA 2L7HA 4QHTA 3HJ8A 3NBIA 4BBAA 4M0DA 2XSZA 3T38A 4HL4A 1G8PA 2V1CA 1N34M 2J7NA 2DWNA 4WW0A 2Z3XA 1N36M 3AOGA 1K3XA 2F5PA 3GPYA 8CATA 3FUTA 3VDUA 3AKZA 3GRVA 3AFHA 3HU2A 1ZAEA 4JV5M 2BJWA 4S12A 2EUCA 4NXNM 1NSFA 3GPXA 1XNQM 1TDHA 4LJ9A 3GLIA 3U6MA 3GQ5A 3WHKA 3Q8XA 2FE8A 4X65M 4DR2M 1GVNA 3CF0A 3FUXA 2CEAA 4XBOA 1QQWA 1GL6A 1N75A 1TGUA 4P16A 2LWXA 5BPVA 4QNRA 1GL7A 1NY5A 3UK6A 2ERCA 3U6PA 4CHTB 5KQDA 3KSJA 3J80S 3MHVC 4LY6A 3L26A 4TUWA 3LMMA 1XWIA 2P5TA 2W82A 3U61B 2DVWB 4MM3B 2UUCM 4LJ8A 4NSRA 4NRVA 2QCUA 2QBYB 1JR3D 3U6EA 3FTDA 1DO0A 4GKJM 2YR0A 2X49A 2CFOA 4FCVA 4IBKA 4FD2A 2F5OA 4GH9A 3KVWA 3UGJA 2EA0A 3I4YA 2CHGA 5IZ7D 1PJJA 3KFUG 4AKHA 4WURA 4DV6M 4LJAA 1Z59A 2R4EA 5GKNA 1S3SA 1Q39A 4DR4M 1E94E 1IN7A 3T1HM 4L15A 4M9XA 1K3WA 1NJFA 2NQ8C 3U60A 5KPRA 4B3MM 3L2AA 2XH9A 1IY1A 1YSYA 3TPZA 3AOEA 3ZH9B 4IBBA 2XEPA 4PT5A 4LZZA 3AOEC 4DV5M 4LJ7A 3LQRA 1TH2A 3FYDA 3J2PB 4DV2M 2Z4SA 3LQQA 4MGZE 4D82A 1IN6A 2HKJA 3KW6A 3E9SA 5ITYA 4GMQA 3SARA 3U6QA 3FTFA 2KRKA 3K92A 1G4AE 2Q2EB 2Z7JA 2JA2A 5C18A 1WXQA 2DXIA 2C9OA 4DR3M 4G4OA 3SATA 3L27A 4DUYM 3KSXA 2ZAOA 2L09A 2QPAA 3SMPA 4LF6M 2I7PA 1SXJA 3C58A 3K8ZA 4L78A 3KOXE 4X62M 1TDZA 1SXJC 1J09A 1LV7A 1TH4A 3KP0E 1HQYE 3FTCA 1FJGM 2C96A 1L1TA 2UU9M 4NXMM 1IXZA 2LXEA 3I51A 4GIPA 4LJ5A 2Y0TA 4R3DA 1R2YA 1NNJA 3R9XB 4FWGA 1L8QA 3GLGA 1HQCA 3WHLA 4FCTA 4FWHA 1I4WA 3U5ZB 5H37D 3KOYE 5DYGA 1L2DA 5EXXA 3VLFB 3A42A 1MU5A 2R45A 3SHGB 3ILKA 1DGBA 1HT2E 3CF2A 4DR7M 4IJEA 3GP1A 1FNNA 4RF1A 1T3TA 4MH0E 3GPPA 2ZM6M 2LNHC 1J5EM 4M9SA 3GLFA 2FNAA 3M7GA 3QWLA 4R7GA 3T15A 4AG6A 2EO2A 5C1BA 4GHAA 5EP3A 4L16A 3DZDA 4I8OA 4LJ6A 3FUUA 3KDSE 5BR8M 3FKEA 2DZOB 3M0EA 4PD2A 4IBEA 3JR5A 2D7HA 4M9ZA 3U61A 4IBDA 5EXTA 4DV4M 3RFWA 3D8LA 4DR6M 2DWLA 3GLHB 4G4NA 3KS8A 4KODA 5EP1A 1K82A 4AQYM 3ZCBB 4PCZA 1N78A 4W5WA 3AV0A 1IXSB 2BJVA 1HNXM 1KYIA 4GKKM 4JI0M 3VK8A 4I81A 4GC5A 2M5ZA 3TL4X 1XMQM 1IQPA 3U6SA 4DR1M 4GHLA 3TE6A 5ITRA 3GPUA 2HHHM 2ZAMA 4KO8A 3PNYA 3SAVA 4DV1M 4JI2M 4ZPXA 1DGFA 3GQ3A 1IY2A 4GC9A 3SAWA 3FTEA 3U6LA 4B3TM 2I7NA 5KPTA 3FUVA 1Z6TA 3A45A 3EIHA 4M0WA 4JN6A 4MGYE 3SYKA 3TWMA 1W5TA 5FLXS 3FD9A 4NSOB 4LFBM 4B7HA 1IN5A 3GLIB 1YE9A 4DR5M 3IG8A 4PDGA 1GLNA 4FW9A 4ITQA 3VKGA 4D81A 3SASA 2V6ZM 1G59A 2D7GA 2KXEA 2R65A 2R62A 5EXSA 1D2NA 4JXJA 3H4MA 2E5LM 3E4RA 3FYCA 4GITA 1G41A 3OTOM 5ITXA 4JI7M 3FUWA 3R8FA 1OFHA 2XZUA 4AKGA 2CHQA 3J81S 1QAOA 3KP1E 1IM2A 3LVWA 1UM8A 1IBMM 4B3RM 1Z5AA 2QZ4A 4B7FA 1SXJE 1QAMA 3A46A 1IN8A 4FCWA 4JI6M 4LZJA 1G3IA 1DGHB 1JR3A 4AKIA 4LRTA 1N77A 4L4UA 2ZANA 4MGHA 3HU1A 4JI4M 3NWLA 2L6OA 1XMOM 3U60B 4OVZA 2UXBM 1KSFX 2Z4RA 3HJSA 5EXPA 4LFAM 5KO3A 3U5ZA 2CE7A 3HHYA 4G6ZA 3U6CA 5ITQA 1EE8A 2QENA 5FTJA 1QAQA 2C5RA 2UUAM 2XSZD 2XFTA 3HWSA 3J27B 3DOAA 1QVRA 1IBKM 2ZBKB 3B9PA 3LVVA 4IBFA 4LF4M 2QP9X 4AZFA 3J7BA 4AI6A 1NHGC 2R46A 5IREB 3AJIB 3L29A 4X66M 1HR0M 4CISA 3VFDA 1L1ZA 2CV0A 2Y0QA 3HJQA 3GO8A 2R4JA 3THGA 1GKIA 4YY3M 2OQ4A 1JQJC 1XC8A 1E32A 4OU7A 1J7KA 3PFIA 4MB7A 1XNRM 2F4VM 4NL4H 5F3WA 4MGKE 4JI5M 2YFQA 2C99A 1IN4A 2O5RA 4II7A 2RGHA 3SMSA 4JI8M 1SXJB 1YUBA 5FTLA 3RE8A 5FTMA 3GQ4A 3JR4A 3RGPA 5FSWA 4LG2A 4IIWA 7CATA 4G4RA 5DNYA 2XZFA 1QZMA 3JAMS 4LF7M 4LF5M 4GRIA 1R2ZA 2DWMA 1E9SA 1QANA 1ORYB 1R7RA 2C98A 1Z5CA 2XF3A 3A98B 4I4LA 4LF8M 4CGYB 2X4AA 2QBYA 3GLGB 2KZSA 2F5QA 4DV3M 4JI3M 3GRUA 4DV0M 1L2CA 2F5SA 3MJ5A 1XXHB 4B3SM 1I94M 1KFVA 4BB9A 4IBJA 2DWZB 3HKPA 2VQFM 2KEBA 3UZUA 3U6DA 1Q3BA 4IJFA 3SC3A 5JI2E 2YQZA 1DO2A 2J7OA 2DHRA 1NJGA 1HT1E 1HNZM 2OPFA 3SFZA 5EQTA 1MX0A 3KOWE 5JI3E 2UXDM 3VKHA 4IBCA 2Y21A 3SYLA 2D7EA 2H1RA 2KA6B 4D80A 3GLFB 4K0KM 3IG5A 4QOZC 1PJIA 3KOZE 4OX9M 1R6BX 2KZUA 2C9CA 3W0FA 4B08A 3K2LA 5EP2A 4JI1M 2VIIA 4Z8XA 2KRUA 4BLCA 4QHSA 1NY6A 4NOOB 4AW4A 1IBLM 3QAUA 4AG5A 4B7GA 2V1UA 3L25A 1SXJD 3KXEC 4QOSA 2G5GX 3ZC7B 4NRWA 3K1JA 1DGHA 5ITXE 3J7AS 1DGGA 1X37A 2FOIC 1C1KA 3DA1A 3TWKA 4JYAM 4DUZM 2UXCM 4IBIA 4G4QA 4Z6YA 4HLQA 2XLJA 3CF6E 3TQSA 3DFZA 3GRRA 1HNWM 3M6AA 4PDIA 3U6OA 2CV1A 1IXRC 3I4VA 1IY0A 2L7IA 2XFSA 5IWAM 4LFCM 3GRYA 2CUZA 4LCBA 3VDPA 4MGIE 2CV2A 3AL0C 3HHZA 3SAUA 2HCBA 5EP4A 1PM5A 5KPZA 3KS4A 4I5SA 3L28A 2KW0A 4KLNA 4LF9M 3BOSA 1N33M 4XGIA 5LMNM 2AHMA 1H6UA 2K47A 4LRSA 1N32M 1TH3A 1NHWC 2HL7A 2LH0A 2FFJA 2Y20A 4RF0A 2CHVA 4DV7M 3HGIA 1VDDA 3W0LB 5KQ8A 5A2QS 5ITUA 1L2BA 1Q3CA 2G8LA 4A3VB 4REZA 4KHPM 1W5SA 3HHWA 4QNMA 4LJ4A 3PVSA 3VK7A 3SHFA 2RGOA 4FWDA 4YHHM 2XGNA 3MK6A 3PNVA 5DYIA 3T1YM 5EJCA 1ZQ9A 4LGMA 4FVMA 5E26A 2DZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSO B;  4NOO B;  4NSR A; 
#chains in the Genus database with same CATH topology
 2UUB M;  3HU3 A;  2LVA A;  4L8R C;  4OW0 A;  1VQ1 A;  3PXG A;  1Z5B A;  3Q8G A;  1QUT A;  1QYR A;  1D0L A;  2M60 A;  3SBJ A;  2R18 A;  3HHX A;  2F5N A;  2JY8 A;  3T6P A;  2X8A A;  1VDL A;  3UMM A;  2VQE M;  5LMU M;  5FTK A;  5ITT A;  3GLH A;  3CTW B;  3UJN A;  3HZJ A;  4IBG A;  2BNK A;  5IT9 S;  1XHB A;  1NNU C;  4EIW A;  3TWL A;  2A5Y B;  4RNA A;  4OVZ B;  1E9R A;  2K9D A;  2LHG A;  1XXH A;  1OJL A;  5E6J A;  4NC6 A;  2RKO A;  1OFI A;  3D8B A;  4X64 M;  5FTN A;  1NVM A;  2YNM D;  3LCV B;  3EIE A;  2WSC F;  4LGY A;  3RGS A;  2L7H A;  1VEJ A;  4QHT A;  3HJ8 A;  2L2D A;  3NBI A;  4BBA A;  4M0D A;  2XSZ A;  4KT0 F;  3T38 A;  4HL4 A;  1OTR A;  1G8P A;  2V1C A;  1N34 M;  2J7N A;  2DWN A;  1GAB A;  4WW0 A;  2KNZ A;  2Z3X A;  1N36 M;  3AOG A;  3LCU A;  1K3X A;  2F5P A;  3GPY A;  8CAT A;  1CUK A;  2DNA A;  1P3Q Q;  3FUT A;  3VDU A;  3AKZ A;  3GRV A;  3AFH A;  2FH0 A;  3F92 A;  3HU2 A;  1ZAE A;  2MR9 A;  4JV5 M;  2BJW A;  3B7N A;  4S12 A;  2EUC A;  1GO5 A;  2JUJ A;  4NXN M;  1NSF A;  1QZE A;  3GPX A;  2JY6 B;  1XNQ M;  1TDH A;  4LJ9 A;  3GLI A;  2DAI A;  3U6M A;  1VEG A;  2WSF F;  3GQ5 A;  1Y8G A;  3WHK A;  3Q8X A;  2DAK A;  2FE8 A;  4X65 M;  4DR2 M;  1GVN A;  3CF0 A;  3FUX A;  2CEA A;  4XBO A;  1QQW A;  1GL6 A;  1N75 A;  1TGU A;  4P16 A;  2LWX A;  5BPV A;  4QNR A;  1GL7 A;  1NY5 A;  3UK6 A;  2ERC A;  3U6P A;  2EKK A;  2O25 A;  4CHT B;  5KQD A;  3KSJ A;  3J80 S;  3MHV C;  3C3D A;  2Z8Y M;  4LY6 A;  3L26 A;  4TUW A;  2OOA A;  3LMM A;  1XWI A;  2P5T A;  2W82 A;  3U61 B;  2DVW B;  4MM3 B;  2UUC M;  4LJ8 A;  4NSR A;  4NRV A;  2QCU A;  2QBY B;  1JR3 D;  4F2L A;  3U6E A;  3FTD A;  1DO0 A;  4GKJ M;  1C7Y A;  2YR0 A;  2X49 A;  2CFO A;  4FCV A;  3W67 A;  4IBK A;  4FD2 A;  2F5O A;  4GH9 A;  2DEN A;  3KVW A;  3UGJ A;  2EA0 A;  3I4Y A;  2CHG A;  5IZ7 D;  1PJJ A;  3KFU G;  4AKH A;  4WUR A;  4DV6 M;  2HWJ A;  4LJA A;  1Z59 A;  1T43 A;  2R4E A;  1S3S A;  2VF7 A;  1PJT A;  5GKN A;  1Q39 A;  2R44 A;  2CRU A;  4DR4 M;  1E94 E;  3H4J A;  4Y28 F;  1IN7 A;  3T1H M;  2QHO B;  4L15 A;  4CJ6 A;  4M9X A;  1K3W A;  1NJF A;  2NQ8 C;  3U60 A;  5KPR A;  4B3M M;  3L2A A;  2JZ0 A;  3B7Q A;  2XH9 A;  1IY1 A;  2WSE F;  1TR8 A;  1YSY A;  3AOE A;  3TPZ A;  3ZH9 B;  4IBB A;  2XEP A;  4PT5 A;  4LZZ A;  3AOE C;  2LTU A;  3QYB A;  4DV5 M;  1QDR A;  4LJ7 A;  2GQF A;  3C9P A;  3LQR A;  1TH2 A;  2QQ8 A;  1OQY A;  3FYD A;  2J5Y A;  1R5L A;  4WP2 A;  3J2P B;  4DV2 M;  2Z4S A;  3LQQ A;  4MGZ E;  2H5X A;  4D82 A;  1IN6 A;  2HKJ A;  3KW6 A;  2DAM A;  3E9S A;  5ITY A;  4GMQ A;  3SAR A;  3U6Q A;  3FTF A;  1OAI A;  2KRK A;  3K92 A;  1G4A E;  1WJ7 A;  1IFY A;  1PGY A;  2Q2E B;  2Z7J A;  2JA2 A;  5C18 A;  1WXQ A;  2DXI A;  2C9O A;  4DR3 M;  4G4O A;  3SAT A;  3L27 A;  4DUY M;  3KSX A;  2ZAO A;  2L09 A;  2QPA A;  3SMP A;  4LF6 M;  2I7P A;  1SXJ A;  3FE3 A;  3C58 A;  3K8Z A;  4L78 A;  3KOX E;  4X62 M;  1TDZ A;  1SXJ C;  1LV7 A;  1J09 A;  1TH4 A;  3I01 M;  3KP0 E;  1HQY E;  4Q7J A;  3FTC A;  1FJG M;  2C96 A;  3I04 M;  1L1T A;  2UU9 M;  4NXM M;  1IXZ A;  2LXE A;  4XK8 F;  3I51 A;  2FS1 A;  3GLH E;  4GIP A;  4LJ5 A;  2Y0T A;  2BWE A;  4R3D A;  1R2Y A;  1NNJ A;  3R9X B;  4FWG A;  1L8Q A;  2MJ5 B;  3QYE A;  3GLG A;  2OOB A;  1HQC A;  3WHL A;  1XXH E;  3V76 A;  4FCT A;  1ZMU A;  4FWH A;  1I4W A;  2EKF A;  3B7Z A;  4ANR A;  1OIP A;  3U5Z B;  4L6V 6;  5H37 D;  3KOY E;  2MGW A;  5DYG A;  1HJP A;  2JNH A;  2L4E A;  5EXX A;  3VLF B;  3A42 A;  1MU5 A;  1L2D A;  3K9O A;  2R45 A;  1WR1 B;  3ILK A;  3SHG B;  1GJS A;  1DGB A;  1HT2 E;  3CF2 A;  4DR7 M;  4IJE A;  1Q02 A;  2DZL A;  3GP1 A;  1FNN A;  4RF1 A;  1T3T A;  4MH0 E;  3GPP A;  2ZM6 M;  2LNH C;  4P17 A;  1J5E M;  1YLA A;  4M9S A;  3GLF A;  2FNA A;  1OAO C;  3M7G A;  3QWL A;  4R7G A;  3T15 A;  2EO2 A;  4AG6 A;  5C1B A;  4GHA A;  5EP3 A;  4L16 A;  4RKU F;  3DZD A;  4I8O A;  4LJ6 A;  3GLI E;  3FUU A;  3KDS E;  5BR8 M;  3FKE A;  2DZO B;  3M0E A;  4PD2 A;  4IBE A;  2LVP C;  3JR5 A;  1V34 A;  2D7H A;  4M9Z A;  3U61 A;  4IBD A;  3E21 A;  5EXT A;  3RFW A;  4DV4 M;  3D8L A;  1LTM A;  4DR6 M;  1T6O A;  3GLH B;  2DWL A;  4G4N A;  3KS8 A;  2CP8 A;  3B74 A;  4KOD A;  5EP1 A;  1K82 A;  4AQY M;  3ZCB B;  4PCZ A;  1N78 A;  4W5W A;  3AV0 A;  1IXS B;  2BJV A;  1HNX M;  1KYI A;  2CWB A;  2DAG A;  4GKK M;  4JI0 M;  3VK8 A;  4I81 A;  2LVN C;  4GC5 A;  2M5Z A;  3TL4 X;  1XMQ M;  1IQP A;  3U6S A;  4DR1 M;  4GHL A;  1VEK A;  3TE6 A;  5ITR A;  3GPU A;  3BBZ A;  2HHH M;  2ZAM A;  2DKL A;  3PNY A;  4KO8 A;  3SAV A;  4DV1 M;  4JI2 M;  1OKS A;  4ZPX A;  1DGF A;  3GQ3 A;  2LVQ D;  1IY2 A;  4GC9 A;  3SAW A;  3FTE A;  3U6L A;  4B3T M;  2I7N A;  5KPT A;  3FUV A;  1Z6T A;  3A45 A;  3EIH A;  1D0K A;  4M0W A;  4JN6 A;  4MGY E;  3SYK A;  1R4G A;  1W5T A;  3TWM A;  5FLX S;  3FD9 A;  4NSO B;  4LFB M;  4B7H A;  1IN5 A;  3GLI B;  1YE9 A;  4DR5 M;  3IG8 A;  4PDG A;  2JP7 A;  1SG9 A;  3FRI A;  1GLN A;  4FW9 A;  4ITQ A;  3VKG A;  2N35 A;  4D81 A;  3SAS A;  2V6Z M;  1G59 A;  2D7G A;  1ZMV A;  2KXE A;  2R65 A;  1OIZ A;  2R62 A;  5EXS A;  1D2N A;  3NBX X;  4JXJ A;  3H4M A;  2E5L M;  3E4R A;  3FYC A;  2JY5 A;  4GIT A;  1G41 A;  3OTO M;  3LW5 F;  5ITX A;  1PJS A;  2R6F A;  4JI7 M;  3FUW A;  3R8F A;  1OFH A;  2XZU A;  2G3Q A;  2GNO A;  4AKG A;  1PRB A;  2CHQ A;  1QUS A;  3J81 S;  1QAO A;  3KP1 E;  1IM2 A;  2DAE A;  2LBC A;  3LVW A;  1UM8 A;  1JB0 F;  2QNJ A;  2VDB B;  1IBM M;  3IEC A;  4B3R M;  1Z5A A;  2QZ4 A;  4B7F A;  1SXJ E;  1QAM A;  3A46 A;  1IN8 A;  1TF0 B;  4FCW A;  3ZQJ A;  4JI6 M;  2APL A;  1G3I A;  1DGH B;  1JR3 A;  4LZJ A;  4LRT A;  4AKI A;  2KNV A;  1N77 A;  1DV0 A;  2VF8 A;  1TTE A;  4L4U A;  2ZAN A;  4MGH A;  2K6B A;  3HU1 A;  4JI4 M;  1EFU B;  1ZMW A;  3NWL A;  2L6O A;  1XMO M;  3U60 B;  4OVZ A;  2UXB M;  1KSF X;  2Z4R A;  3HJS A;  5EXP A;  4LFA M;  5KO3 A;  3U5Z A;  2CE7 A;  3HHY A;  4G6Z A;  3B89 A;  3U6C A;  5ITQ A;  1EE8 A;  2QEN A;  5FTJ A;  1QAQ A;  2C5R A;  2UUA M;  2XSZ D;  2XFT A;  3HWS A;  3J27 B;  3DOA A;  1QVR A;  4G3O A;  2ZBK B;  3B9P A;  1IBK M;  3LVV A;  4IBF A;  3GLG E;  2OO9 A;  4LF4 M;  2QP9 X;  1V33 A;  4AZF A;  2JXN A;  3J7B A;  1GJT A;  3K9P A;  1NHG C;  4AI6 A;  2R46 A;  5IRE B;  3AJI B;  3L29 A;  4X66 M;  4R71 A;  1HR0 M;  4CIS A;  1F4I A;  3VFD A;  4F1I A;  1L1Z A;  2CV0 A;  2Y0Q A;  3HJQ A;  1BVS A;  2DHY A;  2R4J A;  3GO8 A;  3THG A;  1GKI A;  4YY3 M;  2OQ4 A;  1JQJ C;  1XC8 A;  1E32 A;  4OU7 A;  1J7K A;  3PFI A;  4MB7 A;  1WHC A;  1XNR M;  4NL4 H;  2F4V M;  5F3W A;  4MGK E;  4JI5 M;  2YFQ A;  2ZTC A;  2C99 A;  1IN4 A;  2O5R A;  4II7 A;  2RGH A;  3GLF E;  3SMS A;  4JI8 M;  1SXJ B;  4HEO A;  1YUB A;  1NV9 A;  5FTL A;  3RE8 A;  5FTM A;  3GQ4 A;  2KHH A;  3RGP A;  5FSW A;  3JR4 A;  4LG2 A;  4IIW A;  7CAT A;  1V92 A;  4G4R A;  5DNY A;  1IXS A;  2XZF A;  1QZM A;  3JAM S;  4LF7 M;  1ZV1 A;  4LF5 M;  2WZJ A;  4GRI A;  1R2Z A;  1E9S A;  2DWM A;  1QAN A;  3FRH A;  1ORY B;  1R7R A;  2MRO B;  2C98 A;  1Z5C A;  2XF3 A;  3A98 B;  4I4L A;  2JWS A;  4LF8 M;  4CGY B;  2X4A A;  2QSF X;  2QBY A;  3GLG B;  2KZS A;  2F5Q A;  1G71 A;  2JY7 A;  4DV3 M;  4JI3 M;  1AIP C;  3GRU A;  1WGN A;  4DV0 M;  1L2C A;  2ZTD A;  2RRU A;  3MJ5 A;  2F5S A;  1XXH B;  4B3S M;  1I94 M;  1KFV A;  4BB9 A;  4IBJ A;  3HX3 A;  2DWZ B;  3HKP A;  2VQF M;  2KEB A;  3UZU A;  3U6D A;  1Q3B A;  4IJF A;  3SC3 A;  5JI2 E;  1VG5 A;  1WGL A;  2LVO C;  2YQZ A;  1DO2 A;  2J7O A;  2DHR A;  1NJG A;  1HT1 E;  1HNZ M;  2OPF A;  3SFZ A;  5EQT A;  1MX0 A;  3KOW E;  5JI3 E;  2R0I A;  2UXD M;  3VKH A;  4IBC A;  2Y21 A;  3SYL A;  1QDT A;  2D7E A;  2H1R A;  2KA6 B;  4D80 A;  3GLF B;  4K0K M;  1MN3 A;  1WIV A;  3IG5 A;  4QOZ C;  2B3T A;  1PJI A;  3KOZ E;  2LHC A;  4OX9 M;  1R6B X;  4UN2 B;  1A5T A;  2KZU A;  2DI0 A;  2C9C A;  2KDL A;  3W0F A;  4B08 A;  4CIZ A;  3K2L A;  5EP2 A;  2K0B X;  2L4F A;  4JI1 M;  2VII A;  4Z8X A;  2KRU A;  4BLC A;  4QHS A;  1NY6 A;  4NOO B;  4AW4 A;  1IBL M;  3QAU A;  4AG5 A;  4B7G A;  2V1U A;  3L25 A;  1SXJ D;  3KXE C;  4QOS A;  2JZ1 A;  2MH8 A;  2G5G X;  3MMP A;  3ZC7 B;  4NRW A;  3K1J A;  2EJS A;  1DGH A;  5ITX E;  3J7A S;  1DGG A;  1X37 A;  2FOI C;  1C1K A;  3DA1 A;  3TWK A;  2O01 F;  4DUZ M;  4JYA M;  2UXC M;  5DFL A;  4IBI A;  2HAK A;  3BXW A;  1MJG M;  1RU3 A;  4Z6Y A;  3IHP A;  4G4Q A;  4HLQ A;  2XLJ A;  3CF6 E;  3TQS A;  3DFZ A;  1NV8 A;  3GRR A;  1HNW M;  3M6A A;  4PDI A;  1D0M A;  5L8R F;  1XB2 B;  3U6O A;  2CV1 A;  1IXR C;  2BWB A;  3I4V A;  1IY0 A;  2L7I A;  2XFS A;  1JR3 E;  3CGW A;  5IWA M;  4LFC M;  3GRY A;  2CUZ A;  4LCB A;  3E46 A;  3VDP A;  4MGI E;  1UFZ A;  2CV2 A;  3AL0 C;  3HHZ A;  3SAU A;  2HCB A;  5EP4 A;  4GEW A;  1PM5 A;  5KPZ A;  3KS4 A;  4I5S A;  3L28 A;  2KW0 A;  4KLN A;  4LF9 M;  3BOS A;  1N33 M;  4XGI A;  5LMN M;  3HY5 A;  2AHM A;  1AUA A;  1H6U A;  2K47 A;  4LRS A;  1N32 M;  1TH3 A;  1NHW C;  2HL7 A;  4DBG B;  2LH0 A;  2FFJ A;  2Y20 A;  4RF0 A;  2CHV A;  4DV7 M;  3C3E A;  1VDD A;  3HGI A;  3W0L B;  5KQ8 A;  5ITU A;  5A2Q S;  1PJQ A;  1L2B A;  1Q3C A;  2G8L A;  4A3V B;  4REZ A;  4KHP M;  1W5S A;  3HHW A;  4QNM A;  4LJ4 A;  3PVS A;  3VK7 A;  2KNA A;  3SHF A;  2RGO A;  4FWD A;  4YHH M;  2XGN A;  3MK6 A;  3PNV A;  5DYI A;  3T1Y M;  5EJC A;  1ZQ9 A;  4LGM A;  4FVM A;  1EIJ A;  5E26 A;  2DZN B;  1NO1 A;  3W68 A; 
#chains in the Genus database with same CATH homology
 2UUB M;  3HU3 A;  4L8R C;  4OW0 A;  3PXG A;  1Z5B A;  3SBJ A;  1QYR A;  2M60 A;  2R18 A;  3HHX A;  2F5N A;  2X8A A;  3UMM A;  2VQE M;  5LMU M;  5FTK A;  5ITT A;  3GLH A;  3CTW B;  3UJN A;  4IBG A;  2BNK A;  5IT9 S;  1XHB A;  1NNU C;  4EIW A;  3TWL A;  2A5Y B;  4RNA A;  4OVZ B;  1E9R A;  1XXH A;  1OJL A;  5E6J A;  2RKO A;  1OFI A;  3D8B A;  4X64 M;  5FTN A;  1NVM A;  2YNM D;  3EIE A;  4LGY A;  3RGS A;  2L7H A;  4QHT A;  3HJ8 A;  3NBI A;  4BBA A;  4M0D A;  2XSZ A;  3T38 A;  4HL4 A;  1G8P A;  2V1C A;  1N34 M;  2J7N A;  2DWN A;  4WW0 A;  2Z3X A;  1N36 M;  3AOG A;  1K3X A;  2F5P A;  3GPY A;  8CAT A;  3FUT A;  3VDU A;  3AKZ A;  3GRV A;  3AFH A;  3HU2 A;  1ZAE A;  4JV5 M;  2BJW A;  4S12 A;  2EUC A;  4NXN M;  1NSF A;  3GPX A;  1XNQ M;  1TDH A;  4LJ9 A;  3GLI A;  3U6M A;  3GQ5 A;  3WHK A;  3Q8X A;  2FE8 A;  4X65 M;  4DR2 M;  1GVN A;  3CF0 A;  3FUX A;  2CEA A;  4XBO A;  1QQW A;  1GL6 A;  1N75 A;  1TGU A;  4P16 A;  2LWX A;  5BPV A;  4QNR A;  1GL7 A;  1NY5 A;  3UK6 A;  2ERC A;  3U6P A;  4CHT B;  5KQD A;  3KSJ A;  3J80 S;  3MHV C;  4LY6 A;  3L26 A;  4TUW A;  3LMM A;  1XWI A;  2P5T A;  2W82 A;  3U61 B;  2DVW B;  4MM3 B;  2UUC M;  4LJ8 A;  4NSR A;  4NRV A;  2QCU A;  2QBY B;  1JR3 D;  3U6E A;  3FTD A;  1DO0 A;  4GKJ M;  2YR0 A;  2X49 A;  2CFO A;  4FCV A;  4IBK A;  4FD2 A;  2F5O A;  4GH9 A;  3KVW A;  3UGJ A;  2EA0 A;  3I4Y A;  2CHG A;  5IZ7 D;  1PJJ A;  3KFU G;  4AKH A;  4WUR A;  4DV6 M;  4LJA A;  1Z59 A;  2R4E A;  5GKN A;  1S3S A;  1Q39 A;  4DR4 M;  1E94 E;  1IN7 A;  3T1H M;  4L15 A;  4M9X A;  1K3W A;  1NJF A;  2NQ8 C;  3U60 A;  5KPR A;  4B3M M;  3L2A A;  2XH9 A;  1IY1 A;  1YSY A;  3TPZ A;  3AOE A;  3ZH9 B;  4IBB A;  2XEP A;  4PT5 A;  4LZZ A;  3AOE C;  4DV5 M;  4LJ7 A;  3LQR A;  1TH2 A;  3FYD A;  3J2P B;  4DV2 M;  2Z4S A;  3LQQ A;  4MGZ E;  4D82 A;  1IN6 A;  2HKJ A;  3KW6 A;  3E9S A;  5ITY A;  4GMQ A;  3SAR A;  3U6Q A;  3FTF A;  2KRK A;  3K92 A;  1G4A E;  2Q2E B;  2Z7J A;  2JA2 A;  5C18 A;  1WXQ A;  2DXI A;  2C9O A;  4DR3 M;  4G4O A;  3SAT A;  3L27 A;  4DUY M;  3KSX A;  2ZAO A;  2L09 A;  2QPA A;  3SMP A;  4LF6 M;  2I7P A;  1SXJ A;  3C58 A;  3K8Z A;  4L78 A;  3KOX E;  4X62 M;  1TDZ A;  1SXJ C;  1J09 A;  1LV7 A;  1TH4 A;  3KP0 E;  1HQY E;  3FTC A;  1FJG M;  2C96 A;  1L1T A;  2UU9 M;  4NXM M;  1IXZ A;  2LXE A;  3I51 A;  4GIP A;  4LJ5 A;  2Y0T A;  4R3D A;  1R2Y A;  1NNJ A;  3R9X B;  4FWG A;  1L8Q A;  3GLG A;  1HQC A;  3WHL A;  4FCT A;  4FWH A;  1I4W A;  3U5Z B;  5H37 D;  3KOY E;  5DYG A;  1L2D A;  5EXX A;  3VLF B;  3A42 A;  1MU5 A;  2R45 A;  3SHG B;  3ILK A;  1DGB A;  1HT2 E;  3CF2 A;  4DR7 M;  4IJE A;  3GP1 A;  1FNN A;  4RF1 A;  1T3T A;  4MH0 E;  3GPP A;  2ZM6 M;  2LNH C;  1J5E M;  4M9S A;  3GLF A;  2FNA A;  3M7G A;  3QWL A;  4R7G A;  3T15 A;  4AG6 A;  2EO2 A;  5C1B A;  4GHA A;  5EP3 A;  4L16 A;  3DZD A;  4I8O A;  4LJ6 A;  3FUU A;  3KDS E;  5BR8 M;  3FKE A;  2DZO B;  3M0E A;  4PD2 A;  4IBE A;  3JR5 A;  2D7H A;  4M9Z A;  3U61 A;  4IBD A;  5EXT A;  4DV4 M;  3RFW A;  3D8L A;  4DR6 M;  2DWL A;  3GLH B;  4G4N A;  3KS8 A;  4KOD A;  5EP1 A;  1K82 A;  4AQY M;  3ZCB B;  4PCZ A;  1N78 A;  4W5W A;  3AV0 A;  1IXS B;  2BJV A;  1HNX M;  1KYI A;  4GKK M;  4JI0 M;  3VK8 A;  4I81 A;  4GC5 A;  2M5Z A;  3TL4 X;  1XMQ M;  1IQP A;  3U6S A;  4DR1 M;  4GHL A;  3TE6 A;  5ITR A;  3GPU A;  2HHH M;  2ZAM A;  4KO8 A;  3PNY A;  3SAV A;  4DV1 M;  4JI2 M;  4ZPX A;  1DGF A;  3GQ3 A;  1IY2 A;  4GC9 A;  3SAW A;  3FTE A;  3U6L A;  4B3T M;  2I7N A;  5KPT A;  3FUV A;  1Z6T A;  3A45 A;  3EIH A;  4M0W A;  4JN6 A;  4MGY E;  3SYK A;  3TWM A;  1W5T A;  5FLX S;  3FD9 A;  4NSO B;  4LFB M;  4B7H A;  1IN5 A;  3GLI B;  1YE9 A;  4DR5 M;  3IG8 A;  4PDG A;  1GLN A;  4FW9 A;  4ITQ A;  3VKG A;  4D81 A;  3SAS A;  2V6Z M;  1G59 A;  2D7G A;  2KXE A;  2R65 A;  2R62 A;  5EXS A;  1D2N A;  4JXJ A;  3H4M A;  2E5L M;  3E4R A;  3FYC A;  4GIT A;  1G41 A;  3OTO M;  5ITX A;  4JI7 M;  3FUW A;  3R8F A;  1OFH A;  2XZU A;  4AKG A;  2CHQ A;  3J81 S;  1QAO A;  3KP1 E;  1IM2 A;  3LVW A;  1UM8 A;  1IBM M;  4B3R M;  1Z5A A;  2QZ4 A;  4B7F A;  1SXJ E;  1QAM A;  3A46 A;  1IN8 A;  4FCW A;  4JI6 M;  4LZJ A;  1G3I A;  1DGH B;  1JR3 A;  4AKI A;  4LRT A;  1N77 A;  4L4U A;  2ZAN A;  4MGH A;  3HU1 A;  4JI4 M;  3NWL A;  2L6O A;  1XMO M;  3U60 B;  4OVZ A;  2UXB M;  1KSF X;  2Z4R A;  3HJS A;  5EXP A;  4LFA M;  5KO3 A;  3U5Z A;  2CE7 A;  3HHY A;  4G6Z A;  3U6C A;  5ITQ A;  1EE8 A;  2QEN A;  5FTJ A;  1QAQ A;  2C5R A;  2UUA M;  2XSZ D;  2XFT A;  3HWS A;  3J27 B;  3DOA A;  1QVR A;  1IBK M;  2ZBK B;  3B9P A;  3LVV A;  4IBF A;  4LF4 M;  2QP9 X;  4AZF A;  3J7B A;  4AI6 A;  1NHG C;  2R46 A;  5IRE B;  3AJI B;  3L29 A;  4X66 M;  1HR0 M;  4CIS A;  3VFD A;  1L1Z A;  2CV0 A;  2Y0Q A;  3HJQ A;  3GO8 A;  2R4J A;  3THG A;  1GKI A;  4YY3 M;  2OQ4 A;  1JQJ C;  1XC8 A;  1E32 A;  4OU7 A;  1J7K A;  3PFI A;  4MB7 A;  1XNR M;  2F4V M;  4NL4 H;  5F3W A;  4MGK E;  4JI5 M;  2YFQ A;  2C99 A;  1IN4 A;  2O5R A;  4II7 A;  2RGH A;  3SMS A;  4JI8 M;  1SXJ B;  1YUB A;  5FTL A;  3RE8 A;  5FTM A;  3GQ4 A;  3JR4 A;  3RGP A;  5FSW A;  4LG2 A;  4IIW A;  7CAT A;  4G4R A;  5DNY A;  2XZF A;  1QZM A;  3JAM S;  4LF7 M;  4LF5 M;  4GRI A;  1R2Z A;  2DWM A;  1E9S A;  1QAN A;  1ORY B;  1R7R A;  2C98 A;  1Z5C A;  2XF3 A;  3A98 B;  4I4L A;  4LF8 M;  4CGY B;  2X4A A;  2QBY A;  3GLG B;  2KZS A;  2F5Q A;  4DV3 M;  4JI3 M;  3GRU A;  4DV0 M;  1L2C A;  2F5S A;  3MJ5 A;  1XXH B;  4B3S M;  1I94 M;  1KFV A;  4BB9 A;  4IBJ A;  2DWZ B;  3HKP A;  2VQF M;  2KEB A;  3UZU A;  3U6D A;  1Q3B A;  4IJF A;  3SC3 A;  5JI2 E;  2YQZ A;  1DO2 A;  2J7O A;  2DHR A;  1NJG A;  1HT1 E;  1HNZ M;  2OPF A;  3SFZ A;  5EQT A;  1MX0 A;  3KOW E;  5JI3 E;  2UXD M;  3VKH A;  4IBC A;  2Y21 A;  3SYL A;  2D7E A;  2H1R A;  2KA6 B;  4D80 A;  3GLF B;  4K0K M;  3IG5 A;  4QOZ C;  1PJI A;  3KOZ E;  4OX9 M;  1R6B X;  2KZU A;  2C9C A;  3W0F A;  4B08 A;  3K2L A;  5EP2 A;  4JI1 M;  2VII A;  4Z8X A;  2KRU A;  4BLC A;  4QHS A;  1NY6 A;  4NOO B;  4AW4 A;  1IBL M;  3QAU A;  4AG5 A;  4B7G A;  2V1U A;  3L25 A;  1SXJ D;  3KXE C;  4QOS A;  2G5G X;  3ZC7 B;  4NRW A;  3K1J A;  1DGH A;  5ITX E;  3J7A S;  1DGG A;  1X37 A;  2FOI C;  1C1K A;  3DA1 A;  3TWK A;  4JYA M;  4DUZ M;  2UXC M;  4IBI A;  4G4Q A;  4Z6Y A;  4HLQ A;  2XLJ A;  3CF6 E;  3TQS A;  3DFZ A;  3GRR A;  1HNW M;  3M6A A;  4PDI A;  3U6O A;  2CV1 A;  1IXR C;  3I4V A;  1IY0 A;  2L7I A;  2XFS A;  5IWA M;  4LFC M;  3GRY A;  2CUZ A;  4LCB A;  3VDP A;  4MGI E;  2CV2 A;  3AL0 C;  3HHZ A;  3SAU A;  2HCB A;  5EP4 A;  1PM5 A;  5KPZ A;  3KS4 A;  4I5S A;  3L28 A;  2KW0 A;  4KLN A;  4LF9 M;  3BOS A;  1N33 M;  4XGI A;  5LMN M;  2AHM A;  1H6U A;  2K47 A;  4LRS A;  1N32 M;  1TH3 A;  1NHW C;  2HL7 A;  2LH0 A;  2FFJ A;  2Y20 A;  4RF0 A;  2CHV A;  4DV7 M;  3HGI A;  1VDD A;  3W0L B;  5KQ8 A;  5A2Q S;  5ITU A;  1L2B A;  1Q3C A;  2G8L A;  4A3V B;  4REZ A;  4KHP M;  1W5S A;  3HHW A;  4QNM A;  4LJ4 A;  3PVS A;  3VK7 A;  3SHF A;  2RGO A;  4FWD A;  4YHH M;  2XGN A;  3MK6 A;  3PNV A;  5DYI A;  3T1Y M;  5EJC A;  1ZQ9 A;  4LGM A;  4FVM A;  5E26 A;  2DZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...