2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
1SN8A 4B3TL 4JI2L 2KCTA 4APVA 4DR1L 1LUZA 1JJ2A 3LWLA 5DBCA 1S77D 4RPZA 3IRBA 4TQUS 1TWHH 4AQYL 1NK5A 4ECSA 1BPDA 3T5KA 3RJIA 2R8GA 3B0YA 1PH8A 2DKLA 5D46A 2ZM6L 3I4NH 2BHNA 3OW2A 3GTKH 4QJFA 1RYRA 3S24A 1EUJA 4QZ8A 2B21A 1QVCA 3GTPH 4O5CA 1IBLL 5L1KA 4A3BG 5LMUQ 1R9TH 3CPFA 5L1IA 3TANA 4JK1A 4NLGA 4YCWA 4ED2A 5KFGA 4FBTA 3RH6A 2UVWA 4ED0A 2JA8H 5IIOA 3MGIA 1KTQA 2XC9A 5HMLA 1IZ6A 4ECWA 4A3LH 4IQVA 3MDAA 3L7ZC 3Q8KA 1SKWA 4M9NA 1Q1EA 3C2KA 1XJVA 2FMSA 2UXBL 4OWWB 3ULJA 3HPOA 5DGBA 4XRHA 2JA7H 4LF5Q 1L0WA 1UFZA 1S3OA 8ICQA 2BPGA 2NRWA 5KFBA 1TWGH 4C8OA 3RLNA 4G3OA 2UUAL 2P6UA 4ECUA 3T6PA 3CPWA 1YITA 4Y52H 4RQ2A 3J7ZC 2F1HA 3Q8SB 2JY6B 4J9KA 1L3UA 1A62A 1SL0A 3IECA 3PIOA 1OKSA 4JI5Q 2BQRA 1COOA 1XB2B 1KC8C 5HMMA 3GLGE 3IM1A 2EQSA 4DEZA 1XPRA 3RZDH 4TUSA 1QLNA 1XTDA 4BXXH 1HQYE 3UXOA 3H4BA 1VQPA 9ICEA 3BDPA 8ICGA 1NBWA 2R7ZG 1X55A 3M9OB 2DNAA 1S0VA 1T43A 3A74A 2HHUA 5IIMA 2AHOB 4RQ5A 3C1ZA 2JUJA 1WJJA 7ICTA 4J9QA 2DAGA 9ICRA 3T1HL 3A5ZB 3UDXA 5KG2A 3UDFA 4YR3A 2LXJA 1NTGA 9ICNA 4RQ0A 3RJEA 3HOYH 5J0PA 2E2HH 3PF4A 5HHIA 3HOZG 3JPRA 3AUOA 4C3IH 2IMWP 4DUZQ 3OHAA 1Q46A 4X65L 2WB1E 3T1YL 8ICRA 5IYBG 3C5FA 1VCIA 4LFBL 2Z0SA 5KT7A 4DQIA 1SG9A 2EIFA 1Q81C 4KLQA 1VEKA 2AWNA 3SGIA 4F1IA 4R64A 2WAQE 2IHNA 4I2CA 3ETLA 4YWKA 5IYDH 9ICGA 4AYBE 8ICIA 5FJ8H 1T7PA 4YD2A 3T5LA 4DL7A 1E7ZA 2IT1A 1FJGL 3RB4A 2ZTDA 4ED1A 1L5UA 2HHWA 2VZAA 5KFSA 4JI8Q 2VQFL 4ZH4A 4M9LA 2MQHA 2PFQA 3FDSA 4B3SQ 3I4MH 1KLNA 4A3IH 1AIPC 1N32L 5L1JA 3HKSA 4JI1Q 2XY5A 2LTUA 2Y0SE 3ISDA 4DF4A 1VQGA 1XS9D 4EBEA 3CCEA 4RNNA 3S2HH 5J0XA 4YMNA 1SMXA 4O0AA 4Z6FA 2K0BX 3AEVA 2FPMA 4UQGA 2KFNA 1A63A 3RJKA 2W9CB 1HNWQ 2UXDQ 1TXYA 3F2DA 1CSPA 3QZ7A 3TFRA 5J2FA 5DB7A 4O2DA 5C0XG 4QZEA 3ISBA 9ICSA 1Q1BA 2E5LQ 3E2EA 1LYLA 1VQEA 2BCSA 5KT3A 4DV6Q 2V9WA 5J29A 1Y1WH 2FLNA 1EIFA 2JA6H 3K9PA 3S1QH 3TS2A 3ORYA 3RJFA 5EWFA 1EFWA 3GTJH 1VS0A 4B3ML 5J0YA 9ICMA 2NZOA 1YJWA 1IM2A 1C7YA 2HIXA 2B29A 5KFOA 3M85A 1UE7A 1XU4A 4YWMA 3MFIA 3JPTA 7ICIA 5CJ7A 3F8TA 4IJLA 3GV7B 4JBJA 3W1GA 1X9SA 4NXNL 4RPXA 3RLOA 4RT3A 2UUCL 5CP2A 1PYSB 4MTNA 2JA9A 3PX0A 3V6JA 4X62L 1YLAA 5J2KA 4B9MA 3PCOB 1HR0W 3GILA 1K0RA 4AIMA 2AJQA 5KG7A 5J0SA 5EAYA 4IQTA 4OWTB 5J2CA 2JA5G 1EFUB 4BY7G 1XNQQ 2I1QA 4HJ5A 2B63H 5KT5A 2OOBA 1TFRA 4YY3Q 1JMSA 4PMWA 7ICHA 1R4GA 8ICMA 5C5JA 3UE0A 7ICFA 1BPXA 3OHBA 1NJIC 1RPLA 3IHQB 4I2GA 1XPUA 1D7QA 3CCLA 3RAQA 1IL2A 5DQHA 4DF8A 3OTOQ 2I5MX 4J9NA 1HT1E 4MFFA 4RUCA 8ICVA 5KFHA 2KTQA 2KNAA 4BBRH 4DV7Q 3DM3A 2D62A 4I2HA 4LF4L 1PZNA 3NTUA 4EYIB 2EKKA 2JEGA 3RJHA 4F4KA 3FE3A 1X56A 1QZHA 8ICTA 2BCUA 1DOQA 5KT2A 1N36Q 4F50A 1XO1A 1QTMA 5EWEA 1CUKA 4DR5Q 4LNQA 5KTQA 4UP8A 3BZKA 1IBML 4JYAQ 1JJGA 2DZLA 3ZDAA 5JJLA 5BOLA 5IP7H 1U45A 4UP7A 3UDGA 3AYHB 4DV1Q 4DR4Q 3H4JA 1ZQNA 4UBBA 4KN4A 1Z47A 4K4HA 1VQOA 4P4PA 2R92H 3H40A 4DFPA 2OOAA 4QWDA 2OWOA 3HW8A 1VQJA 2FPKA 3M4PA 3GDEA 4R4TA 4BDPA 1I94L 2MJ5B 9ICPA 1KYIA 3ZDCA 4JI3Q 3RN5A 3GIMA 3PMLA 4IRKA 2DPJA 5C4XH 1VQ7A 4C3HH 2WAQG 4YMMA 1FVIA 1GVPA 4R8UA 3N97B 4A3FH 4BXOB 3I55A 2ZJ5A 4PZ7A 9ICKA 2HHVA 1KFDA 3EPGA 5LMUL 2K4KA 2JEFA 5H1SE 3LCUA 2L15A 3HOZH 3RAXA 4XA5A 2ASDA 2JK8A 1HZAA 2VA3A 1EWIA 2HVHA 3GQCA 2K5HA 4KLHA 4A3KH 9ICAA 4LF6L 1T6OA 4UAWA 1VQNA 2YTVA 2P6RA 4QWEA 4LF5L 2KHHA 1Z9FA 4NY8A 3L0OA 3J81i 2PFNA 4ELTA 3G6XA 3FP9A 2BGWA 2XY7A 4EBCA 4CCHA 4I2BA 4M04A 2EXDA 4M47A 5KFAA 1ZETA 3MGHA 2DAKA 2NRTA 4DV2L 2FLPA 2UXCQ 5IINA 1RYSA 4GN4B 2VANA 2ZTEA 1Q02A 2NRXA 3STBC 1V9PA 1S76D 1ZQWA 7ICOA 4EYHB 4GKJQ 2CWPA 4FDBA 4NM2A 2Z6KC 4DR2L 1LTLA 2OTLA 9ICJA 4B9UA 5J2BA 1YIJA 1S40A 3KF6A 4HJ9A 5CHGA 2GWSA 1E1OA 4DV3Q 3HKZE 1S9FA 2ZJAA 3FRHA 2P66A 9ICBA 3OJSA 1U49A 4KHZA 1WCLA 3CAMA 2RHQB 2I0QA 1SLJA 3KHGA 3RBDA 4L5SA 2JY7A 5KFIA 4BA1I 3L2PA 4F2LA 5M5XH 1X2IA 1NJXA 3TAPA 1DV0A 4DQPA 9ICWA 4K0KL 5C44G 1IBKL 1N34L 3MDCA 4JBKA 3HOWG 1SL1A 3CXCA 3Q8QB 7ICKA 5DKWA 3G6EA 2IBKA 1TAUA 2IX1A 4M6WA 4L5TA 4YFKA 4KLDA 1DGSA 2ZJ8A 2HHQA 5J2AA 5DG8A 2LYHA 1S0NA 4Z6CA 4JI7L 2JP7A 1BGXT 4K4IA 5DB8A 4P2HA 1VQBA 2MNAA 2VA8A 1MIUA 5GAGC 4B9TA 5J2EA 2J6TA 4R4QA 4Q43A 1UE1A 4Q8FA 4NXML 4NXZA 5GADC 4YP3A 1JXEA 1HNXL 4LFCQ 2GVBA 2XGQA 1ZJMA 1W2BA 5K36G 4P72A 1MC8A 1WYDA 5DB6A 2VL6A 3NELA 5JEAJ 1ZQPA 3JPNA 5C4JH 1VDLA 5D49A 4C8KA 4BY7H 4GNXA 3FKIG 1ZMVA 4GXIA 2UUBL 1KRPA 3QEBZ 2NN6G 3PV0A 2AGQA 3H3VH 1YBYA 4DR6Q 2BH2A 4F4ZA 4GN3B 3BQ0A 2BDPA 9ICVA 1X3GA 4TVAB 1KXLA 4I28A 4ALPA 3RZOH 1RL2A 3BQ2A 4GEWA 3PO5A 1ZMWA 1ZQFA 1VQ4A 5IWAQ 1X9WA 2ATWA 3UXPA 3KHRA 1D9DA 2FMPA 3V6KA 4FS2A 2MAXA 4YHHQ 3PO3G 2BCQA 4O3QA 1U9LA 4H02A 3TI0A 3PUWA 4NLNA 2E5LL 4R4OA 2IY5B 3EZ5A 1TVAA 3CMAA 2KBNA 3HOVG 2UU9L 5L9XA 1X6OA 1Y1VH 4P4OA 5DQIA 1I6HH 5CR0A 3BU2A 3M4OH 1B43A 3V7JA 3D31A 2ALZA 1CEZA 4IFDJ 3B0XA 1WJ7A 3JPPA 2BH8A 4K4GA 2VS1A 4LF7L 1WGNA 4KLFA 4BY1G 4G3IA 1AE2A 1K9MC 1K3RA 1ZQGA 1BBWA 3MXNB 2JY5A 2HHHQ 5KFRA 4A3EG 1V92A 3BZCA 5GAHC 1VQ9A 3TQYA 4KLKA 9ICOA 3SI8A 3CC7A 4KI0A 4M9HA 4F93B 4F92B 2R8HA 2FXQA 2JEAI 5KFJA 4IRCA 3HT3A 2KN7A 4RMFA 4JWMA 2LVPC 4JV0A 4DAMA 9ICIA 1EYGA 4DL3A 4KLJA 4LF8L 5KG1A 4FS1A 4TQRA 1HR0Q 2FLLA 4KLIA 1K1SA 3AU6A 1GKHA 1GO3E 4YR0A 5HGQA 3PX4A 2VY3A 1XMOQ 4ECQA 3J7A5 3PW5A 1NK7A 1OAIA 2A1AA 4BXOA 3G48A 4F91B 2FPLA 1S0MA 3GIJA 3QE9Y 3PX6A 4DQSA 3OTOL 3RBEA 1ZQJA 1XPOA 3Q8LA 4IR9A 2N8NA 1UA0A 5EWGA 1P8LA 4HIKA 2ES2A 5KG3A 4RQ6A 4WJ4A 2W9BA 1UE6A 3CC2A 2KFZA 1HUOA 4HIOA 5IYCH 4R8UB 3RR7A 2NVQH 1N36L 3SV3A 1VQLA 2BWBA 2FMQA 2XGTA 3BBZA 4KTQA 3H4DA 4I2EA 4JYAL 1KQSA 5GAEC 5HP4A 3GLHE 4DFJA 4DSKA 4X66Q 4DK3C 2PI2E 1KRTA 2MUTA 3C1YA 9ICHA 4YXJA 5FLXc 1C0AA 3CCQA 3S1NH 4DSFA 1KFTA 1NV8A 3PR5B 2F52A 2HHSA 2L2DA 3M9NB 4DS5A 3TQ1A 2CFMA 2JQOA 2YYZA 2QEXA 3GIIA 1ZQYA 4UB5A 4RQ1A 4ELUA 2DAEA 3CCSA 1QVFA 2LVQD 3PW7A 3I2ZA 4DSLA 4M9JA 1X65A 2BA1A 4DFMA 3F1ZA 3HOXG 4A75A 4JI3L 2R0IA 4F5RA 4GNXC 1F4IA 8ICFA 4A3MH 4JV5Q 3J81j 3RR8A 4KHPQ 1AROP 2IHFA 4RQ4A 2GVAA 1L1OA 4MF2A 3PUVA 4B9SA 2CQOA 2ZUBA 3GD7A 1WCMH 2I5HA 4B3RL 1LB2B 2RCNA 3M8SA 2JZBA 2HW3A 5IP9G 1VQHA 5HHHA 2ALYB 5GROA 2R8JA 4J9MA 5C44H 1XWLA 3GLIE 1G3IA 2XCAA 2LXKA 2R93G 2MO0A 1A8VA 1ZQVA 2DI0A 1M90C 5KG6A 3KF6B 5FLMG 1J5EQ 4IQUA 4IOCA 2H5XA 3PY8A 3PUYA 3J80c 4KLTA 5DQGA 1QUQA 4JI0Q 1LV5A 3OSNA 4DR3Q 1WCNA 3TARA 2ASJA 4EBDA 3RH5A 2NVYH 3H15A 8ICJA 3PF5A 4YQWA 1HNZQ 4MFCA 4BWJA 1MSWD 2DPIA 5D4BA 1JXLA 1XSLA 1DO0A 3S16H 2DAMA 1P3QQ 3C5GA 1TWAH 5DLFA 4PPXA 3RLFA 4M6WB 2UXCL 3PR4A 2ZTCA 3I56A 2RDJA 4GOPC 2NVTH 4ELVA 3AFQA 4QZAA 4X64L 1WR1B 4JI2Q 4B3TQ 4GKJL 2LSSA 4DR1Q 5KFPA 5KT6A 2AGOA 2NZHA 1L2FA 3NEMA 4AQYQ 1TK5A 4UN2B 4DV3L 1CKNA 3AFPA 2ZM6Q 2XCPA 4PGYA 3TRZA 2KNVA 4A93G 5DG7A 3MBYA 1CSQA 4RUAA 1BVSA 1X9NA 4A3CG 4YCXA 2BR0A 4DV0Q 3S17H 3T5HA 3HP6A 3UXNA 3PO3H 3K81C 5L1LA 4Y7NH 4GNXB 2Z6KA 2JY8A 3MABA 5J2JA 5KFTA 4DSEA 1YHQA 3HOVH 4A3GG 7ICJA 4A3JG 4GKKL 4DLGA 4QQBX 3H8JA 1G4AE 1ASZA 4DV4Q 3GFKB 2VQEL 4DV5L 1I5FA 1WOCA 2HWJA 2UXBQ 4BY1H 4KLUA 3OSPA 1G41A 2OO9A 1X9MA 4A3BH 4QW9A 3S2DH 3KJPA 4A3EH 3PIPA 4QZBA 3KHHA 3UDIA 1XMQQ 1L3SA 3RJJA 4RQ7A 1QSSA 1TAQA 5F9LA 2Q2TA 1WFQA 4LUOA 1GD7A 4EZ6A 1MJCA 2A8VA 2AGPA 2HHTA 4JI6Q 1VQAA 4LFCL 3B6YA 2PFPA 1B22A 3UQ0A 4F4XA 3PUXA 2M9NA 4YVZA 1QVGA 5J0OA 5ELOA 2PXIA 1XXHE 1ZQOA 1Q86C 1Y8GA 4TUPA 2CKZB 9ICUA 1UT8A 2YTXA 3K7UC 1N8RC 4DNIA 3ZDBA 3M3YH 5JEAG 1ASYA 2R8IA 2YTYA 4F5NA 1UEBA 1NMFA 3PMNA 4IR1A 4DOCA 1LM0A 1L1OC 1ZQAA 4OX9Q 3DLLA 4DR6L 4GOPB 2K75A 1CKOA 2R7FA 1PH7A 1PGYA 3E9IA 4POFA 1OTCA 5J0QA 3CCMA 4C8MA 2BKEA 1PH6A 1U0LA 3MR6A 4Q44A 4GC7A 3KYHC 3LDAA 1TR8A 1WHCA 5IWAL 4I2DA 3C2LA 1NMGA 2WB1G 5CB1A 2R7DA 4YHHL 4KLLA 2QSFX 2AWOA 7ICMA 4BGDA 3ULLA 4IQWA 2ID0A 4TURA 4JBMA 1QZGA 1RXWA 2R7ZH 4TUQA 4LUZA 2HQLA 4GS3A 5EOZA 3E21A 5J2HA 2LVOC 2ATLA 4M2YA 2JA8G 4HJ7A 1PH4A 4AYBG 1QSLA 1NKCA 4EZ9A 1VQCA 3T1YQ 5KG4A 1U5KA 4OO1G 2VNUD 1VQ5A 1YEZA 1A76A 3RRGA 4IFDG 2J6UA 1ZQHA 4F5PA 2W9BB 1BPZA 1AH9A 4HIDA 2E8GA 4F4YA 1IM4A 2V4RA 4QWCA 2R6GA 4YG2A 3KTQA 1WGLA 1ZQCA 1G51A 2ZUCA 1FJGQ 5IYBH 1B8AA 1SROA 3CQZH 2Y0SG 1NJWA 3U50C 2VQFQ 4YR2A 2DGYA 2MUTB 2C2RA 4YD1A 1SE8A 3F2BA 3GTLH 4OWXB 1HT2E 2ISOA 4C2MH 4JBWA 5IP9H 1RXVA 1HR0L 3EW9A 8ICEA 2YV5A 3GV5B 4YCUA 3THVA 1AE3A 4IPGA 5DFLA 4RT2A 1TTEA 1VQIA 7ICEA 1XMOL 2V1CC 1KFSA 1Q8KA 2R93H 5IILA 3V72A 2A1JA 1D9FA 8ICKA 4FO6A 1SZPA 4QZGA 4KLEA 1JT8A 9ICLA 4JI5L 2Q2UA 3H3VI 3I4OA 2LVAA 2Y1IA 5IE8A 2E2IH 1ZQTA 1C9OA 9ICXA 3MEFA 2PMZE 1L1OB 2L4EA 8ICCA 2I5LX 1UE5A 2OCEA 5BR8Q 1ZYQA 2HT1A 2JZBB 4R4CA 4DAYB 3Q8DA 2LVNC 5HY6A 3BQ1A 3CC4A 1X54A 3UQ2A 1KAWA 3G6YA 3MMPA 4DK6C 1BPYA 4O9MA 3RJGA 3PVXA 3TFSA 3OGUA 3KHLA 2EJSA 2ZJPA 2K52A 1OQYA 2N49A 4DPGA 4HEOA 2W9MA 2XGPA 3JPQA 8ICHA 4DO9A 2BCVA 2K9DA 2HIVA 2AQ0A 1QUQB 1TKDA 7ICQA 5DG9A 2PI2A 4A4IA 2JZ0A 3A5UA 5LMNQ 5DBBA 8ICZA 3GO5A 4QIWE 5FJ8G 2W8KA 5KFUA 4C8LA 4DUZL 4X62Q 3RRHA 4LFAQ 4Q8EA 8ICBA 4YCVA 5DLQE 2HVIA 5DBAA 4DSJA 1N9WA 4PHEA 1YHBA 4PHPA 4LZGA 3FRIA 3PGZA 3I4MG 4A3CH 2C22A 4LWCA 1XSNA 1WIVA 1YJ9A 3E0EA 4I27A 1NK9A 2EKFA 3GDXA 3KOJA 2KZMA 1S0OA 2BPFA 4A3GH 4KMUA 4A3JH 4P4MA 3OYYA 5DDYA 2JA5H 4UB2A 1X3EA 2QGQA 2KHJA 4JI8L 2ASLA 3ZJYC 9ICTA 4ED6A 4B3SL 1EQQA 1J5EL 4ECVA 1CKNB 2N3SA 4LF4Q 4KITB 3RB3A 1VEJA 1N33Q 4DOBA 3PUZA 4JI1L 3F2CA 4P75A 1A0IA 4ECTA 3PW2A 4ED8A 3WWVA 4EQ5A 4QZ9A 4DR3L 5J0WA 4R65A 1IBMQ 4IPDA 2BQUA 4F2SA 1K1QA 2PFOA 2C2DA 1XNRQ 1PH5A 1HNWL 2UXDL 1RZTA 7ICGA 4O5KA 2D0PA 4E0DA 3NBHB 3T5JA 2AMCB 1HNZL 3LGJA 4DR7Q 5C3EG 5KFNA 5KFQA 4OXPA 5CWRA 5GQOA 4KLOA 1ZQEA 4QZHA 3K8AA 1JR3E 1S72A 2JEBI 2XO7A 5KFCA 3CMEA 4R1JA 4F4WA 4DV6L 2JEIA 2N78A 1U4BA 8ICYA 3KLWA 1QZEA 3S14H 1OXUA 1MN3A 5TZVA 2C28A 4DLEA 1Z00A 3MR3A 4WP2A 4X6AH 2E2JH 5CA7A 4NLZA 3N4MB 2HHXA 2CWAA 5KT4A 3MR5A 3CW2C 2BCRA 5IIKA 1HZBA 3PO2G 4O3NA 3HOUG 2WP8J 5DDMA 4F2RA 1UT5A 2NRZA 4GOPA 4BWMA 2B63G 4KLSA 2VA2A 4GXJA 2RDIA 4DV0L 3M9BA 2DAIA 3TEHB 4BBSG 2K5VA 1E94E 2C35B 2AKWB 2QA4A 4DL5A 8ICXA 3E9HA 3U4VA 4NPSA 3BJUA 3EWAA 3J80i 2D0OA 2NRVA 2IX0A 1EQRA 1SKRA 1XNQL 4J15A 4PHAA 4F5OA 1VQ6A 3Q8RB 1EIYB 2QHOB 2BPCA 4LW1A 3K75D 4BBRG 4DV4L 4LF6Q 4WJ3M 1J6QA 2CWBA 4YY3L 1RIPA 2IHMA 1MJEA 4O3SA 4IJHA 4HYKA 2HAKA 9ICCA 1O7IA 2MGWA 1SR3A 1VQ8A 4P73A 2CP8A 1XMQL 4JWNA 1TWCH 3CCJA 1KDHA 1D8LA 3JAMi 1JJCB 8ICNA 2F4VQ 4UAYA 5KFFA 3GTQH 4JOIA 4FBUA 4IPHA 4DV7L 4DV2Q 5JJKA 1E22A 5IP7G 3B89A 3H0GG 4JI6L 1V43A 5J0TA 1NK6A 3HKZG 1ZMUA 2R92G 2AU0A 1PA6A 4XQ8A 1NKBA 4DR5L 4JI4Q 5KFDA 1U48A 4DR2Q 2VUMG 5J0RA 4UP9A 4POGA 4DSIA 4F8RA 3ISCA 3CCRA 2QNJA 1DO2A 2B3GA 1ZQQA 4M9GA 4I2IA 4B9LA 4DV1L 4DR4L 5JUMA 8ICSA 3ZDDA 5LMNW 4OX9L 2DFLA 2NN6I 4A3DG 2ZJQA 1Y14B 3PV8A 7ICLA 4QL5A 4GN5A 4PZ8A 4IOAA 5C4XG 1VEGA 1M1KC 9ICFA 4B9NA 3M9MB 3K4GA 4O3OA 1TWFH 1WI5A 4A3FG 3RN2A 2IHEA 4MZ9A 4K0KQ 5M3FG 1IBKQ 1N34Q 1HH2P 1UWVA 2W9AA 1E1TA 1ZQSA 1YHAA 2KHIA 4O3RA 2V4QA 2DUDA 5KFKA 5J2IA 4IRDA 4LF9Q 4ECZA 2A1JB 1VQ1A 1VQKA 5M3MG 4JI7Q 4QY7A 4DFKA 4A3KG 4J9OA 3H8SA 4JCVE 1ZQUA 3JC66 3HOWH 4J9SA 3RNUA 3JPSA 4DOAA 3T3FA 2JNHA 1HUZA 1PV4A 1PH1A 2W8LA 3A0JA 3MFHA 2K14A 4NXMQ 4ME3A 3ULPA 3V7KA 4DUYQ 1QSYA 1HNXQ 1JB7A 2IA6A 3KDFB 4GLAC 5DLGA 3KJOA 3RTVA 2KZ3A 1MQ3A 1PH3A 2L4FA 4KLGA 1PH9A 5AJ3Q 4O3PA 3GTGH 3EIVA 1OXSC 4ECRA 2UUBQ 2K50A 3HFZB 8ICPA 1GO5A 4MFAA 4J9LA 4O0IA 3EPIA 3JAMc 7ICRA 3UE1A 4IO9A 2BQ3A 1ZV1A 4RNMA 8ICUA 5IIJA 1PYBA 1HJPA 1KHIA 1BPEA 1Y88A 3FKIH 3VDYA 2MO1A 3TS0A 9ICQA 4DL4A 4RG1A 4I2JA 4GC6A 5KFVA 4ECYA 3TREA 1PHJA 1IFYA 3K7AH 2PQAA 1N56A 3RB0A 1NY4A 1YJNA 1TK0A 1NK0A 1HZCA 5BR8L 3K80C 4P71A 2DHYA 4RQ8A 2O25A 3UPQA 3EBEA 2XY6A 2UU9Q 1A5TA 4DQQA 3S15H 2OTJA 1OXXK 4HJ8A 3CP0A 1Q7YC 4LF7Q 4C8NA 3M8RA 5C3EH 3K9OA 3BQTA 4HIMA 1IBLQ 1K73C 3S1RH 3QEAZ 5BPCA 8ICWA 2MROB 3JPOA 1JE5A 5J2DA 3PO4A 7ICPA 4JOIC 3MR2A 2WTFA 3H7IA 5J3BA 3LK9A 1TV9A 5LMNL 1FL0A 2GN5A 4F5QA 3SV4A 3LWMA 1KSPA 4LVSA 5KG5A 4I29A 4UBCA 2RF4A 2XTIA 4LFAL 4LF8Q 5KFXA 2RHSB 3NGDA 3PO2H 5KFYA 3KF8B 3GV8B 3CF5A 3HOUH 3RB6A 1ZJNA 1I50H 5IT9c 4J9RA 1Q12A 2UUAQ 2K5NA 4OONA 4AH6A 4BBSH 4R63A 4F3OA 1UA1A 1KEJA 2A19A 3F92A 3GTOH 5J2GA 3W5OA 2F1IA 3G6VA 3V6HA 4JV2A 1Z00B 2F1JA 2PI4A 7ICUA 1KRSA 2PI5A 3ERSX 1BBUA 4PH5A 5M5YH 4A76A 4R66A 1PH2A 1NJZA 1JX4A 2UVRA 4QWBA 4UPAA 3CD6A 2OQKA 5E7NA 1G6PA 4C3JH 3QZ8A 4NB3A 1N33L 4LZDA 2ZUDA 3ZDEA 1VQMA 1Z3EB 4HJAA 1KD1C 4DBGB 1JMCA 4UAZA 1Y1VG 3I4NG 2JEJA 1XNRL 3T1HQ 2MR9A 1EOVA 3H8WA 4DR7L 3H0GH 3PW0A 1I3QH 1XC9A 1V1QA 2LBCA 3Q8PB 4TQSA 2JE6I 2CCZA 5C0XI 1ZQRA 2VUMH 1SL2A 1N48A 1T8EA 5KFEA 3C2MA 4DL6A 5KFMA 2I9GA 3PSIA 1VQDA 4A3LG 4YXMA 4X65Q 4YN4A 3C23A 1B7YB 2ZJRA 4LFBQ 1NKEA 4ED7A 1CKMA 4QWAA 4JC0A 5BOMA 1NV9A 1ZQDA 4A3DH 4MF8A 2JA7G 2HHHL 3RR5A 8ICLA 4B3RQ 2WZJA 4P74A 2Q0ZX 1ZQLA 4UY8C 4XUSA 1ZQKA 3KFUA 5M3FH 3HOXH 5F9NA 4XTCS 2G3QA 3V7LA 4PHDA 4X5VA 2AQ4A 4JUZA 5HNKA 5ELNA 1JIHA 3GTMH 4KN7A 4QW8A 3SZ2A 1NE3A 3GLFE 1N32Q 4DL2A 4RZRA 1KIXA 1VQFA 5M3MH 3G71A 4ECXA 1D8YA 3G4SA 1YI2A 1T9HA 1IXRA 3NENA 4BXXG 4Z6EA 4Q45A 4PGXA 5IYCG 4MEYA 3PNCA 1NK4A 4R4IA 2KENA 5FLMH 5C0XJ 1Q82C 2J6SA 4EX5A 1P16A 1S10A 1G291 2F4VL 3ZD8A 5JJIA 1PFSA 4I2AA 3PW4A 8ICOA 4DWIA 4NM1A 3CCVA 1KL9A 4DKAC 2DENA 4MEXA 4JG2A 2Q2HA 2YU9H 3RH4A 4NLKA 4BA2I 1K8GA 3EYZA 4O5EA 4X64Q 4RQ3A 3AQQA 3I7FA 3KDFA 1IYJB 4R71A 3HOYG 3E46A 2JZ1A 4JI4L 4GLXA 1H95A 4EEYA 4L5QA 4I2FA 1XSPA 1MKHA 2Y1JA 1T4GA 4B3MQ 1ZQMA 4Q7JA 4RPYA 4X66L 4L5RC 1TK8A 3D0FA 2WFWA 2RRUA 2C2EA 4QZDA 1E24A 4LUVA 5KFWA 2KZZA 2MFIA 4DQRA 1GM5A 4A3MG 4GLVB 3FHWA 2B3TA 1L3TA 4KLMA 1WCMG 1U47A 3K0XA 5IYDG 4NXNQ 2UUCQ 3M7NA 4DS4A 2VW9A 4QZCA 3C21A 3U4ZA 4YWLA 2KCMA 2W9CA 1EXNA 3U58A 1OXVA 3OJUA 2KNZA 4GKKQ 3LCVB 4QZIA 4JV5L 4KHPL 1T3NA 8ICAA 4A93H 1YZ6A 1MQ2A 1YNXA 2VQEQ 3CCUA 4DV5Q 2R8KA 4A3IG 1PVOA 2BWEA 4LF9L 4GXKA 3EN2A 3TAQA 4YMOA 5J0UA 3FYHA 1H38A 2Q2IA 4QZFA 4UB1A 1SRUA 3STBD 3AU2A 3ZD9A 1YVCA 3IHPA 2PQAB 3GIKA 1W3SA 2F3IA 4ED3A 3SYZA 7ICSA 3ICEA 2OQ0A 4OO1I 5DGAA 4QGUA 1ZQIA 5M5WH 4PG3A 5JI2E 1FGUA 1ZQBA 4IFDI 3W1BA 1IXSA 4DUYL 5DB9A 1ZQXA 3Q8MA 5KG0A 5KFLA 1OTRA 1B70B 2ASBA 1ZQZA 1NOMA 3M4QA 4M0AA 4JI0L 2UVUA 1L3VA 1OXTA 1A77A 1NJYA 7ICVA 5IY0A 1SFOH 2ISPA 5AJ3L 2UVVA 2BA0A 4PZ6A 1NK8A 1Y1WG 3J81c 2JA6G 1S97A 4JV1A 5KFZA 4RNOA 1X3FA 3HWTA 3HX0A 2JJQA 4MNOA 1BKBA 1HZ9A 4Z6DA 1SKSA 4IPCA 1K8AC 3ER0A 2NVXH 4B9VA 5IIIA 4UB3A 1BPBA 1JN3A 1E3PA 4XIGS 2PNHA 3BJYA 7ICNA 1VG5A 4PGQA 4RU9A 1I94Q 4UB4A 3S1MH 4J9PA 1K83H
chains in the Genus database with same CATH superfamily
3ONNA 4APVA 3C58A 1JROA 4ULLA 5DBCA 4XT3B 4TQUS 1NK5A 4ECSA 3RJIA 3NVVA 1DGFA 1MX0A 3GTKH 3GRRA 1RYRA 2B21A 1D1KA 4A3KB 2O6KA 4NLGA 4YCWA 2CRXA 2F0UA 3RH6A 4ED0A 2JA8H 4ECWA 4LFCM 3FUVA 5I9OA 3Q8KA 3SAVA 1Q1EA 3ULJA 3QG1A 3HPOA 3H3VC 4LF5Q 1KABA 8ICQA 2HL7A 2BPGA 4C8OA 4G3OA 1EY8A 4ECUA 3TQSA 4FWDA 2PCFB 3T6PA 1SWVA 1YITA 4OW0A 4Y52H 2F1HA 2KD1A 2EYFA 3SVMA 3PIOA 5ALQA 2BQRA 3H4MA 5KPZA 3RZDH 4FCWA 1SXJC 4IS7A 1G2TA 3I3CA 2AHOB 2G07A 1D5MC 2F0TA 3WK9A 2HHHM 1KNEA 1PUZA 3HOYH 2E2HH 3PF4A 3JPRA 2IMWP 4X65L 4LFBL 5KT7A 4UATA 1TU2B 3SGIA 2WAQE 3ETLA 4AYBE 5FJ8H 3VDPA 4FD2A 3T5LA 1FJGL 4FWHA 4V190 4GRIA 1Z1VA 4LJXA 3FDSA 5ALRA 2JH7A 1KLNA 2K5DA 1LTMA 4IZ8A 4MH0E 2XY5A 2LTUA 4L8RC 2Y0SE 2KCCA 1SV4A 5D3IB 3CCEA 4EBEA 2N1RA 4YMNA 3C3LA 3TBIB 3AEVA 2FPMA 4IBFA 2KFNA 3RJKA 1HNWQ 1Y1VB 2Y9TA 3NVYA 5J2FA 5DB7A 4LMQD 1SXJB 1LYLA 3DXJC 2J4XA 1C1KA 3T16A 4BS9A 3BQ7A 2FLNA 4ZYSA 1IY0A 4MGKE 5EWFA 1EFWA 2D5DA 4RQNA 1C7YA 2OM6A 2B29A 3S6JA 5JOBA 1WYGA 5KFOA 3M85A 3L29A 3U6MA 4YWMA 5A0LA 2GLEA 4IJLA 3GV7B 4JBJA 2IPKD 5G5HA 4NXNL 4RT3A 2RSOA 2JA9A 3PX0A 2F0PA 3MEHA 2EZYA 5J2KA 4O1NA 2AJQA 5KG7A 5J0SA 1J5EM 5EAYA 1M8AA 5I6WA 4JI1M 3FPPA 1R4GA 2KOLA 1BPXA 2XN9C 4L78A 2NVQB 4I2GA 3HS0C 2AXTU 3MXNA 1D5XC 5KFHA 4EQOA 3DM3A 2D62A 2WACA 4HR7B 1PZNA 5FTKA 2JEGA 1QZHA 5KT2A 1N36Q 5JPNC 1L8QA 5EWEA 1CUKA 4DR5Q 4LNQA 4NOOB 5E79U 1ZRNA 1N78A 5IP7H 1PTOD 4UP7A 3AYHB 2KQ3A 3H4JA 4ZUJA 2F0OA 5FOBB 1VQOA 2R92H 2OOAA 4QWDA 2VB3X 3G6JB 1TT2A 3A8IE 3QU9A 2GA4B 2A5HA 1ZAEA 4RKUF 3J7AS 4P2CB 2G9HD 5C44B 5AM5A 2NO4A 3GIMA 4RKBA 3PMLA 1EEFD 4NRVA 3VYTA 2YFQA 4ZRZA 4A3FH 4BXOB 2Y20A 4C0ZA 1A0PA 2RDGA 1EOTA 3PZPA 4G57A 3MWYW 4RF1A 3LCUA 2RHFA 3RAXA 1STBA 1KDBA 1HZAA 2VF8A 1BOSA 3OPXA 3TN2A 4CDGA 1T6OA 2H3VA 3OOCA 4LJAA 4UAWA 1TWAB 1MI2A 3L0OA 3J81i 2NVTB 2PFNA 3FP9A 2BGWA 4CCHA 4I2BA 4LJ5A 2GQFA 4WJWA 4OX9M 3VA7A 2PPBC 4OJPA 2UXCQ 2A6ED 4GN4B 4NLCA 2ZTEA 5J1ZA 5AIBA 1Q02A 1RHPA 3STBC 4JVZA 4HAIA 4GKJQ 4NM2A 2RKSA 4Y2RA 2OTLA 4B9UA 2G06A 4HJ9A 5CHGA 1E1OA 4OIKA 5C5MA 5FK9C 3D2NA 2P66A 3NHHA 2E1EA 1U49A 1RD9D 2PYKA 2I0QA 5KFIA 4BY1B 4BA1I 5M5XH 2WINB 1NJXA 3TKAA 4DQPA 2WF9A 4K0KL 3KBBA 4R3DA 5C44G 1URJA 1N34L 3MDCA 5FO9B 4DAVA 1RQNA 3CXCA 4NDXA 2BDUA 1FJGM 4ACOA 4OJ5A 2ZJ8A 2WSCF 4X3TA 4JI7L 2JP7A 3OPOA 5DB8A 2R3ZA 4P2HA 1VQBA 5CRXA 1MIUA 5H37D 1S5FD 2J6TA 3KSJA 1WTOA 1UE1A 4Q8FA 4NXML 3KDSE 4NXZA 1L0XB 3CGWA 3U60B 2VXWA 5DB6A 1SYFA 2VL6A 2L09A 4BY7H 4GNXA 1B4OA 1G8ZD 1ZMVA 3B9JA 2KHQA 5IGBA 2NN6G 5BR8M 2AGQA 2B2WC 1EIHA 4DR6Q 4F4ZA 2HOQA 1UHUA 2O2LD 4I28A 2EAMA 2CHGA 1LT5D 2HUGA 3PO5A 1ZMWA 4FYDA 1VQ4A 5IWAQ 2ATWA 2PZUA 2FMPA 4FS2A 4YHHQ 1WD1A 3C1FA 4KJNA 2BCQA 1U9LA 3TI0A 3PUWA 2M00A 3EZ5A 2UU9L 2B8GA 1X6OA 4P4OA 1B43A 2ALZA 1RM6C 1QUTA 4LFAM 4K4GA 2F0QA 4BY1G 3MXNB 4MIUA 3SHFA 5KFRA 4CDCC 3TQYA 9ICOA 3SI8A 4QNRA 3RGSA 1STHA 2FXQA 4C2MB 5JTIA 3SK8A 2V1UA 5KFJA 4KD3A 1J2MA 3PNVA 4JWMA 2LVPC 2R93B 1EYGA 2E2IB 1GKHA 2DXIA 4C3JG 3PW5A 1NJGA 3G48A 2EE1A 1XWIA 2BZFA 4HIKA 1P8LA 5EXSA 2A74C 2ZIUB 1WWVA 3MHVC 3CC2A 2XIWA 4HIOA 1MA7A 1H9KA 2FMQA 1IN8A 2R4EA 3D8LA 2I46A 4X66Q 2PI2E 1UQVA 5FLXc 5C0YA 4QUFA 1TDZA 2WB1C 1NV8A 2NV3A 3M9NB 3TQ1A 2YYZA 2ZIWA 2DAEA 5J39A 2A6HD 5BN3A 2NUCA 2JR5A 4DSLA 1CTMA 3B74A 4O3MA 4PD2A 3F1ZA 3HOXG 4KK7A 1O03A 1U4MA 4GNXC 4M9SA 1Z4OA 4JV5Q 3RR8A 2XRQD 4A3JB 1PVQA 2IHFA 4MF2A 1UUPA 1WCMH 2CXYA 3ETRA 3U6CA 2JZBA 2ALYB 2R8JA 5ALMA 2R93G 2CV1A 3IFDA 4I4LA 4EVOA 2KZUA 1BBXC 2NBFA 3J80c 4P0PA 1QUQA 3ZYYX 1LV5A 1WCNA 2ASJA 5IOCA 1WD0A 2F0DA 3H15A 3PF5A 2DPIA 5D4BA 1EYDA 5GKNA 3WK4A 3ND8A 3QO2A 2ZIVA 3N7RC 4QZAA 4X64L 3JR4A 2EYJA 3NBIA 1VMCA 2LSSA 2WB1B 3IDWA 1L7MA 1RODA 3NEMA 4AQYQ 1AZPA 5CV7A 3AFPA 4PGYA 2KNVA 3MBYA 1CSQA 1BVSA 4H0LC 4YCXA 4B08A 2BR0A 4DV0Q 3UXNA 1PVRA 3PO3H 3SAGA 5L1LA 4Y7NH 4GNXB 4CIZA 1TKWB 2JY8A 1ESRA 1PTOC 4RKLA 3IL8A 7ICJA 5EJWA 1TWCB 1NZBA 4A3JG 4GKKL 2XZUA 4QQBX 4PNYA 2KEBA 4DK1A 2K89A 4DV4Q 4JI0M 2F4IA 1I5FA 2HWJA 5E4XA 1G41A 2OO9A 4IBDA 3ZQJA 3RF9A 1B3QA 4A3BH 2F0EA 3W0FA 3S2DH 1XMQQ 2FHTA 1L2DA 3RJJA 3QXGA 1QSSA 3OMGA 4OELB 3FAHA 3PSFA 4CJ0B 1VQAA 2QCUA 3NPPA 4YVZA 5ELOA 3UMGA 1SV0A 1N8RC 4HSPA 4B3TM 2HBJA 1ASYA 5JU5A 2R8IA 2YTYA 1VLBA 3PMNA 4IR1A 3MC0B 4UAIA 2L5TA 1Q3CA 4K6DA 2XEPA 1TQOA 1PGYA 4POFA 1OTCA 5J0QA 3VK7A 4EQNA 3FRPB 4GC7A 1ET9A 1TR8A 1WHCA 1NNLA 3T4AC 1IBLM 5AKHA 5ALPA 3BS1A 4US9A 4I2DA 2WB1G 5CB1A 4KLLA 2AWOA 4QB4A 3HOWB 1QZGA 4XDXA 4TUQA 2A6EC 4LUZA 2FMMA 4M2YA 2B6GA 1PH4A 1F2ZA 4EZ9A 1HA6A 3NS1A 5KG4A 1PTOB 3MHBA 1L7OA 1VQ5A 5B5EU 3GTGB 4F5PA 2F3NA 4CE6A 1CQFA 1OXJA 2V4RA 3UMBA 4QWCA 2ZXPA 4YG2A 1WGLA 3SHGB 2IOFA 3CQZH 2QB1A 1EY4A 4QIWF 1NJWA 4YR2A 3A8JE 2DGYA 2NZ1D 4YD1A 1GKIA 3L28A 5IZ7D 1QJOA 2RVLA 5G3LD 5CV8A 4JBWA 1RXVA 3EW9A 3K7AB 1H9JA 2XVSA 2F0FA 5DFLA 4DNRB 1TTEA 4KY7A 4C7YA 1XMOL 4BLCA 5IILA 4C4SA 2Q2UA 2D7HA 5IE8A 3MEFA 4A3VB 8ICCA 4F88A 1L2CA 2I5LX 3FYCA 2JZBB 3VFDA 4XQJA 2YX8A 3QWNA 3BQ1A 1BR9A 3CC4A 2L55A 4EEKA 3G6YA 3T1YM 4DK6C 3NRWA 1BPYA 2KZSA 4M0DA 1SAPA 2K52A 1OQYA 4Q5VA 1N61A 2XGPA 4KV6A 4P0PB 1QUQB 4QUCA 1LT4D 7ICQA 5DG9A 4CDDC 3JAMS 4LJ8A 3PNYA 1QANA 5KNIA 1N60A 2H3ZA 4BBSB 3DMUA 7CATA 3RRHA 2VQFM 4YCVA 5DLQE 2HBLA 4K2LA 2HVIA 3GTOB 3OWFA 1N9WA 5I2YA 1GL6A 3I4MG 3WHLA 4LWCA 1L0YB 3FUXA 2ZIVB 2R45A 2IOHA 1LTAD 3L2AA 3U9SA 4I27A 1W6KA 1D0LA 1PJIA 4A3GH 4KMUA 2F5NA 5DDYA 2CPRA 2JA5H 4UB2A 2QGQA 2PZTA 2KHJA 1X32A 2JV3A 4ECVA 2N3SA 1Z59A 3RB3A 1N33Q 1A0IA 5I6YA 3HU3A 4QZ9A 4DR3L 4B6JA 1IBMQ 4IPDA 3E9SA 2PFOA 3I90A 1XNRQ 1HNWL 1B0XA 1RZTA 2D0PA 4E0DA 3T5JA 2AMCB 1HFGA 2HSZA 4KLOA 1ZQEA 3KKAA 4K6LA 4RHRA 4NMZA 3AOGA 3CMEA 2UUCM 4F4WA 4AG6A 4X62M 1QZEA 3S14H 1OXUA 4NLZA 2HHXA 2G9DA 3BYYB 2EJFC 1SIJA 2L0CA 3CW2C 1ZD2P 5KPTA 2WP8J 3E58A 4BWMA 5M3MB 3UJNA 3KZIU 4BBSG 2K5VA 1E94E 3A56A 3E9HA 1IHZA 4KO8A 2F3VA 4NPSA 3EWAA 2D0OA 4GITA 3WOEA 3Q8RB 1UAPA 5COYA 3K75D 1LO5D 4LF6Q 1SNMA 2A6HC 4O3SA 4JWNA 1D8LA 2B2YC 5AK4A 2CHVA 4CJ1B 2F4VQ 1RYUA 2K47A 4N8FA 1J9OA 2Y21A 1PA6A 1NKBA 3KLSA 4DR5L 2N55A 5KFDA 1U48A 4DR2Q 1Q3VA 4USAA 3R2TA 1X3QA 3ZDDA 1U4RA 2DFLA 2JYOA 1EIJA 4QL5A 4GN5A 1RDFA 4IOAA 2J0TD 4B9NA 3M9MB 3K4GA 2KECA 3LVVA 1WI5A 4KMUC 1SXJE 1PZID 3CRKC 1IBKQ 5FTNA 1E1TA 2Z4HA 2KHIA 4O3RA 2V4QA 2DUDA 1G2SA 4ECZA 5M3MG 4QY7A 1DCZA 4LF5M 4DFKA 1LTTD 1AEXA 3H8SA 3OW7A 3JC66 4J9SA 3RNUA 2FINB 3E0JA 4PQXA 3A0JA 2K14A 3ULPA 4DUYQ 1QSYA 2XFTA 2KIVA 3KKAC 4GLAC 2CV0A 2L7HA 5ALTA 3EIVA 1OXSC 3FYDA 1YT3A 3GLHB 2VIIA 1SNDA 5KNCA 1ESFA 5IIJA 1KHIA 2DQNB 1Y88A 3FKIH 3VDYA 4I2JA 4GC6A 5KFVA 2N88A 3TREA 3GTKB 2KK0A 4G6ZA 2FOIC 1J7KA 1N56A 2D7GA 3RB0A 2L5YA 2W03A 4RQ8A 3EBEA 3NXWA 2JA8B 2V1CA 2OTJA 4CGYB 2C5RA 1TH2A 2YNMD 3BQTA 5A35A 3HG9A 2RDHA 3S1RH 4MGIE 2EYMA 1N75A 4Q0FA 3J81S 7ICPA 3NK9A 1HNXM 1BCPB 5D65A 1TV9A 5AM1A 4IL6U 2DWMA 4AKIA 1KSPA 4UBCA 3FTDA 4LF8Q 3WHKA 5KFXA 2SNMA 2UUBM 3NGDA 3L3OC 3KF8B 3CF5A 3RB6A 1I50H 2QCPX 5IT9c 3RZDB 2E5SA 2X4AA 4P0QB 4PCZA 1RG6A 3QB3A 3W5OA 4JV2A 1JALA 1O08A 2LHGA 1B44D 1JX4A 4UPAA 4ANRA 2OQKA 3PFIA 1F9QA 3QZ8A 4R9WA 2RKOA 4LZDA 4QJFB 3K57A 2F0MA 2K05A 3HOYB 1JMCA 4LF7M 4KY6A 2JEJA 1EOVA 4DR7L 4B7HA 3PW0A 4OJOA 2FE8A 2LBCA 3Q8PB 3I72A 5KFEA 3PSIA 2I9GA 3TWKA 1NKEA 4ED7A 2IX3A 1ZQDA 4A3DH 4MF8A 3UGJA 1Q3UA 8ICLA 1STYA 2WZJA 2LI6A 2K4IA 4ITQA 3GPXA 3KFUA 1OIPA 2OHFA 4XTCS 1YNND 5ELNA 2Q8RE 1JIHA 3PQIA 3G71A 4ECXA 2M5ZA 1X37A 1YI2A 1N36M 1F2YA 4Q45A 4MEYA 1PRTD 3ITPA 5C0XJ 1A3UA 4AW4A 1S10A 3PW4A 3CCVA 5KAFU 4MEXA 2YU9H 4BA2I 1K8GA 4DN4M 3KDFA 2OT2A 5FTMA 4C7ZA 3HOYG 3AL0C 4JI4L 4BB9A 1D6EC 4I2FA 4TUWA 1XSPA 5A2QS 3THGA 2B0CA 4X66L 4RPYA 5EP3A 2WFWA 4LUVA 1QVRA 3HGBA 4A3MG 4GLVB 2B3TA 3HOUB 1CFMA 3SFZA 2KCMA 4FXKC 2YB1A 1Y8PB 4JV5L 1YZ6A 5EKLA 5J8YA 5E6JA 4PMBA 2R8KA 1PVOA 4LF9L 4GXKA 3EN2A 3TAQA 1H38A 4QZFA 1YNJD 1BNPA 1X40A 1SRUA 1YVCA 3OWEB 3GIKA 1W3SA 3A7AB 4QGUA 3K5OA 1F2MA 3GLIA 3W1BA 2ICIA 4KN4C 5DB9A 3KLRA 2UXCM 1PZKD 4G4NA 1B70B 1NOMA 3GP7A 2UVUA 2HMXA 3NWTA 1L3VA 2R92B 2ISPA 3U6PA 4GKJM 2BA0A 1NK8A 5ELFA 1S97A 4TRDA 2K7VA 4KD4A 2QBYA 1X3FA 2DHRA 1VJ5A 4UB3A 3AL0B 2XIDA 4XIGS 2WSEF 1I94Q 4UB4A 3C46A 3N52A 4A3FB 4CGZA 1S5LU 1SN8A 1NHGC 2V4DA 1LUZA 1JJ2A 4LAAA 1S77D 4XQNA 4RPZA 4AQYL 1ZQ1C 3SE0A 1GABA 5D46A 3OW2A 1J97A 4L15A 2QB0A 1QG7A 1QVCA 3GTPH 4O5CA 1STEA 2F5OA 1GUSA 2AQ1B 3FTFA 3W67A 3CPFA 4JK1A 4MHEA 4FBTA 2UVWA 3MGIA 3CTWB 3I01M 2XC9A 5HMLA 4A3LH 1WVLA 4IQVA 3L7ZC 2H4OA 1BDOA 4M9NA 2FMSA 2I7PA 4OWWB 4XRHA 2JA7H 4IFDH 1YE9A 1IN7A 2M60A 3KOZE 5H2FU 2NRWA 5KFBA 4JMUA 4Z9CB 1TWGH 4LJ4A 3C2PA 5DYIA 4NP5A 1ONLA 2QDLA 5EE1A 1HXYD 4DR6M 2UUAL 3CPWA 4RQ2A 4OHJA 4J9KA 5IWAM 1OKSA 4X3KA 1COOA 1XB2B 2KUMA 1E9RA 1WTXA 4YHHM 1XPRA 2LKVA 1XXHA 2QKIC 1QLNA 1BCPF 1XTDA 2Y0TA 5M5XB 1HQYE 3UXOA 3H4BA 2XZFA 5J8YC 4KKUA 1W6JA 5KAIU 2R7ZG 3M9OB 2CW0D 1S0VA 5IIMA 4C1NI 2PKEA 1HHVA 2A3VA 3I4YA 7ICTA 2SEBD 9ICRA 3T1HL 3AQFA 4CKEA 1NTGA 4JPBW 4RQ0A 5KNDA 5J0PA 4C1NK 1RDPD 5AI5A 3AUOA 1Q46A 5EBDA 2WB1E 5C4ZA 2G5IB 4UDUC 1VCIA 5LL6S 4KLQA 1QUSA 3HHWA 4BY7B 2IHNA 2HQEA 4U673 5IYDH 9ICGA 1OUQA 2YMQA 1E7ZA 2JMGA 2BDNA 1PK1A 3R8BA 4ED1A 2VZAA 5KFSA 4BWGB 4ZH4A 2PFQA 4A3IH 3J7AV 2CRUA 1N32L 5L1JA 4JI1Q 1K0SA 3FDTA 4DF4A 4LJZC 4H44C 4RNNA 3S2HH 2K0BX 4B9WA 4UQGA 1A63A 4X66M 3F2DA 3QZ7A 4AP9A 1PJSA 5C0XG 4JK1C 2WFAA 5CBEE 5CEHA 2BCSA 4FO2A 3ALRA 5KT3A 4DV6Q 3KFUG 1Y1WH 5ALNA 4IBJA 3S1QH 1VS0A 4B3ML 4BX9C 5J0YA 3Q8GA 1IM2A 2YTUA 1S5ED 3GLIB 2DZNB 3PSPA 2E2DC 2B2UA 1XU4A 3MFIA 3JPTA 3GQ5A 1I4GA 2XNAC 2CHQA 1X42A 2JA2A 4MTNA 3V6JA 3J81E 3NRZA 4JI8M 3PCOB 1XXGA 1CA6A 4OWTB 4P16A 2KJ5A 4BY7G 2I1QA 4HJ5A 5CV6A 2OQ4A 2ZBKB 1JMSA 5C5JA 1EY7A 3NE5B 1XPUA 1D7QA 2UXDM 5DQHA 1FYCA 2B2VA 3OTOQ 2F8KA 8ICVA 2KNAA 4BBRH 1N5WA 4LRSA 4EYIB 1V8QA 2EKKA 4F4KA 2QB0B 4F50A 1XO1A 1QTMA 1YNNC 5ISRA 2RQ5A 3BZKA 1IBML 3K5LA 1EWHA 1T94A 2DGZA 3I28A 1ZQNA 2J7ZA 3DM1A 4P4PA 3H40A 2OWOA 4CF4A 3HZXA 1WCMB 4DV0M 1PRTC 3EIHA 9ICPA 3ZDCA 4BBAA 4IRKA 2JH1A 4DV4M 4C3HH 2WAQG 4MB7A 3HKZF 4YMMA 4FF1A 2RLTA 1FVIA 3UI2A 4YY3M 3NSWA 4WFN3 5KEEA 4EQPA 1XMQM 3GRVA 1EEID 3EPGA 5LMUL 5AICA 3DEEA 2K4KA 1XXHB 5H1SE 4HLQA 3OSOA 3HOZH 4QCLA 1IYVA 2DF4B 4XA5A 1EWIA 3A46A 5I2XA 3HX3A 3GQCA 9ICAA 4LF6L 1CHQD 2PMZC 2CEAA 4PJ0U 1VQNA 3QYEA 2KHHA 5FLXE 2YR0A 2PO4A 1SXEA 3MGHA 2B2UC 2FLPA 5IINA 1RYSA 1V1PA 2VANA 4RCNA 1YNJC 5AI4A 1S76D 7ICOA 4EYHB 1G8PA 4DR2L 2Q4TA 3M7DA 1JOQA 1HRJA 1C48A 1YIJA 2V6ZM 1S40A 5DNFA 2ZXHA 1OO9B 1GHJA 3GLGA 1S9FA 9ICBA 4KHZA 5A2QE 1PRTB 1PK1B 1WCLA 5T1GA 2RHQB 1ZOLA 4XT1B 3KHGA 2JY7A 2G08A 3GP1A 2B8FA 5EXPA 4A3BB 1DV0A 3QUTA 2B2VC 9ICWA 4N9PA 3S2DB 3MXGA 2L12A 2E8NA 1IBKL 3Q8QB 7ICKA 3VYSA 5DKWA 3G6EA 4CJ6A 3ED5A 4M6WA 5IIFA 1DGSA 4LG2A 2LYHA 1S0NA 4Z6CA 5JI3E 5GTHU 3AFHA 4K4IA 2F0LA 5ALSA 4U68A 3FKEA 1RU3A 4B9TA 1XTCD 4M9XA 4YP3A 2PMZB 1JXEA 5M9OA 2R46A 1UCVA 2XGQA 1W2BA 4P72A 3IAYA 3NELA 5JRTA 3JPNA 5C4JH 4Y2QA 2CQAA 3CKIB 5CV9A 3K1ZA 4GXIA 1NR2A 1KRPA 3BDLA 3QEBZ 1YBYA 2MRLA 4GN3B 3BQ0A 4TVAB 4DNTB 2Z3XA 2K28A 1QAOA 4UB6U 1KDCA 3U26A 3WOFA 3VC8A 4RA8A 1D9DA 3TP5A 3PO3G 4GHLA 2VDBB 4O3QA 1F9RA 4H02A 4NLNA 4FFDA 2E5LL 2FDRA 5EE3A 1TVAA 3R3OA 1L6NA 4OO1J 3P7JA 5DQIA 1I6HH 2OEHA 3V7JA 3SR1A 1R4PB 3CQZB 1ZQGA 2Y9UA 1BBWA 5GAHC 3CC7A 4F92B 2R8HA 1F9SA 1DOMA 1MSHA 2CW0C 4K5VA 1I4RA 3HT3A 4I65A 2XSZA 1DGBA 1DK2A 4JV0A 9ICIA 1IQPA 4DL3A 4LF8L 5KG1A 5EP1A 4FS1A 4FXDA 2EYHA 1HR0Q 2FLLA 1N33M 4YR0A 1Q3LA 1X9XA 1FD7D 2K04A 4ECQA 1NK7A 1OAIA 1IBMM 2NB0A 4IIWA 4CNQA 5JJZA 1XNRM 1KAAA 3ZC7B 3RBEA 1XPOA 1FFUA 3Q8LA 2N8NA 2F0KA 1CT1D 3NTIA 1O80A 2SDFA 5KG3A 5EBCA 4KX5A 4WJ4A 3VDUA 2KFZA 5F2DA 2KSOB 2RBMA 3AMUA 3PMFA 3F2UA 3HRDD 3UM9A 2AQ3B 3SV3A 4CBVA 3P75A 4KTQA 3SK5A 3H4DA 4JYAL 5HP4A 3GLHE 2ZAMA 3U5ZA 4YXJA 3KD3A 1H6UA 2IWHA 1KFTA 3ZH9B 1Q90A 2F52A 2QENA 2CFMA 1F2LA 1IW7D 1HTPA 3CCSA 1QVFA 3GQBA 1SEBD 3PW7A 3SC3A 4WORA 1LTID 4JI3L 4A3GB 3J81j 1AROP 2JA5B 3PUVA 2CQOA 2ZUBA 3GD7A 4Y2PA 1LB2B 3LYSA 1V1PB 4ZAIA 1Y69U 5CBAE 1VQHA 4J9MA 2JN4A 3CYMA 3F5AA 1QQ7A 1G3IA 5I9PA 2E8MA 2F4VM 1RKNA 4LY6A 5FLMG 3D2QA 2AUJD 3GLGB 4IQUA 3PUYA 4KLTA 1GHKA 4JI0Q 4KJOA 5KL1B 3OSNA 4EBDA 3LQQA 1HPCA 2NVYH 8ICJA 4YQWA 1HNZQ 3M4OB 4G4KA 3S14B 3FEWX 1JXLA 1OJLA 3S16H 4AI6A 1Z5AA 5C1BA 3A42A 3C5GA 3X3NA 2O5JC 5DLFA 3RLFA 4M6WB 2ZTCA 4GOPC 4FZLA 3MVVA 4DCCA 5JPMC 1WR1B 4B3TQ 1IBKM 3QWLA 2QKQA 2LMRA 4KHPM 1L2FA 2KW0A 4DV3L 1EQTA 2XCPA 4A93G 4ZKCB 4RUAA 3T5HA 3K81C 2PW5A 3QUQA 2Z6KA 3DEOA 3MABA 5J2JA 4DSEA 1YHQA 2BJWA 4GMQA 1T5XD 4A3GG 5K4LA 1JB0F 5TSSA 5JAVA 1K3BC 4DUYM 3B7QA 1N77A 3H8JA 5IGDA 4MTKA 1G4AE 3HJEA 3QJYA 1WOCA 2XVTA 3OSPA 1X9MA 5F3XB 4F71A 4A3EH 2W43A 3UDIA 4GZYC 1L3SA 2E8PA 1DXSA 4RFBA 5F9LA 1LT3D 2LHCA 4EZ6A 1MJCA 5ALHA 2W11A 4JI6Q 1LTRD 4LFCL 2PFPA 4DXFA 1S3SA 3N7SC 3UQ0A 3PUXA 5EPJA 2PXIA 5ALKA 1ZQOA 1A2TA 1Q86C 4ODGA 3AN1A 4TUPA 9ICUA 4REZA 1Z7TA 4MGYE 4JI2M 4DR1M 1NMFA 1O7ZA 1N5XA 4GOPB 3M6KA 1CKOA 3E9IA 1IKLA 3ONAB 5HGTA 3KW6A 4IBEA 3MR6A 5EP4A 5GTIU 4Q44A 3LDAA 2OEOA 1SSOA 3NP8A 3NUCA 4XQQA 2F0HA 3I4VA 4D80A 1QILA 2PMZF 4TURA 4FZNA 2RSNA 1GUOA 3A8KE 3HJQA 4Y2TA 2HQLA 3E21A 5J2HA 4HJ7A 2UXBM 3H91A 1VQCA 4U6PA 3T1YQ 4FZMA 4OO1G 1A76A 2QARA 1F77A 1MD2D 3URYA 4ZQ3A 1BPZA 1AH9A 4HIDA 4F4YA 2R6GA 5AKLA 1JI7A 1SROA 2VQFQ 3U5ZB 2C2RA 2Z1CA 3FKIB 2CVRA 3GTLH 4OWXB 3P1HA 2ISOA 5IP9H 1ZEQX 3U9OA 1AE3A 5CYUA 2NO5A 1QQWA 4RT2A 2G8LA 1KFSA 3NTHA 4FO6A 4QZGA 5KL8B 1C9OA 3M6AA 4K8JA 2L4EA 2EJMA 2WIIB 1ZYQA 3UMCA 4R4CA 3BOSA 3NVZA 3Q8DA 1E32A 1KAWA 3SAFA 3MMPA 1Y8OB 2YB4A 1GUGA 1ZD5A 3TFSA 2EJSA 2ZAOA 2F5PA 8ICHA 2K9DA 5AK5A 1TKDA 3D4WA 2JZ0A 3A5UA 5LMNQ 1I50B 8ICZA 1TY2A 2FE9A 3KXEC 5KFUA 4X62Q 4I8OA 4Q8EA 8ICBA 1GUWA 3DZDA 4LZGA 4CDFC 3PGZA 5CGKA 4A3CH 1E9SA 2W7PA 1YJ9A 1R4QB 4NKLA 3TADA 1NK9A 2EKFA 3KOJA 2KZMA 1CHPD 4P4MA 3BVGA 9ICTA 5E4WC 2J7NA 1TH4A 1EQQA 1J5EL 1ZKOA 2R62A 1LACA 4KITB 3PUZA 4JI1L 1XYIA 3F2CA 1AQ6A 3U6QA 5IGGA 3QUCA 1M4VA 3WWVA 4R65A 1K1QA 1PH5A 2X6GA 4O5KA 1DGGA 3LGJA 5KFNA 5KFQA 3WKAA 2A73B 1VMPA 3SAWA 4QZHA 3K8AA 4A3DB 3HWSA 4R1JA 4DV6L 5DEHA 8ICYA 1MN3A 2ZANA 1Z00A 5IT9E 1N62A 4WP2A 2E2JH 3SARA 1FO4A 4FXGC 2CWAA 1SE2A 3MR5A 5IIKA 2K8CB 4ZOHC 4O3NA 5DDMA 2B63G 2RDIA 3TEHB 4EIWA 2QA4A 4DL5A 4KLNA 8ICXA 2B39A 1NSFA 3MJ5A 3BJUA 4DFDA 2IX0A 1SKRA 4F5OA 1PLFA 1IW7C 4WJ3M 3IV6A 1RIPA 2IHMA 1IYUA 5EKIA 2YU9B 4P73A 3CCJA 3K1JA 3JAMi 2F5SA 1JJCB 8ICNA 4UAYA 3GTQH 2LYAA 3QAUA 4DV2Q 1E22A 1B9NA 1V43A 2TSSA 5J0TA 1GOZA 3OHXC 2YN4A 2OH2A 1I94M 2MSNA 3KOYE 3R93A 5KO3A 5J0RA 2QARB 2F03A 3CCRA 2QNJA 4IUQA 1CI4A 1ZQQA 2Y0QA 2QF7A 5LMNW 4OX9L 4A3DG 2ZJQA 2DWNA 3PV8A 7ICLA 1A3TA 1XO0A 5C4XG 1NJFA 9ICFA 1GXDC 1VF7A 5EQTA 3RN2A 3D2SA 1TVXA 4LRTA 1B50A 2WF8A 4J1MA 4HSVA 4IRDA 3F5EA 2KKPA 3MA2B 4UHVA 2Z9HA 4BUGA 2AQ2B 4A3KG 2Y0SC 4JCVE 1ZQUA 3JPSA 4LJ9A 4DOAA 1HUZA 1SJHD 2YMPA 3MFHA 2C9OA 2DNEA 4ME3A 1E2WA 1HNXQ 3WK7A 4Y28F 1HFNA 5DLGA 3KJOA 1PH3A 4KLGA 4L6TB 1PH9A 5AJ3Q 4ZKBB 1FEZA 2H3FA 1S5BD 4ECRA 1CM9A 2UUBQ 3HFZB 8ICPA 4MFAA 4J9LA 4B7FA 4O0IA 3JAMc 4CF3A 4X3SA 4LK1C 8ICUA 1QOHA 4D82A 1JCKB 4ECYA 1PHJA 1IFYA 1L8OA 4J03A 2PQAA 2HDMA 1NY4A 3GTPB 1YJNA 1NK0A 1IG6A 5BR8L 4P71A 2DHYA 3UPQA 3KP1E 2R6FA 3S15H 2K03A 5HR7A 3B7ZA 3CP0A 1Q7YC 4LF7Q 4HIMA 1K73C 2MROB 2GOLA 1NI3A 3JPOA 2JA7B 3PO4A 1R2ZA 3TSSA 4OVZA 3SENA 5T14A 1TWGB 1MJGM 4DAPA 3SV4A 4I29A 2Y0SB 1ILQA 4LFAL 3MZ5A 4LCBA 3U6OA 1SDFA 2RHSB 2CUZA 3DHQA 3HOUH 4PV1C 1BNZA 3DV9A 2DN8A 1MBYA 3NTKA 1AFPA 2A19A 5AM4A 1D2NA 3V6HA 1Z00B 2F1JA 2PI4A 1KRSA 2PI5A 4PH5A 4A76A 2UVRA 4QWBA 3CD6A 5LHY1 1G6PA 3IG5A 2R4JA 4C3JH 4DV6M 3ZDEA 5ALDA 1C8CA 3LQRA 5ALJA 1Y1VG 2XGNA 3EFXD 1DYQA 3RFWA 3H0GH 5ELBA 1I3QH 1XC9A 1V1QA 4XYQA 3V2TA 3I4LA 5C0XI 1ZQRA 1N48A 3C2MA 4WJ3B 4A3LG 4YXMA 4X65Q 1IKMA 3C23A 3C29A 4LFBQ 2YY6A 2JA7G 2Q0ZX 2WF5A 4A3IB 4HCSA 3VR4A 2HCIA 2K5WA 1EL0A 4UY8C 4O42A 3HOXH 5F9NA 1NNUC 4PHDA 5J22A 3S2HB 3OTOM 1CZGA 2WSFF 4KN7A 3GLFE 5KRUA 3S9WA 1KIXA 1LVHA 1I4WA 3FPUB 4Z6EA 4PGXA 5IYCG 3H0LB 5L1MA 1Y1WB 1SYBA 2K33A 3S1QB 3M0EA 1U4LA 1P16A 1PFSA 2HI0A 2KJ8A 1KL9A 4DKAC 3K92A 2DENA 4NLKA 2ERCA 2LS01 4O5EA 3I7FA 3SQIA 2DJFC 2JZ1A 1H95A 5DAUA 4EEYA 4L5QA 4ILWA 2Y1JA 2EJGC 4IBIA 4RCOA 4FCTA 4QIWC 4L5RC 5FLXL 2C2EA 1PRBA 4QZDA 3QU2A 4B3RM 2KZZA 2MFIA 1LV9A 3FHWA 1D8BA 1L3TA 1U47A 3K0XA 5IYDG 4NXNQ 1HIWA 2VW9A 3U4ZA 4G7HC 3U58A 3RUZA 1OXVA 1QE6A 3OJUA 2KNZA 4QZIA 4Y2VA 8ICAA 4DXGA 1YNXA 2HBKA 4A3IG 3E0FA 4BBRB 5KYIA 2BWEA 4C4RA 5J0UA 4E6IA 3LMMA 3PIP3 1JE4A 2N35A 2F1MA 2PQAB 2HDLA 1SE4A 1PM5A 1LABA 4OL7A 2L4NA 2OQ0A 5DGAA 1K3WA 2OPFA 5M5WH 4IFDI 3J80L 1ET6A 1IXSA 5KFLA 3M4QA 4JI0L 1OXTA 1A77A 3HEJA 7ICVA 5IY0A 1SFOH 1Y1WG 3J81c 2VUMB 3SR6A 4WW0A 5KFZA 4OVZB 3HX0A 1WUDA 4Z6DA 1SKSA 4IPCA 2NVXH 4B9VA 3SHLA 5IIIA 1I4HA 4HMIA 2EY6A 4C3HB 1VG5A 3S1MH 4QIWB 2MU2A 1K83H 4OIJA 2EO2A 4B3TL 1JOOA 4KN7C 4ME5A 4C56C 5BPVA 1TWHH 3T5KA 2R8GA 4CISA 3B0YA 2VQEM 1PH8A 2DKLA 4DV5M 2BHNA 3HOZB 2R44A 3P20A 4FP5D 1EUJA 4QZ8A 3M4YA 1IBLL 1QCKA 1R9TH 1EU4A 4ED2A 1KTQA 1A6SA 1IZ6A 3OTQA 2K6BA 2KEYA 1QZMA 1SKWA 2DWZB 1DRGA 4IBBA 2BDOA 5IODA 2FNAA 5DGBA 1L0WA 1S3OA 5AIAA 3B9PA 2LFNA 3L4PA 3RLNA 2PQEA 1LLRD 1D1IA 5ITUA 2WAQF 1F0MA 1I6VC 4AYBF 5AM0A 1EYCA 3LWEA 1L3UA 1SNOA 1SL0A 1KC8C 3GLGE 3IM1A 2EQSA 1LTBD 4DEZA 3RD4A 1ZXTA 5JVG3 4BXXH 3BXWA 1HA5A 2CE7A 3I91A 5TISU 2Y0SF 4ZPXA 1X55A 3ZI4A 3A74A 2HHUA 1NZPA 4C3HG 1FFVA 2JUJA 1MU5A 2DAGA 3A5ZB 3UDFA 4YR3A 2LXJA 3C28A 5AKIA 3RJEA 2KP7A 3HOZG 2AH5A 4C3IH 3WK6A 3T1YL 8ICRA 5IYBG 1SNPA 2EIFA 1Q81C 2JHDA 2AWNA 2W7OA 1OFIA 5C4JB 4F1IA 4R64A 1HR0M 5EJCA 4I2CA 4YWKA 3EIEA 3NBXX 3D4RA 2K4EA 3C1EA 4JI5M 4GH9A 3GV3A 2HHWA 4JI8Q 2VQFL 4M9LA 2MQHA 4G7ZC 3I4MH 3JR5A 1PFNA 3L9AX 3HKSA 1S5DD 1SYEA 4NL4H 3ISDA 4L4UA 4QHSA 3VR6A 5J0XA 1SMXA 4O0AA 4Z6FA 2RRDA 3D6JA 3SK6A 2UXDQ 3UMMA 3UK6A 1I6HB 3T15A 1DZ1A 2X6LA 4QZEA 3ISBA 4LJ6A 2WV6D 5ALEA 1A2UA 3VLFB 2V9WA 3W68A 1BCPD 1EIFA 2JA6H 3K9PA 1W5SA 2NYVA 4Y2SA 1ZD4A 4FNFA 3GTJH 9ICMA 4FCVA 2HIXA 3T51B 3U6SA 1SZHA 3U6LA 7ICIA 5CJ7A 1JRPA 4IUUA 1X9SA 3W1GA 3TWMA 5ALXA 3RLOA 2UUCL 5CP2A 1GUNA 1PYSB 2RP5A 4X62L 1L7PA 1XC8A 2ODGA 2YMMA 4B9MA 1K0RA 3AMZA 3BDCA 5J2CA 1EFUB 3SMVA 2EH9A 2OOBA 1TFRA 3Q23A 4YY3Q 4PMWA 8ICMA 7ICFA 3OHBA 3A54A 1NJIC 3IHQB 3SYLA 1IL2A 1HNZM 4J9NA 1QB5D 2EZXA 4RUCA 2KTQA 4I2HA 3NVWA 5ALGA 2XSCA 3NTUA 8ICTA 3LW5F 2QQ8A 5L37A 4BJQA 5AI0A 3SD7A 1KTKA 1JJGA 1QAQA 1QNUA 5JJLA 1U45A 3UDGA 5EGTA 4DR4Q 1Z47A 4K4HA 4DFPA 4MN3A 1JWSD 1VQJA 4M8AA 1SJED 2FPKA 1FIQA 1O78A 3GDEA 4BDPA 1NNXA 3GZFA 2ZXIA 1KYIA 3WU2U 3J27B 1QDTA 2DPJA 1VQ7A 4GC9A 1GVPA 4R8UA 2VF7A 3I55A 4PZ7A 9ICKA 1STGA 2HHVA 1KFDA 1PK3A 3W3AA 2Z8YM 1E2ZA 4IURA 2JEFA 2NVYB 4UASA 2L15A 4DV7M 3D6CA 2JK8A 2FI1A 4JI6M 2HVHA 1NUCA 3S16B 4KLHA 3DA1A 2K01A 1LT6D 4QWEA 4LF5L 1Z9FA 4NY8A 5ITQA 1K82A 3G6XA 2XY7A 4M04A 4DV1M 5AM2A 1ZETA 2DAKA 2NRTA 1TR5A 4DV2L 2ZIWB 3F53A 1D2BA 1ZQWA 2F0JA 1R2YA 1GUTA 2CWPA 2DBYA 1LTLA 3K6OA 9ICJA 3H0MB 3TE6A 2GWSA 3K1RB 2EPBA 5CV4A 3CAMA 2O5IC 1SLJA 1F9PA 3RBDA 3TZUA 3K5MA 1JOKA 3L2PA 3WKBA 4F2LA 5D3DA 1X2IA 4X3UA 4A3EB 1EY9A 4JN6A 4JBKA 3HOWG 2O4XA 1SXJA 1SBBB 2W82A 4YFKA 4FW9A 4KLDA 1SYGA 5J2AA 1H9SA 3CF0A 5DG8A 3ND9A 1BGXT 1SV0C 2W04A 1WTRA 4R4QA 4FE3A 3K0YA 5BN4A 5GADC 1HNXL 1ZJMA 5JEAJ 1VDLA 5D49A 4C8KA 3VKHA 3R9KA 2UUBL 1RQLA 1V33A 3PV0A 2M0NA 1J09A 4HMJA 1X3GA 1KXLA 4ALPA 3RZOH 3BQ2A 5EKKA 1ORYB 1ZQFA 4QHTA 1DXMA 2KG5A 2KKVA 5AFWA 2MAXA 1G6ZA 1JUDA 1TS4A 1CQVA 4R4OA 2IY5B 1MGSA 5LMNM 2KBNA 1GL7A 5CR0A 3M4OH 3D31A 2F77X 1IN6A 1WJ7A 3JPPA 5ALUA 2BH8A 2A5YB 2VS1A 4LF7L 4M9ZA 1WGNA 4KLFA 4G3IA 1ZD3A 1AE2A 1K9MC 3DWAA 2NTTA 4A3EG 1V92A 3A98B 3BZCA 2D7EA 3CU7A 3GTLB 1KW4A 1UPHA 2JEAI 4IRCA 2KN7A 4RMFA 4KLJA 4PT5A 5IT9L 4II7A 4W5WA 3KOXE 1GO3E 3I1YA 3PVSA 2M2LA 1Q39A 1XMOQ 1S8OA 3J7A5 4Z6YA 4BXOA 2K32A 4F91B 2FPLA 3QE9Y 3PX6A 5AK3A 5EWGA 2EY2A 3HKPA 2ES2A 4RQ6A 2W9BA 1UE6A 1GJTA 1XNSA 4R8UB 5LL6X 4LZZA 1N36L 1VQLA 2BWBA 2L7IA 5ELCA 4I2EA 1KQSA 2XWBB 4DSKA 2MUTA 3AU7A 9ICHA 1C0AA 1K5OA 3CCQA 3S1NH 2EY5A 3PR5B 5FO8B 4GC5A 2HHSA 3E5SA 2L2DA 4DS5A 2JQOA 2H3QA 3GIIA 4UB5A 2KDLA 2LVQD 3I2ZA 4M9JA 2MJ8A 1X65A 5EP2A 2M9VA 4DFMA 4A75A 2R0IA 2K5QA 8ICFA 4A3MH 3BDOA 4KHPQ 2C98A 2GVAA 1L1OA 1I4PA 1B2TA 1BCPC 4DAYA 1CRXA 5IP9G 2PNRC 1U9RA 5HHHA 3HZJA 5GROA 5IGCA 2WHEA 1XWLA 2D2CC 3KUPA 2MO0A 1A8VA 2DI0A 1K8OA 4IJFA 2XF3A 4IOCA 4DV2M 3PY8A 1WXQA 4FWGA 5DQGA 2QP9X 4DR3Q 2I07B 3TARA 3RH5A 4S12A 1SWWA 4BWJA 2EYOA 1XSLA 1DO0A 2RDFA 5K36H 2E2JB 2UXCL 1H9SB 4ELVA 3GO8A 3U60A 4FF3A 4B7GA 4CHTB 4JI2Q 4GKJL 2XWJB 4DR1Q 5KFPA 5C5LA 2AGOA 1WWUA 2NZHA 3KLSX 1V97A 1TK5A 1RCVD 1CKNA 2ZM6Q 3ZCBB 5DG7A 4CRXA 4HTHA 4A3CG 3S17H 4KY5A 3HP6A 5FTLA 5KFTA 3NBHA 3HOVH 4AKHA 4IUPA 5AI6A 4DLGA 2J7OA 3GTQB 3KS8A 2UXBQ 1R6BX 1GJSA 4OJLA 1E0BA 3J7AF 3KHHA 4UARA 3DOAA 1DD2A 3BS7A 2ZXRA 5HR6A 2MPMA 4PDIA 4OEMB 2LPEA 2EOTA 4I7AA 2Q2TA 3TP7A 4LUOA 1GD7A 3SEBA 2AGPA 2FMCA 5IGFA 3B6YA 2FH0A 1ML0D 3PIO3 5J0OA 2CKZB 5AI8A 1UT8A 2YTXA 3K7UC 3N6RA 4DNIA 3ZDBA 3M3YH 5JEAG 2W55A 1UEBA 2CH4W 1IY2A 4DOCA 4G4OA 1L1OC 1R5LA 4DR6L 2R7FA 2KA6B 1KDAA 3FTCA 4C8MA 2BKEA 1TGUA 2VIXA 1B4FA 2KHSA 4L8JA 4EX7A 5IWAL 2F0WA 1KFVA 5FP0A 4IJEA 4B9XA 1NMGA 4YHHL 2QSFX 7ICMA 4BGDA 1SE3A 2B2WA 4JBMA 2ZIUA 2R7ZH 4US8A 1FNUA 5EOZA 2OYYA 2JA8G 1QSLA 1U5KA 2VNUD 1YEZA 1KKXA 3RRGA 2J6UA 3HHXA 4NL9A 4KT0F 2W9BB 2JWSA 2E8GA 1IM4A 2PW7A 5C4HA 3R9XB 1ZQCA 4JB3A 2ZUCA 2GO7A 3U50C 2MUTB 2VKQA 4QOZC 5AKGA 3F2BA 3E3XA 3B7NA 1Q3BA 3GV5B 4YCUA 4IPGA 4XYOA 2G0AA 7ICEA 2V1CC 1Q8KA 2A1JA 3S15B 3HKZC 1JT8A 9ICLA 3H3VI 2Y1IA 1ZQTA 9ICXA 2DUYA 4ZCKA 1L1OB 4K5XA 3SAUA 2HT1A 4KHVA 4DAYB 1NAPA 3T79A 1EYAA 2QZ4A 3UQ2A 4X65M 2L1BA 4MM3B 1JQYD 4LFBM 3OGUA 5C0XH 2N49A 4DPGA 1V38A 4HEOA 1WTHA 2A69D 3JPQA 4DO9A 2BCVA 2AQ0A 3HHYA 4S3SA 2KCNA 1Q8IA 1DK3A 1V85A 3GO5A 4KTAA 1TS2A 4QIWE 5FJ8G 1Z6TA 1IN4A 4C8LA 1A3VA 1PFBA 4K14A 2P35A 5T1IA 3JAME 5DBAA 1ICFB 4DSJA 1PXUA 5AHXA 1YHBA 4PHPA 2G5HB 5D14A 2C22A 1EY5A 1WIVA 2YQEA 3HJSA 4C3JB 1X6IA 2XI9A 3V76A 2BPFA 2FFKB 2OXPA 2BJVA 4JI8L 2CV2A 3MAQA 1CKNB 2EUCA 4LF4Q 3HJ8A 1NY5A 4DOBA 3H0GB 1QYRA 1J8IA 1I3QB 1GO3F 3PW2A 3HKZB 4ED8A 5J0WA 2NWGA 4I7ZC 4IUNA 3CRXA 4RH6A 2C2DA 3SMSA 2UXDL 2BOSA 7ICGA 3NBHB 3KOWE 4DR7Q 4OXPA 4NL9C 5GQOA 1S72A 2IJ0A 3DWQA 4EX6A 4NXNM 3QYPA 2JEIA 2YQZA 1NR4A 3AV0A 3HOXB 3MR3A 1NY6A 3GPUA 5CA7A 4HL4A 3N4MB 2BCRA 1HZBA 2HDOA 3HOUG 2NRZA 5ALZA 4KLSA 4GXJA 4DV0L 5E26A 2DAIA 4PZNA 2AKWB 2C35B 3BG3A 1JR3D 3M1YA 3U4VA 1B3AA 3J80i 2NRVA 1EQRA 4J15A 4PHAA 1C4QA 3V05A 4DV4L 3BS5A 1J6QA 4G4QA 2CWBA 4YY3L 4HYKA 2HAKA 9ICCA 1O7IA 1VQ8A 2CP8A 1XMQL 2HOFA 2TMPA 1QNKA 2DL0A 2K6AA 4FBUA 4IPHA 5IP7G 2KIWA 2JXJA 3H0GG 1NK6A 3HKZG 2R92G 2AU0A 4JI4Q 4JW0A 4POGA 2E1FA 3ISCA 4F8RA 2KV2A 1DO2A 2B3GA 1X3PA 4M9GA 4B9LA 2RGHA 4DR4L 4NLBA 5JUMA 1IL8A 2NN6I 3I51A 3NQTA 5DYGA 1Y14B 2I7NA 2E75C 4PZ8A 3QU5A 1ENAA 1M1KC 1SNQA 4O3OA 5EPLA 3L27A 1TWFH 4A3FG 2IHEA 4ZLTF 2P5TA 5AI9A 2W9AA 1ZQSA 3A45A 1YHAA 1QQ5A 1BUVT 2FS1A 3VR5A 4QNLA 5KFKA 5M5WB 1EU3A 4GIBA 4LF9Q 2A1JB 5AKZA 2KEEA 2G09A 1KBUA 4KMOB 1SFOB 1PV4A 1PH1A 4L16A 3I04M 3V7KA 8CATA 3KDFB 2DKXA 4IC9A 5FKAC 1MQ3A 5ALVA 1Z5BA 2H1RA 2L4FA 4PMCA 2NVXB 4CKBA 4RGTA 3J2PB 3U61A 2JGAA 4RGMA 2K50A 2DWLA 3S1MB 3DWPA 3EPIA 1K83B 7ICRA 3UE1A 3SEIA 4IO9A 2BQ3A 4QMGA 1ZV1A 1PYBA 5JVH3 1TWHB 4RQMA 1BPEA 4I5SA 3NQIA 2MO1A 1ICWA 4DL4A 4M1UB 4RG1A 3WKEA 3QU7A 4K0KM 1FNNA 1N34M 2HCCA 3T56B 1TK0A 3Q8XA 1DM0B 1R9TB 2O25A 3C3EA 4PZOA 4HJ8A 4H13C 4JI7M 3VKGA 4C8NA 3M8RA 5C3EH 5BPCA 8ICWA 1S5CD 1JE5A 5J2DA 3CHBD 4NXMM 2WTFA 5AKXA 5G5GA 3FMCA 5J3BA 3LK9A 1FL0A 2GN5A 3QOJA 5KYLA 3LWMA 5KG5A 5NUCA 2ESEA 1BF4A 2QBYB 2W3RA 1WTQA 1CK1A 3PO2H 5KFYA 1YSYA 4NC6A 4R7GA 1ZJNA 3EQLC 1Q12A 2UUAQ 1XX8A 4F3OA 2F8LA 1AP0A 1KEJA 1N2XA 1LTSD 3KVWA 2FJ2A 3G6VA 1QCBD 7ICUA 2XSZD 3ERSX 5M5YH 4R66A 4AKGA 2LKYA 1OAOC 4DA2A 5ITXA 4NB3A 1N33L 2UU9M 2ZUDA 2APLA 4EGVA 3I76A 1Z3EB 4HJAA 4UAZA 2HCFA 2CFOA 2DNCA 3C9PA 4C3IB 1XNRL 2Z4RA 3T1HQ 1BNOA 1JC7A 3GU3A 5AKEA 1T5EA 3BS5B 4ICAA 3ILKA 1VDZA 3WKDA 2VUMH 1SL2A 2FFJA 4DL6A 5KFMA 4ZK9B 1VQDA 4YN4A 1JR3A 1B7YB 2ZJRA 1GLNA 4QWAA 5BOMA 5K5PA 3RR5A 1ZRMA 5HURA 4B3RQ 4P74A 4DK0A 3I4MB 3WKCA 4XUSA 5M3FH 2G3QA 4X5VA 4JUZA 2KVCA 2A69C 1NE3A 1X66A 5B66U 5BN5A 1N32Q 3QX7A 1IXRA 2D9UA 1GVNA 2LY7A 4BXXG 2KXEA 3PNCA 1NK4A 4R4IA 2KENA 5FLMH 2JA6B 3H8MA 2EDUA 2J6SA 4N9TA 1Q82C 2Z4IA 1XWEA 4EX5A 2F4VL 4DR4M 5JJIA 4I2AA 3GTJB 3QYBA 8ICOA 4DWIA 4NM1A 2F3WA 4EENA 2LMCB 4JG2A 1CA5A 3RH4A 1ED1A 3EYZA 3CNHA 4RQ3A 4R71A 2ZIXA 3E46A 4GLXA 1I4QA 2B2YA 1T4GA 4B3MQ 4UAVA 4C3IG 3RGPA 1ZQMA 1TK8A 4ID6A 4OJ6A 2K60A 1E24A 4P17A 3KBGA 3GLHA 2MUYA 4KLMA 1WCMG 1ZQ9A 3TDQA 3U61B 2IL8A 4QZCA 3C21A 2W9CA 1EXNA 4YIJA 3LCVB 3I8ZA 3L3FX 4KHPL 1T3NA 4A93H 1VDVA 1MQ2A 2VQEQ 3FM9A 4DV5Q 1OW5A 4YMOA 3FYHA 5E3FA 4UB1A 4QNMA 3ZD9A 3HILA 5KQ8A 3OIPA 4HN7A 2F3IA 3SYZA 3ICEA 4U7CA 3BZDB 1ZQIA 5JI2E 1FGUA 4DUYL 2GNOA 1ZQXA 1OTRA 4PL2A 4M0AA 4X64M 4PZ6A 4F72A 2JA6G 1HUNA 1YZ7A 4JV1A 4RNOA 4MNOA 1BKBA 4DGZA 3KF8A 5C6AA 2NTSA 2VJ5A 2G5DA 3BJYA 7ICNA 1SXDA 3WK5A 1WTPA 4QOSA 4P0QA 1L7NA 2QDBA 3LWUA 4JI2L 2KCTA 4DR1L 1T3QA 2VB2X 5CR3A 4GKKM 4D81A 3LWLA 1UM8A 3IRBA 3EA6A 2Q8TA 1BPDA 3GTMB 2ZM6L 3I4NH 2BCOA 4AG5A 3KSXA 1IXRC 4QJFA 1LKYA 3S24A 2HCBA 2AUKA 2X69A 4IUTA 3U6DA 5L1KA 4A3BG 5LMUQ 2W54A 5L1IA 3TANA 2F44A 1B1ZA 5KFGA 5IIOA 4OD0A 1DGHA 2Z6BA 3MDAA 2JSOA 3C2KA 1XJVA 4OO1H 2UXBL 1A15A 1JICA 1UFZA 2WB1F 2ICEC 3VYUA 4NRWA 3GRYA 1QQ6A 2P6UA 4WRDA 1KSFX 3Q22A 1RJTA 2P5ZX 3J7ZC 3Q8SB 2JY6B 1A62A 3FD9A 3IECA 4JI5Q 1EY6A 1COKA 2C9CA 5HMMA 4NSRA 1EWCA 1QAMA 4TUSA 1SMYD 1VQPA 9ICEA 4K8IA 3IFTA 3BDPA 8ICGA 3D6WA 1R7RA 1NBWA 3I73A 3HHZA 2DNAA 1T43A 4RQ5A 3C3DA 3C1ZA 4DFAA