2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
4QZHA 3SI8A 3GLFE 2ZJ5A 2DAMA 4UP7A 5KFLA 3Q8DA 1L3TA 1NK7A 2I1QA 3CCEA 4EBDA 4YVZA 5D4BA 1XSPA 4RQ4A 4DL5A 4R64A 8ICEA 4PH5A 8ICSA 4DFKA 2HHTA 2ATLA 4IRKA 3PO2H 4TQUS 4O3RA 2DHYA 5L1JA 4A76A 1VDLA 2R7DA 2HHHL 2YTYA 2HWJA 3S2DH 1UEBA 1PFSA 4H02A 2KHJA 5C3EH 4OWTB 4A4IA 2JNHA 1NKEA 2BPGA 3RR8A 4K0KQ 4UBCA 4QWCA 2JEIA 1XSNA 3B89A 3LWLA 2UUCL 3UDXA 1B70B 2D62A 2JA5G 2YYZA 1PH9A 2BA1A 4DR6L 2FPKA 4RNMA 5HP4A 3UDFA 3GDEA 1DGSA 4GNXC 4YMOA 5KG0A 3HOZH 5IP9H 1BVSA 2GVBA 5JJLA 4DKAC 1JJGA 3OTOL 1VQ5A 4QZAA 1N34L 1VG5A 2CWPA 2QSFX 5EWEA 2UXCQ 2IBKA 9ICSA 4R4CA 5EOZA 4A3JG 1Q82C 5BPCA 3Q8KA 3LCVB 4DQSA 8ICLA 3MR5A 1KXLA 1XU4A 4A3IG 4BA2I 4ALPA 1HNZQ 9ICXA 3DLLA 1ZQNA 5DQHA 9ICIA 1KHIA 3E2EA 2AWOA 3TFSA 2KZZA 2BPFA 1CKOA 3T1HQ 1WCLA 1KFSA 3JPQA 3SYZA 1EFWA 1JN3A 1BPDA 4GLXA 4L5QA 4M6WB 3PX0A 4G3OA 4POGA 2CCZA 3I56A 4IQUA 5IY0A 2RDJA 2ALZA 2VY3A 2OTJA 4B9LA 1VQIA 4DSKA 4YWLA 1NKCA 4DWIA 1UWVA 3QZ8A 4M9GA 5JEAG 5CB1A 3OYYA 1KDHA 3TS2A 2OOAA 3RH6A 2UU9Q 3E9IA 1IXRA 1VQAA 3E0EA 4JI5Q 5J0QA 5KG7A 3MR2A 2ES2A 3M8SA 1B43A 1TWGH 3EZ5A 4F5RA 4BXXH 5EWGA 4C3IH 3H3VH 4JV5L 4JI0L 1VQOA 4MZ9A 5GADC 1ZQKA 4Z6DA 2FPMA 2D0PA 3ETLA 4DNIA 9ICLA 2JEAI 4MEYA 4DL4A 4QZEA 1JXEA 4B9NA 4NXML 3M4QA 4YD1A 3C1YA 3TEHB 3QZ7A 2DPIA 4ECUA 1XC9A 4YR3A 8ICWA 3AFPA 5KFFA 2HHWA 8ICZA 1NBWA 1IBLQ 1MKHA 1WCMG 1KTQA 2O25A 4B3TL 1S77D 1VQMA 1JX4A 1L1OB 1ZQTA 4DV1Q 1G41A 3C21A 3AQQA 5DKWA 4A75A 5J2EA 4LUOA 1FL0A 2R92G 4X65Q 4HIDA 1XNRL 1N32Q 2NZHA 1OXVA 4MFCA 2BQRA 5HGQA 9ICGA 1K73C 4Z6FA 1D9DA 3PMLA 5L1IA 3ZDEA 4LUVA 1OAIA 2HHQA 1VS0A 2A1JA 8ICOA 4B3MQ 3BU2A 4O3OA 1CKNB 4YMNA 1V92A 2RHSB 4F8RA 4RQ2A 1L5UA 2R7ZH 2RHQB 4DL2A 4Q8FA 2KCMA 1T3NA 2IA6A 3S1RH 7ICGA 1VCIA 4OXPA 1XNQQ 4QW9A 3I4OA 1KD1C 1KIXA 1XNRQ 1N32L 3ULLA 2ISPA 2VQFL 4B9UA 3A5ZB 1HT2E 3K0XA 3CAMA 4BBRG 4KLSA 2K5NA 4OO1I 5IYCG 4JI7Q 2FPLA 1SL0A 2BCUA 1Q12A 1D9FA 4A3KH 5KFIA 4ED6A 1L3VA 2KTQA 4A3FH 3M4OH 1S9FA 4A3BH 4DAMA 2NVYH 5HHHA 8ICFA 2K5VA 2NRVA 4M9NA 4JV1A 1RXVA 2R92H 3T6PA 1Z9FA 3BQ0A 5J2KA 5DQGA 3CCQA 2UXDL 3JAMi 1NK4A 3BQTA 4JI7L 3T3FA 1KAWA 2FMSA 1AE2A 5AJ3L 3E21A 2E5LQ 5HHIA 2MUTA 4UB2A 2DGYA 4UY8C 5E7NA 1LB2B 3F2BA 3PNCA 5J0WA 8ICCA 3ZDBA 1LM0A 4DQRA 3Q8SB 3CW2C 4P74A 3Q8MA 4BBSG 1LYLA 3GILA 1SL1A 4A3KG 5J2JA 4KMUA 3RJKA 2W9BA 3V7KA 4J9OA 5J0OA 1ZQQA 2JUJA 3PO4A 5KFKA 4DFMA 4I2FA 3V72A 4JBKA 3TFRA 3TAPA 1NK9A 5HMMA 7ICNA 3K81C 2F4VL 2R93G 1TWCH 3ER0A 5J0SA 2ID0A 2MR9A 3HOWG 1D7QA 4JBJA 2FMPA 4QL5A 2AHOB 4KLEA 2I0QA 1YEZA 3IECA 4DR4Q 1Y1WG 4O5EA 2ASJA 4DFPA 3RB0A 1VQCA 1S0VA 4QZ9A 4O5CA 2UUAL 3RB4A 3PIPA 4F93B 9ICVA 4APVA 1Q1BA 1TKDA 9ICMA 2DAIA 2EJSA 4X6AH 5BOLA 2LYHA 3G4SA 2NZOA 4B3RL 1PGYA 3M9MB 3H4JA 1PH5A 4JI8Q 7ICJA 2RCNA 2I5HA 3PW4A 2HHVA 2JA8G 4KHPQ 3F1ZA 1IBML 1HT1E 1K1SA 3OSNA 3UXPA 5M3MG 4I2IA 5LMNL 5C44H 3CCRA 2JP7A 3G6YA 4TURA 2ZTCA 2LSSA 4ECQA 2A8VA 5C5JA 1C0AA 1J5EL 2KCTA 5FJ8H 4X66Q 3BZKA 1G4AE 5EAYA 1YJWA 3PMNA 4ED2A 3GLGE 3J81j 3NBHB 4NLGA 9ICNA 4BXXG 4YY3Q 1X54A 5M3FH 4XQ8A 4WJ3M 3RLNA 1YLAA 4RQ0A 3C5GA 4I2JA 5HY6A 5C0XI 1HQYE 2E2IH 5KFYA 1TAUA 3RJHA 4P73A 1EQQA 4GXJA 1T43A 2N8NA 4DSEA 1QZEA 1LV5A 4KLKA 4LF8Q 4BXOA 1VQPA 5JJKA 4RNNA 1Y8GA 4YCXA 1YVCA 2JY8A 4TVAB 4X62L 1G51A 3EN2A 3TREA 1QVGA 1T4GA 1WI5A 4HJ9A 2XY7A 5KG3A 5KFOA 4QWAA 3RBEA 5IP7G 4DR7Q 4R4IA 4PGQA 9ICQA 3PX6A 4OWXB 5DLGA 3EW9A 1I94Q 2RDIA 1JR3E 4QZGA 4EX5A 2Y1IA 5TZVA 5DBAA 3CCJA 4GN4B 1UA1A 7ICSA 5IYBH 4NXNQ 1PH3A 4A3EH 2KFNA 8ICTA 1A62A 1Q1EA 2HW3A 2R7ZG 2MJ5B 3D31A 4ECTA 2K50A 4HJAA 5KFCA 3FYHA 5J0RA 3HKSA 4DUYQ 2UVVA 4F4KA 1WCNA 1T7PA 1BPYA 2EQSA 4JI3Q 4UPAA 3S1NH 4M47A 2J6SA 1YBYA 3EWAA 5DLQE 2LTUA 3T5JA 3K4GA 3PUWA 8ICBA 3SZ2A 4PPXA 4GN3B 1ZQOA 4JV0A 5KFHA 1HZBA 3SV3A 2VA3A 4QWBA 4JI6L 4B3TQ 3RJGA 4ELTA 9ICAA 4DV5Q 2MQHA 1X2IA 3MDAA 4DV1L 4NXZA 5J2IA 4I2EA 2DKLA 1BPXA 4JWMA 4JI2L 2WFWA 4X65L 5IIJA 1NJWA 4NPSA 1VQNA 4M9JA 3GDXA 4Z6CA 4F2LA 2JA8H 1H95A 4LF5L 1DOQA 4PGYA 1FVIA 2I5MX 1HZ9A 3M9BA 2BCSA 4F50A 3CXCA 4DL6A 4P4PA 2JJQA 1X3GA 3DM3A 4DV2Q 2IHNA 4YR0A 1IM2A 3LGJA 3FP9A 4KLFA 3GTQH 3KYHC 1TXYA 2ZJRA 5KG2A 4A3FG 4B9MA 1YITA 2F1HA 1EOVA 2QHOB 4K0KL 3QE9Y 4I2HA 3G71A 4DV0L 4JC0A 3K7UC 4RUCA 3RH4A 1XMQQ 3PGZA 3M8RA 4QZCA 2OCEA 3G6VA 5KFEA 3GV7B 2HHUA 2HVIA 1FJGL 4GXIA 2BPCA 4DUZQ 4UQGA 1RL2A 4FS1A 2NVTH 4LFCL 2UVUA 5IWAL 5BOMA 2AMCB 4GLVB 4GOPC 4TUSA 3UE0A 5HMLA 4YWMA 2JZBB 4YCUA 5J0UA 1PVOA 3PO5A 1SKWA 5KG4A 4B9SA 4RU9A 1NTGA 4L5SA 4GKJL 3ZJYC 2RRUA 4QZ8A 2BGWA 1L1OA 5KFGA 2BCQA 3OSPA 3AU2A 2B29A 2OOBA 3J81c 1Y1WH 7ICKA 3V6KA 4BXOB 1HZCA 3S1QH 1Q46A 1A8VA 3V6HA 1IYJB 3GD7A 1WOCA 2L2DA 2FLPA 3GV8B 3T1HL 4LZDA 3I55A 4ECVA 2R8JA 1JT8A 2LVAA 4R1JA 4GEWA 1ZQLA 4UBBA 4IRCA 3I7FA 4GKKL 1KFTA 1X56A 1KRTA 5K36G 2F4VQ 4LUZA 4KLLA 4JWNA 3KLWA 1S72A 4ZH4A 1HNZL 2P6RA 1W2BA 1VEJA 1XPRA 2NRZA 1S40A 1IBKQ 1D8LA 1HR0L 4DLGA 1TV9A 4DK6C 1XMOL 4C8OA 1E94E 1NMFA 2YTXA 3F8TA 2B63G 4MNOA 4NLNA 3HOVH 4YCWA 1KFDA 2LVNC 4YN4A 3GIMA 2DAEA 4KLDA 2KZMA 1GM5A 3C2MA 1ASYA 5KTQA 3S24A 4GNXA 3PF5A 4JV5Q 4DLEA 4JI4L 5DG7A 4MFAA 1QTMA 5J0YA 4J9SA 1IBKL 1BBUA 4X64Q 1HR0Q 1OKSA 1U48A 2IHMA 5KFJA 5KFTA 1VQFA 2Y0SE 4JI8L 1XMOQ 3HOXH 1EIFA 3GTOH 3CF5A 1S3OA 1MSWD 3PV8A 3MR3A 4M9LA 1B7YB 1ZQIA 2KNZA 4ED0A 4ED8A 1NOMA 1IBLL 3V7JA 4DBGB 1MJCA 1MC8A 3PY8A 4DFJA 1KRPA 5DG9A 3FDSA 2XGPA 2D0OA 2YU9H 1B22A 3W1GA 4DV6L 3OHAA 3EBEA 2KZ3A 1L3UA 4KLIA 3RRGA 1XJVA 3RZOH 8ICHA 2F52A 4I2DA 4A3DH 4TQSA 1ZQPA 4K4HA 4K4IA 2C22A 1PH1A 3JPRA 3PUXA 2N49A 2OQKA 1GKHA 4BGDA 4XTCS 4QZIA 4OWWB 4J9PA 4B3ML 3A5UA 1SL2A 1N36L 3TQ1A 4C3HH 3H3VI 3BZCA 1JJCB 5BR8Q 2JY6B 4R71A 2N78A 3L2PA 2BR0A 2I5LX 4I2CA 3I2ZA 5F9NA 2VQFQ 3U58A 4CCHA 4A93G 4P4MA 2JQOA 4KN7A 2CKZB 1VEKA 8ICXA 2EKKA 4MFFA 4DV4L 1NK0A 2Q0ZX 4R4OA 4GXKA 1P16A 3OJSA 1E24A 3E9HA 1HJPA 5KFWA 5DDMA 4NLZA 3T1YL 4PHAA 1HNWL 3E46A 3HP6A 4A3BG 1L2FA 3KOJA 2FXQA 3GTLH 1Q7YC 3L0OA 4M04A 1VQGA 8ICAA 1SR3A 5GQOA 1S0NA 5KFAA 2UXDQ 4DV4Q 4IQTA 3HOYG 1QLNA 4K4GA 5J2CA 1ZMVA 2PQAB 4LF7Q 2KFZA 3S17H 1TK8A 3ZDDA 3PO3G 3RNUA 4JBMA 3C2LA 3AYHB 4IJLA 1MQ3A 4B3RQ 4BY7H 1ZQVA 2Z6KC 1KLNA 5C44G 4LFAL 2GWSA 2CFMA 1UA0A 1NK6A 1CKNA 4DR5L 3RJJA 4FO6A 1PH2A 4C8KA 3ICEA 1C9OA 2KHHA 2VUMG 1EIYB 7ICLA 1SN8A 3G6EA 1QZGA 2B3GA 3KF6A 4IJHA 3S1MH 4A3DG 5C4XH 4FS2A 3V6JA 3FRIA 1Q86C 1E22A 1Y1VG 1ZV1A 3CPWA 4DR5Q 5KT2A 2V4RA 3LK9A 4JI2Q 2ASDA 4ECXA 1A77A 2CP8A 2KNVA 3ISBA 4I2GA 8ICYA 4HJ5A 5GAGC 1I6HH 5C0XJ 1XTDA 2HHXA 4IQVA 3BQ2A 5C3EG 1NJZA 4L5RC 1QVFA 1YNXA 1UT5A 1C7YA 4JUZA 4A3LH 2E8GA 1K9MC 7ICHA 2K0BX 1T9HA 2K75A 2UXCL 1CSPA 1M1KC 1SROA 4J9MA 1ZJMA 2XY6A 1VQ7A 4A3MH 4YFKA 1JB7A 4O3SA 3LWMA 4NB3A 1ZQBA 3UPQA 2F3IA 4O3PA 5FJ8G 2NRXA 8ICQA 3CC7A 1YHQA 2JA5H 1KYIA 3JPOA 4P71A 5KT6A 5KFZA 3RB6A 3UQ2A 3W5OA 4YG2A 3PCOB 1WYDA 1A63A 2WP8J 3PO2G 1AROP 1VQ6A 4WJ4A 1SE8A 5DBCA 4A3CH 2HIXA 5IYDH 3F2CA 4UP9A 1ZQMA 4F4WA 1VEGA 8ICUA 3PW7A 5L1KA 4GNXB 4RQ7A 2MFIA 5GROA 4GLAC 1OXSC 4NY8A 2VW9A 1UFZA 4DR6Q 2VQEL 1ZQEA 2ZJAA 4X66L 3GIKA 5IP7H 3MFIA 3HPOA 4QY7A 3NGDA 3Q8RB 2R0IA 3BJYA 3OTOQ 2LVPC 5DB9A 4Q43A 3RJFA 4TUQA 3UXNA 7ICPA 2V1CC 5KFXA 3PIOA 1NV9A 5LMUL 1KEJA 4IPGA 2ASLA 1OTCA 3PW2A 3M85A 1N33Q 4PHEA 2C28A 2XGQA 3MBYA 1K0RA 1Y88A 1N8RC 3U4ZA 5KG5A 1Z47A 1ZQUA 1SZPA 2IY5B 3I4MH 9ICEA 2IX0A 2JZ0A 2DAGA 7ICMA 4LF5Q 1ZQWA 2JEBI 2DFLA 4QWDA 1U49A 4DQPA 2NVXH 3H8WA 4OX9L 2VUMH 4DL3A 1UE1A 1BPEA 1S76D 3T5LA 1NJIC 4DQQA 4IPDA 1KQSA 2KHIA 1VQ4A 3PR5B 1ZQJA 7ICUA 1VQEA 2UUBL 5J2BA 5D46A 1KL9A 4DV3Q 4YHHL 5JJIA 4KLTA 1NJYA 4A93H 1U9LA 5M5WH 1UE7A 4DSIA 2Z6KA 2ASBA 4PGXA 2C2EA 1RIPA 2C35B 1WJJA 4RT2A 2ZM6L 5DB7A 5KG1A 3ULPA 8ICJA 4NXNL 3M4PA 4IR9A 3HFZB 1UE5A 4DUZL 1S0MA 4LFCQ 2DI0A 2BH8A 3NENA 4QWEA 3CCVA 4RQ5A 4JI5L 4DR1Q 3S14H 1U4BA 1YIJA 5J2AA 1K1QA 5IYDG 5CA7A 3CQZH 4KLOA 3UQ0A 2DUDA 4AQYQ 3M3YH 2EIFA 1ZETA 1JJ2A 3S16H 4HEOA 5CJ7A 1U47A 3IHQB 1VQHA 2KENA 3AUOA 1AE3A 4F91B 2ZUBA 4ME3A 1E1OA 1RXWA 4F2RA 3GFKB 4R8UA 4B3SQ 4DV7Q 3ZDAA 4ED1A 3UXOA 2XY5A 1V9PA 9ICHA 4DV2L 3HOUH 7ICIA 4MF8A 2K4KA 5IILA 2B21A 4PHPA 9ICBA 4P72A 5CWRA 1VQKA 3H8SA 1X9WA 2XGTA 2WTFA 1N34Q 4P2HA 2LVQD 4DV5L 3PW5A 8ICMA 3PUZA 3K9OA 4ECWA 1X6OA 2PFOA 1OXTA 2A1JB 3BDPA 1ZQCA 5IP9G 3GTPH 3VDYA 4Z6EA 2F1JA 2DPJA 3U50C 4DV7L 2HVHA 3TQYA 4A3JH 3MMPA 4RQ6A 3PO3H 4R4TA 5LMNW 1NKBA 9ICTA 2UVWA 1H38A 2K14A 2B63H 4RG1A 2LXJA 1WHCA 1Y1VH 2JE6I 1CKMA 2MROB 3CCSA 2PQAA 1ZQZA 2OWOA 3GIJA 4RPYA 5C0XG 1MJEA 2R6GA 4DV0Q 4KLGA 4M0AA 3D0FA 1WGLA 2V9WA 1ZJNA 2KN7A 3CCMA 3HOUG 2F1IA 1FJGQ 2GVAA 3HOZG 3C1ZA 2Y1JA 3J7A5 4J9RA 4POFA 2JA6G 1TWFH 3ZD8A 1VQ8A 1PH8A 1NMGA 3RJEA 3RAXA 2V4QA 4DK3C 1IM4A 4DQIA 4R66A 3HW8A 4C8MA 2WB1E 1EUJA 4JOIA 3HOXG 3B0XA 9ICCA 3TS0A 2BH2A 4MEXA 3MGIA 4PZ8A 3PSIA 2JZBA 4DOBA 4IQWA 5DB8A 1HZAA 4PZ6A 3OW2A 1HNXL 4L5TA 1PA6A 2FLNA 4DPGA 4RPXA 4QQBX 5KFDA 3RLOA 1WR1B 1I3QH 1DV0A 2Q2TA 9ICKA 4EYIB 5LMNQ 2UU9L 4UP8A 1EWIA 3ISDA 5IIMA 2FMQA 1YHBA 4O0AA 4YMMA 4AYBG 4MF2A 4YXJA 4JI0Q 2YV5A 4ECYA 4DS5A 5KFRA 1YJ9A 2HQLA 4DEZA 4YY3L 1KC8C 4OO1G 5CHGA 4LVSA 2YTVA 4P4OA 4O9MA 1L1OC 1R4GA 3TAQA 1ZYQA 2PMZE 3CPFA 1TFRA 1NK5A 1FGUA 4DR3Q 1QUQA 1F4IA 5KFSA 1JMCA 4LF8L 4UAZA 2B3TA 1EFUB 5DG8A 3RN2A 4R63A 5J0XA 5DQIA 1BGXT 3UDIA 4PG3A 5KFUA 5IINA 3IRBA 3HKZG 4NM1A 1ZMUA 4KHPL 2L4FA 1A5TA 4A3GH 1MQ2A 2LVOC 4HJ7A 1PH6A 2MUTB 2PFPA 4XIGS 2IHEA 1ASZA 2ZJ8A 3WWVA 7ICTA 2HAKA 5J2FA 1U5KA 2WZJA 4JYAQ 4F5OA 4LWCA 3OGUA 3GV5B 1QSSA 1Z3EB 4JI1Q 1RPLA 3RAQA 4R65A 3T1YQ 1LTLA 2AU0A 1TVAA 3FHWA 1KRSA 4RQ3A 2AWNA 3RR5A 1TK5A 1CSQA 5BR8L 3GTGH 3S2HH 2J6UA 2W9CB 4AIMA 4LW1A 1EXNA 1PV4A 2Q2UA 2QA4A 5DBBA 4DOCA 3H0GH 1ZQGA 4LF4L 1P8LA 2MO1A 3I4NG 4Y52H 3FE3A 5DGAA 5DB6A 5J2HA 1XB2B 3AU6A 5KG6A 4JI1L 3TARA 4LFBL 1U0LA 1QZHA 3CP0A 4BBRH 4KTQA 5DGBA 8ICRA 5IIOA 2W9MA 4RMFA 2ZTEA 1S0OA 5C4XG 4RQ8A 5KFQA 3MEFA 2UUAQ 2BKEA 4GOPA 1XNQL 4Y7NH 1G3IA 1PZNA 3H7IA 5J0PA 1BBWA 2JK8A 9ICJA 2CWBA 3BJUA 3RTVA 4A3LG 4LF7L 1SMXA 1ZQYA 4DR1L 7ICRA 1WGNA 2NN6I 1ZQDA 1YHAA 3FKIH 2ZTDA 4I2AA 3KDFA 7ICQA 4Q45A 2HT1A 4DF4A 1K83H 2PNHA 4DSJA 1PYSB 4F3OA 4UB4A 5J29A 1TK0A 2PXIA 2AGQA 1A76A 1PH7A 3KFUA 3MABA 2JA6H 2RF4A 5M5XH 2IMWP 1B8AA 3UDGA 3TI0A 4F2SA 3JC66 2VZAA 3M9NB 1MIUA 2HHHQ 1N56A 4IFDG 1ZQAA 2BA0A 3BBZA 3KHGA 2NN6G 2BDPA 3MFHA 4DAYB 1WJ7A 3F2DA 1G291 1XXHE 2UUCQ 4WP2A 2XO7A 5LMUQ 4O3QA 2VANA 1G6PA 3QEBZ 1A0IA 3HWTA 3FRHA 2PFQA 4MTNA 5M3FG 1GD7A 4A3CG 5DDYA 5CP2A 4DSLA 3PUYA 9ICWA 5IIKA 2PI4A 4YXMA 4BY1H 2NRTA 2VL6A 4ED3A 3CCLA 4KLMA 2QNJA 3T5HA 4ELVA 3EPIA 2XCAA 3N4MB 4XUSA 3RB3A 1N48A 2ZJQA 1WCMH 3I4MG 2BWEA 1JXLA 3PR4A 1Y14B 2JA9A 4DR7L 3M7NA 4M2YA 1XMQL 3PUVA 4Q7JA 1D8YA 3KTQA 1YZ6A 1K8AC 2DAKA 4F92B 2CQOA 4DL7A 7ICEA 4GOPB 3RH5A 5IYCH 4F4ZA 2AKWB 4RZRA 3J80i 5IWAQ 1VQ9A 3THVA 4DR2L 1ZQFA 4BY7G 1XWLA 1GO3E 1COOA 3GLIE 4LZGA 4RQ1A 1QSYA 1IBMQ 1U45A 2QEXA 3JPTA 1SKRA 3PV0A 3CC2A 3KDFB 4GKJQ 3SGIA 1R9TH 4DSFA 3GIIA 2OO9A 1HUZA 1J6QA 1M90C 2JZ1A 4IO9A 2VQEQ 4AQYL 1IZ6A 4FDBA 3N97B 5L1LA 3ZDCA 4P75A 3K80C 4JOIC 3GTJH 2EXDA 3KHRA 1K8GA 2M9NA 5KFPA 2Z0SA 8ICGA 4EZ6A 4R4QA 2K5HA 2AQ0A 4B9TA 4QIWE 2P66A 4A3IH 5DLFA 4YCVA 4JI6Q 4UAWA 1OTRA 3PW0A 1WFQA 3CD6A 1VQ1A 3STBC 2Q2IA 5IE8A 2VA2A 1Z00A 4J9KA 2Q2HA 3UE1A 3AEVA 2NVQH 1SG9A 4LNQA 1L3SA 4QZDA 1XO1A 4ELUA 3T5KA 4YR2A 4NXMQ 3CMEA 2BQ3A 2IHFA 3K8AA 2QGQA 5J2GA 4I29A 5IYBG 3H4BA 2E2JH 4J15A 2W9CA 1P3QQ 1I5FA 2NRWA 4OX9Q 3KHLA 1RYRA 2Y0SG 3NEMA 2UVRA 4C2MH 2R8GA 1KSPA 4M6WA 3H4DA 2BWBA 5M5YH 1QVCA 3G6XA 4IPHA 3ZD9A 5H1SE 1JIHA 4HYKA 4YHHQ 1DO2A 4JI4Q 1NY4A 2ZUDA 4GN5A 4R8UB 4DOAA 3HX0A 2W8KA 3JPNA 4ECRA 2JEFA 3U4VA 2OQ0A 4F4XA 4IOAA 4IR1A 4KITB 4B3SL 5D49A 4BY1G 4QZFA 2AGPA 2AGOA 4AH6A 2DZLA 2BCRA 4PMWA 5CR0A 3I4NH 3G48A 1I50H 1RZTA 2MAXA 1O7IA 3CCUA 3KF8B 2W9AA 2R7FA 4JYAL 4BWJA 5J2DA 3M9OB 4TUPA 2VS1A 8ICVA 4JCVE 5FLMH 4O5KA 3JPPA 5HNKA 3QEAZ 2E2HH 4LF6Q 2IT1A 2UXBL 3H8JA 2C2DA 2L4EA 2I9GA 1CEZA 2MO0A 2JA7H 4KLUA 3RN5A 4E0DA 2DNAA 4ED7A 5KFBA 1NE3A 1N9WA 4O0IA 3ISCA 5GAEC 1T8EA 3STBD 1GVPA 1JMSA 3H15A 4DV6Q 4IOCA 1E3PA 5EWFA 2PI2A 1JE5A 3GTMH 3RBDA 4FBUA 2WB1G 3K9PA 5JUMA 2E5LL 4UB5A 1SRUA 3B0YA 1EQRA 4LF6L 4GKKQ 2UXBQ 3GTKH 4UAYA 3C5FA 2K52A 4LFBQ 2BCVA 5IT9c 3K75D 4KN4A 4LF9L 2C2RA 2DENA 1UE6A 1HH2P 1BPBA 9ICRA 2R8IA 3J81i 2XC9A 4JBWA 4TQRA 3C2KA 1E1TA 1VQBA 4HJ8A 1V1QA 4I2BA 1VQLA 4F5NA 1W3SA 4J9LA 4F5QA 1QSLA 3LCUA 4JK1A 1E7ZA 3MGHA 2ALYB 3EIVA 1ZQRA 3OJUA 4LF9Q 1TWAH 2XTIA 1HR0W 4A3MG 4EYHB 2ZJPA 4F5PA 2WAQG 2AQ4A 2W9BB 3IM1A 3RLFA 3L7ZC 4AYBE 4YP3A 2MGWA 3J80c 4G3IA 1TR8A 1Z00B 3OHBA 4EQ5A 1PHJA 2ATWA 2ZUCA 1TTEA 5KT7A 3ERSX 1Q02A 4I27A 3W1BA 2R8KA 5JI2E 1NK8A 1V43A 3MDCA 2JY5A 3GQCA 3HKZE 5IIIA 3JPSA 9ICOA 1IFYA 4YWKA 1X9NA 1SKSA 7ICFA 3KJPA 2LXKA 1X55A 4X64L 1XPUA 4IFDI 1HNXQ 2H5XA 4B9VA 1ZQXA 3GLHE 1QUQB 4C8NA 2A19A 3B6YA 4JV2A 2W8LA 2R93H 3AFQA 4I28A 3NELA 4QGUA 3MXNB 4BWMA 9ICPA 4QW8A 2GN5A 4UN2B 5C4JH 1PYBA 5DFLA 2KBNA 4HIKA 4DR3L 1BPZA 5KFNA 5AJ3Q 4PHDA 5KT3A 3RRHA 5GAHC 1VQDA 1XSLA 1NJXA 4BBSH 1AIPC 3HOWH 3HT3A 1TWHH 4RT3A 4FBTA 3J7ZC 4KHZA 5M3MH 4C3JH 3A0JA 4GC6A 2G3QA 1N33L 3F92A 4EEYA 4JG2A 2VNUD 2CWAA 1ZQSA 1HNWQ 1N36Q 4KLQA 5L9XA 1ZQHA 3Q8QB 3TRZA 4GS3A 4OONA 7ICOA 3SV4A 4ECSA 4NM2A 7ICVA 4Q8EA 3PF4A 4F1IA 2IX1A 1HUOA 1TAQA 1X3EA 2L15A 5JEAJ 3H0GG 2PFNA 4X62Q 3H40A 4GC7A 4DR2Q 4HIOA 2A1AA 4UB3A 4DS4A 4QJFA 1Q81C 4QZBA 4DR4L 1IL2A 1PH4A 4J9QA 8ICKA 2PI2E 1CUKA 5KFVA 2LBCA 1RYSA 1OXUA 1SFOH 3CC4A 4PZ7A 3RZDH 2BQUA 1SLJA 1DO0A 4YD2A 4EBCA 2EKFA 1NV8A 1X65A 2XCPA 4NLKA 1LUZA 5J3BA 1YI2A 4IRDA 5FLXc 3PX4A 3Q8LA 2JY7A 4BA1I 9ICUA 3GO5A 3NTUA 2K9DA 2JEGA 4O3NA 1BKBA 3FKIG 3JAMc 3S15H 8ICPA 2HHSA 2ISOA 4DUYL 3EPGA 4YQWA 4UB1A 4X5VA 4KI0A 1Q8KA 1EYGA 1I94L 4JI3L 1X9SA 5ELNA 4LFAQ 3RJIA 1J5EQ 2JEJA 1IXSA 1GO5A 4RPZA 3MR6A 2HIVA 4EZ9A 4F4YA 2JA7G 4RUAA 4A3EG 2MNAA 4HIMA 1XS9D 3C23A 5KT5A 2AJQA 5ELOA 4LF4Q 3BQ1A 1ZMWA 4RNOA 4O2DA 4ECZA 2OTLA 3A74A 3ULJA 2KNAA 4J9NA 1T6OA 4KLHA 1X9MA 8ICNA 3TANA 3PVXA 2BHNA 3KJOA 1YJNA 1XPOA 3EYZA 2J6TA 1AH9A 2P6UA 1OXXK 2R8HA 1UT8A 3RR7A 1X3FA 8ICIA 3KF6B 4XRHA 2N3SA 4IPCA 3V7LA 5J0TA 1K3RA 1S10A 4IFDJ 5FLMG 4C8LA 4M9HA 3K7AH 9ICFA 3IHPA 4Q44A 5KT4A 2ZM6Q 1OQYA 3LDAA 4EBEA 3CMAA 3KHHA 1L0WA 1WIVA 5F9LA 2PI5A 5KFMA 1VQJA 2FLLA 3HOVG 2VA8A 3ORYA 4BDPA 3Q8PB 1S97A 4DF8A 4DO9A 1MN3A 2WAQE 4A3GG 2UUBQ 4KLJA 3HOYH 4XA5A 4DV3L
chains in the Genus database with same CATH superfamily
4QZHA 3SI8A 1WXQA 2L09A 1NSFA 3GLFE 2DAMA 2CV0A 1HNZM 2ZJ5A 5KFLA 1KBUA 3J27B 3ERQA 2P35A 4UHVA 4UP7A 3LQRA 2IOHA 3Q8DA 1PJJA 1L3TA 1VDVA 1NK7A 2I1QA 3CCEA 4EBDA 2QB1A 4YVZA 5D4BA 1XSPA 3THGA 4RQ4A 4DL5A 4R64A 2WSEF 4GKKM 8ICEA 5C5MA 3GLFB 5DAUA 4PH5A 1AZQA 4XK8F 4DR5M 8ICSA 4EIWA 4DFKA 3DWQA 4R8NA 5CYUA 5E1FA 2HHTA 2ATLA 2K03A 4IRKA 5ELBA 4TQUS 3PO2H 1SNCA 3L2AA 2D5DA 2KMDA 1BCPB 4P0QB 5L8RF 2DHYA 5L1JA 4O3RA 4A76A 1VDLA 2K32A 1JOOA 1CHQD 2R7DA 2HHHL 2YTYA 2HWJA 3S2DH 2PMZB 4LZJA 1UEBA 3KZXA 1EQVA 1PFSA 4H02A 2KHJA 5DM73 5C3EH 2BCOA 1S4ZA 4OWTB 2ERCA 2VQEM 2KUMA 2JNHA 4A4IA 1NKEA 2BPGA 3RR8A 2O4XA 5AFWA 4NOOB 3AV0A 4K0KQ 4IL6U 4EVOA 2YB1A 1X6JA 4G7HC 4UBCA 4N9PA 4N8X1 3HKZF 4G57A 4QWCA 2JEIA 2KVMA 1XSNA 3S14B 3B89A 3LWLA 2PW5A 2UUCL 1EIGA 3UDXA 1B70B 3BQ7A 2D62A 2JA5G 2XGNA 4LJ6A 2YYZA 4F88A 4LF9M 1H9MA 1PH9A 2BA1A 1GOZA 4DR6L 1WTVA 2FPKA 3C58A 4RNMA 5HP4A 3QOLA 3UDFA 1CK1A 3J81S 1DGSA 2PZWA 3GDEA 2IL8A 2X6GA 4GNXC 4YMOA 2YMQA 5KG0A 4MHEA 2F0NA 5CV7A 3HOZH 2F4IA 2B2VC 2I0QA 4NRVA 5IP9H 3U6CA 4P17A 2YMLA 2F0SA 5FO9B 4TSSA 1BVSA 4IC9A 2GVBA 2YY6A 3PMFA 5JJLA 2J4XA 5C4ZA 4DKAC 3IG8A 4GZYC 3WK9A 1JJGA 4R3DA 3WU2U 3OTOL 1VQ5A 4QZAA 2RCFA 5A0LA 1KABA 1L0XB 3QUTA 1CRXA 1VG5A 2F0IA 3TP7A 5A2QE 2CWPA 2QSFX 1N34L 5EWEA 2UXCQ 1GUWA 2IBKA 3RD4A 1LTRD 9ICSA 1EZ6A 3J80E 2OPFA 3UMCA 1SMYD 4R4CA 5EOZA 4G7ZC 4FD2A 4A3JG 3D8LA 2F0PA 5L1MA 1D5ZC 2CH4W 3K92A 5D3IB 3C29A 5BPCA 3Q8KA 1Q82C 5JEAH 3LCVB 2WACA 2CPRA 2B2TA 4DQSA 8ICLA 3HJSA 3MR5A 1KXLA 3F53A 3EIEA 3K5OA 1XU4A 4A3IG 1PK1A 3KBBA 2YU9B 1L0YB 4BA2I 4ALPA 1LV9A 9ICXA 1HNZQ 1O78A 1NJGA 1JORA 3DLLA 1ZQNA 2DZOB 1LTAD 4GH9A 2Y21A 5DQHA 9ICIA 1K8MA 1KHIA 1HR0Q 3E2EA 5G5HA 1Y1VB 2J7ZA 3WKCA 2AWOA 3KSXA 3E5SA 2BJWA 4XT3B 3TFSA 2Y20A 1N63A 2BPFA 2KZZA 2P5ZX 1CKOA 5L37A 1ZD5A 5F2DA 2KCNA 3VR2A 1WTQA 3T1HQ 1WCLA 2G06A 3KOWE 1X9XA 1KFSA 3BYYB 3JPQA 3SYZA 4H13C 1EFWA 1JN3A 1BPDA 2F5SA 4GLXA 3SD7A 4L5QA 4M6WB 3PX0A 1VF5C 4G3OA 3RFWA 4C4TA 3KP0E 4C56C 4POGA 2CCZA 3I56A 4IQUA 3LNNA 5IY0A 2Q2TA 2OEOA 4DFAA 3PXGA 1TU2B 4DV4L 3GPYA 1Z59A 2RDJA 2BDUA 2ALZA 1T3QA 2VY3A 3T38A 2OTJA 4B9LA 1VQIA 2GH1A 3QYBA 4DSKA 1PJSA 1Z5AA 1NKCA 4DWIA 4XDXA 1UWVA 4YWLA 2EZZA 3QZ8A 3GU3A 4M9GA 1LACA 3QXGA 3FUWA 2Y0SC 5CB1A 5JEAG 2ZXIA 1YNND 3OYYA 2QKQA 1KDHA 2DJGC 3TS2A 1AW7A 2OOAA 1WYGA 1GXDC 1X3PA 1UQVA 2QF7A 3RH6A 2UU9Q 3E9IA 1IXRA 1VQAA 3E0EA 1UNSA 1V34A 4JI5Q 3UMMA 5J0QA 5KG7A 4OL7A 4JVZA 1A3TA 3R9XB 3MR2A 2ES2A 3QU4A 4WORA 3M8SA 1B43A 3EZ5A 4F5RA 1TWGH 4BXXH 5EWGA 4K5XA 4C3IH 3H3VH 4JV5L 3LQQA 4JI0L 4X64M 1VQOA 4B3RM 4MZ9A 3GTLB 4MIUA 2IJ0A 1SJED 2XVSA 1ZQKA 4Z6DA 2FPMA 5GADC 2D0PA 3ETLA 4DNIA 9ICLA 2JEAI 2ZIWB 2QCUA 4MEYA 4DL4A 2CV1A 1IL8A 4QZEA 3QB3A 4QNMA 1AQ6A 1JXEA 2DXIA 1QB5D 3KFUG 4B9NA 2WINB 4NXML 3GO8A 3S1QB 3M4QA 2VIIA 1TS3A 4YD1A 3C1YA 3TEHB 3QZ7A 4JI5M 4B7FA 1TDZA 4ECUA 2DPIA 1XC9A 4YR3A 1A6SA 3K5NA 8ICWA 2EY2A 2LY7A 3AFPA 5KFFA 2HHWA 8ICZA 3UM9A 1NBWA 5ELCA 1IBLQ 4QHTA 4Y2QA 1MKHA 1WCMG 2HHHM 2JP1A 1KTQA 2O25A 2Z8LA 4UB6U 1S77D 1VQMA 2L11A 1CT1D 4B3TL 1JX4A 1L1OB 1ONLA 1ZQTA 4DV1Q 1G41A 3C21A 1GUOA 3AQQA 2DL0A 5DKWA 2L6OA 3N6RA 2F0TA 3QO2A 3NVZA 4A75A 1EIJA 4QJFB 5J2EA 4LUOA 5BN3A 1FL0A 2R92G 2WB1F 5E4XA 4X65Q 3I3CA 1WUDA 4UARA 1FFVA 1HIWA 2XIDA 4HIDA 1E2VA 1ZRMA 4JI3M 1UUPA 1XNRL 1N32Q 2ZIVA 2NZHA 1JR3A 3TACB 3SR1A 1OXVA 3QUCA 2BQRA 4MFCA 2H3FA 9ICGA 5CR3A 5HGQA 1K73C 2A6HC 4Z6FA 1D9DA 1QWYA 5JU5A 1XNRM 3PMLA 1QOHA 4FCVA 3MVVA 5ALSA 1D0MA 1NNLA 5L1IA 4KN7C 3ZDEA 4LUVA 1OAIA 3H94A 1K5OA 2HHQA 3E4RA 1VS0A 1G2TA 2A1JA 8ICOA 4B3MQ 3A0BU 2YQEA 2D7HA 3BU2A 3OOCA 4RGOS 4O3OA 1CKNB 4YMNA 1V92A 2W11A 2LMCB 2RHSB 3ICXA 4F8RA 4RQ2A 1L5UA 4EQPA 4KHVA 2R7ZH 2FOIC 4II7A 3A8KE 3U6LA 2RHQB 1N5WA 4DL2A 4Q8FA 2KCMA 5CV6A 1T3NA 4LRTA 4M0DA 2IA6A 3MAQA 3QNMA 7ICGA 1VCIA 3S1RH 3VA7A 4OXPA 1XNQQ 2Z7JA 1D2NA 3I01M 4QW9A 8CATA 3I4OA 1KD1C 3NPPA 2ISPA 3ULLA 2VQFL 1KIXA 1E32A 4B9UA 3A5ZB 1HT2E 5EPKA 3K0XA 3CAMA 1EWHA 1NZBA 4BBRG 4KLSA 4DCCA 2K5NA 4OO1I 3SAGA 1GUTA 1G8ZD 2KJ8A 2FPLA 3N7SC 5ALOA 1SL0A 1SBBB 2BCUA 1S5ED 2WKCA 5ELFA 1A0PA 3N7RC 1Q12A 2IPKD 1D9FA 4LJ9A 4A3KH 5AM2A 5KFIA 4ED6A 1L3VA 2KTQA 3SK5A 3KS8A 4A3FH 2K28A 2A5HA 3M4OH 2PNRC 1S9FA 4A3BH 4JK1C 2G09A 3GTOB 4DAMA 2NVYH 5HHHA 8ICFA 4Z8XA 3MZ5A 2K5VA 2NRVA 4KKUA 4M9NA 1J9OA 1GJXA 3R8FA 1RXVA 3HY5A 4JV1A 2R92H 4L8JA 4RGMA 2OXOA 2F0EA 2EUCA 3T6PA 5KNBA 2FHTA 1Z9FA 2PQEA 3BQ0A 5HR6A 3GTGB 5J2KA 5EPLA 3AQEA 1PTOC 5DQGA 3NVVA 4XGIA 3E3XA 4L6TB 3JAMi 3CCQA 2UXDL 1NK4A 5AK4A 1S5LU 3BQTA 1BO0A 3T3FA 1KAWA 4JI7L 2FMSA 1AE2A 5AJ3L 3E21A 2E5LQ 5HHIA 2MUTA 4UB2A 1D1KA 2DGYA 5DYGA 3HS0C 1BXTA 4UY8C 5E7NA 2MPMA 1LB2B 1T94A 3F2BA 5BR8M 3PNCA 4HEDA 2JXJA 2E74C 5J0WA 1HPCA 8ICCA 2BOSA 3ZDBA 4FF1A 1LM0A 4DQRA 2F03A 3CW2C 3Q8SB 4P74A 3K6OA 3Q8MA 3BS5B 4BBSG 1LYLA 3GILA 1SL1A 1COKA 3DFZA 2XSZD 3HHYA 1MI2A 4JPBW 4FWGA 1XNSA 2WF7A 4A3KG 3WK6A 4KMUA 3SENA 5J2JA 3RJKA 4CJ1B 2W9BA 3V7KA 1ZQ1C 4J9OA 3HJEA 1NSNS 1VDZA 3UJNA 4US9A 2E5SA 5J0OA 1ZQQA 2JUJA 2G0AA 3PO4A 5KFKA 4DFMA 4I2FA 3V72A 2B2UA 3TFRA 4JBKA 3TAPA 2CW0D 1NK9A 1R6BX 4GRIA 4RA8A 5HMMA 2R45A 7ICNA 3K81C 2F4VL 3HOZB 1B44D 1TWCH 2R93G 3ER0A 5HGTA 4FWHA 1PUZA 3I51A 4PL2A 5J0SA 2ID0A 2MR9A 1W6JA 3HOWG 1D7QA 4A3EB 3MC1A 4YIJA 4D81A 2FMPA 4JBJA 4QL5A 3AFHA 2K8BB 2AHOB 4KLEA 4NXMM 3FD9A 1YEZA 2HI0A 1JWSD 4GHAA 2BE5C 3IECA 1STEA 2CH4A 3MFGA 1K83B 4O5EA 5KAFU 4KK7A 5C6AA 1Y1WG 2ASJA 4DR4Q 4DFPA 3RB0A 1VQCA 3J80S 4QZ9A 1S0VA 2EYMA 2LKVA 4DR2M 4O5CA 5ELEA 2UUAL 1NNJA 3RB4A 3PIPA 3QAUA 1ILPA 3I04M 2OHFA 4IBFA 4F93B 5KO3A 9ICVA 2PMZC 2X8AA 2HUGA 1MU5A 1Q1BA 4APVA 1VF7A 1TKDA 9ICMA 1C8CA 2DAIA 2EJSA 4X6AH 2MHVA 1LVHA 5BOLA 1LT3D 4RGTA 1L7NA 2LYHA 5ALWA 1QQ5A 3KK7A 4X3TA 1TAMA 3G4SA 1Z5BA 4DAYA 2QARB 2NZOA 2ZXPA 3SYKA 4B3RL 3DA1A 1PGYA 3ZCBB 3M9MB 3H4JA 4RQNA 1PH5A 2X49A 2QBYB 4JI8Q 7ICJA 2RCNA 1QJOA 3S17B 2I5HA 3VLFB 4AG5A 1JUDA 3PW4A 2HHVA 3F1ZA 2JA8G 4KHPQ 3C1FA 1IBML 2Z6BA 4ULLA 5EPJA 1HT1E 1K1SA 1HCZA 3AJIB 3TZUA 4I81A 3OSNA 3UXPA 5M3MG 2F0WA 2BNKA 4I2IA 3CGWA 3HHZA 1DYQA 1OAOC 4ZAIA 4HTHA 1XWIA 2E5LM 4E6IA 5C44H 4KV6A 3CCRA 2JP7A 3G6YA 4TURA 2ZTCA 5FK9C 1ZD4A 4GFJA 2LSSA 1O7YA 1TY2A 2CFOA 2E8NA 3SARA 4ECQA 5C5JA 4CDEC 4KLNA 3NASA 2KCTA 5FJ8H 3GLGB 3QWNA 4X66Q 3BZKA 5ALPA 3BDCA 1J5EL 1E9RA 1VQNA 1NI3A 1G4AE 1M8AA 1M6YA 1HUNA 2LYAA 4PL1A 3HZJA 5K36H 3SAWA 5EAYA 2B2YC 4BLCA 2H1EA 1ZAEA 4D82A 1PXUA 1H95A 1A3VA 1YJWA 3PMNA 3DWPA 1NO1A 5JI3E 3J81j 3GLGE 4ED2A 4IUUA 3NBHB 4BBRB 1TR5A 3QWLA 4NLGA 9ICNA 4M0WA 2EZVA 4A3BB 4M8AA 1PRTF 4BXXG 4YY3Q 1X54A 5M3FH 4XQ8A 4C3HG 1WD1A 4WJ3M 3RLNA 1YLAA 4RQ0A 4KMOB 3C5GA 2HMXA 4I2JA 1WCMB 5HY6A 5C0XI 3KOXE 1HQYE 2E2IH 2DWLA 3P75A 1NNUC 5CV4A 1BDOA 1B2TA 5KFYA 3SC3A 1TAUA 4LF4M 3RJHA 1GVNA 4P73A 4GC9A 4P0PB 3K7AB 1EQQA 2LNHC 2KE7A 5KPTA 4GXJA 3WK4A 4K2LA 2DJFC 1T43A 5FOBB 5JVG3 2W7PA 2N8NA 4DSEA 5ALVA 4IBKA 2F3VA 4BY1B 1QZEA 1F2ZA 4ME5A 1LV5A 4KLKA 4CF3A 2X4AA 4BXOA 1XHBA 4RH6A 4LF8Q 1VQPA 2OXPA 1JQJC 4DV5M 2YR0A 4RNNA 1FFUA 5JJKA 1Y8GA 4YCXA 3K2LA 3DZDA 2UU9M 3FAHA 1IN4A 3SFZA 1MSGA 1YVCA 1PTOH 3SK8A 3ZYYX 2V1UA 3PSTA 5I2YA 2JY8A 4TVAB 4X62L 3X3NA 4MGHA 1G51A 4G6ZA 4JYAM 3UMBA 3EN2A 3TREA 5KGUA 1QVGA 1T4GA 1WI5A 2L12A 2XY7A 4HJ9A 5KG3A 5KFOA 4QWAA 1QAQA 4NXNM 3RBEA 2D7EA 2F0DA 2RHFA 2PCFB 3R2IA 4R9WA 5IP7G 4DR7Q 4R4IA 4PGQA 2SDFA 9ICQA 3PX6A 4NPSA 4C4RA 2NVYB 5KNDA 4OWXB 3T16A 2F8LA 5DLGA 1T5EA 1ED1A 3KKAC 3EW9A 2OM6A 1I94Q 1B4OA 2RDIA 4IBDA 4G4RA 1JR3E 4QZGA 4EX5A 3P7JA 3D6CA 2Y1IA 1L1ZA 5TZVA 5DBAA 3CCJA 4GN4B 4U6PA 5CV9A 1UA1A 4B08A 7ICSA 5IYBH 5CEHA 1II3A 4NXNQ 3WKBA 2OEHA 1PH3A 2ZXOA 2KHVA 2W54A 3I4VA 1A3UA 4A3EH 3ONNA 2KFNA 8ICTA 1O80A 2C9CA 1A62A 2HW3A 1Q1EA 2KNJA 2LS01 2NTSA 2R7ZG 1Z6TA 3H4MA 4DXFA 5FLXS 3GTKB 3IFDA 2MJ5B 5EP4A 2LMRA 2O6KA 4YHHM 3D31A 2ZIXA 4ECTA 2K50A 4HJAA 5KFCA 2KA6B 1AH9A 1JICA 4LGYA 2KSOA 3FYHA 5J0RA 3FKIB 1PTOD 3HKSA 4DUYQ 2UVVA 5ITYA 3KW6A 2FJ6A 2G08A 1WCNA 3ALRA 1FJGM 4F4KA 1B1ZA 1T7PA 1RCVD 4RAUC 2NO5A 3EROA 3NHHA 1BPYA 2EQSA 4JI3Q 1K3WA 2CHVA 2CRUA 1SYGA 2A68D 4UPAA 3S1NH 4M47A 1LT5D 4WRDA 2J6SA 2F8KA 1YBYA 3EWAA 5DLQE 2LTUA 4AYBC 3T5JA 3NQIA 3I76A 2L7HA 3K4GA 4K0KM 2DGZA 2LFNA 3PUWA 8ICBA 4FYDA 3EVQA 3SZ2A 3I91A 4PPXA 4DUYM 1JROA 4AYBB 5ITXA 1N33M 1Z4OA 1WTOA 4FXGC 4GN3B 1ZQOA 4JV0A 2LPEA 5KFHA 4RF1A 1OXJA 2LBOA 4CRXA 1HZBA 2B2VA 2M9VA 3HOUB 3SV3A 3S9WA 4CDDC 5KAIU 1CFMA 1JI7A 2D7GA 2VA3A 2F0OA 3W0LB 4QWBA 4JI6L 4B3TQ 3OWFA 5EXTA 3RJGA 3VCBA 4ELTA 9ICAA 4QNRA 4HAIA 4WJ3B 3CTWB 2FFKB 1X2IA 3MDAA 2MQHA 2X69A 4NXZA 2FDRA 5J2IA 4I2EA 5C0YA 3BVZA 1CA5A 2DKLA 3GZFA 1BPXA 4JWMA 4JI2L 1YUBA 2JV3A 2WFWA 5ITUA 4X65L 3AL0B 1X3QA 3M4YA 3H8MA 5IIJA 1NJWA 1IHZA 4M9JA 4KLJA 3L26A 4F2LA 3I28A 4Z6CA 2GA4B 2SNMA 1DOQA 4PGYA 4CDFC 2GNOA 4LF5L 1PRTD 1FVIA 2I5MX 3U9OA 1ZXIA 3RZOB 1HZ9A 4FO2A 2IOFA 5G3LD 2QB0B 3M9BA 4FFDA 2BCSA 4F50A 3CXCA 4CHTB 4DL6A 2KSOB 4P4PA 4O42A 1TWHB 3D8GA 4DV3M 1CZWA 2JJQA 1PYWD 1X3GA 3DM3A 4DV2Q 4NC6A 4ZOHC 1IG6A 1NAPA 2IHNA 4YR0A 4NL9A 1Q3LA 3L4PA 1IM2A 1D0LA 4R7GA 3LGJA 4NMZA 3FP9A 1FYCA 4KLFA 2EO2A 5AKYA 2ZXHA 2VUMB 2DN8A 1ZKOA 3KYHC 1TXYA 3SHFA 3GTQH 1J8IA 5ALIA 5KYLA 4K14A 2LI6A 2K8AA 2ZJRA 5KG2A 3GQBA 3FUTA 1SV0A 4KY7A 4B9MA 4A3FG 1YITA 2F1HA 1EOVA 2QHOB 1JQYD 3H09A 4K0KL 4U68A 3QE9Y 1QUTA 5EXXA 2CHBD 4I2HA 4LGMA 1IYUA 1VJ5A 2EYHA 3CHBD 4G4KA 3G71A 4JC0A 4DV0L 3K7UC 4RUCA 1BF4A 1EEFD 4CF4A 3RH4A 1XMQQ 4DV2M 3PGZA 3RF9A 2W04A 3M8RA 4JI2M 4S3SA 5J39A 2OCEA 4QZCA 4LZZA 5AKXA 2QARA 5ALZA 3BXWA 3G6VA 1SE3A 4RFBA 3SBJA 3D8BA 5KFEA 3GV7B 2LH0A 2HVIA 2HHUA 4G4OA 4GXIA 2BPCA 2WF8A 2ICIA 4DUZQ 5FLXL 4UQGA 3C3EA 1HUMA 4FS1A 1RL2A 4R8IA 2NVTH 5IODA 4XYOA 2UVUA 4LFCL 4AKGA 1B53A 2AUJD 2KA7A 2XNAC 4RKBA 5T1IA 5I4DA 2AQ3B 4IBGA 4KD4A 5IWAL 5C3EB 5EJWA 2JHDA 5BOMA 2AMCB 3SXHA 5JRTA 4UATA 4GLVB 5ALHA 2RRDA 3EIHA 1STBA 2AUKA 4GOPC 4TUSA 3UE0A 1LO5D 4QMGA 1NHWC 5HMLA 1U4RA 4YWMA 5C18A 2JZBB 4YCUA 2XWJB 5J0UA 1PVOA 1HFNA 3PO5A 1SKWA 1XMOM 5KG4A 4RGNA 2CRXA 3I4YA 4B9SA 4RU9A 2XSZA 1NTGA 2MSNA 4L5SA 4GKJL 2JMGA 1Y8NB 2RRUA 3ZJYC 1GLNA 4QZ8A 5E6JA 3J7AV 1NCVA 2BGWA 1TWGB 5ALRA 4Y2RA 5GTHU 1I50B 1L1OA 5KFGA 1KTKA 2BCQA 1YNNC 3BVGA 3OSPA 2I7PA 3L29A 4DFDA 2Z4HA 4KT0F 3AU2A 1DOLA 2B29A 1TF0B 3HJQA 2OOBA 3J81c 3B7ZA 7CATA 4N9TA 1Y1WH 1F5SA 7ICKA 3V6KA 4BXOB 2TSSA 3OHXC 3OW7A 3HX3A 3B74A 1HZCA 3S1QH 1Q46A 1A8VA 4MGKE 4LMQD 2UU9L 2I6XA 1IKLA 3KSJA 2Z3XA 3M7DA 1X37A 3L5KA 1T5XD 2LHTA 3C2PA 2ZM6M 4HMJA 3V6HA 1SEBD 2EY6A 1DONA 3KLRA 1IYJB 1RJTA 3GD7A 1VLBA 4WFN3 1WOCA 3SAFA 4BUGA 1SNPA 2L2DA 2FLPA 5A2QL 3GV8B 1N75A 3H0MB 4LZDA 3AOEA 3N28A 4ECVA 5AKJA 2R8JA 1EZ8A 2GOLA 4IURA 2LVAA 1DK3A 3Q22A 1JT8A 4ZQ3A 1QDTA 3IDWA 4K2KA 4R1JA 4GEWA 1CM9A 1ZQLA 4UBBA 4IRCA 3A54A 5M5XB 2VIXA 3I7FA 4GKKL 1KFTA 1X56A 4KJOA 3VR3A 4ID6A 3JR4A 1KRTA 1XNRQ 4MGZE 1PZKD 5K36G 2F4VQ 3M7GA 4OJ6A 3GPXA 5AI5A 4LUZA 5AM4A 3GQ5A 3HJ8A 4KLLA 3UMGA 3TP6A 1X6IA 1I4QA 1CA6A 4JWNA 3KLWA 1S72A 4ZH4A 3HU2A 2P6RA 2KRKA 1M4VA 1STYA 2F0UA 1W2BA 1CI3M 1VEJA 2VF7A 2NRZA 1TWFB 1XPRA 1D8LA 5AKKA 1S40A 1IBKQ 1HR0L 2EYFA 4DLGA 1TV9A 2B2UC 5KL1B 4DK6C 1R4QB 1XMOL 4LJ5A 4C8OA 1E94E 1HR0M 1NMFA 2GLEA 2YTXA 5IZ7D 3F8TA 4MNOA 5M9OA 2B63G 4NLNA 1Q3VA 2VXWA 2E1EA 4YCWA 2XI9A 4ZKCB 4FF4A 1URJA 3HOVH 4KO8A 1PK3A 2R61A 3VFDA 1KFDA 2LVNC 1SMYC 4M9SA 5JPMC 4YN4A 1SXJE 1SXJC 3GIMA 1PMRA 2DAEA 5FSWA 2ZANA 4KLDA 4EELA 1G59A 2KZMA 1GM5A 3T79A 3C2MA 1ASYA 5KTQA 3S24A 3K0YA 4GNXA 3PF5A 4JV5Q 5FO7B 4DLEA 3R3OA 4JI4L 5DG7A 4MFAA 2ZAOA 1QTMA 3MGVA 3RMHA 1SXJB 5J0YA 4J9SA 2HOIA 1IBKL 1BBUA 2XVTA 3QX7A 1OKSA 3PZPA 1U48A 2LM1A 2IHMA 4NP5A 4X64Q 5KFJA 1WTPA 4EX7A 5KFTA 5H37D 2ZIXB 1VQFA 3C28A 2Y0SE 4JI8L 3HOXH 1XMOQ 3C3LA 1EIFA 4HN7A 2EE1A 3GTOH 3JR5A 3H6MA 3CF5A 3W3AA 1S3OA 1MSWD 3PV8A 2Q2EB 3MR3A 4M9LA 1B7YB 4JI7Q 2XRSD 1ZQIA 2KNZA 4DV4M 1IXZA 1JR0D 3L28A 3H0LB 4BWGB 5I6YA 1L6NA 1MGSA 4ED0A 4ED8A 4RF0A 1NOMA 4FNFA 4HMIA 4CJ2C 3V7JA 3DEPA 1BCPD 4DBGB 2LKYA 2KD1A 2EYOA 4DGZA 1MJCA 4AW4A 2B2WC 1ZOLA 5ALUA 2EYPA 5D3DA 1MC8A 3PY8A 3J2PB 3KVWA 4IFDH 1PJIA 5JTIA 4DFJA 1KRPA 1HA5A 3HOWB 2DWMA 2CXYA 3FDSA 5DG9A 2XGPA 2B6GA 1H9SA 1B22A 3M6ZA 2D0OA 3W1GA 4NLBA 3K59A 3MA2B 1X40A 3OHAA 2KZ3A 1L3UA 3EBEA 4DV6L 4KLIA 2M5ZA 3NP8A 3NRZA 1YNJD 2Q4TA 3RRGA 3KLSX 3W2DA 1XJVA 3RZOH 4IJFA 2F3NA 4KMUC 1GL6A 8ICHA 1KDBA 2DUYA 4V0BA 5ALQA 1UCVA 3R9KA 2N55A 5ALNA 1GABA 4I2DA 3OTQA 4F71A 2F52A 4TQSA 1ZQPA 3HHWA 3HGIA 2B8FA 1G91A 4K4HA 4K4IA 2C22A 3L25A 2RSNA 4BB9A 3N52A 1GHJA 2OF1A 3JPRA 2XN9C 1PH1A 3PUXA 1N32M 3A55A 2N49A 3NE5B 2OQKA 3FEWX 1GKHA 3U6EA 2IOFK 4BGDA 4XTCS 1U4PA 5BN4A 2V1CA 2HBJA 2LYBA 4QZIA 4J9PA 1A15A 5I9PA 4B3ML 4OWWB 3A5UA 5F3WA 4Y2VA 1SL2A 1BUVT 1U4LA 4C3HB 3TQ1A 2JGAA 4C3HH 1N36L 1ZD3A 3H3VI 3TQSA 3BZCA 3E58A 2VKQA 1JJCB 5BR8Q 3A8JE 3NWLA 2JY6B 4R71A 4IBCA 1KFVA 2F3WA 3R93A 4MN3A 2FE8A 1Z1BA 5EP3A 2BR0A 2N78A 3L2PA 1A2UA 2I5LX 3KBGA 3AN1A 4I2CA 3I2ZA 3MEHA 4CJ6A 1TH4A 3J7BA 1RDFA 1RM6C 3TSSA 2CE7A 5F9NA 2VQFQ 3U58A 4CCHA 4A93G 4P4MA 1SNDA 2FINB 2JQOA 5LMUM 4KN7A 1XNQM 1VEKA 8ICXA 2EKKA 4MFFA 2CKZB 2G5IB 1NK0A 4FW9A 2Q0ZX 1J2NA 3HRZC 5I2XA 4R4OA 3EFXD 2B8GA 4GXKA 2OT2A 3S2DB 2AH5A 3OJSA 1P16A 4G7OC 1E24A 3E9HA 3WKEA 1HJPA 5KFWA 5DDMA 4NLZA 1F2MA 4PHAA 3T1YL 3IV6A 2WF9A 4GMQA 2XZFA 3E46A 4DN4M 1HNWL 3HP6A 4RKUF 3BDLA 4A3BG 1L2FA 4QIWB 3KOJA 2WF6A 1SSOA 1O7ZA 5ALFA 2CQAA 2FXQA 1Q7YC 3GTLH 2HBMA 3L0OA 2K5WA 3MFYA 3WK7A 4LJAA 4M04A 4QCLA 2NO4A 1VQGA 4JW0A 8ICAA 4W5WA 2HBLA 1SR3A 2RDFA 1RODA 2H1RA 5GQOA 3E0FA 2Y9TA 2R18A 1S0NA 1L7MA 2L0CA 5KYIA 4LY6A 5KFAA 3P20A 1G6ZA 2UXDQ 1OFHA 4DV4Q 4IQTA 3HOYG 1QLNA 2D3DA 2F0FA 4IS7A 5AK5A 1FNUA 3D3RA 2C5RA 1FR3A 4K4GA 5J2CA 1ZMVA 2PQAB 4LF7Q 2C98A 2KFZA 3S17H 1TWCB 2QCPX 1TK8A 3RFAA 3M0EA 3ZDDA 4HSPA 3RNUA 3PO3G 3JAME 3TZDA 5ALGA 4JBMA 2ZIUB 2WHEA 3C2LA 3AYHB 3FDTA 3FMCA 1S5FD 3GPUA 4NLCA 4UAVA 1MQ3A 2I46A 4IJLA 4B3RQ 3CU7A 2UXBM 1LT4D 2G5DA 1HNZL 4IUVA 5AK6A 1LTTD 4BY7H 1ZQVA 1MJGM 2Z6KC 1KLNA 3AU7A 3GTPB 1GJSA 1RF2D 4Y2TA 1F77A 5C44G 4LFAL 1SFOB 2J7NA 4MGIE 4Y2PA 5C1BA 2GWSA 2JR5A 3I1YA 3K8ZA 3KD3A 1UA0A 1NK6A 1CKNA 1PDQA 2CFMA 3RJJA 3D4DA 5T1GA 4FO6A 1QNUA 4C3IG 1GL7A 1QZMA 3WKAA 1L8QA 3T51B 5M5WB 2E8MA 1PH2A 3W68A 3DHQA 4C8KA 2R93B 3ICEA 1C9OA 4I7AA 4OX9M 2KHHA 1IXRC 2NQ8C 2QLTA 1IN5A 2Y0QA 1EIYB 2VUMG 5C4JB 1C1KA 4REZA 1OW5A 3WK8A 7ICLA 2VJ5A 1SN8A 3G6EA 1QZGA 3U5ZB 4U7CA 1BR9A 2B3GA 3KF6A 4IJHA 4TRDA 3PO3B 3J81L 3S1MH 1L1TA 4PZNA 2IWHA 4A3DG 5C4XH 3G7LA 3AMZA 1FO4A 4FS2A 3DWAA 3V6JA 3IN5A 3FRIA 5IGGA 1Q86C 1WD0A 3O0FA 4X65M 4BJQA 5AI0A 2E75C 3AMUA 1E22A 1Y1VG 1Q39A 2H4OA 1ZV1A 4OJ5A 3CPWA 4DR5Q 4MHVA 5KT2A 3LK9A 2V4RA 4JI2Q 2XFTA 2QB0A 1GHKA 2ZIWA 2ASDA 4ECXA 1A77A 1V97A 3OTOM 2CP8A 3FYCA 2F5PA 2KNVA 3ISBA 4DUZM 4B6JA 4I2GA 8ICYA 1UEAB 5GAGC 3PSPA 1YE9A 5JPNC 3ILKA 1I6HH 3BYTB 2O01F 5C0XJ 1XTDA 1B50A 5FTMA 2HHXA 4IQVA 2HCFA 3BQ2A 5C3EG 5CRXA 1NJZA 5CV8A 5KQ8A 4L5RC 1QVFA 3BG3A 4BBAA 1YNXA 1GUNA 2DNEA 1UT5A 1C7YA 4JUZA 4IUQA 4A3LH 2E2HB 4MH0E 2F0LA 2NV3A 2E8GA 4LAAA 4DXGA 1K9MC 5IYCG 2IW3A 2R65A 2PKEA 7ICHA 4DAPA 2K0BX 4PCZA 3QUBA 1XO0A 2UUCM 1EY6A 1FNVA 1T9HA 4GIPA 2K75A 4DV1L 2LHCA 5IGDA 2JA7B 2UXCL 2K1BA 1CSPA 2KG5A 1M1KC 1SROA 4J9MA 1ZJMA 2XY6A 1I6VC 3NTKA 1VQ7A 3QU5A 3J7AF 4A3MH 4YFKA 2B2TC 1B9MA 5IOCA 1JB7A 2BZFA 3GTMB 4O3SA 2EA0A 3LWMA 2KZUA 3CF0A 5E26A 4NB3A 1ZQBA 4M9ZA 3URYA 3UPQA 1NJFA 2F3IA 2F0JA 1DD2A 2WIIB 3DMUA 5E3FA 4O3PA 4DR7M 2KVCA 5FJ8G 2PPBC 2NRXA 8ICQA 4DK0A 3J80L 3CC7A 1YHQA 2JA5H 1KYIA 4Y2JA 4O1NA 3JPOA 4P71A 2JA5B 4AYBF 5KT6A 5KFZA 5ITTA 3RB6A 1JR3D 3UQ2A 2QW7A 3W5OA 4YG2A 2XWBB 3PFIA 3GP1A 3PCOB 3SHGB 1WYDA 1A63A 2WP8J 3PO2G 1AROP 1VQ6A 4KX5A 2A69C 1QANA 4DV6M 4WJ4A 4PT5A 1SE8A 5DBCA 4A3CH 3Q0AA 4ZKBB 2HIXA 4KKSA 3F2CA 5IYDH 1YT3A 4UP9A 3BVMA 3IL8A 2JA8H 1ZQMA 4F4WA 1VEGA 2EJMA 4J1MA 4J8QA 4C2MB 1IV8A 8ICUA 1BNPA 3PW7A 5L1KA 3KJPA 3KDSE 1QVRA 5C4HA 4GNXB 4RQ7A 1DXSA 3T53B 2MFIA 5GROA 4GLAC 4HL4A 1OXSC 4NY8A 2VW9A 4KY5A 1UFZA 4DR6Q 5EBCA 4CKBA 4KX3A 2VQEL 2HKJA 1ZQEA 1PVPA 5AKGA 1SZHA 2ZJAA 4RNAA 4X66L 3GIKA 5IP7H 5ALEA 3KOYE 1H6UA 4C1NI 3U60B 3MFIA 2EVBA 3HPOA 3CF2A 1KLGD 4AKIA 4QY7A 1STAA 3NGDA 2F5QA 1ZRNA 3Q8RB 2XLJA 2WAQF 4CGZA 3U61B 5H2FU 2R0IA 3K1ZA 1IBMM 2LVPC 5DB9A 2HCBA 4Q43A 3BJYA 3RJFA 3MK6A 4TUQA 4L16A 4RQMA 3UXNA 4B7HA 1MD2D 7ICPA 1PZJD 2V1CC 2L5TA 5KFXA 3C3DA 4ABNA 3OMGA 3PIOA 1NV9A 3AM9A 5LMUL 1KEJA 2NZ1D 4UDUC 5EXSA 2ASLA 4IPGA 3PW2A 1OTCA 5JAVA 1DOMA 3M85A 1N33Q 4PHEA 2C28A 2XGQA 3MBYA 1K0RA 1Y88A 1N8RC 2E8OA 1PFNA 3FC4A 4C80A 3U4ZA 2K6BA 4CNQA 5KG5A 1Z47A 4XQQA 2MA1A 1O08A 1ZQUA 2JH7A 2RQXA 2DF4B 3SQIA 5KNCA 5AHXA 1SZPA 1EY5A 1ENCA 2IY5B 4FXDA 3I4MH 9ICEA 1ESRA 2IX0A 2JZ0A 2O5RA 2DAGA 7ICMA 1I4RA 4LF5Q 1ZQWA 2JEBI 4ZCKA 2DFLA 5J22A 4QWDA 1U49A 4DQPA 3HKZB 5COYA 3SAVA 3FPPA 1G71A 2PO4A 3KZIU 4JI6M 1SNQA 2NVXH 3H8WA 1NNXA 4OX9L 2MRLA 2NVXB 2VUMH 5AIBA 4DL3A 4KODA 1BPEA 3S6JA 1S76D 1UE1A 4NKLA 4TKOB 4F72A 3T5LA 5IGFA 5IT9E 1SXDA 1PRTC 1ZD2P 1NJIC 1IKMA 1RTNA 1EIHA 4Y2SA 4DQQA 4IPDA 1KQSA 3ONAB 2KHIA 3WOEA 2CUZA 1EFID 5IIFA 1VQ4A 3PR5B 1ZQJA 7ICUA 1VQEA 4FP5D 2UUBL 2O5IC 5J2BA 5D46A 1KL9A 1DK2A 4YHHL 4DV3Q 5JJIA 2F5OA 2XFSA 1Z7TA 4U673 4KLTA 1NJYA 4A93H 4UB8U 1EWCA 1U9LA 5M5WH 4DR1M 1QYRA 2KKPA 1UE7A 3GP7A 3KS4A 4DSIA 2Z6KA 4J6HA 3GQ3A 4JI8M 2ASBA 4PGXA 5FTJA 2C2EA 1RIPA 2KOBA 2C35B 4I65A 4JYAQ 1ORYB 1WJJA 3V2TA 4CF5A 4RT2A 1A6XA 4I8OA 2ZM6L 5DB7A 5KG1A 5CMDA 1IBLM 1R2YA 2V4DA 3ULPA 4X3KA 4AQYM 2L1BA 3NUQA 2F0MA 8ICJA 4NXNL 3CRLC 4IR9A 3HFZB 1UE5A 3M4PA 1B9NA 1ET9A 4XBOA 2KEEA 2W3SA 2XICA 4I4LA 1S0MA 3OIPA 1IN6A 2BDOA 3GRUA 2DI0A 2K60A 1ICFB 4LFCQ 2BH8A 3I72A 3NENA 4QWEA 3O13A 4RQ5A 2F0QA 4JI5L 5JJZA 3CCVA 1U4BA 4DR1Q 1YIJA 1TVXA 3S14H 2HCCA 5J2AA 4HCEA 1K1QA 3WKDA 5IYDG 2FMCA 1K3XA 5CA7A 3CQZH 5CBEE 4NRWA 4KLOA 1GUGA 1S5DD 1OIPA 1QDRA 3UQ0A 2DUDA 4AQYQ 3DXJC 3M3YH 3QIAA 2EIFA 1JALA 2Y9UA 1ZETA 1JJ2A 3S16H 3LW5F 4HEOA 3IRUA 5CJ7A 1U47A 4LFCM 2XEPA 2PW7A 3PO2B 2M60A 3IHQB 1VQHA 2KENA 3AUOA 1AE3A 4QNLA 3RE8A 2ZUBA 4F91B 3CRXA 1E1OA 4ME3A 1RXWA 3I70A 4F2RA 1PLFA 2JH1A 3GFKB 2VB3X 4R8UA 4GIBA 1SE4A 3MC0B 1D0KA 3ZDAA 4DV7Q 4B3SQ 4ED1A 1TQOA 1BBXC 3UXOA 2XY5A 1V9PA 9ICHA 4DV2L 3HOUH 7ICIA 4MF8A 4MGYE 1DGFA 2K4KA 3UI2A 5IILA 2B21A 4PHPA 3D2NA 9ICBA 5CWRA 4P72A 4X3SA 1VQKA 3H8SA 1X9WA 1L7PA 5E79U 2XGTA 2WTFA 3IFTA 4P2HA 1LTBD 4C3JB 2LVQD 1N34Q 2Z4SA 4AKHA 3J7YW 3PW5A 1IN7A 8ICMA 3PUZA 4DV5L 3KKAA 2UXDM 1BCPF 3K9OA 5IREB 1IY2A 3F5AA 2KJ9A 4ECWA 1PVRA 1KNAA 1X6OA 3A46A 2PFOA 1H9RA 4QHSA 2A1JB 1OXTA 3NRWA 1ZQCA 3BDPA 2EANA 5IP9G 1IXSB 5EKLA 3GTPH 3VDYA 1R2ZA 5AKEA 4Z6EA 1KNEA 5GTIU 2F1JA 2DPJA 3LWEA 1WTHA 2E2JB 3U50C 3VA5A 4DV7L 4JN6A 3OWEB 1VDDA 2HVHA 3T1HL 3L3OC 1Z6HA 3TQYA 4A3JH 4D80A 4FXKC 3MMPA 4RQ6A 3PO3H 1EYAA 2DNCA 1UPHA 4R4TA 1NKBA 9ICTA 5LMNW 3DUZA 2UVWA 4X66M 4Y52H 1H38A 2K14A 2FS1A 4M9XA 3BDOA 1V33A 2B63H 2B63B 5EGTA 3GRYA 4X3UA 2JRZA 4J03A 4IJEA 4RG1A 2FNAA 5ALLA 1STNA 4P0PA 2LXJA 1WHCA 5AKIA 1TT2A 2KEDA 5DEHA 1Y1VH 3KXEC 1CKMA 2JE6I 4OW0A 2K01A 3WDNA 1SNOA 2MROB 3CCSA 2PQAA 4OEMB 4K6LA 1ZQZA 3U6DA 2VF8A 4G4QA 3L9AX 1KN5A 2EDGA 5AM1A 2A74C 1IY0A 2OWOA 3GIJA 3N7PD 4RPYA 3R8BA 1QNKA 2W03A 2VB2X 1Y8PB 5C0XG 1MJEA 2EDUA 1PJQA 2R6GA 4DV0Q 2AQ1B 4KLGA 1E9SA 4M0AA 4IIWA 3D0FA 1IN8A 3BS1A 1WGLA 2V9WA 1MBYA 1ZJNA 2KN7A 4FZMA 3SASA 3Q24A 1SGGA 2F1IA 3CCMA 4AI6A 3HOXB 3HOUG 2A68C 3F2UA 1N36M 3BS7A 1FJGQ 2GVAA 3HOZG 3C1ZA 5ALJA 2Y1JA 2PYKA 3J7A5 5C4XB 1X66A 5KNIA 4J9RA 2EQYA 3GV6A 3P1HA 4POFA 5K4LA 4A3FB 2JA6G 2ZAMA 1TWFH 2B2YA 2KEBA 4LF8M 3M4OB 2LXEA 2KRUA 1SWWA 3ZD8A 2WB1B 5M3FB 3VR6A 1VQ8A 1PH8A 1NMGA 5ALYA 3RJEA 4RHRA 1U4MA 3RAXA 2V4QA 4DK3C 1D1IA 2K4EA 3QR8A 1X42A 1PRBA 4NL9C 1IM4A 2FH0A 1DRGA 4DQIA 3PSFA 4R66A 2KECA 3HW8A 5NUCA 3Q23A 4DNRB 2WB1C 4C8MA 2WB1E 3LVVA 1EUJA 2JSOA 3I4LA 3FYDA 4JOIA 3HOXG 4O3MA 3DEOA 3B0XA 2E3TA 2FE9A 2UXCM 3ZQJA 9ICCA 1GJTA 4OJOA 3TS0A 3I4NB 1FD7D 2BH2A 1QQ6A 3S1RB 4MEXA 3MGIA 4NL4H 4C4SA 4PZ8A 3PSIA 2N88A 2JZBA 4PNYA 4CDGA 4DOBA 2F0KA 2QPAA 1JB0F 4IQWA 5DB8A 2JXMB 1HZAA 4M1UB 4PZ6A 1K82A 3HHXA 1PM5A 3OW2A 1HNXL 1DOKA 4L5TA 4DR4M 1PA6A 2FLNA 4DPGA 4WURA 2LHGA 4RPXA 4QQBX 2NUCA 1ZXTA 5KFDA 4C1NK 3RLOA 1WR1B 2XH9A 1DV0A 3VC8A 9ICKA 1I3QH 2MH8A 1XWEA 4EYIB 1D8BA 1I3QB 1E2WA 5LMNQ 2WAQB 4IALA 4UP8A 2D2CC 3U60A 1HQRD 5BPVA 1IBKM 1XYIA 1EWIA 2AQ2B 3U6MA 1MN8A 4B9XA 2H3IA 4OD0A 3ISDA 5IIMA 2FMQA 1YHBA 3HEJA 2RDGA 4O0AA 4YMMA 1IQPA 1L2BA 2BE5D 4AYBG 4XQJA 1QE6A 4MF2A 3VKHA 4YXJA 4JI0Q 2YV5A 4LJ8A 4G9BA 2A5YB 4ECYA 2JN4A 3E0JA 2UUBM 4RCNA 4DS5A 1BNZA 5KFRA 2OQ4A 4L15A 5F3XB 1RKNA 1XTCD 4LFAM 1YJ9A 5JVH3 4NSOB 2HQLA 3VYRA 3HZXA 2CW0C 4DEZA 4YY3L 1KC8C 1C48A 2A73B 4OO1G 1W5SA 2G9DA 2RGHA 3E6ZX 3SMPA 5CHGA 4LVSA 2YTVA 1TGUA 4P4OA 3GLHA 4O9MA 1L1OC 1R4GA 3TAQA 1ZYQA 4JMUA 2F0HA 2PMZE 2QILA 1TFRA 1NK5A 1FGUA 3CPFA 4KJNA 4FF2A 2XF3A 1WWVA 1DGGA 3NVWA 1I4PA 2DBYA 3SMSA 4IUNA 4DR3Q 1QUQA 3CQZB 1B3QA 2EJGC 4QF4A 3SVMA 1R7RA 1F4IA 1YZ7A 1LTGD 3WK5A 4CISA 5KFSA 1W5TA 2RKOA 2YFQA 1JMCA 4LF8L 3S1NB 4UAZA 1KSFX 2MP1A 2B3TA 2FFJA 2ZT9C 4EGVA 1EFUB 1TDHA 5DG8A 1J2MA 3RN2A 1KAAA 4R63A 5EXPA 5J0XA 5DQIA 1WTWA 2EOTA 1BGXT 4OJPA 4Y2XA 3UDIA 3IAYA 4PG3A 2WF5A 3FM9A 5KFUA 5IINA 3IRBA 1NHGC 2DKZA 3HKZG 4NM1A 1LT6D 1L2CA 3KF8A 2QQ8A 3ZH9B 2F0GA 3A56A 2SOBA 1WTXA 1ZMUA 2UUAM 3A98B 4KHPL 2L4FA 1A5TA 4A3GH 1DM0B 2EH9A 3SAUA 2R44A 2LVOC 1MQ2A 1FNWA 4HJ7A 2YN4A 3FTCA 5IT9S 1DCZA 4NDXA 2R92B 2KDLA 1PH6A 4A3DH 3EUB2 4EX6A 3FUUA 3OMCA 2MUTB 5FTNA 2PFPA 1C20A 1RDPD 4XIGS 3T56B 1QQ7A 2IHEA 1ASZA 1B0XA 1TE2A 2EAOA 2ZJ8A 4Y2UA 7ICTA 1IW7C 3NVYA 2C5CA 4H0LC 3WWVA 1Z4NA 1DGHA 2HAKA 3VDUA 1AZPA 3RZDB 4OO1H 1CQFA 4X62M 3GPPA 3T1YM 5J2FA 4OVZB 1U5KA 1G2SA 4QB4A 2WZJA 2V6ZM 4DV1M 5B66U 4PDIA 4F5OA 2K04A 5FLXE 4LWCA 3S1MB 4LG2A 4IUTA 3U6OA 2YQZA 2K89A 1SNMA 3OGUA 3B7QA 2EAMA 3L3FX 4JB3A 3GTGH 1WTRA 3GV5B 3V96A 1QSSA 4XYQA 2Y0SF 3NBXX 1Z3EB 1V1PA 1V1OA 1EY8A 4JI1Q 3GRVA 2HL7A 5KPRA 1RPLA 3RAQA 3WHKA 2YB4A 4R65A 3T1YQ 1LTLA 4IBIA 3BZDB 3TN2A 1QCKA 2AU0A 1TVAA 2D8CA 3SATA 2CN1A 1KRSA 3FHWA 3PNVA 4RQ3A 2AWNA 2DY8A 2RLTA 1KLUD 5J1ZA 1R9TB 5CGKA 3RR5A 1JCKB 1UM8A 4FZNA 1TS5A 4OIJA 3DM1A 1PVQA 1TK5A 1CSQA 5BR8L 1O03A 2F44A 1EY9A 2M2LA 3K5LA 4ZPXA 2J6UA 3FTFA 2W9CB 1K28A 4OIKA 3S2HH 1N32L 4BX9C 2QBYA 4AIMA 3SAHA 4LW1A 3J81E 1EXNA 1Q3BA 1N60A 3EA6A 5FTKA 1PV4A 2Q2UA 1I6HB 2QA4A 5DBBA 3MXPA 3S16B 4DOCA 2PMZF 3RGPA 3LMMA 1ZQGA 1CTMA 1F2YA 2HDMA 1P8LA 2MO1A 3H0GH 5EQTA 4RWSC 3FE3A 5DGAA 3GTJB 2P5TA 3VK7A 5DB6A 5J2HA 2A6HD 5ISRA 2YU9H 1XB2B 3CYMA 3AU6A 1STHA 4PQXA 2C9OA 5T14A 5KG6A 1ENFA 4DR3M 3TARA 5KQDA 3FVQA 4JI1L 1GUSA 5AKLA 4LFBL 3KLSA 1J5EM 4FVMA 1SYDA 1U0LA 2NVTB 1QH9A 1QZHA 3H3VC 3CP0A 4BBRH 5A2QS 4KTQA 2SEBD 3UK6A 5TISU 5DGBA 4NWIA 1HQMC 8ICRA 3NTHA 3B9JA 5IIOA 2W9MA 1UAPA 4DF7A 4LF6M 2QDLA 2KVSA 4IUPA 4OO1J 4KY6A 4RMFA 2ZIVB 2ZTEA 4ZRZA 4C3IB 1D2BA 2KP7A 3G6JB 2F0VA 5IT9L 1S0OA 3HU1A 4MM3B 5C4XG 2FJ2A 2Q8TA 2JA2A 4RQ8A 5KFQA 1C4QA 3MEFA 2K4PA 2IX3A 2UUAQ 1V1PB 2BKEA 2VJ4A 1RD9D 3A7LA 4Y7NH 4GOPA 2W7OA 1XNQL 1G3IA 1PZNA 3M6AA 1RU3A 3H7IA 5AK3A 5J0PA 2L7IA 1BBWA 4B7GA 2JK8A 4H7BA 2SNSA 2J7OA 4C7YA 3HGBA 4DV5Q 1MA7A 9ICJA 2CWBA 3TWKA 3BJUA 3RTVA 4A3LG 1SWVA 4LF7L 3SMVA 1AN8A 2HSZA 1SMXA 2WSFF 3NWSA 1ZQYA 2OYYA 2F1MA 7ICRA 4L8RC 1A2TA 1WGNA 3HRDD 4LK1C 3T15A 1RG6A 1SYBA 5G3LF 2NN6I 1ZQDA 1YHAA 3FKIH 2ZTDA 4I2AA 3KDFA 4AZFA 7ICQA 3UZUA 3FPUB 4OELB 5IGCA 3OTOQ 2KJ5A 5AKZA 4Q45A 2RSOA 4EEKA 4PMCA 4DF4A 1K83H 1MSHA 2HT1A 2PNHA 2C96A 4DSJA 1PYSB 4LJ7A 4KKTA 5DYIA 4UB4A 5J29A 4F3OA 4IQZA 2A8VA 5FTLA 3U26A 1TK0A 2PXIA 5DNFA 1CI4A 2AGQA 5C44B 4CBVA 5ITQA 1A76A 1TIID 3HU3A 1PH7A 3MHBA 3KFUA 3MABA 2JA6H 2RF4A 5M5XH 2IMWP 3TE6A 3T1HM 3FTEA 1B8AA 3UDGA 2EAPA 3TI0A 4F2SA 3JC66 2VZAA 1JOQA 4UAUA 3M9NB 1MIUA 1N56A 1TKWB 3TBIB 2HHHQ 4IFDG 2DVWB 1IBLL 4CGYB 2RP5A 1ZQAA 2EY1A 1ET6A 4TUWA 3S15B 2R62A 5DNYA 3ITPA 2YX8A 5BN5A 3KFUF 1XXHB 4C7ZA 5KEEA 4JV5M 1VMCA 2BA0A 1S5CD 3BBZA 4P2CB 3KHGA 3R2TA 1K0SA 2Z8YM 4A8EA 3TMEA 2Z4RA 2NN6G 2K05A 2QEJC 4OCZA 1ILQA 2BDPA 1DXMA 2G9HD 3MFHA 1N2XA 1EY4A 4DAYB 1WJ7A 4QOSA 4I5SA 3F2DA 2LWXA 5AIAA 1EYDA 1G291 1XXHE 2VQFM 1K8OA 2UUCQ 2DWNA 4WP2A 2XO7A 1AP0A 3TP8A 5LMUQ 5IGBA 5M5YB 4O3QA 2VANA 3HOVB 1G6PA 3QEBZ 3K1RB 1I4GA 1A0IA 1D6EC 1RTOA 1JC7A 2YNMD 1NUCA 3HWTA 3FRHA 2PFQA 4MTNA 2R3ZA 1GD7A 3W0FA 1S5BD 5M3FG 5DDYA 5CP2A 4DSLA 3PUYA 5J8YC 9ICWA 5I9OA 4DR3L 3TWMA 5FP0A 5IIKA 2PI4A 3FUXA 4YXMA 4BY1H 3K58A 2DWZB 2NRTA 1PTOB 1DGBA 2E2DC 2VL6A 1AFPA 4ED3A 1Y69U 1LTID 4A3KB 4KLMA 3CCLA 3J7AS 2QNJA 4QIWF 3T5HA 2UUBQ 5B5EU 4ELVA 5AM5A 3EPIA 2XCAA 3N4MB 1XPOA 3CF6E 2B39A 4XUSA 1TY0A 4PDGA 3A42A 1FIQA 3RB3A 1QG7A 1N48A 3L27A 1WCMH 2ZJQA 2BWEA 2NTTA 1G8PA 2FMMA 5CC4A 3I4MG 1JXLA 3JAMS 3PR4A 1Y14B 1F9SA 1FNNA 2JA9A 1R5LA 3U9SA 4DR7L 4ZLTF 4JI7M 5K5PA 4S12A 3M7NA 4OVZA 4M2YA 1XMQL 4G4NA 2R7ZB 1N5XA 2MJ8A 3I73A 4Q7JA 1XXHA 1D8YA 3PUVA 4LF4L 5AKHA 3KTQA 4FF3A 1YZ6A 2RVLA 2ZIUA 1JWMD 1K8AC 4P16A 2DAKA 4F92B 4K5WA 4N8FA 2CQOA 4DL7A 4UASA 7ICEA 2L4NA 1TH2A 4AG6A 3QU2A 1NR4A 2A69D 4DR5L 4GOPB 3SHLA 3PNYA 3RH5A 2HDLA 4ILWA 4US8A 4F4ZA 3DDHA 5C5LA 3VYSA 5IYCH 2K5DA 1SAPA 1J09A 2AKWB 4RZRA 3J80i 1IIPA 4DA2A 5ELDA 5IWAQ 1VQ9A 4BBSB 2PZTA 4IN3A 4PV1C 4RKLA 4EQOA 4F8MA 3THVA 3PIP3 3GLIA 4DR2L 4Y2YA 3TADC 1ZQFA 1EY7A 2HQEA 4H44C 1D5MC 1XWLA 1GO3E 5I6WA 4BY7G 2KICA 4OX9Q 1X32A 1COOA 3M6KA 3GLIE 4LZGA 3X3MA 2DY7A 1VMPA 4RQ1A 3DEEA 1QSYA 5GKNA 1IBMQ 1U45A 2QEXA 3E9SA 3JPTA 1SKRA 3PV0A 3CC2A 2QDBA 3KDFB 5LL6S 3D2SA 5ITXE 3GTQB 3M3YB 4GKJQ 3SGIA 1R9TH 4DSFA 1NVMA 1BNOA 3GIIA 1JE4A 3KBXA 3GLIB 2OO9A 5EE9A 1HUZA 1J6QA 3I8ZA 1M90C 4ANRA 3CKIB 2JZ1A 4IO9A 2ESEA 3K1JA 5AM0A