2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
2KCMA 4YCXA 4FBTA 2UVWA 4IQVA 2Q2HA 5CJ7A 8ICQA 5IYDH 5KFMA 1HH2P 3G71A 2F52A 2WP8J 5M5XH 2I0QA 4JI0Q 4AQYL 3ULJA 1FVIA 2MR9A 1HNWL 3PIPA 9ICKA 4LFBQ 1G41A 2JZ0A 4RQ6A 4FO6A 3RR7A 2FMQA 5L1KA 3KHGA 1C7YA 4DEZA 1RXVA 1K1QA 5K36G 2UXCL 4K4GA 4KLHA 1XJVA 4WP2A 1S72A 4JWMA 4X6AH 5DBBA 3T5HA 4DO9A 3JAMi 1ZQZA 2OWOA 2P6UA 2I1QA 1NK5A 4APVA 8ICPA 4GEWA 4DSFA 1EUJA 4KHZA 2BCUA 4RNNA 5DFLA 3OJSA 4YG2A 4YMNA 1PYSB 4JI1L 2R92H 5M3FG 2V4QA 3GLGE 3TARA 2YYZA 1JIHA 2DAIA 5LMUL 1BBUA 1ZQUA 4PZ8A 3VDYA 1Q46A 1E3PA 2YU9H 3FDSA 3C1ZA 4RQ5A 4F2SA 3W5OA 2KZMA 4JOIC 1PH6A 3C5GA 3E2EA 5LMUQ 1P8LA 3AFQA 1VQDA 4UBCA 1IBKQ 2L4FA 1D9FA 1XWLA 4R66A 2MROB 4NM1A 2N3SA 4DQSA 4JI1Q 3MR2A 3ISDA 4UB2A 5CWRA 2BA0A 3K75D 2GN5A 5IYDG 1WJJA 2E2HH 3PUYA 2V9WA 1ZQBA 3KHLA 1IYJB 1G6PA 9ICUA 1QZGA 5F9NA 5IYBG 1TR8A 3CD6A 2R93G 3OGUA 1OQYA 4FBUA 3AUOA 4AYBG 4GNXA 4BA2I 1XPUA 2R0IA 1KFDA 4DV4Q 3BBZA 1LV5A 7ICGA 3SZ2A 4UAWA 1XNRL 3ULPA 2F1IA 4KMUA 3B89A 1VQKA 4RUAA 2LVPC 2BHNA 1NY4A 2ZTEA 2E2JH 2A19A 2UXCQ 4UP8A 3RB0A 2R7DA 3IHPA 3ERSX 3V7KA 1NJWA 1VQOA 1JR3E 5IYCG 3PMLA 3RJEA 1Y88A 4R71A 4LWCA 1RL2A 3Q8RB 3PY8A 4LFAQ 8ICMA 1RZTA 1WCNA 1WI5A 5DG8A 1XU4A 1I94L 2AMCB 3JC66 2NVTH 2W8LA 4Q8FA 1LTLA 1YVCA 5KG4A 2J6TA 8ICAA 1A77A 5C0XG 4DL3A 3TS0A 1PH2A 1U49A 2FMSA 4O3PA 5IP9G 2N8NA 1TAQA 4ELVA 2EQSA 4I2CA 4Q7JA 4F2RA 4Q45A 2UUAQ 9ICCA 1T9HA 1J6QA 1HT1E 5EWGA 2PFPA 4RQ7A 1OXXK 3RTVA 3T1YL 2MAXA 4GXIA 4YHHQ 4YN4A 3U4ZA 3BQ2A 1B7YB 2R93H 2KN7A 2VZAA 3M9OB 4GN4B 5DQHA 1JJGA 3PX6A 4M9LA 5DKWA 2HW3A 4J9PA 1HZAA 4EBDA 1ZETA 4A3GG 3RR8A 4A3BG 4BBSG 3MABA 1K73C 2JEAI 2VA2A 4K4IA 1XMQQ 1W2BA 3K9OA 4KTQA 1MSWD 1EQQA 2L4EA 5GAHC 1EFUB 3RJHA 2Z6KC 3J81j 4YD1A 2K5NA 1NKBA 2LVNC 3Q8DA 3GFKB 4B9VA 2LVOC 4JOIA 4YXMA 2B29A 1LM0A 2BPGA 4LZDA 4P74A 3QE9Y 4NPSA 3SYZA 4DF8A 4UB1A 4QY7A 4MFCA 1VDLA 1FL0A 8ICWA 2R7FA 2HHXA 5CP2A 2Q0ZX 4L5TA 2AWNA 1PH7A 1MJCA 3JPOA 2CWAA 4KN7A 4I2EA 2C2DA 4ELTA 2YTXA 9ICTA 4R4TA 3GQCA 1KDHA 1BBWA 1UE6A 2MUTA 3CCEA 4M9NA 4JV5L 1P3QQ 4JI6Q 4O9MA 5LMNL 2WTFA 5HMLA 2DI0A 2KZZA 4TQRA 1VEGA 3GV5B 4UY8C 4CCHA 1PHJA 4BY1G 4GXJA 4TURA 4TUSA 2LVAA 4NB3A 4DR2L 4LFAL 2IY5B 4NXZA 2EJSA 9ICAA 1HR0Q 2C22A 7ICOA 4GKKQ 3RB3A 4R4OA 4O2DA 1PH8A 2LXJA 4X5VA 5HY6A 1IXSA 2AGOA 5C3EH 3RBEA 1S77D 1EIFA 1I5FA 5FLMH 4A3LG 1TV9A 3UE0A 3PX0A 2JA5G 4JWNA 5IYCH 2ZM6L 3M4OH 4QGUA 3H8JA 1N56A 3RJIA 5DLQE 4A3DG 5D46A 3TANA 3K8AA 4LF5Q 5KFEA 4M47A 1Y1WH 5DLFA 3SV3A 1H95A 4RPZA 3KFUA 1GVPA 1AIPC 1VQFA 2OOAA 5KFLA 5KG7A 5KFJA 2PFQA 4DWIA 4DV4L 3S17H 4K0KQ 2K52A 5J2FA 4YWLA 2DNAA 3PO2H 1E94E 1K3RA 4M2YA 2OTLA 1MQ3A 1IFYA 2RF4A 1Z3EB 4DR7Q 5C4XH 5KT3A 1YNXA 2LVQD 2DAMA 2VNUD 7ICPA 4HIMA 3GTPH 4ECVA 3M8SA 4MF8A 4DOCA 2KCTA 5KG0A 1U45A 9ICSA 7ICEA 4FS1A 4F5NA 5J2CA 4PZ7A 2JZBB 4KLJA 2R8GA 1NK4A 3C21A 5J2JA 3JPPA 2JK8A 2NRXA 4KHPQ 1S76D 3QZ8A 4YQWA 4DR4Q 1UE1A 7ICMA 1B8AA 3H3VI 2KHJA 4QWDA 3FHWA 2JNHA 2QEXA 1KTQA 4UB4A 1TFRA 4EYIB 3EPIA 1Y1VG 8ICVA 3AFPA 2JP7A 1U5KA 1DV0A 4IPCA 2HHVA 1L3VA 2JA7H 4GS3A 3EZ5A 3HOYH 1S3OA 3BQ0A 1E1TA 3H0GG 5KFKA 1YHQA 2IA6A 2JA7G 5DB8A 5FLMG 1MJEA 4DSKA 2MFIA 3L7ZC 1NKCA 4DV3Q 4A75A 1XNQQ 9ICXA 1EXNA 2ZJRA 1YJWA 4YR3A 4DAMA 2HHTA 4DR5L 1SN8A 3MFIA 3W1BA 1BKBA 4QZDA 3M4PA 3MMPA 4AQYQ 2BH2A 5J2DA 3THVA 5DB9A 4TQUS 4DFKA 7ICUA 4YMMA 3D0FA 2VUMH 3GIJA 5GAGC 4JV0A 1U48A 5FJ8G 1KRTA 5HHIA 1JB7A 4R8UB 4IRDA 4PMWA 1NK6A 5DGBA 1TWHH 1T8EA 3LWMA 4F3OA 3QZ7A 3HFZB 1HNWQ 3HOVH 3RZOH 4PHEA 2A1JA 1QVFA 3KHHA 3M4QA 3TAPA 4RG1A 2K75A 1SG9A 5J0QA 1SKSA 3S2DH 3HOXG 5HNKA 1T4GA 3CCJA 7ICTA 3OJUA 4OX9Q 5EWFA 4QW8A 1HZ9A 5E7NA 2R8JA 4C8KA 1C9OA 3PVXA 4IFDJ 1ZQEA 9ICFA 1MC8A 2W9AA 4UB3A 3PW4A 2QNJA 5CHGA 2BQUA 3OSNA 3MFHA 4A3DH 4DQQA 1TK8A 3LCVB 4O5KA 4LF6Q 2JA5H 3PR4A 3RH6A 4RZRA 2GWSA 4DFPA 1ZQSA 4GOPC 2MJ5B 2NRTA 4ECYA 3N97B 4DR4L 4M04A 1VCIA 4MFFA 3PW0A 1HUOA 5KFAA 1PYBA 4RQ1A 3F8TA 2IX1A 4LW1A 2JEGA 3TFSA 3MR6A 2XCAA 3E0EA 2I9GA 1AE2A 1HZCA 3PIOA 2VUMG 5C0XI 1NK9A 1K8GA 2KHIA 4B3TQ 4KN4A 5D49A 1WJ7A 4IQUA 3ICEA 4DR7L 2CP8A 3GDXA 3CC7A 3ZDEA 4B3MQ 4A3JH 1JMSA 2E5LQ 2WFWA 3TI0A 4PG3A 8ICEA 3K81C 4UBBA 4A3IH 2CQOA 2VY3A 2C2RA 5M3MG 1WCLA 1N34L 1X6OA 2NVXH 5F9LA 4DR1L 3U50C 4YCWA 4LF5L 2HIVA 2O25A 5KG3A 3CCRA 1OKSA 1IBMQ 1JX4A 3Q8PB 1SR3A 4Y52H 4F8RA 3TFRA 3AEVA 3K0XA 1BPYA 2Y0SE 1EIYB 2PQAB 5KFFA 1Q1EA 3Q8SB 3AU6A 5L1IA 3JPNA 4I2AA 4BGDA 5L1JA 3MEFA 4DV7Q 1NJIC 5C4JH 4NY8A 4YY3L 4DLEA 4A3FG 2BH8A 4X64Q 4DK6C 3S16H 2K4KA 4QZCA 4EBEA 7ICRA 3Q8LA 4DSLA 2AWOA 9ICHA 4JUZA 3I4NH 4POGA 3BZCA 1NKEA 3K7AH 2NZHA 1GO3E 1W3SA 4JI4L 4BA1I 1HNZL 2QA4A 2BQRA 1K8AC 1SZPA 3HOUH 4IRCA 5KFXA 1SLJA 3UDFA 2QHOB 3HW8A 3Q8KA 4PZ6A 4DV2Q 1FGUA 4I2IA 3TREA 1RIPA 3M8RA 3H40A 1MKHA 1DO0A 4DOAA 4J9LA 1K83H 1TWFH 5KFVA 1S40A 1ZQMA 3CCSA 3KDFA 9ICMA 2MNAA 2JZ1A 3RB4A 4EBCA 1JXEA 3RJKA 4F91B 3MR5A 2ISPA 1NOMA 2BCRA 3KJOA 4X65Q 1RYSA 4UPAA 1WYDA 2A1JB 2VANA 8ICNA 4A3IG 4TUPA 1S9FA 3PGZA 3KOJA 2RCNA 3BU2A 1PH3A 4QWAA 4QZGA 3RBDA 1A8VA 9ICBA 2DENA 1UA0A 3JPRA 5C44G 1PH1A 3ZJYC 3DLLA 3H4BA 5C44H 4DV5L 3PF4A 1NK0A 3D31A 4KLIA 4J9QA 3LCUA 4KLMA 4DV5Q 4P73A 1PZNA 5IY0A 4G3OA 4YR0A 3JAMc 5JUMA 3GLIE 4ED8A 1KFTA 1Q81C 5KT7A 8ICIA 3PO2G 1NV9A 1WOCA 4RT2A 2AKWB 4JI2Q 4JBMA 1D7QA 1Q7YC 4QZEA 1ZQQA 4X65L 2JY6B 2NVYH 3C5FA 4YHHL 5KFNA 8ICLA 3BQTA 5KFIA 3T1YQ 4I2DA 5J0YA 3UQ2A 4LF7Q 1OXVA 2BWBA 3PW5A 4OX9L 4QZ8A 3HOZH 5IP7G 4R4IA 3ORYA 4DR6L 3G4SA 5KFWA 1ZMVA 3TQ1A 4MNOA 4ECTA 8ICKA 3T5JA 5KT2A 2ID0A 5JEAG 4M9JA 4JI3L 1I94Q 1COOA 1GD7A 3H3VH 2Q2TA 3NEMA 1ZQFA 5EAYA 3FP9A 4JI4Q 1VEKA 3FE3A 5DGAA 5HGQA 4XQ8A 3L2PA 1AROP 1T6OA 1XSLA 5J0XA 1OTRA 1PH9A 1MIUA 3RB6A 2KNVA 3SI8A 2K5VA 3T1HL 8ICFA 1D8YA 3TRZA 1S97A 4IRKA 2DGYA 4YY3Q 1U47A 3PV8A 2UUBL 4BBSH 1UE5A 3FKIG 3HPOA 2J6SA 1ZQKA 1QVGA 1TWCH 2QGQA 1GKHA 3UXPA 4DUYL 4P4OA 4DSJA 2UUCL 5KFZA 4YD2A 4A3EH 4ECSA 4DK3C 1WHCA 5DG9A 4HJ5A 4NLKA 3AYHB 4HJ7A 5M3FH 2LXKA 4YVZA 3F1ZA 2Z6KA 2BA1A 3T5KA 3UXOA 4DR1Q 5KFRA 4TUQA 2VL6A 3DM3A 4KLTA 1ZYQA 4BY7H 4DV6Q 4G3IA 3PUZA 1Q8KA 4GC7A 1X9WA 1G4AE 4KHPL 3JPTA 1KXLA 2DAKA 2AGQA 1IBKL 1N33L 4J9MA 4LF8Q 3I4OA 5KFHA 1HQYE 5DQGA 3RZDH 3HP6A 1HUZA 9ICOA 8ICCA 1XSNA 2IMWP 2HHQA 3OTOL 4RQ4A 4O5EA 4IJLA 4A3KH 4YXJA 1ZQCA 1VQ5A 2MGWA 4JI7L 5J2IA 3KDFB 1WGNA 4KLGA 1LUZA 3PX4A 2PI2A 1X9SA 1H38A 2N78A 1ZQPA 3G6VA 4ECQA 2RHQB 1QZHA 4JI5Q 4K0KL 1QZEA 3G6EA 1SE8A 3CC2A 4HJ8A 4EX5A 8ICBA 2UXBQ 2YTYA 3STBC 5J2AA 9ICPA 1SRUA 5ELNA 1VQ6A 4EYHB 1XPOA 2OOBA 2DPJA 5HHHA 4XA5A 4DF4A 4A4IA 4NLGA 4YWMA 3EW9A 3NGDA 3S1MH 3GLHE 2IHEA 3F92A 3QEBZ 2F3IA 4I28A 4OONA 2KENA 1HNXQ 1CKOA 2E2IH 4A3LH 5LMNW 4F5OA 4Z6FA 4O3SA 1PFSA 1V92A 5J0TA 4UAYA 1B22A 2D0OA 1OXUA 3ULLA 4RNMA 3IM1A 2XGQA 1R4GA 4POFA 4QZBA 3J7A5 2MQHA 2JEJA 1Q82C 4ED3A 4X66Q 3Q8QB 2NRZA 2B21A 1YJNA 4P71A 1YHAA 1XMOQ 3RJFA 4QZIA 2Y1IA 3CW2C 4M9GA 3I56A 4A3KG 4RMFA 4IOAA 4F5RA 1IM2A 1N36Q 3C2LA 2YV5A 2UU9L 5LMNQ 4C3HH 4C3JH 3JPSA 3RAQA 4JI3Q 1S0NA 4GLAC 3M85A 3RLNA 5KG5A 4LUVA 2F4VL 4DR6Q 2VQFL 1TXYA 4DLGA 4A3BH 5IYBH 1N48A 4TVAB 1PV4A 3C2KA 8ICOA 4Y7NH 9ICLA 4A3EG 4X62Q 4B3RL 3MDCA 1QVCA 3HWTA 2BKEA 2HQLA 1L3TA 4JI2L 5GADC 3H15A 3HT3A 4QIWE 1VQAA 1OXSC 4LF4L 4KLOA 2BDPA 4UQGA 2DAEA 4O3NA 1IBLQ 1TKDA 1QUQA 3STBD 4NLZA 4PGYA 1B70B 3UPQA 3EPGA 4QQBX 2K9DA 5CA7A 3M3YH 4QL5A 4C2MH 1VQEA 9ICNA 1XPRA 1QSYA 2ZUCA 4BXOB 3J81c 4Z6EA 3KYHC 2XCPA 4A3FH 5FLXc 1X65A 2HHHL 1X56A 1I50H 1X55A 4R8UA 3ISBA 9ICVA 5IINA 1ZQDA 4B9NA 8ICTA 5KFYA 5GQOA 3A5UA 2DKLA 2NRVA 4HYKA 1WIVA 1QLNA 2YTVA 1BPZA 2BCQA 5JI2E 2EKKA 2P66A 3GIMA 2CWPA 3PO4A 1MN3A 2HT1A 1OTCA 1KFSA 1SFOH 4TQSA 2W9CA 3GTKH 1M90C 2PI4A 1SMXA 1TWGH 2OQKA 4LF9Q 2JY7A 2W9CB 1XC9A 3CQZH 4DV2L 5J2KA 2ALZA 2JQOA 5J0OA 1FJGQ 2ZM6Q 4OWXB 2HIXA 3EN2A 1X9MA 4Q43A 4DAYB 4GKJL 1AE3A 4LFCQ 5IE8A 5IIOA 4HIDA 2OTJA 2XY5A 5EWEA 4I2GA 7ICNA 4DV1L 3LGJA 3RJJA 2CWBA 4I2JA 2AJQA 2WAQE 1FJGL 3M7NA 3H8WA 1RYRA 4X64L 2ASDA 1VQBA 1B43A 3S1NH 1X54A 2B3TA 5IIKA 4MEYA 4LFCL 5IIMA 3U58A 2UVVA 4HIKA 2VQEL 9ICJA 4ELUA 5J0SA 1XB2B 4QZHA 3BZKA 2VA8A 4DS5A 4DNIA 3J81i 5KFDA 2BCVA 3GTGH 3QEAZ 5KFQA 4JI6L 4LNQA 1Q12A 4JI8L 4DBGB 4ALPA 3GTOH 3LWLA 2XO7A 1VQPA 5KFTA 4A3JG 1D8LA 3H4JA 2J6UA 2DUDA 1N34Q 5ELOA 5J2GA 7ICIA 3OW2A 2Y0SG 3RJGA 4R63A 4B9LA 2B63H 3RRHA 2XGTA 2ISOA 5TZVA 4B3ML 3RR5A 1PVOA 1S0VA 1YHBA 1XS9D 4GN5A 9ICIA 2C2EA 2JA6H 1OAIA 3V6JA 3BQ1A 3ZDAA 1E1OA 1BGXT 4HJ9A 4LF4Q 4J15A 3MBYA 2DFLA 3HKSA 1V43A 3PF5A 4H02A 4EQ5A 5D4BA 4DPGA 2ZJPA 4RPYA 1TK0A 3RNUA 1HZBA 1G51A 3PMNA 1A5TA 5CR0A 1M1KC 2R7ZH 4F2LA 2JUJA 2BQ3A 1N32Q 4QZAA 1YEZA 1IBLL 3MDAA 1EOVA 1K0RA 1SL2A 3PO5A 2RDJA 2FMPA 1X2IA 2VQFQ 2A8VA 2F1JA 3RRGA 3CMAA 3TQYA 2G3QA 2HAKA 3PUVA 4AH6A 1KAWA 4L5SA 4F5QA 5GAEC 2EKFA 2ASLA 2XY7A 1HR0W 1KC8C 4DQRA 5BR8Q 2UU9Q 2AQ4A 2KZ3A 2LYHA 2UVUA 2HHUA 4JK1A 7ICJA 4IFDI 4HEOA 4WJ3M 3B0XA 4Q44A 3S24A 3GV8B 4J9OA 1VQCA 4X66L 3GILA 3UXNA 4A3MG 1NBWA 3OHBA 8ICZA 2PI2E 1VQ4A 1ZQVA 1TK5A 4I2HA 2WZJA 4GN3B 4JI0L 3GIKA 3K9PA 4ECUA 1N36L 5L1LA 2OCEA 2BR0A 4EZ9A 4RQ2A 4UP9A 9ICWA 2WB1E 1WCMG 1T43A 8ICGA 3M9NB 1HJPA 3SV4A 2FPKA 4F92B 4KLDA 3I7FA 4JG2A 2UXDQ 2Q2UA 3CP0A 1SL0A 1CSQA 4BWJA 4JV1A 4DR3L 4ED0A 4GXKA 4FDBA 2UXBL 5BPCA 3B0YA 1KIXA 1XNQL 4DV3L 3H4DA 1XNRQ 4RNOA 2BWEA 2VS1A 5BR8L 1RPLA 1Y1WG 2PI5A 5BOLA 4KLUA 3CPFA 2A1AA 4K4HA 3FKIH 5H1SE 1A63A 1R9TH 4A93G 3PUXA 4F4YA 4YP3A 9ICEA 1N32L 4QW9A 3LK9A 3MXNB 1SKWA 1PH4A 2JA8G 1Q1BA 3GTQH 3CCVA 4A3CG 2BCSA 3GLFE 3HX0A 3GTJH 1YIJA 1VQJA 3KTQA 4LF8L 3RH5A 3RN2A 4QZFA 5KFSA 1IM4A 1VQMA 2D0PA 4A3MH 4DSIA 1L1OB 7ICVA 1QSLA 1ZQNA 3H8SA 4UB5A 2CKZB 4NXNL 3PO3G 5J29A 2W9BA 1PGYA 2HHWA 3LDAA 1CEZA 4O3QA 3C1YA 4UAZA 8ICSA 1G291 2E8GA 1Y8GA 3F2BA 4YCVA 1S10A 2RRUA 1VS0A 5J3BA 4I27A 4OO1G 2AGPA 1UWVA 1EWIA 1I6HH 4GOPA 1ZQYA 2VQEQ 4DUZQ 3H0GH 2P6RA 1F4IA 3CC4A 4F4KA 4JC0A 4IO9A 4R65A 4C8OA 3PNCA 2HVHA 2I5LX 1MQ2A 2ASJA 1KQSA 4DV1Q 1XTDA 1UA1A 3MR3A 4DS4A 4F50A 3WWVA 1Z47A 4BXXG 4YCUA 3HOUG 3IECA 1NJXA 1SROA 2UVRA 3SGIA 4DKAC 4LFBL 1S0OA 3PW7A 3A74A 5C3EG 3RN5A 4A3CH 2EXDA 3T1HQ 4MEXA 4GLVB 1YLAA 2ZUBA 1VQIA 1N9WA 2BPCA 4LF9L 1TAUA 1UEBA 1HR0L 4KLKA 2DZLA 3KF6A 4P75A 4GKJQ 1NJZA 1VQ9A 3S2HH 3HOZG 4F1IA 4IPHA 2PNHA 1DGSA 5KT5A 1ZQRA 4BDPA 4LF7L 2B3GA 2ZUDA 1N8RC 1CKMA 4IPDA 3G6XA 2ZJAA 4NM2A 4AYBE 2AU0A 1U4BA 3J7ZC 4GC6A 5DDYA 4M6WB 4J9SA 4FS2A 3CCQA 4KLSA 3BJYA 1TTEA 1A76A 1NV8A 1LYLA 1J5EL 3J80c 4RQ0A 3NENA 5J0RA 2HHHQ 4C8NA 4AIMA 1KD1C 4JYAQ 2QSFX 2IHFA 2MO1A 5L9XA 1JT8A 1QSSA 3FYHA 2R8HA 2PFOA 4DL7A 4IR9A 7ICSA 1NMGA 2AHOB 1UFZA 4YFKA 1VQ7A 4DOBA 3S14H 2KNAA 2ALYB 4A93H 1CUKA 1WR1B 4R4QA 1AH9A 2DHYA 2R8IA 4KLLA 1Z00A 1XMQL 4X62L 4B3RQ 3V6KA 4J9NA 3V7JA 5KG6A 4B9UA 3E21A 4C8MA 2FPMA 2B63G 3S15H 2BGWA 4NXMQ 4IOCA 3M9MB 2KTQA 2FLNA 5IP7H 2ZTCA 1Y14B 2XTIA 2HHSA 4BY7G 3PV0A 1ZV1A 3NBHB 4YWKA 4ED7A 1VQ1A 2L2DA 1CKNB 4RUCA 2ATWA 1ZQIA 1PA6A 1UT5A 2L15A 3U4VA 4A76A 4UN2B 2UUAL 4LVSA 3I2ZA 1XMOL 4KLQA 4O3RA 3T3FA 1V1QA 3TAQA 1YITA 4RPXA 1E24A 3ER0A 5KG2A 1HNZQ 2VA3A 2GVAA 4ED1A 3HOVG 4P4PA 3HKZG 2PMZE 1UE7A 3OHAA 4DV0Q 1ZMWA 2D62A 2JA6G 4B9MA 3KJPA 2WB1G 2KFZA 4HJAA 2LBCA 4O3OA 1L0WA 2HWJA 2ES2A 4M9HA 4BBRG 3H7IA 1VQHA 2IHNA 4B3SL 4LUZA 2MO0A 4GNXB 3BDPA 4MTNA 4BXXH 2JZBA 3EYZA 5IWAL 3ISCA 4C8LA 1IBML 1RXWA 4DUZL 1EYGA 1ZQLA 1GM5A 2Z0SA 4DFJA 2XC9A 4ME3A 1HNXL 7ICFA 1KRPA 2K5HA 1XO1A 1SL1A 5BOMA 1P16A 5KT4A 4RQ8A 1JMCA 4NLNA 9ICGA 3PW2A 4E0DA 4ED6A 1ZMUA 4PGXA 2K0BX 1ZJNA 2H5XA 1YZ6A 4YMOA 3G48A 5CB1A 4NXNQ 5DLGA 4XRHA 1KSPA 2Q2IA 2M9NA 7ICKA 4Z6CA 4IR1A 1CSPA 4P4MA 1KHIA 1KLNA 2IHMA 4PH5A 1ZQXA 4QWBA 1ASYA 7ICHA 1BPEA 4JI5L 1NE3A 1X3FA 4EZ6A 1JE5A 3EBEA 2KNZA 4B9TA 8ICJA 4JI7Q 1N33Q 4F4XA 3PCOB 3PSIA 2MUTB 4JBKA 3F2DA 1JXLA 2F1HA 3OTOQ 1E22A 3AU2A 4DV6L 5KFUA 1E7ZA 1TVAA 2BPFA 4F93B 1ZQAA 2ASBA 2ZTDA 3K80C 1L5UA 8ICYA 4LF6L 4F4ZA 1VQNA 2ZJ5A 2KHHA 1IL2A 5M3MH 5IILA 2PQAA 4DQPA 4DUYQ 3CXCA 3BJUA 1ZQHA 2HVIA 1XXHE 4DR3Q 3E9IA 5GROA 3S1QH 5KFGA 3GIIA 3V7LA 3A5ZB 1Q02A 3HOYG 4YR2A 5IWAQ 4IFDG 2UXDL 5DG7A 3TS2A 1Y1VH 4B3SQ 1VEJA 3HOWG 2UUCQ 1KYIA 3ETLA 8ICXA 2ZJQA 4F5PA 4M0AA 4IPGA 4PHAA 3PO3H 3E9HA 4DV0L 4L5QA 5KFCA 2PXIA 3EIVA 3CCLA 2UUBQ 5IT9c 3MGHA 2JEFA 2DPIA 4HIOA 4P72A 3ZDBA 2W8KA 4JBWA 4RQ3A 2R92G 4DSEA 2AQ0A 1ZQTA 2FLLA 1OXTA 2JEBI 2JA8H 2NVQH 5KG1A 4DR5Q 3A0JA 3CAMA 2FXQA 2KFNA 3UDIA 5KFOA 4RU9A 4ECWA 5C0XJ 5JEAJ 3GTLH 5IIIA 3EWAA 4R64A 2LTUA 2RDIA 4J9RA 1A0IA 4QWCA 3KLWA 1SKRA 4F4WA 2I5HA 1I3QH 4OWTB 1VQ8A 4DL6A 1X9NA 3T5LA 4A3GH 4Q8EA 1NK7A 1KL9A 4QZ9A 3GD7A 1T7PA 2JY8A 1X3GA 4Z6DA 5M5YH 3J80i 3RAXA 3N4MB 4JCVE 4KI0A 2C35B 1V9PA 1L2FA 1X3EA 3KF6B 3V6HA 5J0WA 1IXRA 3Q8MA 2Y1JA 3UE1A 1K9MC 1Q86C 3UQ0A 1JN3A 1KEJA 1JJCB 1KRSA 1QUQB 5HP4A 3AQQA 3L0OA 2V1CC 4OO1I 4O5CA 4RT3A 2R7ZG 2JE6I 1XSPA 2GVBA 2C28A 2IX0A 5KFBA 3MGIA 5IIJA 3I4NG 4KLFA 9ICRA 2K14A 3ZDCA 1L3UA 1YI2A 3K4GA 1O7IA 4EEYA 4DQIA 4MFAA 5J0PA 5EOZA 4GNXC 4QWEA 4PPXA 3V72A 1L3SA 5KTQA 4IQWA 4ECXA 3JPQA 2DAGA 1NK8A 5FJ8H 5M5WH 5DB6A 3RH4A 3I55A 9ICQA 1JJ2A 5JJLA 4JI8Q 4MZ9A 4ECZA 2I5MX 1EQRA 3T6PA 1LB2B 4PHDA 3ZDDA 3C23A 3HKZE 5DB7A 4DL4A 5J2EA 4J9KA 1U0LA 5DQIA 1IZ6A 4C3IH 4DL5A 4KITB 3B6YA 3HOXH 3CCUA 3PUWA 1WFQA 3K7UC 4PHPA 5JJIA 1BPBA 1BVSA 2JEIA 2W9MA 3KF8B 2R8KA 1Z00B 1HT2E 1T3NA 5IP9H 1ZQGA 5J2HA 1ZQWA 2PFNA 2JA9A 1VG5A 5AJ3L 4LUOA 4I29A 2R6GA 1K1SA 2KBNA 3ZD9A 3OSPA 1TWAH 4GKKL 2NZOA 1C0AA 3GDEA 3I4MH 2EIFA 4KLEA 3M9BA 4IJHA 3HOWH 1VQLA 3C2MA 3G6YA 1DO2A 4DFMA 4JV2A 1YBYA 3NELA 3CPWA 3GV7B 4JV5Q 2NN6G 4DV7L 4M6WA 5HMMA 2LSSA 3E46A 5AJ3Q 3F2CA 3CCMA 4DR2Q 2ATLA 5C4XG 1S0MA 4XTCS 1WGLA 4OXPA 3GTMH 2FLPA 3FRIA 2NRWA 2XGPA 2OQ0A 4XIGS 5DDMA 1BPDA 4B9SA 1L1OC 2CFMA 4I2BA 4BWMA 4PGQA 2E5LL 2FPLA 2V4RA 1G3IA 3GO5A 4BXOA 8ICHA 3UDXA 1UT8A 4ECRA 3NTUA 3CMEA 2IT1A 4R4CA 1ZQJA 1NTGA 4NXML 4OWWB 1ZJMA 3PR5B 4O0AA 2RHSB 4BBRH 5C5JA 3CF5A 4B3TL 8ICRA 4L5RC 1ASZA 3FRHA 3TEHB 4P2HA 1NJYA 2ZJ8A 1BPXA 4ZH4A 1WCMH 3IHQB 8ICUA 3IRBA 2IBKA 3I4MG 1Z9FA 1NMFA 1A62A 4I2FA 4BY1H 3RLOA 4XUSA 5DBAA 3OYYA 2K50A 1VQGA 7ICLA 7ICQA 4R1JA 4GOPB 1EFWA 4QJFA 1DOQA 5DBCA 4JYAL 1QTMA 4DL2A 4IQTA 4UP7A 3S1RH 1ZQOA 5KT6A 3W1GA 1J5EQ 1PH5A 3RLFA 2NN6I 5KFPA 1D9DA 2OO9A 2JJQA 4JBJA 2VW9A 4ED2A 2F4VQ 1YJ9A 1CKNA 2XY6A 2N49A 5J2BA 2WAQG 4LZGA 4O0IA 2W9BB 1L1OA 2CCZA 3KHRA 4WJ4A 4MF2A 3ZD8A 5J0UA 1GO5A 2JY5A 1U9LA 3UDGA 4GLXA 5JJKA
chains in the Genus database with same CATH superfamily
3U6EA 3CYMA 5JI3E 2KCMA 4YCXA 4U68A 2G9HD 1QQWA 4FBTA 3ND8A 2UVWA 3IG8A 4IQVA 2JA5B 2Y0SC 2Q2HA 3QUBA 5AM3A 4NL9C 5CJ7A 8ICQA 2E2DC 3AB9A 5IYDH 5KFMA 1HH2P 4CDDC 3G71A 3I4MB 3GPXA 2F52A 2WP8J 1B3QA 2M2LA 2TMPA 5M5XH 2I0QA 4JI0Q 3KZXA 4FVMA 1QCKA 2F0WA 4HR7B 1SV4A 3ULJA 4AQYL 3GV3A 4MTKA 1FVIA 1NCVA 2MR9A 3S17B 1PTOF 5HR7A 1F9PA 2A5HA 1HNWL 4L4UA 3TACB 3PIPA 1E9RA 4M9SA 5GTHU 9ICKA 3OMCA 2Q8TA 2JMGA 4LFBQ 1G41A 2JZ0A 4RQ6A 4FO6A 2EH9A 4LRTA 2EAPA 3K2LA 5FTMA 2F3VA 5I9PA 3RR7A 2FMQA 1KDBA 3UI2A 1TWGB 5L1KA 3KHGA 4ZAIA 5EKLA 1L1ZA 2QB0A 2A6HC 1C7YA 1Y1WB 2WACA 4DEZA 1YZ7A 1RXVA 1S5BD 2FE8A 3GLGA 1K1QA 5K36G 4JPBW 4UATA 2UXCL 4K4GA 1NNLA 4JI5M 4KLHA 1Y8OB 3VR4A 1UAPA 1XJVA 4WP2A 1EIGA 1X6JA 4JWMA 1BOSA 3T79A 2F1MA 4X62M 3PIP3 1S72A 4X6AH 5DBBA 3T5HA 4M0DA 4I81A 4DO9A 3NTHA 1K5OA 2IOHA 1I3QB 4OVZA 4M9XA 1ZQZA 2LM4A 2P6UA 2OWOA 2EJGC 1NHGC 2I1QA 1NK5A 1V38A 4APVA 4C80A 1QVRA 3LWEA 4FD2A 2UUAM 4GEWA 4DSFA 3SQIA 8ICPA 1EUJA 1RCVD 4KHZA 4JK1C 1ZD3A 4DFDA 2BCUA 4A3IB 4RNNA 2KZSA 5DFLA 5JTIA 2UXDM 4LGYA 3K5MA 4RNAA 4YG2A 3OJSA 4YMNA 1PYSB 2LMRA 4JI1L 2JH7A 3ZI4A 1CZWA 3ONAB 2R92H 2O6KA 2NO5A 3KOXE 5M3FG 2V4QA 3GLGE 3TARA 1HA5A 1SIJA 8CATA 3WK7A 5AM2A 2YYZA 2KHQA 1JIHA 2DAIA 2XLJA 3F5AA 1KN5A 1BDOA 2FNAA 1BBUA 5LMUL 3MZ5A 1KQQA 3MK6A 1ZQUA 5C44B 4PZ8A 3PSFA 3VDYA 4RGMA 5AKJA 3M7NA 1Q46A 1E3PA 1KSFX 2ICEC 3OMGA 2MU2A 3FDSA 2RDGA 4QUCA 4KX5A 5DM73 3CGWA 3C1ZA 4RQ5A 1WVLA 4F2SA 3FPPA 1FNNA 1BCPB 1QJOA 5ALIA 1QDRA 4KLNA 2VIIA 2KJ5A 4L6V6 2WF5A 4HAIA 3PZPA 2KZMA 4JOIC 1HNZM 2MJ8A 4RCOA 3FYDA 4ZUIA 3J81L 1PH6A 1C48A 3C5GA 2DWLA 3E2EA 5LMUQ 3FAHA 2CE7A 1J2NA 1P8LA 1PM5A 3GLHA 3AFQA 4WRDA 1VQDA 4UBCA 1IBKQ 1DONA 2L4FA 3HZXA 1D9FA 1XWLA 4R66A 1LTAD 3NELA 2MROB 4NM1A 2EAOA 1L6NA 4DQSA 2N3SA 3MR2A 3ISDA 2F0HA 4JI1Q 1W6KA 2C5CA 4UB2A 1Q3BA 2YR0A 5CWRA 2BA0A 4RHRA 3K75D 2GN5A 1L7OA 4Y7NB 5IYDG 1WJJA 2E2HH 3ALRA 5A2QL 5GKNA 2V9WA 3PUYA 4DNRB 1WTQA 1ZQBA 2KQ3A 2MUYA 3KHLA 1E2VA 5TISU 3S1MB 1IYJB 1PXUA 1G6PA 9ICUA 3DWPA 4FXKC 2O5RA 4HSPA 5F9NA 2C98A 5IYBG 4A3FB 1QZGA 1TR8A 1STGA 3CD6A 3SK5A 2V4DA 4PCZA 3OGUA 2I07B 3J2PB 3HRZC 2R93G 1OQYA 4FBUA 3AUOA 3E58A 1A3VA 4AYBG 2IOFK 2R0IA 1KFDA 4UAVA 3HY5A 4DF7A 5JVH3 4DV4Q 1XPUA 1OIPA 1PVPA 3BBZA 1B3AA 2WB1F 4JXJA 1LV5A 1JR0D 3GLIA 7ICGA 3SZ2A 4OJPA 3VYTA 4CDEC 4UAWA 4C3HB 1XNRL 3CNHA 5FO8B 3ULPA 1OAOC 2F1IA 1WTOA 1HCZA 4KMUA 3B89A 4IBDA 4XQJA 1VQKA 4B3SM 2B0CA 4RUAA 2VQFM 3GLFB 2ERCA 4B3RM 4FCVA 4HAEA 1AZQA 4OIJA 5T1IA 2FFKB 2LVPC 2BHNA 5GAHC 1NY4A 2ZTEA 3DWAA 3I3CA 2E2JH 2H3VA 2A19A 2R7ZB 2UXCQ 4UP8A 1JWMD 1TY0A 2EYPA 5A35A 3GTGB 3RB0A 2R7DA 3IHPA 1GUNA 1U4RA 3ERSX 2R6FA 2NVTB 3V7KA 1TE2A 3OW7A 3D3RA 1EY4A 1NJWA 1VQOA 1JR3E 2KICA 3PMLA 2KK0A 3RJEA 5IYCG 1Y88A 4R71A 1BNPA 4LWCA 4UB6U 2XSZA 1RL2A 3Q8RB 3PY8A 1HFGA 3NPPA 4LFAQ 4AKGA 8ICMA 4KT0F 3HX3A 1WCNA 5ALMA 1RZTA 5DG8A 1WI5A 2RGOA 1XU4A 1I94L 3RMHA 3JR4A 2F0MA 2AMCB 3TMEA 5JEAH 3JC66 2NVTH 5EGTA 1WG8A 2SNMA 3BS1A 3N7RC 3N6RA 2DKXA 2W8LA 4Q8FA 5M3MB 1LTLA 5KG4A 8ICAA 2J6TA 1PRTF 1A77A 2CPRA 4DL3A 3CTWB 1YVCA 5C0XG 1U49A 2FMSA 3TS0A 1IN7A 1QWYA 4O3PA 5IP9G 1EY7A 1SWVA 2N8NA 3MFYA 3GTOB 1TAQA 4ELVA 2EQSA 2CVRA 4I2CA 2HDLA 4Q7JA 4F2RA 2PCFB 4Q45A 3BVGA 9ICCA 3FVQA 3TP5A 5I4DA 1T9HA 4Q0FA 2UUAQ 4Y2UA 1J6QA 1HT1E 3N7PD 5EWGA 4RQ7A 2PFPA 4RQMA 3RTVA 3B9PA 1OXXK 4QMGA 1EU3A 3T1YL 2MAXA 4GXIA 2AHMA 4MGIE 5IOCA 4YN4A 5ISRA 3U4ZA 4YHHQ 5K36H 1KABA 3BQ2A 5G5HA 1B7YB 2R93H 2KN7A 5CV8A 2XI9A 3DDHA 2VZAA 2WB1B 3M9OB 5ALOA 2NZ1D 3CQZB 5EKIA 4II7A 4C3HG 4GN4B 2R92B 5DQHA 5FOBB 1JJGA 3PX6A 2A68C 4M9LA 4NXNM 1SMYC 3T38A 2LM1A 1V34A 5DKWA 2HW3A 1SXJC 1RD9D 4AYBB 2EXZA 4J9PA 5AKLA 1EWCA 5JPMC 1STYA 2NYVA 4CF5A 1HZAA 2SEBD 2I7PA 4OD0A 4EBDA 1ZETA 4A3GG 3RR8A 5CC4A 3RZDB 3WK6A 4A3BG 1CT1D 4BBSG 3MABA 2Q4TA 3SENA 3MA2B 1K73C 2JEAI 2VA2A 1K28A 1GHJA 2YMLA 3UMBA 3ZCBB 4UASA 1BCPF 1TDHA 2NQ8C 4K4IA 2Z9HA 1XMQQ 1W2BA 3K9OA 3K5NA 1Q90A 4KTQA 1MSWD 2RCFA 2L4EA 1EQQA 2D8CA 1EFUB 3GPPA 1K3XA 2W43A 5ALLA 3RJHA 1D5MC 4Z6YA 3VK7A 3J81j 1MI2A 2Z6KC 4YD1A 4H13C 4DXGA 1SWWA 2K5NA 4FZLA 1NKBA 2LVNC 1Q3LA 1EFID 1U4LA 3Q8DA 2DZNB 3GFKB 3M4OB 4LFAM 4Y2PA 3HOXB 4B9VA 2LVOC 1BBXC 1TS5A 1SXJD 3HJ8A 2QLTA 4JOIA 5EPJA 1WYGA 2DBYA 4YXMA 2B29A 2YN4A 1C1KA 4C4TA 1Z19A 2G09A 4BLCA 3IG5A 1LM0A 2BPGA 2EYLA 1R2YA 4LZDA 1T5EA 4NW2A 3V96A 4P74A 1SXTA 4WJWA 3QE9Y 4NPSA 3SYZA 4DF8A 4UB1A 4JN6A 5EXTA 3FTDA 3NVVA 3BDOA 3FYCA 4QY7A 3HP3A 4QF4A 4MFCA 4CJ2C 3MJ5A 1VDLA 1FL0A 3KOOA 3KXEC 4AQYM 4KMOB 8ICWA 2R7FA 3SK6A 2CHQA 2HHXA 3TDQA 2VQEM 5CP2A 4F8MA 3S9WA 2Q0ZX 4L5TA 2AWNA 2F5SA 1PH7A 1CK1A 1MJCA 2Z4RA 4LG2A 3AOGA 3A8IE 3FDTA 3JPOA 2CWAA 4KD3A 2Y0SF 4KN7A 4I2EA 3SARA 5AI8A 2C2DA 3I4VA 3WKBA 2B2YA 1RQLA 2F0TA 3U26A 2RDFA 4ELTA 2OEHA 2YTXA 9ICTA 2B2TC 4LJAA 4R4TA 3GQCA 1KDHA 3HILA 2HI0A 5KO3A 1BBWA 1UE6A 2MUTA 3SVMA 3CCEA 4M9NA 1JWSD 4JV5L 1P3QQ 4NLCA 4JI6Q 5AIBA 5IT9E 4O9MA 2ICIA 5LMNL 2WTFA 5HMLA 2D7HA 3OWEB 2DI0A 5FTNA 2EDUA 2QARB 5AKIA 4TQRA 2KZZA 2PZTA 3NVWA 3J81c 2EY1A 1VEGA 4FNFA 3GV5B 4UY8C 4IBCA 4CCHA 1PHJA 3FC4A 4BY1G 1NJIC 2CN1A 4GXJA 4R3DA 4TURA 4TUSA 2LVAA 4FCTA 2G5DA 2GA4B 1NI3A 4NB3A 5KPZA 4NXZA 4EENA 4LFAL 4IS7A 2IY5B 2L1BA 2EJSA 2EYMA 9ICAA 4FXGC 1LT5D 3IDWA 3OPOA 5EP2A 1HR0Q 1EIHA 2C22A 7ICOA 4GKKQ 3B9JA 3RB3A 2IX3A 4R4OA 3ITPA 5DEHA 3GTJB 1IBKM 4O2DA 4G4RA 1PH8A 2EY2A 3Q6SA 2LXJA 1KLGD 3W67A 4X5VA 3TL4X 1G59A 1C4QA 5HY6A 2K5QA 4IBIA 2HBKA 5ALXA 4KY5A 1IXSA 3OSOA 5M5XB 1LKYA 2AGOA 2EY6A 1LTMA 4FWHA 2LY7A 5C3EH 3RBEA 1HHVA 1MD2D 4FXDA 1S77D 1NUCA 1EIFA 1IIPA 1L2CA 2G08A 4DAVA 1I5FA 5FLMH 2DJFC 4A3LG 1F5SA 4AKHA 3S6JA 1TV9A 3CF2A 1O80A 1SNMA 3UE0A 1OFIA 4YY3M 3DV9A 4KKTA 2FHTA 5ITUA 3PX0A 3EROA 2JA5G 4JWNA 1IBLM 1AN8A 4NL9A 2L5TA 5IYCH 1LTSD 3M6ZA 2ZM6L 4QGUA 1JB0F 3H8JA 1N56A 4IUQA 2F5QA 1HA6A 3RJIA 4B3MM 5DLQE 4A3DG 2XIWA 5D46A 1DGGA 3TANA 3K8AA 2L9HA 4LF5Q 5KFEA 4Y2JA 3GRYA 3SYLA 4M47A 3NSWA 1Y1WH 1NNUC 4HSVA 5DLFA 2I7NA 3QYBA 4MB7A 3SV3A 4GS3A 3GQ3A 5AI4A 1H95A 5C4HA 4RPZA 4OEMB 1CQFA 2CV2A 1SXJB 1UCVA 2QDBA 2BZFA 3QUTA 4IURA 1GVPA 3ONNA 3V05A 1AIPC 1VQFA 2OOAA 5KFLA 2ODGA 4W5WA 4Y2VA 5KG7A 1STBA 1DOKA 1YNNC 5KFJA 2PFQA 2H1EA 2VXWA 2PO4A 4C3JB 4WURA 4DWIA 4DV4L 3S17H 4K0KQ 2M0NA 2B2TA 1F9SA 4PT5A 4A3VB 5J2FA 2K52A 4YWLA 4C3JG 4DR6M 3X3MA 5JPNC 2DNAA 1D5ZC 4C2MB 3PO2H 1E94E 3BYYB 1K3RA 2OEOA 4M2YA 2OTLA 5KNBA 1MQ3A 4LJ9A 1IFYA 1PRTD 4RKUF 1Z3EB 2RF4A 4KV6A 2XICA 3T51B 5C4XH 4DR7Q 4H44C 1SDFA 1IY1A 5ALFA 4AZFA 5EE0A 5KT3A 1RHPA 1YNXA 2HCIA 4I8OA 2LVQD 2DAMA 2CH4W 2EYHA 2VNUD 7ICPA 4HIMA 3MGVA 3GTPH 4ECVA 2CH4A 1SAPA 3WKEA 4MF8A 3M8SA 4DOCA 1D8BA 2KCTA 3LWUA 5KG0A 3MHBA 1U45A 4KN4C 1A6XA 1DGFA 9ICSA 7ICEA 3D8LA 3OIQA 4FS1A 4F5NA 4AG5A 1EOTA 5J2CA 1EEID 4PZ7A 2JZBB 4KLJA 2R8GA 1JWUD 2KVCA 2ENBA 5BR8L 1NK4A 3C21A 2DHRA 4MGKE 5J2JA 5AM5A 3JPPA 2JK8A 1GVNA 3C3LA 3PVSA 2NRXA 2L7HA 1PK1B 4B7GA 4OELB 5FTLA 5C4JB 4KHPQ 4PD2A 1S76D 3HS0C 3QZ8A 1QE6A 4YQWA 4DR4Q 2JXMB 1UE1A 4J8QA 1TWHB 2F76X 4US9A 7ICMA 1B8AA 3AU7A 4MHEA 3HKZF 1GHKA 1SYDA 2R3ZA 2QILA 3H3VI 5BPVA 2HKJA 2K89A 2KHJA 1UPHA 4QWDA 3FHWA 2JNHA 3NHHA 5JAVA 2QEXA 1KTQA 1J9OA 3SMPA 2RVLA 4UB4A 1TFRA 4JI0M 4EYIB 3EPIA 3FUWA 1Y1VG 8ICVA 3AFPA 2JP7A 3KKAA 1HNXM 3SR1A 1U5KA 2NUCA 1DV0A 4YIJA 2BJVA 3A45A 4IPCA 1S4ZA 2V1UA 2HHVA 1L3VA 4DR4M 3SFZA 1EIJA 1SV0C 3EZ5A 2UXBM 1DYQA 1LT4D 4LZZA 1O7LA 1HXYD 2WKCA 1S3OA 2HBJA 4EQOA 3BQ0A 2RSOA 4EVOA 1Q8IA 1E1TA 1UHUA 3H0GG 5KFKA 1YHQA 2IA6A 2JA7G 5DB8A 4LJXA 1LT6D 1SYBA 5FLMG 1MJEA 4P0PB 4DSKA 2MFIA 1IXSB 3L7ZC 5C3WA 1NKCA 4DV3Q 1KFVA 4A75A 1U4PA 1XNQQ 2W82A 9ICXA 1EXNA 2ZJRA 4CIZA 2YU9B 4FW9A 4AYBF 4LZJA 4QHSA 1BXTA 3GTPB 1YJWA 4YR3A 3VYRA 5AICA 4DAMA 1Q39A 3KS8A 2HHTA 2MRLA 3BS5B 4NSRA 1SN8A 4DR5L 5FLXS 3MFIA 4CBVA 3U6QA 3QU9A 3W1BA 1BKBA 4QZDA 3M4PA 3MMPA 4DCCA 3H0GB 1CTMA 5J2DA 3AM9A 4AQYQ 3THVA 5DB9A 4TQUS 2BH2A 3GTQB 4DFKA 7ICUA 4YMMA 5KNIA 3D0FA 4OIKA 2VUMH 3GIJA 1DGHA 2K60A 5GAGC 4JV0A 1B9NA 4C7YA 1U48A 1IY2A 2F0FA 3BDLA 3VCBA 5HHIA 1KRTA 5FJ8G 3GTKB 4RA8A 1JB7A 2RHFA 4R8UB 4REZA 1ZD4A 4IRDA 1NK6A 4PMWA 5DGBA 1TWHH 1PJIA 2Z3XA 3LWMA 3QZ7A 1T8EA 4F3OA 1TWCB 2BDNA 2J0TD 4TUWA 5M5WB 3HFZB 1HNWQ 2MSNA 3HOVH 3RZOH 2VIXA 5DYIA 2NO4A 7CATA 5AIAA 2A1JA 4PHEA 3E0JA 1QVFA 2HHHM 3KHHA 3ERQA 1Y8PB 3M4QA 3TAPA 5T1GA 4RG1A 3U61B 4DV6M 2K75A 1SG9A 5J0QA 1SKSA 1M4VA 2CQAA 4RF1A 3HOXG 3S2DH 5HNKA 1T4GA 3CCJA 7ICTA 3U60B 4WW0A 3HJEA 5EWFA 3OJUA 1N34M 4OL7A 2A69D 4OX9Q 2OHFA 4QW8A 1HZ9A 5E7NA 3I04M 2R8JA 4C8KA 2CXYA 1PRTC 4ZKCB 3QNMA 1C9OA 2QW7A 3J7BA 1IV8A 3PVXA 2HBLA 1ZQEA 9ICFA 2IJ0A 2XRSD 1MC8A 1PH2A 4CGZA 2ZG6A 2W9AA 5FSWA 3LQQA 4UB3A 2LKVA 3PW4A 3H94A 5DNFA 2QNJA 4GH9A 3J80S 2F44A 2WF9A 2R45A 5CHGA 2BQUA 1L7NA 3URYA 3OSNA 3MFHA 4A3DH 1L2BA 3KOWE 2KW0A 2W7PA 4DQQA 3LCVB 1TK8A 1F2ZA 1S5ED 2KHSA 2Z6BA 2ZIWA 4O5KA 2O4XA 4UDUC 4LF6Q 5CR3A 2EZXA 1LABA 5J8YC 5ITXA 2JA5H 3PR4A 3AJIB 3RH6A 4RZRA 1SJHD 1I6HB 2GWSA 3F53A 4DFPA 1ZQSA 1COKA 5CBAE 4GOPC 2MJ5B 4GKKM 2NRTA 4ECYA 3N97B 4DR4L 4R9WA 4M04A 1Z5AA 3MHVC 1VCIA 4MFFA 3PW0A 3TE6A 5ALKA 1HUOA 5KFAA 2C9CA 1R7RA 4RQ1A 1PYBA 1LTGD 3F8TA 2XVSA 2IX1A 4LW1A 3VDPA 1DZ1A 1IBMM 2JEGA 4LF9Q 3TFSA 3MR6A 5CRXA 1IN8A 2XCAA 1D1IA 3E0EA 3OHXC 2K5WA 5CBEE 4BBSB 2I9GA 1QUSA 1AE2A 1H9SB 1HZCA 2E5SA 1HPCA 3PIOA 2VUMG 4PZNA 5C0XI 1NK9A 4LFCM 3ILKA 4KMUC 1IN6A 1V1PA 5IGGA 3FUUA 1K8GA 1SYEA 2KHIA 2CRUA 4NSOB 5M9OA 4KN4A 5D49A 3QJYA 4B3TQ 1YT3A 1WJ7A 3AQFA 4IQUA 3ICEA 4DR7L 1B4FA 1PK1A 3UMGA 1FJGM 2CP8A 1TVXA 3R9KA 3GDXA 3CC7A 4RGOS 3ZDEA 1XWIA 2SOBA 4F7XA 1Q3CA 3TKAA 4B3MQ 2WINB 4EQPA 4A3JH 3WK5A 1JMSA 3NTIA 2X69A 2E5LQ 5IREB 5CV6A 2BOSA 2WFWA 3MXPA 4LAAA 4G7HC 3TI0A 1ZOLA 2KKPA 2Z4HA 4PG3A 4A3DB 1ZXIA 4B7HA 2EYOA 2FINB 2DN8A 8ICEA 3K81C 2ZIUB 4UBBA 4Y2RA 2CQOA 2VY3A 2C2RA 4A3IH 2FMCA 5M3MG 1WCLA 1D2NA 1N34L 2ZXRA 2E1EA 1X6OA 4MN3A 2NVXH 2ZIVA 5F9LA 3PO3B 4DR1L 2H3ZA 3U50C 4YCWA 4LF5L 3SAVA 1PDQA 5GTIU 2HIVA 2O25A 2KIWA 5KG3A 1OKSA 2B2UC 3CCRA 1C0AA 1J8IA 3DEOA 2A5YB 1IBMQ 1L8OA 1JX4A 3GLHB 3Q8PB 5ALEA 1SR3A 1PFBA 3QOLA 4F88A 2GLEA 2F0GA 3AFHA 4OU7A 1QUTA 4Y52H 1N75A 2K8BB 4F8RA 3TFRA 3AEVA 2N55A 1O03A 3K0XA 1BPYA 2Y0SE 2KE7A 1A0PA 2JRZA 1EIYB 1O7YA 1RJTA 2BE5D 2PQAB 5KFFA 3JR5A 3K6OA 1Q1EA 4C1NK 3Q8SB 3A54A 5AI0A 1Z59A 1QQ7A 3AU6A 1QCBD 2A73B 3S14B 5L1IA 3JPNA 4I2AA 4BGDA 5L1JA 3MEFA 1K8MA 4LJ7A 5K4LA 2ESEA 4DV7Q 5T14A 5C4JH 5B66U 4LRSA 4NY8A 3QB3A 4DLEA 3U9OA 2BH8A 4YY3L 4A3FG 3K5OA 4IJEA 1I4GA 4DK6C 4X64Q 3S16H 2K4KA 4QZCA 1VF7A 2QQ8A 2QARA 4EBEA 2G8LA 7ICRA 1KDCA 3Q8LA 1LACA 1C8CA 4DSLA 3TP7A 1Z1BA 2AWOA 4FF3A 9ICHA 4JUZA 4BS9A 3OOCA 4RF0A 2L5YA 3SMSA 3I8ZA 5TSSA 3I4NH 5LMUM 3U6DA 3U61A 2F0PA 3LW5F 3BZCA 1NKEA 4CKBA 4POGA 3K7AH 4I65A 3VR3A 2KVMA 5ITYA 1GO3E 2NZHA 1AEXA 5EQTA 2JXJA 1LKYB 5FO9B 5EXPA 5LL6X 4P16A 3HOYB 1V85A 1W3SA 2ZIXB 4JI4L 2WFAA 2YY6A 4BA1I 1HNZL 2QA4A 3MXGA 2BQRA 1K8AC 1SZPA 3NQTA 1A3TA 3T53B 2DKZA 4IRCA 3MC0B 3HOUH 1TS3A 5KFXA 3U6PA 1SLJA 2LH0A 3A8KE 3UDFA 2QHOB 3HW8A 3Q8KA 4PZ6A 2N88A 5F3WA 4DV2Q 2G0AA 1DGHB 4I2IA 1FGUA 3GO5A 3TREA 1RIPA 4IC9A 3M8RA 3H40A 1NSNS 1MKHA 2L12A 4LJZC 1DO0A 4NL4H 3HU3A 4DOAA 4J9LA 4KJNA 1K83H 4N8X1 4US8A 1TU2B 3HOWB 1TWFH 2E2HB 5KFVA 2K4HA 1FFUA 1S40A 1ZQMA 3CCSA 3KDFA 2QF7A 4OW0A 9ICMA 2MNAA 2JZ1A 3RB4A 3PMFA 4I7ZC 4EBCA 3MAQA 1JXEA 3RJKA 4F91B 3MR5A 2ISPA 1NOMA 2HOIA 2BCRA 2B2UA 3KJOA 4X65Q 3J7AF 2HL7A 4ICAA 1R2ZA 1RYSA 1VLBA 5FTJA 1WYDA 4UPAA 2A1JB 2VANA 2KIVA 4G6ZA 2PKEA 2YB1A 4TUPA 1S9FA 8ICNA 3KOJA 3PGZA 5IODA 4A3IG 2RCNA 1GJXA 4JW0A 1NZBA 3BU2A 2B8FA 3I73A 3TN2A 1PH3A 4QWAA 2B63B 4QZGA 3RBDA 1A8VA 9ICBA 2VJ4A 1ESFA 2DENA 1UA0A 3JPRA 1F0MA 2R61A 5EPLA 2KEBA 5C44G 1GL7A 2R44A 2DL0A 2ES6A 1WTHA 3SEBA 3C29A 3ZJYC 4ZKBB 3U6OA 3WK4A 1X42A 4Z9CB 3DLLA 4FF1A 2D5DA 3DFZA 3H4BA 1FJGL 5C44H 4DV5L 3F2UA 3PF4A 4R7GA 4DV7M 1NK0A 3D31A 1XXHA 4KLIA 1I4PA 1VQ4A 2K33A 4J9QA 1IYUA 5DM63 4C4SA 2C99A 3LCUA 4KLMA 1JB3A 2H3QA 2DNCA 2D9UA 4DV5Q 3KZIU 4XT1B 4P73A 1PZNA 3WU2U 1ENCA 1IHZA 3H6MA 5IY0A 4G3OA 1ZYRD 2GOLA 4YR0A 4LY6A 5JUMA 3JAMc 3GLIE 4ED8A 1KFTA 5BR8M 1Q81C 3SBJA 5AKGA 5KT7A 8ICIA 5D3DA 4NOOB 4IUUA 3K1JA 5JOBA 2J7ZA 2RLTA 3EJIA 3PO2G 1EYAA 1NV9A 4Q5VA 1ZKOA 1WOCA 4RT2A 2AKWB 4M9ZA 1PRTB 4JI2Q 1W5SA 1R9TB 4JBMA 2X4AA 1Q7YC 1D7QA 4QZEA 4FE3A 2W55A 1ZQQA 5IGBA 4X65L 2UUBM 2JY6B 2NVYH 3C5FA 4YHHL 2NVXB 2RKOA 5KFNA 4ZUJA 8ICLA 3BQTA 5KFIA 2ZIUA 3T1YQ 2L55A 3QG1A 4I2DA 3VR6A 5B5EU 4X3SA 3MTSA 4NXMM 5J0YA 3UQ2A 1ET6A 4LF7Q 3QU2A 1GUGA 1OXVA 5CV5A 2BWBA 5DNYA 3TZUA 3M3YB 5FTKA 5IGEA 3GPYA 3JAMi 1D2BA 3PW5A 4OX9L 4QZ8A 3OIPA 1Y69U 3NUCA 3HOZH 5IP7G 3GQ4A 4IUTA 4R4IA 3ORYA 4DR6L 3G4SA 4A3JB 3GP7A 4FO2A 5KFWA 3ICXA 3OTQA 1HQCA 3V76A 4A3EB 3IFDA 1ZMVA 3TQ1A 4MNOA 4MHVA 4ECTA 8ICKA 3T5JA 1KNEA 5KT2A 3GPUA 1PFNA 2ID0A 5JEAG 5IT9S 1G8PA 4M9JA 4JI3L 1I94Q 1COOA 3HJQA 1GD7A 2K05A 3H3VH 1JCKB 2Q2TA 4DR3Q 3NEMA 4EX6A 1ZQFA 5EAYA 1YNJD 3FP9A 4JI4Q 3AN1A 1VEKA 3FE3A 5DGAA 2F0OA 2EQYA 2B39A 5ELDA 2R46A 3GQ5A 4XQ8A 4XYQA 3WK8A 5HGQA 1O78A 3L2PA 1AROP 1EWHA 2Y21A 1T6OA 1XSLA 4XYOA 1BNZA 1QAMA 5J0XA 1OTRA 2SNSA 1PH9A 1MIUA 5E4XA 3RB6A 4E6IA 2KNVA 3SI8A 1KAAA 2K5VA 4RCNA 5I6YA 3T1HL 1ZRMA 3GLIB 8ICFA 4LF8M 1D8YA 3TRZA 3ED5A 5ALRA 1S97A 4J1MA 1ET9A 1XMQM 4IRKA 5ELBA 1EL0A 2NTSA 2DGYA 3TZDA 1U47A 4YY3Q 1ECWA 3PV8A 3OTOM 4M8AA 2EZYA 1UE5A 3HPOA 3FKIG 4RAUC 1I50B 2UUBL 3HOVB 2J6SA 4KHVA 1ZQKA 3IL8A 4TKOB 3VR2A 1QVGA 1TWCH 5ALUA 3LVVA 5ALDA 3THGA 1GKHA 2QGQA 1RKNA 2K03A 2Y20A 3VA7A 1SXJA 5EPKA 1Z6TA 4KX3A 3UXPA 1V33A 1PZJD 4DUYL 3HKZC 4P4OA 4DSJA 4IBFA 4HMIA 2UUCL 5ALTA 5KFZA 4YD2A 2F0KA 4DAYA 4A3EH 4ECSA 1FNUA 4DK3C 1YUBA 1WHCA 2LS01 3KP1E 1HQRD 4IL6U 5DG9A 3GP1A 5FLXL 4NLKA 2YMQA 3AYHB 3HG9A 4HJ5A 4HJ7A 5M3FH 2KKVA 3I70A 2LXKA 4YVZA 3F1ZA 2Z6KA 4GHLA 3T5KA 3UXOA 2BA1A 5KFRA 4DR1Q 4TUQA 2A6EC 2VL6A 3DM3A 4KLTA 2R65A 2X49A 1ZYQA 4JMUA 4BY7H 4G7OC 4DV6Q 4G3IA 3PUZA 2G06A 1Q8KA 4GC7A 5C4ZA 1X9WA 1G4AE 2B6GA 3A0BU 5K5PA 3IN5A 3JPTA 3JAML 2DAKA 1X66A 2AGQA 4KHPL 3I91A 1KXLA 3DEEA 1VQ6A 1IBKL 3DZDA 1N33L 4J9MA 2M5ZA 3O0FA 2JN4A 3KLRA 3MC1A 3I4OA 4G4KA 2G5IB 5KFHA 4LF8Q 1HQYE 4X65M 5DQGA 5G3LD 3TPZA 3RZDH 1LT3D 3HP6A 2K1BA 4S12A 1HUZA 1SNDA 9ICOA 4TRDA 1M6YA 3R8FA 2XRQD 8ICCA 3VFDA 1XSNA 3LVWA 5J8YA 2IMWP 2HHQA 4KKSA 3OTOL 2F8KA 4RQ4A 1ZQ9A 4DV0M 4JI4M 1RYUA 4O5EA 3SAWA 1G8ZD 3S2HB 4IJLA 2LFNA 1WTVA 4WORA 5IGCA 4A3KH 2J4XA 1WTXA 4YXJA 4DV1M 1ZQCA 5LMNM 1VQ5A 4IBBA 4GLXA 5D14A 2MGWA 4JI7L 5J2IA 1JOQA 2RQXA 3KDFB 1WGNA 4KLGA 4LF9M 3PX4A 2KRUA 1LUZA 2PI2A 3S1RB 4K5WA 1X9SA 1QYRA 1H38A 1ZQPA 2N78A 3L5KA 3FTEA 3G6VA 4ECQA 2RHQB 3LYSA 1QZHA 1PYWD 4JI5Q 2JA8B 1KBUA 4DV3M 4K0KL 2JSOA 1AUAA 4QHTA 3QWNA 1ZD2P 1PMRA 4A3MB 1QZEA 3G6EA 1SE8A 3CC2A 4HJ8A 3WK9A 5FO7B 4EX5A 8ICBA 2W3SA 3MVVA 5HURA 5E26A 3NRZA 4GITA 3SHFA 2JH1A 3CRXA 1SJED 5L8RF 1GUTA 1HIWA 4BY1B 2UXBQ 2YTYA 2XSZD 3STBC 2H3IA 1GUOA 1Y1VB 3UK6A 4A8EA 1I6VC 3W2DA 3ZQJA 1BCPC 5J2AA 5L37A 9ICPA 1SRUA 2F0LA 5ELNA 4EYHB 1XPOA 3FTCA 1OW5A 2OOBA 2DPJA 2HUGA 5HHHA 4GZYC 5E79U 3HZJA 4XA5A 4CF3A 1STNA 4DF4A 4P2CB 4A4IA 4QOSA 4M0WA 1GABA 1R4QB 4R8NA 4UAUA 4NLGA 1ENFA 1RDPD 1F9RA 3BYTB 4YWMA 2JA7B 2F3NA 3FUXA 3EW9A 3NGDA 2HOQA 3GLHE 1XNSA 1K83B 1BR9A 2IHEA 4C4RA 2FH0A 3F92A 2ZXHA 3QEBZ 4I28A 1QNUA 2F3IA 1PJSA 2XH9A 4OONA 2JA7H 4Y2YA 2KENA 1CKOA 2YNMD 2IW3A 5AI6A 1HNXQ 2E2IH 4A3LH 4F72A 3AOEC 3FUVA 4F5OA 4Z6FA 4O3SA 1V92A 1PFSA 5E3FA 5LMNW 2WAQC 2VUMB 5J0TA 4EIWA 1N78A 1F2MA 1I4XA 3R2TA 3T15A 4UAYA 3SATA 1MGSA 5J22A 1B22A 2G9DA 3HOUB 1AFPA 1H6UA 4EQNA 2DUYA 2D0OA 4OCZA 1OXUA 4RNMA 3ULLA 5C0XH 4UAIA 4ZQ3A 4D82A 3IM1A 2XGQA 1R4GA 2H3FA 4POFA 2BNKA 2LYAA 4QZBA 3J7A5 2MQHA 2JEJA 1SYFA 1Q82C 5AHXA 1DK2A 4ED3A 4X66Q 3Q8QB 2NRZA 4IJFA 2B21A 2F0JA 2J7NA 3KBBA 4P71A 1YHAA 1YJNA 1XMOQ 4DR7M 3RJFA 4QZIA 1QZMA 3D2NA 3CW2C 2Y1IA 4M9GA 1T3QA 1XNRM 2NV3A 1ICFB 4ZRZA 3I56A 4A3KG 4RMFA 3GTMB 4IOAA 4F5RA 1IM2A 3MFGA 1N36Q 3HEJA 5C5LA 2SDFA 2AQ3B 2H1RA 3C2LA 2YV5A 4NC6A 4ABNA 5LMNQ 2UU9L 4C3HH 4XTCS 4C3JH 3JPSA 2PPBC 3RAQA 4JI3Q 2K8AA 3F5EA 1S0NA 4GLAC 3HGIA 2E8PA 4OO1H 3M85A 5KQ8A 2OYYA 1J7KA 4ZOHC 5KG5A 1ZXTA 1X40A 4LUVA 3RLNA 1ILPA 2Z4SA 1SYGA 2DGZA 2F4VL 4QIWB 2VQFL 4DR6Q 1TXYA 5IZ7D 4DLGA 4FP5D 4A3BH 3I90A 2W04A 5IYBH 2FE9A 2P35A 2KOLA 5AFWA 1K8OA 1N48A 3FKEA 2YTUA 4TVAB 1ZEQX 1PV4A 3C2KA 8ICOA 4Y7NH 2AUJD 1N5XA 1SNOA 9ICLA 4B9WA 3SR6A 4A3EG 1I94M 4X62Q 4B3RL 3SC3A 1B0XA 3MDCA 3WKAA 3U5ZA 2EE1A 1QVCA 3J7AV 3HWTA 4ANRA 2BKEA 1QQ5A 4UB8U 1GOZA 2HQLA 1L3TA 4JI2L 1CHQD 4LF5M 1XC8A 5GADC 3H15A 3HT3A 1WTWA 5A0LA 4DR1M 3L4PA 4QIWE 1H9SA 1VQAA 4PJ0U 1OXSC 3IP4B 1ZD5A 5CV9A 4KLOA 4LF4L 2BDPA 2K32A 3H0LB 4UQGA 1GJSA 2DAEA 4O3NA 1EZ6A 3AL0B 4C56C 1WTRA 1IBLQ 1TKDA 2ZT9C 4QCLA 5EXSA 1QUQA 4ULLA 2I6XA 2KMDA 3STBD 2FI1A 1T5XD 4NLZA 2KSOA 4PGYA 5ALQA 1B70B 3UPQA 3EPGA 5C4XB 4QQBX 2QKQA 2K9DA 3MXNA 5CA7A 4LF6M 3M3YH 4QL5A 4C2MH 3PO2B 3P20A 3VKGA 1VQEA 3SASA 2CUZA 1Z6HA 9ICNA 2K8CB 1XPRA 1QSYA 1CA5A 2ZUCA 1NJGA 1Q3UA 4JI2M 4BXOB 4Z6EA 2RA4A 3KYHC 1WWUA 2XCPA 4KD4A 1KKXA 4ITQA 5FLXc 1CHPD 1X6IA 4A3FH 3KSJA 2BDUA 2KV2A 2R4EA 2B2VA 3K5LA 3GTMH 1X65A 3KBXA 2HHHL 1X56A 4CJ6A 1I50H 1CI3M 3PNYA 1X55A 2QPAA 1X9XA 3D8GA 1HFNA 4OGQC 2KNJA 4R8UA 2Y0TA 3RFWA 4JI8M 3ISBA 9ICVA 2XIDA 5IINA 2XZUA 1ZQDA 1SNPA 1X3QA 4B9NA 2MH8A 4DV5M 2X6LA 2IWHA 5A2QE 8ICTA 5KFYA 5GQOA 3A5UA 5NUCA 2Y0QA 2DKLA 2D2CC 2KECA 2NRVA 4HYKA 1LO5D 4FF4A 2MP1A 1WIVA 1QLNA 2YTVA 1FGBD 3OPXA 1BPZA 2G07A 2BCQA 5JI2E 3C28A 1RF2D 2EKKA 3VK8A 1MSHA 2P66A 3GIMA 2CWPA 3PO4A 1T94A 1MN3A 5ITQA 2Y0SB 4A93B 2HT1A 3FD9A 4B7FA 4Y2QA 5AKEA 1KFSA 1SFOH 1OTCA 1A3UA 1MJGM 4I4LA 4TQSA 1QNKA 2W9CA 3GTKH 1N77A 1M90C 2PI4A 1SMXA 3WKDA 1TWGH 2WHEA 1TH4A 2OQKA 2JY7A 2W9CB 2V6ZM 3L3FX 1XC9A 2YFQA 1ILQA 4KO8A 1SXDA 4BJQA 4U6PA 2WKDA 3CQZH 4RWSC 4B08A 5J2KA 3WOFA 4EELA 4RHSA 4DV2L 2R93B 4FZMA 3SMVA 2ALZA 4OJ5A 2JQOA 1FO4A 5J0OA 5FK9C 4MGZE 2K4PA 1FJGQ 4CNQA 2ZM6Q 4ILWA 4OWXB 5C6AA 1LTTD 2HIXA 3EN2A 4CGYB 1K0SA 1X9MA 3D6JA 3QU4A 4Q43A 5I2YA 3CP8A 4DAYB 4LK1C 4GKJL 3T1YM 1AE3A 2OT2A 4LFCQ 5IE8A 4FWGA 5IIOA 2HCCA 4HMJA 4HIDA 2OTJA 1B9MA 3GLGB 2EAMA 2XY5A 3QIAA 1B53A 5EWEA 2PZWA 5I9OA 4I2GA 3VLFB 3HJSA 1BUVT 7ICNA 1PLFA 3LGJA 4DV1L 3D6CA 1ML0D 3RJJA 1SYCA 2CWBA 2WB1C 1N62A 4I2JA 1VJ5A 2AJQA 1WCMB 2WAQE 4O42A 4EEKA 5IIFA 1L0YB 3H8WA 1RYRA 2FJ2A 1AP0A 4X64L 2ASDA 1EYDA 4NKLA 1VQBA 2XVTA 4CDFC 1B43A 1X37A 3WHKA 1SXEA 3S1NH 2PMZF 1X54A 2B3TA 3QU7A 3KS4A 4XBOA 4MEYA 3QU5A 5IIKA 5IIMA 2UVVA 1DM0B 1S8OA 2BCOA 2WSEF 4HIKA 2VQEL 5AM0A 9ICJA 4ELUA 1JE4A 2BE5C 2NVQB 3KDSE 4MM3B 4PL2A 4I7AA 5J0SA 1XB2B 2XEPA 4QZHA 1NJFA 3BZKA 2VA8A 4DS5A 4KN7C 4DNIA 1KW4A 5ITTA 4QNLA 3J81i 5ALGA 3KBGA 3CF6E 4CKCA 1CA6A 4F71A 5KFDA 4AG6A 2BCVA 2TSSA 3NTKA 3GTGH 1OJLA 5F2DA 2KJ9A 1MHWC 3QEAZ 5KFQA 4OO1J 1GKIA 4JI6L 4ZPXA 2HCFA 1SZHA 2JGAA 3HRDD 4LNQA 4V190 1Q12A 3B74A 1TT2A 4JI8L 4DBGB 3U5ZB 4BBAA 5AM4A 4ALPA 3GTOH 3LWLA 2XO7A 1XWEA 1VQPA 5KFTA 2ZXPA 1IYVA 2C9OA 4LFCL 2HQEA 2K47A 1V97A 3NE5B 4A3JG 1D8LA 3H4JA 3K92A 2E3TA 2J6UA 2DUDA 1N34Q 4IALA 3I28A 4RFBA 5J2GA 3Q8GA 2DWZB 2KVSA 2Y9UA 7ICIA 5ELOA 3OW2A 2Y0SG 2D6FC 3ETRA 4BBSH 3D2QA 2QBYB 2YMMA 3RJGA 1SNCA 4R63A 4B9LA 1SSOA 3T16A 4U7CA 2B63H 4IBGA 1D6EC 1ED1A 3VYUA 3L25A 3NBIA 2QDLA 1CM9A 3RRHA 4WJ3B 3MEHA 2XGTA 1QB5D 2ISOA 5TZVA 1F9QA 4ME5A 5KL8B 4GC9A 1S0VA 3RR5A 1YHBA 1XS9D 4B3ML 1PVOA 4GN5A 1TWFB 3BXWA 1OO9B 3R9XB 2C2EA 9ICIA 4DN4M 2F4VM 2JA6H 1OAIA 3UJNA 3V6JA 3CRLC 3BQ1A 5AI9A 5IWAM 4XXEA 2MGSA 4FCWA 3ZDAA 1E1OA 1PTOC 4K2LA 1PZKD 1BGXT 4HJ9A 5FKAC 4LF4Q 4J15A 3A46A 2XFTA 3MBYA 2DFLA 1F2LA 2IL8A 3D4DA 1V43A 3HKSA 2E2IB 4Y28F 5L1MA 3VC8A 2F0QA 4H7BA 4BY7G 2E5LM 2PYKA 3PF5A 4N9TA 4H02A 4PZOA 4EQ5A 5D4BA 4DPGA 2ZJPA 4RPYA 2HBMA 1TK0A 3RNUA 2E76C 1HZBA 1Z5BA 1G51A 5KGUA 3PMNA 1A5TA 5CR0A 4PMBA 1GL6A 4FF2A 4G4NA 1M1KC 2R7ZH 3C46A 5JVG3 1WD1A 4F2LA 2JUJA 2BQ3A 1N32Q 4QZAA 1YEZA 1IBLL 4L63B 3MDAA 1EOVA 4B3TM 5HR6A 1KNAA 1B44D 1K0RA 1SL2A 3PO5A 1HEKA 4CE6A 2RDJA 2Y9TA 2HOFA 5KAFU 3LQRA 2FMPA 2KHVA 1X2IA 1HQMC 2VQFQ 2A8VA 2F1JA 5E6JA 1CI4A 3RRGA 3QYPA 3SDZA 3CMAA 2J7OA 3TQYA 2G3QA 2HAKA 3PUVA 4AH6A 3P1HA 1NO1A 1KAWA 4L5SA 4F5QA 5GAEC 1JR3D 3W0FA 3HHWA 1VMCA 3Q23A 5IGDA 2EKFA 2LHGA 2ASLA 2XY7A 1QAQA 1H9JA 2NN6H 1HR0W 4BX9C 4DQRA 1J09A 2IPKD 4DV4M 4JVZA 2AQ4A 5BR8Q 1KC8C 2CEAA 3C9PA 2KZ3A 4H0LC 2LYHA 2UVUA 4JK1A 2HHUA 7ICJA 4IFDI 2HDOA 3C1EA 4HEOA 1YSYA 1SB3C 3TP6A 3B0XA 4DGZA 4WJ3M 3ZC7B 3PSPA 1QAOA 4Q44A 1CRXA 3S24A 3GV8B 1FD7D 3NASA 4RKLA 3EQLC 3TWKA 4J9OA 1VQCA 1MX0A 3UXNA 3GILA 1NBWA 4X66L 4D81A 4A3MG 3BOSA 2HD3A 2UU9Q 4IBKA 2AH5A 3OHBA 8ICZA 2PI2E 5CV7A 3FTFA 3FMCA 3K59A 1ZQVA 1TK5A 4I2HA 2NWGA 3EVQA 4DFAA 2WZJA 3GRVA 4GN3B 4JI0L 3GIKA 3K9PA 4ECUA 4LJ6A 2F3WA 3MWYW 1N36L 5C1BA 2QB0B 3U6LA 3FPUB 2QB1A 5L1LA 2OCEA 4USAA 4DAPA 2YQEA 2VF7A 1OXJA 3W0LB 1BQQT 2BR0A 1HRJA 5JJKA 4EZ9A 4RQ2A 4UP9A 5EKKA 4EGVA 1EE8A 4DR2M 5M3FB 9ICWA 5ITRA 2WB1E 1S3SA 1WCMG 1LTBD 1T43A 1RDFA 5ALNA 8ICGA 1K82A 1ESRA 1AW7A 3KLSX 3M9NB 1HJPA 5AM1A 1JRPA 3SV4A 4BY7B 5ELFA 4J6HA 2FPKA 1LV7A 4F92B 3T56B 4KLDA 1MSGA 3KFUF 3I7FA 4JG2A 1TF0B 2UXDQ 1YE9A 2EANA 4OJ6A 2Q2UA 1SV0A 3CP0A 1Z4NA 1SL0A 2BDOA 1CSQA 4MGHA 3V2TA 4U673 2XSCA 3PFIA 1NY5A 4BWJA 4JV1A 2E8OA 5AK5A 2DY7A 1NAPA 3A7AB 4ED0A 4DR3L 4GXKA 4FDBA 2UXBL 5BPCA 3P7JA 3B0YA 4DK0A 3SYKA 1QILA 1KIXA 2KOBA 3TP8A 1XNQL 3D4RA 3HHZA 2VJ5A 4DV3L 4Y2XA 2E74C 3JAMS 3H4DA 3H8MA 3UGJA 4RNOA 1XNRQ 2BWEA 1IW7D 2VS1A 3M6AA 1RPLA 1TWAB 2PI5A 5BOLA 2CW0C 4KLUA 1Y1WG 1MU5A 2YU9H 3KOYE 3CPFA 1Q3VA 2DF4B 3DUZA 5ITXE 3EIEA 3I76A 2F0NA 4JI7M 2A1AA 2EY5A 4K4HA 2K28A 3FKIH 2DY8A 3M4OH 1DCZA 1ONLA 3NWSA 3N28A 5H1SE 3E3XA 2MPMA 3G7LA 5D65A 4XQQA 1R9TH 1A63A 2DWNA 1SXJE 2ZXOA 4A93G 5ALHA 1KDAA 2XWBB 3L3OC 2KJ8A 2W7OA 5EJCA 3TADA 2RKSA 3PUXA 1XNQM 4F4YA 1JR3A 4D80A 5BN5A 4YP3A 4B6JA 9ICEA 2OF1A 1J97A 1N32L 3R3OA 2OM6A 1QDTA 5ALVA 4QW9A 3LK9A 3MXNB 1UNSA 1SKWA 2HMXA 3O13A 1FFVA 3NQIA 2KG5A 3PNVA 4L78A 4P0QA 1PH4A 1Q1BA 2JA8G 3GTQH 3CCVA 4AP9A 3WOEA 3GRRA 4A3CG 2BCSA 3GLFE 3HHYA 3HX0A 3GTJH 1YIJA 2RP5A 1VQJA 3HOZB 3KTQA 4LF8L 4GHAA 3RH5A 4HN7A 3RN2A 1HR0M 4QZFA 5LHY1 1UQVA 5KFSA 5CV4A 2LXEA 3RF9A 2LHCA 1FNWA 1IM4A 3X3NA 1VQMA 4CHTB 2D0PA 4A3MH 4DSIA 1L1OB 4S3SA 2WV6D 7ICVA 1SFOB 1QSLA 2JP1A 4I5SA 3H8SA 4UB5A 1ZQNA 2CKZB 4NXNL 4KKUA 1J2MA 4HEDA 2FMMA 5J29A 2W9BA 2Z8YM 1PGYA 3LMMA 2KCNA 3PO3G 2HHWA 2R4JA 3LDAA 1CEZA 4O3QA 2AQ1B 1RTOA 1V1PB 4RH6A 2F5PA 3C1YA 4UAZA 2UUCM 1PUZA 8ICSA 3S2DB 2XF3A 2W3RA 1G291 2E8NA 2E8GA 1Y8GA 5LL6S 2QP9X 5EE3A 2J5YA 3F2BA 1EY5A 2EDGA 4YCVA 1RQNA 5EBCA 1S10A 1OFHA 2RRUA 2V1CA 1VS0A 5J3BA 3R8BA 4I27A 1X32A 4OO1G 3DXJC 1L8QA 2AGPA 4K6DA 1UWVA 4DXFA 1G2TA 1EWIA 1I6HH 4GOPA 1NNXA 1ZQYA 3A56A 2VQEQ 2FDRA 2LWXA 4DUZQ 3H0GH 1RG6A 4JB3A 2PQEA 2P6RA 3OWFA 1K3WA 1AQ6A 1L8LA 1F4IA 3N52A 1GO3F 1GLNA 4F4KA 2YB4A 1X3PA 4JC0A 3CC4A 1QG7A 4IO9A 4R65A 4C8OA 3PNCA 2HVHA 2I5LX 4ZYSA 1MQ2A 3QO2A 1HUMA 4NP5A 2ASJA 4PQXA 1KQSA 1R4PB 2KA7A 5ALYA 2EYJA 4DV1Q 1XTDA 1UA1A 3R93A 3MR3A 4L16A 1PK3A 4KY7A 3K57A 2ZXIA 1STHA 2OXOA 4DS4A 4F50A 3WWVA 1Z47A 4BXXG 4YCUA 3KOZE 1TY2A 5COYA 3HOUG 4MIUA 3IECA 3PIO3 1NJXA 2AUKA 1SROA 3H09A 4RGTA 2UVRA 1LLRD 3SGIA 4DKAC 1S0OA 3C58A 4LFBL 3PW7A 1LV9A 2CFOA 2B2WA 3GLFA 2A74C 3H0MB 1NZPA 3A74A 3LX0A 2KUMA 3TSSA 5CGKA 5C3EG 4RQNA 1SBBB 3RN5A 4AKIA 4A3CH 1WUDA 3FRPB 1DJRD 2EXDA 3T1HQ 5IT9L 2YMPA 4RGNA 4MEXA 4GLVB 1YLAA 2ZUBA 1G6ZA 4Y2SA 1VQIA 1N9WA 3RZOB 2BPCA 4OJOA 4LF9L 1TAUA 1UEBA 4N8FA 1JORA 1HR0L 4KLKA 2DZLA 3KF6A 3G6JB 4Z8XA 4P75A 4GKJQ 1NJZA 1VQ9A 4X3KA 3S2HH 2VDBB 5AK6A 3SK4A 1IXRC 1EY0A 3HOZG 4F1IA 3JAME 4IPHA 2PNHA 3UMMA 1DGSA 5KT5A 1ZQRA 4BDPA 4LF7L 2E2JB 2KCCA 2GO7A 2B3GA 2ZUDA 4B9XA 4CJ1B 1N8RC 3QOJA 1CKMA 4IPDA 4FZNA 1I4RA 3G6XA 2F4VQ 2ZJAA 1JICA 3SE0A 3D6WA 4DU9A 4XT3B 5I6WA 4NM2A 4AYBE 3IV6A 4DA2A 2AU0A 1U4BA 3J7ZC 2C5RA 4GC6A 2RBMA 5DDYA 2B8GA 3NUQA 4M6WB 1IG6A 4J9SA 4FS2A 4X3TA 1H9KA 1PFMA 4M1UB 4KLSA 3RUZA 3CCQA 3C3EA 1F44A 3BJYA 1TTEA 1A76A 3KUPA 1NV8A 1LYLA 1J5EL 3J80c 4RQ0A 4IBEA 1UEAB 3NENA 3SAHA 4CF4A 5J0RA 3J80E 2HHHQ 1PZID 2F8LA 2LI6A 4C8NA 4IUNA 4AIMA 2O01F 1RU3A 1KD1C 3D2SA 3AV0A 4J03A 4BB9A 2QSFX 4JYAQ 3DOAA 2IHFA 2M00A 2G5HB 2WAQF 5H2FU 1N33Q 3M0EA 2MO1A 3AMUA 2L4NA 4GRIA 5L9XA 1CZGA 3TADC 3NVZA 1QSSA 3A8JE 1JT8A 2LMCB 1ORYB 4MGYE 4ZLTF 3FYHA 1BCPD 4PMCA 5IGFA 5J39A 2CV1A 2Q8RE 2R8HA 2PFOA 4DL7A 1VDDA 2KZUA 2CW0D 3S1NB 4IR9A 5AKKA 7ICSA 1NMGA 2AHOB 4DUYM 1U9RA 1UFZA 4YFKA 3SXHA 4O3MA 3VR5A 4DOBA 4K5XA 5EBDA 1VQ7A 2KNAA 2ALYB 3S14H 4A93H 1CUKA 1VDVA 2KP7A 1WR1B 4R4QA 2CRXA 1SEBD 1RODA 2DHYA 1AH9A 3BDCA 4L15A 4LJ8A 3K1RB 2R8IA 2B2WC 4KLLA 1Z00A 2A6ED 1OIZA 2KD1A 3MXUA 1XMQL 2FJ6A 1BNOA 4X62L 4B3RQ 3DA1A 1HUNA 3SAFA 3ND9A 4OVZB 3V6KA 4J9NA 3V7JA 5KG6A 1F77A 4DK1A 5C3EB 1FNVA 4B9UA 1S5LU 5CEHA 1GJTA 1JUDA 2QCPX 1PH1A 1B50A 3E21A 3R2IA 3CHBD 4GKJM 3I72A 4C8MA 2FPMA 4PDIA 4K8JA 4G9BA 3W3AA 5D3IB 2B63G 3M7GA 5G5GA 2BGWA 4NXMQ 2X6GA 1AZPA 3S15H 3IFTA 4IOCA 4QNMA 5FLXE 3M9MB 2EJMA 5KEEA 2KTQA 4IFDH 2FLNA 1JALA 5IP7H 2ZTCA 2EO2A 4GMQA 2LPEA 2HHSA 1Y14B 2XTIA 1EQVA 3SHLA 2WSCF 2JR5A 4QIWF 3PV0A 4GNXA 5H37D 3I4YA 3TQSA 2XFSA 1ZV1A 2PW5A 4QUFA 3AKZA 2RSNA 3GZFA 4HLQA 2K4IA 3H0RB 1IL8A 3NBHB 4YWKA 4ED7A 1VQ1A 2L2DA 1CKNB 4PNYA 5AKXA 4RUCA 4A3KB 2ATWA 1ZQIA 2XWJB 3BS7A 1PA6A 1UT5A 3ZH9B 3WDNA 2R62A 1STEA 2L15A 3U4VA 4C1NI 4A76A 4UN2B 2GH1A 4P0PA 4NMZA 2UUAL 4LVSA 3I2ZA 3NVYA 1XMOL 4JI6M 2A6HD 4KLQA 2DWQA 1XO0A 4O3RA 4DR2L 3T3FA 3KJPA 1V1QA 2Z1CA 3TAQA 1N2XA 2RQ5A 4QJFB 1JOKA 1MN8A 2A69C 4G7ZC 4RPXA 5KNCA 1YITA 3Q8XA 4P17A 1BF4A 5KYLA 1E24A 4ZCKA 3ER0A 5KG2A 1HNZQ 4YHHM 2APLA 2VA3A 2GVAA 4ED1A 4X3UA 5CMDA 4A3GB 1IY0A 2ZAMA