2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
2I5LX 4PHAA 5DLQE 3CCMA 5J2FA 4GXJA 5CHGA 5BOMA 4Q44A 5CP2A 2JE6I 3CCQA 2KHHA 1NJZA 5IIOA 1ZQKA 1XU4A 3MEFA 1XC9A 4I2DA 2DAKA 4LZGA 4RQ1A 3PMNA 5IYCH 3JC66 2UXDQ 4KLIA 2V4RA 1XPUA 2VA8A 4PZ7A 3I56A 3UQ2A 3I55A 4JI4L 4KN7A 5J2KA 5M5WH 4YCWA 2F1HA 3RLFA 2RRUA 5D46A 1IZ6A 1EUJA 2AKWB 4G3IA 3RRGA 4LFCQ 1EXNA 5DKWA 5ELNA 4DUYQ 3T1HL 5TZVA 1WGLA 4BY1G 5L1LA 4G3OA 4DPGA 1UA1A 4TQSA 4QZDA 4QZIA 3E2EA 4DR1L 4FS2A 4RQ5A 3UQ0A 2PI4A 2MUTA 4YCUA 1L2FA 2EIFA 3PW7A 1VQ8A 3H0GG 4DR3L 5HGQA 5HHIA 1V92A 4AYBE 1XNRQ 1VQBA 1ZQDA 3NEMA 4AYBG 2NN6I 2HIXA 1HNWL 3HOVH 4BBSG 3L0OA 4J9OA 4K4GA 3H0GH 4R71A 4R8UA 4UAZA 1IFYA 4RPYA 2IHEA 2AU0A 3KHLA 1YHAA 4UB2A 2MO1A 3QEAZ 1K1SA 4R4IA 4X64Q 2PQAA 4MEYA 4J9LA 4KLJA 4IFDJ 4A3GG 2VQEL 4B9UA 1P8LA 4IFDG 1ZQVA 5DG7A 5E7NA 5J0WA 1WCMG 3IRBA 4B3TQ 3OSNA 4IRCA 4DQQA 4JI3Q 1Z00B 4RQ2A 1PVOA 4RPXA 4DFMA 4UP9A 4M9HA 4RNNA 3GV8B 3PX6A 1Y1WH 3TARA 2IX0A 1RIPA 2JZBB 3CC4A 5DDYA 1BPXA 2ZJQA 3GIIA 1NJXA 4F5OA 1HT2E 4I2FA 4IRDA 3U50C 3RLOA 4BBRH 2Q2TA 5FJ8H 4KLOA 4UBBA 3OTOQ 5GQOA 4JYAL 1X3GA 5C4JH 4KI0A 4X66Q 1M90C 1MSWD 4P75A 4AQYL 4QWEA 4DWIA 4BY1H 4BY7G 4DLGA 4DQSA 3GFKB 4YY3Q 2AQ0A 4J9NA 2ASBA 3S1QH 4K4HA 3PIOA 1W3SA 4B9TA 4JOIC 4DOBA 5M3FH 3E46A 1YZ6A 3HKZE 1KEJA 4FBUA 5L1JA 1BPBA 5C0XI 4UP7A 4F4ZA 2MNAA 8ICNA 2E2HH 4M9LA 1VQPA 2AWOA 1VEKA 5BOLA 1XJVA 1M1KC 3MR6A 2AGPA 4DR4L 1A76A 4UB1A 2ALZA 1KFSA 9ICFA 4IR1A 3OHAA 1VQ7A 3M85A 1XPRA 1ZQJA 2E2JH 1FJGL 1GD7A 5DBAA 4TVAB 2JEJA 4NLNA 3E21A 9ICEA 1T43A 4GNXA 4DAYB 5DB9A 1IL2A 2IHFA 2VANA 1QZGA 1O7IA 1S40A 3C2LA 4JI2Q 4A3DG 2I5MX 3K75D 1X9NA 5KT4A 1N56A 3KDFB 4BXXG 4DK6C 1OTCA 2R7ZH 4DV4Q 1TWHH 2WAQE 1NJIC 5J2CA 8ICLA 3HOWH 3PSIA 3MFIA 4QZEA 4GKJL 2BH2A 3MABA 1HUOA 3GIMA 3CMEA 4PZ6A 3PGZA 4AIMA 4FS1A 2Q2HA 4JI0Q 2W9AA 2HHVA 1ZQQA 3H8JA 3CW2C 9ICVA 1ZV1A 1E1TA 2MO0A 1Z3EB 3G6YA 3S2DH 7ICFA 3BJYA 4HEOA 3K0XA 1J5EQ 3HWTA 3PO3H 3ZD9A 1E7ZA 1KLNA 2R8IA 3N97B 3GILA 1E94E 2J6UA 4DV7L 4POGA 2D62A 5L1IA 5CA7A 1IBKQ 4KLQA 2B29A 2XCAA 4LF4Q 2BPGA 4DL5A 4C3IH 1ZQBA 2N49A 3V6HA 3PY8A 4NLKA 1Y1VG 3CAMA 2WAQG 2Y0SE 3RJGA 1VQCA 3KF6A 2PFNA 7ICMA 4KITB 5C3EH 1CKMA 3QEBZ 2YTXA 9ICOA 1NK6A 8ICCA 4EQ5A 4I28A 4BWMA 2AJQA 2P6RA 3EIVA 3AU6A 1NK7A 3G48A 5J3BA 4HJ8A 4KHPQ 4QZ8A 4XTCS 4X65L 4B9LA 2ZUDA 2JY5A 5C3EG 1NK8A 2PNHA 9ICCA 1PYBA 9ICNA 4M9JA 2HWJA 1T8EA 4MF8A 9ICAA 5C4XH 1S72A 5IT9c 1RYSA 4WJ4A 4ECWA 3V7LA 2JNHA 3TS2A 2QEXA 1D7QA 2DZLA 2JY8A 3PV8A 3K8AA 2FPKA 3HKZG 4QZBA 2L15A 4KLUA 4DL6A 2IHMA 1XO1A 2ZJ8A 1ZQLA 5M5XH 1MC8A 8ICMA 1SE8A 1EQRA 3HT3A 1ZQGA 4JI5L 4XUSA 1G4AE 3RRHA 1S0MA 4KLSA 1EWIA 1NK4A 4KLEA 3I4OA 3PO2H 4JI1Q 2BQ3A 2K50A 3M4PA 1RYRA 8ICEA 1VQJA 3MXNB 1NV9A 1XMQQ 4TUQA 4Q8EA 3PO5A 5J29A 2AHOB 4IO9A 3LK9A 5IWAL 4YN4A 2BCRA 3RNUA 1B70B 2XGPA 3TANA 2UU9L 1K8GA 1XMOL 4WP2A 2R8JA 4R4CA 3MR5A 2UXDL 1GM5A 1ZJNA 2JZ0A 3DLLA 1KFTA 1UE7A 1IM2A 2UVVA 1YBYA 3ETLA 3EZ5A 4I29A 4HYKA 4JI4Q 4GXKA 2HHQA 2HVHA 1AE2A 9ICXA 3TQYA 3EW9A 7ICUA 1WIVA 2GVBA 4DAMA 1HQYE 2GVAA 2Y0SG 1VQ9A 3U4ZA 4DUYL 3T1HQ 1YJ9A 2N78A 4LF5L 1Q12A 5KFDA 5KFKA 2XCPA 3D31A 2KHIA 4KLLA 4F2SA 4LFBQ 4ELTA 5DBCA 5IIMA 7ICSA 2WZJA 4XIGS 4DSKA 1T4GA 3RB3A 4EYHB 8ICUA 4PGYA 4O3PA 2W9CB 3LDAA 3F1ZA 2WB1G 5IYBG 4AH6A 1BVSA 4DF4A 1NKCA 4DR3Q 4Y52H 4JUZA 1C7YA 5DB7A 3G4SA 1HNWQ 2V9WA 4QQBX 1BBWA 1QSLA 5CWRA 1Z47A 3TQ1A 4R4OA 2BQUA 9ICBA 3KYHC 2I5HA 3PF4A 2OOAA 3LCUA 4QWDA 3M9NB 1P3QQ 3RJFA 3I4NG 1SKWA 9ICQA 4RQ8A 4BGDA 1PH3A 3PW4A 1WCMH 1X54A 4DR7L 1TAQA 5IYDH 4EZ6A 5DG9A 3Q8SB 2W8LA 2C22A 4X5VA 2BDPA 1E3PA 1LB2B 4YWKA 1AH9A 1R4GA 3RH6A 1QLNA 5J2HA 4A3MH 4A3JH 2OTJA 9ICSA 4DV2L 1KFDA 4QWCA 4DL7A 4APVA 1EFWA 4B3TL 2E5LQ 1L0WA 3G6EA 4TQUS 4Z6FA 4P2HA 1B8AA 2NZOA 5KFLA 5KFSA 4QL5A 3CMAA 3GDXA 9ICKA 1KHIA 4DKAC 1T9HA 3RTVA 1PH5A 1E24A 2E8GA 4X6AH 1NKBA 5JJLA 7ICHA 1DOQA 5J2DA 4DSLA 1EFUB 2UXCQ 4GNXC 4PGXA 2DAEA 1VEJA 3CCLA 2YTVA 3PUYA 3LCVB 1L3VA 3RB6A 5EWGA 2NRXA 4JYAQ 5KT6A 4YCVA 2EQSA 2PI2A 1TR8A 5J0SA 2XY7A 8ICXA 2Z0SA 2JUJA 4X66L 4LW1A 3RJHA 1ZQCA 4ELUA 4DR5Q 4DNIA 4A3BG 5L9XA 2JA8H 4RZRA 4B3RL 4JBMA 1L1OC 2IA6A 1N9WA 3NBHB 2QA4A 3Q8RB 5CB1A 2R7DA 2F3IA 3HOXG 4A93G 3H40A 4PPXA 4J9PA 4NXMQ 4EEYA 2JQOA 1N36Q 1N32L 2QNJA 2KFNA 1WFQA 1K1QA 4DL3A 4UAYA 1UFZA 4R66A 9ICGA 9ICHA 5DB6A 2ZM6Q 5J0RA 4R65A 2B63H 4DL2A 2NVQH 1JMCA 5DQIA 4YWMA 2VUMH 1UT8A 3JPPA 1L3TA 3ERSX 4JV1A 1YHQA 2IY5B 4JI2L 3L7ZC 1B22A 4F2RA 2NN6G 3ZDEA 5ELOA 4OO1G 3F2BA 4M47A 4DV4L 3JPQA 3TRZA 2KHJA 3UDXA 3GTOH 2UUCQ 2R93H 4XA5A 4R1JA 4A3FG 4GNXB 3RLNA 3UPQA 3H8SA 1HNXL 2XY6A 3BJUA 4GKJQ 4KMUA 3JPOA 4LFAQ 3HP6A 2R8HA 4JWNA 4QZHA 5HP4A 2CFMA 3MR3A 2DNAA 1QSSA 3H8WA 5GAGC 1Q81C 3PNCA 3HPOA 1BGXT 4F92B 2BGWA 4JI0L 3H4DA 1YI2A 3CPFA 2R6GA 1N33Q 3F92A 5LMNL 1JT8A 3PUZA 2RDJA 4F1IA 3U4VA 1XWLA 3PW5A 3THVA 3OJSA 8ICYA 5AJ3L 4DV5L 7ICRA 1IBKL 1IBLL 3JPSA 3ISBA 1RZTA 4M9NA 4OXPA 2MROB 4Z6DA 4X62Q 2B21A 2N3SA 1TWCH 4LWCA 3V7KA 1NMFA 3LWLA 4ECTA 1UE1A 1ZQNA 3S2HH 4DSFA 4A76A 3B0XA 1K0RA 3AFQA 1XNQQ 1L3SA 3BQ2A 1A77A 2A1JB 3V7JA 1A0IA 4MTNA 4ED6A 1ZMUA 4KHPL 3J7A5 4ME3A 4ED7A 4RT3A 4GLAC 3EPGA 2ASLA 1XS9D 1HZ9A 1MJEA 3MGIA 1SFOH 1DV0A 1N48A 4C8MA 5KFEA 5IINA 4Y7NH 3GV5B 3SZ2A 1JB7A 3T3FA 3GLFE 3C2KA 9ICUA 4GXIA 8ICWA 2JEIA 3STBC 2RF4A 1ZQYA 4O5EA 2PFOA 3Q8QB 4A3JG 1D9DA 1Z00A 3HX0A 4JI5Q 1XSLA 4DSJA 4A3DH 2DUDA 4B9NA 3BU2A 4JC0A 1KL9A 1DO0A 2ZJPA 3UDGA 4BXXH 4IOCA 2NRWA 4HIDA 4GOPB 2IX1A 4LUOA 4KN4A 4KLTA 4JV0A 3KFUA 1YJNA 4LF8L 4O3OA 1R9TH 4CCHA 1MIUA 2UXBL 4DO9A 3J7ZC 4HJ7A 4OWWB 4F5NA 5IWAQ 2C35B 1U49A 1QZEA 5FJ8G 1YLAA 1S76D 2UU9Q 4Q8FA 1XMOQ 2DAGA 2PFPA 1UE6A 2YU9H 4PZ8A 1UT5A 3J81j 5KFTA 4DR6Q 2NZHA 1X56A 2HHHQ 2PMZE 4I2GA 1Z9FA 1JXLA 4JOIA 3PF5A 1WR1B 1Q1EA 3NENA 1S97A 2OCEA 1K3RA 3C1ZA 1SL1A 4LF5Q 4YR3A 3RR5A 4EX5A 3A5ZB 4J15A 2ZUBA 4LFBL 1MN3A 4BBSH 2KNVA 2AWNA 1PYSB 2KBNA 2JY6B 1NK9A 2AGOA 4WJ3M 4DQIA 5L1KA 2JJQA 3PIPA 5IP7H 3S24A 1G41A 2K4KA 8ICGA 4YFKA 4TURA 3EN2A 2AMCB 1QTMA 2JA6G 3T5JA 2JY7A 2JEGA 1QVGA 4QGUA 4I2AA 2MGWA 4B9VA 3NGDA 4R63A 4F4WA 2YTYA 1FVIA 3FDSA 4PG3A 1H38A 1ZQFA 3G6VA 1EIYB 5KT2A 2W9BA 1VQFA 1X3EA 1CKOA 3RAQA 1ZQWA 1KSPA 3UXPA 3V72A 1S77D 3GTJH 4DQRA 1VS0A 8ICJA 4DR7Q 1BBUA 2LTUA 2QHOB 1S9FA 2LBCA 4A3CG 4B9SA 1PH9A 3I4NH 1KYIA 1VQHA 2ZUCA 5KFFA 3PX0A 5DQGA 4DV2Q 1ZQMA 2FMPA 2D0OA 1WYDA 4IQUA 2MUTB 5J0OA 2E5LL 5JEAJ 4MFAA 2KCMA 3M8RA 1V43A 3TAQA 2R7FA 1W2BA 1G51A 3IM1A 1LYLA 4IQWA 3OYYA 3W1GA 2ATWA 4XQ8A 2AGQA 9ICJA 2PI2E 3GIJA 3RR7A 8ICRA 1RL2A 1ZJMA 2UXCL 3W5OA 5DLGA 3UE1A 1OTRA 7ICKA 1NY4A 1U45A 3PUXA 1JJGA 3AQQA 4RUAA 4ED3A 7ICQA 4R4QA 4GEWA 5M3FG 5FLMH 4GOPC 3CCRA 3TFRA 1BPDA 2BA0A 5GAHC 3BDPA 4BXOA 4PGQA 4TUPA 2V1CC 2VQFL 4DR5L 5KFHA 1I50H 4Z6EA 2UVRA 4B3RQ 5CR0A 4Q43A 1X55A 1ASYA 1CEZA 3OHBA 3GLGE 2LVOC 1OXTA 1KQSA 9ICIA 1QUQB 1JN3A 1G291 5KFXA 3M9OB 3FKIH 4M6WA 2NVTH 4QZ9A 4NXML 2JA6H 4DS5A 1PH1A 3B89A 5M3MG 2W8KA 1N36L 1N32Q 2MFIA 2BA1A 1ZQOA 4M0AA 2ZM6L 4R64A 3GLIE 4YXJA 3T5LA 3FKIG 3KHGA 4A3EH 4LF9L 5J2AA 2Q0ZX 2DI0A 4F3OA 3JPNA 2QGQA 3M4QA 1ZQIA 2K14A 2HAKA 4YD2A 4GN5A 5KFOA 4NXZA 1MKHA 5F9NA 4C8OA 3IHPA 4J9QA 5HHHA 3GTQH 2VUMG 2UUCL 3GTPH 5IP9H 5J0QA 4PHDA 9ICPA 1X9WA 1HNXQ 2KTQA 4DLEA 2G3QA 1MJCA 3BBZA 3Q8KA 1Q46A 2R92G 1J6QA 4LFAL 3S17H 2MAXA 2JA5G 2ZTCA 1RXWA 1EQQA 1NTGA 3UE0A 1C0AA 5M5YH 2PI5A 4O3QA 3FE3A 1Q1BA 4DV0Q 5KG1A 2PXIA 1SR3A 3JPTA 5EWFA 2WTFA 1OQYA 2KNAA 3EWAA 4BA1I 2BPFA 4KLMA 2DPIA 5LMNQ 2JEBI 1N33L 1PHJA 2JA7G 8ICAA 1V1QA 3RN2A 3RJIA 2FPLA 3NELA 5CJ7A 4FBTA 5AJ3Q 4DV5Q 1VQ4A 1H95A 1PZNA 2XTIA 2FXQA 1IBLQ 4ELVA 5J0UA 2N8NA 4UB5A 2HHUA 4YD1A 3FYHA 1HUZA 7ICPA 1AE3A 4X62L 5J2BA 4LUVA 2L4FA 5EOZA 2DFLA 3AU2A 1VQ5A 3CCSA 2PQAB 3MR2A 1XNQL 4PHPA 1V9PA 4P4OA 4JI6L 2B3TA 2UUBL 4A3IH 1G6PA 1PA6A 3C5GA 4K0KQ 2W9BB 5KFJA 4GS3A 2DPJA 1I5FA 5HMMA 2DAMA 2EKFA 5IILA 2D0PA 4BWJA 2LXJA 1Y14B 3E0EA 2BHNA 3F8TA 2A19A 3GDEA 2IBKA 9ICRA 4K4IA 2ES2A 3UXNA 2OQKA 2IT1A 1KDHA 5J0YA 3PV0A 4J9SA 4DUZL 3HFZB 4EBCA 4JI8Q 7ICTA 1TWGH 1VQDA 1KRSA 4F8RA 1I6HH 4F5QA 2GN5A 1TK0A 3PVXA 2VY3A 2L4EA 2VNUD 1A63A 4ECRA 5DQHA 1T3NA 1JIHA 4LZDA 3EPIA 5JUMA 4F5RA 5KFVA 3T1YL 1IYJB 3M8SA 4A3MG 3GTLH 4RPZA 4B9MA 2Z6KA 2J6SA 4C8LA 3BQ1A 1TV9A 3RJJA 1TAUA 1QZHA 3ISDA 2BCSA 4LVSA 5EWEA 2CQOA 9ICLA 2BQRA 4LF8Q 2L2DA 3T6PA 2MQHA 3M7NA 2P6UA 5FLXc 1K73C 5KFCA 3ZJYC 2UXBQ 4UPAA 2LVNC 2WP8J 2RDIA 2JZBA 4ECSA 8ICZA 1SMXA 4HJ5A 3VDYA 2OOBA 3K7AH 1WI5A 5DG8A 4L5SA 2I1QA 3GTKH 1FL0A 3PMLA 3I4MG 4HIKA 2DKLA 3UDFA 3S1MH 3FHWA 1VDLA 4GLVB 1IBMQ 4M9GA 3UXOA 4DEZA 4DR6L 3TI0A 3Q8LA 3RBEA 3RJKA 2HHHL 4MF2A 1UWVA 3AFPA 5HY6A 2K5VA 3RB0A 4GC7A 1ZQRA 5KFIA 3S1NH 3H7IA 2NRTA 4ED1A 4UY8C 3PUVA 1TWAH 4YHHL 1TXYA 3M3YH 3DM3A 1N34Q 1S0NA 2UUAQ 4OWTB 2K5HA 5KT5A 2MR9A 1OAIA 3STBD 4RQ4A 4QJFA 4B3ML 1ZYQA 1G3IA 4A93H 4I2BA 3JPRA 4YVZA 3Q8MA 4LUZA 2KN7A 1UA0A 1IXRA 2LVPC 3A0JA 1ZQAA 1PH4A 3M4OH 8ICQA 1Y1WG 5IIJA 2F4VL 4O0AA 4IRKA 2C2EA 5KFGA 4A3KG 5IP7G 3M9MB 2Z6KC 2ZJ5A 5C44H 4JV5Q 1COOA 3BZKA 4OONA 5KG2A 1S10A 1QVCA 4NM2A 1JJCB 3KHRA 1FGUA 4MNOA 3PW0A 1PH7A 2C2DA 1E22A 1HT1E 4O3SA 1TWFH 3ICEA 2KZ3A 4NLZA 5KG5A 4RNOA 1Q8KA 2ZTEA 7ICEA 4BY7H 2IMWP 7ICGA 5IYCG 3ZDBA 3H4JA 4YMNA 3HOUH 1WCLA 1WJ7A 2O25A 3HW8A 1I94L 4QWAA 2XC9A 1SKSA 2W9CA 1KRPA 1OXVA 1SKRA 2UVWA 3GV7B 4L5TA 4RQ3A 5DBBA 2FLNA 4QIWE 1VQOA 1WJJA 4DOAA 2KENA 8ICKA 2NVXH 4J9KA 4KLKA 3PX4A 5J2JA 1UE5A 9ICTA 4DV1Q 5D49A 3J80c 1NJYA 4EBEA 1U5KA 3E9HA 1DGSA 1SN8A 4UB3A 5KFNA 4FO6A 2K52A 3KJOA 1Q7YC 4DV6Q 4JV2A 8ICBA 4UP8A 3BQ0A 3Q8PB 3KJPA 1L1OA 1VEGA 2BCQA 4E0DA 4P4MA 4HIMA 3G71A 4OX9Q 1T6OA 2BKEA 4QWBA 2VQFQ 4ECZA 5JJIA 4LNQA 3RH5A 4KLDA 1LUZA 1KRTA 3U58A 4Q7JA 3IHQB 5KT7A 1B7YB 1CSQA 2A1AA 2Q2IA 3KLWA 2BWBA 4MEXA 5JEAG 1OXXK 2OO9A 1YJWA 2AQ4A 1Q86C 3J80i 5DLFA 3TEHB 4A3EG 4UAWA 7ICOA 5BR8L 3H4BA 1OXUA 3K4GA 4R4TA 2HQLA 1EYGA 4TUSA 4DFPA 3C23A 4P71A 4DR2L 4DV3Q 2JK8A 4I27A 5EAYA 5J0XA 5HNKA 1L3UA 3G6XA 1NJWA 2M9NA 4NLGA 4LF9Q 1SZPA 4BXOB 4P74A 2CWPA 1X6OA 5KFYA 4IPDA 2R0IA 8ICVA 3D0FA 5HMLA 5C0XG 2EXDA 3PR4A 1L5UA 4I2HA 5DDMA 4IJLA 2HHWA 3CCEA 4QZCA 3RH4A 4RMFA 2Y1IA 3ZDAA 1E1OA 4GN4B 4YCXA 2KFZA 4GC6A 3QZ8A 2IHNA 2JA7H 1P16A 1VQAA 8ICSA 3AYHB 4GLXA 4YG2A 5K36G 1D8YA 1ZMVA 3LGJA 4GN3B 4F93B 4DV0L 3CXCA 3J81i 7ICIA 2BR0A 4O3NA 1A62A 2HT1A 3SV3A 2R92H 2R8KA 2ALYB 4M6WB 2H5XA 4ECUA 3OGUA 8ICIA 1LM0A 1HR0L 5J2GA 5KG7A 1KTQA 4J9MA 4IQVA 8ICTA 3TAPA 3GIKA 3W1BA 1VQIA 4O5KA 3I2ZA 1VQLA 2KZMA 5J0TA 3MMPA 3KF6B 3GO5A 4JI7L 4DSEA 4RQ0A 4I2CA 4NXNL 2YV5A 2NRVA 4JI6Q 2JA9A 1GVPA 2F1IA 4HIOA 2UUBQ 3K9PA 4O5CA 4RG1A 4K0KL 4B3SL 1LV5A 2ID0A 3ZDDA 1CKNA 2R8GA 2CWAA 1ZMWA 4DFJA 2A1JA 2V4QA 3MDCA 4A3KH 4LF6L 3IECA 3K81C 4GKKL 4MFFA 4RU9A 2CWBA 3K80C 4DS4A 1VCIA 1JMSA 2YYZA 4DUZQ 1X9SA 4GOPA 1XPOA 1K9MC 3BZCA 4QY7A 3CQZH 4JI8L 1L1OB 3ORYA 2VW9A 2HHXA 4F4XA 3RJEA 5DB8A 3CCVA 5F9LA 1U48A 2BPCA 2NRZA 3BQTA 1S0OA 1WGNA 1WOCA 1ZQSA 3HOZG 4EZ9A 3T1YQ 4BA2I 2FLPA 2A8VA 4I2IA 4RNMA 2HHTA 5C5JA 1LTLA 5D4BA 5JI2E 4C3HH 3B6YA 1QSYA 8ICHA 3CP0A 5IE8A 2OWOA 3KHHA 3HOZH 3SGIA 1ZQPA 4IR9A 4IPGA 5DGBA 5KFPA 4JBWA 4L5RC 1OKSA 1KD1C 4YXMA 4Z6CA 1U9LA 3UDIA 2EJSA 1DO2A 3C21A 1Y1VH 2DGYA 1OXSC 3KOJA 3QZ7A 2K0BX 1TK8A 4POFA 4OWXB 3FRIA 1X3FA 3HOVG 3RR8A 1UEBA 4QZGA 3EYZA 1HH2P 2LXKA 3TS0A 2FLLA 3HOXH 2JEAI 1JJ2A 3KTQA 2K5NA 1IBML 2JEFA 4YQWA 1ZQZA 5DGAA 1ASZA 5C0XJ 4LF7Q 1N8RC 1K8AC 2JA8G 2RHSB 2ISPA 4YHHQ 5LMUL 5J2IA 4PMWA 3CCJA 1N34L 2Q2UA 2UUAL 4L5QA 1TK5A 1ZQHA 1TVAA 4DK3C 1A8VA 2CCZA 1VQEA 5KT3A 3A74A 4B3MQ 2R93G 2XY5A 4F50A 1VQ1A 2WFWA 4FDBA 1PH8A 2W9MA 2B3GA 3S16H 1HNZL 4JV5L 3RZDH 2K75A 3N4MB 1HZAA 4ECVA 2HIVA 2F4VQ 3TREA 1SROA 2XO7A 3S1RH 1AROP 3CC7A 7ICLA 5LMNW 1XB2B 4JBJA 1JXEA 5H1SE 4BBRG 3H15A 4NPSA 1NV8A 1EOVA 3KDFA 1SLJA 5KTQA 3V6KA 3GQCA 5BPCA 3NTUA 4UBCA 3FRHA 3SI8A 2LYHA 1Y8GA 4LFCL 5IIIA 4A4IA 3GTMH 2LVQD 2KCTA 9ICMA 1B43A 1RPLA 1MQ2A 3I4MH 2FPMA 4PH5A 3SV4A 1ZETA 1CSPA 1HZCA 2VA2A 1BPEA 3ULLA 4M04A 3ZDCA 4ALPA 4DR1Q 1CUKA 1GKHA 2ZJAA 4F4YA 2JP7A 1I94Q 3GD7A 1SG9A 3CCUA 1IM4A 3M9BA 3GTGH 4C2MH 2ASJA 2VZAA 4H02A 4HJ9A 1SL2A 4O2DA 2DENA 1XNRL 2VL6A 1KIXA 4ECXA 3SYZA 4DV1L 1HR0W 2NVYH 2HW3A 4KLHA 1KAWA 3PR5B 8ICPA 2FMSA 5IY0A 3PO4A 4O3RA 2WB1E 3Q8DA 5KFRA 4IPCA 1F4IA 1BPYA 3S15H 5GROA 1I3QH 5KFUA 5GADC 4RT2A 5IYBH 4HJAA 1JE5A 4DV6L 3H3VI 2BWEA 4KLFA 2I0QA 1NMGA 5KG3A 4JWMA 3CF5A 4X64L 4ECYA 4DSIA 4OX9L 4A3IG 2LVAA 1AIPC 3HOWG 4A3FH 1XSNA 1EIFA 2VQEQ 3ULPA 4UN2B 3OW2A 2F1JA 3OJUA 1YITA 1CKNB 3C5FA 2ZTDA 4J9RA 4Q45A 4JCVE 3RN5A 1GO3E 1X65A 4JI3L 3S14H 5KFWA 5IYDG 2XGTA 1A5TA 4F4KA 3CPWA 4YR2A 3AUOA 1VQ6A 2XGQA 1JR3E 5BR8Q 5JJKA 1TKDA 1QVFA 4DR2Q 3H3VH 4DV3L 3GLHE 4DOCA 4EBDA 7ICNA 4IPHA 4ED0A 3EBEA 3MBYA 5KFZA 5C44G 3RAXA 1BKBA 2P66A 3OTOL 4NB3A 2BCUA 4TQRA 4I2JA 3RZOH 3FP9A 1ZQUA 1ZQEA 3PO2G 2JA5H 1BPZA 1S3OA 4QW9A 4XRHA 4DL4A 4DF8A 1YIJA 2DAIA 3T5HA 4AQYQ 4M2YA 4YY3L 2I9GA 2JZ1A 3TFSA 2OTLA 3ISCA 3CC2A 2C28A 4ZH4A 4DQPA 1D8LA 1NBWA 2C2RA 3LWMA 2HVIA 5KG6A 1NOMA 4DR4Q 3F2CA 4YP3A 4A3LG 1ZQTA 3C1YA 4O0IA 1U47A 4RUCA 4C8KA 1Q02A 4YMOA 1FJGQ 1Y88A 1HR0Q 2ZJRA 4KHZA 4A75A 4P4PA 4JG2A 2EKKA 4ED8A 1U4BA 4A3LH 4YR0A 2PFQA 3MDAA 1XXHE 2DHYA 4JK1A 9ICWA 1X9MA 4JI7Q 3PW2A 1Q82C 1PFSA 1VQKA 4NXNQ 3ULJA 3PUWA 4A3GH 4C8NA 3HOYH 4B3SQ 3A5UA 2Y1JA 4QZFA 4YWLA 3HOUG 3PO3G 4RQ7A 1YVCA 2KZZA 2MJ5B 1VG5A 4LF6Q 1GO5A 1JX4A 4GKKQ 4C3JH 1YNXA 4KLGA 2ISOA 3HOYG 3OSPA 2K9DA 1PH6A 4PHEA 2KNZA 3F2DA 4I2EA 1J5EL 4NY8A 3C2MA 1NK5A 4JBKA 1NE3A 5KFAA 2LSSA 5KFQA 3CD6A 1VQNA 4EYIB 1WCNA 3WWVA 2E2IH 1XSPA 1K83H 1HJPA 3E9IA 4RQ6A 4DV7Q 2CP8A 7ICJA 2VS1A 1KXLA 8ICFA 1KC8C 4LF4L 2VA3A 5KG4A 1YHBA 4A3CH 1PGYA 4UB4A 2J6TA 1U0LA 1PH2A 3I7FA 4R8UB 4MZ9A 4KTQA 3PCOB 1SRUA 1MQ3A 5J0PA 5KG0A 5FLMG 3AEVA 4NM1A 1YEZA 5IP9G 2CKZB 2HHSA 5KFMA 3J81c 5GAEC 4F5PA 7ICVA 1S0VA 5C4XG 1NK0A 2RHQB 3QE9Y 3ER0A 4IQTA 3MFHA 1RXVA 4A3BH 4BDPA 1ZQXA 4X65Q 1QUQA 4UQGA 3RB4A 4O9MA 1PV4A 1TTEA 1HZBA 1IXSA 3RBDA 1T7PA 2RCNA 4IOAA 2QSFX 3JAMc 4DBGB 4P72A 5IIKA 4ED2A 3T5KA 2ATLA 2GWSA 4MFCA 1VQMA 3MGHA 3KF8B 2BCVA 1NKEA 2FMQA 2UVUA 1D9FA 3ZD8A 4LF7L 5DFLA 2B63G 1XTDA 4IFDI 1C9OA 2BH8A 3L2PA 1TFRA 3V6JA 2OQ0A 3K7UC 4DFKA 4ECQA 5LMUQ 3JAMi 4P73A 4IJHA 5J2EA 4QZAA 4JI1L 5KFBA 4F2LA 2R7ZG 2ASDA 3K9OA 4QW8A 8ICOA 1VQGA 4YMMA 4OO1I 4F91B 1X2IA 3HKSA 1XMQL 1SL0A 5M3MH 1HNZQ 1WHCA 3B0YA 2F52A
chains in the Genus database with same CATH superfamily
4BJQA 2I5LX 5TSSA 4PHAA 2J7NA 1GJSA 3A54A 4P17A 5DLQE 4KO8A 1MBYA 5J2FA 3T56B 3CCMA 4GXJA 3DDHA 5CHGA 5EXPA 5CP2A 5BOMA 4Q44A 1QAMA 2KHHA 4KHPM 1JUDA 1NJZA 5IIOA 2JE6I 3R2TA 1H9SB 1ZQKA 1XU4A 2A6HC 3OMGA 3MEFA 4QNMA 1OFIA 4I2DA 2DAKA 1XC9A 2RKSA 4DNRB 4LZGA 3SAFA 4RQ1A 2KIVA 3PMNA 3BG3A 5IYCH 3JC66 2UXDQ 4KLIA 3D6CA 2V4RA 4TSSA 1XPUA 2VA8A 4PZ7A 2L12A 5JVG3 4B6JA 2OYYA 3I56A 2EOTA 3UQ2A 5G3LD 1I6VC 3I55A 3W68A 3SYLA 4JI4L 4KN7A 1Z1BA 3JR5A 5J2KA 5M5WH 3BS5A 4CGZA 2A5YB 5CRXA 4YCWA 1K8OA 1TDZA 2F1HA 2DWLA 3RLFA 2RRUA 5D46A 1IZ6A 3L28A 1EUJA 4YY3M 4OCZA 4EQPA 2AKWB 4G3IA 2CUZA 3RRGA 4LFCQ 1XNSA 2KCCA 1EXNA 4EX7A 3KDSE 5KYIA 4JI3M 5DKWA 4LY6A 5BR8M 5ELNA 4C4RA 4DUYQ 5FP0A 5TZVA 1WGLA 2DKZA 4BY1G 3T1HL 4G4NA 1L1ZA 2PZTA 2FI1A 5L1LA 2LS01 4G3OA 4DPGA 1UA1A 4TQSA 5IOCA 4QZDA 4QZIA 3NK9A 5KPZA 2JA2A 3E2EA 1RKNA 4DR1L 4BY7B 4FS2A 4HMIA 3GLHB 4RQ5A 3UQ0A 1E2VA 5FLXL 5IGBA 1DONA 2PI4A 1PFMA 5LMNM 2MUTA 3P75A 4RHRA 5AM5A 4YCUA 3O0FA 1MN8A 3VK8A 1L2FA 1LTID 5M5WB 2F8KA 3PW7A 4LGMA 2EIFA 5I9PA 2B2VC 5LMUM 3NS1A 2J7ZA 3KLSX 1HRJA 1VQ8A 2F52A 2KJ8A 5KAFU 1V38A 1CI3M 3H0GG 4CDEC 5AM4A 1SDFA 4DR3L 5JI3E 5HGQA 5HHIA 1YNNC 1V92A 2UUBM 3NE5B 2QQ8A 2KOLA 4AYBE 1NNUC 1X66A 1XNRQ 2B2TC 3VYSA 1L0YB 3QJYA 2R92B 1O7LA 4NXNM 1NVMA 3LQQA 1ZQDA 1VQBA 2NN6I 2HIXA 3NEMA 4AYBG 5E4WC 4CDDC 3L0OA 3HOVH 2LPEA 4BBSG 4J9OA 1MSGA 2OEHA 3U6SA 4ZYSA 4FE3A 4FO2A 2KVSA 4K4GA 1KW4A 4C7ZA 4X66M 1S4ZA 2KW0A 3E9SA 3H0GH 1U4RA 1R7RA 5JPMC 3K2LA 3U61B 4R71A 4R8UA 4UAZA 3S1QH 2YMQA 2UUCM 1IFYA 3H0LB 3GPXA 4RPYA 2IHEA 2AU0A 3J80S 5CGKA 3KHLA 3B9PA 4KN4C 2RHFA 1YHAA 4UB2A 3SAWA 4L15A 1XWIA 3GV3A 2MO1A 3QEAZ 1K1SA 3X3NA 3WOEA 4R4IA 4ICAA 4GH9A 3OMCA 3SHLA 4X64Q 1B9MA 1ILQA 2Y0SF 2PQAA 1RTNA 5C3WA 3K57A 1N5XA 3MFYA 4MEYA 1BUVT 4J9LA 4KLJA 2H3FA 4TKOB 4IFDJ 3D6JA 4A3GG 2SOBA 2VQEL 3MWYW 1G2TA 3QU5A 5AICA 2WF5A 4B9UA 1P8LA 4TUWA 1ZQVA 2HCFA 2K32A 4IFDG 2BJWA 5DG7A 5J0WA 5E7NA 4GZYC 2Z9HA 3AOGA 2R62A 1LTMA 3MA2B 1WCMG 3IRBA 4QIWC 4B3TQ 3OSNA 3LVWA 4L78A 3GLGA 2K6AA 4IRCA 4DQQA 4N9PA 1LTBD 2A73B 4JI3Q 2LM4A 2JSOA 3DA1A 1Z00B 4JW0A 1I6HB 4RQ2A 1PVOA 1QANA 4IZ8A 3ILKA 1ZYRC 2MA1A 1G71A 5EXTA 4RPXA 4DFMA 2L55A 4M9HA 3G7LA 4UP9A 3TADA 3PNYA 2I46A 4RNNA 3GV8B 1W6JA 4LF7M 2B2WC 3PX6A 4DR2L 1Y1WH 3TARA 2IX0A 3HOZB 1RIPA 2JZBB 4II7A 3CC4A 5DDYA 1BPXA 2ZJQA 3CQZB 3KVWA 4LFBM 3QX7A 3GIIA 2ZAOA 1NJXA 1EQTA 4F5OA 3H6MA 5C3XA 1HT2E 1F2LA 4I2FA 4IRDA 4L6TB 3RLOA 3U50C 4BBRH 1VJ5A 2X4AA 2Q2TA 5FJ8H 2NQ8C 4KLOA 1J09A 4UBBA 3SE0A 2KICA 3OTOQ 2F4VM 1HNXM 3SATA 1XO0A 5GQOA 4G7OC 4JYAL 1X3GA 2K8BB 4ZRZA 4Z9CB 1HNZM 3PZPA 5AKJA 2QENA 5EJCA 2WSCF 3KD3A 2OT2A 1GUNA 2ZIUB 5C4JH 2AHMA 3Q24A 2KSOA 5ALHA 3LWUA 4KI0A 4X66Q 1JQYD 2EAMA 2RGOA 3A8JE 3K59A 1M90C 1MSWD 3BOSA 3M6KA 4P75A 4NC6A 4AQYL 3MVVA 3HP3A 3GPUA 2CV1A 4QWEA 4DWIA 5JVH3 4BY1H 1HXYD 4BY7G 4DLGA 3U6MA 1QG7A 4DQSA 1ZD5A 1XXHB 3GFKB 5JU5A 3RF9A 4YY3Q 5FTLA 2AQ0A 4J9NA 1LT5D 2K33A 2CHQA 2Z8YM 4K4HA 2ZIXA 4NV0A 2FMCA 4RCOA 3PIOA 1W3SA 3VDPA 4B9TA 4BBSB 4JOIC 4DOBA 1EZ6A 3E46A 1YZ6A 3HKZE 4YHHM 1KEJA 4FBUA 2OF1A 4KD3A 4PV1C 5D3DA 5L1JA 1H9JA 4A93H 1BPBA 1J5EM 2W82A 4JMUA 4F4ZA 2R4EA 4UP7A 5C0XI 4K5WA 5EE3A 2K5WA 2MNAA 2Y0SC 1RG6A 4B9XA 2BDUA 4LJAA 1FFUA 5ALNA 1IG6A 2NBFA 2JA7B 2NVTB 2QB1A 8ICNA 2E2HH 3QUBA 4M9LA 3D8LA 1VQPA 5EKKA 1KN5A 1VEKA 5BOLA 2AWOA 1XJVA 2GQFA 4FVMA 3MR6A 2AGPA 1M1KC 4DR4L 1A76A 4UB1A 2ALZA 3U6EA 3SDZA 1KFSA 9ICFA 1TGUA 5AM2A 4IR1A 3OHAA 4FZLA 3UJNA 1VQ7A 3M85A 1XPRA 1ZQJA 2E2JH 3S1QB 2XSZA 2X6LA 4K2LA 1FJGL 4S12A 2YFQA 1GD7A 2AQ3B 5DBAA 1P7DA 4TVAB 1CQVA 4DAPA 1IQPA 1URJA 2JEJA 3SK8A 1OIZA 3QB3A 4NLNA 3E21A 1EY4A 3S16B 9ICEA 3D4DA 1T43A 4GNXA 4DAYB 1J2NA 4G7ZC 5DB9A 2EYFA 1R9TB 1IL2A 5ALUA 2IHFA 2VANA 1QZGA 2W54A 1O7IA 1Z19A 1HPCA 2QKIC 3ETRA 3C2LA 5FSWA 1V1PA 5CORA 4JI2Q 5IT9E 1S40A 4A3DG 2I5MX 2CQAA 1D1KA 3K75D 1X9NA 5KT4A 1N56A 4LJ4A 3KDFB 4IUQA 5C5LA 4DK6C 1OTCA 2R7ZH 4DV4Q 2HOIA 4BXXG 1TWHH 2DY7A 2YR0A 5J2CA 8ICLA 2WAQE 2LMCB 4XGIA 1NJIC 3HOWH 1KDCA 3PSIA 3CNHA 3MFIA 4QZEA 3BVZA 5ALOA 3EROA 4RNAA 1JB3A 3VR3A 5F2DA 1TT2A 4GKJL 3V76A 1DGHB 3HHYA 2BH2A 4U6PA 3K1ZA 2KDLA 2F4IA 3MABA 1FIQA 2DF4B 3CKIB 5IGEA 2RRDA 1HUOA 3ZCBB 2ENBA 3GIMA 3CMEA 5ALRA 2F44A 4PZ6A 3PGZA 4CJ6A 3VKHA 4AIMA 4FS1A 1PDQA 1D8BA 2WKDA 3NPPA 2Q2HA 1IYUA 4JI0Q 2PZUA 2W9AA 3AL0C 2HHVA 1TF0B 1ZQQA 3H8JA 2RDGA 2L5YA 3CW2C 3U5ZB 9ICVA 1E2WA 4A3KB 1ZV1A 1CQFA 1DCZA 1E1TA 3L25A 1EL0A 1EEFD 1Z3EB 1EZ8A 2MO0A 2NV3A 3G6YA 2QILA 4XT3B 4C3IG 3I73A 3EQLC 1D0LA 4Y2SA 3HJQA 7ICFA 3BJYA 4HEOA 1VDZA 2BDOA 3HWTA 3K0XA 2M00A 3ZD9A 1J5EQ 1E7ZA 1O7YA 1KLNA 3U5ZA 3HOUB 2FNAA 2JWSA 2R8IA 2W04A 3N97B 3GILA 4I7ZC 1E94E 1GUGA 3GTGB 1F2ZA 1KLGD 2J6UA 4IUTA 4C3HG 4Q5VA 3NVZA 4RWSC 3I76A 4DV7L 4POGA 2D62A 5L1IA 5CA7A 1IBKQ 1TKWB 4PDIA 4KLQA 1MI2A 1IYVA 1SAPA 1NI3A 2B29A 2XCAA 2DN8A 2BPGA 4DL5A 4HSPA 4K5XA 4LF4Q 3DEOA 4C3IH 1ZQBA 2N49A 2W55A 2Z4IA 3V6HA 3PY8A 2IOFA 4NLKA 3FPPA 1Y1VG 3CAMA 4TRDA 4IBCA 1N32M 2WAQG 2Y0SE 4MIUA 3RJGA 1VQCA 1JC7A 4NXMM 3KF6A 1TY2A 2PFNA 4FXGC 3I4MB 4CKCA 7ICMA 4KITB 2NO4A 1PVPA 3ICXA 2KK0A 2TMPA 2BNKA 5C3EH 1BOSA 3GQ4A 3H8MA 3QEBZ 5IT9S 3TPZA 9ICOA 1CKMA 1ICFB 2YTXA 1NK6A 8ICCA 2Q2EB 4IBGA 2HBKA 4C4TA 4I28A 2OPFA 4BWMA 2AJQA 2P6RA 4OELB 4EQ5A 5GTIU 4HEDA 3J7AS 5C4ZA 1N2XA 3EIVA 1K3XA 3AU6A 1NK7A 3G48A 5J3BA 4B9WA 4HJ8A 4CGYB 1IN6A 4NRVA 4W5WA 4KHPQ 2DKXA 4K2KA 1T5XD 3MC1A 4OX9M 3P1HA 5CYUA 4MN3A 4QZ8A 3M0EA 1A15A 4XTCS 4X64M 4X65L 4B9LA 2ZUDA 1SMYD 2CFOA 1SV0A 2JY5A 5AKIA 1NK8A 2K01A 2PNHA 9ICCA 2Q8TA 3N52A 5C3EG 3KP1E 5C1BA 2KKVA 1PYBA 3BVGA 4ULLA 3UMGA 9ICNA 2EXZA 5CMDA 4M9JA 3SYKA 2HWJA 1T8EA 1CRXA 4MF8A 9ICAA 5C4XH 2YMPA 5IT9c 1N75A 1RYSA 2I07B 1S72A 4ECWA 1F77A 4WJ4A 3V7LA 3S15B 4FZNA 2JNHA 2XLJA 3TS2A 1IY2A 1DGGA 4QNRA 1TS4A 4NKLA 5HGTA 2QEXA 3OPOA 4CHTB 5KGUA 1D7QA 1WXQA 4PDGA 2DZLA 1SV0C 2NTSA 2JY8A 3PV8A 3KLSA 2EYJA 3I4YA 3GLGB 2PW5A 2FPKA 3HKZG 3K8AA 2HBJA 4OHJA 3J7BA 4QZBA 2L15A 3QXGA 1YZ7A 2YY6A 1V85A 3QOJA 4KLUA 4DL6A 1V1OA 2IHMA 1XO1A 1UNSA 1HEKA 2WHEA 2ZJ8A 1YNND 5EP3A 5AM1A 3DEPA 1ZQLA 5M5XH 1MC8A 1MA7A 3E3XA 8ICMA 1SE8A 1EQRA 3HT3A 3WKBA 1ZQGA 2A68C 4JI5L 3GTMB 1FJGM 1G4AE 4XUSA 3RRHA 1S0MA 4KLSA 1ESFA 1EWIA 2M2LA 5IZ7D 1NK4A 4KLEA 3GTQB 1R6BX 1MJGM 2HUGA 2JA6B 1GUWA 2F8LA 3I4OA 3PO2H 3M4YA 2EJMA 4JI1Q 2BQ3A 3TN2A 4IURA 2K50A 5ALZA 3M4PA 2EDUA 1RYRA 8ICEA 2RLTA 1VQJA 3MXNB 4DV3M 5ALWA 3ZH9B 1NV9A 1Z59A 3EUB2 1XNQM 1XMQQ 4TUQA 4Q8EA 3VLFB 2L4NA 4A3EB 3PO5A 2W11A 5J29A 4FXDA 2AHOB 4LF8M 3C29A 1PRTC 3K5LA 1B1ZA 4IO9A 3LK9A 5DNYA 2BOSA 5IWAL 4YN4A 3I8ZA 3NVYA 2BCRA 2IPKD 3RNUA 5FLMG 1B70B 2FFKB 3RZDB 1BF4A 2XGPA 3HKZB 3TANA 2CPRA 2UU9L 1NSNS 4IUPA 1K8GA 1XMOL 4QHTA 4WP2A 2R8JA 4R4CA 3S1RB 3IDWA 1D1IA 3MR5A 2UXDL 1GM5A 1ZJNA 2JZ0A 1BO0A 5DM73 3DLLA 1KFTA 1UE7A 1IM2A 4I4LA 1D0KA 2UVVA 2LHTA 4Z8XA 1YBYA 2FINB 5BN4A 1CHPD 1FD7D 3VR4A 3TQSA 2HQEA 5ALDA 3ETLA 3EZ5A 4I29A 4HYKA 4JI4Q 4GXKA 2HHQA 1IN4A 5EE0A 5JTIA 2HVHA 1UHUA 1AE2A 5AI6A 3S17B 3PSFA 9ICXA 3TQYA 4K6DA 1H6UA 2Z8LA 3EW9A 7ICUA 1L2BA 1WIVA 1EY6A 2GVBA 4DAMA 1KNEA 1HQYE 4IJFA 5DYGA 2GVAA 2Y0SG 5E3FA 1VQ9A 3U4ZA 2AUJD 4DUYL 3T1HQ 1YJ9A 3PO3H 2PKEA 2KV2A 4DUZM 3UMCA 4MGKE 1PUZA 2N78A 3KBXA 4LF5L 1Q12A 4RCNA 4KMOB 5KFDA 5KFKA 2XCPA 3D31A 1H9RA 3GO8A 2VJ4A 3NUQA 4F2SA 4KLLA 4OJ6A 2KHIA 4LFBQ 4PMCA 3PFIA 4ELTA 2P5ZX 5I6YA 5DBCA 5IIMA 7ICSA 2WZJA 3BS5B 4DSKA 1T4GA 4GITA 1STGA 4OGQC 4XIGS 4A93B 3RB3A 4G4KA 2QKQA 4EYHB 8ICUA 4PGYA 4FF1A 4O3PA 3H3VI 1EYCA 1R2YA 1ZQ1C 2W9CB 3OTOM 2B6GA 2KEYA 1AZPA 3LDAA 3F1ZA 1LTSD 2LFNA 2GA4B 2WB1G 1LLRD 4AH6A 5IYBG 1BVSA 2AXTU 4DF4A 1NKCA 4F88A 2QDBA 1VMPA 2LXEA 4AYBF 4DR3Q 4C56C 4JUZA 3CHBD 1C7YA 3BS1A 2XVTA 2Q4TA 5DB7A 4C2MB 1OJLA 3FTDA 3G4SA 2R45A 4X62M 3U60B 1ESRA 4LZJA 3QAUA 2R6FA 3QWLA 4MM3B 1B4OA 2V9WA 5C4HA 3PNVA 2VF7A 2ZXPA 1AZQA 1HNWQ 4QQBX 3URYA 1BBWA 1E0BA 2G0AA 1QSLA 5CWRA 4MGHA 3HRZC 1YUBA 2JH1A 1Z47A 5AI5A 1IW7D 3TQ1A 5LL6S 4R4OA 4I65A 2BQUA 4QOZC 3HHZA 9ICBA 3K8ZA 1ZKOA 3KYHC 2I5HA 4H44C 1NZBA 4WRDA 2XEPA 3GLFA 5EQ0A 2OOAA 3H94A 3PF4A 3LCUA 1IN8A 4WJ3B 4QWDA 3M9NB 1TWFB 1P3QQ 4I5SA 3B9JA 3RJFA 3I4NG 3SASA 1SKWA 4GIPA 4RQ8A 9ICQA 4BGDA 4OIJA 3L27A 1PH3A 4RKUF 3PW4A 1WCMH 1X54A 2EZZA 2KQ3A 4DR7L 1TAQA 4BBAA 2XRQD 4PQXA 4GFJA 5IYDH 4EZ6A 5DG9A 3Q8SB 2W8LA 2C22A 3RMHA 4X5VA 2BDPA 1E3PA 1JR0D 2B39A 1LB2B 4YWKA 1AH9A 4OW0A 3HZXA 3WK6A 5EJWA 1R4GA 3RH6A 5FKAC 1EIJA 4PMBA 1QLNA 4KODA 4OVZB 1RYUA 2IOHA 5J2HA 3CTWB 3F5EA 1VMCA 1H9KA 3A42A 4RQMA 1UEAB 2N55A 1CFMA 3OHXC 4A3JH 4A3MH 4FF2A 4A3FB 2OTJA 9ICSA 2KP7A 4DV2L 3HOYB 2XZUA 1KFDA 4QWCA 4DL7A 2L6OA 1TE2A 3D2NA 4APVA 1AQ6A 4PL2A 1S5DD 1T5EA 1EFWA 4B3TL 3QUTA 3BS7A 2J7OA 3R93A 2XIWA 1KDBA 2E5LQ 1L0WA 3G6EA 3CRXA 1ILPA 4TQUS 2APLA 1GOZA 4Z6FA 2B8GA 4P2HA 1UPHA 1B8AA 1F2YA 4DGZA 2FE9A 2NZOA 5KFLA 2HDOA 5KFSA 4JI2M 4QL5A 3CMAA 3GDXA 5ITUA 9ICKA 1KHIA 2WB1C 2FS1A 4DKAC 3WKEA 1GHJA 3W2DA 1T9HA 4XQNA 2EAPA 3RTVA 1DOMA 5D65A 1PH5A 2YB4A 1XMQM 1E24A 2A69C 2E8GA 4E6IA 2KECA 3KBBA 1NKBA 7ICHA 1O7ZA 1PTOB 4X6AH 1ZEQX 4G57A 5JJLA 1DOQA 3C2PA 3A8KE 3J27B 2GOLA 3D2SA 1JOKA 2B2UC 5J2DA 1DK2A 4DSLA 1EFUB 3KP0E 5HR6A 3BYTB 5FLXE 1BBXC 4GNXC 2UXCQ 1WUDA 2GNOA 2DAEA 4PGXA 3DM1A 2E2IB 2Y9UA 1VEJA 3CCLA 2YTVA 3PUYA 5CBEE 3QOLA 1PVQA 3LCVB 1L3VA 1Q8IA 3RB6A 1JB0F 2ZIXB 2NRXA 5EWGA 4I7AA 5A2QE 4JYAQ 2PZWA 5KT6A 3QYPA 4YCVA 3I1YA 2EQSA 2PI2A 1A0PA 1A3TA 1TR8A 3NQTA 5J0SA 2XY7A 8ICXA 2Z0SA 2JUJA 4X66L 1S3SA 2RCFA 2C5CA 4LW1A 2NYZD 3RJHA 1ZQCA 1TWAB 4ELUA 1LT3D 4DR5Q 2QP9X 3MJ5A 4GMQA 3VFDA 3FC4A 4HL4A 3TDQA 2UU9M 1Q3LA 1NR2A 4AKIA 3EA6A 5AM3A 4ZQ3A 3K7AB 3U6LA 5EBCA 5L9XA 3T4AC 4DNIA 2JA8H 5B5EU 4A3BG 4RA8A 4RZRA 1DGJA 2OH2A 2XWBB 4B3RL 4MH0E 4AKGA 4JBMA 1VF5C 4ANRA 1L1OC 5AI4A 1W6KA 2Y9TA 3GLIB 4AZFA 3UK6A 3CYMA 2IA6A 1N9WA 3S1MB 4JI4M 2QBYB 4FF4A 2AUKA 1JICA 3VDUA 5TISU 3NWLA 4Y2QA 2ZAMA 1ORYB 1Q90A 3NBHB 4QF4A 3Q8RB 2K89A 4P16A 3T79A 5CB1A 2R7DA 3HG9A 3HKZC 2CW0D 4ABNA 2F3IA 3EJIA 5CV5A 2HBLA 3VYTA 3HOXG 2ASBA 2E8NA 4A93G 3H40A 4PPXA 1TR5A 4J9PA 5IGCA 4NXMQ 4EEYA 2JQOA 1G2SA 2D5DA 2B2YA 2F0QA 1IN7A 1DRGA 1N36Q 1N32L 2QNJA 2KFNA 1WFQA 4CBVA 1K1QA 3GPYA 4UAYA 1UFZA 4R66A 4DL3A 9ICGA 9ICHA 5DB6A 4GC9A 2DNCA 2OQ4A 3FPUB 1COKA 2ZM6Q 5J0RA 4R65A 2B63H 4DL2A 2NVQH 1GJTA 5ALIA 1JMCA 5DQIA 2CXYA 4YWMA 5M3MB 2VUMH 2HOFA 4IS7A 1NHGC 3HJEA 3GLIA 1UT8A 3JPPA 1L3TA 2F0TA 4QB4A 3ERSX 3AQEA 2HSZA 1FO4A 2D7GA 4JV1A 1YE9A 4IUUA 2B8FA 2C98A 2KZUA 1PJQA 2OXOA 1E9RA 4LWCA 1YHQA 1TS2A 4JBKA 2IY5B 4JI2L 4Y28F 4QCLA 3L7ZC 1B22A 2UXBM 4F2RA 1Q39A 2NN6G 1N5WA 3ZDEA 5ELOA 4GHAA 2BE5D 3F2BA 4M47A 5E4XA 3TMEA 4OO1G 4DV4L 3SAUA 4WJWA 1UAPA 3JPQA 3TRZA 2KHJA 3UDXA 2PYKA 2UUCQ 2K4HA 3GTOH 4XA5A 2R93H 4R1JA 4A3FG 4B7FA 5KPRA 2F5SA 4GNXB 2OXPA 5AKLA 3RLNA 3UPQA 3H8SA 1VDVA 2JP1A 2XY6A 3BJUA 1HNXL 4GKJQ 4KMUA 3QUCA 1NY6A 3JPOA 3UZUA 4LFAQ 3HP6A 4A3GB 1PTOC 2LH0A 2R8HA 2Z1CA 4JWNA 4QZHA 5HP4A 2CFMA 3MR3A 3IAYA 2DNAA 5ALQA 1QSSA 2H1EA 3H8WA 5GAGC 1Q81C 5KPTA 1Z4OA 1IBMM 5BPVA 3PNCA 3HPOA 3LWEA 3D3RA 1BGXT 4F92B 2BGWA 4JI0L 1VDDA 3L4PA 4Y2XA 4ODGA 1E2ZA 1K3WA 1BNZA 3H4DA 2BZFA 2F0IA 4N9TA 1YI2A 2N88A 2CN1A 3M1YA 3CPFA 2R6GA 1N33Q 3F92A 5LMNL 1JT8A 4AW4A 3PUZA 2RDJA 1I4PA 2RDHA 4F1IA 1Z4NA 2R4JA 3U4VA 5EXSA 4JI1M 1XWLA 3PW5A 3THVA 3OJSA 3SQIA 8ICYA 1GUOA 3QR8A 5AJ3L 1L2DA 4DV5L 2G5DA 5DNFA 7ICRA 1IBKL 3KOWE 1IBLL 2DNEA 5ALEA 3JPSA 3ISBA 1RZTA 5DYIA 4M9NA 1KKXA 1GUSA 4CF5A 4OXPA 2MROB 3DMUA 1X42A 4Z6DA 2UXCM 4X62Q 2X49A 3KSXA 1IIPA 2O5RA 2LHCA 2B21A 2LKYA 3DEEA 1TWCH 3U6OA 3V7KA 2CE7A 3U6PA 2EQYA 1NMFA 1U4PA 4LMQD 2F0PA 2IX3A 3C3DA 2KNJA 3AFHA 3U61A 3LWLA 3HU3A 4ECTA 1ZQNA 1UE1A 2A6HD 3BDCA 1V1PB 4RH6A 4DSFA 4A76A 3S2HH 3B0XA 1K0RA 3AFQA 1XNQQ 2MU2A 5AIAA 1L3SA 3BQ2A 1A77A 2A1JB 4C0ZA 3V7JA 3OIQA 2NB0A 1V33A 3JAMS 4CRXA 3AJIB 1A0IA 3D8GA 1NNJA 5BN5A 4MTNA 3SVMA 5ALYA 1K28A 2HCBA 3N7PD 1L1TA 4ED6A 4KHVA 1ZMUA 4KHPL 5GTHU 3GQBA 4JI6M 2D6FC 3NUCA 4ZK9B 5I9OA 3J7A5 4ME3A 4ED7A 4REZA 5G5GA 1K5OA 4A3BB 2HKJA 1DXMA 5C18A 4RT3A 1OIPA 1NUCA 3EPGA 1PJSA 2ASLA 4GLAC 1XS9D 3AL0B 3AV0A 4DU9A 1HZ9A 2A6EC 2CW0C 3MGIA 1MJEA 2HL7A 3MXGA 1I4RA 3IP4B 1SFOH 5EXXA 1F9QA 2IJ0A 1DV0A 2E3TA 2D9UA 4DK0A 2ZT9C 1N48A 1X32A 4DF7A 4C8MA 5KFEA 5IINA 4Y7NH 3GV5B 3SZ2A 4KD4A 1JB7A 5ALTA 5JPNC 3T3FA 3HHWA 5EP1A 4IBBA 3GLFE 3C2KA 9ICUA 4K6LA 4GXIA 8ICWA 2JEIA 4XQJA 3STBC 5JOBA 2XFTA 3GP1A 2RF4A 1HNWL 5K4LA 1ZQYA 4EQOA 4O5EA 1J9OA 2PFOA 1FR3A 2PNRC 3Q8QB 1TVXA 4A3JG 1SYBA 1MX0A 2EA0A 2D3DA 1D9DA 4KKSA 1Z00A 4PL1A 3HX0A 1XSLA 4DSJA 5G3LF 4JI5Q 4A3DH 4KY5A 1HNWM 1BQQT 2DUDA 4B9NA 3BU2A 4JC0A 3V96A 1B4FA 1KL9A 1DO0A 2ZJPA 3UDGA 4BXXH 4IOCA 2NRWA 3B74A 3HEJA 1JR3D 1IW7C 4HIDA 4GOPB 2IX1A 2QARA 3U9OA 4LUOA 4KN4A 4KLTA 4JV0A 3KFUA 1YJNA 4LF8L 3W3AA 5KAIU 5KRUA 4O3OA 1R9TH 4CCHA 1MIUA 2UXBL 3EIEA 2V1UA 4DO9A 5J1ZA 2BJVA 3J7ZC 3CGWA 3QO2A 4IN3A 5C4JB 1L2CA 1TIID 5LL6X 3IFTA 4HJ7A 4OWWB 2RKOA 4F5NA 1PRTB 5IWAQ 2C35B 3LMMA 4A3DB 1U49A 1OAOC 4LF9M 4WFN3 1PZJD 1QZEA 2SEBD 2EJFC 4IALA 5FJ8G 1YLAA 1S76D 2UU9Q 2PQEA 1SXJC 4Q8FA 3NVVA 1NAPA 1XMOQ 2F0LA 1XWEA 2DAGA 2PFPA 1UE6A 2YU9H 3FM9A 4P2CB 3KKAA 1CTMA 4PZ8A 3AU7A 3HX3A 3C9PA 1UT5A 2QBYA 1UQVA 2L11A 3J81j 1ZOLA 3E58A 5ALLA 5KFTA 4F72A 4DR6Q 3S2DH 2NZHA 3RD4A 2JXMB 3FUVA 1X56A 2HHHQ 2DWZB 4ZPXA 1I4HA 2PMZE 4I2GA 5AI9A 3LVVA 1JXLA 1Z9FA 3MZ5A 2WIIB 4JOIA 2G8LA 4UARA 3QUQA 3RFAA 3PF5A 4PJ0U 2MGSA 1WR1B 1Q1EA 5C6AA 5ALJA 3NENA 5EQTA 2OCEA 1S97A 1R5LA 3C1ZA 1K3RA 1ENCA 2IW3A 4X3TA 1SL1A 4HJAA 1NO1A 4LF5Q 4YR3A 1EWCA 5E1FA 2A69D 3RR5A 1SXEA 4EX5A 3KFUF 3H3VC 2E5LM 3A5ZB 1IXZA 4J15A 2DXIA 2ZUBA 4HAIA 4KKTA 4LFBL 2Z4SA 1MN3A 2FOIC 2FH0A 3T15A 4CDGA 1JWUD 3Q8GA 5AK5A 2KNVA 4DR4M 2AWNA 1PYSB 2EPBA 4DAYA 4BBSH 4CDCC 1G59A 2KBNA 2JY6B 3NBHA 4KN7C 4FWGA 1NK9A 1FYCA 1S5CD 2AGOA 4QJFB 5EP4A 4WJ3M 4NL4H 3D6WA 4DQIA 5L1KA 2JJQA 4IBKA 3T1YM 4ME5A 3PIPA 2K5DA 3NWTA 5IP7H 2R46A 3S24A 1G41A 2K4KA 3A0HU 4IBFA 5L1MA 8ICGA 4YFKA 3VK7A 4TURA 4NL9A 2AMCB 3EN2A 1QTMA 1QAOA 2JR5A 4UB8U 2PCFB 5ISRA 2HCIA 2NZ1D 2JA6G 1PXUA 1PM5A 3T5JA 3RE8A 2JY7A 5KL8B 2JEGA 1PZID 3C1EA 4ILWA 3J81E 4QGUA 4NJ8A 1QVGA 1GLNA 4I2AA 2MGWA 4IC9A 4B9VA 5EGTA 4RHSA 1N60A 4Y2YA 3NGDA 1D5MC 4R63A 2L1BA 3H09A 4GKJM 4GKKL 1QZMA 2CRUA 3SENA 4F4WA 2CH4W 3HOVB 2YTYA 1EWHA 1FVIA 4D82A 3FDSA 1BCPD 4NSOB 1H38A 1ZQFA 3CF6E 3G6VA 2R3ZA 4PG3A 1EIYB 1Q3CA 5KT2A 2W9BA 1VQFA 1X3EA 3V2TA 5L8RF 1G8ZD 1GKIA 1CKOA 3RAQA 1IV8A 1ZQWA 4KLNA 1KSPA 3AOEC 3UXPA 3V72A 3U60A 1S77D 1HTPA 3EVQA 1L8LA 1ICWA 3GTJH 1QDTA 4DQRA 1VS0A 8ICJA 3WK4A 2RDFA 4DR7Q 3FYDA 4CJ2C 4B3SM 1BBUA 2EANA 5AKHA 5M9OA 2LTUA 5CBAE 2QHOB 4JI0M 1KNAA 4M1UB 1S9FA 2LBCA 3HGIA 3K58A 2JH7A 1HFGA 1TWHB 2MRLA 3TADC 2L7HA 4A3CG 4B9SA 1PH9A 3I4NH 2ZIWB 1M4VA 3QU2A 3CF0A 4P0QA 5CV4A 1KYIA 2ZUCA 5ALKA 1VQHA 5KFFA 3PX0A 4OIKA 5DQGA 4DV2Q 1ZQMA 2FMPA 2D0OA 1WYDA 4IQUA 2MUTB 2E1EA 3HHXA 5J0OA 4KX5A 4J8QA 5JEAJ 4F87A 2E5LL 3GTJB 1CZWA 4MFAA 2KCMA 3M8RA 1V43A 4C1NK 3TAQA 3MEHA 2R7FA 3SHFA 1W2BA 1G51A 3IM1A 2NYVA 4PCZA 4M9XA 1B53A 3DZDA 1LYLA 3AMUA 4IQWA 5FO9B 1TQOA 1PRTD 4JI5M 3F2UA 3OYYA 5KO3A 3W1GA 2ATWA 3O13A 4J03A 4XQ8A 2O5IC 2AGQA 9ICJA 3J7AV 4KV6A 4ZUJA 1UUPA 1I50B 4B3MM 2WF6A 3GIJA 2EY6A 2PI2E 3RR7A 8ICRA 1RL2A 1ZJMA 4ZKBB 3W5OA 3J7YW 3WK8A 2UXCL 5DLGA 2WB1F 3I01M 4R7GA 3SBJA 3UE1A 1SNQA 3GRYA 1OTRA 7ICKA 2MSNA 1NY4A 5FK9C 4BBRB 1JOOA 1U45A 4FD2A 3PUXA 1JJGA 1KLUD 3AQQA 3VC8A 4RUAA 5ALVA 3K6OA 1CA6A 1SNCA 2H3IA 4ED3A 7ICQA 1SB3C 5ALPA 4GEWA 4R4QA 5M3FG 5FLMH 4GOPC 2MPMA 3CCRA 3TFRA 3FKIB 1BPDA 2KA7A 3SAGA 3NHHA 4Q0FA 2BA0A 3S9WA 4Y2UA 1A3VA 5GAHC 3TE6A 3BDPA 4BXOA 4PGQA 2AQ1B 1Z5BA 2YQEA 4TUPA 2V1CC 2VQFL 4DR5L 1OFHA 5KFHA 2CV0A 1Z6TA 4LJ6A 1I50H 4AYBB 2QF7A 1OXJA 1SNPA 1ZRNA 4LRSA 1HA6A 2EAOA 3MXUA 4Z6EA 2UVRA 2WV6D 4F71A 4B3RQ 4LJZC 5CR0A 5I2YA 4Q43A 1X55A 3D2QA 1ASYA 4LF5M 4LG2A 1CEZA 3OHBA 3GLGE 2LVOC 1OXTA 1KQSA 1ZQ9A 3QNMA 9ICIA 1QUQB 1JN3A 2K1BA 4X3UA 1PK1A 2WSEF 1G291 2ZXOA 3KKAC 5KFXA 3M9OB 3FKIH 4M6WA 2DVWB 1HIWA 4QZ9A 3MGVA 4HCEA 1A2TA 4WW0A 2NVTH 2Y0SB 4NXML 5AIBA 4B7GA 4GC5A 4DS5A 1PH1A 3B89A 3Q0AA 2JA6H 5C4XB 5M3MG 2W8KA 2WKCA 3B7NA 1N36L 3TWLA 1N32Q 1PJTA 2JYOA 2MFIA 1T3QA 1EU3A 2BA1A 5FO7B 1ZQOA 3VYRA 3Q23A 2ZXHA 2W3RA 4M0AA 2ZM6L 4R64A 3GLIE 2F0HA 4RGNA 1Z6HA 4YXJA 5CV8A 3T5LA 3FKIG 5FOBB 3SMVA 2D2CC 3KHGA 1X6JA 4A3EH 4LF9L 5J2AA 2Q0ZX 2DI0A 4F3OA 3NP8A 2KIWA 3H0RB 3JPNA 2QGQA 3M4QA 2RBMA 5AI0A 1ZQIA 5IIFA 2F0EA 1GUTA 2F3WA 2K14A 2HAKA 2XGNA 4YD2A 5ELBA 3BYYB 4GN5A 1BDOA 4IQZA 5KFOA 4MB7A 1GVNA 4NXZA 1MKHA 2MUYA 2QW7A 5F9NA 4C80A 4C8OA 2LY7A 2IWHA 4M9ZA 3OIPA 3IHPA 5C0YA 2F5NA 4J9QA 4DR3M 5IWAM 4EIWA 5HHHA 3GTQH 2C99A 1WWVA 2VUMG 2XI9A 2UUCL 3GTPH 2O5JC 1D5ZC 4R9WA 5IP9H 5FTNA 5J0QA 4FYDA 4PHDA 3HY5A 3J81S 9ICPA 2W3SA 1WWUA 1X9WA 1L0XB 1QQ6A 1HNXQ 2KTQA 1SXDA 2G3QA 4DLEA 1MJCA 3BBZA 1RU3A 4R3DA 1Q46A 3Q8KA 1J6QA 3TBIB 2MAXA 4LFAL 2R92G 3SD7A 3I4NB 2HHHM 2ZTCA 1RXWA 1EQQA 4FCWA 3L26A 2W7PA 4HCSA 5C0XH 2JA5G 4N8FA 3NRWA 2O4XA 1NTGA 1PK3A 3UE0A 1PJJA 3K0YA 1EE8A 1C0AA 5M5YH 2PI5A 3FUXA 3FE3A 4MGYE 4DV2M 1SXJA 4O3QA 2G08A 5KG1A 2DL0A 4CNQA 2PXIA 1Q1BA 5JJZA 1SR3A 3JPTA 5EWFA 2WTFA 1OQYA 2KNAA 5J8YC 2A68D 3EWAA 4DNTB 1K3BC 5CV9A 4BA1I 2ICIA 4FW9A 2BPFA 3J80L 4KLMA 2DPIA 1Z7TA 2JEBI 2P5TA 3RUZA 1NY5A 3WHLA 5LMNQ 1PHJA 1N33L 2QEJC 8ICAA 5T14A 3J80E 3SHGB 2JA7G 1V1QA 2KRKA 3RJIA 2FPLA 2RVLA 3NELA 3IV6A 3RN2A 5CJ7A 1O08A 4I81A 4FBTA 3S2DB 5AJ3Q 4DV5Q 1VQ4A 1H95A 1L7OA 1PZNA 3GV6A 5H37D 2XTIA 5EPLA 2F03A 4BX9C 2DZNB 2EYPA 1SXJE 1EYDA 1W5TA 2FXQA 1IBLQ 4ELVA 2EYHA 5J0UA 2N8NA 4UB5A 2HHUA 1T94A 4YD1A 4AP9A 3FYHA 2DWQA 1WG8A 1HUZA 7ICPA 1LKYB 4CJ1B 2LYBA 1AE3A 1Z5CA 4X62L 3G6JB 4EELA 5J2BA 2KCNA 1HHVA 4LUVA 2XRSD 3RFWA 4ID6A 2L4FA 5EOZA 1C1KA 4IBJA 4PT5A 2DFLA 2EYOA 2PW7A 3AU2A 1RM6C 5EE1A 1VQ5A 5T1GA 1HTLD 1RCVD 4CF4A 3CCSA 2Y21A 1HUNA 2PQAB 4OO1J 4EEKA 3FVQA 3MR2A 3U9SA 2XH9A 3TP6A 1XNQL 4PHPA 1V9PA 2QDLA 2YMMA 3E0FA 3TZUA 3A0BU 2NVYB 4P4OA 4JI6L 1IKMA 2B3TA 1BXTA 2UUBL 4A3IH 1G6PA 1PA6A 4HN7A 1SWVA 2ZIVB 4QOSA 5ITXE 2P35A 2VKQA 5KFJA 2W9BB 4JN6A 5AM0A 1BNOA 1I3QB 4GS3A 2NTTA 2DPJA 2DJGC 3SAVA 5HMMA 1I5FA 2D7HA 2DAMA 1X3PA 4C3JB 2KG5A 2PO4A 1N78A 2EKFA 1SXJB 2F5OA 5IILA 3A46A 2Z3XA 4BWJA 2BE5C 1Y14B 2D0PA 2LXJA 3E0EA 2BHNA 2HD3A 3F8TA 2A19A 3GDEA 4AQYM 2IBKA 1SWWA 9ICRA 4FWHA 5DEHA 4K4IA 2M0NA 2ES2A 3UXNA 2OQKA 2IT1A 1I4GA 4OD0A 1KDHA 3N7SC 4WURA 5J0YA 3PV0A 4J9SA 3KOZE 1SXJD 3HFZB 4WORA 4EBCA 4DUZL 3I90A 4J1MA 3NSWA 2C9CA 1SGGA 4JI8Q 7ICTA 3JR4A 1TWGH 4GHLA 1VQDA 1KRSA 3EIHA 4F8RA 1I6HH 1ML0D 1RHPA 3UGJA 4F5QA 2KHVA 1Q3BA 1KTKA 1N34M 2GN5A 3QIAA 1TK0A 3PVXA 2VY3A 2L4EA 3B0YA 2VNUD 1A63A 4ECRA 5DQHA 1T3NA 4H7BA 1PJIA 1JIHA 4BB9A 4LZDA 3EPIA 4A3KG 5JUMA 4F5RA 1PLFA 2NWGA 5KFVA 2DQNB 5EPKA 3T1YL 2R61A 1IYJB 3M8SA 3K5NA 4A3MG 3GTLH 4O42A 4RPZA 4B9MA 2KEEA 3RGPA 2J6SA 2Z6KA 4C8LA 4IBDA 5D3IB 5CC4A 3BQ1A 4DXFA 1TV9A 1KDAA 3F53A 3RJJA 3VR6A 1TAUA 1HFNA 2KEBA 2JV3A 1QZHA 3FUTA 1E9SA 3ISDA 2BCSA 4LVSA 5EWEA 4A3JB 2CQOA 3GTKB 5CV6A 2W03A 1TH4A 1L8QA 9ICLA 2KEDA 4DA2A 1SYDA 1E32A 2BQRA 2ICEC 1WD1A 2L2DA 1D2NA 3FUUA 3T6PA 1DK3A 1Y69U 4LF8Q 2MQHA 1LO5D 4LCBA 1ZXTA 3M7NA 2P6UA 5FLXc 1K73C 1IY0A 5KFCA 3ZJYC 2UXBQ 2H1RA 4UPAA 2N35A 1SE4A 2KRUA 3WDNA 2LVNC 2C96A 5GKNA 1ONLA 1PRBA 5AKZA 2WP8J 5FTMA 2EZYA 2H3ZA 2JZBA 2RDIA 4ECSA 2KE7A 3MXNA 8ICZA 1LTGD 1SMXA 4HJ5A 5KNCA 3BZDB 2Z4HA 3RZOB 1GABA 1TH3A 1FGBD 3VDYA 3U6DA 1JALA 2OOBA 2JA5B 3K7AH 2Z6BA 1WI5A 5DG8A 4ZLTF 1DGHA 2I1QA 2MHVA 2WB1B 4L5SA 3GTKH 3M3YB 1B2TA 1FL0A 3PMLA 1G8PA 3NRZA 4F7XA 4CISA 3I4MG 4HIKA 2DKLA 4DV0M 4AG6A 1EY7A 3THGA 2HBMA 1VDLA 3FHWA 2W43A 4GLVB 3UDFA 5J22A 3S1MH 2F5QA 1IBMQ 4D81A 4M9GA 5IODA 3UXOA 2FJ2A 4DEZA 2HI0A 4DR6L 4OJPA 2F0JA 3TI0A 3Q8LA 3RBEA 3RJKA 2KA6B 3CRKC 3ITPA 2VQFM 4MF2A 2HHHL 1SEBD 4LGYA 1UWVA 4LFAM 3AFPA 5HY6A 2K5VA 2KOBA 3RB0A 4GC7A 1ZQRA 5KFIA 3S1NH 2EVBA 3C3EA 3H7IA 1QJOA 3HJ8A 1S5FD 3D4WA 2NRTA 3I3CA 3I72A 4ED1A 4UY8C 1O78A 1FFVA 3PUVA 1TWAH 3TP8A 4YHHL 1L7MA 1TXYA 3M3YH 3DM3A 1N34Q 4EQNA 2V6ZM 1S0NA 1KFVA 2UUAQ 1TU2B 4OWTB 7CATA 2OHFA 1WTPA 1R4QB 2K5HA 5KT5A 2QPAA 2MR9A 1QNKA 1OAIA 1IY1A 2VUMB 3C5GA 3STBD 4DN4M 4Y52H 4RQ4A 2A5HA 4QJFA 3R8BA 2KXEA 5F3XB 5C44B 1F9SA 1U4MA 1QUSA 4B3ML 1ZYQA 1G3IA 1L7PA 1DXSA 2VIXA 4I2BA 2F0FA 5E6JA 4YVZA 3JPRA 3K5OA 3Q8MA 1DOLA 4LUZA 1JE4A 4QMGA 2YQZA 1FNUA 3SR1A 1WVLA 1F9PA 2KN7A 1UA0A 1IXRA 1OO9B 2LVPC 4V0BA 4DV4M 3A0JA 1A6SA 1ZQAA 2CVRA 5BN3A 8ICQA 1Y1WG 1PH4A 3M4OH 1S5BD 3FAHA 5IIJA 2K05A 2F4VL 4O0AA 5AI8A 1HQCA 1EQVA 4IRKA 3L3OC 3IG5A 5M3FH 3KZIU 2C2EA 3D8BA 1X40A 1TS5A 1C20A 2F76X 4NLCA 2EZVA 2I7NA 2K4PA 3CP8A 5KFGA 1DYQA 2K04A 3LQRA 3R2IA 1N62A 3M9MB 4EVOA 5IP7G 2Z6KC 2VDBB 1OUQA 2ZJ5A 1I4XA 1SSOA 2B63B 4IFDH 3C46A 2R44A 1QQ7A 2EZXA 5C44H 2L7IA 4JV5Q 1COOA 3BZKA 4OJOA 5KG2A 1S10A 1QVCA 1ZXIA 4NM2A 1SE2A 4OONA 4V190 5KNDA 4H0LC 1JJCB 3KHRA 1FGUA 2PMZB 4MNOA 3JAML 3PW0A 1PH7A 4LJ9A 3L9AX 3P7JA 2C2DA 1E22A 1HT1E 4O3SA 4NRWA 1SBBB 1TWFH 2LKVA 3ICEA 2KZ3A 2LYAA 4NLZA 4KMUC 3T16A 2G07A 1SIJA 3SK4A 2M60A 2K4EA 5KG5A 4RNOA 2PMZF 1Q8KA 4G4RA 3TACB 3U26A 3PQIA 2ZTEA 7ICEA 1L8OA 2IMWP 2E1FA 1AEXA 1W5SA 7ICGA 4BY7H 5IYCG 3KZXA 1HR0M 3ZDBA 3H4JA 4YMNA 3HOUH 1WCLA 1WJ7A 2LI6A 2PPBC 1F9RA 1B50A 2O25A 1T3TA 2J4XA 1EY5A 2CH4A 5CR3A 2B0CA 3HW8A 2DY8A 1I94L 3DHQA 4QWAA 1PZKD 4A3MB 3PMFA 2XSZD 2XC9A 1SKSA 4B08A 4XK8F 2W9CA 1KRPA 1CA5A 4OU7A 1SKRA 1OXVA 4PNYA 4CKEA 2UVWA 3GV7B 4USAA 1C4QA 4L5TA 1V34A 1ZD3A 3AN1A 4RQ3A 5DBBA 2FLNA 3LW5F 5HR7A 4QIWE 1K83B 4RF1A 4JVZA 1VQOA 3A98B 3SAHA 4DOAA 1WJJA 2KENA 1EU4A 1J97A 1LTRD 3IG8A 1IBKM 8ICKA 5AFWA 2NVXH 4J9KA 3TP7A 3TKAA 4KLKA 3I04M 3PX4A 5J2JA 1UE5A 9ICTA 2XWJB 4DV1Q 5D49A 3KK7A 3J80c 2K28A 3SFZA 1HA5A 4M0WA 1CHQD 4L6V6 1CK1A 1NJYA 1AUAA 2QB0A 4EBEA 1U5KA 3E9HA 1DGSA 1SN8A 4M8AA 4UB3A 5ELDA 5KFNA 4X3KA 4FO6A 2K52A 1PTOD 3KJOA 2G06A 3N28A 1XXGA 4LJ5A 2K7VA 1Q7YC 4DV6Q 2LBOA 4JV2A 3T51B 8ICBA 4UP8A 4RAUC 3WK5A 3MXPA 4FWDA 4L4UA 5G5HA 3BQ0A 2WF7A 2Y0QA 3Q8PB 1L1OA 3SK5A 3KJPA 2WF9A 1VEGA 2AQ2B 2BCQA 4E0DA 4P4MA 4HIMA 2F0MA 2EJGC 3G71A 5FLXS 2ZIUA 4OX9Q 1T6OA 2BKEA 1ET6A 5JEAH 4Y7NB 3S2HB 3R9XB 2E8PA 4QWBA 2VQFQ 4ECZA 4LK1C 1II3A 4GKKM 5JJIA 4DR6M 2OEOA 4LNQA 4XYOA 4ZAIA 2L09A 1YSYA 3RH5A 1JCKB 1WTHA 3TWMA 3I70A 4KLDA 1SNMA 2DJFC 1LUZA 4K0KQ 3MK6A 1BNPA 1KRTA 3U58A 4LZZA 5BR8L 4Q7JA 3IHQB 5KT7A 1B7YB 4DXGA 2A1AA 2PMZC 3F5AA 1CSQA 1HUMA 2Q2IA 4ACOA 2BWBA 2N1RA 1TS3A 3KLWA 4MEXA 1WTVA 1FEZA 1OXXK 2OO9A 5FTJA 4DR1M 2SNMA 2AQ4A 5JEAG 1YJWA 4M9SA 1Q86C 3J80i 5DLFA 3TEHB 1BR9A 4UAWA 5A2QL 4A3EG 5IGFA 3NBIA 4G9BA 2EUCA 3FYCA 2CRXA 1S5LU 5ALGA 3H4BA 1QUTA 7ICOA 5ITRA 3K4GA 3KOOA 1OXUA 1STEA 3QU9A 3FRPB 1N61A 4R4TA 3T13A 2HQLA 1EYGA 3B7QA 3SMSA 4TUSA 5CEHA 3C23A 4DFPA 4K8JA 4P71A 2JK8A 4DV3Q 1SV4A 2DWMA 1EOTA 4I27A 3GQ3A 2X69A 4L8JA 1I94M 5EAYA 1WTQA 2Z4RA 4RF0A 2E8MA 5HNKA 2ES6A 5J0XA 1L3UA 1F2MA 3A7AB 3DWQA 3G6XA 1NJWA 5KNBA 2M9NA 4NLGA 4LF9Q 1SZPA 3OPXA 1NJFA 4BXOB 1M8AA 1MU5A 2MJ8A 4P74A 5EP2A 2CWPA 4MTKA 1JRPA 1XMOM 2MH8A 1X6OA 2K47A 1F44A 1EFID 5KFYA 3M7GA 4IPDA 2R0IA 8ICVA 1QAQA 3D0FA 1F5SA 5HMLA 5FO8B 2CHVA 5C0XG 2EXDA 3PR4A 1L5UA 1AW7A 4I2HA 3TL4X 5AHXA 4BY1B 4PZNA 5DDMA 2HHWA 4IJLA 3CCEA 4QZCA 1ZAEA 3RH4A 3SXHA 3KUPA 4RMFA 2LMRA 2YU9B 2Y1IA 3H91A 3ZDAA 4NL9C 2Y20A 1E1OA 1STBA 2F0KA 4UW9A 3P20A 2XZFA 4KJOA 1WTWA 4FF3A 4GN4B 1XC8A 1L7NA 3I28A 3NVWA 4YCXA 1Y8NB 2R93B 4QNLA 2KFZA 4GC6A 3S6JA 3QZ8A 3Q8XA 1NZPA 1FNVA 4D80A 2IHNA 1KABA 2JA7H 1P16A 1VQAA 2VQEM 3L3FX 2ESEA 8ICSA 1R4PB 2B2YC 4GLXA 3ONNA 3AYHB 5C5MA 3J7AF 4YG2A 4R8NA 2FE8A 3QU4A 1D8YA 1ZMVA 3LGJA 1EIGA 8CATA 4F93B 4GN3B 1N33M 5J39A 2UXDM 3C1FA 4DV0L 2F2AB 3CXCA 4UHVA 2LNHC 3J81i 4DUYM 7ICIA 5F3WA 4Y2TA 2BR0A 1GXDC 1D0MA 4O3NA 1A62A 4RGTA 3SV3A 2HT1A 2V1CA 1RDFA 2UUAM 2R8KA 2ALYB 4FP5D 1Y8PB 5KIXA 3J81L 4M6WB 2NVXB 5ITTA 1S8OA 5AKYA 3X3MA 2H5XA 4ECUA 1KAAA 4OEMB 3WKAA 2D8CA 4BWGB 1AP0A 2EO2A 3OGUA 8ICIA 4P0QB 2O6KA 1MSHA 1S5ED 1LM0A 1HQMC 3H0GB 1HR0L 5J2GA 5KG7A 4HTHA 4KT0F 1BCPB 1NR4A 4XXEA 1KTQA 4J9MA 4ZKCB 3HILA 3VCBA 1K0SA 4IQVA 5CV7A 4M0DA 3TAPA 8ICTA 1ZRMA 3SK6A 1ZYRD 3GIKA 4H13C 3W1BA 1VQIA 4OL7A 4O5KA 1XNRM 2CHGA 3I2ZA 2XFSA 2SNSA 2C9OA 2KZMA 2QA4A 1VQLA 2EYMA 5J0TA 3MMPA 3KF6B 3GO5A 4JI7L 3H4MA 1BCPF 2RGHA 2NUCA 1F0MA 4DSEA 4BS9A 4DV1M 4RQ0A 4I2CA 4NXNL 1RD9D 5A35A 2YV5A 2NRVA 1NNLA 4JI6Q 2JA9A 1FNWA 4P0PB 4MHEA 1GVPA 1NHWC 2F1IA 4KX3A 4HIOA 2RSOA 2UUBQ 3K9PA 3A45A 4O5CA 1LTTD 4RG1A 4K0KL 5ALXA 4B3SL 4JYAM 1LV5A 5EBDA 2ID0A 3ZDDA 1CKNA 3C58A 2XICA 2HMXA 2R8GA 2JN4A 3UM9A 2CWAA 1ZMWA 4A3VB 3PVSA 1DGBA 4DFJA 2A1JA 2VXWA 1UCVA 2V4QA 3MDCA 4A3KH 4LF6L 3IECA 2GH1A 2R18A 4MFFA 3K81C 4RU9A 3LX0A 5AK3A 3MTSA 3WOFA 3GPPA 2R92H 1GHKA 2CWBA 3ONAB 2H4OA 3PO3B 3K80C 4DS4A 5L37A 1VCIA 2F5PA 2ZXRA 1JMSA 2YYZA 4DUZQ 1X9SA 1YT3A 4GOPA 1IN5A 1XPOA 3BZCA 4QY7A 1K9MC 3CQZH 5AKXA 4JI8L 1L1OB 3ORYA 1SFOB 1JROA 5I4DA 2VW9A 2HHXA 4IL6U 4F4XA 3N7RC 3RJEA 5HURA 5DB8A 3CCVA 1J7KA 4AKHA 2G5IB 5F9LA 1U48A 2F0DA 2XIDA 2BPCA 5D14A 3BVMA 4Y2RA 2NRZA 3BQTA 1S0OA 1WGNA 1Z5AA 4HSVA 2F77X 1WOCA 1ZQSA 4NDXA 3HOZG 4EZ9A 4ITQA 3MHBA 2K8AA 3T1YQ 4BA2I 1Y1VB 1NSFA 2FLPA 2A8VA 4I2IA 4RNMA 2HHTA 4US9A 4FNFA 5C5JA 1LTLA 1N63A 2H3QA 2E2DC 4KY7A 2C5RA 4RKLA 2ODGA 4Y2JA 5D4BA 5JI2E 4FFDA 2RP5A 1STNA 5C3EB 4OO1H 4C3HH 3B6YA 2XF3A 1QSYA 8ICHA 3PIO3 1Y1WB 3CP0A 5IE8A 2OWOA 3KHHA 3HOZH 3SGIA 1ZQPA 3I51A 4IR9A 1BCPC 4IPGA 4KTAA 3HOXB 5DGBA 1Q3UA 2KKPA 5KFPA 1ZD2P 1PMRA 5LHY1 4JBWA 1B9NA 3ALRA 4L5RC 1OKSA 2VB2X 3WK7A 3KLRA 5M3FB 1KD1C 4R8IA 2KSOB 3UMMA 2QARB 4YXMA 2X6GA 4UATA 3DFZA 4Z6CA 1U9LA 1C48A 3UDIA 2EJSA 1DO2A 3B7ZA 5KQ8A 3C21A 1OXSC 1Y1VH