2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
b'MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
9ICGA 4OXPA 5JJLA 3I4OA 3LCUA 2NZHA 9ICUA 1WJJA 5C4XG 3UDXA 1TFRA 1RYSA 4ZH4A 3MFIA 4GKJQ 4YCXA 3K7AH 8ICVA 4NPSA 4YCVA 3W5OA 4M6WB 3RR5A 2WZJA 4LFCL 4Q7JA 1NJXA 1YZ6A 4F92B 3T5KA 4K0KL 1TWAH 1L3VA 3ISBA 4QQBX 3ORYA 1QSSA 4A3JG 1KD1C 2A1JA 5LMNQ 4ED1A 3GLHE 5DB9A 3C23A 2R7ZH 4J9QA 1M90C 4ECUA 1B43A 2XY7A 2F4VL 1J5EL 2JEBI 5J0RA 3GD7A 2UU9Q 7ICIA 4QWBA 4FO6A 2ASLA 4BY7H 1N33L 2R7ZG 3Q8QB 4X6AH 4A3MG 1MN3A 1VEJA 1XU4A 4EBEA 2UUCQ 1L1OB 1VQBA 1NV9A 1Q8KA 5J0QA 1Q86C 3PNCA 1HT2E 2WTFA 4BY7G 4JBJA 1Q82C 4HIKA 3IHQB 1YHAA 4RNMA 4J9SA 8ICSA 4DV3L 4YXMA 2D62A 2PFQA 1NBWA 2DAGA 4LUOA 4M9HA 2WAQE 3FRHA 1X6OA 3EPIA 3RRHA 2V4RA 4DK3C 3CC4A 1IBML 4ED0A 4LF4Q 2ZJPA 2R8JA 2KFZA 1QTMA 5IT9c 3E9HA 3MDCA 4ECSA 2IX1A 1JJ2A 4F4YA 1E22A 4JI2Q 3I55A 4DUZQ 1XJVA 1ZQLA 4UP7A 1PVOA 4MEXA 3C2MA 4RQ7A 4PHDA 2JY7A 3F2BA 3KHRA 5KT5A 8ICQA 1VQ7A 1S0OA 4KLTA 4YFKA 1P3QQ 4JI5Q 2BA0A 4QL5A 3Q8PB 3MMPA 9ICQA 3PY8A 1PYBA 2MNAA 2UVWA 2N49A 3HFZB 5DB8A 5DDMA 3GLFE 4M9LA 5KFIA 1T3NA 2MJ5B 1QSYA 4KLGA 7ICFA 1HR0Q 1JR3E 2EJSA 4LVSA 1CKNA 3GIKA 4DS5A 2NN6I 5GAHC 1TKDA 3H4DA 1KRSA 4BXXG 4GXKA 1XXHE 4JG2A 2EKFA 4RG1A 1S10A 2JEFA 2XCAA 1CUKA 2J6TA 4F2RA 3BZCA 4GNXA 3PCOB 4DFKA 1G3IA 3MR6A 4JV0A 9ICPA 1IL2A 4M47A 4M0AA 3RJKA 4RQ4A 5KFLA 2ZUDA 1RXWA 4X65Q 3H7IA 5ELNA 4DR7Q 1ZETA 4EQ5A 1SL2A 4A3KH 4TUQA 1BGXT 2IHEA 4BBSH 3SV3A 2AGPA 2HHHL 1SKWA 4JC0A 3M9MB 3UE0A 4KN4A 4B9TA 1ZQAA 4R64A 5IIOA 4F4XA 1NJIC 2NRXA 3PV8A 4A3KG 2F1IA 4JOIA 3M4PA 3E9IA 4IQUA 2YTXA 3TRZA 4BBSG 3K9PA 3HOXG 2WAQG 4RU9A 3TS0A 5KFNA 2IY5B 4O0IA 3A74A 3HPOA 4PZ7A 3PO4A 5J0XA 2HHXA 5M3FH 2KCTA 1UE1A 2JZ0A 3N97B 3ZDBA 4YY3L 4IQTA 2ZJRA 1IBKQ 3ERSX 2OWOA 2DFLA 5IIJA 4KLSA 1XTDA 2VA2A 1X9MA 2C35B 2CKZB 2FPMA 4L5TA 4DL3A 5M3FG 4F2LA 3SYZA 2O25A 9ICLA 5IE8A 9ICMA 3MGIA 2DNAA 5M5XH 2KNVA 2XY5A 3RBDA 2UXCQ 3TFSA 1UE6A 5HMLA 4Q8FA 1J6QA 1OTRA 4DR3L 1P16A 2R92G 4MF8A 4JI6Q 4X62Q 1PH8A 2QA4A 2DAMA 1B8AA 4YWKA 4ED6A 5H1SE 8ICKA 4BWMA 2Q2TA 1RZTA 5C0XJ 2ASDA 9ICFA 2VUMH 3KF8B 1QUQA 1ZMVA 1Q1EA 1VQ1A 4TQSA 2ALZA 4HJ8A 4QY7A 8ICYA 2LTUA 4LNQA 4A93H 3GIIA 4DR5L 5DGBA 1N32L 5LMNL 4NLZA 4DR4L 3OHBA 1X54A 2VUMG 4G3OA 2UXDQ 5K36G 4YR2A 1I6HH 1SG9A 4O5CA 1MKHA 1HZBA 1YHQA 9ICVA 4A93G 1OXSC 1YHBA 4O3NA 2YV5A 4RUCA 5F9NA 1QZEA 1BBUA 4EX5A 4YCUA 4UB4A 7ICVA 3K7UC 2CWAA 4AQYQ 1OQYA 4DQRA 4LF6L 3AU2A 1WGNA 1ASZA 8ICPA 4A3IH 2UUCL 1XPUA 1T8EA 5IY0A 5J0YA 3ZD9A 3OTOQ 3CF5A 1XB2B 5IINA 2NZOA 4R4QA 2KHJA 1A0IA 4UN2B 8ICOA 4UB2A 4B3ML 2ALYB 1B22A 5J3BA 1KRTA 3T1HQ 3ULLA 5HMMA 2B3TA 1JXEA 1A5TA 1OAIA 4FS2A 3RJJA 1XMQL 4P73A 2BH2A 2AWNA 2B3GA 4IJLA 4F5PA 4YD2A 1WIVA 1MJEA 4A3DG 1X9SA 1K8GA 3M9NB 3K4GA 4LF4L 2I5LX 2Y0SE 3PO2H 2UXBQ 4O3RA 2JZBA 2XY6A 2JY8A 1ZQBA 5DDYA 4E0DA 1YITA 1S0VA 4LZGA 4ED2A 3K9OA 2FPKA 5DB7A 5E7NA 2LXJA 4DUZL 4YQWA 4DLGA 5IILA 4R4CA 4A3CH 4OO1G 3MFHA 4DSEA 4RZRA 3PO2G 2QHOB 1BPXA 4LF5Q 2ZUCA 2Q2IA 5DQHA 1CEZA 2VA8A 8ICJA 2KZZA 3JPRA 4A3CG 4LFCQ 5J2FA 3CCRA 4RNNA 5BOMA 4YWLA 5M5YH 1TWFH 4M2YA 1B70B 4PHEA 4F4ZA 1PH7A 4F3OA 2K5NA 1EQQA 2ES2A 4MZ9A 2K9DA 1XNQL 3GV5B 3IM1A 4PGYA 3CAMA 4HIDA 4C3IH 9ICOA 2LVQD 8ICUA 2F4VQ 1J5EQ 4C8MA 1MSWD 3H3VH 2MUTB 2D0OA 2JQOA 2BPFA 1L3UA 2JA6H 5DKWA 5JJIA 2IHNA 2GN5A 2R93H 1N33Q 3S1RH 4F5RA 3T5HA 4DQPA 4A3EH 2J6UA 4ECZA 2MGWA 2FMPA 4B9VA 3L0OA 1XC9A 4C3JH 3HWTA 3OGUA 2GWSA 3CXCA 3UDGA 3BQ0A 1UE7A 4DV3Q 1ZV1A 4YWMA 1WOCA 1D8YA 1ZQZA 3CMAA 3BQ1A 2RDIA 1H38A 1EOVA 5FLXc 3H0GG 3HOYH 1S97A 4QW9A 4IRDA 1IXSA 1RYRA 1XSLA 2KBNA 1TR8A 2BKEA 1TWGH 4QZDA 4DV7L 3MDAA 4PZ6A 4TQUS 2BQRA 3HOYG 2JJQA 3OSPA 3G48A 4QWCA 4F1IA 2Y0SG 5IYBH 4XQ8A 5HP4A 1UA0A 1BPEA 3GTKH 1X3FA 2NRTA 2HIXA 1IM4A 1Q46A 3IECA 3EZ5A 1VQ5A 4DR6L 3V6KA 2AQ0A 1VQ6A 5IYDH 2W9BA 3FHWA 2Q2UA 1U47A 2Z6KC 3ULJA 2WB1E 3KOJA 2JEAI 2PQAA 1D9DA 1SLJA 3G6VA 3STBD 1E1OA 5C3EH 5KFJA 8ICLA 1HJPA 4RUAA 2EXDA 4JI4L 2FLNA 4KITB 5IYDG 4C8NA 3THVA 2I5HA 3PUXA 1YJNA 5C5JA 7ICQA 1WHCA 5C3EG 1CKOA 4HIOA 3K0XA 2UXDL 5KFXA 4F4WA 4IRKA 2PXIA 3GV8B 3C5FA 4LF9L 4KLDA 1SN8A 2ZUBA 4GOPC 5C0XI 1VQOA 2JUJA 5KFGA 3ZDDA 5EWGA 1UE5A 4DF4A 4FBTA 3UXOA 1FGUA 4DUYQ 1WI5A 2HIVA 1A76A 4AQYL 2VW9A 1VQMA 9ICCA 3M3YH 1XWLA 1VQAA 3TFRA 1SKSA 2HHHQ 1X56A 4EEYA 3RB4A 2JEJA 2DGYA 1Z00A 1ZQHA 1GM5A 4ECRA 3T3FA 3VDYA 4WP2A 3PW5A 3PSIA 4YVZA 4PHAA 4MEYA 2A1AA 4B9MA 4DL7A 4O9MA 1JJGA 2AGOA 3TARA 4KHPL 4HJ5A 4B3RL 7ICUA 3SGIA 4YR0A 5JEAG 4BXOB 4MTNA 3RB3A 3T6PA 1PH9A 4YY3Q 3H8JA 2BGWA 4O3PA 9ICKA 2I9GA 3TREA 2Q0ZX 1XS9D 2UUAL 2KTQA 4YMNA 1SKRA 5DBBA 1OTCA 1MJCA 4RPXA 4I2JA 3AFPA 3OYYA 2C2EA 2CFMA 1N8RC 4LW1A 1PH1A 5KFPA 2PI5A 1JMSA 1YVCA 3Q8RB 2AWOA 5KFQA 3GILA 2GVBA 5DGAA 3EYZA 4NB3A 3GTLH 2MO1A 4DR3Q 4LF5L 4MFCA 4I2IA 4RQ8A 5J2GA 2FLLA 2PI4A 4ELVA 3LDAA 2WB1G 1V43A 1DO0A 5CWRA 1VQPA 1A63A 2IHMA 3S2DH 4LFAQ 1QZGA 5L1JA 2KNZA 3F8TA 1DOQA 4QZFA 1E3PA 1KFTA 4DR5Q 2RHSB 1N32Q 7ICNA 5KT3A 4DR4Q 4UY8C 3M4QA 1N9WA 4LF7Q 5IP7H 2BWEA 4KLMA 4QZBA 8ICXA 3Q8LA 5KFHA 1NK4A 5J2IA 5M5WH 4R8UB 1VQEA 3RH4A 3JPOA 1KRPA 7ICMA 2DI0A 4EYHB 3MGHA 4LZDA 1GO3E 5IP7G 1MQ3A 4RT3A 4LF6Q 3E0EA 4IQVA 1IBLL 4L5QA 4B9SA 1SR3A 4JI3L 3M9BA 3W1BA 2B63H 2AJQA 8ICTA 5KFMA 3KHGA 3CC2A 1NJWA 2P6RA 5J29A 3V7JA 3S1NH 9ICNA 2AU0A 1X65A 3I4NH 4ED3A 7ICLA 1EQRA 4R4IA 4A3LH 4OWTB 4B3MQ 1UT8A 1TK5A 1AE3A 5KT6A 1MIUA 3J81j 2LVNC 2R8IA 4JK1A 1XMQQ 5DQIA 1KLNA 4BA1I 1ZQQA 4HJ7A 2W8KA 3I4NG 2V9WA 2MR9A 2MO0A 5CA7A 3EBEA 2W9CB 3Q8MA 4C8OA 1ZQDA 1U0LA 1G4AE 5JI2E 4JI7L 1JXLA 1LM0A 3PX4A 4QZHA 1TAUA 4C2MH 3ER0A 4F93B 2YTVA 3PW2A 5J0SA 5KFRA 2ZM6L 1F4IA 1BPBA 1PZNA 3OSNA 5DG7A 5DFLA 3RTVA 2NRWA 3QE9Y 4R1JA 3GDEA 4HEOA 2ASJA 2NVTH 3OHAA 3KF6B 2QNJA 4K4HA 8ICCA 2N8NA 3CP0A 3TANA 4GOPB 4IFDJ 4DKAC 2F1HA 9ICAA 3EWAA 3K75D 1VQKA 2JP7A 2KHIA 2XGQA 3RAXA 1NK5A 4R4OA 1XNQQ 4DOCA 5BOLA 4KTQA 2JY5A 4KN7A 2DENA 5TZVA 4AYBE 4JBKA 5HNKA 3NTUA 1EFWA 3JPPA 2R8GA 4DV4L 1HR0W 3L2PA 2HHVA 4BWJA 7ICHA 2LSSA 4I2HA 3TAPA 4DUYL 2UVVA 3S14H 4ECVA 3CCUA 1OXUA 1VCIA 1U9LA 5KFVA 2KZ3A 1ZQYA 1D8LA 1TK8A 3H8SA 5J2AA 2N3SA 1Z3EB 4QZGA 3U4ZA 4RQ6A 2HHSA 2XTIA 1MC8A 4A4IA 2BR0A 4DSJA 4HIMA 3RH5A 3M4OH 3PO3H 1HT1E 3BQTA 4QJFA 1VQFA 2CWPA 1Y88A 3MBYA 1KL9A 2ZTCA 4JYAL 1L3SA 5DB6A 2E2HH 3TS2A 2KFNA 2JE6I 4I29A 4UB3A 3CPFA 3LGJA 4DV7Q 4F91B 3NBHB 3WWVA 1ZQPA 4K4GA 4X5VA 4J9MA 1UEBA 1PHJA 4X66L 1EXNA 2XC9A 2XO7A 2K14A 5L1KA 1K83H 4UPAA 4J9RA 2WP8J 2L4EA 1HUOA 4DO9A 1K73C 2UVRA 4JCVE 3PF4A 4M6WA 4DV1L 2V4QA 4DQQA 2FMSA 4DV2Q 4DR6Q 5JJKA 3CMEA 5J2CA 1JT8A 1NK7A 1C9OA 1SL0A 4DV5L 3HX0A 4P75A 1U48A 1VQ9A 7ICOA 1WJ7A 2A8VA 2C22A 1NV8A 3G6XA 8ICFA 5BPCA 2RF4A 1QSLA 1YJWA 2VZAA 4P4MA 4LWCA 4QGUA 2IBKA 3GQCA 4IPGA 4JI4Q 3T5JA 4QZIA 1TV9A 2YU9H 4ALPA 4LFAL 1SZPA 4YXJA 7ICEA 3EIVA 1FVIA 1T43A 4DL2A 1GKHA 1ZQVA 1X2IA 1UWVA 5CJ7A 4JBWA 1N36L 4LF7L 4Y7NH 3PR5B 4PGQA 1S72A 3HT3A 2DZLA 4KLOA 2VA3A 4AYBG 5FJ8H 3CCJA 4LF9Q 3L7ZC 4YCWA 3S17H 2G3QA 1BBWA 4A3BH 1EIFA 4XRHA 7ICKA 5GQOA 3PVXA 3RZOH 4F5QA 3H4JA 2D0PA 4POGA 2ISOA 7ICSA 1IFYA 3V72A 2BA1A 4NXML 3DLLA 4UQGA 3ZD8A 1ZQGA 5LMUL 3KHLA 3RN2A 1JN3A 4A3BG 1NK0A 2JK8A 3PW0A 1CSQA 4Q8EA 5KG4A 3M7NA 1Y1WH 4O0AA 4J9PA 4B3TL 4UB1A 3V7KA 5IIMA 5KFTA 4A3IG 5EOZA 2MFIA 2BCVA 1EUJA 4APVA 1V92A 1MQ2A 4F8RA 2HW3A 2R7DA 4DAMA 3GTOH 4JI0Q 2BDPA 4KHPQ 4B3RQ 2F3IA 2ID0A 4ECQA 1ZJNA 3CCLA 5IIIA 4DFMA 2ZJAA 5DLFA 2F52A 2UUAQ 1HNWL 1LYLA 4IPCA 2K50A 3JAMc 5L1IA 4I2GA 1L0WA 1VEGA 1OXXK 3KDFB 4DFJA 3ICEA 4XIGS 4DS4A 1XMOL 2E2IH 2NRZA 1XO1A 3KTQA 3ZDAA 2H5XA 1KFDA 3B0XA 3RR8A 4DFPA 3GTMH 4R66A 2FXQA 4GNXC 2FMQA 4J9NA 3PX6A 1N48A 4O5KA 1K1QA 2XGPA 3C2LA 2Q2HA 2B21A 2V1CC 5L1LA 9ICIA 4HJ9A 4JV5L 1VS0A 1G51A 1JMCA 7ICJA 1L3TA 4DSKA 1ZQOA 1XPRA 1EYGA 3GIJA 4DQIA 4I2FA 4AIMA 1ASYA 2KNAA 1PH3A 2DKLA 1NJYA 1KYIA 4JBMA 1DV0A 1Q12A 1YIJA 3EW9A 3JPTA 8ICMA 3A5UA 4KI0A 4K4IA 3J80c 5DLGA 2BH8A 3FKIH 4L5SA 4UBCA 1I5FA 1KDHA 4JOIC 3CC7A 2R8HA 4PHPA 2UVUA 3RB0A 1PH2A 2HHUA 8ICZA 4IR9A 2EIFA 1B7YB 4LFBL 4UBBA 4IFDI 4NLGA 2LXKA 3GTQH 2P66A 1IBLQ 5C4JH 3RZDH 4JI3Q 3ZDEA 5J2EA 3HKZE 4M9GA 3T5LA 2ASBA 2JA6G 3AQQA 4ED8A 2KN7A 2EKKA 5KFYA 2ATLA 2R93G 2MROB 4ECTA 1KXLA 4A3EG 2W8LA 1NY4A 3PX0A 3K80C 2A1JB 3C5GA 5KFSA 3RJHA 4PH5A 5J0OA 4ME3A 3GDXA 3AUOA 1NK9A 1X55A 5KFEA 4B9UA 2IA6A 4P4PA 3D31A 5IWAL 4MF2A 4KLKA 1W3SA 4QZ9A 4DV6L 5DQGA 1ZQIA 3UDFA 5C44H 2VQFL 2K52A 5IYCH 2CQOA 4JI7Q 2DUDA 1XNRL 1U5KA 4KHZA 5GROA 2W9MA 5C44G 2ZM6Q 3PW4A 4TUPA 4DV2L 4Q43A 5IYBG 3FRIA 2ATWA 3GTGH 3ISCA 1RL2A 8ICGA 5IYCG 3KJOA 2E2JH 3KFUA 4R63A 5IIKA 3E46A 5KG2A 4DSIA 3HOVH 3BZKA 4QWDA 1YEZA 4JI1L 4RQ2A 1SRUA 1TAQA 5FLMH 2GVAA 4GEWA 2VL6A 4NXZA 3TI0A 4C8KA 1A77A 2LBCA 1TVAA 3PIOA 4RNOA 3BQ2A 2HHWA 1KAWA 1ZQNA 3HOVG 1Y14B 4I2EA 1CKMA 3PF5A 4DR1L 3F1ZA 1OKSA 4LUZA 1YBYA 5KFFA 8ICAA 2CWBA 4Z6EA 4Q45A 3V7LA 5FLMG 1JB7A 4M9NA 7ICPA 4DV4Q 3RN5A 3C2KA 2E5LL 1PH4A 2NRVA 4EBDA 1QLNA 3JPQA 1NMGA 4IPHA 4R65A 1ZJMA 1ZQRA 5CR0A 3PV0A 2BPCA 4JV2A 1WGLA 3HKZG 4NM2A 4B9LA 4O5EA 5BR8Q 4EZ9A 2B29A 1BPYA 1PGYA 3C21A 2DPJA 2VANA 5J2KA 2L4FA 1L2FA 1CKNB 4JI8Q 5J0TA 4KLIA 3MR5A 4JYAQ 2J6SA 9ICRA 3HOWH 3HOZH 3CCSA 3KHHA 1R9TH 4YP3A 1VG5A 3KYHC 4JI0L 4GNXB 1HNXL 1YLAA 1OXVA 2K5VA 3JC66 3IRBA 4JWMA 4GKKL 4DOBA 3RJGA 2Z0SA 1VQHA 5KG3A 3N4MB 4X66Q 4OX9L 3HOWG 3HOZG 3IHPA 4EZ6A 2DAIA 2R0IA 1Z9FA 3PMLA 3TAQA 1E94E 4YN4A 2UUBQ 1NTGA 8ICBA 4UAWA 4B3SL 1TXYA 2C2DA 2DAEA 1FL0A 4DV1Q 3FDSA 3DM3A 3UXPA 5J0WA 1S77D 1ZQMA 1KC8C 3EN2A 4DV5Q 1K1SA 9ICBA 3PUVA 2RCNA 2AGQA 4KLJA 1HZAA 1SL1A 7ICTA 3PUZA 2XCPA 5C4XH 4GC7A 3SI8A 4Q44A 3JAMi 1K8AC 1X3GA 4Z6FA 2RDJA 2MUTA 2RRUA 4DLEA 4DOAA 2BQ3A 2I1QA 2JNHA 5KG6A 3D0FA 5J2HA 3E21A 1NKCA 1T4GA 2ZTDA 1U4BA 3M85A 1N36Q 2Y1IA 5CP2A 3EPGA 3PGZA 4A3JH 3G6YA 1SFOH 1E1TA 3HP6A 1ZQSA 4I28A 3QEAZ 3Q8DA 2KZMA 3C1YA 3S2HH 3CW2C 1WFQA 1SE8A 5LMNW 2PI2E 3T1YQ 3PUWA 4LF8L 4YHHL 4NXMQ 1ZQXA 2DHYA 2ZJ8A 2CCZA 4ELTA 5LMUQ 1VQGA 2JA7H 5DLQE 2HHQA 3H40A 4TUSA 4A3MH 3J80i 3U4VA 1QUQB 1S0MA 5KG0A 4B3TQ 4DR2Q 4DPGA 3MR3A 4PG3A 4C3HH 3H15A 1PH6A 2JA7G 3GV7B 1WCNA 2B63G 3LK9A 5D4BA 4NM1A 4BBRH 2PNHA 3AYHB 4JUZA 1W2BA 3RR7A 3GIMA 3JPSA 1X9NA 4PGXA 5C0XG 1QVCA 2L2DA 4DEZA 4A3LG 1LB2B 2JA5H 1RXVA 4BGDA 1PH5A 5EWEA 1L5UA 4BBRG 1C7YA 1HNWQ 1WR1B 3U50C 4WJ4A 3G71A 4QIWE 4DBGB 1GD7A 2R7FA 1XMOQ 2WFWA 2JA5G 1BPZA 4XA5A 4DF8A 5AJ3L 4IO9A 9ICJA 1H95A 3RH6A 4GN3B 4IOCA 3A0JA 2K75A 4YMOA 3BDPA 4Z6CA 2L15A 2ISPA 4GXIA 2ZJ5A 7ICGA 2KENA 4GN5A 4I2DA 3RBEA 2HAKA 1COOA 1S76D 2XGTA 4JV5Q 1VQJA 4R4TA 2NVXH 3UXNA 4JWNA 4DL5A 1YI2A 1YJ9A 1IZ6A 2YTYA 1TWHH 2HVIA 4O3QA 4KMUA 5DG8A 2JEGA 3RJFA 9ICTA 3S1QH 2JZBB 2IX0A 1BKBA 4WJ3M 4FBUA 1AIPC 1I94Q 3RLFA 5KFOA 3H4BA 2OOAA 5JEAJ 3PUYA 3GFKB 3CCQA 3UE1A 4DL4A 4BXXH 4L5RC 4LFBQ 3CQZH 4KLQA 3B89A 1V9PA 1Q1BA 4PMWA 4IR1A 4QZAA 3BJUA 1YNXA 4RQ5A 3Q8SB 1Y1VH 4UB5A 5KFKA 3NGDA 3ETLA 5BR8L 3NENA 3FE3A 4BXOA 1HNZL 1BVSA 2YYZA 4QWAA 2R8KA 4MFFA 2P6UA 4QWEA 3FYHA 4H02A 4GLVB 9ICXA 9ICWA 4DSLA 2JY6B 4JI8L 1Y1VG 2IHFA 3OW2A 4X64L 4J9OA 3MABA 1N34L 2OQ0A 1FJGQ 5IWAQ 2AHOB 5KFDA 5ELOA 3HOXH 1G6PA 3PO3G 7ICRA 4IJHA 1ZMUA 4DV6Q 3C1ZA 4FDBA 1D9FA 2RHQB 5EWFA 4P71A 4OWWB 1SROA 5HGQA 8ICWA 5CB1A 4BA2I 4RQ0A 1ZYQA 2VQFQ 4OO1I 1G41A 4DK6C 2VQEL 3AU6A 1XSNA 1PFSA 2UUBL 3SZ2A 2DAKA 4ECXA 2IMWP 3ZDCA 2VNUD 1O7IA 1QZHA 2OTJA 1D7QA 1XNRQ 5GAGC 4GN4B 4ECWA 3J81c 1C0AA 1X9WA 2BHNA 2NVQH 4NXNL 2MAXA 5KT7A 2A19A 2LVPC 3OJSA 1HH2P 1JE5A 4DV0L 1JX4A 4GLXA 3K8AA 2R6GA 4RPYA 2R92H 4P4OA 1Q81C 4EBCA 1VEKA 1VQLA 5KTQA 4RT2A 1RIPA 4R8UA 4JI1Q 4QW8A 4O2DA 1KFSA 9ICSA 4GXJA 2PMZE 2VS1A 4YR3A 2OCEA 3PIPA 4DSFA 1A62A 2FPLA 4KLEA 1XSPA 4NY8A 1ZMWA 4GKJL 5HY6A 2LVOC 4DR1Q 2I5MX 3F92A 1L1OA 3BJYA 2JA9A 1HUZA 3H3VI 3LCVB 1NE3A 5J2BA 1NKEA 2E5LQ 1N56A 4LUVA 2BWBA 2W9BB 4KLLA 3GLIE 2BCUA 4F5OA 3FP9A 1K0RA 3T1YL 3PO5A 8ICHA 2PQAB 3RNUA 2HWJA 2HHTA 4GS3A 5FJ8G 2AKWB 4B9NA 2BCSA 1HQYE 1ZQFA 2JZ1A 1I50H 2UU9L 3HW8A 1JIHA 2HVHA 2Z6KA 1Q02A 4DR2L 3ISDA 2NN6G 3TQ1A 4NLNA 1LV5A 1OXTA 1ZQWA 4DNIA 5DBCA 3CPWA 2ZTEA 2W9CA 4Y52H 2PFPA 3STBC 1Y1WG 1HNXQ 3QZ8A 1WCMH 4YMMA 1R4GA 4GKKQ 4IOAA 4F4KA 3F2DA 4KLUA 3A5ZB 1X3EA 5DBAA 1TTEA 1TWCH 4OX9Q 3GO5A 1XPOA 5KFUA 2DPIA 4R71A 4A3DH 5KFCA 4B3SQ 1WCMG 4C8LA 1U45A 1SMXA 1VQ4A 4QZ8A 3GTPH 1KHIA 3KF6A 3PMNA 4A3GH 5KFWA 1Z00B 3UPQA 4O3SA 3MXNB 4GOPA 1VDLA 1M1KC 2K4KA 3AFQA 5KFBA 1E7ZA 3GLGE 3F2CA 4XTCS 1NMFA 1AE2A 1NJZA 4PPXA 1QVFA 2BCRA 3M9OB 4ED7A 2BPGA 2QSFX 4CCHA 4A3GG 4P2HA 4JI2L 4NLKA 3U58A 4IPDA 3CCEA 1IXRA 3V6HA 2C28A 1S0NA 1S3OA 3K81C 3JPNA 4DQSA 4YD1A 1V1QA 4DWIA 4RMFA 4JI5L 1TK0A 5GAEC 3G6EA 1I94L 4K0KQ 2E8GA 4F2SA 4DAYB 1KSPA 3UQ0A 4PZ8A 1QVGA 3HOUH 1RPLA 3FKIG 5CHGA 1VQDA 4LF8Q 4YHHQ 4DL6A 5EAYA 4F50A 1HR0L 2PFOA 3QEBZ 3J7A5 1Z47A 4Z6DA 2JA8H 4TQRA 1VQNA 5J0PA 4P74A 1AH9A 3HKSA 1PV4A 1IM2A 4ECYA 3AEVA 3HOUG 4OWXB 2OO9A 2MQHA 3OJUA 2OQKA 2FLPA 4MNOA 1ZQTA 2NVYH 3RAQA 5F9LA 3TEHB 2PI2A 2JA8G 3W1GA 4UP8A 5HHIA 4X65L 4FS1A 4DR7L 8ICIA 4QZCA 3V6JA 2PFNA 3NELA 4UAZA 3RRGA 2CP8A 1GVPA 3H0GH 4J15A 4P72A 1KEJA 1FJGL 1T7PA 1NOMA 2C2RA 1ZQKA 2QEXA 3ULPA 3RJIA 4RPZA 1BPDA 2K0BX 1I3QH 4TVAB 1Q7YC 5D49A 1NKBA 1G291 4IQWA 5KFZA 4G3IA 4BY1H 1EIYB 1VQCA 4M04A 2ZJQA 2F1JA 5AJ3Q 2M9NA 3PR4A 4ELUA 2IT1A 1IBMQ 1L1OC 1HZ9A 2AQ4A 1PA6A 1IBKL 3S16H 4XUSA 4M9JA 4BY1G 1WYDA 2Y1JA 1NK8A 5IP9H 3GTJH 1IYJB 1S9FA 3RB6A 3B6YA 4I27A 1DGSA 3J7ZC 1GO5A 1UT5A 4J9LA 4RQ3A 4F5NA 5M3MH 1UA1A 3S1MH 4UAYA 3SV4A 5J0UA 2UXCL 3I56A 1K9MC 4EYIB 5IP9G 1KIXA 1JJCB 3J81i 3S24A 4AH6A 4JI6L 2K5HA 4X62L 4GC6A 5KG5A 5J2JA 3Q8KA 5M3MG 2AMCB 3QZ7A 3UDIA 1Y8GA 3S15H 1ZQCA 2I0QA 5HHHA 3I7FA 3RJEA 4TURA 3LWMA 3TQYA 3CCVA 3ZJYC 4OONA 9ICEA 3H8WA 3MR2A 4QZEA 4A3FH 8ICNA 4BDPA 3G4SA 1DO2A 2KCMA 1K3RA 1UFZA 2LYHA 2BQUA 2OTLA 4GLAC 4A76A 1P8LA 4I2AA 1HNZQ 1E24A 1ZQUA 5J2DA 4A3FG 1LUZA 1NK6A 2W9AA 5L9XA 1ZQEA 3LWLA 5JUMA 4X64Q 4MFAA 3E2EA 5KT2A 1N34Q 1AROP 1KTQA 2LVAA 3MEFA 3KDFA 4POFA 9ICHA 1EFUB 4IFDG 4RQ1A 3OTOL 4HJAA 1LTLA 2N78A 3CD6A 3PW7A 1CSPA 8ICRA 3NEMA 3I4MH 4HYKA 3M8SA 2HT1A 3KJPA 3BU2A 1WCLA 3RLNA 4JV1A 1EWIA 5DG9A 2VQEQ 1T6OA 3T1HL 3B0YA 1PYSB 2JEIA 1U49A 3I2ZA 4KLFA 5GADC 4I2CA 4IRCA 2OOBA 4YG2A 3I4MG 1HZCA 1S40A 4KLHA 4UP9A 1VQ8A 3BBZA 4NXNQ 4A75A 3UQ2A 1T9HA 1KQSA 4O3OA 3M8RA 3RLOA 5D46A 2HQLA 4DV0Q 2VY3A 2UXBL 5KFAA 2BCQA 4I2BA 1A8VA 8ICEA 3KLWA 5KT4A 4J9KA 2EQSA 5KG7A 1VQIA 2QGQA 5KG1A 1ZQJA 3CCMA 2KHHA
chains in the Genus database with same CATH superfamily
3CF6E 1QAOA 2B0CA 2L6OA 4NPSA 2O5IC 2APLA 3SBJA 3NRZA 4YCVA 2WZJA 4Q7JA 1YZ6A 5ALXA 4K0KL 3ISBA 3ORYA 4HCSA 3TADA 1AW7A 4LJAA 3C23A 2MGSA 1M90C 4JI0M 1B43A 2F4VL 1HNXM 1H9SB 3KLSX 1J5EL 2JEBI 1N5XA 3CNHA 4QWBA 1K8MA 1CA6A 2ASLA 3GLIA 4H0LC 4B3SM 5ALQA 1XU4A 1L1OB 5CRXA 4K5WA 2F3VA 5HGTA 3TL4X 2WTFA 2EYOA 4J9SA 8ICSA 3GP1A 3UMCA 4AG6A 2D62A 2PFQA 2J4XA 4GFJA 4CF5A 1R6BX 3AMUA 1IBML 3T38A 5KNCA 1QTMA 3E9HA 5ITXA 2XFSA 2K60A 3MDCA 1JJ2A 4F4YA 4NLCA 1MX0A 1H6UA 1F9SA 1ZQLA 3F2BA 4YHHM 1S0OA 2R65A 1O80A 4YFKA 5CC4A 5KL1B 3Q8PB 1R4PB 9ICQA 3PY8A 4KD3A 2MNAA 2UVWA 3TDQA 1RYUA 4PZOA 5DDMA 3GLFE 4M9LA 4IUVA 5KFIA 1ZD5A 2CEAA 2WV6D 1WWUA 2F0VA 4KLGA 1JR3E 3ZCBB 1SXTA 3VYRA 1CI4A 4JG2A 3LX0A 2XCAA 1GKIA 2Q8IB 4GNXA 2DZNB 4DFKA 9ICPA 4M47A 1QUTA 2V1CA 4X65Q 3FTDA 4A3KH 2HCFA 1D5ZC 1QCBD 2O2LD 4BBSH 2FOIC 1JRPA 5C18A 3SV3A 4JC0A 3C58A 1R4QB 2NRXA 4A3KG 2F1IA 4FXDA 3E9IA 3HHZA 4M9SA 2YTXA 3T16A 4BBSG 3AL0C 3K9PA 5G3LF 3AM9A 1O03A 4RU9A 2IY5B 3A74A 2LHCA 3PVSA 3HPOA 5J0XA 2RLTA 2KCTA 3VDUA 2BDNA 3N97B 4YY3L 1IBKQ 3ERSX 2YB4A 1XTDA 1U4MA 4K14A 1L1ZA 3MGIA 4DNTB 5M5XH 2UXCQ 4CDEC 3TFSA 5ITUA 5EXTA 1HUNA 1B8AA 3M4OB 4BWMA 2Q2TA 4UDUC 2ASDA 9ICFA 3KBGA 1ZMVA 2FJ6A 2KHQA 4JI8M 4LNQA 4A93H 4NL9C 5J22A 4F88A 4QUFA 2DQNB 3SDZA 4G3OA 1J8IA 1L2DA 1H9RA 3E4RA 3PSPA 4Y2JA 3VR2A 4A93G 4O3NA 1E0BA 2YV5A 3A8IE 4EX5A 1OQYA 3AU2A 1ASZA 8ICPA 2UUCL 1EZ8A 5ALYA 1BUVT 1XB2B 2NZOA 2YU9B 8ICOA 2ODGA 1B4FA 4KMUC 1ET9A 1JXEA 5JAVA 1A5TA 4FS2A 3VR4A 4Y7NB 4YD2A 2Y0QA 4A3DG 1K8GA 4OO1H 3GRVA 1I6VC 4GKJM 3C3EA 1ZQBA 5DB7A 5KQ8A 3VYTA 4OO1G 5K4LA 3MFHA 4HN7A 2ZUCA 3T1YM 1Q3CA 2K4IA 1JROA 1N78A 4LFCQ 3HKZC 2UU9M 3I8ZA 4M2YA 1B70B 3I73A 1FNNA 4MZ9A 2XN9C 2AH5A 2DWMA 8ICUA 2CW0C 3L29A 3H3VH 1W5SA 2HBJA 4PNYA 2D0OA 2JQOA 2BPFA 1L3UA 3NWLA 2JA6H 2IHNA 1N33Q 3WOEA 3S1RH 2L0CA 3T5HA 4DQPA 1BF4A 4ECZA 2JRZA 2EYJA 1WD1A 4B9VA 3Q8XA 1XC9A 3K2LA 1NUCA 1DOLA 3F2UA 3SHFA 3SD7A 3TBIB 4DV3Q 4YWMA 1PJSA 3BDLA 4IZ8A 1TU2B 4MN3A 1EOVA 2B39A 4AP9A 3H0GG 3HOYH 1JOOA 3HY5A 3WKDA 4JI2M 2KBNA 1TR8A 2BKEA 2B8GA 3GRRA 4B7FA 5KPZA 3HOYG 2IOFK 2XF3A 2JJQA 1OXJA 1LV9A 4XQ8A 3QOJA 4JI5M 2FE8A 1UA0A 3DUZA 3ZQJA 1FO4A 5C4JB 2NRTA 2EYPA 2HIXA 4N8X1 1IM4A 4DR6L 2C99A 1LTMA 1U47A 2WB1E 3KOJA 3QG1A 2JEAI 3HS0C 2XSZD 8ICLA 1C20A 4R8IA 2WKDA 5HR6A 3PUXA 5C5JA 7ICQA 3IKJA 1CKOA 1QNKA 3K0XA 3NTIA 3M6AA 3A54A 3GV8B 1YUBA 3C5FA 4LF9L 3GTKB 1A15A 2WFAA 2B2VC 5KFGA 5EWGA 4AQYL 2VW9A 1VQMA 3GPYA 2HHHQ 3B7QA 1X56A 2HMXA 4EEYA 3RB4A 1Z00A 3U9OA 3MXNA 5KQDA 4ECRA 1B2TA 3T3FA 1D1IA 1DGFA 1IXRC 4ILWA 1ZD4A 4O9MA 1JJGA 2HKJA 5JEAG 4MTNA 2KEYA 1F2LA 1KQQA 3T6PA 1TT2A 3H8JA 2XI9A 1AP0A 1ESRA 3BOSA 4JI6M 3BZDB 1Z5AA 3L3FX 2C2EA 5KFPA 3DFZA 2CW0D 3Q8RB 3NVZA 4P0QB 3EYZA 3GTLH 3GQ4A 4LF5L 4MFCA 4EGVA 1AN8A 1BNOA 2E8NA 1EIGA 3HOWB 3HOZB 2KJ8A 1VQPA 1A63A 4EQOA 4IBKA 1E3PA 1HFNA 4L78A 4DR5Q 3ICXA 5CV7A 3M4QA 1T3QA 4LF7Q 4IBGA 3ILKA 3FDTA 1GUGA 2ZXRA 5CR3A 3NWTA 3UGJA 1DGHB 1SNMA 2LXEA 4LZDA 1GO3E 1MQ3A 1N77A 2A6HC 3T56B 4B9SA 4JI3L 4QIWC 5KFMA 1NJWA 2P6RA 2CVRA 3V7JA 4PZNA 3P75A 4ICAA 9ICNA 1F9RA 3SHLA 4ED3A 4B3MQ 4DCCA 2QKQA 3UJNA 2PKEA 2K4EA 2VIXA 5NUCA 4P16A 1ZQQA 2KVSA 1BBXC 2V9WA 2RDHA 1PVQA 2MO0A 5CA7A 1NNLA 1K3XA 2W9CB 4Y28F 4A3VB 2KCNA 3Q8MA 2H3VA 1G4AE 2KIVA 4FWHA 4QZHA 4LMQD 2ZM6L 1F4IA 3H94A 5DG7A 4LZZA 2RGOA 3LWEA 4C3HB 3SASA 2ASJA 3HJEA 2N8NA 4IFDJ 4DKAC 9ICAA 1WTHA 2K03A 5FTKA 1E9RA 1VQKA 3RAXA 4R4OA 3R9XB 1QAQA 4ZUIA 5JJZA 5EJWA 2JY5A 3JAML 4AYBE 2EANA 3VK7A 1KAAA 3QU9A 2B2TC 3AMZA 3L2PA 1Q3LA 7ICHA 2PW5A 3QU5A 4ZKBB 3U26A 4ECVA 3SK4A 1NY5A 1U9LA 1TK8A 3A0HU 4RF1A 1HQMC 3RGPA 2BR0A 3M4OH 3PO3H 3BQTA 3FEWX 3D8LA 4BUGA 1SDFA 1VQFA 3MBYA 1NJFA 2QQ8A 1V97A 2KFNA 2YR0A 1ZQPA 4K4GA 1A2TA 2A73B 2B2WC 1UEBA 1PHJA 2RSNA 2HSZA 1EXNA 2XO7A 4RCNA 5F2DA 2L4EA 3PF4A 3QNMA 4DQQA 1Y1VB 3RFWA 3GRYA 1G2SA 1JT8A 1MI2A 3KP1E 1LKYB 3GRUA 4P75A 1U48A 1CQVA 7ICOA 1WJ7A 3LNNA 1XC8A 3KFUF 4JI4Q 4OJOA 2YU9H 7ICEA 4IBDA 4FCTA 4DL2A 2HCCA 1UWVA 1SYDA 4JBWA 3FTCA 4Y7NH 3PR5B 1S72A 1PDQA 3HT3A 2KNJA 2FNAA 4KLOA 1ENAA 3QIAA 3MVVA 5A2QL 4AKHA 1BBWA 4XRHA 3X3NA 2D0PA 1IFYA 4UQGA 2NN6H 2NYVA 3H91A 3RN2A 4FF2A 1NK0A 2JK8A 5KG4A 4NP5A 3M7NA 2ZANA 3V7KA 2HOFA 5AIAA 5KFTA 1ILQA 3KOXE 1V92A 4DAMA 4JI0Q 2BDPA 4KHPQ 4B3RQ 2ID0A 5AK6A 1M8AA 4DR3M 3KBXA 2UUAQ 1HNWL 2K1BA 4YIJA 5L1IA 1L0WA 1OXXK 2BOSA 4QF4A 4DS4A 2E2IH 2NRZA 1K3BC 3ZDAA 2H5XA 4DFPA 1Y1WB 1K1QA 3C2LA 2B21A 4ZLTF 5AKJA 5DM63 4I2FA 4AIMA 2KNAA 1SXEA 3EW9A 4KN4C 5KPTA 4LF6M 1TWCB 3J80c 2BH8A 1CZGA 4RQMA 2DVWB 4UBCA 2KVMA 2E8MA 4JOIC 4CBVA 5C6AA 3CC7A 3GTPB 1X3QA 2WINB 3RB0A 4A3GB 1B7YB 4LFBL 4USAA 2QDLA 4UBBA 2FHTA 2KKPA 5C4JH 1QJOA 1XMQM 2Y21A 4ED8A 2KN7A 3URYA 2MROB 1KXLA 2W8LA 4FF1A 3PX0A 3SC3A 3C5GA 3AN1A 5J0OA 3JAME 4BS9A 5LHY1 3GDXA 1NK9A 3U61A 5KFEA 3W3AA 3FKIB 4I7AA 2IA6A 3D31A 2HL7A 1U4PA 4JVZA 2F0OA 2WACA 1DGBA 2DUDA 5GROA 3SAUA 4Q43A 2BCOA 3KF8A 1XNQM 1TGUA 1JOKA 4H7BA 4KO8A 3N7SC 5EPJA 2G07A 3C9PA 4GITA 2RQXA 1SRUA 2GVAA 2VL6A 1T3TA 1A77A 2LBCA 1TVAA 4RNOA 3BQ2A 2HHWA 1XNSA 4O1NA 1CKMA 4LUZA 4BY1B 4Z6EA 4LZJA 1WTXA 4DV4Q 3C2KA 2NRVA 4EBDA 5EQ0A 1ZQRA 1EL0A 2PO4A 2BE5C 4HTHA 4OO1J 3L25A 3C21A 2VANA 3ONNA 1L2CA 2L4FA 1CKNB 4JI8Q 5J0TA 1A2UA 4JYAQ 2J6SA 9ICRA 3HOWH 3HOZH 2KG5A 4YP3A 5A2QE 1YLAA 3KOYE 5AM3A 1VQHA 1LTTD 4X66Q 4OX9L 3HOWG 3HOZG 1PRTB 1JQJC 1NR4A 4YN4A 4REZA 2EY1A 4A3FB 3G6JB 3FDSA 3UXPA 3VA5A 4KX5A 1KC8C 3EN2A 4S12A 4AG5A 2AGQA 1SL1A 3WHLA 3CP8A 4GC7A 2UXDM 2R4JA 1K8AC 4PMCA 2CV0A 2RDJA 5EQTA 2MUTA 1PZJD 4ANRA 5J2HA 1U4BA 1BR9A 1N36Q 3KXEC 3EPGA 2Z6BA 4A3JH 3G6YA 1SFOH 1E1TA 3Q8DA 2VKQA 3RF9A 3AB9A 3CW2C 3I70A 4OVZB 1SE8A 2PI2E 3T1YQ 4LF8L 4NXMQ 1ZQXA 2EDUA 3M7GA 2LY7A 3K6OA 5K5PA 5DLQE 3J80i 5KG0A 2AUKA 1XWEA 1DXSA 5DYGA 3W2DA 1NI3A 4PG3A 4C3HH 1WCNA 4CF4A 2PNHA 3AYHB 3THGA 4JUZA 1TDHA 3RR7A 1CRXA 3J7AS 4C3HG 1LB2B 4ID6A 4BGDA 1TS4A 2A6EC 1B53A 1XMOQ 4CJ1B 1A3UA 1IQPA 1PLFA 4A3MB 5AKLA 3A0JA 2L15A 3I4VA 2Y0TA 2KP7A 3K5OA 4GN5A 4MGYE 1COOA 4R4TA 2NVXH 5G5GA 2NO5A 2YTYA 5CV5A 3R8FA 2BE5D 1O7YA 4LJ5A 3VKGA 3PQIA 1BKBA 4US8A 3RLFA 5I6WA 2F0MA 5JEAJ 3PUYA 4IQZA 4DL4A 4UAVA 2K5WA 3IN5A 1V9PA 2DXIA 4PMWA 4IR1A 3B9PA 3BJUA 1BCPD 4MHEA 1Y1VH 4ZPXA 4UB5A 2DNEA 5BR8L 3NENA 3FE3A 1HNZL 1BVSA 1C4QA 3EA6A 4QWAA 4RH6A 2F76X 4H02A 4DSLA 2JY6B 1Y1VG 3H6MA 4JI7M 5AM2A 2OQ0A 4U68A 5IWAQ 2MA1A 4GZYC 4DV6Q 2LM4A 4OIKA 4P71A 1SROA 3GLHB 4RQ0A 4DK6C 1EZ6A 2UUBL 2HBLA 4NSRA 3LW5F 2OTJA 1D7QA 1XNRQ 4GN4B 2BHNA 1QDTA 2NVQH 3Q6SA 4NXNL 2LVPC 3OJSA 5GTIU 5CMDA 1IXSB 2VJ4A 1JX4A 3K8AA 2R6GA 4P4OA 2HOIA 1LTSD 2DJGC 2H3QA 1ORYB 1VQLA 4IN3A 2K6AA 5KTQA 4UB6U 4O2DA 9ICSA 4GXJA 2PMZE 4S3SA 3HOXB 1E9SA 2OCEA 1A62A 1KKXA 4KLEA 1LLRD 4DUYM 1QQ5A 4NY8A 2WKCA 4OIJA 2ZXPA 2JA9A 1HUZA 1SWWA 2E5LQ 3C3DA 3GLIE 4F5OA 1RF2D 1SGGA 3PO5A 8ICHA 3KKAA 4GS3A 4NKLA 2AKWB 3L5KA 1AEXA 4LGMA 2R92B 2X6LA 2WF6A 4DR2L 1OXTA 4RA8A 4RQNA 3STBC 2RKSA 1JR3D 1Y1WG 3QZ8A 4GKKQ 4KK7A 5D3DA 4DV5M 5DBAA 1PVPA 1TWCH 4WRDA 4WURA 3VYSA 4R71A 2SNSA 3CTWB 5KFCA 2EUCA 3GTPH 1SMXA 3NQTA 4QZ8A 5ITXE 4A3GH 3PFIA 5KFWA 4KN7C 2NV3A 1X42A 1I6HB 1QE6A 4A3GG 2QSFX 4P2HA 4NLKA 1A6SA 1EE8A 1R2ZA 3V6HA 2C28A 5ALVA 3JPNA 2B2UC 5LMUM 1ED1A 1I94L 5ALJA 5ELBA 1NHGC 2D7GA 3EROA 4DAYB 3SMSA 2F4IA 4IUNA 4B3TM 3FKIG 3GQBA 3NVWA 1GJSA 5CHGA 3BXWA 5EAYA 4W5WA 1HR0L 2KECA 3QEBZ 1E2VA 4Z6DA 4TQRA 1WVLA 4G9BA 5EE3A 1PV4A 2QW7A 1DXMA 4OWXB 2JXMB 3MHBA 2OQKA 1ZQTA 3RE8A 1SYBA 3TEHB 3VK8A 5ITTA 4C1NI 1STEA 5HHIA 3UMMA 4DR7L 4QZCA 2PFNA 1B0XA 1R2YA 1GVPA 1FJGL 1KEJA 1NOMA 3ULPA 1RCVD 4I4LA 4TVAB 1TWFB 1NKBA 1G291 4K5VA 4AKIA 4G3IA 1PTOH 4BY1H 1VQCA 2WB1C 4C4RA 5AM4A 2M9NA 3PR4A 3NTKA 5ALKA 1TDZA 2G5GX 4BY1G 3SEIA 1WYDA 2JV3A 1WG8A 3B6YA 1D2NA 4I27A 1DGSA 1GHJA 4C3JB 3I56A 1K9MC 2QBYB 1KIXA 4AH6A 1I3QB 1VMPA 5J2JA 3QZ7A 1ICFB 1Y8GA 3DEOA 5HHHA 1EIJA 4CGZA 2F5OA 2RDFA 4TURA 3TQYA 3CCVA 3M0EA 4IUUA 1ZXIA 4G57A 4M1UB 4A3FH 5AKKA 2GO7A 2M00A 1UFZA 3WK6A 5C5LA 4A3FG 2W9AA 5L9XA 2EAPA 3KDSE 1ZQEA 4X64Q 2G5IB 2LVAA 3CKIB 3KDFA 2L1BA 9ICHA 3D6CA 5GKNA 3OTOL 1LTLA 2N78A 8ICRA 2ZIUB 3QU7A 1GJTA 2YX8A 1EWIA 1T6OA 3T1HL 3NXWA 3B0YA 1PYSB 2W3SA 1U49A 3I2ZA 1NNJA 5GADC 2DN8A 1S40A 3WKEA 4ODGA 1VDVA 1T9HA 1KQSA 4LJ9A 4IL6U 4B9XA 5ELFA 4FVMA 2OYYA 4FZMA 8ICEA 2QGQA 1ZQJA 3W67A 3FVQA 3M3YB 2KHHA 1WTPA 2RP5A 4EVOA 9ICGA 5JJLA 3I4OA 2NZHA 9ICUA 5C4XG 4FE3A 2HCBA 4EQNA 3MFIA 3H8MA 2KMDA 3W5OA 4G7ZC 5G5HA 4PT5A 1L3VA 1KD1C 1L6NA 4J9QA 2XY7A 2G9DA 2YNMD 7ICIA 3A45A 2LYAA 4A3MG 4EBEA 3HG9A 3ONAB 3K7AB 1Q8KA 1Q86C 1QG7A 2HD3A 4HIKA 1Q82C 3J2PB 2KEEA 3L27A 4LUOA 4M9HA 2WAQE 1LV7A 3RRHA 1OJLA 3OHXC 3T15A 2V4RA 3AQEA 2HCIA 3CC4A 2RRDA 2R8JA 3UM9A 4F72A 5FO9B 2IX1A 1JE4A 1E22A 3I55A 3HEJA 4AYBC 2FFKB 4RQ7A 4G7OC 1PXUA 4HCEA 3KHRA 3OPOA 4Y2RA 4HLQA 5JPMC 1HA6A 1SV4A 1K8OA 1B3AA 1SXJA 1ZAEA 2BA0A 4QL5A 3MMPA 1S5LU 1PYBA 1JWUD 1RTOA 2QP9X 1QSYA 3E3XA 2EJSA 4DS5A 2EKFA 4DFAA 2Q4TA 4RG1A 3TP6A 2J6TA 4F2RA 2F0FA 3SR1A 2NBFA 4PMBA 3RJKA 4CJ6A 3H7IA 4U7CA 1ZETA 1SL2A 3DXJC 1BGXT 1SYFA 1SKWA 3UE0A 5KL8B 5IIOA 4F4XA 1NJIC 4GHAA 1DZ1A 4KD4A 3HOXG 5KFNA 2FFJA 4PZ7A 3PO4A 1IN5A 2DUYA 4IQTA 2ZJRA 1KLGD 1C1KA 2OWOA 2DFLA 5IIJA 4KLSA 2VA2A 1X9MA 2C35B 2CKZB 4L5TA 2J0TD 1PJJA 3TMEA 4DF7A 3SYZA 2O25A 9ICLA 3S14B 3OTQA 9ICMA 3GV3A 2XY5A 3RBDA 3T4AC 1LTGD 5HMLA 4Q8FA 5AKXA 2R92G 4MF8A 1L7NA 4X62Q 2DAMA 3OPXA 3U6DA 1RZTA 4LY6A 1LTRD 3I04M 2W03A 2ALZA 4HJ8A 2NB0A 2WF9A 1NO1A 2EAOA 1N32L 5EPLA 3S9WA 4DR4L 1N34M 2V4DA 1QILA 2UXDQ 3R2TA 4YR2A 3I90A 1I6HH 1HZBA 2CN1A 1OXSC 5F9NA 5EXXA 1QZEA 1BBUA 2TMPA 2VQEM 4UB4A 7ICVA 3K7UC 2CWAA 5E3FA 4DQRA 4IUPA 3NQIA 4A3IH 4ZCKA 1T8EA 2F77X 4FWGA 2YY6A 1EU3A 3BS5A 4R4QA 4UB2A 4DV0M 1B22A 1KRTA 5L8RF 5HMMA 1OAIA 3HU3A 5GTHU 2BH2A 1MJEA 3D4WA 1JWSD 2X4AA 3K4GA 2BDUA 2Y0SE 2ZAMA 4J1MA 2UXBQ 4O3RA 4E0DA 1FFUA 4ED2A 2L11A 2FPKA 3NSWA 2LXJA 4A3CH 2Q2IA 2R62A 2A69C 1Z7TA 8ICJA 2KZZA 1D1KA 4A3CG 4YWLA 1TWFH 3M6KA 1PH7A 2R46A 2K5NA 1EQQA 4D80A 2K9DA 4IBEA 3GV5B 1EYCA 4PGYA 2P5TA 2LVQD 2F4VQ 1J5EQ 3SR6A 3IG5A 4PDGA 2B2YC 2VJ5A 5JJIA 3AL0B 3ND8A 3FM9A 2X6GA 4QNLA 4F5RA 2FMPA 2MGWA 2QEJC 2ZAOA 3NVVA 4C3JH 3PNVA 2GWSA 5AHXA 5ELCA 1UE7A 1ZQZA 3CMAA 3BQ1A 2RDIA 3D4RA 5E6JA 5FLXc 3NS1A 4C3JG 1S97A 3U5ZA 4QW9A 2CHQA 1UPHA 2VF8A 4RF0A 1WTRA 2AXTU 4DV7L 2J7ZA 2BQRA 4P0PA 4I81A 4QWCA 3L2AA 4F1IA 3BVMA 2R93B 5IYBH 5FK9C 3O13A 3M1YA 4A3EB 1WUDA 3RZDB 1LT5D 1QZMA 3JR4A 1Q46A 3SYKA 2QARA 2W9BA 3FHWA 3ULJA 3HHXA 1LABA 2KJ5A 2PQAA 1SLJA 4F8MA 2KRKA 1SYCA 5ALPA 1CTMA 1HJPA 5ITRA 2FLNA 4Y2VA 1SB3C 4X65M 1WHCA 5M9OA 1JI7A 5KFXA 3LMMA 4HSPA 1SN8A 2ZUBA 4GOPC 1VQOA 1I4RA 4R8NA 3GQ3A 1AZPA 1NNUC 3ZDDA 1UE5A 4DUYQ 3GTGB 9ICCA 1ZYRC 3M3YH 1VQAA 4FZLA 1JORA 2DGYA 1ZQHA 1IBKM 3VDYA 3PSIA 4A8EA 2A69D 4DL7A 7ICUA 4YR0A 2W04A 4BXOB 2UXCM 4LGYA 4YY3Q 1PJQA 1GL6A 3HKZB 3CRKC 4N9TA 1SKRA 5DBBA 3F53A 2E1FA 4NLBA 3OYYA 2DL0A 4II7A 2PI5A 1HTLD 1FR3A 2AWOA 5KFQA 4NB3A 2MO1A 4I2IA 4NSOB 5J2GA 2FLLA 4ELVA 2B2WA 4XK8F 2IHMA 1R9TB 4O42A 2KNZA 3F8TA 1IY1A 4LG2A 2KXEA 2RHSB 1N9WA 2BWEA 4KLMA 4L15A 5KFHA 1NK4A 2FH0A 4R8UB 3JPOA 2RCFA 2DI0A 1N63A 4EYHB 3MGHA 1O7LA 3AJIB 4R3DA 2MUYA 3E0EA 2A5YB 1IBLL 2B63H 8ICTA 3FUWA 4M0WA 3S1NH 2AU0A 7ICLA 4A3LH 4OWTB 2KRUA 1P7DA 2LVNC 2R8IA 4BBAA 4LJ7A 5ALGA 2N1RA 4HJ7A 1STYA 1OO9B 4KHVA 1RKNA 2MR9A 5EBCA 5AICA 4R7GA 2K4HA 3AOEA 2CRXA 2CHBD 1U0LA 2EJMA 4XQNA 4LFCM 1PK1B 3PX4A 1TAUA 4D82A 3BS5B 1SNPA 3ER0A 3PW2A 1Z6TA 3DA1A 3OSNA 3I72A 3RTVA 3KF6B 4HR7B 2XVTA 2QNJA 8ICCA 3TANA 1V33A 1ZYRD 3I76A 2I7NA 3EUB2 5KGUA 2KHIA 2XGQA 1N33M 3F5EA 2YB1A 3U60B 4DOCA 1JOQA 1G6ZA 5BOLA 3SE0A 2KW0A 5TZVA 2LMRA 4JBKA 3JPPA 2Z4RA 4C2MB 2HHVA 4BWJA 2LSSA 3QJYA 2K32A 3B7ZA 1PJTA 2UVVA 3S14H 2YMPA 2GQFA 2NTSA 1VCIA 3K59A 1D8LA 1RHPA 2N3SA 1Z3EB 4QZGA 1HUMA 4RQ6A 4A4IA 2JYOA 1GO3F 4HIMA 2YMLA 2LYBA 1IKMA 4OGQC 4NMZA 3S1QB 3J80L 5DB6A 3NBIA 2CV1A 4UB3A 4CGYB 3T53B 2PMZC 2I07B 5EP3A 3CQZB 2IW3A 1K83H 4UPAA 4J9RA 3TADC 2WP8J 2FDRA 4DV1L 3KFUG 3BDOA 4DR6Q 2EPBA 3CMEA 5JJKA 1NK7A 1C9OA 1JC7A 1K82A 1VQ9A 4RGMA 1UAPA 1V1OA 3F5AA 2OM6A 2RA4A 1NV8A 5BPCA 5A35A 5AI9A 2VZAA 2KIWA 4LWCA 4BJQA 1H9SA 4IPGA 3T5JA 5AI8A 3D8GA 4ALPA 1SZPA 3EIVA 4QIWB 5IGBA 1GUNA 3H09A 3W68A 5CJ7A 2EAMA 1Y69U 1CK1A 2TSSA 1TF0B 4LF7L 2KEBA 4PGQA 2HHHM 2DZLA 5EE0A 1M6YA 2VA3A 5FJ8H 3CCJA 4LF9Q 1EIFA 3PVXA 4POGA 3V72A 2J7OA 3DLLA 1ZQGA 2BNKA 3MK6A 4O0AA 4UAUA 4MHVA 2F3NA 3NE5B 1RM6C 5EOZA 5ALOA 1EUJA 4F8RA 4EIWA 2R7DA 2D6FC 4XBOA 2F3IA 1I4XA 2EE1A 2H3IA 1ZJNA 3CCLA 3BYTB 3A55A 1KDCA 3U6SA 3FUVA 1VEGA 4RGTA 3ICEA 4XIGS 5A2QS 1OW5A 1XO1A 2HDMA 1CI3M 1KFDA 3B0XA 1FIQA 3RR8A 4R66A 4GNXC 4DR5M 4O5KA 5LMNM 5E4XA 2XGPA 2V1CC 4JV5L 2JH7A 1JMCA 7ICJA 1L3TA 5IODA 3SVMA 1HA5A 1XPRA 1ASYA 1PH3A 1WCMB 3NBXX 2R4EA 5F3XB 1MN8A 3O0FA 3JPTA 8ICMA 4K4IA 2A3VA 2QZ4A 3MTSA 1C8CA 2H1RA 2X8AA 5FO8B 1UM8A 2UVUA 1SYEA 2HHUA 1R5LA 4IR9A 3QXGA 4OHJA 4B3MM 4IFDI 4NLGA 4RHRA 2P66A 3RZDH 4JI3Q 1X40A 3AQQA 2R93G 5J8YA 2IOFA 4A3EG 4LF4M 1NY4A 4DNRB 2A1JB 5KFSA 3RJHA 4HAIA 2EVBA 3AUOA 1X55A 4DUZM 4KLKA 2W3RA 4QZ9A 2EJFC 5DQGA 3T13A 4B9WA 4FCWA 2VQFL 2PPBC 2CQOA 2JA8B 2W9MA 2ZM6Q 3PW4A 3SK6A 3TWMA 5DYIA 3GTGH 3TWKA 8ICGA 3J80E 2OPFA 4KV6A 3OW7A 1UQVA 4DSIA 2F2AB 1YEZA 4JI1L 1U4LA 5EKKA 5FLMH 2KA7A 2XH9A 1NNXA 2E76C 4X3TA 3K1ZA 3D4DA 1Y14B 4XQQA 4DR1L 3F1ZA 1OKSA 1HQCA 1YBYA 1V85A 3V7LA 3GLGB 5FLMG 4M9NA 4KTAA 5KAFU 2IL8A 1STAA 3JPQA 4IPHA 4R65A 2EO2A 1TY2A 4DGZA 3KP0E 2XRQD 2FMMA 3HKZG 2E2JB 5AKZA 1BPYA 1F9QA 1PGYA 2E75C 5KRUA 3BS1A 3U6EA 3K5NA 3CCSA 1R9TH 3SENA 4JI0L 3NVYA 1HRJA 1HNXL 1OXVA 3JC66 3IRBA 1GLNA 4JWMA 1S3SA 4EZ6A 3L3OC 3PMLA 3TACB 4B3SL 2IOHA 2OHFA 3A42A 5HURA 4OEMB 1FL0A 4JI4M 3DM3A 1KFVA 3N7PD 3JR5A 1ZQMA 3AU7A 4Z9CB 4KLJA 4U6PA 2LPEA 3SHGB 3PUZA 5E26A 3QWLA 2EY5A 1N75A 2RRUA 4DLEA 2D7HA 2I1QA 2JNHA 1EOTA 2ZIXB 4R9WA 3E21A 1YZ7A 3DV9A 2ZTDA 1NY6A 3A8KE 5CP2A 3EQLC 3R9KA 2HDOA 1WFQA 5LMNW 4RHSA 4YHHL 2DHYA 5CV6A 1MSGA 1UUPA 4KHPM 4B3RM 2HHQA 2WAQC 5COYA 5ALRA 1QUQB 4ZK9B 4KODA 1KN5A 5C0XH 1K28A 2UUAM 2ZBKB 3LK9A 1EY0A 4NM1A 2OQ4A 1BDOA 1ZOLA 1X9NA 4PGXA 5C0XG 3D8BA 1J7KA 1RXVA 1PH5A 1EY8A 1QAMA 1TWAB 1C7YA 3MXUA 5I9PA 1HNWQ 3S2HB 4XDXA 3DEPA 2WFWA 1SSOA 4DF8A 5AJ3L 2XVSA 4GN3B 5BN4A 1MU5A 1SIJA 2JXJA 2ISPA 4K6LA 2ZJ5A 7ICGA 2KENA 2KOLA 4BY7B 3UZUA 1VQJA 4JWNA 1YI2A 1IZ6A 3U6OA 4ULLA 2LHGA 4HAEA 3BG3A 1II3A 2QLTA 4K8IA 2JEGA 3RJFA 4GMQA 9ICTA 3S1QH 1D5MC 2JZBB 2IX0A 1UHUA 1BNPA 1TH2A 1S5FD 1EY5A 3WKBA 1JICA 3UE1A 1STNA 4L5RC 4LFBQ 4XQJA 3CQZH 3SYLA 3C2PA 4KLQA 1Q1BA 2PQEA 5EKLA 4QZAA 3QR8A 3CU7A 1GUWA 5KFKA 1IYUA 4AW4A 4L8JA 4GC9A 3ITPA 2KE7A 4G4NA 2P6UA 1SEBD 3DDHA 9ICWA 2VXWA 1PK3A 4JI8L 2J5YA 3L9AX 4J9OA 3WDNA 2AHOB 4EQPA 4IJHA 1ZMUA 3C1ZA 4P0QA 4OWWB 3WU2U 1ZYQA 4OO1I 1G41A 2Y9UA 3K58A 3AU6A 2PNRC 2DAKA 2XGNA 4ECXA 1QDRA 5E4WC 1IG6A 3LQQA 2EH9A 5GAGC 1SV0A 2JR5A 3J81c 1C0AA 2JXNA 1X9WA 1DM0B 2WIIB 2MAXA 2A19A 2RQ5A 5EXPA 4QOZC 1PMRA 3ALRA 2AQ1B 1Q81C 1VEKA 4RT2A 1RIPA 4CDFC 4DV4M 4QW8A 3QUCA 3P1HA 1DGHA 3C29A 1NHWC 4GKJL 5ALMA 4NJ8A 2I5MX 3H3VI 2NWGA 5J2BA 1N56A 4LUVA 2I46A 3HHYA 5ELEA 3D2QA 1K0RA 3T1YL 1NAPA 4JYAM 1CT1D 3DWPA 3MC1A 2KICA 2L09A 2UU9L 2F0HA 1ECWA 2HVHA 2IX3A 1I4WA 1Q39A 2Z6KA 1Q02A 4I5SA 4X66M 3ISDA 3TQ1A 4NLNA 1LV5A 1ZQWA 4DNIA 5DBCA 2ZTEA 2EOTA 2W9CA 2Y0SC 2Z8LA 2PFPA 1EY7A 5L37A 2Z4SA 4IBCA 4J03A 5FKAC 3GLFB 1WCMH 4YMMA 3FRPB 3F2DA 2H3ZA 4OX9Q 2VUMB 3GO5A 4HL4A 4A3DH 2F0QA 1LT3D 1WCMG 4C8LA 3K8ZA 1KHIA 3GU3A 4O3SA 4LFAM 5AM5A 5ALHA 2K4KA 3I51A 2X49A 4ZAIA 3D2SA 3F2CA 1OUQA 1NMFA 3GO8A 2KVCA 1N36M 2L55A 3M9OB 4ED7A 1SXJE 4JI2L 1V1PB 3LWUA 1J97A 3FD9A 1S3OA 4NXMM 2O6KA 2CFOA 3K81C 4DQSA 2ZIWB 3PXGA 2ERCA 3FYCA 2MU2A 4JI5L 2XLJA 4F2SA 3FTEA 3UQ0A 2L4NA 2VF7A 1Q3BA 4LF8Q 3SMPA 3QUTA 1IN8A 3HJSA 3J7A5 4KJNA 2JA8H 1VQNA 5J0PA 2PZUA 2KD1A 3PO2B 2F0IA 4ECYA 2ZG6A 5HR7A 4U673 2OO9A 4MNOA 4Y2UA 3WK4A 3OIQA 4L8RC 1FNWA 2JA8G 4UP8A 2J7NA 8ICIA 3WOFA 3QOLA 1XMOM 3NELA 2CP8A 3H0GH 3HP3A 1T7PA 2OXPA 1ZQKA 4OU7A 4Y2XA 1A0PA 3H0RB 5D49A 1LKYA 4IQWA 5ALWA 2ZJQA 2F1JA 2F5NA 3FUXA 4J8QA 4C3IB 2M2LA 3TN2A 1GL7A 2CH4W 3S16H 4PL1A 4XUSA 4M9JA 1L8OA 5IP9H 1S9FA 3RB6A 3J7ZC 2F0WA 1CFMA 4L63B 4UAYA 5IGFA 4EYIB 5IP9G 1DYQA 3J81i 1PTOD 4JI6L 3IFDA 3IG8A 3N52A 2QCUA 1ZQCA 1L2BA 2GOLA 1N62A 3E6ZX 1I4PA 3BVZA 9ICEA 2D2CC 4QZEA 4BDPA 3G4SA 5IWAM 1K3RA 5AM0A 4DV7M 4GLAC 4A76A 1P8LA 1HNZQ 4I2AA 4DV6M 1DOMA 1Z1VA 5KAIU 3OWEB 1ZQUA 4EEKA 5J2DA 3SAHA 1NK6A 1B9MA 5JUMA 3E2EA 5KT2A 3MEFA 1XNRM 4POFA 1EFUB 2DBYA 4CF3A 4DV2M 1GOZA 4HJAA 7CATA 4BB9A 4FZNA 5JEAH 1Z6HA 2HT1A 1GUOA 3BU2A 3RLNA 2F0PA 5DG9A 3SK5A 1PJIA 4IC9A 3IL8A 2A68C 4CDGA 4I2CA 4IRCA 4CDCC 1HZCA 4UP9A 1VJ5A 3BBZA 4NXNQ 3KSJA 4QJFB 4O3OA 3M8RA 5D46A 2VY3A 4AKGA 5KFAA 2BCQA 4I2BA 2E5SA 3KLWA 2EQSA 4C0ZA 3FYDA 3CCMA 2E5LM 4OXPA 1D0MA 1WJJA 5EGTA 1TFRA 1RYSA 3I91A 1RG6A 4MGIE 4M6WB 1NJXA 5AI6A 4F92B 1TWAH 1EEID 2KSOB 5LMNQ 4ED1A 3I01M 5DB9A 4ECUA 4IJEA 4GKKM 2F8LA 1D2BA 5IGGA 4FO6A 3WK9A 3V05A 4BY7H 2WB1B 1QWYA 4X6AH 3D2NA 1VQBA 1HHVA 2EA0A 2ZIVB 1HT2E 4BY7G 5F3WA 4RNMA 1IYVA 1OIZA 3B7NA 1KW4A 3KBBA 1NBWA 2DAGA 2Y9TA 1ZXTA 2IWHA 2EXZA 4ED0A 2K33A 5M5WB 4LF4Q 5IT9c 2PYKA 1IKLA 4ECSA 5ALDA 3KOWE 4DUZQ 3BQ7A 3I1YA 4UP7A 3C2MA 4PHDA 2E74C 2GH1A 8ICQA 2VB2X 2DWZB 1CHPD 4KLTA 1J2NA 4M9ZA 3TSSA 1Q3UA 3HFZB 5DB8A 5KNIA 1T3NA 2MJ5B 1HR0Q 1CKNA 2JP1A 3GIKA 5I2YA 2NN6I 5GAHC 1TKDA 3ND9A 4BXXG 1VMCA 1S10A 5JI3E 1MA7A 2Z3XA 2JEFA 3BZCA 3Q8GA 1PZID 2A68D 2XSCA 3PCOB 5D3IB 2F0TA 4RQ4A 4LJZC 5KFLA 1RXWA 5ELNA 4DR7Q 4EQ5A 1AFPA 4TUQA 3EFXD 2KUMA 4B9TA 2H3FA 1K0SA 2M9VA 3FPUB 1NSFA 3HU1A 3M4PA 2Q2EB 3TRZA 3U6CA 5DM73 3TS0A 4O0IA 4KJOA 1WTVA 3RFAA 2JZ0A 4LRSA 5I9OA 5G3LD 2CV2A 3ED5A 4PCZA 1TKWB 2FPMA 4DL3A 3NTHA 1F2ZA 4F2LA 3N7RC 2DNAA 4FNFA 2KNVA 4CJ2C 1UE6A 4ZYSA 4Y2SA 1J6QA 5FP0A 1OTRA 4DR3L 1P16A 4OVZA 3ZI4A 1PH8A 2QA4A 4ED6A 1O7ZA 8ICKA 5FLXL 1RTNA 5C0XJ 3SXHA 2VUMH 2LH0A 1VQ1A 1MSHA 1TS5A 3GIIA 5DGBA 2DHRA 4X64M 4NLZA 4M8AA 3OHBA 1X54A 2XWBB 1QYRA 2VUMG 5K36G 1F0MA 1YHQA 1MKHA 4UATA 1YHBA 4RUCA 2CUZA 5ALTA 4YCUA 4LF6L 1WGNA 1XPUA 3DWQA 5J0YA 1V38A 3ZD9A 3OTOQ 5IINA 1IY0A 1L0YB 2ALYB 5J3BA 3T1HQ 5LL6X 3ULLA 4AYBB 2B3TA 1TQOA 1RDPD 3RJJA 1XMQL 4P73A 2AWNA 1N2XA 4F5PA 3S17B 3PO2H 3RZOB 1KTKA 2XY6A 1YITA 1S0VA 4XYQA 2C9CA 3K9OA 2RBMA 3E58A 2OEHA 4R4CA 1FNVA 4DSEA 5C0YA 3PO2G 2PZTA 5DQHA 1CEZA 5EBDA 4WFN3 2PZWA 4AI6A 5AK5A 3CRXA 3PZPA 1B4OA 5J2FA 3Q22A 3B9JA 2D7EA 4QHTA 4RNNA 2GNOA 5BOMA 1G8PA 4X3UA 1Y8OB 4PHEA 4F4ZA 1XNQL 3IM1A 3CAMA 3MHVC 4C3IH 9ICOA 3HRDD 1MSWD 4G7HC 4FO2A 1J2MA 4KY5A 2ICEC 4KY7A 5I6YA 4C3IG 1HXYD 2E2DC 4KKUA 3GLHA 2J6UA 2AHMA 3L0OA 1XO0A 3CXCA 1PYWD 2O4XA 5FO7B 1WOCA 1D8YA 2QILA 1H38A 4IRDA 3MAQA 1IXSA 1XSLA 1SJHD 2R3ZA 4PZ6A 2JA6B 4CKCA 3S1RB 3E0JA 5HP4A 3GTQB 1BPEA 3GTKH 4QHSA 1QUSA 2WF7A 2AQ0A 3QWNA 2KZSA 4XYOA 5KFJA 1ENFA 4RUAA 2EXDA 3DM1A 1DONA 1DK2A 2SOBA 2YMQA 1GUTA 1DRGA 3K0YA 2Y20A 3FTFA 4RGNA 1PUZA 2UXDL 2PXIA 3A98B 2JA2A 1Z19A 1COKA 2JUJA 1EWCA 4DF4A 4FBTA 1FGUA 1WI5A 4HMIA 5FLXE 1A76A 3TP7A 1XXHA 3GQ5A 3VR3A 3TFRA 1SKSA 3OMGA 2YQZA 2XNAC 1GM5A 3HOVB 1UEAB 4YVZA 3HKZF 2F3WA 3C46A 4KY6A 5C3WA 2A1AA 3HX3A 2AGOA 3TARA 4FD2A 3SGIA 4DU9A 3RB3A 1TIID 3U9SA 4K2KA 3U6LA 9ICKA 1FEZA 2Q0ZX 1XS9D 4X62M 2JHDA 4YMNA 1BCPC 1MJCA 4I2JA 3AFPA 1N8RC 3J7AV 1GABA 2OH2A 3GILA 2HOQA 5DGAA 4DAYA 1G8ZD 3DHQA 2PI4A 1Q90A 2C5CA 3LDAA 2WB1G 5CWRA 1RD9D 4LFAQ 4RKUF 1QZGA 2ZXIA 3KD3A 5L1JA 1DOQA 1KFTA 1Q3VA 4GH9A 1N32Q 1A6XA 7ICNA 5KT3A 4DR4Q 5J2IA 5M5WH 3NK9A 3U6QA 1KRPA 7ICMA 4N8FA 4PD2A 1A3TA 3GTLB 4IQVA 1LTAD 1SR3A 2AJQA 2EYLA 3CC2A 4ZKCB 5A0LA 5J29A 4UB8U 5C4XB 3TE6A 2KJXA 5JVH3 2BJWA 4NV0A 4K6DA 4UW9A 1UT8A 1TK5A 2UXBM 2KOBA 3J81j 2QB0B 4JK1A 3VC8A 5DQIA 1KLNA 1HIWA 2W8KA 3L28A 5IREB 2F03A 2QBYA 5JRTA 1EYAA 2R61A 4JI7L 4K0KM 2JA7B 1DJRD 1LVHA 2YTVA 1YNJC 2DWLA 5KFRA 1BPBA 2XZUA 3NRWA 1D6EC 2F4VM 4HEOA 3GDEA 3OHAA 1J5EM 4BBRB 4X3KA 4GOPB 2N88A 1DD2A 5IIFA 3K75D 2JP7A 1NK5A 4G4RA 1NVMA 1QANA 1SNDA 3KZIU 2X69A 5C5MA 3NTUA 1RJTA 4Y2PA 5JOBA 4K2LA 2ZIUA 2Z7JA 3TAPA 4DUYL 2WHEA 3CCUA 5KFVA 5J2AA 1IBMM 2DWQA 3U4ZA 2HHSA 2XTIA 1MC8A 3PSTA 4ZUJA 1HT1E 4QCLA 1KL9A 4I8OA 1Z5CA 1L3SA 4FF3A 3TS2A 1VLBA 3CPFA 3LGJA 4DV7Q 3NBHB 3WWVA 2WSFF 2XICA 1STGA 5FOBB 3MJ5A 4DO9A 2M60A 2FMSA 2RKOA 3KS4A 4DV2Q 2XRSD 3CRLC 4DV5L 3HX0A 4QIWF 4LJXA 2A8VA 1QNUA 3BYYB 3PO3B 3GV6A 3G6XA 1ENCA 2RF4A 1QSLA 1MBYA 4OCZA 1YJWA 4P4MA 2IBKA 3QUBA 3GQCA 3SEBA 4QZIA 1OIPA 1TV9A 2KJ9A 4MGHA 4CIZA 1GKHA 1ZQVA 1X2IA 3J80S 1UCVA 4AYBG 3S17H 5CBAE 4K5XA 7ICKA 3RZOH 4F5QA 1G2TA 2ISOA 5CV9A 1SE3A 3SAWA 3ZD8A 2IJ0A 5LMUL 1Z1BA 1JN3A 5KNBA 3NUCA 3PW0A 4Q8EA 3HZXA 1Y1WH 4YY3M 4J9PA 5AK4A 4B3TL 4UB1A 3Q24A 1YNJD 3ETRA 2E1EA 2YMMA 5C4ZA 4APVA 3VKHA 2HW3A 2VB3X 2L5TA 4IURA 1BNZA 2QKIC 1SXJC 2JWSA 5FTLA 2EQYA 3QX7A 4DFMA 4K8JA 1LYLA 3QUQA 2K50A 4PL2A 1XXHB 4I2GA 2G09A 5BN5A 3VR5A 5DEHA 4JPBW 3KTQA 4MB7A 1I50B 2FMQA 3PX6A 2Q2HA 4RKBA 2M0NA 5L1LA 9ICIA 3W0LB 2DKXA 3WK7A 1G51A 1ZQOA 3GIJA 4E6IA 2O01F 2K05A 2DKLA 3FUUA 1KYIA 3SMVA 1Q12A 1YIJA 1S5DD 5DLGA 3FKIH 2UUCM 2HBKA 1KDHA 4EX7A 1TH4A 4X3SA 3WHKA 4PHPA 1PH2A 2E2IB 1NCVA 3L4PA 2EIFA 4Z8XA 2OT2A 3GTQH 1VDZA 1IBLQ 3ZDEA 4M9GA 2ASBA 2JA6G 3IAYA 1VF5C 2EKKA 5KFYA 2LS01 4G4OA 2PMZB 4TKOB 5ELDA 4ECTA 4IBIA 1LT6D 1Y8PB 2N55A 1QH9A 3CHBD 4PH5A 5EP4A 5BN3A 4ME3A 3R93A 2L9HA 1WWVA 3J7AF 4B9UA 4MF2A 3GLIB 5CV4A 3LYSA 4G4QA 2K52A 2G08A 2LBOA 1SJED 1U5KA 4KHZA 3SAFA 1WYGA 3NASA 2DNCA 4ABNA 1HCZA 3A7AB 3FRIA 4KLNA 3NHHA 1RL2A 3TQSA 5AKEA 3KJOA 3KFUA 2NQ8C 3Q0AA 5T1IA 5IIKA 1CM9A 3E46A 5KG2A 2XFTA 3HOVH 3BZKA 2XWJB 4RQ2A 4KX3A 3MFYA 3U6MA 1RQLA 1LACA 3PNYA 3V76A 3TI0A 3HZJA 3PIOA 2DKZA 1G59A 1KLUD 1KAWA 1ZQNA 3HOVG 4I2EA 2CWBA 4Q45A 1J09A 1SXJD 2EY6A 2YTUA 1ZJMA 5KPRA 5CR0A 1QB5D 3PV0A 3WK5A 4RGOS 1X32A 1WGLA 4B9LA 3GTJB 2NZ1D 4EZ9A 2W54A 2B29A 1SWVA 5M3MB 5J2KA 3RGSA 3HGBA 1ZD2P 5AI5A 1MJGM 4CNQA 3MR5A 4ME5A 1AUAA 1VG5A 1SYGA 3KYHC 2F0LA 4GNXB 4DR6M 3S15B 1X37A 4Z6YA 5AKGA 3RJGA 2JMGA 2IPKD 5KG3A 2R0IA 3BS7A 1NTGA 4UAWA 2DGZA 4XXEA 2C2DA 4B6JA 2SDFA 4V190 4DV1Q 3FKEA 5J0WA 5T1GA 4OD0A 1K1SA 2RCNA 2C5RA 7ICTA 3MXGA 4FXKC 5C4XH 3SI8A 1K3WA 4LF9M 2L5YA 1X3GA 4XT1B 5AFWA 5KG6A 1NKCA 3HU2A 4AQYM 3M85A 3I4MB 2Y1IA 4FXGC 3PGZA 3OIPA 2F8KA 2K5QA 1ZQSA 3QU2A 3QEAZ 3J81L 3PUWA 2ZJ8A 1ZQ1C 1VQGA 2JA7H 2R18A 5ITYA 3GPUA 4A3MH 3A56A 5ALFA 4DPGA 1HQRD 3H15A 1PH6A 2JA7G 5D4BA 2A74C 4BBRH 2FJ2A 1X3PA 1W2BA 3GIMA 1LT4D 1QVCA 2L2DA 4DEZA 4BWGB 4A3JB 1SFOB 4KKSA 4NL9A 5EWEA 4LF5M 4BBRG 5KYLA 1H9MA 2EY2A 4WJ4A 1PFNA 3G71A 1GVNA 2XIWA 3WKAA 4DBGB 1GD7A 2K6BA 4IUQA 3FUTA 1BPZA 4CJ0B 4XA5A 2QENA 2R7ZB 4IO9A 4L6V6 1H95A 2FE9A 4QOSA 4IOCA 3DEEA 4YMOA 1ICWA 3BDPA 4Z6CA 2XSZA 4KKTA 4JW0A 4I2DA 2HAKA 5IGDA 1S76D 4JV5Q 4OJLA 3UXNA 4DL5A 1YJ9A 5CBEE 4O3QA 4KMUA 5FTMA 5CEHA 1FNUA 4M0DA 4JI3M 1PFMA 5EPKA 1AIPC 4OJ5A 2W55A 2CH4A 1KDAA 1BCPF 2D3DA 1VDDA 4I65A 3B89A 1YNXA 2F5QA 2D8CA 3CYMA 4RQ5A 2KEDA 3V2TA 3NGDA 5E79U 1L1TA 3ETLA 2NVXB 4BXOA 1G91A 3P20A 4QWEA 2IHFA 4RFBA 3OW2A 4OW0A 3MABA 1N34L 5KFDA 5ELOA 3HOXH 1G6PA 2ZM6M 1XX8A 3PO3G 1D9FA 2LM1A 5EWFA 1RDFA 5HGQA 8ICWA 5CB1A 2VQFQ 2VQEL 1PFSA 3SZ2A 2IMWP 3ZDCA 2K8CB 1O7IA 3J7BA 3QYPA 1ZRMA 3EIEA 4QNMA 2HQEA 3K1JA 1HH2P 1JE5A 1YNNC 4AZFA 4DV0L 1ESFA 1PM5A 2A6HD 2R92H 4RPYA 5ISRA 5EP2A 4R8UA 4JI1Q 3PIPA 2WAQB 2FPLA 1XSPA 4FF4A 3H3VC 4GC5A 1ZMWA 3TP8A 5HY6A 5KIXA 4DR1Q 2D5DA 3BJYA 3TKAA 3M7DA 1KBUA 1NE3A 1NKEA 5C3XA 2BWBA 5AK3A 5M3FB 3HILA 2BCUA 3RNUA 2NVQB 2K89A 2HWJA 2HHTA 1C48A 3AOEC 2BCSA 4L6TB 2JZ1A 1I50H 3HWSA 2NN6G 1J9OA 3CPWA 4Y52H 1IHZA 1HNXQ 3KVWA 2K8AA 1PK1A 4F4KA 3A5ZB 3J81E 4BX9C 1XPOA 5KFUA 5J1ZA 4B3SQ 1U45A 1VQ4A 3KF6A 3PMNA 3UPQA 1Z00B 3MXNB 2B2VA 5KO3A 3U6PA 4WORA 1AE2A 1QVFA 3U60A 2JN4A 1ZRNA 2BPGA 4CCHA 2CE7A 2KKVA 4CKBA 3R8BA 3U58A 3CCEA 1TE2A 1IXRA 1S0NA 3P7JA 3S6JA 1TVXA 1V1QA 1TK0A 5GAEC 4K0KQ 1Z4NA 3PMFA 1N60A 2JH1A 1QVGA 2DZOB 1NZPA 3MC0B 1VQDA 4HMJA 4YHHQ 3ZYYX 4F50A 4MH0E 3VFDA 1Z47A 4P74A 1AH9A 3H0LB 4D81A 2HI0A 1IM2A 3AEVA 2MQHA 2PW7A 2FLPA 3RAQA 5L1MA 2QB1A 4H13C 1HNWM 4X65L 1YNND 3V6JA 4J15A 4NL4H 1BXTA 1ZD3A 3RJIA 4FFDA 2K0BX 5M5YB 1I3QH 4CISA 1Q7YC 2Q8TA 2Z9HA 3UMGA 4M04A 5AJ3Q 4ELUA 2IT1A 1IBMQ 1L1OC 1O08A 2O5JC 1PA6A 1IBKL 1IN4A 4B7GA 2Y1JA 3GTJH 1IYJB 3MEHA 4J9LA 4ZOHC 4F5NA 1AQ6A 5M3MH 5C1BA 4IJFA 5J0UA 3QO2A 4LFBM 2UXCL 4C80A 1JJCB 3S24A 2F44A 2K5HA 4GC6A 5M3MG 3Q8KA 1D0KA 3Q23A 3S15H 4C7ZA 1PTOB 3I7FA 2Y0SB 4QNRA 1TWGB 3ZJYC 1TY0A 3H8WA 2DY7A 3MR2A 5IT9L 4LJ4A 2RHFA 4MGZE 2BQUA 2OTLA 3GP7A 5JPNC 4IBFA 1O78A 1LUZA 4FYDA 4MFAA 1ZEQX 1AROP 1KTQA 2F0SA 2F1MA 1I4QA 3MA2B 3OWFA 4RQ1A 3HGIA 5C3EB 1CSPA 3NEMA 3I4MH 4HYKA 1D5XC 3M8SA 3KJPA 2HUGA 2ICIA 4L16A 2JEIA 2B2TA 2ZXHA 3I4MG 1VQ8A 2K28A 2XEPA 4DK1A 3C1EA 1A8VA 5KT4A 4J9KA 5KG7A 1VQIA 2CRUA 3LCUA 5J8YC 3UDXA 4ZH4A 4GKJQ 4YCXA 3K7AH 8ICVA 1V8QA 3N28A 3RR5A 4LFCL 3KOOA 3WKCA 3T5KA 4QQBX 3TWLA 4CHTB 1QSSA 2WB1F 1ML0D 4A3JG 2A1JA 1PVRA 2EYFA 3GLHE 2QF7A 1EU4A 2R7ZH 1WTOA 5D65A 5J0RA 3GD7A 2UU9Q 1W6KA 4OX9M 3FMCA 1U4RA 1N33L 2R7ZG 5E1FA 3Q8QB 2RVLA 4NOOB 3LVVA 1YE9A 1MN3A 1VEJA 3I4YA 2UUCQ 2QCPX 1NV9A 5J0QA 3PNCA 4JBJA 3X3MA 3IHQB 1YHAA 3S2DB 4DV3L 4YXMA 5DAUA 4XT3B 3FRHA 4OELB 1X6OA 3EPIA 4DK3C 2Z8YM 2ZJPA 2LWXA 3SAGA 2KFZA 1X9XA 3HHWA 1F2YA 1SXDA 3CF2A 2MHVA 4JI2Q 1XJVA 1PVOA 4MEXA 2JY7A 3GLGA 5KT5A 1VQ7A 4LF8M 2G8LA 2RDGA 2K8BB 1SE2A 3I4NB 4B08A 1P3QQ 4PQXA 4JI5Q 2G5DA 1IN6A 2W43A 2N49A 1MHWC 2DWNA 4LRTA 5TISU 7ICFA 3SQIA 4LVSA 2K7VA 3H4DA 1KRSA 4GXKA 1XXHE 4F87A 1CUKA 3C28A 1URJA 1G3IA 3MR6A 4JV0A 1GJXA 1A3VA 1IL2A 4M0AA 3T79A 2ZUDA 1B1ZA 3NP8A 3UMBA 2IHEA 2NVTB 2AGPA 2HHHL