2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
2L4EA 4C3IH 7ICNA 1NKCA 1D8YA 4B3RL 4UB3A 1ZETA 2BCSA 3RJEA 4PHPA 4AYBG 3FYHA 4DFJA 3RAXA 4IFDI 1HNXL 3LCUA 3PF5A 4DV6Q 1KDHA 3Q8RB 1Y88A 4MEXA 5KFLA 1JT8A 3ULPA 5LMNW 1QVFA 1ZQOA 1NJYA 3QEBZ 3Q8MA 1G41A 5AJ3L 3H0GG 2ZUDA 4YMOA 4X62L 1Y1WH 4O5KA 2NVQH 7ICHA 4O0IA 7ICGA 3GTPH 1Z00B 1ZMVA 1S9FA 4XRHA 3GIMA 3JPTA 3TRZA 1E3PA 7ICJA 2UXDL 5GROA 3KJOA 2I1QA 3M9OB 4DL4A 4A3DG 4A3LG 1O7IA 1ZJMA 5KFAA 4F2SA 1JXLA 2MJ5B 4IJLA 4YD1A 1KFTA 4B3TQ 4A3IH 4DS4A 4BY1G 2G3QA 4DUZQ 4NLNA 4M9GA 4DL7A 4QGUA 4C2MH 1WCNA 1N32Q 5KFEA 1XSLA 4GNXB 3S1QH 2NRVA 4PH5A 1VEGA 2PQAA 4M6WA 1WOCA 1T3NA 3RH6A 1XPOA 4GC6A 1C9OA 1TVAA 3JPPA 4DV6L 3STBD 5JUMA 2LXKA 4YY3Q 2ALZA 4DR2L 3M9BA 2UU9Q 1VDLA 4POFA 1VQHA 5KFCA 1SKRA 1KRPA 1VQ7A 1Y1VH 5IIMA 4I2CA 3RJHA 1AIPC 9ICGA 1IM2A 3RN2A 3D0FA 3RH4A 1GKHA 1VS0A 1NK9A 2IHMA 1PH1A 4IQTA 4I2JA 1CEZA 2OWOA 2YTYA 4IRKA 1LYLA 4FDBA 1PVOA 1GVPA 4I2FA 4QJFA 5D49A 1QLNA 1N34Q 1YJWA 1QSLA 3RB6A 4RMFA 3BJUA 1TAUA 3I55A 1B43A 4ZH4A 4F5OA 1R9TH 3MMPA 4DR4Q 3L7ZC 1NK0A 4RQ4A 2LXJA 4B3TL 1H95A 2XTIA 2ZJRA 4DUZL 4JV5Q 2ZTEA 1X3FA 8ICWA 3PX0A 2AKWB 1T6OA 3H0GH 1N32L 1TXYA 1X3EA 1JJCB 1T4GA 1M1KC 3G6XA 3ULJA 1PHJA 1EFWA 2XGPA 4R4IA 4DOCA 1H38A 3BQ2A 3HFZB 2Q2UA 4R63A 4YY3L 1LUZA 2UU9L 2ZTDA 5DB8A 3L2PA 1X3GA 5DLQE 1PH5A 3Q8PB 4IJHA 3AQQA 4PPXA 3PO3H 2DENA 1TFRA 3GD7A 3KYHC 2E5LQ 1WR1B 2OOBA 5JEAG 4DR3L 4KLKA 4B9VA 1PH9A 4BY1H 3TS2A 4Q45A 4DBGB 5HHHA 4O3OA 1EIYB 4GNXC 4YR3A 3GQCA 4RPXA 2DGYA 2JJQA 4F1IA 1N34L 3ZDDA 5J3BA 3U50C 1L5UA 9ICKA 4M47A 2WFWA 2Z6KA 5KT7A 3BQ0A 4R64A 2ISPA 4KLIA 1S3OA 1MIUA 1TWGH 2I5HA 4GKKQ 2A1JA 1MQ3A 4DR4L 4M2YA 1LB2B 1HZAA 1NV8A 4IR9A 4JI1Q 1N8RC 4DL3A 2Q0ZX 1UE1A 4JV5L 3E21A 5KFQA 2Z0SA 1V92A 2WAQG 4LUOA 3GO5A 3RLOA 3CD6A 2WZJA 5EOZA 3GLGE 3FRIA 4PHEA 1PZNA 3CXCA 4F4ZA 4QZ9A 1XNQQ 3S2HH 2ALYB 2DAKA 8ICNA 2AMCB 4LNQA 4QZCA 3F2BA 4B9SA 3M4OH 3K7UC 4PZ6A 5TZVA 3CCSA 4ECTA 4GEWA 1G6PA 2NZHA 5KFVA 1KSPA 1IBMQ 1IXRA 1KRSA 1QUQA 3QEAZ 1MN3A 3CCQA 2E5LL 3KHHA 3PIOA 4QW9A 3NEMA 1VQ6A 3KF8B 4UAZA 4DFPA 5M5WH 2ATLA 2D0PA 3CMAA 2OTJA 5CJ7A 1TK0A 2DAEA 3MR2A 3PX4A 4DQQA 4UQGA 4F92B 4YCUA 1Q7YC 3RAQA 3MDCA 3CAMA 4LUZA 4A3CH 3THVA 2GVBA 1K1QA 3T1YL 3GILA 2EXDA 5C44H 2E2IH 4QWEA 3H4JA 3GLIE 4KLJA 1WI5A 3JC66 4FS2A 4GKKL 5IYBG 9ICQA 4I2IA 3S1NH 4JI1L 2JA7H 3KDFB 4HIKA 4WP2A 4KLMA 4JBMA 2ZJPA 4DR6Q 1R4GA 1NK6A 2K4KA 1XNQL 3PW7A 5J29A 3BQ1A 5JJLA 3EZ5A 3PW4A 5GAHC 3OJUA 3H3VI 1L1OA 2EKKA 2D62A 3ISDA 3PW0A 4A3KG 3SZ2A 2LSSA 3PUZA 3CC4A 4LZDA 5C5JA 4KLHA 3ERSX 2PMZE 2JA6G 1KQSA 3RJFA 3FP9A 4YWMA 1SE8A 3KF6B 5DDYA 1TR8A 3MABA 1VQLA 3J81i 3E2EA 4I2AA 3PR5B 2KNAA 2BQ3A 2K0BX 1EFUB 4UB5A 2XCAA 2ASDA 4Z6FA 3H3VH 2VW9A 3B89A 5J2CA 4KHPQ 3EWAA 2IX1A 4KITB 4TQRA 3MR6A 1HQYE 4QZDA 4A4IA 2YV5A 4ELVA 1HZCA 1RIPA 5CWRA 5DG7A 7ICSA 1EWIA 3GTQH 1ZQDA 3HOXG 4BY7H 4JOIA 5KT4A 4OXPA 4FS1A 4DR6L 2JZBA 1BPEA 1OAIA 3UQ2A 1SFOH 4EBEA 2BA1A 4YQWA 1ZQZA 2B3TA 2JK8A 2DAMA 2J6UA 1ZQGA 3JPNA 2WP8J 4XUSA 2R6GA 4TQSA 8ICTA 3C2MA 9ICSA 4DSJA 3RJIA 4ECYA 1ZQMA 4F5NA 3CCEA 7ICRA 1BPBA 4EZ9A 3UXPA 3TAPA 1OKSA 2NRZA 3KHLA 4R4CA 5KFSA 1HH2P 4GLXA 3V7KA 1YIJA 1YNXA 4A3GG 1ZQXA 5J0QA 4P73A 3RR5A 3PUYA 3GTGH 4LZGA 2ASBA 3E46A 2JY6B 2KNZA 1ZQYA 5IP7G 1VQ5A 5EWGA 2VL6A 1QTMA 4F5QA 5FJ8H 4IPHA 4XTCS 1BPZA 5C4JH 4X66L 4BGDA 4A3KH 1ZQWA 5KFXA 2KZ3A 1ZQHA 2VA8A 3GV7B 4ELTA 4IQWA 2JUJA 5EWEA 2UXCL 3EIVA 2ZTCA 4DV3Q 1JIHA 4DFMA 4JI3Q 3K4GA 2PFOA 1NKEA 1XSNA 1MQ2A 2I5LX 8ICLA 5IIIA 5BPCA 5DFLA 3QE9Y 4IR1A 3Q8KA 4YVZA 4POGA 1YHQA 1Y14B 3PVXA 2W9BA 1GD7A 3J81c 1PH4A 2B3GA 4MZ9A 3U58A 4R66A 4DL2A 1ZQFA 2B63H 2ES2A 1JJGA 4PZ8A 5DB7A 2LVNC 1NOMA 1NJIC 5KT6A 2NN6G 5HGQA 4DKAC 5C0XJ 1A5TA 5J0RA 8ICAA 5JI2E 9ICMA 1I3QH 2OCEA 1L0WA 4JI8Q 2B29A 2OQKA 4BWJA 4YR2A 1KHIA 1EUJA 3OHBA 3SV3A 5HMMA 2K9DA 1KFDA 4GN3B 1JMSA 1Q12A 4YXMA 4ECQA 3G6VA 4DV3L 1S0VA 5D4BA 5KFZA 4QZ8A 3S17H 1OXVA 2KBNA 3TAQA 3CPFA 4A3EH 1ZQKA 2AHOB 1W3SA 3F1ZA 4A3FH 4LF6L 5IYDG 1Q46A 2B21A 4JV2A 9ICRA 3JPRA 4LFBQ 1XC9A 2N8NA 2CKZB 2JEBI 3RBEA 9ICUA 1KYIA 2JY8A 2AQ4A 5LMNQ 4DL6A 3JPOA 3HOWG 7ICVA 5D46A 5DBCA 3I4NG 3CCLA 4DF8A 2XY6A 2VNUD 3AFPA 8ICRA 3HWTA 3K7AH 1Y1WG 4MNOA 1D8LA 1EQQA 3I4MG 4DWIA 1K0RA 1UEBA 2FLPA 4RQ3A 1WFQA 4IFDG 2HAKA 1SN8A 3H40A 4RQ7A 1WCMH 4DO9A 2V4QA 2F4VQ 1HNWQ 2HT1A 4R71A 1S40A 4LF8Q 4I29A 4I2DA 4X64Q 3I4OA 2R7DA 2FPMA 2C22A 3RNUA 5KFDA 2OTLA 4DV0Q 3RZOH 2MROB 4HJ9A 4TQUS 1NK5A 4QZAA 4F4XA 8ICPA 3MBYA 1U49A 5GQOA 2HW3A 1QZHA 1TWFH 1RPLA 5KG4A 4QWDA 1QSYA 3K75D 2FLNA 2NZOA 2N3SA 4DSEA 1Q81C 4M9NA 2LVPC 5LMNL 3G48A 5KFPA 2VA2A 1E94E 9ICBA 5KFUA 5KFJA 2UUBQ 4O3SA 1Y1VG 1HR0W 1Q1BA 7ICOA 1SKWA 2R8IA 1C0AA 3J80i 1PYBA 1EQRA 1HZBA 4LVSA 9ICNA 1SRUA 5IYDH 2UUCQ 2Y1JA 1X54A 1T43A 3GLHE 3H4DA 2ZM6Q 4J9KA 2KZMA 2F4VL 2F52A 2AGPA 4OWWB 4CCHA 1XNRQ 3KTQA 4F2RA 4J9RA 3HOWH 1ZQQA 1G3IA 1UWVA 3C1ZA 1PH8A 1KIXA 4X64L 2BPGA 1B70B 3M9MB 5L1IA 3UE0A 1V1QA 4AIMA 4LF5Q 2Q2IA 3I4NH 3OSNA 5IIJA 1VQ9A 1JR3E 2R93G 5J2AA 4DQSA 2IBKA 1E1OA 1BGXT 4JI0Q 2BCUA 4KN7A 2UVRA 2VS1A 3I4MH 4ECXA 1XXHE 3F92A 1ZJNA 4KLEA 4ECRA 4DV2Q 1S0OA 1KL9A 4EBCA 1BBUA 4M0AA 4JBJA 4RQ2A 3TREA 1KD1C 9ICXA 5F9NA 1MJEA 4GOPA 5KFFA 3PO3G 5JJIA 5BOMA 1WGNA 2P6RA 4ED2A 3T5KA 3CPWA 4DEZA 4QZHA 2MR9A 1TKDA 2UUCL 2P66A 3CCVA 2JA8G 4A93G 2ZM6L 1HUOA 3FHWA 3B0YA 4FBTA 2ASLA 4IRDA 9ICFA 1XNRL 4EBDA 2CWPA 1UT5A 2EIFA 4LF5L 3HOZH 1TAQA 1NBWA 1VQMA 5ELNA 1D9DA 4JI0L 2JP7A 2JQOA 2BWBA 5JEAJ 5GAGC 4ECUA 2ASJA 4JWMA 5KG1A 4DOBA 4Z6EA 3PSIA 5C3EG 1PFSA 5BOLA 3EBEA 3MGHA 2PFNA 2HQLA 1LM0A 2IMWP 3BQTA 3LK9A 3MGIA 1NK7A 3C2LA 4IQUA 3HP6A 8ICIA 4RQ0A 3J80c 3HKSA 4G3IA 4DFKA 4ED1A 1P16A 2R93H 4QZEA 4A3CG 2E8GA 4ED3A 4AQYQ 1UE7A 2K5VA 4F5PA 4DF4A 4IRCA 5C44G 1VQIA 2IY5B 4KLLA 4O3QA 5KFWA 2PQAB 4M6WB 4GC7A 2KHIA 2QHOB 3RLNA 1LV5A 4YP3A 2JA7G 2JEJA 3CCJA 1YITA 1KLNA 1Y8GA 2K75A 4I2BA 2K52A 3RRHA 3N97B 4JCVE 4A76A 4YHHQ 4KLQA 1VEJA 4K4GA 3PIPA 3GIJA 1TTEA 1PV4A 2JE6I 4NLZA 1VQ1A 2QA4A 2RRUA 2R8JA 1HNZQ 2MFIA 2E2JH 3GTOH 4NPSA 4B9NA 5M3MH 2JA8H 4NXMQ 4A93H 1UA1A 3RB4A 1ZQNA 4PGXA 4UAYA 1VQPA 2UXBQ 5KTQA 4A3MH 4O2DA 1A76A 4NB3A 4BBSH 1TWAH 8ICGA 5KFRA 3Q8QB 3N4MB 2A19A 4RUAA 4UPAA 2A8VA 3LGJA 1N33Q 4L5TA 4AQYL 4UB4A 4A75A 3V6KA 1NJXA 4QZBA 4KLOA 1G4AE 4APVA 3GTJH 1VG5A 3FKIH 3ISBA 3KDFA 1I6HH 1VQJA 1KAWA 8ICYA 3VDYA 2IA6A 4C8KA 5C3EH 4XA5A 2R7ZG 2F1HA 2XGQA 1GM5A 4IQVA 3Q8SB 2BR0A 4BXXH 4UAWA 5J0TA 4RNOA 1K9MC 4BY7G 3IM1A 3TFSA 1K3RA 4DSFA 4JI6Q 3HOUH 2ZUCA 3GV5B 1GO3E 3SV4A 5M3FH 4LWCA 3AEVA 4A3JH 3KOJA 4F2LA 4RUCA 4F91B 3S14H 3RH5A 4MFCA 2J6TA 1HNZL 3UQ0A 3V7LA 1YJNA 2BA0A 3T1HQ 5DG9A 1RL2A 4BA2I 4NXML 1VQGA 1YZ6A 2RDIA 4TURA 4DV5Q 3EW9A 4ELUA 1N9WA 2UXBL 5DQHA 2PI2E 1XMQQ 3ORYA 2OO9A 4NXNQ 2DFLA 3ZD8A 2ZJ8A 2Y1IA 1X56A 1IYJB 2BPCA 1N33L 4GXKA 4LFCQ 1OXSC 4RPYA 3UDGA 4RG1A 4DLEA 3Q8DA 4DSLA 1NKBA 4DV1Q 4DV7Q 2XY5A 3PUXA 1NV9A 2W9MA 9ICVA 3V6HA 5FJ8G 5KG6A 9ICCA 3KLWA 3GV8B 4QWBA 4B9UA 4YFKA 3E9HA 2FXQA 1IBML 4P4PA 4PGQA 3TARA 1CKNA 5J0UA 4PHAA 4JWNA 4DQIA 3FRHA 3BU2A 8ICEA 1SZPA 5L9XA 3BDPA 1QUQB 4HJ7A 1ZQPA 3MR5A 4P72A 2IHEA 1N48A 3T1HL 4NXZA 5GAEC 4DV5L 3PW5A 1I5FA 5CR0A 1KRTA 1XMQL 4NXNL 2R7ZH 2HWJA 1S10A 2CWBA 2N78A 5J2GA 7ICEA 3AUOA 2HVIA 2K50A 4LFCL 2QGQA 5J0PA 1RXVA 3S15H 1VQFA 2B63G 7ICTA 4DV1L 3M9NB 4DV7L 4UB1A 1MKHA 4LFAQ 1E1TA 2CWAA 1P8LA 1IBLQ 4KI0A 2HHHQ 4TUQA 4DOAA 1L1OB 5ELOA 9ICTA 5KG3A 2KFZA 2Z6KC 3E9IA 3E0EA 4R8UB 4UB2A 1JN3A 4R1JA 4YG2A 4PGYA 3PF4A 1WHCA 2UVUA 3GDEA 4DR7Q 4LW1A 3GTKH 3LCVB 3K0XA 1J5EQ 5HHIA 4RT3A 4P4MA 4GN5A 4KHPL 1F4IA 3PO4A 4A3EG 4ECWA 4Z6CA 1K73C 4L5QA 1X6OA 1D9FA 5BR8Q 4BWMA 4A3FG 2NVTH 1ZQEA 5HMLA 3RRGA 4UP9A 2BKEA 4IOCA 1S72A 4ECSA 5J0WA 4OWTB 3K81C 3TI0A 3K8AA 2LTUA 3C5FA 1A8VA 3PO2H 1FVIA 4F50A 2HHSA 3TFRA 2JZBB 4O3RA 4LFAL 1G51A 2VQFQ 4C3HH 1YBYA 1IBLL 2NRXA 8ICZA 2HHHL 2LBCA 3TANA 5J2IA 3PR4A 4J15A 5DQGA 4P75A 1ZQRA 1P3QQ 4JV1A 5KG0A 1HUZA 2E2HH 1VQBA 2O25A 1PGYA 4YCVA 4O3NA 2C2DA 5IY0A 1N56A 1V9PA 5IE8A 2W9CA 4C8NA 2FMSA 2AWNA 1ZMUA 1WCMG 2V9WA 3ULLA 1G291 3NENA 1J5EL 4DSIA 2RHSB 1T9HA 1X2IA 4HIDA 3T5JA 1UE5A 1TK5A 5IILA 2ZJQA 3UDFA 1L1OC 4DR5Q 5BR8L 8ICVA 4K0KQ 4NLKA 2DAIA 1BKBA 1VCIA 1DV0A 1A0IA 1U4BA 4PG3A 4YD2A 4RPZA 3MEFA 3RB0A 4ED6A 2VQFL 1WIVA 1E22A 4JI3L 2F1JA 1HR0Q 1YLAA 2XGTA 4IFDJ 3BZKA 3D31A 2PI5A 3ETLA 1S0NA 1ZQJA 5CP2A 1HT2E 5DBBA 3PMLA 2HHTA 4IOAA 3HOVG 4BBRH 2C28A 2I5MX 1ZQVA 1OTCA 5LMUQ 7ICLA 4GXIA 4BXOA 9ICHA 1JX4A 3HOYH 4QZIA 1SKSA 2MUTA 3PY8A 4JOIC 4AH6A 5H1SE 1QVGA 3CMEA 8ICKA 4JBWA 4HJ5A 7ICPA 5DB9A 4JC0A 4JYAQ 5IIOA 4QY7A 4F5RA 3IECA 1B8AA 4A3BH 1UE6A 4JI8L 1EYGA 1RZTA 4F4WA 4I2HA 1A77A 1ZMWA 4K0KL 4DQPA 1UFZA 9ICAA 4JI2Q 2C2RA 4O0AA 4Y7NH 1NTGA 9ICLA 4DUYQ 4RQ6A 3RB3A 2IHFA 1VQDA 1ZV1A 3BJYA 5L1JA 2UVWA 1EIFA 2YTVA 4UP7A 1WCLA 2VY3A 1TK8A 3G6EA 4NY8A 2PI4A 4Q44A 3IHPA 3PW2A 3CQZH 3ER0A 3LWLA 1UA0A 1YI2A 4LF7Q 4B3RQ 2RHQB 1K8GA 1S76D 8ICHA 3UXNA 4DK6C 1EXNA 8ICXA 1ZQUA 2KNVA 2PFPA 2GVAA 4LFBL 1D7QA 1VQCA 1PH2A 2NRWA 5IP9G 4I2GA 2PXIA 2HHUA 1X65A 2QSFX 1SROA 2JEAI 2AGQA 4NLGA 5J2EA 1CSQA 1B7YB 5KG5A 9ICOA 2ZJ5A 1VQEA 3DLLA 1DGSA 4DQRA 1SLJA 8ICSA 1IM4A 1Z00A 3HOZG 4Q8FA 4X62Q 2JEGA 7ICMA 4M9JA 4Q8EA 4IPGA 3HOVH 4WJ3M 1A63A 4QWAA 4OO1G 1KTQA 3UDXA 4JI2L 2R8GA 4RZRA 2KTQA 5C0XI 4EEYA 4DUYL 2VQEQ 1QZGA 1ASZA 1JXEA 5CHGA 1KEJA 2W9AA 2BH8A 1VQOA 4F93B 1PYSB 2DHYA 2VZAA 3RR8A 1HNWL 2IHNA 4R4QA 3G6YA 5DGAA 4R4OA 3H8SA 3IHQB 2DUDA 4LF8L 4J9PA 3ZDBA 4GNXA 4F8RA 4JUZA 4LF7L 3TS0A 1ZQAA 3J81j 1COOA 3H7IA 2BGWA 4QW8A 3S16H 5J2KA 2JA9A 4KHZA 4DV0L 3AYHB 4H02A 2ATWA 2OOAA 2BWEA 3M8SA 3A5UA 4B9MA 5CB1A 5IYCG 1L3TA 1I94Q 4HJ8A 7ICKA 2HHVA 4DR2Q 4X65Q 1VQ4A 1XB2B 1WJ7A 2UUAQ 3ZJYC 2V4RA 5IIKA 1XPRA 2BCQA 3GTMH 1I50H 2UUBL 1OQYA 1CKMA 1XPUA 4DV4Q 2L2DA 1K8AC 1DO0A 2GN5A 3PCOB 1KXLA 2MQHA 1S77D 2W8LA 4I27A 5KG7A 2MNAA 5CA7A 4OO1I 2KHJA 4IPDA 1YJ9A 1ZQLA 2R0IA 5M3MG 2VQEL 3J7A5 4FBUA 5KFBA 5DGBA 5IP9H 5HY6A 4A3MG 2YTXA 3AU2A 4BBSG 4EYIB 3F2CA 5J0SA 3EN2A 3STBC 1XJVA 1T7PA 5DB6A 3K9PA 5J0XA 4QL5A 3CW2C 1OTRA 7ICUA 3PX6A 4Q43A 4ED0A 5IWAQ 5FLXc 4JBKA 1L3VA 2K14A 3FKIG 4JI7Q 3M7NA 1I94L 2JA5H 4J9MA 4YXJA 1RXWA 4DV2L 4X65L 3OGUA 1BPDA 5KFHA 2BPFA 2UUAL 4B9TA 3MFIA 4MFFA 1JE5A 4BXXG 3M4QA 1YHBA 4LUVA 4DR3Q 4DV4L 1OXTA 3BZCA 1CSPA 3JAMc 3HOUG 1L3UA 5M3FG 5DDMA 2M9NA 4GOPB 4MEYA 1VQNA 4A3JG 3PMNA 4ALPA 5HP4A 3NTUA 2HIXA 1A62A 2ID0A 2PFQA 5J2HA 4BDPA 2R92G 4ME3A 4DS5A 2R8HA 8ICBA 2CFMA 1CKOA 4HJAA 5KT3A 2HIVA 4HYKA 2XCPA 1X9SA 5KT5A 3H15A 4P2HA 3JPSA 5IYCH 2EKFA 4K4HA 4TUPA 2RDJA 2L4FA 2Y0SE 2KZZA 2DZLA 1KFSA 4I28A 3MXNB 4F4YA 1M90C 3M3YH 2HHXA 2A1AA 3GFKB 3NELA 3KJPA 1YVCA 2VUMG 4MFAA 4RNNA 2LYHA 1RYRA 5EAYA 5IWAL 1U48A 4YWLA 4C3JH 4JI7L 5IT9c 1ZQIA 1YHAA 2L15A 5DBAA 4K4IA 4A3DH 4A3LH 1K1SA 4J9OA 4IO9A 4XQ8A 4KLDA 1PH6A 3EYZA 5L1LA 3RJGA 5M5YH 3T6PA 2PNHA 1NJWA 1KC8C 3RBDA 1MC8A 3PV8A 4DR1Q 1FJGQ 4AYBE 1IL2A 4DLGA 4MTNA 4QQBX 1JMCA 3M8RA 3T1YQ 5KFYA 2H5XA 1AE3A 1IZ6A 1S97A 4DAYB 4NM2A 5DKWA 5K36G 2MAXA 2DPJA 1IBKQ 2C2EA 3HW8A 4O5CA 1ZQBA 2MGWA 2DI0A 1JB7A 4DSKA 3H8WA 2F1IA 4PZ7A 3CP0A 3OHAA 1FGUA 4KLUA 1SG9A 4LF4Q 2R8KA 4DL5A 4GOPC 4P4OA 2QNJA 4QZGA 2JY7A 3PNCA 4C8LA 8ICOA 4YHHL 1E24A 3H8JA 4RNMA 4JK1A 2UVVA 1V43A 1EOVA 2KFNA 4KN4A 3C21A 1TV9A 3K80C 2R92H 1PA6A 3ISCA 2BCVA 4C8OA 3KF6A 1AROP 2RCNA 4GS3A 4X6AH 3KHGA 1DO2A 3W1BA 7ICIA 1Q82C 2R7FA 3TEHB 4DR1L 2CCZA 1FJGL 4P71A 9ICEA 4Q7JA 2A1JB 4MF2A 3U4ZA 2VANA 5DLGA 3C23A 4RU9A 1U47A 4C8MA 3L0OA 2VUMH 4YMNA 3JPQA 4B3MQ 2JY5A 2CQOA 3B0XA 2AU0A 3HX0A 1WJJA 1AH9A 1IBKL 3C5GA 1NK8A 2NRTA 5J2JA 1WGLA 2WTFA 2N49A 3I56A 3BBZA 3C2KA 1ZYQA 4EQ5A 1XSPA 3V72A 1X55A 1XMOQ 4OONA 1SR3A 5KFKA 2LVAA 3K9OA 2JEIA 4KLGA 4JI6L 5FLMG 4LF4L 3GLFE 4OWXB 4BA1I 3PO2G 2D0OA 4PHDA 2AJQA 9ICWA 3ZDCA 4EX5A 1NMFA 3PUVA 3W1GA 5KFMA 2XC9A 1XU4A 1Z3EB 1QSSA 4R8UA 1Z47A 4XIGS 3CC7A 4JG2A 3TQYA 4M04A 3SI8A 4R65A 2J6SA 1HT1E 2EQSA 1Q8KA 2BDPA 3RR7A 1XO1A 2CP8A 5E7NA 2P6UA 1L2FA 2MO1A 3GIKA 1YEZA 1L3SA 4LF9Q 4B3ML 1MJCA 4EYHB 3HT3A 4HIMA 5KFOA 2XY7A 4X66Q 1AE2A 3G71A 3ZDEA 7ICQA 4O9MA 3ICEA 4DPGA 1XMOL 3S1MH 4P74A 3PUWA 5J0YA 4B9LA 4EZ6A 2HHQA 1SL2A 2VA3A 1JJ2A 1BPYA 5KFNA 4YMMA 3I2ZA 3QZ7A 3U4VA 7ICFA 3PO5A 3HPOA 2UXCQ 9ICPA 2YU9H 1CKNB 2IT1A 3SYZA 2C35B 4F4KA 3KHRA 2WB1G 3MR3A 2YYZA 1OXUA 4YCWA 3T5LA 3IRBA 3TQ1A 5IYBH 2ZUBA 4OX9Q 1BVSA 4GKJQ 3FDSA 2WAQE 4WJ4A 3MDAA 3CCUA 4UP8A 4BBRG 2XO7A 1VQKA 2K5HA 1UT8A 2JNHA 1U9LA 1NY4A 1QVCA 2KN7A 3HOYG 5FLMH 2HVHA 1Z9FA 4YWKA 2KCMA 4LF9L 3F8TA 1OXXK 2JZ1A 4TUSA 8ICFA 2FLLA 1Q86C 4QIWE 4JI5Q 4DNIA 3OSPA 1U0LA 4KTQA 4A3BG 1SMXA 4GN4B 4KMUA 4M9HA 3T3FA 4HEOA 2JA6H 2GWSA 5KG2A 3OYYA 2AWOA 2DKLA 4YR0A 5C4XG 3NGDA 3UXOA 1IFYA 1BBWA 1PH3A 3ZDAA 4B3SQ 2Q2TA 4E0DA 4O3PA 3KFUA 4HIOA 1HZ9A 2OQ0A 2V1CC 4M9LA 1DOQA 4TVAB 3W5OA 4O5EA 4Z6DA 1NMGA 3HKZG 4JI4Q 4DR7L 4YN4A 4GLAC 1PH7A 5EWFA 3GDXA 4RT2A 4NM1A 4J9LA 1K83H 3WWVA 4OX9L 4GKJL 4G3OA 3NBHB 2I0QA 1Q02A 3MFHA 3Q8LA 1LTLA 4LF6Q 1BPXA 2BQRA 5KT2A 3HOXH 1W2BA 5JJKA 2DNAA 5KFIA 3AFQA 1HJPA 2I9GA 5J2FA 1N36Q 4RQ8A 2Q2HA 3A0JA 2F3IA 1TWHH 2KHHA 4QZFA 3F2DA 4JI5L 4DK3C 3S2DH 4ED7A 1NE3A 2QEXA 4RQ5A 2RF4A 3H4BA 8ICMA 2HHWA 4KLTA 3M4PA 2LVQD 5J2DA 1U5KA 1QZEA 4F3OA 3EPGA 5M5XH 4GXJA 4B3SL 1VEKA 4A3GH 1WYDA 4I2EA 5IINA 2AGOA 1VQAA 3CC2A 4ECVA 5HNKA 3RJJA 8ICUA 9ICIA 4JI4L 3QZ8A 1C7YA 4UN2B 2W9BB 2W9CB 3V6JA 2ISOA 5GADC 5IP7H 1MSWD 5KFGA 8ICJA 3OTOQ 2LVOC 2EJSA 4UY8C 3G4SA 3DM3A 4JV0A 2DAGA 3ZD9A 2BHNA 2PI2A 2BCRA 2FMPA 4QWCA 3J7ZC 3UDIA 1GO5A 4DR5L 1SL0A 4GLVB 1E7ZA 5L1KA 4R4TA 1CUKA 5DG8A 2DPIA 3RLFA 3UE1A 3OW2A 5C4XH 1N36L 3EPIA 1XTDA 5C0XG 3T5HA 2WB1E 1NK4A 3B6YA 3M85A 5DQIA 4UBCA 4ED8A 1SL1A 1ZQCA 2NN6I 2NVXH 1HR0L 2IX0A 1FL0A 4ECZA 1S0MA 2JZ0A 4L5RC 1IXSA 3RN5A 4KLSA 4UBBA 3AU6A 3I7FA 8ICCA 2MO0A 4IPCA 4L5SA 1X9MA 5LMUL 3UPQA 3RJKA 2BQUA 2NVYH 2KENA 1X9NA 1U45A 9ICJA 1HNXQ 1ZQTA 3GIIA 5J0OA 4BXOB 3GTLH 3OTOL 2BH2A 4X5VA 1VQ8A 4DAMA 2MUTB 2FPKA 3LWMA 8ICQA 3V7JA 4J9QA 4A3IG 5F9LA 1T8EA 1XWLA 4JYAL 3C1YA 3OJSA 3A5ZB 3PGZA 4J9NA 1NJZA 2JEFA 4MF8A 2K5NA 1X9WA 5AJ3Q 1RYSA 3RZDH 3JAMi 3RTVA 2AQ0A 2Y0SG 3CF5A 3S1RH 2ZJAA 3FE3A 3A74A 3PV0A 3CCMA 4Y52H 3SGIA 5KFTA 3HKZE 2W8KA 4FO6A 5J2BA 2FMQA 1TWCH 3CCRA 3S24A 2UXDQ 5DLFA 2JA5G 1Q1EA 4YCXA 4RQ1A 4J9SA 4KLFA 1ASYA 1XS9D 2KCTA 3LDAA 4PMWA 1J6QA 2FPLA 1B22A 1ZQSA
chains in the Genus database with same CATH superfamily
7ICNA 1NKCA 1D8YA 5CR3A 4B3RL 4UB3A 1ZETA 4PHPA 4DFJA 1CZWA 4IFDI 4C4SA 1HNXL 3Q8RB 1Y88A 5KFLA 3ULPA 1NJYA 4JW0A 3E58A 3QEBZ 1K8OA 3QAUA 3A56A 4YMOA 3V76A 4O5KA 2NVQH 4LF5M 1AN8A 1S9FA 3GIMA 2KEYA 4IFDH 3JPTA 4KKUA 5GROA 3FEWX 3M9OB 4A3LG 4LJ7A 1U4LA 5CBEE 4YD1A 4DS4A 3KK7A 2JP1A 2ZIXB 4PL1A 2NBFA 4QGUA 1N32Q 1NR4A 4B3TM 3S1QH 1RJTA 4PH5A 3TADA 2PQAA 4M6WA 1T3NA 1XPOA 4IL6U 1WD1A 1RTNA 3M9BA 2NUCA 2UU9Q 2FH0A 1VQHA 1KRPA 1VQ7A 1Y1VH 5IIMA 4RH6A 3SC3A 3NSWA 1GKHA 4IQTA 1CEZA 2QQ8A 2XI9A 2PMZC 5KPRA 4QJFA 5J1ZA 3Q8GA 1YJWA 4F5OA 1R9TH 2EH9A 3D2SA 1PK3A 4RQ4A 2LXJA 4NL9C 4L8JA 2ZJRA 4DUZL 1OAOC 1X3FA 8ICWA 2EE1A 2AKWB 1AEXA 1X3EA 2F76X 2CXYA 1NVMA 4C0ZA 2XGPA 4R4IA 4DOCA 1SE3A 4ZAIA 1H38A 4AQYM 3NXWA 1G59A 4R63A 4YY3L 3E4RA 4I7AA 3NUQA 5DB8A 5DLQE 4A3KB 4PPXA 3PO3H 2DENA 1TFRA 1TS5A 2E5LQ 5JEAG 2OEHA 3KSJA 4KLKA 4Q45A 5C18A 2JJQA 2DJFC 3KSXA 1EYAA 4M47A 2Z6KA 3H3VC 3KDSE 2Z4RA 1S3OA 4GKKQ 1MQ3A 2J5YA 4M2YA 1HZAA 3TPZA 1S5ED 5J39A 4JV5L 2JV3A 3MEHA 2Z0SA 1V92A 1H9SA 2WAQG 4LUOA 3GO5A 2JMGA 3K5MA 2WZJA 4LJ8A 4JI1M 5KL8B 1WG8A 4F4ZA 4QZ9A 1XNQQ 3CGWA 2ALYB 8ICNA 2AMCB 2F5OA 4KJOA 2E8MA 4B9SA 2QBYA 3M4OH 1CM9A 4PZ6A 2Y21A 4F7XA 1G6PA 1KRSA 1MN3A 2LMRA 3NEMA 1VDZA 3KF8B 4UAZA 1LLRD 2D0PA 3CMAA 5CJ7A 4F92B 3LWEA 3RAQA 3CAMA 4A3CH 1K1QA 4CIZA 4KLNA 4QWEA 1WI5A 3JC66 4FS2A 2V4DA 3KDFB 2ESEA 4JBMA 4UAIA 4GHLA 1NK6A 2K4KA 2HQEA 4BUGA 4QHTA 5J29A 1Z7TA 1SJED 3BQ1A 3EZ5A 1CQVA 2NTTA 2PMZE 1CT1D 2JA6G 5I2XA 1IKLA 2BQ3A 2XCAA 2WSFF 2YMPA 3C3DA 5JOBA 4L6V6 4KITB 4TQRA 4ID6A 1HQYE 5DG7A 7ICSA 1EWIA 2RQ5A 3GTQH 4BY7H 4UB6U 4OXPA 1NNLA 5AM4A 3RZOB 2B3TA 3QYBA 2JK8A 5DM73 1TWFB 3HX3A 3HJSA 1TY2A 3HHYA 4PV1C 4DNRB 4XUSA 2R6GA 1GVNA 3GP7A 4TQSA 5FOBB 1PFNA 4AW4A 1ZQMA 7ICRA 3UXPA 3TAPA 3KHLA 4R4CA 5KFSA 3R9XB 1STAA 1YNXA 3GPPA 1ZQXA 3PUYA 3A54A 2ASBA 4P0QA 2KNZA 1VQ5A 4F5QA 4JK1C 1ECWA 4X66L 4A3KH 3HOWB 5L37A 3IG8A 1Q3UA 3J7BA 3OSOA 2VA8A 3GV7B 4FO2A 2ERCA 2ZTCA 2CV2A 4JI3Q 1NKEA 1LT3D 5EE3A 5IIIA 3QE9Y 4CKEA 1SB3C 4YVZA 1SYDA 4J6HA 1ENCA 1YHQA 1Y14B 3HJEA 1GD7A 3J7AF 4MZ9A 5J8YA 1PLFA 4R66A 2HBMA 5HGQA 5EJCA 1A5TA 5J0RA 5AIAA 1SNOA 2KCNA 4BWJA 3C28A 4KKSA 4JI8M 1O7ZA 3TP6A 3J7AS 1KFDA 2QW7A 3E9SA 5FTKA 1S0VA 1GL6A 4H7BA 1LTGD 3DZDA 1NNUC 1B3QA 4A3EH 4RAUC 2AHOB 1W3SA 4RA8A 4LJ6A 3JPRA 2GH1A 9ICUA 1KYIA 1BR9A 5ALLA 2AQ4A 5LMNQ 3JPOA 1XWIA 5AM1A 1I4PA 5DBCA 1WYGA 3AFPA 2EAMA 2QLTA 4OHJA 4ULLA 5CGKA 4IBJA 2N1RA 1Y1WG 2YY6A 4AI6A 1B0XA 3I4MG 1WFQA 2HAKA 4DO9A 2V4QA 3QWLA 1FGBD 4OGQC 3GQ5A 4R71A 4LF8Q 3JAML 4I29A 2NN6H 4CDDC 1WXQA 1HNWM 2F4VM 4G9BA 4K5WA 1TWAB 2C22A 2XEPA 3RZOH 2EZZA 4X64M 4I7ZC 4I5SA 5GQOA 2HW3A 1TWFH 4QWDA 4GIPA 1KW4A 2N3SA 1EYCA 9ICBA 5ALYA 2C96A 1Q1BA 5C3EB 3NVVA 2W55A 1GL7A 2R8IA 2XVTA 3J80i 1KDAA 3KLRA 1EQRA 1HZBA 4RCOA 4LVSA 5FTJA 2W3RA 3OTQA 4J9KA 2L11A 2F52A 2UUCM 2CV0A 4CCHA 1XNRQ 3KTQA 5C44B 1NY5A 3U6PA 3HOWH 2ZM6M 1ZQQA 1PH8A 1DZ1A 3UE0A 1V1QA 4AZFA 5IIJA 1GXDC 5AI0A 1BGXT 2Y9UA 1XXHE 3F92A 1DM0B 1ZJNA 4KLEA 1L2CA 1MU5A 2XFTA 4JI0M 2EDGA 4ZYSA 3TREA 2B39A 4X65M 5JJIA 4UATA 3MZ5A 4II7A 4K2KA 3CCVA 2KQ3A 3NRZA 2LWXA 2WV6D 2J0TD 2JH7A 2ZAMA 2CWPA 2EIFA 4C4RA 4LF5L 2R7ZB 3HOZH 1TAQA 1WD0A 5ELNA 1D9DA 4LZZA 1OFIA 5AKGA 5KG1A 4XYQA 3S15B 1PFSA 1KN5A 3GQBA 3BQTA 2G08A 5ALSA 3C2LA 1X3QA 4CF3A 1JOKA 2CW0D 3J80c 2EYHA 4ED1A 1P16A 1XTCD 2E8GA 2OH2A 2ZXOA 1D0KA 3MC1A 2EAOA 4IRCA 1VQIA 4ZRZA 3JAME 2IY5B 2I6XA 2PQAB 4M6WB 1V38A 1N78A 2HOIA 2JEJA 1YITA 2K52A 2Z3XA 2NO4A 1VEJA 4K4GA 3WHKA 2JE6I 3WK5A 4YHHM 3NBXX 2OM6A 4NPSA 5M3MH 4NXMQ 4WRDA 1UA1A 3RB4A 4PGXA 4QJFB 1X32A 4UAYA 1VQPA 4TSSA 4A3MH 1TWAH 3CRKC 3N4MB 4KJNA 3NTKA 4HMIA 1MN8A 4AQYL 1EWCA 4A75A 1HCZA 4KLOA 1G4AE 2N55A 3RE8A 1N33M 4WORA 5C3EH 1CI3M 2XF3A 2W43A 4L6TB 5EPKA 5J0TA 2K7VA 1EQVA 1I3QB 3MHVC 3TFSA 2I7PA 2YB4A 1BCPF 4F2LA 4RUCA 4F91B 4JI6M 1F9QA 2LNHC 1U9RA 2BA0A 3IDWA 5D3IB 3EW9A 1XMQQ 3ZD8A 2Y1IA 1X56A 1IYJB 2BPCA 4LFCQ 1OXSC 1CHPD 1H9SB 3Q8DA 1DOKA 1NV9A 2W9MA 3FUXA 3V6HA 1YNJD 5FJ8G 3PSFA 4DV7M 3GV8B 2QBYB 1DXSA 4P4PA 4PGQA 4PHAA 3C29A 5C3WA 1LKYA 2MJ8A 5L9XA 3BDPA 4UHVA 3MR5A 2DZNB 4P72A 4US9A 3K5LA 1TH2A 3UMBA 1N48A 2DXIA 3FTDA 5GAEC 3T1HL 4WW0A 3TKAA 3U6MA 1QDRA 4K8JA 3PW5A 4CDFC 1I5FA 4CDCC 1S8OA 2R7ZH 2M00A 3QOJA 3AUOA 1EY7A 2HVIA 2EJGC 3S15H 3KOXE 7ICTA 4DV1L 3QOLA 4LFAQ 1M8AA 1IBLQ 2HHHQ 4OIJA 4KT0F 9ICTA 2RKSA 1CA6A 4UB2A 3KS8A 4YG2A 4DU9A 1WHCA 2UVUA 3F5EA 3K57A 4FNFA 5BN5A 1F4IA 2D9UA 1IYUA 1B50A 5AM3A 2K4EA 5BR8Q 1SJHD 2FDRA 5JPNC 5HMLA 4IOCA 2BKEA 3BVMA 3K81C 3TI0A 3K8AA 4XQNA 1Z1BA 3C5FA 1A8VA 3PIP3 4F50A 3TFRA 3H0LB 1I4WA 2ZAOA 3DMUA 2NRXA 2LBCA 3TANA 1YT3A 2BDUA 3GV3A 1R4QB 3NE5B 4J15A 3K0YA 3QO2A 5DQGA 1GUNA 2C2DA 3BYYB 2DY8A 1ZKOA 3ULLA 2NV3A 1IY2A 2C98A 7CATA 2Z1CA 1X2IA 1OXJA 1FNUA 5IILA 4P0QB 4NC6A 3ZCBB 1L1OC 4DR5Q 2EZXA 2RGOA 4K0KQ 1ZD4A 2DAIA 5EGTA 4PG3A 1A0IA 4RKUF 4RPZA 2XWJB 2J4XA 3RB0A 5CORA 4ED6A 5D3DA 4EX6A 1HR0Q 5KRUA 4IFDJ 5GKNA 3VKHA 3BZKA 4XT1B 2Y20A 1ZQJA 1HT2E 3MTSA 5DYIA 5E1FA 2HHTA 5ISRA 3A8KE 3CRLC 2I5MX 1ZQVA 4D80A 5LMUQ 4BXOA 5AKYA 2D2CC 4QZIA 2MUTA 2VB2X 5H1SE 4L15A 1D8BA 4H0LC 5AK3A 1QVGA 4B7HA 4HJ5A 3W3AA 4JYAQ 5IIOA 4QY7A 3VC8A 2WF9A 2Q4TA 4KY6A 4JI8L 4BWGB 4I2HA 1A77A 1ZMWA 5BN4A 1PRTC 3PVSA 3PSTA 2C2RA 2F4IA 1AZQA 4DUYQ 4DK1A 3RB3A 1VQDA 4JI2M 4FFDA 2Z6BA 2YTVA 3QB3A 2ZIWA 3G6EA 4NY8A 3H8MA 3IHPA 1TE2A 3LWLA 4HLQA 1YI2A 4BBSB 4B3RQ 2RHQB 1K8GA 2LKVA 3SAWA 8ICHA 5IGCA 1L7MA 1JWMD 2KNVA 3FKEA 3KOWE 2GVAA 5DYGA 4I2GA 2D6FC 3FKIB 4NLGA 3DA1A 1B7YB 5KG5A 9ICOA 2ZJ5A 4EEKA 2KVSA 4IPGA 4OO1G 3HOUB 5ALTA 5M3FB 4RZRA 2F0NA 3D4RA 4G6ZA 1JXEA 4QNLA 4UB8U 2W9AA 1PYSB 2DHYA 1HNWL 3OWFA 2Z9HA 4R4QA 3AQFA 5DGAA 2DUDA 3D8LA 4F8RA 3B7ZA 4LF7L 3H7IA 2P5ZX 4QW8A 1LTTD 3M7GA 4KHZA 2A6ED 2ATWA 5E4WC 4B9MA 2EYOA 1L3TA 5IZ7D 2YMMA 7ICKA 1BNZA 1XB2B 2UUAQ 1B2TA 3SAHA 5H2FU 5KNIA 2OT2A 4DR2M 1K8AC 2O6KA 4QNMA 3U6LA 3PCOB 1IIPA 3LW5F 1WTXA 3K2LA 3LX0A 2R0IA 2MH8A 5DGBA 1H9RA 3SK4A 1T94A 2W03A 5J0SA 3STBC 4LGYA 4QL5A 2WAQB 4Q43A 5IWAQ 2RGHA 1N32M 1L3VA 2K14A 4JI7Q 1I94L 4YXJA 3FTCA 4X65L 3OGUA 1WTWA 2BPFA 2DKXA 4B9TA 4UAVA 3L2AA 2L55A 4BXXG 4DV4L 1OXTA 1K3XA 3JAMc 5DDMA 2M9NA 4MEYA 3PMNA 2WF6A 4ALPA 2EOTA 1A62A 2OHFA 4BDPA 2R92G 5EE0A 1CKOA 4HJAA 1X9SA 3H15A 5IYCH 4K4HA 2F8LA 2DZLA 2A1AA 4C7ZA 2NVTB 1C48A 1RYRA 4YWLA 1GJXA 3PO2B 3GU3A 4KX5A 2M0NA 3T13A 4K4IA 4HAIA 2CHVA 1G8ZD 4A3LH 4V190 4KLDA 1PH6A 2PNHA 1NJWA 4G7HC 2KCCA 1MC8A 2WF5A 3A0HU 2B8FA 1IL2A 3NHHA 3DEPA 4NLCA 1FIQA 2OYYA 1FJGM 1VDVA 1PTOH 4PJ0U 1JB7A 1NNJA 1K83B 3SFZA 3CP0A 4EQOA 3OHAA 1HXYD 2DGZA 1FGUA 4KLUA 1SG9A 2R8KA 4DL5A 4GOPC 4P4OA 1NI3A 4YHHL 4E6IA 4RNMA 4JK1A 3I8ZA 3X3NA 2UVVA 1Q3CA 1G91A 4LF4M 1JB3A 3K80C 1TWHB 1RTOA 3KF6A 2RCNA 2W11A 1DO2A 5ITXE 3W1BA 7ICIA 5B5EU 4NMZA 1Q82C 5ITRA 2KSOB 4Q7JA 4MF2A 4BBRB 4NOOB 2VANA 5DLGA 3C23A 2DNCA 3L0OA 4YMNA 3JPQA 1BDOA 3B0XA 1WJJA 2NRTA 2R44A 5J2JA 3SD7A 3C2KA 2O5JC 5KYLA 3V72A 3J81L 3PMFA 5JEAH 3K9OA 3BS5B 1RD9D 4KLGA 3VK7A 4JI6L 3WK8A 4OWXB 1XWEA 4PHDA 4ANRA 5LL6S 3PUVA 3HS0C 3ALRA 4UASA 1XXHA 2JXNA 4C3HG 4XIGS 2XZUA 3SI8A 2K1BA 1HT1E 3RR7A 3QNMA 4G4KA 4WFN3 4UAUA 4BJQA 3UM9A 1MJCA 3HEJA 4GIBA 3VYTA 3DWQA 1STHA 1DGHB 4X66Q 3G71A 3ZDEA 3ICEA 1S3SA 4EZ6A 1SL2A 1JJ2A 3HPOA 2O2LD 1ENAA 4CDEC 1LKYB 2C35B 3KHRA 2UXCM 3T5LA 2ICEC 2QB0A 2ZUBA 4LJ4A 4OX9Q 3IRUA 2RDFA 4WJ4A 3CCUA 2KKPA 2PYKA 1EIJA 1UHUA 4GKJM 4ICAA 3AOEC 4CJ1B 1S5LU 4LF9L 1BNPA 1OXXK 4S12A 2JZ1A 3U26A 1PVRA 1JI7A 4DN4M 1SMYD 5EKIA 5G3LD 2JA6H 4K14A 3OYYA 4YR0A 3HGBA 5C4XG 1BBWA 4RFBA 4B3SQ 4O3PA 2OQ0A 4TVAB 4O5EA 5AM5A 4YN4A 1E2ZA 3TZUA 1K83H 3WWVA 5JRTA 4JI4M 3NBHB 5ALRA 3DHQA 3Q8LA 1LTLA 2BQRA 4A3IB 3KFUF 1W2BA 2EANA 5JJKA 3AFQA 1HJPA 2LI6A 4C2MB 5J2FA 4LF6M 1N36Q 1STNA 3L26A 3I4YA 1B3AA 1F9RA 1Q8IA 1TWHH 4JI5L 4DK3C 4ED7A 2QEXA 5AIBA 4RQ5A 1X3PA 1QOHA 2ENBA 1S5FD 4KLTA 5J2DA 1HTPA 4CHTB 1WTRA 3NBIA 3EPGA 2ZIVA 2PKEA 3J80S 2AGOA 3CC2A 4ECVA 1F2LA 1DXMA 1C7YA 3V6JA 4AYBB 1U4PA 1L7OA 8ICJA 1WTVA 2XN9C 4JV0A 2DAGA 3FUUA 2BCRA 4FZNA 1F2MA 3J7ZC 4R4TA 1CUKA 3M3YB 1OO9B 3UMCA 5C0XG 3T5HA 3PFIA 2BE5D 3B7NA 5DQIA 1SL1A 1ZQCA 3TN2A 5JJZA 2IX0A 5ALHA 1FL0A 5BPVA 3ONNA 5LMNM 4A3DB 1AW7A 2Z4SA 4KLSA 1C8CA 3I7FA 2MO0A 2KZUA 4ZCKA 1X9MA 3SAGA 5GTHU 2KENA 1ZQTA 4BXOB 4X5VA 1VQ8A 2QCPX 1DGFA 2MUTB 4DAMA 2K8CB 1TWGB 5DNYA 3UJNA 3RZDH 1KLUD 4Y52H 3SGIA 2V1UA 2Y0TA 5J2BA 3S2HB 4RNAA 2UXDQ 2JA5G 3AV0A 3WKBA 4YCXA 4RQ1A 1ILPA 3OIPA 1ASYA 1XS9D 2KCTA 2DWNA 4PMWA 1FFVA 1J6QA 4LJXA 1Z4OA 2L4EA 2HKJA 2ZIWB 3KLSX 5IT9L 5M5WB 5ITUA 1ET9A 2PMZB 5ALZA 3A8IE 3ZI4A 3VKGA 3FYHA 3RAXA 4NLBA 2KMDA 3PF5A 4R8IA 5IREB 1TS3A 3U60B 5LMNW 4XBOA 4DV6M 2A6HC 2E75C 3LWUA 1TY0A 1G41A 3SR6A 5KAIU 1Y1WH 4ZQ3A 7ICHA 4XRHA 3TRZA 2JHDA 2L5TA 1WVLA 5C3XA 1XO0A 4F2SA 1PYWD 2MJ5B 4B3TQ 4A3IH 4IN3A 1JROA 4M9GA 4DL7A 4C2MH 4OJPA 2NRVA 1PTOD 4QIWF 3RH6A 4GC6A 2LMCB 1C9OA 1TVAA 4KK7A 3JPPA 2WHEA 2Z8YM 4DR2L 1O7LA 1VDLA 1GUOA 4KO8A 4F71A 3RJHA 1X40A 3GQ3A 3RN2A 3RH4A 1VS0A 3TP8A 5F3XB 4CF5A 5JPMC 4IRKA 1PVOA 1S4ZA 4I2FA 2Q8IB 5D49A 3D6JA 2YU9B 2Q8RE 1QSLA 3BJUA 1B43A 4PQXA 1U4MA 2VIXA 3L7ZC 1YNND 1DONA 1IL8A 1LTID 2ZTEA 1N32L 1TXYA 1PHJA 5H37D 3BQ2A 2OEOA 1LUZA 2UU9L 5C4JB 3Q8PB 3AQQA 3GD7A 1WR1B 3AL0B 3TS2A 1A2UA 4O3OA 2B2WC 1II3A 4RPXA 5AI8A 5AK4A 4F1IA 3SMSA 2BOSA 4R64A 4KLIA 2I5HA 1TWGH 2A1JA 2KV2A 2IOHA 3K1RB 4JI1Q 1N8RC 1NV8A 4IR9A 1RF2D 4DL3A 5IT9E 1UE1A 3D4DA 1N5XA 3E21A 2I46A 2WB1F 2DZOB 5EOZA 3PZPA 3FRIA 3S2HH 4FW9A 4LNQA 4QZCA 3F2BA 4JXJA 4QNRA 3CCSA 1F77A 3MAQA 2NZHA 3S2DB 2IOFK 1F2ZA 1PJTA 2E5LL 4QW9A 1RQNA 5M5WH 1M6YA 2ATLA 1IBMM 2DAEA 3MR2A 4PL2A 4YCUA 4LUZA 2GVBA 3VA7A 3T16A 2EXDA 3H4JA 3GLIE 5G3LF 3S17B 4GKKL 2XH9A 5IYBG 5E3FA 1E9SA 4HIKA 3HKZF 5E79U 1R4GA 3K1JA 1QE6A 4OJLA 4P0PA 4ITQA 1XNQL 4DR6M 4XK8F 3PW4A 3H3VI 3OJUA 1L1OA 1DGGA 3E5SA 4A3KG 4IS7A 2LSSA 3PUZA 5IGDA 4LZDA 5JVG3 3RJFA 3KF6B 3MABA 4JPBW 1VQLA 3J81i 3AOGA 4I2AA 1L8LA 3PR5B 3BYTB 1IKMA 4UB5A 3URYA 4Z6FA 3H3VH 4YIJA 3B89A 2IX1A 3WHLA 1ZRMA 4A4IA 3R93A 4ELVA 1RIPA 4KHPM 1QG7A 2AXTU 3HOXG 1A3UA 1PVQA 1OAIA 1SFOH 1K5OA 1ZQZA 4N9TA 5CV9A 2D3DA 2DAMA 3FDTA 3SHLA 3JR4A 2DUYA 5IOCA 4Y2TA 1STEA 1XXHB 9ICSA 1A15A 1BCPC 3RJIA 2XSZA 4R9WA 1BPBA 1L7PA 1HH2P 3V7KA 1YIJA 5J0QA 4C3IB 3RR5A 5ALGA 3E46A 2JY6B 5KPTA 2HBJA 5FJ8H 4IPHA 4XTCS 1BPZA 5C4JH 4BGDA 1KDBA 2O5RA 3KBGA 5A2QL 1MSHA 5KFXA 2KZ3A 1ZQHA 3I4NB 4P17A 4OVZA 4IBIA 5EKKA 4ELTA 2JUJA 5EWEA 2UXCL 3EIVA 4EIWA 4DV3Q 1JIHA 3GTPB 2DL0A 1IN7A 2PFOA 2KICA 3D4WA 5DFLA 5B66U 1QUTA 2QB0B 2MU2A 2W9BA 3VR5A 3J81c 1EY5A 2B3GA 3HHZA 2ES2A 5KT6A 2NN6G 4DKAC 1KTKA 9ICMA 1L0WA 1ILQA 4JI8Q 2OXOA 2G09A 3BVZA 3OHBA 5HMMA 5C4HA 3JAMS 4K0KM 1J97A 2R3ZA 2L4NA 4ECQA 5D4BA 5KFZA 3S17H 3D8BA 4FP5D 4F8MA 4PMCA 2L6OA 4L8RC 4ILWA 5ITXA 4I4LA 3SE0A 4LF6L 3GPYA 2RLTA 1F0MA 1ZXTA 2L09A 3WK7A 2B21A 4FXDA 2N8NA 1KSFX 2R93B 2JEBI 1LTSD 3RBEA 4AKHA 4DL6A 3HOWG 3GLGB 2FMMA 3CCLA 4DF8A 2P35A 8ICRA 5KYIA 3HWTA 5FK9C 1PTOF 4MNOA 3MJ5A 5AKKA 4DWIA 2FLPA 3GV6A 2ZXRA 4RQ7A 3I28A 2ZIVB 2I07B 2E2JB 2F4VQ 1HNWQ 3M4YA 2JA8B 2ZXIA 3E0JA 4X64Q 1MSGA 3SBJA 4GZYC 3RNUA 3SMPA 3I4LA 2B6GA 1NK5A 1B4OA 8ICPA 3W2DA 5ALQA 5KG4A 1FNNA 4DV0M 2FLNA 2NZOA 4DSEA 5LMNL 1EFID 2DHRA 1E94E 4X3UA 5KFJA 4O3SA 5A2QE 1HR0W 2F0DA 7ICOA 1PYBA 9ICNA 2RKOA 2UUCQ 2Y1JA 2E74C 3GLHE 3H4DA 4DA2A 2ZM6Q 2HDMA 2ZIXA 2DKZA 3P1HA 4F2RA 2E2IB 3SHFA 1UWVA 1G3IA 3C1ZA 1KIXA 1PDQA 1B70B 3L5KA 3P75A 3S1NB 5L1IA 4AIMA 3I4NH 3OSNA 2JA7B 2G5GX 2WFAA 2IBKA 4JI0Q 2BCUA 2VKQA 3RFWA 2UVRA 3QXGA 1RCVD 1S0OA 4EBCA 4JBJA 2A69C 2H4OA 1KD1C 1HTLD 1MJEA 4GOPA 1SXDA 3QU4A 2UUAM 1WGNA 1IG6A 4XQJA 2P6RA 4R7GA 3T5KA 4NRVA 4DEZA 4QZHA 1TKDA 2CV1A 1ZD3A 2F5QA 3FHWA 3MXNA 4IBCA 4FBTA 3WK4A 4IRDA 1XNRL 2Y0QA 3HKPA 2ODGA 4NV0A 3PQIA 3GRRA 2JP7A 2FS1A 2SNSA 5JEAJ 4FCVA 1PRBA 2ASJA 4CRXA 4JWMA 4DOBA 4Z6EA 5C3EG 3J27B 2PFNA 1LM0A 2DF4B 2IMWP 2A74C 3LK9A 4MH0E 4IQUA 4RQ0A 4DAYA 3HKSA 4G3IA 4IUUA 1UNSA 2R93H 4ED3A 3NVZA 1IXZA 4NSRA 5ITYA 5C44G 1F9SA 3GTGB 4KLLA 1ICFB 4GC7A 1LV5A 3UZUA 1NAPA 4LK1C 3CCJA 1Y8GA 2K75A 4I2BA 4F87A 4JCVE 1TT2A 4YHHQ 3A8JE 3PIPA 4NLZA 3MFYA 2RRUA 2R8JA 2N35A 4A8EA 2E2JH 1NY6A 2F44A 2NO5A 2JA8H 3FAHA 1ZQNA 1LV9A 2H1EA 4O2DA 1LTMA 4OJ5A 8ICGA 1KNEA 2UXBM 2A8VA 3LGJA 4DF7A 1N33Q 4UB4A 3V6KA 3GPXA 1TH4A 1VG5A 3I76A 3KDFA 5AKEA 2QCUA 8ICYA 2B63B 3P7JA 2R7ZG 4ZLTF 3TQSA 1QNUA 2F1HA 4IQVA 3Q8SB 2BR0A 4BXXH 3AOEA 4UAWA 4RNOA 1PFBA 1QQWA 1K3RA 4GMQA 4DSFA 4JI6Q 2ZUCA 3IFDA 1V1OA 1L2DA 5C6AA 2EYMA 4IUVA 5HURA 2KEEA 4XT3B 4MFCA 1RL2A 4BA2I 4NXML 1YZ6A 1VQGA 3ZQJA 4TURA 2EYFA 1K28A 4IQZA 1CRXA 1PMRA 2PI2E 4NXNQ 2OO9A 2DFLA 4MHEA 1URJA 1TF0B 2K05A 1EQTA 4A3FB 4GXKA 4RPYA 3L4PA 4DLEA 2F0JA 4DV7Q 3U6SA 9ICVA 5KG6A 3L3FX 3H0RB 4B9UA 4CKBA 4YFKA 3E9HA 1IBML 5ELBA 3TARA 1CKNA 2RBMA 2EY5A 3R3OA 8ICEA 4HJ7A 3K7AB 2IHEA 5AKHA 4NXZA 1RODA 5EQ0A 1GUWA 1WCMB 1HQRD 1SE2A 4LRTA 1XMQL 4KY7A 3VYUA 1NCVA 5EP1A 2K50A 4LFCL 4XYOA 1RXVA 1VQFA 3KD3A 1QB5D 3HRZC 4P0PB 1P8LA 4KI0A 4DOAA 4REZA 1L1OB 3E9IA 3E0EA 3I04M 4R8UB 1JN3A 4PGYA 1HHVA 2ZT9C 3HOVB 3PF4A 1AQ6A 2K89A 2LYBA 3D6CA 3LCVB 3K0XA 2R18A 2EYPA 4KHPL 3CTWB 3PO4A 2OF1A 2KK0A 1K73C 5I6YA 1R4PB 4BWMA 4PZNA 4XDXA 2LTUA 1IXRC 3GRUA 1B4FA 2RDHA 4M1UB 1KKXA 4O3RA 4LFAL 3KOYE 3VR4A 3SYKA 3KUPA 4C3HH 1YBYA 1IBLL 8ICZA 2HHHL 1X66A 2B8GA 1NNXA 2RSOA 1K3BC 2L5YA 1Z5CA 3OPOA 3GTMB 1ZQRA 4JV1A 1PGYA 1PRTB 2K01A 5IE8A 2KHVA 2VF8A 4PDIA 4WURA 4C8NA 2V9WA 1G291 4HSVA 3GZFA 3T5JA 2G5DA 2ZJQA 3HHXA 5BR8L 4U673 3ND8A 4C80A 4CDGA 2X8AA 4YD2A 1YE9A 2R4JA 3MEFA 1N36M 4OVZB 1LABA 3WDNA 3NRWA 2R46A 2PI5A 1S0NA 3GRYA 2KA6B 5DBBA 3PMLA 4IOAA 3I4VA 1EY6A 1SYGA 3BDOA 1TR5A 4KMOB 4KHVA 4RGNA 3PY8A 3D8GA 4AH6A 1O78A 8ICKA 4JBWA 1TU2B 7ICPA 4JC0A 3GLIA 5HGTA 1GO3F 4F5RA 1JWUD 3IECA 1UE6A 1EYGA 4K0KL 1L1TA 4OCZA 9ICAA 3NWTA 2K5QA 4JI2Q 1KDCA 4MGZE 9ICLA 2IHFA 1BQQT 1ZV1A 2R65A 2UVWA 4B6JA 4OEMB 3K5NA 4Q44A 1UPHA 3X3MA 1UA0A 3BDCA 2Y0SC 3SK8A 1TDZA 8ICXA 1D7QA 1VQCA 3DEEA 2PMZF 3NASA 2FHTA 1CSQA 2F0TA 1QILA 1DGSA 2KUMA 4HEDA 1IM4A 1ORYB 2JEGA 1RYUA 4Q8EA 3HOVH 4EVOA 4X62M 5C0XI 4EELA 4A3JB 3VYRA 4DUYL 4AYBC 1LTBD 4QF4A 5CV7A 3N6RA 1UEAB 1L0YB 1KEJA 1VQOA 2VZAA 3RR8A 5ALIA 3AKZA 2VQEM 4J9PA 3ZDBA 4FZLA 2B2WA 2EA0A 1PM5A 3TS0A 1VJ5A 1V8QA 3S16H 2HOQA 4N8FA 4DV0L 2HMXA 3AYHB 4J8QA 3I70A 2OOAA 5C0XH 2VUMB 5IYCG 2FFJA 4HJ8A 4K6DA 3SK5A 5AK6A 3N52A 4DR2Q 4LJAA 2HOFA 1WJ7A 2A73B 5IIKA 3GTMH 1CKMA 1XPUA 2L2DA 5AKLA 1X9XA 3QU2A 3MFGA 2MQHA 1S77D 2W8LA 4BBAA 4K5VA 5CA7A 4UARA 5KNBA 3FYDA 2KJ5A 4FBUA 2TMPA 2ZIUA 4BBSG 3F2CA 5DB6A 1OTRA 5EQTA 3PSPA 2Z8LA 3FKIG 3M7NA 2JA5H 4J9MA 4FF1A 2UUAL 4MFFA 2N88A 3M4QA 1I4GA 4LMQD 1Z6HA 3HOUG 5M3FG 5D65A 2CFOA 4GOPB 1VQNA 4DR3M 3I51A 5HP4A 3NTUA 5ALOA 2HIXA 2R8HA 8ICBA 1QYRA 5A0LA 4HYKA 4P2HA 4TUPA 2Y0SE 1KFSA 1TGUA 4EX7A 3MXNB 4F4YA 2F0SA 4MN3A 3IP4B 3KJPA 1QAMA 2M60A 1K82A 4MFAA 2LYHA 5EAYA 5IWAL 4JI7L 4HSPA 1YHAA 3J80E 1SYEA 2L15A 1K1SA 3V05A 3OOCA 1CA5A 4J9OA 4IO9A 3NTHA 5M5YH 3EYZA 3RJGA 3T6PA 3RBDA 1C4QA 1SBBB 2CH4A 3PV8A 1FJGQ 4AYBE 3T15A 3E0FA 1ESFA 2E2HB 3M8RA 4X3SA 4DR1M 5KFYA 3J81S 1S97A 4Y2XA 4DAYB 5DKWA 2ZXPA 5K36G 2MAXA 3FUVA 3G7LA 1A6XA 2F1IA 1TDHA 5E6JA 4QIWC 2O01F 4IJFA 4LF4Q 3HOXB 2JY7A 4C8LA 2KFNA 3C21A 1N62A 1AROP 2IL8A 4F88A 4GS3A 4X6AH 2E76C 2JXJA 3KHGA 2C99A 4FXKC 3TEHB 2CCZA 1MBYA 1O03A 4RU9A 1U47A 5M5XB 2VUMH 3SHGB 1X6IA 4B3MQ 2CQOA 3GLHA 1O7YA 3C5GA 1WGLA 2WTFA 3BBZA 4EQ5A 1XSPA 4OONA 3AL0C 2JEIA 3GLFE 1XMOM 4BA1I 3PO2G 1NSFA 2A5YB 3R8BA 3ZDCA 5KFMA 3MGVA 3K1ZA 1XU4A 2JXMB 5ALWA 3A7LA 4R65A 2DWLA 2EQSA 2EY2A 2XSCA 3MVVA 3FTFA 5E7NA 2P6UA 5T1GA 2MO1A 2GA4B 1YEZA 4FWDA 4EYHB 3MHBA 2BDOA 4HIMA 1GLNA 2XY7A 4NP5A 1AE2A 2WB1C 1ZYRC 5J0YA 1B9NA 2VA3A 2RVLA 5EJWA 3A45A 1D2NA 2C9CA 4YMMA 3I2ZA 7ICFA 2PZTA 3PO5A 2UXCQ 1CKNB 3CYMA 4YCWA 1TVXA 3TQ1A 5IYBH 1BVSA 4GKJQ 1PFMA 3FDSA 2QARA 1UAPA 4BBRG 1VQKA 2BCOA 2K5HA 2HCBA 3HOYG 2HVHA 1YZ7A 1Z9FA 3Q22A 3IKJA 3R8FA 2FLLA 4QIWE 4DNIA 3OPXA 1U0LA 5F2DA 3HKZC 1SMXA 4A3BG 4GN4B 1EY0A 4M9HA 3T3FA 4EQPA 2GWSA 5KG2A 4Y2VA 3UXOA 1MA7A 4E0DA 1EE8A 1HZ9A 1XHBA 4MIUA 4JI4Q 1R5LA 4GLAC 4DV3M 1K3WA 5EWFA 3M1YA 4RT2A 4OX9L 4DXFA 2M9VA 4LF6Q 1BPXA 1L8QA 2F5SA 4LAAA 3HOXH 2HD3A 2DNAA 3RUZA 3A0JA 2YQZA 4RQNA 4RHSA 2F3IA 5TSSA 2KHHA 2FJ6A 1Q3LA 3EIEA 4WJWA 3EA6A 1GABA 2QKIC 4CF4A 4Z8XA 1STGA 2LVQD 1QAOA 2W54A 5M5XH 3VR3A 4B3SL 5KGUA 1JR0D 1VEKA 2KNJA 4I2EA 1VQAA 3QJYA 4RGOS 1RKNA 5GADC 2ISOA 1MSWD 1WTQA 5G5HA 4PCZA 3N28A 3DM3A 3OTOM 2PI2A 2KVMA 3C3LA 3L27A 4GLVB 5L1KA 1HA6A 3UE1A 2HCIA 2W3SA 2PW5A 1N36L 3H0GB 3HJ8A 2WB1E 2KG5A 2KXEA 3B6YA 1CQFA 5AHXA 4OO1J 5IT9S 3AJIB 2C9OA 2NN6I 3IFTA 1PRTD 3R9KA 1T3QA 4ECZA 1S0MA 1IXSA 3RN5A 2XSZD 3GO8A 4UBBA 4IPCA 4BY1B 1DGBA 2G5IB 2BQUA 1X9NA 1U45A 5J0OA 3V7JA 4A3IG 1HNXM 3CF6E 1XWLA 3C1YA 3OJSA 1NJZA 2JEFA 3SQIA 1X9WA 5AJ3Q 3GLIB 3RTVA 2Y0SG 3FE3A 2CHQA 3PV0A 3HKZE 2ZG6A 2W8KA 2FMQA 2XICA 3S24A 5DLFA 1LVHA 3FC4A 4IC9A 2VIIA 4BB9A 1PJSA 2LHGA 3HU2A 1SWWA 4IUNA 3DEOA 3SASA 4OJ6A 2PPBC 2AHMA 2L9HA 2D7EA 4AYBG 1DJRD 3D2NA 5NUCA 1TKWB 2DNEA 4DV6Q 3CHBD 1JT8A 5CYUA 1QVFA 1ZQOA 2W7OA 3SMVA 3FTEA 2ZUDA 4X62L 4AG6A 4MGHA 1ZMVA 3CF0A 2KEBA 2E2DC 2UXDL 2I1QA 4A3DG 2NQ8C 4QHSA 4K5XA 1KABA 2G8LA 3F53A 4NKLA 2G3QA 1AUAA 4NLNA 3HHWA 5ELCA 5KFEA 2F0FA 2JR5A 3W0LB 1WOCA 2DBYA 1MD2D 3STBD 5JUMA 5KFCA 1VLBA 4I2CA 3WK6A 1AIPC 9ICGA 1IM2A 4YY3M 3S1MB 2IHMA 2OWOA 4FDBA 2JGAA 2KHQA 3HU3A 1N34Q 4RMFA 3I55A 1TAUA 1IW7C 2G06A 1WTOA 3KBBA 3MMPA 1EY4A 1RDFA 4DR4Q 4B3TL 2XTIA 2CEAA 5KQ8A 2ZIUB 1T6OA 3H0GH 1W5SA 1T4GA 1M1KC 3G6XA 3ULJA 4JV5M 3C3EA 1HFNA 2CE7A 3LMMA 3HFZB 2PO4A 1PH5A 4O1NA 3WOFA 3KYHC 3T38A 4DR3L 4BY1H 2E8PA 3CKIB 4GNXC 5KO3A 1MHWC 9ICKA 4G7OC 3F5AA 5KT7A 2KSOA 2ISPA 1MIUA 2I7NA 1LB2B 3NWSA 3HILA 5KFQA 1KBUA 2AQ1B 1ZQ1C 3KBXA 3RLOA 1BNOA 3CD6A 3FUTA 3GLGE 5IIFA 3H6MA 4PHEA 1PZNA 4G4QA 2F0QA 2XLJA 2BJVA 4NL4H 3BS5A 1MJGM 1IBMQ 1IXRA 3CCQA 1QUQA 3QEAZ 1LV7A 1ENFA 3PIOA 5A35A 1TK0A 3D3RA 3DWPA 1HPCA 1Q7YC 3TZDA 3THVA 3GILA 4A3GB 5C44H 4I2IA 3LQRA 4C1NK 3EIHA 1T3TA 4JI1L 1BCPB 1OIPA 4G4RA 2V1CA 1JB0F 4WP2A 4KLMA 2L12A 4NXNM 2ZJPA 4DR6Q 1DGHA 3OHXC 3PW7A 4UW9A 5JJLA 3ITPA 2EKKA 4RKLA 1VF5C 2D62A 3PW0A 1SYFA 2SDFA 3SZ2A 3CC4A 2DJGC 3HZXA 3ERSX 1ZD2P 4ME5A 1O80A 1KQSA 2X6LA 1SE8A 5DDYA 1TR8A 3L28A 4OELB 5ALDA 2D8CA 4IUTA 4PNYA 2KNAA 2BJWA 4GRIA 5A2QS 4KHPQ 4QZDA 1OIZA 1HZCA 3GLHB 5CWRA 3DUZA 3WOEA 1ZQDA 5KT4A 5K5PA 2Z7JA 1BPEA 3UQ2A 3SAVA 4EBEA 3RFAA 3WKEA 2EUCA 4YQWA 3J7YW 2J6UA 2CUZA 3JPNA 2WP8J 1DOMA 8ICTA 4G4OA 3Q24A 1RDPD 4ECYA 3RMHA 1D1KA 4EZ9A 4QCLA 4L78A 4GLXA 3SR1A 4P73A 4LZGA 1JOOA 1NSNS 2O4XA 3NBHA 1ZQYA 2RRDA 5EWGA 2VL6A 5CBAE 5L8RF 3W68A 4LY6A 1J8IA 1ZQWA 2L0CA 2JH1A 5FTMA 3NVWA 2KKVA 1J09A 1G2SA 1QNKA 1E2WA 4IQWA 1A3VA 4C56C 4DFMA 1XSNA 3B7QA 2EJFC 1R2ZA 1MQ2A 5BPCA 4IR1A 3Q8KA 5EXXA 2A5HA 4POGA 1K0SA 5ALNA 2QARB 2R62A 1PH4A 3C58A 4G7ZC 3K58A 3ND9A 1JJGA 4PZ8A 5DB7A 2LVNC 1NOMA 1H6UA 4MM3B 5C0XJ 2K4IA 1I4QA 5JI2E 8ICAA 1I3QH 4IALA 2OQKA 4YR2A 4MGIE 1Y1VB 3NS1A 3SV3A 2LS01 3K59A 3L25A 4DV3L 4QZ8A 1OXVA 2VXWA 2KBNA 3TAQA 5E26A 1Q39A 3F1ZA 4C3IG 1A3TA 2BZFA 2F0UA 4M9ZA 4JV2A 9ICRA 7ICVA 4LFBM 2LPEA 5D46A 4U7CA 2D5DA 3I4NG 5L1MA 2B2YC 3HU1A 3WK9A 1CTMA 5FLXL 3PO3B 1N61A 1UEBA 1K0RA 3GLFA 1J2NA 3H40A 5KAFU 1OW5A 3EUB2 1PJJA 3GTOB 2HT1A 4A93B 1ZQ9A 3J7AV 4I2DA 1PUZA 2FPMA 3CF2A 5AKIA 4HAEA 4KMUC 4DV0Q 1BUVT 4HJ9A 4TQUS 4QZAA 1QJOA 1U49A 3U60A 1RPLA 3TSSA 1QSYA 4NL9A 2F2AB 1P7DA 5EPJA 1I6HB 2HUGA 3H4MA 1SKWA 1V1PA 3L3OC 4H44C 2AUKA 2YX8A 1C0AA 2UUBM 1IXSB 3O13A 2WKCA 5IYDH 3R2IA 1X54A 3LQQA 2RHFA 2KZMA 2F4VL 2AGPA 4OWWB 4J9RA 4M0DA 3DV9A 4X64L 2BPGA 2L7IA 3FD9A 3M9MB 2Q2IA 2EO2A 1VQ9A 3KOOA 1JR3E 3IN5A 2R93G 5J2AA 4DQSA 4FWHA 3VR2A 2WF8A 3VR6A 1L0XB 2H3ZA 4ECXA 2A6HD 4ECRA 5CC4A 4M0AA 2YQEA 1J9OA 1ZXIA 4RQ2A 4DV2M 1ZEQX 2F0PA 3TDQA 2XZFA 1EY8A 5AKXA 4OU7A 4NJ8A 3OW7A 4PMBA 5C1BA 1X42A 1GOZA 2UUCL 2P66A 2JA8G 2ZM6L 2M5ZA 1XNSA 2LBOA 1SDFA 1R7RA 9ICFA 3NVYA 1N75A 3SAFA 1ML0D 2A68C 1YUBA 1NBWA 2F77X 3GTQB 4BY7B 4JI0L 5AM2A 2JQOA 2K5DA 2BWBA 3TWKA 4ECUA 5IGBA 1S5CD 3PSIA 5EBCA 5FLXE 4BS9A 3MGIA 8ICIA 1LT6D 2NZ1D 1FNVA 2FMCA 4F5PA 2H3VA 4DF4A 4A3VB 4CJ0B 3GTKB 4O3QA 1J7KA 1SV0C 3SYLA 4HN7A 2KHIA 3RLNA 2JA7G 1I4RA 4ZOHC 3RRHA 2QENA 3N97B 3CNHA 3QIAA 4KLQA 1VDDA 1PXUA 3GIJA 1PV4A 5AI6A 2B2UC 2RA4A 5I6WA 2QA4A 1HNZQ 1SE4A 2MFIA 3TP5A 3GTOH 4B9NA 2IWHA 4A93H 3TP7A 1CZGA 2UXBQ 1A76A 4BBSH 3VCBA 3QG1A 2EZYA 5IODA 2A19A 4UPAA 3TACB 2XRSD 3OMGA 4L5TA 2KHSA 5ALMA 1NJXA 4APVA 1RG6A 4Y28F 2SEBD 3FKIH 5AKJA 3ISBA 1BOSA 1I6HH 3VDYA 4C8KA 2XGQA 4CBVA 3LVVA 5EP4A 4LJ5A 1TAMA 3GP1A 1K9MC 3HOUH 3GV5B 1GO3E 5M3FH 2HDLA 3EVQA 2EAPA 4LWCA 3KOJA 2GQFA 2J6TA 2RDIA 4DV5Q 1N9WA 3T1HM 5DQHA 3ORYA 5CMDA 4NWIA 2ZJ8A 2XIDA 4A3EB 3T51B 4N9PA 1N33L 2WACA 3HOYB 1NKBA 2XY5A 3PUXA 2DQNB 4DCCA 4B3MM 1KAAA 1GJTA 4DV1M 2RCFA 3KLWA 2FINB 4QWBA 4A3BB 2FXQA 1SNMA 5J0UA 3SARA 3FRHA 2E1FA 1LACA 2KJ9A 1QUQB 2YB1A 4ZUJA 4GHAA 4Y7NB 3U5ZA 5K36H 2D7HA 2K32A 5CR0A 2F8KA 4NDXA 4NXNL 2HWJA 2KD1A 2GO7A 5J2GA 7ICEA 5ALJA 5J0PA 2B63G 3M9NB 4DV7L 4UB1A 1MKHA 1E1TA 5EBDA 3I72A 4TUQA 1R6BX 2PZUA 5ELOA 5KG3A 4R1JA 2HSZA 4M9SA 4LJZC 4US8A 1BCPD 4LW1A 3GTKH 4GFJA 1J5EQ 1GHKA 5HHIA 4GN5A 5I4DA 2JSOA 4DR7M 2RQXA 1X6OA 1D9FA 4A3FG 2NVTH 3RRGA 1S72A 4ECSA 2LXEA 5J0WA 3RGPA 3PO2H 2HHSA 3HJQA 4FD2A 4RF1A 1G51A 2VQFQ 5C5MA 1E32A 2ZBKB 2KVCA 1IV8A 3C1FA 2KIWA 1SXJC 1P3QQ 1X6JA 1HUZA 1L7NA 1VQBA 2O25A 5IY0A 4O3NA 1V9PA 2W9CA 5AK5A 1ZMUA 1WCMG 3FYCA 3NENA 2X49A 5ELEA 4DSIA 2RHSB 1T9HA 5GTIU 4HIDA 4K8IA 3UI2A 2H3FA 3BXWA 2NYVA 1QANA 4NLKA 2R6FA 1ZOLA 1A6SA 3HOZB 1VCIA 2Y0SB 1PZID 4LZJA 3GLGA 4I81A 1N63A 4ZKCB 4RGMA 1E22A 3J81E 1YLAA 1D1IA 1UUPA 3V96A 2XGTA 2RDGA 2APLA 3D31A 2MUYA 5CP2A 3HOVG 4BBRH 2C28A 2LH0A 1OTCA 4GXIA 7ICLA 3HOYH 1SKSA 4DGZA 4JOIC 2EVBA 3NUCA 3VDPA 1T5XD 3CMEA 5DB9A 2KZSA 4Y2PA 1J2MA 4A3BH 1B8AA 4BX9C 5FSWA 1EEFD 3H09A 2Q8TA 2LYAA 2K4PA 4DQPA 1UFZA 2WINB 3L29A 2K33A 3K6OA 3P20A 4O0AA 4Y7NH 1NTGA 3SDZA 4C3JB 5CRXA 4ZKBB 3BJYA 1WCLA 5M3MB 3PW2A 3QU5A 2QDLA 4A3MB 1JCKB 4FXGC 1DD2A 4LF7M 3UXNA 4DK6C 4LFBL 2D7GA 2PXIA 3AU7A 1SROA 1TS4A 2AGQA 3FRPB 5J2EA 8ICSA 1Z00A 4Q8FA 4X62Q 7ICMA 3U6DA 4DK0A 4WJ3M 4JI2L 2R8GA 2KTQA 1SXJE 4EEYA 2K03A 2SOBA 3A98B 2VQEQ 3GLFB 5CHGA 4R8NA 2BH8A 1SNDA 1F9PA 4JN6A 3IAYA 2G9DA 3QUQA 3G6YA 4R4OA 3AMUA 3IHQB 1SXEA 4GNXA 4JUZA 1ZQAA 3J81j 3IL8A 2DY7A 2JA9A 5KQDA 4H02A 3M8SA 3A5UA 1EY9A 3EFXD 4LRSA 2HHVA 1VQ4A 1EEID 1XPRA 2BCQA 2QILA 2UUBL 1OQYA 1I94M 3MXPA 2MA1A 1IN4A 2GN5A 5C0YA 1KXLA 2A69D 4DV4M 1FFUA 1JOQA 1V1PB 3HP3A 2MNAA 2KHJA 1YJ9A 3J7A5 1XYIA 4V0BA 5IP9H 4OJOA 3AU2A 4EYIB 1OUQA 1QQ5A 1LTRD 1T7PA 3K9PA 3A0BU 5J0XA 3CW2C 7ICUA 3PX6A 1JWSD 1IY0A 4ED0A 4IURA 1EZ6A 5FLXc 1JC7A 1EZ8A 4DV2L 1BPDA 5KFHA 1QDTA 1HA5A 4LUVA 4DR3Q 3BZCA 4QIWB 1L3UA 3I90A 2K8AA 1FD7D 4A3JG 2ID0A 1SV4A 2PFQA 2LFNA 2CFMA 4FCWA 5KT3A 2HIVA 2XCPA 3OMCA 2RDJA 5M9OA 4J03A 1N34M 3PXGA 4M0WA 3A46A 1M90C 3M3YH 1D0LA 5D14A 4DR4M 2F0HA 3UMGA 1DK3A 2VUMG 1FO4A 4RNNA 2YN4A 4C3JH 5IGGA 2ES6A 1SAPA 1ZQIA 3VYSA 5DBAA 4A3DH 3QWNA 4XQ8A 3M7DA 5L1LA 4JB3A 4QMGA 4AG5A 4NRWA 4D81A 3FPUB 4DR1Q 4DLGA 4MTNA 2HDOA 1WUDA 3H94A 3FMCA 1JMCA 2B2VC 4Z9CB 4Y2UA 1AE3A 4C1NI 2WKDA 2DPJA 1IBKQ 2C2EA 4KN7C 3HW8A 3T1YM 1ZQBA 2MGWA 2DI0A 5IGEA 2LM1A 5CEHA 3GQ4A 4M9XA 2QNJA 3PNCA 4AKGA 1E24A 3H8JA 1WWVA 1V43A 3ZYYX 1TV9A 4I65A 1TH3A 2JA2A 2BCVA 4C8OA 4OW0A 3SATA 1CI4A 2WB1B 1EL0A 1EIHA 1QUSA 1FJGL 4P71A 1JQYD 1Y8NB 4KY5A 2CPRA 3HX0A 1AH9A 1HRJA 2VF7A 1KNAA 1XMOQ 1D5XC 5ALVA 2LVAA 4LF4L 1TQOA 1JR3A 5DEHA 2D0OA 9ICWA 4EX5A 3W1GA 2H3IA 5AI4A 1A0PA 3Q0AA 4R8UA 1Z47A 3CC7A 3Q6SA 3HKZB 2NVXB 3N7PD 4D82A 4M8AA 4IBBA 3QU7A 4GITA 3GIKA 4KX3A 1L3SA 3RD4A 4B3ML 2NVYB 2B2TC 2NYZD 1SSOA 1IHZA 3HT3A 1I4HA 4FYDA 4O9MA 4LF9M 2KRKA 4DPGA 4P74A 3NTIA 2HHQA 5I9OA 2Y9TA 1E9RA 2K60A 1LO5D 5AICA 3U9OA 3S1RB 2O5IC 9ICPA 2YU9H 3NPPA 1EU3A 4LGMA 2YYZA 2Q2EB 2B2YA 3IRBA 2QKQA 4CKCA 1DGJA 1L1ZA 2R61A 3U5ZB 4UP8A 2XO7A 4KD3A 2JNHA 1NY4A 1QVCA 4R3DA 3BDLA 5FLMH 3R2TA 4PDGA 4YWKA 3B9PA 2KCMA 1NJGA 4Y2RA 3F8TA 1H9MA 3KKAC 4TUSA 8ICFA 2IPKD 2F0LA 3BS7A 4KMUA 4G57A 2J7NA 4HEOA 4JI5M 4CNQA 4O3MA 1IFYA 1PH3A 3ZDAA 1EU4A 2Q2TA 3EJIA 4Z6YA 4HIOA 2F1MA 2B0CA 4M9LA 1DOQA 3H91A 3LNNA 4LG2A 4Z6DA 2Z4HA 1NMGA 4DR7L 5E4XA 4C4TA 1BF4A 3GDXA 4NM1A 4J9LA 4GKJL 2F03A 4L63B 3VLFB 2I0QA 1Q02A 3MFHA 4MGKE 5BN3A 4QUCA 3KZXA 1Q3BA 4RQ8A 2Q2HA 5KPZA 2KJXA 2MHVA 4QZFA 3F2DA 2HL7A 3S2DH 1VMPA 3C46A 3U6QA 8ICMA 3SXHA 2HHWA 3VFDA 2XGNA 1U5KA 1QZEA 4F3OA 4L16A 4GXJA 1WYDA 1BO0A 5IINA 5HNKA 1NUCA 8ICUA 3U6EA 9ICIA 2K6BA 4JI4L 4UN2B 4OL7A 2W9CB 3OTOQ 5KFGA 1MGSA 2EJSA 4UY8C 3G4SA 1E0BA 2NTSA 2MRLA 2BHNA 3A55A 3PNVA 1E7ZA 2DPIA 3RLFA 3OW2A 2KJ8A 2G5HB 2KIVA 1XTDA 3M6AA 1NK4A 4K6LA 3M85A 2NVXH 1JALA 4L5RC 2JZ0A 3LVWA 3AU6A 5EXSA 3W0FA 3N7SC 8ICCA 4L5SA 4FE3A 3S6JA 3U6CA 2W7PA 2NVYH 1B1ZA 1SNQA 1HNXQ 3GIIA 2BH2A 2MPMA 2H1RA 2BNKA 3ONAB 3LWMA 3QUBA 5F9LA 1PTOB 3A5ZB 3PGZA 2K5NA 1RYSA 3JAMi 2AQ0A 1V85A 3CF5A 3S1RH 3FUWA 5EXPA 2W04A 1S5DD 1DRGA 4J1MA 4AP9A 3CCMA 2LKYA 5KFTA 1SV0A 1NZBA 3CCRA 2KOBA 1HQMC 1Q1EA 3T53B 1NHWC 3LDAA 2EDUA 1B22A 2B2UA 3IG5A 4C3IH 2BCSA 3RJEA 3KVWA 3LCUA 1KDHA 2K8BB 4MEXA 1QVRA 1SZHA 2K5WA 1JORA 3Q8MA 1HQCA 1VF7A 5AJ3L 2WSEF 3H0GG 4MHVA 4W5WA 4O0IA 7ICGA 3GTPH 1Z00B 2F0IA 1E3PA 7ICJA 5KL1B 3KJOA 2WAQF 4GH9A 4DL4A 1O7IA 5LHY1 1ZJMA 5KFAA 1JXLA 3MC0B 4GC5A 3GRVA 4IJLA 2DWMA 1KFTA 2KECA 4BY1G 3F2UA 1DCZA 4DUZQ 4DNTB 1QCKA 1WCNA 1XSLA 4GNXB 1VEGA 5JVH3 2AQ3B 1H9JA 1JUDA 4DV6L 2LXKA 4YY3Q 2ALZA 5TISU 4POFA 1PJIA 1SKRA 1SNPA 4IJEA 1ZRNA 3D0FA 2UU9M 5AI5A 1NK9A