2ZTDA

Mtruva form iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
202
structure length
189
Chain Sequence
MGRGSEFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 46
structure length 189
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ztdA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2ztdA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ztdA01
2E8GA 4O0IA 1E24A 1PH1A 3CPWA 1WR1B 2EXDA 4KI0A 2WAQE 3HOVH 4DO9A 4JBWA 1VQ5A 1VQEA 1CKNA 1YEZA 4YCVA 2FLPA 4BY7H 3H4BA 3RB6A 4O3NA 4GLXA 4KLHA 1HQYE 4DR4Q 2FMPA 3RR8A 1K1SA 1NKBA 4NPSA 2JA5H 3I4NH 8ICBA 1IZ6A 1L3SA 2JK8A 3UDGA 4M9GA 4JI7Q 4RQ7A 4YD1A 4LVSA 1YVCA 4X6AH 2BCUA 2MO1A 4JI3Q 4YN4A 4B3SL 3KHLA 2IA6A 4POGA 3T6PA 8ICAA 4YVZA 1P8LA 3Q8SB 4KMUA 5KFHA 3OYYA 1Z3EB 5KG3A 1ZMUA 4PGXA 3MABA 3MR3A 3B0YA 2UXDL 2DAIA 2HW3A 1EXNA 3BBZA 4F50A 2R7DA 4A3GG 4DSJA 1XPRA 2MAXA 3H4DA 4BXOA 3KDFA 1SZPA 5CB1A 5C0XG 4KN4A 5TZVA 3PV8A 2RRUA 4I27A 8ICRA 5DKWA 3OTOQ 3GLHE 1GM5A 3M4PA 1NTGA 4RQ1A 4ED8A 4ECZA 5DQIA 2NRXA 5CWRA 1HZBA 3TQYA 4LF4L 2XC9A 4IR9A 4DSLA 2JA6H 4J9QA 3HOUG 5J0PA 3RZOH 1IBKQ 2J6TA 3HKZG 1D9FA 2B29A 1K8AC 2EKFA 4GEWA 1ZQNA 2HHSA 2HHUA 4YCXA 2PMZE 3E46A 2QA4A 3B89A 1TVAA 3I4OA 3GV5B 1Z47A 5DBBA 2UVWA 8ICFA 4EEYA 3C5GA 9ICGA 4YCWA 2E5LL 4ECTA 2A1JA 3JPSA 1YHBA 1E1OA 3MFHA 1YNXA 4Y52H 2ZM6Q 4IRKA 4K4GA 4DR6Q 2BPFA 3GIJA 1NY4A 1EQRA 4QZCA 4ED3A 4DBGB 4JV0A 2HHVA 1VCIA 9ICVA 4DQRA 4UAWA 1EIYB 2UU9Q 4B9LA 3KJPA 4B9VA 5DGBA 1W2BA 1KC8C 4RUAA 5KG2A 1QTMA 4JC0A 2MQHA 2WFWA 5KFZA 4O2DA 3RB0A 5DB9A 4GOPC 4IOCA 4F3OA 3PR4A 1ZJNA 3OW2A 4DR1Q 1WJ7A 3EZ5A 3E2EA 5KFEA 1TK8A 3IRBA 3H3VI 3M4OH 2JEBI 2RF4A 4KHZA 2AU0A 1LTLA 4GXKA 1M1KC 1QSSA 4BA2I 4XRHA 4RQ2A 1K3RA 2YYZA 5KFVA 4J9RA 4JI5Q 2WZJA 4HYKA 1SR3A 2A8VA 2MROB 1X65A 1Y1VG 4ALPA 5KFGA 2NZHA 1EYGA 4PPXA 5IIMA 1IBLQ 3OHAA 4POFA 3MR5A 3GILA 4ME3A 4Y7NH 4RQ3A 3V6HA 1NMFA 3RB4A 4KLMA 1KFTA 1B70B 2XTIA 4PMWA 3T3FA 4IPGA 3V7KA 5IWAL 2CWPA 5J2GA 4YCUA 2CCZA 2CKZB 3PUYA 4JYAQ 1NJZA 3S1RH 4A93H 5KFPA 1TAQA 5J0OA 4YWMA 1PH2A 4UBCA 3MR2A 3M9NB 4NXML 2ZUBA 2W8LA 1D8YA 4DV4L 3HOYH 3AU2A 4JBKA 4BWMA 2ATWA 3RH5A 4UAZA 4DR5L 3MDAA 1EQQA 4LFAL 1NJWA 4RNOA 5KFMA 3PX4A 4ED0A 3GLGE 3M8SA 4TQSA 4RG1A 4AQYL 3WWVA 1O7IA 1VQDA 1SKWA 2EIFA 4LWCA 1ZQLA 4PHEA 4M04A 7ICFA 1MJEA 5M3MH 3PIOA 2R7ZH 1GD7A 4O3OA 3C2MA 7ICJA 4YMNA 5JEAG 7ICKA 1YBYA 2R7ZG 4GC7A 3TFSA 4FS2A 3ZDBA 2DUDA 4IQVA 3BQ2A 3E21A 1AH9A 4X66Q 4DUYL 1VS0A 3OSPA 4IFDJ 3OGUA 4ECSA 1VQFA 1J5EL 4GN3B 4F5OA 2JEIA 1E22A 3PO2G 2JEJA 3GIMA 1S40A 4L5RC 2KN7A 2R7FA 1BGXT 4HJ8A 3AFQA 3KF8B 4F2LA 4LF9L 3HT3A 3A5ZB 4HJ7A 5DLQE 3RRGA 2GN5A 2KCTA 5D46A 1E1TA 4I2BA 3S1NH 4JWMA 4YWLA 1ASYA 3PO3G 1YIJA 1HT1E 1VEKA 2IHMA 2IT1A 3TAQA 2AWOA 3CPFA 4Z6DA 2BDPA 4IO9A 2Y0SE 2LYHA 3OJUA 1X55A 2ZUCA 1L0WA 1VQ7A 1UA1A 4DR7L 3GDEA 8ICYA 4Z6FA 2DI0A 5IIKA 2F52A 3H3VH 4C8KA 3TARA 1G51A 2BQUA 3I4MG 9ICSA 4A3GH 3HX0A 3STBD 3M8RA 2XY5A 3BQ0A 4XUSA 1PGYA 4LF5L 1XNQQ 5JUMA 4JI1Q 1XMOL 1X9NA 1TKDA 4QZEA 5IIIA 3BJYA 2WAQG 1SG9A 2LTUA 3MGHA 5HY6A 1HNWQ 4AH6A 2MGWA 3BQTA 1EIFA 4O3PA 1TWAH 1HUOA 5KT3A 2DAMA 5KT5A 3HOUH 4F4WA 1ZQFA 2B21A 9ICJA 9ICQA 1VQCA 1KRPA 2R6GA 1S0VA 4JCVE 4QZDA 1ZQRA 1FL0A 2PI2E 3BQ1A 2Y1JA 2F1HA 1RXWA 5LMUL 2PI2A 1EOVA 9ICLA 5AJ3Q 4QGUA 3ETLA 2Q0ZX 3FKIG 3RLNA 9ICKA 5J0RA 4TQRA 4YFKA 2ES2A 3M9OB 1ZQAA 5E7NA 2NN6I 1V9PA 4GKJL 1A5TA 7ICQA 3K0XA 2PFQA 4IQTA 2BA1A 1XO1A 4DUZQ 1VQ1A 3H8WA 1RL2A 2B63G 2BHNA 1YHQA 3W5OA 3J80c 5KG4A 1PH4A 4GNXC 5IILA 2RHSB 4J9SA 4F5RA 1U49A 3Q8DA 4OX9Q 5D4BA 2YTYA 5BR8L 3UPQA 3GO5A 2UUCL 2BKEA 2UUAQ 3G6XA 5DGAA 4NXZA 3EYZA 4ED1A 1HUZA 4M9HA 2RCNA 3CCRA 1ZV1A 4UB4A 3U50C 4A3MG 3H8JA 2ZJ5A 3GIIA 3N4MB 1UA0A 3CF5A 3QZ7A 3L0OA 1VEJA 1S10A 5HNKA 3CCJA 3ULPA 3JPQA 3SGIA 3RJKA 1OXUA 4DL5A 3ER0A 4DL2A 3JPPA 3L7ZC 4OWWB 8ICCA 2DKLA 4F5PA 4JI2Q 4UB5A 4ECUA 1XNRL 2D62A 2VQFL 2KNAA 1B7YB 4ECXA 1X6OA 2UXBQ 1NK4A 2M9NA 1Y1VH 4DV1Q 2P6RA 2JZ1A 2BWBA 3ISCA 2OTJA 1KAWA 3U4VA 3V7LA 4DAYB 3RJEA 4DSFA 3I2ZA 2R8IA 5H1SE 5C4XG 3HOZH 4F1IA 3PR5B 1PH3A 4P4OA 1OKSA 4I2CA 3UXOA 1VQJA 4B3MQ 1C7YA 4F4XA 2BCQA 9ICPA 3ZJYC 1XMQQ 1R4GA 5F9LA 1B22A 4P4MA 3RAQA 1UFZA 2JE6I 3A0JA 2IY5B 2K9DA 1HZCA 1B8AA 3CQZH 5IYBG 2D0OA 1PYSB 5J2BA 4KITB 3THVA 1ZQDA 4BXXG 1UT8A 4DOBA 4C3JH 4QZGA 4LF8L 3G4SA 4Q7JA 1Q7YC 3ZDAA 4J9OA 3PO5A 4M47A 1HH2P 5KFTA 4X64Q 4QJFA 1T4GA 1IFYA 5CJ7A 4LF6Q 4DPGA 3UXPA 1JMSA 4NM2A 2NVQH 5KG1A 2VNUD 1WYDA 4M9JA 2Q2IA 4Q43A 2K4KA 5KFRA 4DV6Q 1OQYA 2LBCA 1D9DA 3C21A 5HGQA 1NKCA 1YJWA 4NLNA 1S3OA 4DFJA 5KFOA 3GV8B 2HHTA 4ECRA 3QEAZ 5KFLA 1KHIA 3PW2A 4JWNA 4F93B 4KN7A 1N32Q 3PO2H 4C3HH 3PUZA 4A3IG 1SL2A 4IPHA 2JZ0A 4DL6A 1P16A 4JI4Q 1OXSC 2YU9H 4MFFA 3EBEA 4LF7Q 2BH2A 4X62Q 2UXCQ 4Q8EA 3HP6A 3CP0A 3ZD9A 3MXNB 2NZOA 3C5FA 3RH4A 3RLFA 5J2FA 4CCHA 3VDYA 3PO3H 3H0GG 1RPLA 3U4ZA 1ASZA 3S2DH 4EZ9A 1YITA 3LWLA 1L3UA 4BBRG 1IXRA 1XS9D 1PYBA 5DQHA 5M5WH 1K83H 1GKHA 3UDIA 3GTKH 1MIUA 1N34Q 1GO3E 4K0KQ 2OTLA 4R4TA 3RR5A 4FBUA 1LB2B 2R8HA 3F1ZA 3I4MH 1CKOA 1Q46A 1UE5A 2C35B 5KFNA 4DR2Q 3IM1A 2Q2HA 4DSEA 4YY3Q 4EZ6A 5J0SA 4JUZA 3UDXA 4JV5Q 4DV2Q 2V4QA 1MQ3A 3F8TA 2V9WA 4A3JG 1NMGA 3V7JA 2Z6KA 1Q12A 2I5LX 2VA3A 3K80C 4EYHB 1VQPA 3K81C 4NLZA 4F4YA 3SV4A 4DOAA 4DR4L 4A76A 4PHAA 3H40A 4BGDA 2CP8A 7ICRA 1N36Q 3PIPA 5HHIA 3JAMc 3MEFA 1JN3A 3CC7A 4JI7L 5C5JA 4I2AA 1CEZA 5DG7A 5M3FG 4QZIA 3Q8LA 1JXEA 4ECYA 1X9WA 4AYBE 5C3EG 4RPZA 5CA7A 1BBUA 1OXVA 4JI3L 4C8MA 1VQBA 4QWCA 5DDYA 3FKIH 8ICUA 4JOIC 5JI2E 3PY8A 2A19A 2RDJA 3OSNA 1VQ6A 2HVHA 4F2RA 4B3SQ 1SLJA 4RQ8A 4F91B 4J9PA 1X9MA 1S9FA 2BWEA 3GLIE 2B63H 1VQKA 1X3GA 1COOA 1JX4A 5J2AA 2HHQA 4O0AA 1KSPA 1ZQQA 1BKBA 3GTOH 4XTCS 2BA0A 1AROP 3E0EA 3OTOL 2XCAA 2DNAA 4QWEA 1XPUA 4KTQA 5LMNW 2DHYA 4M0AA 8ICXA 4QZHA 8ICMA 1A8VA 1W3SA 3FP9A 3CAMA 1WCMG 2FLLA 4A3MH 1ZQOA 1HNZQ 4A3KG 2V4RA 1IBKL 3C2KA 3CCVA 4O9MA 3K9PA 4DL7A 1CUKA 2R0IA 4I2DA 4C8OA 4ZH4A 4DWIA 8ICZA 2R93G 3M4QA 3AYHB 3GTLH 4YXJA 1UT5A 7ICMA 4QZBA 4Q8FA 2LVQD 4DSKA 7ICEA 3MR6A 4UAYA 4A4IA 4KLSA 2R8JA 2JNHA 8ICSA 3PUXA 5GAHC 2EJSA 2Q2TA 3BDPA 4HEOA 2ZM6L 4DR6L 1I6HH 4IOAA 1EFWA 4O3QA 4DV0L 5KT2A 3B0XA 1FVIA 2NVTH 7ICOA 2D0PA 4YG2A 5C4XH 4GLVB 5DB8A 1VQMA 2UU9L 3UQ0A 2DAEA 4TUQA 1NV9A 2L4FA 8ICQA 1KIXA 2JY6B 1ZJMA 2L2DA 1MC8A 1KYIA 4UB3A 4R4CA 3T1YQ 5IYBH 3AQQA 4IPDA 2JA7G 1R9TH 1TTEA 4GLAC 3ZDEA 2I9GA 5JJLA 4MF8A 2Z0SA 3GTPH 4BXXH 2ASDA 1SE8A 4DR1L 1ZQHA 1OTRA 4LUOA 3RJJA 2LVNC 4DQSA 4JI0Q 5IT9c 2DFLA 2VZAA 5C0XI 2OOBA 4KLFA 3T5HA 3J80i 4JI5L 5EWGA 4MF2A 3ERSX 5GAEC 1AE3A 1HNXL 4A75A 3PNCA 3E9IA 4OWTB 1ZQYA 7ICNA 3KTQA 8ICNA 1KDHA 1T9HA 3PUWA 3G6YA 9ICXA 2MUTB 2OQ0A 1KQSA 4PZ7A 4KHPL 1JT8A 3GDXA 4J9NA 2C2DA 1NOMA 3UQ2A 4JI6Q 5F9NA 2IHNA 3I7FA 2FPMA 3Q8RB 3CMEA 2JP7A 2ZJRA 2F1JA 1U5KA 3RN2A 2JY8A 2L4EA 1XC9A 2LVAA 2K5HA 4JYAL 4A3IH 2Z6KC 4UBBA 3T5KA 1NV8A 4R66A 3F2BA 5IWAQ 9ICRA 4YMOA 1KFSA 3J7ZC 1SL1A 3K9OA 3KYHC 1YJNA 4LFCQ 1SL0A 2XO7A 1RXVA 4J9KA 3AUOA 1XXHE 4PGQA 2OWOA 3H0GH 5IYDG 1K73C 5BOLA 4B3TQ 1XSLA 4I2FA 1VG5A 1I94L 1ZQUA 4XA5A 3N97B 4BBRH 2NRVA 3KOJA 1TXYA 9ICOA 3OJSA 3M3YH 1Y88A 4DL4A 2VQEL 1Q1BA 3EPGA 3LDAA 4YR2A 1U0LA 1IBMQ 3LWMA 1OTCA 1X2IA 9ICUA 2ID0A 2K52A 4JV2A 1TAUA 2Q2UA 5KFQA 4X66L 3F2CA 2F4VQ 1KL9A 2FPKA 7ICPA 4YHHQ 5FJ8G 4NY8A 4A3JH 3RBEA 3G6EA 4YWKA 4X65L 2HHHQ 1ZMWA 3C23A 2HHWA 2OCEA 4M9LA 1ZQZA 2PXIA 3J81c 1G4AE 1ZQPA 2N78A 1Y1WG 3PX0A 4BDPA 4UP9A 1YI2A 1ZQXA 4GN5A 3HWTA 4OXPA 3DLLA 8ICGA 2VA2A 1WOCA 8ICJA 3EIVA 3EPIA 3UE0A 4TVAB 2XY6A 5EAYA 5FLMG 5IINA 3NBHB 3PUVA 5M3FH 1K0RA 1QSYA 1JJCB 3JPTA 5C3EH 4M6WB 1IXSA 1ZQGA 1TWFH 1LV5A 4DF8A 1QVCA 1BPZA 1UEBA 3T5JA 2VA8A 1QVGA 5DDMA 4DV3Q 1D7QA 1S72A 1I5FA 5J29A 1I3QH 8ICIA 4DR3Q 5EWFA 1AIPC 4QWBA 2DPIA 2AJQA 1HR0Q 4YR3A 3FDSA 5J2JA 3RJHA 3PV0A 2N3SA 3NTUA 3LK9A 2HAKA 3Q8MA 2F1IA 3PO4A 1L1OB 3RN5A 5JJIA 1C0AA 3AU6A 1PFSA 1A62A 3GTGH 4R8UB 3LGJA 1XNQL 1QSLA 4RUCA 4JI1L 2HIVA 2PI4A 1KLNA 2EKKA 1T3NA 2AGQA 2GVAA 1HNWL 4DQIA 3V6KA 3UXNA 2F3IA 4KLEA 2AMCB 3PCOB 4MNOA 3HKZE 2WB1E 1WCMH 4RT3A 4QW9A 3H7IA 5J0UA 4KLLA 2MFIA 2FPLA 4KLKA 1FJGQ 3RLOA 2HT1A 2ISOA 4RQ4A 3NEMA 1VQ8A 2R93H 3K8AA 2BR0A 3CCQA 1RZTA 4BWJA 3FHWA 1T6OA 3CC4A 3BZKA 5AJ3L 1ZQTA 1WFQA 1Y8GA 4QZ9A 3C1ZA 2W9CB 2XGQA 2L15A 2UUBQ 4GKKL 4A3CG 2QSFX 4QZ8A 1VQLA 1Q02A 5LMUQ 3PMNA 4AYBG 2FMSA 1X3EA 5IP7G 2HVIA 1GO5A 4GXJA 3JPRA 3RB3A 1RYSA 3MGIA 4DUZL 4DV7L 1IM2A 4BA1I 4LUZA 4GNXB 1LM0A 1IYJB 3JAMi 3PW5A 4R64A 5KFAA 1PH8A 3K4GA 3KFUA 1UWVA 3SZ2A 2ZTCA 3TI0A 1Q86C 3QZ8A 4B9MA 2UUAL 4RT2A 4ELUA 2JA7H 4FBTA 4RNNA 2ZJAA 1A77A 5M5YH 2PFOA 4R63A 4G3OA 1E3PA 2YV5A 5J2EA 3F2DA 4BY1G 3CD6A 2IBKA 1VQIA 1V43A 4IPCA 2BPCA 2P6UA 1KXLA 4ECVA 1TR8A 8ICEA 2HHXA 4Z6CA 2Y1IA 5KG7A 4PHPA 3K75D 4JI2L 1ZQBA 3IHQB 4PG3A 4DV5L 1HT2E 1TWCH 1ZQKA 8ICTA 2UXBL 4R1JA 4GXIA 3SYZA 1TFRA 2DGYA 3BZCA 2IX1A 5KG0A 1EFUB 4HJAA 5KFDA 4L5QA 4RPYA 5DLFA 2QGQA 4OO1G 3FRIA 3IECA 5C0XJ 1XSPA 5L1KA 4IFDG 4LFBQ 7ICLA 2DAGA 4B3ML 2JEGA 1XMQL 3M7NA 4EBCA 5HHHA 1VEGA 3G6VA 2V1CC 2ZTDA 4ELVA 4F92B 4RMFA 3SI8A 2ASJA 2RHQB 4KLOA 1NK8A 4L5TA 5KFFA 2HQLA 2AQ0A 4YXMA 2FMQA 1AE2A 3OHBA 1E94E 5J0WA 4X64L 4A3FG 4K4HA 5IYDH 4R65A 1QZGA 4LF6L 1PHJA 2KCMA 2BQ3A 2I5MX 5L9XA 2ASBA 4LZDA 1OXXK 4EX5A 5GADC 3TAPA 5KG6A 1S97A 2WTFA 4ECWA 3GD7A 4DV6L 2DENA 3T1HQ 5KFYA 2G3QA 2JZBB 8ICLA 2W9BB 4TUPA 4DS5A 5ELOA 1BBWA 5M5XH 1XWLA 2LVPC 2EQSA 2B3GA 5K36G 4B3RQ 3PW7A 1L3VA 2AKWB 2KHIA 4NLKA 4R4QA 5FJ8H 3B6YA 4EYIB 5KFXA 1N32L 3PF4A 2BCSA 1SRUA 1N33L 1NKEA 2I0QA 2NRWA 7ICTA 4HJ5A 4JI4L 1GVPA 1Y1WH 2E2IH 3S2HH 3ULJA 2PFPA 1VDLA 4QZAA 2UXCL 1QVFA 2A1AA 2WP8J 4P72A 2VUMG 5LMNL 1ZQCA 5FLMH 1IM4A 4JI8L 4UP8A 1YJ9A 5HMLA 3CC2A 4KLJA 1PH6A 8ICPA 5EOZA 2XCPA 7ICHA 2CWAA 5J0XA 1UE7A 2I1QA 4A3DG 1N48A 3GV7B 1QUQB 2R8GA 1U47A 4HIKA 1S0OA 1SFOH 1X9SA 2VL6A 2ASLA 2K50A 1N34L 3RJFA 1KEJA 1G3IA 4G3IA 2P66A 4YQWA 2W8KA 4NXNQ 1CSQA 4DKAC 7ICGA 4PZ6A 4DR2L 3KHGA 4YY3L 2MUTA 4JV5L 5DB7A 2OOAA 4DV2L 4BBSG 4DL3A 2ZTEA 1HJPA 1WGNA 4F5NA 3TANA 4O5KA 3T5LA 2DPJA 4FO6A 3FYHA 4QIWE 3GTQH 1JJ2A 2XY7A 2KFNA 4GC6A 1S0MA 4TURA 1N36L 4X5VA 4EQ5A 1RYRA 3ZDCA 3NELA 7ICSA 5J3BA 1DOQA 3C1YA 1PV4A 4P75A 8ICHA 1SROA 4B9TA 1WCNA 1XU4A 2BCRA 1XB2B 3A74A 4A3EG 4RQ0A 3STBC 4IRDA 1OAIA 4MFCA 3MBYA 4PZ8A 2JQOA 4DK6C 1U48A 4ECQA 1NJXA 2UVUA 5KFIA 4C3IH 1N56A 2PNHA 1ZQVA 3ISDA 4A3CH 1MKHA 1MN3A 1PZNA 4UN2B 3HW8A 4LW1A 5BOMA 5IP7H 2CWBA 2ZJ8A 2IHEA 3J81i 5CR0A 1L3TA 2ZUDA 5JEAJ 4C8NA 4O5EA 2ATLA 2Y0SG 4WP2A 1D8LA 1ZQIA 4F5QA 5DBCA 8ICOA 1EUJA 8ICKA 2GVBA 2OQKA 1NJIC 2UXDQ 2K14A 2KFZA 2LVOC 9ICMA 2YTVA 1ZQJA 1K1QA 4RZRA 4NXNL 2KHJA 2PQAB 4P73A 1ZQMA 2J6SA 1VQGA 4MTNA 1BPDA 2JY5A 2GWSA 2HWJA 5L1LA 1HNZL 2ISPA 3RZDH 4K4IA 1NK9A 4RNMA 4NLGA 1XSNA 4LF4Q 4IJHA 4RQ6A 1SMXA 3CCEA 3KHHA 2DZLA 4BY1H 1BVSA 4RU9A 4H02A 3KJOA 1V1QA 3HOWG 3TFRA 4M9NA 1ZETA 9ICBA 2WB1G 5HP4A 2R92G 5C44G 2KENA 4R4OA 4I2IA 4ED2A 4A3BG 3EN2A 3FRHA 4M6WA 2MNAA 1U45A 3RAXA 1QLNA 1VQOA 4UQGA 4EBEA 4I2HA 3TEHB 7ICVA 2C28A 2VY3A 1DGSA 5J2IA 2E5LQ 3D0FA 2NRTA 3JC66 2KHHA 3BJUA 5IP9G 1PVOA 1JB7A 1A63A 5KFCA 4A3LG 1SKRA 2MO0A 4O5CA 1XJVA 5HMMA 1L1OA 4DV0Q 4GOPB 3MMPA 3H4JA 4R8UA 1N9WA 3T1YL 5KFBA 1P3QQ 4UB1A 1YZ6A 3L2PA 1X3FA 5FLXc 1Z00B 3QE9Y 4J15A 2QEXA 5J2DA 3E9HA 4F4ZA 3W1GA 2W9MA 1A0IA 3KF6B 4I2EA 3RNUA 4M2YA 1ZQWA 4NM1A 1UE1A 4I28A 4A3FH 4JI0L 5IIJA 4QWAA 2KTQA 4L5SA 4WJ3M 3Q8QB 3ORYA 3HOXG 1XTDA 1JMCA 2R8KA 3J81j 1PA6A 4EBDA 2HIXA 5CP2A 2N8NA 2W9CA 1IBLL 1H38A 4DLEA 2N49A 4RQ5A 5KFJA 1NK0A 2NRZA 3GLFE 2UVRA 1HNXQ 3M9BA 1CKNB 4JI6L 3TREA 1N8RC 9ICEA 4KLIA 4KLTA 1ZQSA 2YTXA 1JJGA 5KFUA 7ICIA 4JV1A 4KHPQ 4GNXA 4LUVA 5IYCG 5GAGC 2IX0A 2XGTA 3HKSA 4APVA 4O3RA 3V6JA 1L2FA 2JA8G 3HOZG 1S76D 3M9MB 3DM3A 3TS0A 1NK6A 2ZJPA 5KT6A 5KG5A 4LZGA 1ZMVA 4I2GA 5J0QA 1CKMA 4DOCA 2VUMH 3I55A 2FXQA 3LCUA 4LFCL 2BCVA 4NXMQ 1VQAA 2BQRA 3EW9A 4DV4Q 4I2JA 2BPGA 3RRHA 3H8SA 5D49A 2AQ4A 5ELNA 4DR5Q 3JPOA 4LFAQ 5IY0A 4O3SA 1TWHH 2JEFA 4JBJA 4PHDA 3H15A 1PH7A 4B3TL 4A3DH 2ZJQA 2B3TA 2E2HH 1NK5A 1FGUA 1YLAA 2C2EA 4AQYQ 1DV0A 1EWIA 1IL2A 4P4PA 2K75A 5GQOA 4AIMA 4DFMA 1PH9A 1IBML 1I94Q 1PH5A 7ICUA 1KTQA 1SKSA 3UE1A 4P74A 5J2CA 5DFLA 2VQEQ 1DO0A 4BXOB 4KLQA 3KDFB 1S0NA 4DF4A 3PGZA 2F4VL 5DQGA 1WHCA 2KZ3A 1WIVA 2H5XA 9ICCA 4QL5A 4YHHL 4BBSH 4DUYQ 2VS1A 2JJQA 1YHAA 3TRZA 3S1QH 2O25A 3W1BA 2HHHL 5KT4A 1J5EQ 3KLWA 1Z9FA 1HZAA 3KHRA 4DFKA 4OWXB 2NN6G 4OONA 3EWAA 4X65Q 4R71A 1K9MC 4LF9Q 3LCVB 3QEBZ 1NBWA 4LNQA 4QWDA 1WI5A 4UPAA 2PFNA 1KFDA 4DQPA 4A3EH 5BPCA 5J0TA 2ALYB 3A5UA 3GTJH 2JUJA 2AGPA 3PF5A 5KFWA 3GIKA 3CW2C 2BGWA 4DS4A 3ICEA 4DV3L 1VQ9A 1BPBA 3G48A 9ICHA 2A1JB 4DR3L 2CQOA 2VANA 4RPXA 1H95A 4DK3C 4R4IA 1HR0L 3RH6A 4DR7Q 3GQCA 5DBAA 1M90C 2J6UA 3K7UC 4GS3A 5C4JH 3S17H 2JZBA 4MEXA 3HOVG 5L1JA 2W9BA 4P71A 3V72A 8ICVA 3PSIA 5DG9A 4BY7G 4LF5Q 1F4IA 4ED6A 1XMOQ 2NVYH 2JY7A 1L1OC 3CCLA 4QQBX 9ICAA 2FLNA 4A3KH 3D31A 2I5HA 4HIMA 1JE5A 4IQUA 4YR0A 4B9UA 8ICWA 1KRSA 4B9SA 2JA5G 4XQ8A 3I4NG 1FJGL 3RR7A 2KBNA 2MR9A 1B43A 1TWGH 1OXTA 3HOWH 4C2MH 3AFPA 1DO2A 1CSPA 2NVXH 2R92H 3TS2A 3S14H 5C44H 4A3BH 3F92A 4QW8A 3HPOA 1A76A 2UUBL 3MDCA 2KNVA 3HFZB 4ED7A 3RBDA 3MFIA 1QUQA 3NGDA 2C22A 1G291 1QZHA 1C9OA 1T7PA 1VQNA 5KFSA 4DNIA 3CCUA 3S15H 1K8GA 4GKKQ 3UDFA 4GKJQ 5IP9H 3G71A 4GN4B 9ICNA 9ICIA 4A3LH 2DAKA 2OO9A 4OX9L 1JXLA 1VQ4A 5L1IA 1WJJA 5DB6A 2CFMA 4DV7Q 3PVXA 3CXCA 1BPXA 1UE6A 4UY8C 1ZQEA 1KRTA 3S24A 5BR8Q 1ZYQA 1TK0A 1Y14B 4J9LA 2UUCQ 3NENA 2E2JH 4DEZA 4NB3A 4JBMA 2C2RA 2VW9A 2IMWP 1Q81C 4F8RA 2JA6G 4TUSA 4YP3A 4PGYA 5IIOA 4PH5A 1WGLA 4Q44A 1E7ZA 4F2SA 4KLUA 1WCLA 2UVVA 9ICWA 3ISBA 1HR0W 4Q45A 4Z6EA 2BH8A 4JK1A 4DSIA 4P2HA 1X56A 1BPYA 1J6QA 4E0DA 1V92A 3HOXH 4DV1L 3RJIA 4HIDA 4MFAA 9ICTA 4JOIA 3PW0A 9ICFA 5J2HA 3S16H 2AWNA 4DFPA 1MQ2A 1XNRQ 2VQFQ 4YD2A 2K0BX 3K7AH 2IHFA 3PMLA 3PX6A 1S77D 4HJ9A 2AHOB 4DV5Q 5J0YA 2LXJA 1LUZA 5GROA 1T43A 3U58A 4J9MA 4LFBL 5IYCH 1G6PA 3FE3A 3I56A 2JA8H 1JR3E 3SV3A 4F4KA 2AGOA 4FDBA 4MZ9A 3ZD8A 4DAMA 2PQAA 1I50H 3M85A 1VQHA 2K5NA 4XIGS 5DLGA 2ALZA 4IR1A 4B9NA 2LSSA 4LF8Q 3GFKB 1LYLA 4IJLA 2XGPA 4DLGA 1U9LA 4FS1A 3IHPA 3TQ1A 4QZFA 1MJCA 1NJYA 1RIPA 3ULLA 3RTVA 1T8EA 4ELTA 3T1HL 1NK7A 2JA9A 1JIHA 3PW4A 1KD1C 3CCMA 4WJ4A 1SN8A 3GTMH 3ZDDA 4YMMA 4UP7A 4KLGA 4B3RL 1BPEA 5KT7A 3C2LA 3Q8KA 2JEAI 4IQWA 3S1MH 1U4BA 2K5VA 2W9AA 1QZEA 1Q8KA 1L5UA 3BU2A 4LF7L 5J2KA 3Q8PB 4X62L 4MEYA 4JG2A 4GOPA 2KZMA 5DG8A 3RJGA 4A93G 1N33Q 1XPOA 2MJ5B 1HZ9A 1G41A 2PI5A 3CMAA 3AEVA 4KLDA 4QY7A 5JJKA 4I29A 2RDIA 4HIOA 1Z00A 3HOYG 1X54A 3J7A5 1MSWD 3CCSA 5LMNQ 4OO1I 1NE3A 4DQQA 1Q82C 3KF6A 3JPNA 4JI8Q 5EWEA 1TK5A 4IRCA 2QNJA 5CHGA 4IFDI 4K0KL 2KNZA 2LXKA 1Q1EA 2KZZA 5KTQA 4UB2A 2QHOB 4C8LA 4TQUS 5KFKA 5M3MG 5IE8A 1TV9A
chains in the Genus database with same CATH superfamily
4PL1A 3UMMA 4WJ3B 3A0HU 4EX6A 3X3MA 3HOVH 4G4RA 1YUBA 2VIIA 2XNAC 1YEZA 4YCVA 2K8CB 4BY7H 4GLXA 1J9OA 2ZXOA 3D8BA 5AM5A 2FMPA 3RR8A 1K1SA 4WURA 3GQBA 4NPSA 3VA7A 4JI7Q 4S12A 4GIPA 5ALQA 4X6AH 3MWYW 4NW2A 1PYWD 3WK9A 4FWHA 2W7OA 3EA6A 1JR0D 1K0SA 4G4OA 4DR4M 1LACA 3T6PA 4OW0A 1P8LA 4IURA 3MABA 3MR3A 5E26A 5FO9B 1EXNA 3BBZA 4F50A 1XPRA 2MAXA 3H4DA 4BXOA 5CB1A 3PV8A 2Z4IA 8ICRA 5DKWA 3OTOQ 4UARA 2C98A 3M4PA 1NTGA 4RQ1A 1B2TA 1PJJA 5CWRA 3SATA 1B53A 4J9QA 3HOUG 3RZOH 4AW4A 1D9FA 3F2UA 3WK4A 2B29A 2MH8A 4JXJA 3NE5B 2HHUA 2FMMA 4LJZC 4BLCA 5DBBA 1PZJD 2H3FA 2A1JA 1UNSA 1YHBA 1E1OA 3MFHA 5ELBA 2KQ3A 4IRKA 3GIJA 2E2IB 4QZCA 9ICVA 2UU9Q 4PJ0U 3SAGA 1GJSA 3AFHA 3R2TA 1A3TA 5DGBA 2L4NA 3I76A 1W2BA 4I81A 1VDVA 1EL0A 4JC0A 1R2ZA 3RB0A 4DR6M 1ZJNA 4DR1Q 1WJ7A 3EZ5A 4IBCA 2D5DA 2BE5D 1LTLA 5ALDA 2K89A 1QSSA 4BA2I 3C9PA 2K1BA 2YYZA 2A8VA 2MROB 3QUCA 1X65A 3OW7A 1Y1VG 2WFAA 5IIMA 1LLRD 2Z4HA 1JRPA 3OHAA 3TN2A 2LFNA 4KY5A 4F87A 1SXJA 2KEBA 2KCCA 1B1ZA 3V7KA 1H9SA 5A2QL 1AW7A 1BF4A 3S1RH 1HNXM 2H1EA 3I4VA 2L09A 4C3IB 4NXML 2ZUBA 1D8YA 3HOYH 2XEPA 4BWMA 2ATWA 4UAZA 3QO2A 1X6IA 4LFAL 2MSNA 1D2NA 5KFMA 4TQSA 4AQYL 3WWVA 1O7IA 2EVBA 5ITQA 1PFNA 2QARA 1ZQLA 2JP1A 1MJEA 3S6JA 1GD7A 5EE0A 3U9SA 7ICJA 2FFJA 3HHYA 4YMNA 2F3WA 4GC7A 3ZDBA 2DUDA 3GLIB 4IQVA 1PMRA 2XZUA 2I7PA 2CN1A 3OSPA 4XT3B 3SR1A 1J5EL 4GN3B 4F5OA 3PO2G 4C3HG 2JEJA 2XI9A 4L5RC 3RMHA 5DLQE 2GN5A 3MHVC 2KCTA 2NWGA 1SNMA 4X66M 2Q8IB 2PMZB 4XQQA 1RTOA 3PO3G 2IHMA 2IT1A 2AWOA 4GH9A 1N2XA 4Z6DA 2ZG6A 2SOBA 1L0WA 1UA1A 3W3AA 5IIKA 2DI0A 1G51A 9ICSA 4A3GH 2CHVA 2XLJA 5C0XH 4B7GA 3GQ4A 1TKDA 1X9NA 4CF3A 4ZOHC 5IIIA 3QUTA 3BJYA 3HX3A 2LTUA 1GUWA 1WYGA 3MGHA 1HNWQ 3VR2A 3BQTA 5AI5A 1DGFA 2FJ2A 5KT5A 5C18A 9ICJA 4QZDA 1FL0A 1N60A 1XNQM 4JI1M 2F1HA 1RXWA 5AJ3Q 2MU2A 4MGHA 4QGUA 4BB9A 4TQRA 5K5PA 4GKJL 4C0ZA 5KNIA 3ND9A 2MHVA 1ED1A 1V1PB 5ELDA 1S5LU 2BHNA 3QU4A 2VUMB 4OX9Q 5BR8L 3U60B 1SXJC 2BKEA 3OHXC 3G6XA 5DGAA 3EYZA 1UCVA 2E2HB 4JW0A 4DV7M 3N4MB 1UA0A 5A35A 3QZ7A 4GHLA 1OIPA 2P35A 3ULPA 1JB0F 3ZCBB 3ER0A 2Z4RA 4OWWB 5JPMC 4F5PA 4JI2Q 2HBLA 1ICFB 2M9NA 2ZIWA 4IQZA 3K6OA 2X69A 1A3VA 3ONAB 1MI2A 3RJEA 3KP0E 1H9JA 1D5MC 3HOZH 4P4OA 4MGYE 4I2CA 4F4XA 3RAQA 2JE6I 2UXBM 5IYBG 5LL6X 3I1YA 5J2BA 4C3JH 4QZGA 3PIP3 3TP5A 3G4SA 4Q7JA 3N52A 5EBDA 1Q7YC 3ZDAA 4QJFA 1T4GA 4DPGA 3S17B 2CH4A 1L1TA 4M9JA 3HJEA 2K4KA 1D9DA 5JEAH 1D0LA 1NKCA 4NLNA 2OH2A 2JXMB 4QMGA 2HHTA 5T14A 3QEAZ 4RCOA 4F93B 4KN7A 3FVQA 3PUZA 4P16A 4UAVA 2Q8TA 3SK6A 3S14B 2WAQF 3U9OA 2UXCQ 3FUWA 3C5FA 1F2MA 4CCHA 1E0BA 1N32M 1YITA 1SXEA 1L3UA 4BBRG 3J7BA 4Y2SA 3SEBA 4NP5A 5DQHA 3WKDA 1K83H 5I2XA 3NVWA 1PFBA 3RR5A 4FBUA 1LB2B 5TSSA 1Q46A 4JI8M 1UE5A 5KYLA 4DSEA 4YY3Q 1KLGD 1IY1A 2V9WA 4A3JG 2Z6KA 2YFQA 5M9OA 3D3RA 4B7FA 4J1MA 2Z4SA 2HOFA 1N36Q 4FF3A 3QG1A 4JI7L 4JV5M 5M3FG 3K7AB 2CHQA 3EVQA 3K58A 5EPLA 1BBUA 1OXVA 2Z7JA 5DDYA 2EJFC 3FKIH 3PY8A 1RQLA 1EY8A 2QBYB 4G6ZA 3U6CA 2KICA 3ND8A 3GLIE 2A68C 4O0AA 1KSPA 3U61B 2JN4A 3OTOL 2XCAA 2G08A 1RDFA 3CF0A 4QWEA 2FNAA 2C5RA 2DWLA 4G7ZC 4KTQA 4KY6A 3SK5A 1U4MA 8ICXA 2X6GA 1A8VA 5AI9A 4OJPA 2FLLA 3KF8A 4G4NA 3KBGA 1SNDA 4DL7A 5K4LA 8ICZA 3AYHB 4YXJA 3MEHA 1YZ7A 7ICMA 4QZBA 4Y2PA 4DSKA 1ENAA 2JNHA 1R6BX 3UM9A 4LZZA 2Q2TA 4HEOA 2WF9A 1I6HH 1EFWA 2NVTH 4YG2A 2R18A 2DWQA 1EWCA 3WHKA 5DB8A 2D7EA 2UU9L 4CGYB 1NV9A 4GFJA 4R4CA 2DWNA 5JJLA 2I9GA 2EYPA 2Z0SA 3GTPH 1L0YB 4DR1L 1KABA 5I9OA 2Y0TA 4PDIA 3IFDA 2VZAA 5EWGA 4F88A 4MF2A 3PNCA 1KDBA 7ICNA 3KTQA 1KDHA 2LYBA 2AH5A 3GDXA 1NOMA 4JI6Q 2WAQC 2IHNA 4JI0M 1QCKA 2JA5B 2FPMA 2JP7A 4K8JA 2F1JA 2JY8A 2L4EA 1XC9A 3RE8A 2K5HA 2WKCA 4A3IH 2Z6KC 3CYMA 4R66A 4Y2VA 2L0CA 3TE6A 1STAA 9ICRA 4UB8U 5CV5A 3J7ZC 1TAMA 1LTRD 3RUZA 3KYHC 2XO7A 2C5CA 1RXVA 4J9KA 3AUOA 1XXHE 4Q5VA 2OWOA 4N9PA 2F0LA 5BOLA 4B3TQ 1VG5A 1ZQUA 2NRVA 4E6IA 2EY1A 5IWAM 1IBMQ 1OTCA 9ICUA 2OEOA 3NVVA 1D8BA 2ID0A 4OIJA 4JV2A 2G06A 2LKYA 3K1RB 4GC5A 5EE1A 3TSSA 2XVTA 3KLSX 1Z5BA 2F4VQ 4YHHQ 5FJ8G 3G6EA 4MM3B 4YWKA 4XQNA 4X65L 1QWYA 2HHHQ 1LTTD 2HHWA 2CQAA 1RKNA 3LMMA 2N78A 3EFXD 1I4RA 3HWTA 3DLLA 3EPIA 2CPRA 2XY6A 5EAYA 5FLMG 3PUVA 1K0RA 3KLSA 1ZQGA 1BPZA 1UEBA 5C5LA 1O03A 4PMCA 2M60A 1I5FA 1B0XA 1I3QH 4GRIA 2W3SA 5IZ7D 2N3SA 2HOQA 1SB3C 4XYQA 1RD9D 3RN5A 5JJIA 5AFWA 3SVMA 3D2QA 4DV3M 1KLNA 5JTIA 4DGZA 2YNMD 2GVAA 1HNWL 4DQIA 3V6KA 1HR0M 1WCMH 3H7IA 3K59A 3E3XA 1B4FA 3MXNA 4BWJA 3FHWA 3AMUA 1K3WA 3BZKA 5AJ3L 1B9NA 3C1ZA 2W9CB 2YQZA 2L15A 4CIZA 5E1FA 3B7NA 1VQLA 5LMUQ 2I46A 4GXJA 3JPRA 1FJGM 3MGIA 3IAYA 2D3DA 4G4QA 3N7RC 4GNXB 1IYJB 3L4PA 4OVZB 3PW5A 5JAVA 4XK8F 4R64A 3L29A 3K4GA 1UWVA 2UUBM 2ZTCA 3DMUA 5EP4A 4RT2A 2FFKB 3AU7A 5M5YH 2PFOA 2YV5A 1S4ZA 4IUTA 4OX9M 1UUPA 5M3MB 2R7ZB 2BPCA 1Z7TA 1SE4A 3Q22A 4X3UA 4JI2L 1HT2E 1ZQKA 4IBKA 4Z9CB 2DGYA 2IX1A 1EFUB 1LO5D 1PUZA 1KKXA 4RAUC 5KFDA 1EU3A 4RPYA 2E1EA 2QGQA 5EXSA 2ZAMA 4IFDG 2DAGA 1GUTA 3KSJA 3S1NB 3GQ3A 1M8AA 4NSRA 4KLOA 1NK8A 2KEDA 2AQ0A 3GRRA 5EKKA 2FMQA 1U4LA 5IYDH 3BDOA 1HRJA 1QZGA 4FF2A 2BQ3A 1QE6A 2ASBA 3FUXA 2WTFA 3GD7A 3KD3A 1PJQA 1Q3LA 4DF7A 5KFYA 2JZBB 2KJ9A 4TUPA 3HZJA 5M5XH 3WKEA 1WTPA 4RNAA 2EQSA 1GHKA 5IGGA 1TWAB 3P75A 2KHQA 3B6YA 4EYIB 3U6SA 4Q0FA 2W11A 4HJ5A 1GVPA 3H0LB 1Y1WH 3S2HH 3ULJA 2NV3A 1VDLA 2UXCL 2VUMG 1M4VA 1HEKA 5AKXA 4B3RM 1YJ9A 1RQNA 1LV7A 3OIQA 1IIPA 5CV9A 1L7NA 4HIKA 3VCBA 2W54A 3W0FA 4HSPA 4YQWA 2HDOA 4LRSA 2W8KA 4DKAC 4JN6A 1JALA 3KHGA 4YY3L 2SNMA 4PD2A 2OOAA 2NO5A 3WK6A 1Y8NB 2LY7A 1HJPA 1WGNA 1B3AA 3MFGA 2VDBB 1N36L 4X5VA 2N1RA 4OCZA 4NXNM 1RYRA 3NELA 7ICSA 3HU1A 1AUAA 4BBAA 8ICHA 4UAUA 2F8LA 1OAIA 5AM3A 3MBYA 4ECQA 1NJXA 2UVUA 5KFIA 3I8ZA 1N56A 4A3CH 4UN2B 3SK8A 4C8NA 4O5EA 1Q3BA 1D8LA 1ZQIA 1EUJA 8ICKA 2GVBA 3QUBA 2UXDQ 2K14A 1X37A 3CQZB 2LVOC 1K1QA 1V33A 1ZQMA 2J6SA 1D1IA 5GTIU 1IN7A 5L1LA 3RZDH 1NK9A 4RNMA 5BPVA 4LF4Q 3KHHA 2NVQB 4RU9A 4FXDA 3TFRA 1ZETA 2IJ0A 5KPTA 3KUPA 4R4OA 4ED2A 3EN2A 4M6WA 3RAXA 1QLNA 3HJSA 1VQOA 4H7BA 1SXJD 3OMCA 5D3DA 2VY3A 1DGSA 2E5LQ 5JU5A 2KHHA 2J7NA 5EE9A 3BJUA 1J2MA 5A0LA 5KFCA 3SFZA 2YU9B 2FINB 2E74C 4NKLA 4DV0Q 1XNSA 1N9WA 4OHJA 1NNXA 5AI8A 2K5WA 4HCSA 1P3QQ 5EKIA 5ISRA 2KKPA 5J2DA 4EELA 4I2EA 2G8LA 3RNUA 1ZQWA 3GTKB 1AP0A 4I28A 4A3FH 4L4UA 2F5PA 4QWAA 2KTQA 3I4MB 1XTDA 5T1IA 1GL7A 4K6LA 1JMCA 1N63A 5CP2A 1IBLL 4RQ5A 5CORA 1GUNA 4JI6L 1FFUA 1N8RC 1JJGA 5KFUA 2K5DA 3K1JA 2IX0A 1EY6A 1L2FA 3VR4A 3HOZG 2DHRA 3TS0A 1NK6A 2KCNA 5J0QA 2Q4TA 3LCUA 3MFYA 2E2DC 2BCVA 3FC4A 4DV4Q 4RGOS 3H8SA 1PTOF 3JPOA 1TWHH 4JBJA 4PHDA 4B3TL 1HCZA 1NK5A 1EWIA 2XVSA 4N8FA 4P4PA 1IBML 3GTOB 7ICUA 1KTQA 5J2CA 2VQEQ 3O13A 4BXOB 2B2WA 2F4VL 2Y0SF 1CZGA 3R8BA 1WIVA 9ICCA 4YHHL 4BBSH 2VS1A 4A3MB 2HHHL 5KT4A 1HZAA 2IW3A 2NN6G 4GHAA 1PTOH 4LF9Q 2KMDA 3SMVA 3P7JA 4DFAA 4DQPA 1RCVD 4A3EH 4KX3A 5BPCA 3A5UA 5KFWA 3GIKA 2BGWA 1TS5A 3BDLA 9ICHA 5C4XB 2A1JB 3TL4X 4RPXA 2H3QA 4HAIA 2BOSA 1S5DD 2SNSA 3K1ZA 4DCCA 1SDFA 3CNHA 4GS3A 4MEXA 4FFDA 1EZ6A 4OJOA 4ED6A 1XMOQ 3CCLA 9ICAA 2V1UA 3BZDB 4IUVA 4DR7M 4IQUA 4YR0A 8ICWA 2JA5G 5L1MA 1JICA 4AP9A 5CV7A 1LT4D 1HQMC 2A68D 5J39A 3AFPA 4QUCA 3TS2A 3F92A 3HPOA 3BVZA 3SD7A 3RBDA 1G291 3S15H 4CDEC 1SBBB 4R9WA 4GKKQ 2YR0A 4NLBA 4A3LH 1TGUA 3A8KE 1JXLA 1VQ4A 1H9SB 3FTCA 5LMUM 5KO3A 4IS7A 1ZQEA 3S24A 1ZYQA 1Y14B 1TH4A 3H0GB 2E2JH 4DEZA 2C2RA 4F8RA 4TUSA 4PH5A 2K8BB 4KLUA 2WACA 4DAPA 1HR0W 2BH8A 4DSIA 2QARB 5CV8A 1KAAA 2D7HA 3C46A 3RJIA 1I4GA 9ICTA 1SE3A 2UUCM 9ICFA 5J2HA 2AWNA 1MQ2A 1XNRQ 4YD2A 2K0BX 2IHFA 3L9AX 4HJ9A 2K05A 4DV5Q 3EIEA 4IBBA 4GMQA 1R7RA 4J9MA 1BCPF 5IYCH 1YE9A 1D6EC 5KYIA 1HA5A 3I56A 1E9SA 3HRZC 2JA8H 1PTOC 4MZ9A 5C3EB 1TWFB 2PQAA 2K5NA 4OJ6A 4XIGS 1GLNA 2ALZA 1RHPA 3GFKB 2EY6A 1NY6A 1K82A 4FS1A 3IHPA 1MJCA 1NJYA 5DNFA 3ULLA 2Y0SC 3TWLA 3SAUA 3GTGB 2KK0A 1F9RA 3KOXE 3HGIA 5AKEA 3T15A 1COKA 2I6XA 5EBCA 4LF8M 4KLGA 3Q8KA 2JEAI 1ZEQX 1IKLA 2EO2A 5BN4A 3S1MH 1U4BA 5AKHA 1L5UA 4X62L 4Z6YA 1K28A 3RJGA 3FUUA 4PDGA 1HQCA 1XPOA 2MJ5B 1HZ9A 5DEHA 2PI5A 3CMAA 3AEVA 4QY7A 5JJKA 4L6TB 4CF4A 1X54A 3J7A5 3CCSA 5LMNQ 4OO1I 1STEA 4QIWF 5EWEA 4DU9A 1MA7A 1J8IA 3QNMA 2IL8A 1N33M 5M3MG 2R7ZG 2ZXRA 2E8GA 3PMFA 3B9PA 1E24A 2EOTA 1WVLA 5EP3A 2HCBA 4DO9A 3WK5A 5ALYA 4JBWA 2JA7B 5C3XA 1VQEA 2FLPA 1IHZA 1PLFA 3A56A 4MHVA 5ALGA 1WD0A 4D81A 4MTKA 3I4NH 1MSHA 1CI4A 4QHSA 3UDGA 4M9GA 1TWCB 5ITUA 4RQ7A 2RQXA 5AK5A 2RSOA 2RDGA 2LHGA 2MO1A 1ZD2P 3C58A 4JI3Q 4B3SL 4QF4A 2ZIWB 1EY9A 3QU5A 2J5YA 2EE1A 1PJIA 5ELCA 5KG3A 2UXDL 3AQFA 4KHVA 3KDFA 2L5TA 1KN5A 5FO7B 4ED8A 3WOEA 5KQ8A 2NRXA 5FTKA 3TQYA 4LF4L 4FZMA 5FP0A 1IBKQ 2J6TA 4JMUA 4QJFB 5ITYA 2W55A 4IBDA 2F0DA 2EKFA 4GEWA 5I6YA 3GV5B 2WF7A 1CA5A 2J7ZA 4HAEA 5ELFA 1BCPC 3C5GA 2E5LL 3WKBA 4ECTA 5F3XB 3JPSA 1EQTA 3PIO3 1GVNA 3CRKC 3CRLC 1NY4A 4ED3A 1VCIA 4IUPA 4B9VA 4Y2XA 2KDLA 2RGOA 4IOCA 2ZM6M 4DV0M 2X6LA 3OW2A 2EH9A 3E2EA 1TK8A 2B2VC 3H3VI 4CDCC 3NUCA 3M4OH 2JEBI 3VYUA 4ZQ3A 4GXKA 4XRHA 2ZXHA 4HYKA 4L16A 2NZHA 1EYGA 3DV9A 3GTQB 2ZXPA 4POFA 3HHXA 2OM6A 4Y7NH 3V6HA 1B70B 4PMWA 3T3FA 3VLFB 5IWAL 4JI5M 5CRXA 4YCUA 3PUYA 4JYAQ 1NJZA 4A93H 4QIWC 1PH2A 1OFIA 1J2NA 2ZT9C 2W8LA 4DV4L 4R8NA 3AU2A 1TIID 4AYBB 2F0WA 2DN8A 1NJWA 4RNOA 1NUCA 3PX4A 3M8SA 4RG1A 3HS0C 2KUMA 4LWCA 2I7NA 3C2MA 3TACB 2Q2EB 4B6JA 1EQVA 4R3DA 1EIHA 3GPUA 3RGPA 4DNRB 4U6PA 4IFDJ 2JMGA 5KL8B 4BY1B 4MH0E 2KN7A 2VQEM 1BGXT 3AFQA 3KF8B 4LZJA 1GUSA 4LF9L 5KPZA 3RRGA 1XYIA 4JWMA 1HUMA 2VIXA 1YNNC 3TAQA 1F9PA 3FTFA 2BDPA 2E75C 3SK4A 2Y0SE 2ZUCA 2CFOA 3VKGA 3TARA 3I4MG 1BQQT 3TDQA 3HX0A 1PGYA 1XMOL 4QZEA 2B2TA 1J97A 3M6ZA 3D4RA 2MGWA 3VC8A 1EIFA 1W5SA 2DGZA 5FLXS 3H8MA 3HOUH 4CISA 4G4KA 1KRPA 4OL7A 2CH4W 3DXJC 5E4WC 3BQ1A 2Y1JA 2EA0A 2X4AA 3NQTA 2Q0ZX 9ICKA 2LS01 4YFKA 2ES2A 1ZQAA 5E7NA 1L2BA 1DONA 4IQTA 3W5OA 5KG4A 1N77A 1RM6C 4J9SA 4RGNA 3Q8DA 1DRGA 3DEEA 2C96A 3GP1A 4GKKM 2LKVA 2WHEA 3QIAA 2R3ZA 3GO5A 2AQ1B 2UUAQ 2H3VA 4A3DB 4M9HA 4UW9A 3CCRA 2JA2A 3CRXA 3RD4A 4A3MG 5DNYA 4DUZM 2ZJ5A 4CNQA 2P5ZX 3CF5A 3L0OA 1S10A 3L3OC 5HNKA 1JUDA 3C29A 3ERQA 3CCJA 1HFNA 4O42A 1MSGA 1UQVA 3JPQA 1G59A 3ALRA 4DL2A 3L7ZC 3QYPA 2DKLA 1LTAD 2NB0A 4ECUA 4JPBW 1XNRL 3S1QB 2LMRA 1Y1VH 4DV1Q 2JZ1A 4CRXA 2OTJA 2EUCA 3U4VA 1IYUA 2G5IB 5C4XG 4M9ZA 5HR6A 1OKSA 1EEFD 5I4DA 3ZJYC 1XMQQ 1R4GA 4NLCA 4XBOA 2IY5B 2MP1A 3GTJB 3SMPA 2KECA 3THVA 4RHRA 5KIXA 4UB6U 1I4QA 1L8LA 2DZNB 5CJ7A 4B3MM 4LF6Q 1L1ZA 5C4JB 1OAOC 1JMSA 5H2FU 5KG1A 4ITQA 2VNUD 2A5HA 4IIWA 4NJ8A 4DV6Q 3C21A 2NVYB 1VDDA 4A3KB 1KFVA 2F0SA 2JGAA 2PZTA 4X64M 5KFLA 4X3SA 1IKMA 3PO2H 5JOBA 1TWGB 4C3HH 1WG8A 1X3QA 3HOWB 4OJ5A 2CXYA 1SL2A 2JZ0A 2F0QA 4JI4Q 2WB1B 3EBEA 5C44B 4LF7Q 3SAVA 2B2TC 3GPYA 1C1KA 1Z4OA 4QCLA 3N6RA 3HP6A 3ZD9A 3MXNB 1O08A 2YMLA 3PO3H 2RRDA 2JXJA 1RPLA 3H0GG 2EY5A 3U4ZA 4EZ9A 1PYBA 1W6KA 5M5WH 4F8MA 1GKHA 1MIUA 1N34Q 4K0KQ 2OTLA 5JVH3 2FE8A 5LMNM 1AFPA 2R8HA 3F1ZA 2QCPX 2XN9C 1QILA 1EIJA 2D8CA 3IM1A 2Q2HA 5J0SA 1DGJA 4DV2Q 3F8TA 1MQ3A 2DKZA 3VDUA 2O4XA 5BN3A 2VA3A 3K80C 3NQIA 1VQPA 2A69C 3K81C 4A76A 1L7PA 2A5YB 4YIJA 4BGDA 2CP8A 3R8FA 3FM9A 3PIPA 5HHIA 2K33A 1Z6TA 3FAHA 2XWJB 4QHTA 1JN3A 2K32A 4DR2M 1F2LA 3X3NA 2N88A 3HU3A 4AYBE 5IGCA 5C3EG 1D0MA 2WSFF 4JK1C 5AKZA 2GH1A 4JI3L 2DNEA 8ICUA 1SE2A 5JI2E 2XWBB 2RDJA 3CF2A 2HVHA 4F2RA 2GQFA 1DM0B 3ITPA 4RQ8A 3E58A 4J9PA 1S9FA 3WDNA 3SARA 2RVLA 5J2AA 3NRWA 3A54A 2F0MA 3E0EA 5AIBA 4CDDC 2DNAA 1NNLA 1XPUA 1SGGA 4NC6A 1UPHA 4HEDA 4M0AA 3LQQA 4USAA 2DUYA 3CAMA 3DOAA 1PVPA 3QJYA 1HNZQ 1JOKA 3A7LA 1IBKL 3C2KA 3H09A 1CUKA 2R0IA 4PV1C 3KZIU 3GTLH 1UT5A 2JR5A 3GTMB 1SXTA 3D8GA 2KVMA 4A4IA 1ZD3A 2R8JA 8ICSA 4K5VA 2M2LA 2LYAA 2EANA 4IOAA 3MA2B 5ALPA 1FVIA 4HTHA 3OIPA 3UQ0A 2DAEA 1TS3A 1KIXA 2JY6B 4FZNA 3NBXX 1QDTA 1NR4A 5AM2A 5IYBH 4U673 3AQQA 4IPDA 5AKIA 2JA7G 3JR4A 2ASDA 3KFUG 2PZWA 1F2YA 1O7LA 3AB9A 1I4XA 5C0XI 2OOBA 1PRTB 1PTOD 3T1YM 4QNLA 1ET9A 4X3TA 9ICXA 2OQ0A 4KHPL 2C2DA 1DOLA 5AK4A 4FXKC 5F9NA 2KW0A 3SE0A 3I7FA 3GPPA 3Q8RB 3E5SA 1DCZA 3BYYB 3B74A 4JYAL 5IGBA 1RG6A 1YJNA 2XRQD 4FP5D 1XSLA 1L6NA 3SASA 4I2FA 1I94L 4GIBA 4XA5A 4BBRH 1TQOA 1TXYA 9ICOA 3M3YH 3EROA 4DL4A 1I4HA 1Q1BA 3EPGA 4K5XA 5C6AA 1U0LA 3LWMA 1A15A 4FWGA 3VYRA 4LFCM 4DA2A 2NO4A 1DJRD 4L78A 2FPKA 2QEJC 4A3JH 4KN4C 1VMPA 2JA6B 4M9LA 1SYGA 3TKAA 1ZAEA 1NO1A 4BDPA 1E2WA 1NHGC 4GN5A 2R65A 2A3VA 3ILKA 3UE0A 4TVAB 3EIHA 1QVRA 5M3FH 1QSYA 1JJCB 4M6WB 1IXSA 1LV5A 4DF8A 1QVCA 2VA8A 1WXQA 1DD2A 4DR3Q 5EWFA 3U5ZA 1AIPC 1ZKOA 1EFID 3PV0A 3UK6A 3NTUA 1FEZA 4RQNA 1C0AA 4M0WA 3AU6A 4LJ6A 1A62A 2J0TD 1QSLA 2PI4A 5FK9C 2AGQA 3UXNA 3V76A 1T3TA 5C5MA 2WB1E 2RLTA 4G7OC 3BDCA 4QW9A 2G0AA 2MFIA 2FPLA 2HT1A 2L11A 1Q3UA 3E9SA 4RQ4A 3NEMA 1VQ8A 3K8AA 2BR0A 1RZTA 4H44C 1STBA 3QB3A 4QZ8A 4AYBG 3OPXA 2HVIA 1QAQA 3RB3A 2IOHA 1IM2A 1VMCA 3JAMi 3H0RB 3HJQA 3SEIA 1UHUA 3BG3A 1PH8A 2CEAA 3QZ8A 4EX7A 1BCPD 4A8EA 4B9MA 2UUAL 4ELUA 4ZRZA 2ZJAA 2HCIA 1EYDA 1E3PA 4CKCA 3VFDA 4BY1G 3AJIB 4Z8XA 4LJ8A 1V43A 2P6UA 8ICEA 1C4QA 2Y1IA 5KG7A 4PHPA 1ZQBA 3IHQB 2F0FA 4PG3A 8ICTA 4R1JA 4GXIA 3BZCA 5KG0A 1V85A 1XSPA 5L1KA 2ZAOA 1XMQL 4DV1M 5HHHA 1VEGA 2ZTDA 3TP8A 3SI8A 2ASJA 2XSZA 4IN3A 4YXMA 2ODGA 1E94E 4LFBM 4RKLA 4R65A 4LF6L 4C4TA 4Y2TA 3TP6A 4LZDA 3T79A 4DV6L 3T1HQ 3J2PB 2G3QA 1XWLA 1N5XA 1L3VA 2AKWB 4NLKA 5FJ8H 3QUQA 1NNUC 3PF4A 4RF0A 4IUQA 1N33L 2EAMA 3HKZB 2DJFC 1Z59A 7ICTA 4JI4L 4NRWA 1QB5D 2E2IH 4RWSC 2PFPA 3VYSA 3K5MA 5FLMH 1IM4A 2EZXA 4UP8A 3CC2A 3U6MA 4KLJA 1RF2D 3HWSA 2CWAA 5J0XA 1K3BC 4KTAA 4A3DG 1N48A 3GV7B 4LF7M 1U47A 2K50A 1N34L 1KEJA 4K2LA 1DYQA 4PZ6A 2MUTA 1YNND 4DV2L 2APLA 3M0EA 2ZTEA 4F5NA 3GRYA 4O5KA 2KRUA 3T5LA 4K0KM 1JJ2A 2XY7A 4GC6A 3DWQA 5J3BA 1QCBD 3I91A 1JWUD 3IG8A 3HJ8A 1Q3CA 1SROA 4QOZC 3A74A 3STBC 2OXOA 2ZIUA 2JQOA 4DK6C 1U48A 4C3IH 1ZRMA 1ZD4A 5FKAC 4RKBA 1FD7D 3J81i 2ZJ8A 3V96A 2ZUDA 3L25A 1H9RA 8ICOA 1NJIC 2OQKA 3BYTB 2QB0A 2F76X 5EXXA 1ZQJA 4RZRA 2W3RA 4C4SA 2SEBD 2W04A 2PQAB 1VQGA 4MTNA 1SV4A 1WTVA 4MGZE 3QXGA 2JY5A 2HWJA 1Z4NA 1HNZL 2O01F 1CI3M 1SNQA 4RQ6A 1LT5D 4H02A 3HOWG 1EY5A 2R46A 3C1EA 1EOTA 1BCPB 4M9NA 1B4OA 2WB1G 5IOCA 5C44G 3FRHA 3UZUA 1EY0A 2MNAA 4KLNA 1LT3D 4UQGA 2F03A 3TEHB 2C28A 3MJ5A 3DWPA 2NRTA 1DOKA 3I28A 5D3IB 5ALFA 1GUOA 5EXTA 5HMMA 4IFDH 1EYCA 1X3FA 1NVMA 2EYOA 3IN5A 2Z8YM 3S2DB 4J15A 2N35A 4F4ZA 3FEWX 3W1GA 2BDUA 1II3A 2FDRA 3K92A 3IRUA 3TWKA 3J81j 1PA6A 2HIXA 2N49A 5KFJA 3HGBA 3GLFE 2UVRA 1SIJA 2K47A 4QIWB 5GAGC 1JOQA 3V6JA 1LV9A 4P0PA 2HBJA 2XH9A 1ZMVA 2CUZA 4ZK9B 2LH0A 2VUMH 4DOCA 5IODA 2FXQA 2LHCA 1XXHA 2AQ4A 4DR5Q 3SMSA 1N75A 1L7OA 2TMPA 3A55A 2E2HH 1YLAA 2C2EA 4K2KA 1IL2A 2B63B 4KKSA 4AIMA 4DFMA 4AKGA 1PH9A 5CMDA 2PKEA 2RDHA 5GTHU 3UE1A 4NXMM 3KDFB 1S0NA 3PGZA 3E6ZX 2KZ3A 2H5XA 4LFAM 4QL5A 4DUYQ 2JJQA 3NVZA 4AQYM 1NJGA 3CKIB 4OWXB 3VR3A 4PZNA 3GRVA 3EWAA 4X65Q 2WINB 4V190 2DBYA 4R71A 1K9MC 4QNMA 3K5LA 3QEBZ 1QJOA 3G7LA 2GNOA 4UPAA 5J0TA 2ALYB 4K5WA 3CW2C 1J5EM 4DS4A 1K8MA 3ICEA 1L8OA 3PVSA 2A69D 4DR3L 3MXUA 2VANA 1STYA 3GQCA 4ULLA 5DBAA 2HDMA 2J6UA 3K7UC 3S17H 2GA4B 3V72A 1F9QA 1R9TB 3PSIA 3QWLA 1TS2A 2QP9X 4LF5Q 2IOFK 2JY7A 2L12A 2QB1A 2KVSA 3D31A 2C9CA 2EZZA 1JE5A 1CA6A 3A8IE 4XQ8A 2Y9UA 2W7PA 1QANA 1OXTA 2E8PA 4Y28F 3OSOA 1DO2A 1MJGM 2F8KA 3S14H 3WOFA 5IT9S 4QW8A 1A76A 4B7HA 2KNVA 4ED7A 3MFIA 2FE9A 4LJXA 1QUQA 3CCUA 4DNIA 2MUYA 1K8GA 4MB7A 1IG6A 1TDHA 5AM0A 5AK3A 3IKJA 4FZLA 2FMCA 2DAKA 2OO9A 3U6LA 1OW5A 3PVXA 4PT5A 3QYEA 4GC9A 3PSPA 4UY8C 1WTRA 1TK0A 4J9LA 3KVWA 2L9HA 4GKJM 2IMWP 4UDUC 5FOBB 5C3WA 5JVG3 1FO4A 2JA6G 5IIOA 4Q44A 1WCLA 5EPJA 1S3SA 9ICWA 2LPEA 4P2HA 5IGEA 4E0DA 1V92A 4ID6A 2EZVA 5BR8M 5CV6A 4MFAA 3I51A 3PW0A 1N78A 1XO0A 1HA6A 2VQFQ 5AHXA 3K7AH 1S77D 1DGHA 2K5QA 5HGTA 5J0YA 3HY5A 2Z1CA 1YT3A 4TSSA 3U58A 2LXEA 2BE5C 1H9KA 2DZOB 3Q8XA 5EQTA 1HTLD 1A6SA 1JR3E 3VA5A 5EJWA 4DAMA 2KJ5A 1PXUA 3MHBA 2F0GA 2VXWA 2J4XA 4CHTB 5AKKA 4IJLA 5I9PA 2E3TA 2XGPA 3HKPA 3WU2U 3CF6E 2VJ5A 5ALTA 4LY6A 1T8EA 4ELTA 3T1HL 1TY0A 1NK7A 1JIHA 2QLTA 1SN8A 2JXNA 1PK1A 4QB4A 1BPEA 5KT7A 3C2LA 3FTEA 4C56C 4IQWA 1TT2A 4OIKA 1QZEA 3CHBD 1Q8KA 3BU2A 4MEYA 3BS5A 3NBIA 3NSWA 2NN6H 1T5XD 2KJXA 2R93B 3Q0AA 2O5JC 4LJ4A 1MU5A 1G41A 3GZFA 1F5SA 4LJ7A 4I29A 2RDIA 2O5IC 1CT1D 4DQQA 1Q82C 2OHFA 1FR3A 5CHGA 4NL9C 5KAFU 2KNZA 2LXKA 4FCVA 1Y8PB 2QHOB 4TQUS 4UHVA 3ZDCA 1TV9A 1EEID 3DFZA 1PH1A 1WR1B 2EXDA 2FH0A 1VDZA 4WORA 4LGYA 1K5OA 4IUUA 3IL8A 1WWUA 2D2CC 1T3QA 2K01A 4DR4Q 5ALOA 1URJA 1R4PB 2JA5H 8ICBA 1L3SA 4YD1A 4LVSA 3WKAA 5TISU 4O1NA 4AI6A 2M0NA 2BCUA 5CEHA 2YMQA 4KY7A 2NUCA 4W5WA 3KHLA 5HURA 2O5RA 8ICAA 4YVZA 2A73B 3OYYA 3UJNA 1Z3EB 1ZMUA 4II7A 4JI7M 2K4HA 2RRUA 4I27A 1HIWA 5KL1B 2YTUA 3GLHA 4ECZA 1QNKA 4F72A 2QILA 3TWMA 2E76C 3FPUB 4DSLA 1BXTA 1Y8OB 3HKZG 2K04A 4OELB 2JHDA 1K8AC 1ZQNA 3OTOM 4YCXA 2PMZE 3E46A 2QA4A 2H3ZA 1TVAA 4K8IA 1Z47A 2BDNA 2UVWA 9ICGA 1EIGA 2CV2A 4MN3A 4OO1H 1LTGD 1I4PA 1YNXA 4Y52H 4DR6Q 1EQRA 1G91A 4I7ZC 4DBGB 4JV0A 4DQRA 2W03A 2EY2A 4F7XA 4HLQA 4RUAA 2J7OA 1QTMA 2MQHA 1VLBA 5KFZA 5EJCA 3M4YA 5DB9A 1SFOB 5AKLA 3PR4A 3IRBA 2UU9M 2RF4A 1XHBA 2AU0A 2HCCA 4PNYA 1M1KC 1K3RA 4KV6A 4ALPA 1ENFA 4PPXA 2KEEA 1IBLQ 4DR1M 2R62A 3QYBA 3GILA 3F5EA 4ME3A 4U7CA 4RQ3A 4US9A 5G5HA 3RB4A 2XTIA 4IPGA 1PZKD 2CWPA 4TUWA 4AKIA 5KFPA 3QX7A 1TAQA 3MC0B 4ZUIA 3M9NB 1IYVA 2CV1A 4OU7A 2JRZA 3RH5A 4DR5L 3MDAA 2DXIA 4ED0A 2LWXA 3H0MB 1SKWA 3GLGA 4PHEA 5M3MH 3PIOA 2R7ZH 5AM1A 4O3OA 1YBYA 5ALWA 5IT9L 4FS2A 1MGSA 3BQ2A 3E21A 1AH9A 4X66Q 4DUYL 1VS0A 3M7DA 2K4EA 3TQSA 3Q6SA 4ZLTF 1F77A 2R7FA 4L6V6 4HJ8A 1RDPD 4F2LA 1NZPA 3HT3A 4HJ7A 2F3NA 1CHPD 1E1TA 5H37D 1X42A 3S1NH 4YWLA 3T51B 1GJXA 1ASYA 3MVVA 1YIJA 2DY7A 4X65M 3CPFA 4IO9A 3OJUA 1QAOA 2DF4B 3GDEA 2HI0A 8ICYA 2XRSD 2F52A 3H3VH 1L2CA 2O2LD 5FSWA 2N55A 1STHA 2BQUA 3VK7A 1MX0A 3STBD 3M8RA 3OWFA 3B9JA 4XUSA 4OJLA 3MXPA 4LF5L 1XNQQ 1PFMA 5JUMA 4JI1Q 1SG9A 5G3LF 4AH6A 2E8NA 1TWAH 3MTSA 1HUOA 5KT3A 2DAMA 1FNVA 1JCKB 5KEEA 2B21A 1VQCA 5AI4A 2R6GA 4JCVE 4ZKCB 2KD1A 2PI2A 3D4WA 4TKOB 9ICLA 3ETLA 1HNWM 4OGQC 3M9OB 4C3IG 2K4PA 7ICQA 2PFQA 1R2YA 2XSZD 5ALKA 1VQ1A 2B63G 2JWSA 1O80A 3CP8A 4RFBA 4GNXC 3Q8GA 2JH7A 4F5RA 1U49A 4KD4A 5D4BA 1OJLA 3UPQA 5ALHA 2DNCA 4EIWA 3IFTA 2K6AA 3QAUA 4I5SA 4NXZA 2EXZA 5D14A 1HUZA 3SXHA 4UB4A 3H8JA 3GIIA 1OO9B 3NASA 3LQRA 1OUQA 1M6YA 1VF7A 3FTDA 2YY6A 4PMBA 1IN5A 1OXUA 3R2IA 3PQIA 8ICCA 1PVRA 2OF1A 2VQFL 2KNAA 1B7YB 2UXBQ 2P6RA 1D0KA 3ISCA 1KAWA 5E79U 4DSFA 2R8IA 1DOMA 5H1SE 1J7KA 3ZC7B 4QOSA 3UXOA 4G9BA 5F9LA 4JI2M 1SJED 4FYDA 2K9DA 1HZCA 4NDXA 1B8AA 3CQZH 2D0OA 1PYSB 1ZQDA 5ITRA 1UT8A 4BXXG 1IXSB 4M47A 2EJGC 1HH2P 4KJOA 4FF4A 3U5ZB 3NTHA 5FTJA 2NVQH 1ZD5A 2F0EA 3L2AA 3NP8A 2G09A 3VYTA 2Q2IA 4Q43A 5KFRA 2NBFA 1OQYA 2DKXA 3L3FX 1AEXA 1S3OA 2RQ5A 4DFJA 3GV8B 1JB3A 4EQNA 4ECRA 4U68A 3PW2A 1SZHA 1N32Q 3QOLA 4C2MB 1T94A 4IPHA 4DL6A 1P16A 1O7YA 2YU9H 2NVXB 2R92B 2BH2A 4X62Q 4A3BB 5AICA 4Q8EA 3KOWE 2F2AB 2NZOA 3RH4A 1ASZA 3LWLA 1QH9A 5C4HA 3UDIA 3FRPB 3GTKH 2UXCM 4RA8A 4X3KA 3I4MH 1CKOA 2C35B 5KFNA 4EZ6A 3UDXA 4JV5Q 2V4QA 1OFHA 1QYRA 1NMGA 4KT0F 2L7HA 2I5LX 5JRTA 4NLZA 4DOAA 2QKIC 4DR4L 4PHAA 3WKCA 7ICRA 3KZXA 3JAMc 3I4YA 3HOXB 3MEFA 2B0CA 3CC7A 3N7PD 4YY3M 5C5JA 2A6HC 3S16B 3Q8LA 4ECYA 4M9SA 4RPZA 5CA7A 1ZQ1C 1E2ZA 4C8MA 4BJQA 3H6MA 1KDAA 4JOIC 1N36M 3OSNA 1VQ6A 3BVMA 1KNAA 4B3SQ 3I70A 3UMGA 3D2NA 1X9MA 3RGSA 2BWEA 3J7AV 1JOOA 1X3GA 1COOA 1S5FD 4LG2A 1I50B 4CF5A 1ZQQA 3GTOH 3EJIA 3N7SC 1SYEA 4Y2UA 4OEMB 4OD0A 1CM9A 2DHYA 8ICMA 4B08A 4C4RA 4A3MH 2V4RA 4O9MA 1LTID 4I2DA 4C8OA 2L55A 5BN5A 4ZH4A 4DWIA 2EYLA 2R93G 3M4QA 1SV0C 5ALJA 1XWIA 4AG5A 4Q8FA 2LVQD 4KJNA 3MR6A 4UAYA 1NCVA 2K4IA 1IN4A 5GAHC 4XT1B 2G5GX 5ALSA 4DR6L 1QNUA 3U26A 1SNCA 3A8JE 4O3QA 3C3DA 7ICOA 5C4XH 1VQMA 2W43A 4TUQA 2L4FA 2F4IA 8ICQA 1ZJMA 3U6DA 1UEAB 4CDGA 1SWWA 2RCFA 3D6CA 5ALLA 4M8AA 1TTEA 4MF8A 1DGGA 7CATA 2G5HB 1SE8A 3NRZA 3ED5A 3A46A 2RKSA 2PW5A 2LVNC 4I4LA 4JI0Q 4ICAA 4BWGB 5KNBA 3HOVB 3T5HA 3J80i 3ERSX 5GAEC 3RFWA 1HNXL 1IV8A 3E9IA 4OWTB 4BY7B 3S9WA 4ZPXA 8ICNA 1X6JA 3G6YA 3NXWA 4TRDA 2MUTB 4PZ7A 4ILWA 4Y2QA 1D2BA 1HUNA 1JT8A 2Z6BA 2V4DA 3UQ2A 1XTCD 1XWEA 1G8PA 1B50A 2E8OA 3CMEA 2ZJRA 1U5KA 4Y2RA 1PM5A 3KS4A 2LVAA 1NV8A 3F2BA 4CKBA 1IBLM 5IWAQ 4YMOA 4FNFA 1SL1A 3K9OA 2FS1A 4JI6M 2ZIUB 1IQPA 4PGQA 1TR5A 3JAMS 3H0GH 5KQDA 4HMJA 5EPKA 3TADA 1SNPA 2HD3A 3LDAA 4EGVA 4GZYC 3KLRA 1X2IA 1ZRNA 4DK1A 2QB0B 2K52A 1TAUA 5KFQA 1TDZA 4X66L 1AQ6A 2LMCB 1KL9A 4DAYA 4B3TM 3RBEA 4CJ1B 3RZOB 1ZMWA 3C23A 3J81c 3I04M 1ZQZA 2FJ6A 2PXIA 2E5SA 1G4AE 1ZQPA 1IBMM 4UP9A 1YI2A 2ZXIA 2R4EA 4FD2A 1WOCA 1ML0D 2ERCA 3BQ7A 4IL6U 2PW7A 5IINA 2F4VM 1R5LA 4YHHM 5C3EH 1TWFH 2PYKA 2HHHM 3DHQA 3T5JA 1QVGA 5DDMA 4DV3Q 1D7QA 1S5ED 2JH1A 1S72A 8ICIA 2DPIA 1HR0Q 4YR3A 3FDSA 1PZID 3AMZA 3LK9A 1DXMA 2F1IA 2PO4A 3PO4A 4EQPA 1PFSA 3GTGH 3LGJA 1XNQL 4JI1L 4RUCA 2EKKA 2IWHA 3SQIA 2F3IA 3PNYA 4KLEA 4KODA 2D6FC 3HG9A 4MNOA 5J0UA 5IIFA 5ITTA 1NAPA 5EP2A 5EP1A 1FJGQ 3D6WA 2ISOA 1DZ1A 3KFUF 3F5AA 3Q23A 1T6OA 1ZQTA 1WFQA 1QAMA 4QZ9A 2XGQA 2UUBQ 3JAME 3F53A 2EDUA 3PMNA 1O7ZA 1X3EA 5IP7G 5COYA 1FNNA 2ES6A 3DDHA 1RYSA 4DV7L 2MRLA 4BA1I 2Y21A 4LUZA 1P7DA 3S1RB 1LM0A 3P1HA 4IBFA 1CFMA 2KZUA 2EAOA 4P0PB 3KFUA 1TS4A 3HOYB 1SXJB 1MHWC 2HOIA 3TI0A 2RDFA 1Q86C 3K0YA 3AOEA 3TZDA 2JA7H 4FBTA 2EPBA 1A77A 2VB3X 1XXHB 3B7QA 4R63A 4G3OA 5J2EA 3F2DA 5DM73 1VQIA 1NNJA 4MHEA 4ECVA 1TR8A 4ABNA 5GKNA 1H9MA 4MIUA 2XSCA 1FYCA 1TWCH 3L28A 2UXBL 3TADC 3SYZA 1TFRA 3QU2A 1Q90A 4HJAA 3VDPA 4L5QA 1NHWC 1Q3VA 2IX3A 4NWIA 4OO1G 5ALEA 3FRIA 3IECA 3J7AS 7ICLA 4XGIA 4V0BA 2JEGA 3T4AC 2W82A 2HBKA 4EBCA 3JR5A 1K8OA 3G6VA 3C1FA 1AZPA 4RMFA 3I73A 3KS8A 2RHQB 2O6KA 3J81S 2YMPA 1UM8A 2HQLA 5C4ZA 1LTBD 1AE2A 2H3IA 1EU4A 4I65A 3OHBA 5J0WA 3TP7A 4K4HA 5DYIA 2KCMA 3A98B 2I5MX 1FIQA 1QDRA 5L9XA 4A3GB 2AXTU 4EX5A 1S97A 2SDFA 4ECWA 4DS5A 1ONLA 1BBWA 4ACOA 2LVPC 5K36G 4B3RQ 3PW7A 3AQEA 2KHIA 1B44D 1N32L 5B5EU 1SRUA 2OXPA 5EE3A 2I0QA 2H4OA 3KOYE 1FNWA 5ALUA 5FTMA 3W2DA 4P72A 4LGMA 4REZA 3M6AA 4JI8L 1X66A 5HMLA 1PH6A 8ICPA 2B2VA 1UE7A 2I1QA 5ITXE 1AZQA 1QUQB 3PZPA 4X62M 1X9SA 2VL6A 1NY5A 2ASLA 2BDOA 4NXNQ 1CSQA 1GUGA 4P17A 4AYBF 1EE8A 4JV5L 5DB7A 1FNUA 1QQ5A 3RF9A 2Y0QA 1YSYA 3QWNA 4FO6A 1JROA 3GTQH 1XXGA 1SXDA 4TURA 1E9RA 1DOQA 3C1YA 3AOEC 4NOOB 4D82A 4P75A 5EQ0A 3SHGB 1WCNA 4CDFC 2BCRA 5J22A 1PJSA 4RQ0A 3J81E 2EQYA 4PZ8A 1L7MA 1VJ5A 2PNHA 1ZQVA 3ISDA 1MKHA 1MN3A 1DGHB 1G71A 1PZNA 2G07A 3HOZB 5BOMA 5IGFA 2CWBA 2IHEA 2KKVA 5CR0A 1L3TA 2ATLA 4HSVA 5DBCA 2KFZA 1R4QB 2ZIXA 1HFGA 2YTVA 3W0LB 4C3JB 4LJAA 5ALXA 3MK6A 4P73A 4B3SM 1A0PA 4PL2A 1BPDA 4J03A 2GWSA 4L15A 2ISPA 4IJHA 1SMXA 2M00A 2DZLA 2UXDM 5KGUA 4BY1H 1BVSA 2B2YA 9ICBA 4IZ8A 3HHWA 3NBHA 2D7GA 5HP4A 2R92G 1NZBA 4I2IA 3NWSA 4AG6A 4A3BG 4LJ9A 4EBEA 4I2HA 7ICVA 3JAML 4IBIA 5J2IA 4LF4M 3D0FA 1PK1B 5IP9G 1PVOA 1A63A 3KOZE 2MO0A 4O5CA 1L1OA 3BS5B 4KN7C 3H4JA 1W6JA 4R8UA 3FYDA 5B66U 2DVWB 3R93A 3A45A 5KFBA 4UB1A 3L2PA 1V97A 2E5LM 5FLXc 5AKGA 3ZQJA 3QE9Y 3GPXA 1SYBA 1K83B 2W9MA 5NUCA 4JI0L 4L5SA 3HOXG 4EBDA 2N8NA 2EYHA 1H38A 4DLEA 4CJ2C 1NK0A 2NRZA 2WAQB 3M9BA 3TREA 9ICEA 4KLIA 2YTXA 2E8MA 7ICIA 4KHPQ 4LUVA 3GV3A 2XGTA 3HKSA 4APVA 4O3RA 1SXJE 3FUTA 1TF0B 3M9MB 5KT6A 5KG5A 4ZKBB 2VJ4A 1RODA 4G7HC 3I55A 3FKIB 1Q39A 1VQAA 2KHVA 3EW9A 4I2JA 2BPGA 2QZ4A 1KTKA 2LBOA 3RRHA 3K57A 1QQWA 5IY0A 4O3SA 2JEFA 3H15A 4A3DH 2B3TA 3QOJA 4AYBC 1FGUA 1DV0A 1W5TA 1I94Q 1FGBD 4DV4M 4KLQA 4DF4A 2RSNA 1KLUD 4AZFA 1WHCA 5T1GA 3TRZA 3S1QH 1BUVT 3GLHB 1Z9FA 3KHRA 4DFKA 3M7GA 2KZSA 2XGNA 2XIDA 4PZOA 1BNZA 3T53B 1LTMA 5G3LD 1NBWA 4LNQA 4QWDA 2PFNA 2BCOA 1WTHA 3I72A 3WK8A 3GTJH 3PF5A 2I07B 2B2YC 1KBUA 4FW9A 4DV3L 1VQ9A 1I6HB 4ZAIA 3IP4B 2NVTB 2WB1F 1QUSA 2CQOA 1H95A 4DK3C 4R4IA 1HR0L 3RH6A 4DR7Q 4D80A 4LF9M 3K2LA 2VKQA 2F0UA 1M90C 5C4JH 2KOLA 2A6HD 3HOVG 2W9BA 3O0FA 1SMYC 3C2PA 4P71A 8ICVA 5DG9A 3L5KA 3GTPB 4BY7G 2NYVA 1JC7A 2NVYH 1L1OC 1SWVA 3T38A 2LM4A 4A3KH 2XFTA 2F0KA 4HIMA 2ZIVA 4B9UA 4B9SA 2QF7A 2K03A 3KBXA 3AL0C 3RR7A 1FJGL 1TWGH 3HOWH 1GABA 3OPOA 5C44H 3J81L 1XMOM 4DXGA 2UUBL 3PSTA 3MDCA 3AV0A 5AKJA 3NGDA 2C22A 1HHVA 2WV6D 1QZHA 1C9OA 3NHHA 1T7PA 1VQNA 3UDFA 1RYUA 3G71A 4ANRA 4GN4B 3D8LA 4A3IB 4QNRA 4OX9L 1EY7A 4IBJA 1AN8A 2QCUA 2G9DA 1UE6A 2F0OA 1L8QA 1KRTA 4P0QA 3URYA 1ZXIA 2UUCQ 3NENA 2WF6A 1Q81C 2X49A 2GO7A 4YP3A 4PGYA 3P20A 1ZQ9A 1E7ZA 3T56B 4N9TA 1OXJA 2R6FA 1JWMD 4Q45A 3GLGB 1QOHA 4JK1A 1X56A 1BPYA 1J6QA 2R4JA 4HIDA 3SENA 4RKUF 3MAQA 3PMLA 5AI0A 3PX6A 3NPPA 2AHOB 5F2DA 4LAAA 5GROA 1G8ZD 1T43A 1G2TA 1WWVA 3NVYA 1BOSA 3FE3A 1XC8A 3ZYYX 3T16A 5J8YA 4EVOA 3SC3A 3SV3A 4F4KA 4FDBA 1KNEA 1XNRM 4DV5M 1STNA 2QQ8A 2QDLA 4IR1A 1I3QB 4LF8Q 1LYLA 4IBGA 5D65A 4DLGA 1U9LA 5JI3E 4QZFA 4M1UB 2EYFA 5FLXE 1RIPA 1JI7A 3N28A 5AIAA 4IC9A 3R9KA 2HBMA 3RTVA 1A6XA 1GHJA 2JA9A 3KKAA 4GITA 3PW4A 1KD1C 4WJ4A 3GTMH 2WF5A 2KIWA 4B3RL 3OWEB 1WCMB 2LI6A 1PRTF 1GO3F 2K5VA 2M9VA 2W9AA 5J2KA 5E3FA 1ET6A 4JG2A 4GOPA 5DG8A 1N33Q 4HL4A 1Q8IA 3FUVA 2WB1C 4KLDA 3HOYG 1Z00A 1MSWD 1SEBD 1NE3A 2K7VA 3SAFA 4WRDA 3KF6A 4IFDI 1E2VA 2KZZA 5KFKA 1B9MA 4NXNL 2EYJA 4O0IA 1DK3A 5C0YA 3CPWA 5KPRA 4KI0A 2WAQE 2CHGA 1VQ5A 1CKNA 5I6WA 5M5YB 4DN4M 3H4BA 3RB6A 4C1NK 4O3NA 2F0HA 4J6HA 4ODGA 4KLHA 1HQYE 5DYGA 1V38A 4L63B 1NKBA 3NK9A 1EYAA 4RCNA 1MD2D 1IZ6A 2JK8A 1YVCA 4YN4A 1SYFA 2IA6A 3HU2A 4POGA 3Q8SB 4KMUA 5KFHA 2QKQA 4K14A 4PGXA 3B0YA 4PCZA 2DAIA 2HW3A 2R7DA 4A3GG 5E6JA 4DSJA 4KO8A 5ALNA 1SZPA 5C0XG 4KN4A 5TZVA 4JI3M 3GLHE 1GM5A 2G5DA 2EYMA 5DQIA 5J8YC 1LKYA 4I8OA 1HZBA 2XC9A 4IR9A 5KNDA 2JA6H 4ME5A 5J0PA 2AHMA 1RTNA 4HR7B 2HHSA 1RU3A 1MBYA 3B89A 5M5XB 3I4OA 3AOGA 4KKTA 8ICFA 4AKHA 4EEYA 2KNJA 4YCWA 1V8QA 2XZFA 3K5NA 1IBKM 2ZM6Q 4K4GA 4DNTB 2BPFA 3KKAC 1Y1WB 3S2HB 5ALRA 5FTNA 2HHVA 4UAWA 1EIYB 4B9LA 3KJPA 1KC8C 5KG2A 1WTOA 3ETRA 2WFWA 4O2DA 4GOPC 2EAPA 1LABA 3FYCA 4F3OA 2Z3XA 5KFEA 4KHZA 2RP5A