1G3IA

Crystal structure of the hsluv protease-chaperone complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
443
structure length
326
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVDSIIRDLTDSAMKLVRQQEIAKNRIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Crystal and solution structures of an HslUV protease-chaperone complex.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone/hydrolase
total genus 103
structure length 326
sequence length 443
chains with identical sequence B, C, D, E, F, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g3iA02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g3iA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3iA01
4MKGA 1G6HA 2FU5C 4A92A 2MGWA 3MLEA 3BC1A 1CTQA 2XEXA 3AJIB 2P6RA 2O8DA 2FGKA 4CEIB 4KFSA 4G3OA 1T8TA 3RANA 2HYIC 2PH1A 4NH0A 3UATA 4IJMA 3FHCB 4Q00A 5KSOA 2RGBA 4GOXA 4HLUC 1BMFD 5GJVC 1R4GA 3AKCA 1RC8A 2A5JA 3AF0A 1UKYA 1YZUA 4JMPA 1OXUA 3NBFA 1WB9A 1U90A 3RS7A 1VG8A 3GP8A 4F92B 4PX9A 3RWMB 3AGPA 2GETA 1FNNA 1BOFA 4YDHB 2QA5A 1LF0A 2GCNA 2VH5R 1S1CA 2VHQA 4L4UA 1JPJA 1W47A 2BCJQ 3T5DA 3TE6A 1G64A 3KQUA 3SJAA 2B8WA 2O52A 1XD2A 1OXXK 1KI6A 1SVOA 2PZGA 5KU1A 2PT5A 2ZS7A 3QVUA 3I4LA 2ZJ8A 3OF5A 4PO1A 4B44A 2CMKA 5BXQC 5JBQA 4B3CA 2WHXA 4BFTA 4KJZA 1ELOA 3K53A 4XH9B 3ADBA 1R8QA 2XZOA 4ILEA 1AKYA 2VSXA 2LTUA 3DMNA 4II7A 1N5JA 5CK4A 3CO5A 2WMNB 1SXJB 5AUQA 2QUZA 1GRRA 2XOKD 3EWSA 1CRPA 2DWPA 4DXAA 4JLMA 3BXZA 1YZGA 4UJ5A 4E5UA 2WWIA 2WWWA 3T5GA 4R2HA 2GTPA 3WP0A 2D74A 1I4TD 3EXAA 4B35A 3LXXA 1N6PA 3CR7A 2WV9A 1NI3A 3QF4B 2X2FA 4OHYA 4OHVA 3NC0C 2A30A 2O0KA 3X1DA 3KJIA 5C18A 2WOOA 4M1WA 3ZVLA 2LVNC 1D2MA 4A82A 5TARA 1OYWA 1U81A 5GJWC 2QY9A 1JBKA 1DELA 2QHOB 5HKKA 2GJKA 4URVR 1E3MA 3THXA 4A8JA 4ZCIA 5HR5A 1DG1G 1NIJA 2WVJA 3FWYA 4KV9A 4C0SA 3ZDQA 4RJLA 4KBGA 2GXAA 2KHHA 2V8OA 1GP2A 2YINC 3FMIA 4OKSA 4ZKDA 5CB8A 3AVXA 4HSEA 1GZSA 4GSYA 2BC9A 5AJWA 5H68A 2BEKA 4KLZA 5E4FA 1TF5A 1A2BA 1FX0A 3EASA 3L82B 4PO8A 5LBIA 3FVQA 3WY9A 4IOJA 1DAIA 4TTQA 4WW0A 5FUXA 2QPTA 2FFAA 1P2TA 5P21A 2OT3B 3QIAA 2MR9A 1N25A 3IGFA 3GLGE 4FWGA 821PA 3O8RA 4IDQA 1A82A 4BZQA 1UAAA 3LXRA 3F5FA 4RFSB 4RY2A 1SKYE 1K6MA 4D6PA 1IQPA 1G5PA 1E9EA 2GEUA 2VYFA 4MKFA 4RVCA 2IA5A 2H8KA 1L2TA 2B21A 4BFWA 2FWRA 4LI0A 721PA 4LHXA 1QBKC 1Z0DA 4TL8A 2VP2A 1KK1A 5JHHB 4PC1A 3SNHA 2XZPA 1IXSB 2VEDA 2ZJYA 2OFXA 3W5IA 1ZAKA 4HLDA 4HAZA 5TMPA 1T91A 2ZR7A 2ZU6A 5SZIA 1FOEB 3GFPA 4XWAA 3K8YA 3VMFA 1FUUA 4EJSB 2W0SA 3QEOA 2XNDA 5LD2B 4HLQB 2VL7A 3QKSA 4J0QA 5FOXA 2OOBA 4CEJB 4NYIR 4JLPA 4US0R 4B43A 3KB1A 2OXRA 3MSXA 5JZVA 1LV7A 4LPKA 1K5GA 2YJTD 1XTJA 5FPTA 1ZM2A 3JVUA 1ZD9A 5TVKA 2J45A 3HU1A 2ONKA 3U7GA 1XNJA 2RH5A 3BBPA 4QKQA 5CIQA 4Z8XA 4FCTA 2Z43A 2IXEA 5CJPA 1Q57A 2RB4A 3P4XA 1DAFA 3IEUA 5FBWB 2W2VA 3QY0A 4ESVA 3IPYA 3ZS8A 1DAHA 1VTKA 5J4HA 1JB1A 2O8EB 4LJ5A 5IK2A 2L4FA 3K0AA 4Q7LA 2YNMA 2ZRHA 4URUR 1SHKA 4XTRA 2OCPA 2ZUDA 4EPTA 4RD3A 5FBRB 2CCJA 1OHHA 1CS4C 2QU8A 5CYOA 1T3SA 3EW9A 1LVGA 3Q7PA 3QVVA 2C96A 4LV6A 4LV5B 1MO3A 1IY2A 1KAOA 3KZ1E 1AGPA 2QG6A 2P2LA 3I3SR 4TQUS 1FNMA 1OFHA 1T6OA 5B64A 2WWYA 3SS8A 4Q4AB 1U8YA 1T0JB 5HCNA 5FPHA 1G8HA 5CITA 2VHTA 3PQCA 1R6BX 4XOIA 1YZNA 1GRNA 1CJUC 4H9GA 2HAKA 1CR0A 3KKQA 1SVIA 2VP9A 3SE0A 4LSGA 3H4MA 2XTZA 4E07A 4D4JA 2GJ9A 1Y3AA 1NNEA 1XX6A 1G7RA 2RAPA 1P73A 2K0BX 3OE7D 1QZEA 1KSHA 4DEXA 3RNLA 4CIDA 2LKDA 5JWOA 3E46A 2QROA 4IDPA 3VU9B 4R71A 5G41A 2YOHA 4LJ8A 5AJYA 2IWHA 1KI1A 1S9HA 2WJJA 1KI3A 1OLOA 4RD1A 3RSLA 2C98A 2QQ0A 5ANRB 1GAJA 5L8VA 1AS3A 2G6BA 1KSGA 4M4SA 1JR3D 3OFNA 3C41J 2GNOA 4FMDF 2O8BA 4BE7B 2QSZA 2CXXA 5L3QA 3K70C 1Z6XA 4NCIA 4DDTA 2ZRJA 1NL3A 5FUVA 1G41A 3AF2A 5E95A 3C4JA 4TYWA 1M8PA 4MRNA 1EWQA 2FEOA 3TKLA 3FFBA 4PC6A 3AKYA 5FUWA 3ADKA 3CUEF 1E2PA 2DHRA 4L16A 1TU3A 2C77A 4Q7JA 1Q20A 2V7QA 3HJNA 4LX0A 1E2MA 3QG1A 1SULA 4O2RA 2IYUA 1XEXA 2ZTDA 1N0VC 4GZLA 1JXOA 3BFXA 3EC1A 4ZCLA 1A7JA 4LPSA 4OHZA 4PQRA 2AD1A 3VAAA 1JALA 4IVPA 5DH9A 4QJ3A 1XMVA 1TUEA 2ZI9A 1M7GA 5HE9A 4LJ4A 2FH5B 1GKIA 4ZKEA 4FXPA 2AK2A 5EQTA 1T9HA 2ZRKA 4DCSA 4WBSA 1FW6A 2EYQA 2XAUA 3LO5A 2P67A 3QXXA 4LYFA 4R7ZA 2JCSA 2O8DB 1Z6YA 3EA5A 3KW6A 2H5EA 1N5KA 1XD8A 4LWZA 1D9XA 1NN0A 2CLSA 1U9IA 1VHLA 3DM5A 4MRPA 3GLFE 2IYQA 1FP7A 2ZRDA 4LV8B 4DLYA 4AD8A 1NRJB 3RS4A 3OESA 4HAXA 1W46A 2J7PD 1EFRA 2LBCA 2IYSA 2LVPC 1KJYA 3ICEA 5ELXA 3I92A 5FOTA 3GEEA 2ZYUX 4IDOA 3L0OA 4B3XA 1IN5A 2JY8A 2W00A 2DAEA 2ZSDA 1WHCA 2RGXA 1A5TA 1I4LD 1EFUA 2QMEA 3LVQE 4V0NA 1TF2A 2AWOA 4BLTA 2HJVA 3QPUA 3PEWA 2LCFA 3JZAA 3U6BA 4JBXA 2W2XA 3TAHA 2BM0A 4IXNA 2V3CC 5C1BA 3MUFA 1U9IC 4NMMA 3AVWA 3E70C 1A2KC 1W0JD 2JJ2D 2OBLA 1SZPA 4LYAA 3QNUA 5DIFA 2WSSD 4BZPA 1IFYA 1JNYA 2ZUCA 1Z3IX 4G3XA 3SR0A 2ZRPA 5TY0A 1RVDA 1XJ0A 2W2TA 3B1XA 1KI8A 3MHVC 3OIUA 1FMJA 4XJXA 3VR2A 4H1VA 2IS4A 3TBKA 3HU2A 1G3QA 2OO7A 1G1MA 4MITA 2G83A 4KFUA 4GI7A 1WA5A 1ZM9A 1UBCA 4M21A 3IECA 1NLYA 4HUQB 3VLFB 1OIVA 2BBTA 3GEIA 2QT0A 2JLVA 3KB2A 5JI2E 1GM5A 4ACAA 2C5LA 4UNQA 2NIPA 3DL0A 4LBVA 1SVSA 3THXB 3P32A 1G3MA 1W4CA 1VCOA 2OILA 1QZMA 3LNCA 5HTKA 1G5TA 5G53C 4ZDIA 1WBBA 3KDSE 4DLWA 1AS2A 1II8A 3VHLB 4D0GA 1OJLA 3IIKA 1NBME 1PGYA 2VIIA 1R8SA 3CM0A 3F8TA 5JHGB 4ASUA 1AGRA 4I4LA 4LZZA 2EKFA 1K5DA 4LUCA 1FX0B 4QG7A 3ZIAD 3QSYA 3AUYA 2ORWA 2Q9AA 3OIVA 2V1XA 1XMIA 3GJ3A 3SJCA 4C0BA 4G5GA 1ZM4A 2ZJ2A 5GJCA 1YJ5A 2VBCA 3LY5A 2Z4SA 3QEJA 2O5VA 2X8AA 1AZSC 4LHYA 4RZ2A 1Z0FA 4DT1A 3QXSA 5B57C 4DIDA 2GZHA 5SZKB 1ZMWA 3FHOA 3B9PA 4MDEA 2QMUA 2VP6A 2WWGA 1CR1A 1Z0AA 4G1UC 5DFLA 4M9ZA 5FOWA 3QXHA 5G3ZA 3R8FA 1YR9A 4HI0E 2NOAA 4UKDA 1Q21A 2D4HA 2LVAA 3QI2A 3T15A 1IN7A 3A1VA 3LX8A 2PBRA 3WRYC 2WIAA 1US8A 2GCOA 2DAGA 4X8HA 4FI3C 4GRAA 2REBA 3KKNA 1KI9A 3QKSB 3OEED 1RFLA 3LVRE 4WA7A 3AP3A 2Q0HA 3T1QA 2F55A 1YR6A 1EXMA 1ZC4A 2QMHA 4ZIRA 2KBFA 4Z1MD 2WPDA 1YZTA 1W36C 4NL4H 1OYYA 5KSPA 3EPKA 4TL6A 1MH1A 3Q5EA 5A5GA 1MV5A 1TL7C 2RRUA 1EX7A 3R8CA 1P75A 3CPJB 5DN6A 2GAAA 3M1IA 4JL8A 4IDHA 4EFLA 5JMTA 3BJIC 1X1SA 4QOSA 1JR3E 1J99A 1YRAA 4TTRA 2FOLA 5CJ2A 1XTKA 4MDFA 2IS1A 4EUNA 2A2ZA 2J0VA 5F9FA 2P6NA 1DAGA 4H1UA 5F3WB 4G01B 1D9ZA 2LWIA 2WWFA 4JJKA 2GJAA 2ZI7A 1SXJC 5KYKA 3K0AB 3K0SA 1G18A 1HEIA 4K46A 2K9DA 4OHXA 1GWNA 3AH8A 2IYZA 2P5SA 1XWIA 2VQSA 2BMDA 2JUJA 4M9XA 3BB1A 2R8RA 2QPAA 1WP9A 4GOKA 1KO7A 5FH9A 2IC5A 1PUIA 3CBQA 4MUAA 4PFSA 2QRNA 4R98A 3SU8A 2AN9A 2VTKA 3U7EB 2FN4A 2I1VB 2XB4A 4FMDB 3CKLA 4Z8YA 3SHFA 4A6XA 2ZQ5A 1NLZA 2FV8A 2JY7A 3K70B 4DCUA 4YONB 3AEZA 4B6FA 1TX4B 1CP2A 3LH5A 2H18A 2PMDA 4RD0A 4ZDWA 1DPFA 3RVBA 4D4KA 3SYLA 1VDLA 4LRSA 2CJWA 1YRBA 4AIIA 3R9XA 2HJGA 2UVQA 2R0IA 2RGNC 2W58A 3A1SA 4C0QC 4B3BA 5DYIA 1Z06A 2YVUA 3UG7A 4HZUA 2OBMA 3AVPA 3ADCA 3M0EA 1UJ2A 1W5SA 4YMUA 2FX3A 3I5XA 1MO6A 5L3SA 1L4YA 3L8ZA 3U5ZB 4Q02A 2R65A 1SHZA 4L15A 2FZLA 3G5UA 2OG2A 1ZNWA 2OFWA 4YC7A 4MGYR 2J1LA 4NCJA 2O8BB 5FBLB 5KNBA 1XXHE 1XBTA 1VHTA 3C5CA 2CNWD 2IXGA 3VR1A 3TGPA 3B8HA 2ZPTX 1E9FA 3UXMA 3GFOA 4M1KA 1BMFA 2G1JA 4XWKA 4EPVA 5KHOC 3MMPA 4PHGA 1BIFA 1Y8GA 4Q7JB 5FBVB 2ORIA 2QN6A 1FPMA 4LJ6A 2C95A 4ZCMA 2GK7A 3RDPA 1XEXB 2ODNA 1G20E 1GILA 1OF1A 4A0RA 3MFYA 3I61A 5K8LA 4BFVA 3EZ2A 1OKSA 4CW7A 4Q1CA 4TQAA 2IYYA 2ZUBA 1E94E 3EPLA 3ZZUA 4U5XA 1M74A 3J81k 1NSTA 4KLNA 2OFOA 3VKWA 1M7HA 2OLJA 4D2IA 4LC0A 2XZLA 2OCAA 3C14C 1OE0A 4XVQA 2FE4A 3K0CC 4UNPA 3ND9A 2LVOC 1ZUNB 2XOKA 1JEEA 3TAUA 4V03A 3SJZA 2XNSA 5J5CA 4A2WA 4GZMA 2DNAA 4O25A 2FSFA 1A1VA 4MYTA 4NZYA 1AK2A 3A58B 4HYYA 4M0LA 3BGWA 3IKJA 4C0KA 3HP1A 4FWIB 5H1YA 1HTWA 3CRQA 2Q3MA 2CE7A 2NMVA 1T0HB 2BV3A 2DENA 4HDCA 4DLTA 4RZXA 3GLFA 2ZS9A 4C9BA 3KQKA 2ZAOA 1ZNXA 4M22A 1TTEA 3A1TA 2G1KA 1IJFA 2V1UA 4AWXA 2YC4C 3KFXA 4O3MA 2MMGA 3NXSA 2ZE8A 1LTQA 3VR3A 4OI2A 2J46A 3ONWA 4EPWA 3C7KA 2OBNA 4YMVA 2Z6VA 1G8YA 5C46F 4JKYA 1XCMA 4BGDA 4FCVA 1Z0JA 3P26A 2DFTA 2I3BA 3HYTA 5EE0A 4PTLA 1TPZA 4Y0VA 3GLHE 5B58C 2N42A 4L9WA 2C9CA 1LW7A 2CVFA 2PZFA 3KXLA 1LNZA 2ZJAA 1SVWA 3CNNA 1CU1A 1P6XA 2IF2A 2ZREA 4B76A 5EUQB 4F1IA 1XEFA 5HZHA 2BM1A 2L0XA 4B3GA 3ASYA 1OW3B 2FFBA 1OKKD 1PLLA 1F2TA 5DYGA 4TT3A 3THWA 2GK6A 4BLPA 2QE7D 1DARA 1KY3A 2ATVA 4KO8A 2YC2C 1XRJA 3PCRB 4Q03A 2FNAA 2YOFA 4XD7D 1Z0IA 4TZ0A 3THYB 4DB2A 4KSBA 4PHHA 4JS0A 2ZJ5A 2JASA 2HF9A 5FUYA 4TYYA 1T3HA 2PMKA 2CBZA 1HT2E 2OCYC 2QT1A 3T34A 2C8VA 4X8MA 1AQYA 4M8NE 4NYIQ 4OK6A 3QBVA 1II8B 5FI0B 4AURA 1ZRHA 5B30A 4M1MA 3MWYW 1YLAA 3T06B 3AF3A 4CRWB 3QG5A 4KFTA 1TNDA 4LOAA 2BKUA 1H8EA 2RHDA 1NVVR 1D6JA 3QKTA 3BH0A 3NG1A 3LCUA 4N0EA 1HY3A 1JQJC 3UWOA 4IRUB 3A6PC 2BJWA 3EX7C 5DISB 4LBZA 1GL6A 3LAWA 4NCKA 3WBJA 4B2PA 3GPLA 1VCIA 4HEOA 3WHLA 1NBMA 1W36B 4DT1B 2AL7A 5BQ5A 2XJ4A 3ZGXA 4NP6A 1W1WA 2J3EA 4OI0A 4WAUA 1G4UR 1ZNZA 2CLDX 5FR2A 2ERXA 3KKOA 1Z2CA 4LDJA 1XCGB 1F3OA 2OSBA 4QGHA 1W0KD 3GJ4A 4LYHA 1CEEA 1P7CA 4Q1FA 1P3QQ 4KODA 3PEYA 3LRPA 2ZSFA 2QENA 3IBGA 4C7OB 1FTSA 4A0GA 1DOAA 4P31A 1DVRA 3QF7A 1K8RA 2DAMA 1US8B 1KO5A 4GEWA 3C5HA 5DI9A 5SZHB 3S1AA 4DLZA 2CE2X 3CF6R 1I2DA 3NH9A 1MT0A 3VTKA 1GOTA 4HDOB 3QXCA 2QP9X 4UJ3A 4ZIRB 5AK0A 2JLXA 1G8GA 1KAGA 1E2HA 4DUGD 1MO4A 3PVSA 4TLEA 2DBYA 5JWHA 1SKQA 3LCVB 4FN5A 2DI0A 4DIEA 2ZROA 1Z2AA 2A5GA 3HYRA 1YR8A 1E2NA 4W5JA 5TV2A 4TMKA 2Y8EA 1U94A 3FRHA 1G7TA 2DCUA 4MQBA 3UK6A 2PEZA 5JECA 3OE7A 2X2EA 2O0JA 5KPJA 1RPZA 1RE0A 5FFMA 5AUOB 3AP2A 3ZLJA 3K9NA 4S35A 1CULC 5JS8A 5J4LA 2QGNA 1SQ5A 3U2QA 2IK8A 2WICA 1JR3A 2AD5A 4YMWA 1F4IA 1XTRA 4KI0A 4TWZA 1G8PA 3CR8A 4OI1A 3RWOA 2RGDA 2HWJA 1G7CA 2F1JA 2J0QA 1Z29A 3K9HA 3WYFA 1Z6GA 2FA9A 4Q19A 3PV0A 5KNDA 3UG6A 3PG5A 4LHWA 1KIMA 1IN4A 4WOPA 2YWEA 3WBKA 4TMXA 4A8JC 1XTIA 1UBFA 5IT5A 3U44B 4QGFA 4US1R 4C0LA 1KK2A 2MSCB 2QL6A 1CUKA 1I4DD 1E9BA 3GCGA 3M4YA 1P62B 4I81A 1RRFA 3FTQA 4HZUB 4KBFA 1RW4A 1NF3A 4QJ4A 2ZANA 2J0UB 2EKKA 4WP2A 4L5BA 1OPXA 2OESA 1EFCA 4PC3A 1J70A 1XJQA 2KBEA 1ZYUA 4YMTA 4JN6A 1ODFA 2EWVA 3C8UA 3T1OA 4FW9A 3Q7QA 1G21E 3UMRA 3P27A 5FL7D 1N2CE 2GXUA 4C3ZA 1H65A 1CKEA 1L4UA 1E2JA 5FL3A 1S1MA 4WIAA 2V6IA 3ZZ0A 1GTVA 1XPUA 2PT7A 4JLVA 4ERNA 1J8YF 1U0HC 3ZD6A 5AUPB 2HXSA 1COWD 1KKMA 1WQ1R 1TQDA 4Q4HA 2J7PA 1N6RA 5CIWA 1T6NA 4TZ6A 3TW4A 2V6ZM 1XXHA 1WIVA 1WDTA 1RZ3A 3GJ0A 3BOSA 1IY0A 3LBIA 3IILA 4BFZA 1YVDA 1XB2A 1SGWA 4AG5A 1BYUA 2ZU0C 2FFQA 4Q1AA 3AVTA 2OHFA 3QUSA 2JDIA 3I8XA 1G19A 5JRZA 1N6OA 3KX2A 4MRRA 4GNKA 1XPRA 3WMEA 1Q3HA 3N70A 2KNZA 5F2EA 1S4QA 4QHYA 3VNVA 5DI3B 2HT6A 2EFDB 3H1TA 4JYCA 4A2QA 2JJ2A 2WSSA 2QSYA 3W6NA 2NO0A 4AYWA 5KTYA 5E7JA 1KK3A 1MO5A 1ZIOA 4OI4A 2O8FB 1OXVA 3I62A 3ICQB 1BKDR 2EFHB 1EWRA 1DADA 1WJ7A 4MGIR 4QBHA 4HB4A 3MRSA 4QNMA 1E4VA 2I1QA 4DCNA 4LC1A 1L7VC 2WJIA 4I1SA 2IUUA 4YMSA 2EVWX 2MJ5B 1S3GA 4JT4A 4ZI2A 1R0XA 2Z83A 2R2AA 3REGA 2Q9CA 1E79D 3K9LA 5L3RA 2QGZA 1OH6A 4LRTA 1R2QA 4BFYA 2QZ4A 1FQJA 4I1UA 4JVMA 2F3RA 2CHVA 1QHXA 2H1LA 2Q9BA 1ZD1A 3GJ6A 3RLFA 1KO8A 1ZIPA 1FZQA 2R6AA 3P1JA 1VEKA 4UNRA 3B85A 4QXAA 5HKKD 2F1RA 1F6BA 2JLWA 1QF9A 1UM8A 1Z47A 4MKIA 2B8TA 3FFAA 3GMTA 4DBLC 4A9AA 3H84A 2IF0A 3ZIAA 2EJSA 1KK0A 1LS1A 2C2HA 3IEVA 4B73A 3T1TA 3AM1A 1YR7A 2ZI4A 2IWRA 1P3JA 1XZPA 4U7DA 1YZQA 4BLRA 3HPQA 1R7RA 3EZFA 4RD4A 1P2SA 2J7KA 3KXKA 2OM2A 1GITA 2QNRA 4LYJA 3GLHA 1I2MA 2VP0A 4JBYA 4EAQA 1OB2A 5FR1A 1F2TB 3FMPB 3EZ7A 2ZI6A 3THWB 1Z6TA 2H7VA 3KJHA 1M2OB 3NVAA 2QMOA 2VLIA 1N0UA 1D5CA 3WNDA 4B34A 1JXMA 2GHIA 3QXJA 1ZU4A 1P9RA 4UNSA 3UIEA 5KSYA 3CZQA 2EFCB 2A78A 3PJRA 2RGAA 3MD0A 2VSFA 2H57A 1PLJA 1OB5A 3CB4A 4YXWD 1P4SA 4DB4A 4OK5A 4PPQA 3FE3A 2WKRA 3GJXC 4PPFA 1F48A 3IBYA 5JS7A 2XB2A 2AX4A 3OEEA 2EFEB 1UEJA 4I1VA 4TYQA 4Q21A 2ZJZA 4RD2A 3MCAA 4MYUA 4Z1MA 4GPTA 4EPYA 2EU8A 4B3DA 2NGRA 3SYKA 2ZRMA 1GKUB 1GO5A 3FMOB 3BAFA 3SFZA 5F9HA 2F9MA 1ZMXA 4WXRA 4PC2A 4KITB 1XMJA 1G9XA 2N1BA 1E6CA 4WXPA 1KKLA 3KUDA 2PCJA 3TK1A 4FINA 1CRQA 4BWYA 3NKVA 1RYFA 2HXYA 1CJMA 1HE1C 4Q4LA 1WMSA 2B6HA 1XD2B 4D80A 1KI6B 2EQBA 4IHQA 4TSFD 4U02A 2HT1A 5KNCA 3WP1B 3MJRA 4OQLA 4RFVA 1JEDA 3H86A 4TN1A 4DBGB 4JT2A 1Q0UA 1DEKA 2DPXA 1XTSA 3L0SA 4DRZA 1NN3A 2ZM5A 3U3OA 1ZMVA 2A5FA 2YOGA 1P60A 2IBMA 3U4QA 2O8CA 4N1AA 3Q85A 4PXAA 3S1AB 1KI7A 2QQEA 5EXPA 5EZ6B 4C2TA 1KY2A 2ORVA 5EZ5A 1UBEA 1P61B 1E9AA 4IOLA 2OAQ1 3U7FB 3CLVA 1X3SA 1OHHD 5JCPA 1QHGA 1SG9A 5G40A 2AKYA 3OIWA 4ESHA 2DWZB 2REXB 4PQFA 3NBZC 5CLLA 3FPAA 4NPHA 3OZXA 2JZ1A 2WJHA 3VX4A 2GEDA 1VG5A 1BYIA 4IEIA 2D2FA 3O47A 4AKEA 3RABA 2ZSEA 2IYWA 1NKSA 1IHUA 3O8DA 1D8TA 3X1XA 3PUXA 3HR7A 4MYHA 5DSZA 4A8JB 2ANBA 3TW8B 4DSTA 3DEFA 5HPYB 1AJEA 5EE9A 1T8UA 1J8MF 2BBSA 4X8OA 5JEEA 5EXXA 2BBWA 5JLJA 3U7HB 4A0HA 2XGJA 1NMZA 1KDRA 2MMCA 1Z83A 3HDTA 3CF0A 1RJ9A 3ZVRA 3SJBA 5FI1B 3U61B 1JPNA 5CB6A 2PZEA 4GL2A 2JLYA 1F5NA 1DS6A 3FOZA 4CEHA 1ZVQA 2CNWA 2QRZA 3GLIE 1ZM7A 2AFHE 4KVAA 5D3MA 3BFKA 4C0JA 2AKAB 4D0LB 4ZI3A 1A4RA 2ZRGA 3LLUA 3REFA 4JVNA 2ATXA 2ZJBA 4LK2A 3H4JA 2NPFA 4YQFA 1S0UA 2IS6A 3BH6A 3CX8A 3OIYA 2SHKA 4G5RA 4RCYA 1MRSA 2P65A 2FSGA 2F6RA 1YU9A 5HE8A 3GLGA 3OAAD 4BFUA 3W5JA 1DO2A 1Q12A 2K5UA 2WBLC 1FTNA 4JVLA 3PUWA 4Q9KA 2V55B 1PV4A 1TU4A 3KTAA 4DSOA 1M34E 3ZYCA 3UANA 2FPLA 2GBLA 1C9KA 1EFTA 3JZMA 2VO1A 2JZ0A 1MOZA 4TMTA 3Q72A 4CF7A 3VX3A 3A37A 4DVGA 1AS0A 5FTLA 5LB4A 1AKEA 2MSDB 4HLCA 1Q22A 4B48A 4TMVA 3CRRA 4LHZA 3LLMA 4K8OA 4AG6A 1KZ7B 5EUMA 4JVSB 4NDZA 1VPLA 5A4JA 3U60B 2W6JD 3TVDA 4KAXA 2NO9A 5GVRA 3X1YA 3PFIA 4ZPXA 4L8GA 4GITA 5AWFC 3RS0A 1VG0B 2ZE7A 3PITA 3DZDA 3VQTA 1S3SA 2ZETA 3AVOA 4B75A 2EYUA 1NVXQ 4A0FA 4PC7A 4ZV4A 4B47A 5DNYB 2ZE6A 2GESA 4Q4HB 2W6ID 4IOKA 2VHCA 4XWOA 4UXIA 1KSJA 2EWWA 1D2NA 1XXHB 2QP3A 1BVSA 1E2LA 5KDLA 2CEAA 4N0DA 3NC1C 2G0NA 2BEJA 1W4RA 1TQ2A 1XB2B 2ZYWX 1E0JA 2JJ1A 2L2DA 4BLOA 1E69A 1VKJA 3QF4A 2A3RA 4DC9A 2W83A 1KDTA 4BASA 4PSAA 1E32A 4E22A 1AA9A 4KYIB 4RCZA 2V6JA 3EIQA 4NYMR 4HUTA 4G0NA 1P5ZB 1HE8B 1TUIA 4ZO4A 1X37A 4DHEA 1ZCBA 2ODWA 4C0HA 2GRJA 2CHGA 3AVQA 1E2EA 2F1HA 4B32A 4MGZR 2WIBA 3DPUA 4Q1DA 4QBIA 2GF0A 5EJEA 3SBEA 5BWMA 3U6KA 1FUKA 2QSFX 4LY6A 2ZRFA 1WCV1 2F43A 1TQ4A 1KI4A 2JEOA 4C4PA 2YYZA 1JI0A 3T12A 5B2ZA 2B7BA 3EZ6A 3IHLA 4AK9A 3D6TB 4M1SA 4A15A 4Q1EA 1KSFX 4QJ5A 1DO0A 3CRW1 3TR0A 3EPJA 4K81B 2HLDD 1VEJA 2JY6B 2XSZA 4XSHA 1E2IA 1OIXA 1YZKA 3KJEA 2CCGA 2QE7A 5LDDC 3CNLA 3B6EA 2X77A 2OV2A 1VQ1A 2B3TA 3BORA 4YLGA 2Q6TA 5IDVA 4QM6A 4XD7A 4IOMA 2FZ4A 4BLSA 5BN3A 3CPEA 2IHBA 5AUNB 4MRVA 3W6PA 4Q1BA 4BRWA 4GP7A 1U99A 4ITRC 2DVWB 3W90A 4B6EA 1VG9B 1NVVQ 3BH7A 4LRWA 3AV0B 4DLVA 5L3QB 1E9RA 4DWJA 3G0HA 4AKIA 1GL7A 2VP5A 5AJXA 1OH8A 4KVGA 1P9WA 4AYTA 1TTTA 1DBSA 4OL0A 1KJZA 3RS2A 4EJSA 3VR6A 1ZV1A 1MABA 1AN0A 3U3KA 3L0IB 3MAAC 1CIPA 2RKOA 4CYMA 1XJCA 5FOSA 5FPYA 3WNBA 3VKHA 4IXMA 3NIBA 4WZAE 3TSZA 1G291 1UDXA 1E98A 1R5BA 1GIAA 1N5IA 2WTUA 2XTNA 3SC3A 2KWIA 5FPKA 2KNVA 3GLHB 2IEZA 2VA8A 1HJPA 1YZLA 4A36A 1WBDA 1WXQA 3Q9LA 2ZITA 4DLXA 1N6HA 2DFNA 1W0KA 3X1ZA 4MYCA 2WJVA 3MG9A 2QNJA 2CDNA 4FD2A 2PL3A 2IYRA 1ESNA 4MA4A 2R6CA 5K8UA 1TR8A 2IXFA 4M1YA 1CLUA 1Q1ZA 3QKUA 2ZVPX 1QHNA 2JLRA 3O8BA 4P4SA 3B89A 1VDZA 1X1RA 2F3TA 3Q3JB 3AGQA 4OQNA 3IQXA 2AK3A 1G3IA 1XZQA 3E1SA 2CHQA 2QTFA 5CK5A 3V4FA 4BLQA 1JAIA 1U8ZA 4JLNA 4NCNA 1VMAA 3PIRA 1PUJA 2WM9B 1VYVA 3DMDA 3DO6A 1E2KA 4D81A 5EXSA 4HB2A 1SXJD 2ONJA 4EPXA 4OK3A 4DUGA 2XITA 1AIPA 1Z63A 5K8IA 1E2FA 3BFVA 2JLSA 2QTHA 2IYXA 1KO4A 4Q4AA 4F4IA 1GSIA 3TH5A 4KXFB 4MRSA 1XTQA 5FBQB 3DVLA 1U98A 3P4YA 3RSOA 3R9IA 2JLQA 3GEHA 4GMXA 3W8RA 4W9MC 1V43A 2RHMA 1NG9A 4C0AC 1EFUB 2DYKA 2BVNA 2ZEJA 4JL6A 1YE8A 2IEYA 4JLDA 1G7SA 1IY1A 3CX7A 2J0SA 1T5LA 3W9YA 2D2EA 1JR6A 3NHBA 2GVZC 3OHMA 1VCNA 3IO5A 2DKLA 2IYVA 4UNNA 2O25A 1XMSA 1M1YE 1QHSA 2GKSA 1G4AE 5DLQC 2C99A 3KQHA 1QHIA 3D7MA 5AJVB 2ZSBA 5DHFA 2WMOB 1ZINA 3WHKA 1E96A 1OFIA 1KNQA 2AWNA 5BYJA 4Q9HA 5J4YA 4ZDJA 3BERA 1E2GA 3N2EA 1Q44A 2HCBA 4QHSA 4QHTA 3NH6A 4GBMA 1NY6A 3W8NA 4N3NA 4CT5A 1WE2A 4OQXA 2J9RA 2ZRCA 2BCGY 1DE0A 1C7YA 2WJGA 2DAKA 2ZVQX 3PEVA 5EP3A 521PA 3ZD7A 1KMHA 1UKVY 3D8BA 2J87A 4DLSA 1JQLB 5KOYA 1LF5A 4HLUA 4JZKA 1JJVA 4HAVA 3RS3A 3NDPA 5JCZA 1V92A 2WZJA 1M6NA 3BK7A 1HQYE 4V0ME 4ZDKA 2NG1A 1E99A 5DO9A 1RRGA 4NYJR 2JGNA 1RJ9B 2LKCA 3AQ4A 4F4JA 5FL7A 2NO1A 1N5LA 2G88A 3FKQA 4BZXA 3CF2A 4A2PA 1NVUQ 4CEHB 2MSEB 3EARA 4JIMA 4NHOA 5D3MB 5BN5A 1XU4A 2QORA 3CRVA 5JSZA 1CJTC 2QBYA 3TUJC 3FMFA 4IFBA 2FPMA 4D25A 1COWA 3CWQA 2CL7X 2HCJB 2OLKA 2R9VA 2REOA 4FWDA 3I1FA 3LQQA 4S2EA 2QPOA 4LBYA 3R9WA 4Q9IA 2UZ3A 2ECKA 1NJGA 3GLGB 1IM2A 3IHPA 4HZIA 4O2LA 5CM8B 4OYHA 3GLIA 3OEHD 4YDSA 1SKYB 1OIWA 1TAGA 2JIZD 3KTAB 4QBFA 1G6OA 3U3MA 1C1YA 2ZRBA 4BFXA 2GCOB 3T6PA 1E1QD 4M1TA 2BKEA 5IRCD 1QHYA 1W4BA 3BB4A 1Y63A 4EDHA 4UQOA 3F3YA 3HWSA 3RC8A 5LPNA 2WAYA 3BRWD 3KKPA 4BPBA 1EFHA 1E1RD 1CR2A 1EG7A 3RRYA 3FRIA 2HV8A 2N46A 3UMSA 1F2UA 5FOUA 1UPTA 2CK3D 2CVHA 2PJZA 1QDEA 2P0EA 3T35A 3V9PA 1WR1B 1LY1A 5J47A 4KSCA 4A6PA 4LJAA 4JJZA 3W3ZB 3CH4B 5CYPA 1J7KA 3VFDA 4B74A 3MWKA 4D82A 4F7WA 1RRCA 3LBHA 1Z07A 4URXR 3A4MA 3CWZA 1S9DA 3MJHA 2OEPA 3HPRA 3THOA 2DR3A 3SZRA 4D0NA 4Y0AA 1PVOA 1N0WA 1Q1EA 3K9GA 2QI9C 2QAGA 2BWBA 4PQYA 4KHZA 1E79A 5A0FA 4DDVA 4PAQA 1HQCA 1L8QA 3DKVA 3IUYA 2GA8A 4P0TA 4HUQA 4HAYA 4GFDA 4KCGA 2A7QA 2OUKA 1H8HD 3DHWC 4MUBA 2JY5A 2BBOA 3TSOA 1IBRA 3K9PA 2C78A 3ASZA 4HAWA 4OHWA 2VSOA 4JBWA 2VRWA 4IEEA 2L4EA 1G5RA 2KNAA 2BJVA 1C4OA 2XX3A 3BD9A 2JP7A 1ZCAA 4GDFA 3T1VA 3KFVA 1HA3A 3SHWA 4DLUA 3L43A 4TMWA 1GFIA 1ESMA 2VHUA 3IIJA 2F43B 4KYUA 2JLZA 2IYTA 4C2UA 3PXGA 1QVAA 1S96A 3TR5A 2G77B 2ZRLA 1GNPA 1OFUX 1SVLA 2P3SA 2CJWB 3FKSD 3LV8A 2QAGC 3I72A 2ANCA 1AZTA 4XSGA 1ZP6A 1G17A 4ACBA 1CBUA 1NN5A 1PZNA 4D26A 4D4MA 3L8YA 3KKMA 2IYLD 4TLAA 3TIFA 3I5YA 1WGNA 1J2JA 4PPGA 3ADDA 1XFAA 5L3SB 4TT3D 1JJ7A 4RKFA 1QHHA 2GF9A 3DM9B 3A36A 1N6NA 4RSGA 1R0ZA 2J5XA 1SXJE 4FIDA 3SYNA 4W7SA 2D3WA 1KGDA 621PA 2UKDA 1T3LA 4EFMA 4EKDA 6Q21A 1U8AA 4JSYA 4YXWA 3KQLA 3NWJA 3FHTA 1E9DA 5C4GB 2IX3A 2Z4RA 2D06A 1UKEA 1G3RA 4DSNA 3O8CA 4W5WA 4OJKA 3PUVA 3SN6A 2D62A 3ZVNA 2JLUA 2W0MA 1FL9A 3EZ9A 3IPXA 4G5QA 4HATA 1Z22A 4MGKR 3EA0A 1UFZA 2QM7A 3PR1A 1BO6A 4DSUA 5EP2A 3K9OA 1MABB 4OQMA 4AC9A 1ZUIA 1D2EA 2ZRAA 2KE5A 2AFIE 5FTJA 3GQBA 1VECA 1H8ED 2CWBA 1HT1E 2PX0A 1QRAA 3LQRA 3WMFA 1WRBA 1U0LA 2R6DA 1R5OA 3EWAA 2BWEA 4Q47A 4XTCS 5DGXA 3ZQ6A 4B2LA 2YWGA 4M9SA 1TMKA 3TUZC 2KRKA 1KTVA 1OH5A 3WMGA 2H5XA 3F0TA 4JKIA 4DDUA 4O0MA 1ANKA 1E0SA 2FSHA 1JAHA 2DZOB 1NBMD 4M9QA 1E2QA 4NKRA 4TSFA 2XXAA 1EESA 3WXMA 2OO9A 3ZS9A 2ASEA 2ZTCA 4PZYA 1QZXA 4WVFA 5J40A 1KHTA 3QPVA 1EK0A 2V4ZA 3BE4A 1XDBA 1W44A 1W0JA 2QEQA 2TMKA 1E4YA 4P4SB 1T5IA 1YQTA 3DOEA 1MKYA 1C1KA 4CT4B 4P3YA 1VIYA 3IQWA 4RD6A 3AKDA 2ZYVX 3LD9A 1XCPA 4TL9A 4W5HA 1R10A 1NJFA 2G0TA 3TQCA 3PUYA 4V0KA 3R7WA 1XEWY 3NTUA 2D7DA 3SQXA 1KJWA 4IW3B 4CVNA 3B82A 3HU3A 1NP6A 4F4CA 3GLFB 3PENA 2IHYA 5JRJA 2BHRA 3FE2A 5HCIA 1ZNYA 5D3QA 2ERYA 2X1VA 1IOZA 2NO7A 1ZMUA 1WF3A 1W2GA 1OQYA 3NEYA 3SFVA 1ZBDA 1N3BA 3GJ7A 3KUCA 3E21A 1R0YA 1T4GA 2RCNA 3EC2A 1GDDA 4PO9A 5EXTA 2RGEA 1NMXA 3RRMA 3U3RA 3K0EA 1CXZA 4DDWA 5KPDA 1NV9A 2E87A 2GAOA 2WSMA 3TQFA 2V54A 3AKEA 3SQWA 3SI7A 4XIGS 3ZZTA 4PHTA 2KI5A 2ZR9A 1RIFA 4RZUA 4MKHA 3A1UA 4MH0R 3H2YA 1Z6AA 2FEMA 4M53A 1IN6A 1W48A 3C16C 5IF9A 3UMFA 3QKRA 1HURA 1KMQA 1GVNB 2WAXA 3FB4A 4TQ9A 5TB5A 1E9SA 1FMLA 2EFGA 3B1ZA 4XVRA 4JLOA 5JJLA 2H16A 2QM8A 3K09A 1IN8A 3OAAA 2WWHA 1KO1A 1DV0A 2VHJA 4R2IA 4EPRA 3EIHA 1KMHB 4PSVA 4HB3A 3CPHA 1AQUA 4PZZA 5EE3A 2BWJA 4NTZA 1G16A 2BIFA 3KXIA 1Q02A 2NZ8A 2GILA 2B7CA 2AR7A 3NBXX 5J4VA 1XD9A 2F1IA 4DCVA 2JJ8A 4AKHA 4JLAA 3GJ5A 4GMDA 2GZDA 1V5WA 2B92A 3WYAA 3B1VA 3EAQA 1TADA 2YZ2A 3WNCA 4XVUA 4HEJA 2OXCA 3ZQJA 2XNDD 4V0OA 1QG4A 1W2HA 2W6JA 2WOJA 4V02A 5E3HA 2MROB 1DTSA 4Q4JA 2HF8A 1LS6A 1PJRA 2NQ2C 4E03A 5K8TA 5JSZB 2BMJA 2HYDA 2R44A 2QBYB 3K09C 4V0MA 2PJRA 1U0JA 4URWR 1LFDB 2NO6A 3ND8A 3E5HA 4QL3A 1N6KA 4WZBE 4US2R 1NLFA 2W6IA 3MWLA 1UBGA 3IIMA 1ONBA 3K0FA 4UXJA 1SVMA 3EIEA 2ZI3A 4U00A 3E2IA 5AR1A 2P6UA 1BH2A 4E09A 4TYNA 4EQ6A 5FTKA 4NU0A 1ZC3A 3DKPA 3GLIB 4B71A 3NEJA 4Q5IA 3ZH9B 2P5TB 5KO2A 1OV4A 2C9OA 4NE2A 2QP4A 4NYMQ 1NV8A 4FCWA 2A9KA 5E7MA 2D7CA 1KDPA 3ETLA 3CZPA 3N2IA 5IK2D 3V4RA 2DFLA 4FMCF 1X8KA 1NVWQ 5UKDA 4KU4A 2JDID 2PLRA 5H8WA 2BMEA 3CIOA 2OZEA 4M2LA 4GT1A 4CGZA 3FDIA 1P2UA 4GOJA 2ZR0A 1GRQA 3A8TA 4QFMA 1F2UB 1HUQA 3H0KA 4AYXA 1TF7A 4HDQB 4Q01A 1OTRA 2FMXA 2GJSA 5EE5B 5CDFE 1XEWX 4PSKA 4JYBA 4EFNA 2NZJA 4BECA 3K70D 3ECCA 4RZ3A 4OJQA 1W49A 2YV5A 3QE0A 3Q5DA 2DWQA 2HLDA 5JEDA 4ARZA 1ZM3A 3IDQA 4QC2A 2UZIR 2QAGB 1IJEA 4I99A 1S2MA 4PAMA 2PEYA 1R5NA 1IXRC 2QAJA 2F9LA 2O0HA 1KNXA 3AUXA 2JA1A 4P33A 4OBEA 4RKEA 4P32A 3RRNA 3N5CA 2FDCA 2GXQA 1Z08A 3VHXA 5KDDA 2DFKB 1G3UA 3THYA 4F2LA 4A3VB 1KI2A 1VCMA 3KL4A 5GJBA 3OFND 5BYKA 1Z0KA 4IDNA 4Z51A 2CLCX 3WYGA 1MN3A 2R62A 2IUTA 4CEIA 2KJQA 5JJKA 1VIAA 4JLJA 4QM7A 3NHAA 3VR5A 1KYIA 2OE2A 3LDAA 4POAA 3B2EA 3W34A 1IXZA 3SOPA 2G9NA 3TRFA 1G8FA 1ZU5A 3QBTA 4NONA 2CL6X 1TEVA 2Z0MA 3FYHA 4JLKA 4DJTA 2BMFA 4B33A 1ETUA 4G5OA 4F38A 2FF7A 5LB2A 4DCTA 2V7QD 2DWOA 2ZSAA 1OFTA 4Q18A 3AF1A 2ZXUA 1DAKA 3AVVA 2CP8A 2R6FA 1VYUA 2IUSA 1HH4A 1RRPA 1N6IA 5FOVA 5SZJA 2WZQA 3TLXA 5GVSA 121PA 3LBNA 4IFEA 1QHHB 3TVTA 2YKGA 1QVRA 4TTPA 1GKYA 3LA6A 2ODEA 3B9QA 5C4MA 1DAMA 4G5SA 4V0LA 2JAQA 4QBGB 4CZ2A 4C7OA 1KZGB 2Z5FA 2C04A 3MWJA 1NN1A 1E0KA 2IT1A 4P4UA 1AM4D 2ZTSA 1Q3TA 2WKQA 2VF8A 1W5TA 1B0UA 5DHAA 3RYTC 3TJZA 3CW2A 3WRXC 3I8SA 2OAP1 4AY2A 1VG1A 1U2RA 4NBSA 5FPSA 1SXJA 1W4AA 1VYTA 2GBLC 3GFTA 3RC3A 3LWNA 2ZYTX 4B2IA 4M1OA 1X8LA 2ZRNA 3R20A 1E0AA 3HR8A 2ZAMA 1EFRD 4LHVA 5L3VA 1Z28A 1ZD8A 3LW8A 1YHNA 1II0A 4HAUA 4D4LA 3LW7A 4LBWA 4TLBA 1OT3A 1FFHA 3EG5A 3C15C 4QRHA 2XXAB 3L0PA 1PLKA 1X6VA 4PANA 3B1YA 2ZRIA 1WGLA 4TLDA 2PCLA 5F98A 5JFGA 2DZNB 4TLCA 4AI6A 2GDJA 1E2DA 3QPWA 4IVRA 5FTMA 2DHYA 2G3YA 3K1JA 2E9SA 3CONA 3QQ5A 5M04A 2FGJA 4Q9JA 2NPIA 5G3YA 4BRUA 2AXNA 2RGNA 3B5JA 3VR4A 4Q7MB 2DZLA 2ZE5A 5IHPA 3IHWA 3BS4A 1NMYA 2CL0X 2C03A 2RGGA 2RGCA 1KDOA 1II9A 1NIPA 3R7WB 4X8LA 3AF4A 1OKKA 5BN4A 1Q1QA 2PX3A 3ZJYA 1R4AA 1TEXA 4Q66C 4Q48A 4RFSA 4HB0A 1ZUHA 3LFUA 2GCPA 2E1RA 1X8JA 4TMZA 2GXSA 3A4NA 1DG3A 3UKDA 1BS1A 1UF9A 2FG5A 3DDCA 4WZ6A 3U44A 3B1WA 3FGNA 1JECA 3GJ8A 4BEBA 4LCBA 2GZAA 1Z8FA 2V9PA 2ZIAA 1R0WA 5EP4A 2HEIA 3DZ8A 1DAEA 1IXSA 1GNQA 2F7SA 2NTYC 4NYJQ 4PPNA 3X2SA 1UFQA 2IW3A 4JSTA 2BOVA 4I1OA 2I4IA 2WJYA 2J0UA 3KQNA 1P2VA 4BQSA 1YKSA 4FWTA 5JI3E 1RYHA 1XP8A 5CM9C 3TNFA 4CEJA 2J41A 4ASUD 2VF7A 3CRMA 3AB3A 1UDWA 2XJ9A 2LVQD 1IONA 5DE3A 2BDTA 3QKRB 1W7AA 4IKEA 5KDOA 3EPHA 2KB0A 3X1WA 4LJYA 2YHSA 1UADA 2CCKA 3AP1A 2G3QA 4PHFA 3SBDA 1W36D 5GADl 3JVVA 3CX6A 5KUTA 2GJ8A 1RKBA 5AJZA 4C30A 3K0CA 1P72A 5E7IA 2EW1A 2FFHA 3GD7A 2OOAA 3VKGA 2RMKA 3OEHA 3PUZA 4QNRA 2JIZA 4P4TA 1E9CA 221PA 1NSFA 2DY1A 3NDBB 3V00A 3B7GA 3BWDD 4F91B 4EIWA 4AKGA 1KOFA 4EJSC 4Q7KA 4ABYA 1E1QA 5LD2C 1S8FA 2H92A 3CNOA 2O8EA 2QTVB 4IVQA 4BUJA 8OHMA 1OH7A 1NKTA 3G82C 4NCHA 3A4LA 1CR4A 1ZW6A 5J4KA 1CF4A 1N6LA 2J59A 1NVMA 1FP6A 1OXTA 3LX5A 3IO3A 3MGCA 4PR0A 3B60A 4A4DA 1E1RA 5TXGA 3D31A 3BIFA 3RS5A 2GVDC 1TQ6A 2CK3A 4FMCB 4ON9A 1HV8A 2FJUA 5DI3A 3VNUA 1HYQA 3L2OB 2WPDD 4GP6A 4KFRA 4Q4JB 4TL7A 1F60A 1GG2A 2Q21A 4UXHA 3AVUA 2VP4A 1J90A 3BB3A 4PZLA 1Q1BA 2WKPA 4JL5A 2O8FA 2X19A 2Q3HA 2ODBA 2FPKA 2GWHA 3U3JA 4DKXA 5EE1A 2JNHA 3NBYC 3K0FB 3P20A 3I73A 4Q9LA 3I32A 4URZR 5KSZA 3DOFA 5DN6D 4DLRA 2PLFA 4R9UC 4EQ6B 1Z5ZA 4QGGA 2ZI5A 3PEUA 3A1WA 1P9NA 5TDHA 1FQKA 2FSIA 1OSNA 3RAPR 421PA 3SEAA 3SDZA 4PAOA 1GL9B 1B23P 2XTMA 4F93B 3Q8XB 1OXSC 3KJGA 3VU9A 2YWFA 4L9SA 3CH5A 1OAIA 4BEJA 5JWRA 5BW8A 3U4QB 2O8CB 4FMBB 2ZS8A 1H8HA 5FTNA 2H17A 2JJ1D 2WWXA 2AXPA 1CJVC 1AIPC 1IAQA 1NG1A 4JLBA 2GEVA 1VEGA 3RHFA 5EP1A 4BFSA 3D3QA 4TYPA 4LJ7A 4Z54A 5C2JB 3F92A 5H70A 4DEYA 3QENA 1O3YA 2AHOA 1MRNA 2C9YA 3TSWA 2HUPA 1M7BA 1MR3F 3W6OA 4A1FA 1EGAA 1XPOA 4LGMA 3M6AA 2A5DA 2OCBA 3UWKA 4DZZA 2KSQA 3FKSA 3QJYA 3TMKA 1LB1B 2YWHA 4QGAA 5CLQA 3TUIC 2JATA 2VPPA 2IS2A 1GUAA 1T43A 4UN2B 2HDNB 3T61A 4CDGA 3RRZA 2A5YB 4LJ9A 4ARZB 4B3FX 5HZKA 2DAIA 1NY5A 1SVKA 5JJIA 3UPUA 1UEIA 5CDFA 2Q3FA 2DB3A 1CJKC 2ZJOA 1GNRA 1XF9A 2XSZD 3QOFA 3BBZA 2R6GA 1ZJ6A 2IL1A 4URYR 3ZVMA 3AVYA 1O87A 3B13B 1UKZA 4OQFA 3B78A 3W3AA 1X86B 4FWHA 1QG2A 1EX6A
chains in the Genus database with same CATH superfamily
1G6HA 4A92A 1FMCA 2XEXA 3RYFB 3DZJA 4UHJA 5ALGA 5HHTA 4UCWA 3AW8A 2AN3A 9GPBA 1NU8A 2QSUA 1OXUA 2QQ8A 2WJZB 5K5EA 3ER8A 1JKIA 3DZHA 4FOLA 2VH5R 5CT6A 1W47A 2ZT5A 3QX8A 3T5DA 2B8WA 4J9VA 5HJ5A 2PZGA 2E0IA 1U80A 1ELOA 3I4VA 4PZ9A 2QN1A 5LOVF 2DTXA 3K71B 1SXJB 2W6MA 2OBBA 4UJ5A 4O4JF 4JUBA 4FIZA 4RH3A 1S2LA 2YHIB 1Q7EA 3ZHTA 2LVNC 4HGRA 5F33A 3ONNA 3THXA 5ITVA 4ZCIA 3ORFA 4AZ3A 3FWYA 5J59A 3GG2A 3UMBA 3GIWA 3NKLA 4HSEA 1XZAA 2IV2X 3WYDA 1T26A 1AURA 3OURA 1A9ZA 5B3AA 4R9RA 4DR7B 4QYTA 3PSAA 1BWSA 2QRMA 2ZUVA 4CJXA 1SU6A 2J9FB 1JQAA 4KK4A 4OHFA 2FPGA 5C52B 1N57A 1WJGA 2ZM6B 3IBCA 1G38A 3HUEA 2F00A 5TE9A 1GAWA 4TZTA 2BZ1A 3UZUA 1V8ZA 4ZTBA 2OOBA 3G8DA 1WCWA 1XAJA 1B74A 3A1EA 3WMRA 1XLWA 3E5MA 3FD9A 1Y9ZA 4D9BA 1XNJA 4D4HA 4P35A 4IR7A 3R75A 2FZWA 3QRWA 1N2ZA 3HYNA 4NU6A 2N47A 5CJPA 5BV2P 3P4XA 1JB1A 2I87A 5IK2A 1V71A 3GT3A 3PU6A 2H2WA 3HY5A 1AGPA 1R6AA 3NEAA 2WWYA 3I2FA 1EIJA 5L7YA 4Q05A 3OUTA 2VHTA 1XMQB 1F20A 1WPXA 3BXXA 4FZ5A 3ZZMA 3W7VA 1SVIA 1A8QA 4CM8A 1I6MA 3NIDB 2AYYA 5ANRB 1T0BA 4MAFA 1XNHA 4ZEWA 5J9FA 1R18A 5HKOA 4JUCA 3O91A 4MQ6A 4MVWA 5L3QA 5JROA 2QUIA 2B6NA 4ITVA 3C4JA 2H06A 2FEOA 5CBKA 4GLFA 1PYDA 3WLMA 4OGFA 2CNDA 2ZTDA 4DV1B 3OC0A 3HFSA 3RLIA 4LZNA 4UE6A 1XMVA 1IBLM 2AK2A 4BN0A 2XD9A 3Q7RA 3ZV6A 3G2QA 5ALQA 1Z6QA 4R2KA 2UYYA 2ZUWA 2DGDA 5G02A 3DYVA 4B3HA 3U26A 4HQKA 3R7SA 1X7XB 3RADC 3JZAA 3PXDA 1U3TA 5DXJA 3MCUA 1R6XA 3MTQA 3FNGA 1DL5A 5LFAA 3DLHA 4XJXA 2GYWA 4IWYA 1VSTA 2XUFA 5LP6A 5K20A 4B1FA 4TV8B 1QYCA 1LVUA 1UBMS 4F97A 1DKQA 3GLQA 4R9VA 1VCOA 5HTKA 1AS2A 4WEQA 1RJFA 1ZD3A 3STWA 1RLOA 4MB6A 4FP9A 2V6FA 5BSFA 2W42A 3ETNA 1M2EA 1T5BA 3QXSA 1O94A 3E27A 2II6A 1A95A 1Z26A 2RHOA 3UK2A 4Y2RA 1RFLA 3LVRE 5FI5A 2XDQB 4K2HA 1WXXA 2CBGA 3B6KA 3M5PA 3EPKA 4EKEA 4UEOA 4DRXB 3K1AB 1OZ0A 2RRUA 3CPJB 3O8OB 4GXQA 1E5DA 1ONOA 3CEAA 1XLVA 3FHJA 1GSHA 1E2UA 2VQSA 4Q3OA 1CRLA 1B73A 1AQ6A 4LOIA 4DARA 5TEWA 3SARA 3SHFA 1XMPA 4PN7A 2COEA 5KTRA 2FV8A 4BNUA 5EUBA 3M4NA 4LDQA 4OHKA 2GPSA 4PONA 4UHFA 2W58A 4OB7A 2XTAA 2Y3IA 3C6ZA 2H1OA 3F49S 2OBMA 1UJ2A 1USKA 3G8YA 4HAOA 3ZUPA 1V37A 4RZHA 3HE3A 3AL0C 3N07A 2HF2A 1XOIA 1IJKA 3JY6A 2EX1A 2ZUTA 2ZPTX 5I9SA 4DV0B 1KPGA 3K0HA 3ECAA 1BIFA 4WQMA 1UFVA 2QN6A 1JHZA 3UJDA 2BH9A 8GPBA 5GP1A 3AQIA 1L4KA 1H6CA 2WM2A 2F2TA 3NHMA 1QORA 3F74A 5BR8M 2C4UA 1TYZA 1CEQA 1RBYA 1MJ5A 4UNPA 5SYNA 3SJZA 3FAZA 4V38A 5J5CA 4B82A 3IV7A 4DV7B 4YJHB 3EDMA 4RM3A 3QM1A 1RQLA 2F8MA 4JMLA 3N05A 3NBAA 3JPWA 3K92A 3KFXA 4L6AA 3I0MA 3B53X 4JFAA 2AJLI 3ONWA 4M0MA 5HJEA 1XCMA 3K35A 2ETXA 3EPRA 4KMRA 3AJDA 1TPZA 2UVDA 3DMTA 3P96A 1DKOA 2E5LB 4W5QA 5DSXA 2JA2A 1KEUA 4TT3A 4KO8A 1IM5A 1ZXBA 5CW2A 2V65A 2QT1A 1Q83A 1EUYA 4LOAA 3SWWA 3BH0A 2C1EA 1FSGA 3D5TA 1JQJC 3QMPA 3A6PC 3UJHA 2WG0A 5A7HA 2X8JB 1ORTA 1WXWA 4TWIA 5KEIA 4OI0A 3CKKA 4GMFA 4LDJA 4UUOA 5KOHB 4QULA 1FRQA 1RHRA 1QUTA 2DHCA 2W2KA 3PEYA 2P77A 4RA9B 3GPUA 1BH6A 3ZKAA 4C7MA 4KPUB 3C5HA 1EP9A 1I2DA 1YMUA 4LCEA 4HDOB 2HHCA 2B9VA 1H1TA 1WB6A 4BO1A 2G80A 3PDWA 3WICA 3HYRA 1Q0HA 5KX5A 4JQYA 2ZZKA 1U1CA 2CNKA 4TWZA 1TYEB 1G8PA 4YJKA 1XQ6A 2BI8A 4DJDC 5TSDA 4GS5A 1BU8A 4A8JC 2XUHA 4OP1A 3T9CA 1TZKA 3HMKA 1NF3A 2WFAA 4L5BA 4QOFA 1AKQA 5ECYA 2R8YA 3MJEA 3D0KA 3Q7QA 4EI9A 2QD2A 2VDKB 3H5IA 3BWCA 5FA6A 4L74A 1TC2A 4WWHA 1ZVJA 3A6ZA 4ND2A 1N6RA 1JAZA 5EEGA 4ETIA 1CZOA 3MS4A 3JYHA 3GFFA 3T5MA 5EPOA 2ICAA 4FOSA 4KIUA 1BKDR 3YASA 4R51A 4U9UA 4PLWA 4LA4A 2QUHA 3AHIA 3H5OA 1E62A 4KXNA 3GPPA 3G85A 1J09A 4FFRA 4O6VA 1NASA 5HG0A 3VKVA 3GJ6A 3P1JA 5BVHA 4EG8A 1DKMA 3VI3B 1QF9A 1UM8A 3QVGA 1DU4A 4MLDA 1XZPA 4TWRA 1CD5A 4OKNA 1LDGA 1U2EA 3NVAA 5AKKA 4CF4A 2IHTA 5IC6A 4BKOA 1EHYA 4WLFA 5JPIA 4ZQEA 3O2SB 3DH0A 4GI2A 1HE4A 5JYCA 4RD2A 3DCYA 4NXNM 1J39A 3K16A 4WXRA 4RVUA 2N1BA 4WXPA 2BTQB 2AG0A 4LMBA 3GIDA 4NG4A 2EQBA 4UE2A 2IYNA 4TN1A 4JFRA 3E22B 5CB4A 3OFSA 3KR2A 5TPZA 3TQIA 5EZ5A 4N3AA 3TTTA 4OLAA 1GTSA 5I8ZA 4X93A 2JFNA 1V2GA 1TCBA 2IYWA 4BGEA 3AY7A 1V26A 3F90A 4HVTA 5U4QA 5EXXA 3FWZA 3TM4A 5BNTA 5CB6A 1BRTA 5D3MA 2RK6A 3PGJA 3R7DA 3LLUA 1JEAA 3U39A 2NPFA 2IS6A 2OWEA 4G5RA 4NQZA 2FSGA 2ATEA 2XB8A 4D9HA 5HOEA 4PYJA 1DGGA 2C29D 3LTEA 4KE7A 1C9JA 3UYKA 3MTIA 1AKEA 3MTJA 4M7WA 4RV9A 4XQ0A 3WL7A 3KKKA 4L8GA 2PYZA 2ZE7A 1CRWG 4DSAA 1WVMA 1O0CA 3FNEA 2W6ID 3IOCA 2BEUA 2C61A 2HHHM 5BR1A 3NC1C 4R7GA 1E5XA 4PSAA 4L5CA 1JUDA 3R76A 2PNJA 1B8UA 3KCQA 4OQPA 3SIWA 4MVXA 2C0QA 2PUVA 1V25A 2WIBA 2VQFB 3K15A 2ZRFA 2CV2A 1TQ4A 1QQBA 3WLAA 3EPJA 4RJJA 5E6UB 3VR2D 2O2XA 4YLGA 1Y5RA 1X80A 2IHBA 2I71A 4CLRB 4B6EA 1VG9B 2IY7A 2PLWA 1ZV1A 3FB1A 3AEKA 3EODA 1CIPA 4NXMB 5I7HA 5KAPA 3IBTA 4CMHA 3LZCA 2IFTA 4PLHA 4A36A 1N9KA 4QDXA 4FB4A 1ESNA 3F97A 4M1YA 4KIWA 2ZVPX 5AESA 4JYMA 5FI3A 1PE0A 1AQNA 1FP4A 2FP4B 5BWOA 4YGYA 4ISCA 3QYPA 4DEVA 4KXFB 2I8LA 2DYKA 2ZEJA 2HL7A 2CW5A 6ABPA 4AQYB 3VZRA 3SQMA 3GRRA 3C3PA 3FLEA 3MERA 5BW6B 1CQJA 2LXEA 4MUFA 3M6FA 1UK7A 5FF9A 4QHSA 1I1QB 1VMEA 4LRXA 3RSQA 2XUZA 2P1RA 4CT5A 1JKMA 4OGLA 2EW2A 3NJ4A 3LECA 5AW1A 3GNLA 2X0NA 4QUDA 3OQBA 4HNAB 5DGDA 2CEKA 2MSEB 3MRXA 2Z56A 3UHOA 2PR7A 4IMIB 5CFQA 1DKLA 2NYVA 3OWHA 1Y9AA 4A23A 2XT6A 2IU4A 1C0LA 3COJA 4EDHA 1M34A 3ZY2A 3FRIA 1H2ZA 4EW2A 4KSCA 5A3JA 4UDNA 1WZIA 1G21B 1P5JA 5BUSA 2QI9F 4F60A 3RT9A 5AVZA 2ZCJA 5E9QA 2PUEA 2JKZA 1NOJA 2VJCA 5LZ8A 3RFWA 2WK1A 4AN1A 3ZGZA 2LDBA 4TMWA 2GEFA 4ZT2A 5CFMA 2VLBA 4JUFA 2FSSA 5B1IA 3L8YA 5JYBA 3TIFA 3M1LA 1WGNA 4E21A 1B8NA 4JLSA 3FLBA 2PUJA 3PHGA 1HNZM 3SR3A 1MU0A 3O8CA 5C8ZA 1Z22A 1J24A 1BO6A 4AC9A 2KE5A 1KY5A 5ICGA 2P90A 3CJRA 1KTVA 4YMIA 4B3MM 1ZN9A 3ROTA 1PNOA 3WXMA 3S40A 3ZS9A 1RBQA 2ASEA 1Y80A 2HPHA 1KHTA 4N7BA 3R3WA 1E4YA 4XB6B 1YQTA 2PGOA 1UWLA 2CC2A 4KX3A 1VRCA 4P7FA 3NM4A 3M6LA 3TQCA 5JTUA 1FTGA 3T7IA 4HDAA 3PENA 4FILA 4BQNA 2G4VA 3OE4A 5D3QA 2ERYA 1Z16A 2HWYA 3N7AA 1MOQA 1KR2A 2E87A 1AD2A 1YUMA 1L5WA 4REMA 4M53A 4WE3A 2C8JA 4HGPA 3GZNB 2JGLA 4L5JA 2PU7A 4O2BF 3BYZA 7YASA 4YB8A 3ZE2B 1D2HA 4A7PA 3EIHA 4PSVA 3CLSC 2FSVC 2B7CA 2WHYA 5JBNA 4AS3A 4NPAA 1AKMA 3WYAA 4HEJA 1BHQ1 1W2HA 5E3IA 5JS6A 1W2WB 2W48A 1YOVA 1PJRA 4E03A 2A7XA 3FY4A 2DBZA 4IQ0A 3MUOA 2W6IA 4QPJC 1A77A 2ESRA 2YHAA 2YZNA 9LDBA 2A9KA 5CRIA 1EFPA 3D6UA 3RU9A 4GYYA 1ULZA 1NQXA 5JJCA 2RIRA 3AHDA 3WO1A 1KAHA 1SC3A 3FDIA 3A8TA 3OH8A 1CIVA 1Z56C 5GKNA 1U8TA 4OIMA 2NZJA 1JAYA 2P2SA 1D5WA 4Q39A 1HE2A 2YWBA 2X5XA 1S2MA 3A1NA 3NWBA 2JFYA 2F9LA 3H87A 1J2EA 2O0HA 3F96A 2XR1A 4YJGB 3QLUA 4Z51A 2VP3A 3QV2A 4CKYA 1TT7A 4EF6A 4NONA 5ARCA 2DWOA 2ZSAA 5FHQA 1VYUA 5G1NA 1PR4A 1YBMA 3L6EA 1U7PA 3LBNA 6NULA 1QHHB 1SCBA 4D9GA 2RC5A 3B9QA 4C7OA 4G2TA 1T9KA 1GL3A 1UC9A 4BCCA 2ZTSA 2WKQA 3EOAI 4FUQA 2PMEA 3TLJA 3GFTA 3RC3A 2IIPA 3L7MA 1NZDA 1M0EA 4HAUA 1II0A 1KU6A 2RBKA 1PR1A 4Z4IA 3ET4A 3P2EA 1H4QA 1WGLA 2BE7A 2PCLA 1NXOA 5BSMA 1U7XA 3B7ZA 2BI7A 2FGJA 4N6OA 4WNYA 4AJJA 3NYWA 4DPKA 1BE8A 2C42A 3FJOA 1CUWA 1ECCA 3UUEA 1QX3A 4BX8A 3ZJYA 5JC1A 2GCPA 1TRHA 3FOAA 2CDRA 3UKDA 3U4IA 1M1XB 3H7AA 4KI7A 1IUNA 4O8CA 2ZIAA 2P5UA 1DNPA 1UKCA 4JOSA 1JWBB 1QONA 1JR2A 3FDFA 2WB2A 1GEEA 3K3PA 4HQFA 4R6WA 3FGOA 1A9TA 3NHUA 3S4YA 3ZY5A 1HL7A 2RMKA 4P4TA 1V4BA 2AJCA 5LD2C 2H92A 2O8EA 3G82C 2VPZA 2VBIA 3LX5A 4PR0A 2PXAA 4A10A 4KFRA 5FV4A 4UXHA 1ORIA 4FDUA 4UBIA 1WPRA 1XDSA 1T4BA 2XVMA 4MB2A 3GAFA 3LQ2A 2BGIA 1EFAA 1RM0A 4BVHA 1PD1A 5AVSA 4F93B 1OXSC 4WZBA 1JFTA 1KOJA 2QZJA 1NW4A 4FMBB 2C3UA 3CSSA 3GGCA 1DEAA 1KWKA 3OCYA 3C3KA 1QHEA 5DFAA 2UVPB 4FHFA 4LJ7A 3W5VA 4GOMD 4RDCA 1X1TA 2E48A 3W6OA 4YRFA 2I67A 2QGFA 3CEJA 1C14A 7AT1A 4ZO6A 1QGOA 3EGXA 1YRWA 3KZXA 5I3ZA 1VIDA 3TQHA 4YRGA 3NRBA 2ZT8A 3GBPA 4BTEA 2R7KA 5ED0A 3I2JA 1SKMA 3ZD9A 4I2VA 1EX6A 3CO5A 5CDSA 4MKGA 1RHQA 1F0YA 1ZLXA 5DWVA 4MS4A 4WKOA 4GOXA 3IR6A 1RC8A 2AT1A 4UEQA 2RGOA 3HI6A 5FPPA 1RLTA 3EIFA 1KI6A 2PT5A 3Q3HA 2D0DA 1VKOA 2EG5A 3LC1O 4L02A 4EUSA 3QMMA 4ILEA 2AKEA 2LHGA 1PJAA 4C78A 4ZCTA 1B93A 5CTAA 3GLVA 1GRRA 3EWSA 3DA8A 2DWPA 1GPMA 2B4RO 3NDIA 3P0EA 3EXAA 3LVBA 4MX8A 4XWTA 4MR8B 5HKBA 4PCLA 1E3MA 5FYDA 1RI5A 2MSNA 3BCHA 3AU8A 4HRAA 3TO5A 3WAGA 1M67A 4OKSA 4ZKDA 3VA7A 1TF5A 3WK9A 5LBIA 2EDCA 3OTIA 4TTQA 2FFAA 3KWFA 1PT5A 4U0JA 5AK3A 1LRKA 4AY4A 1PQYA 4R9NA 2XCLA 3RO7A 3HDHA 721PA 4LI0A 5AI5A 3Q8MA 1ZIXA 2R00C 4G0XA 1IXSB 1J21A 1JF8A 2ZR7A 3NIWA 5SZIA 4DTIA 2C7VA 3NPMA 3KKEA 4FYMA 4W1RA 2Z5LA 4CMEA 4NF2A 3BILA 4ZTUB 2VZLA 1GNTA 5L95A 2A0UA 5HTOA 2AA3A 2H07A 4ZOAA 2ZJ6A 2B25A 3C6BA 1OHHA 1T3SA 3EW9A 4I4TA 1LVGA 3O03A 2QB5A 4HAIA 3QIVA 3VYTB 1EDBA 1G8HA 5CITA 3VZDA 3PC6A 4L6CA 1YVRA 4GQAA 2OV8A 4H0CA 1CLEA 1OI2A 1ORYB 1X1AA 1YIDA 4MV3A 2GPYA 4M4SA 4TKVB 2J3MA 1AKVA 4U9HS 4DDTA 4ITQA 2JLCA 1NL3A 3KHSA 3FFBA 2YCBA 1E2MA 3LUJA 1FJXA 1ZLYA 1JXOA 2QN3A 4AO7A 2CXNA 2CHUA 4P3XA 2XT9A 4MEAA 4X66M 1YB2A 1V3QE 2JFPA 3ROGA 4DCSA 5JNWA 4R7ZA 3ZJUA 4XR4A 1PSDA 1YQDA 1DGFA 2C1ZA 5ELXA 1ZIYA 2G5PA 3ZWOA 2NV0A 1PJCA 5DBEX 2X41A 1JQKA 1PT7A 4DR3M 1J0XO 5CT4A 5AW8A 3U6BA 1P2BA 3B48A 4NMMA 2JJ2D 2OBLA 1Y1QA 2WSSD 1IFYA 4TUYB 3CE9A 5EIHA 3ZDBA 1M72A 1RKUA 3BFPA 3G0GA 2G83A 1UBCA 5IN5A 1NLYA 4HUQB 1R88A 1NXQA 4EG0A 4WESB 4DQLA 3ROMA 2XA2A 3HBLA 1G3MA 1QFYA 3BD7A 1UJBA 5TLSA 3VHLB 1JR4A 4G4NA 5BNIA 5JHGB 1XL1A 2OVBA 2MDTA 2ORWA 3GJ3A 2KLBA 3AOEA 3FGPA 1T2DA 4DV6M 4MDEA 5CEJA 3PQEA 4P98A 3U3XA 4FVMA 2WIAA 3DXXA 3U0BA 2E4UA 1EX9A 4GRDA 4C2AA 1W36C 4HDSB 2ZYRA 4IZIA 1OAAA 4OEHA 4E7OA 3QJ5A 1D6MA 4QOSA 1YRAA 2A2ZA 3KQQA 3QELB 4OU5A 4NZMA 4KR3A 2P5SA 3EJWA 2D1RA 1IXYA 1WP9A 3CH7A 2Q5OA 3VK8A 3EGVA 4PRYA 4NZPA 1K8QA 4PFSA 3SU8A 3HA3A 1U5BA 2EF0A 1DPFA 4JJIA 3A6DA 1VDLA 4QODA 4U2KA 3N2LA 1N1DA 2MINB 1MJGM 4FEGA 5LYYA 1MO6A 3L02A 2J1LA 2O8BB 1XXHE 1FDWA 4B7AA 3VPGA 4ETNA 2CNWD 4AKSA 4LSMA 1HDOA 1E9FA 2HA2A 4LK3A 4RV5A 4UEJA 4BFLA 2XCUA 4J0KA 3ZK7A 2PGIA 3ECSA 2VQ3A 1YMQA 2P6OA 2A4MA 5A7FA 3U62A 4JCOA 1M9NA 2Z58A 3OLYA 3U1BA 3TW6A 1E64A 4B9AA 2XZLA 1QH8A 4XVQA 2M5ZA 2Q62A 3EYAA 4FYHA 3X44A 2LVOC 1ZUNB 2JI8A 3WAKA 1A1VA 2X5NA 4M0LA 4RAQA 2FDRA 3BL8A 1YVEI 4C9BA 4UVEA 2PSJA 5GY7A 5TQJA 4NV3A 2LNDA 3HA2A 4YMVA 1G8YA 1RWMA 3SZUA 4BGDA 1WCIB 5LXTF 2DFTA 1QS0A 4WXMA 3I2IA 1LW7A 2J3IA 4POOA 5H37D 4JQSA 3HHZA 4KKXB 4MHOA 3TX6A 2ZREA 4F1IA 2FK7A 2Q3DA 1DARA 4XI9A 3RIYA 2YOFA 1K97A 4TZ0A 4DB2A 4KSBA 3KBBA 3VHQA 1WL8A 1T3HA 1KE1A 3NV9A 3SZ3A 3NB0A 1DTWA 1ICIA 2VCHA 5DNVA 2BFBA 3B6JA 4PG8A 3SDBA 1W1WA 3DQZA 3PPWA 1C81A 3FX2A 2H59A 1CEEA 3MWFA 7GPBA 3QHPA 1X74A 4RS3A 4TSRA 3R0JA 2VDWB 3DTVD 2A6PA 2R3SA 4YJ3F 3CW9A 1GOTA 3DLCA 4UJ3A 3IFSA 1AU9A 5LVAA 2JKVA 3FAKA 1NXSA 1JHAA 3EEFA 3DJYA 2J7OA 5JLAA 3I9JA 1KP2A 1NXWA 4BKUA 1Y4DE 2O2DA 4XQEA 1IBCA 2V6BA 4KK3A 3T1HM 3ZLJA 5D7NA 5J4LA 1LSOA 3ZU2A 2Y71A 3KOZE 4YMWA 1F4IA 1UZAA 2DKOA 3U61A 4Y2HA 1GXSA 4ZQHA 4V2UA 2ZCVA 4HZGA 4MMYB 3CN7A 1IN4A 2CRUA 4GMQA 4CCYA 4NLLA 3ORQA 1E9BA 3G5MA 2MYNA 4XEHA 1H42A 1IDN1 4DMMA 3F7MA 4ERXA 5DTQA 4D96A 2RKWA 4B4KA 3UMRA 3I3OA 2GXUA 1H65A 1P29A 4YWJA 3M70A 4FYPA 2VFAA 2JGRA 3ZZ0A 2D1FA 3WFJA 1J8YF 4NRWA 3TW4A 4QPDA 1JEYA 1SGWA 4Q1AA 3F73A 3LWDA 3WMEA 2RBGA 3L4BC 2JJ2A 1TB4A 2WSSA 3ZNNA 2DKFA 1EWRA 2XBLA 1TKRA 3K9WA 1V1MA 2QLFA 1HZJA 1SU4A 3VO1A 3DULA 2EVWX 1UAYA 3QU4A 2NU7B 3OKCA 3OJ0A 4JVMA 2CHVA 3WQQA 3B20A 1T5HX 4QXAA 1F6BA 1CUAA 2JLWA 2B8TA 1Z6PA 2WWTA 4ZGBA 3JALB 1GABA 2E55A 1C7JA 4EAQA 1I2MA 5LYJF 3ZIDA 4QA9A 5FSWA 3FMPB 3THWB 3L8CA 1N0UA 3DA1A 2IEBA 5KJ1A 1OB5A 1QSGA 2OGZA 4M7RA 4KRFA 3R3ZA 1FMTA 2H1VA 4QGSA 3E9DA 4LTMA 2WIDA 3SHOA 2YWDA 4BB6A 2JH9A 5H7XA 2DPXA 4DRZA 1H4VB 5HIAA 1L1FA 1KI7A 1UBEA 3DOCA 1LV8A 1DEHA 3C3BA 3LY8A 4ZC8A 1Y3HA 2ZSEA 4WPGA 3REQA 4C7VA 3X1XA 1PT6A 4A8JB 2OQVA 5EE9A 4ZK2A 5JEEA 1LSJA 2IZ6A 3OCJA 2ECQA 3STTA 4J7CA 1U1DA 5BT8A 3RSSA 2CNWA 1ZM7A 2AFHE 4J03A 1KBOA 3H4JA 2HCRA 3A4VA 3NHJA 5DOZA 3SHGB 2SHKA 5A05A 5JSUA 4LS3A 3KL2A 2FVYA 2CJFA 5J5AA 4DXHA 2JHCA 4YASA 1D7AA 5FTLA 3MJTA 3IUQA 4DJEC 2MSDB 3PNSA 2Q7OE 3Q2IA 1NX6A 2FW0A 2DQSA 3SMSA 1L7EA 4ZPXA 3KD2A 3GL9A 1Z5VA 1Q77A 4KLAA 4KQHA 4LFCM 1GAEO 4M49A 3KUXA 1XB2B 1X15A 1Y89A 1U6KA 5J2UB 1XVAA 2C5HA 1Z25A 2GARA 3URMA 3TLKA 1O8CA 1GZDA 2V6JA 2FLVA 4NYMR 1XQYA 1V0JA 4ZO4A 2F1HA 5FD8A 4FOPA 5BWMA 3HXTA 3KOXA 1V35A 4A15A 4X92A 4QUEA 5L7TA 4YAJA 4G4SP 5AXCA 3UFBA 1V8DA 2CCGA 5LDDC 2AZ4A 1MF7A 1VQ1A 2B3TA 4B3JA 4QM6A 4FFNA 3KHTA 3EW7A 2CFTA 3NBKA 4AKIA 2FUG1 3TIGA 1SIBE 4LQDA 4EY3A 1DBSA 4PN3A 2I78A 2GPAA 3IAS6 1ZMRA 1VIVA 3M4XA 2RKOA 4CYMA 5C1DA 3Q7EA 3BMNB 3ZU3A 1L4MA 4P7JA 5HSGA 1Z5NA 3O3OB 1I7NA 2XXJA 5J23A 3L92A 2FW8A 3JD2A 4P4SA 3V4LA 4PIMA 2IJGX 3DTVA 3IQXA 4V1CB 2VDRB 3PIRA 3USES 3PGMA 1VYVA 4JI2B 2I7XA 1DUIA 3D6FA 4NZNA 1XWWA 1V96A 2JLSA 2IYXA 1KO4A 3PR3A 4MRSA 3NX4A 3P4YA 3GEHA 1JHXA 2ZULA 3O8NA 2PX4A 4JP1A 4QYXA 1YDEA 3CX7A 2J0SA 4WCFC 5ICSA 1JIJA 2PO5A 3RVKA 1F06A 1TMOA 2GNAA 2BF4A 1E92A 1UBJS 1KZ4A 4JJ7A 13PKA 3VSCA 3DDZX 5DHFA 4Q6BA 2YJNA 4IIUA 2PUDA 1Y5LA 4ZDJA 2X1MA 2J9RA 2ZRCA 1C7YA 1P8AA 3HUFA 2ONCA 3D8BA 3U7RA 2XNJA 5EJGA 5ESDA 3E81A 2EQAA 4LXTA 3QVMA 4D8XA 3AQ4A 2NO1A 4GPAA 4P22A 2RH4A 5BN5A 2QBYA 3CURA 2HCJB 1JBQA 4G24A 3I1FA 3RFUA 1QH1B 1QCDA 1TAHA 5LA6A 2Y0TA 2JIZD 2UXBM 3T6PA 3RHTA 1Y4AE 4M1TA 4R8RA 1W4BA 3DV2A 1Y63A 2JRCA 1JMVA 2F3UA 3GBVA 1ULUA 1E1RD 2JAUA 2CVHA 2JHPA 1WDMA 4AIRA 3A4MA 1N2CB 2FB9A 1KRWA 2FR8C 3NCHA 1KS9A 3OD5A 4P0TA 1WV1A 4G4GA 2A7QA 2OUKA 2C7QA 2ONYA 3DCNA 2XEDA 4HAWA 3UICA 5A4MS 5AM4A 4DM7A 3KV1A 2OA0A 3JR4A 2JI9A 3EPPA 1CEYA 1XCOA 3LG2A 1ZS9A 1SVLA 2CJWB 4P80A 3W8FA 3Q7SA 2R7NA 4D26A 3D4LA 4PBTA 3PGXA 1FB5A 3VC3A 4TT3D 2XYHA 3TZCA 1SHTX 4WKPA 3UFXA 1R0ZA 1SXJE 4OP2A 1XA4A 4JSYA 1PYGA 5K0FA 3UUFA 2XEPA 5FWYB 1BDBA 1YHYA 1HT1E 3O4FA 2IXDA 3KYDB 1ODSA 3TUZC 4DKJA 4H7DA 5GGYA 4C88A 4KV7A 3A31A 4PFQA 3D1JA 3ANSA 3ORRA 1YKFA 2H85A 1F8YA 2DERA 3KR1A 5JFTA 2X86A 1XCPA 4H16A 4GE0A 4MGEA 3PUYA 3BVPA 3NTUA 3ICVA 1A71A 3C58A 3I0ZA 1R0YA 2BFCA 3MMZA 1NMXA 3H11B 4DDWA 5KPDA 1LI7A 1GNVA 2VNIA 3A1UA 3UJAA 4D4IA 3AI3A 2ADMA 4JLOA 3RQSA 3HCAA 2H16A 1Y6FA 1QBGA 5KYVA 1QV9A 4CLOB 1KMHB 4HB3A 1GGMA 5LQAA 1G16A 2BIFA 1Q02A 2GN8A 3OI7A 4IF6A 3IRUA 1QVWA 4Q4JA 1XCJA 4V0MA 2P69A 1U0JA 2RHRA 5CG2A 2P8JA 3TFQA 3RGSA 3WWCA 2P5TB 1OV4A 1KE2A 3UMGA 3I6MA 3QUQA 3GP1A 4REQA 3L84A 4JI7M 1X0VA 2QM3A 3PA8A 1EE8A 4HVCA 5M5BA 3IHTA 4DC0A 2NZUG 5FXMA 2FPOA 1U9ZA 2IOHA 2G1PA 1XZLA 3DHEA 3GT4A 2HSDA 3MINA 1R5NA 1P80A 2QAJA 4P32A 4PQEA 5DOVA 3O75A 3OX3A 1XDUA 2GXQA 1QQTA 1KI2A 3KL4A 2TRSB 4PX5A 2WRZA 3ZCTA 3H3XA 1L1QA 1MB3A 4RVGA 2OE2A 2GHQA 4DNQA 3NKFA 3BSYA 2FKAA 4WFIA 3JRNA 4IEFB 1KZ9A 2CL6X 1TEVA 2A9RA 5I9TA 4MW7A 5BSGA 2R4EA 3M6VA 4YJ2F 1Y81A 16PKA 3ROZA 1TOAA 2C04A 1U2SA 4KHPB 1KP3A 2GO7A 3TJZA 3V7NA 1BDIA 2OAP1 4MICA 3X0DA 3GZJA 8MHTA 4NEQA 3V3TA 4FVTA 1WQ4A 5AKXA 5ESWA 4ZOEA 4TLDA 1T5TA 1EEHA 1F7VA 5M04A 3HCNA 1FDUA 3DLIA 3RSGA 3BS4A 5TPZD 1JKJB 4LF9B 3GJYA 3ZYZA 1OKKA 3JSXA 4Q48A 4LOJA 2B37A 3FGNA 3T4UA 3KSBC 3LPNA 1I9GA 1HM5A 4JSTA 3DB2A 1H0HA 1BCSA 2Q07A 4FWTA 4CEJA 5DE3A 4IKEA 4CKZA 3COPA 4EM6A 2JIZA 4J1QA 4J1NA 3VVBA 1NUTA 4K6HA 3TSCA 2QVXX 4YUXA 1KRXA 1NVMA 4AJ9A 1GLNA 1E1RA 5L6MB 3PEEA 3O3MB 2YYSA 2Q29A 3P20A 3I73A 3DOFA 5DN6D 4R9UC 3KEOA 2NTVA 421PA 3R5XA 1JTVA 1TZBA 3L1KA 3G59A 3Q8XB 2OQ2A 3CH5A 1TH2A 5LJLA 1FLDA 1D04A 2ISSD 4ALMA 1G98A 2A9VA 4UU7A 1VPWA 2HMTA 2C9YA 2EAUA 1M7BA 1JN0A 3PR2B 3A9CA 3NHRA 3EAFA 4QGAA 2DSNA 4P34A 3GY0A 2DB3A 4RORA 3HP7A 1VL2A 2R0QC 4HWOA 1VGVA 2JGAA 3BD6A 3L8MA 4FWHA 1ZRSA 4DA0A 3WAJA 6REQB 4C87A 4K9DA 3W6UA 1EBFA 4ZRMA 3ABOB 2IDZA 2FHPA 1QGDA 1QPGA 3H2JA 4F92B 1OX5A 4HV4A 1JPJA 1B2LA 3LIPA 4YRJA 4YHBA 1VJ0A 1SVOA 1FBNA 1UQTA 5BXQC 4B3CA 3IMGA 5ER9A 3A4TA 5EJ7A 3IT0A 1R16A 3BXZA 1K9VF 1YAHA 4WHMA 3E3MA 4ISBA 3CR7A 2WV9A 2ZTLA 4J29A 3Q98A 3ZVLA 1DELA 2R8OA 5EZYA 4W7IA 2BHLA 2GXAA 2JFXA 1LPOA 3H3FA 4ONEA 5TC4A 5LQMA 3QIAA 2MR9A 3EZGA 4ZI7A 4UBMA 3OWXA 4YAWA 1EM6A 2HO5A 2JFHA 1UMKA 2R8XA 4RUKA 4WN9A 4ZQFA 4LHXA 4UVIA 2CB0A 4LHSA 5HFJA 1T1GA 1AQJA 1JSXA 5E6SB 3GFPA 5T57A 3N2GA 3NHSA 5JXGA 5LD2B 5E6RA 1YE3A 5FOXA 4US0R 3OJFA 2YJTD 5NULA 4WINA 4UTNA 5LQRA 1DJNA 5CVDA 2VT7A 2QD5A 2QVZX 2W2VA 2QRJA 4LJ5A 4LF8B 2PLNA 2QU8A 5BUCA 4GECA 4FSXA 4X1OA 1SWWA 2PL1A 3PQCA 1JU3A 3MBIA 1GRNA 4H9GA 4U63A 2RHCA 4ARSA 4D46A 3SE0A 1LTKA 4Z3DA 4ER5A 5C7IO 2RAPA 4DEXA 2I3ZA 4LJ8A 4PCZA 1KI3A 3ZR4B 1QP4A 1PP4A 4H17A 3QOXA 4PBRA 3HGQA 3KP1A 5EHQA 3K70C 2ZRJA 5ALVA 4TYWA 4MRNA 2E4XA 5IJ9B 2NUPA 3BMQB 3DC2A 1E2PA 2VDPB 4Y6PA 1RHJA 2IYUA 3WGMA 5FORA 4II3A 1C9NA 1U8EA 1A7JA 4LPSA 2LHCA 3L18A 3VAAA 3DE2X 3O83A 3JWEA 3JAMS 2FH5B 1GKIA 2DUUA 2JCSA 1MRZA 1MEEA 2I9PA 4KLRA 4GKKM 1X8XA 1IHDA 1W8IA 1NRJB 5LMCA 1FEZA 5EJ9A 2V7VA 3W77A 4GHLA 2RGXA 3NATA 1QDLB 1E3IA 2PMCA 3UTCA 4G3XA 1G3QA 4Z7OB 4G1FA 3C3WA 3WXBA 1T5DX 3EIUA 4ZOLF 3HI4A 1SVSA 3ZQ4A 3GQ5A 3KSRA 2AVDA 4YTEA