1G3IA

Crystal structure of the hsluv protease-chaperone complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
443
structure length
326
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVDSIIRDLTDSAMKLVRQQEIAKNRIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and solution structures of an HslUV protease-chaperone complex.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone/hydrolase
molecule keywords ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT HSLU
total genus 103
structure length 326
sequence length 443
chains with identical sequence B, C, D, E, F, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g3iA02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g3iA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3iA01
3KKPA 2Z0MA 3NTUA 4QJ5A 3ZZUA 4OI0A 4IOLA 4XSHA 1GKIA 4FW9A 2FMXA 1F6BA 3I92A 4OJQA 3SEAA 3TVDA 1ZU4A 3KQLA 2CL7X 2JA1A 5J4VA 3WBKA 4DLYA 1DEKA 1W1WA 2QAGB 1M74A 3B1YA 4WIAA 2BCGY 4RFSB 2NQ2C 2YZ2A 3GEIA 4CDGA 2C8VA 4F93B 1WE2A 1KO1A 2EKFA 2CHGA 3A1WA 4DC9A 4Q66C 1OFTA 4TMVA 2JP7A 2Q3HA 3UXMA 1PVOA 5KDOA 1P72A 2FG5A 3CRVA 4HDOB 4LSGA 3QUSA 1R8QA 5JRJA 3MJRA 4I81A 3VR5A 3OEHA 1XPRA 4NDZA 1DADA 1DOAA 1TX4B 4UNSA 1E0SA 1LS1A 2WSSD 3UKDA 3BGWA 1VCMA 4R2HA 4TYWA 4LYAA 3GLFA 4N3NA 2FGJA 2V8OA 4M9QA 3UMFA 2ZSEA 4OI4A 5AJWA 2CL0X 1LV7A 4P0TA 4BQSA 1E1RA 4L9WA 4Q9JA 2XEXA 1N0UA 2GXUA 3TUZC 1K6MA 4WXRA 3K1JA 1H8HA 4XH9B 1G3MA 3AF1A 3H0KA 3THYB 2V6IA 2JJ1A 1G8HA 2WJJA 2UZIR 4A8JB 1XTIA 4QNMA 1YZTA 4NCNA 2EYQA 2BBTA 1SVWA 2IBMA 1EXMA 4X8OA 3SFZA 3W6PA 4ARZA 3VR2A 1P9WA 2VHJA 4X8LA 1EFRD 1KIMA 3K9OA 3AVYA 2DCUA 3G0HA 3X2SA 2C2HA 1W5TA 1NP6A 2GZHA 3NEYA 3ZIAD 4PSAA 2JZ0A 4P33A 4C30A 5FH9A 1XMVA 2OG2A 2ODNA 1EFUB 1TUEA 3GEEA 1AKYA 3GQBA 3CNOA 1QHSA 2AFIE 3UPUA 4PSVA 3RRZA 1JQLB 1XFAA 1UKEA 3EPJA 2BBSA 1UBEA 1WHCA 3FMOB 1EX6A 3AVOA 4YMVA 2BOVA 2WBLC 2ORIA 3ADDA 3EPLA 1QVRA 3MWJA 3ZVNA 1MR3F 3SNHA 5FL7A 3P4YA 5FBQB 2OEPA 1CTQA 1KSJA 1E2HA 3TQCA 4KSBA 3B8HA 2G83A 2SHKA 2K5UA 2WZQA 3KKNA 4Q21A 5IDVA 5EXSA 5G3ZA 3R7WB 4B71A 3FRIA 3PUZA 2ZIAA 1ZV1A 3B82A 1XMJA 1XCGB 3T12A 2WJIA 2FDCA 1W4BA 2FGKA 2CLDX 2J0SA 1LY1A 4ASUA 1EFTA 3O8BA 3BBZA 1DV0A 1BVSA 1QG2A 3LA6A 3QI2A 3S1AA 3UK6A 1G3QA 3EA5A 2JIZD 2W58A 3NH6A 1UM8A 1Q44A 4B47A 2X19A 4WAUA 5J47A 1UAAA 3BC1A 2MROB 2QE7D 4MYHA 3KJHA 4RZUA 3CH5A 4TTRA 2YOGA 1JPNA 2MSDB 3CZQA 4CEIA 3EZ2A 8OHMA 4ASUD 2ZS9A 1G5TA 1AQUA 2V7QA 3K0FB 3K0CA 2OUKA 3NDPA 1A82A 3OZXA 3QKRB 5TB5A 4DCNA 1NV9A 2DNAA 4LHXA 3WBJA 4POAA 3RRMA 3EXAA 3NIBA 1VTKA 3I4LA 2FOLA 2W6JD 4V0OA 2ZE8A 3K70C 4HAWA 4HUQA 2F1RA 1NVUQ 1F3OA 1OV4A 4TTPA 1ZCBA 5KNCA 2A5GA 5EP4A 4DSOA 4QKQA 1RRCA 1T3SA 2GTPA 2QM8A 1SVOA 1YKSA 4EPWA 4CEIB 2IS2A 3OIWA 5H8WA 1E1QA 2G1JA 1G291 3UMSA 3V00A 2A9KA 3D3QA 4MKGA 4PHHA 1TF7A 1KZGB 2QRZA 4JIMA 4TLDA 3ZVMA 1HYQA 1P60A 5JZVA 4R98A 1ZUIA 2YC2C 2WWIA 4M53A 1Q12A 2PT5A 4OHXA 1NIPA 3EIHA 1T8UA 5B2ZA 3CF6R 1E3MA 2R65A 3LO5A 4C0KA 3A1VA 2ZJYA 4C0BA 3REGA 1W2GA 2WWYA 4GP6A 4LV6A 1FFHA 2WSMA 1K5GA 2G6BA 2WJVA 2W2VA 4M2LA 1OW3B 4RKEA 2F1JA 3VR1A 1GITA 3FHTA 4O0MA 5FTLA 1TL7C 3W8NA 1UADA 1M7GA 4TL8A 2NG1A 2O8BB 1IOZA 3U61B 4URWR 4Q47A 2Q9CA 2ZJZA 4CW7A 1NLZA 2IL1A 3SZRA 3GLHB 3AVXA 1SXJA 4MRRA 4LYHA 2VO1A 5TXGA 1SVMA 3KW6A 1W36C 2QBYB 4U5XA 2VSFA 2LVQD 1G5PA 2JDIA 3C7KA 3A6PC 2OFWA 3AKCA 2CVFA 1DVRA 2CEAA 1DAKA 5LD2C 1KK1A 1U94A 5CDFA 5IHPA 3WRXC 2DHRA 4QGHA 3TUIC 2RGNA 3U3MA 4ZDWA 1KMHA 3CX6A 1KI6B 2HDNB 3A58B 3DKPA 2KNAA 2CHQA 1AKEA 1WXQA 4DBGB 2ZE6A 5FOVA 3PUYA 5C4GB 3PV0A 4YDSA 4URVR 3SFVA 4PZLA 1M8PA 5BYJA 2VP9A 3KTAA 2QBYA 1X3SA 1E2QA 4R7ZA 2V7QD 3N2EA 4WP2A 5SZKB 3O47A 3B85A 5KPDA 2V6JA 4EQ6B 3GJXC 4AG5A 2XXAA 4C3ZA 1NVVR 1GL9B 4OHYA 5AUOB 4Q1DA 2ZI9A 2KRKA 3TK1A 2GCOA 2JY8A 2QSFX 1KMHB 1VDLA 2E1RA 2VH5R 1SKYB 3CPHA 1ZU5A 2W0MA 3I8XA 3CKLA 3L8YA 2VF8A 2GVZC 3EASA 1BIFA 1RRPA 1S2MA 3CBQA 5LB4A 2RGGA 1X37A 2P3SA 4MYUA 3RS2A 4KODA 2GCNA 2AK2A 5G41A 3C5HA 4LDJA 2PCJA 4CIDA 4QBGB 2IYUA 2KJQA 5KHOC 5L3QA 4QM7A 1B23P 3QBVA 4HAUA 1NLFA 1D5CA 4LOAA 5E7JA 3SYNA 4KITB 3QXXA 1AM4D 4A82A 4MUBA 1NN3A 2DB3A 1DELA 1UEJA 3TR0A 3EIQA 4BEBA 3AJIB 3BIFA 1G3UA 3TVTA 1E6CA 2H8KA 1Q1QA 2AR7A 2KBFA 3CNNA 4P4TA 4EPRA 2F43B 4BPBA 4G01B 1JR3E 1XZPA 1DS6A 2A7QA 2ZSDA 4XTRA 1G6HA 1JALA 2IEYA 3C4JA 3RWOA 3SU8A 4M9SA 1RJ9A 3OFNA 3EZFA 4NYIR 2YOFA 2J9RA 3M4YA 2DZLA 1GM5A 4A36A 1IXZA 1NVVQ 1W0KD 3T61A 2EW1A 4MUAA 4I4LA 2NO7A 2PCLA 1VHLA 3SOPA 3KJGA 3MMPA 1OHHD 1VMAA 5E7MA 5G3YA 3ZDQA 2I1QA 3R9IA 1CJMA 1IHUA 4V0MA 1XP8A 2WWGA 4A1FA 2EVWX 4BRUA 3LXXA 1G16A 4GPTA 1WBBA 3CO5A 4FMDB 3LX8A 1H8HD 1NMZA 1NG1A 4B33A 4MDFA 2XB2A 3VU9B 2Q3FA 2ZQ5A 2PEZA 4DEXA 5J4HA 2BKUA 2ZRIA 2NO9A 4TYQA 3QJYA 2ZRGA 1JXOA 4R2IA 2ZU0C 1NNEA 1E4YA 1F60A 1COWA 2RH5A 4RD0A 5FR2A 2BM1A 2D3WA 2R2AA 2MGWA 2AD1A 4HATA 2D62A 2IF2A 4KFUA 1U9IC 1MT0A 4YDHB 3KKOA 4LV8B 2VLIA 2V1UA 3W6OA 3M0EA 2BV3A 1Q0UA 1KHTA 3DOFA 2A30A 1ZMUA 1NKSA 4C7OB 4QM6A 2J46A 3LX5A 1D2EA 2LVOC 1JJVA 1ZYUA 5GJVC 1D9XA 2HAKA 2ATVA 1Z07A 2F9MA 3ETLA 2ZVPX 3BH0A 2BIFA 2P5SA 4C2UA 1XD2B 4Q02A 3P1JA 2QAJA 1EX7A 1BS1A 4CVNA 1KJZA 2TMKA 4RY2A 2OBLA 2EWVA 1NI3A 2Q9AA 4DLRA 3BK7A 2Q6TA 5BW8A 1N5JA 2PL3A 5KDDA 3VR6A 4BWYA 2V1XA 3CRQA 1YE8A 1ZD8A 4BFYA 4DCTA 2BMFA 2QY9A 3TRFA 3E5HA 1MOZA 1HE1C 1E9DA 1XJQA 2OAP1 3FHCB 1N5KA 1XTKA 4N0EA 1TR8A 3GFTA 2L0XA 3RS7A 2NZJA 1QG4A 2X8AA 1QHGA 1RRFA 1G5RA 3DKVA 3O8RA 2PBRA 4BLSA 1CJVC 1D2NA 3B9QA 1P5ZB 1E79A 1NMXA 3UWKA 4WBSA 1ZNYA 1JR6A 1GAJA 2DWOA 4IVPA 3ZS9A 5JECA 3TSOA 1HT1E 1E0AA 2BCJQ 1W4RA 1FX0A 5IF9A 2JY7A 1HV8A 1XEXA 4LRSA 3K9LA 4FMDF 4LZZA 1E2GA 3CRMA 3H1TA 5TDHA 4C4PA 1II9A 1KAOA 1QZEA 1H8EA 5FPTA 4TZ6A 2ZROA 1KI4A 4IOJA 4LC1A 5E7IA 3ZZTA 2PZFA 2QAGA 3DMDA 5FBRB 1U2RA 3W9YA 4W7SA 1FTSA 2GRJA 3KB1A 1CS4C 5F98A 1F48A 1OHHA 4TZ0A 1SQ5A 4MKHA 2D2FA 2WKQA 4D82A 3U3JA 3FYHA 2PT7A 4XVQA 3A1TA 2JLUA 4MRNA 1Y3AA 1JR3D 1UFQA 1FP7A 2JLQA 5HE9A 1SVSA 3P4XA 3P27A 1MKYA 3PG5A 4H1UA 1EWQA 1I2DA 1Y63A 4ZI2A 1CJKC 5TMPA 1PGYA 2KI5A 3GP8A 2DBYA 3B1ZA 1T6NA 4HLQB 1KZ7B 1H8ED 4MRPA 3TW4A 2HYIC 1M7HA 1XD8A 1KSFX 5C46F 3ZQJA 5DSZA 4NTZA 2C9OA 1OFIA 3DL0A 2AKYA 2VEDA 2YJTD 3AF2A 3LH5A 3Q7QA 4JLVA 5FOXA 1T43A 1JXMA 2CVHA 5HE8A 4AYWA 2JUJA 2GAAA 2YINC 3MWKA 4IVQA 1OPXA 2J59A 3ASZA 4H9GA 2CWBA 3T6PA 4BLOA 5A0FA 3A1UA 1Z8FA 4Q1FA 4E5UA 4PTLA 5EE3A 5EUQB 2G88A 2EFDB 4A8JA 5AK0A 3SJCA 3VTKA 4Q18A 2VPPA 1Z29A 1Z2AA 4Q9KA 2FN4A 3AUXA 4QL3A 1ZM2A 3FKSD 2GDJA 2N1BA 1ZAKA 1KK3A 2A78A 3CUEF 4M4SA 4MGYR 5CYOA 3ZS8A 5HCIA 4JLOA 2WHXA 2QGNA 4QHYA 3P32A 3FFBA 4DLUA 2XNSA 4PQRA 4JL8A 3WP1B 1TUIA 2GZAA 2G0NA 5FOSA 5HR5A 2ZI4A 1S96A 1Z28A 1ZCAA 5FUVA 3QPUA 3T1QA 5AJXA 3EX7C 3H86A 1WMSA 1W36D 5JJLA 3C41J 1EWRA 2IWHA 4E22A 1TF2A 2BVNA 2OV2A 1JEEA 3FHOA 1GNPA 1AS3A 4Q19A 3QXJA 5DHFA 1RIFA 3IIKA 3L8ZA 3FMIA 2IYTA 2P5TB 1UDXA 2CJWA 1SHZA 3HP1A 4UQOA 2HT6A 4UN2B 4NE2A 3B6EA 1DAMA 1KYIA 1KDPA 2FE4A 5FTMA 1KO7A 2P6NA 2WOOA 3R7WA 2MJ5B 3OEEA 1UJ2A 2Q0HA 1G7RA 1X8KA 1P4SA 5CLLA 4Q1BA 3AM1A 1HURA 1P61B 2ANCA 2WWWA 4PC7A 4Q9HA 2JDID 2GBLC 1C1KA 2KB0A 5SZIA 3IEUA 2OCAA 2ZJ2A 2WV9A 3LVQE 1GTVA 4OL0A 3D6TB 5F9HA 3LVRE 1TAGA 2C9YA 4AY2A 4M1MA 1X86B 2X1VA 1LS6A 4GEWA 5K8LA 1ZIOA 221PA 4JT4A 4RCZA 5LBIA 1SXJB 1P75A 3AP2A 1NV8A 5JLJA 1P3JA 4MITA 2O0HA 2H16A 2R6CA 5D3MB 3RRYA 5DN6D 1N0WA 2FSGA 1W44A 3TW8B 4P32A 4GOJA 1EGAA 3R20A 3KX2A 4PQFA 5FPKA 1ZM3A 1QHHA 1W0KA 4IJMA 3TAUA 1YZLA 2FFQA 3JVUA 1AGRA 1WA5A 1KI3A 2ANBA 3AKEA 3Q85A 4UXIA 2PJRA 2JATA 2QMOA 1RRGA 3DEFA 3GLIE 2ZUCA 4YMTA 3MJHA 1XF9A 3X1ZA 5EP2A 4LHZA 2VA8A 1F2TB 1IFYA 4Z8XA 5GVRA 5FBLB 2CLSA 3QXHA 3SBEA 1W49A 1XCMA 1CJUC 2K9DA 2WTUA 4TSFA 2P2LA 1Q22A 4R9UC 1P3QQ 3BXZA 3B1VA 1Q02A 3K8YA 4AKHA 4CGZA 4NZYA 2HXYA 3AQ4A 4FWDA 2GEUA 2GVDC 1QHHB 3MHVC 4DJTA 3A4LA 3E70C 4GITA 3QG1A 3BH7A 2GA8A 2N42A 4TMWA 3E1SA 4N0DA 3PEVA 2ODWA 4EPYA 4M1KA 4RSGA 3ADKA 4MH0R 2CBZA 5KSZA 5CB6A 3QPVA 2JGNA 3RC3A 2C9CA 2FWRA 3KXIA 4M21A 4B76A 4LWZA 2JLYA 4QHSA 2BEKA 3B78A 1DG1G 2ZVQX 4S35A 5L3VA 2QGZA 1OH5A 1S8FA 4Q01A 4GMDA 2DAMA 2D4HA 2CP8A 1QHNA 3RRNA 1GVNB 4ZCLA 1T5IA 3I32A 4HYYA 621PA 3OIUA 2AHOA 3K0AA 3QVUA 5D3QA 2L2DA 3EC2A 3GJ3A 2OXRA 3AVQA 2P65A 4DT1A 4TT3A 2LVAA 1VPLA 5JHGB 1AGPA 2J41A 1NVXQ 2ZEJA 4NCIA 1QHYA 3PR1A 4O2RA 1Y8GA 3T1OA 1OH8A 1D6JA 2F43A 3P20A 1EFHA 4U00A 2PX0A 2ZRPA 3QF4A 3CX8A 1DAFA 1OH6A 4M1TA 2JJ8A 1U8AA 4KI0A 3SC3A 4KLNA 3N5CA 3T1VA 4L16A 4Q9LA 3FOZA 4QBHA 2XNDA 1ZJ6A 2J0UB 4BFVA 1K8RA 1TMKA 2RB4A 1OJLA 3RS0A 2NO6A 4MQBA 4A6PA 1L4YA 4PAOA 4L5BA 1E98A 4PZZA 1OFUX 3W3ZB 1GG2A 1M6NA 3SHFA 3GJ7A 1G6OA 3EC1A 4EQ6A 1SXJD 3ASYA 3QF4B 3VLFB 2CK3D 5JSZB 2DFKB 3U4QB 4CT4B 2ZM5A 4JLDA 1KDTA 4MRVA 4HB0A 1D2MA 3CX7A 3AV0B 4NHOA 3U3KA 4B3BA 4D4LA 3IKJA 4QGFA 4FINA 4A0RA 4BEJA 2EFCB 3IBYA 3HU2A 1VG8A 4P31A 4DDVA 5DI3B 2QT0A 3IILA 4C9BA 3EPHA 4KV9A 1LF5A 2CHVA 3TIFA 5E3HA 4IOKA 5FUYA 1MO6A 1MRSA 1SVLA 3THOA 4FMBB 1XEFA 2F3TA 3HWSA 5EP3A 3FKQA 1II0A 1XWIA 1EFRA 2DR3A 4PHGA 2GJKA 3U7FB 1ZMXA 4IFBA 4R71A 2C5LA 2ZAOA 1SXJC 5JSZA 5B58C 1KDRA 2IYXA 4FIDA 1W2HA 2AXPA 3Q7PA 1W4CA 1T8TA 3TMKA 2JJ1D 2XJ4A 3VKWA 4C0LA 5FOWA 4E03A 4LJ4A 5DI3A 2OESA 4NBSA 1N6HA 2F7SA 4JVMA 4PAQA 1CR4A 1E2JA 1KKMA 4PC6A 3A4MA 4JJZA 1WCV1 4KVGA 2H18A 2GNOA 2ZYVX 2Q21A 3SDZA 2G1KA 3BFVA 1IXSB 4DSUA 1LVGA 3LRPA 1II8B 4KFSA 1HUQA 3SS8A 3WY9A 2OOBA 1Z5ZA 2VF7A 1ODFA 5DFLA 2OBNA 1RJ9B 1GFIA 1VYTA 2BMDA 2FFHA 1NSFA 1NVMA 2W6JA 3OEHD 3BFKA 4IEIA 1TTTA 2R6FA 2IYYA 2QQEA 2IWRA 2QI9C 1SHKA 2QP4A 3FGNA 1ZM9A 5JEDA 4LBYA 1TTEA 3TE6A 3LQQA 2ZU6A 3MWLA 3TKLA 3NG1A 2VIIA 2ERXA 1WBDA 3IIJA 3AF4A 4PHTA 2ZRNA 2C98A 2QE7A 1IXSA 5EE5B 2QPAA 3F3YA 3GJ5A 2KWIA 2BBOA 2VTKA 2JIZA 4A0GA 3HJNA 1KNQA 2V6ZM 3QVVA 4YC7A 2RGCA 3W6NA 1IXRC 2GBLA 4IHQA 4P4SA 3H84A 1QRAA 2ZTSA 4KSCA 5CM9C 5M04A 4GDFA 1YQTA 1AIPA 1XEXB 3CF2A 3RHFA 3DM5A 2X2FA 4KYUA 3U7HB 2OFOA 2WVJA 4DVGA 1V92A 1R4AA 2JJ2D 4C0JA 4AYXA 1P73A 4XD7A 1CULC 1G19A 1Z6AA 3L0IB 1G8PA 3PXGA 2JLVA 2AK3A 1GRNA 1MV5A 4GBMA 3T1TA 2ZS8A 4KLZA 5E95A 1E2FA 4P4SB 4ERNA 3CRW1 2GZDA 4BZPA 1YRAA 5GVSA 3HU3A 3CRRA 2UZ3A 2GEDA 3B1WA 4GI7A 3C14C 4HAXA 5KNDA 6Q21A 4HI0E 3PITA 2ZE5A 3AVVA 2OE2A 1Z0IA 1TQ6A 1R4GA 3IO5A 1GO5A 4JBXA 4UNQA 4DCUA 2WKPA 1QF9A 1SZPA 1FOEB 2GCPA 1UDWA 3E21A 2PZGA 4I99A 4RFSA 2ZETA 1B0UA 3ZIAA 2ASEA 1M1YE 4HSEA 3NDBB 2QNJA 2YWFA 3GJ4A 3UATA 2ZJOA 3A1SA 1Z08A 2PJZA 2V54A 2GWHA 1TU4A 1WJ7A 2ZYWX 2HF8A 4P3YA 5BN3A 1I2MA 1OTRA 3M6AA 4HAYA 4I1SA 3GD7A 2B7BA 1TF5A 1RKBA 5TV2A 1XEWY 2A5FA 3U6KA 3PCRB 1G64A 4JVNA 2HXSA 4RVCA 1G17A 2QRNA 3AH8A 2ZI3A 2ZRBA 4TLAA 3SR0A 521PA 1N5IA 2QP9X 1P2UA 3ZZ0A 4G3XA 2DHYA 3B13B 4LHVA 5L3SA 1W7AA 4DB2A 1FX0B 2CCGA 2QA5A 1OXSC 3N70A 3CLVA 4HZUA 3THYA 1CJTC 4TYNA 2FV8A 5K8UA 1XPUA 4A8JC 4US1R 2IS1A 1YHNA 5HTKA 2CXXA 1D9ZA 4LYFA 1ELOA 2OHFA 3IQWA 4ZCMA 4UJ3A 5J40A 2FNAA 2XZLA 1VECA 5FPHA 1A2KC 3GLFE 3W8RA 1T0JB 1J90A 2IUSA 2FJUA 2IK8A 3HR7A 4LBWA 3U5ZB 5BN5A 4C0SA 1EESA 2JLXA 1P9RA 1N6NA 1VG1A 2CJWB 4IDQA 2YC4C 4HZUB 3RSLA 3TUJC 4BLPA 4HLUC 4HLUA 1YVDA 3Q3JB 2WWHA 3PVSA 4RD1A 4TL9A 4NYMQ 4NYMR 5ANRB 1VKJA 5LDDC 1G7TA 3F5FA 2FFAA 4M1SA 5F9FA 4Y0AA 4TLBA 2P67A 1J2JA 1C1YA 1Q21A 2F1IA 4KAXA 4KYIB 1ZMWA 2DENA 1X1RA 2C99A 1CIPA 3KL4A 3EG5A 4M1WA 3DOEA 1GUAA 3NWJA 4AURA 4QJ3A 2A5JA 2MSCB 2HF9A 4IVRA 2ERYA 2IYVA 2UKDA 2IS6A 4PO9A 4W5JA 2RGAA 4QG7A 2QAGC 1R0WA 4TL6A 3RWMB 2HT1A 2QT1A 3MUFA 3UG7A 1COWD 3OIVA 4PPGA 4C0QC 5KU1A 2R62A 2HLDD 4KXFB 1KJYA 1AK2A 5AUNB 2ZANA 3GPLA 3ZJYA 1Q1ZA 2REBA 4O2LA 1SXJE 2O25A 4URUR 3WMEA 2YV5A 1KO5A 4B34A 2JLZA 5HPYB 3OESA 2QEQA 1E2IA 3MLEA 5DYIA 1U81A 3CB4A 2PLFA 3EWSA 4IKEA 1MH1A 1KK0A 4TYPA 1XZQA 1OYWA 4JLPA 3GFPA 3AGQA 4M1YA 2DAKA 2WJGA 3B9PA 5DLQC 3QE0A 2IT1A 4DLVA 4NU0A 3RS4A 5JMTA 1YLAA 1G18A 3B5JA 2VP5A 5L8VA 2IYRA 1NY6A 3QXCA 3Q5DA 3QKTA 2BWEA 1QDEA 1U98A 1G4AE 1PLJA 2REXB 4IDHA 1UKYA 4B32A 3ZYCA 4XWKA 1VYVA 2GETA 4HDCA 5FOUA 1G8FA 2GJ8A 2JLSA 3OFND 4TMZA 3U7EB 3VR4A 3FE3A 4Z8YA 2O8EA 5EJEA 1C4OA 1AZTA 3FDIA 4JBWA 5FUXA 5JBQA 3GLGE 3TGPA 2BMEA 1XXHE 1R0XA 3OF5A 4EAQA 3KKMA 4TMTA 4GNKA 3K9GA 1I4TD 1LW7A 1XTRA 3I3SR 3FTQA 1XBTA 4LX0A 2XOKD 1OIWA 4YQFA 4B3CA 3MWYW 1E79D 1WRBA 1ZVQA 2ZI7A 3P26A 2QL6A 2OCYC 3TSWA 1US8B 2KE5A 3BE4A 4V0NA 4XWAA 2NOAA 3K0AB 1UKZA 2XZPA 4Z1MA 2QTFA 1KTVA 2JJ2A 3GLIB 3RAPR 2O8EB 2ZRJA 3G5UA 3VAAA 2FA9A 1N6PA 4BE7B 2JY5A 5CJ2A 5D3MA 5FR1A 3W34A 3LDAA 1CLUA 4JLKA 1ZRHA 4I1OA 1FZQA 4B73A 1LNZA 1Z63A 3L0SA 1Q3HA 4FI3C 3GJ0A 4OYHA 1GNQA 1DAHA 3VNVA 1E9RA 5EXPA 1XPOA 4A3VB 1TEXA 5EE1A 4EFMA 4JSYA 1F2TA 1OLOA 3L82B 3HDTA 1KGDA 4E09A 2DKLA 5FL3A 1RYFA 3ZVRA 4DLZA 1A4RA 1SG9A 1E9AA 2WKRA 3Q9LA 1GNRA 4BFWA 4DSTA 1YR8A 3U2QA 1IN4A 1DO2A 2JCSA 4M9XA 2PZEA 1R7RA 3O8CA 2J1LA 4RD2A 4F7WA 3AGPA 1L4UA 4JL6A 5BYKA 3SYLA 1O3YA 4QXAA 2O8FB 1FNNA 1O87A 2G0TA 4Q7JB 3KJIA 1OT3A 3SN6A 4DLWA 1N6KA 2OO7A 4HZIA 3UMRA 5JI2E 1HQYE 2OCPA 3OE7D 4Q00A 3KQNA 1GKUB 3QEJA 3JVVA 4MRSA 4ESHA 2AX4A 2R6AA 3BRWD 4D4MA 4Q7MB 1N6RA 2HJGA 3UANA 4EPVA 2J5XA 3K0CC 1HTWA 4WZ6A 4GOXA 5CM8B 1YZQA 3H4JA 2O8FA 1OAIA 2ZR9A 5FBVB 4DXAA 3B89A 3SJAA 2ZSAA 2XXAB 2C78A 1UF9A 2EFEB 1DTSA 2J7PA 3NC1C 3IEVA 1KY2A 1JAIA 1ZNXA 2VBCA 4TQ9A 1RZ3A 3K9NA 4PO1A 4EJSC 3B2EA 1VQ1A 2WPDA 3FMPB 2RHDA 3RYTC 3NHBA 3NXSA 5DH9A 1E9CA 5EZ5A 4DDTA 1J7KA 3ZH9B 4Q48A 2I1VB 1UFZA 1U0LA 821PA 3THWB 4JVSB 4Q4HA 1CU1A 2BWBA 2RGXA 4OK6A 1IONA 3WP0A 3VNUA 2GHIA 1XNJA 3KFXA 4XTCS 4PZYA 1ZD9A 4LCBA 1BKDR 2CNWD 2RGNC 4MGKR 4DEYA 5L3QB 1JQJC 4P4UA 4KFTA 1VCNA 4B2LA 2GF9A 3K0SA 3PUVA 4PC2A 3KZ1E 2J0UA 1RPZA 3CW2A 4TYYA 1KK2A 4K81B 1ZP6A 1SVIA 3I62A 2OT3B 4LPKA 4G0NA 3IUYA 1SKYE 2NPIA 1OKKD 2IHBA 3KUDA 3THWA 2BBWA 4QGAA 1ZM7A 2V4ZA 4J0QA 5G40A 2WWXA 4KBGA 2FZLA 2VP4A 1T9HA 4D80A 2FEMA 2WMNB 4EDHA 1DE0A 2ZAMA 1YZUA 5F2EA 4GFDA 1E9FA 1ZUNB 2OLKA 421PA 2A3RA 4GZMA 4X8MA 1UBFA 1VIYA 1Q1BA 2D74A 2OM2A 4PANA 4L15A 4URXR 4QC2A 5KUTA 2Q3MA 4D2IA 4ZV4A 5KDLA 1CRQA 2H5EA 4NP6A 4V0ME 2GJSA 4ZDIA 3NVAA 4NMMA 1S1CA 4TT3D 1GRQA 2BHRA 4B3FX 1GILA 2JY6B 1HH4A 2GESA 2PMDA 5ELXA 3FE2A 1JNYA 1P9NA 1KOFA 2ZR0A 3H4MA 2HWJA 2J0VA 2QU8A 4FN5A 4LY6A 3LW8A 1VDZA 4JYCA 2FEOA 3B7GA 5FPSA 3ZVLA 4TMXA 1XJ0A 3EAQA 1P6XA 2EJSA 4TQAA 2EKKA 3G82C 4M22A 2QMUA 3VX3A 4PAMA 2NTYC 3IHWA 3IGFA 4M8NE 3QBTA 4PSKA 1BMFD 2VHCA 2FPMA 1NRJB 1FMLA 1Z47A 4JLMA 2F1HA 1QHXA 4Q4AB 4Q7KA 3QG5A 4DDWA 4AI6A 4KJZA 4F4CA 3RABA 1W5SA 1R5BA 2XSZD 3JZMA 2ZJBA 5CJPA 4ACBA 5E4FA 2L4FA 4FXPA 2VP0A 4D0GA 2H7VA 3CONA 5FOTA 3AF3A 3PEYA 1IY1A 3AUYA 3QQ5A 1M7BA 4HAVA 1OQYA 3GLGA 4BLQA 4YLGA 3CPEA 4EFLA 2R0IA 1TQ4A 3L0PA 4KVAA 4PPQA 4BFUA 2B8WA 2ZRKA 1LFDB 1DPFA 2ZSBA 2FFBA 1MO3A 2B8TA 3W3AA 3LNCA 4IXMA 4PC3A 2F6RA 2PH1A 2CNWA 2O0JA 3PEWA 1AS0A 4LJ7A 2YVUA 5JJIA 2CCJA 3OIYA 2QHOB 3L0OA 1WB9A 1OIVA 4TWZA 1GSIA 1KI1A 4LHWA 3LQRA 4G5SA 5DGXA 5DN6A 2RRUA 3V9PA 4B3DA 2WPDD 4ZPXA 1E4VA 1SKQA 2CCKA 721PA 3QPWA 5EP1A 1JPJA 2XITA 2YHSA 2J7PD 1DBSA 2LKDA 4B6EA 2ORWA 2ONKA 1Z6GA 2IUUA 2CK3A 3RSOA 5GJWC 2RMKA 3HPRA 2VHQA 1R5OA 1N3BA 2B3TA 1TNDA 4OKSA 4YXWD 3I8SA 3ICEA 1NN5A 2D7CA 2YKGA 3EPKA 1F5NA 5AWFC 4A2PA 4F92B 4MYTA 1FNMA 1R0YA 4ZI3A 2VP2A 1HE8B 4O25A 2QPOA 1NLYA 1W46A 1XEWX 4ZKEA 4LJ6A 1NF3A 3X1DA 4CYMA 1BMFA 2ZE7A 3HYRA 2D7DA 4B35A 5L3RA 1Q57A 3CPJB 3I72A 4ACAA 3A4NA 1G8YA 3NBYC 1W47A 2X77A 4WA7A 4A15A 4TLEA 1GL6A 2DPXA 2KSQA 1J8YF 5EZ6B 2DI0A 5JS7A 1WF3A 2ZREA 5HCNA 2ZJ8A 2HV8A 5AUQA 1HQCA 1KO4A 1Q3TA 3LBHA 1VEKA 2FSHA 2WZJA 3SQXA 1CUKA 1V5WA 1ETUA 3TLXA 1S1MA 2UVQA 4MKFA 1P7CA 3KDSE 3MG9A 1E2LA 4A0HA 4ARZB 4QFMA 3I61A 2ZXUA 1G21E 3ND9A 1IBRA 4W5WA 3SJBA 2AXNA 5KTYA 3KQKA 4DLTA 4KHZA 4QOSA 2BDTA 5LB2A 3IIMA 4RCYA 1OKSA 1KAGA 3D7MA 3EZ6A 1UBCA 3T34A 4ZIRB 1AA9A 1XTJA 4F91B 3DZDA 4F1IA 1ZD1A 2OOAA 1N25A 2OBMA 2ZRHA 3RS5A 3SE0A 3NH9A 4L4UA 1YJ5A 3VKHA 1EFCA 1GKYA 2D06A 3LBIA 5H68A 5P21A 2K0BX 4JZKA 4HUTA 4EPTA 1S4QA 4XVRA 2Z4RA 1RC8A 2LCFA 4M1OA 1L7VC 2GJ9A 4MDEA 2EWWA 4NCHA 1XU4A 5DE3A 4Z51A 1D8TA 1U0HC 1R6BX 4OQXA 2GAOA 1FTNA 2XOKA 2BJWA 2QNRA 2ZRFA 3KQUA 4A6XA 4RZ3A 2G77B 2ZTDA 1KMQA 2DAGA 3VQTA 4CF7A 3WYGA 3D31A 1IAQA 3Q72A 2FU5C 3MRSA 4Q9IA 1T5LA 3IDQA 5KSOA 2ZYUX 3MD0A 4NKRA 4BECA 2H17A 2XB4A 3NHAA 1Z3IX 1IQPA 2CE7A 2E87A 1KY3A 1PZNA 3GFOA 5JJKA 3T5GA 5GJCA 2GILA 1Z0KA 4UXHA 3DVLA 4JKYA 2FH5B 2PEYA 2XZOA 1L2TA 4K8OA 3NBXX 4Q4LA 3SI7A 1OXTA 5K8TA 3AB3A 1US8A 2EQBA 2BEJA 3RDPA 4AK9A 4EJSB 5GADl 3U44B 1JBKA 4RFVA 5JWOA 1WGNA 3KXLA 1Z83A 4TN1A 2BMJA 1ZC3A 4GP7A 2DZNB 1F2UA 1PV4A 2W83A 5EQTA 2YWGA 1NBME 3PEUA 1CP2A 5H1YA 2RCNA 3DHWC 4B44A 5JCPA 4CEHB 3K0FA 3QKRA 3L43A 1G41A 1NN1A 2AD5A 4URZR 2ATXA 4EKDA 4C2TA 1GRRA 4PXAA 3ONWA 1CRPA 2JZ1A 2KNZA 1XCPA 2LTUA 1E2NA 2Z43A 3IO3A 4ITRC 1OE0A 2NPFA 3WRYC 3R9XA 3QY0A 2CMKA 3LD9A 1XRJA 4Z54A 1E0KA 1BO6A 2JAQA 3I73A 1Z6YA 4NCKA 4DRZA 1CBUA 1N5LA 4HB4A 1ONBA 3HPQA 4E07A 2G9NA 4LJAA 2GEVA 4DUGA 4Q1CA 4L8GA 5UKDA 2FPKA 4RZXA 1MRNA 4UXJA 1FMJA 2I3BA 3LFUA 4AC9A 4BZXA 1NN0A 5SZJA 1AJEA 2CE2X 3NC0C 2VQSA 2NIPA 1TEVA 1VEJA 2H5XA 1UEIA 2AWNA 4GT1A 1FQJA 3E46A 3BS4A 2BJVA 4PO8A 3NBZC 1RFLA 2DFLA 2FX3A 1CKEA 2IYSA 4LJ9A 3NEJA 1KI2A 3Q5EA 2MSEB 2WMOB 2QSYA 1JEDA 1E96A 3FKSA 5TY0A 2ZJ5A 2QM7A 4K46A 4QHTA 3VKGA 2ZRCA 4DCSA 4JL5A 1GIAA 4IDOA 3DM9B 2J45A 4LUCA 5A4JA 3BBPA 3NBFA 3TAHA 1T91A 1TPZA 2ORVA 2QROA 3NKVA 3ADCA 3VR3A 2DVWB 3PFIA 1NBMD 1VIAA 2R8RA 4LHYA 3BWDD 3AVTA 1Z2CA 1N6OA 4UJ5A 1AQYA 2CLCX 4QNRA 4G5GA 5CYPA 2OCBA 3GCGA 3QKSA 3EW9A 3GEHA 3LWNA 5J4LA 3LCVB 3WYFA 3ZLJA 4S2EA 3T35A 1A1VA 4IXNA 1E2EA 3DO6A 4BFTA 5HKKA 2RKOA 4XIGS 5IRCD 5AUPB 2ZS7A 2AL7A 4HEOA 2QTHA 3I1FA 3VHLB 2OO9A 2KBEA 1E94E 1Z0AA 5CK5A 3A36A 2MMGA 4HLDA 1KI6A 3EWAA 5DI9A 4DDUA 1ZNWA 3K9PA 1A2BA 2GF0A 2R6DA 4KCGA 4DT1B 3PIRA 4LJ8A 4A2QA 4XWOA 1VCIA 1VHTA 3UG6A 1R10A 4O3MA 1ESMA 2V3CC 4D4KA 4DHEA 2ZI5A 4LRWA 3FFAA 3AVUA 2O8CB 1AN0A 4WVFA 4Q7JA 4ON9A 2WIAA 4EUNA 2OAQ1 3U6BA 4KO8A 3CR8A 1NMYA 2CDNA 2RGDA 1HJPA 4URYR 3CZPA 3MAAC 4F4IA 4AKGA 3UIEA 1AZSC 1OYYA 2VYFA 4RKFA 3ZD7A 2J87A 1A5TA 4FWHA 3LLUA 1ZIPA 4BRWA 1A7JA 1S9HA 4UNNA 1E2PA 5KSYA 3F92A 2YNMA 4NYIQ 4NYJQ 4AIIA 5JWRA 1ANKA 3THXA 2C77A 3CIOA 2VRWA 4MGZR 1J99A 1ZINA 3CR7A 4C0HA 2ZRMA 4FMCF 2ZPTX 3R8FA 1R8SA 2IX3A 2HLDA 2O8CA 3MFYA 1FUKA 4OQLA 1XB2A 1NBMA 3ICQB 2DZOB 2C95A 1ZW6A 3MCAA 4IEEA 3BERA 4CEJA 1CEEA 1UBGA 4Q4JA 4WZBE 1YR6A 3SYKA 1J8MF 3PQCA 5KO2A 1I4LD 1XTQA 1LTQA 1K5DA 4B2IA 4LC0A 2VSOA 2LVPC 5BQ5A 2NO1A 2WJYA 3THXB 3SBDA 1IM2A 2IHYA 1M2OB 4Q4HB 3K09A 4IDNA 2H1LA 2XTMA 4EPXA 2OFXA 2QORA 2ZRDA 2WAYA 3I5XA 4FCVA 1PJRA 1YZGA 2R9VA 4NONA 2GK7A 1FUUA 2ONJA 2H57A 5LD2B 1N6IA 1E32A 3QKUA 1IJFA 2EYUA 1YRBA 1XMIA 1BYIA 2A5YB 1E0JA 3GJ8A 3BD9A 4Q5IA 4KBFA 5CLQA 5KSPA 4BGDA 1X1SA 2DWPA 3OAAA 4GL2A 5FPYA 1NVWQ 3RC8A 4FWIB 1P2TA 1YR9A 2Z5FA 4CZ2A 4JJKA 4ZKDA 4GOKA 4JSTA 5BWMA 4JLBA 1VG5A 1KO8A 1RVDA 3CH4B 4OJKA 1NJFA 1Q20A 2Z83A 4YMUA 2V55B 4HDQB 3IHLA 4D81A 1KNXA 2VHTA 3LY5A 1OIXA 2LVNC 5SZHB 1VG0B 3QF7A 1DG3A 1E9SA 2EFHB 3QNUA 2QG6A 4G5OA 1P62B 5JFGA 1S9DA 1GDDA 5EE9A 2XGJA 2I4IA 3IBGA 3N2IA 4YXWA 5AJZA 2H92A 1MN3A 4Q03A 3VHXA 1JJ7A 4NH0A 5B30A 3KB2A 4QJ4A 5JI3E 3CF0A 2DFNA 3WHLA 1JAHA 1W0JA 3RLFA 1QZMA 4DBLC 2IYQA 4FD2A 5CB8A 4ESVA 5DIFA 3PENA 3EIEA 1OFHA 1GOTA 1UPTA 1BOFA 1GZSA 5CK4A 4QGGA 4BFXA 4JKIA 5IK2A 4DLXA 1GL7A 4B3XA 1AIPC 3GMTA 5CIQA 5TARA 1S3GA 2N46A 1MO4A 1DAEA 2OZEA 2DAEA 4G5RA 1E99A 2AN9A 2W2XA 3BORA 3TH5A 5FUWA 4PFSA 5LPNA 1U90A 1XD2A 4FCWA 5G53C 4ZDJA 3GJ6A 2OLJA 3F0TA 2L4EA 3VX4A 2W6IA 1OB2A 2IXFA 1R2QA 1CR2A 3C5CA 4YMWA 2DFTA 2ZUBA 3AKYA 5C2JB 2P6RA 1PLLA 4V0LA 1DO0A 2QUZA 1VG9B 3GLGB 2W2TA 1DAIA 1FQKA 4W5HA 2IA5A 3R8CA 2XNDD 3M1IA 1FL9A 4XD7D 1SULA 3U3RA 4AYTA 3AP3A 1TQDA 2GXAA 121PA 4GMXA 1P2VA 4HEJA 3TBKA 2W0SA 2J3EA 3K70D 2FSIA 1G8GA 3AEZA 4I1VA 5JRZA 5C1BA 1CR1A 2QPTA 2XTNA 4RD3A 4WOPA 1G4UR 3U60B 3LBNA 1RE0A 3X1WA 2BWJA 1YZKA 4ZIRA 4G1UC 4Y0VA 4X8HA 4GRAA 1FP6A 1HEIA 2GJAA 3CM0A 3PJRA 2ZRAA 5B64A 2AFHE 4PPNA 1YU9A 4IRUB 2DYKA 4LJYA 4OQNA 2GKSA 2EFGA 3AVPA 2QENA 3EZ7A 2KNVA 1E69A 1WDTA 1ZMVA 2IXEA 2R6GA 3C16C 1BYUA 1Z0JA 1U0JA 2R44A 5A5GA 3W5IA 4V02A 3WMFA 2C03A 2JASA 2QMEA 1U8YA 3FMFA 3KUCA 3V4FA 3QENA 5FTNA 5L3SB 4WXPA 1KI9A 3VMFA 4F4JA 2IYLD 2V9PA 2HCJB 1OXVA 1EFUA 3TQFA 2ZI6A 4OQFA 4LJ5A 4DKXA 4PQYA 3LCUA 5FTJA 4OQMA 1Z0DA 5AR1A 2KHHA 1N0VC 2E9SA 1WIVA 4LPSA 1KKLA 1IJEA 2BKEA 1PLKA 3BB4A 1NG9A 1QVAA 4Q1EA 5FL7D 1W4AA 1KSGA 4F38A 4OBEA 3KQHA 3BOSA 4BLTA 1VCOA 1J70A 3A8TA 4JN6A 1M34E 2X2EA 1ZUHA 4OHWA 4EJSA 3U44A 2IUTA 2RGBA 4NL4H 3FVQA 4B74A 2HUPA 4GSYA 4FWGA 4QRHA 4MKIA 1TQ2A 1NIJA 4AD8A 1TADA 2WIBA 1F2UB 2QSZA 4DCVA 2ODBA 4ZO4A 4DSNA 2O0KA 2ZR7A 5JCZA 2O52A 2QQ0A 1T0HB 5KNBA 3K09C 4BFZA 1FW6A 4FMCB 4MYCA 3GLFB 2BM0A 3DMNA 4BZQA 4DB4A 3WNCA 4UNPA 4IDPA 5IK2D 3KJEA 3A37A 4QBIA 2IXGA 2O5VA 1KDOA 2QMHA 2ZITA 3TNFA 1OB5A 1LB1B 3IHPA 4C0AC 3AF0A 1CR0A 4D0NA 3IQXA 1NSTA 4AG6A 1C9KA 3QXSA 1W0JD 4ZCIA 2AWOA 3WHKA 3SHWA 1IN6A 3WNDA 5FI0B 4HLCA 1T6OA 5CDFE 2JLRA 4Q1AA 1AS2A 1U99A 2EU8A 2XX3A 1E1RD 2QZ4A 4H1VA 1E1QD 4M0LA 4DWJA 4UNRA 3BAFA 4US2R 2B92A 3EARA 1ESNA 1Z6TA 2IEZA 2XSZA 2G3QA 3GLHE 1KJWA 4II7A 1TU3A 4XSGA 2HJVA 3X1YA 1E2KA 2IYWA 3B60A 1IN5A 4EIWA 3BH6A 1R0ZA 4LI0A 4YMSA 4W9MC 3DDCA 3HR8A 3IPXA 2VL7A 2A5DA 3QSYA 2Z4SA 1HT2E 5FI1B 5FTKA 3IECA 1KI8A 4D25A 3ZD6A 3FRHA 3HYTA 1U8ZA 1IN7A 2G3YA 2VHUA 2F55A 2IW3A 4OI2A 1RYHA 2ZJAA 3OAAD 2DY1A 4G3OA 1Q1EA 1ZC4A 2XAUA 2ZTCA 4LRTA 2VP6A 4LYJA 4MGIR 4N1AA 4TL7A 5FBWB 2WJHA 4JVLA 5HZKA 5F3WB 1HY3A 4V03A 3UWOA 4D4JA 1XXHA 2ZUDA 1XD9A 4PX9A 5C18A 1S3SA 4DIDA 2FZ4A 5J4KA 5C4MA 1X6VA 5BXQC 4RD4A 2MMCA 3TSZA 2ECKA 1Z0FA 4OK5A 1R5NA 1X8JA 4CEHA 3CNLA 2W00A 5JEEA 2HYDA 3U7GA 4AKIA 1C7YA 1SGWA 4GZLA 4BFSA 1IY2A 2F3RA 4IW3B 3F8TA 2J7KA 4FWTA 2RGEA 5CIWA 3KKQA 1XMSA 4CT5A 1BH2A 2C96A 1GWNA 1W48A 2IYZA 3X1XA 3EA0A 1OSNA 3S1AB 4ABYA 1NL3A 2OSBA 3LLMA 5J4YA 2XTZA 4XVUA 3Q8XB 3KXKA 1XXHB 2WOJA 2QN6A 3GLIA 2Z6VA 1F4IA 3I5YA 1DARA 2ZRLA 4HB3A 1OKKA 2RAPA 4ILEA 4B6FA 1YZNA 3LXRA 2B21A 4JYBA 3LAWA 4A2WA 4A92A 1ZNZA 5JWHA 2RHMA 4JBYA 3ZQ6A 4TSFD 1KI7A 3RVBA 1IN8A 2W6ID 3BB3A 4KU4A 3QOFA 1G9XA 2OILA 3E2IA 1N2CE 2AKAB 3K0EA 1YR7A 4B75A 4OHVA 4RJLA 3K70B 4HUQB 2FF7A 4JMPA 2PLRA 2JLWA 2HEIA 4CRWB 3T06B 1V43A 2YWEA 4D0LB 1IY0A 3KTAB 3JZAA 4D6PA 2B7CA 5CITA 5TVKA 3ADBA 4A4DA 5DNYB 2QTVB 1WGLA 1Z22A 1JECA 2XJ9A 4DLSA 2ODEA 4XOIA 2YOHA 3IPYA 3H2YA 5KYKA 4CEJB 4NCJA 1H65A 2B6HA 2JEOA 1G7SA 3RNLA 4US0R 3AKDA 1E9BA 1OXUA 2GCOB 4I1UA 2GK6A 4Q4JB 3D8BA 4WW0A 3MGCA 1E2DA 3WXMA 5DYGA 4PR0A 4RD6A 3W5JA 1EG7A 3QKSB 4BLRA 1WP9A 2YYZA 2PMKA 1CXZA 4MA4A 5EUMA 3OEED 1PUJA 2WWFA 3AVWA 1UKVY 5FFMA 3J81k 3FB4A 2WSSA 3K53A 3TJZA 3ND8A 3OE7A 2LWIA 2QP3A 4TQUS 3RS3A 1HA3A 4WZAE 4F2LA 4LV5B 1T3HA 3GLHA 1QBKC 3WMGA 3ECCA 3WNBA 4JT2A 2NZ8A 1NY5A 5EXXA 1T4GA 4PC1A 5J5CA 3C15C 3T15A 3U4QA 4LBVA 1G3RA 4HB2A 2LBCA 2BC9A 4A9AA 1EK0A 2FPLA 4D26A 1QHIA 2MR9A 1T3LA 1DAGA 4B48A 1G1MA 1LF0A 4JLNA 4B3GA 2NMVA 3KFVA 1G7CA 1OF1A 1MO5A 4TLCA 1Z06A 2WICA 4RZ2A 4DIEA 1G3IA 3C8UA 4DUGD 1RW4A 2OXCA 1VYUA 4V0KA 3W90A 4JLJA 5IT5A 4BUJA 1OXXK 3T5DA 4KFRA 5EE0A 2PX3A 3PUWA 1XTSA 2DAIA 1XB2B 2NGRA 5DHAA 2FSFA 1W36B 2CL6X 4DZZA 4Z1MD 1NKTA 4LK2A 4ZDKA 3VU9A 5K8IA 5AJYA 3OHMA 4OK3A 5AJVB 3HU1A 3L2OB 4AWXA 4LBZA 1KSHA 3PUXA 4OI1A 4A0FA 4TMKA 2DWZB 4IOMA 3QEOA 1PUIA 1CF4A 1ZBDA 3RANA 1MABA 2P6UA 3DZ8A 2LKCA 1II8A 4B2PA 3O8DA 1FPMA 3K9HA 2NO0A 3REFA 1SVKA 2Y8EA 2F9LA 4LGMA 1JI0A 2DWQA 2WAXA 2IC5A 3ZGXA 3SJZA 4B43A 4M9ZA 1S0UA 1XX6A 3EZ9A 4AKEA 1E9EA 1ZM4A 5JHHB 1JR3A 3DPUA 4C7OA 2JNHA 1QZXA 4UKDA 5DO9A 3LV8A 3TR5A 4FCTA 1XDBA 2Q9BA 1OH7A 1GP2A 2VSXA 3WYAA 2O8BA 2HCBA 2GXQA 3BB1A 3FWYA 4JS0A 2A2ZA 2REOA 3QIAA 3AP1A 5H70A 3V4RA 1I4DD 1MABB 2WM9B 4PPFA 5BN4A 2IF0A 3VFDA 4Q4AA 5EXTA 1G20E 2C04A 2P0EA 5B57C 5KPJA 4G5QA 5JS8A 2YWHA 5HKKD 1P2SA 5KOYA 3CWQA 4IFEA 4NYJR 4YONB 2O8DA 1NJGA 4U02A 2J0QA 2ZSFA 3BFXA 1L8QA 3MSXA 4OHZA 4BASA 2D2EA 2ZYTX 5HZHA 3SQWA 4PHFA 5DISB 4JLAA 4L9SA 4TTQA 3B1XA 1Z6XA 3CWZA 2IS4A 4U7DA 4EFNA 4Q7LA 4XJXA 1VEGA 3FPAA 4QBFA 1X8LA 3LW7A 1U9IA 1JB1A 5GJBA 2GXSA 1WR1B 1WQ1R 3BJIC 1XJCA 1E2MA 4HAZA 3R9WA 4NPHA 3U3OA 2O8DB 1N6LA
chains in the Genus database with same CATH superfamily
5LM3A 3VO9A 3QTTA 4DAOA 5AK5A 2Z0MA 4IOLA 3NM5A 4XSHA 5IYZB 2FMXA 4OJQA 3L27A 3SS7X 4CLRB 2JA1A 3GGPA 4GXTA 5HCUA 1DKRA 3WBKA 4DLYA 1DEKA 3H8SA 1W1WA 4PAGA 3ZCPA 3PXCX 4IJEA 1L7EA 1QK5A 4OQYA 4B08A 3B1YA 3RYCA 2BCGY 3ESDA 1GGHA 2JC3A 1ZNQO 4QDTA 2NQ2C 3TF5A 4CDGA 5LR6A 1JLLA 3ZHUA 4F93B 1GPLA 1X77A 2OSVA 1YUNA 3A1WA 1NT4A 3NRCA 3PPYA 4HDMB 4Q66C 3VYSB 4N39A 4ALNA 3TX2A 1OFTA 3FWNA 3N6RA 5LQKA 2PUFA 1GJSA 2VUHB 3Q12A 6LDHA 3OD1A 3HMKA 3MJRA 4I81A 2Z4TA 3AHGA 3OEHA 1P4GA 4P53A 4DNQA 2EKDA 2I6GA 2G63A 1DOAA 4AU1A 5I7UA 3QQPA 1E0SA 2OZLB 2WSSD 1N2JA 4LYAA 3GLFA 1SU8A 1BQ3A 1SG0A 1HTTA 1V9LA 2FGJA 1JB0F 2V8OA 2XUAA 2YS7A 3N5KA 5BYAA 1GDTA 2QGFA 2WE7A 4WOKA 2ZVDA 2PZMA 1RQGA 3HO8A 4GNRA 1JLLB 4ZYUA 5B6IA 5JNVA 1LV7A 4JI6M 2FEKA 4P0TA 4BQSA 4L9WA 4P0PB 2XEXA 1Z7BA 4D44A 2QLJA 4MTLA 4LXXA 1OI4A 4BCDA 4DR4M 4Z9AA 4WXRA 4PZ9A 1P0QA 1NXQA 3K1JA 1H8HA 2J5RA 3H0KA 2V6IA 3N2LA 3VZDA 2HPHA 2AOUB 3LQ4A 1M2WA 4A8JB 2QMYA 5ALZA 1XTIA 4C1NA 2XGGA 5LKAA 3ZTWA 2B1RA 4KQKA 1SVWA 2IBMA 3KZVA 3W6PA 2OZLA 1T1IA 3IJPA 2B1JA 2P40A 2DEUA 3FOBA 1EFRD 1KIMA 4EX7A 4HWGA 2A35A 1B14A 2DKOA 4RELA 5F1YA 5KQSA 1HE2A 3EPRA 1USWA 1EFVA 2XA2A 1QAOA 2ZBGA 3M9LA 1Z18A 2F8MA 2IHUA 3LZDA 1W5TA 4O4IA 2GZHA 2QIPA 3R6TA 1Q3BA 3PRJA 1XDGA 2JZ0A 5AW6A 4GOND 3BWCA 2VSQA 4BV2A 1OLXB 2GI4A 1HMPA 3KWFA 1X7ZB 3QX3A 4ESEA 3JQBA 4JGIA 3AHFA 2V59A 1JU3A 1W5FA 3RRZA 1TK9A 4IICA 1L5MA 3RG8A 3G2OA 2BBSA 5AI0A 2XLCA 1W1UA 3AVOA 3FMOB 3JQ6A 3ORFA 4G1VA 4UHFA 5J1TB 1QE3A 3AINA 3I4VA 3OSUA 4A73A 2PR7A 5DM60 4LG2A 3EHEA 1FFAA 4HK4A 2B82A 3HZRA 3H2GA 2Q6KA 3EZGA 3ZVNA 3M5DA 3BIXA 3P4YA 3P2MA 3BXEA 3GP5A 1N0HA 4YJDA 5FBQB 3ND6A 3WK4A 4IQ8A 5DW3A 3TQCA 4WH0A 2DPYA 4D8UA 1LQTA 2Q4OA 4YAFA 2G83A 1XA3A 4INAA 3L7AA 3V1NA 4UOEA 2WYHA 4YO7A 3PFHA 5G0WA 4D9NA 1WKCA 3GO8A 4HGRA 1GQ2A 3LKVA 4LOIA 3VPGA 4D0RA 4E51A 2ZIAA 3EXIA 3MBIA 1ZV1A 1T25A 3FUWA 3BMCA 4UHCA 4QZVA 4KNVA 2WJIA 3B5EA 4YTEA 1W4BA 1JF8A 1Z8DA 1N5DA 1P0IA 1DQSA 1T24A 1XK6A 2DJIA 3EZLA 3E84A 1EFTA 4MULA 1L1RA 4ASUA 4BJ5A 3S1AA 3CW8X 3DNMA 1XOIA 2VAVA 4RTMA 1HBJA 3UK6A 3S8YA 1A7UA 4PZUA 1JA9A 1E1YA 5TMBA 4YP0A 1FA9A 2I3AA 3NH6A 4B47A 1Q44A 3UT5B 5J47A 2G82A 2C0CA 2XT9A 1OZ0A 2GN6A 2QE7D 2Y0EA 2RBEA 4MYHA 4JD5A 3CH5A 1A5BB 3TGWA 4C7MA 5BMVB 3GPBA 4IHJF 3LUDA 3ELYA 5K3SA 1PR2A 1DJNA 2FZGA 3OZXA 1G5TA 1ZK2A 4ASUD 1T1GA 3NDPA 4DNFA 4LHXA 1MB4A 5IJAA 3OEYA 4QXRA 4DUZM 1IATA 4POAA 2VBGA 3EXAA 3IDFA 5CB0A 1VTKA 5E6RB 1X8XA 3BTVA 1Y8CA 2FR8C 3BG5A 4V0OA 3AEQA 3KUXA 3PEEA 4Y2TA 1N34M 4HUQA 4D97A 4FYIA 1NVUQ 3QYEA 3FOFC 1OV4A 3UT5A 4G8BA 1SUSA 2FSUA 3MAJA 4FX5A 3NFYA 2G4LA 4K9MA 1RXCA 1T3SA 3U4CA 1PL8A 3ELUA 5BMVA 1PG5A 2PK3A 1UINA 3GJYA 1SVOA 1YKSA 3ILXA 4EPWA 4CKZA 4NV1A 4RIFA 3BULA 5H8WA 2IS2A 1G291 4WY2A 3UMSA 3OU7A 2A9KA 1V8OA 3D3QA 1PJLA 1QV6A 1KZGB 4JIMA 1PBNA 3RSHA 1NM5A 3ZVMA 2EO2A 2R7NA 4UEOA 1I1NA 3NP7A 1DIAA 2H48A 3IQIX 4UREA 1LW6E 3KL2A 1YTLA 3SSOA 1RS0A 2OBFA 1ZUIA 3WQSB 1VRVA 2QYSA 1XNRB 2WY2D 3R09A 3EG9B 3JQAD 2GGSA 5A3RA 3E03A 3TZLA 1HDXA 2X40A 4H7JA 3DAYA 2JNWA 1YR1A 1Z8NA 3LO5A 3OOSA 4OGLA 3A1VA 1T0UA 1TF0B 2XKAA 4BO0A 1P3DA 4RENA 2FJPA 2WJVA 4G4OA 1U3CA 2W2VA 1OW3B 4PYLA 4ZN6A 4NV0A 1JDSA 4O0MA 3SX4A 3GA0A 3X1MA 4JEUA 4GD3Q 3TNJA 1T9BA 5HGJA 2C20A 4GLOA 5SY9A 4BNIA 4QX6A 5DCLA 4LF7B 4YJ2B 1L7QA 1F8GA 1L2CA 5A6SA 1LEHA 1SXJA 2IV7A 3OTQA 5KWJA 4UATA 3KW6A 1KH2A 5EVCA 3COPA 3DZHA 1XKTA 4U5XA 4B0PA 2E5LB 5ALIA 4MI9A 5HSGA 2Q5EA 3KOZA 2AI1A 1Z5CA 4G25A 2GWRA 1DFHA 1FDWA 4LVUA 4XDHA 5BR1A 4A7PA 3C7KA 3JQ9A 4I55F 4EKEA 1E18A 1EK1A 1EHCA 2CVFA 1DVRA 2QIOA 3AKCA 3LC0A 3LQKA 4TWBA 5LD2C 4RGBA 5IHPA 1ZISA 2DHRA 5AOVA 4PY2A 4RKQA 3A9VA 3VDQA 2V45A 4L8LA 1V1RB 2PJDA 4D0SA 4QU8A 3EIFA 4PSUA 4YJ2A 1KI6B 2HDNB 3A05A 3FWYA 4C0AC 4E1VA 1AKEA 2PNFA 4ID3A 3PUYA 3PV0A 4BBAA 4URVR 3HBMA 1SY7A 4IIVA 4NULA 5BYJA 2QK4A 3KTAA 4ND8B 1HLGA 2TMYA 4L4XA 1E2QA 3ENNA 4R7ZA 2V7QD 1QIHA 4WP2A 3N2EA 1DV2A 1UM9B 1YKGA 4NH4A 3DG9A 4CKCB 4EQ6B 2IDMA 2BGIA 2XXAA 1I6WA 1RXIA 2G25A 4C3ZA 5KYWB 2XLJA 3R7SA 2KRKA 4MDHA 4N3GA 2X1MA 3OA2A 3JQBC 2QV0A 2P2CA 4N3BA 4B7ZA 2GCOA 4R41A 2JY8A 4IF6A 4PZ0A 1VB3A 3UJAA 3ST7A 2QSFX 4TWRA 1JW9B 2IY9A 3CPHA 3N1UA 2W0MA 2XRFA 4PLPA 4CQNA 4WY8A 4J9UE 4MNTA 2FW0A 4KQ2A 5JO9A 3HDGA 3C8ZA 1ZKMA 3P19A 4OKNA 5B53A 4ND8A 3X1KA 1X37A 4MYUA 3K30A 3QVWA 4G81A 4X7PA 3S8EA 4A0QA 4KODA 3B20A 3SOZA 2AK2A 3R0VA 2EGGA 4RTJA 5KHOC 1U0FA 2Q1XA 4GP9A 3BIOA 3R40A 3QBVA 3SYNA 1EVEA 3PQ7A 3OPNA 4KITB 4A82A 4MUBA 2XVMA 5J63A 4MGHA 2DB3A 1HLPA 4HY3A 4E1BA 4LZPA 4BEBA 1V3UA 3BIFA 1YB6A 3STHA 4X7MA 3RAGA 4F56A 1G5IA 1X80A 2P9FA 2H51A 3Q7RA 3UHAA 1LLFA 4HXGA 4F3CA 4Y9DA 3A2MA 4BPBA 1JR3E 1XZPA 2P0AA 4N0MA 1VPWA 3E9RA 1IEWA 1WMDA 1DBPA 1ZIDA 1G6HA 2ZSDA 3LCJA 4UD2A 4XTRA 4WTOA 3ZV6A 5CDHA 2WQ7A 4H60A 3DFZA 2FWMX 5ITRA 5E4TA 4I19A 3P2KA 1J9EA 3EZFA 1NBHA 5IDQA 1Z0ZA 2V5UA 2YOFA 5JANA 2J9RA 1T1JA 2BI4A 2HWYA 2VF4X 3M4YA 5AW9A 2XMQA 1ATIA 2W6NA 5BQFA 2QM3A 4K0KB 2CXRA 2HWXA 1LPBB 1JKXA 3HKPA 3HLYA 2C58A 3HJBA 1Y33E 5I7EA 4DV1M 3PDCA 4ZOEA 4E5KA 2O2SA 4BBPA 2H85A 3M8KA 1RR6A 1UDRA 1VIVA 4PINA 5ALUA 3NKFA 2QN8A 4TYMA 3TTUA 1DQRA 5JIBA 1PYOA 1MRZA 1N1MA 1IHOA 1QGUB 2AFHA 2CDAA 3JYOA 4MUJA 3RARA 3EIWA 3TCXB 4DM7A 3CO5A 3ZYZA 3IBCA 3SIXA 1NP3A 4UM9B 3EFBA 3O93A 3EYWA 3KWLA 3VU9B 3OC6A 4NCBA 5A3JA 2PEZA 2GBPA 4NMHA 1W85B 1N2SA 1Y3BE 2W2LA 3MT9A 1PFWA 2ZRIA 1QUEA 4FNAA 4RJKA 3S4YA 2HWKA 2ZRGA 2W90A 4R2IA 1T0BA 1E4YA 3M34A 3RSFA 3TLJA 2RH5A 3AU8A 2X3YA 4DMHA 2BM1A 5KYUA 2MGWA 4FBGA 4HATA 2D62A 1OC4A 2IF2A 3F97A 4K87A 2WJWA 3KKOA 1YNSA 4C6TB 4Y6GB 2VLIA 4Q93A 2V1UA 3VZBA 2XYGA 1KF0A 1OZFA 2GEBA 3D64A 3GPCA 3V97A 3W6OA 4LSMA 2JFYA 3I2GA 1I51A 5CW2A 4BVGA 1Z26A 3DOFA 3OJWA 2O07A 4YT8A 1H0KA 4ALMA 2OBBA 5A5FA 5L53A 1E3LA 1JYSA 2AXQA 4RVDA 4C7OB 2UUCB 3GGCA 4NBTA 2DP4E 3CMMA 1K06A 2LVOC 1W85A 1JJVA 1ZYUA 4QYSA 1U63A 2DXIA 1B7GO 1XZBA 2QSJA 3DO5A 3DDHA 3ETLA 2ZVPX 4L28A 3K6KA 4NJMB 4WZAB 4XDYA 5U4XA 2M6LA 5G4KA 4CG3A 4G0OA 1XD2B 3EMVA 1ONPA 3NDJA 1JEJA 5JAMA 1PSWA 2X0JA 3KVNA 5JARA 1SUFA 1NVMB 3D54D 2JIMA 1KZHA 3MTGA 2Z3ZA 4B7XA 5JDCA 5JNRA 4P22A 3I01A 3RPEA 1LPAB 3W9UA 4BO6A 2J5QA 4RQUA 1B74A 1CQWA 5JZOA 2Q6TA 4OREX 4D46A 5DTIA 4M87A 5BW8A 2PL3A 1UC9A 4BWYA 3SKVA 5GONB 1SK9A 4XCVA 4JYZA 1YE8A 3BQ9A 1VYHA 2QY9A 2LPMA 3TRFA 4GZ6A 2OXTA 4AMZA 5FAKA 2BR3A 1VBNA 3ERCA 3RKSA 2QUAA 3EBLA 1E9DA 1X19A 4KR2A 4N0EA 1XTKA 1TR8A 3W0FA 1A69A 2YBDA 3MILA 3GUVA 1CUCA 2NZJA 3W05A 5DK6A 2GARA 1QG4A 2X8AA 1KYYA 1R3DA 1G5RA 1RRFA 2Q1TA 3DKVA 2R97A 1TM3E 2PBRA 3GZJA 3OOWA 2XFSA 1ND5A 3GQ4A 2WT4A 3G2HA 1VL5A 3IE2A 4HGQA 2GNAA 2OM6A 1Z12A 4U0JA 3DL4A 3GFGA 3QYFA 1JR6A 2DWOA 1R8JA 4EA7A 4ZYXA 1OBFO 4MMZB 4YQEA 3TSOA 1GTL1 5JXJA 2GKOA 3BRSA 2BCJQ 1E0AA 1W4RA 4O02B 3O75A 2JY7A 3OZBA 1R9NA 4LN1A 5TDHA 1JIUA 5JD5A 1DB3A 3ZKWB 4BMSA 3C7AA 2QUBA 5JYEA 5FPTA 1S2GA 2P2ZA 3ANMA 4S12A 3ND7A 3J81A 1IC6A 3JARA 2RJNA 3KO8A 1VIDA 4JY7A 4KR7A 1AC5A 2C4VA 1H3EA 1CUUA 1I5EA 2GRJA 2Z9CA 1CS4C 1U2QA 4TZ0A 4RK0A 3N86A 1Y5LA 4ZO9A 1SQ5A 2D2FA 5I7AA 3RRXA 4L0DA 1IUOA 2ZAYA 4WV3A 5A6VA 4B4KA 3PE4A 3V8BA 3FNQA 3TFOA 4KDFA 1UK9A 1Y3AA 2R6R1 4MRNA 4X1YA 1RYEA 3ZI4A 3VO8A 4DLPA 1PS9A 1MW8X 5DLDA 1T6ZA 5TGZA 2CMDA 3MTIA 3OFVA 7GPBA 5HFAA 4EHJA 3CXRA 1XAGA 5H81A 5JH7A 2DBYA 2KPOA 2Z2IA 4HLQB 4MRPA 4YGYA 3TCKA 1UQUA 3LL7A 1M7HA 1XD8A 3NMUF 2G08A 3OZIA 3RODA 5HJEA 1V3VA 1XQXA 4J3JA 3DL0A 3HYCA 4UFOA 4G65A 1C7EA 4WFKA 5B1EA 1C4WA 5L7WA 3LH5A 5IT0A 3Q7QA 1ZZEA 3QSGA 3ML1A 2HQSA 2JUJA 1JI3A 4KE9A 1KWGA 3O4FA 1QCCA 2XTJA 1P2BA 2CWWA 3OKAA 1ECGA 3DJFA 2D7JA 2J59A 4MGIE 4I46A 2YJNA 2EFJA 3T6PA 1ISFA 5FBZA 2IKQA 1Z8FA 5DIZA 4LGYA 3LMMA 3L4KA 3QVKA 2GZ1A 5EUQB 2EL7A 2P35A 1LTMA 2OV3A 1KQFA 5JNUA 2EFDB 1QYDA 3UJ9A 1SR8A 1VSVA 2IZ1A 2ID9A 3L46A 1QVWA 4QTUB 4LZOA 3MBKA 4E88A 1Z29A 3ZOZA 3MD9A 4JI1B 1Z2AA 4AZSA 4OX9B 2EWMA 3N8HA 4EY8A 1BKYA 3AL3A 5HJ5A 5GIPE 5I4IA 1F4VA 2HA7A 3CUEF 3F7MA 4NU6A 4QTXA 4E14A 2OXEA 1IWOA 2PAFA 3EZNA 4NBRA 2AQIA 2XNSA 1WUJS 3EOBI 3VYUB 1IZ9A 4JL8A 1USVA 4AXBA 2P9ZA 2Z8YM 4EYQA 3L4BA 2G0NA 5FOSA 2DQSA 4XUDA 4NS1A 1WD7A 4I1YA 5HR5A 3ZJUA 3UAVA 3EX7C 1U7XA 4JP3A 1PJIA 2FAXA 1TJYA 2QVYX 3AESA 1W5BA 2JIDA 3H86A 3LQ1A 1GQSA 4HTFB 4A1OA 3HJGA 1W36D 5JJLA 2IWHA 1E1KA 1QC5B 4FFLA 3I05A 3ZCSA 5B3LA 3DEKA 5E7QA 4RM2A 1WOYA 4G0ZA 1XC7A 2FWIA 1GNPA 1GSAA 4Q19A 2R7LA 3CT6A 3QWIA 2PYZA 1DL5A 3IIKA 4WINA 5E6SA 3ZHZA 3ZWWA 2P5TB 5CYFA 5BSFA 2XRZA 2ZPUA 3K2QA 2CJWA 3NFRA 2I65A 4ZZ3A 3KD3A 2GHRA 4CIBA 3FUVA 4FGWA 3B6EA 1RRMA 1DAMA 4BYMA 4HWSA 1JYEA 3H9EO 3LHKA 2Y0PA 3ZXXA 5FTMA 1HR0B 3A6JA 2DHCA 4QLAA 3RHTA 5J2TB 3EHDA 4EFKA 1U7UA 2WSLA 2XUFA 3I1JA 2BH2A 4PC7A 2JDID 2GBLC 2ZJ1A 3A7EA 3GRPA 1THMA 2YWXA 3IEUA 3LKBA 3N53A 4RF2A 1H1TA 3GZTB 2MWMA 2WV9A 5CT8A 3UGTA 1QGDA 4B46A 1XYVA 4Z7NB 3OQNA 3QVXA 3LVRE 1CQZA 1N2OA 2YVKA 3D5TA 4J1TC 1X86B 2X1VA 3WLEA 4LF6B 3B8EA 4S04A 1ZIOA 4CLHA 4JA0A 1E6KA 2YWRA 2ZAIA 4I6GA 4MQ6A 4KQ9A 3HN2A 3N2NA 5AJTA 5ALGA 3AP2A 1V8DA 1BWPA 2OHVA 4MUMA 5JLJA 1BW9A 2G5GX 1P3JA 3BSFA 5D7BA 3DMGA 3NV7A 2QVLA 5F78A 4BVBA 5CDYA 7CATA 1N0WA 2FSGA 5DCUA 1XQWA 3F78A 1CQXA 4XWWA 2W2PA 2YYSA 5BWCA 1XLUA 3QFCA 2FSVA 2FFQA 5EQJB 3PUKA 5TPZA 5LMNB 1C0EA 1HYHA 3EGDB 1ISRA 2JATA 3NOQA 3GLIE 1E9VA 3TTWA 5KNDH 3PYLA 4TMYA 2B6NA 3SIPA 2PBLA 3AZOA 4LHZA 4BP9A 2VA8A 2A0UA 3BX1A 4Z8XA 4QECA 4N9WA 1L7OA 4D4GA 2C9ZA 5BW4A 1UZLA 4U2EA 3QXHA 4JJAA 2WTUA 3VJLA 5CDTA 1A27A 3V48A 2EERA 4XARA 4RQAA 4AKHA 1CY8A 1NRWA 3A9RA 4CGZA 5EHGA 1NYTA 2JI8A 1U9ZA 3AQ4A 1W29A 3PJGA 4JOQA 2F5SA 3PWZA 4GITA 1GUBA 3VSAA 3C3DA 4AUEA 1R0KA 1NJ1A 3P45A 4JJEA 2IZ7A 5EIAA 5H16A 3UEOA 1Z4NA 5KNCD 2CFOA 1OBHA 1HL3A 2EHDA 3NAQA 3TRIA 3AHCA 3ESXA 3T7CA 4RSGA 3VV2A 4CKEB 3I6BA 2C5HA 3S40A 3QPVA 5JQGF 2FWRA 4XLLA 1GPMA 2YV3A 4LWZA 3PGKA 5TEVA 2K7FA 1DG1G 2QRJA 2H54A 4X93A 1CFZA 4GMDA 2GO7A 2C1ZA 1NUQA 1E5DA 2HJSA 2V0CA 5KCMA 1OX6A 3VC1A 1QHNA 1SCKA 1YRLA 3SXUB 2Z58A 1GVNB 1T5IA 4XR4A 1UMKA 2OMKA 4Z4HA 4W5OA 2IHTA 2I4OA 1M72A 2RKBA 3BGVA 2XCRB 1KMCA 2AHOA 3K0AA 2J30A 3JZIA 1IL0A 1WMEA 5KNLA 1CNFA 2OXRA 2ZIXB 4PT5A 2LVAA 4HDRB 3SX2A 2J41A 2ZEJA 3MCTA 4G86A 2D0IA 5CPBA 1QLWA 3BQMB 3BPSA 1VLZA 2VDNB 4YWJA 4PDGA 1JMVA 3BTOA 1D6JA 3LBYA 4KRXA 3HB5X 4BVLA 4W1SA 4ZHQF 5BURA 1L5QA 5EMKA 1G4HA 3ZDFA 1Z4OA 3CX8A 2FE8A 2ZRQA 4H35A 1CUBA 4YJ3A 1EUZA 1Q1GA 2ID8A 3DFUA 2J3LA 3KOWA 4U39A 3UKJA 3A4VA 4EF5A 4MCHA 3SC3A 1AUPA 2A88A 3ZW8A 5K6AC 4TXNA 1ZEMA 4L16A 1S6YA 1H0SA 4BQNA 1ZJ6A 4GVLA 1V8FA 1CDDA 2QTBA 4IH1A 4LF7M 2G71A 1OJLA 2YY6A 4B7UA 2Y93A 5ALKA 4M7WA 4R3UC 3OICA 4TVSA 4FB4A 3D81A 4YY3M 1SOWA 4PAOA 4L5BA 2WG2A 2J48A 3EYAA 2PTGA 3EPPA 5KC9A 1KYTA 4UOQA 2FUNB 2YZKA 4G07A 4A16A 4GPAA 5EY5B 2VPTA 4BLWA 1H1LA 2R7MA 5BUSA 3PPXA 5JSZB 1IBLB 3QTLA 2PA0A 2GM3A 3D43A 1D2MA 1G6Q1 3CX7A 2PUCA 3U3KA 4D4LA 4RY8A 4QGFA 4U7PB 4B7FA 4RPJA 1WVMA 3IBYA 5AICA 4A0RA 4P31A 2BSQA 2X3UA 2QTGA 3LLSA 1CEXA 3AM5A 4ZVRA 5C1PA 2O01F 2YXPX 3TIFA 5E3HA 1JDZA 8GPBA 2UYHA 1OBVA 2VNSA 1YAJA 1ULBA 4F8JA 4WXYB 1WBJB 1XEFA 1E20A 4REMA 5REQB 1XO1A 2MINB 2PBZA 2H4WA 4GSKA 2CLKB 5IKXA 2VPIA 3E7FA 4PHGA 1SBYA 2A0KA 1QYCA 3IIEA 5DSXA 1I14A 1BDMA 4ZZ1A 4X20B 1CW2B 2RB5A 5F12A 1QV7A 5LBTA 5JSZA 5B58C 4G0UA 1K7SN 1KDRA 2IYXA 1W2HA 3FJ1A 3EJ6A 3GF4A 3K1AB 3Q7PA 4FIDA 4MVJP 1J20A 4JNKA 2XJ4A 4F3RA 2UUAM 2I91A 1Y7TA 2B30A 2A58A 1DXOA 1R6UA 2FMTA 4LJ4A 4BNNA 4JI2M 5IKOA 2OESA 5T41A 4MIOA 4EI9A 4JVMA 4PAQA 4PC6A 1E2JA 4QATA 3A4MA 3HA2A 5JAQA 2GNOA 2ZYVX 5REQA 2ZZMA 3SDZA 4Z7QB 4KACA 4EB6B 5KKCA 1II8B 1XSEA 3O3MB 1HUQA 3MF4A 4KFSA 1XJ5A 3TWLA 3C7CB 3L7LA 3SS8A 4WLFA 4HX9A 2PRYA 5DFLA 3UW1A 2OBNA 3WYCA 2N75A 1JQDA 2NVBA 4IEIA 1HDRA 4NRDA 1NVFA 4CKBB 5CNKA 1IM5A 2G80A 2IYYA 4E3WA 4J2HA 2ZBFA 3E1GA 3UB3A 2ETXA 2IWRA 1SHKA 3CIFA 1GLVA 1LD3A 2A1IA 5DX1A 1WNTA 1QMGA 4LBYA 4A5OA 3TE6A 2CMHA 3MWLA 5ALLA 4C04A 1OFVA 1ECPA 2ERXA 2XDAA 4K28A 3OX1A 3ZHOA 1J2UA 3E15A 5ECDA 2ISCA 2ZRNA 3HB0A 3HG7A 4MR9B 4PHTA 1J4AA 4RYLA 2OPHA 4JQZA 1DQYA 4BJHB 1I6LA 4EB6A 1OLSA 1PO7A 2R1TA 1WXIA 2QPAA 1KMIY 1NVKA 2D00A 2QR3A 2A0FA 2XNHA 3F3YA 3W79A 4TXLA 4EHBA 1Q0HA 1Z4KA 2R6ZA 2IP2A 3OLYA 2HHLA 4GI3A 3DLIA 3GDHA 4HLNA 2HTFA 1IUPA 1NNLA 3AG6A 2BE7A 4YC7A 5CH5A 5DT9A 4G0WA 3JU3A 1OXKB 1LLCA 5KQRA 5ED4A 3T7EA 4DA7A 1LBSA 4MW1A 5DX8A 4NZ9A 2BD0A 4CU5A 3G1WA 4KYUA 2VQDA 2CUZA 1KIAA 3U7HB 2OFOA 3HM2A 4MTCA 1XR3A 2QTCA 5HJ2A 4DVGA 3H87A 3PJDA 4KR9A 4R6XA 4OX9Y 1VJTA 3DONA 5IVDA 1UIMA 1QH8B 3VO2A 5JRDS 3L0IB 1F20A 4XZ3A 4OXNA 1TT7A 2IOFK 3IAUA 1MJNA 1MV5A 1NU6A 3NHRA 1B2RA 3C8HA 3G0GA 1Y5IA 4ZCRA 5GVSA 3AI3A 2A1TR 4BLVA 2P1ZA 1SVNA 1L4NA 1BVUA 1K3TA 1GNSA 3PITA 1GV0A 2ZE5A 4B9EA 1O4WA 3AVVA 5LNK6 4FJ0A 4PQGA 1Z0IA 5DDIP 1GO5A 4UNQA 3KZCA 4CQJA 1M2KA 4D3YA 3DPSA 5EKUA 1ISSA 4YRKA 3RVSA 1SZPA 2D2VA 2XXJA 4C14A 4UVDA 1YA4A 1KH1A 1XK7A 3O3CA 1T2CA 3H5VA 4RFSA 5ESRA 3OTGA 3QI7A 3CUTA 3ZIAA 2QNJA 2UYGA 2IITA 2WJZB 3WX0A 1XTTA 1BA2A 1L7PA 3GJ4A 3KALA 4IEFB 4N6OA 3R3VA 4ZA2A 1QYVA 3UATA 1ISMA 2AT1A 1Z08A 2PJZA 3DLBA 2Z95A 2GWHA 1E3WB 4WBNF 1X15A 3VPBA 4CN8A 2GN1A 2IH2A 1BX0A 3I9V6 3OD5A 1YQEA 1VDDA 2Q2WA 1W35A 3M6AA 1CZNA 5KYXB 3IOMA 5TV2A 3DT8A 3Q2KA 1MF7A 1PT5A 4QJBA 5AO9A 3A42A 1CG6A 2BHSA 1XU7A 2HXSA 3VVLA 4DREA 3LHIA 2GAIA 4ME6A 4YALA 1XT6A 4RTPA 2ZI3A 1ESCA 5F1PA 5KZMB 3SR0A 2FUKA 1M2JA 521PA 1A9SA 2WA2A 4QQNA 4G3XA 5AI9A 4EY7A 3ID6C 4DN6A 2L18A 5EA2A 1YCFA 2Q6VA 1N2EA 1CJCA 2CCGA 1PR5A 5CDUA 2VKQA 5ICEA 4U2BA 3R0ZA 3THYA 2ONYA 5B3JC 2F59A 2FV8A 2VDOB 3CZCA 4X1OA 5EGSA 5MGBA 4NXMB 4BMXA 1Z4PX 2HHAA 1IB6A 5HTKA 3RSQA 2E7ZA 1I1QB 3KHKA 5THXA 5LJIA 1RQNA 2PMWB 5J40A 4UEQA 1CEYA 2DPHA 4MVJI 3M4NA 4KXUA 1UPAA 3DL2A 1A2KC 1OV6A 1YS2X 2DFVA 2GBIA 3GLFE 2Z2KA 1Y4ZA 3W8RA 4BXOB 3IUBA 1R0RE 1K97A 1GYPA 1L1EA 2IK8A 1Q1AA 1W94A 3KSMA 2J9GA 5BN5A 1NQXA 2CLLB 2P27A 1RXEA 2JLXA 1EESA 5G1OA 1P9RA 1YOVB 4MUGA 1VG1A 5JMWA 4IDQA 2PSDA 4FILA 4NX2A 4B80A 1F0YA 3RSLA 3UHPA 4BLPA 2A9QA 2TRSB 1SO8A 1TZ2A 4DRYA 2C4HA 2NP7A 3HMQA 4MRAA 2O3QA 4Q3BA 4WX2B 1V5FA 1Q7GA 1TYAE 1SIWA 2WWHA 3PNQA 1ZGGA 4YNBA 2XF2A 4NYMQ 5FOQA 1OILA 1XZMA 1JDPA 2FSVC 2AI3A 3GPPA 2I2AA 1W4ZA 3G8YA 4AF6A 5F9FA 2H63A 1KERA 2FEPA 3IOBA 1E1CA 1X70A 1NI4A 2IP4A 1ZMWA 1X1RA 2DTDA 2LCQA 4FFSA 4OH1A 2QU7A 1YZFA 3H19A 3N7UA 4KMSA 5ER6A 4M1WA 4RDXA 4LFAB 4UQLA 4RSRA 1T13A 4N5LA 4E2ZA 5IUJC 4IVRA 2BW0A 4YPFA 2QLFA 2IYVA 1KQNA 2UKDA 3UK2A 3VKUA 4PF1A 3FWZA 4OVZA 3MWDB 4W5JA 1R0WA 2P9TA 3KAKA 3EVTA 5EWLA 2QT1A 4JYMA 3MUFA 1LDYA 4YP1A 3GRYA 1N36B 5KU7A 2FPXA 4YRBA 4HXFB 1QZZA 4HQFA 2C7GA 4I4NA 4OSOA 4GQAA 3GPLA 3ZJYA 3BAZA 3WMEA 1BU5A 3SXJA 4J91A 1KO5A 3D7RA 2XA9A 3L9WA 2PRSA 2JLZA 2NX2A 2OGTA 3KSBC 3MQ4A 5DYIA 1U81A 3QY9A 3WZLA 3CZ9A 3NIDB 2G1UA 4JLPA 1OYWA 1KR5A 4O63O 4AF7A 2AZDA 3RC7A 5C7OO 1I7PA 1R6TA 1HKUA 3K5WA 2WJGA 5DLQC 4Q7EA 4DLVA 1K3XA 4TS9A 4CCYB 1YLAA 3B5JA 1WY7A 3UH1A 2X4LA 1ORHA 1MC5A 1NY6A 3M1LA 3QXCA 3QKTA 2CVOA 1I01A 3HP7A 4JKOA 4UULA 1WZUA 3LUGA 1OWOA 1CDEA 4DIKA 2CLMB 4Z4QA 1KZ6A 2HRQA 2RG1A 1UKYA 1GNVA 2WTMA 2YXEA 3EQ8A 5DTRA 2G76A 1ZGHA 1PCXA 5DB4A 3RVMA 3ZYCA 2DM6A 4WLOA 3Q3CA 4EMTA 4XWKA 1OC2A 3TYXA 1ARZA 3D2LA 2JLSA 2P11A 3E1KA 5A02A 2OG1A 3FE3A 1QIIA 3GRRA 5G0UA 4CKXA 5U1PA 2HK8A 3FDIA 3TFWA 3MHTA 5C1OA 1XKLA 2BMEA 4FDUA 1UJMA 3KKMA 4CCYA 2C4UA 2NAFA 3IUSA 4GNKA 1I4TD 4LX0A 3SLKA 1JGTA 1Y1QA 1DC8A 3OURA 3HL0A 2GNPA 1C0LA 3AUAA 4YQFA 3ECAA 1BS9A 1UDCA 1LI4A 1WRBA 4WY5A 4I9HA 1JLSA 4G4QA 4MWTA 3W5CA 1VMEA 3VTAA 1NFFA 5T8KA 1CJSA 1JB9A 2QLLA 2OZVA 5JLAA 2O7QA 3VC7A 2AVDA 4QO7A 2D0OB 1EHIA 4CM6A 3GLQA 4Z1MA 4JJ7A 1KTVA 1K82A 4IG9A 4I14A 1I6MA 3G5UA 1H22A 2K6GA 4O4JA 1N6PA 2FA9A 2R6JA 4GKKB 4H7KA 5CJ2A 3RC8A 4TS1A 3MCZA 4C0XA 1TJ4A 4ZD6A 1CLUA 2ZBDA 4I1OA 4FZVA 4WLUA 5GAJA 1LK0A 3WMWA 3H6GA 4DQVA 1TZCA 2IJGX 2JGRA 4U4AA 1F51E 2JAXA 3L0SA 4LDZA 4PGMA 1E3EA 5DBFA 4EOGA 1GNQA 3IUPA 2F48A 5EXPA 2WE8A 3IQEA 1RWNA 5EE1A 3TEFA 4R9SA 4EFMA 2AYZA 1WG8A 2I66A 4ZOBA 4JT8A 2VRBA 5EWMB 3L82B 2Q7OE 3HDTA 5JAZA 4IAOA 4V2IA 4YAGA 2V1CA 4YP6A 4CIAA 3SQDA 3ISTA 3ZVRA 1E9AA 4Q3AA 4U7GA 1Z15A 1P0MA 2MCFA 4DM4A 1U4NA 1IN4A 3FI9A 2JCSA 3MK6A 3FNGA 3SMQA 1Q11A 2J1LA 5CBKA 3O8CA 2XCTB 3HCEA 1L4UA 4JL6A 1RAAA 3SYLA 5IAEA 2H5LA 5EQFA 3LOQA 2O8FB 1LTKA 3VPFA 1R0SA 4YRQA 3G5MA 3I9KA 1Z13A 1PI3A 1DI0A 3DA8A 4F3YA 3QEJA 1C7QA 1QGZA 1WPXA 3I0ZA 5EWMA 2FFJA 2AX4A 4E1AA 1YJXA 3BRWD 2XKJE 1JHRA 4CLOB 5L4SA 5TS2A 2A0WA 1LLQA 2AR9A 4HRAA 4KZPA 2RHGB 4PFKA 5SICE 4C89A 1QYWA 5IZCA 3UJNA 1HTWA 3CX4A 1GGJA 5CM8B 1QCYA 3OFKA 3SLGA 2O8FA 2VVTA 2H31A 1JA0A 2WJPA 4ETIA 3HHZA 1WZNA 2UU9B 2ZSAA 1BXGB 3SHOA 1UF9A 4UFPA 3IQHX 3DE6X 2HBYA 4MUFA 5BMOA 3IEVA 4BNZA 1SBIA 4OF4A 1VZ2A 2VEOA 1PJCA 2OR3A 3W8DA 3JTMA 4IHAA 4GIBA 1VQ1A