1G3IA

Crystal structure of the hsluv protease-chaperone complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
443
structure length
326
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVDSIIRDLTDSAMKLVRQQEIAKNRIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/hydrolase
molecule keywords ATP-DEPENDENT HSLU PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Crystal and solution structures of an HslUV protease-chaperone complex.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 103
structure length 326
sequence length 443
chains with identical sequence B, C, D, E, F, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g3iA02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g3iA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3iA01
4UN2B 1AIPA 1YKSA 1E2NA 3NEYA 5E7JA 1N6OA 3TAUA 1DAIA 1ZUHA 2J41A 4P33A 2RHMA 2X2FA 3EAQA 3OE7D 2WWYA 3SOPA 2FPMA 4PR0A 5FBQB 4AIIA 5AJWA 3U60B 1MOZA 1W2HA 1WDTA 1WXQA 1XF9A 2ZRHA 2A9KA 3GQBA 5FPYA 5IK2A 2DB3A 2NZJA 4XH9B 1AKYA 4FW9A 2GF0A 1IY2A 3UWOA 4Z1MD 1TQ6A 2Z4SA 2ZI9A 4BFWA 721PA 4BWYA 3B9QA 1Z6XA 2CE2X 5LB2A 4TYYA 3HR8A 4EFNA 5KOYA 2YWFA 2WKQA 3CR8A 2QL6A 2ZJBA 5DI9A 4NU0A 1P5ZB 4HI0E 1PVOA 3GLHA 1N5LA 1D5CA 2DY1A 1RE0A 1IY0A 1TUIA 4TZ0A 4JLMA 1NY5A 1G41A 1Q12A 1EX7A 1N5KA 4DSOA 2IF2A 2JJ8A 2N1BA 3PENA 5HKKD 5JJKA 1GUAA 3SYLA 2ZI5A 4B48A 4QKQA 1TTTA 1E79A 2OE2A 4YXWA 3BRWD 3FHOA 3GJ3A 1XTSA 5AJZA 1TF7A 3W8RA 4MKGA 1A82A 2AWOA 2JZ0A 3KQKA 2P6RA 3SNHA 4P4TA 621PA 1RFLA 4JN6A 4AKGA 4ZKEA 4HAVA 4TL9A 4ACBA 3F92A 5GJBA 1G8FA 4BFTA 2R6GA 3EIHA 4QNRA 3KXLA 3K0AB 1YZGA 5JS8A 3S1AA 2ZRNA 3EC1A 2C96A 3CNNA 5FI0B 2Q9CA 4MYHA 3SHWA 2W0MA 2JJ2A 1ZCBA 4B3XA 2UZIR 2F1IA 1D9XA 4LCBA 1MR3F 4GPTA 1E2IA 1KO7A 1KJYA 2L0XA 4GBMA 3WBJA 2B7CA 1NN0A 4PC6A 3H1TA 4PPGA 1E9RA 5G41A 4URUR 3C5HA 3BFVA 1G16A 2WJYA 1AM4D 4Q9HA 3RS4A 3TR5A 2JLXA 1P2TA 1G7CA 1XMVA 3VR3A 1P2SA 4B76A 2QBYA 2FSFA 4TL7A 1OT3A 4BLQA 1KI9A 4GOKA 3RS5A 3W3ZB 1KK3A 1YLAA 1HEIA 4EPRA 1NN1A 2MJ5B 2OXRA 4GL2A 3NIBA 4N3NA 4PHTA 3UIEA 2LVQD 1OYWA 2G0TA 4BZXA 1S3GA 1VYTA 2YOHA 2ZI3A 3FYHA 3R9IA 5CLQA 3W5IA 2BMFA 3DZDA 1T0HB 4ASUA 1C7YA 2JA1A 3TAHA 3MJHA 3BXZA 4G3OA 1BO6A 5TMPA 1JAHA 3TSOA 1SKQA 1X86B 3A4NA 2W6JD 1L7VC 1KI6B 1M2OB 2VF8A 4HDOB 3LY5A 2C9CA 2IA5A 3ZJYA 1VCIA 2CK3A 1JPJA 2DI0A 2VP5A 1ZNWA 4BZPA 4D4KA 1FX0A 4C0BA 4D0NA 2O8DB 1H8HA 1HQYE 2R6DA 4RSGA 1ZD8A 1UKVY 3SI7A 2R0IA 3T1TA 2ZAOA 3I8SA 2QY9A 2A7QA 4GZLA 5J40A 3BC1A 2R65A 2ZEJA 3HYRA 1FUUA 3WP1B 2VA8A 5KNBA 2AXNA 5IDVA 5J47A 3KKQA 1GKIA 3CIOA 2QAGA 2A5YB 5E7MA 4H9GA 4TWZA 2WJJA 3WYGA 2CHQA 3I73A 1VIYA 1ZUNB 2E9SA 4MQBA 3OIYA 3E2IA 3K0FB 2HLDD 4PQYA 5B57C 2G6BA 3I5XA 1N25A 2KRKA 1E9EA 4GMDA 4ZPXA 2BKUA 3FKSA 2FWRA 1CTQA 2VHJA 3TR0A 3LBNA 3EX7C 3R9XA 3N2EA 2YYZA 3LA6A 5DIFA 5JJIA 2DAGA 4QFMA 5TXGA 1EESA 1DO2A 2CHVA 1G3QA 4QGAA 1MKYA 4W7SA 2R2AA 1LB1B 3A1SA 1WE2A 3GEEA 1P4SA 5IK2D 2Q21A 3U5ZB 1SVMA 4U02A 4NCHA 2GAAA 2V1UA 1T3SA 4M1SA 4DSUA 3AVYA 1U0JA 2DAKA 1JQJC 2D2EA 2FFBA 1RRCA 4MDFA 1WF3A 4KLNA 2I4IA 3GCGA 4G0NA 3ZLJA 2Z83A 2DNAA 3PQCA 4IVQA 4DLSA 3REGA 3FHCB 1Q0UA 1XTIA 3QY0A 4PX9A 3ICQB 2CLCX 4RD2A 3CRRA 2G9NA 1G6HA 2PJZA 4KBGA 4PC3A 1F5NA 2FH5B 3AF2A 1R0YA 1VG1A 4LOAA 2QPAA 3GJ4A 1QHNA 1E79D 3VNVA 2AN9A 4NYIR 4V0KA 2MMCA 1N6LA 4EPTA 3E21A 2DWQA 2QI9C 1MO4A 1Z08A 2QN6A 3LRPA 3Q85A 4JLJA 2OLKA 2HV8A 2UVQA 1Z28A 2D7DA 3CRW1 1W44A 1YZQA 5GVRA 4F38A 1UBGA 3V4RA 1CU1A 4IOLA 4W5JA 4C7OB 3IPXA 2N46A 3NDPA 3W6NA 4BFUA 1RKBA 3LD9A 3QG5A 1OB2A 4EAQA 1XD8A 2ZR7A 3HU2A 2LBCA 1JPNA 3T12A 5FTKA 2ZRPA 4DRZA 1GNQA 1PUIA 4HZIA 1G21E 1FUKA 2J0SA 1ZRHA 2D62A 2WWGA 4B3DA 4K81B 1T5IA 2PCLA 3EA0A 4HAXA 4DSNA 1KSFX 1OXUA 1RVDA 2FZLA 2J45A 2O0HA 2WAXA 3HU1A 3A1WA 1D2NA 4BLRA 4EFMA 1DAMA 1OH6A 1XMIA 4B75A 2ORIA 4HATA 4TSFA 1A7JA 3BIFA 4DJTA 1NVUQ 3B1ZA 2J5XA 2BBTA 1I4DD 3ZVRA 4FMBB 1WQ1R 1E2KA 3A1UA 2GILA 4BFZA 5DISB 4ESVA 4F4CA 4IDPA 3QIAA 1Y8GA 1YR6A 4NZYA 3B1WA 3KTAA 4PFSA 4BGDA 4P31A 1U9IC 4BLSA 1ZD1A 4LJ7A 1OJLA 2GWHA 1QG2A 3QNUA 4KU4A 4RFSA 3CW2A 4Z8XA 1VPLA 1L4YA 3PUZA 3QVUA 1XXHB 2BKEA 3SU8A 4B2LA 4Q4AA 4JSTA 2ATXA 1GRNA 2IXFA 5KO2A 3ZYCA 3FMIA 4WW0A 2F1HA 4YMWA 2EFEB 1HE1C 3TQCA 4E22A 2EVWX 4JLNA 1S96A 1Z0DA 1KDTA 4LPSA 2CK3D 2XOKA 1G1MA 1XBTA 2YOFA 5M04A 1AJEA 4A82A 3CPEA 2MSDB 2P6UA 4CVNA 5F3WB 1E0KA 2OFWA 3THOA 3SQXA 3NVAA 2O0JA 3QG1A 4Q66C 5SZIA 3QKTA 1XU4A 3DEFA 3VR6A 5AUQA 2ZSEA 3U44B 2ZR0A 5EZ5A 3TVDA 1OKKA 1G5RA 2DENA 1Z29A 2DR3A 1QVRA 3SC3A 3SFVA 3LH5A 3T1QA 4UKDA 1XPUA 3H86A 2VO1A 5D3MB 1UKYA 4GNKA 3FKSD 3FFBA 4IHQA 3NH9A 5CLLA 4LX0A 3WYFA 5FL3A 3EW9A 3K0CC 3BAFA 4A36A 1SZPA 2BEJA 2GAOA 121PA 3DHWC 1JEEA 4KYUA 2O8BA 3UG6A 4B71A 1L8QA 5FTJA 1ZD9A 3PUWA 4OBEA 1A2BA 2ZE8A 2IXEA 3NEJA 4HLQB 2H16A 3ZS9A 1LY1A 3B5JA 1FFHA 5EE1A 2A5DA 4EPXA 3CO5A 3CR7A 3SBEA 1N6IA 5KYKA 2PX0A 2G83A 2W6IA 4TMTA 3PITA 4D4LA 4DUGA 1CJUC 2Q3FA 4BFSA 4FWGA 4KV9A 2QM7A 4LWZA 4M1MA 4DEYA 1CBUA 3BOSA 3RVBA 1OYYA 2G88A 4NMMA 5JEDA 3OAAA 2PEYA 2ZSAA 4DDWA 2DBYA 2JASA 4Q1AA 2JAQA 2ZSFA 2P67A 2B8WA 2UZ3A 2TMKA 4DDVA 4EPYA 1QHHA 3GJ7A 4US2R 2SHKA 3NHAA 3EIQA 4HAWA 1OXVA 1MABB 1XEWX 3CH4B 3GLFA 3K09C 4NTZA 4ACAA 1W36C 1TR8A 1KY3A 3CRQA 4OK5A 4UXJA 1G64A 1XWIA 5E7IA 4UNPA 3O47A 2QMUA 3NKVA 2O25A 1OIWA 1IXZA 3H0KA 1M74A 1KMHA 3MWLA 2R8RA 1YJ5A 2L2DA 5DN6A 5H68A 3UMRA 1Z6YA 1A5TA 4ERNA 1JXMA 1YHNA 2YC4C 4H1VA 1NVVQ 3L0IB 2V4ZA 1KO8A 2J9RA 1FPMA 4KLZA 2JGNA 3T15A 2HJGA 2XTNA 5J4VA 5JWHA 1E1RA 5JHGB 1XJCA 4HB2A 2QSFX 4QM7A 1OV4A 1RZ3A 3AVOA 3ADCA 1OFHA 4TSFD 1KZ7B 1FQKA 2ZANA 3VFDA 4Q02A 1UEJA 2DWOA 2EFHB 2QQ0A 1R5BA 4V0LA 4M1OA 1OFTA 2IEYA 2IS2A 5HCNA 1OKSA 3QF7A 4WA7A 3HU3A 4F4JA 2XTMA 4ON9A 1N3BA 4EQ6B 4IEEA 3AVVA 4WZBE 4Q4JB 2V6IA 5EJEA 1OQYA 4V03A 4F7WA 4HB0A 4I99A 3SYKA 4HDQB 2J59A 3PR1A 1VG5A 1XJ0A 1E0SA 2ZE5A 2L4EA 1CIPA 4C0KA 3TW4A 4TYWA 2QQEA 4CGZA 4BLOA 4V0ME 4IDNA 4TMWA 5FH9A 4DCNA 1AK2A 4AYTA 2DZOB 2QORA 1NP6A 4BFVA 3HR7A 821PA 2XOKD 1ZC3A 4LYAA 1XEXB 2C03A 5FUXA 2OZEA 1XD2B 2VP0A 3BB1A 4GSYA 4XJXA 3AM1A 1KO5A 3SN6A 4B2IA 1RYHA 5G40A 3IHWA 1OXXK 1E2FA 3FOZA 5G53C 4BQSA 3VLFB 1S1CA 1BH2A 2OSBA 3O8RA 3R8CA 2FG5A 3X2SA 2VRWA 2QP9X 2YWGA 1T6NA 2ZROA 3LNCA 4ZDKA 1OTRA 3U7EB 4TLAA 2V3CC 2BM0A 1EFTA 3OESA 1O87A 1YRBA 1QVAA 1X8LA 1G4AE 4A0FA 2QTFA 3VKGA 2PMKA 2GXQA 4FMCB 1G3MA 4YC7A 4ABYA 3PJRA 3E5HA 3RHFA 2YVUA 4M9SA 3Q5EA 3LQRA 1LS1A 3KXKA 1CRPA 3KJHA 5JSZA 3RRNA 4C0JA 1VG0B 4TL6A 2EKKA 3LFUA 4M53A 1JR6A 2B3TA 3MGCA 4GRAA 1RJ9A 3DKPA 1VCMA 4M1YA 1EFUA 1I4TD 2IS1A 4W5HA 4JVNA 4LJAA 3FMOB 3OEEA 5JI3E 1PLJA 2DPXA 1U9IA 4QXAA 1ZW6A 3MCAA 2BOVA 2H7VA 4AG6A 3GJ8A 1XFAA 3AF3A 1TU4A 1YR9A 1N0WA 2W6ID 3L0PA 4MITA 3QXXA 2HYDA 4JLDA 1UAAA 3TVTA 5DI3A 4FN5A 3RRZA 4TLDA 5FR1A 2BC9A 2WOOA 1Z2CA 4HLDA 3CF2A 4RY2A 5IHPA 1E9BA 1IM2A 3OAAD 2FFQA 2V1XA 3OIVA 1VIAA 2O52A 1AGRA 2EW1A 3JVUA 2JY8A 3U6BA 1NY6A 2BMJA 2ZJ2A 4GZMA 3ADBA 5ANRB 4B3FX 2WSMA 1G18A 2XB2A 3X1WA 4Z1MA 4NYJR 3VR2A 4JVLA 1MN3A 3SE0A 4XWOA 3QBTA 4PZZA 4V0MA 1ZCAA 2OLJA 4JLPA 1K5GA 3LCUA 1OFIA 1JJ7A 2FFHA 4LBWA 3GLGB 2J0UA 3DKVA 3AVWA 1AS2A 3KQLA 4RCYA 1EFRA 1AN0A 3THYA 2IYUA 2KB0A 3QF4A 2XNDA 4CT5A 3EZ2A 2V6JA 3EASA 5DN6D 3K0CA 4PQFA 3KUCA 1WB9A 3T5GA 2NQ2C 4CT4B 3VHLB 2ONJA 2VP2A 1GTVA 1ZYUA 1XCGB 2WBLC 3I4LA 2J7PD 2QMHA 3B9PA 1M7BA 1F3OA 1ZMUA 1MO6A 1QHGA 3N5CA 1IAQA 4MGYR 5KSYA 2P2LA 3L82B 1E1RD 1BMFD 1QHIA 3VU9A 2QA5A 4G5QA 4JBYA 2GJ9A 4QL3A 5DGXA 3REFA 2GEUA 4O2RA 5L3RA 2WKPA 1LF0A 4JJKA 5J4LA 3LXXA 1DG3A 3MSXA 1FTNA 4DB2A 1F2TB 1QDEA 5AJYA 4LRTA 3GFTA 3P4YA 3FMFA 1VKJA 2X1VA 4LHZA 1QBKC 3OHMA 3X1ZA 4J0QA 1N5IA 4OJKA 5G3ZA 1TQDA 4Q4HB 4CEJA 1NMXA 2QM8A 1F2UA 2Q3HA 2ZRCA 3WP0A 2QNRA 3ZD7A 1GAJA 5D3QA 1HE8B 5GJVC 1HJPA 4PHFA 3O8DA 4XD7D 4DDUA 1SG9A 5F2EA 3K09A 4Y0AA 4ZDJA 1TEXA 4F91B 1W4RA 3OZXA 2VSOA 2DKLA 3DOEA 1A1VA 1G3RA 4Q4LA 3CONA 4ITRC 4PSKA 4NCIA 3VKHA 1T43A 3B82A 1HTWA 2HYIC 4MKHA 2ZSDA 2CLDX 3NTUA 3U3RA 1GL9B 2Q6TA 5EP4A 2ODBA 2KE5A 3ZZTA 2QSZA 2GEVA 4KITB 2FFAA 1BKDR 3P4XA 1JB1A 2BJVA 1FP7A 5KSOA 3X1DA 1KDOA 4Q9IA 2WAYA 1DPFA 2VLIA 2GESA 1ZJ6A 3KQHA 1NVMA 3I5YA 1GOTA 2VSFA 1J99A 1E94E 2O8CA 3IBGA 1XTJA 3L0OA 4TN1A 2CLSA 2WPDA 3RANA 2IW3A 2P0EA 1A4RA 5GJWC 2IUSA 1ZNXA 2QTVB 3LWNA 1XEFA 2X19A 4HZUA 1OHHA 3EZ6A 4NKRA 2IYLD 1R0ZA 3P27A 4EKDA 2I1QA 3OEED 5LD2C 5FTNA 1QRAA 1CR0A 5EQTA 4Q19A 2NMVA 3B89A 3FKQA 4B2PA 3A1TA 4NCNA 1Y63A 1TQ4A 2CL0X 4OHYA 4Q1EA 3W34A 4TQAA 2V55B 5CM9C 4MGZR 5FOXA 1ZM7A 1CKEA 1YR7A 1AKEA 4Q7JB 3K9HA 3K70B 4FWTA 1XB2B 2ZTCA 2CWBA 1E2MA 3QKSB 2DAIA 4LZZA 4RD1A 1K8RA 1NV8A 4HUQB 4KFSA 2MSCB 2PX3A 3L8YA 1K5DA 4B43A 3SDZA 4UNQA 3AKCA 1II0A 1XTRA 3B7GA 3GEIA 3RSOA 3PV0A 3RLFA 5HE9A 3NDBB 1XJQA 3IIKA 3IHLA 2Q3MA 2XZPA 2ZUBA 4M9QA 3F3YA 4EJSB 1N6NA 1DV0A 1AQUA 2YWHA 1VEGA 1IFYA 4D82A 4I1VA 1KDPA 4JSYA 4IFEA 3MWJA 2GTPA 1EFRD 1W0KA 1Q1ZA 1AZTA 2XNDD 2JLUA 3GPLA 4NH0A 5SZJA 1SGWA 3E70C 3AKYA 1DADA 2J87A 1I4LD 1R8SA 2CVHA 4PPFA 4PQRA 2DZNB 4NE2A 2NG1A 1R5NA 3B13B 3LX5A 1PLLA 2RCNA 1T3HA 2NPIA 4QBGB 2C5LA 3CNLA 5TARA 5HZKA 3ECCA 1UKEA 1ZP6A 2ZR9A 3RS2A 4LY6A 1GP2A 2NZ8A 1OFUX 3PEYA 1OF1A 1WIVA 3WXMA 2O8FA 1EX6A 2ANBA 3BB3A 3QEJA 3QKUA 4JKIA 2QT1A 3EPJA 2FE4A 5AUOB 1F4IA 1FOEB 1VCOA 3PEVA 2GK6A 4IRUB 2IYYA 1M6NA 2OCBA 3RS0A 3GLIB 2GCOB 3AVPA 1IXSA 1FNMA 1QHYA 2AD5A 1ZNYA 2NTYC 4II7A 3RS3A 2QMEA 5JRZA 4FXPA 4DC9A 1AA9A 2EYQA 2DHYA 1XTKA 3B1YA 2W0SA 4G01B 3QXSA 3LV8A 1DEKA 3U7FB 1Q57A 4PANA 4TTPA 1KI1A 1M7GA 1U81A 1E99A 2BMDA 3UANA 1IJEA 4TMKA 1NF3A 1S0UA 3LO5A 2DYKA 1KAOA 4TQ9A 4DXAA 1W36D 4KSCA 3M6AA 3C8UA 1VMAA 1WHCA 2ODNA 2ORVA 2FEOA 2ZRBA 3BGWA 1SXJC 1TF2A 2C2HA 2F43B 3DMNA 2CJWB 2KBEA 4CEIA 2CL7X 3CB4A 2OCAA 2ZU6A 3IKJA 2Z6VA 3T06B 2WJIA 2DWZB 3NC0C 1R0XA 4A8JB 3AGPA 1WR1B 2FV8A 5FL7A 1GILA 5L3SA 2HCJB 3GJXC 2NO1A 1HT1E 5BN3A 3JZMA 2JY6B 4IOKA 4Q7MB 1E9CA 2QSYA 3GD7A 1ODFA 4Q48A 1F6BA 3LVRE 2BDTA 2W83A 4IVRA 2NIPA 3ONWA 4PSVA 2WJVA 5TV2A 2WPDD 3UXMA 4A3VB 4B44A 1RYFA 2GNOA 4OK6A 4KHZA 2AFHE 4UJ3A 5JHHB 1NJFA 1OHHD 1EK0A 4KXFB 1NBME 1PZNA 4RZ2A 4OL0A 4B32A 2AK2A 3CH5A 4CW7A 1CJVC 1YQTA 3D3QA 3AUYA 1QHXA 3UATA 3IUYA 2PZGA 4C9BA 3OFND 2HUPA 2FF7A 5KTYA 3BBPA 3RC8A 3TSZA 4AC9A 1MH1A 3LBHA 1P61B 5TDHA 2ZPTX 2G3YA 1R7RA 4PSAA 5JRJA 1NSTA 4B74A 3AEZA 3VAAA 1E3MA 1S4QA 2ODWA 3U3JA 2W2XA 2GZDA 3U3OA 3RAPR 4WXRA 4PHGA 1ZU5A 3SR0A 3T5DA 1RPZA 3AUXA 2VHUA 3AF0A 4B33A 4HAYA 2IYRA 4D80A 3H84A 5C2JB 3LXRA 1VYUA 2WWWA 5K8TA 1XD9A 4NYMR 2BWEA 3KDSE 1NVVR 4QM6A 2EFDB 3CX6A 1W0KD 2LVOC 2DCUA 3WRXC 1GL7A 4B3CA 4HUTA 1I2MA 1SQ5A 1U8AA 1U8ZA 3ADKA 3A4MA 3B85A 3CLVA 3Q9LA 4QJ3A 4O0MA 4L9SA 1UBEA 4ZIRB 1R0WA 3B2EA 4YMVA 2ZUCA 1KIMA 2EJSA 2LTUA 2GJAA 4TL8A 3D8BA 3U4QA 3MMPA 4TLEA 1OPXA 5H70A 2XSZD 3L8ZA 3EPKA 4HLCA 5CDFE 4B6FA 3R7WB 3HPQA 5GVSA 3I62A 4FI3C 3THXB 1V43A 3IO5A 4DLUA 4IOJA 5KDLA 1P7CA 1OIXA 3NBFA 4O2LA 3VTKA 4DLTA 1IN8A 4DSTA 4BPBA 4MKIA 5IRCD 4QJ5A 2EFCB 2O8EA 5FPTA 1EWRA 1SXJE 4RFVA 4DT1A 1OE0A 2BJWA 3CZQA 4DHEA 1GSIA 4BRUA 1NBMA 2K5UA 2NO7A 4MA4A 1YU9A 2Q9AA 1CJKC 3PEWA 3BH6A 4YMSA 2DFLA 1FZQA 1SHZA 3KKOA 4AYWA 4AY2A 2QU8A 2ZJOA 5JS7A 4HLUC 3CX7A 5EE3A 2BHRA 3ZH9B 2P6NA 1NLZA 4ARZB 3CUEF 4AK9A 5FOWA 2O0KA 5JCPA 2WIAA 3ZVNA 3VNUA 1G5PA 5CB6A 1N6RA 3MHVC 4GI7A 3ADDA 4DBGB 4MH0R 1P9NA 1RRPA 3UMFA 2BBSA 5FL7D 2JY7A 3NBYC 5KPDA 1GITA 2H18A 1Q20A 4MUAA 2DVWB 2GDJA 2REBA 2A5JA 1CRQA 1Q1BA 1E0JA 2J3EA 4RD4A 1OB5A 3BFXA 3BFKA 1U98A 4XWAA 4CEHB 4HYYA 2G3QA 5BWMA 1NRJB 1US8B 2WMOB 1R10A 4ZCIA 2REOA 2IYXA 5JECA 4LHVA 1ONBA 5A5GA 3DOFA 2BCGY 2WOJA 2VYFA 5L3QB 3AVTA 2XJ4A 1CEEA 3KB2A 1AGPA 4URVR 1LNZA 1T6OA 1XZQA 5FPHA 1J8MF 4BUJA 3MD0A 4PC1A 4QG7A 4Z54A 4QGGA 4B3GA 1AS3A 1P6XA 3FRIA 1M1YE 1PJRA 1UJ2A 2IF0A 3AGQA 1UEIA 1H8EA 1CR4A 1DELA 4F1IA 4BE7B 4IFBA 1W4AA 1QG4A 2JCSA 3ASYA 3AVQA 1TF5A 4AURA 1N0VC 2ZRJA 5CDFA 3PUVA 2JLRA 4KVGA 2J46A 4A6XA 4US0R 1OLOA 1G4UR 2AHOA 5A4JA 3AVXA 2HDNB 3LQQA 1BOFA 1SVWA 2ERXA 2PL3A 4IKEA 4P4SA 421PA 3B1XA 1EGAA 2GJ8A 2JP7A 1SXJA 1P9WA 4HAZA 4JT2A 1W49A 2ZS9A 4DIEA 1WGLA 1OXSC 3VMFA 4OYHA 1G7SA 3X1YA 3BH0A 3PUYA 2VPPA 1YZTA 4HSEA 3Q7PA 1G291 3VR1A 4RD3A 5FBWB 5CB8A 1PLKA 4DCTA 2NO0A 1E9DA 2ZI7A 1TU3A 4MRPA 4FMCF 4M22A 1R6BX 4LHYA 2C8VA 2CCGA 3CPHA 2YKGA 3AKEA 4M1TA 2WJHA 4BLTA 4QBHA 2ASEA 2PT7A 1NMZA 2IYQA 1D2MA 3O8BA 4A4DA 3LW8A 4WP2A 1NN5A 2WZQA 1BVSA 1U2RA 1VDZA 1WA5A 1YR8A 1KNQA 2FJUA 2FPLA 2GZHA 2IYVA 1XRJA 4L4UA 2YJTD 2ZS8A 2ZYVX 4LGMA 4DCUA 3PG5A 4OI0A 2RGXA 2MGWA 1Z6GA 4URYR 5CITA 4FWHA 1C1KA 2ZRMA 1G7RA 1KI8A 3I32A 3KFVA 4KFUA 3VX4A 1U94A 2H8KA 4PC2A 3ZD6A 4DEXA 221PA 3U7HB 1IN5A 2ERYA 4LHWA 5FBVB 4JKYA 2B21A 1YE8A 1SKYB 2BIFA 2IEZA 4Q9LA 4O25A 2DZLA 1D9ZA 4KI0A 4BEBA 4KBFA 5EP1A 4R2IA 3VQTA 4B34A 1NBMD 2NO9A 4LYFA 1E2EA 1VECA 2ZE6A 3KKNA 4HB3A 1CXZA 1NG1A 1E2DA 4LHXA 2GXAA 3IEVA 2WJGA 2XAUA 3CKLA 2PMDA 2J7PA 4S2EA 4M1WA 1T8UA 3GLHB 1CULC 2A5GA 1CJMA 2XGJA 4H1UA 3E46A 4RZ3A 1RC8A 1UM8A 3K0AA 3CWZA 1BMFA 4LV8B 2F6RA 4TMXA 4ZKDA 1COWD 3C7KA 3IDQA 1W4BA 4A15A 3WNBA 3FGNA 4CDGA 2FDCA 2DFKB 4LJYA 1G6OA 5TB5A 3B60A 1WP9A 3Q8XB 3RNLA 1NG9A 4U00A 4UJ5A 4WIAA 2JLWA 3WMGA 1EWQA 4L15A 5L8VA 3FE3A 5UKDA 5KHOC 2JJ1D 3AF1A 5B30A 4EFLA 1WBBA 2GETA 4M0LA 2OILA 2KWIA 3MAAC 1Q02A 1KJWA 5EP2A 4JVSB 1Z07A 3KFXA 1W4CA 1KYIA 1N5JA 2XNSA 3W3AA 1QZXA 4U7DA 5FTMA 4QGHA 1M8PA 4OHXA 2V6ZM 3VR4A 3WNCA 1ZMVA 1UFQA 4R98A 4XD7A 3EIEA 2ZITA 5SZHB 3S1AB 1ZIOA 4KVAA 2H92A 2WWXA 1IQPA 4OQLA 2ZYTX 3EARA 2CEAA 4A0GA 4LJ4A 4Q01A 2RRUA 3SZRA 4TMVA 2D7CA 2FSGA 4BASA 1KHTA 2XZLA 1SULA 1W0JA 2IWRA 4B3BA 4I1UA 4GOJA 5C46F 2LKCA 5CK5A 2IUUA 4KFRA 4P0TA 1KI6A 1H8ED 5J4KA 3R9WA 1XDBA 1FTSA 1UKZA 2O8DA 1IN7A 4XOIA 2EU8A 4G5GA 3WMEA 2QBYB 1KAGA 4XSHA 4C2UA 3LLMA 4HLUA 2XTZA 4HEOA 2P65A 3D6TB 2FU5C 2WICA 4JYBA 4RCZA 4K8OA 1XCPA 1SXJD 2Z43A 4F4IA 2IHBA 1E9AA 1Z0JA 3D31A 2QGNA 4MDEA 1ZVQA 1OW3B 1Z0KA 2D2FA 1QF9A 3EA5A 2AXPA 3K0FA 3OIWA 5FOUA 1RRGA 1XNJA 5FOTA 2RGEA 1CF4A 2OBNA 4MGIR 1Z22A 2ZIAA 4LK2A 3HDTA 4M2LA 3ZGXA 3HWSA 1FX0B 2ODEA 2C95A 4FINA 4TLBA 1DAGA 3ZDQA 3KQUA 1R8QA 1X3SA 3I72A 4OI4A 1U90A 1CJTC 3A6PC 1UDXA 5HE8A 3LCVB 1LS6A 1DO0A 1ZUIA 4DIDA 1XXHE 4MYCA 2A78A 4PAQA 4URWR 2IS4A 1XMSA 2VHCA 2QAGB 4Q1CA 2J0QA 5IF9A 2XITA 2XEXA 4K46A 3CF0A 3PVSA 5C18A 3K8YA 4IDQA 2KHHA 4QBIA 1W1WA 3SHFA 4DBLC 5JEEA 2OCPA 3EZFA 2XX3A 1VTKA 2OEPA 3V00A 4PAOA 4HB4A 1R4AA 1N6HA 4Z8YA 3TQFA 3AVUA 4KJZA 1PV4A 1KZGB 4W5WA 2MMGA 1HURA 1RRFA 3NWJA 1ELOA 3P32A 4IDOA 5DO9A 5KDOA 4AYXA 2JLVA 3ZVLA 4QC2A 2GXUA 2JATA 2YC2C 3VHXA 3WYAA 4GT1A 4BECA 5CIQA 4C7OA 1EXMA 1P3JA 2IYZA 4F92B 1GIAA 1W2GA 1TUEA 1X8KA 2H57A 4LBVA 2HCBA 4LV6A 2ZTDA 2GZAA 2GF9A 5EUQB 1M34E 4URZR 5JCZA 4U5XA 2LVPC 4Q03A 3BS4A 1T8TA 1ZM3A 4ZDWA 3U3MA 4YDHB 1UF9A 4G5OA 5KDDA 2ZTSA 1JXOA 2C99A 2GKSA 3JVVA 3U2QA 5LBIA 2WZJA 2A3RA 3SJBA 2A2ZA 1Q44A 3M0EA 1RIFA 3B78A 4F93B 3IGFA 2QRZA 2RKOA 1Q21A 3MUFA 4A9AA 1UADA 4KYIB 2RH5A 1EFHA 2OM2A 4PPNA 2XXAA 1G20E 4ESHA 1B0UA 1ZV1A 2XB4A 2YV5A 2G1JA 3MWKA 3RABA 4TT3A 4NBSA 2IYWA 3BE4A 1IXRC 5KUTA 3SYNA 2E1RA 5AJXA 4B6EA 2KJQA 1OIVA 1JAIA 3K9PA 4FD2A 3LLUA 4YDSA 2PH1A 2QP4A 2ZYWX 6Q21A 2K0BX 5EXSA 2FMXA 4IEIA 3MFYA 3TGPA 3C41J 1XXHA 2HEIA 2CMKA 2JDIA 1LW7A 1W0JD 1Z2AA 4FIDA 1NIPA 1Y3AA 4MRRA 2HXYA 2ZXUA 1S3SA 4BLPA 5K8UA 4QHYA 2GCNA 2CNWA 2X77A 5A0FA 2AD1A 3V4FA 1A2KC 1NNEA 4UNSA 4KSBA 2JLQA 1SKYE 5AUPB 3W6PA 2X2EA 2ZRKA 1KKLA 2ZRLA 3VR5A 3KJGA 3CWQA 4XIGS 1HT2E 1J70A 2VHTA 1P60A 2WMNB 1G9XA 3ZZ0A 1WBDA 1GDDA 2FX3A 4ZDIA 2FOLA 2P5SA 3RSLA 1IHUA 4JLVA 1OSNA 1Z8FA 3TKLA 4NPHA 4EPWA 3AF4A 3A37A 3KTAB 4JL8A 2PCJA 2JZ1A 1II8B 2JY5A 3RYTC 3U44A 2C9OA 1L4UA 4RFSB 5LPNA 1JI0A 1FNNA 2FN4A 5HR5A 4Q4AB 2KI5A 1GM5A 3Q5DA 5D3MA 1E4YA 1QZMA 4P4UA 3SEAA 3TRFA 4I1OA 4MRSA 1R4GA 1E32A 1G8GA 2D3WA 1X1RA 4R7ZA 3IECA 2FSHA 3DL0A 2HJVA 1KNXA 3AP3A 3FMPB 4DLXA 4CZ2A 3F8TA 3PIRA 1ZMWA 4FCVA 2PZFA 1F48A 1NMYA 1Q22A 3OFNA 4MRVA 1GFIA 5DSZA 2RGBA 2IHYA 1P62B 1S9HA 4OI1A 2F3TA 2IUTA 3PXGA 4LDJA 4AKHA 1T3LA 1DVRA 3T61A 2WV9A 4FCWA 1L2TA 1GRQA 4IDHA 1E6CA 2AKYA 4ZCLA 5EE9A 1MRSA 2L4FA 2DFTA 2ZUDA 5J5CA 2QE7A 3RC3A 4GMXA 4TTQA 4V02A 3IPYA 1DS6A 1E2GA 2ZRFA 1AZSC 4Q9JA 3T1VA 1UPTA 2PEZA 1LV7A 2LVAA 1KTVA 2J1LA 1T0JB 4N0DA 1KI4A 4C0SA 4E03A 4O3MA 2O8BB 3KB1A 1TEVA 2IL1A 1CR2A 2VBCA 2ZQ5A 3B6EA 2F9MA 3ETLA 4WBSA 3GP8A 2MR9A 1FL9A 1YRAA 3W9YA 3R8FA 3C14C 3UG7A 1MABA 2YINC 3QVVA 1V92A 4PTLA 3EPHA 4LC1A 3CX8A 3QUSA 5GJCA 3R20A 4DLRA 4Z51A 2GBLC 4FCTA 2LCFA 2V8OA 4BFYA 1JJVA 4IXMA 1S9DA 2ZSBA 3SJCA 1JALA 3BBZA 4D6PA 2R62A 5L3VA 1Z0AA 3KKPA 2RGNC 2IYSA 1XPRA 4WXPA 1T5LA 4NCJA 2XSZA 2H17A 1ZM4A 1WJ7A 2DAEA 4CRWB 4UNRA 3SBDA 4D4MA 2QENA 1AS0A 4TQUS 5EXTA 2A30A 3MLEA 1VEKA 1CR1A 2QGZA 1UBCA 1C1YA 1P2VA 3T35A 4JS0A 4NP6A 2KSQA 2WSSA 3FVQA 1JEDA 3P20A 1QHHB 1NVXQ 1G8YA 2OO9A 4QJ4A 1E0AA 2PT5A 4DLYA 4ZI3A 4B35A 5TVKA 2F7SA 3AV0B 2BCJQ 3MRSA 3GLFB 3G82C 3TUIC 5C1BA 4FMDB 3BERA 4AD8A 3MWYW 4OHZA 1JNYA 4TT3D 1G7TA 2FPKA 1OH8A 4UNNA 3I92A 3L43A 2KBFA 5AUNB 4V0NA 1KMHB 4EQ6A 4JJZA 2V54A 4Q4JA 1E98A 3WNDA 1E2QA 1QHSA 2I3BA 3AH8A 4EDHA 1TTEA 4G5SA 4XTRA 5FR2A 3TUJC 3EZ9A 1GNPA 2N42A 1E1QD 2BBWA 2D74A 1Z6TA 2JDID 2QROA 4NYJQ 1Z6AA 4WOPA 4X8HA 1X6VA 4F2LA 3HP1A 3UKDA 3BB4A 2EFGA 4DWJA 4D25A 3ICEA 4DZZA 1Q1QA 1KSHA 4QNMA 3K70C 1KKMA 1GRRA 4AWXA 2CNWD 5DYGA 4HAUA 5BN5A 3GLGE 1E9FA 1SVOA 1GVNB 1IONA 1XP8A 3ND8A 3I61A 1XEXA 1W7AA 1XD2A 1WMSA 2IYTA 3EPLA 2CVFA 4GFDA 3RRMA 3LDAA 3N2IA 1VG8A 4N1AA 1P73A 2OUKA 2B8TA 4M21A 1KO4A 1GWNA 4CYMA 4Q21A 1RW4A 4G3XA 5E4FA 3DPUA 1J90A 5JWOA 4JL5A 3EG5A 2C78A 4EJSC 2BV3A 2ZETA 3FPAA 4GITA 3AKDA 1HYQA 1D6JA 3FDIA 3OIUA 4OJQA 3BH7A 4Q47A 2JNHA 2QZ4A 3NXSA 3OEHA 2JIZD 2QRNA 4TYQA 5BYKA 5KSPA 1P2UA 2VHQA 2NPFA 4BEJA 5ELXA 2IS6A 3DM5A 3T6PA 3NG1A 4L8GA 3Q7QA 1E9SA 2FZ4A 4WAUA 1NJGA 5DHAA 4PAMA 4JMPA 2CCKA 1U0LA 3Q3JB 2P5TB 1DOAA 3PUXA 4RVCA 3PEUA 5FBRB 5HPYB 4M1KA 3NH6A 3UPUA 1KI2A 2VP4A 5EUMA 4LBZA 4LI0A 1FQJA 2CHGA 1NV9A 4R71A 2WVJA 2YNMA 2DHRA 2OV2A 3I3SR 2QE7D 2CXXA 3DZ8A 1X1SA 1ZNZA 5AK0A 1M7HA 2ZREA 2VQSA 3CM0A 4C2TA 5JSZB 2W2TA 2DWPA 1KGDA 5EP3A 2XZOA 4E09A 3LBIA 2OXCA 1Z83A 1MO3A 1DE0A 2ECKA 2LKDA 5JZVA 1RJ9B 2AKAB 2BMEA 4NHOA 4RJLA 2ATVA 1EFUB 2LWIA 1J8YF 5CJ2A 1Z06A 3UMSA 4KCGA 1F60A 1LF5A 1KSJA 3TJZA 3GJ5A 3RS7A 2JEOA 1SVSA 4FWDA 4DVGA 5DYIA 1W46A 1DAFA 3J81k 3GLGA 2GA8A 2KNAA 2ZI6A 4EUNA 1S8FA 2AWNA 5DI3B 3K0SA 1JR3E 5B64A 4YQFA 2R6FA 5BXQC 2GK7A 1KK0A 4LRSA 2QHOB 3ZS8A 4DDTA 5DH9A 2CBZA 4EIWA 4C0LA 1E2LA 2C98A 1CLUA 3FWYA 4A8JC 4DCVA 5JI2E 4JYCA 3THWB 5DFLA 2C77A 3CBQA 4AKIA 3MG9A 1CS4C 2WSSD 4P3YA 5CYOA 3QKRB 3UK6A 2V7QA 2BWBA 2CL6X 3DVLA 4C3ZA 5BW8A 1KI7A 3T1OA 1P75A 4TLCA 3IEUA 4LYHA 4X8MA 3P1JA 5DHFA 2VTKA 4GP6A 4MUBA 3WMFA 4CF7A 3FTQA 3PCRB 3IQXA 5FI1B 3MJRA 4AI6A 1K6MA 1FMLA 2HWJA 1F2TA 1JQLB 1Z0FA 4DCSA 4YXWD 1SVLA 3QPWA 2J0UB 4ILEA 4QOSA 1D8TA 2WWIA 3THYB 3CNOA 4JT4A 3QF4B 3W8NA 2ZI4A 2X8AA 4TYNA 1VHTA 1GZSA 2HF9A 3TNFA 4URXR 1NKSA 1COWA 3BJIC 4LBYA 1E2HA 4Q4HA 4Q1FA 2VSXA 4JLBA 3T34A 2VP9A 3FB4A 2AFIE 2G1KA 3KZ1E 2XXAB 4AKEA 2R6AA 1GKUB 2H5EA 3N70A 2OFOA 2IBMA 4C0QC 2ZRIA 3GJ6A 1U8YA 3VU9B 3AJIB 3HJNA 1VHLA 2W2VA 3NBXX 2JJ1A 4JLOA 2JJ2D 2ZYUX 3A8TA 3DM9B 3TMKA 2ZS7A 2GBLA 1X8JA 2V9PA 5H8WA 2GRJA 2QG6A 5F9FA 1HY3A 3BWDD 3F5FA 3K9GA 4GP7A 2BVNA 3O8CA 3CPJB 2RGNA 4OHVA 5P21A 2EYUA 2QEQA 1OH7A 1GL6A 4XWKA 4MKFA 2HAKA 1NKTA 4RD6A 2H1LA 1KI3A 4LJ5A 2YZ2A 4JLKA 4Q5IA 4WZAE 5EXPA 4NCKA 4X8LA 1Z63A 2G0NA 2RGDA 4P32A 4CEJB 5FPSA 3K9OA 1F2UB 1ZC4A 2BEKA 1VQ1A 2GJKA 2GVZC 4R9UC 4BZQA 3I8XA 1BIFA 3TW8B 2EQBA 1G5TA 3DO6A 3OEHD 1II8A 2AR7A 1DARA 2BBOA 3B1VA 4L5BA 3TUZC 1JR3A 1W36B 2ORWA 2JLYA 3GLIE 4PC7A 1W5SA 1H65A 1XPOA 2ZU0C 4DKXA 3ZZUA 4OQMA 2FGKA 1Q1EA 5FTLA 4ASUD 3GLFE 5CM8B 2FSIA 4HDCA 1XCMA 4LJ9A 1R2QA 3ND9A 2RGCA 3EWSA 2AX4A 3BD9A 2P3SA 1B23P 1MV5A 2ZAMA 4RZUA 4M9ZA 1Q3HA 1H8HD 3CRMA 3CZPA 3GFPA 1HUQA 4MRNA 3Q72A 4YONB 4Q7JA 2WHXA 1FMJA 1G19A 2B7BA 1X37A 2NO6A 2O8CB 1XB2A 3TBKA 3W90A 1MRNA 1KSGA 1W47A 4I4LA 3QKSA 1E4VA 1XX6A 2PLFA 1KK2A 3H2YA 4LRWA 4W9MC 1KJZA 1SVIA 3IQWA 4HUQA 4DLWA 3WBKA 4PHHA 2PJRA 2RAPA 3ZIAA 5EXXA 4QHSA 1ETUA 4NL4H 3WHKA 4HZUB 1G17A 1O3YA 2GEDA 3L2OB 3ZQ6A 1BS1A 2W58A 4JVMA 4Q7KA 5AJVB 5FUVA 2D4HA 2IXGA 3VX3A 2CP8A 1T9HA 3K9LA 3QI2A 1U0HC 1UBFA 4B47A 3TLXA 4YMTA 1HV8A 4EJSA 3RWMB 2FEMA 5KNDA 2UKDA 5B2ZA 3NHBA 3ASZA 5CJPA 1KK1A 4OK3A 1SHKA 1XTQA 3SFZA 1YZNA 4C0HA 2WM9B 2Z0MA 3C5CA 2GJSA 2GVDC 3QPUA 5EE5B 4E5UA 2MROB 4IVPA 4B73A 1CUKA 3AQ4A 4NDZA 1PUJA 2QAJA 4PXAA 4JLAA 1DG1G 5E95A 5J4YA 4NONA 4LUCA 1N2CE 1W48A 2IX3A 2KNVA 2V7QD 3H4JA 2OO7A 2OBLA 1EG7A 1ZU4A 4ZI2A 4A0HA 3U6KA 1Z3IX 1P9RA 2HT1A 5CK4A 1WGNA 2F9LA 3NBZC 2VP6A 5FOSA 1LTQA 3IIJA 4Q7LA 1BYIA 1PGYA 1E96A 2PLRA 2PZEA 4A2WA 3SQWA 2JLZA 4GDFA 3GLIA 2GCOA 3K1JA 2R44A 2ZJAA 5F98A 4C0AC 5KSZA 4D4JA 2OFXA 3LAWA 2VF7A 1LVGA 1N0UA 2OG2A 4TZ6A 4C4PA 3KJEA 1UDWA 1G8HA 1ZMXA 2WIBA 1Q3TA 1ANKA 3QE0A 4BRWA 1XEWY 1XMJA 2ZJ5A 4NYMQ 3FHTA 4RD0A 3L0SA 1G8PA 1JECA 4DLVA 2Z4RA 1KY2A 4MGKR 4L9WA 4MYTA 5C4GB 2O8FB 3TSWA 1VEJA 8OHMA 2EWWA 2Z5FA 2F43A 2W00A 2CJWA 5FFMA 5AWFC 3SJAA 5BYJA 5K8IA 3LX8A 5DLQC 5JJLA 2VIIA 5JMTA 4Y0VA 1IXSB 4OQNA 4Q1DA 1G3IA 4WZ6A 1JBKA 4Q9KA 4A8JA 4A92A 3KQNA 2QTHA 2REXB 5K8LA 1MT0A 1NLFA 4NYIQ 4PZYA 3W5JA 2MSEB 2OAP1 1VG9B 2FGJA 1J2JA 1NN3A 4HEJA 4LV5B 3TE6A 2ZRAA 5HTKA 1HQCA 4LJ6A 1GKYA 2RGGA 4ZCMA 3KXIA 1DAKA 1GG2A 5CYPA 1FW6A 2DFNA 2C9YA 1VCNA 5JWRA 3IHPA 4IXNA 1JR3D 2JLSA 1IN6A 2CE7A 4US1R 4GEWA 4A0RA 2Q9BA 4XVQA 4E07A 1QZEA 1CP2A 2Q0HA 4CEIB 2H5XA 2BWJA 1IJFA 3CF6R 2WTUA 5J4HA 5JFGA 3B8HA 3QEOA 3W6OA 2A5FA 3DDCA 1AIPC 4G5RA 4D0GA 5BQ5A 3HYTA 4RKFA 3D7MA 4L16A 3CRVA 5L3SB 3AP1A 4RZXA 4A2PA 4TYPA 3IILA 4IOMA 1D2EA 2ONKA 2ZE7A 3A58B 3K70D 1ESMA 1ZM2A 3A1VA 1DBSA 2JUJA 1R5OA 2XJ9A 2K9DA 2YOGA 2Y8EA 4D0LB 3EXAA 1ZBDA 1OKKD 1NL3A 3U3KA 2GCPA 3A36A 3ZIAD 3F0TA 4GOXA 2WWFA 4XTCS 4UQOA 3FE2A 1ZAKA 3GJ0A 4A2QA 2QMOA 1C9KA 3SS8A 4EPVA 3IBYA 2C04A 5CIWA 5FUYA 5TY0A 3ZQJA 1TAGA 2IC5A 1ZINA 1OAIA 2QUZA 4ZV4A 5KU1A 2EWVA 2LVNC 4RKEA 4YLGA 3ZVMA 4XSGA 3C15C 4A1FA 3OF5A 4JL6A 2YWEA 1N6PA 2FA9A 1T91A 4OI2A 1YZUA 4N0EA 3QBVA 1IY1A 2OAQ1 3TK1A 3U61B 2F1JA 2QNJA 4ZIRA 2CCJA 4DUGD 5EZ6B 1KDRA 4ZO4A 4D26A 3I1FA 1P3QQ 3K9NA 3WRYC 2PBRA 3FFAA 4QGFA 3QSYA 4YMUA 4LSGA 4S35A 1NSFA 4KAXA 1HA3A 4UXIA 2F55A 4R2HA 5HZHA 1G3UA 1GO5A 2AK3A 3JZAA 2OESA 5LDDC 3THWA 4MYUA 3R7WA 3RWOA 5B58C 3THXA 4M4SA 3QPVA 3SJZA 2GHIA 3QKRA 4A6PA 4FWIB 4KO8A 2VEDA 3OE7A 5FOVA 1W5TA 3K0EA 2D06A 3C16C 4PO1A 4BFXA 2RHDA 3WY9A 2GXSA 2AL7A 3KKMA 3RDPA 1XZPA 3KL4A 1VDLA 2QT0A 1OXTA 4C30A 4DB4A 3BK7A 1II9A 3QXHA 4UXHA 4D2IA 4Q00A 1E2PA 3H4MA 2F3RA 4Q18A 3QQ5A 4AG5A 4JBWA 1KMQA 1AQYA 1IBRA 3DMDA 3E1SA 5EE0A 1KO1A 1DAHA 1YZLA 3U4QB 5LD2B 3PFIA 2NOAA 5DNYB 1MO5A 1TADA 4V0OA 1OH5A 1P72A 4QBFA 2FNAA 1LFDB 1WRBA 4LPKA 1Z47A 2ZJZA 3GEHA 4POAA 4ARZA 5KPJA 2OOBA 3GMTA 1TL7C 3EWAA 3VKWA 5JBQA 5HKKA 2ZJ8A 4OHWA 5H1YA 1J7KA 5DE3A 1NLYA 3EC2A 4QRHA 2IK8A 2O8EB 2R6CA 3P26A 5SZKB 1Z0IA 3U7GA 1KOFA 4OQXA 5IT5A 2J0VA 3KX2A 1T4GA 1S1MA 4DT1B 2OOAA 4LJ8A 4JZKA 3NC1C 1BYUA 1IN4A 4LYJA 2OT3B 4PO9A 4I81A 3X1XA 5BN4A 5LB4A 1YVDA 5G3YA 1V5WA 3G0HA 2O5VA 1E1QA 4QHTA 2QP3A 4CEHA 3BORA 3QENA 2ZJYA 5KNCA 1US8A 3RRYA 1DTSA 5GADl 3M4YA 2OBMA 5JLJA 3LVQE 5HCIA 5L3QA 4FMDF 3G5UA 2J7KA 3QXJA 2E87A 2QAGC 2QPOA 2YHSA 1EFCA 3FRHA 2ZVQX 3TIFA 1HH4A 4CIDA 5F9HA 2ZM5A 2NGRA 2RB4A 3IIMA 4PO8A 4X8OA 4XVUA 1ESNA 2HT6A 4LC0A 4D81A 4JIMA 2RMKA 1SVKA 4PZLA 3GLHE 1NI3A 1TQ2A 1YZKA 1NIJA 2WWHA 1TMKA 1VYVA 4KODA 2G77B 1IOZA 2EKFA 4WVFA 3AP2A 4M8NE 1GNRA 3IO3A 5AR1A 2IWHA 5E3HA 2F1RA 3C4JA 3HPRA 3LW7A 4OKSA 3QOFA 3QXCA 2JIZA 3UWKA 3KJIA 2B6HA 4JBXA 3TH5A 2VH5R 5FBLB 2WKRA 1TNDA 3EZ7A 1S2MA 3A4LA 4Q1BA 4XVRA 1FP6A 1Z5ZA 4PPQA 3KW6A 2ZRGA 1WCV1 3KUDA 4M9XA 3WHLA 1I2DA 2KNZA 3AB3A 3K53A 2OCYC 2W6JA 3M1IA 2VL7A 4IW3B 2OHFA 2RGAA 3GFOA 2ANCA 4I1SA 4OQFA 1ZM9A 1U99A 5FUWA 2BM1A 2B92A 4DLZA 4IJMA 3QJYA 2HXSA 1TPZA 2ZVPX 2I1VB 521PA 5FPKA 1UFZA 1N6KA 1C4OA 2ZRDA 4G1UC 4KFTA 2IT1A 1NVWQ 1TX4B 3V9PA 2HF8A 4P4SB 1SXJB 1E69A 2R9VA 1E2JA 2DAMA 5C4MA 4TMZA 2CDNA 1ZIPA 4TTRA 2QPTA 2HLDA 1DAEA
chains in the Genus database with same CATH superfamily
3HCBA 1KL7A 1YQUA 3A25A 1ZUHA 3PFKA 3T52A 3EAQA 2A9KA 1FYXA 4MVJG 2IHUA 4I3GA 1Z6XA 5KOYA 4HI0E 3UK7A 4G6ZA 4BMPB 1Q12A 1BDIA 4U2DA 1HR0M 1NUPA 3PXAA 4G8DA 2X0DA 1QV7A 3TIGA 4JV5B 5EC8A 4YPVA 4RPCA 3MJ4A 4ACBA 2Z2XA 4MVJP 4BFTA 1XNQM 1DTWA 4RVOA 5JZ9A 4RZIA 1DWUA 1H6UA 2BFDA 3ZI4A 3NWLA 4JU9A 1G16A 3H9QA 4KPGA 1PNTA 1O03A 4JYZA 3K6KA 3WQBA 2ZZMA 4N3NA 1KP9A 4X7RA 3ZWDA 3EN0A 1VC2A 2P69A 2I6UA 3I05A 4CLXA 5LOVB 5HGJA 5HRCA 3AMVA 2CD7A 3WFIA 3IVAA 3SI7A 1UKVY 3CY6A 5FWYA 3A3YA 2R65A 4U7PB 1FUUA 5KNBA 3KKQA 2OOKA 2UYOA 3F46A 1GSAA 1GUBA 2HLDD 2GHTA 5SICE 5DTMA 3FYUC 1C0EA 2YYAA 5TXGA 3MGKA 1MKYA 3SKYA 4DSUA 1FDUA 1I1QB 1HPLA 4HRYA 3KQWA 2YJ4A 5K3FB 1VE6A 3OFKA 3LY7A 1IB0A 3F4LA 2FSSA 4KBGA 4PC3A 4OHUA 4F84A 4TV8F 2DP4E 4LOAA 2IEAA 4YR7A 3ABQB 1AXRA 2HGSA 5FAXA 3C98A 4M7RA 3BGSA 1UBGA 3LOQA 1BZYA 2ZR7A 3E9RA 4QO7A 1RPTA 2J0SA 1ZRHA 4PBRA 2PAAA 4UHJA 4HH0A 4ENTA 4ZAYA 2O2IA 2C4WA 3LHIA 3LCRA 2F59A 3U37A 2C4TA 2HKIA 1DXYA 2BBTA 5FA8A 4AWAA 1QMGA 4ESVA 4UVGA 4KQ6A 2ADMA 4IPTA 2L2QA 3QNUA 4Z8XA 1YC5A 1W5EA 2FKAA 1ADFA 2ATXA 2LBPA 4I46A 4E22A 2ETXA 3EGDA 3KC2A 2JAWA 4YJFB 3AUTA 1XU4A 1TDZA 3JR7A 3ANMA 5LYJA 1QVRA 1C8LA 3QVLA 2VO1A 2W2NA 2OPBA 1JB0F 5FTJA 2XMZA 5IXJA 2DBVO 3L25A 3FRJA 4D4LA 1JHQA 2VUIB 1RXEA 5BMVB 3WIOA 5AJTA 1JAXA 2R66A 4EPYA 1OX4A 1BEEA 2X6QA 3HBLA 3PPVA 1KY3A 4UNPA 1SQSA 2DX7A 1ZGZA 5H68A 3M5CA 1Z15A 3T15A 1U2SA 2Y0DA 2HJGA 4X93A 4G86A 1LD3A 1XJCA 4AMYA 2DWOA 5B1YA 3DHNA 1R5BA 1OFTA 5HCNA 3AR3A 4PZ9A 2I76A 1WIWA 3M4ZA 5EFOA 3UWMA 3FDXA 5BT8A 3TX6A 3V8VA 1RMTA 3RQSA 3F47A 4HB0A 1U8TA 3UAYA 1EFPA 4NR0A 2E49A 4G4NA 4S12A 5FH9A 1GGEA 1NP6A 2CHEA 5P8WA 3E53A 2PZJA 4QUEA 2G0AA 4POOA 4DIUA 3RWBA 3GAZA 2BGMA 2XYGA 1O87A 3VKGA 1KYYA 4GNRA 3I04M 1PJSA 2NM0A 4M53A 5ERXA 4GBGA 4OGWA 1C7QA 2R2GA 5A3RA 4YAWA 4QXAA 5JVDB 4YCAA 3EPPA 1ECPA 1S2OA 2W6ID 2DULA 3WZMA 1BVUA 4JLDA 3EIUA 4GUAA 1KXZA 2DY0A 1YOVA 3ILVA 1PTJA 3V8NA 1BMQA 2PM8A 3HM9A 2ZJ2A 4GZMA 3LLSA 3OPYB 2MYNA 1MHPA 3FSJX 1YUBA 1PZXA 5K7SA 1T9AA 3O7MA 3NBIA 4F2WA 5BUQA 2CGEA 1JFRA 1RLJA 2F8SA 4UUAA 1YIOA 5LNK1 1GFZA 2YVKA 3ABSB 1A8PA 1BMFD 3DS8A 3H17A 3UOWA 3KSUA 4Q3CA 4PLHA 2ZB2A 3TCNA 3MSXA 4CKWA 3P4YA 4HTFA 4PO3X 4O4LB 3DVQX 3RYCB 5ALXA 5CA1B 3ZXXA 2QM8A 2PDAA 2VRCA 1HJPA 4BNTA 2PIAA 3R0IA 4ZDJA 1WETA 1KFJB 5ES4B 5A02A 4ITRC 1RZVA 3L6EA 3CCBA 3U3RA 3NT2A 4MJ7A 2P9GA 2NP6A 1WL8A 4D4GA 3NATA 2ODBA 1Z8HA 2GEVA 3H19A 5A0VA 3HDHA 4BNHA 5FADA 4YB8A 3K73O 1VL1A 1PDWA 4IHJB 3MINB 1URPA 4D4IA 1U7HA 4B3MM 1P18A 2I1QA 2IY8A 3VUEA 1J22A 2W6NA 2EX4A 1IJKA 8LDHA 1QZZA 1GPDG 4RM2A 2PBZA 2PKEA 1UT6A 3ZWWA 4FWTA 3IMCA 1I6KA 1K8RA 1NV8A 4B43A 3GEIA 5FUBA 4XKJA 3ZTTA 1XZKA 1XN1A 3RVRA 4EJSB 3UAOA 5GOTA 3KVNA 2X13A 3MWJA 4WKNA 3M70A 2WHPA 1WKCA 1UAGA 5CDTA 2YFHA 1XRSB 4RF5A 4ZALA 1SUAA 5JPIA 4FFWA 5D8DA 5HZKA 5DYYA 1UKEA 5K5EA 3WXMA 2HTEA 5JAOA 3LQ1A 3RS0A 4DQXA 4ZVLA 3P8ZA 4O4HF 1AA9A 2DHYA 1ZXBA 3A14A 5T4EA 2NZ2A 3J7AS 4N5NA 4TTPA 1ZJ5A 3OZDA 2RH9B 1TJ5A 2BEWB 3BGWA 4QXPA 2ZIWB 3PXCX 2XYHA 3BMXA 2H4XA 3NONA 2Z6VA 4JH0A 2DWZB 2H3HA 4NICA 2ZT8A 4JBHA 1ODFA 1ZOOA 1VL6A 1JH8A 3V6LA 2Y77A 1Z18A 2EL9A 4F11A 3RQIA 3HDJA 2HTFA 1X1BA 2PMWB 4B32A 1CJVC 3KOZA 4C9BA 3IUYA 3VVMA 3CEAA 1R74A 1J21A 4EMTA 3TB6A 3PIIA 1B42A 1HFKA 3T5DA 1H2HA 2J09A 3ZGVA 1A50B 1KMMA 4LXXA 3H84A 4JC8A 1YL6A 2GARA 1SUIA 4L85A 1XD9A 1I51A 3F7NA 3L5OA 1F6WA 4UVIA 3TQQA 1R0WA 3IG8A 4OW0A 4MB2A 1UPCA 4P81A 2PUVA 2VJMB 3N0RA 2G1PA 4ZPJA 3HDGA 2QG9A 1D07A 4DUZB 3ZZNA 3JR3A 4Y67A 4X44A 3WL7A 4DSTA 3VTKA 1E1LA 5D87A 1DT5A 4BWVA 3CZQA 1YIAA 4U3JB 4RSRA 2J6CA 3ZGNA 1CJKC 1YK0A 1UBMS 3QOXA 2ZJOA 4L5IA 4YDQA 4BNUA 1ZD5A 3A10A 4HDSA 4E31A 4EEXA 5CB6A 1I2BA 3ADDA 4PAWA 1TRKA 4AY6A 5EFZA 4YREA 3Q8MA 2V1CA 4LQDA 5FSWA 5JROA 2W6MA 5A1JA 3ROEA 5LP6B 1Y4AE 1NUUA 1IRXA 5IC6A 3QHQA 1OFGA 1PJRA 4GE3A 1H23A 4Q39A 2TECE 4HVLA 3ZZMA 2VHZA 3E7XA 5T64A 4BIIA 1GL3A 2D0OB 1E0DA 4P4SA 4LDAA 1KBZA 4Y6QA 3T4UA 4KN8A 2PR7A 3D5EA 3N59A 4OYHA 2XA2A 3HADA 2PGOA 2RG7A 3GMDA 2XI4A 1ZJZA 4R31A 1AMNA 2B37A 4J7UA 1NN5A 1AUQA 4B08A 4HL6A 1BVSA 2GZHA 5LWHA 2ZS8A 3GCZA 3CKMA 1W25A 4MUYA 1MA0A 3MMNA 4HMPA 4OO3A 3A06A 4JKYA 2IEZA 5CMLA 1ZZGA 1T4DA 4BJ6A 2VBIA 3OT4A 1FY2A 1FDSA 2X4GA 3IESA 1CULC 4HNHA 3WDKA 2F6RA 3MYYA 5TB5A 1PT7A 4L3WA 3RNLA 4WIAA 3FE3A 3QYPA 4FBMA 2Y1OA 1UC4B 5IJ0B 3T7IA 3CX3A 2O2EA 4EG1A 3PZBA 1ZMVA 3S1AB 1ZIOA 1Z16A 3INYA 3QEKA 2RRUA 1Y1SA 1SULA 4I1UA 2LKCA 4TUYF 2ZM6M 5BPVA 3WMEA 1LC3A 4C2UA 3QKIA 5T4FA 1PKXA 1IG3A 4EGJA 1I7QB 2I3AA 1XHLA 2WJPA 1NR5A 4F2DA 4IBEA 4YECA 3KQUA 1X3SA 1C8KA 2CXNA 4MQEB 1XXHE 4PAQA 4UAGA 4BZZA 1EP1B 2QAGB 5JO0A 1IM8A 1QF7A 1VI2A 5FEMA 4WZBA 5GZ6A 2YJ5A 2PKCA 1YAHA 3R9XB 3TZKA 4XCQA 1YBHA 4H7IA 2C3YA 3AYXB 4BTLA 2CFTA 4QC2A 2WKWA 3FA2A 1BXRA 2OHIA 1X8KA 2I65A 1M34E 5IAJA 5LVAA 4LSMA 1JXOA 3GPPA 2EKDA 1DMRA 2G07A 4PPNA 4YCDA 2FW9A 1W29A 3I34X 1CHNA 5CFMA 4B6OA 3NOXA 3LDUA 3PPYA 2JVJA 1Y33E 2X77A 5LCXA 3EEBA 3BMCB 1KKLA 1GZDA 3DOIA 2O9JA 5COAA 1B7GO 4CV2A 1OSNA 4D7AA 3OTHA 2QCUA 4RJJA 1H05A 4U9HS 1AG9A 4TUWA 2JS7A 1G8GA 4YUYA 2HJVA 3AP3A 4TV8A 4QGBA 3PIRA 1U5AA 1ZSNA 5JJBA 4BQQA 1GFIA 3DP7A 3I53A 2BTQB 4IDHA 3SYTA 3RC3A 2NQ8A 2FLVA 1E2GA 2G8LA 3R3HA 4KUHA 2AFIB 4WK0B 5A6VA 3LS2A 1CR2A 1WD5A 2Q0SA 1SC6A 1QCDA 2DHDA 3QUSA 1KAMA 5KX5A 3LT0A 3LXMA 3W5HA 1T5LA 3N2YA 1Y3BE 3NTRA 1HX7A 2GSDA 3AERB 4CG1A 3FVQA 1E5TA 1B76A 4JLWA 5DM2A 2OO9A 4B35A 3ZJ5A 2OGSA 3ZKWB 2PKQO 1OH8A 3VDMA 4EQ6A 4JJZA 3FH0A 2I3BA 4HNGA 2FE8A 1XKQA 3O9VA 1E1QD 1GRRA 1PR9A 3IBSA 4N6GA 2QVXX 3I61A 5KOJA 2UUPA 4UTXA 4WY8A 3GT7A 4Q21A 1GFSA 1J90A 4K28A 3UPTA 5JWOA 3EG5A 3ZE7A 4P1ZA 1NVGA 4R01A 3O73A 4INZA 4REQB 4G89A 1ODIA 2W93A 3T6PA 1H3FA 1LH0A 1A88A 3O9MA 1D4FA 3ILKA 3LUKA 2OYRA 4IGIA 1F8GA 3NDIA 1RWXA 2OV2A 1FS4A 1EVQA 2ONCA 3DZ8A 1USWA 2ZREA 1FFDA 4CLRA 3UJNA 3SR3A 2LH0A 3NXKA 3TJZA 2QZJA 1ORVA 4XLZA 3D43A 1F7UA 3A6DA 4DCVA 3STVA 1EEHA 2VYQA 3JWJA 4AKIA 2Z8XA 2WSSD 1QM5A 4NSOB 2V7QA 2P79A 5A1TA 3ANXA 1GZ7A 1JQLB 5JDIC 4DBVO 1OX6A 1XA3A 2LTAA 3C3CA 3FB4A 2QTNA 3Q9UA 2BW0A 2V9PA 2OQIA 3MERA 1QYDA 2ACEA 3F97A 4JI8M 3HXKA 4LJ5A 5EXPA 1VL2A 5FPSA 4DMUB 5KEIA 3ROQA 4BZQA 4QYIB 3VBEA 2J7NA 4G36A 3RT1A 3IS3A 1DARA 2BBOA 4L5BA 5FFFA 1JR3A 3L46A 3PHJA 4PC7A 4QQRA 1V9SA 3L6BA 4LJ9A 1R2QA 2W82A 1DLIA 1EI9A 2G9UA 4GZ3A 1FS5A 5E3IA 2NO6A 3IP5A 4CFSA 3H2YA 4QNNA 5MFPA 3KYBA 1CHDA 3OFSA 1RWQA 4C4SA 4G56A 4LZLA 3OIFA 4Q7KA 1QYIA 2IXGA 1X9HA 2IZ7A 5B1DA 6CHYA 3OWOA 2NYUA 3HKDB 3OKCA 1C0PA 4NS1A 1V9CA 5HF9A 2NT4A 3GRYA 5J4YA 1J0EA 1WPXA 4IY1A 5DYTA 2VPWA 4RNAA 1FB5A 2AZXA 4RK4A 2VK4A 4IINA 2A14A 2JFXA 3NYRA 1T2NA 1DQZA 4OGGA 3AYZB 2PLRA 3P71T 4A2WA 1SBTA 4WKBA 5K3SA 3K96A 1J0DA 3CZ5A 3WB0A 4TZ6A 1EB8A 5DK4A 3DE0X 4URHA 4RAQA 4DREA 5EUCA 3WB2A 3RBAA 1G8PA 1LC0A 3LUBA 4L8FA 4DLVA 4MGKR 3TSWA 4BNNA 1O5IA 3NWPA 4OREX 1X1AA 3EYAA 5T3YA 2B20A 3B20A 1FLVA 3P4UA 5L9AA 1VCNA 4E5VA 1R5LA 5J4HA 2C20A 3EGVA 1R88A 2VPYA 4DWOA 3OLVA 2F00A 1HEYA 4L16A 4AJNA 1KRHA 5TT1A 3S2SA 1DBSA 2JUJA 1R5OA 2Z3XA 4N5MA 2GCPA 4M1EA 3LPNA 3IFSA 3IBYA 1SU4A 2C04A 3ZQJA 1IQ0A 5KU1A 3PKJA 4YLGA 2HRZA 3D8TA 4EG7A 4ARIA 2J3DA 1WQ3A 2A67A 2L7HA 3DCYA 2FYTA 1SZJG 3WLIA 2CCJA 4ZO4A 1Y8QA 2P6OA 4KNVA 4K2AA 1GZ4A 4S35A 5HZHA 3AFIA 1F7VA 4ZT7A 5YASA 2X7XA 4XM2A 4KO8A 2VEDA 1W5TA 2BTOA 4WGGA 5HMLA 3KL4A 1OXTA 3E15A 3QXHA 5EE0A 2XEDA 3ENQA 3FAZA 3B74A 3S2IA 2Z2ZA 2OD9A 1J7KA 3U39A 2FZEA 3P26A 4EMSA 2OOAA 2YXDA 4OATA 2IKQA 4DAOA 1A8QA 1Z4QA 1PJJA 4QHTA 1WCIB 2ZJYA 5JLJA 1JQDA 5KOHA 4UEWA 5E6UA 4BQEA 4UEKA 1U31A 4C4TA 3KOWE 3R7SA 3GLHE 1GAWA 1WTCA 2HXGA 1NIJA 4H6XA 2I0FA 2H1RA 2EKFA 4WVFA 1GNRA 3C7TA 5C34B 4G0XA 2XQFA 3JD1A 4JB0A 2CZQA 1I7PA 1I2DA 3K53A 1HNZM 4ZYZA 2RGAA 4KK3A 3AUUA 2ZCJA 2WSEF 5LP1A 3V9PA 2HF8A 1E2JA 1NULA 1SJ9A 4JI7B 1ZIPA 2IDKA 4ZEVA 2WWYA 1VJTA 3A1DA 4Q82A 4AP6A 2Z1MA 1MQSA 4Z1MD 1CYEA 2CVZA 2XIQA 2ETVA 1LA2A 4CTKA 3KLNA 5LKRA 1NR1A 4TZ0A 3NHSA 2AFRA 4MQFA 4WBNB 5C53B 3KOZE 2I67A 3HXMA 4YJDA 2INGX 1PDOA 1WU8A 2JBHA 5HIAA 1NW5A 5BW4A 2FRDA 3FNBA 4JN6A 2YV3A 3WGGA 3ZHOA 3NM5A 2PH5A 3FNEA 2PWBA 4PDGA 4AB1A 4RKUF 5EA2A 3ZBQA 5AVYA 2MSNA 2O54A 2C4UA 5BRNA 1XMVA 3DBHA 1XG5A 3DMPA 4DPKA 3L7DA 5JNWA 1IVSA 3W3ZB 2EF1A 1ONPA 4IEFB 4DNFA 3W5IA 4NARA 3HYNA 2F2TA 2M60A 3C3WA 1V6CA 4GH5A 3O2QB 1IMOA 2W48A 3A4NA 3ROKA 4KEAA 3D4NA 2AHRA 2O8DB 1UKBA 2QUJA 3PNMA 2NU6B 4LTDA 2VA8A 2JFNA 5AXDA 2XYVA 1Q7EA 3I8OA 4GM0A 4F6CA 1LPAB 4GMDA 1R0RE 1TFUA 3KR9A 2R2AA 5LQSA 3A1SA 3GEEA 5IK2D 2DAKA 4J2HA 1ZGBA 4KX3A 3O4VA 1M6YA 4PX9A 1R8YA 2G9NA 3AF2A 1R0YA 2MINB 16PKA 3ROGA 2PUHA 5J58A 5I7UA 3OVMA 2O8VA 3UNXA 1DMSA 2Z5GA 1QFYA 1RKBA 4DRZA 1JUDA 4B3DA 1T5IA 2QLBA 3SQDA 5HCUA 1QCYA 3EWNA 1RVDA 1XTBA 4BLRA 4YRJA 2PRZA 4GMKA 1TYBE 4TSFA 3BIFA 5BSVA 2XDAA 5JE8A 5LMCA 1ZISA 4HBZA 1ZD1A 4YP0A 1X7ZB 4LAFA 5ECYA 5KNLA 1PYDA 3BCRA 3U16A 1A76A 4PLTA 1GRNA 4MA5A 2BLLA 2HIAA 1H6CA 4UHKA 3I9OA 2EVWX 3HWX1 1V11A 2BYTA 5K1ZA 3FJYA 4HWRA 2NXCA 4HX9A 1OKKA 3WGZA 1T3ZA 3LH5A 3T1QA 3FYTA 1RZRD 1X8XA 4ID9A 3OM9A 5DM1A 1HFEL 3PUWA 3GGDA 2X4DA 3E81A 4HLQB 3ZS9A 2HNBA 3U6LA 3K6RA 4DUGA 3HBJA 4WI1A 4GD3Q 2IOYA 3IR6A 3OJXA 3HLTA 2FEXA 2X4LA 3BJMA 2QSJA 4NX2A 4N0QA 3UTDA 3OY7A 1FDOA 3W7VA 3G2IA 1M73E 3SWWA 2GEFA 3MMXA 3RSHA 1OIWA 3H0KA 2YZ7A 3RK1A 3HZJA 2RH4A 3FYUA 3G2NA 1C30A 1JG7A 4EECA 1G9TA 2XUDA 1E8DA 4CF6A 1XVUA 5JXWA 2QSFX 1RZ3A 3AVOA 1OFHA 1E3JA 2C82A 2IS2A 1MW8X 4WZBE 4Q4JB 4WJKB 1W59A 1PW7A 3WKDA 3MBOA 3EH2A 3TW4A 1AK2A 1EDOA 5BN5B 2G04A 2YQ4A 2VP0A 1FXUA 1KO5A 3N75A 2M6RA 1SIOA 3VLFB 2SCUB 5LQKA 1ZD2P 4ARAA 1WNFA 3OOEA 2XMCA 3OESA 1SURA 3RHFA 2GCIA 4LDZA 2B3TA 1QIJA 1AB6A 3R6LA 1C3EA 4K87A 4RA9A 4G8BA 3ZDXB 1RLOA 2Q6LA 2WKSA 4IFTA 3C48A 2JGDA 3QTTA 5FR1A 2MR6A 1Z82A 3L01A 3DPIA 1Z5WA 2W8BA 5J9FA 1X1CA 3JVUA 4F6RB 2YBEA 1PZEA 1GLGA 2BSXA 3W68A 4XWOA 3N2ZB 4O59O 1CQPA 4FKZA 2QQ8A 2II6A 1AN0A 3HB5X 2I6TA 3DE5X 1T9DA 3D7NA 2PUEA 3A9TA 3QU9A 5JY1A 5JC1A 2X9GA 4BHTA 1V7QA 3MTJA 1L4BA 3Q15C 1CF2O 4EO9A 5JU6A 1BHSA 3FMFA 2X1VA 1QBKC 4WDRA 1MAWA 4L0MA 3KSMA 2AI3A 4ZT5A 4DC1A 1HE8B 1JBEA 4ZTUB 5JYCA 3ZE1B 3DOEA 2B30A 4ER3A 1IWOA 4GYYA 1EIWA 3U6SA 4BP8A 2ZBPA 1XDDA 4OHPA 3WLNA 3P4XA 1JB1A 1FP7A 2PXXA 3PTLA 5JY6A 3KQHA 1H42A 5FI3A 2QLTA 5KPTA 2QTVB 5IULC 2KMLA 2V5UA 4KTTE 4NOOB 1M54A 1OROA 2BSAA 2BGUA 4NVRA 1FTYA 3UJHA 4NEHB 2BONA 5D7NA 3RASA 4UU7A 1IHXA 2BHSA 5KQLA 1EXDA 4XGRA 1M0EA 2JH9A 2D2VA 3V8MA 2JLUA 2H06A 1T10A 4UFNA 4QATA 1TEZA 1PU2A 2XYRA 3M4JA 1WWKA 2QT1A 4CG3A 1DC5A 3UFBA 1QLHA 2AD5A 1T4BA 2FJPA 3VJRA 4II7A 4MWGA 4AMGA 2EIXA 1NWHA 2ZVDA 1KI1A 2K6GA 2XGSA 4TMKA 1AY0A 1NW6A 4KSCA 3UH0A 1Q39A 5DW0A 4EAAA 2OV6A 1IEQA 3UFXA 5E1OA 2OCAA 2YFYA 2ZU6A 1WQ4A 4YJ3F 4FEEA 3H6HA 4MPPA 4W6ZA 3FUXA 1HT1E 2H48A 1K66A 2QSYA 4JXKA 3LVRE 2PKXA 3DGFC 3NJRA 4B44A 2HNAA 5CCDA 4JI6M 1ZIXA 2ZIVB 1YRYE 2NUTB 4IRMA 3WQHA 3GU3A 3QELA 4GUDA 5JRJA 3NNNA 3I2IA 1I3CA 5BQFA 5K4AA 3U3OA 4WXRA 6GPBA 3EW7A 1YDEA 4RQBA 3MJEA 4F56A 2ZJ1A 4LKOA 4I1RA 4D80A 4JYAM 3QE9Y 4G23A 2YL2A 1W0KD 3PHIA 1I2MA 1U8AA 3H9GA 1PJQA 2REQB 3VYWA 4BWFB 1VSVA 4IBKA 1UC5B 5TPWA 1ODJA 5H70A 2APLA 2VDMB 1JS1X 4OU7A 4QWMA 1VLJA 3K2QA 1L8OA 4YAOA 2FZVA 1GAEO 3F9RA 4MV6A 4O2LA 4X60A 3K2LA 5AW0A 1E3WB 1R16A 4DT1A 1YUMA 1MP0A 4OX9B 4RTSA 3Q8LA 3D6HA 4D6YA 3IKTA 5T4HA 3CRZA 3I1IA 4GDMA 5HBRA 3RSZA 4G67A 2WDZA 4ZCPA 4FTWA 3C1AA 1DBIA 3NWOA 5HS6A 4ZT3A 3NBYC 1VP3A 2DVWB 1JKIA 2JKZA 1CRQA 2A5JA 4J0EA 4LFCM 5EJAA 6REQB 4XWAA 4IF4A 3DE4X 2QRMA 3E4RA 2VYFA 4J0FA 3AVTA 3IAXA 1CEEA 3W9UA 3LF2A 2EJCA 3ZHYA 4Y2UA 1TM1E 1H8EA 4DCMA 2PAFA 1RSZA 2VLBA 3MA0A 3NRCA 1L7OA 3QX9A 4ER6A 2VBGA 3TQIA 3A3OA 4RH0A 4EZEA 3I5MA 3VPFA 1XDGA 5LMNB 3ZXSA 5DNEA 1PLKA 4FMCF 3K8ZA 2C4KA 4B09A 3CBGA 2PT7A 3W67A 2BGNA 2IYVA 3QFRA 4FFMA 1EP3B 4OI0A 2IUEA 3D0OA 4BC1A 3LDFA 4PD2A 3H2GA 2NAPA 5H9VA 1Y9DA 4DRXA 1NBMD 4OQQA 4DLXA 3IEVA 1TM7E 3CKLA 4CWAA 1G98A 3LP6A 4NZPA 3SIXA 2A5GA 4CL8A 2RJNA 4J2TA 3IDQA 1T5TA 4K26A 1FUEA 3VC3A 4B3IA 4J6FA 3GHHA 2EP5A 3SOZA 3WMGA 5IH7A 4B6GA 2JJ1D 3ERCA 5REQB 1S01A 5CW1A 3SZGA 2QD4A 1P8AA 2XUQA 2OBBA 2SICE 3T41A 2ONZA 5EP2A 3K4QA 1Z4PX 2HJWA 2M9MA 2XNSA 4OHXA 5L40A 3EARA 4OF4A 4F2PA 3LQ4A 1Y8RB 1N7JA 4QDTA 4FBGA 4J4TA 1KAGA 1E6UA 4UARA 2NN3C 1DKQA 3SZUA 1Y8CA 4TKVA 3P2YA 2CJXA 2F62A 4F4IA 2ZDHA 3G0CA 2QGNA 2W7TA 1Z0KA 3EA5A 4JNCA 1KETA 3NJ8A 3Q2KA 4C6SA 1C3JA 5AK5A 3MILA 3KVYA 2A9OA 1R5JA 1F2VA 3BHMA 3A6PC 1H9BA 4ETIA 5KNDD 1ZDMA 5C3MA 2QN8A 5IF9A 2RD2A 2XITA 5B4TA 1HORA 1TTPB 4AJHA 4RTOA 4KNYA 1OVGA 3OUTA 4MJLA 2OEPA 4E46A 1EFDN 3TMYA 3AVUA 5EJ2A 1ZESA 4LF8B 4MVCA 3DTNA 4DNXA 2YC2C 5CIQA 1ZK1A 3HJBA 2HCBA 4G9GA 1HSOA 1NI4A 4Q03A 2XKAA 4WNIA 3U3MA 1MQ8B 1U2GC 2GKSA 3U3ZA 5LYYA 3V7UA 4K9OA 4YJHB 2WYHA 1JLHA 4KYIB 2JEZA 3HCEA 5HUQA 2JI9A 3QWLA 2QS9A 3BE4A 1PBTA 5BMOA 4C6HA 3K9PA 1XXHA 1R4MB 1MXFA 2YNMC 1Z2AA 2I2XB 1Y3AA 4MRRA 4DV2B 5A0FA 4KSBA 3N2KA 3W6PA 2MWMA 3CCFA 4L0DA 1HKHA 1HLPA 3RYTC 3Q7EA 4DMGA 2JK0A 1U7OA 4CIWA 4X5OA 5F23A 3FMPB 4XQ9A 1ZZEA 3L6OO 4OI1A 3G5LA 4CT0A 3PXGA 3T61A 3HZZA 4R7TA 3EE6A 2ZUDA 3GFFA 1TIKA 4V02A 2W4QA 5A3QA 2A9VA 1F14A 2PRKA 1LTKA 2WE8A 4BNDA 4NOKA 4BN4A 4RPLA 3AY0A 3THRA 1NRIA 3WK8A 1I32A 3N6VA 4XB1A 4BFYA 4BX3A 3A27A 1ZM4A 1J00A 2GDZA 3SBDA 2ET6A 1CUJA 5EXTA 1A8UA 3U4DA 5AQ1A 3AV0B 2BCJQ 2RJOA 4HNQA 3T8YA 2KBFA 3F4KA 1L5NA 3AH8A 1MDBA 1L1ZA 3EZ9A 1ZW1A 2N42A 2RHRA 3BB4A 2H0QA 4J9UE 4AWXA 1NMQA 2E3JA 4JWTA 4QUHA 3EPLA 3PKIA 5ENDA 3ZCTA 2YMPA 4IJEA 1KVSA 4JB2A 4GVXA 1C5KA 2C78A 2ZETA 1DGGA 4AJ1A 2JNHA 3OHSX 4HNVA 5CT5A 3GK3A 4R1QA 5K6TA 1TVCA 2DPYA 4PAMA 1AN9A 1YO6A 3IQHX 2HMUA 2J4DA 1DOAA 2VP4A 5A4IS 5AHKA 1LI5A 3NWBA 5G4KA 5G0VA 2VTEA 3WWDA 1VPTA 3LHFA 1VHWA 1ZI6A 4QARA 1FW8A 4FZ5A 1F60A 3GJ5A 4BNMA 1FRNA 4PCZA 1EHCA 5HILA 3OP4A 1LKZA 5B64A 4EIWA 3AKZA 2CD9A 2PU7A 3ITNA 3WXBA 1XU9A 5ITUA 3HKBA 3T1OA 3MJVA 3GP1A 1BAPA 1N4DA 3U6PA 4E51A 2XLCA 1XLWA 3NB0A 3GUYA 5HG0A 4YNBA 1J49A 3PF9A 1A1SA 4CQMD 1XSEA 3JYQA 4P53A 1JSRA 4WDQA 2R4EA 3KETA 2QJRA 1W85B 4ZQFA 5AM0A 1QB7A 1D2GA 3BWDD 4GP7A 3O8CA 4LRTB 3IELA 1I7DA 1NKTA 4RD6A 2YZ2A 3OTOB 1C8VB 4K0KM 2G0NA 4P32A 4GM4A 4GRIA 5T8KC 2WFLA 3ETHA 4LKRA 1YWGO 3LVFO 4LF6B 1XCMA 3I4FA 3EB9A 1QIEA 4PWYA 2ZUVA 5JZSA 1PZGA 5JAPA 1HUQA 2AI1A 4YONB 2BKXA 1FMJA 4DADA 5CNKA 2H2HA 3HWWA 3R3JA 2PJRA 3MPOA 5FA6A 4I50A 3ZQ6A 2D4HA 2YY5A 3VX3A 4Z3OA 3GCDA 2PANA 4W5RA 2WD7B 1JG6A 5IWAB 1EX9A 5JSFA 2IJGX 2HU8A 1XA4A 1JJAA 5ITYA 4KV7A 1FJ2A 2O23A 5BYAA 4ZZ0A 4CETA 4W9NC 2G63A 4AZ0B 7YASA 2J4CA 5T7BA 4P5EA 4AUNA 4XB6B 2ORYA 2B8EA 4K6OA 5AJHA 2EBUA 2HO5A 5AO9A 1QKJA 3C0KA 5FO0A 4U7WA 2XQVA 3KUUA 4ER7A 3NETA 3J80S 2OMKA 5BYJA 1BXGA 1C9YA 4W8GA 1NLFA 4I5DA 3D7KA 3INRA 3F6SA 2WIFA 5HTKA 1OU0A 2GH1A 1VA4A 1XMOB 5KMGA 5JDIA 1HSZA 5HWSA 2BL4A 4CCSA 2A5FA 3ND5A 4Q3BA 4ZI7A 2FUEA 4BV8A 3EOBI 5LQJA 1MX0A 2YZKA 4RZXA 2ZE7A 4QZVA 3VR6D 2ENUA 4AMZA 1AKUA 2D5AA 4EPVA 3DONA 2XVXA 3L0DA 3ZJTA 1U3VA 3ZVMA 1GUYA 2O7QA 4JL6A 2FX2A 2IDMA 4U1RA 3I1FA 1Z2NX 2PBRA 1U2PA 2C9MA 4FYVA 4JI1B 1JIJA 4A6PA 2A94A 2D06A 3LCMA 1U5BB 2XDWA 2UUAB 4L9RA 1E3LA 4X0EA 2GD1O 5FCDA 1FIUA 4S05A 1Z47A 1U4NA 4ZYXA 3DF7A 2E2WA 1O6GA 5JNSA 1DFHA 3JALA 4X6YA 3L1VA 3U7GA 2WSLA 1YBFA 5H80A 3E9NA 1USKA 5F3RA 2PZKA 3ID6C 5KNCA 1C9EA 2R8YA 1Y34E 3I23A 3WGYA 1WG8A 1QAQA 3T3NA 4L3OA 2J7KA 5F9HA 4KE6A 4AW4A 5FJJA 5FORA 4B1FA 4X8OA 2OL4A 1PGJA 4KODA 4Z7NB 1JE1A 4ZCQA 5I7HA 2VCHA 3UWKA 1E1NA 1SCBA 1I3MA 1HNWM 5AM3A 1GT6A 1WCV1 4FE7A 3AB3A 4FC6A 4PDIA 2OGZA 2ANCA 3NHRA 4BAGA 1EVZA 1RI1A 1VLLA 3PEFA 521PA 3ENKA 1VZ2A 4TS1A 4GW3A 2DAMA 3ABOB 5BSRA 2YZNA 3FSGD 1QYCA 3IYLW 3K9CA 3N87A 4FHCA 1KARA 3TAUA 3UAZA 3HX3A 1CG6A 3FLMA 5C9ZA 3OE7D 5BNFA 5FBQB 2VDQB 5AJWA 3GQBA 2DB3A 2FPPA 4WERA 3ZE6A 3LT4A 3JWIA 3KOWA 3GLHA 1N5LA 2IGBA 1G41A 1AQIA 3TEJA 4D8XA 2OUIA 2XOXA 3VPSA 1E79A 3L1UA 3R3UA 3GPDG 3ZVKA 1HDXA 3W8RA 1A82A 3F73A 1N8KA 5DB4A 2I8LA 3GV0A 1D9XA 4DV3M 4GPTA 4ZCSA 4BN0A 5K6AC 4Q16A 1NN0A 1N1MA 5HIJA 2I4MA 2PXAA 3CN9A 3LW5F 1LFAA 1KK3A 2VDJA 4JUIA 4KXLA 2UXBB 4ZEMA 2DCMA 2CYAA 2G08A 1LX6A 2Q5HA 5FJIA 3CLTC 1M2OB 3HXPA 1VCIA 5BVHA 1N1DA 1VDDA 1MHTA 5KAMA 2ID4A 2PUDA 3UMJA 2A5YB 2F64A 4KOAA 3R5HA 3D2CA 4HFMA 3LBNA 3DZJA 4F3TA 4ER0A 1DO2A 1MENA 3GJZA 4YASA 1P4SA 3I9NA 2GAAA 4G4IA 1J0AA 2D2EA 4IGFA 2WMDA 4B85A 1H5NA 1GAXA 1YULA 1F5NA 2FH5B 3CIFA 1ST3A 2WW8A 8ADHA 5FLXA 2OXTA 3V55A 2IPMA 1N6LA 1NVTA 4H0CA 2HV8A 3C3DA 1W44A 3ESDA 4H7PA 2OECA 3NDPA 1X9IA 1GTJ1 1RE1A 1NXXA 3S2FA 1JPNA 3T12A 3DR3A 2VA9A 2HIMA 3HVKA 3NPAA 1YB6A 5KQPA 4Y6PA 1KSFX 1USUA 4LFAM 3EMVA 4L2IA 4FE3A 1A7JA 1JDJA 4JNKA 5GIPE 2J5XA 1WQ1R 1MNQA 4L4RA 2ODTX 4NK4A 1Y8GA 5JPDA 3BHNA 1CB7A 2A0FA 5CLGA 4CUZA 4LJ7A 5JCJA 3R41A 4MM3B 4KU4A