1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
4DR3M 3U6CA 1PJIA 4DR7M 4LF8M 4DV0M 1K82A 4JI4M 4JI8M 3GQ3A 3C58A 3TWKA 1IBLM 2OPFA 1IBKM 3GQ4A 5FLXS 5ITXA 3A42A 1EE8A 1L2DA 3U6LA 1PJJA 4JYAM 4DR6M 2UXBM 3TWMA 1Q39A 3J81S 3SAUA 4LF7M 4AQYM 5A2QS 1J5EM 1XC8A 3SASA 1Z59A 4JI3M 1MU5A 5ITTA 4NXNM 4X62M 1L2BA 4X66M 1I94M 3JR4A 4NRWA 3VK7A 4B3TM 1L1ZA 5ITYA 3W0FA 3GP1A 2OQ4A 4LFBM 3GPPA 5ITUA 1KFVA 1L1TA 5ITQA 3SAWA 1Q3CA 4PCZA 4OX9M 3T1YM 1TDZA 1N34M 5ITRA 4DV2M 4B3SM 3SATA 4JI1M 4JI0M 3JR5A 3GPYA 4JI7M 1Z5CA 3U6OA 4LF5M 4GKKM 1PM5A 3OTOM 4GKJM 5IT9S 1HNXM 2UUCM 3A45A 1IBMM 4JI2M 4LFCM 4DR5M 4CISA 1HR0M 4G4NA 3GPUA 2ZBKB 2UXCM 1XNRM 2F5NA 3A46A 1N36M 1K3WA 5LMUM 4LF6M 2F4VM 3U6MA 1R2ZA 1N33M 2F5OA 5LMNM 4MB7A 1TDHA 4DUZM 2F5SA 4DV7M 4G4OA 4LF9M 1HNWM 1Q3BA 4DR1M 4DR2M 4X64M 5ITXE 3SAVA 1R2YA 2E5LM 1Z5AA 4DR4M 4PDIA 4DUYM 4X65M 2VQFM 4K0KM 4G4RA 4PDGA 4KHPM 4LFAM 5BR8M 3SARA 4DV5M 4G4QA 4DV3M 3GO8A 1Z5BA 3DOAA 2XZFA 4JI5M 4JV5M 1NNJA 3SBJA 1MX0A 2EA0A 2F5QA 2UUBM 1FJGM 4YY3M 4NRVA 3TWLA 4PD2A 3U6SA 1HNZM 2XZUA 2F5PA 4B3RM 2UU9M 3J7AS 3VK8A 4LF4M 2Q2EB 2ZM6M 3GPXA 3J80S 1XNQM 2UUAM 2HHHM 4DV6M 1XMOM 4NXMM 2VQEM 3GQ5A 3U6DA 3U6PA 4YHHM 4ITQA 1N32M 3T1HM 3JAMS 4DV1M 2HKJA 4DV4M 5IWAM 4B3MM 4JI6M 1L2CA 3U6EA 3U6QA 1K3XA 1XMQM 2UXDM
chains in the Genus database with same CATH superfamily
3GLGB 4L8RC 5IREB 3L29A 4MGHA 4LF8M 2JNHA 2WZJA 4GC9A 4QNMA 4JI4M 1IN4A 5C18A 3U61A 2K9DA 1NV8A 3KXEC 1Y8GA 4FWGA 2FH0A 3TQSA 1HQCA 4L6V6 2CUZA 5EP4A 1IBKM 5DNYA 3GQ4A 1OIZA 1SXJC 3A42A 3L2AA 3BOSA 2RKOA 4ZPXA 2X8AA 3KP1E 3GLHA 3FE3A 1XB2B 2M60A 4DR6M 3TWMA 2GNOA 2YQZA 1OFHA 1NY5A 3GLGA 3K8ZA 1Z59A 3HX3A 3PXGA 3IECA 4HL4A 5ITTA 1PRBA 4NXNM 3FRHA 4L4UA 3U5ZB 2L6OA 5FTJA 3UK6A 4X66M 1I94M 1OJLA 1N75A 1VDDA 4MGKE 1VEJA 1DGGA 2QSFX 2YFQA 3I04M 1KFVA 3E4RA 3LVWA 4B7HA 4JI1M 4IBDA 5ITQA 4B08A 3SAWA 1HT2E 5EP3A 1ZQ9A 1A5TA 2K0BX 5JI3E 1IN7A 3SATA 3LQQA 5EJCA 1JR3D 3U5ZA 3KSJA 2O5RA 2EKFA 3K1JA 3M0EA 4LF5M 2CHVA 3RE8A 2Z4RA 3GLFE 4GKJM 1G59A 2Y0QA 4M9SA 4GMQA 3A45A 1IBMM 5KPTA 2KNVA 4JN6A 5KO3A 2RGHA 4CISA 1YSYA 1QZMA 3J27B 3FTCA 3L27A 3VLFB 4G4NA 1VEKA 5EXXA 3VDPA 4D80A 2ZAMA 4MM3B 2R4EA 4G6ZA 3MJ5A 1D0KA 2L7IA 2R44A 5BPVA 4FD2A 5LMUM 1N36M 1K3WA 4LF6M 1S3SA 2F4VM 2MH8A 2XFSA 4IBBA 1TH2A 2CWBA 2H1RA 3TPZA 4AW4A 4LGYA 3FYDA 5JI2E 3T15A 3ILKA 2APLA 3PNYA 7CATA 1Q3BA 4DR1M 3AJIB 3SHFA 1YE9A 5ITXE 3VFDA 3SAVA 1R2YA 2E5LM 3SMPA 2BJWA 3CTWB 1HJPA 3AOGA 3QAUA 4DUYM 2LH0A 2VIIA 2VQFM 3HJSA 1AUAA 2C96A 4KHPM 4LFAM 2XSZA 4DV5M 4G4QA 2DWLA 4DV3M 1Z5BA 3DOAA 2QBYB 4F2LA 4JI5M 3PNVA 4D82A 4OU7A 2CHQA 4RF0A 1FJGM 2FFJA 1TH4A 2KHHA 3LCUA 2L7HA 4QNRA 3BBZA 3ZCBB 3GRYA 1DGBA 2XFTA 5EXPA 2UU9M 3RGPA 2Q2EB 3FUVA 4XK8F 4CIZA 2YR0A 4AG6A 1ZMUA 4NXMM 4L78A 1NV9A 2Z8YM 2LVOC 3K9PA 3U6PA 1W5SA 2Y20A 2KW0A 4DV4M 3E21A 5IWAM 3T38A 1H6UA 3GRUA 1J09A 4Q7JA 4CJ6A 3U6EA 3U6QA 1XMQM 1W5TA 1IQPA 1VDLA 5DYGA 1NSFA 2W82A 3UZUA 3V76A 1IN6A 3HKPA 4LRSA 2EUCA 3FUWA 4AKHA 2CV1A 3TWKA 5DFLA 3HU3A 5E6JA 1QYRA 2OPFA 5FLXS 1ZMWA 4PT5A 2G5GX 3FD9A 4JYAM 3KOWE 1V34A 2JZ1A 3KOXE 5KPZA 3VKGA 1JB0F 3QYBA 4AG5A 3W67A 3FTDA 1GKIA 3GRRA 2XGNA 1WHCA 3J81S 2AHMA 1SXJB 2BNKA 2D7EA 5EQTA 4BLCA 4AQYM 1J5EM 3SASA 2D7HA 1F4IA 1N78A 1IN8A 2EKKA 4QHSA 4X62M 1SXJD 1LV7A 3HZJA 1DO2A 2CP8A 4FCWA 1WGNA 1L1ZA 4NRWA 2DNAA 2QENA 2MROB 1PJSA 2OQ4A 2HWJA 4R71A 2DAKA 1DO0A 1QVRA 4REZA 4S12A 1ZAEA 4AI6A 1TTEA 2DI0A 3K92A 4Z8XA 2JA2A 4LCBA 4PCZA 1NJFA 3EIHA 3HU1A 4XBOA 3GLGE 4DV2M 3LMMA 1UFZA 1HT1E 1QAQA 1OIPA 4JI7M 3LQRA 2V1UA 4CHTB 4AKGA 3W68A 3UMMA 1T6OA 3ZC7B 2I7NA 4IBCA 1HNXM 1OQYA 2QZ4A 3ZQJA 3MMPA 2J5YA 1IM2A 1JR3A 1J7KA 1PJTA 2HL7A 4LJAA 2MGWA 5EXSA 3IG8A 3TL4X 2UXCM 2YNMD 3T6PA 2DXIA 4LJ8A 1QDRA 5GKNA 3A46A 2QNJA 4M0WA 2RGOA 4NL4H 1N33M 3L26A 2CE7A 4KO8A 5LMNM 2F5SA 4NOOB 1NY6A 2CFOA 3MHVC 1PJQA 1IY2A 2H5XA 1P3QQ 4MGZE 4LF9M 3HY5A 2LBCA 1HNWM 1KYIA 3HJQA 3UGJA 2OO9A 4I8OA 4DR2M 1HQYE 2I7PA 2QCUA 3E46A 5FTMA 4K0KM 4PDGA 4G4RA 2LVAA 2A5YB 2QHOB 3GLHE 4R7GA 4NC6A 1WR1B 2R18A 5KQDA 4IBIA 1GJSA 2WSCF 4JV5M 2CHGA 1PGYA 4BB9A 1MX0A 3DFZA 2EA0A 2F5QA 2UUBM 3ZH9B 4NRVA 4L15A 4LZJA 4Z6YA 4PD2A 1NHWC 1QQWA 3U6SA 4AKIA 1VEGA 3R8FA 3THGA 4B7FA 1FNNA 4EIWA 3J7AS 3VK8A 2D7GA 1XNQM 2UUAM 4GHLA 3PVSA 2FE8A 2NQ8C 1IXSA 2DKLA 4HEOA 4NSRA 1L8QA 2KZUA 1WGLA 2VQEM 4RKUF 1ZV1A 3RGSA 4YHHM 3E9SA 3R9XB 2VF8A 1XXHE 3T1HM 2LNHC 4WW0A 4CGYB 4DV1M 2HKJA 3K9OA 3W0LB 2L2DA 2KDLA 1CUKA 1K3XA 2UXDM 2KNAA 1KSFX 5IZ7D 4F1IA 3UJNA 2EO2A 3U6CA 1E9RA 2LTUA 3HGIA 2L09A 1G8PA 1JR3E 4GEWA 2GQFA 1XHBA 3GQ3A 4JI8M 1XWIA 1IXSB 2LVNC 1TGUA 3C3EA 2ZTDA 5ITXA 2G8LA 1EE8A 2LWXA 3LVVA 4G3OA 2DAIA 3B7ZA 1NVMA 2QBYA 2OOAA 4L16A 1MN3A 4TUWA 1NHGC 1QANA 2UXBM 1R6BX 1Q39A 5FSWA 3SAUA 4LF7M 1QUTA 3Q8GA 4WP2A 5EP1A 2QP9X 1SXJE 4JI3M 3GRVA 1MU5A 3CF6E 3GLIE 3HJ8A 2ZTCA 4M9ZA 2MJ5B 3KVWA 4OVZB 4FCVA 2C9CA 1QUSA 2K47A 1ZMVA 2DZOB 4RF1A 1WXQA 2X49A 4B7GA 3JR4A 3QWLA 4KODA 3VK7A 3VKHA 3I4YA 4UN2B 1AIPC 2JY6B 1IXRC 2O25A 1L1TA 4WURA 2ZANA 3KFUG 1N77A 4JXJA 3B89A 1YLAA 3HHZA 2L4FA 1TDZA 3B9PA 3L25A 5ITRA 2LVPC 3KOZE 1E32A 4R3DA 4B3SM 1BVSA 1GVNA 4JI0M 3LCVB 4II7A 1G71A 2DENA 3NBXX 2LXEA 4GITA 3JR5A 4OVZA 3KDSE 4GKKM 3GLIA 1WIVA 3AOEC 4M9XA 4IIWA 5F3WA 2R6FA 1JQJC 4LFCM 3U60B 4DR5M 2N35A 3I4VA 4LJ4A 4BBAA 1HR0M 1GL6A 3C9PA 1GJTA 4LJ6A 1E9SA 2QPAA 4AZFA 3GPUA 1OKSA 5EXTA 2O01F 1XXHB 1D0LA 1WJ7A 1XNRM 5FTKA 2Z4SA 4LJ9A 1SXJA 2R65A 4MGYE 2CV0A 3U6MA 1R2ZA 4GC5A 2F5OA 1R5LA 4MB7A 1TDHA 4GRIA 4G4OA 1UM8A 3U60A 4QOZC 2OOBA 3M7GA 1RU3A 4ANRA 2DAEA 3FUTA 4FCTA 4IJFA 2HCBA 4I5SA 3U61B 2LHCA 3Q8XA 1Z5AA 3AL0C 4LRTA 4PDIA 4X65M 5FTNA 2MR9A 4GH9A 4DBGB 2R62A 2Z7JA 2BWEA 2J7OA 1R4GA 3IG5A 5BR8M 2CEAA 1IFYA 2WSFF 3FUXA 3KSXA 3M6AA 3D8LA 3NBIA 4KT0F 3GLHB 2XZFA 2C98A 4Y28F 3SBJA 1G4AE 3SFZA 4YY3M 3IHPA 1TR8A 3TE6A 2KXEA 1HNZM 1OAOC 3NWLA 2CRUA 2R0IA 3I51A 3SHGB 1QAMA 4LF4M 2DHRA 3MK6A 4LZZA 3A98B 4QHTA 1VG5A 2HHHM 4DV6M 3LW5F 1IN5A 2ZAOA 3GQ5A 3U6DA 2KRKA 3KOYE 1GO5A 4M0DA 4QOSA 4ITQA 3J2PB 1N32M 2QQ8A 1DGHB 2JY7A 3CF2A 3JAMS 1T3TA 4LGMA 3WHLA 4IJEA 3KW6A 1G41A 4B3MM 2JZ0A 4JI6M 2JY5A 1L2CA 1IY1A 2C9OA 4KLNA 3B74A 5KQ8A 3HHWA 2EJSA 2LVQD 1OTRA 2JP7A 4DR3M 1PJIA 4DR7M 4LY6A 1ORYB 2JY8A 4DV0M 1K82A 3C58A 2C99A 4IBFA 4P17A 4FW9A 1Z6TA 1C7YA 1IBLM 2R45A 1QAOA 2R4JA 1DGHA 1L2DA 3U6LA 1PJJA 2G3QA 1NJGA 2C5RA 2FS1A 4MH0E 2V6ZM 5KPRA 2P5TA 3FTEA 3RFWA 3PFIA 3VDUA 5A2QS 1XC8A 1QDTA 3B7QA 2Z3XA 3HU2A 8CATA 3C3DA 4IBGA 2JWSA 3KP0E 2DHYA 1DGFA 2DZNB 2K6BA 3FKEA 1L2BA 4B3TM 5ITYA 1D2NA 3W0FA 3GP1A 4LFBM 3GPPA 5ITUA 2V1CA 3FRIA 2FNAA 2XSZD 3HWSA 3AKZA 3SYKA 2DWNA 1Q3CA 4I81A 3AV0A 4OX9M 3T1YM 1LTMA 1N34M 2XF3A 3QYEA 3SYLA 2CV2A 4GHAA 1V92A 3GPYA 1TF0B 4LJ7A 1EIJA 3CGWA 1Z5CA 4IBEA 4LJ5A 4XGIA 3U6OA 1PM5A 2DVWB 1T43A 3OTOM 3GLFA 3KS8A 5IT9S 1I4WA 2L4EA 2Y21A 2UUCM 3DZDA 4JI2M 1GL7A 3F92A 4FWDA 1V33A 2JXNA 1OFIA 4OW0A 5FTLA 2XEPA 1E94E 1GABA 3SMSA 2X4AA 4HLQA 2ZBKB 1VQ1A 2M5ZA 2F5NA 2HAKA 1D0MA 3DA1A 2VF7A 4DUZM 1MJGM 2DZLA 3GLFB 1TH3A 4DV7M 1Q02A 4FWHA 4D81A 2DWMA 5E26A 5C1BA 4I4LA 2KEBA 1C1KA 3L28A 3HHXA 2KRUA 2DAMA 2ERCA 3FUUA 4X64M 1IXZA 3AFHA 1GLNA 2JUJA 4DR4M 2BJVA 4W5WA 3EIEA 1OAIA 2XLJA 2RRUA 3SARA 1IY0A 2LHGA 3GO8A 3BXWA 2KA6B 1NNJA 3FTFA 1R7RA 3SC3A 2KNZA 2KZSA 3TWLA 3GLIB 2B3TA 2BWBA 2R46A 2F5PA 2XZUA 5H37D 4B3RM 3H4JA 4RNAA 3I01M 1SG9A 1YUBA 3D8BA 2DWZB 2VDBB 3AOEA 4FVMA 3KS4A 4IBKA 2FOIC 3J80S 5L8RF 3GPXA 2ZM6M 4GIPA 4MGIE 4P16A 3WHKA 1DV0A 1XMOM 2J7NA 2Y0TA 2WSEF 3J7BA 4IBJA 3K2LA 3B7NA 1XXHA 1G3IA 1QZEA 4LG2A 4NSOB 1EFUB 5DYIA 1X37A 3FYCA 1NO1A 2DAGA 4A3VB 3HHYA 2XH9A 3H4MA 1NNUC 5EP2A 3CF0A
chains in the Genus database with same CATH topology
3GLGB 4L8RC 5IREB 3L29A 4MGHA 4LF8M 4GC9A 4JI4M 4QNMA 1IN4A 5C18A 3U61A 3KXEC 4FWGA 3TQSA 1HQCA 2CUZA 5EP4A 1IBKM 5DNYA 3GQ4A 1SXJC 3A42A 3L2AA 3BOSA 2RKOA 4ZPXA 2X8AA 3KP1E 3GLHA 2M60A 4DR6M 3TWMA 2YQZA 1OFHA 1NY5A 3GLGA 3K8ZA 1Z59A 3PXGA 4HL4A 5ITTA 4NXNM 4L4UA 3U5ZB 2L6OA 5FTJA 3UK6A 4X66M 1I94M 1OJLA 1N75A 1VDDA 4MGKE 1DGGA 2YFQA 1KFVA 3E4RA 3LVWA 4B7HA 4IBDA 5ITQA 4B08A 3SAWA 1HT2E 5EP3A 1ZQ9A 5JI3E 1IN7A 3SATA 3LQQA 5EJCA 1JR3D 3U5ZA 3KSJA 2O5RA 3M0EA 3K1JA 4LF5M 2CHVA 3RE8A 2Z4RA 4GKJM 1G59A 2Y0QA 4M9SA 4GMQA 3A45A 1IBMM 5KPTA 4JN6A 5KO3A 2RGHA 4CISA 1YSYA 1QZMA 3J27B 3FTCA 3L27A 3VLFB 4G4NA 5EXXA 3VDPA 4D80A 2ZAMA 4MM3B 2R4EA 4G6ZA 3MJ5A 5BPVA 2L7IA 1N36M 4FD2A 5LMUM 1K3WA 4LF6M 2F4VM 1S3SA 2XFSA 4IBBA 1TH2A 2H1RA 3TPZA 4AW4A 4LGYA 3FYDA 5JI2E 3T15A 3ILKA 3PNYA 7CATA 1Q3BA 4DR1M 3AJIB 3SHFA 1YE9A 5ITXE 3VFDA 3SAVA 1R2YA 2E5LM 3SMPA 2BJWA 3CTWB 3QAUA 3AOGA 4DUYM 2LH0A 2VIIA 2VQFM 3HJSA 2C96A 4KHPM 4LFAM 2XSZA 4DV5M 4G4QA 2DWLA 4DV3M 1Z5BA 3DOAA 2QBYB 4JI5M 3PNVA 4D82A 4OU7A 2CHQA 4RF0A 1FJGM 2FFJA 1TH4A 2L7HA 4QNRA 3ZCBB 3GRYA 1DGBA 2XFTA 5EXPA 2UU9M 3RGPA 2Q2EB 3FUVA 2YR0A 4AG6A 4NXMM 4L78A 3U6PA 1W5SA 2Y20A 2KW0A 4DV4M 5IWAM 3T38A 1H6UA 3GRUA 1J09A 3U6EA 3U6QA 1XMQM 1W5TA 1IQPA 5DYGA 1NSFA 2W82A 3UZUA 1IN6A 3HKPA 4LRSA 2EUCA 3FUWA 4AKHA 2CV1A 3TWKA 3HU3A 5E6JA 1QYRA 2OPFA 5FLXS 4PT5A 2G5GX 3FD9A 4JYAM 3KOWE 3KOXE 5KPZA 3VKGA 4AG5A 3FTDA 3GRRA 1GKIA 2XGNA 3J81S 2AHMA 1SXJB 2BNKA 2D7EA 5EQTA 4BLCA 4AQYM 1J5EM 3SASA 2D7HA 1N78A 1IN8A 4X62M 4QHSA 1SXJD 1LV7A 1DO2A 4FCWA 4NRWA 1L1ZA 2OQ4A 2QENA 1DO0A 1QVRA 4REZA 4S12A 1ZAEA 4AI6A 3K92A 4Z8XA 2JA2A 4LCBA 4PCZA 1NJFA 3EIHA 3HU1A 4XBOA 4DV2M 3LMMA 1HT1E 1QAQA 4JI7M 3LQRA 2V1UA 4CHTB 4AKGA 3UMMA 3ZC7B 2I7NA 4IBCA 1HNXM 2QZ4A 1IM2A 1JR3A 1J7KA 2HL7A 4LJAA 5EXSA 3IG8A 3TL4X 2UXCM 2YNMD 2DXIA 4LJ8A 5GKNA 3A46A 4M0WA 2RGOA 4NL4H 1N33M 3L26A 2CE7A 4KO8A 5LMNM 2F5SA 4NOOB 1NY6A 2CFOA 3MHVC 1IY2A 4MGZE 4LF9M 1HNWM 3HJQA 1KYIA 3UGJA 4I8OA 4DR2M 1HQYE 2I7PA 2QCUA 5FTMA 4K0KM 4PDGA 4G4RA 2A5YB 4R7GA 2R18A 5KQDA 4IBIA 4JV5M 2CHGA 4BB9A 1MX0A 3DFZA 2EA0A 2F5QA 2UUBM 3ZH9B 4NRVA 4L15A 4LZJA 4Z6YA 4PD2A 1NHWC 1QQWA 3U6SA 4AKIA 3R8FA 3THGA 4B7FA 1FNNA 4EIWA 3J7AS 3VK8A 2D7GA 1XNQM 2UUAM 4GHLA 3PVSA 2FE8A 2NQ8C 4NSRA 2VQEM 1L8QA 2KZUA 3RGSA 4YHHM 3E9SA 3R9XB 3T1HM 2LNHC 4WW0A 4CGYB 4DV1M 2HKJA 3W0LB 1K3XA 2UXDM 1KSFX 5IZ7D 3U6CA 3UJNA 2EO2A 1E9RA 3HGIA 2L09A 1G8PA 3GQ3A 4JI8M 1XHBA 1XWIA 1IXSB 1TGUA 5ITXA 2G8LA 1EE8A 2LWXA 3LVVA 1NVMA 2QBYA 4L16A 4TUWA 1NHGC 1QANA 2UXBM 1R6BX 1Q39A 5FSWA 3SAUA 4LF7M 5EP1A 2QP9X 1SXJE 4JI3M 3GRVA 1MU5A 3CF6E 3HJ8A 4M9ZA 3KVWA 4OVZB 4FCVA 2C9CA 2K47A 4RF1A 2DZOB 4B7GA 3JR4A 1WXQA 2X49A 3VK7A 3QWLA 4KODA 3VKHA 3I4YA 1IXRC 1L1TA 4WURA 2ZANA 3KFUG 1N77A 4JXJA 3HHZA 1TDZA 3B9PA 3L25A 5ITRA 4B3SM 3KOZE 1E32A 1GVNA 4JI0M 4II7A 3JR5A 4JI1M 4GITA 2LXEA 4OVZA 3KDSE 4GKKM 3GLIA 3AOEC 4M9XA 4IIWA 5F3WA 1JQJC 4LFCM 3U60B 4DR5M 1HR0M 3I4VA 4LJ4A 4BBAA 1GL6A 4LJ6A 1E9SA 2QPAA 4AZFA 3GPUA 5EXTA 1XXHB 1XNRM 5FTKA 2Z4SA 4LJ9A 1SXJA 2R65A 4MGYE 2CV0A 3U6MA 1R2ZA 4GC5A 2F5OA 4MB7A 1TDHA 4GRIA 4G4OA 1UM8A 3U60A 4QOZC 3M7GA 3FUTA 4FCTA 4IJFA 2HCBA 4I5SA 3U61B 3Q8XA 1Z5AA 3AL0C 4LRTA 4PDIA 4X65M 5FTNA 4GH9A 2R62A 2Z7JA 2J7OA 3IG5A 5BR8M 2CEAA 3FUXA 3M6AA 3KSXA 3D8LA 3NBIA 3GLHB 2XZFA 2C98A 3SBJA 1G4AE 3SFZA 4YY3M 3TE6A 2KXEA 1HNZM 3NWLA 3I51A 3SHGB 1QAMA 4LF4M 2DHRA 3MK6A 4LZZA 3A98B 4QHTA 2HHHM 4DV6M 1IN5A 2ZAOA 3GQ5A 3U6DA 2KRKA 3KOYE 4M0DA 4QOSA 4ITQA 3J2PB 1N32M 1DGHB 3CF2A 3JAMS 1T3TA 4LGMA 3WHLA 4IJEA 3KW6A 1G41A 4B3MM 4JI6M 1L2CA 1IY1A 2C9OA 4KLNA 5KQ8A 3HHWA 4DR3M 1PJIA 4DR7M 4LY6A 1ORYB 4DV0M 1K82A 3C58A 2C99A 4IBFA 4FW9A 1Z6TA 1IBLM 2R45A 1QAOA 2R4JA 1DGHA 1L2DA 3U6LA 1PJJA 1NJGA 2C5RA 4MH0E 2V6ZM 5KPRA 2P5TA 3FTEA 3RFWA 3PFIA 3VDUA 5A2QS 1XC8A 2Z3XA 3HU2A 8CATA 4IBGA 3KP0E 1DGFA 2DZNB 3FKEA 1L2BA 4B3TM 5ITYA 1D2NA 3W0FA 3GP1A 4LFBM 3GPPA 5ITUA 2V1CA 3HWSA 2FNAA 2XSZD 3AKZA 3SYKA 2DWNA 1Q3CA 4I81A 3AV0A 4OX9M 3T1YM 1N34M 2XF3A 3SYLA 2CV2A 4GHAA 3GPYA 4LJ7A 1Z5CA 4IBEA 4LJ5A 4XGIA 3U6OA 1PM5A 2DVWB 3OTOM 3GLFA 3KS8A 5IT9S 1I4WA 2Y21A 2UUCM 3DZDA 4JI2M 1GL7A 4FWDA 1OFIA 4OW0A 5FTLA 2XEPA 1E94E 3SMSA 2X4AA 4HLQA 2ZBKB 2M5ZA 2F5NA 3DA1A 4DUZM 3GLFB 1TH3A 4DV7M 4FWHA 4D81A 2DWMA 5E26A 5C1BA 4I4LA 2KEBA 1C1KA 3L28A 3HHXA 2KRUA 2ERCA 3FUUA 4X64M 1IXZA 3AFHA 1GLNA 4DR4M 2BJVA 4W5WA 3EIEA 2XLJA 3SARA 1IY0A 3GO8A 2KA6B 1NNJA 3FTFA 1R7RA 3SC3A 2KZSA 3TWLA 3GLIB 2R46A 2F5PA 2XZUA 5H37D 4B3RM 4RNAA 4R3DA 1YUBA 3D8BA 2DWZB 4FVMA 3AOEA 2ZM6M 3KS4A 4IBKA 2FOIC 3J80S 3GPXA 4GIPA 4MGIE 4P16A 3WHKA 1XMOM 2J7NA 2Y0TA 4IBJA 3J7BA 3K2LA 1XXHA 1G3IA 4LG2A 4NSOB 5DYIA 1X37A 3FYCA 4A3VB 3HHYA 2XH9A 3H4MA 1NNUC 5EP2A 3CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 M;  3U6C A;  1PJI A;  4DR7 M;  4LF8 M;  4DV0 M;  1K82 A;  4JI4 M;  4JI8 M;  3GQ3 A;  3C58 A;  3TWK A;  1IBL M;  2OPF A;  1IBK M;  3GQ4 A;  5FLX S;  5ITX A;  3A42 A;  1EE8 A;  1L2D A;  3U6L A;  1PJJ A;  4JYA M;  4DR6 M;  2UXB M;  3TWM A;  1Q39 A;  3J81 S;  3SAU A;  4LF7 M;  4AQY M;  5A2Q S;  1J5E M;  1XC8 A;  3SAS A;  1Z59 A;  4JI3 M;  1MU5 A;  5ITT A;  4NXN M;  4X62 M;  1L2B A;  4X66 M;  1I94 M;  3JR4 A;  4NRW A;  3VK7 A;  4B3T M;  1L1Z A;  5ITY A;  3W0F A;  3GP1 A;  2OQ4 A;  4LFB M;  3GPP A;  5ITU A;  1KFV A;  1L1T A;  5ITQ A;  3SAW A;  1Q3C A;  4PCZ A;  4OX9 M;  3T1Y M;  1TDZ A;  1N34 M;  5ITR A;  4DV2 M;  4B3S M;  3SAT A;  4JI1 M;  4JI0 M;  3JR5 A;  3GPY A;  4JI7 M;  1Z5C A;  3U6O A;  4LF5 M;  4GKK M;  1PM5 A;  3OTO M;  4GKJ M;  5IT9 S;  1HNX M;  2UUC M;  3A45 A;  1IBM M;  4JI2 M;  4LFC M;  4DR5 M;  4CIS A;  1HR0 M;  4G4N A;  3GPU A;  2ZBK B;  2UXC M;  1XNR M;  2F5N A;  3A46 A;  1N36 M;  1K3W A;  5LMU M;  4LF6 M;  2F4V M;  3U6M A;  1R2Z A;  1N33 M;  2F5O A;  5LMN M;  4MB7 A;  1TDH A;  4DUZ M;  2F5S A;  4DV7 M;  4G4O A;  4LF9 M;  1HNW M;  1Q3B A;  4DR1 M;  4DR2 M;  4X64 M;  5ITX E;  3SAV A;  1R2Y A;  2E5L M;  1Z5A A;  4DR4 M;  4PDI A;  4DUY M;  4X65 M;  2VQF M;  4K0K M;  4G4R A;  4PDG A;  4KHP M;  4LFA M;  5BR8 M;  3SAR A;  4DV5 M;  4G4Q A;  4DV3 M;  3GO8 A;  1Z5B A;  3DOA A;  2XZF A;  4JI5 M;  4JV5 M;  1NNJ A;  3SBJ A;  1MX0 A;  2EA0 A;  2F5Q A;  2UUB M;  1FJG M;  4YY3 M;  4NRV A;  3TWL A;  4PD2 A;  3U6S A;  1HNZ M;  2XZU A;  2F5P A;  4B3R M;  2UU9 M;  3J7A S;  3VK8 A;  4LF4 M;  2Q2E B;  2ZM6 M;  3GPX A;  3J80 S;  1XNQ M;  2UUA M;  2HHH M;  4DV6 M;  1XMO M;  4NXM M;  2VQE M;  3GQ5 A;  3U6D A;  3U6P A;  4YHH M;  4ITQ A;  1N32 M;  3T1H M;  3JAM S;  4DV1 M;  2HKJ A;  4DV4 M;  5IWA M;  4B3M M;  4JI6 M;  1L2C A;  3U6E A;  3U6Q A;  1K3X A;  1XMQ M;  2UXD M; 
#chains in the Genus database with same CATH topology
 3GLG B;  4L8R C;  5IRE B;  3L29 A;  4MGH A;  4LF8 M;  2JNH A;  2WZJ A;  4GC9 A;  4QNM A;  4JI4 M;  1IN4 A;  5C18 A;  3U61 A;  2K9D A;  1NV8 A;  3KXE C;  1Y8G A;  4FWG A;  2FH0 A;  3TQS A;  1HQC A;  4L6V 6;  2CUZ A;  5EP4 A;  1IBK M;  5DNY A;  3GQ4 A;  1OIZ A;  1SXJ C;  3A42 A;  3L2A A;  3BOS A;  2RKO A;  4ZPX A;  2X8A A;  3KP1 E;  3GLH A;  3FE3 A;  1XB2 B;  2M60 A;  4DR6 M;  3TWM A;  2GNO A;  2YQZ A;  1OFH A;  1NY5 A;  3GLG A;  3K8Z A;  1Z59 A;  3HX3 A;  3PXG A;  3IEC A;  4HL4 A;  5ITT A;  1PRB A;  4NXN M;  3FRH A;  4L4U A;  3U5Z B;  2L6O A;  5FTJ A;  3UK6 A;  4X66 M;  1I94 M;  1OJL A;  1N75 A;  1VDD A;  4MGK E;  1VEJ A;  1DGG A;  2QSF X;  2YFQ A;  3I04 M;  1KFV A;  3E4R A;  3LVW A;  4B7H A;  4JI1 M;  4IBD A;  5ITQ A;  4B08 A;  3SAW A;  1HT2 E;  5EP3 A;  1ZQ9 A;  1A5T A;  2K0B X;  5JI3 E;  1IN7 A;  3SAT A;  3LQQ A;  5EJC A;  1JR3 D;  3U5Z A;  3KSJ A;  2O5R A;  2EKF A;  3K1J A;  3M0E A;  4LF5 M;  2CHV A;  3RE8 A;  2Z4R A;  3GLF E;  4GKJ M;  1G59 A;  2Y0Q A;  4M9S A;  4GMQ A;  3A45 A;  1IBM M;  5KPT A;  2KNV A;  4JN6 A;  5KO3 A;  2RGH A;  4CIS A;  1YSY A;  1QZM A;  3J27 B;  3FTC A;  3L27 A;  3VLF B;  4G4N A;  1VEK A;  5EXX A;  3VDP A;  4D80 A;  2ZAM A;  4MM3 B;  2R4E A;  4G6Z A;  3MJ5 A;  1D0K A;  2L7I A;  2R44 A;  5BPV A;  4FD2 A;  5LMU M;  1N36 M;  1K3W A;  4LF6 M;  1S3S A;  2F4V M;  2MH8 A;  2XFS A;  4IBB A;  1TH2 A;  2CWB A;  2H1R A;  3TPZ A;  4AW4 A;  4LGY A;  3FYD A;  5JI2 E;  3T15 A;  3ILK A;  2APL A;  3PNY A;  7CAT A;  1Q3B A;  4DR1 M;  3AJI B;  3SHF A;  1YE9 A;  5ITX E;  3VFD A;  3SAV A;  1R2Y A;  2E5L M;  3SMP A;  2BJW A;  3CTW B;  1HJP A;  3AOG A;  3QAU A;  4DUY M;  2LH0 A;  2VII A;  2VQF M;  3HJS A;  1AUA A;  2C96 A;  4KHP M;  4LFA M;  2XSZ A;  4DV5 M;  4G4Q A;  2DWL A;  4DV3 M;  1Z5B A;  3DOA A;  2QBY B;  4F2L A;  4JI5 M;  3PNV A;  4D82 A;  4OU7 A;  2CHQ A;  4RF0 A;  1FJG M;  2FFJ A;  1TH4 A;  2KHH A;  3LCU A;  2L7H A;  4QNR A;  3BBZ A;  3ZCB B;  3GRY A;  1DGB A;  2XFT A;  5EXP A;  2UU9 M;  3RGP A;  2Q2E B;  3FUV A;  4XK8 F;  4CIZ A;  2YR0 A;  4AG6 A;  1ZMU A;  4NXM M;  4L78 A;  1NV9 A;  2Z8Y M;  2LVO C;  3K9P A;  3U6P A;  1W5S A;  2Y20 A;  2KW0 A;  4DV4 M;  3E21 A;  5IWA M;  3T38 A;  1H6U A;  3GRU A;  1J09 A;  4Q7J A;  4CJ6 A;  3U6E A;  3U6Q A;  1XMQ M;  1W5T A;  1IQP A;  1VDL A;  5DYG A;  1NSF A;  2W82 A;  3UZU A;  3V76 A;  1IN6 A;  3HKP A;  4LRS A;  2EUC A;  3FUW A;  4AKH A;  2CV1 A;  3TWK A;  5DFL A;  3HU3 A;  5E6J A;  1QYR A;  2OPF A;  5FLX S;  1ZMW A;  4PT5 A;  2G5G X;  3FD9 A;  4JYA M;  3KOW E;  1V34 A;  2JZ1 A;  3KOX E;  5KPZ A;  3VKG A;  1JB0 F;  3QYB A;  4AG5 A;  3W67 A;  3FTD A;  1GKI A;  3GRR A;  2XGN A;  1WHC A;  3J81 S;  2AHM A;  1SXJ B;  2BNK A;  2D7E A;  5EQT A;  4BLC A;  4AQY M;  1J5E M;  3SAS A;  2D7H A;  1F4I A;  1N78 A;  1IN8 A;  2EKK A;  4QHS A;  4X62 M;  1SXJ D;  1LV7 A;  3HZJ A;  1DO2 A;  2CP8 A;  4FCW A;  1WGN A;  1L1Z A;  4NRW A;  2DNA A;  2QEN A;  2MRO B;  1PJS A;  2OQ4 A;  2HWJ A;  4R71 A;  2DAK A;  1DO0 A;  1QVR A;  4REZ A;  4S12 A;  1ZAE A;  4AI6 A;  1TTE A;  2DI0 A;  3K92 A;  4Z8X A;  2JA2 A;  4LCB A;  4PCZ A;  1NJF A;  3EIH A;  3HU1 A;  4XBO A;  3GLG E;  4DV2 M;  3LMM A;  1UFZ A;  1HT1 E;  1QAQ A;  1OIP A;  4JI7 M;  3LQR A;  2V1U A;  4CHT B;  4AKG A;  3W68 A;  3UMM A;  1T6O A;  3ZC7 B;  2I7N A;  4IBC A;  1HNX M;  1OQY A;  2QZ4 A;  3ZQJ A;  3MMP A;  2J5Y A;  1IM2 A;  1JR3 A;  1J7K A;  1PJT A;  2HL7 A;  4LJA A;  2MGW A;  5EXS A;  3IG8 A;  3TL4 X;  2UXC M;  2YNM D;  3T6P A;  2DXI A;  4LJ8 A;  1QDR A;  5GKN A;  3A46 A;  2QNJ A;  4M0W A;  2RGO A;  4NL4 H;  1N33 M;  3L26 A;  2CE7 A;  4KO8 A;  5LMN M;  2F5S A;  4NOO B;  1NY6 A;  2CFO A;  3MHV C;  1PJQ A;  1IY2 A;  2H5X A;  1P3Q Q;  4MGZ E;  4LF9 M;  3HY5 A;  2LBC A;  1HNW M;  1KYI A;  3HJQ A;  3UGJ A;  2OO9 A;  4I8O A;  4DR2 M;  1HQY E;  2I7P A;  2QCU A;  3E46 A;  5FTM A;  4K0K M;  4PDG A;  4G4R A;  2LVA A;  2A5Y B;  2QHO B;  3GLH E;  4R7G A;  4NC6 A;  1WR1 B;  2R18 A;  5KQD A;  4IBI A;  1GJS A;  2WSC F;  4JV5 M;  2CHG A;  1PGY A;  4BB9 A;  1MX0 A;  3DFZ A;  2EA0 A;  2F5Q A;  2UUB M;  3ZH9 B;  4NRV A;  4L15 A;  4LZJ A;  4Z6Y A;  4PD2 A;  1NHW C;  1QQW A;  3U6S A;  4AKI A;  1VEG A;  3R8F A;  3THG A;  4B7F A;  1FNN A;  4EIW A;  3J7A S;  3VK8 A;  2D7G A;  1XNQ M;  2UUA M;  4GHL A;  3PVS A;  2FE8 A;  2NQ8 C;  1IXS A;  2DKL A;  4HEO A;  4NSR A;  1L8Q A;  2KZU A;  1WGL A;  2VQE M;  4RKU F;  1ZV1 A;  3RGS A;  4YHH M;  3E9S A;  3R9X B;  2VF8 A;  1XXH E;  3T1H M;  2LNH C;  4WW0 A;  4CGY B;  4DV1 M;  2HKJ A;  3K9O A;  3W0L B;  2L2D A;  2KDL A;  1CUK A;  1K3X A;  2UXD M;  2KNA A;  1KSF X;  5IZ7 D;  4F1I A;  3UJN A;  2EO2 A;  3U6C A;  1E9R A;  2LTU A;  3HGI A;  2L09 A;  1G8P A;  1JR3 E;  4GEW A;  2GQF A;  1XHB A;  3GQ3 A;  4JI8 M;  1XWI A;  1IXS B;  2LVN C;  1TGU A;  3C3E A;  2ZTD A;  5ITX A;  2G8L A;  1EE8 A;  2LWX A;  3LVV A;  4G3O A;  2DAI A;  3B7Z A;  1NVM A;  2QBY A;  2OOA A;  4L16 A;  1MN3 A;  4TUW A;  1NHG C;  1QAN A;  2UXB M;  1R6B X;  1Q39 A;  5FSW A;  3SAU A;  4LF7 M;  1QUT A;  3Q8G A;  4WP2 A;  5EP1 A;  2QP9 X;  1SXJ E;  4JI3 M;  3GRV A;  1MU5 A;  3CF6 E;  3GLI E;  3HJ8 A;  2ZTC A;  4M9Z A;  2MJ5 B;  3KVW A;  4OVZ B;  4FCV A;  2C9C A;  1QUS A;  2K47 A;  1ZMV A;  2DZO B;  4RF1 A;  1WXQ A;  2X49 A;  4B7G A;  3JR4 A;  3QWL A;  4KOD A;  3VK7 A;  3VKH A;  3I4Y A;  4UN2 B;  1AIP C;  2JY6 B;  1IXR C;  2O25 A;  1L1T A;  4WUR A;  2ZAN A;  3KFU G;  1N77 A;  4JXJ A;  3B89 A;  1YLA A;  3HHZ A;  2L4F A;  1TDZ A;  3B9P A;  3L25 A;  5ITR A;  2LVP C;  3KOZ E;  1E32 A;  4R3D A;  4B3S M;  1BVS A;  1GVN A;  4JI0 M;  3LCV B;  4II7 A;  1G71 A;  2DEN A;  3NBX X;  2LXE A;  4GIT A;  3JR5 A;  4OVZ A;  3KDS E;  4GKK M;  3GLI A;  1WIV A;  3AOE C;  4M9X A;  4IIW A;  5F3W A;  2R6F A;  1JQJ C;  4LFC M;  3U60 B;  4DR5 M;  2N35 A;  3I4V A;  4LJ4 A;  4BBA A;  1HR0 M;  1GL6 A;  3C9P A;  1GJT A;  4LJ6 A;  1E9S A;  2QPA A;  4AZF A;  3GPU A;  1OKS A;  5EXT A;  2O01 F;  1XXH B;  1D0L A;  1WJ7 A;  1XNR M;  5FTK A;  2Z4S A;  4LJ9 A;  1SXJ A;  2R65 A;  4MGY E;  2CV0 A;  3U6M A;  1R2Z A;  4GC5 A;  2F5O A;  1R5L A;  4MB7 A;  1TDH A;  4GRI A;  4G4O A;  1UM8 A;  3U60 A;  4QOZ C;  2OOB A;  3M7G A;  1RU3 A;  4ANR A;  2DAE A;  3FUT A;  4FCT A;  4IJF A;  2HCB A;  4I5S A;  3U61 B;  2LHC A;  3Q8X A;  1Z5A A;  3AL0 C;  4LRT A;  4PDI A;  4X65 M;  5FTN A;  2MR9 A;  4GH9 A;  4DBG B;  2R62 A;  2Z7J A;  2BWE A;  2J7O A;  1R4G A;  3IG5 A;  5BR8 M;  2CEA A;  1IFY A;  2WSF F;  3FUX A;  3KSX A;  3M6A A;  3D8L A;  3NBI A;  4KT0 F;  3GLH B;  2XZF A;  2C98 A;  4Y28 F;  3SBJ A;  1G4A E;  3SFZ A;  4YY3 M;  3IHP A;  1TR8 A;  3TE6 A;  2KXE A;  1HNZ M;  1OAO C;  3NWL A;  2CRU A;  2R0I A;  3I51 A;  3SHG B;  1QAM A;  4LF4 M;  2DHR A;  3MK6 A;  4LZZ A;  3A98 B;  4QHT A;  1VG5 A;  2HHH M;  4DV6 M;  3LW5 F;  1IN5 A;  2ZAO A;  3GQ5 A;  3U6D A;  2KRK A;  3KOY E;  1GO5 A;  4M0D A;  4QOS A;  4ITQ A;  3J2P B;  1N32 M;  2QQ8 A;  1DGH B;  2JY7 A;  3CF2 A;  3JAM S;  1T3T A;  4LGM A;  3WHL A;  4IJE A;  3KW6 A;  1G41 A;  4B3M M;  2JZ0 A;  4JI6 M;  2JY5 A;  1L2C A;  1IY1 A;  2C9O A;  4KLN A;  3B74 A;  5KQ8 A;  3HHW A;  2EJS A;  2LVQ D;  1OTR A;  2JP7 A;  4DR3 M;  1PJI A;  4DR7 M;  4LY6 A;  1ORY B;  2JY8 A;  4DV0 M;  1K82 A;  3C58 A;  2C99 A;  4IBF A;  4P17 A;  4FW9 A;  1Z6T A;  1C7Y A;  1IBL M;  2R45 A;  1QAO A;  2R4J A;  1DGH A;  1L2D A;  3U6L A;  1PJJ A;  2G3Q A;  1NJG A;  2C5R A;  2FS1 A;  4MH0 E;  2V6Z M;  5KPR A;  2P5T A;  3FTE A;  3RFW A;  3PFI A;  3VDU A;  5A2Q S;  1XC8 A;  1QDT A;  3B7Q A;  2Z3X A;  3HU2 A;  8CAT A;  3C3D A;  4IBG A;  2JWS A;  3KP0 E;  2DHY A;  1DGF A;  2DZN B;  2K6B A;  3FKE A;  1L2B A;  4B3T M;  5ITY A;  1D2N A;  3W0F A;  3GP1 A;  4LFB M;  3GPP A;  5ITU A;  2V1C A;  3FRI A;  2FNA A;  2XSZ D;  3HWS A;  3AKZ A;  3SYK A;  2DWN A;  1Q3C A;  4I81 A;  3AV0 A;  4OX9 M;  3T1Y M;  1LTM A;  1N34 M;  2XF3 A;  3QYE A;  3SYL A;  2CV2 A;  4GHA A;  1V92 A;  3GPY A;  1TF0 B;  4LJ7 A;  1EIJ A;  3CGW A;  1Z5C A;  4IBE A;  4LJ5 A;  4XGI A;  3U6O A;  1PM5 A;  2DVW B;  1T43 A;  3OTO M;  3GLF A;  3KS8 A;  5IT9 S;  1I4W A;  2L4E A;  2Y21 A;  2UUC M;  3DZD A;  4JI2 M;  1GL7 A;  3F92 A;  4FWD A;  1V33 A;  2JXN A;  1OFI A;  4OW0 A;  5FTL A;  2XEP A;  1E94 E;  1GAB A;  3SMS A;  2X4A A;  4HLQ A;  2ZBK B;  1VQ1 A;  2M5Z A;  2F5N A;  2HAK A;  1D0M A;  3DA1 A;  2VF7 A;  4DUZ M;  1MJG M;  2DZL A;  3GLF B;  1TH3 A;  4DV7 M;  1Q02 A;  4FWH A;  4D81 A;  2DWM A;  5E26 A;  5C1B A;  4I4L A;  2KEB A;  1C1K A;  3L28 A;  3HHX A;  2KRU A;  2DAM A;  2ERC A;  3FUU A;  4X64 M;  1IXZ A;  3AFH A;  1GLN A;  2JUJ A;  4DR4 M;  2BJV A;  4W5W A;  3EIE A;  1OAI A;  2XLJ A;  2RRU A;  3SAR A;  1IY0 A;  2LHG A;  3GO8 A;  3BXW A;  2KA6 B;  1NNJ A;  3FTF A;  1R7R A;  3SC3 A;  2KNZ A;  2KZS A;  3TWL A;  3GLI B;  2B3T A;  2BWB A;  2R46 A;  2F5P A;  2XZU A;  5H37 D;  4B3R M;  3H4J A;  4RNA A;  3I01 M;  1SG9 A;  1YUB A;  3D8B A;  2DWZ B;  2VDB B;  3AOE A;  4FVM A;  3KS4 A;  4IBK A;  2FOI C;  3J80 S;  5L8R F;  3GPX A;  2ZM6 M;  4GIP A;  4MGI E;  4P16 A;  3WHK A;  1DV0 A;  1XMO M;  2J7N A;  2Y0T A;  2WSE F;  3J7B A;  4IBJ A;  3K2L A;  3B7N A;  1XXH A;  1G3I A;  1QZE A;  4LG2 A;  4NSO B;  1EFU B;  5DYI A;  1X37 A;  3FYC A;  1NO1 A;  2DAG A;  4A3V B;  3HHY A;  2XH9 A;  3H4M A;  1NNU C;  5EP2 A;  3CF0 A; 
#chains in the Genus database with same CATH homology
 3GLG B;  4L8R C;  5IRE B;  3L29 A;  4MGH A;  4LF8 M;  4GC9 A;  4JI4 M;  4QNM A;  1IN4 A;  5C18 A;  3U61 A;  3KXE C;  4FWG A;  3TQS A;  1HQC A;  2CUZ A;  5EP4 A;  1IBK M;  5DNY A;  3GQ4 A;  1SXJ C;  3A42 A;  3L2A A;  3BOS A;  2RKO A;  4ZPX A;  2X8A A;  3KP1 E;  3GLH A;  2M60 A;  4DR6 M;  3TWM A;  2YQZ A;  1OFH A;  1NY5 A;  3GLG A;  3K8Z A;  1Z59 A;  3PXG A;  4HL4 A;  5ITT A;  4NXN M;  4L4U A;  3U5Z B;  2L6O A;  5FTJ A;  3UK6 A;  4X66 M;  1I94 M;  1OJL A;  1N75 A;  1VDD A;  4MGK E;  1DGG A;  2YFQ A;  1KFV A;  3E4R A;  3LVW A;  4B7H A;  4IBD A;  5ITQ A;  4B08 A;  3SAW A;  1HT2 E;  5EP3 A;  1ZQ9 A;  5JI3 E;  1IN7 A;  3SAT A;  3LQQ A;  5EJC A;  1JR3 D;  3U5Z A;  3KSJ A;  2O5R A;  3M0E A;  3K1J A;  4LF5 M;  2CHV A;  3RE8 A;  2Z4R A;  4GKJ M;  1G59 A;  2Y0Q A;  4M9S A;  4GMQ A;  3A45 A;  1IBM M;  5KPT A;  4JN6 A;  5KO3 A;  2RGH A;  4CIS A;  1YSY A;  1QZM A;  3J27 B;  3FTC A;  3L27 A;  3VLF B;  4G4N A;  5EXX A;  3VDP A;  4D80 A;  2ZAM A;  4MM3 B;  2R4E A;  4G6Z A;  3MJ5 A;  5BPV A;  2L7I A;  1N36 M;  4FD2 A;  5LMU M;  1K3W A;  4LF6 M;  2F4V M;  1S3S A;  2XFS A;  4IBB A;  1TH2 A;  2H1R A;  3TPZ A;  4AW4 A;  4LGY A;  3FYD A;  5JI2 E;  3T15 A;  3ILK A;  3PNY A;  7CAT A;  1Q3B A;  4DR1 M;  3AJI B;  3SHF A;  1YE9 A;  5ITX E;  3VFD A;  3SAV A;  1R2Y A;  2E5L M;  3SMP A;  2BJW A;  3CTW B;  3QAU A;  3AOG A;  4DUY M;  2LH0 A;  2VII A;  2VQF M;  3HJS A;  2C96 A;  4KHP M;  4LFA M;  2XSZ A;  4DV5 M;  4G4Q A;  2DWL A;  4DV3 M;  1Z5B A;  3DOA A;  2QBY B;  4JI5 M;  3PNV A;  4D82 A;  4OU7 A;  2CHQ A;  4RF0 A;  1FJG M;  2FFJ A;  1TH4 A;  2L7H A;  4QNR A;  3ZCB B;  3GRY A;  1DGB A;  2XFT A;  5EXP A;  2UU9 M;  3RGP A;  2Q2E B;  3FUV A;  2YR0 A;  4AG6 A;  4NXM M;  4L78 A;  3U6P A;  1W5S A;  2Y20 A;  2KW0 A;  4DV4 M;  5IWA M;  3T38 A;  1H6U A;  3GRU A;  1J09 A;  3U6E A;  3U6Q A;  1XMQ M;  1W5T A;  1IQP A;  5DYG A;  1NSF A;  2W82 A;  3UZU A;  1IN6 A;  3HKP A;  4LRS A;  2EUC A;  3FUW A;  4AKH A;  2CV1 A;  3TWK A;  3HU3 A;  5E6J A;  1QYR A;  2OPF A;  5FLX S;  4PT5 A;  2G5G X;  3FD9 A;  4JYA M;  3KOW E;  3KOX E;  5KPZ A;  3VKG A;  4AG5 A;  3FTD A;  3GRR A;  1GKI A;  2XGN A;  3J81 S;  2AHM A;  1SXJ B;  2BNK A;  2D7E A;  5EQT A;  4BLC A;  4AQY M;  1J5E M;  3SAS A;  2D7H A;  1N78 A;  1IN8 A;  4X62 M;  4QHS A;  1SXJ D;  1LV7 A;  1DO2 A;  4FCW A;  4NRW A;  1L1Z A;  2OQ4 A;  2QEN A;  1DO0 A;  1QVR A;  4REZ A;  4S12 A;  1ZAE A;  4AI6 A;  3K92 A;  4Z8X A;  2JA2 A;  4LCB A;  4PCZ A;  1NJF A;  3EIH A;  3HU1 A;  4XBO A;  4DV2 M;  3LMM A;  1HT1 E;  1QAQ A;  4JI7 M;  3LQR A;  2V1U A;  4CHT B;  4AKG A;  3UMM A;  3ZC7 B;  2I7N A;  4IBC A;  1HNX M;  2QZ4 A;  1IM2 A;  1JR3 A;  1J7K A;  2HL7 A;  4LJA A;  5EXS A;  3IG8 A;  3TL4 X;  2UXC M;  2YNM D;  2DXI A;  4LJ8 A;  5GKN A;  3A46 A;  4M0W A;  2RGO A;  4NL4 H;  1N33 M;  3L26 A;  2CE7 A;  4KO8 A;  5LMN M;  2F5S A;  4NOO B;  1NY6 A;  2CFO A;  3MHV C;  1IY2 A;  4MGZ E;  4LF9 M;  1HNW M;  3HJQ A;  1KYI A;  3UGJ A;  4I8O A;  4DR2 M;  1HQY E;  2I7P A;  2QCU A;  5FTM A;  4K0K M;  4PDG A;  4G4R A;  2A5Y B;  4R7G A;  2R18 A;  5KQD A;  4IBI A;  4JV5 M;  2CHG A;  4BB9 A;  1MX0 A;  3DFZ A;  2EA0 A;  2F5Q A;  2UUB M;  3ZH9 B;  4NRV A;  4L15 A;  4LZJ A;  4Z6Y A;  4PD2 A;  1NHW C;  1QQW A;  3U6S A;  4AKI A;  3R8F A;  3THG A;  4B7F A;  1FNN A;  4EIW A;  3J7A S;  3VK8 A;  2D7G A;  1XNQ M;  2UUA M;  4GHL A;  3PVS A;  2FE8 A;  2NQ8 C;  4NSR A;  2VQE M;  1L8Q A;  2KZU A;  3RGS A;  4YHH M;  3E9S A;  3R9X B;  3T1H M;  2LNH C;  4WW0 A;  4CGY B;  4DV1 M;  2HKJ A;  3W0L B;  1K3X A;  2UXD M;  1KSF X;  5IZ7 D;  3U6C A;  3UJN A;  2EO2 A;  1E9R A;  3HGI A;  2L09 A;  1G8P A;  3GQ3 A;  4JI8 M;  1XHB A;  1XWI A;  1IXS B;  1TGU A;  5ITX A;  2G8L A;  1EE8 A;  2LWX A;  3LVV A;  1NVM A;  2QBY A;  4L16 A;  4TUW A;  1NHG C;  1QAN A;  2UXB M;  1R6B X;  1Q39 A;  5FSW A;  3SAU A;  4LF7 M;  5EP1 A;  2QP9 X;  1SXJ E;  4JI3 M;  3GRV A;  1MU5 A;  3CF6 E;  3HJ8 A;  4M9Z A;  3KVW A;  4OVZ B;  4FCV A;  2C9C A;  2K47 A;  4RF1 A;  2DZO B;  4B7G A;  3JR4 A;  1WXQ A;  2X49 A;  3VK7 A;  3QWL A;  4KOD A;  3VKH A;  3I4Y A;  1IXR C;  1L1T A;  4WUR A;  2ZAN A;  3KFU G;  1N77 A;  4JXJ A;  3HHZ A;  1TDZ A;  3B9P A;  3L25 A;  5ITR A;  4B3S M;  3KOZ E;  1E32 A;  1GVN A;  4JI0 M;  4II7 A;  3JR5 A;  4JI1 M;  4GIT A;  2LXE A;  4OVZ A;  3KDS E;  4GKK M;  3GLI A;  3AOE C;  4M9X A;  4IIW A;  5F3W A;  1JQJ C;  4LFC M;  3U60 B;  4DR5 M;  1HR0 M;  3I4V A;  4LJ4 A;  4BBA A;  1GL6 A;  4LJ6 A;  1E9S A;  2QPA A;  4AZF A;  3GPU A;  5EXT A;  1XXH B;  1XNR M;  5FTK A;  2Z4S A;  4LJ9 A;  1SXJ A;  2R65 A;  4MGY E;  2CV0 A;  3U6M A;  1R2Z A;  4GC5 A;  2F5O A;  4MB7 A;  1TDH A;  4GRI A;  4G4O A;  1UM8 A;  3U60 A;  4QOZ C;  3M7G A;  3FUT A;  4FCT A;  4IJF A;  2HCB A;  4I5S A;  3U61 B;  3Q8X A;  1Z5A A;  3AL0 C;  4LRT A;  4PDI A;  4X65 M;  5FTN A;  4GH9 A;  2R62 A;  2Z7J A;  2J7O A;  3IG5 A;  5BR8 M;  2CEA A;  3FUX A;  3M6A A;  3KSX A;  3D8L A;  3NBI A;  3GLH B;  2XZF A;  2C98 A;  3SBJ A;  1G4A E;  3SFZ A;  4YY3 M;  3TE6 A;  2KXE A;  1HNZ M;  3NWL A;  3I51 A;  3SHG B;  1QAM A;  4LF4 M;  2DHR A;  3MK6 A;  4LZZ A;  3A98 B;  4QHT A;  2HHH M;  4DV6 M;  1IN5 A;  2ZAO A;  3GQ5 A;  3U6D A;  2KRK A;  3KOY E;  4M0D A;  4QOS A;  4ITQ A;  3J2P B;  1N32 M;  1DGH B;  3CF2 A;  3JAM S;  1T3T A;  4LGM A;  3WHL A;  4IJE A;  3KW6 A;  1G41 A;  4B3M M;  4JI6 M;  1L2C A;  1IY1 A;  2C9O A;  4KLN A;  5KQ8 A;  3HHW A;  4DR3 M;  1PJI A;  4DR7 M;  4LY6 A;  1ORY B;  4DV0 M;  1K82 A;  3C58 A;  2C99 A;  4IBF A;  4FW9 A;  1Z6T A;  1IBL M;  2R45 A;  1QAO A;  2R4J A;  1DGH A;  1L2D A;  3U6L A;  1PJJ A;  1NJG A;  2C5R A;  4MH0 E;  2V6Z M;  5KPR A;  2P5T A;  3FTE A;  3RFW A;  3PFI A;  3VDU A;  5A2Q S;  1XC8 A;  2Z3X A;  3HU2 A;  8CAT A;  4IBG A;  3KP0 E;  1DGF A;  2DZN B;  3FKE A;  1L2B A;  4B3T M;  5ITY A;  1D2N A;  3W0F A;  3GP1 A;  4LFB M;  3GPP A;  5ITU A;  2V1C A;  3HWS A;  2FNA A;  2XSZ D;  3AKZ A;  3SYK A;  2DWN A;  1Q3C A;  4I81 A;  3AV0 A;  4OX9 M;  3T1Y M;  1N34 M;  2XF3 A;  3SYL A;  2CV2 A;  4GHA A;  3GPY A;  4LJ7 A;  1Z5C A;  4IBE A;  4LJ5 A;  4XGI A;  3U6O A;  1PM5 A;  2DVW B;  3OTO M;  3GLF A;  3KS8 A;  5IT9 S;  1I4W A;  2Y21 A;  2UUC M;  3DZD A;  4JI2 M;  1GL7 A;  4FWD A;  1OFI A;  4OW0 A;  5FTL A;  2XEP A;  1E94 E;  3SMS A;  2X4A A;  4HLQ A;  2ZBK B;  2M5Z A;  2F5N A;  3DA1 A;  4DUZ M;  3GLF B;  1TH3 A;  4DV7 M;  4FWH A;  4D81 A;  2DWM A;  5E26 A;  5C1B A;  4I4L A;  2KEB A;  1C1K A;  3L28 A;  3HHX A;  2KRU A;  2ERC A;  3FUU A;  4X64 M;  1IXZ A;  3AFH A;  1GLN A;  4DR4 M;  2BJV A;  4W5W A;  3EIE A;  2XLJ A;  3SAR A;  1IY0 A;  3GO8 A;  2KA6 B;  1NNJ A;  3FTF A;  1R7R A;  3SC3 A;  2KZS A;  3TWL A;  3GLI B;  2R46 A;  2F5P A;  2XZU A;  5H37 D;  4B3R M;  4RNA A;  4R3D A;  1YUB A;  3D8B A;  2DWZ B;  4FVM A;  3AOE A;  2ZM6 M;  3KS4 A;  4IBK A;  2FOI C;  3J80 S;  3GPX A;  4GIP A;  4MGI E;  4P16 A;  3WHK A;  1XMO M;  2J7N A;  2Y0T A;  4IBJ A;  3J7B A;  3K2L A;  1XXH A;  1G3I A;  4LG2 A;  4NSO B;  5DYI A;  1X37 A;  3FYC A;  4A3V B;  3HHY A;  2XH9 A;  3H4M A;  1NNU C;  5EP2 A;  3CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...