1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
1HNZM 4DV0M 5ITXA 4LF8M 3A45A 3DOAA 3T1HM 2UUAM 3SASA 1XMQM 4YHHM 3GO8A 1N33M 1XMOM 4JI3M 3C58A 1N36M 1XNQM 3GPPA 2UUCM 1N34M 3TWKA 3SBJA 3J80S 1R2ZA 5ITXE 4DUYM 1EE8A 5ITRA 3VK8A 4JI8M 1TDZA 3SAWA 4LF6M 3A42A 1PM5A 2F4VM 1L1TA 2EA0A 1HNWM 3U6SA 4B3MM 3SATA 3A46A 4ITQA 2UU9M 5FLXS 5ITYA 1K3WA 4JI1M 4G4QA 1K3XA 4NXMM 1Z5CA 2HHHM 4PCZA 3U6QA 1L1ZA 1Q3BA 1NNJA 4LF9M 4JI5M 4LFCM 1Q3CA 2F5PA 4DR2M 1N32M 4YY3M 1I94M 2F5SA 1PJJA 2F5QA 1MU5A 4NRWA 4DV2M 4B3SM 3U6MA 1Z5AA 4NRVA 5IT9S 3JAMS 3SAUA 4LF4M 5BR8M 3U6OA 3GQ4A 4X66M 1L2DA 5ITTA 1FJGM 4GKKM 2ZM6M 1K82A 4JI2M 4JI0M 3TWLA 1HNXM 4LF5M 4LF7M 2VQEM 4LFAM 2UXDM 3GPUA 4AQYM 3GPYA 1XC8A 1R2YA 1IBKM 2UXCM 2UXBM 1XNRM 4DR1M 4G4NA 4G4OA 4NXNM 1MX0A 3GQ3A 3T1YM 3VK7A 1TDHA 1IBMM 4DUZM 4B3TM 4K0KM 2UUBM 4CISA 4PDGA 2VQFM 4G4RA 3U6EA 4DR4M 4DV5M 1L2BA 4PDIA 1IBLM 3OTOM 3GP1A 2F5OA 2XZFA 4X64M 2E5LM 5ITUA 5LMUM 1PJIA 1J5EM 5LMNM 4JV5M 1Q39A 4KHPM 4LFBM 4OX9M 4DR6M 5A2QS 1HR0M 4GKJM 3W0FA 3JR4A 4DR3M 3TWMA 4B3RM 3U6PA 3SARA 2F5NA 2OQ4A 4JI4M 4PD2A 2HKJA 5ITQA 3JR5A 4DV7M 4DR5M 4X65M 4DR7M 2OPFA 3U6CA 5IWAM 3U6DA 3J81S 2Q2EB 1KFVA 1Z59A 4MB7A 4DV1M 4X62M 4DV3M 4JI7M 4DV4M 4DV6M 1L2CA 1Z5BA 4JI6M 3GQ5A 3GPXA 2ZBKB 4JYAM 3SAVA 3U6LA 2XZUA 3J7AS
chains in the Genus database with same CATH superfamily
2A5YB 2JY6B 4M9XA 2DAMA 1HNZM 3FRIA 1TH3A 3GRYA 2DHRA 1SXJD 2Z3XA 2FE8A 2XFSA 1IXSB 4F1IA 3D8LA 2FS1A 3K8ZA 1N33M 4QOZC 4AG5A 3CGWA 5FTMA 2BWBA 1OQYA 4GC5A 4IBEA 1R6BX 3ZQJA 4LJ9A 1N34M 2UUCM 4L4UA 2CV1A 1DGGA 1GL6A 2EKFA 2K0BX 4I5SA 1TGUA 1IY1A 1R2ZA 1A5TA 1EE8A 2EO2A 3UK6A 3AJIB 1IN6A 3ILKA 3MK6A 2ZTCA 4MM3B 1L1TA 2D7GA 3E4RA 2JNHA 3U6SA 4QOSA 2R62A 3FE3A 3L2AA 5FLXS 2C99A 1DGFA 2WSCF 1QUSA 4GRIA 3SHGB 4AW4A 2JP7A 2NQ8C 1VQ1A 3MMPA 1PJSA 2JY7A 1FNNA 1GO5A 4GC9A 3FD9A 1UM8A 1VEGA 3LVWA 3W68A 1D0LA 4M9SA 1PJJA 4BB9A 2F5QA 2BNKA 2R45A 1MJGM 3I4VA 4LGYA 1XXHE 2CWBA 2I7PA 2L7HA 4LJ6A 4NRVA 3ZC7B 4FWDA 2J7OA 1NVMA 3CF6E 4M0WA 1GABA 3L29A 4NC6A 3FYDA 3U6OA 3RGPA 1FJGM 3Q8GA 5ITTA 2MGWA 2ZM6M 4OVZB 1C1KA 1G8PA 4JI2M 1QDTA 3EIHA 1KYIA 4LJAA 4RF1A 1WXQA 2KRUA 3J7BA 3TWLA 5DYIA 4LF7M 2DWNA 4AQYM 3GRUA 1XXHA 4AG6A 1V33A 4MGIE 4MGHA 1XNRM 1OAOC 4QHSA 4B7GA 1QAMA 3KP0E 4QNRA 1MX0A 4G4OA 4G4NA 3GLGE 3U61A 3VK7A 1TDHA 5EXSA 5BPVA 4K0KM 1Z6TA 3T6PA 4LZJA 1T3TA 4F2LA 1ZAEA 4GHAA 1IBLM 2BJWA 2DXIA 2XFTA 2F5OA 2E5LM 3GLHA 4WURA 4PT5A 1PJIA 1J5EM 5KO3A 1ZMWA 2MROB 3KVWA 3DFZA 2DAKA 2M60A 3B89A 3FUTA 1TTEA 4RKUF 5FTJA 3QYEA 4JV5M 1Q39A 3DZDA 4KHPM 4AKGA 1D0KA 1AIPC 1HR0M 4GKJM 2J5YA 2QENA 3HX3A 5EP3A 4AZFA 3JR4A 5KPRA 4DR3M 1ZQ9A 2KXEA 3T15A 3SARA 1ORYB 2VIIA 3SMSA 4PD2A 1SXJC 2Y0TA 4MGKE 3B7NA 4G6ZA 4DR7M 4LG2A 2OPFA 3C9PA 1PGYA 5IWAM 2DAGA 3U6CA 3J81S 2FNAA 1LTMA 4DV3M 4JI7M 3I51A 8CATA 1HT2E 1CUKA 1I4WA 2OO9A 2CE7A 2DAEA 4GIPA 4B08A 2DHYA 3LQQA 3GLFE 5IREB 2QPAA 2VF7A 1QANA 1ZMVA 2R18A 3U6LA 3K92A 3VKHA 3KSJA 4DV0M 3U60B 4AI6A 1HJPA 3A45A 3I4YA 2RRUA 2UUAM 2HCBA 2RKOA 3AV0A 1XMQM 4YHHM 1TH4A 1QZEA 1XNQM 3KXEC 4I81A 3HJSA 3FUXA 3HU2A 2QQ8A 2XEPA 3GPPA 4B7HA 3ZH9B 3TWKA 2DKLA 1VEKA 1PJQA 4DUYM 1JR3A 3GRRA 2QCUA 1J7KA 1F4IA 1NY6A 3HHYA 1PM5A 1SXJB 2F4VM 4I8OA 2H1RA 3KS8A 4B3MM 1IM2A 1R5LA 3SYLA 3SATA 1WR1B 3KFUG 2UU9M 3FUVA 3AKZA 1DO0A 4KT0F 2V1UA 4JI1M 4G4QA 2ZANA 4LJ8A 1J09A 5GKNA 2G8LA 2QBYA 5EP2A 1E94E 4LY6A 2RGOA 2XH9A 1OFIA 3AFHA 1Q3BA 2CP8A 4FD2A 3GLIA 4LFCM 4DBGB 1N32M 4DR2M 1WIVA 2CRUA 3LW5F 4IBJA 1OAIA 5C1BA 3K9PA 3UJNA 3FUWA 4LJ5A 3U6MA 4FCWA 3L25A 2MR9A 3THGA 2EJSA 3KP1E 2X8AA 3KOYE 1IXSA 3L28A 1XHBA 4IBKA 4D82A 2ZAOA 4IBBA 2VF8A 3PNYA 1W5SA 3TL4X 5FTLA 1IXRC 3MJ5A 1XB2B 3FKEA 1IN4A 1ZMUA 1R4GA 3KOWE 2KNZA 4D80A 1HNXM 3K1JA 5EP1A 5EXPA 3HHWA 3GPYA 3BXWA 1HT1E 1XC8A 1WGNA 1R2YA 1IBKM 2UXCM 1R7RA 2KHHA 4DR1M 2VDBB 2R44A 4WW0A 4NXNM 1VEJA 1BVSA 1QZMA 1QQWA 1G4AE 2L09A 1DGHB 1NSFA 2UUBM 1RU3A 2VQFM 3U6EA 2LVPC 3WHLA 1L2BA 2QHOB 4CIZA 5IZ7D 3OTOM 2L7IA 2AHMA 2YFQA 2XZFA 3HJQA 3SMPA 1QVRA 5LMUM 2CV2A 2JXNA 1DO2A 1YUBA 4FCVA 2LVOC 3HU3A 3AOGA 4XGIA 1T43A 2L4EA 4HLQA 2CHGA 4QHTA 2QNJA 3FTEA 3GRVA 1G59A 2QP9X 1EIJA 2JUJA 4LFBM 1QUTA 2K47A 4DR6M 3C3DA 3W0FA 3GLHE 1PJTA 4L16A 2CHVA 4B3RM 1WHCA 2HKJA 5ITQA 3VDPA 3SYKA 3JR5A 2C9CA 1PRBA 3QWLA 4OVZA 2CEAA 3HGIA 4DR5M 1NY5A 1MN3A 3B7QA 3HY5A 3KOZE 4G3OA 4NSRA 4Z6YA 3U6DA 4W5WA 4XBOA 4M9ZA 4DV1M 2DZLA 4MB7A 4IJFA 4MGZE 4X62M 4DV4M 2HWJA 2P5TA 3HWSA 3U5ZB 1L2CA 4HL4A 1HQYE 1Z5BA 2O01F 3LCUA 4RF0A 3GQ5A 3GPXA 4JI6M 3R9XB 2QZ4A 3LVVA 4BLCA 2R4JA 2DZNB 3AOEC 3I04M 3CF0A 2KZSA 4IBCA 2DWMA 5ITXA 5EJCA 3DOAA 5C18A 5FSWA 2Y20A 3GO8A 1IN5A 1N36M 3D8BA 4S12A 2HL7A 4NOOB 2LVAA 4MGYE 3HU1A 3GLGB 4GITA 3LQRA 3J80S 1XWIA 3FTDA 4MH0E 5ITRA 3VK8A 4LRSA 3KDSE 3A42A 3B74A 4XK8F 5EXXA 1HQCA 3R8FA 4KODA 3MHVC 2D7HA 3A46A 4ITQA 3UGJA 1QYRA 1JR3E 1WJ7A 1K3WA 1K3XA 1IN7A 3LMMA 4NXMM 4EIWA 3KOXE 3IHPA 3L26A 3QAUA 3FTCA 1IXZA 2OOBA 2G5GX 2EUCA 4PCZA 2Z4RA 2OOAA 4I4LA 3U6QA 1L1ZA 3V76A 3UMMA 3IECA 1W5TA 1NJGA 3SHFA 4ANRA 5JI2E 1NNJA 4JI5M 1Q3CA 4NSOB 2F5PA 1IY0A 4JN6A 4YY3M 1D0MA 1G71A 1NO1A 1OTRA 1MU5A 4R7GA 2DWZB 4DV2M 4NRWA 4B3SM 3U60A 1Z5AA 2R46A 5IT9S 2C5RA 4LGMA 4Y28F 4B7FA 2X4AA 5BR8M 3GLIE 2R4EA 4X66M 3GLFB 1S3SA 4GKKM 3M6AA 4II7A 2LNHC 4L6V6 4BBAA 1E9SA 2Y21A 2ZTDA 4D81A 1N77A 3AL0C 2C9OA 3PFIA 1E9RA 4LF5M 2VQEM 2KNAA 1GJSA 1OIZA 2UXBM 2M5ZA 2YR0A 1ZV1A 1TR8A 1YE9A 3IG5A 5L8RF 1JR3D 4DUZM 4B3TM 4CISA 3RGSA 4PDGA 7CATA 3BOSA 2C98A 3C3EA 4L8RC 2Z4SA 3M7GA 3PVSA 2APLA 2GNOA 5F3WA 1KSFX 2K6BA 4CGYB 2I7NA 3EIEA 4NL4H 4GMQA 2FH0A 4AKHA 4Z8XA 3DA1A 3PXGA 2X49A 1SG9A 3T38A 2FFJA 2O25A 2ERCA 5EP4A 2JZ0A 1V92A 3K2LA 3TWMA 5FTNA 2F5NA 1E32A 4FWGA 2V6ZM 2CHQA 4LJ4A 4DV7M 1LV7A 2CFOA 4L15A 4Q7JA 2Z7JA 4GH9A 4M0DA 1KFVA 2FOIC 4LZZA 4ZPXA 2GQFA 2XSZA 1P3QQ 5DNYA 4DV6M 2R6FA 3HJ8A 1NV8A 1VDDA 2LTUA 4LCBA 3ZCBB 1JQJC 2CUZA 2EKKA 2W82A 3CF2A 4FWHA 3SAVA 3I01M 4JXJA 3FUUA 5FTKA 3J27B 2XZUA 1H6UA 3J7AS 1V34A 1DGHA 2KEBA 3SFZA 3TE6A 3RFWA 4R3DA 3T1HM 4LF8M 1NV9A 2WSEF 3SASA 3TPZA 3W0LB 4WP2A 4KO8A 1XMOM 1G3IA 4JI3M 2KNVA 1WGLA 3HHZA 3C58A 5KQDA 1OFHA 4CHTB 3E21A 3SBJA 2BWEA 2V1CA 2LWXA 3HZJA 4LRTA 5ITXE 4GHLA 2XSZD 1NNUC 3NBXX 3KSXA 3J2PB 3WHKA 4IBDA 1DV0A 3M0EA 2J7NA 4JI8M 1TDZA 1UFZA 2JZ1A 2K9DA 3A98B 4A3VB 1XXHB 3SAWA 4LF6M 1OIPA 1TH2A 2QSFX 2RGHA 4IJEA 2EA0A 5KPTA 1OKSA 1D2NA 2O5RA 4CJ6A 1IN8A 3U61B 4FVMA 2XLJA 2YNMD 4AKIA 1EFUB 1X37A 1Q02A 4IBGA 4IBIA 2JA2A 3NBIA 5ITYA 1NHWC 1GJTA 2R0IA 3FRHA 1GKIA 2DWLA 1Z5CA 5KPZA 2HHHM 3SC3A 2G3QA 3Q8XA 3GLHB 4KLNA 3U5ZA 4HEOA 1JB0F 5H37D 4LF9M 3CTWB 3PNVA 3E9SA 1VG5A 1IY2A 1QAOA 1I94M 2F5SA 2DZOB 2KDLA 1YLAA 1C7YA 5KQ8A 1NHGC 2JY5A 2LHCA 1GL7A 1TF0B 3UZUA 1G41A 1GVNA 2DNAA 3B7ZA 3H4JA 4LJ7A 3JAMS 4FW9A 3SAUA 4LF4M 2LVQD 3F92A 4QNMA 2D7EA 2XF3A 2L4FA 3GQ4A 1L2DA 2KZUA 1K82A 4P17A 4JI0M 3GLGA 2WSFF 1GLNA 2WZJA 2N35A 4LFAM 2LHGA 3GPUA 1YSYA 1NJFA 2UXDM 5DYGA 1IQPA 2Z8YM 3HKPA 2LH0A 4UN2B 5EQTA 3GQ3A 3T1YM 1Y8GA 3HHXA 4IIWA 1T6OA 4FCTA 1IBMM 2ZAMA 2HAKA 1N78A 1AUAA 1L8QA 1VDLA 3KS4A 3FYCA 4G4RA 4DR4M 3H4MA 1QAQA 3KW6A 1N75A 4PDIA 4DV5M 2B3TA 1SXJE 2MJ5B 4OW0A 3VKGA 3GP1A 1OJLA 4X64M 3NWLA 2JY8A 1DGBA 4P16A 5ITUA 2LXEA 3AOEA 3L27A 3VDUA 2H5XA 3E46A 2KW0A 3RE8A 3VFDA 2Y0QA 3FTFA 2YQZA 1IFYA 2KRKA 3TQSA 5LMNM 5E6JA 3W67A 3BBZA 1QDRA 4OX9M 2L2DA 2DENA 5A2QS 3QYBA 3K9OA 3LCVB 2LVNC 1SXJA 3U6PA 2OQ4A 4JI4M 5DFLA 4RNAA 2L6OA 3GLFA 3VLFB 3IG8A 2R65A 4X65M 4TUWA 2LBCA 2QBYB 4L78A 2CV0A 5EXTA 2Q2EB 4R71A 4OU7A 2KA6B 1Z59A 5E26A 5JI3E 2DI0A 2C96A 3GLIB 2DVWB 2DAIA 2XGNA 2BJVA 2ZBKB 4IBFA 2MH8A 4JYAM 4GEWA 1HNWM 2JWSA 3B9PA 4REZA
chains in the Genus database with same CATH topology
2A5YB 4M9XA 1HNZM 1TH3A 3GRYA 2DHRA 1SXJD 2Z3XA 2FE8A 2XFSA 1IXSB 3D8LA 3K8ZA 1N33M 4QOZC 4AG5A 5FTMA 4GC5A 4IBEA 1R6BX 1N34M 4LJ9A 2UUCM 4L4UA 2CV1A 1DGGA 1GL6A 4I5SA 1R2ZA 1TGUA 1IY1A 1EE8A 2EO2A 3UK6A 3AJIB 1IN6A 3ILKA 3MK6A 4MM3B 1L1TA 2D7GA 3E4RA 3U6SA 4QOSA 2R62A 3L2AA 5FLXS 2C99A 1DGFA 4GRIA 3SHGB 4AW4A 2NQ8C 1FNNA 4GC9A 3FD9A 1UM8A 3LVWA 4M9SA 1PJJA 4BB9A 2F5QA 2BNKA 2R45A 3I4VA 4LGYA 2I7PA 2L7HA 4LJ6A 4NRVA 3ZC7B 4FWDA 2J7OA 1NVMA 3CF6E 4M0WA 3L29A 3FYDA 3U6OA 3RGPA 1FJGM 5ITTA 2ZM6M 4OVZB 1C1KA 1G8PA 4JI2M 3EIHA 1KYIA 4LJAA 4RF1A 1WXQA 2KRUA 3J7BA 3TWLA 5DYIA 4LF7M 2DWNA 4AQYM 3GRUA 1XXHA 4AG6A 4MGHA 4MGIE 1XNRM 4QHSA 4B7GA 4G4NA 1QAMA 3KP0E 4QNRA 1MX0A 4G4OA 3U61A 3VK7A 1TDHA 5EXSA 5BPVA 4K0KM 1Z6TA 4LZJA 1T3TA 1ZAEA 4GHAA 1IBLM 2BJWA 2DXIA 2XFTA 2F5OA 2E5LM 3GLHA 4WURA 4PT5A 1PJIA 1J5EM 5KO3A 3KVWA 3DFZA 2M60A 3FUTA 5FTJA 4JV5M 1Q39A 3DZDA 4KHPM 4AKGA 1HR0M 4GKJM 2QENA 5EP3A 4AZFA 3JR4A 5KPRA 4DR3M 1ZQ9A 2KXEA 3T15A 3SARA 1ORYB 2VIIA 3SMSA 4PD2A 1SXJC 2Y0TA 4MGKE 4G6ZA 4DR7M 4LG2A 2OPFA 3U6CA 5IWAM 3J81S 2FNAA 4DV3M 4JI7M 3I51A 8CATA 1HT2E 1I4WA 4GIPA 2CE7A 4B08A 3LQQA 5IREB 2QPAA 1QANA 2R18A 3U6LA 3K92A 3VKHA 3KSJA 4DV0M 3U60B 4AI6A 3A45A 3I4YA 2UUAM 2HCBA 2RKOA 3AV0A 1XMQM 4YHHM 1TH4A 1XNQM 3KXEC 4I81A 3HJSA 3FUXA 3HU2A 3GPPA 2XEPA 4B7HA 3ZH9B 3TWKA 4DUYM 1JR3A 3GRRA 2QCUA 1J7KA 1NY6A 3HHYA 1PM5A 1SXJB 2F4VM 4I8OA 2H1RA 3KS8A 4B3MM 1IM2A 3SYLA 3SATA 3KFUG 2UU9M 3FUVA 3AKZA 1DO0A 2V1UA 4JI1M 4G4QA 2ZANA 4LJ8A 1J09A 5GKNA 2G8LA 2QBYA 5EP2A 1E94E 4LY6A 2RGOA 2XH9A 1OFIA 3AFHA 1Q3BA 4FD2A 3GLIA 4LFCM 1N32M 4DR2M 4IBJA 5C1BA 3UJNA 3FUWA 4LJ5A 3U6MA 4FCWA 3L25A 3THGA 3KP1E 2X8AA 3KOYE 3L28A 4IBKA 1XHBA 4D82A 2ZAOA 4IBBA 3PNYA 3TL4X 1W5SA 5FTLA 1IXRC 3MJ5A 3FKEA 1IN4A 3KOWE 4D80A 1HNXM 3K1JA 5EP1A 5EXPA 3HHWA 3GPYA 1HT1E 1XC8A 1R2YA 1IBKM 2UXCM 1R7RA 4DR1M 4WW0A 4NXNM 1QZMA 1QQWA 1G4AE 2L09A 1DGHB 1NSFA 2UUBM 2VQFM 3U6EA 3WHLA 1L2BA 5IZ7D 3OTOM 2L7IA 2AHMA 2YFQA 2XZFA 3HJQA 3SMPA 1QVRA 5LMUM 2CV2A 1DO2A 1YUBA 4FCVA 3HU3A 3AOGA 4XGIA 4QHTA 4HLQA 2CHGA 3FTEA 3GRVA 1G59A 2QP9X 4LFBM 2K47A 4DR6M 3W0FA 4L16A 2CHVA 4B3RM 2HKJA 5ITQA 3VDPA 3SYKA 3JR5A 2C9CA 3QWLA 4OVZA 2CEAA 3HGIA 4DR5M 1NY5A 4NSRA 4Z6YA 3KOZE 3U6DA 4W5WA 4XBOA 4M9ZA 4DV1M 4MB7A 4IJFA 4MGZE 4X62M 4DV4M 2P5TA 3HWSA 3U5ZB 1L2CA 4HL4A 1HQYE 1Z5BA 4JI6M 4RF0A 3GQ5A 3GPXA 3R9XB 2QZ4A 3LVVA 4BLCA 3AOEC 2DZNB 2R4JA 3CF0A 2KZSA 4IBCA 2DWMA 5ITXA 5EJCA 3DOAA 5C18A 5FSWA 2Y20A 3GO8A 1IN5A 1N36M 3D8BA 4S12A 2HL7A 4NOOB 4MGYE 3HU1A 3GLGB 4GITA 3LQRA 3J80S 1XWIA 3FTDA 4MH0E 5ITRA 3VK8A 4LRSA 3KDSE 3A42A 5EXXA 1HQCA 3R8FA 4KODA 3MHVC 2D7HA 3A46A 4ITQA 3UGJA 1QYRA 1K3WA 1K3XA 1IN7A 3LMMA 4NXMM 4EIWA 3KOXE 3L26A 3QAUA 3FTCA 1IXZA 2G5GX 2EUCA 4PCZA 2Z4RA 4I4LA 3U6QA 1L1ZA 3UMMA 1W5TA 1NJGA 3SHFA 5JI2E 1NNJA 4JI5M 1Q3CA 4NSOB 2F5PA 1IY0A 4JN6A 4YY3M 1MU5A 4R7GA 2DWZB 4DV2M 4NRWA 4B3SM 3U60A 1Z5AA 2R46A 5IT9S 2C5RA 4LGMA 4B7FA 2X4AA 5BR8M 2R4EA 4X66M 3GLFB 1S3SA 4GKKM 3M6AA 4II7A 2LNHC 4BBAA 1N77A 1E9SA 2Y21A 4D81A 3AL0C 2C9OA 3PFIA 1E9RA 4LF5M 2VQEM 2UXBM 2M5ZA 2YR0A 1YE9A 3IG5A 1JR3D 4DUZM 4B3TM 4CISA 3RGSA 4PDGA 7CATA 3BOSA 2C98A 4L8RC 2Z4SA 3M7GA 3PVSA 5F3WA 1KSFX 4CGYB 2I7NA 3EIEA 4NL4H 4GMQA 4AKHA 4Z8XA 3DA1A 3PXGA 2X49A 3T38A 2FFJA 2ERCA 5EP4A 3K2LA 3TWMA 5FTNA 2F5NA 1E32A 4FWGA 2V6ZM 2CHQA 4LJ4A 4DV7M 1LV7A 2CFOA 4L15A 2Z7JA 4GH9A 4M0DA 1KFVA 2FOIC 4LZZA 4ZPXA 2XSZA 5DNYA 4DV6M 3HJ8A 1VDDA 4LCBA 3ZCBB 1JQJC 2CUZA 3CF2A 2W82A 4FWHA 3SAVA 4JXJA 3FUUA 5FTKA 3J27B 2XZUA 1H6UA 3J7AS 1DGHA 2KEBA 3SFZA 3TE6A 3RFWA 4R3DA 3T1HM 4LF8M 3SASA 3TPZA 3W0LB 4KO8A 1XMOM 1G3IA 4JI3M 3C58A 3HHZA 5KQDA 1OFHA 4CHTB 3SBJA 2V1CA 4LRTA 2LWXA 5ITXE 4GHLA 2XSZD 1NNUC 3KSXA 3J2PB 3WHKA 4IBDA 3M0EA 2J7NA 4JI8M 1TDZA 4A3VB 3SAWA 4LF6M 3A98B 1XXHB 1TH2A 2RGHA 4IJEA 2EA0A 5KPTA 1D2NA 2O5RA 3U61B 1IN8A 4AKIA 4FVMA 2XLJA 2YNMD 1X37A 4IBGA 4IBIA 2JA2A 3NBIA 5ITYA 1NHWC 2DWLA 1GKIA 1Z5CA 5KPZA 2HHHM 3SC3A 3Q8XA 3GLHB 4KLNA 3U5ZA 4LF9M 5H37D 3CTWB 3PNVA 3E9SA 1IY2A 1QAOA 1I94M 2F5SA 2DZOB 5KQ8A 1NHGC 1GL7A 3UZUA 1G41A 1GVNA 3JAMS 3SAUA 4LJ7A 4LF4M 4FW9A 4QNMA 2D7EA 2XF3A 3GQ4A 1L2DA 2KZUA 1K82A 4JI0M 3GLGA 1GLNA 4LFAM 2UXDM 3GPUA 1YSYA 1NJFA 5DYGA 1IQPA 3HKPA 5EQTA 2LH0A 3GQ3A 3T1YM 3HHXA 4IIWA 1IBMM 4FCTA 2ZAMA 1N78A 1L8QA 4G4RA 3KS4A 4DR4M 3FYCA 3H4MA 1QAQA 3KW6A 1N75A 4PDIA 4DV5M 3VKGA 1SXJE 4OW0A 3GP1A 1OJLA 4X64M 3NWLA 4P16A 1DGBA 5ITUA 2LXEA 3AOEA 3L27A 3VDUA 2KW0A 3RE8A 3VFDA 2Y0QA 3FTFA 2YQZA 2KRKA 3TQSA 5LMNM 5E6JA 4OX9M 5A2QS 3U6PA 1SXJA 4JI4M 2OQ4A 4RNAA 2L6OA 3GLFA 3VLFB 3IG8A 2R65A 4X65M 4TUWA 2QBYB 4L78A 2CV0A 5EXTA 2Q2EB 4OU7A 2KA6B 1Z59A 5E26A 5JI3E 2C96A 3GLIB 2DVWB 2XGNA 2BJVA 2ZBKB 4IBFA 4JYAM 1HNWM 3B9PA 4REZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ M;  4DV0 M;  5ITX A;  4LF8 M;  3A45 A;  3DOA A;  3T1H M;  2UUA M;  3SAS A;  1XMQ M;  4YHH M;  3GO8 A;  1N33 M;  1XMO M;  4JI3 M;  3C58 A;  1N36 M;  1XNQ M;  3GPP A;  2UUC M;  1N34 M;  3TWK A;  3SBJ A;  3J80 S;  1R2Z A;  5ITX E;  4DUY M;  1EE8 A;  5ITR A;  3VK8 A;  4JI8 M;  1TDZ A;  3SAW A;  4LF6 M;  3A42 A;  1PM5 A;  2F4V M;  1L1T A;  2EA0 A;  1HNW M;  3U6S A;  4B3M M;  3SAT A;  3A46 A;  4ITQ A;  2UU9 M;  5FLX S;  5ITY A;  1K3W A;  4JI1 M;  4G4Q A;  1K3X A;  4NXM M;  1Z5C A;  2HHH M;  4PCZ A;  3U6Q A;  1L1Z A;  1Q3B A;  1NNJ A;  4LF9 M;  4JI5 M;  4LFC M;  1Q3C A;  2F5P A;  4DR2 M;  1N32 M;  4YY3 M;  1I94 M;  2F5S A;  1PJJ A;  2F5Q A;  1MU5 A;  4NRW A;  4DV2 M;  4B3S M;  3U6M A;  1Z5A A;  4NRV A;  5IT9 S;  3JAM S;  3SAU A;  4LF4 M;  5BR8 M;  3U6O A;  3GQ4 A;  4X66 M;  1L2D A;  5ITT A;  1FJG M;  4GKK M;  2ZM6 M;  1K82 A;  4JI2 M;  4JI0 M;  3TWL A;  1HNX M;  4LF5 M;  4LF7 M;  2VQE M;  4LFA M;  2UXD M;  3GPU A;  4AQY M;  3GPY A;  1XC8 A;  1R2Y A;  1IBK M;  2UXC M;  2UXB M;  1XNR M;  4DR1 M;  4G4N A;  4G4O A;  4NXN M;  1MX0 A;  3GQ3 A;  3T1Y M;  3VK7 A;  1TDH A;  1IBM M;  4DUZ M;  4B3T M;  4K0K M;  2UUB M;  4CIS A;  4PDG A;  2VQF M;  4G4R A;  3U6E A;  4DR4 M;  4DV5 M;  1L2B A;  4PDI A;  1IBL M;  3OTO M;  3GP1 A;  2F5O A;  2XZF A;  4X64 M;  2E5L M;  5ITU A;  5LMU M;  1PJI A;  1J5E M;  5LMN M;  4JV5 M;  1Q39 A;  4KHP M;  4LFB M;  4OX9 M;  4DR6 M;  5A2Q S;  1HR0 M;  4GKJ M;  3W0F A;  3JR4 A;  4DR3 M;  3TWM A;  4B3R M;  3U6P A;  3SAR A;  2F5N A;  2OQ4 A;  4JI4 M;  4PD2 A;  2HKJ A;  5ITQ A;  3JR5 A;  4DV7 M;  4DR5 M;  4X65 M;  4DR7 M;  2OPF A;  3U6C A;  5IWA M;  3U6D A;  3J81 S;  2Q2E B;  1KFV A;  1Z59 A;  4MB7 A;  4DV1 M;  4X62 M;  4DV3 M;  4JI7 M;  4DV4 M;  4DV6 M;  1L2C A;  1Z5B A;  4JI6 M;  3GQ5 A;  3GPX A;  2ZBK B;  4JYA M;  3SAV A;  3U6L A;  2XZU A;  3J7A S; 
#chains in the Genus database with same CATH topology
 2A5Y B;  2JY6 B;  4M9X A;  2DAM A;  1HNZ M;  3FRI A;  1TH3 A;  3GRY A;  2DHR A;  1SXJ D;  2Z3X A;  2FE8 A;  2XFS A;  1IXS B;  4F1I A;  3D8L A;  2FS1 A;  3K8Z A;  1N33 M;  4QOZ C;  4AG5 A;  3CGW A;  5FTM A;  2BWB A;  1OQY A;  4GC5 A;  4IBE A;  1R6B X;  3ZQJ A;  4LJ9 A;  1N34 M;  2UUC M;  4L4U A;  2CV1 A;  1DGG A;  1GL6 A;  2EKF A;  2K0B X;  4I5S A;  1TGU A;  1IY1 A;  1R2Z A;  1A5T A;  1EE8 A;  2EO2 A;  3UK6 A;  3AJI B;  1IN6 A;  3ILK A;  3MK6 A;  2ZTC A;  4MM3 B;  1L1T A;  2D7G A;  3E4R A;  2JNH A;  3U6S A;  4QOS A;  2R62 A;  3FE3 A;  3L2A A;  5FLX S;  2C99 A;  1DGF A;  2WSC F;  1QUS A;  4GRI A;  3SHG B;  4AW4 A;  2JP7 A;  2NQ8 C;  1VQ1 A;  3MMP A;  1PJS A;  2JY7 A;  1FNN A;  1GO5 A;  4GC9 A;  3FD9 A;  1UM8 A;  1VEG A;  3LVW A;  3W68 A;  1D0L A;  4M9S A;  1PJJ A;  4BB9 A;  2F5Q A;  2BNK A;  2R45 A;  1MJG M;  3I4V A;  4LGY A;  1XXH E;  2CWB A;  2I7P A;  2L7H A;  4LJ6 A;  4NRV A;  3ZC7 B;  4FWD A;  2J7O A;  1NVM A;  3CF6 E;  4M0W A;  1GAB A;  3L29 A;  4NC6 A;  3FYD A;  3U6O A;  3RGP A;  1FJG M;  3Q8G A;  5ITT A;  2MGW A;  2ZM6 M;  4OVZ B;  1C1K A;  1G8P A;  4JI2 M;  1QDT A;  3EIH A;  1KYI A;  4LJA A;  4RF1 A;  1WXQ A;  2KRU A;  3J7B A;  3TWL A;  5DYI A;  4LF7 M;  2DWN A;  4AQY M;  3GRU A;  1XXH A;  4AG6 A;  1V33 A;  4MGI E;  4MGH A;  1XNR M;  1OAO C;  4QHS A;  4B7G A;  1QAM A;  3KP0 E;  4QNR A;  1MX0 A;  4G4O A;  4G4N A;  3GLG E;  3U61 A;  3VK7 A;  1TDH A;  5EXS A;  5BPV A;  4K0K M;  1Z6T A;  3T6P A;  4LZJ A;  1T3T A;  4F2L A;  1ZAE A;  4GHA A;  1IBL M;  2BJW A;  2DXI A;  2XFT A;  2F5O A;  2E5L M;  3GLH A;  4WUR A;  4PT5 A;  1PJI A;  1J5E M;  5KO3 A;  1ZMW A;  2MRO B;  3KVW A;  3DFZ A;  2DAK A;  2M60 A;  3B89 A;  3FUT A;  1TTE A;  4RKU F;  5FTJ A;  3QYE A;  4JV5 M;  1Q39 A;  3DZD A;  4KHP M;  4AKG A;  1D0K A;  1AIP C;  1HR0 M;  4GKJ M;  2J5Y A;  2QEN A;  3HX3 A;  5EP3 A;  4AZF A;  3JR4 A;  5KPR A;  4DR3 M;  1ZQ9 A;  2KXE A;  3T15 A;  3SAR A;  1ORY B;  2VII A;  3SMS A;  4PD2 A;  1SXJ C;  2Y0T A;  4MGK E;  3B7N A;  4G6Z A;  4DR7 M;  4LG2 A;  2OPF A;  3C9P A;  1PGY A;  5IWA M;  2DAG A;  3U6C A;  3J81 S;  2FNA A;  1LTM A;  4DV3 M;  4JI7 M;  3I51 A;  8CAT A;  1HT2 E;  1CUK A;  1I4W A;  2OO9 A;  2CE7 A;  2DAE A;  4GIP A;  4B08 A;  2DHY A;  3LQQ A;  3GLF E;  5IRE B;  2QPA A;  2VF7 A;  1QAN A;  1ZMV A;  2R18 A;  3U6L A;  3K92 A;  3VKH A;  3KSJ A;  4DV0 M;  3U60 B;  4AI6 A;  1HJP A;  3A45 A;  3I4Y A;  2RRU A;  2UUA M;  2HCB A;  2RKO A;  3AV0 A;  1XMQ M;  4YHH M;  1TH4 A;  1QZE A;  1XNQ M;  3KXE C;  4I81 A;  3HJS A;  3FUX A;  3HU2 A;  2QQ8 A;  2XEP A;  3GPP A;  4B7H A;  3ZH9 B;  3TWK A;  2DKL A;  1VEK A;  1PJQ A;  4DUY M;  1JR3 A;  3GRR A;  2QCU A;  1J7K A;  1F4I A;  1NY6 A;  3HHY A;  1PM5 A;  1SXJ B;  2F4V M;  4I8O A;  2H1R A;  3KS8 A;  4B3M M;  1IM2 A;  1R5L A;  3SYL A;  3SAT A;  1WR1 B;  3KFU G;  2UU9 M;  3FUV A;  3AKZ A;  1DO0 A;  4KT0 F;  2V1U A;  4JI1 M;  4G4Q A;  2ZAN A;  4LJ8 A;  1J09 A;  5GKN A;  2G8L A;  2QBY A;  5EP2 A;  1E94 E;  4LY6 A;  2RGO A;  2XH9 A;  1OFI A;  3AFH A;  1Q3B A;  2CP8 A;  4FD2 A;  3GLI A;  4LFC M;  4DBG B;  1N32 M;  4DR2 M;  1WIV A;  2CRU A;  3LW5 F;  4IBJ A;  1OAI A;  5C1B A;  3K9P A;  3UJN A;  3FUW A;  4LJ5 A;  3U6M A;  4FCW A;  3L25 A;  2MR9 A;  3THG A;  2EJS A;  3KP1 E;  2X8A A;  3KOY E;  1IXS A;  3L28 A;  1XHB A;  4IBK A;  4D82 A;  2ZAO A;  4IBB A;  2VF8 A;  3PNY A;  1W5S A;  3TL4 X;  5FTL A;  1IXR C;  3MJ5 A;  1XB2 B;  3FKE A;  1IN4 A;  1ZMU A;  1R4G A;  3KOW E;  2KNZ A;  4D80 A;  1HNX M;  3K1J A;  5EP1 A;  5EXP A;  3HHW A;  3GPY A;  3BXW A;  1HT1 E;  1XC8 A;  1WGN A;  1R2Y A;  1IBK M;  2UXC M;  1R7R A;  2KHH A;  4DR1 M;  2VDB B;  2R44 A;  4WW0 A;  4NXN M;  1VEJ A;  1BVS A;  1QZM A;  1QQW A;  1G4A E;  2L09 A;  1DGH B;  1NSF A;  2UUB M;  1RU3 A;  2VQF M;  3U6E A;  2LVP C;  3WHL A;  1L2B A;  2QHO B;  4CIZ A;  5IZ7 D;  3OTO M;  2L7I A;  2AHM A;  2YFQ A;  2XZF A;  3HJQ A;  3SMP A;  1QVR A;  5LMU M;  2CV2 A;  2JXN A;  1DO2 A;  1YUB A;  4FCV A;  2LVO C;  3HU3 A;  3AOG A;  4XGI A;  1T43 A;  2L4E A;  4HLQ A;  2CHG A;  4QHT A;  2QNJ A;  3FTE A;  3GRV A;  1G59 A;  2QP9 X;  1EIJ A;  2JUJ A;  4LFB M;  1QUT A;  2K47 A;  4DR6 M;  3C3D A;  3W0F A;  3GLH E;  1PJT A;  4L16 A;  2CHV A;  4B3R M;  1WHC A;  2HKJ A;  5ITQ A;  3VDP A;  3SYK A;  3JR5 A;  2C9C A;  1PRB A;  3QWL A;  4OVZ A;  2CEA A;  3HGI A;  4DR5 M;  1NY5 A;  1MN3 A;  3B7Q A;  3HY5 A;  3KOZ E;  4G3O A;  4NSR A;  4Z6Y A;  3U6D A;  4W5W A;  4XBO A;  4M9Z A;  4DV1 M;  2DZL A;  4MB7 A;  4IJF A;  4MGZ E;  4X62 M;  4DV4 M;  2HWJ A;  2P5T A;  3HWS A;  3U5Z B;  1L2C A;  4HL4 A;  1HQY E;  1Z5B A;  2O01 F;  3LCU A;  4RF0 A;  3GQ5 A;  3GPX A;  4JI6 M;  3R9X B;  2QZ4 A;  3LVV A;  4BLC A;  2R4J A;  2DZN B;  3AOE C;  3I04 M;  3CF0 A;  2KZS A;  4IBC A;  2DWM A;  5ITX A;  5EJC A;  3DOA A;  5C18 A;  5FSW A;  2Y20 A;  3GO8 A;  1IN5 A;  1N36 M;  3D8B A;  4S12 A;  2HL7 A;  4NOO B;  2LVA A;  4MGY E;  3HU1 A;  3GLG B;  4GIT A;  3LQR A;  3J80 S;  1XWI A;  3FTD A;  4MH0 E;  5ITR A;  3VK8 A;  4LRS A;  3KDS E;  3A42 A;  3B74 A;  4XK8 F;  5EXX A;  1HQC A;  3R8F A;  4KOD A;  3MHV C;  2D7H A;  3A46 A;  4ITQ A;  3UGJ A;  1QYR A;  1JR3 E;  1WJ7 A;  1K3W A;  1K3X A;  1IN7 A;  3LMM A;  4NXM M;  4EIW A;  3KOX E;  3IHP A;  3L26 A;  3QAU A;  3FTC A;  1IXZ A;  2OOB A;  2G5G X;  2EUC A;  4PCZ A;  2Z4R A;  2OOA A;  4I4L A;  3U6Q A;  1L1Z A;  3V76 A;  3UMM A;  3IEC A;  1W5T A;  1NJG A;  3SHF A;  4ANR A;  5JI2 E;  1NNJ A;  4JI5 M;  1Q3C A;  4NSO B;  2F5P A;  1IY0 A;  4JN6 A;  4YY3 M;  1D0M A;  1G71 A;  1NO1 A;  1OTR A;  1MU5 A;  4R7G A;  2DWZ B;  4DV2 M;  4NRW A;  4B3S M;  3U60 A;  1Z5A A;  2R46 A;  5IT9 S;  2C5R A;  4LGM A;  4Y28 F;  4B7F A;  2X4A A;  5BR8 M;  3GLI E;  2R4E A;  4X66 M;  3GLF B;  1S3S A;  4GKK M;  3M6A A;  4II7 A;  2LNH C;  4L6V 6;  4BBA A;  1E9S A;  2Y21 A;  2ZTD A;  4D81 A;  1N77 A;  3AL0 C;  2C9O A;  3PFI A;  1E9R A;  4LF5 M;  2VQE M;  2KNA A;  1GJS A;  1OIZ A;  2UXB M;  2M5Z A;  2YR0 A;  1ZV1 A;  1TR8 A;  1YE9 A;  3IG5 A;  5L8R F;  1JR3 D;  4DUZ M;  4B3T M;  4CIS A;  3RGS A;  4PDG A;  7CAT A;  3BOS A;  2C98 A;  3C3E A;  4L8R C;  2Z4S A;  3M7G A;  3PVS A;  2APL A;  2GNO A;  5F3W A;  1KSF X;  2K6B A;  4CGY B;  2I7N A;  3EIE A;  4NL4 H;  4GMQ A;  2FH0 A;  4AKH A;  4Z8X A;  3DA1 A;  3PXG A;  2X49 A;  1SG9 A;  3T38 A;  2FFJ A;  2O25 A;  2ERC A;  5EP4 A;  2JZ0 A;  1V92 A;  3K2L A;  3TWM A;  5FTN A;  2F5N A;  1E32 A;  4FWG A;  2V6Z M;  2CHQ A;  4LJ4 A;  4DV7 M;  1LV7 A;  2CFO A;  4L15 A;  4Q7J A;  2Z7J A;  4GH9 A;  4M0D A;  1KFV A;  2FOI C;  4LZZ A;  4ZPX A;  2GQF A;  2XSZ A;  1P3Q Q;  5DNY A;  4DV6 M;  2R6F A;  3HJ8 A;  1NV8 A;  1VDD A;  2LTU A;  4LCB A;  3ZCB B;  1JQJ C;  2CUZ A;  2EKK A;  2W82 A;  3CF2 A;  4FWH A;  3SAV A;  3I01 M;  4JXJ A;  3FUU A;  5FTK A;  3J27 B;  2XZU A;  1H6U A;  3J7A S;  1V34 A;  1DGH A;  2KEB A;  3SFZ A;  3TE6 A;  3RFW A;  4R3D A;  3T1H M;  4LF8 M;  1NV9 A;  2WSE F;  3SAS A;  3TPZ A;  3W0L B;  4WP2 A;  4KO8 A;  1XMO M;  1G3I A;  4JI3 M;  2KNV A;  1WGL A;  3HHZ A;  3C58 A;  5KQD A;  1OFH A;  4CHT B;  3E21 A;  3SBJ A;  2BWE A;  2V1C A;  2LWX A;  3HZJ A;  4LRT A;  5ITX E;  4GHL A;  2XSZ D;  1NNU C;  3NBX X;  3KSX A;  3J2P B;  3WHK A;  4IBD A;  1DV0 A;  3M0E A;  2J7N A;  4JI8 M;  1TDZ A;  1UFZ A;  2JZ1 A;  2K9D A;  3A98 B;  4A3V B;  1XXH B;  3SAW A;  4LF6 M;  1OIP A;  1TH2 A;  2QSF X;  2RGH A;  4IJE A;  2EA0 A;  5KPT A;  1OKS A;  1D2N A;  2O5R A;  4CJ6 A;  1IN8 A;  3U61 B;  4FVM A;  2XLJ A;  2YNM D;  4AKI A;  1EFU B;  1X37 A;  1Q02 A;  4IBG A;  4IBI A;  2JA2 A;  3NBI A;  5ITY A;  1NHW C;  1GJT A;  2R0I A;  3FRH A;  1GKI A;  2DWL A;  1Z5C A;  5KPZ A;  2HHH M;  3SC3 A;  2G3Q A;  3Q8X A;  3GLH B;  4KLN A;  3U5Z A;  4HEO A;  1JB0 F;  5H37 D;  4LF9 M;  3CTW B;  3PNV A;  3E9S A;  1VG5 A;  1IY2 A;  1QAO A;  1I94 M;  2F5S A;  2DZO B;  2KDL A;  1YLA A;  1C7Y A;  5KQ8 A;  1NHG C;  2JY5 A;  2LHC A;  1GL7 A;  1TF0 B;  3UZU A;  1G41 A;  1GVN A;  2DNA A;  3B7Z A;  3H4J A;  4LJ7 A;  3JAM S;  4FW9 A;  3SAU A;  4LF4 M;  2LVQ D;  3F92 A;  4QNM A;  2D7E A;  2XF3 A;  2L4F A;  3GQ4 A;  1L2D A;  2KZU A;  1K82 A;  4P17 A;  4JI0 M;  3GLG A;  2WSF F;  1GLN A;  2WZJ A;  2N35 A;  4LFA M;  2LHG A;  3GPU A;  1YSY A;  1NJF A;  2UXD M;  5DYG A;  1IQP A;  2Z8Y M;  3HKP A;  2LH0 A;  4UN2 B;  5EQT A;  3GQ3 A;  3T1Y M;  1Y8G A;  3HHX A;  4IIW A;  1T6O A;  4FCT A;  1IBM M;  2ZAM A;  2HAK A;  1N78 A;  1AUA A;  1L8Q A;  1VDL A;  3KS4 A;  3FYC A;  4G4R A;  4DR4 M;  3H4M A;  1QAQ A;  3KW6 A;  1N75 A;  4PDI A;  4DV5 M;  2B3T A;  1SXJ E;  2MJ5 B;  4OW0 A;  3VKG A;  3GP1 A;  1OJL A;  4X64 M;  3NWL A;  2JY8 A;  1DGB A;  4P16 A;  5ITU A;  2LXE A;  3AOE A;  3L27 A;  3VDU A;  2H5X A;  3E46 A;  2KW0 A;  3RE8 A;  3VFD A;  2Y0Q A;  3FTF A;  2YQZ A;  1IFY A;  2KRK A;  3TQS A;  5LMN M;  5E6J A;  3W67 A;  3BBZ A;  1QDR A;  4OX9 M;  2L2D A;  2DEN A;  5A2Q S;  3QYB A;  3K9O A;  3LCV B;  2LVN C;  1SXJ A;  3U6P A;  2OQ4 A;  4JI4 M;  5DFL A;  4RNA A;  2L6O A;  3GLF A;  3VLF B;  3IG8 A;  2R65 A;  4X65 M;  4TUW A;  2LBC A;  2QBY B;  4L78 A;  2CV0 A;  5EXT A;  2Q2E B;  4R71 A;  4OU7 A;  2KA6 B;  1Z59 A;  5E26 A;  5JI3 E;  2DI0 A;  2C96 A;  3GLI B;  2DVW B;  2DAI A;  2XGN A;  2BJV A;  2ZBK B;  4IBF A;  2MH8 A;  4JYA M;  4GEW A;  1HNW M;  2JWS A;  3B9P A;  4REZ A; 
#chains in the Genus database with same CATH homology
 2A5Y B;  4M9X A;  1HNZ M;  1TH3 A;  3GRY A;  2DHR A;  1SXJ D;  2Z3X A;  2FE8 A;  2XFS A;  1IXS B;  3D8L A;  3K8Z A;  1N33 M;  4QOZ C;  4AG5 A;  5FTM A;  4GC5 A;  4IBE A;  1R6B X;  1N34 M;  4LJ9 A;  2UUC M;  4L4U A;  2CV1 A;  1DGG A;  1GL6 A;  4I5S A;  1R2Z A;  1TGU A;  1IY1 A;  1EE8 A;  2EO2 A;  3UK6 A;  3AJI B;  1IN6 A;  3ILK A;  3MK6 A;  4MM3 B;  1L1T A;  2D7G A;  3E4R A;  3U6S A;  4QOS A;  2R62 A;  3L2A A;  5FLX S;  2C99 A;  1DGF A;  4GRI A;  3SHG B;  4AW4 A;  2NQ8 C;  1FNN A;  4GC9 A;  3FD9 A;  1UM8 A;  3LVW A;  4M9S A;  1PJJ A;  4BB9 A;  2F5Q A;  2BNK A;  2R45 A;  3I4V A;  4LGY A;  2I7P A;  2L7H A;  4LJ6 A;  4NRV A;  3ZC7 B;  4FWD A;  2J7O A;  1NVM A;  3CF6 E;  4M0W A;  3L29 A;  3FYD A;  3U6O A;  3RGP A;  1FJG M;  5ITT A;  2ZM6 M;  4OVZ B;  1C1K A;  1G8P A;  4JI2 M;  3EIH A;  1KYI A;  4LJA A;  4RF1 A;  1WXQ A;  2KRU A;  3J7B A;  3TWL A;  5DYI A;  4LF7 M;  2DWN A;  4AQY M;  3GRU A;  1XXH A;  4AG6 A;  4MGH A;  4MGI E;  1XNR M;  4QHS A;  4B7G A;  4G4N A;  1QAM A;  3KP0 E;  4QNR A;  1MX0 A;  4G4O A;  3U61 A;  3VK7 A;  1TDH A;  5EXS A;  5BPV A;  4K0K M;  1Z6T A;  4LZJ A;  1T3T A;  1ZAE A;  4GHA A;  1IBL M;  2BJW A;  2DXI A;  2XFT A;  2F5O A;  2E5L M;  3GLH A;  4WUR A;  4PT5 A;  1PJI A;  1J5E M;  5KO3 A;  3KVW A;  3DFZ A;  2M60 A;  3FUT A;  5FTJ A;  4JV5 M;  1Q39 A;  3DZD A;  4KHP M;  4AKG A;  1HR0 M;  4GKJ M;  2QEN A;  5EP3 A;  4AZF A;  3JR4 A;  5KPR A;  4DR3 M;  1ZQ9 A;  2KXE A;  3T15 A;  3SAR A;  1ORY B;  2VII A;  3SMS A;  4PD2 A;  1SXJ C;  2Y0T A;  4MGK E;  4G6Z A;  4DR7 M;  4LG2 A;  2OPF A;  3U6C A;  5IWA M;  3J81 S;  2FNA A;  4DV3 M;  4JI7 M;  3I51 A;  8CAT A;  1HT2 E;  1I4W A;  4GIP A;  2CE7 A;  4B08 A;  3LQQ A;  5IRE B;  2QPA A;  1QAN A;  2R18 A;  3U6L A;  3K92 A;  3VKH A;  3KSJ A;  4DV0 M;  3U60 B;  4AI6 A;  3A45 A;  3I4Y A;  2UUA M;  2HCB A;  2RKO A;  3AV0 A;  1XMQ M;  4YHH M;  1TH4 A;  1XNQ M;  3KXE C;  4I81 A;  3HJS A;  3FUX A;  3HU2 A;  3GPP A;  2XEP A;  4B7H A;  3ZH9 B;  3TWK A;  4DUY M;  1JR3 A;  3GRR A;  2QCU A;  1J7K A;  1NY6 A;  3HHY A;  1PM5 A;  1SXJ B;  2F4V M;  4I8O A;  2H1R A;  3KS8 A;  4B3M M;  1IM2 A;  3SYL A;  3SAT A;  3KFU G;  2UU9 M;  3FUV A;  3AKZ A;  1DO0 A;  2V1U A;  4JI1 M;  4G4Q A;  2ZAN A;  4LJ8 A;  1J09 A;  5GKN A;  2G8L A;  2QBY A;  5EP2 A;  1E94 E;  4LY6 A;  2RGO A;  2XH9 A;  1OFI A;  3AFH A;  1Q3B A;  4FD2 A;  3GLI A;  4LFC M;  1N32 M;  4DR2 M;  4IBJ A;  5C1B A;  3UJN A;  3FUW A;  4LJ5 A;  3U6M A;  4FCW A;  3L25 A;  3THG A;  3KP1 E;  2X8A A;  3KOY E;  3L28 A;  4IBK A;  1XHB A;  4D82 A;  2ZAO A;  4IBB A;  3PNY A;  3TL4 X;  1W5S A;  5FTL A;  1IXR C;  3MJ5 A;  3FKE A;  1IN4 A;  3KOW E;  4D80 A;  1HNX M;  3K1J A;  5EP1 A;  5EXP A;  3HHW A;  3GPY A;  1HT1 E;  1XC8 A;  1R2Y A;  1IBK M;  2UXC M;  1R7R A;  4DR1 M;  4WW0 A;  4NXN M;  1QZM A;  1QQW A;  1G4A E;  2L09 A;  1DGH B;  1NSF A;  2UUB M;  2VQF M;  3U6E A;  3WHL A;  1L2B A;  5IZ7 D;  3OTO M;  2L7I A;  2AHM A;  2YFQ A;  2XZF A;  3HJQ A;  3SMP A;  1QVR A;  5LMU M;  2CV2 A;  1DO2 A;  1YUB A;  4FCV A;  3HU3 A;  3AOG A;  4XGI A;  4QHT A;  4HLQ A;  2CHG A;  3FTE A;  3GRV A;  1G59 A;  2QP9 X;  4LFB M;  2K47 A;  4DR6 M;  3W0F A;  4L16 A;  2CHV A;  4B3R M;  2HKJ A;  5ITQ A;  3VDP A;  3SYK A;  3JR5 A;  2C9C A;  3QWL A;  4OVZ A;  2CEA A;  3HGI A;  4DR5 M;  1NY5 A;  4NSR A;  4Z6Y A;  3KOZ E;  3U6D A;  4W5W A;  4XBO A;  4M9Z A;  4DV1 M;  4MB7 A;  4IJF A;  4MGZ E;  4X62 M;  4DV4 M;  2P5T A;  3HWS A;  3U5Z B;  1L2C A;  4HL4 A;  1HQY E;  1Z5B A;  4JI6 M;  4RF0 A;  3GQ5 A;  3GPX A;  3R9X B;  2QZ4 A;  3LVV A;  4BLC A;  3AOE C;  2DZN B;  2R4J A;  3CF0 A;  2KZS A;  4IBC A;  2DWM A;  5ITX A;  5EJC A;  3DOA A;  5C18 A;  5FSW A;  2Y20 A;  3GO8 A;  1IN5 A;  1N36 M;  3D8B A;  4S12 A;  2HL7 A;  4NOO B;  4MGY E;  3HU1 A;  3GLG B;  4GIT A;  3LQR A;  3J80 S;  1XWI A;  3FTD A;  4MH0 E;  5ITR A;  3VK8 A;  4LRS A;  3KDS E;  3A42 A;  5EXX A;  1HQC A;  3R8F A;  4KOD A;  3MHV C;  2D7H A;  3A46 A;  4ITQ A;  3UGJ A;  1QYR A;  1K3W A;  1K3X A;  1IN7 A;  3LMM A;  4NXM M;  4EIW A;  3KOX E;  3L26 A;  3QAU A;  3FTC A;  1IXZ A;  2G5G X;  2EUC A;  4PCZ A;  2Z4R A;  4I4L A;  3U6Q A;  1L1Z A;  3UMM A;  1W5T A;  1NJG A;  3SHF A;  5JI2 E;  1NNJ A;  4JI5 M;  1Q3C A;  4NSO B;  2F5P A;  1IY0 A;  4JN6 A;  4YY3 M;  1MU5 A;  4R7G A;  2DWZ B;  4DV2 M;  4NRW A;  4B3S M;  3U60 A;  1Z5A A;  2R46 A;  5IT9 S;  2C5R A;  4LGM A;  4B7F A;  2X4A A;  5BR8 M;  2R4E A;  4X66 M;  3GLF B;  1S3S A;  4GKK M;  3M6A A;  4II7 A;  2LNH C;  4BBA A;  1N77 A;  1E9S A;  2Y21 A;  4D81 A;  3AL0 C;  2C9O A;  3PFI A;  1E9R A;  4LF5 M;  2VQE M;  2UXB M;  2M5Z A;  2YR0 A;  1YE9 A;  3IG5 A;  1JR3 D;  4DUZ M;  4B3T M;  4CIS A;  3RGS A;  4PDG A;  7CAT A;  3BOS A;  2C98 A;  4L8R C;  2Z4S A;  3M7G A;  3PVS A;  5F3W A;  1KSF X;  4CGY B;  2I7N A;  3EIE A;  4NL4 H;  4GMQ A;  4AKH A;  4Z8X A;  3DA1 A;  3PXG A;  2X49 A;  3T38 A;  2FFJ A;  2ERC A;  5EP4 A;  3K2L A;  3TWM A;  5FTN A;  2F5N A;  1E32 A;  4FWG A;  2V6Z M;  2CHQ A;  4LJ4 A;  4DV7 M;  1LV7 A;  2CFO A;  4L15 A;  2Z7J A;  4GH9 A;  4M0D A;  1KFV A;  2FOI C;  4LZZ A;  4ZPX A;  2XSZ A;  5DNY A;  4DV6 M;  3HJ8 A;  1VDD A;  4LCB A;  3ZCB B;  1JQJ C;  2CUZ A;  3CF2 A;  2W82 A;  4FWH A;  3SAV A;  4JXJ A;  3FUU A;  5FTK A;  3J27 B;  2XZU A;  1H6U A;  3J7A S;  1DGH A;  2KEB A;  3SFZ A;  3TE6 A;  3RFW A;  4R3D A;  3T1H M;  4LF8 M;  3SAS A;  3TPZ A;  3W0L B;  4KO8 A;  1XMO M;  1G3I A;  4JI3 M;  3C58 A;  3HHZ A;  5KQD A;  1OFH A;  4CHT B;  3SBJ A;  2V1C A;  4LRT A;  2LWX A;  5ITX E;  4GHL A;  2XSZ D;  1NNU C;  3KSX A;  3J2P B;  3WHK A;  4IBD A;  3M0E A;  2J7N A;  4JI8 M;  1TDZ A;  4A3V B;  3SAW A;  4LF6 M;  3A98 B;  1XXH B;  1TH2 A;  2RGH A;  4IJE A;  2EA0 A;  5KPT A;  1D2N A;  2O5R A;  3U61 B;  1IN8 A;  4AKI A;  4FVM A;  2XLJ A;  2YNM D;  1X37 A;  4IBG A;  4IBI A;  2JA2 A;  3NBI A;  5ITY A;  1NHW C;  2DWL A;  1GKI A;  1Z5C A;  5KPZ A;  2HHH M;  3SC3 A;  3Q8X A;  3GLH B;  4KLN A;  3U5Z A;  4LF9 M;  5H37 D;  3CTW B;  3PNV A;  3E9S A;  1IY2 A;  1QAO A;  1I94 M;  2F5S A;  2DZO B;  5KQ8 A;  1NHG C;  1GL7 A;  3UZU A;  1G41 A;  1GVN A;  3JAM S;  3SAU A;  4LJ7 A;  4LF4 M;  4FW9 A;  4QNM A;  2D7E A;  2XF3 A;  3GQ4 A;  1L2D A;  2KZU A;  1K82 A;  4JI0 M;  3GLG A;  1GLN A;  4LFA M;  2UXD M;  3GPU A;  1YSY A;  1NJF A;  5DYG A;  1IQP A;  3HKP A;  5EQT A;  2LH0 A;  3GQ3 A;  3T1Y M;  3HHX A;  4IIW A;  1IBM M;  4FCT A;  2ZAM A;  1N78 A;  1L8Q A;  4G4R A;  3KS4 A;  4DR4 M;  3FYC A;  3H4M A;  1QAQ A;  3KW6 A;  1N75 A;  4PDI A;  4DV5 M;  3VKG A;  1SXJ E;  4OW0 A;  3GP1 A;  1OJL A;  4X64 M;  3NWL A;  4P16 A;  1DGB A;  5ITU A;  2LXE A;  3AOE A;  3L27 A;  3VDU A;  2KW0 A;  3RE8 A;  3VFD A;  2Y0Q A;  3FTF A;  2YQZ A;  2KRK A;  3TQS A;  5LMN M;  5E6J A;  4OX9 M;  5A2Q S;  3U6P A;  1SXJ A;  4JI4 M;  2OQ4 A;  4RNA A;  2L6O A;  3GLF A;  3VLF B;  3IG8 A;  2R65 A;  4X65 M;  4TUW A;  2QBY B;  4L78 A;  2CV0 A;  5EXT A;  2Q2E B;  4OU7 A;  2KA6 B;  1Z59 A;  5E26 A;  5JI3 E;  2C96 A;  3GLI B;  2DVW B;  2XGN A;  2BJV A;  2ZBK B;  4IBF A;  4JYA M;  1HNW M;  3B9P A;  4REZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...