1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
4X65M 5ITQA 3VK8A 2UXDM 5ITYA 5IT9S 5LMUM 4DUZM 1N36M 4NRWA 1Q3CA 3C58A 4YHHM 1HNWM 1MU5A 4LF8M 2HHHM 1N32M 4JI7M 4NXNM 1EE8A 3A45A 1PM5A 3SARA 4JI6M 3U6PA 1FJGM 2ZM6M 3J7AS 4JV5M 4ITQA 4DR1M 3GPUA 3SATA 2HKJA 4JI3M 2UXBM 4JI1M 1PJJA 3DOAA 3VK7A 5ITTA 3GPXA 4NRVA 3W0FA 1IBLM 3JR5A 3U6QA 3U6SA 1TDHA 4AQYM 3SBJA 3GPPA 4LFAM 4DV7M 1K82A 1HNXM 4LF7M 4JI2M 4DV1M 1KFVA 4DR6M 4LFCM 1Z59A 3GQ3A 2VQEM 4G4QA 4MB7A 1L1ZA 2UXCM 5IWAM 4DUYM 1Z5BA 4JI5M 3U6MA 1Z5AA 2F4VM 3A42A 1L2DA 3J80S 2XZFA 4DV4M 1NNJA 1L1TA 4PDIA 3SAVA 4LF9M 1Q3BA 3JAMS 4DV5M 2UUCM 1MX0A 5ITXE 3J81S 4LF6M 2UUAM 2UU9M 2OQ4A 4B3MM 3T1YM 1N33M 4X62M 4X66M 4G4OA 4DV6M 4K0KM 4PDGA 1XNRM 2F5SA 3U6EA 3GO8A 1L2CA 4JYAM 5LMNM 4G4NA 1R2YA 1K3WA 4DR7M 3TWLA 4LF5M 1N34M 1J5EM 4G4RA 5ITRA 3GQ4A 1HNZM 4DR2M 3OTOM 1PJIA 5A2QS 4PD2A 3TWMA 2F5OA 1HR0M 4PCZA 2F5PA 3GP1A 5BR8M 3TWKA 2UUBM 3SASA 1IBKM 4DV0M 2F5NA 4NXMM 3SAUA 3U6DA 4KHPM 4B3TM 1XMQM 3JR4A 2XZUA 4B3SM 3SAWA 2OPFA 4GKKM 3U6OA 4DV2M 4YY3M 5ITXA 3U6LA 5FLXS 4DR5M 1XC8A 4GKJM 4LF4M 1Q39A 4B3RM 4JI0M 1R2ZA 2ZBKB 1K3XA 2Q2EB 1XMOM 2VQFM 4CISA 1TDZA 4DV3M 1L2BA 2EA0A 1XNQM 1Z5CA 3T1HM 4OX9M 3GPYA 4DR3M 1IBMM 5ITUA 2E5LM 2F5QA 4LFBM 4JI4M 4DR4M 3GQ5A 3U6CA 4X64M 3A46A 1I94M 4JI8M
chains in the Genus database with same CATH superfamily
4OU7A 1IY0A 1TF0B 1NHWC 1XWIA 1VEKA 5ITYA 2UXDM 3CF2A 5LMUM 2C9OA 3U61A 4NRWA 4MGIE 1EIJA 1IY1A 1H6UA 4YHHM 4LJ4A 2K9DA 3HWSA 2HHHM 1Z6TA 3MK6A 1WGLA 7CATA 2ZTCA 3PVSA 4QHSA 4R3DA 1R7RA 1FJGM 2BWEA 4Z8XA 4JV5M 2V6ZM 1V34A 2OOBA 4IBIA 4ITQA 3GPUA 1QZEA 3SATA 4IBDA 3HKPA 4ZPXA 5FTMA 1IXRC 4DBGB 4LRSA 5C1BA 1G3IA 1WXQA 5EP4A 2XH9A 1NY6A 4G3OA 1NV9A 2BJWA 1IBLM 1VDLA 3RFWA 2FNAA 4MM3B 2LHGA 3SMSA 4FWGA 1TDHA 2L4EA 3E9SA 5FTNA 3GPPA 4QHTA 1N75A 4DV7M 3V76A 3AL0C 4JI2M 3K9PA 4LFCM 3GQ3A 2VQEM 4MB7A 1GVNA 4B7FA 5IWAM 3J7AS 4LRTA 4S12A 3HHWA 3ILKA 2KEBA 4LJ5A 2NQ8C 2DAKA 1VEJA 2J7NA 2R44A 4IBBA 3UMMA 4Y28F 4FD2A 2J7OA 1NNJA 1IXZA 3SC3A 2CRUA 2KZSA 2KRKA 2HCBA 3MMPA 3U5ZA 1J7KA 3PXGA 2BJVA 4OW0A 2LWXA 4FVMA 1Y8GA 4LF6M 2UUAM 5BPVA 1VQ1A 3M0EA 4MGZE 2R45A 5EXXA 4X62M 1QYRA 1YSYA 2Y21A 2W82A 3FKEA 4Q7JA 2DAIA 3FUUA 4DR7M 2G3QA 1C7YA 2MJ5B 2YFQA 3HU1A 2XF3A 4PT5A 1LV7A 1GKIA 2CEAA 3B7NA 3GQ4A 1HNZM 3FRIA 4GH9A 3GRRA 4OVZA 4FCVA 4L6V6 2I7PA 4Z6YA 2EO2A 3B74A 3ZQJA 3SASA 4XK8F 2KRUA 4AKGA 2CV2A 4NXMM 4HL4A 1IN5A 3I4YA 4IBFA 2L2DA 4LZZA 3KS4A 4GKKM 2DHYA 3FTFA 1QVRA 2XFTA 4DR5M 3KOZE 5GKNA 5EJCA 3VDPA 2RKOA 1J09A 1KSFX 4KT0F 3ZH9B 1IXSB 4NSRA 3HHXA 4CISA 4JN6A 4RF0A 3KS8A 4LG2A 2L7HA 2KXEA 2C96A 1Z5CA 3T1HM 4MGYE 4DR3M 4IBKA 1SXJA 3QYEA 2JP7A 2C98A 2FH0A 2EKKA 4GRIA 2E5LM 3A98B 2F5QA 3MHVC 4JI4M 4DR4M 4LFBM 3U6CA 1QDRA 2CUZA 1PGYA 1QAQA 2LHCA 3HHYA 3PNYA 5ITQA 2B3TA 4LJAA 3VK8A 5FSWA 1NNUC 1ORYB 2WSCF 1IN6A 4FCWA 4GIPA 4DUZM 1IN7A 1HJPA 1OAIA 1QZMA 4LJ6A 2M60A 2R6FA 1JR3A 3HHZA 2JY5A 2CFOA 4LF8M 4GC9A 1MN3A 1WHCA 2L4FA 1PJQA 1SXJD 4NXNM 1DO2A 2Y0QA 2R62A 1EE8A 2WZJA 1WIVA 3A45A 2QSFX 4D82A 3U6PA 2X4AA 3GRYA 4LCBA 2DWLA 3LVWA 2JXNA 1EFUB 4GC5A 2UXBM 2WSEF 4JI1M 3L29A 1PJJA 2KHHA 1D2NA 1VG5A 2O5RA 5C18A 1TH2A 3VK7A 4M0DA 3GPXA 3AOEA 4NRVA 2QZ4A 4GHLA 3JR5A 1ZMUA 2LNHC 5EXTA 1OQYA 1JR3D 1S3SA 1G4AE 1YE9A 2ZAOA 1E94E 1GL6A 3E4RA 3D8LA 3L28A 5FTKA 4LFAM 4B7HA 1K82A 1KFVA 3BOSA 2R4EA 3IECA 4DR6M 2DWZB 4IBGA 3K9OA 2UXCM 4GHAA 3M7GA 2Z4RA 3HU2A 2DAMA 2R65A 3B7QA 1Z5BA 3B9PA 2X49A 3RE8A 1L1TA 3J80S 2LVPC 3TL4X 4DV4M 1N78A 2CHVA 2GQFA 2K47A 3T6PA 1TH3A 2ERCA 4PDIA 4P16A 2HAKA 4NC6A 4IBJA 3JAMS 4HLQA 1HQYE 3KXEC 3Q8GA 2GNOA 4AW4A 3ZCBB 3HZJA 5ITXE 3H4MA 1E32A 4B3MM 1PJSA 3I4VA 4R71A 4G4OA 5KQDA 4IBCA 1OFIA 4PDGA 5FTJA 1XNRM 3QYBA 3CGWA 4JYAM 3NWLA 4G4NA 1R2YA 3W0LB 3L26A 2JY8A 3KW6A 3TWLA 3AJIB 3T38A 4LF5M 3TPZA 1J5EM 3UGJA 5ITRA 3K1JA 2QBYB 2ZAMA 5FTLA 4DR2M 4AKIA 5A2QS 3GLFE 3GLFB 1D0LA 1HR0M 1D0MA 4PCZA 4ANRA 3QAUA 1FNNA 2UUBM 1GJSA 3SHFA 3PFIA 5EP1A 2EJSA 3LQQA 2F5NA 2MH8A 1QUSA 2QP9X 1YLAA 4B08A 1YUBA 2XZUA 3M6AA 2LXEA 3U6OA 1ZMVA 3IG8A 4DV2M 4BB9A 1XXHE 1XXHB 5JI2E 3UK6A 3FUWA 5DFLA 2APLA 1NO1A 3C3EA 1T6OA 3KOYE 2Z8YM 4LGMA 1Q39A 1W5TA 2RRUA 1R2ZA 2ZBKB 3ZC7B 3WHKA 3C3DA 3THGA 3TE6A 4FW9A 2LH0A 2DNAA 4LJ7A 4LJ9A 2DHRA 2XSZD 2EA0A 3FYCA 3E21A 4WURA 2JNHA 2G5GX 3NBXX 3UZUA 4A3VB 4AZFA 2J5YA 4AG5A 1IBMM 4TUWA 4I81A 3FTEA 5IZ7D 1CUKA 1X37A 3RGPA 3IG5A 3HJ8A 3SMPA 2BNKA 2DVWB 4FWDA 5JI3E 1JB0F 2HL7A 2CWBA 3FTCA 2CHQA 2R0IA 3SYLA 1DGGA 2DI0A 3FRHA 5DNYA 3FYDA 4XBOA 1N36M 3KVWA 2QPAA 5E6JA 2XEPA 1IN4A 3C58A 1MU5A 2FS1A 3GLGE 3GLGB 3H4JA 3GLIE 1IXSA 3I04M 3I01M 3U60B 4JI7M 1N32M 2LVAA 5EXSA 3SHGB 2C5RA 1T3TA 1OAOC 1QAMA 2R18A 4JI6M 3LQRA 1DO0A 2VF8A 4DR1M 1NV8A 3Q8XA 5KPRA 5DYIA 2HKJA 1IY2A 1WJ7A 3C9PA 4I8OA 3BXWA 4QNMA 3D8BA 2KNAA 3LMMA 1DGHB 1DGHA 3DOAA 4AKHA 3KP1E 2WSFF 5ITTA 3LVVA 1XB2B 2LVQD 3FD9A 1G59A 3W0FA 4M9SA 2JY7A 4CIZA 3U6QA 1GO5A 1IFYA 1BVSA 3U6SA 1NY5A 2K6BA 2R46A 3FE3A 4MGHA 3SBJA 3J2PB 4REZA 2Y0TA 1HNXM 4LF7M 1C1KA 4IIWA 1Z59A 3EIEA 1UM8A 4G4QA 2Y20A 4RF1A 4DUYM 1G41A 2VIIA 3SARA 3GLHE 2KNVA 3GLHB 4B7GA 3U6MA 3B89A 4NSOB 4F2LA 4JI5M 3A42A 4M9ZA 4XGIA 1QANA 2V1CA 4QOZC 1QQWA 3SAVA 4LF9M 1DV0A 2CV0A 3HGIA 1SXJC 4FCTA 1HQCA 1MX0A 4I5SA 1XHBA 2HWJA 4GEWA 1UFZA 4QNRA 1SG9A 2XFSA 4K0KM 2RGHA 1IM2A 3NBIA 3GO8A 2MR9A 3HJQA 4KODA 2LVOC 4AG6A 2XGNA 3VKGA 2LTUA 3AOGA 1N34M 2LBCA 2VDBB 3HX3A 4IJEA 4D81A 5IREB 1PJIA 3KOWE 1GJTA 2YNMD 3DFZA 3K2LA 4CHTB 5BR8M 3TWKA 4MGKE 4DV0M 4RNAA 2VF7A 4NL4H 4KHPM 3QWLA 1XMQM 3JR4A 4B3SM 1VDDA 3RGSA 2JA2A 3SAWA 2KZUA 3CF6E 3TQSA 2CV1A 1GABA 1DGBA 5ITXA 4YY3M 2LVNC 1Q02A 5FLXS 3AOEC 3HJSA 1G8PA 2FOIC 3U61B 1TTEA 1QAOA 2KDLA 2DAEA 4GKJM 4GMQA 3PNVA 5KPZA 2Z3XA 1K3XA 5EXPA 1XMOM 2VQFM 3W67A 4BLCA 1NJGA 2V1UA 3GRVA 1T43A 2QBYA 3KOXE 1L2BA 1XNQM 4AI6A 4L15A 3GLFA 3J7BA 1ZQ9A 1V92A 1V33A 3GPYA 3VDUA 2QENA 2DAGA 1AUAA 1E9RA 4II7A 5ITUA 2XSZA 3J27B 3GQ5A 2L09A 4X64M 1I94M 1RU3A 4NOOB 2QCUA 4GITA 2I7NA 1AIPC 1NHGC 4X65M 2KW0A 2DKLA 5EP2A 1XXHA 2CE7A 3L27A 4CGYB 5IT9S 3W68A 1I4WA 4F1IA 1HT2E 2O01F 2FE8A 1ZMWA 1Q3CA 2N35A 1HNWM 1VEGA 5E26A 1JQJC 1L8QA 3K92A 1OFHA 5F3WA 2R4JA 2JY6B 2P5TA 1TGUA 1NVMA 4I4LA 1PM5A 2ZM6M 1D0KA 3FUXA 4M0WA 2M5ZA 4W5WA 4JI3M 1PRBA 3U5ZB 3R8FA 1OKSA 3FUVA 3GRUA 2D7EA 4LZJA 4LGYA 2DZNB 4KLNA 2DENA 4FWHA 1QUTA 2BWBA 2DWMA 1MJGM 2L7IA 3UJNA 3SYKA 3DZDA 2DWNA 2QHOB 4AQYM 1R6BX 2Z7JA 2A5YB 2EKFA 1DGFA 8CATA 5KPTA 4DV1M 1TR8A 3CF0A 2YR0A 1L1ZA 4M9XA 1LTMA 2H1RA 1WR1B 2JUJA 3HY5A 3GLGA 4KO8A 4P17A 4UN2B 3GLIB 3GLIA 2OO9A 4OVZB 3U60A 1OIPA 2CHGA 1Z5AA 1TH4A 5L8RF 2F4VM 1L2DA 2XZFA 1OIZA 1W5SA 2Z4SA 1GLNA 3HU3A 2QQ8A 3L2AA 3AV0A 1OJLA 2QNJA 3WHLA 3IHPA 1Q3BA 4DV5M 2RGOA 2UUCM 1R4GA 1G71A 3LCVB 3DA1A 4L16A 1GL7A 3J81S 5DYGA 4IJFA 2UU9M 2C99A 2JZ1A 2OQ4A 1R5LA 3T1YM 1N33M 2D7HA 2DZOB 4X66M 1NJFA 4CJ6A 4DV6M 4G6ZA 3SFZA 5H37D 3F92A 4EIWA 3U6EA 1L2CA 2F5SA 2YQZA 3I51A 3VFDA 5LMNM 4L4UA 2FFJA 3VLFB 1K3WA 2DZLA 4L8RC 2KA6B 2KNZA 1KYIA 3LW5F 1PJTA 2DXIA 4G4RA 2MGWA 2ZTDA 3BBZA 3KFUG 4R7GA 4WW0A 2JZ0A 2L6OA 3OTOM 3FTDA 4PD2A 3TWMA 2F5OA 3GLHA 3AKZA 3R9XB 1OTRA 2C9CA 3K8ZA 1SXJE 1SXJB 2F5PA 3GP1A 4WP2A 2ZANA 4BBAA 1IQPA 1NSFA 1IBKM 2EUCA 2CP8A 3L25A 1IN8A 5KO3A 3U6DA 3SAUA 4B3TM 2X8AA 3KSJA 4JI8M 3LCUA 4LY6A 4QOSA 2OPFA 1F4IA 1ZAEA 2H5XA 2MROB 3FUTA 4IBEA 4L78A 3T15A 3U6LA 3KP0E 1HT1E 1XC8A 1ZV1A 5EP3A 1N77A 3KSXA 1JR3E 4LF4M 4B3RM 4JXJA 4JI0M 3AFHA 2G8LA 3VKHA 3E46A 2Q2EB 5KQ8A 1QDTA 1A5TA 4MH0E 3MJ5A 1TDZA 2XLJA 4DV3M 3EIHA 1WGNA 3B7ZA 3CTWB 5EQTA 4OX9M 1E9SA 2O25A 4D80A 2K0BX 2JWSA 2D7GA 2OOAA 1P3QQ 3KDSE 4LJ8A 3A46A 4HEOA 2AHMA 4RKUF
chains in the Genus database with same CATH topology
4OU7A 1IY0A 1NHWC 1XWIA 2UXDM 5ITYA 3CF2A 5LMUM 2C9OA 3U61A 4NRWA 4MGIE 1IY1A 1H6UA 4YHHM 4LJ4A 3HWSA 2HHHM 1Z6TA 3MK6A 7CATA 3PVSA 4QHSA 4R3DA 1R7RA 1FJGM 4Z8XA 4JV5M 2V6ZM 4IBIA 4ITQA 3GPUA 3SATA 4IBDA 3HKPA 4ZPXA 5FTMA 1IXRC 4LRSA 5C1BA 1G3IA 1WXQA 5EP4A 2XH9A 1NY6A 2BJWA 1IBLM 3RFWA 2FNAA 4MM3B 3SMSA 4FWGA 1TDHA 5FTNA 3E9SA 3GPPA 4QHTA 1N75A 4DV7M 3AL0C 4JI2M 4LFCM 3GQ3A 2VQEM 4MB7A 1GVNA 4B7FA 5IWAM 4LRTA 4S12A 3HHWA 3ILKA 2KEBA 4LJ5A 2NQ8C 2J7NA 4IBBA 3UMMA 1NNJA 4FD2A 2J7OA 1IXZA 3SC3A 2KZSA 2KRKA 2HCBA 3U5ZA 1J7KA 3PXGA 2BJVA 4OW0A 2LWXA 4FVMA 4LF6M 2UUAM 5BPVA 3M0EA 4MGZE 2R45A 5EXXA 4X62M 1QYRA 1YSYA 2Y21A 2W82A 3FKEA 3FUUA 4DR7M 2YFQA 3HU1A 2XF3A 4PT5A 1LV7A 1GKIA 2CEAA 3GQ4A 1HNZM 4GH9A 3GRRA 4OVZA 4FCVA 4Z6YA 2I7PA 2EO2A 3SASA 2KRUA 4AKGA 2CV2A 4NXMM 4HL4A 1IN5A 3I4YA 4IBFA 4LZZA 3KS4A 4GKKM 3FTFA 1QVRA 2XFTA 4DR5M 3KOZE 5GKNA 5EJCA 3VDPA 2RKOA 1J09A 1KSFX 3ZH9B 1IXSB 4NSRA 3HHXA 4CISA 4JN6A 4RF0A 3KS8A 4LG2A 2L7HA 2KXEA 2C96A 1Z5CA 3T1HM 4MGYE 4DR3M 4IBKA 1SXJA 2C98A 4GRIA 2E5LM 2F5QA 4LFBM 3A98B 4JI4M 3MHVC 4DR4M 3U6CA 2CUZA 1QAQA 3HHYA 3PNYA 5ITQA 4LJAA 3VK8A 5FSWA 1NNUC 1ORYB 4FCWA 1IN6A 4GIPA 4DUZM 1IN7A 1QZMA 4LJ6A 2M60A 1JR3A 3HHZA 4LF8M 2CFOA 4GC9A 4NXNM 1SXJD 1DO2A 2Y0QA 2R62A 1EE8A 3A45A 3SARA 3J7AS 4D82A 3U6PA 2X4AA 3GRYA 4LCBA 2DWLA 3LVWA 4GC5A 2UXBM 4JI1M 3L29A 1PJJA 1D2NA 2O5RA 5C18A 1TH2A 3VK7A 4M0DA 3GPXA 3AOEA 4NRVA 2QZ4A 4GHLA 3JR5A 2LNHC 5EXTA 1JR3D 1S3SA 1G4AE 1YE9A 2ZAOA 1E94E 1GL6A 3E4RA 3D8LA 3L28A 5FTKA 4LFAM 4B7HA 1K82A 1KFVA 3BOSA 2R4EA 4DR6M 2DWZB 4IBGA 2UXCM 4GHAA 3M7GA 2Z4RA 3HU2A 2R65A 1Z5BA 3B9PA 2X49A 3RE8A 1L1TA 3J80S 3TL4X 4DV4M 1N78A 2CHVA 2K47A 1TH3A 2ERCA 4PDIA 4P16A 4IBJA 3JAMS 4HLQA 1HQYE 3KXEC 4AW4A 3ZCBB 5ITXE 3H4MA 1E32A 4B3MM 3I4VA 4G4OA 5KQDA 4IBCA 1OFIA 4PDGA 5FTJA 1XNRM 4JYAM 3NWLA 4G4NA 1R2YA 3W0LB 3L26A 3TWLA 3KW6A 3AJIB 3T38A 4LF5M 3TPZA 1J5EM 3UGJA 5ITRA 3K1JA 2QBYB 2ZAMA 5FTLA 4DR2M 4AKIA 5A2QS 3GLFB 1HR0M 4PCZA 3QAUA 1FNNA 2UUBM 3SHFA 3PFIA 5EP1A 3LQQA 2F5NA 2QP9X 4B08A 1YUBA 2XZUA 3M6AA 2LXEA 3U6OA 3IG8A 4DV2M 4BB9A 1XXHB 5JI2E 3UK6A 3FUWA 3KOYE 4LGMA 1Q39A 1W5TA 1R2ZA 2ZBKB 3ZC7B 3WHKA 3THGA 3TE6A 4FW9A 2LH0A 4LJ7A 4LJ9A 2DHRA 2XSZD 2EA0A 3FYCA 4WURA 2G5GX 3UZUA 4A3VB 4AZFA 1IBMM 4AG5A 4TUWA 4I81A 3FTEA 5IZ7D 1X37A 3RGPA 3IG5A 3HJ8A 3SMPA 2BNKA 2DVWB 4FWDA 5JI3E 2HL7A 3FTCA 2CHQA 3SYLA 1DGGA 5DNYA 3FYDA 4XBOA 1N36M 3KVWA 2QPAA 5E6JA 2XEPA 1IN4A 3C58A 1MU5A 3GLGB 1N32M 3U60B 4JI7M 5EXSA 3SHGB 2C5RA 1T3TA 1QAMA 2R18A 4JI6M 3LQRA 1DO0A 4DR1M 3Q8XA 5KPRA 5DYIA 2HKJA 1IY2A 4I8OA 4QNMA 3D8BA 3LMMA 1DGHB 1DGHA 3DOAA 4AKHA 3KP1E 5ITTA 3LVVA 1G59A 3FD9A 3W0FA 4M9SA 3U6QA 3U6SA 1NY5A 2R46A 4MGHA 3SBJA 3J2PB 4REZA 2Y0TA 1HNXM 4LF7M 1C1KA 4IIWA 1Z59A 3EIEA 1UM8A 4G4QA 2Y20A 4RF1A 4DUYM 1G41A 2VIIA 4B7GA 3GLHB 4JI5M 3U6MA 4NSOB 3A42A 4M9ZA 4XGIA 1QANA 2V1CA 4QOZC 1QQWA 3SAVA 4LF9M 2CV0A 3HGIA 1SXJC 4FCTA 1HQCA 1MX0A 4I5SA 1XHBA 4QNRA 2XFSA 4K0KM 2RGHA 1IM2A 3NBIA 3GO8A 3HJQA 4KODA 4AG6A 2XGNA 3VKGA 3AOGA 1N34M 4IJEA 4D81A 5IREB 1PJIA 3KOWE 2YNMD 3DFZA 3K2LA 4CHTB 5BR8M 3TWKA 4MGKE 4DV0M 4RNAA 4NL4H 4KHPM 3QWLA 1XMQM 3JR4A 4B3SM 1VDDA 3RGSA 2JA2A 3SAWA 2KZUA 3CF6E 3TQSA 1DGBA 5ITXA 4YY3M 5FLXS 3AOEC 3HJSA 1G8PA 2FOIC 3U61B 1QAOA 4GKJM 4GMQA 3PNVA 5KPZA 2Z3XA 1K3XA 5EXPA 1XMOM 2VQFM 4BLCA 2V1UA 1NJGA 3GRVA 2QBYA 3KOXE 1L2BA 1XNQM 4AI6A 4L15A 3GLFA 3J7BA 1ZQ9A 3GPYA 3VDUA 2QENA 1E9RA 4II7A 5ITUA 2XSZA 3J27B 3GQ5A 2L09A 4X64M 1I94M 4NOOB 2QCUA 4GITA 2I7NA 1NHGC 4X65M 2KW0A 4CGYB 5EP2A 1XXHA 2CE7A 3L27A 5IT9S 1I4WA 1HT2E 2FE8A 1Q3CA 1HNWM 5E26A 1JQJC 1L8QA 3K92A 1OFHA 5F3WA 2R4JA 2P5TA 4I4LA 1TGUA 1NVMA 1PM5A 2ZM6M 3FUXA 4M0WA 2M5ZA 4W5WA 4JI3M 3U5ZB 3R8FA 3FUVA 3GRUA 4LZJA 2D7EA 4LGYA 2DWMA 2DZNB 4KLNA 2CV1A 4FWHA 2L7IA 3UJNA 3SYKA 3DZDA 2DWNA 4AQYM 1R6BX 2Z7JA 2A5YB 1DGFA 8CATA 5KPTA 4DV1M 3CF0A 2YR0A 1L1ZA 4M9XA 2H1RA 3GLGA 4KO8A 3GLIB 3GLIA 3U60A 4OVZB 2CHGA 1Z5AA 1TH4A 2F4VM 1L2DA 2XZFA 1W5SA 2Z4SA 1GLNA 3HU3A 3L2AA 3AV0A 1OJLA 3WHLA 1Q3BA 4DV5M 2RGOA 2UUCM 3DA1A 4L16A 1GL7A 3J81S 5DYGA 4IJFA 2UU9M 2C99A 2OQ4A 3T1YM 1N33M 2D7HA 2DZOB 4X66M 1NJFA 4DV6M 4G6ZA 3SFZA 5H37D 4EIWA 3U6EA 1L2CA 2F5SA 2YQZA 3I51A 3VFDA 5LMNM 4L4UA 2FFJA 3VLFB 1K3WA 4L8RC 2KA6B 1KYIA 2DXIA 4G4RA 3KFUG 4R7GA 4WW0A 2L6OA 3OTOM 3FTDA 4PD2A 3TWMA 2F5OA 3GLHA 3AKZA 3R9XB 2C9CA 3K8ZA 1SXJE 1SXJB 2F5PA 3GP1A 2ZANA 4BBAA 1IQPA 1NSFA 1IBKM 2EUCA 3L25A 1IN8A 5KO3A 3U6DA 3SAUA 4B3TM 2X8AA 3KSJA 4JI8M 4LY6A 4QOSA 2OPFA 1ZAEA 3T15A 3FUTA 4IBEA 4L78A 3U6LA 3KP0E 1HT1E 1XC8A 5EP3A 1N77A 3KSXA 4LF4M 4B3RM 4JXJA 4JI0M 3AFHA 2G8LA 3VKHA 2Q2EB 5KQ8A 4MH0E 3MJ5A 1TDZA 2XLJA 4DV3M 3EIHA 5EQTA 3CTWB 4OX9M 1E9SA 4D80A 2D7GA 3KDSE 4LJ8A 3A46A 2AHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 M;  5ITQ A;  3VK8 A;  2UXD M;  5ITY A;  5IT9 S;  5LMU M;  4DUZ M;  1N36 M;  4NRW A;  1Q3C A;  3C58 A;  4YHH M;  1HNW M;  1MU5 A;  4LF8 M;  2HHH M;  1N32 M;  4JI7 M;  4NXN M;  1EE8 A;  3A45 A;  1PM5 A;  3SAR A;  4JI6 M;  3U6P A;  1FJG M;  2ZM6 M;  3J7A S;  4JV5 M;  4ITQ A;  4DR1 M;  3GPU A;  3SAT A;  2HKJ A;  4JI3 M;  2UXB M;  4JI1 M;  1PJJ A;  3DOA A;  3VK7 A;  5ITT A;  3GPX A;  4NRV A;  3W0F A;  1IBL M;  3JR5 A;  3U6Q A;  3U6S A;  1TDH A;  4AQY M;  3SBJ A;  3GPP A;  4LFA M;  4DV7 M;  1K82 A;  1HNX M;  4LF7 M;  4JI2 M;  4DV1 M;  1KFV A;  4DR6 M;  4LFC M;  1Z59 A;  3GQ3 A;  2VQE M;  4G4Q A;  4MB7 A;  1L1Z A;  2UXC M;  5IWA M;  4DUY M;  1Z5B A;  4JI5 M;  3U6M A;  1Z5A A;  2F4V M;  3A42 A;  1L2D A;  3J80 S;  2XZF A;  4DV4 M;  1NNJ A;  1L1T A;  4PDI A;  3SAV A;  4LF9 M;  1Q3B A;  3JAM S;  4DV5 M;  2UUC M;  1MX0 A;  5ITX E;  3J81 S;  4LF6 M;  2UUA M;  2UU9 M;  2OQ4 A;  4B3M M;  3T1Y M;  1N33 M;  4X62 M;  4X66 M;  4G4O A;  4DV6 M;  4K0K M;  4PDG A;  1XNR M;  2F5S A;  3U6E A;  3GO8 A;  1L2C A;  4JYA M;  5LMN M;  4G4N A;  1R2Y A;  1K3W A;  4DR7 M;  3TWL A;  4LF5 M;  1N34 M;  1J5E M;  4G4R A;  5ITR A;  3GQ4 A;  1HNZ M;  4DR2 M;  3OTO M;  1PJI A;  5A2Q S;  4PD2 A;  3TWM A;  2F5O A;  1HR0 M;  4PCZ A;  2F5P A;  3GP1 A;  5BR8 M;  3TWK A;  2UUB M;  3SAS A;  1IBK M;  4DV0 M;  2F5N A;  4NXM M;  3SAU A;  3U6D A;  4KHP M;  4B3T M;  1XMQ M;  3JR4 A;  2XZU A;  4B3S M;  3SAW A;  2OPF A;  4GKK M;  3U6O A;  4DV2 M;  4YY3 M;  5ITX A;  3U6L A;  5FLX S;  4DR5 M;  1XC8 A;  4GKJ M;  4LF4 M;  1Q39 A;  4B3R M;  4JI0 M;  1R2Z A;  2ZBK B;  1K3X A;  2Q2E B;  1XMO M;  2VQF M;  4CIS A;  1TDZ A;  4DV3 M;  1L2B A;  2EA0 A;  1XNQ M;  1Z5C A;  3T1H M;  4OX9 M;  3GPY A;  4DR3 M;  1IBM M;  5ITU A;  2E5L M;  2F5Q A;  4LFB M;  4JI4 M;  4DR4 M;  3GQ5 A;  3U6C A;  4X64 M;  3A46 A;  1I94 M;  4JI8 M; 
#chains in the Genus database with same CATH topology
 4OU7 A;  1IY0 A;  1TF0 B;  1NHW C;  1XWI A;  1VEK A;  5ITY A;  2UXD M;  3CF2 A;  5LMU M;  2C9O A;  3U61 A;  4NRW A;  4MGI E;  1EIJ A;  1IY1 A;  1H6U A;  4YHH M;  4LJ4 A;  2K9D A;  3HWS A;  2HHH M;  1Z6T A;  3MK6 A;  1WGL A;  7CAT A;  2ZTC A;  3PVS A;  4QHS A;  4R3D A;  1R7R A;  1FJG M;  2BWE A;  4Z8X A;  4JV5 M;  2V6Z M;  1V34 A;  2OOB A;  4IBI A;  4ITQ A;  3GPU A;  1QZE A;  3SAT A;  4IBD A;  3HKP A;  4ZPX A;  5FTM A;  1IXR C;  4DBG B;  4LRS A;  5C1B A;  1G3I A;  1WXQ A;  5EP4 A;  2XH9 A;  1NY6 A;  4G3O A;  1NV9 A;  2BJW A;  1IBL M;  1VDL A;  3RFW A;  2FNA A;  4MM3 B;  2LHG A;  3SMS A;  4FWG A;  1TDH A;  2L4E A;  3E9S A;  5FTN A;  3GPP A;  4QHT A;  1N75 A;  4DV7 M;  3V76 A;  3AL0 C;  4JI2 M;  3K9P A;  4LFC M;  3GQ3 A;  2VQE M;  4MB7 A;  1GVN A;  4B7F A;  5IWA M;  3J7A S;  4LRT A;  4S12 A;  3HHW A;  3ILK A;  2KEB A;  4LJ5 A;  2NQ8 C;  2DAK A;  1VEJ A;  2J7N A;  2R44 A;  4IBB A;  3UMM A;  4Y28 F;  4FD2 A;  2J7O A;  1NNJ A;  1IXZ A;  3SC3 A;  2CRU A;  2KZS A;  2KRK A;  2HCB A;  3MMP A;  3U5Z A;  1J7K A;  3PXG A;  2BJV A;  4OW0 A;  2LWX A;  4FVM A;  1Y8G A;  4LF6 M;  2UUA M;  5BPV A;  1VQ1 A;  3M0E A;  4MGZ E;  2R45 A;  5EXX A;  4X62 M;  1QYR A;  1YSY A;  2Y21 A;  2W82 A;  3FKE A;  4Q7J A;  2DAI A;  3FUU A;  4DR7 M;  2G3Q A;  1C7Y A;  2MJ5 B;  2YFQ A;  3HU1 A;  2XF3 A;  4PT5 A;  1LV7 A;  1GKI A;  2CEA A;  3B7N A;  3GQ4 A;  1HNZ M;  3FRI A;  4GH9 A;  3GRR A;  4OVZ A;  4FCV A;  4L6V 6;  2I7P A;  4Z6Y A;  2EO2 A;  3B74 A;  3ZQJ A;  3SAS A;  4XK8 F;  2KRU A;  4AKG A;  2CV2 A;  4NXM M;  4HL4 A;  1IN5 A;  3I4Y A;  4IBF A;  2L2D A;  4LZZ A;  3KS4 A;  4GKK M;  2DHY A;  3FTF A;  1QVR A;  2XFT A;  4DR5 M;  3KOZ E;  5GKN A;  5EJC A;  3VDP A;  2RKO A;  1J09 A;  1KSF X;  4KT0 F;  3ZH9 B;  1IXS B;  4NSR A;  3HHX A;  4CIS A;  4JN6 A;  4RF0 A;  3KS8 A;  4LG2 A;  2L7H A;  2KXE A;  2C96 A;  1Z5C A;  3T1H M;  4MGY E;  4DR3 M;  4IBK A;  1SXJ A;  3QYE A;  2JP7 A;  2C98 A;  2FH0 A;  2EKK A;  4GRI A;  2E5L M;  3A98 B;  2F5Q A;  3MHV C;  4JI4 M;  4DR4 M;  4LFB M;  3U6C A;  1QDR A;  2CUZ A;  1PGY A;  1QAQ A;  2LHC A;  3HHY A;  3PNY A;  5ITQ A;  2B3T A;  4LJA A;  3VK8 A;  5FSW A;  1NNU C;  1ORY B;  2WSC F;  1IN6 A;  4FCW A;  4GIP A;  4DUZ M;  1IN7 A;  1HJP A;  1OAI A;  1QZM A;  4LJ6 A;  2M60 A;  2R6F A;  1JR3 A;  3HHZ A;  2JY5 A;  2CFO A;  4LF8 M;  4GC9 A;  1MN3 A;  1WHC A;  2L4F A;  1PJQ A;  1SXJ D;  4NXN M;  1DO2 A;  2Y0Q A;  2R62 A;  1EE8 A;  2WZJ A;  1WIV A;  3A45 A;  2QSF X;  4D82 A;  3U6P A;  2X4A A;  3GRY A;  4LCB A;  2DWL A;  3LVW A;  2JXN A;  1EFU B;  4GC5 A;  2UXB M;  2WSE F;  4JI1 M;  3L29 A;  1PJJ A;  2KHH A;  1D2N A;  1VG5 A;  2O5R A;  5C18 A;  1TH2 A;  3VK7 A;  4M0D A;  3GPX A;  3AOE A;  4NRV A;  2QZ4 A;  4GHL A;  3JR5 A;  1ZMU A;  2LNH C;  5EXT A;  1OQY A;  1JR3 D;  1S3S A;  1G4A E;  1YE9 A;  2ZAO A;  1E94 E;  1GL6 A;  3E4R A;  3D8L A;  3L28 A;  5FTK A;  4LFA M;  4B7H A;  1K82 A;  1KFV A;  3BOS A;  2R4E A;  3IEC A;  4DR6 M;  2DWZ B;  4IBG A;  3K9O A;  2UXC M;  4GHA A;  3M7G A;  2Z4R A;  3HU2 A;  2DAM A;  2R65 A;  3B7Q A;  1Z5B A;  3B9P A;  2X49 A;  3RE8 A;  1L1T A;  3J80 S;  2LVP C;  3TL4 X;  4DV4 M;  1N78 A;  2CHV A;  2GQF A;  2K47 A;  3T6P A;  1TH3 A;  2ERC A;  4PDI A;  4P16 A;  2HAK A;  4NC6 A;  4IBJ A;  3JAM S;  4HLQ A;  1HQY E;  3KXE C;  3Q8G A;  2GNO A;  4AW4 A;  3ZCB B;  3HZJ A;  5ITX E;  3H4M A;  1E32 A;  4B3M M;  1PJS A;  3I4V A;  4R71 A;  4G4O A;  5KQD A;  4IBC A;  1OFI A;  4PDG A;  5FTJ A;  1XNR M;  3QYB A;  3CGW A;  4JYA M;  3NWL A;  4G4N A;  1R2Y A;  3W0L B;  3L26 A;  2JY8 A;  3KW6 A;  3TWL A;  3AJI B;  3T38 A;  4LF5 M;  3TPZ A;  1J5E M;  3UGJ A;  5ITR A;  3K1J A;  2QBY B;  2ZAM A;  5FTL A;  4DR2 M;  4AKI A;  5A2Q S;  3GLF E;  3GLF B;  1D0L A;  1HR0 M;  1D0M A;  4PCZ A;  4ANR A;  3QAU A;  1FNN A;  2UUB M;  1GJS A;  3SHF A;  3PFI A;  5EP1 A;  2EJS A;  3LQQ A;  2F5N A;  2MH8 A;  1QUS A;  2QP9 X;  1YLA A;  4B08 A;  1YUB A;  2XZU A;  3M6A A;  2LXE A;  3U6O A;  1ZMV A;  3IG8 A;  4DV2 M;  4BB9 A;  1XXH E;  1XXH B;  5JI2 E;  3UK6 A;  3FUW A;  5DFL A;  2APL A;  1NO1 A;  3C3E A;  1T6O A;  3KOY E;  2Z8Y M;  4LGM A;  1Q39 A;  1W5T A;  2RRU A;  1R2Z A;  2ZBK B;  3ZC7 B;  3WHK A;  3C3D A;  3THG A;  3TE6 A;  4FW9 A;  2LH0 A;  2DNA A;  4LJ7 A;  4LJ9 A;  2DHR A;  2XSZ D;  2EA0 A;  3FYC A;  3E21 A;  4WUR A;  2JNH A;  2G5G X;  3NBX X;  3UZU A;  4A3V B;  4AZF A;  2J5Y A;  4AG5 A;  1IBM M;  4TUW A;  4I81 A;  3FTE A;  5IZ7 D;  1CUK A;  1X37 A;  3RGP A;  3IG5 A;  3HJ8 A;  3SMP A;  2BNK A;  2DVW B;  4FWD A;  5JI3 E;  1JB0 F;  2HL7 A;  2CWB A;  3FTC A;  2CHQ A;  2R0I A;  3SYL A;  1DGG A;  2DI0 A;  3FRH A;  5DNY A;  3FYD A;  4XBO A;  1N36 M;  3KVW A;  2QPA A;  5E6J A;  2XEP A;  1IN4 A;  3C58 A;  1MU5 A;  2FS1 A;  3GLG E;  3GLG B;  3H4J A;  3GLI E;  1IXS A;  3I04 M;  3I01 M;  3U60 B;  4JI7 M;  1N32 M;  2LVA A;  5EXS A;  3SHG B;  2C5R A;  1T3T A;  1OAO C;  1QAM A;  2R18 A;  4JI6 M;  3LQR A;  1DO0 A;  2VF8 A;  4DR1 M;  1NV8 A;  3Q8X A;  5KPR A;  5DYI A;  2HKJ A;  1IY2 A;  1WJ7 A;  3C9P A;  4I8O A;  3BXW A;  4QNM A;  3D8B A;  2KNA A;  3LMM A;  1DGH B;  1DGH A;  3DOA A;  4AKH A;  3KP1 E;  2WSF F;  5ITT A;  3LVV A;  1XB2 B;  2LVQ D;  3FD9 A;  1G59 A;  3W0F A;  4M9S A;  2JY7 A;  4CIZ A;  3U6Q A;  1GO5 A;  1IFY A;  1BVS A;  3U6S A;  1NY5 A;  2K6B A;  2R46 A;  3FE3 A;  4MGH A;  3SBJ A;  3J2P B;  4REZ A;  2Y0T A;  1HNX M;  4LF7 M;  1C1K A;  4IIW A;  1Z59 A;  3EIE A;  1UM8 A;  4G4Q A;  2Y20 A;  4RF1 A;  4DUY M;  1G41 A;  2VII A;  3SAR A;  3GLH E;  2KNV A;  3GLH B;  4B7G A;  3U6M A;  3B89 A;  4NSO B;  4F2L A;  4JI5 M;  3A42 A;  4M9Z A;  4XGI A;  1QAN A;  2V1C A;  4QOZ C;  1QQW A;  3SAV A;  4LF9 M;  1DV0 A;  2CV0 A;  3HGI A;  1SXJ C;  4FCT A;  1HQC A;  1MX0 A;  4I5S A;  1XHB A;  2HWJ A;  4GEW A;  1UFZ A;  4QNR A;  1SG9 A;  2XFS A;  4K0K M;  2RGH A;  1IM2 A;  3NBI A;  3GO8 A;  2MR9 A;  3HJQ A;  4KOD A;  2LVO C;  4AG6 A;  2XGN A;  3VKG A;  2LTU A;  3AOG A;  1N34 M;  2LBC A;  2VDB B;  3HX3 A;  4IJE A;  4D81 A;  5IRE B;  1PJI A;  3KOW E;  1GJT A;  2YNM D;  3DFZ A;  3K2L A;  4CHT B;  5BR8 M;  3TWK A;  4MGK E;  4DV0 M;  4RNA A;  2VF7 A;  4NL4 H;  4KHP M;  3QWL A;  1XMQ M;  3JR4 A;  4B3S M;  1VDD A;  3RGS A;  2JA2 A;  3SAW A;  2KZU A;  3CF6 E;  3TQS A;  2CV1 A;  1GAB A;  1DGB A;  5ITX A;  4YY3 M;  2LVN C;  1Q02 A;  5FLX S;  3AOE C;  3HJS A;  1G8P A;  2FOI C;  3U61 B;  1TTE A;  1QAO A;  2KDL A;  2DAE A;  4GKJ M;  4GMQ A;  3PNV A;  5KPZ A;  2Z3X A;  1K3X A;  5EXP A;  1XMO M;  2VQF M;  3W67 A;  4BLC A;  1NJG A;  2V1U A;  3GRV A;  1T43 A;  2QBY A;  3KOX E;  1L2B A;  1XNQ M;  4AI6 A;  4L15 A;  3GLF A;  3J7B A;  1ZQ9 A;  1V92 A;  1V33 A;  3GPY A;  3VDU A;  2QEN A;  2DAG A;  1AUA A;  1E9R A;  4II7 A;  5ITU A;  2XSZ A;  3J27 B;  3GQ5 A;  2L09 A;  4X64 M;  1I94 M;  1RU3 A;  4NOO B;  2QCU A;  4GIT A;  2I7N A;  1AIP C;  1NHG C;  4X65 M;  2KW0 A;  2DKL A;  5EP2 A;  1XXH A;  2CE7 A;  3L27 A;  4CGY B;  5IT9 S;  3W68 A;  1I4W A;  4F1I A;  1HT2 E;  2O01 F;  2FE8 A;  1ZMW A;  1Q3C A;  2N35 A;  1HNW M;  1VEG A;  5E26 A;  1JQJ C;  1L8Q A;  3K92 A;  1OFH A;  5F3W A;  2R4J A;  2JY6 B;  2P5T A;  1TGU A;  1NVM A;  4I4L A;  1PM5 A;  2ZM6 M;  1D0K A;  3FUX A;  4M0W A;  2M5Z A;  4W5W A;  4JI3 M;  1PRB A;  3U5Z B;  3R8F A;  1OKS A;  3FUV A;  3GRU A;  2D7E A;  4LZJ A;  4LGY A;  2DZN B;  4KLN A;  2DEN A;  4FWH A;  1QUT A;  2BWB A;  2DWM A;  1MJG M;  2L7I A;  3UJN A;  3SYK A;  3DZD A;  2DWN A;  2QHO B;  4AQY M;  1R6B X;  2Z7J A;  2A5Y B;  2EKF A;  1DGF A;  8CAT A;  5KPT A;  4DV1 M;  1TR8 A;  3CF0 A;  2YR0 A;  1L1Z A;  4M9X A;  1LTM A;  2H1R A;  1WR1 B;  2JUJ A;  3HY5 A;  3GLG A;  4KO8 A;  4P17 A;  4UN2 B;  3GLI B;  3GLI A;  2OO9 A;  4OVZ B;  3U60 A;  1OIP A;  2CHG A;  1Z5A A;  1TH4 A;  5L8R F;  2F4V M;  1L2D A;  2XZF A;  1OIZ A;  1W5S A;  2Z4S A;  1GLN A;  3HU3 A;  2QQ8 A;  3L2A A;  3AV0 A;  1OJL A;  2QNJ A;  3WHL A;  3IHP A;  1Q3B A;  4DV5 M;  2RGO A;  2UUC M;  1R4G A;  1G71 A;  3LCV B;  3DA1 A;  4L16 A;  1GL7 A;  3J81 S;  5DYG A;  4IJF A;  2UU9 M;  2C99 A;  2JZ1 A;  2OQ4 A;  1R5L A;  3T1Y M;  1N33 M;  2D7H A;  2DZO B;  4X66 M;  1NJF A;  4CJ6 A;  4DV6 M;  4G6Z A;  3SFZ A;  5H37 D;  3F92 A;  4EIW A;  3U6E A;  1L2C A;  2F5S A;  2YQZ A;  3I51 A;  3VFD A;  5LMN M;  4L4U A;  2FFJ A;  3VLF B;  1K3W A;  2DZL A;  4L8R C;  2KA6 B;  2KNZ A;  1KYI A;  3LW5 F;  1PJT A;  2DXI A;  4G4R A;  2MGW A;  2ZTD A;  3BBZ A;  3KFU G;  4R7G A;  4WW0 A;  2JZ0 A;  2L6O A;  3OTO M;  3FTD A;  4PD2 A;  3TWM A;  2F5O A;  3GLH A;  3AKZ A;  3R9X B;  1OTR A;  2C9C A;  3K8Z A;  1SXJ E;  1SXJ B;  2F5P A;  3GP1 A;  4WP2 A;  2ZAN A;  4BBA A;  1IQP A;  1NSF A;  1IBK M;  2EUC A;  2CP8 A;  3L25 A;  1IN8 A;  5KO3 A;  3U6D A;  3SAU A;  4B3T M;  2X8A A;  3KSJ A;  4JI8 M;  3LCU A;  4LY6 A;  4QOS A;  2OPF A;  1F4I A;  1ZAE A;  2H5X A;  2MRO B;  3FUT A;  4IBE A;  4L78 A;  3T15 A;  3U6L A;  3KP0 E;  1HT1 E;  1XC8 A;  1ZV1 A;  5EP3 A;  1N77 A;  3KSX A;  1JR3 E;  4LF4 M;  4B3R M;  4JXJ A;  4JI0 M;  3AFH A;  2G8L A;  3VKH A;  3E46 A;  2Q2E B;  5KQ8 A;  1QDT A;  1A5T A;  4MH0 E;  3MJ5 A;  1TDZ A;  2XLJ A;  4DV3 M;  3EIH A;  1WGN A;  3B7Z A;  3CTW B;  5EQT A;  4OX9 M;  1E9S A;  2O25 A;  4D80 A;  2K0B X;  2JWS A;  2D7G A;  2OOA A;  1P3Q Q;  3KDS E;  4LJ8 A;  3A46 A;  4HEO A;  2AHM A;  4RKU F; 
#chains in the Genus database with same CATH homology
 4OU7 A;  1IY0 A;  1NHW C;  1XWI A;  2UXD M;  5ITY A;  3CF2 A;  5LMU M;  2C9O A;  3U61 A;  4NRW A;  4MGI E;  1IY1 A;  1H6U A;  4YHH M;  4LJ4 A;  3HWS A;  2HHH M;  1Z6T A;  3MK6 A;  7CAT A;  3PVS A;  4QHS A;  4R3D A;  1R7R A;  1FJG M;  4Z8X A;  4JV5 M;  2V6Z M;  4IBI A;  4ITQ A;  3GPU A;  3SAT A;  4IBD A;  3HKP A;  4ZPX A;  5FTM A;  1IXR C;  4LRS A;  5C1B A;  1G3I A;  1WXQ A;  5EP4 A;  2XH9 A;  1NY6 A;  2BJW A;  1IBL M;  3RFW A;  2FNA A;  4MM3 B;  3SMS A;  4FWG A;  1TDH A;  5FTN A;  3E9S A;  3GPP A;  4QHT A;  1N75 A;  4DV7 M;  3AL0 C;  4JI2 M;  4LFC M;  3GQ3 A;  2VQE M;  4MB7 A;  1GVN A;  4B7F A;  5IWA M;  4LRT A;  4S12 A;  3HHW A;  3ILK A;  2KEB A;  4LJ5 A;  2NQ8 C;  2J7N A;  4IBB A;  3UMM A;  1NNJ A;  4FD2 A;  2J7O A;  1IXZ A;  3SC3 A;  2KZS A;  2KRK A;  2HCB A;  3U5Z A;  1J7K A;  3PXG A;  2BJV A;  4OW0 A;  2LWX A;  4FVM A;  4LF6 M;  2UUA M;  5BPV A;  3M0E A;  4MGZ E;  2R45 A;  5EXX A;  4X62 M;  1QYR A;  1YSY A;  2Y21 A;  2W82 A;  3FKE A;  3FUU A;  4DR7 M;  2YFQ A;  3HU1 A;  2XF3 A;  4PT5 A;  1LV7 A;  1GKI A;  2CEA A;  3GQ4 A;  1HNZ M;  4GH9 A;  3GRR A;  4OVZ A;  4FCV A;  4Z6Y A;  2I7P A;  2EO2 A;  3SAS A;  2KRU A;  4AKG A;  2CV2 A;  4NXM M;  4HL4 A;  1IN5 A;  3I4Y A;  4IBF A;  4LZZ A;  3KS4 A;  4GKK M;  3FTF A;  1QVR A;  2XFT A;  4DR5 M;  3KOZ E;  5GKN A;  5EJC A;  3VDP A;  2RKO A;  1J09 A;  1KSF X;  3ZH9 B;  1IXS B;  4NSR A;  3HHX A;  4CIS A;  4JN6 A;  4RF0 A;  3KS8 A;  4LG2 A;  2L7H A;  2KXE A;  2C96 A;  1Z5C A;  3T1H M;  4MGY E;  4DR3 M;  4IBK A;  1SXJ A;  2C98 A;  4GRI A;  2E5L M;  2F5Q A;  4LFB M;  3A98 B;  4JI4 M;  3MHV C;  4DR4 M;  3U6C A;  2CUZ A;  1QAQ A;  3HHY A;  3PNY A;  5ITQ A;  4LJA A;  3VK8 A;  5FSW A;  1NNU C;  1ORY B;  4FCW A;  1IN6 A;  4GIP A;  4DUZ M;  1IN7 A;  1QZM A;  4LJ6 A;  2M60 A;  1JR3 A;  3HHZ A;  4LF8 M;  2CFO A;  4GC9 A;  4NXN M;  1SXJ D;  1DO2 A;  2Y0Q A;  2R62 A;  1EE8 A;  3A45 A;  3SAR A;  3J7A S;  4D82 A;  3U6P A;  2X4A A;  3GRY A;  4LCB A;  2DWL A;  3LVW A;  4GC5 A;  2UXB M;  4JI1 M;  3L29 A;  1PJJ A;  1D2N A;  2O5R A;  5C18 A;  1TH2 A;  3VK7 A;  4M0D A;  3GPX A;  3AOE A;  4NRV A;  2QZ4 A;  4GHL A;  3JR5 A;  2LNH C;  5EXT A;  1JR3 D;  1S3S A;  1G4A E;  1YE9 A;  2ZAO A;  1E94 E;  1GL6 A;  3E4R A;  3D8L A;  3L28 A;  5FTK A;  4LFA M;  4B7H A;  1K82 A;  1KFV A;  3BOS A;  2R4E A;  4DR6 M;  2DWZ B;  4IBG A;  2UXC M;  4GHA A;  3M7G A;  2Z4R A;  3HU2 A;  2R65 A;  1Z5B A;  3B9P A;  2X49 A;  3RE8 A;  1L1T A;  3J80 S;  3TL4 X;  4DV4 M;  1N78 A;  2CHV A;  2K47 A;  1TH3 A;  2ERC A;  4PDI A;  4P16 A;  4IBJ A;  3JAM S;  4HLQ A;  1HQY E;  3KXE C;  4AW4 A;  3ZCB B;  5ITX E;  3H4M A;  1E32 A;  4B3M M;  3I4V A;  4G4O A;  5KQD A;  4IBC A;  1OFI A;  4PDG A;  5FTJ A;  1XNR M;  4JYA M;  3NWL A;  4G4N A;  1R2Y A;  3W0L B;  3L26 A;  3TWL A;  3KW6 A;  3AJI B;  3T38 A;  4LF5 M;  3TPZ A;  1J5E M;  3UGJ A;  5ITR A;  3K1J A;  2QBY B;  2ZAM A;  5FTL A;  4DR2 M;  4AKI A;  5A2Q S;  3GLF B;  1HR0 M;  4PCZ A;  3QAU A;  1FNN A;  2UUB M;  3SHF A;  3PFI A;  5EP1 A;  3LQQ A;  2F5N A;  2QP9 X;  4B08 A;  1YUB A;  2XZU A;  3M6A A;  2LXE A;  3U6O A;  3IG8 A;  4DV2 M;  4BB9 A;  1XXH B;  5JI2 E;  3UK6 A;  3FUW A;  3KOY E;  4LGM A;  1Q39 A;  1W5T A;  1R2Z A;  2ZBK B;  3ZC7 B;  3WHK A;  3THG A;  3TE6 A;  4FW9 A;  2LH0 A;  4LJ7 A;  4LJ9 A;  2DHR A;  2XSZ D;  2EA0 A;  3FYC A;  4WUR A;  2G5G X;  3UZU A;  4A3V B;  4AZF A;  1IBM M;  4AG5 A;  4TUW A;  4I81 A;  3FTE A;  5IZ7 D;  1X37 A;  3RGP A;  3IG5 A;  3HJ8 A;  3SMP A;  2BNK A;  2DVW B;  4FWD A;  5JI3 E;  2HL7 A;  3FTC A;  2CHQ A;  3SYL A;  1DGG A;  5DNY A;  3FYD A;  4XBO A;  1N36 M;  3KVW A;  2QPA A;  5E6J A;  2XEP A;  1IN4 A;  3C58 A;  1MU5 A;  3GLG B;  1N32 M;  3U60 B;  4JI7 M;  5EXS A;  3SHG B;  2C5R A;  1T3T A;  1QAM A;  2R18 A;  4JI6 M;  3LQR A;  1DO0 A;  4DR1 M;  3Q8X A;  5KPR A;  5DYI A;  2HKJ A;  1IY2 A;  4I8O A;  4QNM A;  3D8B A;  3LMM A;  1DGH B;  1DGH A;  3DOA A;  4AKH A;  3KP1 E;  5ITT A;  3LVV A;  1G59 A;  3FD9 A;  3W0F A;  4M9S A;  3U6Q A;  3U6S A;  1NY5 A;  2R46 A;  4MGH A;  3SBJ A;  3J2P B;  4REZ A;  2Y0T A;  1HNX M;  4LF7 M;  1C1K A;  4IIW A;  1Z59 A;  3EIE A;  1UM8 A;  4G4Q A;  2Y20 A;  4RF1 A;  4DUY M;  1G41 A;  2VII A;  4B7G A;  3GLH B;  4JI5 M;  3U6M A;  4NSO B;  3A42 A;  4M9Z A;  4XGI A;  1QAN A;  2V1C A;  4QOZ C;  1QQW A;  3SAV A;  4LF9 M;  2CV0 A;  3HGI A;  1SXJ C;  4FCT A;  1HQC A;  1MX0 A;  4I5S A;  1XHB A;  4QNR A;  2XFS A;  4K0K M;  2RGH A;  1IM2 A;  3NBI A;  3GO8 A;  3HJQ A;  4KOD A;  4AG6 A;  2XGN A;  3VKG A;  3AOG A;  1N34 M;  4IJE A;  4D81 A;  5IRE B;  1PJI A;  3KOW E;  2YNM D;  3DFZ A;  3K2L A;  4CHT B;  5BR8 M;  3TWK A;  4MGK E;  4DV0 M;  4RNA A;  4NL4 H;  4KHP M;  3QWL A;  1XMQ M;  3JR4 A;  4B3S M;  1VDD A;  3RGS A;  2JA2 A;  3SAW A;  2KZU A;  3CF6 E;  3TQS A;  1DGB A;  5ITX A;  4YY3 M;  5FLX S;  3AOE C;  3HJS A;  1G8P A;  2FOI C;  3U61 B;  1QAO A;  4GKJ M;  4GMQ A;  3PNV A;  5KPZ A;  2Z3X A;  1K3X A;  5EXP A;  1XMO M;  2VQF M;  4BLC A;  2V1U A;  1NJG A;  3GRV A;  2QBY A;  3KOX E;  1L2B A;  1XNQ M;  4AI6 A;  4L15 A;  3GLF A;  3J7B A;  1ZQ9 A;  3GPY A;  3VDU A;  2QEN A;  1E9R A;  4II7 A;  5ITU A;  2XSZ A;  3J27 B;  3GQ5 A;  2L09 A;  4X64 M;  1I94 M;  4NOO B;  2QCU A;  4GIT A;  2I7N A;  1NHG C;  4X65 M;  2KW0 A;  4CGY B;  5EP2 A;  1XXH A;  2CE7 A;  3L27 A;  5IT9 S;  1I4W A;  1HT2 E;  2FE8 A;  1Q3C A;  1HNW M;  5E26 A;  1JQJ C;  1L8Q A;  3K92 A;  1OFH A;  5F3W A;  2R4J A;  2P5T A;  4I4L A;  1TGU A;  1NVM A;  1PM5 A;  2ZM6 M;  3FUX A;  4M0W A;  2M5Z A;  4W5W A;  4JI3 M;  3U5Z B;  3R8F A;  3FUV A;  3GRU A;  4LZJ A;  2D7E A;  4LGY A;  2DWM A;  2DZN B;  4KLN A;  2CV1 A;  4FWH A;  2L7I A;  3UJN A;  3SYK A;  3DZD A;  2DWN A;  4AQY M;  1R6B X;  2Z7J A;  2A5Y B;  1DGF A;  8CAT A;  5KPT A;  4DV1 M;  3CF0 A;  2YR0 A;  1L1Z A;  4M9X A;  2H1R A;  3GLG A;  4KO8 A;  3GLI B;  3GLI A;  3U60 A;  4OVZ B;  2CHG A;  1Z5A A;  1TH4 A;  2F4V M;  1L2D A;  2XZF A;  1W5S A;  2Z4S A;  1GLN A;  3HU3 A;  3L2A A;  3AV0 A;  1OJL A;  3WHL A;  1Q3B A;  4DV5 M;  2RGO A;  2UUC M;  3DA1 A;  4L16 A;  1GL7 A;  3J81 S;  5DYG A;  4IJF A;  2UU9 M;  2C99 A;  2OQ4 A;  3T1Y M;  1N33 M;  2D7H A;  2DZO B;  4X66 M;  1NJF A;  4DV6 M;  4G6Z A;  3SFZ A;  5H37 D;  4EIW A;  3U6E A;  1L2C A;  2F5S A;  2YQZ A;  3I51 A;  3VFD A;  5LMN M;  4L4U A;  2FFJ A;  3VLF B;  1K3W A;  4L8R C;  2KA6 B;  1KYI A;  2DXI A;  4G4R A;  3KFU G;  4R7G A;  4WW0 A;  2L6O A;  3OTO M;  3FTD A;  4PD2 A;  3TWM A;  2F5O A;  3GLH A;  3AKZ A;  3R9X B;  2C9C A;  3K8Z A;  1SXJ E;  1SXJ B;  2F5P A;  3GP1 A;  2ZAN A;  4BBA A;  1IQP A;  1NSF A;  1IBK M;  2EUC A;  3L25 A;  1IN8 A;  5KO3 A;  3U6D A;  3SAU A;  4B3T M;  2X8A A;  3KSJ A;  4JI8 M;  4LY6 A;  4QOS A;  2OPF A;  1ZAE A;  3T15 A;  3FUT A;  4IBE A;  4L78 A;  3U6L A;  3KP0 E;  1HT1 E;  1XC8 A;  5EP3 A;  1N77 A;  3KSX A;  4LF4 M;  4B3R M;  4JXJ A;  4JI0 M;  3AFH A;  2G8L A;  3VKH A;  2Q2E B;  5KQ8 A;  4MH0 E;  3MJ5 A;  1TDZ A;  2XLJ A;  4DV3 M;  3EIH A;  5EQT A;  3CTW B;  4OX9 M;  1E9S A;  4D80 A;  2D7G A;  3KDS E;  4LJ8 A;  3A46 A;  2AHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...