1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
4B3RM 2UXDM 2UUBM 5LMNM 3GPPA 2E5LM 3SAVA 3JR4A 4JI8M 4JI5M 3SATA 1J5EM 4B3TM 2XZFA 4AQYM 1Z5BA 4PDGA 3U6PA 3GPUA 3W0FA 1K3XA 4NRWA 4JV5M 4KHPM 3TWKA 3U6CA 1IBMM 1HNWM 3OTOM 1XNRM 4LF9M 3GQ3A 2VQEM 3GP1A 4YHHM 2OPFA 4K0KM 4GKJM 2F5SA 1HNZM 4DV6M 3T1YM 3SASA 2HKJA 1EE8A 3U6MA 4OX9M 1Q39A 4G4NA 4JI3M 4LF6M 1FJGM 2UU9M 4JI4M 1Z59A 3TWMA 1Z5CA 5ITQA 5ITXE 4PCZA 1TDZA 1KFVA 4X62M 5IT9S 5LMUM 4JI0M 3GQ4A 3SAWA 4JI6M 4PD2A 1N33M 1L2DA 1HNXM 1IBLM 4PDIA 2EA0A 3T1HM 4G4OA 3JAMS 4DR2M 1NNJA 5ITRA 3DOAA 4DV2M 3U6QA 1I94M 1XNQM 1TDHA 1R2ZA 3J7AS 2ZBKB 4NRVA 3U6SA 4LFBM 4CISA 3VK7A 1L1ZA 3GPXA 2UXCM 4B3SM 5ITTA 5ITUA 4LF8M 5ITYA 3A46A 4JYAM 3A45A 1L1TA 2Q2EB 1N34M 5ITXA 4G4RA 5IWAM 2ZM6M 3SBJA 3C58A 1MX0A 4LFAM 4X64M 4NXMM 4DV4M 2OQ4A 4DV5M 4DR4M 4G4QA 4DR1M 1HR0M 2UUAM 3U6LA 4NXNM 1PM5A 1PJIA 4DV3M 3JR5A 2F4VM 4JI7M 3SAUA 3U6EA 4DUZM 4DR3M 2UXBM 1MU5A 2VQFM 4DUYM 4DV7M 1L2CA 3GQ5A 5A2QS 1K3WA 1XC8A 1IBKM 2HHHM 4DV1M 4GKKM 4X66M 2UUCM 4LF4M 1N36M 3U6DA 3VK8A 4DR7M 2XZUA 1Z5AA 4DV0M 1Q3CA 4MB7A 4LF5M 1Q3BA 2F5OA 4JI1M 3SARA 4LFCM 2F5QA 3J80S 1R2YA 3GPYA 4YY3M 1XMQM 3A42A 1L2BA 4DR5M 4B3MM 4DR6M 4JI2M 1N32M 4X65M 3U6OA 1K82A 3J81S 4LF7M 1XMOM 2F5NA 3TWLA 5BR8M 3GO8A 1PJJA 5FLXS 2F5PA 4ITQA
chains in the Genus database with same CATH superfamily
4B3RM 2UXDM 1Z6TA 4L8RC 2UUBM 5LMNM 1HQYE 1QUTA 2C98A 2C99A 1FNNA 1OAIA 1PJTA 2XH9A 4CGYB 4D80A 3U5ZB 4JI5M 1J5EM 3F92A 3FUVA 1ZV1A 5E6JA 3E9SA 3H4MA 2FOIC 4OU7A 3U6PA 5A2QS 3W0FA 3GPUA 1K3XA 5KPZA 4NRWA 1R4GA 1C1KA 4QOZC 1GKIA 1SXJD 2XLJA 1HNWM 3OTOM 1OFIA 5IZ7D 3KFUG 1BVSA 3B7ZA 3B7NA 1TR8A 4A3VB 2RKOA 3GRYA 1ZMWA 3GLFA 4GKJM 3B74A 2LVOC 1DO2A 4WURA 2C9OA 3SFZA 1SXJB 1TH2A 1IN5A 4BBAA 2DZNB 1DV0A 4G4NA 3BXWA 3AOEA 4QHSA 2CEAA 2UU9M 3HHZA 1VEGA 2ZANA 3QAUA 4LJ8A 3TWMA 1IXSB 1JR3E 3FYDA 5ITQA 5ITXE 3GRRA 2FFJA 1UM8A 2R4EA 3B7QA 3HU2A 1DGBA 1JR3A 3K2LA 3GLIB 5LMUM 1NJGA 3ZC7B 2R4JA 1KFVA 3L27A 4MGHA 1T43A 2D7GA 2K47A 2O25A 3SMSA 2ERCA 1OTRA 3BOSA 3CF6E 1LV7A 3HHXA 3GQ4A 1NJFA 2JZ1A 1N33M 2L4FA 2JZ0A 1HT1E 1OQYA 1V92A 3EIHA 2K0BX 1R7RA 1G8PA 3JAMS 2KZUA 3KDSE 1NNJA 2GNOA 2OO9A 3SC3A 2V1CA 3U6QA 1I94M 5EXPA 1AUAA 1ORYB 2DAGA 2XSZD 2ZBKB 4I81A 3U6SA 3U60A 2KXEA 3I4VA 4QNMA 5JI2E 1R6BX 4IBFA 2ZAOA 4F2LA 3E4RA 3FYCA 4IJEA 2H5XA 3C3EA 3LVVA 3U5ZA 4CHTB 3A45A 4Y28F 5EQTA 3LMMA 2DXIA 5FTJA 4LRTA 4MH0E 3KOYE 1JB0F 4REZA 1IY2A 4MGKE 3UZUA 2Z8YM 2RGOA 4MGYE 3C58A 1ZMVA 2OQ4A 4AZFA 1PM5A 1PJIA 4DV3M 4LGYA 1SXJE 2HWJA 3KS4A 1SXJA 3T6PA 2P5TA 1T6OA 3PVSA 4G6ZA 1LTMA 2DNAA 4XK8F 4OW0A 4NOOB 2FNAA 2K6BA 4R7GA 2HCBA 4LJ7A 2X49A 4M9ZA 3W0LB 3W68A 3D8BA 1E9RA 4B7FA 1IXSA 1NV9A 4XGIA 4X66M 4CIZA 3GLIE 2UUCM 4AKGA 4M9SA 4I4LA 4IBGA 1VEJA 2JNHA 3GLIA 2KNAA 2YFQA 1UFZA 4DV0M 1P3QQ 3UMMA 2JY8A 3R9XB 2KRUA 4W5WA 4RF0A 4YY3M 3KP1E 2Z7JA 1OJLA 4FWHA 2KZSA 4DR5M 1GJTA 2L4EA 2DWZB 1TTEA 1F4IA 2BJVA 1K82A 4B7HA 1XMOM 3CF2A 4IJFA 2F5NA 5BR8M 2QPAA 2XEPA 1X37A 1JR3D 1C7YA 4I8OA 3B9PA 4KODA 2LXEA 4NC6A 3U61B 3SYLA 4ANRA 3GPPA 1QQWA 4IBBA 1IN7A 4QHTA 4L15A 2MR9A 3THGA 1GABA 4AW4A 2QENA 2XSZA 3C9PA 5FTMA 3WHKA 3FTCA 4JV5M 3TWKA 2YNMD 1IBMM 2M5ZA 2ZTDA 3KP0E 4QNRA 1OAOC 3MMPA 3I51A 4LF9M 4GHAA 3K8ZA 4F1IA 3GQ3A 2VQEM 3GP1A 3LCVB 4K0KM 1J09A 3FE3A 4GEWA 1HNZM 1NHGC 4LG2A 2R62A 2HKJA 2GQFA 4IBIA 2O01F 5F3WA 4OX9M 2KRKA 3E21A 3L2AA 3TE6A 1E32A 1XXHE 1L8QA 1Z59A 3J27B 3Q8XA 3PXGA 3SMPA 3TQSA 5EXSA 2MROB 5H37D 2CP8A 4PCZA 1TDZA 3ZQJA 2R0IA 4X62M 2QHOB 1IN8A 4Z8XA 2DZOB 4JI0M 3AOGA 4JI6M 5C18A 2HL7A 3PFIA 3VKHA 1L2DA 3HU1A 4LZZA 4PDIA 1NY5A 3T1HM 4G4OA 3I01M 4FCVA 1ZQ9A 1XWIA 2DAIA 3KVWA 3DOAA 1OFHA 2LTUA 1YSYA 1XNQM 4LFBM 3SYKA 3LW5F 3NBXX 1QAOA 1QYRA 2LHGA 3VK7A 1L1ZA 1WR1B 2MH8A 3NBIA 4NL4H 5ITTA 3U61A 5E26A 3T38A 3KOZE 1ZAEA 3L25A 2LBCA 5EP4A 1HJPA 5ITYA 4PT5A 1IY0A 2CHQA 4LGMA 2G3QA 2DHYA 2X4AA 5ITXA 2EKFA 5IWAM 3FUUA 4MGIE 4G4RA 2OOAA 4D82A 4IBCA 4KLNA 3TPZA 3H4JA 5EP3A 1DO0A 2XFTA 1YUBA 2RGHA 1QAMA 1G41A 4IBDA 1GL6A 2D7EA 2L7IA 1G3IA 2QBYB 3KXEC 4JI7M 2J7NA 3QYEA 4DUZM 4JI8M 1MU5A 2Y21A 3AOEC 4WP2A 3L26A 2VQFM 4DUYM 1PJQA 4I5SA 2FS1A 3FTEA 2JXNA 1IBKM 2HHHM 1GJSA 1HT2E 1R5LA 4GKKM 4ZPXA 2HAKA 3D8LA 2KDLA 2O5RA 3C3DA 2KA6B 3E46A 3K9OA 4DR7M 3KSJA 3VK8A 2R6FA 2XZUA 4GHLA 1Z5AA 4TUWA 1Q3CA 4LF5M 2R45A 4L4UA 4AKIA 2F5QA 5KPTA 3J80S 1IN6A 1D0LA 3UK6A 1R2YA 3GPYA 1OIZA 1XMQM 2JY6B 2JP7A 2X8AA 1H6UA 2QZ4A 3FTDA 5KQDA 3GLGE 3I04M 3MK6A 4X65M 3KSXA 3U6OA 4LF7M 3J2PB 1IFYA 2G5GX 4FW9A 4D81A 2Y0QA 4LY6A 4Z6YA 1T3TA 1N75A 3M6AA 3AFHA 3HJ8A 2F5PA 4ITQA 3PNYA 3HJQA 1D0KA 5EXXA 3IG5A 2BWBA 2YR0A 1XXHB 1VDDA 2LWXA 2DAEA 1ZMUA 1W5TA 4DBGB 4B3TM 3IHPA 5DNYA 2XZFA 3RFWA 4AG6A 1Z5BA 4PDGA 2R18A 4FWDA 4KHPM 2V1UA 3U6CA 2I7NA 4L16A 1V33A 1XNRM 1W5SA 3M0EA 2Y0TA 2OPFA 1SXJC 2F5SA 2QBYA 2JWSA 2V6ZM 3FUWA 3SHFA 3HGIA 3SASA 1EE8A 2QSFX 4KO8A 1K3WA 2CV2A 3WHLA 4MGZE 1Q39A 1VQ1A 2DWLA 1FJGM 1NY6A 4L6V6 2DVWB 1WGLA 3VDUA 1GLNA 3ILKA 2Z4SA 4IBEA 2WSFF 2JUJA 2A5YB 3I4YA 3IG8A 2J7OA 5IT9S 5FTLA 3SAWA 1V34A 4S12A 2LVAA 4G3OA 4PD2A 4JXJA 4EIWA 4FCWA 4R71A 1HNXM 1IBLM 1MN3A 2LH0A 1G4AE 2EA0A 3UGJA 3EIEA 3HHYA 3GLFB 4DR2M 1Q02A 3SBJA 4DV2M 2J5YA 2DI0A 3KOWE 3LVWA 2FH0A 1TDHA 2K9DA 5EP1A 1WGNA 3CF0A 3FD9A 1VEKA 3HU3A 1R2ZA 3J7AS 2QQ8A 2CHGA 1VG5A 5FTKA 2N35A 2UXCM 2L2DA 1E94E 3UJNA 3HZJA 2CFOA 2KNZA 2MGWA 5ITUA 2DENA 2KHHA 1EFUB 4LCBA 1XXHA 3FUTA 1D0MA 2Z4RA 3A46A 5FTNA 2Z3XA 4AI6A 4LJ9A 4IBJA 4IBKA 1L1TA 2Q2EB 1N34M 2RRUA 5GKNA 2ZM6M 3CTWB 1IXZA 2CV0A 1CUKA 4NXMM 4DV4M 4HL4A 1N77A 2DWMA 2AHMA 5EJCA 4DR1M 4UN2B 3U6LA 2CWBA 4HLQA 4NSOB 3AJIB 3JR5A 2C96A 2F4VM 2CRUA 5KO3A 3SAUA 3U6EA 1L2CA 3MHVC 3GLGB 1QAQA 3FTFA 4LRSA 4QOSA 3M7GA 1GVNA 3GQ5A 1E9SA 1IN4A 4IIWA 2L7HA 5KQ8A 1WIVA 1QANA 2L6OA 4KT0F 1IY1A 2H1RA 2LVQD 3U6DA 3MJ5A 1I4WA 4LFCM 2LHCA 2KNVA 4JI1M 4RNAA 2YQZA 1GL7A 1KYIA 3J7BA 3HHWA 3RGPA 3GLHB 3GLFE 1S3SA 1G59A 3NWLA 4AG5A 5DFLA 2EO2A 2G8LA 3A42A 3RE8A 3ZH9B 2ZAMA 1L2BA 2R65A 4XBOA 4B3MM 2NQ8C 2XGNA 4JI2M 2LVPC 2JA2A 4GIPA 3J81S 1WHCA 1VDLA 1NSFA 3GRUA 3GO8A 3DA1A 5FLXS 5KPRA 4M0WA 1PRBA 2Y20A 1QDTA 3HX3A 4MM3B 2R46A 1GO5A 2E5LM 2VIIA 1DGHB 1DGGA 3JR4A 3SAVA 3L29A 3SATA 5DYGA 1A5TA 3IECA 2EJSA 2WSEF 1YE9A 3DZDA 5C1BA 4LJAA 4AQYM 2CUZA 1TGUA 3BBZA 3HKPA 1SG9A 2QP9X 4B08A 2VF7A 2OOBA 3GRVA 1TH3A 1QZMA 3AL0C 4M9XA 2WZJA 3L28A 1WJ7A 4OVZB 2EKKA 4YHHM 4M0DA 4BB9A 1OIPA 3VKGA 4DV6M 3T1YM 3LCUA 4P17A 1DGFA 3K1JA 3GLGA 5EP2A 4FCTA 2BNKA 4GMQA 4FWGA 3U6MA 4JI3M 1IQPA 4LF6M 2XFSA 4JI4M 2XF3A 4GH9A 1Z5CA 2R44A 1HQCA 1JQJC 2B3TA 2KEBA 1N78A 4WW0A 4Q7JA 3GLHE 1QZEA 2D7HA 4II7A 1IM2A 3CGWA 3GLHA 4GC9A 1MJGM 4P16A 3K92A 3HY5A 1YLAA 3VFDA 3HWSA 3T15A 5ITRA 3AKZA 4FVMA 1QVRA 5BPVA 4NRVA 3FKEA 4CISA 1G71A 2KW0A 2DWNA 3R8FA 3GPXA 3AV0A 2JY5A 2DHRA 2JY7A 3VDPA 4B3SM 2QNJA 5JI3E 4LF8M 1DGHA 3LQQA 1AIPC 7CATA 1NNUC 1PJSA 8CATA 1Y8GA 2C5RA 2ZTCA 4JYAM 4B7GA 5L8RF 1OKSA 3FRIA 1QUSA 2DKLA 1MX0A 2VDBB 4FD2A 4LFAM 1TF0B 4JN6A 4BLCA 4X64M 2DAKA 2L09A 4DV5M 2CV1A 4DR4M 3VLFB 4HEOA 2CHVA 2DZLA 2C9CA 3A98B 3LQRA 3KW6A 3W67A 4G4QA 1NO1A 4OVZA 4NXNM 1HR0M 4RKUF 2MJ5B 2UUAM 3TL4X 2WSCF 4DR3M 2UXBM 1NVMA 3QYBA 3FUXA 2W82A 2M60A 3Q8GA 2DAMA 3SHGB 3FRHA 4DV7M 1EIJA 1XC8A 1KSFX 3V76A 5EXTA 3KS8A 3PNVA 4GRIA 3QWLA 4DV1M 1TH4A 1RU3A 3B89A 5DYIA 3ZCBB 4LJ4A 4LF4M 1N36M 4GITA 4GC5A 1PGYA 1XB2B 2BJWA 4NSRA 5IREB 1XHBA 1NV8A 1Q3BA 1IXRC 1WXQA 4MB7A 2F5OA 1NHWC 3SARA 4AKHA 3DFZA 3K9PA 2BWEA 1D2NA 1J7KA 2VF8A 3KOXE 4LJ5A 4LJ6A 4RF1A 2EUCA 4CJ6A 2LVNC 3HJSA 4L78A 5FSWA 2QCUA 2APLA 3RGSA 4DR6M 1N32M 2I7PA 2CE7A 2FE8A 1QDRA 3TWLA 4R3DA 3U60B 1PJJA 2LNHC 4LZJA
chains in the Genus database with same CATH topology
4B3RM 2UXDM 1Z6TA 4L8RC 2UUBM 5LMNM 1HQYE 2C98A 2C99A 4D80A 1FNNA 2XH9A 4JI5M 4CGYB 4JI8M 3U5ZB 1J5EM 3FUVA 5E6JA 3E9SA 3H4MA 2FOIC 4OU7A 3U6PA 3GPUA 3W0FA 1K3XA 4QOZC 5KPZA 4NRWA 1C1KA 1GKIA 1SXJD 2XLJA 1HNWM 3OTOM 1OFIA 5IZ7D 3KFUG 4A3VB 3GLFA 2RKOA 3GRYA 4GKJM 1DO2A 4WURA 2C9OA 3SFZA 1SXJB 1TH2A 1IN5A 4BBAA 2DZNB 4G4NA 3AOEA 4QHSA 2CEAA 2UU9M 3HHZA 2ZANA 3QAUA 4LJ8A 3TWMA 1IXSB 3FYDA 5ITQA 5ITXE 3GRRA 2FFJA 1UM8A 2R4EA 3HU2A 1DGBA 1JR3A 3K2LA 3GLIB 5LMUM 1NJGA 3ZC7B 2R4JA 1KFVA 3L27A 4MGHA 2D7GA 2K47A 3GQ4A 3SMSA 2ERCA 3BOSA 3CF6E 1LV7A 3HHXA 1NJFA 1N33M 1HT1E 3EIHA 1R7RA 1G8PA 3JAMS 2KZUA 3KDSE 1NNJA 3SC3A 2V1CA 3U6QA 1I94M 5EXPA 1ORYB 2ZBKB 2XSZD 4I81A 3U6SA 3U60A 2KXEA 3I4VA 4QNMA 5JI2E 1R6BX 4IBFA 2ZAOA 3E4RA 3FYCA 4IJEA 3LVVA 3U5ZA 4CHTB 3A45A 5EQTA 2DXIA 3LMMA 5FTJA 4LRTA 4MH0E 3KOYE 3C58A 4REZA 1IY2A 4MGKE 3UZUA 3SBJA 2RGOA 4MGYE 2OQ4A 4AZFA 1PM5A 1PJIA 4DV3M 4LGYA 1SXJE 3KS4A 1SXJA 2P5TA 3PVSA 4G6ZA 5A2QS 1K3WA 4OW0A 4NOOB 2FNAA 4R7GA 2HCBA 4LJ7A 2X49A 4M9ZA 3W0LB 3D8BA 1E9RA 4B7FA 4XGIA 4X66M 4AKGA 2UUCM 4M9SA 4I4LA 4IBGA 3GLIA 2YFQA 4DV0M 3UMMA 3R9XB 2KRUA 4W5WA 4RF0A 4YY3M 3KP1E 2Z7JA 1OJLA 4FWHA 2KZSA 4DR5M 2DWZB 2BJVA 1K82A 4B7HA 1XMOM 3CF2A 4IJFA 2F5NA 5BR8M 2QPAA 2XEPA 1X37A 1JR3D 4I8OA 3B9PA 4KODA 2LXEA 3U61B 3SYLA 3GPPA 1QQWA 4IBBA 1IN7A 4QHTA 4L15A 3THGA 4AW4A 2QENA 2XSZA 5FTMA 3WHKA 3FTCA 4JV5M 3TWKA 2YNMD 1IBMM 2M5ZA 3KP0E 4QNRA 3I51A 4LF9M 4GHAA 3K8ZA 3GQ3A 2VQEM 3GP1A 4K0KM 1J09A 1HNZM 1NHGC 4LG2A 2R62A 2HKJA 4IBIA 5F3WA 4OX9M 2KRKA 3L2AA 3TE6A 1E32A 1L8QA 1Z59A 3J27B 3Q8XA 3PXGA 3SMPA 3TQSA 5EXSA 5H37D 4PCZA 1TDZA 4X62M 1IN8A 4Z8XA 2DZOB 4JI0M 3AOGA 4JI6M 5C18A 2HL7A 3PFIA 3VKHA 1L2DA 3HU1A 4LZZA 4PDIA 1NY5A 3T1HM 4G4OA 4FCVA 1ZQ9A 1XWIA 3KVWA 3DOAA 1OFHA 1YSYA 1XNQM 4LFBM 3SYKA 1QAOA 1QYRA 3VK7A 1L1ZA 3NBIA 4NL4H 5ITTA 3U61A 5E26A 3T38A 3KOZE 1ZAEA 3L25A 5EP4A 5ITYA 4PT5A 1IY0A 2CHQA 4LGMA 2X4AA 5ITXA 4G4RA 5IWAM 3FUUA 4MGIE 4D82A 4IBCA 4KLNA 3TPZA 5EP3A 1DO0A 2XFTA 1YUBA 2RGHA 1QAMA 1G41A 4IBDA 1GL6A 2D7EA 2L7IA 1G3IA 2QBYB 3KXEC 4JI7M 2J7NA 4DUZM 1MU5A 2Y21A 3AOEC 3L26A 2VQFM 4DUYM 4I5SA 3FTEA 1IBKM 2HHHM 1HT2E 4GKKM 4ZPXA 3D8LA 2O5RA 2KA6B 4DR7M 3KSJA 3VK8A 2XZUA 4GHLA 4TUWA 1Z5AA 4AKIA 1Q3CA 4LF5M 2R45A 4L4UA 2F5QA 5KPTA 3J80S 1IN6A 3UK6A 1R2YA 3GPYA 1XMQM 2X8AA 1H6UA 2QZ4A 3FTDA 5KQDA 3MK6A 4X65M 3KSXA 3U6OA 4LF7M 3J2PB 2G5GX 4FW9A 4D81A 2Y0QA 4LY6A 4Z6YA 1T3TA 1N75A 3M6AA 3AFHA 3HJ8A 2F5PA 4ITQA 3PNYA 3HJQA 5EXXA 3IG5A 2YR0A 1XXHB 1VDDA 2LWXA 1W5TA 4B3TM 5DNYA 2XZFA 3RFWA 4AG6A 1Z5BA 4PDGA 2R18A 4FWDA 4KHPM 2V1UA 3U6CA 2I7NA 4L16A 1XNRM 1W5SA 3M0EA 2Y0TA 2OPFA 1SXJC 2F5SA 2QBYA 2V6ZM 3FUWA 3SHFA 3HGIA 3SASA 1EE8A 4KO8A 2CV2A 3WHLA 4MGZE 1Q39A 2DWLA 1FJGM 1NY6A 2DVWB 3VDUA 1GLNA 3ILKA 2Z4SA 4IBEA 2A5YB 3I4YA 3IG8A 2J7OA 5IT9S 5FTLA 3SAWA 4S12A 4PD2A 4JXJA 4EIWA 4FCWA 1HNXM 1IBLM 2LH0A 1G4AE 2EA0A 3UGJA 3EIEA 3HHYA 3GLFB 4DR2M 4DV2M 3KOWE 3LVWA 1TDHA 1R2ZA 5EP1A 3CF0A 3J7AS 3FD9A 3HU3A 5FTKA 2CHGA 2UXCM 1E94E 3UJNA 2CFOA 5ITUA 4LCBA 1XXHA 3FUTA 2Z4RA 3A46A 5FTNA 2Z3XA 4AI6A 4LJ9A 4IBJA 4IBKA 1L1TA 2Q2EB 1N34M 5GKNA 2ZM6M 3CTWB 1IXZA 2CV0A 4NXMM 4DV4M 4HL4A 1N77A 2DWMA 2AHMA 5EJCA 4DR1M 3U6LA 4HLQA 4NSOB 3AJIB 3JR5A 2C96A 2F4VM 5KO3A 3SAUA 3U6EA 1L2CA 3MHVC 3GLGB 1QAQA 3FTFA 4LRSA 4QOSA 3M7GA 1GVNA 3GQ5A 1E9SA 1IN4A 4IIWA 2L7HA 5KQ8A 1QANA 2L6OA 1IY1A 2H1RA 3U6DA 3MJ5A 1I4WA 4LFCM 4JI1M 4RNAA 2YQZA 1GL7A 1KYIA 3J7BA 3HHWA 3RGPA 3GLHB 1S3SA 1G59A 3NWLA 4AG5A 2EO2A 2G8LA 3A42A 3RE8A 3ZH9B 2ZAMA 1L2BA 2R65A 4XBOA 4B3MM 2NQ8C 2XGNA 4JI2M 2JA2A 4GIPA 3J81S 1NSFA 3GRUA 3GO8A 3DA1A 5FLXS 5KPRA 4M0WA 2Y20A 4MM3B 2R46A 2E5LM 2VIIA 1DGHB 1DGGA 3JR4A 3SAVA 3L29A 3SATA 5DYGA 1YE9A 3DZDA 5C1BA 4LJAA 4AQYM 2CUZA 1TGUA 3HKPA 2QP9X 4B08A 3GRVA 1TH3A 1QZMA 3AL0C 4M9XA 3L28A 4OVZB 4YHHM 4M0DA 4BB9A 3VKGA 4DV6M 3T1YM 3GLGA 1DGFA 3K1JA 3U6MA 5EP2A 4FCTA 2BNKA 4GMQA 4FWGA 4JI3M 1IQPA 4LF6M 2XFSA 4JI4M 2XF3A 4GH9A 1Z5CA 1HQCA 1JQJC 2KEBA 1N78A 4WW0A 4II7A 2D7HA 1IM2A 3GLHA 4GC9A 4P16A 3K92A 3VFDA 3HWSA 3T15A 5ITRA 3AKZA 4FVMA 1QVRA 5BPVA 4NRVA 3FKEA 4CISA 2KW0A 2DWNA 3R8FA 3GPXA 3AV0A 2DHRA 3VDPA 4B3SM 5JI3E 4LF8M 1DGHA 3LQQA 7CATA 1NNUC 8CATA 2C5RA 4JYAM 4B7GA 1MX0A 4FD2A 4LFAM 4JN6A 4BLCA 4X64M 2L09A 4DV5M 2CV1A 4DR4M 3VLFB 2CHVA 3A98B 2C9CA 3LQRA 4G4QA 3KW6A 1HR0M 2UUAM 4OVZA 4NXNM 3TL4X 4DR3M 2UXBM 1NVMA 3FUXA 2W82A 2M60A 3SHGB 4DV7M 1XC8A 1KSFX 5EXTA 3KS8A 3PNVA 4GRIA 3QWLA 4DV1M 1TH4A 5DYIA 3ZCBB 4LJ4A 4LF4M 1N36M 4GITA 4GC5A 2BJWA 4NSRA 5IREB 1XHBA 4MB7A 1Q3BA 1IXRC 1WXQA 2F5OA 3SARA 1NHWC 4AKHA 3DFZA 1D2NA 1J7KA 3KOXE 4LJ5A 4LJ6A 4RF1A 2EUCA 3HJSA 4L78A 5FSWA 2QCUA 3RGSA 4DR6M 1N32M 2I7PA 2CE7A 2FE8A 3TWLA 4R3DA 3U60B 1PJJA 2LNHC 4LZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R M;  2UXD M;  2UUB M;  5LMN M;  3GPP A;  2E5L M;  3SAV A;  3JR4 A;  4JI8 M;  4JI5 M;  3SAT A;  1J5E M;  4B3T M;  2XZF A;  4AQY M;  1Z5B A;  4PDG A;  3U6P A;  3GPU A;  3W0F A;  1K3X A;  4NRW A;  4JV5 M;  4KHP M;  3TWK A;  3U6C A;  1IBM M;  1HNW M;  3OTO M;  1XNR M;  4LF9 M;  3GQ3 A;  2VQE M;  3GP1 A;  4YHH M;  2OPF A;  4K0K M;  4GKJ M;  2F5S A;  1HNZ M;  4DV6 M;  3T1Y M;  3SAS A;  2HKJ A;  1EE8 A;  3U6M A;  4OX9 M;  1Q39 A;  4G4N A;  4JI3 M;  4LF6 M;  1FJG M;  2UU9 M;  4JI4 M;  1Z59 A;  3TWM A;  1Z5C A;  5ITQ A;  5ITX E;  4PCZ A;  1TDZ A;  1KFV A;  4X62 M;  5IT9 S;  5LMU M;  4JI0 M;  3GQ4 A;  3SAW A;  4JI6 M;  4PD2 A;  1N33 M;  1L2D A;  1HNX M;  1IBL M;  4PDI A;  2EA0 A;  3T1H M;  4G4O A;  3JAM S;  4DR2 M;  1NNJ A;  5ITR A;  3DOA A;  4DV2 M;  3U6Q A;  1I94 M;  1XNQ M;  1TDH A;  1R2Z A;  3J7A S;  2ZBK B;  4NRV A;  3U6S A;  4LFB M;  4CIS A;  3VK7 A;  1L1Z A;  3GPX A;  2UXC M;  4B3S M;  5ITT A;  5ITU A;  4LF8 M;  5ITY A;  3A46 A;  4JYA M;  3A45 A;  1L1T A;  2Q2E B;  1N34 M;  5ITX A;  4G4R A;  5IWA M;  2ZM6 M;  3SBJ A;  3C58 A;  1MX0 A;  4LFA M;  4X64 M;  4NXM M;  4DV4 M;  2OQ4 A;  4DV5 M;  4DR4 M;  4G4Q A;  4DR1 M;  1HR0 M;  2UUA M;  3U6L A;  4NXN M;  1PM5 A;  1PJI A;  4DV3 M;  3JR5 A;  2F4V M;  4JI7 M;  3SAU A;  3U6E A;  4DUZ M;  4DR3 M;  2UXB M;  1MU5 A;  2VQF M;  4DUY M;  4DV7 M;  1L2C A;  3GQ5 A;  5A2Q S;  1K3W A;  1XC8 A;  1IBK M;  2HHH M;  4DV1 M;  4GKK M;  4X66 M;  2UUC M;  4LF4 M;  1N36 M;  3U6D A;  3VK8 A;  4DR7 M;  2XZU A;  1Z5A A;  4DV0 M;  1Q3C A;  4MB7 A;  4LF5 M;  1Q3B A;  2F5O A;  4JI1 M;  3SAR A;  4LFC M;  2F5Q A;  3J80 S;  1R2Y A;  3GPY A;  4YY3 M;  1XMQ M;  3A42 A;  1L2B A;  4DR5 M;  4B3M M;  4DR6 M;  4JI2 M;  1N32 M;  4X65 M;  3U6O A;  1K82 A;  3J81 S;  4LF7 M;  1XMO M;  2F5N A;  3TWL A;  5BR8 M;  3GO8 A;  1PJJ A;  5FLX S;  2F5P A;  4ITQ A; 
#chains in the Genus database with same CATH topology
 4B3R M;  2UXD M;  1Z6T A;  4L8R C;  2UUB M;  5LMN M;  1HQY E;  1QUT A;  2C98 A;  2C99 A;  1FNN A;  1OAI A;  1PJT A;  2XH9 A;  4CGY B;  4D80 A;  3U5Z B;  4JI5 M;  1J5E M;  3F92 A;  3FUV A;  1ZV1 A;  5E6J A;  3E9S A;  3H4M A;  2FOI C;  4OU7 A;  3U6P A;  5A2Q S;  3W0F A;  3GPU A;  1K3X A;  5KPZ A;  4NRW A;  1R4G A;  1C1K A;  4QOZ C;  1GKI A;  1SXJ D;  2XLJ A;  1HNW M;  3OTO M;  1OFI A;  5IZ7 D;  3KFU G;  1BVS A;  3B7Z A;  3B7N A;  1TR8 A;  4A3V B;  2RKO A;  3GRY A;  1ZMW A;  3GLF A;  4GKJ M;  3B74 A;  2LVO C;  1DO2 A;  4WUR A;  2C9O A;  3SFZ A;  1SXJ B;  1TH2 A;  1IN5 A;  4BBA A;  2DZN B;  1DV0 A;  4G4N A;  3BXW A;  3AOE A;  4QHS A;  2CEA A;  2UU9 M;  3HHZ A;  1VEG A;  2ZAN A;  3QAU A;  4LJ8 A;  3TWM A;  1IXS B;  1JR3 E;  3FYD A;  5ITQ A;  5ITX E;  3GRR A;  2FFJ A;  1UM8 A;  2R4E A;  3B7Q A;  3HU2 A;  1DGB A;  1JR3 A;  3K2L A;  3GLI B;  5LMU M;  1NJG A;  3ZC7 B;  2R4J A;  1KFV A;  3L27 A;  4MGH A;  1T43 A;  2D7G A;  2K47 A;  2O25 A;  3SMS A;  2ERC A;  1OTR A;  3BOS A;  3CF6 E;  1LV7 A;  3HHX A;  3GQ4 A;  1NJF A;  2JZ1 A;  1N33 M;  2L4F A;  2JZ0 A;  1HT1 E;  1OQY A;  1V92 A;  3EIH A;  2K0B X;  1R7R A;  1G8P A;  3JAM S;  2KZU A;  3KDS E;  1NNJ A;  2GNO A;  2OO9 A;  3SC3 A;  2V1C A;  3U6Q A;  1I94 M;  5EXP A;  1AUA A;  1ORY B;  2DAG A;  2XSZ D;  2ZBK B;  4I81 A;  3U6S A;  3U60 A;  2KXE A;  3I4V A;  4QNM A;  5JI2 E;  1R6B X;  4IBF A;  2ZAO A;  4F2L A;  3E4R A;  3FYC A;  4IJE A;  2H5X A;  3C3E A;  3LVV A;  3U5Z A;  4CHT B;  3A45 A;  4Y28 F;  5EQT A;  3LMM A;  2DXI A;  5FTJ A;  4LRT A;  4MH0 E;  3KOY E;  1JB0 F;  4REZ A;  1IY2 A;  4MGK E;  3UZU A;  2Z8Y M;  2RGO A;  4MGY E;  3C58 A;  1ZMV A;  2OQ4 A;  4AZF A;  1PM5 A;  1PJI A;  4DV3 M;  4LGY A;  1SXJ E;  2HWJ A;  3KS4 A;  1SXJ A;  3T6P A;  2P5T A;  1T6O A;  3PVS A;  4G6Z A;  1LTM A;  2DNA A;  4XK8 F;  4OW0 A;  4NOO B;  2FNA A;  2K6B A;  4R7G A;  2HCB A;  4LJ7 A;  2X49 A;  4M9Z A;  3W0L B;  3W68 A;  3D8B A;  1E9R A;  4B7F A;  1IXS A;  1NV9 A;  4XGI A;  4X66 M;  4CIZ A;  3GLI E;  2UUC M;  4AKG A;  4M9S A;  4I4L A;  4IBG A;  1VEJ A;  2JNH A;  3GLI A;  2KNA A;  2YFQ A;  1UFZ A;  4DV0 M;  1P3Q Q;  3UMM A;  2JY8 A;  3R9X B;  2KRU A;  4W5W A;  4RF0 A;  4YY3 M;  3KP1 E;  2Z7J A;  1OJL A;  4FWH A;  2KZS A;  4DR5 M;  1GJT A;  2L4E A;  2DWZ B;  1TTE A;  1F4I A;  2BJV A;  1K82 A;  4B7H A;  1XMO M;  3CF2 A;  4IJF A;  2F5N A;  5BR8 M;  2QPA A;  2XEP A;  1X37 A;  1JR3 D;  1C7Y A;  4I8O A;  3B9P A;  4KOD A;  2LXE A;  4NC6 A;  3U61 B;  3SYL A;  4ANR A;  3GPP A;  1QQW A;  4IBB A;  1IN7 A;  4QHT A;  4L15 A;  2MR9 A;  3THG A;  1GAB A;  4AW4 A;  2QEN A;  2XSZ A;  3C9P A;  5FTM A;  3WHK A;  3FTC A;  4JV5 M;  3TWK A;  2YNM D;  1IBM M;  2M5Z A;  2ZTD A;  3KP0 E;  4QNR A;  1OAO C;  3MMP A;  3I51 A;  4LF9 M;  4GHA A;  3K8Z A;  4F1I A;  3GQ3 A;  2VQE M;  3GP1 A;  3LCV B;  4K0K M;  1J09 A;  3FE3 A;  4GEW A;  1HNZ M;  1NHG C;  4LG2 A;  2R62 A;  2HKJ A;  2GQF A;  4IBI A;  2O01 F;  5F3W A;  4OX9 M;  2KRK A;  3E21 A;  3L2A A;  3TE6 A;  1E32 A;  1XXH E;  1L8Q A;  1Z59 A;  3J27 B;  3Q8X A;  3PXG A;  3SMP A;  3TQS A;  5EXS A;  2MRO B;  5H37 D;  2CP8 A;  4PCZ A;  1TDZ A;  3ZQJ A;  2R0I A;  4X62 M;  2QHO B;  1IN8 A;  4Z8X A;  2DZO B;  4JI0 M;  3AOG A;  4JI6 M;  5C18 A;  2HL7 A;  3PFI A;  3VKH A;  1L2D A;  3HU1 A;  4LZZ A;  4PDI A;  1NY5 A;  3T1H M;  4G4O A;  3I01 M;  4FCV A;  1ZQ9 A;  1XWI A;  2DAI A;  3KVW A;  3DOA A;  1OFH A;  2LTU A;  1YSY A;  1XNQ M;  4LFB M;  3SYK A;  3LW5 F;  3NBX X;  1QAO A;  1QYR A;  2LHG A;  3VK7 A;  1L1Z A;  1WR1 B;  2MH8 A;  3NBI A;  4NL4 H;  5ITT A;  3U61 A;  5E26 A;  3T38 A;  3KOZ E;  1ZAE A;  3L25 A;  2LBC A;  5EP4 A;  1HJP A;  5ITY A;  4PT5 A;  1IY0 A;  2CHQ A;  4LGM A;  2G3Q A;  2DHY A;  2X4A A;  5ITX A;  2EKF A;  5IWA M;  3FUU A;  4MGI E;  4G4R A;  2OOA A;  4D82 A;  4IBC A;  4KLN A;  3TPZ A;  3H4J A;  5EP3 A;  1DO0 A;  2XFT A;  1YUB A;  2RGH A;  1QAM A;  1G41 A;  4IBD A;  1GL6 A;  2D7E A;  2L7I A;  1G3I A;  2QBY B;  3KXE C;  4JI7 M;  2J7N A;  3QYE A;  4DUZ M;  4JI8 M;  1MU5 A;  2Y21 A;  3AOE C;  4WP2 A;  3L26 A;  2VQF M;  4DUY M;  1PJQ A;  4I5S A;  2FS1 A;  3FTE A;  2JXN A;  1IBK M;  2HHH M;  1GJS A;  1HT2 E;  1R5L A;  4GKK M;  4ZPX A;  2HAK A;  3D8L A;  2KDL A;  2O5R A;  3C3D A;  2KA6 B;  3E46 A;  3K9O A;  4DR7 M;  3KSJ A;  3VK8 A;  2R6F A;  2XZU A;  4GHL A;  1Z5A A;  4TUW A;  1Q3C A;  4LF5 M;  2R45 A;  4L4U A;  4AKI A;  2F5Q A;  5KPT A;  3J80 S;  1IN6 A;  1D0L A;  3UK6 A;  1R2Y A;  3GPY A;  1OIZ A;  1XMQ M;  2JY6 B;  2JP7 A;  2X8A A;  1H6U A;  2QZ4 A;  3FTD A;  5KQD A;  3GLG E;  3I04 M;  3MK6 A;  4X65 M;  3KSX A;  3U6O A;  4LF7 M;  3J2P B;  1IFY A;  2G5G X;  4FW9 A;  4D81 A;  2Y0Q A;  4LY6 A;  4Z6Y A;  1T3T A;  1N75 A;  3M6A A;  3AFH A;  3HJ8 A;  2F5P A;  4ITQ A;  3PNY A;  3HJQ A;  1D0K A;  5EXX A;  3IG5 A;  2BWB A;  2YR0 A;  1XXH B;  1VDD A;  2LWX A;  2DAE A;  1ZMU A;  1W5T A;  4DBG B;  4B3T M;  3IHP A;  5DNY A;  2XZF A;  3RFW A;  4AG6 A;  1Z5B A;  4PDG A;  2R18 A;  4FWD A;  4KHP M;  2V1U A;  3U6C A;  2I7N A;  4L16 A;  1V33 A;  1XNR M;  1W5S A;  3M0E A;  2Y0T A;  2OPF A;  1SXJ C;  2F5S A;  2QBY A;  2JWS A;  2V6Z M;  3FUW A;  3SHF A;  3HGI A;  3SAS A;  1EE8 A;  2QSF X;  4KO8 A;  1K3W A;  2CV2 A;  3WHL A;  4MGZ E;  1Q39 A;  1VQ1 A;  2DWL A;  1FJG M;  1NY6 A;  4L6V 6;  2DVW B;  1WGL A;  3VDU A;  1GLN A;  3ILK A;  2Z4S A;  4IBE A;  2WSF F;  2JUJ A;  2A5Y B;  3I4Y A;  3IG8 A;  2J7O A;  5IT9 S;  5FTL A;  3SAW A;  1V34 A;  4S12 A;  2LVA A;  4G3O A;  4PD2 A;  4JXJ A;  4EIW A;  4FCW A;  4R71 A;  1HNX M;  1IBL M;  1MN3 A;  2LH0 A;  1G4A E;  2EA0 A;  3UGJ A;  3EIE A;  3HHY A;  3GLF B;  4DR2 M;  1Q02 A;  3SBJ A;  4DV2 M;  2J5Y A;  2DI0 A;  3KOW E;  3LVW A;  2FH0 A;  1TDH A;  2K9D A;  5EP1 A;  1WGN A;  3CF0 A;  3FD9 A;  1VEK A;  3HU3 A;  1R2Z A;  3J7A S;  2QQ8 A;  2CHG A;  1VG5 A;  5FTK A;  2N35 A;  2UXC M;  2L2D A;  1E94 E;  3UJN A;  3HZJ A;  2CFO A;  2KNZ A;  2MGW A;  5ITU A;  2DEN A;  2KHH A;  1EFU B;  4LCB A;  1XXH A;  3FUT A;  1D0M A;  2Z4R A;  3A46 A;  5FTN A;  2Z3X A;  4AI6 A;  4LJ9 A;  4IBJ A;  4IBK A;  1L1T A;  2Q2E B;  1N34 M;  2RRU A;  5GKN A;  2ZM6 M;  3CTW B;  1IXZ A;  2CV0 A;  1CUK A;  4NXM M;  4DV4 M;  4HL4 A;  1N77 A;  2DWM A;  2AHM A;  5EJC A;  4DR1 M;  4UN2 B;  3U6L A;  2CWB A;  4HLQ A;  4NSO B;  3AJI B;  3JR5 A;  2C96 A;  2F4V M;  2CRU A;  5KO3 A;  3SAU A;  3U6E A;  1L2C A;  3MHV C;  3GLG B;  1QAQ A;  3FTF A;  4LRS A;  4QOS A;  3M7G A;  1GVN A;  3GQ5 A;  1E9S A;  1IN4 A;  4IIW A;  2L7H A;  5KQ8 A;  1WIV A;  1QAN A;  2L6O A;  4KT0 F;  1IY1 A;  2H1R A;  2LVQ D;  3U6D A;  3MJ5 A;  1I4W A;  4LFC M;  2LHC A;  2KNV A;  4JI1 M;  4RNA A;  2YQZ A;  1GL7 A;  1KYI A;  3J7B A;  3HHW A;  3RGP A;  3GLH B;  3GLF E;  1S3S A;  1G59 A;  3NWL A;  4AG5 A;  5DFL A;  2EO2 A;  2G8L A;  3A42 A;  3RE8 A;  3ZH9 B;  2ZAM A;  1L2B A;  2R65 A;  4XBO A;  4B3M M;  2NQ8 C;  2XGN A;  4JI2 M;  2LVP C;  2JA2 A;  4GIP A;  3J81 S;  1WHC A;  1VDL A;  1NSF A;  3GRU A;  3GO8 A;  3DA1 A;  5FLX S;  5KPR A;  4M0W A;  1PRB A;  2Y20 A;  1QDT A;  3HX3 A;  4MM3 B;  2R46 A;  1GO5 A;  2E5L M;  2VII A;  1DGH B;  1DGG A;  3JR4 A;  3SAV A;  3L29 A;  3SAT A;  5DYG A;  1A5T A;  3IEC A;  2EJS A;  2WSE F;  1YE9 A;  3DZD A;  5C1B A;  4LJA A;  4AQY M;  2CUZ A;  1TGU A;  3BBZ A;  3HKP A;  1SG9 A;  2QP9 X;  4B08 A;  2VF7 A;  2OOB A;  3GRV A;  1TH3 A;  1QZM A;  3AL0 C;  4M9X A;  2WZJ A;  3L28 A;  1WJ7 A;  4OVZ B;  2EKK A;  4YHH M;  4M0D A;  4BB9 A;  1OIP A;  3VKG A;  4DV6 M;  3T1Y M;  3LCU A;  4P17 A;  1DGF A;  3K1J A;  3GLG A;  5EP2 A;  4FCT A;  2BNK A;  4GMQ A;  4FWG A;  3U6M A;  4JI3 M;  1IQP A;  4LF6 M;  2XFS A;  4JI4 M;  2XF3 A;  4GH9 A;  1Z5C A;  2R44 A;  1HQC A;  1JQJ C;  2B3T A;  2KEB A;  1N78 A;  4WW0 A;  4Q7J A;  3GLH E;  1QZE A;  2D7H A;  4II7 A;  1IM2 A;  3CGW A;  3GLH A;  4GC9 A;  1MJG M;  4P16 A;  3K92 A;  3HY5 A;  1YLA A;  3VFD A;  3HWS A;  3T15 A;  5ITR A;  3AKZ A;  4FVM A;  1QVR A;  5BPV A;  4NRV A;  3FKE A;  4CIS A;  1G71 A;  2KW0 A;  2DWN A;  3R8F A;  3GPX A;  3AV0 A;  2JY5 A;  2DHR A;  2JY7 A;  3VDP A;  4B3S M;  2QNJ A;  5JI3 E;  4LF8 M;  1DGH A;  3LQQ A;  1AIP C;  7CAT A;  1NNU C;  1PJS A;  8CAT A;  1Y8G A;  2C5R A;  2ZTC A;  4JYA M;  4B7G A;  5L8R F;  1OKS A;  3FRI A;  1QUS A;  2DKL A;  1MX0 A;  2VDB B;  4FD2 A;  4LFA M;  1TF0 B;  4JN6 A;  4BLC A;  4X64 M;  2DAK A;  2L09 A;  4DV5 M;  2CV1 A;  4DR4 M;  3VLF B;  4HEO A;  2CHV A;  2DZL A;  2C9C A;  3A98 B;  3LQR A;  3KW6 A;  3W67 A;  4G4Q A;  1NO1 A;  4OVZ A;  4NXN M;  1HR0 M;  4RKU F;  2MJ5 B;  2UUA M;  3TL4 X;  2WSC F;  4DR3 M;  2UXB M;  1NVM A;  3QYB A;  3FUX A;  2W82 A;  2M60 A;  3Q8G A;  2DAM A;  3SHG B;  3FRH A;  4DV7 M;  1EIJ A;  1XC8 A;  1KSF X;  3V76 A;  5EXT A;  3KS8 A;  3PNV A;  4GRI A;  3QWL A;  4DV1 M;  1TH4 A;  1RU3 A;  3B89 A;  5DYI A;  3ZCB B;  4LJ4 A;  4LF4 M;  1N36 M;  4GIT A;  4GC5 A;  1PGY A;  1XB2 B;  2BJW A;  4NSR A;  5IRE B;  1XHB A;  1NV8 A;  1Q3B A;  1IXR C;  1WXQ A;  4MB7 A;  2F5O A;  1NHW C;  3SAR A;  4AKH A;  3DFZ A;  3K9P A;  2BWE A;  1D2N A;  1J7K A;  2VF8 A;  3KOX E;  4LJ5 A;  4LJ6 A;  4RF1 A;  2EUC A;  4CJ6 A;  2LVN C;  3HJS A;  4L78 A;  5FSW A;  2QCU A;  2APL A;  3RGS A;  4DR6 M;  1N32 M;  2I7P A;  2CE7 A;  2FE8 A;  1QDR A;  3TWL A;  4R3D A;  3U60 B;  1PJJ A;  2LNH C;  4LZJ A; 
#chains in the Genus database with same CATH homology
 4B3R M;  2UXD M;  1Z6T A;  4L8R C;  2UUB M;  5LMN M;  1HQY E;  2C98 A;  2C99 A;  4D80 A;  1FNN A;  2XH9 A;  4JI5 M;  4CGY B;  4JI8 M;  3U5Z B;  1J5E M;  3FUV A;  5E6J A;  3E9S A;  3H4M A;  2FOI C;  4OU7 A;  3U6P A;  3GPU A;  3W0F A;  1K3X A;  4QOZ C;  5KPZ A;  4NRW A;  1C1K A;  1GKI A;  1SXJ D;  2XLJ A;  1HNW M;  3OTO M;  1OFI A;  5IZ7 D;  3KFU G;  4A3V B;  3GLF A;  2RKO A;  3GRY A;  4GKJ M;  1DO2 A;  4WUR A;  2C9O A;  3SFZ A;  1SXJ B;  1TH2 A;  1IN5 A;  4BBA A;  2DZN B;  4G4N A;  3AOE A;  4QHS A;  2CEA A;  2UU9 M;  3HHZ A;  2ZAN A;  3QAU A;  4LJ8 A;  3TWM A;  1IXS B;  3FYD A;  5ITQ A;  5ITX E;  3GRR A;  2FFJ A;  1UM8 A;  2R4E A;  3HU2 A;  1DGB A;  1JR3 A;  3K2L A;  3GLI B;  5LMU M;  1NJG A;  3ZC7 B;  2R4J A;  1KFV A;  3L27 A;  4MGH A;  2D7G A;  2K47 A;  3GQ4 A;  3SMS A;  2ERC A;  3BOS A;  3CF6 E;  1LV7 A;  3HHX A;  1NJF A;  1N33 M;  1HT1 E;  3EIH A;  1R7R A;  1G8P A;  3JAM S;  2KZU A;  3KDS E;  1NNJ A;  3SC3 A;  2V1C A;  3U6Q A;  1I94 M;  5EXP A;  1ORY B;  2ZBK B;  2XSZ D;  4I81 A;  3U6S A;  3U60 A;  2KXE A;  3I4V A;  4QNM A;  5JI2 E;  1R6B X;  4IBF A;  2ZAO A;  3E4R A;  3FYC A;  4IJE A;  3LVV A;  3U5Z A;  4CHT B;  3A45 A;  5EQT A;  2DXI A;  3LMM A;  5FTJ A;  4LRT A;  4MH0 E;  3KOY E;  3C58 A;  4REZ A;  1IY2 A;  4MGK E;  3UZU A;  3SBJ A;  2RGO A;  4MGY E;  2OQ4 A;  4AZF A;  1PM5 A;  1PJI A;  4DV3 M;  4LGY A;  1SXJ E;  3KS4 A;  1SXJ A;  2P5T A;  3PVS A;  4G6Z A;  5A2Q S;  1K3W A;  4OW0 A;  4NOO B;  2FNA A;  4R7G A;  2HCB A;  4LJ7 A;  2X49 A;  4M9Z A;  3W0L B;  3D8B A;  1E9R A;  4B7F A;  4XGI A;  4X66 M;  4AKG A;  2UUC M;  4M9S A;  4I4L A;  4IBG A;  3GLI A;  2YFQ A;  4DV0 M;  3UMM A;  3R9X B;  2KRU A;  4W5W A;  4RF0 A;  4YY3 M;  3KP1 E;  2Z7J A;  1OJL A;  4FWH A;  2KZS A;  4DR5 M;  2DWZ B;  2BJV A;  1K82 A;  4B7H A;  1XMO M;  3CF2 A;  4IJF A;  2F5N A;  5BR8 M;  2QPA A;  2XEP A;  1X37 A;  1JR3 D;  4I8O A;  3B9P A;  4KOD A;  2LXE A;  3U61 B;  3SYL A;  3GPP A;  1QQW A;  4IBB A;  1IN7 A;  4QHT A;  4L15 A;  3THG A;  4AW4 A;  2QEN A;  2XSZ A;  5FTM A;  3WHK A;  3FTC A;  4JV5 M;  3TWK A;  2YNM D;  1IBM M;  2M5Z A;  3KP0 E;  4QNR A;  3I51 A;  4LF9 M;  4GHA A;  3K8Z A;  3GQ3 A;  2VQE M;  3GP1 A;  4K0K M;  1J09 A;  1HNZ M;  1NHG C;  4LG2 A;  2R62 A;  2HKJ A;  4IBI A;  5F3W A;  4OX9 M;  2KRK A;  3L2A A;  3TE6 A;  1E32 A;  1L8Q A;  1Z59 A;  3J27 B;  3Q8X A;  3PXG A;  3SMP A;  3TQS A;  5EXS A;  5H37 D;  4PCZ A;  1TDZ A;  4X62 M;  1IN8 A;  4Z8X A;  2DZO B;  4JI0 M;  3AOG A;  4JI6 M;  5C18 A;  2HL7 A;  3PFI A;  3VKH A;  1L2D A;  3HU1 A;  4LZZ A;  4PDI A;  1NY5 A;  3T1H M;  4G4O A;  4FCV A;  1ZQ9 A;  1XWI A;  3KVW A;  3DOA A;  1OFH A;  1YSY A;  1XNQ M;  4LFB M;  3SYK A;  1QAO A;  1QYR A;  3VK7 A;  1L1Z A;  3NBI A;  4NL4 H;  5ITT A;  3U61 A;  5E26 A;  3T38 A;  3KOZ E;  1ZAE A;  3L25 A;  5EP4 A;  5ITY A;  4PT5 A;  1IY0 A;  2CHQ A;  4LGM A;  2X4A A;  5ITX A;  4G4R A;  5IWA M;  3FUU A;  4MGI E;  4D82 A;  4IBC A;  4KLN A;  3TPZ A;  5EP3 A;  1DO0 A;  2XFT A;  1YUB A;  2RGH A;  1QAM A;  1G41 A;  4IBD A;  1GL6 A;  2D7E A;  2L7I A;  1G3I A;  2QBY B;  3KXE C;  4JI7 M;  2J7N A;  4DUZ M;  1MU5 A;  2Y21 A;  3AOE C;  3L26 A;  2VQF M;  4DUY M;  4I5S A;  3FTE A;  1IBK M;  2HHH M;  1HT2 E;  4GKK M;  4ZPX A;  3D8L A;  2O5R A;  2KA6 B;  4DR7 M;  3KSJ A;  3VK8 A;  2XZU A;  4GHL A;  4TUW A;  1Z5A A;  4AKI A;  1Q3C A;  4LF5 M;  2R45 A;  4L4U A;  2F5Q A;  5KPT A;  3J80 S;  1IN6 A;  3UK6 A;  1R2Y A;  3GPY A;  1XMQ M;  2X8A A;  1H6U A;  2QZ4 A;  3FTD A;  5KQD A;  3MK6 A;  4X65 M;  3KSX A;  3U6O A;  4LF7 M;  3J2P B;  2G5G X;  4FW9 A;  4D81 A;  2Y0Q A;  4LY6 A;  4Z6Y A;  1T3T A;  1N75 A;  3M6A A;  3AFH A;  3HJ8 A;  2F5P A;  4ITQ A;  3PNY A;  3HJQ A;  5EXX A;  3IG5 A;  2YR0 A;  1XXH B;  1VDD A;  2LWX A;  1W5T A;  4B3T M;  5DNY A;  2XZF A;  3RFW A;  4AG6 A;  1Z5B A;  4PDG A;  2R18 A;  4FWD A;  4KHP M;  2V1U A;  3U6C A;  2I7N A;  4L16 A;  1XNR M;  1W5S A;  3M0E A;  2Y0T A;  2OPF A;  1SXJ C;  2F5S A;  2QBY A;  2V6Z M;  3FUW A;  3SHF A;  3HGI A;  3SAS A;  1EE8 A;  4KO8 A;  2CV2 A;  3WHL A;  4MGZ E;  1Q39 A;  2DWL A;  1FJG M;  1NY6 A;  2DVW B;  3VDU A;  1GLN A;  3ILK A;  2Z4S A;  4IBE A;  2A5Y B;  3I4Y A;  3IG8 A;  2J7O A;  5IT9 S;  5FTL A;  3SAW A;  4S12 A;  4PD2 A;  4JXJ A;  4EIW A;  4FCW A;  1HNX M;  1IBL M;  2LH0 A;  1G4A E;  2EA0 A;  3UGJ A;  3EIE A;  3HHY A;  3GLF B;  4DR2 M;  4DV2 M;  3KOW E;  3LVW A;  1TDH A;  1R2Z A;  5EP1 A;  3CF0 A;  3J7A S;  3FD9 A;  3HU3 A;  5FTK A;  2CHG A;  2UXC M;  1E94 E;  3UJN A;  2CFO A;  5ITU A;  4LCB A;  1XXH A;  3FUT A;  2Z4R A;  3A46 A;  5FTN A;  2Z3X A;  4AI6 A;  4LJ9 A;  4IBJ A;  4IBK A;  1L1T A;  2Q2E B;  1N34 M;  5GKN A;  2ZM6 M;  3CTW B;  1IXZ A;  2CV0 A;  4NXM M;  4DV4 M;  4HL4 A;  1N77 A;  2DWM A;  2AHM A;  5EJC A;  4DR1 M;  3U6L A;  4HLQ A;  4NSO B;  3AJI B;  3JR5 A;  2C96 A;  2F4V M;  5KO3 A;  3SAU A;  3U6E A;  1L2C A;  3MHV C;  3GLG B;  1QAQ A;  3FTF A;  4LRS A;  4QOS A;  3M7G A;  1GVN A;  3GQ5 A;  1E9S A;  1IN4 A;  4IIW A;  2L7H A;  5KQ8 A;  1QAN A;  2L6O A;  1IY1 A;  2H1R A;  3U6D A;  3MJ5 A;  1I4W A;  4LFC M;  4JI1 M;  4RNA A;  2YQZ A;  1GL7 A;  1KYI A;  3J7B A;  3HHW A;  3RGP A;  3GLH B;  1S3S A;  1G59 A;  3NWL A;  4AG5 A;  2EO2 A;  2G8L A;  3A42 A;  3RE8 A;  3ZH9 B;  2ZAM A;  1L2B A;  2R65 A;  4XBO A;  4B3M M;  2NQ8 C;  2XGN A;  4JI2 M;  2JA2 A;  4GIP A;  3J81 S;  1NSF A;  3GRU A;  3GO8 A;  3DA1 A;  5FLX S;  5KPR A;  4M0W A;  2Y20 A;  4MM3 B;  2R46 A;  2E5L M;  2VII A;  1DGH B;  1DGG A;  3JR4 A;  3SAV A;  3L29 A;  3SAT A;  5DYG A;  1YE9 A;  3DZD A;  5C1B A;  4LJA A;  4AQY M;  2CUZ A;  1TGU A;  3HKP A;  2QP9 X;  4B08 A;  3GRV A;  1TH3 A;  1QZM A;  3AL0 C;  4M9X A;  3L28 A;  4OVZ B;  4YHH M;  4M0D A;  4BB9 A;  3VKG A;  4DV6 M;  3T1Y M;  3GLG A;  1DGF A;  3K1J A;  3U6M A;  5EP2 A;  4FCT A;  2BNK A;  4GMQ A;  4FWG A;  4JI3 M;  1IQP A;  4LF6 M;  2XFS A;  4JI4 M;  2XF3 A;  4GH9 A;  1Z5C A;  1HQC A;  1JQJ C;  2KEB A;  1N78 A;  4WW0 A;  4II7 A;  2D7H A;  1IM2 A;  3GLH A;  4GC9 A;  4P16 A;  3K92 A;  3VFD A;  3HWS A;  3T15 A;  5ITR A;  3AKZ A;  4FVM A;  1QVR A;  5BPV A;  4NRV A;  3FKE A;  4CIS A;  2KW0 A;  2DWN A;  3R8F A;  3GPX A;  3AV0 A;  2DHR A;  3VDP A;  4B3S M;  5JI3 E;  4LF8 M;  1DGH A;  3LQQ A;  7CAT A;  1NNU C;  8CAT A;  2C5R A;  4JYA M;  4B7G A;  1MX0 A;  4FD2 A;  4LFA M;  4JN6 A;  4BLC A;  4X64 M;  2L09 A;  4DV5 M;  2CV1 A;  4DR4 M;  3VLF B;  2CHV A;  3A98 B;  2C9C A;  3LQR A;  4G4Q A;  3KW6 A;  1HR0 M;  2UUA M;  4OVZ A;  4NXN M;  3TL4 X;  4DR3 M;  2UXB M;  1NVM A;  3FUX A;  2W82 A;  2M60 A;  3SHG B;  4DV7 M;  1XC8 A;  1KSF X;  5EXT A;  3KS8 A;  3PNV A;  4GRI A;  3QWL A;  4DV1 M;  1TH4 A;  5DYI A;  3ZCB B;  4LJ4 A;  4LF4 M;  1N36 M;  4GIT A;  4GC5 A;  2BJW A;  4NSR A;  5IRE B;  1XHB A;  4MB7 A;  1Q3B A;  1IXR C;  1WXQ A;  2F5O A;  3SAR A;  1NHW C;  4AKH A;  3DFZ A;  1D2N A;  1J7K A;  3KOX E;  4LJ5 A;  4LJ6 A;  4RF1 A;  2EUC A;  3HJS A;  4L78 A;  5FSW A;  2QCU A;  3RGS A;  4DR6 M;  1N32 M;  2I7P A;  2CE7 A;  2FE8 A;  3TWL A;  4R3D A;  3U60 B;  1PJJ A;  2LNH C;  4LZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...