1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
4DUZM 3JR4A 1HR0M 4PDGA 5ITRA 3SAVA 3U6CA 2XZUA 2HHHM 1PJJA 1IBMM 2UUBM 4GKKM 2F5PA 4G4OA 5LMUM 2UXBM 2Q2EB 4NXMM 1HNWM 1R2ZA 4DV0M 5ITQA 1HNXM 4X66M 3GPYA 4X64M 5IT9S 1Z5AA 3U6LA 4LF7M 4DR3M 1N36M 4DV5M 3GQ5A 1N33M 4JI6M 3A42A 4LF5M 2EA0A 4LFAM 3C58A 4CISA 2ZM6M 2ZBKB 3A45A 2UUAM 4B3SM 4YHHM 4LF6M 1L1TA 4PCZA 3SAUA 4B3MM 4NXNM 1R2YA 3U6OA 1Z5CA 1L2CA 2F5NA 1N32M 1MU5A 1L2BA 2UXCM 3U6EA 1Q3CA 1Z59A 3SAWA 2UXDM 4NRWA 3VK7A 4JI1M 2UUCM 4LF4M 1IBLM 4K0KM 2E5LM 4PD2A 5ITXE 4B3RM 5ITYA 4DV6M 3DOAA 4JV5M 1I94M 1MX0A 2HKJA 4DV7M 4DR7M 1L1ZA 1N34M 3U6MA 2VQEM 4DR4M 1TDZA 4DR6M 4GKJM 4NRVA 5IWAM 3JR5A 1XNQM 5A2QS 4KHPM 2OPFA 4G4NA 1K3XA 1PM5A 3VK8A 3SATA 4ITQA 1EE8A 1XMQM 1HNZM 4DV1M 4G4QA 3GPXA 3J7AS 1XNRM 4LF9M 1TDHA 1PJIA 4OX9M 3U6PA 3GQ3A 3JAMS 2F4VM 4YY3M 4X65M 3GPPA 4JI3M 5ITXA 3A46A 3GO8A 1XC8A 2UU9M 1L2DA 3SBJA 5BR8M 1K3WA 3SASA 1K82A 3TWKA 4B3TM 4JI2M 4DR1M 4JYAM 5FLXS 3GP1A 4MB7A 1IBKM 3TWMA 4LFCM 1Z5BA 1J5EM 1Q39A 5ITUA 1FJGM 3J81S 4DV3M 3T1YM 3TWLA 2F5SA 2XZFA 3SARA 5LMNM 4DV2M 3U6DA 4JI5M 3GQ4A 3OTOM 4X62M 4PDIA 4JI0M 3U6SA 3W0FA 1KFVA 4DR2M 2VQFM 1Q3BA 4AQYM 1NNJA 2OQ4A 2F5QA 4JI7M 1XMOM 2F5OA 4JI8M 3GPUA 4DV4M 4JI4M 4LF8M 3U6QA 4LFBM 3J80S 3T1HM 5ITTA 4G4RA 4DR5M 4DUYM
chains in the Genus database with same CATH superfamily
3JR4A 1QVRA 5ITRA 3GLIA 3HJQA 2HHHM 1PJJA 1IBMM 1AUAA 2UUBM 1XWIA 3MJ5A 4GKKM 2L09A 1NSFA 3LQRA 3GRYA 4LJ8A 3PNVA 4IBCA 4R3DA 2O01F 2M60A 4BBAA 5IT9S 3L2AA 4X64M 3VKHA 4LF7M 2QCUA 4DV5M 4NL4H 5C1BA 2WSEF 4AKHA 3FKEA 1HQYE 1N75A 1G3IA 4I81A 4JI6M 1N33M 1XXHB 1SG9A 2EA0A 4CISA 3ZCBB 2UUAM 2DVWB 2BNKA 3I51A 3QAUA 4Z8XA 4YHHM 3U61B 4L8RC 3TQSA 4Q7JA 1IY1A 1NNUC 1ZMWA 1JR3E 4PCZA 3SAUA 2JXNA 1WHCA 3HU1A 1GL7A 3E21A 2Z3XA 2G5GX 2VF7A 3AV0A 2ZAMA 4QHSA 1KSFX 1R2YA 1ZQ9A 2VDBB 4GC9A 1ZMVA 4I8OA 4JN6A 2GQFA 3U5ZB 3KDSE 3GLGA 1OFIA 2UXDM 4NC6A 4A3VB 2L2DA 2VF8A 3FUWA 2JY6B 1GVNA 3K92A 3H4JA 1IY0A 3KXEC 3U60B 3PNYA 4DV6M 3DA1A 3DOAA 3I4YA 1I94M 1MX0A 2K6BA 2BWEA 3QYBA 1IQPA 4NOOB 4GRIA 1IN4A 4GITA 4OVZB 1QQWA 2LH0A 3E46A 5IREB 4DR6M 2QBYA 5DYGA 4KLNA 2CV2A 2HCBA 2JY7A 1DGHA 3FTDA 3IG8A 1WGLA 1OIZA 4KHPM 2OPFA 1D0MA 3VK8A 4LZZA 3SATA 2LWXA 4HLQA 3J7AS 1OAIA 2MGWA 2DAGA 2G8LA 2JWSA 2D7HA 1PJIA 4OX9M 1WR1B 1NY6A 3HX3A 1YSYA 3PXGA 3FUUA 4YY3M 2DAMA 1SXJC 2MR9A 1G4AE 4X65M 5ITXA 2CFOA 3GO8A 1XC8A 4HEOA 5KPRA 1ZMUA 2YFQA 1LTMA 1WJ7A 4II7A 1IXSA 3W0LB 2KXEA 5E6JA 4XBOA 1NVMA 2V1CA 3GLFA 2DHRA 3GP1A 1G59A 4MGZE 2FNAA 3T15A 5ITUA 1FJGM 3T1YM 3TWLA 3HU3A 3WHKA 2XZFA 2XFSA 5LMNM 2FE8A 3B74A 1X37A 3OTOM 2ZANA 1G8PA 2HWJA 4IBBA 5DNYA 3R8FA 4B7FA 5KQ8A 4QOZC 1QDRA 3W0FA 4DR2M 1KFVA 3GLFB 2VQFM 3LMMA 2R6FA 2A5YB 2R4JA 3EIHA 1OIPA 3KW6A 5FTJA 3U5ZA 3BXWA 4JI7M 2CWBA 4R71A 3UK6A 4JI8M 4JI4M 2DHYA 3HU2A 2I7PA 3B9PA 1T6OA 2QZ4A 2CHVA 3I4VA 4IBJA 5ITTA 4JXJA 2YQZA 3CF2A 3U6DA 4L16A 4DUYM 3GLIE 2QSFX 1D0KA 3I01M 4OU7A 4Z6YA 4G4OA 1C1KA 1HT1E 3BBZA 3UJNA 4MGYE 1R5LA 2H5XA 2CUZA 1VG5A 2RRUA 4F1IA 4WW0A 5ITQA 4FCVA 4DV0M 3M6AA 1Z5AA 4CHTB 2Y21A 2JZ0A 4LGMA 3GQ5A 1NHGC 3W68A 2I7NA 2LBCA 3DFZA 3HGIA 4HL4A 2J7OA 3PVSA 1RU3A 1DV0A 4FVMA 4LFAM 3K9OA 3A45A 1Z6TA 4B3SM 2DZOB 3ZH9B 3KFUG 3LVVA 3FTFA 3AOEC 4B08A 2WZJA 1GJTA 2VIIA 2L4FA 5KQDA 1JB0F 2V1UA 1VDDA 1Z5CA 4LJAA 3HHYA 3HKPA 4L4UA 2CHQA 1QANA 4LY6A 3KS8A 3EIEA 3GLHB 2EO2A 3U6EA 1Q3CA 2Z8YM 4LJ5A 1IN8A 2KHHA 4AW4A 3IECA 4JI1M 2UUCM 2Y0TA 2C5RA 3KOWE 1R4GA 5DFLA 2OO9A 3WHLA 4CIZA 1MJGM 1N77A 2LXEA 1IBLM 1SXJB 8CATA 1R7RA 3T6PA 1E9RA 2EKKA 4I4LA 4DR7M 1OAOC 3HJ8A 5FTLA 4GMQA 4DV7M 3KS4A 1L1ZA 4KODA 3FYDA 3U6MA 2VQEM 1GL6A 1TGUA 3SMPA 4DR4M 2NQ8C 4G6ZA 4PT5A 4CJ6A 1LV7A 4W5WA 4EIWA 2JZ1A 1XNQM 1NV9A 5A2QS 2R44A 4G4NA 1IXZA 3FUTA 1GABA 1XMQM 4L6V6 4D80A 2P5TA 1V92A 2K9DA 3ILKA 2H1RA 3KOZE 3GPXA 3VFDA 4OW0A 1TDHA 4L15A 1NHWC 3U6PA 3A98B 2Y20A 3QYEA 2F4VM 3GPPA 3B7NA 2ZTDA 4JI3M 1PJSA 3UGJA 3A46A 2XF3A 2UU9M 3SBJA 5FTMA 2JNHA 2LNHC 1K3WA 1TF0B 4RNAA 1DGFA 1E9SA 1SXJE 2XGNA 3FYCA 4B3TM 1QZEA 2W82A 4JI2M 4JYAM 4MH0E 2QP9X 1WGNA 4MB7A 2DENA 1W5TA 4LFCM 4IJEA 2LVOC 2QHOB 2WSFF 1ZV1A 1Q39A 1W5SA 3NBXX 3FRIA 3K9PA 2K47A 1J09A 4WURA 1I4WA 3Q8GA 1JQJC 3J27B 4FWGA 3GQ4A 5KPTA 4X62M 2JY8A 2BJVA 5E26A 2C9OA 4M9XA 1OFHA 3ZC7B 3SYKA 1QAOA 2XSZD 4IBKA 2LVQD 1IM2A 1Q3BA 3HHZA 4BLCA 1XMOM 4LF8M 3GPUA 4KT0F 3U6QA 2LVNC 3GRVA 4AKGA 3J80S 4XGIA 2Z4SA 1R2ZA 4IIWA 3LW5F 4DUZM 1XXHA 4PDGA 2CRUA 3U6CA 1QAMA 2O25A 2R0IA 4B7HA 2XZUA 5DYIA 3VLFB 1T43A 2KRUA 3FRHA 1ORYB 4GC5A 2QBYB 5LMUM 2Q2EB 4QNMA 4IBDA 4LJ7A 1EFUB 3D8BA 2R62A 3HWSA 3SMSA 2R46A 3GPYA 1HNXM 1WXQA 1D2NA 1H6UA 2DWMA 1IFYA 1HT2E 2L7HA 4LRTA 4DR3M 1N36M 1NV8A 2Y0QA 3M7GA 2ZTCA 2KDLA 4LJ9A 3GLIB 3A42A 3L26A 3C58A 4TUWA 5BPVA 2ZM6M 2ZBKB 3KSXA 4Y28F 1GJSA 5GKNA 1DGGA 3C3EA 3FUXA 3GLGB 1L1TA 4LF6M 4FWHA 3SYLA 2HL7A 3E4RA 2Z4RA 4AZFA 1L8QA 1XHBA 2R65A 2Z7JA 4IJFA 4NXNM 1TTEA 3GRRA 2KW0A 1L2CA 2JP7A 2JUJA 4FD2A 3RGPA 3B7ZA 4GHLA 3C9PA 3HY5A 4M9ZA 5EP3A 5F3WA 2F5NA 4LRSA 2EUCA 2C9CA 2DKLA 2R45A 5EQTA 4I5SA 4S12A 2CP8A 3KVWA 5JI3E 4NRWA 1G71A 3T1HM 2LVPC 1VDLA 2JA2A 2RGHA 1D0LA 5C18A 4K0KM 1OKSA 2BWBA 1YUBA 2MROB 3SFZA 4IBEA 2N35A 4BB9A 1IN7A 4JV5M 1R6BX 3R9XB 1E94E 2C99A 4P17A 1N34M 3L29A 2KA6B 5EP1A 4GKJM 3FUVA 5EXPA 4QNRA 4NRVA 3B89A 5IWAM 5L8RF 2XH9A 3JR5A 3FD9A 3RFWA 1UM8A 1PJTA 2FFJA 1K3XA 3ZQJA 3HHXA 3J7BA 1PRBA 3L28A 3D8LA 3NBIA 1HNZM 4MGHA 1YLAA 1OTRA 1TH2A 3AOEA 5EP4A 5FTNA 3HJSA 3SHFA 1PGYA 3VDPA 1C7YA 2KNZA 4LF9M 2DAIA 1QUTA 3IG5A 2QQ8A 4LJ4A 4RF0A 7CATA 1BVSA 3GQ3A 2R18A 5IZ7D 3JAMS 1NJFA 3LQQA 3AOGA 1SXJD 3SC3A 1FNNA 1QUSA 4GIPA 1GKIA 1NO1A 1J7KA 2KNAA 4QHTA 1IY2A 2HAKA 3KSJA 4D82A 1MN3A 2DWNA 2KNVA 2O5RA 3M0EA 3LVWA 3SASA 4RF1A 3KP0E 4DR1M 5FLXS 2M5ZA 3K2LA 2BJWA 1IBKM 3TWMA 2G3QA 2KZUA 4M9SA 1J5EM 1A5TA 1UFZA 4IBFA 2L7IA 1OJLA 3AL0C 2FS1A 4GH9A 1VQ1A 2KRKA 2F5SA 2L4EA 3SARA 2ZAOA 2MJ5B 4JI5M 3F92A 4PDIA 4JI0M 3TPZA 3DZDA 3PFIA 5FTKA 3KP1E 3IHPA 2OOBA 3V76A 4AQYM 4LGYA 1P3QQ 2YR0A 2DNAA 5EXSA 2F5OA 5EXXA 4DV4M 2YNMD 3FTEA 4REZA 4B7GA 2CEAA 4WP2A 5KO3A 4MGIE 1V33A 4G4RA 2JY5A 3J81S 1GLNA 1IXRC 1JR3A 1DGBA 1PJQA 1XXHE 4QOSA 1HR0M 3GLHE 3SAVA 3TL4X 1T3TA 4MM3B 3GLGE 4AI6A 2F5PA 5H37D 2UXBM 2FH0A 2J5YA 2D7GA 2R4EA 2CE7A 1NJGA 3LCUA 4AG6A 4NXMM 1HNWM 4CGYB 2FOIC 3L25A 4X66M 2GNOA 3C3DA 1NY5A 2QPAA 2WSCF 4LJ6A 5JI2E 3U6LA 1IN6A 4LG2A 4LCBA 2C96A 2CHGA 4LF5M 4G3OA 2LVAA 1HQCA 1WIVA 2CV1A 4IBGA 4NSOB 3LCVB 1N78A 3AFHA 4M0DA 1Q02A 3W67A 1SXJA 3CF0A 4B3MM 2RKOA 3U6OA 2X49A 2EJSA 4FWDA 3GLHA 3VDUA 3H4MA 3B7QA 3T38A 3L27A 1MU5A 1N32M 1L2BA 1AIPC 1Z59A 4P16A 1DO2A 1TH3A 3SAWA 2EKFA 3I04M 3VK7A 4LF4M 1Y8GA 2OOAA 3Q8XA 1TR8A 2L6OA 3MMPA 3UMMA 1E32A 1S3SA 2E5LM 4PD2A 3CF6E 5ITXE 4B3RM 1QZMA 2LTUA 5ITYA 4LZJA 2DZNB 2LHCA 2J7NA 1CUKA 2QNJA 2HKJA 3TE6A 1GO5A 1QAQA 3GRUA 2DXIA 4FCTA 3K1JA 3QWLA 3SHGB 1VEGA 2CV0A 3AJIB 1TDZA 2XEPA 1DO0A 1HJPA 4FW9A 2C98A 3RGSA 2K0BX 5KPZA 4DBGB 3KOXE 2MH8A 2X4AA 1PM5A 3GLFE 2DWLA 3U61A 1ZAEA 1YE9A 1EE8A 4ZPXA 5EXTA 3HHWA 4ITQA 1QDTA 4DV1M 4GEWA 4G4QA 3J2PB 3RE8A 2DZLA 3THGA 4KO8A 4MGKE 1XNRM 1OQYA 2X8AA 2XSZA 3U60A 4RKUF 1TH4A 2DWZB 1EIJA 2DI0A 2D7EA 4IBIA 4OVZA 2V6ZM 2XFTA 1G41A 1KYIA 2KZSA 1L2DA 5BR8M 5EJCA 2XLJA 4GHAA 1K82A 3TWKA 1XB2B 3BOSA 1DGHB 2KEBA 2DAEA 3CGWA 4AG5A 4D81A 1F4IA 3AKZA 1JR3D 1QYRA 1Z5BA 2DAKA 3NWLA 3UZUA 4R7GA 3E9SA 2B3TA 2AHMA 4DV3M 4XK8F 1V34A 3CTWB 4ANRA 4FCWA 5EP2A 4DV2M 2QENA 4NSRA 3HZJA 3FTCA 3U6SA 2LHGA 5FSWA 2ERCA 2RGOA 3MK6A 4F2LA 3VKGA 1NNJA 4UN2B 4L78A 2OQ4A 2F5QA 2UXCM 1IN5A 1IXSB 4LFBM 1VEKA 2APLA 3FE3A 4AKIA 3KOYE 3MHVC 4DR5M 3K8ZA 4M0WA 1VEJA
chains in the Genus database with same CATH topology
3JR4A 1QVRA 5ITRA 3GLIA 3HJQA 2HHHM 1PJJA 1IBMM 2UUBM 1XWIA 3MJ5A 4GKKM 2L09A 1NSFA 3LQRA 3GRYA 4LJ8A 3PNVA 4IBCA 4R3DA 2M60A 4BBAA 5IT9S 3L2AA 4X64M 3VKHA 4LF7M 2QCUA 4DV5M 4NL4H 5C1BA 4AKHA 3FKEA 1HQYE 1N75A 1G3IA 4I81A 4JI6M 1N33M 1XXHB 2EA0A 4CISA 3ZCBB 2UUAM 2DVWB 2BNKA 3I51A 3QAUA 4Z8XA 4YHHM 3U61B 4L8RC 3TQSA 1IY1A 1NNUC 4PCZA 3SAUA 3HU1A 1GL7A 2Z3XA 2G5GX 3AV0A 4QHSA 2ZAMA 1R2YA 1KSFX 1ZQ9A 4GC9A 4I8OA 4JN6A 3U5ZB 3KDSE 3GLGA 1OFIA 2UXDM 4A3VB 3FUWA 1GVNA 3K92A 1IY0A 3KXEC 3U60B 3PNYA 4DV6M 3DA1A 3DOAA 3I4YA 1I94M 1MX0A 4NOOB 1IQPA 4GRIA 1IN4A 4GITA 4OVZB 1QQWA 2LH0A 5IREB 4DR6M 2QBYA 5DYGA 4KLNA 2CV2A 2HCBA 1DGHA 3FTDA 3IG8A 4KHPM 2OPFA 3VK8A 4LZZA 3SATA 2LWXA 4HLQA 3J7AS 2G8LA 1PJIA 2D7HA 4OX9M 1NY6A 4YY3M 1YSYA 3PXGA 3FUUA 4X65M 1SXJC 1G4AE 5ITXA 2CFOA 3GO8A 1XC8A 5KPRA 2YFQA 4II7A 3W0LB 2KXEA 5E6JA 4XBOA 1NVMA 2V1CA 3GLFA 2DHRA 3GP1A 1G59A 4MGZE 2FNAA 3T15A 5ITUA 1FJGM 3T1YM 3TWLA 3HU3A 3WHKA 2XZFA 2XFSA 5LMNM 2FE8A 1X37A 3OTOM 2ZANA 1G8PA 4IBBA 5DNYA 3R8FA 4B7FA 5KQ8A 4QOZC 3W0FA 1KFVA 4DR2M 3GLFB 2VQFM 3LMMA 2A5YB 2R4JA 3EIHA 3KW6A 5FTJA 3U5ZA 4JI7M 4JI8M 3UK6A 4JI4M 3HU2A 2I7PA 3B9PA 3T1HM 2QZ4A 2CHVA 3I4VA 4IBJA 5ITTA 4JXJA 3CF2A 2YQZA 3U6DA 4L16A 4DUYM 4OU7A 4Z6YA 4G4OA 1C1KA 1HT1E 3UJNA 4MGYE 2CUZA 4WW0A 5ITQA 4FCVA 4DV0M 3M6AA 1Z5AA 4CHTB 2Y21A 4LGMA 3GQ5A 1NHGC 2I7NA 3HGIA 3DFZA 4HL4A 2J7OA 3PVSA 4FVMA 4LFAM 3A45A 1Z6TA 4B3SM 2DZOB 3ZH9B 3KFUG 3LVVA 3FTFA 3AOEC 4B08A 2VIIA 5KQDA 2V1UA 1VDDA 1Z5CA 4LJAA 3HHYA 3HKPA 4L4UA 2CHQA 1QANA 4LY6A 3KS8A 3EIEA 3GLHB 2EO2A 3U6EA 1Q3CA 4LJ5A 1IN8A 4AW4A 4JI1M 2UUCM 2Y0TA 2C5RA 3KOWE 3WHLA 1IBLM 1N77A 2LXEA 1SXJB 8CATA 1R7RA 1E9RA 4I4LA 4DR7M 3HJ8A 5FTLA 4DV7M 4GMQA 3KS4A 1L1ZA 4KODA 3FYDA 3U6MA 2VQEM 1GL6A 1TGUA 3SMPA 4DR4M 2NQ8C 4G6ZA 4PT5A 1LV7A 4W5WA 4EIWA 1XNQM 5A2QS 4G4NA 1IXZA 3FUTA 1XMQM 4D80A 2P5TA 3ILKA 3GPXA 2H1RA 3KOZE 3VFDA 4OW0A 1TDHA 4L15A 1NHWC 3U6PA 3A98B 2Y20A 2F4VM 3GPPA 4JI3M 3UGJA 3A46A 2XF3A 2UU9M 3SBJA 5FTMA 2LNHC 1K3WA 4RNAA 2XGNA 1DGFA 1E9SA 1SXJE 3FYCA 4B3TM 4JI2M 2W82A 4JYAM 4MH0E 2QP9X 4MB7A 4LFCM 1W5TA 4IJEA 1Q39A 1W5SA 2K47A 1J09A 4WURA 1I4WA 1JQJC 3J27B 4FWGA 3GQ4A 5KPTA 4X62M 2BJVA 5E26A 2C9OA 4M9XA 1OFHA 3ZC7B 3SYKA 1QAOA 2XSZD 4IBKA 1IM2A 1Q3BA 3HHZA 4BLCA 1XMOM 4LF8M 3GPUA 3U6QA 3GRVA 4AKGA 3J80S 4XGIA 2Z4SA 1R2ZA 4IIWA 4DUZM 1XXHA 4PDGA 3U6CA 1QAMA 2XZUA 4B7HA 5DYIA 3VLFB 2KRUA 1ORYB 4GC5A 2QBYB 5LMUM 2Q2EB 4QNMA 4IBDA 4LJ7A 3D8BA 2R62A 3HWSA 3SMSA 2R46A 3GPYA 1HNXM 1WXQA 1D2NA 1H6UA 2DWMA 1HT2E 2L7HA 4LRTA 4DR3M 1N36M 2Y0QA 3M7GA 4LJ9A 3GLIB 3A42A 3L26A 3C58A 4TUWA 5BPVA 2ZM6M 2ZBKB 3KSXA 5GKNA 1DGGA 3FUXA 3GLGB 4LF6M 1L1TA 4FWHA 3SYLA 2HL7A 3E4RA 2Z4RA 4AZFA 1L8QA 1XHBA 2R65A 2Z7JA 4IJFA 4NXNM 3GRRA 2KW0A 1L2CA 4FD2A 3RGPA 4GHLA 2F5NA 5EP3A 4M9ZA 5F3WA 4LRSA 2EUCA 2C9CA 5EQTA 2R45A 4I5SA 4S12A 3KVWA 5JI3E 4NRWA 2JA2A 2RGHA 5C18A 4K0KM 1YUBA 3SFZA 4IBEA 4BB9A 1IN7A 4JV5M 1R6BX 3R9XB 1E94E 2C99A 1N34M 3L29A 2KA6B 5EP1A 4GKJM 3FUVA 5EXPA 4QNRA 4NRVA 5IWAM 2XH9A 3JR5A 3FD9A 3RFWA 1UM8A 2FFJA 1K3XA 3HHXA 3J7BA 3L28A 3D8LA 3NBIA 1HNZM 4MGHA 5EP4A 1TH2A 3AOEA 5FTNA 3SHFA 3VDPA 3HJSA 4LF9M 3IG5A 4LJ4A 7CATA 4RF0A 3GQ3A 2R18A 5IZ7D 3JAMS 1NJFA 3LQQA 3AOGA 1SXJD 3SC3A 1FNNA 4GIPA 1GKIA 1J7KA 4QHTA 1IY2A 4D82A 3KSJA 2DWNA 2O5RA 3M0EA 3LVWA 3SASA 4RF1A 3KP0E 4DR1M 5FLXS 2M5ZA 3K2LA 2BJWA 1IBKM 3TWMA 2KZUA 4M9SA 1J5EM 4IBFA 2L7IA 1OJLA 3AL0C 4GH9A 2F5SA 2KRKA 3SARA 2ZAOA 4JI5M 4PDIA 4JI0M 3TPZA 3DZDA 3PFIA 5FTKA 3KP1E 4AQYM 4LGYA 2YR0A 5EXSA 2F5OA 5EXXA 4DV4M 2YNMD 3FTEA 4REZA 4B7GA 2CEAA 5KO3A 4MGIE 4G4RA 3J81S 1GLNA 1DGBA 1JR3A 1IXRC 4QOSA 1HR0M 4B3RM 2UXBM 3SAVA 3TL4X 1T3TA 4MM3B 4AI6A 2F5PA 5H37D 2R4EA 4AG6A 2D7GA 4NXMM 2CE7A 1NJGA 1HNWM 4CGYB 2FOIC 3L25A 4X66M 1NY5A 2QPAA 4LJ6A 5JI2E 3U6LA 1IN6A 4LG2A 4LCBA 2C96A 2CHGA 4LF5M 1HQCA 2CV1A 4IBGA 4NSOB 1N78A 3AFHA 4M0DA 1SXJA 3CF0A 4B3MM 2RKOA 3U6OA 2X49A 4FWDA 3GLHA 3VDUA 3H4MA 3T38A 3L27A 1MU5A 1N32M 1L2BA 1Z59A 4P16A 1DO2A 1TH3A 3SAWA 3VK7A 4LF4M 3Q8XA 2L6OA 3UMMA 1E32A 1S3SA 2E5LM 4PD2A 3CF6E 5ITXE 1QZMA 5ITYA 4LZJA 2DZNB 2J7NA 2HKJA 3TE6A 1QAQA 3GRUA 2DXIA 4FCTA 3K1JA 3QWLA 3SHGB 2CV0A 3AJIB 1TDZA 2XEPA 1DO0A 4FW9A 2C98A 3RGSA 5KPZA 3KOXE 2X4AA 1PM5A 2DWLA 3U61A 1ZAEA 1YE9A 1EE8A 4ZPXA 5EXTA 3HHWA 4ITQA 4DV1M 4G4QA 3J2PB 3RE8A 3THGA 4KO8A 4MGKE 1XNRM 2X8AA 2XSZA 3U60A 1TH4A 2DWZB 2D7EA 4IBIA 4OVZA 2V6ZM 2XFTA 1G41A 1KYIA 2KZSA 1L2DA 5BR8M 5EJCA 2XLJA 4GHAA 1K82A 3TWKA 3BOSA 4D81A 1DGHB 2KEBA 4AG5A 3AKZA 1JR3D 1QYRA 1Z5BA 3NWLA 3UZUA 4R7GA 3E9SA 2AHMA 4DV3M 3CTWB 4FCWA 5EP2A 4DV2M 2QENA 4NSRA 3FTCA 3U6SA 5FSWA 2ERCA 2RGOA 3MK6A 3VKGA 1NNJA 4L78A 2OQ4A 2F5QA 2UXCM 1IN5A 1IXSB 4LFBM 4AKIA 3KOYE 3MHVC 4DR5M 3K8ZA 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ M;  3JR4 A;  1HR0 M;  4PDG A;  5ITR A;  3SAV A;  3U6C A;  2XZU A;  2HHH M;  1PJJ A;  1IBM M;  2UUB M;  4GKK M;  2F5P A;  4G4O A;  5LMU M;  2UXB M;  2Q2E B;  4NXM M;  1HNW M;  1R2Z A;  4DV0 M;  5ITQ A;  1HNX M;  4X66 M;  3GPY A;  4X64 M;  5IT9 S;  1Z5A A;  3U6L A;  4LF7 M;  4DR3 M;  1N36 M;  4DV5 M;  3GQ5 A;  1N33 M;  4JI6 M;  3A42 A;  4LF5 M;  2EA0 A;  4LFA M;  3C58 A;  4CIS A;  2ZM6 M;  2ZBK B;  3A45 A;  2UUA M;  4B3S M;  4YHH M;  4LF6 M;  1L1T A;  4PCZ A;  3SAU A;  4B3M M;  4NXN M;  1R2Y A;  3U6O A;  1Z5C A;  1L2C A;  2F5N A;  1N32 M;  1MU5 A;  1L2B A;  2UXC M;  3U6E A;  1Q3C A;  1Z59 A;  3SAW A;  2UXD M;  4NRW A;  3VK7 A;  4JI1 M;  2UUC M;  4LF4 M;  1IBL M;  4K0K M;  2E5L M;  4PD2 A;  5ITX E;  4B3R M;  5ITY A;  4DV6 M;  3DOA A;  4JV5 M;  1I94 M;  1MX0 A;  2HKJ A;  4DV7 M;  4DR7 M;  1L1Z A;  1N34 M;  3U6M A;  2VQE M;  4DR4 M;  1TDZ A;  4DR6 M;  4GKJ M;  4NRV A;  5IWA M;  3JR5 A;  1XNQ M;  5A2Q S;  4KHP M;  2OPF A;  4G4N A;  1K3X A;  1PM5 A;  3VK8 A;  3SAT A;  4ITQ A;  1EE8 A;  1XMQ M;  1HNZ M;  4DV1 M;  4G4Q A;  3GPX A;  3J7A S;  1XNR M;  4LF9 M;  1TDH A;  1PJI A;  4OX9 M;  3U6P A;  3GQ3 A;  3JAM S;  2F4V M;  4YY3 M;  4X65 M;  3GPP A;  4JI3 M;  5ITX A;  3A46 A;  3GO8 A;  1XC8 A;  2UU9 M;  1L2D A;  3SBJ A;  5BR8 M;  1K3W A;  3SAS A;  1K82 A;  3TWK A;  4B3T M;  4JI2 M;  4DR1 M;  4JYA M;  5FLX S;  3GP1 A;  4MB7 A;  1IBK M;  3TWM A;  4LFC M;  1Z5B A;  1J5E M;  1Q39 A;  5ITU A;  1FJG M;  3J81 S;  4DV3 M;  3T1Y M;  3TWL A;  2F5S A;  2XZF A;  3SAR A;  5LMN M;  4DV2 M;  3U6D A;  4JI5 M;  3GQ4 A;  3OTO M;  4X62 M;  4PDI A;  4JI0 M;  3U6S A;  3W0F A;  1KFV A;  4DR2 M;  2VQF M;  1Q3B A;  4AQY M;  1NNJ A;  2OQ4 A;  2F5Q A;  4JI7 M;  1XMO M;  2F5O A;  4JI8 M;  3GPU A;  4DV4 M;  4JI4 M;  4LF8 M;  3U6Q A;  4LFB M;  3J80 S;  3T1H M;  5ITT A;  4G4R A;  4DR5 M;  4DUY M; 
#chains in the Genus database with same CATH topology
 3JR4 A;  1QVR A;  5ITR A;  3GLI A;  3HJQ A;  2HHH M;  1PJJ A;  1IBM M;  1AUA A;  2UUB M;  1XWI A;  3MJ5 A;  4GKK M;  2L09 A;  1NSF A;  3LQR A;  3GRY A;  4LJ8 A;  3PNV A;  4IBC A;  4R3D A;  2O01 F;  2M60 A;  4BBA A;  5IT9 S;  3L2A A;  4X64 M;  3VKH A;  4LF7 M;  2QCU A;  4DV5 M;  4NL4 H;  5C1B A;  2WSE F;  4AKH A;  3FKE A;  1HQY E;  1N75 A;  1G3I A;  4I81 A;  4JI6 M;  1N33 M;  1XXH B;  1SG9 A;  2EA0 A;  4CIS A;  3ZCB B;  2UUA M;  2DVW B;  2BNK A;  3I51 A;  3QAU A;  4Z8X A;  4YHH M;  3U61 B;  4L8R C;  3TQS A;  4Q7J A;  1IY1 A;  1NNU C;  1ZMW A;  1JR3 E;  4PCZ A;  3SAU A;  2JXN A;  1WHC A;  3HU1 A;  1GL7 A;  3E21 A;  2Z3X A;  2G5G X;  2VF7 A;  3AV0 A;  2ZAM A;  4QHS A;  1KSF X;  1R2Y A;  1ZQ9 A;  2VDB B;  4GC9 A;  1ZMV A;  4I8O A;  4JN6 A;  2GQF A;  3U5Z B;  3KDS E;  3GLG A;  1OFI A;  2UXD M;  4NC6 A;  4A3V B;  2L2D A;  2VF8 A;  3FUW A;  2JY6 B;  1GVN A;  3K92 A;  3H4J A;  1IY0 A;  3KXE C;  3U60 B;  3PNY A;  4DV6 M;  3DA1 A;  3DOA A;  3I4Y A;  1I94 M;  1MX0 A;  2K6B A;  2BWE A;  3QYB A;  1IQP A;  4NOO B;  4GRI A;  1IN4 A;  4GIT A;  4OVZ B;  1QQW A;  2LH0 A;  3E46 A;  5IRE B;  4DR6 M;  2QBY A;  5DYG A;  4KLN A;  2CV2 A;  2HCB A;  2JY7 A;  1DGH A;  3FTD A;  3IG8 A;  1WGL A;  1OIZ A;  4KHP M;  2OPF A;  1D0M A;  3VK8 A;  4LZZ A;  3SAT A;  2LWX A;  4HLQ A;  3J7A S;  1OAI A;  2MGW A;  2DAG A;  2G8L A;  2JWS A;  2D7H A;  1PJI A;  4OX9 M;  1WR1 B;  1NY6 A;  3HX3 A;  1YSY A;  3PXG A;  3FUU A;  4YY3 M;  2DAM A;  1SXJ C;  2MR9 A;  1G4A E;  4X65 M;  5ITX A;  2CFO A;  3GO8 A;  1XC8 A;  4HEO A;  5KPR A;  1ZMU A;  2YFQ A;  1LTM A;  1WJ7 A;  4II7 A;  1IXS A;  3W0L B;  2KXE A;  5E6J A;  4XBO A;  1NVM A;  2V1C A;  3GLF A;  2DHR A;  3GP1 A;  1G59 A;  4MGZ E;  2FNA A;  3T15 A;  5ITU A;  1FJG M;  3T1Y M;  3TWL A;  3HU3 A;  3WHK A;  2XZF A;  2XFS A;  5LMN M;  2FE8 A;  3B74 A;  1X37 A;  3OTO M;  2ZAN A;  1G8P A;  2HWJ A;  4IBB A;  5DNY A;  3R8F A;  4B7F A;  5KQ8 A;  4QOZ C;  1QDR A;  3W0F A;  4DR2 M;  1KFV A;  3GLF B;  2VQF M;  3LMM A;  2R6F A;  2A5Y B;  2R4J A;  3EIH A;  1OIP A;  3KW6 A;  5FTJ A;  3U5Z A;  3BXW A;  4JI7 M;  2CWB A;  4R71 A;  3UK6 A;  4JI8 M;  4JI4 M;  2DHY A;  3HU2 A;  2I7P A;  3B9P A;  1T6O A;  2QZ4 A;  2CHV A;  3I4V A;  4IBJ A;  5ITT A;  4JXJ A;  2YQZ A;  3CF2 A;  3U6D A;  4L16 A;  4DUY M;  3GLI E;  2QSF X;  1D0K A;  3I01 M;  4OU7 A;  4Z6Y A;  4G4O A;  1C1K A;  1HT1 E;  3BBZ A;  3UJN A;  4MGY E;  1R5L A;  2H5X A;  2CUZ A;  1VG5 A;  2RRU A;  4F1I A;  4WW0 A;  5ITQ A;  4FCV A;  4DV0 M;  3M6A A;  1Z5A A;  4CHT B;  2Y21 A;  2JZ0 A;  4LGM A;  3GQ5 A;  1NHG C;  3W68 A;  2I7N A;  2LBC A;  3DFZ A;  3HGI A;  4HL4 A;  2J7O A;  3PVS A;  1RU3 A;  1DV0 A;  4FVM A;  4LFA M;  3K9O A;  3A45 A;  1Z6T A;  4B3S M;  2DZO B;  3ZH9 B;  3KFU G;  3LVV A;  3FTF A;  3AOE C;  4B08 A;  2WZJ A;  1GJT A;  2VII A;  2L4F A;  5KQD A;  1JB0 F;  2V1U A;  1VDD A;  1Z5C A;  4LJA A;  3HHY A;  3HKP A;  4L4U A;  2CHQ A;  1QAN A;  4LY6 A;  3KS8 A;  3EIE A;  3GLH B;  2EO2 A;  3U6E A;  1Q3C A;  2Z8Y M;  4LJ5 A;  1IN8 A;  2KHH A;  4AW4 A;  3IEC A;  4JI1 M;  2UUC M;  2Y0T A;  2C5R A;  3KOW E;  1R4G A;  5DFL A;  2OO9 A;  3WHL A;  4CIZ A;  1MJG M;  1N77 A;  2LXE A;  1IBL M;  1SXJ B;  8CAT A;  1R7R A;  3T6P A;  1E9R A;  2EKK A;  4I4L A;  4DR7 M;  1OAO C;  3HJ8 A;  5FTL A;  4GMQ A;  4DV7 M;  3KS4 A;  1L1Z A;  4KOD A;  3FYD A;  3U6M A;  2VQE M;  1GL6 A;  1TGU A;  3SMP A;  4DR4 M;  2NQ8 C;  4G6Z A;  4PT5 A;  4CJ6 A;  1LV7 A;  4W5W A;  4EIW A;  2JZ1 A;  1XNQ M;  1NV9 A;  5A2Q S;  2R44 A;  4G4N A;  1IXZ A;  3FUT A;  1GAB A;  1XMQ M;  4L6V 6;  4D80 A;  2P5T A;  1V92 A;  2K9D A;  3ILK A;  2H1R A;  3KOZ E;  3GPX A;  3VFD A;  4OW0 A;  1TDH A;  4L15 A;  1NHW C;  3U6P A;  3A98 B;  2Y20 A;  3QYE A;  2F4V M;  3GPP A;  3B7N A;  2ZTD A;  4JI3 M;  1PJS A;  3UGJ A;  3A46 A;  2XF3 A;  2UU9 M;  3SBJ A;  5FTM A;  2JNH A;  2LNH C;  1K3W A;  1TF0 B;  4RNA A;  1DGF A;  1E9S A;  1SXJ E;  2XGN A;  3FYC A;  4B3T M;  1QZE A;  2W82 A;  4JI2 M;  4JYA M;  4MH0 E;  2QP9 X;  1WGN A;  4MB7 A;  2DEN A;  1W5T A;  4LFC M;  4IJE A;  2LVO C;  2QHO B;  2WSF F;  1ZV1 A;  1Q39 A;  1W5S A;  3NBX X;  3FRI A;  3K9P A;  2K47 A;  1J09 A;  4WUR A;  1I4W A;  3Q8G A;  1JQJ C;  3J27 B;  4FWG A;  3GQ4 A;  5KPT A;  4X62 M;  2JY8 A;  2BJV A;  5E26 A;  2C9O A;  4M9X A;  1OFH A;  3ZC7 B;  3SYK A;  1QAO A;  2XSZ D;  4IBK A;  2LVQ D;  1IM2 A;  1Q3B A;  3HHZ A;  4BLC A;  1XMO M;  4LF8 M;  3GPU A;  4KT0 F;  3U6Q A;  2LVN C;  3GRV A;  4AKG A;  3J80 S;  4XGI A;  2Z4S A;  1R2Z A;  4IIW A;  3LW5 F;  4DUZ M;  1XXH A;  4PDG A;  2CRU A;  3U6C A;  1QAM A;  2O25 A;  2R0I A;  4B7H A;  2XZU A;  5DYI A;  3VLF B;  1T43 A;  2KRU A;  3FRH A;  1ORY B;  4GC5 A;  2QBY B;  5LMU M;  2Q2E B;  4QNM A;  4IBD A;  4LJ7 A;  1EFU B;  3D8B A;  2R62 A;  3HWS A;  3SMS A;  2R46 A;  3GPY A;  1HNX M;  1WXQ A;  1D2N A;  1H6U A;  2DWM A;  1IFY A;  1HT2 E;  2L7H A;  4LRT A;  4DR3 M;  1N36 M;  1NV8 A;  2Y0Q A;  3M7G A;  2ZTC A;  2KDL A;  4LJ9 A;  3GLI B;  3A42 A;  3L26 A;  3C58 A;  4TUW A;  5BPV A;  2ZM6 M;  2ZBK B;  3KSX A;  4Y28 F;  1GJS A;  5GKN A;  1DGG A;  3C3E A;  3FUX A;  3GLG B;  1L1T A;  4LF6 M;  4FWH A;  3SYL A;  2HL7 A;  3E4R A;  2Z4R A;  4AZF A;  1L8Q A;  1XHB A;  2R65 A;  2Z7J A;  4IJF A;  4NXN M;  1TTE A;  3GRR A;  2KW0 A;  1L2C A;  2JP7 A;  2JUJ A;  4FD2 A;  3RGP A;  3B7Z A;  4GHL A;  3C9P A;  3HY5 A;  4M9Z A;  5EP3 A;  5F3W A;  2F5N A;  4LRS A;  2EUC A;  2C9C A;  2DKL A;  2R45 A;  5EQT A;  4I5S A;  4S12 A;  2CP8 A;  3KVW A;  5JI3 E;  4NRW A;  1G71 A;  3T1H M;  2LVP C;  1VDL A;  2JA2 A;  2RGH A;  1D0L A;  5C18 A;  4K0K M;  1OKS A;  2BWB A;  1YUB A;  2MRO B;  3SFZ A;  4IBE A;  2N35 A;  4BB9 A;  1IN7 A;  4JV5 M;  1R6B X;  3R9X B;  1E94 E;  2C99 A;  4P17 A;  1N34 M;  3L29 A;  2KA6 B;  5EP1 A;  4GKJ M;  3FUV A;  5EXP A;  4QNR A;  4NRV A;  3B89 A;  5IWA M;  5L8R F;  2XH9 A;  3JR5 A;  3FD9 A;  3RFW A;  1UM8 A;  1PJT A;  2FFJ A;  1K3X A;  3ZQJ A;  3HHX A;  3J7B A;  1PRB A;  3L28 A;  3D8L A;  3NBI A;  1HNZ M;  4MGH A;  1YLA A;  1OTR A;  1TH2 A;  3AOE A;  5EP4 A;  5FTN A;  3HJS A;  3SHF A;  1PGY A;  3VDP A;  1C7Y A;  2KNZ A;  4LF9 M;  2DAI A;  1QUT A;  3IG5 A;  2QQ8 A;  4LJ4 A;  4RF0 A;  7CAT A;  1BVS A;  3GQ3 A;  2R18 A;  5IZ7 D;  3JAM S;  1NJF A;  3LQQ A;  3AOG A;  1SXJ D;  3SC3 A;  1FNN A;  1QUS A;  4GIP A;  1GKI A;  1NO1 A;  1J7K A;  2KNA A;  4QHT A;  1IY2 A;  2HAK A;  3KSJ A;  4D82 A;  1MN3 A;  2DWN A;  2KNV A;  2O5R A;  3M0E A;  3LVW A;  3SAS A;  4RF1 A;  3KP0 E;  4DR1 M;  5FLX S;  2M5Z A;  3K2L A;  2BJW A;  1IBK M;  3TWM A;  2G3Q A;  2KZU A;  4M9S A;  1J5E M;  1A5T A;  1UFZ A;  4IBF A;  2L7I A;  1OJL A;  3AL0 C;  2FS1 A;  4GH9 A;  1VQ1 A;  2KRK A;  2F5S A;  2L4E A;  3SAR A;  2ZAO A;  2MJ5 B;  4JI5 M;  3F92 A;  4PDI A;  4JI0 M;  3TPZ A;  3DZD A;  3PFI A;  5FTK A;  3KP1 E;  3IHP A;  2OOB A;  3V76 A;  4AQY M;  4LGY A;  1P3Q Q;  2YR0 A;  2DNA A;  5EXS A;  2F5O A;  5EXX A;  4DV4 M;  2YNM D;  3FTE A;  4REZ A;  4B7G A;  2CEA A;  4WP2 A;  5KO3 A;  4MGI E;  1V33 A;  4G4R A;  2JY5 A;  3J81 S;  1GLN A;  1IXR C;  1JR3 A;  1DGB A;  1PJQ A;  1XXH E;  4QOS A;  1HR0 M;  3GLH E;  3SAV A;  3TL4 X;  1T3T A;  4MM3 B;  3GLG E;  4AI6 A;  2F5P A;  5H37 D;  2UXB M;  2FH0 A;  2J5Y A;  2D7G A;  2R4E A;  2CE7 A;  1NJG A;  3LCU A;  4AG6 A;  4NXM M;  1HNW M;  4CGY B;  2FOI C;  3L25 A;  4X66 M;  2GNO A;  3C3D A;  1NY5 A;  2QPA A;  2WSC F;  4LJ6 A;  5JI2 E;  3U6L A;  1IN6 A;  4LG2 A;  4LCB A;  2C96 A;  2CHG A;  4LF5 M;  4G3O A;  2LVA A;  1HQC A;  1WIV A;  2CV1 A;  4IBG A;  4NSO B;  3LCV B;  1N78 A;  3AFH A;  4M0D A;  1Q02 A;  3W67 A;  1SXJ A;  3CF0 A;  4B3M M;  2RKO A;  3U6O A;  2X49 A;  2EJS A;  4FWD A;  3GLH A;  3VDU A;  3H4M A;  3B7Q A;  3T38 A;  3L27 A;  1MU5 A;  1N32 M;  1L2B A;  1AIP C;  1Z59 A;  4P16 A;  1DO2 A;  1TH3 A;  3SAW A;  2EKF A;  3I04 M;  3VK7 A;  4LF4 M;  1Y8G A;  2OOA A;  3Q8X A;  1TR8 A;  2L6O A;  3MMP A;  3UMM A;  1E32 A;  1S3S A;  2E5L M;  4PD2 A;  3CF6 E;  5ITX E;  4B3R M;  1QZM A;  2LTU A;  5ITY A;  4LZJ A;  2DZN B;  2LHC A;  2J7N A;  1CUK A;  2QNJ A;  2HKJ A;  3TE6 A;  1GO5 A;  1QAQ A;  3GRU A;  2DXI A;  4FCT A;  3K1J A;  3QWL A;  3SHG B;  1VEG A;  2CV0 A;  3AJI B;  1TDZ A;  2XEP A;  1DO0 A;  1HJP A;  4FW9 A;  2C98 A;  3RGS A;  2K0B X;  5KPZ A;  4DBG B;  3KOX E;  2MH8 A;  2X4A A;  1PM5 A;  3GLF E;  2DWL A;  3U61 A;  1ZAE A;  1YE9 A;  1EE8 A;  4ZPX A;  5EXT A;  3HHW A;  4ITQ A;  1QDT A;  4DV1 M;  4GEW A;  4G4Q A;  3J2P B;  3RE8 A;  2DZL A;  3THG A;  4KO8 A;  4MGK E;  1XNR M;  1OQY A;  2X8A A;  2XSZ A;  3U60 A;  4RKU F;  1TH4 A;  2DWZ B;  1EIJ A;  2DI0 A;  2D7E A;  4IBI A;  4OVZ A;  2V6Z M;  2XFT A;  1G41 A;  1KYI A;  2KZS A;  1L2D A;  5BR8 M;  5EJC A;  2XLJ A;  4GHA A;  1K82 A;  3TWK A;  1XB2 B;  3BOS A;  1DGH B;  2KEB A;  2DAE A;  3CGW A;  4AG5 A;  4D81 A;  1F4I A;  3AKZ A;  1JR3 D;  1QYR A;  1Z5B A;  2DAK A;  3NWL A;  3UZU A;  4R7G A;  3E9S A;  2B3T A;  2AHM A;  4DV3 M;  4XK8 F;  1V34 A;  3CTW B;  4ANR A;  4FCW A;  5EP2 A;  4DV2 M;  2QEN A;  4NSR A;  3HZJ A;  3FTC A;  3U6S A;  2LHG A;  5FSW A;  2ERC A;  2RGO A;  3MK6 A;  4F2L A;  3VKG A;  1NNJ A;  4UN2 B;  4L78 A;  2OQ4 A;  2F5Q A;  2UXC M;  1IN5 A;  1IXS B;  4LFB M;  1VEK A;  2APL A;  3FE3 A;  4AKI A;  3KOY E;  3MHV C;  4DR5 M;  3K8Z A;  4M0W A;  1VEJ A; 
#chains in the Genus database with same CATH homology
 3JR4 A;  1QVR A;  5ITR A;  3GLI A;  3HJQ A;  2HHH M;  1PJJ A;  1IBM M;  2UUB M;  1XWI A;  3MJ5 A;  4GKK M;  2L09 A;  1NSF A;  3LQR A;  3GRY A;  4LJ8 A;  3PNV A;  4IBC A;  4R3D A;  2M60 A;  4BBA A;  5IT9 S;  3L2A A;  4X64 M;  3VKH A;  4LF7 M;  2QCU A;  4DV5 M;  4NL4 H;  5C1B A;  4AKH A;  3FKE A;  1HQY E;  1N75 A;  1G3I A;  4I81 A;  4JI6 M;  1N33 M;  1XXH B;  2EA0 A;  4CIS A;  3ZCB B;  2UUA M;  2DVW B;  2BNK A;  3I51 A;  3QAU A;  4Z8X A;  4YHH M;  3U61 B;  4L8R C;  3TQS A;  1IY1 A;  1NNU C;  4PCZ A;  3SAU A;  3HU1 A;  1GL7 A;  2Z3X A;  2G5G X;  3AV0 A;  4QHS A;  2ZAM A;  1R2Y A;  1KSF X;  1ZQ9 A;  4GC9 A;  4I8O A;  4JN6 A;  3U5Z B;  3KDS E;  3GLG A;  1OFI A;  2UXD M;  4A3V B;  3FUW A;  1GVN A;  3K92 A;  1IY0 A;  3KXE C;  3U60 B;  3PNY A;  4DV6 M;  3DA1 A;  3DOA A;  3I4Y A;  1I94 M;  1MX0 A;  4NOO B;  1IQP A;  4GRI A;  1IN4 A;  4GIT A;  4OVZ B;  1QQW A;  2LH0 A;  5IRE B;  4DR6 M;  2QBY A;  5DYG A;  4KLN A;  2CV2 A;  2HCB A;  1DGH A;  3FTD A;  3IG8 A;  4KHP M;  2OPF A;  3VK8 A;  4LZZ A;  3SAT A;  2LWX A;  4HLQ A;  3J7A S;  2G8L A;  1PJI A;  2D7H A;  4OX9 M;  1NY6 A;  4YY3 M;  1YSY A;  3PXG A;  3FUU A;  4X65 M;  1SXJ C;  1G4A E;  5ITX A;  2CFO A;  3GO8 A;  1XC8 A;  5KPR A;  2YFQ A;  4II7 A;  3W0L B;  2KXE A;  5E6J A;  4XBO A;  1NVM A;  2V1C A;  3GLF A;  2DHR A;  3GP1 A;  1G59 A;  4MGZ E;  2FNA A;  3T15 A;  5ITU A;  1FJG M;  3T1Y M;  3TWL A;  3HU3 A;  3WHK A;  2XZF A;  2XFS A;  5LMN M;  2FE8 A;  1X37 A;  3OTO M;  2ZAN A;  1G8P A;  4IBB A;  5DNY A;  3R8F A;  4B7F A;  5KQ8 A;  4QOZ C;  3W0F A;  1KFV A;  4DR2 M;  3GLF B;  2VQF M;  3LMM A;  2A5Y B;  2R4J A;  3EIH A;  3KW6 A;  5FTJ A;  3U5Z A;  4JI7 M;  4JI8 M;  3UK6 A;  4JI4 M;  3HU2 A;  2I7P A;  3B9P A;  3T1H M;  2QZ4 A;  2CHV A;  3I4V A;  4IBJ A;  5ITT A;  4JXJ A;  3CF2 A;  2YQZ A;  3U6D A;  4L16 A;  4DUY M;  4OU7 A;  4Z6Y A;  4G4O A;  1C1K A;  1HT1 E;  3UJN A;  4MGY E;  2CUZ A;  4WW0 A;  5ITQ A;  4FCV A;  4DV0 M;  3M6A A;  1Z5A A;  4CHT B;  2Y21 A;  4LGM A;  3GQ5 A;  1NHG C;  2I7N A;  3HGI A;  3DFZ A;  4HL4 A;  2J7O A;  3PVS A;  4FVM A;  4LFA M;  3A45 A;  1Z6T A;  4B3S M;  2DZO B;  3ZH9 B;  3KFU G;  3LVV A;  3FTF A;  3AOE C;  4B08 A;  2VII A;  5KQD A;  2V1U A;  1VDD A;  1Z5C A;  4LJA A;  3HHY A;  3HKP A;  4L4U A;  2CHQ A;  1QAN A;  4LY6 A;  3KS8 A;  3EIE A;  3GLH B;  2EO2 A;  3U6E A;  1Q3C A;  4LJ5 A;  1IN8 A;  4AW4 A;  4JI1 M;  2UUC M;  2Y0T A;  2C5R A;  3KOW E;  3WHL A;  1IBL M;  1N77 A;  2LXE A;  1SXJ B;  8CAT A;  1R7R A;  1E9R A;  4I4L A;  4DR7 M;  3HJ8 A;  5FTL A;  4DV7 M;  4GMQ A;  3KS4 A;  1L1Z A;  4KOD A;  3FYD A;  3U6M A;  2VQE M;  1GL6 A;  1TGU A;  3SMP A;  4DR4 M;  2NQ8 C;  4G6Z A;  4PT5 A;  1LV7 A;  4W5W A;  4EIW A;  1XNQ M;  5A2Q S;  4G4N A;  1IXZ A;  3FUT A;  1XMQ M;  4D80 A;  2P5T A;  3ILK A;  3GPX A;  2H1R A;  3KOZ E;  3VFD A;  4OW0 A;  1TDH A;  4L15 A;  1NHW C;  3U6P A;  3A98 B;  2Y20 A;  2F4V M;  3GPP A;  4JI3 M;  3UGJ A;  3A46 A;  2XF3 A;  2UU9 M;  3SBJ A;  5FTM A;  2LNH C;  1K3W A;  4RNA A;  2XGN A;  1DGF A;  1E9S A;  1SXJ E;  3FYC A;  4B3T M;  4JI2 M;  2W82 A;  4JYA M;  4MH0 E;  2QP9 X;  4MB7 A;  4LFC M;  1W5T A;  4IJE A;  1Q39 A;  1W5S A;  2K47 A;  1J09 A;  4WUR A;  1I4W A;  1JQJ C;  3J27 B;  4FWG A;  3GQ4 A;  5KPT A;  4X62 M;  2BJV A;  5E26 A;  2C9O A;  4M9X A;  1OFH A;  3ZC7 B;  3SYK A;  1QAO A;  2XSZ D;  4IBK A;  1IM2 A;  1Q3B A;  3HHZ A;  4BLC A;  1XMO M;  4LF8 M;  3GPU A;  3U6Q A;  3GRV A;  4AKG A;  3J80 S;  4XGI A;  2Z4S A;  1R2Z A;  4IIW A;  4DUZ M;  1XXH A;  4PDG A;  3U6C A;  1QAM A;  2XZU A;  4B7H A;  5DYI A;  3VLF B;  2KRU A;  1ORY B;  4GC5 A;  2QBY B;  5LMU M;  2Q2E B;  4QNM A;  4IBD A;  4LJ7 A;  3D8B A;  2R62 A;  3HWS A;  3SMS A;  2R46 A;  3GPY A;  1HNX M;  1WXQ A;  1D2N A;  1H6U A;  2DWM A;  1HT2 E;  2L7H A;  4LRT A;  4DR3 M;  1N36 M;  2Y0Q A;  3M7G A;  4LJ9 A;  3GLI B;  3A42 A;  3L26 A;  3C58 A;  4TUW A;  5BPV A;  2ZM6 M;  2ZBK B;  3KSX A;  5GKN A;  1DGG A;  3FUX A;  3GLG B;  4LF6 M;  1L1T A;  4FWH A;  3SYL A;  2HL7 A;  3E4R A;  2Z4R A;  4AZF A;  1L8Q A;  1XHB A;  2R65 A;  2Z7J A;  4IJF A;  4NXN M;  3GRR A;  2KW0 A;  1L2C A;  4FD2 A;  3RGP A;  4GHL A;  2F5N A;  5EP3 A;  4M9Z A;  5F3W A;  4LRS A;  2EUC A;  2C9C A;  5EQT A;  2R45 A;  4I5S A;  4S12 A;  3KVW A;  5JI3 E;  4NRW A;  2JA2 A;  2RGH A;  5C18 A;  4K0K M;  1YUB A;  3SFZ A;  4IBE A;  4BB9 A;  1IN7 A;  4JV5 M;  1R6B X;  3R9X B;  1E94 E;  2C99 A;  1N34 M;  3L29 A;  2KA6 B;  5EP1 A;  4GKJ M;  3FUV A;  5EXP A;  4QNR A;  4NRV A;  5IWA M;  2XH9 A;  3JR5 A;  3FD9 A;  3RFW A;  1UM8 A;  2FFJ A;  1K3X A;  3HHX A;  3J7B A;  3L28 A;  3D8L A;  3NBI A;  1HNZ M;  4MGH A;  5EP4 A;  1TH2 A;  3AOE A;  5FTN A;  3SHF A;  3VDP A;  3HJS A;  4LF9 M;  3IG5 A;  4LJ4 A;  7CAT A;  4RF0 A;  3GQ3 A;  2R18 A;  5IZ7 D;  3JAM S;  1NJF A;  3LQQ A;  3AOG A;  1SXJ D;  3SC3 A;  1FNN A;  4GIP A;  1GKI A;  1J7K A;  4QHT A;  1IY2 A;  4D82 A;  3KSJ A;  2DWN A;  2O5R A;  3M0E A;  3LVW A;  3SAS A;  4RF1 A;  3KP0 E;  4DR1 M;  5FLX S;  2M5Z A;  3K2L A;  2BJW A;  1IBK M;  3TWM A;  2KZU A;  4M9S A;  1J5E M;  4IBF A;  2L7I A;  1OJL A;  3AL0 C;  4GH9 A;  2F5S A;  2KRK A;  3SAR A;  2ZAO A;  4JI5 M;  4PDI A;  4JI0 M;  3TPZ A;  3DZD A;  3PFI A;  5FTK A;  3KP1 E;  4AQY M;  4LGY A;  2YR0 A;  5EXS A;  2F5O A;  5EXX A;  4DV4 M;  2YNM D;  3FTE A;  4REZ A;  4B7G A;  2CEA A;  5KO3 A;  4MGI E;  4G4R A;  3J81 S;  1GLN A;  1DGB A;  1JR3 A;  1IXR C;  4QOS A;  1HR0 M;  4B3R M;  2UXB M;  3SAV A;  3TL4 X;  1T3T A;  4MM3 B;  4AI6 A;  2F5P A;  5H37 D;  2R4E A;  4AG6 A;  2D7G A;  4NXM M;  2CE7 A;  1NJG A;  1HNW M;  4CGY B;  2FOI C;  3L25 A;  4X66 M;  1NY5 A;  2QPA A;  4LJ6 A;  5JI2 E;  3U6L A;  1IN6 A;  4LG2 A;  4LCB A;  2C96 A;  2CHG A;  4LF5 M;  1HQC A;  2CV1 A;  4IBG A;  4NSO B;  1N78 A;  3AFH A;  4M0D A;  1SXJ A;  3CF0 A;  4B3M M;  2RKO A;  3U6O A;  2X49 A;  4FWD A;  3GLH A;  3VDU A;  3H4M A;  3T38 A;  3L27 A;  1MU5 A;  1N32 M;  1L2B A;  1Z59 A;  4P16 A;  1DO2 A;  1TH3 A;  3SAW A;  3VK7 A;  4LF4 M;  3Q8X A;  2L6O A;  3UMM A;  1E32 A;  1S3S A;  2E5L M;  4PD2 A;  3CF6 E;  5ITX E;  1QZM A;  5ITY A;  4LZJ A;  2DZN B;  2J7N A;  2HKJ A;  3TE6 A;  1QAQ A;  3GRU A;  2DXI A;  4FCT A;  3K1J A;  3QWL A;  3SHG B;  2CV0 A;  3AJI B;  1TDZ A;  2XEP A;  1DO0 A;  4FW9 A;  2C98 A;  3RGS A;  5KPZ A;  3KOX E;  2X4A A;  1PM5 A;  2DWL A;  3U61 A;  1ZAE A;  1YE9 A;  1EE8 A;  4ZPX A;  5EXT A;  3HHW A;  4ITQ A;  4DV1 M;  4G4Q A;  3J2P B;  3RE8 A;  3THG A;  4KO8 A;  4MGK E;  1XNR M;  2X8A A;  2XSZ A;  3U60 A;  1TH4 A;  2DWZ B;  2D7E A;  4IBI A;  4OVZ A;  2V6Z M;  2XFT A;  1G41 A;  1KYI A;  2KZS A;  1L2D A;  5BR8 M;  5EJC A;  2XLJ A;  4GHA A;  1K82 A;  3TWK A;  3BOS A;  4D81 A;  1DGH B;  2KEB A;  4AG5 A;  3AKZ A;  1JR3 D;  1QYR A;  1Z5B A;  3NWL A;  3UZU A;  4R7G A;  3E9S A;  2AHM A;  4DV3 M;  3CTW B;  4FCW A;  5EP2 A;  4DV2 M;  2QEN A;  4NSR A;  3FTC A;  3U6S A;  5FSW A;  2ERC A;  2RGO A;  3MK6 A;  3VKG A;  1NNJ A;  4L78 A;  2OQ4 A;  2F5Q A;  2UXC M;  1IN5 A;  1IXS B;  4LFB M;  4AKI A;  3KOY E;  3MHV C;  4DR5 M;  3K8Z A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...