1IBKM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ibkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1ibkM02
5A2QS 5LMNM 3U6DA 3JAMS 1Q3CA 3GPXA 4DV0M 4GKKM 1IBMM 1L2CA 3GQ5A 3U6LA 4JI7M 4LF9M 4DR7M 1IBLM 3GO8A 4JI3M 2F5OA 3U6CA 1N34M 4G4NA 3A45A 5IT9S 1L1ZA 4JI0M 5ITYA 1FJGM 1Z59A 2XZUA 2F4VM 4NRWA 1MX0A 4MB7A 1L2BA 4LFAM 4YY3M 3J7AS 4YHHM 4NXNM 4DV7M 2E5LM 3VK7A 4JI1M 4LF6M 4DUZM 3GPUA 3U6EA 3U6MA 1XMOM 4X65M 4KHPM 1XC8A 1PJJA 4DV5M 2F5QA 1XMQM 4OX9M 1TDHA 4DV3M 5ITUA 2UU9M 5ITQA 1Z5BA 3T1YM 4GKJM 5ITXE 4LF7M 3TWMA 2ZM6M 1J5EM 2UUBM 3A46A 2UUCM 4JI4M 1N32M 3GPPA 4JI8M 2ZBKB 4ITQA 3J81S 1XNRM 4NXMM 2HHHM 4K0KM 2UXBM 4JI6M 5ITTA 3SATA 3OTOM 2UXDM 3DOAA 1K82A 3SARA 4X64M 4PDIA 3VK8A 2UUAM 3TWLA 4B3SM 4DV2M 2F5NA 2XZFA 1Q39A 3GPYA 5LMUM 2VQFM 4CISA 1Z5CA 1Q3BA 3JR4A 3GQ3A 3U6SA 3T1HM 1Z5AA 1N33M 4AQYM 4G4QA 3U6PA 4G4OA 1N36M 4DR3M 1K3WA 4DR4M 3U6OA 1TDZA 1I94M 1HNXM 5FLXS 4B3MM 3J80S 4LFBM 1NNJA 4JYAM 1MU5A 4LF8M 4JI5M 1HNWM 2OPFA 3W0FA 4DR5M 3SBJA 4G4RA 4PD2A 4DR6M 1HNZM 1K3XA 3U6QA 1PM5A 4NRVA 3A42A 3TWKA 2OQ4A 1R2ZA 1L2DA 1IBKM 4PDGA 3SAUA 1PJIA 3SAVA 5BR8M 5IWAM 4DV4M 2VQEM 2F5SA 1HR0M 4LFCM 1EE8A 2EA0A 2Q2EB 5ITRA 1XNQM 3GP1A 4DR1M 3SAWA 4JV5M 4LF4M 4LF5M 1KFVA 4PCZA 4B3RM 3JR5A 3C58A 3GQ4A 4DV1M 4DV6M 1R2YA 4JI2M 4DUYM 4X62M 4X66M 2F5PA 2HKJA 3SASA 2UXCM 4B3TM 1L1TA 5ITXA 4DR2M
chains in the Genus database with same CATH superfamily
4REZA 3VKGA 1RU3A 2CHQA 3L2AA 5DFLA 1ZMUA 4B7HA 4L16A 1IBMM 3L25A 4GKKM 3GQ5A 4LGYA 1NHGC 4RF0A 4DR7M 1IBLM 1HT2E 4FD2A 4AKGA 4JI3M 5JI2E 2F5OA 1IFYA 2L2DA 5KQDA 1W5TA 1IN5A 2J7NA 3TPZA 2LVOC 2R6FA 3B89A 4GMQA 2HCBA 1N34M 1L1ZA 2QHOB 3J2PB 1IXRC 3EIHA 4FCWA 2YNMD 1WGLA 5C18A 4IBCA 5KQ8A 2EKKA 3RGSA 1G41A 3B7ZA 4MB7A 3J7AS 2M5ZA 4YY3M 2RGHA 4AG5A 1NJFA 4BBAA 2E5LM 2Y21A 3SHFA 4DUZM 5EXTA 2HAKA 3VDUA 4M9XA 4X65M 1QDRA 4KHPM 2QZ4A 1QQWA 1TTEA 1V34A 1WIVA 4W5WA 1D2NA 1TDHA 4CIZA 2CV2A 2UU9M 4GHAA 2WSFF 3LMMA 3ZC7B 1Z5BA 1OQYA 3FTCA 2QNJA 4GKJM 3TE6A 2LVQD 2APLA 2R46A 2DAGA 2ZTCA 4G3OA 3KDSE 2I7PA 4QNMA 3GRRA 4AZFA 2ZM6M 2FE8A 3GLFA 1GL6A 3A98B 1L8QA 1YLAA 4NSOB 2R4JA 2JY5A 1FJGM 5IZ7D 1OIPA 1XNRM 1GKIA 2QBYA 4GIPA 1A5TA 1JB0F 1N77A 4K0KM 3HHXA 4F2LA 5ITTA 1NSFA 4JI6M 2XSZA 1C7YA 2Y0TA 1ZMVA 2Z7JA 4EIWA 3VK8A 2VDBB 1TH2A 2DAMA 2KDLA 3NBXX 3HZJA 1QVRA 4R71A 1N75A 3VKHA 2EJSA 1G59A 4M9SA 5DYIA 4KODA 5LMUM 3GLGB 1YE9A 2CHVA 3U6SA 3T1HM 2P5TA 2KEBA 2CHGA 1F4IA 2L4EA 1UFZA 4LJ9A 1TDZA 3E46A 2FFJA 4IBDA 2BWEA 1HQYE 3GLHA 3UMMA 3AV0A 3GLFE 3FTFA 2JY8A 2OPFA 2JUJA 3IG5A 3SBJA 3HU3A 5E26A 4PD2A 1GVNA 3AOEC 1NJGA 1HNZM 5FTKA 7CATA 3WHLA 3W0LB 2QBYB 1R2ZA 4NSRA 2OQ4A 2KZUA 3T38A 5KPTA 2BWBA 1PJIA 1X37A 5BR8M 1DO2A 4LJ6A 5IWAM 2V6ZM 3FYCA 4FVMA 2CUZA 2F5SA 2LNHC 3FUVA 2EA0A 2Q2EB 3U5ZB 2KRKA 2ZTDA 2EO2A 1BVSA 3KS4A 2L7HA 2X49A 3AOEA 4FW9A 3HX3A 2EKFA 4LF4M 2Z3XA 2JA2A 2ERCA 3JR5A 4MGIE 3ZQJA 3C58A 4B3RM 2C98A 1R2YA 1QAOA 1QZMA 1E9RA 1GJSA 1IN6A 3E21A 4X62M 4X66M 2F5PA 2QP9X 2V1CA 2CRUA 1L1TA 3GLHB 5H37D 2ZAOA 5A2QS 5LMNM 3JAMS 1Q3CA 5EP4A 5EXPA 1D0KA 3U6LA 4JI7M 3HJQA 8CATA 3HHWA 3IECA 5EQTA 3LCUA 3L26A 3K92A 3GLIB 1SXJE 1GLNA 4P16A 1XXHE 3A45A 1D0MA 1R4GA 3J27B 5EJCA 5ITYA 3C3EA 3C3DA 1MX0A 3MHVC 3R8FA 1SXJA 2DHYA 2Y20A 4NXNM 3CTWB 3H4MA 4LF6M 4RF1A 1SXJD 4LJ8A 2DZLA 3FUWA 1XMOM 1ZQ9A 2JP7A 4LJ5A 4LRSA 4D80A 1XC8A 4DV5M 4D82A 1Z6TA 2Z4SA 3I01M 1IY1A 3I4YA 4B7FA 1DV0A 1EFUB 1IN4A 2WZJA 2XF3A 2MJ5B 3K9PA 5ITQA 4CHTB 4R3DA 2CWBA 3TWMA 3IHPA 4BB9A 3T15A 1J5EM 2UUBM 3GRVA 2J5YA 3A46A 4F1IA 3FYDA 4OW0A 3HHZA 2C99A 2GNOA 2DWMA 2C5RA 2K6BA 2YQZA 3D8LA 3GPPA 2ZBKB 3L29A 1LV7A 4L78A 3U61A 3V76A 1KYIA 1XXHA 2HHHM 3FKEA 1IXSB 2UXBM 1G8PA 3OTOM 2OOBA 1IY0A 1K82A 3SARA 3FUUA 4OVZB 3UJNA 1XWIA 5L8RF 5EXXA 2MR9A 3SYLA 1NO1A 2JY6B 2F5NA 3B7QA 1Q39A 3LQRA 3C9PA 2O25A 3PFIA 3AKZA 2VQFM 3QAUA 1G4AE 4HEOA 3JR4A 2XH9A 1OFHA 1OJLA 4FWGA 1N33M 1E32A 1WGNA 2G5GX 1YUBA 3KS8A 2KW0A 2KNZA 4DR3M 2LVAA 4L8RC 3RE8A 4G6ZA 1NHWC 3VLFB 1IQPA 2R0IA 1UM8A 3WHKA 2CV1A 4B3MM 2H1RA 3K9OA 4JYAM 1TGUA 4IBKA 4I81A 4QHSA 2DWZB 2MROB 4M9ZA 3U61B 4LF8M 5EP3A 2Y0QA 4IBEA 1NV9A 2N35A 1VG5A 1Q02A 1IXSA 2DAIA 2H5XA 3W0FA 4DR5M 4GRIA 1DGFA 2JZ1A 2NQ8C 2KA6B 3U6QA 4A3VB 4QNRA 1XB2B 3U60A 4LGMA 1L2DA 3IG8A 4XBOA 3HU2A 1S3SA 2LTUA 2VIIA 5IREB 3FRHA 2DNAA 4M0WA 2KRUA 4L15A 5DNYA 1CUKA 1SXJB 5ITRA 4LJ4A 1I4WA 4IIWA 2GQFA 1OAIA 1IN8A 4LJ7A 2RRUA 5E6JA 3K2LA 3SAWA 4LY6A 4KT0F 4LF5M 3VDPA 2DVWB 4IJEA 2QENA 2WSCF 3GQ4A 1NY6A 4MGHA 1AUAA 4JI2M 1WHCA 3W68A 1W5SA 3K1JA 3KOZE 4KO8A 3RGPA 5FTNA 3FE3A 3FD9A 5KO3A 1MN3A 3SMSA 4B08A 4IBJA 3SASA 2J7OA 2LH0A 2DAEA 1JR3D 3CF2A 3M6AA 2ZAMA 4MGKE 3U6DA 1J7KA 5EP2A 1L2CA 1OIZA 2MH8A 1G71A 3PXGA 3GO8A 3LQQA 2XFTA 3W67A 2X8AA 1OKSA 3U60B 3U6CA 2C9OA 1TH3A 2LBCA 4GEWA 4JI0M 1JR3E 3KFUG 2CV0A 1Z59A 2QCUA 3BOSA 2XZUA 4TUWA 4AKIA 4NRWA 1L2BA 4WP2A 2BJVA 4YHHM 4DV7M 4JI1M 3VK7A 3F92A 1WJ7A 4CGYB 3U6MA 4IBIA 2QPAA 4GITA 3NBIA 1E9SA 2BNKA 3AFHA 2DWLA 1PJJA 2XSZD 1DGHB 2JZ0A 3EIEA 4JN6A 4NL4H 1IY2A 4QOSA 3SFZA 2LVPC 1XMQM 1TF0B 4OX9M 1FNNA 3CGWA 3KVWA 4AG6A 2O5RA 3B7NA 4FWDA 2A5YB 3T1YM 1PRBA 5ITXE 3QYBA 3HJ8A 3UGJA 1IM2A 3GLIE 3ZCBB 3QYEA 4XK8F 1VEJA 4ANRA 4AW4A 3M0EA 4GC5A 3UK6A 2B3TA 4JI4M 3MJ5A 1C1KA 2LHCA 2FOIC 2R4EA 5FTLA 3UZUA 3B74A 2CFOA 4JI8M 4FCTA 1HJPA 2L09A 3KOXE 1TH4A 3L27A 2R62A 3TQSA 3L28A 3SATA 4LZZA 2UXDM 2JY7A 4QOZC 2L4FA 4X64M 3DFZA 2D7EA 2K47A 2DENA 4PDIA 2UUAM 4AI6A 3PVSA 2JWSA 1OAOC 3B9PA 3TWLA 2D7HA 3FTEA 1PJQA 1VEGA 2XZFA 3KOYE 4IBGA 3AOGA 4S12A 4HL4A 4CISA 1QUSA 1Q3BA 1Z5CA 2LWXA 1OTRA 3E4RA 2M60A 1PJTA 3MK6A 3THGA 3GQ3A 4FCVA 3D8BA 2K9DA 1N78A 3KP1E 1QZEA 4G4QA 1NV8A 1QUTA 3U6PA 1GABA 1K3WA 1G3IA 3U6OA 4RKUF 2AHMA 1XXHB 2R45A 4WURA 4JXJA 1R5LA 1HNXM 2KHHA 1JQJC 3U5ZA 4BLCA 1J09A 2KNAA 1NNJA 1MU5A 3DZDA 4MGZE 1R7RA 4JI5M 2FNAA 4G4RA 4L4UA 1D0LA 1VEKA 2CEAA 2KZSA 2W82A 4DR6M 1MJGM 3NWLA 4IBFA 4OVZA 2KXEA 1PM5A 4NRVA 4PT5A 3GLGA 1IBKM 4PDGA 3SAUA 4DBGB 4I4LA 4DV4M 1OFIA 3KXEC 1GJTA 4LFCM 1EE8A 1V33A 2C96A 3GLHE 2Z8YM 3T6PA 4LJAA 1XNQM 1DO0A 3GLGE 1AIPC 1PGYA 4P17A 2EUCA 5EXSA 2XEPA 2G8LA 4MGYE 4DV1M 3FUTA 5EP1A 4CJ6A 5KPZA 3SC3A 2XGNA 5FSWA 4DUYM 1R6BX 4GHLA 2ZANA 2D7GA 4B3TM 1KSFX 5ITXA 2LXEA 2CP8A 1GO5A 3I51A 3GPXA 4DV0M 2OO9A 1WR1B 2RGOA 3FTDA 2KNVA 4LF9M 3M7GA 4IBBA 4WW0A 2DZNB 1H6UA 2RKOA 1QAMA 3LVWA 4G4NA 5IT9S 2G3QA 3SHGB 3J7BA 2F4VM 3KOWE 4QHTA 3GLFB 2DXIA 3LW5F 5FTJA 4LFAM 3SYKA 2VF7A 4NC6A 4IJFA 2QQ8A 4KLNA 3HKPA 3KSJA 3GPUA 3U6EA 3PNVA 3TL4X 4Z8XA 2L7IA 3HWSA 4UN2B 4GH9A 4LZJA 2F5QA 4MH0E 1T3TA 2Z4RA 2XFSA 1VDLA 4DV3M 4R7GA 5ITUA 3QWLA 4I5SA 5GKNA 4RNAA 3I4VA 1QYRA 2I7NA 4LF7M 5JI3E 1ZAEA 2R65A 2UUCM 2LVNC 1N32M 1QANA 2R44A 1ORYB 4L6V6 3HY5A 4LCBA 4Z6YA 4GC9A 4ITQA 1QAQA 3J81S 3Q8GA 1DGBA 1T6OA 2R18A 4ZPXA 4NXMM 1NNUC 1WXQA 3DOAA 3AL0C 3GRUA 2YFQA 1DGHA 3E9SA 2XLJA 1QDTA 1LTMA 2JNHA 3FRIA 4LG2A 4II7A 4FWHA 1SXJC 4B3SM 3MMPA 3LCVB 1IXZA 4DV2M 2O01F 3CF0A 3AJIB 4XGIA 2WSEF 4D81A 3H4JA 2FS1A 1VQ1A 3BBZA 3GPYA 3Q8XA 3K8ZA 2VF8A 3SMPA 3I04M 3ZH9B 1NY5A 1Z5AA 4Q7JA 1P3QQ 4AQYM 3RFWA 1HQCA 5BPVA 4G4OA 1N36M 2X4AA 1EIJA 2L6OA 1VDDA 4DR4M 3ILKA 4I8OA 3HU1A 1I94M 3HJSA 2K0BX 1ZMWA 2OOAA 5FLXS 3J80S 2FH0A 4LFBM 1Y8GA 2DZOB 3VFDA 2JXNA 4AKHA 1HT1E 2CE7A 2HL7A 1HNWM 1XHBA 1SG9A 1YSYA 2DWNA 1GL7A 3KW6A 1K3XA 3HHYA 4Y28F 1IN7A 4MM3B 1PJSA 2QSFX 3FUXA 3TWKA 3A42A 2HWJA 1JR3A 3SAVA 2VQEM 1HR0M 5KPRA 4LRTA 1DGGA 5C1BA 5FTMA 4M0DA 4HLQA 2DI0A 3CF6E 2C9CA 3GP1A 2DKLA 3GRYA 4B7GA 4DR1M 2BJWA 5DYGA 2YR0A 2DHRA 3BXWA 3PNYA 3R9XB 4JV5M 1KFVA 4PCZA 3KSXA 3GLIA 1NVMA 2MGWA 2LHGA 3DA1A 1E94E 3HGIA 4DV6M 4OU7A 1ZV1A 5F3WA 3LVVA 3KP0E 4NOOB 1TR8A 2DAKA 2V1UA 2HKJA 1V92A 2UXCM 1T43A 4DR2M
chains in the Genus database with same CATH topology
4REZA 3VKGA 2CHQA 3L2AA 4B7HA 4L16A 1IBMM 3L25A 4GKKM 3GQ5A 4LGYA 1NHGC 4RF0A 4DR7M 1IBLM 1HT2E 4FD2A 4AKGA 4JI3M 5JI2E 2F5OA 5KQDA 1W5TA 1IN5A 2J7NA 3TPZA 4GMQA 1N34M 2HCBA 1L1ZA 3J2PB 1IXRC 3EIHA 4FCWA 2YNMD 5C18A 5KQ8A 4IBCA 1FJGM 3RGSA 1G41A 4MB7A 3J7AS 2M5ZA 4YY3M 2RGHA 4AG5A 1NJFA 4BBAA 2E5LM 2Y21A 3SHFA 4DUZM 5EXTA 3VDUA 4M9XA 4X65M 4KHPM 2QZ4A 1QQWA 4W5WA 1D2NA 1TDHA 2UU9M 2CV2A 4GHAA 3LMMA 3ZC7B 1Z5BA 3FTCA 4GKJM 3TE6A 2R46A 3FTEA 4QNMA 2ZM6M 3KDSE 2I7PA 4AZFA 3GRRA 2FE8A 3GLFA 1GL6A 3A98B 1L8QA 4NSOB 2R4JA 5IZ7D 1XNRM 1GKIA 2QBYA 4GIPA 4K0KM 1N77A 3HHXA 4JI6M 5ITTA 1NSFA 2XSZA 2Y0TA 2Z7JA 4EIWA 3VK8A 1TH2A 1QVRA 3VKHA 1N75A 1G59A 4M9SA 5DYIA 4KODA 5LMUM 3GLGB 1YE9A 2CHVA 3U6SA 3T1HM 2P5TA 2KEBA 2CHGA 4LJ9A 1TDZA 4IBDA 2FFJA 1HQYE 3GLHA 3UMMA 3AV0A 3FTFA 2OPFA 3IG5A 3SBJA 3HU3A 5E26A 4PD2A 1GVNA 3AOEC 1NJGA 1HNZM 5FTKA 7CATA 3WHLA 3W0LB 2QBYB 1R2ZA 4NSRA 2OQ4A 2KZUA 3T38A 5KPTA 1PJIA 1X37A 5BR8M 1DO2A 4LJ6A 5IWAM 2V6ZM 3FYCA 4FVMA 2CUZA 2F5SA 2LNHC 3FUVA 2EA0A 2Q2EB 3U5ZB 2KRKA 2EO2A 3KS4A 2L7HA 2X49A 3AOEA 4FW9A 4LF4M 2Z3XA 2JA2A 2ERCA 3JR5A 4MGIE 4B3RM 3C58A 2C98A 1R2YA 1QAOA 1QZMA 1E9RA 1IN6A 4X62M 4X66M 2F5PA 2QP9X 2V1CA 1L1TA 3GLHB 5H37D 2ZAOA 5A2QS 5LMNM 3JAMS 1Q3CA 5EP4A 5EXPA 3U6LA 4JI7M 3HJQA 8CATA 3HHWA 5EQTA 3L26A 3K92A 3GLIB 1SXJE 1GLNA 4P16A 3A45A 3J27B 5EJCA 5ITYA 1MX0A 3MHVC 3R8FA 1SXJA 2Y20A 4NXNM 3CTWB 3H4MA 4LF6M 4RF1A 1SXJD 4LJ8A 3FUWA 1XMOM 1ZQ9A 4LJ5A 4D80A 4LRSA 1XC8A 4DV5M 4D82A 1Z6TA 2Z4SA 1IY1A 3I4YA 4B7FA 1IN4A 2XF3A 5ITQA 4CHTB 4R3DA 3TWMA 4BB9A 3T15A 1J5EM 2UUBM 3GRVA 3A46A 3FYDA 4OW0A 3HHZA 2C99A 2DWMA 2C5RA 2YQZA 3D8LA 3GPPA 2ZBKB 3L29A 1LV7A 4L78A 3U61A 1KYIA 1XXHA 2HHHM 3FKEA 1IXSB 2UXBM 1G8PA 3OTOM 1K82A 1IY0A 3SARA 3FUUA 4OVZB 3UJNA 1XWIA 5EXXA 3SYLA 2F5NA 1Q39A 3LQRA 3PFIA 3AKZA 2VQFM 3QAUA 1G4AE 3JR4A 2XH9A 1OFHA 4FWGA 1OJLA 1N33M 1E32A 2G5GX 1YUBA 3KS8A 2KW0A 4DR3M 4L8RC 3RE8A 4G6ZA 1NHWC 3VLFB 1IQPA 1UM8A 3WHKA 2CV1A 4B3MM 2H1RA 4JYAM 1TGUA 4IBKA 4I81A 4QHSA 2DWZB 4M9ZA 3U61B 4LF8M 5EP3A 2Y0QA 4IBEA 3W0FA 4DR5M 4GRIA 1DGFA 2NQ8C 2KA6B 3U6QA 4A3VB 4QNRA 3U60A 4LGMA 1L2DA 3IG8A 4XBOA 3HU2A 1S3SA 2VIIA 5IREB 4M0WA 2KRUA 4L15A 5DNYA 1SXJB 5ITRA 4LJ4A 1I4WA 4IIWA 1IN8A 4LJ7A 5E6JA 3K2LA 3SAWA 4LY6A 4LF5M 3VDPA 2DVWB 4IJEA 2QENA 3GQ4A 1NY6A 4MGHA 4JI2M 1W5SA 3K1JA 3KOZE 4KO8A 3RGPA 5FTNA 5KO3A 3FD9A 3SMSA 4B08A 4IBJA 3SASA 2J7OA 2LH0A 1JR3D 3CF2A 3M6AA 2ZAMA 4MGKE 3U6DA 1J7KA 5EP2A 1L2CA 3PXGA 3GO8A 3LQQA 2XFTA 2X8AA 3U60B 3U6CA 2C9OA 1TH3A 3KFUG 4JI0M 2CV0A 1Z59A 2QCUA 3BOSA 2XZUA 4TUWA 4AKIA 4NRWA 1L2BA 2BJVA 4YHHM 4DV7M 4JI1M 3VK7A 4CGYB 3U6MA 4IBIA 2QPAA 4GITA 3NBIA 1E9SA 2BNKA 3AFHA 2DWLA 1PJJA 2XSZD 1DGHB 3EIEA 4QOSA 4JN6A 4NL4H 1IY2A 3SFZA 1XMQM 4OX9M 1FNNA 3KVWA 4AG6A 2O5RA 4FWDA 2A5YB 3T1YM 5ITXE 3HJ8A 3UGJA 1IM2A 3ZCBB 4AW4A 3M0EA 4GC5A 3UK6A 4JI4M 3MJ5A 1C1KA 2FOIC 2R4EA 5FTLA 3UZUA 4JI8M 2CFOA 4FCTA 2L09A 3KOXE 1TH4A 3L27A 2R62A 3TQSA 3L28A 3SATA 4LZZA 2UXDM 4QOZC 4X64M 3DFZA 2D7EA 2K47A 4PDIA 2UUAM 4AI6A 3PVSA 3TWLA 3B9PA 2D7HA 2XZFA 3KOYE 4IBGA 3AOGA 4S12A 4HL4A 4CISA 1Z5CA 1Q3BA 2LWXA 3E4RA 3MK6A 3THGA 2M60A 3GQ3A 4FCVA 3D8BA 1N78A 3KP1E 4G4QA 3U6PA 1K3WA 1G3IA 3U6OA 2AHMA 1XXHB 2R45A 4WURA 4JXJA 1HNXM 1JQJC 3U5ZA 4BLCA 1J09A 1NNJA 1MU5A 3DZDA 4MGZE 1R7RA 4JI5M 2FNAA 4G4RA 4L4UA 2CEAA 2KZSA 2W82A 4DR6M 3NWLA 4IBFA 4OVZA 2KXEA 1PM5A 4NRVA 4PT5A 3GLGA 1IBKM 4PDGA 3SAUA 4I4LA 4DV4M 1OFIA 3KXEC 4LFCM 1EE8A 2C96A 4LJAA 1XNQM 1DO0A 2EUCA 5EXSA 2XEPA 2G8LA 4MGYE 4DV1M 3FUTA 5EP1A 5KPZA 3SC3A 2XGNA 5FSWA 4DUYM 1R6BX 4GHLA 2ZANA 2D7GA 4B3TM 1KSFX 5ITXA 2LXEA 3I51A 3GPXA 4DV0M 2RGOA 3FTDA 4LF9M 3M7GA 4IBBA 4WW0A 2DZNB 1H6UA 2RKOA 1QAMA 3LVWA 4G4NA 5IT9S 3SHGB 3J7BA 2F4VM 3KOWE 4QHTA 3GLFB 2DXIA 5FTJA 4LFAM 3SYKA 4IJFA 4KLNA 3HKPA 3KSJA 3GPUA 3U6EA 3PNVA 3TL4X 4Z8XA 2L7IA 3HWSA 4GH9A 4LZJA 2F5QA 4MH0E 1T3TA 2Z4RA 2XFSA 4DV3M 4R7GA 5ITUA 3QWLA 4I5SA 5GKNA 4RNAA 3I4VA 1QYRA 2I7NA 4LF7M 5JI3E 1ZAEA 2R65A 2UUCM 1N32M 1QANA 1ORYB 4LCBA 4Z6YA 4GC9A 4ITQA 1QAQA 3J81S 1DGBA 2R18A 4ZPXA 4NXMM 1NNUC 1WXQA 3DOAA 3AL0C 3GRUA 2YFQA 1DGHA 3E9SA 2XLJA 4LG2A 4II7A 4FWHA 1SXJC 4B3SM 4DV2M 1IXZA 3CF0A 3AJIB 4XGIA 4D81A 3GPYA 3Q8XA 3K8ZA 3SMPA 3ZH9B 1NY5A 1Z5AA 4AQYM 3RFWA 1HQCA 5BPVA 4G4OA 1N36M 2X4AA 2L6OA 1VDDA 4DR4M 3ILKA 4I8OA 3HU1A 1I94M 3HJSA 5FLXS 3J80S 4LFBM 2DZOB 3VFDA 4AKHA 1HT1E 2CE7A 2HL7A 1HNWM 1XHBA 1YSYA 2DWNA 1GL7A 3KW6A 1K3XA 3HHYA 1IN7A 4MM3B 3FUXA 3TWKA 3A42A 1JR3A 3SAVA 2VQEM 1HR0M 5KPRA 4LRTA 1DGGA 5C1BA 5FTMA 4M0DA 4HLQA 3CF6E 2C9CA 3GP1A 3GRYA 4B7GA 4DR1M 2BJWA 5DYGA 2YR0A 2DHRA 3PNYA 3R9XB 4JV5M 1KFVA 4PCZA 3KSXA 3GLIA 1NVMA 3DA1A 1E94E 3HGIA 4DV6M 4OU7A 5F3WA 3LVVA 3KP0E 4NOOB 2V1UA 2HKJA 2UXCM 4DR2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q S;  5LMN M;  3U6D A;  3JAM S;  1Q3C A;  3GPX A;  4DV0 M;  4GKK M;  1IBM M;  1L2C A;  3GQ5 A;  3U6L A;  4JI7 M;  4LF9 M;  4DR7 M;  1IBL M;  3GO8 A;  4JI3 M;  2F5O A;  3U6C A;  1N34 M;  4G4N A;  3A45 A;  5IT9 S;  1L1Z A;  4JI0 M;  5ITY A;  1FJG M;  1Z59 A;  2XZU A;  2F4V M;  4NRW A;  1MX0 A;  4MB7 A;  1L2B A;  4LFA M;  4YY3 M;  3J7A S;  4YHH M;  4NXN M;  4DV7 M;  2E5L M;  3VK7 A;  4JI1 M;  4LF6 M;  4DUZ M;  3GPU A;  3U6E A;  3U6M A;  1XMO M;  4X65 M;  4KHP M;  1XC8 A;  1PJJ A;  4DV5 M;  2F5Q A;  1XMQ M;  4OX9 M;  1TDH A;  4DV3 M;  5ITU A;  2UU9 M;  5ITQ A;  1Z5B A;  3T1Y M;  4GKJ M;  5ITX E;  4LF7 M;  3TWM A;  2ZM6 M;  1J5E M;  2UUB M;  3A46 A;  2UUC M;  4JI4 M;  1N32 M;  3GPP A;  4JI8 M;  2ZBK B;  4ITQ A;  3J81 S;  1XNR M;  4NXM M;  2HHH M;  4K0K M;  2UXB M;  4JI6 M;  5ITT A;  3SAT A;  3OTO M;  2UXD M;  3DOA A;  1K82 A;  3SAR A;  4X64 M;  4PDI A;  3VK8 A;  2UUA M;  3TWL A;  4B3S M;  4DV2 M;  2F5N A;  2XZF A;  1Q39 A;  3GPY A;  5LMU M;  2VQF M;  4CIS A;  1Z5C A;  1Q3B A;  3JR4 A;  3GQ3 A;  3U6S A;  3T1H M;  1Z5A A;  1N33 M;  4AQY M;  4G4Q A;  3U6P A;  4G4O A;  1N36 M;  4DR3 M;  1K3W A;  4DR4 M;  3U6O A;  1TDZ A;  1I94 M;  1HNX M;  5FLX S;  4B3M M;  3J80 S;  4LFB M;  1NNJ A;  4JYA M;  1MU5 A;  4LF8 M;  4JI5 M;  1HNW M;  2OPF A;  3W0F A;  4DR5 M;  3SBJ A;  4G4R A;  4PD2 A;  4DR6 M;  1HNZ M;  1K3X A;  3U6Q A;  1PM5 A;  4NRV A;  3A42 A;  3TWK A;  2OQ4 A;  1R2Z A;  1L2D A;  1IBK M;  4PDG A;  3SAU A;  1PJI A;  3SAV A;  5BR8 M;  5IWA M;  4DV4 M;  2VQE M;  2F5S A;  1HR0 M;  4LFC M;  1EE8 A;  2EA0 A;  2Q2E B;  5ITR A;  1XNQ M;  3GP1 A;  4DR1 M;  3SAW A;  4JV5 M;  4LF4 M;  4LF5 M;  1KFV A;  4PCZ A;  4B3R M;  3JR5 A;  3C58 A;  3GQ4 A;  4DV1 M;  4DV6 M;  1R2Y A;  4JI2 M;  4DUY M;  4X62 M;  4X66 M;  2F5P A;  2HKJ A;  3SAS A;  2UXC M;  4B3T M;  1L1T A;  5ITX A;  4DR2 M; 
#chains in the Genus database with same CATH topology
 4REZ A;  3VKG A;  1RU3 A;  2CHQ A;  3L2A A;  5DFL A;  1ZMU A;  4B7H A;  4L16 A;  1IBM M;  3L25 A;  4GKK M;  3GQ5 A;  4LGY A;  1NHG C;  4RF0 A;  4DR7 M;  1IBL M;  1HT2 E;  4FD2 A;  4AKG A;  4JI3 M;  5JI2 E;  2F5O A;  1IFY A;  2L2D A;  5KQD A;  1W5T A;  1IN5 A;  2J7N A;  3TPZ A;  2LVO C;  2R6F A;  3B89 A;  4GMQ A;  2HCB A;  1N34 M;  1L1Z A;  2QHO B;  3J2P B;  1IXR C;  3EIH A;  4FCW A;  2YNM D;  1WGL A;  5C18 A;  4IBC A;  5KQ8 A;  2EKK A;  3RGS A;  1G41 A;  3B7Z A;  4MB7 A;  3J7A S;  2M5Z A;  4YY3 M;  2RGH A;  4AG5 A;  1NJF A;  4BBA A;  2E5L M;  2Y21 A;  3SHF A;  4DUZ M;  5EXT A;  2HAK A;  3VDU A;  4M9X A;  4X65 M;  1QDR A;  4KHP M;  2QZ4 A;  1QQW A;  1TTE A;  1V34 A;  1WIV A;  4W5W A;  1D2N A;  1TDH A;  4CIZ A;  2CV2 A;  2UU9 M;  4GHA A;  2WSF F;  3LMM A;  3ZC7 B;  1Z5B A;  1OQY A;  3FTC A;  2QNJ A;  4GKJ M;  3TE6 A;  2LVQ D;  2APL A;  2R46 A;  2DAG A;  2ZTC A;  4G3O A;  3KDS E;  2I7P A;  4QNM A;  3GRR A;  4AZF A;  2ZM6 M;  2FE8 A;  3GLF A;  1GL6 A;  3A98 B;  1L8Q A;  1YLA A;  4NSO B;  2R4J A;  2JY5 A;  1FJG M;  5IZ7 D;  1OIP A;  1XNR M;  1GKI A;  2QBY A;  4GIP A;  1A5T A;  1JB0 F;  1N77 A;  4K0K M;  3HHX A;  4F2L A;  5ITT A;  1NSF A;  4JI6 M;  2XSZ A;  1C7Y A;  2Y0T A;  1ZMV A;  2Z7J A;  4EIW A;  3VK8 A;  2VDB B;  1TH2 A;  2DAM A;  2KDL A;  3NBX X;  3HZJ A;  1QVR A;  4R71 A;  1N75 A;  3VKH A;  2EJS A;  1G59 A;  4M9S A;  5DYI A;  4KOD A;  5LMU M;  3GLG B;  1YE9 A;  2CHV A;  3U6S A;  3T1H M;  2P5T A;  2KEB A;  2CHG A;  1F4I A;  2L4E A;  1UFZ A;  4LJ9 A;  1TDZ A;  3E46 A;  2FFJ A;  4IBD A;  2BWE A;  1HQY E;  3GLH A;  3UMM A;  3AV0 A;  3GLF E;  3FTF A;  2JY8 A;  2OPF A;  2JUJ A;  3IG5 A;  3SBJ A;  3HU3 A;  5E26 A;  4PD2 A;  1GVN A;  3AOE C;  1NJG A;  1HNZ M;  5FTK A;  7CAT A;  3WHL A;  3W0L B;  2QBY B;  1R2Z A;  4NSR A;  2OQ4 A;  2KZU A;  3T38 A;  5KPT A;  2BWB A;  1PJI A;  1X37 A;  5BR8 M;  1DO2 A;  4LJ6 A;  5IWA M;  2V6Z M;  3FYC A;  4FVM A;  2CUZ A;  2F5S A;  2LNH C;  3FUV A;  2EA0 A;  2Q2E B;  3U5Z B;  2KRK A;  2ZTD A;  2EO2 A;  1BVS A;  3KS4 A;  2L7H A;  2X49 A;  3AOE A;  4FW9 A;  3HX3 A;  2EKF A;  4LF4 M;  2Z3X A;  2JA2 A;  2ERC A;  3JR5 A;  4MGI E;  3ZQJ A;  3C58 A;  4B3R M;  2C98 A;  1R2Y A;  1QAO A;  1QZM A;  1E9R A;  1GJS A;  1IN6 A;  3E21 A;  4X62 M;  4X66 M;  2F5P A;  2QP9 X;  2V1C A;  2CRU A;  1L1T A;  3GLH B;  5H37 D;  2ZAO A;  5A2Q S;  5LMN M;  3JAM S;  1Q3C A;  5EP4 A;  5EXP A;  1D0K A;  3U6L A;  4JI7 M;  3HJQ A;  8CAT A;  3HHW A;  3IEC A;  5EQT A;  3LCU A;  3L26 A;  3K92 A;  3GLI B;  1SXJ E;  1GLN A;  4P16 A;  1XXH E;  3A45 A;  1D0M A;  1R4G A;  3J27 B;  5EJC A;  5ITY A;  3C3E A;  3C3D A;  1MX0 A;  3MHV C;  3R8F A;  1SXJ A;  2DHY A;  2Y20 A;  4NXN M;  3CTW B;  3H4M A;  4LF6 M;  4RF1 A;  1SXJ D;  4LJ8 A;  2DZL A;  3FUW A;  1XMO M;  1ZQ9 A;  2JP7 A;  4LJ5 A;  4LRS A;  4D80 A;  1XC8 A;  4DV5 M;  4D82 A;  1Z6T A;  2Z4S A;  3I01 M;  1IY1 A;  3I4Y A;  4B7F A;  1DV0 A;  1EFU B;  1IN4 A;  2WZJ A;  2XF3 A;  2MJ5 B;  3K9P A;  5ITQ A;  4CHT B;  4R3D A;  2CWB A;  3TWM A;  3IHP A;  4BB9 A;  3T15 A;  1J5E M;  2UUB M;  3GRV A;  2J5Y A;  3A46 A;  4F1I A;  3FYD A;  4OW0 A;  3HHZ A;  2C99 A;  2GNO A;  2DWM A;  2C5R A;  2K6B A;  2YQZ A;  3D8L A;  3GPP A;  2ZBK B;  3L29 A;  1LV7 A;  4L78 A;  3U61 A;  3V76 A;  1KYI A;  1XXH A;  2HHH M;  3FKE A;  1IXS B;  2UXB M;  1G8P A;  3OTO M;  2OOB A;  1IY0 A;  1K82 A;  3SAR A;  3FUU A;  4OVZ B;  3UJN A;  1XWI A;  5L8R F;  5EXX A;  2MR9 A;  3SYL A;  1NO1 A;  2JY6 B;  2F5N A;  3B7Q A;  1Q39 A;  3LQR A;  3C9P A;  2O25 A;  3PFI A;  3AKZ A;  2VQF M;  3QAU A;  1G4A E;  4HEO A;  3JR4 A;  2XH9 A;  1OFH A;  1OJL A;  4FWG A;  1N33 M;  1E32 A;  1WGN A;  2G5G X;  1YUB A;  3KS8 A;  2KW0 A;  2KNZ A;  4DR3 M;  2LVA A;  4L8R C;  3RE8 A;  4G6Z A;  1NHW C;  3VLF B;  1IQP A;  2R0I A;  1UM8 A;  3WHK A;  2CV1 A;  4B3M M;  2H1R A;  3K9O A;  4JYA M;  1TGU A;  4IBK A;  4I81 A;  4QHS A;  2DWZ B;  2MRO B;  4M9Z A;  3U61 B;  4LF8 M;  5EP3 A;  2Y0Q A;  4IBE A;  1NV9 A;  2N35 A;  1VG5 A;  1Q02 A;  1IXS A;  2DAI A;  2H5X A;  3W0F A;  4DR5 M;  4GRI A;  1DGF A;  2JZ1 A;  2NQ8 C;  2KA6 B;  3U6Q A;  4A3V B;  4QNR A;  1XB2 B;  3U60 A;  4LGM A;  1L2D A;  3IG8 A;  4XBO A;  3HU2 A;  1S3S A;  2LTU A;  2VII A;  5IRE B;  3FRH A;  2DNA A;  4M0W A;  2KRU A;  4L15 A;  5DNY A;  1CUK A;  1SXJ B;  5ITR A;  4LJ4 A;  1I4W A;  4IIW A;  2GQF A;  1OAI A;  1IN8 A;  4LJ7 A;  2RRU A;  5E6J A;  3K2L A;  3SAW A;  4LY6 A;  4KT0 F;  4LF5 M;  3VDP A;  2DVW B;  4IJE A;  2QEN A;  2WSC F;  3GQ4 A;  1NY6 A;  4MGH A;  1AUA A;  4JI2 M;  1WHC A;  3W68 A;  1W5S A;  3K1J A;  3KOZ E;  4KO8 A;  3RGP A;  5FTN A;  3FE3 A;  3FD9 A;  5KO3 A;  1MN3 A;  3SMS A;  4B08 A;  4IBJ A;  3SAS A;  2J7O A;  2LH0 A;  2DAE A;  1JR3 D;  3CF2 A;  3M6A A;  2ZAM A;  4MGK E;  3U6D A;  1J7K A;  5EP2 A;  1L2C A;  1OIZ A;  2MH8 A;  1G71 A;  3PXG A;  3GO8 A;  3LQQ A;  2XFT A;  3W67 A;  2X8A A;  1OKS A;  3U60 B;  3U6C A;  2C9O A;  1TH3 A;  2LBC A;  4GEW A;  4JI0 M;  1JR3 E;  3KFU G;  2CV0 A;  1Z59 A;  2QCU A;  3BOS A;  2XZU A;  4TUW A;  4AKI A;  4NRW A;  1L2B A;  4WP2 A;  2BJV A;  4YHH M;  4DV7 M;  4JI1 M;  3VK7 A;  3F92 A;  1WJ7 A;  4CGY B;  3U6M A;  4IBI A;  2QPA A;  4GIT A;  3NBI A;  1E9S A;  2BNK A;  3AFH A;  2DWL A;  1PJJ A;  2XSZ D;  1DGH B;  2JZ0 A;  3EIE A;  4JN6 A;  4NL4 H;  1IY2 A;  4QOS A;  3SFZ A;  2LVP C;  1XMQ M;  1TF0 B;  4OX9 M;  1FNN A;  3CGW A;  3KVW A;  4AG6 A;  2O5R A;  3B7N A;  4FWD A;  2A5Y B;  3T1Y M;  1PRB A;  5ITX E;  3QYB A;  3HJ8 A;  3UGJ A;  1IM2 A;  3GLI E;  3ZCB B;  3QYE A;  4XK8 F;  1VEJ A;  4ANR A;  4AW4 A;  3M0E A;  4GC5 A;  3UK6 A;  2B3T A;  4JI4 M;  3MJ5 A;  1C1K A;  2LHC A;  2FOI C;  2R4E A;  5FTL A;  3UZU A;  3B74 A;  2CFO A;  4JI8 M;  4FCT A;  1HJP A;  2L09 A;  3KOX E;  1TH4 A;  3L27 A;  2R62 A;  3TQS A;  3L28 A;  3SAT A;  4LZZ A;  2UXD M;  2JY7 A;  4QOZ C;  2L4F A;  4X64 M;  3DFZ A;  2D7E A;  2K47 A;  2DEN A;  4PDI A;  2UUA M;  4AI6 A;  3PVS A;  2JWS A;  1OAO C;  3B9P A;  3TWL A;  2D7H A;  3FTE A;  1PJQ A;  1VEG A;  2XZF A;  3KOY E;  4IBG A;  3AOG A;  4S12 A;  4HL4 A;  4CIS A;  1QUS A;  1Q3B A;  1Z5C A;  2LWX A;  1OTR A;  3E4R A;  2M60 A;  1PJT A;  3MK6 A;  3THG A;  3GQ3 A;  4FCV A;  3D8B A;  2K9D A;  1N78 A;  3KP1 E;  1QZE A;  4G4Q A;  1NV8 A;  1QUT A;  3U6P A;  1GAB A;  1K3W A;  1G3I A;  3U6O A;  4RKU F;  2AHM A;  1XXH B;  2R45 A;  4WUR A;  4JXJ A;  1R5L A;  1HNX M;  2KHH A;  1JQJ C;  3U5Z A;  4BLC A;  1J09 A;  2KNA A;  1NNJ A;  1MU5 A;  3DZD A;  4MGZ E;  1R7R A;  4JI5 M;  2FNA A;  4G4R A;  4L4U A;  1D0L A;  1VEK A;  2CEA A;  2KZS A;  2W82 A;  4DR6 M;  1MJG M;  3NWL A;  4IBF A;  4OVZ A;  2KXE A;  1PM5 A;  4NRV A;  4PT5 A;  3GLG A;  1IBK M;  4PDG A;  3SAU A;  4DBG B;  4I4L A;  4DV4 M;  1OFI A;  3KXE C;  1GJT A;  4LFC M;  1EE8 A;  1V33 A;  2C96 A;  3GLH E;  2Z8Y M;  3T6P A;  4LJA A;  1XNQ M;  1DO0 A;  3GLG E;  1AIP C;  1PGY A;  4P17 A;  2EUC A;  5EXS A;  2XEP A;  2G8L A;  4MGY E;  4DV1 M;  3FUT A;  5EP1 A;  4CJ6 A;  5KPZ A;  3SC3 A;  2XGN A;  5FSW A;  4DUY M;  1R6B X;  4GHL A;  2ZAN A;  2D7G A;  4B3T M;  1KSF X;  5ITX A;  2LXE A;  2CP8 A;  1GO5 A;  3I51 A;  3GPX A;  4DV0 M;  2OO9 A;  1WR1 B;  2RGO A;  3FTD A;  2KNV A;  4LF9 M;  3M7G A;  4IBB A;  4WW0 A;  2DZN B;  1H6U A;  2RKO A;  1QAM A;  3LVW A;  4G4N A;  5IT9 S;  2G3Q A;  3SHG B;  3J7B A;  2F4V M;  3KOW E;  4QHT A;  3GLF B;  2DXI A;  3LW5 F;  5FTJ A;  4LFA M;  3SYK A;  2VF7 A;  4NC6 A;  4IJF A;  2QQ8 A;  4KLN A;  3HKP A;  3KSJ A;  3GPU A;  3U6E A;  3PNV A;  3TL4 X;  4Z8X A;  2L7I A;  3HWS A;  4UN2 B;  4GH9 A;  4LZJ A;  2F5Q A;  4MH0 E;  1T3T A;  2Z4R A;  2XFS A;  1VDL A;  4DV3 M;  4R7G A;  5ITU A;  3QWL A;  4I5S A;  5GKN A;  4RNA A;  3I4V A;  1QYR A;  2I7N A;  4LF7 M;  5JI3 E;  1ZAE A;  2R65 A;  2UUC M;  2LVN C;  1N32 M;  1QAN A;  2R44 A;  1ORY B;  4L6V 6;  3HY5 A;  4LCB A;  4Z6Y A;  4GC9 A;  4ITQ A;  1QAQ A;  3J81 S;  3Q8G A;  1DGB A;  1T6O A;  2R18 A;  4ZPX A;  4NXM M;  1NNU C;  1WXQ A;  3DOA A;  3AL0 C;  3GRU A;  2YFQ A;  1DGH A;  3E9S A;  2XLJ A;  1QDT A;  1LTM A;  2JNH A;  3FRI A;  4LG2 A;  4II7 A;  4FWH A;  1SXJ C;  4B3S M;  3MMP A;  3LCV B;  1IXZ A;  4DV2 M;  2O01 F;  3CF0 A;  3AJI B;  4XGI A;  2WSE F;  4D81 A;  3H4J A;  2FS1 A;  1VQ1 A;  3BBZ A;  3GPY A;  3Q8X A;  3K8Z A;  2VF8 A;  3SMP A;  3I04 M;  3ZH9 B;  1NY5 A;  1Z5A A;  4Q7J A;  1P3Q Q;  4AQY M;  3RFW A;  1HQC A;  5BPV A;  4G4O A;  1N36 M;  2X4A A;  1EIJ A;  2L6O A;  1VDD A;  4DR4 M;  3ILK A;  4I8O A;  3HU1 A;  1I94 M;  3HJS A;  2K0B X;  1ZMW A;  2OOA A;  5FLX S;  3J80 S;  2FH0 A;  4LFB M;  1Y8G A;  2DZO B;  3VFD A;  2JXN A;  4AKH A;  1HT1 E;  2CE7 A;  2HL7 A;  1HNW M;  1XHB A;  1SG9 A;  1YSY A;  2DWN A;  1GL7 A;  3KW6 A;  1K3X A;  3HHY A;  4Y28 F;  1IN7 A;  4MM3 B;  1PJS A;  2QSF X;  3FUX A;  3TWK A;  3A42 A;  2HWJ A;  1JR3 A;  3SAV A;  2VQE M;  1HR0 M;  5KPR A;  4LRT A;  1DGG A;  5C1B A;  5FTM A;  4M0D A;  4HLQ A;  2DI0 A;  3CF6 E;  2C9C A;  3GP1 A;  2DKL A;  3GRY A;  4B7G A;  4DR1 M;  2BJW A;  5DYG A;  2YR0 A;  2DHR A;  3BXW A;  3PNY A;  3R9X B;  4JV5 M;  1KFV A;  4PCZ A;  3KSX A;  3GLI A;  1NVM A;  2MGW A;  2LHG A;  3DA1 A;  1E94 E;  3HGI A;  4DV6 M;  4OU7 A;  1ZV1 A;  5F3W A;  3LVV A;  3KP0 E;  4NOO B;  1TR8 A;  2DAK A;  2V1U A;  2HKJ A;  1V92 A;  2UXC M;  1T43 A;  4DR2 M; 
#chains in the Genus database with same CATH homology
 4REZ A;  3VKG A;  2CHQ A;  3L2A A;  4B7H A;  4L16 A;  1IBM M;  3L25 A;  4GKK M;  3GQ5 A;  4LGY A;  1NHG C;  4RF0 A;  4DR7 M;  1IBL M;  1HT2 E;  4FD2 A;  4AKG A;  4JI3 M;  5JI2 E;  2F5O A;  5KQD A;  1W5T A;  1IN5 A;  2J7N A;  3TPZ A;  4GMQ A;  1N34 M;  2HCB A;  1L1Z A;  3J2P B;  1IXR C;  3EIH A;  4FCW A;  2YNM D;  5C18 A;  5KQ8 A;  4IBC A;  1FJG M;  3RGS A;  1G41 A;  4MB7 A;  3J7A S;  2M5Z A;  4YY3 M;  2RGH A;  4AG5 A;  1NJF A;  4BBA A;  2E5L M;  2Y21 A;  3SHF A;  4DUZ M;  5EXT A;  3VDU A;  4M9X A;  4X65 M;  4KHP M;  2QZ4 A;  1QQW A;  4W5W A;  1D2N A;  1TDH A;  2UU9 M;  2CV2 A;  4GHA A;  3LMM A;  3ZC7 B;  1Z5B A;  3FTC A;  4GKJ M;  3TE6 A;  2R46 A;  3FTE A;  4QNM A;  2ZM6 M;  3KDS E;  2I7P A;  4AZF A;  3GRR A;  2FE8 A;  3GLF A;  1GL6 A;  3A98 B;  1L8Q A;  4NSO B;  2R4J A;  5IZ7 D;  1XNR M;  1GKI A;  2QBY A;  4GIP A;  4K0K M;  1N77 A;  3HHX A;  4JI6 M;  5ITT A;  1NSF A;  2XSZ A;  2Y0T A;  2Z7J A;  4EIW A;  3VK8 A;  1TH2 A;  1QVR A;  3VKH A;  1N75 A;  1G59 A;  4M9S A;  5DYI A;  4KOD A;  5LMU M;  3GLG B;  1YE9 A;  2CHV A;  3U6S A;  3T1H M;  2P5T A;  2KEB A;  2CHG A;  4LJ9 A;  1TDZ A;  4IBD A;  2FFJ A;  1HQY E;  3GLH A;  3UMM A;  3AV0 A;  3FTF A;  2OPF A;  3IG5 A;  3SBJ A;  3HU3 A;  5E26 A;  4PD2 A;  1GVN A;  3AOE C;  1NJG A;  1HNZ M;  5FTK A;  7CAT A;  3WHL A;  3W0L B;  2QBY B;  1R2Z A;  4NSR A;  2OQ4 A;  2KZU A;  3T38 A;  5KPT A;  1PJI A;  1X37 A;  5BR8 M;  1DO2 A;  4LJ6 A;  5IWA M;  2V6Z M;  3FYC A;  4FVM A;  2CUZ A;  2F5S A;  2LNH C;  3FUV A;  2EA0 A;  2Q2E B;  3U5Z B;  2KRK A;  2EO2 A;  3KS4 A;  2L7H A;  2X49 A;  3AOE A;  4FW9 A;  4LF4 M;  2Z3X A;  2JA2 A;  2ERC A;  3JR5 A;  4MGI E;  4B3R M;  3C58 A;  2C98 A;  1R2Y A;  1QAO A;  1QZM A;  1E9R A;  1IN6 A;  4X62 M;  4X66 M;  2F5P A;  2QP9 X;  2V1C A;  1L1T A;  3GLH B;  5H37 D;  2ZAO A;  5A2Q S;  5LMN M;  3JAM S;  1Q3C A;  5EP4 A;  5EXP A;  3U6L A;  4JI7 M;  3HJQ A;  8CAT A;  3HHW A;  5EQT A;  3L26 A;  3K92 A;  3GLI B;  1SXJ E;  1GLN A;  4P16 A;  3A45 A;  3J27 B;  5EJC A;  5ITY A;  1MX0 A;  3MHV C;  3R8F A;  1SXJ A;  2Y20 A;  4NXN M;  3CTW B;  3H4M A;  4LF6 M;  4RF1 A;  1SXJ D;  4LJ8 A;  3FUW A;  1XMO M;  1ZQ9 A;  4LJ5 A;  4D80 A;  4LRS A;  1XC8 A;  4DV5 M;  4D82 A;  1Z6T A;  2Z4S A;  1IY1 A;  3I4Y A;  4B7F A;  1IN4 A;  2XF3 A;  5ITQ A;  4CHT B;  4R3D A;  3TWM A;  4BB9 A;  3T15 A;  1J5E M;  2UUB M;  3GRV A;  3A46 A;  3FYD A;  4OW0 A;  3HHZ A;  2C99 A;  2DWM A;  2C5R A;  2YQZ A;  3D8L A;  3GPP A;  2ZBK B;  3L29 A;  1LV7 A;  4L78 A;  3U61 A;  1KYI A;  1XXH A;  2HHH M;  3FKE A;  1IXS B;  2UXB M;  1G8P A;  3OTO M;  1K82 A;  1IY0 A;  3SAR A;  3FUU A;  4OVZ B;  3UJN A;  1XWI A;  5EXX A;  3SYL A;  2F5N A;  1Q39 A;  3LQR A;  3PFI A;  3AKZ A;  2VQF M;  3QAU A;  1G4A E;  3JR4 A;  2XH9 A;  1OFH A;  4FWG A;  1OJL A;  1N33 M;  1E32 A;  2G5G X;  1YUB A;  3KS8 A;  2KW0 A;  4DR3 M;  4L8R C;  3RE8 A;  4G6Z A;  1NHW C;  3VLF B;  1IQP A;  1UM8 A;  3WHK A;  2CV1 A;  4B3M M;  2H1R A;  4JYA M;  1TGU A;  4IBK A;  4I81 A;  4QHS A;  2DWZ B;  4M9Z A;  3U61 B;  4LF8 M;  5EP3 A;  2Y0Q A;  4IBE A;  3W0F A;  4DR5 M;  4GRI A;  1DGF A;  2NQ8 C;  2KA6 B;  3U6Q A;  4A3V B;  4QNR A;  3U60 A;  4LGM A;  1L2D A;  3IG8 A;  4XBO A;  3HU2 A;  1S3S A;  2VII A;  5IRE B;  4M0W A;  2KRU A;  4L15 A;  5DNY A;  1SXJ B;  5ITR A;  4LJ4 A;  1I4W A;  4IIW A;  1IN8 A;  4LJ7 A;  5E6J A;  3K2L A;  3SAW A;  4LY6 A;  4LF5 M;  3VDP A;  2DVW B;  4IJE A;  2QEN A;  3GQ4 A;  1NY6 A;  4MGH A;  4JI2 M;  1W5S A;  3K1J A;  3KOZ E;  4KO8 A;  3RGP A;  5FTN A;  5KO3 A;  3FD9 A;  3SMS A;  4B08 A;  4IBJ A;  3SAS A;  2J7O A;  2LH0 A;  1JR3 D;  3CF2 A;  3M6A A;  2ZAM A;  4MGK E;  3U6D A;  1J7K A;  5EP2 A;  1L2C A;  3PXG A;  3GO8 A;  3LQQ A;  2XFT A;  2X8A A;  3U60 B;  3U6C A;  2C9O A;  1TH3 A;  3KFU G;  4JI0 M;  2CV0 A;  1Z59 A;  2QCU A;  3BOS A;  2XZU A;  4TUW A;  4AKI A;  4NRW A;  1L2B A;  2BJV A;  4YHH M;  4DV7 M;  4JI1 M;  3VK7 A;  4CGY B;  3U6M A;  4IBI A;  2QPA A;  4GIT A;  3NBI A;  1E9S A;  2BNK A;  3AFH A;  2DWL A;  1PJJ A;  2XSZ D;  1DGH B;  3EIE A;  4QOS A;  4JN6 A;  4NL4 H;  1IY2 A;  3SFZ A;  1XMQ M;  4OX9 M;  1FNN A;  3KVW A;  4AG6 A;  2O5R A;  4FWD A;  2A5Y B;  3T1Y M;  5ITX E;  3HJ8 A;  3UGJ A;  1IM2 A;  3ZCB B;  4AW4 A;  3M0E A;  4GC5 A;  3UK6 A;  4JI4 M;  3MJ5 A;  1C1K A;  2FOI C;  2R4E A;  5FTL A;  3UZU A;  4JI8 M;  2CFO A;  4FCT A;  2L09 A;  3KOX E;  1TH4 A;  3L27 A;  2R62 A;  3TQS A;  3L28 A;  3SAT A;  4LZZ A;  2UXD M;  4QOZ C;  4X64 M;  3DFZ A;  2D7E A;  2K47 A;  4PDI A;  2UUA M;  4AI6 A;  3PVS A;  3TWL A;  3B9P A;  2D7H A;  2XZF A;  3KOY E;  4IBG A;  3AOG A;  4S12 A;  4HL4 A;  4CIS A;  1Z5C A;  1Q3B A;  2LWX A;  3E4R A;  3MK6 A;  3THG A;  2M60 A;  3GQ3 A;  4FCV A;  3D8B A;  1N78 A;  3KP1 E;  4G4Q A;  3U6P A;  1K3W A;  1G3I A;  3U6O A;  2AHM A;  1XXH B;  2R45 A;  4WUR A;  4JXJ A;  1HNX M;  1JQJ C;  3U5Z A;  4BLC A;  1J09 A;  1NNJ A;  1MU5 A;  3DZD A;  4MGZ E;  1R7R A;  4JI5 M;  2FNA A;  4G4R A;  4L4U A;  2CEA A;  2KZS A;  2W82 A;  4DR6 M;  3NWL A;  4IBF A;  4OVZ A;  2KXE A;  1PM5 A;  4NRV A;  4PT5 A;  3GLG A;  1IBK M;  4PDG A;  3SAU A;  4I4L A;  4DV4 M;  1OFI A;  3KXE C;  4LFC M;  1EE8 A;  2C96 A;  4LJA A;  1XNQ M;  1DO0 A;  2EUC A;  5EXS A;  2XEP A;  2G8L A;  4MGY E;  4DV1 M;  3FUT A;  5EP1 A;  5KPZ A;  3SC3 A;  2XGN A;  5FSW A;  4DUY M;  1R6B X;  4GHL A;  2ZAN A;  2D7G A;  4B3T M;  1KSF X;  5ITX A;  2LXE A;  3I51 A;  3GPX A;  4DV0 M;  2RGO A;  3FTD A;  4LF9 M;  3M7G A;  4IBB A;  4WW0 A;  2DZN B;  1H6U A;  2RKO A;  1QAM A;  3LVW A;  4G4N A;  5IT9 S;  3SHG B;  3J7B A;  2F4V M;  3KOW E;  4QHT A;  3GLF B;  2DXI A;  5FTJ A;  4LFA M;  3SYK A;  4IJF A;  4KLN A;  3HKP A;  3KSJ A;  3GPU A;  3U6E A;  3PNV A;  3TL4 X;  4Z8X A;  2L7I A;  3HWS A;  4GH9 A;  4LZJ A;  2F5Q A;  4MH0 E;  1T3T A;  2Z4R A;  2XFS A;  4DV3 M;  4R7G A;  5ITU A;  3QWL A;  4I5S A;  5GKN A;  4RNA A;  3I4V A;  1QYR A;  2I7N A;  4LF7 M;  5JI3 E;  1ZAE A;  2R65 A;  2UUC M;  1N32 M;  1QAN A;  1ORY B;  4LCB A;  4Z6Y A;  4GC9 A;  4ITQ A;  1QAQ A;  3J81 S;  1DGB A;  2R18 A;  4ZPX A;  4NXM M;  1NNU C;  1WXQ A;  3DOA A;  3AL0 C;  3GRU A;  2YFQ A;  1DGH A;  3E9S A;  2XLJ A;  4LG2 A;  4II7 A;  4FWH A;  1SXJ C;  4B3S M;  4DV2 M;  1IXZ A;  3CF0 A;  3AJI B;  4XGI A;  4D81 A;  3GPY A;  3Q8X A;  3K8Z A;  3SMP A;  3ZH9 B;  1NY5 A;  1Z5A A;  4AQY M;  3RFW A;  1HQC A;  5BPV A;  4G4O A;  1N36 M;  2X4A A;  2L6O A;  1VDD A;  4DR4 M;  3ILK A;  4I8O A;  3HU1 A;  1I94 M;  3HJS A;  5FLX S;  3J80 S;  4LFB M;  2DZO B;  3VFD A;  4AKH A;  1HT1 E;  2CE7 A;  2HL7 A;  1HNW M;  1XHB A;  1YSY A;  2DWN A;  1GL7 A;  3KW6 A;  1K3X A;  3HHY A;  1IN7 A;  4MM3 B;  3FUX A;  3TWK A;  3A42 A;  1JR3 A;  3SAV A;  2VQE M;  1HR0 M;  5KPR A;  4LRT A;  1DGG A;  5C1B A;  5FTM A;  4M0D A;  4HLQ A;  3CF6 E;  2C9C A;  3GP1 A;  3GRY A;  4B7G A;  4DR1 M;  2BJW A;  5DYG A;  2YR0 A;  2DHR A;  3PNY A;  3R9X B;  4JV5 M;  1KFV A;  4PCZ A;  3KSX A;  3GLI A;  1NVM A;  3DA1 A;  1E94 E;  3HGI A;  4DV6 M;  4OU7 A;  5F3W A;  3LVV A;  3KP0 E;  4NOO B;  2V1U A;  2HKJ A;  2UXC M;  4DR2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...