1WGLA

Solution structure of cue domain in the c-terminal of human toll-interacting protein (tollip)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSSGSSGCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-interacting protein
publication title Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wglA00
2DAGA 2KNZA 1HT1E 3GLGE 1C7YA 1WGLA 2OOBA 3E46A 2EJSA 2HAKA 2DI0A 2JZ0A 1WJ7A 2ZTCA 4R71A 2LVQD 4F2LA 1VEGA 2LBCA 2K9DA 2LVAA 1BVSA 4HEOA 1OTRA 2CP8A 1G3IA 4GEWA 1HT2E 1XB2B 1KYIA 3BBZA 1VG5A 2DAMA 1DO2A 4DBGB 2LVOC 2EKKA 4G3OA 1GO5A 1VEJA 3IHPA 1VEKA 3K9PA 1WGNA 2LVNC 2JY6B 1QZEA 3E21A 1HJPA 1MN3A 1Y8GA 2HWJA 1ZMVA 3H4JA 1T6OA 4F1IA 1V92A 3FE3A 3FRIA 1ZV1A 2L2DA 1T43A 2B3TA 1UFZA 2JNHA 1OKSA 2KNAA 1OQYA 1F4IA 2ZTDA 5JI2E 2DNAA 2O25A 2K0BX 1DV0A 2MR9A 1E94E 1WIVA 1TTEA 2DAIA 1VDLA 2JP7A 1JR3E 3GLHE 1NV9A 3IECA 1OAIA 2LTUA 2WZJA 1A5TA 2QSFX 1CUKA 1G41A 2JZ1A 1P3QQ 1VQ1A 2OOAA 1IFYA 1EFUB 2DZLA 2JY5A 2JY7A 2DAKA 3MMPA 3LCVB 1NV8A 2RRUA 5DFLA 4WP2A 1HQYE 2KNVA 3T6PA 1YLAA 1ZMUA 1ZMWA 2QHOB 1R4GA 2L4FA 3GLIE 2DKLA 3LCUA 1SG9A 2EKFA 3K9OA 1Q02A 3B89A 3GLFE 1TR8A 1IXSA 2KHHA 3FRHA 4UN2B 1DO0A 2G3QA 1WHCA 2H5XA 2OO9A 3F92A 4Q7JA 1IM2A 1AIPC 2DHYA 2LVPC 2R0IA 2MGWA 2JUJA 2DAEA 1G4AE 2QNJA 2MROB 1XXHE 2DENA 2BWBA 2JY8A 2BWEA 2CWBA 1PGYA 1WR1B 2MJ5B 2L4EA
chains in the Genus database with same CATH superfamily
1GJSA 2DAGA 2QZ4A 1J09A 1HT1E 2ZBKB 4G6ZA 4IBKA 3GLGE 1WGLA 1PJIA 3E46A 4LJAA 1ORYB 3HHZA 1L1TA 2ZM6M 1QUSA 1QQWA 2CHGA 2R4JA 3SBJA 4M0DA 4L8RC 4ITQA 2FE8A 2NQ8C 4F2LA 2C98A 1VEGA 4FWHA 4KLNA 2F5QA 1Q3BA 4DR1M 4GHLA 3CGWA 2L6OA 3AFHA 2XSZD 1KYIA 1VG5A 1DGHB 3SASA 1GABA 4DBGB 3KW6A 4DR5M 3HZJA 4OVZB 3T1HM 5F3WA 2V1UA 1D0LA 2C9CA 4IBCA 4LF6M 4G4NA 2LHCA 4B7FA 3K9PA 2LVNC 3FTDA 2JY6B 3TQSA 1QZEA 3E21A 3HX3A 4NSOB 1MN3A 3CF2A 4X64M 1MU5A 2FH0A 2ZANA 3FTCA 5FLXS 3U6DA 2AHMA 4FVMA 4NSRA 4CIZA 2L2DA 3HU1A 1NNUC 4JI1M 1JQJC 2CHVA 4IBGA 1KSFX 1EIJA 3SHFA 4JI3M 1NNJA 3A46A 1IN7A 5JI3E 3U6EA 3KS8A 2K0BX 4LFCM 1E94E 3GLIA 3I4YA 1TTEA 1IN5A 2G5GX 1NY6A 5H37D 1IBKM 1L2BA 1VDLA 1YUBA 3HGIA 1GL6A 2LHGA 4LZZA 4I81A 1OJLA 2LWXA 3A42A 4W5WA 4D82A 4DR2M 1OAIA 3VKHA 2L7HA 2WZJA 5KPTA 2HCBA 2UXDM 2QSFX 4Z6YA 1N78A 1JB0F 4D81A 1R2YA 4HL4A 3UMMA 3U6OA 1CUKA 1NY5A 3T15A 1XMQM 3KDSE 1VQ1A 3VK8A 2Z4RA 5FSWA 5E26A 2K47A 3FD9A 1T3TA 2Y20A 1GJTA 2DZLA 2HKJA 3U60A 2R6FA 3RFWA 2JY7A 3E9SA 3FKEA 2LNHC 3KP1E 1NV8A 3D8BA 2XGNA 3CTWB 3L28A 3HWSA 4B3SM 2N35A 2QCUA 4CJ6A 1ZMUA 3SC3A 1Q3CA 4S12A 3SMSA 1IY1A 1PJJA 1SG9A 3ZQJA 2XSZA 3HU3A 2QBYB 1PJSA 3B89A 3GLFE 1S3SA 2H1RA 1TR8A 4RF1A 2Q2EB 4QNMA 3B74A 3HJ8A 3GLGB 3ZC7B 2FFJA 4OVZA 3EIEA 4DV7M 4QOZC 2RGHA 2G3QA 5ITYA 2CRUA 3AOGA 4JI7M 2OO9A 3R9XB 3L26A 3LW5F 4LJ8A 3L29A 2BJVA 5EJCA 1QAOA 3GRRA 1XNQM 3LVWA 2MGWA 3Q8GA 3I04M 2LXEA 4BB9A 2JUJA 2QNJA 4II7A 2O01F 2JY8A 3MJ5A 3NBIA 4MGYE 3MHVC 4MB7A 4LF4M 2VQEM 2DVWB 2M5ZA 2I7PA 2BJWA 4LJ4A 4LG2A 2KNZA 1AUAA 1NHGC 3T1YM 1Z6TA 1C7YA 2OOBA 4MGIE 3FUWA 4FCWA 1TH3A 1L2CA 2F5NA 5L8RF 4YY3M 2G8LA 3TWKA 3PFIA 2XEPA 4M9XA 2YQZA 3R8FA 4M9ZA 4Z8XA 3SAWA 4WURA 2O5RA 1BVSA 1TH2A 2D7HA 3AOEC 2FOIC 4DV0M 2RGOA 4JI0M 2CP8A 3SHGB 3JAMS 2D7EA 1K3XA 2L09A 4IIWA 1DO2A 4DR3M 3ILKA 4KO8A 2DWMA 2P5TA 4B3TM 4L4UA 5KPZA 4IBFA 3OTOM 3SARA 4JYAM 4WW0A 3PXGA 2GNOA 3IG8A 3M7GA 3VLFB 3NBXX 2Z8YM 3H4JA 3VDUA 4IJEA 2BNKA 4BBAA 1H6UA 5EXTA 3GQ5A 2WSCF 1ZV1A 1E9SA 4I8OA 2M60A 3CF0A 3KXEC 2Y0QA 3J27B 3WHLA 4LJ9A 3QAUA 1TF0B 2R62A 2ZTDA 2XLJA 3DOAA 3AL0C 5IWAM 4RNAA 3GLHA 5KO3A 4GHAA 3WHKA 2CV1A 2K6BA 3T38A 4EIWA 1IN4A 2C5RA 4FW9A 4M9SA 3GLHE 4AW4A 4JV5M 2FNAA 1NV9A 4QHTA 2KZUA 3IECA 3C3EA 3KSJA 1L1ZA 4GKJM 2R18A 2JWSA 5ITUA 1HR0M 1E9RA 2XZUA 2E5LM 3U6CA 3KSXA 1P3QQ 2OOAA 3IG5A 1IFYA 3W68A 1WXQA 1NVMA 3GLFB 4DV4M 3KOZE 1IQPA 3FTEA 3E4RA 2OPFA 4Y28F 2DAKA 1IBMM 3BOSA 5KQ8A 4FD2A 1D2NA 4R3DA 1TDZA 4GMQA 3LCVB 2RRUA 3FUTA 3C58A 1I94M 1HQYE 2KNVA 1OIZA 2HHHM 1YLAA 1HQCA 1PRBA 2V1CA 3DZDA 4L6V6 1R4GA 3GLIE 4MH0E 3LCUA 1LV7A 5C1BA 2J7NA 5ITRA 1XMOM 5LMNM 4NXMM 1Z59A 2KEBA 3Q8XA 5KPRA 4GRIA 1N34M 3K9OA 2R65A 1Q02A 3U6QA 4JI2M 3AOEA 1SXJC 2UU9M 2Z3XA 1X37A 4BLCA 2KHHA 2R46A 5EXPA 4FWDA 3THGA 4JI5M 4KHPM 4NOOB 1SXJB 3U5ZA 2KW0A 2ZAMA 1N36M 3L27A 2XFSA 3RE8A 3ZCBB 3UJNA 3GP1A 4DR6M 1IM2A 1AIPC 2DHYA 3FUXA 2J5YA 3GRYA 1IXSB 1Z5CA 2UXCM 5ITQA 4NXNM 2CV2A 2UUBM 1QUTA 5DYGA 1G71A 2XZFA 4GITA 4P17A 2HL7A 2BWEA 2CWBA 1PGYA 2CE7A 3NWLA 4LRSA 5EXXA 3U61B 2EA0A 1XXHB 3SATA 4K0KM 1TDHA 3HJSA 4CHTB 5IT9S 1Q39A 2CV0A 2CHQA 2X4AA 4LFAM 4A3VB 2EJSA 4PD2A 3HJQA 2DI0A 1DGHA 2WSFF 4B3MM 1WJ7A 4L16A 3W67A 2DZNB 2JA2A 2VDBB 4R71A 4LGYA 2EO2A 3SFZA 2LVAA 4AG5A 1OTRA 1ZAEA 1XNRM 1NJFA 4B7GA 1G3IA 4LY6A 1XB2B 4B7HA 3B7ZA 1N32M 4CISA 3GRVA 2LVOC 3J7AS 1OFHA 3LQQA 1VEJA 1IBLM 3IHPA 1DGFA 4DV3M 1N33M 1Z5AA 1GKIA 5DNYA 2KDLA 3KOXE 3GPPA 3A45A 2YNMD 4I5SA 4DV1M 1Y8GA 1L2DA 1K82A 4B08A 1T6OA 2JXNA 4F1IA 5IZ7D 3GQ3A 3GQ4A 3QWLA 2F5PA 3D8LA 4AZFA 1KFVA 2B3TA 3B9PA 1UFZA 4XBOA 3J81S 3H4MA 1F4IA 5JI2E 2DNAA 2O25A 1DV0A 1GL7A 2MR9A 4I4LA 4IBEA 3M6AA 1WIVA 4OW0A 1R2ZA 3HKPA 3I51A 3DFZA 3M0EA 5KQDA 4LF7M 1QDRA 1SXJA 5EXSA 1VDDA 2Y0TA 1Z5BA 1J5EM 4JI8M 3HHXA 4HLQA 4AKGA 3K1JA 2LTUA 3GLIB 2R45A 4G4QA 2C99A 3C3DA 2Z7JA 4PT5A 2YR0A 2JZ1A 3V76A 1FJGM 2QENA 3L25A 4XK8F 4DV6M 1IN8A 2FS1A 3KVWA 4LGMA 4REZA 1G59A 2JY5A 2C9OA 4X62M 5ITXA 2CFOA 4JXJA 1XXHA 3K92A 4JN6A 4WP2A 4LF8M 1MX0A 2QBYA 4L78A 1G8PA 3T6PA 1E32A 4MGKE 2GQFA 3GPXA 1ZMWA 3U60B 1QAMA 2QHOB 1ZQ9A 3KOWE 2QQ8A 3TE6A 2L4FA 3VDPA 3GLGA 4IBDA 1NHWC 3I01M 4NRWA 3BXWA 1N75A 1GVNA 1V34A 2DWLA 1D0KA 2KA6B 3KOYE 4RF0A 4LF9M 1R5LA 4LF5M 1NJGA 1J7KA 1EE8A 4GH9A 2KXEA 2UUAM 4ANRA 4XGIA 1RU3A 1JR3D 3TL4X 4OU7A 2QPAA 3JR4A 3HHYA 2VQFM 4CGYB 4DUZM 4RKUF 4UN2B 4IBJA 3ZH9B 4AG6A 4PDGA 3QYBA 4IJFA 4QHSA 3F92A 4Q7JA 4GKKM 4LJ5A 3B7QA 5EP4A 3FYDA 2XFTA 3RGSA 5GKNA 3TWMA 4P16A 4IBBA 3GPYA 2L7IA 2D7GA 3KP0E 2DAEA 1G4AE 1MJGM 3PNYA 4G4OA 2QP9X 2F4VM 1IXZA 1WR1B 3MK6A 4LJ7A 2LH0A 1N77A 3VFDA 1R7RA 4KODA 1L8QA 2WSEF 4AQYM 2VF7A 4G4RA 1IY2A 1IXRC 4QOSA 5EQTA 3UGJA 5EP2A 2HAKA 2Z4SA 4FWGA 1D0MA 2JZ0A 2EUCA 4AKIA 1FNNA 2R44A 2ZTCA 3LMMA 2LVQD 2LBCA 2R4EA 2CUZA 1SXJD 2K9DA 5FTJA 4HEOA 3SAVA 2DHRA 3SAUA 4GEWA 1HT2E 4PCZA 4X65M 1HNXM 3HHWA 3BBZA 3HY5A 3U6LA 1HNWM 4KT0F 2DAMA 3UZUA 3FTFA 4LFBM 1PJTA 4LRTA 1XWIA 3U6MA 2EKKA 4G3OA 1LTMA 4NRVA 4PDIA 1GO5A 5FTLA 1VEKA 4GC5A 4L15A 1QANA 1WGNA 3GRUA 3AJIB 1HJPA 2HWJA 3KS4A 1ZMVA 3DA1A 3B7NA 1PJQA 1V92A 2XF3A 3FE3A 3FRIA 3K2LA 3SYKA 4B3RM 4DV2M 3U6PA 1OFIA 1T43A 3VK7A 2UXBM 3EIHA 1XHBA 1QZMA 2C96A 2JNHA 3SMPA 1OKSA 2CEAA 1QDTA 2KNAA 1UM8A 1OQYA 2ERCA 2V6ZM 5ITTA 2DWZB 1R6BX 1YSYA 4MGZE 1QAQA 1HNZM 1JR3A 2OQ4A 3J2PB 4IBIA 2DAIA 3W0LB 1C1KA 2KRUA 5FTNA 4X66M 3RGPA 2I7NA 1K3WA 2UUCM 4DR7M 3PNVA 5C18A 2JP7A 3FYCA 1JR3E 7CATA 3GLFA 1PM5A 1DGGA 3TPZA 1IY0A 4LJ6A 5A2QS 1QYRA 3QYEA 4QNRA 4R7GA 1A5TA 3GLHB 3VKGA 2DWNA 1IN6A 1GLNA 5E6JA 1G41A 2KZSA 4DV5M 2X8AA 3K8ZA 3JR5A 1EFUB 3FUVA 4GIPA 1TGUA 5EP3A 2DXIA 2ZAOA 4DR4M 3SYLA 5IREB 3MMPA 5LMUM 3AKZA 2Y21A 3I4VA 5DFLA 5FTMA 4FCTA 4AKHA 2VIIA 1XC8A 1DGBA 5FTKA 3TWLA 4JI6M 1OAOC 3L2AA 3AV0A 3GPUA 1YE9A 2XH9A 4ZPXA 3LQRA 1TH4A 3W0FA 2DKLA 3UK6A 3A98B 5EP1A 4OX9M 2YFQA 1NO1A 3HU2A 2F5OA 2DZOB 4D80A 1W5TA 3LVVA 2EKFA 1SXJE 4LZJA 4MGHA 8CATA 1OIPA 1IXSA 4NL4H 4MM3B 2APLA 4YHHM 4AI6A 2X49A 3FRHA 1QVRA 3U6SA 3KFUG 1DO0A 2RKOA 4DUYM 4TUWA 3FUUA 1V33A 3J7BA 2VF8A 4M0WA 1WHCA 2H5XA 4JI4M 2A5YB 3C9PA 3U61A 2J7OA 3J80S 1NSFA 2LVPC 2R0IA 2W82A 4GC9A 3U5ZB 3GO8A 2KRKA 4LCBA 5ITXE 4FCVA 2MROB 4NC6A 1XXHE 2DENA 2BWBA 1I4WA 5DYIA 5BPVA 5BR8M 2F5SA 1W5SA 3CF6E 2MJ5B 3PVSA 2MH8A 2L4EA
chains in the Genus database with same CATH topology
2DAGA 2KNZA 1HT1E 3GLGE 1C7YA 1WGLA 2OOBA 3E46A 2EJSA 2HAKA 2DI0A 2JZ0A 1WJ7A 2ZTCA 4R71A 2LVQD 4F2LA 1VEGA 2LBCA 2K9DA 2LVAA 1BVSA 4HEOA 1OTRA 2CP8A 1G3IA 4GEWA 1HT2E 1XB2B 1KYIA 3BBZA 1VG5A 2DAMA 1DO2A 4DBGB 2LVOC 2EKKA 4G3OA 1GO5A 1VEJA 3IHPA 1VEKA 3K9PA 1WGNA 2LVNC 2JY6B 1QZEA 3E21A 1HJPA 1MN3A 1Y8GA 2HWJA 1ZMVA 3H4JA 1T6OA 4F1IA 1V92A 3FE3A 3FRIA 1ZV1A 2L2DA 1T43A 2B3TA 1UFZA 2JNHA 1OKSA 2KNAA 1OQYA 1F4IA 2ZTDA 5JI2E 2DNAA 2O25A 2K0BX 1DV0A 2MR9A 1E94E 1WIVA 1TTEA 2DAIA 1VDLA 2JP7A 1JR3E 3GLHE 1NV9A 3IECA 1OAIA 2LTUA 2WZJA 1A5TA 2QSFX 1CUKA 1G41A 2JZ1A 1P3QQ 1VQ1A 2OOAA 1IFYA 1EFUB 2DZLA 2JY5A 2JY7A 2DAKA 3MMPA 3LCVB 1NV8A 2RRUA 5DFLA 4WP2A 1HQYE 2KNVA 3T6PA 1YLAA 1ZMUA 1ZMWA 2QHOB 1R4GA 2L4FA 3GLIE 2DKLA 3LCUA 1SG9A 2EKFA 3K9OA 1Q02A 3B89A 3GLFE 1TR8A 1IXSA 2KHHA 3FRHA 4UN2B 1DO0A 2G3QA 1WHCA 2H5XA 2OO9A 3F92A 4Q7JA 1IM2A 1AIPC 2DHYA 2LVPC 2R0IA 2MGWA 2JUJA 2DAEA 1G4AE 2QNJA 2MROB 1XXHE 2DENA 2BWBA 2JY8A 2BWEA 2CWBA 1PGYA 1WR1B 2MJ5B 2L4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAG A;  2KNZ A;  1HT1 E;  3GLG E;  1C7Y A;  1WGL A;  2OOB A;  3E46 A;  2EJS A;  2HAK A;  2DI0 A;  2JZ0 A;  1WJ7 A;  2ZTC A;  4R71 A;  2LVQ D;  4F2L A;  1VEG A;  2LBC A;  2K9D A;  2LVA A;  1BVS A;  4HEO A;  1OTR A;  2CP8 A;  1G3I A;  4GEW A;  1HT2 E;  1XB2 B;  1KYI A;  3BBZ A;  1VG5 A;  2DAM A;  1DO2 A;  4DBG B;  2LVO C;  2EKK A;  4G3O A;  1GO5 A;  1VEJ A;  3IHP A;  1VEK A;  3K9P A;  1WGN A;  2LVN C;  2JY6 B;  1QZE A;  3E21 A;  1HJP A;  1MN3 A;  1Y8G A;  2HWJ A;  1ZMV A;  3H4J A;  1T6O A;  4F1I A;  1V92 A;  3FE3 A;  3FRI A;  1ZV1 A;  2L2D A;  1T43 A;  2B3T A;  1UFZ A;  2JNH A;  1OKS A;  2KNA A;  1OQY A;  1F4I A;  2ZTD A;  5JI2 E;  2DNA A;  2O25 A;  2K0B X;  1DV0 A;  2MR9 A;  1E94 E;  1WIV A;  1TTE A;  2DAI A;  1VDL A;  2JP7 A;  1JR3 E;  3GLH E;  1NV9 A;  3IEC A;  1OAI A;  2LTU A;  2WZJ A;  1A5T A;  2QSF X;  1CUK A;  1G41 A;  2JZ1 A;  1P3Q Q;  1VQ1 A;  2OOA A;  1IFY A;  1EFU B;  2DZL A;  2JY5 A;  2JY7 A;  2DAK A;  3MMP A;  3LCV B;  1NV8 A;  2RRU A;  5DFL A;  4WP2 A;  1HQY E;  2KNV A;  3T6P A;  1YLA A;  1ZMU A;  1ZMW A;  2QHO B;  1R4G A;  2L4F A;  3GLI E;  2DKL A;  3LCU A;  1SG9 A;  2EKF A;  3K9O A;  1Q02 A;  3B89 A;  3GLF E;  1TR8 A;  1IXS A;  2KHH A;  3FRH A;  4UN2 B;  1DO0 A;  2G3Q A;  1WHC A;  2H5X A;  2OO9 A;  3F92 A;  4Q7J A;  1IM2 A;  1AIP C;  2DHY A;  2LVP C;  2R0I A;  2MGW A;  2JUJ A;  2DAE A;  1G4A E;  2QNJ A;  2MRO B;  1XXH E;  2DEN A;  2BWB A;  2JY8 A;  2BWE A;  2CWB A;  1PGY A;  1WR1 B;  2MJ5 B;  2L4E A; 
#chains in the Genus database with same CATH topology
 1GJS A;  2DAG A;  2QZ4 A;  1J09 A;  1HT1 E;  2ZBK B;  4G6Z A;  4IBK A;  3GLG E;  1WGL A;  1PJI A;  3E46 A;  4LJA A;  1ORY B;  3HHZ A;  1L1T A;  2ZM6 M;  1QUS A;  1QQW A;  2CHG A;  2R4J A;  3SBJ A;  4M0D A;  4L8R C;  4ITQ A;  2FE8 A;  2NQ8 C;  4F2L A;  2C98 A;  1VEG A;  4FWH A;  4KLN A;  2F5Q A;  1Q3B A;  4DR1 M;  4GHL A;  3CGW A;  2L6O A;  3AFH A;  2XSZ D;  1KYI A;  1VG5 A;  1DGH B;  3SAS A;  1GAB A;  4DBG B;  3KW6 A;  4DR5 M;  3HZJ A;  4OVZ B;  3T1H M;  5F3W A;  2V1U A;  1D0L A;  2C9C A;  4IBC A;  4LF6 M;  4G4N A;  2LHC A;  4B7F A;  3K9P A;  2LVN C;  3FTD A;  2JY6 B;  3TQS A;  1QZE A;  3E21 A;  3HX3 A;  4NSO B;  1MN3 A;  3CF2 A;  4X64 M;  1MU5 A;  2FH0 A;  2ZAN A;  3FTC A;  5FLX S;  3U6D A;  2AHM A;  4FVM A;  4NSR A;  4CIZ A;  2L2D A;  3HU1 A;  1NNU C;  4JI1 M;  1JQJ C;  2CHV A;  4IBG A;  1KSF X;  1EIJ A;  3SHF A;  4JI3 M;  1NNJ A;  3A46 A;  1IN7 A;  5JI3 E;  3U6E A;  3KS8 A;  2K0B X;  4LFC M;  1E94 E;  3GLI A;  3I4Y A;  1TTE A;  1IN5 A;  2G5G X;  1NY6 A;  5H37 D;  1IBK M;  1L2B A;  1VDL A;  1YUB A;  3HGI A;  1GL6 A;  2LHG A;  4LZZ A;  4I81 A;  1OJL A;  2LWX A;  3A42 A;  4W5W A;  4D82 A;  4DR2 M;  1OAI A;  3VKH A;  2L7H A;  2WZJ A;  5KPT A;  2HCB A;  2UXD M;  2QSF X;  4Z6Y A;  1N78 A;  1JB0 F;  4D81 A;  1R2Y A;  4HL4 A;  3UMM A;  3U6O A;  1CUK A;  1NY5 A;  3T15 A;  1XMQ M;  3KDS E;  1VQ1 A;  3VK8 A;  2Z4R A;  5FSW A;  5E26 A;  2K47 A;  3FD9 A;  1T3T A;  2Y20 A;  1GJT A;  2DZL A;  2HKJ A;  3U60 A;  2R6F A;  3RFW A;  2JY7 A;  3E9S A;  3FKE A;  2LNH C;  3KP1 E;  1NV8 A;  3D8B A;  2XGN A;  3CTW B;  3L28 A;  3HWS A;  4B3S M;  2N35 A;  2QCU A;  4CJ6 A;  1ZMU A;  3SC3 A;  1Q3C A;  4S12 A;  3SMS A;  1IY1 A;  1PJJ A;  1SG9 A;  3ZQJ A;  2XSZ A;  3HU3 A;  2QBY B;  1PJS A;  3B89 A;  3GLF E;  1S3S A;  2H1R A;  1TR8 A;  4RF1 A;  2Q2E B;  4QNM A;  3B74 A;  3HJ8 A;  3GLG B;  3ZC7 B;  2FFJ A;  4OVZ A;  3EIE A;  4DV7 M;  4QOZ C;  2RGH A;  2G3Q A;  5ITY A;  2CRU A;  3AOG A;  4JI7 M;  2OO9 A;  3R9X B;  3L26 A;  3LW5 F;  4LJ8 A;  3L29 A;  2BJV A;  5EJC A;  1QAO A;  3GRR A;  1XNQ M;  3LVW A;  2MGW A;  3Q8G A;  3I04 M;  2LXE A;  4BB9 A;  2JUJ A;  2QNJ A;  4II7 A;  2O01 F;  2JY8 A;  3MJ5 A;  3NBI A;  4MGY E;  3MHV C;  4MB7 A;  4LF4 M;  2VQE M;  2DVW B;  2M5Z A;  2I7P A;  2BJW A;  4LJ4 A;  4LG2 A;  2KNZ A;  1AUA A;  1NHG C;  3T1Y M;  1Z6T A;  1C7Y A;  2OOB A;  4MGI E;  3FUW A;  4FCW A;  1TH3 A;  1L2C A;  2F5N A;  5L8R F;  4YY3 M;  2G8L A;  3TWK A;  3PFI A;  2XEP A;  4M9X A;  2YQZ A;  3R8F A;  4M9Z A;  4Z8X A;  3SAW A;  4WUR A;  2O5R A;  1BVS A;  1TH2 A;  2D7H A;  3AOE C;  2FOI C;  4DV0 M;  2RGO A;  4JI0 M;  2CP8 A;  3SHG B;  3JAM S;  2D7E A;  1K3X A;  2L09 A;  4IIW A;  1DO2 A;  4DR3 M;  3ILK A;  4KO8 A;  2DWM A;  2P5T A;  4B3T M;  4L4U A;  5KPZ A;  4IBF A;  3OTO M;  3SAR A;  4JYA M;  4WW0 A;  3PXG A;  2GNO A;  3IG8 A;  3M7G A;  3VLF B;  3NBX X;  2Z8Y M;  3H4J A;  3VDU A;  4IJE A;  2BNK A;  4BBA A;  1H6U A;  5EXT A;  3GQ5 A;  2WSC F;  1ZV1 A;  1E9S A;  4I8O A;  2M60 A;  3CF0 A;  3KXE C;  2Y0Q A;  3J27 B;  3WHL A;  4LJ9 A;  3QAU A;  1TF0 B;  2R62 A;  2ZTD A;  2XLJ A;  3DOA A;  3AL0 C;  5IWA M;  4RNA A;  3GLH A;  5KO3 A;  4GHA A;  3WHK A;  2CV1 A;  2K6B A;  3T38 A;  4EIW A;  1IN4 A;  2C5R A;  4FW9 A;  4M9S A;  3GLH E;  4AW4 A;  4JV5 M;  2FNA A;  1NV9 A;  4QHT A;  2KZU A;  3IEC A;  3C3E A;  3KSJ A;  1L1Z A;  4GKJ M;  2R18 A;  2JWS A;  5ITU A;  1HR0 M;  1E9R A;  2XZU A;  2E5L M;  3U6C A;  3KSX A;  1P3Q Q;  2OOA A;  3IG5 A;  1IFY A;  3W68 A;  1WXQ A;  1NVM A;  3GLF B;  4DV4 M;  3KOZ E;  1IQP A;  3FTE A;  3E4R A;  2OPF A;  4Y28 F;  2DAK A;  1IBM M;  3BOS A;  5KQ8 A;  4FD2 A;  1D2N A;  4R3D A;  1TDZ A;  4GMQ A;  3LCV B;  2RRU A;  3FUT A;  3C58 A;  1I94 M;  1HQY E;  2KNV A;  1OIZ A;  2HHH M;  1YLA A;  1HQC A;  1PRB A;  2V1C A;  3DZD A;  4L6V 6;  1R4G A;  3GLI E;  4MH0 E;  3LCU A;  1LV7 A;  5C1B A;  2J7N A;  5ITR A;  1XMO M;  5LMN M;  4NXM M;  1Z59 A;  2KEB A;  3Q8X A;  5KPR A;  4GRI A;  1N34 M;  3K9O A;  2R65 A;  1Q02 A;  3U6Q A;  4JI2 M;  3AOE A;  1SXJ C;  2UU9 M;  2Z3X A;  1X37 A;  4BLC A;  2KHH A;  2R46 A;  5EXP A;  4FWD A;  3THG A;  4JI5 M;  4KHP M;  4NOO B;  1SXJ B;  3U5Z A;  2KW0 A;  2ZAM A;  1N36 M;  3L27 A;  2XFS A;  3RE8 A;  3ZCB B;  3UJN A;  3GP1 A;  4DR6 M;  1IM2 A;  1AIP C;  2DHY A;  3FUX A;  2J5Y A;  3GRY A;  1IXS B;  1Z5C A;  2UXC M;  5ITQ A;  4NXN M;  2CV2 A;  2UUB M;  1QUT A;  5DYG A;  1G71 A;  2XZF A;  4GIT A;  4P17 A;  2HL7 A;  2BWE A;  2CWB A;  1PGY A;  2CE7 A;  3NWL A;  4LRS A;  5EXX A;  3U61 B;  2EA0 A;  1XXH B;  3SAT A;  4K0K M;  1TDH A;  3HJS A;  4CHT B;  5IT9 S;  1Q39 A;  2CV0 A;  2CHQ A;  2X4A A;  4LFA M;  4A3V B;  2EJS A;  4PD2 A;  3HJQ A;  2DI0 A;  1DGH A;  2WSF F;  4B3M M;  1WJ7 A;  4L16 A;  3W67 A;  2DZN B;  2JA2 A;  2VDB B;  4R71 A;  4LGY A;  2EO2 A;  3SFZ A;  2LVA A;  4AG5 A;  1OTR A;  1ZAE A;  1XNR M;  1NJF A;  4B7G A;  1G3I A;  4LY6 A;  1XB2 B;  4B7H A;  3B7Z A;  1N32 M;  4CIS A;  3GRV A;  2LVO C;  3J7A S;  1OFH A;  3LQQ A;  1VEJ A;  1IBL M;  3IHP A;  1DGF A;  4DV3 M;  1N33 M;  1Z5A A;  1GKI A;  5DNY A;  2KDL A;  3KOX E;  3GPP A;  3A45 A;  2YNM D;  4I5S A;  4DV1 M;  1Y8G A;  1L2D A;  1K82 A;  4B08 A;  1T6O A;  2JXN A;  4F1I A;  5IZ7 D;  3GQ3 A;  3GQ4 A;  3QWL A;  2F5P A;  3D8L A;  4AZF A;  1KFV A;  2B3T A;  3B9P A;  1UFZ A;  4XBO A;  3J81 S;  3H4M A;  1F4I A;  5JI2 E;  2DNA A;  2O25 A;  1DV0 A;  1GL7 A;  2MR9 A;  4I4L A;  4IBE A;  3M6A A;  1WIV A;  4OW0 A;  1R2Z A;  3HKP A;  3I51 A;  3DFZ A;  3M0E A;  5KQD A;  4LF7 M;  1QDR A;  1SXJ A;  5EXS A;  1VDD A;  2Y0T A;  1Z5B A;  1J5E M;  4JI8 M;  3HHX A;  4HLQ A;  4AKG A;  3K1J A;  2LTU A;  3GLI B;  2R45 A;  4G4Q A;  2C99 A;  3C3D A;  2Z7J A;  4PT5 A;  2YR0 A;  2JZ1 A;  3V76 A;  1FJG M;  2QEN A;  3L25 A;  4XK8 F;  4DV6 M;  1IN8 A;  2FS1 A;  3KVW A;  4LGM A;  4REZ A;  1G59 A;  2JY5 A;  2C9O A;  4X62 M;  5ITX A;  2CFO A;  4JXJ A;  1XXH A;  3K92 A;  4JN6 A;  4WP2 A;  4LF8 M;  1MX0 A;  2QBY A;  4L78 A;  1G8P A;  3T6P A;  1E32 A;  4MGK E;  2GQF A;  3GPX A;  1ZMW A;  3U60 B;  1QAM A;  2QHO B;  1ZQ9 A;  3KOW E;  2QQ8 A;  3TE6 A;  2L4F A;  3VDP A;  3GLG A;  4IBD A;  1NHW C;  3I01 M;  4NRW A;  3BXW A;  1N75 A;  1GVN A;  1V34 A;  2DWL A;  1D0K A;  2KA6 B;  3KOY E;  4RF0 A;  4LF9 M;  1R5L A;  4LF5 M;  1NJG A;  1J7K A;  1EE8 A;  4GH9 A;  2KXE A;  2UUA M;  4ANR A;  4XGI A;  1RU3 A;  1JR3 D;  3TL4 X;  4OU7 A;  2QPA A;  3JR4 A;  3HHY A;  2VQF M;  4CGY B;  4DUZ M;  4RKU F;  4UN2 B;  4IBJ A;  3ZH9 B;  4AG6 A;  4PDG A;  3QYB A;  4IJF A;  4QHS A;  3F92 A;  4Q7J A;  4GKK M;  4LJ5 A;  3B7Q A;  5EP4 A;  3FYD A;  2XFT A;  3RGS A;  5GKN A;  3TWM A;  4P16 A;  4IBB A;  3GPY A;  2L7I A;  2D7G A;  3KP0 E;  2DAE A;  1G4A E;  1MJG M;  3PNY A;  4G4O A;  2QP9 X;  2F4V M;  1IXZ A;  1WR1 B;  3MK6 A;  4LJ7 A;  2LH0 A;  1N77 A;  3VFD A;  1R7R A;  4KOD A;  1L8Q A;  2WSE F;  4AQY M;  2VF7 A;  4G4R A;  1IY2 A;  1IXR C;  4QOS A;  5EQT A;  3UGJ A;  5EP2 A;  2HAK A;  2Z4S A;  4FWG A;  1D0M A;  2JZ0 A;  2EUC A;  4AKI A;  1FNN A;  2R44 A;  2ZTC A;  3LMM A;  2LVQ D;  2LBC A;  2R4E A;  2CUZ A;  1SXJ D;  2K9D A;  5FTJ A;  4HEO A;  3SAV A;  2DHR A;  3SAU A;  4GEW A;  1HT2 E;  4PCZ A;  4X65 M;  1HNX M;  3HHW A;  3BBZ A;  3HY5 A;  3U6L A;  1HNW M;  4KT0 F;  2DAM A;  3UZU A;  3FTF A;  4LFB M;  1PJT A;  4LRT A;  1XWI A;  3U6M A;  2EKK A;  4G3O A;  1LTM A;  4NRV A;  4PDI A;  1GO5 A;  5FTL A;  1VEK A;  4GC5 A;  4L15 A;  1QAN A;  1WGN A;  3GRU A;  3AJI B;  1HJP A;  2HWJ A;  3KS4 A;  1ZMV A;  3DA1 A;  3B7N A;  1PJQ A;  1V92 A;  2XF3 A;  3FE3 A;  3FRI A;  3K2L A;  3SYK A;  4B3R M;  4DV2 M;  3U6P A;  1OFI A;  1T43 A;  3VK7 A;  2UXB M;  3EIH A;  1XHB A;  1QZM A;  2C96 A;  2JNH A;  3SMP A;  1OKS A;  2CEA A;  1QDT A;  2KNA A;  1UM8 A;  1OQY A;  2ERC A;  2V6Z M;  5ITT A;  2DWZ B;  1R6B X;  1YSY A;  4MGZ E;  1QAQ A;  1HNZ M;  1JR3 A;  2OQ4 A;  3J2P B;  4IBI A;  2DAI A;  3W0L B;  1C1K A;  2KRU A;  5FTN A;  4X66 M;  3RGP A;  2I7N A;  1K3W A;  2UUC M;  4DR7 M;  3PNV A;  5C18 A;  2JP7 A;  3FYC A;  1JR3 E;  7CAT A;  3GLF A;  1PM5 A;  1DGG A;  3TPZ A;  1IY0 A;  4LJ6 A;  5A2Q S;  1QYR A;  3QYE A;  4QNR A;  4R7G A;  1A5T A;  3GLH B;  3VKG A;  2DWN A;  1IN6 A;  1GLN A;  5E6J A;  1G41 A;  2KZS A;  4DV5 M;  2X8A A;  3K8Z A;  3JR5 A;  1EFU B;  3FUV A;  4GIP A;  1TGU A;  5EP3 A;  2DXI A;  2ZAO A;  4DR4 M;  3SYL A;  5IRE B;  3MMP A;  5LMU M;  3AKZ A;  2Y21 A;  3I4V A;  5DFL A;  5FTM A;  4FCT A;  4AKH A;  2VII A;  1XC8 A;  1DGB A;  5FTK A;  3TWL A;  4JI6 M;  1OAO C;  3L2A A;  3AV0 A;  3GPU A;  1YE9 A;  2XH9 A;  4ZPX A;  3LQR A;  1TH4 A;  3W0F A;  2DKL A;  3UK6 A;  3A98 B;  5EP1 A;  4OX9 M;  2YFQ A;  1NO1 A;  3HU2 A;  2F5O A;  2DZO B;  4D80 A;  1W5T A;  3LVV A;  2EKF A;  1SXJ E;  4LZJ A;  4MGH A;  8CAT A;  1OIP A;  1IXS A;  4NL4 H;  4MM3 B;  2APL A;  4YHH M;  4AI6 A;  2X49 A;  3FRH A;  1QVR A;  3U6S A;  3KFU G;  1DO0 A;  2RKO A;  4DUY M;  4TUW A;  3FUU A;  1V33 A;  3J7B A;  2VF8 A;  4M0W A;  1WHC A;  2H5X A;  4JI4 M;  2A5Y B;  3C9P A;  3U61 A;  2J7O A;  3J80 S;  1NSF A;  2LVP C;  2R0I A;  2W82 A;  4GC9 A;  3U5Z B;  3GO8 A;  2KRK A;  4LCB A;  5ITX E;  4FCV A;  2MRO B;  4NC6 A;  1XXH E;  2DEN A;  2BWB A;  1I4W A;  5DYI A;  5BPV A;  5BR8 M;  2F5S A;  1W5S A;  3CF6 E;  2MJ5 B;  3PVS A;  2MH8 A;  2L4E A; 
#chains in the Genus database with same CATH homology
 2DAG A;  2KNZ A;  1HT1 E;  3GLG E;  1C7Y A;  1WGL A;  2OOB A;  3E46 A;  2EJS A;  2HAK A;  2DI0 A;  2JZ0 A;  1WJ7 A;  2ZTC A;  4R71 A;  2LVQ D;  4F2L A;  1VEG A;  2LBC A;  2K9D A;  2LVA A;  1BVS A;  4HEO A;  1OTR A;  2CP8 A;  1G3I A;  4GEW A;  1HT2 E;  1XB2 B;  1KYI A;  3BBZ A;  1VG5 A;  2DAM A;  1DO2 A;  4DBG B;  2LVO C;  2EKK A;  4G3O A;  1GO5 A;  1VEJ A;  3IHP A;  1VEK A;  3K9P A;  1WGN A;  2LVN C;  2JY6 B;  1QZE A;  3E21 A;  1HJP A;  1MN3 A;  1Y8G A;  2HWJ A;  1ZMV A;  3H4J A;  1T6O A;  4F1I A;  1V92 A;  3FE3 A;  3FRI A;  1ZV1 A;  2L2D A;  1T43 A;  2B3T A;  1UFZ A;  2JNH A;  1OKS A;  2KNA A;  1OQY A;  1F4I A;  2ZTD A;  5JI2 E;  2DNA A;  2O25 A;  2K0B X;  1DV0 A;  2MR9 A;  1E94 E;  1WIV A;  1TTE A;  2DAI A;  1VDL A;  2JP7 A;  1JR3 E;  3GLH E;  1NV9 A;  3IEC A;  1OAI A;  2LTU A;  2WZJ A;  1A5T A;  2QSF X;  1CUK A;  1G41 A;  2JZ1 A;  1P3Q Q;  1VQ1 A;  2OOA A;  1IFY A;  1EFU B;  2DZL A;  2JY5 A;  2JY7 A;  2DAK A;  3MMP A;  3LCV B;  1NV8 A;  2RRU A;  5DFL A;  4WP2 A;  1HQY E;  2KNV A;  3T6P A;  1YLA A;  1ZMU A;  1ZMW A;  2QHO B;  1R4G A;  2L4F A;  3GLI E;  2DKL A;  3LCU A;  1SG9 A;  2EKF A;  3K9O A;  1Q02 A;  3B89 A;  3GLF E;  1TR8 A;  1IXS A;  2KHH A;  3FRH A;  4UN2 B;  1DO0 A;  2G3Q A;  1WHC A;  2H5X A;  2OO9 A;  3F92 A;  4Q7J A;  1IM2 A;  1AIP C;  2DHY A;  2LVP C;  2R0I A;  2MGW A;  2JUJ A;  2DAE A;  1G4A E;  2QNJ A;  2MRO B;  1XXH E;  2DEN A;  2BWB A;  2JY8 A;  2BWE A;  2CWB A;  1PGY A;  1WR1 B;  2MJ5 B;  2L4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...