1WGLA

Solution structure of cue domain in the c-terminal of human toll-interacting protein (tollip)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'GSSGSSGCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-interacting protein
publication title Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wglA00
3H4JA 2MGWA 2HAKA 2ZTCA 2ZTDA 1WHCA 1YLAA 2EJSA 1Y8GA 2HWJA 2LTUA 4R71A 3E21A 2EKFA 2BWEA 3B89A 1EFUB 2BWBA 2OOBA 2DZLA 2H5XA 1HT2E 1PGYA 2L2DA 3LCVB 2JZ1A 1NV9A 1CUKA 2OOAA 3F92A 1NV8A 3K9OA 2QNJA 1HQYE 2RRUA 2KHHA 4F1IA 4HEOA 1IM2A 2DAMA 1OQYA 2LVPC 2KNZA 2DAGA 4Q7JA 1KYIA 3IECA 1DO2A 2QHOB 3E46A 1XB2B 1SG9A 1WJ7A 1OAIA 3FRHA 3IHPA 2K0BX 1TTEA 2DAIA 1IXSA 2LVOC 1WR1B 2EKKA 3T6PA 3GLHE 1T43A 4WP2A 1AIPC 1E94E 1T6OA 1IFYA 1UFZA 2R0IA 2LVAA 1ZMWA 2OO9A 2QSFX 4GEWA 1F4IA 1DV0A 1DO0A 2JY8A 2DENA 2L4EA 1C7YA 1JR3E 2CP8A 1VEJA 2KNAA 3GLFE 2DI0A 2DAEA 5DFLA 3BBZA 2L4FA 2CWBA 1ZV1A 2LVNC 2LVQD 1OKSA 2MROB 1R4GA 2G3QA 4DBGB 1HT1E 2DAKA 2DNAA 3K9PA 3GLIE 2MR9A 2DKLA 1G41A 2MJ5B 3FE3A 1QZEA 1VEKA 5JI2E 2O25A 2KNVA 1GO5A 1OTRA 2DHYA 1P3QQ 2WZJA 1WGNA 4UN2B 3MMPA 2JUJA 1BVSA 2LBCA 1TR8A 1G3IA 1HJPA 1XXHE 3GLGE 2JY6B 1MN3A 1WIVA 1WGLA 4F2LA 2JY7A 2K9DA 1A5TA 1Q02A 4G3OA 1VG5A 1V92A 1ZMUA 2JNHA 1VDLA 1ZMVA 1VEGA 2JZ0A 3LCUA 1G4AE 2JY5A 2B3TA 3FRIA 2JP7A 1VQ1A
chains in the Genus database with same CATH superfamily
2MGWA 3U6EA 1NJGA 4QNMA 4JI3M 3SHFA 4DV3M 1NY6A 3FTFA 1TF0B 1GJSA 1Y8GA 2HWJA 2L7IA 1L2CA 2HCBA 2EKFA 2JXNA 3CF2A 3ZQJA 2VIIA 3U6QA 1XMOM 1N32M 3B89A 1XHBA 3VDPA 1OFIA 1EFUB 2OOBA 3QWLA 1TDHA 1XXHA 4BLCA 4X62M 3GQ5A 7CATA 5FLXS 5E26A 1QAQA 5FSWA 2H5XA 1G71A 3GRVA 3K92A 1SXJB 3GLFA 5F3WA 1PRBA 3UK6A 4JI5M 1HNWM 1N33M 4LRSA 1HNZM 3SFZA 1NV9A 3THGA 3KOZE 2MH8A 2OOAA 5EQTA 3SYKA 1L1ZA 1K82A 3MJ5A 2F4VM 1IM2A 1D2NA 2VDBB 1OQYA 4AKIA 3HZJA 2Z7JA 3I51A 3HHZA 4DR4M 2CV1A 3HWSA 3LVWA 2DAGA 4FVMA 1ORYB 4KT0F 1IXRC 3J7BA 3U60B 2F5SA 2J7NA 1SXJD 4P16A 1OAIA 2Y0TA 3R8FA 2LNHC 2CRUA 4FWGA 3SMPA 3RGPA 4JI8M 2K0BX 4YHHM 2E5LM 2DAIA 1R6BX 3HHWA 4KO8A 1OFHA 2XFTA 2Z8YM 4FCWA 1T43A 2DWLA 4AI6A 5EJCA 3B7NA 1E94E 2OPFA 3SATA 4ANRA 2R0IA 1OIPA 2LVAA 4YY3M 1ZMWA 1QUTA 4IJFA 3DZDA 2DZOB 2ZAMA 5EXSA 3M0EA 3B7ZA 1Z6TA 3GLFE 2Y0QA 3M7GA 4G4NA 4B08A 1R7RA 1NHGC 4JV5M 2CE7A 1JQJC 2FNAA 3J27B 3T15A 3CF0A 3TL4X 4TUWA 1GKIA 2M5ZA 3FTDA 5L8RF 3NWLA 4DBGB 4G4RA 3KDSE 3K9PA 1SXJE 3UGJA 1TGUA 3W68A 1G41A 3I01M 2VF8A 4NSRA 3U6MA 5DNYA 1PJTA 3GQ3A 5JI2E 2XZUA 2KNVA 4KHPM 1GO5A 4L4UA 5EP2A 1P3QQ 2WZJA 2R65A 3HU2A 1QDTA 4UN2B 4Z8XA 3HGIA 3ZCBB 2UU9M 2LBCA 4FWDA 1IN8A 2EO2A 3D8BA 1G3IA 4LF7M 3T38A 4LF4M 3EIHA 2JY6B 1QAOA 2J7OA 1MN3A 1WIVA 2C99A 1QUSA 2W82A 2OQ4A 4F2LA 2CHQA 1HQCA 2VQFM 4REZA 1JR3A 3KP1E 4M0DA 2DXIA 1A5TA 2FOIC 1Q02A 4G3OA 4LJ6A 3TPZA 3UMMA 4JI0M 4KLNA 1I4WA 4PDIA 4DUZM 4G4QA 1ZMUA 2JNHA 1VDLA 1ZMVA 3KOWE 4IBEA 3LCUA 3PXGA 4M0WA 5BPVA 5FTKA 2JY5A 1NVMA 1PJSA 3FRIA 5C18A 3H4MA 3HJ8A 1VDDA 4LFAM 3A45A 2GQFA 2HL7A 2VF7A 4LGYA 3GLHA 2KA6B 3KVWA 2BJWA 1HNXM 2ZANA 4JN6A 4LZZA 4GHLA 3B7QA 2EJSA 2F5PA 4R71A 4B3MM 3E21A 2J5YA 1QAMA 4MH0E 2V1UA 2KRKA 2QP9X 2JWSA 4CHTB 2Y21A 2BWBA 4B3SM 1KFVA 3GLGA 3KFUG 2DWMA 2DZLA 4NOOB 1PGYA 2L09A 2L2DA 5EXXA 2JZ1A 4MM3B 5BR8M 1S3SA 3DA1A 3T1YM 1N75A 2L7HA 3GO8A 3TWKA 3FYCA 4I81A 3LW5F 2BJVA 4HEOA 2R4EA 2DAMA 1XXHB 1DGGA 5KPRA 1J5EM 4GITA 2DZNB 1D0KA 2QENA 5JI3E 1NNJA 3B74A 1PJQA 2X49A 3GLFB 1IY2A 2CFOA 3HU1A 2KNZA 2LH0A 3C3DA 3KOXE 4HL4A 1UM8A 4Q7JA 1KYIA 2EUCA 3SC3A 5KPTA 1DO2A 2QHOB 3U6LA 4FCVA 5EP4A 5ITXA 5ITTA 3NBIA 2JA2A 3T1HM 4WURA 4CISA 3AL0C 1IBLM 4QOZC 2GNOA 3FTEA 4JI2M 3IHPA 4AKHA 3Q8XA 4AG5A 5IWAM 2D7GA 2RGHA 3L26A 1Z5AA 1V34A 4L15A 4JXJA 1XWIA 3FUXA 3TWLA 3GLHE 2H1RA 4GH9A 4WP2A 3SYLA 2NQ8C 4D81A 1AIPC 2ZBKB 1AUAA 3TE6A 1J09A 4DV2M 3FUTA 3ILKA 4AW4A 8CATA 2QSFX 3V76A 5C1BA 4MGHA 1F4IA 1DV0A 2JY8A 1C7YA 2CP8A 4JI6M 1VEJA 1DGFA 3VDUA 1LV7A 4IIWA 4ITQA 3GRRA 5DFLA 1OIZA 1L2BA 1YSYA 4OVZA 1XC8A 2CWBA 2V1CA 2N35A 1N78A 1IN4A 3GPYA 4Y28F 2MROB 4IBIA 2WSEF 1R2YA 2RKOA 4P17A 5KQDA 3KOYE 1HT1E 2DNAA 3Q8GA 2QCUA 3FUUA 2MR9A 4D82A 2DKLA 3PVSA 2F5OA 1LTMA 2XSZA 2KZUA 2MJ5B 3FE3A 4X66M 1QZMA 3U5ZA 4FD2A 5ITRA 2K47A 2QZ4A 1IN5A 1WGNA 2DVWB 4DV1M 1N77A 2CEAA 3MMPA 2JUJA 4ZPXA 1NHWC 4G6ZA 2X4AA 4KODA 3QYEA 3HHXA 3U61A 1HJPA 1XXHE 1RU3A 4R7GA 1H6UA 2A5YB 3RGSA 3E9SA 4IBFA 4MB7A 3C9PA 3LMMA 2YNMD 4GC5A 4IBDA 1Z59A 4I4LA 2JY7A 2KZSA 4GMQA 4LG2A 2APLA 4L6V6 4M9SA 3PFIA 2K9DA 3WHKA 2UXDM 4WW0A 1L1TA 4RF1A 3A98B 4S12A 1XNQM 2L6OA 4AKGA 2WSFF 1VEGA 2I7PA 3J81S 2Z4SA 5ITUA 3U6SA 3J80S 2LHGA 3GRYA 3HY5A 4B7GA 4NL4H 2JP7A 4PD2A 3H4JA 3GLIA 2HAKA 2LWXA 3CTWB 3FKEA 3K8ZA 2YQZA 2ZTCA 4OX9M 4LFCM 3SASA 1YLAA 5EP1A 3KSJA 3SAWA 2FH0A 4PDGA 2KXEA 5KQ8A 2BWEA 2BNKA 3E4RA 1R5LA 4II7A 1XMQM 3QYBA 2R62A 2C96A 4XK8F 2R18A 3VK8A 1DGHA 2C9OA 4K0KM 1GABA 1ZAEA 4CJ6A 3U6DA 1I94M 4RNAA 2R4JA 3GLHB 3LCVB 4M9ZA 3B9PA 1YUBA 1CUKA 2D7EA 5FTMA 2XF3A 3F92A 1JB0F 3CGWA 1G59A 2C9CA 3K9OA 1JR3D 2QNJA 3SMSA 1EIJA 2V6ZM 2X8AA 4LJ7A 2KEBA 4B7FA 3A46A 2FE8A 2LXEA 5EP3A 3W0LB 3GLGB 2Z3XA 3PNVA 4LZJA 2UUAM 1XNRM 2CV0A 4GHAA 1IBKM 3SBJA 3HKPA 4NRVA 1GLNA 3D8LA 4OU7A 3C3EA 2KDLA 2LHCA 4DV4M 1TH2A 3JR5A 4LF9M 3K1JA 2FFJA 3OTOM 5E6JA 2K6BA 3E46A 3RFWA 3ZC7B 1XB2B 3L27A 4DR7M 3IG8A 1WJ7A 1R2ZA 2AHMA 3FRHA 1L2DA 4LCBA 4JYAM 2UXCM 2KRUA 1PM5A 2XGNA 2Y20A 2KW0A 4MGKE 4DV0M 4DV7M 3M6AA 2QBYA 1IXSA 4LJ5A 2EKKA 5FTJA 4RKUF 1PJJA 3VKGA 4QNRA 1X37A 2C5RA 4GKKM 4FCTA 4L16A 3KP0E 4DR2M 3WHLA 3VKHA 3FD9A 1NO1A 3GPPA 4B3TM 1GL7A 3TQSA 1QANA 2VQEM 3I4YA 4GEWA 3J7AS 2O5RA 1FJGM 3KS8A 2DENA 2L4EA 3GPUA 4FW9A 1JR3E 4LF5M 2KNAA 3AFHA 2DI0A 3BBZA 2YR0A 1OAOC 4D80A 3HJSA 4GRIA 1ZV1A 3KSXA 2LVNC 2LVQD 4IJEA 1OKSA 1Q3BA 3BXWA 4GKJM 3JAMS 1R4GA 1MU5A 4MGYE 5LMUM 2DAKA 3SARA 4EIWA 2O01F 4IBGA 4DR3M 1VEKA 1E9RA 1OTRA 2DHYA 4OVZB 1V33A 4PT5A 2ZM6M 3U6PA 4LGMA 1W5TA 2F5NA 3L28A 3UZUA 5ITQA 1HR0M 3GLGE 4QHTA 3SAVA 3U6CA 3AOGA 1IXZA 1WGLA 4NC6A 2R6FA 3GRUA 2RGOA 3I04M 2XLJA 1IY0A 3SAUA 1TH3A 4AZFA 1PJIA 4JI4M 3LQRA 4BB9A 1ZQ9A 3CF6E 4Z6YA 3DFZA 3DOAA 1GJTA 1K3WA 1Q39A 2R44A 3IG5A 3U61B 4MGIE 3U5ZB 4M9XA 3MK6A 2B3TA 3LVVA 4CIZA 4HLQA 4AQYM 4LY6A 3VFDA 4XBOA 1VQ1A 1YE9A 3AOEA 4IBBA 1SXJA 5H37D 1DGBA 1E32A 1G8PA 3AJIB 3L2AA 3W67A 5FTLA 3AOEC 2ZTDA 3ZH9B 1SXJC 1WHCA 3PNYA 5ITXE 2LTUA 3SHGB 2XSZD 3QAUA 4DUYM 3FUVA 1OJLA 2F5QA 3TWMA 2DHRA 4X64M 4L8RC 4NXMM 1MJGM 3GP1A 1C1KA 3GLIB 3VLFB 1HT2E 4W5WA 3VK7A 4JI7M 1GVNA 4LJ9A 2Q2EB 2XH9A 3U60A 4LF8M 1IY1A 4IBCA 4R3DA 3HHYA 3A42A 1NV8A 1D0MA 2CUZA 3I4VA 1N36M 3HX3A 1HQYE 4I5SA 2RRUA 2FS1A 2CHGA 2KHHA 4F1IA 3AKZA 1KSFX 1DGHB 2R45A 4BBAA 2CHVA 2WSCF 2LVPC 4GIPA 1N34M 2YFQA 2QQ8A 4B7HA 1Z5CA 4CGYB 1J7KA 1Q3CA 4FWHA 5ITYA 2G5GX 3IECA 5IZ7D 4AG6A 2HHHM 1SG9A 4MGZE 1NSFA 4LJAA 4LJ4A 1T3TA 4NSOB 4GC9A 1IQPA 5IREB 3NBXX 1TTEA 1L8QA 1TDZA 1FNNA 2LVOC 3T6PA 1WR1B 2XZFA 4QOSA 3K2LA 5DYIA 4JI1M 1TH4A 4A3VB 3J2PB 5A2QS 3JR4A 4L78A 1EE8A 3FUWA 5KPZA 1T6OA 4QHSA 4G4OA 1UFZA 4PCZA 3U6OA 1IFYA 3UJNA 2OO9A 3L25A 1IN7A 3EIEA 3LQQA 2UXBM 1QVRA 1DO0A 3W0FA 2DWNA 2QBYB 3GQ4A 1IXSB 5KO3A 3KS4A 2I7NA 4NXNM 2EA0A 2C98A 2DAEA 4LF6M 4IBKA 1NY5A 5DYGA 4DR6M 2L4FA 4DV6M 4I8OA 4X65M 1D0LA 4LJ8A 4LFBM 3C58A 1W5SA 2G8LA 1IBMM 3L29A 2DWZB 3R9XB 1NNUC 2G3QA 2D7HA 3KW6A 2XEPA 1WXQA 3GLIE 4NRWA 3MHVC 5EXTA 3KXEC 1E9SA 5LMNM 1NJFA 1QZEA 4DR5M 4IBJA 2O25A 4DV5M 5IT9S 2M60A 5GKNA 2UUBM 1BVSA 1TR8A 4OW0A 3FYDA 1MX0A 3BOSA 1QYRA 5EXPA 1Z5BA 2Z4RA 4LRTA 2R46A 1QQWA 5FTNA 3HU3A 1QDRA 1GL6A 1VG5A 1V92A 2HKJA 4XGIA 2P5TA 4DR1M 2ZAOA 1K3XA 3GPXA 4B3RM 2JZ0A 1IN6A 1G4AE 3AV0A 3HJQA 4RF0A 2QPAA 2CV2A 3RE8A 2UUCM 3FTCA 2XFSA 2ERCA
chains in the Genus database with same CATH topology
3H4JA 2MGWA 2HAKA 2ZTCA 2ZTDA 1WHCA 1YLAA 2EJSA 1Y8GA 2HWJA 2LTUA 4R71A 3E21A 2EKFA 2BWEA 3B89A 1EFUB 2BWBA 2OOBA 2DZLA 2H5XA 1HT2E 1PGYA 2L2DA 3LCVB 2JZ1A 1NV9A 1CUKA 2OOAA 3F92A 1NV8A 3K9OA 2QNJA 1HQYE 2RRUA 2KHHA 4F1IA 4HEOA 1IM2A 2DAMA 1OQYA 2LVPC 2KNZA 2DAGA 4Q7JA 1KYIA 3IECA 1DO2A 2QHOB 3E46A 1XB2B 1SG9A 1WJ7A 1OAIA 3FRHA 3IHPA 2K0BX 1TTEA 2DAIA 1IXSA 2LVOC 1WR1B 2EKKA 3T6PA 3GLHE 1T43A 4WP2A 1AIPC 1E94E 1T6OA 1IFYA 1UFZA 2R0IA 2LVAA 1ZMWA 2OO9A 2QSFX 4GEWA 1F4IA 1DV0A 1DO0A 2JY8A 2DENA 2L4EA 1C7YA 1JR3E 2CP8A 1VEJA 2KNAA 3GLFE 2DI0A 2DAEA 5DFLA 3BBZA 2L4FA 2CWBA 1ZV1A 2LVNC 2LVQD 1OKSA 2MROB 1R4GA 2G3QA 4DBGB 1HT1E 2DAKA 2DNAA 3K9PA 3GLIE 2MR9A 2DKLA 1G41A 2MJ5B 3FE3A 1QZEA 1VEKA 5JI2E 2O25A 2KNVA 1GO5A 1OTRA 2DHYA 1P3QQ 2WZJA 1WGNA 4UN2B 3MMPA 2JUJA 1BVSA 2LBCA 1TR8A 1G3IA 1HJPA 1XXHE 3GLGE 2JY6B 1MN3A 1WIVA 1WGLA 4F2LA 2JY7A 2K9DA 1A5TA 1Q02A 4G3OA 1VG5A 1V92A 1ZMUA 2JNHA 1VDLA 1ZMVA 1VEGA 2JZ0A 3LCUA 1G4AE 2JY5A 2B3TA 3FRIA 2JP7A 1VQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4J A;  2MGW A;  2HAK A;  2ZTC A;  2ZTD A;  1WHC A;  1YLA A;  2EJS A;  1Y8G A;  2HWJ A;  2LTU A;  4R71 A;  3E21 A;  2EKF A;  2BWE A;  3B89 A;  1EFU B;  2BWB A;  2OOB A;  2DZL A;  2H5X A;  1HT2 E;  1PGY A;  2L2D A;  3LCV B;  2JZ1 A;  1NV9 A;  1CUK A;  2OOA A;  3F92 A;  1NV8 A;  3K9O A;  2QNJ A;  1HQY E;  2RRU A;  2KHH A;  4F1I A;  4HEO A;  1IM2 A;  2DAM A;  1OQY A;  2LVP C;  2KNZ A;  2DAG A;  4Q7J A;  1KYI A;  3IEC A;  1DO2 A;  2QHO B;  3E46 A;  1XB2 B;  1SG9 A;  1WJ7 A;  1OAI A;  3FRH A;  3IHP A;  2K0B X;  1TTE A;  2DAI A;  1IXS A;  2LVO C;  1WR1 B;  2EKK A;  3T6P A;  3GLH E;  1T43 A;  4WP2 A;  1AIP C;  1E94 E;  1T6O A;  1IFY A;  1UFZ A;  2R0I A;  2LVA A;  1ZMW A;  2OO9 A;  2QSF X;  4GEW A;  1F4I A;  1DV0 A;  1DO0 A;  2JY8 A;  2DEN A;  2L4E A;  1C7Y A;  1JR3 E;  2CP8 A;  1VEJ A;  2KNA A;  3GLF E;  2DI0 A;  2DAE A;  5DFL A;  3BBZ A;  2L4F A;  2CWB A;  1ZV1 A;  2LVN C;  2LVQ D;  1OKS A;  2MRO B;  1R4G A;  2G3Q A;  4DBG B;  1HT1 E;  2DAK A;  2DNA A;  3K9P A;  3GLI E;  2MR9 A;  2DKL A;  1G41 A;  2MJ5 B;  3FE3 A;  1QZE A;  1VEK A;  5JI2 E;  2O25 A;  2KNV A;  1GO5 A;  1OTR A;  2DHY A;  1P3Q Q;  2WZJ A;  1WGN A;  4UN2 B;  3MMP A;  2JUJ A;  1BVS A;  2LBC A;  1TR8 A;  1G3I A;  1HJP A;  1XXH E;  3GLG E;  2JY6 B;  1MN3 A;  1WIV A;  1WGL A;  4F2L A;  2JY7 A;  2K9D A;  1A5T A;  1Q02 A;  4G3O A;  1VG5 A;  1V92 A;  1ZMU A;  2JNH A;  1VDL A;  1ZMV A;  1VEG A;  2JZ0 A;  3LCU A;  1G4A E;  2JY5 A;  2B3T A;  3FRI A;  2JP7 A;  1VQ1 A; 
#chains in the Genus database with same CATH topology
 2MGW A;  3U6E A;  1NJG A;  4QNM A;  4JI3 M;  3SHF A;  4DV3 M;  1NY6 A;  3FTF A;  1TF0 B;  1GJS A;  1Y8G A;  2HWJ A;  2L7I A;  1L2C A;  2HCB A;  2EKF A;  2JXN A;  3CF2 A;  3ZQJ A;  2VII A;  3U6Q A;  1XMO M;  1N32 M;  3B89 A;  1XHB A;  3VDP A;  1OFI A;  1EFU B;  2OOB A;  3QWL A;  1TDH A;  1XXH A;  4BLC A;  4X62 M;  3GQ5 A;  7CAT A;  5FLX S;  5E26 A;  1QAQ A;  5FSW A;  2H5X A;  1G71 A;  3GRV A;  3K92 A;  1SXJ B;  3GLF A;  5F3W A;  1PRB A;  3UK6 A;  4JI5 M;  1HNW M;  1N33 M;  4LRS A;  1HNZ M;  3SFZ A;  1NV9 A;  3THG A;  3KOZ E;  2MH8 A;  2OOA A;  5EQT A;  3SYK A;  1L1Z A;  1K82 A;  3MJ5 A;  2F4V M;  1IM2 A;  1D2N A;  2VDB B;  1OQY A;  4AKI A;  3HZJ A;  2Z7J A;  3I51 A;  3HHZ A;  4DR4 M;  2CV1 A;  3HWS A;  3LVW A;  2DAG A;  4FVM A;  1ORY B;  4KT0 F;  1IXR C;  3J7B A;  3U60 B;  2F5S A;  2J7N A;  1SXJ D;  4P16 A;  1OAI A;  2Y0T A;  3R8F A;  2LNH C;  2CRU A;  4FWG A;  3SMP A;  3RGP A;  4JI8 M;  2K0B X;  4YHH M;  2E5L M;  2DAI A;  1R6B X;  3HHW A;  4KO8 A;  1OFH A;  2XFT A;  2Z8Y M;  4FCW A;  1T43 A;  2DWL A;  4AI6 A;  5EJC A;  3B7N A;  1E94 E;  2OPF A;  3SAT A;  4ANR A;  2R0I A;  1OIP A;  2LVA A;  4YY3 M;  1ZMW A;  1QUT A;  4IJF A;  3DZD A;  2DZO B;  2ZAM A;  5EXS A;  3M0E A;  3B7Z A;  1Z6T A;  3GLF E;  2Y0Q A;  3M7G A;  4G4N A;  4B08 A;  1R7R A;  1NHG C;  4JV5 M;  2CE7 A;  1JQJ C;  2FNA A;  3J27 B;  3T15 A;  3CF0 A;  3TL4 X;  4TUW A;  1GKI A;  2M5Z A;  3FTD A;  5L8R F;  3NWL A;  4DBG B;  4G4R A;  3KDS E;  3K9P A;  1SXJ E;  3UGJ A;  1TGU A;  3W68 A;  1G41 A;  3I01 M;  2VF8 A;  4NSR A;  3U6M A;  5DNY A;  1PJT A;  3GQ3 A;  5JI2 E;  2XZU A;  2KNV A;  4KHP M;  1GO5 A;  4L4U A;  5EP2 A;  1P3Q Q;  2WZJ A;  2R65 A;  3HU2 A;  1QDT A;  4UN2 B;  4Z8X A;  3HGI A;  3ZCB B;  2UU9 M;  2LBC A;  4FWD A;  1IN8 A;  2EO2 A;  3D8B A;  1G3I A;  4LF7 M;  3T38 A;  4LF4 M;  3EIH A;  2JY6 B;  1QAO A;  2J7O A;  1MN3 A;  1WIV A;  2C99 A;  1QUS A;  2W82 A;  2OQ4 A;  4F2L A;  2CHQ A;  1HQC A;  2VQF M;  4REZ A;  1JR3 A;  3KP1 E;  4M0D A;  2DXI A;  1A5T A;  2FOI C;  1Q02 A;  4G3O A;  4LJ6 A;  3TPZ A;  3UMM A;  4JI0 M;  4KLN A;  1I4W A;  4PDI A;  4DUZ M;  4G4Q A;  1ZMU A;  2JNH A;  1VDL A;  1ZMV A;  3KOW E;  4IBE A;  3LCU A;  3PXG A;  4M0W A;  5BPV A;  5FTK A;  2JY5 A;  1NVM A;  1PJS A;  3FRI A;  5C18 A;  3H4M A;  3HJ8 A;  1VDD A;  4LFA M;  3A45 A;  2GQF A;  2HL7 A;  2VF7 A;  4LGY A;  3GLH A;  2KA6 B;  3KVW A;  2BJW A;  1HNX M;  2ZAN A;  4JN6 A;  4LZZ A;  4GHL A;  3B7Q A;  2EJS A;  2F5P A;  4R71 A;  4B3M M;  3E21 A;  2J5Y A;  1QAM A;  4MH0 E;  2V1U A;  2KRK A;  2QP9 X;  2JWS A;  4CHT B;  2Y21 A;  2BWB A;  4B3S M;  1KFV A;  3GLG A;  3KFU G;  2DWM A;  2DZL A;  4NOO B;  1PGY A;  2L09 A;  2L2D A;  5EXX A;  2JZ1 A;  4MM3 B;  5BR8 M;  1S3S A;  3DA1 A;  3T1Y M;  1N75 A;  2L7H A;  3GO8 A;  3TWK A;  3FYC A;  4I81 A;  3LW5 F;  2BJV A;  4HEO A;  2R4E A;  2DAM A;  1XXH B;  1DGG A;  5KPR A;  1J5E M;  4GIT A;  2DZN B;  1D0K A;  2QEN A;  5JI3 E;  1NNJ A;  3B74 A;  1PJQ A;  2X49 A;  3GLF B;  1IY2 A;  2CFO A;  3HU1 A;  2KNZ A;  2LH0 A;  3C3D A;  3KOX E;  4HL4 A;  1UM8 A;  4Q7J A;  1KYI A;  2EUC A;  3SC3 A;  5KPT A;  1DO2 A;  2QHO B;  3U6L A;  4FCV A;  5EP4 A;  5ITX A;  5ITT A;  3NBI A;  2JA2 A;  3T1H M;  4WUR A;  4CIS A;  3AL0 C;  1IBL M;  4QOZ C;  2GNO A;  3FTE A;  4JI2 M;  3IHP A;  4AKH A;  3Q8X A;  4AG5 A;  5IWA M;  2D7G A;  2RGH A;  3L26 A;  1Z5A A;  1V34 A;  4L15 A;  4JXJ A;  1XWI A;  3FUX A;  3TWL A;  3GLH E;  2H1R A;  4GH9 A;  4WP2 A;  3SYL A;  2NQ8 C;  4D81 A;  1AIP C;  2ZBK B;  1AUA A;  3TE6 A;  1J09 A;  4DV2 M;  3FUT A;  3ILK A;  4AW4 A;  8CAT A;  2QSF X;  3V76 A;  5C1B A;  4MGH A;  1F4I A;  1DV0 A;  2JY8 A;  1C7Y A;  2CP8 A;  4JI6 M;  1VEJ A;  1DGF A;  3VDU A;  1LV7 A;  4IIW A;  4ITQ A;  3GRR A;  5DFL A;  1OIZ A;  1L2B A;  1YSY A;  4OVZ A;  1XC8 A;  2CWB A;  2V1C A;  2N35 A;  1N78 A;  1IN4 A;  3GPY A;  4Y28 F;  2MRO B;  4IBI A;  2WSE F;  1R2Y A;  2RKO A;  4P17 A;  5KQD A;  3KOY E;  1HT1 E;  2DNA A;  3Q8G A;  2QCU A;  3FUU A;  2MR9 A;  4D82 A;  2DKL A;  3PVS A;  2F5O A;  1LTM A;  2XSZ A;  2KZU A;  2MJ5 B;  3FE3 A;  4X66 M;  1QZM A;  3U5Z A;  4FD2 A;  5ITR A;  2K47 A;  2QZ4 A;  1IN5 A;  1WGN A;  2DVW B;  4DV1 M;  1N77 A;  2CEA A;  3MMP A;  2JUJ A;  4ZPX A;  1NHW C;  4G6Z A;  2X4A A;  4KOD A;  3QYE A;  3HHX A;  3U61 A;  1HJP A;  1XXH E;  1RU3 A;  4R7G A;  1H6U A;  2A5Y B;  3RGS A;  3E9S A;  4IBF A;  4MB7 A;  3C9P A;  3LMM A;  2YNM D;  4GC5 A;  4IBD A;  1Z59 A;  4I4L A;  2JY7 A;  2KZS A;  4GMQ A;  4LG2 A;  2APL A;  4L6V 6;  4M9S A;  3PFI A;  2K9D A;  3WHK A;  2UXD M;  4WW0 A;  1L1T A;  4RF1 A;  3A98 B;  4S12 A;  1XNQ M;  2L6O A;  4AKG A;  2WSF F;  1VEG A;  2I7P A;  3J81 S;  2Z4S A;  5ITU A;  3U6S A;  3J80 S;  2LHG A;  3GRY A;  3HY5 A;  4B7G A;  4NL4 H;  2JP7 A;  4PD2 A;  3H4J A;  3GLI A;  2HAK A;  2LWX A;  3CTW B;  3FKE A;  3K8Z A;  2YQZ A;  2ZTC A;  4OX9 M;  4LFC M;  3SAS A;  1YLA A;  5EP1 A;  3KSJ A;  3SAW A;  2FH0 A;  4PDG A;  2KXE A;  5KQ8 A;  2BWE A;  2BNK A;  3E4R A;  1R5L A;  4II7 A;  1XMQ M;  3QYB A;  2R62 A;  2C96 A;  4XK8 F;  2R18 A;  3VK8 A;  1DGH A;  2C9O A;  4K0K M;  1GAB A;  1ZAE A;  4CJ6 A;  3U6D A;  1I94 M;  4RNA A;  2R4J A;  3GLH B;  3LCV B;  4M9Z A;  3B9P A;  1YUB A;  1CUK A;  2D7E A;  5FTM A;  2XF3 A;  3F92 A;  1JB0 F;  3CGW A;  1G59 A;  2C9C A;  3K9O A;  1JR3 D;  2QNJ A;  3SMS A;  1EIJ A;  2V6Z M;  2X8A A;  4LJ7 A;  2KEB A;  4B7F A;  3A46 A;  2FE8 A;  2LXE A;  5EP3 A;  3W0L B;  3GLG B;  2Z3X A;  3PNV A;  4LZJ A;  2UUA M;  1XNR M;  2CV0 A;  4GHA A;  1IBK M;  3SBJ A;  3HKP A;  4NRV A;  1GLN A;  3D8L A;  4OU7 A;  3C3E A;  2KDL A;  2LHC A;  4DV4 M;  1TH2 A;  3JR5 A;  4LF9 M;  3K1J A;  2FFJ A;  3OTO M;  5E6J A;  2K6B A;  3E46 A;  3RFW A;  3ZC7 B;  1XB2 B;  3L27 A;  4DR7 M;  3IG8 A;  1WJ7 A;  1R2Z A;  2AHM A;  3FRH A;  1L2D A;  4LCB A;  4JYA M;  2UXC M;  2KRU A;  1PM5 A;  2XGN A;  2Y20 A;  2KW0 A;  4MGK E;  4DV0 M;  4DV7 M;  3M6A A;  2QBY A;  1IXS A;  4LJ5 A;  2EKK A;  5FTJ A;  4RKU F;  1PJJ A;  3VKG A;  4QNR A;  1X37 A;  2C5R A;  4GKK M;  4FCT A;  4L16 A;  3KP0 E;  4DR2 M;  3WHL A;  3VKH A;  3FD9 A;  1NO1 A;  3GPP A;  4B3T M;  1GL7 A;  3TQS A;  1QAN A;  2VQE M;  3I4Y A;  4GEW A;  3J7A S;  2O5R A;  1FJG M;  3KS8 A;  2DEN A;  2L4E A;  3GPU A;  4FW9 A;  1JR3 E;  4LF5 M;  2KNA A;  3AFH A;  2DI0 A;  3BBZ A;  2YR0 A;  1OAO C;  4D80 A;  3HJS A;  4GRI A;  1ZV1 A;  3KSX A;  2LVN C;  2LVQ D;  4IJE A;  1OKS A;  1Q3B A;  3BXW A;  4GKJ M;  3JAM S;  1R4G A;  1MU5 A;  4MGY E;  5LMU M;  2DAK A;  3SAR A;  4EIW A;  2O01 F;  4IBG A;  4DR3 M;  1VEK A;  1E9R A;  1OTR A;  2DHY A;  4OVZ B;  1V33 A;  4PT5 A;  2ZM6 M;  3U6P A;  4LGM A;  1W5T A;  2F5N A;  3L28 A;  3UZU A;  5ITQ A;  1HR0 M;  3GLG E;  4QHT A;  3SAV A;  3U6C A;  3AOG A;  1IXZ A;  1WGL A;  4NC6 A;  2R6F A;  3GRU A;  2RGO A;  3I04 M;  2XLJ A;  1IY0 A;  3SAU A;  1TH3 A;  4AZF A;  1PJI A;  4JI4 M;  3LQR A;  4BB9 A;  1ZQ9 A;  3CF6 E;  4Z6Y A;  3DFZ A;  3DOA A;  1GJT A;  1K3W A;  1Q39 A;  2R44 A;  3IG5 A;  3U61 B;  4MGI E;  3U5Z B;  4M9X A;  3MK6 A;  2B3T A;  3LVV A;  4CIZ A;  4HLQ A;  4AQY M;  4LY6 A;  3VFD A;  4XBO A;  1VQ1 A;  1YE9 A;  3AOE A;  4IBB A;  1SXJ A;  5H37 D;  1DGB A;  1E32 A;  1G8P A;  3AJI B;  3L2A A;  3W67 A;  5FTL A;  3AOE C;  2ZTD A;  3ZH9 B;  1SXJ C;  1WHC A;  3PNY A;  5ITX E;  2LTU A;  3SHG B;  2XSZ D;  3QAU A;  4DUY M;  3FUV A;  1OJL A;  2F5Q A;  3TWM A;  2DHR A;  4X64 M;  4L8R C;  4NXM M;  1MJG M;  3GP1 A;  1C1K A;  3GLI B;  3VLF B;  1HT2 E;  4W5W A;  3VK7 A;  4JI7 M;  1GVN A;  4LJ9 A;  2Q2E B;  2XH9 A;  3U60 A;  4LF8 M;  1IY1 A;  4IBC A;  4R3D A;  3HHY A;  3A42 A;  1NV8 A;  1D0M A;  2CUZ A;  3I4V A;  1N36 M;  3HX3 A;  1HQY E;  4I5S A;  2RRU A;  2FS1 A;  2CHG A;  2KHH A;  4F1I A;  3AKZ A;  1KSF X;  1DGH B;  2R45 A;  4BBA A;  2CHV A;  2WSC F;  2LVP C;  4GIP A;  1N34 M;  2YFQ A;  2QQ8 A;  4B7H A;  1Z5C A;  4CGY B;  1J7K A;  1Q3C A;  4FWH A;  5ITY A;  2G5G X;  3IEC A;  5IZ7 D;  4AG6 A;  2HHH M;  1SG9 A;  4MGZ E;  1NSF A;  4LJA A;  4LJ4 A;  1T3T A;  4NSO B;  4GC9 A;  1IQP A;  5IRE B;  3NBX X;  1TTE A;  1L8Q A;  1TDZ A;  1FNN A;  2LVO C;  3T6P A;  1WR1 B;  2XZF A;  4QOS A;  3K2L A;  5DYI A;  4JI1 M;  1TH4 A;  4A3V B;  3J2P B;  5A2Q S;  3JR4 A;  4L78 A;  1EE8 A;  3FUW A;  5KPZ A;  1T6O A;  4QHS A;  4G4O A;  1UFZ A;  4PCZ A;  3U6O A;  1IFY A;  3UJN A;  2OO9 A;  3L25 A;  1IN7 A;  3EIE A;  3LQQ A;  2UXB M;  1QVR A;  1DO0 A;  3W0F A;  2DWN A;  2QBY B;  3GQ4 A;  1IXS B;  5KO3 A;  3KS4 A;  2I7N A;  4NXN M;  2EA0 A;  2C98 A;  2DAE A;  4LF6 M;  4IBK A;  1NY5 A;  5DYG A;  4DR6 M;  2L4F A;  4DV6 M;  4I8O A;  4X65 M;  1D0L A;  4LJ8 A;  4LFB M;  3C58 A;  1W5S A;  2G8L A;  1IBM M;  3L29 A;  2DWZ B;  3R9X B;  1NNU C;  2G3Q A;  2D7H A;  3KW6 A;  2XEP A;  1WXQ A;  3GLI E;  4NRW A;  3MHV C;  5EXT A;  3KXE C;  1E9S A;  5LMN M;  1NJF A;  1QZE A;  4DR5 M;  4IBJ A;  2O25 A;  4DV5 M;  5IT9 S;  2M60 A;  5GKN A;  2UUB M;  1BVS A;  1TR8 A;  4OW0 A;  3FYD A;  1MX0 A;  3BOS A;  1QYR A;  5EXP A;  1Z5B A;  2Z4R A;  4LRT A;  2R46 A;  1QQW A;  5FTN A;  3HU3 A;  1QDR A;  1GL6 A;  1VG5 A;  1V92 A;  2HKJ A;  4XGI A;  2P5T A;  4DR1 M;  2ZAO A;  1K3X A;  3GPX A;  4B3R M;  2JZ0 A;  1IN6 A;  1G4A E;  3AV0 A;  3HJQ A;  4RF0 A;  2QPA A;  2CV2 A;  3RE8 A;  2UUC M;  3FTC A;  2XFS A;  2ERC A; 
#chains in the Genus database with same CATH homology
 3H4J A;  2MGW A;  2HAK A;  2ZTC A;  2ZTD A;  1WHC A;  1YLA A;  2EJS A;  1Y8G A;  2HWJ A;  2LTU A;  4R71 A;  3E21 A;  2EKF A;  2BWE A;  3B89 A;  1EFU B;  2BWB A;  2OOB A;  2DZL A;  2H5X A;  1HT2 E;  1PGY A;  2L2D A;  3LCV B;  2JZ1 A;  1NV9 A;  1CUK A;  2OOA A;  3F92 A;  1NV8 A;  3K9O A;  2QNJ A;  1HQY E;  2RRU A;  2KHH A;  4F1I A;  4HEO A;  1IM2 A;  2DAM A;  1OQY A;  2LVP C;  2KNZ A;  2DAG A;  4Q7J A;  1KYI A;  3IEC A;  1DO2 A;  2QHO B;  3E46 A;  1XB2 B;  1SG9 A;  1WJ7 A;  1OAI A;  3FRH A;  3IHP A;  2K0B X;  1TTE A;  2DAI A;  1IXS A;  2LVO C;  1WR1 B;  2EKK A;  3T6P A;  3GLH E;  1T43 A;  4WP2 A;  1AIP C;  1E94 E;  1T6O A;  1IFY A;  1UFZ A;  2R0I A;  2LVA A;  1ZMW A;  2OO9 A;  2QSF X;  4GEW A;  1F4I A;  1DV0 A;  1DO0 A;  2JY8 A;  2DEN A;  2L4E A;  1C7Y A;  1JR3 E;  2CP8 A;  1VEJ A;  2KNA A;  3GLF E;  2DI0 A;  2DAE A;  5DFL A;  3BBZ A;  2L4F A;  2CWB A;  1ZV1 A;  2LVN C;  2LVQ D;  1OKS A;  2MRO B;  1R4G A;  2G3Q A;  4DBG B;  1HT1 E;  2DAK A;  2DNA A;  3K9P A;  3GLI E;  2MR9 A;  2DKL A;  1G41 A;  2MJ5 B;  3FE3 A;  1QZE A;  1VEK A;  5JI2 E;  2O25 A;  2KNV A;  1GO5 A;  1OTR A;  2DHY A;  1P3Q Q;  2WZJ A;  1WGN A;  4UN2 B;  3MMP A;  2JUJ A;  1BVS A;  2LBC A;  1TR8 A;  1G3I A;  1HJP A;  1XXH E;  3GLG E;  2JY6 B;  1MN3 A;  1WIV A;  1WGL A;  4F2L A;  2JY7 A;  2K9D A;  1A5T A;  1Q02 A;  4G3O A;  1VG5 A;  1V92 A;  1ZMU A;  2JNH A;  1VDL A;  1ZMV A;  1VEG A;  2JZ0 A;  3LCU A;  1G4A E;  2JY5 A;  2B3T A;  3FRI A;  2JP7 A;  1VQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...