1WGLA

Solution structure of cue domain in the c-terminal of human toll-interacting protein (tollip)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSSGSSGCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Toll-interacting protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wglA00
2DI0A 1BVSA 1JR3E 1NV8A 1VEKA 1VG5A 2CP8A 2LVAA 2JY5A 4DBGB 1EFUB 3B89A 1WJ7A 1DV0A 1P3QQ 2KNAA 1R4GA 1G41A 1NV9A 1A5TA 2KNZA 2DAGA 1E94E 2L2DA 2MJ5B 1HT1E 2DNAA 2LVQD 1SG9A 4UN2B 1C7YA 1V92A 2JNHA 2ZTCA 2MGWA 1G3IA 2JUJA 1ZV1A 3K9OA 2MROB 2WZJA 2DENA 3FRHA 2L4EA 5DFLA 4F2LA 1WHCA 2HWJA 2L4FA 3FE3A 3GLHE 3LCVB 2QSFX 2EKFA 1WGLA 2JY6B 4WP2A 4G3OA 1VEGA 2LTUA 4F1IA 4Q7JA 3FRIA 2BWBA 1MN3A 5JI2E 3K9PA 3E21A 2LBCA 2K9DA 1OKSA 2R0IA 3GLFE 3F92A 1XB2B 3T6PA 1WIVA 1OTRA 2K0BX 3IHPA 1F4IA 1KYIA 1UFZA 1G4AE 1PGYA 1GO5A 3GLIE 1ZMVA 2KHHA 1OQYA 2DZLA 1CUKA 3E46A 2JZ1A 1VEJA 2DAMA 2H5XA 2JZ0A 1YLAA 2DAIA 2DKLA 2LVOC 3LCUA 2MR9A 1IM2A 2QHOB 1ZMWA 1DO2A 1WR1B 2KNVA 2QNJA 1ZMUA 1TR8A 1Y8GA 1QZEA 2DAKA 1VQ1A 2JY7A 1IFYA 1DO0A 3MMPA 2HAKA 2DHYA 2LVPC 2OOBA 4HEOA 1XXHE 2LVNC 3BBZA 1AIPC 1HQYE 1T6OA 2O25A 1IXSA 3GLGE 1HT2E 2BWEA 1TTEA 1WGNA 2RRUA 2OOAA 1T43A 2JY8A 4GEWA 1OAIA 3IECA 2EJSA 2OO9A 1HJPA 2DAEA 2G3QA 2EKKA 2JP7A 3H4JA 1Q02A 2ZTDA 1VDLA 2CWBA 4R71A 2B3TA
chains in the Genus database with same CATH superfamily
1IY2A 2DI0A 4RNAA 3TL4X 4G4OA 1VG5A 4IJEA 4G6ZA 5EXSA 1EE8A 2JY5A 4DBGB 4YY3M 1EFUB 4MGYE 3C3EA 2XZFA 1DGFA 1WJ7A 1DV0A 1P3QQ 4DR3M 2KNAA 1IBMM 1QQWA 3M7GA 3GPXA 2KNZA 3GQ3A 5FTJA 3GPPA 2Y0QA 1E94E 3CF2A 3E4RA 4XGIA 5FTMA 1QUSA 1Z5BA 3FTCA 1HT1E 2LVQD 4QOSA 4UN2B 1GJSA 1EIJA 5ITXE 1QAQA 1G71A 1JR3D 2HCBA 3DOAA 2UU9M 2YQZA 3L27A 3PVSA 5EXTA 1SXJA 5ITXA 4AKHA 1E9RA 1K3XA 1SXJB 1ZV1A 2R45A 2WZJA 5IT9S 2L4EA 1TH2A 1XC8A 5DFLA 3J2PB 4IBIA 1N33M 4DR6M 3BXWA 3GLHE 2LHGA 3DZDA 2V1CA 3KVWA 4R3DA 4DV0M 3AJIB 3SAWA 2G5GX 1N77A 3M6AA 2EKFA 4LZJA 3T15A 4LRSA 1HQCA 1W5TA 1MX0A 3PFIA 4G3OA 3GO8A 1VEGA 3J7AS 3U6LA 2LTUA 3EIHA 4FWHA 4L16A 4F1IA 4LF7M 4DV6M 1IQPA 4BB9A 5KPTA 3HHXA 2Z3XA 1WXQA 5EXXA 1HNWM 2LBCA 2K9DA 3B9PA 2XZUA 2ZBKB 3J7BA 1NHGC 2XGNA 2R6FA 1DGGA 3GRRA 4X62M 3KOYE 3T1HM 3SASA 2BJWA 3I04M 3VKGA 4R7GA 3GLFA 1KFVA 3MJ5A 1IBKM 3GLHA 1AUAA 1NSFA 2XSZA 2VIIA 1DGHB 1QZMA 2AHMA 2R46A 3IHPA 3W68A 4Z6YA 2ZAOA 1GO5A 5ITTA 3GLIE 3U61A 4JI8M 1XMQM 1OQYA 4ZPXA 3AFHA 1CUKA 3E46A 1PRBA 4IBEA 5EP2A 4CHTB 1VEJA 2DAMA 3U6QA 1YLAA 2DAIA 3FUVA 1N32M 4LGYA 3TQSA 4LJAA 3LQRA 2H1RA 4GC9A 4JI6M 2Y20A 2YR0A 4JXJA 4A3VB 5DYIA 1K3WA 3VFDA 5C18A 1QZEA 4BBAA 2Y21A 2QBYB 4P16A 1I4WA 2WSEF 1R7RA 1IN5A 2DHYA 2I7PA 1NJFA 2LVPC 2CHQA 3SMSA 2L7IA 4DR1M 1N36M 4IIWA 1L8QA 1IXSA 4WW0A 4DV3M 4DR4M 4OX9M 3TWLA 3JAMS 4LG2A 1Q3CA 4LJ5A 4MGKE 3UGJA 3ZH9B 1N34M 1E9SA 4FW9A 4GEWA 1OAIA 1NY5A 4PDGA 2CFOA 2F5QA 3HHZA 2EJSA 5FTNA 2W82A 1XHBA 4X66M 4KO8A 1W5SA 2JXNA 1HNXM 4JI1M 2G3QA 2EKKA 2JP7A 2KA6B 3FUTA 3LQQA 4LJ4A 2Z4SA 3C58A 3SAUA 3K9OA 1ORYB 5A2QS 2XH9A 3LVVA 2OQ4A 2D7EA 2F5OA 1BVSA 1NV8A 1DGBA 2G8LA 5LMUM 3VLFB 5E26A 2LXEA 1ZAEA 2R65A 3D8LA 4L78A 4JI3M 3U60B 2EUCA 1GVNA 4BLCA 4M9SA 1G41A 2CRUA 3SMPA 4CGYB 4I81A 1DGHA 2FOIC 1TGUA 2RGHA 2I7NA 1SXJE 3HZJA 5GKNA 5FSWA 3U61B 1SG9A 1NNUC 4ITQA 3L25A 2ZANA 1GJTA 1LTMA 4AG6A 4MGHA 1S3SA 2A5YB 2JUJA 2XFTA 2N35A 2CE7A 2M5ZA 2MROB 3FRHA 4LF5M 5C1BA 2VF8A 2LNHC 4F2LA 2C99A 4AG5A 2L4FA 3FE3A 3KOZE 4DV7M 3SFZA 4LF9M 4JI2M 2QSFX 3KP0E 1QYRA 1PJTA 3HJQA 5EP3A 1WGLA 2JY6B 4WP2A 3THGA 3VK8A 4CISA 1Z59A 3U6PA 3KP1E 3AV0A 3AKZA 4Q7JA 1OFIA 2BWBA 4QOZC 1MN3A 3BOSA 3GLIA 1YSYA 4CJ6A 3K9PA 2KZSA 4NSOB 3GRUA 4DR2M 1LV7A 3HWSA 4REZA 3TPZA 2DHRA 5FLXS 1GLNA 3K1JA 3JR4A 4LF6M 3GLFE 3Q8XA 4LFCM 4B3RM 5IREB 3L2AA 1OIPA 4FVMA 3WHKA 5JI3E 3UMMA 4AQYM 4IBFA 2UUAM 4OW0A 4KT0F 2K0BX 4TUWA 1F4IA 1KYIA 3RFWA 1OAOC 2XLJA 1G4AE 1YE9A 3IG8A 1ZMVA 2YFQA 2KHHA 4MGZE 2X4AA 1IY0A 2C98A 2C96A 2JZ1A 4DR7M 3C9PA 2LVOC 2Z4RA 1R2ZA 5EQTA 4LJ7A 2UXBM 1QDRA 1IN4A 2MR9A 2X49A 3MHVC 1ZMWA 1Z5AA 2CV1A 1NO1A 3RGSA 4AW4A 1C1KA 2OPFA 4DUZM 1IXRC 4S12A 3FUUA 3R8FA 1TR8A 2MH8A 2QENA 3HX3A 4B3TM 3U6EA 5KQDA 1QDTA 4LFBM 4AKIA 1N75A 3U5ZB 1IFYA 4LCBA 3I01M 1TF0B 2RKOA 1R6BX 2HAKA 3MMPA 2UXDM 4KLNA 2XEPA 3LVWA 3Q8GA 1QAOA 2FS1A 3QAUA 4HEOA 4GRIA 3I4YA 5KQ8A 1GL7A 1HQYE 4NSRA 4B3MM 3GQ4A 2WSFF 2VQFM 2K47A 2D7GA 1T6OA 2QP9X 2QPAA 4LFAM 2XFSA 5DYGA 1QANA 1HT2E 3FYDA 2YNMD 3GPYA 1D0KA 3U6SA 3SATA 4DV5M 3KSJA 2VQEM 3ZC7B 2M60A 3A42A 3B74A 5LMNM 3K8ZA 4RF1A 2DWLA 5F3WA 1N78A 3IECA 3FKEA 3FUXA 3D8BA 1G59A 4JI0M 1R2YA 4RKUF 2F5SA 1HR0M 3GLIB 1FJGM 3AL0C 1V33A 2L7HA 2CWBA 2B3TA 1D2NA 4JYAM 3IG5A 1VEKA 2KZUA 2LVAA 3B89A 4DV1M 1XMOM 2Q2EB 2KXEA 2CV0A 4B7HA 1K82A 3TWMA 2CHVA 2HKJA 5KPRA 4XBOA 3ILKA 3U6MA 1TH3A 3CF0A 3H4MA 4G4QA 5EP4A 2L2DA 2EO2A 5EXPA 4B08A 2MJ5B 3A98B 1GKIA 4LGMA 3GRYA 2C5RA 1V92A 2JNHA 1XNQM 3GP1A 2ZTCA 3QWLA 4MGIE 2R4JA 3GRVA 2F5PA 4JI7M 1X37A 2DENA 2XF3A 1D0LA 5ITYA 2QBYA 4PCZA 1L2DA 3E9SA 3LCVB 4FWGA 4QNRA 3AOEA 1Q39A 2Z8YM 4PDIA 5FTLA 4QHSA 1IXZA 1Q3BA 2JA2A 3E21A 5JI2E 2E5LM 3GQ5A 4LZZA 3MK6A 4QNMA 3KW6A 4JN6A 1R5LA 4GKJM 3CF6E 1JQJC 4RF0A 5ITQA 1FNNA 3U6CA 1XB2B 3T6PA 1Z5CA 4P17A 3QYEA 4GIPA 1E32A 4PT5A 3C3DA 3UZUA 1UFZA 4EIWA 2KDLA 4CIZA 2X8AA 4I4LA 3GPUA 4LY6A 2QQ8A 4IBJA 2KRUA 5E6JA 1NJGA 4HL4A 3FYCA 4L6V6 5IZ7D 3A45A 4X64M 3SC3A 3DA1A 2JZ0A 3KDSE 3LCUA 4IBCA 2Y0TA 4B3SM 1ZQ9A 2NQ8C 3OTOM 4I5SA 3SYKA 3R9XB 3GLFB 5BPVA 3EIEA 3GLHB 1DO2A 3SHGB 3WHLA 2ZAMA 1J7KA 1WR1B 2FNAA 1QUTA 5ITUA 1NHWC 2QNJA 1ZMUA 4L4UA 4Y28F 2DAKA 1VQ1A 3LW5F 2V6ZM 1DO0A 1L1TA 3J80S 3HJSA 3A46A 3T1YM 1HNZM 4M0WA 4GMQA 1NNJA 2LVNC 2APLA 1TDZA 1GABA 2J5YA 4MM3B 1AIPC 4D81A 3L26A 2DZOB 3W0LB 3QYBA 3CGWA 4LJ6A 4IBGA 2DXIA 3PNVA 3B7NA 2ERCA 3VKHA 4JI5M 1WGNA 3VDUA 2J7NA 1OIZA 2OOAA 3U6DA 2DVWB 1MJGM 2CV2A 2Z7JA 3L28A 3M0EA 3UJNA 4FCVA 2FFJA 4L15A 3K92A 2KEBA 2LHCA 2DWZB 1T3TA 4DUYM 4JV5M 3KS4A 2DAEA 1RU3A 1TDHA 4M9XA 5FTKA 3V76A 3FUWA 2ZTDA 1XWIA 1VDLA 4NRVA 4W5WA 3KOXE 3HHYA 4G4RA 4DR5M 4GITA 1JR3E 2CP8A 4DV4M 3HU2A 3HKPA 2UUBM 4X65M 4NL4H 3GLGB 1R4GA 4M9ZA 1NV9A 4B7FA 1A5TA 3JR5A 3ZQJA 3GLGA 2CHGA 3CTWB 4II7A 3SARA 2DAGA 3FTFA 3B7ZA 1PJIA 1UM8A 3KXEC 2R62A 1JB0F 2R44A 3K2LA 4LJ9A 4G4NA 4XK8F 2DNAA 3NWLA 1IY1A 2CEAA 1V34A 1XXHB 2KW0A 2CUZA 1L2CA 2ZM6M 3UK6A 1C7YA 4GC5A 2R4EA 1MU5A 2HL7A 4LF4M 4WURA 2MGWA 1G3IA 4OU7A 2HHHM 4FWDA 4NOOB 2UUCM 4FCTA 3U60A 2QZ4A 2R18A 1IXSB 1WHCA 2HWJA 1QAMA 3U6OA 1IBLM 2DZNB 2WSCF 1Z6TA 1L1ZA 4Z8XA 4I8OA 4D80A 1J09A 2EA0A 4L8RC 2J7OA 2BJVA 3FRIA 3KS8A 3KOWE 2VDBB 3RGPA 4D82A 2C9OA 1I94M 4JI4M 2FH0A 1OKSA 2R0IA 5EJCA 5DNYA 3PXGA 2F5NA 3B7QA 2RGOA 3F92A 4GHAA 4GH9A 3AOEC 1IN6A 1JR3A 1WIVA 4B7GA 3RE8A 2GQFA 2V1UA 1OTRA 3HY5A 3W0FA 4ANRA 1PGYA 2GNOA 3J27B 1J5EM 3VDPA 4IJFA 3KFUG 3DFZA 3AOGA 3U5ZA 1YUBA 2DZLA 3KSXA 1XNRM 2LH0A 8CATA 1D0MA 1NY6A 2H5XA 4IBBA 3SAVA 1KSFX 2DKLA 2F4VM 3T38A 2QCUA 1IM2A 4LRTA 2L6OA 2VF7A 4QHTA 1OFHA 2QHOB 1TH4A 5H37D 1L2BA 1GL6A 3ZCBB 3NBIA 4YHHM 2KNVA 2KRKA 5ITRA 4IBDA 1Y8GA 4NXNM 4AI6A 4FCWA 2JWSA 3I51A 2K6BA 3J81S 2DWNA 4GKKM 2JY7A 2P5TA 1IN8A 4LF8M 3VK7A 4MH0E 1H6UA 1PJSA 2OOBA 1PJQA 5L8RF 3SBJA 4AKGA 1XXHE 3TWKA 3HU1A 2XSZD 2DWMA 3BBZA 3HJ8A 3SYLA 1XXHA 2D7HA 4IBKA 4NXMM 2O25A 4AZFA 5EP1A 1G8PA 3SHFA 1PJJA 4K0KM 1QVRA 2BNKA 1SXJC 1SXJD 1OJLA 2BWEA 3FD9A 3LMMA 1TTEA 3PNYA 3HHWA 3GLGE 4DV2M 3FTEA 1NVMA 2UXCM 2LWXA 2RRUA 5KO3A 4FD2A 4PD2A 4HLQA 1T43A 2JY8A 4M0DA 3W67A 5IWAM 3L29A 3TE6A 2L09A 3I4VA 4OVZA 4LJ8A 1PM5A 1IN7A 3FTDA 2O01F 4OVZB 2O5RA 4NRWA 2OO9A 4MB7A 2FE8A 4NC6A 1HJPA 2C9CA 7CATA 4GHLA 4KHPM 5BR8M 3NBXX 4KODA 5KPZA 3HU3A 3HGIA 1VDDA 3H4JA 1Q02A 4R71A
chains in the Genus database with same CATH topology
2DI0A 1BVSA 1JR3E 1NV8A 1VEKA 1VG5A 2CP8A 2LVAA 2JY5A 4DBGB 1EFUB 3B89A 1WJ7A 1DV0A 1P3QQ 2KNAA 1R4GA 1G41A 1NV9A 1A5TA 2KNZA 2DAGA 1E94E 2L2DA 2MJ5B 1HT1E 2DNAA 2LVQD 1SG9A 4UN2B 1C7YA 1V92A 2JNHA 2ZTCA 2MGWA 1G3IA 2JUJA 1ZV1A 3K9OA 2MROB 2WZJA 2DENA 3FRHA 2L4EA 5DFLA 4F2LA 1WHCA 2HWJA 2L4FA 3FE3A 3GLHE 3LCVB 2QSFX 2EKFA 1WGLA 2JY6B 4WP2A 4G3OA 1VEGA 2LTUA 4F1IA 4Q7JA 3FRIA 2BWBA 1MN3A 5JI2E 3K9PA 3E21A 2LBCA 2K9DA 1OKSA 2R0IA 3GLFE 3F92A 1XB2B 3T6PA 1WIVA 1OTRA 2K0BX 3IHPA 1F4IA 1KYIA 1UFZA 1G4AE 1PGYA 1GO5A 3GLIE 1ZMVA 2KHHA 1OQYA 2DZLA 1CUKA 3E46A 2JZ1A 1VEJA 2DAMA 2H5XA 2JZ0A 1YLAA 2DAIA 2DKLA 2LVOC 3LCUA 2MR9A 1IM2A 2QHOB 1ZMWA 1DO2A 1WR1B 2KNVA 2QNJA 1ZMUA 1TR8A 1Y8GA 1QZEA 2DAKA 1VQ1A 2JY7A 1IFYA 1DO0A 3MMPA 2HAKA 2DHYA 2LVPC 2OOBA 4HEOA 1XXHE 2LVNC 3BBZA 1AIPC 1HQYE 1T6OA 2O25A 1IXSA 3GLGE 1HT2E 2BWEA 1TTEA 1WGNA 2RRUA 2OOAA 1T43A 2JY8A 4GEWA 1OAIA 3IECA 2EJSA 2OO9A 1HJPA 2DAEA 2G3QA 2EKKA 2JP7A 3H4JA 1Q02A 2ZTDA 1VDLA 2CWBA 4R71A 2B3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI0 A;  1BVS A;  1JR3 E;  1NV8 A;  1VEK A;  1VG5 A;  2CP8 A;  2LVA A;  2JY5 A;  4DBG B;  1EFU B;  3B89 A;  1WJ7 A;  1DV0 A;  1P3Q Q;  2KNA A;  1R4G A;  1G41 A;  1NV9 A;  1A5T A;  2KNZ A;  2DAG A;  1E94 E;  2L2D A;  2MJ5 B;  1HT1 E;  2DNA A;  2LVQ D;  1SG9 A;  4UN2 B;  1C7Y A;  1V92 A;  2JNH A;  2ZTC A;  2MGW A;  1G3I A;  2JUJ A;  1ZV1 A;  3K9O A;  2MRO B;  2WZJ A;  2DEN A;  3FRH A;  2L4E A;  5DFL A;  4F2L A;  1WHC A;  2HWJ A;  2L4F A;  3FE3 A;  3GLH E;  3LCV B;  2QSF X;  2EKF A;  1WGL A;  2JY6 B;  4WP2 A;  4G3O A;  1VEG A;  2LTU A;  4F1I A;  4Q7J A;  3FRI A;  2BWB A;  1MN3 A;  5JI2 E;  3K9P A;  3E21 A;  2LBC A;  2K9D A;  1OKS A;  2R0I A;  3GLF E;  3F92 A;  1XB2 B;  3T6P A;  1WIV A;  1OTR A;  2K0B X;  3IHP A;  1F4I A;  1KYI A;  1UFZ A;  1G4A E;  1PGY A;  1GO5 A;  3GLI E;  1ZMV A;  2KHH A;  1OQY A;  2DZL A;  1CUK A;  3E46 A;  2JZ1 A;  1VEJ A;  2DAM A;  2H5X A;  2JZ0 A;  1YLA A;  2DAI A;  2DKL A;  2LVO C;  3LCU A;  2MR9 A;  1IM2 A;  2QHO B;  1ZMW A;  1DO2 A;  1WR1 B;  2KNV A;  2QNJ A;  1ZMU A;  1TR8 A;  1Y8G A;  1QZE A;  2DAK A;  1VQ1 A;  2JY7 A;  1IFY A;  1DO0 A;  3MMP A;  2HAK A;  2DHY A;  2LVP C;  2OOB A;  4HEO A;  1XXH E;  2LVN C;  3BBZ A;  1AIP C;  1HQY E;  1T6O A;  2O25 A;  1IXS A;  3GLG E;  1HT2 E;  2BWE A;  1TTE A;  1WGN A;  2RRU A;  2OOA A;  1T43 A;  2JY8 A;  4GEW A;  1OAI A;  3IEC A;  2EJS A;  2OO9 A;  1HJP A;  2DAE A;  2G3Q A;  2EKK A;  2JP7 A;  3H4J A;  1Q02 A;  2ZTD A;  1VDL A;  2CWB A;  4R71 A;  2B3T A; 
#chains in the Genus database with same CATH topology
 1IY2 A;  2DI0 A;  4RNA A;  3TL4 X;  4G4O A;  1VG5 A;  4IJE A;  4G6Z A;  5EXS A;  1EE8 A;  2JY5 A;  4DBG B;  4YY3 M;  1EFU B;  4MGY E;  3C3E A;  2XZF A;  1DGF A;  1WJ7 A;  1DV0 A;  1P3Q Q;  4DR3 M;  2KNA A;  1IBM M;  1QQW A;  3M7G A;  3GPX A;  2KNZ A;  3GQ3 A;  5FTJ A;  3GPP A;  2Y0Q A;  1E94 E;  3CF2 A;  3E4R A;  4XGI A;  5FTM A;  1QUS A;  1Z5B A;  3FTC A;  1HT1 E;  2LVQ D;  4QOS A;  4UN2 B;  1GJS A;  1EIJ A;  5ITX E;  1QAQ A;  1G71 A;  1JR3 D;  2HCB A;  3DOA A;  2UU9 M;  2YQZ A;  3L27 A;  3PVS A;  5EXT A;  1SXJ A;  5ITX A;  4AKH A;  1E9R A;  1K3X A;  1SXJ B;  1ZV1 A;  2R45 A;  2WZJ A;  5IT9 S;  2L4E A;  1TH2 A;  1XC8 A;  5DFL A;  3J2P B;  4IBI A;  1N33 M;  4DR6 M;  3BXW A;  3GLH E;  2LHG A;  3DZD A;  2V1C A;  3KVW A;  4R3D A;  4DV0 M;  3AJI B;  3SAW A;  2G5G X;  1N77 A;  3M6A A;  2EKF A;  4LZJ A;  3T15 A;  4LRS A;  1HQC A;  1W5T A;  1MX0 A;  3PFI A;  4G3O A;  3GO8 A;  1VEG A;  3J7A S;  3U6L A;  2LTU A;  3EIH A;  4FWH A;  4L16 A;  4F1I A;  4LF7 M;  4DV6 M;  1IQP A;  4BB9 A;  5KPT A;  3HHX A;  2Z3X A;  1WXQ A;  5EXX A;  1HNW M;  2LBC A;  2K9D A;  3B9P A;  2XZU A;  2ZBK B;  3J7B A;  1NHG C;  2XGN A;  2R6F A;  1DGG A;  3GRR A;  4X62 M;  3KOY E;  3T1H M;  3SAS A;  2BJW A;  3I04 M;  3VKG A;  4R7G A;  3GLF A;  1KFV A;  3MJ5 A;  1IBK M;  3GLH A;  1AUA A;  1NSF A;  2XSZ A;  2VII A;  1DGH B;  1QZM A;  2AHM A;  2R46 A;  3IHP A;  3W68 A;  4Z6Y A;  2ZAO A;  1GO5 A;  5ITT A;  3GLI E;  3U61 A;  4JI8 M;  1XMQ M;  1OQY A;  4ZPX A;  3AFH A;  1CUK A;  3E46 A;  1PRB A;  4IBE A;  5EP2 A;  4CHT B;  1VEJ A;  2DAM A;  3U6Q A;  1YLA A;  2DAI A;  3FUV A;  1N32 M;  4LGY A;  3TQS A;  4LJA A;  3LQR A;  2H1R A;  4GC9 A;  4JI6 M;  2Y20 A;  2YR0 A;  4JXJ A;  4A3V B;  5DYI A;  1K3W A;  3VFD A;  5C18 A;  1QZE A;  4BBA A;  2Y21 A;  2QBY B;  4P16 A;  1I4W A;  2WSE F;  1R7R A;  1IN5 A;  2DHY A;  2I7P A;  1NJF A;  2LVP C;  2CHQ A;  3SMS A;  2L7I A;  4DR1 M;  1N36 M;  4IIW A;  1L8Q A;  1IXS A;  4WW0 A;  4DV3 M;  4DR4 M;  4OX9 M;  3TWL A;  3JAM S;  4LG2 A;  1Q3C A;  4LJ5 A;  4MGK E;  3UGJ A;  3ZH9 B;  1N34 M;  1E9S A;  4FW9 A;  4GEW A;  1OAI A;  1NY5 A;  4PDG A;  2CFO A;  2F5Q A;  3HHZ A;  2EJS A;  5FTN A;  2W82 A;  1XHB A;  4X66 M;  4KO8 A;  1W5S A;  2JXN A;  1HNX M;  4JI1 M;  2G3Q A;  2EKK A;  2JP7 A;  2KA6 B;  3FUT A;  3LQQ A;  4LJ4 A;  2Z4S A;  3C58 A;  3SAU A;  3K9O A;  1ORY B;  5A2Q S;  2XH9 A;  3LVV A;  2OQ4 A;  2D7E A;  2F5O A;  1BVS A;  1NV8 A;  1DGB A;  2G8L A;  5LMU M;  3VLF B;  5E26 A;  2LXE A;  1ZAE A;  2R65 A;  3D8L A;  4L78 A;  4JI3 M;  3U60 B;  2EUC A;  1GVN A;  4BLC A;  4M9S A;  1G41 A;  2CRU A;  3SMP A;  4CGY B;  4I81 A;  1DGH A;  2FOI C;  1TGU A;  2RGH A;  2I7N A;  1SXJ E;  3HZJ A;  5GKN A;  5FSW A;  3U61 B;  1SG9 A;  1NNU C;  4ITQ A;  3L25 A;  2ZAN A;  1GJT A;  1LTM A;  4AG6 A;  4MGH A;  1S3S A;  2A5Y B;  2JUJ A;  2XFT A;  2N35 A;  2CE7 A;  2M5Z A;  2MRO B;  3FRH A;  4LF5 M;  5C1B A;  2VF8 A;  2LNH C;  4F2L A;  2C99 A;  4AG5 A;  2L4F A;  3FE3 A;  3KOZ E;  4DV7 M;  3SFZ A;  4LF9 M;  4JI2 M;  2QSF X;  3KP0 E;  1QYR A;  1PJT A;  3HJQ A;  5EP3 A;  1WGL A;  2JY6 B;  4WP2 A;  3THG A;  3VK8 A;  4CIS A;  1Z59 A;  3U6P A;  3KP1 E;  3AV0 A;  3AKZ A;  4Q7J A;  1OFI A;  2BWB A;  4QOZ C;  1MN3 A;  3BOS A;  3GLI A;  1YSY A;  4CJ6 A;  3K9P A;  2KZS A;  4NSO B;  3GRU A;  4DR2 M;  1LV7 A;  3HWS A;  4REZ A;  3TPZ A;  2DHR A;  5FLX S;  1GLN A;  3K1J A;  3JR4 A;  4LF6 M;  3GLF E;  3Q8X A;  4LFC M;  4B3R M;  5IRE B;  3L2A A;  1OIP A;  4FVM A;  3WHK A;  5JI3 E;  3UMM A;  4AQY M;  4IBF A;  2UUA M;  4OW0 A;  4KT0 F;  2K0B X;  4TUW A;  1F4I A;  1KYI A;  3RFW A;  1OAO C;  2XLJ A;  1G4A E;  1YE9 A;  3IG8 A;  1ZMV A;  2YFQ A;  2KHH A;  4MGZ E;  2X4A A;  1IY0 A;  2C98 A;  2C96 A;  2JZ1 A;  4DR7 M;  3C9P A;  2LVO C;  2Z4R A;  1R2Z A;  5EQT A;  4LJ7 A;  2UXB M;  1QDR A;  1IN4 A;  2MR9 A;  2X49 A;  3MHV C;  1ZMW A;  1Z5A A;  2CV1 A;  1NO1 A;  3RGS A;  4AW4 A;  1C1K A;  2OPF A;  4DUZ M;  1IXR C;  4S12 A;  3FUU A;  3R8F A;  1TR8 A;  2MH8 A;  2QEN A;  3HX3 A;  4B3T M;  3U6E A;  5KQD A;  1QDT A;  4LFB M;  4AKI A;  1N75 A;  3U5Z B;  1IFY A;  4LCB A;  3I01 M;  1TF0 B;  2RKO A;  1R6B X;  2HAK A;  3MMP A;  2UXD M;  4KLN A;  2XEP A;  3LVW A;  3Q8G A;  1QAO A;  2FS1 A;  3QAU A;  4HEO A;  4GRI A;  3I4Y A;  5KQ8 A;  1GL7 A;  1HQY E;  4NSR A;  4B3M M;  3GQ4 A;  2WSF F;  2VQF M;  2K47 A;  2D7G A;  1T6O A;  2QP9 X;  2QPA A;  4LFA M;  2XFS A;  5DYG A;  1QAN A;  1HT2 E;  3FYD A;  2YNM D;  3GPY A;  1D0K A;  3U6S A;  3SAT A;  4DV5 M;  3KSJ A;  2VQE M;  3ZC7 B;  2M60 A;  3A42 A;  3B74 A;  5LMN M;  3K8Z A;  4RF1 A;  2DWL A;  5F3W A;  1N78 A;  3IEC A;  3FKE A;  3FUX A;  3D8B A;  1G59 A;  4JI0 M;  1R2Y A;  4RKU F;  2F5S A;  1HR0 M;  3GLI B;  1FJG M;  3AL0 C;  1V33 A;  2L7H A;  2CWB A;  2B3T A;  1D2N A;  4JYA M;  3IG5 A;  1VEK A;  2KZU A;  2LVA A;  3B89 A;  4DV1 M;  1XMO M;  2Q2E B;  2KXE A;  2CV0 A;  4B7H A;  1K82 A;  3TWM A;  2CHV A;  2HKJ A;  5KPR A;  4XBO A;  3ILK A;  3U6M A;  1TH3 A;  3CF0 A;  3H4M A;  4G4Q A;  5EP4 A;  2L2D A;  2EO2 A;  5EXP A;  4B08 A;  2MJ5 B;  3A98 B;  1GKI A;  4LGM A;  3GRY A;  2C5R A;  1V92 A;  2JNH A;  1XNQ M;  3GP1 A;  2ZTC A;  3QWL A;  4MGI E;  2R4J A;  3GRV A;  2F5P A;  4JI7 M;  1X37 A;  2DEN A;  2XF3 A;  1D0L A;  5ITY A;  2QBY A;  4PCZ A;  1L2D A;  3E9S A;  3LCV B;  4FWG A;  4QNR A;  3AOE A;  1Q39 A;  2Z8Y M;  4PDI A;  5FTL A;  4QHS A;  1IXZ A;  1Q3B A;  2JA2 A;  3E21 A;  5JI2 E;  2E5L M;  3GQ5 A;  4LZZ A;  3MK6 A;  4QNM A;  3KW6 A;  4JN6 A;  1R5L A;  4GKJ M;  3CF6 E;  1JQJ C;  4RF0 A;  5ITQ A;  1FNN A;  3U6C A;  1XB2 B;  3T6P A;  1Z5C A;  4P17 A;  3QYE A;  4GIP A;  1E32 A;  4PT5 A;  3C3D A;  3UZU A;  1UFZ A;  4EIW A;  2KDL A;  4CIZ A;  2X8A A;  4I4L A;  3GPU A;  4LY6 A;  2QQ8 A;  4IBJ A;  2KRU A;  5E6J A;  1NJG A;  4HL4 A;  3FYC A;  4L6V 6;  5IZ7 D;  3A45 A;  4X64 M;  3SC3 A;  3DA1 A;  2JZ0 A;  3KDS E;  3LCU A;  4IBC A;  2Y0T A;  4B3S M;  1ZQ9 A;  2NQ8 C;  3OTO M;  4I5S A;  3SYK A;  3R9X B;  3GLF B;  5BPV A;  3EIE A;  3GLH B;  1DO2 A;  3SHG B;  3WHL A;  2ZAM A;  1J7K A;  1WR1 B;  2FNA A;  1QUT A;  5ITU A;  1NHW C;  2QNJ A;  1ZMU A;  4L4U A;  4Y28 F;  2DAK A;  1VQ1 A;  3LW5 F;  2V6Z M;  1DO0 A;  1L1T A;  3J80 S;  3HJS A;  3A46 A;  3T1Y M;  1HNZ M;  4M0W A;  4GMQ A;  1NNJ A;  2LVN C;  2APL A;  1TDZ A;  1GAB A;  2J5Y A;  4MM3 B;  1AIP C;  4D81 A;  3L26 A;  2DZO B;  3W0L B;  3QYB A;  3CGW A;  4LJ6 A;  4IBG A;  2DXI A;  3PNV A;  3B7N A;  2ERC A;  3VKH A;  4JI5 M;  1WGN A;  3VDU A;  2J7N A;  1OIZ A;  2OOA A;  3U6D A;  2DVW B;  1MJG M;  2CV2 A;  2Z7J A;  3L28 A;  3M0E A;  3UJN A;  4FCV A;  2FFJ A;  4L15 A;  3K92 A;  2KEB A;  2LHC A;  2DWZ B;  1T3T A;  4DUY M;  4JV5 M;  3KS4 A;  2DAE A;  1RU3 A;  1TDH A;  4M9X A;  5FTK A;  3V76 A;  3FUW A;  2ZTD A;  1XWI A;  1VDL A;  4NRV A;  4W5W A;  3KOX E;  3HHY A;  4G4R A;  4DR5 M;  4GIT A;  1JR3 E;  2CP8 A;  4DV4 M;  3HU2 A;  3HKP A;  2UUB M;  4X65 M;  4NL4 H;  3GLG B;  1R4G A;  4M9Z A;  1NV9 A;  4B7F A;  1A5T A;  3JR5 A;  3ZQJ A;  3GLG A;  2CHG A;  3CTW B;  4II7 A;  3SAR A;  2DAG A;  3FTF A;  3B7Z A;  1PJI A;  1UM8 A;  3KXE C;  2R62 A;  1JB0 F;  2R44 A;  3K2L A;  4LJ9 A;  4G4N A;  4XK8 F;  2DNA A;  3NWL A;  1IY1 A;  2CEA A;  1V34 A;  1XXH B;  2KW0 A;  2CUZ A;  1L2C A;  2ZM6 M;  3UK6 A;  1C7Y A;  4GC5 A;  2R4E A;  1MU5 A;  2HL7 A;  4LF4 M;  4WUR A;  2MGW A;  1G3I A;  4OU7 A;  2HHH M;  4FWD A;  4NOO B;  2UUC M;  4FCT A;  3U60 A;  2QZ4 A;  2R18 A;  1IXS B;  1WHC A;  2HWJ A;  1QAM A;  3U6O A;  1IBL M;  2DZN B;  2WSC F;  1Z6T A;  1L1Z A;  4Z8X A;  4I8O A;  4D80 A;  1J09 A;  2EA0 A;  4L8R C;  2J7O A;  2BJV A;  3FRI A;  3KS8 A;  3KOW E;  2VDB B;  3RGP A;  4D82 A;  2C9O A;  1I94 M;  4JI4 M;  2FH0 A;  1OKS A;  2R0I A;  5EJC A;  5DNY A;  3PXG A;  2F5N A;  3B7Q A;  2RGO A;  3F92 A;  4GHA A;  4GH9 A;  3AOE C;  1IN6 A;  1JR3 A;  1WIV A;  4B7G A;  3RE8 A;  2GQF A;  2V1U A;  1OTR A;  3HY5 A;  3W0F A;  4ANR A;  1PGY A;  2GNO A;  3J27 B;  1J5E M;  3VDP A;  4IJF A;  3KFU G;  3DFZ A;  3AOG A;  3U5Z A;  1YUB A;  2DZL A;  3KSX A;  1XNR M;  2LH0 A;  8CAT A;  1D0M A;  1NY6 A;  2H5X A;  4IBB A;  3SAV A;  1KSF X;  2DKL A;  2F4V M;  3T38 A;  2QCU A;  1IM2 A;  4LRT A;  2L6O A;  2VF7 A;  4QHT A;  1OFH A;  2QHO B;  1TH4 A;  5H37 D;  1L2B A;  1GL6 A;  3ZCB B;  3NBI A;  4YHH M;  2KNV A;  2KRK A;  5ITR A;  4IBD A;  1Y8G A;  4NXN M;  4AI6 A;  4FCW A;  2JWS A;  3I51 A;  2K6B A;  3J81 S;  2DWN A;  4GKK M;  2JY7 A;  2P5T A;  1IN8 A;  4LF8 M;  3VK7 A;  4MH0 E;  1H6U A;  1PJS A;  2OOB A;  1PJQ A;  5L8R F;  3SBJ A;  4AKG A;  1XXH E;  3TWK A;  3HU1 A;  2XSZ D;  2DWM A;  3BBZ A;  3HJ8 A;  3SYL A;  1XXH A;  2D7H A;  4IBK A;  4NXM M;  2O25 A;  4AZF A;  5EP1 A;  1G8P A;  3SHF A;  1PJJ A;  4K0K M;  1QVR A;  2BNK A;  1SXJ C;  1SXJ D;  1OJL A;  2BWE A;  3FD9 A;  3LMM A;  1TTE A;  3PNY A;  3HHW A;  3GLG E;  4DV2 M;  3FTE A;  1NVM A;  2UXC M;  2LWX A;  2RRU A;  5KO3 A;  4FD2 A;  4PD2 A;  4HLQ A;  1T43 A;  2JY8 A;  4M0D A;  3W67 A;  5IWA M;  3L29 A;  3TE6 A;  2L09 A;  3I4V A;  4OVZ A;  4LJ8 A;  1PM5 A;  1IN7 A;  3FTD A;  2O01 F;  4OVZ B;  2O5R A;  4NRW A;  2OO9 A;  4MB7 A;  2FE8 A;  4NC6 A;  1HJP A;  2C9C A;  7CAT A;  4GHL A;  4KHP M;  5BR8 M;  3NBX X;  4KOD A;  5KPZ A;  3HU3 A;  3HGI A;  1VDD A;  3H4J A;  1Q02 A;  4R71 A; 
#chains in the Genus database with same CATH homology
 2DI0 A;  1BVS A;  1JR3 E;  1NV8 A;  1VEK A;  1VG5 A;  2CP8 A;  2LVA A;  2JY5 A;  4DBG B;  1EFU B;  3B89 A;  1WJ7 A;  1DV0 A;  1P3Q Q;  2KNA A;  1R4G A;  1G41 A;  1NV9 A;  1A5T A;  2KNZ A;  2DAG A;  1E94 E;  2L2D A;  2MJ5 B;  1HT1 E;  2DNA A;  2LVQ D;  1SG9 A;  4UN2 B;  1C7Y A;  1V92 A;  2JNH A;  2ZTC A;  2MGW A;  1G3I A;  2JUJ A;  1ZV1 A;  3K9O A;  2MRO B;  2WZJ A;  2DEN A;  3FRH A;  2L4E A;  5DFL A;  4F2L A;  1WHC A;  2HWJ A;  2L4F A;  3FE3 A;  3GLH E;  3LCV B;  2QSF X;  2EKF A;  1WGL A;  2JY6 B;  4WP2 A;  4G3O A;  1VEG A;  2LTU A;  4F1I A;  4Q7J A;  3FRI A;  2BWB A;  1MN3 A;  5JI2 E;  3K9P A;  3E21 A;  2LBC A;  2K9D A;  1OKS A;  2R0I A;  3GLF E;  3F92 A;  1XB2 B;  3T6P A;  1WIV A;  1OTR A;  2K0B X;  3IHP A;  1F4I A;  1KYI A;  1UFZ A;  1G4A E;  1PGY A;  1GO5 A;  3GLI E;  1ZMV A;  2KHH A;  1OQY A;  2DZL A;  1CUK A;  3E46 A;  2JZ1 A;  1VEJ A;  2DAM A;  2H5X A;  2JZ0 A;  1YLA A;  2DAI A;  2DKL A;  2LVO C;  3LCU A;  2MR9 A;  1IM2 A;  2QHO B;  1ZMW A;  1DO2 A;  1WR1 B;  2KNV A;  2QNJ A;  1ZMU A;  1TR8 A;  1Y8G A;  1QZE A;  2DAK A;  1VQ1 A;  2JY7 A;  1IFY A;  1DO0 A;  3MMP A;  2HAK A;  2DHY A;  2LVP C;  2OOB A;  4HEO A;  1XXH E;  2LVN C;  3BBZ A;  1AIP C;  1HQY E;  1T6O A;  2O25 A;  1IXS A;  3GLG E;  1HT2 E;  2BWE A;  1TTE A;  1WGN A;  2RRU A;  2OOA A;  1T43 A;  2JY8 A;  4GEW A;  1OAI A;  3IEC A;  2EJS A;  2OO9 A;  1HJP A;  2DAE A;  2G3Q A;  2EKK A;  2JP7 A;  3H4J A;  1Q02 A;  2ZTD A;  1VDL A;  2CWB A;  4R71 A;  2B3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...