1WGLA

Solution structure of cue domain in the c-terminal of human toll-interacting protein (tollip)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSSGSSGCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-interacting protein
publication title Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
rcsb
source organism Homo sapiens
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wglA00
1E94E 2DAKA 1TTEA 3MMPA 1WHCA 4WP2A 1G3IA 2JZ1A 1T43A 3E46A 1ZV1A 1TR8A 1HJPA 1JR3E 2HAKA 3FRIA 1VQ1A 2EJSA 1HT2E 1VEGA 2OO9A 1OQYA 4F1IA 2CWBA 5JI2E 1A5TA 1V92A 2MROB 1MN3A 1G4AE 4HEOA 1IFYA 1VDLA 3BBZA 3IHPA 2K9DA 1PGYA 1NV9A 2L4EA 1QZEA 1VEKA 3GLGE 1WJ7A 1BVSA 1OTRA 3GLFE 1WGNA 2ZTDA 2JUJA 1G41A 1VEJA 1F4IA 1HQYE 2DI0A 3T6PA 2EKKA 2O25A 4Q7JA 2DNAA 4R71A 1XB2B 1SG9A 2LBCA 4G3OA 1VG5A 1EFUB 2MJ5B 2LVOC 2DHYA 4GEWA 2JY8A 2JNHA 2LTUA 1CUKA 3LCUA 1AIPC 2K0BX 1XXHE 1IM2A 2LVQD 2JP7A 2DZLA 1DO0A 1C7YA 3GLIE 3LCVB 1IXSA 2DENA 1ZMVA 2DAMA 1GO5A 1Y8GA 2KNAA 2KNVA 2BWEA 2DAIA 2MGWA 2QNJA 1UFZA 2LVNC 1OAIA 2WZJA 2DAGA 2MR9A 3FE3A 2QSFX 2OOAA 3B89A 3H4JA 3F92A 2JZ0A 1WGLA 4UN2B 1R4GA 1KYIA 3FRHA 1YLAA 3K9OA 1P3QQ 2JY5A 2OOBA 2JY6B 1WR1B 2LVAA 2B3TA 3IECA 2CP8A 2LVPC 4F2LA 2R0IA 1NV8A 2HWJA 2DAEA 1DO2A 2ZTCA 2QHOB 4DBGB 1Q02A 2JY7A 2BWBA 1ZMWA 3K9PA 3E21A 2L2DA 2G3QA 1T6OA 2EKFA 1DV0A 2RRUA 2DKLA 2H5XA 2L4FA 1ZMUA 5DFLA 1HT1E 3GLHE 2KHHA 2KNZA 1OKSA 1WIVA
chains in the Genus database with same CATH superfamily
2DAKA 3GO8A 1K3WA 1XHBA 3ZQJA 4L6V6 2CHGA 3VDPA 5ITXA 4DR1M 1D0MA 5FTLA 2UXDM 3FRIA 4JN6A 1YUBA 3HX3A 5KPRA 4HLQA 1PJSA 3A98B 4DR6M 1SXJE 4LF5M 3GPXA 4B7HA 1A5TA 1OIPA 4AKHA 3SAWA 4GC5A 3U6EA 1GL7A 3IG5A 3PXGA 4MB7A 4QOZC 3KSJA 1VDLA 3GPUA 3BBZA 5EXTA 3W0FA 4B08A 5E6JA 4A3VB 2L4EA 1VEKA 2DZNB 3T1HM 1NJFA 4NRWA 1OTRA 4FWDA 2F5OA 2M5ZA 3TE6A 2JUJA 4IBBA 2GQFA 4CJ6A 5DNYA 4OVZB 1Q39A 4LCBA 7CATA 3GLIB 1F4IA 4NXNM 3U5ZB 1N33M 1IXRC 3Q8XA 3TPZA 3JAMS 5EQTA 2KRKA 3FTCA 4IBIA 4LGYA 1QQWA 4R7GA 1PJJA 1GL6A 2X49A 2YFQA 4XGIA 1GJTA 4S12A 4Z6YA 1QAMA 5KPTA 1EFUB 2MJ5B 3FUWA 3L28A 4IJEA 3AV0A 4DR4M 4ANRA 3UGJA 2JY8A 2JNHA 2UXCM 4K0KM 5C1BA 2XEPA 3GPYA 1EE8A 4MH0E 2RGHA 3W68A 3GPPA 4DUZM 2LWXA 3CF0A 1XXHE 3KSXA 2J7NA 3MK6A 2UUBM 3KFUG 2LH0A 3AJIB 1R2ZA 1DO0A 4DV6M 4LJ4A 3NBIA 4LFAM 1C7YA 4PCZA 2HHHM 2EUCA 1QVRA 2I7PA 3W0LB 4LRTA 3HY5A 4GC9A 1WXQA 4AKIA 4NL4H 3UMMA 2DENA 4MGHA 4G4OA 2FFJA 1ZMVA 1Y8GA 4B3RM 2DAIA 2R4JA 2Z7JA 4KHPM 1SXJB 8CATA 1IN5A 1OAIA 1SXJD 2NQ8C 5H37D 3FE3A 4GKKM 4X65M 2OOAA 2JWSA 3F92A 3HJQA 1QUTA 2Z8YM 1KYIA 4LF7M 3FRHA 2ZAOA 3K9OA 1Z59A 3QAUA 1N34M 2JY6B 2LHGA 3IECA 4WURA 5KPZA 3W67A 4F2LA 4IBKA 3GLGA 4HL4A 4FCTA 3PFIA 1QUSA 3J80S 4AG6A 1VDDA 4IJFA 3T15A 1IBLM 2C9CA 2N35A 1W5TA 2CFOA 1MJGM 3J81S 1H6UA 4GIPA 3SC3A 1FNNA 1NY5A 3IG8A 1QYRA 4DBGB 5BPVA 2JY7A 3I01M 5ITTA 3R8FA 3E21A 1OAOC 3U6QA 4GHLA 2L7HA 1JQJC 2EO2A 2FS1A 1DV0A 2QPAA 2RRUA 3GQ4A 1N32M 5EP2A 1YSYA 3LMMA 1UM8A 3TL4X 1HT1E 3FUXA 3GLHE 3U61A 4JI0M 3B89A 1OKSA 1NNJA 1WIVA 1E94E 1S3SA 3U6PA 1Z5AA 5IREB 4MGYE 3L27A 1IY1A 2JZ1A 1J5EM 3DFZA 1DGHA 3U6LA 4JI4M 2YNMD 4DV0M 5DYIA 1JR3E 4I5SA 4DR5M 2QBYB 3AL0C 2R18A 4IBJA 2VIIA 4KLNA 4CGYB 5EXSA 4LGMA 5EP4A 4B3MM 4P16A 2CWBA 4NSOB 1V92A 5KQ8A 3VKGA 3U6MA 3UJNA 3KVWA 5FTNA 1I94M 3I04M 1IFYA 1XC8A 2UU9M 4LJ8A 2MH8A 2K9DA 3M6AA 1NV9A 5ITXE 3VK8A 4P17A 4NSRA 4L78A 1WJ7A 2D7GA 4LJ7A 3K2LA 1LV7A 1WGNA 4AI6A 1G41A 1QDTA 1G59A 3U6OA 2C99A 1TH2A 1T3TA 4DV1M 3VK7A 1OFIA 3SYKA 1K82A 2D7EA 2K6BA 1N78A 1D2NA 4R3DA 1ZQ9A 3A46A 3TWMA 4BLCA 1JB0F 5IWAM 4L15A 4OU7A 3GRRA 2DI0A 2ERCA 5L8RF 1N36M 3HJ8A 3VFDA 4Q7JA 2DNAA 3WHLA 1YE9A 1XB2B 3KP0E 4OVZA 3GLIA 2I7NA 3FUTA 3B7NA 2LBCA 3B7QA 4GITA 3M0EA 3DZDA 3K92A 4RNAA 2LVOC 1NHGC 3SARA 3B74A 3SYLA 5C18A 3B9PA 3EIHA 3E9SA 4QHSA 3UZUA 4JI1M 2LHCA 4LFBM 1C1KA 1IM2A 4FVMA 2JP7A 2KXEA 5LMNM 4JXJA 2CRUA 1NO1A 1PJIA 3LCVB 2VDBB 3HKPA 2UXBM 1IXSA 4BB9A 1XWIA 1Q3BA 1HNWM 2G8LA 1R5LA 1QANA 4LG2A 1GO5A 4Z8XA 3GRVA 3UK6A 4M9ZA 3FTEA 2QNJA 3AFHA 1PRBA 2HL7A 4JI6M 3K8ZA 4RF1A 2QZ4A 5KO3A 1UFZA 2LVNC 2HKJA 2DAGA 2KA6B 2JA2A 2MR9A 4W5WA 1IY0A 3CF2A 1G71A 4LJ9A 5GKNA 1GKIA 4JYAM 2ZAMA 4GRIA 4DR7M 1SXJA 3HHZA 1GLNA 4OW0A 2WSCF 3SHGB 1E9SA 2JY5A 1I4WA 2CE7A 2QQ8A 3PNVA 1Z5BA 4LY6A 4D80A 4DV5M 2DWNA 3J7AS 4MGKE 4REZA 2LVPC 4LF8M 1L1ZA 2G5GX 1GJSA 3AOGA 3QWLA 5DYGA 5EXPA 2YQZA 5KQDA 4M0DA 3EIEA 3D8LA 1IN4A 1D0LA 1LTMA 4AQYM 2BWBA 1V34A 1ZMWA 4G6ZA 4NRVA 2L2DA 4EIWA 1L2CA 3ZH9B 1X37A 2OQ4A 2K47A 1HNXM 5LMUM 2BJVA 1NSFA 4YHHM 2XF3A 1PM5A 5IZ7D 2DKLA 3FYCA 4AG5A 1XMOM 1L2BA 4L4UA 3GQ3A 1R7RA 2Q2EB 3KOZE 3SAUA 2F5QA 4IBDA 3KS8A 2XZUA 2KNZA 3HZJA 2DZOB 4FWHA 3U60B 1HQYE 3HHYA 2F4VM 1TTEA 3MMPA 4IBEA 4DUYM 2Z4RA 1T43A 1OIZA 4X66M 1TR8A 3KS4A 2QENA 4LZJA 1IXZA 2HAKA 1OJLA 3GLFA 1TH3A 2XGNA 3A42A 3L25A 2DWZB 3CGWA 1HT2E 4DV4M 2XSZD 4QHTA 2R4EA 3KW6A 4F1IA 2OPFA 4B3TM 2XFTA 1QAOA 4L8RC 5JI2E 2X8AA 1DGGA 2MROB 2M60A 4DV3M 1D0KA 2W82A 3CTWB 4HEOA 4KODA 1G8PA 2F5NA 2KZSA 5EXXA 3HU1A 4FD2A 3VDUA 2L09A 3U6CA 4NXMM 2ZANA 1QZEA 3GRUA 2KRUA 1GVNA 3QYBA 1AUAA 4DV2M 5A2QS 1IBKM 4XBOA 1XXHB 4FWGA 4JV5M 2ZTDA 1ORYB 3SMSA 5FLXS 1IQPA 1VEJA 1TDZA 4X62M 2V6ZM 4IBCA 2VF7A 3MJ5A 4B3SM 2JXNA 1KSFX 4IBGA 3KXEC 3FYDA 3NWLA 3ZCBB 1KFVA 2EKKA 2O25A 4KO8A 3WHKA 3HGIA 1V33A 1SG9A 2C98A 1NY6A 1VG5A 2L6OA 2UUCM 2V1UA 3U6SA 3C3EA 3D8BA 2DHYA 2LTUA 1CUKA 1NNUC 1OFHA 3LCUA 1AIPC 4DV7M 2LVQD 3RGSA 4CHTB 1E32A 2GNOA 2XFSA 3GLIE 4D82A 3U6DA 2C96A 4D81A 2CV2A 2Z4SA 2R6FA 3GRYA 2BJWA 1TH4A 2BWEA 2FH0A 3AKZA 2VQEM 3U61B 3GQ5A 3RGPA 3SFZA 3U5ZA 3TWKA 2J5YA 3QYEA 4BBAA 3TWLA 2VF8A 3A45A 4GMQA 2QSFX 3FTDA 2XZFA 3H4JA 2F5SA 3J27B 2APLA 2JZ0A 1DGHB 3AOEC 2UUAM 1IN6A 2Z3XA 3GLHB 5E26A 1PJTA 1IBMM 2CEAA 4JI2M 3LQRA 2OOBA 4LF4M 3C3DA 1WR1B 3K1JA 3B7ZA 2LVAA 2B3TA 2CP8A 3SATA 2A5YB 4WW0A 2QP9X 2R0IA 1NV8A 4M9XA 2HWJA 1GABA 2DAEA 3AOEA 2BNKA 2L7IA 1XNQM 2QHOB 2Y20A 1TF0B 2R65A 3KOYE 1SXJC 1JR3D 4MGIE 1QAQA 3K9PA 1L2DA 5ITUA 2O5RA 3T1YM 3LW5F 2CHQA 2DXIA 2V1CA 5ITRA 1Z6TA 1Q3CA 4G4QA 2EA0A 2ZBKB 5F3WA 2H5XA 1HNZM 3ZC7B 4PD2A 1ZMUA 2XH9A 3HHWA 5DFLA 3SBJA 4I8OA 2KHHA 2WZJA 2X4AA 3BXWA 1XNRM 4FW9A 3DOAA 4M0WA 4GKJM 3I4VA 5EP3A 5JI3E 1WHCA 4LF9M 4WP2A 1G3IA 1NHWC 3L29A 3PNYA 4PT5A 4PDIA 2KZUA 3NBXX 1L8QA 1N75A 3E46A 1ZV1A 2DWMA 4I81A 3U60A 1HJPA 3I51A 3J7BA 1VQ1A 3V76A 3VKHA 2EJSA 1VEGA 2OO9A 1OQYA 2C9OA 3H4MA 2CUZA 3C9PA 3HWSA 3KDSE 1MN3A 2R62A 1G4AE 4JI5M 3L2AA 5IT9S 1IN7A 1QZMA 2XSZA 5EJCA 3KOXE 3RFWA 3IHPA 4GH9A 1IXSB 1PGYA 1R6BX 2O01F 3GLGE 1HQCA 1BVSA 2DWLA 3PVSA 3GLFE 3VLFB 2ZM6M 4QOSA 2R44A 4LRSA 4GHAA 2AHMA 4DR3M 1ZAEA 4JI3M 1QDRA 2C5RA 4AW4A 1XXHA 3JR4A 3THGA 4IIWA 3T6PA 3RE8A 4AZFA 2R45A 4R71A 3I4YA 3BOSA 3FKEA 3LVVA 4G3OA 1IY2A 1J7KA 1RU3A 1Z5CA 2DVWB 2KEBA 4IBFA 2CV1A 4B7FA 2DHRA 2Y0TA 3LQQA 3FD9A 1W5SA 4CISA 4GEWA 1TGUA 2LXEA 2QBYA 2LNHC 1DGBA 2KDLA 2WSFF 3CF6E 3L26A 3FUVA 3KP1E 2E5LM 5FTJA 2K0BX 1L1TA 4CIZA 4QNMA 2Y0QA 2DZLA 3LVWA 2RGOA 4LFCM 1EIJA 5FTKA 1FJGM 3KOWE 1K3XA 4JI8M 5FSWA 4JI7M 4RF0A 4FCVA 4MGZE 2DAMA 1R2YA 3SAVA 2KNAA 2FOIC 2KNVA 2P5TA 4G4RA 2D7HA 4ITQA 4Y28F 2MGWA 1N77A 1PJQA 3HHXA 2YR0A 2HCBA 1MX0A 2WSEF 3J2PB 4I4LA 5BR8M 3C58A 2F5PA 2J7OA 3DA1A 4MM3B 3MHVC 2FE8A 1IN8A 4NC6A 3GLGB 4PDGA 1WGLA 4LJ6A 1J09A 4UN2B 4ZPXA 3OTOM 2VQFM 1R4GA 3Q8GA 2QCUA 3FUUA 3GLFB 1E9RA 1YLAA 1P3QQ 3HU3A 5ITYA 3TQSA 3R9XB 2CV0A 3FTFA 1NJGA 4M9SA 4X64M 4XK8F 5EP1A 4KT0F 3GLHA 4LJAA 2KW0A 2R46A 4L16A 4QNRA 2XLJA 1DO2A 2ZTCA 3HU2A 4G4NA 5ITQA 4OX9M 3ILKA 4TUWA 4RKUF 1Q02A 2RKOA 4YY3M 2CHVA 4LJ5A 3GP1A 3E4RA 3HJSA 3SHFA 4LF6M 4B7GA 2G3QA 4DR2M 2H1RA 3SMPA 1NVMA 1T6OA 2EKFA 4AKGA 4NOOB 3T38A 3JR5A 1MU5A 1JR3A 2L4FA 3SASA 1TDHA 5FTMA 1XMQM 1HR0M 4LZZA 4FCWA 4II7A 1DGFA 3M7GA 2Y21A 2FNAA
chains in the Genus database with same CATH topology
1E94E 2DAKA 1TTEA 3MMPA 1WHCA 4WP2A 1G3IA 2JZ1A 1T43A 3E46A 1ZV1A 1TR8A 1HJPA 1JR3E 2HAKA 3FRIA 1VQ1A 2EJSA 1HT2E 1VEGA 2OO9A 1OQYA 4F1IA 2CWBA 5JI2E 1A5TA 1V92A 2MROB 1MN3A 1G4AE 4HEOA 1IFYA 1VDLA 3BBZA 3IHPA 2K9DA 1PGYA 1NV9A 2L4EA 1QZEA 1VEKA 3GLGE 1WJ7A 1BVSA 1OTRA 3GLFE 1WGNA 2ZTDA 2JUJA 1G41A 1VEJA 1F4IA 1HQYE 2DI0A 3T6PA 2EKKA 2O25A 4Q7JA 2DNAA 4R71A 1XB2B 1SG9A 2LBCA 4G3OA 1VG5A 1EFUB 2MJ5B 2LVOC 2DHYA 4GEWA 2JY8A 2JNHA 2LTUA 1CUKA 3LCUA 1AIPC 2K0BX 1XXHE 1IM2A 2LVQD 2JP7A 2DZLA 1DO0A 1C7YA 3GLIE 3LCVB 1IXSA 2DENA 1ZMVA 2DAMA 1GO5A 1Y8GA 2KNAA 2KNVA 2BWEA 2DAIA 2MGWA 2QNJA 1UFZA 2LVNC 1OAIA 2WZJA 2DAGA 2MR9A 3FE3A 2QSFX 2OOAA 3B89A 3H4JA 3F92A 2JZ0A 1WGLA 4UN2B 1R4GA 1KYIA 3FRHA 1YLAA 3K9OA 1P3QQ 2JY5A 2OOBA 2JY6B 1WR1B 2LVAA 2B3TA 3IECA 2CP8A 2LVPC 4F2LA 2R0IA 1NV8A 2HWJA 2DAEA 1DO2A 2ZTCA 2QHOB 4DBGB 1Q02A 2JY7A 2BWBA 1ZMWA 3K9PA 3E21A 2L2DA 2G3QA 1T6OA 2EKFA 1DV0A 2RRUA 2DKLA 2H5XA 2L4FA 1ZMUA 5DFLA 1HT1E 3GLHE 2KHHA 2KNZA 1OKSA 1WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E94 E;  2DAK A;  1TTE A;  3MMP A;  1WHC A;  4WP2 A;  1G3I A;  2JZ1 A;  1T43 A;  3E46 A;  1ZV1 A;  1TR8 A;  1HJP A;  1JR3 E;  2HAK A;  3FRI A;  1VQ1 A;  2EJS A;  1HT2 E;  1VEG A;  2OO9 A;  1OQY A;  4F1I A;  2CWB A;  5JI2 E;  1A5T A;  1V92 A;  2MRO B;  1MN3 A;  1G4A E;  4HEO A;  1IFY A;  1VDL A;  3BBZ A;  3IHP A;  2K9D A;  1PGY A;  1NV9 A;  2L4E A;  1QZE A;  1VEK A;  3GLG E;  1WJ7 A;  1BVS A;  1OTR A;  3GLF E;  1WGN A;  2ZTD A;  2JUJ A;  1G41 A;  1VEJ A;  1F4I A;  1HQY E;  2DI0 A;  3T6P A;  2EKK A;  2O25 A;  4Q7J A;  2DNA A;  4R71 A;  1XB2 B;  1SG9 A;  2LBC A;  4G3O A;  1VG5 A;  1EFU B;  2MJ5 B;  2LVO C;  2DHY A;  4GEW A;  2JY8 A;  2JNH A;  2LTU A;  1CUK A;  3LCU A;  1AIP C;  2K0B X;  1XXH E;  1IM2 A;  2LVQ D;  2JP7 A;  2DZL A;  1DO0 A;  1C7Y A;  3GLI E;  3LCV B;  1IXS A;  2DEN A;  1ZMV A;  2DAM A;  1GO5 A;  1Y8G A;  2KNA A;  2KNV A;  2BWE A;  2DAI A;  2MGW A;  2QNJ A;  1UFZ A;  2LVN C;  1OAI A;  2WZJ A;  2DAG A;  2MR9 A;  3FE3 A;  2QSF X;  2OOA A;  3B89 A;  3H4J A;  3F92 A;  2JZ0 A;  1WGL A;  4UN2 B;  1R4G A;  1KYI A;  3FRH A;  1YLA A;  3K9O A;  1P3Q Q;  2JY5 A;  2OOB A;  2JY6 B;  1WR1 B;  2LVA A;  2B3T A;  3IEC A;  2CP8 A;  2LVP C;  4F2L A;  2R0I A;  1NV8 A;  2HWJ A;  2DAE A;  1DO2 A;  2ZTC A;  2QHO B;  4DBG B;  1Q02 A;  2JY7 A;  2BWB A;  1ZMW A;  3K9P A;  3E21 A;  2L2D A;  2G3Q A;  1T6O A;  2EKF A;  1DV0 A;  2RRU A;  2DKL A;  2H5X A;  2L4F A;  1ZMU A;  5DFL A;  1HT1 E;  3GLH E;  2KHH A;  2KNZ A;  1OKS A;  1WIV A; 
#chains in the Genus database with same CATH topology
 2DAK A;  3GO8 A;  1K3W A;  1XHB A;  3ZQJ A;  4L6V 6;  2CHG A;  3VDP A;  5ITX A;  4DR1 M;  1D0M A;  5FTL A;  2UXD M;  3FRI A;  4JN6 A;  1YUB A;  3HX3 A;  5KPR A;  4HLQ A;  1PJS A;  3A98 B;  4DR6 M;  1SXJ E;  4LF5 M;  3GPX A;  4B7H A;  1A5T A;  1OIP A;  4AKH A;  3SAW A;  4GC5 A;  3U6E A;  1GL7 A;  3IG5 A;  3PXG A;  4MB7 A;  4QOZ C;  3KSJ A;  1VDL A;  3GPU A;  3BBZ A;  5EXT A;  3W0F A;  4B08 A;  5E6J A;  4A3V B;  2L4E A;  1VEK A;  2DZN B;  3T1H M;  1NJF A;  4NRW A;  1OTR A;  4FWD A;  2F5O A;  2M5Z A;  3TE6 A;  2JUJ A;  4IBB A;  2GQF A;  4CJ6 A;  5DNY A;  4OVZ B;  1Q39 A;  4LCB A;  7CAT A;  3GLI B;  1F4I A;  4NXN M;  3U5Z B;  1N33 M;  1IXR C;  3Q8X A;  3TPZ A;  3JAM S;  5EQT A;  2KRK A;  3FTC A;  4IBI A;  4LGY A;  1QQW A;  4R7G A;  1PJJ A;  1GL6 A;  2X49 A;  2YFQ A;  4XGI A;  1GJT A;  4S12 A;  4Z6Y A;  1QAM A;  5KPT A;  1EFU B;  2MJ5 B;  3FUW A;  3L28 A;  4IJE A;  3AV0 A;  4DR4 M;  4ANR A;  3UGJ A;  2JY8 A;  2JNH A;  2UXC M;  4K0K M;  5C1B A;  2XEP A;  3GPY A;  1EE8 A;  4MH0 E;  2RGH A;  3W68 A;  3GPP A;  4DUZ M;  2LWX A;  3CF0 A;  1XXH E;  3KSX A;  2J7N A;  3MK6 A;  2UUB M;  3KFU G;  2LH0 A;  3AJI B;  1R2Z A;  1DO0 A;  4DV6 M;  4LJ4 A;  3NBI A;  4LFA M;  1C7Y A;  4PCZ A;  2HHH M;  2EUC A;  1QVR A;  2I7P A;  3W0L B;  4LRT A;  3HY5 A;  4GC9 A;  1WXQ A;  4AKI A;  4NL4 H;  3UMM A;  2DEN A;  4MGH A;  4G4O A;  2FFJ A;  1ZMV A;  1Y8G A;  4B3R M;  2DAI A;  2R4J A;  2Z7J A;  4KHP M;  1SXJ B;  8CAT A;  1IN5 A;  1OAI A;  1SXJ D;  2NQ8 C;  5H37 D;  3FE3 A;  4GKK M;  4X65 M;  2OOA A;  2JWS A;  3F92 A;  3HJQ A;  1QUT A;  2Z8Y M;  1KYI A;  4LF7 M;  3FRH A;  2ZAO A;  3K9O A;  1Z59 A;  3QAU A;  1N34 M;  2JY6 B;  2LHG A;  3IEC A;  4WUR A;  5KPZ A;  3W67 A;  4F2L A;  4IBK A;  3GLG A;  4HL4 A;  4FCT A;  3PFI A;  1QUS A;  3J80 S;  4AG6 A;  1VDD A;  4IJF A;  3T15 A;  1IBL M;  2C9C A;  2N35 A;  1W5T A;  2CFO A;  1MJG M;  3J81 S;  1H6U A;  4GIP A;  3SC3 A;  1FNN A;  1NY5 A;  3IG8 A;  1QYR A;  4DBG B;  5BPV A;  2JY7 A;  3I01 M;  5ITT A;  3R8F A;  3E21 A;  1OAO C;  3U6Q A;  4GHL A;  2L7H A;  1JQJ C;  2EO2 A;  2FS1 A;  1DV0 A;  2QPA A;  2RRU A;  3GQ4 A;  1N32 M;  5EP2 A;  1YSY A;  3LMM A;  1UM8 A;  3TL4 X;  1HT1 E;  3FUX A;  3GLH E;  3U61 A;  4JI0 M;  3B89 A;  1OKS A;  1NNJ A;  1WIV A;  1E94 E;  1S3S A;  3U6P A;  1Z5A A;  5IRE B;  4MGY E;  3L27 A;  1IY1 A;  2JZ1 A;  1J5E M;  3DFZ A;  1DGH A;  3U6L A;  4JI4 M;  2YNM D;  4DV0 M;  5DYI A;  1JR3 E;  4I5S A;  4DR5 M;  2QBY B;  3AL0 C;  2R18 A;  4IBJ A;  2VII A;  4KLN A;  4CGY B;  5EXS A;  4LGM A;  5EP4 A;  4B3M M;  4P16 A;  2CWB A;  4NSO B;  1V92 A;  5KQ8 A;  3VKG A;  3U6M A;  3UJN A;  3KVW A;  5FTN A;  1I94 M;  3I04 M;  1IFY A;  1XC8 A;  2UU9 M;  4LJ8 A;  2MH8 A;  2K9D A;  3M6A A;  1NV9 A;  5ITX E;  3VK8 A;  4P17 A;  4NSR A;  4L78 A;  1WJ7 A;  2D7G A;  4LJ7 A;  3K2L A;  1LV7 A;  1WGN A;  4AI6 A;  1G41 A;  1QDT A;  1G59 A;  3U6O A;  2C99 A;  1TH2 A;  1T3T A;  4DV1 M;  3VK7 A;  1OFI A;  3SYK A;  1K82 A;  2D7E A;  2K6B A;  1N78 A;  1D2N A;  4R3D A;  1ZQ9 A;  3A46 A;  3TWM A;  4BLC A;  1JB0 F;  5IWA M;  4L15 A;  4OU7 A;  3GRR A;  2DI0 A;  2ERC A;  5L8R F;  1N36 M;  3HJ8 A;  3VFD A;  4Q7J A;  2DNA A;  3WHL A;  1YE9 A;  1XB2 B;  3KP0 E;  4OVZ A;  3GLI A;  2I7N A;  3FUT A;  3B7N A;  2LBC A;  3B7Q A;  4GIT A;  3M0E A;  3DZD A;  3K92 A;  4RNA A;  2LVO C;  1NHG C;  3SAR A;  3B74 A;  3SYL A;  5C18 A;  3B9P A;  3EIH A;  3E9S A;  4QHS A;  3UZU A;  4JI1 M;  2LHC A;  4LFB M;  1C1K A;  1IM2 A;  4FVM A;  2JP7 A;  2KXE A;  5LMN M;  4JXJ A;  2CRU A;  1NO1 A;  1PJI A;  3LCV B;  2VDB B;  3HKP A;  2UXB M;  1IXS A;  4BB9 A;  1XWI A;  1Q3B A;  1HNW M;  2G8L A;  1R5L A;  1QAN A;  4LG2 A;  1GO5 A;  4Z8X A;  3GRV A;  3UK6 A;  4M9Z A;  3FTE A;  2QNJ A;  3AFH A;  1PRB A;  2HL7 A;  4JI6 M;  3K8Z A;  4RF1 A;  2QZ4 A;  5KO3 A;  1UFZ A;  2LVN C;  2HKJ A;  2DAG A;  2KA6 B;  2JA2 A;  2MR9 A;  4W5W A;  1IY0 A;  3CF2 A;  1G71 A;  4LJ9 A;  5GKN A;  1GKI A;  4JYA M;  2ZAM A;  4GRI A;  4DR7 M;  1SXJ A;  3HHZ A;  1GLN A;  4OW0 A;  2WSC F;  3SHG B;  1E9S A;  2JY5 A;  1I4W A;  2CE7 A;  2QQ8 A;  3PNV A;  1Z5B A;  4LY6 A;  4D80 A;  4DV5 M;  2DWN A;  3J7A S;  4MGK E;  4REZ A;  2LVP C;  4LF8 M;  1L1Z A;  2G5G X;  1GJS A;  3AOG A;  3QWL A;  5DYG A;  5EXP A;  2YQZ A;  5KQD A;  4M0D A;  3EIE A;  3D8L A;  1IN4 A;  1D0L A;  1LTM A;  4AQY M;  2BWB A;  1V34 A;  1ZMW A;  4G6Z A;  4NRV A;  2L2D A;  4EIW A;  1L2C A;  3ZH9 B;  1X37 A;  2OQ4 A;  2K47 A;  1HNX M;  5LMU M;  2BJV A;  1NSF A;  4YHH M;  2XF3 A;  1PM5 A;  5IZ7 D;  2DKL A;  3FYC A;  4AG5 A;  1XMO M;  1L2B A;  4L4U A;  3GQ3 A;  1R7R A;  2Q2E B;  3KOZ E;  3SAU A;  2F5Q A;  4IBD A;  3KS8 A;  2XZU A;  2KNZ A;  3HZJ A;  2DZO B;  4FWH A;  3U60 B;  1HQY E;  3HHY A;  2F4V M;  1TTE A;  3MMP A;  4IBE A;  4DUY M;  2Z4R A;  1T43 A;  1OIZ A;  4X66 M;  1TR8 A;  3KS4 A;  2QEN A;  4LZJ A;  1IXZ A;  2HAK A;  1OJL A;  3GLF A;  1TH3 A;  2XGN A;  3A42 A;  3L25 A;  2DWZ B;  3CGW A;  1HT2 E;  4DV4 M;  2XSZ D;  4QHT A;  2R4E A;  3KW6 A;  4F1I A;  2OPF A;  4B3T M;  2XFT A;  1QAO A;  4L8R C;  5JI2 E;  2X8A A;  1DGG A;  2MRO B;  2M60 A;  4DV3 M;  1D0K A;  2W82 A;  3CTW B;  4HEO A;  4KOD A;  1G8P A;  2F5N A;  2KZS A;  5EXX A;  3HU1 A;  4FD2 A;  3VDU A;  2L09 A;  3U6C A;  4NXM M;  2ZAN A;  1QZE A;  3GRU A;  2KRU A;  1GVN A;  3QYB A;  1AUA A;  4DV2 M;  5A2Q S;  1IBK M;  4XBO A;  1XXH B;  4FWG A;  4JV5 M;  2ZTD A;  1ORY B;  3SMS A;  5FLX S;  1IQP A;  1VEJ A;  1TDZ A;  4X62 M;  2V6Z M;  4IBC A;  2VF7 A;  3MJ5 A;  4B3S M;  2JXN A;  1KSF X;  4IBG A;  3KXE C;  3FYD A;  3NWL A;  3ZCB B;  1KFV A;  2EKK A;  2O25 A;  4KO8 A;  3WHK A;  3HGI A;  1V33 A;  1SG9 A;  2C98 A;  1NY6 A;  1VG5 A;  2L6O A;  2UUC M;  2V1U A;  3U6S A;  3C3E A;  3D8B A;  2DHY A;  2LTU A;  1CUK A;  1NNU C;  1OFH A;  3LCU A;  1AIP C;  4DV7 M;  2LVQ D;  3RGS A;  4CHT B;  1E32 A;  2GNO A;  2XFS A;  3GLI E;  4D82 A;  3U6D A;  2C96 A;  4D81 A;  2CV2 A;  2Z4S A;  2R6F A;  3GRY A;  2BJW A;  1TH4 A;  2BWE A;  2FH0 A;  3AKZ A;  2VQE M;  3U61 B;  3GQ5 A;  3RGP A;  3SFZ A;  3U5Z A;  3TWK A;  2J5Y A;  3QYE A;  4BBA A;  3TWL A;  2VF8 A;  3A45 A;  4GMQ A;  2QSF X;  3FTD A;  2XZF A;  3H4J A;  2F5S A;  3J27 B;  2APL A;  2JZ0 A;  1DGH B;  3AOE C;  2UUA M;  1IN6 A;  2Z3X A;  3GLH B;  5E26 A;  1PJT A;  1IBM M;  2CEA A;  4JI2 M;  3LQR A;  2OOB A;  4LF4 M;  3C3D A;  1WR1 B;  3K1J A;  3B7Z A;  2LVA A;  2B3T A;  2CP8 A;  3SAT A;  2A5Y B;  4WW0 A;  2QP9 X;  2R0I A;  1NV8 A;  4M9X A;  2HWJ A;  1GAB A;  2DAE A;  3AOE A;  2BNK A;  2L7I A;  1XNQ M;  2QHO B;  2Y20 A;  1TF0 B;  2R65 A;  3KOY E;  1SXJ C;  1JR3 D;  4MGI E;  1QAQ A;  3K9P A;  1L2D A;  5ITU A;  2O5R A;  3T1Y M;  3LW5 F;  2CHQ A;  2DXI A;  2V1C A;  5ITR A;  1Z6T A;  1Q3C A;  4G4Q A;  2EA0 A;  2ZBK B;  5F3W A;  2H5X A;  1HNZ M;  3ZC7 B;  4PD2 A;  1ZMU A;  2XH9 A;  3HHW A;  5DFL A;  3SBJ A;  4I8O A;  2KHH A;  2WZJ A;  2X4A A;  3BXW A;  1XNR M;  4FW9 A;  3DOA A;  4M0W A;  4GKJ M;  3I4V A;  5EP3 A;  5JI3 E;  1WHC A;  4LF9 M;  4WP2 A;  1G3I A;  1NHW C;  3L29 A;  3PNY A;  4PT5 A;  4PDI A;  2KZU A;  3NBX X;  1L8Q A;  1N75 A;  3E46 A;  1ZV1 A;  2DWM A;  4I81 A;  3U60 A;  1HJP A;  3I51 A;  3J7B A;  1VQ1 A;  3V76 A;  3VKH A;  2EJS A;  1VEG A;  2OO9 A;  1OQY A;  2C9O A;  3H4M A;  2CUZ A;  3C9P A;  3HWS A;  3KDS E;  1MN3 A;  2R62 A;  1G4A E;  4JI5 M;  3L2A A;  5IT9 S;  1IN7 A;  1QZM A;  2XSZ A;  5EJC A;  3KOX E;  3RFW A;  3IHP A;  4GH9 A;  1IXS B;  1PGY A;  1R6B X;  2O01 F;  3GLG E;  1HQC A;  1BVS A;  2DWL A;  3PVS A;  3GLF E;  3VLF B;  2ZM6 M;  4QOS A;  2R44 A;  4LRS A;  4GHA A;  2AHM A;  4DR3 M;  1ZAE A;  4JI3 M;  1QDR A;  2C5R A;  4AW4 A;  1XXH A;  3JR4 A;  3THG A;  4IIW A;  3T6P A;  3RE8 A;  4AZF A;  2R45 A;  4R71 A;  3I4Y A;  3BOS A;  3FKE A;  3LVV A;  4G3O A;  1IY2 A;  1J7K A;  1RU3 A;  1Z5C A;  2DVW B;  2KEB A;  4IBF A;  2CV1 A;  4B7F A;  2DHR A;  2Y0T A;  3LQQ A;  3FD9 A;  1W5S A;  4CIS A;  4GEW A;  1TGU A;  2LXE A;  2QBY A;  2LNH C;  1DGB A;  2KDL A;  2WSF F;  3CF6 E;  3L26 A;  3FUV A;  3KP1 E;  2E5L M;  5FTJ A;  2K0B X;  1L1T A;  4CIZ A;  4QNM A;  2Y0Q A;  2DZL A;  3LVW A;  2RGO A;  4LFC M;  1EIJ A;  5FTK A;  1FJG M;  3KOW E;  1K3X A;  4JI8 M;  5FSW A;  4JI7 M;  4RF0 A;  4FCV A;  4MGZ E;  2DAM A;  1R2Y A;  3SAV A;  2KNA A;  2FOI C;  2KNV A;  2P5T A;  4G4R A;  2D7H A;  4ITQ A;  4Y28 F;  2MGW A;  1N77 A;  1PJQ A;  3HHX A;  2YR0 A;  2HCB A;  1MX0 A;  2WSE F;  3J2P B;  4I4L A;  5BR8 M;  3C58 A;  2F5P A;  2J7O A;  3DA1 A;  4MM3 B;  3MHV C;  2FE8 A;  1IN8 A;  4NC6 A;  3GLG B;  4PDG A;  1WGL A;  4LJ6 A;  1J09 A;  4UN2 B;  4ZPX A;  3OTO M;  2VQF M;  1R4G A;  3Q8G A;  2QCU A;  3FUU A;  3GLF B;  1E9R A;  1YLA A;  1P3Q Q;  3HU3 A;  5ITY A;  3TQS A;  3R9X B;  2CV0 A;  3FTF A;  1NJG A;  4M9S A;  4X64 M;  4XK8 F;  5EP1 A;  4KT0 F;  3GLH A;  4LJA A;  2KW0 A;  2R46 A;  4L16 A;  4QNR A;  2XLJ A;  1DO2 A;  2ZTC A;  3HU2 A;  4G4N A;  5ITQ A;  4OX9 M;  3ILK A;  4TUW A;  4RKU F;  1Q02 A;  2RKO A;  4YY3 M;  2CHV A;  4LJ5 A;  3GP1 A;  3E4R A;  3HJS A;  3SHF A;  4LF6 M;  4B7G A;  2G3Q A;  4DR2 M;  2H1R A;  3SMP A;  1NVM A;  1T6O A;  2EKF A;  4AKG A;  4NOO B;  3T38 A;  3JR5 A;  1MU5 A;  1JR3 A;  2L4F A;  3SAS A;  1TDH A;  5FTM A;  1XMQ M;  1HR0 M;  4LZZ A;  4FCW A;  4II7 A;  1DGF A;  3M7G A;  2Y21 A;  2FNA A; 
#chains in the Genus database with same CATH homology
 1E94 E;  2DAK A;  1TTE A;  3MMP A;  1WHC A;  4WP2 A;  1G3I A;  2JZ1 A;  1T43 A;  3E46 A;  1ZV1 A;  1TR8 A;  1HJP A;  1JR3 E;  2HAK A;  3FRI A;  1VQ1 A;  2EJS A;  1HT2 E;  1VEG A;  2OO9 A;  1OQY A;  4F1I A;  2CWB A;  5JI2 E;  1A5T A;  1V92 A;  2MRO B;  1MN3 A;  1G4A E;  4HEO A;  1IFY A;  1VDL A;  3BBZ A;  3IHP A;  2K9D A;  1PGY A;  1NV9 A;  2L4E A;  1QZE A;  1VEK A;  3GLG E;  1WJ7 A;  1BVS A;  1OTR A;  3GLF E;  1WGN A;  2ZTD A;  2JUJ A;  1G41 A;  1VEJ A;  1F4I A;  1HQY E;  2DI0 A;  3T6P A;  2EKK A;  2O25 A;  4Q7J A;  2DNA A;  4R71 A;  1XB2 B;  1SG9 A;  2LBC A;  4G3O A;  1VG5 A;  1EFU B;  2MJ5 B;  2LVO C;  2DHY A;  4GEW A;  2JY8 A;  2JNH A;  2LTU A;  1CUK A;  3LCU A;  1AIP C;  2K0B X;  1XXH E;  1IM2 A;  2LVQ D;  2JP7 A;  2DZL A;  1DO0 A;  1C7Y A;  3GLI E;  3LCV B;  1IXS A;  2DEN A;  1ZMV A;  2DAM A;  1GO5 A;  1Y8G A;  2KNA A;  2KNV A;  2BWE A;  2DAI A;  2MGW A;  2QNJ A;  1UFZ A;  2LVN C;  1OAI A;  2WZJ A;  2DAG A;  2MR9 A;  3FE3 A;  2QSF X;  2OOA A;  3B89 A;  3H4J A;  3F92 A;  2JZ0 A;  1WGL A;  4UN2 B;  1R4G A;  1KYI A;  3FRH A;  1YLA A;  3K9O A;  1P3Q Q;  2JY5 A;  2OOB A;  2JY6 B;  1WR1 B;  2LVA A;  2B3T A;  3IEC A;  2CP8 A;  2LVP C;  4F2L A;  2R0I A;  1NV8 A;  2HWJ A;  2DAE A;  1DO2 A;  2ZTC A;  2QHO B;  4DBG B;  1Q02 A;  2JY7 A;  2BWB A;  1ZMW A;  3K9P A;  3E21 A;  2L2D A;  2G3Q A;  1T6O A;  2EKF A;  1DV0 A;  2RRU A;  2DKL A;  2H5X A;  2L4F A;  1ZMU A;  5DFL A;  1HT1 E;  3GLH E;  2KHH A;  2KNZ A;  1OKS A;  1WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...