1WGLA

Solution structure of cue domain in the c-terminal of human toll-interacting protein (tollip)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSSGSSGCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-interacting protein
publication title Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wglA00
2JY5A 3GLHE 2DENA 1JR3E 1T43A 1IM2A 5JI2E 1ZMVA 1BVSA 2LVOC 2MJ5B 1TTEA 2LVAA 2JZ0A 4Q7JA 1WIVA 2G3QA 1XB2B 2DKLA 2DAGA 2JNHA 1DO2A 1G41A 2QHOB 3B89A 1PGYA 4F1IA 1KYIA 1TR8A 3GLGE 2MGWA 2HAKA 2OOAA 1P3QQ 2EKFA 2DAKA 2WZJA 2OO9A 1DO0A 3IECA 2DAEA 2JZ1A 1GO5A 2KNVA 1A5TA 4UN2B 2H5XA 1WJ7A 1VEGA 1EFUB 1G3IA 4HEOA 1SG9A 1C7YA 2BWEA 1NV8A 2EJSA 1HJPA 2L4FA 1VEKA 2CP8A 2JUJA 1IFYA 1MN3A 2EKKA 3BBZA 2CWBA 1VEJA 2MROB 3F92A 1R4GA 2B3TA 2RRUA 1DV0A 1HQYE 2DI0A 2ZTDA 1T6OA 1OTRA 2BWBA 1UFZA 1OKSA 1WGNA 3FE3A 2JY6B 1XXHE 1WHCA 2DAMA 3LCUA 3FRIA 2LBCA 3K9OA 1VDLA 2KNZA 2JY8A 4G3OA 3E46A 2LVQD 2QSFX 3H4JA 1F4IA 1VG5A 2KNAA 2DHYA 3LCVB 2KHHA 1Y8GA 1ZMUA 2O25A 1AIPC 2K9DA 3E21A 4R71A 1G4AE 2DZLA 2JP7A 1WGLA 1YLAA 3FRHA 1ZV1A 4DBGB 4F2LA 1ZMWA 2MR9A 1WR1B 2OOBA 2QNJA 4GEWA 5DFLA 1CUKA 3MMPA 2LVPC 2HWJA 3GLIE 3GLFE 3IHPA 1QZEA 1VQ1A 2DNAA 2JY7A 4WP2A 2R0IA 3T6PA 1NV9A 1E94E 1OQYA 1Q02A 1HT2E 2K0BX 1IXSA 2DAIA 3K9PA 2L2DA 1HT1E 2ZTCA 2L4EA 2LTUA 2LVNC 1V92A 1OAIA
chains in the Genus database with same CATH superfamily
2YNMD 3GLHE 5DYIA 3RFWA 4L8RC 1MJGM 3J7BA 1QAMA 2H1RA 4TUWA 4JI8M 1N32M 4KT0F 4OX9M 2HHHM 2DXIA 2M60A 2P5TA 3GLIA 3SASA 1NY5A 3FUVA 4WURA 1T3TA 3GRUA 3AL0C 1YUBA 2JZ0A 1NY6A 4AQYM 1SXJC 2G3QA 3U5ZB 4JYAM 5ITXE 4DUZM 2R44A 3AKZA 1OAOC 3OTOM 2XZFA 2YQZA 2JNHA 1DO2A 2K6BA 1QQWA 4FVMA 4L6V6 3KP1E 4OU7A 3EIEA 4BLCA 4QNMA 1H6UA 4M9SA 3GLHA 3HX3A 4CISA 3BXWA 3GRYA 4LJAA 2FE8A 2Z4SA 1ZAEA 3KOXE 3GLGE 2Z8YM 2OOAA 1P3QQ 2EKFA 1E9SA 3A45A 2WZJA 2L6OA 1Q3BA 2OO9A 3K8ZA 3L29A 4GHAA 3FUTA 3D8BA 2QPAA 2BJWA 2JZ1A 3KSXA 3PNYA 1NJFA 3AOEC 2VF7A 4LRTA 2Z7JA 3U60A 4P17A 1TGUA 3KS4A 4LZZA 5EJCA 1VEGA 1PJIA 2CHVA 3KVWA 3NBIA 3B74A 1EFUB 4DV1M 1G3IA 3CF2A 2FH0A 3PVSA 1PM5A 4CGYB 2Z4RA 2BJVA 3FUWA 4JXJA 2ERCA 4Z8XA 4YHHM 2EO2A 2J7NA 4JI1M 1MN3A 3GLGA 3QWLA 1PJJA 4Y28F 2CHGA 2MROB 3AOGA 3LVWA 1YSYA 2CEAA 1SXJD 1K82A 4MB7A 4R7GA 2B3TA 1JB0F 4CHTB 2DI0A 4LY6A 1TH2A 4II7A 3M6AA 3W0LB 4NRVA 3UGJA 4M0WA 1QVRA 5ITTA 2XZUA 1OKSA 2M5ZA 2QZ4A 2R18A 3RE8A 2JY6B 1XXHE 3U6DA 2EUCA 2F5QA 2UXCM 1IN8A 2LBCA 3NBXX 1DGBA 1VDLA 1IN6A 1TH3A 2KNZA 3FYCA 4GC5A 4L15A 1L1ZA 1N78A 2LVQD 2HKJA 2QSFX 3H4JA 4LGMA 2I7NA 3FKEA 3MK6A 5KPRA 2A5YB 4LJ4A 2O25A 3LQQA 1D0KA 3E21A 3U61A 3HJQA 2KXEA 3FRHA 3HJ8A 2J7OA 4OW0A 4RF0A 3EIHA 3E4RA 1ZMWA 2MR9A 3FTEA 1CUKA 4LJ7A 4BB9A 3RGSA 2HWJA 1XXHA 5KPTA 4KODA 3FYDA 3GLFE 3CGWA 3L27A 4I5SA 1QZEA 1VQ1A 1OIPA 2DNAA 1G8PA 5KQDA 1GABA 4LJ8A 2GQFA 1W5SA 3LQRA 4QHTA 2XGNA 4DR1M 4BBAA 1Q3CA 1Q02A 2XH9A 1IXSA 1PJTA 1HT1E 1GKIA 4NRWA 2DHRA 1QZMA 2L4EA 2X8AA 3HHWA 1X37A 3KDSE 4LRSA 1OAIA 1I94M 2KRKA 4LJ6A 2BNKA 2DENA 4I81A 4Z6YA 1QDTA 2LNHC 4LGYA 2V6ZM 3J7AS 3UJNA 3VK7A 2UUCM 3I01M 2YR0A 5JI2E 1ZMVA 4QHSA 3KOWE 3J80S 1BVSA 3GO8A 2LVOC 2MJ5B 3PNVA 4X66M 4FD2A 5EQTA 4RF1A 3J27B 1KFVA 4WW0A 3A46A 2EA0A 5FTKA 5EXXA 3SFZA 2DWMA 4DUYM 3SMSA 1Z5AA 3M0EA 2QHOB 3W68A 5BR8M 4FCVA 1DGFA 1QDRA 1SXJB 2YFQA 4LZJA 4ANRA 1NSFA 1WXQA 5E6JA 3H4MA 7CATA 1D2NA 1IBLM 1OFHA 1MX0A 3VFDA 2WSFF 3HZJA 3AOEA 4IJEA 5C1BA 2XEPA 3U5ZA 2MGWA 3SYLA 4GC9A 2DAKA 1IXRC 4PDIA 4MGYE 2DAEA 3QAUA 1GO5A 1A5TA 1TDHA 3HY5A 1ORYB 3GRRA 4GITA 4JN6A 4UN2B 4PDGA 2ZM6M 2DVWB 1WJ7A 4XBOA 1EIJA 1AUAA 3GPXA 2D7HA 3KW6A 4FCTA 4NSOB 3JAMS 2XFTA 4W5WA 2CFOA 4DR7M 1QAQA 3DZDA 1XWIA 3TWKA 1C7YA 3TQSA 1W5TA 1HNXM 1NHWC 1XNQM 3Q8GA 2RGOA 4IJFA 2JUJA 3ZC7B 1N77A 1IFYA 3BBZA 2LXEA 5EXPA 2CWBA 4CIZA 1TH4A 3AJIB 5EXTA 2XFSA 3I04M 3U6EA 2WSEF 3FUUA 1R4GA 1NHGC 5EP4A 2VIIA 3SATA 1T6OA 3UMMA 4JI2M 1DGHB 2N35A 1UFZA 5EP3A 1FNNA 1WGNA 3FE3A 3U6OA 1IBMM 3AV0A 4LG2A 3K9OA 4LCBA 2RKOA 3L2AA 2JY8A 3A42A 3HHYA 1N33M 1Z5BA 4MGZE 1UM8A 1I4WA 3CF0A 5IREB 4D82A 5KQ8A 1ZMUA 3TWLA 3HWSA 5FLXS 1XC8A 1JR3D 1AIPC 5LMUM 1R2ZA 1D0MA 2V1CA 3WHLA 4JI7M 2CUZA 2DZLA 2C9CA 5L8RF 2JP7A 3VK8A 2L09A 3JR4A 3SMPA 1WR1B 3J2PB 1NJGA 2KA6B 2HL7A 5DFLA 2F4VM 4AKHA 1HNZM 4QOZC 1G71A 4MM3B 4DV2M 3T1YM 2JY7A 4PT5A 4FCWA 4GRIA 3TE6A 4DV5M 1V34A 3SC3A 2R4EA 2QBYB 1IY1A 1E32A 1QANA 1Z5CA 2W82A 4AG6A 1OQYA 4M0DA 3T1HM 3SHGB 1HT2E 3FUXA 2DAIA 1N36M 2CHQA 3TL4X 4AI6A 3HU2A 3K2LA 1V92A 4GIPA 2X4AA 2O01F 1JR3E 4FW9A 3R8FA 1T43A 1IM2A 4IBDA 2C96A 2G5GX 5FTJA 5C18A 1R7RA 2ZANA 4JV5M 1OJLA 4JI4M 1GLNA 4FWGA 4LF7M 1SXJE 2JXNA 3Q8XA 4AW4A 3GQ5A 8CATA 4MGKE 4CJ6A 5DYGA 3ZH9B 2LVAA 2Z3XA 4MGIE 4PCZA 3KXEC 4Q7JA 1WIVA 4M9XA 4DR4M 2DKLA 2DAGA 4RNAA 2LHCA 1XMOM 1VDDA 3FTFA 5KPZA 3GQ3A 4P16A 1J5EM 2CV0A 2KDLA 2VF8A 2KEBA 2C99A 2R4JA 3B89A 1E9RA 2FS1A 4NXNM 1K3WA 2XF3A 4D80A 3IG5A 1PGYA 4F1IA 1KYIA 3U6QA 1OFIA 1JR3A 4NSRA 5FTLA 3CTWB 1YE9A 3C9PA 2WSCF 5IWAM 1DO0A 2G8LA 3LMMA 4QOSA 3SARA 4LF6M 3U6SA 1SXJA 4XGIA 3UZUA 3BOSA 2ZBKB 2OPFA 1GVNA 4G4QA 4G6ZA 3ZQJA 4LF8M 4D81A 5KO3A 1LV7A 2LH0A 3DA1A 4LJ5A 1NNUC 4DR2M 4DR6M 4OVZB 2J5YA 3KOYE 3SBJA 4S12A 2FNAA 2KZUA 4I8OA 1SG9A 5BPVA 4B7FA 1NV8A 4AKIA 3CF6E 2L4FA 2UXBM 1VEKA 3TWMA 2CP8A 2KW0A 2R6FA 2Y21A 1NO1A 2EKKA 4NC6A 5FSWA 2VQEM 2L7HA 3B9PA 4DV3M 1VEJA 3F92A 1IN5A 5FTNA 2FOIC 1IN4A 3C58A 1PJQA 1XHBA 3FD9A 3ILKA 3L25A 5JI3E 1OTRA 2BWBA 2NQ8C 2V1UA 3B7NA 2Y0TA 4JI3M 2OQ4A 3SYKA 1WHCA 2DAMA 1KSFX 3DOAA 3FRIA 3D8LA 4MGHA 4AZFA 4IIWA 3U6PA 2KRUA 5GKNA 4IBGA 3KFUG 4L16A 4KLNA 4PD2A 4B3TM 4G3OA 2Y0QA 3E46A 5EXSA 1F4IA 3FTCA 1DGHA 2KNAA 4LFAM 3TPZA 4L78A 3SAWA 2DHYA 1D0LA 1IXZA 3LCVB 1L8QA 1Y8GA 2CV2A 4IBKA 2K9DA 4NOOB 2X49A 4R71A 2CV1A 3B7QA 3GPYA 1QAOA 4IBEA 3HHXA 4X62M 1K3XA 2F5SA 1HNWM 1WGLA 5E26A 1ZV1A 2HCBA 4DBGB 2OOBA 4GEWA 3IG8A 1L1TA 2R65A 3PXGA 3MMPA 4X64M 1MU5A 1R6BX 3L26A 4IBJA 2LHGA 3U6MA 3IHPA 5ITRA 1OIZA 2DZNB 2ZAOA 4GH9A 4NL4H 2R45A 4A3VB 4WP2A 3ZCBB 2UU9M 1L2BA 1IQPA 4G4OA 3T6PA 1E94E 4FWHA 2K0BX 3AFHA 3K9PA 2GNOA 2KZSA 2R62A 1PJSA 2L2DA 4G4RA 4B3RM 4JI5M 3GLIB 2ZTCA 3FTDA 2LTUA 3KS8A 4KHPM 2AHMA 2JY5A 3GP1A 1TDZA 2QBYA 3KP0E 3HHZA 2ZAMA 3GRVA 4B08A 1R2YA 4DV4M 2C98A 4HL4A 4REZA 3T15A 3L28A 4LJ9A 3SAVA 5IT9S 4L4UA 1ZQ9A 5A2QS 3VKGA 2Q2EB 4DR5M 2DWZB 2C9OA 1TTEA 2JA2A 3GLHB 5ITXA 3THGA 2C5RA 1GJTA 4RKUF 1XB2B 4KO8A 3V76A 3U6CA 4JI6M 3K1JA 4B3SM 5FTMA 5IZ7D 2QCUA 4EIWA 4GKKM 2F5NA 3VDUA 1G41A 2XSZD 4M9ZA 3B7ZA 3GQ4A 4AKGA 3I4YA 4B7HA 4GKJM 1Q39A 2LWXA 1Z59A 2DZOB 3U60B 1TR8A 3W67A 1IBKM 1J7KA 4NXMM 3SHFA 4K0KM 4ITQA 2HAKA 3SAUA 3C3EA 3NWLA 1QYRA 4FWDA 4IBIA 4MH0E 3RGPA 3W0FA 1IY2A 1NVMA 4DV6M 3IECA 1XMQM 3J81S 3MJ5A 2KNVA 1L2DA 1V33A 3JR5A 2UUAM 3WHKA 1RU3A 1FJGM 1XNRM 2H5XA 4X65M 3GLGB 5EP1A 4XK8F 3A98B 1HR0M 2DWLA 2QENA 4QNRA 4HEOA 3HU1A 4IBCA 3QYEA 1L2CA 1GL6A 2BWEA 4IBBA 2EJSA 1TF0B 4I4LA 1HJPA 4AG5A 2VQFM 4LF4M 3LW5F 4DV0M 5EP2A 2XLJA 2CE7A 1N34M 3VKHA 2K47A 3GPPA 1QUSA 1R5LA 2QP9X 4IBFA 5ITQA 3T38A 3MHVC 4GHLA 4OVZA 1NNJA 3E9SA 1C1KA 2R46A 3VDPA 1GL7A 2RRUA 3C3DA 1HQYE 1S3SA 2FFJA 1EE8A 1DV0A 2ZTDA 3I4VA 1IN7A 2RGHA 4LFCM 3LCUA 1J09A 1GJSA 2L7IA 3DFZA 4GMQA 2APLA 3I51A 1HQCA 4ZPXA 2DWNA 4G4NA 3HGIA 3U61B 2VDBB 3KSJA 2QQ8A 2XSZA 2UXDM 1VG5A 3VLFB 2CRUA 2Y20A 2KHHA 4R3DA 5LMNM 3K92A 4DV7M 1XXHB 3UK6A 4B3MM 3R9XB 2JWSA 3GPUA 4YY3M 1G4AE 3U6LA 3HKPA 1PRBA 1YLAA 4JI0M 1Z6TA 4DR3M 4F2LA 2QNJA 3QYBA 5F3WA 3GLFA 1IXSB 5H37D 2LVPC 5DNYA 3HJSA 3GLIE 2F5PA 4LF9M 1JQJC 2D7EA 1N75A 4LF5M 3LVVA 4B7GA 2E5LM 3PFIA 4HLQA 2R0IA 5ITYA 2O5RA 1DGGA 2I7PA 3KOZE 3M7GA 1IY0A 1NV9A 1LTMA 3HU3A 2F5OA 5ITUA 1QUTA 4LFBM 2D7GA 1G59A 2UUBM 3GLFB 2MH8A 2LVNC
chains in the Genus database with same CATH topology
2JY5A 3GLHE 2DENA 1JR3E 1T43A 1IM2A 5JI2E 1ZMVA 1BVSA 2LVOC 2MJ5B 1TTEA 2LVAA 2JZ0A 4Q7JA 1WIVA 2G3QA 1XB2B 2DKLA 2DAGA 2JNHA 1DO2A 1G41A 2QHOB 3B89A 1PGYA 4F1IA 1KYIA 1TR8A 3GLGE 2MGWA 2HAKA 2OOAA 1P3QQ 2EKFA 2DAKA 2WZJA 2OO9A 1DO0A 3IECA 2DAEA 2JZ1A 1GO5A 2KNVA 1A5TA 4UN2B 2H5XA 1WJ7A 1VEGA 1EFUB 1G3IA 4HEOA 1SG9A 1C7YA 2BWEA 1NV8A 2EJSA 1HJPA 2L4FA 1VEKA 2CP8A 2JUJA 1IFYA 1MN3A 2EKKA 3BBZA 2CWBA 1VEJA 2MROB 3F92A 1R4GA 2B3TA 2RRUA 1DV0A 1HQYE 2DI0A 2ZTDA 1T6OA 1OTRA 2BWBA 1UFZA 1OKSA 1WGNA 3FE3A 2JY6B 1XXHE 1WHCA 2DAMA 3LCUA 3FRIA 2LBCA 3K9OA 1VDLA 2KNZA 2JY8A 4G3OA 3E46A 2LVQD 2QSFX 3H4JA 1F4IA 1VG5A 2KNAA 2DHYA 3LCVB 2KHHA 1Y8GA 1ZMUA 2O25A 1AIPC 2K9DA 3E21A 4R71A 1G4AE 2DZLA 2JP7A 1WGLA 1YLAA 3FRHA 1ZV1A 4DBGB 4F2LA 1ZMWA 2MR9A 1WR1B 2OOBA 2QNJA 4GEWA 5DFLA 1CUKA 3MMPA 2LVPC 2HWJA 3GLIE 3GLFE 3IHPA 1QZEA 1VQ1A 2DNAA 2JY7A 4WP2A 2R0IA 3T6PA 1NV9A 1E94E 1OQYA 1Q02A 1HT2E 2K0BX 1IXSA 2DAIA 3K9PA 2L2DA 1HT1E 2ZTCA 2L4EA 2LTUA 2LVNC 1V92A 1OAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY5 A;  3GLH E;  2DEN A;  1JR3 E;  1T43 A;  1IM2 A;  5JI2 E;  1ZMV A;  1BVS A;  2LVO C;  2MJ5 B;  1TTE A;  2LVA A;  2JZ0 A;  4Q7J A;  1WIV A;  2G3Q A;  1XB2 B;  2DKL A;  2DAG A;  2JNH A;  1DO2 A;  1G41 A;  2QHO B;  3B89 A;  1PGY A;  4F1I A;  1KYI A;  1TR8 A;  3GLG E;  2MGW A;  2HAK A;  2OOA A;  1P3Q Q;  2EKF A;  2DAK A;  2WZJ A;  2OO9 A;  1DO0 A;  3IEC A;  2DAE A;  2JZ1 A;  1GO5 A;  2KNV A;  1A5T A;  4UN2 B;  2H5X A;  1WJ7 A;  1VEG A;  1EFU B;  1G3I A;  4HEO A;  1SG9 A;  1C7Y A;  2BWE A;  1NV8 A;  2EJS A;  1HJP A;  2L4F A;  1VEK A;  2CP8 A;  2JUJ A;  1IFY A;  1MN3 A;  2EKK A;  3BBZ A;  2CWB A;  1VEJ A;  2MRO B;  3F92 A;  1R4G A;  2B3T A;  2RRU A;  1DV0 A;  1HQY E;  2DI0 A;  2ZTD A;  1T6O A;  1OTR A;  2BWB A;  1UFZ A;  1OKS A;  1WGN A;  3FE3 A;  2JY6 B;  1XXH E;  1WHC A;  2DAM A;  3LCU A;  3FRI A;  2LBC A;  3K9O A;  1VDL A;  2KNZ A;  2JY8 A;  4G3O A;  3E46 A;  2LVQ D;  2QSF X;  3H4J A;  1F4I A;  1VG5 A;  2KNA A;  2DHY A;  3LCV B;  2KHH A;  1Y8G A;  1ZMU A;  2O25 A;  1AIP C;  2K9D A;  3E21 A;  4R71 A;  1G4A E;  2DZL A;  2JP7 A;  1WGL A;  1YLA A;  3FRH A;  1ZV1 A;  4DBG B;  4F2L A;  1ZMW A;  2MR9 A;  1WR1 B;  2OOB A;  2QNJ A;  4GEW A;  5DFL A;  1CUK A;  3MMP A;  2LVP C;  2HWJ A;  3GLI E;  3GLF E;  3IHP A;  1QZE A;  1VQ1 A;  2DNA A;  2JY7 A;  4WP2 A;  2R0I A;  3T6P A;  1NV9 A;  1E94 E;  1OQY A;  1Q02 A;  1HT2 E;  2K0B X;  1IXS A;  2DAI A;  3K9P A;  2L2D A;  1HT1 E;  2ZTC A;  2L4E A;  2LTU A;  2LVN C;  1V92 A;  1OAI A; 
#chains in the Genus database with same CATH topology
 2YNM D;  3GLH E;  5DYI A;  3RFW A;  4L8R C;  1MJG M;  3J7B A;  1QAM A;  2H1R A;  4TUW A;  4JI8 M;  1N32 M;  4KT0 F;  4OX9 M;  2HHH M;  2DXI A;  2M60 A;  2P5T A;  3GLI A;  3SAS A;  1NY5 A;  3FUV A;  4WUR A;  1T3T A;  3GRU A;  3AL0 C;  1YUB A;  2JZ0 A;  1NY6 A;  4AQY M;  1SXJ C;  2G3Q A;  3U5Z B;  4JYA M;  5ITX E;  4DUZ M;  2R44 A;  3AKZ A;  1OAO C;  3OTO M;  2XZF A;  2YQZ A;  2JNH A;  1DO2 A;  2K6B A;  1QQW A;  4FVM A;  4L6V 6;  3KP1 E;  4OU7 A;  3EIE A;  4BLC A;  4QNM A;  1H6U A;  4M9S A;  3GLH A;  3HX3 A;  4CIS A;  3BXW A;  3GRY A;  4LJA A;  2FE8 A;  2Z4S A;  1ZAE A;  3KOX E;  3GLG E;  2Z8Y M;  2OOA A;  1P3Q Q;  2EKF A;  1E9S A;  3A45 A;  2WZJ A;  2L6O A;  1Q3B A;  2OO9 A;  3K8Z A;  3L29 A;  4GHA A;  3FUT A;  3D8B A;  2QPA A;  2BJW A;  2JZ1 A;  3KSX A;  3PNY A;  1NJF A;  3AOE C;  2VF7 A;  4LRT A;  2Z7J A;  3U60 A;  4P17 A;  1TGU A;  3KS4 A;  4LZZ A;  5EJC A;  1VEG A;  1PJI A;  2CHV A;  3KVW A;  3NBI A;  3B74 A;  1EFU B;  4DV1 M;  1G3I A;  3CF2 A;  2FH0 A;  3PVS A;  1PM5 A;  4CGY B;  2Z4R A;  2BJV A;  3FUW A;  4JXJ A;  2ERC A;  4Z8X A;  4YHH M;  2EO2 A;  2J7N A;  4JI1 M;  1MN3 A;  3GLG A;  3QWL A;  1PJJ A;  4Y28 F;  2CHG A;  2MRO B;  3AOG A;  3LVW A;  1YSY A;  2CEA A;  1SXJ D;  1K82 A;  4MB7 A;  4R7G A;  2B3T A;  1JB0 F;  4CHT B;  2DI0 A;  4LY6 A;  1TH2 A;  4II7 A;  3M6A A;  3W0L B;  4NRV A;  3UGJ A;  4M0W A;  1QVR A;  5ITT A;  2XZU A;  1OKS A;  2M5Z A;  2QZ4 A;  2R18 A;  3RE8 A;  2JY6 B;  1XXH E;  3U6D A;  2EUC A;  2F5Q A;  2UXC M;  1IN8 A;  2LBC A;  3NBX X;  1DGB A;  1VDL A;  1IN6 A;  1TH3 A;  2KNZ A;  3FYC A;  4GC5 A;  4L15 A;  1L1Z A;  1N78 A;  2LVQ D;  2HKJ A;  2QSF X;  3H4J A;  4LGM A;  2I7N A;  3FKE A;  3MK6 A;  5KPR A;  2A5Y B;  4LJ4 A;  2O25 A;  3LQQ A;  1D0K A;  3E21 A;  3U61 A;  3HJQ A;  2KXE A;  3FRH A;  3HJ8 A;  2J7O A;  4OW0 A;  4RF0 A;  3EIH A;  3E4R A;  1ZMW A;  2MR9 A;  3FTE A;  1CUK A;  4LJ7 A;  4BB9 A;  3RGS A;  2HWJ A;  1XXH A;  5KPT A;  4KOD A;  3FYD A;  3GLF E;  3CGW A;  3L27 A;  4I5S A;  1QZE A;  1VQ1 A;  1OIP A;  2DNA A;  1G8P A;  5KQD A;  1GAB A;  4LJ8 A;  2GQF A;  1W5S A;  3LQR A;  4QHT A;  2XGN A;  4DR1 M;  4BBA A;  1Q3C A;  1Q02 A;  2XH9 A;  1IXS A;  1PJT A;  1HT1 E;  1GKI A;  4NRW A;  2DHR A;  1QZM A;  2L4E A;  2X8A A;  3HHW A;  1X37 A;  3KDS E;  4LRS A;  1OAI A;  1I94 M;  2KRK A;  4LJ6 A;  2BNK A;  2DEN A;  4I81 A;  4Z6Y A;  1QDT A;  2LNH C;  4LGY A;  2V6Z M;  3J7A S;  3UJN A;  3VK7 A;  2UUC M;  3I01 M;  2YR0 A;  5JI2 E;  1ZMV A;  4QHS A;  3KOW E;  3J80 S;  1BVS A;  3GO8 A;  2LVO C;  2MJ5 B;  3PNV A;  4X66 M;  4FD2 A;  5EQT A;  4RF1 A;  3J27 B;  1KFV A;  4WW0 A;  3A46 A;  2EA0 A;  5FTK A;  5EXX A;  3SFZ A;  2DWM A;  4DUY M;  3SMS A;  1Z5A A;  3M0E A;  2QHO B;  3W68 A;  5BR8 M;  4FCV A;  1DGF A;  1QDR A;  1SXJ B;  2YFQ A;  4LZJ A;  4ANR A;  1NSF A;  1WXQ A;  5E6J A;  3H4M A;  7CAT A;  1D2N A;  1IBL M;  1OFH A;  1MX0 A;  3VFD A;  2WSF F;  3HZJ A;  3AOE A;  4IJE A;  5C1B A;  2XEP A;  3U5Z A;  2MGW A;  3SYL A;  4GC9 A;  2DAK A;  1IXR C;  4PDI A;  4MGY E;  2DAE A;  3QAU A;  1GO5 A;  1A5T A;  1TDH A;  3HY5 A;  1ORY B;  3GRR A;  4GIT A;  4JN6 A;  4UN2 B;  4PDG A;  2ZM6 M;  2DVW B;  1WJ7 A;  4XBO A;  1EIJ A;  1AUA A;  3GPX A;  2D7H A;  3KW6 A;  4FCT A;  4NSO B;  3JAM S;  2XFT A;  4W5W A;  2CFO A;  4DR7 M;  1QAQ A;  3DZD A;  1XWI A;  3TWK A;  1C7Y A;  3TQS A;  1W5T A;  1HNX M;  1NHW C;  1XNQ M;  3Q8G A;  2RGO A;  4IJF A;  2JUJ A;  3ZC7 B;  1N77 A;  1IFY A;  3BBZ A;  2LXE A;  5EXP A;  2CWB A;  4CIZ A;  1TH4 A;  3AJI B;  5EXT A;  2XFS A;  3I04 M;  3U6E A;  2WSE F;  3FUU A;  1R4G A;  1NHG C;  5EP4 A;  2VII A;  3SAT A;  1T6O A;  3UMM A;  4JI2 M;  1DGH B;  2N35 A;  1UFZ A;  5EP3 A;  1FNN A;  1WGN A;  3FE3 A;  3U6O A;  1IBM M;  3AV0 A;  4LG2 A;  3K9O A;  4LCB A;  2RKO A;  3L2A A;  2JY8 A;  3A42 A;  3HHY A;  1N33 M;  1Z5B A;  4MGZ E;  1UM8 A;  1I4W A;  3CF0 A;  5IRE B;  4D82 A;  5KQ8 A;  1ZMU A;  3TWL A;  3HWS A;  5FLX S;  1XC8 A;  1JR3 D;  1AIP C;  5LMU M;  1R2Z A;  1D0M A;  2V1C A;  3WHL A;  4JI7 M;  2CUZ A;  2DZL A;  2C9C A;  5L8R F;  2JP7 A;  3VK8 A;  2L09 A;  3JR4 A;  3SMP A;  1WR1 B;  3J2P B;  1NJG A;  2KA6 B;  2HL7 A;  5DFL A;  2F4V M;  4AKH A;  1HNZ M;  4QOZ C;  1G71 A;  4MM3 B;  4DV2 M;  3T1Y M;  2JY7 A;  4PT5 A;  4FCW A;  4GRI A;  3TE6 A;  4DV5 M;  1V34 A;  3SC3 A;  2R4E A;  2QBY B;  1IY1 A;  1E32 A;  1QAN A;  1Z5C A;  2W82 A;  4AG6 A;  1OQY A;  4M0D A;  3T1H M;  3SHG B;  1HT2 E;  3FUX A;  2DAI A;  1N36 M;  2CHQ A;  3TL4 X;  4AI6 A;  3HU2 A;  3K2L A;  1V92 A;  4GIP A;  2X4A A;  2O01 F;  1JR3 E;  4FW9 A;  3R8F A;  1T43 A;  1IM2 A;  4IBD A;  2C96 A;  2G5G X;  5FTJ A;  5C18 A;  1R7R A;  2ZAN A;  4JV5 M;  1OJL A;  4JI4 M;  1GLN A;  4FWG A;  4LF7 M;  1SXJ E;  2JXN A;  3Q8X A;  4AW4 A;  3GQ5 A;  8CAT A;  4MGK E;  4CJ6 A;  5DYG A;  3ZH9 B;  2LVA A;  2Z3X A;  4MGI E;  4PCZ A;  3KXE C;  4Q7J A;  1WIV A;  4M9X A;  4DR4 M;  2DKL A;  2DAG A;  4RNA A;  2LHC A;  1XMO M;  1VDD A;  3FTF A;  5KPZ A;  3GQ3 A;  4P16 A;  1J5E M;  2CV0 A;  2KDL A;  2VF8 A;  2KEB A;  2C99 A;  2R4J A;  3B89 A;  1E9R A;  2FS1 A;  4NXN M;  1K3W A;  2XF3 A;  4D80 A;  3IG5 A;  1PGY A;  4F1I A;  1KYI A;  3U6Q A;  1OFI A;  1JR3 A;  4NSR A;  5FTL A;  3CTW B;  1YE9 A;  3C9P A;  2WSC F;  5IWA M;  1DO0 A;  2G8L A;  3LMM A;  4QOS A;  3SAR A;  4LF6 M;  3U6S A;  1SXJ A;  4XGI A;  3UZU A;  3BOS A;  2ZBK B;  2OPF A;  1GVN A;  4G4Q A;  4G6Z A;  3ZQJ A;  4LF8 M;  4D81 A;  5KO3 A;  1LV7 A;  2LH0 A;  3DA1 A;  4LJ5 A;  1NNU C;  4DR2 M;  4DR6 M;  4OVZ B;  2J5Y A;  3KOY E;  3SBJ A;  4S12 A;  2FNA A;  2KZU A;  4I8O A;  1SG9 A;  5BPV A;  4B7F A;  1NV8 A;  4AKI A;  3CF6 E;  2L4F A;  2UXB M;  1VEK A;  3TWM A;  2CP8 A;  2KW0 A;  2R6F A;  2Y21 A;  1NO1 A;  2EKK A;  4NC6 A;  5FSW A;  2VQE M;  2L7H A;  3B9P A;  4DV3 M;  1VEJ A;  3F92 A;  1IN5 A;  5FTN A;  2FOI C;  1IN4 A;  3C58 A;  1PJQ A;  1XHB A;  3FD9 A;  3ILK A;  3L25 A;  5JI3 E;  1OTR A;  2BWB A;  2NQ8 C;  2V1U A;  3B7N A;  2Y0T A;  4JI3 M;  2OQ4 A;  3SYK A;  1WHC A;  2DAM A;  1KSF X;  3DOA A;  3FRI A;  3D8L A;  4MGH A;  4AZF A;  4IIW A;  3U6P A;  2KRU A;  5GKN A;  4IBG A;  3KFU G;  4L16 A;  4KLN A;  4PD2 A;  4B3T M;  4G3O A;  2Y0Q A;  3E46 A;  5EXS A;  1F4I A;  3FTC A;  1DGH A;  2KNA A;  4LFA M;  3TPZ A;  4L78 A;  3SAW A;  2DHY A;  1D0L A;  1IXZ A;  3LCV B;  1L8Q A;  1Y8G A;  2CV2 A;  4IBK A;  2K9D A;  4NOO B;  2X49 A;  4R71 A;  2CV1 A;  3B7Q A;  3GPY A;  1QAO A;  4IBE A;  3HHX A;  4X62 M;  1K3X A;  2F5S A;  1HNW M;  1WGL A;  5E26 A;  1ZV1 A;  2HCB A;  4DBG B;  2OOB A;  4GEW A;  3IG8 A;  1L1T A;  2R65 A;  3PXG A;  3MMP A;  4X64 M;  1MU5 A;  1R6B X;  3L26 A;  4IBJ A;  2LHG A;  3U6M A;  3IHP A;  5ITR A;  1OIZ A;  2DZN B;  2ZAO A;  4GH9 A;  4NL4 H;  2R45 A;  4A3V B;  4WP2 A;  3ZCB B;  2UU9 M;  1L2B A;  1IQP A;  4G4O A;  3T6P A;  1E94 E;  4FWH A;  2K0B X;  3AFH A;  3K9P A;  2GNO A;  2KZS A;  2R62 A;  1PJS A;  2L2D A;  4G4R A;  4B3R M;  4JI5 M;  3GLI B;  2ZTC A;  3FTD A;  2LTU A;  3KS8 A;  4KHP M;  2AHM A;  2JY5 A;  3GP1 A;  1TDZ A;  2QBY A;  3KP0 E;  3HHZ A;  2ZAM A;  3GRV A;  4B08 A;  1R2Y A;  4DV4 M;  2C98 A;  4HL4 A;  4REZ A;  3T15 A;  3L28 A;  4LJ9 A;  3SAV A;  5IT9 S;  4L4U A;  1ZQ9 A;  5A2Q S;  3VKG A;  2Q2E B;  4DR5 M;  2DWZ B;  2C9O A;  1TTE A;  2JA2 A;  3GLH B;  5ITX A;  3THG A;  2C5R A;  1GJT A;  4RKU F;  1XB2 B;  4KO8 A;  3V76 A;  3U6C A;  4JI6 M;  3K1J A;  4B3S M;  5FTM A;  5IZ7 D;  2QCU A;  4EIW A;  4GKK M;  2F5N A;  3VDU A;  1G41 A;  2XSZ D;  4M9Z A;  3B7Z A;  3GQ4 A;  4AKG A;  3I4Y A;  4B7H A;  4GKJ M;  1Q39 A;  2LWX A;  1Z59 A;  2DZO B;  3U60 B;  1TR8 A;  3W67 A;  1IBK M;  1J7K A;  4NXM M;  3SHF A;  4K0K M;  4ITQ A;  2HAK A;  3SAU A;  3C3E A;  3NWL A;  1QYR A;  4FWD A;  4IBI A;  4MH0 E;  3RGP A;  3W0F A;  1IY2 A;  1NVM A;  4DV6 M;  3IEC A;  1XMQ M;  3J81 S;  3MJ5 A;  2KNV A;  1L2D A;  1V33 A;  3JR5 A;  2UUA M;  3WHK A;  1RU3 A;  1FJG M;  1XNR M;  2H5X A;  4X65 M;  3GLG B;  5EP1 A;  4XK8 F;  3A98 B;  1HR0 M;  2DWL A;  2QEN A;  4QNR A;  4HEO A;  3HU1 A;  4IBC A;  3QYE A;  1L2C A;  1GL6 A;  2BWE A;  4IBB A;  2EJS A;  1TF0 B;  4I4L A;  1HJP A;  4AG5 A;  2VQF M;  4LF4 M;  3LW5 F;  4DV0 M;  5EP2 A;  2XLJ A;  2CE7 A;  1N34 M;  3VKH A;  2K47 A;  3GPP A;  1QUS A;  1R5L A;  2QP9 X;  4IBF A;  5ITQ A;  3T38 A;  3MHV C;  4GHL A;  4OVZ A;  1NNJ A;  3E9S A;  1C1K A;  2R46 A;  3VDP A;  1GL7 A;  2RRU A;  3C3D A;  1HQY E;  1S3S A;  2FFJ A;  1EE8 A;  1DV0 A;  2ZTD A;  3I4V A;  1IN7 A;  2RGH A;  4LFC M;  3LCU A;  1J09 A;  1GJS A;  2L7I A;  3DFZ A;  4GMQ A;  2APL A;  3I51 A;  1HQC A;  4ZPX A;  2DWN A;  4G4N A;  3HGI A;  3U61 B;  2VDB B;  3KSJ A;  2QQ8 A;  2XSZ A;  2UXD M;  1VG5 A;  3VLF B;  2CRU A;  2Y20 A;  2KHH A;  4R3D A;  5LMN M;  3K92 A;  4DV7 M;  1XXH B;  3UK6 A;  4B3M M;  3R9X B;  2JWS A;  3GPU A;  4YY3 M;  1G4A E;  3U6L A;  3HKP A;  1PRB A;  1YLA A;  4JI0 M;  1Z6T A;  4DR3 M;  4F2L A;  2QNJ A;  3QYB A;  5F3W A;  3GLF A;  1IXS B;  5H37 D;  2LVP C;  5DNY A;  3HJS A;  3GLI E;  2F5P A;  4LF9 M;  1JQJ C;  2D7E A;  1N75 A;  4LF5 M;  3LVV A;  4B7G A;  2E5L M;  3PFI A;  4HLQ A;  2R0I A;  5ITY A;  2O5R A;  1DGG A;  2I7P A;  3KOZ E;  3M7G A;  1IY0 A;  1NV9 A;  1LTM A;  3HU3 A;  2F5O A;  5ITU A;  1QUT A;  4LFB M;  2D7G A;  1G59 A;  2UUB M;  3GLF B;  2MH8 A;  2LVN C; 
#chains in the Genus database with same CATH homology
 2JY5 A;  3GLH E;  2DEN A;  1JR3 E;  1T43 A;  1IM2 A;  5JI2 E;  1ZMV A;  1BVS A;  2LVO C;  2MJ5 B;  1TTE A;  2LVA A;  2JZ0 A;  4Q7J A;  1WIV A;  2G3Q A;  1XB2 B;  2DKL A;  2DAG A;  2JNH A;  1DO2 A;  1G41 A;  2QHO B;  3B89 A;  1PGY A;  4F1I A;  1KYI A;  1TR8 A;  3GLG E;  2MGW A;  2HAK A;  2OOA A;  1P3Q Q;  2EKF A;  2DAK A;  2WZJ A;  2OO9 A;  1DO0 A;  3IEC A;  2DAE A;  2JZ1 A;  1GO5 A;  2KNV A;  1A5T A;  4UN2 B;  2H5X A;  1WJ7 A;  1VEG A;  1EFU B;  1G3I A;  4HEO A;  1SG9 A;  1C7Y A;  2BWE A;  1NV8 A;  2EJS A;  1HJP A;  2L4F A;  1VEK A;  2CP8 A;  2JUJ A;  1IFY A;  1MN3 A;  2EKK A;  3BBZ A;  2CWB A;  1VEJ A;  2MRO B;  3F92 A;  1R4G A;  2B3T A;  2RRU A;  1DV0 A;  1HQY E;  2DI0 A;  2ZTD A;  1T6O A;  1OTR A;  2BWB A;  1UFZ A;  1OKS A;  1WGN A;  3FE3 A;  2JY6 B;  1XXH E;  1WHC A;  2DAM A;  3LCU A;  3FRI A;  2LBC A;  3K9O A;  1VDL A;  2KNZ A;  2JY8 A;  4G3O A;  3E46 A;  2LVQ D;  2QSF X;  3H4J A;  1F4I A;  1VG5 A;  2KNA A;  2DHY A;  3LCV B;  2KHH A;  1Y8G A;  1ZMU A;  2O25 A;  1AIP C;  2K9D A;  3E21 A;  4R71 A;  1G4A E;  2DZL A;  2JP7 A;  1WGL A;  1YLA A;  3FRH A;  1ZV1 A;  4DBG B;  4F2L A;  1ZMW A;  2MR9 A;  1WR1 B;  2OOB A;  2QNJ A;  4GEW A;  5DFL A;  1CUK A;  3MMP A;  2LVP C;  2HWJ A;  3GLI E;  3GLF E;  3IHP A;  1QZE A;  1VQ1 A;  2DNA A;  2JY7 A;  4WP2 A;  2R0I A;  3T6P A;  1NV9 A;  1E94 E;  1OQY A;  1Q02 A;  1HT2 E;  2K0B X;  1IXS A;  2DAI A;  3K9P A;  2L2D A;  1HT1 E;  2ZTC A;  2L4E A;  2LTU A;  2LVN C;  1V92 A;  1OAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...