3FYDA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable dimethyladenosine transferase
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fydA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fydA01
2PXAA 2Z6UA 3AWIA 4P7KA 4BP1A 1BC5A 3O7WA 4FR0A 3I9FA 3LCUA 4RTQA 9MHTA 3TMAA 3AXTA 5CVDA 3IYLW 4E30A 5EOVA 2YXLA 3UJ6A 3FRIA 3VYWA 4FZVA 3SVZA 3FYDA 5EKXA 1R8YA 2AN3A 3RW9A 4CXMA 2IP2A 3T7RA 1P1BA 2G8NA 3LKDA 3LGAA 1I1NA 3FYCA 4PONA 4U7PB 1JTFA 3T7SA 1EJ6A 3ERCA 1QAMA 2P7IA 4XUCA 5D1NA 2AOTA 3TFWA 5K01A 1RI4A 5EGSA 1Z3CA 3C6KA 4O29A 4FT4A 2FRXA 3K0BA 5K8VA 4QQNA 2FCAA 4BP3A 2XYQA 3E8SA 1X19A 3LX6A 3MCTA 1NV8A 3DMHA 5HILA 2QYOA 3P9NA 3NDJA 4C07A 2BZGA 1F3LA 5FWAA 5FHRA 3MCZA 5DTRA 5EG5A 4M38A 7MHTA 3BWCA 4FSXA 3KQWA 1XDSA 1XCLA 3FTEA 1VPTA 3OU6A 3BKXA 3P8ZA 4R6XA 3UJDA 4RTOA 2H11A 3KPWA 1P1CA 2GB4A 2FK8A 2ZULA 1TW2A 3DR5A 3MQ2A 3MTIA 3O31A 3PX3A 3UJ8A 3BGVA 3GRUA 3UA3A 3DMFA 4ER0A 1R8XA 1XDUA 4RSRA 5K0EA 2UYQA 3UJ9A 4HG2A 3A4TA 4R8RA 3OCJA 5IKMA 5K0GA 2HNKA 2LD4A 3M6WA 2UZ4A 2C7RA 3EVBA 3KR0A 3OFJA 3JWGA 4U7TB 3C3YA 4ER5A 1WXWA 3GNLA 4PIMA 2B2CA 3ER8A 1KPGA 3DXXA 5EIFA 5DTMA 1SUSA 2PXXA 5JUWA 3NW9A 1KPIA 1UWVA 2ZIGA 3NJRA 3SXJA 3SSNA 2ZWVA 1VL5A 2EX4A 4XUDA 5GP1A 3CGGA 2PBFA 3CKKA 2QM3A 4E70A 5EMJA 5HEKA 4QDJA 1RI1A 2GA9A 4E2WA 4RTJA 1G55A 1WG8A 1X1BA 3C0KA 3G5TA 5G02A 5ICFA 1QAQA 2G71A 1D2GA 4RTLA 1MJFA 2V7EA 4ATNA 2IDKA 2AOVA 2BR5A 3KHKA 5C0OE 2ERCA 5EMKA 3CVOA 5DWQA 5EEHA 3HEMA 3SSMA 4AZTA 3TPZA 1BHJA 3L8DA 4CTJA 2C7QA 1YFLA 2BR3A 4M37A 5FQOA 4HRAA 1KYWA 4GEKA 3I64A 4IWNA 2HR1A 3Q7EA 2WA1A 3DMGA 1JR4A 4G56A 2UYHA 2ZBRA 3KPUA 4YMHA 3KPYA 5CD1A 4DF3A 3LCCA 4LWOA 5P8WA 5KS2A 3B89A 4KDRA 2I9KA 3DUWA 3P2KA 4OA5A 4DZRA 2AOUB 1NT2A 3PB3A 3TRKA 4AUKA 2G1PA 3P9IA 5HIMA 3FUVA 1T43A 2AOXA 3GO4A 1AF7A 4LG1A 1YZHA 5HIIA 3HCBA 1HNNA 4GOLD 3T7TA 5E1BA 1KPHA 2XYRA 2I62A 4AZVA 4V0QA 2NYUA 3FPFA 2ONYA 4E2YA 3MGGA 4KIFA 3S68A 3UBTA 3I58A 3HCCA 5FULA 5MHTA 1SVUA 2FPOA 3IHTA 2XYVA 4PGGA 2XVAA 5FTWA 4ZTBA 2H00A 3VC2A 4YV0A 4FSDA 3PS9A 8MHTA 4GF5A 2NXNA 5K09A 2AZTA 5E8RA 4X41A 1YFJA 3KR2A 2E5WA 5E1DA 1YUBA 3G8BA 3B3JA 2OY0A 1JSZA 2ZZKA 4QPPA 4HGZA 3KPJA 2P8JA 2A14A 4FP9A 2PJDA 5FCDA 4EVIA 2AVDA 3LDFA 1INLA 2JH9A 5K0FA 3AY0A 2O07A 3OZSA 3ORHA 5CM2Z 2G72A 5CCXA 3AXSA 2FYTA 1XTPA 1DCTA 4HH4A 2IBTA 2DPMA 5FQNA 1KR5A 3M6XA 5E9JA 3UJ7A 3WSTA 2PXCA 3NDIA 3O4FA 2N47A 1VP3A 1R6AA 4RWZA 2H1RA 4X60A 4E2XA 5DLYA 3GXOA 5KQRA 2YR0A 1X1DA 3OU2A 4RV9A 2P3OA 3LBFA 5CIYA 3F4KA 3P71T 1FJXA 5EHIA 3V97A 1D2HA 4QTUB 1G8SA 3Q87B 3BUSA 4FGZA 4K6MA 4P7FA 1IM8A 1D2CA 1WXXA 1VIDA 3JWJA 5EMMA 2UYCA 2PV0A 3M70A 5LQRA 3FPEA 3VC1A 4AZSA 3KU1A 3LPMA 3M6UA 4MIKA 5CVUA 5GM1A 2I7CA 5LQUA 2CL5A 2Y1WA 5BP7A 2JG3A 2P3QA 3DLCA 5CUQA 5CVJA 3T0IA 1Q0TA 10MHA 3P9CA 1R00A 2IDJA 4RVHA 4DMGA 1RI3A 3THSA 3BWMA 2ZCJA 2BM8A 2ESRA 1PJZA 3REOA 1WY7A 2OBFA 2AN4A 5HFJA 4YUWA 3HVHA 3EEOA 3LHDA 5FA5A 4DA4A 3IEIA 1I9GA 3I5UA 5ICEA 5LQAA 2PT6A 2ZVJA 1N2XA 4RTKA 2ZZMA 1L3IA 3B7PA 2YUIA 3OE5A 3GDHA 4PCLA 3GRVA 2OO3A 2EJTA 4FT2A 2GAFA 5EHGA 3G2QA 5K05A 4PYMA 5DPMA 4RTPA 4XCXA 3A27A 2GPYA 3DOUA 1JSXA 2EG5A 4QQKA 1EQAA 1RJGA 1P39A 3GGDA 3MAGA 4EKIA 2ZZNA 2QE6A 1N7IA 4YV2A 2PT9A 3DULA 4HGYA 5M5BA 3HCEA 3P97A 4A6DA 2NXCA 5DX0A 4YUZA 2K4MA 1JQEA 3LDGA 2YXDA 2V74B 1B42A 3GWZA 5BW4A 1ORIA 3EPPA 3B5IA 3G7UA 3R0QA 5ICGA 1NW7A 2IGTA 5CVVA 5CCBA 3KQVA 3KR9A 2PX4A 1TPYA 3LECA 1VP9A 1NV9A 1XJ5A 2NNWB 1QYRA 1R74A 3OFKA 3H2BA 4OBWA 2P1DA 1NE2A 5EVJA 2C7PA 1IY9A 4QTTB 3FTDA 2JJQA 5HOQA 2ORED 3G8AA 1AV6A 1F38A 4NECA 4R05A 1WZNA 1FP2A 3R9XB 5GOZA 4F85A 2QRVB 2VP3A 4PWYA 3BKWA 3EVEA 4IV0A 4PYIA 3CC8A 5GIPE 3KKZA 1BKYA 5K0BA 4UOEA 3CJTA 4YUVA 2OYRA 2IH5A 2QY6A 2P7HA 3SM3A 3LSTA 2AOWA 3M4XA 2AN5A 3G2MA 4B17A 4DCMA 3RODA 2YQZA 2GS9A 3EVFA 3FTFA 3P2EA 5DM4A 3M6VA 3G2OA 1G6Q1 3P2IA 5K0NA 2KW5A 5E8JA 2O0LA 5CVEA 1X1AA 3LL7A 3PVCA 4YV1A 4RVDA 2HMYB 5EC8A 1YZ3A 4AZWA 3M33A 5T64A 5DRTA 1NBHA 5BW5A 2IH4A 5E2BA 5K03A 4X63A 1ORHA 3PFGA 4HC4A 5IH3A 3PLAE 2GLUA 4BLVA 1KXZA 2P41A 4GC5A 3GRYA 1VLMA 2IPXA 3QOWA 3TM4A 4PGHA 5LR6A 2ONZA 3RIEA 3C6MA 3GCZA 1FPQA 4P7GA 3UWPA 2O05A 2PWYA 3ELUA 2QRVA 2CMHA 3A7DA 5EZQA 1JG4A 1SG9A 5DTQA 5GWXA 3TKYA 2YXEA 4KDCA 3MERA 2R3SA 3OU7A 4KW7A 2ZTHA 3GRZA 5T6BA 3SSOA 2PX5A 3CJRA 2CWWA 3OPNA 4RVFA 5FUBA 1KYZA 1UIRA 2R6ZA 3BWBA 2BM9A 3HCDA 3E23A 3JWIA 3KQYA 4IV8A 5GIOE 1AQIA 1RI2A 3FPGA 3HTXA 5DSTA 3UA4A 4C08A 5DXJA 4AX8A 2JHPA 1BOOA 3SR4A 2NP6A 1JG2A 2BR4A 3K6RA 3TQSA 1VQ1A 4P58A 5LQNA 4RTNA 5E1OA 5HIKA 2IFTA 2VDVE 2PVCA 4RX1A 1HMYA 3ER9A 2P40A 4YUXA 2OXTA 5F2OA 1O54A 4CKEA 5LQCA 3UZUA 1X1CA 5EEGA 4WVLA 1PRYA 3R24A 4OX9Y 4YUYA 2PX2A 3CBGA 3KR1A 2PY6A 3ID6C 4LECA 4X1OA 4PYJA 4E33A 1ZKDA 4RTRA 1YF3A 3EMDA 4E2ZA 2Z6QA 2DULA 2VDUE 3NVKI 4V0RA 1L1EA 4XUEA 4E31A 5EQJB 4BLWA 3PFHA 2OZVA 1QZZA 5B1SA 1M0EA 2Y1XA 3EVAA 5DM2A 4GC9A 1QAOA 2AOUA 3HA5A 1G60A 4HTFA 1RJDA 2ZLBA 3EGIA 3EVDA 3KQMA 3HA3A 1DUSA 3GJYA 3DTNA 4GOMD 4F86A 5DM0A 2JHAA 1YB2A 3HP7A 3PX2A 4MQ4A 4Y2HA 4PINA 5F2KA 3SGLA 1VBFA 5EIWA 3P9KA 4EMSA 4YMGA 3MHTA 3SX0A 1DL5A 3TLJA 4JXJA 3EVZA 3UJAA 1IXKA 3IV6A 4QDKA 3AJDA 5D1HA 3X0DA 2PSSA 2ZW9A 4C04A 1SQFA 4M7RA 2ADMA 5LQJA 1Q0SA 1ZQ9A 4ISCA 5E9WA 4BLUA 3A7EA 1G8AA 3CJQA 1G38A 3FUTA 4DKJA 3G88A 5EKUA 2C7OA 1ZG3A 2G70A 4PYKA 5HIJA 4A6EA 4MHTA 4C03A 5DX1A 3UFBA 5EZSA 4GQBA 2F8LA 2BH2A 3LKZA 3NTVA 1XDZA 3NVMB 3EVGA 3U81A 3NMUF 5K0CA 4KIGA 2OB2A 2NP7A 1TW3A 2IIPA 2JHCA 2P35A 3THRA 2XBMA 2ZWAA 1R18A 3OZRA 4Y30A 4MWZA 4M36A 2OKCA 2AS0A 3LCVB 1AQJA 3TM5A 4EKGA 4GBED 4HTFB 4HSGA 2AVNA 1V39A 1ZGJA 3OE4A 4X61A 2CKDA 2FHPA 3FUUA 1XVAA 2WK1A 5ERGB 4ER3A 5C1IA 3EMBA 5ICCA 1RJFA 1JQDA 3FUXA 1M6YA 2HV9A 4PIPA 5DXAA 5E2AA 3VSEA 4KVZA 2ZBQA 1JG3A 1XCJA 3PT9A 4EQZA 1KP9A 3EGEA 1QANA 5DX8A 4MTLA 3LBYA 3BGIA 3BGDA 3GU3A 3R6TA 4RVGA 2NXJA 3A26A 3HCFA 5DSXA 5T67A 2I6GA 2PLWA 2ZIEA 3JWHA 5DT2A 4QPNA 1Y8CA 3FRHA 4OA8A 1EJ0A 3HNRA 1KIAA 2OB1A 1FP1D 5E1MA 2XVMA 3B3FA 2P3LA 1L3BA 3BZBA 3GRRA 5DRYA 3ELDA 4E32A 1RJEA 4R8SA 4ER6A 5KVAA 2YTZA 2AR0A 1NKVA 3DP7A 1SUIA 2ZFUA 3C3PA 5K0LA 3I53A 1JTEA 3HVIA 3PTAA 3B3GA 2WA2A 3HCAA 1EIZA 2CMGA 2EJUA 4CKCA 3ELYA 4C05A 5K0JA 3G2PA 2PGXA 1FBNA 3KQQA 2Z6AA 4P7JA 5BXYA 3UJCA 4GOOD 3KQSA 3HM2A 2JH8A 3NWBA 4CKBA 3EGVA 1O9HA 1JG1A 3G89A 4DCGA 3EVCA 3KQPA 5DM1A 1U2ZA 2NXEA 1EG2A 1H1DA 5FADA 1NW3A 5FWDA 3TKAA 3GIWA 1EAMA 1L9KA 4IKPA 5FA8A 1MHTA 3BXOA 3SMQA 2VZ9A 1UFKA 3DXYA 4POOA 5GM2A 2PX8A 3FTCA 2ZSUA 1RI5A 3DXZA 3R3HA 4QVGA 2O57A 1SQGA 5HZMA 3QOXA 3MB5A 2HWKA 3E7PA 3D2LA 1JQ3A 2YX1A 1O9GA 3BWYA 3E05A 3KQOA 3HA7A 3ANXA 3G5LA 1WS6A 4L7VA 2B3TA 4DM3A 5F2NA 1XXLA 4C4AA 3KQTA 3BT7A 3TR6A 5C9ZA 3NWEA 4DQ0A 5GINE 2UYOA 4LWPA 4OBXA 5H02A 4F84A 2VS1A 3HVKA 2FK7A 4R6WA 5EPEA 3CCFA 2PKWA 4GOND 1SKMA 4H0NA 3LDUA 2VDWA 4GUAA 3ME5A 4C06A 2Q41A 5LSAA 1L3CA 3A25A 3TOSA 3HVJA 1KHHA 1NW6A 4FS8A 5E9QA 1I4WA 1NBIA 2GH1A 1ZGAA 2HTEA 4OQDA 3QV2A 4PYNA 5KYGA 1P91A 2EFJA 3KPVA 4KWCA 2O06A 4PNEA 4OQEA 3EEYA 4PYOA 4KRGA 4RTSA 2B78A 3FPJA 2IBSA 3FZGA 2YVLA 1NW5A 2AOTB 4PYQA 5LQKA 3V8VA 3FPHA 5KQSA 2IH2A 2ZIFA 2OPBA 3DLIA 4ER7A 5JR3A 3MTEA 4WXHA 3ELWA 3DH0A 4CTKA 2ZBPA 1VE3A 4PYLA 4Z2YA 1ZHFA 4BY9E 4EK9A 5FHQA 3UJBA 2B9EA 1OR8A 4QVKA 5EMLA 4RTMA 4RYLA 3OZTA 2B25A 4PCAA 5U4XA 3FUWA 4CWAA 1M6EX 1NW8A 1N7JA 2PWPA
chains in the Genus database with same CATH superfamily
4HDRA 4MV0A 4N5DA 4O4JA 4NU6A 5AKGA 3N7TA 1BWQA 1T6XA 2PU7A 3H0EA 5KNCD 3OZIA 4F4CA 3FRIA 1GTMA 3RK0A 4ZAZA 2PZ8A 3BXHA 4BNDA 5C5DA 3QHQA 1TVKB 5IT9S 1FDOA 1I10A 3NCHA 4I4CA 3FFBA 4U7PB 3WYBA 3KC2A 1NRIA 1H2RS 1QAMA 1PYDA 2RG7A 2W6IA 2Z8ZA 3PA8A 1AGYA 2O4UX 1MB2A 1UR5A 4WKPA 5FBLB 1KNQA 3GLTA 2PD4A 2REXB 5IM5A 4HVAA 3HKEB 5D3KA 4UHFA 3BQMB 1JHVA 1YCDA 1SQSA 4RZ2A 1J1ZA 3ND9A 3OCUA 3C5VA 3OFND 2NU8A 3VR4D 1WP9A 3AJ8A 4Y1FA 2DAPA 1D1PA 3DMHA 2MGWA 2I7VA 2MINB 2QYOA 4G4IA 1MRSA 1YRHA 1EGAA 1UM8A 4W6QA 4H7IA 4R5HA 2J7PD 4G8DA 2J0QA 2GPTA 1BH2A 1QHHA 1IVNA 1R9GA 1F2TB 1TM4E 6AT1A 2O7VA 3O9ZA 4I1OA 4CIXA 3IIJA 1IEVA 4AKSA 4O0LA 2GB4A 3W4KA 4MUJA 4TS1A 2FK8A 1PGOA 4WXMA 3ZXXA 5CA0F 3K0SA 3ET4A 3OQOA 4RF1A 2KM1A 4D8TA 2A1UA 4ZQCB 3T4XA 1QTIA 3O91A 4ZVNA 5K0EA 3ZQUA 3NDBB 3GI1A 3UTCA 1MENA 2HK7A 2HNKA 3BD9A 3A6EA 3LZDA 2J30A 1B14A 1OXXK 1MDFA 1RRPA 3WLRA 1OTYA 2JAHA 4H1VA 1PJCA 2JEOA 1FDIA 1WEKA 4BLCA 1HQDA 3CW8X 3LWNA 3IBFA 3WMWA 3P2JA 3LO5A 3DDZX 2PXXA 2OGZA 5TMEA 3SXJA 5CCEA 3L6EA 2ZPAA 2ZJ7A 3CLVA 1J7KA 1DIAA 1FFWA 1GA4A 4J7CA 3LRXA 3V5NA 4QZVA 2VHTA 2DXIA 2JASA 2ZI7A 2ZUBA 1M2JA 3SYRA 3SMPA 3PL1A 1G55A 4H17A 3WYGA 3FVWA 3G5TA 1G2QA 2QPOA 4FFRA 4ZYLA 1DTEA 1QMGA 3CR8A 2DWPA 4ZU3A 1YJXA 5P21A 3WGLA 1F60A 4K1XA 4BYMA 5EIBC 4UW9A 4OHCA 2B5VA 4ZVPA 2BR3A 3WNBA 3HU2A 4CQLB 3E3OA 3ZWQA 5IDQA 2OQ4A 4RKQA 2PL5A 5FSWA 2AXNA 2ZUFA 2J07A 4JP5A 3PQEA 1ZXLA 4MYCA 4X3OA 3SHQA 4QGBA 4DGSA 3FPKA 1LPSA 4EG8A 2FGKA 2GFIA 3OICA 4OEHA 5F5XA 1EP1B 3O8QA 1CR4A 4HKTA 4WZAB 2PA0A 4BKMA 2G67A 1XLUA 1Z6PA 2VTKA 3H18A 4OREX 2LVPC 4RVCA 4J2HA 3EEQA 3GO4A 3AB3A 3QE2A 5CEEA 1P29A 3T7JA 4BU1A 3RVLA 4M9CA 3L6OO 3Q7QA 1A9XA 3H04A 2N0SA 3OF5A 4V0QA 1KYVA 1PT5A 4ZYYA 1Q1EA 3IRVA 2VT7A 2YXPX 3JQPA 1QFMA 3UPDA 3VSBA 1QP7A 3IHTA 1PS9A 2CV2A 1EKXA 1WDLA 3SNKA 5HKAA 2FLWA 1Z5WA 3CRMA 2YCBA 1C0KA 1DO8A 2H18A 3AWDA 1CJVC 3QRWA 3TRHA 5JFGA 4WK4B 1A9YA 1VBMA 1Q92A 4KFCA 1CCWA 5JSUA 2D2FA 2V59A 4XGRA 4G1FA 5AK4A 4QPPA 2ZZKA 3PGKA 2JP7A 2IT1A 3CO0S 1BD3A 3KPJA 5CYPA 1NZFA 7CATA 2O54A 3L9WA 4JEMA 1L7NA 3JQGA 2RGBA 221PA 2RHBA 4XX0B 5FCDA 3SXPA 3ZCQA 4AYTA 1XD8A 2BGIA 5DU2A 1R0WA 5K8UA 2AMVA 3EMVA 4WERA 2WICA 2BDTA 1J9ZA 1XL0A 3V80A 4BB5A 1ES9A 1SK8A 2DAMA 1KAMA 3PRKE 3R5TA 3IOEA 4GYWA 4BECA 1W4CA 3ISVA 2CFCA 2XZLA 1U65A 1Q14A 4OQQA 5DXFA 4TZKA 3GNQA 2NM0A 5FOXA 4NPCA 4TMZA 1XOIA 5JY6A 3PI7A 5ANRB 2HPAA 3WHKA 3JRWA 2OXEA 4FHZA 3QKRA 1DGQA 4ZAVA 1E3LA 3PD0A 4LZJA 4JI5M 1E4VA 2Y1FA 3CKYA 3G7SA 4RV9A 2F1JA 4CCYB 1IFXA 4BQPA 1LBEA 4BATA 3H8VA 3E9QA 5LA6F 1AUPA 5AM0A 4KQWA 4TLEA 4P4UA 4AZSA 4DSAA 5BWLA 4TV8B 1PQUA 5A5DA 1JR6A 4IIJB 2VOJA 3CCBA 5K0TA 1RI3A 2QYSA 3B8HA 5KO2A 4F2WA 2BM8A 3E1KA 2EKFA 5D7BA 1X74A 2NPIA 1BZYA 2OP0A 2O8CB 1ULTA 1DKUA 5EUBA 4LRSA 4RO0A 5JHHB 4DSZA 3C5EA 2FZGA 1R0CA 4N5MA 1JMYA 3CLSD 1QV7A 4XFKA 2WZDA 2I67A 4DS3A 5E4YA 2Q5IA 5KYUB 3OEYA 1M2EA 5IZCA 4G3OA 1EE1A 4NCHA 2BFWA 3RYFA 4NH0A 4G5GA 3WYDA 4C43A 3BRWA 3I8XA 2OXFA 5IFKA 4KCGA 5ICCA 4TKZA 4JBGA 3B2EA 3PWKA 2H4XA 3S2EA 4IS3A 1Z39A 1VHLA 1BH6A 5HUHA 4GGMX 3MVEA 1AKRA 4YALA 3TLKA 1NN1A 3BMNB 1CX9B 3KCQA 4QAQA 2D5CA 2HSJA 4A6DA 3FZNA 4OU4A 3TW0A 3NR2A 3V00A 4QYIA 2V3CC 4ZCLA 1UDCA 2REOA 1YQ9A 1DFGA 2IGTA 2XJ4A 5IANA 3AQIA 3AI1A 1F8YA 1Z18A 2VNKA 3OZXA 2ZJ6A 4DUYM 1E77A 4QARA 3GMIA 5I01A 3ISJA 1AKQA 4IJUA 2FN3A 3EJWA 5EVJA 1ZL0A 2HLHA 1ISJA 2FPXA 2RGGA 3R74A 3CY6A 4TKLA 4TXLA 4FHCA 3G8AA 3LFTA 3AM4A 5ALIA 2JFWA 2V9PA 5B6IA 3ITEA 2PKQO 3CX8A 4S2UA 2OV4A 2WKRA 1QHEA 5TGTA 5AVOA 2ZR7A 3ZVLA 5HS6A 3IDQA 2IUSA 3T1TA 5GMOA 2KPOA 3UK7A 2J0VA 3QPAA 1AKMA 4MKGA 1YIAA 3N07A 2GYUA 3BTOA 3KOMA 2BFFA 3ZWKA 1AUOA 4G0WA 3SATA 1G21B 1E9FA 5ERXA 3TW4A 3A06A 2Q62A 1X2EA 3QI7A 2IS2A 1XTKA 4Z4IA 3ILVA 4YREA 1C30A 1MTZA 1UXIA 2XD9A 5DI9A 2OORC 3G2OA 2EZ8A 4ZARA 2HHCA 4AJNA 3JW8A 5E8JA 4DCUA 4D6PA 2PK3A 1OAAA 3HG7A 2D5LA 2PZMA 3L0SA 1AM4D 3VKGA 1GDDA 4J9VA 1GP2A 3UAYA 1S7GA 1RXUA 1ULUA 4D96A 3RVPA 2FCRA 4JYCA 4OUKX 1JJ7A 1MT3A 2PCLA 5DM60 3JV7A 1O58A 1AN0A 1RE1A 1QB7A 2YVKA 1FTYA 2P0YA 1XZAA 2IUFA 2B5WA 3ICPA 2J3LA 3KJIA 3CRNA 4X6YA 4E94A 1U63A 4URYR 3SX2A 2ZYWX 3RWOA 2WLSA 1GLNA 1SUBA 3BXZA 1NI3A 2K5UA 2V03A 2XMSA 4JVSB 1JG4A 2WNHA 3KOWA 3BJRA 2QTGA 1HETA 1NI5A 4QRDA 2ZM6B 4L02A 3CCCA 3GRZA 4J0IA 1SWVA 4U8GA 3R7SA 2AA3A 4QWWA 5ADUS 3D4BA 1W87A 3U3OA 1WB6A 3JWIA 4ANRA 2ZWIA 3A9UA 3HHEA 5BSMA 2W42A 4QE3A 2ZXEA 2WT9A 3NWJA 2FX5A 16PKA 3P2MA 2DBYA 4LFBM 1OQYA 4RAQA 2AL7A 3KSRA 4C7XA 3OZEA 3GFTA 4D02A 5IS2A 4J6EA 1TJ5A 3G9UA 5LLDA 1XBTA 4G24A 5FJJA 2O8EA 3DDCA 4U39A 4W8OA 3RADC 4Q48A 3WV4A 1CEEA 3CX4A 4IICA 1DEKA 3W6NA 3U0BA 4LGMA 1IK6A 1J4AA 3PXBA 4HGQA 4IPTA 1Q6YA 3I39X 1HMYA 1VJ0A 2XIQA 5EE0A 5BURA 3UH1A 3NJ4A 4MV7A 2WJZB 3BSSA 3ZHZA 2DGDA 2EGHA 2QTCA 3NUGA 4FILA 4KU4A 1RZ3A 4UEWA 4B80A 3FOZA 2W5UA 5KDLA 3JWEA 4FFWA 3L0BA 2WFLA 4TYYA 5IKXA 4NV0A 4UTPA 3K0KA 1Y1QA 3ZV3A 3ETNA 1UBMS 3IKMB 2BFEB 3OZBA 5D5HA 3T61A 1H4SA 2H17A 3FYUB 1ZD5A 4PFKA 1DGGA 1KVUA 4F45A 5B7GA 2Z6QA 1JZQA 3NGLA 4JEHA 1OBHA 4RE5A 2PAAA 2WIBA 2BSQA 5FYDA 2BGUA 4R7GA 2FDXA 3FNEA 1E5XA 3SOPA 4E31A 2D7DA 3JRXA 2XW6A 4GPAA 2G9RA 4ZXPA 1FL9A 3ML1A 4QRIA 2YRXA 3QG5A 4UARA 5FLEX 4OGGA 1VG1A 3QFCA 3RTCA 3UXMA 4Y7DA 3AZPA 1MA3A 2G04A 3DV0A 3HA3A 4HGOA 1DTSA 2OL4A 2J9XB 3PX2A 4F86A 4MGZR 4YPFA 3S8EA 2EOAA 2PUGA 4IMPA 3ROTA 3P9KA 4M0PA 5SZKB 4BO8A 3HCRA 3NEAA 4DRXB 2YWJA 3KYDB 4EO4A 4RCYA 4N6NA 4TT8A 3AF5A 3KDAA 1E0SA 1MZVA 3T1HB 2BMJA 4IIFA 5EP1A 3PGVA 4NEHB 4MVJE 3AZQA 3DW1X 3GZTB 3IDZA 4ISCA 5AI9A 4IL5A 1YA4A 4Q4HB 1I2MA 5DX1A 4EGFA 2DX7A 3NM6B 2WSSD 1GNLA 3IOBA 5EZSA 1U7XA 1KSJA 1SOAA 2JI7A 1WZEA 1BW9B 3CF4G 1UH5A 3ETEA 3CSUA 5JEDA 4Q4JA 3TX2A 1T36B 4XYLA 4PT5A 1XXHE 2DCMA 3FHJA 1R6TA 4UM9B 1Q0QA 3TVTA 1WR1B 1CE8A 1JU4A 1QP0A 1AIPC 3K8OE 4U7WA 3QUBA 4G9GA 2O8BB 2AVNA 4JR0A 5L8RF 3K5IA 4Q00A 2AFVA 1UJ2A 4J0KA 3IERA 3ESYA 4WH0A 4IF4A 4WKCA 1FX0B 3RTEA 3TZQA 4C6RA 5EVCA 2M6RA 3FNRA 4GEGA 3CWCA 4CHTB 1AIPA 1ZJ4A 1UFVA 3GAMA 4O4LF 5AW9A 4AULA 3VKUA 1JQ5A 3CUKA 1QANA 1MX1A 2FZWA 3N74A 3WLOA 3A26A 1HFWA 1UPCA 1LBIA 2R4QA 4O1MA 3JZIA 3NFYA 3Q4GA 1RJWA 1GAEO 1GTJ1 5E1MA 3IAAA 2WNIA 1ZW1A 4JYAB 1AMOA 5LD2C 2I34A 3U3MA 2IV7A 1Q1ZA 5C1BA 2D8MA 5HIKA 2HF8A 3QFSA 5KVAA 4ARCA 2C2ZA 4QAJA 5D85A 3EXAA 3V4VB 3CB4A 1UKYA 3EWAA 2VUUA 2XLCA 3C3PA 3REFA 4XM2A 4LJ5A 3DT8A 5CW1A 3UC9A 5KCMA 3IECA 3E7WA 4EUNA 3ZHVA 2J1LA 4RLQA 3O73A 2XMRA 2EJUA 3KP1A 2ODAA 3GA5A 4D3FA 2CLFB 5FF9A 4ZVOA 5DYIA 3I5YA 1ZNQO 1JXOA 3IV9A 2Z3ZA 4UATA 1I1HA 3KOWE 2ZWMA 4NCXA 4LOKA 2ONJA 1H66A 3A9WA 3HEAA 1ESDA 1R12A 1UMCB 2BGNA 3RUHA 4ZRMA 3GIWA 4XWTA 1RYDA 3FMOB 4CL2A 1ECLA 4HAZA 1KU0A 1UAAA 1Z08A 2VPIA 3PQ4A 5LC1A 1GSHA 4Q05A 4N47A 3A1SA 4KIUA 3RVDA 1PW7A 4F2DA 1NRXA 2FDRA 3K9NA 4H59A 4TQUS 4DSOA 4LOAA 1V8DA 1XLVA 2PYDA 4MKIA 5EZYA 3E05A 3ZWXA 1DBPA 2D74A 1G2OA 3U9TA 1G1AA 4FEAA 4YRGA 2YC2C 4DM3A 2CB9A 3R41A 4RHYA 3UHFA 5JU6A 1WU7A 3GFOA 1ECBA 1KVQA 1RMQA 2CVQA 3WJ7A 3I3SR 4AS3A 5BQXA 3TR6A 3PDHA 1VLJA 3CTPA 5GINE 1T9AA 4J4HA 4CTOA 2VJKA 5LR6A 4HYYA 3CN7A 4HBZA 3TGWA 3R0XA 3DONA 1JWLA 3PG5A 3ACDA 2Z7JA 4C4RA 4Y2UA 4RPGA 1YC2A 1YOBA 1JMVA 1UXOA 4FS8A 4LF9B 2GH1A 2XTZA 5D00A 5REQB 5YASA 2C1XA 3EDYA 3W9BA 2W0MA 3DWGA 4B35A 4Z3DA 1YFZA 1BHO1 3VAYA 1KYYA 4NS1A 1MP0A 4RJLA 3CVXA 1MB3A 4PYOA 2F67A 3O8NA 3VKFA 1CUVA 1V3TA 1E1YA 1WXGA 2FW1A 4LDNA 3DF7A 4BVFA 2EX0A 1C7YA 2UZ1A 2QX8A 4J16C 5A5EA 5LWHA 3UAZA 4FE7A 3S28A 2VDBB 2QENA 3BZWA 3F7NA 3O1JC 4HYTA 2VF8A 4AS1A 2FEOA 1ZHFA 4U8HA 2W0SA 4DADA 4TSRA 1L5GB 1XK6A 4YAGA 3HJAA 2QNIA 4FWBA 2HYIC 4D9GA 1OR8A 4OJKA 4QVKA 3M3DA 4AU1A 1GL3A 1RPTA 1XN1A 3ZTWA 4ARZA 2AGVA 4CGZA 2I4LA 4N03A 5EJGA 2GCPA 1A9QA 3SR3A 2DRIA 3RIYA 3AJ9A 3GK3A 3G2NA 2V6ZM 4ME6A 1QHGA 3I3OA 3RJTA 1NXPA 4WTOA 4MGZE 2VTDA 3A42A 2ISQA 1N0IA 5EKXA 1XZKA 4G5QA 4INZA 1TCCA 4DIEA 1WV0A 1TJNA 2EW1A 5LJIA 3RS0A 3DBIA 1I1NA 4PZYA 1N3YA 2VPYA 2AMJA 1DG1G 1FMTA 1XU4A 2FPGB 3F7MA 4E03A 1WVGA 2UXBB 3HZHA 3W8FA 3M1IA 5D1NA 1U0JA 4YI5A 1F1BA 3AEUA 3DO6A 4MB0A 4CF3A 1ZRSA 1I51A 1QO0D 4AL4A 3B6IA 4HZUB 5BWCA 3OT1B 4JASB 5HIAA 4A5OA 4TLBA 1TA4A 3SIXA 5EL0A 4KXVA 3G6WA 1M8PA 4W5TA 1X19A 4D45A 4GFDA 1G8PA 5GGXA 4Z4GA 5FT9A 4F06A 3B2QA 4WK0B 4EJ2A 3R5JA 2LHGA 5ENZA 1EVQA 1IB6A 1V8OA 2TRSB 1NI4A 4IIUA 1R10A 5A5FA 3UMYA 2G1UA 2AMYA 2C5SA 5BVGA 2JGMA 5HDBB 1VKZA 4YONB 4M1QA 4ZAYA 3U7GA 5KWEA 4ZGWA 2G6BA 4MRSA 5DFAA 1PZGA 4DLPA 3DBVO 2XX3A 4TX1A 2D62A 3BGVA 4BEJA 3I4CA 3N2NA 1FP6A 4JXKA 1R8XA 2ERXA 2W70A 3ZE8A 2QYHA 4UREA 4D4JA 2K2WA 4Q6WA 2HF7A 3OCJA 4XDGA 1DCFA 3H1EA 4XYEA 3ZY3A 1D1TA 1RW4A 3RKUA 3OFJA 3K7EA 5G4KB 3GNLA 1U0RA 3OOYA 3BTSA 4EW6A 2W8BB 5EMHA 4CT0A 1P9NA 1BCRA 1JAHA 1KJQA 4BZPA 3CLSC 2TS1A 4F9GA 4YCCA 2FW7A 1SUSA 3MUNA 3LC2O 3NW9A 1M34B 5A4DA 2EA0A 2FFBA 4K9PA 4A6XA 4BC1A 5KSYA 1HDXA 4XUDA 2BUCA 4EI9A 4AQYM 1U2RA 4Z9BA 2IW3A 4HFRA 4E2WA 1NTRA 1IUPA 3ZCTA 1CB0A 2IZ5A 3HUTA 3FX2A 5AM2A 1WABA 1ZZEA 1R15A 3A70A 1NNJA 3TE6A 1DV2A 1MJFA 3DBOB 3F2VA 4MRNA 4PAGA 1O89A 2X6TA 3GG2A 3N1UA 3CF0A 3INGA 4IVQA 3SN6A 1UBUS 3WL5A 3EJ6A 2C20A 4BB0A 3N2GB 4IXWA 2GUGA 4NHOA 5LZ2A 4X93A 1YTUA 1YACA 2MJLA 3CNNA 4G2TA 4RZXA 3PENA 4M1ZA 3GJ7A 4L8FA 4K2HA 2LKDA 5BYKA 3C58A 1N0HA 4CG3A 1KK2A 4DF3A 1YZLA 2PYIA 1N36B 2W6ZA 3X1YA 4DZRA 3ZR4B 2AOUB 3KJZA 4MYHA 3UVEA 3CT4A 1Q6ZA 1VE9A 2IVFA 2AOXA 5FDFA 4KPEC 4M9QA 1YZHA 3JQAB 1HNNA 3CVUA 4MV8A 3FUCA 3PYLA 3LBAA 4N5IX 1MU0A 4WKOA 5SV2A 2R751 4PSAA 1CNMA 2NYUA 5DASA 1RPNA 5AVKA 3RAGA 4CZ2A 1R0RE 2CVOA 2GJKA 5JCXA 5JC1A 5KREA 1K06A 4D82A 2NAPA 1SVUA 2QU7A 3QVUA 1PD1A 5GQSA 4CLRA 4PGGA 1C3OA 4LXIA 3U5TA 1O7JA 1P31A 2EQ5A 3DAOA 5JMOA 3EIUA 1JLRA 1KSGA 3BJEA 2JCGA 1NVEA 4P1ZA 5C37A 2FW9A 3HN2A 3AESA 3G8BA 4YIKA 4AMBA 4BLPA 1QH8A 1ZN9A 1S2MA 3GMSA 3KD3A 3KXKA 1XTBA 4YASA 5L45A 1IN1A 4QGHA 3MILA 4FP9A 4KACA 1DB3A 4Q1FA 4KFUA 1K1EA 1OV4A 3NVDA 4RIFA 4ETIA 1C0LA 1Y3DE 1TT5B 2C9ZA 4TTRA 3AOGA 4M8KA 1TRHA 3VNUA 3M7GA 2ZSKA 4JIGA 4RHCA 4MIEA 5D6OA 1NBWB 1G8YA 1LGYA 1XTPA 1BMFA 2X1HA 4JUCA 3TQFA 1EGQA 1SBIA 2CXPA 3L7BA 2I4IA 2PWZA 3RRNA 4LF8M 3BB3A 3C3EA 1QG4A 1W73A 2HA6A 2DZLA 3LUDA 3N7UA 5DGHA 3COWA 3VHXA 3AVVA 3HDTA 1DQNA 2FZVA 3F4KA 4DV6M 2JH3A 5TEVA 3VDXA 2CYAA 4QTUB 1GU0A 4UAJA 3TFQA 1XYGA 2CLDX 1HZZC 1SXJE 3GEHA 3OCWA 3IQHX 3EX7C 2C9MA 3T8YA 1X8XA 3CR3C 3GLHB 1ZI6A 1XZBA 2D1SA 3GUUA 4JC8A 2ZRHA 2VHUA 4L1KA 3ETLA 4KKVA 5CVJA 5IDYA 3OQNA 1Q0TA 2E1PA 2MOKA 2QXTA 2P90A 2LW7A 3OEED 3THSA 2PFSA 2XYGA 3PP8A 1RC0A 2PBRA 2H65A 2GPBA 1RP7A 3GEGA 4EB3A 5TQ0A 5BMVB 5FR1A 5ICEA 3F49S 1IZZA 5MN5A 3L40A 4XWYA 3ROPA 4DCOA 1XNQB 3E48A 4UCXA 5AD1A 4CU2A 1VLLA 5H3LA 3GRVA 2QPTA 3EA5A 2IWHA 1AX9A 1OH7A 1A8UA 4HH1A 3CLUC 1N92A 4LSMA 5H37D 3ZH9B 4LTMA 2QZSA 1N6HA 1EFRD 1VI6A 4O4JB 3R9WA 3BX1A 4K46A 3HBJA 2ZZNA 3W2EA 5EJAA 3ZWCA 4BBPA 1KWGA 3KUXA 3TIVA 2P67A 4IKOA 4W6ZA 121PA 3A1UA 4XK8F 1Y3HA 3HU5A 2E3JA 5CJJA 2C4MA 3A6FA 4R1PA 3WRYA 2BUAA 2E89A 3NDPA 2GN9A 2R60A 1IY1A 1GPDG 4I08A 3RANA 3QU2A 3J27B 3PR2B 3R7FA 5JJ5A 4AECA 4FHEA 4BNXA 4DPMA 1FDTA 4HCJA 4LCJA 4WIAA 2FWBA 1IHOA 4AZ0B 2DERA 1UKBA 2WJ3A 3I6BA 3L6RA 4RV5A 4XQCA 1SXGA 1ZJZA 3N0WA 3RG8A 1C2TA 2FJUA 1NLYA 4ZTZB 1E3WB 3MPOA 4CVNA 3D1LA 2ODBA 1NJGA 2ZROA 4WMLA 2KBFA 4CMKA 1G5HA 5JRZA 4JI4B 4L22A 1N2SA 2I03A 5EXPA 2UVDA 3OEEA 1UMBA 1ZJYA 4Z6KA 5CVTA 5GIPE 2VRWA 4X94A 4XAQA 4ZYTA 5EHZA 1FIUA 3OTOB 3AJEA 2BJHA 5LJLA 1IN6A 3SM3A 4B4UA 2YHBA 4UXIA 1DV1A 3D8BA 4YXWA 4GBMA 5B58T 4LFCB 3UCEA 2IXDA 3KVRA 3RF6A 4RJJA 1S1MA 4M54A 4RABA 3FTFA 1Z2DA 3G02A 3JASA 2VHQA 2I2DA 1BU5A 3FNFA 4JP1A 4KG7A 4CCYA 3IAHA 4UNSA 1LCIA 2ZIZA 1TGYA 4OFWA 2CDRA 3Q9LA 4RVDA 4YCJA 3IP1A 4DLAA 2QSUA 2JFQA 3KSMA 1G9TA 3BMXA 4JMPA 3NCTA 3HWSA 2J7OA 5BW5A 2W4MA 5DNAA 3SS8A 2LVAA 4ANFA 1TH4A 2ZSDA 3JCZA 3VSEA 3F8WA 4AN4A 4LK3A 2EG9A 1SBYA 3LX8A 1L1FA 1QGUB 2OZPA 3ETDA 2R8YA 3OLVA 4B44A 3NS7A 5JDIC 3WLFA 2C5AA 3GCZA 4JKIA 4L0QA 1PKXA 2HQRA 2GOYA 5JOQA 3UJ3X 1Z9BA 4AUEA 1GGHA 4P35A 4YJHB 4KJXA 2GBCA 4XIYA 4WCFB 4ENTA 2OAP1 1RWQA 1F2UB 2A1UB 2OBBA 3KEOA 4R1NA 4BAUA 2R3SA 1RE0A 3OU7A 1S1CA 1NVUQ 4G8JA 4WZBA 4NMHA 1RM0A 4BVKA 5CHYA 5GVRA 3UB4A 1L1ZA 3VU9B 2NV2B 4IV8A 4DT1A 3EZ9A 1ECJA 3JZFA 2UXDM 1ISFA 3OZUA 3KLOA 4TXNA 2VAXA 1VPLA 2X5NA 2ZRFA 1ONSA 5J23A 4AF6A 2DKLA 1ODFA 2VO1A 5B55A 4AX8A 1LDYA 4AJOA 1XDBA 4PG7A 3V4LA 3IP3A 4L57A 3WQSB 4PLFA 2QPAA 4P58A 2ZATA 1WUHS 5DNWA 4C0XA 4YXFA 5DYGA 2UU9M 2I3DA 2LTUA 4B3CA 3ER9A 5MFPA 3UC5A 5JI3E 4HAWA 2GERA 2FEWB 3FI0A 4UOQA 1TLTA 3KKMA 3X3HA 3HXMA 5GJVC 2PX2A 2VBGA 4NBRA 4UHJA 1YMVA 3K71B 3NEYA 1XRPA 3O3MB 4HGNA 3LG2A 1QC5B 5CNKA 1YF3A 3GW8A 3P2YA 2D3WA 1GABA 2QRQA 1JWBB 2Q5LA 1PNVA 3ZVRA 1BDJA 1KMIY 2EFDB 1J99A 4F1IA 1OT3A 1Z17A 1HRKA 3BULA 3ZG6A 1THGA 1KYIA 4L9SA 2AF4C 2GPSA 3FHCB 4GMFA 4EHKA 5ITZA 3DDWA 5DV9A 3UK1A 1DP4A 3B74A 1TLLA 1GFZA 4LZZA 1DQYA 3DE3X 4I1IA 4RY0A 3ZNNA 4DANA 3KRTA 1U3VA 1S96A 3GJYA 4GOMD 2NAFA 4LF6M 2B36A 3EBPA 5I4BA 5T4BA 3W6PA 4PINA 1E3IA 1SZCA 1F2DA 1Y4DE 4GIBA 4DLNA 4EX7A 1ZV1A 1XG5A 3WBKA 4UUOA 4CM8B 3EPLA 2XKJE 3PCXA 2OO5C 4LKOA 4AMYA 2BBTA 1JIQA 1RJ9A 1HL7A 1PFYA 2RJNA 2ZPTX 4K26A 5CB4A 3LVRE 5IMSA 1XZLA 5LQJA 3BJZA 1B3RA 2D59A 4YDQA 5T8KC 1F0YA 3F71A 3D6TB 2XH9A 5J1TB 3JYPA 3KKKA 1ZG3A 5C53B 2PBZA 2C07A 1MB9A 3UFBA 2JK0A 3G8YA 3JD3A 4GQBA 4S1PA 1DRWA 3PXGA 2CLHB 3C5CA 3G68A 3G5UA 4QOGA 3W79A 1YB7A 3EVGA 4BAGA 4EOGA 3TMKA 5K0CA 3TD6A 2NP7A 3QEMA 5DOVA 3LAWA 5JDCA 1DAKA 5F98A 2SKCA 1IQUA 1GHTA 2D1YA 3OC6A 4M1OA 1GNVA 1JHRA 3DOAA 1XJCA 2HWJA 3OE4A 3PR1A 5JH7B 1U3FA 4A0SA 5BWOA 3AQ4A 1Q7TA 5ERGB 3RSHA 4HDRB 3MIIA 4LHXA 4EHFA 3EMBA 1LRJA 3PZRA 4F2HA 1UKAA 1QOQB 2XB9A 1M6YA 4R16A 1U8XX 1VRWA 4R8VA 3AVXA 3C24A 1D2AA 1QX3A 1F20A 3LPDA 2QL9A 1UMDA 5FA6A 2ZJ8A 4RKFA 2WJIA 2C59A 2RGNA 5EE9A 1OU4A 1RQLA 1TYCA 2FXVA 4YQEA 3TWMA 3LP8A 3ACBA 1NOIA 2XNSA 3HQ4O 3LYUA 1VMKA 2PA3A 4R7ZA 4WZ6A 4KI0A 5DSXA 1OFTA 4K0RA 4IIJA 3FRHA 3O4IA 3ZY5A 1JLKA 1QIKA 3OJEA 5C80A 2F4VM 2APLA 2OB1A 1R8JA 5HQJA 3UFXB 5FBQB 3ZW9A 1WIVA 2P3LA 5CLIA 1RC8A 1XNQM 3LUJA 4TLCA 4XIIA 1W0KA 2YWBA 3O8BA 2HXGA 4QBTA 5DE3A 1SUIA 3SEFA 4FTWA 1N6IA 1Z2OX 1JTEA 1PGNA 4CIAA 3T1OA 4B32A 2N1MA 4YP9A 2YJ3A 4W82A 1V71A 4ZQFA 5KYWA 3ELYA 4DKXA 1V2GA 2ZJ1A 1UP7A 4IVRA 4QL3A 2CBZA 2FE4A 4GDMA 3W7VA 2HA0A 3BCSA 4U9UA 2VJAA 1A9ZA 5C31A 1ECPA 3DDNA 5A0FA 3RTAA 1PBNA 2QY9A 1C7EA 1S02A 1AKWA 5A6VA 1C14A 4FDVA 4QXMA 2RGAA 2YHIB 3C45A 1QCDA 3ZY2A 3ANNA 2PLRA 5TARA 4TKUB 4IP0A 2I87A 1Z62A 2H2IA 3JD4A 5E4JA 1HTWA 2F5PA 1KQNA 2DWNA 3ROGA 1I5EA 2NZYA 4HDKA 5G3ZA 5FA8A 5A03A 1V3QE 3QF4A 2IIQA 1NVMB 1YR2A 2RK3A 1UBSB 2Y2UA 4QVGA 1WQ3A 4QQFA 2GI4A 5B1IA 2HWKA 3KJFA 1ZK4A 2VK4A 2YZ7A 1E1DA 1VJDA 1XB2A 3CFYA 3GDGA 3OHPA 1Z6YA 4ZVQA 3W34A 4HDQB 3MMPA 4DR5M 2IIVA 4WLVA 5ITVA 5IWAB 4JLJA 1K8YB 3NYIA 3MTJA 5GJBA 4UDOA 1BJTA 2XHEA 4G4RA 4RH0A 4OBXA 2EFYA 2QUBA 2XLBA 2REBA 3KVNA 5FEMA 3QXCA 3K9PA 4BGEA 2CXSA 3LDUA 1ADCA 3K35A 2Q41A 1NX9A 3RS8A 4RM3A 4TL6A 3HVJA 1M8KA 2IYLD 1ZAEA 2OFXA 4Z2AA 3FWKA 2QUHA 4J94A 4PXYA 1OD6A 2JAQA 4NZZA 1T2CA 2PX3A 4MMXB 5TMBA 3KPVA 2E5LB 1E7WA 4KWCA 4JI7B 3AYZB 3TH5A 1O95C 7MDHA 4G1UC 2IBSA 3FZGA 3DCJA 4L9RA 2AG0A 4V0NA 4Y1RB 1JHUA 3MJTA 1PGQA 1QE5A 4TSKA 4R1LA 4TN5A 1YHZA 2O2XA 3PFBA 4R3NA 5ALNA 1FPMA 1OPRA 3BF7A 3VJLA 1TUIA 4YGXB 1IXSB 1XD2B 2HDOA 4Z1MD 1U0FA 4LBWA 1C9DB 1IPFA 1Z26A 2FWMX 1M1UA 3BE5A 3LD9A 5KO3A 3DTVD 2QIOA 3OQBA 1BXRA 5FNVB 1V35A 1ORYB 5TPWA 3E3AA 5HJ5A 5LB2A 3NGXA 1JI3A 2HIMA 3IQZA 2NUPA 4I4TB 2QN6A 5AVUA 3ONVA 4F3NA 4BVHA 1M6EX 4C9BA 3DZBA 2REQB 4EZIA 5JE8A 1RXWA 4DVJA 2IZ0A 2PSFA 4ESEA 1AO0A 4YA6A 4BNUA 5B3KA 4KLRA 5HQTA 1KC1A 2ZP1A 5TS2A 2VRNA 2XITA 3H0KA 3HKDA 4GPD1 3ZIUA 5E7IA 4AMUA 1I3KA 2X58A 4YPOA 2E48A 3LGAA 3E2IA 3ZH2A 3Q8XA 4FE3A 1M83A 3SYNA 3HLKA 4J1SA 2L7IA 3ERCA 3J81S 1DCMA 1VL8A 1TU4A 3JQCA 4XUCA 4GPIB 2V7BA 1Z3CA 2GR9A 3CGWA 4FT4A 2QOEA 1ZOLA 4UDNA 3Q5GA 4R68A 4RHEA 5BSEA 5AM1A 2VP2A 4BP3A 1TR8A 5KU7A 2NZJA 2UYGA 4IIJF 3G2IA 4ZAWA 2F2TA 3CT6A 3P9NA 2VTBA 3MTBA 3NDJA 4IF6A 4JFRA 4UEKA 1GQQA 2Q28A 5LU9A 1F3LA 2XKKA 3VMMA 3H4IA 5JNUA 4N1AA 4XJXA 1X6VA 1PIWA 2R00A 2ZYIA 1OIWA 1DGHA 1M67A 2C4KA 3PUVA 1IDN1 3PXAA 2A0XA 4JB3A 4N0MA 4OH1A 2SICE 2VSYA 3ZD8A 2VQDA 4ZOLB 2CBXA 2G5TA 1D09A 1SKBA 4K8RB 1L4MA 5LMUM 1HDRA 1L5VA 1UOPA 4KIJA 4D3DA 4FQ8A 3I0MA 3MQ2A 3UJ8A 2IH4A 4KNYA 1DPGA 5FUQA 4QSMA 4BTVA 5JAIA 3EFOA 1ILEA 3RS2A 1IQRA 3H1PA 2NZXA 1DBSA 1XNRM 1Z2PX 3A4TA 1V1MB 2XYPA 3IAXA 3K9BA 3L4EA 2AG6A 4UNNA 4BUJA 5KTTA 3DFUA 3U40A 2HDWA 3K8YA 4UUPA 4MKFA 4G4GA 1NUQA 1P0PA 2QJRA 2GTPA 2P77A 5DO9A 3WYCA 3GUYA 3ER8A 5AIBA 4LF7M 1BX1A 1E2MA 4QXPA 1CQIB 5DTMA 3TOVA 4Q3KA 1GADO 1KPIA 2EFHB 2O9JA 1ZD3A 3L07A 1JR3E 1CEXA 2GHRA 3NBKA 3ZDZB 1Y6GA 1M1YE 2BI7A 1M8JA 2X0RA 4XI9A 3SJBA 3W5CA 4MDFA 3DUFA 2J08A 2UYYA 9ATCA 1OILA 4GM4A 4M0CA 2XLJA 4RHUA 4GKAA 2FFHA 2QMYA 2C4VA 5ICFA 5L7YA 1QAQA 2B8WA 1DRJA 3GH3A 4IGKA 4GX2A 5DB4A 2A92A 1PN3A 3HEMA 4K6FA 5ALFA 4AQYB 3B6KA 3TTTA 3C3MA 4ZOBA 3H2IA 4M37A 4PC6A 2EO2A 3TUJC 1VJGA 1JVNA 4C1BA 3RHSA 2BKLA 1JR4A 1U7DA 3MT0A 4G0YA 2ZREA 4UJ3A 3VZCA 4W63A 1ZC4A 3CO5A 4IJWA 4ADSG 4F46A 5J2UA 1X8JA 1V4BA 4Y9SA 5KI6A 4I9HA 4ZI7B 2QUZA 1YS9A 5KS2A 5KWJA 3FJYA 1RWNA 1Y34E 4C0JA 4ZYZA 3DUWA 2GFQA 4P4NA 1NT2A 3I01A 3LDAA 4YCMA 2R65A 1ZPDA 1DIRA 4JX8A 4LMRA 1EFPA 1UINA 1N2OA 5F23A 4CF4A 1AU9A 4GOLD 1TA0A 4F3KA 3FZEA 9ABPA 4NXMM 4Q7EA 1K6EA 3EQZA 3T5BA 3EARA 4B3TM 4KIFA 3UBTA 3A98B 1KHTA 1P9WA 2QW0X 4AN0A 4W1QA 1U2PA 3F6SA 4FGKA 2FOIC 1VBNA 3H8SA 4GXRA 1PSDA 4JP2A 3NOVA 2NTYC 2J3EA 4L51A 1VE5A 1C5KA 5KJEA 1QFXA 4UD6A 3RO7A 1XV5A 2WUGA 3OP1A 1JEOA 3PXDA 4RK4A 1C8BA 2CYCA 3K20A 5K45A 2R7LA 2SNIE 3H2SA 1EJBA 3UWMA 3HJGA 4RD6A 1XA0A 2JGDA 4HV4A 3QA3E 5IKPA 1TMYA 2C29D 3GUHA 3V1LA 2AVDA 4ES6A 3ZDAA 3EIEA 3W68A 1UJ4A 2ACVA 3WMRA 2HJRA 5F4BA 4NEGA 2YW9A 4DAEA 4EI8A 4FWTA 3T06B 3PXCX 4HH4A 1FNDA 1KR5A 2ATVA 4O4HB 3J80A 2VYVD 3KKOA 2NVBA 4X60A 1QUSA 5KJFA 1V11B 5DLYA 2V65A 3OWXA 4G0MA 1YULA 1D4OA 1OAOC 1HLDA 2C03A 2BKEA 2E49A 3NAZA 4IZOA 2WWGA 4RMJA 4ZU1X 4Q9JA 3DA1A 1NURA 2X7XA 4L76A 3QLJA 4N76A 2XQJA 1MB0A 3R1IA 3K8QA 1QDEA 2JGIA 4HDAA 2X0IA 2OR3A 2IPAB 4HK4A 5B37A 2WUEA 1W0KD 1ISGA 2QI9F 3G6KA 5F21A 1J2EA 3AY3A 2Y1WA 3HE3A 1SQ5A 3LKBA 3Q85A 4MPJA 2ZBUA 4OHZA 3TBKA 2PUDA 1FTQA 4Q4AB 1DLIA 5D6NA 4BMVA 2AFHA 5HK8A 3GT4A 3TLAA 1FE8A 1E8NA 1H1LA 1P7ZA 1SO8A 5CT4A 3UFXA 1H2FA 4N9WA 1XQ6A 1B8OA 1C7RA 1U6KA 1CS4C 3HYRA 4QOFA 1GITA 1TCUA 3GP1A 2WILA 4XA8A 3DAHA 1WKBA 2XOKD 2CCGA 2QAGC 4ZYVA 3INRA 4BQRA 3AMVA 2PT6A 5E3IA 4AZ3B 4OXRA 5IF9A 2X4LA 4JYAM 4QYWA 2Z5LA 2Z1MA 5CT6A 1EG7A 4C6SA 3JSAA 1PFVA 1SHJA 3KZMA 3C1AA 3EQ6A 4L5AA 1KEUA 1YB6A 4FFBA 4U3JB 5SICE 1DTWB 3GMDA 3R0ZA 4F8EA 5CDTA 5AVXA 3K9HA 3T3IA 1NVBA 4U2CA 2VYND 1GIAA 3N2IA 1KO7A 2C96A 2GKOA 3ROZA 2C2OA 1TTTA 2QE7A 3IQDB 2QRNA 4C3VA 2KDLA 1HYBA 5BQ5A 1LPMA 5EPOA 4RLFA 1A9PA 1RLMA 3T6KA 1G3IA 1CS0B 2PPVA 4GI5A 4AO7A 5ENVA 4FVTA 1JJAA 3KZCA 1QH9A 4QDXA 1JHOA 4MWOA 1FNSA 1J70A 2J4DA 1T2EA 3IS3A 1ORIA 2LE0A 3B5IA 5FOSA 1R9NA 2XWSA 1MUUA 4MCHA 4UM8B 2DWOA 2WYUA 2YW2A 3MHVC 2B7CA 1GCUA 3HV2A 3IEXA 4KLAA 4PFSA 4B8WA 3OEHA 2F3RA 3ASYA 3OT1A 4ZVSA 3VPAA 2HKIA 1NVGA 3P0IA 1NV9A 2B1QA 4KMRA 3WXBA 4D4HA 2V6MA 4NBUA 1J56A 3QVTA 4KGVA 4EG7A 1JIXA 4JJFA 1HZZA 3KBBA 4JR2A 2VHJA 4UFNA 5IULC 4QTTB 3A6PC 2GK4A 1W46A 1YU9A 1BMDA 1AV6A 2EFGA 4NECA 1LQ2A 1PD0A 1GG2A 4HGPA 2ZUEA 5EJ6A 1YUMA 4Q9DA 2I7TA 3T3PB 2B8TA 3GQVA 4IX9A 3LZ6A 1JKIA 3KKZA 3EOBI 4AIIA 4AW4A 4DOMA 3SQDA 3NT4A 1BA2A 2HYDA 1WGNA 4JL5A 4BFZA 3O4HA 4OHYA 5A6SA 1YQDA 2BELA 5DULA 4DEYA 3KOYE 3T4EA 5IXJA 5KOHB 4JC5A 5LZ9A 4D3ZA 4N82A 1THTA 4P08A 3P2EA 5JAUA 3N8KA 1NUHA 1W2GA 1WLYA 1KJJA 2IPMA 4MQLA 4EZEA 4X24A 3FF1A 5LBIA 4Q47A 4DJTA 4HB0A 4TSFD 1HNWB 1NN3A 2VAVA 1QIDA 4CKWB 4A0GA 1C29B 2WFZA 5K03A 5KNBH 1BTOA 1V5EA 4WWHA 5HP4A 2F90A 1XPOA 1GO2A 1GPLA 3G8CA 1U4NA 4TTPA 1K3XA 4GC5A 1KY4A 2W58A 2FXIA 2PQ2A 3KOYA 4IXNA 4TWJA 1FFGA 1Y5NA 1K8QA 3RTDA 3SE7A 3ENVA 3WGOA 1WOYA 2PKYX 1WTCA 1TEVA 3L4SO 3OMXA 1OGIA 4P7GA 4QPZA 5JS8A 4ASUD 2OBNA 2B1RA 3PRYA 2G83A 3JYQA 3NUQA 2WT8A 3S40A 3TZKA 2R2AA 5EAIA 1YK1A 2B83A 1K4YA 1OGYA 1GDHA 2HF9A 3OJFA 3Q3IA 4NE2A 4KT0F 2GXUA 4C01A 8LDHA 1G8FA 1EXNA 4NCBA 5HOEA 1ZBQA 2PX5A 4L6V6 4HFJA 2P2NA 2IS4A 1FRFS 2VNSA 2WPDA 4UCWA 4X91A 1A2KC 5FH9A 4JU9A 3ZDEA 1FQOA 1TF0B 1B2RA 3C5HA 1UXHA 2YZGA 1UDRA 1TK3A 1XN4A 4WUVA 5MN6A 1N32B 3FLAA 3K6RA 2QKYA 4C4PA 3I4FA 2BMEA 2ICAA 2JGLA 3HJUA 5E1OA 4CHGA 4F4UA 5HKKD 5FTKA 4DBGB 1YGPA 2C58A 4KO4S 2OXTA 1QLJA 1D0SA 1P0FA 1MKYA 4N7BA 2VN8A 2RGDA 3D8LA 1PRYA 1SN7A 2QDXA 3RYFB 3ZWMA 5SZHB 3ND7A 1DS6A 8AT1A 5FWXA 3IMCA 4E33A 2IPLA 2BTOA 1HR0M 5TMDA 3TW8B 5JHGB 1AHIA 2OE2A 3C43A 1BCSA 1RD4A 3DWIA 3TZLA 2OK8A 2QP3A 1I7NA 1PK7A 3EODA 4KN6A 3KP0E 4ZOEA 3NT5A 4Z0TA 1W1WA 1V8BA 2W6OA 2P6OA 4XE5A 3WQRA 3V55A 5H9WA 5EJFA 1B16A 4HTFA 5B6PA 5F7OA 3E4RA 3I04A 1V0JA 4E5NA 1G2PA 4OYHA 1QDRA 4W5WA 4ZVLA 1Y6RA 4P0TA 1VBFA 2CDBA 2E6KA 3LYHA 5KYVA 3KSUA 1HE8B 1X14A 2OQRA 1DAIA 2JANA 3DAFA 3N75A 3SC2A 1ZMTA 3SM9A 1NJ5A 5AVTA 3BHJA 5CIQA 2FSFA 3EA4A 1JILA 1XZMA 3ZE0B 2AJLI 4V3BA 5CDFA 2HA3A 1BMFD 2I78A 3F5DA 3FWNA 3QI2A 4DBLE 5HQ3B 4FK8A 4ZJUA 4P4LA 4RVNA 4Q39A 2ZDQA 1SHKA 4FDUA 1NN5A 2ZBKB 4IX1A 3PJFA 4OHWA 3IB3A 5E9WA 1FQJA 2Q0XA 4PS0A 1C50A 3FUTA 2LDXA 4IQ0A 4ZO8A 3RLIA 3WP0A 4TWIA 1GUFA 1ZJ5A 3TYXA 3SC3A 3AK4A 4DIFA 2MHCA 4LHSA 1VEKA 1XMXA 1VJ5A 1YCFA 3DNPA 2FPIB 3EDRA 4MQEB 4RIHA 1BS1A 4HLQA 4O5AA 4QLBA 2YRWA 4Z7OB 1IATA 3MB8A 4E5UA 1LXCA 3ZI7A 4P82A 4C14A 4YAOA 1CQIA 4CMAA 3V34A 1T9HA 3V7YA 4D9JA 3P0EA 1KRWA 4FEYA 3N3AC 3MFYA 4P4SA 2PZJA 3ZHXA 1PGYA 3R3JA 4LVNA 1GVNA 3AV0A 2RI0A 2YRFA 2R87A 1DGBA 2VF7A 1WZCA 1GG9A 3M6FA 4PXAA 1C0PA 4AY2A 3C1OA 2R86A 3QFRA 4GBJA 2Y99A 4KVFA 4EPXA 5CG2A 1LI7A 1TNDA 2Y2VA 1RVDA 3MT9A 2WP8J 1JSRA 1F8GA 3OBBA 5DMXA 3EGEA 4F5WA 1DHTA 4ZU6X 2BMDA 3DZJA 4ZI5A 1M2NA 4DIBA 4FMBB 5BMVF 1LBSA 1N2ZA 2I6GA 3RS4A 4D81A 3S29A 3UEOA 5CDYA 3MWDA 5KPZA 3VZQA 2GD2A 3M5WA 3WMXA 5KNBA 1E2KA 3NAQA 3PIDA 2XVMA 4L9AA 4CQMA 3RASA 1UOOA 1JTVA 1AA9A 2FN9A 1P4RA 1QHFA 3ZHOA 2TMKA 3HB9A 4QDZA 1CEQA 1Q39A 2AR0A 3TZHA 2IP4A 3FCUB 3R7DA 3LC0A 2H7VA 4EGQA 3B3GA 1HKHA 2IYEA 3BQNB 3VDNB 3T3NA 3GLIE 1YS7A 3ZU5A 1AKTA 4CJ6A 2CLIB 4PNZA 2GEVA 1C7ZA 5HZHA 1X39A 2Z6AA 1PEKE 3SR0A 5KVQA 2GD1O 4TMFA 2YN2A 1O9HA 1V8PA 4PC2A 4LHVA 1F4PA 3FHOA 2NXEA 2E1RA 1BOFA 2OVBA 4DCVA 1UMBB 3K9OA 1QFYA 2F6RA 2YV5A 4WOKA 4AIRA 3BMCA 2QRKA 4BLQA 1Z5GA 4IDFA 2JW5A 2HEIA 1AK2A 5F7JA 2QMOA 3PYXA 4MW6A 1H94A 1TU3A 2EZ9A 2JLRA 2PX8A 3LVVA 2X13A 2Y1DA 4S35A 2P5SA 3SEAA 4MB2A 4GS5A 3JQ7B 5FUXA 1R6VA 3NRCA 3TEFA 4DAOA 5F33A 2K9DA 1TM7E 2JBAB 1JKJB 3A3PA 2HXYA 1P61B 5H7XA 3G5LA 1YI8A 1WS6A 4DWVA 5K8JB 2C9CA 1SQ6A 4MV9A 2VYNA 1ZLYA 4MQUA 4TWZA 1M34A 3WK4A 2JLWA 4LRSB 4BNZA 1IMOA 2XVYA 2FP4A 3M9XA 1ODIA 1R4MB 1L4FA 1OWNA 1XTTA 2JFNA 3OD5A 4KXLA 4LWPA 4P81A 5AK6A 5HFNA 1KS9A 2GCEA 3PD7A 2JDID 3NM4A 4KO2S 4H0NA 1OWLA 3SD7A 3HXOA 4GUAA 1P45A 1H5NA 4YRAA 3DC7A 5C7IO 1SU7A 3NYRA 2WU0A 4MW4A 1SMKA 1NBIA 3PEEA 4OQDA 2CLLB 3UAGA 1QQ7A 3RSFA 3ROFA 4MZXA 1K4MA 1CBUA 3MN1A 2WWVD 3CMCO 2QG4A 3F6BX 3C41J 3M5DA 4CL8A 5KQPA 2I7DA 1W34A 1ZSVA 1BEZA 2GT1A 4KN5A 2BGRA 3O9VA 2IH2A 1Z0SA 1Y6JA 4WLUA 3HKEA 2JLUA 4R8LA 1E62A 2QRUA 4EFDA 3MWEA 3X2FA 1VJ1A 1XFAA 2V96A 2FR8A 1NY5A 1QPGA 2O01F 3T38A 1ZA2A 2ZJ4A 3IILA 4FNAA 4KE7A 4BO0A 1Y8QA 3RAJA 2AXQA 1GRNA 1RS0A 1U5CA 4Y9UA 3RIXA 4LJ6A 4XGIA 4FS3A 4C4OA 2DQ4A 3AGQA 1QH1B 2PKEA 4QJIA 2O8BA 3IVCA 3HMKA 2G0NA 1IN8A 1L6RA 3LK7A 4HL4A 1P2GA 3DCNA 4PCAA 5G0VA 3WZ2A 3HEBA 3OLYA 4BBZA 4AICA 3K6SA 2Y67A 2FN8A 2V0CA 5EUMA 2Z6UA 2VF2A 3IJ5A 3X1KA 2HF2A 3QY9A 1CR2A 4BP9A 3CNOA 3T7KA 5LKRA 4OU7A 5IJ0A 3P1JA 1R8YA 3MGBA 3PA6A 4WZBB 2ATEA 1JXQA 4MVJG 5AOAA 1T3LA 4MUBA 4W8HA 5JSHA 3TGPA 4I4LA 1CYDA 1VMIA 4QXAA 4KYIB 5I4KA 4A03A 4DGQA 5LCXA 1KY2A 4QUJA 1ZH8A 2W93A 1OW3B 1H2EA 2JFXA 2R11A 2QN2A 3K0BA 1DNPA 1V1RA 2Z9BA 3KK0A 5KC9A 1VIMA 1QR2A 1NY6A 1QF7A 3DL2A 1HUQA 4M9ZA 2BNKA 2BP7B 3F0TA 1DBWA 3L0YA 4KXWA 1KJ9A 2WF5A 3I2YX 4QBFA 4UAGA 2NPOA 3U4DA 4EHLA 1E6EA 4G4OA 2C2XA 3MCZA 4D57A 1S2IA 2VTVA 2QTAA 2D2IA 1OC4A 1H69A 2VHCA 3RCBA 4CCSA 3ORSA 3A04A 3FTEA 5E6JA 1CF2O 2VDLB 5JISA 2JLSA 4WY8A 2H11A 1ACJA 3IC5A 2O2GA 2F3SA 4Q15A 2OPHA 1NG9A 1TF7A 1ZI9A 2BFOA 2P9GA 2F8MA 2TMDA 3E9CA 3HLYA 5KOYA 3ND8A 4YQYA 5JD6A 3GQ4A 1CFZA 3DP9A 2QW8A 4B84A 3TZBA 2GZRA 3O1LA 4UUQA 2UZ4A 4F4JA 1EZZA 1VE6A 1EHIA 1ZH6A 2AQ8A 3U3KA 3M3HA 2O0KA 4XOIA 2Q6TA 2UUPA 3PK0A 1IONA 2FWAA 3ASUA 2OAGA 1RXCA 3MTQA 1MEJA 2JA1A 5JFOA 1CV2A 3BEDA 3UMGA 4ITQA 1KPGA 1O94D 4LY9A 4CKWA 3SYKA 2W6JD 4I2NA 4NFYA 1Q95A 3IUYA 1T0UA 4PICA 2O3TA 5H16A 4B87A 1RFLA 2CHQA 3B7WA 3EASA 3ISTA 3TJMA 1WXFA 4Z8YA 3CGGA 4EGAA 2AC4A 3DPSA 1T9KA 2D06A 1UPFA 2JARA 3EG9A 3KJEA 2C0QA 4PCUA 2OMKA 4QHYA 2IUUA 3ZBUA 4L8VA 3MYRA 3NP9A 1UBNA 2ZR9A 2XYHA 4L16A 3GLVA 3F46A 1KRHA 2P0AA 3SF8B 5JJBA 2QGFA 4POAA 5LUAA 2Z0MA 2NVWA 5TDHA 4HRAA 3ASVA 5JBNA 4YO7A 4N0PA 4HFMA 1VLVA 1NNSA 4GMDA 4IDNA 3TW8A 4DG5A 3AVWA 1G8KA 1ORVA 1N3LA 2ERYA 4MH0R 4UTXA 5GONF 2ZBRA 3F2IA 1E6CA 1NQWA 3OJWA 1ZIXA 3AOEC 2IRWA 5BUCA 3O94A 4LWOA 4P9NA 4QEDA 3CUSA 1O5OA 1KDTA 3LBIA 4X8LA 2A5FA 5AVJA 3SEQA 3L49A 3WYNA 4G8BA 3WRWA 4R2WA 4MLDA 4YWHA 3ZV6A 1I0ZA 1LPNA 2ETXA 2NYRA 2ST1A 5F73A 2JIPA 3LLSA 3EF3A 5KTNA 3RPEA 1KPHA 2KLHA 1N77A 3ZYZA 2CNWD 3AKYA 2RIPA 4ARZB 1TTEA 4G9EA 1K98A 3I58A 5FULA 2I6XA 4OQZA 3OLQA 3CF4A 3Q3HA 1Y8ZA 1JDVA 2RGYA 1UMKA 2OHFA 1IOZA 2PT7A 3LQKA 3PS9A 5JZOA 4KBGA 4EF6A 3DEKA 5HWSA 5E8RA 4BWFB 1ADFA 1SIWA 2DBZA 1BCSB 1LSSA 1J2RA 1S2GA 3R3SA 4OB6A 4LUCA 2YOGA 3MBIA 1OSNA 5ALUA 5LP6F 4LJ7A 1CZLA 1OLUB 1NM5A 1INLA 1T8TA 3H84A 4UEOA 5K0FA 2I99A 2PFGA 1TQ2A 3TLBA 2DR2A 4PZ9A 1W8DA 4E6PA 4V03A 3JD2A 2M60A 1DJMA 2CLSA 3M9LA 2I4NA 3T5CA 3HU1A 1CFJA 1CXZA 2O6HA 2P6UA 3PQ6A 1CUCA 1N8SA 3GXOA 1JLLA 2YZKA 3NTRA 2P30A 5CFNA 2FKNA 3PXUA 1Y1KE 3I6IA 1UWKA 1EZ1A 2G5GX 5T3UA 1I7QB 3OQVA 2D6FA 3OURA 4NARA 1FNMA 1VLQA 1UJ6A 4OHBA 2BY4A 5AW1A 1VIDA 1F2UA 3PDIA 5JD5A 1NTOA 2D5IA 4ZMBA 2NO9A 1XMOM 1N57A 3DS8A 4X65B 1HZJA 3W0LB 1O8BA 4MVJM 5LQUA 3TNYA 1Z8FA 1YTLA 4NC9A 2WHPA 2Z98A 3DEYX 3G9TA 1I14A 1E8DA 1KI1A 2H4ZA 2P5TB 2VWGA 1EVYA 3F90A 4NJOA 1L5FA 4WOPA 1XWWA 1VJCA 2DFLA 2WSSA 5HE9A 4LXUA 4B6RA 4BNVA 2QCUA 4EA7A 3MUOA 4GWLA 3HLTA 4HUQA 3AEYA 1ESZA 4CKZA 3EEOA 2HRBA 2KA6B 4DN6A 2CGEA 2H9YA 1P3DA 4C89A 5JMTA 5ALYA 5FPHA 4OKSA 5LYJF 1EE8A 1OHHD 1JMKC 2IEAA 5FNVA 4HTAA 1MA0A 4KOEC 2DPHA 5FOWA 4H0CA 4PCLA 3R75A 2OO3A 2EJTA 2XPCA 2Y4OA 4KO3S 4PX9A 5IJXA 5ALRA 4B47A 1EVKA 3JYNA 2XCSB 4OHKA 1XEXB 3OT5A 3NIFB 3R4VA 2IJGX 3NEPX 4NYIQ 1GXSB 3T12A 3WSWA 2JUJA 3G3EA 3GGDA 4EKIA 3WRYC 1MFPA 3L9XA 2VXBA 2GAIA 4PSUA 4R1MA 2OHIA 5JNVA 2ZQYA 4FUTA 1JSCA 1BXGB 1VZ3A 2X5JO 3WGMA 1TM1E 2PD3A 3PC3A 2NVUB 3BYZA 5LNK6 3L26A 2XGMA 1OH6A 3GPXA 4X85A 1WPXA 3V7FA 1YBVA 1II8B 4CMEC 5A3SA 3D3JA 5F35A 1VA4A 1NW7A 2XQGA 2OLJA 2OBXA 5HJ2A 3DHYA 4EWLA 3WIBA 3SAWA 3KQVA 3A1FA 1AVTA 3RFUA 1UKCA 4BBAA 3K4QA 5CR9A 2UXBM 2NNWB 3QE0A 5J58A 2G76A 2CVHA 2ZIWB 4FYWA 1JYFA 4XM1A 3ROMA 2OGWA 2HQSA 3PX7A 5BPFA 3ADBA 3C4JA 1GT6A 2E2WA 1TQ6A 4QBGB 1Y3IA 3H75A 1VHTA 4XJVA 1DIBA 3E22B 3T99A 4XH9B 4MQFA 2VHWA 4F38A 5DT9A 1TJ4A 2OYRA 3ZWOA 2OFPA 1ZIPA 3UMMA 4C7OB 1XQ1A 3LSTA 1YZGA 3M4XA 1CZKA 1NXTA 2ET6A 2I3AA 3GD5A 5SY4A 4PYJA 1WBBA 2ZYAA 4PLYA 1ZVJA 3K8ZA 5G53C 4KPGA 4RJ2A 2WUFA 1X8LA 4K9NA 3NRJA 3CX7A 2BUBA 4G4JA 2AE1A 3OOHA 1YB5A 5ERYA 3W5IA 3ACCA 3GZNB 2P6PA 2RHRA 3IDOA 5CVEA 2AN1A 1A7JA 4ZOLF 1RIFA 1UQRA 1EFCA 1P1RA 5D7NA 1RHJA 5IH3A 3ZGNA 1Z0ZA 1MRNA 3CTWB 1WMAA 1XMPA 2J48A 2Q5FA 5AVSA 1V5GA 2B98A 4JC4A 4R1SA 4IGEA 3TM4A 3TUIC 4Q1AA 3S3TA 4JCOA 4OV6B 1RKXA 1USUA 4UUBA 1QVAA 1YO6A 1MAVA 1Y4ZA 1SUAA 4L28A 3O38A 3KQUA 1Z6TA 5JJLA 2D7JA 2I7XA 1KETA 1AKEA 1JDJA 3C7KA 2NTVA 5IF3A 3UGTA 1FJGM 1OAKA 5T6BA 3RFTA 3T4UA 5I7UA 3CJRA 5EIXA 2Y9PB 2RGCA 2X0DA 4RF5A 4HQOA 3L8CA 1R8SA 3LW7A 4MUXA 3TOZA 4ZDKA 1F0KA 3H87A 4CQNA 1AQIA 1V4NA 1DAFA 4MJ3A 2ZDHA 4ETMA 5K9ZA 1RQXA 1XZGA 2ZSAA 2C42A 1WUJS 4RZUA 4DA9A 1PE0A 3TLXA 3VVLA 1G64A 5KJCA 1NFQA 4BYGA 1KA9H 4MCIA 5BSWA 2YJ4A 2GM3A 4YAIA 1AXRA 1RHKA 4L50A 3KUUA 3EPRA 3IGFA 3OPVA 3ZWPA 4YP5A 4S0ZA 4B4DA 4GL4A 5JVDA 5DH9A 5FI0B 3B2NA 1R3DA 4B3XA 1IJEA 4BFUA 1PGPA 1QU3A 1HK7A 4S1TA 3OZGA 2ZRBA 1HT1E 5IZ7D 1ZM2A 4PZAA 4RORA 2DMRA 3V48A 3GLSA 2FPIA 3V4PB 13PKA 4Z9XA 4CMCA 1PWZA 1U2EA 1V34A 3NIWA 2C2BA 1Z5CA 2FZEA 3VSCA 3I23A 4RK5A 1EWQA 4DMKA 3MAAC 1R0XA 3FMIA 2AR7A 5LBTA 1SBCA 4YCAA 3VNSA 4DUGD 1SXPA 2LIPA 1AD2A 2ZBEA 2BKXA 1MJHA 3EW9A 5HFAA 2YV3A 1BCRB 2QROA 3V1MA 4IQ8A 1F5SA 5J63A 1ZRNA 1UBLS 4QOSA 1Q7CA 2KSQA 3O6VA 1YB2A 4FQ7A 4M99A 4Q1DA 4YAJA 4JOBA 5GZ1A 4JS0A 2QDKA 3GT0A 4N6GA 1P0IA 4IFEA 1NOJA 4K05A 5BN5B 4CMIA 4EJFA 1CUKA 1LW7A 1T26A 2JI9A 3BERA 4TYWA 4JXJA 2GKSA 2E85A 1VRCA 2RB5A 4AY5A 3QFTA 1OYOA 1SURA 1VXRA 4TZ6A 1J1UA 1ZQ9A 2Q5QA 4CM4B 1Y1RA 3A7EA 4X1IB 1CLEA 1ZLXA 4DLBA 4UZEA 3FNHA 1DBVO 5EKUA 4V0MA 1M2FA 1NF8A 4GPBA 10MHA 3TFOA 2GQFA 1N0VC 4JLVA 4IIEA 1L8OA 3ICWA 3VHQA 4B45A 4OSOA 1R0YA 1WHTA 1U8CB 2CXNA 1VYHA 2GEUA 1TW3A 4JI8M 2L2QA 2Y77A 4GXNA 4J2TA 1R0KA 4NHEA 2AMLA 1RFGE 3Q5DA 1HLFA 4X7BA 1JSLA 2WAAA 2HWWA 2QVLA 4R3UC 5LUBA 5TQJA 1VL2A 4LNUB 4LRWA 3AILA 5MF6A 4MB7A 2XUAA 1M8FA 4ON9A 3ZE6A 1WZ2A 4ER3A 3RYCB 3ZCUA 4DC1A 3I4YA 2L4EA 1PQWA 2OGUA 3JVIA 3MRVA 4MAFA 4MVWA 2UUCB 4EHNA 5LP6A 5TQ2A 5DN6A 3B5EA 2ZDGA 2PGOA 4DNPA 2BOVA 4BO1A 3EGWA 4KUGA 1ISRA 1K68A 1EQUA 4LRUA 2YN4A 1PGJA 5T67A 1D4AA 1I2ZA 4BRZA 1ZMUA 2B2XA 3FH0A 4EBBA 1IH8A 2R6DA 3EGCA 4GI1A 5K5EA 1EJ0A 3KUKA 1DVRA 5HR5A 5DHSA 3PJGA 4F1WA 2B0JA 2JJ1D 4PLVA 3TQQA 5SYNA 2R45A 3HDYA 3K0FB 4RHTA 1U99A 5DRYA 4N0EA 4QGAA 4R9NA 4UMEA 3NHUA 4N3NA 4CN9A 1NKVA 1X7DA 3CNLA 3NHWA 1JQAA 4JLUA 3QY0A 2DUJA 4C3OB 4OM7A 4D92A 2FZKA 4GHWA 5LIPA 3DQQA 1JBKA 1E3TA 3DYBA 1ZH0A 2ZJ5A 2QQ8A 3RUCA 2GJAA 2JFHA 4JB0A 5ALVA 5MGNA 1FEZA 2Y6VA 3LXXA 4QUDA 3UJCA 2BGLA 2Q9AA 2Q7OE 1KEKA 2IYYA 1I8TA 4P8RA 1SXJB 1N5IA 2C5LA 2J45A 1KP3A 2JAWA 3IAM1 3EXFB 1M2VB 3BHIA 4PU0A 2GN2A 4X8OA 4GG1A 1YDHA 3ZV5A 4YRNA 3UWKA 4YT5A 4A3VB 5AESA 3C6BA 3IVMA 5CP8A 3N6RA 4EYEA 1W1IA 1SXJC 1E1QD 4QTXA 4LF9M 4JI3B 4F5EA 1YRYE 3WO0A 3MELA 1Q0HA 1SFRA 1X1RA 3DXZA 3K4PA 3RWBA 1R2QA 5CRIA 3WL6A 1Y5LA 4UJ5A 5LNK1 3MWEB 4LNAA 1VC2A 4IQGA 2YCLA 1VXOA 4JODA 3SIWA 4ZJPA 1JEQB 3WQQA 3ZPXA 1OXSC 4PTZA 4CODB 4UU1A 1VFNA 3OKFA 4G97A 3GD7A 4F84A 7AT1A 4I1UA 2FK7A 3GGOA 1KQOA 1J1IA 1L5HA 4G8CA 4AO8A 3U19A 4NJMB 3E03A 1QDTA 3PGA1 1NA5A 3B1ZA 5PNTA 1E9BA 4NCJA 4ZMSA 4JLDA 1ZUNA 2AZXA 2GF2A 421PA 4A2CA 4D3YA 2GEKA 1GGKA 4RDHA 5B53A 3EIXA 1JQBA 1RM3A 1UMCA 1XHLA 1P2FA 1KARA 2IK8A 5G0SA 3EZGA 4DG9A 3K9WA 2VHVA 1RQGA 3FPJA 5DJ5A 3KLNA 1PZHA 4CCAA 1MV5A 2O52A 4JQZA 1T2VA 4CEHB 3PQ3A 3MJFA 2UZ0A 3D6NB 4BWGA 4NJEA 3PE6A 1HH4A 4KYUA 2QM8A 5FLXA 4EY6A 1QS0A 2AW5A 4KN9S 3HKCA 1VE3A 1PDOA 2GN8A 4BU0A 1Q83A 4EK9A 1ODLA 1QIMA 1UPBA 3BD8A 1HNXB 1HDIA 2FW0A 3L29A 4I55A 4X54A 3K09C 4XB6B 3KAPA 4A73A 2AK3A 3O93A 4AY3A 1ZOSA 4JEUA 4JSRA 2R9VA 4BP1A 1EDOA 3KXIA 4J0FA 4K8OA 3ZVMA 2W37A 4KE6A 2RDMA 1I3NA 2CUZA 1NR7A 1P2UA 2WJGA 3AXTA 3KYJB 3IYLW 3STHA 3UIEA 1I94B 4U2BA 1PVDA 2ZUSA 2ZJ3A 3D0OA 4AFNA 3DZKA 1LC3A 5JNLA 4CXMA 3JATA 3AINA 5EFOA 2G8NA 2KX7A 2IYWA 3NYWA 4BO6A 4MZDA 4DIDA 4F3YA 3ZTYA 3ECSA 1Q1NA 1O9BA 1NKSA 1KC3A 3T1VA 1EK5A 2VATA 1H65A 1RBZA 4BO3A 1L7EA 3HJBA 4QQNA 1HPLA 4UHDA 3UKOA 4R3DA 1KFCB 3FOAA 4E1VA 4DG8A 1IUKA 1LLDA 1Y8QB 4MPRA 1PW5A 1PCXA 3KT3A 2A9VA 3KL4A 4QYMA 4ROTA 3LCMA 3GDWA 5CD9A 1JPNA 1L2TA 1X9HA 4EX6A 3DVAA 4ZICA 1K3UB 5FHRA 4URXR 4EFMA 1K8RA 2DUWA 3R9XA 3TRFA 1BO6A 1E2FA 4N0QA 1Z4JA 5CEFA 5CMLA 3BB4A 3K6SB 1F8XA 1Z4KA 1DX4A 3BJIC 3E22A 5CW2A 5FP0A 3UG6A 2O1WA 4MM3B 2ZANA 2H08A 4WY2A 4CLXA 1S9HA 3O2QB 5FPKA 1U0NA 2DE0X 3C4VA 2O8FA 5H81A 5ALWA 4PGAA 3WWCA 2E4WA 4MAMA 4F8JA 2JIMA 2HW8A 4O59O 2WP0A 4X6LA 3QVGB 4MVJH 3RARA 1AV7A 2D7GA 2YKGA 2DQZA 4L5IA 3P9QA 2DHEA 1DELA 1GZSA 2G3QA 1K7EB 2LD4A 1KMNA 4CBVA 3KR0A 2QT9A 2GK6A 3FMPB 3JWGA 4K7JA 4U7TB 2PMCA 4X1YB 4HLQB 4OXNA 3MT8A 4MRAA 5BV8A 3ZJTA 1TECE 3ZN2A 3CZ5A 3NOOA 1NVTA 4UTZA 4KBFA 2ORYA 4I3HA 3DPUA 1DX6A 3JQAA 4D79A 2Q4EA 1KQFA 1ZISA 2ZIGA 3GHYA 4C04A 5GP1A 4OX9M 1FFXA 1H2HA 4DLTA 2VJMB 4AY4A 4PSCA 2ZT8A 5KMGB 4G36A 4WLFA 1R16A 1KKLA 2GA9A 2HMWA 3HXKA 3TTSA 3UUWA 3REQB 4MS4B 3WRVA 3R9IA 1DRKA 5AW8A 4MUMA 4BNMA 2H4WA 2BR5A 5K0ZA 2C94A 4FGSA 4JI1B 1W36B 5CFMA 5FBRB 5THKA 4WW0A 2ZAIA 1PUXA 2XSZA 4D8YA 1L7AA 2K7FA 3RVOA 3CZMA 3Q6IA 4OD0A 4QWMA 1XCOA 4OJTA 1XRSB 3TF5A 1KVRA 3C7TA 5CTAA 2WHRA 3H05A 4KK3A 3RNLA 4ZHQA 1COWA 2QLBA 3KPYA 1I6LA 3X1DA 4D9IA 5P8WA 3GFPA 5KJ6A 5L6MB 1A8PA 1SIOA 4KDRA 5FOTA 5B12A 4AI6A 2WKWA 4JP8A 4DEXA 4MX8A 3A37A 1T0PA 5CXSA 2QL6A 2WZQA 3R0JA 3QXXA 1Q3CA 5LQSA 4U7DA 3F5SA 4LG1A 3DQZA 2QN1A 3EUAA 2D7HA 4I66A 4B2PA 2DFVA 3AVPA 3S5UA 3D1VA 3GN1A 2ZKLA 1JB1A 4MROA 2PJUA 3A6HA 3VPGA 4W99A 2QL5A 3RU2A 2JFGA 3UPUA 3BH0A 1VG0B 3D7KA 1GOTA 2J3KA 3OLZA 1O6GA 3VC2A 5CB4B 5FORA 2NOAA 3GFFA 5FRDA