3FYDA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable dimethyladenosine transferase
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fydA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fydA01
5EZSA 2JHCA 3B3JA 2FHPA 4ER5A 1QANA 2H00A 5BW4A 4CTJA 2BR3A 4JXJA 2CKDA 1Y8CA 1N7JA 2BZGA 1RI5A 2ORED 2ZULA 3K0BA 3RIEA 4M7RA 4YUXA 3LPMA 1SUIA 4GOLD 1L9KA 2I7CA 2B2CA 5E8JA 5EOVA 1EJ0A 5DT2A 1SQGA 5K0JA 5EGSA 3KPUA 5DM4A 4GOND 4POOA 3FUUA 3AJDA 3LCVB 3P9NA 3GRYA 1RJEA 1L3IA 1KYZA 2AN3A 1KPIA 4FSDA 5LQNA 3DXZA 5K0EA 5CD1A 3BUSA 2Z6UA 4U7PB 1NV9A 1KHHA 2G70A 5KS2A 4BY9E 1QAOA 1ZHFA 1VQ1A 4BLWA 3FTCA 3NWBA 4O29A 3NDIA 3FZGA 3AWIA 1VLMA 3TFWA 4ER7A 4RTKA 1Q0TA 5CVVA 2UYOA 3DXXA 3KPVA 4EKIA 2XBMA 1N7IA 5EG5A 2PXAA 3NDJA 3OZTA 3O31A 2C7OA 5EKXA 1L3BA 1KPGA 5CM2Z 4C08A 1VL5A 2JH9A 4FT2A 5EPEA 3UJ9A 3QV2A 5EVJA 3JWIA 4ER0A 4L7VA 3KPWA 2ZWAA 3QOWA 1NW8A 4HSGA 3PT9A 4Y2HA 1WS6A 4QPPA 1VIDA 3FUVA 2ADMA 3G89A 3U81A 3GDHA 3IHTA 4GF5A 3SVZA 1JQ3A 2NYUA 3A7EA 4OQEA 3UZUA 1TW3A 3DTNA 3NVMB 1NBIA 3TLJA 3G2PA 2NP6A 1PJZA 2H11A 3EEYA 3OE4A 4P7KA 5CVUA 2P3QA 3DP7A 2GA9A 1VP3A 2GB4A 5K0FA 2EG5A 1M6EX 3MGGA 3GJYA 3G88A 4XUDA 5ICGA 3UJCA 5EIWA 4OQDA 2ONZA 3GRRA 3HTXA 3HCEA 3DR5A 2OBFA 3MTEA 3P9CA 4PCAA 3G2QA 2OPBA 3BWYA 3HVKA 3JWJA 4OA5A 5FWDA 4EVIA 1WXWA 5K0LA 3THSA 3KPJA 4EQZA 2AR0A 4YV2A 4PYOA 2NP7A 1TPYA 5HIKA 2UZ4A 1SG9A 3OFJA 5ERGB 3P2EA 3BGDA 1ZGAA 3KQMA 3LGAA 2VDUE 4WXHA 2PX2A 1DCTA 1XJ5A 1DL5A 2Q41A 1ZKDA 3G2MA 5DX8A 2HMYB 2PGXA 2AOXA 1F3LA 2WA2A 2BR4A 1SQFA 3BWMA 4M36A 2PY6A 3EMBA 5ICCA 3V8VA 4P7FA 1KIAA 1YFLA 4B17A 3M6WA 2PT9A 1SKMA 3B7PA 2Z6QA 1RJGA 5FWAA 1XDSA 3KPYA 3VSEA 4AZSA 1L1EA 3G2OA 5FTWA 5HFJA 2YX1A 2VZ9A 4GOMD 3JWHA 3TOSA 1ZQ9A 2QYOA 5DSXA 5KQRA 4PGHA 5EHIA 1X19A 4CKBA 1IXKA 3CVOA 2PXCA 2YQZA 4PYJA 3EPPA 3LECA 2HV9A 4GUAA 4RTNA 5IKMA 4PONA 2QRVA 3FTEA 3DLIA 3FUWA 3HA5A 4C05A 4CXMA 3IEIA 3DOUA 1D2HA 2VDVE 4PCLA 1R8XA 3DMHA 3REOA 3C3PA 3P9IA 1NV8A 1XXLA 4H0NA 3THRA 5DM2A 2IIPA 3EVFA 3A27A 3KQVA 5GM2A 2PV0A 1VBFA 4RV9A 3SM3A 3ER9A 3P2IA 1R8YA 1G60A 1WXXA 3OU2A 3B5IA 2IGTA 4HGYA 3NW9A 5EKUA 1NW6A 7MHTA 4E2WA 3KKZA 1I4WA 1FBNA 1JG2A 3UJDA 2ZIFA 4CTKA 2G71A 4YMHA 4R05A 4HG2A 2XYVA 3MERA 1P39A 5JR3A 3ANXA 3PX2A 3R6TA 4LG1A 3UJ7A 2CMGA 3LX6A 3FUTA 3PB3A 5LQJA 2XYQA 4RTPA 3Q7EA 2PX8A 2IBSA 2PWPA 4EMSA 5K8VA 2GLUA 2GS9A 4KW7A 3X0DA 5CUQA 2OYRA 2ZBPA 2YXDA 1UWVA 4V0QA 5D1HA 3KQSA 3NJRA 3HA3A 3MHTA 3EVZA 1RJFA 3FRIA 3TR6A 2CWWA 4EK9A 3A7DA 1JG3A 5GWXA 3HCFA 4C4AA 2YXLA 3B3GA 4HTFA 3VC2A 5K05A 4FZVA 2P3LA 3LDGA 5E9QA 4RTMA 3KQYA 1MJFA 4PNEA 3ELYA 4BP1A 3FTFA 5K09A 1AF7A 3P71T 5DPMA 5GOZA 3PVCA 3KQPA 4OBXA 4YV1A 4YUVA 3T7RA 5HZMA 5K0BA 3R9XB 1QAQA 4R8RA 10MHA 3EVCA 4IV0A 3OU7A 2WA1A 2AVDA 2R3SA 1MHTA 2G1PA 3DMFA 4KDCA 3I58A 2DULA 3TPZA 1U2ZA 3EVBA 4DKJA 2ZVJA 4PYNA 2GAFA 2PWYA 2I6GA 5DRTA 5DTRA 4RTRA 4P58A 5EHGA 3OFKA 5EMLA 4F85A 2ONYA 1JTEA 4AZTA 1SVUA 2AOUA 4AZVA 2IH5A 1FJXA 3LKDA 2P1DA 4ER6A 3GRVA 3MTIA 1BHJA 5CVDA 1XCLA 5CVJA 4F86A 3KR2A 4KWCA 3GRZA 3R0QA 4BLUA 4M37A 5LR6A 1YF3A 5EQJB 2O0LA 4MQ4A 2P8JA 3GWZA 4E33A 5KQSA 4PGGA 5C0OE 5DTQA 3KR1A 3MAGA 5GINE 1IM8A 4PIPA 3SR4A 2HTEA 3NWEA 4Z2YA 3RODA 3DULA 5BP7A 1NBHA 2C7RA 4NECA 3NTVA 2UYCA 4YUZA 2YR0A 5E8RA 3KQWA 5D1NA 2EFJA 3CGGA 1FP2A 3E05A 4QQKA 3T0IA 1HMYA 3UBTA 1Z3CA 1ZGJA 2IDKA 3G7UA 4FT4A 4LWPA 1VPTA 4RVFA 4PINA 4RVHA 5E1OA 5GM1A 4KIGA 3EVEA 5LQKA 2PJDA 1FPQA 4RTJA 5E2BA 5FULA 3ELUA 4G56A 5FA5A 3FYDA 2P7HA 2PVCA 5DRYA 1JR4A 3ERCA 3BWBA 3OZSA 2OKCA 5C9ZA 3A4TA 4DQ0A 2PKWA 2OO3A 3M70A 1YZ3A 1R00A 1D2GA 1JG4A 2V7EA 4RX1A 1WY7A 1P91A 2BM9A 4R6WA 4YUYA 3EEOA 2AZTA 1XVAA 2ERCA 3LDUA 3R3HA 2AN5A 1NE2A 1KR5A 1G8SA 2FCAA 2ZW9A 3GO4A 2C7PA 2B25A 1O9GA 1F38A 1RI2A 1YB2A 3K6RA 2VDWA 4PYMA 2C7QA 4IWNA 2OZVA 3BGIA 4PWYA 5KVAA 3SMQA 3UA4A 1X1BA 3DXYA 3CC8A 3GGDA 1G8AA 3HCBA 4BLVA 2HWKA 3G5LA 3GCZA 3A26A 4M38A 5E1MA 3PFGA 4IKPA 2KW5A 2ZBRA 4GQBA 5DX1A 1XTPA 2WK1A 4E30A 3ER8A 1JTFA 1O54A 1M6YA 5FQNA 5DTMA 5HIMA 3C6KA 1AQIA 3GNLA 4V0RA 3FUXA 5U4XA 5MHTA 3FPFA 3LBYA 3ORHA 3KR0A 5M5BA 3OCJA 4MHTA 5G02A 3DLCA 2OY0A 3B3FA 2JJQA 4RWZA 2UYHA 3E8SA 3ME5A 1YFJA 4WVLA 4QDJA 4A6DA 4EKGA 3TM5A 2VP3A 3EGVA 3DMGA 2FYTA 2GPYA 4YV0A 4P7GA 5KYGA 2IBTA 2P7IA 1BC5A 3CJTA 3QOXA 2ZIGA 2YXEA 3O4FA 4PYLA 5FADA 5HILA 1JQEA 3O7WA 5FQOA 5GIPE 5DXJA 3FPGA 2P41A 2NXJA 2ZLBA 2ZIEA 2PLWA 5EMMA 5ICFA 1YUBA 4FSXA 2NNWB 2ZCJA 2IP2A 3TMAA 4DF3A 2B3TA 3AXSA 3EVGA 3MCTA 2AOTB 4KVZA 1KP9A 4E32A 3M6XA 2BH2A 5E9WA 5EMJA 5T64A 3FPHA 3CBGA 4PYIA 3C0KA 4E2YA 1P1CA 1JG1A 3UFBA 1INLA 2JG3A 2FK7A 1DUSA 3LDFA 3TRKA 3GXOA 3UJAA 3ID6C 4YUWA 4AX8A 3AY0A 5C1IA 4F84A 5EEGA 1EG2A 2ZBQA 1X1DA 5B1SA 4CWAA 2H1RA 5ICEA 5LQCA 5FUBA 2AN4A 3KHKA 4HRAA 3TKAA 3FPEA 1R6AA 2G8NA 3L8DA 2FRXA 1VP9A 3PS9A 4IV8A 4U7TB 5EEHA 4DZRA 8MHTA 3Q87B 2DPMA 3HNRA 1X1AA 1HNNA 2Y1WA 1ORIA 1T43A 4K6MA 5K03A 2LD4A 2AOVA 5T67A 3UA3A 4E2XA 3I9FA 4XUEA 4X61A 3OZRA 4FR0A 3G8AA 2QM3A 3B89A 3KR9A 1P1BA 5DM0A 4C06A 3BKXA 1I1NA 4KRGA 5LQAA 2QE6A 2BR5A 3PX3A 4R6XA 3LCUA 5DX0A 4E2ZA 2N47A 3E23A 3EGIA 3DH0A 3F4KA 2QY6A 1X1CA 4OBWA 2NXEA 3LKZA 4E70A 4LECA 1UIRA 4GOOD 5FCDA 3V97A 5FHRA 4FP9A 3P2KA 1RI1A 3CCFA 2HNKA 4X1OA 3P8ZA 1N2XA 1NT2A 3M6VA 3UJ6A 4DCMA 3ELDA 1OR8A 1QAMA 2ESRA 5F2OA 4PYKA 3S68A 3MB5A 3HCDA 2YVLA 4XCXA 4DA4A 2HR1A 1QZZA 2ZZNA 1NKVA 3G5TA 2UYQA 4RVGA 2VS1A 5H02A 5EC8A 1BOOA 3A25A 1EIZA 2ZFUA 4PIMA 1FP1D 3HEMA 5FHQA 1XDUA 5DSTA 3WSTA 5HIIA 5CVEA 2CMHA 4C03A 2XVMA 1ORHA 2P35A 4P7JA 4CKEA 3M4XA 4X41A 1G55A 3HP7A 2JH8A 2FPOA 3VC1A 5EZQA 4C04A 1ZG3A 2K4MA 4HH4A 4ATNA 1QYRA 5DLYA 4X60A 3HCCA 5E1BA 3BXOA 4OX9Y 3UWPA 5IH3A 3KQTA 3FYCA 1NW5A 2JHPA 2AOWA 3T7TA 2PSSA 4RTLA 3PLAE 5FA8A 4BP3A 5DWQA 2EX4A 2B78A 9MHTA 3G8BA 3KQOA 1I9GA 1AQJA 4RTSA 3ELWA 2O05A 3P97A 3GRUA 3EVDA 1H1DA 1G38A 2XVAA 2V74B 5EMKA 3OU6A 2OB2A 4RTQA 2IFTA 4QQNA 5K0CA 4OA8A 3BWCA 4YMGA 4AZWA 2QRVB 3FRHA 5HEKA 5CCXA 2YTZA 3I53A 3UJBA 3CJQA 3GIWA 3HVHA 2R6ZA 3LBFA 4PYQA 4QTTB 3TKYA 1BKYA 3RW9A 5E1DA 1EAMA 2O06A 5K0GA 2ZSUA 3HM2A 5T6BA 3EGEA 1D2CA 2PXXA 4QDKA 3BKWA 2JHAA 5EIFA 3BT7A 2PT6A 1RJDA 1NW7A 3C6MA 3HCAA 4RYLA 1IY9A 2CL5A 3SGLA 3OPNA 1B42A 1G6Q1 2I62A 1V39A 4UOEA 5BW5A 3P9KA 1NW3A 3HVJA 3I5UA 3LL7A 4HC4A 5GP1A 5GIOE 5LQRA 5LQUA 3PFHA 5P8WA 4DM3A 1M0EA 2Z6AA 2EJUA 5LSAA 2E5WA 2A14A 3HA7A 3HVIA 4KDRA 1EJ6A 4ZTBA 1R18A 4DCGA 4ER3A 5CIYA 3SX0A 5F2NA 3DUWA 4QTUB 4QPNA 3OE5A 2PX4A 3VYWA 2I9KA 2O07A 1JSXA 3JWGA 4A6EA 2IH2A 2NXCA 3MQ2A 1WG8A 5E2AA 4QVGA 4AUKA 3C3YA 1XDZA 4E31A 2B9EA 2AVNA 2IDJA 4CKCA 1JSZA 3MCZA 2YUIA 2O57A 2NXNA 3UJ8A 4HGZA 1R74A 4FS8A 3LSTA 1JQDA 3NMUF 2F8LA 1VE3A 2AOUB 3BGVA 3IV6A 3T7SA 3TQSA 4GEKA 2AS0A 2G72A 4R8SA 2ZTHA 1KYWA 2ZZKA 3H2BA 3LHDA 4MIKA 4RVDA 5K0NA 2BM8A 5BXYA 3KQQA 1KPHA 4DMGA 3SXJA 3EMDA 3I64A 2P3OA 1O9HA 3EVAA 4LWOA 2ZZMA 1XCJA 5HOQA 4ISCA 5JUWA 3GU3A 1L3CA 1Q0SA 1WZNA 3FTDA 3CJRA 5E9JA 1AV6A 4MWZA 2GH1A 3BZBA 4QVKA 1TW2A 1RI3A 3IYLW 2AOTA 4RSRA 3AXTA 1RI4A 2P40A 3D2LA 2ZWVA 3E7PA 4MTLA 5F2KA 3SSMA 4GBED 1EQAA 4KIFA 2IH4A 2OXTA 1KXZA 3CKKA 2XYRA 3NVKI 5K01A 2OB1A 3M33A 4GC5A 3TM4A 4GC9A 3PTAA 3KU1A 5DM1A 5HIJA 3R24A 5DXAA 3SSNA 4Y30A 4FGZA 1PRYA 1YZHA 2PX5A 3FPJA 4HTFB 2Y1XA 2EJTA 2IPXA 3M6UA 4X63A 4RTOA 3LCCA 1UFKA 5CCBA 4C07A 3SSOA 4XUCA 2PBFA 1SUSA 2FK8A
chains in the Genus database with same CATH superfamily
3ZIAA 2C5EA 3I61A 2JI4A 1TM5E 1MX5A 4L8GA 3BCUA 4FKBA 4DMLA 3HHXA 4S04A 1PNTA 3G0CA 2LNHC 3DE4X 4IO0A 2ZULA 1RLJA 4WKNA 5C4GB 5B2EA 1PR4A 3PC8C 4IS2A 4KN5A 1DDOA 2Z7JA 2MU1A 3K9PA 3K1YA 2I7CA 2DHRA 4GOKA 4GOLD 4CKBB 3OWOA 3LS2A 1R4GA 5DT2A 1E3LA 1FNMA 1Z45A 4BX9A 1T0BA 2DBVO 1L5RA 4E4TA 4RZQA 5JNRA 3JAMS 5JARA 4UM9B 1XNQB 1F5SA 1VMEA 2JKVA 4DR4B 3KHTA 5FP0A 3ZIUA 3WL5A 2PD6A 1L4BA 3IAAA 3M5WA 5FBHA 1FRZA 3N8HA 3QV1A 2ZR9A 4D8YA 3W2GA 4UHJA 4B1FA 2A1IA 2YWFA 4MQMA 2XDQB 5EY5B 3WP0A 3ZH9B 4XKJA 3WS7A 2CVPA 5JXWA 3CPEA 1T1JA 5EI5A 1EVKA 1BO6A 5FL7D 3T41A 2R4JA 5JQGF 1H9AA 2Y0CA 1FYEA 3I4CA 3RLFA 3TMYA 4COOA 4ECEA 4D82A 1TAQA 4NBRA 4GW3A 3AV3A 3KOMA 5CX4A 2JH9A 2Q7OE 5JADA 3L6DA 3QV2A 3S8YA 3UHFA 5IEJA 2PUTA 3OO1A 1ONOA 2VNIA 4MICA 5C8DA 4XSHA 5JNUA 4HPXB 4CQMD 4MJ7A 2XMGA 3FUVA 1QR2A 3GWGA 1Y37A 3IHTA 4N6GA 4NSRA 3QMPA 4Q3OA 5BORA 4XVQA 2A5LA 3Q8KA 1AUPA 1R0YA 2VQSA 3QW4B 4HFJA 1WUYA 4UBKA 4WGGA 3TSOA 5ITZA 5AKIA 4BXOB 1JQKA 2VRWA 2C2ZA 2YINC 4QGFA 4X3CA 1H8HA 2CLSA 1XP5A 4BNWA 2X9LA 3F7TA 3L2OB 4MRRA 5I9BA 4ZI5A 2PH1A 4HJRA 5DBEX 1GSIA 2PRKA 1V16A 1WIVA 1G4HA 1C4XA 3D2BA 1FVXA 3DWFA 3QWHA 4HGPA 4L9AA 4BO4A 2BL4A 3AJIB 1HNWM 1GPNA 2X0DA 4W6QA 4RIIA 1E1QA 1VE5A 4OKSA 3N0VA 3UAWA 1O0BA 3ROKA 2RGUA 1PFWA 1UC9A 4NMMA 2FW0A 2OBFA 4BGEA 3BSYA 2W6IA 4WY8A 3TAUA 3ADDA 5DHAA 1G8HA 1KZ4A 4WX2B 2YZ2A 3FJ1A 5BR8M 3U61B 1I3KA 3A1UA 2R6HA 5ALGA 3TW6A 4BNDA 1PGQA 3RCBA 3T0FA 1I94M 1MW8X 3FE3A 2Z3WA 1DCTA 2YY5A 1RXEA 1TH4A 3O1LA 4JVMA 1B00A 1TM7E 2AMLA 1ND6A 2GR9A 1G5PA 1FTSA 3PRJA 1SVNA 2LKCA 1R2YA 1FQJA 4CODB 4DJEC 5EJ6A 2ATCA 3ZDYB 2OCIA 4F1IA 2AD5A 3OZIA 2EKQA 3PICA 4GRDA 1QJCA 3VZSA 4ABYA 3GVXA 2J3EA 1AZSC 2GEDA 4RZSA 1X37A 3CUSA 2H52A 4QGAA 3Q5DA 5F5NA 5GONB 3ZV3A 3DMYA 2QIPA 5SY9A 5LQAA 3TOSA 4GKJM 1BHQ1 3U6QA 3P9PA 5IKEA 2YN0A 5FFFA 2YIJA 1ZK3A 1QP4A 2C9MA 4KFTA 2PXCA 3ENKA 2QZZA 4GS5A 1IWPB 2BJHA 1K27A 2EOAA 4GUAA 4LF9B 4LGVA 3E22A 3VNQA 4C05A 2C9YA 1ZY2A 1JFLA 2B20A 1WBBA 3AI7A 5K3BA 4UTVA 3ZWOA 4GEGA 3ABOB 1NBEA 1PQ4A 3HO8A 4KMSA 3IC5A 3SIWA 1U81A 4BS9A 4AN1A 5EUQB 5LUBA 4TKVA 3DMPA 3KP1E 2WWHA 3NGXA 4IH4A 1BMQA 1US8A 4I66A 1WXXA 1K75A 2HW8A 5FPQA 1G9TA 3W1EA 2YZGA 4PZUA 4JLPA 4OL0A 1IB0A 1DEHA 2PUWA 3HZOA 2J31A 3A45A 3MJHA 3R41A 1HDOA 4CW7A 1MABB 1Z62A 1GL3A 2ACEA 3ZOZA 3HPQA 2LPMA 3FNRA 3R6TA 4BNIA 3LE8A 3QFTA 3ST7A 3RS0A 4C76A 4QM6A 3P9QA 1XKTA 2PX8A 1E9EA 3VPHA 4CJ6A 3B52X 3EC2A 2XTZA 4HDSB 3QMVA 1TO6A 2C9DA 2CVFA 2PZLA 4V0QA 1JXMA 3F2VA 2WM3A 4XPIA 1EGQA 2PS0A 1V2GA 2C3PA 5H16A 2GPNA 4YT4A 1SKYE 4BO3A 2JJ1D 1KERA 1T3SA 2HQ1A 4JB2A 1ZICA 3OQBA 1WGNA 3NP7A 2XT0A 3PPYA 4GLJA 2YYAA 2PMCA 2KS6A 4EUFA 4IX1A 2AFVA 1HL7A 2V1UA 5JZVA 1NI5A 4H18A 4B3JA 2AUTA 1E4EA 5AUNB 5FTNA 2PZJA 3SBJA 1MB2A 4YV1A 1C81A 3RK0A 4DPKA 4IQ4A 1OZ0A 4A8JC 1CRLA 1D4FA 2DE0X 2IP1A 7GPBA 4QHTA 2I7XA 4JYBA 3ZUGA 2Z2IA 2VWHA 4IV0A 3ROMA 5LUAA 5DNYA 1ZD8A 2RC5A 2WA1A 5FWXA 3ZU5A 4I5DA 3BIFA 2CDBA 5ALRA 4MO2A 4E6EA 1TK3A 1QE5A 2B92A 1BE6A 2PDAA 2AEMA 4CEIB 5KVSA 1TR8A 4X62B 3D4IA 2WTEA 2I3GA 1UC4B 1XMQM 1OQAA 3RUDA 4OGFA 3U4MA 4J0CA 3WFIA 4DIEA 3LCJA 2CC2A 4HAWA 2YZNA 1J0AA 2WHQA 3TVYA 2P1DA 5CA0A 2AUMA 5AW0A 2VUTA 3QUQA 4U5QA 2VXBA 1KRHA 3QH4A 1IXSA 3THGA 3ONVA 2RCNA 1NTRA 3GRZA 4LF5B 1OWLA 2FW1A 2FN9A 4TLDA 1JFFB 5H3LA 5IM4F 2MHCA 1AM4D 6Q21A 2QD3A 1JJFA 1OX5A 3HU2A 1JECA 1Z6ZA 1S8AA 1ZSYA 2CL7X 2ORWA 4G4IA 3RS5A 3WYEA 4ARBA 1UKAA 2PUBA 2I7PA 4AXXA 1V0JA 4GFDA 1H2FA 2OT3B 1I4OA 2HMVA 4RWEA 4CQJA 1E6WA 2PANA 3DULA 4HYQA 1JG7A 5J2TA 2O5CA 3ZCRA 1LBEA 2OGZA 1JW9B 1WUJS 2WEKA 4WLVA 5DB4A 3QNWA 2H5XA 1DKMA 4KK3A 3O4HA 3E1GA 2QP9X 5D1NA 1Y1QA 2H2FA 3GCDA 3JYQA 5AJVB 5EL0A 3AV0B 4CETA 5JI2E 1LPSA 3HI4A 1MO6A 2HA5A 5I48A 4Y1RB 2ZSIA 4REQA 2IHTA 4OXKA 4ND5A 2J1LA 2DAMA 3PUYA 5IZCA 3QNUA 1X92A 1XJWA 2PVCA 3BWBA 3G2NA 4UU0A 1SFRA 4TV8B 4AD8A 2XWJI 2PKWA 4EAQA 1H8HD 3KKPA 1R00A 2P4SA 4KAJA 1NN5A 1P91A 4X64M 4JI0M 3AM5A 3A36A 1ZK4A 5FI5A 1XVAA 5TPZA 4D99A 3R3HA 3F3SA 2LH0A 1KR5A 3WJ1A 1O9GA 4DVGA 2JAQA 4W5RA 3L8GA 2E89A 3AT1A 4OMUA 2AXEA 1I33A 4O4IB 4HGOA 3UA4A 1XBTA 3AL2A 4EI7A 2CFOA 4M38A 3K2IA 2I03A 4EFKA 1RXUA 3I1YA 1V71A 1N1GA 4R9SA 5EXSA 2W2XA 1XZLA 2PT7A 2F3TA 4GQBA 2WTNA 1MB9A 4Q47A 4CEHA 2H5JA 4ZEMA 3MGCA 5ESWA 1NPYA 1JTFA 1XP8A 4DLPA 3PEYA 1PO7A 1OU0A 4TLAA 1PUJA 2PBRA 3EUAA 1AA6A 1X7HA 4LGYA 2Z2ZA 2C00A 1KVRA 3N0XA 5CDSA 2ATXA 2JGRA 3ME5A 1J33A 3OMXA 1ZC3A 4D46A 1M5RA 2XSZA 3E7DA 3DBLB 4XWOA 1MEJA 3P96A 3IPCA 1TC1A 4ZT4A 4YAIA 1TVKB 2E1PA 3CJTA 4LGCA 4DCPA 1Y8QB 3EN0A 3H6GA 5EZ5A 2MYTA 3K92A 1RHJA 4EM6A 5JBIA 3VU9B 3STXA 3ZNPA 4F7WA 1K7XB 1A50B 1IVNA 2Y2VA 3O84A 4PG5A 5K6AC 1W1WA 3TSAA 3QLTA 5ICFA 4AY4A 3ZWBA 2ZTCA 2Q3FA 4PPGA 4MI9A 3QXJA 5CA1A 4KR3A 1PS9A 3MCTA 3BHIA 3TZKA 4IWYA 1SC6A 4MB2A 1AQNA 2CSUA 2BH2A 2CNNA 5E9WA 5ULLA 3JTMA 2ZJ2A 1CLUA 5ALFA 3ZLTA 821PA 3KYBA 4MW6A 4BTLA 1LPAB 1KF0A 3LF1A 4CQLA 2O54A 2H2WA 2KBEA 3INNA 5H3HA 1CYEA 3LMMA 1RAGA 1WP9A 1WP4A 4WV3A 3GQVA 5IJ9A 3T5GA 4NCHA 3U1TA 3WIDA 4C6SA 2X14A 5FR2A 1VSVA 2HK6A 3JX9A 1PFUA 2QRZA 2XE6A 3OIWA 2FE1A 4UCFA 3V8BA 4BIMA 5A9SB 1B2LA 1FL9A 1MENA 2G8NA 4NU8X 4C6TB 4P83A 4YX9A 5BVHA 1UJ4A 2GPAA 3EA0A 4CGYB 2W37A 3NI2A 3FB1A 2GKSA 1IN8A 3LW7A 3A14A 4E12A 3NT4A 1HURA 1ZC4A 2JXNA 3ADBA 1ADJA 5C8YF 5ALEA 2YZMA 1JE1A 3UV6A 4DREA 2IHYA 4Y0AA 4BAUA 2EIHA 1M8GA 4HNAA 3VBCA 3HEBA 4E2ZA 1I6MA 1N1EA 2O3TA 5D8DA 2HYIC 1C9KA 2GK7A 5HOEA 3WDMA 1NVFA 2BZ0A 1KAEA 1PZNA 2FY8A 1T2DA 2OFWA 2YOFA 3NBUA 4JI1M 4IDGA 5EINA 3CCFA 5L3VA 4OHUA 3KYDA 3AW8A 1DTEA 1NXTA 1NT2A 1VL8A 3PL1A 4LN1A 1QQ7A 3B1ZA 1J90A 1M0SA 3E58A 1SB9A 2VK4A 3EPRA 3ETGA 4M0FA 4DSOA 5IG2A 4MCHA 1FB5A 1KYXA 2JW5A 4J0EA 2OHGA 2FW6A 1NKVA 2Y0TA 3B9PA 1LSOA 4L0MA 3NGMA 3AUSA 4CN9A 4F4FA 1RFGE 2PZEA 4LBYA 4Z9YA 4DLZA 2A59A 2GBPA 4X0EA 4N0QA 3GLKA 2ODAA 5JT1A 5KYYB 1Y6QA 1T10A 1Z4JA 1D6JA 1YA4A 4FZJA 2IY9A 3V46A 4BNZA 3T3NA 1XD2A 2XVMA 4P5DA 6ADHA 1MLDA 4X41A 1JQ5A 5AKGA 3WIUA 4YJFA 3ZC7B 4XB2A 1UJMA 2K4MA 3EDOA 3VQTA 2LVNC 3JQPA 2OV4A 4JJ4A 1JPUA 2FPIA 1D7AA 3S2YA 3EW9A 3WTCA 5DLDA 4HNTA 2PZBA 1M34B 1PNQA 3PNQA 2AMYA 2ZSFA 3UANA 4RAQA 3LVVA 4N9WA 2NO5A 1S2OA 2VTEA 1HYGA 1HEYA 2QP3A 2YMLA 4Z0HO 3T6KA 2IYTA 1NJ8A 2EDCA 3K8YA 4QUDA 3I04A 4DA9A 1U0FA 4M1SA 1CNEA 1OBFO 4CL2A 2DFNA 4MM3B 1E60A 1ZNWA 4MKIA 3A6PC 5A5FA 2G6TA 3MRVA 4MGIE 2WIFA 1M6VA 3LLCA 4LV6A 4LMAA 1X38A 4PQFA 4OOFA 3WHKA 1YACA 1JYSA 1P4JA 2FWAA 2IZ0A 2Q21A 1ZM7A 4FNOA 3WAGA 1DG3A 1KAHA 3AOGA 2QRVB 4KLAA 1HZJA 3GGGA 2VN8A 4ID3A 1Y4AE 4PYQA 1TT7A 2YHIB 3WGTA 2F7SA 4YRIA 2Q5HA 3NJ8A 5HVNA 2QXUA 1MA3A 1ESZA 1WHSA 1RC0A 2F8SA 1ZOSA 3BXZA 2IYRA 2ZJ7A 1L4EA 1W73A 2PT6A 3G7NA 2JZOA 1BXKA 3TR5A 5BW5A 4OI0A 5CLFA 1XMOM 2DKLA 1CF9A 2Q1WA 1KJNA 2J6IA 4YJ3A 2GF9A 1GFIA 5LQSA 2GYVA 1YIOA 5TF4A 5HZGA 1YSCA 1T9AA 1GNQA 2E5WA 4JB3A 5LSAA 3PXAA 1HE1C 4TZ6A 1WY5A 3UV3A 1XQWA 2DQSA 4CZ2A 4FTWA 4OYHA 3ILKA 2J87A 5AJWA 5HM8A 4KR0A 1WQ4A 3NEYA 1TYAE 2X1LA 5AJTA 2W2LD 4LZAA 3PWSA 4ICIA 1AGRA 1KJWA 2NXCA 2BCGY 1G7SA 1T0HB 1TQHA 3JYLA 4AUKA 1Y1LA 4BLPA 4IRMA 3UHOA 4HWRA 4G9GA 2OECA 3N8DA 1PGNA 4FKZA 1MGOA 4ISBA 5A4FS 5K8TA 5BPFA 3L07A 1JQDA 4UDOA 3SI7A 4DQXA 3OIGA 4Y2QA 3DNFA 1M83A 4MRMB 4ARAA 4KUEA 3CKMA 4B7ZA 1U0BB 3H2BA 4AQYB 3SIPA 3L26A 4BV9A 3AUKA 4CG1A 1I51A 2LBCA 4C0HA 3A4NA 2QL5A 1QGZA 1EA5A 1NR7A 5LXTB 1O9HA 3D6VA 1R1DA 2I67A 3GCGA 3H75A 1CW2B 1NQWA 3PF9A 4FGSA 2P65A 1F4IA 4EP1A 3GLQA 4A0SA 2GH1A 1XDGA 3BZBA 3GVIA 4QYWA 3MBKA 4CF6A 4GX5A 3FNFA 4IDOA 1BFDA 1W5BA 2ZYWX 1E2FA 3C3KA 2I5PO 2D4AA 1GGHA 1IXRC 4IZHA 3SXUA 1ZIPA 3PT5A 1KZ7B 4AC9A 2XUFA 2E48A 1T4DA 2JAUA 3FVVA 4B9AA 4N47A 3Q6IA 1YZHA 5UKDA 4DVJA 5FPPA 1O0SA 2EJTA 4PBRA 1WKVA 3HJRA 2O06A 3THXB 1G64A 3QOFA 1R6UA 4J49A 4LVCA 3NYRA 1P77A 1LJUA 5HYVA 3K9QO 4TPKA 3KEQA 3WSWA 1IVSA 4M9XA 1PSDA 4UVHA 1STOA 1MO4A 2HUNA 4YP7A 3RTCA 2UKDA 4ZI2A 2O8EA 3TUZC 3R7NA 3V48A 2WD9A 2Q2WA 1GUZA 5EXDA 4AWXA 1R4ZA 1XRSB 1SQGA 1B7GO 2W8BA 4B8ZA 4GOND 2FOLA 1BG6A 3OY2A 5CPBA 5EZYF 3DBIA 4HOYA 4KGDA 5DGIA 2QTVB 3G82C 4G07A 2WWWA 4I5IA 2R68A 1IJFA 1N78A 3M3HA 1EFPB 4YJFB 4C6HA 2JS7A 1FTWA 1THZA 3MMZA 1GCUA 4KK4A 4DA7A 3AVTA 3N39C 3GLHA 3GLGE 1JYEA 4IVRA 2RHLA 4F6LA 1ZHFA 3MT7A 2GZSA 4Z3DA 4AZ3A 3AF1A 3KKOA 3G1WA 3TQIA 3STHA 1L7XA 5DDIP 3QKUA 4EHLA 4ER7A 3TQFA 1CY1A 3O8QA 5CNIA 3MBOA 1US8B 2HMUA 1ZNZA 5CXUA 5B4TA 4WZBA 4MH0R 3PFWO 3K0CC 2XQVA 3I9JA 5EWMB 1Q1BA 2ZVQX 3I8XA 5EKXA 1Q0HA 2BOVA 2TS1A 2Z1DA 3EWAA 3QVXA 3EAFA 4MWDA 4TSRA 3R5JA 4KDFA 5EPEA 3TIIA 1GZUA 2XA9A 4U39A 4YJKA 5FI0B 1QH1A 5K51A 3VUEA 2PJRA 3WLPA 2ZBEA 5JQGB 3FSEA 1PQUA 2BGLA 1AZTA 2DHDA 2PUJA 4HDMA 1I4DD 1UK6A 3U81A 4G5SA 3L7BA 4OU5A 1LTQA 2BFBB 2EX0A 2PWBA 5HG0A 5JANA 2R0QC 4FQ5A 1DIBA 3KKQA 2MSEB 4W82A 3K5HA 3VK7A 1NMEA 4U2DA 4QVIA 2NP6A 3EEYA 2XCOA 4YC7A 3SZOA 3C7KA 4BP9A 2ECPA 5G0UA 2W0MA 1LWNA 4Z7JA 4JI3M 4QO8A 4NCKA 4DG9A 5FPYA 5HRCA 1WLYA 4GG1A 2C7GA 5E7QA 4DR7M 1IN1A 3V6LA 2R85A 4UHFA 1ACJA 2QMOA 1WCYA 4A16A 2B36A 3GEIA 1WL8A 1T8TA 3GP5A 5EUMA 4NE2A 4C7OA 4I5SA 1WEKA 2GRUA 5E6SA 3BZUA 1FQOA 2XMSA 4NBVA 2GJSA 3ZZTA 3EMKA 3U6CA 5ALZA 4ZZ3A 1D1TA 4Y9RA 3RWBA 5BUSA 2JEOA 3OFJA 1LX7A 4MQFB 2Y1DA 2IUSA 5IWAB 1EE1A 5DEIA 4XD2A 4HWOA 3ROQA 7ADHA 2J3QA 4DY6A 4NXMB 3OE7A 2WFLB 4A6PA 5JRZA 3W3AD 3VBEA 2V3WA 5JALA 2JBAB 2RC6A 4D74A 4EI2A 5U1PA 1ZMVA 4NZPA 1Z4PX 1T5HX 3T7AA 3WQBA 4R81A 1YFLA 5FUMA 4ROTA 1V5WA 3K0FA 4G63A 1C3OB 2AJ8A 4F46A 4HUQA 4BVBA 1CB7A 1QPBA 3K94A 2XJ9A 1N2BA 3DYIA 3WB1A 4GOMD 4CI9A 3PDUA 3F7NA 2YWDA 3QBTA 3QF4A 3QPUA 3IALA 3SATA 4MQEA 3X1ZA 1GZVA 5KOHB 2HDOA 4GEWA 2WQ6A 2PN1A 3EQ8A 3QG1A 3B74A 4QJ3A 3VO2A 3H5LA 3EZ7A 4E51A 2NMVA 4KQHA 2VDMB 1HYQA 3PC3A 4K86A 4DV3B 1GOTA 1OY1A 4WY2A 1J7JA 2P0YA 4RZUA 1AVTA 2HSDA 1RWWA 1H6CA 4MCAA 4MPTA 5SYMA 3DLTA 3U19A 1XLWA 3IUBA 4W9RA 3KOOA 4Y6OA 2WUDA 3BGOS 1YQEA 1DOZA 5A05A 4G8BA 5TXGA 2UUAB 2XI4A 1QHNA 1KS2A 4TMKA 1GRCA 2WMNB 1ZK1A 3ZZNA 5DI3B 3KKNA 1XYYA 2B37A 4Q3EA 5IT9S 3KLBA 5JSKA 4KODA 4BMZA 4O2AA 1E2GA 4LGMA 4DYVA 3SHGB 4WNCA 4DAEA 5JR3A 3D7SA 1CCWA 4DUZM 2I8CA 3UBMA 5KNCD 5AJUA 1XTBA 1Z13A 1BGWA 3O8OA 4S24A 4X91A 2DI0A 5H8WA 1ADCA 1KAGA 1YKSA 2W6JA 3HN6A 4BB6A 4AJOA 1C2YA 1CD5A 2GS9A 3X0DA 4EJSB 5A3QA 3FWKA 3G1UA 1UWVA 4GIPA 1T8RA 2ENUA 1GT6A 4MWOA 3J81S 4LF4B 1ODKA 4MDFA 3CQ9A 2Q49A 2IYPA 4YQZA 3PITA 2ZJOA 1CF4A 4PF1A 3L2AA 1I5EA 2BMFA 2ZYVX 4YGXB 2HKJA 2AIRA 3B3GA 3S1SA 5EXXA 1UBOS 3D4BA 3QPAA 3E46A 1Z0AA 3WAJA 1J1UA 3L8EA 3LC2O 3HO6A 1VCHA 4CUKA 5JAUA 5AJYA 1BKDR 4DR5B 3NM5A 2G63A 1QRDA 4UEJA 3GH1A 5IDWA 3M6IA 1RRPA 4BZXA 5CDFA 3UJ3X 1SXHA 1JE0A 3FKEA 5AQ1A 1MO3A 2QR2A 3ADCA 2ID9A 2Y4OA 1W9HA 1UT6A 4BGIA 4EHBA 5JCPA 5FNVB 4ARZA 4O4LF 2R8EA 1C1XA 4QC2A 5BSMA 1CZRA 1ZHOA 4DUGD 3LV8A 3IUEA 3WGQA 2G25A 2QSUA 4UOQA 3I5YA 3ZGNA 2UZ1B 3RPEA 4MUIA 4F56A 5HZHA 2HMTA 2O14A 3QX9A 2R1TB 3FMFA 1LDMA 5T6MA 3WMXA 4DDWA 1QE3A 5A02A 2MSWA 4UM7A 1ZGHA 2O59A 3GN2A 4M1MA 1VYHA 2ENWA 4Q9LA 4CVNA 3MTIA 1DAHA 1H0SA 2NM0A 4LI0A 4BNFA 2D7DA 3P19A 1V37A 3SYRA 1GRVA 2W4MA 4INJA 3MQ4A 4ZGGA 4K9SA 3IV7A 2XUZA 1I7SB 1QGAA 2QN7A 2YHSA 2XKAA 2OZLA 3U31A 2CXQA 1VJ1A 1O8CA 1RMQA 2V7QA 4CF4A 3ILXA 1IEXA 5DM70 4C14A 5K8CA 3SEFA 3GYGA 4K6CA 3WK5A 1Z6YA 1FFSA 4RE6A 5JS8A 1I01A 4WUVA 5BWNA 2D5LA 3HSKA 3CRW1 1UWCA 3AUTA 3VJKA 4MWSA 4P33A 4TWAA 4AKSA 3U6SA 4H7PA 1QIGA 1MIHA 2AKAB 4CQMB 4QQKA 1ZD3A 3HFRA 3TLMA 5BSHA 3LUHA 1EP1B 3KQHA 1XV5A 2ASEA 4YT2A 3JQQA 3V7UA 1JR4A 3ERCA 3O8OB 3QXHA 2KM1A 1O58A 2A92A 1J97A 1D2GA 4WXEA 4OHZA 1FSGA 2WWFA 2QVZX 3M4YA 4PLCA 3PEVA 4CT5A 2XVXA 3IQGX 1MVOA 3L1IA 3R0XA 5IJXA 5TPWB 4DQKA 1X1SA 3UK0A 3VM6A 4Z8XA 2F5OA 3EF1A 4FIZA 3D4PA 4MOWA 4RHYA 5LP6C 4D9KA 5CAEA 2AW3A 3Q8XA 1Z29A 1HORA 4J1NA 4BMOB 1EFLA 3KDPA 2HRZA 2TMDA 3JQCA 4OAQA 2IHNA 3BX1A 4TMFA 1KETA 4DZZA 4YJHB 5KMGB 1WB9A 1Z56C 1HTBA 1ABEA 3ZLUA 2W2QA 3LUAA 2DAGA 2A5JA 1RBZA 2AYXA 2WSYB 4NRDA 3SLRA 4BECA 4MIEA 4LHXA 5A2GA 4K5QA 5KTMA 4JEUA 3HHZA 1ODFA 1NDQA 2FFRA 3AJ9A 4YMSA 1ZK2A 2DHQA 3IHPA 1THTA 2Z83A 3IAM1 1RKBA 3AM4A 1O54A 1ZRHA 2VF4X 5BQ5A 4E1BA 2D3WA 3ESYA 3G5AA 5CYPA 3DDNA 3ZZ0A 3GL9A 3LBYA 3CZPA 3ESDA 4NG5A 4D4KA 4EWLA 4YCSA 2K0BX 4JLJA 2ANBA 2Y1FA 4QDXA 5EJ4A 4TLMB 4WVLA 4R0NA 3EUFA 1Z4KA 5FFMA 5FWNA 5KC8A 3IDSA 4MV7A 4NBSA 4YV0A 3K0FB 3JQDA 4CF3A 2Z30A 4EHDA 1IHDA 5EXPA 3RBAA 3DKPA 1DLIA 2CCKA 2JFHA 1M6HA 1PJ8A 2ZIGA 2IXBA 1O97C 4FINA 4WZZA 3HJNA 3VR6A 3ZI7A 1FXUA 1NYLA 4U63A 3RH0A 4LF7B 4OX9B 1OIZA 2O5EA 2O19A 2ACKA 2O0KA 2P41A 1GFSA 2E5FA 2ZLBA 1L8XA 4PC3A 2P5TA 3IL2A 3KSUA 3JATB 2ET6A 2QQ8A 3KUCA 3OQMA 3HL4A 2HQSA 3EVGA 2XNHA 4DJTA 2ZANA 4FILA 1Z25A 4B3IA 1R88A 1J0CA 1RRGA 5BUZA 4S05A 1U2QA 4UMEA 4DV4M 1U0HC 5FSWA 3TL4X 1NUTA 3C1OA 5ELXA 1I9CA 3JXEA 4JB0A 3GFOA 1JG1A 2EGGA 1J06A 1KC1A 4Y7DA 4KKVA 2XB2A 4Q4CA 4DDTA 1OILA 1QZUA 2A1UB 2PWZA 1QCCA 5AW3A 1FRQA 1W75A 3RFUA 1SVMA 1QTIA 4YP0A 4AX8A 1IBKB 2L6OA 2KBFA 1HDZA 1M67A 3A1CA 1KEVA 1CC1S 3HXMA 1T3GA 2CJWB 2F3SA 5JAOA 5FUBA 3LZ6A 3UOWA 3KZCA 3CNEA 2PSEA 3EE6A 4ND6A 2A88A 5I5GA 1A9SA 5AM5A 1WZ2A 1Y8RB 1I3OA 5H70A 1WWKA 3T4EA 5GONF 5JFTA 5FDFA 1QUEA 4NENB 1P0MA 1ORIA 1CDEA 2J30A 4J7XA 3SAWA 1DXQA 1XF1A 2OC9A 3NHWA 2CV1A 2CXSA 2PQ2A 3OZRA 4M54A 1DKRA 2X1VA 4BNYA 3PYXA 3KR9A 4ZC1A 3RSFA 3Q9NA 4YECA 3R7BA 2QE6A 4L8LA 1U1CA 4C4RA 3E23A 1X1CA 4RS3A 1FRFS 3RNLA 2FPSA 4ACAA 4E70A 9GPBA 4JLVA 1UIRA 2YW2A 3T52A 3G2IA 3I1JA 1OXXK 4LQLA 3FYUC 2PAAA 3PG5A 4QDUA 1B0AA 2MYUA 5D7BA 3UJ6A 3WOVA 3KQLA 3L28A 5ALPA 4ZYLA 5B6PA 1NZJA 1FFBA 4D6XA 5KYTA 3RWMB 3W3AA 3OE7D 3HZJA 2IYEA 3A32A 4DOMA 2HR1A 2A57A 5F77A 4YXWD 1RLOA 1TEVA 2H1WA 2WHPA 4XD7D 1SK9A 1CHDA 3ZX5A 2QI9C 1S2NA 2ZFUA 4IQ0A 2RBKA 1N3BA 3EQ2A 4MV5A 2O7VA 4E5PA 3VYUB 3A2KA 5BWOA 4J7UA 1BQ4A 1V8FA 3NCTA 3U7FB 2P35A 2VOJA 1NXXA 4M0CA 4B2LA 3RREA 5HXAA 1KQPA 1J8VA 2ONJA 2LR0A 5JEDA 3HU3A 1G6KA 4BO8A 5JU6A 2A9QA 3A6ZA 3C5EA 3MTBA 2ZUWA 3H5VA 3OZGA 1PL7A 4Q7KA 2VYNA 3TNDA 3THXA 3TG2A 1T4BA 2FMIA 4NEQA 5CT8A 2QDKA 3KS8A 4MR9A 2IOFA 4UUMA 1NR5A 4YMIA 5A7GA 4CDNA 3HXQA 2BF7A 2LIPA 1QP0A 2O8FB 1W581 1X7GA 1QF7A 1S2MA 2H17A 3LRPA 4IJMA 4TKLA 3WLJA 4ALMA 2ZRNA 3TH5A 1I9GA 1QTNA 4W7SA 5K8UA 4MQLA 1NP3A 4RTSA 4B76A 2K7FA 3EVDA 4U7WA 1T4MA 3NRCA 5CU7A 2P79A 2NSYA 3HP4A 1UAAA 2D6FA 1EIJA 2YMQA 5CDFE 2AYYA 1THMA 3BE6A 4CMGA 4AW9A 1B8OA 4BPBA 3GLIB 1EESA 3KTAA 3TSZA 3LBFA 2R6ZA 2I99A 3OKPA 1Q21A 4JASB 1BKYA 1WR8A 4MR7B 4TTRA 1JHAA 1GADO 2EV9A 1NULA 2J45A 1ZSVA 3IPAA 3AHIA 1TZKA 3FTPA 2R60A 2X1HA 2PNFA 5AHWA 1NW7A 3NONA 5FI3A 1L8QA 5CBPB 2Q0SA 5J5VA 4LSWA 5CIWA 3JR5A 1WW8A 2AQKA 5IT4A 3HLKA 5F33A 3A9CA 3NYQA 2D2XA 5F3WA 3L7KA 2FRDA 2GHIA 1K4KA 1TIPA 1NIPA 3PQCA 4MQBA 1GGFA 1LLUA 1L5GB 4KR6A 4J0GA 2X6TA 1OFUA 4NEGA 5D87A 4L22A 4TQGA 3OE5A 3KP0E 2RKWA 3F7MA 1L5FA 2DSTA 3BSSA 3JWGA 4KQEA 2DCMA 2CLCX 3VR6H 2HT1A 3GB9A 4LTDA 1F2TB 1XDZA 2F3QA 1WQ3A 3LWNA 5F4BA 3TB4A 1HDEA 3FOFC 4IJWA 4J3JA 2CD7A 1WM1A 3D7RA 1N5DA 4DIBA 2J5YA 4BNGA 5JSUA 3WLAA 3EHEA 3OJFA 4MW1A 1NSYA 1J70A 3HRKA 1VE3A 2R1TA 3IV6A 1Q7GA 1U7UA 4HS4A 3JPWA 2AS0A 2C07A 3KT0A 4JR0A 1ZI9A 5KSOA 3HY5A 4LYGA 4B3GA 4AB1A 2NU9B 1NN0A 4C20A 2FE4A 3ADPA 1A4XA 3W0FA 4RVDA 4E1VA 4H35A 1CUBA 1KPHA 1MG0A 1L2BA 2WTBA 4Y2UA 2CXTA 4DMGA 4OKNA 2Z2JA 2OHJA 1CUGA 1VHTA 2WICA 1M7BA 2OWEA 2YXPX 5HRAA 2WV9A 3HJ8A 1JKIA 2C2XA 3EVAA 4HZUB 4QYIB 4RDHA 2CZGA 2VF8A 2WHYA 3GU3A 1PZGA 3U3KA 4AY5A 1K6MA 3RUHA 4UVIA 2ZVDA 4X64B 2NN3C 3FFWA 1DAMA 4RCZA 2HK8A 1N8TA 4GBED 4KIFA 3GPUA 1OAAA 4PPFA 1AXEA 3ABQB 2IYWA 1WMFA 4Q24A 5K01A 2NVOA 3H65A 2N3ZA 4GC9A 2OD2A 5LZ5A 1UBMS 2WU8A 3QJYA 4P1ZA 5DXAA 4OXQA 2CSXA 4BN4A 3IULA 3EULA 2QGFA 1JXQA 1PV1A 4CR7A 3LPLA 4LS3A 3G3EA 2KWIA 1J99A 4J4TA 5AJHA 4ZCPA 5ARBA 5H4GA 3EG9B 3SSOA 1V5GA 5B7QA 3B7WA 2GYUA 1PRBA 1VTKA 2I4MA 1J2RA 2JHCA 1OGIA 3RARA 3RC1A 5I51A 1GAEO 2WJPA 3BMNA 3DBRA 3M82A 4B7XA 3EPKA 4ZCIA 1M1UA 1W6UA 3B1WA 3H6HA 4M7RA 5JNSA 4LJAA 1JWLA 3DO8A 2GN4A 1UQRA 2W6ZA 2O1EA 2VYCA 3D5EA 5CYFA 5EOVA 1JKJA 3BJIC 2F3RA 1EJ0A 3IUSA 1RP7A 3VYRB 4UUAA 5EGSA 3R7WA 2V1CA 2I7TA 2W2LA 4C0BA 3KQUA 3TX6A 2MROB 1TMYA 3OZFA 4XVHA 2QTHA 1Y5RA 1CLEA 5DP2A 3P9NA 1JHOA 4EDFA 3IVAA 1UOOA 2FETA 1EH5A 1NYQA 5FOTA 1NUAA 1WXDA 3UQZA 4BP8A 1WCXA 3P9RA 5BSVA 1AMOA 1XN1A 5E6UB 2EGUA 2WFAA 3IEXA 1RKQA 1JR6A 3RGSA 3FMVA 4A8JA 5IDXA 2B4YA 2HPHA 1QV6A 1OI4A 4IVPA 2V7GA 3STYA 4HLCA 1DV2A 2OCXA 2W4IA 3EIEA 4K6KA 1BMDA 3UUWA 1N7IA 4YRMA 6REQB 3PQFA 3W2IA 3QEMA 1BDHA 1NW4A 5F3RA 4JYAB 4PLYA 4XQGA 2L4EA 2VPZA 1VA5A 3QVVA 4HEJA 4IILA 4DR2M 2JNWA 4F4DA 3J81k 3Q7RA 3OZWA 4YCBA 4Q39A 1O5IA 2DFDA 3EGXB 2FHSA 1KOGA 1Z5GA 1Y80A 2QL9A 1RNLA 3PUVA 4KAAA 1R9GA 2DWOA 1U63A 1IHYA 4J6EA 4P3PA 5JMTA 1N32M 5KTOA 1YDFA 5KSPA 2IX3A 2H7YA 3RYTC 4HD8A 3AYXB 3D6MA 5K8LA 4NAVA 4MINA 2XJ4A 3T1OA 2D1YA 5I7EA 1CP3A 1MF7A 2PTHA 3CUWA 1R5OA 3E7XA 4D98A 3ZCBB 4HLQB 1E92A 5IVDA 1E1NA 4GIBA 4N7RA 4UNQA 2BMWA 1SVIA 1ZIYA 1V4VA 1R3DA 4R2MA 5FBWB 3U62A 3G8DA 1Z8DA 2PR2A 1EFVB 1ZMTA 1RYFA 1UXJA 2COKA 4Q1AA 2D7HA 4AWAA 5CFQA 3L4JA 1KDOA 3QVGA 3NORA 2AQ8A 3K1TA 3EBLA 1GU1A 3N28A 3NVDA 1E9DA 1N5MA 3GYBA 3DHEA 3JZMA 1C7IA 4N0PA 3GT3A 4WXHA 3R0IA 1ZKDA 4R9VA 1Q02A 4JP2A 3BHNA 1NVTA 1ZBQA 5H0IA 1WBJB 1A77A 2WA2A 2V5UA 4ITUA 4OBEA 4A91A 4I50B 2BP7A 3TG8A 3IERA 5JASA 3ICOA 2V5AA 1SH7A 1KI7A 4CFSA 4ZOQI 1KFVA 2PT9A 3K5IA 3M6WA 3MF4A 1RPZA 1FDVA 3TNFA 1M1XB 3RE1A 5SY6A 3TLGA 4YALA 4BKUA 3SBXA 1T3ZA 3DEKA 3AMVA 4OXIA 1FRNA 3COSA 4V03A 1ZQ9A 1ID1A 1FFHA 1TJ5A 2TMGA 4LZLA 1N77A 4QDOA 2O25A 4M0WA 1X19A 2ZYAA 5C2JB 1SBZA 2QRNA 4LXGA 3HE3A 3OAAD 1P2FA 2P5TB 2X23A 4JJ8A 2I6UA 2YHAA 1XQYA 4UJ5A 5IKMA 3DLIA 3UMYA 1K8ZB 2V7TA 1ODIA 4B3TB 3EEIA 1QQTA 1T0UA 4FYVA 2C83A 4JQYA 2GJAA 2JI8A 2QMZA 3THRA 1HE2A 1T2AA 2B1IA 3EVFA 1M76A 2C94A 4DR3B 1U5BB 3V1YA 1VBFA 1Q1EA 3TB6A 1LJLA 1TZJA 3N70A 4PRKA 5FUYA 5IKXA 4WINA 5DHSA 3KIPA 3R76A 2NZYA 4YGYA 2IS2A 4UEWA 1OWNA 1ZSNA 3QX3A 3WKEA 1HKHA 4EX7A 3OIDA 4BWYA 2G9ZA 3HDQA 3Q10A 4FVTA 2YYZA 3DL0A 1V11A 4HH1A 4K46A 4GSKA 1II8B 1W34A 3QXSA 1R0LA 5IBRA 5IUJC 2LV8A 4BFXA 3ZGLA 3BYZA 1ZXLA 1YCFA 3C3CA 3PDCA 2FEPA 5CFRA 1SU4A 2LNDA 1XTKA 1T13A 2OZKA 4LI3X 3DZGA 5JROA 5DBGA 1XOIA 5HK8A 5K2OA 3HM9A 2CJPA 2QVXX 5JYCA 1SXPA 1KKUA 2RRUA 1E18A 2JH3A 3DEAA 1SQSA 4J16A 4YAOA 5HWSA 4KREA 2ZPUA 4ZVRA 3FH0A 4I9UA 3GZNA 4XIIA 2BEVA 1ZJ5A 3VZPA 3U09A 2NTNA 3PHJA 3A2LA 1WA5A 4RANA 1CETA 5B53A 4ND4A 4FCWA 1GTG1 3SFVA 4ZVPA 3PZBA 1T8PA 2QN8A 1F2VA 4BNUA 2IV7A 1XJ0A 5DPMA 2EW2A 1WO8A 3HRIA 3KQPA 3OIYA 3KOYA 4JLAA 4F3YA 2OOSA 1HFEL 5BSGA 2I2CA 3VU8A 3SQLA 1Z36A 4TLEA 2AWOA 3C9PA 1KR2A 3G0IA 2UYGA 3U9LA 4U6QA 1XTUA 3UB4A 1VJ0A 4KI7A 4HYTA 3QFFA 2PIDA 4NCXA 4MHTA 4M7OA 1MNAA 3EVBA 4KGXA 2XLBA 2GAFA 1XZKA 1P6XA 3OOEA 1NF8A 3MC1A 1BJKA 2C8VA 4UASA 4PBTA 1EFUB 3H11A 4R2JA 3U3JA 4HN9A 1WAMA 4MQUA 5FWXB 2VF5X 4QLOA 4C4ZA 1NWCA 1U2EA 2GN8A 3SMSA 5CXXA 6YASA 3ND5A 4CKCB 2FMUA 3OCYA 2PX6A 3EDRA 3TW8A 2VSFA 2FH0A 3VV2A 2B4TO 3W4IA 5CBPA 4YDQA 3CS3A 1YF3A 5TPZD 1BQ3A 2HREA 5KQSA 3GZNB 1NNUC 2ZYTX 2WB4A 3NKFA 3JARA 2NXWA 2O9JA 1QIIA 3QXXA 1QK5A 2QU8A 1E66A 1LXCA 3RODA 4KVAA 2W83A 5DCUA 1BQEA 1XVLA 3IJEB 3BILA 2YC2C 1XEXA 1OH6A 1AKRA 4YO7A 2EQ5A 2JJMA 1QX3A 3P2OA 4GLFA 1DCFA 1Z17A 2IDKA 3G7UA 3R5FA 1NLYA 4O0LA 3TWOA 2RONA 2VZ8A 1NP7A 2YOGA 3H13A 4RGVA 4TRJA 1JAYA 4ZODA 5ILQA 3WJAA 3PNMA 3FCOA 4YJ2F 1W88B 3R09A 3IOYA 2YHIA 4HMOA 4EZEA 2WV7A 1XN4A 5EGNA 3EEBA 4P9NA 5H80A 4G4OA 1GG2A 3ZXUB 1P3QQ 4NCAA 1FP4A 2BM9A 4MRVA 2AZTA 2IX9A 4EHIA 3F47A 3JQ7A 2XZOA 5DMHA 4MWTA 2C7PA 3EDMA 1TAUA 3N8NA 3D6HA 1BEEA 2R8XA 1C9EA 3K6KA 4MH0E 3DVQX 3Q41A 4JROA 5GQSA 2EZ8A 5EJ9A 2VXOA 3CNHA 2JAHA 1WVIA 3H2SA 3ZGXA 1N6NA 1NU8A 1YBHA 1G8AA 1MAVA 3KT3A 2WKPA 4KQGA 4BB9A 3A26A 2W0SA 4RKYA 4M22A 4EVSA 4YJ2A 3KKMA 2VQFM 3I72A 3MK31 4IKPA 4PLTA 2IK8A 5A03A 2ZBRA 4XA8A 3R6GA 3ZS8A 4REMA 5DX1A 2PUCA 2VCYA 1V9CA 1RE0A 2QX8A 1N5LA 3KB8A 3SYKA 5I7AA 1C9YA 2OO5A 1LUAA 2YV2A 1Z12A 3KSDO 5U4XA 4EW3A 4D4MA 2YCLA 3DVLA 2F1RA 5DYIA 1L2CA 2WF8A 3D02A 4TZTA 5JPCA 4YV7A 2Z9BA 4CT4B 1P7WA 2VUSA 1E5XA 4ZAWA 3LX5A 2R44A 1GKKA 2HHJA 1JB9A 1UZUA 1IATA 3ZGZA 3GVHA 5G1PA 2GK6A 4EGJA 2REOA 1Z6AA 1ZMRA 2XB9A 1JHDA 1GAQA 2Y0DA 4BVEA 1OYWA 4BCDA 2QHXA 4R0VA 1XNRB 3TQQA 1JQEA 1CX9B 3GLRA 3R0VA 2QYSA 1REQA 2HNBA 5D3KA 2TMYA 2PLAA 5LVAA 4RKQA 4FGLA 1Z74A 1GO2A 2ZIEA 2ZIWB 2JJ1A 3D8NA 4P3NA 4CFZA 1YUBA 1ECJA 1Z4OA 3E9NA 3TI7A 1UXOA 1UK7A 4GPBA 2ONKA 4ZHQB 4R7TA 3V55A 3AXSA 3L0ZA 3QK7A 2LKDA 3M6XA 1RLUA 2WJAA 2MINB 3FPHA 4MCIA 1GVNA 3HWSA 3EF0A 3F5DA 1FXWA 3I5MA 1XKLA 1OFUX 1YZNA 3Q8WA 2AD1A 3TTVA 4BVJA 3COWA 3GJZA 7MDHA 4JBXA 3ZTWA 3DVAB 1XMIA 3MXTA 5E3JA 4CM3A 1Q14A 2HWWA 2OPFA 4CKXA 3SY8A 3UXHA 1AG9A 5IW8A 1C7EA 5BVGB 2FU5C 1X1EA 2P75A 2AFIE 3HG7A 4J0DA 1M8JA 2D62A 5B7NA 5C5CA 4OB6A 5KDOA 4FI3C 1P2BA 5FPHA 2UXBB 1Y9AA 1OGYA 3UATA 1P5RA 2DHEA 5GOTA 1Z73A 1NRIA 2QSZA 2XZPA 4PANA 3I9V6 1JEYB 1GPDG 1H69A 2PM8A 1WCWA 1V1RB 1WV0A 5JJIA 1NVWQ 5KQ8A 1SVWA 3B89A 4B4KA 3RG8A 4LPKA 1YDEA 4DNOA 3QSGA 5JS1A 2BR5A 5HFAA 2IOYA 2M6KA 5AHXA 1OA1A 1I13A 3HKEB 4K81B 1CQPA 4L0QA 1X39A 1V41E 3DF9A 3BVPA 3IHKA 3NIDB 1KH1A 2DLCX 4NQZA 2PTGA 1T2UA 1NUHA 3A37A 3V4SA 2C3YA 4B3MM 1BDMA 3VYVA 4B0OA 1FFAA 5CCEA 2GT1A 4BQIA 4MUBA 4J0QA 4MW2A 3VVLA 4H7JA 3DL7A 1B6TA 2IYOA 2W2PA 2WP8J 3DV9A 4MKFA 3VX3A 3VH2A 3FMGA 1M2OB 1YQGA 3L18A 2PKCA 3I73A 4A36A 2L09A 1YR3A 3DBRB 1GZ4A 2I3BA 4H3SA 3HA2A 3OLCX 2Z95A 4I6EA 4X6XA 3P32A 1KSJA 3M6FA 5AK0A 3TEMA 4KACA 4X1KA 5D5HA 1NMYA 3G49A 1O97D 3CF0A 2QQGA 3RIHA 3UHJA 2FWBA 1NY6A 4HH4A 1PWXA 3GPYA 1B8NA 1L7NA 5TY0A 3SKXA 2IPAB 4ATNA 4CIBA 3NTOA 4X60A 1X42A 3WNBA 4EY8A 2A58A 5MFPA 3LUKA 4PHHA 2W2TA 3FD8A 1GRNA 5CNMA 1RACA 3ZBQA 3EUEA 3I2IA 2DUJA 5EMNA 5H1YA 1V1JA 1DO0A 9MHTA 4L74A 2ZB7A 3HBFA 3O8NA 1ZZEA 1GA1A 4I4TF 2JIZD 4PM4A 4TKUA 2BTEA 4IKOA 5J2TB 1DFGA 2QNIA 3DONA 1L2DA 4CQMA 1O0CA 3AB3A 2QDXA 5HF8A 2Q5JA 3PVSA 3EVTA 5M2QA 1PT7A 3P9XA 4KJZA 2O1XA 4M7WA 1DP4A 3T1HM 1JIJA 3NO4A 4B6EA 2OXCA 3G02A 3DGFC 4TUYF 2OQ2A 4XX0A 3JQ7B 3D7KA 4KIUA 4C88A 3D4OA 4CR8A 3QHAA 1OB2A 1HQDA 5EIFA 2IYXA 1NONA 4HJXA 1UR5A 2QPTA 1GGMA 2RB4A 4P5EA 3HVJA 2QLTA 4QBKA 1CXZA 2P9EA 1LY1A 3RLIA 2EJUA 4KPUB 4FDMA 3QITA 3HA7A 1BJTA 4B7UA 1EBFA 3GEMA 3P4UA 1FP6A 4LY9A 4UAUA 3GJ8A 4EG5A 5HQ3A 3RVBA 4K8OA 3MQFA 3OF3A 1YR9A 4CTNA 5JSZA 4F8EA 4A6EA 1VJRA 3TQCA 5EKTA 3DV0A 1SZJG 1R50A 3KOZA 5CDYA 4AMZA 4DR4M 2B9EA 3GRFA 3SMVA 1QH8B 3ZQKA 1JSZA 3A1EA 4KOAA 2CV0A 2PSJA 1NMSA 2C8JA 2YUIA 3FOWA 4GWGA 3AU8A 4N5DA 4U4AA 1A8UA 3WFZA 4WXPA 7YASA 4UXIA 4F4CA 4DR1B 3T7SA 3ZIAD 3QVMA 2FVYA 1Q95A 3V8PA 3MHVC 4FZRA 2ZZKA 4NL4H 3LHDA 3QZUA 1Q0QA 1QCYA 4PNHA 3ER6A 5G0TA 5T4EA 2ZTVA 5BV2P 2H7XA 1NVAA 1Z4MA 2PLNA 4KLZA 3I45A 4TTJA 4BO5A 3HI6A 1MOSA 5L8VA 1M8FA 3V42A 5JJKA 4HRXA 1YXMA 3FTDA 4LDAA 3PR2B 4LFCB 3TNJA 2PLRA 3AVWA 1TW2A 1KI6B 3VJRA 4XOUA 4RORA 2OGWA 4N0EA 1N92A 3TZ6A 4CU2A 2FWRA 1EQAA 1EUDA 2QNJA 1BYIA 1SPBS 1YC5A 1KFKB 2BGIA 2B98A 4KQFA 3HZRA 1MR3F 4MCJA 3L0YA 2GCOA 1EP3B 3D2CA 1HQYE 1PGOA 2GTPA 3IE2A 3MJCA 3N2LA 5CP8A 3AVQA 1FX0A 1V26A 2NWQA 2WIKA 3ZY3A 4YBRA 3SR0A 2VH5R 5KOYA 4MX8A 1T36B 2VATA 1L5ZA 1DPGA 2XMRA 1O94C 1BH6A 1T5IA 3ICVA 3AHGA 4OQYA 5C80A 4MS3B 4X8HA 3AKDA 4RVUA 3CUKA 4FMCB 5BSUA 3RT1A 4HQNA 3TK1A 4DV4B 3A9RA 1VIYA 3K0BA 1RI5A 3Q5EA 3ETDA 4PXSA 3TOZA 3VGJA 4HEOA 3VR5D 4A92A 2XTAA 4CCSA 5L3SB 2QNBA 1KP2A 1NQUA 5E8JA 2QJTA 3ZKWA 4B80A 3I2KA 4GLLA 2ZWOA 3MWDA 3KPUA 4UEOA 1AKEA 1W4AA 2V7UA 3R20A 2HA0A 1L7OA 4LYAA 3IVMA 2P2ZA 3PE4A 4LNUB 3H87A 5IFKA 1NPTO 3UC5A 2VJQA 1WETA 2UUCB 4XI9A 2FRDC 3BHJA 4OQLA 1XTQA 5HIAA 2P9QA 1P2VA 4C6RA 2J3KA 4JC4A 5JD4A 5AI9A 1K9VF 2QD5A 1QQBA 4P6VF 4KHPB 4DMKA 4KHZA 1USKA 3WL7A 4KQ9A 4QQ8A 5AW6A 3Q1KA 1O8BA 1AS2A 3TLZA 4P81A 4RD6A 4YI5A 5A1JA 4MZDA 4IFEA 1TU0A 1RRVA 1M2OA 1MB0A 1MPTA 1X7YA 2SBTA 3OZTA 2JRLA 2C7OA 1KPGA 2WHRA 3QNMA 4FWGA 2DY1A 4ZPJA 3RVSA 1GKIA 3BXFA 1F9AA 1R0CA 1JWBB 1Y8RA 2NYAA 1Q3BA 2FE8A 1KH2A 1UM9A 4JXKA 1EZ1A 4IIFA 4FB4A 1Z83A 3W5IA 3NVAA 1TU4A 3A7EA 1Y1TA 4PNZA 2FNAA 3M2TA 4E5UA 4EIWA 4Q9NA 4R1UA 1KORA 2HRRA 2HA2A 4W5NA 1GQYA 2J3DA 1D0LA 1N36M 1S4MA 1XTRA 3OE4A 1Z0FA 2LE0A 3PQ8A 4N7BA 1VE7A 4E5KA 5MDHA 4KP7A 1N32B 1K8QA 3DP7A 3FAZA 4UAVA 2A5FA 2G7MC 2EG5A 4CUZA 2EIXA 1P0FA 4CLXA 4KITB 1RJWA 3VC7A 4B82A 5KI6A 1XALA 1Y7HA 2KQUA 5ICGA 2HC9A 1VEGA 1EQUA 3E9YA 3SJ7A 3HCEA 4INOA 5J63A 3HB9A 1KDRA 4AG5A 3P9CA 4TN5A 1W85B 4Q1DA 1N5RA 4MB7A 4JWKA 1ABFA 1G6OA 5BVGA 5FOQA 3DAFA 4ENTA 1KMMA 3FW1A 3KSRA 3WWPA 4CGYA 4C2TA 1UBCA 3PXCX 4I2NA 5T8KC 2BFNA 4FW9A 1KGSA 1M3SA 2Q41A 2QRLA 3EXFA 3L1KA 1RPAA 3TSYA 2Y66A 3ESXA 4DBZA 5JQWA 4DCNA 2WVGA 5GJVC 3OESA 2B8JA 3WX0A 5C52B 4ZVOA 4ZN6A 3L7LA 4X97A 1MU5A 3BAZA 4WZBB 1KIAA 1B1AA 2ZWMA 4CFYA 3D7NA 3LT1A 4YMTA 5EKSA 3AF2A 3B85A 1GGNA 3TOVA 2ONCA 1SKAA 2IF0A 4HKTA 3W5UA 4EPXA 1ZR2A 2LVPC 1D2MA 1DX9A 1JIKA 4LZWA 4GNKA 4PRZA 3UMSA 1DVRA 5CM8B 3L7DA 1MC5A 1U6KA 4QU8A 3TTYA 1E3QA 3DW1X 1Z5OA 5SZHB 4CKBA 4EHKA 4EJSC 3OLQA 1Q1ZA 3M5CA 2DWQA 5ERXA 2RBGA 4B6RA 1SOWA 4GKBA 4RY0A 4ZQFA 2C03A 2A4KA 4M0PA 1NG1A 1AA9A 2DWMA 1CUJA 4ZEOA 3OOSA 1X7ZB 2PX3A 4QEDA 3RD5A 3ZN2A 3UH0A 4NOLA 1IOVA 4UHDA 4DLBA 5G0SA 2XTMA 4RSHA 1R2QA 4QTYA 1K7CA 3R77A 3PSHA 1HL3A 5JSFA 3VU3A 3CPHA 2HWJA 3ZQJA 2ZI3A 3UWOA 4DLAA 4R01A 1JJAA 4MULA 5KB3A 1MU0A 3LU1A 2C0QA 1LF0A 4YRZA 2QT9A 4K40A 3TGLA 4F93B 1P39A 3PPXA 2GJ8A 2F4VM 3T5BA 5GKNA 1PL6A 5EP4A 1RAAA 2NVUA 3BRCA 3EXAA 4LEIA 4YAWA 5J47A 3E27A 3LX6A 3FUTA 4KU4A 4RHEA 2O2IA 1OHHA 3J27B 3CX8A 5AHOA 1XQ1A 4EZIA 4TL6A 1V7PC 4BHTA 1IYZA 3R4VA 5JSHA 3SZLA 5NULA 3WZ2A 3WGUA 2PUHA 4TL7A 4EK9A 1GYRA 3AERB 2QN9A 5EJIA 4MP8A 1IBMM 1Z8HA 2HSEA 2WW8A 4I3FA 4UZSA 5KYWB 3RI3A 1NNEA 1G18A 4MDEA 3LDGA 2FJ0A 1H66A 1ZONA 3HYRA 5G1NA 1RWBA 2YJGA 4RSMA 5JZ9A 4JI4B 1KO5A 3QVWA 2PKRA 4ANRA 1CEEA 2XUHA 4FONA 2JIQA 2QUAA 4JUAA 3V33A 2O8DB 1FNNA 4GI5A 2JWSA 2HPAA 3V2UA 2PUDA 3OLYA 2CMKA 2F3PA 3FYTA 3NRJA 3O5AA 4AO7A 4JT2A 3H5TA 2FEWB 2CD9A 5AKHA 4E4RA 4AZ0A 4BE9A 2NZXA 2C92A 3H4VA 4LDJA 2O4UX 1HSZA 4M0UA 3M5DA 3D31A 4X65M 3L8YA 4JELA 5CITA 2M6SA 2VG8A 1EE2A 2ZVJA 1OX4B 3LWZA 2H65A 4XQ0A 1CFJA 1L1TA 5A2QS 3HMKA 3JZDA 2J4DA 4E1AA 1AUOA 3ORRA 1AX9A 3GUZA 3LKDA 3RUCA 1TLLA 3UWKA 2Q3MA 1E2JA 1E9SA 4YAJA 3FOCA 2WWGA 2EL9A 3OURA 4IHKA 1ORTA 3MT9A 3U6LA 5LR6A 3JQ8A 2JFNA 1E64A 3DCJA 3EFOA 3L9WA 4B5KA 4F04A 2P8JA 1DTWB 1G3QA 5ITXE 1EUQA 2PS1A 4P3XA 2M60A 2BPOA 1PJCA 3KR1A 4TS4A 4KFCA 3L6CA 2EG9A 4C0XA 2HTEA 4JU9A 3C5VA 2FUCA 2P9TA 3NAGA 3KSBC 4N8EA 1A8SA 2P6PA 3KC2A 2IWHA 4E14A 3A1VA 4HTAA 2YR0A 2ERYA 2X76A 1ZNXA 3RF6A 2EFJA 1V4NA 1YRYE 1NPDA 2GBLC 3OCCA 4WT7A 1ZOPA 3LC0A 1QKIA 2FFJA 1M6VB 3NH6A 4FT4A 5DNYB 3KT8A 1CY0A 5ALSA 4EABA 1X0XA 1FPQA 1V8OA 5EIEA 2FR8C 4D0LB 4RTJA 5JPDA 5C1OA 1G8YA 4P36A 1PT5A 5JVDB 3S28A 1N75A 5BSWA 4DTCA 1H93A 1AGXA 2ODPA 2CNOA 3NXKA 3THOA 1ZESA 5C1BA 3QKSB 3EEOA 3RJTA 5ESXA 1A9QA 4LRUA 4LXUA 1Y3CE 4NHEA 3HO1A 4YJ2B 1KI4A 1NE2A 1FJ2A 2ZW9A 3L02A 2K87A 3V3KA 1F9EA 1PS8A 4OHRA 3VKHA 1H85A 2RKBA 2OZVA 2OFFA 3H1EA 3CLUD 1JQAA 1YR7A 3FNBA 1BHSA 1QYVA 4L9WA 4AJPA 3L0OA 2WDZA 1QG4A 3WRYC 2GN2A 3SDZA 1Y7LA 2C54A 1IE3A 1KS9A 4RETA 3N8IA 2HSWA 4BUZA 4RPCA 3HXOA 2CYBA 3HPRA 2IBTA 4WN9B 1T5OA 1XTPA 4R9NA 1SULA 1KIFA 3OPYI 4E21A 4X1YB 1RMTA 3JV7A 5LMCA 1UPTA 2E85A 2QZSA 3FUXA 1CNMA 2CHFA 1TGVA 2CKMA 3PDIB 4JN6B 2GPSA 3F92A 4JEMA 1W2HA 3DMRA 4CKEB 4WJLA 9LDBA 1Z8NA 5DNUA 5MF6A 2GAOA 2Q1SA 4G1FA 2DZOB 2WF6A 2QZ4A 1X80B 1ZH8A 4LHWA 5FO1A 1S7GA 5LDGA 2VQEB 2FZEA 3KEMA 3V1TC 2V5VA 2GPWA 3EZYA 3TECE 5DV9A 3CUTA 3Q11A 2NW6A 4L8VA 4UUPA 1L9XA 4NPCA 1V9SA 5JATA 2EERA 4KQ6A 5M7EA 4RIEA 4Z86A 4H0FA 2YS7A 5K4AA 3AFMA 3GFFA 4YRRA 3OJWA 5K2MA 2NNWB 4ES6A 3SC2A 3SFTA 2Y20A 2D00A 1AUXA 4X71A 2B3TA 5EE0A 4LVUA 3RSQA 1G2QA 1W94A 4HX9A 1ODTC 1P7YA 3KOUA 1CQJB 1IG0A 5DW0A 4QT0A 1ULHA 2VPPA 4I99A 1UJ2A 2VDOB 1TT5A 1M2VA 5ALQA 3IAM6 3ITNA 2OHXA 4RY8A 1INLA 1USVA 2EKZA 3B9RA 3U7HB 3ZXIA 4D3DA 3ML1A 1Y3FE 2VXCA 3PUHA 4R9RA 5FBQB 3ZLVA 1C0IA 1GGEA 3KJNA 3U4GA 2OCGA 3VTFA 1QQAA 2VDJA 1TZ2A 5E26A 3KHKA 5LL6P 4JKOA 4OQ4A 3PS9A 4GMQA 3KKLA 2I7DA 1PLKA 2V4UA 4U7TB 1NBMA 4GU5A 2Z98A 2DQZA 3PC7A 3I9KA 1WU7A 2KPOA 4JU8A 3G0GA 2V3CC 4PDGA 1P1JA 3D3JA 4PPQA 4RA6B 1FQKA 4OGLA 3V80A 3O75A 3FCYA 2FSSA 3AU9A 3F6EX 1YR2A 1AZWA 3MGKA 4NNJA 3OCXA 1BIFA 1T9BA 3RAFC 4MDHA 1ZITA 4LYHA 1QGUA 3OEEA 3UNXA 1B3BA 3IKMB 1D6SA 1EZ4A 1DOHA 1NHGA 1OT5A 1ESDA 2YWBA 1CIPA 1AB6A 3LVBA 3I0NA 4EBFA 4YN3A 2DKFA 3LKZA 4QJ4A 1EFPA 2AHOA 2CFTA 1FSFA 1N0WA 2ZE6A 1U1EA 3N2GB 1KY4A 5JDCA 3SC2B 1TQ2A 5BWBA 5F23A 3B1JA 3BCSA 2QSFX 3PFNA 2VAPA 4FGJA 3M6VA 4DPMA 1BX0A 1EIWA 1QYDA 2NUPB 2VHXA 3FVRA 1OR8A 4OMFG 4PY2A 5BSKA 2N46A 3CLVA 4PYRA 3S68A 1NBAA 2Q5QA 2FG7C 2DWNA 1SWVA 2BKAA 3I0ZA 3U7EB 4PW0A 2RHTA 4CNBA 4YQFA 3VZRA 3CVXA 2IXEA 2GM3A 5ECDA 1G2OA 1K08A 2XYPA 1YMVA 4AIRA 2AF3C 3Q0EA 1RKXA 2KXEA 3THWB 4EY5A 2ZROA 4QREA 4TWRA 3WSTA 5CVEA 3RK4A 5HQTA 4DR7B 1ORHA 4TTQA 3ETJA 3WKBA 2L2QA 1U7PA 4I3HA 1Q57A 5IFLA 4K0KM 3PQ7A 1IL0A 3JWEA 1O5TA 2J48A 4K6HA 2MOKA 1J8MF 4P4NA 1QPZA 2O8NA 2IYLD 1Z5WA 3IODA 4F71A 5BR8B 3IOCA 4K1XA 4QUHA 2ZPTX 4CLHA 1TMOA 4TXLA 2JZCA 3L4KA 5REQB 1U9YA 3LI2A 1CG6A 1W52X 2D13A 2QB5A 3D8SA 3BORA 2P9ZA 3FKSA 4JGGA 3V4VB 3W5CA 3VKVA 1WMAA 1KVSA 3TINA 1NFRA 4AS3A 4FFRA 3VYTB 4WP2A 5CVTA 4FCTA 3V8EA 1NLFA 4V0KA 3T3HA 1R7RA 3DO6A 3FWPA 2D5AA 2XVAA 1CPYA 1Y0BA 2ECKA 2V74B 1X74A 4PFKA 4X6YA 4G09A 3SNKA 1NN1A 4B4DA 4AQYM 4JP8A 2FJUA 4WCFA 4AROA 2VJBA 3PKJA 3OOHA 1GTMA 1Q22A 4BO7A 1SCAA 2K7ZA 1C4KA 4Q6BA 3VO1A 3TKYA 3C16C 3L79A 3R6WA 2XOXA 3RHTA 1QGDA 1PZEA 2YJZA 3OZXA 5A4JA 1UXKA 2ZSUA 1CIVA 4M1QA 4Q03A 5GADl 2HM7A 1FNCA 1XPJA 4HH3C 2HPVA 4P82A 2C9ZA 4FFOA 2A0YA 2E49A 3HCAA 4OLAA 2CL5A 1QE0A 4AX4A 1H6BA 1V39A 2P68A 1LC0A 2BHLA 5AVUA 1EDEA 3I01M 2R7MA 4DLSA 1LA2A 1H3FA 2HGSA 2RHOA 1XZIA 3LY8A 4QFBA 3LCRA 4R1PA 4U02A 4YRJA 2GI4A 2ZRKA 3QMWA 2WYUA 2ZE8A 1MTZA 3GAAA 4X20B 2C77A 4QPNA 3A46A 3RBVA 1K8YB 1QVRA 3DPUA 3J7AC 1UPUA 2XWSA 2P5SA 1GA4A 4JQSA 1MJ5A 1NVVR 1EI9A 2V6JA 3C15C 2PSFA 1TT5B 1MH9A 2AVNA 1QBGA 1QYWA 2IUUA 1NQOA 2NXNA 3H5IA 1QRRA 4QHYA 4HGZA 3KLPX 3LQ2A 2DTEA 3LT4A 4X66M 1NVUQ 2EFHB 3DCIA 1E0JA 2ZSKA 4DIMA 4MPJA 5JAHA 3L41A 3BFXA 3FDJA 2RMKA 4G0XA 3Q7TA 1UADA 3AFOA 5K0NA 3U60B 3KQQA 3Q5GA 2WM8A 5J4YA 1BCSA 2ZXUA 1CUZA 3QU2A 4KL8S 4UATA 1QTRA 4ZCTA 2J7PD 5FTJA 4KFUA 1Z6PA 3RBZA 2H1FA 2Y1OA 2ZZMA 3C4QA 3E5MA 4ZVNA 1OZGA 1MN6A 1LLDA 2JCBA 2H1IA 2K2QB 1E3SA 1H5UA 2EJWA 3GEEA 2AN1A 2PMWB 3HMQA 1PJQA 4LZOA 4MWZA 2H5LA 2OVFA 2P40A 3ZX4A 1C1XB 3UC9A 3HFJA 2DMRA 4LVOA 1U1IA 2C4KA 2HB6A 4MHOA 4TX1A 1UBHS 1ESNA 4H1TA 3W8NA 1C1KA 1EB8A 2XYRA 3KZXA 4D4JA 3A6JA 5B57C 4GMHA 1BWQA 4NYIQ 4GC5A 2PL5A 2EJCA 4TWJA 3WGMA 1AO3A 2FZLA 1JS1X 5HX7A 3K72B 3I8OA 4YRAA 3ZHOA 3T38A 3S2UA 2W58A 2HY7A 4RELA 4URZR 4LF8M 1J07A 4FOSA 4KB5A 4Q4HA 3BSFA 3DFUA 2QSJA 3R7WB 3HJUA 2BFPA 1DC6A 1YI8A 3DZHA 1C7QA 5TEWA 1BE0A 1OIVA 2OORA 2Q8QA 1ZGGA 5L53A 2WQ7A 4KN9S 2H00A 4GMXA 2GNOA 4DRXA 4JXJA 4S12A 2CKDA 4II7A 2GD1O 4UNSA 1IUKA 1WCIA 4YRLA 5DYTA 1DG9A 1T8WA 1BU8A 1HT0A 2F43A 2JK0A 1LSSA 2C99A 1R4MA 5B58C 1N6HA 4PO8A 4ACBA 2ZSAA 3H86A 4FS3A 5CMLA 5ECYA 4EW6A 4XAQA 3IBYA 4EW2A 1CJCA 4MUMA 4Y2JA 3WB9A 1VLVA 1TIBA 1UKZA 4LJ5A 2AFIB 2I6QA 4Q93A 3WL8A 4F2PA 2PZAA 3BE8A 2QLJA 1SVOA 4PAGA 3ZI4A 1C30B 1D0VA 4B34A 3H0EA 4CM4B 1RYZA 1NV9A 3FNQA 1ZN2A 3PA8A 1M2JA 2J09A 4BY9E 2IUFA 4KEAA 1BN6A 1TK2A 1OBOA 1Y9ZA 2G1UA 3TVDA 4O63O 1XHBA 2V4ZA 3A05A 1ZX1A 2W90A 3GUCA 4GE0A 3TFWA 4B87A 4Z1MD 1GUYA 1MEOA 5I7HA 4PD2A 4B3XA 1EEHA 1NUPA 2ZU0C 3EBPA 3NV9A 1NVVQ 1QVAA 3KZVA 3NU1A 3D0QA 1O96A 1KI3A 3MELA 1YRQA 3DPSA 1CUFA 1MAUA 3KUXA 5HUJA 4NJEB 3LTNC 1EFAA 1QZEA 1EM8A 3I12A 2P4HX 4G5GA 4PVDA 4Z0TA 3TCXB 4EF5A 5F2EA 2DPLA 4IIYA 2R48A 2WYIA 3PT9A 4UHBA 3ZR4B 1RBMA 1FDTA 1O03A 2ADMA 2W2KA 3GDHA 2UYYA 4LYJA 5AKXA 3A1SA 1YSYA 4K9LA 2C2KA 1L5MA 1TW3A 1USIA 5BMVA 3R3VA 1ZIDA 1Y3HA 2JVKA 4URXR 4Y2VA 2BGTA 4TN1A 4MAMA 4JAVC 1SZDA 3LQ1A 4NAHA 3IS3A 4AM8A 2B5OA 3GRCA 3L0IB 4WOPA 4E5YA 2VJCA 1G7RA 2FUG6 2JLRA 3DDUA 3WMFA 1D03A 1YK0A 2JGNA 2Q1UA 2DBRA 3E4CA 2JBAA 3G88A 3Q6NA 4LDZA 3BQMB 4IDQA 3CTMA 4D0SA 4YAFA 4QODA 5I01A 3RANA 4DV3M 1XVTA 1V48A 2RHWA 2XH8A 1IHPA 3KX2A 2EO2A 1EFRD 2F8MA 5C7IO 1OLXB 2NQ8A 5K0LA 3THSA 4R8LA 3NKVA 1H6UA 2MGWA 3A3KA 2KEBA 2EZ4A 3UEOA 1EVQA 1TPYA 2RGGA 3OECA 3IT1A 4OHVA 1FS6A 4FHDA 1DDGA 1U0EA 3HSYA 2AOXA 2GZMA 4LXQA 2V3VA 3W5VA 3ABSB 5CD9A 5EJ5A 2PY6A 3EMBA 1Z18A 2BRUA 5KKAA 3TTWA 1YA6A 1W5AA 3FOAA 5EKDA 2DVMA 3V4LA 2YWGA 3IT0A 4YO8A 5LIPA 1VG5A 4CI0B 1WKBA 1YR1A 3TTUA 1ISRA 3NPMA 3VNVA 1IY8A 3JWHA 3NETA 5AUQA 4L57A 4CR6A 4JC8A 1NHGC 4ND8B 4NS4A 1I10A 3KXPA 4MV3A 3AEYA 2I29A 2BBTA 2ZDQA 4MUNA 2R47A 2D74A 4QXRA 3ADKA 1NURA 3C97A 4PYJA 3EPPA 3LECA 4L5BA 3OSUA 4WD3A 1JDPA 3LP8A 3E3AA 4JBWA 4GHAA 1IONA 1XE3A 4PONA 4EARA 3BPSA 3IP5A 1KK1A 4RZ2A 2HBRA 2JPDA 4DADA 2HFJA 4S1VA 1R8XA 1VHDA 5SZJA 5I4CA 4FUTA 4RD1A 2NU6B 1P9LA 1N25A 1PQPA 2O0JA 2FEKA 3EIHA 3A0RB 3BS4A 3CH4B 4PNPA 4X44A 3ZU4A 3GH3A 3IVRA 2VHYA 3SAVA 1CJMA 2EARA 3DMDA 3KRTA 4MIYA