3FYDA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fydA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fydA01
4E2XA 5EOVA 2WK1A 2JH9A 2YX1A 1AV6A 1L3CA 4PNEA 4X61A 3MTEA 3LDGA 1I1NA 5KYGA 4PWYA 5DX0A 3RW9A 3SGLA 3C3PA 5EVJA 3DR5A 3F4KA 4X60A 8MHTA 5LSAA 4ISCA 1EQAA 4CTKA 3I58A 3LCCA 3FPEA 3UFBA 3TKYA 3I5UA 3EVFA 5EMJA 1HNNA 1NE2A 1PJZA 2QY6A 3G8BA 5EMMA 2GH1A 3UJ7A 5EEHA 2H1RA 3A25A 1N7IA 2PXAA 2QM3A 3P9NA 3AY0A 1XCLA 5GOZA 4Y30A 3FUVA 3BGIA 2E5WA 3NJRA 2I9KA 2GS9A 3GRUA 4MHTA 2ESRA 1JQ3A 4OBXA 4BP1A 4ER6A 4MQ4A 2P1DA 1G6Q1 2PT6A 4E2WA 5EC8A 4GOND 7MHTA 3KPUA 2AOTA 3ELUA 2OPBA 1RJDA 5KQSA 2K4MA 4OA8A 1JQDA 4RYLA 5BW5A 3LBFA 3TOSA 4HGZA 1EG2A 3I9FA 3FPHA 4H0NA 4P7KA 4PYIA 2ZIEA 4X63A 5EIFA 1F38A 1DUSA 2NXCA 1FJXA 4RVHA 1XJ5A 4KVZA 3T7RA 3KQWA 4DCMA 2AOUB 4AUKA 3G2QA 4DMGA 4HH4A 1SUSA 2JHAA 3B5IA 2VDWA 2XVMA 3DMFA 3KPVA 5GM1A 1NV8A 4V0QA 2WA1A 2ZIGA 2VZ9A 1FBNA 2CL5A 2P40A 2CMHA 2O07A 2P8JA 3G7UA 1VQ1A 4GUAA 4ER0A 5K0FA 3FYCA 5LQJA 4RSRA 2IH2A 1L3BA 3KQYA 3B3JA 3CCFA 2OKCA 3MTIA 3GU3A 1G60A 2BR3A 2ERCA 4C04A 3GNLA 3P2KA 4KRGA 4AZTA 5B1SA 3FZGA 4XUEA 2YUIA 3B3FA 1EAMA 1EJ0A 2XYRA 3M4XA 3KKZA 3HA5A 3HCDA 2NNWB 4P58A 1AQJA 3UA4A 1Q0TA 3FUTA 4WXHA 3EGVA 3MGGA 1QAMA 1NW3A 3E05A 3ME5A 3P2EA 2OO3A 4PYQA 4RTMA 2UZ4A 5HFJA 3LBYA 3UJBA 5CM2Z 5DTQA 4BY9E 3M6UA 2G70A 1RI5A 3KQOA 4GOOD 3A27A 1WS6A 2EJTA 4LWOA 1TW3A 4OQEA 4U7PB 5LQNA 3GRRA 2UYQA 5E2BA 4IKPA 2HV9A 5K0NA 3HCEA 4FT2A 2YR0A 5DM2A 1R8YA 4KDCA 3UJ9A 1F3LA 3FTCA 2BM9A 2O57A 2P41A 2QYOA 5EMKA 4E70A 3IEIA 3T0IA 4RTOA 4MTLA 2CWWA 2OY0A 2VP3A 2AVNA 4GBED 3X0DA 5CCXA 5E1OA 4ER3A 1XXLA 9MHTA 3DOUA 2PLWA 3QOWA 4YV0A 4FZVA 1WXXA 3HNRA 2GB4A 4HSGA 4RTLA 1X1BA 2IH5A 2Z6UA 1BC5A 4KW7A 5GP1A 5ICFA 5FQOA 2BZGA 3DMHA 2PX4A 1VL5A 2AOWA 1RJEA 3KQQA 3OE4A 3R0QA 2LD4A 1R74A 5F2KA 4GEKA 2I6GA 5EEGA 3DULA 2R6ZA 3JWHA 3SR4A 3KQMA 2FYTA 2AN3A 1XDZA 1P1BA 4R6WA 2FK7A 3B3GA 3MB5A 2ZWVA 4F84A 4XUCA 1NBIA 3BWYA 3NW9A 5BXYA 4V0RA 5K8VA 1KYWA 4X1OA 3UWPA 1DL5A 3OFKA 5EZQA 1UFKA 5E8RA 3NWBA 1ZGAA 2Z6QA 1JSXA 3OU7A 1KHHA 5GM2A 2PX8A 5GINE 10MHA 5ICGA 3ER8A 1SQFA 5KVAA 3FYDA 4RTJA 3BKXA 4EVIA 5ICEA 3K0BA 2P7HA 5DSTA 3SX0A 3NWEA 2AOUA 3CGGA 1X1AA 2JHCA 4MWZA 3V97A 2EG5A 3A7DA 2NXNA 5LQRA 3AWIA 5F2OA 3HA7A 2JG3A 5EHIA 4M38A 2FRXA 4C03A 4GOLD 1SUIA 5K0EA 3E8SA 5T67A 1YFLA 4RVDA 4YUZA 3UJCA 1ZKDA 3JWIA 4QPPA 5FULA 3S68A 5LQKA 3V8VA 4AX8A 1N2XA 3M70A 5HIJA 2PGXA 4QDKA 2NXEA 2XVAA 2GPYA 3KPWA 3C6KA 5FHRA 3HA3A 4PCLA 2V7EA 5DXAA 5D1NA 4F86A 3DMGA 3A7EA 5FWDA 5HIMA 1XVAA 3PLAE 5E1DA 3VSEA 1X1CA 1EIZA 5LQCA 4X41A 3T7SA 3PTAA 3GIWA 5EIWA 4C4AA 3P2IA 1L3IA 2KW5A 5KS2A 2ORED 1NKVA 4AZSA 4CKBA 3KPJA 4P7JA 2AS0A 3SSNA 4BLWA 4BP3A 5KQRA 3NVKI 2ZBRA 3EVDA 3UZUA 3GO4A 2OXTA 1YZ3A 5HOQA 5HILA 5K0LA 5CVDA 1P91A 3AJDA 3EVZA 2UYOA 3PFGA 3PX2A 5F2NA 3D2LA 3THSA 4PYLA 4A6DA 2NYUA 2ZW9A 4CTJA 1MJFA 3BGVA 2PVCA 4IV8A 3HVKA 3LGAA 3EGEA 2HNKA 4PYMA 4A6EA 1KPHA 1PRYA 5DRTA 1WZNA 5EKUA 3UBTA 1IM8A 3JWJA 1FP1D 5DRYA 2EX4A 2Q41A 4R05A 1Z3CA 2ZIFA 3LKDA 4E31A 4RTSA 3O7WA 3OZRA 5DWQA 3SSMA 3I64A 3BWMA 3HVJA 5M5BA 5DX1A 3MAGA 3ORHA 3TMAA 2C7RA 3GDHA 1XDSA 5ERGB 3ER9A 4OBWA 3P8ZA 1NW7A 5E9JA 5FHQA 3TKAA 2C7PA 3KQSA 4QTTB 4QTUB 3CBGA 4RTRA 4CXMA 5JR3A 5K0BA 3OFJA 4PYOA 2P3QA 5C0OE 5LQAA 3FTFA 2XBMA 2C7OA 1G8SA 3G8AA 2ONZA 4DZRA 5DTMA 1YFJA 4AZWA 5GIPE 4PYJA 1XCJA 2DULA 2YVLA 1JQEA 4U7TB 5C9ZA 5HIIA 4PYNA 5U4XA 5GIOE 4DKJA 2BR4A 1L1EA 1OR8A 3HVIA 4FR0A 4YMGA 3BT7A 5P8WA 3G5TA 2B3TA 2IFTA 3EGIA 1X19A 2EJUA 2YXEA 5CIYA 2UYCA 5K01A 2V74B 3DH0A 2NP7A 2ZVJA 3EVGA 3R6TA 2ZLBA 5MHTA 1QANA 3EEYA 2NXJA 1L9KA 2JJQA 5T64A 5EMLA 2OBFA 2G8NA 2F8LA 1VP3A 5DXJA 3G2OA 3PS9A 2QRVB 4EKGA 4QDJA 1G8AA 3A26A 5DT2A 2HR1A 3RIEA 2IBSA 1NW6A 4K6MA 2XYQA 4RV9A 4CWAA 2ZZNA 5EKXA 3KHKA 3LX6A 3O4FA 2PT9A 3DTNA 4YUXA 3PVCA 4QVKA 3R3HA 2ZZKA 1KR5A 3FPJA 3OCJA 4IV0A 4OX9Y 3PB3A 5EGSA 2IGTA 3E7PA 3HEMA 4FT4A 1B42A 4OA5A 3UJDA 4BLVA 5K09A 3DLIA 3L8DA 4CKCA 3A4TA 1XDUA 2I62A 3M6WA 3UJ6A 2FHPA 3KQTA 3P9KA 4YV1A 4RVGA 1Y8CA 2BH2A 1TPYA 2AN4A 5E8JA 2O05A 2IIPA 4OQDA 2VDVE 3KQVA 1BOOA 3R9XB 1NBHA 3KR2A 1I4WA 3VC2A 1YB2A 2ZCJA 2YXLA 3G88A 3GXOA 4RTKA 3EVAA 3GJYA 2ONYA 3R24A 3H2BA 4LG1A 4E2YA 2B2CA 3P71T 1O9GA 2ZFUA 3EMDA 5DTRA 3ELYA 1JG2A 2IH4A 1VIDA 2PWPA 3IHTA 4RWZA 1HMYA 1RI2A 4EK9A 1X1DA 1JR4A 2O06A 2R3SA 3TR6A 4M36A 2IDJA 2QE6A 1FPQA 2PX2A 1IY9A 3LPMA 4R8RA 4ER7A 4PIMA 2P3LA 2CMGA 2ZSUA 3LECA 3HCCA 4P7FA 3LDUA 1P1CA 1SVUA 2P7IA 3K6RA 5LR6A 2Z6AA 4RVFA 1MHTA 3BZBA 3IV6A 1BKYA 2AR0A 4JXJA 2CKDA 3KR1A 1I9GA 4KWCA 5DM0A 5H02A 3RODA 5DX8A 2G1PA 2IP2A 3FPGA 3SVZA 2A14A 3UJAA 1AF7A 5K0GA 2PX5A 2O0LA 3KR0A 3TM4A 3WSTA 4QPNA 5GWXA 4DF3A 5FA5A 4GQBA 3CJQA 5DM4A 3GGDA 1KPGA 1NW5A 3HM2A 3EEOA 1KXZA 5CUQA 1VLMA 4IWNA 1R18A 3ID6C 3G5LA 4XUDA 3FUWA 4E30A 3EVEA 3DXYA 4EKIA 1ZGJA 5E9QA 3EPPA 2PJDA 2EFJA 4XCXA 4YUYA 1JTEA 4BLUA 2ZWAA 3TRKA 4B17A 4KIFA 3SSOA 1UIRA 3OZSA 1VBFA 3LDFA 1IXKA 2VDUE 3AXTA 3P9CA 3DXZA 4DA4A 4PGGA 3TPZA 2VS1A 4NECA 4L7VA 5C1IA 4FP9A 3NDIA 2QRVA 4YV2A 2PY6A 1ZQ9A 3EMBA 3LCUA 3SMQA 3M6XA 3THRA 1FP2A 1KP9A 5IKMA 2PSSA 1VPTA 3E23A 2IPXA 3MCZA 1NW8A 1QZZA 2JHPA 2PXXA 2JH8A 4M37A 3PT9A 5EG5A 3BGDA 4Z2YA 4PIPA 1KPIA 3HCAA 2OB2A 4HRAA 3P97A 3MQ2A 5D1HA 5HZMA 5E9WA 3TFWA 4F85A 1ORHA 2XYVA 2B25A 5E1BA 1KIAA 3GCZA 4PGHA 3LHDA 4E32A 5DPMA 2P35A 5DSXA 3B89A 3BWCA 3O31A 1YF3A 3HCBA 2AOVA 1RI1A 1XTPA 1AQIA 5CVVA 4CKEA 2YTZA 3MHTA 1D2GA 4P7GA 3GRZA 3BUSA 1T43A 2GLUA 1RJGA 5HEKA 5EHGA 3ANXA 1H1DA 1UWVA 2H00A 3FUUA 1DCTA 3C6MA 4QVGA 4RTQA 3G2PA 5ICCA 5K03A 4FS8A 2OZVA 3CJTA 2PV0A 4PONA 3OU6A 4C06A 1VE3A 1R00A 2ZULA 5FA8A 3KU1A 3NVMB 3GRVA 4PINA 4DQ0A 2AZTA 4ER5A 1U2ZA 4KIGA 2AVDA 3HP7A 1EJ6A 5IH3A 1JG3A 3SM3A 4POOA 2UYHA 3DP7A 2YXDA 3EVCA 4QQNA 4Y2HA 2H11A 3TM5A 3FUXA 4FSDA 1WXWA 3JWGA 3G89A 1V39A 5E1MA 1VP9A 3PX3A 3OZTA 3IYLW 2PXCA 5K05A 5FADA 3HTXA 3DLCA 3REOA 3QOXA 4HTFB 1D2CA 2HWKA 1JG4A 2FCAA 5E2AA 2N47A 4AZVA 3CC8A 1D2HA 2B78A 2BM8A 3SXJA 2WA2A 4GC9A 3LSTA 3MCTA 2C7QA 2OYRA 3CKKA 3U81A 4PYKA 5LQUA 1SQGA 5CVJA 1O54A 1WY7A 3NTVA 4GF5A 4C07A 4E2ZA 2ZZMA 5CD1A 4ZTBA 5FWAA 3M6VA 4MIKA 4R6XA 3I53A 3LCVB 3G2MA 1G55A 4YMHA 1G38A 2G72A 2I7CA 1N7JA 1Q0SA 2BR5A 3Q7EA 4LECA 5DLYA 2HMYB 5EPEA 1R6AA 3ELDA 3UA3A 3FTEA 3NMUF 3TLJA 4C05A 2ZBQA 4DCGA 5CCBA 1ZHFA 2FK8A 2IDKA 5CVEA 3GRYA 2DPMA 4HC4A 5FUBA 3VYWA 2GA9A 2Y1XA 5K0CA 3AXSA 5K0JA 1SKMA 2AN5A 2PKWA 3OE5A 4LWPA 3FRIA 1SG9A 5G02A 1RJFA 1QYRA 2AOTB 3FRHA 3NDJA 5T6BA 5EZSA 4O29A 3Q87B 2PWYA 3DXXA 3MERA 5FQNA 3PFHA 4G56A 3HCFA 3T7TA 2ADMA 5FCDA 1JTFA 4M7RA 1KYZA 4UOEA 4QQKA 4EQZA 5BP7A 2YQZA 4EMSA 3TQSA 4FGZA 4GC5A 2NP6A 3OU2A 4E33A 3C0KA 3FPFA 4YUVA 2ZBPA 5DM1A 4C08A 4GOMD 4R8SA 3LL7A 3QV2A 3EVBA 1QAOA 5JUWA 3HVHA 1BHJA 1ORIA 3BXOA 1ZG3A 1INLA 1JG1A 4PCAA 2FPOA 1RI3A 1R8XA 2B9EA 2OB1A 4ATNA 3KQPA 1M0EA 1WG8A 3LKZA 4DM3A 2GAFA 3B7PA 4RTPA 5BW4A 1RI4A 4YUWA 1NV9A 1M6EX 1M6YA 2Y1WA 3CVOA 3GWZA 3P9IA 5CVUA 2P3OA 1TW2A 4RTNA 3C3YA 3VC1A 2ZTHA 4HG2A 5FTWA 1O9HA 1P39A 1YZHA 2PBFA 3KR9A 4FSXA 4KDRA 3BWBA 3ERCA 4HGYA 3DUWA 4WVLA 3BKWA 3OPNA 2HTEA 1YUBA 3CJRA 3M33A 2AOXA 3KPYA 4RX1A 1QAQA 1NT2A 3ELWA 3FTDA 5EQJB 2G71A 5HIKA 3UJ8A 2IBTA 1JSZA 4HTFA
chains in the Genus database with same CATH superfamily
3LXRA 1IHUA 1KGSA 1R4NA 1W5AA 1R2YA 2HHAA 1TVKB 3F5FA 5EMJA 4BXOA 2FUEA 1IQUA 1FQOA 1Z34A 4II2A 2W2TA 1G2PA 5GJWC 1OC2A 5F7OA 1J0DA 3K1AA 4P5DA 1LU9A 5TQJA 1EG2A 1D7OA 3E2MA 5CYPA 5FBVB 3BTUA 4LJAA 1G7RA 1AK9A 4GWGA 1UBEA 1OB5A 1X7ZB 3GZJA 3LA8A 5IMSA 4JK3A 4ZXPA 3VTAA 4IBKA 1AQJA 2AD1A 2YNMA 3PK0A 4LYHA 4B84A 4DA8A 5CM2Z 2J1LA 2XA1A 5J1SB 4Y28F 3NI2A 4PEVA 2QYOA 4E70A 4IGIA 4M76B 5E1OA 4KE9A 4FZVA 4ZT3A 2GAIA 4EG3A 4AJLA 2AJLI 5D6OA 1ZD9A 1PR1A 3A2KA 2HBQA 4P22A 3BQMB 4GD3Q 3PPIA 3RYCA 5D5HA 3AV0A 1E5VA 4KJXA 2ZYSA 4CGZA 4MINA 2P0AA 3ZWCA 3QKIA 3ESBA 3QU5A 5SV2A 1W36C 1FUKA 2I2WA 4DCJA 2JARA 2AI2A 2XVAA 3Q12A 1J7KA 3DFMA 2FSSA 3O8DA 2IYRA 4RZ2A 4LXIA 4FE3A 3NBXX 2JI4A 4HWOA 1ZUNB 4MAFA 3U6OA 3VOBA 5ESXA 1HX7A 1P6QA 2GPJA 2BI7A 1MAHA 4AJ4A 3AYXB 2C5AA 1F6DA 3W6UA 1KNXA 3DFKA 3L8HA 1B1CA 4WEOA 2OQRA 4F9EA 4KXXA 3DCYA 4PYOA 4XVQA 3IOCA 1J39A 3UTDA 1U3TA 2F1HA 2P91A 3RC3A 1ZESA 3HVIA 4CTNA 2UUPA 3U5TA 3KE9A 3MRXA 3AUXA 2KHZA 1UBMS 1MB2A 1YIAA 4OJYA 3SZRA 4R51A 5TVKA 5K3AA 4EY4A 3TL6A 2FOIA 4IDPA 3OOHA 4ED9A 1LLQA 2CLSA 3ESYA 3ASVA 1LK5A 3MFYA 1J5PA 3IO3A 3LNTA 2FZKA 1KZ9A 3CR3C 4U2GA 4PZDA 2JIRA 2IZ5A 2KWIA 3L8ZA 2GN2A 3GXOA 2HSZA 3ESXA 2A57A 2EF1A 1P73A 2QD1A 5DM60 2CXUA 4DAEA 3C41J 4MB0A 3AUUA 3SC2A 3KOUA 2CEKA 3FPSA 5EWMB 2V9CA 3RJZA 1U7DA 4XCVA 1GJRA 4QVIA 4O6VA 2RGXA 3HKBA 2HLPA 3NANA 2ZWAA 3SSOA 2TSYB 2VPTA 4KE8A 4G25A 3JQ9C 1Q95A 2PSSA 4PU0A 1WMBA 1RHRA 3N5KA 1N5MA 3AEKB 1R5LA 3ZYZA 2JLCA 3U7RA 3GCDA 3V2IA 1N7GA 3V1YA 3OT1B 5E0KB 1QU3A 3VH3A 3GGCA 1CY7A 4KB5A 4W1RA 1R00A 2C84A 4TYPA 1IZ8A 4FLFA 5ALKA 1MR3F 1VGVA 1VP9A 2VH1A 4CTMA 3KZVA 2ISCA 5LDHA 4NBWA 2FPIA 3R0VA 1O77A 4RJLA 2D13A 1U9CA 1MABA 1TZ2A 3AETB 3GEMA 4IS3A 2J48A 1KI2A 3N3BC 3F3SA 3TW8A 4EP1A 4EDFA 1V3TA 4EDHA 4KTTE 3PFHA 2O54A 4US0R 1T8PA 6Q21A 2XRYA 2Y0CA 4D3YA 4ALIA 2DM6A 1NV9A 1MN6A 5ITRA 4TV9A 3T7IA 1UC5B 1ZJZA 1GTL1 4J9VA 4TLEA 4JI8B 2LNDA 4WAUA 2GZDA 5F33A 1D6SA 3LHIA 4G07A 1YRAA 4CDRA 3H1PA 1AQUA 3LDGA 3K6KA 4GBJA 4S12A 1VGRA 4AQDA 3HN7A 2HK6A 4A3VB 4FEAA 3MBIA 2B7LA 3VNBA 1XD2B 4Y8VA 5TMBA 2OFPA 4FFPA 3PEVA 2WJ3A 2OPFA 4A0QA 1ZICA 2HJ9A 5FBZA 3QHQA 2VTKA 5HNKA 2ZRPA 4RHXA 3Q8MA 3EIOA 2HA2A 5HZGA 2NU7A 4RGYA 3ANYB 2HRCA 3A6PC 2DUNA 1KY5A 1HR0M 1TYBE 3QE3A 4CPDA 4H31A 3DTVA 4D4HA 3K94A 4YMTA 3CH5A 3E18A 1XPJA 4AJKA 3TGWA 3D1JA 3WWDA 3EX7C 2W6MA 3LWDA 2VP2A 4E3ZA 4KSCA 1DFHA 1QRSA 2PVPA 3NW9A 2UXCM 1MCZA 1BXRB 4GEGA 4N9QA 2GSDA 3MCWA 1AB6A 4P36A 5B1HA 2DBZA 4PLHA 3FNFA 4ENTA 1V0JA 2XCRB 7REQB 4CQLB 2NXEA 1XL0A 1A97A 2QRUA 3IHPA 1XEWY 2ZTMA 3AEZA 4XAQA 4QGBA 1G4HA 1B0UA 1BIFA 3FLEA 1V2HE 5JAZA 5IZCC 4NYIR 3EVZA 4MULA 3ED5A 2REXB 3G0GA 1DC7A 5KYYB 4M1ZA 1Z3CA 4ZT2A 3JQBA 3JAWA 4JEHA 4CJ6A 1ZJJA 4MA5A 2COKA 4LFBM 2RBGA 1YHYA 2ZJ2A 3H1FA 1K8YB 5GIOE 2IFTA 2CNNA 3OP4A 4UM9B 1AXEA 1J2RA 3HN6A 3LP8A 2ST1A 5EMLA 3DVQX 1OLXB 4OU5A 2QB5A 3D81A 3LX6A 3VZRA 2MSCB 4LHYA 2HSGA 3T5MA 3WBBA 5DASA 3F4LA 2YJTD 5E8JA 2O3RA 5D3ZA 3R7AA 1EE1A 1SEPA 1AS3A 2JW5A 5CYOA 4XSVA 4BDTA 4M36A 2WKPA 3Q41A 4D0LB 5LWHA 1IEXA 1U8EA 3SNHA 4OAQA 3TTVA 1QC5B 2W2OA 1YKGA 3KR0A 4JEMA 1KS2A 4JJGA 3GUYA 1N6KA 2BRUA 2OQVA 4Q1VA 1U99A 1TTHA 2OZLB 3TOCA 1HJPA 4A8PA 1N1GA 4G4NA 1WR8A 4UFPA 2AXNA 3HO8A 2Y21A 4DV3B 3O1IC 1NVVR 1LTQA 4EG0A 4PIPA 2X22A 3W9UA 4FFWA 4HLQB 2Q46A 3U6LA 1FSGA 3OF2A 1QGAA 2ECFA 3WLKX 3VKFA 3FCEA 1ZCZA 4QO8A 2PUCA 5KMGB 4I9UA 4UNIA 1QOPB 2CNLA 2QTVA 4BVJA 4FMPA 3T52A 1GO5A 3SHWA 1JZQA 2DKOA 2XITA 3QE9Y 1JVBA 4DRXA 4ZO8A 3UOGA 3ST7A 3OLZA 3GLTA 3U48A 3MS4A 5JS7A 3DBLB 3N28A 3FNIA 5KQLA 1UBNA 1W59A 3QHPA 3MPUA 1EI9A 1X7YB 4G2NA 4IR7A 3DB2A 3KOYE 2BONA 2RH5A 4M8KA 1J00A 3L4BC 3IBSA 3G0HA 4HGYA 1YUBA 2AEFA 4U00A 1QNLA 5B1DA 4LPKA 1AV6A 1T29A 2QRQA 5CIQA 5BV1A 2WM9B 1XMSA 3ROPA 3T5BA 4D9EA 4K6FA 3AMVA 2ANBA 3LS2A 2W8BA 4UUBA 2AWOA 2Y1DA 4CLOB 1K3UB 5CLIA 4H1WA 4OATA 3IJRA 3OOEA 2FX3A 1MFZA 1VE9A 2OORC 4XWKA 5GTDA 3WWPA 2HSEA 3AVOA 4PGMA 3LU1A 1G2IA 2ZM6M 2WSIA 2AYYA 4DNPA 3PRHA 1GKIA 4BC1A 1TEZA 3M2PA 3T4PA 3DT8A 3EGVA 1YCDA 4KVFA 2BFDA 4WOKA 4XYEA 3ET4A 4HBZA 4YROA 2XECA 5TGDA 1IU9A 2IQ5A 3MIIA 3OZUA 4K6GA 4MTLA 4FFVA 4RTLA 1Y4DE 1WAMA 4KW7A 4CM6A 1PFUA 3EB9A 2YRXA 1UDAA 2WF5A 4RF2A 4WP2A 5CA0B 3RVPA 3JARA 4AG5A 3GLIE 5LKRA 3UAOA 1HLFA 4AK9A 1NBAA 3BKXA 4DDVA 4URZR 3VYTB 3K35A 2Q3FA 2EQAA 2O1XA 4L22A 3C1TA 3AM4A 3P0HA 1N6NA 3FE3A 3R5HA 3TQHA 3C6KA 2R8OA 5JXHA 3AB7A 4F86A 4CI9A 3DVRX 1W6RA 1M34E 3EZ2A 4OB6A 5DULA 4G5HA 3UMCA 2WABA 4Z3DA 2G0TA 1KRXA 3OHSX 4P17A 1E92A 3O8LA 3H9BA 2ATEA 1VCOA 1ZH8A 1QYIA 3SSMA 3ZHOA 4DE5A 5IJ9A 4NMMA 5J2TF 1NW7A 3WJAA 2ZE7A 2XUKA 3HBAA 1Y9AA 2XOEA 1IBMM 1DKUA 3CX6A 3B6ZA 1P9OA 3TN7A 1OFGA 4MW6A 1GYQA 4YR9A 1R0CA 2QBYB 3TOVA 1XTZA 3THGA 4Y2SA 3FR7A 3KAKA 2QQ0A 4P0TA 3LT1A 4L4XA 4JA2A 3VKUA 1H0KA 1EDZA 4K9SA 3T9FA 1Y8AA 1HDZA 3C14C 3HDYA 1B8VA 2B2XA 1FFAA 3G0DA 3KIPA 1ZAKA 4L02A 2WQZA 1SIBE 3ELYA 2DWUA 5A3QA 3UKDA 2W2LD 1L6IA 4R8RA 4QFCA 3LDUA 1XB2B 3HHEA 4E1BA 2HRBA 2IODA 4D25A 4EPVA 1XMOB 4WLFA 5EJIA 3TM4A 1KL7A 1MX3A 2PFGA 1ZNQO 1THGA 4MWEA 4HWRA 221PA 4TQAA 1BA3A 4P5PA 2OT3B 2I4RA 1HZZC 3FCXA 4PZ9A 3NHMA 3N8DA 2YMQA 1JF8A 1COZA 3EAQA 3EJWA 3GGJA 3DBHA 1TCBA 3RHTA 2WTXA 3KQUA 3FBGA 4X95A 3FUCA 3R6LA 2FG7C 3THYA 3UB4A 4HDNA 4LDZA 4JUIA 4Y9SA 3PNYA 4MCJA 4YVFA 3TSYA 2GK3A 4ITUA 7ABPA 2YMMA 5FWAA 3MJDA 1JUDA 2QTBA 2GKGA 1V4NA 4ZOLA 3D8TA 5CJJA 5HKKD 2OHIA 4XARA 3W4KA 5KPTA 2HF2A 3TTTA 1NUUA 3RF6A 5G0VA 2C4NA 4MDFA 3WFZA 5C7OO 3W2FA 1DC5A 1X87A 4IOJA 2PWAA 2GA8A 4GKJM 4MUNA 3KYIB 5EIBD 4TV8A 2QS9A 3VBCA 3T34A 4C22A 1SBHA 4CKWA 2FPRA 4FOLA 3ENKA 2CLLB 3K9LA 1EEHA 1NL3A 1PJIA 4U5XA 2ATIA 3BA6A 3CNNA 4PG5A 4KDRA 2Q8PA 5EXXA 1X7WB 2FEKA 4V38A 1Z82A 4Q1DA 4Q7QA 2BE9A 5BW6B 3GBSA 2PH3A 5T3UA 4BO6A 1X6VA 4LDQA 1SUFA 2YWFA 4OB7A 5J58A 1EQAA 2IV2X 2OOKA 3X2FA 4XM2A 3RE1A 4YN3A 3HLTA 1QIHA 1E8MA 1OFTA 2C94A 1FPMA 5LZ5A 3HB4X 1V5FA 4PZEA 3VR4H 2WSMA 4RU1A 4ND8A 2KB0A 1SUSA 4L6CA 3D31A 3IXLA 4A92A 5FLEX 3EXIA 2EZ8A 3OIFA 1VMAA 2YXBA 3FMIA 5GMOA 3B3JA 1HA3A 3DEYX 2W2VA 1E1YA 1JEOA 5AKYA 2XYRA 5E95A 4TTSA 3DO5A 1EZ1A 2XGSA 3OQ6A 1A8IA 3EXG2 5BR1A 4PAQA 1AKRA 1EM8A 4ZALA 2DTDA 3O4GA 2C7BA 4G5YA 2O3JA 4DNQA 1G7TA 1ZMRA 2G4LA 2AYZA 3FTCA 2W93A 5EZ5A 1QTRA 4RM2A 3PQ2A 4YV0A 2C0QA 2K7ZA 2X9NA 1ZVVA 5BWOA 1JBEA 2Z58A 2NADA 1WXQA 1YQ9A 2V4UA 3DSRA 1JFSA 1JDVA 4PG4A 1QPZA 2H29A 1YR7A 4CCYB 4V0RA 3VDUA 5I9NA 1LI7A 1RPJA 5A0TA 5JYBA 4MS3B 3PWKA 4EVIA 5DYGA 2GT1A 2IHTA 5KWJA 2DHCA 3K92A 1SVLA 2EKQA 2YV4A 4Y18A 3TWKA 2G40A 2VQEM 2FZVA 5DMXA 5LDDC 4O2RA 2F3QA 1BA2A 1C4OA 3SHFA 3WLRA 4LUCA 5EIWA 2GTIA 3KJQA 1C9YA 4R1NA 4L16A 1JI3A 4OP1A 4RDCA 2DAPA 5B4TA 4P0PB 1I7SB 3PFGA 4A6DA 3ZDYB 4B45A 1H2YA 4WNCA 3N2ZB 5H7XA 4B6QA 1COWA 3Q15C 2JJYA 2UZAA 1UPFA 3DDHA 3QFTA 4PXSA 1ECCA 3F46A 2UUOA 3A37A 5CBPA 3E9ZA 4AMGA 1MX5A 1TDZA 2JATA 3GN1A 3M5CA 5FBQB 4PSKA 3TK1A 2QQ8A 4MVJE 4ZV4A 1W0KA 1QH0A 1NUTA 4LGVA 4CFSA 2YWBA 2NQTA 1T1JA 4Z7OB 2PTGA 3C8ZA 5MHTA 4K9LA 3S2YA 4TWZA 3EEYA 5DLEA 2E4XA 3FLBA 5DXJA 3EZGA 2VDRB 3RIEA 1TVKA 2OCLA 3BAFA 4R5HA 5ARCA 5E3JA 4DV1M 4JEUA 3EZ7A 2DH5A 4QPDA 1UOPA 2RAUA 4RZUA 3HJUA 2V5UA 5L3RA 2C29D 1KMIY 1GQOA 1N6LA 2CB0A 4ZDWA 1CIJA 1I5EA 4IYJA 3RHZA 4AJNA 2R3SA 2HTFA 1NVUQ 4B3JA 1F12A 4KHZA 1MV8A 1ZZGA 4Y2JA 3PKIA 1X7ZA 1IIRA 4CISA 3UJAA 3B2NA 4QG7A 3K8QA 1KE1A 4DILA 2WR8A 4PY2A 2QM7A 5E9QA 3NIFB 3WMEA 3T5GA 1OXTA 3LCUA 1LB1B 2XIQA 3RJ9A 2WJAA 3ITKA 4HDMB 5GJBA 1N36M 1I1QB 3Q8XB 4GLJA 1Q1AA 4A5SA 3I04A 5K4GA 1IY8A 4EJSB 4I5SA 3SEZA 3JY6A 4QXMA 1QZTA 4DQVA 3WAJA 4KNVA 4Z9XA 2AZTA 2W4IA 4C5BA 4FBLA 5FI5A 4N6OA 1ZJWA 3G89A 1SH7A 2XMPA 5KYNA 2QAGC 2Q6OA 2Y0BA 4IMRA 4TMYA 1XIVA 2IF0A 4YYZA 4J7UA 1DS6A 3OX1A 1DKMA 2GEBA 1M2VB 2E85A 1RFGE 1GPYA 4CMEC 1IFYA 3CRW1 1UM9B 1XFDA 5C1PA 4CR7A 2R60A 2HLDD 1I51A 1M2OA 3AP3A 3C1UA 1C30A 3EF0A 3G8YA 2CVQA 2P9EA 2OAEA 5B5SA 3H4MA 4B4VA 1AGYA 5IFKA 4LRUA 3PRJA 3VC1A 1T8WA 4URWR 4IIHA 3E8XA 2QLBA 2XAAA 2QX6A 3NVAA 4CETA 1YB1A 3KPYA 1NN1A 5CAEA 1N5JA 4HTFA 2EQBA 5AK5A 1NRWA 5TF4A 1HUQA 5IC6A 1LFDB 1PYGA 1IAVA 5IDWA 3TQFA 1SZDA 5DNVA 3RSOA 2QL5A 3BDVA 2GK4A 4MPDA 4PLVA 3QKRA 2P9ZA 4QC2A 3SG0A 2VZ0A 4WFJA 2X77A 3HBLA 5FJIA 2KMLA 5AVOA 3KOWA 4K6CA 2BMVA 3KQWA 2ZI3A 4UE6A 2B1IA 5FAXA 2VZ9A 1ZR2A 4OJKA 4WWHA 3ICEA 4YK7A 3ZY5A 4PE5B 2X0EA 4AKSA 1UDCA 2AN9A 4Q7MB 1R27A 3MGGA 2ZRMA 2HQ1A 5K6AA 1IBLM 4ECEA 1KHTA 1XRJA 2R25B 4NABA 4U6SA 1YL7A 4HF7A 3I09A 1XZ8A 3KQMA 3VR6D 5IK2D 1I4EB 1YR8A 3LHSA 2WAYA 2GF2A 1XU7A 1C81A 3EXEA 3DV9A 3PUJA 1EVEA 4OMCA 3IIJA 1LI4A 1LDGA 3BBPA 3JVUA 3Q85A 5T6MA 4JQYA 5EP2A 5AXAA 3KSJA 3LVVA 3K0AB 4NJEB 1Z59A 5BN3B 3B7GA 2DKLA 3AKYA 2QRZA 3MJRA 3FZEA 4AZSA 1FFWA 5HOQA 3ZIAD 4UXHA 5J3JA 5ALXA 1MJFA 3HU1A 3HJ8A 1JVSA 5I5GA 5IM4F 4R1OA 4PR3A 1AU9A 1V9CA 4NATA 5CB0A 5JXIA 1QTNA 2F5NA 3LFUA 4BNNA 1AQNA 4GVLA 5DTMA 1IJFA 4MI9A 5A1TA 3NFRA 2BR4A 4UW9A 5KKNB 2B4KA 1XRMA 4BVKA 3AI7A 5DNYA 3C3MA 1S3IA 3LCMA 2IHUA 1ULSA 1P9RA 5EMNA 3ZN2A 1OH6A 4D0NA 4KUGA 5EKXA 3WICA 3R3VA 2I22A 2XNDA 1XD2A 1ZLYA 2NTEA 5MF6A 1CV2A 5LP6C 4DCPA 4JI2M 4FNGA 4KLAA 3K0FB 3WLJA 2I76A 4L3WA 2QF7A 1V35A 3OJCA 1KJNA 1L2DA 4GMFA 1XC7A 1O9GA 1ZONA 1X1DA 3MTAA 1B41A 4ZVOA 3G8DA 2O2YA 1SVUA 2P7IA 2R6JA 4EAQA 1B3RA 1A69A 5JY6A 1G3IA 4OYYA 3GLVA 4AG3A 2PMDA 4LOLA 4NJMA 3EPPA 2D7DA 1GFWA 1NZJA 3FYUC 2MSEB 3QTTA 3REQA 2F67A 3BB4A 2PSJA 3Q2OA 2GJ4A 3E3AA 2HU7A 1U04A 1RZVA 4LZWA 4LOHA 1MQ9A 4W8GA 5ALOA 3BE8A 4KNYA 1DCTA 4TTPA 4PNZA 1EP1B 3IDAA 1YDFA 1FU8A 2RHTA 2G8LA 3P4YA 5I51A 3F6SA 2LNHC 4QQNA 4ISBA 4KSBA 4YRPA 4R1UA 5HX7A 2MGWA 4DV2M 4ZAFA 1DG9A 2PZKA 1KERA 2RHMA 3FPKA 3ZYCA 5JYEA 4FGWA 5LYJB 4DZZA 3QYAA 2O2XA 1F9EA 2WKSA 4QEZA 3V6LA 1MXHA 2P1RA 2R7MA 1UMBA 5KYYA 2A5JA 2HMVA 4LZOA 5DNDA 2I7TA 3ENQA 4GXQA 5KOIA 1R4MB 4XD7A 3RADC 4TQUS 4CQNA 3ZGOA 4RTPA 1TNDA 1G5IA 1SELA 3JZMA 1YZHA 2POQX 5ALNA 4B9EA 4RD3A 4BZPA 5JDIA 4IBBA 1JIIA 3C5CA 3WK8A 4KITB 1Z68A 4BFZA 1XCGB 1R8SA 1VKNA 4M1WA 3PPVA 1D0KA 4RV5A 3IG8A 4TTVA 1I1NA 1OLXA 2RHLA 1W36B 4OQXA 3FYSA 3M4YA 3A14A 5JC8A 1SXJE 2WHPB 4DS3A 1FUUA 1K3WA 2XDYA 3UENA 5HQJA 1QGOA 3C15C 3ICPA 3STTA 3DOIA 5DI9A 3OSUA 2H2DA 4QHYA 3H42B 1GOTA 4UUPA 4B3DA 4Y0AA 3FKSD 1SC3A 4ER0A 1R0KA 3T3HA 2CP8A 3B9BA 1A5BB 3PFFA 4XGKA 3FMPB 1QC5A 3SIXA 2UYYA 3VO8A 4P58A 3QVWA 4YO8A 1TQDA 2DUUA 5A9TA 4IZIA 1VHWA 2AHMA 4ZJZA 1I7NA 1Q14A 3GMDA 4QXPA 3RYFA 5CFPA 2DJIA 2BZSA 3NWPA 2GQ0A 3HYNA 3W4JA 1U8UA 4XUGB 3LQRA 4XDGA 2O8FB 1BGXT 10MHA 2WIKA 4EI2A 1FRZA 4G4RA 1H8EA 4MWZA 1NW9B 1J56A 2QTFA 3DNFA 3GVHA 1RPTA 1DIBA 2ZS9A 4TWIA 3RV4A 3VR5A 3SX2A 3GJSA 2EO2A 4OCZA 4DJFC 1WDWB 4EMBA 2AEMA 4XIJA 1PJBA 1N0IA 2VJYA 2O23A 2P67A 4Q4CA 3DBLA 5HJ2A 4D79A 1F60A 4FDLA 2JF0A 4GM1A 3IVRA 3W8DA 5HKLA 4K40A 4H4CA 4RTRA 5K0BA 4AO6A 3IDFA 1B43A 4Z4FA 4FBGA 4PYJA 4FIZA 1QOQB 5I7EA 5AFSA 3WKEA 5CR9A 2W42A 3W67A 4IGAA 3E7DA 1J25A 4PTLA 3I2HA 1YBVA 3GVIA 4U3JB 5KYWB 2D1SA 3OTWA 5JZVA 4CWAA 3MUOA 1PK8A 3RU9A 2CDRA 4QVKA 5DN9A 3WJ2A 1UJ6A 4B7CA 3TLGA 4HAZA 4F1IA 1FUYB 1NM5C 4A91A 4TZTA 1T0PA 2XWPA 4YHBA 3D3EA 4XD2A 4UTVA 1P17A 1N3IA 3PQ8A 5CX1A 1NYQA 2GBLC 4JI4M 1XAIA 1Z4KA 4NZPA 3NHAA 4RQUA 4BNTA 2R4UA 4KR3A 1MIOB 2B8TA 5AUQA 1B0AA 3IOEA 4GQAA 1LDEA 3AL0C 3V42A 2A0UA 7CATA 1G3MA 3OQHA 1ZI6A 1Y48E 4ARCA 4CMHA 5CG1A 1N2IA 3JALA 4PRZA 4B8ZA 1CJVC 5BNZA 2A0XA 2OQ2A 5DHRA 3L28A 2FAXA 2QJRA 1EH5A 2XUOA 2CK3A 2FEAA 2XF2A 3G2PA 1T3ZA 3IVAA 4Z7NB 5HG0A 4F9GA 4C4XA 2NZ2A 5HA5A 2JIZD 5KCMA 1VHQA 3IA2A 3MTJA 4DCVA 3T3OA 1EWTA 3FA2A 5AW4A 4FZ3A 3PLNA 1QMGA 1TMOA 4WXYB 2Q5HA 3B8HA 4E3WA 4GL4A 1JKJB 4UAVA 4Q15A 1RDFA 1ZHHA 2GPSA 2DHDA 2F4VB 4ETNA 3FGOA 1E8NA 4B47A 1CB0A 2ADMA 3MGAA 3L27A 2GBFA 4Z8XA 5CMLA 4RENA 4OP2A 1P7WA 2JGDB 3RIXA 1Q91A 5FTMA 1O58A 1NMYA 4PC6A 2WWIA 2P3OA 1YOVA 4EG5A 3RVQA 1PUXA 3WLFA 3ZVMA 4LGCA 2XB4A 1WLYA 3MYYA 2MTBA 1I3CA 1DEAA 2YX1A 1WEHA 1EPUA 1DDGA 2C5EA 4ALMA 1X2EA 5CDSA 2J3KA 2P2DA 2ZRBA 3JQFC 4YASA 2EZ9A 4YMSA 3ZTYA 2I4MA 4MWOA 4X6LA 1P0PA 2WTMA 2ESRA 1CW2B 1Y6RA 4KRFA 1PT8A 4UTXA 1XZPA 3U9TA 2F3PA 4IWYA 3OEHD 2XEDA 4KODA 3HFJA 3C48A 5CA1F 3RWMB 4O1MA 3ZWBA 1ZO8A 4R3UC 4WI1A 1EAMA 4RCVA 2RGBA 2XXAA 5JG7A 1O94C 2FRDA 2RGDA 2MDTA 3F5SA 3EY9A 5KU1A 2UYQA 2GZ2A 4LNHA 1XP8A 4ZCTA 3O74A 4U7DA 2AC2A 1JZTA 3LL4A 2Q28A 1PIWA 5ICFA 1URPA 3IAS6 4B3SB 1A2OA 4G41A 5E4FA 1YOBA 5KB3A 1J09A 2R62A 5DYTA 3R3SA 2OHJA 1WULS 4D3SA 1T1IA 1HDCA 2CUKA 1JXQA 6NULA 2ADFA 3URMA 2YJZA 3V8VA 3U3JA 3IUEA 2NN3C 3PD1A 3K5IA 1SPXA 2XOKD 1A7AA 2FPLA 5B3JC 1PJ4A 2CDNA 3QIAA 4WA7A 2X40A 1H1LB 1ZNWA 2UU9M 3ENVA 3H6GA 3C8UA 1Z35A 4KWIA 1DGFA 3OAAD 1E20A 5DLDA 2EX4A 2GF9A 2O0KA 1WB6A 3OLYA 3J7TA 3OUUA 5FUYA 3WVNA 3SYMA 1Y1LA 1BAPA 3SQOA 1X7WA 2IYLD 1NGSA 3KB8A 1CLEA 2GJ8A 2A9QA 3GYBA 3BMNB 1TCVA 2JJQA 1G19A 3N86A 2CDCA 5AM4A 1Y7IA 2HDHA 3EIXA 1Z26A 1EFPB 5AKZA 2CJYA 4YUXA 4U63A 5KKAA 1RJWA 2NYRA 3VR4A 3MK31 3NRJA 1FB5A 4KWEA 4YQYA 4RLHA 4EVQA 1N32M 4UARA 3AP1A 2C2MA 5ICSA 4YCSA 3GAMA 1OKSA 3IAM1 3M5PA 3GAFA 1G21B 1BCRB 2FZWA 3ESCA 1LLFA 3MWDA 3ABQB 4UXJA 4DCNA 4LI3X 1UEJA 1N34M 2WQ6A 1WDMA 3VYRB 3AB8A 2QTWB 5KOJB 4URVR 1YV9A 4BJ6A 1VBNA 4RELA 4N5NA 4BKPA 3BMXA 2ZUBA 4UJ3A 4HQFA 1IEVA 4AURA 1PS8A 1XTTA 3K9CA 5KNBD 3FWNA 2JLXA 2LIPA 4PM4A 3VSCA 3R6GA 2JFUA 5EHQA 3ET5A 2I6XA 4OAOA 3COYA 2AVDA 2G77B 2BFFA 2Y6UA 2GI4A 4OGLA 4L3VA 1E0SA 2YZMA 3KZCA 1NR5A 3RSZA 4E2ZA 1QPBA 4ZTBA 1DADA 4KPUA 5TB5A 2JIMA 2ZR7A 2IHYA 3W8FA 1UDRA 3DYVA 1TA9A 1ZHFA 2BFOA 2DPMA 3HYLA 4D5EA 3W7BA 3WP0A 5G02A 3J80A 1KAOA 2FN4A 4JQOA 2CLMB 4YUVA 2A9OA 4JI3B 2G9UA 1V8PA 1Z17A 4M99A 4I4TF 4IHQA 4Y1GA 4X1KB 4FSXA 3KJEA 4W5QA 4P4SA 1DAEA 1N33B 1P7VA 1SCAA 3ANTA 2IZ1A 2Q6KA 2ZUUA 1ZVJA 4RMGA 1NVWQ 4B6PA 1M0TA 5LZ8A 2J5KA 5ALQA 1H65A 2YHUA 1IM5A 1IJEA 2C9ZA 4LYGA 2AJ8A 3LCCA 1UZMA 3C6YA 4YWJA 4Y6SA 4QXOA 4KR7A 2P6OA 3E7XA 1VDMA 4HMQA 5AM3A 2O3QA 3TNDA 3UYKA 3ZLJA 4NIMA 2QI9F 4YRBA 2BEVB 5FTJA 5EL0A 1DUIA 2P9BA 3WZMA 1Q6YA 1PWXA 4RUKA 4P35A 2WA1A 4WACA 1QG0A 4EPYA 4FGKA 3CPEA 2ID9A 4M1TA 2IH2A 1TEVA 1M1XB 1U5BB 4BNLA 1QOZA 2D5IA 5DBHX 4BHTA 2BEWA 4LF7M 4NENB 1NU8A 2P75A 3EAFA 3K6SB 1IPEA 4WJKB 3DVLA 4DR2B 5DTQA 3SU8A 5B2ZA 3V7YA 2ASVA 1OREA 1WPQA 3DG9A 3HY6A 1TQ6A 3WBFA 2PAFA 5JCOA 4HDMA 3L6UA 4TMWA 1G5TA 1VJ0A 4KQCA 4EJSA 1B2LA 4XM1A 1QHYA 1DL5A 5E8RA 2WM3A 4NWIA 5KCZA 3BTSA 1TEXA 1HE8B 1S2OA 3L6CA 1DX9A 4KQHA 4KQFA 1W52X 3LWZA 2VA9A 2POCA 2GARA 1VIVA 3FCAA 4LHSA 5BUZA 4UTPA 4B35A 4N0PA 2RG7A 3GUUA 3P9SA 1HL7A 3FF4A 2ZBRA 1LNSA 3QYPA 4TGLA 4G8BA 1LI5A 2VPQA 1UEIA 4DVGA 1X70A 1IK6A 1V4BA 1Y37A 1NN5A 1C7QA 4CQMD 1JMVA 4D57A 2D4AA 4NPAA 1VCMA 2AG5A 3CZMA 4GOKA 2XT6A 2XUPA 2FH0A 4GE0A 3LX4A 1R15A 3A42A 2EJSA 2XTJA 4J29A 3KCQA 1XG5A 4R1PA 4BNJA 3AKDA 4C2UA 4BZQA 4Q3NA 3INGA 4AS1A 2DERA 3ZTTA 4G4OA 2RRUA 2PT9A 4WXRA 5EMHA 3OZXA 4FFLA 1ZCAA 2F3SA 5HFNA 2ZTCA 4TX1A 3I8XA 1PJ3A 3AZOA 3ROMA 3SJZA 1JIQA 3DBIA 2P9YA 2XLCA 2TRSB 4URFA 5DTRA 3EMDA 2ZJ7A 1CDEA 2Z83A 1U6IA 4WKGA 4ERNA 1C3VA 4OKIA 4IXWA 3CX3A 1V8BA 2CLEB 4FDTA 2YJ4A 1AZTA 4L7QA 2ZBGA 2IEAA 2PJDA 1W35A 2DU8A 1JDSA 4PO8A 2XGOA 1E6WA 1NRXA 2R5FA 4IIUA 2HXSA 4M37A 4BX8A 3P1JA 4FIDA 1OZHA 2EP5A 4JLWA 3ZD9A 2EERA 4N03A 1QZEA 3FHOA 5CG2A 3DDOA 2PD4A 3QBVA 2DZLA 2QMQA 5ULLA 2X5JO 2FUG6 1Y4SA 3TSAA 3PEUA 5A5VA 3TIFA 2MYUA 1JNYA 2FPGB 3K0AA 4NJEA 4DA7A 2ZI4A 3GC6A 5BN3A 1P0FA 2BFPA 1BDJA 2VT7A 1J99A 4INJA 4YJ3F 1PFWA 3B7WA 1LK7A 4PLFA 2YJ6A 1PJQA 3ILKA 4A27A 3T8YA 1FMLA 1X74A 3H1GA 2BFMA 4YMVA 3GAZA 3M2TA 4IBOA 3FCUB 4N7BA 1XTRA 1L5OA 1SZCA 3H2GA 3ELBA 2GCOB 3O1HB 1Q74A 4XA8A 3L1HA 1G20E 3LAWA 3PYXA 4C7KA 1DHTA 4NPHA 4MWSA 3TUZC 1V7ZA 1JEEA 5G4KA 1OFVA 1GGKA 1OI7A 1OX4B 1KK1A 2J3JA 2FMKA 3RWOA 8MHTA 5IT5A 4CTKA 4WCVA 1GZVA 3X44A 1SQ6A 5AHXA 4TWBA 4FNMA 2EARA 1PBTA 1ZH6A 5HR5A 3H5AA 4HGZA 3FPHA 3VJRA 4N41A 3COJA 1J42A 2NUPB 5JC1A 1TT5A 2DE0X 3HWX1 2Z5LA 5AQEA 5JPIA 2RHOA 1Z8NA 4H0FA 1BXZA 4AJJA 1IN4A 1G0OA 2R8RA 4LY0A 4RJTA 1HL3A 3IR6A 1TMYA 2BIFA 3AESB 3IT2A 5CEEA 2BUCA 3JYNA 1XZCA 1R3DA 4RA9B 4XYBA 4BB9A 3CH7A 2R6GA 5ITQA 1NVAA 2W6JD 1UFKA 3VHQA 1LLCA 2VNJA 1FJHA 1MFPA 3E1KA 4EA6A 2PPVA 1CQPA 4Q48A 5LQRA 1P8JA 3MTQA 1AO3A 3TB6A 5F4ZA 1CUAA 1D04A 1LW7A 2WPDD 1DAIA 1EJ2A 2FHSA 3BMQB 1X1CA 1GUAA 3U61A 2C31A 3R7SA 1F8UA 1RU3A 3ND6A 4JT9A 3QLVA 1UT6A 2UYOA 3BD9A 4F6LA 2GYVA 5JOQA 4DQLA 2I4LA 2Q4BA 2RGUA 3SZ3A 4KO3S 2JASA 2PUWA 2JS7A 2QSZA 1JKMA 1Z2DA 1EP3B 4JZYA 4LF8B 4ZC8A 1RHMA 1MO4A 4LHEA 4X84A 4MV0A 5C9ZA 5K5EA 4XRGA 2RK3A 1NLYA 2ZS7A 4AW9A 1ACMA 4EUNA 2QAGB 4H1TA 2JP7A 3JQDA 4FGUA 5JS8A 4MGEA 4RAQA 3A26A 1X3SA 4P2BA 1WTAA 5DNCA 2XGNA 1BN7A 3AR5A 3BPSA 5EUMA 1PFYA 3R7WB 1XEFA 1A8UA 4ENWA 1WZEA 5KNDH 4JI6M 2PANA 1FVOA 1ZLXA 1IY9A 1ZCJA 4N47A 2DBQA 4AY5A 4BQPA 3KR1A 4HBGA 2Z2JA 2AR7A 5DM70 4N3CA 4UVDA 3NX4A 1BWPA 3FJYA 3JWPA 1IVNA 1UBLS 1ONPA 4L7VA 4QYIB 4YCBA 1Z0SA 1WY5A 4RY0A 3PX7A 4CMCA 3AVYA 3UAXA 3GRCA 2P0YA 3GZTB 3I4CA 1EK0A 3FJOA 1F2UA 1NG9A 5C2JB 2VP4A 2XRFA 2ECKA 4OHXA 2CD9A 2XTZA 1O1YA 5INTA 1YR2A 4DDUA 2O8FA 4WSOA 3H6HA 2ZULA 1SUEA 4QQ8A 3O3OB 1TO1E 3CUWA 3PEYA 2R8ZA 4QLBA 4F4FA 3PX3A 1ZVMA 1ZSVA 1UK8A 3P2OA 4F2LA 1EWYA 2XQGA 3K0HA 1JPNA 3DEIA 1R6AA 2JCGA 4AZ3A 2YS7A 4H7HA 3AFGA 5FPTA 4ZU1X 4UEJA 4UQLA 2H5IA 1L8LA 1MG0A 4L2IA 1IC6A 3GNTA 4MVJG 1SG9A 4WX2B 5T6BA 1ZVQA 4Q3KA 2DT8A 5J47A 2QTTA 1F1BA 5KJ1A 4KAJA 4UDOA 2OOBA 3LL7A 3A1UA 2OHOA 1U63A 1T1RA 2BC9A 1VM6A 5LA6A 3QLUC 3FAKA 4MPRA 3KTOA 4NBVA 4Y9UA 3KJGA 2W6QA 1JIKA 3ORSA 2XVYA 4NG5A 1O0SA 4U3JA 4MVXA 3KKEA 1ISSA 5KTKA 5KYWA 3VDMA 4AJHA 5C4GB 4HH3C 1UXKA 1VECA 1AM4D 4FDVA 2SICE 5F2EA 3ISTA 1P1RA 1H0RA 3WFJA 5BQPA 5HM6A 2H3HA 4DV0M 5IARA 3L7MA 4QWWA 2GQFA 3GQVA 1FMJA 4GSYA 1KFCB 1LSOA 2H5LA 4JODA 5EIFA 5H8WA 3T7RA 3FDIA 1H3NA 4GR4A 3ZE0B 3C58A 2Q3LA 2F17A 1M2FA 2VQ3A 5ADHA 1UBKS 3KOMA 1L5KA 1V8DA 4TMTA 1XCPA 3NASA 1C8LA 3I39X 4KRGA 3BFVA 3O2SB 4Q34A 4GPAA 2PD3A 1ZC3A 3PQEA 3IAM6 4TWAA 3D6JA 5K3FA 3EOAI 1FU4A 1XXLA 1GAEO 3C5VA 5FPHA 3EIEA 4PZ0A 1ZR4A 1EUZA 2BFEB 3N2KA 2LCIA 4ND5A 3ZZTA 3QLEA 3G7SA 3AFMA 2JIDA 2AWNA 3CZ4A 4U9HS 4WKBA 4MUIA 3H1BA 2OCKA 1CUEA 4G0QA 3ZGXA 2ZYUX 3ZCQA 2LE0A 4PCLA 3AEXA 1E2MA 1OV6A 5I7VA 4PGFA 5FUXA 1NJ2A 4D8YA 1D0MA 2Y9PB 3DXFA 4BQOA 4H4DA 3L7KA 5KX5F 1SOUA 4X0EA 3FYUB 1Y80A 2PL9A 2ZT6A 2Z2IA 2BI4A 1D6NA 1LJLA 2H52A 3ILXA 3UBTA 4P32A 1DX6A 1RMTA 1BJKA 3QF4B 2OUKA 3MAGA 2DNAA 1GLVA 2JGDA 2OBBA 5DU2A 3MT7A 1M54A 5JH7F 2B8WA 4LF4B 4CCSA 4TTRA 1KEEB 3VV2A 1NQOA 5CIYA 3QG1A 4MUXA 1GKLA 1FYEA 2AFIA 2IX3A 3OO1A 1T2UA 5EJ5A 4EKGA 4INZA 3ZLTA 4GMKA 2GERA 3BMOB 4MYCA 1JHYA 4HLUC 4PN3A 3GVPA 4HB4A 2LXEA 3WGLA 3C6XA 2P6PA 1FL9A 1ZRMA 1CB7A 3P45A 2VWPA 3R24A 1VXRA 1GY8A 3PHCA 3KOXA 4D3ZA 1K2WA 1NBMD 2XE6A 3W5UA 1XT6A 4MEAA 1N5KA 1IDOA 3PCTA 3B36A 1Z83A 3PPYA 1WB5A 2WSSD 3VDPA 3FJ1A 3BXXA 1NU6A 5LOVA 4ZCQA 2K7FA 2OQIA 3PQ4A 5EY5B 2DWPA 1GNPA 5BRAA 4AKTA 5MN5A 1ZOIA 5E9WA 3IBCA 1PNRA 4EYSA 1DLJA 1L5MA 1YZTA 3HCBA 1OA0A 1RCTE 5EHGA 4DT1B 1CP2A 2V03A 3ESDA 5IBQA 2LVBA 1JG3A 3LNCA 3QYEA 3UOWA 1OZ0A 3F5DA 2DLNA 5HJEA 3DKIA 4XJXA 1QO0A 4AZVA 4CL3A 3M9XA 1VJRA 2C7QA 2Y4NA 3DT9A 3OA2A 4KBGA 3CX8A 3N7UA 3RRXA 1GCIA 1KKMA 1YKSA 3H11A 1WSDA 4H6XA 1E1QA 1FTYA 5L53A 1HSOA 4IIEA 2RGYA 4NKRA 3CEPB 4QTZA 4P4TA 3TE7A 2CV1A 5LUBA 1E5LA 3FWZA 2GO7A 3OIUA 4PZAA 1QPGA 2FDXA 1E9RA 3C3YA 3TBKA 4KXWA 3ZUPA 1PGNA 2ZI5A 2JEZA 4RVSA 2NT4A 4S1PA 3ANLA 4EJ0A 3RFTA 2YN2A 3OURA 3B51X 3SEFA 1POWA 2Q50A 4I14A 1EFPA 3I58A 3WIOA 1E63A 2DWMA 2QX8A 5JWOA 1OROA 1TKRA 1UPBA 2PT6A 2XZUA 3RRMA 3UWOA 1ETHA 5DIZA 4OK3A 1CNFA 1BROA 5JI2E 3DHNA 1A76A 2WSFF 3C16C 2FMXA 2RB5A 2JJ2D 4PFSA 4PTZA 3TWOA 3JD2A 4L85A 4IGEA 4OGGA 4WLNA 3RSLA 2PL1A 4W7SA 2JGKA 1PFKA 1U6JA 3T5CA 4JB3A 3GRFA 2I1LA 4O33A 3RU2A 2JZOA 4M7WA 4ZEOA 5J4YA 4LCBA 3O9ZA 5AKJA 4YH1A 3HACA 1W0JA 3R0QA 3QU7A 1V43A 2ZUSA 1VE1A 4BFVA 4US1R 1R10A 4ZV7A 5F1PA 2HCBA 4TS9A 3W34A 3KSMA 4G4GA 2XE7A 5JJLA 1KI4A 2QD5A 5CXSA 3K09A 2X7JA 4RVOA 4DMLA 2QL7A 2G7MC 3MW8A 3IPYA 5BR4A 3IAS1 4NX2A 3ZC3A 3VTZA 1SBQA 1V41E 5KPJA 4PQGA 4QLAA 4L0MA 5FNVF 3H97A 1AUOA 1OWLA 3DD1A 2KW5A 2VHZA 4L5BA 4W5OA 2G1KA 4TQ9A 4YAOA 1A2BA 3ZQUA 2PVCA 1XE3A 4YCNA 4C21A 3GPXA 5DRYA 1OAOA 3K4QA 4JJEA 3UOAB 1QFYA 1HH4A 4P83A 3SC4A 2FZLA 1EBFA 5AM0A 1CEXA 3JZIA 3CZRA 4GQIA 1SJ9A 5PNTA 4L9RA 3DOEA 1MJGA 2CDBA 1YB5A 3AZQA 2OD9A 3U60B 1RWMA 3PC4A 1IZYA 4B6JA 2QRNA 3LPLA 1WETA 5D84A 4CLEA 5K09A 1ZUNA 3BSFA 1VCIA 3GPIA 3ZWQA 3EEFA 5FBWB 1RSZA 2O14A 2K87A 5LMNB 1FLDA 4M87A 2BEVA 3FNBA 2KBFA 5C31A 2I6QA 1LGYA 4F5DA 3O75A 2IE8A 3COZA 4RZXA 1U5BA 2DPXA 2VXBA 4MARA 3H5OA 4JCCA 3BK7A 3K6SA 1NW5A 2OHGA 4ZCSA 4E30A 1TL7C 4B81A 4RS3A 4MKXA 2G5PA 2FMTA 2ILVA 4WESB 2UYGA 5DSXA 4G1FA 4DWJA 3OQPA 3BBLA 1LW6E 1WHTB 4G8CA 1JLMA 1RAFA 3T9DA 2PT5A 2F1IA 1K7FB 2UXBB 1P4SA 3PITA 4KGVA 2A9VA 4JROA 3OZIA 4PINA 3VTFA 1GVHA 2DLDA 1JAHA 4JAVC 4Y2HA 4II3A 1OKKD 4PVCA 5EWMA 4RHFA 4JQCA 3CIOA 4O1HA 2OGZA 3PNOA 4Q1FA 4HN4B 1BVUA 5DNEA 1P6XA 2X8LA 5L7YA 3LCVB 5BMVB 2DQYA 3TMYA 4ZYUA 3I2FA 2TMKA 1N57A 1X0VA 1VRWA 4TKVB 4TSFA 1TF5A 3EOBI 1HZZA 1MOPA 3AEKA 4X62B 1KYZA 2FR8C 3NHBA 3HVHA 4X65M 3OT1A 1BQEA 1VYTA 4ID3A 3IPXA 3JR4A 5CVUA 2OK7A 3ZW8A 1GGMA 3VO2A 5EJ2A 3ER6A 1AURA 1Q1ZA 1TRHA 1TJ4A 1F4VA 4OMFG 1WV0A 3JWEA 4UVEA 3HR8A 3L9WA 4NARA 5F5XA 1X7DA 4DIOA 3UFBA 1FMFA 5EIOA 4E14A 3AETA 4U6NA 3UJ7A 4I55F 3B20A 1EM6A 4M0CA 4NPCA 1DXHA 3GY0A 1NLUA 2YIDA 1UPAA 1G5RA 3FKQA 3D7MA 3RSHA 3PGKA 1XMXA 4V0QA 1WMFA 3BXZA 2P40A 5EJ8A 4FSHA 3ZXSA 2FOLA 5M2QA 4RTMA 2IDZA 1IY0A 1DRUA 4B87A 1ZCFA 4CU2A 4RZSA 1HK7A 5FO1A 3PUVA 2K5UA 4RK1A 2V7QD 3AM1A 2YC2C 1L6RA 3LUGA 1CF4A 1S89A 1QQAA 4NP6A 4O3FA 1EXDA 4NMXB 1V1RB 4V1CI 5H82A 3IE0A 4ZCLA 4G26A 2FY8A 3HPRA 4N54A 5ALDA 4CF3A 4UBLA 1PUJA 4HB3A 3S70A 2EG5A 6REQB 4RY8A 2AJCA 1Q5PA 1CR6A 1PEYA 2CVHA 2C4KA 2QLTA 3UK6A 2OG1A 2BSAA 2AX4A 1G8HA 2OCAA 3HHZA 4DEVA 3ORQA 4YBZA 5H5JA 5FB3A 4NEQA 4DIDA 3I1FA 4QDOA 4XDZA 3AJDA 3OZVA 4BNFA 2VWQA 1CXZA 2PU7A 1LBIA 3C5HA 3KKLA 4TVSA 4MWCA 4BBJA 3N8HA 5DGTA 1L2BA 5JVDF 1BXRA 2F00A 5IW8A 1Z62A 5LQAA 3UMJA 3QXSA 5CDUA 2FF7A 3MS2A 3KW6A 5EUCA 4YMGA 4MNTA 4L4RA 1JJ7A 4OH7A 4EECA 1OX4A 7REQA 4CQLA 1ZITA 1N8TA 3RVRA 1GZSA 3RAEC 2HLNA 3PQCA 4XIIA 2GN6A 1RLJA 4JP3A 5CPBA 5BNTA 4ARSA 1YRBA 3NBAA 5FT9A 3W5BA 5IF9A 3L1IA 3QH4A 2D7HA 5KPRA 3AF0A 3H2BA 3C97A 1G59A 4G85A 3LUBA 2NUPA 2EKLA 2J6IA 3TX2A 1OAKA 3SYTA 5A2QA 3HLYA 4P08A 1AV7A 4B6GA 2XMRA 1YJXA 4D4JA 2HWYA 4DYHA 1VB3A 5DFAA 2P4QA 3SMQA 5F9HA 3Q7TA 1YJ8A 2B4TO 3NAMA 1N9KA 2GILA 4RA9A 1K6MA 1W4CA 4Q7JB 3G5AA 4WBNB 2H5JA 3E2PA 3IAUA 4W9NC 1UPCA 4DJEC 2I03A 3FSGA 3RT9A 1BG6A 2P77A 2SKCA 3OKPA 1FA9A 2VAWA 3BSWA 3PRKE 3T94A 2WJVA 3QFSA 3CKKA 1FW6A 3K0KA 4UBJA 3SMVA 3ILYA 1E1CB 1JG6A 2FPMA 4KO1S 1ISFA 4RESA 2ATVA 1SQ0A 4KIJA 2OZLA 2OBLA 3OCCA 1D4FA 2FUG1 4GZ3A 4OI1A 1VYHA 2H2GA 4IHJB 1PZEA 4G0ZA 2B69A 1R50A 4EOGA 1SQ5A 4IHKA 4HLQA 2QV7A 3AUJB 3KXPA 5EIHA 1LTMA 4ZZ3A 3D54D 4NZYA 5ALHA 4DIUA 2BFWA 3CVOA 4LJLA 3T7EA 1TKCA 5KMGA 1UPXA 4FYKA 2DC1A 3PUZA 4IIJF 5HE9A 2EJBA 2IY9A 1D2MA 4HNRA 3N8IA 5KUTA 4ZU6X 2IIBA 3BSSA 4FHFA 4IRUB 3LPCA 3A9SA 4M0FA 2ZKIA 4XXHA 2NYVA 5KU7A 1U9ZA 5KNDA 4OBXA 2V98A 1YFKA 3B6MA 4ZYWA 1NXQA 5FH9A 2CC2A 1S0UA 1GZUA 2ZG6A 4YRZA 5KWEA 1F38A 3LOPA 1X7YA 4LK3A 2AK2A 5KJ6A 3SE0A 4H7IA 4IXMA 4J4TA 2LUOA 3GU3A 3LT4A 1IVYA 1Z5UA 1RXVA 3DC7A 2QJWA 3V1LA 1QHXA 1YI1A 5D5PA 3Q7QA 2D2IA 4UBIA 3M6UA 1RI5A 3SC3A 4S24A 6GPBA 2KPOA 4QYIA 4BRSA 4GBED 1N8KA 2WINI 2A5YB 3S4YA 4EYQA 2VJPA 4XGNA 2I71A 4CLOA 4S1WA 3GZ4A 2E55A 3CNLA 1Z73A 3I52A 3M1AA 4G8DA 5ECWA 4FN4A 4YQFA 3U44B 3JD0A 3IL2A 5FBHA 4EPXA 4JY7A 2J5BA 2A8YA 2FR1A 5FA6A 1OFIA 5T7BA 5DN6A 2HHLA 1G2QA 5HDBB 3PKZA 3HDJA 3WO0A 1QHEA 5ERYA 3AJ9A 4LYYA 3I6ZA 2PV7A 3T06B 1NXWA 3PX2A 5TPZD 3KB1A 3GVXA 2C4MA 4ZYXA 1FS4A 2G6BA 2I6SA 1UEXC 1HLGA 1H5UA 1PCXA 4QNMA 3S55A 3TMAA 2H85A 1GKYA 5CA0A 2OAQ1 2HN9A 3B85A 2JGNA 4ZOCA 3BQ9A 2B8EA 3T5PA 4PX5A 1X1QA 3U1VA 3COSA 1Q57A 1CY4A 3MUFA 5GONF 5EUBA 3E9MA 4Q3OA 3Q9SA 1MP0A 2FPSA 4DLWA 2NP7A 4KGZA 3C4VA 3VR1A 3FD8A 1M1UA 4FR2A 4GI2A 4FQ8A 4BO8A 2D1TA 3P0IA 4L5JA 4XOIA 3OFSA 2PUDA 3GEBA 2XTMA 2QQ5A 2BHSA 4OU7A 2DP4E 3WXBA 3ISJA 3UJDA 2ZT7A 3F7MA 3UJ6A 3FY4A 1Y8CA 3LUHA 1SBCA 4LOAA 3W1VA 3MQFA 3G9XA 3OMWA 1WMAA 1FUEA 1N2CE 2PUTA 1RI2A 3M7GA 1QR2A 3EYWA 2H1CA 2ENWA 1GGJA 1W1UA 3D7SA 3Q8KA 2XKJE 1E79A 1MVLA 4HLNA 3DL0A 2B61A 3UO8B 1NMQA 4B2LA 2CJXA 2ZJ8A 1XEXB 3CB4A 2QBYA 1DBIA 4U8HA 1PT9A 2B83A 4CT5A 1MF7A 3ZZUA 2W83A 5IJZA 3DEZA 5TXGA 1E1DA 3HJAA 5EG5A 2NV6A 2ZSJA 3VJMA 4C4RA 2BFEA 3UHOA 3MA0A 4LVUA 4R71A 4XB6B 2JFYA 4P82A 1D2NA 4KIUA 1Y3BE 1DEOA 3RFXA 4FHCA 2LBPA 1XB2A 3L46A 3QG5A 1LKZA 1KARA 4WQMA 4DCTA 3N05A 1Z6GA 3AVTA 1CSEE 3AWDA 2ZRDA 1ABFA 1Y82A 2BJHA 2RHWA 3FMOB 4BAZA 2BMFA 3FYUA 1Q0UA 2NG1A 1ODFA 1W5SA 3PC7A 7GPBA 1I4DD 3K70C 4DDHA 1H8HD 3QF4A 1IVSA 4TVKA 1Z47A 4F3RA 4P80A 2J7KA 2IP4A 3PJDA 3NH6A 1B8PA 3T4XA 1KBQA 1J07A 4QELA 3O4HA 3D4PA 3DZCA 4N6GA 4GLLA 5IPFA 1J1UA 4RJJA 3GMSA 3WOHA 3ZHTA 2XYPA 3H8JA 4X8HA 1DJPA 3U3RA 1UXIA 5KSPA 1JJVA 3VNAA 5BOSB 1H3EA 4LRWA 1MW9X 4D4KA 3VV3A 1V9LA 4YAEA 3WNDA 5HUHA 1OMOA 1Y1SA 4D9NA 1NAIA 4L5CA 1U2DC 4MUEA 4S2EA 4ZOAA 3AJ8A 4IJ5A 2OC4A 3VNRA 1TAGA 3RC7A 2HF9A 3ZV3A 3ETCA 4ODIA 4MDYA 2PAAA 3FYCA 1SKBA 4URHA 4EHHA 4L07A 1Q0RA 4L4YA 1TCCA 3C7AA 3AJRA 3UUGA 3CV3A 4ENRA 1K75A 1HTTA 3H5WA 4NOMA 2ZYDA 2P2SA 4ZRMA 2LP4Y 3INTA 1WQ1R 3PYMA 3VOAA 4EGQA 3THXB 2RBEA 4X3OA 1ULBA 4DA9A 1ZIDA 1ZP6A 3IP8A 4YRRA 4AWBA 1Z33A 4ZOQI 1AC5A 1KHHA 1ADGA 3O93A 4R7TA 4B44A 3NWEA 3TTYA 2NYAA 5ISMA 1UBOS 3JQAB 3WZ2A 4UUMA 4RVDA 1L1RA 3KG2A 4PSDA 2CFCA 2IY8A 5BW8A 3DMDA 2VYND 4LXXA 5D1NA 2VYVD 3A4VA 5HRUA 3I6MA 2F1RA 3QPVA 1U0JA 4RNAA 1QIEA 2Q62A 4I8OA 2NO7A 3JQPA 1R9JA 2Q2QA 1HR0B 4BLPA 1E0DA 3G0CA 1CR0A 2RCNA 2WJ4A 3AI3A 2AK3A 4RKUF 2MYTA 2J0SA 5ANRB 2AUMA 3QP9A 1QCCA 1I13A 3BD8A 4CCYA 4AJPA 2O48X 3RUCA 2OXCA 1IXSB 4E4TA 1IPHA 4IW3B 1XCJA 4MS3A 4J76A 5HIIA 1JJAA 1GQFA 1M1NB 3SMPA 2RHRA 3IDZA 2UXCB 1YRLA 5HFAA 3WA6A 3RNLA 3MB8A 2X6RA 4LISA 1JN0A 4UE2A 1R6VA 4IJMA 2CNBA 1VP3A 2FLVA 3IH5A 1VPWA 1MNAA 4MQEB 3DTNA 5IYZB 4RD1A 4H9GA 1LV8A 4UNRA 1XZLA 5J5CA 1N78A 3GLRA 1Y3HA 3OFND 2AE2A 2X4IA 3WWEA 2EFEB 4TXLA 3L8EA 3FOZA 2B2CA 4OFZA 3DAYA 1KQ3A 2BYTA 1W5EA 2H4WA 2OTCA 3URKA 4U2DA 2AG1A 2HYIC 3TXXA 4CEHB 5LQDA 1TGVA 2GHRA 4MJLA 2CCGA 4HAWA 2GM9A 1F1JA 1IXZA 4IPTA 1YKFA 4Q19A 3OWXA 5JBNA 4D82A 2DKNA 4LFBB 4YUYA 3KWLA 1UWCA 4EL0A 4MB6A 1J8QA 3ZWXA 3O47A 1BE0A 5BNIA 3O5AA 3O03A 3OC0A 3T1YM 2VEDA 1CE8B 3H4TA 1PYDA 5F51A 5C4IA 2R65A 5JHHB 4UHDA 5CVVA 1NVFA 1OOEA 1KYIA 1P7YA 1XK7A 2PGNA 2Y4OA 1XDDA 2C0PA 2P4HX 2ERYA 4O8ZA 3DLCA 3L8YA 3TZHA 1YBHA 3LOUA 1PM5A 5CURA 5JCPA 4BWGA 1F8FA 2IE0A 3M6VA 4B3CA 3PHIA 2AXEA 3GPCA 5K99A 1LRKA 2B21A 3N5CA 4C05A 4DDKA 5G1OA 4D43A 1ZOPA 3C39A 2A1IA 1ENZA 3LYAA 4F3KA 2BZ1A 3OWOA 1HQYE 1CZKA 1WW3A 1ZQ1A 3Q8XA 3RRNA 4YA6A 5DEOA 1A9QA 3ACBA 5HCNA 1K6XA 4OHOA 2Q5QA 1E2EA 1Z5GA 4AYTA 4DUYM 4B74A 4X45A 4ABYA 4TV9F 4WK4B 4AY6A 3PNLA 1LDBA 1QAQA 5D3MB 3NHWA 3U26A 1N2HA 4IMJB 2X1HA 4L57A 1T9BA 4KAFA 3U60A 1NNLA 1VL2A 4QM7A 1CIVA 4KXMA 5CGZA 4JT8A 3B7NA 5LU8A 2G82A 1M2VA 1Z4NA 5DDIP 1BW9B 2HEIA 4EFLA 1MIHA 3G8BA 4ZVKA 4B7HA 3DZIA 1I32A 1FU7A 3UK2A 3AG5A 1E1RD 1UM9A 1U8TA 3QYFA 4OU4A 1G1AA 1XZJA 3EBOA 5EC8A 1IN6A 1B0PA 2GLXA 2D2XA 4PYIA 4BMYA 5FPYA 1C7EA 3G2QA 4JR1A 3UQYS 5IT0A 3G7UA 1PL0A 5JARA 1NPDA 3PFIA 3CY6A 1A2KC 2C57A 3HDHA 3ESQA 1E1MA 2QRMA 5JEDA 5HZKA 3V4LA 2BGJA 4BASA 1ENPA 4BVBA 1GQYA 4Y9DA 1V95A 3BE4A 3L1JA 4A0RA 5ALYA 2ETVA 1T6YA 1H85A 3IS3A 3OPYB 1ZBQA 2JB9A 5IANA 4IYRA 4XSGA 2BVNA 1EVZA 1A3CA 1CQWA 2VYCA 5TMDA 5FQOA 3KQNA 4EAAA 3GCWA 3ZXYA 1T3TA 2ZJFA 2AFVA 4WZBB 2X3YA 4L5YA 2QUKA 1QRRA 4NSRA 4I4CA 4OFWA 3V3KA 4B4UA 1EAYA 2MSKA 2RGAA 4MRMB 1TD9A 4FYIA 5KQDA 3OECA 2Z8YM 4KX3A 2L82A 2WYOA 3ZWKA 5D51S 2FN9A 2PGXA 3JR7A 1ZOLA 1AUVA 4C30A 1XF1A 3BHIA 2VDBB 5BMVA 3T7SA 2ZM6B 3LUJA 4MHOA 1SHKA 3ZKWB 1SA0B 3AVXA 2B35A 2V4MA 3AF3A 1T2DA 2W70A 5EZYB 3ZVNA 4JNCA 1AZWA 1G4AE 4W82A 3DKPA 4LIPD 4IDGA 5JAQA 1KP3A 4DR6M 4UAUA 2QVBA 4KDFA 4RPKA 3ZLUA 4LV6A 3WRXA 3ZS9A 1ZV1A 2UYCA 3UK7A 1QYWA 4G0PA 1BDMA 2IHKA 4BMSA 4I1RA 3HFSA 1MDBA 4QDJA 8LDHA 1EUCB 3N2EA 2CWDA 3RTDA 1CERA 3H5NA 2XQVA 1M5RA 3DDCA 2F1JA 3HUEA 3FFAA 3H65A 2NOAA 4UVIA 5DISB 2X5XA 3DMRA 1QWOA 3IOBA 3JAMS 4HADA 3UVEA 3H17A 1AF7A 5K0GA 1QV9A 1XLVA 5A1JA 1IBMB 2PPLA 4FWTA 1SVWA 2VDUE 3ZZ1A 5CDFE 4MPJA 1UXHA 5D1HA 4KLZA 4C6SA 4JBLA 1YF3A 1BS9A 3E5MA 4JLVA 3K0FA 1RCUA 4BNZA 2JFFA 3IIMA 3PA8A 4IP0A 1H6BA 2R68A 4I8DA 4L73A 3E46A 1DV2A 4Q1CA 2B78A 4D6PA 4D0GA 5JSYA 1WOMA 3VPXA 1H4VB 2OGWA 3WIUA 2VIIA 5K2OA 1Q0SA 5HVNA 2LPMA 2VJMB 1VSVA 1UFVA 4AL4A 4EMUA 1ZM2A 3NWJA 4W7HA 1GAJA 5IAAA 5AXDA 2VZ8A 1YE5A 3AU8A 1OQYA 1TU3A 4U6QA 3WHPA 1M0EA 4JJKA 2V5AA 2E9SA 3NATA 3ACCA 1S3SA 5H9VA 3PQ6A 4G65A 3OFJA 3AM5A 2HIHA 4X5OA 3PXXA 1KIFA 3CUUA 4LDJA 2QSFX 1LNQA 4K9KA 2VT6A 4UHCA 4DMHA 3UAWA 1ZN8A 4Z0HO 5JLJA 4MGKE 5LYJA 5B1EA 4R9RA 1PR5A 2D8MA 4CMGA 4BRUA 4QEKA 5EPUA 1CX9B 4WFKA 1WSAA 4BNDB 3IB3A 4J4BA 3VDRA 5JZMA 2Z95A 3Q3IA 4ZHSA 3EXHC 4BLQA 1R4MA 4GVXA 3V1TC 1YDGA 1HO3A 2XBUA 3MBKA 4GKJB 4WCDA 2YUIA 2IDMA 4BFLA 1VIMA 3NRCA 1S2NA 1L4HA 1KRHA 4FT2A 4QECA 4JYAM 4MOWA 2Q0QA 2WHPA 4ZYYA 3KQQA 2QR2A 3NHYA 3NOVA 4MYRA 1USGA 2GWHA 3Q0IA 2YDXA 2JJMA 3IEXA 1Z06A 3N0RA 5CH5A 3OQJA 4DGQA 1EFUB 5FLXA 2NZYA 2CBZA 3E8SA 3MAAC 4QPPA 3NCTA 4HO1X 5DH9A 3NV9A 1IQ0A 1JIUA 1E1CA 1QJ4A 3VR0A 3VSEA 4X41A 1N6IA 4LJKA 4G8JA 2AA3A 2EFYA 1XKXA 3FSEA 3R8XA 1Z5BA 3K32A 1CLUA 4J8PA 4KI0A 1DINA 4TVBA 5BPFA 4B5KA 2L69A 5KQGA 3AERB 1A9ZA 2JZ1A 2WFAA 5FV7A 5ALEA 4TYNA 3O7WA 3LLVA 1JXMA 1ODCA 3QTBA 3LBNA 4URUR 1AE1A 3WBJA 5ADUS 2DULA 4TL8A 4M8NE 3JQCA 8OHMA 1GQRA 4A15A 4IIWA 4L8WB 1W5FA 1I6WA 1GEEA 1UJ4A 2FN3A 4KBFA 1H0HA 3A10A 2WAXA 2GN0A 1XA0A 4Q9NA 1J2YA 4GRDA 4R2IA 5FORA 4J94A 2VQEB 2WTNA 3NG1A 2QN2A 1BVYF 4JL6A 3C74A 4RABA 1P0CA 2ZIZA 3HZOA 5B6IA 3QVXA 3I2JA 3HGIA 4MGKR 3S1SA 2OC9A 3JQ9A 2N35A 1K5HA 1MC5A 3NXSA 1T2CA 3WGNA 2C3OA 5BPHA 3QWAA 2IJGX 3KD2A 3HCCA 3SJAA 3W5JA 4E5KA 2Q21A 4HPXB 2I1QA 4IO1A 3KU4A 3A6HA 5DYWA 3L0BA 1UK7A 2CLFB 3U6KA 5TF0A 1UIRA 2FSUA 3EDMA 1Z2AA 2W4QA 1CUSA 3MRSA 4RH1A 1Z5VA 4PPQA 5KJEA 2V54A 5E1BA 4TS1A 1VG5A 2HJHA 3QEOA 3D4NA 4C4SA 2WF6A 1GN9A 1IOVA 4BNGA 3U44A 1EJ6A 1PQPA 4TN1A 4DV1B 3P9RA 5E1MA 1KY3A 1DCMA 2VF8A 3OI7A 2FWJA 5IVPA 3RVSA 1MIOA 5CITA 1WP4A 4ZOLF 2QLFA 1IYZA 3VKHA 1GU7A 5C8YB 2Y76A 2DZNB 2JVIA 3UMBA 2IDKA 1TPZA 2J45A 3N6RA 4UEWA 4QPJC 1A5TA 1LPNA 1AJEA 4XGIA 2JBAB 4O29A 4U8GA 1R0BA 3FOBA 1YTLA 4N3NA 5FCDA 1HYHA 5K4HA 2HA6A 4XQCA 4WZ6A 1U0GA 4NOKA 5LP6B 4TYWA 1RI3A 2X0KA 5DFLA 1N36B 5BV2P 3K9OA 4AY3A 5EWJB 2GKOA 3UGTA 4G0NA 5JFOA 1PLKA 1QFXA 2JH9A 2HSDA 1QIKA 1Y1PA 3QWFA 3PQ5A 4F2PA 4R2MA 1M5TA 1JKJA 2XPCA 2IHNA 1GA4A 2PUFA 4OHPA 3VSBA 5EEHA 3A25A 4CLDA 2QIPA 2GNAA 4XQ0A 4Q7LA 3I4VA 1VHLA 4NFYA 1KZ4A 1Q6ZA 1XAHA 3OETA 4ZYLA 7AT1A 1DLIA 4K3UA 3T1HM 1CJMA 4GMHA 3HBNA 2GZSA 3WLPA 4ZCRA 1F6WA 6ADHA 2WVHA 4Z86A 1L3BA 2VK8A 5CCDA 1H05A 2O5VA 1L5FA 1IWOA 2C2YA 2HD4A 4YT8A 2EU8A 1C50A 4YAIA 1JALA 2AG0A 2B82A 5CB8A 2G70A 4GOOD 3KQHA 3WGKA 3IESA 4ZZ0A 2NGRA 2VWGA 3MSXA 3FFBA 3TLXA 4L78A 2V6BA 3ICQB 3FWYA 4FNAA 1FTSA 4PPGA 2OD2A 5K3SA 5KDOA 4QUEA 3ZR4B 1TFUA 4XWTA 5IZCA 1NBWB 4J2TA 4MQLA 2ZUDA 2J31A 1JB0F 1IZ0A 3CLTD 5GV8A 3HA7A 1UKAA 4PSAA 1E9CA 3UMVA 5AI0A 1LPSA 2OKGA 3S68A 4GP9A 3ZE8A 2YOGA 5I7WA 4NYJR 5HS6A 2MYNA 3AF4A 2ZYIA 3CN7A 3R23A 3SARA 4WLUA 1OA1A 5B58C 4NH4A 3QLTA 4J75A 2LVNC 2C5GA 3PXBA 2DWNA 3HXQA 1RP1A 3BGVA 2D1YA 1AOXA 4ESHA 3F7NA 1IBLB 4NCHA 4G5RA 1PW7A 3L7LA 4MVJD 5YASA 1XL1A 3AHCA 1D09A 4QBGB 2GCGA 4MPPA 5TDHA 1V25A 3ZW9A 3CLRD 3PEEA 1BE8A 4PYNA 4J1TC 1FSSA 3O95A 2H08A 3BILA 1OBOA 1AHHA 2QRVB 3NT5A 1OJ7A 5BOSA 3PZBA 1H2WA 1MU0A 1ZSNA 2JGRA 4EW2A 4UPVA 1LBTA 1H1LA 1TZMA 4TT3A 4GHAA 4X1YB 1TPYA 4B6RA 4Q66C 2Q5EA 3PTLA 1DBVO 2D2VA 2ZK7A 3QFRA 2JJ8A 3OT5A 4MITA 3M6AA 2IH4A 4MCAA 4GIPA 1Z28A 1TYZA 5K3BA 1IBKM 5AKEA 4Z1OA 3A45A 3EGXB 4P7FA 4ARAA 1W4LA 5A6SB 1KQGA 3JV7A 3CS3A 1G17A 2EFDB 4F7WA 4RHUA 2D0PB 3BMNA 3AH8A 3U3OA 2WAOA 4ZAXA 1MH1A 4UU7A 4LFAM 3VYUB 1QHNA 1E9AA 2ECOA 3RIYA 3O31A 3WB0A 4MAAA 1VL1A 3A9RA 1SVMA 3LWNA 5ELLA 1Y9ZA 1XZKA 1EIWA 1VIYA 3FVWA 5AJUA 4ALLA 1DT3A 3EZYA 4FUQA 1CVRA 3EVCA 1G21A 1BCRA 2R1UA 4WA8A 4JI2B 1UBGA 1U8ZA 2AH5A 1V5WA 2DI0A 4FSDA 2C1XA 5KSZA 3B7QA 1B7GO 4CR8A 2BUAA 1MB4A 3ZW7A 4OO3A 1SC6A 1PLLA 3L4BA 1TT7A 2FEWB 5KOJA 3FNHA 3C7CB 5C1DA 1BCSB 3L1UA 3MWGA 3UA3A 1UKEA 1DC6A 3OQBA 5BV7A 1BEZA 1KTIA 3T12A 3TRDA 1DJMA 1GV1A 4LZAA 4WURA 3ZWWA 4Z7QB 4PHGA 2D8AA 4IXNA 4QJ3A 1TH3A 4QG3A 1V7CA 4X9XA 1J24A 4FB4A 2BKAA 4PCAA 2COEA 1TKAA 2R7NA 1K88A 3NKFA 3ZDXB 4F2WA 1M1NA 2OORA 1YVDA 4PXAA 4RK6A 5EIBC 4IDHA 4ZAZA 2WIJA 4F3YA 3RC9A 4DUGA 4W7IA 4D2IA 2G67A 3ZHSA 5IYZA 3GBPA 2PIAA 4ZHQB 1YASA 3OX2A 1H2BA 2ZBUA 4DV2B 3NHLA 4JBIA 1HDYA 2PH5A 2Z4RA 7MHTA 4QBIA 1YI0A 4YAWA 4K6OA 2JIQA 3LHKA 4NE7A 3ZE2B 2VTEA 5K3CA 2UAGA 4ZARA 1DQSA 2PT7A 3LQYA 1RXUA 4WL0A 4MV5A 5GM1A 3HY3A 3T15A