3FYDA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fydA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fydA01
9MHTA 4RTNA 4V0QA 4Y30A 1R8XA 3FPGA 4DQ0A 5EHGA 1RI3A 3UJ8A 2OO3A 2GLUA 3KQWA 3FPHA 3P71T 4PYNA 5EOVA 1SQFA 1Q0TA 2IH4A 1EAMA 5LSAA 1DL5A 4EMSA 2VS1A 4QTUB 2IFTA 2GH1A 4RWZA 1ZGAA 2IP2A 2JJQA 3TM4A 2PBFA 3CGGA 1VP9A 3V8VA 2PGXA 3KPVA 1AQJA 5K0FA 2OKCA 3K6RA 3PVCA 3P9CA 5D1HA 5GINE 3HCDA 2F8LA 5EMKA 5HIIA 4E2YA 3HM2A 4CKCA 2I9KA 5K8VA 3LDUA 3PB3A 2A14A 5C1IA 3G88A 4F85A 3KPUA 3L8DA 2BR3A 5EZSA 4FSDA 3I64A 3FTEA 4HC4A 4ER5A 5GIPE 5FADA 3GJYA 4PNEA 1I4WA 4EKGA 3KR1A 1BC5A 2OZVA 3M6XA 3M70A 3A7DA 3TRKA 4OBWA 2GB4A 4QTTB 5DX0A 1WXWA 2FK7A 1NW7A 3B3FA 3KPYA 3DXZA 2PLWA 1O9HA 2VZ9A 4E2ZA 2YXEA 3I53A 2PT9A 3R9XB 3I5UA 2ONYA 2KW5A 5K0NA 3SXJA 3PX3A 3KKZA 2ZVJA 5JR3A 4BY9E 1B42A 4HH4A 3OCJA 2ZIEA 1L3IA 3C0KA 2VDUE 5DWQA 5E1BA 4RTPA 5EMJA 2PX2A 5K09A 4AX8A 2I7CA 3P9IA 3PT9A 3KPJA 1NE2A 3GRVA 2NXEA 4DF3A 5ICEA 4V0RA 5EEGA 3NJRA 3FUXA 3G2OA 3G8AA 4ER7A 3T0IA 2C7RA 1QAOA 3P8ZA 1P1CA 5ERGB 3TMAA 2FCAA 3JWIA 5CCXA 4ER0A 3DMGA 3I9FA 4F84A 2P7HA 4H0NA 5EMMA 4RTMA 3OU6A 1VE3A 5CVJA 2ZTHA 3HTXA 1IY9A 4HTFA 5DX8A 4YMHA 4PONA 2GPYA 1ZGJA 2B25A 3B3JA 4RTKA 4CTKA 3G2PA 1JG4A 4P7JA 4PGHA 5DX1A 1NT2A 3M33A 3SR4A 3SSMA 5C0OE 3BGDA 5KYGA 2AOWA 3EGEA 3LCCA 5EQJB 1G6Q1 1KXZA 1KPGA 5K03A 3MTEA 1JG2A 2OYRA 3T7TA 4PCAA 4PGGA 3FZGA 3DOUA 4BLVA 4RTOA 2I62A 1WZNA 3DP7A 3NW9A 5K0CA 5EEHA 2AN5A 4Y2HA 3UJ6A 3C6KA 3REOA 3MQ2A 4F86A 4DKJA 1FP2A 4FT4A 2ZZNA 3SMQA 1QANA 5EHIA 2AS0A 1PRYA 2P40A 3EVBA 2FHPA 1I1NA 1YFLA 1WS6A 2DPMA 2JH8A 3G7UA 4GOND 3FUTA 3LL7A 3LBYA 5E9WA 2XYVA 4M37A 5LQJA 3BGIA 2GAFA 3AJDA 3ME5A 3LDGA 1R00A 2FRXA 3OU2A 5DTRA 2EX4A 3NWEA 2ZWAA 4MWZA 4RTQA 3E05A 1X1BA 2R6ZA 4CTJA 1HMYA 2G1PA 5CVVA 3TFWA 2OY0A 2AOTB 1KYZA 1JQEA 3G2MA 4PINA 4RSRA 3FRHA 5EKXA 4K6MA 1SUSA 2JHAA 2FYTA 5E8JA 4QVKA 4RTRA 1RI5A 2OPBA 4YV2A 2GA9A 5ICGA 3ER8A 2NXNA 1X19A 5FA8A 4MHTA 1P91A 3UA4A 4EVIA 2WA2A 2G72A 3BZBA 3KQSA 2P1DA 2EJUA 2XYQA 5CVUA 3HVJA 3ELYA 2PSSA 3G89A 3OFJA 4PCLA 5DSTA 3DLIA 3CJRA 1XDUA 4Z2YA 3G2QA 4HTFB 5DTMA 1SKMA 5DRYA 2AOUA 7MHTA 4RVDA 3AXSA 3OU7A 3HCBA 5FHQA 2H11A 4OX9Y 4P7GA 5FWAA 4YUYA 1FPQA 1R6AA 1VP3A 3O7WA 1ORIA 2VP3A 3IEIA 1BHJA 3HCFA 4PWYA 2Z6AA 3LDFA 3LKZA 1UWVA 1JSZA 3GRUA 4KDRA 3MCTA 3UJAA 3HA3A 3UWPA 2CL5A 1Z3CA 5BW4A 2PWYA 2P35A 2YXDA 4RVHA 3SSNA 3GDHA 4RVGA 2HNKA 1ZQ9A 5CM2Z 3U81A 1QZZA 1TW3A 3T7SA 1P39A 4ISCA 2BR5A 3ELWA 5BW5A 4QPPA 5LQUA 5K0JA 1FP1D 3FTCA 1HNNA 4CWAA 4DCGA 4RYLA 1NBHA 3K0BA 3GNLA 4FT2A 3SSOA 2Z6QA 3DTNA 1SVUA 4M36A 2IIPA 2EFJA 4PYJA 3G8BA 1ORHA 3SGLA 2ESRA 2PX4A 3FPJA 3B89A 5DM0A 2BM8A 1JQ3A 2CKDA 2E5WA 2O0LA 2IH5A 2I6GA 1RI2A 2YVLA 4PIMA 4PYQA 3RW9A 4OQDA 3FUUA 2IDKA 3AWIA 1L9KA 5LQAA 3HVIA 1NBIA 4FR0A 5HOQA 4X1OA 4RTJA 2ZWVA 5GIOE 3C3PA 1RJEA 3UJ7A 2PT6A 3KQVA 5G02A 3CKKA 3E7PA 3FRIA 4KVZA 3MHTA 4IWNA 1QYRA 4HG2A 2OB1A 3NDIA 4G56A 5EC8A 3TLJA 2CWWA 3TKAA 3WSTA 1YZ3A 2P3OA 1KPIA 5KQRA 3OE5A 3DULA 2NNWB 2YX1A 1NV9A 1R74A 2YR0A 1EQAA 4E2WA 5K0GA 2FPOA 3HCEA 2QM3A 5ICFA 1SG9A 3PFGA 3UFBA 4AZTA 3KR9A 1ZHFA 4OA8A 1XDSA 5EZQA 2PXCA 4U7TB 3A7EA 1VLMA 3GU3A 4FGZA 5E8RA 4DM3A 2H00A 3CJQA 3R24A 3BWYA 3HVHA 5M5BA 4C03A 2IGTA 2PKWA 2AOXA 2PX8A 1M0EA 5FQOA 3QOWA 3UBTA 3BWBA 3VC1A 4AZSA 4O29A 3UJDA 5FQNA 4C05A 1XXLA 3VC2A 3VSEA 3GRRA 1MHTA 4EK9A 4KWCA 4RTSA 5FUBA 4KW7A 4AZVA 1Q0SA 3BWCA 4ER3A 3EGIA 5GOZA 3EVZA 5D1NA 1YB2A 2VDWA 3SX0A 4QDJA 3KQYA 3MCZA 3QV2A 3PFHA 5DXAA 5EVJA 4CKBA 5IH3A 1L3CA 3O31A 1EJ0A 4GC9A 2HTEA 1XDZA 4EQZA 1L3BA 1EIZA 2PWPA 1IXKA 1U2ZA 2P7IA 1KYWA 3FUVA 3KQOA 3M6UA 4IV0A 4PYKA 4BLWA 3NVKI 1KPHA 3IYLW 1Y8CA 2ZCJA 2ZZKA 3JWGA 4HSGA 1P1BA 3CC8A 3EMDA 2BH2A 3HVKA 1FBNA 2P41A 1SUIA 1INLA 4KDCA 4QQNA 1XVAA 3HP7A 2HMYB 3TPZA 2V7EA 10MHA 1NW5A 1VIDA 2ZLBA 4C06A 4GC5A 2B3TA 4RX1A 1N2XA 4XUCA 5GP1A 1YUBA 3PTAA 1VL5A 3NMUF 4L7VA 1VPTA 5LQKA 2AR0A 1WXXA 1G8SA 1RJDA 3HEMA 3B3GA 3O4FA 4PYLA 5E9QA 4HRAA 4ER6A 3KQPA 4E33A 5CIYA 8MHTA 1T43A 2V74B 4PYIA 4BLUA 3DR5A 3LCUA 1NW8A 4YV0A 1R18A 3EGVA 3HA5A 2O57A 2NYUA 2JH9A 3EPPA 3NTVA 3P9NA 4C4AA 1XCJA 1KR5A 1KIAA 3QOXA 2JG3A 4HGZA 1TPYA 3ELUA 5GM1A 1UIRA 3G5LA 4IKPA 5FWDA 3ERCA 5CUQA 4RVFA 5BXYA 3EVGA 3AXTA 3SM3A 3BGVA 2P3QA 3B7PA 1EG2A 3DUWA 3BUSA 4GBED 3DMFA 5BP7A 2CMHA 4QDKA 5E1OA 2ZBRA 4PYOA 5EPEA 4R05A 4OA5A 3UJ9A 4DA4A 2PVCA 2HV9A 2Q41A 5HIJA 2Y1WA 5T64A 2IH2A 1XCLA 5GM2A 4MIKA 3EVAA 3EVCA 3Q87B 1F3LA 2XYRA 5CVEA 2G70A 4E32A 1X1CA 4X41A 3BT7A 5F2OA 1M6EX 2IDJA 1SQGA 2YTZA 5DLYA 2PX5A 5K0LA 1JTFA 2NP7A 5HILA 4FP9A 2AVNA 2ZIFA 4CKEA 4YUZA 1VQ1A 4YUXA 3C3YA 5CVDA 5F2KA 5GWXA 3LBFA 4KIGA 1RJFA 4YMGA 5H02A 2QE6A 2Z6UA 3T7RA 1KP9A 3GIWA 4KIFA 4R8SA 5FA5A 4B17A 1YF3A 1UFKA 3MGGA 5E1DA 3NDJA 1L1EA 3M4XA 1NW3A 2B2CA 2ZIGA 4A6DA 4FS8A 3JWHA 3I58A 3ELDA 1F38A 2QRVA 5DPMA 5C9ZA 4BP1A 4ZTBA 5IKMA 3MERA 3SVZA 1X1AA 3EVDA 3KQTA 3NWBA 4XUDA 2OB2A 5E9JA 4AZWA 2ZZMA 4MTLA 5KQSA 3IHTA 3OE4A 1AV6A 1G8AA 5E1MA 1FJXA 1H1DA 3A4TA 1RI4A 3FPFA 3KPWA 4RV9A 2JHCA 1DCTA 3A26A 2G8NA 5T67A 3GXOA 2ZBPA 4XCXA 2ADMA 3A27A 4KRGA 5HIKA 5EIFA 3M6WA 1NW6A 1G60A 2EG5A 3THRA 5LQNA 3A25A 4X60A 2G71A 3P9KA 2AOUB 3UA3A 3D2LA 1JTEA 2ZFUA 2BR4A 2BM9A 3OFKA 3ANXA 3Q7EA 3X0DA 4YV1A 2C7QA 4WXHA 4NECA 2XBMA 4E2XA 4C08A 5K01A 4GOOD 3P2KA 3DXXA 4WVLA 2LD4A 1D2CA 4C07A 2NXCA 4R6XA 2DULA 3LPMA 3V97A 5HIMA 5FULA 2R3SA 3H2BA 5DRTA 3AY0A 2O05A 2JHPA 2UZ4A 3GCZA 4RTLA 2NP6A 1NKVA 1M6YA 1WY7A 4M38A 3E8SA 2P3LA 3FPEA 2PV0A 3OZSA 4P7FA 5EGSA 5DM1A 4YUVA 4EKIA 1G38A 1N7IA 2PXXA 1G55A 3ID6C 4OQEA 1BKYA 5E2BA 5EIWA 3FYDA 2O07A 5HFJA 2OXTA 4POOA 4UOEA 5HEKA 5FTWA 4C04A 2AZTA 2UYCA 2QY6A 1O9GA 5U4XA 2CMGA 3DLCA 3PX2A 4LG1A 1RJGA 5K0EA 1X1DA 5P8WA 2QRVB 3MTIA 3HNRA 3LHDA 3PLAE 2AOVA 2AOTA 3EMBA 1KHHA 5CCBA 2B78A 2EJTA 3DMHA 4MQ4A 3MAGA 3P2IA 2PXAA 4LECA 4DZRA 5F2NA 4BP3A 3LGAA 2QYOA 4LWPA 2C7PA 1QAQA 1WG8A 1N7JA 3GRZA 4FZVA 3LKDA 5DM2A 3UJCA 5K0BA 3TOSA 3KHKA 4P58A 4YUWA 4R6WA 3GO4A 4DMGA 3KR0A 3FTFA 3CVOA 5DT2A 2AN3A 4LWOA 3E23A 4PIPA 1MJFA 3MB5A 1TW2A 2BZGA 2GS9A 2O06A 2ONZA 2AN4A 2PJDA 3THSA 2C7OA 3C6MA 4QPNA 3BKWA 1JR4A 3BXOA 1ZKDA 4X61A 5E2AA 4AUKA 1DUSA 2UYOA 4DCMA 5KS2A 2OBFA 2UYHA 3GWZA 3CJTA 3ORHA 2WK1A 1D2GA 3OZTA 1JG1A 1QAMA 4QVGA 1XTPA 5CD1A 2YUIA 3LCVB 4GOMD 2HR1A 2IBTA 1AQIA 3CBGA 2VDVE 3LSTA 3HCAA 4A6EA 1YFJA 3RIEA 2YQZA 3NVMB 1EJ6A 1D2HA 5LR6A 4GOLD 3HCCA 3UJBA 4E31A 3EEOA 2ERCA 5HZMA 4U7PB 5DXJA 3UZUA 4R8RA 4P7KA 2AVDA 2HWKA 4JXJA 3TKYA 4GQBA 5T6BA 3OPNA 5DM4A 3EVFA 3FYCA 2ZW9A 4X63A 1V39A 5FHRA 5B1SA 2XVAA 3KU1A 5JUWA 5K05A 1I9GA 1PJZA 5EMLA 4E70A 3KQQA 5EG5A 5KVAA 1RI1A 3GGDA 4QQKA 4CXMA 1YZHA 2ZULA 3KQMA 3LX6A 4OBXA 3FTDA 3B5IA 3P2EA 1JQDA 2B9EA 2YXLA 3R6TA 2IBSA 4IV8A 3VYWA 1JSXA 4E30A 2PY6A 1XJ5A 3G5TA 5MHTA 2NXJA 2N47A 3TR6A 4HGYA 3S68A 3PS9A 3KR2A 2ZSUA 1JG3A 1AF7A 1BOOA 1ZG3A 4GUAA 5LQRA 2K4MA 4GF5A 2H1RA 2WA1A 3GRYA 2ZBQA 3P97A 2ORED 3IV6A 3BKXA 3JWJA 4ATNA 4FSXA 4GEKA 3CCFA 3HA7A 5ICCA 2UYQA 3ER9A 3DH0A 1NV8A 3TM5A 1O54A 2Y1XA 4XUEA 2IPXA 3EVEA 4PYMA 5FCDA 2XVMA 1VBFA 3LECA 5DTQA 3R3HA 3RODA 2P8JA 3EEYA 3M6VA 5DSXA 3TQSA 3OZRA 5LQCA 2FK8A 3R0QA 3BWMA 1IM8A 1OR8A 1R8YA 3DXYA 3F4KA 3FUWA 4M7RA 5EKUA
chains in the Genus database with same CATH superfamily
3I4CA 3EXG2 7ADHA 2QTVB 1OX6A 5SYNA 4TXHA 4PGFA 1YZLA 4XKJA 2OO7A 3T1HM 1VZ3A 2DUWA 4H31A 2V7VA 4MITA 1ZSYA 2ZTLA 4Z7NB 1I7PA 3SQOA 1OGJA 2R6GA 1RKQA 1QH8A 4RM3A 1ADGA 3C1OA 3IT0A 3GZTB 2XRFA 1P4RA 5ICEA 5BNZA 4LCEA 1K89A 4ER0A 1Z37A 4IEIA 4RTMA 1D6SA 1H1LA 3HB1A 3MJHA 3ZWWA 5KNBA 3AW8A 4JLNA 4QRDA 2A4KA 1KXZA 4MGKR 2I87A 3ZGZA 3DEAA 4F38A 4GOND 1FTNA 4L6AA 5IEBA 4XQGA 1CC1S 5FLYA 1Q1GA 3KEGA 4PINA 5AVXA 1PFYA 3N3BC 2NXNA 3RG8A 3CXUA 2H2FA 3VVMA 1U2GC 4H0CA 1NURA 1G6HA 4OV6B 3SJZA 2I4RA 4L5YA 1I8TA 4GICA 1BQ4A 2DWNA 1B8VA 5SZIA 3FUCA 2X4IA 2BP7A 2FG5A 1FDRA 4BLTA 4ZMSA 3FKEA 1XVVA 3I45A 3FTCA 3BE8A 1X77A 1K4YA 1ECPA 2HOQA 2H1WA 1HT3A 2KNZA 5JCZA 1H94A 1PT5A 1RYEA 2PT7A 1M75A 1KH1A 4MRRA 1EFRD 3O3CA 3EXAA 2ATCA 3DWEX 3BHMA 4G6ZA 3W3ZB 5A3VA 4B7FA 4K0KB 1SOAA 1EBUA 2G9QA 5JZOA 3IDOA 4GMFA 1TJYA 3DMYA 3D5QA 4FDAA 3L1KA 4JVLA 4DR5M 4PCZA 3EW9A 1DEAA 1KZHA 2G04A 3HP4A 4M76B 1D8AA 2ORVA 4HWGA 2VXCA 4RSMA 3LP5A 5AOAA 1TO6A 1XA3A 3ZV7A 2YH2A 2ZIXA 3DMFA 2EERA 2ZBRA 3R5JA 1DWQA 5DP2A 2R7NA 4DA4A 1SU4A 2PKRA 3RUHA 2VT7A 1KGSA 4L4RA 1IQUA 1TVKB 1GTZA 3JR5A 4TT3D 1YR1A 1RAGA 4B6SA 1CUHA 1JLLA 2C54A 4UZSA 5KVVA 4FS8A 1JKJA 3IPXA 1QWOA 2AEJA 4KPGA 2P67A 3TK1A 2Y9MB 8CATA 3G1TA 5F3RA 1G6OA 4B3TM 3AB7A 3RROA 1ADCA 1B73A 4MDFA 3SHTA 4GGMX 1E1RD 1G1MA 5K01A 6GPBA 3COZA 2IYOA 4I4TA 4U63A 2FXIA 1Q1EA 2JGDA 4Y6LA 4C2BA 4YUVA 4ZEVA 1A98A 1WB9A 1TCUA 1KOLA 4Z54A 4BWGA 3ZOKA 5BNFA 2E48A 4E21A 4Q9JA 3A4NA 3ILYA 4MX8A 2EJBA 5AKLA 3TIFA 4P58A 3WKAA 4RE5A 1ISPA 5DYYA 1QIJA 3E23A 4JN6A 1ST3A 3MFYA 1QVAA 5JEEA 2X40A 1NZJA 3FIUA 4LPKA 3DP9A 1JG7A 2LTAA 1FYVA 3HCRA 2VF8A 3JYOA 3KUDA 1S8AA 3A31A 5DBGA 1H2HA 4EJSA 1BWPA 3FOCA 4Q1EA 1Z7YA 2PMFA 3O74A 1SKQA 1T1SA 4PRZA 3BFJA 4UARA 1E6CA 4OBXA 4CZ2A 5L7TA 9ATCA 1D0MA 3PIDA 2I65A 3HLYA 4NENA 3PFKA 2CVZA 2K4MA 2V3CC 1IM2A 3P0EA 1YL6A 5IT9A 2CWBA 3F5DA 3RLIA 1L2CA 1PEKE 3VMMA 5FEUA 4QOEA 2VUSA 4NARA 4OGWA 4EELA 5A9TA 4HL4A 3BMNB 1RAIA 2EAUA 4D9BA 1RYDA 4J1TA 2AH5A 3R4VA 1OXXK 1WKCA 2XHEA 2P1RA 4QRHA 2RHBA 1R4MA 3VR1A 3GPXA 2HRZA 3L8CA 2H4HA 1CQJB 3FI0A 1SU8A 3SAVA 3OCJA 3AC0A 3D6MA 5AVYA 3JWPA 3NHUA 2G76A 4EPYA 3I9FA 1CZOA 2QNRA 1O94D 2PWZA 5K45A 1PL8A 1B4DA 1XZBA 5AK4A 3L77A 1GAXA 4E1BA 4N03A 1DMSA 3U13A 4UU7A 4KXXA 3NJ8A 1N4AA 4CBVA 2YYSA 3ZLVA 4P3NA 2GAFA 3DGEC 1HY3A 5L7WA 2R96A 3Q10A 1KYXA 4LZLA 2OPBA 3RFFA 1GFZA 3IO5A 5CLFA 4FKBA 3OY2A 2RB5A 3B85A 1GQQA 4PAQA 3HI6A 1SA0B 5CAEA 4OKNA 3FX2A 1BKDR 1JHUA 2NUPB 4CFZA 1MX0A 2GD1O 1UC8A 3DVSX 4IDOA 1MD9A 3AHDA 1GDTA 1R4NA 4RL6A 4W5NA 1Y98A 4ILEA 2PNFA 3ESDA 3N53A 4J2HA 3E5MA 3J7AS 2UZ1A 4BNNA 1QOPB 1FSSA 1DGHB 4EPTA 3AILA 1FUKA 2OE2A 2RGXA 1NPYA 1CG6A 3E9ZA 1XYGA 4EPWA 4WKBA 4YPFA 1GO2A 5L40A 3HO6A 2M5ZA 3S40A 2J1LA 4D3DA 4LNUA 4WDQA 1WCIA 4EMBA 3A3PA 3E9YA 3M6UA 4LI0A 3ORFA 1KEUA 4ZO6A 1YJ8A 3A8TA 3R0ZA 4NG4A 3YASA 2GF9A 1F1JA 2HMYB 4YAKA 5EN4A 4YLGA 3BQMB 1Z6TA 3EPLA 3UXMA 1NYQA 5LP6B 4NDZA 2JI9A 3U37A 4OFZA 3ZC3A 2XT6A 1NNLA 2P6UA 1M2NA 1Z08A 2VPIA 1KDRA 2AFHE 5HIJA 4Q7EA 2IEDA 2QG9A 5F3WB 3DLTA 4G0MA 1UBUS 3L28A 1XF1A 4MB7A 4L3WA 1VG0B 1P5ZB 1QCYA 2ZVDA 1JHYA 4PSAA 2QM8A 2QBYB 1MPTA 5CB4B 1CQIA 2OSVA 4HYEA 3CINA 3WLIA 4NRWA 3EBLA 2RBKA 4S2UA 2EGHA 2ADMA 5K4HA 3L7JA 4U6SA 2O01F 3RAGA 2C3UA 2JLQA 2BFDB 4N0QA 4IRMA 3PUVA 1DE0A 1LPBB 3W68A 4RAOA 1UKBA 1G8JA 1I5EA 4KHPB 4WXPA 2ZRBA 3R8FA 1C5KA 3Q3EA 3LVVA 5HWSA 4L50A 3INNA 4OX9B 1USKA 4ZO7A 3LLSA 4GOXA 2C9MA 2UVQA 1UOOA 1CTQA 4N7RA 2R47A 5K0BA 4CEHB 3LCJA 3M9XA 3WLTA 3UATA 2FFQA 1VSQA 2EVWX 3BD7A 4R83A 3CX3A 3FG9A 1C8KA 1I6LA 3BFVA 2IBTA 3ADKA 3X1DA 4KXNA 4Q9IA 3WMRA 3N5KA 3H5IA 2X1HA 5AQ1A 2O59A 3LPNA 3SZ3A 4RU1A 5CFNA 2Y1OA 2R45A 4LOIA 3E0QA 4IDQA 1RI1A 1N78A 3W3AA 1GOTA 1C4KA 2CD7A 3FPSA 5FUWA 3X1MA 5JS2A 4RK0A 2XA1A 3ZG6A 3HNOA 5BW6B 2ORED 2NXWA 3A2MA 4RKWA 3MWDB 1G291 5EJ7A 3CF0A 3KJQA 4MLPA 2OO3A 4U9UA 2WYUA 3MSCA 1B76A 3ZYCA 4C3OB 2R1TA 3FAZA 3IUSA 5K3FA 3EQ8A 5LD2C 1KKMA 2WOOA 3C74A 3ZC7B 1N2CE 1RKVA 4L02A 3U7QB 4TWZA 3E7XA 3LOUA 2R4QA 2JH3A 5GONB 3FMIA 4OXRA 3GLFE 3T95A 2GTIA 2XGOA 1XAHA 4OHUA 2EBWA 3G2JA 2OCAA 3TRIA 1VE3A 4CU5A 1GJTA 3LWNA 1AU9A 3VZDA 2FKAA 1UFOA 4MRMB 1POWA 2C5FA 1JDSA 3M83A 4X64M 4N6OA 4R81A 1PRYA 5AW4A 2XYGA 3S8YA 3CH7A 2QNIA 3EPRA 3LAWA 3LG2A 3FOZA 1RRMA 3ADPA 3CKYA 1DIBA 1D9XA 1HMYA 5DI3B 2JHAA 4RSGA 4R69A 4B8ZA 2H4FA 4YV2A 4Q3EA 4MA0A 3BIOA 4PFJA 3IEPA 2JLXA 2HQSA 2BKXA 4B9EA 2VEDA 4Y2UA 3MHVC 5MF6A 2FOIC 2R7AA 2H29A 3HBNA 3MTJA 1ODKA 3HBFA 2DAPA 1AQLA 4RIEA 4A8TA 4FT2A 2GXQA 3VAZA 1BHO1 3SGLA 4O2BF 1W0CA 2JD2A 1K68A 1SXJB 1EZ4A 5CLQA 4DQKA 1YRQA 2HFKA 5LNK1 1AGRA 5JS8A 2SKDA 4RA6B 5TVKA 1YZQA 3WB0A 3ZV4A 1ZMRA 3V34A 3UFBA 2QPTA 4BMXA 4O1HA 1MN3A 2QYSA 3L02A 2HIGA 1DC6A 2AZ4A 3AR2A 1PZMA 1YE9A 3ZY5A 4J29A 5KJEA 4K6FA 1KQFA 1Z82A 1QYCA 4RZUA 3D6TB 2P41A 2WD7B 3UG7A 1T9DA 4DMFA 5J4VA 3ICVA 3QGMA 2W90A 3WI7A 4EGFA 5HCIA 2IWHA 1VJTA 4ISBA 2V0GA 3NHLA 4C7MA 3ZHOA 3KALA 2CYCA 3T9FA 3R44A 3WLOA 4JGIA 5BXYA 3QVKA 2JI4A 4PZAA 3D3EA 2KZUA 3TTWA 2YVUA 1K3UB 3AKEA 3HUEA 2VZ0A 1HYGA 1VQ1A 4LZJA 3M1YA 3L1JA 3WOVA 5JO0A 2Q1YA 4C2UA 1QHHB 4OJQA 2XKBA 4LHVA 3K92A 3E70C 2Q5QA 1B15A 2Z9BA 4IEEA 3K0FB 2Z56A 5FNVF 1Q11A 3A3OA 2QLBA 1NLYA 4MI6A 1JU9A 3THRA 4PHTA 4S1NA 3JQAD 3NORA 2GOYA 1I9CA 3UA3A 5KREA 2LVAA 3HJ8A 5B64A 3SSAA 3T38A 3O90A 4YP7A 3II6X 3KXLA 4YAWA 4C7OA 2QGZA 1ECCA 5C1OA 4RIGA 2O8CB 3CX8A 3JU3A 3EMBA 3ZNOA 1YGPA 2B78A 2EL7A 4R01A 3K3PA 2IZOA 2F1JA 4DR2M 3LKDA 1P44A 1V3UA 1D4OA 1IONA 3MZ0A 2ZAOA 1Y82A 4WP2A 3DBOB 2Z5VA 2KLHA 2C7OA 1GNTA 4DCMA 1G21A 1OAOC 1EX6A 1PM5A 2ZTMA 3QOFA 2IW3A 3DMTA 1OI7A 1VECA 4UNRA 4DNPA 5DFAA 1E18A 4CRWB 4HDSB 4R8VA 2GEBA 1DAMA 2QTLA 2DAMA 3GN1A 2OHOA 1X3SA 3CURA 3SMVA 1DOAA 5CA0B 1RQ7A 4EHIA 1NQUA 1XU7A 3D6JA 2FUNB 2JIQA 4Z99A 1I1OA 4GP9A 5JCJA 1T5HX 2BKVA 4M53A 3TWLA 5C35A 4FFBA 1R9MA 4G0OA 4FWDA 5FO1A 3R0QA 5FL7D 4XQ0A 2QRHA 1QGOA 1JHZA 3D4IA 3K9OA 1Y9DA 4IUCS 4PVDA 5BWCA 5COAA 2PBFA 3KDSE 4ZHQB 5HPYB 1BTOA 3L43A 2A5FA 2N75A 4COKA 1T6YA 4K46A 4UHHA 1X9GA 1O9HA 2B5OA 2YXEA 3C8DA 4F3NA 1NI4B 3P9IA 1R6DA 2CHUA 2B8EA 1J8DA 3A9VA 1ZISA 5KQMA 5C8YB 3EYAA 4O02B 4B8WA 1YBMA 3ICQB 1E2DA 1XJ0A 4D9NA 3SSMA 3FJ1A 5TPWB 5I7HA 2OILA 4HPWA 4I3HA 3IEVA 1QCDA 2LXNA 4DIUA 3GA5A 4JT2A 2V4MA 4MCIA 3SXPA 1YFLA 2X5JO 2AC2A 1U3CA 1XP5A 2JH8A 2P8SA 1PR1A 3W5HA 1COWD 2QQGA 6AT1A 2CLDX 3GJ0A 4JIGA 4RTQA 4R0VA 1RRGA 2I2BA 1YT5A 3NYIA 3FYUC 4TLCA 1Y8GA 2RJOA 3EJWA 1EP3B 2DWCA 5CVUA 1UFRA 3LHKA 2VPZA 2IHVA 3EDQA 5D7BA 4Q9AA 5CVCA 3K71B 5M04A 2RC6A 2PJUA 1LTHR 1OFGA 4C2AA 2ZT5A 4AAYA 3I0ZA 1XRJA 3L93A 1CLUA 1PUJA 2CUKA 3U81A 2Y2UA 2OAEA 4DYHA 3U6KA 2P0EA 1YRYE 2ZUSA 5J2UA 2BWEA 3ZHXA 2E5WA 4X8MA 3K1TA 3DKPA 4YMTA 3QEOA 2DQ4A 4BRSA 1NNEA 1CFJA 3GQBA 3GPLA 3TXXA 2PXHA 1O9BA 3L0DA 3V9AA 1Z8DA 3H6KA 3GMTA 4BVFA 4PX9A 1LS6A 1UJ5A 2CD9A 2PE5A 2PUJA 1CR4A 1H05A 3QHAA 4GWGA 3KCNA 1CQPA 1XQWA 1N0HA 4CETA 4MRVA 1KPHA 1GUZA 4PG8A 3CZ9A 4GPZA 1WMFA 2H9AA 4AIIA 2DAIA 4LRSB 4NONA 4OTZA 3RFVA 3SHQA 3T1QA 1G0OA 1E1CB 4HRAA 4IIBA 2RGHA 4LPSA 3E3LA 2HY7A 4K9LA 4JMLA 3VR4D 1BXZA 3SM3A 1G4HA 1PN3A 2R00C 5AJYA 4JLJA 1N36M 1EQ2A 4LSWA 3UCFA 3FF4A 4RZHA 4KRXA 1KWKA 4O4IF 1T36A 1E4YA 1AJEA 1DG9A 1YOVA 1GCIA 1TECE 2C1EA 2P1ZA 3V2UA 3W1EA 1K88A 1Q44A 1A1VA 1XZGA 2R6DA 2WVHA 1P31A 3H1BA 3ELDA 5CH8A 4EQ6B 2Z0MA 4TKZA 1XNRM 4CW7A 5BSGA 1K7SN 5AI5A 1NLUA 1NBEA 3G3EA 1PGOA 3AEUA 4C07A 3GJ3A 2D7DA 1VPEA 4DRZA 2W71A 4FFOA 4I99A 3W5UA 4Q4HB 4GPD1 2P9CA 2XUOA 3MIIA 1U94A 3IAUA 2O20A 1GNQA 2O2ZA 2CNWD 3SE0A 2EBHX 1AN0A 1BE1A 4MV7A 2ZE8A 4TSRA 1PZEA 3UOWA 3CT4A 1HWYA 4Q03A 2ATIA 1JIKA 5HK9A 3JV7A 3D4NA 1KI3A 5C5CA 1CE8B 5FUVA 2G5PA 4OP1A 1AF4A 3FIJA 1NHWA 4MDYA 1ADFA 5JH7B 2ZULA 2QTMA 1NRXA 3DV0A 2P69A 4TTVA 2MU1A 1IZYA 5FBQB 4AROA 4KVGA 4BNWA 1CVRA 5BV0A 4Y1RB 3LO5A 1JV2B 3UMCA 1QRRA 1EDOA 4RTNA 1LWNA 1QG2A 3GLGE 1EWKA 2Q27A 2ZAYA 5DNUA 3KZCA 4OF4A 1CUZA 3SMSA 3TTVA 2IP2A 1VHLA 3ZHZA 3GHHA 4XVUA 4URZR 4QBIA 2QRLA 5C1IA 2FP4B 1O5TA 4LZAA 4F85A 3GZ4A 1BWSA 4HC4A 4HDNA 3P0JA 5FWXB 2DM6A 4Y2PA 1AKVA 5EZYF 4QU9A 3I53A 3G1UA 3PPXA 3PE4A 3ZJYA 3KKZA 1UMDA 4QDTA 6REQA 2PUWA 1W4LA 1AHHA 2CF5A 2C0CA 3HKDA 3T06B 2BBTA 3E21A 1CRPA 1A9RA 1XC8A 4NBUA 4HSEA 2YKGA 2MIIA 2WSSA 4ZO9A 3N2KA 1B8PA 4IIXA 5ECDA 5JRDS 5HOEA 1EVYA 3QVGA 4BZPA 1SZPA 2EIXA 4JDUA 4U3JA 2ZSDA 4BNMA 2LDBA 2JS7A 3BD9A 1VKZA 2WQ7A 3LDGA 4L4XA 4MOWA 2H1CA 4Z1OA 1BEZA 1LDMA 1SFRA 1J56A 5E8JA 4D9IA 4D45A 1P91A 2FMIA 1OC4A 4BQSA 1KJWA 1QP8A 4GL2A 5ITQA 5FHQA 5ITZB 3O7WA 2I5PO 4M83A 5IN4A 3JWEA 4TV9A 4I5SA 1KJ8A 4QPCA 4HDMA 4YVFA 3OZAA 3WO0A 3BTVA 1KEPA 3LBIA 4A23A 2Y1FA 3C3KA 1JFFA 4KMSA 1WSWA 4GIPA 2Y77A 2GZ2A 2ZT7A 1TGYA 4PQRA 1QQWA 1C4OA 1R50A 1WNTA 4P4UA 2OZLA 4GM1A 3ZVRA 2YYAA 1RJEA 1ZSNA 3CXRA 1JJBA 2GASA 1HDRA 2J0VA 3TQOA 3MTQA 1PZXA 2ATVA 1ACJA 5K0GA 2DY1A 2EZ8A 2FPOA 5AUNB 1IVNA 4JL6A 3OOJA 1AHNA 5GVRA 1WZEA 2Q4RA 1ADJA 4ER3A 2ZATA 1OBHA 1VEJA 2HDNB 2XOXA 3O94A 1ZK1A 3KQOA 4PSKA 1C1HA 1THGA 4MCJA 1OAIA 2G1JA 1NDQA 2XMRA 1DFHA 2VNHA 1ZGCA 4I0WB 2J7KA 3ZGXA 5HGXA 2QTNA 1KR5A 1C41A 4QSMA 1THMA 1OU4A 4YALA 2ZPAA 5HW0A 3HQ4O 4DR3M 2PMDA 2XMSA 2IDJA 2V6MA 1T4DA 3TZKA 3VTKA 2XCUA 1ZMUA 2WFZA 4MARA 4X45A 3M2PA 3SVZA 1NJ8A 2XODA 2YJGA 2GETA 2G7MC 1FVHA 5FDFA 1LZKA 5LQNA 3UPDA 3FCCA 4LFCB 2I2CA 2OO5C 2F5SA 4J0JA 2FUG6 2B8NA 1UKCA 4OBBA 2XEXA 1RRPA 5CJPA 4CG1A 3A0RB 2HL7A 3K70D 2MYPA 1PI3A 2IYZA 3ZE8A 4BLPA 4UMFA 3CYFA 1JRLA 1QE3A 2CEKA 2X0RA 1RWBA 1GU0A 3GRZA 3EWIA 4IHJF 1RMTA 4XA8A 3DCYA 3KHKA 3T5AA 1YJXA 2OENG 1YH3A 4P36A 3A1SA 3IXLA 4TKUB 1HYBA 5EMNA 4RVUA 2O3TA 4G25A 1WU8A 3KD2A 1GGVA 1ZUHA 4HB0A 4E31A 4W5QA 5HZMA 3F78A 2GJAA 1ODFA 1KHTA 1M5UA 4YRCA 3LX6A 3G5AA 4BO4A 2QX6A 4OMDA 3GB9A 3GLVA 3C6QA 1GO5A 5IAOA 5KJ6A 1E2JA 2VK4A 2H1OA 4XYGA 8ATCA 2EW2A 3VJMA 3R9XA 1RACA 3S6JA 3IPAA 2FS1A 2RGEA 1YZFA 1WCWA 1U3DA 1XEWX 3NRBA 4DB2A 2BMDA 3CLTC 1U7OA 2XMBA 4F60A 2H4JA 5IKPA 4F04A 2CDAA 4EJMA 4Q4JB 5HIIA 1YACA 2BR3A 1FFBA 5SZHB 4H08A 4E5DA 3W5BA 1JKMA 1WXWA 2D13A 5TEWA 2NO0A 3V1TC 2ZBDA 3TNLA 4PTZA 1TTPB 3WLQA 2WSYB 1H66A 4IFBA 2HL6A 1NVWQ 2QSZA 4P83A 4Z4HA 4OHBA 4CTKA 2OV4A 3EGEA 5ELMA 3CKLA 4TLMB 4B74A 4P5EA 4BLSA 1T9AA 1ZZGA 4DCPA 4M9XA 2CEAA 2F48A 3DEFA 3OLZA 1GLNA 1N5LA 4LE1A 4CQLA 3UPUA 3NBFA 5ALYA 2LUOA 1TKAA 2EX4A 4MWZA 4Z49A 3CRZA 4RTRA 3G7SA 4W99A 3UA4A 4OGGA 3IQEA 1WZCA 4DCSA 4MO2A 2X3UA 2ZYWX 1EHCA 3ENQA 2H11A 1OI4A 5LZ2A 1Z5NA 4DV7B 2C95A 3QWAA 5KI6A 1IXSA 3TOCA 4PZYA 2P5TB 2PKCA 4A73A 4XW2A 1G4UR 1CNFA 3NBZC 2HUNA 5DBIA 4R9NA 2QTCA 3DT9A 3D2CA 3EXIB 1AHIA 2PUCA 4Y0AA 4REZA 5EWJB 2F64A 3LPLA 2XKJE 5LXTF 3OQ6A 5JWRA 1S2MA 3BMOB 5TT1A 2CBGA 1ZHFA 1OAAA 4Q05A 2AOXA 4O29A 3KV3O 4G3OA 4PG5A 4LQLA 4YDRA 1OWNA 4ARCA 2F5NA 3AF5A 3LT0A 1J49A 4N54A 2ONCA 3LQKA 4XGIA 2XT0A 4TTRA 4NHOA 1AZLA 2OG1A 2H48A 3GGSA 3H0CA 4B3HA 4G5QA 2VHWA 2Z57A 3PPVA 3AOGA 2WIKA 3D1JA 3GUVA 1Z9BA 3EEIA 5IMBA 3AHCA 4AKGA 4ZMBA 4YEDA 4LOKA 1XI2A 2XGSA 2F00A 3RJTA 4AJJA 4C1NA 3IA7A 1JFTA 4KIGA 3WKDA 2J0EA 1UFKA 3NDJA 1H4QA 3WWPA 5B3KA 3N6VA 4ZAFA 4TYQA 3SASA 4D1YA 1QTRA 3AHGA 6CHYA 3Q0EA 1EBBA 2P5YA 3ZE6A 1WB5A 3OZFA 1RC0A 1E3WB 1KYYA 1UR5A 1FSFA 3T12A 3TSYA 4OHFA 3ZEIA 4YRPA 3NU1A 1D2CA 4PRLA 2XYHA 4HXEB 4EKDA 4JXZA 1ZI6A 1NR5A 2TMGA 4XOUA 2Z2KA 3OWOA 4FWTA 1CDZA 2Q5EA 2ZRAA 1YQWA 5J4KA 1MB4A 3H18A 2BKLA 3ZS8A 5CCBA 1J0XO 2CZCA 3H2SA 3RKUA 4X8HA 1N7JA 1ESEA 2JLSA 3V1MA 1TCAA 3CTWB 3G6KA 3BEDA 3EOAI 2CLSA 3WJAA 4TROA 4DDWA 1E2QA 1LSSA 3DMRA 3EZFA 1A69A 1KOFA 5KAPA 4U5XA 3JVUA 3FROA 3PNBA 4AP9A 5LYJF 1IEXA 4E5KA 3KSJA 4FX2A 4FHCA 2XZFA 3C48A 3FYTA 1GA1A 5ERYA 3AVVA 3E9NA 2DWPA 4HGQA 4AWAA 2XQIA 4ID3A 1XJ5A 2HH9A 3GLHB 3NCHA 3IIEA 5JQGA 3KP1E 3DAHA 4GEKA 4RFVA 3EVEA 1HG1A 4URHA 1AX9A 1S8NA 1Z4MA 3DEYX 3OTHA 4RK7A 5BSVA 1Y7IA 1E3QA 1SBTA 1J5EM 4WBNB 3RT1A 5DLDA 4FNGA 2R6AA 2E2WA 8OHMA 4DJTA 1XD9A 5SYAA 4H4EA 2Q29A 4MKHA 2WWIA 1DAOA 3P19A 2BFCB 4TLDA 4DLBA 1J8FA 2V9PA 3A1TA 1HNWB 2O52A 1U3GA 2W6PA 2IL1A 4OD0A 2BH9A 2VNSA 2VK8A 2RD2A 1U7XA 4BZXA 2G1UA 2IF0A 4LTMA 1C9MA 5CLIA 4H0NA 2IZ1A 3HADA 3OWHA 3ROMA 4N6NA 1F48A 2GPSA 2UDPA 4FT4A 1YZGA 1K4MA 2ZXUA 4I50A 4EW6A 3LL7A 3OIUA 3ROPA 4GKBA 1GPKA 2CZQA 1NM5A 1F51E 3WWEA 4BNVA 4LC0A 3ROGA 2XE7A 4EHFA 4UUAA 1XNQM 3H86A 3K2EA 3DEJA 1XZMA 4UHKA 1TF7A 3BZBA 5FTKA 3CB2A 2DAKA 2OVBA 1RYHA 3C8UA 4MVJH 4KLRA 4X8LA 3N2ZB 2WMDA 5DHSA 1OF1A 4RVGA 1AKQA 4NDNE 4D26A 4ISCA 4JSRA 3GRFA 1NBHA 3GFPA 5KZMB 3IDFA 1CCWA 5T8KA 1HZZA 1P1RA 2G40A 1R12A 3IBSA 5JSUA 4BCCA 4MZDA 1R7RA 2NOAA 3MPOA 3UAGA 3F5FA 2XUJA 4MQEA 2FLKA 1QZMA 4BMSA 3QMPA 2D3TA 4M99A 2X0FA 4M0PA 5E4TA 1YULA 3BWYA 5MFZA 3KX2A 1O96B 3KJNA 2VDQB 5JD5A 1RKXA 4DCTA 4RTSA 4RKQA 2QMUA 3DD1A 1AXGA 2QVXX 3SIWA 1IWOA 2QSFX 3GELA 4XLTA 1Y8RA 3IUJA 4CLHA 3BK7A 3F7OA 3F6BX 4GBJA 5IT5A 1KARA 4I9GA 2QTWB 1RT9A 3K0KA 2GCOA 3K1ZA 5DK6A 4HRYA 4HKTA 2NZWA 4B6PA 4RANA 1F5NA 1ISJA 1MNQA 3A9UA 3CB4A 3Q3IA 2J67A 4XVHA 1OAKA 1ULSA 4PYOA 2PRJA 4MS1A 1NJ6A 2F5PA 3PD7A 1ZH0A 4BNGA 1Z6ZA 2OZKA 3CSDA 4TX1A 1RXCA 2SICE 5KWEA 3ECCA 3O1JC 2ZIGA 3DZBA 4L1KA 2FZGA 3RVJA 1DBPA 1DIOB 4XCXA 2D5CA 4K9SA 2NVUA 4P86A 4KB5A 2VT2A 4ZT3A 2VYCA 2CDCA 3S44A 2PMCA 6PFKA 3S7TA 3LPMA 2VJQA 4HNQA 1ES9A 5IPFA 2CB0A 2E6UX 1J23A 1GPMA 4BGEA 2RSLA 3LY8A 3ONDA 2J5RA 4WTOA 4QGSA 2ACVA 4DIKA 3QVLA 5E4YA 1LU9A 5CXXA 1XKQA 4YH1A 1TTQB 5HA5A 2X0EA 4CM4B 4YAEA 3BXOA 4JELA 1SHJA 3SIPA 3CJTA 4QJ5A 1UC4B 3LSTA 5BV8A 5DWDA 3B2NA 3IEKA 1QDTA 2QHOB 3I2FA 2VQDA 4NF2A 4UMEA 3A6ZA 1M2VA 1KU6A 1GZ4A 2JFQA 1M7BA 2HA0A 4URWR 3ABQB 4ZEMA 3OM0A 1YE3A 2OP0A 1UINA 3O8QA 1SUEA 1C3EA 1PEYA 1PW7A 1E9VA 1T10A 5KYUB 4O4JA 1UBTS 4QM6A 4PYMA 4K7JA 1GLVA 5DSXA 4D6PA 2QQFA 3E9DA 1MO4A 3D7KA 2XMQA 3B7ZA 4B31A 2LTUA 1EIJA 4PYNA 4NCXA 2JJ8A 2WKRA 2XBLA 3EFOB 3M6MD 3M5PA 1DMRA 2F8LA 5E7IA 5LLSA 3V33A 2PVPA 4DXAA 4ZYWA 2B94A 4IXNA 2OK8A 5B1HA 3WIEA 5DX0A 4MHSA 3C3AA 4PIVA 2ADFA 1Z75A 2WDPA 4ZDKA 2WR8A 1ZGZA 2QL7A 7CATA 5ALTA 2AXPA 1CUKA 1FTQA 1H3FA 4KAJA 2P9BA 1X7WB 1Z2NX 1VKNA 1ZPDA 4MO9A 3DV2A 4RTKA 3PGMA 4GPEA 5ITVA 1C9NA 4YJKA 3G9QA 3RUDA 3G59A 2JCVA 4HL6A 3EDCA 3RUIA 3WWOA 4WINA 3PQ8A 4XASA 1QDLB 1OIXA 2R6ZA 2GBPA 4ZU6X 1U2DA 5KYKA 3AO0B 5JI2E 5EA2A 2YY6A 1AGXA 3AEKA 2DQZA 3GZJA 1GGEA 2PYDA 4KNWA 2YS6A 1XKXA 1GGJA 3TRFA 2NYVA 4BIIA 1EB9A 3ADBA 2NGRA 4P4GA 3RVRA 4IGKA 1XJCA 3BSWA 5CEEA 2CCJA 2IX9A 4ARZA 1Y9JA 3RT7A 2D5LA 4L2IB 4DV0M 5EWLA 3O38A 3DE6X 2Q0QA 2I6GA 1VA4A 3TEFA 4YRBA 1TOAA 3L79A 3K4PA 2O2DA 2EKBA 1MABB 3I32A 3B38A 3ILSA 5KWJA 4CLRB 2NUTA 4JYAB 4G67A 4E2WA 2GZ3A 1OXUA 3DVQX 4ICIA 4WA8A 2YC4C 2ZTCA 3A1VA 3JD2A 2R4JA 1QFXA 4GE0A 1F8FA 3OZDA 1QUSA 1QE5A 1D1TA 1NF2A 1VE7A 3PFHA 2O0HA 3CEHA 3L8EA 1Y3FE 1XU4A 1XDZA 4MW4A 4YAJA 1KDPA 4QYIB 1ZA2A 3T9CA 2VNJA 1KI9A 4KIWA 3HJFA 4XIFA 3D6UA 4GZ5A 4YWJA 1EYZA 4JV5M 1YE8A 3WLRA 1QX4A 5C18A 1L1TA 1LTQA 4A6XA 5EIAA 3AXTA 2G7ZA 4KNVA 1Y1PA 2HDOA 4Z1MD 2FPKA 1SJ9A 2Z4RA 4BV9A 4GPIB 3RC9A 1E2EA 3FVVA 2Q5LA 3RWBA 5K7SA 3CPSA 3H5WA 4MV4A 4LTNA 1TNDA 3O8RA 1GARA 3PQ7A 2DHRA 3U7FB 3QKSB 4EPRA 3A4TA 2FEPA 2ZDHA 1CZKA 2Z1MA 4Z3DA 4TUYF 5LMUM 3BD8A 3IP5A 4MAMA 2QU8A 3OCYA 1SD2A 2UVPA 3H6GA 3QVUA 2JRLA 1DV1A 1Y8QB 4CIWA 1M76A 3PQ2A 5AKZA 3GVXA 3FY4A 1YONA 1UFQA 1VCNA 3NEAA 2FUG1 4BVHA 1KHHA 3S2IA 4BVBA 3BN3A 5TQ2A 1EFCA 1TEVA 2AJCA 4LNHA 2R6R1 4BNKA 3GO4A 5CJ2A 5JZBA 3QTTA 2F3PA 4XJTA 5FFNA 2C20A 2F3SA 2UYOA 1M34A 2ZM6B 1S2NA 4N5DA 4KFUA 1E9CA 5A4IS 5ULLA 3E5RA 5DXJA 2BGTA 2B6HA 2CK3A 4F6CA 4TVBA 2HO5A 4AY6A 1LPNA 5DNDA 4B47A 5CA1A 1PJLA 1RZVA 1RM4A 1RPTA 5CJJA 1OXVA 4DUYM 2Y4NA 1YTLA 3VVCA 3LKVA 4AP6A 3GEMA 1PL6A 3DNMA 4XIIA 1NHGA 4I3FA 2PKEA 4RJIA 4B3SM 3JQGB 3DZGA 4G63A 1A9ZA 1IBLB 3HDJA 4TGLA 4F7DA 1EG7A 4U4AA 3NHYA 4W6ZA 3EZYA 1IN6A 1SVIA 3KLMX 3O2JA 1NX9A 2A0FA 1ZD9A 4MV6A 1U28C 5KYYA 3HDTA 2JJQA 3RYIB 4RMIA 4WA7A 3SYRA 5HF8A 1JLKA 2C82A 1UMBB 3UK0A 1JP7A 4ZTZB 3ORQA 1A04A 2C99A 4OAPA 4P31A 3KBBA 1I6KA 2QVCA 1IZ8A 3MT9A 3TAUA 3V2HA 3SWWA 4DEXA 2HT6A 2OBXA 1U6JA 3TD6A 3H3FA 5LUAA 5JDIC 1J39A 3DL2A 4QNNA 5A2GA 3O4JA 1U2TA 4YGXB 1MIHA 3ZJ5A 2IF2A 2APJA 3PQEA 1G6Q1 3TF5A 2WNHA 5M7EA 3DP7A 5KNDA 4IUBS 4CPDA 5CIQA 1GZ7A 3KAPA 2IEBA 2PH3A 2XMCA 1TZMA 1VI2A 4TZ0A 3H2HA 1Y5MA 3WAJA 2ZJ7A 1ZM7A 2WF5A 3DLIA 2AOUA 4NBNA 4FQ8A 3AXSA 3L25A 3PNOA 3KWJA 1Q6ZA 3V4LA 5L9AA 3OT4A 3VKUA 4CUZA 3UFXA 2DLNA 1G66A 4MP3A 2VYNA 3ZLJA 2IYLD 2HEGA 2QJRA 1HDXA 2Q28A 4NFHA 2Z7JA 3BSFA 3PNYA 4BLQA 1P6UA 2FRDC 3DNPA 3DPUA 1AKMA 2IS2A 2Y6UA 4UDYX 1I4DD 2CFSA 2JF0A 4YCBA 5CURA 4RTJA 5IBCA 2XSZA 2F1OA 5LWQA 3M3PA 2V8OA 3OE5A 4RSHA 3V4VB 1D1QA 3V1YA 4CDMA 5HJ5A 3UJDA 3NAQA 4AMBA 1WE2A 5JHGB 1XVIA 3TIGA 4HWSA 3EGIA 3PC7A 3SX0A 3VSAA 1CW2B 4F4DA 4G84A 4B5LA 3RJZA 4LVCA 4DLZA 5EFOA 1UQUA 1E99A 1H42A 1L4UA 1GPAA 3J81k 3OCCA 1U0LA 2IPMA 1M1UA 3PEWA 5BWOA 1HLPA 2LE0A 4MIEA 3S2YA 4QYWA 1K7XB 5BNIA 3DUFB 4NBLA 2JG3A 5J58A 3OKPA 2X9NA 3WWCA 2QR3A 1ISMA 4U7DA 2X22A 5DMXA 1BVRA 3U40A 4GBED 5J5CA 4DANA 3IKMB 1RQPA 4KPUA 4MEAA 3C4QA 2XQFA 5FO0A 4B79A 3UTDA 3TECE 1W7AA 3NGMA 1SCDA 3VM6A 3AF3A 4Q3OA 1FDIA 3H11B 1XWFA 3DBLA 1CJBA 3J7TA 2BEVB 1N2EA 1WTCA 1JH8A 2OV2A 4EIWA 4G4RA 2TECE 1YHYA 1H0KA 5KBYA 4MHOA 1EUDA 4DAEA 2WMYA 4D9EA 3BPSA 3A9RA 2ZFUA 1YR2A 2BTEA 1OGYA 3EGXB 4EKIA 1YL5A 2O07A 2QTRA 2PSEA 4C04A 3OLVA 3TINA 2I3BA 4X90A 5P8WA 2IP1A 1N34M 2QLFA 2AOTA 1MQSA 1NVUQ 1HMPA 2ODNA 1EFLA 4U2FA 5GJCA 4ZWNA 3SQNA 1B6GA 521PA 2ACEA 5JNWA 1E5XA 4NQRA 1FZQA 1G7TA 4X61A 1IN1A 2JCGA 1TVMA 3DAOA 3QE2A 1QXSA 4GUDA 2QTVA 2XUZA 3HO1A 2P65A 3RIXA 3T52A 3BQ9A 1BEEA 4Q9LA 1I9GA 1Q3HA 4ROTA 1PX0A 2YY5A 4FFRA 2YXLA 3VYWA 3WXBA 1MBZA 3ZDRA 4WCFB 1X7HA 4IVPA 4HLUA 3ROEA 1JR3A 3JZDA 3UJNA 3DH0A 4Y2YA 5FCDA 3LECA 3IDQA 4QJ4A 2I80A 2P8JA 4WOBA 4NIMA 2QRKA 4CKWB 3ZI4A 4HMQA 3U1BA 2ZJ1A 5EKUA 3HCPA 5TSDA 1M8GA 1KE2A 1NQ5A 2XDQA 2LBCA 4UNIA 3CGWA 3ILHA 5AOBA 4TS4A 2DSTA 5TE9A 2I7VA 5EP1A 2J9XB 1QLJA 3QPUA 4QJ3A 1P45A 3TBFA 1UWLA 2IXDA 4M8LA 3MJ5A 4PO3X 1WKBA 1ELOA 1ISSA 4UFNA 3L26A 3JW8A 2QM0A 2KEBA 2JJMA 3TE6A 5GAJA 5IT0A 1R16A 3MQ4A 3ZKWB 2X76A 1FUIA 3M4ZA 4X1YB 3B9BA 1WRBA 4WUVA 5FOXA 2BEJA 3E4CA 4IQ4A 3GH1A 2QJFA 2NQTA 1WHTB 5CDYA 2C29D 2C97A 4IQFA 1AKUA 4I4LA 5DF1A 4KR6A 1Z5ZA 5FOWA 3BGIA 5DCUA 2I6UA 1FDSA 2UAGA 3C5CA 5TJHA 2CLFB 2A1UB 5H82A 5HSGA 1EMDA 1I4OA 3B51X 2BV3A 2KW0A 3S1LA 3OHSX 5F2EA 1NATA 4TZ6A 1X74A 5CT5A 3LW8A 5EMHA 3QJ5A 3KWMA 4GM0A 1KKLA 4L9SA 4POAA 4U7FA 2WOJA 4HDQB 3NFYA 2YRXA 2C4WA 2EOAA 5B7PA 3DAFA 3RNLA 1JL3A 2YUTA 5G2OA 5GIOE 1YB6A 3A4VA 3ZVLA 5CRIA 3SFZA 3ONNA 3A6GA 3IP8A 2HHCA 1ZQ1A 1QOZA 3F6YA 1JDVA 3K0CC 3LRXA 4CMAA 3TZQA 3IQXA 5BR7A 3SY8A 4LW8A 2F1IA 4HOYA 1T4CA 3PGVA 4IIHA 3DBIA 5AHWA 1L3CA 2PBLA 2OUIA 4QAJA 2FN8A 2VO1A 2WIJA 5HUQA 3O83A 3EUWA 4GX1A 2QZ4A 3DBRB 1TVKA 2QK4A 2JGRA 4RX1A 1EP1B 1R0KA 3PTAA 3H5LA 1MIOB 1RJDA 3BJZA 5ELLA 1V4BA 2ZRNA 3ZQ6A 1MO2A 1PYOA 3F5QA 1JEQA 1T4MA 2J45A 3AWDA 3EVGA 3LXXA 1BGVA 2QN7A 3H1FA 4EEXA 3GFOA 3GLUA 4DLSA 1QZUA 3QNMA 2HV9A 3K05A 1TF0B 1M7GA 4QO8A 3AF6A 1GPUA 1HL7A 2WP8J 1OFVA 3L06A 3J7BA 2OQ4A 2GCIA 4Z3KA 1T6NA 1T8RA 1KQNA 1GEEA 4MVJP 4PYRA 1NN1A 4HQ0A 3C3XA 3USCS 1MG5A 5TB5A 2LZ0A 4X6YA 4UDNA 5EIFA 2JP7A 3PRHA 2VAWA 2PH7A 1DTSA 4YV1A 4K9OA 4JJFA 2WWVD 4N1AA 1Y81A 2H3EA 3C9PA 1G55A 1IK6A 1LSJA 3M7GA 2VWPA 1O1YA 5K0EA 3C1UA 3DLCA 2X9GA 2NTVA 3MJCA 4LJ7A 3INRA 2JFFA 1ZIOA 1H2YA 3J80S 3NM4A 1Z0DA 4M1SA 2OV1A 3HJSA 5FPQA 1U3VA 4IKOA 2B2XA 1YB7A 4FINA 2C9YA 5A7GA 2F4VM 2MJLA 1FX1A 2R25B 5F9MA 3UJBA 5E26A 2NN3C 4U7PB 2EZUA 5AESA 1Z34A 1QG6A 5JZMA 2FWBA 3OPNA 2L17A 5D6NA 4IFTA 3VPDA 4F1JA 3OCUA 3Q8XB 1K0FA 1V47A 3ZW7A 4CLDA 1DB3A 3ADDA 1Q7RA 1FU4A 3GBPA 5D01A 1CQJA 3JYNA 2WP0A 3WLEA 4RVSA 1NPTO 1WF6A 5E4FA 4HHEA 4ZFNA 3C6YA 3QPWA 1E20A 3FPGA 1LS1A 2I7NA 4J6FA 3KSMA 2R4UA 3KDAA 5KWVA 1N5MA 2OM6A 1WVGA 4RGYA 3T7IA 3OX3A 5TPZA 2RJ3A 3X1YA 3FFBA 4RMGA 1KY5A 4S1OA 3SFVA 5DK4A 4BWYA 1OTXA 1LDNA 1T1GA 4BB9A 1XLTC 3FGOA 4CEJB 2R0QC 3WL3A 2G3YA 2WAYA 2B4AA 2A59A 3FMPB 4WACA 2JGNA 2C4KA 1XMQB 1RNLA 1AKNA 3TN7A 5E3HA 4KO3S 4KYTA 1KFJB 4HDRB 2GEVA 4K5QA 1WABA 4EA6A 5EIOA 4X20A 4HVCA 1G8YA 3LMMA 3I73A 1I3MA 2I62A 3P0IA 5FAKA 3C6KA 4KT0F 4QFBA 1NYRA 3N0VA 1SA0A 4P9NA 1PQPA 3RQSA 3C3EA 2NUPA 4Q18A 2DPLA 2GARA 3LUJA 4J9VA 1W52X 1NL3A 2I7XA 1B14A 1SVWA 5IJZA 2O2GA 1X19A 5JBNA 2R8XA 2CFCA 1DGHA 3D6FA 4J7CA 1JH9A 2BL4A 3A14A 5CFMA 5HJEA 3U7JA 2AUNA 3RTCA 3ZCTA 4NPHA 4NXMM 4KN8A 3KOZE 5A3RA 2GO1A 4P38A 4H77A 3EZ2A 3QNWA 4U7HA 4OHMA 5CTJA 2JHGA 3VR2D 4ID9A 1D2MA 1V71A 4P4LA 1WM1A 3O9ZA 3Q3CA 2O48X 4D6YA 3RNOA 3TI7A 1LPAB 3FBTA 2JFHA 4IIVA 2O1WA 3A1UA 1AV7A 4WRRA 4C03A 3L7AA 4RVNA 1GN9A 1K98A 1MAHA 5GQSA 3RD5A 1UEXC 1HE5A 1PNQA 3U6DA 1J0AA 4RH1A 2VSFA 3THYB 4RZXA 5F3WA 3K2BA 4Q66C 4EY7A 1LF0A 2Z8XA 3IUPA 3LQ4A 1NW5A 3EA5A 1LQ2A 1M1YE 4D4KA 4BVKA 4OHPA 4X1IB 2QBYA 3KS8A 5CB4A 2F3RA 3EZ9A 2WIDA 3VR6H 3J7AC 2JH9A 1VJ5A 4EA7A 1YQGA 2IYAA 2EWWA 2BFDA 1ESNA 4Q1DA 3QFFA 2P9QA 3KL4A 3JQQA 4YCMA 5TMPA 4ZQIA 4B7AA 5LA6B 1BX1A 4B45A 1M7HA 1I6MA 4HAYA 4MPDA 3WGMA 3QVOA 2W6JA 2DFKB 1SIOA 3L6CA 4D80A 3PKZA 3ZGNA 1H2ZA 1J99A 4L8RC 3GGPA 1TTTA 1DGBA 4CEHA 4E11A 2A5JA 5CDGA 1FDVA 4YACA 3A42A 1VOTA 4UAJA 3VMFA 5A6VA 4WERA 1MW8X 1CJSA 1ZVKA 2YBEA 2F67A 3RYTC 5BQ5A 3VHLB 1NI3A 3IP1A 2Z5LA 1NX6A 1FIUA 1YWGO 5KTPA 3PUZA 3QI2A 5DH9A 3VKFA 1NULA 2IS1A 1RXIA 2BI4A 3PFBA 2JLZA 4GKKM 3SNHA 2Q4DA 3UWSA 3TOXA 2XLCA 4MB6A 2ZYGA 1OGIA 2Y05A 3MWDA 2B0JA 1NMQA 1GFIA 5AKIA 2QTHA 1DKPA 4P98A 3PIIA 1P1JA 4HUJA 2AMYA 2O4CA 4X93A 1G2OA 3B9QA 3LHIA 5I48A 1XCPA 2H17A 1F6WA 1JFVA 1J2EA 2REQB 5BN3B 3S2GA 4JVSB 3U7QA 3IR5A 2G9RA 5GONA 2NSHA 1F6DA 3DYBA 2HFJA 4K2HA 5KTRA 2YNMD 2QVYX 3REFA 2NU9A 1KEEB 1PQUA 3P71T 3HA2A 5T57A 1FTWA 2JLVA 1LLFA 4LMBA 4IVRA 4DR4M 4MRMA 2YDYA 2ZBFA 3SZOA 1X42A 4GXRA 5HNKA 4KLNA 2BEUA 4S0ZA 5HMMA 1OB2A 1VLZA 1Z28A 1FXUA 3Q11A 4PQYA 5DI3A 4DBGB 2CXPA 3PFWO 4MAFA 2SECE 1R37A 1AXEA 2IYYA 1TDHA 3T0IA 3BGDA 3CNHA 4GLJA 5T4HA 2IU0A 3BBPA 4UBOA 5A5VA 3TLGA 4B4WA 4FBLA 2DPMA 5GV8A 1W30A 3LFUA 3INGA 2Y0CA 4GKVA 1SXJA 1B2LA 4AUNA 3IPCA 5AI8A 1RXVA 4ZV7A 3RYCB 2UUPA 3QH4A 4GLFA 3QYPA 3N7AA 4RA6A 5FWAA 2FWIA 1RZRD 2UZ0A 2E4YA 2VFAA 3UWKA 4O0LA 4OREX 4NBRA 3FMVA 4QHTA 1G3IA 4BC1A 4DADA 2QRQA 4Y9TA 2INGX 1P39A 4QPPA 1T6OA 5ALUA 4Z3OA 2GAOA 5LN1A 1NI5A 4PIMA 5IX8A 1D7OA 3D7RA 2IPOA 3L8YA 3NIDB 1PZNA 5ED0A 2Q3DA 2WD7A 4LJAA 3AKZA 1UZNA 4KV9A 4PS1A 1HOTA 5AVTA 4AMVA 2B1GA 1DDGA 4LI3X 4U7TB 2VUUA 1V6CA 3UBTA 5B2ZA 3UC5A 5IFLA 2DFDA 1QH1B 5CH3A 2ZRDA 4B08A 4IV0A 2HJSA 3WYDA 4JKIA 3TW0A 4UXIA 2ECOA 1INLA 1L4YA 2QR2A 2P4HX 4NJMB 2IELA 3UTCA 3OIYA 3ZZUA 2LP4Y 2J7PA 2NWQA 3K0FA 2VYFA 4G01B 1Z6YA 1JLMA 2ZCVA 1M5TA 4B32A 5TMDA 4OLAA 1PNTA 1B23P 3VPAA 3IJ5A 1XPUA 2JGEA 4RPLA 3KSXA 3KZOA 3HGQA 1JIXA 3I92A 3OJXA 4R8KA 2BJWA 1DG3A 4Q1BA 1U11A 2I2DA 5FA5A 5BORA 3ABOB 4A6DA 5LU9A 1F38A 2O8CA 1J2UA 2OB2A 3CU5A 3L6UA 3EH2A 4Y28F 4DMCA 3I4YA 3KSUA 1UJCA 1Y6JA 4KSYA 4ZI7B 4FNOA 1TC2A 1Q77A 3F71A 2C42A 4NYIQ 4Q9DA 4IPTA 2LD4A 3M9WA 4LZOA 1DC3A 3UGJA 2R84A 3U9LA 1NUUA 5K99A 4DYDA 3T4UA 1YS2X 4IDBA 1E92A 1B1CA 1EFDN 1T5SA 3HXQA 4YXFA 1DRUA 1GPLA 1FA9A 4JBLA 1T2FA 5J63A 4HDSA 1AUPA 4PFKA 4NMWA 2PXAA 1ZN2A 4DT1B 4KQMA 5EVCA 5CA0A 1MU5A 1UUFA 3IP7A 1SKYB 3GAFA 4OYYA 1SUWA 5A3SA 3LY5A 4FYKA 3VZBA 3NH9A 5KTKA 1UEIA 2BLNA 4NCAA 2ZUBA 3WB9A 2DH5A 4F5YA 2J8ZA 3SQLA 4MDEA 5C7YA 2HBQA 5EJ2A 2ZW9A 1E3MA 2G36A 1FS5A 4ZHQA 4MYCA 4QQKA 3P9ZA 2C4MA 3FF1A 1HEIA 1J8VA 1GNRA 2NXJA 5EPOA 4JU8A 3OHMA 1XAJA 4LF9M 4ZZ0A 4MV3A 1U9IC 4BYGA 1NI4A 4WWHA 3GBVA 3AHJA 2HQ1A 1DNPA 3STHA 2CUZA 4MR7B 1R10A 5C8YA 5BWNA 2J0QA 1XD2B 1G16A 3TUIC 4PN3A 2XAUA 1MB0A 3NHJA 1CQZA 3EZXA 3BIXA 3U4CA 2PO5A 5EZSA 3FTEA 2AIRA 2UZIR 3FOAA 4DV5B 2GB4A 3MWKA 4BFYA 3NYWA 2AQKA 1VHDA 1LRLA 3TW8B 4DNQA 4O3FA 4MR9B 4LZZA 3ZH2A 1YJ5A 5C5IA 1ONNA 1GYQA 4J0HA 2JASA 3G5UA 1PTJA 1NBAA 1TK3A 3V32A 3VR5D 5CEJA 4KN9S 1Y1TA 1N3BA 2FHPA 4Q34A 4KNYA 1C9KA 1YA4A 1FY2A 1X1TA 3EYWA 3L0IB 1SU6A 4HB4A 3DG9A 3ZY4A 3TRHA 1IZZA 5AJWA 1FP6A 5K8CA 4K40A 3AIIA 1TJ4A 3SC4A 4ARVA 5LOVB 4CNQA 3A98B 1AKTA 3TWOA 4U2DA 4IP0A 2Q07A 3AMVA 3RV3A 5EP2A 3FWHA 4DBVO 3RU2A 2VHZA 3ISTA 3N8HA 1P7PA 4JI2B 1PHRA 3DLPX 2AHRA 5KSWB 1LI5A 3A2LA 1OQYA 2KNAA 4YRKA 1S9HA 4XSGA 4Z4CA 3O92A 4D8WA 2PUDA 3WKCA 1CEEA 4BHTA 3WLAA 1ZOLA 3UH0A 2GUGA 1E1CA 4OQ4A 3K1YA 3ILVA 4IXDA 4P93A 5AIBA 2I4LA 4LQDA 2WJWA 4MS4A 3OA0A 3WV5A 4X1KB 2V5UA 5ARCA 1MA3A 5CG2A 2NTJA 4RZ3A 4CMBA 1PBNA 1RFGE 4YJFB 1KSGA 2C96A 4C21A 2XXJA 4RY0A 4CCWA 1VL5A 2QZ9A 2JI7A 4NAHA 2VXBA 4EQ6A 2QLMA 1FSPA 2AE1A 1RHKA 5I9TA 5GZ3A 1XTRA 1GUYA 3AUJB 4XWYA 2PMWB 2BZSA 4RHEA 1D2AA 1KC1A 3K9LA 2VP4A 4NV0A 4P80A 3KKQA 4YMGA 4W5HA 3L7DA 5E95A 4Q4HA 4MKZA 2DI0A 4AMUA 3MJRA 1QQ7A 3GGGA 3JARB 4CODB 1PF7E 5KX5F 4AULA 4N3GA 3V7NA 3H1AA 3KIPA 3JQEA 5H9WA 1P7ZA 1VYVA 1PG2A 2AJDA 1KMHB 5TQVA 2VWQA 3PK0A 3M89A 1RQLA 3ND6A 2JHPA 4C0KA 3OZSA 4QE3A 1UJ4A 2F8MA 1V7QA 2E37A 3OQHA 5AVSA 3LDAA 2DETA 4FYWA 4MGKE 2CXRA 3GV0A 1DG1G 5G1OA 3ENWA 5JH7A 5BMOA 3EWSA 2Z2YA 3DKRA 3K72B 4OHKA 1QTQA 2YZ7A 3GP1A 5DU2A 4NKRA 1IXRC 1D6NA 3HN2A 3IURA 3L9WA 4O4LB 4Y1RA 1U63A 2ST1A 1PQWA 4I5EA 2QG6A 5U4QA 2IHKA 4A6EA 1NO1A 2YQZA 2ZJOA 4YHHB 1UODA 2B8TA 3EUFA 2QE7A 1RLTA 3U09A 3GFBA 3BOSA 4XE5A 4MUJA 3VBEA 2JLYA 1QVZA 3NHBA 2WAOA 2FP4A 4NMLA 2ZI6A 1U1DA 3S68A 2X5XA 4QEKA 1W73A 5FWXA 4PZPA 3JWJA 1RABA 3WIBA 3RTGA 4D25A 3DZCA 2XVMA 4I6GA 1QKKA 4WADA 1UOEA 3AM3A 3STWA 3AU9A 5JAQA 3G1WA 3WX0A 3A6DA 1XMOB 1Z29A 3I5MA 4GEWA 3F46A 4OJKA 2XCLA 1JQBA 5EJEA 2BT4A 3WJ7A 3RK1A 3LDUA 2PAAA 3EIWA 2J08A 5DGIA 4A92A 4HH0A 2Y8EA 5BRAA 3GJ7A 3L40A 5JR3A 2B21A 3BHJA 2GEKA 4PCVA 2WSMA 1N92A 3DS8A 1LLQA 2V1UA 4R1TA 3QEMB 3QVJA 1JAYA 5CVJA 2V7PA 3SE7A 1CKEA 1THZA 2IYWA 3KHTA 5ITZA 1NQWA 4M2LA 2WPDA 4P17A 1WZNA 1M72A 5EEHA 4BMNA 3RGWS 1BG6A 3TVTA 2BSQA 1GCOA 2W2LA 4HV4A 4ZZ2A 1M2FA 1UM9B 1P0FA 3FUTA 3JD1A 2RI0A 3FDZB 4QOSA 4LHZA 4MLDA 1AK2A 2PN1A 2J3LA 2MSDB 2FX3A 2EJUA 3DOAA 1J97A 3MJVA 2CSUA 3PXXA 2BUBA 2A3NA 4HNGA 4DV1M 4I2VA 4CJ6A 1MA0A 5HJ2A 4ZCLA 3B1XA 3LYHA 3Q8LA 3AEQB 3HJQA 4JC4A 5JDCA 3T7SA 2DR0A 3C7DB 4DAOA 4HH3C 4L57A 5JWHA 2ESRA 4TRJA 2P2DA 2F8TA 2IH5A 3PCXA 3H04A 4UXHA 1U5CA 3BORA 4X65B 4PXYA 1N6PA 1I0ZA 3RRYA 2EO2A 5EC8A 2B8JA 3NV9A 4M89A 4DR7M 3HCEA 1TYBE 2QM3A 5ICFA 2AE2A 3TLCA 2XWSA 1GKIA 2HK8A 1XXLA 4A36A 1KEVA 2YOHA 5H3CA 3OIFA 1SO8A 4F0JA 3M6IA 3SYTA 4BKRA 2KNVA 2ZE5A 2C4VA 3LSYA 4PEVA 2JIPA 3E5HA 1J06A 4WOJA 1TKCA 4I1UA 5A4JA 3U6CA 3OP4A 1Q0HA 3EF1A 3TPZA 1MENA 1NBWB 4AJLA 4IMRA 2VDBB 1Q92A 4K0RA 3X43A 2GPBA 4NZOA 1UK8A 1G5HA 3CUSA 4EB6B 2MTBA 2XAAA 1ZHHA 1NW8A 2ZJ3A 4FKMA 2HWYA 3EPPA 1KMIY 3OZXA 3CUEF 1NVVQ 3BIWA 3ROQA 3IB6A 2MSLA 4QDZA 2ZM5A 2VNIA 2VPTA 4ZCQA 4QAQA 1KAMA 3TZCA 3CSUA 4HXYA 2HMSA 3PTZA 4WNAB 4LJ4A 4JWKA 2RH9B 1KP9A 1U02A 3LYUA 1YF3A 1L1ZA 1SOVA 4MICA 4C30A 3JVVA 3CO5A 2R5FA 1X15A 3WLJA 2CT8A 2P27A 5IDXA 1GUAA 3TR5A 3GXOA 1W49A 1DT3A 3RGPA 1TPZA 1R0BA 1KZYC 3SHOA 2L4EA 4YY3M 4TKUA 1W36B 1NWCA 4UNNA 5F1YA 2JD1A 1ZL2A 5BSFA 3QUAA 3D8SA 5F1OA 4TV8F 1EDBA 4WFQA 3SQDA 3RQIA 4ZAVA 3U3JA 4FZVA 3JQPA 2QD3A 3HCOA 1GSOA 1EK6A 2Q5JA 5BPVA 1SCKA 3PNVA 1KFCB 4N8DA 1B0ZA 4WT7A 3NBMA 3ZCQA 4MWDA 1QKJA 1IVSA 2P9JA 4TXLA 2I8CA 1LZLA 2CL7X 4UPEA 4KGDA 2WVGA 4Q4JA 3K2QA 3ENZA 5AWFC 1SPXA 2EP8A 2AKYA 2HLPA 1X87A 3SS8A 4N0EA 4O5AA 3MS2A 4CVNA 5JT1A 3OTQA 3OZRA 1L5SA 2IYUA 4HLNA 4IYJA 2RK6A 2AZDA 3PR3A 4LOLA 4D81A 1EA5A 2CWDA 4BTVA 5FH9A 3MJ4A 4QTUB 5EYPB 1Z2AA 1VI6A 1L0BA 4DPMA 4PY2A 3QFHA 4B8YA 4OLBA 3PVCA 1AUVA 3WKBA 4P3KA 2NTEA 3WLMA 1WQ3A 1GAEO 4UUQA 4ZARA 3LF2A 4I55F 3Q40A 4A2QA 3RU3A 1XNJA 3LVBA 2WUGA 1R64A 3SG0A 4MVYA 1E59A 1R6UA 2C2GA 1C0PA 4B2YA 1BQEA 2XZLA 2MOKA 4YWHA 4QOFA 1MV8A 3U7RA 3T7EA 1V8PA 3MTEA 4E08A 1OUMA 2AXQA 2GBLC 4P0PB 2OORC 4C4ZA 5DBHX 2M2IA 1VM6A 3AJEA 1SURA 4GYKA 3EXIA 4YBZA 4FHDA 3W3AD 3Q12A 5EWJA 4EG5A 2W6OA 4BRZA 3ZD7A 4FR5A 2CYBA 4MUGA 4IJVA 1LW7A 3BMOA 1EXDA 3VHXA 2HQRA 3NIBA 3QVSA 4EG6A 1VTKA 2C4UA 1QZZA 2WHQA 3SAJA 3DTNA 4M36A 3S2EA 2PIAA 1AS3A 2K6GA 4U0JA 2X8BA 5KYWA 2W2VA 1DGQA 3K35A 4BNYA 5G02A 4CF4A 5JJLA 5DNEA 2DWMA 4WZAB 1P4AA 1ZXXA 3PQ3A 2LDXA 3UWDA 4AZSA 5F35A 5BNWA 5C7IO 4KW7A 4F8YA 1RM3A 4R41A 3GT0A 3WIVA 3JAMA 3K94A 1X8JA 5FV4A 4E5UA 2QP3A 2WZQA 1TVEA 3QNUA 2HCFA 3NUQA 3R7AA 2IEGA 5HUJA 4ZC1A 3OECA 3P1JA 4DIBA 3NONA 2XGMA 2J46A 1JHOA 2GD0A 2OECA 4OH7A 2NYUA 3RFUA 1XCJA 2C9CA 3PTLA 3G9UA 2QN2A 3CEMA 4UTXA 4BGIA 5KOIA 3GO8A 3GXBA 3UJHA 3NUZA 3WWYA 2J41A 3CM0A 4DQLA 4LBVA 1LBSA 4MPTA 2PVSA 2PKYX 1L5ZA 3IHKA 3KTDA 2JK0A 3TJZA 5LMCA 1ZWLA 1Z22A 3IVGA 2IPLA 4LFBB 5KAMA 3RKRA 1MF7A 1PTKA 1RQGA 2Z08A 3GNSA 4YAGA 3NBAA 2BF7A 4UC0A 4C7VA 5KOJB 4WXHA 3AUTA 1IFXA 4H7FA 1OTHA 2CKMA 1O94C 2I66A 3EY4A 4JI8B 3AU8A 1QP7A 1IN5A 4RF5A 1BMQA 3D4LA 1OWOA 2XE6A 2UYCA 3ZHRA 1WWKA 4JI3M 3AL2A 4GSKA 4HXGA 4RVCA 2XOKA 5G1PA 3N2LA 1VKRA 2PO7A 3GLHA 1KJIA 3AHEA 4MA4A 2G4CA 3H4JA 1PW5A 4JDPA 3LY7A 2C3PA 4BE7B 5IUJC 4IGAA 4WX2B 2BVNA 4EPVA 4C4YA 1TD9A 3MTDA 1BFDA 3UF0A 1XQ9A 1GQOA 4WBNA 1N2IA 3ZVKA 4LF4B 3IHLA 2A1TR 3KU1A 4E70A 1RU3A 4BPRA 1W48A 2BFCA 1JQJC 2ZSUA 1MQAA 1A7KA 1Y3CE 4R5HA 1XZDA 3IV6A 2MSWA 4G26A 3SQMA 4XUEA 1Y6QA 3BZUA 2J85A 2HXYA 2AYZA 3GEIA 3QF4B 3EXHB 2BTOA 3F4KA 4EBBA 4CIBA 1YQTA 4Q12A 3LTNC 1JT9A 4AKTA 4NU5A 2WT9A 5T4EA 1MDBA 4YJ3A 3L0ZA 3BH0A 5F1PA 3QP9A 2VRWA 5K8VA 1JA9A 2NUAB 4FSDA 4X85A 3ICPA 5IWAB 2XNKA 1C3JA 1PJCA 4PLWA 3AOEA 2XNHA 3KD3A 2HF2A 2IY9A 4B2PA 2CMFA 4RLHA 1ZYUA 3LV8A 2PPVA 3CVUA 1F2UB 1M3SA 3S99A 1P2DA 2H3HA 4YJGA 3TQQA 4NVRA 4LYGA 4ABYA 3A37A 3A9CA 2I67A 1UP4A 1IG3A 3NEPX 4PTLA 4NJEB 2MR6A 1E79D 5ADHA 2AKEA 3NW9A 4JLVA 2XZOA 4DLYA 5EXPA 1ENZA 3I4VA 4EZBA 2ZAMA 2O2JA 5ADUS 1E4OA 2OM2A 2OD9A 4NZYA 3FWYA 4EO9A 2IXAA 1XZLA 1X1BA 3VQTA 4ZCTA 4DV6M 1QYDA 3P2YA 1E98A 3FDFA 2I99A 1T3SA 2P1DA 3OURA 3RRXA 1Z4QA 2ZPTX 1YRBA 1YQUA 1ZM2A 3I9JA 4LC9A 1XQYA 3IEIA 3WGVA 4TS3A 2YWXA 4A2PA 1O96A 1QQBA 4GQIA 1QYIA 1C7IA 1TW3A 1H0RA 3HLKA 4HAXA 4E07A 2WSEF 4UHCA 3IESA 2XQGA 3L6DA 2P91A 4EUHA 2CKDA 1WW2A 5B4UA 1RI2A 1FYEA 3O6VA 2DZOB 4EB3A 3ESZA 4R9RA 4P4TA 2WFAA 5B3AA 1P2FA 1U4OA 3TS1A 5K8TA 4MP6A 3H16A 2AUTA 4IDAA 1NFRA 3OEED 3KTFA 2QTGA 3T5CA 5KNCH 4FXOA 4GPTA 3PZRA 4AM8A 1DOHA 1EJ0A 1L7VC 4A6PA 3VDRA 4XLZA 1B93A 4J16C 2EXXA 4JC0A 4BJ1A 3NTRA 4ALLA 4FJ0A 3FZEA 1VIDA 1DJLA 3NOXA 4ZYXA 4A8JB 3R3VA 2FMUA 1G21E 1C0IA 2VP2A 2R8RA 3CV3A 5DEIA 3E1SA 1XDGA 1UOPA 1R9NA 2EX1A 3ZDYB 1ZWKA 3H5OA 4OQQA 3B7PA 3SVLA 3PC6A 4W9NC 2VJYA 3JY6A 1XDBA 3T61A 4Z7QB 3ZCSA 4OK6A 4OVZB 3CPJB 1FCJA 2JCSA 5K0LA 5HILA 4ZEWA 1FQKA 4ZC8A 4X24A 2P68A 3V2GA 1YAHA 2L4FA 4WCVA 5EIBD 3OM9A 5E9JA 3FWKA 3QUBA 5BV2P 3PUHA 3W2FA 4HCJA 5AW1A 4KRGA 4X3CA 4YQYA 1HG0A 1DAGA 3H84A 4ER5A 1SY7A 2IU4A 1ZMTA 1U7HA 1RXWA 3RSGA 1FNDA 4LKOA 4M7PA 1ZUNB 5FPTA 3VZRA 5KJ1A 2WAAA 2O2HA 2FZCA 4JI6B 4LY6A 2N42A 5DM1A 2ZB8A 3SQXA 4RKFA 2C2HA 3A9TA 1GQYA 1WTAA 3HBLA 2G6TA 2WT8A 4YRDA 4DQXA 1NLMA 3A05A 4QICA 5D00A 4NLLA 2CHGA 3LX4A 4AKIA 4H7EA 5KYUA 2B7BA 3U6QA 2BZGA 2E4XA 2ONZA 1IY0A 5HK8A 4D5GA 2OBFA 1GXSB 5B7NA 5BRJA 2VDRB 5AKHA 1TFRA 5B1SA 2XLBA 3EFOA 2C7VA 4GYJA 1L1FA 2R4TA 3PEEA 2YHBA 4BB5A 4KQHA 5MHTA 2VAXA 1G5RA 3DE4X 4GT1A 4RO0A 1CLEA 2CCGA 3EEBA 1EM6A 4LX8A 4RDCA 1XXHB 5EUCA 4LJLA 2J7NA 3PQDA 3U0BA 3K1JA 1JLHA 3LT1A 2OC4A 3GK3A 1RIIA 4XXHA 1KZ6A 1LWOA 1Z2DA 1X7WA 4Q1FA 2VPYA 2ZRQA 3SIRA 4RWZA 4D3XA 2YJ5A 4XCVA 3QIAA 3SDBA 2Z8ZA 1VRVA 2EBUA 3K6RA 4I8IA 4BB0A 4BO2A 5ALMA 5DN6D 3KYCB 5KDLA 5TC4A 1CUDA 1OH7A 2FQQA 5HCNA 2GN8A 1BDBA 1LTMA 4RDXA 2DPYA 3ASUA 3VUEA 3LT5A 5EMJA 1OT5A 3OZ7A 1JJFA 4AKEA 5C46F 1C1XB 1H0SA 3B1KA 3AR9A 4DJDC 3ZBUA 3OZEA 3HYNA 5DX8A 1N6IA 3DWGA 5AKGA 1PHPA 4L5JA 1JG2A 3U4QB 1XR3A 2HHHB 1FP2A 3EHEA 1OYWA 2O6HA 1GGKA 1OLSB 1WPGA 1OI3A 1RRCA 4L2IA 4JJ7A 4LDAA 5HM6A 4N3CA 4BVJA 3VU1A 3LK6A 2Z9CA 3TIXB 4QOGA 5HZKA 1B8UA 1GGFA 2FRXA 4Z8YA 3TXAA 3RRMA 3DAPA 4IMPA 1RPNA 1EX1A 1CS0B 2QX7A 4Y0VA 1IATA 2JLAA 4J94A 1V8DA 1A4UA 3NANA 5ENVA 1MABA 5AKEA 2JXNA 1W1IA 2OFOA 1NVAA 3ZKAA 1JBKA 2FGJA 4IJ6A 3HCFA 2AC7A 4ZYYA 1ZONA 1U8ZA 1TZKA 2MSKA 2NQ8A 2OXCA 2DUNA 5F21A 4PLYA 3K6KA 2WPNA 5H3HA 2BHSA 4MWEA 4D0GA 4UPVA 2V1CA 3A45A 4KO4S 3D8NA 2A7XA 5DV9A 4QYIA 2YIJA 3JPWA 3WQHA 3I9LA 3GROA 3F3YA 3FSJX 3QU2A 4JQYA 2JDID 4Y18A 3TLJA 2ZVQX 2HRQA 5B2EA 2RGNA 3FM9A 3GU3A 2HBYA 3WIOA 2V98A 2ZUDA 3KZMA 5FQOA 4G9BA 3UMMA 4AJ1A 4LF5M 4EK9A 5BMVF 4AZVA 2HMWA 3EQZA 2GUWA 1P0QA 5FF9A 4URXR 4PC3A 2HSWA 3HHWA 2ZG6A 2WSSD 1ZD4A 2OLKA 1W96A 5BOSB 3Q7TA 2LKDA 1J2RA 1XRLA 2DOKA 1HE1C 1NMZA 2HQBA 2J6CA 2OHJA 4UU0A 3M34A 3AR4A 3IQHX 1T43A 2V74B 1DQPA 3QKSA 4Z86A 4K1LA 1FEZA 1WCXA 2DH6A 3BMNA 2WWGA 1KO4A 2P6PA 1PK8A 1ZJZA 4K3UA 2QD4A 1ORDA 3GG9A 1EFVB 4Y2JA 2QA5A 1Y8QA 3UEOA 1V34A 4YRNA 2R5WA 5A0FA 5ITXE 2QJOA 2A88A 3TQTA 4B3RM 3KLPX 4ZTBA 3MERA 1N6HA 3HE3A 3DO5A 2BYTA 2JHCA 2PKXA 3G8YA 1ZRMA 4S05A 2IYRA 4NCJA 3ANXA 5EKSA 3ZY3A 3H83A 2C7QA 1ETUA 1TYAE 1C0EA 4IRXA 5JC1A 3L6OO 3WMXA 2O05A 4IBOA 1GZVA 4UOEA 4FVTA 2ZI5A 3ZDAA 3FE3A 5DHPA 3HNRA 3PLAE 2WZDA 4RENA 4PR0A