3FYDA

Crystal structure of dim1 from the thermophilic archeon, methanocaldococcus jannaschi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable dimethyladenosine transferase
publication title Structural and functional divergence within the Dim1/KsgA family of rRNA methyltransferases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fydA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fydA01
1ZKDA 3D2LA 2IIPA 4R6XA 3ERCA 2OBFA 4PINA 3KKZA 5D1NA 4HH4A 2AOVA 1JTFA 1VBFA 5EMMA 4OA8A 1RJGA 2LD4A 2PWPA 2ZTHA 1P39A 3P9KA 3UJ7A 3A26A 2PX2A 5DXAA 3FUTA 2ERCA 3FZGA 3LBFA 3TLJA 2PGXA 4U7TB 3CCFA 4E2WA 4KDCA 3KR9A 2EX4A 2VDWA 3NJRA 3I5UA 3T7SA 2OKCA 4RTPA 3HTXA 5LQAA 4RTNA 1INLA 5T6BA 3AWIA 2R3SA 3O31A 2CMGA 5K01A 4YMGA 2EG5A 1EQAA 3FTEA 1V39A 3R3HA 4M7RA 4R8SA 3HP7A 5C1IA 1R18A 5DWQA 1MJFA 5EPEA 3VSEA 1JG2A 4QDJA 3PS9A 1AV6A 1YUBA 2QE6A 1RI2A 4LWOA 4F84A 2XYQA 3KQVA 1Z3CA 1XCJA 3G8AA 3ER8A 2VZ9A 3BGDA 1HNNA 3EEYA 3C6MA 1ZQ9A 1ZGAA 1H1DA 5DLYA 4L7VA 4GBED 2O07A 3PX2A 2JHAA 5GM2A 3NTVA 3U81A 1BC5A 5FCDA 4QTTB 2O57A 3LCUA 2HNKA 4V0QA 5EEGA 3KPVA 3FPHA 3UA3A 4HGYA 3GO4A 3CJTA 3EVBA 3MQ2A 4X61A 5JUWA 3DLCA 2G1PA 5M5BA 4EVIA 4PYMA 5D1HA 5ERGB 5GIOE 2O06A 1IM8A 1XCLA 3V97A 3T0IA 1DCTA 3DXXA 3B5IA 1BHJA 1I9GA 1NBHA 2NXCA 5HIIA 2ZZKA 1G60A 1VE3A 3GRRA 3THSA 1NKVA 3OZSA 5K0CA 2FRXA 3FUUA 2BR5A 3CGGA 3H2BA 3PFHA 4OBWA 4AZVA 2PX8A 2VDUE 3HVIA 3LX6A 1YF3A 1OR8A 2P1DA 1BOOA 1PRYA 2UYHA 1SVUA 3DR5A 4MIKA 1O54A 3KR2A 4QQNA 2GB4A 3P2IA 2FHPA 3CBGA 2YUIA 5EC8A 4AX8A 1FJXA 3UJ8A 3FTDA 1X1BA 4O29A 5FHRA 3S68A 5LR6A 2BM8A 3IHTA 3ER9A 3TKAA 3BWBA 3FRIA 3GRUA 4KDRA 2ZBPA 2OYRA 3MHTA 5HILA 1HMYA 1AQJA 4OBXA 2IBSA 5HIKA 4HSGA 1O9HA 4RTOA 1RJFA 1JSZA 1R74A 2FK7A 3HEMA 2OB2A 4PNEA 2Z6UA 2I7CA 4ER6A 2C7RA 2B9EA 3R0QA 3OE5A 4X1OA 5ICGA 4RTJA 5K0GA 5FWAA 1MHTA 4UOEA 5CVVA 2JJQA 4RX1A 3TM5A 4AZSA 2EJUA 4XCXA 3R6TA 3OU2A 2HWKA 2AN5A 3AXSA 1VIDA 2ZULA 3A25A 3I64A 1KP9A 3OZTA 2B2CA 2QRVB 3CKKA 5DX0A 5EIWA 2I9KA 4A6DA 4FZVA 2GA9A 1VQ1A 3G2OA 3OU6A 2AOTA 2AOUB 3BKWA 3C3YA 2ZWAA 4HG2A 5T67A 4YMHA 4YUWA 2I62A 3JWIA 4OX9Y 3BXOA 2N47A 5CVDA 1IXKA 3C6KA 5E1BA 4RTKA 4AZWA 2B78A 1WXWA 2AVDA 5HEKA 4QDKA 1JG1A 1FP1D 5DTRA 2ZFUA 4EMSA 3MCTA 3BUSA 3KU1A 1L9KA 3L8DA 5U4XA 5KVAA 2F8LA 3TPZA 3E7PA 3PT9A 5EEHA 3DMHA 1M0EA 5K0BA 2ZIFA 3B7PA 4ATNA 1FP2A 4BLWA 2ZWVA 3HCDA 1Q0TA 3BT7A 4DKJA 2IH5A 2JG3A 3UJBA 4P7FA 2FYTA 1X1AA 3KPYA 3UFBA 2P35A 4E2YA 4ER7A 3AXTA 3Q87B 5F2KA 5G02A 4C04A 5E9WA 5HIJA 2Q41A 3SSOA 2IDJA 3O4FA 4E2XA 1KYWA 4PYOA 3NWEA 4KW7A 5FHQA 1YZ3A 5EG5A 5E1MA 4LECA 5MHTA 2YXLA 2IDKA 1SQFA 5EHIA 3PB3A 3DXZA 2G71A 3AJDA 2GLUA 3M6XA 4RVFA 3SSMA 3JWHA 1NT2A 4DA4A 2OXTA 3M33A 5GWXA 5K0FA 3FUWA 4RVHA 3G2QA 3VYWA 3FTFA 3ELWA 3GU3A 3HCBA 4PYLA 4AZTA 4M37A 3TMAA 4GOND 3A7EA 4KIGA 4RTSA 3ID6C 3BZBA 3PFGA 2IBTA 4PCAA 4RWZA 3NVMB 4IV0A 5LQRA 4IWNA 2YXEA 3HCEA 3G8BA 3P8ZA 4X41A 2AOTB 3KPUA 5DM1A 3UJAA 3KPJA 5KYGA 2AR0A 4KIFA 1G8AA 2QRVA 1JQEA 2YTZA 2O0LA 5K0NA 2AOUA 2ZIEA 3LDGA 5K05A 4GUAA 1KPIA 2PXCA 4QPPA 3FUVA 1TW2A 4ISCA 1WZNA 3FPEA 2AOXA 2JHCA 3A7DA 5FQOA 4C06A 4P7KA 2YR0A 4DM3A 2OPBA 3E8SA 2AN4A 4YV2A 5BXYA 4KVZA 5LQCA 4PGHA 4FT2A 2OB1A 3OFJA 4IV8A 3G2PA 2NP7A 4E30A 3DTNA 5FULA 3VC2A 3EEOA 1PJZA 2ONYA 4QVGA 5EMLA 4FR0A 5E1DA 2DULA 5E2BA 1DL5A 3JWJA 3UWPA 4RTRA 1NV9A 3GXOA 5LQUA 3K0BA 1YB2A 3VC1A 4M38A 2OY0A 1RI3A 3KQYA 4E2ZA 5CD1A 4RVDA 1I4WA 1YFJA 2YX1A 5ICEA 4POOA 9MHTA 3BGIA 5BW5A 5GINE 3A27A 3DUWA 3HNRA 5H02A 1WXXA 3MB5A 4PONA 1VP9A 4YUXA 3NDIA 3DULA 5B1SA 4CKEA 3HVHA 5BP7A 5IKMA 1G38A 2GAFA 1NW7A 3LPMA 1EJ0A 5E1OA 4AUKA 4QTUB 2ZVJA 4PYQA 3OZRA 3G2MA 1NW3A 2EFJA 4PYIA 1L3CA 3R9XB 3GGDA 2GS9A 4KRGA 1QANA 1EJ6A 1QAQA 1P1CA 1R8XA 3REOA 3OPNA 2IFTA 3EGIA 4DCGA 4DMGA 1SUSA 3PLAE 3CJRA 1VP3A 4FP9A 4CTKA 1KIAA 3HA7A 2NXEA 4CXMA 2AVNA 3FUXA 3M6UA 1RJDA 5KQSA 3FYDA 3SGLA 3GRVA 2KW5A 1ORIA 4C08A 4WXHA 3LL7A 2VDVE 1KXZA 3P97A 2VP3A 3CC8A 2PLWA 5EZSA 4E33A 4HGZA 2PXAA 1O9GA 2PT9A 1SUIA 3B3FA 3P9IA 3QV2A 4GOOD 3LDFA 4GQBA 3EGVA 5HOQA 2PKWA 4HTFA 4FS8A 1KHHA 2AOWA 1VL5A 2ONZA 5GM1A 1RJEA 4C03A 1B42A 1ZG3A 2G8NA 3KQOA 2P40A 3HVJA 3P71T 1I1NA 1RI4A 2ZBRA 3DH0A 4FT4A 4RYLA 4P58A 5CVUA 2WK1A 2V74B 4DF3A 3TKYA 1XTPA 1WG8A 2P7IA 3OCJA 4PIPA 5FUBA 4ER5A 2PJDA 1TPYA 1M6YA 3LECA 4Y2HA 5DM4A 2UYOA 5DPMA 3OFKA 4RTMA 3NVKI 3BKXA 1N7JA 4PYJA 3PTAA 1YFLA 2NXJA 4P7JA 2FCAA 4GOLD 1QZZA 4F86A 4C05A 3RIEA 1G8SA 5HFJA 2UYCA 3EVGA 4PYKA 4ZTBA 3UJ6A 5K8VA 2Y1WA 3K6RA 1JR4A 4P7GA 4BY9E 2BR4A 5K0EA 3TQSA 3O7WA 3P2KA 2JH9A 2R6ZA 5DX1A 2QM3A 5E2AA 4MQ4A 4RTLA 2XVMA 3G89A 2IH4A 1FPQA 4R6WA 1SKMA 4C07A 4KWCA 4OA5A 5EHGA 2AN3A 1P1BA 1JG3A 4X60A 5GP1A 3T7RA 3LCVB 3EPPA 5T64A 1P91A 3GDHA 4H0NA 2P3OA 2PX4A 2I6GA 4HRAA 1JG4A 2XVAA 3HVKA 3KQTA 2NXNA 3IV6A 5LQKA 3KPWA 1XJ5A 4CWAA 1DUSA 1KYZA 1AF7A 2NYUA 3KQWA 3LCCA 1QAMA 3R24A 5EGSA 3SVZA 3UJCA 3TR6A 3RW9A 1BKYA 3M6VA 2WA1A 3ME5A 4PCLA 5FQNA 2IGTA 3EVFA 3AY0A 3FPFA 3G88A 3DOUA 4DCMA 3ORHA 4QPNA 3JWGA 3MCZA 4EK9A 5EOVA 5ICCA 1EG2A 4YUVA 1KPGA 3IYLW 2C7QA 3LSTA 5LQJA 3SX0A 3E05A 3G5LA 4G56A 3B3JA 3UZUA 3Q7EA 4HC4A 4XUCA 3KQPA 3G5TA 3OE4A 1Y8CA 4MWZA 4HTFB 5DXJA 3EMDA 4B17A 2C7PA 5EIFA 2EJTA 5DSTA 1JTEA 2XYVA 1X1DA 4E31A 5F2NA 1ZGJA 1KR5A 3GIWA 3HCFA 3P2EA 1XXLA 1ZHFA 3LGAA 4EQZA 1EIZA 1UWVA 2OZVA 3A4TA 2HTEA 1NW8A 3KR0A 5BW4A 4C4AA 1G6Q1 1R00A 5EZQA 5DT2A 2P3QA 2E5WA 4WVLA 2BM9A 2Y1XA 2YQZA 5CCBA 1L3BA 2GPYA 4RTQA 1SQGA 3OU7A 4PIMA 3NW9A 1IY9A 1NW6A 3KHKA 5ICFA 1KPHA 4R05A 3V8VA 4CKBA 4DQ0A 5C9ZA 2PV0A 2IH2A 3F4KA 4CTJA 5GOZA 1UFKA 2NNWB 3GRZA 2ZW9A 2Z6QA 4R8RA 2PVCA 3MTIA 4GEKA 3UBTA 5IH3A 5EVJA 1R6AA 2PWYA 2H1RA 3B89A 5DRTA 3EVEA 3UA4A 1QAOA 3EGEA 4A6EA 2ESRA 4E70A 5GIPE 4PGGA 1U2ZA 3BWMA 2NP6A 5DTQA 4RSRA 3KQMA 3C3PA 4EKIA 4GC9A 5EKXA 1R8YA 4LWPA 2P41A 1X1CA 4Y30A 1JQ3A 3GNLA 3DMFA 2BR3A 5E8RA 2HMYB 3ELDA 5HZMA 4YV1A 5JR3A 5E9JA 5FWDA 5K09A 2UYQA 1ORHA 2A14A 3EVDA 1L1EA 5FTWA 3THRA 4NECA 3CVOA 2ZCJA 1NV8A 2PBFA 5KQRA 4GOMD 5FADA 1NW5A 4FGZA 4E32A 1WS6A 2FPOA 3LDUA 4X63A 5EMJA 2G72A 2ZZMA 1WY7A 1SG9A 3SSNA 5K0JA 1XDZA 3HCAA 4YV0A 3SXJA 2IPXA 3PX3A 3X0DA 2ZBQA 5KS2A 3PVCA 1RI5A 2QYOA 3HA5A 2V7EA 4GC5A 2PY6A 5EQJB 4ER3A 2FK8A 2BH2A 3ELYA 3LKDA 5HIMA 1D2CA 3EVAA 3M4XA 3TOSA 3FRHA 3HM2A 5E9QA 5E8JA 5DRYA 1VLMA 2OO3A 2WA2A 3FPGA 3I58A 4BLVA 3UJ9A 1T43A 1UIRA 3FTCA 3GJYA 3MGGA 3ANXA 5CVJA 1XDUA 5LSAA 2QY6A 3LKZA 2AZTA 1VPTA 2CKDA 3FYCA 2B3TA 2O05A 3B3GA 4M36A 2Z6AA 3DP7A 4YUZA 3ELUA 3G7UA 5DSXA 3UJDA 2DPMA 2CWWA 1EAMA 2JHPA 2P8JA 1YZHA 3HA3A 4EKGA 2UZ4A 1G55A 5EKUA 4JXJA 3I53A 2JH8A 2IP2A 3M6WA 1N7IA 3DLIA 1F3LA 4MTLA 3FPJA 4ER0A 1D2GA 2CL5A 2HV9A 5LQNA 3SMQA 1NE2A 4OQDA 5EMKA 3TRKA 1M6EX 4Z2YA 3EVCA 2ZZNA 1F38A 5P8WA 3GRYA 1L3IA 3DMGA 4BP1A 3KQQA 2AS0A 1X19A 2BZGA 3SR4A 3QOWA 2C7OA 2XYRA 2ADMA 1XVAA 4QVKA 5DM0A 3NMUF 3SM3A 3QOXA 3P9NA 4QQKA 5CVEA 2ZSUA 4V0RA 5CCXA 4LG1A 4RVGA 3CJQA 4GF5A 4BLUA 1RI1A 10MHA 5CUQA 5K0LA 1N2XA 4U7PB 2HR1A 2PXXA 4RV9A 5FA8A 2XBMA 2P7HA 3DXYA 1JSXA 5CIYA 1Q0SA 5DX8A 2K4MA 8MHTA 1AQIA 3BWYA 3EVZA 3LBYA 3RODA 4XUEA 4F85A 3TM4A 2GH1A 3T7TA 3GWZA 4BP3A 2PX5A 1NBIA 2G70A 2H00A 3GCZA 2B25A 3KR1A 5F2OA 3LHDA 4XUDA 4MHTA 3KQSA 2ORED 3I9FA 3EMBA 3MERA 3MTEA 3P9CA 4IKPA 3TFWA 4DZRA 1JQDA 1TW3A 3M70A 2YXDA 1FBNA 3BGVA 2H11A 2CMHA 2ZLBA 4FSDA 2P3LA 3E23A 5K03A 4K6MA 4YUYA 3NWBA 2VS1A 3HCCA 4PWYA 3IEIA 5DTMA 5DM2A 7MHTA 1XDSA 4OQEA 4FSXA 3NDJA 5C0OE 4CKCA 3MAGA 1QYRA 2ZIGA 2PSSA 2PT6A 3C0KA 4PYNA 3WSTA 5FA5A 1D2HA 2YVLA 3BWCA 5CM2Z
chains in the Genus database with same CATH superfamily
3KXIA 5KAMA 2XCIA 1K5GA 1A98A 5ALVA 3FCXA 4I8XA 1B6SA 2Q0XA 4PLWA 1L5VA 2AJLI 3BJRA 2F3RA 1TA0A 4I1VA 3JY6A 4AKHA 1H9BA 4JKIA 5FL7A 3PUKA 2ODAA 3FTEA 3UWOA 3HQ4O 4D5GA 3ZWBA 2KI5A 5F76A 4AJLA 5TQJA 4E88A 3KS4A 1RTKA 2H51A 3KQVA 1EX9A 1ODTC 2ZXEA 3UXEA 4WCFC 1M1YA 4NYJR 2VJOA 2GOYA 2HNKA 2O2XA 5JUWA 1EUDB 4R54A 5EJAA 3FUUA 1SQSA 3RBVA 2I1WA 2CXTA 1UC9A 3BZWA 2V3WA 3I8SA 3ER9A 4I3FA 4LYEA 4GOXA 3VNUA 5HILA 5AOCA 3KJGA 1S5PA 1ZIPA 3WOVA 4POAA 1NBME 1LBQA 1XU9A 4KXNA 1GSOA 4UNIA 4DQKA 2QYSA 5H70A 1YZNA 4N76A 4YCBA 1WXWA 3M3DA 2JLQA 4PN3A 5IUKC 5FWXB 1U1CA 3DOIA 3L77A 1ZEJA 1FVFA 3PP8A 1UBUS 2WV9A 1PGNA 1NBAA 4I5SA 1IJBA 4UU1A 1N5KA 1TDJA 3WLSA 5EJFA 1UXKA 4JI3B 5FHQA 3TW0A 4S1OA 1ABBA 2VYND 3UT5A 3KEMA 1QG0A 3TMAA 1FNCA 4ZIRB 1EB9A 4M1SA 1GTVA 4MDFA 2R6FA 2C9YA 3UHOA 1XK6A 3PGXA 4URYR 2VAWA 2XUZA 2GCOA 3DCJA 1OA0A 1X9IA 2WYHA 4AP9A 4B09A 2XDQA 2XNJA 2AG6A 2XZUA 4MMZB 1GXSB 4Z4FA 6REQA 4IKEA 4N6GA 1SXIA 1O3YA 4MQUA 2ZB7A 3VR1A 4YS6A 2XIQA 5H37D 2PQ6A 1P80A 1ZBDA 2Q4OA 5KQDA 4JP1A 1ADFA 1QDUA 4JEIA 2GF9A 2AZXA 1GARA 3G79A 4YHBA 1U3WA 3OCJA 2EATA 4B1FA 1D8TA 4QGGA 5ELXA 4LZOA 4EMUA 5JMPA 4FX5A 5E6RB 1H2EA 1MPTA 2WOJA 1M66A 2A59A 3P2KA 3QPVA 2A0FA 2WU8A 3ZU4A 1PNQA 3AHEA 3QE0A 3CUKA 2RG7A 3Q8KA 3GLVA 3A3PA 2D7GA 1DO2A 3PU6A 1GCIA 4G56A 5HFAA 1NFRA 1ZJYA 1B3RA 3BEOA 1I10A 4CLEA 2YVQA 3JD4A 4DNFA 1IHOA 1WHSA 3P5SA 5TQ0A 2WFZA 3L2OB 2JIPA 3RO7A 5TQVA 3PF8A 3C6BA 3CM0A 4ND1A 2IIQA 4IF6A 2FSIA 1ZGGA 1FOEB 1R9NA 4WLVA 3UK7A 3QF4A 2ZJ8A 3NT2A 1T4BA 1RRMA 4TTAA 3QEBZ 5LB4A 2O01F 1U9IC 5K7SA 2AX4A 2DLDA 3OUZA 1A69A 4C4TA 1PJLA 4FVTA 3DE4X 3LVBA 4COKA 5BRNA 1QV6A 1YQQA 2QMUA 2PMFA 1XDUA 1KMHA 2HYDA 5EIBD 4C0KA 1HNZB 2YDXA 4A1OA 4TX1A 2V7UA 4LOIA 1Y3BE 2OFFA 3SHTA 1GIAA 2EKDA 3IQHX 1HC7A 1W0JA 4TUYA 3NWJA 3QLTA 1ACLA 3BH6A 3HU5A 3KJQA 5FTJA 5DBGA 4LG1A 2RB4A 2ZP1A 3R0ZA 4GKJM 3LOQA 1UP6A 3SJUA 1Y3CE 2WD7B 3U3XA 3JQFC 5BSKA 3DUFA 5B6PA 2DRIA 5CCEA 3ED5A 1OGYA 3ZGLA 1WQ4A 3GBVA 2YVLA 1VA4A 4N47A 4AY5A 4IIXA 2WSCF 4JB0A 3BXXA 3F3KA 4IOLA 3MOSA 3HDVA 5ALKA 4D46A 1BD4A 1G59A 3AUFA 5AOAA 3SE7A 4HLUA 1P1FA 3JVVA 4D3XA 1G5PA 4GMFA 3P45A 3IULA 3QA3E 1J0XO 2Z2KA 2FX3A 2FZEA 3V42A 4RQTA 5H1YA 4I19A 4BJ6A 1Y9AA 3D9QX 3VR6D 3RK1A 3IDAA 1E2HA 5LL6P 1I3OA 4WVFA 2XCLA 3EAFA 5FF9A 3W04A 5KX5F 4ZO6A 4UDOA 1FXSA 2FWAA 2VTBA 4O4HF 4WJZA 1FXWF 3RS0A 4JNCA 3LCMA 3TOZA 2O2HA 3DMNA 1YUNA 3R4CA 4YT4A 1M0EA 1C14A 3NALA 4CM9D 5BMOA 3T5DA 3WA7A 1EHYA 1O2DA 1N6OA 1NI4A 2PRIA 1I0IA 4M0WA 5JFTA 5AW0A 3LO5A 4F3CA 3T3NA 3ZV7A 3KOYA 4OY3A 3GGSA 5DNVA 1FFDA 5EN4A 4EW1A 5FLXA 5FEMA 1DAPA 3PDJA 5J2UF 4Y8VA 2XW6A 5TX7A 2P4HX 1Y7IA 3CNQS 5BVHA 3EWNA 4TLAA 1K89A 1NU6A 4PRLA 2JNWA 3VDRA 3A37A 3WKBA 1OXTA 1A4RA 1LJLA 2NGRA 4BKRA 4E2FA 4BE4A 3CSUA 1IY2A 5AK0A 1UZNA 2BCEA 3T3PB 2ZE5A 4MW4A 4C7OB 2P9YA 3PWZA 1QV7A 3L6OO 4AO6A 1DJPA 3W2EA 3KQOA 4OQLA 1OAKA 2JARA 3U62A 5C35A 2G0TA 3GFQA 3F92A 4LOAA 2GHRA 3TBHA 4DBVO 1XA4A 3X1DA 4E03A 3KJFA 1UFQA 5C8YB 3EZXA 3PF9A 5CITA 5DNDA 5HKLA 5LYJB 3TL6A 3OQHA 1ZUIA 3ITDA 4XJVA 5DW0A 4QECA 1MEEA 2C3UA 4BVLA 5DZSA 1T9CA 4HNTA 1VHQA 1SHKA 4WFQA 1U9ZA 4DG5A 1Y8QA 4Y6QA 3FOZA 1TU3A 4E31A 1K4MA 4F46A 2O8NA 3O0DA 3LQYA 3OFVA 2W70A 3IVCA 5DGXA 4BMNA 3SEQA 2C5RA 2AEEA 2PZJA 2BYTA 5DTQA 4MUNA 1U7TA 2Z98A 2AGVA 3GMSA 3IR6A 4DV4M 2YOHA 3QOFA 1L1EA 2PGLA 2A1IA 2G63A 3B6EA 2DVWB 3EAQA 4YAWA 1ABEA 4GI1A 1RRPA 3BE4A 1HLGA 3DLBA 5U1PA 5JXGA 1ZI9A 3STWA 1Z0AA 1UFOA 3ZEIA 3U4MA 2JHGA 5IHPA 3TW8A 4MR8B 4XARA 2D8MA 2VT2A 2IYQA 4F5WA 4R4JA 2WAYA 4IGKA 5I9SA 1LEHA 3FFAA 2G7ZA 2I6QA 3EUFA 1DGHB 3RV4A 4X62M 2HYIC 4CG1A 3M6IA 4A10A 3TH5A 4L5YA 3IVXA 1VCNA 3BIFA 1DQRA 2J46A 3GQBA 4DV2B 3EXFA 5EUMA 3P9CA 5CLIA 1GY8A 2VHVA 3NUZA 3SC2A 5TJ9A 4PZDA 1D3AA 4KG7A 2IIPA 1TLLA 1WDMA 2YW2A 3HI6A 1NNLA 3LCRA 2BEWB 4Y18A 4L6CA 2JL1A 2DSTA 2XYQA 2AFHA 3KKKA 3FI9A 1JLLA 2GK3A 3EZFA 2W8ZA 5FX2A 3GEIA 1OVMA 3T54A 1WD7A 2BHRA 5D5PA 2BFAA 1U0HC 1OWPA 4FJ2A 2H4FA 1G8GA 2R68A 3F7NA 3V55A 1WU8A 1J8DA 1QUTA 1EH5A 4BZQA 1XO1A 3TLGB 5SY6A 4RTJA 2C2WA 3KOYE 5EIWA 1K66A 2C4UA 4OK6A 1SMKA 2C58A 1Z2AA 2ZJ3A 4G1BA 2BAGA 5INTA 3CCBA 3GGJA 4A5SA 1NSYA 5AKGA 1Z12A 1IBMM 4H27A 4DKJA 3D54D 4ITVA 3L06A 1P2UA 4R69A 3NFRA 4FMCF 4NICA 4B6RA 2V4MA 2WY2D 1QTIA 1UL1X 3W0FA 1GRQA 1ETUA 4BFVA 1E2NA 1RAGA 3GVPA 3FZEA 4D8YA 4JBXA 3ICPA 5GV8A 4UBNA 3WI7A 1QNFA 3NPMA 1YLAA 4M9CA 2FUCA 5EKTA 1TI7A 2RGAA 5FORA 4LJYA 3I04M 5JDCA 2GAAA 3NGMA 4R1QA 2G4LA 2QUBA 1VHJA 3PRYA 4QVGA 1QYIA 4DSNA 4UAUA 4GGPA 1CFZA 3DT8A 3Q15C 1HPLA 4WY8A 3TZHA 4BYGA 3E7WA 1E59A 1WXXA 1RWNA 2R7AA 3EIXA 5F1PA 1NW3A 2XPCA 3BTVA 4OAPA 5JI2E 5EWJA 2YRFA 2MWMA 3OHPA 4XQCA 5K8CA 4F04A 1ZD8A 3PGA1 3CKLA 2F1RA 2BFPA 3DW1X 4KMSA 1WP9A 1A5AB 5F2EA 3B74A 4L0MA 3FKQA 1XTPA 1GYQA 1GQQA 3EIUA 4TLDA 4X8HA 4RTMA 2OBNA 4WFKA 1L1RA 2VK1A 2VSNA 4EDHA 1RM5A 1IXZA 2P78A 2OYSA 5DX1A 1YA4A 4CM3A 2GEUA 1DV0A 5FI3A 1F8YA 2RONA 1W88B 2GZ1A 1UK6A 1OBVA 1KOFA 2BJVA 2C4KA 3LBIA 2IGTA 3R5KA 3I2YX 4LRWA 2R86A 1WR1B 3V32A 1QC5A 2FH5B 4ZU1X 2B8WA 5ALSA 5DSTA 4PR3A 1N2IA 4DJFC 1PTJC 1PJ2A 1CETA 1HE1C 3IKMB 3N5CA 3GG9A 1N5OX 5HE9A 4S1NA 3FSRA 1CV2A 4ZI5A 1YVRA 5M04A 4BMDA 3HCNA 1DS6A 1X8LA 3SBDA 2WNSA 4DSZA 2YN4A 3BQNB 1RLJA 1MA0A 4WKOA 5FDFA 2W98A 1E9AA 1HO3A 5E8JA 1BDHA 3QX3A 3KXLA 3DVAA 2IZ5A 4TVKA 4XYEA 5ITUA 5DM60 4QUDA 1B0AA 1OV4A 4BJ5A 1NE2A 4DV0B 4TTPA 4UEJA 4EYOA 3ZCPA 2GPWA 3K9WA 2AFHE 3LBAA 4JJFA 2IYVA 4P8RA 4RPIA 4M9XA 2QENA 4I55A 3REFA 2FW9A 3I9FA 4RDXA 3TOXA 4A0GA 1L7AA 4JHLA 4C2UA 2WICA 1VBMA 1BH6A 3OQOA 4UPDA 2PT6A 3FFBA 2JASA 1P2BA 2IQIA 3UXMA 2HRCA 2X1LA 5FNVB 1DBQA 2DQYA 3NATA 3ZU6A 2VDWA 4K6HA 2CD7A 3A10A 4I2VA 5E3HA 3GPXA 5HJ7A 1PGJA 4JSRA 2Q6IA 2HHHB 2DI0A 2P62A 4X6YA 3A1FA 4LMPA 3PC3A 4JVLA 3A6KA 5BQOA 1N4AA 4P93A 1O89A 3KTFA 4UUMA 3L0OA 3V80A 4MUBA 2ZYTX 1KRXA 2NN3C 3IILA 4PYMA 1E5QA 1H8EA 3V97A 1KDRA 1HFJA 3K2IA 4MV1A 3SC6A 4QDZA 2IVFA 3P2OA 5A2QA 4PHTA 2WWFA 5EIHA 2X9NA 5DASA 4J1QA 4M7WA 4ZVUA 4D5EA 2GXSA 3CTMA 3C4QA 4FWGA 1SPBS 3KIPA 2XF8A 3R7BA 5ALLA 4ER6A 1G4HA 2D74A 1E99A 1SPXA 1XYVA 3WS7A 3ZWWA 4JI1M 3G5UA 5I8WA 4WNIA 3D0RA 5CFOA 4A0RA 4FEEA 1PGYA 3QU4A 2POCA 2EX1A 2B99A 1V4BA 3V1MA 3K73O 1DXYA 2ALJA 1VE6A 4A2QA 1QDRA 1X7XA 3JTEA 4RGVA 3SSOA 1XDGA 1V5GA 4F1IA 2FXVA 3N8HA 1QK5A 4BPBA 1WMAA 2OXTA 2Z0MA 2AJCA 2XNCA 3A0RB 3HBJA 4PSKA 4B7XA 1SVNA 3RQSA 4ZT2A 5JS2A 1I0ZA 4NYIR 1Z7WA 1UBMS 3E8SA 4IV8A 2JCGA 3UAXA 2HEIA 1K2WA 1DL5A 1QKKA 4LHYA 3QH4A 4CPDA 3QVLA 3EPJA 3HKEA 3PHBE 1G38A 1MAHA 5GADl 3VGPA 4PYIA 2YYAA 2Q5LA 4Q47A 2IFTA 5FWYB 1MOZA 1XAJA 4P2BA 4ONEA 4FMPA 3L82B 5K3CA 3E5MA 3UGQA 3AF3A 3IEMA 4GBJA 5BMVA 2WKPA 1NG1A 1N2CA 5AW7A 2VLIA 1MR3F 4RF4A 4BMSA 2Z56A 4LUCA 3OMWA 2ACWA 4V2UA 5JCJD 1SCQA 4ND3A 1PJJA 5JC1A 2ZIXA 3I1JA 2WF8A 3NGXA 2G9UA 4CMEA 1VEGA 3RRYA 4DR5M 2QJFA 5C5DA 4RFLA 4XIGS 3DBOB 1ZH0A 4Q3BA 2W90A 1KYQA 5DHRA 2W2KA 3QYFA 1B00A 3OE1A 3BN3A 2JY5A 1WAMA 2JAPA 2OP1A 1XLWA 4V0NA 5CDYA 1E9DA 3R74A 4UTXA 1KS9A 5KYWA 3LLUA 3T94A 3PQ3A 4Z7QB 4MVJA 1IBCA 1YB5A 2FZ5A 3BMXA 3MMXA 1O6GA 4DWJA 2KBEA 1ODLA 5MN6A 3M1YA 3MBIA 4KR6A 4G0OA 1XDWA 1Z07A 3HA5A 4E6EA 3LRXA 4IGFA 1Q0TA 1KH2A 3ETEA 3S3TA 4Z0NA 4RA6B 1T2CA 3FOFC 4CLOB 5I7UA 3HCOA 2XGNA 1XXHE 4JR0A 2IV2X 4WA7A 5MF6A 2CWWA 2AXQA 4BB9A 1CR2A 1N6RA 4DLVA 2N46A 4XVCA 4H3HB 4K1LA 2P90A 3Q88A 2QQEA 3DS8A 2WDPA 1FBNA 2WIBA 1I94M 1AC5A 3D8TA 5IKEA 1QYRA 4JJ7A 2JGFA 4TVOA 3STXA 3UXYA 4UE6A 3BOSA 2VA8A 4CEHA 1NN0A 3CUYA 1XHBA 1XZHA 2P2DA 1KC1A 2B8TA 3KKNA 2ZRJA 4KPYA 4DHWA 2IY9A 3INNA 3LY8A 2RK6A 4EJSC 1L6IA 2P91A 2Z1DA 2C9ZA 2H3EA 2J9YB 2WM8A 4M8NE 2V96A 1FFHA 1FTQA 4JDUA 4R0NA 3OVMA 3ZWVA 3E8MA 2YNMD 4MAMA 5AJVB 4PANA 2Q1XA 5JZBA 5CCDA 2NXCA 5KYUA 3B7QA 1TQDA 3RFWA 5CBPB 4EVSA 1UF9A 4PAOA 1DWQA 1O6BA 3I9KA 1OXBB 2WZCA 3A1TA 4U6QA 2OYRA 4Y6PA 1Z63A 1HMYA 1XF9A 3SOZA 1Y4UA 3IMGA 3R8FA 3O2JA 2GNOA 2P2LA 3GEMA 4JX8A 1EWVA 2FR0A 5EIAA 2P9GA 1DUVG 4MROA 3WYAA 1JALA 1OB2A 1JG1A 5ER9A 4HGQA 2G5TA 3ENZA 2WWYA 3NI2A 1THZA 4MPTA 1I32A 3V34A 3L7BA 3U6EA 1F8UA 4OHKA 4DRZA 1EFHA 4O4JF 3L02A 4OXXA 2F62A 2Q62A 4IDEA 4IX9A 4K9DA 3A1SA 4NTZA 3OOHA 4IV0A 3WNCA 1XZLA 2Z7JA 3VDPA 3H1AA 5HKAA 4GSKA 1G7RA 5AW4A 4W5WA 1SIBE 1G8MA 3BAFA 3CZMA 3IPXA 2X8AA 3P7MA 4CT4B 2X8BA 1UBHS 1TOAA 2JEZA 1P4SA 2A67A 1QH1A 3NDIA 3TYXA 4YRCA 4J16A 2QPLA 2JGEA 4Q3KA 2AV6A 2RGNA 1PJCA 1QVWA 4OUDA 3FW1A 2OO5C 1JV2B 3I61A 1AURA 1SXQA 1L7BA 4HAOA 1C3OA 3T52A 4H9GA 3W5CA 1VJ0A 3IS3A 3SP1A 1CR4A 9LDBA 2VDLB 4L2IA 1DO8A 1V25A 3IDQA 5F51A 1MOPA 4GOLD 1CJKC 2PLFA 3C1OA 5LP1A 1Q5PA 2XB6A 1UPCA 2R6ZA 3AV0A 5KNBA 2H1CA 2HA4A 2XMGA 4DQDA 4UXJA 3OO1A 5IREB 3EGOA 1VEKA 1IQPA 2GKSA 3A6DA 4WRRA 3M5DA 1Q7GA 4OTZA 1DKPA 2ECKA 2IIVA 4OHOA 1XZIA 2WJGA 4B7GA 1EG2A 5BVGA 3AFIA 1G42A 4EW3A 4RMIA 3VOBA 3HR8A 2D3TA 1TVCA 4ARIA 2PUCA 2C3MA 2XHEA 1WJGA 5EZQA 4A2WA 4NARA 5CCBA 3CB2A 1W30A 3WL7A 2DC1A 3BH0A 1QCDA 1NW4A 4HBZA 3L0SA 3BYZA 2WPDD 4D45A 4JIGA 5TGZA 1SUFA 3ADPA 3AQ4A 3VI3B 1XTKA 1IOZA 3RT9A 2WKRA 1E96A 3UAGA 5A5DA 4C3UA 3FFWA 2QQ5A 3OG9A 1X80A 5HIMA 4AS1A 3DQPA 4Q0MA 4RK1A 4ASUD 1E4EB 4P4NA 4IIUA 5L51A 1YRHA 2IXAA 5DIFA 3TUJC 3E3LA 3B1WA 2R6AA 4ML3A 3DLIA 3E53A 3FPJA 1NC3A 4CIZA 5IANA 3Q8XA 5L53A 4URHA 1IL0A 1C1YA 4MUHA 1PBNA 1O95D 2BMJA 4YX9A 3U3RA 1Y1PA 5J47A 1Y9EA 1WO8A 3LK7A 5CH8A 1YUMA 1N0WA 3NLLA 3ZGNA 3JRWA 3STYA 1HX7A 2X42A 1Y8RB 2K6GA 2A35A 4R2LA 3L6DA 3NIGB 4AL4A 3MD9A 4DNXA 1RC8A 3AIIA 3LBFA 3TBFA 1KMIY 4DR6M 1HLDA 4Q4HA 5JH7F 4G37A 4OP2A 3F6PA 3S70A 1Z5UA 2VT6A 5C31A 1T8YA 1DKRA 2FSHA 3KZKA 1J9EA 4RF2A 3SM9A 3CX6A 4ZU3A 4BRWA 4AG6A 5CTJA 3QFCA 3LUKA 4WD3A 3AVYA 2RHMA 3IP7A 2DKLA 4BU1A 1NBHA 5IWAM 2ECFA 4G97A 1NQ5A 4OBEA 1IZ9A 2CHEA 3UOGA 2W6NA 4R3WA 3GL9A 2Y2VA 4MV9A 2WC1A 3GX1A 3ZD9A 1UMCA 1VBNA 2G5PA 1OLSB 3HY3A 1P81A 3BREA 3KDSE 4HAZA 4H0FA 3IQDB 5DIZA 2GK7A 3NUGA 3OZTA 3CKKA 1BNCA 1BRMA 2PMWB 3OOWA 2L7IA 4G5FA 2VBIA 3F6RA 1P4HA 5JROA 1G5HA 2NV0A 3E7PA 5JSZA 4L76A 3BT7A 2JG3A 3AQIA 4G0MA 3GT4A 4UBKA 4HQKA 4W82A 4YGYA 3MCUA 1E0DA 3K0SA 1F4LA 1O94A 3ABIA 1XEFA 2ZAGA 3KDAA 1T15A 1JIUA 3OE7D 1MU5A 3M6XA 2IU6A 1VLHA 2RBGA 4J03A 4NE7A 1IONA 3ZHSA 4L28A 4IICA 4BKUA 2HL6A 1D2AA 2O8DA 1MW8X 3U3ZA 4JGBA 2QRZA 2HUNA 4YRMA 1EQ2A 1G2OA 1RM0A 4R41A 4UFOA 5DGTA 3PPIA 4RZHA 4HCJA 4XA8A 2OENG 5BN1A 4IPTA 1KI1A 4LNHA 4OI4A 5ALGA 2KQUA 3HNRA 3TZ6A 3AF1A 2I22A 2OHOA 4RANA 2X0RA 1FFWA 4HEHA 4XYMA 5C7IO 4H1UA 3N2KA 4F45A 3RVJA 5TVKA 4MSUA 3L49A 1M76A 4CLXA 3I72A 4X6LA 1ZOOA 1RI4A 1C2YA 2EGGA 2VJMA 1ZKMA 3H8VA 5DNYA 3UUWA 1UT8A 5I45A 1K0UA 3L79A 3RYFB 1FFYA 3UB3A 4LF8B 1PJRA 4TLMB 4EHAA 3OCCA 1ZUHA 1V16B 3K70D 4P82A 4MS1A 4A03A 4ESOA 1K3WA 1XBTA 1F5NA 4CWAA 4MVJP 3IEUA 2F9LA 1QVZA 5IVDA 1DZIA 3W2GA 3M6VA 4LFBB 4WNAB 1L4LA 3HM9A 1SBQA 1E3DA 2R6JA 3RE1A 3THXA 1G9SA 2AL7A 3EQZA 1SCAA 1Y5NA 3GZNA 1C30B 5BW4A 1QZMA 1PO7A 1ZRMA 1EBBA 5AP9A 3VI4B 4MV3A 4QNMA 3NQ41 3E61A 1COZA 5FRDA 5K4HA 1JT9A 2J9GA 4KC0A 4QNNA 4JSTA 1GM5A 4R51A 2NVOA 1EFRA 4BGUA 5GIPE 2G08A 1WA5A 2VF7A 2O7RA 5CMLA 3BJIC 5HS4A 3SAUA 1NMQA 4CE6A 1RCFA 1XPUA 4ZQGA 1WTCA 5DLEA 1BQ3A 1SR8A 1Q16A 1QP4A 4Y6OA 3RSHA 3ETDA 2BH2A 3DLHA 2CFCA 2XMDA 3DHEA 5DRYA 3GP8A 3CCCA 1SZCA 2ZSIA 3CO5A 3HXMA 4MWEA 1JB9A 3MIIA 2QDXA 2PEZA 3PEFA 2W4MA 3D7NA 1DOZA 4D8TA 3SEFA 4Z2YA 2WLSA 2WTNA 4KGXA 1M1ZA 4B3CA 1H2WA 1A82A 4UAJA 2L0XA 1RVV1 2WG1A 1MIOB 3AEKB 2XLBA 5CAEA 3NBMA 3VYRB 4RF0A 3TFWA 3P0JA 2V58A 1SFRA 4YBRA 4QRHA 4OQEA 4QT0A 4IG4A 1PL0A 2PSSA 2ZT8A 3WFJA 4Z0PA 3HL4A 4DXDA 2BGIA 5I9IA 1VCOA 3GLTA 3I2JA 2V4UA 4DILA 4KI7A 2XE7A 3NRJA 3HJBA 1Z5GA 4CCAA 4YR7A 4QA9A 4KDEA 2COEA 1GNVA 1GCUA 5L4NA 3TG8A 2V7VA 4Q3AA 7ABPA 2AI3A 4H3SA 1CEQA 3VZQA 2QTHA 5KX5B 1FDSA 3THSA 4MUXA 5HRCA 3TZBA 1FYDA 4MB0A 4EX7A 4O4HB 3NO4A 4KACA 3ODPA 4ZZIA 1QRDA 3PNPA 4C22A 2FPKA 1T10A 1T5LA 2C2MA 2J09A 4KDRA 1OB5A 3GBSA 2H1VA 2RE8A 4FXPA 3FCYA 4LOHA 4PNEA 4W8OA 2FPGA 4ALKA 2WB2A 1P7WA 2B2CA 2QRVB 1PUXA 4XIIA 4HLNA 4LFAB 5H3LA 5GQSA 1OAOA 1L5OA 1EYZA 3LE8A 2W2QA 1GCGA 1C8VB 4ZOAA 4EW6A 4RNCA 2GD6A 5EJCA 1FP4B 1R4GA 1MGOA 4NU6A 2C2OA 5E9WA 1HNWB 1RSZA 3VYTB 2SCUB 2BCJQ 4Z3DA 4L8LA 5J2UB 4RVFA 2RH5A 4AYXA 5SICE 2XQKA 4XVRA 4JEHA 1PWXA 4F2GA 2A58A 2DPHA 3PQFA 2G82A 1XC7A 3U4QA 1MJNA 3KE9A 1QFXA 1Z4JA 3BRWA 1Z8FA 2NLOA 4ED9A 5FUXA 2MSKA 1F5SA 4BQNA 1A8SA 1TJPB 3DHWC 5IC5A 1J0CA 2AA3A 1V3TA 1CS0A 2R45A 3PDCA 4ECAA 1NW7A 2NPOA 3RYCB 4QBTA 4KRFA 2BRUA 3CX3A 1DEOA 4AS3A 2DFPA 4BCBA 4AG5A 2Q3FA 2VDVE 4PGMA 2PXAA 1IC6A 1NKTA 5EZYF 4ZP1A 3CRQA 4K88A 5BW8A 2Q8PA 5SV2A 1GKIA 4UHEA 2RJNA 2NZJA 4QBKA 1GSIA 1G66A 2H0QA 3GRFA 1P1HA 2LBCA 3LW8A 1KDPA 4HDSA 1J0EA 1FPQA 2R8EA 3GCWA 1M6WA 3M9WA 4CDRA 4FCTA 3QLVC 5LQKA 3R7AA 3TRFA 4U8HA 4JLAA 3TG2A 3UENA 1EE1A 2VDKB 3A1NA 3PIRA 1Y3IA 3ZY5A 4V24A 2CWDA 3V1YA 3IQIX 4ZOLA 1FNNA 2BCGY 2CFSA 5KC9A 3WRYC 4TMTA 3LY5A 1A8UA 4MDYA 3U49A 4LVOA 3ZZUA 1L3BA 2O7NA 5G1OA 4EATA 3H75A 3WWCA 4URWR 3UA4A 1CY7A 2HEGA 4JEMA 3LGSA 3T3IA 1R0BA 2VPXA 4GC9A 3RASA 3GNLA 4IDOA 2OWEA 3E9SA 4HNRA 1FC0A 1TB4A 3QKRB 4I3GA 3HHZA 1DEKA 1BXRB 2EJVA 3WMRA 4TKVB 5AJHA 3HADA 1W46A 3O1IC 3LKDA 1SUBA 4Z9YA 4BQFA 3UPUA 3N2YA 1ZU4A 5H9VA 3UUGA 2Z09A 5CPBA 4LAFA 3T9DA 2P8JA 4OIFA 3GLGB 3I73A 3AUXA 1ZJ4A 3S5JA 2FUNB 4DAOA 1T9KA 4OHUA 2VCEA 1MMFB 4ZHSA 2MTBA 3RG8A 2PXXA 1DQPA 3JQAD 4LRQA 3GWGA 4IOKA 3ELBA 2PX5A 5GTDA 4GMKA 2ACVA 2ZLBA 2R5WA 3OQJA 4L8VA 4MGYE 5IC6A 3HCCA 3WZMA 2H4ZA 2Q8QA 1Z3IX 3MEQA 1UJCA 3WNDA 2JJ8A 3B2NA 3PYMA 4X95A 3AJRA 4RQBA 1I3NA 5CDGA 1JH9A 1FS6A 3SCZA 3ZBTA 1ZQ9A 3MOGA 5G3ZA 4NL4H 3DBLB 5BN5A 1S01A 4YY3M 1YIOA 3VBCA 3F71A 1YO6A 3GC6A 1NHWA 4IJKA 2XQGA 1KZ6A 4BZXA 1JTVA 1EP2B 3O4VA 1SQ6A 3T35A 3RTCA 1HEIA 4R9VA 5GV7A 3H0EA 4LZNA 1PW5A 2FZGA 1LI5A 4L02A 2LVBA 3KB6A 3V3KA 1FZTA 2I67A 4R81A 4GT1A 1FQKA 4FMCB 3E22B 2JAXA 1VBKA 4BKMA 2W6IA 2VYFA 4D8VA 3OURA 3ROMA 2E4ZA 3R5HA 4ETWA 1GG9A 5EIBC 3K70B 2O2GA 4I4TA 2JZCA 1LTMA 4RU1A 3WWPA 1T36B 1W25A 3S2IA 4ER7A 3FFTA 4TT3D 4QOEA 3MCWA 3L8HA 5JRZA 5KJCA 1GPLA 4D98A 4DV6B 3AJIB 3SYKA 5FBKA 3QZUA 1DJMA 3MMPA 4K6CA 3KV1A 1E20A 2GVDC 3DMYA 1XU4A 2ZE6A 3UOWA 3BDIA 3VTFA 7REQB 2R8RA 5J2TF 1JW9B 1L5ZA 2PXCA 3U9LA 1R15A 5KVAA 1V45E 3NANA 3DG9A 2IT1A 1TEVA 1PYDA 1H4TA 5EUQB 2NQTA 3OPYI 1U2EA 4GRIA 4YMWA 4QUIA 1QRTA 5CP8A 5CGZA 1YFJA 3OM0A 5F5LA 5IJ0A 4FHCA 3JD1A 3WNZA 1TXGA 4XD7D 2QWXA 2A1TR 4JOBA 1AUVA 4AUKA 4O4LA 3VUFA 2CXOA 1E3WB 1EJ6A 1JLKA 2J0EA 3FF1A 1X7ZA 4FU0A 3AV3A 3SAJA 3RABA 4CW7A 2GCEA 5CD9A 3WWEA 2RH9B 1A5TA 3UAZA 4YGXB 3I1IA 2F3QA 1ZITA 4XUEA 2HU5A 3H2SA 1I4OA 4GKBA 5IJAA 2YV2A 1U2DC 5CDTA 2YVKA 5KYYB 4C7JA 1CF9A 4REZA 4WY5A 2IPOA 3KFUG 1TK3A 1SY7A 3BF8A 2J30A 3NT4A 2JBHA 3R3XA 3BSYA 1KBQA 1H22A 4WN3A 5LZ8A 2WYVA 3PHJA 2ZJOA 3IOYA 4FFNA 1DRJA 3O3CA 1M1YE 1QAMA 4E0BA 4KYTA 4MKIA 4MB6A 1MNQA 1Q7RA 3SMSA 1BDJA 3DBVO 2J33A 1H2ZA 2EQBA 1PX0A 5IT5A 5CIWA 2WF9A 2V97A 3L4SO 4BO0A 4QU9A 3OU7A 1O96A 2BJHA 4MP8A 4B3DA 4BQEA 4L1KA 1EG7A 1QH8A 3ROTA 4Q19A 2K9DA 1FVHA 3L4EA 4UDYX 4ZQBA 1VRWA 1U1IA 5BURA 2R6DA 2NSLA 4GSLA 4LSWA 3KTAB 1DJLA 2IYYA 5DOVA 4BV3A 1E7RA 5REQA 5EHXA 4UAGA 2QAGC 4ARZA 4ZA2A 2JGDB 2FEOA 2Y21A 2HAEA 8ABPA 4IBEA 4B2IA 3WP0A 3HSKA 4XPIB 1CUFA 4MH0R 5EE5B 1TF0B 3U7IA 1M7BA 2OC4A 2FFJA 2VEDA 4I50A 1MU0A 4B5LA 1SCUA 4CMHA 4WACA 1IATA 3UTDA 1VB5A 3UMFA 2POQX 3IV7A 2DUUA 1C4WA 4W1QA 4WXRA 1N5DA 5A5EA 3IT3A 3D3WA 3UUEA 1L5HA 2VJBA 3DL2A 2CMHA 1EWTA 4RZ3A 3VPFA 4CLRB 1TRKA 2XBUA 1KZ9A 4NX2A 4IY1A 3D2LA 1O97D 5JPDA 1TCCA 5TMBA 3KVRA 2WWRA 5DXAA 2Y6VA 1SUAA 5B7NA 2HWUA 1J90A 4B46A 3R4VA 3I5UA 2Q4DA 3BTUA 1ODFA 3AU9A 2VDPB 4EB6B 1KRWA 1ZC4A 1JB0F 2C9MA 3U31A 4PPGA 1H9AA 2XMRA 2LKCA 1H1DA 5C32A 4ZEOA 4C20A 3RKSA 3DYIA 2HREA 4QULA 4X7PA 1JR6A 1B6TA 4LDAA 2L7HA 5JLJA 1M3SA 1YF3A 2P1DA 1PRYA 4TS3A 3M4ZA 1QHYA 3PEVA 3QVTA 1FJXA 1P1KA 1FNMA 4W7HA 2ZJZA 1P60A 1D6JA 1R74A 4MZDA 2JFVA 2Y93A 3EH1A 1W9HA 1MC4A 4INAA 5FUYA 2AN5A 4I14A 1VZ3A 2I9KA 4YJ3F 1HSZA 4A6DA 2PZFA 1ULTA 1AKVA 1YSYA 2A1UB 5IEBA 4FQ7A 3UV7A 2HFJA 3TNFA 1IFYA 1JXAA 1M83A 1JIQA 3QBEA 5KPTA 2TMGA 4ATNA 3VPBA 5LXTA 4FFMA 5F78A 5EJMA 4YXWA 2PQ2A 1TM5E 4GLJA 2VH2A 3EHEA 3ESBA 2JAWA 2IDJA 4IZOA 1YZ3A 2HDNB 4EGFA 4AW9A 1X7WB 4JLBA 5JZ9A 4KIGA 3PFGA 1BW9A 3DPIA 3GNQA 3QENA 2CJWB 3KPUA 4ZI2A 4WH0A 2JLYA 1J4AA 5BR1A 3U1BA 3TVTA 1JJAA 3LNTA 2Q3BA 5L3RA 5I3CA 4PXAA 3MK6A 1KI3A 1DC8A 3WO1A 4JEUA 3I1YA 1Q0ZA 5JPCA 2OORC 2AZMA 2Y0PA 1WCWA 3AF5A 3BD8A 4II7A 3V46A 3KL4A 2ONCA 2QD3A 3T9CA 4I5DA 1N2GA 4DB4A 1E1RA 4EBFA 5A03A 3BSSA 3W3AD 3R2JA 1VCIA 3CLSD 1CIJA 3N0XA 4H4DA 5IPFA 4A0HA 2OK7A 2ID4A 4J0CA 1FLVA 2AOWA 2WG0A 5F77A 1PG0A 3MWDA 3RIHA 1C7EA 3HV0A 4ZCRA 4Y2RA 1R0XA 3A2NA 3EPKA 4AJ9A 2B21A 3GRCA 3ZGZA 5TQ2B 3B82A 4C7BA 3JQAB 5FBLB 4DABA 5A5GA 5LLSA 3RSFA 2I2XB 1ZICA 1DX4A 3EGDB 3HGQA 5FUQA 3UBMA 3M6FA 5TPWB 3HHPA 4IL5A 1X1DA 2AI2A 5AI9A 4MPJA 4HB2A 5ITZB 5B2ZA 5ITWA 1NW6A 4HNSA 4FE3A 4C2AA 2PWYA 3EGEA 5CX1B 1X7DA 4DUZM 2ZJBA 3EPHA 1DIHA 1RQGA 5GVSA 4LBWA 1M73E 2V9CA 2R1UA 5EKDA 1W75A 3TTTA 2NO1A 5FAXA 2B1IA 4I9UA 2BUBA 5KDLA 3ZHBA 3NORA 2JCXA 2VBFA 1Q1ZA 1JE0A 3HUFA 1WEKA 4YA6A 1QH9A 4AXBA 5K5EA 4EF5A 5G0VA 2XH9A 1MZPA 3B3AA 3CXRA 2AC7A 5AH0A 1CJCA 2BBSA 3I9LA 4LXHA 1XWFA 3LZDA 3W2FA 3AETA 3VYVA 1UKVY 3FOAA 3EMBA 1UZMA 3OWXA 4NSNA 1CTQA 1IY1A 3AKZA 5L7TA 4I1SA 3NBQA 3W67A 3LPLA 1S7GA 3EOBI 4HH4A 2GWRA 1PFUA 4NE2A 4PLFA 3L6UA 3PGLA 4Z1OA 1DLJA 1DADA 5DE3A 4EKNB 2KB0A 3ROKA 2C4NA 4WGGA 1UADA 4R71A 2O59A 2O8EA 4K26A 2COUA 2NMVA 1GU7A 4ZQIA 2SICE 4WEQA 3L1UA 5AI6A 4P0TA 3OJLA 4D6YA 5IYZF 3DDZX 3D2AA 4Q9IA 1OIWA 2ZZKA 1ZVVA 4HDCA 3LX6A 1NI5A 1TQ6A 4QQNA 2D1RA 1RC1A 2GB4A 2YUIA 6NULA 1MB9A 4L9RA 2C1EA 3EXG1 5L6LB 4UHHA 1JMKC 3IAS6 2GGSA 2P9CA 1VCMA 1A9ZA 2C5HA 2I7CA 1NAIA 2V6ZM 4P3PA 5CH5A 4EI7A 3UHPA 5SY4A 1CJTC 1B6RA 2YWXA 3RIYA 3GNSA 1JF8A 4DT1A 5D5HA 1QU2A 4C3OB 3EN0A 1AD2A 1Y3DE 4PZYA 1DAGA 1F2UA 1JFRA 2WF6A 3BUSA 4UEKA 4O4JB 3LHSA 3F1KA 3MWEA 2Q9AA 4HQRA 2JIOA 3JYHA 2XX3A 1G4AE 2DHYA 3D3NA 4U39A 2YMPA 3P32A 1LPBB 1CJUC 4UUBA 4YONB 3FBTA 3FMPB 3OT4A 2WQ7A 2XOXA 1JX6A 2JEYA 1YH3A 2OOSA 3RIXA 1Z25A 3WXBA 1DVRA 2DETA 1AN9A 1PS8A 6Q21A 4R9NA 3BBPA 2AN4A 2PYDA 3GAAA 1CUSA 3TD6A 1TQ4A 4R2KA 4FR0A 3EQ6A 3GMTA 5F7OA 4JVSB 2O4CA 4LMAA 2RGUA 2HRDA 2RB5A 5F4BA 4I3HA 3R9KA 5J59A 1SCJA 3WG9A 1DJNA 1B2RA 3P5BA 3W34A 2X4IA 1GTL1 4TWAA 3GELA 2G09A 2I7TA 1WQ1R 5BV1A 3FMOB 5BWOA 2MSEB 1JDBB 4QYWA 1JHXA 2ET6A 1JVNA 4OF4A 3U1TA 2A92A 3IMCA 1SN7A 3QU9A 1JKXA 4UD6A 1GTMA 3NM6B 1CIPA 4WHMA 3UMMA 3OFND 2CK3A 1EBFA 4IF4A 3PUZA 2P6NA 5CT6A 3ZW8A 3EXG2 4MGZE 4EP1A 1YAHA 3WV5A 4XXHA 3ZC3A 3KQWA 3SVZA 1I4EB 5FA6A 1R4NA 1U90A 3ORHA 3UATA 4G4JA 1G5RA 3OAAA 4G85A 4JXKA 5DK4A 4A4DA 1NZDA 2LHGA 2IS6A 2OZVA 3D8BA 4YRBA 3CTWB 1QO0A 2P2CA 1WV1A 4M8LA 2GPYA 3DT9A 4NWIA 4M1EA 1NUAA 1G8PA 4D2IA 3ZZNA 1I2BA 1ZNZA 2YZMA 5L3SB 3GYGA 3LC1O 1OWLA 3GD5A 3AVPA 2BBWA 2V9PA 2XMZA 5EUBA 3OOYA 3KVVA 4L95C 1FSGA 3JATB 3DFUA 4QXPA 4DV7M 3HXLA 1ZJZA 5AXDA 3NT5A 4DRXA 3R3ZA 1NSTA 4W5OA 2G0AA 1YA8A 4UDNA 2W82A 2ZOSA 3WB1A 3L0IB 3MRVA 2OC9A 2AZTA 1GVNB 4G0WA 3GYBA 1WDKA 4C78A 3UW1A 1YQUA 4JSYA 3SN6A 2IS1A 1ZM3A 2WVAA 4OHBA 5LQNA 3VR2A 3WGQA 3GMIA 5AVWA 1QMGA 3HP4A 1KZHA 1Z0DA 4OH7A 3KQQA 1Y5RA 5HKOA 3P20A 2ZSUA 2WBLC 3TQTA 5KREA 4LXYA 3L6CA 2BKAA 2VQ3A 1Q0SA 1E2BA 4PQYA 4B43A 4NBRA 2AUTA 1KEWA 4ALNA 4M2LA 2HPAA 3B1VA 1Z74A 4K6MA 2UVQA 1PUJA 5JH7B 1VE1A 3CLTD 1KYYA 1ZD9A 4CEIA 2FMIA 4DLRA 5E0KB 2PZGA 3B9BA 3MK31 4GMGA 2R6HA 4HDNB 3CT4A 2FAXA 3IUBA 3VVCA 1PZXA 4OFXA 1IH8A 1KQPA 4MB2A 1FMTA 1GA6A 2D1TA 3A06A 2CVQA 3JQGA 5BUZA 1SXJD 2AMYA 2X0JA 4KEAA 3U81A 3SC4A 1V11A 4EBBA 4K03A 4LRTA 3I4CA 1UMBB 4TUYF 4YP9A 2XUGA 3AHIA 4JVNA 1HZZC 3B5JA 3HXPA 3NTUA 2N1BA 2MINA 2WU4A 3BMQB 4F3NA 1PEDA 5GJVC 2DBRA 5JO0A 4KWEA 5ABPA 1G9TA 4BQQA 2A94A 4UCQA 1ZL2A 3UGKA 2VHWA 2FRDA 3NYQA 4PG7A 1SOUA 4Q9HA 4FZVA 4B3MB 2ZQ5A 4OX9Y 1EESA 1PNVA 1QGUB 1V35A 5GOTA 2EKQA 1NRJB 2WJAA 4KR7A 2A1TS 5KQLA 3UFBA 1NF3A 1PR2A 4OHYA 2J7KA 1GUDA 3OZWA 1IK4A 4EPXA 4JFRA 1SQFA 2H63A 2ZJ0A 4ZAVA 3V5NA 2BDUA 4FZRA 4L8YA 2F59A 4EKYA 5DM1A 4EUFA 3UJAA 1IOLA 3ND5A 2HJHA 5BV7A 3EXHB 4K40A 1ZIDA 1YK1A 3LH5A 4DPKA 3OFJA 4LJ4A 4N3BA 4ZARA 2L2QA 2VZ0A 2ZR9A 1YBAA 4KMMA 3U3JA 1U5BA 4C01A 3AJ9A 2JLXA 3ND6A 3AM4A 1HURA 1UDWA 4HZIA 4CDGA 2GARA 3U4DA 1KYTA 2C96A 3OZRA 2B34A 1KWGA 2WIGA 3VRHA 3QVGB 2OHJA 3W9SA 3B3FA 1YVDA 1WDTA 3K9HA 4J94A 1E5DA 3PFNA 1ORTA 3E5RA 2V03A 2VQEB 3HUUA 1M6YA 4YO8A 4CQJA 4WBNA 2IS4A 1VPEA 2XUHA 1NUTA 3NHZA 3F74A 2G77B 3L7YA 1NULA 3DZJA 2ZR8A 3UT0A 2QLMA 2IEIA 1T6OA 3ISJA 4FUTA 1YVPA 2J48A 1EFVB 2BEVB 1Z5ZA 3R24A 1QIFA 3ME5A 2JI9A 3TLBA 3U7RA 4EK9A 2JS7A 3OZEA 2LV8A 3ABSB 4MRAA 2V6BA 5JYCA 1V6SA 5AT1A 2C7PA 1X74A 5CB6A 2FZWA 3M89A 3LX5A 1GZVA 1G6Q1 3SEAA 1Y6GA 2BGMA 1IB0A 3N28A 5H16A 2E37A 2WT9A 2MHCA 2O8BA 3UFXB 1CE8B 2YN0A 2R8OA 2QRJA 4DXAA 3ZW9A 3R8CA 2H1RA 2VUIB 5DRTA 5I7FA 1FTYA 4FEAA 2RKOA 4O1IA 4YV1A 2YJTD 3SYTA 4I9GA 2Y0DA 2RHJA 4PFKA 1UBCA 2M6SA 1TZJA 2ZM6B 5JEEA 2BBOA 4PLCA 3PUHA 1HE4A 4EEZA 3ELYA 1R0YA 2V45A 1IN5A 1PDOA 1UIRA 5SZHB 5I8PA 4QDUA 4F92B 3WRWA 3QSYA 3GI1A 1RACA 4TXLA 4ND8B 2NU9B 1ECCA 3EQ8A 5IT9S 5KSYA 3ITEA 3R7WA 1CKEA 1Z18A 2R1TA 2ZZNA 3PUWA 2QXYA 3LX8A 5ALFA 2VPPA 1OFUX 5D7BA 1RWVA 3HDQA 5CIYA 3UYLA 2CNWD 3HR4A 4J2OA 4QOGA 3MZ0A 3HJUA 2V7GA 1U0RA 4XGIA 2BZ1A 3V7WA 5KMGA 2HN9A 4RVUA 4YMUA 1A2QA 4ZKDA 1PDVA 2GX6A 3OIDA 4GVXA 4KKVA 2OD7A 3RUAA 2GILA 3RHZA 4QZVA 5HFNA 2BHNA 3QKTA 4QHTA 1SGWA 1W7AA 3HYSA 5B1DA 4D1YA 1YUBA 2PM8A 4D6XA 5KYTA 2OFPA 1AV7A 1VG9B 1FRZA 1YQGA 4DC9A 2AK3A 2FA9A 5J4HA 1K27A 4AW4A 2FW6A 1Z5OA 1JHAA 4REMA 4X7BA 1U8YA 1G60A 1N2CE 5EXPA 1PKEA 3PDUA 2ODNA 3EUAA 3IMFA 4J7CA 1EAYA 1HY3A 4JCOA 4NBUA 3H9BA 5AYVA 3RFTA 1O0SA 3K9CA 1N32M 1M2FA 4KPUA 1JSZA 1X39A 3I6QA 4O5AA 4C87A 5K8UA 4UBJA 4U2FA 1C0PA 1XD8A 4LS3A 2DUJA 2IOQA 3C6KA 4WASA 3QEAZ 5EL0A 1F4PA 4L8GA 2F8LA 4BVBA 3CLVA 4FEYA 4P32A 1TZCA 3PITA 3RTEA 2GN9A 1AF4A 3Q87B 2GT1A 2PGIA 4D3DA 3BIOA 2R79A 3DTTA 1BVSA 4MVJE 5LA6A 3CX8A 4GPEA 2ZWIA 4I5FA 3EIOA 1VKZA 4U7FA 1O95C 2XTZA 4GOND 1C7QA 1ZRHA 3WADA 2MMGA 3KPJA 4D0LB 1W52X 3T7JA 4J6EA 2HK6A 5LQCA 4W8HA 4AUNA 5B5SA 3DTNA 2WFLB 4LNUA 4M1YA 2YWDA 1MXHA 2FQXA 3TJMA 3H1FA 3HNPA 5IMSA 2Q9CA 1TE2A 4POOA 2C77A 2Q6VA 2PS0A 4FBGA 1CZKA 5AKZA 4QYTA 1ENOA 5EZYB 3BHIA 2R1ZA 3QPDA 2ENUA 4WKBA 1CZRA 4XCQA 1J5EB 1YDEA 2BFEB 3PQ4A 4E1BA 1PS0A 5JCZA 4XDGA 4ZVLA 4CF6A 2FV8A 4G26A 3KUCA 2AKYA 3U6LA 4M49A 1VJ5A 5JT1A 3OUTA 1R8SA 4XM0A 3ZV3A 5JO9A 3QUTA 1SWWA 1FJHA 3HP1A 4BNZA 4UUOA 3DMTA 3E58A 1V71A 4DB2A 4G1UC 3PUJA 5EXXA 1T4DA 3GGPA 1T35A 3V8MA 2EDCA 3TEJA 2VEOA 4RHYA 3GV0A 1XMOB 3JWGA 4HPWA 1JVSA 2ANBA 5HF5A 2XT9A 5DHAA 3H65A 1MHPA 4QO8A 5IZ4A 4QOSA 4RWEA 3WGVA 4IYRA 1IZ7A 1YR8A 5A9SA 4C0HA 1NPTO 3SKXA 1C7RA 1WD5A 3CVXA 2JKZA 4ZAWA 1PQPA 1HEYA 3N07A 2J6IA 3ZI7A 1H2AS 1JHUA 1SXJB 1QLHA 3ENNA 2R8BA 4GWKA 3X1XA 4S0ZA 3VGJA 3ELDA 4PQFA 3DR3A 4LXGA 4BV9A 4KIWA 4GOMD 4NOOB 3MLAA 4YV0A 1PIWA 3JXEA 4NVRA 1DG3A 3NTOA 3HYCA 1NBMD 4L22A 1GLVA 2GHQA 3GG2A 1WKBA 4DEVA 2J5YA 4BO9A 1G3UA 1XTUA 1ETHA 1QFYA 2YCBA 1NDUA 4CMJA 4TXNA 4UBMA 3QLUC 1S8AA 2G1UA 3BCUA 4YAGA 1RW4A 2VAPA 1Z36A 4Z7OB 1X7YA 4G4SP 2ZVQX 1SUEA 3LNCA 1DIGA 4J75A 5JVDA 5BOVA 1RT9A 3MN1A 2ATVA 5JD4A 4OP1A 4V0RA 3P0HA 2C4TA 3SYLA 1LLQA 4F1JA 1V9SA 3F5MA 4RA9B 1TH4A 2I3DA 1CRZA 1MB4A 3PNKA 1C9NA 4YRZA 3LF2A 4PSCA 4FW9A 1G1MA 1GTJ1 2PBRA 1WE2A 5GGYA 3V00A 2IX3A 4ZMRA 1JNXX 4JV5B 6ABPA 4K9KA 2H2HA 1SVIA 4KO3S 2R3SA 1E3MA 5C37A 4LYYA 2ZRKA 1R18A 3VH4A 3EZ7A 1NOJA 2QE6A 5J43A 2QX7A 1Z88A 2PKCA 4YB8A 4XEUA 4G0ZA 2O07A 1JT2A 3AERB 3SLKA 4CKWB 1Q0UA 3DXXA 1MX1A 5JMOA 3VM6A 4MWSA 3PFHA 2NPIA 1KI8A 1SB9A 3ZVLA 5JU6A 2Z4SA 4QPZA 4YR9A 4I55F 3P9ZA 3WOHA 4FOTA 3BZUA 4CUKA 1ECGA 1RHMA 2WU0A 1CY6A 1BMDA 3ZGVA 2AFIA 4MS3B 4PX3A 5KHOC 1CZNA 3DFMA 3O8BA 2FH0A 1E1NA 3AVQA 3R23A 1L7RA 1TT5A 4IP0A 4N5NA 1EGQA 2V59A 4YLEA 1AKUA 1PNTA 4MWBA 1MW9X 4BEWA 5CT5A 3ES9A 4BLWA 4UUNA 1I7DA 2C83A 4EYGA 1GT6A 4GECA 2GFHA 1VXOA 2J0UB 4I1UA 1AGYA 2WJ3A 4JYZA 5J2TB 4JA0A 2LTAA 3P4YA 3J80S 3D4IA 3S0JA 3MCVA 5K0FA 3U60A 2XUPA 3SWWA 1O4WA 1L1FA 2G76A 2WWHA 2SKDA 4A6XA 1N9GB 2HLHA 4DV5M 5BV8A 1IAVA 3NBZC 2YTZA 4FDTA 4PICA 4L4XA 4BMCA 3BK1A 3F6EX 2MYTA 2QGZA 5ES3A 3HKCB 1RC0A 4BC0A 1PJZA 1CBUA 1ZI8A 4G5HA 4EENA 1FUUA 2J9FA 1Y6QA 2PLNA 3UKDA 3SQXA 4K81B 4Z4IA 2IHNA 3G2MA 1SVOA 2QS9A 1OZFA 1KWKA 2NO0A 2QJTA 5FL7D 3TWKA 1J8YF 3QV2A 1T13A 4B7FA 3G1WA 2AN1A 1NXSA 2AX3A 3I2IA 1VL5A 4G4SO 4MVJG 2Q5FA 1TQHA 5JDIC 2JK0A 1N9ZA 4H4EA 2H1SA 4UM5A 3PYXA 2ZYHA 4H7DA 3U13A 3ZVRA 3OKCA 4WUTA 5DT9A 5ICCA 4JC8A 2F4NA 3VJRA 3GPPA 3AFGA 5B7QA 1RD4A 4GPAA 4LQLA 3OP4A 4DMCA 5LFAA 3ZU2A 3QWAA 1R00A 2P3QA 1Y89A 3SQOA 4MXDA 1KETA 1K5DA 4KR3A 5IFLA 2ADFA 1AMNA 3BPSA 4G0XA 4IBKA 1CDDA 1T9GR 1DBRA 2DQZA 3QU2A 2IP1A 1ML4A 1OV6A 4GP6A 3L0PA 4HVAA 3PNLA 4WKNA 4KKXB 4IEEA 2EKFA 3JX9A 2LBPA 1SA0B 5BMVF 1II9A 5CDSA 4MP6A 3ECSA 2RC5A 3VO1A 5DYNA 3PE6A 2QKYA 1JG7A 3BE8A 2WFAA 4AC9A 1TYBE 1OWNA 2GZDA 2FW7A 2CV1A 2O05A 4A2CA 4R0MA 3QKIA 3A0UA 1R5OA 2NQ2C 2HCRA 2XF3A 2ZSBA 3TR5A 4EL0A 3NOVA 2JH8A 4OFZA 1RLOA 2OXRA 5LB2A 2CUZA 3R75A 3C6QA 1L0BA 1YJAA 2QNIA 2FUG6 4R9RA 1DQZA 4PZUA 4QQKA 4WXPA 1QHSA 5EAIA 3DV2A 4Y9DA 4RMHA 1AG9A 1TK2A 4AO8A 4GXQA 1Y1SA 2YXDA 1VDZA 4UXHA 4DQXA 2JFBA 4B6GA 2CVFA 4W7IA 3CUEF 5CLGA 5HX7A 5AWFC 3PRHA 3L5OA 4MA5A 4DGQA 1GGFA 2ERCA 4ZN6A 4AUEA 5CPFA 1T5DX 3HWSA 4LTMA 2A78A 1CUAA 4NK5A 3KSMA 1CQJB 3EC1A 3H9EO 3JZDA 1E77A 3W2IA 4X65M 1HDRA 4ZEMA 2I3ZA 1QWOA 5ILGA 1IN8A 4QDOA 2JI8A 4O8ZA 1ZMWA 3WNQA 4AMVA 2LNHC 2VDJA 4NEQA 5HIIA 3H2BA 4M60A 1JDJA 4UTOA 4G01B 4HP8A 4YJ3B 3K5IA 3CQ9A 3CRMA 3TECE 4DLSA 1UJ5A 1KVTA 3VOSA 1IWOA 1VGVA 2A3NA 3MBKA 3ICWA 1HYHA 1GR1A 4RX1A 5AJUA 1XTJA 1VQ1A 1AUOA 1UBKS 3A36A 3B3QA 2H59A 4FC6A 1XHEA 3O0TA 3FJ1A 4GGMX 1KFEB 3VZCA 1N9KA 3AEQB 3TSOA 3QAUA 2Q5EA 4K86A 2MSNA 1NNUA 2QUAA 4LF9B 2EF1A 2HQBA 1AXRA 4ND5A 3SSMA 4OHMA 1R10A 4MRSA 3FTFA 1NJFA 2GPSA 5BPVA 3RV3A 5B3JC 4TVBA 1P0PA 1YC2A 3PNSA 1RQ2A 2R0IA 3L8YA 4CR6A 4EB0A 1E1KA 3O2NA 4F9GA 1FSFA 1W2WB 1X77A 3CRNA 3X1MA 3H05A 4OPMA 5AVSA 1V8BA 4PGHA 5CT9A 2OB1A 2FS1A 3FOCA 5E2BA 4RTRA 1QV9A 2OA0A 4YV7A 4R9SA 2Q2WA 2XCOA 4TLEA 3TB4A 1XB2A 4ZJYA 1N2EA 4NZNA 5FBVB 2JI4A 3DAGA 1KKMA 1QPZA 5L4SA 4ZYVA 2QF7A 1OAIA 4PM4A 3LUDA 2J3KA 4E4TA 4RL4A 2VP3A 1PUIA 1Z22A 1JEYB 1I6KA 3EXEA 2XCSB 3FY4A 3DZGA 2ZIVB 4H6XA 4BVHA 4H1HA 1Q12A 5IM4A 2OE2A 3L8FA 2LZ0A 4P7JA 1Z8NA 3LT2A 5E2AA 1NJ6A 1W48A 3A70A 5G4KA 3PT5A 1BIFA 4GM1A 4FYKA 2ZB3A 2QXUA 5KO3A 1SKBA 1GZ6A 4HUQA 1I3LA 3K09A 2B1JA 3D7MA 1MT0A 3NM4A 4MK4A 3DAHA 4LRYA 4MUKA 3FTNA 3HCFA 1XNQB 3MAJA 3RK0A 5IS2A 3OD1A 1PD0A 3N74A 1L5WA 4RELA 2JZ1A 1EZZA 2VRWA 3L7MA 5JRJA 2OBXA 4EHNA 4EVQA 4GEKA 1HDYA 5CFMA 3KYJB 1P19A 2C3YA 1U2ZA 2DWNA 5LUAA 5IC4A 5FADA 3WSVA 3P9PA 2V7TA 4X63A 3VNQA 2D2VA 3LC2O 5FPYA 4FHZA 3MFQA 2AC2A 2C98A 1F7UA 3AR5A 3WYFA 2W2LD 4NK4A 4MPPA 3JS5A 4M6WA 3SMVA 1R5BA 1K1EA 1KTVA 3G9TA 4DREA 3RR2A 4BDSA 3RAFC 5ALTA 4PSUA 2PANA 1RRFA 2FX5A 2A5LA 3WLKX 3CA8A 2B5WA 4BP1A 2RJOA 3TTSA 3NKFA 3VKFA 1P18A 4U6SA 4Z7JA 2IODA 3VNAA 2GH1A 3G7NA 2FCRA 3B2QA 4W6QA 4NU8X 3ZHVA 3JVIA 1XCBA 4MO9A 2W2TA 3EDQA 5E26A 2FEWB 3A4MA 2RHHA 1NBWB 3WYEA 3JASA 3JR3A 2ROQA 3C5CA 3N59A 1T0IA 1GKKA 4NFYA 4Z86A 5IYZB 4LK3A 4YK7A 1NLFA 3ET5A 2CSXA 5KYXA 2UUCM 3UEOA 4CISA 1Y5LA 3D8SA 4XWAA 1QGYA 2O2IA 5HNKA 4DWVA 1JKJB 5LIPA 3DLCA 4EVIA 3ZCXA 5AVZA 3RFUA 4TMWA 2AFVA 1CUBA 5BUCA 5T8KA 1DXHA 2JGRA 3BWDD 3C58A 1P9OA 1EFTA 1XJWA 2JXNA 3GDWA 4C0SA 1X87A 4IIGA 4BQRA 4DE5A 2IBSA 5KNLA 3NIWA 4IJWA 2J7PA 5AFSA 2BFNA 4RMJA 5DWDA 3A25A 3ADKA 4TYPA 3GZJA 1B76A 4X91A 1V2GA 3ZWOA 1BU8A 1IPHA 4RY2A 2H08A 1ZR4A 2I8CA 4YO7A 1ZR2A 2TRSB 4W1RA 4MB7A 3TQRA 3UB2A 5F98A 1BWQA 2ZGVA 4KFRA 1I7SB 2GM5A 1U81A 5EP3A 1Q91A 4KAJA 1BAPA 3D5EA 4CIWA 1T1IA 4EAAA 4LE2A 3G0GA 4UJ5A 4LY6A 5KNDA 3PSHA 3I2KA 2P9ZA 2DWMA 3FCOA 4DJDC 1G8AA 5DXFA 1MABA 4HD8A 3L8ZA 4GUAA 5CA1F 3L6EA 4TV8F 1LRLA 4KO4S 5JSQA 1YJCA 2A4MA 1Z4MA 1O97C 2VLBA 1GU1A 1JA0A 4U2KA 1KQ3A 1CQPA 3VC1A 5DGDA 4JT2A 3BB1A 4JI8M 4FINA 1M34A 2PQ0A 5HJEA 1M7HA 3GOQA 3H2KA 3UT5B 2MJ5B 2YHIB 5ETJA 3EQ7A 2P67A 3V2UA 4MKZA 4DVJA 2ONZA 2I87A 3F7MA 2P40A 3LLMA 1DOAA 1FTNA 2V74B 4DF3A 4W9NC 3FCCA 4CRWB 1YOBA 1U94A 3AEYA 2P6PA 2WHXA 1Y1LA 5ARBA 2GCOB 5B1IA 4DPLA 1NQWA 2CY0A 5F7ZA 4RTLA 3CNEA 1PD1A 2I2FA 5JJIA 2UVDA 6REQB 1Z62A 2P9JA 4L6IA 2PGNA 4C2BA 3AL0C 5BSEA 3BICA 1LWNA 1KSJA 1ORWA 1KPGA 1QHEA 3LUBA 3RTAA 4PO1A 3GIWA 1Z2CA 1A4UA 2B4QA 1CRLA 1BFDA 1U8TA 2ZT5A 3T3MB 2NVUA 3P0EA 2VHZA 2C2GA 5LDHA 2ODQA 1OKKD 4MVJH 4G25A 3ENVA 4B85A 1VHTA 1OASA 2Q50A 3Q41A 2PX3A 5JR3A 3ZTYA 3N2GA 3RRZA 2OD2A 2GCPA 1ZM7A 5KQRA 4A7PA 4M46A 3U3OA 4NH4A 2HB6A 2FZ4A 2D2EA 1JAIA 3LA8A 2NSDA 2Y1KA 3DEJA 5AXCA 3NBXX 3WYBA 3AIMA 2GBPA 4FR5A 3K9PA 3PD7A 1B15A 3D64A 4Q34A 2A7QA 2D13A 2IP4A 1VPDA 4PVCA 4IVPA 2C00A 4NFLA 3AIKA 5TQ0B 3A4IA 2DTEA 3M83A 1TAQA 3U17A 2WJ4A 2OQVA 1DKUA 2HV9A 1KZ4A 1PFGA 4QRDA 3DLAA 4QQ8A 4U7PB 2WSEF 2BMDA 1C1DA 3WQRA 3BWYA 1JQDA 3HY5A 2A6PA 1QR2A 4CIBA 1YR6A 1WULS 4XLTA 5DBHX 4HJRA 3P26A 2GSDA 2X5JO 5DCLA 1L4EA 3UTCA 4N6OA 5U4QA 4HT3B 1C0KA 2VNHA 1NX9A 4K5QA 1WTAA 1WPRA 3SK0A 4TUYB 4TZ0A 2PV7A 3G1TA 4NZ9A 2BELA 1GTSA 3TWOA 5DF1A 2RGGA 5J40A 5HF9A 3VOTA 4EUEA 2WYUA 3QY9A 4LX0A 3MHPA 5ALOA 1ZNWA 3HJRA 3CJTA 5B1HA 2G1PA 5KPZA 3T4UA 3BL5A 3ZJ4A 3EXHC 2AB0A 3DLPX 1QHFA 1JDSA 3T7EA 2VKTA 1ZIYA 4TSFA 2FZKA 3HBNA 1TIPA 4LG2A 4ARUA 2RI1A 1ZCJA 1P2FA 4BJ1A 1O9HA 3G0IA 1XL0A 5K45A 1MHTA 1Q22A 2F4VM 1D1SA 1GU0A 1RKVA 1IUKA 4CN9A 3RKRA 3ZUPA 4F1KA 5HVNA 5T3UA 1NX6A 1JHMA 5L8RF 4ZYTA 2JRCA 1S2MA 5U4XA 1DPFA 3S55A 1A9XB 4CVNA 2ZWVA 3ZDFA 5CFLA 1PSZA 1ISJA 2ZRDA 3RTDA 1EWYA 3V4SA 4JUCA 1EINA 3Q0EA 1EX6A 2C1XA 4LV8B 1QHHB 3R9XA 1R9MA 4TL9A 4DJEC 3HCBA 4DDUA 3T7IA 4OQMA 3ZTWA 3LIIA 3WAKA 1L7VC 4D4HA 1KK3A 4CTOA 2B82A 2XSZA 1U1GA 5AMXA 4W1SA 3A9UA 1M5TA 4DOMA 3PJDA 5EI5A 2P6RA 1TZMA 3WL4A 621PA 4N7JA 1JSCA 4AVYA 4BWVA 4YV2A 1YRAA 3DEFA 1GNLA 1IULA 2AMVA 1UBRS 2VXBA 1U1FA 2WKWA 2VNKA 3KZCA 2Z43A 5DHSA 3OPYA 1TKBA 4BNFA 3PC6A 3LVVA 3ZD7A 5FPTA 2XGSA 3M1AA 1VP3A 3RVSA 3KQKA 3U0VA 3AL3A 2XITA 3FDJA 5J4KA 2WT8A 3LD9A 5K6AA 2F9MA 4GOOD 5B3KA 5CG1A 1Y8GA 4JS0A 3TOVA 3P71T 2IHVA 2EL9A 1T9GS 4LA4A 5KNBH 4CUJA 1XRRA 4XJSA 5BVHB 1BA2A 4CL2A 3PUYA 4C05A 2YIDA 2WIFA 4YC7A 2ENWA 1K8QA 3C1UA 3H9QA 1IJFA 1KHTA 1PR5A 4YAFA 2JLCA 4UE3S 2VRNA 3UPTA 3QFHA 2AI1A 3KP0E 1CZHA 1B74A 4X93A 5FJIA 1U5AA 4OREX 1V5EA 5A0TA 1AZWA 1AZSC 2JD1A 3UZUA 5FI5A 1HM5A 3VTKA 3TN7A 4XWKA 4NMXB 4EYKA 3UMRA 2PH3A 3A4YA 3JCZA 1IBLM 2D7JA 4UREA 2DWQA 1TMGE 1OT5A 2HZBA 5LMUM 1QM5A 4Q6WA 4AYTA 4PZAA 1UFKA 3C3XA 2YBDA 3IHPA 3U6OA 1JQ3A 1G3RA 1EDOA 3CVOA 3PGMA 4EA9A 1T8PA 1OC2A 1GPMA 3TUZC 3FXAA 3OZFA 3M4NA 4GYKA 1Y8QB 4P92A 5BR8M 3CV3A 5CVJA 1CR1A 1CRPA 3SS9X 2N0SA 4KRYA 1U3UA 4YH1A 3AF4A 2B4YA 2X5XA 1K6EA 1DKMA 1YACA 4ZOLF 1RYMA 2JIQA 3CWZA 3NHMA 4KN6A 1FJ2A 4Y6GB 2IEAA 3KQLA 4V1CI 2PSHA 3C74A 4NZYA 2HQSA 1Y5IA 2BGLA 2AD1A 1JQJC 2BKLA 3N0TA 1GOTA 3SJ7A 4KR2A 5EPUA 3CZQA 1CVRA 3AHCA 2WQ6A 2F5NA 2GXQA 4G0UA 1GJSA 3SHOA 4TKUB 3D8UA 3LZCA 2PGXA 2RGWA 4HNGA 3GHYA 3WFZA 2BOVA 3F78A 1T26A 2C82A 2FJPA 2P9QA 1V7ZA 4YECA 1SC6A 3WYDA 2YXNA 3KRTA 2Q2OA 2YS6A 1U3GA 3GQBB 1GRRA 4LXXA 2X1MA 4KGDA 1DCTA 3MRTA 1KI7A 2WDZA 1NQTA 5DI3B 3VX4A 4QJ3A 3NHRA 3MT0A 4XX0B 5FBZA 2IYLD 2WJJA 1EFUA 1XZPA 1XZAA 5ADVA 3AJAA 2GNAA 2E5LM 4RNDB 3OLYA 1J7KA 3TLYA 1QK3A 1WVGA 2X4LA 1BU5A 2I4TA 2IUYA 5B1EA 4NABA 1KP9A 4H6PA 4R2IA 4RCVA 2XGOA 2AFHB 2OILA 1JLLB 1XZGA 4XTRA 1C7IA 2QGFA 4LYDA 2JB9A 1BVHA 5BWNA 1CEEA 4YHHM 1CNFA 1NRWA 3KOUA 3IKTA 1PNOA 5BSWA 4U00A 1E4OA 5TT0A 5HR5A 2VA9A 4HJXA 1TUIA 2GMWA 1CP3A 1XD9A 2W6ZA 2J3EA 2DZNB 2M98A 5DYWA 3BGSA 4NAUA 2Q3MA 4Q9NA 2OHGA 4MP3A 3DE0X 5C2JB 4DA4A 4TYWA 1T6XA 1BZYA 3FJYA 4M37A 5KBYA 1LLDA 2ZJ5A 4PCAA 2HJWA 1ZI6A 4BNWA 3E9NA 1VJ1A 4FOLA 3E2PA 4INJA 1SD5A 1RWQA 4GMHA 4KE9A 1GJTA 2PS1A 5JNUA 3KXKA 2CCJA 3QU5A 5ICEA 4KN5A 4NBKA 4KN9S 2E7ZA 4AQYB 4ZHQA 1T5HX 1UZUA 4RC9A 3V6LA 4KRGA 4I4TF 3H5OA 1SUSA 3AKYA 3IX7A 3L27A 1SXJC 4D81A 3AZPA 4EI2A 3C7AA 3MBOA 3FM9A 4FGUA 1TL7C 2V8BA 3KM0A 3CG0A 1Y82A 3G6KA 2PCJA 5DTIA 2XQJA 5ERYA 2Z08A 4TOIA 3COVA 1DWPA 1XRMA 4BAZA 1HFEL 3KKPA 1H6DA 3VMFA 3WK7A 1A5SB 3S2ZA 2QM3A 1I2DA 4LSZA 3WP1B 4C07A 3TTXA 4KUGA 1SU4A 1T0PA 3FDZA 4AS2A 2PVSA 2NU6A 2QRPA 1MFPA 3MSXA 2CLHB 4G2NA 3PNVA 4DSUA 4FQ5A 1SC1A 5DFAA 4O4LF 3BA1A 1GUYA 1NW8A 1QUSA 2ZWPA 3P52A 3REGA 2YHAA 2QVXX 5AUQA 2EBHX 1N33B 1U5CA 4PNZA 1NVMA 4H7FA 3GRZA 3SZLA 3ZE8A 1QQ6A 1WIVA 1R1DA 4ZRMA 4JLMA 5EKXA 4MYHA 4U7DA 3ADBA 4DBLE 3HG7A 3T61A 4C29A 3AUYA 5HM6A 4H18A 1H05A 4XW2A 1Q92A 1Z5CA 4ZT3A 1PT5A 1QC5B 4GXNA 4MIOA 1Q3HA 2B0JA 3ROPA 1Q6YA 2ID7A 1QDEA 4B3RM 1KSHA 2VHTA 1Q39A 2Z6AA 5FBWB 1Y7HA 2EBUA 4DM7A 2WM9B 4RZQA 1CY2A 5BV0A 1NG9A 3T5MA 1AB5A 2FFAA 4ESHA 2FLVA 3QU7A 3SR4A 3C98A 4RY0A 1Q44A 4RCYA 1ZSYA 2FDXA 3ZI4A 2OBLA 3Q72A 3L46A 3U7EB 1NI3A 4Y1RA 1XD2A 3GRPA 1RZRA 2IUFA 3RAPR 2FG7C 3ZJTA 2DAGA 5FLYA 2V0GA