3OTOM

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3otoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3otoM02
4DUZM 3SAUA 1PM5A 1R2ZA 2UUCM 4DV7M 4AQYM 4JI4M 4G4OA 2F5QA 1Q39A 3GPPA 4PDIA 4DV4M 5ITQA 4K0KM 2EA0A 4LF6M 4B3MM 3A42A 5ITYA 4MB7A 4LF4M 2UXDM 4JI7M 3SAVA 1N34M 4DV3M 4KHPM 3GPXA 1TDHA 1L2BA 1XNQM 4G4RA 3DOAA 4DR2M 3U6MA 4CISA 5LMUM 3J80S 3J81S 3SASA 4DV1M 4JI6M 2UXCM 4ITQA 4DR3M 1XMOM 4G4NA 2F5SA 4DR6M 4LFBM 2Q2EB 4PD2A 1TDZA 3GQ4A 5IWAM 1XC8A 1N33M 5LMNM 3U6LA 5ITXE 1N32M 4JI3M 4DV5M 4NRWA 4DR7M 3W0FA 4X66M 3GP1A 2VQFM 2ZM6M 2OPFA 1I94M 3A46A 1J5EM 1L2DA 1IBMM 4B3RM 3GO8A 3U6DA 4B3SM 4LF9M 1R2YA 4JI1M 4JI2M 1HNWM 4JV5M 1EE8A 3T1HM 5IT9S 3C58A 3GPUA 2XZUA 4B3TM 1IBKM 2F5OA 4LF5M 3SATA 5ITTA 2F5NA 4JI0M 1IBLM 1FJGM 1NNJA 4GKKM 4DV0M 4PCZA 4G4QA 4LF7M 2F5PA 1MX0A 3GQ5A 1K3XA 1K3WA 5A2QS 5ITUA 3U6EA 1L2CA 2UUAM 4LFAM 4JI5M 3U6SA 4X62M 4DR5M 4OX9M 3J7AS 4GKJM 1PJJA 4DV6M 1HNXM 1Z5AA 1HR0M 2UXBM 1Q3CA 4NXNM 1PJIA 4LFCM 3TWLA 3GQ3A 1Z59A 4YHHM 4LF8M 3SARA 2VQEM 1Q3BA 4JYAM 2E5LM 3SAWA 2HKJA 4DUYM 4DR1M 3U6QA 4JI8M 3SBJA 1KFVA 5FLXS 3TWMA 1MU5A 4NRVA 4DV2M 3VK8A 1XNRM 4YY3M 1L1TA 3U6OA 3VK7A 4PDGA 4X64M 3OTOM 3T1YM 2OQ4A 3A45A 3TWKA 3JAMS 2UU9M 1Z5CA 2UUBM 5ITRA 5BR8M 1XMQM 4DR4M 4NXMM 2HHHM 3GPYA 1K82A 1L1ZA 2ZBKB 3JR5A 2XZFA 4X65M 1N36M 5ITXA 1Z5BA 3U6PA 1HNZM 2F4VM 3U6CA 3JR4A
chains in the Genus database with same CATH superfamily
1QAOA 1E9RA 1IXZA 2LHGA 5C1BA 4I5SA 3TQSA 4AQYM 4MM3B 2XFTA 3SHFA 3FD9A 4LJ6A 4G3OA 2GQFA 2RRUA 4B3MM 2DAIA 3SAVA 2L6OA 2LVOC 3KOZE 4G4RA 2C98A 2WZJA 2DAKA 1XHBA 2Y0TA 5KQDA 4CISA 4XGIA 5DYIA 5LMUM 3RGPA 3J80S 2X4AA 3AOGA 2DZNB 1GJSA 4AG5A 4JI6M 1S3SA 2B3TA 1R6BX 2QHOB 2D7EA 2CHQA 3KOXE 3GRUA 3HU3A 2R6FA 3TE6A 4DR6M 2BWEA 1H6UA 3GLFB 4QOSA 1XC8A 5LMNM 5ITXE 4DV5M 2DKLA 2K0BX 2O01F 4DR7M 2BWBA 1QAMA 4HL4A 2C96A 4X66M 2XLJA 1PJQA 2RKOA 1OFHA 2ZM6M 3A46A 2I7NA 1DGBA 1L2DA 3GO8A 3B74A 3GLHA 3GRYA 3U6DA 4B3SM 3I04M 3ZC7B 1V34A 4GHAA 4L78A 4LJ7A 2MGWA 1NY5A 5IT9S 4AKHA 3C58A 1N78A 3U5ZB 4REZA 4B3TM 2CFOA 5KQ8A 1PJTA 1VDLA 5E6JA 4A3VB 2C9CA 4NSRA 3RFWA 1C7YA 1FJGM 4B7HA 3E4RA 2ZTDA 1KYIA 4G4QA 1NNUC 3U61A 1PJSA 2YQZA 1RU3A 1UM8A 1L2CA 2HL7A 1TGUA 3K8ZA 2CV1A 4KO8A 3U6SA 3FTCA 2ZANA 4OX9M 2DENA 1GL6A 4M0WA 2DWLA 4QNRA 1CUKA 1IXSA 2KZUA 3TWLA 3V76A 2FNAA 4FCTA 4LG2A 3VFDA 1Z59A 2XSZA 2YNMD 2HWJA 3AOEC 3PVSA 1OIPA 1SG9A 4IBDA 1IN8A 3M7GA 2CUZA 4FCWA 4AKIA 3SBJA 1G59A 3GRRA 1XXHB 3B7ZA 4JN6A 1NO1A 3FRIA 3HZJA 2JZ1A 3TWMA 2QP9X 2JZ0A 1MU5A 4DV2M 5DNYA 1HQCA 3CF6E 2WSEF 1D0LA 1G41A 4LGMA 3HHYA 1L1TA 3M0EA 3SC3A 1OQYA 2DXIA 4FWDA 2KNVA 2KNZA 1GKIA 1DGGA 2CP8A 4B7GA 4PDGA 1FNNA 2KDLA 4MGYE 3T1YM 4IBIA 1X37A 1YLAA 2WSCF 5EXXA 3QYEA 2UU9M 5EJCA 4QHSA 3ZQJA 5JI3E 3GLIA 3U60B 2KZSA 2JXNA 2LVAA 4WW0A 4EIWA 1XMQM 4PT5A 4MGZE 3KFUG 4OVZA 2Z3XA 1YE9A 4P17A 2DI0A 1IFYA 1I4WA 4IJEA 1T6OA 3HU1A 3TL4X 2JY8A 3JR5A 4LRTA 3VDUA 2XZFA 3HJQA 3LMMA 1N36M 2HAKA 4QHTA 1IXRC 5FTKA 3KOWE 2LWXA 2JNHA 2EJSA 3A42A 4IIWA 5L8RF 2QNJA 2R4EA 2V1UA 4L6V6 3EIHA 2QPAA 1R2ZA 1VG5A 5KPRA 1QANA 2JY7A 4AZFA 2F5QA 3L29A 4I8OA 3GPPA 2FFJA 3GLGE 2R0IA 5GKNA 4AI6A 4FD2A 3HX3A 1DGHA 1GO5A 4IJFA 4LZJA 1L2BA 3A98B 3PFIA 4G6ZA 1TH4A 3DOAA 2LVPC 2R46A 1EFUB 2MJ5B 3SASA 4DV1M 2UXCM 4ITQA 4M9SA 5H37D 1OAIA 1XMOM 2FH0A 1WGLA 4G4NA 2F5SA 1HJPA 2X49A 4FWHA 4F1IA 3KW6A 1D0MA 1NJFA 2ZTCA 4IBFA 1NSFA 4NSOB 1N33M 3U6LA 2XSZD 1JR3A 3AL0C 4BBAA 3W0FA 3SFZA 2CRUA 3GP1A 2DWMA 2BNKA 5EQTA 3SHGB 1R7RA 2QQ8A 2OPFA 1J5EM 4B3RM 4KLNA 1JR3E 1GABA 4RF0A 3HJSA 4M0DA 4FW9A 3FUUA 3FYDA 1JQJC 3B7QA 4D81A 2LBCA 1WIVA 4P16A 1TH3A 4GHLA 2KHHA 4M9XA 4JI1M 4JV5M 2KRKA 3LVVA 2X8AA 4S12A 5EXSA 2CHGA 2AHMA 4XBOA 2L4EA 4IBJA 2F5OA 1NHGC 1IBLM 2G8LA 3R8FA 3L26A 3UK6A 2LVNC 3GQ5A 3W68A 4OU7A 2XFSA 5ITUA 3IG5A 2W82A 2DVWB 1VDDA 2BJWA 1SXJC 2J7NA 3H4JA 4LFAM 2VIIA 2CWBA 1TTEA 4X62M 3GLFA 1WXQA 4Q7JA 1Z5AA 1A5TA 4NXNM 2OOAA 1HQYE 1KSFX 1G71A 4D80A 4RNAA 3GLFE 4NC6A 1GL7A 1MJGM 4JYAM 1VEKA 4UN2B 3CTWB 3SAWA 3FUXA 2HKJA 4DUYM 4DR1M 3GLHE 2R18A 1IY2A 1QZEA 1ZMUA 2CHVA 2KW0A 1VEGA 1T3TA 3VKHA 3M6AA 3T6PA 1E94E 1G3IA 1YSYA 2ZAMA 4GC9A 2L2DA 3U5ZA 4YY3M 2EKFA 3B89A 4FCVA 4KT0F 4LJ9A 1C1KA 3L2AA 1VQ1A 4LGYA 4Z6YA 2C5RA 2C99A 4IBGA 3FRHA 4WURA 1Z5CA 4L8RC 1E9SA 1L8QA 4Z8XA 5ITRA 5BR8M 1DO2A 2WSFF 2HCBA 4GEWA 1QZMA 3KOYE 4DR4M 3FTFA 4RF1A 3F92A 3WHKA 2VF7A 1JR3D 3RGSA 1SXJB 5EXPA 2JY5A 3AV0A 2CEAA 1HT1E 2J5YA 3J2PB 4IBBA 2FOIC 4Y28F 1DV0A 1HNZM 1Z5BA 4WP2A 3UMMA 2I7PA 1NHWC 3KP0E 3BOSA 1W5SA 2KA6B 4LJ4A 3PNYA 3SYKA 1Z6TA 2K9DA 3HKPA 4BB9A 2KEBA 1PM5A 2DAMA 2M5ZA 5JI2E 1XXHA 4G4OA 4DV4M 4PDIA 4ANRA 1XWIA 2XGNA 2EA0A 1OTRA 4K0KM 4AKGA 2QENA 5ITYA 4LF4M 1XXHE 2BJVA 4GITA 4KHPM 3GPXA 1TDHA 1XNQM 2XEPA 3L28A 4HLQA 2RGHA 3K9OA 3QWLA 1QUSA 2P5TA 3D8BA 1QQWA 3KSXA 4DR2M 2JA2A 1ZQ9A 2K47A 1IY1A 4I81A 3HHZA 3GLIE 3U60A 4DR3M 2D7GA 2QCUA 3FUWA 4LJAA 4IBEA 4MH0E 1WJ7A 3C3EA 4LFBM 2Q2EB 4QOZC 2VDBB 1TDZA 1D0KA 2L09A 3GQ4A 1QAQA 1N32M 5EP2A 4NRWA 2JWSA 2VQFM 1IN6A 3PNVA 3AJIB 7CATA 2ERCA 3AOEA 1I94M 5EP1A 1OKSA 4W5WA 3MMPA 2DHRA 1EIJA 4BLCA 2XH9A 3GLGB 1HNWM 1J7KA 1N75A 3C3DA 1EE8A 3NBIA 5KPTA 2NQ8C 4NOOB 1IN5A 1GVNA 3T1HM 2XZUA 2DWZB 2FE8A 1IBKM 2Y0QA 2LVQD 2DZOB 4LF5M 4LJ5A 5EP4A 1QDTA 3DA1A 4R71A 3SATA 3HHXA 1NNJA 2G5GX 3E9SA 1QDRA 3IG8A 4DV0M 4GKKM 3CGWA 2F5PA 5FSWA 1MX0A 2DAGA 2C9OA 3B9PA 4HEOA 3FUVA 3CF2A 1K3WA 1IN4A 2UUAM 2QBYB 4KODA 2YFQA 5F3WA 1PJJA 1GJTA 1OIZA 4MGKE 4DV6M 4XK8F 3LQQA 1HR0M 2UXBM 3NWLA 1IM2A 1R5LA 3LVWA 1PJIA 3KS8A 2LXEA 1LV7A 1OJLA 3GQ3A 1LTMA 5DYGA 5C18A 4YHHM 1N77A 4LJ8A 4LF8M 2VQEM 2A5YB 5FTMA 2YR0A 3ILKA 8CATA 3EIEA 4NL4H 3KSJA 2DHYA 2MROB 3SMSA 3K92A 3NBXX 3K1JA 3U6QA 3DZDA 1VEJA 1KFVA 3BBZA 1F4IA 1AUAA 2D7HA 2R44A 3I4VA 4NRVA 1XNRM 4L4UA 2DAEA 3HGIA 2RGOA 1PRBA 2H5XA 4CJ6A 4L16A 1IN7A 3TPZA 3VK7A 1E32A 4M9ZA 3L27A 3T38A 1NVMA 3A45A 3MK6A 3Q8XA 1GLNA 4GMQA 3WHLA 1NV8A 1XB2B 2Y20A 2HHHM 1K82A 2R65A 1OFIA 1WR1B 3E46A 3T15A 2KNAA 3JR4A 2JUJA 2Z7JA 3HY5A 2L7HA 3UGJA 2LNHC 1G8PA 5ITXA 4CHTB 2F4VM 3U6CA 1V92A 3FE3A 3FUTA 3SMPA 3AKZA 3K9PA 4DUZM 3LW5F 3SAUA 2H1RA 1AIPC 2UUCM 3AFHA 4FWGA 1ZMWA 4I4LA 4JXJA 3E21A 3LQRA 4DV7M 2QZ4A 4JI4M 1Q39A 3D8LA 3GLHB 4MGIE 3UZUA 3KXEC 5ITQA 5KO3A 1QYRA 2MR9A 4LF6M 4B7FA 4MB7A 2UXDM 4JI7M 1N34M 3SYLA 4DV3M 2DNAA 3GRVA 3KP1E 4GRIA 4RKUF 5IREB 2KRUA 3U6MA 4TUWA 3KVWA 3J81S 5BPVA 1TF0B 1NY6A 1Y8GA 3MHVC 3HU2A 3C9PA 3DFZA 1ZV1A 3RE8A 3U61B 1ZAEA 4LZZA 3FTDA 4AW4A 2Z4RA 1SXJA 1ORYB 3HHWA 4PD2A 1G4AE 1NJGA 5IWAM 3CF0A 2L4FA 4JI3M 2N35A 2CV2A 3LCVB 2LHCA 3VLFB 3QYBA 1SXJE 1HT2E 1IXSB 2R4JA 3LCUA 3FKEA 1OAOC 3I51A 5KPZA 1IBMM 5EP3A 3HWSA 4LF9M 2FS1A 1R2YA 3BXWA 4GH9A 3IECA 4D82A 3PXGA 4JI2M 1WHCA 3GPUA 3HJ8A 3ZCBB 2VF8A 2CV0A 3ZH9B 4IBKA 5ITTA 2F5NA 4GIPA 4JI0M 4LY6A 4PCZA 3W0LB 2LH0A 2Z4SA 4LF7M 1ZMVA 1MN3A 3Q8GA 4LCBA 1K3XA 5A2QS 3MJ5A 2O25A 3KDSE 3W67A 4R3DA 4B08A 3GLIB 3U6EA 3R9XB 2OO9A 2Y21A 5E26A 4JI5M 1IY0A 2M60A 2K6BA 4OVZB 4CGYB 4DR5M 3B7NA 2DWNA 3J7AS 4GKJM 1Q02A 4QNMA 4CIZA 1HNXM 1Q3CA 2J7OA 5DFLA 1PGYA 4MGHA 3J27B 4GC5A 4LFCM 1DO0A 3I4YA 4IBCA 3FYCA 5EXTA 3SARA 5FTJA 1Q3BA 3UJNA 1W5TA 2OOBA 2R45A 2E5LM 2ZAOA 2JP7A 2L7IA 4F2LA 3H4MA 2EUCA 1QUTA 4JI8M 5FLXS 2APLA 2KXEA 2MH8A 1BVSA 3GLGA 2DZLA 1IQPA 4R7GA 5FTNA 5FTLA 2XF3A 3VDPA 1DGFA 3VK8A 1YUBA 1DGHB 2LTUA 4L15A 3U6OA 2CE7A 3KS4A 3VKGA 3QAUA 1R4GA 1T43A 3THGA 4X64M 4LRSA 3J7BA 3OTOM 4II7A 2R62A 2OQ4A 1TH2A 3TWKA 3JAMS 2JY6B 2O5RA 2UUBM 1JB0F 2QSFX 1UFZA 2GNOA 2V6ZM 1P3QQ 1TR8A 4ZPXA 4FVMA 4AG6A 1QVRA 1SXJD 2QBYA 4DBGB 1WGNA 2EKKA 4NXMM 3K2LA 3GPYA 1D2NA 1L1ZA 2ZBKB 3L25A 4OW0A 5IZ7D 4X65M 3FTEA 2EO2A 3IHPA 1J09A 3U6PA 1NV9A 1V33A 3I01M 2G3QA 2Z8YM 2V1CA
chains in the Genus database with same CATH topology
1QAOA 1E9RA 1IXZA 5C1BA 4I5SA 3TQSA 4AQYM 4MM3B 2XFTA 3SHFA 3FD9A 4LJ6A 4B3MM 3SAVA 2L6OA 3KOZE 4G4RA 2C98A 1XHBA 2Y0TA 5KQDA 4CISA 4XGIA 5DYIA 5LMUM 3RGPA 3J80S 2X4AA 3AOGA 2DZNB 4AG5A 4JI6M 1S3SA 1R6BX 2D7EA 2CHQA 3KOXE 3GRUA 3HU3A 3TE6A 4DR6M 1H6UA 3GLFB 4QOSA 1XC8A 5LMNM 5ITXE 4DV5M 4DR7M 4HL4A 1QAMA 2C96A 4X66M 2XLJA 2RKOA 1OFHA 2ZM6M 3A46A 2I7NA 1DGBA 1L2DA 3GO8A 3GRYA 3GLHA 3U6DA 4B3SM 3ZC7B 4GHAA 4L78A 4LJ7A 1NY5A 5IT9S 4AKHA 3C58A 1N78A 3U5ZB 4REZA 4B3TM 2CFOA 5KQ8A 5E6JA 4A3VB 2C9CA 4NSRA 3RFWA 1FJGM 4B7HA 3E4RA 1KYIA 4G4QA 1NNUC 3U61A 2YQZA 1UM8A 1L2CA 2HL7A 1TGUA 3K8ZA 2CV1A 4KO8A 3U6SA 3FTCA 2ZANA 4OX9M 1GL6A 4M0WA 2DWLA 4QNRA 3TWLA 2KZUA 4LG2A 2FNAA 4FCTA 3VFDA 1Z59A 2XSZA 2YNMD 3AOEC 3PVSA 4IBDA 1IN8A 3M7GA 2CUZA 4FCWA 4AKIA 3SBJA 1G59A 3GRRA 1XXHB 4JN6A 3TWMA 2QP9X 1MU5A 4DV2M 5DNYA 1HQCA 3CF6E 4LGMA 1G41A 3HHYA 1L1TA 3M0EA 3SC3A 2DXIA 4FWDA 1GKIA 1DGGA 4B7GA 4PDGA 1FNNA 3T1YM 4MGYE 4IBIA 1X37A 5EXXA 2UU9M 5EJCA 4QHSA 5JI3E 3GLIA 3U60B 2KZSA 4WW0A 1XMQM 4EIWA 4PT5A 4MGZE 3KFUG 4OVZA 2Z3XA 1YE9A 1I4WA 4IJEA 3HU1A 3TL4X 3JR5A 4LRTA 3VDUA 2XZFA 3HJQA 3LMMA 1N36M 4QHTA 1IXRC 5FTKA 3KOWE 2LWXA 3A42A 4IIWA 2V1UA 2R4EA 3EIHA 2QPAA 1R2ZA 5KPRA 1QANA 4AZFA 2F5QA 3L29A 4I8OA 3GPPA 2FFJA 4AI6A 5GKNA 4FD2A 1DGHA 4IJFA 4LZJA 1L2BA 3A98B 3PFIA 4G6ZA 1TH4A 3DOAA 2R46A 3SASA 4DV1M 2UXCM 4ITQA 4M9SA 5H37D 1XMOM 4G4NA 2F5SA 2X49A 4FWHA 3KW6A 1NJFA 4IBFA 1NSFA 4NSOB 1N33M 3U6LA 2XSZD 1JR3A 3AL0C 4BBAA 3W0FA 3SFZA 3GP1A 2DWMA 2BNKA 5EQTA 3SHGB 1R7RA 2OPFA 1J5EM 4B3RM 4KLNA 4RF0A 3HJSA 4M0DA 4FW9A 3FUUA 3FYDA 1JQJC 4D81A 4P16A 1TH3A 4GHLA 4JI1M 4M9XA 4JV5M 2KRKA 3LVVA 2X8AA 4S12A 5EXSA 2CHGA 2AHMA 4XBOA 4IBJA 2F5OA 1NHGC 1IBLM 2G8LA 3R8FA 3L26A 3UK6A 3GQ5A 4OU7A 2XFSA 5ITUA 3IG5A 2W82A 2DVWB 1VDDA 2BJWA 1SXJC 2J7NA 4LFAM 4X62M 2VIIA 3GLFA 1WXQA 1Z5AA 4NXNM 1HQYE 1KSFX 4D80A 4RNAA 1GL7A 4JYAM 3CTWB 3SAWA 3FUXA 2HKJA 4DUYM 4DR1M 2R18A 1IY2A 2CHVA 2KW0A 1T3TA 3VKHA 3M6AA 1E94E 1G3IA 1YSYA 2ZAMA 4GC9A 3U5ZA 4YY3M 4FCVA 4LJ9A 1C1KA 3L2AA 4Z6YA 2C5RA 2C99A 4IBGA 4WURA 1Z5CA 4L8RC 1E9SA 1L8QA 4Z8XA 5ITRA 5BR8M 1DO2A 2HCBA 1QZMA 3KOYE 4DR4M 3FTFA 4RF1A 3WHKA 1JR3D 3RGSA 1SXJB 5EXPA 3AV0A 2CEAA 1HT1E 3J2PB 4IBBA 2FOIC 1HNZM 1Z5BA 3UMMA 3KP0E 2I7PA 1NHWC 3BOSA 1W5SA 2KA6B 4LJ4A 3PNYA 3SYKA 1Z6TA 3HKPA 4BB9A 2KEBA 1PM5A 2M5ZA 5JI2E 1XXHA 4G4OA 4DV4M 4PDIA 1XWIA 2XGNA 2EA0A 4K0KM 4AKGA 2QENA 5ITYA 4LF4M 2BJVA 4GITA 4KHPM 3GPXA 1TDHA 1XNQM 2XEPA 3L28A 4HLQA 2RGHA 3QWLA 2P5TA 4DR2M 3D8BA 1QQWA 3KSXA 2JA2A 1ZQ9A 2K47A 1IY1A 4I81A 3HHZA 3U60A 4DR3M 2D7GA 2QCUA 3FUWA 4LJAA 4IBEA 4MH0E 4LFBM 2Q2EB 4QOZC 1TDZA 2L09A 3GQ4A 1QAQA 1N32M 5EP2A 4NRWA 2VQFM 1IN6A 3PNVA 3AJIB 7CATA 2ERCA 3AOEA 1I94M 5EP1A 4W5WA 2DHRA 4BLCA 2XH9A 3GLGB 1HNWM 1J7KA 1N75A 1EE8A 3NBIA 5KPTA 2NQ8C 4NOOB 1IN5A 1GVNA 3T1HM 2XZUA 2DWZB 2FE8A 1IBKM 2Y0QA 2DZOB 4LF5M 4LJ5A 5EP4A 3SATA 3DA1A 3HHXA 1NNJA 2G5GX 3E9SA 4DV0M 3IG8A 4GKKM 2F5PA 5FSWA 1MX0A 2C9OA 3B9PA 1K3WA 3FUVA 3CF2A 1IN4A 2UUAM 2QBYB 4KODA 2YFQA 5F3WA 1PJJA 4MGKE 4DV6M 3LQQA 1HR0M 2UXBM 3NWLA 1IM2A 3LVWA 1PJIA 3KS8A 2LXEA 1LV7A 1OJLA 3GQ3A 5DYGA 5C18A 4YHHM 1N77A 4LJ8A 4LF8M 2VQEM 2A5YB 5FTMA 2YR0A 3ILKA 8CATA 3EIEA 4NL4H 3KSJA 3SMSA 3U6QA 3K92A 3K1JA 3DZDA 1KFVA 2D7HA 3I4VA 4NRVA 1XNRM 4L4UA 3HGIA 2RGOA 4L16A 1IN7A 3TPZA 3VK7A 1E32A 4M9ZA 3L27A 3T38A 1NVMA 3A45A 3MK6A 3Q8XA 1GLNA 4GMQA 3WHLA 2Y20A 2HHHM 1K82A 2R65A 1OFIA 3T15A 2Z7JA 2L7HA 3UGJA 2LNHC 1G8PA 5ITXA 4CHTB 2F4VM 3U6CA 3SMPA 3FUTA 3AKZA 4DUZM 3SAUA 2H1RA 2UUCM 3AFHA 4FWGA 4JXJA 4I4LA 3LQRA 4DV7M 2QZ4A 4JI4M 1Q39A 3D8LA 3GLHB 4MGIE 3UZUA 3KXEC 5ITQA 5KO3A 1QYRA 4LF6M 4B7FA 4MB7A 2UXDM 4JI7M 1N34M 3SYLA 4DV3M 3GRVA 3KP1E 4GRIA 4TUWA 5IREB 2KRUA 3U6MA 3KVWA 3J81S 5BPVA 1NY6A 3MHVC 3HU2A 3DFZA 3U61B 1ZAEA 4LZZA 3FTDA 4AW4A 2Z4RA 1SXJA 1ORYB 3HHWA 4PD2A 1G4AE 1NJGA 5IWAM 3CF0A 4JI3M 2CV2A 3VLFB 1SXJE 1HT2E 1IXSB 2R4JA 3FKEA 3I51A 5KPZA 1IBMM 5EP3A 3HWSA 4LF9M 1R2YA 4GH9A 4D82A 3PXGA 4JI2M 3GPUA 3HJ8A 3ZCBB 2CV0A 3ZH9B 4IBKA 5ITTA 2F5NA 4GIPA 4JI0M 4LY6A 4PCZA 3W0LB 2LH0A 2Z4SA 4LF7M 1K3XA 4LCBA 5A2QS 3MJ5A 3GLIB 3KDSE 4B08A 4R3DA 3U6EA 3R9XB 2Y21A 5E26A 4JI5M 1IY0A 2M60A 4OVZB 4CGYB 4DR5M 2DWNA 3J7AS 4GKJM 4QNMA 1HNXM 1Q3CA 2J7OA 4MGHA 3J27B 4GC5A 4LFCM 1DO0A 3I4YA 4IBCA 3FYCA 5EXTA 3SARA 5FTJA 1Q3BA 3UJNA 1W5TA 2R45A 2E5LM 2ZAOA 2L7IA 3H4MA 2EUCA 4JI8M 5FLXS 3GLGA 2KXEA 4R7GA 1IQPA 5FTNA 5FTLA 2XF3A 3VDPA 1DGFA 3VK8A 1YUBA 1DGHB 4L15A 3U6OA 2CE7A 3KS4A 3VKGA 3QAUA 3THGA 4X64M 4LRSA 3J7BA 3OTOM 4II7A 2R62A 2OQ4A 1TH2A 3TWKA 3JAMS 2O5RA 2UUBM 2V6ZM 4ZPXA 4FVMA 4AG6A 1QVRA 1SXJD 2QBYA 4NXMM 3K2LA 3GPYA 1D2NA 1L1ZA 2ZBKB 3L25A 4OW0A 5IZ7D 4X65M 3FTEA 2EO2A 1J09A 3U6PA 3JR4A 4LGYA 3RE8A 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ M;  3SAU A;  1PM5 A;  1R2Z A;  2UUC M;  4DV7 M;  4AQY M;  4JI4 M;  4G4O A;  2F5Q A;  1Q39 A;  3GPP A;  4PDI A;  4DV4 M;  5ITQ A;  4K0K M;  2EA0 A;  4LF6 M;  4B3M M;  3A42 A;  5ITY A;  4MB7 A;  4LF4 M;  2UXD M;  4JI7 M;  3SAV A;  1N34 M;  4DV3 M;  4KHP M;  3GPX A;  1TDH A;  1L2B A;  1XNQ M;  4G4R A;  3DOA A;  4DR2 M;  3U6M A;  4CIS A;  5LMU M;  3J80 S;  3J81 S;  3SAS A;  4DV1 M;  4JI6 M;  2UXC M;  4ITQ A;  4DR3 M;  1XMO M;  4G4N A;  2F5S A;  4DR6 M;  4LFB M;  2Q2E B;  4PD2 A;  1TDZ A;  3GQ4 A;  5IWA M;  1XC8 A;  1N33 M;  5LMN M;  3U6L A;  5ITX E;  1N32 M;  4JI3 M;  4DV5 M;  4NRW A;  4DR7 M;  3W0F A;  4X66 M;  3GP1 A;  2VQF M;  2ZM6 M;  2OPF A;  1I94 M;  3A46 A;  1J5E M;  1L2D A;  1IBM M;  4B3R M;  3GO8 A;  3U6D A;  4B3S M;  4LF9 M;  1R2Y A;  4JI1 M;  4JI2 M;  1HNW M;  4JV5 M;  1EE8 A;  3T1H M;  5IT9 S;  3C58 A;  3GPU A;  2XZU A;  4B3T M;  1IBK M;  2F5O A;  4LF5 M;  3SAT A;  5ITT A;  2F5N A;  4JI0 M;  1IBL M;  1FJG M;  1NNJ A;  4GKK M;  4DV0 M;  4PCZ A;  4G4Q A;  4LF7 M;  2F5P A;  1MX0 A;  3GQ5 A;  1K3X A;  1K3W A;  5A2Q S;  5ITU A;  3U6E A;  1L2C A;  2UUA M;  4LFA M;  4JI5 M;  3U6S A;  4X62 M;  4DR5 M;  4OX9 M;  3J7A S;  4GKJ M;  1PJJ A;  4DV6 M;  1HNX M;  1Z5A A;  1HR0 M;  2UXB M;  1Q3C A;  4NXN M;  1PJI A;  4LFC M;  3TWL A;  3GQ3 A;  1Z59 A;  4YHH M;  4LF8 M;  3SAR A;  2VQE M;  1Q3B A;  4JYA M;  2E5L M;  3SAW A;  2HKJ A;  4DUY M;  4DR1 M;  3U6Q A;  4JI8 M;  3SBJ A;  1KFV A;  5FLX S;  3TWM A;  1MU5 A;  4NRV A;  4DV2 M;  3VK8 A;  1XNR M;  4YY3 M;  1L1T A;  3U6O A;  3VK7 A;  4PDG A;  4X64 M;  3OTO M;  3T1Y M;  2OQ4 A;  3A45 A;  3TWK A;  3JAM S;  2UU9 M;  1Z5C A;  2UUB M;  5ITR A;  5BR8 M;  1XMQ M;  4DR4 M;  4NXM M;  2HHH M;  3GPY A;  1K82 A;  1L1Z A;  2ZBK B;  3JR5 A;  2XZF A;  4X65 M;  1N36 M;  5ITX A;  1Z5B A;  3U6P A;  1HNZ M;  2F4V M;  3U6C A;  3JR4 A; 
#chains in the Genus database with same CATH topology
 1QAO A;  1E9R A;  1IXZ A;  2LHG A;  5C1B A;  4I5S A;  3TQS A;  4AQY M;  4MM3 B;  2XFT A;  3SHF A;  3FD9 A;  4LJ6 A;  4G3O A;  2GQF A;  2RRU A;  4B3M M;  2DAI A;  3SAV A;  2L6O A;  2LVO C;  3KOZ E;  4G4R A;  2C98 A;  2WZJ A;  2DAK A;  1XHB A;  2Y0T A;  5KQD A;  4CIS A;  4XGI A;  5DYI A;  5LMU M;  3RGP A;  3J80 S;  2X4A A;  3AOG A;  2DZN B;  1GJS A;  4AG5 A;  4JI6 M;  1S3S A;  2B3T A;  1R6B X;  2QHO B;  2D7E A;  2CHQ A;  3KOX E;  3GRU A;  3HU3 A;  2R6F A;  3TE6 A;  4DR6 M;  2BWE A;  1H6U A;  3GLF B;  4QOS A;  1XC8 A;  5LMN M;  5ITX E;  4DV5 M;  2DKL A;  2K0B X;  2O01 F;  4DR7 M;  2BWB A;  1QAM A;  4HL4 A;  2C96 A;  4X66 M;  2XLJ A;  1PJQ A;  2RKO A;  1OFH A;  2ZM6 M;  3A46 A;  2I7N A;  1DGB A;  1L2D A;  3GO8 A;  3B74 A;  3GLH A;  3GRY A;  3U6D A;  4B3S M;  3I04 M;  3ZC7 B;  1V34 A;  4GHA A;  4L78 A;  4LJ7 A;  2MGW A;  1NY5 A;  5IT9 S;  4AKH A;  3C58 A;  1N78 A;  3U5Z B;  4REZ A;  4B3T M;  2CFO A;  5KQ8 A;  1PJT A;  1VDL A;  5E6J A;  4A3V B;  2C9C A;  4NSR A;  3RFW A;  1C7Y A;  1FJG M;  4B7H A;  3E4R A;  2ZTD A;  1KYI A;  4G4Q A;  1NNU C;  3U61 A;  1PJS A;  2YQZ A;  1RU3 A;  1UM8 A;  1L2C A;  2HL7 A;  1TGU A;  3K8Z A;  2CV1 A;  4KO8 A;  3U6S A;  3FTC A;  2ZAN A;  4OX9 M;  2DEN A;  1GL6 A;  4M0W A;  2DWL A;  4QNR A;  1CUK A;  1IXS A;  2KZU A;  3TWL A;  3V76 A;  2FNA A;  4FCT A;  4LG2 A;  3VFD A;  1Z59 A;  2XSZ A;  2YNM D;  2HWJ A;  3AOE C;  3PVS A;  1OIP A;  1SG9 A;  4IBD A;  1IN8 A;  3M7G A;  2CUZ A;  4FCW A;  4AKI A;  3SBJ A;  1G59 A;  3GRR A;  1XXH B;  3B7Z A;  4JN6 A;  1NO1 A;  3FRI A;  3HZJ A;  2JZ1 A;  3TWM A;  2QP9 X;  2JZ0 A;  1MU5 A;  4DV2 M;  5DNY A;  1HQC A;  3CF6 E;  2WSE F;  1D0L A;  1G41 A;  4LGM A;  3HHY A;  1L1T A;  3M0E A;  3SC3 A;  1OQY A;  2DXI A;  4FWD A;  2KNV A;  2KNZ A;  1GKI A;  1DGG A;  2CP8 A;  4B7G A;  4PDG A;  1FNN A;  2KDL A;  4MGY E;  3T1Y M;  4IBI A;  1X37 A;  1YLA A;  2WSC F;  5EXX A;  3QYE A;  2UU9 M;  5EJC A;  4QHS A;  3ZQJ A;  5JI3 E;  3GLI A;  3U60 B;  2KZS A;  2JXN A;  2LVA A;  4WW0 A;  4EIW A;  1XMQ M;  4PT5 A;  4MGZ E;  3KFU G;  4OVZ A;  2Z3X A;  1YE9 A;  4P17 A;  2DI0 A;  1IFY A;  1I4W A;  4IJE A;  1T6O A;  3HU1 A;  3TL4 X;  2JY8 A;  3JR5 A;  4LRT A;  3VDU A;  2XZF A;  3HJQ A;  3LMM A;  1N36 M;  2HAK A;  4QHT A;  1IXR C;  5FTK A;  3KOW E;  2LWX A;  2JNH A;  2EJS A;  3A42 A;  4IIW A;  5L8R F;  2QNJ A;  2R4E A;  2V1U A;  4L6V 6;  3EIH A;  2QPA A;  1R2Z A;  1VG5 A;  5KPR A;  1QAN A;  2JY7 A;  4AZF A;  2F5Q A;  3L29 A;  4I8O A;  3GPP A;  2FFJ A;  3GLG E;  2R0I A;  5GKN A;  4AI6 A;  4FD2 A;  3HX3 A;  1DGH A;  1GO5 A;  4IJF A;  4LZJ A;  1L2B A;  3A98 B;  3PFI A;  4G6Z A;  1TH4 A;  3DOA A;  2LVP C;  2R46 A;  1EFU B;  2MJ5 B;  3SAS A;  4DV1 M;  2UXC M;  4ITQ A;  4M9S A;  5H37 D;  1OAI A;  1XMO M;  2FH0 A;  1WGL A;  4G4N A;  2F5S A;  1HJP A;  2X49 A;  4FWH A;  4F1I A;  3KW6 A;  1D0M A;  1NJF A;  2ZTC A;  4IBF A;  1NSF A;  4NSO B;  1N33 M;  3U6L A;  2XSZ D;  1JR3 A;  3AL0 C;  4BBA A;  3W0F A;  3SFZ A;  2CRU A;  3GP1 A;  2DWM A;  2BNK A;  5EQT A;  3SHG B;  1R7R A;  2QQ8 A;  2OPF A;  1J5E M;  4B3R M;  4KLN A;  1JR3 E;  1GAB A;  4RF0 A;  3HJS A;  4M0D A;  4FW9 A;  3FUU A;  3FYD A;  1JQJ C;  3B7Q A;  4D81 A;  2LBC A;  1WIV A;  4P16 A;  1TH3 A;  4GHL A;  2KHH A;  4M9X A;  4JI1 M;  4JV5 M;  2KRK A;  3LVV A;  2X8A A;  4S12 A;  5EXS A;  2CHG A;  2AHM A;  4XBO A;  2L4E A;  4IBJ A;  2F5O A;  1NHG C;  1IBL M;  2G8L A;  3R8F A;  3L26 A;  3UK6 A;  2LVN C;  3GQ5 A;  3W68 A;  4OU7 A;  2XFS A;  5ITU A;  3IG5 A;  2W82 A;  2DVW B;  1VDD A;  2BJW A;  1SXJ C;  2J7N A;  3H4J A;  4LFA M;  2VII A;  2CWB A;  1TTE A;  4X62 M;  3GLF A;  1WXQ A;  4Q7J A;  1Z5A A;  1A5T A;  4NXN M;  2OOA A;  1HQY E;  1KSF X;  1G71 A;  4D80 A;  4RNA A;  3GLF E;  4NC6 A;  1GL7 A;  1MJG M;  4JYA M;  1VEK A;  4UN2 B;  3CTW B;  3SAW A;  3FUX A;  2HKJ A;  4DUY M;  4DR1 M;  3GLH E;  2R18 A;  1IY2 A;  1QZE A;  1ZMU A;  2CHV A;  2KW0 A;  1VEG A;  1T3T A;  3VKH A;  3M6A A;  3T6P A;  1E94 E;  1G3I A;  1YSY A;  2ZAM A;  4GC9 A;  2L2D A;  3U5Z A;  4YY3 M;  2EKF A;  3B89 A;  4FCV A;  4KT0 F;  4LJ9 A;  1C1K A;  3L2A A;  1VQ1 A;  4LGY A;  4Z6Y A;  2C5R A;  2C99 A;  4IBG A;  3FRH A;  4WUR A;  1Z5C A;  4L8R C;  1E9S A;  1L8Q A;  4Z8X A;  5ITR A;  5BR8 M;  1DO2 A;  2WSF F;  2HCB A;  4GEW A;  1QZM A;  3KOY E;  4DR4 M;  3FTF A;  4RF1 A;  3F92 A;  3WHK A;  2VF7 A;  1JR3 D;  3RGS A;  1SXJ B;  5EXP A;  2JY5 A;  3AV0 A;  2CEA A;  1HT1 E;  2J5Y A;  3J2P B;  4IBB A;  2FOI C;  4Y28 F;  1DV0 A;  1HNZ M;  1Z5B A;  4WP2 A;  3UMM A;  2I7P A;  1NHW C;  3KP0 E;  3BOS A;  1W5S A;  2KA6 B;  4LJ4 A;  3PNY A;  3SYK A;  1Z6T A;  2K9D A;  3HKP A;  4BB9 A;  2KEB A;  1PM5 A;  2DAM A;  2M5Z A;  5JI2 E;  1XXH A;  4G4O A;  4DV4 M;  4PDI A;  4ANR A;  1XWI A;  2XGN A;  2EA0 A;  1OTR A;  4K0K M;  4AKG A;  2QEN A;  5ITY A;  4LF4 M;  1XXH E;  2BJV A;  4GIT A;  4KHP M;  3GPX A;  1TDH A;  1XNQ M;  2XEP A;  3L28 A;  4HLQ A;  2RGH A;  3K9O A;  3QWL A;  1QUS A;  2P5T A;  3D8B A;  1QQW A;  3KSX A;  4DR2 M;  2JA2 A;  1ZQ9 A;  2K47 A;  1IY1 A;  4I81 A;  3HHZ A;  3GLI E;  3U60 A;  4DR3 M;  2D7G A;  2QCU A;  3FUW A;  4LJA A;  4IBE A;  4MH0 E;  1WJ7 A;  3C3E A;  4LFB M;  2Q2E B;  4QOZ C;  2VDB B;  1TDZ A;  1D0K A;  2L09 A;  3GQ4 A;  1QAQ A;  1N32 M;  5EP2 A;  4NRW A;  2JWS A;  2VQF M;  1IN6 A;  3PNV A;  3AJI B;  7CAT A;  2ERC A;  3AOE A;  1I94 M;  5EP1 A;  1OKS A;  4W5W A;  3MMP A;  2DHR A;  1EIJ A;  4BLC A;  2XH9 A;  3GLG B;  1HNW M;  1J7K A;  1N75 A;  3C3D A;  1EE8 A;  3NBI A;  5KPT A;  2NQ8 C;  4NOO B;  1IN5 A;  1GVN A;  3T1H M;  2XZU A;  2DWZ B;  2FE8 A;  1IBK M;  2Y0Q A;  2LVQ D;  2DZO B;  4LF5 M;  4LJ5 A;  5EP4 A;  1QDT A;  3DA1 A;  4R71 A;  3SAT A;  3HHX A;  1NNJ A;  2G5G X;  3E9S A;  1QDR A;  3IG8 A;  4DV0 M;  4GKK M;  3CGW A;  2F5P A;  5FSW A;  1MX0 A;  2DAG A;  2C9O A;  3B9P A;  4HEO A;  3FUV A;  3CF2 A;  1K3W A;  1IN4 A;  2UUA M;  2QBY B;  4KOD A;  2YFQ A;  5F3W A;  1PJJ A;  1GJT A;  1OIZ A;  4MGK E;  4DV6 M;  4XK8 F;  3LQQ A;  1HR0 M;  2UXB M;  3NWL A;  1IM2 A;  1R5L A;  3LVW A;  1PJI A;  3KS8 A;  2LXE A;  1LV7 A;  1OJL A;  3GQ3 A;  1LTM A;  5DYG A;  5C18 A;  4YHH M;  1N77 A;  4LJ8 A;  4LF8 M;  2VQE M;  2A5Y B;  5FTM A;  2YR0 A;  3ILK A;  8CAT A;  3EIE A;  4NL4 H;  3KSJ A;  2DHY A;  2MRO B;  3SMS A;  3K92 A;  3NBX X;  3K1J A;  3U6Q A;  3DZD A;  1VEJ A;  1KFV A;  3BBZ A;  1F4I A;  1AUA A;  2D7H A;  2R44 A;  3I4V A;  4NRV A;  1XNR M;  4L4U A;  2DAE A;  3HGI A;  2RGO A;  1PRB A;  2H5X A;  4CJ6 A;  4L16 A;  1IN7 A;  3TPZ A;  3VK7 A;  1E32 A;  4M9Z A;  3L27 A;  3T38 A;  1NVM A;  3A45 A;  3MK6 A;  3Q8X A;  1GLN A;  4GMQ A;  3WHL A;  1NV8 A;  1XB2 B;  2Y20 A;  2HHH M;  1K82 A;  2R65 A;  1OFI A;  1WR1 B;  3E46 A;  3T15 A;  2KNA A;  3JR4 A;  2JUJ A;  2Z7J A;  3HY5 A;  2L7H A;  3UGJ A;  2LNH C;  1G8P A;  5ITX A;  4CHT B;  2F4V M;  3U6C A;  1V92 A;  3FE3 A;  3FUT A;  3SMP A;  3AKZ A;  3K9P A;  4DUZ M;  3LW5 F;  3SAU A;  2H1R A;  1AIP C;  2UUC M;  3AFH A;  4FWG A;  1ZMW A;  4I4L A;  4JXJ A;  3E21 A;  3LQR A;  4DV7 M;  2QZ4 A;  4JI4 M;  1Q39 A;  3D8L A;  3GLH B;  4MGI E;  3UZU A;  3KXE C;  5ITQ A;  5KO3 A;  1QYR A;  2MR9 A;  4LF6 M;  4B7F A;  4MB7 A;  2UXD M;  4JI7 M;  1N34 M;  3SYL A;  4DV3 M;  2DNA A;  3GRV A;  3KP1 E;  4GRI A;  4RKU F;  5IRE B;  2KRU A;  3U6M A;  4TUW A;  3KVW A;  3J81 S;  5BPV A;  1TF0 B;  1NY6 A;  1Y8G A;  3MHV C;  3HU2 A;  3C9P A;  3DFZ A;  1ZV1 A;  3RE8 A;  3U61 B;  1ZAE A;  4LZZ A;  3FTD A;  4AW4 A;  2Z4R A;  1SXJ A;  1ORY B;  3HHW A;  4PD2 A;  1G4A E;  1NJG A;  5IWA M;  3CF0 A;  2L4F A;  4JI3 M;  2N35 A;  2CV2 A;  3LCV B;  2LHC A;  3VLF B;  3QYB A;  1SXJ E;  1HT2 E;  1IXS B;  2R4J A;  3LCU A;  3FKE A;  1OAO C;  3I51 A;  5KPZ A;  1IBM M;  5EP3 A;  3HWS A;  4LF9 M;  2FS1 A;  1R2Y A;  3BXW A;  4GH9 A;  3IEC A;  4D82 A;  3PXG A;  4JI2 M;  1WHC A;  3GPU A;  3HJ8 A;  3ZCB B;  2VF8 A;  2CV0 A;  3ZH9 B;  4IBK A;  5ITT A;  2F5N A;  4GIP A;  4JI0 M;  4LY6 A;  4PCZ A;  3W0L B;  2LH0 A;  2Z4S A;  4LF7 M;  1ZMV A;  1MN3 A;  3Q8G A;  4LCB A;  1K3X A;  5A2Q S;  3MJ5 A;  2O25 A;  3KDS E;  3W67 A;  4R3D A;  4B08 A;  3GLI B;  3U6E A;  3R9X B;  2OO9 A;  2Y21 A;  5E26 A;  4JI5 M;  1IY0 A;  2M60 A;  2K6B A;  4OVZ B;  4CGY B;  4DR5 M;  3B7N A;  2DWN A;  3J7A S;  4GKJ M;  1Q02 A;  4QNM A;  4CIZ A;  1HNX M;  1Q3C A;  2J7O A;  5DFL A;  1PGY A;  4MGH A;  3J27 B;  4GC5 A;  4LFC M;  1DO0 A;  3I4Y A;  4IBC A;  3FYC A;  5EXT A;  3SAR A;  5FTJ A;  1Q3B A;  3UJN A;  1W5T A;  2OOB A;  2R45 A;  2E5L M;  2ZAO A;  2JP7 A;  2L7I A;  4F2L A;  3H4M A;  2EUC A;  1QUT A;  4JI8 M;  5FLX S;  2APL A;  2KXE A;  2MH8 A;  1BVS A;  3GLG A;  2DZL A;  1IQP A;  4R7G A;  5FTN A;  5FTL A;  2XF3 A;  3VDP A;  1DGF A;  3VK8 A;  1YUB A;  1DGH B;  2LTU A;  4L15 A;  3U6O A;  2CE7 A;  3KS4 A;  3VKG A;  3QAU A;  1R4G A;  1T43 A;  3THG A;  4X64 M;  4LRS A;  3J7B A;  3OTO M;  4II7 A;  2R62 A;  2OQ4 A;  1TH2 A;  3TWK A;  3JAM S;  2JY6 B;  2O5R A;  2UUB M;  1JB0 F;  2QSF X;  1UFZ A;  2GNO A;  2V6Z M;  1P3Q Q;  1TR8 A;  4ZPX A;  4FVM A;  4AG6 A;  1QVR A;  1SXJ D;  2QBY A;  4DBG B;  1WGN A;  2EKK A;  4NXM M;  3K2L A;  3GPY A;  1D2N A;  1L1Z A;  2ZBK B;  3L25 A;  4OW0 A;  5IZ7 D;  4X65 M;  3FTE A;  2EO2 A;  3IHP A;  1J09 A;  3U6P A;  1NV9 A;  1V33 A;  3I01 M;  2G3Q A;  2Z8Y M;  2V1C A; 
#chains in the Genus database with same CATH homology
 1QAO A;  1E9R A;  1IXZ A;  5C1B A;  4I5S A;  3TQS A;  4AQY M;  4MM3 B;  2XFT A;  3SHF A;  3FD9 A;  4LJ6 A;  4B3M M;  3SAV A;  2L6O A;  3KOZ E;  4G4R A;  2C98 A;  1XHB A;  2Y0T A;  5KQD A;  4CIS A;  4XGI A;  5DYI A;  5LMU M;  3RGP A;  3J80 S;  2X4A A;  3AOG A;  2DZN B;  4AG5 A;  4JI6 M;  1S3S A;  1R6B X;  2D7E A;  2CHQ A;  3KOX E;  3GRU A;  3HU3 A;  3TE6 A;  4DR6 M;  1H6U A;  3GLF B;  4QOS A;  1XC8 A;  5LMN M;  5ITX E;  4DV5 M;  4DR7 M;  4HL4 A;  1QAM A;  2C96 A;  4X66 M;  2XLJ A;  2RKO A;  1OFH A;  2ZM6 M;  3A46 A;  2I7N A;  1DGB A;  1L2D A;  3GO8 A;  3GRY A;  3GLH A;  3U6D A;  4B3S M;  3ZC7 B;  4GHA A;  4L78 A;  4LJ7 A;  1NY5 A;  5IT9 S;  4AKH A;  3C58 A;  1N78 A;  3U5Z B;  4REZ A;  4B3T M;  2CFO A;  5KQ8 A;  5E6J A;  4A3V B;  2C9C A;  4NSR A;  3RFW A;  1FJG M;  4B7H A;  3E4R A;  1KYI A;  4G4Q A;  1NNU C;  3U61 A;  2YQZ A;  1UM8 A;  1L2C A;  2HL7 A;  1TGU A;  3K8Z A;  2CV1 A;  4KO8 A;  3U6S A;  3FTC A;  2ZAN A;  4OX9 M;  1GL6 A;  4M0W A;  2DWL A;  4QNR A;  3TWL A;  2KZU A;  4LG2 A;  2FNA A;  4FCT A;  3VFD A;  1Z59 A;  2XSZ A;  2YNM D;  3AOE C;  3PVS A;  4IBD A;  1IN8 A;  3M7G A;  2CUZ A;  4FCW A;  4AKI A;  3SBJ A;  1G59 A;  3GRR A;  1XXH B;  4JN6 A;  3TWM A;  2QP9 X;  1MU5 A;  4DV2 M;  5DNY A;  1HQC A;  3CF6 E;  4LGM A;  1G41 A;  3HHY A;  1L1T A;  3M0E A;  3SC3 A;  2DXI A;  4FWD A;  1GKI A;  1DGG A;  4B7G A;  4PDG A;  1FNN A;  3T1Y M;  4MGY E;  4IBI A;  1X37 A;  5EXX A;  2UU9 M;  5EJC A;  4QHS A;  5JI3 E;  3GLI A;  3U60 B;  2KZS A;  4WW0 A;  1XMQ M;  4EIW A;  4PT5 A;  4MGZ E;  3KFU G;  4OVZ A;  2Z3X A;  1YE9 A;  1I4W A;  4IJE A;  3HU1 A;  3TL4 X;  3JR5 A;  4LRT A;  3VDU A;  2XZF A;  3HJQ A;  3LMM A;  1N36 M;  4QHT A;  1IXR C;  5FTK A;  3KOW E;  2LWX A;  3A42 A;  4IIW A;  2V1U A;  2R4E A;  3EIH A;  2QPA A;  1R2Z A;  5KPR A;  1QAN A;  4AZF A;  2F5Q A;  3L29 A;  4I8O A;  3GPP A;  2FFJ A;  4AI6 A;  5GKN A;  4FD2 A;  1DGH A;  4IJF A;  4LZJ A;  1L2B A;  3A98 B;  3PFI A;  4G6Z A;  1TH4 A;  3DOA A;  2R46 A;  3SAS A;  4DV1 M;  2UXC M;  4ITQ A;  4M9S A;  5H37 D;  1XMO M;  4G4N A;  2F5S A;  2X49 A;  4FWH A;  3KW6 A;  1NJF A;  4IBF A;  1NSF A;  4NSO B;  1N33 M;  3U6L A;  2XSZ D;  1JR3 A;  3AL0 C;  4BBA A;  3W0F A;  3SFZ A;  3GP1 A;  2DWM A;  2BNK A;  5EQT A;  3SHG B;  1R7R A;  2OPF A;  1J5E M;  4B3R M;  4KLN A;  4RF0 A;  3HJS A;  4M0D A;  4FW9 A;  3FUU A;  3FYD A;  1JQJ C;  4D81 A;  4P16 A;  1TH3 A;  4GHL A;  4JI1 M;  4M9X A;  4JV5 M;  2KRK A;  3LVV A;  2X8A A;  4S12 A;  5EXS A;  2CHG A;  2AHM A;  4XBO A;  4IBJ A;  2F5O A;  1NHG C;  1IBL M;  2G8L A;  3R8F A;  3L26 A;  3UK6 A;  3GQ5 A;  4OU7 A;  2XFS A;  5ITU A;  3IG5 A;  2W82 A;  2DVW B;  1VDD A;  2BJW A;  1SXJ C;  2J7N A;  4LFA M;  4X62 M;  2VII A;  3GLF A;  1WXQ A;  1Z5A A;  4NXN M;  1HQY E;  1KSF X;  4D80 A;  4RNA A;  1GL7 A;  4JYA M;  3CTW B;  3SAW A;  3FUX A;  2HKJ A;  4DUY M;  4DR1 M;  2R18 A;  1IY2 A;  2CHV A;  2KW0 A;  1T3T A;  3VKH A;  3M6A A;  1E94 E;  1G3I A;  1YSY A;  2ZAM A;  4GC9 A;  3U5Z A;  4YY3 M;  4FCV A;  4LJ9 A;  1C1K A;  3L2A A;  4Z6Y A;  2C5R A;  2C99 A;  4IBG A;  4WUR A;  1Z5C A;  4L8R C;  1E9S A;  1L8Q A;  4Z8X A;  5ITR A;  5BR8 M;  1DO2 A;  2HCB A;  1QZM A;  3KOY E;  4DR4 M;  3FTF A;  4RF1 A;  3WHK A;  1JR3 D;  3RGS A;  1SXJ B;  5EXP A;  3AV0 A;  2CEA A;  1HT1 E;  3J2P B;  4IBB A;  2FOI C;  1HNZ M;  1Z5B A;  3UMM A;  3KP0 E;  2I7P A;  1NHW C;  3BOS A;  1W5S A;  2KA6 B;  4LJ4 A;  3PNY A;  3SYK A;  1Z6T A;  3HKP A;  4BB9 A;  2KEB A;  1PM5 A;  2M5Z A;  5JI2 E;  1XXH A;  4G4O A;  4DV4 M;  4PDI A;  1XWI A;  2XGN A;  2EA0 A;  4K0K M;  4AKG A;  2QEN A;  5ITY A;  4LF4 M;  2BJV A;  4GIT A;  4KHP M;  3GPX A;  1TDH A;  1XNQ M;  2XEP A;  3L28 A;  4HLQ A;  2RGH A;  3QWL A;  2P5T A;  4DR2 M;  3D8B A;  1QQW A;  3KSX A;  2JA2 A;  1ZQ9 A;  2K47 A;  1IY1 A;  4I81 A;  3HHZ A;  3U60 A;  4DR3 M;  2D7G A;  2QCU A;  3FUW A;  4LJA A;  4IBE A;  4MH0 E;  4LFB M;  2Q2E B;  4QOZ C;  1TDZ A;  2L09 A;  3GQ4 A;  1QAQ A;  1N32 M;  5EP2 A;  4NRW A;  2VQF M;  1IN6 A;  3PNV A;  3AJI B;  7CAT A;  2ERC A;  3AOE A;  1I94 M;  5EP1 A;  4W5W A;  2DHR A;  4BLC A;  2XH9 A;  3GLG B;  1HNW M;  1J7K A;  1N75 A;  1EE8 A;  3NBI A;  5KPT A;  2NQ8 C;  4NOO B;  1IN5 A;  1GVN A;  3T1H M;  2XZU A;  2DWZ B;  2FE8 A;  1IBK M;  2Y0Q A;  2DZO B;  4LF5 M;  4LJ5 A;  5EP4 A;  3SAT A;  3DA1 A;  3HHX A;  1NNJ A;  2G5G X;  3E9S A;  4DV0 M;  3IG8 A;  4GKK M;  2F5P A;  5FSW A;  1MX0 A;  2C9O A;  3B9P A;  1K3W A;  3FUV A;  3CF2 A;  1IN4 A;  2UUA M;  2QBY B;  4KOD A;  2YFQ A;  5F3W A;  1PJJ A;  4MGK E;  4DV6 M;  3LQQ A;  1HR0 M;  2UXB M;  3NWL A;  1IM2 A;  3LVW A;  1PJI A;  3KS8 A;  2LXE A;  1LV7 A;  1OJL A;  3GQ3 A;  5DYG A;  5C18 A;  4YHH M;  1N77 A;  4LJ8 A;  4LF8 M;  2VQE M;  2A5Y B;  5FTM A;  2YR0 A;  3ILK A;  8CAT A;  3EIE A;  4NL4 H;  3KSJ A;  3SMS A;  3U6Q A;  3K92 A;  3K1J A;  3DZD A;  1KFV A;  2D7H A;  3I4V A;  4NRV A;  1XNR M;  4L4U A;  3HGI A;  2RGO A;  4L16 A;  1IN7 A;  3TPZ A;  3VK7 A;  1E32 A;  4M9Z A;  3L27 A;  3T38 A;  1NVM A;  3A45 A;  3MK6 A;  3Q8X A;  1GLN A;  4GMQ A;  3WHL A;  2Y20 A;  2HHH M;  1K82 A;  2R65 A;  1OFI A;  3T15 A;  2Z7J A;  2L7H A;  3UGJ A;  2LNH C;  1G8P A;  5ITX A;  4CHT B;  2F4V M;  3U6C A;  3SMP A;  3FUT A;  3AKZ A;  4DUZ M;  3SAU A;  2H1R A;  2UUC M;  3AFH A;  4FWG A;  4JXJ A;  4I4L A;  3LQR A;  4DV7 M;  2QZ4 A;  4JI4 M;  1Q39 A;  3D8L A;  3GLH B;  4MGI E;  3UZU A;  3KXE C;  5ITQ A;  5KO3 A;  1QYR A;  4LF6 M;  4B7F A;  4MB7 A;  2UXD M;  4JI7 M;  1N34 M;  3SYL A;  4DV3 M;  3GRV A;  3KP1 E;  4GRI A;  4TUW A;  5IRE B;  2KRU A;  3U6M A;  3KVW A;  3J81 S;  5BPV A;  1NY6 A;  3MHV C;  3HU2 A;  3DFZ A;  3U61 B;  1ZAE A;  4LZZ A;  3FTD A;  4AW4 A;  2Z4R A;  1SXJ A;  1ORY B;  3HHW A;  4PD2 A;  1G4A E;  1NJG A;  5IWA M;  3CF0 A;  4JI3 M;  2CV2 A;  3VLF B;  1SXJ E;  1HT2 E;  1IXS B;  2R4J A;  3FKE A;  3I51 A;  5KPZ A;  1IBM M;  5EP3 A;  3HWS A;  4LF9 M;  1R2Y A;  4GH9 A;  4D82 A;  3PXG A;  4JI2 M;  3GPU A;  3HJ8 A;  3ZCB B;  2CV0 A;  3ZH9 B;  4IBK A;  5ITT A;  2F5N A;  4GIP A;  4JI0 M;  4LY6 A;  4PCZ A;  3W0L B;  2LH0 A;  2Z4S A;  4LF7 M;  1K3X A;  4LCB A;  5A2Q S;  3MJ5 A;  3GLI B;  3KDS E;  4B08 A;  4R3D A;  3U6E A;  3R9X B;  2Y21 A;  5E26 A;  4JI5 M;  1IY0 A;  2M60 A;  4OVZ B;  4CGY B;  4DR5 M;  2DWN A;  3J7A S;  4GKJ M;  4QNM A;  1HNX M;  1Q3C A;  2J7O A;  4MGH A;  3J27 B;  4GC5 A;  4LFC M;  1DO0 A;  3I4Y A;  4IBC A;  3FYC A;  5EXT A;  3SAR A;  5FTJ A;  1Q3B A;  3UJN A;  1W5T A;  2R45 A;  2E5L M;  2ZAO A;  2L7I A;  3H4M A;  2EUC A;  4JI8 M;  5FLX S;  3GLG A;  2KXE A;  4R7G A;  1IQP A;  5FTN A;  5FTL A;  2XF3 A;  3VDP A;  1DGF A;  3VK8 A;  1YUB A;  1DGH B;  4L15 A;  3U6O A;  2CE7 A;  3KS4 A;  3VKG A;  3QAU A;  3THG A;  4X64 M;  4LRS A;  3J7B A;  3OTO M;  4II7 A;  2R62 A;  2OQ4 A;  1TH2 A;  3TWK A;  3JAM S;  2O5R A;  2UUB M;  2V6Z M;  4ZPX A;  4FVM A;  4AG6 A;  1QVR A;  1SXJ D;  2QBY A;  4NXM M;  3K2L A;  3GPY A;  1D2N A;  1L1Z A;  2ZBK B;  3L25 A;  4OW0 A;  5IZ7 D;  4X65 M;  3FTE A;  2EO2 A;  1J09 A;  3U6P A;  3JR4 A;  4LGY A;  3RE8 A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...