3OTOM

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3otoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3otoM02
1HNZM 1Z5CA 4LF8M 4OX9M 4JI6M 1TDZA 2F5NA 4GKKM 4B3SM 4G4OA 1R2ZA 4K0KM 5ITRA 3GP1A 2VQFM 4X66M 5ITUA 5LMUM 4DV7M 1L2BA 1L1TA 1XNRM 1IBMM 4DR7M 1PJIA 4B3MM 4LF4M 3SATA 3GQ4A 2VQEM 1HNXM 3A46A 3GPXA 3GQ3A 4DR3M 4DR4M 4PCZA 3GPYA 1K3WA 1XC8A 1N34M 5BR8M 4JI1M 4YY3M 4DV2M 4LF6M 3W0FA 2F5QA 4JI8M 1PM5A 2F4VM 4GKJM 2Q2EB 3TWKA 4JV5M 5A2QS 3SARA 1PJJA 4JI0M 4LFCM 2UXDM 1Z59A 4DR5M 4G4QA 3TWMA 4X62M 2E5LM 5IWAM 4JI4M 3J81S 3DOAA 1L2DA 1XNQM 5FLXS 3U6EA 4LF9M 4AQYM 1R2YA 1Q3BA 2ZM6M 3JAMS 4PDGA 4YHHM 4JI3M 2XZUA 1NNJA 3A45A 3A42A 2UU9M 2OQ4A 4NXMM 3SAUA 5ITTA 4NRWA 2UXBM 1K82A 2UUAM 4DR6M 2UUBM 4DUZM 1IBLM 1Q39A 4X65M 2F5PA 3GQ5A 4LFBM 4B3RM 3GO8A 3U6CA 2XZFA 1J5EM 3OTOM 4KHPM 3GPUA 3U6MA 4MB7A 4DV3M 4CISA 1N36M 1Z5AA 1L2CA 3U6OA 4JI5M 3J7AS 2UUCM 4X64M 5LMNM 4DV6M 2EA0A 1MU5A 2ZBKB 4DV1M 1XMOM 3TWLA 1MX0A 3U6PA 3J80S 4B3TM 1KFVA 4DR2M 2UXCM 1I94M 5ITYA 4G4NA 1IBKM 1XMQM 4DV5M 3SASA 2HKJA 4JYAM 4DV4M 5ITXE 5ITXA 1EE8A 4DUYM 3U6LA 3U6SA 3SAWA 3JR4A 4NRVA 4LFAM 1Z5BA 1FJGM 3VK7A 4JI7M 2F5SA 1HNWM 1N32M 4NXNM 2F5OA 3C58A 4JI2M 5IT9S 4PDIA 1K3XA 3VK8A 4LF7M 4ITQA 4DV0M 3U6QA 3GPPA 2OPFA 3JR5A 4G4RA 4DR1M 1HR0M 1L1ZA 1N33M 3T1HM 3T1YM 3SAVA 3SBJA 3U6DA 5ITQA 4LF5M 4PD2A 2HHHM 1Q3CA 1TDHA
chains in the Genus database with same CATH superfamily
1BVSA 3UMMA 2KDLA 2XEPA 2GQFA 2KHHA 1TDZA 4G4OA 3IG5A 2DXIA 1OTRA 5C1BA 2VQFM 1XXHB 5ITUA 4DV7M 4B3MM 4M0WA 4MGIE 3SFZA 2GNOA 2O5RA 2XGNA 4Z8XA 1IXZA 3HU1A 2APLA 3MK6A 1IN5A 4GMQA 4IBBA 3SHGB 3ZH9B 4D80A 3U60A 1G4AE 2QP9X 4KLNA 3GQ3A 2KA6B 3J7BA 4DR3M 5L8RF 2JZ1A 2LHGA 2FNAA 1XC8A 2OOAA 4L6V6 3L29A 3MHVC 3M6AA 3KXEC 3KVWA 4JI8M 4WURA 3VKGA 1QAQA 1QDRA 4CJ6A 4KODA 4M0DA 2XLJA 1L8QA 2UXDM 2ZTDA 1QDTA 4DR5M 1J7KA 4G4QA 4BBAA 3AL0C 1ORYB 4Z6YA 3U5ZA 3B7ZA 4JI4M 3I4VA 1XNQM 3KP0E 5FLXS 5KPRA 4LF9M 1X37A 1QYRA 1IXSB 3RGPA 1G3IA 2ZANA 4JN6A 2QENA 5DFLA 3Q8GA 4L8RC 2YR0A 4M9ZA 3A42A 1WXQA 2KEBA 4HEOA 2O01F 2R4EA 2OQ4A 3ZCBB 2L09A 4I4LA 4NRWA 1E9RA 3R9XB 2LTUA 4IJEA 3U60B 1Q39A 4X65M 2JA2A 3GLIE 2DWNA 3FRHA 3KOZE 5EP4A 1N75A 3PXGA 5KPZA 4II7A 5E6JA 1J5EM 1H6UA 1R6BX 1V34A 1DGBA 2CE7A 3KDSE 2DHYA 3LQRA 4NSOB 3W67A 2KNVA 3B7NA 3GPUA 4FWHA 1UFZA 3FTDA 1N36M 3VDPA 3I4YA 1RU3A 1OJLA 4X64M 2C99A 2WZJA 4CGYB 3U5ZB 1IM2A 1XMOM 3KOYE 3TWLA 3J80S 4LJ8A 4KT0F 3HHXA 3VKHA 1TGUA 1LTMA 4DR2M 5ITYA 4S12A 4G4NA 2WSCF 1XMQM 1NO1A 3HHZA 1E32A 2CWBA 4DV4M 2A5YB 2QZ4A 5ITXE 3FUVA 5ITXA 1EE8A 1A5TA 2KZSA 1SG9A 2MR9A 3SAWA 1GL7A 2BWEA 5KQ8A 2JZ0A 1V92A 2EKFA 4TUWA 3I51A 1HT1E 1P3QQ 2BWBA 3HGIA 3B9PA 3L27A 2D7HA 2VF8A 1IN8A 1ZMVA 1ZV1A 4RF0A 4D82A 1GLNA 2L4FA 4NL4H 4LF7M 2P5TA 3QAUA 2C98A 1DGHA 3JR5A 1TH2A 4G4RA 1HR0M 3CF0A 2Z4RA 4IIWA 2WSEF 2RKOA 3B89A 3GLHE 4F2LA 3GLHA 3U61A 4QNRA 3SAVA 3U6DA 4FCWA 3SYLA 1NJGA 2MGWA 1HNZM 1Z5CA 2YFQA 4JI6M 3HWSA 4K0KM 2BJVA 4IBFA 2O25A 3BXWA 3DFZA 3RE8A 3IECA 2R0IA 5JI3E 4PT5A 4X66M 3GP1A 5EP1A 2NQ8C 5LMUM 1QUTA 1XNRM 3D8BA 2H5XA 1T43A 1IBMM 3FTEA 4DR7M 3SATA 3GQ4A 3MJ5A 3A46A 3GPXA 3KSXA 2HL7A 1IN6A 2DWLA 3LCUA 2JY7A 3LVVA 1K3WA 1PGYA 5BR8M 1XWIA 4DV2M 4M9SA 5KQDA 1IQPA 3KW6A 2F4VM 4GKJM 3TWKA 2C9CA 3AFHA 2EJSA 3BBZA 1F4IA 1GABA 4JI0M 4LFCM 5H37D 2MJ5B 5FTNA 1DGHB 3DA1A 1OFIA 4REZA 5IWAM 2EKKA 3VFDA 2V6ZM 3DOAA 1QAMA 3QWLA 4MGHA 1L2DA 3U6EA 5FSWA 4AG6A 3GLHB 3U61B 1R2YA 2DAGA 2QBYA 1Q3BA 4CHTB 2XFTA 4CIZA 1TH3A 3JAMS 1JB0F 4YHHM 1OFHA 1QZEA 2XZUA 1NNJA 1IXRC 4AI6A 3RGSA 2DWZB 4IBDA 1SXJD 2K47A 2QNJA 3HHYA 1VQ1A 2UU9M 5IZ7D 3SAUA 5ITTA 3MMPA 2UXBM 3GLFE 1K82A 1PJTA 3GLFA 4ZPXA 2UUBM 2DAIA 2M60A 4LRSA 2B3TA 4WP2A 4IBCA 3THGA 3FTFA 2DHRA 2L4EA 3U6CA 2XZFA 3FUUA 3HZJA 1YLAA 1GL6A 2WSFF 2X4AA 1IN7A 3K9OA 3U6MA 4P17A 4CISA 1L2CA 2V1CA 3M7GA 2K0BX 5LMNM 1PRBA 4LG2A 1DV0A 1MX0A 2RGOA 4R7GA 4B3TM 1C1KA 2LWXA 4IBEA 2KW0A 4L16A 3UJNA 1W5TA 2QBYB 2R6FA 2YNMD 4I5SA 1QVRA 3T6PA 4DV5M 2XH9A 2CV0A 3K1JA 2K6BA 3E21A 4B7HA 1FNNA 4OVZA 3FRIA 1UM8A 2RGHA 1Q02A 2RRUA 2FE8A 2JNHA 3GRVA 4NRVA 1HQYE 3B7QA 4XBOA 4LJAA 1OAIA 3NBXX 4XK8F 3L2AA 3GLFB 3VK7A 3R8FA 4JI7M 4FD2A 2CHGA 2QQ8A 2ZTCA 5FTKA 1R4GA 2CRUA 1SXJE 4LJ7A 2M5ZA 1SXJA 4G6ZA 4MGKE 4JI2M 3PVSA 4XGIA 5IT9S 1TH4A 4PDIA 1K3XA 4I8OA 2L2DA 2ZAOA 3DZDA 2X49A 2DWMA 1EFUB 4NSRA 4GEWA 5KPTA 1IFYA 1QZMA 4DR1M 2LVOC 1CUKA 2DAMA 3FUTA 3LCVB 1QUSA 5EJCA 4B7FA 3T1HM 5IREB 3FUWA 4LF5M 3PNVA 2QSFX 5DNYA 2HHHM 3C3EA 4IBKA 2Z4SA 2FOIC 2F5NA 1R2ZA 3J27B 3E9SA 4LGMA 1VDLA 3WHLA 4IBGA 1GJTA 2FS1A 2XFSA 4OVZB 1VDDA 2MROB 2EUCA 1VEJA 2VQEM 4LF4M 1QQWA 1D2NA 2ERCA 4LY6A 2C96A 2FFJA 2J5YA 2YQZA 4DR4M 3GRRA 2CHQA 3GPYA 1J09A 4LJ6A 2JP7A 4L15A 4G3OA 3SC3A 2LVNC 1WGLA 3AJIB 3HU2A 1NJFA 2DNAA 3ILKA 4LF6M 4IBIA 5EXPA 4AKHA 3L26A 1SXJB 2R4JA 3HJQA 1PM5A 2QHOB 5A2QS 1PJJA 4GIPA 1Z59A 1V33A 3TWMA 3NBIA 4X62M 1WIVA 3AOGA 3VDUA 2KRUA 1DO0A 1KYIA 3CTWB 2V1UA 1GKIA 4LCBA 3TQSA 4AQYM 3TE6A 1TTEA 3LQQA 4UN2B 1N78A 4EIWA 2ZM6M 1MN3A 4PDGA 1OKSA 2DVWB 1GO5A 4GH9A 3A45A 4B08A 2KRKA 3QYBA 4FW9A 2R65A 2JY5A 2OOBA 2CEAA 2EO2A 2JXNA 1D0MA 2KZUA 2XF3A 3I04M 4KO8A 5E26A 1IBLM 4DR6M 2LHCA 3F92A 4LZJA 2Y20A 4QNMA 4LFBM 1NSFA 4B3RM 1XB2B 3GO8A 1PJQA 1TF0B 2JUJA 4Y28F 1E94E 4KHPM 2Z7JA 2DZLA 3TPZA 1OAOC 3J2PB 2QCUA 2Y0QA 4MB7A 2R46A 1Z5AA 3U6OA 4JI5M 2HWJA 4DV6M 1HT2E 2EA0A 1MU5A 3UK6A 2R45A 2ZBKB 1SXJC 1AIPC 3U6PA 4D81A 3L25A 3T15A 1KFVA 3UGJA 2HAKA 1I94M 1Y8GA 1JQJC 1NHGC 2LBCA 1T6OA 1ZMWA 2QPAA 4IJFA 5BPVA 3ZQJA 1GJSA 1I4WA 3A98B 2OO9A 4L4UA 3RFWA 4B7GA 1YSYA 4QOSA 4LGYA 2DZNB 3U6SA 4LJ9A 3JR4A 3VLFB 2DKLA 4LZZA 2G3QA 2W82A 3AOEA 4LFAM 1Z5BA 1N77A 1G71A 2LXEA 3C3DA 3FYCA 1HNWM 1N32M 2C9OA 4BLCA 2F5OA 3C58A 1OIPA 3SMPA 1IN4A 1D0KA 2K9DA 2LVAA 5JI2E 2LVQD 4ANRA 2BNKA 4DBGB 1W5SA 3AV0A 3GPPA 1MJGM 3HHWA 5EXTA 4LJ4A 2D7EA 4IBJA 3KFUG 3QYEA 5DYGA 1N33M 5DYIA 2R44A 5FTMA 3HX3A 4LRTA 4FCVA 3SBJA 5ITQA 4PD2A 4OX9M 1Q3CA 1OQYA 4GITA 1C7YA 1JR3D 4LF8M 4GKKM 5FTJA 8CATA 2X8AA 4B3SM 5ITRA 4A3VB 1GVNA 1NVMA 3E4RA 2DAKA 3H4JA 5EXXA 4NC6A 5EP3A 1L2BA 1L1TA 4MM3B 4AKIA 3T38A 1TR8A 3IG8A 1PJIA 3KS8A 3CF6E 3LMMA 2J7OA 1HNXM 4FWGA 1LV7A 3EIHA 4GRIA 3B74A 4PCZA 4GHAA 1NV8A 2CV1A 4HL4A 3KSJA 3GRYA 3HJ8A 1N34M 4QOZC 2Z3XA 1IY2A 7CATA 1DO2A 2BJWA 5EP2A 4YY3M 2DI0A 4JI1M 4NOOB 4I81A 1WGNA 3W0FA 2F5QA 1VEKA 4RNAA 2Q2EB 4BB9A 4JV5M 2I7PA 2LVPC 1VG5A 3SARA 1AUAA 3GLIA 3L28A 1NY6A 1QANA 4AG5A 3IHPA 3M0EA 2D7GA 2E5LM 3J81S 2G5GX 3FTCA 2H1RA 3LW5F 1KSFX 3TL4X 5KO3A 1QAOA 1WHCA 2MH8A 3AKZA 2C5RA 1HQCA 3ZC7B 5F3WA 4AKGA 4L78A 3SYKA 4QHSA 4JI3M 1G41A 1EIJA 4M9XA 2DAEA 4GC5A 1VEGA 3FE3A 1ZMUA 2R62A 3EIEA 3LVWA 3Q8XA 1NV9A 4WW0A 3W0LB 4R71A 1OIZA 2XSZD 3WHKA 3UZUA 1G59A 4NXMM 1JR3E 4RKUF 1JR3A 3NWLA 1ZAEA 2LH0A 3KS4A 2UUAM 3PFIA 4DUZM 4OW0A 1XHBA 2DZOB 3SHFA 3HKPA 4HLQA 3GQ5A 1YE9A 5EXSA 4AZFA 2F5PA 1G8PA 2JWSA 4JXJA 1D0LA 4MGYE 4P16A 1R5LA 2HCBA 2L7HA 2KNZA 4AW4A 2VDBB 1E9SA 3CGWA 1IY1A 3CF2A 4W5WA 3OTOM 3GLGE 3GLGA 3FYDA 3AOEC 2CFOA 1IY0A 4DV3M 2JY6B 5EQTA 3GLIB 3FUXA 2VIIA 3J7AS 1DGFA 3HY5A 2UUCM 4FCTA 1T3TA 2Y21A 1R7RA 3I01M 2FH0A 4DV1M 4QHTA 3KOXE 4OU7A 2VF7A 2CP8A 4R3DA 3SMSA 2UXCM 3GRUA 2N35A 3C9PA 1IBKM 1YUBA 1XXHE 1ZQ9A 1XXHA 2CHVA 3D8LA 2R18A 2HKJA 3K8ZA 2L6OA 4FWDA 3SASA 4JYAM 4MH0E 3K2LA 3HU3A 1PJSA 2LNHC 4Q7JA 2J7NA 3U6LA 4DUYM 4RF1A 3PNYA 2DENA 4FVMA 2G8LA 3K92A 3HJSA 2ZAMA 2CUZA 3H4MA 1FJGM 3FKEA 1DGGA 2L7IA 2F5SA 1NNUC 3FD9A 4GC9A 1WJ7A 1HJPA 3BOSA 4NXNM 3K9PA 2KXEA 4LJ5A 1NY5A 5FTLA 2XSZA 2Z8YM 3VK8A 2CV2A 3KP1E 4ITQA 4MGZE 4F1IA 1Z6TA 3KOWE 3GLGB 4DV0M 3U6QA 4GHLA 2OPFA 2Y0TA 5GKNA 2JY8A 1L1ZA 1S3SA 3E46A 2AHMA 3T1YM 2KNAA 3W68A 5C18A 2I7NA 3V76A 1NHWC 1IXSA 1WR1B 1TDHA
chains in the Genus database with same CATH topology
3UMMA 2XEPA 1TDZA 4G4OA 3IG5A 2DXIA 5C1BA 2VQFM 1XXHB 5ITUA 4DV7M 4B3MM 4M0WA 4MGIE 3SFZA 2O5RA 2XGNA 4Z8XA 5EP1A 1IXZA 3HU1A 3MK6A 4GMQA 1IN5A 4IBBA 3SHGB 3ZH9B 4D80A 3U60A 1G4AE 2QP9X 4KLNA 3GQ3A 2KA6B 3J7BA 4DR3M 2FNAA 1XC8A 3L29A 3MHVC 3M6AA 3KXEC 3KVWA 4JI8M 4WURA 3VKGA 1QAQA 2XLJA 4KODA 4M0DA 2UXDM 1L8QA 4DR5M 1J7KA 4G4QA 4BBAA 3AL0C 1ORYB 4Z6YA 3U5ZA 4JI4M 3I4VA 1XNQM 3KP0E 5FLXS 5KPRA 4LF9M 1X37A 1QYRA 1IXSB 3RGPA 1G3IA 2ZANA 4JN6A 2QENA 4L8RC 2YR0A 4M9ZA 3A42A 1WXQA 2KEBA 2R4EA 2OQ4A 3ZCBB 2L09A 4I4LA 4NRWA 3R9XB 4IJEA 3U60B 1Q39A 4X65M 2JA2A 2DWNA 3KOZE 5EP4A 1N75A 3PXGA 5KPZA 4II7A 5E6JA 1J5EM 1H6UA 1R6BX 2CE7A 1DGBA 3KDSE 3LQRA 4NSOB 3GPUA 4FWHA 3FTDA 1N36M 3VDPA 3I4YA 1OJLA 4X64M 2C99A 4CGYB 3U5ZB 1IM2A 1XMOM 3KOYE 3TWLA 3J80S 4LJ8A 3HHXA 3VKHA 1TGUA 4DR2M 5ITYA 4S12A 4G4NA 1XMQM 3HHZA 1E32A 4DV4M 2A5YB 2QZ4A 5ITXE 3FUVA 5ITXA 1EE8A 2KZSA 3SAWA 1GL7A 5KQ8A 4TUWA 3I51A 3L27A 1HT1E 3HGIA 3B9PA 2D7HA 1IN8A 4RF0A 4D82A 1GLNA 4LF7M 4NL4H 2P5TA 3QAUA 2C98A 1DGHA 3JR5A 1TH2A 4G4RA 1HR0M 3CF0A 2Z4RA 4IIWA 2RKOA 3U61A 3GLHA 4QNRA 3SAVA 3U6DA 4FCWA 3SYLA 1NJGA 1HNZM 1Z5CA 2YFQA 4JI6M 3HWSA 4K0KM 2BJVA 4IBFA 3DFZA 3RE8A 5JI3E 3GP1A 4PT5A 4X66M 5LMUM 2NQ8C 1XNRM 3D8BA 1IBMM 3FTEA 4DR7M 3SATA 3GQ4A 3MJ5A 3A46A 3GPXA 3KSXA 2HL7A 1IN6A 2DWLA 1K3WA 3LVVA 5BR8M 1XWIA 4DV2M 4M9SA 5KQDA 1IQPA 3KW6A 2F4VM 4GKJM 3TWKA 2C9CA 3AFHA 4JI0M 4LFCM 5H37D 5FTNA 1DGHB 3DA1A 1OFIA 4REZA 5IWAM 3VFDA 2V6ZM 3DOAA 1QAMA 3QWLA 4MGHA 1L2DA 3U6EA 5FSWA 4AG6A 3GLHB 3U61B 1R2YA 2QBYA 1Q3BA 4CHTB 2XFTA 3JAMS 1TH3A 4YHHM 1OFHA 2XZUA 1NNJA 1IXRC 4AI6A 3RGSA 2DWZB 4IBDA 1SXJD 2K47A 3HHYA 2UU9M 5IZ7D 3SAUA 5ITTA 2UXBM 1K82A 3GLFA 4ZPXA 2UUBM 2M60A 4LRSA 4IBCA 3THGA 3FTFA 2DHRA 3U6CA 2XZFA 3FUUA 1GL6A 2X4AA 1IN7A 3U6MA 4CISA 1L2CA 2V1CA 3M7GA 5LMNM 4LG2A 1MX0A 2RGOA 4R7GA 4B3TM 1C1KA 2LWXA 4IBEA 2KW0A 4L16A 3UJNA 1W5TA 2QBYB 2YNMD 4I5SA 1QVRA 4DV5M 2XH9A 2CV0A 3K1JA 4B7HA 1FNNA 4OVZA 1UM8A 2RGHA 2FE8A 4NRVA 3GRVA 1HQYE 4XBOA 4LJAA 3L2AA 3GLFB 3VK7A 3R8FA 4JI7M 4FD2A 2CHGA 5FTKA 1SXJE 4LJ7A 2M5ZA 1SXJA 4G6ZA 4MGKE 4JI2M 3PVSA 4XGIA 5IT9S 1TH4A 4PDIA 1K3XA 4I8OA 2ZAOA 3DZDA 2X49A 2DWMA 4NSRA 5KPTA 1QZMA 4DR1M 3FUTA 5EJCA 4B7FA 3T1HM 5IREB 3FUWA 4LF5M 3PNVA 5DNYA 2HHHM 4IBKA 2Z4SA 2FOIC 2F5NA 1R2ZA 3J27B 3E9SA 4LGMA 3WHLA 4IBGA 2XFSA 4OVZB 1VDDA 2EUCA 4LF4M 2VQEM 1QQWA 1D2NA 2ERCA 4LY6A 2C96A 2FFJA 2YQZA 4DR4M 3GRRA 2CHQA 3GPYA 1J09A 4LJ6A 4L15A 3SC3A 3AJIB 3ILKA 3HU2A 1NJFA 4LF6M 4IBIA 5EXPA 4AKHA 3L26A 1SXJB 2R4JA 3HJQA 1PM5A 5A2QS 1PJJA 4GIPA 1Z59A 3TWMA 3NBIA 4X62M 3AOGA 3VDUA 2KRUA 1DO0A 1KYIA 3CTWB 2V1UA 1GKIA 4LCBA 3TQSA 4AQYM 3TE6A 3LQQA 1N78A 4EIWA 2ZM6M 4PDGA 2DVWB 4GH9A 3A45A 4B08A 2KRKA 4FW9A 2R65A 2CEAA 2EO2A 2KZUA 2XF3A 4KO8A 5E26A 4DR6M 1IBLM 4LZJA 2Y20A 4QNMA 4LFBM 1NSFA 4B3RM 3GO8A 1E94E 4KHPM 2Z7JA 3TPZA 3J2PB 2QCUA 2Y0QA 4MB7A 2R46A 1Z5AA 3U6OA 4JI5M 4DV6M 1HT2E 2EA0A 1MU5A 3UK6A 2R45A 2ZBKB 1SXJC 3U6PA 4D81A 3L25A 3T15A 1KFVA 3UGJA 1I94M 1JQJC 1NHGC 2QPAA 4IJFA 5BPVA 1I4WA 3A98B 4L4UA 3RFWA 4B7GA 1YSYA 4QOSA 4LGYA 2DZNB 3U6SA 4LJ9A 3JR4A 3VLFB 4LZZA 3AOEA 2W82A 4LFAM 1Z5BA 1N77A 2LXEA 3FYCA 1HNWM 1N32M 2C9OA 4BLCA 2F5OA 3C58A 3SMPA 1IN4A 5JI2E 2BNKA 1W5SA 3AV0A 3GPPA 3HHWA 5EXTA 3KFUG 4LJ4A 2D7EA 4IBJA 5DYGA 1N33M 5DYIA 5FTMA 4LRTA 4FCVA 3SBJA 5ITQA 4PD2A 4OX9M 1Q3CA 4GITA 1JR3D 4LF8M 4GKKM 5FTJA 8CATA 2X8AA 4B3SM 5ITRA 4A3VB 1GVNA 1NVMA 3E4RA 5EXXA 5EP3A 1L2BA 1L1TA 4MM3B 4AKIA 3T38A 3IG8A 1PJIA 3KS8A 3CF6E 3LMMA 2J7OA 1HNXM 4FWGA 1LV7A 3EIHA 4GRIA 4PCZA 4GHAA 2CV1A 4HL4A 3KSJA 3GRYA 3HJ8A 1N34M 4QOZC 2Z3XA 1IY2A 7CATA 1DO2A 2BJWA 5EP2A 4YY3M 4JI1M 4NOOB 4I81A 3W0FA 2F5QA 4RNAA 2Q2EB 4BB9A 4JV5M 2I7PA 3SARA 3GLIA 3L28A 1NY6A 1QANA 4AG5A 3M0EA 2D7GA 2E5LM 3J81S 2G5GX 3FTCA 2H1RA 1KSFX 3TL4X 5KO3A 1QAOA 3AKZA 2C5RA 1HQCA 3ZC7B 5F3WA 4AKGA 4L78A 3SYKA 4QHSA 4JI3M 1G41A 4M9XA 4GC5A 2R62A 3EIEA 3LVWA 3Q8XA 4WW0A 3W0LB 2XSZD 3WHKA 3UZUA 1G59A 4NXMM 1JR3A 3NWLA 1ZAEA 2LH0A 3KS4A 2UUAM 3PFIA 4DUZM 4OW0A 1XHBA 2DZOB 3SHFA 3HKPA 4HLQA 3GQ5A 1YE9A 5EXSA 4AZFA 2F5PA 1G8PA 4JXJA 4MGYE 4P16A 2HCBA 2L7HA 4AW4A 1E9SA 1IY1A 3CF2A 4W5WA 3OTOM 3GLGA 3FYDA 3AOEC 2CFOA 1IY0A 4DV3M 5EQTA 3GLIB 3FUXA 2VIIA 3J7AS 1DGFA 2UUCM 4FCTA 1T3TA 2Y21A 1R7RA 4DV1M 4QHTA 3KOXE 4OU7A 4R3DA 3SMSA 2UXCM 3GRUA 1IBKM 1YUBA 1ZQ9A 1XXHA 2CHVA 3D8LA 2R18A 2HKJA 3K8ZA 2L6OA 4FWDA 3SASA 4JYAM 4MH0E 3K2LA 3HU3A 2LNHC 2J7NA 3U6LA 4DUYM 4RF1A 3PNYA 4FVMA 2G8LA 3K92A 3HJSA 2ZAMA 2CUZA 3H4MA 1FJGM 3FKEA 1DGGA 2L7IA 2F5SA 1NNUC 3FD9A 4GC9A 3BOSA 4NXNM 2KXEA 4LJ5A 1NY5A 5FTLA 2XSZA 3VK8A 2CV2A 3KP1E 4ITQA 4MGZE 3GLGB 1Z6TA 3KOWE 4DV0M 3U6QA 4GHLA 2OPFA 2Y0TA 5GKNA 1L1ZA 1S3SA 2AHMA 3T1YM 5C18A 2I7NA 1NHWC 1E9RA 1TDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ M;  1Z5C A;  4LF8 M;  4OX9 M;  4JI6 M;  1TDZ A;  2F5N A;  4GKK M;  4B3S M;  4G4O A;  1R2Z A;  4K0K M;  5ITR A;  3GP1 A;  2VQF M;  4X66 M;  5ITU A;  5LMU M;  4DV7 M;  1L2B A;  1L1T A;  1XNR M;  1IBM M;  4DR7 M;  1PJI A;  4B3M M;  4LF4 M;  3SAT A;  3GQ4 A;  2VQE M;  1HNX M;  3A46 A;  3GPX A;  3GQ3 A;  4DR3 M;  4DR4 M;  4PCZ A;  3GPY A;  1K3W A;  1XC8 A;  1N34 M;  5BR8 M;  4JI1 M;  4YY3 M;  4DV2 M;  4LF6 M;  3W0F A;  2F5Q A;  4JI8 M;  1PM5 A;  2F4V M;  4GKJ M;  2Q2E B;  3TWK A;  4JV5 M;  5A2Q S;  3SAR A;  1PJJ A;  4JI0 M;  4LFC M;  2UXD M;  1Z59 A;  4DR5 M;  4G4Q A;  3TWM A;  4X62 M;  2E5L M;  5IWA M;  4JI4 M;  3J81 S;  3DOA A;  1L2D A;  1XNQ M;  5FLX S;  3U6E A;  4LF9 M;  4AQY M;  1R2Y A;  1Q3B A;  2ZM6 M;  3JAM S;  4PDG A;  4YHH M;  4JI3 M;  2XZU A;  1NNJ A;  3A45 A;  3A42 A;  2UU9 M;  2OQ4 A;  4NXM M;  3SAU A;  5ITT A;  4NRW A;  2UXB M;  1K82 A;  2UUA M;  4DR6 M;  2UUB M;  4DUZ M;  1IBL M;  1Q39 A;  4X65 M;  2F5P A;  3GQ5 A;  4LFB M;  4B3R M;  3GO8 A;  3U6C A;  2XZF A;  1J5E M;  3OTO M;  4KHP M;  3GPU A;  3U6M A;  4MB7 A;  4DV3 M;  4CIS A;  1N36 M;  1Z5A A;  1L2C A;  3U6O A;  4JI5 M;  3J7A S;  2UUC M;  4X64 M;  5LMN M;  4DV6 M;  2EA0 A;  1MU5 A;  2ZBK B;  4DV1 M;  1XMO M;  3TWL A;  1MX0 A;  3U6P A;  3J80 S;  4B3T M;  1KFV A;  4DR2 M;  2UXC M;  1I94 M;  5ITY A;  4G4N A;  1IBK M;  1XMQ M;  4DV5 M;  3SAS A;  2HKJ A;  4JYA M;  4DV4 M;  5ITX E;  5ITX A;  1EE8 A;  4DUY M;  3U6L A;  3U6S A;  3SAW A;  3JR4 A;  4NRV A;  4LFA M;  1Z5B A;  1FJG M;  3VK7 A;  4JI7 M;  2F5S A;  1HNW M;  1N32 M;  4NXN M;  2F5O A;  3C58 A;  4JI2 M;  5IT9 S;  4PDI A;  1K3X A;  3VK8 A;  4LF7 M;  4ITQ A;  4DV0 M;  3U6Q A;  3GPP A;  2OPF A;  3JR5 A;  4G4R A;  4DR1 M;  1HR0 M;  1L1Z A;  1N33 M;  3T1H M;  3T1Y M;  3SAV A;  3SBJ A;  3U6D A;  5ITQ A;  4LF5 M;  4PD2 A;  2HHH M;  1Q3C A;  1TDH A; 
#chains in the Genus database with same CATH topology
 1BVS A;  3UMM A;  2KDL A;  2XEP A;  2GQF A;  2KHH A;  1TDZ A;  4G4O A;  3IG5 A;  2DXI A;  1OTR A;  5C1B A;  2VQF M;  1XXH B;  5ITU A;  4DV7 M;  4B3M M;  4M0W A;  4MGI E;  3SFZ A;  2GNO A;  2O5R A;  2XGN A;  4Z8X A;  1IXZ A;  3HU1 A;  2APL A;  3MK6 A;  1IN5 A;  4GMQ A;  4IBB A;  3SHG B;  3ZH9 B;  4D80 A;  3U60 A;  1G4A E;  2QP9 X;  4KLN A;  3GQ3 A;  2KA6 B;  3J7B A;  4DR3 M;  5L8R F;  2JZ1 A;  2LHG A;  2FNA A;  1XC8 A;  2OOA A;  4L6V 6;  3L29 A;  3MHV C;  3M6A A;  3KXE C;  3KVW A;  4JI8 M;  4WUR A;  3VKG A;  1QAQ A;  1QDR A;  4CJ6 A;  4KOD A;  4M0D A;  2XLJ A;  1L8Q A;  2UXD M;  2ZTD A;  1QDT A;  4DR5 M;  1J7K A;  4G4Q A;  4BBA A;  3AL0 C;  1ORY B;  4Z6Y A;  3U5Z A;  3B7Z A;  4JI4 M;  3I4V A;  1XNQ M;  3KP0 E;  5FLX S;  5KPR A;  4LF9 M;  1X37 A;  1QYR A;  1IXS B;  3RGP A;  1G3I A;  2ZAN A;  4JN6 A;  2QEN A;  5DFL A;  3Q8G A;  4L8R C;  2YR0 A;  4M9Z A;  3A42 A;  1WXQ A;  2KEB A;  4HEO A;  2O01 F;  2R4E A;  2OQ4 A;  3ZCB B;  2L09 A;  4I4L A;  4NRW A;  1E9R A;  3R9X B;  2LTU A;  4IJE A;  3U60 B;  1Q39 A;  4X65 M;  2JA2 A;  3GLI E;  2DWN A;  3FRH A;  3KOZ E;  5EP4 A;  1N75 A;  3PXG A;  5KPZ A;  4II7 A;  5E6J A;  1J5E M;  1H6U A;  1R6B X;  1V34 A;  1DGB A;  2CE7 A;  3KDS E;  2DHY A;  3LQR A;  4NSO B;  3W67 A;  2KNV A;  3B7N A;  3GPU A;  4FWH A;  1UFZ A;  3FTD A;  1N36 M;  3VDP A;  3I4Y A;  1RU3 A;  1OJL A;  4X64 M;  2C99 A;  2WZJ A;  4CGY B;  3U5Z B;  1IM2 A;  1XMO M;  3KOY E;  3TWL A;  3J80 S;  4LJ8 A;  4KT0 F;  3HHX A;  3VKH A;  1TGU A;  1LTM A;  4DR2 M;  5ITY A;  4S12 A;  4G4N A;  2WSC F;  1XMQ M;  1NO1 A;  3HHZ A;  1E32 A;  2CWB A;  4DV4 M;  2A5Y B;  2QZ4 A;  5ITX E;  3FUV A;  5ITX A;  1EE8 A;  1A5T A;  2KZS A;  1SG9 A;  2MR9 A;  3SAW A;  1GL7 A;  2BWE A;  5KQ8 A;  2JZ0 A;  1V92 A;  2EKF A;  4TUW A;  3I51 A;  1HT1 E;  1P3Q Q;  2BWB A;  3HGI A;  3B9P A;  3L27 A;  2D7H A;  2VF8 A;  1IN8 A;  1ZMV A;  1ZV1 A;  4RF0 A;  4D82 A;  1GLN A;  2L4F A;  4NL4 H;  4LF7 M;  2P5T A;  3QAU A;  2C98 A;  1DGH A;  3JR5 A;  1TH2 A;  4G4R A;  1HR0 M;  3CF0 A;  2Z4R A;  4IIW A;  2WSE F;  2RKO A;  3B89 A;  3GLH E;  4F2L A;  3GLH A;  3U61 A;  4QNR A;  3SAV A;  3U6D A;  4FCW A;  3SYL A;  1NJG A;  2MGW A;  1HNZ M;  1Z5C A;  2YFQ A;  4JI6 M;  3HWS A;  4K0K M;  2BJV A;  4IBF A;  2O25 A;  3BXW A;  3DFZ A;  3RE8 A;  3IEC A;  2R0I A;  5JI3 E;  4PT5 A;  4X66 M;  3GP1 A;  5EP1 A;  2NQ8 C;  5LMU M;  1QUT A;  1XNR M;  3D8B A;  2H5X A;  1T43 A;  1IBM M;  3FTE A;  4DR7 M;  3SAT A;  3GQ4 A;  3MJ5 A;  3A46 A;  3GPX A;  3KSX A;  2HL7 A;  1IN6 A;  2DWL A;  3LCU A;  2JY7 A;  3LVV A;  1K3W A;  1PGY A;  5BR8 M;  1XWI A;  4DV2 M;  4M9S A;  5KQD A;  1IQP A;  3KW6 A;  2F4V M;  4GKJ M;  3TWK A;  2C9C A;  3AFH A;  2EJS A;  3BBZ A;  1F4I A;  1GAB A;  4JI0 M;  4LFC M;  5H37 D;  2MJ5 B;  5FTN A;  1DGH B;  3DA1 A;  1OFI A;  4REZ A;  5IWA M;  2EKK A;  3VFD A;  2V6Z M;  3DOA A;  1QAM A;  3QWL A;  4MGH A;  1L2D A;  3U6E A;  5FSW A;  4AG6 A;  3GLH B;  3U61 B;  1R2Y A;  2DAG A;  2QBY A;  1Q3B A;  4CHT B;  2XFT A;  4CIZ A;  1TH3 A;  3JAM S;  1JB0 F;  4YHH M;  1OFH A;  1QZE A;  2XZU A;  1NNJ A;  1IXR C;  4AI6 A;  3RGS A;  2DWZ B;  4IBD A;  1SXJ D;  2K47 A;  2QNJ A;  3HHY A;  1VQ1 A;  2UU9 M;  5IZ7 D;  3SAU A;  5ITT A;  3MMP A;  2UXB M;  3GLF E;  1K82 A;  1PJT A;  3GLF A;  4ZPX A;  2UUB M;  2DAI A;  2M60 A;  4LRS A;  2B3T A;  4WP2 A;  4IBC A;  3THG A;  3FTF A;  2DHR A;  2L4E A;  3U6C A;  2XZF A;  3FUU A;  3HZJ A;  1YLA A;  1GL6 A;  2WSF F;  2X4A A;  1IN7 A;  3K9O A;  3U6M A;  4P17 A;  4CIS A;  1L2C A;  2V1C A;  3M7G A;  2K0B X;  5LMN M;  1PRB A;  4LG2 A;  1DV0 A;  1MX0 A;  2RGO A;  4R7G A;  4B3T M;  1C1K A;  2LWX A;  4IBE A;  2KW0 A;  4L16 A;  3UJN A;  1W5T A;  2QBY B;  2R6F A;  2YNM D;  4I5S A;  1QVR A;  3T6P A;  4DV5 M;  2XH9 A;  2CV0 A;  3K1J A;  2K6B A;  3E21 A;  4B7H A;  1FNN A;  4OVZ A;  3FRI A;  1UM8 A;  2RGH A;  1Q02 A;  2RRU A;  2FE8 A;  2JNH A;  3GRV A;  4NRV A;  1HQY E;  3B7Q A;  4XBO A;  4LJA A;  1OAI A;  3NBX X;  4XK8 F;  3L2A A;  3GLF B;  3VK7 A;  3R8F A;  4JI7 M;  4FD2 A;  2CHG A;  2QQ8 A;  2ZTC A;  5FTK A;  1R4G A;  2CRU A;  1SXJ E;  4LJ7 A;  2M5Z A;  1SXJ A;  4G6Z A;  4MGK E;  4JI2 M;  3PVS A;  4XGI A;  5IT9 S;  1TH4 A;  4PDI A;  1K3X A;  4I8O A;  2L2D A;  2ZAO A;  3DZD A;  2X49 A;  2DWM A;  1EFU B;  4NSR A;  4GEW A;  5KPT A;  1IFY A;  1QZM A;  4DR1 M;  2LVO C;  1CUK A;  2DAM A;  3FUT A;  3LCV B;  1QUS A;  5EJC A;  4B7F A;  3T1H M;  5IRE B;  3FUW A;  4LF5 M;  3PNV A;  2QSF X;  5DNY A;  2HHH M;  3C3E A;  4IBK A;  2Z4S A;  2FOI C;  2F5N A;  1R2Z A;  3J27 B;  3E9S A;  4LGM A;  1VDL A;  3WHL A;  4IBG A;  1GJT A;  2FS1 A;  2XFS A;  4OVZ B;  1VDD A;  2MRO B;  2EUC A;  1VEJ A;  2VQE M;  4LF4 M;  1QQW A;  1D2N A;  2ERC A;  4LY6 A;  2C96 A;  2FFJ A;  2J5Y A;  2YQZ A;  4DR4 M;  3GRR A;  2CHQ A;  3GPY A;  1J09 A;  4LJ6 A;  2JP7 A;  4L15 A;  4G3O A;  3SC3 A;  2LVN C;  1WGL A;  3AJI B;  3HU2 A;  1NJF A;  2DNA A;  3ILK A;  4LF6 M;  4IBI A;  5EXP A;  4AKH A;  3L26 A;  1SXJ B;  2R4J A;  3HJQ A;  1PM5 A;  2QHO B;  5A2Q S;  1PJJ A;  4GIP A;  1Z59 A;  1V33 A;  3TWM A;  3NBI A;  4X62 M;  1WIV A;  3AOG A;  3VDU A;  2KRU A;  1DO0 A;  1KYI A;  3CTW B;  2V1U A;  1GKI A;  4LCB A;  3TQS A;  4AQY M;  3TE6 A;  1TTE A;  3LQQ A;  4UN2 B;  1N78 A;  4EIW A;  2ZM6 M;  1MN3 A;  4PDG A;  1OKS A;  2DVW B;  1GO5 A;  4GH9 A;  3A45 A;  4B08 A;  2KRK A;  3QYB A;  4FW9 A;  2R65 A;  2JY5 A;  2OOB A;  2CEA A;  2EO2 A;  2JXN A;  1D0M A;  2KZU A;  2XF3 A;  3I04 M;  4KO8 A;  5E26 A;  1IBL M;  4DR6 M;  2LHC A;  3F92 A;  4LZJ A;  2Y20 A;  4QNM A;  4LFB M;  1NSF A;  4B3R M;  1XB2 B;  3GO8 A;  1PJQ A;  1TF0 B;  2JUJ A;  4Y28 F;  1E94 E;  4KHP M;  2Z7J A;  2DZL A;  3TPZ A;  1OAO C;  3J2P B;  2QCU A;  2Y0Q A;  4MB7 A;  2R46 A;  1Z5A A;  3U6O A;  4JI5 M;  2HWJ A;  4DV6 M;  1HT2 E;  2EA0 A;  1MU5 A;  3UK6 A;  2R45 A;  2ZBK B;  1SXJ C;  1AIP C;  3U6P A;  4D81 A;  3L25 A;  3T15 A;  1KFV A;  3UGJ A;  2HAK A;  1I94 M;  1Y8G A;  1JQJ C;  1NHG C;  2LBC A;  1T6O A;  1ZMW A;  2QPA A;  4IJF A;  5BPV A;  3ZQJ A;  1GJS A;  1I4W A;  3A98 B;  2OO9 A;  4L4U A;  3RFW A;  4B7G A;  1YSY A;  4QOS A;  4LGY A;  2DZN B;  3U6S A;  4LJ9 A;  3JR4 A;  3VLF B;  2DKL A;  4LZZ A;  2G3Q A;  2W82 A;  3AOE A;  4LFA M;  1Z5B A;  1N77 A;  1G71 A;  2LXE A;  3C3D A;  3FYC A;  1HNW M;  1N32 M;  2C9O A;  4BLC A;  2F5O A;  3C58 A;  1OIP A;  3SMP A;  1IN4 A;  1D0K A;  2K9D A;  2LVA A;  5JI2 E;  2LVQ D;  4ANR A;  2BNK A;  4DBG B;  1W5S A;  3AV0 A;  3GPP A;  1MJG M;  3HHW A;  5EXT A;  4LJ4 A;  2D7E A;  4IBJ A;  3KFU G;  3QYE A;  5DYG A;  1N33 M;  5DYI A;  2R44 A;  5FTM A;  3HX3 A;  4LRT A;  4FCV A;  3SBJ A;  5ITQ A;  4PD2 A;  4OX9 M;  1Q3C A;  1OQY A;  4GIT A;  1C7Y A;  1JR3 D;  4LF8 M;  4GKK M;  5FTJ A;  8CAT A;  2X8A A;  4B3S M;  5ITR A;  4A3V B;  1GVN A;  1NVM A;  3E4R A;  2DAK A;  3H4J A;  5EXX A;  4NC6 A;  5EP3 A;  1L2B A;  1L1T A;  4MM3 B;  4AKI A;  3T38 A;  1TR8 A;  3IG8 A;  1PJI A;  3KS8 A;  3CF6 E;  3LMM A;  2J7O A;  1HNX M;  4FWG A;  1LV7 A;  3EIH A;  4GRI A;  3B74 A;  4PCZ A;  4GHA A;  1NV8 A;  2CV1 A;  4HL4 A;  3KSJ A;  3GRY A;  3HJ8 A;  1N34 M;  4QOZ C;  2Z3X A;  1IY2 A;  7CAT A;  1DO2 A;  2BJW A;  5EP2 A;  4YY3 M;  2DI0 A;  4JI1 M;  4NOO B;  4I81 A;  1WGN A;  3W0F A;  2F5Q A;  1VEK A;  4RNA A;  2Q2E B;  4BB9 A;  4JV5 M;  2I7P A;  2LVP C;  1VG5 A;  3SAR A;  1AUA A;  3GLI A;  3L28 A;  1NY6 A;  1QAN A;  4AG5 A;  3IHP A;  3M0E A;  2D7G A;  2E5L M;  3J81 S;  2G5G X;  3FTC A;  2H1R A;  3LW5 F;  1KSF X;  3TL4 X;  5KO3 A;  1QAO A;  1WHC A;  2MH8 A;  3AKZ A;  2C5R A;  1HQC A;  3ZC7 B;  5F3W A;  4AKG A;  4L78 A;  3SYK A;  4QHS A;  4JI3 M;  1G41 A;  1EIJ A;  4M9X A;  2DAE A;  4GC5 A;  1VEG A;  3FE3 A;  1ZMU A;  2R62 A;  3EIE A;  3LVW A;  3Q8X A;  1NV9 A;  4WW0 A;  3W0L B;  4R71 A;  1OIZ A;  2XSZ D;  3WHK A;  3UZU A;  1G59 A;  4NXM M;  1JR3 E;  4RKU F;  1JR3 A;  3NWL A;  1ZAE A;  2LH0 A;  3KS4 A;  2UUA M;  3PFI A;  4DUZ M;  4OW0 A;  1XHB A;  2DZO B;  3SHF A;  3HKP A;  4HLQ A;  3GQ5 A;  1YE9 A;  5EXS A;  4AZF A;  2F5P A;  1G8P A;  2JWS A;  4JXJ A;  1D0L A;  4MGY E;  4P16 A;  1R5L A;  2HCB A;  2L7H A;  2KNZ A;  4AW4 A;  2VDB B;  1E9S A;  3CGW A;  1IY1 A;  3CF2 A;  4W5W A;  3OTO M;  3GLG E;  3GLG A;  3FYD A;  3AOE C;  2CFO A;  1IY0 A;  4DV3 M;  2JY6 B;  5EQT A;  3GLI B;  3FUX A;  2VII A;  3J7A S;  1DGF A;  3HY5 A;  2UUC M;  4FCT A;  1T3T A;  2Y21 A;  1R7R A;  3I01 M;  2FH0 A;  4DV1 M;  4QHT A;  3KOX E;  4OU7 A;  2VF7 A;  2CP8 A;  4R3D A;  3SMS A;  2UXC M;  3GRU A;  2N35 A;  3C9P A;  1IBK M;  1YUB A;  1XXH E;  1ZQ9 A;  1XXH A;  2CHV A;  3D8L A;  2R18 A;  2HKJ A;  3K8Z A;  2L6O A;  4FWD A;  3SAS A;  4JYA M;  4MH0 E;  3K2L A;  3HU3 A;  1PJS A;  2LNH C;  4Q7J A;  2J7N A;  3U6L A;  4DUY M;  4RF1 A;  3PNY A;  2DEN A;  4FVM A;  2G8L A;  3K92 A;  3HJS A;  2ZAM A;  2CUZ A;  3H4M A;  1FJG M;  3FKE A;  1DGG A;  2L7I A;  2F5S A;  1NNU C;  3FD9 A;  4GC9 A;  1WJ7 A;  1HJP A;  3BOS A;  4NXN M;  3K9P A;  2KXE A;  4LJ5 A;  1NY5 A;  5FTL A;  2XSZ A;  2Z8Y M;  3VK8 A;  2CV2 A;  3KP1 E;  4ITQ A;  4MGZ E;  4F1I A;  1Z6T A;  3KOW E;  3GLG B;  4DV0 M;  3U6Q A;  4GHL A;  2OPF A;  2Y0T A;  5GKN A;  2JY8 A;  1L1Z A;  1S3S A;  3E46 A;  2AHM A;  3T1Y M;  2KNA A;  3W68 A;  5C18 A;  2I7N A;  3V76 A;  1NHW C;  1IXS A;  1WR1 B;  1TDH A; 
#chains in the Genus database with same CATH homology
 3UMM A;  2XEP A;  1TDZ A;  4G4O A;  3IG5 A;  2DXI A;  5C1B A;  2VQF M;  1XXH B;  5ITU A;  4DV7 M;  4B3M M;  4M0W A;  4MGI E;  3SFZ A;  2O5R A;  2XGN A;  4Z8X A;  5EP1 A;  1IXZ A;  3HU1 A;  3MK6 A;  4GMQ A;  1IN5 A;  4IBB A;  3SHG B;  3ZH9 B;  4D80 A;  3U60 A;  1G4A E;  2QP9 X;  4KLN A;  3GQ3 A;  2KA6 B;  3J7B A;  4DR3 M;  2FNA A;  1XC8 A;  3L29 A;  3MHV C;  3M6A A;  3KXE C;  3KVW A;  4JI8 M;  4WUR A;  3VKG A;  1QAQ A;  2XLJ A;  4KOD A;  4M0D A;  2UXD M;  1L8Q A;  4DR5 M;  1J7K A;  4G4Q A;  4BBA A;  3AL0 C;  1ORY B;  4Z6Y A;  3U5Z A;  4JI4 M;  3I4V A;  1XNQ M;  3KP0 E;  5FLX S;  5KPR A;  4LF9 M;  1X37 A;  1QYR A;  1IXS B;  3RGP A;  1G3I A;  2ZAN A;  4JN6 A;  2QEN A;  4L8R C;  2YR0 A;  4M9Z A;  3A42 A;  1WXQ A;  2KEB A;  2R4E A;  2OQ4 A;  3ZCB B;  2L09 A;  4I4L A;  4NRW A;  3R9X B;  4IJE A;  3U60 B;  1Q39 A;  4X65 M;  2JA2 A;  2DWN A;  3KOZ E;  5EP4 A;  1N75 A;  3PXG A;  5KPZ A;  4II7 A;  5E6J A;  1J5E M;  1H6U A;  1R6B X;  2CE7 A;  1DGB A;  3KDS E;  3LQR A;  4NSO B;  3GPU A;  4FWH A;  3FTD A;  1N36 M;  3VDP A;  3I4Y A;  1OJL A;  4X64 M;  2C99 A;  4CGY B;  3U5Z B;  1IM2 A;  1XMO M;  3KOY E;  3TWL A;  3J80 S;  4LJ8 A;  3HHX A;  3VKH A;  1TGU A;  4DR2 M;  5ITY A;  4S12 A;  4G4N A;  1XMQ M;  3HHZ A;  1E32 A;  4DV4 M;  2A5Y B;  2QZ4 A;  5ITX E;  3FUV A;  5ITX A;  1EE8 A;  2KZS A;  3SAW A;  1GL7 A;  5KQ8 A;  4TUW A;  3I51 A;  3L27 A;  1HT1 E;  3HGI A;  3B9P A;  2D7H A;  1IN8 A;  4RF0 A;  4D82 A;  1GLN A;  4LF7 M;  4NL4 H;  2P5T A;  3QAU A;  2C98 A;  1DGH A;  3JR5 A;  1TH2 A;  4G4R A;  1HR0 M;  3CF0 A;  2Z4R A;  4IIW A;  2RKO A;  3U61 A;  3GLH A;  4QNR A;  3SAV A;  3U6D A;  4FCW A;  3SYL A;  1NJG A;  1HNZ M;  1Z5C A;  2YFQ A;  4JI6 M;  3HWS A;  4K0K M;  2BJV A;  4IBF A;  3DFZ A;  3RE8 A;  5JI3 E;  3GP1 A;  4PT5 A;  4X66 M;  5LMU M;  2NQ8 C;  1XNR M;  3D8B A;  1IBM M;  3FTE A;  4DR7 M;  3SAT A;  3GQ4 A;  3MJ5 A;  3A46 A;  3GPX A;  3KSX A;  2HL7 A;  1IN6 A;  2DWL A;  1K3W A;  3LVV A;  5BR8 M;  1XWI A;  4DV2 M;  4M9S A;  5KQD A;  1IQP A;  3KW6 A;  2F4V M;  4GKJ M;  3TWK A;  2C9C A;  3AFH A;  4JI0 M;  4LFC M;  5H37 D;  5FTN A;  1DGH B;  3DA1 A;  1OFI A;  4REZ A;  5IWA M;  3VFD A;  2V6Z M;  3DOA A;  1QAM A;  3QWL A;  4MGH A;  1L2D A;  3U6E A;  5FSW A;  4AG6 A;  3GLH B;  3U61 B;  1R2Y A;  2QBY A;  1Q3B A;  4CHT B;  2XFT A;  3JAM S;  1TH3 A;  4YHH M;  1OFH A;  2XZU A;  1NNJ A;  1IXR C;  4AI6 A;  3RGS A;  2DWZ B;  4IBD A;  1SXJ D;  2K47 A;  3HHY A;  2UU9 M;  5IZ7 D;  3SAU A;  5ITT A;  2UXB M;  1K82 A;  3GLF A;  4ZPX A;  2UUB M;  2M60 A;  4LRS A;  4IBC A;  3THG A;  3FTF A;  2DHR A;  3U6C A;  2XZF A;  3FUU A;  1GL6 A;  2X4A A;  1IN7 A;  3U6M A;  4CIS A;  1L2C A;  2V1C A;  3M7G A;  5LMN M;  4LG2 A;  1MX0 A;  2RGO A;  4R7G A;  4B3T M;  1C1K A;  2LWX A;  4IBE A;  2KW0 A;  4L16 A;  3UJN A;  1W5T A;  2QBY B;  2YNM D;  4I5S A;  1QVR A;  4DV5 M;  2XH9 A;  2CV0 A;  3K1J A;  4B7H A;  1FNN A;  4OVZ A;  1UM8 A;  2RGH A;  2FE8 A;  4NRV A;  3GRV A;  1HQY E;  4XBO A;  4LJA A;  3L2A A;  3GLF B;  3VK7 A;  3R8F A;  4JI7 M;  4FD2 A;  2CHG A;  5FTK A;  1SXJ E;  4LJ7 A;  2M5Z A;  1SXJ A;  4G6Z A;  4MGK E;  4JI2 M;  3PVS A;  4XGI A;  5IT9 S;  1TH4 A;  4PDI A;  1K3X A;  4I8O A;  2ZAO A;  3DZD A;  2X49 A;  2DWM A;  4NSR A;  5KPT A;  1QZM A;  4DR1 M;  3FUT A;  5EJC A;  4B7F A;  3T1H M;  5IRE B;  3FUW A;  4LF5 M;  3PNV A;  5DNY A;  2HHH M;  4IBK A;  2Z4S A;  2FOI C;  2F5N A;  1R2Z A;  3J27 B;  3E9S A;  4LGM A;  3WHL A;  4IBG A;  2XFS A;  4OVZ B;  1VDD A;  2EUC A;  4LF4 M;  2VQE M;  1QQW A;  1D2N A;  2ERC A;  4LY6 A;  2C96 A;  2FFJ A;  2YQZ A;  4DR4 M;  3GRR A;  2CHQ A;  3GPY A;  1J09 A;  4LJ6 A;  4L15 A;  3SC3 A;  3AJI B;  3ILK A;  3HU2 A;  1NJF A;  4LF6 M;  4IBI A;  5EXP A;  4AKH A;  3L26 A;  1SXJ B;  2R4J A;  3HJQ A;  1PM5 A;  5A2Q S;  1PJJ A;  4GIP A;  1Z59 A;  3TWM A;  3NBI A;  4X62 M;  3AOG A;  3VDU A;  2KRU A;  1DO0 A;  1KYI A;  3CTW B;  2V1U A;  1GKI A;  4LCB A;  3TQS A;  4AQY M;  3TE6 A;  3LQQ A;  1N78 A;  4EIW A;  2ZM6 M;  4PDG A;  2DVW B;  4GH9 A;  3A45 A;  4B08 A;  2KRK A;  4FW9 A;  2R65 A;  2CEA A;  2EO2 A;  2KZU A;  2XF3 A;  4KO8 A;  5E26 A;  4DR6 M;  1IBL M;  4LZJ A;  2Y20 A;  4QNM A;  4LFB M;  1NSF A;  4B3R M;  3GO8 A;  1E94 E;  4KHP M;  2Z7J A;  3TPZ A;  3J2P B;  2QCU A;  2Y0Q A;  4MB7 A;  2R46 A;  1Z5A A;  3U6O A;  4JI5 M;  4DV6 M;  1HT2 E;  2EA0 A;  1MU5 A;  3UK6 A;  2R45 A;  2ZBK B;  1SXJ C;  3U6P A;  4D81 A;  3L25 A;  3T15 A;  1KFV A;  3UGJ A;  1I94 M;  1JQJ C;  1NHG C;  2QPA A;  4IJF A;  5BPV A;  1I4W A;  3A98 B;  4L4U A;  3RFW A;  4B7G A;  1YSY A;  4QOS A;  4LGY A;  2DZN B;  3U6S A;  4LJ9 A;  3JR4 A;  3VLF B;  4LZZ A;  3AOE A;  2W82 A;  4LFA M;  1Z5B A;  1N77 A;  2LXE A;  3FYC A;  1HNW M;  1N32 M;  2C9O A;  4BLC A;  2F5O A;  3C58 A;  3SMP A;  1IN4 A;  5JI2 E;  2BNK A;  1W5S A;  3AV0 A;  3GPP A;  3HHW A;  5EXT A;  3KFU G;  4LJ4 A;  2D7E A;  4IBJ A;  5DYG A;  1N33 M;  5DYI A;  5FTM A;  4LRT A;  4FCV A;  3SBJ A;  5ITQ A;  4PD2 A;  4OX9 M;  1Q3C A;  4GIT A;  1JR3 D;  4LF8 M;  4GKK M;  5FTJ A;  8CAT A;  2X8A A;  4B3S M;  5ITR A;  4A3V B;  1GVN A;  1NVM A;  3E4R A;  5EXX A;  5EP3 A;  1L2B A;  1L1T A;  4MM3 B;  4AKI A;  3T38 A;  3IG8 A;  1PJI A;  3KS8 A;  3CF6 E;  3LMM A;  2J7O A;  1HNX M;  4FWG A;  1LV7 A;  3EIH A;  4GRI A;  4PCZ A;  4GHA A;  2CV1 A;  4HL4 A;  3KSJ A;  3GRY A;  3HJ8 A;  1N34 M;  4QOZ C;  2Z3X A;  1IY2 A;  7CAT A;  1DO2 A;  2BJW A;  5EP2 A;  4YY3 M;  4JI1 M;  4NOO B;  4I81 A;  3W0F A;  2F5Q A;  4RNA A;  2Q2E B;  4BB9 A;  4JV5 M;  2I7P A;  3SAR A;  3GLI A;  3L28 A;  1NY6 A;  1QAN A;  4AG5 A;  3M0E A;  2D7G A;  2E5L M;  3J81 S;  2G5G X;  3FTC A;  2H1R A;  1KSF X;  3TL4 X;  5KO3 A;  1QAO A;  3AKZ A;  2C5R A;  1HQC A;  3ZC7 B;  5F3W A;  4AKG A;  4L78 A;  3SYK A;  4QHS A;  4JI3 M;  1G41 A;  4M9X A;  4GC5 A;  2R62 A;  3EIE A;  3LVW A;  3Q8X A;  4WW0 A;  3W0L B;  2XSZ D;  3WHK A;  3UZU A;  1G59 A;  4NXM M;  1JR3 A;  3NWL A;  1ZAE A;  2LH0 A;  3KS4 A;  2UUA M;  3PFI A;  4DUZ M;  4OW0 A;  1XHB A;  2DZO B;  3SHF A;  3HKP A;  4HLQ A;  3GQ5 A;  1YE9 A;  5EXS A;  4AZF A;  2F5P A;  1G8P A;  4JXJ A;  4MGY E;  4P16 A;  2HCB A;  2L7H A;  4AW4 A;  1E9S A;  1IY1 A;  3CF2 A;  4W5W A;  3OTO M;  3GLG A;  3FYD A;  3AOE C;  2CFO A;  1IY0 A;  4DV3 M;  5EQT A;  3GLI B;  3FUX A;  2VII A;  3J7A S;  1DGF A;  2UUC M;  4FCT A;  1T3T A;  2Y21 A;  1R7R A;  4DV1 M;  4QHT A;  3KOX E;  4OU7 A;  4R3D A;  3SMS A;  2UXC M;  3GRU A;  1IBK M;  1YUB A;  1ZQ9 A;  1XXH A;  2CHV A;  3D8L A;  2R18 A;  2HKJ A;  3K8Z A;  2L6O A;  4FWD A;  3SAS A;  4JYA M;  4MH0 E;  3K2L A;  3HU3 A;  2LNH C;  2J7N A;  3U6L A;  4DUY M;  4RF1 A;  3PNY A;  4FVM A;  2G8L A;  3K92 A;  3HJS A;  2ZAM A;  2CUZ A;  3H4M A;  1FJG M;  3FKE A;  1DGG A;  2L7I A;  2F5S A;  1NNU C;  3FD9 A;  4GC9 A;  3BOS A;  4NXN M;  2KXE A;  4LJ5 A;  1NY5 A;  5FTL A;  2XSZ A;  3VK8 A;  2CV2 A;  3KP1 E;  4ITQ A;  4MGZ E;  3GLG B;  1Z6T A;  3KOW E;  4DV0 M;  3U6Q A;  4GHL A;  2OPF A;  2Y0T A;  5GKN A;  1L1Z A;  1S3S A;  2AHM A;  3T1Y M;  5C18 A;  2I7N A;  1NHW C;  1E9R A;  1TDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...