3OTOM

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3otoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3otoM02
3GP1A 2XZFA 1L2BA 3TWLA 3GQ3A 4B3TM 3T1YM 1Z5BA 5A2QS 1HNXM 4JV5M 4LF8M 2F5QA 4B3RM 2UXBM 5ITRA 4DV7M 3GPPA 3GO8A 2OPFA 3GQ5A 1IBLM 4LF7M 5ITUA 4DV0M 3U6CA 4DR3M 1IBMM 1Q3BA 3JAMS 4JI3M 1XNRM 5ITYA 1Q3CA 2HKJA 4YY3M 1MX0A 4PDGA 1N32M 1L2CA 5ITTA 1PJIA 4JI5M 3C58A 1K3XA 2UUCM 4K0KM 4JI0M 4NRWA 3SBJA 3TWMA 1Q39A 3GQ4A 4G4OA 4NXNM 4DUZM 3U6DA 3SAUA 4PCZA 4DR6M 4JI2M 4PD2A 3TWKA 2Q2EB 4GKJM 4PDIA 3A46A 1I94M 1FJGM 4DUYM 3SAWA 4DR4M 4G4NA 4DR1M 3JR5A 3U6QA 3U6EA 4G4QA 5IT9S 4B3MM 2ZM6M 1N33M 2F5SA 4G4RA 3VK8A 1XMOM 3T1HM 5FLXS 1J5EM 2UU9M 4B3SM 4LF9M 1L1ZA 4DR5M 4AQYM 5LMUM 4LF6M 4OX9M 3A45A 1N36M 1HNZM 4DV6M 4LFBM 1NNJA 3A42A 2XZUA 4LFAM 2VQEM 2UXDM 4LF5M 1K3WA 1K82A 3J80S 2F5OA 1XNQM 4DV3M 5IWAM 3GPYA 4DV5M 1R2YA 1HR0M 2E5LM 1L1TA 2OQ4A 1PJJA 1R2ZA 4JI8M 3U6MA 4LF4M 4LFCM 4JI6M 1N34M 4X64M 4X62M 1L2DA 1TDHA 1Z5CA 3SASA 2VQFM 3U6SA 5ITQA 3J7AS 3GPXA 4KHPM 3GPUA 2HHHM 1KFVA 3OTOM 4CISA 4NRVA 3JR4A 3U6LA 5ITXE 4JYAM 1Z5AA 3SAVA 3SATA 4JI7M 1TDZA 3U6PA 3DOAA 1HNWM 4YHHM 1XMQM 1PM5A 1EE8A 2UXCM 2ZBKB 4X65M 2F5PA 4DV4M 3U6OA 1MU5A 4JI1M 4GKKM 4MB7A 5ITXA 4DV2M 2EA0A 5LMNM 1Z59A 4DR7M 5BR8M 1IBKM 3J81S 3SARA 2F5NA 4X66M 1XC8A 4JI4M 3W0FA 4DR2M 3VK7A 2UUBM 4NXMM 2UUAM 4ITQA 4DV1M 2F4VM
chains in the Genus database with same CATH superfamily
1YUBA 3FTCA 3GP1A 2XZFA 3K92A 2QHOB 1WXQA 1Z5BA 4G3OA 4QHTA 3HJ8A 2B3TA 5A2QS 2YNMD 3GLHB 1HNXM 4JV5M 3Q8GA 4L78A 3T38A 4I4LA 5ITRA 2MROB 2C9OA 4DBGB 1IBLM 4LF7M 5ITUA 1UFZA 3GRYA 2LVNC 1G4AE 4REZA 1XNRM 4FW9A 1Q3CA 5IREB 1SXJB 2HKJA 1N32M 2WZJA 4MGKE 1L2CA 5E6JA 1DGBA 2CUZA 4JI5M 3W68A 2L7HA 2CHVA 4FWDA 4NRWA 3GQ4A 1YE9A 4KT0F 3B74A 3LVVA 3KS8A 1PGYA 4QHSA 3TL4X 1IXSA 2L2DA 8CATA 1I94M 3E4RA 1IFYA 4G4NA 4LRSA 2DWZB 2JZ1A 3U6EA 1GL6A 2R18A 4G4QA 1IM2A 3VLFB 4CIZA 2XLJA 4QNRA 1NY5A 1VEKA 3MK6A 4RKUF 1NHWC 2KNZA 2W82A 3UK6A 1XMOM 3T1HM 1F4IA 1WGLA 5EP1A 4MGHA 4B08A 2M5ZA 1QAMA 5H37D 2FOIC 2XEPA 4DR5M 3DA1A 2DAIA 5E26A 3L29A 5LMUM 2V6ZM 5DYIA 3KP1E 3U60B 4LRTA 3A45A 2R65A 1R4GA 1Q02A 3SMSA 4OW0A 1OQYA 1KYIA 4P17A 2VF7A 2EKKA 4LG2A 3SHGB 4NC6A 4BBAA 2F5OA 4LJAA 4GC5A 4DV3M 1ZQ9A 1R2YA 2JXNA 3B7NA 5FTMA 1HR0M 2P5TA 3HY5A 3AFHA 1VQ1A 1ORYB 1HT1E 3H4MA 3HJQA 4LF4M 4IBEA 4JI6M 2CEAA 4L4UA 4X62M 1TDHA 2LVPC 2X8AA 3SASA 2DAKA 4XBOA 3U6SA 1OFHA 1WJ7A 2RGHA 2L6OA 2JA2A 2OOAA 2BJWA 3E9SA 3HKPA 1XXHE 4BLCA 5GKNA 1KFVA 1OIPA 3FUWA 4CISA 3HHXA 3SC3A 3JR4A 1TTEA 5ITXE 1Z5AA 4D81A 2CHQA 1OFIA 3KOZE 3EIEA 3CGWA 2WSFF 4RF1A 3SATA 3NBIA 5DFLA 2R44A 1PRBA 2VF8A 1E9RA 2GQFA 1WIVA 1AUAA 1EE8A 2K47A 2VIIA 2ZBKB 3WHKA 1XMQM 1QYRA 1PM5A 2F5PA 3R9XB 3VKGA 1DGGA 4B7GA 2DVWB 4FCTA 3IECA 4MB7A 3GLFE 1T6OA 1AIPC 3FYCA 3ZCBB 1Z6TA 1VDDA 2LNHC 3BXWA 2FE8A 1VG5A 7CATA 1GL7A 4OVZA 3GLGB 3K9OA 4GRIA 4B7HA 2HWJA 2RKOA 1G41A 4WP2A 3VDPA 2KRUA 2EKFA 3ZC7B 4Z6YA 2WSEF 3IG5A 5EXXA 2UUBM 1QUSA 2I7NA 3M0EA 2BWBA 4ITQA 2CWBA 5FTLA 4NXMM 2DENA 2J7NA 3K1JA 4GITA 3L2AA 3TWLA 5KQ8A 4LGMA 4IBDA 1IN4A 1XXHA 2UXBM 4AKHA 3AJIB 2MGWA 3CF6E 3QYBA 3GQ5A 1N77A 2DWLA 2C96A 3TQSA 4DR3M 1ZV1A 1MJGM 1S3SA 3U5ZA 5ITYA 5L8RF 3FTEA 3C3EA 4YY3M 3M6AA 1MX0A 2DZNB 4B7FA 1PJIA 1XXHB 2X4AA 2BNKA 3HX3A 1K3XA 4TUWA 4AKGA 3LMMA 2DHRA 3SBJA 4II7A 4WURA 2N35A 4NXNM 4DUZM 3U6DA 4M9SA 2MJ5B 4AG5A 4JI2M 3IHPA 3A46A 4LJ4A 4DUYM 3SAWA 2G5GX 1QZEA 5EP4A 2KW0A 1PJQA 5JI2E 4LCBA 2R4EA 3B89A 5EJCA 3RE8A 4XGIA 4B3MM 2YR0A 3HHWA 1DGFA 3FYDA 3GLFB 4LJ7A 4F2LA 3SYKA 3HU2A 3W0LB 5FLXS 3MMPA 4B3SM 1L1ZA 3A98B 3PFIA 2KZUA 1WGNA 4OX9M 3BOSA 1GKIA 3E46A 4L16A 1N36M 2XFSA 1HNZM 3HU1A 1XB2B 3L25A 5DYGA 3A42A 2XZUA 3R8FA 3FUVA 4FCVA 1IY2A 1D2NA 2UXDM 4MGZE 3FUXA 1PJSA 1R6BX 1NY6A 4F1IA 4NSRA 4GIPA 2ZANA 1LV7A 4HEOA 4DV5M 2J7OA 3I4VA 2E5LM 2Z4RA 2LHGA 2LVQD 5C18A 2QSFX 2FFJA 1IQPA 1QUTA 4JI8M 1L8QA 1R7RA 3HZJA 4JXJA 2ZTCA 3U6MA 3Q8XA 2DWNA 4AI6A 4GEWA 1IXSB 4LFCM 1HJPA 2FS1A 2LVOC 4LZJA 1L2DA 1V34A 4IBKA 1Z5CA 2JZ0A 2VQFM 3HU3A 3J7AS 3TPZA 4LY6A 4IJFA 1HQYE 2L09A 5EP2A 3DZDA 2L4FA 2BWEA 2QZ4A 3OTOM 2Z8YM 2R45A 3U6LA 1JQJC 3RGSA 2CV2A 2DXIA 1TR8A 1OTRA 1YLAA 3U6PA 4QOZC 1E9SA 3DOAA 1HQCA 3HGIA 3I4YA 4YHHM 2UXCM 2KNVA 4X65M 2C5RA 4DV4M 4AG6A 1NNUC 3QYEA 2D7GA 4JI1M 3AL0C 1ZMWA 4GKKM 1ZMVA 3U61A 1Y8GA 2G3QA 2OO9A 4DV2M 5F3WA 2X49A 1GO5A 2EUCA 3KDSE 5BR8M 4GHLA 4A3VB 2O25A 1JR3D 4ZPXA 4I81A 5EXTA 2J5YA 2K9DA 2Y21A 1FNNA 1LTMA 1MN3A 4OU7A 4JI4M 3AV0A 3W0FA 4AW4A 4DR2M 2KDLA 3VK7A 1V92A 3LQQA 4IBIA 4IBFA 4NSOB 2CHGA 2LVAA 1A5TA 2APLA 2LHCA 2OOBA 2Z4SA 1DGHA 3C3DA 2ERCA 3KW6A 4KO8A 4DV1M 2F4VM 5C1BA 1GJSA 1HT2E 3UMMA 1IXZA 1NVMA 4B3TM 3T1YM 3VDUA 3IG8A 1C7YA 4LF8M 1IN8A 1E94E 1JR3E 1TGUA 4KLNA 4B3RM 2KHHA 3GO8A 2OPFA 2DZOB 2Y0TA 1J7KA 4D82A 3GLIE 1OIZA 2C99A 1Q3BA 1W5SA 1G59A 4CHTB 3AKZA 1R5LA 5JI3E 4PDGA 3J7BA 3C58A 2LTUA 2WSCF 2UUCM 4JI0M 2GNOA 3TE6A 3I51A 3TWMA 2R62A 2L4EA 4G4OA 3J27B 4M9XA 4Q7JA 4PCZA 2EJSA 3FUUA 4RF0A 3SMPA 1FJGM 2MR9A 3NBXX 4DR4M 1IN7A 4DR1M 3U6QA 4OVZB 5IT9S 3LVWA 1NJGA 4IBCA 4AZFA 4EIWA 2ZM6M 5EXSA 3SYLA 2LWXA 1N33M 2QP9X 2YQZA 3B9PA 4Z8XA 3FUTA 3DFZA 2FNAA 1GABA 2DWMA 3F92A 4L8RC 2HCBA 2G8LA 2QBYA 2HAKA 2UU9M 2QNJA 2XGNA 5EQTA 2Y20A 1E32A 3LCUA 4AQYM 2QPAA 4LF6M 3GRUA 5FTNA 1XWIA 1JR3A 4W5WA 2JY7A 1QVRA 3HHYA 4DV6M 4XK8F 2FH0A 1QAQA 4LFAM 3FRIA 5KPTA 4LF5M 1VEJA 1K3WA 2XSZA 3GLIA 4MH0E 3J80S 2CE7A 2K6BA 3U5ZB 1TH2A 4GH9A 3KVWA 2VDBB 2CP8A 4CJ6A 4M0DA 2R4JA 2LH0A 3KS4A 3VFDA 1DO2A 3KOXE 4QNMA 1L1TA 3SFZA 3EIHA 3L28A 1R2ZA 2AHMA 3V76A 3D8LA 3KP0E 2XF3A 3E21A 3RGPA 4PT5A 3GLIB 2V1UA 1T3TA 2R6FA 3FKEA 3L27A 1N34M 4BB9A 4IBGA 1OAOC 2D7EA 4GC9A 2CV0A 1TF0B 5ITQA 1QZMA 4KHPM 2CRUA 3L26A 3GLHA 3PNVA 2HHHM 4IJEA 2M60A 1RU3A 4CGYB 4NRVA 3UZUA 5KPZA 3CF2A 3KOWE 1GJTA 2V1CA 4JYAM 2MH8A 4HLQA 1KSFX 3SAVA 4JI7M 1SXJA 1VEGA 4GHAA 2KZSA 4FD2A 4LJ9A 3PVSA 2KA6B 1D0KA 4R7GA 1MU5A 2CV1A 2NQ8C 4MGYE 4NL4H 1BVSA 1ZMUA 3FE3A 1D0MA 2DAEA 1IBKM 3J81S 4FWHA 3LQRA 3PNYA 1XC8A 2D7HA 2LXEA 1J09A 1G8PA 4GMQA 1IN5A 5FSWA 1GVNA 2R46A 3PXGA 3FTDA 3QWLA 1GLNA 5FTKA 2ZAOA 3LCVB 4I8OA 1L2BA 3GQ3A 4ANRA 4LJ5A 1G3IA 3K9PA 2KEBA 4FWGA 1JB0F 2H5XA 3ILKA 3U60A 1P3QQ 2F5QA 2Z7JA 3I01M 4S12A 4G6ZA 4DV7M 2L7IA 3WHLA 1TH3A 3GPPA 4DV0M 3U6CA 4L6V6 4QOSA 1IBMM 3JAMS 4JI3M 2QQ8A 5KPRA 2EO2A 2JY5A 5ITTA 3GLGE 3KSXA 4I5SA 3THGA 4K0KM 2RGOA 4FCWA 5KQDA 2JWSA 1Q39A 1NSFA 4DR6M 3SAUA 2XSZD 4PD2A 4M9ZA 4WW0A 2Q2EB 3TWKA 3U61B 4PDIA 4GKJM 1SG9A 2C98A 3HWSA 5IZ7D 1IY1A 3JR5A 5KO3A 4MM3B 3H4JA 3B7ZA 3HHZA 4M0WA 1YSYA 4IIWA 2QCUA 2Y0QA 2F5SA 1H6UA 3FTFA 3AOEC 4G4RA 2DZLA 3VK8A 3VKHA 2A5YB 2CFOA 1DGHB 4NOOB 1J5EM 1N75A 3J2PB 3HJSA 1T43A 3QAUA 4LZZA 4LF9M 3SHFA 5EXPA 2LBCA 1OJLA 2KNAA 4MGIE 2DAGA 4R3DA 2XH9A 1IXRC 3GRRA 4LFBM 3AOEA 1G71A 1W5TA 3GRVA 3MHVC 2DAMA 4LJ8A 1NNJA 2H1RA 3D8BA 5FTJA 2VQEM 3BBZA 1K82A 4FVMA 1SXJD 1EIJA 3CF0A 2O5RA 2DNAA 3KXEC 1XNQM 3W67A 5IWAM 3GPYA 3GLGA 3KSJA 1NO1A 3C9PA 4P16A 1X37A 3MJ5A 4R71A 2OQ4A 1PJJA 4AKIA 1CUKA 3NWLA 4UN2B 3GLHE 2JY8A 2C9CA 2JP7A 3I04M 1OAIA 1VDLA 1QDTA 4D80A 2Z3XA 2O01F 4X64M 2JUJA 1D0LA 3K8ZA 3FRHA 3T6PA 1SXJE 1NV9A 1IY0A 3GPXA 2DKLA 3UJNA 2KRKA 4IBJA 1NJFA 1NHGC 4RNAA 4LJ6A 3GPUA 1QDRA 2ZAMA 1QANA 4L15A 2QBYB 4KODA 1I4WA 3AOGA 1WHCA 4HL4A 2HL7A 1ZAEA 3M7GA 3RFWA 2K0BX 2XFTA 4JN6A 1DO0A 3ZQJA 2I7PA 3KOYE 3ZH9B 5DNYA 1IN6A 1WR1B 1TDZA 4Y28F 1HNWM 3LW5F 3K2LA 2YFQA 5BPVA 2R0IA 3UGJA 3U6OA 2QENA 3B7QA 5ITXA 3FD9A 3KFUG 1PJTA 1XHBA 2EA0A 5LMNM 2RRUA 1EFUB 2JY6B 1TH4A 1Z59A 3CTWB 1NV8A 3SARA 4DR7M 1N78A 1SXJC 2F5NA 1OKSA 4X66M 1DV0A 2DHYA 1QQWA 2JNHA 1C1KA 4LGYA 1UM8A 2BJVA 3GLFA 2ZTDA 1V33A 2KXEA 2UUAM 1QAOA 5EP3A 4IBBA 2DI0A 3T15A
chains in the Genus database with same CATH topology
1YUBA 3FTCA 3GP1A 2XZFA 3K92A 4QHTA 1WXQA 1Z5BA 5A2QS 3HJ8A 2YNMD 3GLHB 1HNXM 4JV5M 4L78A 3T38A 4I4LA 5ITRA 2C9OA 1IBLM 4LF7M 5ITUA 3GRYA 1G4AE 4REZA 1XNRM 4FW9A 1Q3CA 5IREB 1SXJB 2HKJA 1N32M 4MGKE 1L2CA 5E6JA 1DGBA 2CUZA 4JI5M 2L7HA 2CHVA 4FWDA 4NRWA 3GQ4A 1YE9A 3LVVA 3KS8A 4QHSA 3TL4X 8CATA 1I94M 3E4RA 4G4NA 4LRSA 2DWZB 3U6EA 1GL6A 2R18A 4G4QA 1IM2A 3VLFB 2XLJA 4QNRA 1NY5A 3MK6A 1NHWC 2W82A 3UK6A 1XMOM 3T1HM 5EP1A 4MGHA 4B08A 2M5ZA 1QAMA 5H37D 2FOIC 2XEPA 4DR5M 3DA1A 5E26A 3L29A 5LMUM 2V6ZM 5DYIA 3KP1E 3U60B 4LRTA 3A45A 2R65A 3SMSA 4OW0A 1KYIA 4LG2A 3SHGB 4BBAA 2F5OA 4LJAA 4GC5A 4DV3M 1ZQ9A 1R2YA 5FTMA 1HR0M 2P5TA 3AFHA 1ORYB 1HT1E 3H4MA 3HJQA 4LF4M 4IBEA 4JI6M 2CEAA 4L4UA 4X62M 1TDHA 2X8AA 3SASA 4XBOA 3U6SA 1OFHA 2RGHA 2L6OA 2JA2A 3E9SA 2BJWA 3HKPA 4BLCA 5GKNA 1KFVA 3FUWA 4CISA 3HHXA 3SC3A 3JR4A 5ITXE 1Z5AA 4D81A 2CHQA 1OFIA 3KOZE 3EIEA 4RF1A 3SATA 3NBIA 1E9RA 1XMQM 1PM5A 1EE8A 2K47A 2VIIA 2ZBKB 3WHKA 2F5PA 1QYRA 3R9XB 3VKGA 1DGGA 4B7GA 2DVWB 4FCTA 4MB7A 3FYCA 3ZCBB 1Z6TA 1VDDA 2LNHC 2FE8A 7CATA 1GL7A 4OVZA 3GLGB 4GRIA 4B7HA 2RKOA 1G41A 3VDPA 2KRUA 3ZC7B 4Z6YA 3IG5A 5EXXA 2UUBM 2I7NA 3M0EA 4NXMM 4ITQA 5FTLA 2J7NA 4GITA 3K1JA 3L2AA 3TWLA 5KQ8A 4LGMA 4IBDA 1IN4A 1XXHA 2UXBM 4AKHA 3AJIB 3CF6E 3GQ5A 1N77A 2DWLA 2C96A 3TQSA 4DR3M 1S3SA 3U5ZA 5ITYA 3FTEA 4YY3M 3M6AA 1MX0A 2DZNB 4B7FA 1PJIA 1XXHB 2X4AA 2BNKA 1K3XA 4TUWA 4AKGA 3LMMA 2DHRA 3SBJA 4II7A 4WURA 4NXNM 4DUZM 3U6DA 4M9SA 4JI2M 4AG5A 3A46A 4LJ4A 4DUYM 3SAWA 2G5GX 5EP4A 2KW0A 5JI2E 4LCBA 2R4EA 5EJCA 3RE8A 4XGIA 4B3MM 2YR0A 3HHWA 1DGFA 3FYDA 3GLFB 4LJ7A 3SYKA 3HU2A 3W0LB 5FLXS 4B3SM 1L1ZA 3A98B 3PFIA 2KZUA 4OX9M 3BOSA 1GKIA 4L16A 1N36M 2XFSA 1HNZM 3HU1A 3L25A 5DYGA 3A42A 2XZUA 3R8FA 3FUVA 4FCVA 1IY2A 1D2NA 2UXDM 4MGZE 3FUXA 1R6BX 1NY6A 4NSRA 4GIPA 2ZANA 1LV7A 4DV5M 2J7OA 3I4VA 2E5LM 2Z4RA 5C18A 2FFJA 1IQPA 4JI8M 1L8QA 1R7RA 4JXJA 3U6MA 4AI6A 3Q8XA 2DWNA 1IXSB 4LFCM 4LZJA 1L2DA 4IBKA 1Z5CA 2VQFM 3HU3A 3J7AS 3TPZA 4LY6A 4IJFA 1HQYE 2L09A 5EP2A 3DZDA 2QZ4A 3OTOM 2R45A 3U6LA 1JQJC 3RGSA 2CV2A 2DXIA 3U6PA 4QOZC 1E9SA 3DOAA 1HQCA 3HGIA 3I4YA 4YHHM 2UXCM 2C5RA 4X65M 4DV4M 4AG6A 1NNUC 2D7GA 4JI1M 3AL0C 4GKKM 3U61A 4DV2M 5F3WA 2X49A 2EUCA 3KDSE 5BR8M 4GHLA 4A3VB 4ZPXA 1JR3D 4I81A 5EXTA 2Y21A 1FNNA 4OU7A 4JI4M 3AV0A 3W0FA 4AW4A 4DR2M 3VK7A 3LQQA 4IBIA 4IBFA 4NSOB 2CHGA 3KW6A 2Z4SA 1DGHA 2ERCA 4KO8A 4DV1M 2F4VM 5C1BA 1HT2E 3UMMA 1IXZA 1NVMA 4B3TM 3T1YM 3VDUA 3IG8A 4LF8M 1IN8A 1E94E 1TGUA 4KLNA 4B3RM 3GO8A 2OPFA 2DZOB 2Y0TA 1J7KA 4D82A 2C99A 1Q3BA 1W5SA 1G59A 4CHTB 3AKZA 5JI3E 4PDGA 3J7BA 3C58A 2UUCM 4JI0M 3TE6A 3I51A 3TWMA 2R62A 4G4OA 3J27B 4M9XA 4PCZA 3FUUA 4RF0A 3SMPA 1FJGM 4DR4M 1IN7A 4DR1M 3U6QA 4OVZB 5IT9S 3LVWA 1NJGA 4IBCA 4AZFA 4EIWA 2ZM6M 5EXSA 3SYLA 2LWXA 1N33M 2QP9X 2YQZA 3B9PA 4Z8XA 3FUTA 3DFZA 2FNAA 2DWMA 4L8RC 2HCBA 2G8LA 2QBYA 2UU9M 5EQTA 2XGNA 2Y20A 1E32A 4AQYM 2QPAA 4LF6M 3GRUA 5FTNA 1XWIA 1JR3A 4W5WA 1QVRA 3HHYA 4DV6M 1QAQA 4LFAM 5KPTA 4LF5M 1K3WA 2XSZA 3GLIA 4MH0E 3J80S 2CE7A 3U5ZB 1TH2A 4GH9A 3KVWA 4M0DA 2R4JA 2LH0A 3KS4A 3VFDA 1DO2A 3KOXE 4QNMA 1L1TA 3SFZA 3EIHA 3L28A 1R2ZA 2AHMA 3D8LA 3KP0E 2XF3A 3GLIB 3RGPA 4PT5A 2V1UA 1T3TA 3FKEA 3L27A 1N34M 4BB9A 4IBGA 2D7EA 4GC9A 2CV0A 5ITQA 1QZMA 4KHPM 3L26A 3GLHA 3PNVA 2HHHM 4IJEA 2M60A 4CGYB 4NRVA 3UZUA 5KPZA 3CF2A 3KOWE 4JYAM 2V1CA 4HLQA 1KSFX 3SAVA 4JI7M 1SXJA 4GHAA 2KZSA 4FD2A 4LJ9A 3PVSA 2KA6B 4R7GA 1MU5A 2CV1A 2NQ8C 4MGYE 4NL4H 1IBKM 3J81S 4FWHA 3LQRA 3PNYA 1XC8A 2D7HA 2LXEA 1J09A 1G8PA 4GMQA 1IN5A 5FSWA 1GVNA 2R46A 3PXGA 3FTDA 3QWLA 1GLNA 5FTKA 2ZAOA 4I8OA 1L2BA 3GQ3A 4LJ5A 1G3IA 2KEBA 4FWGA 3U60A 3ILKA 2F5QA 2Z7JA 4S12A 4G6ZA 4DV7M 2L7IA 3WHLA 1TH3A 3GPPA 4DV0M 3U6CA 4QOSA 1IBMM 3JAMS 4JI3M 5KPRA 2EO2A 5ITTA 3KSXA 4I5SA 3THGA 4K0KM 2RGOA 4FCWA 5KQDA 1Q39A 1NSFA 4DR6M 3SAUA 2XSZD 4PD2A 4M9ZA 4WW0A 2Q2EB 3TWKA 3U61B 4PDIA 4GKJM 2C98A 3HWSA 5IZ7D 1IY1A 3JR5A 5KO3A 4MM3B 3HHZA 4M0WA 1YSYA 4IIWA 2QCUA 2Y0QA 2F5SA 1H6UA 3FTFA 3AOEC 4G4RA 3VK8A 3VKHA 2A5YB 2CFOA 1DGHB 4NOOB 1J5EM 3J2PB 1N75A 3HJSA 3QAUA 4LZZA 4LF9M 3SHFA 5EXPA 1OJLA 4MGIE 4R3DA 2XH9A 1IXRC 3GRRA 4LFBM 3AOEA 3GRVA 1W5TA 3MHVC 4LJ8A 1NNJA 2H1RA 3D8BA 5FTJA 2VQEM 1K82A 4FVMA 1SXJD 3CF0A 2O5RA 3KXEC 1XNQM 5IWAM 3GPYA 3GLGA 3KSJA 4P16A 4AKIA 1X37A 3MJ5A 2OQ4A 1PJJA 3NWLA 2C9CA 4D80A 2Z3XA 4X64M 3K8ZA 1SXJE 1IY0A 3GPXA 3UJNA 2KRKA 4IBJA 1NJFA 1NHGC 4RNAA 4LJ6A 3GPUA 2ZAMA 1QANA 4L15A 2QBYB 4KODA 1I4WA 3AOGA 4HL4A 2HL7A 1ZAEA 3M7GA 3RFWA 2XFTA 4JN6A 1DO0A 2I7PA 3KOYE 3ZH9B 5DNYA 1IN6A 1TDZA 1HNWM 3K2LA 2YFQA 5BPVA 3UGJA 3U6OA 2QENA 5ITXA 3FD9A 3KFUG 1XHBA 2EA0A 5LMNM 1TH4A 1Z59A 3CTWB 4DR7M 3SARA 1N78A 1SXJC 2F5NA 4X66M 1QQWA 1C1KA 4LGYA 1UM8A 2BJVA 3GLFA 2KXEA 2UUAM 1QAOA 5EP3A 4IBBA 3T15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP1 A;  2XZF A;  1L2B A;  3TWL A;  3GQ3 A;  4B3T M;  3T1Y M;  1Z5B A;  5A2Q S;  1HNX M;  4JV5 M;  4LF8 M;  2F5Q A;  4B3R M;  2UXB M;  5ITR A;  4DV7 M;  3GPP A;  3GO8 A;  2OPF A;  3GQ5 A;  1IBL M;  4LF7 M;  5ITU A;  4DV0 M;  3U6C A;  4DR3 M;  1IBM M;  1Q3B A;  3JAM S;  4JI3 M;  1XNR M;  5ITY A;  1Q3C A;  2HKJ A;  4YY3 M;  1MX0 A;  4PDG A;  1N32 M;  1L2C A;  5ITT A;  1PJI A;  4JI5 M;  3C58 A;  1K3X A;  2UUC M;  4K0K M;  4JI0 M;  4NRW A;  3SBJ A;  3TWM A;  1Q39 A;  3GQ4 A;  4G4O A;  4NXN M;  4DUZ M;  3U6D A;  3SAU A;  4PCZ A;  4DR6 M;  4JI2 M;  4PD2 A;  3TWK A;  2Q2E B;  4GKJ M;  4PDI A;  3A46 A;  1I94 M;  1FJG M;  4DUY M;  3SAW A;  4DR4 M;  4G4N A;  4DR1 M;  3JR5 A;  3U6Q A;  3U6E A;  4G4Q A;  5IT9 S;  4B3M M;  2ZM6 M;  1N33 M;  2F5S A;  4G4R A;  3VK8 A;  1XMO M;  3T1H M;  5FLX S;  1J5E M;  2UU9 M;  4B3S M;  4LF9 M;  1L1Z A;  4DR5 M;  4AQY M;  5LMU M;  4LF6 M;  4OX9 M;  3A45 A;  1N36 M;  1HNZ M;  4DV6 M;  4LFB M;  1NNJ A;  3A42 A;  2XZU A;  4LFA M;  2VQE M;  2UXD M;  4LF5 M;  1K3W A;  1K82 A;  3J80 S;  2F5O A;  1XNQ M;  4DV3 M;  5IWA M;  3GPY A;  4DV5 M;  1R2Y A;  1HR0 M;  2E5L M;  1L1T A;  2OQ4 A;  1PJJ A;  1R2Z A;  4JI8 M;  3U6M A;  4LF4 M;  4LFC M;  4JI6 M;  1N34 M;  4X64 M;  4X62 M;  1L2D A;  1TDH A;  1Z5C A;  3SAS A;  2VQF M;  3U6S A;  5ITQ A;  3J7A S;  3GPX A;  4KHP M;  3GPU A;  2HHH M;  1KFV A;  3OTO M;  4CIS A;  4NRV A;  3JR4 A;  3U6L A;  5ITX E;  4JYA M;  1Z5A A;  3SAV A;  3SAT A;  4JI7 M;  1TDZ A;  3U6P A;  3DOA A;  1HNW M;  4YHH M;  1XMQ M;  1PM5 A;  1EE8 A;  2UXC M;  2ZBK B;  4X65 M;  2F5P A;  4DV4 M;  3U6O A;  1MU5 A;  4JI1 M;  4GKK M;  4MB7 A;  5ITX A;  4DV2 M;  2EA0 A;  5LMN M;  1Z59 A;  4DR7 M;  5BR8 M;  1IBK M;  3J81 S;  3SAR A;  2F5N A;  4X66 M;  1XC8 A;  4JI4 M;  3W0F A;  4DR2 M;  3VK7 A;  2UUB M;  4NXM M;  2UUA M;  4ITQ A;  4DV1 M;  2F4V M; 
#chains in the Genus database with same CATH topology
 1YUB A;  3FTC A;  3GP1 A;  2XZF A;  3K92 A;  2QHO B;  1WXQ A;  1Z5B A;  4G3O A;  4QHT A;  3HJ8 A;  2B3T A;  5A2Q S;  2YNM D;  3GLH B;  1HNX M;  4JV5 M;  3Q8G A;  4L78 A;  3T38 A;  4I4L A;  5ITR A;  2MRO B;  2C9O A;  4DBG B;  1IBL M;  4LF7 M;  5ITU A;  1UFZ A;  3GRY A;  2LVN C;  1G4A E;  4REZ A;  1XNR M;  4FW9 A;  1Q3C A;  5IRE B;  1SXJ B;  2HKJ A;  1N32 M;  2WZJ A;  4MGK E;  1L2C A;  5E6J A;  1DGB A;  2CUZ A;  4JI5 M;  3W68 A;  2L7H A;  2CHV A;  4FWD A;  4NRW A;  3GQ4 A;  1YE9 A;  4KT0 F;  3B74 A;  3LVV A;  3KS8 A;  1PGY A;  4QHS A;  3TL4 X;  1IXS A;  2L2D A;  8CAT A;  1I94 M;  3E4R A;  1IFY A;  4G4N A;  4LRS A;  2DWZ B;  2JZ1 A;  3U6E A;  1GL6 A;  2R18 A;  4G4Q A;  1IM2 A;  3VLF B;  4CIZ A;  2XLJ A;  4QNR A;  1NY5 A;  1VEK A;  3MK6 A;  4RKU F;  1NHW C;  2KNZ A;  2W82 A;  3UK6 A;  1XMO M;  3T1H M;  1F4I A;  1WGL A;  5EP1 A;  4MGH A;  4B08 A;  2M5Z A;  1QAM A;  5H37 D;  2FOI C;  2XEP A;  4DR5 M;  3DA1 A;  2DAI A;  5E26 A;  3L29 A;  5LMU M;  2V6Z M;  5DYI A;  3KP1 E;  3U60 B;  4LRT A;  3A45 A;  2R65 A;  1R4G A;  1Q02 A;  3SMS A;  4OW0 A;  1OQY A;  1KYI A;  4P17 A;  2VF7 A;  2EKK A;  4LG2 A;  3SHG B;  4NC6 A;  4BBA A;  2F5O A;  4LJA A;  4GC5 A;  4DV3 M;  1ZQ9 A;  1R2Y A;  2JXN A;  3B7N A;  5FTM A;  1HR0 M;  2P5T A;  3HY5 A;  3AFH A;  1VQ1 A;  1ORY B;  1HT1 E;  3H4M A;  3HJQ A;  4LF4 M;  4IBE A;  4JI6 M;  2CEA A;  4L4U A;  4X62 M;  1TDH A;  2LVP C;  2X8A A;  3SAS A;  2DAK A;  4XBO A;  3U6S A;  1OFH A;  1WJ7 A;  2RGH A;  2L6O A;  2JA2 A;  2OOA A;  2BJW A;  3E9S A;  3HKP A;  1XXH E;  4BLC A;  5GKN A;  1KFV A;  1OIP A;  3FUW A;  4CIS A;  3HHX A;  3SC3 A;  3JR4 A;  1TTE A;  5ITX E;  1Z5A A;  4D81 A;  2CHQ A;  1OFI A;  3KOZ E;  3EIE A;  3CGW A;  2WSF F;  4RF1 A;  3SAT A;  3NBI A;  5DFL A;  2R44 A;  1PRB A;  2VF8 A;  1E9R A;  2GQF A;  1WIV A;  1AUA A;  1EE8 A;  2K47 A;  2VII A;  2ZBK B;  3WHK A;  1XMQ M;  1QYR A;  1PM5 A;  2F5P A;  3R9X B;  3VKG A;  1DGG A;  4B7G A;  2DVW B;  4FCT A;  3IEC A;  4MB7 A;  3GLF E;  1T6O A;  1AIP C;  3FYC A;  3ZCB B;  1Z6T A;  1VDD A;  2LNH C;  3BXW A;  2FE8 A;  1VG5 A;  7CAT A;  1GL7 A;  4OVZ A;  3GLG B;  3K9O A;  4GRI A;  4B7H A;  2HWJ A;  2RKO A;  1G41 A;  4WP2 A;  3VDP A;  2KRU A;  2EKF A;  3ZC7 B;  4Z6Y A;  2WSE F;  3IG5 A;  5EXX A;  2UUB M;  1QUS A;  2I7N A;  3M0E A;  2BWB A;  4ITQ A;  2CWB A;  5FTL A;  4NXM M;  2DEN A;  2J7N A;  3K1J A;  4GIT A;  3L2A A;  3TWL A;  5KQ8 A;  4LGM A;  4IBD A;  1IN4 A;  1XXH A;  2UXB M;  4AKH A;  3AJI B;  2MGW A;  3CF6 E;  3QYB A;  3GQ5 A;  1N77 A;  2DWL A;  2C96 A;  3TQS A;  4DR3 M;  1ZV1 A;  1MJG M;  1S3S A;  3U5Z A;  5ITY A;  5L8R F;  3FTE A;  3C3E A;  4YY3 M;  3M6A A;  1MX0 A;  2DZN B;  4B7F A;  1PJI A;  1XXH B;  2X4A A;  2BNK A;  3HX3 A;  1K3X A;  4TUW A;  4AKG A;  3LMM A;  2DHR A;  3SBJ A;  4II7 A;  4WUR A;  2N35 A;  4NXN M;  4DUZ M;  3U6D A;  4M9S A;  2MJ5 B;  4AG5 A;  4JI2 M;  3IHP A;  3A46 A;  4LJ4 A;  4DUY M;  3SAW A;  2G5G X;  1QZE A;  5EP4 A;  2KW0 A;  1PJQ A;  5JI2 E;  4LCB A;  2R4E A;  3B89 A;  5EJC A;  3RE8 A;  4XGI A;  4B3M M;  2YR0 A;  3HHW A;  1DGF A;  3FYD A;  3GLF B;  4LJ7 A;  4F2L A;  3SYK A;  3HU2 A;  3W0L B;  5FLX S;  3MMP A;  4B3S M;  1L1Z A;  3A98 B;  3PFI A;  2KZU A;  1WGN A;  4OX9 M;  3BOS A;  1GKI A;  3E46 A;  4L16 A;  1N36 M;  2XFS A;  1HNZ M;  3HU1 A;  1XB2 B;  3L25 A;  5DYG A;  3A42 A;  2XZU A;  3R8F A;  3FUV A;  4FCV A;  1IY2 A;  1D2N A;  2UXD M;  4MGZ E;  3FUX A;  1PJS A;  1R6B X;  1NY6 A;  4F1I A;  4NSR A;  4GIP A;  2ZAN A;  1LV7 A;  4HEO A;  4DV5 M;  2J7O A;  3I4V A;  2E5L M;  2Z4R A;  2LHG A;  2LVQ D;  5C18 A;  2QSF X;  2FFJ A;  1IQP A;  1QUT A;  4JI8 M;  1L8Q A;  1R7R A;  3HZJ A;  4JXJ A;  2ZTC A;  3U6M A;  3Q8X A;  2DWN A;  4AI6 A;  4GEW A;  1IXS B;  4LFC M;  1HJP A;  2FS1 A;  2LVO C;  4LZJ A;  1L2D A;  1V34 A;  4IBK A;  1Z5C A;  2JZ0 A;  2VQF M;  3HU3 A;  3J7A S;  3TPZ A;  4LY6 A;  4IJF A;  1HQY E;  2L09 A;  5EP2 A;  3DZD A;  2L4F A;  2BWE A;  2QZ4 A;  3OTO M;  2Z8Y M;  2R45 A;  3U6L A;  1JQJ C;  3RGS A;  2CV2 A;  2DXI A;  1TR8 A;  1OTR A;  1YLA A;  3U6P A;  4QOZ C;  1E9S A;  3DOA A;  1HQC A;  3HGI A;  3I4Y A;  4YHH M;  2UXC M;  2KNV A;  4X65 M;  2C5R A;  4DV4 M;  4AG6 A;  1NNU C;  3QYE A;  2D7G A;  4JI1 M;  3AL0 C;  1ZMW A;  4GKK M;  1ZMV A;  3U61 A;  1Y8G A;  2G3Q A;  2OO9 A;  4DV2 M;  5F3W A;  2X49 A;  1GO5 A;  2EUC A;  3KDS E;  5BR8 M;  4GHL A;  4A3V B;  2O25 A;  1JR3 D;  4ZPX A;  4I81 A;  5EXT A;  2J5Y A;  2K9D A;  2Y21 A;  1FNN A;  1LTM A;  1MN3 A;  4OU7 A;  4JI4 M;  3AV0 A;  3W0F A;  4AW4 A;  4DR2 M;  2KDL A;  3VK7 A;  1V92 A;  3LQQ A;  4IBI A;  4IBF A;  4NSO B;  2CHG A;  2LVA A;  1A5T A;  2APL A;  2LHC A;  2OOB A;  2Z4S A;  1DGH A;  3C3D A;  2ERC A;  3KW6 A;  4KO8 A;  4DV1 M;  2F4V M;  5C1B A;  1GJS A;  1HT2 E;  3UMM A;  1IXZ A;  1NVM A;  4B3T M;  3T1Y M;  3VDU A;  3IG8 A;  1C7Y A;  4LF8 M;  1IN8 A;  1E94 E;  1JR3 E;  1TGU A;  4KLN A;  4B3R M;  2KHH A;  3GO8 A;  2OPF A;  2DZO B;  2Y0T A;  1J7K A;  4D82 A;  3GLI E;  1OIZ A;  2C99 A;  1Q3B A;  1W5S A;  1G59 A;  4CHT B;  3AKZ A;  1R5L A;  5JI3 E;  4PDG A;  3J7B A;  3C58 A;  2LTU A;  2WSC F;  2UUC M;  4JI0 M;  2GNO A;  3TE6 A;  3I51 A;  3TWM A;  2R62 A;  2L4E A;  4G4O A;  3J27 B;  4M9X A;  4Q7J A;  4PCZ A;  2EJS A;  3FUU A;  4RF0 A;  3SMP A;  1FJG M;  2MR9 A;  3NBX X;  4DR4 M;  1IN7 A;  4DR1 M;  3U6Q A;  4OVZ B;  5IT9 S;  3LVW A;  1NJG A;  4IBC A;  4AZF A;  4EIW A;  2ZM6 M;  5EXS A;  3SYL A;  2LWX A;  1N33 M;  2QP9 X;  2YQZ A;  3B9P A;  4Z8X A;  3FUT A;  3DFZ A;  2FNA A;  1GAB A;  2DWM A;  3F92 A;  4L8R C;  2HCB A;  2G8L A;  2QBY A;  2HAK A;  2UU9 M;  2QNJ A;  2XGN A;  5EQT A;  2Y20 A;  1E32 A;  3LCU A;  4AQY M;  2QPA A;  4LF6 M;  3GRU A;  5FTN A;  1XWI A;  1JR3 A;  4W5W A;  2JY7 A;  1QVR A;  3HHY A;  4DV6 M;  4XK8 F;  2FH0 A;  1QAQ A;  4LFA M;  3FRI A;  5KPT A;  4LF5 M;  1VEJ A;  1K3W A;  2XSZ A;  3GLI A;  4MH0 E;  3J80 S;  2CE7 A;  2K6B A;  3U5Z B;  1TH2 A;  4GH9 A;  3KVW A;  2VDB B;  2CP8 A;  4CJ6 A;  4M0D A;  2R4J A;  2LH0 A;  3KS4 A;  3VFD A;  1DO2 A;  3KOX E;  4QNM A;  1L1T A;  3SFZ A;  3EIH A;  3L28 A;  1R2Z A;  2AHM A;  3V76 A;  3D8L A;  3KP0 E;  2XF3 A;  3E21 A;  3RGP A;  4PT5 A;  3GLI B;  2V1U A;  1T3T A;  2R6F A;  3FKE A;  3L27 A;  1N34 M;  4BB9 A;  4IBG A;  1OAO C;  2D7E A;  4GC9 A;  2CV0 A;  1TF0 B;  5ITQ A;  1QZM A;  4KHP M;  2CRU A;  3L26 A;  3GLH A;  3PNV A;  2HHH M;  4IJE A;  2M60 A;  1RU3 A;  4CGY B;  4NRV A;  3UZU A;  5KPZ A;  3CF2 A;  3KOW E;  1GJT A;  2V1C A;  4JYA M;  2MH8 A;  4HLQ A;  1KSF X;  3SAV A;  4JI7 M;  1SXJ A;  1VEG A;  4GHA A;  2KZS A;  4FD2 A;  4LJ9 A;  3PVS A;  2KA6 B;  1D0K A;  4R7G A;  1MU5 A;  2CV1 A;  2NQ8 C;  4MGY E;  4NL4 H;  1BVS A;  1ZMU A;  3FE3 A;  1D0M A;  2DAE A;  1IBK M;  3J81 S;  4FWH A;  3LQR A;  3PNY A;  1XC8 A;  2D7H A;  2LXE A;  1J09 A;  1G8P A;  4GMQ A;  1IN5 A;  5FSW A;  1GVN A;  2R46 A;  3PXG A;  3FTD A;  3QWL A;  1GLN A;  5FTK A;  2ZAO A;  3LCV B;  4I8O A;  1L2B A;  3GQ3 A;  4ANR A;  4LJ5 A;  1G3I A;  3K9P A;  2KEB A;  4FWG A;  1JB0 F;  2H5X A;  3ILK A;  3U60 A;  1P3Q Q;  2F5Q A;  2Z7J A;  3I01 M;  4S12 A;  4G6Z A;  4DV7 M;  2L7I A;  3WHL A;  1TH3 A;  3GPP A;  4DV0 M;  3U6C A;  4L6V 6;  4QOS A;  1IBM M;  3JAM S;  4JI3 M;  2QQ8 A;  5KPR A;  2EO2 A;  2JY5 A;  5ITT A;  3GLG E;  3KSX A;  4I5S A;  3THG A;  4K0K M;  2RGO A;  4FCW A;  5KQD A;  2JWS A;  1Q39 A;  1NSF A;  4DR6 M;  3SAU A;  2XSZ D;  4PD2 A;  4M9Z A;  4WW0 A;  2Q2E B;  3TWK A;  3U61 B;  4PDI A;  4GKJ M;  1SG9 A;  2C98 A;  3HWS A;  5IZ7 D;  1IY1 A;  3JR5 A;  5KO3 A;  4MM3 B;  3H4J A;  3B7Z A;  3HHZ A;  4M0W A;  1YSY A;  4IIW A;  2QCU A;  2Y0Q A;  2F5S A;  1H6U A;  3FTF A;  3AOE C;  4G4R A;  2DZL A;  3VK8 A;  3VKH A;  2A5Y B;  2CFO A;  1DGH B;  4NOO B;  1J5E M;  1N75 A;  3J2P B;  3HJS A;  1T43 A;  3QAU A;  4LZZ A;  4LF9 M;  3SHF A;  5EXP A;  2LBC A;  1OJL A;  2KNA A;  4MGI E;  2DAG A;  4R3D A;  2XH9 A;  1IXR C;  3GRR A;  4LFB M;  3AOE A;  1G71 A;  1W5T A;  3GRV A;  3MHV C;  2DAM A;  4LJ8 A;  1NNJ A;  2H1R A;  3D8B A;  5FTJ A;  2VQE M;  3BBZ A;  1K82 A;  4FVM A;  1SXJ D;  1EIJ A;  3CF0 A;  2O5R A;  2DNA A;  3KXE C;  1XNQ M;  3W67 A;  5IWA M;  3GPY A;  3GLG A;  3KSJ A;  1NO1 A;  3C9P A;  4P16 A;  1X37 A;  3MJ5 A;  4R71 A;  2OQ4 A;  1PJJ A;  4AKI A;  1CUK A;  3NWL A;  4UN2 B;  3GLH E;  2JY8 A;  2C9C A;  2JP7 A;  3I04 M;  1OAI A;  1VDL A;  1QDT A;  4D80 A;  2Z3X A;  2O01 F;  4X64 M;  2JUJ A;  1D0L A;  3K8Z A;  3FRH A;  3T6P A;  1SXJ E;  1NV9 A;  1IY0 A;  3GPX A;  2DKL A;  3UJN A;  2KRK A;  4IBJ A;  1NJF A;  1NHG C;  4RNA A;  4LJ6 A;  3GPU A;  1QDR A;  2ZAM A;  1QAN A;  4L15 A;  2QBY B;  4KOD A;  1I4W A;  3AOG A;  1WHC A;  4HL4 A;  2HL7 A;  1ZAE A;  3M7G A;  3RFW A;  2K0B X;  2XFT A;  4JN6 A;  1DO0 A;  3ZQJ A;  2I7P A;  3KOY E;  3ZH9 B;  5DNY A;  1IN6 A;  1WR1 B;  1TDZ A;  4Y28 F;  1HNW M;  3LW5 F;  3K2L A;  2YFQ A;  5BPV A;  2R0I A;  3UGJ A;  3U6O A;  2QEN A;  3B7Q A;  5ITX A;  3FD9 A;  3KFU G;  1PJT A;  1XHB A;  2EA0 A;  5LMN M;  2RRU A;  1EFU B;  2JY6 B;  1TH4 A;  1Z59 A;  3CTW B;  1NV8 A;  3SAR A;  4DR7 M;  1N78 A;  1SXJ C;  2F5N A;  1OKS A;  4X66 M;  1DV0 A;  2DHY A;  1QQW A;  2JNH A;  1C1K A;  4LGY A;  1UM8 A;  2BJV A;  3GLF A;  2ZTD A;  1V33 A;  2KXE A;  2UUA M;  1QAO A;  5EP3 A;  4IBB A;  2DI0 A;  3T15 A; 
#chains in the Genus database with same CATH homology
 1YUB A;  3FTC A;  3GP1 A;  2XZF A;  3K92 A;  4QHT A;  1WXQ A;  1Z5B A;  5A2Q S;  3HJ8 A;  2YNM D;  3GLH B;  1HNX M;  4JV5 M;  4L78 A;  3T38 A;  4I4L A;  5ITR A;  2C9O A;  1IBL M;  4LF7 M;  5ITU A;  3GRY A;  1G4A E;  4REZ A;  1XNR M;  4FW9 A;  1Q3C A;  5IRE B;  1SXJ B;  2HKJ A;  1N32 M;  4MGK E;  1L2C A;  5E6J A;  1DGB A;  2CUZ A;  4JI5 M;  2L7H A;  2CHV A;  4FWD A;  4NRW A;  3GQ4 A;  1YE9 A;  3LVV A;  3KS8 A;  4QHS A;  3TL4 X;  8CAT A;  1I94 M;  3E4R A;  4G4N A;  4LRS A;  2DWZ B;  3U6E A;  1GL6 A;  2R18 A;  4G4Q A;  1IM2 A;  3VLF B;  2XLJ A;  4QNR A;  1NY5 A;  3MK6 A;  1NHW C;  2W82 A;  3UK6 A;  1XMO M;  3T1H M;  5EP1 A;  4MGH A;  4B08 A;  2M5Z A;  1QAM A;  5H37 D;  2FOI C;  2XEP A;  4DR5 M;  3DA1 A;  5E26 A;  3L29 A;  5LMU M;  2V6Z M;  5DYI A;  3KP1 E;  3U60 B;  4LRT A;  3A45 A;  2R65 A;  3SMS A;  4OW0 A;  1KYI A;  4LG2 A;  3SHG B;  4BBA A;  2F5O A;  4LJA A;  4GC5 A;  4DV3 M;  1ZQ9 A;  1R2Y A;  5FTM A;  1HR0 M;  2P5T A;  3AFH A;  1ORY B;  1HT1 E;  3H4M A;  3HJQ A;  4LF4 M;  4IBE A;  4JI6 M;  2CEA A;  4L4U A;  4X62 M;  1TDH A;  2X8A A;  3SAS A;  4XBO A;  3U6S A;  1OFH A;  2RGH A;  2L6O A;  2JA2 A;  3E9S A;  2BJW A;  3HKP A;  4BLC A;  5GKN A;  1KFV A;  3FUW A;  4CIS A;  3HHX A;  3SC3 A;  3JR4 A;  5ITX E;  1Z5A A;  4D81 A;  2CHQ A;  1OFI A;  3KOZ E;  3EIE A;  4RF1 A;  3SAT A;  3NBI A;  1E9R A;  1XMQ M;  1PM5 A;  1EE8 A;  2K47 A;  2VII A;  2ZBK B;  3WHK A;  2F5P A;  1QYR A;  3R9X B;  3VKG A;  1DGG A;  4B7G A;  2DVW B;  4FCT A;  4MB7 A;  3FYC A;  3ZCB B;  1Z6T A;  1VDD A;  2LNH C;  2FE8 A;  7CAT A;  1GL7 A;  4OVZ A;  3GLG B;  4GRI A;  4B7H A;  2RKO A;  1G41 A;  3VDP A;  2KRU A;  3ZC7 B;  4Z6Y A;  3IG5 A;  5EXX A;  2UUB M;  2I7N A;  3M0E A;  4NXM M;  4ITQ A;  5FTL A;  2J7N A;  4GIT A;  3K1J A;  3L2A A;  3TWL A;  5KQ8 A;  4LGM A;  4IBD A;  1IN4 A;  1XXH A;  2UXB M;  4AKH A;  3AJI B;  3CF6 E;  3GQ5 A;  1N77 A;  2DWL A;  2C96 A;  3TQS A;  4DR3 M;  1S3S A;  3U5Z A;  5ITY A;  3FTE A;  4YY3 M;  3M6A A;  1MX0 A;  2DZN B;  4B7F A;  1PJI A;  1XXH B;  2X4A A;  2BNK A;  1K3X A;  4TUW A;  4AKG A;  3LMM A;  2DHR A;  3SBJ A;  4II7 A;  4WUR A;  4NXN M;  4DUZ M;  3U6D A;  4M9S A;  4JI2 M;  4AG5 A;  3A46 A;  4LJ4 A;  4DUY M;  3SAW A;  2G5G X;  5EP4 A;  2KW0 A;  5JI2 E;  4LCB A;  2R4E A;  5EJC A;  3RE8 A;  4XGI A;  4B3M M;  2YR0 A;  3HHW A;  1DGF A;  3FYD A;  3GLF B;  4LJ7 A;  3SYK A;  3HU2 A;  3W0L B;  5FLX S;  4B3S M;  1L1Z A;  3A98 B;  3PFI A;  2KZU A;  4OX9 M;  3BOS A;  1GKI A;  4L16 A;  1N36 M;  2XFS A;  1HNZ M;  3HU1 A;  3L25 A;  5DYG A;  3A42 A;  2XZU A;  3R8F A;  3FUV A;  4FCV A;  1IY2 A;  1D2N A;  2UXD M;  4MGZ E;  3FUX A;  1R6B X;  1NY6 A;  4NSR A;  4GIP A;  2ZAN A;  1LV7 A;  4DV5 M;  2J7O A;  3I4V A;  2E5L M;  2Z4R A;  5C18 A;  2FFJ A;  1IQP A;  4JI8 M;  1L8Q A;  1R7R A;  4JXJ A;  3U6M A;  4AI6 A;  3Q8X A;  2DWN A;  1IXS B;  4LFC M;  4LZJ A;  1L2D A;  4IBK A;  1Z5C A;  2VQF M;  3HU3 A;  3J7A S;  3TPZ A;  4LY6 A;  4IJF A;  1HQY E;  2L09 A;  5EP2 A;  3DZD A;  2QZ4 A;  3OTO M;  2R45 A;  3U6L A;  1JQJ C;  3RGS A;  2CV2 A;  2DXI A;  3U6P A;  4QOZ C;  1E9S A;  3DOA A;  1HQC A;  3HGI A;  3I4Y A;  4YHH M;  2UXC M;  2C5R A;  4X65 M;  4DV4 M;  4AG6 A;  1NNU C;  2D7G A;  4JI1 M;  3AL0 C;  4GKK M;  3U61 A;  4DV2 M;  5F3W A;  2X49 A;  2EUC A;  3KDS E;  5BR8 M;  4GHL A;  4A3V B;  4ZPX A;  1JR3 D;  4I81 A;  5EXT A;  2Y21 A;  1FNN A;  4OU7 A;  4JI4 M;  3AV0 A;  3W0F A;  4AW4 A;  4DR2 M;  3VK7 A;  3LQQ A;  4IBI A;  4IBF A;  4NSO B;  2CHG A;  3KW6 A;  2Z4S A;  1DGH A;  2ERC A;  4KO8 A;  4DV1 M;  2F4V M;  5C1B A;  1HT2 E;  3UMM A;  1IXZ A;  1NVM A;  4B3T M;  3T1Y M;  3VDU A;  3IG8 A;  4LF8 M;  1IN8 A;  1E94 E;  1TGU A;  4KLN A;  4B3R M;  3GO8 A;  2OPF A;  2DZO B;  2Y0T A;  1J7K A;  4D82 A;  2C99 A;  1Q3B A;  1W5S A;  1G59 A;  4CHT B;  3AKZ A;  5JI3 E;  4PDG A;  3J7B A;  3C58 A;  2UUC M;  4JI0 M;  3TE6 A;  3I51 A;  3TWM A;  2R62 A;  4G4O A;  3J27 B;  4M9X A;  4PCZ A;  3FUU A;  4RF0 A;  3SMP A;  1FJG M;  4DR4 M;  1IN7 A;  4DR1 M;  3U6Q A;  4OVZ B;  5IT9 S;  3LVW A;  1NJG A;  4IBC A;  4AZF A;  4EIW A;  2ZM6 M;  5EXS A;  3SYL A;  2LWX A;  1N33 M;  2QP9 X;  2YQZ A;  3B9P A;  4Z8X A;  3FUT A;  3DFZ A;  2FNA A;  2DWM A;  4L8R C;  2HCB A;  2G8L A;  2QBY A;  2UU9 M;  5EQT A;  2XGN A;  2Y20 A;  1E32 A;  4AQY M;  2QPA A;  4LF6 M;  3GRU A;  5FTN A;  1XWI A;  1JR3 A;  4W5W A;  1QVR A;  3HHY A;  4DV6 M;  1QAQ A;  4LFA M;  5KPT A;  4LF5 M;  1K3W A;  2XSZ A;  3GLI A;  4MH0 E;  3J80 S;  2CE7 A;  3U5Z B;  1TH2 A;  4GH9 A;  3KVW A;  4M0D A;  2R4J A;  2LH0 A;  3KS4 A;  3VFD A;  1DO2 A;  3KOX E;  4QNM A;  1L1T A;  3SFZ A;  3EIH A;  3L28 A;  1R2Z A;  2AHM A;  3D8L A;  3KP0 E;  2XF3 A;  3GLI B;  3RGP A;  4PT5 A;  2V1U A;  1T3T A;  3FKE A;  3L27 A;  1N34 M;  4BB9 A;  4IBG A;  2D7E A;  4GC9 A;  2CV0 A;  5ITQ A;  1QZM A;  4KHP M;  3L26 A;  3GLH A;  3PNV A;  2HHH M;  4IJE A;  2M60 A;  4CGY B;  4NRV A;  3UZU A;  5KPZ A;  3CF2 A;  3KOW E;  4JYA M;  2V1C A;  4HLQ A;  1KSF X;  3SAV A;  4JI7 M;  1SXJ A;  4GHA A;  2KZS A;  4FD2 A;  4LJ9 A;  3PVS A;  2KA6 B;  4R7G A;  1MU5 A;  2CV1 A;  2NQ8 C;  4MGY E;  4NL4 H;  1IBK M;  3J81 S;  4FWH A;  3LQR A;  3PNY A;  1XC8 A;  2D7H A;  2LXE A;  1J09 A;  1G8P A;  4GMQ A;  1IN5 A;  5FSW A;  1GVN A;  2R46 A;  3PXG A;  3FTD A;  3QWL A;  1GLN A;  5FTK A;  2ZAO A;  4I8O A;  1L2B A;  3GQ3 A;  4LJ5 A;  1G3I A;  2KEB A;  4FWG A;  3U60 A;  3ILK A;  2F5Q A;  2Z7J A;  4S12 A;  4G6Z A;  4DV7 M;  2L7I A;  3WHL A;  1TH3 A;  3GPP A;  4DV0 M;  3U6C A;  4QOS A;  1IBM M;  3JAM S;  4JI3 M;  5KPR A;  2EO2 A;  5ITT A;  3KSX A;  4I5S A;  3THG A;  4K0K M;  2RGO A;  4FCW A;  5KQD A;  1Q39 A;  1NSF A;  4DR6 M;  3SAU A;  2XSZ D;  4PD2 A;  4M9Z A;  4WW0 A;  2Q2E B;  3TWK A;  3U61 B;  4PDI A;  4GKJ M;  2C98 A;  3HWS A;  5IZ7 D;  1IY1 A;  3JR5 A;  5KO3 A;  4MM3 B;  3HHZ A;  4M0W A;  1YSY A;  4IIW A;  2QCU A;  2Y0Q A;  2F5S A;  1H6U A;  3FTF A;  3AOE C;  4G4R A;  3VK8 A;  3VKH A;  2A5Y B;  2CFO A;  1DGH B;  4NOO B;  1J5E M;  3J2P B;  1N75 A;  3HJS A;  3QAU A;  4LZZ A;  4LF9 M;  3SHF A;  5EXP A;  1OJL A;  4MGI E;  4R3D A;  2XH9 A;  1IXR C;  3GRR A;  4LFB M;  3AOE A;  3GRV A;  1W5T A;  3MHV C;  4LJ8 A;  1NNJ A;  2H1R A;  3D8B A;  5FTJ A;  2VQE M;  1K82 A;  4FVM A;  1SXJ D;  3CF0 A;  2O5R A;  3KXE C;  1XNQ M;  5IWA M;  3GPY A;  3GLG A;  3KSJ A;  4P16 A;  4AKI A;  1X37 A;  3MJ5 A;  2OQ4 A;  1PJJ A;  3NWL A;  2C9C A;  4D80 A;  2Z3X A;  4X64 M;  3K8Z A;  1SXJ E;  1IY0 A;  3GPX A;  3UJN A;  2KRK A;  4IBJ A;  1NJF A;  1NHG C;  4RNA A;  4LJ6 A;  3GPU A;  2ZAM A;  1QAN A;  4L15 A;  2QBY B;  4KOD A;  1I4W A;  3AOG A;  4HL4 A;  2HL7 A;  1ZAE A;  3M7G A;  3RFW A;  2XFT A;  4JN6 A;  1DO0 A;  2I7P A;  3KOY E;  3ZH9 B;  5DNY A;  1IN6 A;  1TDZ A;  1HNW M;  3K2L A;  2YFQ A;  5BPV A;  3UGJ A;  3U6O A;  2QEN A;  5ITX A;  3FD9 A;  3KFU G;  1XHB A;  2EA0 A;  5LMN M;  1TH4 A;  1Z59 A;  3CTW B;  4DR7 M;  3SAR A;  1N78 A;  1SXJ C;  2F5N A;  4X66 M;  1QQW A;  1C1K A;  4LGY A;  1UM8 A;  2BJV A;  3GLF A;  2KXE A;  2UUA M;  1QAO A;  5EP3 A;  4IBB A;  3T15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...