3OTOM

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
115
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3otoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3otoM02
4DV6M 4NRWA 4PDIA 4JI5M 4PDGA 1XMQM 4NXNM 4JI1M 3JR5A 4PCZA 5ITQA 4NXMM 5ITYA 1K3XA 3TWLA 3TWKA 3SATA 1XNQM 3GQ5A 4JI3M 1HNXM 4B3RM 3J80S 5FLXS 2F4VM 3A46A 1Q39A 3GPPA 3VK8A 4DV7M 1L2CA 1MX0A 3A45A 1XMOM 1L2BA 1HR0M 4LF4M 4DV4M 4DR7M 3JAMS 3U6SA 3JR4A 4DUZM 4X66M 5A2QS 3SAVA 5LMNM 3U6OA 3U6QA 5IT9S 4YY3M 3C58A 4LF6M 4DUYM 4G4QA 1Z59A 3GO8A 1MU5A 1Z5BA 2UXCM 1K3WA 2F5NA 3DOAA 2HHHM 4CISA 4JI2M 2F5PA 4JI0M 3VK7A 2F5OA 4B3MM 4B3SM 1Z5AA 4AQYM 2UXBM 4DR4M 3U6DA 4DR2M 3OTOM 4KHPM 4JI4M 3GPUA 4ITQA 4JI7M 4OX9M 2HKJA 5ITTA 4X65M 3U6LA 4JYAM 1TDZA 1R2YA 2VQEM 4DR1M 4LFBM 5BR8M 1XNRM 3T1YM 1KFVA 4X64M 1J5EM 1IBKM 4LF8M 1N32M 1PJIA 1Q3BA 4JV5M 3SBJA 1IBMM 1TDHA 4DR3M 3U6EA 2UUAM 1Z5CA 3U6PA 3SAWA 3GP1A 3SAUA 3SASA 1HNWM 1HNZM 2UXDM 5LMUM 4DR6M 3J81S 3TWMA 1PM5A 1N34M 1N36M 2UU9M 3U6CA 4DV2M 4G4OA 1FJGM 3J7AS 4K0KM 4YHHM 3GQ3A 4DV0M 2F5QA 4LF5M 2OPFA 5ITXE 3A42A 4DV1M 5IWAM 2UUCM 4JI6M 5ITRA 4MB7A 1R2ZA 4LFCM 2XZFA 3GQ4A 4G4RA 4JI8M 4X62M 2Q2EB 2OQ4A 4B3TM 3GPXA 4LF9M 1NNJA 4GKJM 2ZM6M 4LFAM 1XC8A 1L2DA 3U6MA 1L1TA 1N33M 3W0FA 3T1HM 1IBLM 4DV5M 3SARA 1K82A 1EE8A 4PD2A 4LF7M 1Q3CA 5ITUA 2VQFM 3GPYA 2EA0A 1L1ZA 2E5LM 4NRVA 2F5SA 2UUBM 1PJJA 4DR5M 2ZBKB 4G4NA 2XZUA 1I94M 4DV3M 4GKKM 5ITXA
chains in the Genus database with same CATH superfamily
4DV6M 4NRWA 4FW9A 2G5GX 2XGNA 4NXNM 3H4MA 5FSWA 1N77A 3MHVC 2DHYA 3CTWB 4RF1A 1YLAA 4HLQA 4PCZA 5ITQA 1K3XA 1WGLA 1XNQM 5KPRA 3L2AA 3FUXA 3M7GA 2DKLA 3J80S 5FLXS 2Z4RA 3VK8A 3RGSA 2JUJA 5F3WA 2LVNC 4KO8A 3MMPA 1AUAA 1KYIA 2KNAA 3A45A 1XMOM 3LQQA 5JI3E 4LF4M 1TH3A 3IECA 1EIJA 1YSYA 3CF0A 2R44A 1WHCA 2BWBA 3GRUA 1E32A 2G8LA 2P5TA 2X4AA 2XF3A 2LH0A 5DYGA 4AG5A 4P17A 3AFHA 1HQCA 4DUYM 3AOEA 4F2LA 3ZC7B 1NY5A 3SMSA 2DAGA 3VLFB 3TPZA 7CATA 2A5YB 3L26A 2HHHM 1GO5A 3W67A 1NV9A 2QQ8A 3K1JA 4RF0A 1TR8A 2C99A 4DR4M 2DWMA 2HL7A 4IBCA 2QNJA 4JI4M 1N78A 2LTUA 3KP0E 2CHGA 1NJGA 2YFQA 3ILKA 3KDSE 4I5SA 4JI7M 1IY1A 2HKJA 4M0DA 1DGHA 1GVNA 1QQWA 3E21A 2FOIC 3FYDA 1D0MA 4LGYA 5FTKA 4DR1M 1R2YA 3VKGA 4I8OA 4KT0F 1TH4A 5BR8M 4L78A 4LF8M 1D0LA 1HT2E 2O01F 3K8ZA 1QUSA 4GH9A 1X37A 2Y21A 4JV5M 1JQJC 1DGFA 3DA1A 2C5RA 4LCBA 1XXHA 2QHOB 2FH0A 4R3DA 2XFSA 4MGIE 1VQ1A 2V1CA 1T6OA 2R46A 3IG8A 3QYEA 1IXSA 2ZTCA 1GJSA 4XBOA 2QPAA 3UMMA 3PXGA 1PM5A 2KZSA 1N34M 4Y28F 5EXSA 3A98B 4DV2M 1FJGM 2L2DA 4YHHM 2QCUA 1HJPA 3VDPA 1WGNA 2OPFA 4G6ZA 4DV1M 3UJNA 5IWAM 2O5RA 2HCBA 4B08A 3AL0C 5EXTA 1R2ZA 3GQ4A 3I01M 2V6ZM 3FTFA 2LVOC 2R0IA 4CJ6A 3GPXA 2O25A 1UM8A 1IN6A 2JZ1A 4LFAM 1L2DA 3ZQJA 2KHHA 2L7IA 2ZAOA 3T1HM 1QVRA 3U60B 2JNHA 4KODA 3C9PA 4RKUF 5E26A 1EE8A 2ZANA 3GPYA 1NO1A 2JXNA 1I4WA 3T15A 2UUBM 2EKFA 3HHXA 1PJJA 2B3TA 2ZBKB 1I94M 2CEAA 4S12A 2KEBA 2DAIA 2R18A 2LHCA 2EUCA 4IBGA 4QOZC 2R6FA 2VF7A 4NC6A 5JI2E 1E94E 4PDIA 1T43A 4JI5M 4FWHA 4PDGA 1QDTA 2I7NA 3R8FA 4JI1M 1J09A 2KNVA 5ITYA 2OOAA 1IY2A 1PJSA 2H5XA 3FRIA 3TWKA 3TWLA 4JI3M 4HEOA 3HU2A 4GRIA 2I7PA 3R9XB 3E4RA 1Y8GA 3FKEA 1MX0A 4IIWA 2JY7A 1L2BA 3KOYE 2XH9A 1NJFA 2J7OA 2YQZA 3FD9A 4QOSA 4DR7M 3LCUA 4DUZM 2XSZD 1OAOC 4GC9A 2OO9A 3SAVA 1NHGC 3KSJA 2K47A 4GITA 2CRUA 1IFYA 2DZLA 4YY3M 1VDLA 3C58A 1UFZA 3LMMA 1Z59A 4LF6M 3ZCBB 1Z5BA 4A3VB 2UXCM 1HT1E 4MGHA 2BNKA 4LJ8A 3FUUA 1K3WA 1QANA 1QZMA 1W5TA 2BJWA 2L09A 3SC3A 3THGA 2OOBA 4AKHA 2JZ0A 4FD2A 2FE8A 3SYLA 4NSRA 4IBIA 2RGHA 3VDUA 4JI0M 2F5PA 2F5OA 3QYBA 1LV7A 1H6UA 3H4JA 3QAUA 4MH0E 4KHPM 1IXSB 1HQYE 2JA2A 1T3TA 4ITQA 3PVSA 1IY0A 2LWXA 1S3SA 2K6BA 3PFIA 2XSZA 1NNUC 4X65M 3U6LA 4L6V6 1V33A 4LGMA 4LJ4A 3BBZA 2DWNA 3M6AA 1N75A 1XNRM 1KFVA 3QWLA 4FCTA 1PJIA 2G3QA 3B9PA 5EP4A 1TDHA 2CUZA 4RNAA 4LJ5A 3RE8A 5FTJA 2Y0TA 3GLIA 1GABA 2QENA 2ZAMA 5KPZA 5IZ7D 3U61B 2XFTA 4OVZB 3MJ5A 1C1KA 3SHGB 3J27B 3SMPA 4B7HA 3GLHE 2L6OA 3WHKA 4D82A 1KSFX 1ZMVA 2DAMA 4AI6A 3FUWA 3J7BA 2CWBA 3J81S 3TWMA 4DR6M 5FTNA 3FTCA 4G4OA 4L15A 2KW0A 3GQ3A 3KS8A 3EIEA 1GKIA 3Q8GA 5ITXE 3A42A 3GLFB 2FS1A 2D7GA 4II7A 2M60A 4JI8M 2KRUA 4X62M 1WR1B 2NQ8C 3W0LB 2J5YA 2CV0A 3GRYA 5L8RF 2OQ4A 1JR3E 2DVWB 4I81A 1WJ7A 3NBXX 3HJSA 1NNJA 1E9SA 3D8LA 2ZM6M 4BB9A 1XC8A 1XB2B 2R65A 4XGIA 3U5ZA 1L1TA 1GL7A 4L8RC 2WSFF 1J7KA 3GLIB 2Y20A 2Z3XA 2C96A 2L4FA 3LVWA 1QYRA 3B7NA 4PD2A 5EJCA 3NBIA 1Q3CA 2R4JA 2LVPC 3U60A 2E5LM 4JXJA 2CHVA 2J7NA 2VDBB 4IBFA 4D80A 2F5SA 2DHRA 4GHLA 2DXIA 2Z4SA 3FRHA 2WSEF 2VIIA 2XZUA 5C1BA 3WHLA 3KVWA 4LZZA 3E46A 2C9OA 4HL4A 3M0EA 4MGKE 1CUKA 3B89A 4REZA 2D7EA 4NXMM 3FTDA 3UK6A 3HGIA 4F1IA 1XMQM 1DV0A 1ZQ9A 1IN7A 2KA6B 1YUBA 1JB0F 1NY6A 5DFLA 1QZEA 1XHBA 3SATA 1GJTA 4LG2A 3GQ5A 1HNXM 4B3RM 4P16A 5KQ8A 3AOEC 3GLGA 2DZOB 4TUWA 2LHGA 4IBKA 1Q39A 3L28A 3FYCA 2X8AA 1L2CA 3HHWA 4WW0A 1G3IA 3PNYA 1SXJC 2CV2A 4DV4M 3E9SA 1V34A 1BVSA 2LNHC 5A2QS 3GLFE 5LMNM 1VEJA 3U6OA 1P3QQ 2WSCF 4IJFA 4LY6A 3K9PA 1EFUB 4GHAA 1R5LA 1ZAEA 4G4QA 1IQPA 2JP7A 3B7ZA 5EP1A 3B74A 1IXRC 1DO0A 1FNNA 2H1RA 1OIPA 3KP1E 4L16A 2LBCA 2QP9X 4CISA 1RU3A 3HHYA 3T6PA 4B3MM 1TGUA 4XK8F 4AQYM 4OVZA 1VDDA 4DR2M 3TQSA 1NHWC 4ANRA 1WXQA 5DYIA 4OX9M 1R4GA 5ITTA 1OAIA 2R4EA 1OFIA 3I51A 2KZUA 3MK6A 5E6JA 5IREB 4EIWA 4JYAM 4R71A 1F4IA 3CF2A 2L4EA 1OKSA 2VQEM 4LRTA 1V92A 2YR0A 3J2PB 4NL4H 3HU3A 2JY8A 3DZDA 4GIPA 1IBKM 2DNAA 4IJEA 3K2LA 4M9SA 3SBJA 1IBMM 4DR3M 3LVVA 2QZ4A 2UUAM 3SFZA 4M9ZA 4BBAA 3U6PA 2CFOA 4DBGB 4BLCA 1NV8A 2AHMA 1ZMUA 2L7HA 2ZTDA 5BPVA 3SAUA 1HNWM 2JWSA 3D8BA 2RRUA 1ZMWA 2DWZB 4Q7JA 4ZPXA 3UGJA 5LMUM 2JY6B 1HNZM 3FTEA 2V1UA 1N36M 1MJGM 3U6CA 3V76A 5KO3A 3J7AS 1MN3A 5FTLA 3GLIE 2F5QA 1DGBA 3LW5F 2K0BX 3AV0A 4LF5M 1IXZA 1DGGA 4GMQA 1G41A 3NWLA 1DO2A 4NSOB 5ITRA 1QAQA 2CE7A 2XZFA 1R7RA 2MJ5B 2HAKA 4G4RA 2ERCA 2Q2EB 2DAKA 2R45A 1D0KA 1IN4A 1G71A 3L27A 4OU7A 4B3TM 3KOZE 2MROB 2Y0QA 2QBYA 4LF9M 1SXJB 2C9CA 4IBEA 4JN6A 3GRVA 4FCWA 1QAMA 2LVQD 3EIHA 3I4VA 2XLJA 1N33M 3BOSA 3I04M 3HHZA 3ZH9B 1QAOA 3Q8XA 3HKPA 4DV5M 2DENA 5KPTA 4QHSA 2VF8A 3GLFA 4B7FA 2MR9A 5ITUA 4LZJA 2LVAA 2APLA 2BWEA 2CHQA 4LRSA 2KRKA 1JR3A 1WIVA 4Z8XA 4AW4A 2EA0A 1L1ZA 4LJAA 8CATA 1G59A 4DR5M 4G4NA 2CP8A 2DI0A 2C98A 4IBJA 4GKKM 3W68A 3IHPA 3KOWE 3L29A 3BXWA 3C3EA 4AG6A 1QUTA 2Z7JA 2K9DA 1XXHB 4FCVA 4WP2A 5ITXA 4MGYE 3K92A 4M9XA 3TL4X 3U5ZB 4FWDA 3RFWA 5DNYA 4CGYB 3HWSA 4IBBA 4CIZA 3JR5A 3L25A 2MH8A 3KFUG 1NSFA 3KS4A 4GC5A 1SXJE 1TTEA 3UZUA 1QDRA 1JR3D 3GLHA 2JY5A 3VFDA 2F4VM 1GL6A 1OIZA 4L4UA 3A46A 3GPPA 2MGWA 3FUVA 4DV7M 1TF0B 1C7YA 1HR0M 5GKNA 1R6BX 5EP3A 1ORYB 1SXJD 3JAMS 3U6SA 1PJQA 4I4LA 3HZJA 4NOOB 3PNVA 4X66M 3HJ8A 3JR4A 3U6QA 2CV1A 1VEKA 1ZV1A 5H37D 5IT9S 1G8PA 3AKZA 1OTRA 2QBYB 3HX3A 3GLGE 4LJ9A 3GO8A 1MU5A 2D7HA 3U61A 3KXEC 3KOXE 2F5NA 1E9RA 2DWLA 3DOAA 2M5ZA 3C3DA 3KW6A 4JI2M 3VK7A 2YNMD 4B3SM 4GEWA 1Z5AA 3VKHA 2UXBM 1PJTA 4UN2B 3U6DA 2KDLA 3OTOM 2W82A 3I4YA 3GPUA 1IM2A 1NVMA 2QSFX 4KLNA 4MM3B 4M0WA 1OJLA 4QNMA 1TDZA 3DFZA 4LFBM 1A5TA 2EO2A 5EXPA 5EXXA 3T1YM 1D2NA 1AIPC 4X64M 1LTMA 1DGHB 1J5EM 2DAEA 5EP2A 1N32M 1Q3BA 5C18A 1PGYA 3U6EA 1GLNA 2LXEA 2FNAA 1Z5CA 4G3OA 1L8QA 3LCVB 2R62A 2RKOA 1SXJA 1VEGA 1IN8A 4QNRA 3SAWA 3GP1A 3SASA 3CGWA 1IN5A 5EQTA 3TE6A 2UXDM 3KSXA 4AZFA 2KNZA 4FVMA 4QHTA 3GLGB 2UU9M 4WURA 3HU1A 4K0KM 4DV0M 2RGOA 4MGZE 4R7GA 5KQDA 4JI6M 2GQFA 2EJSA 4IBDA 2UUCM 4MB7A 1OFHA 4LFCM 1Z6TA 2WZJA 1XWIA 1TH2A 3IG5A 3B7QA 1PRBA 2DZNB 2Z8YM 2N35A 3FE3A 1YE9A 4GKJM 3AOGA 3U6MA 4LJ6A 1SG9A 3W0FA 2BJVA 1IBLM 3HJQA 4OW0A 2HWJA 4B7GA 3F92A 3FUTA 1XXHE 1K82A 3CF6E 4FWGA 3SHFA 3SARA 4LF7M 3HY5A 5FTMA 2EKKA 1W5SA 3GLHB 4PT5A 4NRVA 1OQYA 1Q02A 4CHTB 2VQFM 4W5WA 2X49A 2FFJA 3K9OA 3T38A 3RGPA 3LQRA 1VG5A 4D81A 3GRRA 4AKGA 2KXEA 1G4AE 4AKIA 4DV3M 2XEPA 4Z6YA 3SYKA 3AJIB 2GNOA 4LJ7A
chains in the Genus database with same CATH topology
4DV6M 4NRWA 4FW9A 2G5GX 2XGNA 4NXNM 3H4MA 5FSWA 1N77A 3MHVC 4RF1A 3CTWB 4PCZA 4HLQA 5ITQA 1K3XA 1XNQM 5KPRA 3L2AA 3FUXA 3M7GA 3J80S 5FLXS 2Z4RA 3VK8A 3RGSA 5F3WA 4KO8A 1KYIA 3A45A 1XMOM 3LQQA 5JI3E 4LF4M 1TH3A 1YSYA 3CF0A 3GRUA 1E32A 2G8LA 2P5TA 2X4AA 2XF3A 2LH0A 5DYGA 4AG5A 3AFHA 1HQCA 4DUYM 3AOEA 3ZC7B 1NY5A 3SMSA 3VLFB 3TPZA 7CATA 2A5YB 3L26A 2HHHM 3K1JA 4RF0A 2C99A 4DR4M 2DWMA 2HL7A 4IBCA 1N78A 4JI4M 3KP0E 2CHGA 1NJGA 2YFQA 3ILKA 3KDSE 4I5SA 4JI7M 1IY1A 2HKJA 4M0DA 1DGHA 1GVNA 1QQWA 5FTKA 2FOIC 3FYDA 1R2YA 4LGYA 3VKGA 4DR1M 4I8OA 1TH4A 5BR8M 4L78A 4LF8M 1HT2E 3K8ZA 4GH9A 1X37A 2Y21A 4JV5M 1JQJC 1DGFA 3DA1A 2C5RA 4LCBA 1XXHA 4R3DA 2XFSA 4MGIE 2V1CA 2R46A 3IG8A 4XBOA 2QPAA 3UMMA 3PXGA 1PM5A 2KZSA 1N34M 4DV2M 5EXSA 3A98B 1FJGM 4YHHM 2QCUA 3VDPA 2OPFA 4G6ZA 4DV1M 3UJNA 5IWAM 2O5RA 2HCBA 4B08A 3AL0C 5EXTA 1R2ZA 3GQ4A 2V6ZM 3FTFA 3GPXA 1UM8A 1IN6A 4LFAM 1L2DA 2L7IA 2ZAOA 3T1HM 1QVRA 3U60B 4KODA 5E26A 1EE8A 2ZANA 3GPYA 1I4WA 3T15A 2UUBM 1PJJA 3HHXA 2ZBKB 1I94M 2CEAA 4S12A 2KEBA 2R18A 4QOZC 2EUCA 4IBGA 5JI2E 1E94E 4PDIA 4JI5M 4FWHA 4PDGA 2I7NA 3R8FA 4JI1M 1J09A 5ITYA 1IY2A 3TWKA 3TWLA 4JI3M 3HU2A 4GRIA 2I7PA 3R9XB 3E4RA 3FKEA 1MX0A 4IIWA 1L2BA 3KOYE 2XH9A 1NJFA 2J7OA 2YQZA 3FD9A 4QOSA 4DR7M 4DUZM 2XSZD 4GC9A 3SAVA 1NHGC 3KSJA 2K47A 4GITA 4YY3M 3C58A 4LF6M 3LMMA 1Z59A 3ZCBB 1Z5BA 4A3VB 2UXCM 1HT1E 4MGHA 2BNKA 4LJ8A 3FUUA 1K3WA 1QANA 1QZMA 1W5TA 2BJWA 2L09A 3SC3A 3THGA 4AKHA 4FD2A 2FE8A 3SYLA 4NSRA 4IBIA 2RGHA 3VDUA 4JI0M 2F5PA 2F5OA 1LV7A 1H6UA 3QAUA 4MH0E 4KHPM 1IXSB 1HQYE 2JA2A 1T3TA 4ITQA 3PVSA 1IY0A 2LWXA 1S3SA 3PFIA 2XSZA 1NNUC 4X65M 3U6LA 4LGMA 4LJ4A 2DWNA 3M6AA 1N75A 1XNRM 1KFVA 3QWLA 4FCTA 1PJIA 5EP4A 3B9PA 3RE8A 1TDHA 2CUZA 4RNAA 4LJ5A 3GLIA 5FTJA 2Y0TA 2QENA 2ZAMA 5KPZA 5IZ7D 3U61B 2XFTA 4OVZB 3MJ5A 1C1KA 3SHGB 3J27B 3SMPA 4B7HA 2L6OA 3WHKA 4D82A 1KSFX 4AI6A 3FUWA 3J7BA 4DR6M 3J81S 3TWMA 5FTNA 3FTCA 4G4OA 4L15A 2KW0A 3GQ3A 3KS8A 3EIEA 1GKIA 5ITXE 3GLFB 3A42A 2D7GA 4II7A 2M60A 4JI8M 2KRUA 4X62M 2NQ8C 3W0LB 2CV0A 3GRYA 2OQ4A 2DVWB 4I81A 1NNJA 3HJSA 1E9SA 3D8LA 2ZM6M 4BB9A 1XC8A 4XGIA 2R65A 3U5ZA 1L1TA 1GL7A 4L8RC 1J7KA 3GLIB 2Y20A 2Z3XA 2C96A 3LVWA 1QYRA 4PD2A 5EJCA 3NBIA 1Q3CA 2R4JA 3U60A 2E5LM 4JXJA 2CHVA 2J7NA 4IBFA 4D80A 2F5SA 2DHRA 4GHLA 2DXIA 2Z4SA 2VIIA 2XZUA 5C1BA 3WHLA 3KVWA 4LZZA 2C9OA 4HL4A 3M0EA 4MGKE 4REZA 2D7EA 4NXMM 3FTDA 3UK6A 3HGIA 1XMQM 1ZQ9A 1IN7A 2KA6B 1YUBA 1NY6A 1XHBA 3SATA 4LG2A 3GQ5A 1HNXM 4B3RM 4P16A 5KQ8A 3AOEC 3GLGA 2DZOB 4TUWA 4IBKA 1Q39A 3L28A 3FYCA 2X8AA 1L2CA 3HHWA 4WW0A 1G3IA 3PNYA 1SXJC 2CV2A 4DV4M 3E9SA 2LNHC 5A2QS 5LMNM 3U6OA 4IJFA 4LY6A 4GHAA 1ZAEA 4G4QA 1IQPA 5EP1A 1IXRC 1DO0A 1FNNA 2H1RA 3KP1E 4L16A 2QP9X 4CISA 3HHYA 4B3MM 1TGUA 4AQYM 4OVZA 1VDDA 4DR2M 3TQSA 1NHWC 1WXQA 5DYIA 4OX9M 5ITTA 2R4EA 1OFIA 3I51A 2KZUA 3MK6A 5E6JA 5IREB 4EIWA 4JYAM 3CF2A 2VQEM 4LRTA 2YR0A 3J2PB 4NL4H 3HU3A 3DZDA 4GIPA 1IBKM 4IJEA 3K2LA 4M9SA 3SBJA 1IBMM 4DR3M 3LVVA 2QZ4A 2UUAM 3SFZA 4M9ZA 4BBAA 3U6PA 2CFOA 4BLCA 2AHMA 2L7HA 3SAUA 5BPVA 1HNWM 3D8BA 1HNZM 4ZPXA 3UGJA 2DWZB 2UXDM 5LMUM 3FTEA 2V1UA 1N36M 3U6CA 5KO3A 3J7AS 5FTLA 2F5QA 1DGBA 4LF5M 3AV0A 1IXZA 1DGGA 4GMQA 1G41A 3NWLA 1DO2A 4NSOB 5ITRA 1QAQA 2CE7A 2XZFA 1R7RA 4G4RA 2ERCA 2Q2EB 2R45A 3L27A 1IN4A 4OU7A 4B3TM 3KOZE 2Y0QA 2QBYA 4LF9M 1SXJB 2C9CA 4IBEA 4JN6A 3GRVA 4FCWA 1QAMA 3EIHA 3I4VA 2XLJA 1N33M 3BOSA 3HHZA 3ZH9B 1QAOA 3Q8XA 3HKPA 4DV5M 5KPTA 4QHSA 3GLFA 4B7FA 5ITUA 4LZJA 4Z8XA 4AW4A 2EA0A 2CHQA 4LRSA 2KRKA 1JR3A 1L1ZA 4LJAA 8CATA 1G59A 4DR5M 4G4NA 2C98A 4IBJA 4GKKM 3KOWE 3L29A 4AG6A 2Z7JA 4FCVA 1XXHB 3U5ZB 5ITXA 3TL4X 4MGYE 3K92A 4M9XA 4FWDA 3RFWA 5DNYA 4CGYB 3HWSA 4IBBA 3JR5A 3L25A 3KFUG 1NSFA 3KS4A 4GC5A 1SXJE 3VFDA 3UZUA 1JR3D 3GLHA 2F4VM 1GL6A 4L4UA 3A46A 3GPPA 3FUVA 4DV7M 1HR0M 5GKNA 1R6BX 5EP3A 1ORYB 1SXJD 3JAMS 3U6SA 4I4LA 3JR4A 4NOOB 3PNVA 4X66M 3HJ8A 3U6QA 2CV1A 5H37D 5IT9S 1G8PA 3AKZA 2QBYB 4LJ9A 3GO8A 1MU5A 2D7HA 3U61A 3KXEC 3KOXE 2F5NA 1E9RA 2DWLA 3DOAA 2M5ZA 3KW6A 4JI2M 3VK7A 2YNMD 4B3SM 1Z5AA 3VKHA 2UXBM 3U6DA 3OTOM 2W82A 3I4YA 3GPUA 1IM2A 1NVMA 4MM3B 4KLNA 4M0WA 1OJLA 4QNMA 1TDZA 3DFZA 4LFBM 2EO2A 5EXPA 5EXXA 3T1YM 1D2NA 4X64M 1J5EM 1DGHB 5EP2A 1N32M 1Q3BA 5C18A 3U6EA 1GLNA 2LXEA 2FNAA 1Z5CA 1L8QA 2R62A 2RKOA 1SXJA 1IN8A 4QNRA 3SAWA 3GP1A 3SASA 1IN5A 5EQTA 3TE6A 3KSXA 4AZFA 4FVMA 4QHTA 3GLGB 2UU9M 4WURA 3HU1A 4K0KM 4DV0M 2RGOA 4MGZE 4R7GA 5KQDA 4JI6M 2UUCM 4IBDA 4MB7A 1OFHA 4LFCM 1Z6TA 1XWIA 1TH2A 3IG5A 2DZNB 1YE9A 4GKJM 3AOGA 3U6MA 4LJ6A 3W0FA 2BJVA 1IBLM 3HJQA 4OW0A 4B7GA 3FUTA 3SARA 1K82A 3CF6E 4FWGA 3SHFA 4LF7M 5FTMA 1W5SA 4PT5A 3GLHB 2VQFM 4NRVA 4CHTB 4W5WA 2X49A 2FFJA 3T38A 3RGPA 3LQRA 4D81A 3GRRA 4AKGA 2KXEA 1G4AE 4AKIA 4DV3M 2XEPA 4Z6YA 3SYKA 3AJIB 4LJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 M;  4NRW A;  4PDI A;  4JI5 M;  4PDG A;  1XMQ M;  4NXN M;  4JI1 M;  3JR5 A;  4PCZ A;  5ITQ A;  4NXM M;  5ITY A;  1K3X A;  3TWL A;  3TWK A;  3SAT A;  1XNQ M;  3GQ5 A;  4JI3 M;  1HNX M;  4B3R M;  3J80 S;  5FLX S;  2F4V M;  3A46 A;  1Q39 A;  3GPP A;  3VK8 A;  4DV7 M;  1L2C A;  1MX0 A;  3A45 A;  1XMO M;  1L2B A;  1HR0 M;  4LF4 M;  4DV4 M;  4DR7 M;  3JAM S;  3U6S A;  3JR4 A;  4DUZ M;  4X66 M;  5A2Q S;  3SAV A;  5LMN M;  3U6O A;  3U6Q A;  5IT9 S;  4YY3 M;  3C58 A;  4LF6 M;  4DUY M;  4G4Q A;  1Z59 A;  3GO8 A;  1MU5 A;  1Z5B A;  2UXC M;  1K3W A;  2F5N A;  3DOA A;  2HHH M;  4CIS A;  4JI2 M;  2F5P A;  4JI0 M;  3VK7 A;  2F5O A;  4B3M M;  4B3S M;  1Z5A A;  4AQY M;  2UXB M;  4DR4 M;  3U6D A;  4DR2 M;  3OTO M;  4KHP M;  4JI4 M;  3GPU A;  4ITQ A;  4JI7 M;  4OX9 M;  2HKJ A;  5ITT A;  4X65 M;  3U6L A;  4JYA M;  1TDZ A;  1R2Y A;  2VQE M;  4DR1 M;  4LFB M;  5BR8 M;  1XNR M;  3T1Y M;  1KFV A;  4X64 M;  1J5E M;  1IBK M;  4LF8 M;  1N32 M;  1PJI A;  1Q3B A;  4JV5 M;  3SBJ A;  1IBM M;  1TDH A;  4DR3 M;  3U6E A;  2UUA M;  1Z5C A;  3U6P A;  3SAW A;  3GP1 A;  3SAU A;  3SAS A;  1HNW M;  1HNZ M;  2UXD M;  5LMU M;  4DR6 M;  3J81 S;  3TWM A;  1PM5 A;  1N34 M;  1N36 M;  2UU9 M;  3U6C A;  4DV2 M;  4G4O A;  1FJG M;  3J7A S;  4K0K M;  4YHH M;  3GQ3 A;  4DV0 M;  2F5Q A;  4LF5 M;  2OPF A;  5ITX E;  3A42 A;  4DV1 M;  5IWA M;  2UUC M;  4JI6 M;  5ITR A;  4MB7 A;  1R2Z A;  4LFC M;  2XZF A;  3GQ4 A;  4G4R A;  4JI8 M;  4X62 M;  2Q2E B;  2OQ4 A;  4B3T M;  3GPX A;  4LF9 M;  1NNJ A;  4GKJ M;  2ZM6 M;  4LFA M;  1XC8 A;  1L2D A;  3U6M A;  1L1T A;  1N33 M;  3W0F A;  3T1H M;  1IBL M;  4DV5 M;  3SAR A;  1K82 A;  1EE8 A;  4PD2 A;  4LF7 M;  1Q3C A;  5ITU A;  2VQF M;  3GPY A;  2EA0 A;  1L1Z A;  2E5L M;  4NRV A;  2F5S A;  2UUB M;  1PJJ A;  4DR5 M;  2ZBK B;  4G4N A;  2XZU A;  1I94 M;  4DV3 M;  4GKK M;  5ITX A; 
#chains in the Genus database with same CATH topology
 4DV6 M;  4NRW A;  4FW9 A;  2G5G X;  2XGN A;  4NXN M;  3H4M A;  5FSW A;  1N77 A;  3MHV C;  2DHY A;  3CTW B;  4RF1 A;  1YLA A;  4HLQ A;  4PCZ A;  5ITQ A;  1K3X A;  1WGL A;  1XNQ M;  5KPR A;  3L2A A;  3FUX A;  3M7G A;  2DKL A;  3J80 S;  5FLX S;  2Z4R A;  3VK8 A;  3RGS A;  2JUJ A;  5F3W A;  2LVN C;  4KO8 A;  3MMP A;  1AUA A;  1KYI A;  2KNA A;  3A45 A;  1XMO M;  3LQQ A;  5JI3 E;  4LF4 M;  1TH3 A;  3IEC A;  1EIJ A;  1YSY A;  3CF0 A;  2R44 A;  1WHC A;  2BWB A;  3GRU A;  1E32 A;  2G8L A;  2P5T A;  2X4A A;  2XF3 A;  2LH0 A;  5DYG A;  4AG5 A;  4P17 A;  3AFH A;  1HQC A;  4DUY M;  3AOE A;  4F2L A;  3ZC7 B;  1NY5 A;  3SMS A;  2DAG A;  3VLF B;  3TPZ A;  7CAT A;  2A5Y B;  3L26 A;  2HHH M;  1GO5 A;  3W67 A;  1NV9 A;  2QQ8 A;  3K1J A;  4RF0 A;  1TR8 A;  2C99 A;  4DR4 M;  2DWM A;  2HL7 A;  4IBC A;  2QNJ A;  4JI4 M;  1N78 A;  2LTU A;  3KP0 E;  2CHG A;  1NJG A;  2YFQ A;  3ILK A;  3KDS E;  4I5S A;  4JI7 M;  1IY1 A;  2HKJ A;  4M0D A;  1DGH A;  1GVN A;  1QQW A;  3E21 A;  2FOI C;  3FYD A;  1D0M A;  4LGY A;  5FTK A;  4DR1 M;  1R2Y A;  3VKG A;  4I8O A;  4KT0 F;  1TH4 A;  5BR8 M;  4L78 A;  4LF8 M;  1D0L A;  1HT2 E;  2O01 F;  3K8Z A;  1QUS A;  4GH9 A;  1X37 A;  2Y21 A;  4JV5 M;  1JQJ C;  1DGF A;  3DA1 A;  2C5R A;  4LCB A;  1XXH A;  2QHO B;  2FH0 A;  4R3D A;  2XFS A;  4MGI E;  1VQ1 A;  2V1C A;  1T6O A;  2R46 A;  3IG8 A;  3QYE A;  1IXS A;  2ZTC A;  1GJS A;  4XBO A;  2QPA A;  3UMM A;  3PXG A;  1PM5 A;  2KZS A;  1N34 M;  4Y28 F;  5EXS A;  3A98 B;  4DV2 M;  1FJG M;  2L2D A;  4YHH M;  2QCU A;  1HJP A;  3VDP A;  1WGN A;  2OPF A;  4G6Z A;  4DV1 M;  3UJN A;  5IWA M;  2O5R A;  2HCB A;  4B08 A;  3AL0 C;  5EXT A;  1R2Z A;  3GQ4 A;  3I01 M;  2V6Z M;  3FTF A;  2LVO C;  2R0I A;  4CJ6 A;  3GPX A;  2O25 A;  1UM8 A;  1IN6 A;  2JZ1 A;  4LFA M;  1L2D A;  3ZQJ A;  2KHH A;  2L7I A;  2ZAO A;  3T1H M;  1QVR A;  3U60 B;  2JNH A;  4KOD A;  3C9P A;  4RKU F;  5E26 A;  1EE8 A;  2ZAN A;  3GPY A;  1NO1 A;  2JXN A;  1I4W A;  3T15 A;  2UUB M;  2EKF A;  3HHX A;  1PJJ A;  2B3T A;  2ZBK B;  1I94 M;  2CEA A;  4S12 A;  2KEB A;  2DAI A;  2R18 A;  2LHC A;  2EUC A;  4IBG A;  4QOZ C;  2R6F A;  2VF7 A;  4NC6 A;  5JI2 E;  1E94 E;  4PDI A;  1T43 A;  4JI5 M;  4FWH A;  4PDG A;  1QDT A;  2I7N A;  3R8F A;  4JI1 M;  1J09 A;  2KNV A;  5ITY A;  2OOA A;  1IY2 A;  1PJS A;  2H5X A;  3FRI A;  3TWK A;  3TWL A;  4JI3 M;  4HEO A;  3HU2 A;  4GRI A;  2I7P A;  3R9X B;  3E4R A;  1Y8G A;  3FKE A;  1MX0 A;  4IIW A;  2JY7 A;  1L2B A;  3KOY E;  2XH9 A;  1NJF A;  2J7O A;  2YQZ A;  3FD9 A;  4QOS A;  4DR7 M;  3LCU A;  4DUZ M;  2XSZ D;  1OAO C;  4GC9 A;  2OO9 A;  3SAV A;  1NHG C;  3KSJ A;  2K47 A;  4GIT A;  2CRU A;  1IFY A;  2DZL A;  4YY3 M;  1VDL A;  3C58 A;  1UFZ A;  3LMM A;  1Z59 A;  4LF6 M;  3ZCB B;  1Z5B A;  4A3V B;  2UXC M;  1HT1 E;  4MGH A;  2BNK A;  4LJ8 A;  3FUU A;  1K3W A;  1QAN A;  1QZM A;  1W5T A;  2BJW A;  2L09 A;  3SC3 A;  3THG A;  2OOB A;  4AKH A;  2JZ0 A;  4FD2 A;  2FE8 A;  3SYL A;  4NSR A;  4IBI A;  2RGH A;  3VDU A;  4JI0 M;  2F5P A;  2F5O A;  3QYB A;  1LV7 A;  1H6U A;  3H4J A;  3QAU A;  4MH0 E;  4KHP M;  1IXS B;  1HQY E;  2JA2 A;  1T3T A;  4ITQ A;  3PVS A;  1IY0 A;  2LWX A;  1S3S A;  2K6B A;  3PFI A;  2XSZ A;  1NNU C;  4X65 M;  3U6L A;  4L6V 6;  1V33 A;  4LGM A;  4LJ4 A;  3BBZ A;  2DWN A;  3M6A A;  1N75 A;  1XNR M;  1KFV A;  3QWL A;  4FCT A;  1PJI A;  2G3Q A;  3B9P A;  5EP4 A;  1TDH A;  2CUZ A;  4RNA A;  4LJ5 A;  3RE8 A;  5FTJ A;  2Y0T A;  3GLI A;  1GAB A;  2QEN A;  2ZAM A;  5KPZ A;  5IZ7 D;  3U61 B;  2XFT A;  4OVZ B;  3MJ5 A;  1C1K A;  3SHG B;  3J27 B;  3SMP A;  4B7H A;  3GLH E;  2L6O A;  3WHK A;  4D82 A;  1KSF X;  1ZMV A;  2DAM A;  4AI6 A;  3FUW A;  3J7B A;  2CWB A;  3J81 S;  3TWM A;  4DR6 M;  5FTN A;  3FTC A;  4G4O A;  4L15 A;  2KW0 A;  3GQ3 A;  3KS8 A;  3EIE A;  1GKI A;  3Q8G A;  5ITX E;  3A42 A;  3GLF B;  2FS1 A;  2D7G A;  4II7 A;  2M60 A;  4JI8 M;  2KRU A;  4X62 M;  1WR1 B;  2NQ8 C;  3W0L B;  2J5Y A;  2CV0 A;  3GRY A;  5L8R F;  2OQ4 A;  1JR3 E;  2DVW B;  4I81 A;  1WJ7 A;  3NBX X;  3HJS A;  1NNJ A;  1E9S A;  3D8L A;  2ZM6 M;  4BB9 A;  1XC8 A;  1XB2 B;  2R65 A;  4XGI A;  3U5Z A;  1L1T A;  1GL7 A;  4L8R C;  2WSF F;  1J7K A;  3GLI B;  2Y20 A;  2Z3X A;  2C96 A;  2L4F A;  3LVW A;  1QYR A;  3B7N A;  4PD2 A;  5EJC A;  3NBI A;  1Q3C A;  2R4J A;  2LVP C;  3U60 A;  2E5L M;  4JXJ A;  2CHV A;  2J7N A;  2VDB B;  4IBF A;  4D80 A;  2F5S A;  2DHR A;  4GHL A;  2DXI A;  2Z4S A;  3FRH A;  2WSE F;  2VII A;  2XZU A;  5C1B A;  3WHL A;  3KVW A;  4LZZ A;  3E46 A;  2C9O A;  4HL4 A;  3M0E A;  4MGK E;  1CUK A;  3B89 A;  4REZ A;  2D7E A;  4NXM M;  3FTD A;  3UK6 A;  3HGI A;  4F1I A;  1XMQ M;  1DV0 A;  1ZQ9 A;  1IN7 A;  2KA6 B;  1YUB A;  1JB0 F;  1NY6 A;  5DFL A;  1QZE A;  1XHB A;  3SAT A;  1GJT A;  4LG2 A;  3GQ5 A;  1HNX M;  4B3R M;  4P16 A;  5KQ8 A;  3AOE C;  3GLG A;  2DZO B;  4TUW A;  2LHG A;  4IBK A;  1Q39 A;  3L28 A;  3FYC A;  2X8A A;  1L2C A;  3HHW A;  4WW0 A;  1G3I A;  3PNY A;  1SXJ C;  2CV2 A;  4DV4 M;  3E9S A;  1V34 A;  1BVS A;  2LNH C;  5A2Q S;  3GLF E;  5LMN M;  1VEJ A;  3U6O A;  1P3Q Q;  2WSC F;  4IJF A;  4LY6 A;  3K9P A;  1EFU B;  4GHA A;  1R5L A;  1ZAE A;  4G4Q A;  1IQP A;  2JP7 A;  3B7Z A;  5EP1 A;  3B74 A;  1IXR C;  1DO0 A;  1FNN A;  2H1R A;  1OIP A;  3KP1 E;  4L16 A;  2LBC A;  2QP9 X;  4CIS A;  1RU3 A;  3HHY A;  3T6P A;  4B3M M;  1TGU A;  4XK8 F;  4AQY M;  4OVZ A;  1VDD A;  4DR2 M;  3TQS A;  1NHW C;  4ANR A;  1WXQ A;  5DYI A;  4OX9 M;  1R4G A;  5ITT A;  1OAI A;  2R4E A;  1OFI A;  3I51 A;  2KZU A;  3MK6 A;  5E6J A;  5IRE B;  4EIW A;  4JYA M;  4R71 A;  1F4I A;  3CF2 A;  2L4E A;  1OKS A;  2VQE M;  4LRT A;  1V92 A;  2YR0 A;  3J2P B;  4NL4 H;  3HU3 A;  2JY8 A;  3DZD A;  4GIP A;  1IBK M;  2DNA A;  4IJE A;  3K2L A;  4M9S A;  3SBJ A;  1IBM M;  4DR3 M;  3LVV A;  2QZ4 A;  2UUA M;  3SFZ A;  4M9Z A;  4BBA A;  3U6P A;  2CFO A;  4DBG B;  4BLC A;  1NV8 A;  2AHM A;  1ZMU A;  2L7H A;  2ZTD A;  5BPV A;  3SAU A;  1HNW M;  2JWS A;  3D8B A;  2RRU A;  1ZMW A;  2DWZ B;  4Q7J A;  4ZPX A;  3UGJ A;  5LMU M;  2JY6 B;  1HNZ M;  3FTE A;  2V1U A;  1N36 M;  1MJG M;  3U6C A;  3V76 A;  5KO3 A;  3J7A S;  1MN3 A;  5FTL A;  3GLI E;  2F5Q A;  1DGB A;  3LW5 F;  2K0B X;  3AV0 A;  4LF5 M;  1IXZ A;  1DGG A;  4GMQ A;  1G41 A;  3NWL A;  1DO2 A;  4NSO B;  5ITR A;  1QAQ A;  2CE7 A;  2XZF A;  1R7R A;  2MJ5 B;  2HAK A;  4G4R A;  2ERC A;  2Q2E B;  2DAK A;  2R45 A;  1D0K A;  1IN4 A;  1G71 A;  3L27 A;  4OU7 A;  4B3T M;  3KOZ E;  2MRO B;  2Y0Q A;  2QBY A;  4LF9 M;  1SXJ B;  2C9C A;  4IBE A;  4JN6 A;  3GRV A;  4FCW A;  1QAM A;  2LVQ D;  3EIH A;  3I4V A;  2XLJ A;  1N33 M;  3BOS A;  3I04 M;  3HHZ A;  3ZH9 B;  1QAO A;  3Q8X A;  3HKP A;  4DV5 M;  2DEN A;  5KPT A;  4QHS A;  2VF8 A;  3GLF A;  4B7F A;  2MR9 A;  5ITU A;  4LZJ A;  2LVA A;  2APL A;  2BWE A;  2CHQ A;  4LRS A;  2KRK A;  1JR3 A;  1WIV A;  4Z8X A;  4AW4 A;  2EA0 A;  1L1Z A;  4LJA A;  8CAT A;  1G59 A;  4DR5 M;  4G4N A;  2CP8 A;  2DI0 A;  2C98 A;  4IBJ A;  4GKK M;  3W68 A;  3IHP A;  3KOW E;  3L29 A;  3BXW A;  3C3E A;  4AG6 A;  1QUT A;  2Z7J A;  2K9D A;  1XXH B;  4FCV A;  4WP2 A;  5ITX A;  4MGY E;  3K92 A;  4M9X A;  3TL4 X;  3U5Z B;  4FWD A;  3RFW A;  5DNY A;  4CGY B;  3HWS A;  4IBB A;  4CIZ A;  3JR5 A;  3L25 A;  2MH8 A;  3KFU G;  1NSF A;  3KS4 A;  4GC5 A;  1SXJ E;  1TTE A;  3UZU A;  1QDR A;  1JR3 D;  3GLH A;  2JY5 A;  3VFD A;  2F4V M;  1GL6 A;  1OIZ A;  4L4U A;  3A46 A;  3GPP A;  2MGW A;  3FUV A;  4DV7 M;  1TF0 B;  1C7Y A;  1HR0 M;  5GKN A;  1R6B X;  5EP3 A;  1ORY B;  1SXJ D;  3JAM S;  3U6S A;  1PJQ A;  4I4L A;  3HZJ A;  4NOO B;  3PNV A;  4X66 M;  3HJ8 A;  3JR4 A;  3U6Q A;  2CV1 A;  1VEK A;  1ZV1 A;  5H37 D;  5IT9 S;  1G8P A;  3AKZ A;  1OTR A;  2QBY B;  3HX3 A;  3GLG E;  4LJ9 A;  3GO8 A;  1MU5 A;  2D7H A;  3U61 A;  3KXE C;  3KOX E;  2F5N A;  1E9R A;  2DWL A;  3DOA A;  2M5Z A;  3C3D A;  3KW6 A;  4JI2 M;  3VK7 A;  2YNM D;  4B3S M;  4GEW A;  1Z5A A;  3VKH A;  2UXB M;  1PJT A;  4UN2 B;  3U6D A;  2KDL A;  3OTO M;  2W82 A;  3I4Y A;  3GPU A;  1IM2 A;  1NVM A;  2QSF X;  4KLN A;  4MM3 B;  4M0W A;  1OJL A;  4QNM A;  1TDZ A;  3DFZ A;  4LFB M;  1A5T A;  2EO2 A;  5EXP A;  5EXX A;  3T1Y M;  1D2N A;  1AIP C;  4X64 M;  1LTM A;  1DGH B;  1J5E M;  2DAE A;  5EP2 A;  1N32 M;  1Q3B A;  5C18 A;  1PGY A;  3U6E A;  1GLN A;  2LXE A;  2FNA A;  1Z5C A;  4G3O A;  1L8Q A;  3LCV B;  2R62 A;  2RKO A;  1SXJ A;  1VEG A;  1IN8 A;  4QNR A;  3SAW A;  3GP1 A;  3SAS A;  3CGW A;  1IN5 A;  5EQT A;  3TE6 A;  2UXD M;  3KSX A;  4AZF A;  2KNZ A;  4FVM A;  4QHT A;  3GLG B;  2UU9 M;  4WUR A;  3HU1 A;  4K0K M;  4DV0 M;  2RGO A;  4MGZ E;  4R7G A;  5KQD A;  4JI6 M;  2GQF A;  2EJS A;  4IBD A;  2UUC M;  4MB7 A;  1OFH A;  4LFC M;  1Z6T A;  2WZJ A;  1XWI A;  1TH2 A;  3IG5 A;  3B7Q A;  1PRB A;  2DZN B;  2Z8Y M;  2N35 A;  3FE3 A;  1YE9 A;  4GKJ M;  3AOG A;  3U6M A;  4LJ6 A;  1SG9 A;  3W0F A;  2BJV A;  1IBL M;  3HJQ A;  4OW0 A;  2HWJ A;  4B7G A;  3F92 A;  3FUT A;  1XXH E;  1K82 A;  3CF6 E;  4FWG A;  3SHF A;  3SAR A;  4LF7 M;  3HY5 A;  5FTM A;  2EKK A;  1W5S A;  3GLH B;  4PT5 A;  4NRV A;  1OQY A;  1Q02 A;  4CHT B;  2VQF M;  4W5W A;  2X49 A;  2FFJ A;  3K9O A;  3T38 A;  3RGP A;  3LQR A;  1VG5 A;  4D81 A;  3GRR A;  4AKG A;  2KXE A;  1G4A E;  4AKI A;  4DV3 M;  2XEP A;  4Z6Y A;  3SYK A;  3AJI B;  2GNO A;  4LJ7 A; 
#chains in the Genus database with same CATH homology
 4DV6 M;  4NRW A;  4FW9 A;  2G5G X;  2XGN A;  4NXN M;  3H4M A;  5FSW A;  1N77 A;  3MHV C;  4RF1 A;  3CTW B;  4PCZ A;  4HLQ A;  5ITQ A;  1K3X A;  1XNQ M;  5KPR A;  3L2A A;  3FUX A;  3M7G A;  3J80 S;  5FLX S;  2Z4R A;  3VK8 A;  3RGS A;  5F3W A;  4KO8 A;  1KYI A;  3A45 A;  1XMO M;  3LQQ A;  5JI3 E;  4LF4 M;  1TH3 A;  1YSY A;  3CF0 A;  3GRU A;  1E32 A;  2G8L A;  2P5T A;  2X4A A;  2XF3 A;  2LH0 A;  5DYG A;  4AG5 A;  3AFH A;  1HQC A;  4DUY M;  3AOE A;  3ZC7 B;  1NY5 A;  3SMS A;  3VLF B;  3TPZ A;  7CAT A;  2A5Y B;  3L26 A;  2HHH M;  3K1J A;  4RF0 A;  2C99 A;  4DR4 M;  2DWM A;  2HL7 A;  4IBC A;  1N78 A;  4JI4 M;  3KP0 E;  2CHG A;  1NJG A;  2YFQ A;  3ILK A;  3KDS E;  4I5S A;  4JI7 M;  1IY1 A;  2HKJ A;  4M0D A;  1DGH A;  1GVN A;  1QQW A;  5FTK A;  2FOI C;  3FYD A;  1R2Y A;  4LGY A;  3VKG A;  4DR1 M;  4I8O A;  1TH4 A;  5BR8 M;  4L78 A;  4LF8 M;  1HT2 E;  3K8Z A;  4GH9 A;  1X37 A;  2Y21 A;  4JV5 M;  1JQJ C;  1DGF A;  3DA1 A;  2C5R A;  4LCB A;  1XXH A;  4R3D A;  2XFS A;  4MGI E;  2V1C A;  2R46 A;  3IG8 A;  4XBO A;  2QPA A;  3UMM A;  3PXG A;  1PM5 A;  2KZS A;  1N34 M;  4DV2 M;  5EXS A;  3A98 B;  1FJG M;  4YHH M;  2QCU A;  3VDP A;  2OPF A;  4G6Z A;  4DV1 M;  3UJN A;  5IWA M;  2O5R A;  2HCB A;  4B08 A;  3AL0 C;  5EXT A;  1R2Z A;  3GQ4 A;  2V6Z M;  3FTF A;  3GPX A;  1UM8 A;  1IN6 A;  4LFA M;  1L2D A;  2L7I A;  2ZAO A;  3T1H M;  1QVR A;  3U60 B;  4KOD A;  5E26 A;  1EE8 A;  2ZAN A;  3GPY A;  1I4W A;  3T15 A;  2UUB M;  1PJJ A;  3HHX A;  2ZBK B;  1I94 M;  2CEA A;  4S12 A;  2KEB A;  2R18 A;  4QOZ C;  2EUC A;  4IBG A;  5JI2 E;  1E94 E;  4PDI A;  4JI5 M;  4FWH A;  4PDG A;  2I7N A;  3R8F A;  4JI1 M;  1J09 A;  5ITY A;  1IY2 A;  3TWK A;  3TWL A;  4JI3 M;  3HU2 A;  4GRI A;  2I7P A;  3R9X B;  3E4R A;  3FKE A;  1MX0 A;  4IIW A;  1L2B A;  3KOY E;  2XH9 A;  1NJF A;  2J7O A;  2YQZ A;  3FD9 A;  4QOS A;  4DR7 M;  4DUZ M;  2XSZ D;  4GC9 A;  3SAV A;  1NHG C;  3KSJ A;  2K47 A;  4GIT A;  4YY3 M;  3C58 A;  4LF6 M;  3LMM A;  1Z59 A;  3ZCB B;  1Z5B A;  4A3V B;  2UXC M;  1HT1 E;  4MGH A;  2BNK A;  4LJ8 A;  3FUU A;  1K3W A;  1QAN A;  1QZM A;  1W5T A;  2BJW A;  2L09 A;  3SC3 A;  3THG A;  4AKH A;  4FD2 A;  2FE8 A;  3SYL A;  4NSR A;  4IBI A;  2RGH A;  3VDU A;  4JI0 M;  2F5P A;  2F5O A;  1LV7 A;  1H6U A;  3QAU A;  4MH0 E;  4KHP M;  1IXS B;  1HQY E;  2JA2 A;  1T3T A;  4ITQ A;  3PVS A;  1IY0 A;  2LWX A;  1S3S A;  3PFI A;  2XSZ A;  1NNU C;  4X65 M;  3U6L A;  4LGM A;  4LJ4 A;  2DWN A;  3M6A A;  1N75 A;  1XNR M;  1KFV A;  3QWL A;  4FCT A;  1PJI A;  5EP4 A;  3B9P A;  3RE8 A;  1TDH A;  2CUZ A;  4RNA A;  4LJ5 A;  3GLI A;  5FTJ A;  2Y0T A;  2QEN A;  2ZAM A;  5KPZ A;  5IZ7 D;  3U61 B;  2XFT A;  4OVZ B;  3MJ5 A;  1C1K A;  3SHG B;  3J27 B;  3SMP A;  4B7H A;  2L6O A;  3WHK A;  4D82 A;  1KSF X;  4AI6 A;  3FUW A;  3J7B A;  4DR6 M;  3J81 S;  3TWM A;  5FTN A;  3FTC A;  4G4O A;  4L15 A;  2KW0 A;  3GQ3 A;  3KS8 A;  3EIE A;  1GKI A;  5ITX E;  3GLF B;  3A42 A;  2D7G A;  4II7 A;  2M60 A;  4JI8 M;  2KRU A;  4X62 M;  2NQ8 C;  3W0L B;  2CV0 A;  3GRY A;  2OQ4 A;  2DVW B;  4I81 A;  1NNJ A;  3HJS A;  1E9S A;  3D8L A;  2ZM6 M;  4BB9 A;  1XC8 A;  4XGI A;  2R65 A;  3U5Z A;  1L1T A;  1GL7 A;  4L8R C;  1J7K A;  3GLI B;  2Y20 A;  2Z3X A;  2C96 A;  3LVW A;  1QYR A;  4PD2 A;  5EJC A;  3NBI A;  1Q3C A;  2R4J A;  3U60 A;  2E5L M;  4JXJ A;  2CHV A;  2J7N A;  4IBF A;  4D80 A;  2F5S A;  2DHR A;  4GHL A;  2DXI A;  2Z4S A;  2VII A;  2XZU A;  5C1B A;  3WHL A;  3KVW A;  4LZZ A;  2C9O A;  4HL4 A;  3M0E A;  4MGK E;  4REZ A;  2D7E A;  4NXM M;  3FTD A;  3UK6 A;  3HGI A;  1XMQ M;  1ZQ9 A;  1IN7 A;  2KA6 B;  1YUB A;  1NY6 A;  1XHB A;  3SAT A;  4LG2 A;  3GQ5 A;  1HNX M;  4B3R M;  4P16 A;  5KQ8 A;  3AOE C;  3GLG A;  2DZO B;  4TUW A;  4IBK A;  1Q39 A;  3L28 A;  3FYC A;  2X8A A;  1L2C A;  3HHW A;  4WW0 A;  1G3I A;  3PNY A;  1SXJ C;  2CV2 A;  4DV4 M;  3E9S A;  2LNH C;  5A2Q S;  5LMN M;  3U6O A;  4IJF A;  4LY6 A;  4GHA A;  1ZAE A;  4G4Q A;  1IQP A;  5EP1 A;  1IXR C;  1DO0 A;  1FNN A;  2H1R A;  3KP1 E;  4L16 A;  2QP9 X;  4CIS A;  3HHY A;  4B3M M;  1TGU A;  4AQY M;  4OVZ A;  1VDD A;  4DR2 M;  3TQS A;  1NHW C;  1WXQ A;  5DYI A;  4OX9 M;  5ITT A;  2R4E A;  1OFI A;  3I51 A;  2KZU A;  3MK6 A;  5E6J A;  5IRE B;  4EIW A;  4JYA M;  3CF2 A;  2VQE M;  4LRT A;  2YR0 A;  3J2P B;  4NL4 H;  3HU3 A;  3DZD A;  4GIP A;  1IBK M;  4IJE A;  3K2L A;  4M9S A;  3SBJ A;  1IBM M;  4DR3 M;  3LVV A;  2QZ4 A;  2UUA M;  3SFZ A;  4M9Z A;  4BBA A;  3U6P A;  2CFO A;  4BLC A;  2AHM A;  2L7H A;  3SAU A;  5BPV A;  1HNW M;  3D8B A;  1HNZ M;  4ZPX A;  3UGJ A;  2DWZ B;  2UXD M;  5LMU M;  3FTE A;  2V1U A;  1N36 M;  3U6C A;  5KO3 A;  3J7A S;  5FTL A;  2F5Q A;  1DGB A;  4LF5 M;  3AV0 A;  1IXZ A;  1DGG A;  4GMQ A;  1G41 A;  3NWL A;  1DO2 A;  4NSO B;  5ITR A;  1QAQ A;  2CE7 A;  2XZF A;  1R7R A;  4G4R A;  2ERC A;  2Q2E B;  2R45 A;  3L27 A;  1IN4 A;  4OU7 A;  4B3T M;  3KOZ E;  2Y0Q A;  2QBY A;  4LF9 M;  1SXJ B;  2C9C A;  4IBE A;  4JN6 A;  3GRV A;  4FCW A;  1QAM A;  3EIH A;  3I4V A;  2XLJ A;  1N33 M;  3BOS A;  3HHZ A;  3ZH9 B;  1QAO A;  3Q8X A;  3HKP A;  4DV5 M;  5KPT A;  4QHS A;  3GLF A;  4B7F A;  5ITU A;  4LZJ A;  4Z8X A;  4AW4 A;  2EA0 A;  2CHQ A;  4LRS A;  2KRK A;  1JR3 A;  1L1Z A;  4LJA A;  8CAT A;  1G59 A;  4DR5 M;  4G4N A;  2C98 A;  4IBJ A;  4GKK M;  3KOW E;  3L29 A;  4AG6 A;  2Z7J A;  4FCV A;  1XXH B;  3U5Z B;  5ITX A;  3TL4 X;  4MGY E;  3K92 A;  4M9X A;  4FWD A;  3RFW A;  5DNY A;  4CGY B;  3HWS A;  4IBB A;  3JR5 A;  3L25 A;  3KFU G;  1NSF A;  3KS4 A;  4GC5 A;  1SXJ E;  3VFD A;  3UZU A;  1JR3 D;  3GLH A;  2F4V M;  1GL6 A;  4L4U A;  3A46 A;  3GPP A;  3FUV A;  4DV7 M;  1HR0 M;  5GKN A;  1R6B X;  5EP3 A;  1ORY B;  1SXJ D;  3JAM S;  3U6S A;  4I4L A;  3JR4 A;  4NOO B;  3PNV A;  4X66 M;  3HJ8 A;  3U6Q A;  2CV1 A;  5H37 D;  5IT9 S;  1G8P A;  3AKZ A;  2QBY B;  4LJ9 A;  3GO8 A;  1MU5 A;  2D7H A;  3U61 A;  3KXE C;  3KOX E;  2F5N A;  1E9R A;  2DWL A;  3DOA A;  2M5Z A;  3KW6 A;  4JI2 M;  3VK7 A;  2YNM D;  4B3S M;  1Z5A A;  3VKH A;  2UXB M;  3U6D A;  3OTO M;  2W82 A;  3I4Y A;  3GPU A;  1IM2 A;  1NVM A;  4MM3 B;  4KLN A;  4M0W A;  1OJL A;  4QNM A;  1TDZ A;  3DFZ A;  4LFB M;  2EO2 A;  5EXP A;  5EXX A;  3T1Y M;  1D2N A;  4X64 M;  1J5E M;  1DGH B;  5EP2 A;  1N32 M;  1Q3B A;  5C18 A;  3U6E A;  1GLN A;  2LXE A;  2FNA A;  1Z5C A;  1L8Q A;  2R62 A;  2RKO A;  1SXJ A;  1IN8 A;  4QNR A;  3SAW A;  3GP1 A;  3SAS A;  1IN5 A;  5EQT A;  3TE6 A;  3KSX A;  4AZF A;  4FVM A;  4QHT A;  3GLG B;  2UU9 M;  4WUR A;  3HU1 A;  4K0K M;  4DV0 M;  2RGO A;  4MGZ E;  4R7G A;  5KQD A;  4JI6 M;  2UUC M;  4IBD A;  4MB7 A;  1OFH A;  4LFC M;  1Z6T A;  1XWI A;  1TH2 A;  3IG5 A;  2DZN B;  1YE9 A;  4GKJ M;  3AOG A;  3U6M A;  4LJ6 A;  3W0F A;  2BJV A;  1IBL M;  3HJQ A;  4OW0 A;  4B7G A;  3FUT A;  3SAR A;  1K82 A;  3CF6 E;  4FWG A;  3SHF A;  4LF7 M;  5FTM A;  1W5S A;  4PT5 A;  3GLH B;  2VQF M;  4NRV A;  4CHT B;  4W5W A;  2X49 A;  2FFJ A;  3T38 A;  3RGP A;  3LQR A;  4D81 A;  3GRR A;  4AKG A;  2KXE A;  1G4A E;  4AKI A;  4DV3 M;  2XEP A;  4Z6Y A;  3SYK A;  3AJI B;  4LJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...