4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
2EA0A 3U6OA 4LFBM 4DV4M 1XNRM 3JAMS 3SBJA 4JI6M 3A46A 4LF8M 4GKJM 5ITTA 4G4QA 1N34M 1Z5BA 1Z5AA 4PD2A 3U6EA 1K3XA 2HHHM 3U6CA 2UXDM 2XZUA 5ITQA 3DOAA 4DV1M 4DR1M 4DR6M 4YHHM 5ITRA 1Q3BA 2OPFA 1HNWM 4JI3M 4LF9M 3TWMA 5A2QS 5ITXE 4DUZM 1Z5CA 3U6LA 1XC8A 3T1YM 4PDIA 4AQYM 4X64M 1KFVA 1IBLM 2ZBKB 4JI1M 5LMUM 2VQFM 1HR0M 4NRWA 3GP1A 3GO8A 3U6DA 1MU5A 1PJIA 4PCZA 3J81S 1Z59A 1XMOM 3GPUA 4KHPM 4MB7A 2F5QA 4JV5M 2F5NA 3TWLA 4DV0M 3GQ3A 3VK7A 4CISA 3J7AS 4GKKM 1N33M 3U6MA 1HNZM 4G4OA 3TWKA 5ITUA 1R2ZA 1Q39A 2HKJA 1L2BA 4B3RM 3GPXA 1NNJA 4LF7M 2OQ4A 3J80S 4B3TM 4B3SM 5LMNM 4OX9M 1N32M 2F5PA 4DR7M 1L1ZA 4JI2M 4JI8M 5IT9S 2UUBM 4JI5M 1I94M 3A45A 2XZFA 2UXBM 3C58A 4X65M 5ITYA 1K82A 1IBKM 3T1HM 1HNXM 4ITQA 3GPYA 2UUAM 3SATA 4G4RA 4NXMM 3SAUA 1EE8A 4DR2M 1XMQM 4DV6M 2UUCM 1K3WA 3SAVA 1L2CA 4LFCM 2ZM6M 4B3MM 4JI4M 4DV7M 1PJJA 4DV5M 1TDZA 4PDGA 1J5EM 4X62M 3SARA 4DUYM 2UXCM 4K0KM 4DR4M 4DR5M 4JI0M 4LF4M 3JR4A 4G4NA 2VQEM 5IWAM 4DV3M 3VK8A 4LFAM 1L1TA 3SAWA 1FJGM 4LF5M 4YY3M 3SASA 1L2DA 4NXNM 2F5SA 3W0FA 3JR5A 2E5LM 2Q2EB 5BR8M 4LF6M 1TDHA 1XNQM 3GQ4A 2UU9M 4JYAM 3GQ5A 5ITXA 3A42A 3GPPA 4NRVA 1IBMM 1PM5A 1R2YA 4X66M 3U6PA 2F5OA 3U6SA 2F4VM 4JI7M 4DR3M 4DV2M 1N36M 5FLXS 1MX0A 1Q3CA 3U6QA 3OTOM
chains in the Genus database with same CATH superfamily
4A3VB 1X37A 7CATA 3SYLA 3SMPA 4JI6M 1D2NA 3A46A 4LF8M 5ITTA 3VKHA 4GMQA 2LVPC 1LV7A 4REZA 4Y28F 1K3XA 4I8OA 1QAQA 1DV0A 1IQPA 3F92A 4GC5A 5EXTA 3B89A 1E9SA 2DHRA 1OAOC 2O5RA 2XSZD 3L28A 3GLFB 3HHZA 3D8LA 4DV1M 5DFLA 4YHHM 2QPAA 3GLIE 1Q3BA 2HAKA 3SMSA 2OPFA 2XGNA 3K9OA 4QHSA 1ZMVA 3TWMA 3LQQA 5ITXE 1PJSA 1Z5CA 3U6LA 2KNZA 1NV8A 2ZTDA 4LZJA 3FUVA 1DGFA 2AHMA 2R4JA 3D8BA 2JY5A 1J09A 4PDIA 2R45A 4AQYM 2Z4SA 1P3QQ 2C5RA 3W0LB 1XXHB 5LMUM 4CHTB 2GQFA 3M7GA 5FTJA 1NHWC 5C18A 3VDPA 4S12A 3B74A 3B9PA 2JA2A 2KXEA 1KYIA 4BB9A 3J81S 1ORYB 1HJPA 3KP0E 4AG6A 1XMOM 1SXJB 3HU1A 3UMMA 4MB7A 3PVSA 4JV5M 3KXEC 3TWLA 3TE6A 3HJ8A 5EP3A 4LGMA 1UFZA 4G6ZA 1OIPA 3U6MA 2C9OA 2FFJA 1WHCA 2XSZA 3HY5A 4OW0A 5BPVA 5FSWA 5ITUA 2HKJA 3I51A 2CP8A 4B3RM 4FW9A 1XWIA 1L8QA 1PJTA 4II7A 3J80S 1N32M 1DGHA 4AW4A 2H5XA 3CF0A 2DAMA 4IBBA 4JI5M 4GRIA 2DHYA 2R46A 3C58A 4X65M 4LG2A 4FCWA 4OU7A 3SATA 2G3QA 3SAUA 4JXJA 3TPZA 3LVVA 2QBYA 4HL4A 2L6OA 3GLIB 5FTMA 2K47A 1QDTA 4DV5M 4Q7JA 2UXCM 4PT5A 3R9XB 2VF7A 4DR4M 4TUWA 1HQYE 2K9DA 4DV3M 3T38A 1YSYA 3PXGA 3U61A 5JI3E 2KEBA 1ZQ9A 2Y21A 5F3WA 3U61B 1WJ7A 3IHPA 2Z8YM 3UZUA 1N77A 4AKHA 2L4FA 4LJ9A 4NXNM 1NO1A 2E5LM 4M9ZA 5BR8M 3U5ZA 1XNQM 3HGIA 3EIEA 3A98B 3GQ5A 3VKGA 1TGUA 1GVNA 1V92A 3NWLA 4NRVA 1IN6A 1WIVA 2CEAA 2M60A 2MJ5B 3FUWA 3DFZA 4X66M 3U6PA 2F5OA 3U6SA 4JI7M 1GKIA 4F2LA 3QWLA 4NL4H 4DV2M 1K82A 1MX0A 2QBYB 3AL0C 2W82A 3VDUA 1MJGM 4B7HA 5KO3A 3C3DA 2BWBA 3OTOM 4KLNA 2JP7A 3FD9A 4R3DA 4DV4M 2JY7A 3J2PB 4G4QA 1IN8A 1CUKA 2LWXA 4PD2A 3U6CA 4L4UA 1DO2A 2UXDM 2XH9A 3QAUA 2XZUA 2R65A 5ITQA 1C7YA 3DOAA 4DR1M 3FTCA 4DR6M 2LBCA 4OVZA 2LNHC 2R0IA 3HHXA 4BBAA 3FRHA 3KOYE 2BNKA 4D82A 5EP1A 4LF9M 5DNYA 2I7PA 2G5GX 5C1BA 1G8PA 1QVRA 2ZAMA 2DNAA 2K6BA 3HJSA 4NSRA 2C98A 1VEJA 5EXXA 1GLNA 1H6UA 2Y0TA 3TL4X 3T1YM 1T6OA 1XC8A 2YQZA 2J7OA 2DAEA 4IBDA 2V6ZM 1NSFA 1KFVA 1IBLM 2MR9A 2ZBKB 3SYKA 4JI1M 3LW5F 2B3TA 2VQFM 1ZAEA 2JUJA 2Y0QA 4NRWA 3SC3A 1GJTA 3GO8A 2CHGA 4FCTA 3ZC7B 1ZMWA 4GEWA 4WP2A 5GKNA 3GLFA 3M6AA 4FCVA 1R7RA 4B7GA 3GPUA 2L4EA 2RRUA 3M0EA 4DV0M 2Y20A 2D7EA 3VK7A 3J7AS 3RE8A 4ZPXA 2XEPA 3UK6A 5KQ8A 5DYIA 4LRSA 1TTEA 4AI6A 1HNZM 4M0WA 2RKOA 1D0MA 3WHKA 3U60A 4Z8XA 2Z7JA 1EFUB 1L2BA 4HEOA 1J7KA 3FUUA 2JY6B 3K9PA 2O25A 4B3TM 1JB0F 3GLHA 5LMNM 2NQ8C 3L29A 3HU3A 3AFHA 4OX9M 4QOZC 1WXQA 1IN7A 1GL7A 3L27A 4LJ5A 2BJVA 4AZFA 2XF3A 2ZANA 3B7QA 4M9SA 3A45A 4MGIE 2XZFA 2UXBM 3HHWA 5FTNA 1IBKM 2DKLA 1HNXM 5KPRA 2N35A 1PRBA 4W5WA 4DV6M 2UUCM 2P5TA 3KDSE 2DAKA 2ZM6M 2KZSA 4B3MM 4JI4M 2DZOB 2OOAA 1V33A 1IXSB 2BJWA 5EXPA 4GITA 2RGOA 4PDGA 1VDLA 4LJ7A 3HZJA 2X4AA 1QANA 4DUYM 3E46A 3J7BA 3Q8GA 3MK6A 3T15A 4DR5M 3CTWB 2LVAA 2CV2A 1R4GA 2LTUA 3DA1A 3PNVA 3B7ZA 4G4NA 3NBIA 2QZ4A 3H4MA 5IWAM 3VK8A 1S3SA 3HWSA 3KFUG 1G71A 2V1UA 2J7NA 4KO8A 4GHLA 2L7HA 1QAMA 4YY3M 1VG5A 3KS8A 1JR3D 3VFDA 3VLFB 1NV9A 2X49A 4L15A 3GLIA 2Q2EB 2FE8A 2JZ0A 1TDHA 4MGHA 4IIWA 3GQ4A 2UU9M 4JYAM 1TH3A 1IY1A 1VDDA 3I4YA 2I7NA 4JN6A 4QOSA 4MGYE 1IM2A 1W5SA 2JZ1A 2WSFF 5EXSA 2F4VM 2WZJA 1D0LA 5JI2E 4DR3M 2ZTCA 2CWBA 2QQ8A 4IBCA 4CJ6A 1N36M 5FLXS 2DWNA 1RU3A 3KS4A 2MGWA 3WHLA 1OQYA 3U6OA 4LJ4A 3HJQA 2LHGA 4LFBM 3KSJA 3FTDA 1XNRM 3JAMS 3RGPA 2D7HA 3SBJA 2YNMD 2R44A 1OKSA 3LQRA 4R71A 1N34M 5DYGA 2HHHM 1SXJD 4FWDA 4I81A 1JR3E 5EQTA 5FTKA 5FTLA 1Y8GA 4AKGA 4LJAA 4ANRA 3UJNA 4OVZB 1DO0A 1QZEA 2QNJA 2KHHA 4BLCA 3FTEA 3GLHB 4GHAA 3W67A 2RGHA 2XFTA 4JI3M 1KSFX 4FVMA 3DZDA 1W5TA 4DUZM 1VEGA 3THGA 1YLAA 2QHOB 1OTRA 2DWZB 3BXWA 1IXRC 4KT0F 3KP1E 4IBEA 3GLGE 1N78A 4IJEA 4FWHA 1R5LA 4GC9A 4X64M 1TH4A 2QSFX 1VEKA 3CF2A 1OIZA 2DENA 3E21A 2KA6B 3GP1A 2VDBB 3ILKA 2L2DA 4LGYA 4EIWA 4I5SA 3K8ZA 2V1CA 1Z59A 3SHGB 3AOEC 1SG9A 3SFZA 4KHPM 1E94E 4GIPA 1UM8A 2G8LA 1QQWA 3FKEA 2D7GA 4B08A 3I4VA 3GRYA 1NHGC 3K1JA 4KODA 3GLGA 2F5NA 2DAGA 4GKKM 1NJFA 2R4EA 3H4JA 3KOWE 1XHBA 3SHFA 2DAIA 2ZAOA 3FTFA 1HQCA 2ERCA 3MHVC 1HT1E 4LCBA 3RFWA 5KPZA 4G4OA 4IJFA 3TWKA 1GABA 1XXHA 1Q39A 3E4RA 5H37D 1NNJA 2JY8A 2OQ4A 3QYBA 1IFYA 1TF0B 1LTMA 2CRUA 2LXEA 3HHYA 2F5PA 1E32A 3ZH9B 2M5ZA 4JI2M 1SXJC 4IBJA 4JI8M 2OO9A 1AUAA 2R6FA 4G3OA 5IREB 1FNNA 3EIHA 3FUTA 3RGSA 4RF1A 1GL6A 2LVNC 2C9CA 2J5YA 2YR0A 3T6PA 4P17A 2FH0A 3T1HM 4ITQA 4D81A 4NSOB 2UUAM 4G4RA 3IECA 4DR2M 4XBOA 1EIJA 1WGLA 3CGWA 3SAVA 4LFCM 3GLHE 4D80A 2QENA 5EP4A 4DV7M 3GRRA 4NC6A 1NVMA 4M0DA 3BBZA 2CV1A 1IXZA 3MMPA 1R6BX 4JI0M 4LF4M 1F4IA 3JR4A 3LCVB 2L7IA 2VQEM 2HL7A 3I04M 4FD2A 1PGYA 4LFAM 1NY6A 1L1TA 1WR1B 2DZNB 2DVWB 3FE3A 2F5SA 2DXIA 3JR5A 4LF6M 2WSCF 3LVWA 2QP9X 1IXSA 2R18A 3LMMA 4AG5A 2MROB 1JQJC 2DWMA 2JNHA 5ITXA 3A42A 4HLQA 3GRVA 1PM5A 4L6V6 2CHVA 2CFOA 3ZCBB 4L8RC 5E26A 3K92A 5E6JA 4LY6A 1A5TA 4DBGB 1G4AE 2EUCA 2A5YB 2KRKA 3U6DA 1Q3CA 1QDRA 4GH9A 2EA0A 4WURA 4R7GA 3I01M 3J27B 4XK8F 2GNOA 4GKJM 4L16A 2DWLA 2KDLA 3U5ZB 1Z5AA 1E9RA 1Z5BA 3U6EA 1OFIA 2WSEF 1DGGA 1N75A 3KW6A 2CE7A 2KNAA 1G59A 3AOGA 4RNAA 3HU2A 4IBFA 5ITRA 2C96A 2HCBA 3PNYA 2VF8A 4MM3B 1HNWM 2VIIA 4UN2B 4FWGA 5A2QS 1BVSA 2FOIC 1MN3A 4QHTA 2BWEA 4LZZA 4LJ8A 3BOSA 2H1RA 4B7FA 2LHCA 3LCUA 1HT2E 1HR0M 5IZ7D 3CF6E 4IBKA 1YUBA 2R62A 1MU5A 1OJLA 1T3TA 2HWJA 4NOOB 3AJIB 3TQSA 3ZQJA 1IY2A 4CIZA 1NNUC 3V76A 4PCZA 1PJIA 1Q02A 2LVOC 3AOEA 4CGYB 4IBGA 1PJQA 3KOXE 4QNMA 2APLA 2F5QA 1QUSA 1XXHE 1IN4A 3GRUA 3GQ3A 4IBIA 4CISA 3FYCA 1OAIA 3HKPA 3MJ5A 2K0BX 1N33M 1NY5A 1QYRA 3Q8XA 3QYEA 3FRIA 5EJCA 4LRTA 1V34A 2FS1A 1R2ZA 4AKIA 4QNRA 3L2AA 5KQDA 3L25A 3GPXA 4LF7M 2LH0A 2EKFA 3UGJA 2CHQA 3HX3A 4B3SM 3C3EA 1NJGA 1ZV1A 2KW0A 4WW0A 1QZMA 4DR7M 3B7NA 1L1ZA 1T43A 1XB2B 5IT9S 1TR8A 2UUBM 3PFIA 3AV0A 1ZMUA 2CV0A 1I94M 2C99A 3KOZE 2OOBA 3NBXX 4RKUF 4LJ6A 5ITYA 1VQ1A 3GLFE 3GPYA 1JR3A 3IG8A 1EE8A 4NXMM 2L09A 1XMQM 3U60B 1K3WA 2Z4RA 1L2CA 1Z6TA 1PJJA 2CUZA 1YE9A 3KSXA 4F1IA 3C9PA 1QAOA 1DGBA 1TH2A 1TDZA 5KPTA 2EO2A 4X62M 1J5EM 1I4WA 2LVQD 3SARA 4MGZE 3AKZA 4K0KM 1IY0A 2O01F 4RF0A 8CATA 1AIPC 3KVWA 2JWSA 1GO5A 4P16A 1G3IA 2XFSA 4XGIA 2YFQA 3SAWA 4L78A 1FJGM 5L8RF 2KNVA 2KRUA 1D0KA 3W68A 4LF5M 2KZUA 5EP2A 1SXJE 3R8FA 1OFHA 1L2DA 3SASA 3IG5A 1QUTA 3FYDA 3W0FA 1DGHB 2X8AA 3K2LA 2EJSA 2FNAA 4I4LA 3FUXA 4MH0E 2MH8A 4Z6YA 3L26A 1G41A 2EKKA 2XLJA 3GPPA 1C1KA 3E9SA 1IBMM 1R2YA 4MGKE 2QCUA 1IN5A 2Z3XA 3GLGB 4M9XA 1GJSA 2DI0A 1WGNA 2JXNA 1SXJA 2DZLA 3U6QA
chains in the Genus database with same CATH topology
4A3VB 1X37A 7CATA 3SYLA 3SMPA 4JI6M 1D2NA 3A46A 4LF8M 5ITTA 3VKHA 4GMQA 1LV7A 4REZA 1K3XA 4I8OA 1QAQA 1IQPA 4GC5A 5EXTA 1E9SA 2DHRA 2O5RA 2XSZD 3L28A 3GLFB 3HHZA 3D8LA 4DV1M 4YHHM 2QPAA 1Q3BA 3SMSA 2OPFA 2XGNA 4QHSA 3TWMA 3LQQA 5ITXE 1Z5CA 3U6LA 4LZJA 3FUVA 1DGFA 2AHMA 2R4JA 3D8BA 4PDIA 1J09A 4AQYM 2R45A 2Z4SA 2C5RA 3W0LB 1XXHB 5LMUM 4CHTB 5FTJA 3M7GA 1NHWC 5C18A 3VDPA 4S12A 3B9PA 2JA2A 2KXEA 1KYIA 4BB9A 3J81S 1ORYB 3KP0E 1XMOM 4AG6A 1SXJB 3HU1A 3UMMA 4MB7A 3PVSA 4JV5M 3KXEC 3TWLA 3TE6A 3HJ8A 5EP3A 4LGMA 4G6ZA 3U6MA 2C9OA 2FFJA 2XSZA 5BPVA 4OW0A 5FSWA 5ITUA 2HKJA 3I51A 4B3RM 4FW9A 1XWIA 1L8QA 4II7A 3J80S 1N32M 1DGHA 4AW4A 3CF0A 4IBBA 4JI5M 4GRIA 2R46A 3C58A 4X65M 4LG2A 4FCWA 4OU7A 3SATA 3SAUA 4JXJA 3TPZA 3LVVA 2QBYA 4HL4A 2L6OA 3GLIB 5FTMA 2K47A 4DV5M 2UXCM 4PT5A 3R9XB 4DR4M 4TUWA 1HQYE 4DV3M 3T38A 1YSYA 3PXGA 3U61A 5JI3E 2KEBA 1ZQ9A 2Y21A 5F3WA 3U61B 3UZUA 1N77A 4AKHA 4LJ9A 4NXNM 2E5LM 4M9ZA 5BR8M 3U5ZA 1XNQM 3HGIA 3EIEA 3A98B 3GQ5A 3VKGA 1TGUA 1GVNA 3NWLA 4NRVA 1IN6A 2M60A 2CEAA 3FUWA 4X66M 3U6PA 3DFZA 2F5OA 3U6SA 4JI7M 1GKIA 3QWLA 4NL4H 4DV2M 1K82A 1MX0A 2QBYB 3AL0C 2W82A 3VDUA 4B7HA 5KO3A 3OTOM 4KLNA 3FD9A 4R3DA 4DV4M 3J2PB 4G4QA 1IN8A 2LWXA 4PD2A 3U6CA 4L4UA 1DO2A 2UXDM 2XH9A 3QAUA 2XZUA 2R65A 5ITQA 3DOAA 4DR1M 3FTCA 4DR6M 4OVZA 2LNHC 3HHXA 4BBAA 3KOYE 4D82A 2BNKA 4LF9M 5EP1A 5DNYA 2I7PA 2G5GX 5C1BA 1G8PA 1QVRA 2ZAMA 3HJSA 4NSRA 2C98A 1XC8A 5EXXA 1GLNA 1H6UA 2Y0TA 3TL4X 3T1YM 2YQZA 2J7OA 4IBDA 2V6ZM 1NSFA 1KFVA 1IBLM 3SYKA 2ZBKB 4JI1M 2VQFM 1ZAEA 4NRWA 2Y0QA 3SC3A 3GO8A 2CHGA 4FCTA 3ZC7B 3GLFA 5GKNA 3M6AA 4FCVA 1R7RA 4B7GA 3GPUA 3M0EA 4DV0M 2Y20A 2D7EA 3VK7A 3J7AS 3RE8A 4ZPXA 2XEPA 3UK6A 5KQ8A 5DYIA 4LRSA 4AI6A 1HNZM 4M0WA 2RKOA 3WHKA 3U60A 4Z8XA 2Z7JA 1L2BA 1J7KA 3FUUA 4B3TM 5LMNM 3GLHA 4OX9M 2NQ8C 3L29A 3HU3A 3AFHA 4QOZC 1WXQA 1IN7A 1GL7A 3L27A 4LJ5A 2BJVA 4AZFA 2XF3A 2ZANA 4M9SA 4MGIE 3A45A 2XZFA 2UXBM 3HHWA 5FTNA 1IBKM 1HNXM 5KPRA 4W5WA 4DV6M 2UUCM 2P5TA 3KDSE 2ZM6M 2KZSA 4B3MM 4JI4M 2DZOB 1IXSB 2BJWA 5EXPA 4GITA 2RGOA 4PDGA 4LJ7A 2X4AA 1QANA 4DUYM 3J7BA 3MK6A 3T15A 4DR5M 3CTWB 2CV2A 3DA1A 3PNVA 4G4NA 3NBIA 2QZ4A 3H4MA 5IWAM 3VK8A 1S3SA 3HWSA 3KFUG 2V1UA 2J7NA 4KO8A 4GHLA 2L7HA 1QAMA 4YY3M 3KS8A 1JR3D 3VFDA 3VLFB 2X49A 4L15A 3GLIA 2Q2EB 2FE8A 1TDHA 4MGHA 4IIWA 3GQ4A 2UU9M 4JYAM 1TH3A 1IY1A 1VDDA 3I4YA 2I7NA 4JN6A 4QOSA 4MGYE 1IM2A 1W5SA 5EXSA 2F4VM 5JI2E 4DR3M 1N36M 4IBCA 2DWNA 5FLXS 3KS4A 3WHLA 3U6OA 4LJ4A 3HJQA 4LFBM 3KSJA 3FTDA 1XNRM 3JAMS 3RGPA 2D7HA 3SBJA 2YNMD 3LQRA 1N34M 5DYGA 2HHHM 1SXJD 4FWDA 4I81A 5EQTA 5FTKA 5FTLA 4AKGA 4LJAA 3UJNA 4OVZB 1DO0A 4BLCA 3FTEA 3GLHB 4GHAA 2RGHA 2XFTA 4JI3M 1KSFX 4FVMA 3DZDA 1W5TA 4DUZM 3THGA 2DWZB 1N78A 1IXRC 3KP1E 4IBEA 4IJEA 4FWHA 4GC9A 4X64M 1TH4A 3CF2A 2KA6B 3GP1A 3ILKA 4LGYA 4EIWA 4I5SA 3K8ZA 2V1CA 1Z59A 3SHGB 3AOEC 3SFZA 4KHPM 1E94E 4GIPA 1UM8A 2G8LA 1QQWA 3FKEA 2D7GA 4B08A 3I4VA 3GRYA 1NHGC 3K1JA 4KODA 3GLGA 2F5NA 4GKKM 1NJFA 2R4EA 3KOWE 1XHBA 3SHFA 2ZAOA 3FTFA 1HQCA 2ERCA 3MHVC 1HT1E 4LCBA 3RFWA 5KPZA 4G4OA 4IJFA 3TWKA 1XXHA 1Q39A 3E4RA 5H37D 1NNJA 2OQ4A 2LXEA 3HHYA 2F5PA 1E32A 3ZH9B 2M5ZA 4JI2M 1SXJC 4IBJA 4JI8M 5IREB 1FNNA 3EIHA 3FUTA 3RGSA 4RF1A 1GL6A 2C9CA 2YR0A 4ITQA 3T1HM 4D81A 4NSOB 2UUAM 4G4RA 4DR2M 4XBOA 3SAVA 4LFCM 4D80A 2QENA 5EP4A 4DV7M 3GRRA 1NVMA 4M0DA 2CV1A 1IXZA 1R6BX 4JI0M 4LF4M 3JR4A 2L7IA 2VQEM 2HL7A 4FD2A 4LFAM 1NY6A 1L1TA 2DZNB 2DVWB 2F5SA 2DXIA 3JR5A 4LF6M 3LVWA 2QP9X 2R18A 4AG5A 3LMMA 2DWMA 1JQJC 5ITXA 3A42A 4HLQA 3GRVA 1PM5A 2CHVA 2CFOA 3ZCBB 4L8RC 5E26A 3K92A 5E6JA 4LY6A 1G4AE 2EUCA 2A5YB 2KRKA 3U6DA 1Q3CA 4GH9A 2EA0A 4WURA 4R7GA 3J27B 4GKJM 4L16A 2DWLA 3U5ZB 1Z5AA 1E9RA 1Z5BA 3U6EA 1OFIA 1DGGA 1N75A 3KW6A 2CE7A 1G59A 3AOGA 4RNAA 3HU2A 4IBFA 5ITRA 2C96A 2HCBA 3PNYA 1HNWM 4MM3B 2VIIA 4FWGA 5A2QS 2FOIC 4QHTA 4LZZA 4LJ8A 3BOSA 2H1RA 4B7FA 1HR0M 1HT2E 5IZ7D 3CF6E 4IBKA 1YUBA 2R62A 1MU5A 1OJLA 1T3TA 4NOOB 3AJIB 3TQSA 1PJIA 1IY2A 4PCZA 1NNUC 4CGYB 3AOEA 4IBGA 3KOXE 4QNMA 2F5QA 1IN4A 3GRUA 3GQ3A 4IBIA 4CISA 3FYCA 3MJ5A 3HKPA 1N33M 1NY5A 1QYRA 3Q8XA 5EJCA 4LRTA 1R2ZA 4AKIA 4QNRA 3L2AA 5KQDA 3L25A 3GPXA 4LF7M 2LH0A 3UGJA 2CHQA 4B3SM 1NJGA 2KW0A 4WW0A 1QZMA 4DR7M 1L1ZA 5IT9S 2UUBM 3PFIA 3AV0A 2CV0A 1I94M 2C99A 3KOZE 4LJ6A 5ITYA 3GPYA 1JR3A 3IG8A 1EE8A 4NXMM 2L09A 1XMQM 3U60B 1K3WA 2Z4RA 1L2CA 1Z6TA 1PJJA 2CUZA 1YE9A 3KSXA 1QAOA 1DGBA 1TH2A 1TDZA 5KPTA 2EO2A 4X62M 1J5EM 1I4WA 3SARA 4MGZE 3AKZA 4K0KM 1IY0A 4RF0A 8CATA 3KVWA 4P16A 1G3IA 2XFSA 4XGIA 2YFQA 3SAWA 4L78A 1FJGM 2KRUA 4LF5M 2KZUA 5EP2A 1SXJE 3R8FA 1OFHA 1L2DA 3SASA 3IG5A 3FYDA 3W0FA 1DGHB 2X8AA 3K2LA 2FNAA 4I4LA 3FUXA 4MH0E 4Z6YA 3L26A 1G41A 2XLJA 3GPPA 1C1KA 3E9SA 1IBMM 1R2YA 4MGKE 2QCUA 1IN5A 2Z3XA 3GLGB 4M9XA 1SXJA 3U6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA0 A;  3U6O A;  4LFB M;  4DV4 M;  1XNR M;  3JAM S;  3SBJ A;  4JI6 M;  3A46 A;  4LF8 M;  4GKJ M;  5ITT A;  4G4Q A;  1N34 M;  1Z5B A;  1Z5A A;  4PD2 A;  3U6E A;  1K3X A;  2HHH M;  3U6C A;  2UXD M;  2XZU A;  5ITQ A;  3DOA A;  4DV1 M;  4DR1 M;  4DR6 M;  4YHH M;  5ITR A;  1Q3B A;  2OPF A;  1HNW M;  4JI3 M;  4LF9 M;  3TWM A;  5A2Q S;  5ITX E;  4DUZ M;  1Z5C A;  3U6L A;  1XC8 A;  3T1Y M;  4PDI A;  4AQY M;  4X64 M;  1KFV A;  1IBL M;  2ZBK B;  4JI1 M;  5LMU M;  2VQF M;  1HR0 M;  4NRW A;  3GP1 A;  3GO8 A;  3U6D A;  1MU5 A;  1PJI A;  4PCZ A;  3J81 S;  1Z59 A;  1XMO M;  3GPU A;  4KHP M;  4MB7 A;  2F5Q A;  4JV5 M;  2F5N A;  3TWL A;  4DV0 M;  3GQ3 A;  3VK7 A;  4CIS A;  3J7A S;  4GKK M;  1N33 M;  3U6M A;  1HNZ M;  4G4O A;  3TWK A;  5ITU A;  1R2Z A;  1Q39 A;  2HKJ A;  1L2B A;  4B3R M;  3GPX A;  1NNJ A;  4LF7 M;  2OQ4 A;  3J80 S;  4B3T M;  4B3S M;  5LMN M;  4OX9 M;  1N32 M;  2F5P A;  4DR7 M;  1L1Z A;  4JI2 M;  4JI8 M;  5IT9 S;  2UUB M;  4JI5 M;  1I94 M;  3A45 A;  2XZF A;  2UXB M;  3C58 A;  4X65 M;  5ITY A;  1K82 A;  1IBK M;  3T1H M;  1HNX M;  4ITQ A;  3GPY A;  2UUA M;  3SAT A;  4G4R A;  4NXM M;  3SAU A;  1EE8 A;  4DR2 M;  1XMQ M;  4DV6 M;  2UUC M;  1K3W A;  3SAV A;  1L2C A;  4LFC M;  2ZM6 M;  4B3M M;  4JI4 M;  4DV7 M;  1PJJ A;  4DV5 M;  1TDZ A;  4PDG A;  1J5E M;  4X62 M;  3SAR A;  4DUY M;  2UXC M;  4K0K M;  4DR4 M;  4DR5 M;  4JI0 M;  4LF4 M;  3JR4 A;  4G4N A;  2VQE M;  5IWA M;  4DV3 M;  3VK8 A;  4LFA M;  1L1T A;  3SAW A;  1FJG M;  4LF5 M;  4YY3 M;  3SAS A;  1L2D A;  4NXN M;  2F5S A;  3W0F A;  3JR5 A;  2E5L M;  2Q2E B;  5BR8 M;  4LF6 M;  1TDH A;  1XNQ M;  3GQ4 A;  2UU9 M;  4JYA M;  3GQ5 A;  5ITX A;  3A42 A;  3GPP A;  4NRV A;  1IBM M;  1PM5 A;  1R2Y A;  4X66 M;  3U6P A;  2F5O A;  3U6S A;  2F4V M;  4JI7 M;  4DR3 M;  4DV2 M;  1N36 M;  5FLX S;  1MX0 A;  1Q3C A;  3U6Q A;  3OTO M; 
#chains in the Genus database with same CATH topology
 4A3V B;  1X37 A;  7CAT A;  3SYL A;  3SMP A;  4JI6 M;  1D2N A;  3A46 A;  4LF8 M;  5ITT A;  3VKH A;  4GMQ A;  2LVP C;  1LV7 A;  4REZ A;  4Y28 F;  1K3X A;  4I8O A;  1QAQ A;  1DV0 A;  1IQP A;  3F92 A;  4GC5 A;  5EXT A;  3B89 A;  1E9S A;  2DHR A;  1OAO C;  2O5R A;  2XSZ D;  3L28 A;  3GLF B;  3HHZ A;  3D8L A;  4DV1 M;  5DFL A;  4YHH M;  2QPA A;  3GLI E;  1Q3B A;  2HAK A;  3SMS A;  2OPF A;  2XGN A;  3K9O A;  4QHS A;  1ZMV A;  3TWM A;  3LQQ A;  5ITX E;  1PJS A;  1Z5C A;  3U6L A;  2KNZ A;  1NV8 A;  2ZTD A;  4LZJ A;  3FUV A;  1DGF A;  2AHM A;  2R4J A;  3D8B A;  2JY5 A;  1J09 A;  4PDI A;  2R45 A;  4AQY M;  2Z4S A;  1P3Q Q;  2C5R A;  3W0L B;  1XXH B;  5LMU M;  4CHT B;  2GQF A;  3M7G A;  5FTJ A;  1NHW C;  5C18 A;  3VDP A;  4S12 A;  3B74 A;  3B9P A;  2JA2 A;  2KXE A;  1KYI A;  4BB9 A;  3J81 S;  1ORY B;  1HJP A;  3KP0 E;  4AG6 A;  1XMO M;  1SXJ B;  3HU1 A;  3UMM A;  4MB7 A;  3PVS A;  4JV5 M;  3KXE C;  3TWL A;  3TE6 A;  3HJ8 A;  5EP3 A;  4LGM A;  1UFZ A;  4G6Z A;  1OIP A;  3U6M A;  2C9O A;  2FFJ A;  1WHC A;  2XSZ A;  3HY5 A;  4OW0 A;  5BPV A;  5FSW A;  5ITU A;  2HKJ A;  3I51 A;  2CP8 A;  4B3R M;  4FW9 A;  1XWI A;  1L8Q A;  1PJT A;  4II7 A;  3J80 S;  1N32 M;  1DGH A;  4AW4 A;  2H5X A;  3CF0 A;  2DAM A;  4IBB A;  4JI5 M;  4GRI A;  2DHY A;  2R46 A;  3C58 A;  4X65 M;  4LG2 A;  4FCW A;  4OU7 A;  3SAT A;  2G3Q A;  3SAU A;  4JXJ A;  3TPZ A;  3LVV A;  2QBY A;  4HL4 A;  2L6O A;  3GLI B;  5FTM A;  2K47 A;  1QDT A;  4DV5 M;  4Q7J A;  2UXC M;  4PT5 A;  3R9X B;  2VF7 A;  4DR4 M;  4TUW A;  1HQY E;  2K9D A;  4DV3 M;  3T38 A;  1YSY A;  3PXG A;  3U61 A;  5JI3 E;  2KEB A;  1ZQ9 A;  2Y21 A;  5F3W A;  3U61 B;  1WJ7 A;  3IHP A;  2Z8Y M;  3UZU A;  1N77 A;  4AKH A;  2L4F A;  4LJ9 A;  4NXN M;  1NO1 A;  2E5L M;  4M9Z A;  5BR8 M;  3U5Z A;  1XNQ M;  3HGI A;  3EIE A;  3A98 B;  3GQ5 A;  3VKG A;  1TGU A;  1GVN A;  1V92 A;  3NWL A;  4NRV A;  1IN6 A;  1WIV A;  2CEA A;  2M60 A;  2MJ5 B;  3FUW A;  3DFZ A;  4X66 M;  3U6P A;  2F5O A;  3U6S A;  4JI7 M;  1GKI A;  4F2L A;  3QWL A;  4NL4 H;  4DV2 M;  1K82 A;  1MX0 A;  2QBY B;  3AL0 C;  2W82 A;  3VDU A;  1MJG M;  4B7H A;  5KO3 A;  3C3D A;  2BWB A;  3OTO M;  4KLN A;  2JP7 A;  3FD9 A;  4R3D A;  4DV4 M;  2JY7 A;  3J2P B;  4G4Q A;  1IN8 A;  1CUK A;  2LWX A;  4PD2 A;  3U6C A;  4L4U A;  1DO2 A;  2UXD M;  2XH9 A;  3QAU A;  2XZU A;  2R65 A;  5ITQ A;  1C7Y A;  3DOA A;  4DR1 M;  3FTC A;  4DR6 M;  2LBC A;  4OVZ A;  2LNH C;  2R0I A;  3HHX A;  4BBA A;  3FRH A;  3KOY E;  2BNK A;  4D82 A;  5EP1 A;  4LF9 M;  5DNY A;  2I7P A;  2G5G X;  5C1B A;  1G8P A;  1QVR A;  2ZAM A;  2DNA A;  2K6B A;  3HJS A;  4NSR A;  2C98 A;  1VEJ A;  5EXX A;  1GLN A;  1H6U A;  2Y0T A;  3TL4 X;  3T1Y M;  1T6O A;  1XC8 A;  2YQZ A;  2J7O A;  2DAE A;  4IBD A;  2V6Z M;  1NSF A;  1KFV A;  1IBL M;  2MR9 A;  2ZBK B;  3SYK A;  4JI1 M;  3LW5 F;  2B3T A;  2VQF M;  1ZAE A;  2JUJ A;  2Y0Q A;  4NRW A;  3SC3 A;  1GJT A;  3GO8 A;  2CHG A;  4FCT A;  3ZC7 B;  1ZMW A;  4GEW A;  4WP2 A;  5GKN A;  3GLF A;  3M6A A;  4FCV A;  1R7R A;  4B7G A;  3GPU A;  2L4E A;  2RRU A;  3M0E A;  4DV0 M;  2Y20 A;  2D7E A;  3VK7 A;  3J7A S;  3RE8 A;  4ZPX A;  2XEP A;  3UK6 A;  5KQ8 A;  5DYI A;  4LRS A;  1TTE A;  4AI6 A;  1HNZ M;  4M0W A;  2RKO A;  1D0M A;  3WHK A;  3U60 A;  4Z8X A;  2Z7J A;  1EFU B;  1L2B A;  4HEO A;  1J7K A;  3FUU A;  2JY6 B;  3K9P A;  2O25 A;  4B3T M;  1JB0 F;  3GLH A;  5LMN M;  2NQ8 C;  3L29 A;  3HU3 A;  3AFH A;  4OX9 M;  4QOZ C;  1WXQ A;  1IN7 A;  1GL7 A;  3L27 A;  4LJ5 A;  2BJV A;  4AZF A;  2XF3 A;  2ZAN A;  3B7Q A;  4M9S A;  3A45 A;  4MGI E;  2XZF A;  2UXB M;  3HHW A;  5FTN A;  1IBK M;  2DKL A;  1HNX M;  5KPR A;  2N35 A;  1PRB A;  4W5W A;  4DV6 M;  2UUC M;  2P5T A;  3KDS E;  2DAK A;  2ZM6 M;  2KZS A;  4B3M M;  4JI4 M;  2DZO B;  2OOA A;  1V33 A;  1IXS B;  2BJW A;  5EXP A;  4GIT A;  2RGO A;  4PDG A;  1VDL A;  4LJ7 A;  3HZJ A;  2X4A A;  1QAN A;  4DUY M;  3E46 A;  3J7B A;  3Q8G A;  3MK6 A;  3T15 A;  4DR5 M;  3CTW B;  2LVA A;  2CV2 A;  1R4G A;  2LTU A;  3DA1 A;  3PNV A;  3B7Z A;  4G4N A;  3NBI A;  2QZ4 A;  3H4M A;  5IWA M;  3VK8 A;  1S3S A;  3HWS A;  3KFU G;  1G71 A;  2V1U A;  2J7N A;  4KO8 A;  4GHL A;  2L7H A;  1QAM A;  4YY3 M;  1VG5 A;  3KS8 A;  1JR3 D;  3VFD A;  3VLF B;  1NV9 A;  2X49 A;  4L15 A;  3GLI A;  2Q2E B;  2FE8 A;  2JZ0 A;  1TDH A;  4MGH A;  4IIW A;  3GQ4 A;  2UU9 M;  4JYA M;  1TH3 A;  1IY1 A;  1VDD A;  3I4Y A;  2I7N A;  4JN6 A;  4QOS A;  4MGY E;  1IM2 A;  1W5S A;  2JZ1 A;  2WSF F;  5EXS A;  2F4V M;  2WZJ A;  1D0L A;  5JI2 E;  4DR3 M;  2ZTC A;  2CWB A;  2QQ8 A;  4IBC A;  4CJ6 A;  1N36 M;  5FLX S;  2DWN A;  1RU3 A;  3KS4 A;  2MGW A;  3WHL A;  1OQY A;  3U6O A;  4LJ4 A;  3HJQ A;  2LHG A;  4LFB M;  3KSJ A;  3FTD A;  1XNR M;  3JAM S;  3RGP A;  2D7H A;  3SBJ A;  2YNM D;  2R44 A;  1OKS A;  3LQR A;  4R71 A;  1N34 M;  5DYG A;  2HHH M;  1SXJ D;  4FWD A;  4I81 A;  1JR3 E;  5EQT A;  5FTK A;  5FTL A;  1Y8G A;  4AKG A;  4LJA A;  4ANR A;  3UJN A;  4OVZ B;  1DO0 A;  1QZE A;  2QNJ A;  2KHH A;  4BLC A;  3FTE A;  3GLH B;  4GHA A;  3W67 A;  2RGH A;  2XFT A;  4JI3 M;  1KSF X;  4FVM A;  3DZD A;  1W5T A;  4DUZ M;  1VEG A;  3THG A;  1YLA A;  2QHO B;  1OTR A;  2DWZ B;  3BXW A;  1IXR C;  4KT0 F;  3KP1 E;  4IBE A;  3GLG E;  1N78 A;  4IJE A;  4FWH A;  1R5L A;  4GC9 A;  4X64 M;  1TH4 A;  2QSF X;  1VEK A;  3CF2 A;  1OIZ A;  2DEN A;  3E21 A;  2KA6 B;  3GP1 A;  2VDB B;  3ILK A;  2L2D A;  4LGY A;  4EIW A;  4I5S A;  3K8Z A;  2V1C A;  1Z59 A;  3SHG B;  3AOE C;  1SG9 A;  3SFZ A;  4KHP M;  1E94 E;  4GIP A;  1UM8 A;  2G8L A;  1QQW A;  3FKE A;  2D7G A;  4B08 A;  3I4V A;  3GRY A;  1NHG C;  3K1J A;  4KOD A;  3GLG A;  2F5N A;  2DAG A;  4GKK M;  1NJF A;  2R4E A;  3H4J A;  3KOW E;  1XHB A;  3SHF A;  2DAI A;  2ZAO A;  3FTF A;  1HQC A;  2ERC A;  3MHV C;  1HT1 E;  4LCB A;  3RFW A;  5KPZ A;  4G4O A;  4IJF A;  3TWK A;  1GAB A;  1XXH A;  1Q39 A;  3E4R A;  5H37 D;  1NNJ A;  2JY8 A;  2OQ4 A;  3QYB A;  1IFY A;  1TF0 B;  1LTM A;  2CRU A;  2LXE A;  3HHY A;  2F5P A;  1E32 A;  3ZH9 B;  2M5Z A;  4JI2 M;  1SXJ C;  4IBJ A;  4JI8 M;  2OO9 A;  1AUA A;  2R6F A;  4G3O A;  5IRE B;  1FNN A;  3EIH A;  3FUT A;  3RGS A;  4RF1 A;  1GL6 A;  2LVN C;  2C9C A;  2J5Y A;  2YR0 A;  3T6P A;  4P17 A;  2FH0 A;  3T1H M;  4ITQ A;  4D81 A;  4NSO B;  2UUA M;  4G4R A;  3IEC A;  4DR2 M;  4XBO A;  1EIJ A;  1WGL A;  3CGW A;  3SAV A;  4LFC M;  3GLH E;  4D80 A;  2QEN A;  5EP4 A;  4DV7 M;  3GRR A;  4NC6 A;  1NVM A;  4M0D A;  3BBZ A;  2CV1 A;  1IXZ A;  3MMP A;  1R6B X;  4JI0 M;  4LF4 M;  1F4I A;  3JR4 A;  3LCV B;  2L7I A;  2VQE M;  2HL7 A;  3I04 M;  4FD2 A;  1PGY A;  4LFA M;  1NY6 A;  1L1T A;  1WR1 B;  2DZN B;  2DVW B;  3FE3 A;  2F5S A;  2DXI A;  3JR5 A;  4LF6 M;  2WSC F;  3LVW A;  2QP9 X;  1IXS A;  2R18 A;  3LMM A;  4AG5 A;  2MRO B;  1JQJ C;  2DWM A;  2JNH A;  5ITX A;  3A42 A;  4HLQ A;  3GRV A;  1PM5 A;  4L6V 6;  2CHV A;  2CFO A;  3ZCB B;  4L8R C;  5E26 A;  3K92 A;  5E6J A;  4LY6 A;  1A5T A;  4DBG B;  1G4A E;  2EUC A;  2A5Y B;  2KRK A;  3U6D A;  1Q3C A;  1QDR A;  4GH9 A;  2EA0 A;  4WUR A;  4R7G A;  3I01 M;  3J27 B;  4XK8 F;  2GNO A;  4GKJ M;  4L16 A;  2DWL A;  2KDL A;  3U5Z B;  1Z5A A;  1E9R A;  1Z5B A;  3U6E A;  1OFI A;  2WSE F;  1DGG A;  1N75 A;  3KW6 A;  2CE7 A;  2KNA A;  1G59 A;  3AOG A;  4RNA A;  3HU2 A;  4IBF A;  5ITR A;  2C96 A;  2HCB A;  3PNY A;  2VF8 A;  4MM3 B;  1HNW M;  2VII A;  4UN2 B;  4FWG A;  5A2Q S;  1BVS A;  2FOI C;  1MN3 A;  4QHT A;  2BWE A;  4LZZ A;  4LJ8 A;  3BOS A;  2H1R A;  4B7F A;  2LHC A;  3LCU A;  1HT2 E;  1HR0 M;  5IZ7 D;  3CF6 E;  4IBK A;  1YUB A;  2R62 A;  1MU5 A;  1OJL A;  1T3T A;  2HWJ A;  4NOO B;  3AJI B;  3TQS A;  3ZQJ A;  1IY2 A;  4CIZ A;  1NNU C;  3V76 A;  4PCZ A;  1PJI A;  1Q02 A;  2LVO C;  3AOE A;  4CGY B;  4IBG A;  1PJQ A;  3KOX E;  4QNM A;  2APL A;  2F5Q A;  1QUS A;  1XXH E;  1IN4 A;  3GRU A;  3GQ3 A;  4IBI A;  4CIS A;  3FYC A;  1OAI A;  3HKP A;  3MJ5 A;  2K0B X;  1N33 M;  1NY5 A;  1QYR A;  3Q8X A;  3QYE A;  3FRI A;  5EJC A;  4LRT A;  1V34 A;  2FS1 A;  1R2Z A;  4AKI A;  4QNR A;  3L2A A;  5KQD A;  3L25 A;  3GPX A;  4LF7 M;  2LH0 A;  2EKF A;  3UGJ A;  2CHQ A;  3HX3 A;  4B3S M;  3C3E A;  1NJG A;  1ZV1 A;  2KW0 A;  4WW0 A;  1QZM A;  4DR7 M;  3B7N A;  1L1Z A;  1T43 A;  1XB2 B;  5IT9 S;  1TR8 A;  2UUB M;  3PFI A;  3AV0 A;  1ZMU A;  2CV0 A;  1I94 M;  2C99 A;  3KOZ E;  2OOB A;  3NBX X;  4RKU F;  4LJ6 A;  5ITY A;  1VQ1 A;  3GLF E;  3GPY A;  1JR3 A;  3IG8 A;  1EE8 A;  4NXM M;  2L09 A;  1XMQ M;  3U60 B;  1K3W A;  2Z4R A;  1L2C A;  1Z6T A;  1PJJ A;  2CUZ A;  1YE9 A;  3KSX A;  4F1I A;  3C9P A;  1QAO A;  1DGB A;  1TH2 A;  1TDZ A;  5KPT A;  2EO2 A;  4X62 M;  1J5E M;  1I4W A;  2LVQ D;  3SAR A;  4MGZ E;  3AKZ A;  4K0K M;  1IY0 A;  2O01 F;  4RF0 A;  8CAT A;  1AIP C;  3KVW A;  2JWS A;  1GO5 A;  4P16 A;  1G3I A;  2XFS A;  4XGI A;  2YFQ A;  3SAW A;  4L78 A;  1FJG M;  5L8R F;  2KNV A;  2KRU A;  1D0K A;  3W68 A;  4LF5 M;  2KZU A;  5EP2 A;  1SXJ E;  3R8F A;  1OFH A;  1L2D A;  3SAS A;  3IG5 A;  1QUT A;  3FYD A;  3W0F A;  1DGH B;  2X8A A;  3K2L A;  2EJS A;  2FNA A;  4I4L A;  3FUX A;  4MH0 E;  2MH8 A;  4Z6Y A;  3L26 A;  1G41 A;  2EKK A;  2XLJ A;  3GPP A;  1C1K A;  3E9S A;  1IBM M;  1R2Y A;  4MGK E;  2QCU A;  1IN5 A;  2Z3X A;  3GLG B;  4M9X A;  1GJS A;  2DI0 A;  1WGN A;  2JXN A;  1SXJ A;  2DZL A;  3U6Q A; 
#chains in the Genus database with same CATH homology
 4A3V B;  1X37 A;  7CAT A;  3SYL A;  3SMP A;  4JI6 M;  1D2N A;  3A46 A;  4LF8 M;  5ITT A;  3VKH A;  4GMQ A;  1LV7 A;  4REZ A;  1K3X A;  4I8O A;  1QAQ A;  1IQP A;  4GC5 A;  5EXT A;  1E9S A;  2DHR A;  2O5R A;  2XSZ D;  3L28 A;  3GLF B;  3HHZ A;  3D8L A;  4DV1 M;  4YHH M;  2QPA A;  1Q3B A;  3SMS A;  2OPF A;  2XGN A;  4QHS A;  3TWM A;  3LQQ A;  5ITX E;  1Z5C A;  3U6L A;  4LZJ A;  3FUV A;  1DGF A;  2AHM A;  2R4J A;  3D8B A;  4PDI A;  1J09 A;  4AQY M;  2R45 A;  2Z4S A;  2C5R A;  3W0L B;  1XXH B;  5LMU M;  4CHT B;  5FTJ A;  3M7G A;  1NHW C;  5C18 A;  3VDP A;  4S12 A;  3B9P A;  2JA2 A;  2KXE A;  1KYI A;  4BB9 A;  3J81 S;  1ORY B;  3KP0 E;  1XMO M;  4AG6 A;  1SXJ B;  3HU1 A;  3UMM A;  4MB7 A;  3PVS A;  4JV5 M;  3KXE C;  3TWL A;  3TE6 A;  3HJ8 A;  5EP3 A;  4LGM A;  4G6Z A;  3U6M A;  2C9O A;  2FFJ A;  2XSZ A;  5BPV A;  4OW0 A;  5FSW A;  5ITU A;  2HKJ A;  3I51 A;  4B3R M;  4FW9 A;  1XWI A;  1L8Q A;  4II7 A;  3J80 S;  1N32 M;  1DGH A;  4AW4 A;  3CF0 A;  4IBB A;  4JI5 M;  4GRI A;  2R46 A;  3C58 A;  4X65 M;  4LG2 A;  4FCW A;  4OU7 A;  3SAT A;  3SAU A;  4JXJ A;  3TPZ A;  3LVV A;  2QBY A;  4HL4 A;  2L6O A;  3GLI B;  5FTM A;  2K47 A;  4DV5 M;  2UXC M;  4PT5 A;  3R9X B;  4DR4 M;  4TUW A;  1HQY E;  4DV3 M;  3T38 A;  1YSY A;  3PXG A;  3U61 A;  5JI3 E;  2KEB A;  1ZQ9 A;  2Y21 A;  5F3W A;  3U61 B;  3UZU A;  1N77 A;  4AKH A;  4LJ9 A;  4NXN M;  2E5L M;  4M9Z A;  5BR8 M;  3U5Z A;  1XNQ M;  3HGI A;  3EIE A;  3A98 B;  3GQ5 A;  3VKG A;  1TGU A;  1GVN A;  3NWL A;  4NRV A;  1IN6 A;  2M60 A;  2CEA A;  3FUW A;  4X66 M;  3U6P A;  3DFZ A;  2F5O A;  3U6S A;  4JI7 M;  1GKI A;  3QWL A;  4NL4 H;  4DV2 M;  1K82 A;  1MX0 A;  2QBY B;  3AL0 C;  2W82 A;  3VDU A;  4B7H A;  5KO3 A;  3OTO M;  4KLN A;  3FD9 A;  4R3D A;  4DV4 M;  3J2P B;  4G4Q A;  1IN8 A;  2LWX A;  4PD2 A;  3U6C A;  4L4U A;  1DO2 A;  2UXD M;  2XH9 A;  3QAU A;  2XZU A;  2R65 A;  5ITQ A;  3DOA A;  4DR1 M;  3FTC A;  4DR6 M;  4OVZ A;  2LNH C;  3HHX A;  4BBA A;  3KOY E;  4D82 A;  2BNK A;  4LF9 M;  5EP1 A;  5DNY A;  2I7P A;  2G5G X;  5C1B A;  1G8P A;  1QVR A;  2ZAM A;  3HJS A;  4NSR A;  2C98 A;  1XC8 A;  5EXX A;  1GLN A;  1H6U A;  2Y0T A;  3TL4 X;  3T1Y M;  2YQZ A;  2J7O A;  4IBD A;  2V6Z M;  1NSF A;  1KFV A;  1IBL M;  3SYK A;  2ZBK B;  4JI1 M;  2VQF M;  1ZAE A;  4NRW A;  2Y0Q A;  3SC3 A;  3GO8 A;  2CHG A;  4FCT A;  3ZC7 B;  3GLF A;  5GKN A;  3M6A A;  4FCV A;  1R7R A;  4B7G A;  3GPU A;  3M0E A;  4DV0 M;  2Y20 A;  2D7E A;  3VK7 A;  3J7A S;  3RE8 A;  4ZPX A;  2XEP A;  3UK6 A;  5KQ8 A;  5DYI A;  4LRS A;  4AI6 A;  1HNZ M;  4M0W A;  2RKO A;  3WHK A;  3U60 A;  4Z8X A;  2Z7J A;  1L2B A;  1J7K A;  3FUU A;  4B3T M;  5LMN M;  3GLH A;  4OX9 M;  2NQ8 C;  3L29 A;  3HU3 A;  3AFH A;  4QOZ C;  1WXQ A;  1IN7 A;  1GL7 A;  3L27 A;  4LJ5 A;  2BJV A;  4AZF A;  2XF3 A;  2ZAN A;  4M9S A;  4MGI E;  3A45 A;  2XZF A;  2UXB M;  3HHW A;  5FTN A;  1IBK M;  1HNX M;  5KPR A;  4W5W A;  4DV6 M;  2UUC M;  2P5T A;  3KDS E;  2ZM6 M;  2KZS A;  4B3M M;  4JI4 M;  2DZO B;  1IXS B;  2BJW A;  5EXP A;  4GIT A;  2RGO A;  4PDG A;  4LJ7 A;  2X4A A;  1QAN A;  4DUY M;  3J7B A;  3MK6 A;  3T15 A;  4DR5 M;  3CTW B;  2CV2 A;  3DA1 A;  3PNV A;  4G4N A;  3NBI A;  2QZ4 A;  3H4M A;  5IWA M;  3VK8 A;  1S3S A;  3HWS A;  3KFU G;  2V1U A;  2J7N A;  4KO8 A;  4GHL A;  2L7H A;  1QAM A;  4YY3 M;  3KS8 A;  1JR3 D;  3VFD A;  3VLF B;  2X49 A;  4L15 A;  3GLI A;  2Q2E B;  2FE8 A;  1TDH A;  4MGH A;  4IIW A;  3GQ4 A;  2UU9 M;  4JYA M;  1TH3 A;  1IY1 A;  1VDD A;  3I4Y A;  2I7N A;  4JN6 A;  4QOS A;  4MGY E;  1IM2 A;  1W5S A;  5EXS A;  2F4V M;  5JI2 E;  4DR3 M;  1N36 M;  4IBC A;  2DWN A;  5FLX S;  3KS4 A;  3WHL A;  3U6O A;  4LJ4 A;  3HJQ A;  4LFB M;  3KSJ A;  3FTD A;  1XNR M;  3JAM S;  3RGP A;  2D7H A;  3SBJ A;  2YNM D;  3LQR A;  1N34 M;  5DYG A;  2HHH M;  1SXJ D;  4FWD A;  4I81 A;  5EQT A;  5FTK A;  5FTL A;  4AKG A;  4LJA A;  3UJN A;  4OVZ B;  1DO0 A;  4BLC A;  3FTE A;  3GLH B;  4GHA A;  2RGH A;  2XFT A;  4JI3 M;  1KSF X;  4FVM A;  3DZD A;  1W5T A;  4DUZ M;  3THG A;  2DWZ B;  1N78 A;  1IXR C;  3KP1 E;  4IBE A;  4IJE A;  4FWH A;  4GC9 A;  4X64 M;  1TH4 A;  3CF2 A;  2KA6 B;  3GP1 A;  3ILK A;  4LGY A;  4EIW A;  4I5S A;  3K8Z A;  2V1C A;  1Z59 A;  3SHG B;  3AOE C;  3SFZ A;  4KHP M;  1E94 E;  4GIP A;  1UM8 A;  2G8L A;  1QQW A;  3FKE A;  2D7G A;  4B08 A;  3I4V A;  3GRY A;  1NHG C;  3K1J A;  4KOD A;  3GLG A;  2F5N A;  4GKK M;  1NJF A;  2R4E A;  3KOW E;  1XHB A;  3SHF A;  2ZAO A;  3FTF A;  1HQC A;  2ERC A;  3MHV C;  1HT1 E;  4LCB A;  3RFW A;  5KPZ A;  4G4O A;  4IJF A;  3TWK A;  1XXH A;  1Q39 A;  3E4R A;  5H37 D;  1NNJ A;  2OQ4 A;  2LXE A;  3HHY A;  2F5P A;  1E32 A;  3ZH9 B;  2M5Z A;  4JI2 M;  1SXJ C;  4IBJ A;  4JI8 M;  5IRE B;  1FNN A;  3EIH A;  3FUT A;  3RGS A;  4RF1 A;  1GL6 A;  2C9C A;  2YR0 A;  4ITQ A;  3T1H M;  4D81 A;  4NSO B;  2UUA M;  4G4R A;  4DR2 M;  4XBO A;  3SAV A;  4LFC M;  4D80 A;  2QEN A;  5EP4 A;  4DV7 M;  3GRR A;  1NVM A;  4M0D A;  2CV1 A;  1IXZ A;  1R6B X;  4JI0 M;  4LF4 M;  3JR4 A;  2L7I A;  2VQE M;  2HL7 A;  4FD2 A;  4LFA M;  1NY6 A;  1L1T A;  2DZN B;  2DVW B;  2F5S A;  2DXI A;  3JR5 A;  4LF6 M;  3LVW A;  2QP9 X;  2R18 A;  4AG5 A;  3LMM A;  2DWM A;  1JQJ C;  5ITX A;  3A42 A;  4HLQ A;  3GRV A;  1PM5 A;  2CHV A;  2CFO A;  3ZCB B;  4L8R C;  5E26 A;  3K92 A;  5E6J A;  4LY6 A;  1G4A E;  2EUC A;  2A5Y B;  2KRK A;  3U6D A;  1Q3C A;  4GH9 A;  2EA0 A;  4WUR A;  4R7G A;  3J27 B;  4GKJ M;  4L16 A;  2DWL A;  3U5Z B;  1Z5A A;  1E9R A;  1Z5B A;  3U6E A;  1OFI A;  1DGG A;  1N75 A;  3KW6 A;  2CE7 A;  1G59 A;  3AOG A;  4RNA A;  3HU2 A;  4IBF A;  5ITR A;  2C96 A;  2HCB A;  3PNY A;  1HNW M;  4MM3 B;  2VII A;  4FWG A;  5A2Q S;  2FOI C;  4QHT A;  4LZZ A;  4LJ8 A;  3BOS A;  2H1R A;  4B7F A;  1HR0 M;  1HT2 E;  5IZ7 D;  3CF6 E;  4IBK A;  1YUB A;  2R62 A;  1MU5 A;  1OJL A;  1T3T A;  4NOO B;  3AJI B;  3TQS A;  1PJI A;  1IY2 A;  4PCZ A;  1NNU C;  4CGY B;  3AOE A;  4IBG A;  3KOX E;  4QNM A;  2F5Q A;  1IN4 A;  3GRU A;  3GQ3 A;  4IBI A;  4CIS A;  3FYC A;  3MJ5 A;  3HKP A;  1N33 M;  1NY5 A;  1QYR A;  3Q8X A;  5EJC A;  4LRT A;  1R2Z A;  4AKI A;  4QNR A;  3L2A A;  5KQD A;  3L25 A;  3GPX A;  4LF7 M;  2LH0 A;  3UGJ A;  2CHQ A;  4B3S M;  1NJG A;  2KW0 A;  4WW0 A;  1QZM A;  4DR7 M;  1L1Z A;  5IT9 S;  2UUB M;  3PFI A;  3AV0 A;  2CV0 A;  1I94 M;  2C99 A;  3KOZ E;  4LJ6 A;  5ITY A;  3GPY A;  1JR3 A;  3IG8 A;  1EE8 A;  4NXM M;  2L09 A;  1XMQ M;  3U60 B;  1K3W A;  2Z4R A;  1L2C A;  1Z6T A;  1PJJ A;  2CUZ A;  1YE9 A;  3KSX A;  1QAO A;  1DGB A;  1TH2 A;  1TDZ A;  5KPT A;  2EO2 A;  4X62 M;  1J5E M;  1I4W A;  3SAR A;  4MGZ E;  3AKZ A;  4K0K M;  1IY0 A;  4RF0 A;  8CAT A;  3KVW A;  4P16 A;  1G3I A;  2XFS A;  4XGI A;  2YFQ A;  3SAW A;  4L78 A;  1FJG M;  2KRU A;  4LF5 M;  2KZU A;  5EP2 A;  1SXJ E;  3R8F A;  1OFH A;  1L2D A;  3SAS A;  3IG5 A;  3FYD A;  3W0F A;  1DGH B;  2X8A A;  3K2L A;  2FNA A;  4I4L A;  3FUX A;  4MH0 E;  4Z6Y A;  3L26 A;  1G41 A;  2XLJ A;  3GPP A;  1C1K A;  3E9S A;  1IBM M;  1R2Y A;  4MGK E;  2QCU A;  1IN5 A;  2Z3X A;  3GLG B;  4M9X A;  1SXJ A;  3U6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...