4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
3JR5A 4DUYM 5BR8M 2UXDM 1Q39A 3U6QA 5ITXE 4LFAM 2HHHM 3U6OA 5ITQA 2VQFM 3U6CA 2UUAM 2VQEM 4JI7M 2UUBM 5ITRA 5IWAM 1Q3BA 2F5PA 3GQ5A 4LF6M 3GQ3A 5ITXA 4YY3M 4JI3M 1KFVA 1N32M 1R2YA 4PD2A 1K3XA 1XC8A 4PDGA 1K3WA 2F5SA 4DV6M 3T1HM 4DV0M 4X65M 2HKJA 2F5NA 4JI6M 4GKJM 4LF7M 1TDZA 3U6MA 4ITQA 2UUCM 3SAUA 5IT9S 2F4VM 1Z59A 4B3RM 3TWMA 4B3TM 1IBKM 3C58A 4LF4M 3T1YM 1TDHA 3GQ4A 2ZM6M 3VK8A 3GO8A 1N34M 3JAMS 3GPYA 3JR4A 3VK7A 4DR7M 4GKKM 2XZFA 3SATA 2EA0A 3OTOM 2Q2EB 3SARA 3U6EA 3A46A 5LMUM 1IBLM 3GP1A 4G4NA 3GPXA 4PDIA 4PCZA 1XMQM 1L2CA 4DR1M 4OX9M 2F5OA 1EE8A 4DV1M 3U6LA 1HNWM 4DV4M 3U6SA 4K0KM 1HNXM 1MU5A 1NNJA 1PJIA 3GPPA 4NXNM 5FLXS 4DV2M 4KHPM 4DR5M 3SBJA 1PJJA 2E5LM 3SAWA 4MB7A 1HNZM 4DR6M 1MX0A 4LFBM 5A2QS 4JI8M 4G4OA 4DR3M 4JI5M 4DR4M 1Q3CA 4LF5M 3TWKA 1N36M 3J7AS 3A45A 1N33M 4NRVA 3SASA 3J81S 2XZUA 1L2BA 4LF9M 4AQYM 4DV5M 1I94M 5LMNM 5ITYA 1XNRM 4DV3M 1L2DA 2OQ4A 3SAVA 1L1ZA 3U6PA 1R2ZA 4JV5M 2UU9M 1IBMM 4X62M 4JI1M 1XNQM 1Z5BA 4X64M 4JYAM 3DOAA 4CISA 3A42A 1K82A 2UXCM 3GPUA 5ITTA 4B3SM 4JI4M 2F5QA 4NRWA 1Z5CA 4LFCM 1Z5AA 4DUZM 4DV7M 2OPFA 4LF8M 4JI0M 3TWLA 1XMOM 1J5EM 2ZBKB 4B3MM 1FJGM 3W0FA 4NXMM 4YHHM 4X66M 4G4RA 4DR2M 1HR0M 5ITUA 4G4QA 1PM5A 3J80S 4JI2M 3U6DA 1L1TA 2UXBM
chains in the Genus database with same CATH superfamily
3JR5A 4DUYM 4GHAA 4GRIA 4AI6A 5ITXE 2MR9A 2VQFM 2EUCA 1SG9A 5DFLA 2CUZA 4QNRA 3HJQA 1ZMVA 2JUJA 4B7FA 2WZJA 2DENA 5BPVA 2GNOA 2DAMA 1VQ1A 3PNYA 2DWZB 4IBGA 1G4AE 2J7NA 3GQ3A 2DNAA 2QZ4A 2WSCF 4PD2A 1J09A 4LGMA 2X49A 3BBZA 1VDLA 4LJ4A 2AHMA 4I8OA 4ANRA 8CATA 4XGIA 3UGJA 2QBYB 4F1IA 2RGHA 1OAOC 3HY5A 5FTMA 3UZUA 5F3WA 3B89A 1R4GA 1XWIA 4AW4A 1E32A 2MGWA 1GJTA 3K92A 2I7PA 1JR3D 1Z59A 3E21A 1DGGA 2OOBA 4B3RM 2LVQD 4REZA 4AG5A 2P5TA 3KOYE 3RGPA 3R9XB 4D80A 3GQ4A 4MM3B 2BWBA 2R4EA 3C3DA 3GO8A 3JAMS 4GKKM 2C9CA 1N77A 1T6OA 2LHGA 4B7GA 2HCBA 1PJQA 2R62A 2CV0A 1UFZA 4BLCA 5LMUM 1XXHE 3VLFB 5FTKA 3KFUG 2DWMA 1IM2A 1TH3A 1L2CA 1P3QQ 4B08A 3SYLA 5KPZA 3U6LA 4RKUF 1HNWM 1JR3A 1XHBA 3B7ZA 1E9RA 4LRTA 2KZUA 4DV4M 1FNNA 1RU3A 2CRUA 1DGHA 2WSFF 1GL6A 4IJFA 3GPPA 4NXNM 4KHPM 1PJJA 2K9DA 3UK6A 2DAEA 3HJ8A 1D0LA 3H4JA 4MB7A 1MX0A 5A2QS 3K9PA 4LZJA 5C18A 3GLFB 3EIHA 1AUAA 4L4UA 3TWKA 4CJ6A 2WSEF 3A45A 2LH0A 4LJAA 3B7QA 4NRVA 3VDUA 3J81S 3GRUA 2O5RA 2CHQA 2KRKA 2LHCA 1L2BA 4LF9M 1YUBA 2J5YA 2YQZA 5EXPA 2DZLA 3NBIA 2EKKA 3W68A 4NL4H 2OQ4A 3HX3A 4BB9A 2BWEA 3THGA 3L2AA 4KO8A 3AJIB 4CIZA 1L1ZA 1OIPA 5JI2E 4MGIE 4JV5M 1PRBA 1HQCA 1Z5BA 4LZZA 4Z8XA 2Y21A 4CISA 1D2NA 2RKOA 1K82A 3TE6A 1V92A 1IXRC 4JI4M 4NRWA 2F5QA 1N75A 4LFCM 1Z5AA 4M0DA 5DYIA 3AFHA 1IN8A 2XF3A 2Z4RA 2CV1A 4LF8M 5E26A 1J5EM 2ZANA 2EKFA 1OQYA 2Z8YM 4NC6A 4QNMA 3L25A 1T43A 3RE8A 1IFYA 1GL7A 3IG5A 4X66M 4GC9A 5ITUA 3H4MA 1GABA 3L28A 3HGIA 3E4RA 4AZFA 2XGNA 1QUTA 3E9SA 3AOEA 4IBJA 2UXDM 3T38A 3U6QA 2LVPC 1YE9A 3CF6E 4G6ZA 2DKLA 4KODA 5FSWA 2YFQA 1YSYA 4LGYA 2UUAM 3K1JA 2VQEM 2DXIA 2D7EA 1Z6TA 2KNVA 4MGKE 2FE8A 2KDLA 3C9PA 5IWAM 4TUWA 5EP2A 1JR3E 3M6AA 3GRRA 1ORYB 4HLQA 2JP7A 1GLNA 2L4FA 4RF1A 5EXTA 4LF6M 1SXJD 1T3TA 4Y28F 2OO9A 2BJWA 3D8LA 1KFVA 3HU1A 2JA2A 1D0KA 5EXXA 1XC8A 4PDGA 2QHOB 1QQWA 2F5SA 3DFZA 1PJTA 3AOEC 2LNHC 3HHXA 1PGYA 2HKJA 2VIIA 4GKJM 1X37A 2X4AA 2JY7A 3V76A 4ITQA 2VF8A 2UUCM 1MN3A 5EP4A 5IT9S 3TWMA 4B3TM 4IJEA 4IBIA 1IBKM 1QZEA 3IECA 2EJSA 3KW6A 2Z3XA 2DHRA 3KSXA 1A5TA 1SXJA 3HKPA 3VK7A 5IREB 3I01M 4FWDA 3HWSA 3DA1A 3SATA 1WGLA 5EXSA 2C98A 1VEKA 1ZQ9A 4R71A 3AKZA 1IXSB 3A46A 3GP1A 4G4NA 1BVSA 2DVWB 3GPXA 4PDIA 4PCZA 5JI3E 3C3EA 2LWXA 3LCVB 4RF0A 3K9OA 1E94E 4DR1M 2F5OA 4LJ6A 3QYBA 3FRIA 4L16A 1C7YA 3MHVC 1XXHB 2KRUA 1N78A 2ZTDA 4JN6A 3LVVA 5KPRA 1CUKA 1QYRA 2CHGA 3VKHA 1TH2A 2C5RA 1PJIA 1SXJC 4DV2M 1D0MA 4R7GA 2V1CA 4DR5M 4LJ9A 3FUUA 3SBJA 1V34A 3TQSA 4I81A 4II7A 4LFBM 1HNZM 1NJGA 3HHZA 4JI5M 3W0LB 1Q3CA 4LF5M 3SHFA 4IBDA 1NHWC 2APLA 2FNAA 3KSJA 4W5WA 3FE3A 2QQ8A 2YR0A 3GLFA 1N33M 3F92A 1GVNA 2L09A 3SASA 2NQ8C 3L26A 4ZPXA 4DV5M 4LG2A 3LQRA 3Q8GA 4XK8F 1NJFA 5ITYA 3SYKA 1R5LA 4DV3M 1GO5A 3KOZE 2XFTA 3LQQA 2R18A 3U6PA 7CATA 2CV2A 3KS4A 4X62M 3ILKA 4JYAM 4X64M 5KQ8A 5GKNA 3DOAA 3U60B 1NY5A 2VF7A 3A42A 1IY2A 4JXJA 2UXCM 3HU3A 3KVWA 4B3SM 1IQPA 5EP1A 1HT2E 1Z5CA 2JWSA 1TR8A 3GLIA 2CP8A 4DV7M 3KXEC 2XH9A 3AL0C 4M9XA 4G3OA 5EJCA 1NHGC 1QAOA 4GIPA 1KSFX 3LCUA 3GRYA 4YHHM 3ZH9B 4G4RA 3GLHA 4G4QA 1SXJE 2LTUA 3J80S 3NBXX 4FD2A 2K6BA 1HJPA 2CWBA 4HEOA 3GLGA 4AG6A 1EIJA 3AOGA 3HU2A 4GH9A 4IBCA 2RRUA 2H5XA 4D81A 3KS8A 2CEAA 3U5ZA 2KNZA 2FS1A 2O01F 4LFAM 3U6OA 5ITQA 3KP0E 3B74A 5EQTA 5ITRA 1ZV1A 4GMQA 3PFIA 1HQYE 4P17A 3GQ5A 4L8RC 3I4YA 3RGSA 1JQJC 2XFSA 4LJ8A 2FH0A 4QHSA 3VDPA 3AV0A 2Y0TA 3MJ5A 3FTEA 4MGHA 5ITXA 4L78A 4JI3M 4YY3M 1N32M 4KT0F 2DHYA 2DAGA 4PT5A 2ZAMA 3U61A 1K3WA 1OTRA 2ERCA 4DV6M 3T1HM 4DV0M 3B9PA 3FUTA 4X65M 2F5NA 4JI6M 2M60A 1TDZA 4IBBA 3I4VA 4OVZB 4Q7JA 2N35A 3SAUA 1W5TA 2V6ZM 2R6FA 5FTJA 2F4VM 1QDTA 1IN4A 1L8QA 1LTMA 2JZ1A 3T1YM 2DWNA 2ZM6M 1F4IA 3VK8A 1HT1E 4IIWA 1N34M 3GPYA 2LVOC 3JR4A 1OJLA 2EA0A 2EO2A 3TL4X 3U6EA 4AKGA 2Z7JA 2K47A 3J2PB 2OOAA 2DAKA 2CFOA 3FYCA 1XMQM 3QYEA 3UMMA 4OX9M 1EE8A 4DV1M 3GLIE 2R65A 1DV0A 2QBYA 2JY5A 2QPAA 4MGZE 4WURA 3HHYA 4K0KM 1MU5A 2CHVA 1GKIA 1H6UA 2C9OA 2KZSA 3KP1E 5EP3A 2E5LM 3CGWA 3GLHE 3MMPA 3B7NA 4GEWA 3GLGE 3EIEA 1I4WA 2JY6B 2VDBB 2R45A 1OFIA 3NWLA 4LCBA 5H37D 3L29A 2KXEA 1NNUC 1G8PA 4DR4M 3DZDA 4LRSA 5C1BA 2B3TA 4F2LA 2Z4SA 2V1UA 4LY6A 1QUSA 3IG8A 1DO2A 1E9SA 4M0WA 2Y0QA 2XZUA 1DGFA 4AQYM 1G59A 1OAIA 3A98B 1V33A 3FTCA 1XNRM 3SAVA 1TGUA 2HWJA 1DGBA 2UU9M 1IN6A 4JI1M 2DI0A 4FWHA 1TTEA 1QANA 4FVMA 4MH0E 1XNQM 3ZCBB 2QCUA 1NSFA 2FOIC 1WHCA 2XSZD 3U60A 3FD9A 3KOXE 4DUZM 1NVMA 2J7OA 3VKGA 1G3IA 2R46A 3HJSA 5IZ7D 3VFDA 1XMOM 4AKIA 1Q02A 4FW9A 3BXWA 3W0FA 3UJNA 2QENA 2BJVA 1OKSA 1VEJA 1W5SA 1ZMUA 1WJ7A 2XEPA 1PM5A 2MJ5B 4IBEA 1DO0A 3J7BA 3U6DA 4S12A 3KOWE 4I4LA 3WHKA 2XLJA 3I04M 2UXBM 4XBOA 1R6BX 4CGYB 5BR8M 1NY6A 1Q39A 2DZNB 1QAQA 1SXJB 3FUVA 2HHHM 4RNAA 1PJSA 1LV7A 3SFZA 2R4JA 2R0IA 3U6CA 2JY8A 2LVAA 1G41A 2XSZA 3L27A 3M0EA 3LVWA 1WXQA 2D7GA 3PVSA 4OU7A 4JI7M 4NSRA 2UUBM 1IN5A 5FTNA 1AIPC 1Q3BA 2F5PA 3D8BA 2C99A 4LJ7A 2M5ZA 4MGYE 1J7KA 2GQFA 3FKEA 3Q8XA 1R2YA 2RGOA 1K3XA 1Y8GA 1MJGM 2MROB 1OFHA 2L4EA 3PXGA 4QHTA 2JXNA 2DAIA 1IY1A 3QWLA 2JZ0A 4LF7M 3M7GA 3U6MA 4IBFA 3FRHA 4D82A 3T15A 2KA6B 4GHLA 3SMSA 2FFJA 2H1RA 3HHWA 3C58A 4OVZA 3RFWA 4LF4M 5KQDA 1TDHA 2KHHA 1NV8A 2KNAA 4I5SA 4KLNA 4CHTB 2BNKA 4M9ZA 4DR7M 2Y20A 2L2DA 2O25A 2L7IA 1R7RA 2XZFA 4FCVA 3MK6A 4R3DA 3T6PA 3OTOM 2Q2EB 3SARA 3FTDA 4AKHA 3KDSE 1IBLM 1NO1A 2KW0A 3SC3A 4M9SA 3WHLA 2I7NA 2R44A 1VDDA 4DR6M 2QSFX 4FCTA 4GITA 4A3VB 1DGHB 1QDRA 4FWGA 2K0BX 3ZC7B 4QOZC 3CTWB 2HAKA 3U6SA 1HNXM 3R8FA 3LMMA 1NNJA 3E46A 1IN7A 1WGNA 3HZJA 4NSOB 1TF0B 2LVNC 5FLXS 3GLIB 3FTFA 1NV9A 1C1KA 3CF2A 3IHPA 3GLFE 3SAWA 2L7HA 2L6OA 2QNJA 4FCWA 2LXEA 1JB0F 3LW5F 4JI8M 4UN2B 1VEGA 4G4OA 4DR3M 5FTLA 1EFUB 3GLHB 3FUWA 4EIWA 5KO3A 1N36M 3J7AS 2W82A 4L6V6 3SMPA 1VG5A 5DYGA 3GLGB 1KYIA 4WP2A 3I51A 1GJSA 2YNMD 1S3SA 2KEBA 1WIVA 3W67A 5L8RF 3U5ZB 4Z6YA 2A5YB 1IXSA 2G8LA 3FYDA 3J27B 1IY0A 1I94M 5LMNM 4B7HA 4WW0A 1L2DA 2MH8A 3GRVA 5DNYA 1WR1B 1QAMA 1G71A 1ZAEA 3CF0A 1QZMA 4IBKA 4DBGB 1R2ZA 4LJ5A 3BOSA 2HL7A 3QAUA 4QOSA 3TPZA 4BBAA 1IBMM 4NOOB 1XXHA 1YLAA 4OW0A 2ZAOA 1UM8A 4P16A 1QVRA 4HL4A 5KPTA 5ITTA 3GPUA 3K8ZA 3ZQJA 3U61B 3PNVA 2OPFA 1TH4A 4L15A 4JI0M 3TWLA 2ZBKB 2X8AA 4B3MM 1FJGM 2D7HA 4NXMM 2G3QA 2C96A 2DWLA 1XB2B 4DR2M 3K2LA 5E6JA 1HR0M 1OIZA 4JI2M 3FUXA 2JNHA 2CE7A 4GC5A 2DZOB 3SHGB 2ZTCA 1L1TA 2LBCA 2G5GX 1IXZA 2QP9X 1ZMWA
chains in the Genus database with same CATH topology
3JR5A 4DUYM 4GHAA 4GRIA 4AI6A 5ITXE 2VQFM 2EUCA 2CUZA 4QNRA 3HJQA 4B7FA 5BPVA 3PNYA 2DWZB 4IBGA 1G4AE 2J7NA 3GQ3A 2QZ4A 4PD2A 1J09A 4LGMA 2X49A 4LJ4A 8CATA 2QBYB 2AHMA 4I8OA 3UGJA 4XGIA 2RGHA 5FTMA 3UZUA 5F3WA 1XWIA 4AW4A 1E32A 3K92A 2I7PA 1JR3D 1Z59A 4B3RM 1DGGA 4REZA 4AG5A 2P5TA 3KOYE 3RGPA 3R9XB 4D80A 3GQ4A 4MM3B 2R4EA 3GO8A 3JAMS 4GKKM 2C9CA 1N77A 4B7GA 2HCBA 2R62A 2CV0A 5LMUM 4BLCA 3VLFB 5FTKA 3KFUG 2DWMA 1IM2A 1TH3A 1L2CA 4B08A 3SYLA 5KPZA 3U6LA 1HNWM 1JR3A 1XHBA 1E9RA 4LRTA 2KZUA 4DV4M 1FNNA 1DGHA 1GL6A 4IJFA 3GPPA 4NXNM 4KHPM 1PJJA 3UK6A 3HJ8A 4MB7A 1MX0A 5A2QS 4LZJA 5C18A 3GLFB 3EIHA 4L4UA 3TWKA 3A45A 2LH0A 4LJAA 4NRVA 3VDUA 3J81S 3GRUA 2O5RA 2CHQA 2KRKA 1L2BA 4LF9M 1YUBA 2YQZA 5EXPA 3NBIA 4NL4H 2OQ4A 4BB9A 1L1ZA 3THGA 3L2AA 4KO8A 3AJIB 4JV5M 5JI2E 4MGIE 1HQCA 1Z5BA 4LZZA 4Z8XA 2Y21A 4CISA 1D2NA 2RKOA 1K82A 3TE6A 1IXRC 4JI4M 4NRWA 2F5QA 1N75A 4LFCM 1Z5AA 4M0DA 5DYIA 3AFHA 1IN8A 2XF3A 2Z4RA 2CV1A 4LF8M 5E26A 1J5EM 2ZANA 4QNMA 3L25A 3RE8A 1GL7A 3IG5A 4X66M 4GC9A 5ITUA 3H4MA 3L28A 3HGIA 3E4RA 4AZFA 2XGNA 3E9SA 3AOEA 4IBJA 2UXDM 3T38A 3U6QA 4KODA 1YE9A 3CF6E 4G6ZA 5FSWA 2YFQA 1YSYA 4LGYA 2UUAM 3K1JA 2VQEM 2DXIA 2D7EA 1Z6TA 4MGKE 2FE8A 5IWAM 4TUWA 5EP2A 3M6AA 3GRRA 1ORYB 4HLQA 1GLNA 4LF6M 4RF1A 5EXTA 1SXJD 1T3TA 2BJWA 3D8LA 1KFVA 3HU1A 2JA2A 5EXXA 1XC8A 4PDGA 1QQWA 2F5SA 3DFZA 3AOEC 2LNHC 3HHXA 2VIIA 2HKJA 4GKJM 1X37A 2X4AA 4ITQA 2UUCM 5EP4A 5IT9S 3TWMA 4B3TM 4IJEA 4IBIA 1IBKM 3KW6A 2Z3XA 2DHRA 3KSXA 1SXJA 3HKPA 3VK7A 5IREB 4FWDA 3HWSA 3DA1A 3SATA 5EXSA 2C98A 1ZQ9A 3A46A 3AKZA 1IXSB 3GP1A 4G4NA 2DVWB 3GPXA 4PDIA 4PCZA 5JI3E 2LWXA 4DR1M 4RF0A 1E94E 2F5OA 4LJ6A 4L16A 3MHVC 1XXHB 2KRUA 1N78A 4JN6A 3LVVA 5KPRA 1QYRA 2CHGA 3VKHA 1TH2A 2C5RA 1PJIA 1SXJC 4DV2M 4R7GA 2V1CA 4DR5M 4LJ9A 3FUUA 3SBJA 3TQSA 4I81A 4II7A 4LFBM 1HNZM 1NJGA 4JI5M 3W0LB 1Q3CA 4LF5M 3SHFA 4IBDA 1NHWC 2FNAA 3KSJA 4W5WA 2YR0A 3GLFA 1N33M 1GVNA 2L09A 3SASA 2NQ8C 3L26A 4ZPXA 4DV5M 4LG2A 3LQRA 1NJFA 5ITYA 3SYKA 4DV3M 3KOZE 2XFTA 3LQQA 2R18A 3U6PA 7CATA 2CV2A 3KS4A 4X62M 3ILKA 4JYAM 4X64M 5KQ8A 5GKNA 3DOAA 3U60B 1NY5A 3A42A 1IY2A 4JXJA 2UXCM 3HU3A 3KVWA 4B3SM 1IQPA 5EP1A 1HT2E 1Z5CA 3GLIA 4DV7M 3KXEC 2XH9A 3AL0C 4M9XA 5EJCA 1NHGC 1QAOA 4GIPA 1KSFX 3GRYA 4YHHM 3ZH9B 4G4RA 3GLHA 4G4QA 1SXJE 3J80S 4FD2A 3GLGA 4AG6A 3AOGA 3HU2A 4GH9A 4IBCA 4D81A 3KS8A 2CEAA 3U5ZA 4LFAM 3U6OA 5ITQA 3KP0E 5EQTA 5ITRA 4GMQA 3PFIA 1HQYE 3GQ5A 4L8RC 3I4YA 3RGSA 1JQJC 2XFSA 4LJ8A 3VDPA 4QHSA 3AV0A 2Y0TA 3MJ5A 3FTEA 4MGHA 5ITXA 4L78A 4JI3M 4YY3M 1N32M 4PT5A 2ZAMA 3U61A 1K3WA 2ERCA 4DV6M 3T1HM 4DV0M 3B9PA 3FUTA 4X65M 2F5NA 4JI6M 2M60A 1TDZA 4IBBA 3I4VA 4OVZB 3SAUA 1W5TA 2V6ZM 5FTJA 2F4VM 1IN4A 1L8QA 3T1YM 2DWNA 2ZM6M 3VK8A 1HT1E 4IIWA 1N34M 3GPYA 3JR4A 1OJLA 2EA0A 2EO2A 3TL4X 3U6EA 2Z7JA 2K47A 3J2PB 2CFOA 3FYCA 1XMQM 3UMMA 4OX9M 1EE8A 4DV1M 2R65A 2QBYA 2QPAA 4MGZE 4WURA 3HHYA 4K0KM 1MU5A 2CHVA 1GKIA 1H6UA 2C9OA 2KZSA 3KP1E 5EP3A 2E5LM 3EIEA 1I4WA 3NWLA 5H37D 2R45A 1OFIA 4LCBA 4DR6M 3L29A 2KXEA 1NNUC 1G8PA 4DR4M 3DZDA 4LRSA 5C1BA 2Z4SA 2V1UA 4LY6A 3IG8A 1DO2A 1E9SA 4M0WA 2Y0QA 2XZUA 1DGFA 4AQYM 1G59A 3A98B 3FTCA 1XNRM 3SAVA 1TGUA 1DGBA 2UU9M 1IN6A 4JI1M 4FWHA 4FVMA 1XNQM 1QANA 4MH0E 3ZCBB 2QCUA 1NSFA 2FOIC 2XSZD 3U60A 3FD9A 3KOXE 4DUZM 1NVMA 2J7OA 3VKGA 1G3IA 2R46A 3HJSA 5IZ7D 3VFDA 1XMOM 4AKIA 4FW9A 3W0FA 3UJNA 2QENA 2BJVA 1W5SA 2XEPA 1PM5A 4IBEA 1DO0A 3J7BA 3U6DA 4S12A 3KOWE 4I4LA 3WHKA 2XLJA 2UXBM 4XBOA 1R6BX 4CGYB 5BR8M 1NY6A 1Q39A 2DZNB 1QAQA 1SXJB 3FUVA 2HHHM 4RNAA 1LV7A 3SFZA 2R4JA 3U6CA 3HHZA 2XSZA 1G41A 3L27A 3M0EA 3PVSA 3LVWA 1WXQA 2D7GA 4OU7A 4JI7M 4AKGA 4NSRA 2UUBM 1IN5A 5FTNA 1Q3BA 2F5PA 3D8BA 2C99A 4LJ7A 2M5ZA 4MGYE 1J7KA 3FKEA 3Q8XA 1R2YA 2RGOA 1K3XA 1OFHA 3PXGA 4QHTA 1IY1A 3QWLA 4LF7M 3M7GA 3U6MA 4IBFA 4D82A 3T15A 2KA6B 4GHLA 3SMSA 2FFJA 2H1RA 3HHWA 3C58A 4OVZA 3RFWA 4LF4M 5KQDA 1TDHA 4I5SA 4KLNA 4CHTB 2BNKA 4M9ZA 4DR7M 2Y20A 2L7IA 1R7RA 2XZFA 4FCVA 3MK6A 4R3DA 3OTOM 2Q2EB 3SARA 3FTDA 4AKHA 3KDSE 1IBLM 2KW0A 3SC3A 4M9SA 3WHLA 2I7NA 1VDDA 4FCTA 4GITA 4A3VB 1DGHB 4FWGA 3ZC7B 4QOZC 3CTWB 3U6SA 1HNXM 3R8FA 3LMMA 1NNJA 1IN7A 4NSOB 5FLXS 3GLIB 3FTFA 1C1KA 3CF2A 3SAWA 2L7HA 2L6OA 4FCWA 2LXEA 4JI8M 4G4OA 4DR3M 5FTLA 3GLHB 3FUWA 4EIWA 5KO3A 1N36M 3J7AS 2W82A 3SMPA 5DYGA 3GLGB 1KYIA 3I51A 2YNMD 1S3SA 2KEBA 3U5ZB 2A5YB 2G8LA 3FYDA 3J27B 1IY0A 1I94M 5LMNM 4B7HA 4WW0A 1L2DA 3GRVA 5DNYA 1ZAEA 1QAMA 3CF0A 1QZMA 4IBKA 1R2ZA 4LJ5A 3BOSA 2HL7A 3QAUA 4QOSA 3TPZA 4BBAA 1IBMM 4NOOB 1XXHA 4OW0A 2ZAOA 1UM8A 4P16A 1QVRA 4HL4A 5KPTA 5ITTA 3GPUA 3K8ZA 3U61B 3PNVA 2OPFA 1TH4A 4L15A 4JI0M 3TWLA 2ZBKB 2X8AA 4B3MM 1FJGM 2D7HA 4NXMM 2C96A 2DWLA 4DR2M 3K2LA 5E6JA 1HR0M 4JI2M 3FUXA 4GC5A 2CE7A 3SHGB 2DZOB 1L1TA 2G5GX 1IXZA 2QP9X 4Z6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR5 A;  4DUY M;  5BR8 M;  2UXD M;  1Q39 A;  3U6Q A;  5ITX E;  4LFA M;  2HHH M;  3U6O A;  5ITQ A;  2VQF M;  3U6C A;  2UUA M;  2VQE M;  4JI7 M;  2UUB M;  5ITR A;  5IWA M;  1Q3B A;  2F5P A;  3GQ5 A;  4LF6 M;  3GQ3 A;  5ITX A;  4YY3 M;  4JI3 M;  1KFV A;  1N32 M;  1R2Y A;  4PD2 A;  1K3X A;  1XC8 A;  4PDG A;  1K3W A;  2F5S A;  4DV6 M;  3T1H M;  4DV0 M;  4X65 M;  2HKJ A;  2F5N A;  4JI6 M;  4GKJ M;  4LF7 M;  1TDZ A;  3U6M A;  4ITQ A;  2UUC M;  3SAU A;  5IT9 S;  2F4V M;  1Z59 A;  4B3R M;  3TWM A;  4B3T M;  1IBK M;  3C58 A;  4LF4 M;  3T1Y M;  1TDH A;  3GQ4 A;  2ZM6 M;  3VK8 A;  3GO8 A;  1N34 M;  3JAM S;  3GPY A;  3JR4 A;  3VK7 A;  4DR7 M;  4GKK M;  2XZF A;  3SAT A;  2EA0 A;  3OTO M;  2Q2E B;  3SAR A;  3U6E A;  3A46 A;  5LMU M;  1IBL M;  3GP1 A;  4G4N A;  3GPX A;  4PDI A;  4PCZ A;  1XMQ M;  1L2C A;  4DR1 M;  4OX9 M;  2F5O A;  1EE8 A;  4DV1 M;  3U6L A;  1HNW M;  4DV4 M;  3U6S A;  4K0K M;  1HNX M;  1MU5 A;  1NNJ A;  1PJI A;  3GPP A;  4NXN M;  5FLX S;  4DV2 M;  4KHP M;  4DR5 M;  3SBJ A;  1PJJ A;  2E5L M;  3SAW A;  4MB7 A;  1HNZ M;  4DR6 M;  1MX0 A;  4LFB M;  5A2Q S;  4JI8 M;  4G4O A;  4DR3 M;  4JI5 M;  4DR4 M;  1Q3C A;  4LF5 M;  3TWK A;  1N36 M;  3J7A S;  3A45 A;  1N33 M;  4NRV A;  3SAS A;  3J81 S;  2XZU A;  1L2B A;  4LF9 M;  4AQY M;  4DV5 M;  1I94 M;  5LMN M;  5ITY A;  1XNR M;  4DV3 M;  1L2D A;  2OQ4 A;  3SAV A;  1L1Z A;  3U6P A;  1R2Z A;  4JV5 M;  2UU9 M;  1IBM M;  4X62 M;  4JI1 M;  1XNQ M;  1Z5B A;  4X64 M;  4JYA M;  3DOA A;  4CIS A;  3A42 A;  1K82 A;  2UXC M;  3GPU A;  5ITT A;  4B3S M;  4JI4 M;  2F5Q A;  4NRW A;  1Z5C A;  4LFC M;  1Z5A A;  4DUZ M;  4DV7 M;  2OPF A;  4LF8 M;  4JI0 M;  3TWL A;  1XMO M;  1J5E M;  2ZBK B;  4B3M M;  1FJG M;  3W0F A;  4NXM M;  4YHH M;  4X66 M;  4G4R A;  4DR2 M;  1HR0 M;  5ITU A;  4G4Q A;  1PM5 A;  3J80 S;  4JI2 M;  3U6D A;  1L1T A;  2UXB M; 
#chains in the Genus database with same CATH topology
 3JR5 A;  4DUY M;  4GHA A;  4GRI A;  4AI6 A;  5ITX E;  2MR9 A;  2VQF M;  2EUC A;  1SG9 A;  5DFL A;  2CUZ A;  4QNR A;  3HJQ A;  1ZMV A;  2JUJ A;  4B7F A;  2WZJ A;  2DEN A;  5BPV A;  2GNO A;  2DAM A;  1VQ1 A;  3PNY A;  2DWZ B;  4IBG A;  1G4A E;  2J7N A;  3GQ3 A;  2DNA A;  2QZ4 A;  2WSC F;  4PD2 A;  1J09 A;  4LGM A;  2X49 A;  3BBZ A;  1VDL A;  4LJ4 A;  2AHM A;  4I8O A;  4ANR A;  8CAT A;  4XGI A;  3UGJ A;  2QBY B;  4F1I A;  2RGH A;  1OAO C;  3HY5 A;  5FTM A;  3UZU A;  5F3W A;  3B89 A;  1R4G A;  1XWI A;  4AW4 A;  1E32 A;  2MGW A;  1GJT A;  3K92 A;  2I7P A;  1JR3 D;  1Z59 A;  3E21 A;  1DGG A;  2OOB A;  4B3R M;  2LVQ D;  4REZ A;  4AG5 A;  2P5T A;  3KOY E;  3RGP A;  3R9X B;  4D80 A;  3GQ4 A;  4MM3 B;  2BWB A;  2R4E A;  3C3D A;  3GO8 A;  3JAM S;  4GKK M;  2C9C A;  1N77 A;  1T6O A;  2LHG A;  4B7G A;  2HCB A;  1PJQ A;  2R62 A;  2CV0 A;  1UFZ A;  4BLC A;  5LMU M;  1XXH E;  3VLF B;  5FTK A;  3KFU G;  2DWM A;  1IM2 A;  1TH3 A;  1L2C A;  1P3Q Q;  4B08 A;  3SYL A;  5KPZ A;  3U6L A;  4RKU F;  1HNW M;  1JR3 A;  1XHB A;  3B7Z A;  1E9R A;  4LRT A;  2KZU A;  4DV4 M;  1FNN A;  1RU3 A;  2CRU A;  1DGH A;  2WSF F;  1GL6 A;  4IJF A;  3GPP A;  4NXN M;  4KHP M;  1PJJ A;  2K9D A;  3UK6 A;  2DAE A;  3HJ8 A;  1D0L A;  3H4J A;  4MB7 A;  1MX0 A;  5A2Q S;  3K9P A;  4LZJ A;  5C18 A;  3GLF B;  3EIH A;  1AUA A;  4L4U A;  3TWK A;  4CJ6 A;  2WSE F;  3A45 A;  2LH0 A;  4LJA A;  3B7Q A;  4NRV A;  3VDU A;  3J81 S;  3GRU A;  2O5R A;  2CHQ A;  2KRK A;  2LHC A;  1L2B A;  4LF9 M;  1YUB A;  2J5Y A;  2YQZ A;  5EXP A;  2DZL A;  3NBI A;  2EKK A;  3W68 A;  4NL4 H;  2OQ4 A;  3HX3 A;  4BB9 A;  2BWE A;  3THG A;  3L2A A;  4KO8 A;  3AJI B;  4CIZ A;  1L1Z A;  1OIP A;  5JI2 E;  4MGI E;  4JV5 M;  1PRB A;  1HQC A;  1Z5B A;  4LZZ A;  4Z8X A;  2Y21 A;  4CIS A;  1D2N A;  2RKO A;  1K82 A;  3TE6 A;  1V92 A;  1IXR C;  4JI4 M;  4NRW A;  2F5Q A;  1N75 A;  4LFC M;  1Z5A A;  4M0D A;  5DYI A;  3AFH A;  1IN8 A;  2XF3 A;  2Z4R A;  2CV1 A;  4LF8 M;  5E26 A;  1J5E M;  2ZAN A;  2EKF A;  1OQY A;  2Z8Y M;  4NC6 A;  4QNM A;  3L25 A;  1T43 A;  3RE8 A;  1IFY A;  1GL7 A;  3IG5 A;  4X66 M;  4GC9 A;  5ITU A;  3H4M A;  1GAB A;  3L28 A;  3HGI A;  3E4R A;  4AZF A;  2XGN A;  1QUT A;  3E9S A;  3AOE A;  4IBJ A;  2UXD M;  3T38 A;  3U6Q A;  2LVP C;  1YE9 A;  3CF6 E;  4G6Z A;  2DKL A;  4KOD A;  5FSW A;  2YFQ A;  1YSY A;  4LGY A;  2UUA M;  3K1J A;  2VQE M;  2DXI A;  2D7E A;  1Z6T A;  2KNV A;  4MGK E;  2FE8 A;  2KDL A;  3C9P A;  5IWA M;  4TUW A;  5EP2 A;  1JR3 E;  3M6A A;  3GRR A;  1ORY B;  4HLQ A;  2JP7 A;  1GLN A;  2L4F A;  4RF1 A;  5EXT A;  4LF6 M;  1SXJ D;  1T3T A;  4Y28 F;  2OO9 A;  2BJW A;  3D8L A;  1KFV A;  3HU1 A;  2JA2 A;  1D0K A;  5EXX A;  1XC8 A;  4PDG A;  2QHO B;  1QQW A;  2F5S A;  3DFZ A;  1PJT A;  3AOE C;  2LNH C;  3HHX A;  1PGY A;  2HKJ A;  2VII A;  4GKJ M;  1X37 A;  2X4A A;  2JY7 A;  3V76 A;  4ITQ A;  2VF8 A;  2UUC M;  1MN3 A;  5EP4 A;  5IT9 S;  3TWM A;  4B3T M;  4IJE A;  4IBI A;  1IBK M;  1QZE A;  3IEC A;  2EJS A;  3KW6 A;  2Z3X A;  2DHR A;  3KSX A;  1A5T A;  1SXJ A;  3HKP A;  3VK7 A;  5IRE B;  3I01 M;  4FWD A;  3HWS A;  3DA1 A;  3SAT A;  1WGL A;  5EXS A;  2C98 A;  1VEK A;  1ZQ9 A;  4R71 A;  3AKZ A;  1IXS B;  3A46 A;  3GP1 A;  4G4N A;  1BVS A;  2DVW B;  3GPX A;  4PDI A;  4PCZ A;  5JI3 E;  3C3E A;  2LWX A;  3LCV B;  4RF0 A;  3K9O A;  1E94 E;  4DR1 M;  2F5O A;  4LJ6 A;  3QYB A;  3FRI A;  4L16 A;  1C7Y A;  3MHV C;  1XXH B;  2KRU A;  1N78 A;  2ZTD A;  4JN6 A;  3LVV A;  5KPR A;  1CUK A;  1QYR A;  2CHG A;  3VKH A;  1TH2 A;  2C5R A;  1PJI A;  1SXJ C;  4DV2 M;  1D0M A;  4R7G A;  2V1C A;  4DR5 M;  4LJ9 A;  3FUU A;  3SBJ A;  1V34 A;  3TQS A;  4I81 A;  4II7 A;  4LFB M;  1HNZ M;  1NJG A;  3HHZ A;  4JI5 M;  3W0L B;  1Q3C A;  4LF5 M;  3SHF A;  4IBD A;  1NHW C;  2APL A;  2FNA A;  3KSJ A;  4W5W A;  3FE3 A;  2QQ8 A;  2YR0 A;  3GLF A;  1N33 M;  3F92 A;  1GVN A;  2L09 A;  3SAS A;  2NQ8 C;  3L26 A;  4ZPX A;  4DV5 M;  4LG2 A;  3LQR A;  3Q8G A;  4XK8 F;  1NJF A;  5ITY A;  3SYK A;  1R5L A;  4DV3 M;  1GO5 A;  3KOZ E;  2XFT A;  3LQQ A;  2R18 A;  3U6P A;  7CAT A;  2CV2 A;  3KS4 A;  4X62 M;  3ILK A;  4JYA M;  4X64 M;  5KQ8 A;  5GKN A;  3DOA A;  3U60 B;  1NY5 A;  2VF7 A;  3A42 A;  1IY2 A;  4JXJ A;  2UXC M;  3HU3 A;  3KVW A;  4B3S M;  1IQP A;  5EP1 A;  1HT2 E;  1Z5C A;  2JWS A;  1TR8 A;  3GLI A;  2CP8 A;  4DV7 M;  3KXE C;  2XH9 A;  3AL0 C;  4M9X A;  4G3O A;  5EJC A;  1NHG C;  1QAO A;  4GIP A;  1KSF X;  3LCU A;  3GRY A;  4YHH M;  3ZH9 B;  4G4R A;  3GLH A;  4G4Q A;  1SXJ E;  2LTU A;  3J80 S;  3NBX X;  4FD2 A;  2K6B A;  1HJP A;  2CWB A;  4HEO A;  3GLG A;  4AG6 A;  1EIJ A;  3AOG A;  3HU2 A;  4GH9 A;  4IBC A;  2RRU A;  2H5X A;  4D81 A;  3KS8 A;  2CEA A;  3U5Z A;  2KNZ A;  2FS1 A;  2O01 F;  4LFA M;  3U6O A;  5ITQ A;  3KP0 E;  3B74 A;  5EQT A;  5ITR A;  1ZV1 A;  4GMQ A;  3PFI A;  1HQY E;  4P17 A;  3GQ5 A;  4L8R C;  3I4Y A;  3RGS A;  1JQJ C;  2XFS A;  4LJ8 A;  2FH0 A;  4QHS A;  3VDP A;  3AV0 A;  2Y0T A;  3MJ5 A;  3FTE A;  4MGH A;  5ITX A;  4L78 A;  4JI3 M;  4YY3 M;  1N32 M;  4KT0 F;  2DHY A;  2DAG A;  4PT5 A;  2ZAM A;  3U61 A;  1K3W A;  1OTR A;  2ERC A;  4DV6 M;  3T1H M;  4DV0 M;  3B9P A;  3FUT A;  4X65 M;  2F5N A;  4JI6 M;  2M60 A;  1TDZ A;  4IBB A;  3I4V A;  4OVZ B;  4Q7J A;  2N35 A;  3SAU A;  1W5T A;  2V6Z M;  2R6F A;  5FTJ A;  2F4V M;  1QDT A;  1IN4 A;  1L8Q A;  1LTM A;  2JZ1 A;  3T1Y M;  2DWN A;  2ZM6 M;  1F4I A;  3VK8 A;  1HT1 E;  4IIW A;  1N34 M;  3GPY A;  2LVO C;  3JR4 A;  1OJL A;  2EA0 A;  2EO2 A;  3TL4 X;  3U6E A;  4AKG A;  2Z7J A;  2K47 A;  3J2P B;  2OOA A;  2DAK A;  2CFO A;  3FYC A;  1XMQ M;  3QYE A;  3UMM A;  4OX9 M;  1EE8 A;  4DV1 M;  3GLI E;  2R65 A;  1DV0 A;  2QBY A;  2JY5 A;  2QPA A;  4MGZ E;  4WUR A;  3HHY A;  4K0K M;  1MU5 A;  2CHV A;  1GKI A;  1H6U A;  2C9O A;  2KZS A;  3KP1 E;  5EP3 A;  2E5L M;  3CGW A;  3GLH E;  3MMP A;  3B7N A;  4GEW A;  3GLG E;  3EIE A;  1I4W A;  2JY6 B;  2VDB B;  2R45 A;  1OFI A;  3NWL A;  4LCB A;  5H37 D;  3L29 A;  2KXE A;  1NNU C;  1G8P A;  4DR4 M;  3DZD A;  4LRS A;  5C1B A;  2B3T A;  4F2L A;  2Z4S A;  2V1U A;  4LY6 A;  1QUS A;  3IG8 A;  1DO2 A;  1E9S A;  4M0W A;  2Y0Q A;  2XZU A;  1DGF A;  4AQY M;  1G59 A;  1OAI A;  3A98 B;  1V33 A;  3FTC A;  1XNR M;  3SAV A;  1TGU A;  2HWJ A;  1DGB A;  2UU9 M;  1IN6 A;  4JI1 M;  2DI0 A;  4FWH A;  1TTE A;  1QAN A;  4FVM A;  4MH0 E;  1XNQ M;  3ZCB B;  2QCU A;  1NSF A;  2FOI C;  1WHC A;  2XSZ D;  3U60 A;  3FD9 A;  3KOX E;  4DUZ M;  1NVM A;  2J7O A;  3VKG A;  1G3I A;  2R46 A;  3HJS A;  5IZ7 D;  3VFD A;  1XMO M;  4AKI A;  1Q02 A;  4FW9 A;  3BXW A;  3W0F A;  3UJN A;  2QEN A;  2BJV A;  1OKS A;  1VEJ A;  1W5S A;  1ZMU A;  1WJ7 A;  2XEP A;  1PM5 A;  2MJ5 B;  4IBE A;  1DO0 A;  3J7B A;  3U6D A;  4S12 A;  3KOW E;  4I4L A;  3WHK A;  2XLJ A;  3I04 M;  2UXB M;  4XBO A;  1R6B X;  4CGY B;  5BR8 M;  1NY6 A;  1Q39 A;  2DZN B;  1QAQ A;  1SXJ B;  3FUV A;  2HHH M;  4RNA A;  1PJS A;  1LV7 A;  3SFZ A;  2R4J A;  2R0I A;  3U6C A;  2JY8 A;  2LVA A;  1G41 A;  2XSZ A;  3L27 A;  3M0E A;  3LVW A;  1WXQ A;  2D7G A;  3PVS A;  4OU7 A;  4JI7 M;  4NSR A;  2UUB M;  1IN5 A;  5FTN A;  1AIP C;  1Q3B A;  2F5P A;  3D8B A;  2C99 A;  4LJ7 A;  2M5Z A;  4MGY E;  1J7K A;  2GQF A;  3FKE A;  3Q8X A;  1R2Y A;  2RGO A;  1K3X A;  1Y8G A;  1MJG M;  2MRO B;  1OFH A;  2L4E A;  3PXG A;  4QHT A;  2JXN A;  2DAI A;  1IY1 A;  3QWL A;  2JZ0 A;  4LF7 M;  3M7G A;  3U6M A;  4IBF A;  3FRH A;  4D82 A;  3T15 A;  2KA6 B;  4GHL A;  3SMS A;  2FFJ A;  2H1R A;  3HHW A;  3C58 A;  4OVZ A;  3RFW A;  4LF4 M;  5KQD A;  1TDH A;  2KHH A;  1NV8 A;  2KNA A;  4I5S A;  4KLN A;  4CHT B;  2BNK A;  4M9Z A;  4DR7 M;  2Y20 A;  2L2D A;  2O25 A;  2L7I A;  1R7R A;  2XZF A;  4FCV A;  3MK6 A;  4R3D A;  3T6P A;  3OTO M;  2Q2E B;  3SAR A;  3FTD A;  4AKH A;  3KDS E;  1IBL M;  1NO1 A;  2KW0 A;  3SC3 A;  4M9S A;  3WHL A;  2I7N A;  2R44 A;  1VDD A;  4DR6 M;  2QSF X;  4FCT A;  4GIT A;  4A3V B;  1DGH B;  1QDR A;  4FWG A;  2K0B X;  3ZC7 B;  4QOZ C;  3CTW B;  2HAK A;  3U6S A;  1HNX M;  3R8F A;  3LMM A;  1NNJ A;  3E46 A;  1IN7 A;  1WGN A;  3HZJ A;  4NSO B;  1TF0 B;  2LVN C;  5FLX S;  3GLI B;  3FTF A;  1NV9 A;  1C1K A;  3CF2 A;  3IHP A;  3GLF E;  3SAW A;  2L7H A;  2L6O A;  2QNJ A;  4FCW A;  2LXE A;  1JB0 F;  3LW5 F;  4JI8 M;  4UN2 B;  1VEG A;  4G4O A;  4DR3 M;  5FTL A;  1EFU B;  3GLH B;  3FUW A;  4EIW A;  5KO3 A;  1N36 M;  3J7A S;  2W82 A;  4L6V 6;  3SMP A;  1VG5 A;  5DYG A;  3GLG B;  1KYI A;  4WP2 A;  3I51 A;  1GJS A;  2YNM D;  1S3S A;  2KEB A;  1WIV A;  3W67 A;  5L8R F;  3U5Z B;  4Z6Y A;  2A5Y B;  1IXS A;  2G8L A;  3FYD A;  3J27 B;  1IY0 A;  1I94 M;  5LMN M;  4B7H A;  4WW0 A;  1L2D A;  2MH8 A;  3GRV A;  5DNY A;  1WR1 B;  1QAM A;  1G71 A;  1ZAE A;  3CF0 A;  1QZM A;  4IBK A;  4DBG B;  1R2Z A;  4LJ5 A;  3BOS A;  2HL7 A;  3QAU A;  4QOS A;  3TPZ A;  4BBA A;  1IBM M;  4NOO B;  1XXH A;  1YLA A;  4OW0 A;  2ZAO A;  1UM8 A;  4P16 A;  1QVR A;  4HL4 A;  5KPT A;  5ITT A;  3GPU A;  3K8Z A;  3ZQJ A;  3U61 B;  3PNV A;  2OPF A;  1TH4 A;  4L15 A;  4JI0 M;  3TWL A;  2ZBK B;  2X8A A;  4B3M M;  1FJG M;  2D7H A;  4NXM M;  2G3Q A;  2C96 A;  2DWL A;  1XB2 B;  4DR2 M;  3K2L A;  5E6J A;  1HR0 M;  1OIZ A;  4JI2 M;  3FUX A;  2JNH A;  2CE7 A;  4GC5 A;  2DZO B;  3SHG B;  2ZTC A;  1L1T A;  2LBC A;  2G5G X;  1IXZ A;  2QP9 X;  1ZMW A; 
#chains in the Genus database with same CATH homology
 3JR5 A;  4DUY M;  4GHA A;  4GRI A;  4AI6 A;  5ITX E;  2VQF M;  2EUC A;  2CUZ A;  4QNR A;  3HJQ A;  4B7F A;  5BPV A;  3PNY A;  2DWZ B;  4IBG A;  1G4A E;  2J7N A;  3GQ3 A;  2QZ4 A;  4PD2 A;  1J09 A;  4LGM A;  2X49 A;  4LJ4 A;  8CAT A;  2QBY B;  2AHM A;  4I8O A;  3UGJ A;  4XGI A;  2RGH A;  5FTM A;  3UZU A;  5F3W A;  1XWI A;  4AW4 A;  1E32 A;  3K92 A;  2I7P A;  1JR3 D;  1Z59 A;  4B3R M;  1DGG A;  4REZ A;  4AG5 A;  2P5T A;  3KOY E;  3RGP A;  3R9X B;  4D80 A;  3GQ4 A;  4MM3 B;  2R4E A;  3GO8 A;  3JAM S;  4GKK M;  2C9C A;  1N77 A;  4B7G A;  2HCB A;  2R62 A;  2CV0 A;  5LMU M;  4BLC A;  3VLF B;  5FTK A;  3KFU G;  2DWM A;  1IM2 A;  1TH3 A;  1L2C A;  4B08 A;  3SYL A;  5KPZ A;  3U6L A;  1HNW M;  1JR3 A;  1XHB A;  1E9R A;  4LRT A;  2KZU A;  4DV4 M;  1FNN A;  1DGH A;  1GL6 A;  4IJF A;  3GPP A;  4NXN M;  4KHP M;  1PJJ A;  3UK6 A;  3HJ8 A;  4MB7 A;  1MX0 A;  5A2Q S;  4LZJ A;  5C18 A;  3GLF B;  3EIH A;  4L4U A;  3TWK A;  3A45 A;  2LH0 A;  4LJA A;  4NRV A;  3VDU A;  3J81 S;  3GRU A;  2O5R A;  2CHQ A;  2KRK A;  1L2B A;  4LF9 M;  1YUB A;  2YQZ A;  5EXP A;  3NBI A;  4NL4 H;  2OQ4 A;  4BB9 A;  1L1Z A;  3THG A;  3L2A A;  4KO8 A;  3AJI B;  4JV5 M;  5JI2 E;  4MGI E;  1HQC A;  1Z5B A;  4LZZ A;  4Z8X A;  2Y21 A;  4CIS A;  1D2N A;  2RKO A;  1K82 A;  3TE6 A;  1IXR C;  4JI4 M;  4NRW A;  2F5Q A;  1N75 A;  4LFC M;  1Z5A A;  4M0D A;  5DYI A;  3AFH A;  1IN8 A;  2XF3 A;  2Z4R A;  2CV1 A;  4LF8 M;  5E26 A;  1J5E M;  2ZAN A;  4QNM A;  3L25 A;  3RE8 A;  1GL7 A;  3IG5 A;  4X66 M;  4GC9 A;  5ITU A;  3H4M A;  3L28 A;  3HGI A;  3E4R A;  4AZF A;  2XGN A;  3E9S A;  3AOE A;  4IBJ A;  2UXD M;  3T38 A;  3U6Q A;  4KOD A;  1YE9 A;  3CF6 E;  4G6Z A;  5FSW A;  2YFQ A;  1YSY A;  4LGY A;  2UUA M;  3K1J A;  2VQE M;  2DXI A;  2D7E A;  1Z6T A;  4MGK E;  2FE8 A;  5IWA M;  4TUW A;  5EP2 A;  3M6A A;  3GRR A;  1ORY B;  4HLQ A;  1GLN A;  4LF6 M;  4RF1 A;  5EXT A;  1SXJ D;  1T3T A;  2BJW A;  3D8L A;  1KFV A;  3HU1 A;  2JA2 A;  5EXX A;  1XC8 A;  4PDG A;  1QQW A;  2F5S A;  3DFZ A;  3AOE C;  2LNH C;  3HHX A;  2VII A;  2HKJ A;  4GKJ M;  1X37 A;  2X4A A;  4ITQ A;  2UUC M;  5EP4 A;  5IT9 S;  3TWM A;  4B3T M;  4IJE A;  4IBI A;  1IBK M;  3KW6 A;  2Z3X A;  2DHR A;  3KSX A;  1SXJ A;  3HKP A;  3VK7 A;  5IRE B;  4FWD A;  3HWS A;  3DA1 A;  3SAT A;  5EXS A;  2C98 A;  1ZQ9 A;  3A46 A;  3AKZ A;  1IXS B;  3GP1 A;  4G4N A;  2DVW B;  3GPX A;  4PDI A;  4PCZ A;  5JI3 E;  2LWX A;  4DR1 M;  4RF0 A;  1E94 E;  2F5O A;  4LJ6 A;  4L16 A;  3MHV C;  1XXH B;  2KRU A;  1N78 A;  4JN6 A;  3LVV A;  5KPR A;  1QYR A;  2CHG A;  3VKH A;  1TH2 A;  2C5R A;  1PJI A;  1SXJ C;  4DV2 M;  4R7G A;  2V1C A;  4DR5 M;  4LJ9 A;  3FUU A;  3SBJ A;  3TQS A;  4I81 A;  4II7 A;  4LFB M;  1HNZ M;  1NJG A;  4JI5 M;  3W0L B;  1Q3C A;  4LF5 M;  3SHF A;  4IBD A;  1NHW C;  2FNA A;  3KSJ A;  4W5W A;  2YR0 A;  3GLF A;  1N33 M;  1GVN A;  2L09 A;  3SAS A;  2NQ8 C;  3L26 A;  4ZPX A;  4DV5 M;  4LG2 A;  3LQR A;  1NJF A;  5ITY A;  3SYK A;  4DV3 M;  3KOZ E;  2XFT A;  3LQQ A;  2R18 A;  3U6P A;  7CAT A;  2CV2 A;  3KS4 A;  4X62 M;  3ILK A;  4JYA M;  4X64 M;  5KQ8 A;  5GKN A;  3DOA A;  3U60 B;  1NY5 A;  3A42 A;  1IY2 A;  4JXJ A;  2UXC M;  3HU3 A;  3KVW A;  4B3S M;  1IQP A;  5EP1 A;  1HT2 E;  1Z5C A;  3GLI A;  4DV7 M;  3KXE C;  2XH9 A;  3AL0 C;  4M9X A;  5EJC A;  1NHG C;  1QAO A;  4GIP A;  1KSF X;  3GRY A;  4YHH M;  3ZH9 B;  4G4R A;  3GLH A;  4G4Q A;  1SXJ E;  3J80 S;  4FD2 A;  3GLG A;  4AG6 A;  3AOG A;  3HU2 A;  4GH9 A;  4IBC A;  4D81 A;  3KS8 A;  2CEA A;  3U5Z A;  4LFA M;  3U6O A;  5ITQ A;  3KP0 E;  5EQT A;  5ITR A;  4GMQ A;  3PFI A;  1HQY E;  3GQ5 A;  4L8R C;  3I4Y A;  3RGS A;  1JQJ C;  2XFS A;  4LJ8 A;  3VDP A;  4QHS A;  3AV0 A;  2Y0T A;  3MJ5 A;  3FTE A;  4MGH A;  5ITX A;  4L78 A;  4JI3 M;  4YY3 M;  1N32 M;  4PT5 A;  2ZAM A;  3U61 A;  1K3W A;  2ERC A;  4DV6 M;  3T1H M;  4DV0 M;  3B9P A;  3FUT A;  4X65 M;  2F5N A;  4JI6 M;  2M60 A;  1TDZ A;  4IBB A;  3I4V A;  4OVZ B;  3SAU A;  1W5T A;  2V6Z M;  5FTJ A;  2F4V M;  1IN4 A;  1L8Q A;  3T1Y M;  2DWN A;  2ZM6 M;  3VK8 A;  1HT1 E;  4IIW A;  1N34 M;  3GPY A;  3JR4 A;  1OJL A;  2EA0 A;  2EO2 A;  3TL4 X;  3U6E A;  2Z7J A;  2K47 A;  3J2P B;  2CFO A;  3FYC A;  1XMQ M;  3UMM A;  4OX9 M;  1EE8 A;  4DV1 M;  2R65 A;  2QBY A;  2QPA A;  4MGZ E;  4WUR A;  3HHY A;  4K0K M;  1MU5 A;  2CHV A;  1GKI A;  1H6U A;  2C9O A;  2KZS A;  3KP1 E;  5EP3 A;  2E5L M;  3EIE A;  1I4W A;  3NWL A;  5H37 D;  2R45 A;  1OFI A;  4LCB A;  4DR6 M;  3L29 A;  2KXE A;  1NNU C;  1G8P A;  4DR4 M;  3DZD A;  4LRS A;  5C1B A;  2Z4S A;  2V1U A;  4LY6 A;  3IG8 A;  1DO2 A;  1E9S A;  4M0W A;  2Y0Q A;  2XZU A;  1DGF A;  4AQY M;  1G59 A;  3A98 B;  3FTC A;  1XNR M;  3SAV A;  1TGU A;  1DGB A;  2UU9 M;  1IN6 A;  4JI1 M;  4FWH A;  4FVM A;  1XNQ M;  1QAN A;  4MH0 E;  3ZCB B;  2QCU A;  1NSF A;  2FOI C;  2XSZ D;  3U60 A;  3FD9 A;  3KOX E;  4DUZ M;  1NVM A;  2J7O A;  3VKG A;  1G3I A;  2R46 A;  3HJS A;  5IZ7 D;  3VFD A;  1XMO M;  4AKI A;  4FW9 A;  3W0F A;  3UJN A;  2QEN A;  2BJV A;  1W5S A;  2XEP A;  1PM5 A;  4IBE A;  1DO0 A;  3J7B A;  3U6D A;  4S12 A;  3KOW E;  4I4L A;  3WHK A;  2XLJ A;  2UXB M;  4XBO A;  1R6B X;  4CGY B;  5BR8 M;  1NY6 A;  1Q39 A;  2DZN B;  1QAQ A;  1SXJ B;  3FUV A;  2HHH M;  4RNA A;  1LV7 A;  3SFZ A;  2R4J A;  3U6C A;  3HHZ A;  2XSZ A;  1G41 A;  3L27 A;  3M0E A;  3PVS A;  3LVW A;  1WXQ A;  2D7G A;  4OU7 A;  4JI7 M;  4AKG A;  4NSR A;  2UUB M;  1IN5 A;  5FTN A;  1Q3B A;  2F5P A;  3D8B A;  2C99 A;  4LJ7 A;  2M5Z A;  4MGY E;  1J7K A;  3FKE A;  3Q8X A;  1R2Y A;  2RGO A;  1K3X A;  1OFH A;  3PXG A;  4QHT A;  1IY1 A;  3QWL A;  4LF7 M;  3M7G A;  3U6M A;  4IBF A;  4D82 A;  3T15 A;  2KA6 B;  4GHL A;  3SMS A;  2FFJ A;  2H1R A;  3HHW A;  3C58 A;  4OVZ A;  3RFW A;  4LF4 M;  5KQD A;  1TDH A;  4I5S A;  4KLN A;  4CHT B;  2BNK A;  4M9Z A;  4DR7 M;  2Y20 A;  2L7I A;  1R7R A;  2XZF A;  4FCV A;  3MK6 A;  4R3D A;  3OTO M;  2Q2E B;  3SAR A;  3FTD A;  4AKH A;  3KDS E;  1IBL M;  2KW0 A;  3SC3 A;  4M9S A;  3WHL A;  2I7N A;  1VDD A;  4FCT A;  4GIT A;  4A3V B;  1DGH B;  4FWG A;  3ZC7 B;  4QOZ C;  3CTW B;  3U6S A;  1HNX M;  3R8F A;  3LMM A;  1NNJ A;  1IN7 A;  4NSO B;  5FLX S;  3GLI B;  3FTF A;  1C1K A;  3CF2 A;  3SAW A;  2L7H A;  2L6O A;  4FCW A;  2LXE A;  4JI8 M;  4G4O A;  4DR3 M;  5FTL A;  3GLH B;  3FUW A;  4EIW A;  5KO3 A;  1N36 M;  3J7A S;  2W82 A;  3SMP A;  5DYG A;  3GLG B;  1KYI A;  3I51 A;  2YNM D;  1S3S A;  2KEB A;  3U5Z B;  2A5Y B;  2G8L A;  3FYD A;  3J27 B;  1IY0 A;  1I94 M;  5LMN M;  4B7H A;  4WW0 A;  1L2D A;  3GRV A;  5DNY A;  1ZAE A;  1QAM A;  3CF0 A;  1QZM A;  4IBK A;  1R2Z A;  4LJ5 A;  3BOS A;  2HL7 A;  3QAU A;  4QOS A;  3TPZ A;  4BBA A;  1IBM M;  4NOO B;  1XXH A;  4OW0 A;  2ZAO A;  1UM8 A;  4P16 A;  1QVR A;  4HL4 A;  5KPT A;  5ITT A;  3GPU A;  3K8Z A;  3U61 B;  3PNV A;  2OPF A;  1TH4 A;  4L15 A;  4JI0 M;  3TWL A;  2ZBK B;  2X8A A;  4B3M M;  1FJG M;  2D7H A;  4NXM M;  2C96 A;  2DWL A;  4DR2 M;  3K2L A;  5E6J A;  1HR0 M;  4JI2 M;  3FUX A;  4GC5 A;  2CE7 A;  3SHG B;  2DZO B;  1L1T A;  2G5G X;  1IXZ A;  2QP9 X;  4Z6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...