4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
4B3RM 4DUYM 3SBJA 2VQEM 1IBMM 1J5EM 3U6QA 4JI4M 3U6SA 3SAVA 4LF7M 4JV5M 3JAMS 3T1YM 4PD2A 4LF6M 3DOAA 1XMQM 2F5NA 3A46A 4PDIA 2EA0A 1K82A 1FJGM 3SAUA 2E5LM 2F5SA 4JI3M 4NRVA 2UU9M 1Z5BA 1L1TA 4X65M 4NXMM 2UXDM 4DV7M 4B3MM 5FLXS 4JI5M 3C58A 1IBKM 3GO8A 1K3XA 4DV0M 3U6EA 3GQ3A 3SAWA 1L2CA 1IBLM 3GP1A 1NNJA 4PCZA 4DUZM 1Z59A 3U6LA 4JI8M 4G4QA 3U6MA 1XMOM 1KFVA 3J7AS 1N33M 4DV2M 2F5PA 4G4RA 4JI7M 1Z5CA 5ITRA 3TWKA 5LMUM 3OTOM 4DV3M 3VK8A 1HNWM 1N36M 4OX9M 1HNXM 3GQ4A 4G4OA 1L1ZA 4DR1M 4AQYM 1K3WA 4LFBM 4JYAM 2ZBKB 1HR0M 4G4NA 1I94M 4JI1M 1PM5A 3JR5A 2HKJA 3TWMA 3SATA 4B3TM 2F4VM 2XZFA 4PDGA 1R2ZA 5BR8M 3U6CA 2UUAM 4KHPM 4JI6M 4GKJM 1TDZA 4GKKM 1Z5AA 3T1HM 4DV5M 5IT9S 1TDHA 1PJJA 3SARA 4JI0M 3GPXA 2UUCM 1R2YA 4NXNM 4DR7M 2UUBM 4K0KM 3A45A 2VQFM 3GQ5A 1XNRM 5LMNM 3W0FA 3GPPA 1MU5A 4DR6M 3GPUA 4MB7A 5ITYA 3J81S 5IWAM 4JI2M 2XZUA 1XNQM 1N34M 3GPYA 4DR5M 2ZM6M 1Q39A 4YY3M 4LF4M 1Q3CA 5ITQA 1HNZM 3SASA 3U6DA 4DR2M 5ITXE 4DV4M 3U6OA 1XC8A 4LFAM 3J80S 2OPFA 4LF9M 1L2DA 4ITQA 4B3SM 1N32M 3JR4A 2OQ4A 3TWLA 2UXCM 4DR3M 4DV6M 3A42A 4YHHM 1MX0A 4X62M 4DR4M 1PJIA 4NRWA 4X64M 1Q3BA 1EE8A 5ITTA 5ITUA 3VK7A 2HHHM 4X66M 4LFCM 4LF5M 2Q2EB 2UXBM 2F5QA 5ITXA 1L2BA 4LF8M 2F5OA 4CISA 3U6PA 5A2QS 4DV1M
chains in the Genus database with same CATH superfamily
3FKEA 1PJQA 3SBJA 2VQEM 2KXEA 2LVNC 3HHYA 2KZSA 2XFTA 2DAEA 3U61A 2JY8A 3U6QA 3K9PA 1Q02A 2CE7A 3BBZA 4Y28F 5KPTA 2V1UA 3UK6A 3LQRA 2C5RA 1XMQM 2F5NA 1OIPA 1YUBA 3KP0E 3IECA 1SXJA 1FJGM 3SAUA 2LVOC 4MGIE 2KZUA 1WGLA 2KDLA 5GKNA 1J7KA 3HJ8A 1QUSA 4JI3M 3KSJA 4CHTB 4NRVA 4P17A 2KW0A 4F2LA 4GHAA 2K9DA 2VDBB 3I4YA 4OVZB 3ILKA 4G3OA 3CGWA 3GLIB 4MGHA 2UXDM 1I4WA 2CHVA 3HY5A 5KQ8A 1D2NA 1IBKM 1ZV1A 3E21A 4RF1A 3GO8A 1K3XA 2DZNB 4I8OA 4AW4A 3KOYE 2KHHA 1IBLM 3IG5A 2DWMA 2X4AA 5FSWA 3B7NA 3MHVC 4PCZA 4LCBA 4GIPA 1IXRC 1X37A 1T43A 4LY6A 1TH4A 4AZFA 2H5XA 3C3DA 4DV2M 1ZMUA 3MK6A 3W67A 4G4RA 4IBGA 1GKIA 4I4LA 2D7HA 3GRUA 4IIWA 5LMUM 1G3IA 1N36M 1OJLA 4IBFA 4LJ4A 2D7GA 4JYAM 4AQYM 3U5ZA 1YLAA 2ZBKB 1HR0M 1R5LA 3DZDA 2HCBA 4Q7JA 3FTCA 1W5SA 3SATA 3SMSA 3FYCA 2G8LA 2F4VM 3H4MA 2R4EA 3K9OA 2UUAM 2EJSA 2NQ8C 3KXEC 4KHPM 2KNAA 1TH2A 2YQZA 4GKJM 1TDZA 3FUWA 1Z5AA 3PFIA 4IBDA 5EP3A 2VIIA 3FUUA 2M60A 1DGHB 1NSFA 1PJSA 1NV9A 2C9CA 1N75A 4JXJA 1R2YA 1VEKA 4NXNM 4DR7M 3A45A 1NHGC 3B9PA 5C1BA 2C9OA 3IG8A 1EIJA 3B7QA 4IBIA 3T6PA 5LMNM 2OO9A 1UM8A 3KDSE 2HL7A 3FUTA 4II7A 3W0FA 1MU5A 3GLGE 2BJVA 4OU7A 4MH0E 4W5WA 1GLNA 3PXGA 3J2PB 5IWAM 4TUWA 3B74A 4P16A 3T15A 3GRRA 1G8PA 1JR3A 1OFIA 1QDTA 2EKKA 4NSRA 3WHKA 1Z6TA 3TL4X 2XF3A 2QBYB 3HWSA 3UGJA 1Q39A 5IZ7D 4IBCA 2ZM6M 3LCUA 1HNZM 2X49A 3SASA 2DI0A 1HQYE 2KEBA 2R62A 4R7GA 4CIZA 3U6DA 5FTNA 2DAKA 3J80S 1E32A 1CUKA 3RGSA 3KS8A 4XBOA 2OQ4A 3AL0C 1DV0A 3TE6A 1ORYB 1NY5A 3SFZA 2LH0A 3A42A 2L2DA 1TF0B 1PJIA 4QOSA 3AOEC 1VQ1A 2DENA 1IN6A 1T6OA 2R18A 2CV0A 4NRWA 3HX3A 5EXSA 7CATA 5ITTA 3NBXX 1H6UA 2J7OA 3GRVA 2I7NA 4GITA 1TR8A 1T3TA 3IHPA 4M9SA 4LFCM 2UXBM 5ITXA 3W68A 3L25A 3K8ZA 1IM2A 2F5OA 3U6PA 1V33A 5A2QS 3F92A 1K3WA 4DUYM 4JI4M 3SAVA 4LF7M 3KW6A 3ZQJA 4JV5M 2Z4SA 1G4AE 2L7IA 2KNZA 3Q8XA 3DOAA 1VDLA 3UZUA 3A46A 4PDIA 2EA0A 1R6BX 3M7GA 1K82A 4F1IA 2HWJA 2E5LM 4HEOA 4R3DA 2XGNA 3VLFB 3L28A 2F5SA 2DXIA 3AV0A 3SHGB 3LQQA 4IBBA 4LZJA 1HJPA 4LRSA 2J7NA 1XWIA 2FFJA 4IJFA 4M0DA 5FLXS 4JI5M 3ZC7B 3B7ZA 4MGZE 1PJTA 3U6EA 1L2CA 1NJFA 3GLGA 3V76A 1NNJA 4MGYE 2XLJA 1HT2E 2LNHC 2R45A 2JP7A 1QAOA 4JI8M 3CF6E 4BLCA 1C1KA 3CF0A 1XMOM 3KVWA 5EXXA 3LW5F 2OOBA 1IXSA 3ZCBB 2GQFA 1DO2A 4R71A 1YE9A 4JI7M 2B3TA 1XXHA 1WHCA 4GEWA 4LJ9A 2XSZA 5IREB 3CF2A 3OTOM 4DV3M 3VK8A 1HNWM 2QZ4A 1TGUA 1L1ZA 4KT0F 3SYKA 3D8LA 4Z8XA 4LFBM 3BOSA 2FNAA 4LJ7A 2CRUA 1I94M 3UMMA 3JR5A 3TWMA 3VFDA 3KOZE 4IBJA 4PDGA 4XGIA 4XK8F 3U61B 1OFHA 5BR8M 2P5TA 2DNAA 2LVQD 4AG5A 1A5TA 1ZAEA 2XH9A 2APLA 2G5GX 4JN6A 1NVMA 3CTWB 5IT9S 2ZTDA 1TDHA 1FNNA 1XXHE 2DWZB 2MGWA 4FD2A 2V1CA 2Y20A 3NBIA 3D8BA 4L78A 4K0KM 3FUVA 4FWGA 4HLQA 3RGPA 3WHLA 1LTMA 5KQDA 1D0KA 2AHMA 5L8RF 2CHGA 4IJEA 2V6ZM 1JQJC 2JY5A 3GPPA 1DO0A 3GLFB 3MMPA 1R4GA 1GO5A 3TPZA 2EKFA 4MB7A 4WW0A 5ITYA 3GLIE 3QWLA 2JNHA 4D82A 1XNQM 4AKHA 1QAQA 1N34M 2QCUA 4B08A 3GPYA 2R0IA 1JB0F 4KODA 3K2LA 4BB9A 4LF4M 1RU3A 1P3QQ 1SXJB 3LCVB 1IN5A 1DGGA 1WR1B 4DV4M 1IN8A 1TH3A 1XC8A 2O01F 4LJ6A 1DGBA 1NO1A 4ITQA 4OVZA 4NSOB 1AUAA 3QAUA 4QOZC 3FUXA 3FRIA 1OQYA 2JA2A 1IN7A 2CP8A 4LGMA 1GJTA 2ERCA 2G3QA 2KA6B 3FRHA 2DHYA 1Q3BA 4KLNA 2L7HA 5ITUA 3VK7A 5F3WA 2MROB 4X66M 5KO3A 4D81A 1TTEA 3ZH9B 1GL7A 2DAGA 2R4JA 1L2BA 1XB2B 1OAIA 4CJ6A 3L26A 2KRKA 2Y0TA 1S3SA 2C99A 3Q8GA 2BJWA 3VDUA 4EIWA 5EJCA 3R9XB 1SXJC 1DGFA 3U60B 2D7EA 3U6SA 4QNRA 3SC3A 4B7GA 2YFQA 4LF6M 4PD2A 1HQCA 4FVMA 4I81A 1UFZA 3QYBA 3SMPA 2L09A 1NY6A 2L4EA 2K47A 2QNJA 2R65A 1Z5BA 4FWDA 4PT5A 1E9RA 4WP2A 2OOAA 2N35A 4DV7M 1EFUB 3M6AA 4A3VB 4HL4A 2RGOA 3HHWA 2QPAA 2ZANA 4L6V6 4LZZA 5DYIA 4DV0M 3GQ3A 2JXNA 2M5ZA 2FOIC 4DUZM 3U6LA 1IY2A 1QUTA 2DAIA 2LBCA 2Z7JA 3K92A 4WURA 4S12A 3U6MA 2XFSA 1E94E 4NC6A 4NL4H 4GRIA 1YSYA 2MJ5B 1W5TA 3EIEA 5H37D 1Z5CA 5ITRA 3TWKA 2EUCA 4Z6YA 1IXSB 2QQ8A 2KRUA 1QAMA 2RRUA 4G4NA 3VKGA 1VEJA 2WZJA 4JI1M 2QENA 1V34A 5KPZA 2DHRA 4B3TM 2DZOB 4QHSA 5FTKA 2LWXA 1R2ZA 3PNVA 1IY0A 3GLHA 5C18A 4FCVA 4RKUF 5BPVA 2FH0A 1WGNA 4GKKM 2CWBA 2ZTCA 3T1HM 4B7FA 2LHGA 1HT1E 4DV5M 4AKIA 4JI0M 3AOGA 3KOXE 3GPXA 4CGYB 2UUCM 4FW9A 1MN3A 1KYIA 3AFHA 2DAMA 3HZJA 4MM3B 1GVNA 1QANA 3THGA 2VQFM 2UUBM 2DWLA 3E46A 4G6ZA 1AIPC 4OW0A 1QZEA 3L2AA 3C9PA 1NJGA 1G71A 4QHTA 2LHCA 2VF7A 4QNMA 5EP1A 4GC9A 1V92A 2XSZD 1OAOC 4LJ5A 3GPUA 4AI6A 3J81S 1VEGA 2I7PA 2XZUA 2CFOA 3L29A 1OTRA 3GLFA 1WIVA 2BWEA 2K6BA 2A5YB 3U5ZB 2Z8YM 4RNAA 4DR5M 3GLIA 4IBKA 1XXHB 3AJIB 5E26A 1N78A 2CHQA 3W0LB 3I4VA 5ITXE 3U6OA 3LMMA 4LFAM 2JY6B 2LVPC 4AKGA 4L16A 1L2DA 3JR4A 1MJGM 1D0LA 2R44A 2RKOA 1IY1A 4ZPXA 3SHFA 4B7HA 3TWLA 2JZ1A 4DR3M 1NNUC 1OKSA 3GLFE 4DV6M 4YHHM 1Y8GA 4X62M 2LVAA 2JWSA 4X64M 3MJ5A 3RE8A 1EE8A 2EO2A 2HHHM 2QHOB 4GHLA 1PRBA 4LF5M 1IN4A 4FCTA 2Q2EB 1F4IA 2Z4RA 2ZAMA 3T38A 5EXTA 3AOEA 4CISA 3DFZA 1SG9A 4REZA 4DV1M 4B3RM 2QBYA 2QP9X 1IBMM 2QSFX 3VKHA 3HHZA 1J5EM 2Y0QA 3I01M 2W82A 2YNMD 3JAMS 1QVRA 3T1YM 4RF0A 1ZMWA 1IXZA 1R7RA 2L6OA 3E9SA 2Z3XA 5DYGA 4KO8A 4L8RC 1DGHA 4ANRA 8CATA 2L4FA 5EQTA 2UU9M 4M0WA 1L1TA 3C3EA 4D80A 4X65M 4NXMM 1JR3D 4B3MM 1WXQA 4AG6A 3C58A 4FWHA 3E4RA 2FE8A 2WSEF 1QQWA 3SAWA 5DFLA 2LXEA 3GP1A 4L4UA 1C7YA 1GABA 3GRYA 3LVWA 2K0BX 1Z59A 2C98A 4MGKE 3J7BA 2FS1A 4FCWA 4G4QA 2GNOA 3EIHA 1JR3E 1KFVA 4LG2A 3LVVA 3NWLA 1N77A 3J7AS 1N33M 2F5PA 1GL6A 2RGHA 3HU2A 1PGYA 1G41A 4LJ8A 2H1RA 2XEPA 4GMQA 3FTEA 3VDPA 5FTMA 3DA1A 2HAKA 2WSFF 5DNYA 1HNXM 3GQ4A 4G4OA 4OX9M 4DR1M 1IQPA 4LJAA 4BBAA 3U60A 2O25A 3FD9A 3QYEA 3GLHE 1PM5A 2HKJA 3I04M 2VF8A 2C96A 2XZFA 1VDDA 3PNYA 2CV2A 3FYDA 2CUZA 1IFYA 3FTDA 2DZLA 3UJNA 3J27B 3U6CA 1KSFX 3K1JA 1NHWC 2MH8A 2WSCF 4JI6M 1OIZA 3HHXA 2MR9A 2KNVA 1GJSA 1XHBA 3RFWA 2BNKA 4IBEA 2CEAA 1PJJA 3SARA 1ZQ9A 2R6FA 1QDRA 3HJQA 1ZMVA 3H4JA 3HJSA 3GQ5A 4M9ZA 2JZ0A 1XNRM 3KOWE 2J5YA 2LTUA 5KPRA 3R8FA 3M0EA 5EP4A 3SYLA 2CV1A 3BXWA 1QYRA 4GC5A 4DR6M 2DKLA 1WJ7A 4JI2M 2R46A 4UN2B 2BWBA 1QZMA 5JI3E 4LGYA 3L27A 4M9XA 1BVSA 2DVWB 1E9SA 5EP2A 3FE3A 3HKPA 4YY3M 1Q3CA 1VG5A 2YR0A 5FTJA 4GH9A 5ITQA 5JI2E 4DR2M 1SXJD 3B89A 3AKZA 2OPFA 4LF9M 3FTFA 3HU1A 5E6JA 4B3SM 3HU3A 1D0MA 4I5SA 1N32M 2DWNA 3KSXA 3I51A 2UXCM 2O5RA 5EXPA 3PVSA 3GLGB 3KFUG 1MX0A 2JUJA 1SXJE 3GLHB 2ZAOA 4DR4M 3HGIA 3KS4A 1G59A 2JY7A 2Y21A 2X8AA 1LV7A 3TQSA 3A98B 4NOOB 2F5QA 4LF8M 3KP1E 1J09A 4L15A 4LRTA 1NV8A 4DBGB 5FTLA 1L8QA
chains in the Genus database with same CATH topology
3FKEA 3SBJA 2VQEM 2KXEA 3HHYA 2KZSA 2XFTA 3U61A 3U6QA 2CE7A 5KPTA 2V1UA 3UK6A 3LQRA 2C5RA 1XMQM 2F5NA 1YUBA 3KP0E 1FJGM 1SXJA 3SAUA 4MGIE 2KZUA 5GKNA 1J7KA 3HJ8A 4CHTB 4JI3M 3KSJA 4GHAA 4NRVA 2KW0A 3I4YA 4OVZB 3ILKA 3GLIB 4MGHA 2UXDM 1I4WA 2CHVA 5KQ8A 1D2NA 1IBKM 4RF1A 3GO8A 1K3XA 2DZNB 4I8OA 4AW4A 3KOYE 1IBLM 3IG5A 2DWMA 2X4AA 5FSWA 3MHVC 4PCZA 4LCBA 4GIPA 1IXRC 1X37A 4LY6A 1TH4A 4AZFA 4DV2M 3MK6A 4G4RA 4IBGA 1GKIA 4I4LA 2D7HA 3GRUA 4IIWA 5LMUM 1G3IA 1N36M 1OJLA 4IBFA 4LJ4A 2D7GA 4JYAM 4AQYM 3U5ZA 2ZBKB 1HR0M 3DZDA 2HCBA 3FTCA 1W5SA 3SATA 3SMSA 3FYCA 2G8LA 2F4VM 3H4MA 2R4EA 2UUAM 2NQ8C 3KXEC 4KHPM 1TH2A 2YQZA 4GKJM 1TDZA 3FUWA 1Z5AA 3PFIA 4IBDA 5EP3A 2VIIA 3FUUA 2M60A 1DGHB 1NSFA 2C9CA 4JXJA 1N75A 1R2YA 4NXNM 4DR7M 3A45A 1NHGC 3B9PA 5C1BA 2C9OA 3IG8A 4IBIA 5LMNM 1UM8A 3KDSE 2HL7A 3FUTA 4II7A 3W0FA 1MU5A 2BJVA 4OU7A 4MH0E 4W5WA 1GLNA 3PXGA 3J2PB 5IWAM 4TUWA 4P16A 3T15A 3GRRA 1G8PA 1JR3A 1OFIA 4NSRA 3WHKA 2QBYB 1Z6TA 3TL4X 2XF3A 3HWSA 3UGJA 1Q39A 5IZ7D 4IBCA 2ZM6M 1HNZM 2X49A 3SASA 1HQYE 2KEBA 2R62A 4R7GA 3U6DA 5FTNA 3J80S 1E32A 3RGSA 3KS8A 4XBOA 2OQ4A 3AL0C 3TE6A 1ORYB 1NY5A 3SFZA 2LH0A 3A42A 1PJIA 4QOSA 3AOEC 2CV0A 4NRWA 1IN6A 2R18A 5EXSA 7CATA 5ITTA 1H6UA 2J7OA 3GRVA 2I7NA 4GITA 4M9SA 1T3TA 4LFCM 2UXBM 5ITXA 3L25A 3K8ZA 1IM2A 2F5OA 3U6PA 5A2QS 1K3WA 4DUYM 4JI4M 3SAVA 4LF7M 3KW6A 4JV5M 2Z4SA 1G4AE 2L7IA 3Q8XA 3DOAA 3UZUA 3A46A 4PDIA 2EA0A 1R6BX 3M7GA 1K82A 2E5LM 2DXIA 4R3DA 2XGNA 3VLFB 3L28A 2F5SA 3AV0A 3SHGB 3LQQA 4IBBA 4LZJA 4LRSA 2J7NA 1XWIA 2FFJA 4IJFA 4M0DA 5FLXS 4JI5M 3ZC7B 4MGZE 3U6EA 1L2CA 1NJFA 3GLGA 1NNJA 4MGYE 2XLJA 1HT2E 2LNHC 2R45A 1QAOA 4JI8M 3CF6E 4BLCA 1C1KA 3CF0A 1XMOM 3KVWA 5EXXA 3ZCBB 1DO2A 1YE9A 4JI7M 1XXHA 4LJ9A 2XSZA 5IREB 3CF2A 3OTOM 4DV3M 3VK8A 1HNWM 2QZ4A 1TGUA 1L1ZA 3SYKA 3D8LA 4Z8XA 4LFBM 3BOSA 2FNAA 4LJ7A 1I94M 3UMMA 3JR5A 3TWMA 3VFDA 3KOZE 4IBJA 4PDGA 4XGIA 3U61B 1OFHA 5BR8M 2P5TA 4AG5A 1ZAEA 2XH9A 2G5GX 4JN6A 1NVMA 3CTWB 5IT9S 1TDHA 1FNNA 2DWZB 4FD2A 2V1CA 2Y20A 3NBIA 3D8BA 4L78A 4K0KM 3FUVA 4FWGA 4HLQA 3RGPA 3WHLA 5KQDA 2AHMA 2CHGA 4IJEA 2V6ZM 1JQJC 3GPPA 1DO0A 3GLFB 3TPZA 4MB7A 4WW0A 5ITYA 3QWLA 4D82A 4AKHA 1XNQM 1QAQA 1N34M 2QCUA 4B08A 3GPYA 4KODA 4BB9A 3K2LA 4LF4M 1SXJB 1IN5A 1DGGA 4DV4M 1IN8A 1TH3A 1XC8A 4LJ6A 1DGBA 4ITQA 4OVZA 4NSOB 3QAUA 4QOZC 3FUXA 2JA2A 1IN7A 4LGMA 2ERCA 2KA6B 1Q3BA 4KLNA 2L7HA 5ITUA 3VK7A 5F3WA 4X66M 5KO3A 4D81A 3ZH9B 1GL7A 2R4JA 1L2BA 3L26A 2KRKA 2Y0TA 1S3SA 2C99A 2BJWA 3VDUA 4EIWA 5EJCA 3R9XB 1SXJC 1DGFA 3U60B 2D7EA 3U6SA 4QNRA 3SC3A 4B7GA 2YFQA 4LF6M 4PD2A 1HQCA 4FVMA 4I81A 3SMPA 2L09A 1NY6A 2K47A 2R65A 1Z5BA 4FWDA 4PT5A 1E9RA 4DV7M 3M6AA 4A3VB 4HL4A 2RGOA 3HHWA 2QPAA 2ZANA 4LZZA 5DYIA 4DV0M 3GQ3A 2M5ZA 2FOIC 4DUZM 3U6LA 1IY2A 2Z7JA 3K92A 4WURA 4S12A 3U6MA 2XFSA 1E94E 4NL4H 4GRIA 1YSYA 1W5TA 3EIEA 5H37D 1Z5CA 5ITRA 3TWKA 2EUCA 4Z6YA 1IXSB 2KRUA 1QAMA 4G4NA 3VKGA 4JI1M 2QENA 5KPZA 2DHRA 4B3TM 2DZOB 4QHSA 5FTKA 2LWXA 1R2ZA 3PNVA 1IY0A 3GLHA 5C18A 4FCVA 5BPVA 4GKKM 3T1HM 4B7FA 1HT1E 4DV5M 4AKIA 4JI0M 3AOGA 3KOXE 3GPXA 4CGYB 2UUCM 4FW9A 1KYIA 3AFHA 4MM3B 2UUBM 1GVNA 1QANA 3THGA 2VQFM 2DWLA 4G6ZA 4OW0A 3L2AA 1NJGA 4QHTA 4QNMA 5EP1A 4GC9A 2XSZD 4LJ5A 3GPUA 4AI6A 3J81S 2I7PA 2XZUA 2CFOA 3L29A 3GLFA 2A5YB 3U5ZB 4DR5M 4RNAA 3GLIA 4IBKA 1XXHB 3AJIB 5E26A 1N78A 2CHQA 3W0LB 3I4VA 5ITXE 3U6OA 3LMMA 4LFAM 4AKGA 4L16A 1L2DA 3JR4A 2RKOA 4ZPXA 1IY1A 3SHFA 4B7HA 3TWLA 4DR3M 1NNUC 4DV6M 4YHHM 4X62M 4X64M 3MJ5A 3RE8A 1EE8A 2EO2A 2HHHM 4GHLA 4LF5M 1IN4A 4FCTA 2Q2EB 2Z4RA 2ZAMA 3T38A 5EXTA 3AOEA 4CISA 3DFZA 4REZA 4DV1M 4B3RM 2QBYA 2QP9X 1IBMM 3VKHA 3HHZA 1J5EM 2Y0QA 2W82A 2YNMD 3JAMS 1QVRA 3T1YM 4RF0A 1IXZA 1R7RA 2L6OA 3E9SA 2Z3XA 5DYGA 4KO8A 4L8RC 1DGHA 8CATA 5EQTA 2UU9M 4M0WA 1L1TA 4D80A 4X65M 4NXMM 1JR3D 4B3MM 1WXQA 4AG6A 3C58A 4FWHA 3E4RA 2FE8A 1QQWA 3SAWA 2LXEA 3GP1A 4L4UA 3GRYA 3LVWA 4MGKE 1Z59A 2C98A 3J7BA 4FCWA 4G4QA 3EIHA 1KFVA 4LG2A 3LVVA 3NWLA 1N77A 3J7AS 1N33M 2F5PA 1GL6A 2RGHA 3HU2A 1G41A 4LJ8A 2H1RA 2XEPA 4GMQA 3FTEA 3VDPA 5FTMA 3DA1A 5DNYA 4OX9M 1HNXM 3GQ4A 4G4OA 4DR1M 1IQPA 4LJAA 4BBAA 3U60A 3FD9A 1PM5A 2HKJA 2C96A 2XZFA 1VDDA 3PNYA 2CV2A 3FYDA 2CUZA 3FTDA 3UJNA 3J27B 3U6CA 1KSFX 3K1JA 1NHWC 4JI6M 3HHXA 1XHBA 3RFWA 2BNKA 4IBEA 2CEAA 1PJJA 3SARA 1ZQ9A 3HJQA 3HJSA 3GQ5A 4M9ZA 1XNRM 3KOWE 5KPRA 3R8FA 3M0EA 5EP4A 3SYLA 2CV1A 4GC5A 1QYRA 4DR6M 4JI2M 2R46A 1QZMA 5JI3E 4LGYA 3L27A 4M9XA 2DVWB 5EP2A 1E9SA 3HKPA 4YY3M 1Q3CA 2YR0A 5FTJA 5ITQA 4GH9A 5JI2E 4DR2M 1SXJD 3AKZA 2OPFA 4LF9M 3FTFA 3HU1A 5E6JA 4B3SM 3HU3A 1N32M 4I5SA 2DWNA 3KSXA 3I51A 2UXCM 2O5RA 5EXPA 3PVSA 3GLGB 3KFUG 1MX0A 3GLHB 1SXJE 4DR4M 2ZAOA 3HGIA 3KS4A 1G59A 2Y21A 2X8AA 1LV7A 3TQSA 3A98B 4NOOB 2F5QA 4LF8M 3KP1E 1J09A 4L15A 4LRTA 5FTLA 1L8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R M;  4DUY M;  3SBJ A;  2VQE M;  1IBM M;  1J5E M;  3U6Q A;  4JI4 M;  3U6S A;  3SAV A;  4LF7 M;  4JV5 M;  3JAM S;  3T1Y M;  4PD2 A;  4LF6 M;  3DOA A;  1XMQ M;  2F5N A;  3A46 A;  4PDI A;  2EA0 A;  1K82 A;  1FJG M;  3SAU A;  2E5L M;  2F5S A;  4JI3 M;  4NRV A;  2UU9 M;  1Z5B A;  1L1T A;  4X65 M;  4NXM M;  2UXD M;  4DV7 M;  4B3M M;  5FLX S;  4JI5 M;  3C58 A;  1IBK M;  3GO8 A;  1K3X A;  4DV0 M;  3U6E A;  3GQ3 A;  3SAW A;  1L2C A;  1IBL M;  3GP1 A;  1NNJ A;  4PCZ A;  4DUZ M;  1Z59 A;  3U6L A;  4JI8 M;  4G4Q A;  3U6M A;  1XMO M;  1KFV A;  3J7A S;  1N33 M;  4DV2 M;  2F5P A;  4G4R A;  4JI7 M;  1Z5C A;  5ITR A;  3TWK A;  5LMU M;  3OTO M;  4DV3 M;  3VK8 A;  1HNW M;  1N36 M;  4OX9 M;  1HNX M;  3GQ4 A;  4G4O A;  1L1Z A;  4DR1 M;  4AQY M;  1K3W A;  4LFB M;  4JYA M;  2ZBK B;  1HR0 M;  4G4N A;  1I94 M;  4JI1 M;  1PM5 A;  3JR5 A;  2HKJ A;  3TWM A;  3SAT A;  4B3T M;  2F4V M;  2XZF A;  4PDG A;  1R2Z A;  5BR8 M;  3U6C A;  2UUA M;  4KHP M;  4JI6 M;  4GKJ M;  1TDZ A;  4GKK M;  1Z5A A;  3T1H M;  4DV5 M;  5IT9 S;  1TDH A;  1PJJ A;  3SAR A;  4JI0 M;  3GPX A;  2UUC M;  1R2Y A;  4NXN M;  4DR7 M;  2UUB M;  4K0K M;  3A45 A;  2VQF M;  3GQ5 A;  1XNR M;  5LMN M;  3W0F A;  3GPP A;  1MU5 A;  4DR6 M;  3GPU A;  4MB7 A;  5ITY A;  3J81 S;  5IWA M;  4JI2 M;  2XZU A;  1XNQ M;  1N34 M;  3GPY A;  4DR5 M;  2ZM6 M;  1Q39 A;  4YY3 M;  4LF4 M;  1Q3C A;  5ITQ A;  1HNZ M;  3SAS A;  3U6D A;  4DR2 M;  5ITX E;  4DV4 M;  3U6O A;  1XC8 A;  4LFA M;  3J80 S;  2OPF A;  4LF9 M;  1L2D A;  4ITQ A;  4B3S M;  1N32 M;  3JR4 A;  2OQ4 A;  3TWL A;  2UXC M;  4DR3 M;  4DV6 M;  3A42 A;  4YHH M;  1MX0 A;  4X62 M;  4DR4 M;  1PJI A;  4NRW A;  4X64 M;  1Q3B A;  1EE8 A;  5ITT A;  5ITU A;  3VK7 A;  2HHH M;  4X66 M;  4LFC M;  4LF5 M;  2Q2E B;  2UXB M;  2F5Q A;  5ITX A;  1L2B A;  4LF8 M;  2F5O A;  4CIS A;  3U6P A;  5A2Q S;  4DV1 M; 
#chains in the Genus database with same CATH topology
 3FKE A;  1PJQ A;  3SBJ A;  2VQE M;  2KXE A;  2LVN C;  3HHY A;  2KZS A;  2XFT A;  2DAE A;  3U61 A;  2JY8 A;  3U6Q A;  3K9P A;  1Q02 A;  2CE7 A;  3BBZ A;  4Y28 F;  5KPT A;  2V1U A;  3UK6 A;  3LQR A;  2C5R A;  1XMQ M;  2F5N A;  1OIP A;  1YUB A;  3KP0 E;  3IEC A;  1SXJ A;  1FJG M;  3SAU A;  2LVO C;  4MGI E;  2KZU A;  1WGL A;  2KDL A;  5GKN A;  1J7K A;  3HJ8 A;  1QUS A;  4JI3 M;  3KSJ A;  4CHT B;  4NRV A;  4P17 A;  2KW0 A;  4F2L A;  4GHA A;  2K9D A;  2VDB B;  3I4Y A;  4OVZ B;  3ILK A;  4G3O A;  3CGW A;  3GLI B;  4MGH A;  2UXD M;  1I4W A;  2CHV A;  3HY5 A;  5KQ8 A;  1D2N A;  1IBK M;  1ZV1 A;  3E21 A;  4RF1 A;  3GO8 A;  1K3X A;  2DZN B;  4I8O A;  4AW4 A;  3KOY E;  2KHH A;  1IBL M;  3IG5 A;  2DWM A;  2X4A A;  5FSW A;  3B7N A;  3MHV C;  4PCZ A;  4LCB A;  4GIP A;  1IXR C;  1X37 A;  1T43 A;  4LY6 A;  1TH4 A;  4AZF A;  2H5X A;  3C3D A;  4DV2 M;  1ZMU A;  3MK6 A;  3W67 A;  4G4R A;  4IBG A;  1GKI A;  4I4L A;  2D7H A;  3GRU A;  4IIW A;  5LMU M;  1G3I A;  1N36 M;  1OJL A;  4IBF A;  4LJ4 A;  2D7G A;  4JYA M;  4AQY M;  3U5Z A;  1YLA A;  2ZBK B;  1HR0 M;  1R5L A;  3DZD A;  2HCB A;  4Q7J A;  3FTC A;  1W5S A;  3SAT A;  3SMS A;  3FYC A;  2G8L A;  2F4V M;  3H4M A;  2R4E A;  3K9O A;  2UUA M;  2EJS A;  2NQ8 C;  3KXE C;  4KHP M;  2KNA A;  1TH2 A;  2YQZ A;  4GKJ M;  1TDZ A;  3FUW A;  1Z5A A;  3PFI A;  4IBD A;  5EP3 A;  2VII A;  3FUU A;  2M60 A;  1DGH B;  1NSF A;  1PJS A;  1NV9 A;  2C9C A;  1N75 A;  4JXJ A;  1R2Y A;  1VEK A;  4NXN M;  4DR7 M;  3A45 A;  1NHG C;  3B9P A;  5C1B A;  2C9O A;  3IG8 A;  1EIJ A;  3B7Q A;  4IBI A;  3T6P A;  5LMN M;  2OO9 A;  1UM8 A;  3KDS E;  2HL7 A;  3FUT A;  4II7 A;  3W0F A;  1MU5 A;  3GLG E;  2BJV A;  4OU7 A;  4MH0 E;  4W5W A;  1GLN A;  3PXG A;  3J2P B;  5IWA M;  4TUW A;  3B74 A;  4P16 A;  3T15 A;  3GRR A;  1G8P A;  1JR3 A;  1OFI A;  1QDT A;  2EKK A;  4NSR A;  3WHK A;  1Z6T A;  3TL4 X;  2XF3 A;  2QBY B;  3HWS A;  3UGJ A;  1Q39 A;  5IZ7 D;  4IBC A;  2ZM6 M;  3LCU A;  1HNZ M;  2X49 A;  3SAS A;  2DI0 A;  1HQY E;  2KEB A;  2R62 A;  4R7G A;  4CIZ A;  3U6D A;  5FTN A;  2DAK A;  3J80 S;  1E32 A;  1CUK A;  3RGS A;  3KS8 A;  4XBO A;  2OQ4 A;  3AL0 C;  1DV0 A;  3TE6 A;  1ORY B;  1NY5 A;  3SFZ A;  2LH0 A;  3A42 A;  2L2D A;  1TF0 B;  1PJI A;  4QOS A;  3AOE C;  1VQ1 A;  2DEN A;  1IN6 A;  1T6O A;  2R18 A;  2CV0 A;  4NRW A;  3HX3 A;  5EXS A;  7CAT A;  5ITT A;  3NBX X;  1H6U A;  2J7O A;  3GRV A;  2I7N A;  4GIT A;  1TR8 A;  1T3T A;  3IHP A;  4M9S A;  4LFC M;  2UXB M;  5ITX A;  3W68 A;  3L25 A;  3K8Z A;  1IM2 A;  2F5O A;  3U6P A;  1V33 A;  5A2Q S;  3F92 A;  1K3W A;  4DUY M;  4JI4 M;  3SAV A;  4LF7 M;  3KW6 A;  3ZQJ A;  4JV5 M;  2Z4S A;  1G4A E;  2L7I A;  2KNZ A;  3Q8X A;  3DOA A;  1VDL A;  3UZU A;  3A46 A;  4PDI A;  2EA0 A;  1R6B X;  3M7G A;  1K82 A;  4F1I A;  2HWJ A;  2E5L M;  4HEO A;  4R3D A;  2XGN A;  3VLF B;  3L28 A;  2F5S A;  2DXI A;  3AV0 A;  3SHG B;  3LQQ A;  4IBB A;  4LZJ A;  1HJP A;  4LRS A;  2J7N A;  1XWI A;  2FFJ A;  4IJF A;  4M0D A;  5FLX S;  4JI5 M;  3ZC7 B;  3B7Z A;  4MGZ E;  1PJT A;  3U6E A;  1L2C A;  1NJF A;  3GLG A;  3V76 A;  1NNJ A;  4MGY E;  2XLJ A;  1HT2 E;  2LNH C;  2R45 A;  2JP7 A;  1QAO A;  4JI8 M;  3CF6 E;  4BLC A;  1C1K A;  3CF0 A;  1XMO M;  3KVW A;  5EXX A;  3LW5 F;  2OOB A;  1IXS A;  3ZCB B;  2GQF A;  1DO2 A;  4R71 A;  1YE9 A;  4JI7 M;  2B3T A;  1XXH A;  1WHC A;  4GEW A;  4LJ9 A;  2XSZ A;  5IRE B;  3CF2 A;  3OTO M;  4DV3 M;  3VK8 A;  1HNW M;  2QZ4 A;  1TGU A;  1L1Z A;  4KT0 F;  3SYK A;  3D8L A;  4Z8X A;  4LFB M;  3BOS A;  2FNA A;  4LJ7 A;  2CRU A;  1I94 M;  3UMM A;  3JR5 A;  3TWM A;  3VFD A;  3KOZ E;  4IBJ A;  4PDG A;  4XGI A;  4XK8 F;  3U61 B;  1OFH A;  5BR8 M;  2P5T A;  2DNA A;  2LVQ D;  4AG5 A;  1A5T A;  1ZAE A;  2XH9 A;  2APL A;  2G5G X;  4JN6 A;  1NVM A;  3CTW B;  5IT9 S;  2ZTD A;  1TDH A;  1FNN A;  1XXH E;  2DWZ B;  2MGW A;  4FD2 A;  2V1C A;  2Y20 A;  3NBI A;  3D8B A;  4L78 A;  4K0K M;  3FUV A;  4FWG A;  4HLQ A;  3RGP A;  3WHL A;  1LTM A;  5KQD A;  1D0K A;  2AHM A;  5L8R F;  2CHG A;  4IJE A;  2V6Z M;  1JQJ C;  2JY5 A;  3GPP A;  1DO0 A;  3GLF B;  3MMP A;  1R4G A;  1GO5 A;  3TPZ A;  2EKF A;  4MB7 A;  4WW0 A;  5ITY A;  3GLI E;  3QWL A;  2JNH A;  4D82 A;  1XNQ M;  4AKH A;  1QAQ A;  1N34 M;  2QCU A;  4B08 A;  3GPY A;  2R0I A;  1JB0 F;  4KOD A;  3K2L A;  4BB9 A;  4LF4 M;  1RU3 A;  1P3Q Q;  1SXJ B;  3LCV B;  1IN5 A;  1DGG A;  1WR1 B;  4DV4 M;  1IN8 A;  1TH3 A;  1XC8 A;  2O01 F;  4LJ6 A;  1DGB A;  1NO1 A;  4ITQ A;  4OVZ A;  4NSO B;  1AUA A;  3QAU A;  4QOZ C;  3FUX A;  3FRI A;  1OQY A;  2JA2 A;  1IN7 A;  2CP8 A;  4LGM A;  1GJT A;  2ERC A;  2G3Q A;  2KA6 B;  3FRH A;  2DHY A;  1Q3B A;  4KLN A;  2L7H A;  5ITU A;  3VK7 A;  5F3W A;  2MRO B;  4X66 M;  5KO3 A;  4D81 A;  1TTE A;  3ZH9 B;  1GL7 A;  2DAG A;  2R4J A;  1L2B A;  1XB2 B;  1OAI A;  4CJ6 A;  3L26 A;  2KRK A;  2Y0T A;  1S3S A;  2C99 A;  3Q8G A;  2BJW A;  3VDU A;  4EIW A;  5EJC A;  3R9X B;  1SXJ C;  1DGF A;  3U60 B;  2D7E A;  3U6S A;  4QNR A;  3SC3 A;  4B7G A;  2YFQ A;  4LF6 M;  4PD2 A;  1HQC A;  4FVM A;  4I81 A;  1UFZ A;  3QYB A;  3SMP A;  2L09 A;  1NY6 A;  2L4E A;  2K47 A;  2QNJ A;  2R65 A;  1Z5B A;  4FWD A;  4PT5 A;  1E9R A;  4WP2 A;  2OOA A;  2N35 A;  4DV7 M;  1EFU B;  3M6A A;  4A3V B;  4HL4 A;  2RGO A;  3HHW A;  2QPA A;  2ZAN A;  4L6V 6;  4LZZ A;  5DYI A;  4DV0 M;  3GQ3 A;  2JXN A;  2M5Z A;  2FOI C;  4DUZ M;  3U6L A;  1IY2 A;  1QUT A;  2DAI A;  2LBC A;  2Z7J A;  3K92 A;  4WUR A;  4S12 A;  3U6M A;  2XFS A;  1E94 E;  4NC6 A;  4NL4 H;  4GRI A;  1YSY A;  2MJ5 B;  1W5T A;  3EIE A;  5H37 D;  1Z5C A;  5ITR A;  3TWK A;  2EUC A;  4Z6Y A;  1IXS B;  2QQ8 A;  2KRU A;  1QAM A;  2RRU A;  4G4N A;  3VKG A;  1VEJ A;  2WZJ A;  4JI1 M;  2QEN A;  1V34 A;  5KPZ A;  2DHR A;  4B3T M;  2DZO B;  4QHS A;  5FTK A;  2LWX A;  1R2Z A;  3PNV A;  1IY0 A;  3GLH A;  5C18 A;  4FCV A;  4RKU F;  5BPV A;  2FH0 A;  1WGN A;  4GKK M;  2CWB A;  2ZTC A;  3T1H M;  4B7F A;  2LHG A;  1HT1 E;  4DV5 M;  4AKI A;  4JI0 M;  3AOG A;  3KOX E;  3GPX A;  4CGY B;  2UUC M;  4FW9 A;  1MN3 A;  1KYI A;  3AFH A;  2DAM A;  3HZJ A;  4MM3 B;  1GVN A;  1QAN A;  3THG A;  2VQF M;  2UUB M;  2DWL A;  3E46 A;  4G6Z A;  1AIP C;  4OW0 A;  1QZE A;  3L2A A;  3C9P A;  1NJG A;  1G71 A;  4QHT A;  2LHC A;  2VF7 A;  4QNM A;  5EP1 A;  4GC9 A;  1V92 A;  2XSZ D;  1OAO C;  4LJ5 A;  3GPU A;  4AI6 A;  3J81 S;  1VEG A;  2I7P A;  2XZU A;  2CFO A;  3L29 A;  1OTR A;  3GLF A;  1WIV A;  2BWE A;  2K6B A;  2A5Y B;  3U5Z B;  2Z8Y M;  4RNA A;  4DR5 M;  3GLI A;  4IBK A;  1XXH B;  3AJI B;  5E26 A;  1N78 A;  2CHQ A;  3W0L B;  3I4V A;  5ITX E;  3U6O A;  3LMM A;  4LFA M;  2JY6 B;  2LVP C;  4AKG A;  4L16 A;  1L2D A;  3JR4 A;  1MJG M;  1D0L A;  2R44 A;  2RKO A;  1IY1 A;  4ZPX A;  3SHF A;  4B7H A;  3TWL A;  2JZ1 A;  4DR3 M;  1NNU C;  1OKS A;  3GLF E;  4DV6 M;  4YHH M;  1Y8G A;  4X62 M;  2LVA A;  2JWS A;  4X64 M;  3MJ5 A;  3RE8 A;  1EE8 A;  2EO2 A;  2HHH M;  2QHO B;  4GHL A;  1PRB A;  4LF5 M;  1IN4 A;  4FCT A;  2Q2E B;  1F4I A;  2Z4R A;  2ZAM A;  3T38 A;  5EXT A;  3AOE A;  4CIS A;  3DFZ A;  1SG9 A;  4REZ A;  4DV1 M;  4B3R M;  2QBY A;  2QP9 X;  1IBM M;  2QSF X;  3VKH A;  3HHZ A;  1J5E M;  2Y0Q A;  3I01 M;  2W82 A;  2YNM D;  3JAM S;  1QVR A;  3T1Y M;  4RF0 A;  1ZMW A;  1IXZ A;  1R7R A;  2L6O A;  3E9S A;  2Z3X A;  5DYG A;  4KO8 A;  4L8R C;  1DGH A;  4ANR A;  8CAT A;  2L4F A;  5EQT A;  2UU9 M;  4M0W A;  1L1T A;  3C3E A;  4D80 A;  4X65 M;  4NXM M;  1JR3 D;  4B3M M;  1WXQ A;  4AG6 A;  3C58 A;  4FWH A;  3E4R A;  2FE8 A;  2WSE F;  1QQW A;  3SAW A;  5DFL A;  2LXE A;  3GP1 A;  4L4U A;  1C7Y A;  1GAB A;  3GRY A;  3LVW A;  2K0B X;  1Z59 A;  2C98 A;  4MGK E;  3J7B A;  2FS1 A;  4FCW A;  4G4Q A;  2GNO A;  3EIH A;  1JR3 E;  1KFV A;  4LG2 A;  3LVV A;  3NWL A;  1N77 A;  3J7A S;  1N33 M;  2F5P A;  1GL6 A;  2RGH A;  3HU2 A;  1PGY A;  1G41 A;  4LJ8 A;  2H1R A;  2XEP A;  4GMQ A;  3FTE A;  3VDP A;  5FTM A;  3DA1 A;  2HAK A;  2WSF F;  5DNY A;  1HNX M;  3GQ4 A;  4G4O A;  4OX9 M;  4DR1 M;  1IQP A;  4LJA A;  4BBA A;  3U60 A;  2O25 A;  3FD9 A;  3QYE A;  3GLH E;  1PM5 A;  2HKJ A;  3I04 M;  2VF8 A;  2C96 A;  2XZF A;  1VDD A;  3PNY A;  2CV2 A;  3FYD A;  2CUZ A;  1IFY A;  3FTD A;  2DZL A;  3UJN A;  3J27 B;  3U6C A;  1KSF X;  3K1J A;  1NHW C;  2MH8 A;  2WSC F;  4JI6 M;  1OIZ A;  3HHX A;  2MR9 A;  2KNV A;  1GJS A;  1XHB A;  3RFW A;  2BNK A;  4IBE A;  2CEA A;  1PJJ A;  3SAR A;  1ZQ9 A;  2R6F A;  1QDR A;  3HJQ A;  1ZMV A;  3H4J A;  3HJS A;  3GQ5 A;  4M9Z A;  2JZ0 A;  1XNR M;  3KOW E;  2J5Y A;  2LTU A;  5KPR A;  3R8F A;  3M0E A;  5EP4 A;  3SYL A;  2CV1 A;  3BXW A;  1QYR A;  4GC5 A;  4DR6 M;  2DKL A;  1WJ7 A;  4JI2 M;  2R46 A;  4UN2 B;  2BWB A;  1QZM A;  5JI3 E;  4LGY A;  3L27 A;  4M9X A;  1BVS A;  2DVW B;  1E9S A;  5EP2 A;  3FE3 A;  3HKP A;  4YY3 M;  1Q3C A;  1VG5 A;  2YR0 A;  5FTJ A;  4GH9 A;  5ITQ A;  5JI2 E;  4DR2 M;  1SXJ D;  3B89 A;  3AKZ A;  2OPF A;  4LF9 M;  3FTF A;  3HU1 A;  5E6J A;  4B3S M;  3HU3 A;  1D0M A;  4I5S A;  1N32 M;  2DWN A;  3KSX A;  3I51 A;  2UXC M;  2O5R A;  5EXP A;  3PVS A;  3GLG B;  3KFU G;  1MX0 A;  2JUJ A;  1SXJ E;  3GLH B;  2ZAO A;  4DR4 M;  3HGI A;  3KS4 A;  1G59 A;  2JY7 A;  2Y21 A;  2X8A A;  1LV7 A;  3TQS A;  3A98 B;  4NOO B;  2F5Q A;  4LF8 M;  3KP1 E;  1J09 A;  4L15 A;  4LRT A;  1NV8 A;  4DBG B;  5FTL A;  1L8Q A; 
#chains in the Genus database with same CATH homology
 3FKE A;  3SBJ A;  2VQE M;  2KXE A;  3HHY A;  2KZS A;  2XFT A;  3U61 A;  3U6Q A;  2CE7 A;  5KPT A;  2V1U A;  3UK6 A;  3LQR A;  2C5R A;  1XMQ M;  2F5N A;  1YUB A;  3KP0 E;  1FJG M;  1SXJ A;  3SAU A;  4MGI E;  2KZU A;  5GKN A;  1J7K A;  3HJ8 A;  4CHT B;  4JI3 M;  3KSJ A;  4GHA A;  4NRV A;  2KW0 A;  3I4Y A;  4OVZ B;  3ILK A;  3GLI B;  4MGH A;  2UXD M;  1I4W A;  2CHV A;  5KQ8 A;  1D2N A;  1IBK M;  4RF1 A;  3GO8 A;  1K3X A;  2DZN B;  4I8O A;  4AW4 A;  3KOY E;  1IBL M;  3IG5 A;  2DWM A;  2X4A A;  5FSW A;  3MHV C;  4PCZ A;  4LCB A;  4GIP A;  1IXR C;  1X37 A;  4LY6 A;  1TH4 A;  4AZF A;  4DV2 M;  3MK6 A;  4G4R A;  4IBG A;  1GKI A;  4I4L A;  2D7H A;  3GRU A;  4IIW A;  5LMU M;  1G3I A;  1N36 M;  1OJL A;  4IBF A;  4LJ4 A;  2D7G A;  4JYA M;  4AQY M;  3U5Z A;  2ZBK B;  1HR0 M;  3DZD A;  2HCB A;  3FTC A;  1W5S A;  3SAT A;  3SMS A;  3FYC A;  2G8L A;  2F4V M;  3H4M A;  2R4E A;  2UUA M;  2NQ8 C;  3KXE C;  4KHP M;  1TH2 A;  2YQZ A;  4GKJ M;  1TDZ A;  3FUW A;  1Z5A A;  3PFI A;  4IBD A;  5EP3 A;  2VII A;  3FUU A;  2M60 A;  1DGH B;  1NSF A;  2C9C A;  4JXJ A;  1N75 A;  1R2Y A;  4NXN M;  4DR7 M;  3A45 A;  1NHG C;  3B9P A;  5C1B A;  2C9O A;  3IG8 A;  4IBI A;  5LMN M;  1UM8 A;  3KDS E;  2HL7 A;  3FUT A;  4II7 A;  3W0F A;  1MU5 A;  2BJV A;  4OU7 A;  4MH0 E;  4W5W A;  1GLN A;  3PXG A;  3J2P B;  5IWA M;  4TUW A;  4P16 A;  3T15 A;  3GRR A;  1G8P A;  1JR3 A;  1OFI A;  4NSR A;  3WHK A;  2QBY B;  1Z6T A;  3TL4 X;  2XF3 A;  3HWS A;  3UGJ A;  1Q39 A;  5IZ7 D;  4IBC A;  2ZM6 M;  1HNZ M;  2X49 A;  3SAS A;  1HQY E;  2KEB A;  2R62 A;  4R7G A;  3U6D A;  5FTN A;  3J80 S;  1E32 A;  3RGS A;  3KS8 A;  4XBO A;  2OQ4 A;  3AL0 C;  3TE6 A;  1ORY B;  1NY5 A;  3SFZ A;  2LH0 A;  3A42 A;  1PJI A;  4QOS A;  3AOE C;  2CV0 A;  4NRW A;  1IN6 A;  2R18 A;  5EXS A;  7CAT A;  5ITT A;  1H6U A;  2J7O A;  3GRV A;  2I7N A;  4GIT A;  4M9S A;  1T3T A;  4LFC M;  2UXB M;  5ITX A;  3L25 A;  3K8Z A;  1IM2 A;  2F5O A;  3U6P A;  5A2Q S;  1K3W A;  4DUY M;  4JI4 M;  3SAV A;  4LF7 M;  3KW6 A;  4JV5 M;  2Z4S A;  1G4A E;  2L7I A;  3Q8X A;  3DOA A;  3UZU A;  3A46 A;  4PDI A;  2EA0 A;  1R6B X;  3M7G A;  1K82 A;  2E5L M;  2DXI A;  4R3D A;  2XGN A;  3VLF B;  3L28 A;  2F5S A;  3AV0 A;  3SHG B;  3LQQ A;  4IBB A;  4LZJ A;  4LRS A;  2J7N A;  1XWI A;  2FFJ A;  4IJF A;  4M0D A;  5FLX S;  4JI5 M;  3ZC7 B;  4MGZ E;  3U6E A;  1L2C A;  1NJF A;  3GLG A;  1NNJ A;  4MGY E;  2XLJ A;  1HT2 E;  2LNH C;  2R45 A;  1QAO A;  4JI8 M;  3CF6 E;  4BLC A;  1C1K A;  3CF0 A;  1XMO M;  3KVW A;  5EXX A;  3ZCB B;  1DO2 A;  1YE9 A;  4JI7 M;  1XXH A;  4LJ9 A;  2XSZ A;  5IRE B;  3CF2 A;  3OTO M;  4DV3 M;  3VK8 A;  1HNW M;  2QZ4 A;  1TGU A;  1L1Z A;  3SYK A;  3D8L A;  4Z8X A;  4LFB M;  3BOS A;  2FNA A;  4LJ7 A;  1I94 M;  3UMM A;  3JR5 A;  3TWM A;  3VFD A;  3KOZ E;  4IBJ A;  4PDG A;  4XGI A;  3U61 B;  1OFH A;  5BR8 M;  2P5T A;  4AG5 A;  1ZAE A;  2XH9 A;  2G5G X;  4JN6 A;  1NVM A;  3CTW B;  5IT9 S;  1TDH A;  1FNN A;  2DWZ B;  4FD2 A;  2V1C A;  2Y20 A;  3NBI A;  3D8B A;  4L78 A;  4K0K M;  3FUV A;  4FWG A;  4HLQ A;  3RGP A;  3WHL A;  5KQD A;  2AHM A;  2CHG A;  4IJE A;  2V6Z M;  1JQJ C;  3GPP A;  1DO0 A;  3GLF B;  3TPZ A;  4MB7 A;  4WW0 A;  5ITY A;  3QWL A;  4D82 A;  4AKH A;  1XNQ M;  1QAQ A;  1N34 M;  2QCU A;  4B08 A;  3GPY A;  4KOD A;  4BB9 A;  3K2L A;  4LF4 M;  1SXJ B;  1IN5 A;  1DGG A;  4DV4 M;  1IN8 A;  1TH3 A;  1XC8 A;  4LJ6 A;  1DGB A;  4ITQ A;  4OVZ A;  4NSO B;  3QAU A;  4QOZ C;  3FUX A;  2JA2 A;  1IN7 A;  4LGM A;  2ERC A;  2KA6 B;  1Q3B A;  4KLN A;  2L7H A;  5ITU A;  3VK7 A;  5F3W A;  4X66 M;  5KO3 A;  4D81 A;  3ZH9 B;  1GL7 A;  2R4J A;  1L2B A;  3L26 A;  2KRK A;  2Y0T A;  1S3S A;  2C99 A;  2BJW A;  3VDU A;  4EIW A;  5EJC A;  3R9X B;  1SXJ C;  1DGF A;  3U60 B;  2D7E A;  3U6S A;  4QNR A;  3SC3 A;  4B7G A;  2YFQ A;  4LF6 M;  4PD2 A;  1HQC A;  4FVM A;  4I81 A;  3SMP A;  2L09 A;  1NY6 A;  2K47 A;  2R65 A;  1Z5B A;  4FWD A;  4PT5 A;  1E9R A;  4DV7 M;  3M6A A;  4A3V B;  4HL4 A;  2RGO A;  3HHW A;  2QPA A;  2ZAN A;  4LZZ A;  5DYI A;  4DV0 M;  3GQ3 A;  2M5Z A;  2FOI C;  4DUZ M;  3U6L A;  1IY2 A;  2Z7J A;  3K92 A;  4WUR A;  4S12 A;  3U6M A;  2XFS A;  1E94 E;  4NL4 H;  4GRI A;  1YSY A;  1W5T A;  3EIE A;  5H37 D;  1Z5C A;  5ITR A;  3TWK A;  2EUC A;  4Z6Y A;  1IXS B;  2KRU A;  1QAM A;  4G4N A;  3VKG A;  4JI1 M;  2QEN A;  5KPZ A;  2DHR A;  4B3T M;  2DZO B;  4QHS A;  5FTK A;  2LWX A;  1R2Z A;  3PNV A;  1IY0 A;  3GLH A;  5C18 A;  4FCV A;  5BPV A;  4GKK M;  3T1H M;  4B7F A;  1HT1 E;  4DV5 M;  4AKI A;  4JI0 M;  3AOG A;  3KOX E;  3GPX A;  4CGY B;  2UUC M;  4FW9 A;  1KYI A;  3AFH A;  4MM3 B;  2UUB M;  1GVN A;  1QAN A;  3THG A;  2VQF M;  2DWL A;  4G6Z A;  4OW0 A;  3L2A A;  1NJG A;  4QHT A;  4QNM A;  5EP1 A;  4GC9 A;  2XSZ D;  4LJ5 A;  3GPU A;  4AI6 A;  3J81 S;  2I7P A;  2XZU A;  2CFO A;  3L29 A;  3GLF A;  2A5Y B;  3U5Z B;  4DR5 M;  4RNA A;  3GLI A;  4IBK A;  1XXH B;  3AJI B;  5E26 A;  1N78 A;  2CHQ A;  3W0L B;  3I4V A;  5ITX E;  3U6O A;  3LMM A;  4LFA M;  4AKG A;  4L16 A;  1L2D A;  3JR4 A;  2RKO A;  4ZPX A;  1IY1 A;  3SHF A;  4B7H A;  3TWL A;  4DR3 M;  1NNU C;  4DV6 M;  4YHH M;  4X62 M;  4X64 M;  3MJ5 A;  3RE8 A;  1EE8 A;  2EO2 A;  2HHH M;  4GHL A;  4LF5 M;  1IN4 A;  4FCT A;  2Q2E B;  2Z4R A;  2ZAM A;  3T38 A;  5EXT A;  3AOE A;  4CIS A;  3DFZ A;  4REZ A;  4DV1 M;  4B3R M;  2QBY A;  2QP9 X;  1IBM M;  3VKH A;  3HHZ A;  1J5E M;  2Y0Q A;  2W82 A;  2YNM D;  3JAM S;  1QVR A;  3T1Y M;  4RF0 A;  1IXZ A;  1R7R A;  2L6O A;  3E9S A;  2Z3X A;  5DYG A;  4KO8 A;  4L8R C;  1DGH A;  8CAT A;  5EQT A;  2UU9 M;  4M0W A;  1L1T A;  4D80 A;  4X65 M;  4NXM M;  1JR3 D;  4B3M M;  1WXQ A;  4AG6 A;  3C58 A;  4FWH A;  3E4R A;  2FE8 A;  1QQW A;  3SAW A;  2LXE A;  3GP1 A;  4L4U A;  3GRY A;  3LVW A;  4MGK E;  1Z59 A;  2C98 A;  3J7B A;  4FCW A;  4G4Q A;  3EIH A;  1KFV A;  4LG2 A;  3LVV A;  3NWL A;  1N77 A;  3J7A S;  1N33 M;  2F5P A;  1GL6 A;  2RGH A;  3HU2 A;  1G41 A;  4LJ8 A;  2H1R A;  2XEP A;  4GMQ A;  3FTE A;  3VDP A;  5FTM A;  3DA1 A;  5DNY A;  4OX9 M;  1HNX M;  3GQ4 A;  4G4O A;  4DR1 M;  1IQP A;  4LJA A;  4BBA A;  3U60 A;  3FD9 A;  1PM5 A;  2HKJ A;  2C96 A;  2XZF A;  1VDD A;  3PNY A;  2CV2 A;  3FYD A;  2CUZ A;  3FTD A;  3UJN A;  3J27 B;  3U6C A;  1KSF X;  3K1J A;  1NHW C;  4JI6 M;  3HHX A;  1XHB A;  3RFW A;  2BNK A;  4IBE A;  2CEA A;  1PJJ A;  3SAR A;  1ZQ9 A;  3HJQ A;  3HJS A;  3GQ5 A;  4M9Z A;  1XNR M;  3KOW E;  5KPR A;  3R8F A;  3M0E A;  5EP4 A;  3SYL A;  2CV1 A;  4GC5 A;  1QYR A;  4DR6 M;  4JI2 M;  2R46 A;  1QZM A;  5JI3 E;  4LGY A;  3L27 A;  4M9X A;  2DVW B;  5EP2 A;  1E9S A;  3HKP A;  4YY3 M;  1Q3C A;  2YR0 A;  5FTJ A;  5ITQ A;  4GH9 A;  5JI2 E;  4DR2 M;  1SXJ D;  3AKZ A;  2OPF A;  4LF9 M;  3FTF A;  3HU1 A;  5E6J A;  4B3S M;  3HU3 A;  1N32 M;  4I5S A;  2DWN A;  3KSX A;  3I51 A;  2UXC M;  2O5R A;  5EXP A;  3PVS A;  3GLG B;  3KFU G;  1MX0 A;  3GLH B;  1SXJ E;  4DR4 M;  2ZAO A;  3HGI A;  3KS4 A;  1G59 A;  2Y21 A;  2X8A A;  1LV7 A;  3TQS A;  3A98 B;  4NOO B;  2F5Q A;  4LF8 M;  3KP1 E;  1J09 A;  4L15 A;  4LRT A;  5FTL A;  1L8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...