4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
3GPYA 4DV1M 3VK7A 4K0KM 2UUAM 5A2QS 3U6QA 3GQ5A 4DV2M 1Z5CA 4MB7A 1Q3CA 4DV4M 3SBJA 5ITXA 1XMQM 1Q39A 4JI1M 3A42A 2F5QA 1L2CA 4DV6M 4NRVA 1XMOM 2F5OA 1N34M 3GPPA 3U6LA 1K3XA 2F5SA 1XNQM 1N36M 1EE8A 3U6PA 3JR4A 4X64M 2VQFM 2EA0A 3TWLA 3SARA 1XNRM 4JI7M 1HNZM 2F5NA 4DR7M 4DR3M 2UU9M 4LF4M 4NRWA 4DR1M 1Q3BA 3GPXA 1Z59A 1R2YA 1L1TA 3J7AS 4KHPM 4LFBM 3TWMA 3T1YM 3A45A 3SAWA 1PJIA 5ITYA 2UUCM 5ITQA 4YHHM 2OPFA 4G4QA 3DOAA 4LF8M 3GQ3A 1MX0A 3SAVA 3T1HM 4LFAM 4DR5M 4PCZA 2XZFA 1R2ZA 2XZUA 4JI8M 3U6MA 4B3SM 4G4NA 1TDHA 4PD2A 4B3MM 4X62M 3SASA 2UXBM 4DV7M 1N33M 3W0FA 1XC8A 4DUZM 4NXNM 2HHHM 4DV3M 3JAMS 5IWAM 1PM5A 1L2BA 3U6CA 1HR0M 4NXMM 4JV5M 2HKJA 4JI6M 3U6SA 1K82A 1HNWM 4PDIA 5BR8M 2UUBM 5IT9S 3TWKA 2VQEM 1J5EM 4GKKM 4JI0M 4B3TM 3SAUA 1N32M 3SATA 3GQ4A 2F4VM 1L1ZA 1IBKM 1L2DA 5LMNM 1IBLM 1Z5AA 3A46A 3U6DA 4LF5M 3C58A 3GO8A 1NNJA 4JI3M 5ITXE 3VK8A 4G4OA 4OX9M 3OTOM 5LMUM 1K3WA 4GKJM 1TDZA 1HNXM 4JYAM 1Z5BA 1FJGM 3GPUA 4YY3M 1KFVA 2E5LM 4X65M 3J81S 4DV0M 4DR6M 4LF6M 2UXCM 4B3RM 3U6OA 2UXDM 3GP1A 2ZM6M 4DV5M 3J80S 4LF9M 4DR2M 3U6EA 4DR4M 4JI2M 4LF7M 1PJJA 5ITUA 5FLXS 2F5PA 4CISA 4X66M 3JR5A 4PDGA 1IBMM 4DUYM 4AQYM 4JI4M 1I94M 1MU5A 5ITTA 4ITQA 5ITRA 2ZBKB 4LFCM 4JI5M 4G4RA 2OQ4A 2Q2EB
chains in the Genus database with same CATH superfamily
2LXEA 2QP9X 2RGHA 3H4JA 3VK7A 3I04M 3T38A 2D7GA 3ZQJA 2XSZD 4MGIE 4DV2M 2JZ0A 1SXJB 5FTLA 1DGBA 4GC5A 2DI0A 1IFYA 5ITXA 3D8LA 2Z3XA 3T6PA 3B9PA 4JI1M 3A42A 3T15A 2A5YB 4RF0A 1JQJC 4L8RC 4DV6M 3R9XB 3J27B 3RE8A 2BJVA 1E9RA 2C9CA 2MH8A 3HJSA 3GPPA 1DO2A 1KSFX 1IN8A 1NJGA 2G5GX 3KDSE 4R7GA 1EE8A 5FTKA 1IXRC 3HGIA 2O25A 3U61B 1GVNA 3GLIB 2VQFM 1T3TA 4GHLA 1XNRM 4LJ7A 1WGNA 2H5XA 3UMMA 1YE9A 3GRUA 1Q3BA 3L25A 4A3VB 3J7AS 1WXQA 3U5ZB 3PNYA 4KHPM 2HCBA 4LFBM 1NHGC 3FTEA 1IY2A 5BPVA 1VDLA 1IN4A 4KT0F 2R65A 5ITYA 1XWIA 1QYRA 1OFHA 1N75A 3SC3A 1OKSA 2D7HA 1R6BX 1RU3A 2OPFA 4G4QA 4LF8M 4MH0E 4QHSA 4I4LA 1HT1E 1MX0A 2R45A 4M9ZA 4OVZA 1NO1A 2DWMA 1QZMA 2KZUA 3DA1A 4Z6YA 2K6BA 4DR5M 2N35A 4JI8M 1R2ZA 3FE3A 2OOBA 1E32A 5KPTA 4AKHA 4B3MM 4X62M 1L8QA 3B7ZA 3W0FA 1XXHA 1Q02A 1UFZA 1GO5A 2FNAA 4NXNM 2XSZA 2HHHM 2JY8A 2DAIA 4B7FA 2CP8A 3QAUA 1PM5A 2YR0A 4BB9A 1AIPC 3KP1E 4WP2A 2X4AA 3TQSA 2DAEA 3B74A 1K82A 4LJ4A 2LTUA 3KOXE 4MGHA 3RFWA 1R5LA 5FSWA 2UUBM 4B08A 1PGYA 3TWKA 1WJ7A 4GKKM 2YQZA 4FWDA 4GHAA 3K9OA 3MHVC 5IREB 2R6FA 4LJ8A 1WGLA 4QNMA 3SHFA 4IBFA 3U6DA 5F3WA 4FCWA 3BBZA 4M0DA 5GKNA 3GO8A 1QZEA 2R4EA 4OU7A 4LZJA 3THGA 3GLGB 2CFOA 3OTOM 4JYAM 4GKJM 4B7GA 2M60A 1UM8A 4D81A 3FYDA 3K1JA 2FFJA 3AOEC 1XHBA 7CATA 2MGWA 3J81S 3U60B 2VF8A 4LF6M 4MM3B 2R18A 3E46A 2EO2A 5FTMA 2BWEA 3AFHA 3J80S 4DR2M 1OIPA 2WSFF 4D82A 3MK6A 2L7HA 3KS8A 2I7NA 3UJNA 2DENA 2KNAA 4CISA 4FWHA 2EJSA 4X66M 4JI4M 3FUTA 3GLFB 2LVQD 2JY5A 2WSEF 1I4WA 3FUXA 3VDUA 2DAMA 3FRIA 1OIZA 4XBOA 3V76A 4JI5M 3I51A 4P16A 1F4IA 2ZAMA 3GRYA 4GC9A 4LGMA 3AL0C 2FOIC 2JNHA 2JUJA 2JY6B 2QSFX 4DV1M 5EP2A 1FNNA 2UUAM 5EXXA 3U6QA 3HJQA 4NSRA 3RGSA 1IN7A 1MN3A 1Z5CA 2JXNA 4MB7A 1DGFA 1Q3CA 3U61A 5L8RF 3GLIA 2JP7A 2ZTCA 1VDDA 5KQ8A 3ZH9B 1WIVA 3KOZE 4M0WA 4AKIA 4FVMA 2QNJA 1QQWA 2J5YA 1L2CA 2Y20A 1VEGA 1NVMA 2CEAA 2O5RA 4NRVA 4QOZC 3U5ZA 1N34M 2KRKA 3J2PB 3U6LA 2KNZA 5JI3E 3FYCA 3GLHE 4IBIA 3AKZA 1YLAA 1OAIA 1TR8A 4I5SA 1ZMVA 4IBEA 5EXPA 2EA0A 1XB2B 2DKLA 2XH9A 3LCUA 2KRUA 4IBKA 4L15A 4L4UA 2CHGA 3TWLA 4JI7M 4R3DA 2L4EA 4AG6A 2F5NA 4DR3M 1QAMA 3KXEC 2LBCA 4LZZA 2DHYA 2Y0QA 2L2DA 2CV1A 3KW6A 2R4JA 3KOWE 4Q7JA 4AG5A 3FTCA 2K0BX 4KODA 1QANA 2C96A 2JZ1A 2P5TA 3A45A 1QDTA 3T1YM 2YNMD 1PJIA 1X37A 3K8ZA 2UUCM 1E9SA 2LVAA 2HL7A 1G8PA 3W68A 1OAOC 1NV8A 3GQ3A 3HZJA 2R62A 2K47A 3F92A 1C1KA 3M7GA 4LFAM 1G59A 4PCZA 2XZFA 1DGGA 1TH3A 1GJTA 4NSOB 1JR3D 4IJEA 1NY6A 1TDHA 4M9SA 3TL4X 3SASA 2UXBM 4DV7M 4RKUF 2FS1A 3L27A 1WR1B 3WHKA 2RRUA 4DV3M 4S12A 5IWAM 2QBYA 3PFIA 4JV5M 4GIPA 5EP1A 2HKJA 3J7BA 2R46A 4JI6M 1OFIA 3ZCBB 4FW9A 4F1IA 3KFUG 4G6ZA 5BR8M 3U60A 3I4YA 3AV0A 3SAUA 1SXJD 2DNAA 1N32M 2GNOA 3EIEA 1L1ZA 1IBKM 4JXJA 4NOOB 3C58A 3AJIB 3VLFB 4JI3M 1GLNA 5EQTA 3ZC7B 2D7EA 5ITXE 1VG5A 3VK8A 2DXIA 1K3WA 4OX9M 3GRVA 1DGHB 1G71A 1HNXM 1D0MA 3SHGB 3UZUA 2Z4RA 5KQDA 4YY3M 3GLFA 1FJGM 4DV0M 4DBGB 4DR6M 1HT2E 3K92A 4LJ6A 1D0KA 3L28A 2Z4SA 5H37D 2ZM6M 4AKGA 1Z6TA 4ZPXA 2DVWB 3W0LB 3HHXA 2XEPA 4DR4M 1HJPA 1TGUA 4LF7M 1W5TA 3PVSA 1PJJA 5FLXS 4AQYM 4EIWA 1J7KA 5ITTA 4ITQA 5FTNA 1VEKA 2CWBA 3MJ5A 2M5ZA 3TPZA 2L6OA 2BWBA 3D8BA 1TTEA 3LW5F 4Y28F 1GKIA 1JR3A 2OQ4A 2EKFA 4FD2A 2Q2EB 3GPYA 4K0KM 2QPAA 5A2QS 3E9SA 3L26A 3GQ5A 2DZNB 1GJSA 1QAOA 3FUWA 3FUUA 3LMMA 4DV4M 3IHPA 1XMQM 5C18A 5DNYA 4CIZA 1ORYB 2R44A 2F5QA 2KA6B 2QHOB 4IJFA 4UN2B 4BLCA 1XMOM 2Y21A 2XLJA 4L78A 1XXHE 3LCVB 2EKKA 1SXJA 3Q8GA 4QOSA 1K3XA 1XNQM 3K9PA 1C7YA 1IN6A 1ZQ9A 3JR4A 2DHRA 3A98B 3SARA 3LQRA 3QYBA 1HNZM 4DR7M 1YUBA 3AOEA 4LF4M 4DR1M 2Y0TA 3HKPA 3GPXA 2CV0A 1R2YA 2K9DA 2QENA 3CGWA 3HHWA 4OVZB 3HX3A 4L6V6 3RGPA 4LJ5A 2JA2A 1QDRA 4XK8F 3TWMA 1Y8GA 4W5WA 4CGYB 3SAWA 3SMSA 1JR3E 2BJWA 2WZJA 2ZAOA 4D80A 4KLNA 1XXHB 4YHHM 3DOAA 3MMPA 2DWZB 2WSCF 3AOGA 3SAVA 3T1HM 2OO9A 3FD9A 2R0IA 3E4RA 5C1BA 2CE7A 4G4NA 4IBBA 2XF3A 4R71A 1QVRA 1H6UA 3HHZA 3W67A 1XC8A 2DAKA 4AZFA 5E6JA 2XFTA 4DUZM 4MGYE 4II7A 2C98A 4WURA 1NY5A 1SXJE 1HR0M 4NXMM 1YSYA 2G8LA 4F2LA 1OQYA 3HY5A 1R7RA 4QNRA 1DGHA 3K2LA 1HNWM 1J09A 1SG9A 2KEBA 3EIHA 4L16A 1LV7A 2LHGA 2QQ8A 2NQ8C 2G3QA 1J5EM 1EFUB 3FKEA 1N77A 1IY1A 2B3TA 4IBCA 4I8OA 3GLHB 1W5SA 1Z5AA 3A46A 1IBLM 5E26A 3GLIE 1NNJA 3BOSA 5DYIA 3B89A 4IBJA 4G4OA 1G4AE 2CRUA 2MROB 5LMUM 3Q8XA 1TDZA 1QUSA 2HAKA 4WW0A 3GPUA 4IBDA 2KXEA 2LWXA 4HLQA 1E94E 4B3RM 3B7NA 3U6OA 1NSFA 3FRHA 1NNUC 3WHLA 3GP1A 1R4GA 4REZA 4LF9M 1WHCA 3CF0A 2LVNC 3ILKA 3L2AA 5FTJA 3FTFA 3GLGA 2DZOB 2LHCA 2AHMA 3UK6A 5EP4A 2F5PA 2DAGA 1V34A 3KSJA 4NC6A 4CJ6A 4PDGA 1IBMM 4AI6A 4I81A 4LCBA 3HHYA 1I94M 3VFDA 4MGKE 2X49A 5ITRA 2GQFA 4LRSA 5KPRA 4LFCM 2LH0A 2V6ZM 1GL7A 2C99A 4G4RA 1QUTA 1VEJA 1ZAEA 3LQQA 4BBAA 4AW4A 2KW0A 4XGIA 2FH0A 2BNKA 3NBIA 1IXSB 4P17A 4FWGA 3SMPA 3IG8A 3VDPA 3KSXA 1ZMUA 1LTMA 1PJTA 1IY0A 4LJAA 1BVSA 2ERCA 3SBJA 2V1CA 3B7QA 5IZ7D 2KNVA 1Q39A 2I7PA 1QAQA 2H1RA 3DZDA 1G41A 3L29A 1TH4A 2RGOA 3R8FA 2J7NA 2ZANA 3PNVA 2F5OA 2RKOA 2CHQA 3I01M 1D0LA 3UGJA 2F5SA 4FCVA 1N36M 2LVPC 2CHVA 3FTDA 4LG2A 1IQPA 3U6PA 5EXSA 3VKGA 4NL4H 4X64M 3C3EA 3KP0E 1NJFA 4GMQA 4JN6A 3GLGE 2YFQA 2CUZA 2UU9M 4NRWA 1IM2A 5KO3A 2W82A 1Z59A 3GRRA 4GRIA 4KO8A 1L1TA 2L09A 1DV0A 2QCUA 1V33A 1GL6A 3VKHA 1PRBA 3KS4A 3SYKA 1S3SA 2L7IA 1N78A 3BXWA 4QHTA 1A5TA 1DO0A 2ZTDA 3IG5A 5ITQA 1AUAA 3GLFE 1MJGM 4RF1A 4RNAA 4LJ9A 3M6AA 1SXJC 2EUCA 2VF7A 3LVVA 2CV2A 1IXZA 3M0EA 4OW0A 2QBYB 2KHHA 4LY6A 3SYLA 2XZUA 2LNHC 3E21A 2HWJA 4GEWA 4LGYA 4CHTB 3U6MA 2DWNA 4PD2A 4B3SM 3I4VA 1TH2A 5EP3A 3FUVA 1N33M 3DFZA 3HJ8A 2V1UA 2MR9A 3GLHA 4TUWA 3JAMS 3CF6E 1L2BA 4M9XA 3U6CA 1G3IA 3CTWB 2DZLA 1IN5A 3LVWA 1JB0F 2KZSA 3U6SA 2J7OA 5EXTA 1V92A 1TF0B 1T43A 2X8AA 4PDIA 5IT9S 3QWLA 8CATA 1EIJA 1NV9A 2VQEM 2O01F 4FCTA 4JI0M 3HU2A 4B3TM 3HWSA 2KDLA 3SATA 3GQ4A 4GITA 3TE6A 2F4VM 2FE8A 4HL4A 1L2DA 5LMNM 4GH9A 2LVOC 4LRTA 4LF5M 3PXGA 2JY7A 2VIIA 5JI2E 4HEOA 5DYGA 1Z5BA 1CUKA 2E5LM 3HU1A 3SFZA 4X65M 2VDBB 3HU3A 1ZV1A 1KFVA 1HQYE 1OJLA 4MGZE 2UXCM 2APLA 1PJSA 5EJCA 2UXDM 1PJQA 4G3OA 3KOYE 4B7HA 4DV5M 2DWLA 1T6OA 1OTRA 2JWSA 2C9OA 3QYEA 4IIWA 1P3QQ 2QZ4A 4Z8XA 1IXSA 3U6EA 3KVWA 4JI2M 3H4MA 3CF2A 3IECA 1KYIA 5ITUA 4IBGA 3JR5A 2L4FA 4DUYM 3C9PA 2XFSA 1GABA 1MU5A 2Z7JA 2OOAA 3NBXX 2Z8YM 3NWLA 5DFLA 2ZBKB 5KPZA 2C5RA 4PT5A 2MJ5B 2XGNA 1D2NA 4ANRA 1VQ1A 3C3DA 1ZMWA 1NHWC 1HQCA
chains in the Genus database with same CATH topology
2LXEA 2QP9X 2RGHA 3VK7A 3T38A 2D7GA 2XSZD 4MGIE 4DV2M 1SXJB 5FTLA 1DGBA 4GC5A 5ITXA 3D8LA 2Z3XA 3B9PA 4JI1M 3A42A 3T15A 2A5YB 4RF0A 1JQJC 4L8RC 4DV6M 3R9XB 3J27B 3RE8A 2BJVA 1E9RA 2C9CA 3GPPA 3HJSA 1DO2A 1KSFX 1IN8A 1NJGA 2G5GX 3KDSE 4R7GA 1EE8A 5FTKA 1IXRC 3HGIA 3U61B 1GVNA 3GLIB 2VQFM 1T3TA 4GHLA 1XNRM 4LJ7A 3UMMA 1YE9A 3GRUA 1Q3BA 3L25A 4A3VB 3J7AS 1WXQA 3U5ZB 3PNYA 4KHPM 2HCBA 4LFBM 1NHGC 3FTEA 1IY2A 5BPVA 1IN4A 2R65A 5ITYA 1XWIA 1QYRA 1OFHA 1N75A 3SC3A 2D7HA 1R6BX 2OPFA 4G4QA 4LF8M 4MH0E 4QHSA 4I4LA 1HT1E 1MX0A 2R45A 4M9ZA 4OVZA 1QZMA 2KZUA 3DA1A 4Z6YA 4DR5M 4JI8M 1R2ZA 1E32A 5KPTA 4AKHA 4B3MM 4X62M 1L8QA 3W0FA 1XXHA 2FNAA 4NXNM 2XSZA 2HHHM 4B7FA 1PM5A 3QAUA 2YR0A 4BB9A 3KP1E 2X4AA 3TQSA 1K82A 4LJ4A 3KOXE 4MGHA 3RFWA 5FSWA 2UUBM 4B08A 3TWKA 4GKKM 2YQZA 4FWDA 4GHAA 3MHVC 5IREB 4LJ8A 4QNMA 3SHFA 4IBFA 3U6DA 5F3WA 4FCWA 4M0DA 5GKNA 3GO8A 2R4EA 4OU7A 4LZJA 3THGA 3GLGB 2CFOA 3OTOM 4JYAM 4GKJM 4B7GA 2M60A 1UM8A 4D81A 3FYDA 3K1JA 2FFJA 3AOEC 1XHBA 7CATA 3J81S 3U60B 4LF6M 4MM3B 2R18A 2EO2A 5FTMA 3AFHA 3J80S 4DR2M 4D82A 3MK6A 2L7HA 3KS8A 2I7NA 3UJNA 4CISA 4FWHA 4X66M 4JI4M 3FUTA 3GLFB 3VDUA 1I4WA 3FUXA 4XBOA 4JI5M 3I51A 4P16A 2ZAMA 3GRYA 4GC9A 4LGMA 3AL0C 2FOIC 4DV1M 5EP2A 1FNNA 2UUAM 5EXXA 3U6QA 3HJQA 4NSRA 3RGSA 1IN7A 1Z5CA 4MB7A 1DGFA 1Q3CA 3U61A 3GLIA 1VDDA 5KQ8A 3ZH9B 3KOZE 4M0WA 4AKIA 4FVMA 1QQWA 1L2CA 2Y20A 1NVMA 2CEAA 2O5RA 4NRVA 4QOZC 3U5ZA 1N34M 2KRKA 3J2PB 3U6LA 5JI3E 3FYCA 4IBIA 3AKZA 4I5SA 4IBEA 5EXPA 2EA0A 4IBKA 4L15A 2XH9A 4L4UA 2KRUA 3TWLA 4JI7M 2CHGA 4R3DA 4AG6A 2F5NA 4DR3M 1QAMA 3KXEC 4LZZA 2Y0QA 2CV1A 3KW6A 2R4JA 3KOWE 4AG5A 3FTCA 4KODA 1QANA 2C96A 2P5TA 3A45A 3T1YM 1PJIA 2YNMD 1X37A 3K8ZA 2UUCM 1E9SA 2HL7A 1G8PA 3GQ3A 2R62A 2K47A 1C1KA 3M7GA 4LFAM 4PCZA 2XZFA 1DGGA 1TH3A 4NSOB 1JR3D 4IJEA 1NY6A 1TDHA 4M9SA 3TL4X 3SASA 2UXBM 4DV7M 3L27A 3WHKA 4DV3M 4S12A 5IWAM 2QBYA 3PFIA 4JV5M 4GIPA 5EP1A 2HKJA 3J7BA 2R46A 4JI6M 1OFIA 3ZCBB 4FW9A 3KFUG 4G6ZA 5BR8M 3U60A 3I4YA 3AV0A 3SAUA 1SXJD 1N32M 3EIEA 1L1ZA 1IBKM 4JXJA 4NOOB 3C58A 3AJIB 3VLFB 4JI3M 1GLNA 5EQTA 3ZC7B 2D7EA 5ITXE 3VK8A 2DXIA 4OX9M 1K3WA 3GRVA 1DGHB 1HNXM 3SHGB 3UZUA 2Z4RA 5KQDA 4YY3M 3GLFA 1FJGM 4DV0M 4DR6M 1HT2E 3K92A 4LJ6A 3L28A 2Z4SA 5H37D 2ZM6M 4AKGA 1Z6TA 4ZPXA 2DVWB 3W0LB 3HHXA 2XEPA 4DR4M 1TGUA 4LF7M 1W5TA 3PVSA 1PJJA 5FLXS 4AQYM 4EIWA 1J7KA 5ITTA 4ITQA 5FTNA 3MJ5A 2M5ZA 3TPZA 2L6OA 3D8BA 1GKIA 1JR3A 2OQ4A 4FD2A 2Q2EB 3GPYA 4K0KM 2QPAA 5A2QS 3E9SA 3L26A 3GQ5A 2DZNB 1QAOA 3FUWA 3FUUA 3LMMA 4DV4M 1XMQM 5C18A 5DNYA 1ORYB 2F5QA 2KA6B 4IJFA 4BLCA 1XMOM 2Y21A 2XLJA 4L78A 1SXJA 4QOSA 1K3XA 1XNQM 1IN6A 1ZQ9A 3JR4A 2DHRA 3A98B 3SARA 3LQRA 1HNZM 4DR7M 1YUBA 3AOEA 4LF4M 4DR1M 2Y0TA 3HKPA 3GPXA 2CV0A 1R2YA 2QENA 3HHWA 4OVZB 3RGPA 4LJ5A 2JA2A 3TWMA 4W5WA 4CGYB 3SAWA 3SMSA 2BJWA 2ZAOA 4D80A 4KLNA 1XXHB 4YHHM 3DOAA 2DWZB 3AOGA 3SAVA 3T1HM 3FD9A 3E4RA 5C1BA 2CE7A 4G4NA 4IBBA 2XF3A 1QVRA 1H6UA 3HHZA 1XC8A 4AZFA 5E6JA 2XFTA 4DUZM 4MGYE 4II7A 2C98A 4WURA 1NY5A 1SXJE 1HR0M 4NXMM 1YSYA 2G8LA 1R7RA 4QNRA 1DGHA 3K2LA 1HNWM 1J09A 2KEBA 3EIHA 4L16A 1LV7A 2NQ8C 1J5EM 3FKEA 1N77A 1IY1A 4IBCA 4I8OA 3GLHB 1W5SA 1Z5AA 3A46A 1IBLM 5E26A 1NNJA 3BOSA 5DYIA 4IBJA 4G4OA 1G4AE 5LMUM 3Q8XA 1TDZA 4WW0A 3GPUA 4IBDA 2KXEA 2LWXA 4HLQA 1E94E 4B3RM 3U6OA 1NSFA 1NNUC 3WHLA 3GP1A 4REZA 4LF9M 3CF0A 3ILKA 3L2AA 3FTFA 5FTJA 3GLGA 2DZOB 2AHMA 3UK6A 5EP4A 2F5PA 3KSJA 1IBMM 4PDGA 4AI6A 4I81A 4LCBA 3HHYA 1I94M 3VFDA 4MGKE 2X49A 5ITRA 4LRSA 5KPRA 4LFCM 2LH0A 2V6ZM 1GL7A 2C99A 4G4RA 1ZAEA 3LQQA 4BBAA 4AW4A 2KW0A 4XGIA 2BNKA 3NBIA 1IXSB 4FWGA 3SMPA 3IG8A 3VDPA 3KSXA 1IY0A 4LJAA 2ERCA 3SBJA 2V1CA 5IZ7D 1Q39A 2I7PA 1QAQA 2H1RA 3DZDA 1G41A 3L29A 1TH4A 2RGOA 3R8FA 2J7NA 2ZANA 3PNVA 2F5OA 2RKOA 2CHQA 2F5SA 3UGJA 4FCVA 1N36M 2CHVA 3FTDA 4LG2A 1IQPA 3U6PA 5EXSA 3VKGA 4NL4H 4X64M 3KP0E 1NJFA 4GMQA 4JN6A 2YFQA 2CUZA 2UU9M 4NRWA 1IM2A 5KO3A 2W82A 1Z59A 3GRRA 4GRIA 4KO8A 1L1TA 2L09A 2QCUA 1GL6A 3VKHA 3KS4A 3SYKA 1S3SA 2L7IA 1N78A 4QHTA 1DO0A 3IG5A 5ITQA 4RF1A 4RNAA 4LJ9A 3M6AA 1SXJC 2EUCA 3LVVA 2CV2A 1IXZA 3M0EA 4OW0A 2QBYB 4LY6A 3SYLA 2XZUA 2LNHC 4LGYA 3U6MA 2DWNA 4CHTB 4B3SM 4PD2A 3I4VA 1TH2A 5EP3A 3FUVA 1N33M 3DFZA 3HJ8A 2V1UA 3GLHA 4TUWA 3JAMS 3CF6E 1L2BA 4M9XA 3U6CA 1G3IA 3CTWB 1IN5A 3LVWA 2KZSA 3U6SA 2J7OA 5EXTA 2X8AA 4PDIA 5IT9S 3QWLA 8CATA 2VQEM 4FCTA 4JI0M 3HU2A 4B3TM 3HWSA 3SATA 3GQ4A 4GITA 3TE6A 2F4VM 2FE8A 4HL4A 1L2DA 5LMNM 4GH9A 4LF5M 4LRTA 3PXGA 2VIIA 5JI2E 5DYGA 1Z5BA 2E5LM 3HU1A 3SFZA 4X65M 3HU3A 1KFVA 1HQYE 1OJLA 4MGZE 2UXCM 5EJCA 2UXDM 4DV5M 3KOYE 4B7HA 2DWLA 2C9OA 4IIWA 3U6EA 2QZ4A 4Z8XA 3KVWA 4JI2M 3H4MA 3CF2A 1KYIA 5ITUA 4IBGA 3JR5A 4DUYM 2XFSA 1MU5A 2Z7JA 2C5RA 3NWLA 1G59A 2DWMA 2ZBKB 5KPZA 4PT5A 2XGNA 1D2NA 1NHWC 1HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPY A;  4DV1 M;  3VK7 A;  4K0K M;  2UUA M;  5A2Q S;  3U6Q A;  3GQ5 A;  4DV2 M;  1Z5C A;  4MB7 A;  1Q3C A;  4DV4 M;  3SBJ A;  5ITX A;  1XMQ M;  1Q39 A;  4JI1 M;  3A42 A;  2F5Q A;  1L2C A;  4DV6 M;  4NRV A;  1XMO M;  2F5O A;  1N34 M;  3GPP A;  3U6L A;  1K3X A;  2F5S A;  1XNQ M;  1N36 M;  1EE8 A;  3U6P A;  3JR4 A;  4X64 M;  2VQF M;  2EA0 A;  3TWL A;  3SAR A;  1XNR M;  4JI7 M;  1HNZ M;  2F5N A;  4DR7 M;  4DR3 M;  2UU9 M;  4LF4 M;  4NRW A;  4DR1 M;  1Q3B A;  3GPX A;  1Z59 A;  1R2Y A;  1L1T A;  3J7A S;  4KHP M;  4LFB M;  3TWM A;  3T1Y M;  3A45 A;  3SAW A;  1PJI A;  5ITY A;  2UUC M;  5ITQ A;  4YHH M;  2OPF A;  4G4Q A;  3DOA A;  4LF8 M;  3GQ3 A;  1MX0 A;  3SAV A;  3T1H M;  4LFA M;  4DR5 M;  4PCZ A;  2XZF A;  1R2Z A;  2XZU A;  4JI8 M;  3U6M A;  4B3S M;  4G4N A;  1TDH A;  4PD2 A;  4B3M M;  4X62 M;  3SAS A;  2UXB M;  4DV7 M;  1N33 M;  3W0F A;  1XC8 A;  4DUZ M;  4NXN M;  2HHH M;  4DV3 M;  3JAM S;  5IWA M;  1PM5 A;  1L2B A;  3U6C A;  1HR0 M;  4NXM M;  4JV5 M;  2HKJ A;  4JI6 M;  3U6S A;  1K82 A;  1HNW M;  4PDI A;  5BR8 M;  2UUB M;  5IT9 S;  3TWK A;  2VQE M;  1J5E M;  4GKK M;  4JI0 M;  4B3T M;  3SAU A;  1N32 M;  3SAT A;  3GQ4 A;  2F4V M;  1L1Z A;  1IBK M;  1L2D A;  5LMN M;  1IBL M;  1Z5A A;  3A46 A;  3U6D A;  4LF5 M;  3C58 A;  3GO8 A;  1NNJ A;  4JI3 M;  5ITX E;  3VK8 A;  4G4O A;  4OX9 M;  3OTO M;  5LMU M;  1K3W A;  4GKJ M;  1TDZ A;  1HNX M;  4JYA M;  1Z5B A;  1FJG M;  3GPU A;  4YY3 M;  1KFV A;  2E5L M;  4X65 M;  3J81 S;  4DV0 M;  4DR6 M;  4LF6 M;  2UXC M;  4B3R M;  3U6O A;  2UXD M;  3GP1 A;  2ZM6 M;  4DV5 M;  3J80 S;  4LF9 M;  4DR2 M;  3U6E A;  4DR4 M;  4JI2 M;  4LF7 M;  1PJJ A;  5ITU A;  5FLX S;  2F5P A;  4CIS A;  4X66 M;  3JR5 A;  4PDG A;  1IBM M;  4DUY M;  4AQY M;  4JI4 M;  1I94 M;  1MU5 A;  5ITT A;  4ITQ A;  5ITR A;  2ZBK B;  4LFC M;  4JI5 M;  4G4R A;  2OQ4 A;  2Q2E B; 
#chains in the Genus database with same CATH topology
 2LXE A;  2QP9 X;  2RGH A;  3H4J A;  3VK7 A;  3I04 M;  3T38 A;  2D7G A;  3ZQJ A;  2XSZ D;  4MGI E;  4DV2 M;  2JZ0 A;  1SXJ B;  5FTL A;  1DGB A;  4GC5 A;  2DI0 A;  1IFY A;  5ITX A;  3D8L A;  2Z3X A;  3T6P A;  3B9P A;  4JI1 M;  3A42 A;  3T15 A;  2A5Y B;  4RF0 A;  1JQJ C;  4L8R C;  4DV6 M;  3R9X B;  3J27 B;  3RE8 A;  2BJV A;  1E9R A;  2C9C A;  2MH8 A;  3HJS A;  3GPP A;  1DO2 A;  1KSF X;  1IN8 A;  1NJG A;  2G5G X;  3KDS E;  4R7G A;  1EE8 A;  5FTK A;  1IXR C;  3HGI A;  2O25 A;  3U61 B;  1GVN A;  3GLI B;  2VQF M;  1T3T A;  4GHL A;  1XNR M;  4LJ7 A;  1WGN A;  2H5X A;  3UMM A;  1YE9 A;  3GRU A;  1Q3B A;  3L25 A;  4A3V B;  3J7A S;  1WXQ A;  3U5Z B;  3PNY A;  4KHP M;  2HCB A;  4LFB M;  1NHG C;  3FTE A;  1IY2 A;  5BPV A;  1VDL A;  1IN4 A;  4KT0 F;  2R65 A;  5ITY A;  1XWI A;  1QYR A;  1OFH A;  1N75 A;  3SC3 A;  1OKS A;  2D7H A;  1R6B X;  1RU3 A;  2OPF A;  4G4Q A;  4LF8 M;  4MH0 E;  4QHS A;  4I4L A;  1HT1 E;  1MX0 A;  2R45 A;  4M9Z A;  4OVZ A;  1NO1 A;  2DWM A;  1QZM A;  2KZU A;  3DA1 A;  4Z6Y A;  2K6B A;  4DR5 M;  2N35 A;  4JI8 M;  1R2Z A;  3FE3 A;  2OOB A;  1E32 A;  5KPT A;  4AKH A;  4B3M M;  4X62 M;  1L8Q A;  3B7Z A;  3W0F A;  1XXH A;  1Q02 A;  1UFZ A;  1GO5 A;  2FNA A;  4NXN M;  2XSZ A;  2HHH M;  2JY8 A;  2DAI A;  4B7F A;  2CP8 A;  3QAU A;  1PM5 A;  2YR0 A;  4BB9 A;  1AIP C;  3KP1 E;  4WP2 A;  2X4A A;  3TQS A;  2DAE A;  3B74 A;  1K82 A;  4LJ4 A;  2LTU A;  3KOX E;  4MGH A;  3RFW A;  1R5L A;  5FSW A;  2UUB M;  4B08 A;  1PGY A;  3TWK A;  1WJ7 A;  4GKK M;  2YQZ A;  4FWD A;  4GHA A;  3K9O A;  3MHV C;  5IRE B;  2R6F A;  4LJ8 A;  1WGL A;  4QNM A;  3SHF A;  4IBF A;  3U6D A;  5F3W A;  4FCW A;  3BBZ A;  4M0D A;  5GKN A;  3GO8 A;  1QZE A;  2R4E A;  4OU7 A;  4LZJ A;  3THG A;  3GLG B;  2CFO A;  3OTO M;  4JYA M;  4GKJ M;  4B7G A;  2M60 A;  1UM8 A;  4D81 A;  3FYD A;  3K1J A;  2FFJ A;  3AOE C;  1XHB A;  7CAT A;  2MGW A;  3J81 S;  3U60 B;  2VF8 A;  4LF6 M;  4MM3 B;  2R18 A;  3E46 A;  2EO2 A;  5FTM A;  2BWE A;  3AFH A;  3J80 S;  4DR2 M;  1OIP A;  2WSF F;  4D82 A;  3MK6 A;  2L7H A;  3KS8 A;  2I7N A;  3UJN A;  2DEN A;  2KNA A;  4CIS A;  4FWH A;  2EJS A;  4X66 M;  4JI4 M;  3FUT A;  3GLF B;  2LVQ D;  2JY5 A;  2WSE F;  1I4W A;  3FUX A;  3VDU A;  2DAM A;  3FRI A;  1OIZ A;  4XBO A;  3V76 A;  4JI5 M;  3I51 A;  4P16 A;  1F4I A;  2ZAM A;  3GRY A;  4GC9 A;  4LGM A;  3AL0 C;  2FOI C;  2JNH A;  2JUJ A;  2JY6 B;  2QSF X;  4DV1 M;  5EP2 A;  1FNN A;  2UUA M;  5EXX A;  3U6Q A;  3HJQ A;  4NSR A;  3RGS A;  1IN7 A;  1MN3 A;  1Z5C A;  2JXN A;  4MB7 A;  1DGF A;  1Q3C A;  3U61 A;  5L8R F;  3GLI A;  2JP7 A;  2ZTC A;  1VDD A;  5KQ8 A;  3ZH9 B;  1WIV A;  3KOZ E;  4M0W A;  4AKI A;  4FVM A;  2QNJ A;  1QQW A;  2J5Y A;  1L2C A;  2Y20 A;  1VEG A;  1NVM A;  2CEA A;  2O5R A;  4NRV A;  4QOZ C;  3U5Z A;  1N34 M;  2KRK A;  3J2P B;  3U6L A;  2KNZ A;  5JI3 E;  3FYC A;  3GLH E;  4IBI A;  3AKZ A;  1YLA A;  1OAI A;  1TR8 A;  4I5S A;  1ZMV A;  4IBE A;  5EXP A;  2EA0 A;  1XB2 B;  2DKL A;  2XH9 A;  3LCU A;  2KRU A;  4IBK A;  4L15 A;  4L4U A;  2CHG A;  3TWL A;  4JI7 M;  4R3D A;  2L4E A;  4AG6 A;  2F5N A;  4DR3 M;  1QAM A;  3KXE C;  2LBC A;  4LZZ A;  2DHY A;  2Y0Q A;  2L2D A;  2CV1 A;  3KW6 A;  2R4J A;  3KOW E;  4Q7J A;  4AG5 A;  3FTC A;  2K0B X;  4KOD A;  1QAN A;  2C96 A;  2JZ1 A;  2P5T A;  3A45 A;  1QDT A;  3T1Y M;  2YNM D;  1PJI A;  1X37 A;  3K8Z A;  2UUC M;  1E9S A;  2LVA A;  2HL7 A;  1G8P A;  3W68 A;  1OAO C;  1NV8 A;  3GQ3 A;  3HZJ A;  2R62 A;  2K47 A;  3F92 A;  1C1K A;  3M7G A;  4LFA M;  1G59 A;  4PCZ A;  2XZF A;  1DGG A;  1TH3 A;  1GJT A;  4NSO B;  1JR3 D;  4IJE A;  1NY6 A;  1TDH A;  4M9S A;  3TL4 X;  3SAS A;  2UXB M;  4DV7 M;  4RKU F;  2FS1 A;  3L27 A;  1WR1 B;  3WHK A;  2RRU A;  4DV3 M;  4S12 A;  5IWA M;  2QBY A;  3PFI A;  4JV5 M;  4GIP A;  5EP1 A;  2HKJ A;  3J7B A;  2R46 A;  4JI6 M;  1OFI A;  3ZCB B;  4FW9 A;  4F1I A;  3KFU G;  4G6Z A;  5BR8 M;  3U60 A;  3I4Y A;  3AV0 A;  3SAU A;  1SXJ D;  2DNA A;  1N32 M;  2GNO A;  3EIE A;  1L1Z A;  1IBK M;  4JXJ A;  4NOO B;  3C58 A;  3AJI B;  3VLF B;  4JI3 M;  1GLN A;  5EQT A;  3ZC7 B;  2D7E A;  5ITX E;  1VG5 A;  3VK8 A;  2DXI A;  1K3W A;  4OX9 M;  3GRV A;  1DGH B;  1G71 A;  1HNX M;  1D0M A;  3SHG B;  3UZU A;  2Z4R A;  5KQD A;  4YY3 M;  3GLF A;  1FJG M;  4DV0 M;  4DBG B;  4DR6 M;  1HT2 E;  3K92 A;  4LJ6 A;  1D0K A;  3L28 A;  2Z4S A;  5H37 D;  2ZM6 M;  4AKG A;  1Z6T A;  4ZPX A;  2DVW B;  3W0L B;  3HHX A;  2XEP A;  4DR4 M;  1HJP A;  1TGU A;  4LF7 M;  1W5T A;  3PVS A;  1PJJ A;  5FLX S;  4AQY M;  4EIW A;  1J7K A;  5ITT A;  4ITQ A;  5FTN A;  1VEK A;  2CWB A;  3MJ5 A;  2M5Z A;  3TPZ A;  2L6O A;  2BWB A;  3D8B A;  1TTE A;  3LW5 F;  4Y28 F;  1GKI A;  1JR3 A;  2OQ4 A;  2EKF A;  4FD2 A;  2Q2E B;  3GPY A;  4K0K M;  2QPA A;  5A2Q S;  3E9S A;  3L26 A;  3GQ5 A;  2DZN B;  1GJS A;  1QAO A;  3FUW A;  3FUU A;  3LMM A;  4DV4 M;  3IHP A;  1XMQ M;  5C18 A;  5DNY A;  4CIZ A;  1ORY B;  2R44 A;  2F5Q A;  2KA6 B;  2QHO B;  4IJF A;  4UN2 B;  4BLC A;  1XMO M;  2Y21 A;  2XLJ A;  4L78 A;  1XXH E;  3LCV B;  2EKK A;  1SXJ A;  3Q8G A;  4QOS A;  1K3X A;  1XNQ M;  3K9P A;  1C7Y A;  1IN6 A;  1ZQ9 A;  3JR4 A;  2DHR A;  3A98 B;  3SAR A;  3LQR A;  3QYB A;  1HNZ M;  4DR7 M;  1YUB A;  3AOE A;  4LF4 M;  4DR1 M;  2Y0T A;  3HKP A;  3GPX A;  2CV0 A;  1R2Y A;  2K9D A;  2QEN A;  3CGW A;  3HHW A;  4OVZ B;  3HX3 A;  4L6V 6;  3RGP A;  4LJ5 A;  2JA2 A;  1QDR A;  4XK8 F;  3TWM A;  1Y8G A;  4W5W A;  4CGY B;  3SAW A;  3SMS A;  1JR3 E;  2BJW A;  2WZJ A;  2ZAO A;  4D80 A;  4KLN A;  1XXH B;  4YHH M;  3DOA A;  3MMP A;  2DWZ B;  2WSC F;  3AOG A;  3SAV A;  3T1H M;  2OO9 A;  3FD9 A;  2R0I A;  3E4R A;  5C1B A;  2CE7 A;  4G4N A;  4IBB A;  2XF3 A;  4R71 A;  1QVR A;  1H6U A;  3HHZ A;  3W67 A;  1XC8 A;  2DAK A;  4AZF A;  5E6J A;  2XFT A;  4DUZ M;  4MGY E;  4II7 A;  2C98 A;  4WUR A;  1NY5 A;  1SXJ E;  1HR0 M;  4NXM M;  1YSY A;  2G8L A;  4F2L A;  1OQY A;  3HY5 A;  1R7R A;  4QNR A;  1DGH A;  3K2L A;  1HNW M;  1J09 A;  1SG9 A;  2KEB A;  3EIH A;  4L16 A;  1LV7 A;  2LHG A;  2QQ8 A;  2NQ8 C;  2G3Q A;  1J5E M;  1EFU B;  3FKE A;  1N77 A;  1IY1 A;  2B3T A;  4IBC A;  4I8O A;  3GLH B;  1W5S A;  1Z5A A;  3A46 A;  1IBL M;  5E26 A;  3GLI E;  1NNJ A;  3BOS A;  5DYI A;  3B89 A;  4IBJ A;  4G4O A;  1G4A E;  2CRU A;  2MRO B;  5LMU M;  3Q8X A;  1TDZ A;  1QUS A;  2HAK A;  4WW0 A;  3GPU A;  4IBD A;  2KXE A;  2LWX A;  4HLQ A;  1E94 E;  4B3R M;  3B7N A;  3U6O A;  1NSF A;  3FRH A;  1NNU C;  3WHL A;  3GP1 A;  1R4G A;  4REZ A;  4LF9 M;  1WHC A;  3CF0 A;  2LVN C;  3ILK A;  3L2A A;  5FTJ A;  3FTF A;  3GLG A;  2DZO B;  2LHC A;  2AHM A;  3UK6 A;  5EP4 A;  2F5P A;  2DAG A;  1V34 A;  3KSJ A;  4NC6 A;  4CJ6 A;  4PDG A;  1IBM M;  4AI6 A;  4I81 A;  4LCB A;  3HHY A;  1I94 M;  3VFD A;  4MGK E;  2X49 A;  5ITR A;  2GQF A;  4LRS A;  5KPR A;  4LFC M;  2LH0 A;  2V6Z M;  1GL7 A;  2C99 A;  4G4R A;  1QUT A;  1VEJ A;  1ZAE A;  3LQQ A;  4BBA A;  4AW4 A;  2KW0 A;  4XGI A;  2FH0 A;  2BNK A;  3NBI A;  1IXS B;  4P17 A;  4FWG A;  3SMP A;  3IG8 A;  3VDP A;  3KSX A;  1ZMU A;  1LTM A;  1PJT A;  1IY0 A;  4LJA A;  1BVS A;  2ERC A;  3SBJ A;  2V1C A;  3B7Q A;  5IZ7 D;  2KNV A;  1Q39 A;  2I7P A;  1QAQ A;  2H1R A;  3DZD A;  1G41 A;  3L29 A;  1TH4 A;  2RGO A;  3R8F A;  2J7N A;  2ZAN A;  3PNV A;  2F5O A;  2RKO A;  2CHQ A;  3I01 M;  1D0L A;  3UGJ A;  2F5S A;  4FCV A;  1N36 M;  2LVP C;  2CHV A;  3FTD A;  4LG2 A;  1IQP A;  3U6P A;  5EXS A;  3VKG A;  4NL4 H;  4X64 M;  3C3E A;  3KP0 E;  1NJF A;  4GMQ A;  4JN6 A;  3GLG E;  2YFQ A;  2CUZ A;  2UU9 M;  4NRW A;  1IM2 A;  5KO3 A;  2W82 A;  1Z59 A;  3GRR A;  4GRI A;  4KO8 A;  1L1T A;  2L09 A;  1DV0 A;  2QCU A;  1V33 A;  1GL6 A;  3VKH A;  1PRB A;  3KS4 A;  3SYK A;  1S3S A;  2L7I A;  1N78 A;  3BXW A;  4QHT A;  1A5T A;  1DO0 A;  2ZTD A;  3IG5 A;  5ITQ A;  1AUA A;  3GLF E;  1MJG M;  4RF1 A;  4RNA A;  4LJ9 A;  3M6A A;  1SXJ C;  2EUC A;  2VF7 A;  3LVV A;  2CV2 A;  1IXZ A;  3M0E A;  4OW0 A;  2QBY B;  2KHH A;  4LY6 A;  3SYL A;  2XZU A;  2LNH C;  3E21 A;  2HWJ A;  4GEW A;  4LGY A;  4CHT B;  3U6M A;  2DWN A;  4PD2 A;  4B3S M;  3I4V A;  1TH2 A;  5EP3 A;  3FUV A;  1N33 M;  3DFZ A;  3HJ8 A;  2V1U A;  2MR9 A;  3GLH A;  4TUW A;  3JAM S;  3CF6 E;  1L2B A;  4M9X A;  3U6C A;  1G3I A;  3CTW B;  2DZL A;  1IN5 A;  3LVW A;  1JB0 F;  2KZS A;  3U6S A;  2J7O A;  5EXT A;  1V92 A;  1TF0 B;  1T43 A;  2X8A A;  4PDI A;  5IT9 S;  3QWL A;  8CAT A;  1EIJ A;  1NV9 A;  2VQE M;  2O01 F;  4FCT A;  4JI0 M;  3HU2 A;  4B3T M;  3HWS A;  2KDL A;  3SAT A;  3GQ4 A;  4GIT A;  3TE6 A;  2F4V M;  2FE8 A;  4HL4 A;  1L2D A;  5LMN M;  4GH9 A;  2LVO C;  4LRT A;  4LF5 M;  3PXG A;  2JY7 A;  2VII A;  5JI2 E;  4HEO A;  5DYG A;  1Z5B A;  1CUK A;  2E5L M;  3HU1 A;  3SFZ A;  4X65 M;  2VDB B;  3HU3 A;  1ZV1 A;  1KFV A;  1HQY E;  1OJL A;  4MGZ E;  2UXC M;  2APL A;  1PJS A;  5EJC A;  2UXD M;  1PJQ A;  4G3O A;  3KOY E;  4B7H A;  4DV5 M;  2DWL A;  1T6O A;  1OTR A;  2JWS A;  2C9O A;  3QYE A;  4IIW A;  1P3Q Q;  2QZ4 A;  4Z8X A;  1IXS A;  3U6E A;  3KVW A;  4JI2 M;  3H4M A;  3CF2 A;  3IEC A;  1KYI A;  5ITU A;  4IBG A;  3JR5 A;  2L4F A;  4DUY M;  3C9P A;  2XFS A;  1GAB A;  1MU5 A;  2Z7J A;  2OOA A;  3NBX X;  2Z8Y M;  3NWL A;  5DFL A;  2ZBK B;  5KPZ A;  2C5R A;  4PT5 A;  2MJ5 B;  2XGN A;  1D2N A;  4ANR A;  1VQ1 A;  3C3D A;  1ZMW A;  1NHW C;  1HQC A; 
#chains in the Genus database with same CATH homology
 2LXE A;  2QP9 X;  2RGH A;  3VK7 A;  3T38 A;  2D7G A;  2XSZ D;  4MGI E;  4DV2 M;  1SXJ B;  5FTL A;  1DGB A;  4GC5 A;  5ITX A;  3D8L A;  2Z3X A;  3B9P A;  4JI1 M;  3A42 A;  3T15 A;  2A5Y B;  4RF0 A;  1JQJ C;  4L8R C;  4DV6 M;  3R9X B;  3J27 B;  3RE8 A;  2BJV A;  1E9R A;  2C9C A;  3GPP A;  3HJS A;  1DO2 A;  1KSF X;  1IN8 A;  1NJG A;  2G5G X;  3KDS E;  4R7G A;  1EE8 A;  5FTK A;  1IXR C;  3HGI A;  3U61 B;  1GVN A;  3GLI B;  2VQF M;  1T3T A;  4GHL A;  1XNR M;  4LJ7 A;  3UMM A;  1YE9 A;  3GRU A;  1Q3B A;  3L25 A;  4A3V B;  3J7A S;  1WXQ A;  3U5Z B;  3PNY A;  4KHP M;  2HCB A;  4LFB M;  1NHG C;  3FTE A;  1IY2 A;  5BPV A;  1IN4 A;  2R65 A;  5ITY A;  1XWI A;  1QYR A;  1OFH A;  1N75 A;  3SC3 A;  2D7H A;  1R6B X;  2OPF A;  4G4Q A;  4LF8 M;  4MH0 E;  4QHS A;  4I4L A;  1HT1 E;  1MX0 A;  2R45 A;  4M9Z A;  4OVZ A;  1QZM A;  2KZU A;  3DA1 A;  4Z6Y A;  4DR5 M;  4JI8 M;  1R2Z A;  1E32 A;  5KPT A;  4AKH A;  4B3M M;  4X62 M;  1L8Q A;  3W0F A;  1XXH A;  2FNA A;  4NXN M;  2XSZ A;  2HHH M;  4B7F A;  1PM5 A;  3QAU A;  2YR0 A;  4BB9 A;  3KP1 E;  2X4A A;  3TQS A;  1K82 A;  4LJ4 A;  3KOX E;  4MGH A;  3RFW A;  5FSW A;  2UUB M;  4B08 A;  3TWK A;  4GKK M;  2YQZ A;  4FWD A;  4GHA A;  3MHV C;  5IRE B;  4LJ8 A;  4QNM A;  3SHF A;  4IBF A;  3U6D A;  5F3W A;  4FCW A;  4M0D A;  5GKN A;  3GO8 A;  2R4E A;  4OU7 A;  4LZJ A;  3THG A;  3GLG B;  2CFO A;  3OTO M;  4JYA M;  4GKJ M;  4B7G A;  2M60 A;  1UM8 A;  4D81 A;  3FYD A;  3K1J A;  2FFJ A;  3AOE C;  1XHB A;  7CAT A;  3J81 S;  3U60 B;  4LF6 M;  4MM3 B;  2R18 A;  2EO2 A;  5FTM A;  3AFH A;  3J80 S;  4DR2 M;  4D82 A;  3MK6 A;  2L7H A;  3KS8 A;  2I7N A;  3UJN A;  4CIS A;  4FWH A;  4X66 M;  4JI4 M;  3FUT A;  3GLF B;  3VDU A;  1I4W A;  3FUX A;  4XBO A;  4JI5 M;  3I51 A;  4P16 A;  2ZAM A;  3GRY A;  4GC9 A;  4LGM A;  3AL0 C;  2FOI C;  4DV1 M;  5EP2 A;  1FNN A;  2UUA M;  5EXX A;  3U6Q A;  3HJQ A;  4NSR A;  3RGS A;  1IN7 A;  1Z5C A;  4MB7 A;  1DGF A;  1Q3C A;  3U61 A;  3GLI A;  1VDD A;  5KQ8 A;  3ZH9 B;  3KOZ E;  4M0W A;  4AKI A;  4FVM A;  1QQW A;  1L2C A;  2Y20 A;  1NVM A;  2CEA A;  2O5R A;  4NRV A;  4QOZ C;  3U5Z A;  1N34 M;  2KRK A;  3J2P B;  3U6L A;  5JI3 E;  3FYC A;  4IBI A;  3AKZ A;  4I5S A;  4IBE A;  5EXP A;  2EA0 A;  4IBK A;  4L15 A;  2XH9 A;  4L4U A;  2KRU A;  3TWL A;  4JI7 M;  2CHG A;  4R3D A;  4AG6 A;  2F5N A;  4DR3 M;  1QAM A;  3KXE C;  4LZZ A;  2Y0Q A;  2CV1 A;  3KW6 A;  2R4J A;  3KOW E;  4AG5 A;  3FTC A;  4KOD A;  1QAN A;  2C96 A;  2P5T A;  3A45 A;  3T1Y M;  1PJI A;  2YNM D;  1X37 A;  3K8Z A;  2UUC M;  1E9S A;  2HL7 A;  1G8P A;  3GQ3 A;  2R62 A;  2K47 A;  1C1K A;  3M7G A;  4LFA M;  4PCZ A;  2XZF A;  1DGG A;  1TH3 A;  4NSO B;  1JR3 D;  4IJE A;  1NY6 A;  1TDH A;  4M9S A;  3TL4 X;  3SAS A;  2UXB M;  4DV7 M;  3L27 A;  3WHK A;  4DV3 M;  4S12 A;  5IWA M;  2QBY A;  3PFI A;  4JV5 M;  4GIP A;  5EP1 A;  2HKJ A;  3J7B A;  2R46 A;  4JI6 M;  1OFI A;  3ZCB B;  4FW9 A;  3KFU G;  4G6Z A;  5BR8 M;  3U60 A;  3I4Y A;  3AV0 A;  3SAU A;  1SXJ D;  1N32 M;  3EIE A;  1L1Z A;  1IBK M;  4JXJ A;  4NOO B;  3C58 A;  3AJI B;  3VLF B;  4JI3 M;  1GLN A;  5EQT A;  3ZC7 B;  2D7E A;  5ITX E;  3VK8 A;  2DXI A;  4OX9 M;  1K3W A;  3GRV A;  1DGH B;  1HNX M;  3SHG B;  3UZU A;  2Z4R A;  5KQD A;  4YY3 M;  3GLF A;  1FJG M;  4DV0 M;  4DR6 M;  1HT2 E;  3K92 A;  4LJ6 A;  3L28 A;  2Z4S A;  5H37 D;  2ZM6 M;  4AKG A;  1Z6T A;  4ZPX A;  2DVW B;  3W0L B;  3HHX A;  2XEP A;  4DR4 M;  1TGU A;  4LF7 M;  1W5T A;  3PVS A;  1PJJ A;  5FLX S;  4AQY M;  4EIW A;  1J7K A;  5ITT A;  4ITQ A;  5FTN A;  3MJ5 A;  2M5Z A;  3TPZ A;  2L6O A;  3D8B A;  1GKI A;  1JR3 A;  2OQ4 A;  4FD2 A;  2Q2E B;  3GPY A;  4K0K M;  2QPA A;  5A2Q S;  3E9S A;  3L26 A;  3GQ5 A;  2DZN B;  1QAO A;  3FUW A;  3FUU A;  3LMM A;  4DV4 M;  1XMQ M;  5C18 A;  5DNY A;  1ORY B;  2F5Q A;  2KA6 B;  4IJF A;  4BLC A;  1XMO M;  2Y21 A;  2XLJ A;  4L78 A;  1SXJ A;  4QOS A;  1K3X A;  1XNQ M;  1IN6 A;  1ZQ9 A;  3JR4 A;  2DHR A;  3A98 B;  3SAR A;  3LQR A;  1HNZ M;  4DR7 M;  1YUB A;  3AOE A;  4LF4 M;  4DR1 M;  2Y0T A;  3HKP A;  3GPX A;  2CV0 A;  1R2Y A;  2QEN A;  3HHW A;  4OVZ B;  3RGP A;  4LJ5 A;  2JA2 A;  3TWM A;  4W5W A;  4CGY B;  3SAW A;  3SMS A;  2BJW A;  2ZAO A;  4D80 A;  4KLN A;  1XXH B;  4YHH M;  3DOA A;  2DWZ B;  3AOG A;  3SAV A;  3T1H M;  3FD9 A;  3E4R A;  5C1B A;  2CE7 A;  4G4N A;  4IBB A;  2XF3 A;  1QVR A;  1H6U A;  3HHZ A;  1XC8 A;  4AZF A;  5E6J A;  2XFT A;  4DUZ M;  4MGY E;  4II7 A;  2C98 A;  4WUR A;  1NY5 A;  1SXJ E;  1HR0 M;  4NXM M;  1YSY A;  2G8L A;  1R7R A;  4QNR A;  1DGH A;  3K2L A;  1HNW M;  1J09 A;  2KEB A;  3EIH A;  4L16 A;  1LV7 A;  2NQ8 C;  1J5E M;  3FKE A;  1N77 A;  1IY1 A;  4IBC A;  4I8O A;  3GLH B;  1W5S A;  1Z5A A;  3A46 A;  1IBL M;  5E26 A;  1NNJ A;  3BOS A;  5DYI A;  4IBJ A;  4G4O A;  1G4A E;  5LMU M;  3Q8X A;  1TDZ A;  4WW0 A;  3GPU A;  4IBD A;  2KXE A;  2LWX A;  4HLQ A;  1E94 E;  4B3R M;  3U6O A;  1NSF A;  1NNU C;  3WHL A;  3GP1 A;  4REZ A;  4LF9 M;  3CF0 A;  3ILK A;  3L2A A;  3FTF A;  5FTJ A;  3GLG A;  2DZO B;  2AHM A;  3UK6 A;  5EP4 A;  2F5P A;  3KSJ A;  1IBM M;  4PDG A;  4AI6 A;  4I81 A;  4LCB A;  3HHY A;  1I94 M;  3VFD A;  4MGK E;  2X49 A;  5ITR A;  4LRS A;  5KPR A;  4LFC M;  2LH0 A;  2V6Z M;  1GL7 A;  2C99 A;  4G4R A;  1ZAE A;  3LQQ A;  4BBA A;  4AW4 A;  2KW0 A;  4XGI A;  2BNK A;  3NBI A;  1IXS B;  4FWG A;  3SMP A;  3IG8 A;  3VDP A;  3KSX A;  1IY0 A;  4LJA A;  2ERC A;  3SBJ A;  2V1C A;  5IZ7 D;  1Q39 A;  2I7P A;  1QAQ A;  2H1R A;  3DZD A;  1G41 A;  3L29 A;  1TH4 A;  2RGO A;  3R8F A;  2J7N A;  2ZAN A;  3PNV A;  2F5O A;  2RKO A;  2CHQ A;  2F5S A;  3UGJ A;  4FCV A;  1N36 M;  2CHV A;  3FTD A;  4LG2 A;  1IQP A;  3U6P A;  5EXS A;  3VKG A;  4NL4 H;  4X64 M;  3KP0 E;  1NJF A;  4GMQ A;  4JN6 A;  2YFQ A;  2CUZ A;  2UU9 M;  4NRW A;  1IM2 A;  5KO3 A;  2W82 A;  1Z59 A;  3GRR A;  4GRI A;  4KO8 A;  1L1T A;  2L09 A;  2QCU A;  1GL6 A;  3VKH A;  3KS4 A;  3SYK A;  1S3S A;  2L7I A;  1N78 A;  4QHT A;  1DO0 A;  3IG5 A;  5ITQ A;  4RF1 A;  4RNA A;  4LJ9 A;  3M6A A;  1SXJ C;  2EUC A;  3LVV A;  2CV2 A;  1IXZ A;  3M0E A;  4OW0 A;  2QBY B;  4LY6 A;  3SYL A;  2XZU A;  2LNH C;  4LGY A;  3U6M A;  2DWN A;  4CHT B;  4B3S M;  4PD2 A;  3I4V A;  1TH2 A;  5EP3 A;  3FUV A;  1N33 M;  3DFZ A;  3HJ8 A;  2V1U A;  3GLH A;  4TUW A;  3JAM S;  3CF6 E;  1L2B A;  4M9X A;  3U6C A;  1G3I A;  3CTW B;  1IN5 A;  3LVW A;  2KZS A;  3U6S A;  2J7O A;  5EXT A;  2X8A A;  4PDI A;  5IT9 S;  3QWL A;  8CAT A;  2VQE M;  4FCT A;  4JI0 M;  3HU2 A;  4B3T M;  3HWS A;  3SAT A;  3GQ4 A;  4GIT A;  3TE6 A;  2F4V M;  2FE8 A;  4HL4 A;  1L2D A;  5LMN M;  4GH9 A;  4LF5 M;  4LRT A;  3PXG A;  2VII A;  5JI2 E;  5DYG A;  1Z5B A;  2E5L M;  3HU1 A;  3SFZ A;  4X65 M;  3HU3 A;  1KFV A;  1HQY E;  1OJL A;  4MGZ E;  2UXC M;  5EJC A;  2UXD M;  4DV5 M;  3KOY E;  4B7H A;  2DWL A;  2C9O A;  4IIW A;  3U6E A;  2QZ4 A;  4Z8X A;  3KVW A;  4JI2 M;  3H4M A;  3CF2 A;  1KYI A;  5ITU A;  4IBG A;  3JR5 A;  4DUY M;  2XFS A;  1MU5 A;  2Z7J A;  2C5R A;  3NWL A;  1G59 A;  2DWM A;  2ZBK B;  5KPZ A;  4PT5 A;  2XGN A;  1D2N A;  1NHW C;  1HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...