4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
3U6LA 1Q39A 3DOAA 5ITQA 3J81S 2OQ4A 1XMOM 1J5EM 4LF7M 5ITYA 4DR4M 3SBJA 4MB7A 1NNJA 2ZBKB 3C58A 1R2YA 4JI4M 1L1ZA 1XNRM 3GPYA 3U6PA 4B3RM 2XZUA 2F5NA 4CISA 4DR5M 3VK7A 4DR3M 4DV7M 1Z5AA 2Q2EB 4B3MM 4LFBM 4DV2M 4G4OA 4LF4M 4LFCM 4PCZA 5FLXS 4YY3M 4DUYM 4DR2M 3SAUA 4GKKM 4DR7M 1Z5BA 3JR4A 1PM5A 4ITQA 1K3XA 1XMQM 4JI2M 5LMUM 5ITXE 4B3SM 4DV1M 3GPXA 2UUCM 2UXBM 4LF6M 1N36M 1Q3BA 1L2CA 3J80S 5ITXA 3U6EA 1L2DA 3SASA 4X62M 4DV3M 1Z5CA 3U6QA 1FJGM 4JI3M 1TDHA 2HKJA 3A45A 4G4QA 3GPUA 4PDIA 3A46A 4DV4M 1TDZA 4JI5M 4JI6M 2F4VM 4X66M 1IBMM 2VQEM 2ZM6M 4PDGA 4DR1M 1EE8A 5ITUA 4NXNM 5LMNM 3W0FA 3SAWA 5ITTA 1N33M 5IT9S 3GPPA 4G4NA 4JI8M 4KHPM 1HR0M 3U6SA 4DV0M 4DV6M 2UXCM 4OX9M 3GQ4A 4DUZM 1XC8A 1K3WA 2UXDM 3T1YM 4X64M 3SARA 1XNQM 3J7AS 4K0KM 4LF5M 3GQ5A 4GKJM 4DV5M 3U6MA 1HNWM 5A2QS 1PJJA 1I94M 2VQFM 4B3TM 2F5PA 4NXMM 3A42A 4JYAM 5IWAM 3JAMS 1Q3CA 4JI1M 4LFAM 1L2BA 5BR8M 1IBKM 5ITRA 2EA0A 3SATA 4PD2A 1N32M 4LF9M 3OTOM 3TWKA 4YHHM 2XZFA 1N34M 3GO8A 3U6OA 1R2ZA 4DR6M 1MX0A 4G4RA 1IBLM 4JI7M 2UUAM 4JV5M 2E5LM 2F5OA 1KFVA 2OPFA 2UUBM 3U6DA 4X65M 2F5QA 3VK8A 2F5SA 1PJIA 1HNXM 3GQ3A 4AQYM 3GP1A 1L1TA 4NRWA 1Z59A 3TWLA 3TWMA 3U6CA 3SAVA 1K82A 4LF8M 3JR5A 3T1HM 4NRVA 2HHHM 2UU9M 1HNZM 4JI0M 1MU5A
chains in the Genus database with same CATH superfamily
3PNYA 3C3DA 3H4JA 1NY6A 2QPAA 3DOAA 3L29A 1W5TA 4LF7M 3QYBA 3LVVA 4DR4M 4AI6A 4MGYE 2JA2A 3GRRA 5EXTA 1IN6A 1EFUB 1YSYA 1NNJA 7CATA 1IXZA 1XNRM 3CF0A 4A3VB 3U6PA 4B3RM 1TH4A 3F92A 4XK8F 3UK6A 2H5XA 2CRUA 3TE6A 3UJNA 2LVAA 3B9PA 2RGHA 4MM3B 1G41A 2CFOA 1IN8A 2LVNC 2Q2EB 4L16A 4NOOB 5EXSA 1AUAA 3GRYA 4G4OA 4IBEA 3WHKA 2BWBA 1PJQA 4YY3M 2ZAMA 3SMSA 2Z4SA 1Z5BA 3AOEC 2JUJA 2CHQA 3FTEA 2G3QA 1QAMA 1X37A 2BNKA 4JI2M 2C5RA 4GIPA 2LH0A 2KZSA 3LCVB 2KEBA 2J7NA 3QWLA 5FTLA 1L2CA 4EIWA 2EO2A 1XB2B 4GEWA 4OVZB 2ZTDA 5ITXA 5KPZA 3U6EA 3HU1A 4X62M 4DV3M 1Z5CA 4GITA 4IJFA 3SASA 1WIVA 1TDHA 2HKJA 3A45A 2A5YB 2QSFX 4F1IA 2DHYA 4PDIA 1WHCA 4AZFA 2MH8A 2QHOB 4JI6M 2F4VM 3VDUA 5FTNA 4AG6A 2VQEM 4IBKA 1RU3A 1NV9A 1EE8A 4XBOA 2DZNB 3LW5F 4HLQA 4B7FA 1DGBA 5ITTA 2R18A 3U60A 1TGUA 4HEOA 2HWJA 4NSRA 4AW4A 2FS1A 4JN6A 1WR1B 3AKZA 2YFQA 4L78A 4KHPM 2UXCM 3DFZA 2P5TA 1N75A 3GRUA 5E6JA 3WHLA 4ANRA 2VIIA 3GLGA 4DUZM 1YUBA 1G8PA 3KP1E 4D80A 3SARA 4LF5M 4LRSA 5H37D 3ZH9B 3GQ5A 4GHLA 3KS8A 2XFTA 2DAIA 3IG8A 4OU7A 2DWZB 3L2AA 1N77A 2WSCF 1DO0A 2VQFM 2F5PA 2EUCA 2XEPA 2MGWA 3SYKA 2D7HA 2BWEA 1IY2A 2K47A 3DA1A 2EJSA 4JYAM 5IWAM 3IG5A 4LFAM 1J09A 3AV0A 1MN3A 1OAOC 1ZMWA 1ZMVA 5KQDA 1TR8A 1L2BA 4AKHA 2EA0A 3SATA 4PD2A 3KXEC 2R6FA 1HT2E 1G71A 5DNYA 2I7PA 3TWKA 1JQJC 4L6V6 3T38A 2QQ8A 1N34M 4GH9A 2CE7A 4G4RA 3K9OA 1GLNA 1HJPA 4JV5M 2OPFA 3U6DA 4X65M 1GO5A 3K2LA 1IM2A 2KNVA 1OTRA 4WW0A 2L6OA 1L1TA 4M9ZA 4ZPXA 2KNAA 3FYDA 2K0BX 2XFSA 1IXRC 3RGSA 3QAUA 3AL0C 2QNJA 8CATA 3CF2A 3T1HM 2HHHM 1G59A 2UU9M 4IBFA 3E4RA 4RKUF 4JI0M 3LQRA 1DGFA 1S3SA 2DXIA 3A98B 1G3IA 1D0LA 1VEJA 3HJSA 2QP9X 2HCBA 2LBCA 3HWSA 1LV7A 2OQ4A 1NO1A 1XMOM 5ITYA 2L4EA 4BLCA 1OQYA 1DGGA 1R7RA 4FCTA 3RGPA 3C58A 2VF8A 5EP3A 1HT1E 3SMPA 5EP2A 1OKSA 1L1ZA 2WZJA 1UM8A 2XZUA 4LJAA 2F5NA 3FRHA 3U5ZB 1GJTA 3VK7A 1J7KA 1DO2A 4I81A 4DR3M 1Z5AA 1DV0A 1L8QA 3KS4A 4B3MM 4LFBM 2YQZA 2Z7JA 4XGIA 5DFLA 5KO3A 2OOAA 4PCZA 4DUYM 3I4YA 4DR2M 4GKKM 4I5SA 3W67A 1PJSA 2VDBB 1PM5A 3FUVA 3ZCBB 2G8LA 1K3XA 4ITQA 3GLFA 5LMUM 2DHRA 3E9SA 3RFWA 5ITXE 3HJ8A 4R71A 3R9XB 3FKEA 3GLGB 4BBAA 1SG9A 1Q3BA 2Z8YM 3J2PB 1IFYA 2X49A 2LHCA 3UMMA 3U61A 4LRTA 3U6QA 1FJGM 3Q8GA 2L7HA 3B7NA 2C99A 2YNMD 4G4QA 1Z6TA 4LGYA 3VDPA 4LG2A 2R4JA 3W0LB 3U5ZA 2L7IA 1IN7A 2DAMA 2XH9A 1OIZA 4D82A 2DAGA 3VLFB 2ZM6M 2CHGA 4PDGA 5ITUA 1QANA 2L09A 5EP4A 3SC3A 3KFUG 1NHGC 2CWBA 3GLHA 4FW9A 3M0EA 4LGMA 2D7EA 3AOEA 1GL7A 3GPPA 2GNOA 1HR0M 1QAQA 2QCUA 1TF0B 4IIWA 1XC8A 2UXDM 2XSZA 4MGIE 3J7AS 4K0KM 2GQFA 3GLFE 4GKJM 4DV5M 2MROB 4I8OA 3U6MA 3MMPA 4FCVA 4OVZA 5A2QS 1HNWM 4Z6YA 1NNUC 1VEKA 4B3TM 3SHFA 4P16A 4W5WA 1XHBA 3HHXA 3A42A 3KOZE 3AJIB 4IBDA 2W82A 3HY5A 3KW6A 2VF7A 1TH3A 3KOWE 3ZC7B 4IBJA 2V6ZM 2FFJA 1L2DA 5BPVA 3U60B 1N32M 4FWDA 1VEGA 3BXWA 4NC6A 2XZFA 1I4WA 3K1JA 4R3DA 1XXHE 2Y20A 1R2ZA 5L8RF 2UUAM 2E5LM 4B7HA 2UUBM 2DI0A 1XWIA 3KP0E 1XXHA 1DGHB 2O25A 3LQQA 2F5SA 1PJIA 2D7GA 4KODA 2G5GX 4RF1A 2Z4RA 3GQ3A 2C96A 2CV2A 3GP1A 1GABA 3HGIA 1N78A 5IREB 4DV1M 3I04M 2YR0A 3VKGA 2LXEA 3FE3A 5EP1A 3TWMA 4PT5A 3U6CA 3SAVA 1T6OA 4P17A 5EXPA 2OO9A 1AIPC 3PXGA 5KPTA 1HNZM 1R2YA 1WXQA 1GKIA 3THGA 2L4FA 3AFHA 4G6ZA 1NY5A 3FUTA 3KVWA 3U6LA 1V34A 3KOYE 4RNAA 1BVSA 4AKGA 3GLFB 3FYCA 4RF0A 1J5EM 1UFZA 1FNNA 4KO8A 2XF3A 3LCUA 3SBJA 3ILKA 1VDLA 3QYEA 1TTEA 2EKKA 4MB7A 2XLJA 1YE9A 2JY8A 2Y0TA 3U61B 2V1UA 3GLHE 3GPYA 3K9PA 1IY0A 2DWNA 4HL4A 1IY1A 1NHWC 3NWLA 3FRIA 4DV7M 1IN4A 2JY7A 4GRIA 1G4AE 2XGNA 4DV2M 1V92A 2QBYA 2X4AA 2LVOC 3SAUA 4DR7M 2BJWA 3VKHA 1D2NA 1IN5A 1PRBA 2DENA 2JZ0A 4LJ5A 3RE8A 3JR4A 3K92A 4GC5A 4WP2A 3C3EA 1QDTA 3MHVC 1QYRA 5EXXA 1Q02A 1R5LA 3FTCA 3HU2A 5FTJA 5FTKA 3GPXA 2CP8A 2M5ZA 1N36M 1SXJC 3J80S 2DNAA 2KHHA 3SYLA 1QUTA 3W68A 3E46A 1VQ1A 5GKNA 1OJLA 4II7A 4JI3M 3SHGB 4M0WA 4CJ6A 3GPUA 3GRVA 4G3OA 4LJ8A 2CEAA 2EKFA 2KRUA 4IBBA 3R8FA 4WURA 5F3WA 3A46A 1P3QQ 4MGHA 1MJGM 1V33A 1D0KA 4X66M 2DZOB 3HHWA 4GMQA 1QQWA 2CHVA 3HKPA 4IBCA 4NXNM 2LVPC 5LMNM 3FTFA 5IT9S 1XXHB 1QVRA 2C9OA 2R0IA 1T3TA 2ZAOA 4FD2A 3VFDA 2JZ1A 4G4NA 4JI8M 1VDDA 4DV0M 2ERCA 3MJ5A 3HHZA 4B08A 1E9RA 2HL7A 2ZTCA 2J7OA 3T6PA 3GQ4A 4NSOB 5JI3E 1OIPA 1K3WA 1XNQM 3B74A 4L15A 1A5TA 3HZJA 1NVMA 3SFZA 3C9PA 4IJEA 1WGLA 1ZAEA 3H4MA 2KDLA 3L28A 2B3TA 1WGNA 1PJJA 2MJ5B 4Q7JA 3PNVA 2K6BA 2KA6B 4LJ4A 4R7GA 4JXJA 1NV8A 3MK6A 1E9SA 2FOIC 4GHAA 5DYIA 3IECA 4JI1M 1R4GA 1H6UA 3L27A 5BR8M 4MGZE 5JI2E 2H1RA 1IBKM 3FUUA 2CV1A 4AKIA 1ZV1A 1YLAA 2X8AA 2LWXA 2R4EA 3NBIA 3U6OA 3AOGA 1PJTA 3B89A 4BB9A 1SXJB 3HX3A 2DWLA 1VG5A 1JR3D 2LHGA 2JY5A 2F5QA 3HJQA 4F2LA 3VK8A 1HNXM 3GLHB 1JB0F 4AQYM 5FSWA 2HAKA 4NRWA 1Z59A 3I4VA 2R65A 2WSFF 2KW0A 2LTUA 4KLNA 4QHSA 2R62A 4REZA 3FUWA 4S12A 1NSFA 2V1CA 2CV0A 4LF8M 4Y28F 3HU3A 2ZANA 3CF6E 1KYIA 2KRKA 1QAOA 3JR5A 1K82A 4NRVA 1T43A 2Y21A 1TH2A 3PFIA 4NL4H 4TUWA 1EIJA 2WSEF 2DWMA 2R45A 1MU5A 3EIEA 2RKOA 2K9DA 4LZJA 1CUKA 4OW0A 1Q39A 2N35A 4MGKE 2MR9A 5ITQA 3J81S 2O01F 2FE8A 2NQ8C 2JY6B 4Z8XA 3GLIE 2C9CA 2L2DA 3GLGE 1GL6A 3K8ZA 3V76A 2ZBKB 4JI4M 4L8RC 4LY6A 1NJFA 4CISA 4DR5M 3NBXX 1SXJA 1LTMA 3CTWB 3LVWA 3L26A 2JWSA 2M60A 3I01M 3IHPA 3J27B 3J7BA 4UN2B 4CIZA 3E21A 2R44A 3TPZA 4LF4M 4LFCM 2JXNA 3M6AA 5FLXS 1SXJE 1R6BX 2KNZA 3KSXA 1XMQM 3LMMA 4QOZC 3PVSA 4LCBA 2FH0A 2UUCM 4B3SM 2UXBM 1QZMA 4LF6M 2RGOA 1QUSA 3KOXE 3B7ZA 3BOSA 4M0DA 2O5RA 1C1KA 5EQTA 5C1BA 4AG5A 4M9XA 1IXSB 1NJGA 3ZQJA 1JR3A 5KPRA 2BJVA 3M7GA 1D0MA 5EJCA 4DV4M 2LVQD 2QENA 1TDZA 1F4IA 4JI5M 4IBGA 2KXEA 1ZMUA 5DYGA 2KZUA 1IBMM 2DVWB 3CGWA 1GVNA 4DR1M 3W0FA 1JR3E 1HQCA 3GLIB 2JP7A 3SAWA 1N33M 1DGHA 2XSZD 2AHMA 2DZLA 4QOSA 1WJ7A 3U6SA 4FWGA 4L4UA 4CHTB 4IBIA 4DV6M 2APLA 1ZQ9A 1KSFX 2QZ4A 3D8LA 3DZDA 4FVMA 1E94E 4OX9M 3HHYA 2R46A 4X64M 1OFHA 1QDRA 4MH0E 3UGJA 1ORYB 2Z3XA 3T1YM 1C7YA 2QBYB 3B7QA 4M9SA 1Y8GA 5KQ8A 4FCWA 3KDSE 1OFIA 1W5SA 3I51A 2DKLA 4LJ6A 1I94M 4D81A 4LJ9A 2FNAA 1PGYA 4NXMM 1IQPA 3FTDA 4CGYB 3JAMS 4FWHA 1Q3CA 3L25A 4LJ7A 3UZUA 2DAKA 4QNRA 1GJSA 3BBZA 4GC9A 5ITRA 1OAIA 1IXSA 4LF9M 4QNMA 3OTOM 4YHHM 5FTMA 2J5YA 4I4LA 3TQSA 3GO8A 4DR6M 1MX0A 3FD9A 1IBLM 4JI7M 1SXJD 2DAEA 2OOBA 2F5OA 2Y0QA 1KFVA 3GLIA 3D8BA 2JNHA 1QZEA 4B7GA 2I7NA 3T15A 2RRUA 2C98A 5E26A 1E32A 3FUXA 3KSJA 5IZ7D 4KT0F 3TWLA 4LZZA 3TL4X 4DBGB 4QHTA 3EIHA 2CUZA 3Q8XA 5C18A 1HQYE 2LNHC
chains in the Genus database with same CATH topology
3PNYA 1NY6A 2QPAA 3DOAA 3L29A 1W5TA 4LF7M 3LVVA 4DR4M 4AI6A 4MGYE 2JA2A 3GRRA 5EXTA 1IN6A 1YSYA 1NNJA 7CATA 1IXZA 1XNRM 3CF0A 4A3VB 3U6PA 4B3RM 1TH4A 3UK6A 3TE6A 3UJNA 3B9PA 4MM3B 2RGHA 1G41A 2CFOA 1IN8A 2Q2EB 4L16A 4NOOB 5EXSA 3GRYA 4G4OA 4IBEA 3WHKA 4YY3M 2ZAMA 3SMSA 2Z4SA 1Z5BA 3AOEC 3FTEA 2CHQA 1QAMA 1X37A 2BNKA 4JI2M 2C5RA 4GIPA 2LH0A 2KZSA 2KEBA 2J7NA 3QWLA 5FTLA 1L2CA 4EIWA 2EO2A 4OVZB 5ITXA 3U6EA 5KPZA 1L2DA 3HU1A 4X62M 4DV3M 1Z5CA 4GITA 4IJFA 3SASA 1TDHA 2HKJA 3A45A 2A5YB 4PDIA 4AZFA 4JI6M 2F4VM 3VDUA 5FTNA 4AG6A 2VQEM 4IBKA 1EE8A 4XBOA 2DZNB 4HLQA 4B7FA 5ITTA 1DGBA 2R18A 3U60A 1TGUA 4NSRA 4AW4A 4JN6A 3AKZA 4KHPM 2YFQA 4L78A 2UXCM 3DFZA 2P5TA 1N75A 3GRUA 5E6JA 3WHLA 4DUZM 2VIIA 3GLGA 1YUBA 1G8PA 3KP1E 4D80A 3SARA 4LF5M 4LRSA 5H37D 3ZH9B 3GQ5A 4GHLA 3KS8A 2XFTA 3IG8A 4OU7A 2DWZB 3L2AA 1N77A 1DO0A 2VQFM 2F5PA 2EUCA 2XEPA 3SYKA 2D7HA 1IY2A 2K47A 3DA1A 4JYAM 5IWAM 3IG5A 4LFAM 1J09A 3AV0A 4AKHA 5KQDA 1L2BA 2EA0A 3SATA 4PD2A 3KXEC 1HT2E 5DNYA 2I7PA 3TWKA 1JQJC 3T38A 1N34M 4GH9A 2CE7A 4G4RA 1GLNA 4JV5M 2OPFA 3U6DA 4X65M 3K2LA 1IM2A 4WW0A 2L6OA 1L1TA 4M9ZA 4ZPXA 3FYDA 2XFSA 1IXRC 3RGSA 3QAUA 3AL0C 8CATA 3CF2A 3T1HM 2HHHM 1G59A 2UU9M 4IBFA 3E4RA 4JI0M 3LQRA 1DGFA 1S3SA 2DXIA 3A98B 1G3IA 3HJSA 2QP9X 2HCBA 3HWSA 1LV7A 2OQ4A 1XMOM 5ITYA 4BLCA 1DGGA 1R7RA 4FCTA 3RGPA 3C58A 3SMPA 5EP3A 1HT1E 1L1ZA 5EP2A 1UM8A 2XZUA 4LJAA 2F5NA 3U5ZB 3VK7A 1J7KA 1DO2A 4I81A 4DR3M 1Z5AA 1L8QA 3KS4A 4B3MM 4LFBM 2YQZA 2Z7JA 4XGIA 5KO3A 4PCZA 4DUYM 3I4YA 4DR2M 4GKKM 4I5SA 1PM5A 3FUVA 3ZCBB 2G8LA 1K3XA 4ITQA 3GLFA 5LMUM 2DHRA 3E9SA 3RFWA 5ITXE 3HJ8A 3R9XB 3FKEA 3GLGB 4BBAA 1Q3BA 3J2PB 2X49A 3UMMA 3U61A 4LRTA 3U6QA 1FJGM 2L7HA 4G4QA 2C99A 2YNMD 1Z6TA 4LGYA 3VDPA 4LG2A 2R4JA 3W0LB 3U5ZA 2L7IA 1IN7A 2XH9A 4D82A 3VLFB 2ZM6M 2CHGA 4PDGA 5ITUA 1QANA 2L09A 5EP4A 3SC3A 3KFUG 1NHGC 3GLHA 4FW9A 3M0EA 4LGMA 2D7EA 3AOEA 1GL7A 3GPPA 1HR0M 1QAQA 2QCUA 4IIWA 1XC8A 2UXDM 2XSZA 4MGIE 3J7AS 4K0KM 4GKJM 4DV5M 4I8OA 3U6MA 1HNWM 4FCVA 4OVZA 5A2QS 4Z6YA 1NNUC 4B3TM 3SHFA 4P16A 4W5WA 1XHBA 3HHXA 3A42A 3KOZE 3AJIB 4IBDA 2W82A 3KW6A 3KOWE 1TH3A 3ZC7B 4IBJA 2V6ZM 2FFJA 5BPVA 3U60B 1N32M 4FWDA 2XZFA 1I4WA 3K1JA 4R3DA 2Y20A 1R2ZA 2UUAM 2E5LM 4B7HA 2UUBM 1XWIA 3KP0E 1XXHA 1DGHB 3LQQA 2F5SA 1PJIA 2D7GA 4KODA 2G5GX 4RF1A 2Z4RA 3GQ3A 2C96A 2CV2A 3GP1A 3HGIA 1N78A 5IREB 2YR0A 3VKGA 2LXEA 3TWMA 5EP1A 3U6CA 4PT5A 3SAVA 5EXPA 1HNZM 3PXGA 5KPTA 1R2YA 1WXQA 1GKIA 3THGA 3AFHA 4G6ZA 1NY5A 3FUTA 3KVWA 3U6LA 4RNAA 3KOYE 4AKGA 3GLFB 3FYCA 4RF0A 1J5EM 1FNNA 4KO8A 2XF3A 3SBJA 3ILKA 2XLJA 4MB7A 1YE9A 2Y0TA 3U61B 2V1UA 3GPYA 1IY0A 2DWNA 4HL4A 1IY1A 1NHWC 3NWLA 4DV7M 1IN4A 4GRIA 1G4AE 2XGNA 4DV2M 2QBYA 2X4AA 3SAUA 4DR7M 2BJWA 3VKHA 1D2NA 1IN5A 4LJ5A 3RE8A 3JR4A 3K92A 4GC5A 3MHVC 1QYRA 5EXXA 3FTCA 3HU2A 5FTKA 5FTJA 3GPXA 4DV1M 1N36M 2M5ZA 1SXJC 3J80S 3SYLA 5GKNA 1OJLA 4II7A 4JI3M 3SHGB 4M0WA 3GPUA 3GRVA 4LJ8A 2CEAA 2KRUA 4IBBA 3R8FA 4WURA 5F3WA 3A46A 4MGHA 4X66M 2DZOB 3HHWA 4GMQA 1QQWA 2CHVA 3HKPA 4IBCA 4NXNM 5LMNM 3FTFA 5IT9S 1XXHB 1QVRA 2C9OA 2ZAOA 1T3TA 4FD2A 3VFDA 4G4NA 4JI8M 1VDDA 4DV0M 2ERCA 3MJ5A 3HHZA 4B08A 1E9RA 2HL7A 3GQ4A 2J7OA 1K3WA 4NSOB 5JI3E 1XNQM 3SFZA 4L15A 1NVMA 4IJEA 1ZAEA 3H4MA 3L28A 1PJJA 3PNVA 4R7GA 2KA6B 4LJ4A 4JXJA 3MK6A 1E9SA 2FOIC 4GHAA 5DYIA 4JI1M 1H6UA 3L27A 5BR8M 4MGZE 5JI2E 2H1RA 1IBKM 3FUUA 2CV1A 4AKIA 2X8AA 2LWXA 2R4EA 3NBIA 3U6OA 3AOGA 4BB9A 1SXJB 2DWLA 1JR3D 2F5QA 3HJQA 3VK8A 1HNXM 3GLHB 4AQYM 4NRWA 1Z59A 3I4VA 2R65A 4KLNA 2KW0A 4REZA 5FSWA 4QHSA 2R62A 4S12A 3FUWA 1NSFA 2V1CA 2CV0A 4LF8M 1K82A 3HU3A 2ZANA 3CF6E 1KYIA 2KRKA 1QAOA 3JR5A 4NRVA 4TUWA 2Y21A 1TH2A 3PFIA 4NL4H 2DWMA 2R45A 3EIEA 1MU5A 2RKOA 4LZJA 4OW0A 1Q39A 4MGKE 5ITQA 3J81S 2FE8A 2NQ8C 4Z8XA 2C9CA 1GL6A 3K8ZA 2ZBKB 4JI4M 4L8RC 4LY6A 1NJFA 4CISA 4DR5M 1SXJA 3CTWB 3LVWA 3L26A 2M60A 3J7BA 3J27B 3TPZA 4LF4M 4LFCM 3M6AA 5FLXS 1SXJE 1R6BX 3KSXA 1XMQM 3LMMA 4QOZC 3PVSA 4LCBA 4B3SM 2UUCM 2UXBM 1QZMA 4LF6M 2RGOA 3KOXE 3BOSA 4M0DA 2O5RA 1C1KA 5EQTA 5C1BA 4AG5A 4M9XA 1IXSB 1NJGA 5KPRA 1JR3A 2BJVA 3M7GA 5EJCA 4DV4M 1TDZA 2QENA 4JI5M 4IBGA 2KXEA 5DYGA 2KZUA 1IBMM 2DVWB 4DR1M 1GVNA 3W0FA 3GLIB 1HQCA 3SAWA 1N33M 1DGHA 2XSZD 2AHMA 4QOSA 3U6SA 4FWGA 4L4UA 4CHTB 4IBIA 4DV6M 1ZQ9A 1KSFX 3DZDA 2QZ4A 3D8LA 4FVMA 1E94E 4OX9M 3HHYA 2R46A 4X64M 1OFHA 4MH0E 3UGJA 2Z3XA 1ORYB 3T1YM 2QBYB 4M9SA 5KQ8A 4FCWA 3KDSE 1OFIA 1W5SA 3I51A 4LJ6A 1I94M 4D81A 4LJ9A 2FNAA 4NXMM 1IQPA 3FTDA 4CGYB 3JAMS 4FWHA 1Q3CA 3L25A 4LJ7A 3UZUA 4QNRA 4GC9A 5ITRA 4LF9M 4QNMA 3OTOM 4YHHM 5FTMA 4I4LA 3TQSA 3GO8A 4DR6M 1MX0A 3FD9A 1IBLM 4JI7M 1SXJD 2F5OA 2Y0QA 1KFVA 3GLIA 3D8BA 4B7GA 2I7NA 3T15A 2C98A 5E26A 1E32A 3FUXA 3KSJA 5IZ7D 3TWLA 4LZZA 3TL4X 4QHTA 3EIHA 2CUZA 3Q8XA 5C18A 1HQYE 2LNHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6L A;  1Q39 A;  3DOA A;  5ITQ A;  3J81 S;  2OQ4 A;  1XMO M;  1J5E M;  4LF7 M;  5ITY A;  4DR4 M;  3SBJ A;  4MB7 A;  1NNJ A;  2ZBK B;  3C58 A;  1R2Y A;  4JI4 M;  1L1Z A;  1XNR M;  3GPY A;  3U6P A;  4B3R M;  2XZU A;  2F5N A;  4CIS A;  4DR5 M;  3VK7 A;  4DR3 M;  4DV7 M;  1Z5A A;  2Q2E B;  4B3M M;  4LFB M;  4DV2 M;  4G4O A;  4LF4 M;  4LFC M;  4PCZ A;  5FLX S;  4YY3 M;  4DUY M;  4DR2 M;  3SAU A;  4GKK M;  4DR7 M;  1Z5B A;  3JR4 A;  1PM5 A;  4ITQ A;  1K3X A;  1XMQ M;  4JI2 M;  5LMU M;  5ITX E;  4B3S M;  4DV1 M;  3GPX A;  2UUC M;  2UXB M;  4LF6 M;  1N36 M;  1Q3B A;  1L2C A;  3J80 S;  5ITX A;  3U6E A;  1L2D A;  3SAS A;  4X62 M;  4DV3 M;  1Z5C A;  3U6Q A;  1FJG M;  4JI3 M;  1TDH A;  2HKJ A;  3A45 A;  4G4Q A;  3GPU A;  4PDI A;  3A46 A;  4DV4 M;  1TDZ A;  4JI5 M;  4JI6 M;  2F4V M;  4X66 M;  1IBM M;  2VQE M;  2ZM6 M;  4PDG A;  4DR1 M;  1EE8 A;  5ITU A;  4NXN M;  5LMN M;  3W0F A;  3SAW A;  5ITT A;  1N33 M;  5IT9 S;  3GPP A;  4G4N A;  4JI8 M;  4KHP M;  1HR0 M;  3U6S A;  4DV0 M;  4DV6 M;  2UXC M;  4OX9 M;  3GQ4 A;  4DUZ M;  1XC8 A;  1K3W A;  2UXD M;  3T1Y M;  4X64 M;  3SAR A;  1XNQ M;  3J7A S;  4K0K M;  4LF5 M;  3GQ5 A;  4GKJ M;  4DV5 M;  3U6M A;  1HNW M;  5A2Q S;  1PJJ A;  1I94 M;  2VQF M;  4B3T M;  2F5P A;  4NXM M;  3A42 A;  4JYA M;  5IWA M;  3JAM S;  1Q3C A;  4JI1 M;  4LFA M;  1L2B A;  5BR8 M;  1IBK M;  5ITR A;  2EA0 A;  3SAT A;  4PD2 A;  1N32 M;  4LF9 M;  3OTO M;  3TWK A;  4YHH M;  2XZF A;  1N34 M;  3GO8 A;  3U6O A;  1R2Z A;  4DR6 M;  1MX0 A;  4G4R A;  1IBL M;  4JI7 M;  2UUA M;  4JV5 M;  2E5L M;  2F5O A;  1KFV A;  2OPF A;  2UUB M;  3U6D A;  4X65 M;  2F5Q A;  3VK8 A;  2F5S A;  1PJI A;  1HNX M;  3GQ3 A;  4AQY M;  3GP1 A;  1L1T A;  4NRW A;  1Z59 A;  3TWL A;  3TWM A;  3U6C A;  3SAV A;  1K82 A;  4LF8 M;  3JR5 A;  3T1H M;  4NRV A;  2HHH M;  2UU9 M;  1HNZ M;  4JI0 M;  1MU5 A; 
#chains in the Genus database with same CATH topology
 3PNY A;  3C3D A;  3H4J A;  1NY6 A;  2QPA A;  3DOA A;  3L29 A;  1W5T A;  4LF7 M;  3QYB A;  3LVV A;  4DR4 M;  4AI6 A;  4MGY E;  2JA2 A;  3GRR A;  5EXT A;  1IN6 A;  1EFU B;  1YSY A;  1NNJ A;  7CAT A;  1IXZ A;  1XNR M;  3CF0 A;  4A3V B;  3U6P A;  4B3R M;  1TH4 A;  3F92 A;  4XK8 F;  3UK6 A;  2H5X A;  2CRU A;  3TE6 A;  3UJN A;  2LVA A;  3B9P A;  2RGH A;  4MM3 B;  1G41 A;  2CFO A;  1IN8 A;  2LVN C;  2Q2E B;  4L16 A;  4NOO B;  5EXS A;  1AUA A;  3GRY A;  4G4O A;  4IBE A;  3WHK A;  2BWB A;  1PJQ A;  4YY3 M;  2ZAM A;  3SMS A;  2Z4S A;  1Z5B A;  3AOE C;  2JUJ A;  2CHQ A;  3FTE A;  2G3Q A;  1QAM A;  1X37 A;  2BNK A;  4JI2 M;  2C5R A;  4GIP A;  2LH0 A;  2KZS A;  3LCV B;  2KEB A;  2J7N A;  3QWL A;  5FTL A;  1L2C A;  4EIW A;  2EO2 A;  1XB2 B;  4GEW A;  4OVZ B;  2ZTD A;  5ITX A;  5KPZ A;  3U6E A;  3HU1 A;  4X62 M;  4DV3 M;  1Z5C A;  4GIT A;  4IJF A;  3SAS A;  1WIV A;  1TDH A;  2HKJ A;  3A45 A;  2A5Y B;  2QSF X;  4F1I A;  2DHY A;  4PDI A;  1WHC A;  4AZF A;  2MH8 A;  2QHO B;  4JI6 M;  2F4V M;  3VDU A;  5FTN A;  4AG6 A;  2VQE M;  4IBK A;  1RU3 A;  1NV9 A;  1EE8 A;  4XBO A;  2DZN B;  3LW5 F;  4HLQ A;  4B7F A;  1DGB A;  5ITT A;  2R18 A;  3U60 A;  1TGU A;  4HEO A;  2HWJ A;  4NSR A;  4AW4 A;  2FS1 A;  4JN6 A;  1WR1 B;  3AKZ A;  2YFQ A;  4L78 A;  4KHP M;  2UXC M;  3DFZ A;  2P5T A;  1N75 A;  3GRU A;  5E6J A;  3WHL A;  4ANR A;  2VII A;  3GLG A;  4DUZ M;  1YUB A;  1G8P A;  3KP1 E;  4D80 A;  3SAR A;  4LF5 M;  4LRS A;  5H37 D;  3ZH9 B;  3GQ5 A;  4GHL A;  3KS8 A;  2XFT A;  2DAI A;  3IG8 A;  4OU7 A;  2DWZ B;  3L2A A;  1N77 A;  2WSC F;  1DO0 A;  2VQF M;  2F5P A;  2EUC A;  2XEP A;  2MGW A;  3SYK A;  2D7H A;  2BWE A;  1IY2 A;  2K47 A;  3DA1 A;  2EJS A;  4JYA M;  5IWA M;  3IG5 A;  4LFA M;  1J09 A;  3AV0 A;  1MN3 A;  1OAO C;  1ZMW A;  1ZMV A;  5KQD A;  1TR8 A;  1L2B A;  4AKH A;  2EA0 A;  3SAT A;  4PD2 A;  3KXE C;  2R6F A;  1HT2 E;  1G71 A;  5DNY A;  2I7P A;  3TWK A;  1JQJ C;  4L6V 6;  3T38 A;  2QQ8 A;  1N34 M;  4GH9 A;  2CE7 A;  4G4R A;  3K9O A;  1GLN A;  1HJP A;  4JV5 M;  2OPF A;  3U6D A;  4X65 M;  1GO5 A;  3K2L A;  1IM2 A;  2KNV A;  1OTR A;  4WW0 A;  2L6O A;  1L1T A;  4M9Z A;  4ZPX A;  2KNA A;  3FYD A;  2K0B X;  2XFS A;  1IXR C;  3RGS A;  3QAU A;  3AL0 C;  2QNJ A;  8CAT A;  3CF2 A;  3T1H M;  2HHH M;  1G59 A;  2UU9 M;  4IBF A;  3E4R A;  4RKU F;  4JI0 M;  3LQR A;  1DGF A;  1S3S A;  2DXI A;  3A98 B;  1G3I A;  1D0L A;  1VEJ A;  3HJS A;  2QP9 X;  2HCB A;  2LBC A;  3HWS A;  1LV7 A;  2OQ4 A;  1NO1 A;  1XMO M;  5ITY A;  2L4E A;  4BLC A;  1OQY A;  1DGG A;  1R7R A;  4FCT A;  3RGP A;  3C58 A;  2VF8 A;  5EP3 A;  1HT1 E;  3SMP A;  5EP2 A;  1OKS A;  1L1Z A;  2WZJ A;  1UM8 A;  2XZU A;  4LJA A;  2F5N A;  3FRH A;  3U5Z B;  1GJT A;  3VK7 A;  1J7K A;  1DO2 A;  4I81 A;  4DR3 M;  1Z5A A;  1DV0 A;  1L8Q A;  3KS4 A;  4B3M M;  4LFB M;  2YQZ A;  2Z7J A;  4XGI A;  5DFL A;  5KO3 A;  2OOA A;  4PCZ A;  4DUY M;  3I4Y A;  4DR2 M;  4GKK M;  4I5S A;  3W67 A;  1PJS A;  2VDB B;  1PM5 A;  3FUV A;  3ZCB B;  2G8L A;  1K3X A;  4ITQ A;  3GLF A;  5LMU M;  2DHR A;  3E9S A;  3RFW A;  5ITX E;  3HJ8 A;  4R71 A;  3R9X B;  3FKE A;  3GLG B;  4BBA A;  1SG9 A;  1Q3B A;  2Z8Y M;  3J2P B;  1IFY A;  2X49 A;  2LHC A;  3UMM A;  3U61 A;  4LRT A;  3U6Q A;  1FJG M;  3Q8G A;  2L7H A;  3B7N A;  2C99 A;  2YNM D;  4G4Q A;  1Z6T A;  4LGY A;  3VDP A;  4LG2 A;  2R4J A;  3W0L B;  3U5Z A;  2L7I A;  1IN7 A;  2DAM A;  2XH9 A;  1OIZ A;  4D82 A;  2DAG A;  3VLF B;  2ZM6 M;  2CHG A;  4PDG A;  5ITU A;  1QAN A;  2L09 A;  5EP4 A;  3SC3 A;  3KFU G;  1NHG C;  2CWB A;  3GLH A;  4FW9 A;  3M0E A;  4LGM A;  2D7E A;  3AOE A;  1GL7 A;  3GPP A;  2GNO A;  1HR0 M;  1QAQ A;  2QCU A;  1TF0 B;  4IIW A;  1XC8 A;  2UXD M;  2XSZ A;  4MGI E;  3J7A S;  4K0K M;  2GQF A;  3GLF E;  4GKJ M;  4DV5 M;  2MRO B;  4I8O A;  3U6M A;  3MMP A;  4FCV A;  4OVZ A;  5A2Q S;  1HNW M;  4Z6Y A;  1NNU C;  1VEK A;  4B3T M;  3SHF A;  4P16 A;  4W5W A;  1XHB A;  3HHX A;  3A42 A;  3KOZ E;  3AJI B;  4IBD A;  2W82 A;  3HY5 A;  3KW6 A;  2VF7 A;  1TH3 A;  3KOW E;  3ZC7 B;  4IBJ A;  2V6Z M;  2FFJ A;  1L2D A;  5BPV A;  3U60 B;  1N32 M;  4FWD A;  1VEG A;  3BXW A;  4NC6 A;  2XZF A;  1I4W A;  3K1J A;  4R3D A;  1XXH E;  2Y20 A;  1R2Z A;  5L8R F;  2UUA M;  2E5L M;  4B7H A;  2UUB M;  2DI0 A;  1XWI A;  3KP0 E;  1XXH A;  1DGH B;  2O25 A;  3LQQ A;  2F5S A;  1PJI A;  2D7G A;  4KOD A;  2G5G X;  4RF1 A;  2Z4R A;  3GQ3 A;  2C96 A;  2CV2 A;  3GP1 A;  1GAB A;  3HGI A;  1N78 A;  5IRE B;  4DV1 M;  3I04 M;  2YR0 A;  3VKG A;  2LXE A;  3FE3 A;  5EP1 A;  3TWM A;  4PT5 A;  3U6C A;  3SAV A;  1T6O A;  4P17 A;  5EXP A;  2OO9 A;  1AIP C;  3PXG A;  5KPT A;  1HNZ M;  1R2Y A;  1WXQ A;  1GKI A;  3THG A;  2L4F A;  3AFH A;  4G6Z A;  1NY5 A;  3FUT A;  3KVW A;  3U6L A;  1V34 A;  3KOY E;  4RNA A;  1BVS A;  4AKG A;  3GLF B;  3FYC A;  4RF0 A;  1J5E M;  1UFZ A;  1FNN A;  4KO8 A;  2XF3 A;  3LCU A;  3SBJ A;  3ILK A;  1VDL A;  3QYE A;  1TTE A;  2EKK A;  4MB7 A;  2XLJ A;  1YE9 A;  2JY8 A;  2Y0T A;  3U61 B;  2V1U A;  3GLH E;  3GPY A;  3K9P A;  1IY0 A;  2DWN A;  4HL4 A;  1IY1 A;  1NHW C;  3NWL A;  3FRI A;  4DV7 M;  1IN4 A;  2JY7 A;  4GRI A;  1G4A E;  2XGN A;  4DV2 M;  1V92 A;  2QBY A;  2X4A A;  2LVO C;  3SAU A;  4DR7 M;  2BJW A;  3VKH A;  1D2N A;  1IN5 A;  1PRB A;  2DEN A;  2JZ0 A;  4LJ5 A;  3RE8 A;  3JR4 A;  3K92 A;  4GC5 A;  4WP2 A;  3C3E A;  1QDT A;  3MHV C;  1QYR A;  5EXX A;  1Q02 A;  1R5L A;  3FTC A;  3HU2 A;  5FTJ A;  5FTK A;  3GPX A;  2CP8 A;  2M5Z A;  1N36 M;  1SXJ C;  3J80 S;  2DNA A;  2KHH A;  3SYL A;  1QUT A;  3W68 A;  3E46 A;  1VQ1 A;  5GKN A;  1OJL A;  4II7 A;  4JI3 M;  3SHG B;  4M0W A;  4CJ6 A;  3GPU A;  3GRV A;  4G3O A;  4LJ8 A;  2CEA A;  2EKF A;  2KRU A;  4IBB A;  3R8F A;  4WUR A;  5F3W A;  3A46 A;  1P3Q Q;  4MGH A;  1MJG M;  1V33 A;  1D0K A;  4X66 M;  2DZO B;  3HHW A;  4GMQ A;  1QQW A;  2CHV A;  3HKP A;  4IBC A;  4NXN M;  2LVP C;  5LMN M;  3FTF A;  5IT9 S;  1XXH B;  1QVR A;  2C9O A;  2R0I A;  1T3T A;  2ZAO A;  4FD2 A;  3VFD A;  2JZ1 A;  4G4N A;  4JI8 M;  1VDD A;  4DV0 M;  2ERC A;  3MJ5 A;  3HHZ A;  4B08 A;  1E9R A;  2HL7 A;  2ZTC A;  2J7O A;  3T6P A;  3GQ4 A;  4NSO B;  5JI3 E;  1OIP A;  1K3W A;  1XNQ M;  3B74 A;  4L15 A;  1A5T A;  3HZJ A;  1NVM A;  3SFZ A;  3C9P A;  4IJE A;  1WGL A;  1ZAE A;  3H4M A;  2KDL A;  3L28 A;  2B3T A;  1WGN A;  1PJJ A;  2MJ5 B;  4Q7J A;  3PNV A;  2K6B A;  2KA6 B;  4LJ4 A;  4R7G A;  4JXJ A;  1NV8 A;  3MK6 A;  1E9S A;  2FOI C;  4GHA A;  5DYI A;  3IEC A;  4JI1 M;  1R4G A;  1H6U A;  3L27 A;  5BR8 M;  4MGZ E;  5JI2 E;  2H1R A;  1IBK M;  3FUU A;  2CV1 A;  4AKI A;  1ZV1 A;  1YLA A;  2X8A A;  2LWX A;  2R4E A;  3NBI A;  3U6O A;  3AOG A;  1PJT A;  3B89 A;  4BB9 A;  1SXJ B;  3HX3 A;  2DWL A;  1VG5 A;  1JR3 D;  2LHG A;  2JY5 A;  2F5Q A;  3HJQ A;  4F2L A;  3VK8 A;  1HNX M;  3GLH B;  1JB0 F;  4AQY M;  5FSW A;  2HAK A;  4NRW A;  1Z59 A;  3I4V A;  2R65 A;  2WSF F;  2KW0 A;  2LTU A;  4KLN A;  4QHS A;  2R62 A;  4REZ A;  3FUW A;  4S12 A;  1NSF A;  2V1C A;  2CV0 A;  4LF8 M;  4Y28 F;  3HU3 A;  2ZAN A;  3CF6 E;  1KYI A;  2KRK A;  1QAO A;  3JR5 A;  1K82 A;  4NRV A;  1T43 A;  2Y21 A;  1TH2 A;  3PFI A;  4NL4 H;  4TUW A;  1EIJ A;  2WSE F;  2DWM A;  2R45 A;  1MU5 A;  3EIE A;  2RKO A;  2K9D A;  4LZJ A;  1CUK A;  4OW0 A;  1Q39 A;  2N35 A;  4MGK E;  2MR9 A;  5ITQ A;  3J81 S;  2O01 F;  2FE8 A;  2NQ8 C;  2JY6 B;  4Z8X A;  3GLI E;  2C9C A;  2L2D A;  3GLG E;  1GL6 A;  3K8Z A;  3V76 A;  2ZBK B;  4JI4 M;  4L8R C;  4LY6 A;  1NJF A;  4CIS A;  4DR5 M;  3NBX X;  1SXJ A;  1LTM A;  3CTW B;  3LVW A;  3L26 A;  2JWS A;  2M60 A;  3I01 M;  3IHP A;  3J27 B;  3J7B A;  4UN2 B;  4CIZ A;  3E21 A;  2R44 A;  3TPZ A;  4LF4 M;  4LFC M;  2JXN A;  3M6A A;  5FLX S;  1SXJ E;  1R6B X;  2KNZ A;  3KSX A;  1XMQ M;  3LMM A;  4QOZ C;  3PVS A;  4LCB A;  2FH0 A;  2UUC M;  4B3S M;  2UXB M;  1QZM A;  4LF6 M;  2RGO A;  1QUS A;  3KOX E;  3B7Z A;  3BOS A;  4M0D A;  2O5R A;  1C1K A;  5EQT A;  5C1B A;  4AG5 A;  4M9X A;  1IXS B;  1NJG A;  3ZQJ A;  1JR3 A;  5KPR A;  2BJV A;  3M7G A;  1D0M A;  5EJC A;  4DV4 M;  2LVQ D;  2QEN A;  1TDZ A;  1F4I A;  4JI5 M;  4IBG A;  2KXE A;  1ZMU A;  5DYG A;  2KZU A;  1IBM M;  2DVW B;  3CGW A;  1GVN A;  4DR1 M;  3W0F A;  1JR3 E;  1HQC A;  3GLI B;  2JP7 A;  3SAW A;  1N33 M;  1DGH A;  2XSZ D;  2AHM A;  2DZL A;  4QOS A;  1WJ7 A;  3U6S A;  4FWG A;  4L4U A;  4CHT B;  4IBI A;  4DV6 M;  2APL A;  1ZQ9 A;  1KSF X;  2QZ4 A;  3D8L A;  3DZD A;  4FVM A;  1E94 E;  4OX9 M;  3HHY A;  2R46 A;  4X64 M;  1OFH A;  1QDR A;  4MH0 E;  3UGJ A;  1ORY B;  2Z3X A;  3T1Y M;  1C7Y A;  2QBY B;  3B7Q A;  4M9S A;  1Y8G A;  5KQ8 A;  4FCW A;  3KDS E;  1OFI A;  1W5S A;  3I51 A;  2DKL A;  4LJ6 A;  1I94 M;  4D81 A;  4LJ9 A;  2FNA A;  1PGY A;  4NXM M;  1IQP A;  3FTD A;  4CGY B;  3JAM S;  4FWH A;  1Q3C A;  3L25 A;  4LJ7 A;  3UZU A;  2DAK A;  4QNR A;  1GJS A;  3BBZ A;  4GC9 A;  5ITR A;  1OAI A;  1IXS A;  4LF9 M;  4QNM A;  3OTO M;  4YHH M;  5FTM A;  2J5Y A;  4I4L A;  3TQS A;  3GO8 A;  4DR6 M;  1MX0 A;  3FD9 A;  1IBL M;  4JI7 M;  1SXJ D;  2DAE A;  2OOB A;  2F5O A;  2Y0Q A;  1KFV A;  3GLI A;  3D8B A;  2JNH A;  1QZE A;  4B7G A;  2I7N A;  3T15 A;  2RRU A;  2C98 A;  5E26 A;  1E32 A;  3FUX A;  3KSJ A;  5IZ7 D;  4KT0 F;  3TWL A;  4LZZ A;  3TL4 X;  4DBG B;  4QHT A;  3EIH A;  2CUZ A;  3Q8X A;  5C18 A;  1HQY E;  2LNH C; 
#chains in the Genus database with same CATH homology
 3PNY A;  1NY6 A;  2QPA A;  3DOA A;  3L29 A;  1W5T A;  4LF7 M;  3LVV A;  4DR4 M;  4AI6 A;  4MGY E;  2JA2 A;  3GRR A;  5EXT A;  1IN6 A;  1YSY A;  1NNJ A;  7CAT A;  1IXZ A;  1XNR M;  3CF0 A;  4A3V B;  3U6P A;  4B3R M;  1TH4 A;  3UK6 A;  3TE6 A;  3UJN A;  3B9P A;  4MM3 B;  2RGH A;  1G41 A;  2CFO A;  1IN8 A;  2Q2E B;  4L16 A;  4NOO B;  5EXS A;  3GRY A;  4G4O A;  4IBE A;  3WHK A;  4YY3 M;  2ZAM A;  3SMS A;  2Z4S A;  1Z5B A;  3AOE C;  3FTE A;  2CHQ A;  1QAM A;  1X37 A;  2BNK A;  4JI2 M;  2C5R A;  4GIP A;  2LH0 A;  2KZS A;  2KEB A;  2J7N A;  3QWL A;  5FTL A;  1L2C A;  4EIW A;  2EO2 A;  4OVZ B;  5ITX A;  3U6E A;  5KPZ A;  1L2D A;  3HU1 A;  4X62 M;  4DV3 M;  1Z5C A;  4GIT A;  4IJF A;  3SAS A;  1TDH A;  2HKJ A;  3A45 A;  2A5Y B;  4PDI A;  4AZF A;  4JI6 M;  2F4V M;  3VDU A;  5FTN A;  4AG6 A;  2VQE M;  4IBK A;  1EE8 A;  4XBO A;  2DZN B;  4HLQ A;  4B7F A;  5ITT A;  1DGB A;  2R18 A;  3U60 A;  1TGU A;  4NSR A;  4AW4 A;  4JN6 A;  3AKZ A;  4KHP M;  2YFQ A;  4L78 A;  2UXC M;  3DFZ A;  2P5T A;  1N75 A;  3GRU A;  5E6J A;  3WHL A;  4DUZ M;  2VII A;  3GLG A;  1YUB A;  1G8P A;  3KP1 E;  4D80 A;  3SAR A;  4LF5 M;  4LRS A;  5H37 D;  3ZH9 B;  3GQ5 A;  4GHL A;  3KS8 A;  2XFT A;  3IG8 A;  4OU7 A;  2DWZ B;  3L2A A;  1N77 A;  1DO0 A;  2VQF M;  2F5P A;  2EUC A;  2XEP A;  3SYK A;  2D7H A;  1IY2 A;  2K47 A;  3DA1 A;  4JYA M;  5IWA M;  3IG5 A;  4LFA M;  1J09 A;  3AV0 A;  4AKH A;  5KQD A;  1L2B A;  2EA0 A;  3SAT A;  4PD2 A;  3KXE C;  1HT2 E;  5DNY A;  2I7P A;  3TWK A;  1JQJ C;  3T38 A;  1N34 M;  4GH9 A;  2CE7 A;  4G4R A;  1GLN A;  4JV5 M;  2OPF A;  3U6D A;  4X65 M;  3K2L A;  1IM2 A;  4WW0 A;  2L6O A;  1L1T A;  4M9Z A;  4ZPX A;  3FYD A;  2XFS A;  1IXR C;  3RGS A;  3QAU A;  3AL0 C;  8CAT A;  3CF2 A;  3T1H M;  2HHH M;  1G59 A;  2UU9 M;  4IBF A;  3E4R A;  4JI0 M;  3LQR A;  1DGF A;  1S3S A;  2DXI A;  3A98 B;  1G3I A;  3HJS A;  2QP9 X;  2HCB A;  3HWS A;  1LV7 A;  2OQ4 A;  1XMO M;  5ITY A;  4BLC A;  1DGG A;  1R7R A;  4FCT A;  3RGP A;  3C58 A;  3SMP A;  5EP3 A;  1HT1 E;  1L1Z A;  5EP2 A;  1UM8 A;  2XZU A;  4LJA A;  2F5N A;  3U5Z B;  3VK7 A;  1J7K A;  1DO2 A;  4I81 A;  4DR3 M;  1Z5A A;  1L8Q A;  3KS4 A;  4B3M M;  4LFB M;  2YQZ A;  2Z7J A;  4XGI A;  5KO3 A;  4PCZ A;  4DUY M;  3I4Y A;  4DR2 M;  4GKK M;  4I5S A;  1PM5 A;  3FUV A;  3ZCB B;  2G8L A;  1K3X A;  4ITQ A;  3GLF A;  5LMU M;  2DHR A;  3E9S A;  3RFW A;  5ITX E;  3HJ8 A;  3R9X B;  3FKE A;  3GLG B;  4BBA A;  1Q3B A;  3J2P B;  2X49 A;  3UMM A;  3U61 A;  4LRT A;  3U6Q A;  1FJG M;  2L7H A;  4G4Q A;  2C99 A;  2YNM D;  1Z6T A;  4LGY A;  3VDP A;  4LG2 A;  2R4J A;  3W0L B;  3U5Z A;  2L7I A;  1IN7 A;  2XH9 A;  4D82 A;  3VLF B;  2ZM6 M;  2CHG A;  4PDG A;  5ITU A;  1QAN A;  2L09 A;  5EP4 A;  3SC3 A;  3KFU G;  1NHG C;  3GLH A;  4FW9 A;  3M0E A;  4LGM A;  2D7E A;  3AOE A;  1GL7 A;  3GPP A;  1HR0 M;  1QAQ A;  2QCU A;  4IIW A;  1XC8 A;  2UXD M;  2XSZ A;  4MGI E;  3J7A S;  4K0K M;  4GKJ M;  4DV5 M;  4I8O A;  3U6M A;  1HNW M;  4FCV A;  4OVZ A;  5A2Q S;  4Z6Y A;  1NNU C;  4B3T M;  3SHF A;  4P16 A;  4W5W A;  1XHB A;  3HHX A;  3A42 A;  3KOZ E;  3AJI B;  4IBD A;  2W82 A;  3KW6 A;  3KOW E;  1TH3 A;  3ZC7 B;  4IBJ A;  2V6Z M;  2FFJ A;  5BPV A;  3U60 B;  1N32 M;  4FWD A;  2XZF A;  1I4W A;  3K1J A;  4R3D A;  2Y20 A;  1R2Z A;  2UUA M;  2E5L M;  4B7H A;  2UUB M;  1XWI A;  3KP0 E;  1XXH A;  1DGH B;  3LQQ A;  2F5S A;  1PJI A;  2D7G A;  4KOD A;  2G5G X;  4RF1 A;  2Z4R A;  3GQ3 A;  2C96 A;  2CV2 A;  3GP1 A;  3HGI A;  1N78 A;  5IRE B;  2YR0 A;  3VKG A;  2LXE A;  3TWM A;  5EP1 A;  3U6C A;  4PT5 A;  3SAV A;  5EXP A;  1HNZ M;  3PXG A;  5KPT A;  1R2Y A;  1WXQ A;  1GKI A;  3THG A;  3AFH A;  4G6Z A;  1NY5 A;  3FUT A;  3KVW A;  3U6L A;  4RNA A;  3KOY E;  4AKG A;  3GLF B;  3FYC A;  4RF0 A;  1J5E M;  1FNN A;  4KO8 A;  2XF3 A;  3SBJ A;  3ILK A;  2XLJ A;  4MB7 A;  1YE9 A;  2Y0T A;  3U61 B;  2V1U A;  3GPY A;  1IY0 A;  2DWN A;  4HL4 A;  1IY1 A;  1NHW C;  3NWL A;  4DV7 M;  1IN4 A;  4GRI A;  1G4A E;  2XGN A;  4DV2 M;  2QBY A;  2X4A A;  3SAU A;  4DR7 M;  2BJW A;  3VKH A;  1D2N A;  1IN5 A;  4LJ5 A;  3RE8 A;  3JR4 A;  3K92 A;  4GC5 A;  3MHV C;  1QYR A;  5EXX A;  3FTC A;  3HU2 A;  5FTK A;  5FTJ A;  3GPX A;  4DV1 M;  1N36 M;  2M5Z A;  1SXJ C;  3J80 S;  3SYL A;  5GKN A;  1OJL A;  4II7 A;  4JI3 M;  3SHG B;  4M0W A;  3GPU A;  3GRV A;  4LJ8 A;  2CEA A;  2KRU A;  4IBB A;  3R8F A;  4WUR A;  5F3W A;  3A46 A;  4MGH A;  4X66 M;  2DZO B;  3HHW A;  4GMQ A;  1QQW A;  2CHV A;  3HKP A;  4IBC A;  4NXN M;  5LMN M;  3FTF A;  5IT9 S;  1XXH B;  1QVR A;  2C9O A;  2ZAO A;  1T3T A;  4FD2 A;  3VFD A;  4G4N A;  4JI8 M;  1VDD A;  4DV0 M;  2ERC A;  3MJ5 A;  3HHZ A;  4B08 A;  1E9R A;  2HL7 A;  3GQ4 A;  2J7O A;  1K3W A;  4NSO B;  5JI3 E;  1XNQ M;  3SFZ A;  4L15 A;  1NVM A;  4IJE A;  1ZAE A;  3H4M A;  3L28 A;  1PJJ A;  3PNV A;  4R7G A;  2KA6 B;  4LJ4 A;  4JXJ A;  3MK6 A;  1E9S A;  2FOI C;  4GHA A;  5DYI A;  4JI1 M;  1H6U A;  3L27 A;  5BR8 M;  4MGZ E;  5JI2 E;  2H1R A;  1IBK M;  3FUU A;  2CV1 A;  4AKI A;  2X8A A;  2LWX A;  2R4E A;  3NBI A;  3U6O A;  3AOG A;  4BB9 A;  1SXJ B;  2DWL A;  1JR3 D;  2F5Q A;  3HJQ A;  3VK8 A;  1HNX M;  3GLH B;  4AQY M;  4NRW A;  1Z59 A;  3I4V A;  2R65 A;  4KLN A;  2KW0 A;  4REZ A;  5FSW A;  4QHS A;  2R62 A;  4S12 A;  3FUW A;  1NSF A;  2V1C A;  2CV0 A;  4LF8 M;  1K82 A;  3HU3 A;  2ZAN A;  3CF6 E;  1KYI A;  2KRK A;  1QAO A;  3JR5 A;  4NRV A;  4TUW A;  2Y21 A;  1TH2 A;  3PFI A;  4NL4 H;  2DWM A;  2R45 A;  3EIE A;  1MU5 A;  2RKO A;  4LZJ A;  4OW0 A;  1Q39 A;  4MGK E;  5ITQ A;  3J81 S;  2FE8 A;  2NQ8 C;  4Z8X A;  2C9C A;  1GL6 A;  3K8Z A;  2ZBK B;  4JI4 M;  4L8R C;  4LY6 A;  1NJF A;  4CIS A;  4DR5 M;  1SXJ A;  3CTW B;  3LVW A;  3L26 A;  2M60 A;  3J7B A;  3J27 B;  3TPZ A;  4LF4 M;  4LFC M;  3M6A A;  5FLX S;  1SXJ E;  1R6B X;  3KSX A;  1XMQ M;  3LMM A;  4QOZ C;  3PVS A;  4LCB A;  4B3S M;  2UUC M;  2UXB M;  1QZM A;  4LF6 M;  2RGO A;  3KOX E;  3BOS A;  4M0D A;  2O5R A;  1C1K A;  5EQT A;  5C1B A;  4AG5 A;  4M9X A;  1IXS B;  1NJG A;  5KPR A;  1JR3 A;  2BJV A;  3M7G A;  5EJC A;  4DV4 M;  1TDZ A;  2QEN A;  4JI5 M;  4IBG A;  2KXE A;  5DYG A;  2KZU A;  1IBM M;  2DVW B;  4DR1 M;  1GVN A;  3W0F A;  3GLI B;  1HQC A;  3SAW A;  1N33 M;  1DGH A;  2XSZ D;  2AHM A;  4QOS A;  3U6S A;  4FWG A;  4L4U A;  4CHT B;  4IBI A;  4DV6 M;  1ZQ9 A;  1KSF X;  3DZD A;  2QZ4 A;  3D8L A;  4FVM A;  1E94 E;  4OX9 M;  3HHY A;  2R46 A;  4X64 M;  1OFH A;  4MH0 E;  3UGJ A;  2Z3X A;  1ORY B;  3T1Y M;  2QBY B;  4M9S A;  5KQ8 A;  4FCW A;  3KDS E;  1OFI A;  1W5S A;  3I51 A;  4LJ6 A;  1I94 M;  4D81 A;  4LJ9 A;  2FNA A;  4NXM M;  1IQP A;  3FTD A;  4CGY B;  3JAM S;  4FWH A;  1Q3C A;  3L25 A;  4LJ7 A;  3UZU A;  4QNR A;  4GC9 A;  5ITR A;  4LF9 M;  4QNM A;  3OTO M;  4YHH M;  5FTM A;  4I4L A;  3TQS A;  3GO8 A;  4DR6 M;  1MX0 A;  3FD9 A;  1IBL M;  4JI7 M;  1SXJ D;  2F5O A;  2Y0Q A;  1KFV A;  3GLI A;  3D8B A;  4B7G A;  2I7N A;  3T15 A;  2C98 A;  5E26 A;  1E32 A;  3FUX A;  3KSJ A;  5IZ7 D;  3TWL A;  4LZZ A;  3TL4 X;  4QHT A;  3EIH A;  2CUZ A;  3Q8X A;  5C18 A;  1HQY E;  2LNH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...