4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
2F5QA 1MX0A 5FLXS 4YY3M 1HR0M 3J7AS 4X65M 4DV0M 4KHPM 2F5OA 2F5PA 5ITTA 1Q3CA 2UU9M 3U6OA 3JAMS 2F5SA 3A45A 3A42A 4B3SM 4LF6M 2UXDM 5ITXA 1N34M 2OPFA 4PCZA 4JI8M 3OTOM 1I94M 3U6SA 5A2QS 1N36M 3U6PA 4DV1M 1Q39A 2UUBM 1L2DA 3JR5A 3SASA 4JI3M 3GQ3A 1HNWM 3U6CA 1XMQM 4X64M 2HHHM 3SBJA 3SAVA 4DV2M 1FJGM 4JV5M 4DR6M 4DR4M 4K0KM 2UUAM 3U6QA 4G4OA 1IBKM 4DV5M 5IT9S 1XMOM 3GO8A 4DUYM 3T1YM 3J80S 4JI6M 3SARA 1TDHA 3U6LA 4LFCM 3SAWA 3TWKA 3VK8A 4G4RA 2HKJA 1L1TA 3SAUA 4NRVA 1R2YA 4DR1M 3U6MA 4LF4M 1J5EM 4JI7M 1PM5A 1XNRM 4G4QA 1Q3BA 1XNQM 4JI0M 2VQEM 1K3WA 4PDIA 2XZUA 4AQYM 4B3RM 1Z5AA 5ITRA 1EE8A 1PJIA 4DV6M 4DV3M 2XZFA 4LF9M 1N33M 1Z5CA 1HNXM 4ITQA 2Q2EB 1K3XA 4B3TM 4YHHM 1R2ZA 3U6EA 1XC8A 5LMNM 4B3MM 4NXNM 3JR4A 4JI5M 4JYAM 2UXCM 1TDZA 1L2CA 1N32M 3GPPA 5IWAM 4JI4M 4JI1M 3GPUA 1K82A 1L2BA 2E5LM 2F4VM 3U6DA 2ZBKB 4MB7A 2UXBM 1HNZM 2UUCM 1PJJA 5ITXE 4DUZM 4CISA 4GKJM 1Z59A 2EA0A 4NXMM 1KFVA 4PDGA 4DR5M 2F5NA 3W0FA 4DR2M 5ITQA 3VK7A 4LF8M 5ITYA 5ITUA 1L1ZA 3J81S 2OQ4A 4DR7M 3GQ4A 4DR3M 4OX9M 1Z5BA 2ZM6M 2VQFM 3TWLA 3TWMA 4LF5M 4LFAM 3SATA 4LFBM 3DOAA 4PD2A 5LMUM 4X62M 3GQ5A 4DV4M 4DV7M 1IBLM 3A46A 4JI2M 4X66M 4LF7M 3C58A 1MU5A 3GPYA 3T1HM 1IBMM 4NRWA 3GP1A 3GPXA 5BR8M 1NNJA 4G4NA 4GKKM
chains in the Genus database with same CATH superfamily
3PVSA 2APLA 1TH2A 4AI6A 3B74A 4PT5A 2F5PA 4RKUF 3HJSA 2W82A 1F4IA 3EIHA 4OVZB 2FS1A 1YUBA 2CEAA 4IBIA 3JAMS 3A45A 3HU1A 4HL4A 4I4LA 2C9CA 4HLQA 1NVMA 4B3SM 3GRYA 4MGYE 1N34M 4PCZA 4JI8M 2QENA 5A2QS 2DAIA 3U6PA 1XB2B 2H5XA 1L2DA 5JI2E 1NHGC 2EKKA 2KEBA 4TUWA 3K9OA 4B08A 3U5ZA 4L8RC 3W68A 3SAVA 2Z4SA 4GHAA 5C18A 4DV2M 1YLAA 4LJ8A 4L6V6 4DR6M 4DR4M 3MK6A 4BBAA 3KOZE 5IT9S 2FFJA 3M0EA 3GO8A 2KA6B 2BJWA 2LTUA 2LXEA 4IJEA 2MH8A 3V76A 3AOGA 2BWEA 2LHCA 3FYCA 2KNAA 2WSEF 4NRVA 1TF0B 4Q7JA 1R2YA 4DR1M 3KFUG 4FVMA 2DENA 4MGHA 3U61B 2C96A 3VDUA 1OAOC 1ZQ9A 3I4VA 1J5EM 2CWBA 4G3OA 3I04M 5EXPA 3BBZA 1XWIA 3TQSA 2K0BX 2XH9A 3J7BA 4FWGA 5FTKA 4JI0M 4AG6A 2VQEM 1K3WA 4PDIA 3LQRA 1PRBA 4AQYM 1PGYA 3GLIA 2JY8A 2K47A 2KNZA 4LF9M 5JI3E 1QYRA 1SXJB 1N33M 3VFDA 4LZJA 2C98A 4LY6A 2Q2EB 3GLHB 2O25A 1G8PA 2R18A 4YHHM 3U6EA 2DWZB 4B3MM 3KDSE 4LJAA 4JI5M 2CE7A 4LJ5A 3J2PB 1DGBA 2XFTA 1V33A 3I01M 3Q8GA 3SMSA 4JI1M 1VG5A 4XK8F 2DKLA 4FWDA 3GPUA 2DWMA 2R4EA 2ZBKB 1OIZA 2KZSA 3IECA 3IG8A 2UUCM 3ZQJA 1JR3D 3HY5A 5FTNA 3DFZA 2VIIA 2YR0A 4NXMM 1VEKA 1KFVA 5DFLA 1C1KA 3W0LB 4NSRA 4DR2M 2KW0A 3I51A 4M9XA 3VLFB 2L7IA 1TGUA 5ITYA 2KRUA 1XXHB 3AV0A 2EJSA 4R7GA 1QUTA 3UZUA 1NNUC 3IG5A 4CJ6A 4DR3M 5KO3A 4GC9A 2VQFM 1BVSA 4JN6A 1H6UA 4LF5M 2O01F 4LFBM 3LVWA 3C9PA 1Y8GA 1UFZA 1YSYA 2DZOB 2NQ8C 3K92A 4D80A 2KNVA 4IBKA 3A46A 4I8OA 4JI2M 1VQ1A 3CTWB 4B7GA 1T3TA 3UK6A 4NRWA 1IBMM 1MN3A 2QNJA 3UMMA 4D81A 3MHVC 3GPXA 3R9XB 3FTCA 5FTMA 2C99A 1OQYA 1N78A 4AKHA 2M5ZA 3KP0E 2J7NA 5F3WA 2WSFF 1PJSA 1DO0A 2HL7A 2G5GX 4YY3M 3GLFA 1JR3A 4DV0M 1X37A 2K9DA 5ITTA 3U60A 1S3SA 1Q3CA 4G6ZA 4B7HA 2ZAMA 3U6OA 1IXSB 2MROB 3CF2A 4A3VB 3FUWA 2LVAA 3I4YA 4XGIA 2QCUA 4IBFA 1OKSA 2CRUA 2JZ1A 3A42A 2LVQD 3RGPA 1OFIA 2OPFA 4I81A 2OOAA 3ZH9B 3OTOM 1I94M 2JP7A 4KLNA 3U6SA 4GMQA 1ZMVA 2KDLA 4OVZA 1VDDA 3AJIB 3JR5A 2L4FA 4L15A 2Z3XA 4QNRA 3MJ5A 4QOSA 5BPVA 2HHHM 3EIEA 1G59A 1G71A 2ZTDA 3KOYE 3SBJA 1V92A 1IQPA 3VDPA 3AFHA 3NWLA 2R44A 3K9PA 2D7GA 4K0KM 1IXZA 2XLJA 3U6QA 3E4RA 5GKNA 5C1BA 3FRHA 2MR9A 1R5LA 4AKIA 2R65A 4UN2B 3QAUA 3U6LA 2LWXA 3PXGA 3B89A 3TWKA 2M60A 4NOOB 5KQ8A 3U6MA 3SFZA 4LF4M 1IY2A 2LVPC 1I4WA 1R4GA 1IM2A 4GC5A 3GLGB 2GQFA 4IJFA 2VF7A 4G4QA 1HQCA 1SXJE 1IN6A 1J09A 3RGSA 2XZUA 2R62A 3GLHE 1EFUB 3ILKA 4KT0F 5EP2A 1Z5AA 2V1CA 3LCVB 4LGMA 4LJ6A 1EE8A 1GABA 2J5YA 2V6ZM 3H4MA 3HU3A 2XZFA 3GRVA 1GO5A 2G3QA 1JQJC 2FNAA 2N35A 4ITQA 2V1UA 1AUAA 2R45A 1GKIA 1G4AE 1UM8A 1KSFX 5KPTA 2B3TA 1NSFA 2HCBA 3LVVA 1L2CA 2MJ5B 5IZ7D 2EUCA 4NC6A 3K8ZA 4QHSA 3LW5F 1NY6A 3SHGB 2LBCA 3U6DA 4MB7A 2JA2A 3HWSA 1HNZM 1XHBA 3WHLA 5ITXE 1PJJA 1XXHE 2QSFX 1TR8A 1Z59A 2JY6B 4GEWA 4II7A 1D0KA 4PDGA 4AG5A 2JZ0A 4F2LA 2DNAA 2DVWB 5ITQA 4CHTB 1NV8A 3GRUA 4LGYA 2L7HA 2R4JA 2OQ4A 4WURA 4MM3B 1PJQA 3TWMA 1YE9A 1DO2A 4XBOA 1TTEA 1G3IA 2OO9A 1T6OA 1KYIA 4D82A 5H37D 3DOAA 2G8LA 1XXHA 4PD2A 5LMUM 1DGHA 3FUXA 3FKEA 4LRSA 4X62M 3E46A 1IBLM 2BJVA 1RU3A 4LF7M 3HHXA 2X49A 2DWNA 2D7EA 1MU5A 3GPYA 1QAMA 3NBIA 1E9RA 3R8FA 4GKKM 2L4EA 1WGLA 5EP3A 4B7FA 2DAGA 1WIVA 2F5QA 1MX0A 1MJGM 3C3EA 4AZFA 3L25A 1ORYB 1HR0M 3J7AS 4X65M 4KHPM 3RE8A 2XGNA 4LZZA 4FCWA 4MGZE 3QWLA 3B7ZA 4IIWA 1WHCA 3B7NA 4R3DA 4CGYB 4F1IA 3CGWA 4LF6M 2X4AA 3GLIB 3T38A 5E6JA 3BOSA 4RF0A 2EO2A 3PFIA 1IXSA 1ZAEA 2EKFA 3HU2A 4JI3M 3SASA 3GQ3A 3BXWA 3HX3A 1DGFA 3U6CA 3A98B 1QANA 1D2NA 3SC3A 4L16A 5E26A 1QVRA 1FNNA 2Y0TA 3PNYA 3TE6A 3HJQA 1LTMA 2P5TA 2Z4RA 3TL4X 4ANRA 1IBKM 4S12A 1NO1A 1ZV1A 1IN4A 2Y21A 3K2LA 3J80S 3SARA 4HEOA 2VDBB 3GLGE 3HHZA 3FD9A 3Q8XA 3SYLA 4ZPXA 4P16A 1VEGA 3PNVA 2WSCF 4I5SA 1QUSA 1W5TA 4JI7M 2O5RA 1XNRM 5EQTA 2CP8A 3ZC7B 1G41A 1Q3BA 2JY5A 3KP1E 2DAEA 1DV0A 4JXJA 2OOBA 2BNKA 1WGNA 3LCUA 1VEJA 2KRKA 4DV6M 4QHTA 4DV3M 2DI0A 1OTRA 1P3QQ 2MGWA 4BLCA 3VKGA 1Z5CA 1HNXM 1D0LA 3L2AA 4B3TM 4MH0E 3JR4A 3GRRA 1HJPA 4JYAM 1TDZA 2QP9X 1NY5A 3KSJA 1N32M 4MGIE 4AW4A 5EXSA 5IWAM 2QBYB 4BB9A 2E5LM 1K82A 1L2BA 3FTEA 2UXBM 1OIPA 4LJ4A 3GLFB 2XSZA 1NJGA 2C9OA 2JY7A 5EXTA 3TPZA 4DUZM 2Z7JA 3AOEA 7CATA 3T6PA 3L28A 3KW6A 2C5RA 4IBGA 4GRIA 5KQDA 2DAMA 1T43A 4DR5M 1QQWA 2FH0A 3KXEC 1ZMWA 3E21A 1C7YA 2A5YB 2JNHA 4NSOB 3VK7A 4P17A 1V34A 2CUZA 3U61A 4M0WA 3D8LA 1WR1B 4QNMA 3D8BA 3KS4A 1L1ZA 3J81S 2VF8A 2YNMD 3B7QA 4IBBA 5EXXA 5DNYA 4FCTA 3HHWA 1L8QA 2CV2A 3AKZA 4OX9M 2YQZA 3F92A 2LHGA 4FW9A 3TWLA 3SMPA 4LFAM 2ZTCA 2L6OA 2K6BA 3HJ8A 1ZMUA 1IY1A 5KPZA 1IY0A 4KO8A 1SXJA 3THGA 3KS8A 3GQ5A 4DV7M 4IBJA 1IFYA 3HKPA 3GLHA 2R6FA 5DYGA 3FTDA 2CV1A 2XFSA 5BR8M 5FTJA 3UJNA 1NNJA 2DHYA 2JWSA 2XEPA 3QYBA 4GH9A 4GIPA 4NL4H 3FUVA 3L27A 5FLXS 4AKGA 3ZCBB 2KZUA 3GLIE 4IBDA 2F5OA 3LMMA 5IREB 3AL0C 2YFQA 2ZANA 2UU9M 3UGJA 1IXRC 1LV7A 2F5SA 1R7RA 1QDRA 2L09A 3U5ZB 2UXDM 5ITXA 3IHPA 2HAKA 3FRIA 3KVWA 2QHOB 1SG9A 2RRUA 2KHHA 1IN7A 2XF3A 1N36M 4QOZC 4IBEA 1HT2E 1Q39A 4DV1M 2UUBM 1HQYE 1W5SA 2I7PA 1HNWM 4MGKE 2CHVA 2HWJA 4LJ7A 1XMQM 4X64M 4LRTA 3L29A 2DHRA 2DZLA 4FCVA 4IBCA 5FSWA 5L8RF 2DWLA 3B9PA 3KOWE 4WW0A 1OJLA 1Z6TA 2Y20A 3QYEA 1FJGM 2JUJA 4JV5M 1E32A 1TH4A 3FE3A 3W67A 2UUAM 4GITA 4G4OA 1JB0F 4DV5M 1XMOM 3T1YM 1NHWC 4DUYM 3C3DA 4JI6M 1TDHA 3FYDA 4LCBA 2R46A 4LFCM 3SAWA 3VK8A 4G4RA 2HKJA 3CF0A 3WHKA 2H1RA 3T15A 1L1TA 3HZJA 3SAUA 1AIPC 2RKOA 4REZA 4L78A 1GLNA 1TH3A 1PM5A 1D0MA 1QZMA 1E94E 5EP1A 1XNQM 2WZJA 5KPRA 1HT1E 3HGIA 1WXQA 3MMPA 4OW0A 4B3RM 4Y28F 1GJTA 1QDTA 4M0DA 8CATA 5ITRA 2LVOC 4M9ZA 1PJIA 2RGOA 1DGHB 1R6BX 2KXEA 2X8AA 3M6AA 1GL7A 1WJ7A 1NV9A 1E9SA 3L26A 1K3XA 3HHYA 3M7GA 2FOIC 4DBGB 4FWHA 5EJCA 1R2ZA 2Y0QA 4WP2A 5LMNM 4RF1A 2XSZD 3GLFE 1XC8A 1JR3E 1QZEA 4RNAA 4NXNM 1EIJA 1GVNA 2UXCM 1QAQA 1GJSA 1GL6A 2DAKA 3CF6E 3GPPA 1VDLA 2GNOA 4EIWA 3KSXA 5EP4A 3KOXE 4JI4M 2F4VM 2RGHA 2FE8A 3AOEC 5FTLA 4CISA 4GKJM 2QZ4A 2Z8YM 1J7KA 1IN8A 1QAOA 3LQQA 4KODA 2EA0A 4GHLA 4Z6YA 2F5NA 1N75A 3W0FA 2AHMA 2ZAOA 3H4JA 2LVNC 2QBYA 4LJ9A 4LF8M 1OAIA 3NBXX 4FD2A 1DGGA 5ITUA 1NJFA 2LNHC 4DR7M 3GLGA 1SXJD 3GQ4A 2BWBA 5DYIA 1Z5BA 2ERCA 2ZM6M 2CV0A 4L4UA 3SHFA 2R0IA 4LG2A 2CFOA 3VKHA 3SATA 2LH0A 1CUKA 4R71A 4CIZA 1N77A 1SXJC 4W5WA 2QQ8A 4OU7A 2JXNA 2QPAA 2CHGA 1IN5A 3SYKA 4DV4M 2CHQA 4Z8XA 4X66M 3FTFA 1A5TA 2DZNB 3DZDA 3RFWA 3C58A 3E9SA 3J27B 4M9SA 2L2DA 1Q02A 2D7HA 3T1HM 2DXIA 3GP1A 1OFHA 2I7NA 2J7OA 3DA1A 3U60B 1PJTA 3FUTA 4G4NA 3K1JA 3FUUA
chains in the Genus database with same CATH topology
3PVSA 1TH2A 4AI6A 2F5PA 4PT5A 3HJSA 2W82A 3EIHA 4OVZB 1YUBA 2CEAA 4IBIA 3JAMS 3A45A 3HU1A 4HL4A 4I4LA 2C9CA 4HLQA 1NVMA 4B3SM 3GRYA 4MGYE 1N34M 4PCZA 4JI8M 2QENA 5A2QS 3U6PA 1L2DA 5JI2E 1NHGC 2KEBA 4TUWA 4B08A 3U5ZA 4L8RC 3SAVA 2Z4SA 4GHAA 5C18A 4DV2M 4LJ8A 4DR6M 4DR4M 3MK6A 4BBAA 3KOZE 5IT9S 2FFJA 3M0EA 3GO8A 2KA6B 2BJWA 2LXEA 4IJEA 3AOGA 3FYCA 4NRVA 1R2YA 4DR1M 3KFUG 4FVMA 4MGHA 3U61B 1J5EM 2C96A 3VDUA 1ZQ9A 3I4VA 5EXPA 1XWIA 3TQSA 3J7BA 2XH9A 5FTKA 4FWGA 4JI0M 4AG6A 2VQEM 1K3WA 4PDIA 3LQRA 4AQYM 3GLIA 2K47A 4LF9M 5JI3E 1QYRA 1SXJB 1N33M 3VFDA 4LZJA 2C98A 4LY6A 2Q2EB 3GLHB 1G8PA 2R18A 4YHHM 3U6EA 2DWZB 4B3MM 4LJAA 4JI5M 2CE7A 4LJ5A 3J2PB 1DGBA 2XFTA 3SMSA 4JI1M 3GPUA 4FWDA 2DWMA 2R4EA 2ZBKB 2KZSA 3IG8A 2UUCM 1JR3D 5FTNA 3DFZA 2VIIA 2YR0A 4NXMM 1KFVA 1C1KA 3W0LB 4NSRA 4DR2M 2KW0A 3I51A 4M9XA 3VLFB 2L7IA 1TGUA 5ITYA 2KRUA 1XXHB 3AV0A 4R7GA 3UZUA 1NNUC 3IG5A 4DR3M 5KO3A 4GC9A 2VQFM 4JN6A 1H6UA 4LF5M 4LFBM 3LVWA 1YSYA 2DZOB 2NQ8C 3K92A 4D80A 4IBKA 3A46A 4I8OA 4JI2M 3CTWB 4B7GA 1T3TA 3UK6A 4NRWA 1IBMM 3UMMA 4D81A 3MHVC 3GPXA 3K1JA 3FTCA 5FTMA 2C99A 1N78A 4AKHA 2M5ZA 3KP0E 2J7NA 5F3WA 1DO0A 2HL7A 2G5GX 4YY3M 3GLFA 1JR3A 4DV0M 1X37A 5ITTA 3U60A 1S3SA 1Q3CA 4G6ZA 4B7HA 2ZAMA 3U6OA 1IXSB 3CF2A 4A3VB 3FUWA 3I4YA 4XGIA 2QCUA 4IBFA 3A42A 3RGPA 1OFIA 2OPFA 4I81A 3ZH9B 3OTOM 1I94M 4KLNA 3U6SA 4GMQA 4OVZA 1VDDA 3AJIB 3JR5A 2Z3XA 4L15A 4QNRA 3MJ5A 4QOSA 5BPVA 2HHHM 3EIEA 1G59A 3SBJA 3KOYE 1IQPA 3VDPA 3AFHA 3NWLA 2D7GA 4K0KM 1IXZA 2XLJA 3U6QA 3E4RA 5GKNA 5C1BA 4AKIA 2R65A 3QAUA 3U6LA 2LWXA 3PXGA 3TWKA 2M60A 4NOOB 5KQ8A 3U6MA 3SFZA 4LF4M 1IY2A 1I4WA 1IM2A 4GC5A 3GLGB 4IJFA 4G4QA 1HQCA 1SXJE 1IN6A 1J09A 3RGSA 2XZUA 2R62A 3ILKA 5EP2A 1Z5AA 2V1CA 4LGMA 4LJ6A 1EE8A 2V6ZM 3H4MA 3HU3A 2XZFA 3GRVA 1JQJC 2FNAA 4ITQA 2V1UA 2R45A 1GKIA 1G4AE 1UM8A 1KSFX 5KPTA 1NSFA 2HCBA 3LVVA 1L2CA 5IZ7D 2EUCA 3K8ZA 4QHSA 1NY6A 3SHGB 3U6DA 4MB7A 2JA2A 3HWSA 1HNZM 1XHBA 3WHLA 5ITXE 1PJJA 1Z59A 4II7A 4PDGA 4AG5A 2DVWB 5ITQA 4CHTB 3GRUA 4LGYA 2L7HA 2R4JA 2OQ4A 4WURA 4MM3B 3TWMA 1YE9A 1DO2A 4XBOA 1G3IA 1KYIA 4D82A 5H37D 3DOAA 2G8LA 1XXHA 4PD2A 5LMUM 1DGHA 3FUXA 3FKEA 4LRSA 4X62M 1IBLM 2BJVA 4LF7M 3HHXA 2X49A 2DWNA 2D7EA 1MU5A 3GPYA 1QAMA 3NBIA 1E9RA 3R8FA 4GKKM 5EP3A 4B7FA 2F5QA 1MX0A 4AZFA 3L25A 1ORYB 1HR0M 3J7AS 4X65M 4KHPM 3RE8A 2XGNA 4LZZA 4FCWA 4MGZE 3QWLA 4IIWA 4R3DA 4CGYB 4LF6M 2X4AA 3GLIB 3T38A 5E6JA 3BOSA 4RF0A 2EO2A 3PFIA 1ZAEA 3SASA 3HU2A 4JI3M 3GQ3A 1DGFA 3U6CA 3A98B 1QANA 1D2NA 3SC3A 4L16A 5E26A 1QVRA 1FNNA 2Y0TA 3PNYA 3TE6A 3HJQA 2P5TA 2Z4RA 3TL4X 1IBKM 4S12A 1IN4A 2Y21A 3K2LA 3J80S 3SARA 3HHZA 3FD9A 3Q8XA 3SYLA 4ZPXA 4P16A 3PNVA 4I5SA 1W5TA 4JI7M 2O5RA 1XNRM 5EQTA 3ZC7B 1G41A 1Q3BA 3KP1E 4JXJA 2BNKA 2KRKA 4DV6M 4QHTA 4DV3M 3VKGA 4BLCA 1Z5CA 1HNXM 3L2AA 4B3TM 4MH0E 3JR4A 3GRRA 4JYAM 1TDZA 2QP9X 1NY5A 3KSJA 1N32M 4MGIE 4AW4A 5EXSA 5IWAM 2QBYB 4BB9A 2E5LM 1K82A 1L2BA 3FTEA 2UXBM 4LJ4A 3GLFB 2XSZA 1NJGA 2C9OA 5EXTA 3TPZA 4DUZM 2Z7JA 3AOEA 7CATA 3L28A 3KW6A 2C5RA 4IBGA 4GRIA 5KQDA 4DR5M 1QQWA 3KXEC 2A5YB 4NSOB 3VK7A 2CUZA 3U61A 4M0WA 3D8LA 4QNMA 3D8BA 3KS4A 1L1ZA 3J81S 2YNMD 5DNYA 4IBBA 5EXXA 2CV2A 3R9XB 4FCTA 3HHWA 1L8QA 3AKZA 4OX9M 2YQZA 4FW9A 3TWLA 3SMPA 4LFAM 2L6OA 3HJ8A 1IY1A 5KPZA 1IY0A 4KO8A 1SXJA 3THGA 3KS8A 3GQ5A 4DV7M 4IBJA 3HKPA 3GLHA 5DYGA 3FTDA 2CV1A 2XFSA 5BR8M 5FTJA 3UJNA 1NNJA 2XEPA 4GH9A 4GIPA 4NL4H 3FUVA 3L27A 5FLXS 4AKGA 3ZCBB 2KZUA 4IBDA 2F5OA 3LMMA 5IREB 3AL0C 2YFQA 2ZANA 2UU9M 3UGJA 1IXRC 1LV7A 2F5SA 1R7RA 2L09A 3U5ZB 2UXDM 5ITXA 3KVWA 2XF3A 1IN7A 1N36M 4QOZC 4IBEA 1HT2E 1Q39A 4DV1M 2UUBM 1HQYE 1W5SA 2I7PA 1HNWM 4MGKE 2CHVA 4LJ7A 1XMQM 4X64M 4LRTA 3L29A 2DHRA 4FCVA 4IBCA 5FSWA 2DWLA 3B9PA 3KOWE 4WW0A 1OJLA 1Z6TA 2Y20A 1FJGM 4JV5M 1E32A 1TH4A 2UUAM 4GITA 4G4OA 4DV5M 1XMOM 3T1YM 1NHWC 4DUYM 4JI6M 1TDHA 3FYDA 4LCBA 2R46A 4LFCM 3SAWA 3VK8A 4G4RA 2HKJA 3CF0A 3WHKA 2H1RA 3T15A 1L1TA 3SAUA 4REZA 2RKOA 4L78A 1GLNA 1TH3A 1PM5A 1QZMA 1E94E 5EP1A 1XNQM 5KPRA 1HT1E 3HGIA 1WXQA 4OW0A 4B3RM 4M0DA 8CATA 5ITRA 4M9ZA 1PJIA 2RGOA 1DGHB 1R6BX 2KXEA 2X8AA 3M6AA 1GL7A 1E9SA 3L26A 1K3XA 3HHYA 3M7GA 2FOIC 4FWHA 5EJCA 1R2ZA 2Y0QA 1XC8A 5LMNM 4RF1A 2XSZD 4RNAA 4NXNM 1GVNA 2UXCM 1QAQA 1GL6A 3CF6E 3GPPA 4EIWA 4JI4M 3KSXA 5EP4A 3KOXE 2F4VM 2RGHA 2FE8A 3AOEC 5FTLA 4CISA 4GKJM 2QZ4A 4KODA 1J7KA 1IN8A 1QAOA 3LQQA 2EA0A 4GHLA 4Z6YA 2F5NA 1N75A 3W0FA 2AHMA 2ZAOA 2QBYA 4LJ9A 4LF8M 4FD2A 1DGGA 5ITUA 1NJFA 2LNHC 4DR7M 3GLGA 1SXJD 3GQ4A 5DYIA 1Z5BA 2ERCA 2ZM6M 2CV0A 4L4UA 3SHFA 4LG2A 2CFOA 3VKHA 3SATA 2LH0A 1N77A 1SXJC 4W5WA 4OU7A 2QPAA 2CHGA 1IN5A 3SYKA 4DV4M 2CHQA 4Z8XA 4X66M 3FTFA 2DZNB 3DZDA 3RFWA 3C58A 3E9SA 3J27B 4M9SA 3T1HM 2D7HA 2DXIA 3GP1A 1OFHA 2I7NA 2J7OA 3DA1A 3U60B 3FUTA 4G4NA 3KDSE 3FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Q A;  1MX0 A;  5FLX S;  4YY3 M;  1HR0 M;  3J7A S;  4X65 M;  4DV0 M;  4KHP M;  2F5O A;  2F5P A;  5ITT A;  1Q3C A;  2UU9 M;  3U6O A;  3JAM S;  2F5S A;  3A45 A;  3A42 A;  4B3S M;  4LF6 M;  2UXD M;  5ITX A;  1N34 M;  2OPF A;  4PCZ A;  4JI8 M;  3OTO M;  1I94 M;  3U6S A;  5A2Q S;  1N36 M;  3U6P A;  4DV1 M;  1Q39 A;  2UUB M;  1L2D A;  3JR5 A;  3SAS A;  4JI3 M;  3GQ3 A;  1HNW M;  3U6C A;  1XMQ M;  4X64 M;  2HHH M;  3SBJ A;  3SAV A;  4DV2 M;  1FJG M;  4JV5 M;  4DR6 M;  4DR4 M;  4K0K M;  2UUA M;  3U6Q A;  4G4O A;  1IBK M;  4DV5 M;  5IT9 S;  1XMO M;  3GO8 A;  4DUY M;  3T1Y M;  3J80 S;  4JI6 M;  3SAR A;  1TDH A;  3U6L A;  4LFC M;  3SAW A;  3TWK A;  3VK8 A;  4G4R A;  2HKJ A;  1L1T A;  3SAU A;  4NRV A;  1R2Y A;  4DR1 M;  3U6M A;  4LF4 M;  1J5E M;  4JI7 M;  1PM5 A;  1XNR M;  4G4Q A;  1Q3B A;  1XNQ M;  4JI0 M;  2VQE M;  1K3W A;  4PDI A;  2XZU A;  4AQY M;  4B3R M;  1Z5A A;  5ITR A;  1EE8 A;  1PJI A;  4DV6 M;  4DV3 M;  2XZF A;  4LF9 M;  1N33 M;  1Z5C A;  1HNX M;  4ITQ A;  2Q2E B;  1K3X A;  4B3T M;  4YHH M;  1R2Z A;  3U6E A;  1XC8 A;  5LMN M;  4B3M M;  4NXN M;  3JR4 A;  4JI5 M;  4JYA M;  2UXC M;  1TDZ A;  1L2C A;  1N32 M;  3GPP A;  5IWA M;  4JI4 M;  4JI1 M;  3GPU A;  1K82 A;  1L2B A;  2E5L M;  2F4V M;  3U6D A;  2ZBK B;  4MB7 A;  2UXB M;  1HNZ M;  2UUC M;  1PJJ A;  5ITX E;  4DUZ M;  4CIS A;  4GKJ M;  1Z59 A;  2EA0 A;  4NXM M;  1KFV A;  4PDG A;  4DR5 M;  2F5N A;  3W0F A;  4DR2 M;  5ITQ A;  3VK7 A;  4LF8 M;  5ITY A;  5ITU A;  1L1Z A;  3J81 S;  2OQ4 A;  4DR7 M;  3GQ4 A;  4DR3 M;  4OX9 M;  1Z5B A;  2ZM6 M;  2VQF M;  3TWL A;  3TWM A;  4LF5 M;  4LFA M;  3SAT A;  4LFB M;  3DOA A;  4PD2 A;  5LMU M;  4X62 M;  3GQ5 A;  4DV4 M;  4DV7 M;  1IBL M;  3A46 A;  4JI2 M;  4X66 M;  4LF7 M;  3C58 A;  1MU5 A;  3GPY A;  3T1H M;  1IBM M;  4NRW A;  3GP1 A;  3GPX A;  5BR8 M;  1NNJ A;  4G4N A;  4GKK M; 
#chains in the Genus database with same CATH topology
 3PVS A;  2APL A;  1TH2 A;  4AI6 A;  3B74 A;  4PT5 A;  2F5P A;  4RKU F;  3HJS A;  2W82 A;  1F4I A;  3EIH A;  4OVZ B;  2FS1 A;  1YUB A;  2CEA A;  4IBI A;  3JAM S;  3A45 A;  3HU1 A;  4HL4 A;  4I4L A;  2C9C A;  4HLQ A;  1NVM A;  4B3S M;  3GRY A;  4MGY E;  1N34 M;  4PCZ A;  4JI8 M;  2QEN A;  5A2Q S;  2DAI A;  3U6P A;  1XB2 B;  2H5X A;  1L2D A;  5JI2 E;  1NHG C;  2EKK A;  2KEB A;  4TUW A;  3K9O A;  4B08 A;  3U5Z A;  4L8R C;  3W68 A;  3SAV A;  2Z4S A;  4GHA A;  5C18 A;  4DV2 M;  1YLA A;  4LJ8 A;  4L6V 6;  4DR6 M;  4DR4 M;  3MK6 A;  4BBA A;  3KOZ E;  5IT9 S;  2FFJ A;  3M0E A;  3GO8 A;  2KA6 B;  2BJW A;  2LTU A;  2LXE A;  4IJE A;  2MH8 A;  3V76 A;  3AOG A;  2BWE A;  2LHC A;  3FYC A;  2KNA A;  2WSE F;  4NRV A;  1TF0 B;  4Q7J A;  1R2Y A;  4DR1 M;  3KFU G;  4FVM A;  2DEN A;  4MGH A;  3U61 B;  2C96 A;  3VDU A;  1OAO C;  1ZQ9 A;  3I4V A;  1J5E M;  2CWB A;  4G3O A;  3I04 M;  5EXP A;  3BBZ A;  1XWI A;  3TQS A;  2K0B X;  2XH9 A;  3J7B A;  4FWG A;  5FTK A;  4JI0 M;  4AG6 A;  2VQE M;  1K3W A;  4PDI A;  3LQR A;  1PRB A;  4AQY M;  1PGY A;  3GLI A;  2JY8 A;  2K47 A;  2KNZ A;  4LF9 M;  5JI3 E;  1QYR A;  1SXJ B;  1N33 M;  3VFD A;  4LZJ A;  2C98 A;  4LY6 A;  2Q2E B;  3GLH B;  2O25 A;  1G8P A;  2R18 A;  4YHH M;  3U6E A;  2DWZ B;  4B3M M;  3KDS E;  4LJA A;  4JI5 M;  2CE7 A;  4LJ5 A;  3J2P B;  1DGB A;  2XFT A;  1V33 A;  3I01 M;  3Q8G A;  3SMS A;  4JI1 M;  1VG5 A;  4XK8 F;  2DKL A;  4FWD A;  3GPU A;  2DWM A;  2R4E A;  2ZBK B;  1OIZ A;  2KZS A;  3IEC A;  3IG8 A;  2UUC M;  3ZQJ A;  1JR3 D;  3HY5 A;  5FTN A;  3DFZ A;  2VII A;  2YR0 A;  4NXM M;  1VEK A;  1KFV A;  5DFL A;  1C1K A;  3W0L B;  4NSR A;  4DR2 M;  2KW0 A;  3I51 A;  4M9X A;  3VLF B;  2L7I A;  1TGU A;  5ITY A;  2KRU A;  1XXH B;  3AV0 A;  2EJS A;  4R7G A;  1QUT A;  3UZU A;  1NNU C;  3IG5 A;  4CJ6 A;  4DR3 M;  5KO3 A;  4GC9 A;  2VQF M;  1BVS A;  4JN6 A;  1H6U A;  4LF5 M;  2O01 F;  4LFB M;  3LVW A;  3C9P A;  1Y8G A;  1UFZ A;  1YSY A;  2DZO B;  2NQ8 C;  3K92 A;  4D80 A;  2KNV A;  4IBK A;  3A46 A;  4I8O A;  4JI2 M;  1VQ1 A;  3CTW B;  4B7G A;  1T3T A;  3UK6 A;  4NRW A;  1IBM M;  1MN3 A;  2QNJ A;  3UMM A;  4D81 A;  3MHV C;  3GPX A;  3R9X B;  3FTC A;  5FTM A;  2C99 A;  1OQY A;  1N78 A;  4AKH A;  2M5Z A;  3KP0 E;  2J7N A;  5F3W A;  2WSF F;  1PJS A;  1DO0 A;  2HL7 A;  2G5G X;  4YY3 M;  3GLF A;  1JR3 A;  4DV0 M;  1X37 A;  2K9D A;  5ITT A;  3U60 A;  1S3S A;  1Q3C A;  4G6Z A;  4B7H A;  2ZAM A;  3U6O A;  1IXS B;  2MRO B;  3CF2 A;  4A3V B;  3FUW A;  2LVA A;  3I4Y A;  4XGI A;  2QCU A;  4IBF A;  1OKS A;  2CRU A;  2JZ1 A;  3A42 A;  2LVQ D;  3RGP A;  1OFI A;  2OPF A;  4I81 A;  2OOA A;  3ZH9 B;  3OTO M;  1I94 M;  2JP7 A;  4KLN A;  3U6S A;  4GMQ A;  1ZMV A;  2KDL A;  4OVZ A;  1VDD A;  3AJI B;  3JR5 A;  2L4F A;  4L15 A;  2Z3X A;  4QNR A;  3MJ5 A;  4QOS A;  5BPV A;  2HHH M;  3EIE A;  1G59 A;  1G71 A;  2ZTD A;  3KOY E;  3SBJ A;  1V92 A;  1IQP A;  3VDP A;  3AFH A;  3NWL A;  2R44 A;  3K9P A;  2D7G A;  4K0K M;  1IXZ A;  2XLJ A;  3U6Q A;  3E4R A;  5GKN A;  5C1B A;  3FRH A;  2MR9 A;  1R5L A;  4AKI A;  2R65 A;  4UN2 B;  3QAU A;  3U6L A;  2LWX A;  3PXG A;  3B89 A;  3TWK A;  2M60 A;  4NOO B;  5KQ8 A;  3U6M A;  3SFZ A;  4LF4 M;  1IY2 A;  2LVP C;  1I4W A;  1R4G A;  1IM2 A;  4GC5 A;  3GLG B;  2GQF A;  4IJF A;  2VF7 A;  4G4Q A;  1HQC A;  1SXJ E;  1IN6 A;  1J09 A;  3RGS A;  2XZU A;  2R62 A;  3GLH E;  1EFU B;  3ILK A;  4KT0 F;  5EP2 A;  1Z5A A;  2V1C A;  3LCV B;  4LGM A;  4LJ6 A;  1EE8 A;  1GAB A;  2J5Y A;  2V6Z M;  3H4M A;  3HU3 A;  2XZF A;  3GRV A;  1GO5 A;  2G3Q A;  1JQJ C;  2FNA A;  2N35 A;  4ITQ A;  2V1U A;  1AUA A;  2R45 A;  1GKI A;  1G4A E;  1UM8 A;  1KSF X;  5KPT A;  2B3T A;  1NSF A;  2HCB A;  3LVV A;  1L2C A;  2MJ5 B;  5IZ7 D;  2EUC A;  4NC6 A;  3K8Z A;  4QHS A;  3LW5 F;  1NY6 A;  3SHG B;  2LBC A;  3U6D A;  4MB7 A;  2JA2 A;  3HWS A;  1HNZ M;  1XHB A;  3WHL A;  5ITX E;  1PJJ A;  1XXH E;  2QSF X;  1TR8 A;  1Z59 A;  2JY6 B;  4GEW A;  4II7 A;  1D0K A;  4PDG A;  4AG5 A;  2JZ0 A;  4F2L A;  2DNA A;  2DVW B;  5ITQ A;  4CHT B;  1NV8 A;  3GRU A;  4LGY A;  2L7H A;  2R4J A;  2OQ4 A;  4WUR A;  4MM3 B;  1PJQ A;  3TWM A;  1YE9 A;  1DO2 A;  4XBO A;  1TTE A;  1G3I A;  2OO9 A;  1T6O A;  1KYI A;  4D82 A;  5H37 D;  3DOA A;  2G8L A;  1XXH A;  4PD2 A;  5LMU M;  1DGH A;  3FUX A;  3FKE A;  4LRS A;  4X62 M;  3E46 A;  1IBL M;  2BJV A;  1RU3 A;  4LF7 M;  3HHX A;  2X49 A;  2DWN A;  2D7E A;  1MU5 A;  3GPY A;  1QAM A;  3NBI A;  1E9R A;  3R8F A;  4GKK M;  2L4E A;  1WGL A;  5EP3 A;  4B7F A;  2DAG A;  1WIV A;  2F5Q A;  1MX0 A;  1MJG M;  3C3E A;  4AZF A;  3L25 A;  1ORY B;  1HR0 M;  3J7A S;  4X65 M;  4KHP M;  3RE8 A;  2XGN A;  4LZZ A;  4FCW A;  4MGZ E;  3QWL A;  3B7Z A;  4IIW A;  1WHC A;  3B7N A;  4R3D A;  4CGY B;  4F1I A;  3CGW A;  4LF6 M;  2X4A A;  3GLI B;  3T38 A;  5E6J A;  3BOS A;  4RF0 A;  2EO2 A;  3PFI A;  1IXS A;  1ZAE A;  2EKF A;  3HU2 A;  4JI3 M;  3SAS A;  3GQ3 A;  3BXW A;  3HX3 A;  1DGF A;  3U6C A;  3A98 B;  1QAN A;  1D2N A;  3SC3 A;  4L16 A;  5E26 A;  1QVR A;  1FNN A;  2Y0T A;  3PNY A;  3TE6 A;  3HJQ A;  1LTM A;  2P5T A;  2Z4R A;  3TL4 X;  4ANR A;  1IBK M;  4S12 A;  1NO1 A;  1ZV1 A;  1IN4 A;  2Y21 A;  3K2L A;  3J80 S;  3SAR A;  4HEO A;  2VDB B;  3GLG E;  3HHZ A;  3FD9 A;  3Q8X A;  3SYL A;  4ZPX A;  4P16 A;  1VEG A;  3PNV A;  2WSC F;  4I5S A;  1QUS A;  1W5T A;  4JI7 M;  2O5R A;  1XNR M;  5EQT A;  2CP8 A;  3ZC7 B;  1G41 A;  1Q3B A;  2JY5 A;  3KP1 E;  2DAE A;  1DV0 A;  4JXJ A;  2OOB A;  2BNK A;  1WGN A;  3LCU A;  1VEJ A;  2KRK A;  4DV6 M;  4QHT A;  4DV3 M;  2DI0 A;  1OTR A;  1P3Q Q;  2MGW A;  4BLC A;  3VKG A;  1Z5C A;  1HNX M;  1D0L A;  3L2A A;  4B3T M;  4MH0 E;  3JR4 A;  3GRR A;  1HJP A;  4JYA M;  1TDZ A;  2QP9 X;  1NY5 A;  3KSJ A;  1N32 M;  4MGI E;  4AW4 A;  5EXS A;  5IWA M;  2QBY B;  4BB9 A;  2E5L M;  1K82 A;  1L2B A;  3FTE A;  2UXB M;  1OIP A;  4LJ4 A;  3GLF B;  2XSZ A;  1NJG A;  2C9O A;  2JY7 A;  5EXT A;  3TPZ A;  4DUZ M;  2Z7J A;  3AOE A;  7CAT A;  3T6P A;  3L28 A;  3KW6 A;  2C5R A;  4IBG A;  4GRI A;  5KQD A;  2DAM A;  1T43 A;  4DR5 M;  1QQW A;  2FH0 A;  3KXE C;  1ZMW A;  3E21 A;  1C7Y A;  2A5Y B;  2JNH A;  4NSO B;  3VK7 A;  4P17 A;  1V34 A;  2CUZ A;  3U61 A;  4M0W A;  3D8L A;  1WR1 B;  4QNM A;  3D8B A;  3KS4 A;  1L1Z A;  3J81 S;  2VF8 A;  2YNM D;  3B7Q A;  4IBB A;  5EXX A;  5DNY A;  4FCT A;  3HHW A;  1L8Q A;  2CV2 A;  3AKZ A;  4OX9 M;  2YQZ A;  3F92 A;  2LHG A;  4FW9 A;  3TWL A;  3SMP A;  4LFA M;  2ZTC A;  2L6O A;  2K6B A;  3HJ8 A;  1ZMU A;  1IY1 A;  5KPZ A;  1IY0 A;  4KO8 A;  1SXJ A;  3THG A;  3KS8 A;  3GQ5 A;  4DV7 M;  4IBJ A;  1IFY A;  3HKP A;  3GLH A;  2R6F A;  5DYG A;  3FTD A;  2CV1 A;  2XFS A;  5BR8 M;  5FTJ A;  3UJN A;  1NNJ A;  2DHY A;  2JWS A;  2XEP A;  3QYB A;  4GH9 A;  4GIP A;  4NL4 H;  3FUV A;  3L27 A;  5FLX S;  4AKG A;  3ZCB B;  2KZU A;  3GLI E;  4IBD A;  2F5O A;  3LMM A;  5IRE B;  3AL0 C;  2YFQ A;  2ZAN A;  2UU9 M;  3UGJ A;  1IXR C;  1LV7 A;  2F5S A;  1R7R A;  1QDR A;  2L09 A;  3U5Z B;  2UXD M;  5ITX A;  3IHP A;  2HAK A;  3FRI A;  3KVW A;  2QHO B;  1SG9 A;  2RRU A;  2KHH A;  1IN7 A;  2XF3 A;  1N36 M;  4QOZ C;  4IBE A;  1HT2 E;  1Q39 A;  4DV1 M;  2UUB M;  1HQY E;  1W5S A;  2I7P A;  1HNW M;  4MGK E;  2CHV A;  2HWJ A;  4LJ7 A;  1XMQ M;  4X64 M;  4LRT A;  3L29 A;  2DHR A;  2DZL A;  4FCV A;  4IBC A;  5FSW A;  5L8R F;  2DWL A;  3B9P A;  3KOW E;  4WW0 A;  1OJL A;  1Z6T A;  2Y20 A;  3QYE A;  1FJG M;  2JUJ A;  4JV5 M;  1E32 A;  1TH4 A;  3FE3 A;  3W67 A;  2UUA M;  4GIT A;  4G4O A;  1JB0 F;  4DV5 M;  1XMO M;  3T1Y M;  1NHW C;  4DUY M;  3C3D A;  4JI6 M;  1TDH A;  3FYD A;  4LCB A;  2R46 A;  4LFC M;  3SAW A;  3VK8 A;  4G4R A;  2HKJ A;  3CF0 A;  3WHK A;  2H1R A;  3T15 A;  1L1T A;  3HZJ A;  3SAU A;  1AIP C;  2RKO A;  4REZ A;  4L78 A;  1GLN A;  1TH3 A;  1PM5 A;  1D0M A;  1QZM A;  1E94 E;  5EP1 A;  1XNQ M;  2WZJ A;  5KPR A;  1HT1 E;  3HGI A;  1WXQ A;  3MMP A;  4OW0 A;  4B3R M;  4Y28 F;  1GJT A;  1QDT A;  4M0D A;  8CAT A;  5ITR A;  2LVO C;  4M9Z A;  1PJI A;  2RGO A;  1DGH B;  1R6B X;  2KXE A;  2X8A A;  3M6A A;  1GL7 A;  1WJ7 A;  1NV9 A;  1E9S A;  3L26 A;  1K3X A;  3HHY A;  3M7G A;  2FOI C;  4DBG B;  4FWH A;  5EJC A;  1R2Z A;  2Y0Q A;  4WP2 A;  5LMN M;  4RF1 A;  2XSZ D;  3GLF E;  1XC8 A;  1JR3 E;  1QZE A;  4RNA A;  4NXN M;  1EIJ A;  1GVN A;  2UXC M;  1QAQ A;  1GJS A;  1GL6 A;  2DAK A;  3CF6 E;  3GPP A;  1VDL A;  2GNO A;  4EIW A;  3KSX A;  5EP4 A;  3KOX E;  4JI4 M;  2F4V M;  2RGH A;  2FE8 A;  3AOE C;  5FTL A;  4CIS A;  4GKJ M;  2QZ4 A;  2Z8Y M;  1J7K A;  1IN8 A;  1QAO A;  3LQQ A;  4KOD A;  2EA0 A;  4GHL A;  4Z6Y A;  2F5N A;  1N75 A;  3W0F A;  2AHM A;  2ZAO A;  3H4J A;  2LVN C;  2QBY A;  4LJ9 A;  4LF8 M;  1OAI A;  3NBX X;  4FD2 A;  1DGG A;  5ITU A;  1NJF A;  2LNH C;  4DR7 M;  3GLG A;  1SXJ D;  3GQ4 A;  2BWB A;  5DYI A;  1Z5B A;  2ERC A;  2ZM6 M;  2CV0 A;  4L4U A;  3SHF A;  2R0I A;  4LG2 A;  2CFO A;  3VKH A;  3SAT A;  2LH0 A;  1CUK A;  4R71 A;  4CIZ A;  1N77 A;  1SXJ C;  4W5W A;  2QQ8 A;  4OU7 A;  2JXN A;  2QPA A;  2CHG A;  1IN5 A;  3SYK A;  4DV4 M;  2CHQ A;  4Z8X A;  4X66 M;  3FTF A;  1A5T A;  2DZN B;  3DZD A;  3RFW A;  3C58 A;  3E9S A;  3J27 B;  4M9S A;  2L2D A;  1Q02 A;  2D7H A;  3T1H M;  2DXI A;  3GP1 A;  1OFH A;  2I7N A;  2J7O A;  3DA1 A;  3U60 B;  1PJT A;  3FUT A;  4G4N A;  3K1J A;  3FUU A; 
#chains in the Genus database with same CATH homology
 3PVS A;  1TH2 A;  4AI6 A;  2F5P A;  4PT5 A;  3HJS A;  2W82 A;  3EIH A;  4OVZ B;  1YUB A;  2CEA A;  4IBI A;  3JAM S;  3A45 A;  3HU1 A;  4HL4 A;  4I4L A;  2C9C A;  4HLQ A;  1NVM A;  4B3S M;  3GRY A;  4MGY E;  1N34 M;  4PCZ A;  4JI8 M;  2QEN A;  5A2Q S;  3U6P A;  1L2D A;  5JI2 E;  1NHG C;  2KEB A;  4TUW A;  4B08 A;  3U5Z A;  4L8R C;  3SAV A;  2Z4S A;  4GHA A;  5C18 A;  4DV2 M;  4LJ8 A;  4DR6 M;  4DR4 M;  3MK6 A;  4BBA A;  3KOZ E;  5IT9 S;  2FFJ A;  3M0E A;  3GO8 A;  2KA6 B;  2BJW A;  2LXE A;  4IJE A;  3AOG A;  3FYC A;  4NRV A;  1R2Y A;  4DR1 M;  3KFU G;  4FVM A;  4MGH A;  3U61 B;  1J5E M;  2C96 A;  3VDU A;  1ZQ9 A;  3I4V A;  5EXP A;  1XWI A;  3TQS A;  3J7B A;  2XH9 A;  5FTK A;  4FWG A;  4JI0 M;  4AG6 A;  2VQE M;  1K3W A;  4PDI A;  3LQR A;  4AQY M;  3GLI A;  2K47 A;  4LF9 M;  5JI3 E;  1QYR A;  1SXJ B;  1N33 M;  3VFD A;  4LZJ A;  2C98 A;  4LY6 A;  2Q2E B;  3GLH B;  1G8P A;  2R18 A;  4YHH M;  3U6E A;  2DWZ B;  4B3M M;  4LJA A;  4JI5 M;  2CE7 A;  4LJ5 A;  3J2P B;  1DGB A;  2XFT A;  3SMS A;  4JI1 M;  3GPU A;  4FWD A;  2DWM A;  2R4E A;  2ZBK B;  2KZS A;  3IG8 A;  2UUC M;  1JR3 D;  5FTN A;  3DFZ A;  2VII A;  2YR0 A;  4NXM M;  1KFV A;  1C1K A;  3W0L B;  4NSR A;  4DR2 M;  2KW0 A;  3I51 A;  4M9X A;  3VLF B;  2L7I A;  1TGU A;  5ITY A;  2KRU A;  1XXH B;  3AV0 A;  4R7G A;  3UZU A;  1NNU C;  3IG5 A;  4DR3 M;  5KO3 A;  4GC9 A;  2VQF M;  4JN6 A;  1H6U A;  4LF5 M;  4LFB M;  3LVW A;  1YSY A;  2DZO B;  2NQ8 C;  3K92 A;  4D80 A;  4IBK A;  3A46 A;  4I8O A;  4JI2 M;  3CTW B;  4B7G A;  1T3T A;  3UK6 A;  4NRW A;  1IBM M;  3UMM A;  4D81 A;  3MHV C;  3GPX A;  3K1J A;  3FTC A;  5FTM A;  2C99 A;  1N78 A;  4AKH A;  2M5Z A;  3KP0 E;  2J7N A;  5F3W A;  1DO0 A;  2HL7 A;  2G5G X;  4YY3 M;  3GLF A;  1JR3 A;  4DV0 M;  1X37 A;  5ITT A;  3U60 A;  1S3S A;  1Q3C A;  4G6Z A;  4B7H A;  2ZAM A;  3U6O A;  1IXS B;  3CF2 A;  4A3V B;  3FUW A;  3I4Y A;  4XGI A;  2QCU A;  4IBF A;  3A42 A;  3RGP A;  1OFI A;  2OPF A;  4I81 A;  3ZH9 B;  3OTO M;  1I94 M;  4KLN A;  3U6S A;  4GMQ A;  4OVZ A;  1VDD A;  3AJI B;  3JR5 A;  2Z3X A;  4L15 A;  4QNR A;  3MJ5 A;  4QOS A;  5BPV A;  2HHH M;  3EIE A;  1G59 A;  3SBJ A;  3KOY E;  1IQP A;  3VDP A;  3AFH A;  3NWL A;  2D7G A;  4K0K M;  1IXZ A;  2XLJ A;  3U6Q A;  3E4R A;  5GKN A;  5C1B A;  4AKI A;  2R65 A;  3QAU A;  3U6L A;  2LWX A;  3PXG A;  3TWK A;  2M60 A;  4NOO B;  5KQ8 A;  3U6M A;  3SFZ A;  4LF4 M;  1IY2 A;  1I4W A;  1IM2 A;  4GC5 A;  3GLG B;  4IJF A;  4G4Q A;  1HQC A;  1SXJ E;  1IN6 A;  1J09 A;  3RGS A;  2XZU A;  2R62 A;  3ILK A;  5EP2 A;  1Z5A A;  2V1C A;  4LGM A;  4LJ6 A;  1EE8 A;  2V6Z M;  3H4M A;  3HU3 A;  2XZF A;  3GRV A;  1JQJ C;  2FNA A;  4ITQ A;  2V1U A;  2R45 A;  1GKI A;  1G4A E;  1UM8 A;  1KSF X;  5KPT A;  1NSF A;  2HCB A;  3LVV A;  1L2C A;  5IZ7 D;  2EUC A;  3K8Z A;  4QHS A;  1NY6 A;  3SHG B;  3U6D A;  4MB7 A;  2JA2 A;  3HWS A;  1HNZ M;  1XHB A;  3WHL A;  5ITX E;  1PJJ A;  1Z59 A;  4II7 A;  4PDG A;  4AG5 A;  2DVW B;  5ITQ A;  4CHT B;  3GRU A;  4LGY A;  2L7H A;  2R4J A;  2OQ4 A;  4WUR A;  4MM3 B;  3TWM A;  1YE9 A;  1DO2 A;  4XBO A;  1G3I A;  1KYI A;  4D82 A;  5H37 D;  3DOA A;  2G8L A;  1XXH A;  4PD2 A;  5LMU M;  1DGH A;  3FUX A;  3FKE A;  4LRS A;  4X62 M;  1IBL M;  2BJV A;  4LF7 M;  3HHX A;  2X49 A;  2DWN A;  2D7E A;  1MU5 A;  3GPY A;  1QAM A;  3NBI A;  1E9R A;  3R8F A;  4GKK M;  5EP3 A;  4B7F A;  2F5Q A;  1MX0 A;  4AZF A;  3L25 A;  1ORY B;  1HR0 M;  3J7A S;  4X65 M;  4KHP M;  3RE8 A;  2XGN A;  4LZZ A;  4FCW A;  4MGZ E;  3QWL A;  4IIW A;  4R3D A;  4CGY B;  4LF6 M;  2X4A A;  3GLI B;  3T38 A;  5E6J A;  3BOS A;  4RF0 A;  2EO2 A;  3PFI A;  1ZAE A;  3SAS A;  3HU2 A;  4JI3 M;  3GQ3 A;  1DGF A;  3U6C A;  3A98 B;  1QAN A;  1D2N A;  3SC3 A;  4L16 A;  5E26 A;  1QVR A;  1FNN A;  2Y0T A;  3PNY A;  3TE6 A;  3HJQ A;  2P5T A;  2Z4R A;  3TL4 X;  1IBK M;  4S12 A;  1IN4 A;  2Y21 A;  3K2L A;  3J80 S;  3SAR A;  3HHZ A;  3FD9 A;  3Q8X A;  3SYL A;  4ZPX A;  4P16 A;  3PNV A;  4I5S A;  1W5T A;  4JI7 M;  2O5R A;  1XNR M;  5EQT A;  3ZC7 B;  1G41 A;  1Q3B A;  3KP1 E;  4JXJ A;  2BNK A;  2KRK A;  4DV6 M;  4QHT A;  4DV3 M;  3VKG A;  4BLC A;  1Z5C A;  1HNX M;  3L2A A;  4B3T M;  4MH0 E;  3JR4 A;  3GRR A;  4JYA M;  1TDZ A;  2QP9 X;  1NY5 A;  3KSJ A;  1N32 M;  4MGI E;  4AW4 A;  5EXS A;  5IWA M;  2QBY B;  4BB9 A;  2E5L M;  1K82 A;  1L2B A;  3FTE A;  2UXB M;  4LJ4 A;  3GLF B;  2XSZ A;  1NJG A;  2C9O A;  5EXT A;  3TPZ A;  4DUZ M;  2Z7J A;  3AOE A;  7CAT A;  3L28 A;  3KW6 A;  2C5R A;  4IBG A;  4GRI A;  5KQD A;  4DR5 M;  1QQW A;  3KXE C;  2A5Y B;  4NSO B;  3VK7 A;  2CUZ A;  3U61 A;  4M0W A;  3D8L A;  4QNM A;  3D8B A;  3KS4 A;  1L1Z A;  3J81 S;  2YNM D;  5DNY A;  4IBB A;  5EXX A;  2CV2 A;  3R9X B;  4FCT A;  3HHW A;  1L8Q A;  3AKZ A;  4OX9 M;  2YQZ A;  4FW9 A;  3TWL A;  3SMP A;  4LFA M;  2L6O A;  3HJ8 A;  1IY1 A;  5KPZ A;  1IY0 A;  4KO8 A;  1SXJ A;  3THG A;  3KS8 A;  3GQ5 A;  4DV7 M;  4IBJ A;  3HKP A;  3GLH A;  5DYG A;  3FTD A;  2CV1 A;  2XFS A;  5BR8 M;  5FTJ A;  3UJN A;  1NNJ A;  2XEP A;  4GH9 A;  4GIP A;  4NL4 H;  3FUV A;  3L27 A;  5FLX S;  4AKG A;  3ZCB B;  2KZU A;  4IBD A;  2F5O A;  3LMM A;  5IRE B;  3AL0 C;  2YFQ A;  2ZAN A;  2UU9 M;  3UGJ A;  1IXR C;  1LV7 A;  2F5S A;  1R7R A;  2L09 A;  3U5Z B;  2UXD M;  5ITX A;  3KVW A;  2XF3 A;  1IN7 A;  1N36 M;  4QOZ C;  4IBE A;  1HT2 E;  1Q39 A;  4DV1 M;  2UUB M;  1HQY E;  1W5S A;  2I7P A;  1HNW M;  4MGK E;  2CHV A;  4LJ7 A;  1XMQ M;  4X64 M;  4LRT A;  3L29 A;  2DHR A;  4FCV A;  4IBC A;  5FSW A;  2DWL A;  3B9P A;  3KOW E;  4WW0 A;  1OJL A;  1Z6T A;  2Y20 A;  1FJG M;  4JV5 M;  1E32 A;  1TH4 A;  2UUA M;  4GIT A;  4G4O A;  4DV5 M;  1XMO M;  3T1Y M;  1NHW C;  4DUY M;  4JI6 M;  1TDH A;  3FYD A;  4LCB A;  2R46 A;  4LFC M;  3SAW A;  3VK8 A;  4G4R A;  2HKJ A;  3CF0 A;  3WHK A;  2H1R A;  3T15 A;  1L1T A;  3SAU A;  4REZ A;  2RKO A;  4L78 A;  1GLN A;  1TH3 A;  1PM5 A;  1QZM A;  1E94 E;  5EP1 A;  1XNQ M;  5KPR A;  1HT1 E;  3HGI A;  1WXQ A;  4OW0 A;  4B3R M;  4M0D A;  8CAT A;  5ITR A;  4M9Z A;  1PJI A;  2RGO A;  1DGH B;  1R6B X;  2KXE A;  2X8A A;  3M6A A;  1GL7 A;  1E9S A;  3L26 A;  1K3X A;  3HHY A;  3M7G A;  2FOI C;  4FWH A;  5EJC A;  1R2Z A;  2Y0Q A;  1XC8 A;  5LMN M;  4RF1 A;  2XSZ D;  4RNA A;  4NXN M;  1GVN A;  2UXC M;  1QAQ A;  1GL6 A;  3CF6 E;  3GPP A;  4EIW A;  4JI4 M;  3KSX A;  5EP4 A;  3KOX E;  2F4V M;  2RGH A;  2FE8 A;  3AOE C;  5FTL A;  4CIS A;  4GKJ M;  2QZ4 A;  4KOD A;  1J7K A;  1IN8 A;  1QAO A;  3LQQ A;  2EA0 A;  4GHL A;  4Z6Y A;  2F5N A;  1N75 A;  3W0F A;  2AHM A;  2ZAO A;  2QBY A;  4LJ9 A;  4LF8 M;  4FD2 A;  1DGG A;  5ITU A;  1NJF A;  2LNH C;  4DR7 M;  3GLG A;  1SXJ D;  3GQ4 A;  5DYI A;  1Z5B A;  2ERC A;  2ZM6 M;  2CV0 A;  4L4U A;  3SHF A;  4LG2 A;  2CFO A;  3VKH A;  3SAT A;  2LH0 A;  1N77 A;  1SXJ C;  4W5W A;  4OU7 A;  2QPA A;  2CHG A;  1IN5 A;  3SYK A;  4DV4 M;  2CHQ A;  4Z8X A;  4X66 M;  3FTF A;  2DZN B;  3DZD A;  3RFW A;  3C58 A;  3E9S A;  3J27 B;  4M9S A;  3T1H M;  2D7H A;  2DXI A;  3GP1 A;  1OFH A;  2I7N A;  2J7O A;  3DA1 A;  3U60 B;  3FUT A;  4G4N A;  3KDS E;  3FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...