4X65M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x65M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x65M02
2F4VM 2F5NA 1K3XA 5A2QS 4LFAM 4JI8M 2UUCM 1Q3BA 4LF8M 3SBJA 1IBMM 3JR4A 3GQ5A 1MX0A 3J7AS 4YHHM 3A45A 3TWKA 1N34M 5ITRA 4JV5M 4G4QA 5IT9S 1HNWM 4G4NA 3SAWA 1I94M 4GKKM 1L1ZA 4JI2M 4CISA 1Q3CA 1K82A 4DV2M 4G4RA 3U6OA 3SATA 3GQ3A 1N32M 1Z59A 4DR4M 4DR5M 4NXMM 1L2DA 4DR1M 4JYAM 1FJGM 4PDGA 2VQEM 1R2YA 5FLXS 3A46A 4DR3M 1XC8A 2UUBM 4GKJM 1NNJA 5IWAM 4LFCM 1K3WA 5ITQA 1MU5A 3U6LA 4LF6M 2ZBKB 2UU9M 4JI4M 4AQYM 3J80S 3SARA 4B3TM 1TDZA 2F5SA 2UUAM 1XMQM 4MB7A 3SASA 2HHHM 3U6EA 4DV6M 2Q2EB 4DR6M 5ITYA 3GP1A 2OPFA 1HNZM 3T1YM 3W0FA 3JR5A 1XMOM 1Z5AA 4LF9M 4K0KM 1HNXM 4NXNM 3U6MA 1PM5A 3GPYA 4LFBM 4DV0M 3T1HM 2OQ4A 5ITXA 4DV4M 4NRVA 4X65M 2HKJA 5LMUM 2UXDM 3VK8A 1IBLM 3DOAA 3SAUA 3U6SA 4OX9M 3OTOM 4LF5M 4LF4M 1Q39A 4X62M 4DR7M 3SAVA 4B3SM 1TDHA 5BR8M 5LMNM 2VQFM 4DUYM 4JI0M 3GO8A 3GPPA 4DV5M 1L2CA 2XZFA 2F5QA 4JI3M 3U6QA 1IBKM 4DUZM 4ITQA 2XZUA 4DV7M 3VK7A 5ITTA 4JI1M 1N33M 1R2ZA 2EA0A 3U6CA 1KFVA 4LF7M 3TWMA 1PJIA 3JAMS 4PCZA 4PD2A 4JI5M 4DV1M 3U6DA 4DV3M 1J5EM 3C58A 1N36M 1EE8A 3TWLA 2F5PA 1Z5CA 3GQ4A 3J81S 4KHPM 4G4OA 2ZM6M 2E5LM 4JI7M 5ITXE 3A42A 1L2BA 4B3RM 4X66M 2F5OA 4X64M 1PJJA 3GPUA 4NRWA 3U6PA 3GPXA 4YY3M 4DR2M 1Z5BA 4B3MM 1HR0M 1XNRM 4PDIA 1XNQM 2UXCM 4JI6M 1L1TA 5ITUA 2UXBM
chains in the Genus database with same CATH superfamily
5E6JA 2G5GX 2YFQA 2JY7A 4MGZE 5A2QS 3K2LA 1OFIA 4XBOA 1OIZA 1QDRA 1F4IA 5FTJA 1XB2B 4LF8M 3GRYA 2Z3XA 1IBMM 1SXJC 3FTFA 1EFUB 3J7AS 4BBAA 3FUVA 3TWKA 2JZ1A 1ORYB 2BWEA 3EIHA 2HWJA 3GRVA 3SAWA 3UMMA 2C9CA 2DWLA 2CHGA 4FCVA 2G3QA 4RF1A 3CF2A 1NNUC 2JA2A 4L6V6 4LJ6A 1QUSA 3SHGB 2KRKA 2R4EA 2DENA 4D81A 3GQ3A 4DR5M 3B9PA 1QZMA 2XGNA 2EKFA 4GITA 5FLXS 2O01F 3FUTA 3FRIA 3HHXA 3FKEA 1DGGA 5DYIA 7CATA 3AOEA 4LFCM 3U6LA 4LF6M 2QP9X 2VF7A 3ILKA 4AQYM 1AIPC 4M9SA 2WSFF 2CV0A 4LGYA 2AHMA 2F5SA 2J7OA 2RGHA 3AOGA 3ZCBB 3FYCA 2JZ0A 4G6ZA 4NOOB 5DYGA 2Z7JA 1QAQA 2DWNA 1E94E 3W0LB 2DWZB 2LTUA 2XH9A 3VDPA 3T1YM 2MROB 1HNZM 2CE7A 1JB0F 3EIEA 3W0FA 2CHQA 2DVWB 2QSFX 5EP3A 4LF9M 3GLGE 4R71A 1TTEA 4FCWA 4FVMA 3L2AA 1SXJA 4DV0M 1OJLA 5ITXA 2L4FA 1OQYA 4AG6A 3GLFB 4R3DA 3DOAA 4LZJA 3SAUA 1NVMA 2APLA 3KSXA 3B7ZA 3Q8GA 3GLGB 4ZPXA 2KZUA 4WURA 3KOWE 4IBIA 4LF5M 4P17A 4DR7M 2FS1A 1DGHA 4B3SM 1IXRC 1TDHA 2JXNA 4GIPA 4B7GA 2MR9A 4JI0M 3V76A 1N75A 3GPPA 3FE3A 4FWGA 3PXGA 4ITQA 4JI1M 2H1RA 1N33M 3CF0A 2EA0A 3R8FA 4AI6A 4OVZB 1G41A 1JQJC 2V1UA 2X4AA 4LJ5A 4B7FA 1TF0B 1Z6TA 1KFVA 1R6BX 1GVNA 4GHLA 3HX3A 2A5YB 1IY2A 4PCZA 5FTNA 5KPRA 1XHBA 3CTWB 1X37A 3I4VA 2J7NA 1D0KA 3U60B 3TE6A 3U6DA 2X49A 4AKHA 2LVNC 3U5ZB 4GRIA 1EE8A 3GLHE 3HJQA 3VDUA 3GQ4A 3ZC7B 4G4OA 4JI7M 1GO5A 3IG5A 1DO2A 1C7YA 4X66M 1VEJA 2ZAOA 2F5OA 1QAOA 2LXEA 2LBCA 2L09A 2DHRA 4FWHA 5FSWA 2ZTCA 2LVPC 4YY3M 3GPXA 3KS8A 3UJNA 1QANA 1HR0M 4PDIA 3B7QA 1PJQA 3GLHB 2CWBA 3IG8A 1PJTA 3QAUA 1L1TA 1DGBA 3J2PB 4FW9A 3L28A 1K3XA 3R9XB 3M0EA 1Q3BA 1GJSA 3RGPA 3JR4A 1IXSB 1MX0A 1YLAA 1AUAA 1IXZA 2VF8A 2R46A 3SHFA 1WR1B 1N34M 3PVSA 3FUWA 3LVWA 2HAKA 2WSCF 3B74A 4G4NA 4CHTB 4RNAA 1I94M 2XEPA 4Q7JA 1VG5A 1HT2E 4CISA 1Q3CA 2FOIC 1PGYA 2R62A 4DV2M 1G3IA 4MH0E 4DR4M 3HY5A 3ZH9B 1L2DA 4JYAM 4GH9A 4PDGA 3K92A 3WHLA 3J7BA 3QYBA 2K9DA 3UK6A 1R2YA 4IBGA 1TGUA 1MN3A 4MGYE 1YE9A 4OU7A 4OW0A 3C3DA 1NNJA 2C96A 4IJFA 3RFWA 4L8RC 3M6AA 1ZMUA 1R7RA 4JI4M 2D7HA 3K8ZA 2DWMA 3AJIB 4B3TM 3SYKA 1TDZA 5E26A 2UUAM 2FFJA 5FTKA 2L4EA 3BOSA 2CP8A 2FH0A 3VFDA 1G59A 4LJ9A 2QZ4A 4MGKE 4DR6M 1IN4A 2LVAA 2JY8A 3Q8XA 3I4YA 3JR5A 1T6OA 4XGIA 1Z5AA 4Y28F 1XMOM 4LRTA 4K0KM 2RKOA 1HNXM 2CHVA 2V6ZM 3GPYA 3MMPA 4LFBM 2OO9A 1E32A 2C99A 3PFIA 4DV4M 1EIJA 3WHKA 5H37D 1HJPA 3L29A 1IBLM 1NY6A 1IY0A 3L27A 3LQQA 4IBEA 1G4AE 1JR3A 4KT0F 4OX9M 2RRUA 2L7IA 2I7PA 2LH0A 3LCUA 4IJEA 5C1BA 3LW5F 4I4LA 4NSOB 4NC6A 1R4GA 2BJVA 1QAMA 4B08A 3NWLA 5LMNM 1ZMVA 5EP2A 1A5TA 3K1JA 3TPZA 4DUYM 3A98B 3THGA 1NJGA 2ERCA 4LG2A 1C1KA 2WZJA 2MGWA 3FUUA 1IBKM 1J7KA 1XXHE 3VK7A 2R44A 1R2ZA 1QDTA 1D2NA 5JI3E 3W67A 2CUZA 1IY1A 3E4RA 3AV0A 3MHVC 2WSEF 3AKZA 1PJIA 3JAMS 3UZUA 2LWXA 1QZEA 4JI5M 3AFHA 1XXHB 2EO2A 2KRUA 3KW6A 4IBJA 4M9XA 2OOBA 1OIPA 2EJSA 3VKHA 4DV3M 1NJFA 3FTCA 1OTRA 1ZMWA 2XSZA 4LY6A 2QPAA 1VQ1A 4IBDA 1T3TA 1Z5CA 1QQWA 5L8RF 2BJWA 2LHGA 3D8BA 4X64M 2L7HA 4NRWA 1RU3A 5EXPA 3U6PA 2DXIA 2DAIA 3KXEC 1OAOC 4DR2M 5EXSA 2CEAA 4DBGB 1XNRM 1XNQM 1KSFX 3E21A 4QHSA 3M7GA 4JI6M 4GHAA 1FNNA 1IN8A 3IHPA 3UGJA 2F4VM 1VDLA 4AKGA 3GLFA 2QCUA 4FCTA 4JI8M 1OAIA 4GEWA 1PRBA 1TR8A 4II7A 3SBJA 1MJGM 3H4MA 3HHZA 4YHHM 1WGLA 3VLFB 1I4WA 2DZLA 4G4QA 2QQ8A 1HNWM 5FTLA 1TH4A 4Z8XA 3HHYA 4JI2M 2CV2A 3U61A 2R4JA 2DI0A 2K0BX 4W5WA 1SG9A 2DAGA 1IN5A 3SATA 1N32M 2RGOA 2DHYA 4NXMM 4KO8A 5FTMA 4DR1M 1FJGM 3C3EA 2VQEM 4IBKA 2JNHA 1R5LA 2ZTDA 2VDBB 5EJCA 1XC8A 2UUBM 4GKJM 3KSJA 3FYDA 5IWAM 3K9PA 1N78A 2DAMA 1MU5A 2ZBKB 4HEOA 3U60A 4GMQA 4IBFA 4A3VB 2UU9M 4JXJA 4NSRA 3J80S 2DAEA 2ZANA 4MB7A 2R6FA 1DGFA 2KEBA 2HHHM 2QBYB 4QOZC 3U6EA 1DO0A 1HQCA 5C18A 4LZZA 1V33A 4I8OA 3HU3A 1QYRA 2QENA 1GABA 1WHCA 5IREB 1VEKA 2V1CA 2Z4RA 2KW0A 1L8QA 2L2DA 5EXXA 3RE8A 2XFTA 1OFHA 3HWSA 3KOXE 2KNVA 3SYLA 3PNYA 3H4JA 4UN2B 2LNHC 3HJSA 3KOYE 3MJ5A 2HKJA 3VK8A 3FRHA 2Z4SA 3PNVA 3I01M 1GJTA 2EKKA 3U6SA 2LVOC 5KPZA 3QWLA 3OTOM 5EXTA 1Q39A 4X62M 4TUWA 3SAVA 3HZJA 2HL7A 2K6BA 2CFOA 2X8AA 2VQFM 4F2LA 4MGIE 3GLIA 4DV5M 3KVWA 2XZFA 2F5QA 4IBBA 4MM3B 3NBXX 1UM8A 3U6QA 2JY6B 1W5TA 4CIZA 1JR3E 3KDSE 4KLNA 4S12A 2YNMD 4M0WA 1G71A 4HL4A 5ITTA 5GKNA 4M0DA 3U6CA 4L16A 3GRRA 2KXEA 5KQ8A 3F92A 3I04M 1JR3D 4IBCA 5DNYA 4MGHA 4LF7M 4CGYB 1V34A 3LQRA 2JUJA 1LTMA 1N77A 3BXWA 5EP1A 2C98A 1NV9A 1J5EM 3KFUG 3TL4X 3AL0C 2JP7A 1Y8GA 4FWDA 1HT1E 3TWLA 2F5PA 2OOAA 2C9OA 1SXJE 2Z8YM 2Y0TA 3J81S 4KHPM 4LJ4A 1UFZA 4PT5A 3A42A 5ITXE 8CATA 4B3RM 2I7NA 1PJJA 1QUTA 1WIVA 2P5TA 3LVVA 3SC3A 3SMSA 3GPUA 1SXJD 1HQYE 3C9PA 3HU1A 1WJ7A 5KQDA 1LV7A 4B3MM 3B7NA 2Y0QA 3HKPA 4L4UA 1GKIA 1SXJB 1D0LA 1PJSA 1W5SA 3QYEA 5ITUA 3TQSA 2UXBM 4LRSA 5IZ7D 4AKIA 1T43A 2KNZA 3KS4A 4I81A 2F5NA 2XSZD 4LFAM 2UUCM 3E9SA 1NV8A 3HU2A 3GRUA 3GQ5A 1E9SA 5KPTA 4CJ6A 3J27B 2GNOA 1DGHB 2W82A 4XK8F 3A45A 2KDLA 1XWIA 2R18A 2KZSA 4QHTA 5ITRA 4JV5M 5IT9S 1D0MA 2BWBA 1ZV1A 4WP2A 4GKKM 4QOSA 3BBZA 3GLFE 4I5SA 1L1ZA 1IN7A 4RF0A 1YUBA 2JWSA 3DA1A 1P3QQ 2ZAMA 2XLJA 1CUKA 3U6OA 4G4RA 1K82A 4L15A 4ANRA 1IQPA 1Z59A 4R7GA 3L25A 1GLNA 3HHWA 2LHCA 1GL7A 4F1IA 3HJ8A 3A46A 4DR3M 3RGSA 3FTEA 2XF3A 3KP0E 2DAKA 1E9RA 3FD9A 1K3WA 5ITQA 1XXHA 3GLGA 2O25A 5F3WA 4HLQA 2C5RA 2H5XA 3FTDA 4LGMA 3SARA 2Y20A 1XMQM 4BLCA 1NO1A 3SASA 3VKGA 4IIWA 3B89A 4DV6M 4AZFA 5JI2E 1ZQ9A 4QNRA 2Q2EB 4GC5A 3U61B 5ITYA 3GP1A 1NY5A 2OPFA 3T38A 4KODA 2MH8A 4NL4H 1IN6A 1J09A 2K47A 2JY5A 2R65A 1VEGA 2YR0A 3T6PA 4NXNM 3U6MA 1BVSA 1PM5A 2R0IA 4EIWA 3T1HM 5DFLA 2J5YA 2XFSA 4OVZA 2OQ4A 1ZAEA 4NRVA 4LCBA 4X65M 2EUCA 5LMUM 2UXDM 3ZQJA 1YSYA 3I51A 4LJ8A 2CRUA 1NSFA 2DKLA 1G8PA 3CGWA 4Z6YA 1GL6A 1H6UA 4BB9A 3E46A 2KNAA 4LF4M 2M5ZA 1KYIA 2NQ8C 2QNJA 2O5RA 4AG5A 2YQZA 3U5ZA 2FNAA 2Y21A 2CV1A 3KP1E 5BR8M 5BPVA 4FD2A 2QHOB 3DZDA 3GO8A 2BNKA 2D7EA 3K9OA 3T15A 2KHHA 1L2CA 1NHGC 4P16A 4D80A 4QNMA 4JI3M 1QVRA 2DZOB 2KA6B 4GC9A 4DUZM 4B7HA 2XZUA 2R45A 2HCBA 3NBIA 4DV7M 2LVQD 2MJ5B 4AW4A 3IECA 4REZA 4JN6A 2D7GA 3GLHA 3KOZE 3MK6A 1S3SA 4L78A 3TWMA 3GLIE 4G3OA 3SFZA 5EP4A 4PD2A 5KO3A 3LMMA 3CF6E 4DV1M 1IFYA 2GQFA 4D82A 4M9ZA 1IXSA 1NHWC 3C58A 1VDDA 1N36M 2FE8A 1TH2A 2N35A 3GLIB 2QBYA 1Q02A 2DZNB 1OKSA 3W68A 3AOEC 2E5LM 1WXQA 2ZM6M 1DV0A 2VIIA 2M60A 1L2BA 2L6OA 1IM2A 3D8LA 2B3TA 3SMPA 1V92A 3DFZA 4RKUF 1TH3A 2G8LA 1Z5BA 2DNAA 4WW0A 3FUXA 3L26A 2UXCM 4LJ7A 3HGIA 1WGNA 4LJAA 5EQTA 3LCVB
chains in the Genus database with same CATH topology
5E6JA 2G5GX 2YFQA 4MGZE 5A2QS 3K2LA 1OFIA 4XBOA 5FTJA 4LF8M 3GRYA 2Z3XA 1IBMM 1SXJC 3FTFA 3J7AS 4BBAA 3FUVA 3TWKA 1ORYB 3EIHA 3GRVA 3SAWA 3UMMA 2C9CA 2DWLA 2CHGA 4FCVA 4RF1A 3CF2A 1NNUC 2JA2A 4LJ6A 3SHGB 2KRKA 2R4EA 4D81A 3GQ3A 4DR5M 3B9PA 1QZMA 2XGNA 4GITA 5FLXS 3FUTA 3HHXA 3FKEA 1DGGA 5DYIA 7CATA 3AOEA 4LFCM 3U6LA 4LF6M 2QP9X 3ILKA 4AQYM 4M9SA 2CV0A 4LGYA 2AHMA 2F5SA 2J7OA 2RGHA 3AOGA 3ZCBB 3FYCA 4G6ZA 4NOOB 5DYGA 2Z7JA 1QAQA 2DWNA 1E94E 3W0LB 2DWZB 2XH9A 3T1YM 3VDPA 1HNZM 2CE7A 3EIEA 3W0FA 2CHQA 2DVWB 5EP3A 4LF9M 4FCWA 4FVMA 3L2AA 1SXJA 4DV0M 1OJLA 5ITXA 4AG6A 3GLFB 4R3DA 3DOAA 4LZJA 3SAUA 1NVMA 3KSXA 3GLGB 4ZPXA 2KZUA 4WURA 3KOWE 4IBIA 4LF5M 4DR7M 1DGHA 4B3SM 1IXRC 1TDHA 4GIPA 4B7GA 4JI0M 1N75A 3GPPA 4FWGA 3PXGA 4ITQA 4JI1M 2H1RA 1N33M 3CF0A 2EA0A 3R8FA 4AI6A 4OVZB 1G41A 1JQJC 2V1UA 2X4AA 4LJ5A 4B7FA 1KFVA 1Z6TA 1R6BX 1GVNA 4GHLA 4PCZA 2A5YB 1IY2A 5FTNA 5KPRA 3I4VA 1XHBA 1X37A 3CTWB 2J7NA 3U60B 3TE6A 3U6DA 2X49A 4AKHA 3U5ZB 4GRIA 1EE8A 3HJQA 3VDUA 3GQ4A 3ZC7B 4G4OA 4JI7M 3IG5A 1DO2A 4X66M 2ZAOA 2F5OA 1QAOA 2LXEA 4FWHA 2L09A 2DHRA 4YY3M 5FSWA 3GPXA 3KS8A 3UJNA 1QANA 1HR0M 4PDIA 3GLHB 3IG8A 1L1TA 3QAUA 1DGBA 3J2PB 4FW9A 3L28A 1K3XA 3R9XB 3M0EA 1Q3BA 3RGPA 3JR4A 1IXSB 1MX0A 1IXZA 2R46A 3SHFA 1N34M 3PVSA 3FUWA 3LVWA 4G4NA 4CHTB 4RNAA 1I94M 2XEPA 1HT2E 4CISA 1Q3CA 2FOIC 2R62A 4DV2M 1G3IA 4MH0E 4DR4M 3ZH9B 1L2DA 4JYAM 4GH9A 4PDGA 3K92A 3WHLA 3J7BA 3UK6A 1R2YA 4IBGA 1TGUA 4MGYE 1YE9A 4OU7A 4OW0A 1NNJA 2C96A 4IJFA 3RFWA 4L8RC 3M6AA 4JI4M 1R7RA 2D7HA 3K8ZA 2DWMA 3AJIB 4B3TM 3SYKA 1TDZA 5E26A 2UUAM 2FFJA 5FTKA 3BOSA 3VFDA 1G59A 4LJ9A 2QZ4A 4MGKE 4DR6M 1IN4A 3Q8XA 3I4YA 3JR5A 4XGIA 1Z5AA 1XMOM 4LRTA 4K0KM 2RKOA 1HNXM 2CHVA 2V6ZM 3GPYA 4LFBM 1E32A 2C99A 3PFIA 4DV4M 3WHKA 5H37D 3L29A 1IBLM 1NY6A 1IY0A 3L27A 3LQQA 4IBEA 1G4AE 1JR3A 4OX9M 2L7IA 2I7PA 2LH0A 5C1BA 4IJEA 4I4LA 4NSOB 2BJVA 1QAMA 4B08A 3NWLA 5LMNM 5EP2A 3K1JA 3TPZA 4DUYM 3A98B 3THGA 1NJGA 2ERCA 4LG2A 1C1KA 3FUUA 1IBKM 1J7KA 3VK7A 1R2ZA 1D2NA 5JI3E 2CUZA 1IY1A 3E4RA 3AV0A 3MHVC 3AKZA 1PJIA 3JAMS 3UZUA 2LWXA 4JI5M 3AFHA 1XXHB 2EO2A 2KRUA 3KW6A 4IBJA 4M9XA 3VKHA 4DV3M 1NJFA 3FTCA 2XSZA 4LY6A 2QPAA 4IBDA 1T3TA 1Z5CA 1QQWA 2BJWA 3D8BA 4X64M 2L7HA 4NRWA 5EXPA 1N78A 3U6PA 2DXIA 3KXEC 4DR2M 5EXSA 2CEAA 1XNRM 1XNQM 1KSFX 4GHAA 4QHSA 3M7GA 4JI6M 1FNNA 1IN8A 3UGJA 2F4VM 4AKGA 3GLFA 2QCUA 4FCTA 4JI8M 3SBJA 4II7A 3HHZA 3H4MA 4YHHM 3VLFB 1I4WA 4G4QA 1HNWM 5FTLA 1TH4A 4Z8XA 3HHYA 4JI2M 2CV2A 3U61A 2R4JA 4W5WA 1IN5A 3SATA 1N32M 2RGOA 4NXMM 4KO8A 5FTMA 4DR1M 1FJGM 2VQEM 4IBKA 5EJCA 1XC8A 2UUBM 4GKJM 3KSJA 3FYDA 5IWAM 1MU5A 2ZBKB 3U60A 2UU9M 4GMQA 4IBFA 4A3VB 4JXJA 4NSRA 3J80S 2ZANA 4MB7A 1DGFA 2KEBA 2HHHM 2QBYB 4QOZC 3U6EA 1DO0A 1HQCA 5C18A 4LZZA 4I8OA 3HU3A 1QYRA 2QENA 5IREB 2V1CA 2Z4RA 2KW0A 1L8QA 5EXXA 3RE8A 2XFTA 1OFHA 3HWSA 3KOXE 3SYLA 3PNYA 2LNHC 3HJSA 3KOYE 3MJ5A 2HKJA 3VK8A 2Z4SA 3PNVA 3U6SA 5KPZA 3QWLA 3OTOM 5EXTA 1Q39A 4X62M 4TUWA 3SAVA 2HL7A 2VQFM 2CFOA 2X8AA 4MGIE 3GLIA 4DV5M 3KVWA 2XZFA 2F5QA 4IBBA 4MM3B 1UM8A 3U6QA 1W5TA 3KDSE 4KLNA 4S12A 2YNMD 4M0WA 4HL4A 5ITTA 5GKNA 4M0DA 3U6CA 4L16A 3GRRA 2KXEA 5KQ8A 5DNYA 1JR3D 4IBCA 4MGHA 4LF7M 4CGYB 3LQRA 1N77A 5EP1A 2C98A 1J5EM 3KFUG 3TL4X 3AL0C 4FWDA 1HT1E 3TWLA 2F5PA 2C9OA 1SXJE 3J81S 2Y0TA 4KHPM 4LJ4A 4PT5A 3A42A 5ITXE 8CATA 4B3RM 2I7NA 1PJJA 2P5TA 3LVVA 3GPUA 3SC3A 3SMSA 1SXJD 1HQYE 3HU1A 5KQDA 1LV7A 4B3MM 2Y0QA 3HKPA 4L4UA 1GKIA 1SXJB 1W5SA 5ITUA 3TQSA 2UXBM 4LRSA 5IZ7D 4AKIA 2F5NA 4I81A 3KS4A 2XSZD 4LFAM 2UUCM 3E9SA 3HU2A 3GRUA 3GQ5A 1E9SA 5KPTA 3J27B 1DGHB 2W82A 3A45A 1XWIA 2R18A 2KZSA 4QHTA 5ITRA 4JV5M 5IT9S 4GKKM 4QOSA 1L1ZA 4I5SA 1IN7A 4RF0A 1YUBA 3DA1A 2ZAMA 2XLJA 1K82A 3U6OA 4G4RA 4L15A 1IQPA 1Z59A 4R7GA 3L25A 1GLNA 3HHWA 1GL7A 3HJ8A 3A46A 4DR3M 3RGSA 3FTEA 2XF3A 3KP0E 1E9RA 3FD9A 1K3WA 5ITQA 1XXHA 3GLGA 5F3WA 4HLQA 2C5RA 3FTDA 4LGMA 3SARA 2Y20A 1XMQM 4BLCA 3SASA 3VKGA 4IIWA 4DV6M 4AZFA 5JI2E 1ZQ9A 4QNRA 2Q2EB 4GC5A 3U61B 5ITYA 3GP1A 1NY5A 2OPFA 3T38A 4KODA 4NL4H 1IN6A 1J09A 2K47A 2R65A 2YR0A 4NXNM 3U6MA 1PM5A 4EIWA 3T1HM 2XFSA 4OVZA 2OQ4A 1ZAEA 4NRVA 4LCBA 4X65M 2EUCA 5LMUM 2UXDM 1YSYA 3I51A 4LJ8A 1NSFA 1G8PA 4Z6YA 1GL6A 1H6UA 4BB9A 4LF4M 2M5ZA 1KYIA 2NQ8C 2O5RA 4AG5A 2YQZA 3U5ZA 2FNAA 2Y21A 2CV1A 3KP1E 5BR8M 5BPVA 4FD2A 3DZDA 3GO8A 2BNKA 2D7EA 3T15A 1L2CA 1NHGC 4P16A 4D80A 4QNMA 4JI3M 1QVRA 2DZOB 2KA6B 4GC9A 4DUZM 4B7HA 2XZUA 2R45A 2HCBA 3NBIA 4DV7M 4AW4A 4REZA 4JN6A 2D7GA 3GLHA 3KOZE 3MK6A 1S3SA 4L78A 3TWMA 3SFZA 5EP4A 4PD2A 5KO3A 3LMMA 3CF6E 4DV1M 4D82A 4M9ZA 1NHWC 3C58A 1VDDA 1N36M 2FE8A 1TH2A 3GLIB 2QBYA 2DZNB 3AOEC 2E5LM 1WXQA 2ZM6M 2VIIA 2M60A 1L2BA 2L6OA 1IM2A 3D8LA 3SMPA 3DFZA 1TH3A 2G8LA 1Z5BA 4WW0A 3FUXA 3L26A 2UXCM 4LJ7A 3HGIA 4LJAA 5EQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V M;  2F5N A;  1K3X A;  5A2Q S;  4LFA M;  4JI8 M;  2UUC M;  1Q3B A;  4LF8 M;  3SBJ A;  1IBM M;  3JR4 A;  3GQ5 A;  1MX0 A;  3J7A S;  4YHH M;  3A45 A;  3TWK A;  1N34 M;  5ITR A;  4JV5 M;  4G4Q A;  5IT9 S;  1HNW M;  4G4N A;  3SAW A;  1I94 M;  4GKK M;  1L1Z A;  4JI2 M;  4CIS A;  1Q3C A;  1K82 A;  4DV2 M;  4G4R A;  3U6O A;  3SAT A;  3GQ3 A;  1N32 M;  1Z59 A;  4DR4 M;  4DR5 M;  4NXM M;  1L2D A;  4DR1 M;  4JYA M;  1FJG M;  4PDG A;  2VQE M;  1R2Y A;  5FLX S;  3A46 A;  4DR3 M;  1XC8 A;  2UUB M;  4GKJ M;  1NNJ A;  5IWA M;  4LFC M;  1K3W A;  5ITQ A;  1MU5 A;  3U6L A;  4LF6 M;  2ZBK B;  2UU9 M;  4JI4 M;  4AQY M;  3J80 S;  3SAR A;  4B3T M;  1TDZ A;  2F5S A;  2UUA M;  1XMQ M;  4MB7 A;  3SAS A;  2HHH M;  3U6E A;  4DV6 M;  2Q2E B;  4DR6 M;  5ITY A;  3GP1 A;  2OPF A;  1HNZ M;  3T1Y M;  3W0F A;  3JR5 A;  1XMO M;  1Z5A A;  4LF9 M;  4K0K M;  1HNX M;  4NXN M;  3U6M A;  1PM5 A;  3GPY A;  4LFB M;  4DV0 M;  3T1H M;  2OQ4 A;  5ITX A;  4DV4 M;  4NRV A;  4X65 M;  2HKJ A;  5LMU M;  2UXD M;  3VK8 A;  1IBL M;  3DOA A;  3SAU A;  3U6S A;  4OX9 M;  3OTO M;  4LF5 M;  4LF4 M;  1Q39 A;  4X62 M;  4DR7 M;  3SAV A;  4B3S M;  1TDH A;  5BR8 M;  5LMN M;  2VQF M;  4DUY M;  4JI0 M;  3GO8 A;  3GPP A;  4DV5 M;  1L2C A;  2XZF A;  2F5Q A;  4JI3 M;  3U6Q A;  1IBK M;  4DUZ M;  4ITQ A;  2XZU A;  4DV7 M;  3VK7 A;  5ITT A;  4JI1 M;  1N33 M;  1R2Z A;  2EA0 A;  3U6C A;  1KFV A;  4LF7 M;  3TWM A;  1PJI A;  3JAM S;  4PCZ A;  4PD2 A;  4JI5 M;  4DV1 M;  3U6D A;  4DV3 M;  1J5E M;  3C58 A;  1N36 M;  1EE8 A;  3TWL A;  2F5P A;  1Z5C A;  3GQ4 A;  3J81 S;  4KHP M;  4G4O A;  2ZM6 M;  2E5L M;  4JI7 M;  5ITX E;  3A42 A;  1L2B A;  4B3R M;  4X66 M;  2F5O A;  4X64 M;  1PJJ A;  3GPU A;  4NRW A;  3U6P A;  3GPX A;  4YY3 M;  4DR2 M;  1Z5B A;  4B3M M;  1HR0 M;  1XNR M;  4PDI A;  1XNQ M;  2UXC M;  4JI6 M;  1L1T A;  5ITU A;  2UXB M; 
#chains in the Genus database with same CATH topology
 5E6J A;  2G5G X;  2YFQ A;  2JY7 A;  4MGZ E;  5A2Q S;  3K2L A;  1OFI A;  4XBO A;  1OIZ A;  1QDR A;  1F4I A;  5FTJ A;  1XB2 B;  4LF8 M;  3GRY A;  2Z3X A;  1IBM M;  1SXJ C;  3FTF A;  1EFU B;  3J7A S;  4BBA A;  3FUV A;  3TWK A;  2JZ1 A;  1ORY B;  2BWE A;  3EIH A;  2HWJ A;  3GRV A;  3SAW A;  3UMM A;  2C9C A;  2DWL A;  2CHG A;  4FCV A;  2G3Q A;  4RF1 A;  3CF2 A;  1NNU C;  2JA2 A;  4L6V 6;  4LJ6 A;  1QUS A;  3SHG B;  2KRK A;  2R4E A;  2DEN A;  4D81 A;  3GQ3 A;  4DR5 M;  3B9P A;  1QZM A;  2XGN A;  2EKF A;  4GIT A;  5FLX S;  2O01 F;  3FUT A;  3FRI A;  3HHX A;  3FKE A;  1DGG A;  5DYI A;  7CAT A;  3AOE A;  4LFC M;  3U6L A;  4LF6 M;  2QP9 X;  2VF7 A;  3ILK A;  4AQY M;  1AIP C;  4M9S A;  2WSF F;  2CV0 A;  4LGY A;  2AHM A;  2F5S A;  2J7O A;  2RGH A;  3AOG A;  3ZCB B;  3FYC A;  2JZ0 A;  4G6Z A;  4NOO B;  5DYG A;  2Z7J A;  1QAQ A;  2DWN A;  1E94 E;  3W0L B;  2DWZ B;  2LTU A;  2XH9 A;  3VDP A;  3T1Y M;  2MRO B;  1HNZ M;  2CE7 A;  1JB0 F;  3EIE A;  3W0F A;  2CHQ A;  2DVW B;  2QSF X;  5EP3 A;  4LF9 M;  3GLG E;  4R71 A;  1TTE A;  4FCW A;  4FVM A;  3L2A A;  1SXJ A;  4DV0 M;  1OJL A;  5ITX A;  2L4F A;  1OQY A;  4AG6 A;  3GLF B;  4R3D A;  3DOA A;  4LZJ A;  3SAU A;  1NVM A;  2APL A;  3KSX A;  3B7Z A;  3Q8G A;  3GLG B;  4ZPX A;  2KZU A;  4WUR A;  3KOW E;  4IBI A;  4LF5 M;  4P17 A;  4DR7 M;  2FS1 A;  1DGH A;  4B3S M;  1IXR C;  1TDH A;  2JXN A;  4GIP A;  4B7G A;  2MR9 A;  4JI0 M;  3V76 A;  1N75 A;  3GPP A;  3FE3 A;  4FWG A;  3PXG A;  4ITQ A;  4JI1 M;  2H1R A;  1N33 M;  3CF0 A;  2EA0 A;  3R8F A;  4AI6 A;  4OVZ B;  1G41 A;  1JQJ C;  2V1U A;  2X4A A;  4LJ5 A;  4B7F A;  1TF0 B;  1Z6T A;  1KFV A;  1R6B X;  1GVN A;  4GHL A;  3HX3 A;  2A5Y B;  1IY2 A;  4PCZ A;  5FTN A;  5KPR A;  1XHB A;  3CTW B;  1X37 A;  3I4V A;  2J7N A;  1D0K A;  3U60 B;  3TE6 A;  3U6D A;  2X49 A;  4AKH A;  2LVN C;  3U5Z B;  4GRI A;  1EE8 A;  3GLH E;  3HJQ A;  3VDU A;  3GQ4 A;  3ZC7 B;  4G4O A;  4JI7 M;  1GO5 A;  3IG5 A;  1DO2 A;  1C7Y A;  4X66 M;  1VEJ A;  2ZAO A;  2F5O A;  1QAO A;  2LXE A;  2LBC A;  2L09 A;  2DHR A;  4FWH A;  5FSW A;  2ZTC A;  2LVP C;  4YY3 M;  3GPX A;  3KS8 A;  3UJN A;  1QAN A;  1HR0 M;  4PDI A;  3B7Q A;  1PJQ A;  3GLH B;  2CWB A;  3IG8 A;  1PJT A;  3QAU A;  1L1T A;  1DGB A;  3J2P B;  4FW9 A;  3L28 A;  1K3X A;  3R9X B;  3M0E A;  1Q3B A;  1GJS A;  3RGP A;  3JR4 A;  1IXS B;  1MX0 A;  1YLA A;  1AUA A;  1IXZ A;  2VF8 A;  2R46 A;  3SHF A;  1WR1 B;  1N34 M;  3PVS A;  3FUW A;  3LVW A;  2HAK A;  2WSC F;  3B74 A;  4G4N A;  4CHT B;  4RNA A;  1I94 M;  2XEP A;  4Q7J A;  1VG5 A;  1HT2 E;  4CIS A;  1Q3C A;  2FOI C;  1PGY A;  2R62 A;  4DV2 M;  1G3I A;  4MH0 E;  4DR4 M;  3HY5 A;  3ZH9 B;  1L2D A;  4JYA M;  4GH9 A;  4PDG A;  3K92 A;  3WHL A;  3J7B A;  3QYB A;  2K9D A;  3UK6 A;  1R2Y A;  4IBG A;  1TGU A;  1MN3 A;  4MGY E;  1YE9 A;  4OU7 A;  4OW0 A;  3C3D A;  1NNJ A;  2C96 A;  4IJF A;  3RFW A;  4L8R C;  3M6A A;  1ZMU A;  1R7R A;  4JI4 M;  2D7H A;  3K8Z A;  2DWM A;  3AJI B;  4B3T M;  3SYK A;  1TDZ A;  5E26 A;  2UUA M;  2FFJ A;  5FTK A;  2L4E A;  3BOS A;  2CP8 A;  2FH0 A;  3VFD A;  1G59 A;  4LJ9 A;  2QZ4 A;  4MGK E;  4DR6 M;  1IN4 A;  2LVA A;  2JY8 A;  3Q8X A;  3I4Y A;  3JR5 A;  1T6O A;  4XGI A;  1Z5A A;  4Y28 F;  1XMO M;  4LRT A;  4K0K M;  2RKO A;  1HNX M;  2CHV A;  2V6Z M;  3GPY A;  3MMP A;  4LFB M;  2OO9 A;  1E32 A;  2C99 A;  3PFI A;  4DV4 M;  1EIJ A;  3WHK A;  5H37 D;  1HJP A;  3L29 A;  1IBL M;  1NY6 A;  1IY0 A;  3L27 A;  3LQQ A;  4IBE A;  1G4A E;  1JR3 A;  4KT0 F;  4OX9 M;  2RRU A;  2L7I A;  2I7P A;  2LH0 A;  3LCU A;  4IJE A;  5C1B A;  3LW5 F;  4I4L A;  4NSO B;  4NC6 A;  1R4G A;  2BJV A;  1QAM A;  4B08 A;  3NWL A;  5LMN M;  1ZMV A;  5EP2 A;  1A5T A;  3K1J A;  3TPZ A;  4DUY M;  3A98 B;  3THG A;  1NJG A;  2ERC A;  4LG2 A;  1C1K A;  2WZJ A;  2MGW A;  3FUU A;  1IBK M;  1J7K A;  1XXH E;  3VK7 A;  2R44 A;  1R2Z A;  1QDT A;  1D2N A;  5JI3 E;  3W67 A;  2CUZ A;  1IY1 A;  3E4R A;  3AV0 A;  3MHV C;  2WSE F;  3AKZ A;  1PJI A;  3JAM S;  3UZU A;  2LWX A;  1QZE A;  4JI5 M;  3AFH A;  1XXH B;  2EO2 A;  2KRU A;  3KW6 A;  4IBJ A;  4M9X A;  2OOB A;  1OIP A;  2EJS A;  3VKH A;  4DV3 M;  1NJF A;  3FTC A;  1OTR A;  1ZMW A;  2XSZ A;  4LY6 A;  2QPA A;  1VQ1 A;  4IBD A;  1T3T A;  1Z5C A;  1QQW A;  5L8R F;  2BJW A;  2LHG A;  3D8B A;  4X64 M;  2L7H A;  4NRW A;  1RU3 A;  5EXP A;  3U6P A;  2DXI A;  2DAI A;  3KXE C;  1OAO C;  4DR2 M;  5EXS A;  2CEA A;  4DBG B;  1XNR M;  1XNQ M;  1KSF X;  3E21 A;  4QHS A;  3M7G A;  4JI6 M;  4GHA A;  1FNN A;  1IN8 A;  3IHP A;  3UGJ A;  2F4V M;  1VDL A;  4AKG A;  3GLF A;  2QCU A;  4FCT A;  4JI8 M;  1OAI A;  4GEW A;  1PRB A;  1TR8 A;  4II7 A;  3SBJ A;  1MJG M;  3H4M A;  3HHZ A;  4YHH M;  1WGL A;  3VLF B;  1I4W A;  2DZL A;  4G4Q A;  2QQ8 A;  1HNW M;  5FTL A;  1TH4 A;  4Z8X A;  3HHY A;  4JI2 M;  2CV2 A;  3U61 A;  2R4J A;  2DI0 A;  2K0B X;  4W5W A;  1SG9 A;  2DAG A;  1IN5 A;  3SAT A;  1N32 M;  2RGO A;  2DHY A;  4NXM M;  4KO8 A;  5FTM A;  4DR1 M;  1FJG M;  3C3E A;  2VQE M;  4IBK A;  2JNH A;  1R5L A;  2ZTD A;  2VDB B;  5EJC A;  1XC8 A;  2UUB M;  4GKJ M;  3KSJ A;  3FYD A;  5IWA M;  3K9P A;  1N78 A;  2DAM A;  1MU5 A;  2ZBK B;  4HEO A;  3U60 A;  4GMQ A;  4IBF A;  4A3V B;  2UU9 M;  4JXJ A;  4NSR A;  3J80 S;  2DAE A;  2ZAN A;  4MB7 A;  2R6F A;  1DGF A;  2KEB A;  2HHH M;  2QBY B;  4QOZ C;  3U6E A;  1DO0 A;  1HQC A;  5C18 A;  4LZZ A;  1V33 A;  4I8O A;  3HU3 A;  1QYR A;  2QEN A;  1GAB A;  1WHC A;  5IRE B;  1VEK A;  2V1C A;  2Z4R A;  2KW0 A;  1L8Q A;  2L2D A;  5EXX A;  3RE8 A;  2XFT A;  1OFH A;  3HWS A;  3KOX E;  2KNV A;  3SYL A;  3PNY A;  3H4J A;  4UN2 B;  2LNH C;  3HJS A;  3KOY E;  3MJ5 A;  2HKJ A;  3VK8 A;  3FRH A;  2Z4S A;  3PNV A;  3I01 M;  1GJT A;  2EKK A;  3U6S A;  2LVO C;  5KPZ A;  3QWL A;  3OTO M;  5EXT A;  1Q39 A;  4X62 M;  4TUW A;  3SAV A;  3HZJ A;  2HL7 A;  2K6B A;  2CFO A;  2X8A A;  2VQF M;  4F2L A;  4MGI E;  3GLI A;  4DV5 M;  3KVW A;  2XZF A;  2F5Q A;  4IBB A;  4MM3 B;  3NBX X;  1UM8 A;  3U6Q A;  2JY6 B;  1W5T A;  4CIZ A;  1JR3 E;  3KDS E;  4KLN A;  4S12 A;  2YNM D;  4M0W A;  1G71 A;  4HL4 A;  5ITT A;  5GKN A;  4M0D A;  3U6C A;  4L16 A;  3GRR A;  2KXE A;  5KQ8 A;  3F92 A;  3I04 M;  1JR3 D;  4IBC A;  5DNY A;  4MGH A;  4LF7 M;  4CGY B;  1V34 A;  3LQR A;  2JUJ A;  1LTM A;  1N77 A;  3BXW A;  5EP1 A;  2C98 A;  1NV9 A;  1J5E M;  3KFU G;  3TL4 X;  3AL0 C;  2JP7 A;  1Y8G A;  4FWD A;  1HT1 E;  3TWL A;  2F5P A;  2OOA A;  2C9O A;  1SXJ E;  2Z8Y M;  2Y0T A;  3J81 S;  4KHP M;  4LJ4 A;  1UFZ A;  4PT5 A;  3A42 A;  5ITX E;  8CAT A;  4B3R M;  2I7N A;  1PJJ A;  1QUT A;  1WIV A;  2P5T A;  3LVV A;  3SC3 A;  3SMS A;  3GPU A;  1SXJ D;  1HQY E;  3C9P A;  3HU1 A;  1WJ7 A;  5KQD A;  1LV7 A;  4B3M M;  3B7N A;  2Y0Q A;  3HKP A;  4L4U A;  1GKI A;  1SXJ B;  1D0L A;  1PJS A;  1W5S A;  3QYE A;  5ITU A;  3TQS A;  2UXB M;  4LRS A;  5IZ7 D;  4AKI A;  1T43 A;  2KNZ A;  3KS4 A;  4I81 A;  2F5N A;  2XSZ D;  4LFA M;  2UUC M;  3E9S A;  1NV8 A;  3HU2 A;  3GRU A;  3GQ5 A;  1E9S A;  5KPT A;  4CJ6 A;  3J27 B;  2GNO A;  1DGH B;  2W82 A;  4XK8 F;  3A45 A;  2KDL A;  1XWI A;  2R18 A;  2KZS A;  4QHT A;  5ITR A;  4JV5 M;  5IT9 S;  1D0M A;  2BWB A;  1ZV1 A;  4WP2 A;  4GKK M;  4QOS A;  3BBZ A;  3GLF E;  4I5S A;  1L1Z A;  1IN7 A;  4RF0 A;  1YUB A;  2JWS A;  3DA1 A;  1P3Q Q;  2ZAM A;  2XLJ A;  1CUK A;  3U6O A;  4G4R A;  1K82 A;  4L15 A;  4ANR A;  1IQP A;  1Z59 A;  4R7G A;  3L25 A;  1GLN A;  3HHW A;  2LHC A;  1GL7 A;  4F1I A;  3HJ8 A;  3A46 A;  4DR3 M;  3RGS A;  3FTE A;  2XF3 A;  3KP0 E;  2DAK A;  1E9R A;  3FD9 A;  1K3W A;  5ITQ A;  1XXH A;  3GLG A;  2O25 A;  5F3W A;  4HLQ A;  2C5R A;  2H5X A;  3FTD A;  4LGM A;  3SAR A;  2Y20 A;  1XMQ M;  4BLC A;  1NO1 A;  3SAS A;  3VKG A;  4IIW A;  3B89 A;  4DV6 M;  4AZF A;  5JI2 E;  1ZQ9 A;  4QNR A;  2Q2E B;  4GC5 A;  3U61 B;  5ITY A;  3GP1 A;  1NY5 A;  2OPF A;  3T38 A;  4KOD A;  2MH8 A;  4NL4 H;  1IN6 A;  1J09 A;  2K47 A;  2JY5 A;  2R65 A;  1VEG A;  2YR0 A;  3T6P A;  4NXN M;  3U6M A;  1BVS A;  1PM5 A;  2R0I A;  4EIW A;  3T1H M;  5DFL A;  2J5Y A;  2XFS A;  4OVZ A;  2OQ4 A;  1ZAE A;  4NRV A;  4LCB A;  4X65 M;  2EUC A;  5LMU M;  2UXD M;  3ZQJ A;  1YSY A;  3I51 A;  4LJ8 A;  2CRU A;  1NSF A;  2DKL A;  1G8P A;  3CGW A;  4Z6Y A;  1GL6 A;  1H6U A;  4BB9 A;  3E46 A;  2KNA A;  4LF4 M;  2M5Z A;  1KYI A;  2NQ8 C;  2QNJ A;  2O5R A;  4AG5 A;  2YQZ A;  3U5Z A;  2FNA A;  2Y21 A;  2CV1 A;  3KP1 E;  5BR8 M;  5BPV A;  4FD2 A;  2QHO B;  3DZD A;  3GO8 A;  2BNK A;  2D7E A;  3K9O A;  3T15 A;  2KHH A;  1L2C A;  1NHG C;  4P16 A;  4D80 A;  4QNM A;  4JI3 M;  1QVR A;  2DZO B;  2KA6 B;  4GC9 A;  4DUZ M;  4B7H A;  2XZU A;  2R45 A;  2HCB A;  3NBI A;  4DV7 M;  2LVQ D;  2MJ5 B;  4AW4 A;  3IEC A;  4REZ A;  4JN6 A;  2D7G A;  3GLH A;  3KOZ E;  3MK6 A;  1S3S A;  4L78 A;  3TWM A;  3GLI E;  4G3O A;  3SFZ A;  5EP4 A;  4PD2 A;  5KO3 A;  3LMM A;  3CF6 E;  4DV1 M;  1IFY A;  2GQF A;  4D82 A;  4M9Z A;  1IXS A;  1NHW C;  3C58 A;  1VDD A;  1N36 M;  2FE8 A;  1TH2 A;  2N35 A;  3GLI B;  2QBY A;  1Q02 A;  2DZN B;  1OKS A;  3W68 A;  3AOE C;  2E5L M;  1WXQ A;  2ZM6 M;  1DV0 A;  2VII A;  2M60 A;  1L2B A;  2L6O A;  1IM2 A;  3D8L A;  2B3T A;  3SMP A;  1V92 A;  3DFZ A;  4RKU F;  1TH3 A;  2G8L A;  1Z5B A;  2DNA A;  4WW0 A;  3FUX A;  3L26 A;  2UXC M;  4LJ7 A;  3HGI A;  1WGN A;  4LJA A;  5EQT A;  3LCV B; 
#chains in the Genus database with same CATH homology
 5E6J A;  2G5G X;  2YFQ A;  4MGZ E;  5A2Q S;  3K2L A;  1OFI A;  4XBO A;  5FTJ A;  4LF8 M;  3GRY A;  2Z3X A;  1IBM M;  1SXJ C;  3FTF A;  3J7A S;  4BBA A;  3FUV A;  3TWK A;  1ORY B;  3EIH A;  3GRV A;  3SAW A;  3UMM A;  2C9C A;  2DWL A;  2CHG A;  4FCV A;  4RF1 A;  3CF2 A;  1NNU C;  2JA2 A;  4LJ6 A;  3SHG B;  2KRK A;  2R4E A;  4D81 A;  3GQ3 A;  4DR5 M;  3B9P A;  1QZM A;  2XGN A;  4GIT A;  5FLX S;  3FUT A;  3HHX A;  3FKE A;  1DGG A;  5DYI A;  7CAT A;  3AOE A;  4LFC M;  3U6L A;  4LF6 M;  2QP9 X;  3ILK A;  4AQY M;  4M9S A;  2CV0 A;  4LGY A;  2AHM A;  2F5S A;  2J7O A;  2RGH A;  3AOG A;  3ZCB B;  3FYC A;  4G6Z A;  4NOO B;  5DYG A;  2Z7J A;  1QAQ A;  2DWN A;  1E94 E;  3W0L B;  2DWZ B;  2XH9 A;  3T1Y M;  3VDP A;  1HNZ M;  2CE7 A;  3EIE A;  3W0F A;  2CHQ A;  2DVW B;  5EP3 A;  4LF9 M;  4FCW A;  4FVM A;  3L2A A;  1SXJ A;  4DV0 M;  1OJL A;  5ITX A;  4AG6 A;  3GLF B;  4R3D A;  3DOA A;  4LZJ A;  3SAU A;  1NVM A;  3KSX A;  3GLG B;  4ZPX A;  2KZU A;  4WUR A;  3KOW E;  4IBI A;  4LF5 M;  4DR7 M;  1DGH A;  4B3S M;  1IXR C;  1TDH A;  4GIP A;  4B7G A;  4JI0 M;  1N75 A;  3GPP A;  4FWG A;  3PXG A;  4ITQ A;  4JI1 M;  2H1R A;  1N33 M;  3CF0 A;  2EA0 A;  3R8F A;  4AI6 A;  4OVZ B;  1G41 A;  1JQJ C;  2V1U A;  2X4A A;  4LJ5 A;  4B7F A;  1KFV A;  1Z6T A;  1R6B X;  1GVN A;  4GHL A;  4PCZ A;  2A5Y B;  1IY2 A;  5FTN A;  5KPR A;  3I4V A;  1XHB A;  1X37 A;  3CTW B;  2J7N A;  3U60 B;  3TE6 A;  3U6D A;  2X49 A;  4AKH A;  3U5Z B;  4GRI A;  1EE8 A;  3HJQ A;  3VDU A;  3GQ4 A;  3ZC7 B;  4G4O A;  4JI7 M;  3IG5 A;  1DO2 A;  4X66 M;  2ZAO A;  2F5O A;  1QAO A;  2LXE A;  4FWH A;  2L09 A;  2DHR A;  4YY3 M;  5FSW A;  3GPX A;  3KS8 A;  3UJN A;  1QAN A;  1HR0 M;  4PDI A;  3GLH B;  3IG8 A;  1L1T A;  3QAU A;  1DGB A;  3J2P B;  4FW9 A;  3L28 A;  1K3X A;  3R9X B;  3M0E A;  1Q3B A;  3RGP A;  3JR4 A;  1IXS B;  1MX0 A;  1IXZ A;  2R46 A;  3SHF A;  1N34 M;  3PVS A;  3FUW A;  3LVW A;  4G4N A;  4CHT B;  4RNA A;  1I94 M;  2XEP A;  1HT2 E;  4CIS A;  1Q3C A;  2FOI C;  2R62 A;  4DV2 M;  1G3I A;  4MH0 E;  4DR4 M;  3ZH9 B;  1L2D A;  4JYA M;  4GH9 A;  4PDG A;  3K92 A;  3WHL A;  3J7B A;  3UK6 A;  1R2Y A;  4IBG A;  1TGU A;  4MGY E;  1YE9 A;  4OU7 A;  4OW0 A;  1NNJ A;  2C96 A;  4IJF A;  3RFW A;  4L8R C;  3M6A A;  4JI4 M;  1R7R A;  2D7H A;  3K8Z A;  2DWM A;  3AJI B;  4B3T M;  3SYK A;  1TDZ A;  5E26 A;  2UUA M;  2FFJ A;  5FTK A;  3BOS A;  3VFD A;  1G59 A;  4LJ9 A;  2QZ4 A;  4MGK E;  4DR6 M;  1IN4 A;  3Q8X A;  3I4Y A;  3JR5 A;  4XGI A;  1Z5A A;  1XMO M;  4LRT A;  4K0K M;  2RKO A;  1HNX M;  2CHV A;  2V6Z M;  3GPY A;  4LFB M;  1E32 A;  2C99 A;  3PFI A;  4DV4 M;  3WHK A;  5H37 D;  3L29 A;  1IBL M;  1NY6 A;  1IY0 A;  3L27 A;  3LQQ A;  4IBE A;  1G4A E;  1JR3 A;  4OX9 M;  2L7I A;  2I7P A;  2LH0 A;  5C1B A;  4IJE A;  4I4L A;  4NSO B;  2BJV A;  1QAM A;  4B08 A;  3NWL A;  5LMN M;  5EP2 A;  3K1J A;  3TPZ A;  4DUY M;  3A98 B;  3THG A;  1NJG A;  2ERC A;  4LG2 A;  1C1K A;  3FUU A;  1IBK M;  1J7K A;  3VK7 A;  1R2Z A;  1D2N A;  5JI3 E;  2CUZ A;  1IY1 A;  3E4R A;  3AV0 A;  3MHV C;  3AKZ A;  1PJI A;  3JAM S;  3UZU A;  2LWX A;  4JI5 M;  3AFH A;  1XXH B;  2EO2 A;  2KRU A;  3KW6 A;  4IBJ A;  4M9X A;  3VKH A;  4DV3 M;  1NJF A;  3FTC A;  2XSZ A;  4LY6 A;  2QPA A;  4IBD A;  1T3T A;  1Z5C A;  1QQW A;  2BJW A;  3D8B A;  4X64 M;  2L7H A;  4NRW A;  5EXP A;  1N78 A;  3U6P A;  2DXI A;  3KXE C;  4DR2 M;  5EXS A;  2CEA A;  1XNR M;  1XNQ M;  1KSF X;  4GHA A;  4QHS A;  3M7G A;  4JI6 M;  1FNN A;  1IN8 A;  3UGJ A;  2F4V M;  4AKG A;  3GLF A;  2QCU A;  4FCT A;  4JI8 M;  3SBJ A;  4II7 A;  3HHZ A;  3H4M A;  4YHH M;  3VLF B;  1I4W A;  4G4Q A;  1HNW M;  5FTL A;  1TH4 A;  4Z8X A;  3HHY A;  4JI2 M;  2CV2 A;  3U61 A;  2R4J A;  4W5W A;  1IN5 A;  3SAT A;  1N32 M;  2RGO A;  4NXM M;  4KO8 A;  5FTM A;  4DR1 M;  1FJG M;  2VQE M;  4IBK A;  5EJC A;  1XC8 A;  2UUB M;  4GKJ M;  3KSJ A;  3FYD A;  5IWA M;  1MU5 A;  2ZBK B;  3U60 A;  2UU9 M;  4GMQ A;  4IBF A;  4A3V B;  4JXJ A;  4NSR A;  3J80 S;  2ZAN A;  4MB7 A;  1DGF A;  2KEB A;  2HHH M;  2QBY B;  4QOZ C;  3U6E A;  1DO0 A;  1HQC A;  5C18 A;  4LZZ A;  4I8O A;  3HU3 A;  1QYR A;  2QEN A;  5IRE B;  2V1C A;  2Z4R A;  2KW0 A;  1L8Q A;  5EXX A;  3RE8 A;  2XFT A;  1OFH A;  3HWS A;  3KOX E;  3SYL A;  3PNY A;  2LNH C;  3HJS A;  3KOY E;  3MJ5 A;  2HKJ A;  3VK8 A;  2Z4S A;  3PNV A;  3U6S A;  5KPZ A;  3QWL A;  3OTO M;  5EXT A;  1Q39 A;  4X62 M;  4TUW A;  3SAV A;  2HL7 A;  2VQF M;  2CFO A;  2X8A A;  4MGI E;  3GLI A;  4DV5 M;  3KVW A;  2XZF A;  2F5Q A;  4IBB A;  4MM3 B;  1UM8 A;  3U6Q A;  1W5T A;  3KDS E;  4KLN A;  4S12 A;  2YNM D;  4M0W A;  4HL4 A;  5ITT A;  5GKN A;  4M0D A;  3U6C A;  4L16 A;  3GRR A;  2KXE A;  5KQ8 A;  5DNY A;  1JR3 D;  4IBC A;  4MGH A;  4LF7 M;  4CGY B;  3LQR A;  1N77 A;  5EP1 A;  2C98 A;  1J5E M;  3KFU G;  3TL4 X;  3AL0 C;  4FWD A;  1HT1 E;  3TWL A;  2F5P A;  2C9O A;  1SXJ E;  3J81 S;  2Y0T A;  4KHP M;  4LJ4 A;  4PT5 A;  3A42 A;  5ITX E;  8CAT A;  4B3R M;  2I7N A;  1PJJ A;  2P5T A;  3LVV A;  3GPU A;  3SC3 A;  3SMS A;  1SXJ D;  1HQY E;  3HU1 A;  5KQD A;  1LV7 A;  4B3M M;  2Y0Q A;  3HKP A;  4L4U A;  1GKI A;  1SXJ B;  1W5S A;  5ITU A;  3TQS A;  2UXB M;  4LRS A;  5IZ7 D;  4AKI A;  2F5N A;  4I81 A;  3KS4 A;  2XSZ D;  4LFA M;  2UUC M;  3E9S A;  3HU2 A;  3GRU A;  3GQ5 A;  1E9S A;  5KPT A;  3J27 B;  1DGH B;  2W82 A;  3A45 A;  1XWI A;  2R18 A;  2KZS A;  4QHT A;  5ITR A;  4JV5 M;  5IT9 S;  4GKK M;  4QOS A;  1L1Z A;  4I5S A;  1IN7 A;  4RF0 A;  1YUB A;  3DA1 A;  2ZAM A;  2XLJ A;  1K82 A;  3U6O A;  4G4R A;  4L15 A;  1IQP A;  1Z59 A;  4R7G A;  3L25 A;  1GLN A;  3HHW A;  1GL7 A;  3HJ8 A;  3A46 A;  4DR3 M;  3RGS A;  3FTE A;  2XF3 A;  3KP0 E;  1E9R A;  3FD9 A;  1K3W A;  5ITQ A;  1XXH A;  3GLG A;  5F3W A;  4HLQ A;  2C5R A;  3FTD A;  4LGM A;  3SAR A;  2Y20 A;  1XMQ M;  4BLC A;  3SAS A;  3VKG A;  4IIW A;  4DV6 M;  4AZF A;  5JI2 E;  1ZQ9 A;  4QNR A;  2Q2E B;  4GC5 A;  3U61 B;  5ITY A;  3GP1 A;  1NY5 A;  2OPF A;  3T38 A;  4KOD A;  4NL4 H;  1IN6 A;  1J09 A;  2K47 A;  2R65 A;  2YR0 A;  4NXN M;  3U6M A;  1PM5 A;  4EIW A;  3T1H M;  2XFS A;  4OVZ A;  2OQ4 A;  1ZAE A;  4NRV A;  4LCB A;  4X65 M;  2EUC A;  5LMU M;  2UXD M;  1YSY A;  3I51 A;  4LJ8 A;  1NSF A;  1G8P A;  4Z6Y A;  1GL6 A;  1H6U A;  4BB9 A;  4LF4 M;  2M5Z A;  1KYI A;  2NQ8 C;  2O5R A;  4AG5 A;  2YQZ A;  3U5Z A;  2FNA A;  2Y21 A;  2CV1 A;  3KP1 E;  5BR8 M;  5BPV A;  4FD2 A;  3DZD A;  3GO8 A;  2BNK A;  2D7E A;  3T15 A;  1L2C A;  1NHG C;  4P16 A;  4D80 A;  4QNM A;  4JI3 M;  1QVR A;  2DZO B;  2KA6 B;  4GC9 A;  4DUZ M;  4B7H A;  2XZU A;  2R45 A;  2HCB A;  3NBI A;  4DV7 M;  4AW4 A;  4REZ A;  4JN6 A;  2D7G A;  3GLH A;  3KOZ E;  3MK6 A;  1S3S A;  4L78 A;  3TWM A;  3SFZ A;  5EP4 A;  4PD2 A;  5KO3 A;  3LMM A;  3CF6 E;  4DV1 M;  4D82 A;  4M9Z A;  1NHW C;  3C58 A;  1VDD A;  1N36 M;  2FE8 A;  1TH2 A;  3GLI B;  2QBY A;  2DZN B;  3AOE C;  2E5L M;  1WXQ A;  2ZM6 M;  2VII A;  2M60 A;  1L2B A;  2L6O A;  1IM2 A;  3D8L A;  3SMP A;  3DFZ A;  1TH3 A;  2G8L A;  1Z5B A;  4WW0 A;  3FUX A;  3L26 A;  2UXC M;  4LJ7 A;  3HGI A;  4LJA A;  5EQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...