1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Methyltransferase
molecule keywords RRNA METHYLTRANSFERASE
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
2WK1A 3M6VA 5FULA 2UZ4A 1BC5A 4OA8A 3JWGA 5GIPE 2BR5A 1FBNA 3GJYA 3BGIA 4X61A 1EG2A 3P9IA 3OFJA 4PYIA 2OKCA 2YVLA 3JWHA 3LKZA 4RX1A 2F8LA 4XUDA 5DX0A 3TKYA 3FTDA 4H0NA 4CTJA 5LQJA 2BH2A 5DX1A 5LR6A 5HIKA 5FWDA 1SUIA 5CD1A 3KPJA 2OXTA 5EZQA 3DMGA 2ZZKA 3R0QA 5T6BA 4O29A 4IWNA 4ER6A 5D1HA 3SGLA 3SSMA 2P8JA 4DCGA 2ZZMA 3TKAA 3C3PA 1NKVA 1P1BA 3AY0A 1UFKA 3HVHA 3KR2A 4K6MA 2EJTA 2P7IA 4G56A 2ADMA 3PX2A 4C4AA 4DZRA 1RJEA 5FQOA 1JQEA 1INLA 5EMLA 3VYWA 3ER8A 2QRVA 3KHKA 4U7PB 5K0FA 4FT2A 3ER9A 4GOND 1KYWA 1SQGA 3I53A 4FS8A 2Z6UA 2YXDA 3A27A 5HZMA 3A7DA 3BWCA 3HCBA 3MAGA 4GBED 4DF3A 1YFLA 5F2KA 3FUVA 4CTKA 3B5IA 4IV8A 4PIMA 2FCAA 4QQNA 5LQAA 3DXYA 1R74A 3DLIA 2Z6AA 2JHAA 3LX6A 2IIPA 4YMGA 2FHPA 3IV6A 5DTRA 5F2NA 3M4XA 5GWXA 2XVAA 2WA2A 3EMBA 4ZTBA 2FYTA 2QM3A 5DRTA 3OZTA 2PV0A 2P35A 2C7PA 3FZGA 2Y1XA 2JH9A 2YQZA 3TR6A 3KR1A 3TMAA 4RTRA 5BW4A 4GC9A 3THSA 8MHTA 3FTFA 1BOOA 3L8DA 4HG2A 3TRKA 3B89A 4RTSA 4HSGA 3S68A 2PGXA 3DULA 4AZWA 5GINE 3BGDA 4P7GA 3GRVA 3GRUA 5IH3A 1P91A 3HVKA 3NWEA 4RTJA 1RJGA 3PTAA 2NP7A 1ZKDA 3DR5A 3FPHA 2ZBPA 1EQAA 3GCZA 2AVNA 3E8SA 4PINA 3H2BA 3D2LA 4RTLA 3F4KA 4YV0A 3RIEA 4RVDA 1IM8A 2PVCA 2HNKA 2NXCA 3CGGA 3G88A 5KVAA 5GIOE 1Y8CA 2GB4A 4LWPA 3I58A 2H00A 4AZVA 4HH4A 4YUVA 5CCBA 2R3SA 1JG4A 4RTOA 2V7EA 5E8RA 4RYLA 3M6XA 2AOTA 5T67A 4GF5A 4RTMA 4RVGA 2QYOA 1D2CA 5EQJB 4E2YA 3A4TA 3SX0A 1NE2A 4E32A 4QDKA 1JR4A 1KPHA 2PT6A 2R6ZA 3ME5A 3KQVA 1FP2A 3VC1A 1L3IA 4E70A 5C9ZA 1D2HA 2P3OA 5K03A 5GM2A 4ER7A 2YXEA 5FADA 4BP1A 3GWZA 2GA9A 1XVAA 3KPUA 2LD4A 3HEMA 1YZ3A 3HTXA 2B3TA 3BZBA 4FSXA 4X41A 4KDRA 3SSNA 1R00A 4MIKA 1NBHA 3HCDA 3MQ2A 3HVJA 5E1OA 5KQSA 5HIMA 3HA7A 3A7EA 5CUQA 3MHTA 3KQOA 1YFJA 4PWYA 2PT9A 1ZGAA 3R24A 2PX4A 4XCXA 3HA3A 3DUWA 3GU3A 4KRGA 5K0EA 3AWIA 3KQMA 5KYGA 2JJQA 1RI2A 1DUSA 3NVMB 3TOSA 3OE4A 4F85A 2PXCA 1N7IA 3P9NA 2VDUE 5FA5A 4EMSA 2AN4A 4V0QA 4JXJA 3KQPA 3LBYA 2ZCJA 4E33A 1L3BA 2IH4A 4KVZA 2BR4A 2XYRA 4QVKA 4X60A 5H02A 1IXKA 1JSZA 1NW6A 2PXAA 3FUWA 2ZZNA 2ZWAA 3T7SA 3THRA 1B42A 2PLWA 1VBFA 4EK9A 2H11A 2FRXA 2I9KA 3UJBA 3BKWA 1EJ6A 3TM4A 4B17A 1TPYA 5DPMA 1G8SA 1X19A 4FT4A 3EMDA 4X63A 5EIFA 4HRAA 2N47A 5LSAA 3HCFA 3EGEA 3IYLW 1EJ0A 2V74B 2OB2A 5DSTA 4AUKA 3FUUA 5E9QA 4LWOA 4DCMA 1MJFA 5GOZA 4GUAA 3MTEA 2QE6A 1SUSA 2YX1A 2C7QA 4QPPA 5EMMA 1AQIA 3NMUF 1RI5A 2P3LA 3KU1A 5LQKA 4HTFA 5CIYA 1WZNA 1XJ5A 3KPVA 3MB5A 1SKMA 2EG5A 3A26A 3CBGA 4EKGA 2ZBRA 4RV9A 3X0DA 4BLUA 5CVEA 1IY9A 2PKWA 3EVCA 3GRRA 3G7UA 1DL5A 4HGZA 5DWQA 4ER0A 2ESRA 3GO4A 3LHDA 4OQEA 3UZUA 5DLYA 1SVUA 3UJ8A 3SM3A 1ZQ9A 5G02A 4RWZA 3OU6A 2O07A 3DH0A 1P1CA 5EEHA 1KHHA 2H1RA 4E2XA 3UA3A 4GOOD 2IH5A 1NW8A 3DOUA 2AOUB 5LQRA 3REOA 2GAFA 1NV9A 3DXZA 2IBTA 1NV8A 1NW7A 3PT9A 3LBFA 4DKJA 4R8SA 3T7TA 4OQDA 4CKEA 1QAOA 5BW5A 2DPMA 3DXXA 3I5UA 4YV1A 2IPXA 4X1OA 3E05A 3FPEA 4R6XA 4UOEA 5K8VA 4EVIA 5E1BA 2VDVE 4AX8A 5K05A 1HMYA 1AV6A 4GQBA 3NWBA 3UWPA 1L3CA 2CMGA 3HA5A 3QV2A 1FP1D 4FGZA 1Q0SA 5DM1A 3KQQA 4RSRA 1Q0TA 3A25A 4POOA 4YUYA 4CXMA 4P58A 3GDHA 4R6WA 5DM2A 3AXTA 3O4FA 4PCAA 4MQ4A 1ORIA 4GOLD 3O7WA 4ISCA 3G2QA 5CVJA 3DMFA 2E5WA 2PWYA 2VS1A 2YTZA 4C03A 4R05A 5E1MA 2NXEA 3G2PA 4NECA 3LGAA 2GS9A 3KR0A 2PJDA 5ICEA 2HV9A 5EOVA 4OBXA 3P71T 3PB3A 3UJ9A 2G71A 3Q87B 3HNRA 5FWAA 3NTVA 3UJCA 3PVCA 2WA1A 2P7HA 3P8ZA 2FK7A 4QQKA 3SR4A 3EEOA 3DP7A 2QRVB 3CJRA 2PBFA 4HGYA 3BWBA 3NW9A 3G5LA 1N2XA 4KW7A 3FTCA 2AN3A 5BP7A 3TQSA 2Z6QA 5E1DA 3KQTA 1N7JA 4Y2HA 2EFJA 4KDCA 1O9GA 1PJZA 1QANA 2BR3A 1TW3A 5ICGA 4PONA 5DX8A 2G70A 1ZG3A 2PXXA 4XUCA 5CM2Z 4E2ZA 3E23A 1XXLA 2CWWA 4M7RA 2ZULA 4GOMD 3T7RA 4KIGA 1OR8A 1KR5A 4RTPA 2AVDA 1FJXA 2ORED 1JQ3A 3KPWA 3VC2A 3NVKI 5DM4A 2AR0A 2FPOA 2KW5A 3EVDA 4EQZA 5DM0A 3GGDA 3IHTA 2C7OA 1ZGJA 3FUTA 2Y1WA 3HVIA 4BLVA 5DXJA 2BM8A 3ELDA 1VQ1A 4RVHA 4PYQA 1BHJA 3AJDA 3FRHA 3GRZA 2K4MA 3JWJA 2CMHA 5EC8A 4A6EA 3HCAA 1YUBA 1KPIA 2YR0A 3ID6C 5M5BA 1RI4A 2EJUA 3EVEA 3PS9A 4QVGA 5FQNA 1WG8A 2G8NA 1UWVA 5K01A 1X1AA 4QTTB 1EIZA 5U4XA 2NNWB 2P3QA 5DRYA 5DT2A 4Z2YA 1M0EA 4PYJA 2DULA 5CCXA 4E30A 3CVOA 3MCZA 5K0LA 1SQFA 3C3YA 9MHTA 5GP1A 4GC5A 4AZSA 2ZWVA 3MGGA 1KPGA 2AOTB 1QAQA 5D1NA 2UYQA 1MHTA 2VP3A 3LDGA 2ZIEA 1DCTA 2ZVJA 3ELWA 4C05A 3EVBA 1NT2A 4P7JA 1M6YA 1KIAA 3MCTA 3B3FA 3Q7EA 5FTWA 5K0NA 2O06A 3KQSA 3G89A 1R18A 1RJDA 3T0IA 1SG9A 4E2WA 4DQ0A 3FUXA 3B3GA 4OBWA 4C04A 1XDZA 3M6UA 4KIFA 2GH1A 4BLWA 5FUBA 2IDJA 5E2BA 3SXJA 1WY7A 5EHGA 4YMHA 3EVFA 3JWIA 3G8BA 4YUXA 3G2OA 2AN5A 3FTEA 1EAMA 3DTNA 3MTIA 4FP9A 4A6DA 5IKMA 1AQJA 1X1CA 1JSXA 1V39A 2ZSUA 2IH2A 5K0JA 1L9KA 3GRYA 4M37A 2CKDA 2NYUA 2OY0A 4LECA 2OYRA 1UIRA 3O31A 2XYVA 2BZGA 4PGGA 5EMJA 2OZVA 4EKIA 3CJTA 3MERA 3OZSA 2UYHA 4RTQA 5KS2A 2XBMA 3V97A 3VSEA 4P7FA 3SMQA 2ZW9A 3BKXA 1JG2A 3FPGA 2FK8A 1KYZA 3C6KA 4YUWA 5KQRA 1VPTA 1F3LA 3P97A 5JR3A 4QTUB 3TLJA 1WXWA 1U2ZA 3OZRA 1I4WA 2EX4A 10MHA 3KPYA 4YV2A 1BKYA 1NW3A 2AZTA 3PX3A 3UJ6A 1VLMA 4CKBA 3ORHA 7MHTA 5DXAA 3G5TA 5EEGA 3OCJA 3C6MA 3P9CA 3ELYA 1WXXA 5EVJA 3TPZA 4M38A 5K0BA 3LSTA 1KP9A 2PY6A 5E8JA 3QOWA 4IV0A 2AOVA 1O9HA 2IFTA 1RJFA 3LDUA 3TM5A 4QPNA 5HIJA 4C07A 2I62A 3CKKA 4OA5A 4RVFA 1O54A 1NW5A 5E2AA 3HCCA 5EG5A 4GEKA 3UJDA 3NJRA 2PX5A 4MHTA 3WSTA 3ELUA 5CVUA 4ATNA 2IGTA 3PLAE 2A14A 3FPJA 1H1DA 2B78A 3HP7A 5EPEA 5HILA 1JTFA 4RTNA 4F86A 1VP3A 2G1PA 3QOXA 3BUSA 3EVZA 2IP2A 3LCCA 3M70A 1QYRA 1NBIA 3GIWA 3NDIA 4HTFB 5ICCA 2HTEA 2XVMA 1L1EA 3LCUA 4PYMA 5DTMA 1X1DA 3BGVA 2GPYA 5CVVA 3LECA 2VZ9A 2JHPA 2PSSA 2CL5A 3LDFA 1G38A 5E9JA 4PYLA 2AOXA 3LCVB 5ERGB 3R6TA 1VIDA 2PWPA 1D2GA 5DTQA 1XTPA 2HWKA 4CKCA 1VL5A 5GM1A 5EHIA 2HR1A 3M6WA 3I64A 3P2IA 5B1SA 3KQWA 3EVGA 5FCDA 5EGSA 3KR9A 5EMKA 3RW9A 3SSOA 1R8YA 1F38A 3OFKA 5F2OA 3C0KA 1ORHA 2O05A 2OBFA 2I7CA 4RTKA 2ERCA 3G8AA 3NDJA 3R9XB 3K6RA 4C08A 2B9EA 5EKUA 3EVAA 1QAMA 3UJAA 3UBTA 4AZTA 1FPQA 3DLCA 2ZBQA 3CJQA 3IEIA 1XCLA 3RODA 3EEYA 2PX8A 3GXOA 3KQYA 5LQNA 4BY9E 4PNEA 1VP9A 1AF7A 3CCFA 1RI1A 5EIWA 4PYOA 2ZLBA 4V0RA 3AXSA 3PFHA 3BWMA 3EPPA 2B25A 3LKDA 5C0OE 2YXLA 4PCLA 2UYOA 3FPFA 3LL7A 2UYCA 3TFWA 2NP6A 4DM3A 5BXYA 3BXOA 5FHQA 2P41A 4HC4A 5K09A 5HFJA 2IBSA 1XDUA 2OPBA 1HNNA 3E7PA 5ICFA 3UFBA 4QDJA 2NXJA 2IDKA 5EKXA 5E9WA 2Q41A 4LG1A 2O57A 3P9KA 5P8WA 4PIPA 5LQCA 3P2EA 3DMHA 2ZIGA 2ONZA 4M36A 4MWZA 5HIIA 1I1NA 4C06A 2BM9A 4ER5A 1JG1A 2G72A 4FSDA 4PYNA 2JH8A 5EZSA 1ZHFA 3FYCA 3UA4A 5LQUA 5MHTA 1PRYA 3B3JA 3OU7A 1YB2A 3GNLA 1G55A 1VE3A 4YUZA 3EGIA 2HMYB 5DSXA 1XDSA 3SVZA 1P39A 1XCJA 5K0GA 2ZTHA 3ERCA 1JTEA 5K0CA 1WS6A 3CC8A 2YUIA 3ANXA 2OB1A 3EGVA 5CVDA 4U7TB 1R6AA 2AS0A 4P7KA 1G60A 3UJ7A 3BWYA 5T64A 2P1DA 4IKPA 2GLUA 1G8AA 3M33A 1Z3CA 4CWAA 2AOWA 1M6EX 1TW2A 5FA8A 2ZFUA 3U81A 4L7VA 4OX9Y 2NXNA 3OPNA 1JQDA 2ZIFA 3FRIA 4Y30A 4ER3A 3I9FA 5HEKA 3V8VA 4E31A 1T43A 2B2CA 2PX2A 3B7PA 5C1IA 3HCEA 1I9GA 5JUWA 5FHRA 3G2MA 2ONYA 4WXHA 4WVLA 2JHCA 4FR0A 4PGHA 1X1BA 3PFGA 1QZZA 3HM2A 3LPMA 3OE5A 3R3HA 4PYKA 4DA4A 1YF3A 2P40A 2AOUA 1RI3A 3P2KA 4FZVA 4F84A 1JG3A 4DMGA 3KKZA 2VDWA 3FYDA 1G6Q1 1KXZA 4MTLA 1YZHA 2O0LA 2OO3A 2C7RA 4R8RA 2JG3A 2I6GA 3OU2A 4XUEA 5HOQA 4BP3A 3BT7A 4KWCA 1R8XA 2QY6A 3K0BA 2XYQA
chains in the Genus database with same CATH superfamily
4PO1A 4Q48A 1AZLA 2AW3A 2H5LA 3C8DA 3L29A 2F8LA 3F6EX 4QUBA 4OQZA 5EZQA 4KQIA 3ES9A 1X1QA 3WLOA 4MUNA 1L1QA 5DHRA 1ZD5A 1N9KA 3I53A 4FS8A 3FMPB 1J70A 2P9EA 4A8PA 5ENVA 1TM4E 2D7EA 3L8ZA 2XDWA 2JLXA 2IYVA 3RYIA 4O4LA 2FZGA 4H3HB 3GJTA 1TI7A 3G2IA 2BGNA 3HUTA 1LTHR 1XTVA 1ORWA 1Y6GA 2DU8A 3F2IA 4EQ6B 3SJ7A 5JFTA 1PKXA 1Q0PA 2G7MC 3NWPA 4MYCA 5KDLA 2EWWA 3DB2A 5TQ0B 4YMWA 3LKVA 4O5OA 4KE8A 3JD1A 2J4DA 4BNYA 1H2WA 3G9XA 1M2WA 3QWHA 1QK5A 2NUAA 4Z0NA 4RA6B 3MCWA 3WQRA 3MINB 3P9ZA 3QTTA 4D5GA 1GG8A 3QSGA 3I6YA 3N8DA 2BHLA 4GX1A 2JC3A 4YJHA 4HH0A 4JBIA 1U9YA 3S55A 4G0NA 4M88A 3JYPA 5A0VA 2DHRA 4H27A 4XDZA 4B7AA 4YJ2F 3T4EA 2JIDA 3A3NA 1AKRA 4BO1A 3HJNA 1KARA 3IKMB 1V16B 1AD2A 4UPEA 1RYYA 3OEED 1TKBA 4J4HA 4Q9NA 3I45A 3WGUA 5AKXA 2VBGA 2M5ZA 1DGHA 4Z4FA 4AY2A 5FTMA 4HATA 1EFCA 1IK4A 1NF8A 2JRLA 3GNSA 2XUGA 2Z1DA 5K0ZA 1GO2A 3PNPA 1Z59A 2XNCA 2FOXA 4IKEA 1QZTA 1YH3A 3D3QA 2BTQA 5GV7A 3BM5A 8OHMA 4EI8A 3IUSA 1FOEB 1XIVA 1T0JB 3C3DA 1DBRA 5JAIA 1R9JA 1O9GA 1F9EA 3RFFA 3U3MA 4TSKA 1J24A 3ANMA 5JASA 2Z1NA 2Z0MA 3PNSA 3F5MA 2IYXA 3O75A 2JZCA 4P36A 4ZI7B 4DEXA 3OO1A 1ULUA 3A9VA 1XKXA 4ZVPA 5H3LA 5BPHA 2WF9A 3BFVA 2PO7A 1SQFA 4TKMA 5H7XA 2P65A 3HWRA 2X0FA 2WWGA 4QU0A 1LDYA 5AK4A 3C3EA 1IK6A 3I51A 3FBTA 5ALIA 3JYQA 1MQSA 5I7OA 1HE3A 4UDOA 4DRZA 3BGSA 3AVQA 5C8YB 2IPAB 1OC4A 3IGFA 3I2FA 1CRQA 4U9IS 5EQDA 4RFSB 3S27A 4ZTUB 4HADA 3OX2A 3HJGA 2XQIA 2FSGA 5J2UB 1OHHD 5D5PA 1YKSA 2CXPA 3L4BC 4R5MA 5DEIA 3UCEA 1ZC3A 4G5YA 4R3DA 3AILA 4UNSA 1C3EA 3LLSA 1QH8A 5EG5A 1BFKA 2E1PA 2RARA 2IGTA 3NTRA 1PV2A 2QI9F 2ZM6B 5JALA 3ZJVA 1NBIA 3L1KA 1AUAA 5GJWC 3ZBUA 3VR6A 4L5BA 4Y9RA 4I46A 3FE3A 2OBLA 3JAWB 2H1OA 1STOA 2QVCA 5C5DA 1J0BA 4KSCA 3HDJA 3K73O 3DFZA 1WLYA 4Q9HA 1V3TA 2WD7B 3N74A 4NZMA 3K35A 4MUAA 4QNMA 1PR6A 5DGTA 4F3TA 2XNDD 1M75A 1Z0ZA 3LWZA 3PVSA 3IUNA 2PRSA 5KYKA 3IB6A 1QRSA 4RAQA 1A2BA 2GBIA 5G40A 1NT4A 5HCNA 3JQ7A 2EEZA 4EHFA 2CC2A 5CJ2A 1U02A 3JAKB 2YFQA 1WXQA 3SVZA 2AJBA 2XCTB 1TZBA 1XG5A 4JYPA 1XLVA 3E22B 4N3AA 3V76A 2YL2A 1QHNA 3LUAA 2WHPB 2XZDA 2AG5A 4CT5A 1AMNA 4O4HA 3D2BA 2VIIA 1N78A 4DA4A 4U2BA 4QXAA 2KNZA 1X80B 3M9LA 3E0QA 2I2AA 2MT9A 3HHWA 1TVMA 1EK5A 4ZMBA 5A7FA 1UBJS 4F1KA 4MVJP 2B0CA 3BICA 1U8TA 5LQJA 4Y9DA 3JYLA 2XLBA 1A72A 3M9WA 4O1HA 1PVVA 4X85A 1IQRA 2LBPA 4Q24A 1FUIA 3AR6A 5FOXA 2CCJA 1Y8RB 4V1CB 3DL0A 3IDQA 3IG8A 4PAMA 1F6DA 4AS3A 5MFZA 1SHZA 2W2PA 4MWEA 2DERA 3NAMA 1H8HA 4P82A 2QM3A 4CMAA 2G6TA 2BH9A 1FS6A 1IJEA 2BM1A 2JLVA 3CUUA 2Q0HA 1PSDA 1XDGA 1UZLA 4L4ZA 2KW0A 2IXGA 4UPDA 1U8AA 2QG6A 3DAGA 2E5FA 1GIAA 5J58A 3I6BA 4HH4A 1PUJA 3RSLA 3GP5A 4BNGA 1DG3A 2PAFA 1T25A 1SOUA 3M6XA 3CWZA 5D87A 1Q3KA 4YRSA 4K03A 3VR1A 4WURA 1F6WA 5EGNA 4X5OA 4ARCA 1RYBA 1XA3A 1XCMA 2ENWA 4Q7MB 4H7PA 5ELLA 2CWBA 2N35A 2O2ZA 3TTYA 3TOVA 3GU3A 4U1RA 1I94M 4R0NA 1KHTA 3EC2A 1GLNA 1LBTA 3PC6A 4TYPA 1YDWA 2BFDA 4IIBA 1E1QA 2QUJA 4AAYA 2WI8A 1QCZA 3FUWA 1TT5A 2PT5A 4Q3CA 3DMRA 4IJKA 2B4TO 2OHFA 2AI1A 3EGEA 1QH1A 2OA0A 2H6EA 2JI4A 1YDHA 4UXHA 5CIYA 4I4IA 3NP9A 3O8QB 2BUAA 4RIEA 1BVRA 3I9OA 1NQOA 2W6QA 5EXPA 4OQEA 5C31A 4M0WA 1EE2A 4R7GA 1U3TA 3IQXA 4BEJA 3EMKA 2C3UA 2BEUA 4HLNA 5FPPA 5EXSA 1PAUA 5F21A 3H6KA 4YPFA 5JY1A 2ZBFA 2YV2A 1O77A 4EZIA 1DKOA 2HJVA 1GAWA 2OEPA 1OGJA 2HDNB 3TCKA 4KR0A 1CQZA 5TVGA 5KSOA 1GRCA 4CE6A 3AHHA 2PX6A 3VC3A 4CMGA 4Y2HA 1N2CB 3BVPA 1EP1B 1H2FA 1XZ8A 1AF4A 2RCYA 2I7PA 2B82A 3R5KA 4RESA 3PPIA 5CPFA 4L51A 3EXG1 3OQHA 5JQGF 4UHBA 1DEOA 3UXEA 4GMGA 2J32A 4A0QA 3MCZA 3QELB 3NAGA 4GC5A 3P4XA 2JY6B 1BWSA 1GSOA 2AR7A 7MDHA 4Y6GB 2ID7A 4I50F 1KY3A 1NYQA 1RTKA 1CDZA 4AJHA 4RELA 2RCNA 3GEBA 2CKDA 4ZAVA 2W48A 4LF8M 3QSYA 3GPIA 5LWHA 4RORA 5BYBA 1P2UA 4LFAB 1A77A 3TTVA 3QX7A 2EZ8A 2JNHA 4IS2A 5EEGA 3OSZA 1GZ6A 2X9VA 2YUTA 3CKKA 2UXBM 1G21A 4OM8A 4W5NA 4ZXFA 3PR3A 2VBCA 3BPSA 4H4CA 1SQ0A 5JTTA 1YMQA 2IEBA 4Y2TA 2BPOA 4B7UA 3R3ZA 4P86A 3HRIA 3M83A 4TV8F 1HLPA 3KXPA 4FFBA 2VJOA 3HKDA 1KS9A 3WXBA 1OH6A 2EU8A 1M1NB 2CSXA 4MS3A 1YJ5A 1F2UB 2FPUA 2P77A 4JGBA 3O8LA 1TE2A 3VUEA 2DLNA 1JKXA 5LXTA 2F9FA 5FHQA 1U98A 5HFJA 1G9SA 4QDJA 3KELA 3KX2A 5D85A 2HLDA 1A2OA 1KFVA 2PPVA 4JBGA 1TM3E 5K0GA 2AG6A 2FPLA 5AUPB 4JC8A 5JVDB 5AJTA 1IUOA 3AF1A 2GETA 2YH2A 4N5DA 4Q4HA 1XXHB 4AMZA 2R86A 1JHRA 3U7FB 4RKYA 3H17A 2JFGA 1THGA 1BW9A 2IVFA 2Q4EA 5ALMA 3PNQA 1P17A 3RJMA 3A1TA 1YZHA 1NUQA 2V59A 4ITUA 4H7IA 4EM6A 3MBIA 1GN8A 3BIFA 3N7TA 1DT5A 4XM1A 3RRNA 2VH1A 2MYNA 3ER8A 1L5FA 4B8WA 3RWBA 2X0RA 2PWAA 4MLDA 5IJ9A 2P35A 4Z9XA 5KNBD 4BFYA 3GZ4A 2D2VA 2QRPA 4EB8A 1KYIA 2G63A 2VJPA 3ICWA 3R3YA 4P2GA 3N2GB 3BK7A 5BSKA 1ZN9A 4G85A 4Y2SA 3LK7A 3R9IA 1U2QA 2BZSA 1YK1A 1EPUA 3DVSX 1G42A 1RWQA 4WLVA 4KE7A 3GWZA 1P81A 5CB6A 5K8JB 5L7WA 1NBHA 5LKAA 5CDGA 1E3DA 3G3EA 4BB5A 4AM8A 3BRWD 4Q6BA 3MCAA 3DE6X 4FJ2A 2JAXA 2WAMA 2ZDGA 3KOMA 4TXJA 1VPVA 5KU7A 5TLSA 4OFBA 4R9RA 2C5FA 4M89A 1UZUA 1JPUA 4BX3A 3QH4A 4IOMA 5DTJA 5ITYA 1DQSA 2XKAA 4WFKA 2VP6A 5CB4B 1AQIA 2NQTA 3D7LA 3FROA 4XTCS 2FF7A 2ZBRA 2JXNA 3G7UA 1P61B 1IM2A 2VYVD 2CFSA 2SCUA 4MTCA 4ADSG 2FE1A 1WR1B 4AKGA 1RRVA 4Z9YA 3ZKAA 2I71A 5EZYA 3ZY4A 1FMJA 4DKJA 3ZI0A 2J9YB 3DXXA 3VV2A 4YV1A 3E4RA 4CEJB 5CJJA 1E9EA 1O57A 4AMYA 1Q1GA 4PCAA 3U4DA 2D5AA 4JH0A 4WRRA 3ZWWA 2XWBF 4ZVLA 3LF1A 1RXCA 3BWBA 1TM2A 1IWPB 4DCSA 2Z6QA 2EFJA 4KDCA 4D6PA 4HHEA 4WCDA 1YZFA 1M2HA 3RROA 4MVYA 1YSYA 1IZZA 4LJYA 4FR5A 2V4ZA 2KRKA 2Y67A 1GVNB 3BIWA 1OLUA 3GGGA 4QVGA 5LD2C 3PR2B 2SNIE 3AGQA 1T1GA 3FN4A 3M6FA 3AUTA 4IRUB 3PYXA 4E5DA 3AH8A 2IHTA 1E59A 4TLMB 3JS5A 1KO5A 2YVAA 5A71A 1ECPA 2BFBB 4LYDA 3HDHA 5AVJA 1W96A 3GT4A 3EHEA 5KPZA 2SKEA 1BU5A 1GNTA 5AKZA 1V4VA 2G5GX 4I9FA 4P3YA 3BH6A 3UV3A 3Q0IA 2HSWA 1O9HA 3DYBA 4FSHA 5E2AA 2LIPA 2CLKB 1HQKA 2OHVA 3UB4A 1F17A 3H1FA 3T3IA 2X19A 2F1HA 4C76A 4ZEMA 5J4YA 5T4FA 4CV0A 4DLUA 4UTOA 3ZGLA 4MH0E 3BWDD 2WJWA 1DAGA 3W3ZB 4HAYA 1M6VB 4YMLA 5KO2A 4V0MA 4C08A 4C4SA 3IQHX 1UMDA 1M73E 3KUDA 4JLWA 4ZOEA 2HNBA 1AO3A 3ST7A 5DN6D 4M8SA 3M5WA 4MLPA 3OKFA 3OEHA 4TT3A 3B1XA 1XROA 3H1GA 9ATCA 3INRA 3ZX5A 1PZGA 3DYIA 2J1LA 4S05A 2YNMC 2C0CA 3LVRE 4REZA 2GEUA 5LPNA 3ZHYA 2Q1SA 2GLUA 4YAWA 2C1ZA 3LQ1A 1J1ZA 1M6EX 4BJ3A 2EDCA 1Z4NA 2OBYA 3I9FA 1SVSA 2ID4A 4M7WA 2F3UA 2H18A 4U00A 3IPYA 3HM2A 4M49A 3V48A 3VI4B 4I3HA 3V8BA 4OO3A 1EB9A 3ESXA 4P3OA 1XF1A 4H2DA 3LT5A 4NKRA 3ET4A 2Q6OA 4ALNA 1F8FA 5F98A 4NSOB 2UXCM 3HVHA 3VR2A 4G01B 4YALA 5DCUA 2X49A 3VKFA 4RCVA 4B71A 1RQPA 1YIOA 1PGQA 1REQA 4E6EA 1TEZA 3J80S 3T1QA 5LZ9A 4KNVA 4N03A 4G07A 1NFRA 3SAJA 4N5NA 5I4KA 3T6PA 1Z5NA 1FSSA 3UIEA 3I9V6 2KEBA 2TRSB 1TQ2A 1LK5A 3KTOA 1E2LA 2C9YA 1DKMA 4ZT7A 1JIUA 1T2FA 2C3PA 5BW6B 3MJDA 1XF9A 5K7SA 2RKOA 3CNQS 2QRHA 5B6JA 2IPOA 3ROKA 1P0QA 2X1MA 3VHXB 2I8AA 1RWKA 1R2ZA 1P7VA 3JZFA 4HPJB 4DMKA 3HCDA 3G2HA 3ZIDA 7REQA 2JKYA 3V5NA 2AI3A 3PDJA 2JIPA 3OE4A 4H7HA 2PXCA 1PJLA 2GEJA 4B76A 1BROA 5FA6A 3FUCA 4JUDX 1T6XA 1V71A 2BM0A 1T1IA 4ENUA 3A37A 1GA6A 5HJEA 2RHTA 1SULA 2AWOA 1N9ZA 1J8VA 1NN3A 3UC5A 4PG4A 4CTNA 3ZW8A 5CFOA 5CYOA 2ZTDA 5EJ5A 4HB3A 1RZ3A 2VXOA 1H42A 3D54D 4E5VA 1C9JA 4BZQA 1MORA 2R6JA 1XMVA 2ZG6A 4MWBA 3GJQA 2YZ7A 1SXPA 1LRJA 4UMDA 4YUYA 3T8YA 4NBWA 1QHSA 3KAJA 1JEYB 5KVCA 1Q92A 1ZCZA 4PRZA 1QB8A 1YHNA 2OD7A 3DOIA 5TPZA 3OIDA 3VH4A 3P0IA 3BWEA 4M1KA 2EQAA 1Z4IA 3WL6A 2XAUA 2V7QD 1VGRA 2E3JA 3VYTB 1A9YA 4Y18A 4FFLA 4KR7A 3T7CA 5JH7A 3PEWA 2VZLA 4CKZA 3SIXA 2G07A 2M6RA 4OFWA 4WLFA 1Z3IX 4YRRA 1NULA 1RM3A 4RVHA 2OYCA 3RYHB 1W4BA 3L26A 4LZWA 3G02A 4R16A 1MU5A 3DFIA 1X9GA 1F0YA 1P9RA 4MUEA 5AT1A 2O54A 4QYXA 3O92A 1N1EA 1GRVA 5H4HA 1IVNA 5KO3A 3MOGA 3L8YA 3ROPA 4C7KA 5EHNA 3T54A 4A8HA 3TMYA 2CEAA 4A6DA 3K0AA 3OECA 1AVTA 5AW4A 3CX4A 1KDOA 3CFYA 2IEGA 4DA9A 2ERXA 2E48A 2IIBA 4KLZA 5KNCH 1U1IA 1C3OA 1C7ZA 1R66A 1KKMA 1DELA 3EN0A 1E79A 4XSHA 2DPGA 1GUAA 3HCCA 3PSAA 4GYJA 4Q3KA 4CMKA 5K8IA 1LF0A 4J7XA 3ABSB 4HEQA 3X43A 4ZARA 4OUKX 3LQ4A 1NKSA 1XZMA 1MDBA 2EGGA 2WF7A 2DZLA 2Z8YM 3D02A 3CN9A 1U3VA 3K0KA 4Z4GA 5E0OA 1WV0A 1EUDB 3REQB 1HKHA 2RGXA 2PH3A 3AXSA 3TTSA 3PDCA 1QONA 3WXMA 2UUAM 1QIHA 3DZJA 1EX9A 4HC4A 4TGLA 3EULA 5ICFA 1GADO 2GYYA 4YONB 2J3LA 4QYIB 2H52A 4JWTA 2NU6A 3U9LA 1Y34E 3UUGA 1EGAA 2Q45A 1TAHA 3FTQA 1NY5A 3NBFA 1UWKA 1KA9H 4IH9A 2YXBA 3HU3A 3L5KA 3IDAA 1BXZA 3BXXA 5IULC 1N0HA 3A36A 1TJ5A 1J0EA 2I7NA 2W43A 3G2MA 1GQ2A 3RC2A 4ND3A 5DH9A 2JARA 4LKRA 4BU0A 1B6SA 3WLLA 1Q44A 3VTKA 2D7HA 2D4AA 5EA2A 5HP4A 4NJMA 4NYMR 2XI4A 1I14A 2JLQA 1K3WA 3AI1A 5IJXA 2OZPA 4RX1A 4CTJA 1PQ4A 3R0QA 1EHCA 1HT1E 1QP7A 4O4IB 3EHDA 1CP3A 3AESA 1OWLA 3AY0A 5EJ7A 2BCGY 4KMOA 4PLPA 2JGNA 1WXHA 2GN1A 1XZKA 3ZE9A 4CKWA 2J0UA 1E1CA 4LYYA 1A4XA 1HYBA 3RC3A 2NW6A 1QK3A 3GGJA 1R0CA 1NPYA 3K8OE 5FNZA 3SICE 5KPJA 3Q88A 2QL9A 1ODIA 4ZVVA 3VTFA 2NP7A 2YFHA 3H9EO 3FF4A 5C8ZA 4AZVA 2E89A 2ZS9A 1E6EA 5FL7D 3QK7A 3LOPA 3BS4A 4B6GA 5EUQB 4DXHA 3W9SA 4U7HA 4M46A 3KS9A 2G4VA 3ENWA 3LXRA 3JZMA 4LX0A 2Q4RA 1G9XA 4XCVA 2EJBA 4BQSA 2CMDA 4RA9B 3ZV4A 4JR0A 2PZAA 1WIWA 4FFMA 3SZRA 1X70A 4KVZA 4QHSA 3WYNA 4IIUA 3GEMA 4C0LA 5LA6B 5JV5A 1TTTA 3OZUA 3DC2A 3TLBA 1K0UA 4MNTA 1NVFA 3QLVA 3CSSA 4DGSA 2P9FA 4QTYA 3S2UA 1GG5A 2OYSA 4KH0A 3FSRA 1JE0A 2VDRB 2BMDA 1DL5A 5ERXA 5JISA 1ODTC 4MUXA 4YVFA 1I5OA 4C6TB 3U4IA 4OK5A 4BKQA 1V6CA 2XH8A 1Z5OA 3BG5A 3FAKA 5CH3A 2INGX 1GCAA 3J7AS 4UOEA 2WU1A 4B3SB 1KMHB 3TI7A 2AEMA 1ZJ5A 2EIXA 1Y1PA 2CE7A 4A16A 2ZU0C 2FFRA 5ICEA 2HTFA 1XRNA 3D6AA 2WSSD 4YRGA 4B74A 1V8BA 1I7NA 1YUNA 3L27A 4NESA 1JHVA 3IPRA 2AYYA 2FX2A 3DS8A 4AS2A 4TUYF 1FJXA 2VLIA 4PFJA 3WLNA 2HHLA 3CMCO 4QXPA 2C7VA 2HI0A 3I5MA 4KPUB 4DG9A 3SEQA 2QL6A 3KP1E 4UW9A 4GE0A 4UCWA 1GZ3A 4CZ2A 2H1FA 3HBNA 5AMXA 4ERNA 1XZNA 1XL0A 1GTRA 2CN1A 1JJVA 3GEPA 1C8BA 1ESCA 2Q3DA 3Q1LA 1K2VN 2W9XA 2BBOA 2PZKA 2ZIEA 1Z8FA 3JARB 2O52A 3IUEA 2V6JA 1WUYA 3NHBA 4YIHA 3QWBA 1NXVA 4OFZA 4DDHA 3AM5A 2NIPA 5L7TA 3ROFA 1DC5A 3BFJA 3L8CA 2QX8A 1C8VB 3CO0S 5IF3A 3B13B 1E64A 1WB9A 4MRAA 1LI5A 1MOSA 2YY7A 4TTVA 3QU4A 2DHYA 5C4IA 3I0ZA 1EGQA 1U3CA 2PLRA 2P2ZA 5H68A 3O4GA 4FEEA 5J59A 2BGTA 4JYAB 3ICEA 2QJFA 3I8XA 2G76A 4YCMA 2HR1A 2V8BA 3UW3A 4Y2QA 1F38A 5TGZA 3FSGA 4JBHA 1AXEA 1WZUA 3TINA 2X3YA 3WV4A 3MRTA 4WDRA 3DJFA 3F2VA 2FMIA 3EZ9A 1E2JA 3R44A 1TFRA 4ZKDA 4G3XA 5JRDS 3JQQA 2OOKA 2R97A 2OCYC 3RS7A 2J5BA 1PRYA 3RJ5A 3ZD7A 1ZZGA 1RBYA 4YREA 3K0CA 3EGVA 1J0AA 1QB7A 3GGCA 3AIKA 2XGOA 1V34A 4TXMA 3ZS8A 5TX7A 4UM9B 4ZMRA 3UK7A 1A2KC 1YVDA 1CE8B 2NXNA 3HEBA 3UH1A 3LZ6A 4DV3M 2WABA 2IZZA 1GOTA 3Q41A 3K94A 1S8FA 1VRWA 1WZCA 4UEWA 1JW9B 3GVCA 4RXUA 3AR9A 3KEOA 3QEOA 2ZXEA 2QDXA 3A6KA 2MSEB 2VSOA 3OPYB 4Z7OB 4CBVA 5LR6A 3DEKA 3FIJA 2C58A 2J3DA 4A6XA 2C2MA 5AI0A 3TKAA 1ULBA 3V1LA 2F3SA 3EEFA 4U7PB 2YJ3A 3UXYA 3HCBA 1G7CA 3LT2A 1EFUA 3MWFA 4CTKA 1UOOA 4PIMA 1M5UA 4XOIA 2OPHA 3M7IA 4G41A 2C1EA 5KNDD 4S1OA 2J7OA 4GC9A 1O03A 3L8DA 4DV2M 3NGXA 3EZXA 2PMWB 3JQ8B 2YV4A 3SZ3A 5KVAA 4PT5A 5KKCA 3T34A 2AB0A 1L6RA 5AKYA 2CNKA 2AH5A 1A98A 3WE7A 1R5OA 3HTXA 3HYTA 3F3KA 4FSXA 1KJNA 4JMPA 3LBAA 5I7UA 4TS9A 3IHWA 1NJ1A 4FFDA 2GCNA 4AWAA 4ZI2A 3MMXA 1SB9A 2I78A 2CGEA 2TMYA 3PU6A 3PJGA 2B1RA 1Y3HA 1ZYUA 1U5AA 5EIFA 3DL7A 2ZR0A 3IYLW 2A59A 3DP9A 1EVYA 4NYMQ 3BTVA 3TJMA 2EW1A 2HX1A 3OTWA 3NMUF 3LF2A 1VHWA 1JLRA 2HA3A 2G17A 4XRRA 4R2HA 1UKZA 3OURA 1ST2A 1VE5A 1XTQA 3PCTA 3H05A 2IH5A 1NNEA 4UM7A 2AFVA 4W82A 1ZMOA 1IY0A 4Q4AA 4OQDA 4K81B 1C0LA 4LCJA 5E1BA 1TGVA 5ADUS 1Q0SA 3ND6A 3PX7A 2TMGA 4L5IA 1Q0TA 1MTZA 4DBZA 1V9SA 3WRXA 4YT4A 4M0CA 2ISQA 4Q3DA 3UJ9A 2ZJAA 2I4NA 4W4TA 1WUHS 4D8XA 1NPTO 1ZR2A 2LDBA 4P83A 2IHUA 1QYDA 1M1UA 1TW3A 2PTGA 3RVMA 4LZJA 3THWB 1YCHA 4KXFB 4TZ6A 2W6PA 2ZULA 3A1DA 3VYVA 2LNDA 1U8ZA 3LP6A 4MX8A 3GMTA 4KR9A 4TTQA 1J2YA 3VNAA 3PUKA 2Q6VA 4QBTA 5A0FA 1KSGA 3FJYA 1SBIA 2PLFA 1ZEJA 5CR9A 5JJBA 5FXMA 3HKBA 4COOA 2OUIA 3SLKA 2A4MA 5I4BA 4HMOA 1V3UA 4QRIA 4NV3A 1GHTA 2ZBKB 5FUXA 3ZD9A 2D1RA 4YCJA 2REOA 2CB9A 5F7XA 3A6DA 2SICE 4WFQA 2PXHA 4L0CA 1VLJA 1COWA 4V3BA 2WFAA 3KD2A 2DFVA 2ZXUA 5FTKA 3CLRC 3GFSA 4NMXB 4CM4B 4PXSA 5IVPA 2IKSA 4DSOA 1JXQA 4HAOA 3SATA 3IAAA 3SJUA 4BRUA 3W04A 4AF6A 1NYTA 4RKWA 3LECA 2HK7A 5B4VA 5CFPA 1G7RA 3W7BA 2VF2A 4OQQA 1IVSA 2BELA 4F8EA 1FDVA 1XZPA 4UVDA 4Q1FA 4XIIA 1NJGA 4ENVA 1JR6A 1XK7A 1YDEA 3T61A 2P6RA 3O83A 3ZW7A 4EY8A 5C35A 1NRJB 2YXNA 4OL9A 4KQHA 2OAGA 4MRNA 1KE2A 1LJUA 4FYMA 1JXAA 2Y2VA 3HC7A 2JLCA 1D2EA 3OQ6A 1HKUA 1CB7A 5DSXA 2E5LM 1JIKA 2D2FA 4OUDB 3MJTA 1B8PA 5JSQA 5DHQA 4EHKA 3WK6A 2DKLA 3A2MA 1SH7A 2N1BA 3V2HA 2FMFA 1AZWA 3A98B 5THXA 3ZQKA 4NLLA 2ST1A 3A0UA 4MI6A 1YF3A 1DE0A 3WLJA 1JQKA 2WF6A 4BNTA 1OBOA 5BUSA 2XB4A 4MTLA 2O0JA 3I39X 1D1QA 5KYYA 4HFMA 3TKYA 1KAEA 3PGA1 3LPDA 4BAGA 3KT8A 1ZMWA 5L3SB 4GM0A 4IWNA 3Q8MA 5TVKA 4P3PA 4ZVNA 1A5TA 3HKPA 1YCDA 2Q5EA 2ZDHA 4F9EA 1XCGB 1TAUA 4K6CA 1GCOA 3IP5A 3JR5A 4L5YA 4LRQA 2ISSD 1NVUQ 3DBVO 1EH5A 2DRIA 1L4YA 3SQMA 1KFCB 1A8IA 1EZZA 3O8NA 4JK3A 2UUBM 4MR7A 5EHZA 2GZMA 3RSCA 1R6DA 3TRKA 3GRUA 1P91A 3OLYA 1J5PA 1TTQB 1S3GA 2GB4A 1JXMA 4U0KA 1OQYA 3GLIA 4C0AC 2QYOA 2R6ZA 3NIFB 4GM4A 5BSEA 1KO7A 3IXLA 1AB5A 4U5XA 4F3YA 3D1VA 3KUKA 1MB9A 1P9OA 2GRUA 3RE1A 4FC7A 4X1YA 3NVMB 4TVOA 3TJZA 2XYRA 4KO3S 5LDHA 1FSPA 2WUFA 1N5JA 4REQA 2OPFA 2H4ZA 4NMWA 5JBIA 6ADHA 4FGJA 3LW7A 3GYBA 1WMAA 3UKJA 4BO8A 4WJLA 2BJHA 5A4DA 2EFGA 4XWKA 4FI3F 3MAJA 3E7FA 2WY2D 4KX5A 3A6EA 4I6GA 4LV6A 2X7HA 1AKUA 5G02A 2GCOA 2H1RA 5LZ8A 2VQ3A 3M49A 1PSWA 3SS8A 3UKDA 3QE0A 2VHWA 5AHWA 3DMTA 3TI9A 4JP1A 3BEDA 5GPBA 4YN3A 1PR3A 1O08A 5A2GA 2Y27A 4JI5B 1Y8QA 3RR2A 1QHHB 5FJIA 3STWA 2ZYDA 2C4MA 5I9IA 5JOQA 3CNBA 3KKMA 4Y2JA 3VR5H 4B4KA 1FYXA 4D26A 5IBCA 1GQSA 1S9DA 3B3AA 4R01A 5C8XA 1H9CA 3I8SA 5AK3A 2WTBA 1C2TA 5IYZA 1T4BA 1OGYA 3MVEA 3GZNA 5IRCD 2BEWB 4QODA 1PNTA 4RJ2A 4Z51A 3O21A 3U3KA 5D1NA 4N18A 5K0NA 1J2TA 3BCUA 1YGYA 3PNLA 2EP5A 4EI7A 5K3SA 2OHHA 1J00A 4IDGA 5L8VA 5KJ1A 1ODCA 3KSBC 4QNNA 5IG2A 2PZFA 2R7KA 5D8DA 2EYUA 2R60A 1UQTA 3RUHA 4QAQA 4MRVA 1FK8A 1PDVA 4RXMA 4M38A 3IILA 3CR7A 3BIJA 3W5UA 1O4WA 3D8UA 2ONJA 4OAPA 2D2XA 3W1WA 4D46A 1W0JD 2B78A 4XRGA 3EVZA 2C9CA 5I7SA 1UL1X 3NANA 3NBYC 2H4JA 3P9QA 2CK3D 4PZ0A 3TLAA 1NVGA 1CZOA 1YQXA 5I5GA 3QVGB 2E4UA 2QNBA 3NDJA 1L5KA 2B8JA 1USUA 3N0VA 3L6UA 2W0SA 3CTWB 3CPSA 1Q84A 2FQQA 1F4LA 3CUYA 3PFNA 3FBGA 4W1PA 3WGLA 2NV6A 1ZHFA 5ANRB 1QIFA 5M29A 3R3VA 2PV7A 4JLOA 3V1TC 3RWOA 3PFBA 1CR1A 1JQDA 3OCZA 2PBRA 1QCCA 4XH9B 3LVQE 2JS7A 1Z6PA 4GQIA 3TZQA 1R9MA 2BJWA 3B9QA 5A6SB 4NXMM 1KSHA 1SVOA 3PZRA 4C0JA 2D7JA 4S0ZA 2P5SA 3JR4A 2LKCA 4HQOA 2HL7A 4MIOA 4HVCA 4QHYA 1TA0A 4MW4A 3SJCA 5JPIA 2AD5A 2YQ4A 5JS8A 2M6SA 1ZRNA 4G56A 1VI2A 5K9ZA 3E9SA 4HNAB 4CODB 5HF6A 1HEYA 1QR6A 1EFHA 3DLIA 5CH5A 4F46A 1KVTA 5KWIA 2ZJBA 1FF9A 3A3YA 5JFGA 1OVMA 4MJXA 2W00A 4DRXB 4PNHA 4QX6A 4B7FA 2XOEA 4Q1EA 3BA6A 1PRBA 4OB7A 1E96A 3ABOB 1HRDA 3JD3A 5A4FS 4LAFA 1VKOA 5F64A 1GITA 2IODA 5ICSA 1CUEA 1TTHA 4XQEA 1CWUA 4JD5A 5CT8A 3HVJA 1Y8ZA 4B33A 5DFLA 5EINA 2O8NA 1RCTE 2JBAB 4GR4A 3WQQA 2A2ZA 3D7KA 1WDLA 2NV2B 1H22A 2BFMA 4R1SA 4YRCA 5JS6A 5F12A 3W67A 1D7OA 4DEVA 5J4LA 1NR5A 4BE9A 3OX4A 4LWOA 1HEIA 3UKOA 1MBZA 1P33A 5LQKA 4QBHA 4KQKA 2HRBA 1RKUA 3KAQA 3T06B 5C1PA 5FKJA 2WQ7A 3G82C 3IQWA 3OX3A 1VE1A 1NVMB 4QBGB 3AOGA 5EJMA 2VQEB 2O3JA 4NG4A 1NZJA 2HMWA 3G0HA 3ADBA 1QQ6A 4E21A 4HYYA 3DWGA 2ATVA 2DFKB 5BN3B 1NC3A 4HQKA 2AG8A 3TWLA 3KR0A 1R12A 3FKSA 3KT0A 3C5WP 2B36A 5FWAA 4G5QA 1SXJE 2QNJA 2ZTSA 3T3EA 2BCJQ 3QITA 2V7PA 3IHKA 2FG7C 3JZAA 1YQUA 5HKOA 1H0RA 4ZC1A 3JD2A 4KWEA 1XVUA 3TX6A 4A6EA 5ILGA 3FFXA 2WUGA 2JIQA 1TO1E 5B37A 2O8FA 4WZAA 1HRKA 2VDJA 2WYVA 4FVTA 2Z56A 1G6OA 1ZGCA 3BXFA 2XH9A 4PHTA 3ON5A 1WULS 5FLKA 2RC5A 1K3FA 2X14A 5IVIA 4DMCA 4GLOA 3DCJA 4EI2A 1Y9ZA 3CJTA 3EODA 3TL4X 4W6ZA 3M82A 3LXXA 1SZJG 3RTEA 4O2LA 2M2IA 2G5CA 1VSTA 5H80A 3WFIA 4L4UA 2X40A 4YAGA 2XYGA 1XP8A 2JGKA 1C1XB 2OGZA 1VEJA 5LFAA 4YYZA 4WLNA 3R77A 2DE0X 1VCNA 3KR9A 1UP7A 3Q9UA 1XNJA 1J7KA 3ASYA 1O95D 4GE3A 5EN4A 3EQ2A 4DCVA 2UUCB 3U6LA 4FQ8A 2Y0QA 4XM0A 2UXDM 4FFWA 4TN1A 4IIJB 4V0RA 1OAAA 3D7NA 4RYDA 4F4IA 2VJBA 4X1IA 4CMCA 1XWFA 2B94A 1ONNA 4ZVTA 3WJ2A 1GQRA 5CXUA 2NO5A 2QD1A 4UHJA 4BBZA 1BYIA 4PYNA 3Q5EA 2OCXA 3MLEA 1DC8A 5AVQA 4WCFA 2H2IA 1L5MA 4DABA 1NO1A 1TVEA 5JSFA 2QDKA 4NPHA 3UEOA 2P9CA 4ISBA 5JUWA 4BNMA 2V7BA 2HCFA 2VXBA 2IF2A 1VIYA 4ZV4A 1IQPA 2VDQB 4ENQA 2ZYUX 3W79A 1J25A 4RSHA 5I9TA 3T7EA 4YT8A 2HYDA 4N82A 4BFZA 2QUBA 4WIAA 5KJ6A 3ZDXB 1I5RA 2Q1UA 3AR2A 1P3DA 1TOAA 3B2QA 1UJNA 3KHKA 4CG2A 1TDJA 2EKQA 421PA 2H92A 2YHUA 2YXDA 2BGUA 4BGUA 1R74A 3B9RA 4E0BA 2JI7A 4IJWA 2G9NA 2QR5A 3IOYA 2JLYA 3CG4A 2BGGA 4QLAA 3PITA 4M87A 1C81A 3ZIAA 4L57A 2JJ2D 2IYWA 1JMVA 2XZPA 3STXA 1MFZA 3PEEA 5DGDA 3KFVA 1YB6A 3AR5A 3H2JA 1DTWA 1H6AA 2L19A 2G80A 5LLTA 4L02A 4ZQBA 1ADJA 1P0FA 1QVVA 3HSYA 4BGVA 2ACKA 2ZWAA 1GFWA 2RJOA 1V7ZA 1CY2A 3E4CA 4L76A 4GL2A 4AUKA 1I4EB 3KE8A 1ZJZA 1RFLA 4R41A 3IG5A 5F77A 3GNTA 4TROA 2ESRA 3TGLA 3Q7RA 4ID9A 4DA8A 1FNSA 2VUHB 1SIWA 3QLVC 4GPTA 4D4KA 1PR5A 5BN4A 4ZIRB 3DXZA 1KI1A 4PANA 2O01F 4YHHM 4QPDA 5GKNA 4O1MA 4BBPA 5KOHB 1N6RA 2C0QA 1G19A 3BL6A 3LY8A 3WDLA 4L95C 2MH8A 1GR1A 4BZWA 1AMOA 5I8WA 3ZDAA 3KOZA 2O5EA 4MHSA 1NI4A 3RB8A 1ZM2A 4OKNA 1OXVA 3HN6A 1RNLA 4U8HA 2CXRA 2Q28A 4MGIE 5CM2Z 2JDID 4NZOA 2OG1A 1R4GA 3OY2A 2H29A 1JHQA 3GA5A 1YCGA 2IUUA 3SYRA 2GCPA 3A10A 3LUDA 5DM0A 1ZEMA 3RGPA 1LUAA 3TRHA 4IS3A 1N7HA 4IY1A 3WJ7A 5E3HA 2YJ4A 1R8QA 4HMPA 4LY9A 3GNQA 1U5BA 4YDRA 3G5UA 3WICA 4FDMA 2RHGB 2ODNA 4MVJG 3OOEA 2LDXA 5IX8A 3V33A 1WSDA 3N2EA 3UK2A 4LVCA 3AFOA 1B14A 1P80A 1SA0A 4QM6A 1CVRA 1KEZA 3E9DA 2XFSA 4BL5A 3VFDA 5KYWA 1GYQA 3C7TA 1W76A 3HABA 4MCHA 1GTJ1 3NTOA 5TXGA 4ANRA 1LPNA 4J2OA 2WICA 1UJ6A 4WN9B 4C07A 3L93A 4A7PA 1UXJA 3I01M 1U1CA 3H99A 2V9CA 4C7JA 4X20B 5IASA 1YE5A 1G38A 3VOAA 1JJIA 2HHHM 3KQWA 2IXFA 3I05A 4I81A 1PR1A 3ZDZB 2AUNA 5C5EA 5JARA 1Z35A 4ZGGA 2J31A 1J22A 1U0TA 2R1VA 3PEFA 4DGQA 4QULA 3S4YA 1I6KA 2RHBA 1K6MA 2FSIA 5DYIA 4TKUB 3TBKA 1HDIA 2BW0A 2OAEA 5BVGB 1KFJB 2PSJA 1UEJA 1RWNA 2TECE 3GNLA 4J0JA 4CVNA 3A46A 1G60A 4L28A 3GEHA 3CCBA 5JO0A 4AJLA 5CNKA 2MMGA 1D1PA 2C2WA 3AU9A 4Y30A 3O74A 5KSWB 3BHJA 3K0CC 4IHJF 3OUUA 4A1FA 1WHTB 2JHCA 2IHKA 3V4OA 5D6OA 3NTLA 1ZP6A 3AETA 1OU0A 3BJZA 1TD9A 3GC6A 4RHYA 3O84A 2B21A 4QVKA 1PG2A 3ITKA 1QE0A 4KXQA 1BIFA 3HV0A 4RIGA 2A5YB 2ZZKA 4JJ4A 1P1BA 5KVSA 1X7GA 4AY6A 1BCSA 3AHDA 3MS2A 2LVAA 1SXQA 2JNWA 3C3WA 4FFVA 2NQ8A 4FYYA 4KXXA 3TNJA 4PGMA 3EWAA 5FOWA 3TPCA 3UMJA 3ZBQA 3BXGA 4EO9A 4LY3A 1K7CA 3B8EA 1UFOA 3P9RA 5DSZA 3DL4A 2NGRA 4NCJA 1PU2A 4PQYA 3L4EA 3L6CA 3LC0A 4QOIA 3UAOA 1K5DA 4KJXA 3T3DA 3DTVA 4YMTA 5FADA 1QZMA 1AV7A 1XZEA 4D3XA 4H35A 3KQOA 4PLZA 4B5KA 2J7PA 2I6FA 3SDBA 5KHLB 2VDUE 2YZ2A 1CDEA 1VIVA 3FBWA 2J3EA 2C5GA 1O94D 5SICE 1E1KA 1M34B 2NUPA 3NBIA 2P9YA 3RSGA 4WFIA 1KQNA 3E27A 4YJ3A 2VAMA 3TPFA 3DE4X 1OIXA 4O4JF 3FLBA 2PK3A 4OAQA 5E7JA 3QF4B 2H8KA 5DYWA 4XLTA 3QKSA 1B74A 3DO5A 3KLBA 3UGQA 1QF9A 3N58A 1O8BA 3QE4A 4DR4M 3O5AA 3PWSA 1X2EA 1NHWA 2JY8A 1N4DA 3SXUB 3R6WA 4DG8A 5PNTA 3CVJA 1ZVMA 4B47A 1Q7BA 5JCJA 4GXRA 3L0YA 4YASA 3AV0A 1EVZA 3DC7A 1YZLA 2G0AA 3BSWA 1FDUA 3WRXC 3VNBA 4C7BA 4NAUA 3VNSA 2X8JB 4TL7A 3WSVA 1BX3A 1F4VA 3AF2A 3EGXA 4K8RB 4EA7A 4WBNF 1VC2A 3VX3A 4BC1A 4V0KA 1CT9A 1RI4A 2OESA 1L5GB 3P96A 1OV4A 4GX0A 2WVHA 3DOEA 4URVR 2HQRA 5A2QS 1KIAA 2RGEA 3CEAA 3SXJA 3NHAA 1U94A 3AL2A 5FBKA 4L85A 3LW5F 1QSGA 4IQ8A 5ITRA 1Q57A 3NM5A 4FC6A 2MJ5B 1P4SA 3OD5A 3CISA 1K7SN 3CW9A 1L5SA 1KWGA 3NONA 3DKRA 2M9MA 1HF3A 3IURA 4S1NA 2WU8A 1OCEA 2ZRHA 4EQ6A 2B30A 4GECA 3SC4A 1TQDA 1D2AA 5HJ5A 5C1BA 5ICCA 1P45A 3QKRA 3FHLA 4K9OA 2VZ9A 1Y1SA 3W0FA 1U1FA 2BBSA 2EHJA 2ZSHA 1B73A 1L5HB 2Y77A 5CG2A 3MINA 1VP9A 2JKVA 3T1TA 2DR0A 2LXEA 4MDFA 3LQRA 3MOIA 1DGFA 1CUJA 3FOCA 1AM4D 2ZI4A 4AS1A 1Y9EA 4GG1A 5JSUA 4OXRA 4LGCA 1N5RA 3VNVA 3QI2A 2XVZA 1H4TA 4MCIA 3W9UA 2AZXA 1NXPA 4RQAA 4K9DA 2F2TA 2CKMA 1XRQA 1F7VA 1ZH2A 1RBQA 4DIFA 1W581 1S2LA 3LK6A 4XYGA 3LSYA 4XPZA 5A5VA 1V16A 1DU4A 1ADGA 1DARA 3KOXA 4FZVA 3NYRA 1T1EA 3LAWA 3DL2A 3X44A 4DSAA 5I5EA 5KDDA 2VATA 2E49A 4CCAA 4JSTA 3SKXA 3LYHA 4H0NA 1ZLXA 4D9JA 4DLKA 3C7AA 2D62A 5JS1A 4TMKA 2Q2WA 3C41J 2A88A 4AWBA 1GZHB 1M6HA 2QN3A 3BD6A 1GSAA 4IEEA 5F4BA 2Z6UA 1IXSA 4Q9JA 2VUSA 3K30A 2B20A 2R5NA 2F6RA 3QWAA 4EHDA 4UD6A 5DRTA 1SBYA 4JI3M 4M2LA 4BP8A 4G2NA 1NF3A 3AKYA 3QWFA 4RGYA 1WOYA 1WV1A 2B5VA 4ZI7A 4RU1A 1A5BB 4PZDA 2PYZA 4BNLA 1DRKA 3L0ZA 2CMKA 3D2LA 2NXCA 3S5JA 3STHA 3NBZC 3CZQA 3LDAA 1P1IA 3SWWA 1RCFA 1KOFA 4W99A 1MA0A 3P2OA 1GZ7A 4DIBA 1MZVA 1RSZA 2W82A 3L0CA 3EASA 5C8YA 3IALA 3ROXA 3X3HA 4WERA 4S2UA 4NX2A 1M7HA 4CEHB 4XLLA 2DPXA 3KXDA 1LBQA 5JO9A 4LQCA 4G1MB 4R0VA 2JBWA 3M3PA 5J2UA 3WZMA 1OZ0A 1V26A 4LY0A 1PIWA 1JQ5A 5SY6A 3KOYA 3BKWA 4D5EA 4MVWA 1OASA 1X19A 3PXAA 4Q1AA 4I55F 4IHKA 2P62A 1LVHA 4X65M 4ZU6X 1XNQM 2OAQ1 1P18A 1E2PA 1URPA 3B5JA 3JAWA 1MG5A 5ALQA 3RIMA 2PRZA 4R83A 5AI6A 2VYCA 1W5FA 3OCWA 1G3MA 2OO7A 3JQAD 2B35A 4P58A 1XV5A 2PFSA 2V4MA 1TB4A 1VHJA 4IFBA 1MAHA 2RHRA 4MVJF 2JFYA 3MGKA 1ND6A 3DMTC 4EB0A 4HRVA 4FXOA 4F97A 1FJGB 1MAWA 3AZOA 1S8AA 3JAKA 4RPIA 4A2PA 4LXIA 4LF5B 2FSPA 3E22A 2XRZA 4XR9A 1H3EA 2BT4A 2GD0A 4L9RA 1SVLA 1I4OA 3A6FA 4YT5A 2R8YA 2OXCA 4FD2A 1H05A 1L4BA 1X80A 3TRIA 4J1QA 3MGGA 2ZRJA 3QNMA 4EGQA 3PC8A 3L92A 2HXYA 1KY5A 4JN6B 1PJRA 4RHUA 2C97A 1CCWA 2HGSA 5HKKA 1XDZA 4DLSA 2BI8A 2EF1A 3LUFA 1RLIA 3MGAA 5JG7A 1A4IA 2IXTA 1W85B 3S2YA 3DV0B 1Y8RA 3E5RA 4V1CA 3SMQA 2JIBA 1NOIA 1M54A 4U7FA 3KJEA 4V2UA 4XKJA 4XWAA 3T1NA 4BVKA 3R1IA 3DDSA 2J0VA 5C4GB 2QU7A 1L5LA 2BGLA 3ASVA 2OECA 5C32A 2ZI5A 4X84A 1WMDA 2JHPA 2CL5A 1QH0A 1Y98A 3F74A 3W2EA 5I01A 2H31A 1QBKC 3HI6A 2GN4A 3OJXA 1F4PA 4PZCA 1KAQA 3OQBA 5IWAM 5IMSA 2JFZA 4NABA 4TMYA 1SU7A 3PQCA 2EGHA 4UTPA 3KUCA 2GCGA 5LOVF 3DZKA 1E0SA 2DBVO 5AXBA 1HNNA 1P3Y1 3IJPA 2CXOA 2C5BA 4B3FX 3OTOM 3MT0A 4JP2A 1NBWB 4XUGB 1JG6A 3CBQA 1RWBA 3O8QA 2I7DA 1ODJA 2AEJA 3RC9A 5AICA 1BH6A 2P9HA 3G5AA 3QPAA 4CF6A 2JANA 2GN9A 4PRYA 4GP9A 2EW2A 4G0PA 5ES3A 2IL1A 2ZQZA 4AJIA 1IIRA 1YR3A 5HQJA 2FR0A 5ED0A 2XWJI 1U2SA 4CHGA 3U19A 1HQDA 3ONFA 3TVYA 4P98A 5DX1A 4RF3A 4L6V6 5AM4A 3KFUG 3IEPA 4OMFG 2ZSAA 1Z47A 1NRWA 1WQ3A 5KJFA 1EGVB 1AS3A 3QXSA 3ZZ0A 3IT0A 4Z4IA 1N2CA 3PKZA 2EATA 4CYMA 4LHVA 6Q21A 3S8EA 4L9WA 3L1HA 3IV6A 1Z33A 2ZAGA 2X0KA 1AQLA 4FYHA 1M3SA 2NU9B 3BYZA 4MUYA 2MR9A 3L41A 2WKRA 5LMCA 4PD2A 1IONA 5EYPB 2BWBA 3OM8A 1YXMA 2IDMA 3SX0A 2WF8A 4MV4A 4EO4A 4DHEA 1OD6A 1OKKD 2GN0A 4IIDA 3TK1A 4GPIB 5J63A 1JEDA 5AVKA 1AUXA 2XE6A 2JJQA 4ZDJA 1Q3TA 2DG2A 3RYFB 3FDJA 1HI9A 3LO8A 2G09A 1W5AA 3OIYA 1NONA 1TYEB 1JH8A 3V4ZA 3U6PA 2YZKA 3TM4A 3QBEA 3W4IA 3ZVKA 5LQMA 3F6SA 4LGYA 3QKUA 4ZEXA 3L1IA 1N1DA 3RK0A 3CW8X 3E7WA 4QFBA 2K47A 1J42A 2RE8A 1J90A 3OJOA 3LHDA 3F90A 3SM3A 4ZCIA 4M53A 1KYQA 4P6VF 1DRVA 5KCMA 2PKEA 3ZNNA 2WIFA 3MS4A 1VE6A 2GF2A 1F2UA 4IMRA 4NPAA 4ACBA 4C7XA 4Z4QA 3PRJA 5DNEA 4DCJA 4EGSA 3V8EA 1PZMA 3P71T 3UJCA 1K6EA 2QVGA 1RZRA 4PBRA 4QJBA 3ZXXA 1HOXA 4A8JB 2RHMA 1KJIA 5LP6B 3K53A 3X2EA 1OR8A 3IC5A 4AYWA 3NTXA 2WIKA 4RFLA 1XXHA 3K1AB 4KQWA 3WHPA 3A9WA 2OSBA 2WILA 3G0OA 4KRYA 4X64B 3PHIA 1CUIA 2NU7B 2OWEA 4BVAA 4GH9A 3FUXA 2P9QA 4BLWA 2AF3C 3STTA 1TJNA 3KLOA 1A7UA 4BNHA 1WXFA 2KWIA 2H7YA 2XXBA 4M37A 4OP1A 3EUFA 3CRZA 3O2NA 2JFFA 3LHSA 2P1RA 2YINC 3ZOKA 1GYPA 4JUCA 1TJYA 4CI0B 4AXXA 2OOAA 1LK7A 5U9CA 4B87A 4I3GA 1MGPA 3NHYA 3CWQA 3N86A 2RI1A 5ICMA 1DV2A 5KTRA 3NNNA 4TV9B 3V8MA 1UF9A 1VE7A 2CLOB 5DZSA 3VR3A 4FHZA 3N2GA 5JHGB 4FFNA 1XTBA 2HUNA 1FW6A 5B1SA 1KKLA 4JY7A 4UTZA 2HBZA 3AHJA 2MINB 3GDFA 3HJCA 2G5PA 4TKZA 3HWWA 5CTJA 3R09A 4QPCA 4UEKA 2JI9A 1MZPA 4BY9E 2F4VB 2R8EA 5HDQA 3N6VA 3QVUA 1HTTA 1E2FA 4QTZA 1JZSA 5TMPA 4AJNA 4IDDA 3TECE 3HGQA 1KL7A 5EUCA 2Q4BA 4D56A 1JT9A 7AT1A 1CZLA 3KK0A 2R18A 4WJZA 3MUOA 3TX2A 5JNUA 1SAYA 1Z63A 1X1TA 3ZN2A 1XEXB 4L07A 4UHHA 2R4UA 2WZQA 3DVQX 4WCFC 3SQXA 4CLEA 2OK7A 1I1OA 1RWVA 3HYLA 3ISTA 5C18A 3FWYA 4ESVA 2EX0A 4HZGA 3PYMA 5BN5B 3A9RA 4CEJA 2FEPA 3C8ZA 3LH5A 3AUXA 4QHTA 4RF5A 5LYJF 3THYB 3FYUB 4BJ5A 3K0FB 1T4MA 1YZGA 5D1HA 3EH1A 5IM4A 4CFYA 3F9IA 4FT2A 5G0TA 1OFGA 2EERA 2Y6VA 2C8LA 4IV5A 1MRSA 4IJEA 1VPLA 4XEHA 5CXXA 1U0HC 3SHTA 1QZUA 1A9OA 5TQ2B 3GLHE 1JLLB 1UH5A 2VHUA 1ZCAA 4K88A 4I6JA 1ATZA 3H2BA 1FSGA 4YV0A 2VHEA 2Q6KA 4DB2A 4B7HA 4A0HA 3RVOA 3AFIA 3TTXA 3JQAB 4JI6B 4DC0A 2V7XA 5L9AA 4N0EA 3U7EB 3JQRA 2E7ZA 1VHQA 5BYKA 2XYHA 2Y1GA 2XPCA 2F64A 3W8FA 1T8WA 2A8YA 2Z9CA 3U7QB 8GPBA 3RLIA 3R7NA 3TOSA 1D0MA 3ZWQA 4Z8YA 2DENA 1L7DA 5KCZA 2FN8A 2WSIA 2RAVA 5J5VA 1UPFA 2C9DA 5F52A 2WR8A 3DZCA 4MULA 2RIRA 3NB0A 3A6PC 1RQ7A 2V3VA 1HBJA 2OB2A 1ZD8A 1VGQA 3N8IA 3FCAA 4ENTA 2I55A 2CLHB 2QTCA 5BN1A 3UCFA 3U3JA 2R85A 2RI6A 1N0UA 3MJFA 1UC9A 1GL9B 1H65A 3FF1A 3TUZC 3ICCA 2FW1A 3LT4A 3QA9A 5TEWA 2B3DA 1Z0KA 5FBLB 4FKMA 3TR5A 4U7JA 3E70C 3FE2A 4MI1A 3FX2A 4WKBA 3ZYZA 1FTGA 1N5DA 4N9QA 2O8DB 3BK1A 1SD1A 5DOVA 4Q37A 3Q87B 4JXKA 4HYTA 4QQKA 1E5QA 1N3BA 4F9GA 3MMZA 3CRMA 4L72A 4EPWA 4D9EA 3T5DA 4RMNA 4RTPA 1L8XA 4RNAA 3LW8A 3DCIA 3IEUA 1ZNYA 2C9ZA 1IN6A 4WVFA 1P44A 3VYSB 2K4MA 2D06A 3QHAA 5AKLA 1I1HA 1J9EA 3PICA 5LZ2A 3ONVA 1W25A 4X1KB 1RQRA 2XCLA 3KXIA 5EE9A 2OL4A 3OMXA 3BFPA 1ZD9A 2H51A 4MS1B 3T0IA 4ZOLF 3WIOA 3FOFC 2H1HA 4GKKB 1Z7EA 2PZGA 1HL3A 2B4AA 4CIVA 4ECAA 3OF5A 2Q0QA 3S2IA 1Y7HA 5HRUA 2GMWA 5U1PA 4UNRA 4DR6B 4AO6A 1U0BB 3PEVA 10MHA 5G1PA 3V4LA 4RETA 1B4DA 4XIFA 4FMDB 1P1HA 5E9AA 1SC4A 1M2FA 2QJRA 4IXNA 5EKSA 2VJYA 1T6BY 5A62A 1UFZA 2PWPA 4LF6B 3C5CA 5LC1A 4KI7A 2CB0A 3VHXA 1IBKM 4ZREA 1MD9A 1WMBA 3C0KA 1YR8A 3K6RA 3HDQA 4BKMA 3A9CA 2QN1A 5DIZA 3TO5A 4XIGS 3PFHA 1EIJA 4BKOA 4CFZA 2P2SA 1NDUA 4PO9A 5BXYA 5K09A 5CDUA 3G23A 2PX0A 3FMGA 1JWAB 3O94A 3M1AA 2VPZA 3BRCA 1YJ8A 4FE7A 3UA4A 5LQUA 2XCRB 2ZDQA 3C3XA 1W75A 4A15A 1TH4A 4EMTA 4C87A 3X1JA 3L7YA 3IERA 1V5GA 4KGDA 1JB1A 2EKDA 2Z4RA 2P69A 3IKJA 1TW2A 4H18A 1CDDA 2AWNA 1JS1X 1LGYA 1FUUA 4KGVA 5L40A 4DNOA 1A71A 4WNAB 1PK8A 1A50B 1RWOA 3W2TA 2FN3A 4K6HA 4CPDA 3ITEA 3B74A 1IUNA 1NHGA 4V1CI 2QBYB 2XDQB 3JX9A 3IIKA 2QSUA 3VO9A 5IVKA 4EYSA 3LLVA 3FRJA 3FNRA 4P4LA 1JEYA 4AU1A 2D1SA 2JEZA 1C3JA 5FNVF 2J9GA 16PKA 2YOGA 5EMLA 4NBKA 2X5OA 4C0SA 1T4CB 3DHVA 3D0RA 2NVWA 1U0SY 5B3KA 2OQRA 2X1LA 3UHJA 1LVUA 3TNYA 5ALKA 4WK0B 2HBRA 3R76A 3K2IA 2P11A 4EG1A 2BFNA 2NQ8C 2EW8A 2HMVA 3NWEA 4PINA 4NOMA 1M2EA 2GESA 4MUBA 3MWKA 3HWSA 1T6NA 3FMVA 4MRPA 3WDKA 1NSTA 4A5SA 5C7YA 3SPXA 3RU3A 3G2NA 1D03A 1E7RA 2ZPUA 1YR1A 3U39A 3I73A 3TIXB 2OOSA 1XPOA 2R6AA 5B2EA 3IVRA 3AJAA 1SUCA 2AFIB 2H3EA 1G8SA 4EAQA 1ZINA 4N1AA 4ZZIA 4OP3A 4DV0M 1M1YB 3OCUA 1G5QA 3MTEA 1NJ5A 3WWDA 1O0BA 1XVTA 2AQ8A 4LYEA 4UREA 4JUIA 1IY9A 2W4IA 2H85A 1N8KA 1WA5A 3WL3A 3OU6A 3KEFA 1Q16A 3P2MA 3QXJA 1QO7A 4B6QA 1YDFA 1WCIB 3TG2A 1Z5WA 3D6UA 4WZBB 1JFSA 4LBYA 2HIGA 4OHFA 1OKSA 1JJFA 3EZNA 3MWEB 5DM2A 1BKDR 4FKZA 3AEQB 3R40A 4J0EA 1I2DA 3T9BA 4E5PA 2QT1A 3H5TA 1CU1A 2HADA 4QYIA 3K2QA 1ENOA 1NHWC 4B1FA 2WIJA 1L8QA 1N2XA 5AJUA 1P0IA 3X1MA 3ONWA 4UZEA 3ZDCA 2EX1A 4ZRDA 1TCAA 1JG7A 5FTJA 7CATA 2JFBA 2CWWA 1CY6A 5EJGA 3KTAB 3VC2A 2O2GA 4ZCTA 5CBPB 3F8WA 1R5JA 1YBFA 4OHCA 3ZLJA 4FIDA 1PJQA 2WJ6A 2CSUA 4HAZA 2XMBA 3M5PA 1M0EA 1H5QA 4PC7A 1CFZA 2GTIA 4EVSA 3AF3A 2QHXA 4DR7M 1ECBA 4EJMA 3ZGYA 4GIPA 2AFHE 3E5MA 4LQDA 1DIBA 1PLLA 3I30X 4ZJPA 3RQIA 3I83A 3KJXA 1D9ZA 2OY0A 4HNVA 1M7GA 3GEIA 1PGJA 2DI0A 3P97A 4MEBA 4B81A 3H04A 5IMBA 1VG0B 4BLPA 2XMSA 2JHGA 1EU1A 4XE5A 1F2TB 3B7QA 3R3JA 5B57C 1WSAA 3ZE6A 1PJSA 4GLBA 5GM1A 4QEZA 4EUKA 1HK7A 1A97A 1U90A 2PZJA 3G8AA 4DAEA 4CHTB 2CL0X 1QTRA 4J49A 4ND5A 1RI1A 3H7AA 2E4YA 1MJGA 3MJHA 4LVOA 2UYCA 2DJ5A 1L8OA 1L2TA 3S5UA 1QYVA 1CZUA 3BRQA 2GZRA 3VZQA 4JBLA 1QV6A 3HSKA 1KFBB 4Z53A 3A9SA 3EWSA 2GEFA 5A03A 2V97A 3KHSA 3EZGA 4OHUA 3GXBA 3ETDA 5IDVA 3ZHRA 4P22A 3LHIA 4C78A 4C6TA 1G2PA 5FFNA 1Z4MA 2O19A 1U7HA 1V1RB 4MQFB 4NC9A 4Z3OA 3WB1A 3K4PA 4NYIR 1V45E 2B7BA 4FDLA 3FCSB 2Y3IA 1II9A 3ZGXA 3NAZA 2XA2A 4BQIA 3FMOB 4IVRA 3Q9SA 1DQRA 1WABA 3DMGA 4IQ0A 3B51X 3U40A 4C6SA 4AWXA 1MRZA 3H5VA 3MYRA 3E3LA 2BMAA 3Q2OA 4AZ0A 2QD2A 3CLKA 3AKDA 2SECE 2APJA 2EXXA 4K1LA 1PT9A 3HYNA 2JZ0A 1P5HA 3D6JA 1XA4A 2NOAA 3U6MA 2YHSA 3NVDA 1YDGA 4R1LA 5KUTA 4YUVA 4MGZE 1MIOB 1VJ5A 3KZCA 1B6TA 1L7OA 5KQ8A 1E2UA 1DHRA 4UU7A 5ALGA 1UDAA 4CF7A 4DIOA 1N7GA 1DUIA 3E3AA 3AVTA 4G5HA 2WOOA 4Y0VA 2HYIC 1BE6A 4W5HA 4DARA 4B08A 2YZGA 1R4NB 2W5UA 1ZMBA 1QZ3A 1COZA 1GAEO 4TX1A 1CXZA 1EJ6A 2YMLA 3ZDQA 1WHSA 1YU6A 3EMDA 4DV5M 2QYTA 3FI0A 3BOSA 4C9BA 1OI2A 5D7BA 2C96A 3X0DA 3I9NA 2FW0A 5K51A 2GLTA 5EFOA 3TOZA 3JATB 5A3SA 3PWZA 4HI0E 1XZGA 2VJDA 2VKTA 2Y1FA 3R0IA 1E2DA 3KBBA 3LBFA 1R1DA 3E2PA 1E1RD 3KT6A 3NV9A 2OD2A 3LC7O 4WT7A 2IEDA 2O25A 2C3YA 5M34A 1FVOA 1ZUIA 5AHXA 3HZJA 2K2WA 1DG9A 4PAGA 3CZPA 2Q62A 3FHCB 1QYIA 4I3FA 2A6PA 2WAOA 1SKYE 5CFQA 4CV1A 4B7CA 3GFVA 3RVLA 5AXDA 1CE8A 4AROA 3T6KA 1DXYA 1BA2A 2RGNA 4BLVA 2XKKA 1XDBA 2OAP1 2A5LA 2EJUA 2L0XA 4TZKA 2AZ4A 1FC0A 5AVTA 5G53C 5T41A 1BWQA 2RMKA 4LF8B 3EAFA 3UWOA 3I2JA 3EVBA 4QDUA 2OWDA 3OPYA 2HIAA 5EIBC 1P7PA 2OZEA 3LUCA 4OHXA 2JRCA 4BQRA 1Y4ZA 1QE5A 3EGDB 3PC8C 4R1TA 1QG0A 4G8DA 4C1NA 4L5CA 2IPLA 2XBMA 1OA1A 1PWZA 3VAAA 2I3GA 3OX1A 2DLDA 4RBNA 3MJ5A 3MGBA 3ORHA 3OCJA 1KP9A 3UHOA 2IYLD 3L1JA 1QX4A 1RHRA 2IPMA 4D44A 1JTFA 3AVXA 3DCYA 1IC6A 1Z4KA 5CVVA 4IINA 3JQ8A 4I4NA 3GA0A 1G4UR 3WRYA 3OUTA 4E03A 2JFPA 2KE5A 3SSOA 2XYPA 1PF7E 3WK5A 4D6YA 3D5QA 1O97C 5E3JA 4JJAA 5FV7A 5IT9A 1QUEA 2J9XB 2Y99A 1RLJA 1H5UA 2XNSA 1NBAA 2FEAA 1UBRS 1D6SA 2P9ZA 1B41A 4FOOA 1K4YA 4TRMA 1NDQA 5HIIA 4ACAA 4IG9A 4F12A 1L9XA 3ZZTA 4IP0A 5LLDA 4I8XA 3AM3A 1NQ5A 3OQIB 2A5JA 4U7TB 1FMTA 1ANKA 1GSIA 3HY3A 2YCBA 1RDFA 2CL7X 2YWGA 1PYGA 5A4AA 1LD3A 6NULA 4ZI5A 1LQ2A 4DMGA 1MV8A 2DFPA 1LJLA 5CNMA 3T5TA 3NZEA 2JLZA 2YVLA 3UHAA 4OYYA 2ODPA 4OMCA 1R8JA 4ER6A 4HFJA 2ONKA 3KC2A 4URZR 3WNQA 1ML4A 1G8KA 2COEA 5CAEA 4M83A 3I4VA 1AK1A 4KOAA 1M2VB 1XYYA 2X0NA 3QQPA 2YYYA 1JNXX 5LZ7A 3GPXA 3LIPA 4AN1A 3W6ZA 2EQ5A 4GI3A 2AC7A 4OJYA 4AMBA 1DBPA 2O2XA 3B1KA 3NIDB 1RXIA 3H9BA 4E15A 1I6LA 4HZUA 2O9JA 3KIPA 5LMUM 1SVNA 2Q8NA 3KVNA 4B44A 4BIIA 4RPJA 4GIBA 4EJ0A 4W8GA 3SSNA 1W29A 5HZKA 1A95A 2HQSA 3EISA 5G1NA 3TZKA 4AJ2A 5KYGA 4NP6A 3GELA 4RLHA 3TIIA 3I5XA 4Z1MD 2ZYGA 1XEAA 3WY9A 1Q7RA 3F0TA 1AB6A 4P31A 1QTNA 2UAGA 2R62A 1ACLA 5E6UA 2V7TA 3PGLA 2XUDA 3W6NA 4NYIQ 2DMRA 2VQSA 4MYUA 1NBME 2EG5A 4XM2A 1QHIA 4LE1A 4JA0A 4PZUA 3MRVA 3D6FA 5HKLA 4WCVA 4ZKEA 3LRPA 3NX4A 4ZHSA 3IPAA 2BDEA 2FZ4A 1NV8A 3KNZA 3CRVA 3JYNA 3VBCA 4DBLE 5L3VA 4FGZA 4MGYR 4CM9A 2GVNA 1H2YA 4KTTE 1Z6AA 5I8ZA 1RM5A 4KPGA 1WJGA 4P84A 1C80A 4KJZA 5EESA 2GJSA 4LTDA 3DHYA 1N25A 4YUAA 2X5XA 4OUDA 1SIOA 2X4DA 4P33A 2ZWMA 4CNBA 4OLBA 1WDKA 1W2WB 3TQCA 2ZJYA 2P4HX 3DBOB 2B8EA 4BNUA 3GF4A 1YUBA 5FL7A 1XNHA 2PD4A 1F2VA 3FDFA 3KRTA 2PRIA 1DBVO 3EGWA 2CD7A 3U4QB 5U4QA 1Q77A 4DLRA 3JPWA 2IIVA 4GXNA 3RU2A 3GAAA 4PZEA 4KRFA 4QXQA 4QYMA 1DMRA 2XUIA 2H1SA 3C6BA 2JP7A 3O31A 2OZVA 2UYGA 2Q1TA 4JBXA 4ILEA 3VPXA 1J8MF 4ALJA 4D7AA 3TE7A 3PX3A 5EJAA 1L5NA 2OFFA 2GBLA 2IOQA 1KORA 3Q3CA 1N2OA 2WVJA 1WPXA 3EMVA 3O2JA 3DWIA 5ITUA 3PNOA 2OSVA 1AJEA 3NNSA 3I4LA 3UW1A 1J2UA 2XSZA 3KS4A 3QX8A 3EIWA 4NU0A 5ENDA 3RW9A 1PT8A 3RAPR 3RCBA 1KZ4A 1FDRA 1ZCJA 1GABA 4CJ6A 5BSVA 5IANA 3FFBA 1EP2B 2RBGA 4ZT6A 1O96B 4HX2A 2HQBA 3SF8B 1UM9B 2JGLA 3R7BA 1P7WA 1GGMA 1Q1NA 1C41A 2XUHA 1WNTA 3BILA 2EFCB 2FUG1 3VKUA 4ER5A 1KETA 4MARA 4LMRA 3HR8A 1WDMA 2Q50A 4RE5A 1HFJA 5CVDA 4J0DA 4KQJA 3TRJA 4NHEA 1N0WA 1GR0A 1J97A 1SUDA 4DUZB 5DASA 3IP3A 2DP4E 1ZUHA 5B4TA 4YRKA 2RAFA 5FHRA 2B2XA 3U7RA 1VHLA 2WJVA 3R3HA 1CS0A 5AOBA 2IXBA 2FX5A 4X9XA 1TX4B 1PJ3A 2O0LA 2BMEA 2GSWA 3ZDRA 3ZQUA 3QF7A 1BS9A 2WBLC 4EA8A 1YSCA 5M5BA 3JWHA 2QVLA 4RFVA 1WW3A 5IARA 4EJSB 3H2KA 1VG9B 4FFSA 2BUBA 1QHHA 1FQWA 3L6RA 1V43A 1YAHA 5M3BA 1N5IA 4OV6B 4MP8A 4BNVA 1BO6A 1N2ZA 1MGOA 4RV4A 5DI3A 4HT3B 4BB9A 2BP7B 2PGXA 2WP8J 3OCYA 1ZVVA 1NYRA 1NJFA 2XCOA 5CGQB 2R7NA 1SC9A 4DYHA 3D8NA 4IKOA 2VP9A 4PC1A 1CJBA 2BEWA 3FA2A 1R0RE 2CFCA 4EITA 3AI2A 2ZJ6A 1EINA 5F23A 2BEVB 3LVFO 4OQFA 2P9BA 2D2EA 3KT3A 3SU8A 4W7SA 4S0XA 3NRJA 2PHZA 1E6WA 1FLVA 4LK2A 1VBKA 5T4EA 4UULA 4RIIA 1LBIA 2ZAMA 5FA5A 1C8LA 4RQTA 4DMUB 3CW2A 5AVYA 1TCUA 1WCYA 4LDQA 4BIMA 1H0KA 2OC9A 2CJWB 3ZCVA 1YFZA 4R1QA 2ONCA 2G1UA 2GQ0A 1AOXA 3HHZA 4UN2B 3SDZA 2BGJA 5HE9A 4QPPA 4KLRA 3LBIA 1QO9A 3LY9A 3Q6NA 2RG1A 3Q40A 4BLUA 2ZT5A 1IG3A 2XZUA 2V65A 3ZJ4A 2B4QA 4FYVA 1C3VA 1LW6E 5BMOA 1SEPA 3U48A 3AQ4A 5GAJA 3LPAA 3ADCA 4BV3A 3DBRB 2KJQA 4P34A 2LCIA 2DBQA 4DT1B 5ITTA 4AP6A 5TQ0A 3H5WA 3W3AA 1DKQA 3J2PB 3HNRA 1DEKA 1EDEA 2VHYA 4HRXA 1NZDA 2I3DA 2QUIA 3F97A 3PDHA 4RA6A 3FKJA 4B4OA 3B12A 1NNUA 2WG1A 4PONA 3I42A 3IVAA 1XHEA 1RMTA 4QO7A 4HOYA 4KIGA 5EUMA 2DTDA 1HTWA 2Q3CA 2Q1XA 5DXJA 3BE5A 4FR2A 5KOIA 3TD9A 2VWHA 1WEKA 1EB8A 2O1EA 2CEKA 5BXQC 2AYZA 1G5HA 1O1YA 1DHTA 1RAGA 3OQOA 1C14A 1Z13A 2IZ1A 3ELWA 2QPAA 4YWJA 3JQDA 4M3NA 4YMHA 2MSNA 2EYQA 2J5YA 1EAMA 1ZDMA 5FI0B 1UIRA 5EJIA 1ENPA 4KFTA 3MQFA 4HNAA 1DNPA 5GONB 2ZW9A 2Y66A 4JROA 1YJAA 3NBUA 5JXHA 3VU8A 1JZQA 4OX9M 2M6KA 1PW5A 3L0DA 4NCNA 2OHOA 4PLFA 3N2KB