1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Methyltransferase
molecule keywords RRNA METHYLTRANSFERASE
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
4Z2YA 4PYIA 5DSTA 5BP7A 3BT7A 5EPEA 2P7IA 5HIIA 3U81A 5DXJA 4X1OA 4EVIA 2BH2A 5CUQA 3FUVA 1FBNA 2YTZA 5C1IA 1WG8A 2AOUA 4DM3A 1ZGJA 3LSTA 3TM5A 1B42A 1MJFA 5HOQA 1IXKA 5CVDA 5LQUA 1RJGA 3ELWA 1DL5A 2KW5A 4RVHA 5DRTA 3ERCA 4MHTA 3FUTA 5DSXA 2IFTA 2I7CA 1KIAA 1RJFA 4O29A 3EVDA 2QRVA 3KQSA 1VL5A 4RVDA 1QANA 2NYUA 2XVMA 3FTFA 1XDZA 2G1PA 3HCFA 5CVEA 3P8ZA 5G02A 5GIOE 3OZTA 1SQFA 2UYOA 2HWKA 2OBFA 5GWXA 1XCJA 1RI4A 3GIWA 3GNLA 3NDIA 4C06A 2AN5A 2FK7A 2IBTA 4BLUA 4HRAA 2Z6QA 3CJQA 5FULA 4CTKA 10MHA 5CCBA 2CKDA 3BWMA 3KR9A 3GJYA 4P58A 1R18A 5EC8A 5FQOA 3O31A 2PT9A 4DA4A 2BM9A 3A25A 3P9KA 2AN4A 3EPPA 1KPIA 3BZBA 3G7UA 5DTRA 3MHTA 1BHJA 1YZ3A 3THRA 4OA5A 5E8JA 3AXTA 3M6XA 4DZRA 2FCAA 5H02A 4YUWA 5K8VA 3FPGA 2IBSA 5DT2A 2C7OA 3TM4A 5LQJA 4MWZA 2PBFA 5DM4A 1RI2A 3EMDA 5EIWA 5EVJA 3DLCA 5DLYA 2JH8A 2EJUA 3M6VA 2O06A 3NTVA 4R6XA 5KQRA 3P2KA 3FRIA 3CGGA 4U7TB 2PX2A 3MCTA 5IH3A 3GCZA 2GS9A 1ZKDA 1NBIA 4A6DA 3FZGA 3FRHA 2IP2A 1JR4A 3GU3A 4YUVA 3PT9A 4DCGA 5CD1A 3LKDA 5GOZA 4BLVA 1DUSA 4RVGA 3R9XB 3B3GA 3HCDA 1R8YA 1V39A 3ANXA 1EJ0A 3OU6A 4U7PB 5FQNA 3CJTA 5FWAA 2O0LA 1AF7A 4ER0A 1IY9A 3ORHA 5HZMA 5B1SA 3WSTA 4FP9A 4YUZA 1AQIA 3GWZA 1XCLA 2QY6A 3KQOA 3LDFA 1VPTA 3P71T 3P2IA 3DH0A 2VDWA 4QQNA 4AX8A 2G72A 3HVJA 1JQDA 3MTEA 3R6TA 3KKZA 3KR2A 4CKEA 4ER3A 3HCCA 2ONZA 5CM2Z 3KU1A 3KQYA 5E9QA 1KYWA 3UJ8A 1XTPA 2AVNA 1U2ZA 1G60A 3G5TA 4HG2A 5E9JA 4XUEA 4KW7A 1UFKA 3KQWA 5LQAA 4M37A 4GBED 3C6KA 3NDJA 4LG1A 1YUBA 4YUYA 4RTOA 3JWGA 3A27A 4M38A 3Q87B 2VP3A 4E30A 1X19A 5EZSA 4X60A 1D2HA 5CCXA 1VP3A 2WK1A 2H1RA 3NJRA 4L7VA 1D2GA 3M6UA 1FP1D 1EJ6A 3FUUA 2IH5A 1WY7A 1SVUA 5DM0A 3M4XA 1G8AA 1VIDA 5EEHA 3FTEA 3FTCA 3SSOA 1EQAA 3HTXA 3CCFA 2OZVA 3OE5A 3GRVA 3DXYA 3BGDA 1SUIA 2PLWA 3DMFA 4GC5A 1EG2A 2Y1XA 3CKKA 3DP7A 1F38A 3MERA 4PCLA 2PKWA 3VYWA 1NV9A 4YUXA 1QAOA 1I4WA 2I62A 4V0QA 5GM1A 2ZTHA 5HIKA 2ADMA 2P41A 3EEOA 1R6AA 4GC9A 5E9WA 4B17A 2AVDA 3AXSA 4MTLA 1JTFA 4CWAA 2B2CA 2QYOA 2QRVB 1N2XA 5K03A 3OFJA 5FWDA 3PX2A 3MAGA 4E33A 5E1DA 3A4TA 3LCVB 1PJZA 2P8JA 4ATNA 1KR5A 2Z6AA 2FPOA 2WA1A 1ORHA 4QVGA 3T0IA 1G8SA 4R8SA 3LPMA 3AJDA 3HNRA 4CKCA 3GDHA 4E2WA 5DXAA 1KP9A 4UOEA 2ERCA 2P40A 3DMHA 3I53A 3DLIA 3LHDA 3MQ2A 3PS9A 5EMLA 1QYRA 5K0GA 4RTMA 1F3LA 3LL7A 3LDGA 4GOOD 5T67A 1N7IA 2ZIGA 1YF3A 3C3PA 3FPEA 2P3QA 4K6MA 4PGGA 4F84A 5HEKA 2ZWVA 2O05A 4AZVA 2R6ZA 1ORIA 2UZ4A 2PXAA 3MB5A 2GA9A 5DM1A 3ELYA 3MTIA 3EGEA 3UJ6A 5K09A 2ONYA 3ER9A 2ZW9A 3LECA 3LDUA 3I58A 3PB3A 2ZULA 2G71A 2ZIFA 3MCZA 3NWEA 4C03A 3TPZA 1P1CA 1G55A 3BKXA 2ZLBA 3KPVA 3VSEA 4RWZA 5FHRA 4EKGA 4E70A 3ME5A 4PWYA 4XCXA 2ZCJA 3NWBA 3PFHA 4C04A 4BLWA 1NE2A 1P91A 2ZIEA 3KPUA 4AZWA 4AZSA 2O07A 3UFBA 2DPMA 1X1DA 2PX4A 2NXCA 5EKUA 1NV8A 3P97A 2JHCA 2YVLA 4HH4A 2ESRA 3EGIA 3SVZA 3ELDA 3RW9A 1N7JA 3LKZA 2JHPA 3PTAA 5DTQA 5DX0A 5K0NA 3BWYA 3SM3A 1Q0TA 2YXDA 3OCJA 1VP9A 3IEIA 3T7TA 5P8WA 1JG4A 3V97A 4EQZA 1XXLA 2CL5A 3I9FA 1FJXA 4C4AA 4PGHA 2B9EA 2ZWAA 1O9GA 2XBMA 5ICEA 5K0JA 2BR5A 1O9HA 3KQTA 1P39A 1H1DA 1ZQ9A 3G2PA 2DULA 2YR0A 2YX1A 1TW3A 3TOSA 2XYQA 5FTWA 2IIPA 3BUSA 4GOND 2PV0A 4ER6A 4YMGA 2C7PA 3UWPA 3S68A 3JWIA 3EVZA 3GRRA 2ZFUA 4QDKA 5GINE 5MHTA 1NKVA 5BW4A 2AOTA 2AR0A 3I5UA 3KR1A 3NVMB 5FUBA 2C7RA 2IDKA 2PY6A 4KRGA 4OA8A 3LCUA 1YB2A 5U4XA 1RI1A 3HA3A 3P9CA 4GOMD 5HFJA 1WZNA 2AOXA 4PYNA 2VS1A 3EMBA 1I1NA 3O4FA 1G6Q1 3IV6A 3NMUF 4DKJA 3I64A 1INLA 2JG3A 4P7JA 1HNNA 2B3TA 4GF5A 5LQNA 4DF3A 1P1BA 3FUWA 2EJTA 2GB4A 3K0BA 3G2MA 3SMQA 5KVAA 3DTNA 3HEMA 3RIEA 2P3LA 1AQJA 1RJEA 5M5BA 4DCMA 1KPGA 2AOUB 4IV8A 5E1BA 4ER5A 5BXYA 2PGXA 4Y30A 4KIGA 3P9NA 2P35A 4RVFA 3H2BA 3T7SA 5CIYA 5C0OE 4PIMA 4RTPA 1M0EA 1JG3A 4PYOA 2IGTA 4R05A 3EVCA 5CVUA 4MQ4A 2V7EA 1L9KA 4E31A 1OR8A 1X1AA 2OB1A 2PT6A 4PYQA 4RX1A 3GRZA 5EGSA 4GOLD 3SSMA 4OQDA 4HGYA 1JSZA 3TFWA 5EOVA 5D1NA 4C08A 4FZVA 1DCTA 3HVHA 4ISCA 4NECA 4WXHA 3X0DA 5FA8A 1X1BA 3UZUA 3FPFA 5EEGA 4KVZA 5BW5A 3HA7A 3DR5A 5EG5A 3EVBA 1BKYA 2ZSUA 4Y2HA 3L8DA 3GRUA 2ZBQA 1QZZA 3BWBA 4M36A 1XDSA 2XVAA 1VE3A 1HMYA 5KYGA 3EEYA 5F2KA 1ZG3A 4POOA 4FT4A 2OPBA 3B89A 1L3IA 3RODA 3TLJA 3TR6A 3V8VA 1WS6A 3R3HA 4IV0A 1RJDA 4RTRA 2AOTB 4PYLA 2PWYA 4IWNA 1BC5A 5CVVA 3E23A 3UJAA 2O57A 4LECA 1YFJA 1IM8A 5K0EA 4YV1A 4G56A 2YUIA 4MIKA 4KWCA 4HTFB 3KPJA 5E1MA 5EQJB 1JSXA 5E2AA 1JQ3A 2VDVE 5DWQA 1XDUA 3OFKA 5FCDA 5EHIA 5LQRA 3P9IA 4CKBA 3G8BA 4ER7A 2Z6UA 1KPHA 5DPMA 3LGAA 2PWPA 4QQKA 4YV2A 2YXEA 2EX4A 2GPYA 4KIFA 5T6BA 4RTKA 3GGDA 2GLUA 2PJDA 3HCAA 3D2LA 5ICGA 1YZHA 3B3JA 2IH2A 3GRYA 2EFJA 2C7QA 1FP2A 2FRXA 3HP7A 5EMMA 3G5LA 5HIJA 1KHHA 2HV9A 4EKIA 3VC1A 2G70A 3G89A 2VZ9A 3FYDA 4PNEA 2HR1A 3PX3A 1I9GA 3EVFA 4A6EA 2A14A 3G2OA 4WVLA 5FA5A 4PYJA 1SKMA 3E8SA 2Q41A 5LQCA 3FPJA 3BWCA 3CJRA 3K6RA 4FSXA 4PYKA 2OO3A 4PYMA 4C07A 5C9ZA 2H00A 1R8XA 1Z3CA 2LD4A 2GAFA 4FT2A 3SGLA 5JUWA 1MHTA 4KDCA 2NP7A 2AOWA 4F86A 5LSAA 3LBYA 1NW8A 1O54A 1T43A 1EIZA 3UJ9A 4QVKA 2FK8A 2NXEA 5JR3A 5K0BA 3HVIA 3LX6A 3G88A 4P7KA 4RTQA 4RYLA 1NT2A 1NW7A 2N47A 2P1DA 5E8RA 2GH1A 4P7GA 2PVCA 3DULA 2ZZKA 4GQBA 3ELUA 4FGZA 5EKXA 5F2NA 3EGVA 1ZHFA 3QOWA 4IKPA 5EZQA 3M70A 5K01A 5K0FA 4R8RA 1RI3A 3KQQA 3QOXA 2ZZMA 2OY0A 1NW3A 4DMGA 4M7RA 2YQZA 2XYRA 4CXMA 2BZGA 2IH4A 3EVGA 5E1OA 5GM2A 4C05A 4RTJA 3HCEA 3TKYA 4JXJA 3Q7EA 3TRKA 2YXLA 4YMHA 4ZTBA 3NVKI 4AZTA 2HNKA 3KQPA 4HGZA 1QAMA 5ICCA 3DXXA 3OPNA 1AV6A 1TW2A 4KDRA 2NP6A 3JWHA 5FHQA 5DX8A 4CTJA 2AN3A 3A26A 3CBGA 2PSSA 5EHGA 3UJCA 3SSNA 7MHTA 4E2ZA 5HIMA 1EAMA 3R24A 3R0QA 3KQMA 1UWVA 4FSDA 4E2YA 1NW6A 3G2QA 3F4KA 4EMSA 1BOOA 3FTDA 5T64A 5K05A 3PVCA 4QPNA 2PXXA 2HTEA 2OKCA 2BM8A 2FHPA 2P7HA 3E05A 4PONA 3REOA 2IDJA 2Y1WA 4YV0A 1XJ5A 2UYCA 2FYTA 3M6WA 4OBWA 1M6YA 3O7WA 3ID6C 3IHTA 5FADA 2I9KA 5HILA 1L1EA 5E2BA 3DXZA 5CVJA 3C6MA 3VC2A 2E5WA 3SR4A 2BR3A 4E32A 2JJQA 4BY9E 4F85A 1NW5A 4QTUB 4GUAA 2OYRA 1FPQA 3JWJA 3UJ7A 4GEKA 3ER8A 1L3CA 2K4MA 3CC8A 4X61A 2VDUE 4LWOA 4QDJA 4BP3A 1L3BA 1X1CA 2AOVA 2QE6A 3BKWA 3MGGA 4HC4A 5EIFA 3SXJA 1ZGAA 3AY0A 1RI5A 2V74B 3OU7A 5K0LA 3NW9A 2ZZNA 4V0RA 5KS2A 5LQKA 2B25A 4FR0A 1WXWA 4DQ0A 4PINA 1XVAA 3UA4A 3DMGA 3HM2A 3LCCA 2PXCA 3UBTA 3B3FA 2CMGA 3C0KA 4OBXA 1KXZA 2ORED 2B78A 4H0NA 3IYLW 3TQSA 3LBFA 5GIPE 4RTLA 3M33A 4R6WA 4OQEA 4AUKA 3KR0A 3KHKA 4RV9A 3CVOA 3KPYA 1UIRA 5D1HA 4QTTB 1TPYA 3QV2A 3T7RA 2EG5A 3DUWA 1PRYA 1G38A 3HVKA 3SX0A 2H11A 3G8AA 4PIPA 2JHAA 3B7PA 3BGVA 4RSRA 5DRYA 3GO4A 5K0CA 2JH9A 3EVAA 1YFLA 1M6EX 4E2XA 4QPPA 5F2OA 5DTMA 2R3SA 1KYZA 3TKAA 5IKMA 1JG1A 1JG2A 4LWPA 3FUXA 1SG9A 3HCBA 3FYCA 4EK9A 1QAQA 2P3OA 3PFGA 4XUCA 1R74A 2ZBRA 2OXTA 4BP1A 1JTEA 4X63A 4RTSA 3BGIA 3OZRA 9MHTA 2CMHA 2BR4A 1WXXA 5EMKA 1R00A 3DOUA 3OE4A 5EMJA 5LR6A 2XYVA 2PX8A 3PLAE 3A7EA 1Q0SA 4XUDA 3UA3A 2NXJA 3KPWA 4X41A 1VQ1A 2PX5A 3AWIA 3P2EA 3KQVA 3C3YA 2F8LA 1JQEA 2UYQA 2IPXA 3A7DA 3B5IA 1SQGA 1SUSA 2AZTA 3E7PA 3GXOA 3BXOA 3OU2A 2I6GA 3EVEA 3HA5A 4HTFA 5GP1A 5ICFA 5KQSA 4FS8A 2WA2A 2ZBPA 2CWWA 2AS0A 8MHTA 4PCAA 3UJDA 3OZSA 4HSGA 4OX9Y 1D2CA 1Y8CA 1NBHA 2G8NA 4RTNA 5DM2A 3FPHA 3TMAA 3UJBA 1VLMA 3THSA 2UYHA 2HMYB 2ZVJA 5ERGB 4P7FA 5DX1A 2QM3A 2NNWB 2NXNA 2OB2A 1VBFA
chains in the Genus database with same CATH superfamily
3G5UA 3BT7A 1QE3A 2KA6B 2HXSA 1R6BX 4KO1S 3RQSA 3BVPA 2A5YB 4RANA 3C4VA 1YL7A 4G81A 5DB4A 4BDTA 1FS4A 4X65M 1WG8A 1XZIA 3DM9B 4PICA 3SF8B 3IG8A 3T5PA 2F5OA 1B6SA 2FCRA 2X5KO 3OOEA 4CKZA 2AFHB 4RVHA 4Z9BA 1UZNA 1ISHA 2YIVX 1OWOA 1T9AA 3FBGA 4I1RA 4DABA 5M3BA 4LJRA 2GKOA 4ZYLA 4UVEA 1XNQM 1I36A 3AZOA 4CJ6A 1F48A 5P21A 1DIHA 1PWEA 3LGXA 3UMGA 4OHZA 2XTAA 1DX6A 4QRIA 3S7ZA 1LZLA 1NUHA 2H31A 2XCIA 3IHKA 5C8YA 5KOHA 1BKSB 1R27A 4RTOA 3HBFA 3N6VA 4EYOA 2HCRA 2KS6A 1T3ZA 2J9FA 3V4OA 4V1CB 1P29A 4NP6A 5T3YA 3S2EA 3QHPA 4DUGD 1EFAA 4IICA 2ACEA 3LVBA 2PT9A 1NHWA 1PW5A 5A9SB 2V5UA 2X8BA 2ZUDA 5IT9S 4WVFA 3CLKA 1R5JA 1DCMA 1MOQA 5G53C 4QXPA 1T3SA 3KXPA 1NUAA 1LPAB 3OTWA 2IBSA 4NSOB 3CVJA 1KQNA 3SP1A 3QG1A 4ROTA 5CYOA 3GLGB 4F3CA 5LA6F 3L27A 3WRVA 5KTMA 5HP4A 3GEHA 4YRSA 4IYRA 4YIKA 3HXMA 4ZPXA 2EV9A 3GY0A 3MJFA 3T7JA 4ASUD 2ADFA 4X91A 3HQ4O 4D81A 5KX5A 3A2KA 1KR2A 4WKBA 3IP6A 1OROA 2QMQA 2J0SA 3LQYA 4Q19A 5F2EA 4P7BA 5BSWA 3NBZC 1P9OA 4PHTA 3ZK7A 5JNRA 2WZDA 3EXIB 4OYLA 5H68A 1K3XA 1DUSA 2HLDD 4DQXA 2AC7A 3AHFA 3GVIA 3VVMA 2GXAA 2B3DA 1U3GA 3IUQA 3LC7O 4YRIA 1AF7A 2PLFA 3DFIA 3PIRA 3IPLA 4MVJA 4R7TA 1IXSA 5HF8A 4G24A 2DWPA 4NDNE 2WJPA 5CTJA 5JPIA 4ENQA 3EQ8A 4FP9A 5FXMA 4QJ4A 3SSAA 4AJHA 1J9ZA 3S55A 1B8PA 1E3LA 1JPJA 4BKRA 4K1XA 4A0SA 3LF1A 3L2OB 4MGEA 3T61A 3PDIA 4Q24A 1M1YA 1XCMA 1JEOA 1ZEJA 2ONZA 2YQ5A 3O2NA 4Q3CA 5CM2Z 5JDIA 2VNKA 4MV7A 4F71A 3DOHA 4G84A 3TEJA 2BDEA 4M0MA 1OGIA 3B53X 5LQAA 1T0JB 2J08A 2AHRA 4ZKEA 3MRXA 2WQ6A 1ATZA 3CH4B 4LX8A 3C7AA 3WIEA 2A1IA 3JWGA 2FZCA 1PJCA 4GOKA 4PQGA 4XSHA 4H1VA 5HMLA 3IAS6 4MSUA 1X19A 3FSEA 1D2HA 2VA8A 4DN6A 4KQGA 3RVOA 2OILA 4PHFA 5FOWA 3NIFB 3TW8A 4PX3A 1QQ6A 4A0FA 2IU6A 4XM2A 3FTEA 3P9PA 3SSOA 1WW3A 2Q5IA 1U3VA 2VHCA 3BMXA 4GR4A 5HK9A 4KR6A 5LP1A 1AHHA 4AQDA 3REGA 1BX3A 3TRHA 3E2PA 5AVWA 4YYZA 4PTLA 2H2DA 2Y1XA 4KQ6A 2FUG1 2X6RA 3EXAA 1MO4A 3HB0A 1L4LA 3JV7A 5AKZA 1PD1A 3RS3A 4B6FA 2EFYA 4Q7LA 1OU0A 3J7BA 2HNAA 3OQIA 4J91A 5ESWA 2ADMA 1Y6QA 4UBMA 1R6AA 3E9SA 3SI7A 4WCDA 1D6MA 1KOGA 2QQGA 3HZJA 5EJ4A 5GP1A 2O1EA 2X15A 2P9ZA 3E5MA 4CCAA 3EQZA 3OHMA 1GCOA 5JHGB 1P3Y1 4DLXA 2B83A 1ZOOA 2WSLA 1W4RA 1GNQA 4KKXB 2HZBA 1IONA 2CFOA 4H7IA 4FB4A 4X8LA 3ZHOA 3SQXA 1YCGA 1OVGA 2FDRA 1MQSA 2P11A 4IFIA 5AM4A 1RACA 4F38A 1Z63A 2DU8A 3OOHA 3LPMA 3U1TA 1KEPA 2C5SA 2AV6A 3BGWA 3K2IA 1OW3B 2VBCA 1D6JA 4E2WA 1PFVA 5DXAA 2O54A 3RRMA 2OCBA 4IJFA 2I1QA 1U0SY 2Q5CA 5FDFA 4V0OA 5U1PA 4E5MA 4GOOD 3TD6A 2Y05A 2MSDB 2YOGA 3BMQA 3IA7A 4EW1A 3ZLBA 1PK9A 2OOKA 4RIHA 4X6YA 5IXYA 4BUCA 1OFGA 2B37A 1U2SA 2PXAA 2GUGA 2WSFF 4EG5A 4ZI7F 4HP8A 1ODLA 2AWNA 1LSJA 1JLLB 3JWEA 3O7MA 2LPMA 1C0KA 1A9SA 1FU7A 4FOPA 4G1BA 3C6XA 3S27A 3AVTA 1JI0A 3LAWA 4BNLA 1F17A 2Y1KA 1D4ZA 4W99A 4O8CA 4OQ4A 4TTIA 1CUIA 3NWEA 4ZOCA 5DHTA 2VPWA 4DCSA 3WGYA 4XVHA 4E15A 1MEOA 4CUJA 4NEQA 1LV8A 2C59A 3PFHA 5AK5A 1H85A 3QPVA 3SHGB 3UT6A 4IF4A 1ZHOA 5FO1A 4JGBA 1X7WB 4R1MA 5GONF 4GVLA 1IY2A 2X9LA 3OZEA 4J4HA 3RW9A 2MR6A 3PGKA 3H1PA 4MPDA 4PM4A 5DX0A 2V7VA 1YU9A 1YVDA 3EZGA 3T7TA 2HW8A 1OFVA 3RWBA 3UMBA 4MQ5A 4KHPM 1MXHA 1W8DA 3S1SA 1FVHA 1BFUA 3AUUA 1YR6A 3PQ5A 4L85A 4EBBA 2XZUA 3I39X 1RPAA 2GEUA 5KJCA 5F98A 1XC8A 4MGIE 1H1DA 4J6FA 4JT4A 5CJ2A 2M6RA 1UT5A 4IVNA 1LD3A 1JXAA 2XMZA 3NETA 4ZYUA 4INPA 4JFRA 5E0OA 5FLEX 5DEIA 4QNRA 5JQGA 2FUNB 1EE8A 2OBLA 1KVSA 3UWPA 4F60A 3RBXA 2DHRA 4QICA 3B60A 4K8RB 1E9CA 3S5JA 3F6CA 1SHKA 4FXOA 3CHYA 2QRZA 4A73A 4DFDA 3IBGA 2YXPX 2HC9A 3WL5A 3EF3A 1KFJB 4PZUA 3HMQA 3KUDA 1W93A 4NPAA 1V25A 4MVYA 3R7SA 2UYGA 2ZRKA 2UVDA 4YRAA 2WTUA 4EMBA 1DTSA 1NMSA 1YNSA 3TLCA 3I64A 1DB3A 4TQGA 2B3TA 3BIJA 3SHWA 2WKPA 2P6PA 3QI7A 1VLHA 3SC2A 5BVHA 3LK6A 2O8FA 3UWDA 4TT3A 3DE5X 2DY1A 3GXBA 3EXHC 3IB3A 4LDRA 4RLSA 5ARCA 5FNVF 1PX0A 4JUFA 1KDVA 4HZGA 4KIGA 2SECE 1M0EA 2G40A 2DG2A 2O5VA 1GT91 4A4DA 3AUXA 5CVUA 2A5GA 1WQ4A 3PQ2A 4KPEC 3O0TA 4AS1A 3TEMA 2VJQA 3REQB 1M1NA 3HACA 4BGUA 4GMQA 1OF1A 2F67A 3ZG6A 3HDQA 1LQ2A 2J3LA 3QWIA 3V3KA 2ATIA 1E7MA 1X74A 2QX9A 5ALQA 2FX5A 4UXHA 1GSIA 2OKGA 3NHFA 1WPRA 1FYVA 3THWA 1XZLA 5BRJA 1UC9A 1E4EA 1KJWA 2BI7A 3G1TA 2BIFA 4QBIA 1U0BB 3K0AA 1GGMA 2K2WA 3CZPA 2HBYA 3N0WA 1RMYA 2HHHM 1MTZA 1IY0A 2QGNA 5A71A 1HPLA 3THOA 3B2QA 1R7RA 3EXHB 2X19A 3LHKA 1GFZA 1EP1B 1SCJA 2WVHA 5TGZA 3HB4X 3VH4A 3ZY4A 3HCOA 3EEYA 1ZA1A 3AOEC 3A2NA 2L09A 4DPLA 5FTKA 3UXYA 5B7NA 1BG6A 4CR7A 1PT7A 3JD1A 5DH9A 3NBIA 4XQEA 4C0BA 5ELXA 4RTRA 2JH3A 4V2IA 4IWNA 1G4UR 3MMXA 4PV7A 1NC1A 1SR8A 1WD7A 3OCUA 3OPYA 4C14A 4OFXA 4LECA 1QYVA 1IM8A 2A86A 3LHSA 2WD9A 4NONA 1DAEA 3RRXA 4M7PA 1VE1A 3ZDBA 4FJ0A 1TCVA 2REQB 3M34A 5KTPA 1XDUA 2P9CA 1M8FA 1ZS9A 1Y34E 3U3ZA 4ARIA 3UAXA 4LHZA 9LDTA 1F8XA 1YS7A 2GPYA 4EI2A 3RUPA 2XRZA 2CL0X 2OMKA 2NU9A 3GGDA 2GPSA 2OHOA 2PJDA 4QUBA 5AJZA 3RUDA 4TSKA 4YDSA 2PS0A 1SCBA 4QUHA 2BEUB 1NVVQ 1SB9A 1L4YA 4P4TA 3V48A 1X70A 5EFOA 3T3OA 1WUHS 1NXWA 1P7WA 2C8KA 4GGMX 4PSDA 3HR7A 4H7DA 4IBDA 1VB5A 3TAHA 1K3FA 2G70A 3DKRA 4B7FA 2AK2A 2GM5A 3FHLA 4P82A 3PX3A 3SOPA 2P9GA 1MENA 5FA5A 2JHFA 4H2DA 2D1QA 4MRVA 4ESVA 2YWEA 4KXVA 4CHGA 3KJZA 2WSMA 2QHOB 3WA6A 1R6DA 1ELOA 2GAFA 4B2PA 4F2PA 3QF4B 4B7HA 3RIYA 1TRKA 3IR7A 4RFVA 5EXDA 1T0PA 3G2NA 2NP7A 3K5WA 5JNWA 1KZGB 3NHAA 3X3HA 3AYZB 1AGRA 1PQWA 2NAPA 2G09A 1TMGE 1ZC3A 2JAOA 2RH5A 2OCKA 1EB9A 2PCLA 3DQZA 2Y0QA 1X1QA 4NMMA 4L5AA 4QWWA 5F2NA 3AIIA 2R1ZA 1BX0A 3M4YA 1FYWA 4TQUS 4MR7A 4ANRA 1SIWA 3IKLA 3T54A 3ZIDA 4RQAA 4MS4A 4PR0A 2OY0A 2NACA 3VI3B 4JP1A 9LDBA 3ANMA 2XTNA 3K71B 1Q19A 2ZPTX 3UF0A 4BNDB 3P5BA 1M2GA 2H5IA 5H8WA 3H87A 2CVFA 4PLVA 3R3SA 4ZXPA 2SKEA 3TKYA 2QPAA 2WLSA 4G26A 1A8PA 1F60A 1LLUA 3NVKI 1LTKA 3DXXA 1BFKA 3MS7A 2Q2QA 4JCOA 2JJ1D 1BWPA 2YYYA 3D3KA 3DGEC 5B57C 1AV6A 3GUYA 2PEZA 4NR0A 1DTEA 5EJ2A 4HVAA 3ZLTA 3K09A 3WX0A 4U6SA 3SKYA 2R6HA 4CM7A 1LF5A 1MQ8B 5A5FA 3SSNA 2FR8A 3K6SA 1YONA 1WU7A 1YCHA 2H06A 2AEFA 2J45A 3R24A 4GS5A 4YRJA 4KR7A 4E2YA 5EMNA 4XDYA 1H4VB 1QIHA 1UINA 4OJMX 1X87A 4ZJZA 3KDPA 2AC4A 5L4LA 5T64A 3FTDA 3CWZA 3ESZA 2VF2A 1IH8A 3QE0A 1UP4A 5EZYB 1WIVA 1Z6PA 1XZNA 1S2LA 2HTEA 3KBOA 4AF6A 1YQTA 4HUQB 1NKTA 5REQB 2BM8A 3GLHA 4M8LA 2NZYA 5B7GA 2JGJA 1IVYA 4U0JA 4AMBA 2RBKA 3ADOA 5J5CA 2YHBA 4UAGA 4PAQA 3HL4A 4IDGA 5HILA 3IH5A 3KYCA 3TNFA 4H7KA 2HDHA 1J21A 2E5WA 4Y6SA 1K63A 2WICA 1E2BA 4GQAA 5CT6A 2C9CA 1R6TA 3KXIA 4JYAB 2HWXA 3CA8A 4GUAA 2IOQA 1KGDA 2JVIA 3A3NA 3DW1X 1ZIYA 4NIMA 4S0ZA 4R2KA 2XMCA 3FMPB 5TY0A 4EUHA 3DEHA 1HT0A 2QE6A 4M1YA 5DLEA 4JBHA 5BWLA 1DARA 2UXDM 2OZLB 2VNAA 3Q6IA 1IK6A 2RHJA 1DG9A 4JV5M 3NW9A 4QOGA 3S29A 4F3YA 1QB8A 1QG6A 4H17A 3WGNA 3SWWA 1J5PA 1NVBA 1H23A 1O6CA 3NP7A 4PSVA 1IPEA 1P7CA 2OM2A 4YC7A 4PINA 1XVAA 2W22A 4C4PA 3QJ5A 2JL1A 3PU6A 2NUPA 4IBOA 3K9NA 4POAA 5BPVA 1GLGA 5CNIA 2W6ID 4I36A 1TQ8A 4ZCPA 5KNBA 1D9ZA 3GLTA 3Q4GA 3PR1A 2HO5A 4DC9A 1JAZA 2SCUA 3DE0X 1UQRA 1HNZM 1RXSA 2P1RA 1RWMA 3WZ2A 3DVSX 3P52A 3MBOA 3LUBA 3M0EA 1PRYA 3WDMA 5DNCA 2O20A 1RAAA 4IH4A 2F43A 2EZ4A 3EPHA 1HBJA 3BF7A 3C6QA 4PW0A 4R2IA 4CL0A 1FX0B 1Q0HA 2XDQA 2FY8A 3GV0A 4KFRA 1XZFA 3EPRA 2HKIA 3G1WA 5ALPA 1CK4A 5JVDF 4Y6PA 1E6EA 1NI5A 1KYZA 1KMHA 1YBMA 3K9CA 1GVNA 1JG1A 2BFFA 2GBCA 3E1SA 1CP3A 3RYTC 4UVGA 3FYCA 3H5TA 4L08A 5EA2A 1K3TA 1K2VN 3DKKA 4X8HA 3OTIA 2R7KA 3JARA 3KELA 5C1PA 5KVVA 4GBMA 2ZJ4A 2WAMA 4O6VA 1CUBA 3CCCA 4H3HB 1UC8A 5HE9A 3EH1A 4FD2A 1KJJA 3EGOA 2I55A 5EMJA 1VG9B 1PR2A 4F1IA 1XK6A 2I2XB 4Z1MA 3UWMA 3QXGA 3J81S 4G5QA 3U2QA 2XQKA 1IJBA 1G2PA 4HJXA 1FDUA 3C3YA 1U2GC 2R1UA 3HJTA 3OY2A 5KTRA 1OT3A 1DIBA 1N3BA 2IPXA 2GEBA 1TT7A 4OJNA 4CMEA 2HREA 3ER9A 3LC0A 2XI4A 1D6SA 1EAYA 3WNZA 2CUNA 2G04A 1Q39A 4LCJA 2GCOB 5IDYA 3IG5A 4LQLA 1LK7A 4RTNA 3MA0A 2CFCA 3TMAA 4F2HA 4LK3A 4IGEA 2EATA 2QM3A 4RKRA 2ZUFA 4CN9A 2NNWB 2X1MA 1P4SA 5JD3A 5AVOA 4DLZA 1JSRA 1O5OA 1Y7LA 2FWIA 2V7BA 3DV2A 3PKIA 4MQFA 4QEZA 5BV7A 3DBHB 1DDOA 5HIIA 5J2UA 3P4YA 1FYFA 1MAAA 3GRFA 2AYXA 1Q77A 2JI7A 2ZBGA 1JE0A 5HOQA 4E13A 5ALFA 5KU1A 1UDCA 1WL8A 2Q2OA 2QRLA 1N3IA 3ELWA 1E6MA 4KC0A 1PK7A 2H54A 2FEKA 3ERCA 4ZQFA 2W2LA 3E15A 3FUTA 2JGLA 4L4SA 2HL6A 4L9AA 1JEQB 1JHPA 1D0MA 4BNZA 1JJVA 3DF9A 3L05A 2LCIA 3TCXB 2NYUA 2O50A 4MRAA 2CF5A 1KC3A 5LP6F 1L4EA 4W5TA 3HJUA 5AJVB 2HCTA 1KE2A 1CEEA 1UZUA 4B3MB 2QEQA 4U8GA 2K7FA 3RK4A 5JYEA 1C3OA 3GPDG 3HG7A 2XUPA 5LQSA 5AHRA 1IN1A 2CKDA 5DTJA 3BWMA 2O2ZA 1EX6A 3FDIA 1RDFA 2IL1A 4LWQA 3MMNA 4I14A 1E7RA 4DR6M 1TGYA 3K6JA 3P9KA 5A3JA 2RGCA 4CTMA 2XTZA 5BNFA 3RPEA 2NPIA 3EXEA 3K9OA 5FH9A 3MJSA 4PRYA 1LWNA 4HYEA 5DIFA 1A88A 3AVQA 1D1SA 1KOFA 3HLTA 5LQJA 1V2HE 3CLHA 1QQAA 4ADSG 2IWHA 4U02A 3UK0A 3QE9Y 2GWRA 4HLQA 1NXXA 4RD4A 4BX8A 2VYVD 1XQVA 4RSHA 1RRGA 3HVUA 1FIUA 1PR0A 3K5IA 1CE8B 3CGGA 3VPXA 2PX2A 3MCTA 2X5OA 1K3WA 2WLTA 4FGWA 4J90A 4EJSB 1IVSA 1JUDA 3OG9A 4G97A 3FRHA 1GKKA 2WF7A 3ELBA 4U3JA 5CT5A 1NXQA 2JAWA 2ODNA 3BRCA 1CQIB 4PBTA 4TRNA 4XPZA 3ZV5A 5HPYB 4QUGA 3T4XA 2ODTX 2R8ZA 4FNAA 5IKEA 1EJ0A 1Y9DA 2RBEA 3CJTA 1PAUA 1IY9A 2A8YA 1IMJA 3UJ3X 1CDEA 4Y1EA 3FAKA 1IXSB 3G5MA 3CRVA 4D2IA 4XFKA 1EP3B 1Z5ZA 2GRAA 3FH0A 2PSDA 4OOFA 1AHIA 4EL0A 3IQZA 3TLGB 4WBNB 2JUJA 4GPBA 1TQHA 4ZVMA 1U8ZA 4YHHM 5CGZA 5K6AC 5BURA 2H3HA 2J33A 3O1JC 3KZOA 1VL1A 3K0HA 3KOUA 3R3VA 1L5LA 5JSFA 3I6IA 5E9JA 2B4KA 4I50F 5F4BA 2JFFA 3PC7A 1F2TA 2C4KA 1WF6A 3ZZUA 4PSAA 2XD4A 3FMFA 1ZX1A 3SYNA 3V1LA 1USKA 2AX3A 2FW6A 4GBED 4N5HX 4MHOA 5EJGA 2JFNA 2PMFA 4S1TA 5LDHA 3QZUA 4R7ZA 1FU8A 3GLGA 3EBOA 3MG9A 5JAHA 4L2IA 5J23A 3A27A 3HGMA 3ILVA 5G3ZA 1OBVA 4E30A 2I2AA 2OO9A 1ID1A 1TU4A 1S6YA 2B30A 1EVKA 2JCXA 2ZYTX 3M6UA 1XELA 3DZFA 4NOMA 1WY7A 4NV3A 1FOEB 1KDYA 2QN2A 1WAMA 3VZRA 3KYDB 3HB7A 3R5KA 1Y6GA 5H1YA 3MTQA 3A3PA 1C9KA 3OE5A 1W5TA 1IRXA 1QR6A 2FEMA 4M1KA 1GT6A 3WP0A 5L6LB 2WEKA 4QGBA 1QZEA 1N2CB 3I92A 1OH5A 2UU9B 4HV4A 5A0TA 3DZDA 3HSYA 3WJ2A 2GCGA 4HFRA 5JAIA 4X1YA 4AJKA 1QQ5A 4JEMA 4NHOA 3EEOA 4P4UA 3EUEA 3KT6A 1JH8A 3DEJA 3H4MA 2PK3A 1EX9A 3A1CA 2EGGA 5CHYA 4DV5B 3WLMA 3C7TA 1FTQA 1WMSA 3D6JA 3UENA 1JR2A 1GUDA 5L7TA 3DA1A 2H7VA 3L1HA 2AJDA 1GG5A 1LLDA 2Z9BA 4UU8A 1ODKA 3PWSA 4RPLA 5LDGA 1WABA 2GT1A 2FNAA 1QUTA 1XRJA 1XQXA 2R4TA 3EVTA 3R5FA 1YT5A 2MYPA 2A33A 4Q1EA 4IXNA 4WACA 4ZVKA 4AMGA 1I7PA 4Q37A 4UOEA 2ERCA 4NG5A 4O4HF 2HCBA 1MGOA 1XTIA 3HJBA 4JQYA 3SLKA 1Z22A 5IZCC 1PVDA 1WOMA 4WESA 1LLFA 1LDBA 1HRKA 2YRFA 2Z56A 1XPJA 3Q7SA 3C2QA 1Y42X 4OJYA 3DDWA 3Q0TA 5AJYA 1K4MA 1J1UA 1AUQA 2FS1A 4BXOB 1ORIA 2GZHA 3QYEA 4GXNA 4MKIA 3MB5A 3ZYZA 4YT4A 1R0YA 4JB3A 2O2JA 3C7DB 5HXAA 1QVZA 2BZSA 3HV2A 4GZ6A 4X94A 3NFRA 2JGDB 1ZRSA 4HWTA 4C7VA 3LECA 3B1JA 2NNLD 4O4IA 1Z2EA 3RT9A 1FYEA 2B99A 2W6NA 3KVNA 3MCZA 1P1CA 2Q1TA 4ODIA 4HOYA 1MJHA 4XK8F 3NWBA 4UKDA 2GHRA 5AI9A 2ZS8A 4TGLA 2DZDA 4ITVA 2IVZA 2OUKA 3NUGA 4N03A 1SIBE 5EP3A 3TW6A 5A5VA 5CDFE 4D80A 3OY7A 3PQFA 1WX1A 4DUYM 4NMWA 3UY4A 1J00A 2C00A 2HD4A 2G82A 3DAPA 1RYHA 2CNDA 4G63A 2C96A 2YVQA 4C78A 4HQFA 3O03A 4KPGA 3DMTA 5K1ZA 5K3AA 2KBEA 2QZPA 2IHZA 5H80A 2RJNA 4I55A 3LO8A 4QODA 5K3OA 5AVVA 1FJXA 1NN1A 5ESRA 2VZ0A 2EDAA 3GOQA 3L1IA 3ZNOA 2X8LA 5CPFA 3MWEA 4LHXA 1EJBA 3TQCA 1DBPA 3HU1A 1QWSA 3A05A 5KNLA 3ADPA 2FPPB 4LOLA 1OB2A 5EKDA 1TEZA 4PVCA 3WO0A 1WQ1R 1MOSA 1EFUA 2ZSJA 2JGDA 3U48A 1RKQA 1U0JA 4QDKA 1V92A 2KRKA 4Q12A 2XLJA 1XP8A 4MR9A 4YALA 2PN1A 3C5HA 3CUEF 1I4TD 4CMIB 1TADA 3SU8A 3D3NA 4KRGA 3H2SA 3WLFA 4AJNA 4EGFA 1PDWA 4J0JA 5EMHA 1N34B 3UGKA 4LF7B 4CISA 5B4VA 3NTUA 4ETWA 2ZCVA 2HA3A 1V3QE 1N7GA 3QE3A 5JBQA 5JZOA 3W3AA 4DIFA 3IT0A 3ZQKA 2MYNA 5BV8A 4H1WA 1ZWKA 3NMUF 5F1KA 2R5FA 4P2GA 1Z4LA 4MYCA 4ZTZB 3BXEA 1UBNA 5TEVA 4MEBA 3T9EA 2WJZB 4WZBB 2GB4A 1C4KA 3F6YA 4X97A 2GCNA 4QTYA 3HBNA 5L8RF 3WFZA 4NESA 3BFXA 3F96A 4DCMA 1B16A 4Q4JB 1KI4A 4ZCQA 1UFQA 3X1XA 1D0KA 2VHWA 2MOKA 2RSLA 3SHFA 2YHIA 4O59O 4EJ2A 1XC7A 2RHDA 1Z0JA 1DQSA 1X0VA 4XKJA 5AHXA 1Q0ZA 5J59A 1QQTA 1YO6A 3VKWA 1YHYA 3VJMA 4BRZA 1NQXA 1TUIA 4C43A 3BDAA 5M04A 5CLJA 1P2SA 4CF3A 3H97A 4NK4A 3BSYA 1VL6A 3FGNA 3HVHA 4WXHA 2BMVA 4OMUA 4DUZB 1DMRA 1T35A 2R5NA 1P0PA 4OUKX 5K3FA 4B3GA 4ZAWA 3AEQA 2I2WA 5J3JA 4BQOA 1UJCA 3O93A 3TE6A 3ZD6A 4MRSA 5F9HA 1QDUA 4CCYB 5IDWA 2PL9A 2WAXA 4M0CA 4DYDA 1JPVA 5M29A 2RHBA 3QTLA 1M5TA 4XB1A 3H4VA 3RVKA 3BD6A 3L4BA 4RY2A 1NJ6A 3I0MA 1CF2O 3QXXA 2EYUA 5E4TA 4B4UA 4QHSA 3TR6A 1N6RA 1AUAA 5B5SA 2AOTB 3WO1A 2XE7A 5FORA 5HKOA 1YFJA 1SKAA 2HBQA 1WV0A 1NG9A 2CDCA 2YUIA 4UU7A 4EJMA 2HHHB 4B40A 3QVLA 4E07A 2FG7C 5DYNA 4YR7A 1J39A 1CETA 2AG8A 1YQGA 5FCDA 5LQRA 2PR7A 1KPHA 4OQNA 3WWDA 4CT4B 5FJIA 2GLUA 1TAHA 4E2FA 1BCSB 1YGPA 4XD7A 3JQGA 3NATA 1WSAA 3VFDA 1FP2A 1D03A 3JR5A 5JZBA 5EIEA 1CJCA 2NG1A 4WOPA 3TQTA 1YR9A 3MJTA 3LHFA 4Q7QA 3VYRB 4HNTA 3EIHA 3QUAA 4YLYA 4JL6A 3FYDA 2Q9BA 3JQBC 4DWJA 3W9BA 1ZMBA 3CRNA 4HT3B 1PUJA 4DJ5X 6CHYA 2VDMB 4FWTA 3K2QA 1ZH4A 1ECFA 1F9EA 3RC7A 1AQLA 5JANA 1EVEA 4TTPA 1SVIA 3FYSA 2WJAA 2Q5OA 1U9IC 3OEYA 3I4VA 4QPDA 2WHYA 5H81A 1ZN7A 5EWLA 1EIZA 3ITNA 5JI2E 3P5SA 4H7FA 2C9MA 2VKTA 4OI2A 4WIAA 4BE7B 2JLUA 3IR5A 1IHXA 3H17A 3W68A 3DOJA 4P7KA 1MDBA 2P8SA 3MS4A 4FPXA 4UTRA 3SVTA 3TAXA 3AR6A 3A1NA 4IBCA 4R7GA 4LVNA 1CERA 1ZD3A 1EDZA 3L9WA 2P75A 4C6RA 4O5OA 3MJRA 3WC4A 1V4BA 4MGHA 3RHZA 2YWCA 3RS9A 1MRZA 2YQZA 1NXPA 3G7SA 3A2LA 4ND5A 4M3NA 4DR1B 1SOVA 4C05A 4NEGA 2YXLA 4R8KA 1A96A 2ZJOA 4D6PA 3CUKA 3M8KA 1N5IA 3OFSA 2CHUA 3TOCA 2AK3A 1N25A 3H4IA 3E9RA 4L27A 4UMVA 1N2ZA 1QVWA 5TJHA 1SC1A 4O0LA 3ZWBA 5CFQA 1QMPA 1XD2B 4DSZA 3KSXA 2EL9A 4AF8A 3ZCUA 3ZYCA 4FN5A 5EHGA 4CEHB 4Z1OA 1J7JA 2GBGA 4YRTA 3SG0A 3RRJA 3MW8A 3ZUPA 3EG5A 4ANFA 2MTBA 1IB0A 1DEOA 4UUQA 4DY6A 4LFAM 2CW5A 2QG6A 2E7ZA 2NO1A 1ESMA 2QY9A 3U60A 3T1NA 2XV1A 1VGRA 5EQDA 1I0ZA 4HEJA 3GL9A 3NNDA 3L06A 1RPZA 3KJIA 4IHJF 1GPNA 2FHPA 1XB2B 4MH0E 1G20E 2FJ0A 4ZCRA 1OXXK 3SQWA 1TMOA 1ANKA 2GSDA 2QG4A 4QFCA 3VQTA 1LPOA 1E61A 3NDPA 5TB5A 3P19A 4AUMA 1GNRA 1QG0A 3GFVA 1TDHA 2HQOA 4FXPA 1MJNA 2JJQA 5TGTA 1KKLA 4MW5A 1NW5A 2OYRA 4M0FA 3B3QA 2FMXA 1F2TB 3OT1B 4RADA 1X1CA 2GYUA 3IJRA 4N8DA 2C31A 3SXJA 1XJWA 3CLRD 1GGKA 1D7OA 3AY0A 1SBZA 3CVYA 3O4VA 1W5EA 2E89A 1D3AA 3ETNA 4FI3F 2JFUA 5LQKA 2WIJA 3MHPA 4RF1A 4R9VA 3TZBA 3VR0A 1OAAA 4DMKA 1XTQA 5AUOB 3LSYA 1NTRA 3O95A 1JWBB 5L3QB 1A0OA 4NBLA 2O2IA 2ATEA 2WYUA 3E18A 2ZJYA 3GJTA 4X6LA 4XEUA 5DN6A 5BSEA 3TW0A 1C4XA 2OXIA 3K9WA 3WV4A 4EFDA 1SOUA 3PLNA 4FCWA 4M49A 4O1HA 1WHCA 4ZU3A 3UAZA 4O4LF 2DYKA 3L02A 4K40A 3ZWQA 2HMTA 1NJFA 3HFSA 2BBOA 2R4QA 1P4GA 1R88A 1TPYA 4MVJF 2XKJE 3NT4A 2VRCA 3KKOA 4FGKA 3C5WP 4NRDA 4O1MA 4P4SA 2J46A 3PDUA 1A7KA 4YJGA 1QRTA 4HS4A 1CDOA 3BORA 1WPGA 1DKRA 3HVKA 4I9HA 1FNSA 4AY4A 4J4TA 1I7SB 5JSKA 3IBYA 5DRYA 1C7QA 1CRWG 3ISTA 2VBIA 3N8DA 4KHZA 2YVAA 3M49A 1UANA 4BVGA 2HF2A 5IF3A 2Q8QA 2L82A 4MS3A 2RKBA 5COAA 1BD4A 1Z37A 2CB0A 3CRW1 3JD2A 3Q2OA 4WQMA 5F7ZA 2XB2A 3UMYA 1ZVJA 2XH8A 3FY4A 1D0VA 1T1EA 1IJEA 1BVYF 3MVEA 4DPMA 3DEKA 3V7WA 1ENZA 1PEYA 3AVPA 8CATA 4OB8A 1YZNA 2ACVA 2WUWE 5ALLA 2CWBA 1YVRA 1CY6A 2BV3A 4NH0A 3UA3A 4MVXA 4X41A 1IBMM 5KWIA 5AI4A 5IWAB 1IUNA 1CX9B 1NUUA 2ZIXB 4FC7A 1K5PA 2IF0A 4DQKA 4MUNA 3OIGA 4L0MA 4RQUA 2A9PA 3EVEA 5FBRB 4XTRA 4OL0A 1W87A 1ZUNA 4BVHA 2ZRFA 3H7IA 5E6UB 5TRTA 4BL5A 1RU3A 3V8NA 1V71A 3AFNA 4Q1CA 1EX7A 1SNYA 2AC2A 3K8OE 1H0SA 1D5WA 2VK2A 2H1WA 3P20A 5ERGB 4BTLA 3IP7A 3GNSA 1KZ7B 2O7SA 4QYTA 1Z5UA 4PDGA 4MUJA 2K47A 1XD2A 1NF2A 4ZVVA 2BKLA 4Z2YA 4IHKA 1G71A 4KN9S 2YUTA 5BSFA 5DXJA 1RYBA 3L4BC 1SZPA 3LA8A 2QRKA 2LBPA 3NNNA 2DWQA 4DM3A 5B6IA 1RZRA 1HYGA 1KFKB 5BY2A 5JNLA 4JLPA 1NF3A 5EJAA 1IXKA 1ML3A 1D09A 1AN9A 2W6MA 2H4WA 4INJA 5J5VA 3AW8A 1ZSVA 3L0CA 2H1SA 5BWBA 3NHZA 4HQKA 3TL3A 2OOBA 3GVHA 4HKTA 1LDEA 3TIIA 3I5AA 1RM5A 4RVDA 4G0OA 3B51X 5AW7A 2IS2A 4RHXA 4LRYA 5CCEA 1SQFA 1HDGO 3KT0A 3KSJA 2YFKA 2ICAA 2I5PO 1HDIA 2OV2A 1KZ4A 3DDUA 3HXPA 3DB1A 3NDIA 4FFRA 2E5LM 4IJKA 3T06B 1E0JA 2ZSIA 3J27B 1KYQA 4IL5A 4B7XA 4BLUA 4D0NA 1ILEA 2EW8A 1GPWB 1E6LA 4PCUA 4PZZA 5AWFC 4ZD6A 5CCBA 4IS3A 4E5UA 3TZCA 1J70A 1K5GA 2ONKA 4FMCB 2OBMA 2ZM6M 1N6KA 2EFGA 2II6A 4L22A 3Q7TA 4GP9A 4EY6A 4ZOEA 2FMTA 4YAFA 1H2EA 3WGQA 4S2UA 1U2RA 4J7UA 1GUYA 3AWDA 2UXDB 4NJMB 1AGYA 1EFVA 2AD1A 1ZGBA 3I6ZA 3ZHUA 1C1HA 1RJ9A 4Y9UA 3VH1A 2FE8A 4JV5B 2G5PA 5JATA 5J4YA 1DRUA 5MFPA 1L7AA 4YUWA 1JR3E 4YRRA 5FEMA 4UN2B 4D56A 2Q21A 3ICCA 1KSGA 3JQPA 1CS0B 3HY6A 2YIMA 4Q1BA 5HS6A 3TTVA 4DLUA 4O0MA 5A4MS 3GT3A 1Y1TA 2JLVA 1T34A 1G7TA 5KQLA 2Q4BA 1PVVA 1YZQA 2JLCA 5E26A 2O06A 3KZ1E 4G1VA 4ZAVA 2XXAA 2G83A 4NDAA 4MUXA 3FRIA 4KPFC 3ORQA 2YBEA 1GZ7A 2ATCA 3F71A 4ZVTA 2HBZA 3P9SA 5KYWB 1T0BA 3BRQA 5A2QS 4NCKA 3PEUA 1R16A 3NUZA 1U5BA 5FWAA 3BRSA 5L51A 2JDID 4ZOLA 1KK3A 1VIYA 4LZJA 5EFZA 4INZA 4O08A 4XWGA 3TSZA 2X2FA 2IK8A 3TVDA 4CG3A 4DV2M 4KXNA 4JJ8A 3PEEA 4E4YA 4HX2A 1DWQA 3MTEA 1URPA 2Y1FA 1MHPA 1R6XA 2B8JA 1GDHA 1XIVA 4Y9DA 4Z4CA 1A9QA 1F4PA 4HH1A 3CM0A 3KC2A 1B2RA 2QN7A 4WSOA 4NWIA 4P84A 3LUKA 1L5NA 2TYSB 4MUFA 4O4JF 2LBCA 1NNSA 1EJ2A 2OLJA 3TTXA 3N8KA 1N0IA 3BB1A 3L0OA 3Q2IA 5D6NA 3NDJA 4CKCB 4RA6A 1Z8NA 3BRWD 3TE7A 1U9JA 3BEOA 3MXOA 4LZNA 4DC0A 4DDTA 1EFDN 2VJDA 5CA0A 3BXXA 3Q87B 4XXHA 3V8PA 4GP6A 2IVFA 2GEFA 4EDHA 2G5CA 2WIAA 3HDYA 4F2WA 1AS0A 2WHPB 1Z34A 4EYEA 2R6CA 4RY8A 2WF8A 2R9VA 1PZHA 1ZYUA 1VPDA 1K5DA 2PS1A 2G80A 3M4ZA 4HDRA 2H48A 1JRLA 3IVRA 4CM4B 2BMJA 2DQYA 3A1EA 1JEAA 1P2FA 2ZDQA 3GRVA 4U0KA 2CDNA 4RH3A 1XEXA 5DOVA 3IC5A 4N7RA 1G5QA 1E9EA 3MPUA 1CZLA 1EG2A 1X7GA 2W6ZA 6AT1A 3EPLA 2ZIWB 3OM1A 3HA2A 4MP3A 2NVUB 3FLBA 2ZTHA 4DSAA 1EUDB 3IS3A 4WOKA 1WY5A 2ISCA 1NXTA 3ZE0B 3G0GA 1VKHA 1ZJYA 2B94A 221PA 3I5MA 3NEJA 1UZLA 3OFJA 4L8VA 4DIDA 4YUAA 1M7BA 4KN8A 3FR7A 3LT1A 5E1DA 5AK0A 3W8FA 3NWLA 4B31A 3L82B 1KR5A 2KHHA 2FPOA 5CXSA 4BO3A 4ZCIA 3Q3GE 4R1LA 1M2KA 3QENA 1ULTA 1TM3E 2P40A 1EFPB 3B6MA 3DLIA 1C80A 3THYB 3QNMA 2MSKA 1NRXA 1CUXA 3TINA 5FFNA 1BXGB 2V0NA 3KZMA 3OF3A 4M1OA 4R2MA 3QWLA 3GBPA 4UDNA 4XD2A 4DSUA 3IUSA 2P3QA 1AURA 3DEAA 1TVKA 5TC4A 4C4ZA 4OKNA 3QITA 4FNOA 5K2MA 3VR1A 3AQIA 3B6KA 4TVOA 2C3MA 3U6LA 1EVQA 3UCFA 2W2TA 3LLVA 4I55F 4AK9A 2FSHA 3MGBA 3C3EA 4MQ6A 1L5VA 1KZYC 3U62A 3VU9A 2PT7A 2H1FA 2CLFB 3S8YA 4QDUA 2VEOA 3VU0A 3RV4A 2CE7A 1F0PA 1CZUA 5IVPA 3DBLB 3I6MA 4ZOLF 4D4JA 2PE5A 3NEYA 4RFSA 2V1UA 1IUPA 1QYWA 2YMLA 3B38A 4IDPA 4WKOA 2FVXA 1PKXA 1M7GA 4FYHA 3CO0S 3FNIA 4C7XA 5AVZA 1K7EB 3STHA 2WTXA 5JCPA 4JGGA 4TLAA 1G8MA 3HUDA 1ZVQA 4LKOA 3B2NA 1L5RA 2W82A 3QBEA 2YXDA 2PKYX 3EWAA 4Q3BA 3OCJA 4EB6A 1VP9A 2C03A 3NDRA 1HG1A 3TRFA 5KYYB 4NH4A 2B1QA 2H07A 3HSSA 1SXGA 2HPHA 2AN1A 4IMRA 4AWXA 2NTJA 3I32A 3KKPA 5KUTA 1Y4DE 2AFIA 2O3JA 1QP7A 3PC2A 3PNSA 3W79A 5HR5A 5FTWA 1OT5A 2IIPA 3AJ8A 1FQJA 2PV0A 4DMCA 4UQLA 4PFQA 2XYPA 1WPXA 2FMUA 4MWEA 2J3EA 4PHCA 3OJLA 3S0JA 4M7WA 1FXWF 3M9LA 2YWRA 3SZGA 1NKVA 2Q2EB 2P91A 1SCQA 2WJHA 4H3SA 4QAQA 4RO0A 2PV7A 1UADA 3OZWA 1UOEA 3OJWA 4R3NA 4U7GA 4ZAFA 4B4DA 3VR2A 1XNGA 1NSTA 4MMYB 4N47A 4BNYA 5JARA 3GPIA 5FPQA 4EUFA 4JXZA 1K6EA 4B7ZA 5C4IA 4H9GA 3AKYA 2YV3A 3EZ9A 3H16A 1I1NA 4LA4A 1Y98A 2CDBA 4PYNA 1VYHA 2I71A 3TIXB 2IYPA 1C0IA 1HRDA 3OI7A 1NNJA 3ABIA 3HCWA 3C1AA 5E0KB 2R11A 1HURA 4WLUA 4Q05A 2DR2A 3L2AA 3L7YA 1T5TA 2K9DA 2JFPA 3QYFA 3RUCA 1KPGA 4AZ3A 5LP6B 2B9VA 2HA5A 1LFAA 1N2CA 5DISB 2P35A 1I1OA 3R9IA 3RWOA 3UW3A 4ARSA 2VSNA 3BXWA 1S2MA 2IUSA 2B6HA 1JAXA 2WZBA 3QJGA 4Q39A 3E7XA 4RJJA 4WCFB 1R9GA 2H0QA 5EGSA 5TARA 3VHXA 3ZX4A 1XMOB 4KOEC 1UDRA 1E4OA 3D6TB 1U7UA 1M2HA 1CJUC 3NV9A 4HGYA 2DFTA 3TW8B 3FI9A 4CMHA 4LXUA 4AMYA 3KJGA 5KI6A 3ZD8A 3BWXA 1W7AA 3OIVA 4QOJA 3H05A 1T5HX 1YRLA 3FZEA 4X1KB 3ZXYA 4ERNA 1QJCA 4HAXA 1ZA2A 2HCFA 3A4IA 4K6KA 2HQRA 1BKYA 2ZSUA 4KBFA 4LXYA 4UEWA 2Y93A 4Y2HA 2VHYA 1QR2A 1VIVA 3OIWA 1OE0A 1QTQA 2F8SA 1J8MF 2H17A 2Y0DA 2GF0A 1I24A 1NVWQ 5HQTA 4YJHA 2EUCA 1F4LA 1CZRA 3H7AA 3NEAA 1MX3A 1KEVA 1BROA 1AZWA 3G8DA 2NW6A 4B87A 5AIAA 5CFMA 2J5YA 1E2FA 4AJ4A 2ZWOA 1Q1GA 1B8NA 1FNNA 3P0FA 3AB3A 7CATA 3PG5A 5JXWA 1RBYA 4JBWA 3DFUA 5HDBB 3RIGA 1E5VA 2VUHB 2XMPA 4UJ5A 4ALKA 4Z3DA 4NVRA 4PXSA 4P3PA 2WWWA 5E4YA 5E1MA 1JIXA 1E9SA 1R4AA 2FG5A 3CMMA 3M1YA 4GGPA 4S1PA 3VVCA 5A4FS 1JBKA 3IB6A 5JZMA 3OFKA 4DJJA 4JX9A 2DAIA 3H6HA 3KYBA 5CXUA 2A67A 3E8XA 3BOSA 5JWRA 3BSFA 3OCXA 1CWUA 2XMBA 4FM9A 3QKTA 3ON5A 3IQIX 4RF0A 1CIVA 1ABEA 1VLVA 2OHIA 1I2BA 1OLOA 1X38A 1SXIA 2P9JA 3FX2A 1P7ZA 1X7XB 2PUTA 3QXJA 4N0PA 5GVRA 5GPBA 4E11A 3KOZA 3U7HB 4OO3A 5I7WA 3B1YA 2MSLA 3PHJA 4UUNA 4C1NA 4BO2A 4U2BA 1JA0A 2UUBM 1I1QB 2I0FA 3K1YA 4LMAA 4BIMA 2IYNA 5EJ7A 1YZTA 1YBAA 4FR2A 5J1SB 4R8MA 3SHTA 4GPZA 1B76A 3RSFA 3CX3A 3GC6A 4FDVA 1KFVA 2OO3A 4HLQB 4QDZA 5CM9C 5EY5B 2D54A 3G0OA 1CNMA 3QLVA 2RBGA 4BP8A 3RANA 5JSYA 3VX3A 2I7NA 2AI3A 1UPBA 4AG6A 4HQ6A 3FCSB 3M4NA 1VMIA 5A0VA 2D7JA 3I9KA 3KEGA 1E5QA 3E9YA 3QBVA 3VTKA 3X1JA 1G2QA 2KDLA 1HL3A 2NXWA 4OM7A 3R7WB 1EUCB 4RTQA 3UAOA 4EMUA 2X2PA 4CU2A 3GZJA 2IHNA 1N8KA 3A14A 3U7IA 1CJKC 2D4AA 3AHHA 2H57A 5JV5A 1AY0A 4KFTA 1CRLA 1GTZA 3DHNA 3TK1A 4H7PA 3T7DA 3FGZA 2QTVA 1VMDA 2FB9A 3LOUA 2LHGA 3SVLA 4KMOA 5KAPA 1GL6A 1KBQA 3UHPA 2PG3A 4G5XA 1AUOA 2BRUA 1OPXA 1YZYA 3F7OA 5E1OA 4QM7A 3ICQB 2FEAA 3IVMA 1YFZA 3VNUA 2L0XA 2RH8A 4DCCA 1H1TA 1KBZA 3KQPA 5ICCA 4I6EA 2XD9A 4PHGA 1HE3A 1OLXA 4CT5A 5I4KA 1Y82A 1KOJA 1YJXA 4GYYA 2FN3A 3ZC3A 3NOOA 2EP8A 2W0MA 1QPGA 2QUIA 2YHIB 1O0BA 5DI9A 3ABRB 2NZWA 1BCSA 1X92A 5ITUA 2NV2B 3OLVA 5IG2A 1DRVA 4OHUA 4HH0A 1Q1QA 3JAMA 3STWA 1VKZA 4LYHA 4CLOA 3IA2A 2YW9A 4PLZA 3OF2A 3V7NA 4RIGA 2AXPA 1XI2A 2OT3B 3FYTA 1TGUA 3WBJA 2B2NA 4FN4A 3RS0A 1E60A 1Y7HA 3KJXA 1Z56C 2VEDA 3OE7D 1ZIDA 2QTMA 3VBCA 3N87A 1OA0A 3ZEAA 5G4KA 1DJPA 3JCZA 3KEQA 1NKSA 1RXIA 4LJAA 1JKJB 2UVQA 3P2OA 3VHLB 4BQRA 4PQYA 2JJ8A 2ZJ8A 4EY5A 3TVTA 2HTFA 4TZKA 2ZI9A 4BVJA 2I9KA 3BXZA 1U8TA 2JFXA 5E2BA 4ABTA 3HRHA 4NYIR 2OG2A 1DC6A 5IK2D 3I8XA 4KUEA 3SX2A 1A3CA 3CX6A 4U2KA 4ZDIA 5KTNA 1JLSA 3ZW9A 2OE2A 5DF1A 1KI2A 4GNRA 1KZ1A 1TK9A 3PF9A 1N36M 3MXTA 4JWTA 4BBAA 4Y1FA 4B71A 3NAGA 2I3ZA 2V74B 3C5EA 3HY5A 1JKFA 3AIMA 5CA1B 3NT2A 2ZZNA 5KJ6A 4A91A 3STUA 4MDYA 5I5GA 2C9OA 1FE8A 4M0DA 2ZYUX 3OBBA 3UA4A 5LMNB 5F9FA 4L8GA 1VJ5A 1RM4A 4JI6M 4HHEA 3T1TA 4WZBA 3H75A 1KQOA 4G4SO 2OZEA 5L6MB 2FUKA 2WDPA 4K7JA 3U4HA 3LBFA 3II6X 1FJGB 5AESA 1T4CA 1DAOA 2XITA 4J94A 4LDAA 1XVTA 4MA5A 5FPYA 5J63A 4TXNA 5BVGB 1Y3AA 4BV2A 3CVOA 2QU7A 3NHUA 3VR5A 1V1RA 4DWVA 2COUA 2PXHA 2C2MA 3UWSA 5E6SA 4LJ6A 3KP0E 1GNTA 1SWVA 3OZXA 3D8LA 1IJFA 3D7NA 5THXA 5CLFA 5FOVA 1SVKA 2XF8A 3AX6A 3SEFA 3HLYA 3LT4A 1NNUA 3ITKA 1PGJA 1Q15A 1V7CA 4O4IB 2XXJA 4G41A 4E94A 3ET4A 2JHAA 2H5XA 3BGVA 5K0CA 2OCAA 1Q3TA 3B7QA 4HBGA 1M6EX 2W8BB 4DS3A 2GZDA 3SBXA 3D4OA 2R3SA 3H99A 3UKOA 3FKQA 3HI6A 1KZHA 2V8BA 3KD3A 1XTJA 3LXMA 4BWGA 4I1OA 3ZE6A 4NV0A 3OKCA 4XUCA 1E9RA 3N8NA 1MA3A 1B8UA 1LZKA 3AKEA 3LNCA 4PLHA 2XCSB 3P32A 4G0XA 3THYA 3BX1A 5FBHA 2VF5X 1WXXA 1D2RA 2YHSA 3KUCA 3TBKA 3VC7A 1UBTS 3LYUA 1QC5A 1HYHA 4GYKA 1I94B 3RD5A 2CLLB 1XJQA 3JYHA 1MVNA 3UM9A 1QYCA 2DT5A 3FYHA 1THMA 1TJYA 2D1SA 3P4XA 1WMAA 1SQGA 4KODA 2BCJQ 4PX5A 5KTTA 2WVAA 3TFOA 1GTRA 1TVEA 4D45A 2XXAB 2VDLB 3H2ZA 2V6IA 4FFLA 4UFOA 2XQJA 4NCNA 3GK3A 3D5EA 4NI5A 4RU1A 1SH7A 4YQZA 3AVVA 1WBJB 3OZSA 3ZHRA 4UC0A 5J1TB 2HEIA 4C3ZA 4RBNA 4HF7A 4KQ1A 2XWJI 2C98A 2ZSBA 5BWCA 4P7FA 1DKPA 1ABFA 1ETHA 2LRHA 2ZCUA 1SOWA 5DM60 1RBQA 3NAMA 1AMOA 1ZCBA 2VJLA 1Z5VA 2CXNA 3NKLA 3OM9A 5ALGA 3RTGA 4QKQA 1TQDA 1VEJA 1M66A 1NX6A 4JJ6A 4RHCA 1TFRA 2EQ5A 4XCVA 1NWCA 3QLEA 1TCUA 5LBTA 3KETA 3BE5A 4OGKA 4FYPA 3PCXA 1Z47A 1B42A 1OTXA 5IJ0B 4ZTUB 4W1SA 5JASA 4JLBA 1ABBA 3F5DA 1EX1A 4JBIA 1C9MA 3B6ZA 4NDZA 1IBKM 1O5IA 3QLTA 4BQSA 3CVXA 2WSEF 1UAGA 2HB6A 2OENG 5AJWA 5I4BA 1WE2A 2QYSA 1KIAA 1RJFA 3ITDA 3QOFA 4ZOBA 3OOWA 1G8KA 4ND4A 3BTOA 3KFVA 2P77A 4HAZA 4KUGA 1WCXA 5GWXA 3B2EA 1MV8A 1XCJA 5EIHA 4YXFA 5K20A 1M6VB 1KY5A 1AC5A 3CTPA 4XIYA 1PDOA 2IZ7A 5BQXA 3INTA 1NATA 3U7FB 3HN7A 2VQFB 2O25A 1ZINA 4TOIA 5HRAA 3G82C 1RBMA 5E6UA 1P7PA 2E1PA 4FKBA 3U0VA 4GYJA 1H6UA 2IX3A 4IDDA 3LQFA 2W6JA 1V7ZA 3WWCA 5BMVF 1M1UA 3C6YA 3H4JA 2C5LA 2WAAA 3PNVA 2BE7A 4JYZA 4M6WA 2WIKA 3QOYA 2V6BA 3L7LA 4M9XA 3WNBA 1QQ7A 2PM8A 5ITVA 3TTSA 5JAMA 3D2CA 1A8SA 5IC5A 3RREA 3WAGA 4X62B 2BJHA 4DNFA 1IATA 4AROA 1SIOA 1N6IA 5H70A 3LPDA 1SBTA 4FJ1A 4KIUA 3AG6A 2EJUA 1Z2AA 1TVCA 3GLFA 5E38A 1PEAA 1RLIA 4O3MA 2C5EA 3PDHA 4X8OA 4A5SA 4P4GA 2ZXUA 1E1NA 1DBWA 2GN4A 1NBIA 5TPZD 4MQBA 2ASEA 1JR4A 4DCGA 4OHVA 2HF9A 3RAJA 1V34A 2IYRA 2H4YA 4D0RA 4FX5A 4LDQA 5ETJA 4BLCA 3R9XB 4LDJA 1ZJZA 1EBFA 1L4HA 2CLIB 1JECA 5FQNA 3TQOA 4QUEA 2K2QB 3QE4A 1M2VA 2AF4C 1TYDE 3L7MA 4RGYA 4D46A 4NBNA 3AV0B 1ZM3A 1MC8A 3GFOA 3RH0A 2ZT7A 1U3WA 2Q5QA 2WM2A 3K96A 1SZJG 4NARA 4J76A 5T6MA 2YNMC 3GGSA 3IAM6 4RMHA 2YJ4A 3HKCA 2FMHA 2JCSA 2X41A 4EP1A 3IVGA 2HHAA 3B85A 4CKEA 1AG9A 4KQHA 3FCCA 3LVFO 3KU1A 2OCXA 3W5HA 4QJ3A 2QDKA 1LDMA 4JI5M 3EQ7A 2BHTA 3IMFA 4K86A 4MR8B 4FGUA 1UMBA 1P6XA 3DFZA 4Q7MB 5BQ3A 2DWCA 3JAWA 3TQHA 2KYRA 3ZZ0A 4EFKA 3WGHA 3TZQA 4LG1A 4B45A 1RTKA 3M6AA 4LTDA 3ZCBB 2J8ZA 3DV0A 3JARB 1R37A 1QUEA 3ICVA 1N2BA 2R7NA 1DGBA 3O92A 4WGFA 4XYBA 4QOIA 5E7JA 5TMEA 2H2HA 1DFHA 5EZYF 5F33A 1FSGA 4E4RA 3GJ0A 1KJ8A 3PQEA 5HM6A 2GNPA 3U61A 4UDXX 4EG7A 3IEXA 3RSZA 3B1WA 2L2DA 3WR5A 5T7BA 2IDZA 1U7OA 3NOQA 1VIDA 3JYLA 3PGXA 4RVUA 4AY6A 1MZVA 3JQDA 5DW0A 3O9VA 1YS9A 1AA9A 3WHLA 1V8FA 2RHRA 2FGKA 4RENA 3QSYA 4G4OA 3DP7A 1GKIA 2CLKB 1EDEA 3L0PA 1NXOA 4NBSA 4KSCA 1KAOA 5TQ0B 3TCKA 4ALNA 1WD5A 1QAOA 2I62A 3OQJA 4TS1A 3ZWOA 4Q9JA 1BMDA 4HAVA 3B7GA 3CXUA 2JIMA 4YY3M 1CQXA 1RNLA 3PNKA 4P3OA 3EARA 5GJCA 5KTKA 4Y2GA 2Q1XA 3I1FA 4CLDA 2HJHA 3RJMA 1CF4A 1WR8A 2APLA 3DZHA 3VYSB 1UBGA 1WKVA 4ICIA 3Q6MA 4JHLA 4YVFA 4ZRNA 4JC5A 3CN7A 1UWCA 4DMFA 3A98B 1PQ4A 3C97A 1CUVA 1ORHA 3GEPA 5DHPA 5T4EA 3KV3O 3VRHA 4AICA 5KPJA 4C4RA 1W4BA 2X3UA 3IPCA 1PK8A 4JUDX 4RH0A 1XL0A 3VZDA 1XHLA 3ZWXA 3CIFA 4LVOA 3PS9A 2JFOA 2HN9A 3K1TA 5FTNA 4RTMA 4A0QA 3L6BA 4KPUA 2VAWA 3M1LA 3N3BC 4BTVA 2B2XA 5HX7A 4TTTS 5CPBA 1Q1AA 4OQPA 4DA6A 5CYGA 5IULC 1BJRE 2QG9A 3U37A 4EA6A 3TZEA 4M0KA 4L9WA 1Q2XA 1M0SA 2OXEA 2XUFA 3MGCA 4HSEA 3EODA 4O25A 3T35A 1TC2A 5JVDB 2G4CA 3JRNA 1EUZA 1DWPA 4G5SA 4Y1RB 1GADO 3LDUA 1GU0A 3D6AA 2J0QA 1O77A 3HLKA 3DMPA 3TPZA 4Q3DA 3ZWNA 3OECA 4DJDC 2DETA 3RKRA 2JIZA 4MRMB 4OYHA 3C9PA 2JD1A 3C8DA 3V76A 4Q01A 4A8JC 1T9BA 2A4KA 1NLZA 2AYYA 1M2OB 2O07A 2Y9MB 2ON6A 3ZTWA 3S5UA 4D9FA 2ZETA 3E9EA 3LT0A 5LBUA 5JDIC 2W70A 1RYZA 1V6CA 1BNCA 2GAOA 4E14A 1D2AA 2IPNA 2VDNB 3C5CA 2G9RA 4MZXA 4BFSA 5KSZA 2LWXA 2IYOA 1VBMA 2VC2B 5CLLA 1HG0A 2QTHA 1JG4A 2J07A 1VE7A 2R2GA 1YS1X 4EQZA 1VL2A 4RL6A 4LFBB 2D7HA 1I51A 3DBVO 2AW5A 4QUIA 3FHCB 2HQ1A 5K0JA 4D96A 1WR1B 5IC6A 1SQ6A 4XASA 2QQFA 5I45A 4TYQA 5BRAA 1GILA 2VJYA 3QAUA 2J9RA 2RI1A 4P34A 1PJSA 5CCDA 4GOND 3LMKA 3U3KA 4DR4B 2EIHA 2DUMA 2X8AA 5TT0A 4UBLA 3EVZA 5JVDA 1TTTA 5EPUA 4UTPA 1EYZA 3K1JA 1GCGA 3EMVA 2R87A 4KO2S 1PX2A 2CVOA 2Q62A 1CY7A 5L53A 3CR8A 1KEZA 1K8XB 3CF6E 3KZKA 2FPSA 2EW2A 1X3LA 3RFVA 5D7NA 2GI4A 1Z7EA 3HNPA 3OD1A 3Q9UA 4HNHA 1FDRA 2DUNA 2ILTA 1KSJA 1WUIS 1GFIA 3O4GA 5AI6A 1ZBDA 1JLLA 1HNWB 2A7XA 4KDFA 3U4DA 4CFSA 3DMRA 4PAWA 1DJNA 5DJ5A 5KVAA 2WJ6A 4J0IA 1ND6A 1IHDA 2ISSD 4JT8A 4K9KA 5AP9A 1B8OA 1UJNA 3AEXA 1USGA 1N1GA 4G8DA 1ZCZA 3RSGA 4DIKA 1G7SA 4ENTA 1QKIA 2YZMA 3RFXA 1A98A 3E1GA 1H6BA 2BFDA 1C9EA 1TTQB 1L9KA 1W581 1ZM9A 2GDJA 2HUPA 2OP0A 3GLFB 1WVMA 4B3RM 2YFQA 3KXEC 1CUCA 1GKYA 2QT1A 4RDIA 4Y9RA 4C5AA 4W4TA 1RQ2A 2EBHX 2NAFA 2JCBA 4E6EA 2PQ2A 5KTSA 2XWSA 4LF5B 1XAHA 5JISA 4XJSA 3WY9A 1WZIA 2F5NA 5FA8A 2O2EA 1R5LA 1JHUA 3PHCA 4TV8B 4DEVA 1PGQA 2G9NA 3WLHA 5BN3B 821PA 4D92A 2QJOA 4Q93A 5HZHA 1JHOA 4A16A 3ZQ6A 1V37A 1W88B 3FLEA 3B8HA 5DW3A 3GRUA 4B8YA 4KWTA 3TUZC 3KLMX 4FK8A 2WYIA 3ROXA 4R40A 1V16A 3G49A 1QGZA 3SEAA 4CM5A 1GGEA 1G0OA 1LS6A 5CA0F 3UMMA 1AZSC 4LXQA 3ZH2A 4Q4AA 1JEEA 2V9CA 2X58A 4CKEB 2Z6VA 2DLNA 2QN3A 4UXJA 2VPIA 5TLSA 1E2UA 4Z9AA 1WDTA 3L0ZA 2BYTA 5HQ3B 5KSYA 1BC5A 3UJAA 3QK7A 3Q72A 2YFHA 2ZRPA 4U5QA 1PZXA 3EZXA 3NRCA 4IVPA 1NSFA 3JYOA 4D3XA 5BOSB 5ER6A 2QAIA 2ZYRA 3KALA 3DTTA 6LDHA 3GFQA 3U09A 4CIWA 5L9AA 1OPRA 2O52A 3EF0A 1NVTA 1P31A 1RWXA 4WEQA 3UQZA 1Z62A 1BN6A 3SAUA 1WIWA 2CDRA 2HXGA 3H2JA 3TQRA 1RTTA 1YZFA 1D9XA 2XCRB 3DZ8A 1GHTA 1HLGA 3LP6A 1JJBA 2QYHA 3S4YA 3GAFA 1QRSA 3MWDB 2HMUA 2CL6X 2JIOA 4II7A 3KKKA 3RUIA 2Q6IA 1GGHA 1YOVB 2ZI3A 2G08A 4JLNA 2CD9A 4WP2A 4YEDA 2HRCA 5MN6A 2EGUA 3UKJA 3N28A 4B3DA 4G23A 2VRBA 3PVSA 3I4LA 4EKIA 1A95A 4LEIA 4WZZA 2R00A 2VTBA 1U99A 2QL9A 1KDPA 2VDWB 2XYGA 3ADCA 1UAAA 5CT4A 4XWAA 1SG0A 3AMVA 2A0UA 4BCCA 4BZXA 4MW4A 3C6ZA 4YAGA 1HTTA 1XNQB 2GTPA 2Q7OE 3CJRA 3K6RA 3DTVB 4UPDA 4XRGA 2OCLA 5C9ZA 3MOIA 2I8AA 4MQMA 3VHQA 4CM8A 4FEEA 4KDCA 2JZOA 1UBEA 4X1KA 3UCXA 4MEJA 4Z7OB 2AMLA 1H2BA 4IP0A 3AO0B 2QLJA 4M8IA 3CF6R 3BQNB 1COZA 3TLMA 1HQDA 3HVIA 3ZX5A 4TYNA 4EO9A 2DAEA 4HNRA 3U6SA 3JVUA 4OQZA 4TSFD 5SYMA 5LOVA 2QBYB 5I7SA 4P17A 3EDRA 4GQBA 4FGZA 1FRQA 1TM5E 1J99A 2DKOA 2BMFA 1DCFA 3L93A 4Y2JA 5EZQA 3GJRA 5EP1A 3QY0A 1J2RA 4IIJB 1ML4A 3ESDA 3IIJA 1XFDA 3IE0A 3R5JA 3U3XA 1I13A 1Y6JA 2BDUA 3ILHA 5TJ9A 1TJ3A 2H29A 3E70C 4W9MC 1U2QA 4Y7DA 4MUBA 4C0QC 2IH4A 4U5XA 3ZDDA 1YXMA 1ZJ5A 2G9QA 3P0HA 4PGMA 3RUHA 3Q98A 5J4KA 4D26A 4KXUA 4V0KA 3RROA 1TJPB 3JQBA 1KK0A 5IC4A 2JK1A 4NNJA 5LXTB 1PBTA 2AN3A 1CUEA 4MGZR 4OMCA 3RFUA 5AK6A 4PT5A 2WSSD 2PSSA 3LXXA 2B4TO 4FWGA 4EUEA 4IBJA 4UU0A 2IXGA 3DD1A 5HIMA 4YFYA 1GVHA 2NUTA 4Z8XA 4CQJA 2VATA 3IQFA 4DG9A 1DC4A 4ALJA 3P26A 3EK2A 1Z2NX 3NYWA 2XT9A 4CM1A 2WT4A 1QNFA 3RYIB 5JSHA 4OLAA 4B46A 1IL0A 3QIVA 4ZGBA 1JIJA 2DERA 4G85A 1L7DA 2FN8A 3WL6A 4UUBA 5EHNA 2P9BA 5T4FA 4F1WA 3REOA 4YV0A 4X1YB 1XJ5A 2Y1EA 1I4LD 4I55B 5TF4A 1B4DA 1TQ6A 3D8SA 3ID6C 1JAHA 1E2EA 3VR6H 1P9LA 1OWMA 4G4IA 1K7CA 1ZMXA 4L6AA 1ONNA 1SD1A 3LP8A 4IDNA 4AKTA 1TJNA 2BFEB 2DHQA 3KXLA 3O75A 1IZYA 1R3UA 2LIVA 1E6WA 1PYOA 1XTTA 3CH6A 3B7ZA 1XD8A 3LQ1A 3PPIA 1IFXA 1J25A 2GHIA 1G8FA 2Z2KA 2DHYA 4W7SA 4E5KA 4Y28F 1F6DA 5AM3A 3RGPA 3KLBA 3PFBA 4OI0A 4OQQA 1Y0BA 4F3NA 1IOZA 3CEJA 4YAOA 2F3PA 3ENKA 1QC5B 1QX3A 5CNKA 2W4IA 2VRWA 4KQJA 3AJAA 1LSUA 1XYVA 3SC2B 4LMRA 2OHGA 3L4SO 3G2IA 1EVIA 3EBPA 4KV7A 3UGQA 5ABPA 5ALIA 4PSKA 1EEXB 2FPGA 4OBBA 4RTLA 3U60B 3GJ8A 3NLLA 2IUUA 4MGIR 4EFNA 3AUFA 1UIRA 3GJ4A 1JDVA 3AGPA 3HCPA 3IAUA 1QP4A 1JEYA 1FP4A 2QQ0A 1NF8A 2VH1A 3I4FA 2E18A 4JQZA 5GV8A 1RIIA 4ZC1A 1Y6FA 2ZIVB 4LVCA 4MA0A 4OLFA 1W94A 1FUUA 1SU8A 4MKZA 1DUVG 4I9FA 2AW3A 3GO4A 3L40A 3NTXA 5K6TA 4Y98A 3DZBA 4QPPA 3SR3A 1YFLA 2D5IA 1R10A 4RXMA 5F2OA 5IKMA 3HB1A 3AIOA 1UKAA 4W7HA 3VOSA 3EFBA 2GZMA 5KYWA 3CLRC 3ECAA 3EOZA 121PA 2BFFB 3L04A 4UOQA 3M3PA 3Q0IA 4AY5A 5J2TA 1KFCB 4JNKA 1ND5A 4AVYA 5LYJF 1G8GA 1PQPA 4L02A 4ZYTA 1SHJA 3F8SA 1NJ2A 1DV2A 1U1DA 1SKUA 1E3QA 2MT9A 5IZCA 4Q4AB 3DLPX 3DDZX 3GDWA 5DEOA 1UKYA 4CF5A 3TJZA 1LI5A 1CSEE 4LV8B 1LBSA 4TLLB 4ZRDA 2G9VA 1IB6A 2MWMA 1QRRA 2GXQA 3JQEA 2VHZA 2AZTA 1NX9A 4R54A 1C30B 2BT4A 1QLWA 2I6GA 1Z7YA 3J7AC 2BFBA 3SM9A 1SXJD 2WYVA 2X4AA 5DV9A 2Q3HA 3ZN2A 4O2LA 2PPLA 4G1CA 4DE5A 2PWBA 3FPHA 1N2HA 3ZWVA 1N77A 1QIKA 3FJ1A 1SUBA 2YC2C 4I5FA 3DD5A 4RDHA 2EA0A 1DWUA 3QVSA 4IGIA 2XKKA 4BJ1A 1W1IA 2H52A 2BP7B 4FW9A 5FJJA 721PA 4HDNA 4HGNA 4AP9A 4R83A 5JSZB 5KDDA 1E1MA 3GA5A 3J81k 3OEWA 1C8LA 3KK0A 4J16A 1IDN1 2KSQA 4K6CA 4N7MA 3WIBA 5HW0A 3VGJA 3ROZA 1A1SA 3W2FA 3QEBZ 2QLBA 4LMPA 2PGDA 1OU4A 2X2OA 1VG8A 3KB8A 4I6GA 3U9SA 3ZQUA 3OURA 1CR0A 1JKJA 3AFIA 4HLUA 3LLUA 4LYEA 4QEDA 4D6YA 2EJSA 4LF7M 2WNSA 3G85A 4EA9A 4QL3A 5HWSA 4CMKA 1NJ1A 2JLXA 3JU3A 1JKXA 2PZJA 4HL6A 2L7HA 1GABA 2YCLA 4LXTA 3VHXB 4DEXA 3HFJA 3JZMA 5G02A 3BIXA 5LLDA 1UOQA 1FFHA 1DUIA 4QTZA 2IBTA 3A6LA 3BMNB 1QFYA 5FULA 3ZLJA 2UUAM 3D2BA 3I2JA 1YK1A 1BRTA 4NY1A 1XCGB 2F5QA 2QTVB 3AGQA 3EW7A 3IDZA 3O31A 3QSGA 4LHWA 3INGA 5K2OA 4GG1A 1KVUA 1DKUA 4RD0A 3QNUA 1DDIA 2OXCA 5DTRA 3ZCQA 1FA9A 1E5TA 2RKWA 3K05A 3GP5A 1QQWA 3AXTA 2PBRA 1W5FA 1UC5B 2BF4A 2I2FA 1DJMA 3F67A 4JYPA 3CTWB 1YRYE 4JSYA 3CFYA 3A9RA 4RGQA 1H2AS 3WDLA 1ZICA 4PLFA 1TC1A 5A5DA 4L72A 4YAWA 5LLSA 3ZCVA 2QXUA 1KWGA 3FVRA 1NY5A 2QZ9A 4QDOA 4ZV9A 4NBWA 1W52X 3VNRA 4L7QA 5JH7B 2GN0A 3M6VA 3NTVA 5JROA 4R6XA 3K9HA 4LZWA 5HCUA 4AZFA 1XVUA 2CJXA 4JA2A 1U5AA 1QJ4A 2VOEA 4G8JA 2GS9A 3GT7A 4LW8A 5C3MA 1JEYB 2QUBA 2GFIA 4RD3A 1ZC4A 1OXSC 2D74A 2I3AA 3GRKA 1NULA 2ONJA 3SE0A 4B6QA 2Z8XA 2CYCA 3IV9A 2VRNA 2W2NA 2WJWA 3EYWA 3IESA 3B3GA 4FYJA 1CUDA 4KE8A 5TSDA 4F56A 4FFBA 2V58A 5EIXA 1TGVA 3JRXA 1GGJA 1WP4A 1WDLA 2ZSEA 5JXIA 4UHCA 2C9BA 4JODA 5ALOA 2I4NA 4CETA 3QQ5A 2NGRA 1C7FA 4Z1MD 4JI1M 4QQNA 3D6FA 3TI9A 3X1DA 3IAXA 1PFKA 2G72A 3R6TA 4RA9A 3LWBA 1QYIA 1X9IA 3O8DA 4LXXA 3S6JA 3QBTA 2H7YA 4EG0A 3GF4A 2HRRA 3O8QA 2B1JA 5KAMA 2W2LD 3TH5A 5C7LO 4B3HA 2ZRCA 5JCOC 3U56A 5F7JA 3W3AD 4YT5A 4M37A 4EY4A 5IHXA 4U00A 4JI4B 3ABSB 4CM9D 2ZUBA 4DLKA 2XJ9A 2AMYA 2KLBA 1Q20A 1GQRA 5AFSA 2I67A 5D8DA 4LF9B 4FBLA 1C81A 1CBUA 2ZS7A 1NDUA 2YV4A 1KKUA 3T1HM 3I37X 4L7VA 3WXMA 1W9HA 3FUUA 2HJSA 3IEUA 3OP1A 1Z73A 3BL5A 1K2WA 1E4VA 3PL5A 1U0LA 4DNXA 4QJBA 1G8AA 4EM6A 1Z35A 2PD6A 4KWEA 4B76A 2D06A 1UP6A 1EK5A 1EQAA 4N0QA 4NQZA 4XDZA 5AK4A 4EB6B 1OMOA 4DRXB 2QLLA 1G5FA 4I50B 4IV5A 3CEHA