1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRNA METHYLTRANSFERASE
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Methyltransferase
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
4IWNA 5CCXA 3MCZA 3B7PA 5DXJA 5CIYA 2EJTA 5LQRA 1X1CA 3B5IA 4QDKA 3EVZA 2CWWA 2JHPA 2PLWA 1NKVA 3BWBA 4RVDA 4M37A 4MTLA 3V8VA 2BZGA 3PVCA 2IIPA 3M33A 2ERCA 2XVAA 2NNWB 3A27A 1SQGA 3LBYA 10MHA 2IH5A 4OQEA 5FA5A 1D2GA 2ONYA 3HVJA 4C05A 2C7RA 3OE5A 3NVMB 3MGGA 4YMGA 4RTKA 2OB1A 5F2NA 4QPPA 5GWXA 5HEKA 5BP7A 4UOEA 2ZIFA 4QPNA 1WXXA 2OB2A 1DUSA 2NYUA 3FPEA 2PSSA 4ISCA 4GC9A 1R18A 4GF5A 4RTMA 1OR8A 2I7CA 5HFJA 1XJ5A 2ZZNA 1EJ6A 1JTEA 5K05A 4GC5A 4FZVA 2PXAA 1RJFA 3P2EA 3KU1A 4LECA 2IFTA 3FUUA 3ERCA 3MQ2A 1DCTA 4CKEA 5IH3A 1YUBA 2R6ZA 4Y2HA 4V0RA 3LCCA 5T64A 3UJBA 4CTJA 1Q0SA 4GOLD 4R6WA 1M6YA 2PX8A 4F84A 3QOWA 2P3LA 4R8RA 3P9KA 4EKGA 5DM4A 1R8YA 1YF3A 3NW9A 4PYQA 5EPEA 5E9WA 5HZMA 5ICGA 4POOA 1SVUA 1Q0TA 2ZIGA 5LQNA 3PTAA 2YXLA 1XVAA 3LHDA 3A26A 4Y30A 2C7PA 2FRXA 2OPBA 3ELYA 3DUWA 3WSTA 1FJXA 2GPYA 2DPMA 3IV6A 3O31A 4KWCA 5T6BA 3REOA 1UFKA 2G8NA 1KPHA 5DTQA 5HIKA 4HC4A 3DMGA 3UBTA 2ZBPA 1G8AA 3FUVA 3ELDA 3R6TA 5FHRA 2P40A 1JQDA 2IDJA 2BM8A 5HILA 4PYIA 5MHTA 1WZNA 5EKUA 5CVUA 3U81A 1AF7A 1JTFA 3T0IA 1XCJA 4R6XA 5EHGA 4YV2A 2PX2A 5LQUA 2P1DA 2VDUE 3UWPA 2XYQA 4GOOD 3PT9A 3KPJA 3KQOA 2CKDA 2ZBQA 2FHPA 4C08A 3E8SA 3UJAA 1N7JA 3UJ8A 4C06A 4ER7A 2YUIA 3UA4A 2NP6A 3VC2A 4YUYA 4P7JA 1L1EA 1X1DA 3AXTA 3HCDA 3FPFA 4PONA 2PX4A 4E2WA 3AJDA 5DSTA 4PCLA 4RVFA 4YUWA 1O9GA 3HCAA 3A25A 4K6MA 5EG5A 3UA3A 3GXOA 4OA8A 1JQEA 1NW3A 3BT7A 2UYHA 1FBNA 1INLA 1R8XA 3EVBA 3KR9A 5U4XA 2HTEA 2VDVE 4FT2A 4PWYA 1RI5A 4QQNA 2PX5A 5FA8A 2VZ9A 3SR4A 1NW5A 2AOUA 3ELUA 3LCUA 2C7OA 4RWZA 3CBGA 2I9KA 3OFJA 2YR0A 3KQPA 1NW7A 3EVGA 4U7TB 3FTDA 3KPWA 4RSRA 5DX8A 2IH2A 3R9XB 3ELWA 2WA1A 1XCLA 3P9NA 5DTMA 5K0NA 4F86A 3FPJA 3PS9A 4RYLA 1SG9A 1YZHA 2B2CA 3TPZA 2JHAA 2PWPA 5CVVA 1X1BA 3H2BA 5EEHA 1L3IA 5FTWA 4B17A 3CKKA 3SGLA 3C6KA 3G2OA 4A6DA 2Z6QA 4E32A 3SM3A 1G6Q1 2G72A 4GUAA 1JG1A 5BXYA 3P9IA 4XUEA 4E31A 4YUZA 1IY9A 1FP1D 1NE2A 4E2YA 1D2HA 1L9KA 1ZKDA 2PVCA 3KKZA 3L8DA 1NBIA 2NXJA 2O0LA 3BKWA 3DXXA 3GNLA 4IV8A 4WVLA 5T67A 3EVCA 4DMGA 3OCJA 4BLUA 3RW9A 4H0NA 1KPIA 1QAMA 2OO3A 3HM2A 4AZWA 5GM2A 5M5BA 2IGTA 1RI4A 3DXZA 2CMGA 3UZUA 5CCBA 3B89A 3QV2A 3OU2A 4PGHA 3NWEA 5EKXA 1MJFA 4DZRA 4DKJA 1NT2A 1TPYA 2AN3A 4RTJA 3RODA 3FUXA 3HVHA 5EZQA 3T7SA 5EQJB 3TR6A 1KP9A 3CC8A 3LX6A 4RTNA 4HTFB 2OXTA 3F4KA 2YVLA 3KQTA 3M70A 1SUSA 5EVJA 4E33A 3LDGA 5FQOA 5C9ZA 3BGVA 2O07A 2V74B 4P7FA 4PYNA 3SX0A 1G60A 3THRA 1IM8A 2G70A 3O4FA 4XCXA 3MAGA 2XYVA 4RTPA 5DLYA 3FTEA 5EMKA 5B1SA 2ZLBA 1WG8A 3M6XA 4X41A 1ZHFA 2K4MA 5DWQA 5KQSA 4FT4A 2AOWA 2QRVA 5IKMA 5GM1A 1UIRA 3LBFA 3OE4A 5DXAA 5E1DA 1G38A 1XDUA 3LDFA 2PV0A 3LSTA 3TKAA 5GIPE 2F8LA 1YFJA 2GS9A 4ER5A 4KW7A 4LWPA 5FQNA 3TFWA 2BR3A 3HVIA 3FYCA 1RI1A 1XTPA 2HWKA 1U2ZA 2AOVA 3EMBA 1ORHA 2LD4A 4G56A 2HNKA 1IXKA 2QYOA 5DPMA 3G5LA 2Z6AA 5E2BA 3G7UA 2P7IA 5DTRA 3SMQA 1QYRA 4FS8A 2IBTA 5DRYA 1JSXA 2EFJA 4P7GA 5BW5A 3V97A 4X61A 5FHQA 1HMYA 4ZTBA 4FP9A 4EVIA 3GRYA 3DLCA 3THSA 2WK1A 1WS6A 3FTFA 3G2QA 3I53A 4QTUB 3IEIA 2P3QA 3DMHA 4X63A 1R00A 2ZW9A 3T7TA 2FCAA 4Z2YA 4C07A 1N2XA 4KDCA 4CXMA 3OZTA 2ZULA 2ZZKA 3BXOA 5HIIA 4DM3A 1P1CA 3VC1A 3I5UA 4JXJA 3K6RA 4R8SA 2FK8A 2XVMA 3GJYA 5D1NA 2GH1A 4PIMA 5C0OE 2EG5A 3VSEA 4AZSA 5KVAA 1NW6A 5GP1A 4F85A 2ZIEA 5DM1A 3PB3A 7MHTA 2ZWVA 3CCFA 4C4AA 3HTXA 3FUWA 3KQQA 1NV8A 2DULA 2VP3A 3KR1A 2B3TA 2Z6UA 5E8JA 2ORED 3RIEA 5GIOE 2HR1A 1X19A 2AVNA 3DOUA 2AOTB 2H1RA 3Q87B 4GQBA 4AX8A 3KQVA 5K0LA 3S68A 4WXHA 2OY0A 5CVDA 3Q7EA 3UJ7A 4L7VA 1Z3CA 3P97A 3DR5A 5K09A 2KW5A 4RVHA 5EOVA 4RVGA 1L3CA 1VQ1A 2B25A 2AZTA 3CJQA 3R24A 5K0JA 3KPYA 5LQCA 2EX4A 4KVZA 5HOQA 1JQ3A 3TQSA 4QTTB 4ER6A 3CJRA 2GLUA 3DMFA 4OA5A 2GB4A 5CUQA 5FWDA 1EAMA 3FPGA 9MHTA 5CVJA 3I58A 1YB2A 4HSGA 4YV1A 1RI2A 3GDHA 3P8ZA 3DP7A 3QOXA 4XUDA 5E1MA 2A14A 3KPVA 4CKBA 3DLIA 1QANA 2UYOA 2NXEA 3SSOA 2R3SA 3AWIA 3EVEA 3A7EA 3PX3A 3EEOA 2NP7A 1SUIA 1NBHA 2IPXA 1SKMA 3I64A 4PCAA 1ZGAA 2H00A 2VS1A 3UJ9A 2ZBRA 4RTRA 5F2OA 5EIWA 2JJQA 2O05A 3BWYA 2XBMA 1RJEA 4EKIA 3C6MA 5CD1A 2BR4A 1PJZA 3ER9A 3EVFA 3TLJA 3E23A 4BY9E 4OBWA 3UFBA 3UJCA 2OBFA 2P8JA 5FULA 5EIFA 3VYWA 1I4WA 4GBED 2ADMA 1KPGA 2PT9A 3BKXA 3KR2A 2P41A 1WXWA 4QVGA 1X1AA 2O06A 4XUCA 3LKZA 4KRGA 4P58A 2OZVA 3MTEA 4FSDA 4KIFA 5E2AA 4YV0A 5DSXA 4ER0A 1TW3A 3O7WA 4PYKA 5KS2A 1T43A 3JWJA 1EG2A 5KYGA 3AXSA 3R0QA 2ZVJA 1BC5A 1RJDA 5FADA 3TMAA 3GWZA 4PYJA 2ZFUA 5ERGB 3FUTA 1JR4A 3PFGA 5E8RA 4IKPA 4EQZA 1M0EA 3ORHA 2PJDA 4BLWA 2CMHA 1XDSA 4RTLA 5K8VA 2P3OA 3G2MA 5DX0A 2UYCA 2AN4A 5F2KA 1JG3A 1F38A 3AY0A 4FR0A 5K0BA 3DH0A 3JWGA 5EZSA 4EMSA 1RI3A 2Y1XA 4U7PB 2AR0A 1SQFA 4DA4A 1D2CA 2C7QA 3ID6C 2V7EA 3KQSA 3K0BA 2YTZA 3CJTA 4OQDA 1FPQA 3KQYA 2JH8A 4AUKA 3P2KA 1R6AA 3MB5A 1N7IA 4V0QA 3ANXA 2BH2A 2ZZMA 3JWIA 3TM5A 3EGEA 5HIJA 1BOOA 4MIKA 4RTSA 3G2PA 5LSAA 2N47A 3G89A 5FWAA 2B9EA 1P39A 2FYTA 5CVEA 1G8SA 4IV0A 5E1BA 1L3BA 5LR6A 2QE6A 3C3YA 3OFKA 4M36A 4HRAA 4X60A 4RX1A 2P35A 2ZCJA 5EMJA 2IDKA 2OYRA 3CVOA 2NXNA 4OBXA 3UJDA 4BP3A 3FYDA 2B78A 5GOZA 2I6GA 4CKCA 4YMHA 4ER3A 2UYQA 5K0CA 1M6EX 2OKCA 4RV9A 1H1DA 4ATNA 3BGIA 2NXCA 3EPPA 1HNNA 2BM9A 3ME5A 3SSMA 3KHKA 1EQAA 1BKYA 2PGXA 2PT6A 4BLVA 2YX1A 3KPUA 4C03A 4PIPA 1I9GA 4C04A 3A7DA 4X1OA 3PLAE 1AV6A 3GU3A 2UZ4A 1EIZA 4RTOA 3M6UA 3LGAA 4PINA 4FGZA 1DL5A 3MTIA 3KQMA 2GAFA 1ZG3A 1KXZA 4DF3A 2IH4A 1R74A 2ZSUA 3EVDA 4P7KA 1AQJA 1NW8A 2PKWA 3M6WA 4GEKA 5DM2A 2EJUA 3DTNA 2PXXA 1V39A 3EGIA 3HCEA 2AOUB 4E70A 1P91A 4GOMD 3BWMA 1YZ3A 2AN5A 3SSNA 3DXYA 3LKDA 3B3FA 2AVDA 5EMLA 3C3PA 4LG1A 5G02A 1KYZA 3CGGA 3TOSA 1VLMA 3NTVA 2PXCA 4R05A 3NWBA 3OZRA 3NJRA 1QZZA 4KIGA 4MQ4A 4AZTA 4NECA 3OU7A 4HG2A 5E9JA 2WA2A 3BWCA 2PY6A 3IYLW 2YXEA 4HTFA 5JR3A 3TM4A 2FPOA 2IBSA 1UWVA 3OU6A 5HIMA 3HCBA 1G55A 4QDJA 3D2LA 3T7RA 1FP2A 2IP2A 3HCCA 1EJ0A 3HVKA 3UJ6A 1MHTA 5EC8A 3G5TA 5ICFA 3EMDA 2PBFA 3I9FA 2VDWA 5DT2A 3EEYA 4E2XA 3FRHA 4PYLA 1TW2A 2Y1WA 3SVZA 5FUBA 4HGZA 1ZQ9A 3G8AA 4QVKA 3G88A 5LQAA 3EGVA 5K01A 2P7HA 2FK7A 2HV9A 1JG2A 2O57A 4DCGA 1KIAA 4M38A 4A6EA 4EK9A 3NVKI 5LQKA 3LECA 5K03A 4E2ZA 3GGDA 1BHJA 1RJGA 3NDIA 4PGGA 5KQRA 3M4XA 3E05A 3NDJA 5K0EA 4M7RA 2CL5A 2ONZA 3BZBA 5DRTA 2G1PA 5EMMA 1Y8CA 1B42A 3M6VA 1KR5A 1NV9A 2BR5A 5LQJA 1ORIA 4E30A 3JWHA 3BGDA 4QQKA 1KHHA 2ESRA 1VE3A 3IHTA 3HA3A 1VIDA 3HNRA 3G8BA 3GCZA 3LCVB 5H02A 2GA9A 3OPNA 5EGSA 3SXJA 1JG4A 2PWYA 4YUXA 5GINE 1I1NA 2JG3A 2ZWAA 5ICCA 3KQWA 1P1BA 2QRVB 1F3LA 4HH4A 3MHTA 5JUWA 3GO4A 2AOXA 3LPMA 3HP7A 5E1OA 5E9QA 4DCMA 3HCFA 4DQ0A 4RTQA 2AS0A 1PRYA 2Q41A 1O54A 4LWOA 1XDZA 3FTCA 3GIWA 5FCDA 3NMUF 3FZGA 5DM0A 5BW4A 1ZGJA 2G71A 5K0FA 4O29A 4CTKA 1QAOA 1VBFA 4PYMA 2ZTHA 3P9CA 3C0KA 2YQZA 4KDRA 5P8WA 5ICEA 1WY7A 3KR0A 3ER8A 3P71T 3GRZA 3PX2A 1VP9A 2QY6A 3HA7A 3B3GA 4CWAA 3A4TA 4AZVA 8MHTA 2YXDA 4PYOA 4MWZA 3P2IA 1KYWA 3HEMA 3E7PA 4HGYA 3GRRA 5DX1A 1VL5A 3FPHA 4FSXA 3R3HA 4OX9Y 3MCTA 2AOTA 3OZSA 4MHTA 2JHCA 3GRVA 1AQIA 5EEGA 2HMYB 3DULA 5C1IA 1O9HA 5K0GA 1VPTA 3EVAA 2JH9A 4PNEA 3TRKA 2I62A 5D1HA 3LL7A 2H11A 3FRIA 3MERA 5CM2Z 2E5WA 1JSZA 3X0DA 2XYRA 4BP1A 3GRUA 3PFHA 1QAQA 3HA5A 1XXLA 2QM3A 3BUSA 3LDUA 5EHIA 3B3JA 3TKYA 4GOND 1VP3A 4YUVA 1YFLA
chains in the Genus database with same CATH superfamily
1Y9DA 5CCXA 3TGLA 3ZGOA 1ZD2P 3I39X 1JW9B 4UPEA 2ZE7A 5AI4A 1OFTA 2QSFX 2IYQA 3IPXA 4UFNA 5LBIA 1HR0M 4IJKA 1Q21A 1PFUA 4O4JA 2QHOB 5CTJA 3I73A 1LY1A 4O08A 5BRAA 1DGQA 1LX7A 3Q7PA 3EXEA 3IVCA 3Q15C 2M6KA 2G9NA 3GL9A 3MEQA 2D06A 1L4LA 2GESA 2P75A 4CFZA 1WSAA 5MHTA 2WV9A 3WR5A 1FVHA 2R9VA 2BKVA 3OHSX 3GGJA 4A91A 1Y7TA 2QF7A 3A1VA 4PLZA 4PDIA 1UJ5A 1CQJB 3A6PC 2AOUA 3MJ4A 2YWGA 4BGUA 3AB7A 5JCOC 3TNJA 1JR2A 1J56A 1L1RA 4ZVTA 4YP6A 3C74A 1VG9B 1KOFA 5CU7A 4TTJA 5EKSA 1Z0FA 3NHWA 1DLJA 4ZYXA 1GXSB 1UPUA 3VYRB 4K0RA 3U4QB 3HU3A 2H51A 3MQ4A 5ENZA 1E0JA 2VUSA 1JLKA 4J75A 2ID9A 4HLCA 4UKDA 5JYEA 5LBTA 3B82A 3BMNB 2NV2B 5KQSA 1QZXA 4S12A 3HFJA 4R51A 4QDTA 5IJAA 1PZMA 3ZPXA 1Y1RA 1YZTA 4H3VA 3W6PA 1MPXA 4I3HA 2Q5HA 3I53A 2HHJA 4P5DA 4QULA 1UXKA 2ZU0C 1TQ8A 4O4IB 4P81A 2YOHA 1WMAA 4K9RA 1C1DB 1KJIA 1CUUA 2B4QA 4WNAB 2VP3A 1C0KA 1L5KA 2IV3A 2NUTB 2HU5A 3UJ7A 4JJIA 2D0IA 3N7TA 2J3DA 4CIAA 3EGWA 4KU4A 3BMNA 3LYHA 3DMRA 3BPSA 1DMSA 1CCWA 2G82A 2OGUA 4BQPA 3OPYI 5AHXA 5B6JA 3AFMA 3UMRA 2GSWA 1N6OA 3C6MA 4NHEA 1W8IA 4DAOA 2JFVA 3NHRA 2W83A 4CLHA 3UW1A 2J5QA 1VKNA 4KRXA 3D1VA 2GGSA 2DPHA 3TTSA 4HMOA 4I2NA 2E3JA 1R4NA 4X6UA 5KCZA 2X8WA 4Z3OA 2COEA 2AFHB 3G2HA 3N86A 2GNPA 1Q7TA 1ADCA 1E7MA 2JIBA 3IOCA 2Z43A 1UIMA 3O91A 1YR3A 3ME5A 1R9MA 3FWYA 3MRSA 1PR4A 2RGYA 3OJXA 3FKEA 2WJYA 1KNQA 1NQTA 2GM5A 3ZVMA 3DDOA 4HDNA 1JIXA 1WSDA 1IZ7A 2AVDA 3J81k 4ZO7A 4EG6A 2Q1WA 5AHKA 3TM4A 4FGKA 1FP2A 1EVEA 4YAKA 3QLVA 3WGQA 5M3BA 2AFHA 1Q2UA 5JJKA 2YVAA 1YNSA 4B3BA 3Q2OA 3LC7O 3JVVA 4JP2A 3TIVA 1B3RA 1DRJA 3CWCA 2R6HA 3KSZO 3OC6A 2Z5LA 1VIAA 4TUYF 1TOAA 1J49A 1LRLA 5IM4A 1GRRA 1LBQA 1WJ7A 3KZNA 4BNYA 3MIIA 1D4ZA 3VR6H 2D54A 2O7SA 3HP1A 5F64A 1GQSA 5IAOA 4JIMA 4HDKB 3EPKA 4S1TA 4XFJA 1R0SA 3G13A 4AU1A 4PQGA 1TJ4A 2O19A 1XQ1A 3M4NA 2GRAA 5H37D 1ZIDA 2XWBF 1D9ZA 3AIOA 1JEQA 5F12A 1U3GA 1X38A 3KIPA 2YHAA 4RVDA 3L4EA 4LGMA 4MEJA 2ZAMA 3AZQA 3EBPA 3OQVA 4TTIA 3X2FA 3TJRA 1OIVA 8AT1A 2ZZNA 3DPUA 4WOCA 5DW3A 2BWEA 5A5FA 4W7SA 4M8IA 4DV1M 1ORDA 2FDRA 2FR8A 3HE3A 3U6QA 4WK2B 1N9GB 3TTUA 1E5VA 2B4RO 4BMXA 3AVQA 3FMVA 1Y8QB 2HNAA 4ZZ2A 4MUXA 4UXJA 1ADBA 6LDHA 3O31A 1A9YA 4KPYA 2C5BA 2FW8A 1V16B 2JJ2A 3GCDA 4KKVA 2R4EA 3H13A 1J1ZA 3U3OA 1L1EA 3J81S 2ET6A 1GTRA 3JZDA 3AESA 3TLMA 3LSYA 1F2TB 1WCYA 3WVNA 2EJVA 4U5QA 2AXNA 2Z2KA 3FTDA 1S6YA 2J33A 4LOKA 3GLQA 5LP6A 4CBVA 1FY2A 1G6Q1 2WHPB 1FP1D 3TZLA 3PUJA 4QU0A 1C4KA 2CXUA 1P0PA 1P2GA 4XIGS 1TF0B 1E1LA 1I7SB 1V16A 3IEXA 3H4MA 2OXTA 3OAAA 4RPLA 5T6MA 3UPDA 1E1KA 5IASA 4FFRA 5AJTA 4TQUS 4DBVO 1J5EB 2BMAA 5ECDA 4V0SA 2HA3A 1F2TA 2P0YA 2QBYB 2N0SA 1RYNA 4CEIB 3U7HB 3EQ8A 2HWKA 4B40A 1PR9A 1H2YA 3RANA 5DRYA 4GM0A 2FN9A 4PCZA 3FTFA 3A4IA 3KP0E 3R75A 2RGBA 3MYRA 1PL6A 3K9QO 4IEEA 5AW7A 2QIPA 2FPPA 4EH1A 1PZEA 5ALMA 3BMOA 2IITA 3TOVA 3R7BA 1N0WA 4AQDA 5AJYA 5DE3A 1IRXA 1HT2E 2W2XA 2R7LA 2MROB 1Z7EA 3GARA 3SZOA 3KS9A 2A35A 2XUDA 1CLEA 4RTRA 2RSLA 1KAMA 1PJZA 4MIEA 1HDCA 3J27B 2DT5A 5BWOA 1KVQA 3PXCX 4MW5A 1WQ1R 4KRGA 1I2ZA 1JU4A 2GAIA 3N2IA 3D7LA 3LZCA 1J8MF 1JPNA 1I7QB 3L4BA 4FR0A 4YRCA 1Z38A 2QQFA 4BP8A 1VMKA 1LTHR 2PLFA 4QZVA 1Y1TA 5JW6A 13PKA 3HZHA 4JVSB 1P39A 2EYUA 3DTVD 3E1SA 2X4LA 1EGVB 3HXMA 3VU9A 4U7FA 3H4VA 1FJHA 1ZZGA 5ALUA 2I33A 1W93A 5H81A 2HZ7A 3IKVA 1F4IA 3E22B 2LBPA 4NVRA 3FX2A 2VDBB 1LW6E 2C78A 4AKIA 1FSFA 3SZGA 2ORIA 2GPBA 4NENA 4PSDA 3PGXA 5ISMA 5KTYA 1UP6A 1I2AA 3NONA 2Q1YA 1PV1A 4TMVA 3DB2A 2R65A 4LSWA 4QLOA 4O2AB 2O8FA 3NIFB 1OX4A 3FGNA 2O2SA 3WK6A 3BBLA 1MVLA 5B1HA 5H02A 2QRVB 2E6UX 1OGYA 1IULA 2QQEA 2B1JA 4IFIA 2P5TA 1AM4D 1UXJA 2B36A 4FJ2A 2BDEA 2W71A 2GEFA 2O3QA 5EEGA 1M8GA 2Q5LA 2D7GA 4ZVLA 1VG0B 2XTAA 3KALA 3W5CA 2IEDA 2OV8A 2N35A 4KPUA 2HSGA 4Y1EA 1D7OA 3AJAA 1MX9A 3EFOA 4RVSA 4CM1A 4HFRA 4BXOA 3N0WA 1C8LA 4MRMB 2ZE8A 4J4BA 1E7RA 3BXEA 1H66A 4X7MA 5HEKA 4O5AA 4RGYA 2R84A 1GPUA 3SDZA 4QT0A 2RONA 3U0VA 4CLEA 2GK6A 3GLSA 3MFYA 4WOJA 3D8SA 4EABA 2PX8A 1HRDA 2J9ZB 5AVRA 4WEOA 3QOWA 3IQZA 2B7CA 5JZMA 3GGSA 4MS4A 1E0KA 3NEYA 2HH9A 3FCAA 3MRXA 4HDOB 3U81A 4PHCA 5GAJA 3IH5A 1MABA 1E2GA 3K0HA 1U0TA 4GL4A 1AQYA 2L2QA 4YUWA 3M83A 4EAQA 5JVDF 4UAJA 3WIVA 3EVBA 1V11B 4Q3KA 4Q16A 3VJMA 1IOLA 4G37A 3A70A 3DLBA 1Y5IA 3P9ZA 1PFWA 5ALKA 3SGLA 2DWLA 3SICE 3STVA 3H1TA 4ONEA 5C52B 2JGDA 3KE9A 2LVQD 4G1UC 3N2EA 1BFKA 1YBHA 1FXUA 3CC8A 2JIQA 3KTAA 3EMKA 2QQ0A 3UPUA 1LRKA 2C2GA 1ML4A 2HGZA 1W2HA 2E4WA 1XDUA 4EYSA 5EIEA 5KQPA 4JBYA 4LWPA 2JGNA 1T8PA 4C01A 2VA8A 5E2BA 3DD5A 3Q9NA 1I3LA 3A3YA 3ESXA 3DJFA 4K05A 2VTBB 4HSEA 4GKJB 4JGBA 4EY5A 3NGLA 1T2UA 3JVUA 2JGJA 3H1EA 2HR1A 3WLEA 1W4RA 1X14A 1MOSA 3ZE6A 1FYVA 1KI6B 3JARA 1V25A 2ODBA 4XUDA 3UEOA 2O2JA 4KC0A 2Q4DA 4JVMA 3LKBA 4AO8A 3LKZA 4WK0B 4MQEA 3VZRA 1TA0A 3N2NA 5TQ2B 4PYJA 2F1KA 1M8KA 1UWLA 5A7HA 1J39A 3RLFA 4QUEA 3T8YA 4IL5A 5BN5A 2XA1A 2VT7A 3V1KA 5IU6A 5BYKA 3VKGA 1S2NA 2OOSA 4K9KA 1PLLA 2IYSA 4MA4A 3PXBA 4CM7A 1XHFA 2E4ZA 3OLQA 4GKAA 4RMGA 3I37X 3C41J 3A32A 4RXUA 4MS3B 2QX7A 4ZYVA 2Y0TA 4M1SA 4YRJA 3W5SA 5KB3A 3IVMA 2BP7B 4F1KA 1PZFA 2WLTA 3MWYW 3JD4A 2AN1A 5EP4A 5I8PA 1TLFA 1V5IA 1NOKA 4ARIA 1SHKA 3WAGA 2QVLA 3R40A 5K03A 3E05A 4CYMA 2FPIB 1IWOA 2D7HA 3QLEA 4EO9A 4RK7A 1V47A 4J0JA 4DBLC 3J7BA 4GHAA 1NNUC 4XQCA 1VGRA 5IKEA 4DQ0A 1JFTA 4DLVA 3HZRA 4HATA 3G0IA 2A1UA 4RDIA 2OZKA 4R3NA 2Q2EB 3SQOA 4OHOA 5CNJA 1KZ4A 5I7HA 3MLAA 3FCOA 5AM5A 2KB0A 2ECKA 4HDQB 1GNSA 2X7HA 3D8TA 4L72A 5BWCA 2ZJ5A 5D84A 1CDOA 1VJDA 3G0CA 3K05A 1ZOIA 5ALWA 3BX1A 4IBCA 4CQMA 3BSFA 4PLVA 1GGVA 4YHBA 1ESCA 2ZWIA 2EW1A 4JODA 1RWKA 3LLUA 3KHTA 1E2QA 3BFVA 1V45E 5FTLA 2QYTA 1WXXA 4WE3A 1U99A 5CEJA 3H04A 1KQOA 2BHTA 3EXFA 4H7KA 4HJXA 3K0AB 3TTXA 1G4AE 4LXHA 4PLTA 3TLBA 4RQBA 4CM6A 4AZ0B 1GPAA 3G17A 4LDPA 3DUWA 3ER6A 1CW2B 3ZWMA 5CXQA 3HVRA 3ZX4A 7REQB 1XCJA 4E3WA 4YJGA 2CKDA 3UMVA 2GI4A 4BGDA 2H1WA 1YB6A 5I9BA 4R7ZA 2GN6A 3LHFA 1PEKE 3QBTA 3Q1KA 4PCVA 5EG5A 4OA8A 4IBEA 5BN4B 1QB8A 3P27A 2WQ6A 1CIJA 1W1IA 5EZ6B 4ZWNA 3VX3A 3WYGA 4NU6A 5CG1A 3QELA 5BV8A 3A3PA 4B4UA 1TL7C 3GZNB 4WVLA 1UEXC 1QAMA 5JAQA 1Q1EA 3QEJA 4WNIA 1HDYA 3RODA 2LVPC 3L6RA 4U7WA 3RADC 1CEYA 1BX1A 2AHRA 4EUNA 3QNMA 4LCBA 3BORA 3KRTA 4X1IA 3Q6NA 2OILA 4B81A 3EIEA 3LI2A 1IXKA 1GM5A 1OT3A 2BI4A 4MGYE 3BA1A 3OM9A 5E6SB 1N36B 1QHNA 5TQJA 5CLLA 5DV9A 3WFIA 4WBNB 4FYIA 2E7ZA 3HHWA 1FTQA 3EPJA 2XTMA 1XYVA 1XHEA 2FZGA 2QGZA 1H42A 1X19A 1SXPA 3HHXA 4EIWA 2GJ8A 2OY0A 2I7TA 3MT9A 1Z63A 4D3ZA 2OVFA 4AMVA 3G85A 4LAFA 3BK7A 4TTRA 1MJGM 4WXPA 4ZAWA 4MX8A 3LFUA 4KWHA 2O8EB 3CFYA 4RH0A 1Z88A 2PGDA 4Y6OA 3BSSA 3FD8A 3U61B 1AJEA 5KTMA 1DKLA 2VPTA 2HV8A 1W49A 3KOMA 3TLJA 3VYWA 4R3WA 5H83A 1IEVA 2PJRA 1B7GO 2F5SA 1EWQA 3VNAA 4EQZA 3VDPA 4QFDA 1WKBA 2QVXX 1F38A 3GQBB 2FVXA 3MF4A 4ITRC 4QQRA 3K1ZA 2PAAA 3G2PA 3FNEA 1DE0A 4KQHA 4RMIA 4W5OA 4U2FA 1HRKA 1L4FA 1NOIA 1K6XA 4NYJR 4LW8A 2HGSA 2V65A 3QX7A 2DTEA 4B7FA 1TT7A 3PYMA 2W4MA 1P91A 4PEVA 1T9CA 1A4UA 1Z2DA 3ZHYA 2YFKA 2YXPX 1QYVA 4MGZR 5B3KA 2QR3A 1BJRE 3I6IA 2F55A 3IQWA 1SH7A 4YLEA 1BHJA 2JIOA 4K9SA 2PLAA 5D86A 1ES9A 1XDGA 1XZNA 2VSNA 2ESRA 2PS0A 1ULBA 1WP9A 4GITA 1GIAA 4UE6A 3ZN2A 1M34E 2JL1A 3OZ7A 5FWYB 3IAHA 2FHSA 4O29A 2H2GA 1CZRA 2ZSKA 1G0NA 2GFIA 4NPHA 3UT0A 2QSZA 2XF8A 3DMTA 4JUIA 3X1ZA 1XF9A 4HVCA 3HB0A 4RMNA 3BJEA 2JH9A 3HI4A 1E6CA 4KYIB 3LKVA 1TCAA 4LQLA 1TB4A 1KAOA 2I1VB 2IUSA 4XFKA 3C98A 4TMWA 1D09A 4ZV9A 4DM4A 1JPVA 4LFAB 4BEVA 4I9UA 3F7NA 2F5QA 4GECA 5JAPA 3W6OA 4D4LA 2YIDA 1Q6YA 3OQ6A 1H1LA 1XZHA 4TKUA 2B0CA 3C1UA 1ISFA 5IH3A 2X0KA 1U9CA 4KRYA 2WUVA 3LT1A 3RABA 2WFLB 1VL2A 1XCGB 4F06A 4C4OA 2CXSA 1CSEE 2P0AA 1QUEA 2D3WA 2J1LA 4EHKA 2CB9A 3K3PA 3RBVA 2QTWB 3LT0A 3PC3A 4DR3M 3QG5A 1VCHA 3IJRA 3EN0A 1D04A 2PT5A 5EPUA 3FPFA 5JFOA 4XWTA 4MH0R 3CRRA 4P3NA 4P9NA 4CMEC 1KDRA 2V6ZM 3ZWBA 2IPOA 4NCIA 1DOHA 1M6VA 2P91A 4U7TB 2NAFA 1EUDA 3QXSA 2F6RA 5CYOA 4QUJA 1E8NA 3SZMA 4O3FA 3QLUA 4AJOA 2NU7B 2AYZA 2OO5A 2CMGA 2VDKB 2RH4A 1L1ZA 1NJFA 2PX3A 2CVPA 1R15A 3K71B 1EXNA 4MYTA 4KCGA 5GM1A 3CG4A 3TB6A 4B9EA 1JG7A 4JP8A 4FMDB 3P7MA 1HG1A 4LMAA 5DPMA 1W75A 4I19A 5BW5A 5E0OA 3ZV6A 4BCBA 5AVWA 3HABA 2GZ2A 2H31A 3WLKX 1MC5A 4QOGA 3TD6A 2UYYA 4MVJE 3VPGA 4TLLB 2PV7A 4J16C 4KMSA 5B4TA 4J1TA 4XSHA 4PLHA 2D1YA 2PBLA 4DV0M 2P2CA 5C32A 3P4UA 2ZPTX 2R48A 4MV0A 4DC0A 3RUEA 4DDVA 1FVOA 1E9BA 2IOHA 4M0KA 5ALFA 3PX3A 4ZI7B 4RQUA 3L6OO 4UFOA 1VSQA 4A10A 1DJOA 1W48A 4URFA 5ABPA 1H9AA 1GDTA 5L45A 5JWOA 3AXSA 2WYOA 1N0UA 2ZFUA 3H99A 4BQFA 3ZOKA 1KL7A 5AW8A 1Z5ZA 3ZQUA 5T57A 3QSGA 2WZDA 3SHTA 2HCTA 1ABBA 5KYYA 1KGDA 4NZMA 3JWEA 1J07A 4LDRA 4C78A 2JH8A 1E2BA 3BRSA 2OCAA 3G7SA 5FNVF 1AS3A 4RK1A 4B46A 2DBYA 5ED4A 2Z2JA 3AL2A 3IP6A 3W3AA 5EMJA 2Q3JA 1OHHA 3G68A 5ESDA 2FPGB 1NASA 1BKYA 1J23A 1SC4A 3WYEA 3FDXA 1N2BA 2BGKA 3OSUA 1ZG3A 3FYUA 1MCZA 4G9BA 3WK5A 4ZRNA 4IBDA 4BUZA 4FE3A 1GRQA 1C29B 2HHAA 3LE8A 3GP8A 2CLEB 1U0NA 1TFRA 1ZQ1A 3SQNA 5KKNB 3M1AA 4IKEA 3KQKA 4MVJP 4YXWD 1W85B 1UR5A 2R8EA 3KUXA 2BTOA 1QZMA 5ALRA 1JGTA 3M6VA 4IUYA 3D0OA 2VSXA 4LBYA 2FPGA 5TARA 4AICA 4BE9A 3FTNA 2FSFA 3G6WA 3E2MA 4H7HA 4MRSA 2A3RA 3ZW7A 3RU2A 5JECA 3RT7A 1U90A 1NI4B 2JAXA 3PFNA 3MJFA 2OSBA 2FSHA 1RYDA 3HEMA 2DOKA 5KYUA 5ARCA 1WMEA 5JCJA 5F7OA 4KSCA 4B3CA 5K0GA 1RXSA 3LZDA 1XCMA 2B94A 5ANRB 2H7CA 2ZUTA 4PZPA 1VE9A 1D0IA 2DWPA 4BDTA 4TWIA 2V7PA 2P6OA 2H2IA 1QM5A 3ROFA 4CIZA 1E77A 1QP8A 5T8KA 1I5RA 1ODCA 1OWMA 4YRIA 5KNBH 1CPYA 1W4AA 4V03A 4ZO6A 4Q4HB 4OFZA 3NW9A 4PYQA 3TPCA 3FUCA 4YAWA 4M4SA 1QIMA 4YWHA 4RULA 1XR3A 4D42A 1YTUA 2R00C 2ZT8A 5ALHA 5AH0A 1RRFA 2H1FA 2XRYA 3DT8A 4P3KA 2YASA 4NBWA 3JX9A 2V5UA 4UREA 4X91A 5T4EA 3K7EA 3HCAA 4X7BA 4DDHA 1XQ9A 5KTNA 4MROA 2I7XA 5LZ4A 2VAVA 5DNUA 2WA1A 3FPJA 4C07A 3T5AA 3NIGB 3EWAA 3OQOA 3UVEA 1HNWM 4INAA 1BJKA 2F4NA 2IGTA 3UHFA 4K8OA 4FWDA 5HQ3A 3A4LA 3V8NA 1G2IA 1QVRA 1ULSA 1SUSA 3N3AC 2O07A 1M67A 4OKSA 2WKQA 3NAZA 2X7JA 1OUMA 2XE8A 2QKYA 5IKMA 1PDVA 5DIFA 3I0ZA 2R6DA 4RK6A 1SEVA 5E6RA 5L3VA 4LYAA 2XEXA 2FSIA 4LN1A 2GS9A 5FFMA 3DMNA 3DOFA 2MYNA 2GLXA 3VNSA 1Y7PA 3G3EA 2CDCA 2JJMA 1OXKB 2V9PA 3JYNA 1I13A 2O5VA 1SQ0A 5WRFA 2R1ZA 2ZRLA 2Y0PA 2WWVD 4MA0A 1XRRA 2QE7A 3PNMA 1ZL2A 4D46A 2NACA 2Z9CA 3R7SA 2DLCX 1LV8A 1DG3A 1LC0A 4BFCA 3GR6A 1E7YA 3AETB 2V1XA 1RI2A 1Z08A 2QRGA 1QANA 2W6ZA 1FW8A 1VKOA 1SQ6A 4FZ3A 4AZ3A 1U4SA 2F43A 1SXGA 3CUYA 4R01A 3GHHA 3SR3A 2FN7A 5BMOA 2J0SA 2W4QA 2JLVA 1G18A 4LXIA 1OLXB 1LX6A 1XZJA 3N8GA 3KJHA 4OUDA 4HQRA 3E8XA 1K97A 4IIGA 3RC1A 1XK7A 1OVGA 3IG5A 1ZBQA 2E4YA 1H3NA 3GNTA 1KSFX 2OC4A 1J2YA 2QZPA 2LUOA 5JNRA 5IT9S 5TPZA 3E9EA 1L3BA 1UMKA 1ZMUA 1WPXA 3BL5A 1OASA 4B7XA 3LOPA 4YMHA 3FYDA 4II7A 3HUUA 4D4HA 5TMDA 1PYDA 2Z4TA 2JFWA 4B7CA 3B1KA 3TBKA 1K1EA 1AK2A 1XNRB 1T0UA 1OLXA 1LF5A 1O0SA 2EL7A 5HOEA 1NUTA 3PQ7A 4RKYA 4RZQA 4YMGA 3ZU2A 2PXCA 4QDXA 1FP4A 4M2LA 2F8SA 3Q88A 1VOTA 4BPBA 1P1FA 1BTOA 2VPQA 4ZCMA 3F96A 3R8XA 2IE8A 1TW2A 1DAEA 3K0CC 1N9KA 2GJ4A 2W2LA 1RXUA 2WP0A 4WEQA 1FFCA 2X3YA 2QG4A 4N6OA 3SEZA 5FPSA 4ZQGA 4DNOA 2WG0A 4D9EA 2B92A 1E7QA 3V4LA 2FKNA 4YJHB 1N77A 2CMDA 3U4CA 2R8PA 2B82A 4ITUA 4DLYA 5E3HA 2NTNA 1V33A 4RIEA 3THWB 3KQHA 1Y6QA 1KFBB 1K2WA 1XTVA 3Q8XA 3ZU5A 1NUPA 1ML3A 3N39C 3LQ2A 2CWWA 4LMPA 4JLPA 4ZT5A 1BJTA 4NNPA 4OL0A 1VPEA 4WCVA 5C3MA 2C2BA 3U0BA 4CM5A 1M2KA 1SA0B 1ZNQO 2J6BA 2WJAA 2I7DA 2BFEB 3EDCA 1RXCA 4U63A 2X8BA 2QI9F 4I9FA 1YF3A 1UC4B 1KMIY 4UQOA 3WLFA 4D3DA 4OXKA 1N1MA 4MZXA 3U31A 4QJ4A 2IQIA 3KWLA 2BKLA 4LZNA 4O1HA 5D3MA 2VDUE 2JY5A 5DMHA 1IAVA 3KCNA 1Y4UA 4Q4AA 1VLZA 1OWOA 3BB1A 1NW3A 1XAHA 5K3OA 4E2FA 3STYA 5AD1A 5IWAB 4PAOA 1SXQA 2POCA 5CVCA 2YMLA 3WC4A 3A46A 2MOKA 4IH9A 4DRXB 3CNBA 3RIHA 1NULA 1P80A 1VJ1A 1YIAA 2PAFA 5M5BA 2FP4A 1FFHA 3SS8A 1Z06A 5MN5A 4P4SB 2XDAA 1KEVA 3LCRA 1AKNA 4QFMA 1GVNA 1A8QA 3OZXA 1QGUB 3LMKA 3UAZA 1CKEA 4N7MA 1R3DA 2OHGA 4PFKA 5AIBA 2BCGY 5KEIA 5IEBA 4ZODA 3TEFA 1B6SA 1GPH1 4D0NA 5H3LA 1M10A 3V6LA 4DCVA 2VHWA 4JQCA 4RHUA 2QB5A 2WK1A 3GLIB 2IHNA 1E9EA 4QYIA 4FX5A 1H2HA 5CLQA 5A05A 4AECA 1I7NA 3CCFA 4X1KB 4UCWA 1ARZA 2D00A 3H2KA 3L6DA 4TV8B 4WXYB 3ROZA 1TVKB 1E7WA 4KO1S 3FVQA 4PG6A 2Q1TA 3RVLA 3DE6X 3KPYA 4GSYA 2F4VB 5DKFA 4CF7A 2P77A 3U44B 4AT1A 1EUZA 1CJSA 1ZUNB 2EP5A 3A6ZA 3PGLA 3CVWA 1B43A 4UCXA 2QSJA 1CJCA 1S2MA 4JYAM 3QBJA 4Q1CA 1NR5A 1VRVA 3W2IA 2VQEB 1H4QA 3RIXA 4IDOA 1LU9A 1IDOA 2O06A 2OZVA 3TX2A 4KNVA 4MUYA 2F90A 2VYVA 4O4JB 4NF2A 1CR0A 2IOYA 4U5XA 1EYZA 2NUPA 4RTLA 4BZXA 3JWGA 3DEKA 1SQFA 3IVGA 1YR9A 2PGAA 4BMDA 3TM5A 2I2BA 1DBQA 4TLCA 1UXHA 3ONWA 3ZIDA 1L4MA 3N0TA 1GL3A 5SY6A 1XQ6A 5J59A 4O63O 1EA7A 4LRWA 1RPAA 2OKCA 2WTEA 2J0EA 3NASA 5MFPA 5DGCA 1GRNA 4H6PA 1VEGA 3KYJB 3UWDA 4YY3M 3D3WA 3TTVA 2YIMA 1UF9A 3VKUA 5FPKA 1D7AA 2AOUB 3D8HA 1QBGA 1E1YA 4DV3M 5FX2A 3R74A 3IC5A 3FOAA 2OAGA 4G0MA 5LVAA 2ZR7A 1R9GA 2CJFA 4UEQA 4I4NA 2BFNA 3DPSA 4AO7A 1B8VA 1ZQ9A 1GPMA 1EFCA 4QA9A 4JLKA 5CFQA 1RW4A 4MWTA 4WY8A 3ZHOA 1F3LA 3LUJA 1BEEA 2AG0A 3U4GA 3FBTA 5BSFA 1K8QA 4MUGA 4BFSA 1VBFA 4P86A 1JEDA 3V46A 4H1HA 3C3MA 1OBHA 5ELLA 5HK9A 3CF0A 1HT0A 3PWSA 3O95A 2O52A 1R1DA 4D4MA 1N34M 2YDXA 3RREA 1O89A 2P2LA 1BN7A 1ENOA 4ZOLF 3HWSA 4RVNA 2X0RA 5EJIA 1V3VA 5E3JA 3A9VA 3OFNA 5I7RA 3ET5A 5ECYA 4ID9A 2OZEA 2GCIA 4XYBA 1P0IA 4GOJA 4R9SA 2FS1A 1ONBA 1YS7A 4O25A 4WKPA 1DCTA 1XQWA 2GZRA 2I22A 2GYUA 3L49A 4M9RA 4LZWA 5HG0A 5AI5A 4N5NA 1M0SA 1TCCA 3WSTA 4RAQA 5DHTA 5ES3A 5HILA 4OMUA 5KBYA 1R4NB 1E3WA 1ECPA 3EDMA 4OAQA 1JTFA 3SYTA 4LSGA 2KNAA 1QFZA 4DUGD 2ZRDA 2NLOA 3UJAA 3ZHTA 5KSOA 1XZQA 2ID8A 1UBSB 2E4UA 3ETJA 4GWGA 3CE9A 4X84A 5TT1A 4F4CA 4C9BA 2UV8A 5J63A 4JBWA 4EB3A 1QK4A 3DM5A 3LW8A 5AFSA 3I9V6 1XA0A 3G23A 1A7KA 3C3BA 2NXJA 2VNKA 5AI6A 4JLWA 5JAZA 2PMDA 4HDNB 1TXGA 3GJZA 4OSOA 1TA9A 5G1PA 4E21A 2HXGA 1U0SY 4N47A 4JYMA 3PCTA 3SZ3A 4OFBA 3ZNQA 3KQNA 2ZB7A 4Q1AA 2AXQA 3HMQA 4E4RA 1R3UA 2EDAA 3UK0A 3ZZTA 1EPUA 2FA9A 2W2VA 4AY4A 1BXRA 3SHVA 2XOKD 2A7XA 3HDHA 3RQSA 3GLFE 3LQYA 4DDMA 5FI1B 2D5CA 1SRQA 4JELA 4QSMA 4OKNA 2JB9A 2PMKA 1PL7A 3I1IA 3JWPA 3GJSA 4IRUB 5F4ZA 3WL7A 4HX2A 2Q0HA 1D07A 2HUNA 1I5OA 3WL6A 1JHYA 3ND9A 4HVAA 3B7ZA 1H65A 5GIOE 4HP8A 4IIJA 2GM3A 3AU8A 4LFCB 3OP1A 2DWQA 1TQDA 2FP3A 4PO8A 4NXNB 1G0OA 2NPIA 4XKJA 1JEQB 2W6IA 3DPIA 5DHAA 3HKEA 1IONA 4Q0MA 3DNFA 5CIQA 5JQGA 3A6KA 3ETNA 4KH0A 1WBDA 2ZTCA 1DQPA 1Y6GA 1NJ6A 1JJ7A 4X9XA 2QNJA 3JZIA 1F9AA 4UHCA 3E3LA 2L09A 5ERGB 3G7NA 4TXHA 1LI4A 2P62A 1JR3E 3JYQA 4EENA 4BRUA 4DA4A 1PGQA 4D80A 3HGTA 3RG2A 4L0CA 4C0XA 3VGPA 1J8YF 1KJ9A 1AO3A 1ND5A 4QBTA 1XTRA 2QRKA 1H4VB 2RGCA 3GP3A 4X60A 4KNYA 4F6LA 5CLGA 3U49A 1Z5GA 5HKAA 2L4FA 4MGYR 3F3KA 1J2TA 3KHKA 3UJNA 2IYOA 2JEYA 3AESB 3RNLA 2RK6A 3TUZC 2AJBA 2JIZA 3KOOA 4J7AA 4C0HA 2YL2A 5TB5A 3JQAD 3QBDA 1OTHA 2JFHA 2PY6A 4HTFA 5LP6B 1WF3A 1QO0D 1AUOA 1AQ6A 5L6MB 3CUKA 3MBIA 5JBIA 5A1TA 1UDBA 4MKHA 1G3QA 1NLFA 1NV9A 1S3FA 4PF1A 1HZZC 3GEPA 5SZKB 1NUAA 4Q05A 3IBCA 1EXVA 2H4HA 3JZMA 3FYHA 3UTDA 1UP7A 4WLFA 3NFYA 3RS5A 3VYUB 2GJSA 1M54A 4MHTA 3ZBPA 2WUGA 3D8LA 4D57A 2DFDA 4ED9A 2XIQA 2FPPB 2QXYA 2WPDD 1GITA 3T7IA 2VAWA 4FWGA 3BMOB 4YUVA 4D9CA 4F1IA 4Y9RA 3ZJVA 2V8BA 3ORSA 4EVRA 3M4JA 2VDMB 1RC1A 2DZOB 2W0MA 2P9QA 5BWNA 3GH1A 3RHTA 4N3GA 2HF2A 3KT3A 2C03A 4IW3B 4GMXA 3TO5A 3R3ZA 4UNIA 1T6NA 3ICCA 4ZT6A 3VHXA 4V0RA 2P0EA 4FEAA 3OIVA 1PQPA 1EFRD 1ISMA 1I6MA 3HBLA 2XUHA 1N0HA 4DIBA 1NF2A 3BAFA 1MD9A 1NJ2A 3PC8C 1P61B 1ZAEA 2GQFA 1JMVA 1AXGA 1RQPA 1V9CA 3A1FA 2WF6A 3SSAA 1JNYA 2ZJ2A 2EJCA 3W0LB 1YAHA 2NW6A 1UKVY 5CA1A 3MWLA 1CDEA 2WOOA 1NVUQ 2BEVA 4JN6B 2HNBA 2V5VA 1LSUA 1DFHA 3VU9B 2ZYGA 4UM9B 4TSKA 3ZY4A 1KIFA 3L0SA 2ZI3A 4XIIA 1SG9A 3UTCA 5FTWA 1JG1A 3FB1A 4CL3A 5ERYA 2O0LA 3E7DA 1K4YA 1KPIA 2XEPA 3DOIA 4FFWA 3OU2A 3ADKA 4DZRA 4NENB 1I0ZA 4B3HA 3C4JA 3NBAA 3CIOA 3LX6A 3KQTA 1K88A 2OM6A 4HXEB 1G60A 3GRCA 4NYMR 2XYVA 1U1IA 1ORRA 2QV0A 3OD1A 2W2NA 1EKXA 2G06A 3LSTA 2O8FB 3ZIAA 1SHUX 4JN6A 2V7VA 1OX4B 3A04A 2G40A 2XA2A 3IT1A 1A9QA 1O1YA 2AEEA 1FNCA 1JSXA 5JZSA 3HYSA 4R2IA 1TKAA 3WRXC 5AJHA 2XH9A 3GF4A 1P8JA 2D7JA 1WXEA 4COOA 1Z75A 3M49A 3BXWA 2P5TB 2BZSA 3LUKA 4FU0A 2P27A 3VR4A 4YWJA 2RHOA 4D6XA 1NKTA 1WP4A 3PD1A 4LOIA 2OVBA 4JB0A 1YB5A 1SFRA 3AKDA 3DJYA 1FUKA 4IKOA 1EAMA 5ICMA 3I1YA 1OJLA 4C22A 1USVA 2H08A 4KPUB 2E5LB 5AVXA 3EFOB 5DHRA 3O1IC 1RJEA 4U0JA 4LF4B 1UFZA 2QVCA 4JD5A 4BXOB 3PL1A 1OROA 1G3RA 3DHNA 3O75A 3ACDA 2R4UA 4KAAA 1EUQA 1VCMA 2G5CA 3RBAA 4EMTA 2DHDA 5LCXA 4L27A 2VL7A 4TN1A 4OQMA 3TQRA 4B0PA 5KOHA 1GADO 4MS4B 3GT3A 1VHDA 4CU2A 4HO1X 5AK5A 3I51A 5FAXA 2J7OA 1EGAA 1ZY2A 2FWMX 5EIHA 2I6FA 2IK8A 1MABB 4DVJA 3CG0A 2AEFA 2EKPA 3NX4A 3JQDA 4CR7A 1QG0A 3NWOA 1GR0A 3L92A 3GU3A 1A9SA 4LXQA 5G0TA 2DAGA 5GTDA 3SLGA 2ODEA 1ZCFA 3DZKA 4QGGA 1ZMRA 1P7ZA 1D1TA 1K3WA 3L8EA 2F8MA 3SY8A 1DZ3A 2JGDB 2HLDD 4IMJB 2WM3A 1RWWA 2HV9A 2N75A 5KX5A 3NVKI 3M4XA 2YYAA 3VYTB 5FV4A 1G71A 1WF6A 3KTAB 4Z5XA 4GOKA 4YONB 3EZ2A 1ULUA 4BIIA 4XCQA 3M6FA 4P98A 4ZZ0A 1O58A 1A4IA 1O95A 2JBWA 4I14A 1OWNA 2DAIA 2VDOB 3WQRA 1NMZA 5E7MA 3GW8A 1QAOA 1NVVQ 2CZCA 3P71T 1E32A 3IPLA 4XJVA 3AF2A 2EZ9A 3GLGE 3FCUB 4NARA 4G0NA 4MJ3A 4M7WA 4OIFA 1X1CA 1IZ9A 2D1SA 1POXA 1V71A 5FL7D 2ONYA 4A2WA 2OHOA 3JARB 5F2NA 1KC3A 4N12A 2ZJBA 3RV3A 2ZEJA 1DZIA 1EJ6A 3KB2A 1CJKC 2VR1A 1L0BA 1Q0PA 4GHWA 2VJAA 3HI6A 4GH9A 5KPTA 5IH7A 3CLKA 3KBBA 3URKA 3ESYA 4JBNA 4NBLA 3CKMA 4MQEB 4RENA 3REGA 4HEHA 5JI3E 2VJLA 1H2WA 3CZCA 6YASA 4U8HA 2CHVA 1DDIA 2I1LA 4D9JA 4NICA 4N3CA 1E98A 1GSAA 3VM6A 1L7VC 4C06A 5BN5B 2CMKA 2LR0A 3AJDA 4BAGA 1V2HE 3BEOA 4BUJA 2ZTUA 2ORYA 3B36A 2C8VA 5TQVA 3VVMA 3GJ0A 1ZC3A 2LTUA 1UBEA 4IH4A 2Z04A 2CT8A 1BH6A 3B3QA 3G2OA 4LYEA 4JI0M 1MLDA 4A2CA 1Y82A 1DFGA 4TMZA 3PC2A 3ICVA 2WZBA 3BGSA 4TRRA 2LDXA 2GUGA 2M6RA 1K06A 3F8WA 4D9GA 2W0SA 5DISB 5TXGA 2YVLA 3NS7A 4JXXA 4MWCA 1H0KA 2ZQZA 4FC6A 4LOLA 1UK9A 4JITA 4JLMA 3BREA 1THZA 4X65B 1PHPA 2IEGA 3BK1A 5ILOA 1FOEB 5ALPA 1P2DA 4DQUA 4PC1A 4QG7A 4WKOA 2Q4TA 2D8MA 2ZQ5A 3PDIA 4OV6B 4UE3S 3OZTA 3A28A 2IS6A 5C31A 2A1UB 2GXAA 2H4YA 2QHXA 2Z4SA 1NV8A 5H80A 1Z2PX 4UXHA 1T0JB 5LA6F 1UZLA 5AVJA 1JQLB 4F3NA 3COVA 3GNQA 1E69A 3AHIA 4BFTA 5JLJA 1V3TA 1A8IA 4YX9A 1KHTA 4NCAA 1WIVA 4CM3A 1QMPA 2YZ7A 4CQMB 3E23A 2W6JD 3KS4A 1PDOA 2PUTA 1PFQA 3JAWA 2ADMA 3EGOA 3EOZA 2OOAA 4URWR 5JXHA 1KY3A 4K3VA 4LRTA 3ROMA 3DWGA 1Y33E 3UCFA 3DC7A 4F71A 3EXFB 4LHSA 4N5MA 1U8ZA 2JS7A 1IXSA 5BR7A 5IVIA 3TIXB 4FDMA 3GFFA 1MQ9A 3DZFA 3V33A 4P31A 1GPDG 3N5KA 3TLKA 3B70A 4CJXA 2C9MA 2XXJA 2N47A 3LPLA 2RH5A 3C24A 3FIUA 4DIKA 4GGOA 3INYA 2CLFB 4WBXC 4I5DA 4N82A 1JJFA 1I33A 2H54A 4ZVKA 4YJGB 1C14A 3MGBA 3PFCA 4EJ2A 3OF3A 4L6V6 1RXWA 3L77A 2W2TA 1MP0A 5LZ7A 3QEBZ 4LWZA 1F0YA 4EFMA 1NRXA 4GZ5A 1WUYA 3QVGA 3FHTA 2Z95A 4A3VB 3HFRA 1GCGA 2XCRB 4TYYA 1ECGA 1F0KA 3QELB 1JQKA 2KBFA 2FRDC 2RGRA 4ILKA 1EHYA 3JAKA 3UKJA 1GLGA 5CT5A 3R7AA 3TAHA 2ILTA 1UBMS 2QM8A 1SXJD 4BKQA 3ZV4A 3MNFA 3EZLA 1DKOA 1EQUA 3HNRA 5E38A 1BHO1 2CHGA 4W9MC 2ODNA 4X1IB 3TTWA 3GJQA 4S2EA 1NN5A 3C39A 4R4JA 4Z1OA 1U2QA 3IUSA 3CTWB 3HLTA 2GR9A 3B3GA 2RI0A 2E1RA 1O9HA 4TWJA 3KT8A 2HLHA 2ZUUA 4RE6A 3OX2A 1MIHA 4IICA 2IXTA 3G2NA 5TMPA 2IXGA 1AURA 3MCZA 2J5BA 2FMHA 2PSFA 4NONA 5CP8A 3WLNA 4DR2B 3VO8A 1EMDA 3SMSA 1X0XA 2QL6A 2I3ZA 1NTOA 2AE1A 5J4HA 2I6QA 2FMXA 1Z6ZA 3AVYA 4GPBA 1RJFA 3LQFA 4QREA 4PS0A 1MT0A 2B7LA 2YJZA 3ROKA 3TD2A 2VP6A 2WF7A 1DT3A 2H59A 4LYYA 2ZETA 1FK8A 2CMFA 1HQDA 3WLHA 3JPWA 3T4PA 3VDXA 4BNIA 3QH4A 4U1RA 4A5SA 3ZXXA 3ZS9A 2RIRA 2JI6A 5KJ6A 1ZHHA 5CBPA 4YRQA 2RGGA 4HWKA 3L06A 2Q0XA 2WOJA 4M0WA 4PRLA 4DMMA 2D5BA 3I2HA 4XQEA 3LC2O 1KGSA 1THTA 2OQ2A 1C3OA 1F8GA 5CVVA 4MVJG 2APJA 1U94A 3E0XA 1NBIA 3TSWA 3ZGXA 1SC9A 2X0NA 1UT5A 5KYWA 1Y48E 1NT2A 1YJ8A 5EZQA 4HAYA 1T2EA 3OQJA 1R8SA 4X24A 3BGVA 3W9SA 2F59A 1RDFA 4BB9A 4BEBA 4E5VA 3FAZA 5HS4A 4F45A 3O03A 3MW8A 4M0LA 1ODFA 3OE4A 1E9CA 3OKPA 3K9FC 4OX9B 3K9OA 4BVBA 4BNJA 2HHHB 2VTEA 1WS6A 3SJCA 2JFZA 4XR9A 1MQ8B 4HVTA 5C35A 4CM9A 1G66A 4AF6A 4R2XA 3VNRA 2Q3EA 4XSVA 3USES 1WZCA 2ZUEA 4GWLA 3VR5H 1AKRA 1O4VA 4EY6A 2LPMA 2QPLA 4IZIA 4Q18A 3TQSA 2ZTVA 4YP5A 4G24A 3GFOA 3RJ5A 3SP1A 4ZQIA 5K0SA 2YDYA 4Z4FA 2J09A 5A03A 4AFNA 3KZCA 2GYWA 4XUCA 4EDHA 4JGIA 4XR4A 5H0IA 1KWGA 4MMYB 4KN9S 4TXNA 3DEJA 1H1LB 1YKGA 2GN9A 4TKUB 4IKPA 3OUUA 3TKLA 2Q8QA 2VNAA 4I1VA 5K8VA 2UYCA 1FLNA 4JI7M 2H18A 4JX9A 4B3RM 2FX5A 5I7UA 3IESA 2P30A 2J5XA 1KFJB 1XLTC 3WYDA 4I9NA 4OHUA 1ZJZA 1MENA 2EBHX 2HDNB 2YWFA 4BCCA 4I55F 3HKPA 4MGKR 3PDHA 4PPNA 3I2IA 4BLVA 4C03A 1T0PA 3CY6A 3T9EA 5A2QA 5GADl 3EVDA 1M6VB 4O59O 1DAHA 1DBRA 2WSEF 1XF1A 2OV2A 2Y77A 2Q2OA 2R7NA 1EUDB 4K6GA 1GU7A 4K9NA 4CUJA 1LBEA 5JU6A 1ZH0A 2C7BA 4LF6B 1UWVA 2LKDA 3KAJA 4X6XA 2IP2A 5D8DA 3E5HA 4X8OA 3I9FA 4YPOA 1PBNA 5FUBA 1DXYA 3PC7A 4MQLA 2CL6X 3GFTA 2CZGA 3DAFA 5JJCA 3G0DA 3SOZA 5LD2B 2B2XA 2JDID 4QICA 1OLSA 1TVCA 1DEKA 2XQKA 1WZIA 5LQJA 5IP5A 2WJGA 1LNZA 1UK8A 3DVRX 1YU9A 4RYDA 2I6XA 4XD7D 4RAOA 4N9QA 3C70A 3DAGA 4PWZA 1JA0A 4B3JA 1UK7A 3HJRA 2IYAA 2VH5R 4N39A 2FFRA 4BC1A 1UKAA 2AHMA 1GCUA 2XEDA 1UAAA 1YBFA 4CI9A 5C1IA 4M86A 4KE7A 4JLDA 3TCXB 2FUEA 2PDAA 4AJHA 1UJCA 3TKYA 4MEBA 3NC4A 5DW0A 4ECEA 1OKKD 1R66A 3B7PA 1E2KA 3Q8WA 4FFLA 4D8VA 5AM2A 1QE3A 3CGWA 3PGVA 2DPGA 2OUIA 1NW9B 4Q1VA 1A72A 4XH9B 3IALA 4P0TA 2NYUA 2CNBA 2EBFX 2YMQA 4D9MA 3OT4A 1GFWA 3AKZA 4GW3A 3LU1A 1KA9H 2WFAA 5FLXA 1Z5VA 3I5AA 1KSGA 1V7CA 4UNQA 1H5QA 3CNQS 3B38A 1FTYA 3AJ9A 2PRZA 3IV6A 3WYFA 4BQNA 4GMGA 4YDQA 2AC4A 5KYYB 2JGAA 4RGQA 2ABWA 2QAIA 4JHLA 4BX8A 1N5OX 1VCOA 3UJHA 3QI7A 2XSZA 3B74A 3E7XA 3RJ9A 3D4BA 2OGTA 1PG5A 1EFLA 1MC4A 5AUOB 2BCEA 4U2CA 1V9LA 1HC7A 5FFNA 2C5EA 2C9BA 3HL4A 1BEZA 4QUKA 3ST7A 3NCHA 3FYUB 2DWUA 3O83A 8LDHA 2YJNA 4XJSA 4BNXA 1NVTA 4DVGA 2ZRHA 4E22A 4L8FA 1GJSA 1DO0A 5FNZA 3SEAA 2M6LA 4X66B 2PO7A 1QYCA 2IKSA 3LNTA 1GY8A 4KW7A 4HWGA 3PNYA 4MVJM 3QX9A 2NO6A 3LCJA 5A0FA 2CCKA 3BIFA 3SDSA 2R4TA 3BE5A 1YE9A 4N01A 1FX1A 3BD8A 3F9RA 1SKUA 2UU9M 4MYUA 3OA0A 4Y6QA 3FOEC 1PK9A 2PN1A 2HYIC 3SMPA 4UAGA 2WSMA 3WBFA 5A3JA 3JAMS 4PO1A 5KYUB 4GQBA 1CRWG 3S68A 1W94A 3Q7EA 3JZFA 4HWTA 5LU8A 5TNXA 4IQ8A 1VE1A 5HMMA 9MHTA 2XUKA 2XLJA 2HD4A 3HKDA 2HA6A 5AM3A 4RV4A 3K20A 4OJQA 4BY9E 2G5GX 2VDLB 3L05A 4WJKB 4DXDA 3ZQJA 3DL0A 2I71A 4WD3A 4MR9A 3R09A 1XTBA 4QOZC 1UP4A 3RVKA 1AGRA 1UJNA 3ANMA 1COWA 2C3OA 3HCRA 3WLAA 5HCUA 1Z13A 3BRCA 4JT2A 3ML1A 5HCIA 3U1VA 3NNNA 4A7PA 1SCQA 5JC8A 2Q62A 4AYWA 4UOQA 2C07A 5GZ6A 1Y7LA 5IJWA 2QMUA 2IYVA 1N7GA 4KVFA 1RRCA 2B78A 2GN2A 2GQ0A 3EPPA 4HYQA 3DE1X 5JDIA 3PDWA 5ULLA 2XLBA 1N2SA 4XRGA 3AUFA 1RXEA 1WSBA 3MC1A 3GRKA 4CFYA 1U6KA 3BXGA 5HE9A 4BV9A 4GYYA 1G8MA 2ZAOA 4EX6A 3F78A 2E6KA 4BO9A 1ESNA 1SR8A 2XDWA 4GKKB 3F74A 2GXSA 4E2XA 2RBGA 3IEPA 3IQEA 2ES4A 4N3NA 1FTSA 4HGZA 3M9LA 3SKYA 2V55B 5F3RA 3G88A 1U80A 2QRHA 3INNA 3EA5A 4YFYA 5JTUA 4JEUA 1KI4A 3LQ4A 4Q7KA 2Y1FA 5HQ3B 3GG9A 3A10A 4A8HA 3L7AA 5A3RA 1I4DD 1LTKA 1DDGA 5LXTA 4AD8A 3OZUA 5A4JA 1XT6A 4NZNA 2PPVA 2YWBA 5E6RB 4H1WA 2X6QA 4YB8A 3AHFA 1K5PA 3ICEA 1JVSA 1YT5A 4BMOB 4YV7A 3H0EA 3TDMA 4X95A 1ESMA 2RHRA 3FCEA 3STHA 2KM1A 1YZUA 3PK0A 2KYRA 2VAPA 3EEQA 4KI0A 4P34A 1N1DA 1VXOA 5M29A 2XQJA 4FJ0A 3F1LA 3BL8A 4FGUA 1NVFA 3ZWOA 5DP2A 5FA5A 2Q6TA 2GBLC 3QA9A 2VJPA 1TFUA 1RQXA 2FUG6 3MCVA 4AZ3B 3HU1A 2F43B 4GPEA 1OI7A 1PUIA 3ZDCA 1IOWA 3D7NA 3B51X 4IQ4A 4FNMA 1R0LA 5IDQA 3PYXA 2YOFA 1QMGA 2OOKA 2PSEA 3JYLA 1YJ5A 3L0BA 4DR6B 3GELA 4Q9LA 4OUDB 1HUQA 3L3BA 1N1EA 2Q3FA 5GZ3A 3QMMA 1HTTA 5JCOA 4W82A 1EVLA 1QIIA 3KJFA 2GCOA 2WWWA 3OX4A 4EGSA 2GPTA 2FX3A 2CLLB 1C7JA 2PKQP 4NMXB 4M54A 3QJYA 4HXFB 4HEA1 4Y28F 4QTYA 4OM7A 2HTEA 1FEZA 5HSGA 1LK7A 3KUUA 1PQ4A 1E61A 1IVNA 3EISA 2YW9A 2UUBB 3DV2A 1ZD9A 3OIGA 5D6OA 1ZKDA 5K0ZA 2ACVA 1IUNA 3VOAA 1WXFA 4ZVRA 2ZI5A 4CETA 1PL8A 3IP5A 4JR2A 1FP4B 4DIFA 3TR6A 3UMMA 3I9KA 5DLYA 3ZD8A 1YV9A 2QZ4A 4AJIA 4H08A 1SVLA 5HNKA 5L3ZA 1R2ZA 1JI3A 4V0NA 5DT9A 4WY2A 5DN6D 1B41A 2WWHA 3TMYA 1HI9A 2I1QA 4JJ7A 1NUHA 1FJGB 1T2FA 3SS7X 3VXKA 2BGLA 4OHMA 5EE5B 3AHEA 1S8AA 3CVJA 2MU1A 3IEIA 1Y4ZA 4YMTA 1Y1SA 1LWOA 3CR3C 1FFAA 2ZIEA 5BSWA 2FV8A 1TO1E 1KFCB 2CJXA 4C29A 5JARA 3T1HM 4WXHA 1RM5A 1CUDA 2ZDQA 3WKBA 3HHEA 2HJGA 2DAMA 4OXIA 5C80A 4OGFA 3T34A 2YNMA 3Q8XB 1Z68A 2PZ8A 2KMLA 1YBMA 1T91A 5I5GA 4L5YA 4JOBA 1Q0UA 4Z0HO 2PA3A 4H3KB 1NHWC 5JADA 1ZW1A 4QO8A 3CVVA 3ORYA 1W96A 2QLLA 4AM8A 2V96A 3MTEA 4YV0A 4AW9A 2II6A 1T43A 2C3UA 4U9UA 1RJDA 1DJLA 4ANFA 4CHTA 1VSUA 2CXNA 5LMUM 4C0SA 2JKYA 1RI3A 1MQAA 5JMOA 3OD5A 1S3GA 5B4UA 3T1TA 3CJTA 2QT0A 1F7VA 1LLFA 3II6X 2KXEA 2Q4RA 4WNCA 2ZB3A 1SVNA 4ZPXA 2Z1NA 5JFGA 4C6TA 3WB9A 4E03A 3K31A 4JI3B 5H8WA 5D3MB 4RH3A 4CKCA 1ST2A 1GTMA 3THGA 3MUNA 1Z59A 2QG9A 4XWGA 4ZOQI 1Q44A 4Y2VA 4Q4AB 4EI7A 2G07A 1W25A 4LJLA 4U2GA 4WLEA 1CNEA 3G2KA 4X92A 5KDDA 4OGKA 1GG8A 3QHAA 1ZC4A 1MB4A 1SBTA 4R8MA 3IXMA 1HNZM 3LKDA 2BV3A 1LQUA 3NTVA 3S0JA 1S2DA 1PLJA 1XTTA 4XVHA 3U9LA 1I3KA 1KEKA 1ZA1A 2CNWD 3IEMA 3EEYA 2FP4B 5EUMA 4E0BA 1KORA 1N5KA 3RYHA 4JJEA 1QH9A 2AKYA 2F9LA 1NJ8A 4DSTA 1GVNB 1PKXA 1LEHA 4L51A 1JAXA 1PL0A 3GCZA 2VHVA 3LL4A 4CPDA 5ADVA 1CRZA 4DV2M 1OC4A 1D4OA 2XMQA 4MUKA 5JSZA 3I42A 1VHLA 5DFAA 2NQ8C 2YQZA 4U7DA 2O01F 2JI7A 5KSPA 1L8QA 4JI4B 4ON9A 2VJBA 2GILA 3OHMA 2B4TO 2EZUA 4EG3A 2LNHC 5DYIA 4QYIB 3DULA 3CB4A 3MLEA 2E5WA 1JSZA 3ACCA 3BUSA 4WAUA 1BMFA 4QBKA 1VRCA 1VXRA 3U3DA 4ZQFA 1ZDMA 3I4FA 2Y0EA 4RQAA 4E88A 1VSTA 2O3RA 1L5SA 1CUEA 4RTMA 4RWEA 4LOJA 1XJ5A 4XVQA 4L15A 3AF3A 2CFCA 3WDLA 3D3EA 4RCZA 1NL3A 4S1PA 5UKDA 1YVEI 3LYLA 1LDNA 1Z5OA 1W6RA 4QYTA 3KP1E 1I2BA 4LZAA 3Q8MA 2ZR8A 2CNKA 2KE5A 1QX3A 3FHOA 1YL7A 3AM4A 3W8EA 2NUPB 1Y0BA 1EK1A 5JNSA 2AD1A 2XNJA 5IVPA 1EDDA 3V3TA 5DNVA 5LQUA 1K8XB 2P79A 2CEAA 5F1YA 5CEFA 1RQ2A 1IQRA 1KFVA 3VSCA 1TEXA 2XBUA 2BSQA 1I1OA 4A26A 1SXJC 1XCPA 1VL1A 2YR0A 1SZJG 2VZ8A 4XK8F 3L79A 2GVDC 2G9RA 3SJUA 1JZTA 1ISRA 1UC5B 4BATA 4W8GA 5BXYA 3P9IA 2ZGVA 5JAHA 3D3WB 2H8KA 3ED5A 1Y3CE 2CLCX 1AXRA 1F17A 2HXYA 4V0ME 3T4EA 2A2ZA 4FFBA 3B7NA 3C3XA 4YAFA 2WNSA 1G63A 1DRKA 5CB4A 1PGOA 1V3UA 2XMZA 4HLQA 5KIAA 2FN8A 1X9IA 3A06A 3L7CA 3ICOA 1F2DA 1RHQA 3NOOA 1MNAA 5B1YA 3EDQA 1H2AS 2FWBA 2PH5A 1CY0A 3OE7D 3L29A 1NFRA 2J87A 3G79A 4X8HA 4EF4A 3IUBA 5EQFA 4LXGA 1Y6FA 3ONFA 2VDQB 4D0GA 3COYA 1RHKA 5BMVF 2KJQA 3VSEA 3QUCA 1J9EA 4QPCA 3UIEA 1OFIA 3M9XA 4CMHA 4E12A 3AEXA 3P0JA 4HEQA 4C4RA 2I8CA 4JXZA 2EWMA 2BMFA 4NOMA 3WB2A 3PDUA 5CDTA 1KEWA 4IXDA 2P2NA 3EVEA 4EFLA 4B3MM 2JJQA 3OLXA 1KRWA 3SHGB 5FP0A 5BT9A 2B21A 4ETIA 4S1WA 3OJFA 4KO2S 1QYDA 3KJNA 4IVRA 4BTEA 2DENA 4MRPA 2G9ZA 3DDUA 3PQ6A 5A04A 3ISVA 1BNCA 3O9ZA 4KAFA 4DNQA 1U7HA 1OI4A 2WMDA 1K6EA 3NB0A 2O2EA 4BFXA 5K3BA 2HMTA 3FCYA 4IDCA 2XYPA 1XU9A 4WRRA 3OZAA 2FYTA 5TPWA 5LR6A 4HRAA 3NM4A 1E3WB 4Z0NA 2VJKA 1GOTA 4GM1A 3LW5F 4L3VA 2W6MA 2NXCA 1DOZA 4FFNA 1WOMA 3PFFA 2PGXA 4JBXA 4TQ9A 2OXIA 1R12A 1ZR4A 1YR7A 1RKVA 4Q1EA 1CR6A 5IVDA 2OCPA 2G0TA 3LC0A 1JTVA 2R6R1 2QM7A 2YW2A 1M2WA 5REQA 3P9QA 1IUPA 3T3GA 1IHOA 1WLYA 5DMXA 5ALGA 2JZNA 1NXQA 3QWAA 4BBPA 4BKRA 3HJNA 1XXHE 1KIAA 3ELBA 1TM3E 1PWYE 2WAAA 4EELA 2ONZA 1Q1BA 4ZO8A 3R7DA 1NW4A 3ZDRA 3TZCA 2QAGA 1VE3A 4AUNA 5PGMA 1SU6A 1ZX1A 1O5IA 1BXRB 1SUFA 3B6IA 3N28A 4L8RC 3QEMA 1ECFA 3AT1A 3SBDA 3K9CA 5EZYF 1PR3A 5COAA 4GQAA 3REQA 1W47A 3AI2A 3GRRA 4CIYA 2JHCA 4IINA 1T5LA 5EHXA 3FVRA 4IBKA 2OFWA 2BFWA 2BN4A 4HYTA 1WY5A 1ZK1A 3AYZB 1UQUA 4IIJB 4CNBA 1FFEA 5FLEX 5KPJA 1NKVA 4MWEA 2XUGA 4EL5A 2PGNA 2Y71A 2OCDA 4YRFA 1M1YA 3HKEB 3SXUA 3K9GA 3E27A 2HBRA 5JNTA 2P65A 2Z5VA 5JQGB 3T38A 2IFTA 3FZYA 4C7VA 4IOLA 3BC1A 4ZPJA 8ADHA 2FH0A 1FIUA 2QXUA 3A3OA 4E15A 3REFA 2VNJA 4UU1A 5TEWA 1SCDA 1EM8B 3Q10A 2UXBM 3WO0A 3GBVA 3BXHA 5T41A 4IS3A 2WLSA 3VTAA 3NC0C 5LYJA 5H9VA 4TLDA 4O1IA 2Q2QA 4ZA2A 3NNSA 1DUVG 4PLCA 3TQQA 3ZD6A 3MTDA 2OXEA 1X7HA 5C4MA 4I5IA 5FB3A 4OJKA 3PQ3A 4K81B 1M0WA 1DPGA 3D1JA 2W70A 2I4LA 9ATCA 4LIPD 2X4AA 1LI7A 1YS2X 2E21A 1GN9A 4S0ZA 5B7QA 3ZDFA 1EM8A 1QR2A 4B8YA 5GM2A 3K0FA 4IO0A 1XCOA 3OUZA 4YJ3F 3O1LA 1IIBA 4FR2A 4A36A 1FMCA 3PRHA 4HTFB 2H52A 3RHZA 4E33A 1DQRA 3LV8A 5BUQA 3LUCA 4KXMA 1ZH8A 4O4HF 3OOJA 4PDGA 2H4FA 2GJ9A 4DLLA 4V39A 2P2GA 2D2VA 3PP8A 2GAAA 3HN7A 2OBMA 1HMYA 3M7IA 2P6NA 2WHXA 1YDHA 4RSGA 3M0EA 5BW6B 5JAIA 3T7TA 3U6CA 1CULC 3ZTTA 1YACA 4KOEC 1AS2A 4OI0A 4MLZA 4K0KM 5M04A 4PSCA 1J70A 3PDJA 2Q7OE 3TLAA 4OP1A 5D7NA 3P4XA 1X1EA 4IXWA 1XE3A 1DC6A 2XD9A 3IPCA 3W8FA 4MW2A 2FPMA 3ZV3A 2RH9B 1NN3A 1OPRA 3W34A 3LAWA 2KWIA 1RHMA 5J3JA 3FZNA 5DBIA 3DMPA 3OG9A 1IMJA 1Y9ZA 4TV9F 1OYVA 1N5JA 4DV6M 3U6EA 2DETA 3SBXA 7CATA 4EKEA 2OBLA 2BY4A 1P5JA 3KR2A 4QU8A 4TVBA 3OTOB 1Y4DE 3VHXB 4QD3A 4EPWA 1TM2A 1H5UA 2HWJA 2M1XA 3DWEX 2NU9A 1G2OA 3OCCA 4WA7A 4D8XA 3A1DA 5ALLA 3UQZA 2JP7A 5GJBA 2XZPA 1V1JA 1H4TA 4WFKA 2F8TA 3H83A 2NO5A 1ZR2A 4MR8B 5AVQA 1AQLA 1IB0A 2QW8A 2PT6A 5LZ9A 2VYND 3BFPA 4K5QA 4KLRA 4ZGBA 3DBLA 4RUKA 5CA1B 1WKVA 2BEVB 1VL6A 3WHIA 4J0FA 3KD3A 1NIJA 3R6WA 1KYZA 1KQNA 5BSMA 1DXQA 3KFUG 5I01A 3SAVA 4Z54A 5AKJA 2QG6A 1ZJ6A 1NNUA 3WICA 3W7BA 3UUEA 4HFNA 4C0JA 5FIUA 3QVUA 1OQAA 5CJPA 3SVZA 4CE6A 2ST1A 1D5CA 3KAPA 4QVKA 3L7JA 2D59A 5LQKA 2QYSA 2UYGA 3HJTA 3V1UA 4MR8A 4RY9A 2X0JA 4QRIA 2PKQO 1R5NA 1KY2A 2Q7XA 1H8HD 4NU0A 3C16C 2AZ4A 1QP0A 4KIWA 5KVCA 4HXYA 4Y3UA 4UBIA 3R3XA 2IGBA 3BK2A 5EE0A 1CZUA 1KO4A 1ZIXA 1UKCA 4YRMA 3BD7A 1U3VA 5P21A 1QAQA 4IIVA 3O1JC 2CFOA 3ZWKA 2VCHA 2QS9A 1SUAA 3H5IA 5LKRA 2LWXA 1KH1A 3DG9A 3TNFA 2EG9A 2ZS7A 5C1BA 1GUBA 1H3EA 1NJGA 3GFRA 1XLUA 4H0FA 4EBBA 4A8PA 1USKA 1GYQA 1GRCA 2QR5A 4JB3A 5AW2A 2WC1A 3PVZA 1XWFA 1JXMA 3I30X 5EXXA 1Z6QA 3H5LA 1X77A 4HNQA 1XZIA 3IXQA 4C2UA 2O54A 2CYCA 3KKOA 1GKLA 4CW7A 4F12A 3D4PA 2YJ5A 2VT2A 3CO5A 2F3SA 3UNXA 2VF8A 3PXGA 1RT9A 1W0JA 2W43A 1ZOSA 2ZM6M 1TR8A 1BRMA 1JQDA 2BM8A 3TR5A 2YJ4A 4BVKA 1G21E 1X2BA 5LMNM 1OFUA 5KOHB 4J90A 1QLWA 2QNIA 2ISCA 5L3QA 4RVFA 1OKSA 1DHTA 1B3BA 1L7NA 1JQBA 4C4PA 3RJTA 2JFGA 3U4IA 1MTZA 4X20A 1OFVA 4RSRA 2J5KA 2P2YA 1L1TA 2B2CA 1A1VA 2XUFA 4I2VA 1GL9B 4LZOA 3L7KA 4OI1A 4DNPA 4H77A 4B73A 5JISA 4MVJF 1RQRA 1TH4A 3LA6A 2JEZA 2XOEA 3FN4A 1PVVA 4LVCA 2WRZA 4GKBA 3PUVA 3ZV5A 3LDGA 3M6LA 4DLZA 3D6UA 3TFQA 4C7XA 3QA3E 3IP1A 1B74A 5KX5B 4EUEA 2PMCA 2ZDGA 3V4FA 3CEPB 1WUHS 1IDN1 2VT6A 1BYIA 2PGOA 3EVTA 4M83A 3B3AA 1ZINA 1B14A 4C6SA 3CE6A 5CGQB 3FF4A 3UJPA 1HYGA 2WE8A 4JYCA 4R84A 1BWSA 2ZROA 1P3JA 3GPIA 3PD7A 2A5FA 3DXFA 2H16A 4GR9A 3WDKA 2YJ3A 4KN6A 1VLHA 5EJMA 1N92A 3WFJA 4JI2B 1OXVA 3QV1A 1YK1A 3MMNA 5G3ZA 1K9SA 1KYQA 2FETA 3A6EA 3OLYA 2OBFA 2P41A 2RGHA 4WJZA 3GLRA 3SJ7A 1YC2A 1WXDA 3M8KA 2I7VA 4FVMA 5L6LB 3U4HA 5EIAA 3H19A 1VEJA 2DFKB 3SQWA 5DGDA 2IVZA 1T3HA 4G1EB 4EJSC 4Q48A 4W5RA 5D6NA 2SICE 1QH8A 4RFSB 5JNLA 4HF7A 5IX8A 2GVZC 1ONPA 1ODIA 4FE4A 4M3NA 1HNNA 3QIAA 5LM3A 2IUFA 4F4JA 3VH4A 4L0MA 3E7WA 4HHEA 4LYHA 1AV6A 5KOJA 1PJJA 3JR5A 5A9SA 4HFMA 1RE1A 4ZI2A 2IUTA 4KODA 3MT0A 5EMLA 2BFCA 3HNPA 3DEZA 2CEKA 4AZTA 1CJTC 4K1LA 1TD1A 2HRDA 2PNFA 1T8WA 4HB4A 3BQNB 1Z9BA 4TZ0A 3T1NA 3ESCA 4UFPA 3A9SA 2QRNA 4RFSA 4O5OA 3TE6A 2FR0A 4OL9A 5AVSA 3D6TB 2KSQA 4OEHA 2JAHA 4BGVA 3U48A 4HS4A 1T2VA 3GEMA 4EMUA 2O0MA 4D9KA 3LXUX 3D5TA 2CXQA 1M8FA 2RFLA 4REQA 3RD5A 5ICCA 1T8TA 2K9DA 1Q92A 2VVTA 1ATIA 2BISA 4EQ6A 1Z5BA 2OFPA 4KO8A 2NYAA 2V3WA 1ORWA 1IN5A 3GGGA 3HA7A 2G17A 1T9GS 4P35A 2GEDA 2XECA 3R3HA 2Q7DA 3PDIB 4JKIA 5EJ7A 4LQCA 1VLVA 4C4SA 2QI9C 2I54A 1GYPA 2V7BA 2I91A 1F4LA 5JBNA 4QL3A 1T1SA 1XMOM 3PKJA 4I36A 2CE2X 4JUFA 4EG4A 5FTKA 1D6JA 2WKWA 1IOVA 3F4BA 4G5QA 3KELA 1X9GA 4PZ9A 3NATA 2E1PA 1G3MA 2DERA 1W9HA 1VHJA 3KU1A 3EUWA 4XM2A 3O8RA 3O8BA 3JAWB 1KEEA 5J2TA 3HKBA 1F2UA 4YPVA 4LRTB 3T3IA 4G8BA 4CMEA 3WV4A 4BUCA 5IZCC 2AFIB 1JDVA 2AK3A 1H0SA 1IXSB 3NCTA 4HOYA 2D2IA 4U7HA 2MR9A 5AW3A 5KWSA 5KYNA 3H6GA 1I14A 3U3XA 1V0JA 3WZ2A 1A7UA 4B6EA 4PCLA 1TJNA 5A4DA 5C4GB 4KL8S 1Z4QA 3IELA 4UARA 4UHEA 1UMDA 2QTZA 1N6PA 4YP1A 4G4SP 1QLJA 1GGHA 2DWCA 2Y1OA 3M81A 3ZS8A 1M6HA 3F3SA 4MIOA 2AWNA 1LQTA 3ASUA 1KZ1A 4JQZA 3PEFA 4X71A 3EAGA 2J7PD 3O0DA 2ZI9A 1WTAA 2AFIA 5H70A 3O2QB 4ZARA 3QVGB 1OI3A 2Q4BA 4M98A 4OU5A 3K9LA 4PFJA 4LC1A 3CF6E 1GFSA 2AV6A 1SBZA 3WIDA 3JAKB 4G0VA 1Q12A 4FCWA 4GMFA 4J16A 2HCBA 4HWSA 3KU4A 2FLVA 3EOAI 4KMOA 2C0CA 2B8JA 4FFDA 2B2NA 1QO0A 3DW1X 4WKGA 3G0GA 3QMPA 4IOKA 3OTWA 3MBKA 3UICA 1A97A 1DWUA 2G6BA 4RJ2A 4FMCB 1K8YB 4KACA 3KEFA 4KXQA 4V24A 1K7SN 4B6JA 1TYBE 5BT8A 3IAS6 1AUXA 1QHXA 4JR0A 4RS3A 1FRQA 4M0UA 4AXXA 2X22A 1M3SA 4CUKA 1SM4A 1MAUA 4IF6A 1KI9A 2HL6A 3DQQA 2O48X 5KNCH 3TR0A 2ZCVA 2PK3A 4YMVA 1IJEA 3T9DA 3S5UA 2VRCD 4L4YA 4EMSA 2K2WA 3FWHA 3RPEA 3NDBB 3PUIA 4LI3X 2CJYA 3E3MA 1BFDA 5DVZA 4TQAA 3KQYA 2QD3A 3SQMA 4JX8A 2LP4Y 1XDWA 3C7CB 3N5CA 1UPTA 3EGEA 5FBWB 2O7QA 2CJPA 3WXMA 3DD1A 2GHQA 4NPCA 4PSAA 4UC0A 3MS2A 3AF6A 3AVUA 4B08A 1TUBA 5CBPB 3PGMA 2BGNA 3VUEA 1XU4A 2CK3D 1BKSB 1FJ2A 1ATZA 4G4RA 3B5EA 4NABA 4JI6M 2BGJA 4MHSA 1U0FA 1OXBB 4MUAA 2BELA 4TXLA 1JA9A 1C3OB 1SCNE 1U1DA 3BJZA 3MXTA 1U0BB 5HIMA 2GDZA 3HCCA 4XJTA 1C30A 4HXGA 3E9NA 3FNHA 5KYWB 7ADHA 4G97A 3BHIA 1O57A 1XTSA 2XFSA 3S5JA 1VJTA 4ZV4A 3L1HA 1JXOA 2JD2A 3FHCB 1PGNA 2AG5A 1MRNA 3ZCUA 3O5AA 3IEVA 1PRYA 3N59A 1CUSA 2A59A 1Z4MA 1GAQA 4W7HA 5IARA 1UBOS 4Z8YA 1GT91 2AYYA 1C4WA 3W5DA 3KJGA