1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Methyltransferase
molecule keywords RRNA METHYLTRANSFERASE
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
4P7FA 3P2IA 5E8RA 5GP1A 4PGHA 4DA4A 4QDJA 4LWOA 2OB2A 2CMHA 4IV0A 2AVDA 3AXSA 3G88A 4IV8A 4R6XA 3S68A 10MHA 2CKDA 2JH8A 3EVDA 1Y8CA 1QANA 4YUVA 4C08A 4MWZA 4ER5A 3EPPA 2DPMA 2GB4A 4FGZA 2JHPA 5GM1A 2H11A 1AV6A 2PLWA 5K0JA 4GBED 5E1OA 4F84A 5GIOE 3C6KA 4DMGA 5FWAA 3FPFA 4GEKA 3GJYA 5EZQA 3CBGA 4CKBA 3KPJA 2FRXA 3LKDA 4R05A 2PGXA 5F2OA 3G7UA 4CKEA 5ICGA 4RTRA 3BWBA 2AN5A 1I4WA 3DH0A 5BP7A 1JG4A 2JHAA 2QM3A 1N7JA 2NXCA 2QYOA 2IFTA 3SXJA 3I53A 3KQYA 1NKVA 3KPVA 3G5TA 3NTVA 4BLVA 1M0EA 4KDCA 5DM2A 5DTMA 5K0CA 3A26A 3HVHA 3P9CA 3R9XB 2NYUA 4IWNA 2GPYA 1H1DA 3HP7A 1X1DA 3V97A 3E7PA 3OU2A 1DCTA 4QTUB 2PVCA 3FUUA 1RI5A 3ELDA 3HCBA 1AF7A 3KQWA 5DX1A 5F2KA 2ZW9A 2G1PA 3KR0A 3TRKA 2ESRA 2PXCA 1RI4A 4CTKA 4MQ4A 3PFGA 1JG1A 3CC8A 4RTQA 8MHTA 3V8VA 2P41A 5G02A 2GH1A 3FPHA 1JR4A 3I58A 3EEOA 3U81A 2P35A 3H2BA 3DP7A 5FADA 1G6Q1 4C04A 4YV1A 3IHTA 5ICFA 1BOOA 3FPEA 5K0NA 1JTFA 2F8LA 2FPOA 1KYZA 3KQQA 3HCCA 5EHIA 1QAOA 2OYRA 3OE5A 3GRVA 4FSXA 3CKKA 3D2LA 3P2KA 3LDGA 3RIEA 2HR1A 4CWAA 3FPGA 2DULA 2QRVA 3R0QA 4EKGA 4YV2A 2I7CA 3LKZA 4C4AA 2I6GA 3Q87B 3UZUA 2NXNA 3A7EA 2IH5A 3UJBA 1EG2A 3M6UA 2P7IA 3RW9A 2AOUA 3MTIA 5K0BA 3DUWA 3LX6A 4JXJA 5EIWA 2EJUA 3UJ6A 5T64A 3DMFA 2VDWA 4IKPA 1QYRA 4XUDA 2B78A 1G8SA 3BGVA 4PIMA 3B89A 1EQAA 2YUIA 3OCJA 3SVZA 3G8AA 1V39A 2H1RA 4Z2YA 4E2XA 2P3QA 2HNKA 4DQ0A 3LBFA 3FUXA 3DULA 1ORHA 4GF5A 2HTEA 4RVGA 5FA8A 4YUYA 3MB5A 1ORIA 2PXXA 4F85A 5ICCA 1QAMA 2XVMA 1MJFA 3HVJA 2BR3A 2ZWAA 4M38A 3K0BA 3TFWA 2FK8A 2ZLBA 5CD1A 3NVKI 2QE6A 4H0NA 2E5WA 3ELWA 3EVZA 5DM0A 3TLJA 2QRVB 2XVAA 3G2MA 4RTMA 3LECA 5CVDA 1PJZA 5BXYA 2ZCJA 5DLYA 3PS9A 3T7RA 2VP3A 3I64A 3T7TA 3TM4A 2WA1A 3BT7A 5KVAA 3G89A 4QDKA 1XTPA 2AOTA 5KS2A 2OKCA 4FS8A 5T6BA 3REOA 1XCLA 1XDZA 4OX9Y 3R24A 5HZMA 3DTNA 4AZSA 1BKYA 1SUSA 3G2QA 1YUBA 1AQIA 4ATNA 1VL5A 1RJDA 1F3LA 1NV9A 5C9ZA 1KHHA 5LQAA 4U7PB 3AWIA 1INLA 5K0FA 2GLUA 5EMJA 5DWQA 4FR0A 3EVFA 1P39A 1R18A 5U4XA 3UJAA 2UYQA 1KYWA 2OBFA 2JG3A 5EPEA 4YV0A 3GRYA 2C7QA 3SSMA 3QV2A 4WVLA 3HA5A 3E05A 5DPMA 1XJ5A 1SKMA 3KKZA 3HEMA 2HMYB 3IV6A 3MGGA 3QOXA 1JQ3A 2PX8A 3ELYA 4KRGA 3MCZA 5HILA 4AZVA 4ZTBA 4P7GA 5KQSA 3RODA 4EK9A 4RTKA 2XYQA 1KP9A 2P3OA 3AXTA 2YTZA 3HA7A 3MHTA 4B17A 3B3JA 2AVNA 5HFJA 4XUEA 2G72A 1WZNA 3E8SA 4ER0A 4YUWA 3AY0A 5DTRA 4PWYA 4DZRA 3B3FA 4X1OA 4DCMA 3KQTA 4GC5A 3EVEA 3KQVA 3KR2A 3M4XA 3M6VA 2FHPA 2ONYA 3NJRA 4K6MA 4X63A 3FTDA 5FWDA 4RV9A 5DSXA 5EMMA 3X0DA 3ANXA 2Y1XA 1D2CA 3A4TA 1RI2A 3GDHA 1NW7A 5EG5A 2OZVA 1X19A 5K0GA 1WY7A 2PY6A 3KQSA 2IPXA 1YZHA 3DXZA 4R8RA 3A27A 5E9QA 3JWGA 3KR9A 1G8AA 3GRZA 3ER9A 3B3GA 2PJDA 3UA3A 3O7WA 5K0EA 2C7RA 2K4MA 1B42A 2ZULA 4ER3A 2YXLA 3ERCA 1ZGAA 3LDUA 3NWEA 5EOVA 2NNWB 5E8JA 3CCFA 3C6MA 3HCFA 2AOVA 1NW5A 3HM2A 4BLUA 4E30A 5IKMA 2VDVE 4GQBA 1RI3A 2CWWA 2O0LA 3HVKA 1T43A 5C0OE 4YMHA 5MHTA 3EGEA 5LQJA 1VLMA 1X1BA 1QAQA 2I62A 3BKXA 1FBNA 7MHTA 3FYCA 2BR4A 3LBYA 3MTEA 4OQDA 2YQZA 4RYLA 5E9WA 1XDSA 1SVUA 3FRHA 4LWPA 5IH3A 1I9GA 4XCXA 5E2BA 4C06A 3LCVB 2O57A 3TOSA 4Y30A 4QVKA 4HGYA 3OU6A 2AOWA 5FA5A 2UZ4A 1U2ZA 1O9HA 1KPHA 1F38A 1L3IA 4UOEA 3P8ZA 3PFHA 3GIWA 1NT2A 3UBTA 1G38A 4RTNA 2ZZNA 3UJ7A 3TQSA 1N7IA 2BM8A 3PTAA 2EJTA 3TMAA 1KR5A 2LD4A 1HNNA 3BWCA 4HRAA 3GRUA 2B3TA 3KPYA 5FTWA 5HOQA 4RTSA 3E23A 4PONA 4RVHA 5EKUA 3GGDA 2I9KA 1RI1A 3FTFA 2ZWVA 4LG1A 3P9KA 2ZFUA 5CIYA 2AR0A 3GU3A 4A6EA 4EQZA 2XYRA 5FHQA 1G55A 4HG2A 2QY6A 5DM1A 3UJCA 2Z6QA 4RTPA 1XXLA 3M6XA 4Y2HA 5H02A 5CVUA 5HIMA 3GRRA 4PYKA 1QZZA 2PX5A 1M6YA 5HIKA 5GIPE 1EJ6A 4CTJA 3MERA 1YF3A 3LPMA 4U7TB 3PX3A 5DXAA 3DLIA 5DX8A 2P8JA 3THSA 3EVBA 4YUZA 5JR3A 5EC8A 2YXEA 1RJEA 5FULA 3PLAE 3OZTA 2EX4A 1O54A 1L3CA 1D2HA 1P1CA 1P1BA 2G8NA 1R8XA 3BGIA 3DMHA 5LQUA 5EHGA 4PYIA 1FP2A 1OR8A 1FPQA 5ERGB 2AOXA 4QPPA 4F86A 5ICEA 2OB1A 5EIFA 2VS1A 3EVAA 3PX2A 5LQCA 4MIKA 3FRIA 5EMKA 4GOND 2UYHA 3ER8A 3FPJA 3L8DA 1HMYA 2YVLA 2P7HA 3BKWA 1X1CA 2PV0A 3OFKA 3OU7A 4PYNA 3VSEA 3WSTA 5CCXA 2PWYA 2BZGA 2PX4A 1JQEA 3KQOA 4MTLA 4C05A 4PYOA 3FTCA 3SR4A 4BP3A 1M6EX 4OQEA 4OA5A 2IH2A 5LQRA 4RVFA 1KPGA 2PT9A 3BZBA 2WK1A 5EMLA 1WXXA 3OPNA 5K0LA 2AZTA 5HEKA 3UJDA 1JG2A 3GO4A 4E2YA 3HTXA 3SSNA 1VIDA 2PX2A 3GWZA 3M70A 1UWVA 3LHDA 3THRA 3B7PA 1UIRA 3GCZA 3TPZA 3AJDA 1L1EA 2V7EA 4QQKA 3IYLW 5E1MA 2C7OA 3LGAA 3TKAA 4OBWA 4AX8A 3P97A 5EKXA 4E70A 5F2NA 4PIPA 5LQKA 3JWJA 1AQJA 5FHRA 2JJQA 2PSSA 1NBIA 4E31A 4FT4A 4RWZA 3PVCA 3M6WA 1R74A 4L7VA 4PCLA 5FQOA 3HNRA 2OO3A 3CJRA 4KWCA 4PGGA 4A6DA 3UWPA 5KQRA 1Z3CA 2ZZKA 1DL5A 3DOUA 2HV9A 3LL7A 4HGZA 4X60A 5HIIA 3HCAA 3EGVA 3K6RA 1WG8A 3KHKA 3KU1A 3OZRA 5CVEA 1R6AA 2AN4A 2IP2A 5K03A 1JSXA 3HCDA 1YB2A 4PYQA 4BY9E 5GINE 1KXZA 2PKWA 5BW5A 3QOWA 4HC4A 2N47A 3P2EA 3C0KA 4CXMA 3NWBA 3IEIA 3UJ8A 3SMQA 5CM2Z 4PNEA 2XBMA 5CCBA 2AN3A 5P8WA 2BM9A 4KW7A 4PINA 4C07A 5K09A 3PT9A 3HCEA 4KDRA 5KYGA 2Z6UA 3TKYA 1RJFA 5DM4A 4FZVA 3NDIA 4M37A 4V0RA 5K05A 4MHTA 4EVIA 4OA8A 5EGSA 2NXJA 3LDFA 4ISCA 4P58A 1IM8A 5E2AA 3VC2A 3SM3A 5E9JA 4E32A 2ORED 3FUWA 3GXOA 3SSOA 2CMGA 3BXOA 1JQDA 3ME5A 2BR5A 4XUCA 5DX0A 5EVJA 5FQNA 1D2GA 2ONZA 5B1SA 1TW3A 4E33A 4FSDA 1EJ0A 3G2PA 1L3BA 3NW9A 4PYLA 1FJXA 2Z6AA 4KIFA 1I1NA 3EGIA 4X41A 2CL5A 1VE3A 1VBFA 2A14A 4FT2A 4E2ZA 1EAMA 2VDUE 2O05A 2AS0A 4FP9A 3DXYA 2IDJA 3PB3A 1Q0TA 2EFJA 5D1NA 3T0IA 4EKIA 1R00A 2ZBQA 5EEHA 3FYDA 5DTQA 2R6ZA 1XDUA 2AOTB 5DSTA 1RJGA 4PYMA 5E1DA 1WS6A 3P9IA 2GS9A 5LQNA 1NW6A 4R6WA 4ER6A 3VC1A 5LR6A 5GM2A 5CVVA 1ZQ9A 3OFJA 5K01A 3BUSA 1IXKA 2O07A 4E2WA 2G70A 2XYVA 1MHTA 1SG9A 3JWHA 3ORHA 3FUVA 1VQ1A 1DUSA 1YZ3A 1ZHFA 2H00A 2ZTHA 3TR6A 1NW8A 2ZIFA 1SQGA 2UYCA 2PT6A 1VPTA 3G8BA 1JTEA 3Q7EA 3FZGA 3HA3A 2P3LA 2Y1WA 2EG5A 3B5IA 4DCGA 1KPIA 1JSZA 1G60A 2GAFA 2V74B 2ZIEA 3DLCA 3NVMB 4QPNA 3UA4A 2IH4A 4EMSA 4RSRA 4O29A 1NE2A 4BLWA 3R3HA 2FK7A 5D1HA 2YR0A 1BHJA 3I5UA 1WXWA 3DMGA 5DRTA 2BH2A 1XVAA 2FYTA 3EVCA 3C3YA 2ERCA 3EVGA 2AOUB 4DF3A 3EMBA 5BW4A 3FUTA 3NDJA 5M5BA 3P71T 2PBFA 1TPYA 4HTFA 3SGLA 4KVZA 5HIJA 5FUBA 3UJ9A 5K8VA 2FCAA 2JH9A 5GWXA 4AUKA 2IBTA 3DXXA 3LCUA 2IGTA 3MCTA 4GOMD 3CGGA 2IDKA 4YMGA 3OE4A 2UYOA 3CJQA 1VP9A 2OXTA 1YFJA 1N2XA 5EZSA 2NP7A 1ZG3A 4M7RA 3LSTA 2B9EA 5LSAA 4PCAA 2B2CA 3R6TA 2C7PA 2IBSA 3BGDA 4AZWA 1L9KA 1VP3A 5DXJA 4AZTA 3P9NA 1NBHA 4YUXA 2WA2A 1NW3A 4R8SA 3EMDA 2ZBPA 2VZ9A 2ZVJA 2IIPA 3UFBA 4GC9A 3KPUA 3KR1A 3ID6C 3LCCA 5JUWA 2GA9A 3CVOA 3NMUF 2OY0A 1Q0SA 3KQMA 2OPBA 2ZIGA 4QQNA 4G56A 3T7SA 1SQFA 4DM3A 1IY9A 3KPWA 3OZSA 5T67A 1P91A 3A25A 4V0QA 1X1AA 3O31A 1TW2A 1XCJA 1JG3A 2Q41A 3BWYA 1PRYA 2P40A 1SUIA 4CKCA 3C3PA 4QVGA 4WXHA 4RTJA 4KIGA 4RTLA 3G2OA 5DT2A 4HH4A 2ZBRA 4DKJA 1R8YA 3I9FA 2P1DA 4M36A 9MHTA 3GNLA 4HTFB 3TM5A 4ER7A 4GOLD 4QTTB 5GOZA 4RTOA 1FP1D 3MQ2A 3ELUA 5DRYA 5FCDA 3VYWA 2PXAA 2ZZMA 3FTEA 4RX1A 1NV8A 2YXDA 3JWIA 4GOOD 1YFLA 4BP1A 3KQPA 2G71A 3M33A 3F4KA 4RVDA 1O9GA 5CVJA 3HVIA 3EEYA 3CJTA 2R3SA 5EEGA 4P7JA 4POOA 1ZGJA 3BWMA 2ADMA 4C03A 2PWPA 2HWKA 2NXEA 5CUQA 5C1IA 4NECA 5E1BA 5EQJB 2ZSUA 4LECA 1UFKA 4X61A 1BC5A 3O4FA 3MAGA 3G5LA 2KW5A 2B25A 4OBXA 4GUAA 4HSGA 1EIZA 3SX0A 2O06A 3DR5A 2JHCA 1KIAA 1ZKDA 2YX1A 2NP6A 4P7KA 4PYJA 3A7DA
chains in the Genus database with same CATH superfamily
4ND7A 5FO0A 3CHYA 1PG5A 2OESA 4MK4A 1EWKA 4GZ5A 1Z13A 3GJTA 3PGXA 3RYTC 4N8SA 3A98B 1C9YA 1SZJG 1TGYA 1C41A 2UVPB 5DCYA 5JNWA 1II0A 2O3UA 2J5XA 3G02A 3PNPA 4AY6A 3ZU5A 2GRAA 1I2AA 1WB5A 2JH8A 1E58A 2F9LA 3GBPA 4IF4A 4KODA 1QTRA 3BQNB 4UCXA 4BFWA 4ECEA 5C4IA 1M54A 1GZ5A 3VU3A 3EIOA 1XPUA 1NVXQ 2H4FA 1VGRA 5GM1A 4ME6A 4GO1A 4MYRA 1CUXA 5K45A 1GDTA 1E6LA 4F84A 3FKSA 4DMGA 2R8XA 2ODBA 4OJNA 4JEUA 3BIJA 3SIPA 1IFYA 4DGSA 3TECE 1AXEA 2FEWB 4CMAA 3CR7A 3U17A 2ECKA 5B6PA 3ND6A 3EZ7A 2J1LA 3OZ7A 4UM9D 2XF8A 3TVTA 3WGHA 2ID8A 1G0NA 1UC5B 2FW0A 2ZJ5A 2YZ7A 2AGVA 2Z5LA 4G4SP 1N7JA 3BBPA 3NYRA 2HCJB 1V7PC 2ONKA 4G8DA 5HTOA 3LI2A 1RBZA 4A0HA 1A4UA 1J33A 4HQ6A 7GPBA 4Y6PA 5J2UB 4MEAA 3LRTA 1Z75A 1BU5A 4MVXA 1AMOA 4N0PA 1WM1A 1WXEA 1ZLXA 1ZU4A 1XMSA 1ZJ6A 3V97A 4B80A 3B82A 1B73A 3ZKAA 1AF7A 1QG0A 4RVUA 4X97A 5BQOA 3DZJA 4OM7A 2HHLA 1LDMA 4Q7MB 2CDAA 5LOVB 4LEIA 4DWJA 3B6JA 3L7IA 1LW6E 1V71A 3JARB 1JLMA 4L02A 5CLFA 4B3HA 1MTOA 1OROA 2CGEA 2P35A 3IAM1 3DP7A 2X0RA 1EFRD 1U02A 3P9YA 3IHTA 1CK4A 3U4IA 3VI4B 1L5WA 2WNHA 1G7TA 2QR3A 5ARDA 2ONJA 3O0DA 1P9NA 3B38A 1KJIA 4X8HA 2QTLA 1C29B 3OCUA 4W5TA 5AWFC 1I7DA 4DDVA 4DLBA 4YV2A 2AEMA 4L8FA 2EKPA 4G4NA 5AHKA 5H1YA 4G5QA 5E6UB 1E6MA 3C14C 3D43A 4Z9BA 4RHEA 5IH7A 4KE9A 4ZOAA 2ILTA 4R1MA 5H82A 1CG6A 3MTIA 5IAKA 3UHOA 1JNXX 5EIBD 2Y0DA 3AHDA 1EX6A 3HB4X 3H2JA 4KH0A 1G7RA 4OXNA 3LH5A 4HDNB 4UDOA 3NAMA 4NP6A 5TGTA 3SVZA 2GD1O 2IXBA 3M5CA 4RV4A 1OHHA 1Z39A 1LTMA 1JKFA 3GEPA 1USIA 3I1JA 4XB1A 5ALMA 3VO8A 5KWIA 2HRBA 3LX4A 5BSGA 3IG5A 1VLJA 4NMLA 4Y2TA 1EDZA 1THGA 1LY1A 5KSPA 2O8EA 4HNAB 1AK1A 1I80A 3M9WA 3ELWA 1WVGA 3AR7A 4CTOA 3K1JA 5IVPA 3PNBA 3FDXA 2WD8A 4BMYA 4O4IA 4RTMA 4FEYA 1WUJS 4C1NA 5LLDA 4JUCA 2QE7A 5AJWA 1S4MA 4PFJA 5TQJA 4BNDB 3G5UA 3M6MD 2WTMA 3O0TA 3PC3A 3RSCA 1IBKB 4BLCA 2QJRA 1CY6A 3VR5A 5C34B 3H5VA 4L5IA 4RKRA 1SXQA 2QU8A 3P4XA 1JEOA 3R0VA 3BCHA 1NZJA 4FS8A 4HNTA 5HUQA 5IRCD 2AFVA 2V7PA 3D8UA 5LOVA 3ASVA 3NNDA 3QKUA 3KM0A 2VDJA 4KG7A 3HB9A 5LD2B 1ZW1A 4KPUA 2XCIA 4RH0A 1QCCA 1N1EA 1U3FA 4OJTA 2WWXA 3M82A 4QQRA 1NV9A 3U1TA 3CH6A 4BVLA 1KHHA 2F1IA 1GCUA 2WINI 1INLA 3PPIA 1PU2A 1FFGA 4MH0E 2OR3A 2G1KA 2QT0A 3Q15C 3UW3A 1DO2A 1CNEA 3GRYA 1Y5NA 2IYXA 2V45A 2ZT8A 3BILA 4BZZA 1W52X 3HA5A 4B4UA 4JK3A 5AOCA 5IK2A 1XFAA 2OVBA 1R2QA 2HRDA 2HMYB 4P31A 3UB2A 5CNIA 5BWNA 2PX8A 2AC7A 2PKXA 4PLTA 4CL2A 1JG6A 4MPDA 2Z8ZA 4BWVA 4BQOA 5HF5A 3Q4GA 3JQGB 4JVNA 3RODA 4EIWA 4DSTA 3U4QB 2QMQA 3CYFA 1VSQA 2DHDA 3AXTA 4KMRA 3GLHE 3UV7A 5FOVA 2HDNB 3V2HA 4DV0M 1UKCA 3GFSA 4D41A 1BRTA 2MMCA 3OT1B 3GDWA 3IDFA 3IMGA 4JVSB 1QTIA 2MSWA 5EHQA 1KI1A 1O4WA 1T25A 1FDOA 4UMDA 1PNVA 3WKDA 4ETNA 4I9HA 1RKQA 1BXGA 4BFXA 4F45A 4DCPA 1NXOA 4DCMA 2R86A 1BDIA 4X64B 4ZCMA 3AETB 3P0RA 4ITQA 4X63A 2GUGA 3V2UA 1JSCA 4UU0A 5DSXA 3QYJA 1FDWA 4XWAA 5EMMA 4BGIA 3OEEA 5H4GA 3IT2A 4L6IA 5EG5A 1ZOIA 1DRVA 2QBYA 4X00A 1TK2A 4UVGA 2GETA 3ZCTA 5IDQA 2UUBM 2P2SA 2XMCA 1X2BA 4ROSA 4CMGA 5DCLA 1G8AA 3NKLA 3UMYA 2XRFA 1W5TA 1UWLA 3G9XA 3CRMA 5CIWA 4RHTA 5HK8A 3CKYA 1OYYA 4K9KA 2AD1A 5CTAA 5CFRA 1ZGAA 1LI4A 2G9RA 5K8JB 3ZZ1A 4DNOA 2P75A 1J70A 4Q9IA 3FFXA 1K1EA 4IPTA 4P4UA 3N0XA 1ESZA 3AR6A 1UP4A 2LTAA 1KYVA 1NQAO 3KB8A 5FUXA 4D9GA 3EGEA 2PBRA 1J2EA 5DEOA 5AVKA 1XTVA 2XAAA 4LXGA 1X1BA 4EFNA 6GPBA 3H6KA 2G4VA 2YXPX 1KDPA 1W29A 3I6BA 5E9WA 2ZTSA 1M0EA 4KPYA 3KU4A 4I36A 3KS8A 3R5JA 4DHWA 6CHYA 2RI1A 4YP1A 3RKUA 3O1LA 5GADl 2VN8A 3KLBA 4ALLA 4HXYA 2ZSDA 3HY5A 4C01A 2C58A 3ZDAA 1OAAA 5LA6A 2UZ4A 5LMUB 4IX9A 3GQVA 4WKPA 1ZHHA 1O8CA 4UXIA 1A9TA 1G38A 4IOLA 1D07A 3QUCA 3D02A 2FPPA 1G1AA 4JJEA 3IVRA 2R6JA 1DBRA 4WK4B 2B3TA 1A2KC 1V3QE 3DVLA 3E9DA 4MUXA 2EA0A 4LJ9A 1FDTA 1ZWLA 1DCMA 1U2RA 1WLYA 1U4SA 4WOCA 4F60A 3AUJB 5JROA 1AKWA 1G66A 5ITXA 3I51A 2AR0A 2HOQA 2FX2A 3AO0B 2DPLA 1H6AA 3H8JA 3MMNA 3L93A 4R2WA 4RPCA 2V5UA 3BHMA 3G0DA 4UE2A 5AXAA 1XXLA 3M6XA 1I4TD 1OBOA 1OU0A 2CJYA 3QENA 4LDNA 4M1SA 4B8WA 5ILOA 2JEYA 2XFSA 1ZM9A 2AQHA 3HABA 3QOYA 4GYJA 5H81A 1J06A 1Y3BE 2OHXA 3DM5A 1LU9A 1EJ6A 3JR4A 2PD4A 1GZ6A 2ERYA 5FP0A 4EHHA 2OMKA 3EGDB 3TOZA 1JB1A 3C4VA 3RS2A 4Q4JB 3B2EA 3GPXA 1PEAA 4KXLA 4DDWA 2YXEA 3GVIA 3P2JA 1MHPA 3RRNA 3ND5A 3OPQA 1OGIA 4HNQA 3DLPX 2O8BA 3Q88A 1K86A 5KPZA 4IBJA 1J5PA 2P9TA 3P19A 4H08A 3AF4A 1EVEA 4R54A 2O19A 1RHRA 4GXRA 4IIBA 2GT1A 4HN4B 2A9KA 2AUNA 4MR7B 3FRIA 1UPTA 1MIOB 5EMKA 1Z74A 4G0WA 4GI1A 3MS7A 4MROA 4Z4FA 4YJ2B 3OFKA 4BIIA 4YRMA 4BX8A 2ZS7A 4DJTA 2DFVA 2W6QA 4DG9A 5I7VA 4G0NA 3ZE7A 1YR9A 4LZJA 1BVUA 1P2GA 3HDHA 4RVFA 1RHQA 2H51A 1RW4A 3Q6NA 4II3A 5EMLA 4JLMA 3LOUA 4ZI2A 2DQSA 2OOKA 3FAZA 4I4IA 1J8DA 1DG3A 1VIDA 4QUHA 2I99A 1TDJA 1UBTS 3QZUA 3DD5A 2H1WA 2Q50A 3R1IA 4Y1RB 4HO1X 4RGYA 2WJ6A 3K0KA 3WIOA 4DCUA 3PHBE 4G25A 2FZ4A 5HQ3B 4DC1A 4QQKA 4RMGA 3FOWA 5L8VA 3PGA1 4MNTA 4JDUA 5AKEA 3EXG2 2CNKA 2JJQA 5AQEA 3A9SA 3PVCA 4G26A 3GARA 2I29A 4JC0A 4R9SA 4BIMA 2IHBA 4PCLA 4JV5B 1CLEA 3HZZA 3P96A 5AVZA 4MUYA 3ZZNA 1TM5E 1WEKA 4Y28F 1DNPA 4J0DA 1PAUA 4B31A 1DGGA 4QARA 3V9AA 4JR2A 5T3YA 4JT9A 3O7MA 5HM6A 3WXBA 3C5HA 3WB9A 3LUPA 2VH1A 1R0KA 5CNMA 2Q2EB 2PKWA 2QGZA 3QOWA 1G7SA 4HC4A 3THOA 3K0AA 3NHLA 3NWBA 1AMNA 4ZOBA 1Z0UA 2C00A 1OPXA 2FPIA 3PBKA 5IJ9B 3P9ZA 4LTNA 3UWMA 5K3FB 1I6MA 4WN9A 5K09A 3O3CA 1T6YA 1TNDA 1DAKA 1YS4A 4FZVA 2FDXA 2OXEA 1NJSA 2GWHA 4PLWA 1GGKA 2ODAA 3TAHA 4MHTA 2ZUEA 5E2AA 4LZOA 2FDCA 3B53X 1Z73A 4ARZA 4ZT2A 2XGJA 4K6CA 1U2GA 1KY4A 4HF7A 3IA2A 1MZPA 2QN6A 1DGHA 4LVOA 1E64A 5H16A 4JI6M 3FHCB 4FMPA 5BN3A 3PGLA 3RGSA 4KN8A 3KB1A 3RFXA 2Z6AA 4C21A 1MG5A 2JGNA 3EK2A 4KFSA 4ONEA 1QZTA 4C4OA 4QJ3A 5LUAA 1GT91 1ZX1A 1P7YA 1Z35A 3WMWA 2SKDA 4PZ9A 4LHEA 2WIDA 4MPRA 4EYEA 5A0FA 1EI9A 1XZAA 1YNSA 2QRJA 1WABA 2E1PA 2XNDA 3MTDA 5DJ5A 2LVQD 2JZCA 3R77A 5D3QA 5DSTA 1L8AA 1RJGA 1XVIA 2Q3LA 3PUKA 1QNFA 4PYMA 4B71A 3OLZA 3G0OA 4UOZA 5A4MS 5JLAA 5GINE 1SG0A 1D0KA 3M5PA 3NS7A 3GLTA 3U37A 2XDQB 1XNGA 3NBMA 3W1WA 1NR5A 3AF2A 4PQGA 1NI4A 3W2TA 1ONSA 1N3IA 2F1JA 2X6QA 4J29A 3VDRA 1UQTA 3GLIB 2WB2A 1YBAA 3WDSA 1JHXA 1W4ZA 2VTBA 3VR6D 2J9FB 4ZVPA 3GLFB 1SZCA 2O2GA 2UZIR 2ZR0A 4G8JA 4OREX 1UBRS 4QPCA 3WB2A 5CM8B 4EY6A 3T3NA 5BNWA 4KIWA 3FR8A 3HU3A 3SJCA 2V7VA 3CPJB 4NPHA 1XZLA 4JBWA 5ER9A 2DUWA 2ZIEA 2FLWA 4WURA 3BCUA 2O2XA 1OQAA 4BNZA 2RG7A 4EMSA 3O03A 2NAFA 1L1ZA 1AY0A 1U3UA 1U80A 3NANA 4KO3S 1KZ4A 5AHXA 4I9FA 4JU9A 3ZXXA 4EJFA 5C8YF 1PF7E 3RLIA 2ZVDA 3WRWA 3MBOA 2XXBA 3QX9A 3ASZA 2I54A 4HP8A 5EJ5A 4TV8A 2G07A 2P9QA 3U3XA 2WHYA 4P98A 1T2UA 2HHJA 3F47A 5FUBA 1VJ1A 1IPHA 4F11A 5K4GA 3TZBA 5KAPA 1NC3A 2YV1A 3WDLA 3K9FC 4AUKA 3H75A 4TSKA 3QVLA 3GCGA 3GHYA 1VRCA 3HXPA 1VECA 6REQB 1QIKA 1ABFA 3K0CC 2E4VA 4YMGA 4X54A 1CUIA 3ICVA 4JI5M 1VP9A 2C8VA 1G8FA 1SC6A 3GLSA 3DE1X 4HRXA 1Z2PX 4IJVA 2OXTA 4O8CA 1N2XA 1DHTA 3MS4A 3B9QA 4M7RA 2ZU0C 1IHDA 1I7LA 2AG5A 3ICEA 2WB4A 2CWDA 3T5AA 1RC1A 2P9HA 1OQYA 3OQPA 3N86A 3KKEA 3GCXA 2QUHA 3GLGE 3FD9A 1MA3A 1Z4JA 3NIBA 4MWTA 1F2VA 2GVNA 3TIGA 4G3OA 2ZVJA 3VQTA 5A4FS 1Y4UA 4HGRA 1JQAA 1R0CA 2XOKA 5LZ7A 3LC7O 3NEYA 3QXHA 4NBWA 3RI3A 1YJXA 3WTCA 4BUZA 5JANA 5JUWA 1IHPA 2OCIA 1DQZA 2W4MA 2WD7B 3CVOA 3NC4A 4PSDA 4YRPA 3WDKA 1H2FA 1Q22A 1YULA 3TLXA 4EVQA 4U2FA 2O5EA 1GGHA 1A2OA 5T67A 3DP9A 4G5OA 5L51A 4HZIA 4JV5M 1W87A 3IV9A 1C4KA 4OBBA 4B45A 5L4LA 4TVBA 1QGAA 1PQUA 2OM2A 3QVJA 4JELA 1U8UA 5D87A 4DUGA 3E3OA 2FLKA 3L6OO 1QF6A 1WD7A 4HAXA 5EE1A 1A8PA 3M3DA 5IBRA 1ISIA 2R47A 1YGPA 1M1YB 1E8DA 4RH1A 5K9ZA 4H7DA 4R9NA 3UJ3X 2NV0A 5CT6A 1SUDA 3F6EX 2XNKA 3MQ2A 3VR3D 2C9YA 3GMDA 2GJSA 1H8HA 1QF7A 5IKXA 2UXBM 1YFLA 1F4VA 3LQ4A 4EITA 1NAIA 3DTYA 3MWDA 3QFFA 2Y1GA 1JIJA 3G23A 5ELLA 2DFLA 3WX0A 5J4KA 5JECA 2XJ4A 1AQLA 3CINA 1ZISA 1WR1B 5EP2A 2YJ4A 2QRUA 4NECA 1PZMA 2F1OA 4BO9A 1M2NA 2LPMA 1XXHE 3O4FA 4RF3A 1UKYA 3QI7A 1L7MA 3CW8X 5C7YA 3OX2A 1IVSA 1NR1A 2LHGA 2WR8A 3E27A 3OJEA 3QUBA 2I78A 1Z6YA 3FNRA 1JKMA 4IY1A 4TT3A 5SZKB 5IN4A 2QAIA 2VPTA 3F1LA 3NVDA 3ZD7A 1VG1A 3MJDA 4D42A 1NYQA 3P2IA 3AQ4A 1HETA 4US2R 4NXMB 3FYUB 5F76A 3D6AA 4ID9A 2FA9A 3QVMA 3OUTA 1KAOA 4FR5A 4TLBA 4F1JA 3KOXA 2CMHA 3R75A 2PZFA 3BYZA 4NU0A 1KHTA 3H84A 5KX5F 1H0RA 2DAGA 1LZKA 3S68A 4J0JA 2V3VA 4C08A 1EFTA 1M1NA 5DF1A 3ZHYA 3GJ8A 5KTKA 3NBKA 2GQFA 2H4WA 1X1TA 2PWZA 4RC9A 5HUJA 1W0KD 5DWDA 2FOLA 2WJJA 3VTZA 3U61A 4EG3A 3GJYA 2XWQA 3OCCA 5TQ0A 4UHJA 2WJYA 1FLAA 1Z6GA 2BFOA 2W0SA 2YV2A 3UPDA 4MOWA 1YRWA 4RK5A 2Y0PA 3BAFA 3JPYA 3OLQA 4IBFA 4H3SA 2OCBA 1Y33E 4JKYA 4FCTA 2MSDB 3IQXA 5EPOA 4E14A 5A5EA 3M6LA 5JAHA 3TGLA 2HCFA 1U8ZA 4EG7A 2O8DA 3OH8A 1JHDA 4FK8A 1RRGA 3N1UA 3U6SA 1UBEA 4NE2A 2ISCA 1K5HA 3PVZA 1XU9A 1Z88A 4OMDA 1GEGA 4PCVA 4PSCA 3KQNA 1SKUA 3EEFA 1A8QA 2R6GA 4ZAZA 5FKJA 2NYUA 1KI6B 2FSPA 4YJGA 4KMOA 4D6YA 2Y0CA 4BPBA 2CE7A 3F46A 5B2EA 4NL4H 3LVWA 4N5LA 2KBEA 4U2DA 4MQ4A 1VG9B 2P5TB 5A4KA 5J2TA 1GCGA 2GZAA 1E7RA 1X9IA 2H8KA 3U7EB 4C2AA 3U19A 4TUWA 1K8XB 1Q77A 3KEGA 1R15A 3N2GA 1QHYA 3WRYC 2JCVA 1G6Q1 3VK8A 2VKTA 2QMUA 3TSWA 4C4XA 1DTEA 1HPLA 2Q3CA 1M7GA 3L4BC 3HCCA 5JBNA 2ZRPA 1ZMXA 5T41A 2EWMA 1GPMA 4OXIA 2VUUA 4O4IB 4R3WA 3V8BA 3HDVA 3HU2A 1J6UA 1JEQA 2CFOA 2A9VA 2QV0A 3KZVA 5EXEA 1DXQA 2C92A 2IY8A 2HO5A 4GG1A 1PNTA 4DSNA 1NW9B 4I1OA 2GBLC 2IOFA 4ZRDA 4B3SB 3TB4A 3RSFA 3DKIA 5T64A 1RLOA 1QYRA 1C4WA 4XUDA 2QTBA 3WWCA 3TZ6A 2F59A 2JLRA 2YJ5A 3D6HA 3OCVA 5KOYA 2FLVA 2YYZA 2Y27A 3U7IA 3VHQA 2CNDA 4WK0B 3VVCA 1P72A 4KI0A 1EUZA 1ZLYA 3A06A 1TUBA 2H7XA 3U26A 1ENZA 5ICCA 4U7FA 4ZFNA 2FEXA 5JVDF 1POXA 1ZK1A 2PRZA 5E4JA 4ZV9A 5LB4A 5DGIA 1GL7A 3FZNA 3E1SA 2X8JA 2X42A 3UT5A 1LPPA 4WKOA 1J20A 2BV3A 1E98A 1T3HA 3V3TA 1ISPA 1U7DA 3JZMA 1CUGA 5JZOA 4HEOA 3KZKA 1WMEA 2JIRA 3NBAA 4HD8A 3HB1A 4FMCF 4QGHA 1I94B 2XNHA 4Q3NA 1YZTA 2GEUA 3CLVA 4Y67A 1PE0A 3W9UA 2DI0A 1PKEA 2JFYA 2QD1A 3KUCA 5KS2A 4G9BA 4DILA 4OGFA 3OLWA 3MN1A 3ON5A 2GX6A 4Q12A 2IU0A 1I94M 3C6YA 5TF4A 1DKQA 3FFAA 4LOKA 4YA6A 5EZYA 1LB1B 1BKYA 3SQWA 3RBXA 1SUSA 4ZCQA 4ZIRB 3FF1A 2JAQA 4GP6A 4L16A 1DIAA 4GHWA 4ZYUA 4JJAA 5LLSA 3T4PA 3V8NA 1ZR2A 3QA3E 1ZNQO 5C5EA 3UGJA 4GGOA 4GL4A 3W6PA 3L8EA 2OBFA 3VR2D 1AGPA 1BVYF 2H4HA 3TD2A 2XE7A 5TGZA 5JYCA 2SECE 4W8OA 5DPMA 4YRNA 3LLCA 1O03A 2MJLA 4JWTA 3IV6A 3K9QO 2XNCA 2OYCA 1THZA 1SBZA 2ZYGA 3EXIA 2H06A 5FOWA 3HXOA 3KVVA 4OUDB 4CIDA 1BMQA 2P3OA 1NTOA 1B00A 3EW7A 1KEWA 4WKCA 2X0DA 1JN0A 2CXRA 3VSBA 4BNMA 2RGHA 2P9CA 3H1BA 2R8YA 4WNAB 2AVNA 1S8FA 4ZT6A 5HFJA 4RHFA 4YJFA 4ZT3A 4BKQA 1AOXA 1ZIOA 2M2IA 4ZHQA 3HJAA 4DZRA 2V7XA 4L8RC 4RL4A 1UZLA 3G49A 1Q16A 5F33A 2AXEA 3T52A 4XASA 4P0QB 3GT0A 3WKEA 4O2BA 1O4VA 1BHSA 3P2OA 2PZJA 4DBLC 4YCCA 1PJJA 4JNKA 3W1VA 3HYSA 2C83A 4IUDS 1D2CA 1YB7A 5CM9C 3UAVA 1EX1A 1SVSA 2BGIA 2P9FA 3H9GA 4H4DA 4WWHA 3IVGA 3RCBA 3V4OA 1XRJA 2X5NA 1WXFA 3T3IA 3W2HA 4AKIA 4BRUA 1XP5A 1XCOA 4MEJA 3GRZA 1YJ8A 3GZJA 3LBHA 2ZRMA 3HCWA 1QH1A 3IERA 4IGKA 3PC6A 4L9SA 4MW2A 4PSUA 4L72A 1B42A 1TM1E 1VE6A 3EODA 2JLQA 3HDYA 4CMHA 5I7WA 3RGWS 4JI8B 1BCSB 3SYLA 3EBPA 1C0LA 3OX3A 4XQ9A 4WJZA 1NT4A 4KLRA 4E30A 3SX4A 1E9RA 1RI3A 2FZWA 2ZBGA 1CQZA 4II7A 2L4EA 1DTWA 1KFBB 4IJ5A 4NULA 3LP5A 1PL8A 2JIZA 3N8HA 5L3SB 3WSWA 1ZONA 3VO9A 4GVXA 1W48A 2BKLA 3EAQA 1N34B 2V03A 3BRSA 2WFAA 3QU7A 4PZUA 3GPLA 2NZ2A 3EFBA 4RD6A 5KMGA 1XDSA 2WJPA 3OM8A 1YL7A 2FWNA 2HA2A 2J9ZB 1Y3IA 2OCXA 4M2LA 1ZIXA 3LCVB 3NVAA 4M9UA 3VNRA 1SXJD 1UBMS 3ZDYB 2AOWA 5NULA 1ULZA 3B6EA 3EVTA 2FP4B 3TJRA 1E5VA 2P6OA 3AVOA 4KL8S 1JEQB 2QN7A 3DDCA 1J25A 1N7IA 2BM8A 3M1IA 3TMAA 2J8ZA 1MO6A 1HNNA 2RKWA 2PZ8A 1J0BA 3FHLA 2BE9A 3FTNA 3MJHA 4C0KA 4LZNA 4O4HB 3SR0A 2F6RA 2P62A 3GUHA 4PONA 4BJ3A 1Z2DA 3GGDA 3ICPA 1CFZA 2O5CA 4AJOA 3BM5A 1PUXA 4G86A 3AZQA 1ODIA 2XYRA 3ROEA 2HL6A 3D8NA 2EERA 2QM8A 6YASA 5DB4A 1I1QB 1UK8A 3VYUB 3CUYA 3U62A 3AEUB 1OXUA 5K4AA 3NHYA 4B33A 3CF6E 1V16B 3IELA 1NYLA 1FFAA 3KYBA 3T7AA 2UAGA 1PWHA 3V8RA 1GZ3A 2R7NA 2WYHA 4FEEA 4YRAA 2PWAA 1AUOA 3SJ7A 3TB6A 3NO4A 5LYJB 1SUFA 3HYRA 4K87A 3ANSA 3C3CA 3VZRA 1KMIY 4A0RA 1ZUNA 1K3WA 4M1QA 1NBMA 3MLEA 3HL0A 1QHIA 3QPWA 4GHLA 2LP4Y 3HHZA 5IWAB 5EMNA 5EJMA 1N5JA 4BEVA 3O9VA 5DNEA 4B4KA 3RWOA 1QQWA 3BXWA 3E6AA 1U5CA 5AJUA 1Q0TA 2MH8A 1B7GO 1Y9EA 1XC7A 2PX4A 3AR2A 4UDYX 3C85A 4I1UA 2C97A 4OK6A 4PYOA 4ZO7A 1DKUA 1E6KA 1J1ZA 1K98A 1N0UA 3QVVA 4DMHA 3BWEA 2V3WA 1DFGA 3HV0A 3R6WA 4CQLB 4OMFG 2DT8A 2NUAB 2WHPA 1WXXA 3GVCA 4V24A 4YRZA 3I73A 1KTIA 1K2WA 1ZINA 2WAYA 2BBSA 3EG9B 1L4UA 4IZHA 1MJGA 3HJ8A 2CNBA 1N4DA 3SSNA 1SHLA 3AUYA 4GPTA 1ZAKA 1TCVA 1UIRA 1PK9A 4NRWA 2OECA 2V7EA 4REQA 4Q9NA 3MGAA 4RO0A 3LSYA 5TGDA 1V6SA 4MV9A 4WLNA 2NIPA 3S1AA 1M5RA 5HIAA 3U7QA 2V97A 4L95C 1CIJA 5KNDD 4IP0A 2Z30A 1SOMA 3GLQA 1MRZA 1R74A 3IVAA 1OI4A 1K75A 1P6UA 2DBZA 4IHQA 4WEQA 4GICA 5BR8M 2OO3A 1XMVA 4NOLA 4C2TA 4BNNA 3AG6A 1DL5A 2FQXA 2XQKA 4LK3A 4UJ3A 1IU9A 3W8NA 4ZYTA 1WG8A 3LK6A 4P3YA 3WWPA 4TPKA 4EEKA 3BORA 1YI8A 3PF9A 2AYXA 4RXMA 1RXVA 2YJ3A 2BL4A 1TTEA 4EW1A 3B48A 1H94A 1B43A 1TEXA 4HSEA 4LZAA 4P33A 3P2EA 4NESA 2JGKA 2Q3JA 4IZIA 2O8FA 5AM0A 5DN9A 4ENQA 4RHCA 2GEJA 3GP1A 4WL0A 3KHUA 2IIVA 2W6ID 3IB6A 3SJAA 1J90A 1FDIA 2I6XA 2D0PB 1EMDA 2GZ1A 5FFNA 3RB8A 3V4PB 3FPBA 2AG8A 4R40A 1K7YA 4BLOA 4EYOA 4K6GA 1NJGA 4BUJA 3SG0A 4C6TA 1RCTE 4YCAA 1RBMA 1GPKA 4CEHB 1P7ZA 2Q9AA 1SURA 1QGED 3TL2A 1BJKA 1YDWA 3V8QA 4ABTA 1F8YA 1EKXA 5LOVF 1TW3A 1DAEA 4RE5A 2VSQA 2WVGA 3VPAA 1E6UA 3EOZA 3CMMA 1YJ5A 3QTBA 3S27A 2Q9CA 3SY8A 3ZBQA 1SBTA 3W04A 3ZX5A 4EO4A 3LBIA 3LQKA 2BVNA 4ITUA 1L1QA 1E1RA 1G4UR 1LK5A 3WLTA 3QK7A 2IEDA 4CE6A 1A2BA 3QJGA 2WF6A 2DLNA 2NSDA 4CMKA 2XUHA 4P2GA 2K7FA 4G1CA 4MGHA 4PC7A 4HDCA 3SIXA 3TLAA 3EXHA 3FKQA 4YT4A 4D0SA 2XZUA 3WAGA 3B1XA 1B1CA 2XLBA 4Y6GB 5E1DA 2GPNA 3T7KA 2EUCA 4JSTA 1IZ0A 4ER6A 2CLDX 4NI5A 3WO1A 4N65A 4PANA 3COZA 3KJQA 1AD2A 2AJTA 2PS3A 1XRLA 4R3UC 1Q50A 4DHEA 2BLLA 4LF8M 4PNHA 4PTYA 2VHUA 5CFMA 2JLUA 5KC8A 3GLGA 1PJ3A 1YZ3A 2GK3A 1WBJB 2Q28A 4LF4M 1Q3KA 2MYPA 1MORA 1SQGA 2NADA 1XU7A 2Y8EA 3PRKE 2NTEA 3Q7EA 4OU5A 5ESDA 4DJDC 1NMQA 3OJFA 3FI9A 1Q20A 13PKA 2IYUA 3K1TA 4IM7A 3L7MA 3RRMA 4CT4B 5HK9A 2YXNA 3VVMA 2M98A 3GDOA 5AUPB 3LQRA 1GUZA 4R98A 2GO1A 3TEFA 1QRUA 3NVMB 2I80A 3RIYA 1JH9A 1N32B 1P17A 3B3QA 1J2TA 3R9KA 3HCNA 2H65A 4AJ4A 5J5CA 3DV2A 4WKGA 4WCFA 4TXJA 1M8GA 3RRFA 3WQQA 4XDZA 3A2NA 2IWRA 2J0UA 3PUXA 3BSSA 1LX7A 4MWEA 1J00A 4CMEA 2Q6OA 1ZK3A 3BE8A 1RXUA 1L5YA 4M6WA 4QATA 1YQTA 3CV3A 5E7QA 5JXIA 3EG5A 4E4YA 3USES 1GYRA 1YMVA 5FJIA 3ZX4A 2XZPA 3GYBA 4GL2A 3ZGZA 3TR0A 2XA1A 5BQXA 1H9CA 1G63A 1UKAA 1ZGGA 3GP8A 1Z4LA 3C8MA 3KOZE 3I8SA 2YWFA 4S35A 3CGGA 4ALJA 2GAOA 1EJBA 2R5WA 5INTA 4N7MA 3PEWA 2WWYA 5HZHA 3L18A 3L01A 3TUZC 3O4VA 1JAXA 4JH0A 4GBGA 3OAAA 1S96A 4IIWA 1HM5A 1ZG3A 1Y7IA 4RADA 3U5ZA 1T8SA 4RDCA 1QRTA 4IO0A 4YAWA 1RQXA 4CG1A 2VUHB 3JALA 4J91A 2IBSA 3D7LA 3KJGA 3NUQA 4OKNA 4U7HA 3G8YA 4YC7A 3N2EA 2EZ8A 3IOBA 1QFMA 4NC9A 4HNUA 3IIMA 1TH4A 2IYLD 5AHWA 3SIRA 1A98A 2ZBPA 2HRQA 3Q7QA 1V7QA 5F3DA 5BNFA 2Z2JA 3FNIA 1NWHA 4JYZA 1W0CA 3PWKA 4WDRA 3DBVO 2R45A 2XTJA 2PH7A 4YASA 1N57A 1IDOA 4GRAA 4DM3A 3AHFA 1PZXA 1Q84A 2Z9CA 3NPAA 3MUOA 1LVUA 4P9NA 5CHEA 5DNWA 5ERXA 4CFYA 1XOIA 1X1AA 1FUIA 3MEQA 3H9BA 1JA9A 1XZCA 5SY4A 4EO7A 2H08A 5FA6A 3B60A 3MLAA 3ZV6A 5TJ9A 4WXHA 4RTJA 4QA9A 1VKRA 2HQOA 2L09A 4XIYA 1MH1A 2Q46A 2VPIA 3VKGA 2WU3A 4WBNA 5CDHA 1ADCA 1JLLB 2VR1A 1NUAA 1PWZA 1P1RA 4PLFA 3W8RA 1WBBA 4IH1A 4B3BA 1ZRNA 1GJRA 3OJXA 2D5AA 4PX2A 3RJZA 1FP1D 5AKZA 4A5SA 1P6XA 4ZZ0A 4RKWA 1GR0A 3O2NA 1CUWA 1R6DA 1Z7EA 3L2AA 1A5TA 4FZ5A 4XUGB 4FQ8A 3PLNA 1YZYA 5CXXA 3LHIA 1NV8A 2IYTA 1TF7A 1N33M 3AUTA 1NX9A 3C97A 4S0ZA 4ZAFA 4GD3Q 4EPYA 5B5SA 1A7AA 3M33A 4G5RA 1OA1A 4LGVA 5ILGA 4AP9A 2PLRA 5DK6A 2RHRA 3KT6A 1R9GA 5JYBA 2DWMA 1MFZA 4R1NA 9LDBA 5L3SA 4C0JA 2A86A 3GFGA 2IXFA 1TUIA 3WWOA 4B09A 1L4YA 2GN8A 3N6VA 2ADMA 5KVQA 4I14A 1D7AA 4XB6B 3UGQA 5EUCA 1H66A 1GU1A 2MOKA 2PLNA 4Y8VA 2IPNA 2E4YA 4BBAA 2QJTA 3MMXA 4UM7A 2BRUC 4E09A 1G19A 1DHRA 4H0FA 2IF2A 3U3MA 1J24A 5FBHA 2Y6UA 4Z4GA 1OTHA 3I2GA 1A8UA 1NNUA 2DHCA 4I8XA 1YZGA 3QFRA 5GJWC 5E8RA 2RGXA 3K70C 2G7ZA 3FWHA 3U1VA 2FFHA 4BU0A 3KLNA 1OTYA 2GRUA 1FSFA 3OZFA 3V34A 4LWOA 3NAQA 2QVYX 2FG7C 4EPRA 3R0ZA 4YMIA 1K0FA 3VMFA 2D7GA 4O6VA 1XVTA 3SZUA 6Q21A 1YHYA 3WHIA 4Q05A 1OF1A 1S8AA 3JATB 1E1KA 1AUXA 3P32A 4KXXA 2AEFA 3TW8B 1RAGA 4EEXA 1T4CA 1SPBS 4O4JB 3MJEA 4C30A 4KTVE 3D8RA 3H9CA 4NBNA 2Q5IA 2KRUA 1PGJA 3BQ9A 3CVUA 5E1OA 1V8ZA 4OGLA 1S5PA 3D0QA 4V0NA 4LJ5A 4LX0A 4F06A 1UODA 1Z6TA 3CBGA 5KKAA 1L4NA 1ZA2A 2JGDB 2VP6A 3T4XA 4CKBA 2JH3A 4HFRA 4WXMA 4OHYA 4PGAA 3O4RA 4O4JF 3WADA 2VH5R 3WJ2A 1C7IA 4H77A 1L4KA 1E1NA 2AN5A 4HUQB 5GOTA 1HH4A 3DAPA 2PQ2A 2QYOA 2ZUBA 4UTRA 3TEJA 3ZXIA 2YIJA 4OQ4A 3T8YA 2XDAA 4B44A 2JEZA 4L75A 2ZXEA 1DX6A 2DJIA 3DZ8A 5P21A 5DTMA 5K0CA 3CS3A 3P9CA 2J85A 1E3WB 2NO5A 1PKXA 2EBUA 4I99A 1LDBA 2VQ3A 3PJEA 4NZYA 1UK9A 4JI7M 3K09A 2VC2B 5BWBA 1PFWA 2RBGA 2R5NA 4QTUB 4U9HS 4WZZA 2ORVA 2PVCA 1RI5A 2KRKA 3W68A 3HB7A 4QICA 3PWSA 4BUCA 3PICA 5AKKA 1EWTA 3KR0A 2R18A 3FPCA 3TXXA 3VKFA 4DBVO 2R5FA 4CCWA 2PE5A 1YU6A 3M4YA 1XMIA 2P41A 2B8TA 2RH4A 4MAFA 1QVRA 3FOEC 1YBFA 3B5JA 3H4VA 3V1KA 2YJZA 1JT9A 3FPEA 4J07A 2J9GA 2QPLA 4UEQA 1JTFA 1KC1A 1NLUA 2QLMA 3IR7A 3TOCA 4L8GA 1UH5A 3RIEA 1DIOB 1D0VA 3NV7A 1PYOA 3TDMA 2HR1A 1LK0A 2QRVA 4TYWA 4NPAA 1GO5A 2I7CA 4EMBA 3BCSA 2QJFA 1SMKA 1Q7GA 3O8CA 4N40A 1P4JA 3L7AA 2FP4A 4DQUA 1ZN9A 3GPUA 3M9LA 4LWQA 5AUQA 3RSSA 7ABPA 4L07A 4JBYA 1I0ZA 2P2ZA 3WFJA 4HUTA 3IS3A 2GBFA 3RE8A 3A1WA 3N75A 2XQJA 1YVDA 3LNCA 2JBAA 3GJ0A 2RI6A 5K3CA 1TUGA 5FTMA 1PZEA 4BMOB 2J5QA 3FPSA 3PDUA 3OCJA 4GE0A 4S1OA 4TUYF 3ZGXA 1TM3E 2BKUA 3GA5A 3H1TA 4UBMA 4UM9B 4JCCA 2QVCA 4RM2A 4RPGA 4RWEA 4Y2UA 1QB8A 1P74A 2XEXA 4ALIA 4KQJA 4DR5M 1SD1A 4CR7A 4K9DA 1PN3A 1RWNA 1VKJA 2FWAA 3OT4A 4I08A 4M38A 4G84A 4URVR 4CIAA 4W5QA 4ZDKA 3DOCA 4NU8X 2QSJA 3WK4A 5L4NA 2L6OA 1YRYE 1L7RA 2FPMA 4GPEA 5I9SA 5IU6A 4URZR 2HCRA 4GM4A 1SCAA 3DKRA 1L7DA 1X7HA 2WJHA 3A6KA 1K92A 2Z8YA 3AIIA 4YP0A 1JFTA 2KPOA 2R6AA 3B6KA 1LSJA 2Q9BA 3I5MA 2WA1A 4ND1A 3RU7A 3F2VA 1P5HA 2AWOA 3G89A 4JBNA 3VAAA 5KVAA 2HK8A 3EXEB 4Z9XA 3ADKA 5F2EA 3U48A 3PQ6A 3ZD8A 5MN6A 3NTLA 2EZTA 3H0KA 4O2BB 2O20A 3D7NA 5IYZF 5FT9A 4YCSA 4I9NA 1E4EA 3HJRA 5K6TA 1N6OA 1ZJYA 5J9FA 4JOBA 1PJBA 1V3UA 1Z8HA 5FUYA 4F5ZA 1RACA 4HBGA 5C9ZA 2NZ8A 1CEYA 4BGVA 1OAIA 1LCIA 5ALVA 4MHSA 3EQ9A 2W6ZA 1SIUA 3H04A 3U4QA 5HW0A 5JMPA 1N3BA 1NJ5A 3C4QA 4DMLA 3LT4A 4GI7A 1EDEA 1UCFA 3BB3A 1N4AA 3ZIUA 3BBZA 5BN4A 5I47A 4B3MB 1QM5A 2P6UA 4H7HA 2FZVA 5GKNA 4OX9M 4FD2A 2JAHA 2WWGA 1G5FA 1FLDA 1P7PA 3FLMA 2A9OA 3GRKA 4E1VA 4Y3UA 4H3HB 4CM3A 3L0CA 1NNUC 2D59A 1UM9B 5KYXB 4RTKA 1D2NA 2PZMA 5GMOA 2HO4A 3LJKA 3FGNA 1CRQA 1FW8A 3RSLA 5ADWA 3KLOA 1XV5A 1C0IA 1WB4A 2G72A 5IC5A 4YPFA 2PSEA 5BNZA 3F6RA 1NL3A 4CKWA 1R64A 2X76A 4AUNA 3BHIA 4TKZA 3TRFA 2QQ0A 4D3DA 4JJZA 1BDJA 1CUYA 2WG0A 1A2QA 2V7GA 3OQJA 4M1MA 2IPOA 4L74A 4HGPA 4RPJA 3TWOA 1B3BA 1U4OA 3CG0A 1W76A 3P0JA 4NYJR 2OXIA 1AMUA 1E2HA 1JDZA 4HDQB 1VB5A 5L6LB 1RAIA 4X1IB 2FMTA 4DM4A 1RI2A 4AO6A 3DDHA 2FZCA 2JJ2A 4B7CA 3VXKA 1HWYA 1XQ9A 4H4CA 4IH4A 5BYKA 2NZJA 1ZSVA 1YWGO 1Z3IX 3RF6A 3WK7A 2O50A 4AKEA 2XUGA 4KR9A 5IKEA 2Q0XA 3LXUX 1U3WA 1KJQA 2EIHA 3OFND 1NRXA 1T9KA 4BWYA 1Z4IA 4IEIA 5GVSA 2IIBA 4OJKA 1F5NA 4J2OA 5AI8A 3STHA 4IRXA 1O6BA 1CRZA 5FBZA 5GQSA 4M0PA 3ZGYA 2HC9A 2W2NA 3NBQA 2VTDA 3NHWA 1FLNA 1XALA 3HVKA 4JLSA 1T43A 1YCFA 3AETA 3B20A 4HWKA 1IG3A 5G4LA 1C0KA 4BJ6A 4ERXA 4MHOA 2VDOB 4GR5A 4KN9S 3F8TA 2X7XA 3AVWA 1XEXA 2VCYA 3FYCA 1TC1A 1BEUB 3Q11A 4TTTS 3OFNA 4DR5B 2JY5A 1U1DA 1KZYC 3MTQA 2ZT5A 3EDQA 4QDTA 4QXRA 4RF5A 4CDRA 4YAIA 1P4HA 2YC2C 1DWPA 2C9DA 1J0CA 5EKTA 3DE2X 3TZQA 4LY6A 1A9XB 1AURA 3CF4A 1KPHA 4FVMA 5E0KB 5DYIA 2XBLA 3WZ2A 1LF5A 4ARSA 5HSGA 3V7FA 4JQOA 3DA8A 5CK4A 3EMVA 3GPCA 1OC4A 3QH4A 5IXJA 3WLMA 4Q5IA 3G82C 3UAOA 2JJMA 2HXYA 3OG9A 1KE1A 3C87A 4W7HA 1JQJC 2TECE 4O5AA 3TCKA 4B3FX 1MF7A 2JEOA 2AK2A 1TU4A 2PUTA 1GA4A 4JITA 4TGLA 3IO3A 4DWWA 4AUEA 3KTOA 3GUCA 4MGEA 5FB3A 1Q7BA 2ECQA 3PD1A 3IDOA 4AS1A 1RVDA 2Q45A 3BL6A 1IXYA 4ZI7A 4ZAYA 3GJ5A 3C98A 5B55A 2GF9A 4OYHA 2Z7JA 4B40A 4URUR 4B83A 1HYBA 4Z7NB 4QLOA 3WK8A 1KXJA 3QBEA 2VYQA 1FSGA 4R8VA 5A4IS 4IAOA 3ETDA 1O94A 2HSJA 1CJMA 1TYCA 2O4CA 2WIAA 1RKXA 4LG2A 2NGRA 2PS0A 3DXFA 3OIVA 4U9UA 1N1DA 2YZGA 3ESQA 1L5HA 3ZK7A 4EHNA 4XZ3A 2P0AA 1DMRA 1MO2A 3ILKA 2C4NA 4ZYYA 4XEUA 1VIVA 3K70D 4PAQA 4RSHA 4YYEA 1DPGA 2C8KA 5D51S 2R7KA 4CFSA 3MT9A 3RYFB 1ECJA 4UZEA 2JGDA 4C05A 5IJ0B 3L79A 3O38A 3L02A 5D84A 3AWDA 1V3VA 4ZKDA 4IILA 4WNYA 3BZBA 1GRVA 4Z9AA 4YDHB 1BX1A 2FFRA 1G41A 3KELA 3PPWA 4RFSB 2ZUUA 5HJ7A 2XMPA 3PXCX 4MQUA 3WIEA 1EE9A 5DEIA 3GJ3A 1EINA 1UAAA 1EXWA 1IJKA 4BNJA 2C5SA 3LGAA 1NRJB 1ZPDA 1QDEA 5HMLA 3NDBB 1HO3A 1WQ1R 1ECCA 3CSDA 3OBIA 1O6FA 2J4DA 4DV4M 3JZFA 1A27A 2COKA 4MI3A 5LIRA 1PSDA 1EVQA 3K05A 2B2XA 2F5OA 2ZUDA 2RJOA 2I3AA 4HKTA 3C6QA 4TSRA 1LS6A 1QS0B 1UMCA 3UWOA 1Y98A 3X1WA 3CJRA 5DOZA 4YMUA 1S4QA 3D3EA 5ITYA 5E4FA 5HIIA 5IDYA 1V7ZA 3DZHA 2QTWB 5J59A 1EK5A 3KU1A 1KBOA 3UH1A 5F3WB 2H2AA 1IHOA 4X93A 2HA0A 4MUEA 4ZQIA 4M21A 4IMPA 5JDIA 3HCDA 2P90A 3KKPA 1L1FA 4BY9E 1FJGB 5C80A 1EHYA 1JJBA 3PWZA 1MNAA 2QPOA 4BV8A 2D54A 3SMQA 1XHBA 4MMXB 3T1QA 1JIVA 1CJVC 2RGBA 3VO2A 3DLHA 2XBMA 4FB5A 2P77A 1TIPA 5L45A 2DUJA 6NULA 4RACA 1ANKA 1L7AA 2CEKA 1S01A 2G40A 4V3CA 2XCUA 3IJRA 1LNZA 1E6EA 3K1AB 4OFWA 3Q0IA 3TE6A 4Y9UA 4X45A 4MZDA 1VB3A 5CT5A 1N6LA 2O3SA 2P4QA 3CUUA 5FNVA 5EPUA 1RZRD 2CYAA 2HWXA 1TA9A 2IXAA 1V7CA 1FYVA 2AUMA 1FZQA 3RG8A 3CNLA 3W5IA 3P0FA 4EYSA 3BQMB 1ZAEA 4IDNA 1KY2A 2QGNA 2Y66A 3CVXA 1G8JA 3TVYA 4DW8A 2II6A 5ALUA 3ZCQA 2DWPA 3NW9A 4F5EA 2NZWA 1Z0IA 2OCPA 3E58A 4RPLA 5TPWA 5C32A 1S9HA 2FFBA 4OU7A 3U4HA 4HYEA 2O7SA 3ZVMA 1GG2A 5J58A 4EPWA 1Z62A 1H5QA 4Q9HA 2CLIB 1YRAA 1QIDA 4JLNA 2V6ZM 4OMCA 1J2UA 1R00A 4INZA 2ZBQA 2ZI5A 4HB4A 4MR8B 5JI3E 1I7NA 4ITRC 5EEHA 3ETHA 4EKYA 2VUIB 3IPYA 3EXEA 1VXRA 1FDRA 1TEVA 1A8IA 4X7PA 2PN1A 3R3WA 1ZXBA 2YN2A 2G0TA 4I5EA 2WVJA 2NU8B 3PZRA 4FDVA 3VRHA 1QVZA 2CUKA 3ABOB 3VHLB 4IGAA 3GH3A 1XZHA 2J3QA 2P3SA 4MJ3A 1GTVA 5CLHA 4RKUF 2V6BA 2RGDA 2WU0A 1SELA 3ESBA 3F2IA 4KLAA 2L2DA 2HGZA 3AY7A 4LRSA 5CYPA 3WNBA 5ALIA 4AFNA 1COWD 3C5EA 5ALPA 4A8PA 1VPLA 4DPLA 2I2XB 3G8BA 4V38A 3SEAA 5K6RA 1WA5A 2A1UB 1P45A 1AB6A 3NFYA 1GAWA 1FFEA 1GPYA 2EG5A 3AX6A 4BRZA 4FWIB 4J6FA 4PF1A 1WY5A 1TFRA 1O1YA 2B82A 3QJ5A 1C3XA 4CJ6A 1NE2A 3HGMA 4GKKM 1H5UA 1L7QA 2C2MA 4H27A 1F51E 2MYNA 2RBKA 3TCNA 3ZDXB 1BX3A 1WXWA 3SBJA 2YWEA 4PG8A 5BVGA 3ADDA 4R2LA 1G21A 4F2DA 2ZYTX 1JHAA 2C96A 2FDRA 3D0KA 5J1SB 5HKKD 2G80A 2QTGA 1KJZA 2HBRA 3FI0A 4ES6A 1EGAA 1WZCA 1Z22A 3CZCA 2Z3VA 3PEFA 3LC1O 2XPCA 4TS3A 1I6LA 3UJ9A 4EZEA 4Z1MA 4TYQA 4YMVA 4LCJA 2GLTA 1X8KA 3PNVA 2WSMA 1HF3A 4BDTA 4EGFA 1UFOA 1BMFD 4GI5A 1DZIA 2EF1A 1DKPA 1M2VA 2GR9A 3HH8A 1QNLA 1W4AA 3SOPA 1P2SA 3UC5A 3GVPA 4EKDA 1PR3A 4WDQA 1HNWM 3HACA 5D01A 3KBOA 4OW0A 4PHTA 3TD6A 1SXPA 5EZSA 1ISGA 1EVJA 2B9EA 4PG6A 5LSAA 2H2FA 1C80A 5JSHA 1R4GA 4P4SA 4FXOA 4ED9A 4X66B 4DDTA 1ZMBA 4WCDA 2F5QA 1O2DA 2VNKA 4JA2A 4TWJA 1CT9A 2JFGA 3QMWA 2FE1A 4OSPA 1XPJA 3VFDA 2XYPA 1E18A 2CXOA 4C0AC 4ND8A 1ORDA 2WSCF 1C1DA 2ZREA 2ZYSA 4YEDA 3X1YA 2FSGA 1KP2A 2GCEA 4DLRA 2GA9A 4G4GA 1G8KA 2QSFX 4H3VA 2NZYA 1N78A 3GDGA 1JWLA 2P2DA 4KXFB 2QYTA 3EF3A 2UZ3A 4V0QA 4LF9B 1GCAA 5ARCA 2IYSA 4OVZA 3BWYA 4QEKA 4LY9A 3QXCA 3DL2A 3WGMA 5BN1A 4LFAM 3O2JA 3IUNA 4EA9A 4AC9A 3GNTA 4YDSA 2QMOA 2WIFA 2FE4A 2H54A 5CXSA 1VE5A 2JD1A 3DZFA 2BWEA 4GKVA 4N48A 4OEHA 1ACMA 1GZVA 4JSYA 2G76A 4AJ9A 9LDTA 1SG6A 4L8WB 1G8MA 5FNVB 5I7UA 3ZOKA 1US8B 2ANBA 3ITDA 2WJWA 4LF6B 2OXFA 3SZOA 1EM8B 3L28A 4D43A 4PC3A 2B1QA 3R2JA 1I7SB 2DTXA 4D44A 4KVGA 2EX1A 3FWYA 2G71A 2GN1A 3A4NA 4MRMB 4HDAA 4RSMA 3KAQA 1R9JA 5HRUA 3K53A 1P7CA 5F52A 4GOXA 3URMA 2WTBA 1ZGJA 5CDFE 2Z5FA 2DZLA 4A0QA 1A9PA 2WFLA 3BFVA 1QZUA 3MLBA 2DR0A 3PSHA 5E1BA 5EQJB 3NFRA 4WKBA 2EYQA 4MS1A 3V7NA 1QG4A 2PMFA 3MRVA 1L7NA 3ACDA 1JHPA 3UFXA 1T0JB 1E2EA 3PNSA 4C3UA 1U8EA 7REQA 1Q3HA 5KHAA 3AR9A 1N9KA 1XZKA 4I46A 5BSEA 4FVTA 1Y8QB 2ZI6A 3ZJ4A 3ENVA 5KYUA 2VCEA 2P0EA 5TPZD 4I0WB 2AI1A 5HP4A 4PN7A 3QEKA 4DA4A 4G0OA 1NXQA 1OPRA 4IV0A 5AVJA 2CBGA 4WUTA 2H16A 1A8HA 3KDSE 2NG1A 3FKJA 4P4TA 1A5BB 3IMCA 4DUGD 2CVFA 1FCJA 1RLTA 4XKJA 3BRCA 3I6MA 4IIGA 2VQDA 4QREA 1IBLB 5LNK1 3DOEA 1EFPB 1YKSA 5FPTA 5T4BA 3EISA 4GBED 3RVRA 1XYGA 2D8AA 3UJHA 3WRXA 3ROXA 4OXRA 3NHFA 4MKGA 4MYSA 4V1CI 1Q95A 4OUDA 4DLZA 4F8YA 721PA 4ZVSA 1DC5A 1RT9A 3D1JA 3BXGA 3TF5A 2VBFA 2XE6A 2KYRA 3S7ZA 3VZCA 5J1TB 1OWLA 1RWWA 1CUZA 2VYFA 3D64A 1EE2A 1GQ2A 3DMPA 1JLKA 4LYEA 4QASA 2V54A 2QM3A 1Z6ZA 4G6ZA 2ZJAA 4Q3BA 3KTAA 2FUKA 3Q5GA 2EAUA 4FEGA 3OPYI 2ZYDA 4B3JA 1SJ9A 1V43A 2GD0A 3PXDA 5F1YA 3T5BA 3ZJYA 3PNQA 1VJ0A 1ODJA 4HNRA 3J7TA 2RAVA 2C7GA 2M6SA 4N9WA 3V80A 4AJKA 3SC3A 4QWMA 5C7LO 3MAJA 3FUUA 1VEKA 3PQ4A 2IDMA 1EUDB 1M1XB 3DVAB 4JASB 3BE4A 5KPJA 1XJ0A 3AEUA 5C31A 3VUEA 4UU7A 4XVUA 3I39X 1E2NA 1NULA 5AK3A 1QP4A 5A5VA 1JAIA 2I34A 2WM3A 4C0BA 2ZB7A 2VUTA 4KIUA 2BIFA 3W2EA 1RXCA 5DCWA 3HU5A 2OZPA 1JR6A 1YB6A 1I3OA 3EF0A 3M2TA 3OI7A 2XUZA 3QX7A 2QP3A 4GIBA 4PVCA 4MARA 2H8GA 3FE3A 3Q9NA 1QCYA 2VLIA 3R0QA 3ZPXA 4HZGA 1CQPA 2Y1FA 4Y6OA 2JLCA 4BTLA 4EKGA 4F2HA 3L4KA 3LY5A 3O8QA 3GOHA 3W67A 1HG1A 1U2DC 3MUFA 1ULAA 1ZA1A 1QO0A 5C37A 3T1OA 2VPZA 5LU9A 5KO2A 4U02A 4DV5B 4FKBA 1U98A 4MV1A 2AJCA 2C57A 3IXLA 4BVAA 2VDKB 1BVSA 2W70A 5CXUA 3RTGA 1KK2A 3WY9A 5IAGA 3A6GA 4ZCIA 1Z2NX 4HB0A 2EFDB 3W79A 4CNBA 2VATA 3EVNA 4X9XA 2AIRA 4E2XA 3NPMA 3OA0A 2WTXA 1AN9A 3EC7A 1V8OA 4R1OA 1ORHA 5JJ5A 2WP0A 4LXUA 4KFUA 4WN3A 3PSAA 1QRRA 5JNUA 1QAMA 1O7JA 4HQRA 3RE1A 2BR3A 4BVFA 3F6PA 3K0BA 3GEGA 4HAIA 1HNZM 3A2MA 2GN4A 5K5EA 3CEAA 3HBJA 3H65A 4B4VA 4L50A 3FGPA 1T2VA 3D3WB 3RS8A 1H2AS 1S1MA 2BEUB 2EV9A 3TLCA 3W5HA 4LRYA 4RNAA 1XIVA 1Z8DA 3L04A 3TOVA 5EJ9A 3A1DA 4PAGA 4ND2A 1YR6A 3OQ6A 2CB0A 2JD0A 2I67A 1S89A 3AHJA 5CH3A 2O8NA 3TM4A 4L5CA 2WKPA 2LVBA 1T9DA 1RRMA 5ELMA 3PHGA 3REOA 1SCJA 1VFNA 2FQYA 4Q3DA 2QVBA 5HZMA 1NXPA 3EYWA 3F7TA 3D7KA 1LPSA 4N47A 3QYFA 3CKLA 4GEGA 4XSVA 3O8NA 4YJGB 3HYTA 3F5FA 4D80A 3I6QA 4I4LA 4KXWA 2QVLA 1Z0FA 4G5FA 1ECFA 4PRKA 2HWYA 3MWJA 4DGQA 2YW2A 3EVFA 1GG8A 4H6VA 1IPFA 1ULUA 1UKEA 2EJSA 4B85A 2XLJA 3IDAA 5B4VA 4CHTB 1OFGA 2HREA 3D6MA 1CLUA 1WSWA 2Z6VA 4JBXA 4JP3A 1FP7A 3USCS 4AJHA 1V5EA 3K9HA 4AZVA 1ORTA 1GR1A 3I92A 3ND8A 5KB3A 4ZTBA 4P7GA 5KQSA 3F71A 2QW0X 1FRFS 3HBLA 1SU4A 3MYRA 2CUTA 3ZHOA 2FR8A 1BU8A 4HRVA 4YDRA 1R0YA 5JY1A 3B3JA 2XZTA 3H1PA 3QLVA 4BNUA 4XUEA 3A42A 1WZNA 2X58A 2Q1SA 3MK31 3KDAA 2C4HA 4LYJA 1YZQA 5DTRA 5C1PA 4UEWA 2PUBA 4UNQA 3M4XA 2D1QA 1M33A 3QNUA 4EFKA 4RGQA 1L5NA 1X92A 4QFMA 1W5FA 2V8BA 2XGNA 3FJOA 1E0DA 1KI7A 1KNQA 1GNVA 1VI6A 2VJKA 3A10A 3OWXA 1HG0A 3GJRA 1RWMA 1H8EA 1SWWA 1HT3A 4GH9A 1WULS 2DTEA 1C3LA 3DJYA 3QF4A 4LJYA 4TMYA 1P4RA 5KDDA 2C2OA 4IQGA 3SQMA 2ZULA 3ERCA 1JLSA 3I23A 4NENB 3BRWD 4AP5A 1HY3A 1DIRA 5AW2A 1HEYA 1CRPA 2HQSA 2KSQA 5D5HA 4BCBA 5HQ3A 1VLQA 2HXSA 3TI9A 1KFJB 4YO8A 3QYBA 4H35A 1C5KA 4ZVTA 5E95A 1SK8A 3WLPA 3ZVLA 4WZAB 4WJLA 1YS6A 2V1XA 1FVHA 1G2QA 4HAOA 2NPOA 3TKLA 5HCUA 5EWLB 4TZ6A 1SVUA 2Y4NA 1GEEA 1Y3FE 2FWJA 3L4EA 1DEXA 1XAGA 1KO7A 2HLDA 2NZVG 3ROZA 2K2QB 3OCXA 1F3OA 2I6FA 1U9JA 2WUGA 2W0MA 2VA9A 1RHUA 3DA1A 3Q6IA 4JOQA 4MJXA 4QOHA 3AP1A 3UJ7A 3BWDD 3EA4A 4HRAA 2J3EA 2BWBA 2V65A 3PC7A 3O4GA 4G85A 3ZJVA 3QELB 3URKA 2AQ8A 3F3SA 3UPTA 1ZEJA 3NIDB 4QBIA 2BFDA 4N8EA 1TVCA 1T6BY 4U3JA 4KO4S 1RYZA 4WX2B 5LYJA 4RTPA 4OG2A 4YJHB 4XW2A 2Q99A 4M4SA 3AKDA 2X9QA 1N36M 4EY3A 4KPUB 3GRRA 1Z47A 3W4IA 3E18A 1EX9A 3GD5A 4LF5M 1J8MF 3RM3A 4RK7A 4A92A 1K6JA 5A5FA 3PX7A 5C1DA 4EKIA 2AZXA 2FH5B 1TKBA 4O4LA 1NFRA 2BW0A 2C9MA 2H1CA 3P26A 4LI3X 4QSMA 4U7TB 3ZW9A 4UXJA 4OLAA 4ZK2A 3MXTA 1ID8A 2XUDA 3FB4A 3TFQA 2GCOB 1BIFA 3OZTA 4TMKA 3OUUA 4DREA 1NMYA 2G8NA 1HOXA 4WESB 2NUPB 2Y1EA 3AF3A 4O1MA 4JR1A 5ERGB 4Z49A 2AI3A 1QIHA 1G9TA 1MP0A 3EVAA 1LJUA 1BX0A 1KZ7B 4GOND 1Z0SA 1JU3A 2D8MA 2LVAA 2X8JB 1POWA 1X1CA 3ANNA 3ZWCA 4RF4A 1ZD3A 1VIAA 1JQEA 2M5ZA 3IALA 4BBZA 2HHHM 3FOBA 1ICIA 1U7ZA 3IEXA 4TLDA 4YRTA 4BP3A 1JF8A 5BVHA 2OOBA 1RKUA 3Q5DA 3V9PA 3WFIA 4KN5A 5EWLA 4DLWA 3DBHB 3MHVC 4ZODA 1KJNA 1J2JA 1UWCA 3TW8A 3ZZTA 3ZY2A 4URYR 3GWZA 1UC4B 2DJ5A 2J9XB 4PEVA 4TTJA 3TD9A 1U8CB 5DK4A 4Z0PA 1SULA 2NU7B 2AXPA 3TXYA 1NRWA 5IARA 4MCAA 4PXAA 5F1KA 5FI1B 3W7VA 3QA9A 2GDZA 4IHAA 4XGIA 5IUJC 1GTJ1 1T2EA 3HBFA 4DARA 1ONNA 4EHLA 1AQJA 3H86A 2G88A 3MD9A 2K87A 3BEDA 2FN8A 1T0UA 1E1YA 1NBOA 3AT1A 2OLJA 2GYVA 4N5IX 4QJBA 2K6BA 1AC5A 2EATA 4KVAA 4RV5A 1SO8A 4XRRA 1K0UA 2VPYA 3ZK9A 5GV7A 3EOBI 3LC0A 1SKQA 1UJ2A 2K0BX 4IDBA 1BROA 4YACA 4AIRA 2GARA 4GEWA 2WFZA 1RDFA 1KXZA 2QVGA 2P9YA 3A9WA 3OIUA 4HH1A 5BW5A 5LMNM 2KHZA 3QLVC 3Q3GE 1B23P 3EA0A 3R6GA 2Q6LA 1DEKA 4YJFB 3FETA 2ZYWX 3FMGA 1PR9A 3H5OA 3KE8A 4MR8A 3JAKB 4N6GA 4BMDA 4LY0A 1UJCA 3CLTD 4KDRA 4X7MA 4YAEA 1CY2A 2GBGA 2Y77A 4XIJA 5BN5B 3KVYA 3TYXA 2BDEA 3KTAB 3LG2A 1CB7A 4JYCA 3KV3O 4X3PA 4KREA 4US1R 1RR6A 5LP6C 5DHTA 2FUEA 3PUHA 1DE0A 1RWQA 3RIMA 4NWIA 2WSLA 2DAKA 1T9ZA 1DCFA 3UCEA 3Q9UA 1K4YA 3STVA 4D5EA 1MC8A 5FWYA 2EKFA 3E9MA 1NJ8A 4D7AA 5K20A 4OUKX 4IDFA 4HB2A 4ZREA 2CL5A 3RHSA 1JA0A 3NT4A 2FWBA 3P0IA 4LAFA 3O3OB 2JFFA 4FNMA 5SYNA 2Z4RA 2QX4A 3DVQX 4HPJB 2HUPA 1Z37A 1NMEA 4ILKA 4ZOEA 5D1NA 3SZ3A 4MUNA 2R6ZA 1XTKA 4OFBA 4J1NA 1C9DB 2BP7A 2NT4A 1VMAA 3N2NA 4M0EA 3EGCA 4BX2A 1V3TA 1L4EA 3KYJB 4JQSA 1Y9AA 4X6YA 4AY5A 5AKJA 2A2ZA 3BC1A 3D2CA 1Y3DE 2CVZA 3LQFA 4M8IA 4NBSA 2H63A 1XNHA 4LNHA 1GKLA 1UC8A 2EGUA 1ZEMA 2H00A 5FFMA 1DMSA 1TMOA 3BF8A 4QHSA 1W4RA 3BFXA 3IC5A 5F7ZA 5D00A 2WOJA 1D0SA 1XL0A 1YRHA 2BGTA 4G3XA 4F2WA 1UZMA 4AM8A 1JHVA 4UTNA 4LXHA 4M1KA 1W73A 3SC4A 2ZGVA 1BW9B 1KI4A 2Q3MA 4C5BA 4Q3CA 4TL6A 3PKIA 1K6IA 3GGGA 2EARA 3RVKA 1C7YA 2WIGA 4N82A 3NBFA 4RA6A 1IRXA 1JU4A 5SY6A 3KQLA 2O7VA 1T6NA 3KOZA 1GVNB 4CF4A 5IANA 4RMHA 2UXBB 1Y8AA 3KQKA 1BKDR 2PJZA 3AEYA 3QTLA 5ADHA 3TBKA 4KNVA 4DNQA 3GLHA 2XOXA 4D82A 3N9IA 5CA1F 1TAHA 4X92A 2VQEM 4EOGA 2LCQA 4EGJA 3VZQA 1XZIA 1K66A 5E3HA 2ZANA 2VP0A 2X1VA 1NQVA 3C6BA 3IVCA 3CXRA 3AV3A 1YFKA 5DP1A 4PXYA 4NCXA 4HPXB 1WPGA 1H8HD 2ZTUA 4K3UA 4YRCA 3KKNA 5FEMA 5HF8A 3RTEA 1FLVA 3CJQA 4EDHA 3ZU4A 2RAPA 1R6UA 2O2CA 4ZCRA 4RF0A 2LNDA 4F1KA 3THYA 1ZN2A 2C9ZA 1JAYA 1CDEA 5IW8A 1GUAA 1YZVA 3ASUA 4PAWA 3T95A 2IUYA 2VHEA 5JCOA 3RFVA 4D4JA 2OBNA 1RWBA 3VHXA 1CC1S 1F0NA 1L9KA 1VP3A 2C07A 5F7JA 5HMMA 1C1KA 1XRPA 2QV7A 2ZE8A 1GITA 1XRNA 3CB2A 4IDEA 4K40A 2I65A 2XCQA 4UAJA 4V03A 3RS7A 5GZ3A 5MN5A 2PUAA 4CGZA 2PKQO 3JAMS 3N7AA 4R0NA 5AW9A 5AK6A 1H5NA 4O2RA 5HS4A 3ZWAA 3ZWQA 5ER6A 1X7XA 4I4NA 4XM2A 2J0QA 3N74A 3F9CA 2VNIA 2K7ZA 2CJPA 2OBXA 1PJAA 1ZVVA 2UUOA 3HEAA 3DFZA 1E1QD 3KCQA 1AHHA 3L05A 1FE8A 4BV3A 4CKCA 3NRJA 1D0IA 4EB6A 1DGHB 4QEDA 4UZFA 3ZQ4A 1WTCA 3CZAA 1WP9A 4RTLA 3QVWA 1B16A 4LDRA 3MSCA 1AZSC 4N12A 2QQEA 5TT1A 1KI9A 1I2CA 2BHSA 5CJPA 4D4IA 1EXDA 1MC1A 2XNJA 5EAIA 2GM4A 1LLQA 2A9QA 4A2CA 2REOA 1UDAA 5FWXA 4LDZA 3B6ZA 4BDSA 1NJFA 3GEEA 2JA1A 3VV3A 3HUFA 2EWWA 3KZNA 5AI5A 4WZBE 3ZDQA 2O1SA 4QU9A 4AKSA 1A97A 2JFPA 2OO5A 3AFMA 1E1QA 2SNIE 2ZZMA 1TOAA 4H7EA 2IPAB 2VF7A 1GL3A 2O1XA 3ZHQA 3CTPA 4YGXB 2HWUA 2RHJA 1YBMA 5L3QB 1J0XO 1CETA 1ZL2A 3H3JA 4DQXA 4HAUA 4EB0A 3BWMA 2NX2A 1OC2A 3RIXA 3SIWA 2ENUA 2GVDC 3VPHA 2IZ7A 1FVFA 2BM1A 2O6LA 4WEOA 4FE7A 4PVDA 1H69A 4GUAA 4V0OA 2MMGA 3KSXA 2ZI4A 4GPBA 3IIIA 1RXEA 2CXXA 2IEBA 3LMMA 3JSAA 2JP7A 2XF2A 3OIDA 3RWBA 1M2GA 1LBTA 4PYJA 2WYOA 2BFMA 1EP2B 2OP1A 4QUBA 4E1AA 2WFMA 2QRGA 2BSXA 1I2MA 3PI7A 1SB8A 2UVQA 1HKUA 4RE6A 1KWKA 3AMVA 5BQ5A 3TIFA 4MJLA 4O3MA 1OJLA 3E5RA 3GHHA 3ZQJA 2ZR9A 2V5VA 3E3NA 4C89A 2HADA 4M98A 5LJIA 4CLXA 3ANTA 1F8GA 1BNCA 4FGZA 1WCIB 4C7XA 4CEIB 1RYDA 4DRZA 1PWYE 2UKDA 2AHRA 3ZU3A 5JZSA 4C5CA 1P4GA 1IB6A 2NVWA 3C6KA 3UAXA 1U2TA 1HT2E 3K0FB 4GEKA 1VC2A 3OA2A 5G1PA 2DSTA 3MW8A 5G0VA 5KQMA 4IFEA 1KEEA 4MWCA 1GILA 2FI1A 3KZXA 1NFQA 3KFVA 1R5NA 4YP5A 1HYQA 4NK5A 2FEAA 3DHNA 1NSYA 4O8ZA 2L0XA 1D0MA 3B52X 4TS4A 1HV8A 3IV7A 2WUEA 1KKLA 1TADA 4MV0A 2GHTA 3GUZA 3TLKA 1J99A 4ETIA 1OBHA 5I9LA 1KOLA 4OSOA 4Z51A 1QRSA 3H1AA 1BG6A 4LFCM 1H1TA 1A5AB 3LWNA 3ND9A 5DM2A 1KSGA 4BKPA 3LO5A 2LV8A 2J6IA 2OP0A 4IWNA 3NR2A 1N7HA 2NXWA 2FSHA 5IJWA 4UDNA 3VHXB 5K2OA 3TRKA 1P2FA 3VR2A 4BNLA 4D0GA 4IJ6A 2XWSA 4HX5A 4C7JA 1B26A 1KAEA 2PZAA 2YNMC 4OATA 3QBVA 1ZCAA 4FYJA 1EX7A 1RSZA 2P4SA 1WPXA 1BSVA 1DEOA 1JR3D 2CNWA 3DQPA 4K3VA 3IPCA 1F4IA 1JXOA 4YTEA 2P8SA 3PR2B 2Y67A 4V2UA 2OYRA 3SDBA 4FS3A 4XCVA 1HLFA 2ZVPX 2RB5A 4J76A 1ARZA 3WNZA 1GO2A 1DKNA 4AG3A 2G3YA 4KYUA 4BO3A 4BQQA 1GL6A 1MKYA 2DM6A 3U7HB 3SD7A 3NALA 1HDCA 2O14A 4G2TA 5JYEA 1NBME 2ZKLA 1MX1A 1U7TA 2Y0TA 4NNPA 2AJDA 5HA5A 2FW6A 1YCGA 5AJXA 3REGA 1MC4A 1VSBA 5EIWA 1P5JA 2G09A 4KFRA 3JQ7B 2JVJA 2PZGA 4DQLA 5K6AC 2Q5CA 4HDMB 5JH7F 4I1VA 5KOHA 4X5OA 4ZJPA 3S8YA 3N8GA 2QN1A 1U0BB 4Z4HA 1DIBA 3N2KA 2PA0A 3FUXA 4GF5A 4QJIA 3LPAA 1JYEA 1EFKA 3DW1X 1ONPA 4N18A 5AMXA 3KHSA 3A3PA 2PZEA 3R7WA 1ZCJA 3F1KA 4MIOA 2W00A 4NJEB 3T5PA 4K5QA 1Y3AA 4UVDA 3JZDA 2N46A 4EG5A 1OH5A 1GLGA 4BCCA 1WMDA 2LKCA