1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
b'MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRNA METHYLTRANSFERASE
molecule tags Methyltransferase
source organism Streptococcus pneumoniae
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
3M33A 1EJ0A 2YR0A 1F38A 1FP1D 1L3BA 1XCLA 3CKKA 3LDGA 3LCCA 2NYUA 1VLMA 4LWPA 2PJDA 4F84A 3TQSA 5KQSA 3AXTA 1KIAA 4PIPA 1RI4A 1VQ1A 3CCFA 3M70A 5GWXA 5K0EA 1DCTA 1L1EA 2ZWAA 4FT4A 4Z2YA 2YVLA 5GIOE 3DXXA 1PRYA 3THSA 1G6Q1 1L3IA 3MCTA 3OFKA 5EIWA 3A7DA 1KYWA 3R6TA 5EMKA 4HGYA 5ICGA 3KPYA 3P2EA 1HNNA 4FP9A 3GO4A 3EMBA 2ZZKA 5EHIA 3T7RA 1VP3A 3BKWA 3HNRA 4P7KA 4PINA 2GH1A 2PX4A 5EMMA 1SVUA 5HOQA 5EEHA 2FYTA 3TM4A 2WA1A 3QOXA 4PCAA 1NW8A 1XDUA 4NECA 2Z6QA 1FP2A 1Y8CA 2P3QA 3LCUA 2GLUA 4RWZA 5EKXA 4M36A 4DF3A 2Y1XA 4XUDA 2ONZA 3BGDA 5EIFA 2IBSA 3IV6A 4U7PB 1NKVA 2PXAA 3S68A 3SMQA 3G8AA 3KR1A 3RW9A 4KDRA 3MERA 5C1IA 4RTMA 3ERCA 3P9IA 5JR3A 4EQZA 2JH9A 3BGIA 3O7WA 2JG3A 5K0JA 3LDFA 1R8XA 2CL5A 2FCAA 2PX2A 1KPHA 2OB1A 3ELWA 3PB3A 3RODA 3UFBA 3REOA 2ZIFA 2AOXA 5EOVA 5LSAA 3Q87B 2IDKA 5E8RA 1BOOA 1VPTA 2G8NA 3IEIA 2B3TA 3G8BA 3TPZA 2UZ4A 5GP1A 3KU1A 3DLIA 4V0QA 5CVUA 3EPPA 5E9JA 4UOEA 4DZRA 4PYIA 2HR1A 1P1BA 3PS9A 4GF5A 1YUBA 2IBTA 2IFTA 4HRAA 3OZTA 1D2GA 2G72A 3EMDA 3KQSA 3UA4A 3BZBA 3NVKI 5KVAA 2O0LA 3G2OA 7MHTA 3MTEA 1FPQA 2AR0A 3FTCA 5FHRA 3G5TA 1P1CA 2JHAA 3KQOA 5K0GA 3DP7A 1DL5A 1WXWA 5HFJA 3HVKA 2F8LA 4E33A 3T7TA 4DMGA 4E2XA 4MQ4A 2EX4A 2ZTHA 4GOLD 4E30A 2ORED 5DT2A 4KWCA 2AVNA 2CMHA 5CVEA 3EVAA 1N7IA 5EEGA 3ELDA 3UJ9A 4E70A 3C0KA 1WXXA 4RX1A 3EGVA 3HCFA 2R3SA 4ER5A 3L8DA 1VP9A 2B2CA 2OO3A 2AOTB 3C3PA 4PYLA 3G2QA 3CBGA 3E7PA 1R00A 5K01A 4L7VA 3FUVA 5KYGA 4PGHA 5CVVA 3NJRA 4A6EA 3KPVA 4IKPA 4DA4A 5DRYA 1QAQA 5K05A 2IH2A 1B42A 2GAFA 2P3OA 4Y2HA 5CM2Z 3B3FA 2JHPA 3FTEA 3DMGA 5F2OA 3LKDA 8MHTA 3FYDA 2HWKA 2JH8A 5IKMA 4P7FA 3CJTA 1ORIA 1KYZA 4RTOA 5D1NA 5E1MA 4F86A 2PT6A 3K6RA 2O05A 5CUQA 5F2KA 3OFJA 3C6MA 2YTZA 3P71T 4WVLA 3UJAA 2QRVB 5DM4A 2CWWA 3KQQA 4WXHA 5DTQA 1F3LA 1I1NA 1NBIA 3K0BA 3FTFA 3UWPA 4RTPA 4CKBA 1MHTA 2NXNA 3GIWA 2HNKA 3MTIA 5EPEA 3THRA 2PSSA 3VC2A 2IH4A 2NNWB 3UJ8A 4PYOA 3GRZA 3U81A 1WZNA 3E05A 4PYJA 2GPYA 3E23A 2PWYA 3M6XA 1JG4A 3MCZA 4FGZA 2AS0A 4XCXA 3TFWA 4RTSA 4OBWA 5DM1A 3PLAE 1RJEA 2HMYB 1AV6A 2ZWVA 2NP6A 2IIPA 1X1BA 2AZTA 4KIFA 4LWOA 4YV2A 3WSTA 3LDUA 3PTAA 1WG8A 2AOVA 2GB4A 3HCCA 1RI1A 3M4XA 2EFJA 3G88A 4OQDA 4E32A 2PWPA 3E8SA 1UFKA 5DM2A 5DTMA 4X60A 3IHTA 5F2NA 2BH2A 3FTDA 5LQRA 2P3LA 3ELYA 4EKIA 2ZSUA 1WS6A 3CC8A 3I9FA 4Y30A 4M37A 5DX8A 5E1OA 4DCGA 3SSMA 3AXSA 4E2WA 3JWHA 1NW7A 4BLWA 3PT9A 2I6GA 2IGTA 3BGVA 3HTXA 1X1CA 2O06A 4OA5A 3LGAA 1XCJA 5DTRA 4PYQA 2PXCA 3NDJA 2B78A 5LR6A 3ORHA 1NV8A 4QTTB 5LQCA 2JHCA 3MGGA 3BWCA 4P7JA 5FQNA 3SX0A 3KQTA 3P97A 5E9QA 3TLJA 4K6MA 1JR4A 5K0BA 3RIEA 1NW3A 4QVGA 1ZKDA 3DR5A 3I64A 3KR9A 5FA8A 4C04A 4C4AA 1EJ6A 5FTWA 3A4TA 4U7TB 1KHHA 2R6ZA 5G02A 4ER6A 1M6YA 2PX8A 4IV8A 4X1OA 1M6EX 1VE3A 4GOND 2C7RA 2VP3A 3OE4A 5P8WA 1NW5A 1JG2A 2O57A 3AWIA 4KW7A 1NW6A 2YXLA 3C6KA 3B5IA 3GXOA 3P2KA 2OZVA 1VIDA 4G56A 1ZHFA 5MHTA 4GC5A 2PLWA 5DXAA 5K8VA 3EEOA 2GA9A 4FS8A 1XDZA 3I5UA 4PYNA 4CKEA 4X41A 3LCVB 2EJTA 4AZWA 2G71A 4HG2A 3SSNA 4YV0A 4RTNA 4R6XA 4R8RA 2OYRA 1JQEA 3EVGA 4GOOD 4EKGA 2FHPA 2Q41A 5D1HA 1RI5A 4DKJA 1BHJA 2I7CA 1X1AA 4IWNA 3UJ7A 10MHA 2UYHA 1TW3A 5FHQA 1L3CA 1NT2A 2IPXA 4GOMD 3FUXA 4HH4A 4ZTBA 3SR4A 2XVAA 1X1DA 4OA8A 1NBHA 3LECA 1FBNA 3P9CA 3DMHA 5IH3A 2QRVA 1X19A 4E2YA 2KW5A 3LX6A 1IM8A 3A27A 5FWAA 4ER3A 1M0EA 4RVDA 5LQAA 1NE2A 1O9HA 1KXZA 2ZBQA 1YZ3A 3QV2A 5LQNA 3NMUF 3GRUA 2EJUA 2PV0A 4YUZA 3NW9A 2I9KA 5C9ZA 5DX1A 5HILA 4RVFA 2UYCA 2P8JA 4FR0A 3KR0A 2NXEA 2QY6A 3EVEA 3R24A 4RTLA 1R6AA 5BXYA 2CMGA 2C7OA 4BP3A 5HIJA 2PGXA 2JJQA 4AZVA 1XVAA 2VDVE 3OU2A 3PFGA 2V74B 1D2CA 3KPWA 1TW2A 4MWZA 3UZUA 1EQAA 2QYOA 3GDHA 5DXJA 5E2BA 4GUAA 5BW4A 5GM1A 3BKXA 5GINE 3R3HA 2ZULA 1ZGAA 3DLCA 2Y1WA 4YUVA 5KS2A 4HTFA 5U4XA 4OQEA 4YV1A 2UYQA 1XDSA 1RI2A 3A7EA 4BLVA 4GEKA 2XBMA 1SG9A 2PVCA 3JWJA 3KPUA 1JQDA 5DRTA 1G60A 2B9EA 1JG1A 3HA5A 3PFHA 4FT2A 4RTRA 2AN4A 2XVMA 2AN3A 3T7SA 4PWYA 2NP7A 2AOUB 3FUTA 1P39A 4EVIA 3KQWA 2C7PA 2K4MA 2OBFA 3FZGA 3X0DA 5LQUA 5EZSA 4PGGA 4MIKA 4XUCA 2WA2A 1G55A 2QM3A 2YXEA 2ZBRA 3A26A 3I58A 2PX5A 2I62A 2VDUE 2WK1A 3H2BA 5FQOA 5T6BA 3DXZA 3HCBA 3TOSA 1YB2A 3KQVA 2EG5A 5DPMA 5DX0A 1EAMA 4QVKA 3F4KA 2ZCJA 5DSTA 3HCAA 3FRHA 5EG5A 4HGZA 4FSDA 1QYRA 3MQ2A 1XXLA 2E5WA 2V7EA 3C3YA 3NVMB 2DPMA 3PVCA 4GBED 4KVZA 5E1BA 1YFJA 1R18A 4RSRA 4O29A 5HIKA 5E2AA 3NWBA 5EGSA 2FK7A 1WY7A 2AVDA 3B7PA 3FPJA 4CTKA 1EG2A 2YQZA 3NWEA 5ICEA 2A14A 4AZTA 2ZZMA 4OX9Y 3NDIA 3SM3A 3TR6A 4GC9A 1O54A 3G7UA 4CTJA 3GU3A 2ONYA 5ERGB 4C06A 3HP7A 1R74A 3FPFA 1N7JA 4M38A 5B1SA 1XTPA 4X63A 5LQJA 2ZBPA 1NV9A 1TPYA 4C08A 3KHKA 2P35A 3BWYA 2P7HA 3G2PA 3OU6A 1KPGA 5H02A 5EC8A 1ZG3A 3BWMA 3EEYA 3P2IA 5HZMA 1IXKA 3HVHA 1AQJA 3LHDA 4QPPA 3I53A 3P8ZA 5HIMA 1N2XA 3KQPA 4H0NA 5GOZA 4MHTA 5CCXA 1UIRA 2BR5A 3UJCA 4YMHA 2ZLBA 4JXJA 1AF7A 3LSTA 4KRGA 2OXTA 5M5BA 3VYWA 9MHTA 3BT7A 4HSGA 5K0CA 3FPGA 3GRVA 1D2HA 2AOWA 3QOWA 3KQYA 1G8AA 3SGLA 2OPBA 2VDWA 5FULA 3M6UA 2BM8A 2P41A 3HEMA 2IH5A 5EZQA 1SUSA 2C7QA 2GS9A 5EMLA 2FPOA 1JTEA 4YUWA 1JTFA 4P58A 2BR4A 3LKZA 1KPIA 1BC5A 1AQIA 4FZVA 3ER9A 3Q7EA 3EVZA 3SVZA 1XJ5A 3LBFA 1T43A 2OY0A 3JWGA 4PONA 1I9GA 1PJZA 3HCDA 3UJ6A 4CXMA 2DULA 3ER8A 3DH0A 1YFLA 1JG3A 2FRXA 3FRIA 4A6DA 4R6WA 2AN5A 3MHTA 4XUEA 4QPNA 4V0RA 2O07A 3EGIA 3CJRA 3G5LA 4DQ0A 2B25A 5EKUA 4AX8A 2FK8A 1O9GA 1U2ZA 2BZGA 1Q0SA 4HC4A 4LG1A 5K0NA 4LECA 2PBFA 3AY0A 4ER7A 3M6VA 1R8YA 4ER0A 3FUUA 3MB5A 3TKYA 3UJDA 5LQKA 5K0FA 3EVCA 2OKCA 2ZZNA 3PX3A 3V8VA 4BP1A 4PCLA 4QQKA 3OU7A 3BUSA 5CD1A 2G1PA 3FPHA 1MJFA 2BR3A 4KDCA 1ZQ9A 2P7IA 3LPMA 5CCBA 3UBTA 1L9KA 1SQFA 5FUBA 1QAMA 2VZ9A 1VBFA 4QQNA 5T67A 3GRRA 3P9KA 5GM2A 3SSOA 2G70A 4QDKA 1FJXA 3A25A 1YZHA 1SQGA 3AJDA 4YUXA 1HMYA 3GGDA 5GIPE 2PT9A 1RJFA 2ZIGA 1ZGJA 3D2LA 2N47A 3GNLA 5EVJA 4KIGA 3ELUA 4C05A 1JSZA 3G2MA 4MTLA 5DSXA 1INLA 1OR8A 3TM5A 4AUKA 5EMJA 5K09A 2YXDA 3HA3A 3KR2A 3O4FA 2Z6UA 4ATNA 2H11A 3DMFA 3KPJA 3OZSA 4CKCA 4GQBA 2P1DA 5FCDA 4BLUA 3MAGA 2ADMA 2ERCA 2HV9A 3DXYA 3IYLW 3SXJA 5DLYA 5DM0A 2XYQA 3BXOA 2ZIEA 4IV0A 2CKDA 4P7GA 4RV9A 2BM9A 1EIZA 1V39A 2NXCA 5CVJA 1SKMA 2Z6AA 3B89A 2XYRA 2YUIA 3OCJA 4EMSA 1KR5A 1YF3A 3G89A 2UYOA 3EGEA 1VL5A 3EVBA 5HEKA 2NXJA 1Z3CA 2PKWA 5FA5A 3JWIA 2H1RA 5FADA 5EQJB 4DCMA 1P91A 3HVIA 3O31A 5HIIA 3VSEA 4X61A 5BP7A 4RTJA 4BY9E 3FUWA 3EVFA 4HTFB 4RVGA 1IY9A 3ME5A 5E9WA 3R0QA 3GCZA 3HVJA 4EK9A 1RJDA 3TKAA 1ORHA 3UJBA 3LBYA 1RJGA 3CGGA 1SUIA 4ISCA 4OBXA 4R8SA 4PNEA 2ZW9A 3FPEA 3OE5A 4YMGA 1QANA 4RVHA 3BWBA 5T64A 4DM3A 1KP9A 2P40A 2XYVA 3VC1A 5FWDA 3DUWA 4CWAA 3GRYA 3HA7A 3HCEA 3OPNA 4E31A 1QZZA 2LD4A 3B3GA 5JUWA 5KQRA 3CVOA 3P9NA 3V97A 3M6WA 3FYCA 3DULA 3EVDA 3DTNA 4M7RA 1JSXA 4R05A 5ICCA 5BW5A 4PYMA 1G8SA 3R9XB 5K03A 3ID6C 3OZRA 1H1DA 2ZFUA 5E1DA 4C07A 1G38A 5E8JA 3NTVA 3ANXA 5CVDA 1UWVA 4AZSA 3KKZA 4QDJA 4PYKA 5ICFA 2IP2A 2OB2A 4E2ZA 3KQMA 4PIMA 5DWQA 1RI3A 4C03A 3GJYA 5C0OE 3HM2A 4YUYA 2PXXA 2ESRA 2H00A 4POOA 4RTQA 3PX2A 4RYLA 1BKYA 2YX1A 2ZVJA 1Q0TA 2IDJA 2AOTA 3CJQA 5K0LA 3TMAA 3TRKA 4FSXA 1I4WA 2AOUA 3B3JA 2PY6A 3GWZA 4QTUB 3UA3A 1QAOA 2QE6A 5EHGA 2VS1A 4RTKA 5CIYA 2HTEA 3T0IA 3DOUA 4B17A 3LL7A 4F85A 1DUSA 1JQ3A
chains in the Genus database with same CATH superfamily
3WLNA 1U1CA 4A5SA 2DKNA 5JH7A 1CSEE 1XRJA 1AS3A 2EHJA 3O4GA 5H59A 1JMVA 3VYTB 1G5HA 3M7IA 3PPYA 1CK4A 3CCFA 1XPJA 1SUAA 5J5AA 5F9FA 2QV0A 4L6IA 1QDLB 2HFKA 3ZCVA 2WR8A 3HY5A 4JDUA 4FFSA 1XDWA 2JAOA 2XTZA 4RIHA 5ILGA 3HJBA 4ZCIA 2IEGA 2XUDA 2J48A 3A7DA 1G6OA 1KYWA 4IBKA 1M5UA 3G2JA 3LS2A 4QPCA 5LBTA 2UXBB 2DAIA 3P9QA 3CHYA 3IS3A 3WGLA 2VZ8A 2ES4A 3JTMA 2D0DA 4OPMA 3SXUB 4DIBA 5FPKA 2B2NA 1K0FA 2XUZA 3VC3A 4JI4B 3HNRA 2KNVA 5HP4A 4FQ8A 2NO0A 4LXIA 1HDIA 1JVNA 1O95A 3DBRB 4RKRA 3FWNA 3H42B 4MVJH 5KNCD 1WD5A 3FFBA 1J0BA 1MX3A 1XNHA 4B3BA 4W9NC 4EI8A 2QTZA 1NXPA 4DNXA 1F8YA 5BWBA 1GTMA 4JB3A 4IV5A 3LAWA 1NKVA 1U7TA 1YBMA 3D3QA 2BW0A 5K3AA 1H42A 5C7YA 4EFMA 5AJXA 3AG5A 4BCBA 1YU9A 4CMIA 1STOA 2W6QA 4DCTA 2EZ9A 3DS8A 4ETMA 1B8VA 4B40A 4YR7A 3OIYA 4WFJA 2JH9A 4URZR 3WWPA 2VH2A 2WTAA 4K81B 3TF5A 5U1PA 1TVEA 3BD9A 2JFGA 3MRTA 5A5VA 2GJ4A 4XDGA 5GONF 3ADBA 4CZ2A 4LF9M 4RXUA 4EF6A 1C29B 3Q7IA 4ENSA 2FN4A 3FPSA 3G8BA 3V32A 1Y8QB 4BN0A 2OHOA 4KRFA 2PZKA 2FTKE 3STVA 1A9XB 4NZ9A 1EEHA 2VAXA 1P1BA 3BXFA 4NDAA 5HF9A 3EF1A 3UTDA 5JCXA 4KQMA 3U6MA 3H3JA 2XF2A 2VA8A 2A1TS 2PQ0A 3OD5A 3G2OA 1PG5A 5FBZA 3WYAA 4D6YA 5GADl 1A9RA 4IWXA 4L6CA 2FZ5A 3UB3A 1A9XA 2FQXA 2GJSA 2XKBA 3PFWO 1DADA 4S2UA 8GPBA 2LCIA 4US1R 1YZQA 4Z8XA 4E2XA 4LVCA 2EX4A 2ZQZA 3A6ZA 4NJEA 4N54A 3O2QB 1I10A 1ZL0A 1GZ5A 1Q19A 2FZGA 4OVZA 3ESQA 4ZAGA 3W90A 2Y1DA 5A3QA 1XPOA 3JARB 2NZVG 2UVQA 1HRDA 2W43A 3WGGA 4W5NA 1D4OA 3ECSA 3I4YA 2XHZA 1XCGB 5KYGA 1U2QA 2FDRA 1P7YA 4KZKA 2IH2A 3L4EA 3D6MA 1G18A 2FH5B 3OCVA 1ACMA 1YZTA 2RG7A 2DGDA 4ARCA 2ZWOA 4HPJB 1P3QQ 3AJIB 3PBKA 2X58A 4LHWA 1RJWA 4ZRNA 4HAOA 5LYYA 2IOHA 4CCSA 4RTOA 4P84A 1JEOA 3H2YA 1XU9A 4PIVA 4YJ2F 2K0BX 1VIYA 2HWYA 1AS0A 4ZFNA 5JDIC 3MG9A 3Q8XA 3FPLA 5DO9A 5H3CA 3R9IA 2Z5LA 3Q6IA 3UWPA 2JGAA 1SPBS 1ENOA 4L8LA 3SQLA 2XI4A 3UF0A 3BCHA 1LWOA 5ENVA 2XV1A 3ZJ4A 2FKNA 2C4KA 5KJ6A 3A1SA 4A3SA 5IKXA 4DYHA 4BX9A 4A23A 4BKRA 5IKPA 1RWWA 3ZUGA 1V9CA 3IKTA 3PUWA 2Y1KA 4MWBA 3E23A 4QIHA 3LZDA 1K88A 5ITWA 1XVTA 4TPKA 2YQ5A 3CEAA 2XVZA 2QP4A 5AVRA 2IIPA 4QKQA 3CLUC 3KJIA 1T13A 2WNHA 3E3MA 3QXHA 4Q19A 5KOIA 2XGGA 3PWTA 2PHZA 4XTRA 3VBEA 4M0KA 1G0NA 3RM3A 4JV5B 3WTCA 5FWYA 3D4PA 4QPDA 3KJQA 1ZW6A 3KTAA 2YS6A 4KGDA 5DTMA 3T3MB 4X60A 3QM1A 4YRTA 3G1TA 4ZV4A 3FLMA 4S1PA 1RJ9A 1NF2A 4MP6A 4PQGA 2D13A 2QE7A 5KSYA 4LFBB 3KOXE 1KIFA 3HB0A 1SK8A 4LDJA 4HN4B 1L5HA 5EPUA 1DIAA 5JPIA 4RF1A 4EHBA 1AOXA 1LK0A 2Y6UA 1ZJYA 3FYUB 4N3BA 2WJWA 3IQEA 1QK4A 2HU8A 3NDJA 1CCWA 2F9FA 4LKRA 3UOWA 2BEUA 2JJ8A 1Z4QA 1TF5A 3ORQA 3HRKA 3P97A 4PTZA 1U5BB 1H4TA 5F78A 4B48A 5H68A 1TQDA 1Q0PA 1UBEA 2E6KA 1W5AA 2HADA 2NT4A 4DJAA 4KUEA 5CFOA 2I4OA 1XN4A 4QUHA 2DFTA 4WL0A 5AKKA 5ECGC 4EG3A 3WWZA 4JHXA 1OU0A 1L7RA 4M1EA 3C7TA 3U40A 2I87A 4LV6A 4BLOA 3ETHA 1JQBA 3FR7A 1N1GA 3T9EA 2ZYWX 5HW0A 1AHIA 5GJVC 5IJWA 1TJ3A 1E1YA 1VE3A 4FHCA 2J67A 4JMLA 3QPAA 1WOYA 3F7MA 4YJ3F 1XNQM 3SC3A 4C2TA 2NTEA 2AFIE 2GZ1A 3ZV3A 1WCIB 1RM5A 2OZVA 1M1ZA 1ZHFA 1ZJZA 3GD7A 1OLOA 4UDYX 4A8PA 1SK9A 3V4SA 2GN8A 2YIDA 1F1BA 1KYXA 2BVNA 4J1QA 3F5SA 3Q7TA 3OQMA 2I91A 3I04M 3OZUA 2DPXA 1L4EA 1TAGA 4FKZA 3H5VA 1SIBE 1K6IA 3PNOA 4CTMA 1TMYA 1UPUA 1WP4A 1XEAA 2OO5A 2VNHA 4G41A 4MLZA 1GYQA 3OPYB 4N0PA 3T4PA 5AOAA 4D5GA 3ZCBB 4K0KM 2IIQA 1VRVA 2YJNA 4BMZA 3FVRA 4R8VA 5B1IA 3QY0A 2VOEA 2QLJA 4ES6A 2UVPB 3OX2A 4H3HB 3QTLA 1NBHA 3IMFA 3EFHA 2X8WA 3CXUA 3KUXA 3LHFA 3VLFB 3UYLA 5DM60 1BFUA 4ZYUA 3MK31 1RVDA 3LX6A 2R8XA 3U39A 1QRRA 3C1OA 4B6GA 1CW2B 1N6LA 4G9EA 3EPJA 2V9PA 2RJOA 3BQMB 3DDCA 1WR8A 4G0VA 2PZEA 4XSHA 4KQWA 4A73A 3E4CA 2ODTX 2XBLA 3FDZA 1MAVA 4R9NA 5AM1A 3T4UA 1R37A 1JKFA 3VTAA 1FDWA 5FBWB 1K63A 4RVFA 1GDHA 3O8CA 1G7SA 4JASB 3IKJA 4AD8A 4I3HA 3RSSA 1K6XA 2AI3A 1BMDA 2IE0A 2WG1A 5D7BA 3SIWA 5ICSA 3PUVA 1RRGA 1PEYA 1CR4A 1G20B 1QLJA 2NM0A 3D1JA 3GVHA 5JNTA 2JZ1A 1OH8A 2Z2KA 4CDMA 3PDUA 4A91A 1K82A 3CISA 1ACLA 3AHEA 1GVNA 2ONKA 3HFJA 2H1FA 2GGSA 1NJ6A 4FC6A 2J0UB 4Q1CA 5BPHA 2CYAA 1K3XA 1O7JA 2F3QA 2I6UA 5ALLA 2IC5A 3UMRA 3WLQA 1I7DA 4WZAA 1WJ7A 2F64A 2I7TA 3QTBA 5B2EA 4FGJA 4CLRA 3BXPA 4B76A 3QPBA 2OVBA 2K87A 1OFHA 3HA5A 1U98A 4CMAA 3LXUX 2PPVA 1P9OA 4D8TA 1CEQA 2W6CX 3FAZA 1T25A 5BYKA 3T6PA 2ZIAA 5EJGA 3KSRA 3AUSA 3W5HA 1FK8A 2J85A 5EYPB 4LFAB 4IIBA 4EPWA 4RWEA 3K4HA 4RJJA 1F8XA 4A8JB 2ZJ6A 2XXAB 2R68A 1GQOA 4LGMA 1JHOA 2VP5A 3LQ4A 1KYQA 4Q9NA 5F9MA 4CKWB 4YUAA 3U7FB 1HDGO 1QOZA 3KQVA 3PTZA 1E9DA 1UODA 4BVHA 3CRVA 1VSTA 2CMFA 2IITA 3NVAA 5I47A 4MLCA 1L1RA 4Q00A 3KZXA 4FN5A 5IN4A 1D2MA 3BIJA 4JELA 2E5WA 2YASA 2FPSA 3MWJA 2XZTA 3O84A 3EARA 2JZ0A 4RQBA 1YNSA 1UFVA 2XADA 3AJEA 3B7PA 3DUFB 4CTKA 4OQQA 2WY2D 2C99A 3O90A 3R0JA 4ZJYA 3U61B 1WPQA 2L17A 2IP4A 3VZCA 2KPOA 4LBZA 4AMBA 5LFAA 3G7SA 2VSQA 3MGKA 4C06A 1B14A 1R74A 3N8KA 3HWSA 2C4VA 3KXPA 2G88A 3NT4A 3BJEA 1TFUA 4PZAA 3DUFA 4RMIA 1OXUA 3T61A 1UPAA 2X0EA 1Q12A 4RETA 1ZGGA 2XMDA 2JIOA 4YO7A 4HQKA 1Y9DA 4ZGBA 1ZD4A 1B1CA 1PR6A 1T0PA 1N5DA 2REXB 3PQ7A 4WE3A 1CLUA 2CFIA 1KJWA 3KXKA 4ROSA 4CLHA 2GCEA 4BC0A 4HADA 4NCXA 5H80A 4MHTA 2HA4A 4MW2A 1LWNA 2I3BA 4YMVA 1AUOA 2XQVA 2NYAA 3LBAA 3LZ6A 1P31A 1CF4A 1BX1A 5I8WA 1FFYA 2GM3A 1FS5A 9LDBA 4G1UC 1K98A 3RVQA 2YWGA 3U2QA 3QE2A 4NFYA 1MIOB 5JCOA 4B4DA 4C9BA 1MC1A 4XW2A 3W8NA 3WL3A 3SJUA 1XXHA 4KGVA 2DUUA 4TWAA 4YAFA 3X1KA 2IA5A 3VK8A 1K06A 4PSUA 1U0GA 5TX7A 2H8KA 1M0WA 1GKYA 1OPXA 1EK6A 1XJWA 3AR4A 2F8SA 2Q21A 2W0SA 1XZCA 1XJ5A 2Q6LA 2C2MA 3F6SA 1YMUA 5EJEA 4LOLA 2NU8B 1QIFA 3JWGA 4DA0A 1BXZA 3R77A 2FPIA 3KHSA 4A6DA 2HRQA 3OM1A 1VMDA 2O07A 3F2VA 1R27A 2X1HA 1MA0A 3OURA 1HNXM 4GZ6A 1XRLA 4K9KA 4G1MB 4C0JA 1BDHA 1O9GA 2BZGA 2DTDA 3UWMA 3X3HA 3DWIA 1LLQA 2WKQA 4BFSA 3NHMA 3DF7A 4Q21A 2JI8A 4BPRA 5F3WA 3S8YA 3WB1A 5JSZB 1H2EA 3GJZA 5E6SA 4X62B 1OX6A 3SAWA 2WMOB 3S28A 1YUNA 1HYEA 2ZSKA 4YP5A 3HHYA 3ZDBA 2H08A 2RGNC 1ZX1A 2I8LA 1MJFA 3WWCA 2PAFA 3K0EA 1GTJ1 2G80A 4ANRA 1TZ2A 4KDFA 4YXWD 3FHOA 2XGJA 4G0MA 2QMHA 4QXMA 3UH0A 2VTDA 1FYXA 5CFLA 1DQSA 1YS2X 2NAFA 1F7VA 1K27A 4JI0B 4ZJUA 3KYDB 3BOSA 4OXYA 3B82A 2HZ7A 3UV6A 2I7VA 2IHBA 1NFFA 3EODA 4FYKA 4RZXA 3UHPA 2EKPA 3N87A 2QW0X 4HFNA 4LQLA 5EVJA 2GXSA 3WKDA 1GZUA 5I4KA 1EWRA 3C3KA 3KRTA 1EGQA 3GARA 4DPMA 2WKWA 3IP9A 4MW7A 4AZ0A 1RIFA 3B7QA 3DMFA 5ALDA 4CKCA 1E7QA 4Y28F 2JIZA 1EE8A 3UOAB 1VOTA 2CSUA 3II6X 5JXGA 1XFDA 4DR1B 2QROA 2CL6X 3O8QB 4C0QC 4UAUA 1KNQA 4ZYTA 5JQGF 4MLPA 2BM9A 2NXCA 3FKQA 3OCWA 2CDCA 4HQLA 3BTSA 4CF7A 2QXUA 1KE1A 1VSVA 2DKFA 2FPUA 2GMWA 5HEKA 1X1RA 3OZAA 1AKYA 4TKZA 5DTEA 3PRJA 2X5OA 3DDSA 2QT1A 5EQJB 2H65A 4AT1A 1YE5A 3RGPA 1LK5A 4G37A 1GTRA 5CXXA 1I8TA 1O94C 1XYGA 3AEZA 1VG0B 2W6JA 4LV5B 5KJCA 3ZCSA 2B8EA 3TZBA 5K3BA 5FTKA 5TGTA 1O6BA 1T34A 2OAP1 3LMMA 4X7RA 4ZI7B 4KQHA 5CA0F 2HWXA 1B43A 1SUIA 1UXKA 2POCA 2V4MA 2DC1A 2I99A 3ZWNA 2OLEA 2X4IA 3RS0A 2WP0A 2P68A 2IYYA 3WKCA 2Q3HA 3R5SA 5FWDA 5L8VA 4RF3A 4JWKA 2LD4A 1R5LA 1K7FB 1T2FA 4E14A 3LO8A 4Q9IA 2GPWA 4W1PA 2P5TB 1S6YA 2X9LA 3VBCA 2WV7A 2J3KA 3IG8A 1JAHA 3DMDA 3QBTA 4HUQA 4M7RA 3VR5H 1AKRA 4J7XA 1QIDA 3PC7A 4HLQB 5JZBA 2QSZA 3P0EA 3NHBA 1P61B 2QU7A 2ZFUA 4IXNA 4HX5A 2XW6A 2VBFA 5CVDA 2N42A 1PEKE 1ABBA 3BCSA 4O33A 4EI2A 5IYZA 2IEDA 4AICA 3FOAA 1E7MA 3CYFA 4M76B 5DTIA 3WL4A 2PD4A 3KQMA 4JWTA 3NYWA 3K5IA 4LF7B 1HE3A 4LRSA 1SG0A 1SURA 3C3MA 3HDTA 2DETA 4XWTA 1WQ4A 1Z33A 4ZCMA 4DJTA 1ESEA 3WIUA 2SICE 4KI0A 8OHMA 2A58A 4WFQA 5AW8A 1MEJA 3M49A 4H7PA 2HMWA 4TS1A 1FJGM 5IDQA 3DZHA 3H8VA 3ZWMA 2JFHA 1KDPA 4B3JA 2IT1A 4TM7A 4XPIA 3QE3A 5E7QA 1NLYA 2WW8A 5AK6A 5DYWA 2ZJ4A 5TQVA 1YQTA 3TSOA 1E2BA 4YY3M 2OCLA 1UDXA 2I1LA 2ID4A 3LCCA 4R8MA 2VYCA 5HM6A 4KPUB 1KZ7B 4BB6A 1GABA 2ERYA 2OM6A 2Z6VA 4GI2A 4N1AA 4F84A 1RRCA 1LDYA 1P3Y1 2Z4RA 2ZAOA 1U5CA 3VX4A 1MC8A 2B0JA 4K9PA 3KOZE 4WLFA 4FHFA 4WQMA 2JJYA 3OFVA 3WK5A 1J0XO 3FNEA 4JC5A 4DLZA 1C1KA 4HTAA 1USGA 4UUPA 4L85A 4RHXA 1AQNA 2XCQA 3WAJA 4GZLA 4KVFA 3JD3A 3EXEB 4UATA 2PU7A 1HNNA 3WIEA 3RQIA 4C7KA 3CH5A 1D9ZA 3D7MA 4XQCA 4B84A 1N2JA 2A33A 3F5DA 4DCCA 1Q1GA 1Y0BA 2QZPA 2VWPA 4YJFB 5AJWA 5KPRA 2VPXA 1YRWA 4NULA 3I9MA 3L7LA 2KRKA 3DFFA 4D9MA 2SCUB 4HB2A 2ILVA 4PCAA 2SHKA 2TMGA 2PDAA 1YDFA 3DDHA 4Q93A 4WERA 4L9WA 3BC1A 3EF3A 4V0MA 2VRCA 3U44A 1GZ6A 1KAMA 3N2GA 3G9XA 5EKXA 3AV3A 2Y1XA 2WF6A 4HBGA 4Z3KA 4PFSA 4EZBA 3RVRA 1XVUA 2YY5A 2VT6A 2H29A 2W48A 2F3TA 1W1IA 4NS4A 4TVSA 4MIOA 5KQ8A 3REQA 3T52A 4ZCTA 1JFFB 3ERCA 3P9IA 4EY8A 5ALTA 4UAVA 1Y3BE 4M89A 3RFFA 4ESOA 3LC1O 1VRWA 3HDQA 4UTNA 2VK1A 3CZAA 5LA6F 4DRYA 4ZKEA 1H22A 3MUNA 4Q9KA 4E6PA 2NOAA 1BQEA 2OWDA 1E58A 2XUPA 1QQ5A 1P1FA 2IYOA 1C3OA 3F5MA 3OZFA 1VPTA 2QTAA 2JFXA 2C2YA 1U5BA 2C4HA 2ZUVA 2F5QA 1AB5A 3FNBA 2CE2X 2PTHA 3IB6A 3N05A 5DOZA 3EXAA 1Q22A 2AI2A 2BEVA 1EA5A 2X9NA 3AUUA 3MFQA 3MUOA 1YZVA 3PS9A 4GF5A 3JS5A 4GSLA 3T0FA 4H0FA 4NC6A 1E61A 1WUYA 2R8ZA 2FZ4A 3TVDA 4P3KA 3KT0A 1VJDA 1GO2A 1H0HA 3KE9A 1SEVA 1HR0M 5ELXA 4DMFA 4NQRA 3TL2A 1V9LA 2IU0A 2ZTHA 3N6XA 5DZSA 5I45A 1J5EB 1MFPA 3S7ZA 3F4BA 4NL4H 1MA3A 1MQAA 4JLDA 1K5DA 5CVEA 4X65B 1YD7A 2YFYA 3C0KA 1JEQB 2C3YA 1ZPDA 2Q3FA 4NMWA 1PWYE 4FZ3A 1UAAA 3DOEA 4LOJA 3GV0A 2MGWA 1MENA 2R1UA 1KEZA 4E0BA 5CB4B 2W2MA 2OCAA 4KX5A 3BCUA 1YACA 2W6JD 3TKLA 5CDGA 1T2AA 2XKKA 1FU8A 1YJCA 2YV4A 1ZUIA 3FLBA 1Z2PX 1DIGA 1JAXA 4IO0A 3UVEA 1JHYA 2QRUA 2QJOA 4L8WB 4Q03A 2H4HA 2XJ9A 4QLAA 1A7KA 1OBOA 1KVTA 3U4QA 2ID7A 1H66A 4A7PA 5D1NA 5JASA 4Z0NA 4C3ZA 5ARDA 3FAKA 3DE5X 2XYHA 3OJ0A 4B3GA 4HMPA 1Z4JA 2VBIA 1ZN2A 3BZWA 4UEJA 1BHQ1 2A92A 3HSSA 3RYTC 2DHRA 4D02A 3CPEA 4F6CA 5CFMA 1KSGA 4HEA1 3RIGA 1DLJA 4P86A 3UJ8A 3NHRA 5ECWA 3NAGA 1HQYE 1AN0A 1JX6A 2GPYA 3WLRA 2Z56A 3NLLA 4UUMA 3LKVA 2Q9BA 3G82C 4P33A 4ZQHA 5EN4A 1EFKA 4CQMB 3LF2A 1PTJA 2YJ4A 3EVTA 5AJZA 4DBLE 1Z8DA 2VFAA 5KZMB 1IBKM 2W2LD 1KC1A 3B78A 2ZKLA 3JQ8B 1V34A 1ZJ5A 3G88A 4E32A 1B6RA 4KLAA 4MUFA 5CG2A 3NWLA 3KVOA 1A7AA 4MHSA 3JR7A 4DUPA 3UM9A 1OBCA 5H16A 4AQDA 2IHNA 3QRWA 3B48A 3Q3EA 1OLUB 4BFVA 3ROTA 3LUHA 3WC4A 3QPDA 1KY3A 3TNJA 3ZGXA 3C98A 3N0TA 4J7UA 5DGXA 4MVXA 1U2EA 1WKCA 4WZAB 4Z5XA 4M37A 5DWVA 3TAXA 4TWIA 2C9OA 5H9WA 1ZRNA 3FIUA 4HNSA 4X44A 1XP8A 2J3HA 3K2BA 3MJCA 4WUVA 1ISRA 1X3LA 3BTOA 3INNA 4KN5A 4EAQA 2WB2A 1PJBA 4KCGA 5IANA 1I4OA 1QV9A 1P7PA 4UVHA 3UWOA 4IBGA 2OENG 4HEA6 3WGKA 3TLJA 1P9WA 1FFXB 3GOHA 4KRXA 4DR5M 1D1PA 4PSVA 2MYUA 2FWRA 4U02A 5AXBA 2PJUA 2VLBA 5IM4A 1JYSA 1O89A 1EXWA 1AM4D 1CUFA 1LRKA 2F5NA 4MVJP 3HR7A 1U31A 2OV8A 2G0TA 4DR4M 3MRVA 4I9UA 1GAWA 4C87A 2NT3A 5CMLA 3INRA 1XTBA 3VU9B 4QOGA 5LZ9A 2SKEA 1QO9A 2WHPB 1KEEB 4IJEA 2RIRA 3AJRA 3FVQA 4BB9A 3NBKA 4Q4AA 5P8WA 3RYFB 2LVBA 3Q12A 3ZCQA 1RQPA 2BFNA 3LL4A 4KE6A 3B5IA 3OESA 4Y98A 2JP7A 1N92A 1U8ZA 1ZRSA 3E9MA 3GHHA 4QZVA 4Q4JB 2JUJA 3CZMA 5JATA 4FD2A 1SUFA 4Q15A 1WZ2A 4U7HA 1IJKA 1ISSA 2ZYIA 3T5BA 2DZDA 3QEJA 4R7ZA 4C6RA 2WWFA 4U0KA 3AF0A 1FTYA 1BE6A 3DQPA 2ZREA 1C8KA 4IDCA 4X85A 5E6UB 1SZJG 4UUOA 1I94M 4KR6A 2G40A 2MSNA 4ZIRB 5I9MA 1FMJA 2D8AA 3BE8A 4C21A 4BNHA 4I4TA 1O58A 2AEFA 5FHQA 4AKIA 4HK4A 1VPEA 3E18A 3B5JA 4FMDB 4FC7A 2I0FA 5THQA 1NKTA 3EQZA 3NTLA 1GLVA 3UJHA 1I24A 4OLJA 4A1OA 4Y6SA 1D2NA 1GTL1 1OLSA 4RDHA 5A5DA 2XCRB 4E2YA 1QZUA 4I9NA 1U9IC 2AQIA 5D2CA 2NUTB 3IX7A 4YJ2B 4HGQA 4N18A 1NRJB 4N41A 3GX1A 4Z4IA 2OFXA 3TGWA 1XXHB 1YFKA 2F8MA 3H1EA 4XDHA 5IHPA 2DY1A 3EDRA 2PWBA 3OFND 1DB3A 1W4ZA 1WW2A 2OM2A 4BNVA 2RMKA 3CUYA 1EM8A 4C5BA 3A4LA 3U7JA 3D64A 1GZSA 3PC2A 3F6PA 4IXDA 3RC9A 2O1XA 1WNFA 2NO5A 4CL8A 4DGQA 1VZ3A 2QAGB 4X1IA 4D82A 2WU1A 4P0TA 5C8YB 2JJQA 1GXSA 1YS7A 1EUDB 2ZSBA 3H05A 4KWEA 5C4GB 5JJ5A 1ZVJA 1D2CA 1X13A 1Q1ZA 1EQAA 2QYOA 1NTOA 4JKOA 1N8KA 1WDKA 4D4GA 3RSCA 3EZFA 3H9EO 5LU9A 3ZGOA 3RHFA 4ZZ3A 5GM1A 1T0JB 2EGGA 3PWZA 1Y5NA 3EGCA 4OX9B 3HY4A 3D6TB 2J5QA 3DLCA 4K05A 4WFKA 5BSHA 1L6RA 4YT2A 5F4ZA 1VI2A 1J1UA 4EW3A 1SU8A 4ONEA 2L7HA 3B3QA 4GSKA 2PCJA 4WOPA 5KAPA 4KE7A 4ESEA 1QYWA 2RFLA 1Q5PA 1JQDA 2JARA 4GXRA 3I2GA 1A4RA 2W2OA 3CQ9A 3LVFO 1I1HA 1AXEA 1C14A 4TLMB 3WLOA 1B6TA 4KREA 2NP7A 5L3SB 3DZBA 3OKCA 4LY3A 4E21A 3GL9A 4JYMA 4M9SA 2FPXA 1N2ZA 3KQKA 1DX4A 1ZN8A 4LSWA 4YASA 2F17A 1T6YA 4IBBA 3NHAA 1R5OA 4KQIA 3WP0A 3OZCA 4L08A 1MTZA 3OCXA 3R4CA 1KZGB 2Q3BA 4PBRA 4R4JA 3VYSB 1PHRA 4KN8A 1ULZA 4XX0B 4QQ8A 4LJ7A 2PGOA 3A3KA 4J90A 4MRNA 1Y9AA 4TZ6A 4UM8B 3C3YA 1DGQA 2AT1A 2XVXA 3JV7A 4OF4A 1DAPA 2KLBA 3RYCB 4K6KA 4LHSA 1HY3A 2C5FA 4BJ6A 3FGNA 3NWEA 2WT9A 1IXYA 2ZZMA 1EX9A 1GJTA 4RC9A 4YPVA 1UFOA 2VA9A 3R6WA 3VV2A 3DAFA 4NRDA 3WWDA 4B8WA 5K01A 3WRXC 1T4DA 1QVRA 1BMTA 1P0MA 4Q7LA 5DISB 1YR2A 4R7TA 1KOLA 4RLHA 4PR3A 1B8NA 4WXPA 2LCQA 1E96A 2O2SA 4OB6A 2XWQA 3D0KA 1E1QA 1GEGA 2PL9A 2P35A 3VR1A 2OFWA 4LYFA 3G2PA 4TTAA 3ULKA 3IOEA 4O1MA 1GSIA 5ISMA 2GAJA 1R0YA 4WN9B 3GPYA 3KOWA 2C9BA 3UMGA 1DRWA 1C1DA 1SB8A 4ZVLA 1NJ8A 1L1ZA 4WNAA 2NNLD 3UJCA 3LSTA 2WWVD 4KRGA 3VYWA 2D1TA 1GWNA 1O57A 3KB8A 3LT0A 1Y5LA 4G24A 3DEHA 4RFSB 3KQYA 4J0FA 4UTXA 4ZCRA 4AY5A 1C80A 1DCKA 1LDGA 2C3OA 3G6WA 3I52A 3D7LA 4JJGA 3X1WA 5BVGB 3AHHA 2BWEA 1FXSA 3B1KA 1N0IA 4BVBA 3RLIA 2IEZA 2ORVA 3ZWXA 2BF7A 1RPZA 4G8CA 4G3OA 1R4MB 3CF6R 1KAEA 1SBTA 1QHFA 3KVRA 1R6XA 3BB1A 4GX2A 4DR3M 5CX1B 1AQIA 1NJ1A 1QPZA 1CJVC 3GUCA 4AAYA 2VH5R 4HOYA 3ZWWA 1ZK1A 4L5CA 3Q8KA 1P4SA 1D4ZA 2HU2A 3L92A 5FUWA 5JNRA 4GFDA 4LPKA 4MRVA 2DP4E 2GA8A 3KOYE 1TPZA 2VG8A 1J22A 4UTOA 4GKBA 3QU9A 1KJNA 4KHZA 4YO8A 3J27B 2JY8A 2BMJA 5NULA 1N33M 4LDRA 1F6DA 3PG5A 5K0NA 3VQTA 3A6JA 2I76A 1ORVA 1AUQA 3H9GA 1R8YA 4G84A 4HZUB 1PYGA 1YVDA 4MWGA 3AILA 5BQPA 3FTNA 3SPXA 3IHPA 2E2WA 3EVCA 3GAZA 3UENA 5K0FA 5ADVA 1VFPA 1H8ED 3QIVA 1DPFA 4MCIA 1CFZA 3VGPA 3IVCA 2A0XA 2XNHA 4H7FA 1YKGA 4QHSA 1DO0A 3EXIB 4ZVMA 4ERNA 2JFNA 5TGZA 2VDLB 5EJ4A 1PQYA 2RARA 5HRAA 4MA4A 3FNRA 4XEHA 5D5PA 1QAMA 1R9MA 2FW6A 1UM9B 2KYRA 3GJTA 1VBFA 3GRFA 5JZ9A 3LQ2A 5G0WA 5I9LA 4F2GA 4BWVA 3OVMA 1FEZA 2BFDA 3DAPA 4ID3A 1T26A 2CLHB 1L4LA 4G4IA 2C2WA 5DGCA 3PIRA 1VBNA 5IAOA 1EVIA 3K30A 5KQGA 2CLCX 3A2MA 3L7MA 2ZI6A 3IRVA 2A1UA 1NXTA 1XC8A 1CUIA 1QNFA 3LO5A 4FMDF 1UBRS 3TQHA 4L74A 2H11A 1TO6A 5F12A 2X0NA 3D31A 5FCDA 1QRUA 3SXJA 4N0EA 3DAHA 1T3HA 2VRBA 1U02A 4EPXA 1XVIA 4LEIA 3AUAA 4BGDA 1E60A 4DCMA 1XMSA 1DBVO 2H18A 1TA0A 3O31A 3OHSX 4IDGA 5ITTA 2W58A 5DH9A 4KN6A 4WP2A 3FM9A 3FVWA 3HJCA 1QG2A 4IHQA 1UH5A 2C59A 4R0VA 1I32A 5H83A 3REQB 3UYKA 4CF4A 2WSCF 1Z4KA 2O3JA 2P9FA 3GELA 1YRYE 2XNJA 4DMKA 5IVKA 2GKOA 2BELA 2IXGA 3P9SA 4J0JA 4PS1A 1L1TA 2E7ZA 3UT5A 3IILA 3WIVA 5BOSB 2AN1A 3C58A 1K4MA 3EIQA 5CITA 1EFVB 2HQRA 1KJJA 1XT6A 4G0OA 5T64A 4PGMA 4LTNA 1JS1X 2H5JA 2MJLA 1JLLA 2Q50A 2UU9M 4KIJA 3HCEA 4HV4A 5JUWA 3PXDA 4Y2TA 2OHHA 1YJQA 2XIJA 5IJ0A 1KO4A 3B3AA 3HP1A 3MJHA 3DTNA 1E63A 3THWA 3HUTA 3DBLA 4Z53A 1QHYA 4MR8B 3KXIA 2H7YA 3MFYA 5AKHA 5B4VA 1A8IA 2X2EA 1OW3B 1WE2A 3ONNA 4ZVOA 1IZ8A 3IIIA 3R7SA 4DSZA 4WJLA 2GKGA 2YDXA 3HDYA 3A4IA 3IT2A 3SR3A 5D84A 2UZAA 4YRZA 5BSWA 2VTBA 3JATA 4LCBA 4Q82A 3NBXX 1XP5A 3OJWA 1JR3E 4N65A 1WMFA 2A8YA 1HL3A 2OUKA 1FP7A 2PUTA 3RTGA 4HZIA 1XIVA 4CG0A 3MUFA 4EYKA 1W4CA 4BKMA 1D0LA 5CYOA 5KC9A 1GR0A 3S81A 1G21B 1F4VA 2FEWB 3SFZA 2PUDA 2Q99A 1P1IA 1XZPA 3KVNA 4YR9A 2WIBA 1FZTA 4QTUB 2QE6A 5EHGA 2CDAA 4JOBA 4RKUF 1H1TA 3A36A 2I7NA 4Y1FA 3HVRA 3FH0A 3U6OA 3X0DA 3U4QB 2D1QA 1HEUA 1FDRA 4MQUA 3VKGA 5HTOA 2QTRA 4MDFA 2HJVA 1KJQA 2RCNA 2XCOA 4EG1A 4DUGA 1PS0A 2RC6A 4PIPA 5KOHA 2UXCM 1W49A 4QM7A 1AKQA 3ZEAA 1MG0A 2IUTA 2PLFA 2PKQO 3G79A 2GETA 3Q5EA 5EKSA 1Z17A 3FF1A 3ROZA 1RQ7A 1UT6A 1GR1A 3O4JA 4MGIE 2H3EA 3WHKA 1KSJA 1V8BA 2ZVPX 5ITSA 2OE2A 4FOSA 4OOEA 4N39A 3BN3A 4LY9A 1MDBA 3EBLA 3PGA1 2J7OA 2IY7A 1TGUA 2H2GA 4U0JA 4KQGA 1TYCA 1QZ3A 3D8HA 3T7RA 4CQMA 2DENA 2PX4A 5D3KA 3R7FA 3DCYA 1Z35A 3HUFA 5TNXA 4DIDA 1EFLA 3H9UA 2HLPA 2ZYDA 3DO8A 2ZJZA 1IN4A 3SYLA 4NECA 2GOYA 4G5YA 1J8DA 1NP7A 1A1SA 3D02A 1YBVA 3DEFA 4QYXA 1H2ZA 3O38A 2BJHA 1VJGA 3LCUA 8CATA 2Y92A 3OHPA 3GLGB 2QZSA 1T2VA 3QYPA 4JBGA 1EUZA 1IU9A 4R51A 1YXMA 1DG9A 3IV6A 3DB1A 3ITNA 3H7AA 4GPTA 4Y9SA 3SMQA 1W36C 1FXWA 1X7WA 2COUA 4LYAA 2O2YA 5M3BA 1T9GS 5C8DA 4CEHB 4L72A 4MS4B 2NPFA 1B0UA 2ODQA 3DHNA 3R2JA 2HA7A 1QU3A 2ZUDA 2CL5A 1OOEA 4RZQA 3V7YA 3OIDA 2CCGA 3L0IB 3NGXA 3NBUA 4QHYA 5ALFA 3GCDA 4C5AA 3RF7A 4AJHA 3GQ5A 3CMCO 4OFXA 5FR2A 1E1RA 3L84A 3NWOA 3ZGYA 4HNVA 3UK1A 3WJ2A 4N0DA 2KLHA 3ZY6A 4DPLA 2YNMA 3TPZA 3UXHA 5L53A 3A1DA 4B6QA 5DBEX 1NWCA 4NHEA 3MS4A 4OHWA 4BWFB 3H2SA 1BQ3A 5EZ5A 4J16A 4JJZA 1B8UA 3TNDA 1Q02A 4NMHA 4MW5A 2HY7A 3ZDCA 3NPMA 5TGDA 4OXNA 5IU6A 1U9ZA 2O1SA 1RWXA 2CZQA 3SX2A 3KKMA 3QVGB 4RQUA 3EUWA 6Q21A 4MRSA 3F96A 3PSAA 2JLWA 4LRTA 3G5TA 3JQGB 2DT5A 3STYA 4KQXA 2VSOA 4Q4AB 3S0JA 1HK7A 2YJGA 2F8LA 5F7XA 4EITA 3HMQA 5EQDA 3V7NA 2Z9DA 4JUAA 1J70A 2VR1A 4MQEA 4ZTZB 1WETA 2REQA 4DR6B 1X7XB 5IRCD 3Q41A 3QUCA 4RX1A 3UCEA 5MFZA 4CPDA 1IB6A 2N1MA 2VF4X 1VCNA 5CGQB 5BSKA 2WKPA 3JD2A 4ZAFA 1JHAA 4GX5A 4PZDA 2IHTA 2V7UA 4WZBB 1C0KA 4YA6A 2I2XB 1QAQA 4I50A 1T2CA 4JD5A 3PUZA 3ASYA 3SEQA 2X42A 1NQVA 2GAFA 3LY8A 5HMLA 2B3DA 3EGDA 3G49A 4MARA 2X2FA 3LSYA 3DL0A 5AO9A 2WU8A 3HLYA 3DBHA 3QOFA 4IQ8A 3L40A 5F2OA 4DR3B 3WK6A 4NXNM 4ZT4A 1KYZA 2XB6A 4EW6A 1ST3A 4QBIA 1I2CA 1X7DA 3VDNB 5CUQA 3VTZA 4EY4A 1JSRA 2CJXA 2XE4A 1L5FA 4B3RB 3QJGA 5EPOA 2BGRA 3I09A 3R3YA 4HX2A 1D7OA 4C30A 3KQQA 2BOVA 3K0BA 4RE6A 4DA6A 1UINA 4B6EA 4RTPA 4ITRC 3UMFA 2PVSA 3THRA 4XB6B 3DV2A 4OU7A 2R65A 2Q2OA 5EESA 1REQA 5BORA 2D2FA 3C1TA 1YRQA 4JJ8A 5GTDA 3AEYA 4OU4A 1V8DA 4KX3A 1SXJE 3QHAA 5FPQA 4DG9A 2C94A 2RGXA 4CQLA 4PHTA 3VUFA 3DHVA 2W42A 3MRXA 5EQTA 1DZ3A 1TMGE 2ZAGA 4PM4A 1JDVA 1TLLA 2PGIA 2YZMA 3STTA 2Z98A 1WHTA 2OHGA 1R0KA 2ASVA 2APJA 4LWOA 4CODB 3IEMA 3WSTA 3K3PA 3MQFA 3QVTA 3P9ZA 2GB4A 4JLJA 4ZAVA 4CVNA 3PTAA 3H7IA 2O4CA 1EUDA 2I9PA 4XR4A 2ACEA 3QWFA 1DEXA 1ULBA 5JARA 4JI7M 1CDEA 1SKBA 2O23A 1E2MA 3OLZA 4HS4A 2MH8A 3V4LA 5IJZA 1UC5B 1GIAA 1PGYA 1O87A 3JASB 3L07A 1KYIA 2OORA 2CEAA 4W1SA 3TB4A 1MQSA 4BJHB 1ENPA 1IZ9A 4GLBA 5EGNA 5KYWB 5DMXA 5DX8A 1OWOA 4BYMA 5LDHA 3ORRA 4RL6A 2PUFA 3CFYA 1T1GA 4MVWA 4J03A 5FV7A 4B4OA 4BXOA 1YASA 2RAFA 4YFYA 3WWOA 1TH2A 3CRNA 1XDGA 4NSRA 3FFWA 5CPBA 1CUXA 2RDMA 1CJUC 2PNJA 5KYWA 3DM5A 1FTSA 1YA4A 4MS1B 3ZGLA 1NMQA 2QYTA 3DE1X 4F6LA 3BHMA 3QV1A 4WK6A 1QHNA 4ZTUB 1FQOA 3RIEA 4BTLA 1I01A 1NVVR 1TIKA 2VTKA 1ONBA 3K6KA 1L7NA 2AB0A 1DMRA 5P21A 3ZWAA 1QDTA 2FR8C 3AHJA 3H84A 3UAVA 1IDOA 3WA6A 4D0SA 1WUIS 2FG7C 4AQYB 4HAIA 5AM5A 2O8VA 1L6IA 1Q3BA 4XLZA 2O3RA 1RC0A 1ZAYA 5T6MA 3F7TA 1KMIY 3B60A 3K7EA 4ZA2A 3V8NA 2QL9A 1MH1A 4AVYA 3Q3CA 3F3YA 2I03A 2NU7B 4NPHA 1FDTA 1VPWA 1A8SA 2ZYSA 4MQ5A 4B34A 4EB0A 1KRWA 3ZHXA 3AR8A 4ZHQB 1JVSA 3MCUA 4B3MM 1J49A 1Q21A 1OQAA 3PCXA 1AMOA 2RGGA 3LUCA 1JAZA 1HE4A 1VKRA 3H5LA 3GYBA 4XYGA 2W71A 2R79A 1Z7YA 3MPOA 3E7FA 1OWPA 2PFSA 2NU7A 3OM0A 4MVJF 3SSNA 1GTG1 4AKTA 4UEOA 1QQ7A 1V3QE 4ETWA 4RTNA 2YC4C 1DQNA 1KY2A 1UK8A 2OYRA 621PA 1ETHA 3FKJA 4F93B 5K2OA 2VPYA 4JQSA 4M0MA 3M9LA 1M7HA 1Q91A 4UPDA 1D1TA 1SCQA 3N0RA 1V1MB 3F3SA 1Q95A 1P60A 3LW8A 1UKAA 4PHGA 3ZOKA 3KCNA 3OSZA 1TUGA 2ZS9A 2GZ3A 4JI0M 3HLTA 2R00C 4B32A 2PJZA 3S2UA 3ZX5A 4AW4A 3L2OB 5DN9A 4AJ9A 1WZUA 1FBNA 1QHIA 3O8OB 2NSJA 6CHYA 3QFSA 4HYTA 5HQ3A 3DMHA 3O0TA 1M5RA 3JAWA 1PJ2A 4H6WA 1G71A 4ZOBA 4MWEA 4TMVA 4EHHA 4Q9HA 4KWIA 5KQLA 1HYBA 3CTWB 4MYRA 1ECFA 3ZHOA 1H3NA 1DEKA 2YHSA 3TDKA 5LOVF 5DYGA 3LHIA 3TJMA 3EC1A 4XGKA 1NLUA 4V3BA 1JEEA 5JAMA 4I50F 4KOEC 1F8GA 1W581 3AF3A 4OP3A 4EG5A 4D3FA 3RRYA 4KMSA 5JSUA 1SVNA 1YHYA 1BW9B 2I66A 3PGXA 5DX1A 2I6FA 4B7ZA 3TLGB 3RF6A 2UYCA 3HBLA 1HLGA 4MSUA 3NGLA 1J0EA 5BSTA 4O2AA 4DAEA 3GC6A 3LQRA 3QF4B 2QX9A 2OD7A 2XUGA 5IAKA 4D9EA 2V0NA 4U3JB 2J3QA 3ENVA 3V6LA 1U8XX 3JQ7B 4LZZA 2IU4A 4WY5A 1BHSA 2AKYA 1LSOA 3P2YA 3KEQA 3TQCA 5KYYA 1F06A 4LXQA 1EVZA 3I6ZA 1CY0A 1OZGA 1ZGAA 3LT1A 4HDOB 3EZYA 4YUVA 2A9VA 1OBFO 2OGTA 2YOGA 4TROA 5T57A 2B6HA 3DAOA 3IJRA 3QA3E 4ARZB 2AJ8A 5IDYA 3HXTA 3MWYW 5JY1A 2I3ZA 4XYLA 2V65A 1FNMA 3AB8A 3QFTA 2B9EA 3N0XA 3BH7A 4RKEA 1JG1A 1MO2A 3WK7A 2LIPA 3B12A 4AKGA 4WGFA 1RACA 3KP0E 4GMXA 2NO6A 1TUEA 1T8TA 3QJ5A 3P32A 2AJBA 4Q4DA 2AOUB 4LBVA 4WLEA 3TZLA 4MEBA 2HUPA 3JRNA 4UNIA 5DTJA 4ARZA 3QKSB 5F51A 3QYAA 1ZY2A 1R5JA 1AO3A 3E7WA 1V92A 4MIKA 5DMHA 5IVIA 1CLEA 1LDMA 2BDUA 4JSTA 2BHRA 1UXJA 2GBFA 3BMCA 4FDLA 4R41A 1AKUA 3T7AA 1NR7A 1Z5BA 1P4HA 4J7AA 3ROKA 1YB2A 2AYXA 3IBYA 2FPGB 3KZOA 1S4MA 4ZQFA 1S01A 4JNCA 1DQYA 1LLDA 3F4KA 3E27A 1K89A 4C4TA 5FLXA 1B2LA 5HCNA 2GFHA 3AR3A 1XXLA 2PANA 3PQ6A 1SOVA 4R1QA 3PEUA 1SJ9A 2HMTA 5F52A 3HJSA 4N7MA 4WJZA 2HLNA 2ZRPA 1RZUA 1BNCA 4AJPA 1RKBA 3B6EA 4JJAA 4DZZA 3CX3A 1RRKA 2CNDA 4PW0A 4BNUA 4JUCA 3WB0A 4EY7A 5FDFA 5KMGA 3K15A 2ONYA 3FNFA 3GJSA 1GAXA 1G3UA 5KDDA 5EJ7A 2FF7A 4FJ0A 3SBJA 2A4KA 3A70A 1G59A 5JC8A 4B83A 1JG7A 3DEIA 4X63A 4Y2VA 5JADA 5J2TA 3CX4A 3MGAA 1G2IA 3U1TA 3EN0A 5HJEA 1H5NA 2IYEA 2IEYA 4Q3AA 4WXEA 2C5EA 1IMJA 5F4BA 4QGBA 3WKAA 2B4KA 1SBHA 4G1FA 4RZUA 4O2BB 4D4MA 5C1DA 3WHLA 1J9ZA 1S2OA 1YR7A 2GASA 2W8ZA 2WWTA 4QSMA 5FO0A 1YUMA 3ZW7A 1Q39A 2BEVB 1WXHA 3NIBA 4H4DA 5L4SA 5M29A 2FQWA 2B37A 2GSDA 2G9QA 4WAUA 1U3UA 1XHEA 2CHEA 1IC6A 1RRVA 4HNRA 2JGIA 3CR8A 4NMXB 4R2KA 2ETXA 3DHEA 4YAWA 3HGMA 1YL6A 1JKMA 2KZUA 1N9GA 2EDCA 1KS2A 5BURA 1ODJA 4ND1A 2VAWA 1KYTA 2JWSA 4I8OA 2WUGA 3CKLA 2G5TA 4O2RA 1HTBA 4TLBA 2QTFA 1FRVA 4ZVSA 1OI7A 3AI2A 4AZ3B 3BZUA 3DOOA 2C3UA 4EY6A 1SWWA 2EX0A 2WNSA 3CR3C 3EZ6A 1JEQA 4C4OA 2Z30A 3DZFA 3G1UA 3LKZA 4QBFA 4RVOA 2A94A 4M1TA 4ZDIA 3BICA 2ZAIA 4M8IA 4CW7A 1J2YA 2OY0A 4BJ5A 3MN1A 4UZEA 1YCFA 1ZUNB 4LJ5A 3HCWA 4FLMA 4MRRA 3CNEA 4LSMA 3L7AA 4YAIA 2QP3A 4B3SB 4AN1A 1YSYA 2ZGVA 4KRYA 1A5SB 5LP6C 1ZKMA 3EBOA 4N3NA 1CQIB 3VR6H 4C4YA 5BNIA 3IPYA 3MD9A 1Z5OA 4IHAA 4IPTA 4ADSG 3KM0A 4M46A 3KNZA 5ALUA 3OJOA 1MF7A 1UC9A 1ZVMA 2HKJA 5ALNA 2GWRA 5LC1A 3I9OA 2G1PA 2RAUA 3C14C 2IYRA 1GQFA 3DHYA 1IHPA 1SD2A 4QAJA 4V2IA 4AY3A 1MQ9A 1IEVA 2BMAA 1OIXA 2BV3A 2CKMA 3NKFA 1SZPA 6REQB 2VK8A 3SHVA 3FFAA 3W0LB 1XTKA 3QWBA 1TNDA 4HDKB 1HLDA 3A25A 4EB8A 3AJDA 2VAVA 1KI2A 3EXHA 4DLKA 4W5OA 1V6AA 1K8QA 1NF3A 3SBEA 4ZICA 4XQ9A 3C74A 5BUSA 4R8LA 4BAZA 3P4XA 1FUIA 3NHPA 1JU3A 4KIGA 3MK6A 4HY3A 1LW6E 4MWCA 5DSXA 4ARIA 3VMMA 1I9CA 5EMJA 5DV9A 2RE8A 3KR2A 4G8DA 3OOHA 1RRMA 2QOEA 3P27A 2R45A 5LKAA 3IJEB 3MAGA 3DXYA 2HCRA 5HZHA 1SUBA 3BX1A 2ZUSA 5DLYA 5I3ZA 1G8YA 4AF7A 2JGKA 4OH1A 1B0AA 3DM9B 1H23A 2XYRA 2YUIA 2EO2A 3H16A 3BVPA 4H9GA 1JLSA 3FNGA 4EEKA 2Y0EA 1XVVA 5FUYA 3QX7A 3KTOA 1JG6A 1NLZA 3ZS8A 4QA9A 5A1TA 5BP7A 1P91A 3CXRA 5A3RA 2OHXA 1AIPC 1RBYA 3HC7A 4EYEA 3CUVA 1UFZA 4GRAA 1N4AA 1Y4AE 2V0CA 1HFJA 3WYCA 1XZHA 4AJOA 1UOQA 2CNNA 4LE1A 3GCZA 1XEWY 4EK9A 1RWKA 1N5MA 2IBMA 4OGGA 4JVOA 3UV7A 2FLVA 4C4PA 1VA4A 2UKDA 3FPEA 5IDWA 3HU1A 1ESNA 1JECA 2OBXA 2N46A 1PZNA 3MGBA 3BMNA 3NYQA 1TRKA 1PQPA 2IODA 3ZDAA 1KXJA 2E1PA 2HHLA 1NBAA 1MV8A 1K66A 2XX3A 2YY6A 1I3CA 2ZPUA 4JP1A 4G5XA 4QPZA 5CM9C 5I9TA 4HN2A 5AI9A 3C4VA 4GIBA 4GT1A 2XD9A 4WH0A 3L5KA 3IHWA 3OKFA 4WESA 3QVGA 2HF8A 3BHIA 2BFFB 4M99A 3WNCA 3I6IA 4GXNA 3ZDEA 1MX9A 2VNSA 1G3MA 1KORA 4G2NA 4G4GA 4LRTB 1PJQA 1Z37A 3L8YA 3LIPA 3RWBA 4XSVA 3DV9A 1NYQA 3ZBTA 2Q7XA 3KELA 4D4IA 1RYHA 1DDOA 2IXFA 1HJPA 5FPPA 4LF8M 1CY8A 3OETA 3RFVA 1OBVA 4R9VA 2ZRGA 1Q0TA 1GT91 4J4BA 2E4AA 5TPWA 3W67A 3J80S 1Y34E 2BKXA 2I67A 2AG8A 3RSGA 3OSUA 3TJRA 5C1PA 1Y1RA 4BECA 5FEUA 2DERA 4U2EA 2VS1A 4MGKR 3O93A 5CIYA 2O59A 4F11A 3O21A 2FV8A 4JT8A 2BT4A 4JFAA 4Y3UA 2H0QA 2FU5C 4LRUA 5E4TA 1FP1D 2AKAB 2PBLA 4HL4A 1COWD 2NYUA 4W4TA 3HB7A 4IZHA 3NRBA 5KQSA 3KFVA 1LJ8A 4TKUA 2WIDA 3ZQJA 3A4NA 3K35A 4EDHA 4FWTA 5EXTA 1CJBA 3IAEA 1SOMA 3MTQA 5EZ6B 3QSYA 1QP0A 5TSDA 3SCZA 4ASUA 2DFKB 1COWA 2ZRQA 3HPQA 4CV3A 1ZO8A 5BN1A 1ZOOA 3ND5A 3DCNA 4BNZA 5EMNA 2HCBA 1HE5A 1IZ0A 1GZDA 1CJSA 2AJTA 2GLXA 4FXOA 2WUEA 3ZZTA 3VR2D 3HYRA 4TUYA 2AE2A 5A2QA 4DV4B 1P6UA 3HLKA 3BKWA 1DUIA 1UPTA 2DJ5A 1M34A 1SXGA 2YKGA 5DCYA 2NU8A 1YDWA 2NMVA 3TM4A 1T9BA 1GN8A 4N6NA 2WA1A 4YMUA 3OT1B 5JXJA 3E4DA 4P36A 4JQYA 3J7BA 3WK4A 1DGHB 1XV5A 1PQ4A 2VT2A 2MINA 4NF2A 4DILA 4GHLA 4PO3X 2C2ZA 3O26A 1E99A 2RI0A 2ATVA 1FCJA 2C84A 5AIBA 2XLJA 1A8HA 1CE8A 2AHRA 1XMQB 2CYBA 4B79A 1BXGB 1NDQA 2HXYA 3SARA 4IVRA 3OT1A 1E4YA 2J46A 3MERA 5AHRA 1V3TA 2Z6AA 4PC1A 1U99A 5DVZA 3GLKA 4Z99A 4F5DA 2ACWA 5GJBA 1WIVA 1EB9A 3ANSA 4U6SA 3HZRA 4FDUA 4TUWA 2JGLA 4GU5A 5AK0A 3E1SA 4XIYA 1QTIA 1D2EA 2O50A 1SWVA 2APLA 2J30A 4GR4A 4TXNA 5H8WA 4ON9A 4Z7OB 1AH2A 5JD5A 1EWYA 4HNQA 3WRYC 5A4AA 1RXYA 2PFKA 2FZLA 1VGRA 3NXKA 1EVYA 3L29A 1XU4A 4ISBA 4RDIA 1T24A 1CUKA 1ULSA 4G5SA 3S55A 4QUEA 4M9ZA 1N1MA 2PGLA 2QQGA 3QKIA 5AW5A 4YHHM 3DJYA 1Q1EA 1ZISA 4R2XA 5JMPA 5KVAA 2AXPA 3MTEA 3U49A 3UUGA 1LPPA 4WZBE 4OAOA 4K6HA 3EYWA 3NONA 3OQNA 4FFBA 4BNIA 1K6JA 4EOGA 1Z0FA 2VDBB 1P74A 4E33A 1RXEA 2EYQA 5KU1A 5KNDA 5AW1A 5IZ4A 2JD2A 4G23A 3ASZA 1W1WA 2LNDA 3U26A 2RB5A 4NRVA 3AC0A 2WEKA 3IDSA 3L1KA 1N7IA 2O25A 2CUTA 4ZANA 4TM8A 2JB9A 2DQ4A 4XGQA 1DC3A 1J8MF 4C14A 2VL7A 1ZUWA 1W75A 2FZEA 3AV0B 1N5RA 1VXRA 3CONA 1CUYA 2ODNA 3VOBA 5JWRA 5LA6A 1N8NA 1P8JA 1TVCA 4GECA 4L5AA 3C3EA 3PDWA 3QG5A 3ZIAA 4Q3BA 2VDKB 3MQ4A 2WI8A 1FSGA 4PAOA 1E94E 2JFQA 4I1SA 4RMNA 1I6WA 2VF2A 3IDOA 3TLZA 4CMKA 4ZI7A 1OTRA 2X49A 1M76A 2MMCA 1JXOA 1E3JA 4AS3A 2H2HA 1OIVA 4GZ5A 1RLJA 3OZIA 4TRNA 3A3YA 1M2OB 1W34A 2QT9A 1NT4A 2J9YB 3DBOB 1Z82A 4LC0A 4IO1A 4DDMA 3LTNC 4X97A 1M73E 3UOGA 3ZQ4A 1YBAA 4LISA 4Q9JA 5KQPA 4KV7A 1H94A 2QVZX 3GIWA 4JBXA 4P9NA 3X1JA 1LTHR 1UEXC 1W1UA 1OV6A 2A7QA 4UHDA 3H11A 5AUOB 3STXA 3O1HB 2HV8A 1WZNA 1RABA 2B7BA 3Q3IA 1DFHA 2R84A 3AI7A 4RMHA 2VJOA 3PFKA 3WKEA 4F6RA 4R1UA 1RHKA 4FGZA 2DAEA 1XWFA 1Y7PA 1YZKA 3GFPA 1LLUA 4FJ2A 3TFWA 4N82A 4DCOA 4JU8A 1N6OA 5J2UB 1AK1A 5LUAA 1T6XA 4FKBA 2RK3A 3NP7A 1MX5A 5C5CA 1GAJA 4L7QA 5EAIA 3ZDYB 4PN3A 3AL2A 2V98A 3OQJA 3M4XA 4P22A 5B1HA 3GG9A 1IPFA 2W6IA 3EZ2A 1QE3A 2QSFX 1AUXA 3QKWA 3R23A 4NE2A 1HKUA 2X2PA 4NSNA 4GMDA 5CLGA 1S8OA 1Z3IX 3ZV7A 1HNZB 3DWGA 4YPOA 3CN7A 4PZ9A 3OEEA 4W7SA 1IY2A 1NHGA 3EXIA 4RABA 1BFKA 2WDPA 4I4LA 1LX7A 2O8BA 5BR1A 3HCPA 2B1GA 3ELYA 2ZSUA 2XUAA 3G5MA 2RONA 1J7KA 1VG1A 4OBBA 4R69A 4U9HS 2D2IA 2IGTA 3BGVA 3ZVLA 5EY5B 1P2TA 3H3FA 4XUGB 1Y1SA 3HTXA 5CLHA 4E5NA 2O2ZA 4DV6B 3BIXA 1P2SA 4EFNA 2Z2ZA 3RAEC 4JL8A 4I36A 1JUDA 2IY9A 3G6KA 1H5QA 3ORHA 1IY8A 2W83A 4UXJA 3CVYA 2AFIB 4UREA 4YWHA 2IU6A 1MG5A 2A0FA 2ZJ0A 3HKBB 3AVOA 3LLUA 1THZA 3W8RA 4FFBB 4HAXA 1D0MA 1R3DA 1YONA 2FF5A 4K6MA 5GGYA 1XRQA 3K9OA 3QVMA 4YP7A 4OD0A 3KALA 3L9WA 2NSLA 4JJ7A 2BGIA 3EPKA 2RGAA 1SCAA 4QOIA 4HMQA 2BI4A 4V24A 1R1DA 3CEMA 2G9VA 4Q3EA 4CM9D 3K70D 2EIHA 4GL4A 3CEPB 4OHXA 1M6YA 1SKYE 2OLJA 3I5YA 5JVDA 4LQ4A 4JENA 4M0UA 2FOXA 2P2LA 2VP3A 1NW5A 4DV1B 4AO6A 1S3SA 4AROA 2Q3CA 3FGZA 4YDRA 1TJ4A 1WMEA 1C3OB 1N3BA 3FCXA 3KKEA 1NMXA 4X6UA 2JRCA 3OX1A 1H2AS 4G56A 4H1UA 5SZIA 5T41A 1OYYA 2Q4BA 4X71A 3HJRA 3U44B 3OQIA 2VCEA 2GA9A 3U3OA 4CM4B 3I5UA 1X38A 3PJRA 3HR8A 4DR2B 2RBEA 2X76A 3KVYA 1T8UA 5J4LA 4LJ9A 2E4ZA 1OX4B 2CV1A 4GYYA 3ZE1B 2CMDA 1M2HA 1L5ZA 1ZM2A 3P0IA 4QXQA 5DT9A 5AI6A 3QHQA 2FN9A 3DEYX 5AVTA 3GJ6A 2EKDA 4O5OA 4YH1A 1C9YA 3QFRA 3NH6A 2UYHA 3D3JA 4I1UA 1O6FA 1L3CA 1UFRA 3D1LA 3LUFA 4B33A 5KTNA 2I3AA 4DJJA 1X1DA 1C7ZA 1MABA 4HNAB 2GD1O 3MMSA 4D0LB 2Q8PA 4E11A 3SKVA 3V8QA 3U6SA 2GJAA 1X19A 1N2HA 1CJTC 2NO1A 4QOSA 2CXTA 1IM8A 5LLDA 4C5CA 3M2TA 5HE9A 5EKDA 1ULAA 4C4XA 2V9ZA 3U48A 5A4IS 2PS9A 3GDOA 4O3MA 1SULA 4CETA 3SZOA 4B9AA 2TYSB 4YUZA 4DMRA 3NW9A 2RGOA 5B6JA 4GE0A 5C9ZA 1EWKA 1VKHA 2GM5A 2PCLA 1B7GO 3CKMA 5SY6A 4DG5A 4KMMA 4J1TC 2JLAA 2QZZA 4DLRA 4XRGA 1IOWA 1QR2A 1Y1LA 1CS0A 2X1LA 4FR0A 3RVBA 1DKLA 4PCVA 1X94A 3WXBA 2Y3IA 2C7OA 2OD9A 5IEJA 1I1OA 2XMGA 2VQFM 1H85A 3UMMA 4IG4A 4CLXA 3LUGA 3TLKA 1HDXA 4YEDA 2V4UA 4AKHA 1AK2A 4MWZA 5GVSA 2GILA 3L6CA 1ADGA 5E2BA 3DE3X 2DBVO 4L51A 2PMCA 5E6JA 1P2FA 5BO5A 1TQ4A 1BWSA 4DIMA 5BVHA 3RNLA 4AWBA 4LOIA 4OQEA 3FMFA 5H4HA 4YV1A 3BHJA 3ADDA 2V5VA 1QH8B 2CZCA 2OOAA 3DFMA 3IP8A 3TW4A 2B69A 3JWJA 2Y1FA 2C5SA 3OG9A 2VZLA 1G60A 1EFUB 3KDAA 1QU2A 1V7PC 4TKMA 2AN4A 3GJXC 3FCAA 2I2BA 1AX9A 2H92A 2Q9CA 4BVEA 2YQ4A 4E07A 1VIVA 4LN1A 3FZGA 2Q3DA 3BILA 3ZWYA 2IXTA 1BJRE 4LBWA 4XUCA 4LRYA 1W96A 3TLAA 3AX6A 3TRFA 1QFMA 1XL0A 4DIEA 3EXHB 4EUHA 3Q1LA 1A9OA 5AVQA 1T8WA 5IUNC 1OLUA 3WMFA 5CW1A 5K8LA 2GNPA 4UEWA 1Q84A 4PEVA 5TQ0A 2ZCJA 2QGNA 3JSXA 3U7QB 4OVZB 1C9JA 2WWGA 3L7OA 4BQQA 2DPMA 3IP6A 3B85A 2GCIA 1Z4NA 2F1RA 3CE9A 1QK5A 5HIKA 5JCJD 1JJBA 3LVQE 3RO7A 1Y42X 4ZT3A 2GAOA 2JGEA 2QAJA 3V34A 3M34A 4E4YA 3A6FA 1PJSA 3SHFA 1BCRB 1CPYA 1DLIA 4PNZA 5INTA 2IS2A 1ADJA 3JQ8A 1NVUQ 2I4NA 3VNVA 4MUIA 2F1HA 1II8A 2IOYA 3ZS9A 1URPA 2VJAA 1JI3A 5A05A 4X9XA 3DPIA 1K2VN 2O8EB 3ITEA 3VMFA 1IG0A 2BDTA 2KHHA 4YP6A 3ZW9A 4B7GA 3E5RA 3B36A 2Q7OE 2VP0A 4Q7KA 4JC0A 4WMLA 5JS7A 2PS0A 3BWMA 3VV3A 4D57A 4KR7A 3A6PC 3L77A 3CLHA 3P2IA 4WEQA 2G77B 5HZMA 2Q0XA 3I53A 2WVJA 1B41A 4FDVA 4RZ2A 1QDUA 5EINA 4RVSA 2AUTA 1QGED 2BR5A 1U0JA 3D8NA 1FW6A 3QMMA 2OXTA 4NZNA 1V4BA 4P4TA 16PKA 4TOIA 1KWGA 3GRVA 1M74A 1PKXA 2P0EA 4R1TA 4ENWA 1L2CA 4N5DA 1TTHA 4WSOA 5K3EA 3A3NA 3EDOA 3UJPA 4GS5A 2UXDB 1WSDA 3BK1A 5AXCA 3OZVA 2O3TA 2ZUTA 5EZQA 1LSUA 5EVCA 2VVTA 1N1DA 2NZWA 4JT2A 2XKJE 5LXTA 1BKDR 2BFCA 3VKVA 2LXNA 3ZX4A 2G07A 2R48A 4O59O 4TWJA 5EE9A 1VRCA 3U37A 1N75A 4R2IA 3V7FA 3W6OA 5L3QA 1Z5VA 4OGLA 4B35A 3O1JC 2J3JA 4GOKA 1GA6A 3G3EA 3A9UA 4IG9A 2FW7A 2HBZA 4Y18A 2XAUA 5IT4A 2AN5A 5TPZD 3GNTA 3HK2A 3CJRA 2NU9B 1AZSC 2DX7A 2I29A 2RHDA 2BEJA 5E2IA 2GFQA 4DV3M 2ZSIA 2P6RA 2DSTA 2GXQA 2FK8A 4OJTA 1G4AE 3SEFA 1WVGA 4DREA 4GKKM 5D3MA 3PNKA 1KDZA 5LWHA 3D6VA 4X7MA 1X77A 4TMXA 1QFSA 3NUGA 4XTCS 4DNPA 4OW0A 2VN8A 2HA5A 4H0CA 4CJ6A 4HH0A 3VPHA 4PQFA 2XBUA 4WZAE 4ER0A 5A3VA 3AU9A 1NXQA 4DIKA 4ZU3A 1RE0A 3PX3A 1VBKA 2ZU6A 5BYAA 2EKBA 2II6A 1ABEA 4KPGA 1Y89A 2O5VA 4BNMA 1P29A 3T12A 2OK8A 3Q3GE 1DZIA 4B3FX 4XASA 1LQ2A 2F8TA 3DGEC 4KDEA 5GY7A 2AUNA 1ZNZA 1RRFA 2GZRA 3CLTC 2CC2A 4MV8A 4UBJA 5CH3A 4M0LA 3ZW8A 3PX7A 2VRWA 3MBOA 3P9KA 3EG5A 1ISHA 3I0NA 1VEJA 3U13A 1W2WB 3VDMA 2R60A 4J07A 1SA0A 1X87A 1N2CB 2C4WA 1HMYA 3GVCA 1EFRD 1E2QA 4UJ5A 2VRNA 1MJNA 1R0WA 3D2LA 3IAXA 5EXEA 2EHDA 1RMYA 3GPDG 1M8GA 2C7GA 4MNTA 3ZEIA 2Z04A 4Q0MA 5F1OA 3OZEA 1Q2UA 3DPUA 4RY9A 4AJ2A 2ZWPA 5DW3A 4KBGA 2YRXA 4KGZA 3BRQA 1JFSA 1GG9A 1IOVA 3BHNA 3VPXA 2ZJ2A 5IZ7D 2A35A 1PZGA 3PGVA 2IZ1A 1B15A 3Q6MA 1SKQA 4PZEA 2ZUBA 1U2PA 4V0KA 1XQXA 3O9MA 5E6SB 1G8JA 3TXXA 5CDFE 2GFIA 1PW5A 4HWOA 4GNRA 3WYDA 1GDDA 1C41A 1ZNYA 2O2HA 4JOSA 2QHXA 2Y9MB 1Z83A 4I5SA 5KOJA 4WNCA 3E9ZA 4RIGA 4KK3A 4R81A 1N5LA 1WCWA 3LUJA 4OLFA 1I51A 4KP7A 3IAHA 4MQMA 3A9CA 4MI3A 4F06A 2QX7A 2WFLB 2XZPA 3IHLA 1SGWA 1TLTA 3MAAC 3GFFA 3GQ3A 2AK3A 3ER6A 2VDQB 4YIKA 3T1TA 2QCUA 2O0HA 2XA2A 2B6NA 4JLVA 4DAOA 4EI7A 4PNEA 3L4KA 3F92A 3GJ8A 3PF8A 3JQQA 4M1KA 4YCDA 3DP9A 3OE5A 2G3QA 4KIUA 4IIYA 1V33A 4MWSA 4MPTA 3IHKA 4PTYA 2P40A 4OP1A 3SVTA 1QV6A 4I7EA 2V7XA 3B1VA 1QB8A 3ZGNA 3B3GA 5BQXA 2C97A 4NYIR 1QP7A 1AJEA 1AXRA 4MI1A 1UC8A 2W98A 1JT9A 4FWDA 3VPCA 4NDNE 2VPTA 4KLCA 2VQ6A 2OKGA 4Z0HO 4CMIB 3VZDA 1G8SA 4OL9A 1QKIA 3OZRA 4CF6A 5JBNA 1XO1A 1VDDA 1G38A 3F90A 4IXTA 3ANXA 1GPDG 4ZMRA 3MM4A 1C4KA 4FHZA 2IP2A 1E6EA 3O8BA 2YH2A 5DWQA 1O94A 4NNPA 4K86A 3HM2A 4IBOA 4L07A 4I1OA 2BKAA 3AFMA 4ND2A 3S99A 5IS2A 3VSCA 5LQMA 1Z63A 3BTUA 1QH0A 3TMAA 3AV0A 3LRXA 1Y4ZA 5TMBA 3Q8MA 4OI0A 1JV2B 3W2IA 3GWZA 9LDTA 5A4FS 1L7OA 1X7HA 3E9YA 2CP8A 1KAHA 2BMEA 1DSSG 5I7VA 1ZNXA 4JC8A 2AA3A 1DUSA 2Z3VA 2ZPAA 5G2OA 1WB9A 3PQ8A 3I3OA 5DNUA 2EV9A 3VDQA 2M5ZA 4KNVA 3ZQUA 3QX9A 4BFYA 2C54A 1DVRA 4WHMA 2ZWAA 1QTNA 2OHJA 5AJTA 5CA1B 3AIKA 5EXDA 1KKUA 1M6NA 1Q16A 4AQYM 2HSZA 3THXA 5KPZA 1E3EA 5T3YA 1GPWB 2DG2A 1KQOA 4XOUA 3VDXA 1DV1A 5IEBA 3RANA 3H11B 1JMKC 3KQLA 2IS6A 5EMHA 1D8TA 4TZTA 2O8FB 2OXFA 2WABA 2KHZA 5IM5A 2VRCD 3R7DA 1WR1B 3LP8A 2O14A 2FPLA 4LY0A 2XRZA 2JA1A 4Z4CA 3JQBA 2X7JA 4P7KA 2RHWA 4I8DA 2GEVA 2N1BA 4MP8A 2ST1A 2R0IA 4XVUA 4B3CA 4HUTA 1PZFA 3N8IA 3ETEA 4HL6A 2DAMA 3M1YA 5MN5A 2JG3A 2QRHA 2BBOA 5ALIA 2BMDA 3GD5A 3IUQA 4RXMA 2NUAA 4RY2A 3VHXA 5U4QA 2XA9A 5EIFA 2WF7A 3QKTA 5F77A 4DKXA 3PYLA 1GILA 2RGWA 3RW9A 3A6GA 3H0KA 1YZLA 3E8XA 1L1FA 2WJZB 4RTMA 3OO1A 5HYVA 1LPAB 3LXRA 5JR3A 2ACKA 1JQLB 4Y2PA 1XWWA 5K0JA 3NNDA 3PXXA 3PB3A 4HUJA 2FWIA 5TEVA 1EVJA 5FBHA 3V80A 1CHDA 3BMXA 2AXEA 5JQWA 4MLDA 3NNNA 4H31A 4PX5A 4GBGA 1X2BA 2O9JA 1XTTA 5E8RA 2G8NA 1CY1A 2OXCA 3EDCA 3F5FA 3PXUA 3DOHA 3I4FA 3S5UA 5IABA 1E0AA 5FWXB 2EJWA 2PZFA 1YIDA 4UOEA 1ATIA 1T15A 3GGJA 5HKOA 4M87A 1YUBA 2UUBB 1L7XA 3I23A 3GEMA 5CHEA 4ZOCA 1PKEA 4K9LA 4PR0A 4DNQA 2PYZA 4HI0E 4OSOA 1I36A 5BSRA 1FPQA 5LLTA 3GJ4A 1N6KA 4FBGA 4OQ4A 1G5QA 1AO0A 3CCCA 2H7XA 4HWSA 4B7FA 1R64A 2G9UA 1NZFA 4IVNA 1I3MA 2ZE5A 3O95A 2YOHA 5FA6A 3HZHA 1CULC 3ZXXA 5J2TB 1TFRA 1PL6A 1XOIA 1JYEA 3U0VA 1E9CA 2YCLA 1OWNA 1Z2CA 4A27A 2WQZA 9ABPA 3BIOA 1UP6A 1W0KA 2C00A 2Y1LA 5IAAA 4B3TB 1XX6A 2FWMX 1QFJA 5EZYA 1UXIA 2IXEA 5JALA 2PE5A 2PO7A 4IDDA 2Y0TA 1OY1A 3HHXA 1NN0A 1X1QA 2BHNA 4YAJA 3UFXB 4PN7A 4IKPA 3EC7A 3LUPA 5DSZA 4F8EA 4JNKA 3QNMA 5MFPA 3IMCA 4IGFA 3LCMA 2C96A 1LQUA 4ND6A 4Q4HA 5ALZA 3WZLA 1RHMA 1D04A 5E9AA 1ZDMA 5CFQA 2JH8A