1YUBA

Solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
245
structure length
245
Chain Sequence
b'MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRNA METHYLTRANSFERASE
publication title Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Methyltransferase
total genus 42
structure length 245
sequence length 245
ec nomenclature ec 2.1.1.184: 23S rRNA (adenine(2085)-N(6))-dimethyltransferase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1yubA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yubA01
4CTJA 3SXJA 3V8VA 3MAGA 3FTFA 3G8BA 2EJTA 3HCCA 4EKIA 2FRXA 1TW2A 3E23A 2GA9A 1JTEA 3PX3A 3GXOA 1AV6A 2JH9A 5CVVA 2CWWA 5E2BA 4PYLA 5C0OE 3V97A 4H0NA 4A6EA 4OQDA 2IFTA 5ERGB 1D2HA 3TR6A 4CWAA 2QE6A 4OA5A 1SUIA 5BW5A 3SSNA 4PIMA 4YUVA 4IKPA 5K0CA 4E2XA 3D2LA 2I6GA 3H2BA 3P71T 4DCGA 1JTFA 3FUTA 3KQTA 4AZWA 2UYCA 2JH8A 2IP2A 4YMHA 3DLIA 1EQAA 1VBFA 5E1DA 5GINE 1KHHA 2ZSUA 1TPYA 2QM3A 1AF7A 4BLUA 1FBNA 1HNNA 3HP7A 2ZWVA 2K4MA 3GU3A 3R24A 4ER7A 4RTSA 4ER6A 1NW8A 2H11A 4YUXA 2VS1A 4RVFA 3MCZA 1WG8A 3DTNA 5HIIA 5ICGA 2B78A 3EEOA 3DXZA 3KQVA 5FCDA 4YV1A 2YUIA 3MHTA 5GIPE 3TLJA 4PONA 1Q0TA 4LG1A 3A7EA 2PT6A 3EVCA 3SM3A 2N47A 3ELWA 3NJRA 4HH4A 5FQNA 5HZMA 5CIYA 5KQRA 3C6KA 3KR0A 3FPEA 3BXOA 5EHGA 5EG5A 3DR5A 4C05A 1B42A 5LQJA 5LQUA 4X1OA 1NBHA 3T7SA 4AZSA 3TQSA 1VIDA 1QAQA 2OY0A 3KQOA 4X63A 5EOVA 1BKYA 2ONZA 3PX2A 3O31A 2P35A 4RWZA 3FPHA 3LECA 3SVZA 2IH2A 4RX1A 5C1IA 2NXEA 5FHRA 3QOXA 5T67A 4YV2A 1OR8A 2AZTA 4GUAA 4KRGA 2QRVB 4PIPA 5DTRA 3R0QA 2ZZMA 4R6WA 2CL5A 2YX1A 4C03A 1NV8A 1M6YA 3NDJA 3DXXA 1DUSA 1XVAA 1ZGAA 2P7IA 1RI1A 2FPOA 2P3LA 5LQRA 5CVEA 3OU7A 3TOSA 4LECA 3CKKA 1N7JA 1Y8CA 2VDUE 2AVDA 2NNWB 4FSXA 5E8RA 4RSRA 5DTMA 5F2NA 1P1CA 4PNEA 3KQQA 5CCBA 5JR3A 2PX4A 2BR4A 2ZULA 3A27A 3A26A 3G8AA 5E8JA 5KQSA 3GIWA 3FTEA 2KW5A 3MERA 4ER5A 2AOTB 3C0KA 2WA1A 4P58A 1UIRA 4PWYA 3WSTA 3LX6A 5CM2Z 3JWHA 4ZTBA 4AZVA 3LDGA 1JG4A 2CKDA 4UOEA 2H00A 3G2MA 1FP2A 4Z2YA 5GP1A 1KYZA 5HEKA 2PXXA 3OE5A 3SR4A 1NV9A 4CTKA 1P39A 4U7PB 4HG2A 3EGEA 2IH5A 3UA4A 5DM2A 1IXKA 4F86A 5MHTA 1JQEA 2PJDA 3GRYA 2C7QA 4YMGA 2XYQA 1QAMA 2OPBA 5H02A 5GM1A 3LL7A 3FTCA 4HSGA 2G70A 2LD4A 1I9GA 2Q41A 4RTKA 3NWEA 3BWYA 4DA4A 3FTDA 1N2XA 2AOUB 3M6VA 2ZWAA 4QQKA 3RIEA 1R00A 2YQZA 3ELYA 1EAMA 3UJ6A 2IBTA 2G71A 3KU1A 3ORHA 4M37A 1NW6A 2ZLBA 3RW9A 2B3TA 2PSSA 2O57A 5FULA 3TRKA 5K0BA 1AQJA 5HIMA 4C07A 2EG5A 1WZNA 1YB2A 5T6BA 4ER3A 2ORED 2B25A 5K0LA 5CUQA 3KQMA 1R74A 3T0IA 2OBFA 1UWVA 3BGIA 3TPZA 5DPMA 1EIZA 3DMGA 3EMDA 5EEGA 1RJEA 2AR0A 2WK1A 4X60A 1HMYA 3DLCA 1XDSA 4K6MA 3HNRA 4QQNA 2CMHA 1G8AA 3EPPA 4MQ4A 5G02A 1D2CA 3GRZA 4OX9Y 5FWAA 3BT7A 1O54A 2R3SA 2BR5A 3F4KA 3KHKA 3LCUA 4M7RA 4E33A 2AVNA 3KR1A 2UZ4A 3ER8A 3EVFA 3DP7A 3JWIA 7MHTA 1JG3A 3M6XA 3R6TA 4BP1A 5LSAA 2PVCA 1FPQA 2OB1A 2YXLA 2YVLA 2PV0A 2R6ZA 3KQYA 3CC8A 4FT4A 1P1BA 3K6RA 4C08A 3A4TA 2JHPA 3REOA 1YFLA 4RTLA 3P9CA 4PYQA 1XJ5A 1ORIA 5K0FA 3HA3A 5K03A 2AN3A 1NW3A 3TKAA 5EMLA 3M6WA 1BOOA 3AXTA 3CJTA 2YXEA 3G5TA 4YUWA 1RI4A 1G38A 4KIFA 5GIOE 3E05A 3PFHA 5CVDA 4RTPA 3EVDA 4RVDA 4PYNA 2YR0A 5EMKA 3C6MA 3G2OA 5F2OA 3UJDA 4EQZA 2C7RA 5JUWA 3UJBA 2WA2A 3VSEA 1P91A 3GRVA 1G55A 1L3BA 5DM0A 5EMJA 5GM2A 3VC2A 4DQ0A 2GLUA 4GOND 5CCXA 3R3HA 4RTRA 3Q7EA 2Y1WA 4E31A 3G88A 2JJQA 2OKCA 5EKXA 5F2KA 1JSXA 3HVJA 5DX0A 2GH1A 1XCJA 1VQ1A 4X41A 3EVAA 4GOLD 5FADA 3E8SA 4YUZA 1SQGA 3EGVA 3BGDA 4R8SA 4CKCA 4F84A 4Y2HA 3Q87B 3KQWA 3PT9A 5E1OA 3SX0A 2DPMA 5GWXA 4OBXA 2YTZA 5K0JA 3UJ7A 1JG2A 1X1DA 1WY7A 4PCLA 2UYOA 4HGYA 2NXNA 3BZBA 3EEYA 2YXDA 1KPIA 4P7FA 3FUUA 5FA5A 3ELDA 4LWPA 5EEHA 3NDIA 4ISCA 4PYMA 4MIKA 1VPTA 2ZW9A 3KPVA 3B7PA 4V0QA 3KPYA 2HNKA 5EKUA 3SGLA 3PTAA 1QANA 3DXYA 3EMBA 2GAFA 3FYDA 2V7EA 1O9GA 2IBSA 3SSMA 2QRVA 2HR1A 3L8DA 3DH0A 5EIFA 2UYQA 3S68A 2ERCA 5FA8A 2PY6A 4GEKA 3HTXA 3C3PA 4XUDA 5CD1A 4RTOA 4MWZA 2ZTHA 3FRIA 3CCFA 4DKJA 5E9QA 3GDHA 1QYRA 4RTQA 5D1HA 3LDUA 5T64A 5LQCA 4R05A 3OFKA 2BH2A 4PYIA 4KIGA 5EMMA 2XVMA 5BW4A 5K0GA 4PYOA 4PYJA 3G2PA 1G60A 2AS0A 4HC4A 3GGDA 4PCAA 2OXTA 4KDCA 3GO4A 1H1DA 5FHQA 4E2ZA 3UWPA 5DM1A 2AOTA 3EVEA 4BLWA 4QPPA 3GCZA 1IM8A 1VP9A 4BLVA 4C06A 2BZGA 4V0RA 2GB4A 3OU2A 4QPNA 4O29A 2IDKA 3BGVA 3OCJA 3LBYA 5FTWA 5LQAA 2O06A 1T43A 5EHIA 3HCAA 4P7KA 3MQ2A 2ESRA 3DOUA 1VL5A 1R18A 1RI2A 3I5UA 4QVKA 10MHA 4C04A 5IKMA 3DUWA 5EZSA 2NXCA 1INLA 5HOQA 1JQDA 3C3YA 3ERCA 2EX4A 4BP3A 3R9XB 5ICEA 5DX1A 2E5WA 5LQNA 3U81A 1RI5A 3P9KA 5ICFA 3AJDA 4JXJA 4L7VA 2NP7A 2PGXA 3LPMA 4U7TB 3P2IA 1XDZA 1JG1A 3OPNA 1WXWA 3HVIA 3I64A 4KW7A 4F85A 2IIPA 3HCDA 3LGAA 2AOUA 2PWPA 3KQSA 3UZUA 1L1EA 1X1BA 4RTJA 2IH4A 2P7HA 4MTLA 5E1BA 5CVJA 3UFBA 4QTTB 4R8RA 4XCXA 2XBMA 3CJRA 2JHAA 3HVKA 3BWCA 5DWQA 5P8WA 3FRHA 3LKZA 3LKDA 5EPEA 3IEIA 2PXCA 4HGZA 3M70A 5KS2A 4FT2A 2HTEA 2GPYA 3DMFA 3P2EA 2I62A 3NTVA 4CXMA 4FSDA 3AWIA 3HA7A 4GBED 4GOOD 2AOWA 1NW7A 3TFWA 4E30A 3EVZA 2Z6AA 1L3IA 3P9NA 4DF3A 1SUSA 1YFJA 2V74B 3OZTA 3IV6A 1YZHA 4DZRA 4P7GA 5C9ZA 1RJGA 3HEMA 4HTFB 3EVBA 3OZSA 1R8YA 2PBFA 4GC5A 3FZGA 3QOWA 4HRAA 2FYTA 2C7PA 1XXLA 3ID6C 2QY6A 1ZG3A 3OFJA 1YZ3A 4EK9A 4FZVA 2VP3A 1NKVA 4OBWA 1V39A 2ADMA 5EGSA 1M6EX 1PJZA 1VE3A 4X61A 5DM4A 3X0DA 3KQPA 2DULA 4IV0A 3M4XA 3P97A 3FPJA 1VLMA 2G1PA 1MJFA 2H1RA 3B3FA 3TM4A 3KR2A 2VDWA 2I9KA 2FK7A 1EG2A 1X1CA 4FS8A 1ORHA 2IDJA 3KKZA 5FWDA 3LHDA 4YV0A 4RV9A 1MHTA 5CVUA 1DCTA 4E32A 2AN4A 4PGHA 5K0NA 4DCMA 4KWCA 3A7DA 2GS9A 1RJFA 1JQ3A 2B2CA 3MTIA 3BUSA 3GJYA 3MB5A 3P8ZA 4DM3A 1TW3A 2ZBPA 3HM2A 2HMYB 2PX5A 3AY0A 3LBFA 4LWOA 2PKWA 5EZQA 3B5IA 1KPHA 2BM8A 3T7TA 4RYLA 1ZGJA 1G8SA 3B3GA 4KVZA 4FP9A 1KP9A 1KXZA 4XUCA 5HIJA 3TMAA 5LR6A 3M6UA 2EJUA 3PLAE 4RVGA 3B89A 1UFKA 2HWKA 3NW9A 2G8NA 3VC1A 4DMGA 2Z6QA 3PFGA 3PS9A 1R8XA 3JWJA 2CMGA 2FHPA 2QYOA 4MHTA 4GQBA 4IWNA 3LCCA 4E2YA 3BWMA 3UA3A 2PX2A 2JHCA 4EMSA 2BR3A 3JWGA 3PB3A 1VP3A 5DTQA 2OO3A 2ZCJA 4QTUB 2ZBQA 3KPUA 2PX8A 5EC8A 3IYLW 4RTMA 4YUYA 5HFJA 1Z3CA 4ER0A 3FUXA 3P9IA 2EFJA 3LCVB 2HV9A 2ZZKA 2B9EA 5IH3A 5BXYA 3BKWA 2OYRA 1WXXA 4PGGA 3THRA 2P41A 4E2WA 2I7CA 2BM9A 2ZIGA 1YF3A 3GNLA 4XUEA 1NE2A 3GWZA 5HILA 1ZKDA 1L3CA 4GC9A 1NW5A 4BY9E 1N7IA 4AUKA 4NECA 3CBGA 3SSOA 5LQKA 2AOXA 3EGIA 5DRYA 2O07A 1SVUA 2ZVJA 3I58A 2Z6UA 1D2GA 3DMHA 4CKEA 3GRUA 2OB2A 3CVOA 2NXJA 3OU6A 5E9JA 1XCLA 2P8JA 3G89A 3OZRA 2XYVA 4EVIA 3G2QA 3PVCA 1FJXA 1FP1D 1G6Q1 2P40A 5DXJA 2O0LA 1KYWA 1WS6A 2P3QA 1F3LA 4QVGA 8MHTA 1DL5A 5K01A 2ZIEA 3E7PA 3G7UA 4P7JA 3GRRA 3MTEA 3HCBA 3IHTA 5HIKA 1QZZA 5DRTA 2VDVE 2XYRA 1BHJA 4A6DA 4GF5A 3NVMB 5U4XA 2F8LA 3ME5A 3UJ8A 3CGGA 1IY9A 2PLWA 2PXAA 4B17A 4PINA 1KR5A 3AXSA 4M36A 2XVAA 3BWBA 1KIAA 3UJCA 1AQIA 5FQOA 3O4FA 2P3OA 3TKYA 1M0EA 3NMUF 3QV2A 3I53A 3M33A 3NWBA 1RI3A 5BP7A 2AOVA 4KDRA 2C7OA 3FUVA 3NVKI 3BKXA 3ER9A 2PT9A 1O9HA 4FR0A 5D1NA 2A14A 4M38A 1NT2A 1ZHFA 3CJQA 2NP6A 1EJ6A 3KPWA 1I4WA 4RVHA 9MHTA 4RTNA 1QAOA 1I1NA 3FUWA 1L9KA 3DULA 3HCEA 1JSZA 2JG3A 3FYCA 4Y30A 1KPGA 1BC5A 2Y1XA 4G56A 5DSTA 4E70A 3EVGA 2FK8A 4IV8A 1SKMA 3KPJA 4FGZA 1XTPA 2FCAA 3MCTA 1U2ZA 5FUBA 1EJ0A 5GOZA 5E9WA 1F38A 2ONYA 4WXHA 3K0BA 4AZTA 3A25A 5DSXA 5EIWA 1ZQ9A 4AX8A 1YUBA 2O05A 5KYGA 2NYUA 1X1AA 2PWYA 5KVAA 2ZBRA 4OQEA 2ZIFA 4HTFA 3THSA 3UJ9A 5ICCA 5K8VA 3HVHA 5K05A 3FPFA 3FPGA 1Q0SA 3VYWA 5K0EA 3B3JA 4OA8A 3P2KA 1X19A 1PRYA 1NBIA 1SG9A 3MGGA 5DLYA 2IPXA 3LSTA 2VZ9A 3O7WA 5DXAA 2AN5A 4POOA 3SMQA 1R6AA 4PYKA 1XDUA 4QDKA 2ZZNA 4ATNA 2UYHA 1SQFA 4CKBA 5B1SA 3LDFA 4QDJA 5EQJB 3ANXA 3HCFA 2ZFUA 2P1DA 2OZVA 3HA5A 2IGTA 5E1MA 1JR4A 2G72A 3G5LA 3I9FA 5E2AA 3UJAA 5M5BA 3UBTA 3T7RA 3ELUA 4GOMD 4R6XA 1RJDA 5DX8A 3RODA 5DT2A 4WVLA 3TM5A 5K09A 3KR9A 5EVJA 4C4AA 3OE4A 4EKGA
chains in the Genus database with same CATH superfamily
5C7IO 3E23A 4H4CA 1D4FA 1VMAA 3OX3A 2WWVD 2PX3A 4YDQA 4DKXA 3GJ4A 1BN7A 3E9YA 2OXIA 2CXPA 3W05A 4CU2A 4R2HA 3GRAA 3Q3HA 4ZXPA 3ZIUA 5CIYA 4HWPA 5JAPA 4CQNA 2HJVA 3A1WA 4BGEA 1YGPA 2FXVA 1VFNA 5FYDA 3A9TA 5EXEA 1ZBDA 3V6LA 2X8AA 4IIGA 4X66M 1O0BA 5JATA 1I3OA 4PHFA 2PX4A 2AOTB 1C7ZA 3ZZ1A 5HGJA 4D4LA 1I5EA 1Y5NA 3F1KA 4WHMA 2WU3A 3WTCA 2YJ6A 1ODSA 1ML4A 1YZQA 3FOAA 4X71A 2OMEA 1KQPA 1ZD3A 3PGMA 2Q41A 4DA4A 3HY6A 3I1YA 2E55A 5BO5A 2IEBA 1E1QA 3WA6A 3DO8A 1EBUA 2XMGA 3ODGA 4ZO6A 1R74A 4HLUC 4YA6A 5DEOA 1NQOA 1JDJA 3GLGE 1BJKA 3IV9A 4L5JA 4IIVA 3JALB 2ZTMA 1N2BA 3HYLA 2A67A 3WK6A 3Q8XA 4GX0A 3ZYCA 5K03A 2QGFA 2CFCA 5FFNA 2Z57A 3ZCPA 2F4VM 4JLUA 4YRCA 1B3RA 3K3PA 5AP9A 5B3KA 4LI0A 4BQNA 2OKCA 1XOIA 1N2SA 3K53A 3OLWA 2IX3A 2QUAA 3CIFA 2VIIA 2FPXA 3SZOA 2GZAA 3RASA 3DBRA 4RXTA 2KI5A 2XLCA 3CZQA 1H42A 3VR5A 1KFJB 5B6IA 4Y6LA 4V1CI 4TT3A 4RK6A 3RSZA 1UFVA 3KFVA 1J9GA 3UG6A 3EFEA 3OTOB 3P1JA 1T35A 3T95A 3S8YA 4RTOA 3ORSA 4TKLA 2H1FA 4XASA 3FMFA 3E4RA 5B1DA 3RC3A 4CT4B 1Z0AA 3E22B 2W8ZA 3E70C 4G5XA 3F2VA 3WLOA 4GVPA 3ZY4A 1QP0A 1C9MA 2BKUA 2W98A 2DAMA 2RK6A 3CTPA 1XTJA 4WY5A 2V9CA 1OLXA 4U7JA 1RI5A 3DBOB 1R0XA 5JEDA 4C7MA 4EI8A 3R44A 3NDRA 2Y21A 4RTJA 3BMQA 5CT4A 3OE7D 1GVNA 3BWCA 2I6FA 3NWLA 4D80A 2OHJA 3DD5A 4DJ5X 4MDEA 1EFKA 3ZZMA 2PMDA 4XR9A 3OZTA 3K2EA 4IGKA 2IYVA 2JL1A 2XHZA 1WP4A 4OUDA 1C9YA 1ODFA 2ZRDA 1VE3A 4N8SA 1DVRA 4GPBA 5MF6A 1XG5A 3EY9A 4D8TA 5J2TF 4BCDA 4G97A 5L53A 3BK7A 3VK7A 2GN8A 4FD2A 4R5MA 4UFNA 1KYYA 2UAGA 4RAOA 5TARA 3LE8A 5EZQA 4AFNA 2PKWA 4KQHA 3MGKA 2J3JA 3GARA 4RQBA 4NHEA 1LZKA 4JFRA 2Z6QA 1Z0ZA 5C35A 3G8YA 4RS3A 3CLRC 3SASA 3GUZA 1NPDA 3WO1A 2INGX 4R69A 4UUOA 5KYUA 2FPRA 3U13A 1NMQA 3PC3A 3GJTA 1GSIA 4NZ9A 4Y6OA 1A7AA 4FFSA 4A8PA 3F7NA 3UT5B 2W8BA 5ITZA 3WMEA 3OQ1A 3MCVA 3WGLA 3AGQA 1ZS9A 4FGWA 1R4NB 4E5VA 4I1SA 3D3EA 4QVGA 2I7NA 3KKMA 3H83A 2O6HA 3RGSA 2ZPUA 3ZBUA 4HDNA 1T2NA 4TTPA 3AEKA 2XUAA 1T2DA 3SF8A 2OKGA 4AKSA 1FJGM 4N76A 3TZQA 1M33A 3PXEA 3GVCA 3VVBA 4MZDA 3IE2A 4C0BA 2EATA 1FTNA 3BIOA 3GHHA 4WXHA 5DSXA 1UKZA 2CNDA 3H0EA 2WV7A 4EI2A 1NSTA 5J59A 4GBMA 2VF4X 2ODAA 2IPXA 3AB8A 1TJPB 3U6QA 3HBJA 1HOXA 1QMGA 4PC1A 5HRAA 1Z7EA 1OX4B 4Q24A 4Q1VA 2HTFA 4KXFB 1QOZA 3JWEA 4GE0A 3G5AA 3GXOA 1Z13A 3CNLA 5DYYA 3D5EA 1D7OA 1UDBA 2D2FA 2XGJA 3VR6D 3G0DA 5D01A 1S0UA 5ICMA 4PU0A 2D0IA 1JTVA 2IV2X 4RC9A 5TLSA 1PK7A 3SM3A 1AXGA 5JS7A 3A06A 3ETLA 3FPEA 3LHFA 5LQUA 1F2DA 2P35A 4LHYA 4WJKB 4I4TF 5CX1A 2VK2A 4GUAA 2P4HX 3BGOS 2ZYVX 5IJAA 4BNJA 1J23A 4F8JA 5KQ8A 2R4UA 4N8DA 4PPFA 3KJZA 1LF5A 4OIFA 3H5WA 2EV9A 3LDGA 3PDHA 3EDQA 3ASUA 1Y34E 3QI7A 3HKDB 3AEUB 2W2VA 1ZU5A 2BFDB 4NC9A 2WVHA 1Y6ZA 2L4EA 3PWZA 2XQVA 3U5ZA 3N0TA 1ZL0A 1H6DA 2ZT8A 2PL9A 2QLTA 1KIMA 4QRIA 2YFQA 1BS2A 1QH1A 1ZC3A 4ZVVA 1DP4A 1OJLA 1DC7A 4I9GA 3QEKA 5EUQB 3M3HA 2D5AA 5DNYB 2VDLB 2CJFA 2EKZA 4FU0A 5CHYA 1VMKA 1JA0A 2H8KA 2XUIA 2DH5A 4IRMA 4XYMA 3HJAA 3ASYA 2FW1A 4A0QA 5KPDA 3ND5A 1ZMBA 5FA5A 4D43A 2CDNA 1VMDA 1Y8QB 4I50B 1ZNYA 1JQAA 3IKLA 3IUYA 5THKA 4JCOA 3U6KA 2O8DB 1KMQA 1TK2A 4TXJA 1T91A 2HLPA 2AK2A 1NXXA 4EF6A 2HPAA 3H5OA 1WUHS 4JNCA 2IEYA 2JFXA 5DEIA 1RLUA 3R20A 1KI7A 3U7JA 3RNLA 3HVUA 1PRBA 3Q7TA 3BXPA 3U81A 3D9QX 3STXA 3K2LA 3CF6E 2JZ0A 5HQ3B 4WXPA 2FKNA 1KJ8A 3VDXA 5LU9A 4G0OA 3HEBA 5LU8A 3DMFA 2D1RA 4DA0A 1GGMA 1XDWA 4MVJE 4KNVA 2XNHA 3NGXA 3HEMA 4TMTA 1C50A 4HRAA 2O50A 5KYTA 1U0NA 3CHYA 4UUBA 2VA9A 2Q28A 3IPAA 1TM5E 1EUDA 1TZBA 3DEYX 4EBBA 1V8OA 1YTLA 4HQFA 2G3QA 3MTIA 1NVMA 3GP8A 3A8TA 5EHXA 1NVXQ 4QM6A 1ZK4A 1LDEA 3G68A 1RXYA 1MX3A 4N1AA 2R7NA 4HKTA 1E3QA 1GGNA 2W4IA 1M10A 2TMKA 2CWDA 1ZL2A 4V03A 1TEXA 2H16A 2DZNB 1A9YA 4RDCA 1GR1A 2CF6A 3AW8A 5K01A 5BR4A 1KOFA 1PR2A 3TVTA 2RGNA 1G5QA 4NOMA 2VOEA 3QV2A 1UC8A 3ZD7A 2ODPA 5BP7A 5D1NA 4HWTA 4Z54A 2B4KA 2RJ3A 1L5GB 1YJXA 1QO0D 3HZRA 5G0VA 3UNXA 2UXDB 5LMNM 5AKZA 4CI0B 1UPFA 3Q85A 2ZTCA 2H1OA 1QIJA 1DQSA 4GKVA 4JYCA 2ZWMA 1ZH6A 4RWEA 5KHLB 2E9SA 3EJWA 4YMIA 1O95C 3MIIA 2OWEA 1PSDA 3EDOA 1ULHA 3O8BA 4Q93A 3SNKA 2ZU6A 4LFCB 3D4IA 3FTFA 1QFSA 2X8JB 3UWSA 3HCCA 4HV4A 2C2YA 4OK6A 1PYGA 1LQTA 4U2KA 2JGRA 4EEXA 3KU4A 2R2AA 3N2KB 1JWLA 3IJRA 4AZ3A 1F8FA 4N5DA 3RT9A 2AMVA 2W0MA 1CF4A 4WEQA 3UAYA 1G18A 1P81A 3STYA 5JJIA 3I32A 4RHXA 4D02A 1JIXA 4H4DA 1VIDA 3VZSA 5J58A 1NUUA 1IU9A 4Q9IA 1X14A 1YDHA 3B48A 5ESDA 1E0KA 1M0WA 5IMBA 3PDCA 2DFDA 1U8AA 1UP4A 3NO4A 4QYXA 1A8UA 3CONA 4RW0A 1EVZA 2RK3A 3LFHA 3LWNA 3U1BA 4LOAA 1I33A 1O5IA 1FW6A 2ZDGA 3O83A 4JYBA 5GM1A 3D2BA 1T9GR 4V1CA 3GLIB 3AERA 1Q16A 2YQZA 1TIBA 3C7DB 1BVSA 1ZGZA 4C07A 1XPUA 1VXOA 5LC1A 1MU0A 1T9CA 3GFGA 4CMEC 1TKBA 3CXUA 1QTQA 4N5IX 1QQ6A 3FLMA 3I2FA 3E3NA 1PT6A 3P9CA 3IKTA 4IHAA 1N3IA 3JVDA 3O4RA 3R5JA 4RZ3A 5AVRA 3AY6A 2VQ6A 3DA8A 1K5GA 4TM8A 3WWYA 1A5SB 3KUUA 4CF4A 4G1UC 4CGZA 3BGDA 2F8SA 4DNXA 5K0JA 2C4KA 5JNUA 1PUXA 1H05A 3ROMA 4MJXA 2NO9A 3C3XA 4UU8A 4JDUA 4HTAA 1Q0UA 1L4KA 4Q7EA 1Y6FA 1Z5PA 1F2TA 1GJSA 3CINA 3IAM6 2RGUA 1SVMA 3SXUA 2Q5HA 2FOIA 2JJMA 4AXBA 2NV0A 3H9UA 3ZGLA 2X6QA 5CT5A 1DJNA 4QPNA 3KYIB 3AZQA 3X2FA 1NKSA 1UFRA 2MGWA 1OTXA 1I6LA 4K6CA 2Q1TA 2JI7A 3FJYA 2XOEA 3HYNA 4DMUB 4XWTA 5HS6A 3ONFA 4F6LA 3DMRA 5LVAA 3S6JA 4EF5A 5EPEA 3QK7A 5ELMA 2YH2A 3WXBA 3NHLA 2XQKA 5TGTA 3INGA 1E2HA 2CLMB 2VLIA 5EINA 1SG0A 4IM7A 1I9CA 1ZU4A 2M32A 4HVTA 4JR0A 2OO9A 2IUEA 4LXYA 1PT9A 4ID3A 2J32A 3KVOA 3DFFA 3HN6A 1FSPA 4KQMA 4HZUA 2YQ5A 3CRW1 2WYOA 2IXBA 4UHHA 1QE5A 4ODIA 1HEIA 3K9BA 4TRMA 1A4UA 3MLBA 3L7OA 1EPUA 3DOOA 2C94A 1P44A 1LU9A 1L4LA 2ZPTX 5KREA 1J99A 2ZIAA 2HCFA 4L6V6 5CK5A 4EOGA 1FFYA 1SVOA 3OQNA 3KPUA 4V0ME 3Q72A 1NOIA 2G06A 4RTMA 2OGTA 4NYIQ 1SWVA 4AB1A 1VTKA 1WXXA 1KJQA 4PQFA 1GCIA 1L5ZA 4GZMA 2BGIA 1E1QD 3KTDA 4LXXA 4R1PA 3RIYA 4WA7A 5A71A 4RD0A 1A9TA 4IF6A 2O0LA 4KQCA 1G8FA 1WZCA 3PPXA 3L84A 1MO5A 3CU5A 2HLNA 4AJNA 2JFUA 1EK1A 4I4TA 3IR6A 2H4XA 4H6VA 3USZA 1FIUA 1N4DA 1NUPA 3OA2A 3BQ9A 1AIPC 3EA4A 3ZHXA 3PGJA 2RGXA 3A3NA 5M34A 1SVWA 3I4LA 3GFSA 4NY1A 4O4JA 4QNNA 4Z4CA 4E5SA 1W73A 3JAWA 1DDIA 4JVNA 2VTBA 1NASA 2PSHA 4RESA 3VR5D 3QYAA 4TT3D 3RV4A 1N6RA 4LF6M 1N0IA 2MJLA 1SIBE 5DT2A 1XAIA 4UE3S 1FYXA 1M2OB 4JJKA 1ODJA 3TG2A 3IIIA 1E5TA 1ESMA 1K1EA 1T24A 3QHQA 5C3MA 1PL0A 3RS4A 1LW7A 2GFIA 1I6KA 2F3PA 3AJEA 4FYVA 5IVPA 4AK9A 3PI6A 3MHTA 3N8IA 5GY7A 1NBWB 5I01A 4FS3A 3C1TA 2ILVA 4AZSA 5K8UA 4X63A 3PC8A 2XB8A 3OJEA 3RVRA 1C1XA 4M1MA 2VUIB 2P3SA 1R37A 2ZTDA 3AF2A 2ORIA 3M9WA 3Q11A 2KW5A 2Q2QA 4KKVA 4P58A 3LUAA 3F5DA 2H2AA 3FNIA 2R97A 1NIJA 4FYKA 3MW8A 3C4QA 5BRAA 2R6R1 3A3PA 4JLOA 5FJIA 5JJLA 4I9HA 4W9NC 1WZNA 1EK2A 4X7RA 5TQ2B 1ZXLA 3PVSA 1OU0A 2ORYA 4X60A 3OSZA 5JH7B 2R3SA 1SCQA 2ZBVA 4AT1A 3NOOA 5EE5B 1G7RA 1Y98A 1JA1A 3KAKA 2Q4RA 1XKTA 3PDWA 3REOA 3UJ3X 4DIMA 1BMTA 4KK4A 3I2IA 5AJXA 1KI1A 1NZDA 4E22A 5TS2A 3FFWA 3N5CA 2FSUA 4L4UA 3IVMA 3ILHA 2P6OA 4PYRA 2WJ6A 5JG7A 3LHSA 4B1FA 2DPMA 2YWFA 1GPUA 1W4RA 2WF9A 1ZCFA 4YASA 2WF5A 1JZSA 1C8BA 5EPUA 3SKVA 4LZPA 2HR1A 1EH5A 2VP5A 4AYWA 2WTEA 3SAUA 5DTEA 1SIOA 3VI3B 2HIGA 1XZEA 4GXQA 4EFLA 4UULA 4GXNA 1L7BA 1O6ZA 2UVQA 1O0SA 1NULA 4MJ3A 3IXLA 4AJ1A 2DCUA 1TCVA 3C7KA 2OILA 5AW1A 3E9EA 5IDWA 4WQMA 5LQNA 4CKWA 1PIWA 3P2IA 4ZO8A 4J2TA 4JC8A 5CA0F 4U2CA 4FSHA 4OL9A 3FRHA 5A2QA 3DO5A 2QVCA 1BX3A 5SZJA 1Z0FA 1RQNA 2Y05A 5KPTA 4D7AA 2Y99A 5DNVA 3M6FA 1RJGA 3ZDYB 1H5UA 2MU1A 4MH0R 3L0SA 1CZUA 4KQKA 4P3PA 2CF5A 2EDCA 4EQ6A 1E3JA 1A69A 1AKVA 3FVWA 4YREA 4FNOA 4QWWA 2IUUA 4PGHA 1JXAA 4PC2A 1A9XA 4EEKA 3THWB 1TMGE 1XRMA 2RH9B 3DAGA 3D7SA 4B0PA 5HHTA 3S28A 1G9SA 3HKPA 1UK8A 1Z62A 5LXTF 1U2QA 2OO3A 4W5WA 2ZBQA 1KZ4A 2HBZA 4P98A 2FPMA 2NPFA 1UFOA 2G5PA 3LMKA 4WA8A 1TFRA 3RABA 1FXSA 4IIEA 1Q50A 4YDSA 4O4HF 3ZLBA 4XIIA 4C21A 2KDLA 4FONA 1UWKA 4ZU1X 2HU8A 1V16A 2UXCB 2O8FA 2JS7A 1I94B 4G8BA 4ZEVA 3IQIX 2FW9A 1U80A 4FFBA 1Y6JA 2PZLA 3H0KA 2AF3C 4OYYA 4IV8A 2HRQA 2V65A 3A25A 2XSZA 2IY9A 1BGXT 2P6MA 2H3HA 1LC3A 4WKNA 5DLYA 1R5LA 3L8ZA 3LSTA 3PGA1 4LZJA 2A5DA 2FN3A 1JMYA 1EVQA 3B13B 4CRWB 2IGTA 2G72A 2WICA 2ZB8A 4UASA 4ZDKA 1CVLA 4GI5A 3KR9A 3DDOA 2WHPB 4CLDA 4AW4A 2ACWA 2HXYA 1AZWA 1CR6A 2DHYA 2NNLD 4RQAA 3DHYA 3KSRA 4F3TA 4BGIA 3IDAA 3QUCA 1KO4A 2RI0A 1WG8A 1X7XA 1ZD9A 2WKRA 4LW8A 3D0RA 4EYQA 1NVGA 4NI5A 3B74A 2VG8A 5AVQA 3TOCA 3DTTA 4RX1A 2Y4OA 4ANFA 4UZSA 4MS3B 2FEXA 1M6YA 4MUAA 1JPUA 1FLDA 4JA0A 1QX4A 3ABRB 4NS1A 4JYAB 1SJ9A 3IVCA 3EZ9A 1Q77A 2DFPA 2Y2VA 8OHMA 3G2MA 3L8CA 1I01A 2ON6A 5HSGA 3I72A 3WL6A 3RU9A 2QD1A 4X94A 4NP6A 5IBRA 1JW9B 4YXFA 1BX0A 4CTNA 4ER3A 4HDMB 3VOAA 1DAGA 1H23A 4TTVA 3T6KA 3Q98A 3E5NA 4IO1A 3EVFA 2R65A 3FFAA 4QKQA 1T2FA 2AJLI 4DLSA 2XX3A 1NFQA 1G19A 3U3MA 1DJPA 1XZCA 2XGGA 1XNJA 1ZI8A 3N1UA 1I4OA 3UAOA 1GTZA 1MZPA 3TW0A 2H2FA 2BRUA 1QP8A 2GD1O 1US8A 3RS9A 3E2PA 1OE0A 3ZNQA 3OEHA 1U3DA 2ZYWX 3N7TA 1H8EA 3GBPA 3KJIA 2A57A 1MENA 5F1OA 3HGIA 2MT9A 5BSGA 3H18A 3LM8A 4TL9A 1O3YA 4E5PA 2Q8PA 4Q4JA 2QMQA 2X8LA 5HK8A 2VAMA 1B41A 1JFTA 4HC4A 4MCHA 3I61A 1X7WB 1JLMA 3D5TA 2R7MA 1BD4A 3A36A 3HABA 4P5EA 2XOXA 5AH0A 2I3BA 4LN1A 2F55A 3DUWA 3NAQA 3M2TA 4MWBA 2Q4BA 4ZCSA 3U6EA 1P0PA 1V3UA 3WLRA 3TFOA 3I9V6 2J7NA 3WX0A 1GTJ1 2HJSA 2ZVPX 2NZJA 3JD1A 1TOAA 4X20B 5IKPA 3KXKA 3CLTC 2DKOA 3UCFA 5JC1A 3SZLA 3A6DA 1G8KA 1KOGA 4AICA 4GZ3A 5K8TA 4IV0A 2RFLA 2H4WA 4XCQA 4R2KA 3BFVA 4EPXA 1E4OA 1DU4A 4LOIA 2WV9A 4TSFA 3QVLA 4E5UA 1HORA 3R41A 1O6FA 1H3NA 1RP7A 2JVKA 2ZYSA 2GESA 4HEA6 2MHCA 4HXFB 5EE9A 2M6SA 2GCNA 2YV1A 3N3AC 3X1YA 3LCVB 2NQTA 1DV2A 2VJMA 2Z43A 3Q5GA 4IIFA 4KI7A 3BMNA 3LXRA 2BMWA 3MTGA 4ESOA 2ARKA 3AY7A 5DYTA 2LWXA 2F8LA 3LVRE 2PXAA 2QSYA 3OH8A 1HT2E 1XFAA 1R0WA 3DG9A 2J59A 2ZE5A 3FNEA 4IHJF 5FLXS 1VIAA 2IYSA 1RKXA 2J3DA 1R0BA 4IQ8A 3BB3A 4MMYB 1KDOA 3CO5A 5KAPA 3I9JA 4Q4HA 1RBYA 3L7AA 3K6SA 4DRZA 4F97A 1Z2PX 4CHTB 2O52A 1L7RA 3CZCA 3OVMA 2JWSA 5KU7A 1P3JA 1A5AB 5M5BA 3RWMB 3KOZE 5FWXA 4YJHA 4A1FA 3RAPR 3E3LA 2JKYA 2GF2A 1P7VA 2C2GA 5HJ7A 3H5RA 3QXGA 4PNHA 3KWFA 4DDMA 1Z22A 2B1RA 2FWNA 2OECA 2X0RA 4HX2A 2FCRA 2ZWVA 3UWKA 2F1OA 3WWEA 1V11A 3QAUA 4UBNA 1HYGA 2ZSFA 3F98A 4FN4A 2FW6A 2M1XA 4KI0A 4Y2RA 5T7BA 1HQKA 5D3MA 3HB0A 4ZD6A 3ICWA 4C03A 3Q8KA 2ZJAA 5ICSA 3LNCA 3HB9A 3L1KA 2FR8C 3HYCA 5C5EA 3C7CB 4F9FA 1WXFA 3C24A 4QLAA 1YUMA 3PTLA 1L2DA 4LOHA 2SNIE 3UGJA 3QFTA 4X44A 5EJ6A 2PXXA 5TY0A 3MS2A 3B5JA 1A4XA 1XMQB 2ZRHA 1WB9A 2QSJA 1MJGM 4UQPA 3NNSA 2FWMX 4BNYA 2ZT5A 3TR0A 3S70A 3V8MA 2CRUA 1Z82A 1G21B 1Z5BA 1YB2A 3R8XA 4RADA 2C2ZA 2J41A 5K0ZA 1Z7WA 5KAMA 3KR1A 4JUCA 2QVGA 1BFUA 4ENQA 2HLDA 1YVDA 1AQYA 5H16A 1G5PA 3K8ZA 2WU8A 2OXFA 3FSGA 4LJ6A 1R4ZA 4YUWA 4JV5B 4CM1A 2DVWB 3A6EA 2WU4A 4KQEA 1QS0B 2UXBB 2CL6X 2ZVQX 3IUJA 2VT2A 3U56A 2PEYA 5F12A 4YPOA 2Z7JA 2IF0A 4EYKA 4RZXA 1IHDA 3THOA 1V3VA 1AQ6A 1IN4A 4MWOA 3MXOA 4JLPA 4BKUA 5INTA 4TTIA 2PO7A 2FSGA 4OU5A 3FRIA 4DUZM 3RD5A 5CVCA 1C1KA 3CR7A 4G63A 3RQSA 1FS4A 1UBFA 2ZJOA 3RSCA 1ZDMA 2H1SA 4IOKA 2ANBA 4OJNA 2UVPB 2LPMA 1YS7A 4ML3A 4R2MA 2ZI3A 1RI2A 4HN4B 2FQWA 1PCXA 5HOQA 3V8EA 2COKA 4UCWA 4EY6A 4O4HA 2NU8B 4IUBS 2XTZA 2PRIA 5AHRA 2KEBA 4Z4FA 4KAJA 3KCNA 2M6KA 4EGSA 3PXAA 2RHMA 1D9XA 3TGPA 1V4BA 3MQFA 4CXMA 5K8CA 1PS9A 2JCSA 2IYRA 3GJ7A 5AFSA 1KI4A 1DEAA 3M4ZA 4HTFB 2OVBA 6AT1A 2ADMA 1AXEA 1II8B 3TX6A 3VH1A 4BLOA 2ZRLA 1NXQA 2YCBA 2W93A 2AXNA 4ND7A 1ISHA 3LV8A 4N0PA 2J9FB 4WY2A 2CMGA 3A6JA 5EI5A 3FVTA 1VP3A 3KTOA 1SWWA 3TVDA 4IJFA 3BORA 1BIFA 1H6BA 3NTXA 1JEQB 1R12A 2XWBF 3CVJA 2N3ZA 5K6TA 1BQEA 4AS2A 1WHCA 4LK3A 4PANA 4QODA 2V4UA 3N8HA 4S24A 1U4NA 5DHTA 2QZPA 3NIWA 3AVXA 4NOJA 1L5YA 1G20B 1V48A 4M36A 1A1SA 4LZAA 4BZZA 4A27A 3AUFA 4A0GA 3LOPA 3WOHA 1J5XA 5JMWA 1SXJB 5C32A 2O9JA 3ZPXA 2Z9DA 1WUJS 3LG2A 2XADA 3IDZA 3WBJA 1B3BA 3F3YA 4LISA 4RK5A 2GZ2A 1CERA 3UJAA 4DIEA 1NNJA 2NO1A 4BFUA 5JYDA 2X4GA 4WVLA 5AVYA 3K2IA 3CE9A 2C1ZA 3ZLJA 2AK3A 1FY2A 2C58A 2KHHA 3ZQUA 3E7WA 2FE4A 1D2EA 4TYWA 2JJYA 4YUVA 1TVKB 4IKPA 3O7MA 1DBQA 1V4VA 4E08A 1UT6A 4L8WB 2QM3A 1P0IA 4DC0A 1NW8A 2B78A 3VMMA 2JAPA 1LXCA 1TLTA 1CY8A 1JJVA 1NFFA 4JLSA 5ITWA 2AUMA 3T7SA 2X0IA 2Z5GA 3QE9Y 2O2HA 4LHXA 4DFDA 4TV9B 3SVZA 1N2CA 3M2PA 1CZRA 4FJ2A 4JI6M 2EF0A 4N5HX 1VKOA 4CUKA 3DXXA 4K9LA 3OU7A 4YDRA 2RJOA 4Q00A 5FPTA 1ORDA 3DA1A 2JIMA 1E9FA 1EFVA 2JAXA 4BAZA 2YWGA 4RNDB 5FPPA 3VHQA 1FP2A 3P19A 2WT8A 1OXUA 5IC5A 3GMDA 3KJNA 5EJMA 5DM2A 3IPCA 4W1PA 3DHVA 3ZKWA 1WHSA 1Y1RA 4ENRA 3SF0A 4QIHA 3BWYA 2TSYB 2UUAM 5BY2A 1JLRA 2H4JA 2J3EA 4X62B 5CUQA 3DLBA 3B9BA 5DFLA 4NFHA 1YR1A 3IAS1 4UHJA 3PA6A 2DPGA 3R3VA 1KDYA 4URHA 3CR3C 4LE0A 1KDRA 2CSXA 1R10A 1EP9A 2Y0EA 3EVAA 1G2PA 1D2NA 1Z5ZA 2HIHA 3SX0A 1WY7A 4ON9A 1EXMA 3R7NA 1P3DA 1KR2A 1DBPA 3LXXA 3KXIA 4XWOA 2AI1A 4KBYA 4IBIA 1BWQA 1HL3A 2B4TO 2WZCA 4MOWA 2XSZD 1NZJA 1YQUA 1GG2A 3WYAA 3WMRA 2TECE 1DAIA 4D3DA 4B3TM 4YJFB 3NBYC 2Q1XA 4R0MA 5TXGA 1YDWA 1TT5A 1I0ZA 3NKFA 4YJGA 1VL5A 3PXGA 1X77A 2IZ1A 5A4JA 4PPNA 2GTHA 2R45A 3WLJA 3I64A 4FJ0A 3PHLA 3HU3A 3J80S 1N34M 4KWHA 3O73A 1C3XA 3U44A 1ZWKA 4MDFA 4JASB 4B7FA 4KXWA 4EPWA 1K6JA 1H2XA 2A0UA 3VZCA 2FYTA 3TO5A 3KTFA 4IHJA 1AF4A 3O8CA 4BBPA 5G0UA 5I7SA 4Q1EA 1HJPA 5BQXA 3DE7X 3GLFE 4Q3OA 2VHUA 2R66A 1K3UB 2VPIA 5CAEB 1WU7A 2UZ3A 4IQ4A 3TBHA 3DV2A 3TE6A 3GG2A 3OJCA 4OQXA 4E2YA 2Z2XA 4B4KA 1UXHA 1B6RA 2ZZKA 4B3SM 4BU0A 1NJSA 3U7EB 1T3HA 1G5RA 3L0OA 3T4XA 1PQPA 1RACA 1WETA 4CQMB 2FE1A 2PZ8A 3A4MA 3EGIA 3C8ZA 2VBFA 3HHXA 3ILKA 2FXIA 1UK6A 2HWJA 1U6KA 2ANCA 4G37A 5FTJA 1JKIA 5DNWA 4CLXA 4JGIA 2WWWA 4DCVA 1M7GA 3GJZA 3CVYA 3EASA 3IVGA 1ZN2A 3CLUD 1O9HA 3WKDA 2GEDA 4LKRA 5JQGB 1XA0A 2FMUA 4C43A 4P53A 4QECA 1OFUX 3BH0A 3OEHD 2I2XB 2IVFA 1H8ED 1UOQA 4OA8A 1X8XA 1Z26A 1FQWA 3QX8A 3MZ0A 3MWLA 2UUCB 2EOAA 1GDDA 4IDAA 4G5HA 2HMVA 3MRTA 1B4DA 5FV7A 3CLSD 4HWKA 1J90A 2VH5R 1JILA 2XF2A 2CDRA 3MRVA 4XM1A 1S1CA 5C2JB 3C48A 1I1OA 3DVQX 3H2BA 3A1FA 1JTFA 5GJBA 3PJEA 2ZXFA 3MIZA 2X2FA 1AF7A 1RPJA 4MQBA 4RVFA 2PEZA 3EK2A 1FLNA 3O95A 2RGNC 5FOXA 3D43A 4K6HA 2PJUA 4LFBM 4WINA 5ISMA 3ZWDA 3PNPA 4YV2A 1R0ZA 4XI9A 3PUZA 3ROEA 4L8LA 2FPOA 2A5GA 4EHFA 3WHKA 4YVFA 1AZLA 1Y8CA 4NMWA 4BE7B 1N8KA 3EISA 1E7WA 1YR9A 1Z4JA 3N59A 2CXHA 2NZ8A 4O0LA 5B57C 1Z6PA 1NMZA 4EJ0A 1IPHA 5F35A 5H02A 3MELA 1TTEA 1CJMA 3WMWA 1R00A 3DOJA 4ZQIA 3MJEA 3WWOA 4CJXA 1GZ5A 5AO9A 2XWJI 4Y2GA 3VSBA 3KTAA 3HNRA 4MQ4A 2JLCA 1D2CA 1ZR2A 1P75A 3GUUA 1QH1B 4PPQA 2CUZA 1WDTA 2DWPA 2YXLA 1TTTA 8LDHA 5BN4A 1H0KA 4PIVA 4OHKA 1BKDR 2HJHA 4J1NA 4C4XA 4R2XA 5KPJA 1S3IA 2FAXA 2W2LA 1C4WA 3Q3JB 4PS1A 1HETA 1DEOA 3STTA 3T7AA 2FEWB 3GLHE 4GPD1 2Z56A 4BP8A 4JP3A 1THTA 3IS3A 4GX1A 1U2SA 1WDKA 4UBOA 1XA3A 1GPDG 3ILSA 3BRWA 1LS1A 1XWFA 1PKXA 3TXYA 4GEKA 5HPYB 5DB4A 1PJSA 3WJAA 3MWFA 3PEYA 3GG9A 1U5AA 4I99A 3FGOA 1Y3CE 2Q3DA 3ZBTA 1C9NA 3D4PA 4DV7M 2OK8A 1KH2A 5AJZA 3UK7A 1NF9A 1PEKE 3R7WA 1YDFA 3AIMA 3OECA 4KEAA 2WFLA 1Q74A 1TYDE 2HDHA 1E2IA 2C4NA 3A1CA 4YHBA 2PPVA 2PT5A 1ZW1A 4Q1AA 3LF2A 4RPCA 3V9AA 4ZCTA 3DL2A 1RR6A 2YC4C 3QOWA 3I01A 3GLKA 3AUKA 2ZT6A 4LYAA 1HTTA 1BE1A 5IK2A 4BBAA 1XJCA 3B6ZA 4DAEA 1L4HA 2CNLA 3GCWA 2RCNA 4BMOB 3P9RA 1Y5IA 4QDTA 2IW3A 1OXKB 1OPRA 4KP7A 2QPOA 4NNOA 4BVEA 1CYDA 2OV1A 3BJMA 3IMCA 3EZ2A 2ZBPA 1LTKA 3OJWA 3AVVA 2BW0A 4O02B 3LIPA 4NPAA 3NCTA 3UY4A 2RGDA 3RC1A 3IG5A 1X9IA 1U94A 3K0CC 1PEAA 4S0ZA 4YN3A 3LY7A 5BXYA 4CLOB 5ESRA 2I3AA 3RAEC 1EFDN 1IAVA 2FRDA 5CYGA 2WP0A 4RPHA 2VDOB 3ITEA 4B4UA 1U3CA 1F3LA 3BIJA 4Y18A 1NWCA 2HLDD 2DSTA 3PUVA 4H15A 2Z3WA 3Q15C 4WZZA 3UO8B 6Q21A 3KYCB 4B33A 3FSGD 5CBKA 3I09A 4O4JF 4L5CA 1E4EA 3RYHB 1XZNA 2BGTA 3NNDA 3IAAA 3CLKA 2L2QA 3OIGA 3V4FA 2DQYA 2JG3A 2PUWA 4IH1A 2ZI7A 2M6LA 3WFZA 2C5EA 2WOJA 5KYGA 4LJYA 4DQXA 3OPYI 3CH6A 2Y1EA 2JFFA 3SKXA 2VNJA 1P0QA 2E4ZA 4LF4M 4K3UA 5CDSA 4AMYA 1IZYA 3EPKA 1R3UA 4TXNA 3J27B 1EJBA 4NX2A 1MRZA 2NU9B 5DHRA 2JFVA 1M76A 5FLKA 5REQB 4OSPA 4C4AA 4CTJA 4R4JA 3CM0A 1A8PA 3HCWA 1T9ZA 5CEFA 2QL9A 4EY4A 1L5OA 2I6GA 4HNUA 3BWXA 5C34B 1GEEA 4C87A 5BUSA 1QIGA 4H6XA 1XK7A 2OP1A 3MD9A 1ZJ5A 2AJCA 1JFSA 3KQNA 1OBFO 3EYAA 1B23P 3FUCA 4DIBA 4LY9A 4RJTA 3WLQA 3G0GA 5J5AA 2DENA 1UDAA 3UMCA 4M99A 3DOHA 4MQ5A 5I8WA 1J8VA 4MYTA 1FUIA 3ABQB 3QRWA 1WOYA 3J7TA 2IOYA 1VGRA 4X1KB 4CIYA 1JVBA 3F8SA 3OFSA 3C0KA 1BS1A 1J24A 3KDAA 4RV5A 1HGXA 3WMGA 1JG4A 5BVHB 3QLTA 4YWJA 3ZGNA 1QLWA 1ZIXA 2PSJA 5DYWA 1RU3A 4LYGA 5DBGA 2YWCA 3KU1A 1CTQA 2RAUA 2YWBA 3JAKA 2PL1A 5I4IA 1A9RA 4BNHA 1PFVA 8GPBA 2OGUA 1EK5A 3EPPA 3BT7A 5G02A 4D3FA 4WSOA 2AVNA 2UZ4A 3OBIA 5JSYA 3P2YA 2YVLA 1EX7A 1MNQA 4KV7A 3C7AA 4DEYA 1CK4A 1NRJB 4K5QA 1SK8A 3ROPA 3PFHA 1UBCA 4D3XA 2H29A 4EB6B 3SJCA 1L5VA 4HDOB 5BUQA 4UFOA 4X41A 2HDOA 1ZD1A 5E1OA 4MUMA 3P9XA 3C98A 5IMSA 2AZMA 4IQGA 1PQUA 5J2TB 3ZHTA 3DHWC 2WD9A 5IC4A 2W71A 1EM8B 1KEUA 1W29A 3BL5A 3SXUB 3R8FA 2EZTA 3BSYA 3BDIA 1EFHA 4FYXA 4ZCMA 1GD1O 4LRSB 2ZCUA 1TGVA 3T1OA 2PBLA 3LPNA 1PD1A 1B6SA 4K28A 3U7QB 4C7KA 2R751 1B6GA 4DR3B 4GMHA 2AFVA 4JZYA 4YALA 3OLQA 5C7LO 5FD8A 3TB4A 5JI2E 2VCEA 4KLRA 1IUKA 1P2FA 4NENA 2AI2A 2VWGA 2V0NA 4Y2YA 1JMKC 3L7NA 1KBQA 3ZCUA 2JZOA 4JI7B 1YOBA 1W2GA 3X44A 4M6WA 3W2EA 3FB1A 4IPTA 3THXB 1G64A 2QAJA 1Z4IA 5I9SA 4DCMA 3LL4A 4HR7A 4OMDA 5KNBH 5FBVB 1V7PC 3NKVA 1KXJA 3LXUX 3L6DA 1U3WA 1M8PA 2JCBA 2BEVA 2F90A 2FU5C 3INYA 5K6RA 5FX2A 2R8BA 1E2DA 3R7LA 4W6ZA 1XP5A 3L7JA 5LMCA 4JLKA 1RM5A 4IJKA 4M3NA 4UM9D 1NY5A 1NGSA 2P8JA 3L7CA 3OCVA 3TW8A 2W2KA 2MR9A 1ST3A 3F7MA 5KDLA 3HE3A 1L7DA 4L73A 4EJSA 2I67A 4MV5A 4DXHA 3NMUF 4I4TB 2C07A 4DVJA 2HM7A 4A73A 1DFGA 5IJ0B 4B47A 3H5LA 2AD5A 2WHYA 3EZNA 1O8BA 1X1AA 5JD5A 3ZBPA 2AMYA 3BHJA 3JAWB 5A9RA 4HB4A 2QYTA 3HA5A 3UBTA 3G5LA 3ELUA 4R6XA 3TQOA 5JSHA 3WIVA 1TYCA 4LV5B 1JTEA 2WNSA 4PYLA 4J0KA 1FDSA 5D86A 1VGVA 2VATA 1IOVA 4GKAA 1N77A 4MI6A 4C6TA 1A2BA 4ER7A 3LWBA 4MDHA 5LP1A 2JNHA 4F8YA 2QP3A 1B42A 1F3OA 3GT0A 5A7FA 1IVSA 2XOKA 3RPEA 2DWUA 3DUFA 1KBOA 2Q5QA 1I7LA 1G3MA 2W4QA 4WCDA 4OXIA 5FNZA 5E8RA 2ZGVA 2PRSA 5ERXA 3W0LB 1G21E 2O3RA 4BMDA 3SR4A 3GDGA 4P32A 1CUXA 4YHHM 4MV1A 3LBHA 4B3RB 5IKXA 2VZEA 1DHTA 1JQEA 5LKAA 3IKVA 1W30A 3AF1A 3K0FA 3HDVA 3W7VA 1UXJA 4ZAVA 3WZMA 2QORA 1U1GA 1DCKA 3I39X 2QY9A 1C30B 5HIMA 2NW6A 4OHPA 1R7RA 3QIAA 5EIXA 3T0IA 1JH9A 2YRXA 4HDSB 4E12A 4ZYVA 1BROA 3KE9A 4XGIA 3JWIA 4HLQA 1YQWA 3QVWA 1I14A 4Q3DA 4E94A 2BLNA 4QASA 2XTAA 3HB4X 3AEQA 721PA 1W7AA 4QJBA 1UT8A 4I2VA 4M22A 1XMIA 2QN1A 2Q8NA 3LUPA 1IN6A 3B9RA 1XCJA 4YIKA 4OI1A 3FWYA 1YJ8A 4U9IS 2L69A 2WBLC 3NHRA 4G4SP 4YH1A 5EEHA 5G4KB 4LNUB 2FE8A 3BRCA 2EC5A 3IMGA 1TL7C 3EF1A 4HHEA 4RXMA 2CLCX 2PV7A 1R9NA 4MR7A 1F4LA 1TC2A 3NIBA 2G07A 2R8XA 4X1IA 3RAFC 5C4IA 4PYJA 1P7CA 4YO8A 1SBZA 2K6GA 1KS2A 3TNDA 3OU2A 3KHTA 2V6ZM 2C5HA 7GPBA 3VKFA 4KFCA 4Z0TA 2YVQA 3L49A 5G1OA 1FP4A 3O21A 1P5JA 5FAKA 4DV4B 3FCSB 3QFSA 4Y1RA 1ULAA 4PQRA 3CLUC 2O2JA 3M70A 1A9ZA 4URYR 1NC3A 5CPFA 4DMRA 2B69A 2BRUC 2DR3A 2WKQA 5DTIA 1NW7A 1KY2A 1MA3A 1XZMA 4Q4AA 2C7PA 4JYPA 3C16C 4PS0A 1ADBA 4WOBA 3ZD9A 1CBUA 1QIIA 5ARCA 4JQYA 1PJZA 5B37A 3ANTA 4NSRA 1K75A 2A88A 1L4NA 4E21A 5IZ4A 3W90A 4CEJA 1DSSG 2VTDA 4NH0A 2OA0A 5AYVA 2ZWPA 3RGWS 3CLSC 3STUA 4CF6A 1KSFX 1FX0A 5ARBA 4WNCA 4IIYA 4OJMX 1O87A 3KZOA 3WADA 3AB3A 1N7HA 3ICCA 3IB3A 4YWHA 5CB0A 5G4LA 2BFAA 4IYJA 1XQ9A 3SDZA 4B4OA 3O2NA 2I1QA 2QUJA 2XDQA 4BLPA 4OHBA 1ORWA 1YCFA 4RF2A 3WK9A 3DBLB 2JASA 2GPNA 1A4RA 3I2YX 1PL8A 3USES 4J7CA 1L0BA 2MIIA 3IHKA 3N75A 4D9HA 4V24A 4D3ZA 3ISVA 1SXJE 2AG0A 4FE7A 4QBTA 3IHTA 3QWAA 3V8BA 4JC0A 2DUUA 5CURA 2JUJA 4I14A 3AR6A 2OQ2A 4L9AA 2WTUA 2O8FB 1FFCA 1Y63A 5BWOA 3F7OA 1E1LA 4Y2VA 3U40A 2WRZA 1LBSA 4M0WA 3PK0A 5DCWA 1XVIA 2W2LD 1WPXA 2QHOB 4LMRA 5GOZA 2VF2A 5LLTA 3BHIA 3H3JA 3DZFA 3ZJVA 5AXDA 3QVTA 4AG3A 2ZRQA 3N0XA 4FPXA 1QFYA 4YAJA 2FWRA 3L4SO 1ESNA 4CKBA 1YB5A 5BPFA 4INOA 4BFSA 3BRWD 1Z16A 5MFPA 3GPDG 3ZGYA 4BNDA 2IXEA 2VT3A 4ITUA 4YMWA 4DQLA 4CWAA 2FF7A 1UFQA 3MCUA 4JQSA 3T4EA 1HZZA 4P3NA 1D04A 4IJUA 4L85A 1A2OA 2X22A 4TWJA 1JLLA 4WOKA 2FJPA 2W82A 1X7XB 4BNZA 1U5CA 1RRFA 2W0SA 2C1XA 4F4CA 4IIWA 5EG5A 4X6YA 1QYVA 1RWOA 1FDTA 1Y1TA 1W9HA 1JQBA 4RWZA 5DTRA 4MICA 1XMVA 2GBLA 2NNWB 4DV6M 1P1CA 1UJBA 1CFZA 5IK2D 3MERA 3VX3A 3AUUA 5JV5A 2RGYA 1I3LA 3THYB 3OE5A 3KFXA 1N2ZA 1GCUA 2XE8A 1MOPA 3JQGA 2DAEA 1GPLA 3S2YA 2P5YA 3C5HA 1B26A 1E2JA 4IXTA 2DBQA 2HMUA 2HWWA 1RJEA 3E4DA 4US1R 4DV2B 2CMHA 3QGMA 4WX2B 2G4LA 1JG3A 3DB1A 4ERNA 1AGNA 5D85A 1BCSA 3NM5A 4IZIA 4DG9A 1NXTA 1E0DA 3D3NA 2QIPA 4PCVA 5LJIA 3HJHA 3I2GA 4XBOA 4L4YA 5B7GA 4NG4A 3SIRA 4EMBA 2VDQB 2WINI 4F38A 2V7GA 4AF6A 3ANSA 4P2GA 5F7ZA 5BURA 4P0QB 1CQIA 4ZHQA 4TS4A 1W0CA 4F96A 1Z15A 2IIQA 1GEGA 2VSYA 2XD4A 1RRKA 1Y81A 2YJ3A 2REQA 4CG1A 1NLFA 4B34A 3E8XA 2FW8A 4ZWNA 5LMZA 3EVTA 4DSTA 2PAAA 5DDIP 1QVAA 1USVA 3MPUA 4PF1A 3GQBB 2PUBA 1QWOA 3BXEA 5HJ5A 2KS6A 4FOSA 4FCWA 1WXWA 4N5LA 5IZ7D 4P92A 1RWNA 2J45A 3FHOA 4UHKA 4GLJA 3KOXE 3JATB 4KWEA 2BJWA 4MVJG 2Z6AA 5K2MA 5TR9A 2V74B 3QH4A 4LXUA 4HMPA 4WK0B 1Y4DE 2ZJBA 4ZVUA 4X7BA 5BN5B 1CHNA 4ZALA 5JAMA 3UVEA 5E7MA 5KNCH 2DFVA 1WTAA 4RF0A 2X1VA 4CN9A 5EESA 3DVAA 3KEQA 4YXWA 1CSEE 5TPZA 1EZ4A 1MEOA 2BE9A 2XMPA 5HF5A 2PMEA 4BNTA 5TF4A 4QXRA 3B7NA 3FMIA 1E6CA 4D6PA 3A9VA 5KNDA 1BHQ1 1WDMA 3EQ9A 2NVUA 2D1FA 1JDUA 4J1QA 3N7AA 1P5ZB 5FUYA 1KK2A 7AT1A 2DC1A 2EFYA 4PZPA 2PIAA 2DI0A 1GAQA 1WTCA 2JFBA 1XD9A 3AJRA 3FYCA 2NPOA 4PPGA 1PT8A 3RDPA 2LV8A 3UC5A 2PKRA 3P5BA 1HL7A 2QD2A 2ZUWA 3TG8A 2YHIB 4KRFA 1OFUA 3QX9A 2WE7A 2EJBA 5BSEA 4WWHA 3DOEA 4CV0A 2VWQA 5C1DA 2NU7A 3FMVA 4G09A 2O8NA 3LBIA 1GUAA 2BT4A 4OA5A 2EFHB 5ALHA 1PDOA 5AOCA 4ENTA 4D9JA 1OB5A 1EQAA 4R01A 1L7MA 4E6EA 4O4LF 5FLXA 4RHCA 4RJIA 4UHBA 5LZ5A 2FZGA 1OYVA 2G1UA 4AL4A 4XAQA 4I1RA 2ONZA 1G4AE 3LECA 4X45A 3CQ9A 2MTBA 3UOGA 2FNAA 4BJ6A 1ZW6A 2H7XA 3ECCA 1GR0A 2JY7A 4K0KB 2WPDA 2ZJ1A 5I9MA 4HGRA 4G1CA 3L0ZA 3JWHA 1PR5A 1AY0A 3GVHA 4IIXA 1NF2A 4RA9B 2D2EA 3WJ1A 3R3JA 5LBUA 1E1KA 4X9XA 4RM3A 4MGIE 1HT3A 1X7DA 2C42A 1GRRA 2J9XB 1B8VA 1DWPA 2NIPA 2FI1A 4F3CA 5K0LA 5DPMA 3EMDA 4DG5A 5DASA 2B36A 3TQHA 3F4KA 2Q1YA 4G0NA 5CA0B 3I6YA 4GEGA 1VJDA 5HRCA 1LDYA 2FFBA 3NYIA 1HDZA 4QUKA 5COBA 3KP1A 1R0KA 1QGUB 4G8CA 4TN1A 2MSCB 5DM0A 5IFLA 4J1TA 2WAAA 5LBIA 2LTAA 4AKGA 2R1UA 1ZISA 4DAOA 3ZY3A 3Q87B 3BXWA 1R4MA 4PLFA 5ER9A 4RELA 3UJ7A 5DT9A 4C6HA 1KY4A 2LCFA 4RTQA 3DOCA 4UZEA 5BW8A 1KSJA 2PL3A 3W4JA 3SY8A 4XUDA 5CD1A 1QYRA 2W70A 5LXTB 4YQYA 1PW5A 4B8YA 2E0IA 1HNWB 1ZCZA 3L7KA 4KH0A 3QJYA 1F60A 2BHNA 4F1JA 3R76A 1LLFA 1FSGA 5TV2A 3H6KA 1CU1A 4W9MC 2SCUB 1SK9A 2GBIA 3A9CA 4QTTB 3L7YA 5AI4A 5JD3A 2R1VB 2OD2A 1O2DA 5DHSA 4QTXA 3D6NB 4BTLA 3UC9A 1RRVA 5DBHX 4EUNA 2CLSA 4WBNA 5LWQA 2FEAA 3HXLA 3EXEB 1OAOA 3CSDA 4EHAA 4FYIA 3M4XA 3P97A 2XOKD 3NC4A 1OQAA 4B6PA 1AUAA 1PTKA 3ADDA 2ZM6B 2AKAB 2BY4A 4ZFNA 1BDHA 1IUNA 2XUGA 2X4DA 2LVOC 2H9AA 2J5RA 2IXGA 3IP9A 3FBTA 4MYUA 3H2SA 2HRDA 1AK1A 2B8EA 3SK0A 4F5EA 5IUNC 1PZFA 3FI0A 3FLEA 3JD2A 3UXMA 3THRA 4XUEA 1VG9B 2X4LA 3GJ3A 3PFIA 3DWIA 2R44A 4KLCA 5AI5A 3AF3A 5BYAA 2E4AA 2CSUA 1RFGE 4L6AA 1E6UA 1Z8FA 2HCJB 5I4CA 2O3TA 2ASEA 1QRUA 5CYFA 4EDFA 3MMZA 2A58A 3H84A 4CQLA 4OY3A 2EL9A 3L0PA 1RM4A 3DKKA 3FVQA 2B7CA 3OZXA 1I1NA 2HEGA 4LF8M 2YV5A 4Y30A 4M8SA 3A11A 2J4FA 4I1YA 1M5RA 2XDWA 3ORYA 5K8VA 1W85A 1OX6A 2BHRA 3VKUA 3B3JA 2R6GA 5M2QA 4UHCA 2D7EA 5PNTA 2WAXA 1ODIA 2NXWA 1VA4A 2E5LB 4CCAA 2DAKA 2FPIA 3VZRA 5TPWB 3INTA 2IQ5A 4DA6A 4GP7A 3BHMA 5EVJA 4JAVC 1TQ2A 2RHOA 2FRXA 3LCMA 3RRZA 2A5JA 2CFIA 4V0KA 3HHZA 1LSSA 1CUJA 4X00A 1AMNA 3SQMA 1N78A 3FHLA 2FZWA 2VDNB 4JVLA 3VDRA 3I45A 3FWHA 5FR2A 2C5SA 2PMBA 1TC1A 4JC4A 5KYXA 4HS9A 4XSHA 4BMSA 3LC1O 2HF9A 4Q39A 3KZXA 1NBHA 1PFWA 4DLBA 2L18A 4BO7A 3V8NA 4XSGA 5BV0A 2C97A 4LFAM 1N2CB 3EFHA 3SIXA 4EM6A 4XJSA 4P4SB 1UJ6A 3Q5DA 4G84A 2PTGA 4W8OA 4O3MA 5AK5A 2QCUA 1HY3A 1CR0A 2ZETA 4L51A 3UAWA 2P1ZA 3G8AA 3IUBA 2REXB 1EVKA 3INRA 4U7PB 2EEPA 2J3MA 4H08A 2FV8A 1C1DB 3GNQA 1X42A 1XSEA 3U49A 4YS6A 5I7EA 2ZG6A 1BQ3A 2CVQA 4U1RA 4QUBA 2VJPA 2QTBA 2J9RA 3S3TA 4CTOA 3NG1A 4I1IA 1TAGA 1BDBA 3F0TA 4EW1A 2J6CA 2VF7A 1QIDA 3L8FA 1KOLA 1DAMA 4TLCA 1XTIA 1V1RB 4J49A 1EWRA 5D87A 3ECSA 1THZA 3NOXA 4B71A 1W8DA 3TMYA 3ZHYA 2B9VA 4F1KA 2NM0A 2G9QA 2WQ7A 1MPXA 3U7FB 4Z6KA 1II9A 3WLTA 1FRQA 3FYDA 3EGCA 2LVPC 4P3KA 4TKUB 1Q39A 2JFWA 5HZGA 2Y76A 5K3EA 4M7OA 5E4YA 1I1HA 3ZU6A 4ARBA 3ZWMA 1WZUA 1LLCA 3O8OB 2PM8A 4AX4A 2WWFA 3TGLA 3BL6A 2DP4E 5H0IA 4F6RB 4ZDWA 1NNEA 3SMVA 1UIMA 3I5UA 4U0KA 1CLEA 1ONPA 1PKEA 1USKA 2R5WA 2CLIB 4M8NE 3GP5A 3V4PB 4FGSA 2Y66A 3UK0A 3TZKA 4BVBA 3C1UA 3T7DA 1FNCA 1USGA 3FSJX 3COPA 2IWRA 4HAIA 3BPSA 3B1JA 2HF7A 1ZD2P 3QYEA 2P4EA 1PTJA 2VT7A 4JSRA 3BFPA 5DK4A 1RXUA 3FW1A 4H7DA 3L8YA 3FM9A 1UOPA 4CDNA 1U02A 1IG3A 4UUNA 2CXRA 3FPJA 1IBKM 3SYKA 4FW9A 4XKJA 4GWLA 2RGHA 2DFLA 3Q8MA 5DMHA 2QG4A 3IE0A 2DH6A 3JVIA 3M6MD 4TMWA 1G8SA 1NHGA 1QU3A 3P0RA 2EZ8A 2EJUA 5ES3A 2QMOA 4MYCA 4DWJA 1EP1B 5IAAA 5EJ8A 4YP5A 3QPCA 4WCVA 3RSOA 5JO9A 3LRPA 3FPBA 4TPKA 2P2ZA 5KYWA 1AUXA 4RF5A 1E9CA 4O4LA 3DMHA 3HZOA 5K3OA 3H9BA 3TKLA 2BUAA 3SLRA 3DW1X 1H2FA 4AJEA 3EH1A 5TT1A 3C6XA 2AG1A 5E0KB 1WF3A 3AXSA 3GLIE 3UJCA 2V9PA 4B3XA 4NRDA 1SU8A 1L7QA 1EJ0A 3UHPA 2XJ9A 1EVYA 1AU9A 1SXHA 4CLHA 3KB8A 2YOGA 3BSWA 1T0UA 5BN1A 3DVSX 3PUIA 3IP5A 1OA0A 2APLA 1V37A 4I8OA 3KHUA 3M6AA 4ZC1A 2J0VA 3Q8XB 1IQPA 1VRWA 1BJTA 2GSDA 4O25A 3EW9A 3A42A 3HKCA 2JH8A 1S7CA 1KVTA 2ZRGA 1TPYA 3VSDA 5I7UA 1IDOA 4RZUA 4ARCA 2DQ4A 4NJMA 5KWSA 1M0SA 2CP8A 2W2MA 3WFJA 3V7FA 3DBRB 4EGAA 3BXOA 2ZTUA 2GRJA 2OVFA 1AT1A 4D9EA 5GGXA 1BKYA 1QMPA 4FYYA 2WM8A 4TS9A 4XA8A 4E3WA 2G83A 1GTSA 2I6QA 5FSWA 1QF9A 3TWOA 4IWYA 2V55B 4GMXA 1C5KA 2CKMA 4P1ZA 4G26A 4M4SA 3A27A 4RIFA 4BAUA 1APBA 1EFPA 3KB1A 4DGSA 4G4QA 4Z2YA 1YIOA 3OY2A 3G6WA 1GSOA 5DN9A 5E9AA 1OLXB 2PJDA 3KELA 1FTYA 1UZNA 2VPXA 4YXWD 1CY0A 5IPFA 5TPZD 3BMQB 1YBMA 2E6KA 1GTG1 1LH0A 1JIIA 2IUYA 1GVNB 1SC9A 4HNAA 2JW5A 2JFZA 1UWVA 1HXHA 1DKLA 1O54A 3IKJA 3HB1A 3H19A 5FB3A 1ZH0A 1G0OA 1UT5A 5KNDD 4OUDB 2JA1A 3CX3A 1DXHA 5GJWC 3ZE1B 2HBQA 4XIGS 2EHJA 3UPDA 1IC6A 5FLYA 2G82A 1F5NA 4AVYA 1HF3A 4P3XA 1QQ7A 4NYJQ 5HF8A 1HRKA 1JI0A 1WRBA 3GLTA 2QAGA 4S1OA 3ZWNA 5IN4A 1U0JA 3PNKA 2ZS8A 1FFXA 1QQBA 2WHXA 3NH9A 1O9GA 4PD2A 1KYIA 3WQHA 5KYUB 1JHOA 3B52X 3ESXA 1GUBA 4DSOA 3GDHA 1JSCA 1HQYE 2W8BB 5ITZB 4U9HS 4Y2UA 2OXTA 1KAMA 1E5QA 3KV3O 5ECDA 4QU5A 5LQAA 1OZFA 10MHA 3IULA 4HDNB 1KRHA 5ITSA 5DX1A 1J5EM 2FQ1A 3AEKB 2ZM5A 1DMRA 3SF8B 4K9DA 3IIJA 3OPNA 3ND6A 4Q47A 1TJYA 5CM9C 1ZRSA 3UZUA 3Q5EA 1VE7A 3FDJA 2ILTA 1S2DA 4YQZA 1RIFA 3KEMA 4UEJA 4BZWA 4DV0B 3ENVA 2AOWA 1X39A 3PRHA 2KW0A 1E8NA 4PRLA 4NULA 1MTZA 2EZ9A 4AYTA 2B20A 1LDBA 2JLVA 2XRZA 4S1TA 1LJ8A 4IG4A 2UUBM 4NQRA 2FPUA 4LG2A 1YJ5A 2F3TA 3DE4X 3OQOA 1NY6A 1A5ZA 1TW3A 2WPDD 2JKVA 1SHUX 1AOXA 1CUSA 4ZKDA 4S05A 3ANMA 4F6CA 3QUTA 4BKRA 1H9CA 1L4EA 2NSHA 5IHXA 3ML1A 2QTWB 3EMKA 3LGXA 4M1SA 1M1YA 4MGKR 5JT1A 1MKYA 4ER0A 4JU8A 3T54A 2JD0A 4NOLA 3QKUA 1E77A 4A1OA 3RKUA 5IP5A 3BE5A 1P2UA 1TQ4A 3FB4A 4TMKA 5CX1B 4OJKA 4WK2B 2QMHA 1KYWA 5HGXA 3LQ1A 4OYHA 3NYRA 1JQLB 5DGDA 3ME5A 3I0ZA 1QHYA 1MAAA 3TZEA 1I5RA 1YCDA 2XUJA 3KHSA 3LOUA 4M9SA 1NE7A 3E18A 3L6BA 2HSWA 4X5OA 3FWKA 2IYFA 1PFYA 2BP7A 4XX0A 2UYYA 4KBGA 4A8TA 4E0BA 3SQLA 5K7SA 4GRIA 4TSFD 1AN9A 4HNHA 2MSNA 4R16A 3QE3A 2Y6UA 4UCFA 3U5ZB 4P35A 1J0XO 2NVWA 2C9CA 3RF6A 2VQDA 1RPZA 5K0TA 3M7GA 3KSXA 3CKLA 1QR6A 4X93A 3QY0A 3R6LA 1P5HA 1V26A 1VIMA 2IV3A 4AS3A 3V97A 1KMHA 2VO1A 2CDCA 4P33A 1E2NA 4IW3B 4R1MA 4OSEA 4L08A 4MW7A 1UWLA 3OOWA 4LHSA 1VG8A 1COWA 3U16A 5IDVA 4KO3S 2GMWA 1GV0A 4LZZA 3RC8A 5L7TA 4AUEA 3SS9X 2A4MA 3GH3A 1TEVA 3PX2A 1P72A 3WOVA 4FMBB 5IASA 1B1AA 2GN0A 1WPQA 1EEHA 3NDJA 3F92A 4RMGA 3HSSA 3A3KA 3F8WA 1OV6A 2XCSB 3L0BA 1DAPA 2M9MA 2I80A 3X1ZA 4GBJA 4Y2TA 2CE2X 3GY0A 2GX6A 2CNBA 4R2LA 3RC7A 1R2ZA 3SAVA 3LL7A 3JQ8A 2XMRA 2ZJ7A 5EMNA 4MWGA 2FPPA 2W00A 3LLVA 2ZAOA 2ZPAA 5GQSA 1YA6A 1YNOA 4HZIA 4X65B 4BQOA 1HMYA 2Q50A 3FG9A 3EY4A 3QOYA 4OX9Y 3VBEA 3T9EA 3KHKA 1K6IA 3UAGA 3E03A 1UDWA 3B2EA 5B55A 4Z0NA 4KIWA 2JHPA 3HFJA 3N74A 5JHHB 4IJQA 2QD3A 4M0DA 1EUDB 3UJHA 3QKTA 5JUWA 1P91A 2J4CA 1L5HA 5A4DA 3WBBA 2OFXA 1NVMB 4EVSA 2FOIC 3T0GA 3BZBA 1MQ8B 3SGLA 4K9RA 2IOHA 1LNQA 2Y67A 4ZOQI 4QGFA 1G3UA 3PA8A 1CZLA 4BPRA 4BL5A 3H86A 2PZMA 3F46A 3DKRA 2PS1A 3LBYA 3NDPA 5CDFA 5FTKA 3ZDXB 4XTRA 3BZWA 3TTWA 1VLQA 5ICFA 1KH3A 5FV4A 2R7KA 5CGZA 2CV0A 3SQXA 3B6EA 1ACMA 4GKKB 4ZV7A 2QTHA 2WM9B 1RFLA 3GC6A 3GA7A 5CH5A 3K1AA 1E59A 5K6AA 2CDBA 3KZCA 1SA0A 2EX1A 3L18A 2LUOA 2RONA 4A16A 4PICA 4B3MB 5D3QA 2GETA 1ONSA 2WKWA 2BM8A 4NWIA 1R0LA 3UH1A 3IAXA 3RR2A 5C52B 1TDHA 2BEVB 1JJAA 1R8XA 3DLPX 5BXQC 3AL2A 1M8JA 2X58A 3HMQA 1EFLA 3DQQA 2AWOA 4MRPA 4AZ3B 1I7QB 2D62A 1SU7A 3D7KA 1JBQA 2PWBA 3VYTB 4NCHA 3ZVNA 1K7SN 3HDTA 3N2YA 2PKYX 1GKUB 3VPSA 2HT1A 3UUWA 1J6UA 3W34A 2BWBA 4AI6A 3IAEA 4IBKA 3E7PA 2H1WA 2W2KB 1F20A 2HMWA 4ZVOA 4AP6A 3RUEA 2QT1A 3BE6A 1DIOB 4DJDC 4PAMA 1U8TA 3GMSA 4ZEXA 3ZY2A 4QOIA 4DLRA 4F9GA 2PKQP 4PRZA 3QSYA 3QWBA 4YRNA 1YR6A 1GCAA 4KGDA 5A5GA 3P0FA 3JPWA 3W78A 3HVHA 4JI3B 4V1CB 3AERB 1U9CA 1N1DA 5DBFA 3KZ1E 5K45A 2JAHA 3DJFA 2CDAA 4TRNA 3VPHA 4LZNA 1GNRA 1XL0A 2YFHA 4CT5A 4TS3A 2JH9A 5MN6A 2OYCA 3W06A 1BAPA 3MFQA 3PC8C 3VISA 3GK3A 2RGWA 1HFJA 4AZWA 4ZQCB 4GMFA 1W76A 4ZCIA 4DR2B 5ED4A 1N0WA 4M46A 1TJ4A 4BCBA 1EG7A 5BPVA 1D4OA 2FQYA 4RSMA 5CTJA 1P60A 5F1KA 2BGKA 2WFZA 3EEQA 2LCQA 2DCMA 3JYHA 4OHXA 3AHJA 1C2YA 1POWA 1F2TB 3PL1A 1ZOOA 4M0EA 2E4YA 3VK8A 1ODKA 2WVJA 4FW8A 1AKYA 2YIMA 4PWYA 4M0MA 1E2LA 5DGXA 1HT0A 2ZSEA 2ODNA 3ESRA 5J4VA 1C3LA 2WG1A 3K0FB 3AKYA 3C41J 4PTZA 1T1GA 3K96A 4NDNE 1J8QA 1SB9A 1BOFA 2DHQA 4DBVO 2OBFA 3UTCA 1IATA 4PO8A 3IEKA 1LVUA 5AJTA 3IR7A 4RTSA 4BEJA 3SQNA 5IC6A 4J29A 4DIOA 2XB6A 1JIKA 4HZUB 3P9ZA 3HFRA 3VC2A 2GGSA 4ZO7A 3G88A 1N3LA 3I5YA 4ZHQF 4JIMA 4Z8YA 5KNLA 3KQWA 4N01A 1H6CA 2RRUA 2W37A 4OM8A 2A9FA 5F3WA 3VR1A 1H93A 1MUUA 1E1NA 2ZUCA 3CSSA 1X1TA 4UU7A 4D99A 4LY0A 3C58A 1MR3F 3GMIA 5IJWA 3CRNA 4EY5A 6LDHA 5JS8A 4JROA 1CIPA 4A8HA 2BCJQ 1T4GA 3IAHA 3M4NA 4P0PB 3I2KA 5T64A 1RM3A 2YCLA 4OJTA 3H8JA 3SZGA 4TMZA 2X5NA 5C37A 2FETA 4C78A 4G6ZA 2GB4A 3D64A 1I3CA 2ABWA 3MMXA 1N5JA 2Q6VA 5FPHA 3TLGA 4HRXA 1KKUA 3PTZA 4J3FA 5A5VA 3CRQA 4EI9A 1PSZA 1GQ2A 2QNJA 1ENPA 5I4KA 3UGKA 4Y1RB 4EA7A 4MR8A 2WJ3A 4HGZA 4LDQA 2C1EA 3LWZA 3AWIA 1XZAA 3CIOA 3EVZA 3TLYA 4O4JB 2O6LA 3KXLA 1JE0A 1TO1E 4YRGA 2H7CA 2VTBB 5A4AA 3KSUA 2CFOA 2PT7A 4NF2A 3K92A 4D9GA 1V41E 4NE2A 1PGJA 5LNK1 2V9ZA 4G9BA 3H6HA 2GJ9A 5HCNA 2GQFA 1YZNA 4BFXA 3WLPA 1CR1A 5F2EA 6NULA 3KFLA 3X3HA 4DZTA 1QPBA 4GMQA 3UM9A 4S0XA 4DV5B 4WV3A 4TUWA 4L0QA 1W25A 3CEHA 1UK7A 3AFMA 5I9NA 2A0YA 1Z06A 1C1XB 1N3YA 2Z1DA 1UANA 4IDPA 3LI2A 3BD9A 5CITA 3MUEA 1TU3A 1JS1X 1KE1A 3Q3IA 3TKYA 1R4GA 2NUTA 3M33A 1RTTA 1TRKA 1OBHA 2IE0A 2OCXA 5TEVA 2I9PA 1V7CA 2ZXEA 2ONYA 3VNQA 2XJ4A 5K0EA 4EP1A 3LFTA 2FFHA 4D0LB 1O1YA 5I47A 5B6PA 4MO2A 1OI2A 1HQCA 5JFGA 2BWJA 3AFOA 3CUEF 3WP1B 4P4UA 1E92A 1S8FA 1XRRA 5HKKA 3QYFA 4CM3A 1GQQA 1XZIA 1ULTA 3FCYA 5LKRA 4HNVA 2J6IA 3TLBA 3ZTWA 3OIWA 4HEHA 4KYUA 5DH9A 5D2CA 4DR4M 3NM6B 5D5HA 1UQUA 3NBUA 2MSEB 1ZIPA 1JLLB 2JI9A 5JO0A 4IG9A 1PGQA 3HPRA 1A5TA 2CW5A 2B1IA 3FYSA 4M88A 2WI8A 4IZOA 2DE0X 2R8OA 4IZ6A 3SJZA 5JJCA 3H9GA 1T8YA 2WB2A 1GU0A 4LAFA 1EEXB 3IQFA 3VDPA 1MA0A 5EUBA 5KBYA 2AFHA 1EQ2A 1PN3A 3PEEA 1ZZEA 3T3OA 4IL5A 3I9MA 4WOPA 1OGIA 5MHTA 2I2DA 4CKWB 3QJGA 3SG0A 2R2GA 2GBPA 3ZE0B 4L4RA 5HBRA 1MEEA 4HQ0A 2O1XA 3WWDA 3NAMA 1OWMA 1XROA 4MGZE 2VDMB 2HU2A 1L7EA 5EPOA 3CWQA 4IDBA 4RQUA 3SU8A 4UM7A 2WZQA 2ZRKA 4X64B 1P1BA 1LNZA 4EQ6B 3D81A 5T57A 4QU0A 3ANLA 5HZHA 2ZREA 1F6DA 4IS2A 4D4HA 1MJ5A 1A9XB 1RC8A 3ADCA 2K6BA 2O2XA 4J4HA 4GPZA 3H5AA 4PSUA 3DEZA 4EKNB 1XWWA 5MGNA 5K3DA 5AJYA 4QM7A 4GWGA 1V6SA 1EBFA 4F3NA 3OPYA 4TTAA 1S89A 5EKTA 5EAIA 1G20E 4TOIA 4HO1X 1G7SA 5E6RA 3JQFA 2G0NA 5ADWA 3O93A 5ALJA 3PQDA 1W44A 5EKSA 1SURA 2DKFA 2JLUA 1AHHA 4G0XA 4QUAA 4E1AA 2I99A 1IWBB 3GGGA 4FILA 1V16B 4DLKA 4R3DA 3Q9LA 1D6JA 4BN4A 2V4MA 4ICIA 3PPYA 4WBNF 5HRUA 5F98A 2AC7A 4FFBB 2ZTLA 4A2CA 1OBOA 1CF9A 1ZR4A 3UEOA 5BRJA 2JIQA 3U31A 4R8MA 3AYZB 1COWD 3K09A 3ZH9B 1YZHA 2R8RA 2D5BA 3DCYA 2I1VB 1QXSA 5EIHA 3OZEA 2QTAA 1E0JA 3ZGVA 2MSLA 1X7YA 1XZBA 2ODTX 3MS4A 3KAJA 3D6AA 3MT9A 3DEKA 4KWTA 1B0AA 3D3WA 2ONJA 2XLJA 3B5IA 1HNXB 3S2SA 4E46A 4PAOA 3DVAB 2CXUA 4TVBA 1FDUA 4YP1A 4IWNA 1Z5CA 3TAXA 2D7DA 3I4VA 3H3XA 3TB6A 4TX1A 1GSAA 3A2MA 4J0EA 4YRKA 5A0FA 1AKTA 2QSUA 3BAZA 5HILA 1U2EA 3GWZA 1C14A 3G82C 3QXXA 1QDEA 2O7VA 2NVUB 4WADA 3AF5A 3LLSA 2V0CA 4JP1A 1YAHA 2FX3A 2C5BA 3A28A 4O33A 2Z98A 2JY6B 5IJZA 5I3ZA 3T5DA 2I3GA 4HYTA 2Q46A 2ZKLA 4BNIA 5CLQA 1PO7A 4OB7A 1DEXA 4Z9YA 1N5IA 3WB2A 4F92B 5ICCA 3DE1X 5JWHA 5D7BA 2V59A 4QDKA 1MU5A 1SULA 1IM2A 2Y8EA 4AJJA 3D8NA 3MTQA 2FZ4A 1D0SA 3PXDA 5KWVA 1Q19A 2XUDA 3UXEA 2B99A 1MO3A 2IIBA 5K3SA 5JALA 1DTWA 2DBVO 4NNPA 3SSNA 1NX9A 3O26A 1J2JA 2OOSA 4YMHA 1M54A 4PSDA 4XWWA 1US8B 2K4MA 3TSAA 3KQVA 2FZCA 1K0FA 1E1MA 1K3FA 1LPNA 1ULUA 4TRRA 4AD8A 5AM1A 1I2AA 3D54D 2QUZA 3NWPA 4IXDA 3KQOA 4FEGA 2UUOA 4WE3A 3QOXA 4WASA 3QSGA 3RI3A 3TH5A 5IXSA 3C5WP 4Q4JB 2OG2A 5A3RA 5SY9A 3HSKA 3IIKA 5JYEA 2IHBA 2F2TA 3GAAA 5MFZA 3TL6A 3ED5A 3ZWBA 2PS9A 2ISCA 4FDVA 3QU7A 1Z88A 1NV9A 2H59A