2D7EA

Crystal structure of n-terminal domain of pria from e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 18
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7eA01
4NL4H 2D7EA 2DWNA 2D7HA 2D7GA 2DWLA 2DWMA
chains in the Genus database with same CATH superfamily
1E32A 1NVMA 3E46A 3QYBA 3LVVA 4LF4M 3RGSA 5EXTA 1NNUC 1QYRA 2OO9A 2DWZB 4DR7M 1MN3A 2KNAA 2LVQD 2O5RA 4GKKM 3U6CA 3E4RA 4GHLA 1T43A 2LVAA 3IG5A 3Q8XA 4IBBA 1DGFA 1ZMWA 1MJGM 2APLA 4L8RC 2Y0QA 4IBCA 2R4JA 1QAQA 1XXHA 1QAOA 1YE9A 1IN4A 4MGYE 4X64M 4Z6YA 2L7HA 3GLHB 2L7IA 4LRSA 5KQDA 2F5NA 4UN2B 2DWMA 2UU9M 1Q3CA 1HNXM 4JI7M 4LFBM 4X66M 1E9SA 5FLXS 1WHCA 4DV4M 1DV0A 2L09A 3KOWE 3UK6A 5EP4A 5KO3A 1XXHE 4L6V6 1LTMA 2JWSA 2LVPC 4DR2M 3SAWA 2VF7A 1EE8A 3U61B 3D8LA 3IECA 4AG6A 3THGA 1ZMVA 3KOZE 2VDBB 2YFQA 3MJ5A 3JR5A 4LF9M 1QUSA 1DO0A 3PFIA 2R4EA 3GRRA 1TDZA 4DBGB 2CP8A 3CGWA 4MB7A 1Q39A 2M60A 3L25A 2QNJA 2F5PA 3B9PA 1GL7A 3QWLA 1N33M 3J2PB 5F3WA 3PNYA 1J5EM 1GLNA 3FTFA 3I01M 4BLCA 1ZMUA 2UXCM 4DR3M 2FOIC 3GQ5A 4AKHA 3KVWA 3VLFB 1VG5A 2I7PA 2NQ8C 3D8BA 3GLHA 1IXZA 2M5ZA 3TQSA 2CEAA 1IQPA 1E9RA 2QHOB 1KYIA 2JY7A 5E26A 3LQQA 3KP1E 4G4NA 2UUBM 1GL6A 3HHXA 2DZNB 1Z5AA 2L2DA 3AOGA 1L2CA 4IBGA 2KW0A 5KPTA 4G6ZA 4IBFA 3HJ8A 4MH0E 2EKKA 4RNAA 4I81A 4MGHA 5LMNM 1HT2E 3GLIB 4LZZA 1NO1A 2Z4SA 3NWLA 1NV8A 4HEOA 4HL4A 2C9OA 4GC9A 5FTMA 3GLHE 3SYLA 1IY2A 1QZEA 1IXSB 2HCBA 2R6FA 3HU1A 4DV5M 3U61A 3C3DA 2QP9X 2X8AA 4EIWA 2LVOC 1SXJD 3GP1A 5ITUA 1ZQ9A 2LHGA 1Z59A 1KFVA 1W5TA 2MGWA 2WSFF 1TDHA 1TF0B 1IN8A 3KFUG 3K2LA 2F4VM 2ZAOA 3SYKA 1WJ7A 3R8FA 5A2QS 5EP3A 5DYIA 2LHCA 1E94E 4NL4H 5EXXA 3UZUA 5BR8M 3HHZA 2DAMA 2VIIA 3L29A 4AW4A 3TWMA 2H1RA 2K0BX 2EO2A 5DYGA 3GPYA 1NHGC 2L4EA 4DUZM 1R2ZA 3I4YA 2G8LA 2RGOA 2KRKA 2XSZA 4II7A 2Y20A 2O25A 3T38A 3U6EA 1OQYA 1C1KA 1DGGA 2Q2EB 4IBJA 3MK6A 4LFAM 4KODA 7CATA 4L15A 4AQYM 3VFDA 5ITRA 4AKIA 2XZUA 2LTUA 5IT9S 1L2BA 1IXSA 4LF6M 2JP7A 1VEJA 5ITTA 2WSEF 3VK8A 3DFZA 1SG9A 2JUJA 2KZUA 3T15A 2X4AA 4QNMA 1FJGM 1LV7A 2R18A 3GPPA 3SFZA 4DR4M 1PJJA 4MGKE 4LJ5A 4XK8F 4IBKA 3SAVA 3BXWA 5EQTA 3FYCA 1OAOC 1PJTA 4PT5A 3VKHA 2JY8A 5E6JA 3CF2A 2R65A 1QDRA 1IY1A 4BBAA 4FWHA 4JI8M 1W5SA 3B7ZA 3CF6E 3HJSA 4JXJA 4LRTA 4XBOA 5EJCA 1SXJA 2ZM6M 4DV0M 2F5QA 4DR6M 4GC5A 3U6QA 3VDUA 4FCTA 3H4MA 4QHTA 3ZCBB 1PGYA 4DV3M 1L8QA 1ZAEA 4AI6A 3DZDA 4ANRA 2CE7A 2ZANA 3FTDA 5FTNA 1NY5A 2LWXA 2XGNA 4KLNA 2C96A 5EXPA 2KHHA 3JAMS 2EA0A 2CHQA 1G41A 2C99A 4R7GA 2OOAA 4MGIE 3GLGB 4FD2A 2FH0A 4JI5M 2A5YB 3KDSE 1SXJE 5IREB 1I4WA 4M9SA 1C7YA 3ZQJA 2R0IA 1T3TA 4R71A 1PJIA 1N34M 4PDGA 2X49A 5KPRA 4FVMA 4X65M 4GMQA 3RFWA 1V34A 1Q02A 1YLAA 3CF0A 3FRIA 4MGZE 5DNYA 1EIJA 5IWAM 4LJ9A 1NY6A 4IIWA 1TH2A 4CHTB 3GPUA 3T1HM 1GJTA 3LCVB 2DWLA 4CGYB 1DGBA 1XNQM 2H5XA 1IM2A 2UXBM 4D82A 4Y28F 1OAIA 2RGHA 1G4AE 2CHVA 1XMQM 1QQWA 3EIEA 4WP2A 4JI2M 4TUWA 1HNWM 3KOYE 4FCVA 1OTRA 1IBKM 4I4LA 1G59A 4GRIA 5EP2A 2XFSA 4KHPM 4GH9A 4AG5A 2XH9A 1GO5A 2KA6B 1Q3BA 3PNVA 4KO8A 4LJ7A 3PVSA 4DV2M 3U6OA 3SARA 1JB0F 1PJQA 2R46A 4QOSA 3U5ZB 1OKSA 2JA2A 1I94M 3WHKA 5IZ7D 3GLGA 2XSZD 2JY5A 4LFCM 3RE8A 2DXIA 4D80A 3GLFB 1T6OA 1IN5A 5C18A 1JR3A 2QQ8A 3UJNA 3GO8A 4G4RA 1F4IA 1OFHA 2JXNA 1IY0A 1UFZA 2RRUA 3PXGA 1G8PA 5FSWA 1D0KA 5C1BA 3E21A 4LJ8A 4DR1M 2ZBKB 1QAMA 4GEWA 2YR0A 4B7GA 4F2LA 2OPFA 2EUCA 2HL7A 4BB9A 1IN6A 3GRVA 4DR5M 1N75A 2LBCA 3GLGE 1UM8A 1QUTA 3HZJA 3FUUA 3L27A 2QENA 4NC6A 4NSOB 3TWKA 1HQYE 1JR3E 1MU5A 3TPZA 3V76A 5FTLA 5JI3E 3U6SA 4G3OA 3ILKA 4IJFA 4LF8M 4XGIA 3W0LB 3J81S 4GIPA 4NOOB 1R5LA 3LVWA 1HQCA 1A5TA 3WHLA 4LJ4A 5ITXA 1GABA 3IHPA 1J09A 3AKZA 3W67A 3HX3A 2F5OA 4JV5M 2JZ1A 2QZ4A 4I5SA 4L16A 1N32M 3HGIA 1VQ1A 3EIHA 2HAKA 4QHSA 1NJFA 2D7GA 2JY6B 5EXSA 3GLFA 3Q8GA 5H37D 1SXJC 1GJSA 2CRUA 1GVNA 1CUKA 2QCUA 3KW6A 3T6PA 4IBDA 2DWNA 4AZFA 3UGJA 5ITXE 2D7HA 2QBYB 5BPVA 4F1IA 4RF1A 1QANA 2Z7JA 3HWSA 3SC3A 1HJPA 1TGUA 3F92A 4L4UA 5FTKA 1D0MA 4PDIA 4X62M 4REZA 1HNZM 3K9OA 1FNNA 2GNOA 4DV7M 4OVZB 3GLIA 2D7EA 2YNMD 3A45A 4JI1M 1WGNA 3DA1A 2G3QA 2DZLA 2QPAA 3B7QA 3LCUA 3B7NA 1ZV1A 3MMPA 3GLFE 4QOZC 2KDLA 3K92A 4JI0M 3C3EA 3FYDA 4LCBA 1OIPA 4LZJA 3VK7A 4OU7A 4QNRA 2B3TA 2CV2A 4JYAM 2ZAMA 4M9ZA 4DUYM 1L1ZA 2C5RA 1IN7A 3DOAA 2KNZA 4CISA 4FW9A 3ZH9B 4L78A 4WURA 3SAUA 1L1TA 4FWDA 3GLIE 2L4FA 2DHYA 2Z3XA 2MROB 4LJ6A 1VEKA 4ITQA 3K1JA 3M7GA 3J80S 1VDDA 1ORYB 1JR3D 3GQ4A 2QBYA 1DGHB 3H4JA 3L28A 1XNRM 1WGLA 1IBMM 2DZOB 1NSFA 1G71A 5FTJA 1K82A 2N35A 3J7BA 4CJ6A 3AV0A 2EJSA 5JI2E 4GHAA 3C9PA 1BVSA 4OW0A 1J7KA 2DKLA 4P17A 4OVZA 4G4QA 2DVWB 3LW5F 5LMUM 5DFLA 1EFUB 2DNAA 2O01F 3CTWB 3A42A 4JN6A 4PCZA 2Y0TA 4Q7JA 4DV1M 4NXMM 1WXQA 3HKPA 1VEGA 4LF7M 3SBJA 2CFOA 2VQEM 2CWBA 1PM5A 3FTCA 3U6PA 2JNHA 2LXEA 1WIVA 1R6BX 2JZ0A 2LH0A 3SHGB 4G4OA 1D2NA 2DAIA 2XZFA 2KXEA 5KPZA 4GITA 2K6BA 3ZC7B 2HWJA 3KXEC 1G3IA 2K9DA 2XFTA 2V1UA 3AL0C 4AKGA 3OTOM 3AOEA 2KRUA 4B3MM 2CV1A 1N36M 3BOSA 3KOXE 4FWGA 2MR9A 1QDTA 2VQFM 1MX0A 1DGHA 8CATA 3U6LA 4B3SM 1HT1E 4JI3M 1OJLA 1K3WA 3FUXA 3B89A 4LJAA 5ITYA 1NV9A 1NNJA 2UXDM 1V92A 1YSYA 3SMSA 1XMOM 1D0LA 2WSCF 1OIZA 1DO2A 3TL4X 2XLJA 4NRVA 3LMMA 1VDLA 3W68A 1K3XA 2E5LM 2Z4RA 3K9PA 3MHVC 4IBEA 4B08A 1TH4A 2V6ZM 2BNKA 1NHWC 2P5TA 4HLQA 3KSJA 3W0FA 3R9XB 4PD2A 3J27B 3BBZA 2UUAM 1IBLM 1H6UA 2AHMA 1P3QQ 4IBIA 4Z8XA 4M9XA 4M0WA 2BWBA 2WZJA 3HU3A 1GKIA 2FFJA 3HJQA 4RF0A 3C58A 1N77A 3FUVA 1Z5BA 3K8ZA 2KZSA 4ZPXA 2LVNC 1RU3A 2DHRA 2K47A 3B74A 3I04M 1R2YA 3A98B 3LQRA 4D81A 3M0EA 1OFIA 4W5WA 1S3SA 2R62A 4S12A 2DI0A 2J7NA 1TTEA 1IXRC 2XF3A 2C98A 3HHWA 2G5GX 3U5ZA 2F5SA 4OX9M 3SHFA 1AIPC 1TH3A 2LNHC 2GQFA 3I4VA 2YQZA 1KSFX 3NBXX 3GPXA 3GRYA 2J7OA 3U60B 2CV0A 3VDPA 4YHHM 4JI4M 1WR1B 1TR8A 3KS4A 1JQJC 2C9CA 4LY6A 1X37A 3GQ3A 3SATA 2BJWA 1XWIA 1YUBA 4CIZA 1L2DA 1XC8A 3KSXA 2W82A 3RGPA 2EKFA 2OOBA 5GKNA 4GKJM 3AJIB 1PRBA 1AUAA 3HU2A 1XHBA 5KQ8A 4DV6M 4B3TM 1HR0M 1SXJB 3U6MA 1QZMA 3FKEA 3M6AA 2HKJA 2MH8A 3HY5A 2Y21A 2I7NA 2VF8A 3SASA 3FUTA 2DAKA 3GRUA 1XB2B 2DENA 2HHHM 2MJ5B 1Z5CA 2Z8YM 1Y8GA 2RKOA 4LGMA 1N78A 4JI6M 4WW0A 2BWEA 3IG8A 3FTEA 1IFYA 3AFHA 2FS1A 4KT0F 4K0KM 3FD9A 1R4GA 1XXHB 2XEPA 4P16A 1QVRA 3FRHA 4YY3M 1PJSA 2ERCA 4MM3B 2R44A 2CHGA 2V1CA 4RKUF 4LGYA 3TWLA 5ITQA 5L8RF 4NXNM 3AOEC 3U60A 4B3RM 4B7FA 3JR4A 3HHYA 2FNAA 2FE8A 3KP0E 4M0DA 4LF5M 4A3VB 2J5YA 4FCWA 2BJVA 1NJGA 2DAEA 5EP1A 1R7RA 1Z6TA 2R45A 3FE3A 3FUWA 4LG2A 2L6OA 3T1YM 3L2AA 3U6DA 3VKGA 3KS8A 2KEBA 4I8OA 2QSFX 3SMPA 1V33A 3TE6A 2ZTDA 3I51A 3QAUA 4NSRA 4IJEA 3NBIA 2OQ4A 2CUZA 2UUCM 2KNVA 3L26A 2DAGA 4NRWA 3UMMA 3J7AS 3QYEA 3E9SA 4R3DA 3A46A 4B7HA 2ZTCA
chains in the Genus database with same CATH topology
1E32A 1NVMA 3LVVA 4LF4M 3RGSA 5EXTA 1NNUC 1QYRA 4DR7M 2DWZB 2O5RA 4GKKM 3U6CA 3E4RA 4GHLA 3IG5A 3Q8XA 4IBBA 1DGFA 4L8RC 2Y0QA 4IBCA 2R4JA 1QAQA 1XXHA 1QAOA 1YE9A 1IN4A 4MGYE 4X64M 4Z6YA 2L7HA 3GLHB 2L7IA 4LRSA 5KQDA 2F5NA 2UU9M 2DWMA 1Q3CA 1HNXM 4JI7M 4LFBM 4X66M 1E9SA 5FLXS 4DV4M 2L09A 3KOWE 3UK6A 5EP4A 5KO3A 4DR2M 3SAWA 1EE8A 3U61B 3D8LA 4AG6A 3THGA 3KOZE 2YFQA 3MJ5A 3JR5A 4LF9M 3PFIA 1DO0A 2R4EA 3GRRA 1TDZA 3L25A 4MB7A 1Q39A 2M60A 2F5PA 3B9PA 1GL7A 3QWLA 1N33M 3J2PB 5F3WA 3PNYA 1J5EM 1GLNA 3FTFA 4BLCA 2UXCM 4DR3M 2FOIC 3GQ5A 4AKHA 3KVWA 3VLFB 2I7PA 2NQ8C 3D8BA 3GLHA 1IXZA 2M5ZA 3TQSA 2CEAA 1IQPA 1E9RA 1KYIA 5E26A 3LQQA 3KP1E 4G4NA 2UUBM 1GL6A 3HHXA 2DZNB 1Z5AA 1L2CA 3AOGA 4IBGA 2KW0A 5KPTA 4G6ZA 4IBFA 3HJ8A 4MH0E 4RNAA 4I81A 4MGHA 5LMNM 1HT2E 3GLIB 4LZZA 2Z4SA 3NWLA 5FTMA 3SYLA 4HL4A 2C9OA 4GC9A 1IY2A 2HCBA 1IXSB 3HU1A 4DV5M 3U61A 2QP9X 2X8AA 4EIWA 1SXJD 3GP1A 5ITUA 1ZQ9A 1Z59A 1KFVA 1W5TA 1TDHA 1IN8A 3KFUG 3K2LA 2F4VM 2ZAOA 3SYKA 3R8FA 5A2QS 5EP3A 5DYIA 1E94E 4NL4H 5EXXA 3UZUA 5BR8M 3HHZA 2VIIA 3L29A 4AW4A 3TWMA 2H1RA 2EO2A 5DYGA 3GPYA 1NHGC 4DUZM 1R2ZA 3I4YA 2G8LA 2RGOA 2XSZA 2KRKA 4II7A 2Y20A 3T38A 3U6EA 1C1KA 1DGGA 2Q2EB 4IBJA 3MK6A 4LFAM 4KODA 7CATA 4L15A 4AQYM 3VFDA 5ITRA 4AKIA 2XZUA 5IT9S 1L2BA 4LF6M 5ITTA 3VK8A 3DFZA 2KZUA 3T15A 2X4AA 4QNMA 1FJGM 1LV7A 2R18A 3GPPA 3SFZA 4DR4M 1PJJA 4MGKE 4LJ5A 4IBKA 3SAVA 5EQTA 3FYCA 4PT5A 3VKHA 5E6JA 3CF2A 2R65A 1IY1A 4BBAA 4FWHA 4JI8M 1W5SA 3CF6E 3HJSA 4JXJA 4LRTA 4XBOA 5EJCA 2ZM6M 1SXJA 4DV0M 2F5QA 4DR6M 4GC5A 3U6QA 3VDUA 4FCTA 3H4MA 4QHTA 3ZCBB 4DV3M 1L8QA 1ZAEA 4AI6A 3DZDA 2CE7A 2ZANA 3FTDA 5FTNA 1NY5A 2LWXA 2XGNA 4KLNA 2C96A 5EXPA 3JAMS 2EA0A 2CHQA 1G41A 2C99A 4R7GA 4MGIE 3GLGB 4FD2A 4JI5M 2A5YB 3KDSE 1SXJE 5IREB 1I4WA 4M9SA 1T3TA 1PJIA 1N34M 4PDGA 2X49A 5KPRA 4FVMA 4X65M 4GMQA 3RFWA 5DNYA 3CF0A 4MGZE 5IWAM 4LJ9A 1NY6A 4IIWA 1TH2A 4CHTB 3GPUA 3T1HM 2DWLA 4CGYB 1DGBA 1XNQM 1IM2A 2UXBM 4D82A 2RGHA 1G4AE 2CHVA 1XMQM 1QQWA 3EIEA 4TUWA 4JI2M 1HNWM 3KOYE 4FCVA 1IBKM 4I4LA 1G59A 4GRIA 5EP2A 2XFSA 4KHPM 4GH9A 4AG5A 2XH9A 2KA6B 1Q3BA 3PNVA 4KO8A 4LJ7A 3PVSA 4DV2M 3U6OA 3SARA 4QOSA 2R46A 3U5ZB 2JA2A 1I94M 3WHKA 5IZ7D 3GLGA 2XSZD 4LFCM 3RE8A 2DXIA 4D80A 3GLFB 3UJNA 1IN5A 5C18A 1JR3A 3GO8A 4G4RA 1OFHA 1IY0A 3PXGA 1G8PA 5FSWA 5C1BA 4LJ8A 4DR1M 2ZBKB 1QAMA 4B7GA 2YR0A 2OPFA 2EUCA 2HL7A 4BB9A 1IN6A 3GRVA 4DR5M 1N75A 1UM8A 3L27A 3FUUA 2QENA 4NSOB 3TWKA 1HQYE 1MU5A 3TPZA 5FTLA 3U6SA 5JI3E 4LF8M 4IJFA 3ILKA 4XGIA 3W0LB 3J81S 4GIPA 4NOOB 3LVWA 3WHLA 1HQCA 4LJ4A 5ITXA 3AKZA 1J09A 4JV5M 2F5OA 2QZ4A 4I5SA 4L16A 1N32M 3HGIA 3EIHA 4QHSA 1NJFA 2D7GA 5EXSA 3GLFA 5H37D 1SXJC 1GVNA 2QCUA 2DWNA 3KW6A 2QBYB 4IBDA 4AZFA 3UGJA 5ITXE 2D7HA 5BPVA 4RF1A 1QANA 2Z7JA 3HWSA 3SC3A 1TGUA 4L4UA 5FTKA 4PDIA 4X62M 4REZA 1HNZM 1FNNA 4DV7M 4OVZB 3GLIA 2D7EA 2YNMD 3A45A 4JI1M 3DA1A 2QPAA 4QOZC 3K92A 4JI0M 4LCBA 3FYDA 4LZJA 3VK7A 4OU7A 4QNRA 2CV2A 4JYAM 2ZAMA 4M9ZA 4DUYM 1L1ZA 2C5RA 1IN7A 3DOAA 4CISA 4FW9A 3ZH9B 4L78A 4WURA 3SAUA 1L1TA 4FWDA 2Z3XA 4LJ6A 4ITQA 3K1JA 3M7GA 3J80S 1VDDA 1ORYB 1JR3D 3GQ4A 2QBYA 1DGHB 1XNRM 3L28A 1IBMM 2DZOB 1NSFA 5FTJA 1K82A 3J7BA 3AV0A 5JI2E 4GHAA 4OW0A 1J7KA 4G4QA 4OVZA 2DVWB 5LMUM 3CTWB 3A42A 4JN6A 4PCZA 2Y0TA 4DV1M 4NXMM 1WXQA 3HKPA 4LF7M 3SBJA 2CFOA 2VQEM 1PM5A 3FTCA 3U6PA 2LXEA 3SHGB 1R6BX 2LH0A 4G4OA 1D2NA 2XZFA 2KXEA 5KPZA 4GITA 3ZC7B 3KXEC 1G3IA 2XFTA 2V1UA 3AL0C 4AKGA 3OTOM 3AOEA 2KRUA 4B3MM 2CV1A 1N36M 3BOSA 3KOXE 4FWGA 2VQFM 1MX0A 1DGHA 8CATA 3U6LA 4B3SM 1HT1E 4JI3M 1OJLA 1K3WA 3FUXA 4LJAA 5ITYA 1NNJA 2UXDM 1YSYA 3SMSA 1XMOM 3TL4X 1DO2A 2XLJA 4NRVA 3LMMA 1K3XA 2E5LM 2Z4RA 3MHVC 4IBEA 4B08A 1TH4A 2V6ZM 2BNKA 1NHWC 2P5TA 4HLQA 3KSJA 3W0FA 3R9XB 4PD2A 3J27B 2UUAM 1IBLM 1H6UA 2AHMA 4IBIA 4Z8XA 4M9XA 4M0WA 3HU3A 1GKIA 2FFJA 3HJQA 4RF0A 3C58A 1N77A 3FUVA 1Z5BA 3K8ZA 2KZSA 4ZPXA 2DHRA 2K47A 1R2YA 3A98B 3LQRA 4D81A 3M0EA 1OFIA 4W5WA 1S3SA 2R62A 4S12A 2J7NA 1IXRC 2XF3A 2C98A 3HHWA 2G5GX 3U5ZA 2F5SA 4OX9M 3SHFA 2LNHC 1TH3A 3I4VA 2YQZA 1KSFX 3GPXA 3GRYA 2J7OA 3U60B 2CV0A 3VDPA 4YHHM 4JI4M 3KS4A 1JQJC 2C9CA 4LY6A 1X37A 3GQ3A 3SATA 2BJWA 1XWIA 1YUBA 1L2DA 1XC8A 3KSXA 2W82A 3RGPA 5GKNA 4GKJM 3AJIB 3HU2A 1XHBA 5KQ8A 4DV6M 4B3TM 1HR0M 1SXJB 3U6MA 1QZMA 3FKEA 3M6AA 2HKJA 2Y21A 2I7NA 3SASA 3FUTA 3GRUA 2HHHM 1Z5CA 2RKOA 4LGMA 1N78A 4JI6M 4WW0A 3IG8A 3FTEA 3AFHA 4K0KM 3FD9A 4P16A 1XXHB 2XEPA 1QVRA 4YY3M 2ERCA 4MM3B 2V1CA 2CHGA 4LGYA 3TWLA 5ITQA 4NXNM 3AOEC 3U60A 4B3RM 4B7FA 3JR4A 3HHYA 2FNAA 2FE8A 3KP0E 4M0DA 4LF5M 4A3VB 4FCWA 2BJVA 1NJGA 5EP1A 4LG2A 1R7RA 1Z6TA 2R45A 3FUWA 2L6OA 3T1YM 3L2AA 3U6DA 3VKGA 3KS8A 2KEBA 4I8OA 3SMPA 3TE6A 3I51A 3QAUA 4NSRA 4IJEA 3NBIA 2OQ4A 2CUZA 2UUCM 3L26A 4NRWA 3UMMA 3J7AS 3E9SA 4R3DA 3A46A 4B7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL4 H;  2D7E A;  2DWN A;  2D7H A;  2D7G A;  2DWL A;  2DWM A; 
#chains in the Genus database with same CATH topology
 1E32 A;  1NVM A;  3E46 A;  3QYB A;  3LVV A;  4LF4 M;  3RGS A;  5EXT A;  1NNU C;  1QYR A;  2OO9 A;  2DWZ B;  4DR7 M;  1MN3 A;  2KNA A;  2LVQ D;  2O5R A;  4GKK M;  3U6C A;  3E4R A;  4GHL A;  1T43 A;  2LVA A;  3IG5 A;  3Q8X A;  4IBB A;  1DGF A;  1ZMW A;  1MJG M;  2APL A;  4L8R C;  2Y0Q A;  4IBC A;  2R4J A;  1QAQ A;  1XXH A;  1QAO A;  1YE9 A;  1IN4 A;  4MGY E;  4X64 M;  4Z6Y A;  2L7H A;  3GLH B;  2L7I A;  4LRS A;  5KQD A;  2F5N A;  4UN2 B;  2DWM A;  2UU9 M;  1Q3C A;  1HNX M;  4JI7 M;  4LFB M;  4X66 M;  1E9S A;  5FLX S;  1WHC A;  4DV4 M;  1DV0 A;  2L09 A;  3KOW E;  3UK6 A;  5EP4 A;  5KO3 A;  1XXH E;  4L6V 6;  1LTM A;  2JWS A;  2LVP C;  4DR2 M;  3SAW A;  2VF7 A;  1EE8 A;  3U61 B;  3D8L A;  3IEC A;  4AG6 A;  3THG A;  1ZMV A;  3KOZ E;  2VDB B;  2YFQ A;  3MJ5 A;  3JR5 A;  4LF9 M;  1QUS A;  1DO0 A;  3PFI A;  2R4E A;  3GRR A;  1TDZ A;  4DBG B;  2CP8 A;  3CGW A;  4MB7 A;  1Q39 A;  2M60 A;  3L25 A;  2QNJ A;  2F5P A;  3B9P A;  1GL7 A;  3QWL A;  1N33 M;  3J2P B;  5F3W A;  3PNY A;  1J5E M;  1GLN A;  3FTF A;  3I01 M;  4BLC A;  1ZMU A;  2UXC M;  4DR3 M;  2FOI C;  3GQ5 A;  4AKH A;  3KVW A;  3VLF B;  1VG5 A;  2I7P A;  2NQ8 C;  3D8B A;  3GLH A;  1IXZ A;  2M5Z A;  3TQS A;  2CEA A;  1IQP A;  1E9R A;  2QHO B;  1KYI A;  2JY7 A;  5E26 A;  3LQQ A;  3KP1 E;  4G4N A;  2UUB M;  1GL6 A;  3HHX A;  2DZN B;  1Z5A A;  2L2D A;  3AOG A;  1L2C A;  4IBG A;  2KW0 A;  5KPT A;  4G6Z A;  4IBF A;  3HJ8 A;  4MH0 E;  2EKK A;  4RNA A;  4I81 A;  4MGH A;  5LMN M;  1HT2 E;  3GLI B;  4LZZ A;  1NO1 A;  2Z4S A;  3NWL A;  1NV8 A;  4HEO A;  4HL4 A;  2C9O A;  4GC9 A;  5FTM A;  3GLH E;  3SYL A;  1IY2 A;  1QZE A;  1IXS B;  2HCB A;  2R6F A;  3HU1 A;  4DV5 M;  3U61 A;  3C3D A;  2QP9 X;  2X8A A;  4EIW A;  2LVO C;  1SXJ D;  3GP1 A;  5ITU A;  1ZQ9 A;  2LHG A;  1Z59 A;  1KFV A;  1W5T A;  2MGW A;  2WSF F;  1TDH A;  1TF0 B;  1IN8 A;  3KFU G;  3K2L A;  2F4V M;  2ZAO A;  3SYK A;  1WJ7 A;  3R8F A;  5A2Q S;  5EP3 A;  5DYI A;  2LHC A;  1E94 E;  4NL4 H;  5EXX A;  3UZU A;  5BR8 M;  3HHZ A;  2DAM A;  2VII A;  3L29 A;  4AW4 A;  3TWM A;  2H1R A;  2K0B X;  2EO2 A;  5DYG A;  3GPY A;  1NHG C;  2L4E A;  4DUZ M;  1R2Z A;  3I4Y A;  2G8L A;  2RGO A;  2KRK A;  2XSZ A;  4II7 A;  2Y20 A;  2O25 A;  3T38 A;  3U6E A;  1OQY A;  1C1K A;  1DGG A;  2Q2E B;  4IBJ A;  3MK6 A;  4LFA M;  4KOD A;  7CAT A;  4L15 A;  4AQY M;  3VFD A;  5ITR A;  4AKI A;  2XZU A;  2LTU A;  5IT9 S;  1L2B A;  1IXS A;  4LF6 M;  2JP7 A;  1VEJ A;  5ITT A;  2WSE F;  3VK8 A;  3DFZ A;  1SG9 A;  2JUJ A;  2KZU A;  3T15 A;  2X4A A;  4QNM A;  1FJG M;  1LV7 A;  2R18 A;  3GPP A;  3SFZ A;  4DR4 M;  1PJJ A;  4MGK E;  4LJ5 A;  4XK8 F;  4IBK A;  3SAV A;  3BXW A;  5EQT A;  3FYC A;  1OAO C;  1PJT A;  4PT5 A;  3VKH A;  2JY8 A;  5E6J A;  3CF2 A;  2R65 A;  1QDR A;  1IY1 A;  4BBA A;  4FWH A;  4JI8 M;  1W5S A;  3B7Z A;  3CF6 E;  3HJS A;  4JXJ A;  4LRT A;  4XBO A;  5EJC A;  1SXJ A;  2ZM6 M;  4DV0 M;  2F5Q A;  4DR6 M;  4GC5 A;  3U6Q A;  3VDU A;  4FCT A;  3H4M A;  4QHT A;  3ZCB B;  1PGY A;  4DV3 M;  1L8Q A;  1ZAE A;  4AI6 A;  3DZD A;  4ANR A;  2CE7 A;  2ZAN A;  3FTD A;  5FTN A;  1NY5 A;  2LWX A;  2XGN A;  4KLN A;  2C96 A;  5EXP A;  2KHH A;  3JAM S;  2EA0 A;  2CHQ A;  1G41 A;  2C99 A;  4R7G A;  2OOA A;  4MGI E;  3GLG B;  4FD2 A;  2FH0 A;  4JI5 M;  2A5Y B;  3KDS E;  1SXJ E;  5IRE B;  1I4W A;  4M9S A;  1C7Y A;  3ZQJ A;  2R0I A;  1T3T A;  4R71 A;  1PJI A;  1N34 M;  4PDG A;  2X49 A;  5KPR A;  4FVM A;  4X65 M;  4GMQ A;  3RFW A;  1V34 A;  1Q02 A;  1YLA A;  3CF0 A;  3FRI A;  4MGZ E;  5DNY A;  1EIJ A;  5IWA M;  4LJ9 A;  1NY6 A;  4IIW A;  1TH2 A;  4CHT B;  3GPU A;  3T1H M;  1GJT A;  3LCV B;  2DWL A;  4CGY B;  1DGB A;  1XNQ M;  2H5X A;  1IM2 A;  2UXB M;  4D82 A;  4Y28 F;  1OAI A;  2RGH A;  1G4A E;  2CHV A;  1XMQ M;  1QQW A;  3EIE A;  4WP2 A;  4JI2 M;  4TUW A;  1HNW M;  3KOY E;  4FCV A;  1OTR A;  1IBK M;  4I4L A;  1G59 A;  4GRI A;  5EP2 A;  2XFS A;  4KHP M;  4GH9 A;  4AG5 A;  2XH9 A;  1GO5 A;  2KA6 B;  1Q3B A;  3PNV A;  4KO8 A;  4LJ7 A;  3PVS A;  4DV2 M;  3U6O A;  3SAR A;  1JB0 F;  1PJQ A;  2R46 A;  4QOS A;  3U5Z B;  1OKS A;  2JA2 A;  1I94 M;  3WHK A;  5IZ7 D;  3GLG A;  2XSZ D;  2JY5 A;  4LFC M;  3RE8 A;  2DXI A;  4D80 A;  3GLF B;  1T6O A;  1IN5 A;  5C18 A;  1JR3 A;  2QQ8 A;  3UJN A;  3GO8 A;  4G4R A;  1F4I A;  1OFH A;  2JXN A;  1IY0 A;  1UFZ A;  2RRU A;  3PXG A;  1G8P A;  5FSW A;  1D0K A;  5C1B A;  3E21 A;  4LJ8 A;  4DR1 M;  2ZBK B;  1QAM A;  4GEW A;  2YR0 A;  4B7G A;  4F2L A;  2OPF A;  2EUC A;  2HL7 A;  4BB9 A;  1IN6 A;  3GRV A;  4DR5 M;  1N75 A;  2LBC A;  3GLG E;  1UM8 A;  1QUT A;  3HZJ A;  3FUU A;  3L27 A;  2QEN A;  4NC6 A;  4NSO B;  3TWK A;  1HQY E;  1JR3 E;  1MU5 A;  3TPZ A;  3V76 A;  5FTL A;  5JI3 E;  3U6S A;  4G3O A;  3ILK A;  4IJF A;  4LF8 M;  4XGI A;  3W0L B;  3J81 S;  4GIP A;  4NOO B;  1R5L A;  3LVW A;  1HQC A;  1A5T A;  3WHL A;  4LJ4 A;  5ITX A;  1GAB A;  3IHP A;  1J09 A;  3AKZ A;  3W67 A;  3HX3 A;  2F5O A;  4JV5 M;  2JZ1 A;  2QZ4 A;  4I5S A;  4L16 A;  1N32 M;  3HGI A;  1VQ1 A;  3EIH A;  2HAK A;  4QHS A;  1NJF A;  2D7G A;  2JY6 B;  5EXS A;  3GLF A;  3Q8G A;  5H37 D;  1SXJ C;  1GJS A;  2CRU A;  1GVN A;  1CUK A;  2QCU A;  3KW6 A;  3T6P A;  4IBD A;  2DWN A;  4AZF A;  3UGJ A;  5ITX E;  2D7H A;  2QBY B;  5BPV A;  4F1I A;  4RF1 A;  1QAN A;  2Z7J A;  3HWS A;  3SC3 A;  1HJP A;  1TGU A;  3F92 A;  4L4U A;  5FTK A;  1D0M A;  4PDI A;  4X62 M;  4REZ A;  1HNZ M;  3K9O A;  1FNN A;  2GNO A;  4DV7 M;  4OVZ B;  3GLI A;  2D7E A;  2YNM D;  3A45 A;  4JI1 M;  1WGN A;  3DA1 A;  2G3Q A;  2DZL A;  2QPA A;  3B7Q A;  3LCU A;  3B7N A;  1ZV1 A;  3MMP A;  3GLF E;  4QOZ C;  2KDL A;  3K92 A;  4JI0 M;  3C3E A;  3FYD A;  4LCB A;  1OIP A;  4LZJ A;  3VK7 A;  4OU7 A;  4QNR A;  2B3T A;  2CV2 A;  4JYA M;  2ZAM A;  4M9Z A;  4DUY M;  1L1Z A;  2C5R A;  1IN7 A;  3DOA A;  2KNZ A;  4CIS A;  4FW9 A;  3ZH9 B;  4L78 A;  4WUR A;  3SAU A;  1L1T A;  4FWD A;  3GLI E;  2L4F A;  2DHY A;  2Z3X A;  2MRO B;  4LJ6 A;  1VEK A;  4ITQ A;  3K1J A;  3M7G A;  3J80 S;  1VDD A;  1ORY B;  1JR3 D;  3GQ4 A;  2QBY A;  1DGH B;  3H4J A;  3L28 A;  1XNR M;  1WGL A;  1IBM M;  2DZO B;  1NSF A;  1G71 A;  5FTJ A;  1K82 A;  2N35 A;  3J7B A;  4CJ6 A;  3AV0 A;  2EJS A;  5JI2 E;  4GHA A;  3C9P A;  1BVS A;  4OW0 A;  1J7K A;  2DKL A;  4P17 A;  4OVZ A;  4G4Q A;  2DVW B;  3LW5 F;  5LMU M;  5DFL A;  1EFU B;  2DNA A;  2O01 F;  3CTW B;  3A42 A;  4JN6 A;  4PCZ A;  2Y0T A;  4Q7J A;  4DV1 M;  4NXM M;  1WXQ A;  3HKP A;  1VEG A;  4LF7 M;  3SBJ A;  2CFO A;  2VQE M;  2CWB A;  1PM5 A;  3FTC A;  3U6P A;  2JNH A;  2LXE A;  1WIV A;  1R6B X;  2JZ0 A;  2LH0 A;  3SHG B;  4G4O A;  1D2N A;  2DAI A;  2XZF A;  2KXE A;  5KPZ A;  4GIT A;  2K6B A;  3ZC7 B;  2HWJ A;  3KXE C;  1G3I A;  2K9D A;  2XFT A;  2V1U A;  3AL0 C;  4AKG A;  3OTO M;  3AOE A;  2KRU A;  4B3M M;  2CV1 A;  1N36 M;  3BOS A;  3KOX E;  4FWG A;  2MR9 A;  1QDT A;  2VQF M;  1MX0 A;  1DGH A;  8CAT A;  3U6L A;  4B3S M;  1HT1 E;  4JI3 M;  1OJL A;  1K3W A;  3FUX A;  3B89 A;  4LJA A;  5ITY A;  1NV9 A;  1NNJ A;  2UXD M;  1V92 A;  1YSY A;  3SMS A;  1XMO M;  1D0L A;  2WSC F;  1OIZ A;  1DO2 A;  3TL4 X;  2XLJ A;  4NRV A;  3LMM A;  1VDL A;  3W68 A;  1K3X A;  2E5L M;  2Z4R A;  3K9P A;  3MHV C;  4IBE A;  4B08 A;  1TH4 A;  2V6Z M;  2BNK A;  1NHW C;  2P5T A;  4HLQ A;  3KSJ A;  3W0F A;  3R9X B;  4PD2 A;  3J27 B;  3BBZ A;  2UUA M;  1IBL M;  1H6U A;  2AHM A;  1P3Q Q;  4IBI A;  4Z8X A;  4M9X A;  4M0W A;  2BWB A;  2WZJ A;  3HU3 A;  1GKI A;  2FFJ A;  3HJQ A;  4RF0 A;  3C58 A;  1N77 A;  3FUV A;  1Z5B A;  3K8Z A;  2KZS A;  4ZPX A;  2LVN C;  1RU3 A;  2DHR A;  2K47 A;  3B74 A;  3I04 M;  1R2Y A;  3A98 B;  3LQR A;  4D81 A;  3M0E A;  1OFI A;  4W5W A;  1S3S A;  2R62 A;  4S12 A;  2DI0 A;  2J7N A;  1TTE A;  1IXR C;  2XF3 A;  2C98 A;  3HHW A;  2G5G X;  3U5Z A;  2F5S A;  4OX9 M;  3SHF A;  1AIP C;  1TH3 A;  2LNH C;  2GQF A;  3I4V A;  2YQZ A;  1KSF X;  3NBX X;  3GPX A;  3GRY A;  2J7O A;  3U60 B;  2CV0 A;  3VDP A;  4YHH M;  4JI4 M;  1WR1 B;  1TR8 A;  3KS4 A;  1JQJ C;  2C9C A;  4LY6 A;  1X37 A;  3GQ3 A;  3SAT A;  2BJW A;  1XWI A;  1YUB A;  4CIZ A;  1L2D A;  1XC8 A;  3KSX A;  2W82 A;  3RGP A;  2EKF A;  2OOB A;  5GKN A;  4GKJ M;  3AJI B;  1PRB A;  1AUA A;  3HU2 A;  1XHB A;  5KQ8 A;  4DV6 M;  4B3T M;  1HR0 M;  1SXJ B;  3U6M A;  1QZM A;  3FKE A;  3M6A A;  2HKJ A;  2MH8 A;  3HY5 A;  2Y21 A;  2I7N A;  2VF8 A;  3SAS A;  3FUT A;  2DAK A;  3GRU A;  1XB2 B;  2DEN A;  2HHH M;  2MJ5 B;  1Z5C A;  2Z8Y M;  1Y8G A;  2RKO A;  4LGM A;  1N78 A;  4JI6 M;  4WW0 A;  2BWE A;  3IG8 A;  3FTE A;  1IFY A;  3AFH A;  2FS1 A;  4KT0 F;  4K0K M;  3FD9 A;  1R4G A;  1XXH B;  2XEP A;  4P16 A;  1QVR A;  3FRH A;  4YY3 M;  1PJS A;  2ERC A;  4MM3 B;  2R44 A;  2CHG A;  2V1C A;  4RKU F;  4LGY A;  3TWL A;  5ITQ A;  5L8R F;  4NXN M;  3AOE C;  3U60 A;  4B3R M;  4B7F A;  3JR4 A;  3HHY A;  2FNA A;  2FE8 A;  3KP0 E;  4M0D A;  4LF5 M;  4A3V B;  2J5Y A;  4FCW A;  2BJV A;  1NJG A;  2DAE A;  5EP1 A;  1R7R A;  1Z6T A;  2R45 A;  3FE3 A;  3FUW A;  4LG2 A;  2L6O A;  3T1Y M;  3L2A A;  3U6D A;  3VKG A;  3KS8 A;  2KEB A;  4I8O A;  2QSF X;  3SMP A;  1V33 A;  3TE6 A;  2ZTD A;  3I51 A;  3QAU A;  4NSR A;  4IJE A;  3NBI A;  2OQ4 A;  2CUZ A;  2UUC M;  2KNV A;  3L26 A;  2DAG A;  4NRW A;  3UMM A;  3J7A S;  3QYE A;  3E9S A;  4R3D A;  3A46 A;  4B7H A;  2ZTC A; 
#chains in the Genus database with same CATH homology
 1E32 A;  1NVM A;  3LVV A;  4LF4 M;  3RGS A;  5EXT A;  1NNU C;  1QYR A;  4DR7 M;  2DWZ B;  2O5R A;  4GKK M;  3U6C A;  3E4R A;  4GHL A;  3IG5 A;  3Q8X A;  4IBB A;  1DGF A;  4L8R C;  2Y0Q A;  4IBC A;  2R4J A;  1QAQ A;  1XXH A;  1QAO A;  1YE9 A;  1IN4 A;  4MGY E;  4X64 M;  4Z6Y A;  2L7H A;  3GLH B;  2L7I A;  4LRS A;  5KQD A;  2F5N A;  2UU9 M;  2DWM A;  1Q3C A;  1HNX M;  4JI7 M;  4LFB M;  4X66 M;  1E9S A;  5FLX S;  4DV4 M;  2L09 A;  3KOW E;  3UK6 A;  5EP4 A;  5KO3 A;  4DR2 M;  3SAW A;  1EE8 A;  3U61 B;  3D8L A;  4AG6 A;  3THG A;  3KOZ E;  2YFQ A;  3MJ5 A;  3JR5 A;  4LF9 M;  3PFI A;  1DO0 A;  2R4E A;  3GRR A;  1TDZ A;  3L25 A;  4MB7 A;  1Q39 A;  2M60 A;  2F5P A;  3B9P A;  1GL7 A;  3QWL A;  1N33 M;  3J2P B;  5F3W A;  3PNY A;  1J5E M;  1GLN A;  3FTF A;  4BLC A;  2UXC M;  4DR3 M;  2FOI C;  3GQ5 A;  4AKH A;  3KVW A;  3VLF B;  2I7P A;  2NQ8 C;  3D8B A;  3GLH A;  1IXZ A;  2M5Z A;  3TQS A;  2CEA A;  1IQP A;  1E9R A;  1KYI A;  5E26 A;  3LQQ A;  3KP1 E;  4G4N A;  2UUB M;  1GL6 A;  3HHX A;  2DZN B;  1Z5A A;  1L2C A;  3AOG A;  4IBG A;  2KW0 A;  5KPT A;  4G6Z A;  4IBF A;  3HJ8 A;  4MH0 E;  4RNA A;  4I81 A;  4MGH A;  5LMN M;  1HT2 E;  3GLI B;  4LZZ A;  2Z4S A;  3NWL A;  5FTM A;  3SYL A;  4HL4 A;  2C9O A;  4GC9 A;  1IY2 A;  2HCB A;  1IXS B;  3HU1 A;  4DV5 M;  3U61 A;  2QP9 X;  2X8A A;  4EIW A;  1SXJ D;  3GP1 A;  5ITU A;  1ZQ9 A;  1Z59 A;  1KFV A;  1W5T A;  1TDH A;  1IN8 A;  3KFU G;  3K2L A;  2F4V M;  2ZAO A;  3SYK A;  3R8F A;  5A2Q S;  5EP3 A;  5DYI A;  1E94 E;  4NL4 H;  5EXX A;  3UZU A;  5BR8 M;  3HHZ A;  2VII A;  3L29 A;  4AW4 A;  3TWM A;  2H1R A;  2EO2 A;  5DYG A;  3GPY A;  1NHG C;  4DUZ M;  1R2Z A;  3I4Y A;  2G8L A;  2RGO A;  2XSZ A;  2KRK A;  4II7 A;  2Y20 A;  3T38 A;  3U6E A;  1C1K A;  1DGG A;  2Q2E B;  4IBJ A;  3MK6 A;  4LFA M;  4KOD A;  7CAT A;  4L15 A;  4AQY M;  3VFD A;  5ITR A;  4AKI A;  2XZU A;  5IT9 S;  1L2B A;  4LF6 M;  5ITT A;  3VK8 A;  3DFZ A;  2KZU A;  3T15 A;  2X4A A;  4QNM A;  1FJG M;  1LV7 A;  2R18 A;  3GPP A;  3SFZ A;  4DR4 M;  1PJJ A;  4MGK E;  4LJ5 A;  4IBK A;  3SAV A;  5EQT A;  3FYC A;  4PT5 A;  3VKH A;  5E6J A;  3CF2 A;  2R65 A;  1IY1 A;  4BBA A;  4FWH A;  4JI8 M;  1W5S A;  3CF6 E;  3HJS A;  4JXJ A;  4LRT A;  4XBO A;  5EJC A;  2ZM6 M;  1SXJ A;  4DV0 M;  2F5Q A;  4DR6 M;  4GC5 A;  3U6Q A;  3VDU A;  4FCT A;  3H4M A;  4QHT A;  3ZCB B;  4DV3 M;  1L8Q A;  1ZAE A;  4AI6 A;  3DZD A;  2CE7 A;  2ZAN A;  3FTD A;  5FTN A;  1NY5 A;  2LWX A;  2XGN A;  4KLN A;  2C96 A;  5EXP A;  3JAM S;  2EA0 A;  2CHQ A;  1G41 A;  2C99 A;  4R7G A;  4MGI E;  3GLG B;  4FD2 A;  4JI5 M;  2A5Y B;  3KDS E;  1SXJ E;  5IRE B;  1I4W A;  4M9S A;  1T3T A;  1PJI A;  1N34 M;  4PDG A;  2X49 A;  5KPR A;  4FVM A;  4X65 M;  4GMQ A;  3RFW A;  5DNY A;  3CF0 A;  4MGZ E;  5IWA M;  4LJ9 A;  1NY6 A;  4IIW A;  1TH2 A;  4CHT B;  3GPU A;  3T1H M;  2DWL A;  4CGY B;  1DGB A;  1XNQ M;  1IM2 A;  2UXB M;  4D82 A;  2RGH A;  1G4A E;  2CHV A;  1XMQ M;  1QQW A;  3EIE A;  4TUW A;  4JI2 M;  1HNW M;  3KOY E;  4FCV A;  1IBK M;  4I4L A;  1G59 A;  4GRI A;  5EP2 A;  2XFS A;  4KHP M;  4GH9 A;  4AG5 A;  2XH9 A;  2KA6 B;  1Q3B A;  3PNV A;  4KO8 A;  4LJ7 A;  3PVS A;  4DV2 M;  3U6O A;  3SAR A;  4QOS A;  2R46 A;  3U5Z B;  2JA2 A;  1I94 M;  3WHK A;  5IZ7 D;  3GLG A;  2XSZ D;  4LFC M;  3RE8 A;  2DXI A;  4D80 A;  3GLF B;  3UJN A;  1IN5 A;  5C18 A;  1JR3 A;  3GO8 A;  4G4R A;  1OFH A;  1IY0 A;  3PXG A;  1G8P A;  5FSW A;  5C1B A;  4LJ8 A;  4DR1 M;  2ZBK B;  1QAM A;  4B7G A;  2YR0 A;  2OPF A;  2EUC A;  2HL7 A;  4BB9 A;  1IN6 A;  3GRV A;  4DR5 M;  1N75 A;  1UM8 A;  3L27 A;  3FUU A;  2QEN A;  4NSO B;  3TWK A;  1HQY E;  1MU5 A;  3TPZ A;  5FTL A;  3U6S A;  5JI3 E;  4LF8 M;  4IJF A;  3ILK A;  4XGI A;  3W0L B;  3J81 S;  4GIP A;  4NOO B;  3LVW A;  3WHL A;  1HQC A;  4LJ4 A;  5ITX A;  3AKZ A;  1J09 A;  4JV5 M;  2F5O A;  2QZ4 A;  4I5S A;  4L16 A;  1N32 M;  3HGI A;  3EIH A;  4QHS A;  1NJF A;  2D7G A;  5EXS A;  3GLF A;  5H37 D;  1SXJ C;  1GVN A;  2QCU A;  2DWN A;  3KW6 A;  2QBY B;  4IBD A;  4AZF A;  3UGJ A;  5ITX E;  2D7H A;  5BPV A;  4RF1 A;  1QAN A;  2Z7J A;  3HWS A;  3SC3 A;  1TGU A;  4L4U A;  5FTK A;  4PDI A;  4X62 M;  4REZ A;  1HNZ M;  1FNN A;  4DV7 M;  4OVZ B;  3GLI A;  2D7E A;  2YNM D;  3A45 A;  4JI1 M;  3DA1 A;  2QPA A;  4QOZ C;  3K92 A;  4JI0 M;  4LCB A;  3FYD A;  4LZJ A;  3VK7 A;  4OU7 A;  4QNR A;  2CV2 A;  4JYA M;  2ZAM A;  4M9Z A;  4DUY M;  1L1Z A;  2C5R A;  1IN7 A;  3DOA A;  4CIS A;  4FW9 A;  3ZH9 B;  4L78 A;  4WUR A;  3SAU A;  1L1T A;  4FWD A;  2Z3X A;  4LJ6 A;  4ITQ A;  3K1J A;  3M7G A;  3J80 S;  1VDD A;  1ORY B;  1JR3 D;  3GQ4 A;  2QBY A;  1DGH B;  1XNR M;  3L28 A;  1IBM M;  2DZO B;  1NSF A;  5FTJ A;  1K82 A;  3J7B A;  3AV0 A;  5JI2 E;  4GHA A;  4OW0 A;  1J7K A;  4G4Q A;  4OVZ A;  2DVW B;  5LMU M;  3CTW B;  3A42 A;  4JN6 A;  4PCZ A;  2Y0T A;  4DV1 M;  4NXM M;  1WXQ A;  3HKP A;  4LF7 M;  3SBJ A;  2CFO A;  2VQE M;  1PM5 A;  3FTC A;  3U6P A;  2LXE A;  3SHG B;  1R6B X;  2LH0 A;  4G4O A;  1D2N A;  2XZF A;  2KXE A;  5KPZ A;  4GIT A;  3ZC7 B;  3KXE C;  1G3I A;  2XFT A;  2V1U A;  3AL0 C;  4AKG A;  3OTO M;  3AOE A;  2KRU A;  4B3M M;  2CV1 A;  1N36 M;  3BOS A;  3KOX E;  4FWG A;  2VQF M;  1MX0 A;  1DGH A;  8CAT A;  3U6L A;  4B3S M;  1HT1 E;  4JI3 M;  1OJL A;  1K3W A;  3FUX A;  4LJA A;  5ITY A;  1NNJ A;  2UXD M;  1YSY A;  3SMS A;  1XMO M;  3TL4 X;  1DO2 A;  2XLJ A;  4NRV A;  3LMM A;  1K3X A;  2E5L M;  2Z4R A;  3MHV C;  4IBE A;  4B08 A;  1TH4 A;  2V6Z M;  2BNK A;  1NHW C;  2P5T A;  4HLQ A;  3KSJ A;  3W0F A;  3R9X B;  4PD2 A;  3J27 B;  2UUA M;  1IBL M;  1H6U A;  2AHM A;  4IBI A;  4Z8X A;  4M9X A;  4M0W A;  3HU3 A;  1GKI A;  2FFJ A;  3HJQ A;  4RF0 A;  3C58 A;  1N77 A;  3FUV A;  1Z5B A;  3K8Z A;  2KZS A;  4ZPX A;  2DHR A;  2K47 A;  1R2Y A;  3A98 B;  3LQR A;  4D81 A;  3M0E A;  1OFI A;  4W5W A;  1S3S A;  2R62 A;  4S12 A;  2J7N A;  1IXR C;  2XF3 A;  2C98 A;  3HHW A;  2G5G X;  3U5Z A;  2F5S A;  4OX9 M;  3SHF A;  2LNH C;  1TH3 A;  3I4V A;  2YQZ A;  1KSF X;  3GPX A;  3GRY A;  2J7O A;  3U60 B;  2CV0 A;  3VDP A;  4YHH M;  4JI4 M;  3KS4 A;  1JQJ C;  2C9C A;  4LY6 A;  1X37 A;  3GQ3 A;  3SAT A;  2BJW A;  1XWI A;  1YUB A;  1L2D A;  1XC8 A;  3KSX A;  2W82 A;  3RGP A;  5GKN A;  4GKJ M;  3AJI B;  3HU2 A;  1XHB A;  5KQ8 A;  4DV6 M;  4B3T M;  1HR0 M;  1SXJ B;  3U6M A;  1QZM A;  3FKE A;  3M6A A;  2HKJ A;  2Y21 A;  2I7N A;  3SAS A;  3FUT A;  3GRU A;  2HHH M;  1Z5C A;  2RKO A;  4LGM A;  1N78 A;  4JI6 M;  4WW0 A;  3IG8 A;  3FTE A;  3AFH A;  4K0K M;  3FD9 A;  4P16 A;  1XXH B;  2XEP A;  1QVR A;  4YY3 M;  2ERC A;  4MM3 B;  2V1C A;  2CHG A;  4LGY A;  3TWL A;  5ITQ A;  4NXN M;  3AOE C;  3U60 A;  4B3R M;  4B7F A;  3JR4 A;  3HHY A;  2FNA A;  2FE8 A;  3KP0 E;  4M0D A;  4LF5 M;  4A3V B;  4FCW A;  2BJV A;  1NJG A;  5EP1 A;  4LG2 A;  1R7R A;  1Z6T A;  2R45 A;  3FUW A;  2L6O A;  3T1Y M;  3L2A A;  3U6D A;  3VKG A;  3KS8 A;  2KEB A;  4I8O A;  3SMP A;  3TE6 A;  3I51 A;  3QAU A;  4NSR A;  4IJE A;  3NBI A;  2OQ4 A;  2CUZ A;  2UUC M;  3L26 A;  4NRW A;  3UMM A;  3J7A S;  3E9S A;  4R3D A;  3A46 A;  4B7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...