2D7EA

Crystal structure of n-terminal domain of pria from e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Primosomal protein N'
total genus 18
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7eA01
2D7EA 2DWLA 2D7HA 2DWNA 4NL4H 2DWMA 2D7GA
chains in the Genus database with same CATH superfamily
2FH0A 1QAQA 4LFAM 3U6LA 2ZAMA 1PRBA 2CV1A 4I81A 4L16A 2R44A 3RE8A 3ZH9B 3MMPA 4W5WA 4B3TM 3CF0A 2BNKA 3I01M 1R6BX 4ZPXA 1XNRM 2UXDM 2J5YA 2DAMA 1EFUB 1SXJE 2DAEA 1QVRA 4RKUF 5EQTA 4MGYE 1A5TA 2LTUA 3IHPA 4QOSA 3TWKA 2ZTDA 4JXJA 3B7NA 3TWLA 4IJFA 4X66M 1E94E 3AJIB 1R4GA 1D2NA 4IBIA 4G4RA 3LW5F 1G8PA 4DV2M 5ITXA 1ZMWA 2QBYA 1D0LA 1IY2A 2R46A 3KOZE 3KXEC 3LVVA 5EP3A 1OQYA 2RKOA 2WSEF 1QZEA 2LVAA 2BWBA 3BOSA 3U6PA 2G8LA 1Z6TA 2VF7A 3C9PA 2QCUA 3B74A 1YE9A 1NJFA 4FVMA 3J2PB 4MM3B 2OPFA 2P5TA 4BB9A 3I04M 4IBKA 2XLJA 1IBMM 1LTMA 4L78A 5BPVA 1HQCA 3AOGA 1S3SA 1L2DA 3C3EA 1V92A 3D8BA 2QZ4A 2HKJA 2OOBA 2Z7JA 5JI3E 3JR5A 4LY6A 3K2LA 4YHHM 3SAWA 1IBLM 1XXHA 2CP8A 1OFHA 3IECA 1IN5A 4MGHA 3SAVA 1OAIA 2XFTA 1NHWC 2Z4RA 2XZUA 4LZJA 5C1BA 2R65A 5ITYA 1AUAA 3VLFB 3R9XB 2CRUA 4JN6A 4LGYA 2CHQA 4QOZC 2BWEA 5EP4A 2O25A 5KO3A 4WURA 3KS8A 3E4RA 2EJSA 3U60A 4R3DA 4RF1A 2GNOA 2L4FA 5LMNM 4L4UA 3UZUA 4AI6A 1W5TA 4GC9A 4A3VB 3M6AA 4OW0A 2Z8YM 3A46A 3J80S 2DWZB 3GRRA 3CF2A 1UM8A 2LVQD 3HU3A 1HNZM 1HR0M 5ITTA 3A98B 1X37A 4PDGA 3KOWE 2HHHM 3SARA 3SAUA 2M5ZA 4I8OA 3W0LB 1NHGC 2CV2A 1L8QA 2E5LM 3AFHA 3GRUA 3GLGB 3FTDA 4KLNA 2DWMA 1XWIA 3SYLA 1QDTA 1SG9A 1ZMVA 3NWLA 3CF6E 3VK8A 1JR3A 2D7HA 1L1TA 3AL0C 1Z5BA 1Q02A 2KZUA 4X65M 3HHYA 2LHCA 3U6CA 2L2DA 3IG5A 4OVZA 3J27B 1T6OA 7CATA 1XC8A 1GJSA 5ITRA 4NSOB 2UXCM 2MH8A 3UK6A 3HX3A 2K6BA 3AOEC 1CUKA 2ERCA 2X4AA 3JR4A 4FCTA 1UFZA 2DAKA 2XH9A 3V76A 1DO2A 3AOEA 1TGUA 2JWSA 3T15A 3KP1E 1G59A 4GKJM 2R0IA 4LCBA 1PJJA 5LMUM 2EUCA 3GLFE 1IN8A 2JY6B 3HHWA 1C7YA 4LGMA 4KHPM 1N32M 3Q8GA 1D0KA 3HJSA 4DR2M 2UUBM 1K3XA 2O5RA 1NY5A 2ZTCA 2QSFX 1J5EM 1ORYB 2M60A 5FTMA 4QHSA 1NO1A 4LF6M 2XSZD 2Z3XA 2KNVA 4NRVA 3J81S 1N77A 3HGIA 2V6ZM 2BJWA 2Y0TA 4QNRA 4JI2M 1I94M 1QYRA 2LXEA 2MR9A 2LVOC 2C98A 3H4JA 2F5OA 4KODA 3E46A 5FTLA 2LH0A 2RGHA 1GL7A 4LJ7A 3T38A 3RGSA 2QHOB 1RU3A 3K9OA 4GEWA 3FTFA 4QHTA 3GQ3A 2F5QA 3GLIB 1DGBA 1ZV1A 1E9SA 1JQJC 4LJ9A 4DR5M 4OX9M 4NC6A 1IM2A 2LNHC 3FE3A 4DBGB 4LF5M 5KPTA 2DKLA 2G5GX 1DV0A 5F3WA 2C96A 3GLHA 2C99A 1GKIA 1L2BA 1E32A 5DFLA 2KEBA 2HL7A 2RRUA 2KNAA 2N35A 4DUYM 4IBJA 1DO0A 4XBOA 1OJLA 4M0DA 5GKNA 3J7AS 4JI1M 2K0BX 4EIWA 2DWNA 1LV7A 2R4JA 2K9DA 4D81A 2KRUA 2K47A 4DV4M 1TH3A 2OOAA 4M9ZA 1OAOC 3SASA 2C9CA 1L2CA 2CFOA 3GRVA 3L29A 4LF4M 2KA6B 2ZAOA 5IWAM 3ZQJA 3GLHE 3I4VA 1NJGA 3GPYA 1J09A 2YNMD 1VEGA 3SC3A 1BVSA 4HEOA 2C5RA 2EKKA 4DV0M 2CEAA 2KW0A 3T1YM 4YY3M 2DZOB 2KDLA 1IQPA 1W5SA 3UJNA 1OIZA 1OTRA 3T6PA 1JR3D 1XNQM 1DGFA 3ZCBB 3D8LA 4R7GA 3HY5A 2V1CA 3FRIA 3FYDA 3FD9A 4DV5M 2G3QA 3RFWA 1SXJB 2VQFM 1XMOM 2Y0QA 2DXIA 2XF3A 3J7BA 3UMMA 4CGYB 2CHGA 4ITQA 1G41A 4K0KM 4NSRA 5KPRA 1QAMA 2DHYA 3LQQA 2XFSA 2F5SA 3U6OA 1R7RA 1PJQA 4XGIA 1KFVA 3GLIA 4IBDA 4LG2A 4BBAA 4FCWA 2ZBKB 3MK6A 1NSFA 1DGGA 4DR4M 4B08A 2CUZA 5KQ8A 3GLIE 2HAKA 1HNXM 1IN6A 3GLFA 2Y21A 1J7KA 4NOOB 4R71A 3GQ4A 4DV6M 4P17A 3SMPA 3JAMS 3GRYA 5EP1A 1HNWM 1IY0A 2KNZA 3I4YA 5EXTA 2DVWB 3A42A 3VDUA 1TF0B 3DZDA 3GLFB 2WSFF 3FUUA 1HT2E 1PJSA 3PNYA 3B9PA 2D7EA 2XGNA 4IBFA 4JI7M 1QANA 1N75A 2XEPA 3HU2A 1E9RA 2EO2A 1JR3E 4WP2A 3ZC7B 5KPZA 4JI8M 3B7ZA 1I4WA 4LRTA 5FTKA 1IN7A 1C1KA 1Z5CA 4AKHA 3WHKA 1JB0F 5KQDA 3CGWA 4LZZA 3L25A 4IJEA 1OKSA 2LVPC 4MGKE 4DR7M 5FTJA 4JI6M 1XXHE 3BBZA 3Q8XA 4LRSA 2H1RA 2L7IA 4CHTB 2L4EA 1G71A 1WXQA 2QQ8A 1R2ZA 4HL4A 3R8FA 2MJ5B 4JI0M 4LJ5A 1MJGM 3HJ8A 3GP1A 3C3DA 3U6EA 3QYBA 2EA0A 1OFIA 3RGPA 4G4NA 4G6ZA 3SATA 5BR8M 2L7HA 5DNYA 2NQ8C 2DAGA 5FSWA 4X64M 2F4VM 4FWGA 5EP2A 3VKGA 4PCZA 4I4LA 3QYEA 1NV9A 1YUBA 2JUJA 3K1JA 4FD2A 4MH0E 3M7GA 4KO8A 3U5ZB 2YFQA 3PFIA 1TR8A 1QDRA 3FUVA 1GO5A 1MX0A 1WGLA 3UGJA 3BXWA 1IXZA 3HHXA 1PJTA 5IREB 5IZ7D 4FW9A 1GLNA 3KDSE 5EJCA 1G3IA 1QUTA 3PVSA 5FLXS 3HHZA 3DA1A 2QBYB 1EIJA 4AKIA 3GPUA 4LF7M 1IXSB 1MN3A 4MB7A 4F1IA 4B3SM 2H5XA 3FUWA 2I7PA 4X62M 1IFYA 1XHBA 3KW6A 1VG5A 3TPZA 3L27A 1TH4A 3KSXA 2KZSA 4I5SA 4P16A 1Z5AA 4FWDA 2QPAA 4B7FA 4AZFA 3M0EA 1PGYA 1YLAA 2LVNC 2MROB 4AG5A 4D80A 4LFCM 4Z6YA 1MU5A 1Q39A 3HZJA 4XK8F 4DV3M 4IIWA 2O01F 2HCBA 1ZMUA 2GQFA 2JXNA 1EE8A 1TDHA 3FTCA 3I51A 3LMMA 4LJ8A 2DWLA 4B7HA 1T43A 2JY5A 4FWHA 4AG6A 2HWJA 1R2YA 1WJ7A 4GKKM 5IT9S 2DHRA 1QQWA 4GITA 4M9SA 1V33A 2JNHA 2UUCM 3SHFA 2R18A 3NBIA 1IBKM 4JI5M 3KS4A 2DENA 3HWSA 3L2AA 4L8RC 3W67A 2DNAA 3U5ZA 3GLGA 1SXJA 2ZANA 1IXRC 4S12A 1SXJC 5A2QS 1VEJA 4PD2A 2R45A 3H4MA 1NY6A 1VDLA 3HKPA 2R4EA 3TWMA 2LHGA 4DV1M 1GL6A 3FRHA 4JI4M 3TE6A 2FOIC 4JV5M 4JYAM 1OIPA 1ZQ9A 4G4OA 3DFZA 2EKFA 2L09A 3TQSA 1WGNA 3FKEA 4HLQA 3VK7A 2JA2A 4B3RM 1QUSA 2Y20A 3F92A 3SFZA 4G4QA 2XZFA 3HU1A 2UXBM 4GIPA 4AKGA 4IBCA 4NL4H 4REZA 3C58A 1Q3BA 4IBGA 4RNAA 3AV0A 2AHMA 4CIZA 2R6FA 1PM5A 3EIEA 3K9PA 2C9OA 2FFJA 3GPPA 4BLCA 5EXXA 3U61B 2APLA 3K8ZA 1NNJA 2YR0A 4NRWA 2KRKA 5EXPA 1XB2B 4OVZB 3KOXE 2UUAM 1XXHB 4GHAA 3IG8A 3MHVC 1ZAEA 3LQRA 2J7NA 4LF8M 2OO9A 4D82A 1N78A 3VDPA 4M0WA 1FJGM 4QNMA 3SHGB 3AKZA 3T1HM 1VDDA 4ANRA 4DV7M 1GVNA 4F2LA 4II7A 5E6JA 2DI0A 3B89A 4FCVA 3W0FA 3SYKA 3WHLA 8CATA 4DUZM 1XMQM 2WZJA 3EIHA 1WR1B 4B7GA 2QNJA 3U6QA 1T3TA 5FTNA 4G3OA 4LF9M 2WSCF 3KP0E 1V34A 2X8AA 5JI2E 4B3MM 2W82A 3OTOM 4DR6M 1QZMA 2UU9M 4LJ4A 4LJAA 2XSZA 1R5LA 3TL4X 4DR1M 3A45A 3GO8A 1VQ1A 5L8RF 5ITXE 2FNAA 1TH2A 3QAUA 4WW0A 3U61A 3NBXX 1IN4A 2KHHA 4AW4A 4GH9A 3U6SA 1Z59A 2VDBB 1G4AE 2YQZA 4Z8XA 2JZ1A 4NXNM 3VKHA 4GMQA 4TUWA 3QWLA 3GLHB 5H37D 4LFBM 3E21A 3KOYE 1AIPC 2R62A 3KVWA 2VF8A 3MJ5A 5EXSA 2FE8A 1Y8GA 2OQ4A 1Q3CA 3B7QA 4L6V6 1D0MA 4KT0F 2MGWA 2L6OA 1H6UA 1KYIA 4NXMM 1DGHA 5ITUA 2CHVA 2B3TA 3PNVA 4GC5A 3GPXA 4GRIA 4CJ6A 2V1UA 1QAOA 2DAIA 2X49A 2J7OA 2Z4SA 2LBCA 4MGZE 2D7GA 4JI3M 1K3WA 1GABA 1IY1A 3KFUG 4L15A 1K82A 5DYGA 2F5PA 4PDIA 1PJIA 2JY8A 2CWBA 2JZ0A 1NNUC 3U60B 3FUTA 4PT5A 3THGA 3U6MA 5ITQA 1FNNA 3SMSA 3E9SA 2ZM6M 1HT1E 4DR3M 2FS1A 1VEKA 1WHCA 4IBBA 3FUXA 4UN2B 1TDZA 3LVWA 3PXGA 2VIIA 3W68A 5E26A 2I7NA 4CISA 1NVMA 2JY7A 3LCUA 2A5YB 4AQYM 1NV8A 5C18A 4Q7JA 2Q2EB 3ILKA 2VQEM 3DOAA 2F5NA 1SXJD 4M9XA 3GQ5A 1L1ZA 4OU7A 4MGIE 3SBJA 2QENA 1P3QQ 1N34M 2DZLA 2KXEA 2BJVA 3U6DA 2QP9X 4LJ6A 4RF0A 4GHLA 2CV0A 3VFDA 4Y28F 1WIVA 1N36M 1HJPA 1TTEA 1GJTA 3KSJA 2DZNB 1KSFX 3HJQA 3GLGE 2LWXA 3L26A 3L28A 5DYIA 1YSYA 4IBEA 3LCVB 2JP7A 2CE7A 1HQYE 3FTEA 3CTWB 3FYCA 3K92A 1IXSA 1F4IA 2RGOA 1DGHB 1N33M
chains in the Genus database with same CATH topology
1QAQA 4LFAM 3U6LA 2ZAMA 2CV1A 4I81A 4L16A 3RE8A 3ZH9B 4W5WA 4B3TM 3CF0A 2BNKA 1R6BX 4ZPXA 1XNRM 2UXDM 1SXJE 1QVRA 5EQTA 4MGYE 4QOSA 3TWKA 4JXJA 3TWLA 4IJFA 4X66M 1E94E 3AJIB 4G4RA 1D2NA 4IBIA 1G8PA 4DV2M 5ITXA 2QBYA 1IY2A 2R46A 3KOZE 3KXEC 3LVVA 5EP3A 2RKOA 3BOSA 3U6PA 2G8LA 1Z6TA 2QCUA 4MM3B 1YE9A 1NJFA 4FVMA 3J2PB 2OPFA 2P5TA 4BB9A 4IBKA 2XLJA 1IBMM 4L78A 5BPVA 1HQCA 3AOGA 1S3SA 1L2DA 3D8BA 2QZ4A 2HKJA 2Z7JA 5JI3E 3JR5A 3SAWA 4LY6A 3K2LA 4YHHM 1IBLM 1XXHA 1OFHA 1IN5A 4MGHA 3SAVA 2XFTA 1NHWC 2Z4RA 2XZUA 4LZJA 5C1BA 2R65A 5ITYA 3VLFB 3R9XB 4JN6A 4LGYA 2CHQA 4QOZC 5EP4A 5KO3A 4WURA 3KS8A 3E4RA 3U60A 4R3DA 4RF1A 5LMNM 4L4UA 3UZUA 4AI6A 1W5TA 4GC9A 4A3VB 3M6AA 4OW0A 3A46A 3J80S 2DWZB 3GRRA 3CF2A 1UM8A 3HU3A 1HNZM 1HR0M 5ITTA 3A98B 1X37A 4PDGA 3KOWE 2HHHM 3SARA 3SAUA 2M5ZA 4I8OA 3W0LB 1NHGC 2CV2A 1L8QA 2E5LM 3AFHA 3GRUA 3GLGB 3FTDA 4KLNA 2DWMA 1XWIA 3SYLA 3NWLA 3VK8A 3AL0C 3CF6E 1JR3A 2D7HA 1L1TA 1Z5BA 2KZUA 4X65M 3HHYA 3U6CA 3IG5A 4OVZA 7CATA 3J27B 1XC8A 5ITRA 4NSOB 2UXCM 3UK6A 3AOEC 2ERCA 2X4AA 3JR4A 4FCTA 2XH9A 1DO2A 3AOEA 1TGUA 3T15A 1G59A 3KP1E 4GKJM 4LCBA 1PJJA 5LMUM 2EUCA 1IN8A 3HHWA 4LGMA 4KHPM 1N32M 3HJSA 4DR2M 2UUBM 1K3XA 2O5RA 1NY5A 1J5EM 1ORYB 2M60A 5FTMA 4QHSA 4LF6M 2XSZD 2Z3XA 4NRVA 3J81S 1N77A 3HGIA 2V6ZM 2BJWA 2Y0TA 4QNRA 4JI2M 1I94M 1QYRA 2LXEA 2C98A 2F5OA 4KODA 5FTLA 2LH0A 2RGHA 1GL7A 4LJ7A 3T38A 3RGSA 3FTFA 4QHTA 3GQ3A 2F5QA 3GLIB 1DGBA 4DR5M 1E9SA 1JQJC 4LJ9A 4OX9M 4JV5M 4LF5M 1IM2A 2LNHC 5KPTA 2G5GX 5F3WA 2C96A 3GLHA 2C99A 1GKIA 1L2BA 1E32A 2KEBA 2HL7A 4DUYM 4IBJA 1DO0A 4XBOA 1OJLA 4M0DA 5GKNA 3J7AS 4JI1M 4EIWA 2DWNA 1LV7A 2R4JA 4D81A 2KRUA 2K47A 4DV4M 1TH3A 3SASA 4M9ZA 2C9CA 2CFOA 3GRVA 3L29A 4LF4M 2KA6B 2ZAOA 5IWAM 3I4VA 1NJGA 3GPYA 1J09A 2YNMD 3SC3A 2C5RA 4DV0M 2CEAA 2KW0A 3T1YM 4YY3M 2DZOB 1IQPA 1W5SA 3UJNA 1XNQM 1JR3D 1DGFA 3ZCBB 3D8LA 4R7GA 2V1CA 3FYDA 3FD9A 4DV5M 3RFWA 1SXJB 2VQFM 1XMOM 2Y0QA 2DXIA 2XF3A 3J7BA 3UMMA 4CGYB 2CHGA 4ITQA 1G41A 4K0KM 4NSRA 5KPRA 1QAMA 3LQQA 2XFSA 2F5SA 3U6OA 1R7RA 4XGIA 1KFVA 3GLIA 4IBDA 4LG2A 4BBAA 4FCWA 2ZBKB 3MK6A 1NSFA 1DGGA 4DR4M 4B08A 2CUZA 5KQ8A 1HNXM 1IN6A 3GLFA 2Y21A 1J7KA 4NOOB 3GQ4A 4DV6M 3SMPA 3JAMS 3GRYA 5EP1A 1HNWM 1IY0A 3I4YA 5EXTA 2DVWB 3A42A 3VDUA 3DZDA 3GLFB 3FUUA 1HT2E 3PNYA 3B9PA 2D7EA 2XGNA 4IBFA 4JI7M 1QANA 1N75A 2XEPA 3HU2A 1E9RA 2EO2A 3ZC7B 5KPZA 4JI8M 5FTKA 1I4WA 4LRTA 1IN7A 1C1KA 1Z5CA 4AKHA 3WHKA 5KQDA 4LZZA 3L25A 4IJEA 4MGKE 4DR7M 5FTJA 4JI6M 3Q8XA 4LRSA 2H1RA 2L7IA 4CHTB 1WXQA 1R2ZA 4HL4A 3R8FA 4JI0M 4LJ5A 3HJ8A 3GP1A 3U6EA 2EA0A 1OFIA 3RGPA 4G4NA 4G6ZA 3SATA 5BR8M 2L7HA 5DNYA 2NQ8C 5FSWA 4X64M 2F4VM 4FWGA 5EP2A 3VKGA 4PCZA 4I4LA 4FD2A 1YUBA 4MH0E 3K1JA 1L2CA 3U5ZB 3M7GA 4KO8A 2YFQA 3PFIA 3FUVA 1MX0A 3UGJA 1IXZA 3HHXA 5IREB 5IZ7D 4FW9A 1GLNA 3KDSE 5EJCA 1G3IA 3PVSA 5FLXS 3HHZA 3DA1A 2QBYB 4AKIA 3GPUA 4LF7M 1IXSB 4MB7A 4B3SM 3FUWA 2I7PA 4X62M 1XHBA 3KW6A 3TPZA 3L27A 1TH4A 3KSXA 2KZSA 4I5SA 4P16A 1Z5AA 4FWDA 2QPAA 4B7FA 4AZFA 3M0EA 4AG5A 4D80A 4LFCM 4Z6YA 1MU5A 1Q39A 4DV3M 4IIWA 2HCBA 3LMMA 3FTCA 1EE8A 1TDHA 3I51A 2DWLA 4LJ8A 4B7HA 4AG6A 4FWHA 1R2YA 4GKKM 5IT9S 2DHRA 1QQWA 4GITA 4M9SA 4JI5M 2UUCM 3SHFA 2R18A 3NBIA 1IBKM 4L8RC 3KS4A 3HWSA 3L2AA 3U5ZA 3GLGA 1SXJA 2ZANA 1IXRC 4S12A 1SXJC 5A2QS 4PD2A 2R45A 3H4MA 1NY6A 3HKPA 2R4EA 3TWMA 4DV1M 4JI4M 1GL6A 3TE6A 2FOIC 4JYAM 1ZQ9A 4G4OA 3DFZA 2L09A 3TQSA 3FKEA 4HLQA 3VK7A 2JA2A 4B3RM 3SFZA 2Y20A 4G4QA 2XZFA 3HU1A 2UXBM 4GIPA 4AKGA 4IBCA 4NL4H 4REZA 3C58A 1Q3BA 4IBGA 4RNAA 3AV0A 2AHMA 1PM5A 3EIEA 2C9OA 2FFJA 3GPPA 4BLCA 5EXXA 3U61B 3K8ZA 1NNJA 2YR0A 4NRWA 2KRKA 5EXPA 4OVZB 3KOXE 2UUAM 1XXHB 4GHAA 3IG8A 3MHVC 1ZAEA 3LQRA 2J7NA 4LF8M 4D82A 1N78A 3VDPA 4M0WA 1FJGM 4QNMA 3SHGB 3AKZA 3T1HM 1VDDA 4DV7M 1GVNA 4II7A 5E6JA 4FCVA 3W0FA 3SYKA 3WHLA 8CATA 4DUZM 1XMQM 3EIHA 4B7GA 3U6QA 1T3TA 5FTNA 4LF9M 3KP0E 2X8AA 5JI2E 4B3MM 2W82A 3OTOM 4DR6M 1QZMA 2UU9M 4LJ4A 4LJAA 2XSZA 3TL4X 4DR1M 3A45A 3GO8A 5ITXE 2FNAA 1TH2A 3QAUA 4WW0A 3U61A 1IN4A 4AW4A 4GH9A 3U6SA 1Z59A 1G4AE 2YQZA 4Z8XA 4NXNM 3VKHA 4GMQA 4TUWA 3QWLA 3GLHB 5H37D 4LFBM 3KOYE 2R62A 3KVWA 3MJ5A 5EXSA 2FE8A 2OQ4A 1Q3CA 2L6OA 1H6UA 1KYIA 4NXMM 1DGHA 5ITUA 2CHVA 3PNVA 4GC5A 3GPXA 4GRIA 2V1UA 1QAOA 2X49A 2J7OA 2Z4SA 4MGZE 2D7GA 4JI3M 1K3WA 1IY1A 3KFUG 4L15A 1K82A 5DYGA 2F5PA 4PDIA 1PJIA 3U60B 1NNUC 3FUTA 4PT5A 3THGA 3U6MA 5ITQA 1FNNA 3SMSA 3E9SA 2ZM6M 1HT1E 4DR3M 4IBBA 3FUXA 1TDZA 3LVWA 3PXGA 2VIIA 5E26A 2I7NA 4CISA 1NVMA 2A5YB 4AQYM 5C18A 2Q2EB 3ILKA 2VQEM 3DOAA 2F5NA 1SXJD 4M9XA 3GQ5A 1L1ZA 4OU7A 4MGIE 3SBJA 2QENA 1N34M 2KXEA 2BJVA 3U6DA 2QP9X 4LJ6A 4RF0A 4GHLA 2CV0A 3VFDA 1N36M 3KSJA 2DZNB 1KSFX 3HJQA 2LWXA 3L26A 3L28A 5DYIA 1YSYA 4IBEA 2CE7A 1HQYE 3FTEA 3CTWB 3FYCA 3K92A 2RGOA 1DGHB 1N33M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7E A;  2DWL A;  2D7H A;  2DWN A;  4NL4 H;  2DWM A;  2D7G A; 
#chains in the Genus database with same CATH topology
 2FH0 A;  1QAQ A;  4LFA M;  3U6L A;  2ZAM A;  1PRB A;  2CV1 A;  4I81 A;  4L16 A;  2R44 A;  3RE8 A;  3ZH9 B;  3MMP A;  4W5W A;  4B3T M;  3CF0 A;  2BNK A;  3I01 M;  1R6B X;  4ZPX A;  1XNR M;  2UXD M;  2J5Y A;  2DAM A;  1EFU B;  1SXJ E;  2DAE A;  1QVR A;  4RKU F;  5EQT A;  4MGY E;  1A5T A;  2LTU A;  3IHP A;  4QOS A;  3TWK A;  2ZTD A;  4JXJ A;  3B7N A;  3TWL A;  4IJF A;  4X66 M;  1E94 E;  3AJI B;  1R4G A;  1D2N A;  4IBI A;  4G4R A;  3LW5 F;  1G8P A;  4DV2 M;  5ITX A;  1ZMW A;  2QBY A;  1D0L A;  1IY2 A;  2R46 A;  3KOZ E;  3KXE C;  3LVV A;  5EP3 A;  1OQY A;  2RKO A;  2WSE F;  1QZE A;  2LVA A;  2BWB A;  3BOS A;  3U6P A;  2G8L A;  1Z6T A;  2VF7 A;  3C9P A;  2QCU A;  3B74 A;  1YE9 A;  1NJF A;  4FVM A;  3J2P B;  4MM3 B;  2OPF A;  2P5T A;  4BB9 A;  3I04 M;  4IBK A;  2XLJ A;  1IBM M;  1LTM A;  4L78 A;  5BPV A;  1HQC A;  3AOG A;  1S3S A;  1L2D A;  3C3E A;  1V92 A;  3D8B A;  2QZ4 A;  2HKJ A;  2OOB A;  2Z7J A;  5JI3 E;  3JR5 A;  4LY6 A;  3K2L A;  4YHH M;  3SAW A;  1IBL M;  1XXH A;  2CP8 A;  1OFH A;  3IEC A;  1IN5 A;  4MGH A;  3SAV A;  1OAI A;  2XFT A;  1NHW C;  2Z4R A;  2XZU A;  4LZJ A;  5C1B A;  2R65 A;  5ITY A;  1AUA A;  3VLF B;  3R9X B;  2CRU A;  4JN6 A;  4LGY A;  2CHQ A;  4QOZ C;  2BWE A;  5EP4 A;  2O25 A;  5KO3 A;  4WUR A;  3KS8 A;  3E4R A;  2EJS A;  3U60 A;  4R3D A;  4RF1 A;  2GNO A;  2L4F A;  5LMN M;  4L4U A;  3UZU A;  4AI6 A;  1W5T A;  4GC9 A;  4A3V B;  3M6A A;  4OW0 A;  2Z8Y M;  3A46 A;  3J80 S;  2DWZ B;  3GRR A;  3CF2 A;  1UM8 A;  2LVQ D;  3HU3 A;  1HNZ M;  1HR0 M;  5ITT A;  3A98 B;  1X37 A;  4PDG A;  3KOW E;  2HHH M;  3SAR A;  3SAU A;  2M5Z A;  4I8O A;  3W0L B;  1NHG C;  2CV2 A;  1L8Q A;  2E5L M;  3AFH A;  3GRU A;  3GLG B;  3FTD A;  4KLN A;  2DWM A;  1XWI A;  3SYL A;  1QDT A;  1SG9 A;  1ZMV A;  3NWL A;  3CF6 E;  3VK8 A;  1JR3 A;  2D7H A;  1L1T A;  3AL0 C;  1Z5B A;  1Q02 A;  2KZU A;  4X65 M;  3HHY A;  2LHC A;  3U6C A;  2L2D A;  3IG5 A;  4OVZ A;  3J27 B;  1T6O A;  7CAT A;  1XC8 A;  1GJS A;  5ITR A;  4NSO B;  2UXC M;  2MH8 A;  3UK6 A;  3HX3 A;  2K6B A;  3AOE C;  1CUK A;  2ERC A;  2X4A A;  3JR4 A;  4FCT A;  1UFZ A;  2DAK A;  2XH9 A;  3V76 A;  1DO2 A;  3AOE A;  1TGU A;  2JWS A;  3T15 A;  3KP1 E;  1G59 A;  4GKJ M;  2R0I A;  4LCB A;  1PJJ A;  5LMU M;  2EUC A;  3GLF E;  1IN8 A;  2JY6 B;  3HHW A;  1C7Y A;  4LGM A;  4KHP M;  1N32 M;  3Q8G A;  1D0K A;  3HJS A;  4DR2 M;  2UUB M;  1K3X A;  2O5R A;  1NY5 A;  2ZTC A;  2QSF X;  1J5E M;  1ORY B;  2M60 A;  5FTM A;  4QHS A;  1NO1 A;  4LF6 M;  2XSZ D;  2Z3X A;  2KNV A;  4NRV A;  3J81 S;  1N77 A;  3HGI A;  2V6Z M;  2BJW A;  2Y0T A;  4QNR A;  4JI2 M;  1I94 M;  1QYR A;  2LXE A;  2MR9 A;  2LVO C;  2C98 A;  3H4J A;  2F5O A;  4KOD A;  3E46 A;  5FTL A;  2LH0 A;  2RGH A;  1GL7 A;  4LJ7 A;  3T38 A;  3RGS A;  2QHO B;  1RU3 A;  3K9O A;  4GEW A;  3FTF A;  4QHT A;  3GQ3 A;  2F5Q A;  3GLI B;  1DGB A;  1ZV1 A;  1E9S A;  1JQJ C;  4LJ9 A;  4DR5 M;  4OX9 M;  4NC6 A;  1IM2 A;  2LNH C;  3FE3 A;  4DBG B;  4LF5 M;  5KPT A;  2DKL A;  2G5G X;  1DV0 A;  5F3W A;  2C96 A;  3GLH A;  2C99 A;  1GKI A;  1L2B A;  1E32 A;  5DFL A;  2KEB A;  2HL7 A;  2RRU A;  2KNA A;  2N35 A;  4DUY M;  4IBJ A;  1DO0 A;  4XBO A;  1OJL A;  4M0D A;  5GKN A;  3J7A S;  4JI1 M;  2K0B X;  4EIW A;  2DWN A;  1LV7 A;  2R4J A;  2K9D A;  4D81 A;  2KRU A;  2K47 A;  4DV4 M;  1TH3 A;  2OOA A;  4M9Z A;  1OAO C;  3SAS A;  2C9C A;  1L2C A;  2CFO A;  3GRV A;  3L29 A;  4LF4 M;  2KA6 B;  2ZAO A;  5IWA M;  3ZQJ A;  3GLH E;  3I4V A;  1NJG A;  3GPY A;  1J09 A;  2YNM D;  1VEG A;  3SC3 A;  1BVS A;  4HEO A;  2C5R A;  2EKK A;  4DV0 M;  2CEA A;  2KW0 A;  3T1Y M;  4YY3 M;  2DZO B;  2KDL A;  1IQP A;  1W5S A;  3UJN A;  1OIZ A;  1OTR A;  3T6P A;  1JR3 D;  1XNQ M;  1DGF A;  3ZCB B;  3D8L A;  4R7G A;  3HY5 A;  2V1C A;  3FRI A;  3FYD A;  3FD9 A;  4DV5 M;  2G3Q A;  3RFW A;  1SXJ B;  2VQF M;  1XMO M;  2Y0Q A;  2DXI A;  2XF3 A;  3J7B A;  3UMM A;  4CGY B;  2CHG A;  4ITQ A;  1G41 A;  4K0K M;  4NSR A;  5KPR A;  1QAM A;  2DHY A;  3LQQ A;  2XFS A;  2F5S A;  3U6O A;  1R7R A;  1PJQ A;  4XGI A;  1KFV A;  3GLI A;  4IBD A;  4LG2 A;  4BBA A;  4FCW A;  2ZBK B;  3MK6 A;  1NSF A;  1DGG A;  4DR4 M;  4B08 A;  2CUZ A;  5KQ8 A;  3GLI E;  2HAK A;  1HNX M;  1IN6 A;  3GLF A;  2Y21 A;  1J7K A;  4NOO B;  4R71 A;  3GQ4 A;  4DV6 M;  4P17 A;  3SMP A;  3JAM S;  3GRY A;  5EP1 A;  1HNW M;  1IY0 A;  2KNZ A;  3I4Y A;  5EXT A;  2DVW B;  3A42 A;  3VDU A;  1TF0 B;  3DZD A;  3GLF B;  2WSF F;  3FUU A;  1HT2 E;  1PJS A;  3PNY A;  3B9P A;  2D7E A;  2XGN A;  4IBF A;  4JI7 M;  1QAN A;  1N75 A;  2XEP A;  3HU2 A;  1E9R A;  2EO2 A;  1JR3 E;  4WP2 A;  3ZC7 B;  5KPZ A;  4JI8 M;  3B7Z A;  1I4W A;  4LRT A;  5FTK A;  1IN7 A;  1C1K A;  1Z5C A;  4AKH A;  3WHK A;  1JB0 F;  5KQD A;  3CGW A;  4LZZ A;  3L25 A;  4IJE A;  1OKS A;  2LVP C;  4MGK E;  4DR7 M;  5FTJ A;  4JI6 M;  1XXH E;  3BBZ A;  3Q8X A;  4LRS A;  2H1R A;  2L7I A;  4CHT B;  2L4E A;  1G71 A;  1WXQ A;  2QQ8 A;  1R2Z A;  4HL4 A;  3R8F A;  2MJ5 B;  4JI0 M;  4LJ5 A;  1MJG M;  3HJ8 A;  3GP1 A;  3C3D A;  3U6E A;  3QYB A;  2EA0 A;  1OFI A;  3RGP A;  4G4N A;  4G6Z A;  3SAT A;  5BR8 M;  2L7H A;  5DNY A;  2NQ8 C;  2DAG A;  5FSW A;  4X64 M;  2F4V M;  4FWG A;  5EP2 A;  3VKG A;  4PCZ A;  4I4L A;  3QYE A;  1NV9 A;  1YUB A;  2JUJ A;  3K1J A;  4FD2 A;  4MH0 E;  3M7G A;  4KO8 A;  3U5Z B;  2YFQ A;  3PFI A;  1TR8 A;  1QDR A;  3FUV A;  1GO5 A;  1MX0 A;  1WGL A;  3UGJ A;  3BXW A;  1IXZ A;  3HHX A;  1PJT A;  5IRE B;  5IZ7 D;  4FW9 A;  1GLN A;  3KDS E;  5EJC A;  1G3I A;  1QUT A;  3PVS A;  5FLX S;  3HHZ A;  3DA1 A;  2QBY B;  1EIJ A;  4AKI A;  3GPU A;  4LF7 M;  1IXS B;  1MN3 A;  4MB7 A;  4F1I A;  4B3S M;  2H5X A;  3FUW A;  2I7P A;  4X62 M;  1IFY A;  1XHB A;  3KW6 A;  1VG5 A;  3TPZ A;  3L27 A;  1TH4 A;  3KSX A;  2KZS A;  4I5S A;  4P16 A;  1Z5A A;  4FWD A;  2QPA A;  4B7F A;  4AZF A;  3M0E A;  1PGY A;  1YLA A;  2LVN C;  2MRO B;  4AG5 A;  4D80 A;  4LFC M;  4Z6Y A;  1MU5 A;  1Q39 A;  3HZJ A;  4XK8 F;  4DV3 M;  4IIW A;  2O01 F;  2HCB A;  1ZMU A;  2GQF A;  2JXN A;  1EE8 A;  1TDH A;  3FTC A;  3I51 A;  3LMM A;  4LJ8 A;  2DWL A;  4B7H A;  1T43 A;  2JY5 A;  4FWH A;  4AG6 A;  2HWJ A;  1R2Y A;  1WJ7 A;  4GKK M;  5IT9 S;  2DHR A;  1QQW A;  4GIT A;  4M9S A;  1V33 A;  2JNH A;  2UUC M;  3SHF A;  2R18 A;  3NBI A;  1IBK M;  4JI5 M;  3KS4 A;  2DEN A;  3HWS A;  3L2A A;  4L8R C;  3W67 A;  2DNA A;  3U5Z A;  3GLG A;  1SXJ A;  2ZAN A;  1IXR C;  4S12 A;  1SXJ C;  5A2Q S;  1VEJ A;  4PD2 A;  2R45 A;  3H4M A;  1NY6 A;  1VDL A;  3HKP A;  2R4E A;  3TWM A;  2LHG A;  4DV1 M;  1GL6 A;  3FRH A;  4JI4 M;  3TE6 A;  2FOI C;  4JV5 M;  4JYA M;  1OIP A;  1ZQ9 A;  4G4O A;  3DFZ A;  2EKF A;  2L09 A;  3TQS A;  1WGN A;  3FKE A;  4HLQ A;  3VK7 A;  2JA2 A;  4B3R M;  1QUS A;  2Y20 A;  3F92 A;  3SFZ A;  4G4Q A;  2XZF A;  3HU1 A;  2UXB M;  4GIP A;  4AKG A;  4IBC A;  4NL4 H;  4REZ A;  3C58 A;  1Q3B A;  4IBG A;  4RNA A;  3AV0 A;  2AHM A;  4CIZ A;  2R6F A;  1PM5 A;  3EIE A;  3K9P A;  2C9O A;  2FFJ A;  3GPP A;  4BLC A;  5EXX A;  3U61 B;  2APL A;  3K8Z A;  1NNJ A;  2YR0 A;  4NRW A;  2KRK A;  5EXP A;  1XB2 B;  4OVZ B;  3KOX E;  2UUA M;  1XXH B;  4GHA A;  3IG8 A;  3MHV C;  1ZAE A;  3LQR A;  2J7N A;  4LF8 M;  2OO9 A;  4D82 A;  1N78 A;  3VDP A;  4M0W A;  1FJG M;  4QNM A;  3SHG B;  3AKZ A;  3T1H M;  1VDD A;  4ANR A;  4DV7 M;  1GVN A;  4F2L A;  4II7 A;  5E6J A;  2DI0 A;  3B89 A;  4FCV A;  3W0F A;  3SYK A;  3WHL A;  8CAT A;  4DUZ M;  1XMQ M;  2WZJ A;  3EIH A;  1WR1 B;  4B7G A;  2QNJ A;  3U6Q A;  1T3T A;  5FTN A;  4G3O A;  4LF9 M;  2WSC F;  3KP0 E;  1V34 A;  2X8A A;  5JI2 E;  4B3M M;  2W82 A;  3OTO M;  4DR6 M;  1QZM A;  2UU9 M;  4LJ4 A;  4LJA A;  2XSZ A;  1R5L A;  3TL4 X;  4DR1 M;  3A45 A;  3GO8 A;  1VQ1 A;  5L8R F;  5ITX E;  2FNA A;  1TH2 A;  3QAU A;  4WW0 A;  3U61 A;  3NBX X;  1IN4 A;  2KHH A;  4AW4 A;  4GH9 A;  3U6S A;  1Z59 A;  2VDB B;  1G4A E;  2YQZ A;  4Z8X A;  2JZ1 A;  4NXN M;  3VKH A;  4GMQ A;  4TUW A;  3QWL A;  3GLH B;  5H37 D;  4LFB M;  3E21 A;  3KOY E;  1AIP C;  2R62 A;  3KVW A;  2VF8 A;  3MJ5 A;  5EXS A;  2FE8 A;  1Y8G A;  2OQ4 A;  1Q3C A;  3B7Q A;  4L6V 6;  1D0M A;  4KT0 F;  2MGW A;  2L6O A;  1H6U A;  1KYI A;  4NXM M;  1DGH A;  5ITU A;  2CHV A;  2B3T A;  3PNV A;  4GC5 A;  3GPX A;  4GRI A;  4CJ6 A;  2V1U A;  1QAO A;  2DAI A;  2X49 A;  2J7O A;  2Z4S A;  2LBC A;  4MGZ E;  2D7G A;  4JI3 M;  1K3W A;  1GAB A;  1IY1 A;  3KFU G;  4L15 A;  1K82 A;  5DYG A;  2F5P A;  4PDI A;  1PJI A;  2JY8 A;  2CWB A;  2JZ0 A;  1NNU C;  3U60 B;  3FUT A;  4PT5 A;  3THG A;  3U6M A;  5ITQ A;  1FNN A;  3SMS A;  3E9S A;  2ZM6 M;  1HT1 E;  4DR3 M;  2FS1 A;  1VEK A;  1WHC A;  4IBB A;  3FUX A;  4UN2 B;  1TDZ A;  3LVW A;  3PXG A;  2VII A;  3W68 A;  5E26 A;  2I7N A;  4CIS A;  1NVM A;  2JY7 A;  3LCU A;  2A5Y B;  4AQY M;  1NV8 A;  5C18 A;  4Q7J A;  2Q2E B;  3ILK A;  2VQE M;  3DOA A;  2F5N A;  1SXJ D;  4M9X A;  3GQ5 A;  1L1Z A;  4OU7 A;  4MGI E;  3SBJ A;  2QEN A;  1P3Q Q;  1N34 M;  2DZL A;  2KXE A;  2BJV A;  3U6D A;  2QP9 X;  4LJ6 A;  4RF0 A;  4GHL A;  2CV0 A;  3VFD A;  4Y28 F;  1WIV A;  1N36 M;  1HJP A;  1TTE A;  1GJT A;  3KSJ A;  2DZN B;  1KSF X;  3HJQ A;  3GLG E;  2LWX A;  3L26 A;  3L28 A;  5DYI A;  1YSY A;  4IBE A;  3LCV B;  2JP7 A;  2CE7 A;  1HQY E;  3FTE A;  3CTW B;  3FYC A;  3K92 A;  1IXS A;  1F4I A;  2RGO A;  1DGH B;  1N33 M; 
#chains in the Genus database with same CATH homology
 1QAQ A;  4LFA M;  3U6L A;  2ZAM A;  2CV1 A;  4I81 A;  4L16 A;  3RE8 A;  3ZH9 B;  4W5W A;  4B3T M;  3CF0 A;  2BNK A;  1R6B X;  4ZPX A;  1XNR M;  2UXD M;  1SXJ E;  1QVR A;  5EQT A;  4MGY E;  4QOS A;  3TWK A;  4JXJ A;  3TWL A;  4IJF A;  4X66 M;  1E94 E;  3AJI B;  4G4R A;  1D2N A;  4IBI A;  1G8P A;  4DV2 M;  5ITX A;  2QBY A;  1IY2 A;  2R46 A;  3KOZ E;  3KXE C;  3LVV A;  5EP3 A;  2RKO A;  3BOS A;  3U6P A;  2G8L A;  1Z6T A;  2QCU A;  4MM3 B;  1YE9 A;  1NJF A;  4FVM A;  3J2P B;  2OPF A;  2P5T A;  4BB9 A;  4IBK A;  2XLJ A;  1IBM M;  4L78 A;  5BPV A;  1HQC A;  3AOG A;  1S3S A;  1L2D A;  3D8B A;  2QZ4 A;  2HKJ A;  2Z7J A;  5JI3 E;  3JR5 A;  3SAW A;  4LY6 A;  3K2L A;  4YHH M;  1IBL M;  1XXH A;  1OFH A;  1IN5 A;  4MGH A;  3SAV A;  2XFT A;  1NHW C;  2Z4R A;  2XZU A;  4LZJ A;  5C1B A;  2R65 A;  5ITY A;  3VLF B;  3R9X B;  4JN6 A;  4LGY A;  2CHQ A;  4QOZ C;  5EP4 A;  5KO3 A;  4WUR A;  3KS8 A;  3E4R A;  3U60 A;  4R3D A;  4RF1 A;  5LMN M;  4L4U A;  3UZU A;  4AI6 A;  1W5T A;  4GC9 A;  4A3V B;  3M6A A;  4OW0 A;  3A46 A;  3J80 S;  2DWZ B;  3GRR A;  3CF2 A;  1UM8 A;  3HU3 A;  1HNZ M;  1HR0 M;  5ITT A;  3A98 B;  1X37 A;  4PDG A;  3KOW E;  2HHH M;  3SAR A;  3SAU A;  2M5Z A;  4I8O A;  3W0L B;  1NHG C;  2CV2 A;  1L8Q A;  2E5L M;  3AFH A;  3GRU A;  3GLG B;  3FTD A;  4KLN A;  2DWM A;  1XWI A;  3SYL A;  3NWL A;  3VK8 A;  3AL0 C;  3CF6 E;  1JR3 A;  2D7H A;  1L1T A;  1Z5B A;  2KZU A;  4X65 M;  3HHY A;  3U6C A;  3IG5 A;  4OVZ A;  7CAT A;  3J27 B;  1XC8 A;  5ITR A;  4NSO B;  2UXC M;  3UK6 A;  3AOE C;  2ERC A;  2X4A A;  3JR4 A;  4FCT A;  2XH9 A;  1DO2 A;  3AOE A;  1TGU A;  3T15 A;  1G59 A;  3KP1 E;  4GKJ M;  4LCB A;  1PJJ A;  5LMU M;  2EUC A;  1IN8 A;  3HHW A;  4LGM A;  4KHP M;  1N32 M;  3HJS A;  4DR2 M;  2UUB M;  1K3X A;  2O5R A;  1NY5 A;  1J5E M;  1ORY B;  2M60 A;  5FTM A;  4QHS A;  4LF6 M;  2XSZ D;  2Z3X A;  4NRV A;  3J81 S;  1N77 A;  3HGI A;  2V6Z M;  2BJW A;  2Y0T A;  4QNR A;  4JI2 M;  1I94 M;  1QYR A;  2LXE A;  2C98 A;  2F5O A;  4KOD A;  5FTL A;  2LH0 A;  2RGH A;  1GL7 A;  4LJ7 A;  3T38 A;  3RGS A;  3FTF A;  4QHT A;  3GQ3 A;  2F5Q A;  3GLI B;  1DGB A;  4DR5 M;  1E9S A;  1JQJ C;  4LJ9 A;  4OX9 M;  4JV5 M;  4LF5 M;  1IM2 A;  2LNH C;  5KPT A;  2G5G X;  5F3W A;  2C96 A;  3GLH A;  2C99 A;  1GKI A;  1L2B A;  1E32 A;  2KEB A;  2HL7 A;  4DUY M;  4IBJ A;  1DO0 A;  4XBO A;  1OJL A;  4M0D A;  5GKN A;  3J7A S;  4JI1 M;  4EIW A;  2DWN A;  1LV7 A;  2R4J A;  4D81 A;  2KRU A;  2K47 A;  4DV4 M;  1TH3 A;  3SAS A;  4M9Z A;  2C9C A;  2CFO A;  3GRV A;  3L29 A;  4LF4 M;  2KA6 B;  2ZAO A;  5IWA M;  3I4V A;  1NJG A;  3GPY A;  1J09 A;  2YNM D;  3SC3 A;  2C5R A;  4DV0 M;  2CEA A;  2KW0 A;  3T1Y M;  4YY3 M;  2DZO B;  1IQP A;  1W5S A;  3UJN A;  1XNQ M;  1JR3 D;  1DGF A;  3ZCB B;  3D8L A;  4R7G A;  2V1C A;  3FYD A;  3FD9 A;  4DV5 M;  3RFW A;  1SXJ B;  2VQF M;  1XMO M;  2Y0Q A;  2DXI A;  2XF3 A;  3J7B A;  3UMM A;  4CGY B;  2CHG A;  4ITQ A;  1G41 A;  4K0K M;  4NSR A;  5KPR A;  1QAM A;  3LQQ A;  2XFS A;  2F5S A;  3U6O A;  1R7R A;  4XGI A;  1KFV A;  3GLI A;  4IBD A;  4LG2 A;  4BBA A;  4FCW A;  2ZBK B;  3MK6 A;  1NSF A;  1DGG A;  4DR4 M;  4B08 A;  2CUZ A;  5KQ8 A;  1HNX M;  1IN6 A;  3GLF A;  2Y21 A;  1J7K A;  4NOO B;  3GQ4 A;  4DV6 M;  3SMP A;  3JAM S;  3GRY A;  5EP1 A;  1HNW M;  1IY0 A;  3I4Y A;  5EXT A;  2DVW B;  3A42 A;  3VDU A;  3DZD A;  3GLF B;  3FUU A;  1HT2 E;  3PNY A;  3B9P A;  2D7E A;  2XGN A;  4IBF A;  4JI7 M;  1QAN A;  1N75 A;  2XEP A;  3HU2 A;  1E9R A;  2EO2 A;  3ZC7 B;  5KPZ A;  4JI8 M;  5FTK A;  1I4W A;  4LRT A;  1IN7 A;  1C1K A;  1Z5C A;  4AKH A;  3WHK A;  5KQD A;  4LZZ A;  3L25 A;  4IJE A;  4MGK E;  4DR7 M;  5FTJ A;  4JI6 M;  3Q8X A;  4LRS A;  2H1R A;  2L7I A;  4CHT B;  1WXQ A;  1R2Z A;  4HL4 A;  3R8F A;  4JI0 M;  4LJ5 A;  3HJ8 A;  3GP1 A;  3U6E A;  2EA0 A;  1OFI A;  3RGP A;  4G4N A;  4G6Z A;  3SAT A;  5BR8 M;  2L7H A;  5DNY A;  2NQ8 C;  5FSW A;  4X64 M;  2F4V M;  4FWG A;  5EP2 A;  3VKG A;  4PCZ A;  4I4L A;  4FD2 A;  1YUB A;  4MH0 E;  3K1J A;  1L2C A;  3U5Z B;  3M7G A;  4KO8 A;  2YFQ A;  3PFI A;  3FUV A;  1MX0 A;  3UGJ A;  1IXZ A;  3HHX A;  5IRE B;  5IZ7 D;  4FW9 A;  1GLN A;  3KDS E;  5EJC A;  1G3I A;  3PVS A;  5FLX S;  3HHZ A;  3DA1 A;  2QBY B;  4AKI A;  3GPU A;  4LF7 M;  1IXS B;  4MB7 A;  4B3S M;  3FUW A;  2I7P A;  4X62 M;  1XHB A;  3KW6 A;  3TPZ A;  3L27 A;  1TH4 A;  3KSX A;  2KZS A;  4I5S A;  4P16 A;  1Z5A A;  4FWD A;  2QPA A;  4B7F A;  4AZF A;  3M0E A;  4AG5 A;  4D80 A;  4LFC M;  4Z6Y A;  1MU5 A;  1Q39 A;  4DV3 M;  4IIW A;  2HCB A;  3LMM A;  3FTC A;  1EE8 A;  1TDH A;  3I51 A;  2DWL A;  4LJ8 A;  4B7H A;  4AG6 A;  4FWH A;  1R2Y A;  4GKK M;  5IT9 S;  2DHR A;  1QQW A;  4GIT A;  4M9S A;  4JI5 M;  2UUC M;  3SHF A;  2R18 A;  3NBI A;  1IBK M;  4L8R C;  3KS4 A;  3HWS A;  3L2A A;  3U5Z A;  3GLG A;  1SXJ A;  2ZAN A;  1IXR C;  4S12 A;  1SXJ C;  5A2Q S;  4PD2 A;  2R45 A;  3H4M A;  1NY6 A;  3HKP A;  2R4E A;  3TWM A;  4DV1 M;  4JI4 M;  1GL6 A;  3TE6 A;  2FOI C;  4JYA M;  1ZQ9 A;  4G4O A;  3DFZ A;  2L09 A;  3TQS A;  3FKE A;  4HLQ A;  3VK7 A;  2JA2 A;  4B3R M;  3SFZ A;  2Y20 A;  4G4Q A;  2XZF A;  3HU1 A;  2UXB M;  4GIP A;  4AKG A;  4IBC A;  4NL4 H;  4REZ A;  3C58 A;  1Q3B A;  4IBG A;  4RNA A;  3AV0 A;  2AHM A;  1PM5 A;  3EIE A;  2C9O A;  2FFJ A;  3GPP A;  4BLC A;  5EXX A;  3U61 B;  3K8Z A;  1NNJ A;  2YR0 A;  4NRW A;  2KRK A;  5EXP A;  4OVZ B;  3KOX E;  2UUA M;  1XXH B;  4GHA A;  3IG8 A;  3MHV C;  1ZAE A;  3LQR A;  2J7N A;  4LF8 M;  4D82 A;  1N78 A;  3VDP A;  4M0W A;  1FJG M;  4QNM A;  3SHG B;  3AKZ A;  3T1H M;  1VDD A;  4DV7 M;  1GVN A;  4II7 A;  5E6J A;  4FCV A;  3W0F A;  3SYK A;  3WHL A;  8CAT A;  4DUZ M;  1XMQ M;  3EIH A;  4B7G A;  3U6Q A;  1T3T A;  5FTN A;  4LF9 M;  3KP0 E;  2X8A A;  5JI2 E;  4B3M M;  2W82 A;  3OTO M;  4DR6 M;  1QZM A;  2UU9 M;  4LJ4 A;  4LJA A;  2XSZ A;  3TL4 X;  4DR1 M;  3A45 A;  3GO8 A;  5ITX E;  2FNA A;  1TH2 A;  3QAU A;  4WW0 A;  3U61 A;  1IN4 A;  4AW4 A;  4GH9 A;  3U6S A;  1Z59 A;  1G4A E;  2YQZ A;  4Z8X A;  4NXN M;  3VKH A;  4GMQ A;  4TUW A;  3QWL A;  3GLH B;  5H37 D;  4LFB M;  3KOY E;  2R62 A;  3KVW A;  3MJ5 A;  5EXS A;  2FE8 A;  2OQ4 A;  1Q3C A;  2L6O A;  1H6U A;  1KYI A;  4NXM M;  1DGH A;  5ITU A;  2CHV A;  3PNV A;  4GC5 A;  3GPX A;  4GRI A;  2V1U A;  1QAO A;  2X49 A;  2J7O A;  2Z4S A;  4MGZ E;  2D7G A;  4JI3 M;  1K3W A;  1IY1 A;  3KFU G;  4L15 A;  1K82 A;  5DYG A;  2F5P A;  4PDI A;  1PJI A;  3U60 B;  1NNU C;  3FUT A;  4PT5 A;  3THG A;  3U6M A;  5ITQ A;  1FNN A;  3SMS A;  3E9S A;  2ZM6 M;  1HT1 E;  4DR3 M;  4IBB A;  3FUX A;  1TDZ A;  3LVW A;  3PXG A;  2VII A;  5E26 A;  2I7N A;  4CIS A;  1NVM A;  2A5Y B;  4AQY M;  5C18 A;  2Q2E B;  3ILK A;  2VQE M;  3DOA A;  2F5N A;  1SXJ D;  4M9X A;  3GQ5 A;  1L1Z A;  4OU7 A;  4MGI E;  3SBJ A;  2QEN A;  1N34 M;  2KXE A;  2BJV A;  3U6D A;  2QP9 X;  4LJ6 A;  4RF0 A;  4GHL A;  2CV0 A;  3VFD A;  1N36 M;  3KSJ A;  2DZN B;  1KSF X;  3HJQ A;  2LWX A;  3L26 A;  3L28 A;  5DYI A;  1YSY A;  4IBE A;  2CE7 A;  1HQY E;  3FTE A;  3CTW B;  3FYC A;  3K92 A;  2RGO A;  1DGH B;  1N33 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...