2D7EA

Crystal structure of n-terminal domain of pria from e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7eA01
2D7EA 2DWNA 2D7GA 2DWLA 4NL4H 2D7HA 2DWMA
chains in the Genus database with same CATH superfamily
1NNUC 2MJ5B 3HJSA 4B7GA 3HU3A 2JY7A 1CUKA 1R5LA 3IG8A 3TPZA 4B7HA 2EKFA 3SAWA 1W5SA 2QSFX 4JXJA 1NV8A 1NY6A 2CE7A 2LWXA 3ILKA 4G6ZA 4QNMA 3E46A 3U61B 3ZCBB 4JI6M 1N33M 2LBCA 4I8OA 3SARA 3SASA 1IFYA 5EP4A 4JI0M 1VEJA 1RU3A 1PRBA 2QBYB 3UZUA 4DR2M 2LXEA 4DV4M 1GKIA 3FD9A 1PJIA 4JI1M 1PJTA 1WHCA 3KS4A 2G8LA 1IN7A 3NBIA 3U6SA 1ZMVA 2R4EA 4IJEA 4LF7M 4DV6M 1Q3CA 2OOAA 4LGMA 4G4QA 3T15A 3U61A 2XSZA 3C3EA 2X8AA 4AG5A 5EP3A 5ITRA 2DAEA 1ZAEA 5E26A 3HHZA 4DV1M 2KRUA 4OVZA 2DAKA 1PM5A 3GRRA 3H4MA 2QBYA 2CV2A 2EA0A 2DENA 3J27B 4R71A 3LVVA 2HKJA 4F2LA 1QAQA 2E5LM 4NC6A 3I04M 4DR6M 3WHKA 4B7FA 1H6UA 4X62M 1E9RA 3QYBA 3HWSA 1VEGA 1TGUA 3PVSA 3SMPA 2BJVA 4GEWA 2XFTA 1JR3A 4MB7A 1TDZA 3UGJA 2O25A 4XGIA 3VK7A 3AV0A 4LRTA 1OJLA 4LFCM 1Y8GA 1L2DA 2EO2A 1JR3E 5ITTA 3CTWB 2LNHC 1HJPA 2UUCM 2A5YB 2BWEA 4LF4M 2RKOA 1MN3A 3AOGA 1R2ZA 1IBMM 2M60A 4ITQA 4OX9M 1MX0A 1AUAA 1QAOA 1YE9A 2KZSA 1QAMA 4GRIA 3U5ZB 3B7NA 2XH9A 4B3SM 2D7HA 4CISA 1IXSB 2LHCA 2JY8A 3CGWA 2WSFF 3LCUA 3GLHB 4FW9A 1OAOC 3GLGA 4II7A 1OFHA 4AKHA 2CV0A 2DXIA 3KOYE 3GLGE 4QNRA 3JR5A 3THGA 1YLAA 3LQRA 4KHPM 2KNAA 4GMQA 2X49A 4KO8A 2BNKA 3TWLA 1N34M 1K3XA 3VKGA 2KA6B 1EFUB 2HWJA 2C9CA 1JB0F 2JY5A 4AKGA 4HEOA 4AZFA 5FLXS 3U5ZA 3JR4A 1QUTA 1VDLA 4LG2A 2RGOA 3L28A 2QCUA 4L4UA 4M9SA 4R7GA 1K3WA 4NXMM 2JP7A 3GLHA 3NWLA 5FTNA 3J7AS 4A3VB 5FTMA 3PXGA 4L6V6 2J7OA 1MU5A 3GLHE 4OU7A 2RGHA 3JAMS 1JQJC 4DV0M 2LHGA 4AG6A 4DV3M 4L8RC 2VF8A 1Q39A 5BR8M 5A2QS 2C5RA 1IBLM 4QOSA 4AW4A 4NOOB 1GL7A 4FCWA 2C98A 2DHYA 2FH0A 1DO2A 4LZZA 2F5QA 1C1KA 3HGIA 5EXTA 3FTEA 4LF9M 1ZMUA 3GPXA 2OPFA 1GJTA 2QQ8A 2QZ4A 3FYCA 3TL4X 1C7YA 2C9OA 2YNMD 2D7GA 3GRVA 4KLNA 1OFIA 3T6PA 1XWIA 3GO8A 4IJFA 1NY5A 5KPRA 2CFOA 5FTLA 1T43A 3KVWA 3HHWA 4LJAA 1OAIA 4UN2B 3CF2A 4I4LA 2RRUA 4ANRA 2Z4RA 3K92A 3RFWA 3C58A 3A45A 3QYEA 2ZBKB 4JYAM 4GC9A 2LH0A 4IBGA 1NNJA 3U6DA 2D7EA 4DBGB 2DZNB 2DWNA 3SYKA 1OIZA 2GQFA 4LJ8A 3AOEA 1PJSA 3AOEC 4BLCA 3GPPA 3EIHA 3E9SA 3ZQJA 2L7IA 3BXWA 1R4GA 1IN5A 5F3WA 1AIPC 2JUJA 3HU1A 4W5WA 1QUSA 2H1RA 3IECA 2CHVA 3GP1A 2F5SA 5EP1A 4MGZE 3HZJA 2LTUA 2JXNA 2V1UA 1ZQ9A 4QOZC 4PDGA 5EP2A 1HT2E 2R44A 5DYIA 2QP9X 1E94E 4GKKM 3B89A 3GRUA 4OVZB 3K2LA 3CF6E 3MJ5A 4XK8F 1W5TA 3LCVB 3B7ZA 3E21A 5EJCA 4X65M 1BVSA 3U60B 3SC3A 2DVWB 3F92A 4G4OA 2FS1A 1Q02A 5FTKA 4HLQA 2DAIA 3W68A 1K82A 2R0IA 4IBKA 1N32M 2UXBM 2X4AA 1R6BX 4DR1M 3TQSA 4PT5A 4G4RA 2K0BX 2P5TA 1N77A 2DWMA 2CUZA 2DAGA 2I7NA 4GH9A 4YY3M 2XZFA 1J5EM 3LQQA 5E6JA 1N75A 4LF8M 3A42A 2KNVA 2APLA 2V1CA 4B08A 4DV5M 3SFZA 2DZOB 3B7QA 5KQDA 3U60A 7CATA 4M0WA 4DV7M 4FWGA 4D80A 3B9PA 4IBDA 1WIVA 3FUVA 3VDUA 2XF3A 3GLGB 4NL4H 3FYDA 3UMMA 1NHGC 2K6BA 2QPAA 1NJFA 4B3TM 4D81A 3K8ZA 4B3MM 2C99A 1TH4A 2V6ZM 5LMNM 3T38A 2R18A 3DFZA 5KO3A 4TUWA 2VF7A 3C3DA 1TH2A 2UXDM 5JI3E 3GPYA 3KXEC 1SXJD 2L7HA 4LGYA 3RGPA 1GO5A 4L15A 4M9XA 2UUBM 3I4YA 3KOZE 1IM2A 3HJQA 5IZ7D 5KQ8A 3Q8GA 3SBJA 3VLFB 3L29A 4DUYM 1VEKA 3GLIA 4JI4M 4RNAA 4S12A 1SG9A 1XMQM 3M0EA 1N36M 2JZ0A 3GLFB 1NV9A 2KNZA 2OO9A 1HQCA 2AHMA 3GLIE 1WGNA 3KSXA 2QENA 5EXSA 2DWLA 2CHQA 1D0LA 4MGYE 1T6OA 2L4FA 1QDRA 3BBZA 2FFJA 2R62A 3KOWE 1LV7A 1Z5AA 2Y0TA 3VKHA 1HQYE 1HNXM 1FNNA 1GL6A 2YFQA 1DGGA 1UFZA 1LTMA 3D8LA 4Y28F 2NQ8C 1TTEA 2Z4SA 2F5NA 2LVNC 3R9XB 3D8BA 3M6AA 1XC8A 3GQ5A 3KOXE 3T1HM 2G5GX 1NJGA 3BOSA 4WW0A 5DFLA 5ITXA 3GLFA 3L2AA 1L2BA 3VDPA 1Z5CA 3GPUA 4G4NA 3M7GA 4PDIA 3KP1E 2KHHA 1QQWA 1OQYA 5ITXE 2C96A 3GLFE 4F1IA 4JV5M 1EIJA 3IHPA 3B74A 4D82A 1KFVA 3FRHA 2Z3XA 5LMUM 4LRSA 1NVMA 1QZMA 2FE8A 4JI3M 4BB9A 4MM3B 2XLJA 1DGFA 4MGIE 4B3RM 4IBBA 2FOIC 3MK6A 4NXNM 4LJ5A 1HNWM 1L8QA 2KW0A 2XGNA 1IY2A 1QYRA 2YR0A 2Q2EB 1XNRM 1IN4A 3A46A 3FTDA 1X37A 4Z6YA 3K1JA 5ITQA 2XEPA 2HHHM 4GC5A 2OQ4A 1G41A 3V76A 1S3SA 3AJIB 4LFAM 1IN8A 1XHBA 2HL7A 3TWKA 2QHOB 4FVMA 3GQ3A 2CWBA 3FUXA 3DA1A 4IBIA 2O5RA 2BWBA 3AFHA 3U6OA 1Z6TA 2WSEF 1TH3A 2Y0QA 2ZM6M 3U6LA 5EQTA 1SXJA 1G3IA 1J09A 1ZMWA 2JA2A 1YSYA 3HU2A 2F5PA 3FRIA 4IBEA 1V34A 2KDLA 4FWHA 1SXJE 1MJGM 2CEAA 4JI7M 5H37D 3SATA 1WXQA 5KPTA 3KP0E 4HL4A 1IQPA 3FUWA 2HAKA 4Z8XA 4NSOB 2JWSA 1N78A 3DOAA 3U6PA 1VG5A 3SAUA 1D0MA 2R6FA 1P3QQ 3HY5A 4X66M 1NHWC 3CF0A 3HHXA 3L26A 1G71A 2LVAA 2R45A 4LF6M 1DGHB 3RE8A 2F4VM 2O01F 2ZANA 1TDHA 5IREB 5ITUA 2WSCF 3K9PA 3MHVC 4K0KM 4P16A 3L27A 1XMOM 1OTRA 4GHAA 1TF0B 1QANA 3LW5F 1T3TA 3DZDA 2DI0A 4GKJM 2MGWA 3HHYA 4FD2A 1GABA 1EE8A 2Z8YM 1IXRC 3IG5A 4AKIA 3FTCA 2FNAA 2CRUA 1YUBA 2K9DA 2LVOC 2EKKA 2KEBA 2XFSA 2MH8A 4L78A 3SAVA 3W0LB 2KZUA 5GKNA 2YQZA 3A98B 2DHRA 1DGHA 1WR1B 3TWMA 1D2NA 2DAMA 1OIPA 3VFDA 4JI5M 2Y21A 4DR4M 4I81A 4KODA 3ZC7B 2LVQD 3QWLA 4FCVA 3MMPA 3KFUG 1E9SA 3HJ8A 3OTOM 1HT1E 2VDBB 2ZTCA 4LZJA 1VDDA 3ZH9B 2R46A 5DNYA 1PJQA 3NBXX 3J81S 1V92A 2GNOA 1XXHB 4DR5M 4P17A 3R8FA 4IBCA 3GLIB 2M5ZA 2R65A 3I01M 1Q3BA 3QAUA 3KDSE 5KPZA 3UK6A 2J5YA 2JNHA 5FSWA 2XZUA 2KRKA 1J7KA 4JI8M 4RKUF 1F4IA 1HNZM 1HR0M 2DZLA 2W82A 4BBAA 3FUUA 2VIIA 4FWDA 4LJ9A 2L09A 4IIWA 1FJGM 5C1BA 1A5TA 4Q7JA 4CHTB 3TE6A 4LFBM 4AI6A 3GRYA 1XXHA 3AL0C 2MR9A 4MGHA 3WHLA 3LVWA 2VQFM 2BJWA 1Z5BA 2Z7JA 2MROB 1XXHE 3L25A 4X64M 5C18A 3I4VA 4LJ7A 4RF0A 3PNVA 2F5OA 1R7RA 5JI2E 1IXZA 2KXEA 1KSFX 3Q8XA 1KYIA 4DR3M 1GLNA 3HKPA 2J7NA 4NSRA 3J80S 1I4WA 3U6MA 1DV0A 4CGYB 3W67A 1Z59A 2DWZB 2WZJA 3AKZA 4JI2M 4EIWA 4DV2M 2HCBA 4MH0E 4LF5M 3RGSA 4M9ZA 1OKSA 1PJJA 3KW6A 1DGBA 2ZAOA 3FKEA 1G4AE 1ORYB 1TR8A 2Y20A 1G8PA 1PGYA 4WP2A 1XNQM 4PCZA 3H4JA 5ITYA 3J7BA 3SHGB 3FTFA 2UU9M 4L16A 2UXCM 3HX3A 3J2PB 1DO0A 1IXSA 4GITA 1L1TA 2H5XA 4M0DA 4OW0A 2CV1A 4R3DA 2UUAM 4CJ6A 1SXJB 3W0FA 1UM8A 1QZEA 2DNAA 3SYLA 2L6OA 3SHFA 3T1YM 1R2YA 2LVPC 1IN6A 1G59A 4WURA 4RF1A 2L4EA 4FCTA 1VQ1A 2XSZD 4ZPXA 5BPVA 5L8RF 1L2CA 2L2DA 4DR7M 3LMMA 3KSJA 2OOBA 4LJ6A 3GQ4A 2EUCA 3C9PA 3PNYA 4DUZM 1WJ7A 3FE3A 2VQEM 1L1ZA 2JZ1A 1XB2B 3UJNA 3U6EA 5DYGA 4GHLA 1NO1A 3EIEA 1GJSA 3SMSA 4YHHM 2N35A 5IWAM 2JY6B 4MGKE 3VK8A 4G3OA 1QVRA 2ZTDA 4CIZA 1ZV1A 4I5SA 1WGLA 1D0KA 1V33A 4AQYM 4JN6A 2G3QA 2ZAMA 1SXJC 3E4RA 4LY6A 3U6QA 4REZA 1E32A 2I7PA 2K47A 3K9OA 4NRWA 1JR3D 3KS8A 2CP8A 5IT9S 2ERCA 3PFIA 1IY1A 1QDTA 2CHGA 4NRVA 4IBJA 8CATA 1IBKM 4LCBA 4PD2A 3I51A 5FTJA 2R4JA 4QHSA 3FUTA 4KT0F 1NSFA 4IBFA 1GVNA 2B3TA 2DKLA 4XBOA 1I94M 4QHTA 1IY0A 5EXXA 5EXPA 2EJSA 4LJ4A 3U6CA 4GIPA 2QNJA
chains in the Genus database with same CATH topology
1NNUC 3HJSA 4B7GA 3HU3A 3IG8A 4B7HA 3TPZA 3SAWA 1W5SA 4JXJA 4G6ZA 1NY6A 2CE7A 2LWXA 3ILKA 4QNMA 3U61B 3ZCBB 4JI6M 1N33M 4I8OA 3SARA 3SASA 5EP4A 4JI0M 2QBYB 3UZUA 4DR2M 2LXEA 4DV4M 1GKIA 3FD9A 1PJIA 4JI1M 3KS4A 2G8LA 1IN7A 3NBIA 3U6SA 2R4EA 4IJEA 4LF7M 4DV6M 1Q3CA 4LGMA 4G4QA 3T15A 3U61A 2XSZA 4AG5A 2X8AA 5EP3A 5ITRA 1ZAEA 5E26A 3HHZA 4DV1M 2KRUA 4OVZA 1PM5A 3GRRA 3H4MA 2QBYA 2CV2A 2EA0A 3J27B 3LVVA 2HKJA 1QAQA 2E5LM 4DR6M 3WHKA 4B7FA 1H6UA 4X62M 1E9RA 3HWSA 1TGUA 3PVSA 3SMPA 2BJVA 4MB7A 2XFTA 1JR3A 1TDZA 3UGJA 4XGIA 3VK7A 3AV0A 4LRTA 1OJLA 4LFCM 2EO2A 5ITTA 3CTWB 2LNHC 2UUCM 2A5YB 4LF4M 2RKOA 1R2ZA 3AOGA 4ITQA 1IBMM 2M60A 4OX9M 1MX0A 1YE9A 1QAOA 2KZSA 1QAMA 4GRIA 3U5ZB 2XH9A 4B3SM 2D7HA 4CISA 1IXSB 3GLHB 4FW9A 3GLGA 4II7A 1OFHA 4AKHA 2CV0A 2DXIA 3KOYE 4QNRA 3JR5A 3THGA 3LQRA 4KHPM 4GMQA 4KO8A 2X49A 3TWLA 2BNKA 1K3XA 1N34M 3VKGA 2KA6B 2C9CA 4AKGA 4AZFA 5FLXS 3U5ZA 3JR4A 4LG2A 2RGOA 3L28A 2QCUA 4L4UA 4M9SA 4R7GA 1K3WA 4NXMM 3GLHA 3NWLA 5FTNA 3J7AS 4A3VB 5FTMA 3PXGA 2J7OA 1MU5A 4OU7A 2RGHA 3JAMS 1JQJC 4DV0M 4AG6A 4DV3M 4L8RC 5BR8M 1Q39A 5A2QS 2C5RA 1IBLM 4QOSA 4AW4A 4NOOB 1GL7A 4FCWA 2C98A 1DO2A 4LZZA 2F5QA 1C1KA 3HGIA 5EXTA 3FTEA 4LF9M 3GPXA 2OPFA 2QZ4A 3FYCA 3TL4X 2C9OA 2YNMD 2D7GA 3GRVA 4KLNA 1OFIA 1XWIA 3GO8A 4IJFA 1NY5A 5KPRA 2CFOA 5FTLA 4LJAA 3KVWA 3HHWA 3CF2A 4I4LA 2Z4RA 3K92A 3RFWA 3C58A 3A45A 2ZBKB 4JYAM 4GC9A 2LH0A 4IBGA 1NNJA 3U6DA 2D7EA 2DWNA 2DZNB 3SYKA 4LJ8A 3AOEA 3AOEC 4BLCA 3GPPA 3EIHA 3E9SA 2L7IA 1IN5A 5F3WA 4W5WA 3HU1A 2H1RA 2CHVA 3GP1A 2F5SA 5EP1A 4MGZE 2V1UA 1ZQ9A 4QOZC 4PDGA 5EP2A 1HT2E 5DYIA 2QP9X 1E94E 4GKKM 3GRUA 4OVZB 3K2LA 3CF6E 3MJ5A 1W5TA 5EJCA 4X65M 3U60B 3SC3A 2DVWB 4G4OA 5FTKA 4HLQA 1K82A 4IBKA 1N32M 2UXBM 2X4AA 1R6BX 4DR1M 3TQSA 4PT5A 2P5TA 1N77A 2DWMA 2CUZA 2XZFA 2I7NA 4GH9A 4YY3M 1J5EM 3LQQA 5E6JA 1N75A 4LF8M 3A42A 2V1CA 4B08A 4DV5M 3SFZA 2DZOB 5KQDA 3U60A 7CATA 4M0WA 4DV7M 4FWGA 4D80A 3B9PA 4IBDA 3FUVA 3VDUA 2XF3A 3GLGB 4NL4H 3FYDA 3UMMA 1NHGC 2QPAA 1NJFA 4B3TM 4D81A 3K8ZA 4B3MM 2C99A 1TH4A 2V6ZM 5LMNM 3T38A 2R18A 3DFZA 5KO3A 4TUWA 1TH2A 2UXDM 5JI3E 3GPYA 3KXEC 1SXJD 2L7HA 4LGYA 3RGPA 4L15A 4M9XA 2UUBM 3I4YA 3KOZE 1IM2A 3HJQA 5IZ7D 5KQ8A 3SBJA 3VLFB 3L29A 4DUYM 3GLIA 4JI4M 4RNAA 4S12A 1XMQM 3M0EA 1N36M 3GLFB 1HQCA 2AHMA 3KSXA 5EXSA 2QENA 2DWLA 2CHQA 4MGYE 2FFJA 2R62A 3KOWE 1LV7A 1Z5AA 2Y0TA 3VKHA 1HQYE 1HNXM 1FNNA 1GL6A 2YFQA 1DGGA 3D8LA 2F5NA 2NQ8C 2Z4SA 3R9XB 3D8BA 3M6AA 1XC8A 3GQ5A 3KOXE 3T1HM 2G5GX 1NJGA 3BOSA 4WW0A 5ITXA 3GLFA 3L2AA 1L2BA 3VDPA 1Z5CA 3GPUA 4G4NA 3M7GA 4PDIA 3KP1E 1QQWA 5ITXE 4JV5M 2C96A 4D82A 1KFVA 2Z3XA 5LMUM 4LRSA 1NVMA 1QZMA 2FE8A 4JI3M 4BB9A 4MM3B 2XLJA 1DGFA 4MGIE 4B3RM 4IBBA 2FOIC 3MK6A 4NXNM 4LJ5A 1HNWM 1L8QA 2KW0A 2XGNA 1IY2A 1QYRA 2YR0A 2Q2EB 1XNRM 1IN4A 3A46A 3FTDA 1X37A 4Z6YA 3K1JA 5ITQA 2XEPA 2HHHM 4GC5A 2OQ4A 1G41A 1S3SA 3AJIB 4LFAM 1IN8A 1XHBA 2HL7A 3TWKA 4G4RA 4FVMA 3GQ3A 3FUXA 3DA1A 4IBIA 2O5RA 3AFHA 3U6OA 1Z6TA 2ZM6M 1TH3A 2Y0QA 3U6LA 5EQTA 1SXJA 1G3IA 1J09A 2JA2A 3HU2A 1YSYA 2F5PA 4IBEA 4FWHA 1SXJE 2CEAA 4JI7M 5H37D 3SATA 1WXQA 5KPTA 3KP0E 4HL4A 1IQPA 3FUWA 4Z8XA 4NSOB 1N78A 3DOAA 3U6PA 3SAUA 4X66M 1NHWC 3CF0A 3HHXA 3L26A 4LF6M 2R45A 1DGHB 3RE8A 2F4VM 2ZANA 1TDHA 5IREB 5ITUA 3MHVC 4K0KM 4P16A 3L27A 1XMOM 4GHAA 1QANA 1T3TA 3DZDA 4GKJM 3HHYA 4FD2A 1EE8A 3IG5A 1IXRC 4AKIA 3FTCA 2FNAA 1YUBA 2KEBA 2XFSA 4L78A 3SAVA 3W0LB 2KZUA 5GKNA 2YQZA 3A98B 2DHRA 1DGHA 3TWMA 1D2NA 3VFDA 4JI5M 2Y21A 4DR4M 4I81A 4KODA 3ZC7B 3QWLA 4FCVA 3KFUG 1E9SA 3HJ8A 3OTOM 1HT1E 4LZJA 1VDDA 3ZH9B 2R46A 5DNYA 3J81S 1XXHB 4DR5M 3R8FA 4IBCA 3GLIB 2M5ZA 2R65A 3QAUA 1Q3BA 3KDSE 5KPZA 3UK6A 5FSWA 2XZUA 2KRKA 1J7KA 4JI8M 1HNZM 1HR0M 2W82A 4BBAA 3FUUA 2VIIA 4FWDA 4LJ9A 2L09A 4IIWA 1FJGM 5C1BA 4CHTB 4LFBM 3TE6A 4AI6A 3GRYA 1XXHA 3AL0C 4MGHA 3WHLA 3LVWA 2VQFM 2BJWA 1Z5BA 2Z7JA 3L25A 4X64M 5C18A 3I4VA 4LJ7A 4RF0A 3PNVA 2F5OA 1R7RA 5JI2E 1IXZA 2KXEA 1KSFX 3Q8XA 1KYIA 4DR3M 1GLNA 3HKPA 2J7NA 4NSRA 3J80S 1I4WA 3U6MA 4CGYB 1Z59A 2DWZB 3AKZA 4JI2M 4EIWA 4DV2M 2HCBA 4MH0E 4LF5M 3RGSA 4M9ZA 1PJJA 3KW6A 1DGBA 2ZAOA 3FKEA 1G4AE 1ORYB 2Y20A 1G8PA 1XNQM 4PCZA 5ITYA 3J7BA 3SHGB 3FTFA 2UU9M 4L16A 2UXCM 3J2PB 1DO0A 4GITA 1L1TA 4M0DA 4OW0A 2CV1A 4R3DA 2UUAM 1SXJB 3W0FA 1UM8A 1R2YA 3SHFA 3SYLA 2L6OA 3T1YM 1L2DA 1G59A 1IN6A 4WURA 4RF1A 4FCTA 2XSZD 4ZPXA 5BPVA 1L2CA 4DR7M 3LMMA 3KSJA 4LJ6A 3GQ4A 2EUCA 3PNYA 4DUZM 2VQEM 1L1ZA 3U6EA 3UJNA 5DYGA 4GHLA 3EIEA 3SMSA 4YHHM 5IWAM 4MGKE 3VK8A 1QVRA 4I5SA 4AQYM 4JN6A 3E4RA 2ZAMA 1SXJC 4LY6A 3U6QA 4REZA 1E32A 2I7PA 2K47A 4NRWA 1JR3D 3KS8A 5IT9S 2ERCA 3PFIA 1IY1A 2CHGA 4NRVA 4IBJA 8CATA 1IBKM 4LCBA 4PD2A 3I51A 5FTJA 2R4JA 4QHSA 3FUTA 1NSFA 4IBFA 1GVNA 4XBOA 1I94M 4QHTA 1IY0A 5EXXA 5EXPA 4LJ4A 3U6CA 4GIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7E A;  2DWN A;  2D7G A;  2DWL A;  4NL4 H;  2D7H A;  2DWM A; 
#chains in the Genus database with same CATH topology
 1NNU C;  2MJ5 B;  3HJS A;  4B7G A;  3HU3 A;  2JY7 A;  1CUK A;  1R5L A;  3IG8 A;  3TPZ A;  4B7H A;  2EKF A;  3SAW A;  1W5S A;  2QSF X;  4JXJ A;  1NV8 A;  1NY6 A;  2CE7 A;  2LWX A;  3ILK A;  4G6Z A;  4QNM A;  3E46 A;  3U61 B;  3ZCB B;  4JI6 M;  1N33 M;  2LBC A;  4I8O A;  3SAR A;  3SAS A;  1IFY A;  5EP4 A;  4JI0 M;  1VEJ A;  1RU3 A;  1PRB A;  2QBY B;  3UZU A;  4DR2 M;  2LXE A;  4DV4 M;  1GKI A;  3FD9 A;  1PJI A;  4JI1 M;  1PJT A;  1WHC A;  3KS4 A;  2G8L A;  1IN7 A;  3NBI A;  3U6S A;  1ZMV A;  2R4E A;  4IJE A;  4LF7 M;  4DV6 M;  1Q3C A;  2OOA A;  4LGM A;  4G4Q A;  3T15 A;  3U61 A;  2XSZ A;  3C3E A;  2X8A A;  4AG5 A;  5EP3 A;  5ITR A;  2DAE A;  1ZAE A;  5E26 A;  3HHZ A;  4DV1 M;  2KRU A;  4OVZ A;  2DAK A;  1PM5 A;  3GRR A;  3H4M A;  2QBY A;  2CV2 A;  2EA0 A;  2DEN A;  3J27 B;  4R71 A;  3LVV A;  2HKJ A;  4F2L A;  1QAQ A;  2E5L M;  4NC6 A;  3I04 M;  4DR6 M;  3WHK A;  4B7F A;  1H6U A;  4X62 M;  1E9R A;  3QYB A;  3HWS A;  1VEG A;  1TGU A;  3PVS A;  3SMP A;  2BJV A;  4GEW A;  2XFT A;  1JR3 A;  4MB7 A;  1TDZ A;  3UGJ A;  2O25 A;  4XGI A;  3VK7 A;  3AV0 A;  4LRT A;  1OJL A;  4LFC M;  1Y8G A;  1L2D A;  2EO2 A;  1JR3 E;  5ITT A;  3CTW B;  2LNH C;  1HJP A;  2UUC M;  2A5Y B;  2BWE A;  4LF4 M;  2RKO A;  1MN3 A;  3AOG A;  1R2Z A;  1IBM M;  2M60 A;  4ITQ A;  4OX9 M;  1MX0 A;  1AUA A;  1QAO A;  1YE9 A;  2KZS A;  1QAM A;  4GRI A;  3U5Z B;  3B7N A;  2XH9 A;  4B3S M;  2D7H A;  4CIS A;  1IXS B;  2LHC A;  2JY8 A;  3CGW A;  2WSF F;  3LCU A;  3GLH B;  4FW9 A;  1OAO C;  3GLG A;  4II7 A;  1OFH A;  4AKH A;  2CV0 A;  2DXI A;  3KOY E;  3GLG E;  4QNR A;  3JR5 A;  3THG A;  1YLA A;  3LQR A;  4KHP M;  2KNA A;  4GMQ A;  2X49 A;  4KO8 A;  2BNK A;  3TWL A;  1N34 M;  1K3X A;  3VKG A;  2KA6 B;  1EFU B;  2HWJ A;  2C9C A;  1JB0 F;  2JY5 A;  4AKG A;  4HEO A;  4AZF A;  5FLX S;  3U5Z A;  3JR4 A;  1QUT A;  1VDL A;  4LG2 A;  2RGO A;  3L28 A;  2QCU A;  4L4U A;  4M9S A;  4R7G A;  1K3W A;  4NXM M;  2JP7 A;  3GLH A;  3NWL A;  5FTN A;  3J7A S;  4A3V B;  5FTM A;  3PXG A;  4L6V 6;  2J7O A;  1MU5 A;  3GLH E;  4OU7 A;  2RGH A;  3JAM S;  1JQJ C;  4DV0 M;  2LHG A;  4AG6 A;  4DV3 M;  4L8R C;  2VF8 A;  1Q39 A;  5BR8 M;  5A2Q S;  2C5R A;  1IBL M;  4QOS A;  4AW4 A;  4NOO B;  1GL7 A;  4FCW A;  2C98 A;  2DHY A;  2FH0 A;  1DO2 A;  4LZZ A;  2F5Q A;  1C1K A;  3HGI A;  5EXT A;  3FTE A;  4LF9 M;  1ZMU A;  3GPX A;  2OPF A;  1GJT A;  2QQ8 A;  2QZ4 A;  3FYC A;  3TL4 X;  1C7Y A;  2C9O A;  2YNM D;  2D7G A;  3GRV A;  4KLN A;  1OFI A;  3T6P A;  1XWI A;  3GO8 A;  4IJF A;  1NY5 A;  5KPR A;  2CFO A;  5FTL A;  1T43 A;  3KVW A;  3HHW A;  4LJA A;  1OAI A;  4UN2 B;  3CF2 A;  4I4L A;  2RRU A;  4ANR A;  2Z4R A;  3K92 A;  3RFW A;  3C58 A;  3A45 A;  3QYE A;  2ZBK B;  4JYA M;  4GC9 A;  2LH0 A;  4IBG A;  1NNJ A;  3U6D A;  2D7E A;  4DBG B;  2DZN B;  2DWN A;  3SYK A;  1OIZ A;  2GQF A;  4LJ8 A;  3AOE A;  1PJS A;  3AOE C;  4BLC A;  3GPP A;  3EIH A;  3E9S A;  3ZQJ A;  2L7I A;  3BXW A;  1R4G A;  1IN5 A;  5F3W A;  1AIP C;  2JUJ A;  3HU1 A;  4W5W A;  1QUS A;  2H1R A;  3IEC A;  2CHV A;  3GP1 A;  2F5S A;  5EP1 A;  4MGZ E;  3HZJ A;  2LTU A;  2JXN A;  2V1U A;  1ZQ9 A;  4QOZ C;  4PDG A;  5EP2 A;  1HT2 E;  2R44 A;  5DYI A;  2QP9 X;  1E94 E;  4GKK M;  3B89 A;  3GRU A;  4OVZ B;  3K2L A;  3CF6 E;  3MJ5 A;  4XK8 F;  1W5T A;  3LCV B;  3B7Z A;  3E21 A;  5EJC A;  4X65 M;  1BVS A;  3U60 B;  3SC3 A;  2DVW B;  3F92 A;  4G4O A;  2FS1 A;  1Q02 A;  5FTK A;  4HLQ A;  2DAI A;  3W68 A;  1K82 A;  2R0I A;  4IBK A;  1N32 M;  2UXB M;  2X4A A;  1R6B X;  4DR1 M;  3TQS A;  4PT5 A;  4G4R A;  2K0B X;  2P5T A;  1N77 A;  2DWM A;  2CUZ A;  2DAG A;  2I7N A;  4GH9 A;  4YY3 M;  2XZF A;  1J5E M;  3LQQ A;  5E6J A;  1N75 A;  4LF8 M;  3A42 A;  2KNV A;  2APL A;  2V1C A;  4B08 A;  4DV5 M;  3SFZ A;  2DZO B;  3B7Q A;  5KQD A;  3U60 A;  7CAT A;  4M0W A;  4DV7 M;  4FWG A;  4D80 A;  3B9P A;  4IBD A;  1WIV A;  3FUV A;  3VDU A;  2XF3 A;  3GLG B;  4NL4 H;  3FYD A;  3UMM A;  1NHG C;  2K6B A;  2QPA A;  1NJF A;  4B3T M;  4D81 A;  3K8Z A;  4B3M M;  2C99 A;  1TH4 A;  2V6Z M;  5LMN M;  3T38 A;  2R18 A;  3DFZ A;  5KO3 A;  4TUW A;  2VF7 A;  3C3D A;  1TH2 A;  2UXD M;  5JI3 E;  3GPY A;  3KXE C;  1SXJ D;  2L7H A;  4LGY A;  3RGP A;  1GO5 A;  4L15 A;  4M9X A;  2UUB M;  3I4Y A;  3KOZ E;  1IM2 A;  3HJQ A;  5IZ7 D;  5KQ8 A;  3Q8G A;  3SBJ A;  3VLF B;  3L29 A;  4DUY M;  1VEK A;  3GLI A;  4JI4 M;  4RNA A;  4S12 A;  1SG9 A;  1XMQ M;  3M0E A;  1N36 M;  2JZ0 A;  3GLF B;  1NV9 A;  2KNZ A;  2OO9 A;  1HQC A;  2AHM A;  3GLI E;  1WGN A;  3KSX A;  2QEN A;  5EXS A;  2DWL A;  2CHQ A;  1D0L A;  4MGY E;  1T6O A;  2L4F A;  1QDR A;  3BBZ A;  2FFJ A;  2R62 A;  3KOW E;  1LV7 A;  1Z5A A;  2Y0T A;  3VKH A;  1HQY E;  1HNX M;  1FNN A;  1GL6 A;  2YFQ A;  1DGG A;  1UFZ A;  1LTM A;  3D8L A;  4Y28 F;  2NQ8 C;  1TTE A;  2Z4S A;  2F5N A;  2LVN C;  3R9X B;  3D8B A;  3M6A A;  1XC8 A;  3GQ5 A;  3KOX E;  3T1H M;  2G5G X;  1NJG A;  3BOS A;  4WW0 A;  5DFL A;  5ITX A;  3GLF A;  3L2A A;  1L2B A;  3VDP A;  1Z5C A;  3GPU A;  4G4N A;  3M7G A;  4PDI A;  3KP1 E;  2KHH A;  1QQW A;  1OQY A;  5ITX E;  2C96 A;  3GLF E;  4F1I A;  4JV5 M;  1EIJ A;  3IHP A;  3B74 A;  4D82 A;  1KFV A;  3FRH A;  2Z3X A;  5LMU M;  4LRS A;  1NVM A;  1QZM A;  2FE8 A;  4JI3 M;  4BB9 A;  4MM3 B;  2XLJ A;  1DGF A;  4MGI E;  4B3R M;  4IBB A;  2FOI C;  3MK6 A;  4NXN M;  4LJ5 A;  1HNW M;  1L8Q A;  2KW0 A;  2XGN A;  1IY2 A;  1QYR A;  2YR0 A;  2Q2E B;  1XNR M;  1IN4 A;  3A46 A;  3FTD A;  1X37 A;  4Z6Y A;  3K1J A;  5ITQ A;  2XEP A;  2HHH M;  4GC5 A;  2OQ4 A;  1G41 A;  3V76 A;  1S3S A;  3AJI B;  4LFA M;  1IN8 A;  1XHB A;  2HL7 A;  3TWK A;  2QHO B;  4FVM A;  3GQ3 A;  2CWB A;  3FUX A;  3DA1 A;  4IBI A;  2O5R A;  2BWB A;  3AFH A;  3U6O A;  1Z6T A;  2WSE F;  1TH3 A;  2Y0Q A;  2ZM6 M;  3U6L A;  5EQT A;  1SXJ A;  1G3I A;  1J09 A;  1ZMW A;  2JA2 A;  1YSY A;  3HU2 A;  2F5P A;  3FRI A;  4IBE A;  1V34 A;  2KDL A;  4FWH A;  1SXJ E;  1MJG M;  2CEA A;  4JI7 M;  5H37 D;  3SAT A;  1WXQ A;  5KPT A;  3KP0 E;  4HL4 A;  1IQP A;  3FUW A;  2HAK A;  4Z8X A;  4NSO B;  2JWS A;  1N78 A;  3DOA A;  3U6P A;  1VG5 A;  3SAU A;  1D0M A;  2R6F A;  1P3Q Q;  3HY5 A;  4X66 M;  1NHW C;  3CF0 A;  3HHX A;  3L26 A;  1G71 A;  2LVA A;  2R45 A;  4LF6 M;  1DGH B;  3RE8 A;  2F4V M;  2O01 F;  2ZAN A;  1TDH A;  5IRE B;  5ITU A;  2WSC F;  3K9P A;  3MHV C;  4K0K M;  4P16 A;  3L27 A;  1XMO M;  1OTR A;  4GHA A;  1TF0 B;  1QAN A;  3LW5 F;  1T3T A;  3DZD A;  2DI0 A;  4GKJ M;  2MGW A;  3HHY A;  4FD2 A;  1GAB A;  1EE8 A;  2Z8Y M;  1IXR C;  3IG5 A;  4AKI A;  3FTC A;  2FNA A;  2CRU A;  1YUB A;  2K9D A;  2LVO C;  2EKK A;  2KEB A;  2XFS A;  2MH8 A;  4L78 A;  3SAV A;  3W0L B;  2KZU A;  5GKN A;  2YQZ A;  3A98 B;  2DHR A;  1DGH A;  1WR1 B;  3TWM A;  1D2N A;  2DAM A;  1OIP A;  3VFD A;  4JI5 M;  2Y21 A;  4DR4 M;  4I81 A;  4KOD A;  3ZC7 B;  2LVQ D;  3QWL A;  4FCV A;  3MMP A;  3KFU G;  1E9S A;  3HJ8 A;  3OTO M;  1HT1 E;  2VDB B;  2ZTC A;  4LZJ A;  1VDD A;  3ZH9 B;  2R46 A;  5DNY A;  1PJQ A;  3NBX X;  3J81 S;  1V92 A;  2GNO A;  1XXH B;  4DR5 M;  4P17 A;  3R8F A;  4IBC A;  3GLI B;  2M5Z A;  2R65 A;  3I01 M;  1Q3B A;  3QAU A;  3KDS E;  5KPZ A;  3UK6 A;  2J5Y A;  2JNH A;  5FSW A;  2XZU A;  2KRK A;  1J7K A;  4JI8 M;  4RKU F;  1F4I A;  1HNZ M;  1HR0 M;  2DZL A;  2W82 A;  4BBA A;  3FUU A;  2VII A;  4FWD A;  4LJ9 A;  2L09 A;  4IIW A;  1FJG M;  5C1B A;  1A5T A;  4Q7J A;  4CHT B;  3TE6 A;  4LFB M;  4AI6 A;  3GRY A;  1XXH A;  3AL0 C;  2MR9 A;  4MGH A;  3WHL A;  3LVW A;  2VQF M;  2BJW A;  1Z5B A;  2Z7J A;  2MRO B;  1XXH E;  3L25 A;  4X64 M;  5C18 A;  3I4V A;  4LJ7 A;  4RF0 A;  3PNV A;  2F5O A;  1R7R A;  5JI2 E;  1IXZ A;  2KXE A;  1KSF X;  3Q8X A;  1KYI A;  4DR3 M;  1GLN A;  3HKP A;  2J7N A;  4NSR A;  3J80 S;  1I4W A;  3U6M A;  1DV0 A;  4CGY B;  3W67 A;  1Z59 A;  2DWZ B;  2WZJ A;  3AKZ A;  4JI2 M;  4EIW A;  4DV2 M;  2HCB A;  4MH0 E;  4LF5 M;  3RGS A;  4M9Z A;  1OKS A;  1PJJ A;  3KW6 A;  1DGB A;  2ZAO A;  3FKE A;  1G4A E;  1ORY B;  1TR8 A;  2Y20 A;  1G8P A;  1PGY A;  4WP2 A;  1XNQ M;  4PCZ A;  3H4J A;  5ITY A;  3J7B A;  3SHG B;  3FTF A;  2UU9 M;  4L16 A;  2UXC M;  3HX3 A;  3J2P B;  1DO0 A;  1IXS A;  4GIT A;  1L1T A;  2H5X A;  4M0D A;  4OW0 A;  2CV1 A;  4R3D A;  2UUA M;  4CJ6 A;  1SXJ B;  3W0F A;  1UM8 A;  1QZE A;  2DNA A;  3SYL A;  2L6O A;  3SHF A;  3T1Y M;  1R2Y A;  2LVP C;  1IN6 A;  1G59 A;  4WUR A;  4RF1 A;  2L4E A;  4FCT A;  1VQ1 A;  2XSZ D;  4ZPX A;  5BPV A;  5L8R F;  1L2C A;  2L2D A;  4DR7 M;  3LMM A;  3KSJ A;  2OOB A;  4LJ6 A;  3GQ4 A;  2EUC A;  3C9P A;  3PNY A;  4DUZ M;  1WJ7 A;  3FE3 A;  2VQE M;  1L1Z A;  2JZ1 A;  1XB2 B;  3UJN A;  3U6E A;  5DYG A;  4GHL A;  1NO1 A;  3EIE A;  1GJS A;  3SMS A;  4YHH M;  2N35 A;  5IWA M;  2JY6 B;  4MGK E;  3VK8 A;  4G3O A;  1QVR A;  2ZTD A;  4CIZ A;  1ZV1 A;  4I5S A;  1WGL A;  1D0K A;  1V33 A;  4AQY M;  4JN6 A;  2G3Q A;  2ZAM A;  1SXJ C;  3E4R A;  4LY6 A;  3U6Q A;  4REZ A;  1E32 A;  2I7P A;  2K47 A;  3K9O A;  4NRW A;  1JR3 D;  3KS8 A;  2CP8 A;  5IT9 S;  2ERC A;  3PFI A;  1IY1 A;  1QDT A;  2CHG A;  4NRV A;  4IBJ A;  8CAT A;  1IBK M;  4LCB A;  4PD2 A;  3I51 A;  5FTJ A;  2R4J A;  4QHS A;  3FUT A;  4KT0 F;  1NSF A;  4IBF A;  1GVN A;  2B3T A;  2DKL A;  4XBO A;  1I94 M;  4QHT A;  1IY0 A;  5EXX A;  5EXP A;  2EJS A;  4LJ4 A;  3U6C A;  4GIP A;  2QNJ A; 
#chains in the Genus database with same CATH homology
 1NNU C;  3HJS A;  4B7G A;  3HU3 A;  3IG8 A;  4B7H A;  3TPZ A;  3SAW A;  1W5S A;  4JXJ A;  4G6Z A;  1NY6 A;  2CE7 A;  2LWX A;  3ILK A;  4QNM A;  3U61 B;  3ZCB B;  4JI6 M;  1N33 M;  4I8O A;  3SAR A;  3SAS A;  5EP4 A;  4JI0 M;  2QBY B;  3UZU A;  4DR2 M;  2LXE A;  4DV4 M;  1GKI A;  3FD9 A;  1PJI A;  4JI1 M;  3KS4 A;  2G8L A;  1IN7 A;  3NBI A;  3U6S A;  2R4E A;  4IJE A;  4LF7 M;  4DV6 M;  1Q3C A;  4LGM A;  4G4Q A;  3T15 A;  3U61 A;  2XSZ A;  4AG5 A;  2X8A A;  5EP3 A;  5ITR A;  1ZAE A;  5E26 A;  3HHZ A;  4DV1 M;  2KRU A;  4OVZ A;  1PM5 A;  3GRR A;  3H4M A;  2QBY A;  2CV2 A;  2EA0 A;  3J27 B;  3LVV A;  2HKJ A;  1QAQ A;  2E5L M;  4DR6 M;  3WHK A;  4B7F A;  1H6U A;  4X62 M;  1E9R A;  3HWS A;  1TGU A;  3PVS A;  3SMP A;  2BJV A;  4MB7 A;  2XFT A;  1JR3 A;  1TDZ A;  3UGJ A;  4XGI A;  3VK7 A;  3AV0 A;  4LRT A;  1OJL A;  4LFC M;  2EO2 A;  5ITT A;  3CTW B;  2LNH C;  2UUC M;  2A5Y B;  4LF4 M;  2RKO A;  1R2Z A;  3AOG A;  4ITQ A;  1IBM M;  2M60 A;  4OX9 M;  1MX0 A;  1YE9 A;  1QAO A;  2KZS A;  1QAM A;  4GRI A;  3U5Z B;  2XH9 A;  4B3S M;  2D7H A;  4CIS A;  1IXS B;  3GLH B;  4FW9 A;  3GLG A;  4II7 A;  1OFH A;  4AKH A;  2CV0 A;  2DXI A;  3KOY E;  4QNR A;  3JR5 A;  3THG A;  3LQR A;  4KHP M;  4GMQ A;  4KO8 A;  2X49 A;  3TWL A;  2BNK A;  1K3X A;  1N34 M;  3VKG A;  2KA6 B;  2C9C A;  4AKG A;  4AZF A;  5FLX S;  3U5Z A;  3JR4 A;  4LG2 A;  2RGO A;  3L28 A;  2QCU A;  4L4U A;  4M9S A;  4R7G A;  1K3W A;  4NXM M;  3GLH A;  3NWL A;  5FTN A;  3J7A S;  4A3V B;  5FTM A;  3PXG A;  2J7O A;  1MU5 A;  4OU7 A;  2RGH A;  3JAM S;  1JQJ C;  4DV0 M;  4AG6 A;  4DV3 M;  4L8R C;  5BR8 M;  1Q39 A;  5A2Q S;  2C5R A;  1IBL M;  4QOS A;  4AW4 A;  4NOO B;  1GL7 A;  4FCW A;  2C98 A;  1DO2 A;  4LZZ A;  2F5Q A;  1C1K A;  3HGI A;  5EXT A;  3FTE A;  4LF9 M;  3GPX A;  2OPF A;  2QZ4 A;  3FYC A;  3TL4 X;  2C9O A;  2YNM D;  2D7G A;  3GRV A;  4KLN A;  1OFI A;  1XWI A;  3GO8 A;  4IJF A;  1NY5 A;  5KPR A;  2CFO A;  5FTL A;  4LJA A;  3KVW A;  3HHW A;  3CF2 A;  4I4L A;  2Z4R A;  3K92 A;  3RFW A;  3C58 A;  3A45 A;  2ZBK B;  4JYA M;  4GC9 A;  2LH0 A;  4IBG A;  1NNJ A;  3U6D A;  2D7E A;  2DWN A;  2DZN B;  3SYK A;  4LJ8 A;  3AOE A;  3AOE C;  4BLC A;  3GPP A;  3EIH A;  3E9S A;  2L7I A;  1IN5 A;  5F3W A;  4W5W A;  3HU1 A;  2H1R A;  2CHV A;  3GP1 A;  2F5S A;  5EP1 A;  4MGZ E;  2V1U A;  1ZQ9 A;  4QOZ C;  4PDG A;  5EP2 A;  1HT2 E;  5DYI A;  2QP9 X;  1E94 E;  4GKK M;  3GRU A;  4OVZ B;  3K2L A;  3CF6 E;  3MJ5 A;  1W5T A;  5EJC A;  4X65 M;  3U60 B;  3SC3 A;  2DVW B;  4G4O A;  5FTK A;  4HLQ A;  1K82 A;  4IBK A;  1N32 M;  2UXB M;  2X4A A;  1R6B X;  4DR1 M;  3TQS A;  4PT5 A;  2P5T A;  1N77 A;  2DWM A;  2CUZ A;  2XZF A;  2I7N A;  4GH9 A;  4YY3 M;  1J5E M;  3LQQ A;  5E6J A;  1N75 A;  4LF8 M;  3A42 A;  2V1C A;  4B08 A;  4DV5 M;  3SFZ A;  2DZO B;  5KQD A;  3U60 A;  7CAT A;  4M0W A;  4DV7 M;  4FWG A;  4D80 A;  3B9P A;  4IBD A;  3FUV A;  3VDU A;  2XF3 A;  3GLG B;  4NL4 H;  3FYD A;  3UMM A;  1NHG C;  2QPA A;  1NJF A;  4B3T M;  4D81 A;  3K8Z A;  4B3M M;  2C99 A;  1TH4 A;  2V6Z M;  5LMN M;  3T38 A;  2R18 A;  3DFZ A;  5KO3 A;  4TUW A;  1TH2 A;  2UXD M;  5JI3 E;  3GPY A;  3KXE C;  1SXJ D;  2L7H A;  4LGY A;  3RGP A;  4L15 A;  4M9X A;  2UUB M;  3I4Y A;  3KOZ E;  1IM2 A;  3HJQ A;  5IZ7 D;  5KQ8 A;  3SBJ A;  3VLF B;  3L29 A;  4DUY M;  3GLI A;  4JI4 M;  4RNA A;  4S12 A;  1XMQ M;  3M0E A;  1N36 M;  3GLF B;  1HQC A;  2AHM A;  3KSX A;  5EXS A;  2QEN A;  2DWL A;  2CHQ A;  4MGY E;  2FFJ A;  2R62 A;  3KOW E;  1LV7 A;  1Z5A A;  2Y0T A;  3VKH A;  1HQY E;  1HNX M;  1FNN A;  1GL6 A;  2YFQ A;  1DGG A;  3D8L A;  2F5N A;  2NQ8 C;  2Z4S A;  3R9X B;  3D8B A;  3M6A A;  1XC8 A;  3GQ5 A;  3KOX E;  3T1H M;  2G5G X;  1NJG A;  3BOS A;  4WW0 A;  5ITX A;  3GLF A;  3L2A A;  1L2B A;  3VDP A;  1Z5C A;  3GPU A;  4G4N A;  3M7G A;  4PDI A;  3KP1 E;  1QQW A;  5ITX E;  4JV5 M;  2C96 A;  4D82 A;  1KFV A;  2Z3X A;  5LMU M;  4LRS A;  1NVM A;  1QZM A;  2FE8 A;  4JI3 M;  4BB9 A;  4MM3 B;  2XLJ A;  1DGF A;  4MGI E;  4B3R M;  4IBB A;  2FOI C;  3MK6 A;  4NXN M;  4LJ5 A;  1HNW M;  1L8Q A;  2KW0 A;  2XGN A;  1IY2 A;  1QYR A;  2YR0 A;  2Q2E B;  1XNR M;  1IN4 A;  3A46 A;  3FTD A;  1X37 A;  4Z6Y A;  3K1J A;  5ITQ A;  2XEP A;  2HHH M;  4GC5 A;  2OQ4 A;  1G41 A;  1S3S A;  3AJI B;  4LFA M;  1IN8 A;  1XHB A;  2HL7 A;  3TWK A;  4G4R A;  4FVM A;  3GQ3 A;  3FUX A;  3DA1 A;  4IBI A;  2O5R A;  3AFH A;  3U6O A;  1Z6T A;  2ZM6 M;  1TH3 A;  2Y0Q A;  3U6L A;  5EQT A;  1SXJ A;  1G3I A;  1J09 A;  2JA2 A;  3HU2 A;  1YSY A;  2F5P A;  4IBE A;  4FWH A;  1SXJ E;  2CEA A;  4JI7 M;  5H37 D;  3SAT A;  1WXQ A;  5KPT A;  3KP0 E;  4HL4 A;  1IQP A;  3FUW A;  4Z8X A;  4NSO B;  1N78 A;  3DOA A;  3U6P A;  3SAU A;  4X66 M;  1NHW C;  3CF0 A;  3HHX A;  3L26 A;  4LF6 M;  2R45 A;  1DGH B;  3RE8 A;  2F4V M;  2ZAN A;  1TDH A;  5IRE B;  5ITU A;  3MHV C;  4K0K M;  4P16 A;  3L27 A;  1XMO M;  4GHA A;  1QAN A;  1T3T A;  3DZD A;  4GKJ M;  3HHY A;  4FD2 A;  1EE8 A;  3IG5 A;  1IXR C;  4AKI A;  3FTC A;  2FNA A;  1YUB A;  2KEB A;  2XFS A;  4L78 A;  3SAV A;  3W0L B;  2KZU A;  5GKN A;  2YQZ A;  3A98 B;  2DHR A;  1DGH A;  3TWM A;  1D2N A;  3VFD A;  4JI5 M;  2Y21 A;  4DR4 M;  4I81 A;  4KOD A;  3ZC7 B;  3QWL A;  4FCV A;  3KFU G;  1E9S A;  3HJ8 A;  3OTO M;  1HT1 E;  4LZJ A;  1VDD A;  3ZH9 B;  2R46 A;  5DNY A;  3J81 S;  1XXH B;  4DR5 M;  3R8F A;  4IBC A;  3GLI B;  2M5Z A;  2R65 A;  3QAU A;  1Q3B A;  3KDS E;  5KPZ A;  3UK6 A;  5FSW A;  2XZU A;  2KRK A;  1J7K A;  4JI8 M;  1HNZ M;  1HR0 M;  2W82 A;  4BBA A;  3FUU A;  2VII A;  4FWD A;  4LJ9 A;  2L09 A;  4IIW A;  1FJG M;  5C1B A;  4CHT B;  4LFB M;  3TE6 A;  4AI6 A;  3GRY A;  1XXH A;  3AL0 C;  4MGH A;  3WHL A;  3LVW A;  2VQF M;  2BJW A;  1Z5B A;  2Z7J A;  3L25 A;  4X64 M;  5C18 A;  3I4V A;  4LJ7 A;  4RF0 A;  3PNV A;  2F5O A;  1R7R A;  5JI2 E;  1IXZ A;  2KXE A;  1KSF X;  3Q8X A;  1KYI A;  4DR3 M;  1GLN A;  3HKP A;  2J7N A;  4NSR A;  3J80 S;  1I4W A;  3U6M A;  4CGY B;  1Z59 A;  2DWZ B;  3AKZ A;  4JI2 M;  4EIW A;  4DV2 M;  2HCB A;  4MH0 E;  4LF5 M;  3RGS A;  4M9Z A;  1PJJ A;  3KW6 A;  1DGB A;  2ZAO A;  3FKE A;  1G4A E;  1ORY B;  2Y20 A;  1G8P A;  1XNQ M;  4PCZ A;  5ITY A;  3J7B A;  3SHG B;  3FTF A;  2UU9 M;  4L16 A;  2UXC M;  3J2P B;  1DO0 A;  4GIT A;  1L1T A;  4M0D A;  4OW0 A;  2CV1 A;  4R3D A;  2UUA M;  1SXJ B;  3W0F A;  1UM8 A;  1R2Y A;  3SHF A;  3SYL A;  2L6O A;  3T1Y M;  1L2D A;  1G59 A;  1IN6 A;  4WUR A;  4RF1 A;  4FCT A;  2XSZ D;  4ZPX A;  5BPV A;  1L2C A;  4DR7 M;  3LMM A;  3KSJ A;  4LJ6 A;  3GQ4 A;  2EUC A;  3PNY A;  4DUZ M;  2VQE M;  1L1Z A;  3U6E A;  3UJN A;  5DYG A;  4GHL A;  3EIE A;  3SMS A;  4YHH M;  5IWA M;  4MGK E;  3VK8 A;  1QVR A;  4I5S A;  4AQY M;  4JN6 A;  3E4R A;  2ZAM A;  1SXJ C;  4LY6 A;  3U6Q A;  4REZ A;  1E32 A;  2I7P A;  2K47 A;  4NRW A;  1JR3 D;  3KS8 A;  5IT9 S;  2ERC A;  3PFI A;  1IY1 A;  2CHG A;  4NRV A;  4IBJ A;  8CAT A;  1IBK M;  4LCB A;  4PD2 A;  3I51 A;  5FTJ A;  2R4J A;  4QHS A;  3FUT A;  1NSF A;  4IBF A;  1GVN A;  4XBO A;  1I94 M;  4QHT A;  1IY0 A;  5EXX A;  5EXP A;  4LJ4 A;  3U6C A;  4GIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...