2D7EA

Crystal structure of n-terminal domain of pria from e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal protein N'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 18
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2d7eA01
2D7GA 2DWMA 2D7EA 2D7HA 2DWLA 4NL4H 2DWNA
chains in the Genus database with same CATH superfamily
1DGFA 2EKKA 2JNHA 2QZ4A 4CGYB 2HHHM 2BWBA 3K8ZA 1IQPA 3FTFA 4HLQA 1QVRA 4LJ7A 4LZJA 1JB0F 2UU9M 2H1RA 2CEAA 1IN8A 4A3VB 3GRRA 2ERCA 3GRYA 1GO5A 4AKIA 2VDBB 4NXMM 3CF2A 5ITRA 1T43A 2XGNA 4LJ4A 3FYCA 1QYRA 2R65A 2R4JA 3L29A 4II7A 2HAKA 4KO8A 1C7YA 4PDIA 1P3QQ 4XGIA 1HNXM 2JWSA 1Q3CA 2JY8A 2KW0A 4X64M 4IBEA 3GPYA 4M9SA 2YFQA 3QAUA 4R7GA 2QBYB 4NRVA 3TE6A 1IXSB 1GJTA 4MGKE 4WP2A 1VEGA 1SXJC 2DNAA 3KSJA 5A2QS 1K3XA 1PRBA 2WSCF 2FFJA 3NBXX 3LCUA 2L2DA 1IBKM 4ITQA 1OIZA 3C3DA 2KNZA 5EXTA 4KLNA 3DZDA 1G41A 1XHBA 3QYBA 1HT2E 2HWJA 2XZUA 1Q02A 2UXCM 3HWSA 2QP9X 1FNNA 3W0FA 4B7HA 2KXEA 4JXJA 4G4NA 1RU3A 4AKGA 3M6AA 4W5WA 3U5ZB 3V76A 2C9OA 2H5XA 2LVOC 3GPPA 3KSXA 2R62A 3FUTA 3E21A 2DZLA 3JAMS 2XF3A 4FCVA 1MN3A 4FWDA 2F4VM 2VF8A 3HU1A 1HT1E 2BJWA 1PJTA 1QAOA 2P5TA 5JI3E 5KO3A 3U6EA 4HEOA 1D2NA 3BXWA 4RNAA 3PNYA 1SXJE 1WJ7A 1NV8A 3LQQA 5KPZA 4I5SA 3GLHA 2WZJA 5FTKA 1IN5A 1QAMA 3PXGA 3MHVC 3U6OA 2W82A 2CWBA 1OKSA 2VQEM 4GRIA 3HKPA 2KZSA 4MB7A 3F92A 1SG9A 2FE8A 1ZQ9A 1PM5A 1QUTA 4NSOB 1IN6A 4NSRA 3GLGA 1GLNA 3DOAA 4LY6A 2UUBM 1NJGA 2JY7A 3I4VA 4ANRA 4AZFA 5KQDA 3LMMA 2NQ8C 3MJ5A 4IBBA 2ZAMA 1E32A 4CHTB 2VQFM 4K0KM 2DAIA 3GLIA 4DV5M 3JR5A 2UUCM 1G59A 4M0WA 4LGMA 1FJGM 3L26A 1PJIA 4JN6A 1IXRC 2DVWB 1J09A 2X4AA 4DUYM 4DV7M 2CHVA 5FLXS 4OX9M 3SASA 2LHCA 5EP2A 4FD2A 4NOOB 2XLJA 2F5NA 4B3SM 2J5YA 1QZMA 3BOSA 2APLA 2MJ5B 3H4MA 3UZUA 4DR2M 2XSZD 3IG5A 3LW5F 4NL4H 2RKOA 1YLAA 2JXNA 4X66M 1IFYA 4GHLA 1DV0A 1TR8A 2RGHA 3K1JA 3VLFB 3E46A 4OVZA 4GKKM 1ORYB 3HU3A 4DV2M 2D7EA 3HHWA 2FOIC 2DWLA 2LH0A 4DBGB 1NV9A 4G3OA 1R2YA 1F4IA 1VDLA 1XXHB 1OAIA 2KNAA 3KVWA 2L7HA 3MMPA 4L15A 4LGYA 4BBAA 5DNYA 2JUJA 1TH3A 3VK8A 2F5PA 1QAQA 4YY3M 1D0LA 2KDLA 4M9ZA 3VKGA 2QPAA 3EIEA 1HNZM 2DHRA 1W5TA 2O5RA 2HKJA 3GO8A 2BNKA 2KRUA 3J81S 2RGOA 4NC6A 3SAWA 1L1TA 1TDHA 2Z8YM 4GEWA 1AIPC 4LJ5A 1NNUC 3U6PA 5FTJA 3SMPA 4G4OA 4FW9A 1Z5AA 4TUWA 4MH0E 2M60A 2CHQA 3PFIA 3E4RA 4BB9A 2C5RA 3SMSA 4QNMA 3TWLA 4F1IA 1OAOC 1Z5CA 3TWKA 4DV1M 3U60A 3T1HM 3RFWA 4FWHA 5LMUM 3AJIB 3GRUA 3KW6A 3AL0C 3GQ4A 3KOYE 2X8AA 1OFHA 3J7BA 1L2CA 1E9SA 1OQYA 4LJ9A 3TL4X 1N33M 1WR1B 1TH2A 2M5ZA 3MK6A 4LJ8A 2EA0A 5FTLA 2F5QA 3PVSA 3IHPA 4IBFA 4P17A 1GABA 2GNOA 4AI6A 8CATA 2KEBA 4LZZA 1T3TA 5IREB 2LVPC 1QANA 1T6OA 2ZTDA 3UJNA 3OTOM 2Z4RA 4JI8M 3SHFA 2OOAA 1PJJA 3FRIA 2R44A 2ZANA 1IY0A 2D7HA 4B3TM 2QENA 3FRHA 3AFHA 1R5LA 1DO2A 1PJSA 3HGIA 4KT0F 1K82A 3VDUA 3U61B 4D82A 3KXEC 3LCVB 3GP1A 4LFAM 1GKIA 4S12A 3SYKA 2BJVA 3AKZA 2B3TA 3L28A 2KA6B 3K92A 3R9XB 4AQYM 3FUVA 1G4AE 2AHMA 2JY6B 5ITUA 2G3QA 2A5YB 4G4QA 1IM2A 2C98A 3FUXA 3TWMA 2J7NA 1QUSA 1GL6A 3HJQA 4BLCA 3GLHE 2Q2EB 3NBIA 5KQ8A 3K9PA 2DHYA 1LV7A 3ZH9B 1GVNA 1CUKA 3U6DA 4NXNM 1XMOM 1IXZA 3AOEC 1N36M 1IN7A 1SXJB 2DAGA 2LNHC 4IIWA 2HL7A 5F3WA 1ZMUA 3L27A 3VFDA 5C1BA 3GQ5A 3I4YA 2XSZA 3CTWB 3E9SA 1G71A 1R7RA 3GLGE 2CV2A 4DV3M 1HJPA 1AUAA 1NY6A 1QDRA 4DR4M 1N75A 3THGA 1ZV1A 4G6ZA 3IECA 1L1ZA 4B3RM 2YNMD 4DV6M 3GRVA 2QCUA 1NNJA 2CV1A 4LF5M 3KDSE 4P16A 3GLIE 2ZAOA 3B7NA 1VEJA 2WSEF 1DGHA 2KNVA 1KSFX 4GHAA 3FYDA 2QBYA 1H6UA 4AG6A 4JV5M 4JI6M 2K9DA 1WGNA 3W68A 1NO1A 2DWMA 1UFZA 4OVZB 3RE8A 3TQSA 4LF8M 3LVVA 2FS1A 4DUZM 3U6CA 1XB2B 1N77A 2FH0A 2EUCA 2F5SA 4RF1A 3C9PA 4DR3M 4JYAM 2YR0A 3J80S 4REZA 4LFBM 5ITXA 4IBGA 3CGWA 3U5ZA 3LQRA 4YHHM 1Z59A 2CE7A 4OW0A 4CJ6A 4B08A 3SAUA 1L2DA 1TGUA 3KOZE 2KRKA 3AOEA 2K0BX 4OU7A 5E26A 1G3IA 2JA2A 2L09A 3M0EA 3RGSA 1WXQA 3KP1E 1V92A 3HU2A 4DR7M 2DZOB 4HL4A 4IJEA 3SAVA 2R0IA 1W5SA 1D0MA 1V34A 1XWIA 4RF0A 4PT5A 4Z8XA 3R8FA 4QNRA 3AV0A 4L78A 1NJFA 3FKEA 3SHGB 2EO2A 4GITA 1JR3A 3FE3A 1IY1A 4D81A 2JZ1A 5EXPA 1N32M 4B7GA 1UM8A 4CIZA 2MROB 2R46A 1JQJC 3CF0A 3HHZA 4LFCM 3WHKA 1S3SA 3ZQJA 3UGJA 3J27B 4F2LA 3B9PA 2QNJA 1QDTA 2CRUA 4I4LA 2L6OA 2DZNB 4ZPXA 4GC9A 4LRSA 1PGYA 4LF4M 1G8PA 5ITYA 3B74A 2JZ0A 4I8OA 3T1YM 5DYIA 4QOSA 4DR1M 3GPXA 4L16A 3ZC7B 1WGLA 4UN2B 1EE8A 1I94M 4MGZE 3SBJA 1WHCA 1XNQM 4LF6M 1A5TA 4DR6M 4R3DA 1R2ZA 3DFZA 2CFOA 3D8BA 3GLFE 3JR4A 1KFVA 1BVSA 2K47A 1DO0A 1NHGC 1OIPA 5EQTA 4EIWA 5ITQA 1IN4A 1MX0A 2DENA 4GMQA 1K3WA 3GQ3A 3Q8GA 4L8RC 2CUZA 2V1UA 1XXHA 4NRWA 3QWLA 4FCTA 2UUAM 1VQ1A 2FNAA 4Z6YA 3KS8A 1J5EM 1NVMA 4L6V6 1JR3D 2EJSA 2Y20A 3VDPA 5H37D 5KPTA 4JI4M 5IWAM 4JI1M 3L25A 1MU5A 1C1KA 5FSWA 1LTMA 2CP8A 5IT9S 3GLFA 4XBOA 5EP3A 2J7OA 4WURA 3FUUA 2C99A 1R6BX 1Z5BA 1NHWC 3HHXA 4MGYE 1ZMVA 4XK8F 4R71A 1OFIA 2LWXA 3GLHB 3SC3A 3L2AA 2KZUA 3FTDA 4G4RA 2DAKA 1IY2A 2DI0A 3UK6A 2OO9A 3C58A 2LXEA 1DGHB 4AKHA 3H4JA 5DFLA 1DGBA 1ZAEA 2N35A 4CISA 4X65M 4AW4A 3GLGB 5EP1A 1TF0B 3I51A 7CATA 4PD2A 1HNWM 2G5GX 2R6FA 3HZJA 4JI7M 1OTRA 2VIIA 2DAEA 3W67A 2MR9A 3GLIB 3HY5A 2OOBA 1Q39A 1PJQA 4GIPA 4MGIE 2Y0QA 3UMMA 1GL7A 5C18A 2RRUA 2L4EA 3A45A 4X62M 1N34M 3Q8XA 2OQ4A 1DGGA 2K6BA 2LBCA 3VK7A 3SATA 1HQCA 5FTMA 4LCBA 2DKLA 5KPRA 5DYGA 1GJSA 4D80A 5L8RF 2QQ8A 4FWGA 2VF7A 2LVAA 4JI2M 3HX3A 3VKHA 3BBZA 1IBMM 3QYEA 5ITXE 3ZCBB 1IXSA 1TTEA 3A98B 3IG8A 3U61A 2ZM6M 1J7KA 3U6QA 1TDZA 4JI5M 2MGWA 2XH9A 2R18A 3B7QA 4I81A 2C9CA 4B3MM 2GQFA 1EIJA 2UXDM 1TH4A 2OPFA 5IZ7D 3A42A 2L4FA 3SFZA 3KOWE 3FUWA 3U6LA 4IBJA 4IBKA 4FCWA 2O25A 5EXSA 1Q3BA 2F5OA 4PCZA 3T38A 3KS4A 4MM3B 1D0KA 3B7ZA 5EP4A 4Q7JA 4M9XA 5FTNA 3KP0E 1HQYE 1QZEA 3B89A 4GH9A 4MGHA 4QOZC 2XFSA 1NY5A 4LF7M 2Y0TA 4GC5A 4DR5M 3U6SA 2LTUA 1IBLM 3SARA 2V6ZM 1SXJA 4LJAA 1JR3E 3HJSA 1QQWA 2XFTA 2R45A 3A46A 3D8LA 4DV4M 1I4WA 2JY5A 3PNVA 4PDGA 3J2PB 4LRTA 4IBDA 1V33A 1MJGM 1EFUB 2DAMA 2HCBA 3DA1A 3K2LA 4RKUF 3TPZA 5JI2E 3U60B 1XMQM 4AG5A 1ZMWA 2KHHA 5BR8M 3KFUG 2XZFA 4IBCA 3C3EA 2V1CA 2Z4SA 2G8LA 3EIHA 3NWLA 5LMNM 1HR0M 3ILKA 4JI0M 3RGPA 3W0LB 2QHOB 2WSFF 3CF6E 5GKNA 3M7GA 5BPVA 3GPUA 5E6JA 3HHYA 1KYIA 1NSFA 1VG5A 4QHSA 2Z7JA 2E5LM 5EXXA 3T15A 2L7IA 3SYLA 1X37A 3K9OA 4IJFA 5ITTA 3U6MA 1E94E 2EKFA 2Y21A 2X49A 3T6PA 3I01M 4KHPM 2O01F 1YUBA 1L2BA 1L8QA 1VDDA 4GKJM 2DWNA 3KOXE 3I04M 2LVQD 3WHLA 4LF9M 2QSFX 1N78A 1R4GA 3AOGA 1Z6TA 2JP7A 3HJ8A 1XNRM 2CHGA 3GLFB 3FTEA 5EJCA 1XXHE 2C96A 3FTCA 4LG2A 1WIVA 1YE9A 2UXBM 4FVMA 4B7FA 1SXJD 4M0DA 2YQZA 2I7NA 4IBIA 3FD9A 1Y8GA 2CV0A 2LVNC 1E9RA 2I7PA 1XC8A 2MH8A 4DV0M 2DXIA 3J7AS 4WW0A 2ZTCA 4Y28F 2XEPA 1VEKA 3LVWA 4LJ6A 2Z3XA 1YSYA 2D7GA 2DWZB 4JI3M 1OJLA 2R4EA 2ZBKB 4QHTA 4L4UA 2BWEA 4KODA 2LHGA
chains in the Genus database with same CATH topology
1DGFA 4CGYB 2QZ4A 2HHHM 3K8ZA 1IQPA 3FTFA 4HLQA 1QVRA 4LJ7A 4LZJA 2UU9M 2H1RA 2CEAA 1IN8A 4A3VB 3GRRA 2ERCA 3GRYA 4AKIA 4NXMM 3CF2A 5ITRA 2XGNA 4LJ4A 3FYCA 1QYRA 2R65A 2R4JA 3L29A 4II7A 4KO8A 4PDIA 4XGIA 1HNXM 1Q3CA 2KW0A 4X64M 3GPYA 4IBEA 4M9SA 2YFQA 3QAUA 4R7GA 2QBYB 4NRVA 3TE6A 1IXSB 4MGKE 5A2QS 1SXJC 3KSJA 1K3XA 2FFJA 1IBKM 4ITQA 5EXTA 4KLNA 3DZDA 1G41A 1XHBA 1HT2E 2XZUA 2UXCM 3HWSA 2QP9X 1FNNA 3W0FA 4B7HA 2KXEA 4JXJA 4G4NA 4AKGA 3M6AA 4W5WA 3U5ZB 2C9OA 3GPPA 3KSXA 2R62A 3FUTA 3JAMS 2XF3A 4FCVA 4FWDA 2F4VM 3HU1A 1HT1E 2BJWA 1QAOA 2P5TA 5JI3E 5KO3A 3U6EA 1D2NA 4RNAA 3PNYA 1SXJE 3LQQA 5KPZA 4I5SA 3GLHA 5FTKA 1IN5A 1QAMA 3PXGA 3MHVC 3U6OA 2W82A 2VQEM 4GRIA 3HKPA 2KZSA 4MB7A 2FE8A 1ZQ9A 1PM5A 4NSOB 1IN6A 4NSRA 3GLGA 1GLNA 3DOAA 4LY6A 2UUBM 1NJGA 4AZFA 3I4VA 5KQDA 5LMUM 3LMMA 2NQ8C 3MJ5A 4IBBA 2ZAMA 1E32A 4CHTB 2VQFM 4K0KM 3GLIA 4DV5M 3JR5A 2UUCM 1G59A 4M0WA 4LGMA 1FJGM 3L26A 1PJIA 4JN6A 1IXRC 2DVWB 1J09A 2X4AA 4DUYM 4DV7M 2CHVA 5FLXS 4OX9M 3SASA 5EP2A 4FD2A 4NOOB 2XLJA 2F5NA 4B3SM 1QZMA 3BOSA 3H4MA 3UZUA 4DR2M 2XSZD 3IG5A 4NL4H 2RKOA 4X66M 4GHLA 2RGHA 3K1JA 3VLFB 4OVZA 4GKKM 1ORYB 3HU3A 4DV2M 2D7EA 3HHWA 2FOIC 2DWLA 2LH0A 1R2YA 1XXHB 4L15A 3KVWA 3GPUA 2L7HA 4LGYA 5DNYA 4BBAA 2E5LM 1TH3A 3VK8A 2F5PA 1QAQA 4YY3M 4M9ZA 3VKGA 2QPAA 3EIEA 1HNZM 2DHRA 1W5TA 2O5RA 2HKJA 3GO8A 2BNKA 2KRUA 3J81S 2RGOA 3SAWA 1L1TA 1TDHA 4LJ5A 1NNUC 3U6PA 5FTJA 3SMPA 4G4OA 4FW9A 1Z5AA 4MH0E 2M60A 2CHQA 3PFIA 3E4RA 4BB9A 2C5RA 3SMSA 4QNMA 3TWLA 1Z5CA 3TWKA 4DV1M 3U60A 3T1HM 3RFWA 4FWHA 3AJIB 3GRUA 3KW6A 3AL0C 3GQ4A 3KOYE 2X8AA 1OFHA 3J7BA 1L2CA 1E9SA 4LJ9A 3TL4X 1N33M 3MK6A 1TH2A 2M5ZA 4LJ8A 2EA0A 2F5QA 5FTLA 3PVSA 4IBFA 4AI6A 8CATA 2KEBA 4LZZA 1T3TA 5IREB 1QANA 4JI8M 3UJNA 3OTOM 2Z4RA 3SHFA 1PJJA 2ZANA 1IY0A 2D7HA 4B3TM 2QENA 3AFHA 1DO2A 3HGIA 1K82A 3VDUA 3U61B 4D82A 3KXEC 3GP1A 4LFAM 1GKIA 4S12A 3SYKA 2BJVA 3AKZA 3L28A 2KA6B 3K92A 3R9XB 4AQYM 3FUVA 1G4AE 2AHMA 5ITUA 2A5YB 4G4QA 1IM2A 2C98A 3FUXA 3TWMA 2J7NA 1GL6A 3HJQA 4BLCA 2Q2EB 3NBIA 5KQ8A 1LV7A 3ZH9B 1GVNA 3U6DA 1XMOM 4NXNM 1IXZA 3AOEC 1N36M 1IN7A 1SXJB 2LNHC 4IIWA 2HL7A 5F3WA 3L27A 5C1BA 3GQ5A 3I4YA 2XSZA 3CTWB 3E9SA 1R7RA 2CV2A 4DV3M 1NY6A 4DR4M 1N75A 3THGA 4G6ZA 1L1ZA 4B3RM 2YNMD 4DV6M 3GRVA 2QCUA 1NNJA 2CV1A 4LF5M 3KDSE 4P16A 2ZAOA 1DGHA 1KSFX 4GHAA 3FYDA 2QBYA 1H6UA 4AG6A 4JV5M 4JI6M 2DWMA 4OVZB 3RE8A 3TQSA 4LF8M 3LVVA 4DUZM 3U6CA 1N77A 2F5SA 2EUCA 4RF1A 4JYAM 4DR3M 2YR0A 3J80S 4REZA 4LFBM 5ITXA 4IBGA 3U5ZA 3LQRA 4YHHM 1Z59A 2CE7A 4OW0A 1L2DA 4B08A 3SAUA 1TGUA 3KOZE 2KRKA 3AOEA 4OU7A 5E26A 1G3IA 2JA2A 2L09A 3M0EA 3RGSA 1WXQA 3KP1E 3HU2A 4DR7M 2DZOB 4HL4A 4IJEA 3SAVA 1W5SA 1XWIA 4RF0A 4PT5A 4Z8XA 3R8FA 4QNRA 3AV0A 4L78A 1NJFA 3FKEA 3SHGB 2EO2A 4GITA 1JR3A 1IY1A 4D81A 5EXPA 1N32M 4B7GA 1UM8A 2R46A 1JQJC 3CF0A 3HHZA 4LFCM 3WHKA 1S3SA 3UGJA 3J27B 3B9PA 4I4LA 2L6OA 2DZNB 4ZPXA 4GC9A 4LRSA 4LF4M 1G8PA 5ITYA 3T1YM 4I8OA 5DYIA 4QOSA 4DR1M 3GPXA 4L16A 3ZC7B 1EE8A 1I94M 4MGZE 3SBJA 1XNQM 4LF6M 4DR6M 4R3DA 1R2ZA 3DFZA 2CFOA 3D8BA 3JR4A 1KFVA 2K47A 1DO0A 1NHGC 5EQTA 4EIWA 5ITQA 1IN4A 1MX0A 4GMQA 1K3WA 4L8RC 3GQ3A 2CUZA 2V1UA 1XXHA 4NRWA 3QWLA 4FCTA 2UUAM 2FNAA 4KHPM 4Z6YA 3KS8A 1J5EM 1NVMA 1JR3D 3VDPA 2Y20A 5H37D 5KPTA 4JI4M 5IWAM 4JI1M 3L25A 1MU5A 1C1KA 5FSWA 5IT9S 3GLFA 4XBOA 5EP3A 2J7OA 4WURA 3FUUA 2C99A 1R6BX 1Z5BA 1NHWC 3HHXA 4MGYE 1OFIA 2LWXA 3GLHB 3SC3A 3L2AA 2KZUA 3FTDA 4G4RA 1IY2A 3UK6A 3C58A 2LXEA 1DGHB 4AKHA 1DGBA 1ZAEA 4CISA 4X65M 4AW4A 3GLGB 5EP1A 3I51A 7CATA 4PD2A 1HNWM 2G5GX 4JI7M 2VIIA 3GLIB 1Q39A 4GIPA 4MGIE 2Y0QA 3UMMA 1GL7A 5C18A 4X62M 3A45A 1N34M 3Q8XA 2OQ4A 1DGGA 3VK7A 3SATA 1HQCA 5FTMA 4LCBA 5KPRA 5DYGA 4D80A 4FWGA 4JI2M 3VKHA 1IBMM 5ITXE 3ZCBB 3A98B 3IG8A 3U61A 2ZM6M 1J7KA 3U6QA 1TDZA 4JI5M 2XH9A 2R18A 4I81A 2C9CA 4B3MM 2UXDM 1TH4A 2OPFA 5IZ7D 3A42A 3SFZA 3KOWE 3FUWA 3U6LA 4IBJA 4IBKA 4FCWA 5EXSA 2F5OA 1Q3BA 4PCZA 3T38A 3KS4A 4MM3B 5EP4A 4M9XA 5FTNA 3KP0E 1HQYE 4GH9A 4MGHA 4QOZC 2XFSA 1NY5A 4LF7M 2Y0TA 4GC5A 4DR5M 3U6SA 1IBLM 3SARA 2V6ZM 1SXJA 4LJAA 3HJSA 1QQWA 2XFTA 2R45A 3A46A 3D8LA 4DV4M 1I4WA 3PNVA 4PDGA 3J2PB 4LRTA 4IBDA 4TUWA 2HCBA 3DA1A 3K2LA 5JI2E 3TPZA 3U60B 1XMQM 4AG5A 5BR8M 3KFUG 2XZFA 4IBCA 2V1CA 2Z4SA 2G8LA 3EIHA 3NWLA 5LMNM 1HR0M 3ILKA 4JI0M 3RGPA 3W0LB 3CF6E 5GKNA 3M7GA 5BPVA 5E6JA 3HHYA 1KYIA 1NSFA 4QHSA 2Z7JA 5EXXA 3T15A 2L7IA 3SYLA 1X37A 4IJFA 5ITTA 3U6MA 1E94E 2Y21A 2X49A 1YUBA 1L2BA 1L8QA 1VDDA 4GKJM 2DWNA 3KOXE 3WHLA 4LF9M 1N78A 3AOGA 1Z6TA 3HJ8A 1XNRM 2CHGA 3GLFB 3FTEA 5EJCA 2C96A 3FTCA 2UXBM 4LG2A 1YE9A 4FVMA 4B7FA 1SXJD 4M0DA 2YQZA 2I7NA 4IBIA 3FD9A 2CV0A 1E9RA 2I7PA 1XC8A 4DV0M 2DXIA 3J7AS 4WW0A 2XEPA 3LVWA 4LJ6A 2Z3XA 1YSYA 2D7GA 2DWZB 4JI3M 1OJLA 2R4EA 2ZBKB 4QHTA 4L4UA 4KODA 3VFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7G A;  2DWM A;  2D7E A;  2D7H A;  2DWL A;  4NL4 H;  2DWN A; 
#chains in the Genus database with same CATH topology
 1DGF A;  2EKK A;  2JNH A;  2QZ4 A;  4CGY B;  2HHH M;  2BWB A;  3K8Z A;  1IQP A;  3FTF A;  4HLQ A;  1QVR A;  4LJ7 A;  4LZJ A;  1JB0 F;  2UU9 M;  2H1R A;  2CEA A;  1IN8 A;  4A3V B;  3GRR A;  2ERC A;  3GRY A;  1GO5 A;  4AKI A;  2VDB B;  4NXM M;  3CF2 A;  5ITR A;  1T43 A;  2XGN A;  4LJ4 A;  3FYC A;  1QYR A;  2R65 A;  2R4J A;  3L29 A;  4II7 A;  2HAK A;  4KO8 A;  1C7Y A;  4PDI A;  1P3Q Q;  4XGI A;  1HNX M;  2JWS A;  1Q3C A;  2JY8 A;  2KW0 A;  4X64 M;  4IBE A;  3GPY A;  4M9S A;  2YFQ A;  3QAU A;  4R7G A;  2QBY B;  4NRV A;  3TE6 A;  1IXS B;  1GJT A;  4MGK E;  4WP2 A;  1VEG A;  1SXJ C;  2DNA A;  3KSJ A;  5A2Q S;  1K3X A;  1PRB A;  2WSC F;  2FFJ A;  3NBX X;  3LCU A;  2L2D A;  1IBK M;  4ITQ A;  1OIZ A;  3C3D A;  2KNZ A;  5EXT A;  4KLN A;  3DZD A;  1G41 A;  1XHB A;  3QYB A;  1HT2 E;  2HWJ A;  2XZU A;  1Q02 A;  2UXC M;  3HWS A;  2QP9 X;  1FNN A;  3W0F A;  4B7H A;  2KXE A;  4JXJ A;  4G4N A;  1RU3 A;  4AKG A;  3M6A A;  4W5W A;  3U5Z B;  3V76 A;  2C9O A;  2H5X A;  2LVO C;  3GPP A;  3KSX A;  2R62 A;  3FUT A;  3E21 A;  2DZL A;  3JAM S;  2XF3 A;  4FCV A;  1MN3 A;  4FWD A;  2F4V M;  2VF8 A;  3HU1 A;  1HT1 E;  2BJW A;  1PJT A;  1QAO A;  2P5T A;  5JI3 E;  5KO3 A;  3U6E A;  4HEO A;  1D2N A;  3BXW A;  4RNA A;  3PNY A;  1SXJ E;  1WJ7 A;  1NV8 A;  3LQQ A;  5KPZ A;  4I5S A;  3GLH A;  2WZJ A;  5FTK A;  1IN5 A;  1QAM A;  3PXG A;  3MHV C;  3U6O A;  2W82 A;  2CWB A;  1OKS A;  2VQE M;  4GRI A;  3HKP A;  2KZS A;  4MB7 A;  3F92 A;  1SG9 A;  2FE8 A;  1ZQ9 A;  1PM5 A;  1QUT A;  4NSO B;  1IN6 A;  4NSR A;  3GLG A;  1GLN A;  3DOA A;  4LY6 A;  2UUB M;  1NJG A;  2JY7 A;  3I4V A;  4ANR A;  4AZF A;  5KQD A;  3LMM A;  2NQ8 C;  3MJ5 A;  4IBB A;  2ZAM A;  1E32 A;  4CHT B;  2VQF M;  4K0K M;  2DAI A;  3GLI A;  4DV5 M;  3JR5 A;  2UUC M;  1G59 A;  4M0W A;  4LGM A;  1FJG M;  3L26 A;  1PJI A;  4JN6 A;  1IXR C;  2DVW B;  1J09 A;  2X4A A;  4DUY M;  4DV7 M;  2CHV A;  5FLX S;  4OX9 M;  3SAS A;  2LHC A;  5EP2 A;  4FD2 A;  4NOO B;  2XLJ A;  2F5N A;  4B3S M;  2J5Y A;  1QZM A;  3BOS A;  2APL A;  2MJ5 B;  3H4M A;  3UZU A;  4DR2 M;  2XSZ D;  3IG5 A;  3LW5 F;  4NL4 H;  2RKO A;  1YLA A;  2JXN A;  4X66 M;  1IFY A;  4GHL A;  1DV0 A;  1TR8 A;  2RGH A;  3K1J A;  3VLF B;  3E46 A;  4OVZ A;  4GKK M;  1ORY B;  3HU3 A;  4DV2 M;  2D7E A;  3HHW A;  2FOI C;  2DWL A;  2LH0 A;  4DBG B;  1NV9 A;  4G3O A;  1R2Y A;  1F4I A;  1VDL A;  1XXH B;  1OAI A;  2KNA A;  3KVW A;  2L7H A;  3MMP A;  4L15 A;  4LGY A;  4BBA A;  5DNY A;  2JUJ A;  1TH3 A;  3VK8 A;  2F5P A;  1QAQ A;  4YY3 M;  1D0L A;  2KDL A;  4M9Z A;  3VKG A;  2QPA A;  3EIE A;  1HNZ M;  2DHR A;  1W5T A;  2O5R A;  2HKJ A;  3GO8 A;  2BNK A;  2KRU A;  3J81 S;  2RGO A;  4NC6 A;  3SAW A;  1L1T A;  1TDH A;  2Z8Y M;  4GEW A;  1AIP C;  4LJ5 A;  1NNU C;  3U6P A;  5FTJ A;  3SMP A;  4G4O A;  4FW9 A;  1Z5A A;  4TUW A;  4MH0 E;  2M60 A;  2CHQ A;  3PFI A;  3E4R A;  4BB9 A;  2C5R A;  3SMS A;  4QNM A;  3TWL A;  4F1I A;  1OAO C;  1Z5C A;  3TWK A;  4DV1 M;  3U60 A;  3T1H M;  3RFW A;  4FWH A;  5LMU M;  3AJI B;  3GRU A;  3KW6 A;  3AL0 C;  3GQ4 A;  3KOY E;  2X8A A;  1OFH A;  3J7B A;  1L2C A;  1E9S A;  1OQY A;  4LJ9 A;  3TL4 X;  1N33 M;  1WR1 B;  1TH2 A;  2M5Z A;  3MK6 A;  4LJ8 A;  2EA0 A;  5FTL A;  2F5Q A;  3PVS A;  3IHP A;  4IBF A;  4P17 A;  1GAB A;  2GNO A;  4AI6 A;  8CAT A;  2KEB A;  4LZZ A;  1T3T A;  5IRE B;  2LVP C;  1QAN A;  1T6O A;  2ZTD A;  3UJN A;  3OTO M;  2Z4R A;  4JI8 M;  3SHF A;  2OOA A;  1PJJ A;  3FRI A;  2R44 A;  2ZAN A;  1IY0 A;  2D7H A;  4B3T M;  2QEN A;  3FRH A;  3AFH A;  1R5L A;  1DO2 A;  1PJS A;  3HGI A;  4KT0 F;  1K82 A;  3VDU A;  3U61 B;  4D82 A;  3KXE C;  3LCV B;  3GP1 A;  4LFA M;  1GKI A;  4S12 A;  3SYK A;  2BJV A;  3AKZ A;  2B3T A;  3L28 A;  2KA6 B;  3K92 A;  3R9X B;  4AQY M;  3FUV A;  1G4A E;  2AHM A;  2JY6 B;  5ITU A;  2G3Q A;  2A5Y B;  4G4Q A;  1IM2 A;  2C98 A;  3FUX A;  3TWM A;  2J7N A;  1QUS A;  1GL6 A;  3HJQ A;  4BLC A;  3GLH E;  2Q2E B;  3NBI A;  5KQ8 A;  3K9P A;  2DHY A;  1LV7 A;  3ZH9 B;  1GVN A;  1CUK A;  3U6D A;  4NXN M;  1XMO M;  1IXZ A;  3AOE C;  1N36 M;  1IN7 A;  1SXJ B;  2DAG A;  2LNH C;  4IIW A;  2HL7 A;  5F3W A;  1ZMU A;  3L27 A;  3VFD A;  5C1B A;  3GQ5 A;  3I4Y A;  2XSZ A;  3CTW B;  3E9S A;  1G71 A;  1R7R A;  3GLG E;  2CV2 A;  4DV3 M;  1HJP A;  1AUA A;  1NY6 A;  1QDR A;  4DR4 M;  1N75 A;  3THG A;  1ZV1 A;  4G6Z A;  3IEC A;  1L1Z A;  4B3R M;  2YNM D;  4DV6 M;  3GRV A;  2QCU A;  1NNJ A;  2CV1 A;  4LF5 M;  3KDS E;  4P16 A;  3GLI E;  2ZAO A;  3B7N A;  1VEJ A;  2WSE F;  1DGH A;  2KNV A;  1KSF X;  4GHA A;  3FYD A;  2QBY A;  1H6U A;  4AG6 A;  4JV5 M;  4JI6 M;  2K9D A;  1WGN A;  3W68 A;  1NO1 A;  2DWM A;  1UFZ A;  4OVZ B;  3RE8 A;  3TQS A;  4LF8 M;  3LVV A;  2FS1 A;  4DUZ M;  3U6C A;  1XB2 B;  1N77 A;  2FH0 A;  2EUC A;  2F5S A;  4RF1 A;  3C9P A;  4DR3 M;  4JYA M;  2YR0 A;  3J80 S;  4REZ A;  4LFB M;  5ITX A;  4IBG A;  3CGW A;  3U5Z A;  3LQR A;  4YHH M;  1Z59 A;  2CE7 A;  4OW0 A;  4CJ6 A;  4B08 A;  3SAU A;  1L2D A;  1TGU A;  3KOZ E;  2KRK A;  3AOE A;  2K0B X;  4OU7 A;  5E26 A;  1G3I A;  2JA2 A;  2L09 A;  3M0E A;  3RGS A;  1WXQ A;  3KP1 E;  1V92 A;  3HU2 A;  4DR7 M;  2DZO B;  4HL4 A;  4IJE A;  3SAV A;  2R0I A;  1W5S A;  1D0M A;  1V34 A;  1XWI A;  4RF0 A;  4PT5 A;  4Z8X A;  3R8F A;  4QNR A;  3AV0 A;  4L78 A;  1NJF A;  3FKE A;  3SHG B;  2EO2 A;  4GIT A;  1JR3 A;  3FE3 A;  1IY1 A;  4D81 A;  2JZ1 A;  5EXP A;  1N32 M;  4B7G A;  1UM8 A;  4CIZ A;  2MRO B;  2R46 A;  1JQJ C;  3CF0 A;  3HHZ A;  4LFC M;  3WHK A;  1S3S A;  3ZQJ A;  3UGJ A;  3J27 B;  4F2L A;  3B9P A;  2QNJ A;  1QDT A;  2CRU A;  4I4L A;  2L6O A;  2DZN B;  4ZPX A;  4GC9 A;  4LRS A;  1PGY A;  4LF4 M;  1G8P A;  5ITY A;  3B74 A;  2JZ0 A;  4I8O A;  3T1Y M;  5DYI A;  4QOS A;  4DR1 M;  3GPX A;  4L16 A;  3ZC7 B;  1WGL A;  4UN2 B;  1EE8 A;  1I94 M;  4MGZ E;  3SBJ A;  1WHC A;  1XNQ M;  4LF6 M;  1A5T A;  4DR6 M;  4R3D A;  1R2Z A;  3DFZ A;  2CFO A;  3D8B A;  3GLF E;  3JR4 A;  1KFV A;  1BVS A;  2K47 A;  1DO0 A;  1NHG C;  1OIP A;  5EQT A;  4EIW A;  5ITQ A;  1IN4 A;  1MX0 A;  2DEN A;  4GMQ A;  1K3W A;  3GQ3 A;  3Q8G A;  4L8R C;  2CUZ A;  2V1U A;  1XXH A;  4NRW A;  3QWL A;  4FCT A;  2UUA M;  1VQ1 A;  2FNA A;  4Z6Y A;  3KS8 A;  1J5E M;  1NVM A;  4L6V 6;  1JR3 D;  2EJS A;  2Y20 A;  3VDP A;  5H37 D;  5KPT A;  4JI4 M;  5IWA M;  4JI1 M;  3L25 A;  1MU5 A;  1C1K A;  5FSW A;  1LTM A;  2CP8 A;  5IT9 S;  3GLF A;  4XBO A;  5EP3 A;  2J7O A;  4WUR A;  3FUU A;  2C99 A;  1R6B X;  1Z5B A;  1NHW C;  3HHX A;  4MGY E;  1ZMV A;  4XK8 F;  4R71 A;  1OFI A;  2LWX A;  3GLH B;  3SC3 A;  3L2A A;  2KZU A;  3FTD A;  4G4R A;  2DAK A;  1IY2 A;  2DI0 A;  3UK6 A;  2OO9 A;  3C58 A;  2LXE A;  1DGH B;  4AKH A;  3H4J A;  5DFL A;  1DGB A;  1ZAE A;  2N35 A;  4CIS A;  4X65 M;  4AW4 A;  3GLG B;  5EP1 A;  1TF0 B;  3I51 A;  7CAT A;  4PD2 A;  1HNW M;  2G5G X;  2R6F A;  3HZJ A;  4JI7 M;  1OTR A;  2VII A;  2DAE A;  3W67 A;  2MR9 A;  3GLI B;  3HY5 A;  2OOB A;  1Q39 A;  1PJQ A;  4GIP A;  4MGI E;  2Y0Q A;  3UMM A;  1GL7 A;  5C18 A;  2RRU A;  2L4E A;  3A45 A;  4X62 M;  1N34 M;  3Q8X A;  2OQ4 A;  1DGG A;  2K6B A;  2LBC A;  3VK7 A;  3SAT A;  1HQC A;  5FTM A;  4LCB A;  2DKL A;  5KPR A;  5DYG A;  1GJS A;  4D80 A;  5L8R F;  2QQ8 A;  4FWG A;  2VF7 A;  2LVA A;  4JI2 M;  3HX3 A;  3VKH A;  3BBZ A;  1IBM M;  3QYE A;  5ITX E;  3ZCB B;  1IXS A;  1TTE A;  3A98 B;  3IG8 A;  3U61 A;  2ZM6 M;  1J7K A;  3U6Q A;  1TDZ A;  4JI5 M;  2MGW A;  2XH9 A;  2R18 A;  3B7Q A;  4I81 A;  2C9C A;  4B3M M;  2GQF A;  1EIJ A;  2UXD M;  1TH4 A;  2OPF A;  5IZ7 D;  3A42 A;  2L4F A;  3SFZ A;  3KOW E;  3FUW A;  3U6L A;  4IBJ A;  4IBK A;  4FCW A;  2O25 A;  5EXS A;  1Q3B A;  2F5O A;  4PCZ A;  3T38 A;  3KS4 A;  4MM3 B;  1D0K A;  3B7Z A;  5EP4 A;  4Q7J A;  4M9X A;  5FTN A;  3KP0 E;  1HQY E;  1QZE A;  3B89 A;  4GH9 A;  4MGH A;  4QOZ C;  2XFS A;  1NY5 A;  4LF7 M;  2Y0T A;  4GC5 A;  4DR5 M;  3U6S A;  2LTU A;  1IBL M;  3SAR A;  2V6Z M;  1SXJ A;  4LJA A;  1JR3 E;  3HJS A;  1QQW A;  2XFT A;  2R45 A;  3A46 A;  3D8L A;  4DV4 M;  1I4W A;  2JY5 A;  3PNV A;  4PDG A;  3J2P B;  4LRT A;  4IBD A;  1V33 A;  1MJG M;  1EFU B;  2DAM A;  2HCB A;  3DA1 A;  3K2L A;  4RKU F;  3TPZ A;  5JI2 E;  3U60 B;  1XMQ M;  4AG5 A;  1ZMW A;  2KHH A;  5BR8 M;  3KFU G;  2XZF A;  4IBC A;  3C3E A;  2V1C A;  2Z4S A;  2G8L A;  3EIH A;  3NWL A;  5LMN M;  1HR0 M;  3ILK A;  4JI0 M;  3RGP A;  3W0L B;  2QHO B;  2WSF F;  3CF6 E;  5GKN A;  3M7G A;  5BPV A;  3GPU A;  5E6J A;  3HHY A;  1KYI A;  1NSF A;  1VG5 A;  4QHS A;  2Z7J A;  2E5L M;  5EXX A;  3T15 A;  2L7I A;  3SYL A;  1X37 A;  3K9O A;  4IJF A;  5ITT A;  3U6M A;  1E94 E;  2EKF A;  2Y21 A;  2X49 A;  3T6P A;  3I01 M;  4KHP M;  2O01 F;  1YUB A;  1L2B A;  1L8Q A;  1VDD A;  4GKJ M;  2DWN A;  3KOX E;  3I04 M;  2LVQ D;  3WHL A;  4LF9 M;  2QSF X;  1N78 A;  1R4G A;  3AOG A;  1Z6T A;  2JP7 A;  3HJ8 A;  1XNR M;  2CHG A;  3GLF B;  3FTE A;  5EJC A;  1XXH E;  2C96 A;  3FTC A;  4LG2 A;  1WIV A;  1YE9 A;  2UXB M;  4FVM A;  4B7F A;  1SXJ D;  4M0D A;  2YQZ A;  2I7N A;  4IBI A;  3FD9 A;  1Y8G A;  2CV0 A;  2LVN C;  1E9R A;  2I7P A;  1XC8 A;  2MH8 A;  4DV0 M;  2DXI A;  3J7A S;  4WW0 A;  2ZTC A;  4Y28 F;  2XEP A;  1VEK A;  3LVW A;  4LJ6 A;  2Z3X A;  1YSY A;  2D7G A;  2DWZ B;  4JI3 M;  1OJL A;  2R4E A;  2ZBK B;  4QHT A;  4L4U A;  2BWE A;  4KOD A;  2LHG A; 
#chains in the Genus database with same CATH homology
 1DGF A;  4CGY B;  2QZ4 A;  2HHH M;  3K8Z A;  1IQP A;  3FTF A;  4HLQ A;  1QVR A;  4LJ7 A;  4LZJ A;  2UU9 M;  2H1R A;  2CEA A;  1IN8 A;  4A3V B;  3GRR A;  2ERC A;  3GRY A;  4AKI A;  4NXM M;  3CF2 A;  5ITR A;  2XGN A;  4LJ4 A;  3FYC A;  1QYR A;  2R65 A;  2R4J A;  3L29 A;  4II7 A;  4KO8 A;  4PDI A;  4XGI A;  1HNX M;  1Q3C A;  2KW0 A;  4X64 M;  3GPY A;  4IBE A;  4M9S A;  2YFQ A;  3QAU A;  4R7G A;  2QBY B;  4NRV A;  3TE6 A;  1IXS B;  4MGK E;  5A2Q S;  1SXJ C;  3KSJ A;  1K3X A;  2FFJ A;  1IBK M;  4ITQ A;  5EXT A;  4KLN A;  3DZD A;  1G41 A;  1XHB A;  1HT2 E;  2XZU A;  2UXC M;  3HWS A;  2QP9 X;  1FNN A;  3W0F A;  4B7H A;  2KXE A;  4JXJ A;  4G4N A;  4AKG A;  3M6A A;  4W5W A;  3U5Z B;  2C9O A;  3GPP A;  3KSX A;  2R62 A;  3FUT A;  3JAM S;  2XF3 A;  4FCV A;  4FWD A;  2F4V M;  3HU1 A;  1HT1 E;  2BJW A;  1QAO A;  2P5T A;  5JI3 E;  5KO3 A;  3U6E A;  1D2N A;  4RNA A;  3PNY A;  1SXJ E;  3LQQ A;  5KPZ A;  4I5S A;  3GLH A;  5FTK A;  1IN5 A;  1QAM A;  3PXG A;  3MHV C;  3U6O A;  2W82 A;  2VQE M;  4GRI A;  3HKP A;  2KZS A;  4MB7 A;  2FE8 A;  1ZQ9 A;  1PM5 A;  4NSO B;  1IN6 A;  4NSR A;  3GLG A;  1GLN A;  3DOA A;  4LY6 A;  2UUB M;  1NJG A;  4AZF A;  3I4V A;  5KQD A;  5LMU M;  3LMM A;  2NQ8 C;  3MJ5 A;  4IBB A;  2ZAM A;  1E32 A;  4CHT B;  2VQF M;  4K0K M;  3GLI A;  4DV5 M;  3JR5 A;  2UUC M;  1G59 A;  4M0W A;  4LGM A;  1FJG M;  3L26 A;  1PJI A;  4JN6 A;  1IXR C;  2DVW B;  1J09 A;  2X4A A;  4DUY M;  4DV7 M;  2CHV A;  5FLX S;  4OX9 M;  3SAS A;  5EP2 A;  4FD2 A;  4NOO B;  2XLJ A;  2F5N A;  4B3S M;  1QZM A;  3BOS A;  3H4M A;  3UZU A;  4DR2 M;  2XSZ D;  3IG5 A;  4NL4 H;  2RKO A;  4X66 M;  4GHL A;  2RGH A;  3K1J A;  3VLF B;  4OVZ A;  4GKK M;  1ORY B;  3HU3 A;  4DV2 M;  2D7E A;  3HHW A;  2FOI C;  2DWL A;  2LH0 A;  1R2Y A;  1XXH B;  4L15 A;  3KVW A;  3GPU A;  2L7H A;  4LGY A;  5DNY A;  4BBA A;  2E5L M;  1TH3 A;  3VK8 A;  2F5P A;  1QAQ A;  4YY3 M;  4M9Z A;  3VKG A;  2QPA A;  3EIE A;  1HNZ M;  2DHR A;  1W5T A;  2O5R A;  2HKJ A;  3GO8 A;  2BNK A;  2KRU A;  3J81 S;  2RGO A;  3SAW A;  1L1T A;  1TDH A;  4LJ5 A;  1NNU C;  3U6P A;  5FTJ A;  3SMP A;  4G4O A;  4FW9 A;  1Z5A A;  4MH0 E;  2M60 A;  2CHQ A;  3PFI A;  3E4R A;  4BB9 A;  2C5R A;  3SMS A;  4QNM A;  3TWL A;  1Z5C A;  3TWK A;  4DV1 M;  3U60 A;  3T1H M;  3RFW A;  4FWH A;  3AJI B;  3GRU A;  3KW6 A;  3AL0 C;  3GQ4 A;  3KOY E;  2X8A A;  1OFH A;  3J7B A;  1L2C A;  1E9S A;  4LJ9 A;  3TL4 X;  1N33 M;  3MK6 A;  1TH2 A;  2M5Z A;  4LJ8 A;  2EA0 A;  2F5Q A;  5FTL A;  3PVS A;  4IBF A;  4AI6 A;  8CAT A;  2KEB A;  4LZZ A;  1T3T A;  5IRE B;  1QAN A;  4JI8 M;  3UJN A;  3OTO M;  2Z4R A;  3SHF A;  1PJJ A;  2ZAN A;  1IY0 A;  2D7H A;  4B3T M;  2QEN A;  3AFH A;  1DO2 A;  3HGI A;  1K82 A;  3VDU A;  3U61 B;  4D82 A;  3KXE C;  3GP1 A;  4LFA M;  1GKI A;  4S12 A;  3SYK A;  2BJV A;  3AKZ A;  3L28 A;  2KA6 B;  3K92 A;  3R9X B;  4AQY M;  3FUV A;  1G4A E;  2AHM A;  5ITU A;  2A5Y B;  4G4Q A;  1IM2 A;  2C98 A;  3FUX A;  3TWM A;  2J7N A;  1GL6 A;  3HJQ A;  4BLC A;  2Q2E B;  3NBI A;  5KQ8 A;  1LV7 A;  3ZH9 B;  1GVN A;  3U6D A;  1XMO M;  4NXN M;  1IXZ A;  3AOE C;  1N36 M;  1IN7 A;  1SXJ B;  2LNH C;  4IIW A;  2HL7 A;  5F3W A;  3L27 A;  5C1B A;  3GQ5 A;  3I4Y A;  2XSZ A;  3CTW B;  3E9S A;  1R7R A;  2CV2 A;  4DV3 M;  1NY6 A;  4DR4 M;  1N75 A;  3THG A;  4G6Z A;  1L1Z A;  4B3R M;  2YNM D;  4DV6 M;  3GRV A;  2QCU A;  1NNJ A;  2CV1 A;  4LF5 M;  3KDS E;  4P16 A;  2ZAO A;  1DGH A;  1KSF X;  4GHA A;  3FYD A;  2QBY A;  1H6U A;  4AG6 A;  4JV5 M;  4JI6 M;  2DWM A;  4OVZ B;  3RE8 A;  3TQS A;  4LF8 M;  3LVV A;  4DUZ M;  3U6C A;  1N77 A;  2F5S A;  2EUC A;  4RF1 A;  4JYA M;  4DR3 M;  2YR0 A;  3J80 S;  4REZ A;  4LFB M;  5ITX A;  4IBG A;  3U5Z A;  3LQR A;  4YHH M;  1Z59 A;  2CE7 A;  4OW0 A;  1L2D A;  4B08 A;  3SAU A;  1TGU A;  3KOZ E;  2KRK A;  3AOE A;  4OU7 A;  5E26 A;  1G3I A;  2JA2 A;  2L09 A;  3M0E A;  3RGS A;  1WXQ A;  3KP1 E;  3HU2 A;  4DR7 M;  2DZO B;  4HL4 A;  4IJE A;  3SAV A;  1W5S A;  1XWI A;  4RF0 A;  4PT5 A;  4Z8X A;  3R8F A;  4QNR A;  3AV0 A;  4L78 A;  1NJF A;  3FKE A;  3SHG B;  2EO2 A;  4GIT A;  1JR3 A;  1IY1 A;  4D81 A;  5EXP A;  1N32 M;  4B7G A;  1UM8 A;  2R46 A;  1JQJ C;  3CF0 A;  3HHZ A;  4LFC M;  3WHK A;  1S3S A;  3UGJ A;  3J27 B;  3B9P A;  4I4L A;  2L6O A;  2DZN B;  4ZPX A;  4GC9 A;  4LRS A;  4LF4 M;  1G8P A;  5ITY A;  3T1Y M;  4I8O A;  5DYI A;  4QOS A;  4DR1 M;  3GPX A;  4L16 A;  3ZC7 B;  1EE8 A;  1I94 M;  4MGZ E;  3SBJ A;  1XNQ M;  4LF6 M;  4DR6 M;  4R3D A;  1R2Z A;  3DFZ A;  2CFO A;  3D8B A;  3JR4 A;  1KFV A;  2K47 A;  1DO0 A;  1NHG C;  5EQT A;  4EIW A;  5ITQ A;  1IN4 A;  1MX0 A;  4GMQ A;  1K3W A;  4L8R C;  3GQ3 A;  2CUZ A;  2V1U A;  1XXH A;  4NRW A;  3QWL A;  4FCT A;  2UUA M;  2FNA A;  4KHP M;  4Z6Y A;  3KS8 A;  1J5E M;  1NVM A;  1JR3 D;  3VDP A;  2Y20 A;  5H37 D;  5KPT A;  4JI4 M;  5IWA M;  4JI1 M;  3L25 A;  1MU5 A;  1C1K A;  5FSW A;  5IT9 S;  3GLF A;  4XBO A;  5EP3 A;  2J7O A;  4WUR A;  3FUU A;  2C99 A;  1R6B X;  1Z5B A;  1NHW C;  3HHX A;  4MGY E;  1OFI A;  2LWX A;  3GLH B;  3SC3 A;  3L2A A;  2KZU A;  3FTD A;  4G4R A;  1IY2 A;  3UK6 A;  3C58 A;  2LXE A;  1DGH B;  4AKH A;  1DGB A;  1ZAE A;  4CIS A;  4X65 M;  4AW4 A;  3GLG B;  5EP1 A;  3I51 A;  7CAT A;  4PD2 A;  1HNW M;  2G5G X;  4JI7 M;  2VII A;  3GLI B;  1Q39 A;  4GIP A;  4MGI E;  2Y0Q A;  3UMM A;  1GL7 A;  5C18 A;  4X62 M;  3A45 A;  1N34 M;  3Q8X A;  2OQ4 A;  1DGG A;  3VK7 A;  3SAT A;  1HQC A;  5FTM A;  4LCB A;  5KPR A;  5DYG A;  4D80 A;  4FWG A;  4JI2 M;  3VKH A;  1IBM M;  5ITX E;  3ZCB B;  3A98 B;  3IG8 A;  3U61 A;  2ZM6 M;  1J7K A;  3U6Q A;  1TDZ A;  4JI5 M;  2XH9 A;  2R18 A;  4I81 A;  2C9C A;  4B3M M;  2UXD M;  1TH4 A;  2OPF A;  5IZ7 D;  3A42 A;  3SFZ A;  3KOW E;  3FUW A;  3U6L A;  4IBJ A;  4IBK A;  4FCW A;  5EXS A;  2F5O A;  1Q3B A;  4PCZ A;  3T38 A;  3KS4 A;  4MM3 B;  5EP4 A;  4M9X A;  5FTN A;  3KP0 E;  1HQY E;  4GH9 A;  4MGH A;  4QOZ C;  2XFS A;  1NY5 A;  4LF7 M;  2Y0T A;  4GC5 A;  4DR5 M;  3U6S A;  1IBL M;  3SAR A;  2V6Z M;  1SXJ A;  4LJA A;  3HJS A;  1QQW A;  2XFT A;  2R45 A;  3A46 A;  3D8L A;  4DV4 M;  1I4W A;  3PNV A;  4PDG A;  3J2P B;  4LRT A;  4IBD A;  4TUW A;  2HCB A;  3DA1 A;  3K2L A;  5JI2 E;  3TPZ A;  3U60 B;  1XMQ M;  4AG5 A;  5BR8 M;  3KFU G;  2XZF A;  4IBC A;  2V1C A;  2Z4S A;  2G8L A;  3EIH A;  3NWL A;  5LMN M;  1HR0 M;  3ILK A;  4JI0 M;  3RGP A;  3W0L B;  3CF6 E;  5GKN A;  3M7G A;  5BPV A;  5E6J A;  3HHY A;  1KYI A;  1NSF A;  4QHS A;  2Z7J A;  5EXX A;  3T15 A;  2L7I A;  3SYL A;  1X37 A;  4IJF A;  5ITT A;  3U6M A;  1E94 E;  2Y21 A;  2X49 A;  1YUB A;  1L2B A;  1L8Q A;  1VDD A;  4GKJ M;  2DWN A;  3KOX E;  3WHL A;  4LF9 M;  1N78 A;  3AOG A;  1Z6T A;  3HJ8 A;  1XNR M;  2CHG A;  3GLF B;  3FTE A;  5EJC A;  2C96 A;  3FTC A;  2UXB M;  4LG2 A;  1YE9 A;  4FVM A;  4B7F A;  1SXJ D;  4M0D A;  2YQZ A;  2I7N A;  4IBI A;  3FD9 A;  2CV0 A;  1E9R A;  2I7P A;  1XC8 A;  4DV0 M;  2DXI A;  3J7A S;  4WW0 A;  2XEP A;  3LVW A;  4LJ6 A;  2Z3X A;  1YSY A;  2D7G A;  2DWZ B;  4JI3 M;  1OJL A;  2R4E A;  2ZBK B;  4QHT A;  4L4U A;  4KOD A;  3VFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...