4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
4FCVA 1IM2A 2ZAMA 1NJGA 4GITA 4LJ8A 5FTMA 1OFIA 1XXHB 2QBYA 3BOSA 3PFIA 5FTLA 5EP3A 1SXJD 3HU1A 5FTNA 3HU2A 3ZH9B 5FTKA 4LJAA 1E32A 1IXRC 3PVSA 1DO0A 4FCWA 1S3SA 4QNRA 4A3VB 1IXZA 5FTJA 4LRTA 4D80A 1DO2A 1NY5A 1G3IA 1G4AE 3D8BA 2R65A 2VIIA 4I4LA 4EIWA 1HQCA 2V6ZM 4QNMA 1IQPA 1NY6A 2Z4SA 1SXJA 1JQJC 4D82A 1X37A 1HT1E 2CE7A 4KO8A 4QHTA 5EQTA 3WHLA 2ZAOA 3AJIB 2DZOB 3CF0A 2RKOA 4I81A 3GLIA 1SXJC 1W5SA 3KW6A 5EP1A 4FWGA 1KSFX 1LV7A 2V1UA 3M0EA 1IN7A 2BJVA 4L4UA 2KRKA 3GLHB 3H4MA 5EXTA 1SXJE 3SYKA 1UM8A 4LJ9A 1IY1A 4LZZA 5EXSA 4QHSA 5EXXA 2BJWA 1XXHA 2QBYB 2CHVA 4L15A 4FD2A 3U60B 2Z4RA 3GLFA 4Z8XA 1D2NA 1G41A 4QOSA 3GLGB 2C96A 1NVMA 3HU3A 2CHGA 1E94E 1IY2A 4FWDA 5C18A 5EXPA 1QZMA 3MHVC 5JI3E 1IN5A 4JN6A 3UK6A 4FW9A 1IN8A 2QPAA 2QENA 3R8FA 1IN6A 4LGMA 1HQYE 2C9OA 2DWZB 1IY0A 2DZNB 3SYLA 2CHQA 3CF2A 3WHKA 4WW0A 5EP2A 3PXGA 3EIHA 3HWSA 4KODA 3SC3A 4LJ7A 3M6AA 1HT2E 1OFHA 3VFDA 5C1BA 2FNAA 4KLNA 3EIEA 1QVRA 2C99A 3GLHA 2QZ4A 5JI2E 4LJ5A 4LRSA 2ZANA 4FCTA 1C1KA 1JR3A 1R6BX 2X8AA 5DYIA 3U5ZB 3DZDA 1SXJB 3U61B 4LJ4A 4ZPXA 1OJLA 3GLFB 1XWIA 1NSFA 1JR3D 3GLGA 1FNNA 2C98A 1IN4A 2HCBA 4L16A 1IXSB 2XSZA 3K1JA 2XSZD 2QP9X 1W5TA 2R62A 1KYIA 1R7RA 2C9CA 4FWHA 3GLIB 2CEAA 3KDSE 2DHRA 4LJ6A 4LY6A 1J7KA 1NJFA 5DYGA 3VLFB 1L8QA 4D81A 4LCBA 2DVWB 5EP4A 3B9PA
chains in the Genus database with same CATH superfamily
2I7PA 4FCVA 5KPZA 1L1ZA 2KW0A 1UFZA 2Z3XA 5KQ8A 2R4JA 3AOGA 4IBGA 1TH2A 2QHOB 4LJ8A 3QYBA 3RGPA 4JI0M 5FTLA 2EKKA 1G71A 3HJQA 5FTNA 3KOYE 2LVAA 1AIPC 1ZV1A 3L29A 3BXWA 3FTEA 3I04M 4B7FA 5LMUM 4OX9M 3LVWA 4CHTB 4QNRA 4B3MM 4NSRA 2CV0A 4Q7JA 2FOIC 3L26A 4DR4M 2ERCA 2LTUA 1NY5A 1QQWA 2MH8A 2LBCA 4RF1A 2R65A 3FUUA 4I8OA 1IQPA 2W82A 1NY6A 3U6DA 1VDLA 4IBJA 3JAMS 3A46A 1QZEA 3WHLA 4QHTA 2J7OA 2KZSA 2ZAOA 4LFBM 4JI7M 4GEWA 3CF0A 2RKOA 4AI6A 3K92A 3SATA 4PT5A 4DR6M 2UU9M 3TE6A 4IBCA 3GLIA 1ZMWA 2O01F 2BNKA 4FWGA 4GC5A 1WHCA 4XK8F 2C5RA 2BJVA 2G3QA 1SXJE 2DZLA 3ZC7B 1AUAA 2R45A 4JI6M 4LJ9A 2VQEM 1IBMM 2KNAA 2A5YB 2L09A 2JY6B 2BJWA 1JB0F 2JUJA 2OPFA 2LWXA 2J5YA 4M9XA 2K6BA 4X65M 5A2QS 4LF7M 1CUKA 1Y8GA 4NRVA 2EA0A 3VKGA 4DR5M 4YY3M 2RGHA 2FE8A 4GKJM 1TTEA 2DAKA 3FUTA 3U6MA 1Q02A 4CJ6A 1NVMA 3HU3A 1R2YA 1TH4A 4FWDA 5C18A 3MMPA 1PJQA 1QZMA 1VEGA 2FFJA 2L4FA 3T38A 3KOWE 3UK6A 4R3DA 1OAOC 3U5ZA 4G4QA 3RFWA 5DFLA 2K0BX 2DWZB 3UJNA 1N34M 3QAUA 2YR0A 3PXGA 3PNYA 1G59A 3EIHA 3FRHA 4XGIA 5BPVA 3C3EA 5IWAM 5FLXS 1HT2E 4B08A 5C1BA 1TDHA 1D0MA 1QVRA 2C99A 3B89A 1QUSA 2QZ4A 3KSXA 4LJ5A 4LRSA 3AL0C 1MX0A 4L78A 2MR9A 2Z7JA 1C1KA 2XFTA 4WURA 3FE3A 3HJ8A 3W68A 1OJLA 4AG5A 2ZM6M 1XWIA 1NSFA 2D7EA 3SAUA 2UUCM 4CISA 1FNNA 2C98A 1IN4A 3CF6E 1EE8A 4IJFA 4L16A 1IBKM 3K1JA 2Q2EB 1D0KA 2RGOA 3HHZA 3LVVA 1VEKA 4FWHA 3GLIB 3ZCBB 2UUBM 2L6OA 2DHRA 3IG5A 3U6PA 5KPTA 2HWJA 3Q8XA 4M0DA 1J7KA 4LGYA 5IZ7D 5KO3A 1TGUA 4FVMA 1K3WA 4LF6M 1GKIA 3TQSA 3I4YA 2OQ4A 1DGBA 2DVWB 1ZMUA 4Y28F 2KZUA 3LCVB 1NJGA 2VQFM 2LHCA 3J80S 5ITTA 5FTMA 3GLHE 1OFIA 4KT0F 3L25A 1VDDA 4MGKE 3HU1A 4IJEA 3HU2A 4NOOB 3AOEC 3ZH9B 1NNUC 1T3TA 4LJAA 3HGIA 2ZTCA 1QAQA 1NV9A 3L27A 4DBGB 2XF3A 1TR8A 2CWBA 1DO0A 1VG5A 2AHMA 3UGJA 2LVOC 1ORYB 2P5TA 4FCWA 2KNZA 3NBIA 4LRTA 4D80A 4GKKM 1DO2A 2X4AA 1HR0M 4JI4M 4WP2A 1G4AE 4BLCA 3J27B 2V6ZM 2LH0A 1JQJC 1SXJA 4DV1M 4R71A 1X37A 3L28A 1HT1E 2CE7A 1K3XA 3J81S 3E21A 3W0FA 1T43A 3D8LA 4RF0A 1ZMVA 2CFOA 4R7GA 4IBIA 4DR3M 3U60A 2UUAM 4GHLA 2D7HA 5E26A 1PRBA 2JP7A 4RNAA 2DXIA 1WGNA 1W5SA 4NRWA 2V1UA 1LV7A 2Y0TA 3UZUA 3M0EA 1IN7A 4PCZA 3C58A 2EKFA 4L4UA 2M5ZA 1GABA 5EXTA 3PNVA 1UM8A 4AQYM 4OVZA 1GLNA 4M9ZA 3K9OA 1N78A 4MGYE 4LZZA 8CATA 1P3QQ 4JV5M 4QHSA 1DGGA 4OU7A 3U6SA 2R6FA 3T1HM 1Z59A 1L2BA 1WIVA 2G5GX 3I4VA 1HNZM 3B7NA 1IXSA 4DR7M 3SMSA 2RRUA 2Z4RA 3GLGE 1TF0B 4F2LA 1NHWC 1N36M 2R18A 1D2NA 1G41A 1WXQA 4QOSA 3U6OA 2CP8A 3GRRA 3J2PB 4B3RM 1MN3A 3FUVA 2CHGA 3H4JA 4LZJA 3AFHA 1IY2A 5EXPA 1IN5A 4AKHA 4FW9A 3HZJA 4DV0M 1EFUB 2QENA 3J7BA 5L8RF 3DOAA 2CRUA 3KS8A 1HQYE 2HL7A 2XZFA 1QAMA 2L7HA 5ITXE 4LFAM 3CF2A 4WW0A 2LVPC 2OOAA 2I7NA 3LW5F 1QDTA 2MJ5B 3M6AA 1OFHA 3SFZA 1QANA 2WSEF 4KLNA 5ITRA 2KXEA 2DWMA 1NO1A 4S12A 4NL4H 2O5RA 7CATA 1PM5A 3HHWA 1JR3E 1Q3CA 2ZANA 2CV1A 2X8AA 5DYIA 4IBDA 3U61B 1GJSA 4LJ4A 3GLFB 1GVNA 4MGIE 3GO8A 4B7HA 4CGYB 2QNJA 4YHHM 1N77A 1QAOA 4DUYM 1W5TA 1IFYA 2R62A 2KHHA 2Y21A 1R7RA 2N35A 2R0IA 2F5PA 3I01M 5ITUA 2LVQD 1HJPA 5DYGA 3VLFB 3TWKA 4DR1M 3VDPA 2M60A 2JY8A 5EP4A 2H1RA 1OKSA 1NHGC 4GITA 4DV6M 3SMPA 3GQ5A 2D7GA 1MU5A 4JI2M 5FTKA 4NXMM 3LCUA 2J7NA 4MB7A 1E32A 2KEBA 3PVSA 4IBEA 2UXBM 1QUTA 1L2DA 2YNMD 4A3VB 3GPUA 5FTJA 4HLQA 2DAGA 2BWEA 2JY5A 3LQRA 1T6OA 1SG9A 3D8BA 4I4LA 2VIIA 4B3TM 3SBJA 1HQCA 1V33A 3C9PA 2DWNA 2YFQA 3SARA 1K82A 2MROB 2Z4SA 2DKLA 1N33M 4KO8A 3HJSA 5EQTA 2DI0A 3SAVA 5E6JA 2NQ8C 4L6V6 5DNYA 3AJIB 3QWLA 2DWLA 4AKGA 4I81A 4GC9A 4MH0E 4B3SM 1SXJC 1XHBA 5EP1A 2GQFA 1KSFX 4G3OA 2XFSA 3FYDA 3T6PA 1I94M 2UXCM 3SHGB 2KRKA 3H4MA 1F4IA 2QQ8A 3SYKA 2VDBB 3UMMA 1IY1A 1NV8A 1Z6TA 4LF4M 1J09A 3GPPA 1E9RA 2K47A 3SAWA 5F3WA 2CHVA 3NWLA 3HHXA 2KRUA 3MJ5A 4LF9M 2EO2A 4FD2A 3GRYA 3U60B 1N32M 2YQZA 4NSOB 1E9SA 1DGHA 2HKJA 3E9SA 5IREB 2F5NA 1OIPA 1V92A 3KSJA 1J5EM 1YSYA 1VQ1A 2DAMA 1GO5A 1GJTA 3GLIE 3MHVC 1ZQ9A 4G4RA 2JXNA 1TH3A 4AKIA 3FTCA 3VK8A 1Q3BA 4QOZC 3ZQJA 4JYAM 2QPAA 2BWBA 3A98B 3GLFE 3VKHA 4LGMA 2DAIA 2DZNB 3U6EA 2L2DA 1IY0A 2Y20A 2XZUA 3SYLA 3GPYA 2HHHM 1R4GA 3GRVA 4IBFA 2HAKA 3A45A 1XC8A 3FTDA 4JXJA 2XH9A 4PDIA 4NXNM 3L2AA 3HWSA 3TWLA 3GP1A 3K2LA 1Z5AA 3Q8GA 2F5OA 3VFDA 1FJGM 1V34A 3AOEA 3GLHA 3TL4X 4X62M 2FH0A 4K0KM 3C3DA 4FCTA 3M7GA 4DV7M 1R6BX 2FS1A 4DUZM 4BB9A 3U5ZB 3DZDA 1SXJB 2F5QA 2JWSA 2L7IA 1DGHB 4TUWA 1N75A 1QYRA 3NBXX 1JR3D 4MGZE 4NC6A 3I51A 2K9DA 2O25A 1L2CA 2ZTDA 4IIWA 1PJJA 3E46A 1KFVA 1Z5CA 3F92A 4M9SA 4RKUF 2CEAA 3A42A 3MK6A 2EUCA 3KDSE 4LJ6A 2DENA 3KOZE 3W67A 1XMOM 5ITQA 4I5SA 3RE8A 3W0LB 4PD2A 3JR5A 1TDZA 4L8RC 2VF8A 3B9PA 4G4OA 3KP0E 4CIZA 1IM2A 2ZAMA 4JI5M 1Q39A 2JNHA 1XXHB 2QBYA 3BOSA 3PFIA 4GMQA 2EJSA 4GH9A 4XBOA 5EP3A 1IBLM 1SXJD 1G8PA 1YLAA 5EJCA 2E5LM 1ZAEA 3AV0A 4LFCM 5H37D 3KP1E 2WSCF 1IXRC 2R44A 3TWMA 1GL7A 1PGYA 1R2ZA 2JY7A 3HHYA 1S3SA 1D0LA 1IXZA 2WSFF 1PJSA 3CGWA 3GQ3A 4GRIA 2LXEA 2GNOA 2XEPA 3DFZA 3E4RA 3IG8A 1G3IA 5ITXA 1OQYA 2OOBA 2R46A 4B7GA 4EIWA 3OTOM 4QNMA 3SHFA 2XLJA 4D82A 4DR2M 3SASA 2L4EA 3FUWA 4LG2A 1H6UA 1XNRM 1NNJA 3KS4A 3CTWB 3RGSA 3U6QA 1XB2B 2DZOB 4ANRA 3KW6A 5GKNA 4W5WA 3VDUA 4II7A 3GPXA 3V76A 2Z8YM 3HY5A 3GLHB 2DAEA 4AW4A 3K9PA 2VF7A 1HNXM 4JI8M 4LF8M 4KHPM 3HKPA 3LQQA 3FUXA 1DV0A 1HNWM 5EXSA 2Y0QA 5EXXA 4ITQA 4GHAA 1WJ7A 1XXHA 4BBAA 2QBYB 3ILKA 4JI1M 3FD9A 3K8ZA 4MGHA 1XXHE 2QCUA 4L15A 2JZ1A 2G8LA 5IT9S 4IBKA 4DV3M 1XMQM 2XGNA 2LHGA 3BBZA 3VK7A 3TPZA 1L1TA 4AZFA 3GLFA 4Z8XA 4REZA 3GLGB 2C96A 4DV4M 1RU3A 4P16A 2DHYA 4HEOA 3R9XB 3DA1A 4DV5M 3FYCA 1E94E 2APLA 3B7ZA 4G6ZA 3IHPA 3U6LA 1LTMA 3J7AS 2UXDM 3AKZA 5JI3E 1OIZA 5KPRA 2QSFX 3KXEC 4GIPA 4JN6A 1IN8A 1OTRA 2H5XA 3KFUG 5FSWA 3R8FA 2X49A 1A5TA 1IN6A 1BVSA 3FKEA 4IBBA 2C9OA 4F1IA 2CV2A 1PJTA 4OW0A 2CHQA 2LVNC 3WHKA 1I4WA 5EP2A 1DGFA 3U6CA 4UN2B 4X66M 5BR8M 3GQ4A 2ZBKB 3FRIA 4KODA 3SC3A 1YUBA 1QDRA 4LJ7A 5KQDA 3B74A 4G4NA 3T1YM 2MGWA 2FNAA 2F5SA 3EIEA 1R5LA 2F4VM 4PDGA 5JI2E 3U61A 1PJIA 3FTFA 2DNAA 4OVZB 1WGLA 4DV2M 1XNQM 1OAIA 1JR3A 1MJGM 3HX3A 2V1CA 5LMNM 3LMMA 4X64M 4ZPXA 2OO9A 2WZJA 1C7YA 4Z6YA 2JA2A 2KA6B 3GLGA 3QYEA 2HCBA 3KVWA 2KNVA 3B7QA 1IXSB 2CUZA 3T15A 2XSZA 3KOXE 1Z5BA 2R4EA 2QP9X 2XSZD 3THGA 1EIJA 1KYIA 2LNHC 4LF5M 2C9CA 3GRUA 3IECA 2B3TA 2JZ0A 1VEJA 5ITYA 3JR4A 1WR1B 4LY6A 1NJFA 1YE9A 4M0WA 4HL4A 1L8QA 4MM3B 2KDLA 4D81A 4LCBA 4P17A 4AG6A 4JI3M 1GL6A
chains in the Genus database with same CATH topology
2I7PA 4FCVA 5KPZA 1L1ZA 2KW0A 2Z3XA 5KQ8A 2R4JA 3AOGA 4IBGA 1TH2A 4LJ8A 3RGPA 4JI0M 5FTLA 3HJQA 5FTNA 3KOYE 3L29A 3FTEA 4B7FA 5LMUM 4OX9M 3LVWA 4CHTB 4QNRA 4NSRA 2CV0A 2FOIC 3L26A 4DR4M 2ERCA 1NY5A 1QQWA 4RF1A 2R65A 3FUUA 4I8OA 1IQPA 2W82A 1NY6A 3U6DA 4IBJA 3JAMS 3A46A 3WHLA 4QHTA 2J7OA 2KZSA 2ZAOA 4LFBM 4JI7M 3CF0A 2RKOA 4AI6A 3K92A 3SATA 4PT5A 4DR6M 2UU9M 3TE6A 4IBCA 3GLIA 2BNKA 4FWGA 4GC5A 2C5RA 2BJVA 1SXJE 3ZC7B 2R45A 4JI6M 4LJ9A 2VQEM 1IBMM 2A5YB 2L09A 2BJWA 2OPFA 2LWXA 4M9XA 4X65M 5A2QS 4LF7M 2EA0A 4NRVA 3VKGA 4DR5M 4YY3M 2RGHA 2FE8A 4GKJM 3FUTA 3U6MA 1NVMA 3HU3A 1R2YA 1TH4A 4FWDA 5C18A 1QZMA 2FFJA 3T38A 3KOWE 3UK6A 4R3DA 3U5ZA 4G4QA 3RFWA 2DWZB 3UJNA 1N34M 3QAUA 2YR0A 3PXGA 3PNYA 1G59A 3EIHA 4XGIA 5BPVA 5IWAM 5FLXS 1HT2E 4B08A 5C1BA 1TDHA 1QVRA 2C99A 2QZ4A 3KSXA 4LJ5A 4LRSA 3AL0C 1MX0A 4L78A 2Z7JA 1C1KA 2XFTA 4WURA 3HJ8A 1OJLA 4AG5A 2ZM6M 1XWIA 1NSFA 2D7EA 3SAUA 2UUCM 4CISA 1FNNA 2C98A 1IN4A 3CF6E 1EE8A 4IJFA 4L16A 1IBKM 3K1JA 2Q2EB 2RGOA 3HHZA 3LVVA 4FWHA 3GLIB 3ZCBB 2UUBM 2L6OA 2DHRA 3IG5A 3U6PA 5KPTA 3Q8XA 4M0DA 1J7KA 4LGYA 5IZ7D 5KO3A 1TGUA 4FVMA 1K3WA 4LF6M 1GKIA 3TQSA 3I4YA 2OQ4A 1DGBA 2DVWB 2KZUA 1NJGA 2VQFM 3J80S 5ITTA 5FTMA 1OFIA 3L25A 1VDDA 4MGKE 3HU1A 4IJEA 3HU2A 4NOOB 3AOEC 3ZH9B 1NNUC 1T3TA 4LJAA 3HGIA 1QAQA 3L27A 3UGJA 2XF3A 1DO0A 2AHMA 1ORYB 2P5TA 4FCWA 3NBIA 4LRTA 4D80A 4GKKM 1DO2A 2X4AA 1HR0M 4JI4M 1G4AE 4BLCA 3J27B 2V6ZM 2LH0A 1JQJC 1SXJA 4DV1M 1X37A 3L28A 1HT1E 2CE7A 1K3XA 3J81S 3W0FA 3D8LA 4DR3M 4RF0A 3U60A 2CFOA 4R7GA 4IBIA 2UUAM 4GHLA 2D7HA 5E26A 4RNAA 2DXIA 4NRWA 1W5SA 2V1UA 1LV7A 2Y0TA 3UZUA 3M0EA 1IN7A 4PCZA 3C58A 4L4UA 2M5ZA 5EXTA 3PNVA 1UM8A 4AQYM 4OVZA 1GLNA 4M9ZA 1N78A 4MGYE 4LZZA 8CATA 4JV5M 4QHSA 1DGGA 4OU7A 3U6SA 3T1HM 1Z59A 1L2BA 1HNZM 2G5GX 3I4VA 4DR7M 3SMSA 2Z4RA 1NHWC 1N36M 2R18A 1D2NA 1G41A 1WXQA 4QOSA 3U6OA 3GRRA 3J2PB 4B3RM 3FUVA 2CHGA 4LZJA 3AFHA 1IY2A 5EXPA 1IN5A 4AKHA 4FW9A 4DV0M 2QENA 3J7BA 3DOAA 3KS8A 1HQYE 2HL7A 2XZFA 1QAMA 2L7HA 5ITXE 4LFAM 3CF2A 4WW0A 2I7NA 3M6AA 1OFHA 3SFZA 1QANA 4KLNA 5ITRA 2KXEA 2DWMA 4S12A 4NL4H 2O5RA 7CATA 1PM5A 3HHWA 2ZANA 1Q3CA 2CV1A 2X8AA 5DYIA 4IBDA 3U61B 4LJ4A 3GLFB 1GVNA 4MGIE 3GO8A 4B7HA 4CGYB 4YHHM 1N77A 1QAOA 4DUYM 1W5TA 2R62A 2Y21A 1R7RA 2F5PA 5ITUA 5DYGA 3VLFB 3TWKA 4DR1M 3VDPA 2M60A 5EP4A 2H1RA 1NHGC 4GITA 4DV6M 3SMPA 3GQ5A 2D7GA 1MU5A 4JI2M 5FTKA 4NXMM 2J7NA 4MB7A 1E32A 2KEBA 3PVSA 4IBEA 2UXBM 1L2DA 2YNMD 4A3VB 3GPUA 5FTJA 4HLQA 3LQRA 3D8BA 4I4LA 2VIIA 4B3TM 3SBJA 1HQCA 2DWNA 2YFQA 3SARA 1K82A 2Z4SA 1N33M 4KO8A 3HJSA 5EQTA 3SAVA 5E6JA 2NQ8C 5DNYA 3AJIB 3QWLA 2DWLA 4AKGA 4I81A 4GC9A 4MH0E 4B3SM 1SXJC 1XHBA 5EP1A 1KSFX 2XFSA 3FYDA 2UXCM 1I94M 3SHGB 2KRKA 3H4MA 3SYKA 3UMMA 1IY1A 1Z6TA 4LF4M 1J09A 3GPPA 1E9RA 2K47A 3SAWA 5F3WA 2CHVA 3NWLA 3HHXA 2KRUA 3MJ5A 4LF9M 2EO2A 4FD2A 3GRYA 3U60B 1N32M 2YQZA 4NSOB 1E9SA 3E9SA 1DGHA 2HKJA 5IREB 2F5NA 3KSJA 1J5EM 1YSYA 4G4RA 3MHVC 1ZQ9A 1TH3A 4AKIA 3FTCA 3VK8A 1Q3BA 4QOZC 4JYAM 2QPAA 3A98B 3VKHA 4LGMA 2DZNB 3U6EA 1IY0A 2Y20A 2XZUA 3SYLA 3GPYA 2HHHM 4IBFA 3GRVA 3A45A 1XC8A 3FTDA 4JXJA 2XH9A 4PDIA 4NXNM 3L2AA 3HWSA 3TWLA 3GP1A 3K2LA 1Z5AA 2F5OA 3VFDA 1FJGM 3AOEA 3GLHA 3TL4X 4X62M 4K0KM 4FCTA 3M7GA 4DV7M 1R6BX 3U5ZB 4DUZM 4BB9A 2F5QA 3DZDA 1SXJB 2L7IA 1DGHB 4TUWA 1N75A 1QYRA 1JR3D 4MGZE 3I51A 1L2CA 4IIWA 1PJJA 1KFVA 1Z5CA 4M9SA 2CEAA 3A42A 3MK6A 2EUCA 3KDSE 4LJ6A 3KOZE 1XMOM 5ITQA 4I5SA 3RE8A 3W0LB 4PD2A 3JR5A 1TDZA 4L8RC 3B9PA 4G4OA 3KP0E 1IM2A 2ZAMA 4JI5M 1Q39A 1XXHB 2QBYA 3BOSA 3PFIA 4GMQA 4GH9A 4XBOA 5EP3A 1IBLM 1SXJD 1G8PA 5EJCA 2E5LM 1ZAEA 3AV0A 4LFCM 5H37D 3KP1E 1IXRC 3TWMA 1GL7A 1R2ZA 3HHYA 1S3SA 1IXZA 3GQ3A 4GRIA 2LXEA 3IG8A 3DFZA 2XEPA 3E4RA 5ITXA 1G3IA 4B7GA 2R46A 4EIWA 3OTOM 4QNMA 3SHFA 2XLJA 4D82A 4DR2M 3SASA 3FUWA 4LG2A 1H6UA 1XNRM 1NNJA 3KS4A 3CTWB 3RGSA 3U6QA 2DZOB 3KW6A 5GKNA 4W5WA 3VDUA 4II7A 3GPXA 1HNXM 3GLHB 4AW4A 4LF8M 4JI8M 4KHPM 3HKPA 3LQQA 3FUXA 1HNWM 5EXSA 2Y0QA 5EXXA 4ITQA 4GHAA 1XXHA 4BBAA 2QBYB 3ILKA 4JI1M 3FD9A 3K8ZA 4MGHA 2QCUA 4L15A 2G8LA 5IT9S 4IBKA 4DV3M 1XMQM 2XGNA 3VK7A 3TPZA 1L1TA 4AZFA 3GLFA 4Z8XA 4REZA 3GLGB 2C96A 4DV4M 4P16A 3R9XB 3DA1A 4DV5M 3FYCA 1E94E 4G6ZA 3U6LA 3J7AS 2UXDM 3AKZA 5JI3E 5KPRA 4GIPA 3KXEC 4JN6A 1IN8A 3KFUG 5FSWA 3R8FA 2X49A 1IN6A 3FKEA 4IBBA 2C9OA 2CV2A 4OW0A 2CHQA 3U6CA 3WHKA 1I4WA 5EP2A 1DGFA 4X66M 5BR8M 3GQ4A 2ZBKB 4KODA 3SC3A 1YUBA 4LJ7A 5KQDA 4G4NA 3T1YM 2FNAA 2F5SA 3EIEA 2F4VM 4PDGA 5JI2E 3U61A 1PJIA 3FTFA 4OVZB 4DV2M 1XNQM 1JR3A 5LMNM 2V1CA 3LMMA 4X64M 4ZPXA 4Z6YA 2JA2A 2KA6B 3GLGA 3KVWA 2HCBA 1IXSB 2CUZA 3T15A 3KOXE 2XSZA 1Z5BA 2R4EA 2QP9X 2XSZD 3THGA 1KYIA 2LNHC 4LF5M 2C9CA 3GRUA 3JR4A 5ITYA 4LY6A 1NJFA 1YE9A 4M0WA 4HL4A 1L8QA 4MM3B 4D81A 4B3MM 4LCBA 4AG6A 4JI3M 1GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCV A;  1IM2 A;  2ZAM A;  1NJG A;  4GIT A;  4LJ8 A;  5FTM A;  1OFI A;  1XXH B;  2QBY A;  3BOS A;  3PFI A;  5FTL A;  5EP3 A;  1SXJ D;  3HU1 A;  5FTN A;  3HU2 A;  3ZH9 B;  5FTK A;  4LJA A;  1E32 A;  1IXR C;  3PVS A;  1DO0 A;  4FCW A;  1S3S A;  4QNR A;  4A3V B;  1IXZ A;  5FTJ A;  4LRT A;  4D80 A;  1DO2 A;  1NY5 A;  1G3I A;  1G4A E;  3D8B A;  2R65 A;  2VII A;  4I4L A;  4EIW A;  1HQC A;  2V6Z M;  4QNM A;  1IQP A;  1NY6 A;  2Z4S A;  1SXJ A;  1JQJ C;  4D82 A;  1X37 A;  1HT1 E;  2CE7 A;  4KO8 A;  4QHT A;  5EQT A;  3WHL A;  2ZAO A;  3AJI B;  2DZO B;  3CF0 A;  2RKO A;  4I81 A;  3GLI A;  1SXJ C;  1W5S A;  3KW6 A;  5EP1 A;  4FWG A;  1KSF X;  1LV7 A;  2V1U A;  3M0E A;  1IN7 A;  2BJV A;  4L4U A;  2KRK A;  3GLH B;  3H4M A;  5EXT A;  1SXJ E;  3SYK A;  1UM8 A;  4LJ9 A;  1IY1 A;  4LZZ A;  5EXS A;  4QHS A;  5EXX A;  2BJW A;  1XXH A;  2QBY B;  2CHV A;  4L15 A;  4FD2 A;  3U60 B;  2Z4R A;  3GLF A;  4Z8X A;  1D2N A;  1G41 A;  4QOS A;  3GLG B;  2C96 A;  1NVM A;  3HU3 A;  2CHG A;  1E94 E;  1IY2 A;  4FWD A;  5C18 A;  5EXP A;  1QZM A;  3MHV C;  5JI3 E;  1IN5 A;  4JN6 A;  3UK6 A;  4FW9 A;  1IN8 A;  2QPA A;  2QEN A;  3R8F A;  1IN6 A;  4LGM A;  1HQY E;  2C9O A;  2DWZ B;  1IY0 A;  2DZN B;  3SYL A;  2CHQ A;  3CF2 A;  3WHK A;  4WW0 A;  5EP2 A;  3PXG A;  3EIH A;  3HWS A;  4KOD A;  3SC3 A;  4LJ7 A;  3M6A A;  1HT2 E;  1OFH A;  3VFD A;  5C1B A;  2FNA A;  4KLN A;  3EIE A;  1QVR A;  2C99 A;  3GLH A;  2QZ4 A;  5JI2 E;  4LJ5 A;  4LRS A;  2ZAN A;  4FCT A;  1C1K A;  1JR3 A;  1R6B X;  2X8A A;  5DYI A;  3U5Z B;  3DZD A;  1SXJ B;  3U61 B;  4LJ4 A;  4ZPX A;  1OJL A;  3GLF B;  1XWI A;  1NSF A;  1JR3 D;  3GLG A;  1FNN A;  2C98 A;  1IN4 A;  2HCB A;  4L16 A;  1IXS B;  2XSZ A;  3K1J A;  2XSZ D;  2QP9 X;  1W5T A;  2R62 A;  1KYI A;  1R7R A;  2C9C A;  4FWH A;  3GLI B;  2CEA A;  3KDS E;  2DHR A;  4LJ6 A;  4LY6 A;  1J7K A;  1NJF A;  5DYG A;  3VLF B;  1L8Q A;  4D81 A;  4LCB A;  2DVW B;  5EP4 A;  3B9P A; 
#chains in the Genus database with same CATH topology
 2I7P A;  4FCV A;  5KPZ A;  1L1Z A;  2KW0 A;  1UFZ A;  2Z3X A;  5KQ8 A;  2R4J A;  3AOG A;  4IBG A;  1TH2 A;  2QHO B;  4LJ8 A;  3QYB A;  3RGP A;  4JI0 M;  5FTL A;  2EKK A;  1G71 A;  3HJQ A;  5FTN A;  3KOY E;  2LVA A;  1AIP C;  1ZV1 A;  3L29 A;  3BXW A;  3FTE A;  3I04 M;  4B7F A;  5LMU M;  4OX9 M;  3LVW A;  4CHT B;  4QNR A;  4B3M M;  4NSR A;  2CV0 A;  4Q7J A;  2FOI C;  3L26 A;  4DR4 M;  2ERC A;  2LTU A;  1NY5 A;  1QQW A;  2MH8 A;  2LBC A;  4RF1 A;  2R65 A;  3FUU A;  4I8O A;  1IQP A;  2W82 A;  1NY6 A;  3U6D A;  1VDL A;  4IBJ A;  3JAM S;  3A46 A;  1QZE A;  3WHL A;  4QHT A;  2J7O A;  2KZS A;  2ZAO A;  4LFB M;  4JI7 M;  4GEW A;  3CF0 A;  2RKO A;  4AI6 A;  3K92 A;  3SAT A;  4PT5 A;  4DR6 M;  2UU9 M;  3TE6 A;  4IBC A;  3GLI A;  1ZMW A;  2O01 F;  2BNK A;  4FWG A;  4GC5 A;  1WHC A;  4XK8 F;  2C5R A;  2BJV A;  2G3Q A;  1SXJ E;  2DZL A;  3ZC7 B;  1AUA A;  2R45 A;  4JI6 M;  4LJ9 A;  2VQE M;  1IBM M;  2KNA A;  2A5Y B;  2L09 A;  2JY6 B;  2BJW A;  1JB0 F;  2JUJ A;  2OPF A;  2LWX A;  2J5Y A;  4M9X A;  2K6B A;  4X65 M;  5A2Q S;  4LF7 M;  1CUK A;  1Y8G A;  4NRV A;  2EA0 A;  3VKG A;  4DR5 M;  4YY3 M;  2RGH A;  2FE8 A;  4GKJ M;  1TTE A;  2DAK A;  3FUT A;  3U6M A;  1Q02 A;  4CJ6 A;  1NVM A;  3HU3 A;  1R2Y A;  1TH4 A;  4FWD A;  5C18 A;  3MMP A;  1PJQ A;  1QZM A;  1VEG A;  2FFJ A;  2L4F A;  3T38 A;  3KOW E;  3UK6 A;  4R3D A;  1OAO C;  3U5Z A;  4G4Q A;  3RFW A;  5DFL A;  2K0B X;  2DWZ B;  3UJN A;  1N34 M;  3QAU A;  2YR0 A;  3PXG A;  3PNY A;  1G59 A;  3EIH A;  3FRH A;  4XGI A;  5BPV A;  3C3E A;  5IWA M;  5FLX S;  1HT2 E;  4B08 A;  5C1B A;  1TDH A;  1D0M A;  1QVR A;  2C99 A;  3B89 A;  1QUS A;  2QZ4 A;  3KSX A;  4LJ5 A;  4LRS A;  3AL0 C;  1MX0 A;  4L78 A;  2MR9 A;  2Z7J A;  1C1K A;  2XFT A;  4WUR A;  3FE3 A;  3HJ8 A;  3W68 A;  1OJL A;  4AG5 A;  2ZM6 M;  1XWI A;  1NSF A;  2D7E A;  3SAU A;  2UUC M;  4CIS A;  1FNN A;  2C98 A;  1IN4 A;  3CF6 E;  1EE8 A;  4IJF A;  4L16 A;  1IBK M;  3K1J A;  2Q2E B;  1D0K A;  2RGO A;  3HHZ A;  3LVV A;  1VEK A;  4FWH A;  3GLI B;  3ZCB B;  2UUB M;  2L6O A;  2DHR A;  3IG5 A;  3U6P A;  5KPT A;  2HWJ A;  3Q8X A;  4M0D A;  1J7K A;  4LGY A;  5IZ7 D;  5KO3 A;  1TGU A;  4FVM A;  1K3W A;  4LF6 M;  1GKI A;  3TQS A;  3I4Y A;  2OQ4 A;  1DGB A;  2DVW B;  1ZMU A;  4Y28 F;  2KZU A;  3LCV B;  1NJG A;  2VQF M;  2LHC A;  3J80 S;  5ITT A;  5FTM A;  3GLH E;  1OFI A;  4KT0 F;  3L25 A;  1VDD A;  4MGK E;  3HU1 A;  4IJE A;  3HU2 A;  4NOO B;  3AOE C;  3ZH9 B;  1NNU C;  1T3T A;  4LJA A;  3HGI A;  2ZTC A;  1QAQ A;  1NV9 A;  3L27 A;  4DBG B;  2XF3 A;  1TR8 A;  2CWB A;  1DO0 A;  1VG5 A;  2AHM A;  3UGJ A;  2LVO C;  1ORY B;  2P5T A;  4FCW A;  2KNZ A;  3NBI A;  4LRT A;  4D80 A;  4GKK M;  1DO2 A;  2X4A A;  1HR0 M;  4JI4 M;  4WP2 A;  1G4A E;  4BLC A;  3J27 B;  2V6Z M;  2LH0 A;  1JQJ C;  1SXJ A;  4DV1 M;  4R71 A;  1X37 A;  3L28 A;  1HT1 E;  2CE7 A;  1K3X A;  3J81 S;  3E21 A;  3W0F A;  1T43 A;  3D8L A;  4RF0 A;  1ZMV A;  2CFO A;  4R7G A;  4IBI A;  4DR3 M;  3U60 A;  2UUA M;  4GHL A;  2D7H A;  5E26 A;  1PRB A;  2JP7 A;  4RNA A;  2DXI A;  1WGN A;  1W5S A;  4NRW A;  2V1U A;  1LV7 A;  2Y0T A;  3UZU A;  3M0E A;  1IN7 A;  4PCZ A;  3C58 A;  2EKF A;  4L4U A;  2M5Z A;  1GAB A;  5EXT A;  3PNV A;  1UM8 A;  4AQY M;  4OVZ A;  1GLN A;  4M9Z A;  3K9O A;  1N78 A;  4MGY E;  4LZZ A;  8CAT A;  1P3Q Q;  4JV5 M;  4QHS A;  1DGG A;  4OU7 A;  3U6S A;  2R6F A;  3T1H M;  1Z59 A;  1L2B A;  1WIV A;  2G5G X;  3I4V A;  1HNZ M;  3B7N A;  1IXS A;  4DR7 M;  3SMS A;  2RRU A;  2Z4R A;  3GLG E;  1TF0 B;  4F2L A;  1NHW C;  1N36 M;  2R18 A;  1D2N A;  1G41 A;  1WXQ A;  4QOS A;  3U6O A;  2CP8 A;  3GRR A;  3J2P B;  4B3R M;  1MN3 A;  3FUV A;  2CHG A;  3H4J A;  4LZJ A;  3AFH A;  1IY2 A;  5EXP A;  1IN5 A;  4AKH A;  4FW9 A;  3HZJ A;  4DV0 M;  1EFU B;  2QEN A;  3J7B A;  5L8R F;  3DOA A;  2CRU A;  3KS8 A;  1HQY E;  2HL7 A;  2XZF A;  1QAM A;  2L7H A;  5ITX E;  4LFA M;  3CF2 A;  4WW0 A;  2LVP C;  2OOA A;  2I7N A;  3LW5 F;  1QDT A;  2MJ5 B;  3M6A A;  1OFH A;  3SFZ A;  1QAN A;  2WSE F;  4KLN A;  5ITR A;  2KXE A;  2DWM A;  1NO1 A;  4S12 A;  4NL4 H;  2O5R A;  7CAT A;  1PM5 A;  3HHW A;  1JR3 E;  1Q3C A;  2ZAN A;  2CV1 A;  2X8A A;  5DYI A;  4IBD A;  3U61 B;  1GJS A;  4LJ4 A;  3GLF B;  1GVN A;  4MGI E;  3GO8 A;  4B7H A;  4CGY B;  2QNJ A;  4YHH M;  1N77 A;  1QAO A;  4DUY M;  1W5T A;  1IFY A;  2R62 A;  2KHH A;  2Y21 A;  1R7R A;  2N35 A;  2R0I A;  2F5P A;  3I01 M;  5ITU A;  2LVQ D;  1HJP A;  5DYG A;  3VLF B;  3TWK A;  4DR1 M;  3VDP A;  2M60 A;  2JY8 A;  5EP4 A;  2H1R A;  1OKS A;  1NHG C;  4GIT A;  4DV6 M;  3SMP A;  3GQ5 A;  2D7G A;  1MU5 A;  4JI2 M;  5FTK A;  4NXM M;  3LCU A;  2J7N A;  4MB7 A;  1E32 A;  2KEB A;  3PVS A;  4IBE A;  2UXB M;  1QUT A;  1L2D A;  2YNM D;  4A3V B;  3GPU A;  5FTJ A;  4HLQ A;  2DAG A;  2BWE A;  2JY5 A;  3LQR A;  1T6O A;  1SG9 A;  3D8B A;  4I4L A;  2VII A;  4B3T M;  3SBJ A;  1HQC A;  1V33 A;  3C9P A;  2DWN A;  2YFQ A;  3SAR A;  1K82 A;  2MRO B;  2Z4S A;  2DKL A;  1N33 M;  4KO8 A;  3HJS A;  5EQT A;  2DI0 A;  3SAV A;  5E6J A;  2NQ8 C;  4L6V 6;  5DNY A;  3AJI B;  3QWL A;  2DWL A;  4AKG A;  4I81 A;  4GC9 A;  4MH0 E;  4B3S M;  1SXJ C;  1XHB A;  5EP1 A;  2GQF A;  1KSF X;  4G3O A;  2XFS A;  3FYD A;  3T6P A;  1I94 M;  2UXC M;  3SHG B;  2KRK A;  3H4M A;  1F4I A;  2QQ8 A;  3SYK A;  2VDB B;  3UMM A;  1IY1 A;  1NV8 A;  1Z6T A;  4LF4 M;  1J09 A;  3GPP A;  1E9R A;  2K47 A;  3SAW A;  5F3W A;  2CHV A;  3NWL A;  3HHX A;  2KRU A;  3MJ5 A;  4LF9 M;  2EO2 A;  4FD2 A;  3GRY A;  3U60 B;  1N32 M;  2YQZ A;  4NSO B;  1E9S A;  1DGH A;  2HKJ A;  3E9S A;  5IRE B;  2F5N A;  1OIP A;  1V92 A;  3KSJ A;  1J5E M;  1YSY A;  1VQ1 A;  2DAM A;  1GO5 A;  1GJT A;  3GLI E;  3MHV C;  1ZQ9 A;  4G4R A;  2JXN A;  1TH3 A;  4AKI A;  3FTC A;  3VK8 A;  1Q3B A;  4QOZ C;  3ZQJ A;  4JYA M;  2QPA A;  2BWB A;  3A98 B;  3GLF E;  3VKH A;  4LGM A;  2DAI A;  2DZN B;  3U6E A;  2L2D A;  1IY0 A;  2Y20 A;  2XZU A;  3SYL A;  3GPY A;  2HHH M;  1R4G A;  3GRV A;  4IBF A;  2HAK A;  3A45 A;  1XC8 A;  3FTD A;  4JXJ A;  2XH9 A;  4PDI A;  4NXN M;  3L2A A;  3HWS A;  3TWL A;  3GP1 A;  3K2L A;  1Z5A A;  3Q8G A;  2F5O A;  3VFD A;  1FJG M;  1V34 A;  3AOE A;  3GLH A;  3TL4 X;  4X62 M;  2FH0 A;  4K0K M;  3C3D A;  4FCT A;  3M7G A;  4DV7 M;  1R6B X;  2FS1 A;  4DUZ M;  4BB9 A;  3U5Z B;  3DZD A;  1SXJ B;  2F5Q A;  2JWS A;  2L7I A;  1DGH B;  4TUW A;  1N75 A;  1QYR A;  3NBX X;  1JR3 D;  4MGZ E;  4NC6 A;  3I51 A;  2K9D A;  2O25 A;  1L2C A;  2ZTD A;  4IIW A;  1PJJ A;  3E46 A;  1KFV A;  1Z5C A;  3F92 A;  4M9S A;  4RKU F;  2CEA A;  3A42 A;  3MK6 A;  2EUC A;  3KDS E;  4LJ6 A;  2DEN A;  3KOZ E;  3W67 A;  1XMO M;  5ITQ A;  4I5S A;  3RE8 A;  3W0L B;  4PD2 A;  3JR5 A;  1TDZ A;  4L8R C;  2VF8 A;  3B9P A;  4G4O A;  3KP0 E;  4CIZ A;  1IM2 A;  2ZAM A;  4JI5 M;  1Q39 A;  2JNH A;  1XXH B;  2QBY A;  3BOS A;  3PFI A;  4GMQ A;  2EJS A;  4GH9 A;  4XBO A;  5EP3 A;  1IBL M;  1SXJ D;  1G8P A;  1YLA A;  5EJC A;  2E5L M;  1ZAE A;  3AV0 A;  4LFC M;  5H37 D;  3KP1 E;  2WSC F;  1IXR C;  2R44 A;  3TWM A;  1GL7 A;  1PGY A;  1R2Z A;  2JY7 A;  3HHY A;  1S3S A;  1D0L A;  1IXZ A;  2WSF F;  1PJS A;  3CGW A;  3GQ3 A;  4GRI A;  2LXE A;  2GNO A;  2XEP A;  3DFZ A;  3E4R A;  3IG8 A;  1G3I A;  5ITX A;  1OQY A;  2OOB A;  2R46 A;  4B7G A;  4EIW A;  3OTO M;  4QNM A;  3SHF A;  2XLJ A;  4D82 A;  4DR2 M;  3SAS A;  2L4E A;  3FUW A;  4LG2 A;  1H6U A;  1XNR M;  1NNJ A;  3KS4 A;  3CTW B;  3RGS A;  3U6Q A;  1XB2 B;  2DZO B;  4ANR A;  3KW6 A;  5GKN A;  4W5W A;  3VDU A;  4II7 A;  3GPX A;  3V76 A;  2Z8Y M;  3HY5 A;  3GLH B;  2DAE A;  4AW4 A;  3K9P A;  2VF7 A;  1HNX M;  4JI8 M;  4LF8 M;  4KHP M;  3HKP A;  3LQQ A;  3FUX A;  1DV0 A;  1HNW M;  5EXS A;  2Y0Q A;  5EXX A;  4ITQ A;  4GHA A;  1WJ7 A;  1XXH A;  4BBA A;  2QBY B;  3ILK A;  4JI1 M;  3FD9 A;  3K8Z A;  4MGH A;  1XXH E;  2QCU A;  4L15 A;  2JZ1 A;  2G8L A;  5IT9 S;  4IBK A;  4DV3 M;  1XMQ M;  2XGN A;  2LHG A;  3BBZ A;  3VK7 A;  3TPZ A;  1L1T A;  4AZF A;  3GLF A;  4Z8X A;  4REZ A;  3GLG B;  2C96 A;  4DV4 M;  1RU3 A;  4P16 A;  2DHY A;  4HEO A;  3R9X B;  3DA1 A;  4DV5 M;  3FYC A;  1E94 E;  2APL A;  3B7Z A;  4G6Z A;  3IHP A;  3U6L A;  1LTM A;  3J7A S;  2UXD M;  3AKZ A;  5JI3 E;  1OIZ A;  5KPR A;  2QSF X;  3KXE C;  4GIP A;  4JN6 A;  1IN8 A;  1OTR A;  2H5X A;  3KFU G;  5FSW A;  3R8F A;  2X49 A;  1A5T A;  1IN6 A;  1BVS A;  3FKE A;  4IBB A;  2C9O A;  4F1I A;  2CV2 A;  1PJT A;  4OW0 A;  2CHQ A;  2LVN C;  3WHK A;  1I4W A;  5EP2 A;  1DGF A;  3U6C A;  4UN2 B;  4X66 M;  5BR8 M;  3GQ4 A;  2ZBK B;  3FRI A;  4KOD A;  3SC3 A;  1YUB A;  1QDR A;  4LJ7 A;  5KQD A;  3B74 A;  4G4N A;  3T1Y M;  2MGW A;  2FNA A;  2F5S A;  3EIE A;  1R5L A;  2F4V M;  4PDG A;  5JI2 E;  3U61 A;  1PJI A;  3FTF A;  2DNA A;  4OVZ B;  1WGL A;  4DV2 M;  1XNQ M;  1OAI A;  1JR3 A;  1MJG M;  3HX3 A;  2V1C A;  5LMN M;  3LMM A;  4X64 M;  4ZPX A;  2OO9 A;  2WZJ A;  1C7Y A;  4Z6Y A;  2JA2 A;  2KA6 B;  3GLG A;  3QYE A;  2HCB A;  3KVW A;  2KNV A;  3B7Q A;  1IXS B;  2CUZ A;  3T15 A;  2XSZ A;  3KOX E;  1Z5B A;  2R4E A;  2QP9 X;  2XSZ D;  3THG A;  1EIJ A;  1KYI A;  2LNH C;  4LF5 M;  2C9C A;  3GRU A;  3IEC A;  2B3T A;  2JZ0 A;  1VEJ A;  5ITY A;  3JR4 A;  1WR1 B;  4LY6 A;  1NJF A;  1YE9 A;  4M0W A;  4HL4 A;  1L8Q A;  4MM3 B;  2KDL A;  4D81 A;  4LCB A;  4P17 A;  4AG6 A;  4JI3 M;  1GL6 A; 
#chains in the Genus database with same CATH homology
 2I7P A;  4FCV A;  5KPZ A;  1L1Z A;  2KW0 A;  2Z3X A;  5KQ8 A;  2R4J A;  3AOG A;  4IBG A;  1TH2 A;  4LJ8 A;  3RGP A;  4JI0 M;  5FTL A;  3HJQ A;  5FTN A;  3KOY E;  3L29 A;  3FTE A;  4B7F A;  5LMU M;  4OX9 M;  3LVW A;  4CHT B;  4QNR A;  4NSR A;  2CV0 A;  2FOI C;  3L26 A;  4DR4 M;  2ERC A;  1NY5 A;  1QQW A;  4RF1 A;  2R65 A;  3FUU A;  4I8O A;  1IQP A;  2W82 A;  1NY6 A;  3U6D A;  4IBJ A;  3JAM S;  3A46 A;  3WHL A;  4QHT A;  2J7O A;  2KZS A;  2ZAO A;  4LFB M;  4JI7 M;  3CF0 A;  2RKO A;  4AI6 A;  3K92 A;  3SAT A;  4PT5 A;  4DR6 M;  2UU9 M;  3TE6 A;  4IBC A;  3GLI A;  2BNK A;  4FWG A;  4GC5 A;  2C5R A;  2BJV A;  1SXJ E;  3ZC7 B;  2R45 A;  4JI6 M;  4LJ9 A;  2VQE M;  1IBM M;  2A5Y B;  2L09 A;  2BJW A;  2OPF A;  2LWX A;  4M9X A;  4X65 M;  5A2Q S;  4LF7 M;  2EA0 A;  4NRV A;  3VKG A;  4DR5 M;  4YY3 M;  2RGH A;  2FE8 A;  4GKJ M;  3FUT A;  3U6M A;  1NVM A;  3HU3 A;  1R2Y A;  1TH4 A;  4FWD A;  5C18 A;  1QZM A;  2FFJ A;  3T38 A;  3KOW E;  3UK6 A;  4R3D A;  3U5Z A;  4G4Q A;  3RFW A;  2DWZ B;  3UJN A;  1N34 M;  3QAU A;  2YR0 A;  3PXG A;  3PNY A;  1G59 A;  3EIH A;  4XGI A;  5BPV A;  5IWA M;  5FLX S;  1HT2 E;  4B08 A;  5C1B A;  1TDH A;  1QVR A;  2C99 A;  2QZ4 A;  3KSX A;  4LJ5 A;  4LRS A;  3AL0 C;  1MX0 A;  4L78 A;  2Z7J A;  1C1K A;  2XFT A;  4WUR A;  3HJ8 A;  1OJL A;  4AG5 A;  2ZM6 M;  1XWI A;  1NSF A;  2D7E A;  3SAU A;  2UUC M;  4CIS A;  1FNN A;  2C98 A;  1IN4 A;  3CF6 E;  1EE8 A;  4IJF A;  4L16 A;  1IBK M;  3K1J A;  2Q2E B;  2RGO A;  3HHZ A;  3LVV A;  4FWH A;  3GLI B;  3ZCB B;  2UUB M;  2L6O A;  2DHR A;  3IG5 A;  3U6P A;  5KPT A;  3Q8X A;  4M0D A;  1J7K A;  4LGY A;  5IZ7 D;  5KO3 A;  1TGU A;  4FVM A;  1K3W A;  4LF6 M;  1GKI A;  3TQS A;  3I4Y A;  2OQ4 A;  1DGB A;  2DVW B;  2KZU A;  1NJG A;  2VQF M;  3J80 S;  5ITT A;  5FTM A;  1OFI A;  3L25 A;  1VDD A;  4MGK E;  3HU1 A;  4IJE A;  3HU2 A;  4NOO B;  3AOE C;  3ZH9 B;  1NNU C;  1T3T A;  4LJA A;  3HGI A;  1QAQ A;  3L27 A;  3UGJ A;  2XF3 A;  1DO0 A;  2AHM A;  1ORY B;  2P5T A;  4FCW A;  3NBI A;  4LRT A;  4D80 A;  4GKK M;  1DO2 A;  2X4A A;  1HR0 M;  4JI4 M;  1G4A E;  4BLC A;  3J27 B;  2V6Z M;  2LH0 A;  1JQJ C;  1SXJ A;  4DV1 M;  1X37 A;  3L28 A;  1HT1 E;  2CE7 A;  1K3X A;  3J81 S;  3W0F A;  3D8L A;  4DR3 M;  4RF0 A;  3U60 A;  2CFO A;  4R7G A;  4IBI A;  2UUA M;  4GHL A;  2D7H A;  5E26 A;  4RNA A;  2DXI A;  4NRW A;  1W5S A;  2V1U A;  1LV7 A;  2Y0T A;  3UZU A;  3M0E A;  1IN7 A;  4PCZ A;  3C58 A;  4L4U A;  2M5Z A;  5EXT A;  3PNV A;  1UM8 A;  4AQY M;  4OVZ A;  1GLN A;  4M9Z A;  1N78 A;  4MGY E;  4LZZ A;  8CAT A;  4JV5 M;  4QHS A;  1DGG A;  4OU7 A;  3U6S A;  3T1H M;  1Z59 A;  1L2B A;  1HNZ M;  2G5G X;  3I4V A;  4DR7 M;  3SMS A;  2Z4R A;  1NHW C;  1N36 M;  2R18 A;  1D2N A;  1G41 A;  1WXQ A;  4QOS A;  3U6O A;  3GRR A;  3J2P B;  4B3R M;  3FUV A;  2CHG A;  4LZJ A;  3AFH A;  1IY2 A;  5EXP A;  1IN5 A;  4AKH A;  4FW9 A;  4DV0 M;  2QEN A;  3J7B A;  3DOA A;  3KS8 A;  1HQY E;  2HL7 A;  2XZF A;  1QAM A;  2L7H A;  5ITX E;  4LFA M;  3CF2 A;  4WW0 A;  2I7N A;  3M6A A;  1OFH A;  3SFZ A;  1QAN A;  4KLN A;  5ITR A;  2KXE A;  2DWM A;  4S12 A;  4NL4 H;  2O5R A;  7CAT A;  1PM5 A;  3HHW A;  2ZAN A;  1Q3C A;  2CV1 A;  2X8A A;  5DYI A;  4IBD A;  3U61 B;  4LJ4 A;  3GLF B;  1GVN A;  4MGI E;  3GO8 A;  4B7H A;  4CGY B;  4YHH M;  1N77 A;  1QAO A;  4DUY M;  1W5T A;  2R62 A;  2Y21 A;  1R7R A;  2F5P A;  5ITU A;  5DYG A;  3VLF B;  3TWK A;  4DR1 M;  3VDP A;  2M60 A;  5EP4 A;  2H1R A;  1NHG C;  4GIT A;  4DV6 M;  3SMP A;  3GQ5 A;  2D7G A;  1MU5 A;  4JI2 M;  5FTK A;  4NXM M;  2J7N A;  4MB7 A;  1E32 A;  2KEB A;  3PVS A;  4IBE A;  2UXB M;  1L2D A;  2YNM D;  4A3V B;  3GPU A;  5FTJ A;  4HLQ A;  3LQR A;  3D8B A;  4I4L A;  2VII A;  4B3T M;  3SBJ A;  1HQC A;  2DWN A;  2YFQ A;  3SAR A;  1K82 A;  2Z4S A;  1N33 M;  4KO8 A;  3HJS A;  5EQT A;  3SAV A;  5E6J A;  2NQ8 C;  5DNY A;  3AJI B;  3QWL A;  2DWL A;  4AKG A;  4I81 A;  4GC9 A;  4MH0 E;  4B3S M;  1SXJ C;  1XHB A;  5EP1 A;  1KSF X;  2XFS A;  3FYD A;  2UXC M;  1I94 M;  3SHG B;  2KRK A;  3H4M A;  3SYK A;  3UMM A;  1IY1 A;  1Z6T A;  4LF4 M;  1J09 A;  3GPP A;  1E9R A;  2K47 A;  3SAW A;  5F3W A;  2CHV A;  3NWL A;  3HHX A;  2KRU A;  3MJ5 A;  4LF9 M;  2EO2 A;  4FD2 A;  3GRY A;  3U60 B;  1N32 M;  2YQZ A;  4NSO B;  1E9S A;  3E9S A;  1DGH A;  2HKJ A;  5IRE B;  2F5N A;  3KSJ A;  1J5E M;  1YSY A;  4G4R A;  3MHV C;  1ZQ9 A;  1TH3 A;  4AKI A;  3FTC A;  3VK8 A;  1Q3B A;  4QOZ C;  4JYA M;  2QPA A;  3A98 B;  3VKH A;  4LGM A;  2DZN B;  3U6E A;  1IY0 A;  2Y20 A;  2XZU A;  3SYL A;  3GPY A;  2HHH M;  4IBF A;  3GRV A;  3A45 A;  1XC8 A;  3FTD A;  4JXJ A;  2XH9 A;  4PDI A;  4NXN M;  3L2A A;  3HWS A;  3TWL A;  3GP1 A;  3K2L A;  1Z5A A;  2F5O A;  3VFD A;  1FJG M;  3AOE A;  3GLH A;  3TL4 X;  4X62 M;  4K0K M;  4FCT A;  3M7G A;  4DV7 M;  1R6B X;  3U5Z B;  4DUZ M;  4BB9 A;  2F5Q A;  3DZD A;  1SXJ B;  2L7I A;  1DGH B;  4TUW A;  1N75 A;  1QYR A;  1JR3 D;  4MGZ E;  3I51 A;  1L2C A;  4IIW A;  1PJJ A;  1KFV A;  1Z5C A;  4M9S A;  2CEA A;  3A42 A;  3MK6 A;  2EUC A;  3KDS E;  4LJ6 A;  3KOZ E;  1XMO M;  5ITQ A;  4I5S A;  3RE8 A;  3W0L B;  4PD2 A;  3JR5 A;  1TDZ A;  4L8R C;  3B9P A;  4G4O A;  3KP0 E;  1IM2 A;  2ZAM A;  4JI5 M;  1Q39 A;  1XXH B;  2QBY A;  3BOS A;  3PFI A;  4GMQ A;  4GH9 A;  4XBO A;  5EP3 A;  1IBL M;  1SXJ D;  1G8P A;  5EJC A;  2E5L M;  1ZAE A;  3AV0 A;  4LFC M;  5H37 D;  3KP1 E;  1IXR C;  3TWM A;  1GL7 A;  1R2Z A;  3HHY A;  1S3S A;  1IXZ A;  3GQ3 A;  4GRI A;  2LXE A;  3IG8 A;  3DFZ A;  2XEP A;  3E4R A;  5ITX A;  1G3I A;  4B7G A;  2R46 A;  4EIW A;  3OTO M;  4QNM A;  3SHF A;  2XLJ A;  4D82 A;  4DR2 M;  3SAS A;  3FUW A;  4LG2 A;  1H6U A;  1XNR M;  1NNJ A;  3KS4 A;  3CTW B;  3RGS A;  3U6Q A;  2DZO B;  3KW6 A;  5GKN A;  4W5W A;  3VDU A;  4II7 A;  3GPX A;  1HNX M;  3GLH B;  4AW4 A;  4LF8 M;  4JI8 M;  4KHP M;  3HKP A;  3LQQ A;  3FUX A;  1HNW M;  5EXS A;  2Y0Q A;  5EXX A;  4ITQ A;  4GHA A;  1XXH A;  4BBA A;  2QBY B;  3ILK A;  4JI1 M;  3FD9 A;  3K8Z A;  4MGH A;  2QCU A;  4L15 A;  2G8L A;  5IT9 S;  4IBK A;  4DV3 M;  1XMQ M;  2XGN A;  3VK7 A;  3TPZ A;  1L1T A;  4AZF A;  3GLF A;  4Z8X A;  4REZ A;  3GLG B;  2C96 A;  4DV4 M;  4P16 A;  3R9X B;  3DA1 A;  4DV5 M;  3FYC A;  1E94 E;  4G6Z A;  3U6L A;  3J7A S;  2UXD M;  3AKZ A;  5JI3 E;  5KPR A;  4GIP A;  3KXE C;  4JN6 A;  1IN8 A;  3KFU G;  5FSW A;  3R8F A;  2X49 A;  1IN6 A;  3FKE A;  4IBB A;  2C9O A;  2CV2 A;  4OW0 A;  2CHQ A;  3U6C A;  3WHK A;  1I4W A;  5EP2 A;  1DGF A;  4X66 M;  5BR8 M;  3GQ4 A;  2ZBK B;  4KOD A;  3SC3 A;  1YUB A;  4LJ7 A;  5KQD A;  4G4N A;  3T1Y M;  2FNA A;  2F5S A;  3EIE A;  2F4V M;  4PDG A;  5JI2 E;  3U61 A;  1PJI A;  3FTF A;  4OVZ B;  4DV2 M;  1XNQ M;  1JR3 A;  5LMN M;  2V1C A;  3LMM A;  4X64 M;  4ZPX A;  4Z6Y A;  2JA2 A;  2KA6 B;  3GLG A;  3KVW A;  2HCB A;  1IXS B;  2CUZ A;  3T15 A;  3KOX E;  2XSZ A;  1Z5B A;  2R4E A;  2QP9 X;  2XSZ D;  3THG A;  1KYI A;  2LNH C;  4LF5 M;  2C9C A;  3GRU A;  3JR4 A;  5ITY A;  4LY6 A;  1NJF A;  1YE9 A;  4M0W A;  4HL4 A;  1L8Q A;  4MM3 B;  4D81 A;  4B3M M;  4LCB A;  4AG6 A;  4JI3 M;  1GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...