4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
1QVRA 1QZMA 2C9OA 1J7KA 1JR3A 1DO0A 1L8QA 3DZDA 4JN6A 1D2NA 3GLIA 5FTNA 2CE7A 5C1BA 1SXJA 3HWSA 3K1JA 5EXXA 3AJIB 2CHVA 4FW9A 1LV7A 1OFHA 2C99A 4LJAA 1OJLA 4LY6A 5EP3A 3MHVC 3VFDA 1E94E 3ZH9B 3PVSA 1IY2A 4L4UA 5C18A 3U60B 3EIEA 2C98A 4LGMA 3WHKA 1W5TA 1IN6A 1JQJC 5DYIA 5EXPA 3SC3A 4GITA 4D81A 1NSFA 2R62A 3D8BA 1R7RA 2QP9X 1NVMA 5EP2A 3GLGB 3SYKA 4QHSA 4KODA 3GLHB 3U61B 1NY6A 1G4AE 5FTJA 2DVWB 2RKOA 1DO2A 3GLGA 5EP1A 4FWGA 1W5SA 1X37A 4LJ6A 4QHTA 2DZNB 1SXJC 2V6ZM 1IN4A 3SYLA 4QOSA 4ZPXA 3VLFB 5EP4A 1IN7A 3CF0A 5FTMA 2QENA 4A3VB 2C9CA 2QPAA 2QBYB 4LRSA 1HQCA 4L16A 4FCVA 2FNAA 3EIHA 1IM2A 4FCWA 4L15A 4EIWA 1IQPA 5EXTA 4FD2A 4D80A 3GLFB 2DZOB 4LJ8A 3UK6A 4LJ4A 1NY5A 4QNMA 1S3SA 4FCTA 1IY1A 2BJWA 3GLHA 3HU3A 1E32A 1HQYE 2C96A 1G3IA 1SXJE 2ZAMA 1OFIA 3M6AA 5FTLA 2BJVA 4LRTA 1G41A 4LJ5A 4Z8XA 1IXSB 2DWZB 5EXSA 1IN8A 3CF2A 5EQTA 4KO8A 4FWHA 4FWDA 2QBYA 1KYIA 4I81A 4LCBA 1R6BX 4LZZA 3GLIB 2R65A 2XSZD 1XXHB 5DYGA 1SXJB 4D82A 5JI2E 3PXGA 3U5ZB 1IXZA 1IY0A 1JR3D 4WW0A 4KLNA 3BOSA 2ZANA 1XXHA 1UM8A 1SXJD 1KSFX 1NJFA 2X8AA 3HU2A 4LJ7A 2CHQA 1HT1E 3GLFA 1C1KA 3R8FA 1IXRC 1XWIA 1FNNA 4I4LA 1HT2E 2CEAA 3PFIA 2Z4RA 2KRKA 3M0EA 3H4MA 2QZ4A 2Z4SA 2V1UA 4LJ9A 3KW6A 2DHRA 2VIIA 1NJGA 3KDSE 5JI3E 3WHLA 2ZAOA 3HU1A 2HCBA 4QNRA 5FTKA 2CHGA 3B9PA 2XSZA 1IN5A
chains in the Genus database with same CATH superfamily
2EO2A 2QSFX 1ZMVA 4PT5A 2M60A 3CTWB 3FD9A 1G71A 2KDLA 5C1BA 1J09A 2BNKA 2CHVA 2EKFA 1IBLM 2R44A 3GLGE 4LY6A 3ZH9B 1E94E 1EE8A 2CV0A 2HAKA 3A98B 5BPVA 4GHLA 3EIEA 3SHFA 4MB7A 3B7QA 4XGIA 3W67A 2UU9M 1JQJC 4JI8M 3VKHA 1QYRA 4BBAA 4GITA 4JI4M 3F92A 3L28A 4LFBM 1QAQA 3L29A 3I4YA 2QP9X 5EP2A 1PGYA 4IJEA 4NRWA 1Z5AA 2Z7JA 4QHSA 1L2DA 4KODA 2XLJA 2O01F 4PCZA 1G4AE 4X64M 4B3SM 1DGBA 2AHMA 2DVWB 3DOAA 5FTJA 2F5OA 2UXCM 1PJTA 1DO2A 1Q02A 3Q8XA 5KPTA 1V92A 2L4EA 2KXEA 3E46A 1TR8A 4LF6M 2LTUA 4GRIA 2YR0A 1OAIA 2ZM6M 4LJ6A 4G3OA 4M9SA 3GLFE 2K6BA 3I01M 2FE8A 3SBJA 3SYLA 4IJFA 1PJQA 4LZJA 5IT9S 3A46A 3SAWA 4A3VB 3U6SA 2I7PA 3W0FA 4JV5M 4QOZC 2J7OA 3ZCBB 2LBCA 3U6EA 4LF8M 4JYAM 3FRHA 4L78A 1OIZA 3LQRA 3KP1E 3OTOM 2FNAA 2XH9A 4DV2M 4OVZB 1N75A 3EIHA 2Z8YM 3U60A 2MH8A 3KOWE 4L15A 3AFHA 3MJ5A 4GC5A 3QYBA 4FD2A 2GNOA 3HHYA 4EIWA 2L7HA 2YQZA 3L2AA 4AW4A 4LJ8A 1Z5BA 1GABA 1YSYA 2DZLA 4FCTA 2DAGA 4JI7M 2BJWA 1JR3E 1QAMA 1XHBA 3FYDA 1LTMA 3GLHA 3AL0C 1HQYE 1IFYA 2C96A 3K9OA 5ITYA 1SXJE 1PJJA 4B3TM 1OFIA 4L6V6 4B3MM 3U6PA 2BJVA 3TQSA 3J7BA 3QYEA 4LJ5A 3T1YM 4REZA 3UGJA 4R3DA 5EXSA 2H5XA 2OOAA 3J27B 3IG5A 1IN8A 5IWAM 4KO8A 4FWHA 4JI3M 4RNAA 1GJTA 1Z5CA 4DBGB 2QBYA 4IBBA 4LZZA 2J7NA 1IBMM 2XSZD 5JI2E 1QQWA 3GPUA 1N36M 1ZMUA 3I04M 4KT0F 2MROB 1JR3D 4B3RM 5DFLA 2DAKA 3HHXA 4NOOB 2M5ZA 2DWNA 1SXJD 3A42A 3LW5F 1TDHA 1C1KA 3C3EA 3W68A 3D8LA 2R6FA 4AKGA 1WHCA 3FUVA 2Z4RA 2G5GX 2JZ1A 3SHGB 4R71A 1G59A 4DR1M 2KRKA 2DWLA 3H4MA 3FUXA 2QCUA 4DV4M 2ZTDA 2V1UA 1GVNA 2X49A 3KW6A 1XB2B 2RGHA 1F4IA 3AOGA 5ITRA 3B7NA 1NJGA 3KDSE 1T6OA 1VDDA 3VKGA 2ZAOA 4CGYB 2O25A 5FSWA 3SARA 3GPYA 4WURA 1NNJA 1NO1A 1QVRA 1QZMA 2UXBM 2C9OA 5ITXA 2G3QA 3DZDA 1L8QA 2FFJA 3TWKA 1I94M 1D2NA 4CIZA 3SAVA 1WIVA 2OQ4A 3RGPA 3W0LB 4B08A 3JR5A 4B7HA 3NBXX 5EP3A 3LCUA 4MM3B 4JI6M 3HY5A 5E6JA 4JXJA 1WR1B 8CATA 5FLXS 3U60B 2KRUA 1PM5A 1NHWC 3LVWA 3KVWA 3THGA 4NXMM 5IREB 4NC6A 2BWBA 2HHHM 1TGUA 3SC3A 1HNZM 2J5YA 1NSFA 2R62A 3T15A 4PD2A 3HX3A 1MU5A 4LGYA 3T38A 3MK6A 1K82A 1ORYB 4IBIA 5E26A 3E9SA 4DV3M 4LF9M 3GLHB 2LNHC 2FOIC 1IBKM 1T43A 2KNAA 2RKOA 4IBCA 3TPZA 4DV7M 3GLGA 4AKIA 1NHGC 2DNAA 2Q2EB 3KP0E 4GHAA 4AG5A 3I51A 5ITUA 4IIWA 5LMNM 1WJ7A 4G6ZA 4G4RA 2K47A 2LH0A 1N34M 4X65M 3K9PA 3VK8A 1HJPA 4ZPXA 5EP4A 2LXEA 2QBYB 1JB0F 2C9CA 4TUWA 3HJ8A 3SAUA 1D0KA 1T3TA 4DR6M 5KPZA 2DAEA 1TH3A 2RGOA 4YY3M 2KZSA 2LVQD 2XEPA 5KQ8A 2KW0A 4G4QA 5EXTA 4D80A 2DI0A 3FTCA 3J2PB 4NL4H 1HNWM 4LJ4A 3GQ3A 1NNUC 1EFUB 2WSFF 4QNMA 3T6PA 4AKHA 4WP2A 5KO3A 3U6LA 1OAOC 1TF0B 1IY1A 2D7EA 1K3XA 3FTDA 3U61A 2WSEF 3LCVB 1G3IA 4LFAM 2QNJA 4MH0E 3SMPA 2D7HA 1VDLA 2ZAMA 3M6AA 3FUWA 3GRYA 1DGGA 4LF7M 2BWEA 1E9RA 2DWZB 4F2LA 4AZFA 3J81S 3CF2A 5EQTA 1RU3A 4HL4A 3VDUA 1KYIA 3E4RA 4I81A 1Q39A 1R6BX 1HNXM 2LVNC 3GRVA 1D0LA 4B7FA 1XXHB 3FRIA 4D82A 1DV0A 4JI5M 3I4VA 3MMPA 4P16A 1NV8A 4II7A 4WW0A 4LF4M 2CV1A 4BB9A 3HU2A 1NJFA 2X8AA 3PNVA 2DHYA 2CRUA 3R8FA 3QAUA 1QAOA 2LVPC 1IXRC 1XWIA 4DR7M 4IBKA 4NSOB 4F1IA 4I4LA 3ZC7B 1HT2E 2DAIA 4OU7A 2UUCM 1MX0A 2Z4SA 1BVSA 2JXNA 2K9DA 4OW0A 1CUKA 4ITQA 4BLCA 2DHRA 2FH0A 4CISA 2KA6B 2EKKA 1NV9A 3TL4X 2HL7A 5JI3E 5ITQA 4G4NA 3WHLA 3QWLA 1Z6TA 1IXSA 3VK7A 2R18A 3HHWA 1V33A 3U6OA 4M0DA 4RF0A 3H4JA 3GLIA 5FTNA 3HWSA 3KSXA 1DGHA 2L2DA 2Y0QA 5EXXA 5BR8M 2APLA 3C58A 3TWMA 1LV7A 3U5ZA 2XGNA 4LJAA 3VFDA 1GKIA 3GLHE 3HJSA 3PVSA 2K0BX 2LVAA 1TDZA 1IY2A 4HEOA 1AIPC 5ITTA 2XF3A 2MGWA 3B89A 3SFZA 1XNRM 2C98A 1OTRA 3HJQA 1W5TA 1D0MA 2OO9A 1Q3BA 2WZJA 2W82A 4XBOA 5EXPA 2LWXA 3VDPA 2FS1A 2UUAM 4NSRA 1QANA 3D8BA 1NVMA 1G8PA 2ERCA 4DR3M 3SYKA 4X66M 2ZTCA 5GKNA 4IBGA 3U61B 1NY6A 1I4WA 1YUBA 2EUCA 3U6MA 2CV2A 2A5YB 3FUTA 1N32M 3Q8GA 5EP1A 2YFQA 2L09A 2O5RA 1W5SA 1QUTA 1VG5A 4PDGA 4DV5M 1L2CA 1X37A 1L1ZA 4QHTA 1Q3CA 2V6ZM 3K8ZA 4M0WA 2ZBKB 3FUUA 4QOSA 3VLFB 3HGIA 1EIJA 2JY8A 3CF0A 2QENA 2QPAA 3IECA 4LRSA 1HQCA 1GLNA 1HR0M 2N35A 4S12A 2MR9A 4GH9A 1MN3A 5EJCA 1C7YA 2F5SA 5L8RF 1N33M 4I5SA 1R5LA 3KXEC 3L27A 3UK6A 4CJ6A 3FTFA 4Y28F 2Y21A 1KFVA 1S3SA 4DV0M 2R46A 1TTEA 3LMMA 2XFTA 5ITXE 1E9SA 1OQYA 1R4GA 2KHHA 3UJNA 1XXHE 1YLAA 3KSJA 2F5NA 2E5LM 4Q7JA 2KEBA 4R7GA 1ZQ9A 2F5PA 1XNQM 3KOZE 2KNVA 2VF8A 4LRTA 4MGIE 3GPXA 1QDRA 1IXSB 4AQYM 2LHGA 2I7NA 4DV6M 3BBZA 3HKPA 4FWDA 2HWJA 3GRRA 1XMOM 3U6CA 3TWLA 3GLIB 1PRBA 4GKJM 4K0KM 1VEGA 3JAMS 1DGHB 1OIPA 2CWBA 4MGZE 5IZ7D 4AG6A 3GQ4A 3U5ZB 1IXZA 2X4AA 3RE8A 3AKZA 4KLNA 5F3WA 3BOSA 4DR2M 3GQ5A 4LJ7A 3GLFA 2XZFA 2JZ0A 1FNNA 7CATA 4LF5M 2L7IA 3C9PA 4YHHM 2CEAA 3PFIA 4X62M 4Z6YA 2DKLA 2UUBM 3M0EA 2JWSA 3E21A 4GEWA 1TH2A 2QZ4A 1J5EM 4LJ9A 2JA2A 4JI0M 2R0IA 2VIIA 1H6UA 1P3QQ 3FTEA 2MJ5B 2QQ8A 4NXNM 2DXIA 3DA1A 1WGLA 3C3DA 1AUAA 3HU1A 2EA0A 2HCBA 2KZUA 2VQEM 2CHGA 5C18A 2XSZA 2Y0TA 4KHPM 4IBJA 3CF6E 2R4EA 1J7KA 2B3TA 4RKUF 1JR3A 1DO0A 4JN6A 3SASA 2CE7A 4IBDA 3J7AS 1MJGM 1SXJA 3TE6A 3K1JA 3UZUA 3AJIB 1R2ZA 4FW9A 3GPPA 2CFOA 2EJSA 5DNYA 1OFHA 2C99A 2L6OA 1OJLA 1YE9A 3MHVC 3LVVA 4XK8F 1Y8GA 4L4UA 4P17A 4LGMA 3WHKA 2XFSA 2H1RA 1IN6A 3DFZA 5DYIA 1WGNA 3ILKA 4D81A 4PDIA 2LVOC 3AOEA 1R7RA 3NWLA 2JY6B 2OPFA 2F5QA 1QZEA 4JI2M 3GLGB 2OOBA 2Z3XA 2D7GA 3M7GA 3HZJA 1VQ1A 3IHPA 4DR5M 3CGWA 3LQQA 3KOYE 2L4FA 3BXWA 4W5WA 1L1TA 4LG2A 1VEJA 3JR4A 3PNYA 3FE3A 2P5TA 3GRUA 4FWGA 3RGSA 2CUZA 1DGFA 4OX9M 2G8LA 2JY5A 4G4OA 1XC8A 2DZNB 1SXJC 5H37D 1IN4A 1R2YA 5LMUM 4GC9A 1A5TA 1IN7A 3FYCA 3L26A 5FTMA 1N77A 4RF1A 2YNMD 1XMQM 3K92A 4IBEA 1PJIA 2F4VM 3KS4A 4L16A 3K2LA 3RFWA 4FCVA 3B7ZA 2CP8A 1SG9A 1IM2A 3AV0A 4FCWA 4I8OA 1IQPA 1GL7A 2VQFM 3AOEC 3HHZA 3GLFB 1QDTA 2DZOB 2JNHA 2V1CA 2VF7A 4MGYE 1NY5A 3NBIA 2RRUA 2XZUA 4M9ZA 3KFUG 3FKEA 2JUJA 4CHTB 1FJGM 2HKJA 3R9XB 3HU3A 4HLQA 1E32A 3GLIE 2JY7A 4MGKE 4DR4M 5FTLA 3GP1A 2UXDM 2VDBB 4GKKM 1ZMWA 3V76A 3J80S 4M9XA 1G41A 3B74A 4IBFA 1L2BA 1K3WA 4Z8XA 3U6DA 4DUYM 3L25A 1OKSA 4B7GA 1GJSA 2R45A 3GO8A 3UMMA 1N78A 2C5RA 2DENA 3KOXE 1ZAEA 2LHCA 4LCBA 2R65A 2KNZA 5DYGA 1SXJB 2WSCF 4ANRA 5A2QS 4MGHA 3IG8A 3PXGA 4AI6A 4JI1M 4OVZA 2DAMA 1IY0A 2JP7A 4UN2B 2ZANA 1XXHA 1UM8A 1KSFX 3U6QA 2CHQA 1HT1E 1ZV1A 4GIPA 1PJSA 1V34A 3SATA 4LFCM 5KQDA 3ZQJA 1WXQA 3A45A 4NRVA 4DUZM 4DV1M 3T1HM 2NQ8C 1QUSA 2Y20A 2QHOB 1Z59A 3SMSA 1TH4A 1GO5A 4L8RC 4FVMA 2R4JA 1GL6A 3KS8A 4GMQA 4QNRA 1UFZA 5FTKA 5KPRA 1VEKA 3B9PA 2DWMA 2GQFA 1IN5A
chains in the Genus database with same CATH topology
2EO2A 4PT5A 2M60A 3CTWB 3FD9A 5C1BA 1J09A 2BNKA 2CHVA 1IBLM 4LY6A 3ZH9B 1E94E 1EE8A 2CV0A 3A98B 5BPVA 4GHLA 3EIEA 3SHFA 4MB7A 4XGIA 2UU9M 1JQJC 4JI8M 3VKHA 1QYRA 4BBAA 4GITA 4JI4M 3L28A 4LFBM 1QAQA 3L29A 3I4YA 2QP9X 5EP2A 4IJEA 4NRWA 1Z5AA 2Z7JA 4QHSA 1L2DA 4KODA 2XLJA 4PCZA 1G4AE 4X64M 4B3SM 1DGBA 2AHMA 2DVWB 3DOAA 5FTJA 2F5OA 2UXCM 1DO2A 3Q8XA 5KPTA 2KXEA 4LF6M 4GRIA 2YR0A 2ZM6M 4LJ6A 4M9SA 2FE8A 3SBJA 3SYLA 4IJFA 4LZJA 5IT9S 3A46A 3SAWA 4A3VB 3U6SA 2I7PA 3W0FA 4JV5M 4QOZC 2J7OA 3ZCBB 3U6EA 4LF8M 4JYAM 4L78A 3LQRA 3KP1E 3OTOM 2FNAA 2XH9A 4DV2M 4OVZB 1N75A 3EIHA 3U60A 3KOWE 4L15A 3AFHA 3MJ5A 4GC5A 4FD2A 3HHYA 4EIWA 3AL0C 2L7HA 2YQZA 3L2AA 4AW4A 4LJ8A 1Z5BA 1YSYA 4FCTA 4JI7M 2BJWA 3GLHA 1QAMA 1XHBA 3FYDA 1HQYE 2C96A 1PJJA 5ITYA 1SXJE 4B3TM 1OFIA 4B3MM 3U6PA 2BJVA 3TQSA 3J7BA 4LJ5A 3T1YM 4REZA 3UGJA 4R3DA 5EXSA 3J27B 3IG5A 1IN8A 5IWAM 4KO8A 4FWHA 4JI3M 4RNAA 2QBYA 1Z5CA 4IBBA 4LZZA 2J7NA 1IBMM 2XSZD 5JI2E 1QQWA 3GPUA 1N36M 1JR3D 4B3RM 3HHXA 4NOOB 2M5ZA 2DWNA 1SXJD 3A42A 1TDHA 1C1KA 3D8LA 4AKGA 3FUVA 2Z4RA 2G5GX 3SHGB 1G59A 2DWLA 4DR1M 2KRKA 3H4MA 3FUXA 2QCUA 4DV4M 2V1UA 1GVNA 2X49A 3KW6A 2RGHA 3AOGA 5ITRA 1NJGA 3KDSE 1VDDA 3VKGA 2ZAOA 4CGYB 5FSWA 3SARA 3GPYA 4WURA 1NNJA 1QVRA 1QZMA 2UXBM 2C9OA 5ITXA 3DZDA 1L8QA 2FFJA 3TWKA 1I94M 1D2NA 3SAVA 2OQ4A 3RGPA 3W0LB 4B08A 3JR5A 4B7HA 5EP3A 4MM3B 4JI6M 5E6JA 4JXJA 8CATA 5FLXS 3U60B 2KRUA 1PM5A 1NHWC 3LVWA 3KVWA 3THGA 4NXMM 5IREB 2HHHM 1TGUA 3SC3A 1HNZM 1NSFA 2R62A 3T15A 4PD2A 1MU5A 4LGYA 3T38A 3MK6A 1K82A 1ORYB 4IBIA 5E26A 3E9SA 4DV3M 4LF9M 3GLHB 2LNHC 2FOIC 1IBKM 2RKOA 4IBCA 3TPZA 4DV7M 3GLGA 4AKIA 1NHGC 2Q2EB 3KP0E 4GHAA 4AG5A 3I51A 5ITUA 4IIWA 5LMNM 4G6ZA 4G4RA 2K47A 2LH0A 1N34M 4X65M 3VK8A 4ZPXA 5EP4A 2LXEA 2QBYB 2C9CA 4TUWA 3HJ8A 3SAUA 1T3TA 4DR6M 5KPZA 1TH3A 2RGOA 4YY3M 2KZSA 2XEPA 5KQ8A 4G4QA 2KW0A 5EXTA 4D80A 3FTCA 3J2PB 4NL4H 1HNWM 4LJ4A 3GQ3A 1NNUC 4QNMA 4AKHA 5KO3A 3U6LA 1IY1A 2D7EA 1K3XA 3FTDA 3U61A 1G3IA 4LFAM 3SMPA 4MH0E 2D7HA 2ZAMA 3M6AA 3FUWA 3GRYA 1DGGA 4LF7M 1E9RA 2DWZB 4AZFA 3J81S 3CF2A 5EQTA 4HL4A 3VDUA 1KYIA 3E4RA 4I81A 1Q39A 1R6BX 1HNXM 3GRVA 4B7FA 1XXHB 4D82A 4JI5M 3I4VA 4P16A 4II7A 4WW0A 4LF4M 2CV1A 4BB9A 3HU2A 1NJFA 2X8AA 3PNVA 3R8FA 3QAUA 1QAOA 1IXRC 1XWIA 4DR7M 4IBKA 4NSOB 4I4LA 3ZC7B 1HT2E 4OU7A 2UUCM 1MX0A 2Z4SA 4OW0A 4ITQA 4BLCA 2DHRA 4CISA 2KA6B 3TL4X 2HL7A 5JI3E 5ITQA 4G4NA 3WHLA 3QWLA 1Z6TA 3VK7A 2R18A 3HHWA 3U6OA 4M0DA 4RF0A 3GLIA 5FTNA 3HWSA 3KSXA 1DGHA 5EXXA 2Y0QA 5BR8M 3C58A 3TWMA 3U5ZA 1LV7A 2XGNA 4LJAA 3VFDA 1GKIA 3HJSA 3PVSA 1TDZA 1IY2A 5ITTA 2XF3A 3SFZA 1XNRM 2C98A 3HJQA 1W5TA 4GKJM 1Q3BA 4XBOA 2W82A 5EXPA 3VDPA 2LWXA 2UUAM 4NSRA 1QANA 3D8BA 1NVMA 1G8PA 2ERCA 4DR3M 3SYKA 4X66M 5GKNA 4IBGA 3U61B 1NY6A 1I4WA 1YUBA 2EUCA 3U6MA 2CV2A 2A5YB 3FUTA 1N32M 5EP1A 2YFQA 2L09A 2O5RA 1W5SA 4PDGA 4DV5M 1L2CA 1X37A 1L1ZA 4QHTA 1Q3CA 2V6ZM 3K8ZA 4M0WA 2ZBKB 3FUUA 4QOSA 3VLFB 3HGIA 3CF0A 2QENA 2QPAA 4LRSA 1HQCA 1GLNA 1HR0M 4S12A 4GH9A 5EJCA 2F5SA 1N33M 4I5SA 3KXEC 3L27A 3UK6A 3FTFA 2Y21A 1KFVA 1S3SA 4DV0M 2R46A 3LMMA 2XFTA 5ITXE 1E9SA 3UJNA 3KSJA 2F5NA 2E5LM 2KEBA 4R7GA 1ZQ9A 2F5PA 1XNQM 3KOZE 4LRTA 4MGIE 3GPXA 1IXSB 4AQYM 2I7NA 4DV6M 3HKPA 4FWDA 1XMOM 3GRRA 3U6CA 3TWLA 3GLIB 4K0KM 3JAMS 1DGHB 5IZ7D 4MGZE 4AG6A 3GQ4A 3U5ZB 1IXZA 2X4AA 3RE8A 3AKZA 4KLNA 5F3WA 3BOSA 4DR2M 3GQ5A 4LJ7A 3GLFA 2XZFA 1FNNA 7CATA 4LF5M 2L7IA 4YHHM 2CEAA 3PFIA 4X62M 4Z6YA 2UUBM 3M0EA 1J5EM 1TH2A 2QZ4A 4LJ9A 2JA2A 4JI0M 2VIIA 1H6UA 3FTEA 4NXNM 2DXIA 3DA1A 2EA0A 3HU1A 2HCBA 2KZUA 2VQEM 2CHGA 5C18A 2XSZA 2Y0TA 4KHPM 4IBJA 3CF6E 2R4EA 1J7KA 3SASA 1JR3A 1DO0A 4JN6A 2CE7A 4IBDA 3J7AS 1SXJA 3UZUA 3TE6A 3K1JA 3AJIB 1R2ZA 4FW9A 3GPPA 2CFOA 5DNYA 1OFHA 2C99A 2L6OA 1OJLA 1YE9A 3MHVC 3LVVA 4L4UA 4LGMA 3WHKA 2XFSA 2H1RA 1IN6A 3DFZA 5DYIA 3ILKA 4D81A 4PDIA 3AOEA 1R7RA 3NWLA 2OPFA 2F5QA 4JI2M 3GLGB 2Z3XA 2D7GA 3M7GA 4DR5M 3LQQA 3KOYE 4W5WA 1L1TA 4LG2A 3JR4A 3PNYA 2P5TA 3GRUA 4FWGA 3RGSA 2CUZA 1DGFA 4OX9M 2G8LA 4G4OA 1XC8A 2DZNB 1SXJC 5H37D 1IN4A 1R2YA 5LMUM 4GC9A 1IN7A 3FYCA 3L26A 5FTMA 1N77A 4RF1A 2YNMD 1XMQM 3K92A 4IBEA 1PJIA 2F4VM 3KS4A 4L16A 3K2LA 3RFWA 4FCVA 1IM2A 3AV0A 4FCWA 4I8OA 1IQPA 1GL7A 2VQFM 3AOEC 3HHZA 3GLFB 2DZOB 2V1CA 4MGYE 1NY5A 3NBIA 2XZUA 4M9ZA 3KFUG 3FKEA 4CHTB 1FJGM 2HKJA 3R9XB 3HU3A 4HLQA 1E32A 4MGKE 4DR4M 5FTLA 3GP1A 2UXDM 4GKKM 3J80S 4M9XA 1G41A 4IBFA 1L2BA 1K3WA 4Z8XA 3U6DA 4DUYM 3L25A 4B7GA 2R45A 3GO8A 3UMMA 1N78A 2C5RA 3KOXE 1ZAEA 4LCBA 2R65A 5DYGA 1SXJB 5A2QS 4MGHA 3IG8A 3PXGA 4AI6A 4JI1M 4OVZA 1IY0A 2ZANA 1XXHA 1UM8A 1KSFX 3U6QA 2CHQA 1HT1E 4GIPA 3SATA 4LFCM 5KQDA 1WXQA 3A45A 4NRVA 4DUZM 4DV1M 3T1HM 2NQ8C 2Y20A 1Z59A 3SMSA 1TH4A 4L8RC 4FVMA 2R4JA 1GL6A 3KS8A 4GMQA 4QNRA 5FTKA 5KPRA 3B9PA 2DWMA 1IN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVR A;  1QZM A;  2C9O A;  1J7K A;  1JR3 A;  1DO0 A;  1L8Q A;  3DZD A;  4JN6 A;  1D2N A;  3GLI A;  5FTN A;  2CE7 A;  5C1B A;  1SXJ A;  3HWS A;  3K1J A;  5EXX A;  3AJI B;  2CHV A;  4FW9 A;  1LV7 A;  1OFH A;  2C99 A;  4LJA A;  1OJL A;  4LY6 A;  5EP3 A;  3MHV C;  3VFD A;  1E94 E;  3ZH9 B;  3PVS A;  1IY2 A;  4L4U A;  5C18 A;  3U60 B;  3EIE A;  2C98 A;  4LGM A;  3WHK A;  1W5T A;  1IN6 A;  1JQJ C;  5DYI A;  5EXP A;  3SC3 A;  4GIT A;  4D81 A;  1NSF A;  2R62 A;  3D8B A;  1R7R A;  2QP9 X;  1NVM A;  5EP2 A;  3GLG B;  3SYK A;  4QHS A;  4KOD A;  3GLH B;  3U61 B;  1NY6 A;  1G4A E;  5FTJ A;  2DVW B;  2RKO A;  1DO2 A;  3GLG A;  5EP1 A;  4FWG A;  1W5S A;  1X37 A;  4LJ6 A;  4QHT A;  2DZN B;  1SXJ C;  2V6Z M;  1IN4 A;  3SYL A;  4QOS A;  4ZPX A;  3VLF B;  5EP4 A;  1IN7 A;  3CF0 A;  5FTM A;  2QEN A;  4A3V B;  2C9C A;  2QPA A;  2QBY B;  4LRS A;  1HQC A;  4L16 A;  4FCV A;  2FNA A;  3EIH A;  1IM2 A;  4FCW A;  4L15 A;  4EIW A;  1IQP A;  5EXT A;  4FD2 A;  4D80 A;  3GLF B;  2DZO B;  4LJ8 A;  3UK6 A;  4LJ4 A;  1NY5 A;  4QNM A;  1S3S A;  4FCT A;  1IY1 A;  2BJW A;  3GLH A;  3HU3 A;  1E32 A;  1HQY E;  2C96 A;  1G3I A;  1SXJ E;  2ZAM A;  1OFI A;  3M6A A;  5FTL A;  2BJV A;  4LRT A;  1G41 A;  4LJ5 A;  4Z8X A;  1IXS B;  2DWZ B;  5EXS A;  1IN8 A;  3CF2 A;  5EQT A;  4KO8 A;  4FWH A;  4FWD A;  2QBY A;  1KYI A;  4I81 A;  4LCB A;  1R6B X;  4LZZ A;  3GLI B;  2R65 A;  2XSZ D;  1XXH B;  5DYG A;  1SXJ B;  4D82 A;  5JI2 E;  3PXG A;  3U5Z B;  1IXZ A;  1IY0 A;  1JR3 D;  4WW0 A;  4KLN A;  3BOS A;  2ZAN A;  1XXH A;  1UM8 A;  1SXJ D;  1KSF X;  1NJF A;  2X8A A;  3HU2 A;  4LJ7 A;  2CHQ A;  1HT1 E;  3GLF A;  1C1K A;  3R8F A;  1IXR C;  1XWI A;  1FNN A;  4I4L A;  1HT2 E;  2CEA A;  3PFI A;  2Z4R A;  2KRK A;  3M0E A;  3H4M A;  2QZ4 A;  2Z4S A;  2V1U A;  4LJ9 A;  3KW6 A;  2DHR A;  2VII A;  1NJG A;  3KDS E;  5JI3 E;  3WHL A;  2ZAO A;  3HU1 A;  2HCB A;  4QNR A;  5FTK A;  2CHG A;  3B9P A;  2XSZ A;  1IN5 A; 
#chains in the Genus database with same CATH topology
 2EO2 A;  2QSF X;  1ZMV A;  4PT5 A;  2M60 A;  3CTW B;  3FD9 A;  1G71 A;  2KDL A;  5C1B A;  1J09 A;  2BNK A;  2CHV A;  2EKF A;  1IBL M;  2R44 A;  3GLG E;  4LY6 A;  3ZH9 B;  1E94 E;  1EE8 A;  2CV0 A;  2HAK A;  3A98 B;  5BPV A;  4GHL A;  3EIE A;  3SHF A;  4MB7 A;  3B7Q A;  4XGI A;  3W67 A;  2UU9 M;  1JQJ C;  4JI8 M;  3VKH A;  1QYR A;  4BBA A;  4GIT A;  4JI4 M;  3F92 A;  3L28 A;  4LFB M;  1QAQ A;  3L29 A;  3I4Y A;  2QP9 X;  5EP2 A;  1PGY A;  4IJE A;  4NRW A;  1Z5A A;  2Z7J A;  4QHS A;  1L2D A;  4KOD A;  2XLJ A;  2O01 F;  4PCZ A;  1G4A E;  4X64 M;  4B3S M;  1DGB A;  2AHM A;  2DVW B;  3DOA A;  5FTJ A;  2F5O A;  2UXC M;  1PJT A;  1DO2 A;  1Q02 A;  3Q8X A;  5KPT A;  1V92 A;  2L4E A;  2KXE A;  3E46 A;  1TR8 A;  4LF6 M;  2LTU A;  4GRI A;  2YR0 A;  1OAI A;  2ZM6 M;  4LJ6 A;  4G3O A;  4M9S A;  3GLF E;  2K6B A;  3I01 M;  2FE8 A;  3SBJ A;  3SYL A;  4IJF A;  1PJQ A;  4LZJ A;  5IT9 S;  3A46 A;  3SAW A;  4A3V B;  3U6S A;  2I7P A;  3W0F A;  4JV5 M;  4QOZ C;  2J7O A;  3ZCB B;  2LBC A;  3U6E A;  4LF8 M;  4JYA M;  3FRH A;  4L78 A;  1OIZ A;  3LQR A;  3KP1 E;  3OTO M;  2FNA A;  2XH9 A;  4DV2 M;  4OVZ B;  1N75 A;  3EIH A;  2Z8Y M;  3U60 A;  2MH8 A;  3KOW E;  4L15 A;  3AFH A;  3MJ5 A;  4GC5 A;  3QYB A;  4FD2 A;  2GNO A;  3HHY A;  4EIW A;  2L7H A;  2YQZ A;  3L2A A;  4AW4 A;  4LJ8 A;  1Z5B A;  1GAB A;  1YSY A;  2DZL A;  4FCT A;  2DAG A;  4JI7 M;  2BJW A;  1JR3 E;  1QAM A;  1XHB A;  3FYD A;  1LTM A;  3GLH A;  3AL0 C;  1HQY E;  1IFY A;  2C96 A;  3K9O A;  5ITY A;  1SXJ E;  1PJJ A;  4B3T M;  1OFI A;  4L6V 6;  4B3M M;  3U6P A;  2BJV A;  3TQS A;  3J7B A;  3QYE A;  4LJ5 A;  3T1Y M;  4REZ A;  3UGJ A;  4R3D A;  5EXS A;  2H5X A;  2OOA A;  3J27 B;  3IG5 A;  1IN8 A;  5IWA M;  4KO8 A;  4FWH A;  4JI3 M;  4RNA A;  1GJT A;  1Z5C A;  4DBG B;  2QBY A;  4IBB A;  4LZZ A;  2J7N A;  1IBM M;  2XSZ D;  5JI2 E;  1QQW A;  3GPU A;  1N36 M;  1ZMU A;  3I04 M;  4KT0 F;  2MRO B;  1JR3 D;  4B3R M;  5DFL A;  2DAK A;  3HHX A;  4NOO B;  2M5Z A;  2DWN A;  1SXJ D;  3A42 A;  3LW5 F;  1TDH A;  1C1K A;  3C3E A;  3W68 A;  3D8L A;  2R6F A;  4AKG A;  1WHC A;  3FUV A;  2Z4R A;  2G5G X;  2JZ1 A;  3SHG B;  4R71 A;  1G59 A;  4DR1 M;  2KRK A;  2DWL A;  3H4M A;  3FUX A;  2QCU A;  4DV4 M;  2ZTD A;  2V1U A;  1GVN A;  2X49 A;  3KW6 A;  1XB2 B;  2RGH A;  1F4I A;  3AOG A;  5ITR A;  3B7N A;  1NJG A;  3KDS E;  1T6O A;  1VDD A;  3VKG A;  2ZAO A;  4CGY B;  2O25 A;  5FSW A;  3SAR A;  3GPY A;  4WUR A;  1NNJ A;  1NO1 A;  1QVR A;  1QZM A;  2UXB M;  2C9O A;  5ITX A;  2G3Q A;  3DZD A;  1L8Q A;  2FFJ A;  3TWK A;  1I94 M;  1D2N A;  4CIZ A;  3SAV A;  1WIV A;  2OQ4 A;  3RGP A;  3W0L B;  4B08 A;  3JR5 A;  4B7H A;  3NBX X;  5EP3 A;  3LCU A;  4MM3 B;  4JI6 M;  3HY5 A;  5E6J A;  4JXJ A;  1WR1 B;  8CAT A;  5FLX S;  3U60 B;  2KRU A;  1PM5 A;  1NHW C;  3LVW A;  3KVW A;  3THG A;  4NXM M;  5IRE B;  4NC6 A;  2BWB A;  2HHH M;  1TGU A;  3SC3 A;  1HNZ M;  2J5Y A;  1NSF A;  2R62 A;  3T15 A;  4PD2 A;  3HX3 A;  1MU5 A;  4LGY A;  3T38 A;  3MK6 A;  1K82 A;  1ORY B;  4IBI A;  5E26 A;  3E9S A;  4DV3 M;  4LF9 M;  3GLH B;  2LNH C;  2FOI C;  1IBK M;  1T43 A;  2KNA A;  2RKO A;  4IBC A;  3TPZ A;  4DV7 M;  3GLG A;  4AKI A;  1NHG C;  2DNA A;  2Q2E B;  3KP0 E;  4GHA A;  4AG5 A;  3I51 A;  5ITU A;  4IIW A;  5LMN M;  1WJ7 A;  4G6Z A;  4G4R A;  2K47 A;  2LH0 A;  1N34 M;  4X65 M;  3K9P A;  3VK8 A;  1HJP A;  4ZPX A;  5EP4 A;  2LXE A;  2QBY B;  1JB0 F;  2C9C A;  4TUW A;  3HJ8 A;  3SAU A;  1D0K A;  1T3T A;  4DR6 M;  5KPZ A;  2DAE A;  1TH3 A;  2RGO A;  4YY3 M;  2KZS A;  2LVQ D;  2XEP A;  5KQ8 A;  2KW0 A;  4G4Q A;  5EXT A;  4D80 A;  2DI0 A;  3FTC A;  3J2P B;  4NL4 H;  1HNW M;  4LJ4 A;  3GQ3 A;  1NNU C;  1EFU B;  2WSF F;  4QNM A;  3T6P A;  4AKH A;  4WP2 A;  5KO3 A;  3U6L A;  1OAO C;  1TF0 B;  1IY1 A;  2D7E A;  1K3X A;  3FTD A;  3U61 A;  2WSE F;  3LCV B;  1G3I A;  4LFA M;  2QNJ A;  4MH0 E;  3SMP A;  2D7H A;  1VDL A;  2ZAM A;  3M6A A;  3FUW A;  3GRY A;  1DGG A;  4LF7 M;  2BWE A;  1E9R A;  2DWZ B;  4F2L A;  4AZF A;  3J81 S;  3CF2 A;  5EQT A;  1RU3 A;  4HL4 A;  3VDU A;  1KYI A;  3E4R A;  4I81 A;  1Q39 A;  1R6B X;  1HNX M;  2LVN C;  3GRV A;  1D0L A;  4B7F A;  1XXH B;  3FRI A;  4D82 A;  1DV0 A;  4JI5 M;  3I4V A;  3MMP A;  4P16 A;  1NV8 A;  4II7 A;  4WW0 A;  4LF4 M;  2CV1 A;  4BB9 A;  3HU2 A;  1NJF A;  2X8A A;  3PNV A;  2DHY A;  2CRU A;  3R8F A;  3QAU A;  1QAO A;  2LVP C;  1IXR C;  1XWI A;  4DR7 M;  4IBK A;  4NSO B;  4F1I A;  4I4L A;  3ZC7 B;  1HT2 E;  2DAI A;  4OU7 A;  2UUC M;  1MX0 A;  2Z4S A;  1BVS A;  2JXN A;  2K9D A;  4OW0 A;  1CUK A;  4ITQ A;  4BLC A;  2DHR A;  2FH0 A;  4CIS A;  2KA6 B;  2EKK A;  1NV9 A;  3TL4 X;  2HL7 A;  5JI3 E;  5ITQ A;  4G4N A;  3WHL A;  3QWL A;  1Z6T A;  1IXS A;  3VK7 A;  2R18 A;  3HHW A;  1V33 A;  3U6O A;  4M0D A;  4RF0 A;  3H4J A;  3GLI A;  5FTN A;  3HWS A;  3KSX A;  1DGH A;  2L2D A;  2Y0Q A;  5EXX A;  5BR8 M;  2APL A;  3C58 A;  3TWM A;  1LV7 A;  3U5Z A;  2XGN A;  4LJA A;  3VFD A;  1GKI A;  3GLH E;  3HJS A;  3PVS A;  2K0B X;  2LVA A;  1TDZ A;  1IY2 A;  4HEO A;  1AIP C;  5ITT A;  2XF3 A;  2MGW A;  3B89 A;  3SFZ A;  1XNR M;  2C98 A;  1OTR A;  3HJQ A;  1W5T A;  1D0M A;  2OO9 A;  1Q3B A;  2WZJ A;  2W82 A;  4XBO A;  5EXP A;  2LWX A;  3VDP A;  2FS1 A;  2UUA M;  4NSR A;  1QAN A;  3D8B A;  1NVM A;  1G8P A;  2ERC A;  4DR3 M;  3SYK A;  4X66 M;  2ZTC A;  5GKN A;  4IBG A;  3U61 B;  1NY6 A;  1I4W A;  1YUB A;  2EUC A;  3U6M A;  2CV2 A;  2A5Y B;  3FUT A;  1N32 M;  3Q8G A;  5EP1 A;  2YFQ A;  2L09 A;  2O5R A;  1W5S A;  1QUT A;  1VG5 A;  4PDG A;  4DV5 M;  1L2C A;  1X37 A;  1L1Z A;  4QHT A;  1Q3C A;  2V6Z M;  3K8Z A;  4M0W A;  2ZBK B;  3FUU A;  4QOS A;  3VLF B;  3HGI A;  1EIJ A;  2JY8 A;  3CF0 A;  2QEN A;  2QPA A;  3IEC A;  4LRS A;  1HQC A;  1GLN A;  1HR0 M;  2N35 A;  4S12 A;  2MR9 A;  4GH9 A;  1MN3 A;  5EJC A;  1C7Y A;  2F5S A;  5L8R F;  1N33 M;  4I5S A;  1R5L A;  3KXE C;  3L27 A;  3UK6 A;  4CJ6 A;  3FTF A;  4Y28 F;  2Y21 A;  1KFV A;  1S3S A;  4DV0 M;  2R46 A;  1TTE A;  3LMM A;  2XFT A;  5ITX E;  1E9S A;  1OQY A;  1R4G A;  2KHH A;  3UJN A;  1XXH E;  1YLA A;  3KSJ A;  2F5N A;  2E5L M;  4Q7J A;  2KEB A;  4R7G A;  1ZQ9 A;  2F5P A;  1XNQ M;  3KOZ E;  2KNV A;  2VF8 A;  4LRT A;  4MGI E;  3GPX A;  1QDR A;  1IXS B;  4AQY M;  2LHG A;  2I7N A;  4DV6 M;  3BBZ A;  3HKP A;  4FWD A;  2HWJ A;  3GRR A;  1XMO M;  3U6C A;  3TWL A;  3GLI B;  1PRB A;  4GKJ M;  4K0K M;  1VEG A;  3JAM S;  1DGH B;  1OIP A;  2CWB A;  4MGZ E;  5IZ7 D;  4AG6 A;  3GQ4 A;  3U5Z B;  1IXZ A;  2X4A A;  3RE8 A;  3AKZ A;  4KLN A;  5F3W A;  3BOS A;  4DR2 M;  3GQ5 A;  4LJ7 A;  3GLF A;  2XZF A;  2JZ0 A;  1FNN A;  7CAT A;  4LF5 M;  2L7I A;  3C9P A;  4YHH M;  2CEA A;  3PFI A;  4X62 M;  4Z6Y A;  2DKL A;  2UUB M;  3M0E A;  2JWS A;  3E21 A;  4GEW A;  1TH2 A;  2QZ4 A;  1J5E M;  4LJ9 A;  2JA2 A;  4JI0 M;  2R0I A;  2VII A;  1H6U A;  1P3Q Q;  3FTE A;  2MJ5 B;  2QQ8 A;  4NXN M;  2DXI A;  3DA1 A;  1WGL A;  3C3D A;  1AUA A;  3HU1 A;  2EA0 A;  2HCB A;  2KZU A;  2VQE M;  2CHG A;  5C18 A;  2XSZ A;  2Y0T A;  4KHP M;  4IBJ A;  3CF6 E;  2R4E A;  1J7K A;  2B3T A;  4RKU F;  1JR3 A;  1DO0 A;  4JN6 A;  3SAS A;  2CE7 A;  4IBD A;  3J7A S;  1MJG M;  1SXJ A;  3TE6 A;  3K1J A;  3UZU A;  3AJI B;  1R2Z A;  4FW9 A;  3GPP A;  2CFO A;  2EJS A;  5DNY A;  1OFH A;  2C99 A;  2L6O A;  1OJL A;  1YE9 A;  3MHV C;  3LVV A;  4XK8 F;  1Y8G A;  4L4U A;  4P17 A;  4LGM A;  3WHK A;  2XFS A;  2H1R A;  1IN6 A;  3DFZ A;  5DYI A;  1WGN A;  3ILK A;  4D81 A;  4PDI A;  2LVO C;  3AOE A;  1R7R A;  3NWL A;  2JY6 B;  2OPF A;  2F5Q A;  1QZE A;  4JI2 M;  3GLG B;  2OOB A;  2Z3X A;  2D7G A;  3M7G A;  3HZJ A;  1VQ1 A;  3IHP A;  4DR5 M;  3CGW A;  3LQQ A;  3KOY E;  2L4F A;  3BXW A;  4W5W A;  1L1T A;  4LG2 A;  1VEJ A;  3JR4 A;  3PNY A;  3FE3 A;  2P5T A;  3GRU A;  4FWG A;  3RGS A;  2CUZ A;  1DGF A;  4OX9 M;  2G8L A;  2JY5 A;  4G4O A;  1XC8 A;  2DZN B;  1SXJ C;  5H37 D;  1IN4 A;  1R2Y A;  5LMU M;  4GC9 A;  1A5T A;  1IN7 A;  3FYC A;  3L26 A;  5FTM A;  1N77 A;  4RF1 A;  2YNM D;  1XMQ M;  3K92 A;  4IBE A;  1PJI A;  2F4V M;  3KS4 A;  4L16 A;  3K2L A;  3RFW A;  4FCV A;  3B7Z A;  2CP8 A;  1SG9 A;  1IM2 A;  3AV0 A;  4FCW A;  4I8O A;  1IQP A;  1GL7 A;  2VQF M;  3AOE C;  3HHZ A;  3GLF B;  1QDT A;  2DZO B;  2JNH A;  2V1C A;  2VF7 A;  4MGY E;  1NY5 A;  3NBI A;  2RRU A;  2XZU A;  4M9Z A;  3KFU G;  3FKE A;  2JUJ A;  4CHT B;  1FJG M;  2HKJ A;  3R9X B;  3HU3 A;  4HLQ A;  1E32 A;  3GLI E;  2JY7 A;  4MGK E;  4DR4 M;  5FTL A;  3GP1 A;  2UXD M;  2VDB B;  4GKK M;  1ZMW A;  3V76 A;  3J80 S;  4M9X A;  1G41 A;  3B74 A;  4IBF A;  1L2B A;  1K3W A;  4Z8X A;  3U6D A;  4DUY M;  3L25 A;  1OKS A;  4B7G A;  1GJS A;  2R45 A;  3GO8 A;  3UMM A;  1N78 A;  2C5R A;  2DEN A;  3KOX E;  1ZAE A;  2LHC A;  4LCB A;  2R65 A;  2KNZ A;  5DYG A;  1SXJ B;  2WSC F;  4ANR A;  5A2Q S;  4MGH A;  3IG8 A;  3PXG A;  4AI6 A;  4JI1 M;  4OVZ A;  2DAM A;  1IY0 A;  2JP7 A;  4UN2 B;  2ZAN A;  1XXH A;  1UM8 A;  1KSF X;  3U6Q A;  2CHQ A;  1HT1 E;  1ZV1 A;  4GIP A;  1PJS A;  1V34 A;  3SAT A;  4LFC M;  5KQD A;  3ZQJ A;  1WXQ A;  3A45 A;  4NRV A;  4DUZ M;  4DV1 M;  3T1H M;  2NQ8 C;  1QUS A;  2Y20 A;  2QHO B;  1Z59 A;  3SMS A;  1TH4 A;  1GO5 A;  4L8R C;  4FVM A;  2R4J A;  1GL6 A;  3KS8 A;  4GMQ A;  4QNR A;  1UFZ A;  5FTK A;  5KPR A;  1VEK A;  3B9P A;  2DWM A;  2GQF A;  1IN5 A; 
#chains in the Genus database with same CATH homology
 2EO2 A;  4PT5 A;  2M60 A;  3CTW B;  3FD9 A;  5C1B A;  1J09 A;  2BNK A;  2CHV A;  1IBL M;  4LY6 A;  3ZH9 B;  1E94 E;  1EE8 A;  2CV0 A;  3A98 B;  5BPV A;  4GHL A;  3EIE A;  3SHF A;  4MB7 A;  4XGI A;  2UU9 M;  1JQJ C;  4JI8 M;  3VKH A;  1QYR A;  4BBA A;  4GIT A;  4JI4 M;  3L28 A;  4LFB M;  1QAQ A;  3L29 A;  3I4Y A;  2QP9 X;  5EP2 A;  4IJE A;  4NRW A;  1Z5A A;  2Z7J A;  4QHS A;  1L2D A;  4KOD A;  2XLJ A;  4PCZ A;  1G4A E;  4X64 M;  4B3S M;  1DGB A;  2AHM A;  2DVW B;  3DOA A;  5FTJ A;  2F5O A;  2UXC M;  1DO2 A;  3Q8X A;  5KPT A;  2KXE A;  4LF6 M;  4GRI A;  2YR0 A;  2ZM6 M;  4LJ6 A;  4M9S A;  2FE8 A;  3SBJ A;  3SYL A;  4IJF A;  4LZJ A;  5IT9 S;  3A46 A;  3SAW A;  4A3V B;  3U6S A;  2I7P A;  3W0F A;  4JV5 M;  4QOZ C;  2J7O A;  3ZCB B;  3U6E A;  4LF8 M;  4JYA M;  4L78 A;  3LQR A;  3KP1 E;  3OTO M;  2FNA A;  2XH9 A;  4DV2 M;  4OVZ B;  1N75 A;  3EIH A;  3U60 A;  3KOW E;  4L15 A;  3AFH A;  3MJ5 A;  4GC5 A;  4FD2 A;  3HHY A;  4EIW A;  3AL0 C;  2L7H A;  2YQZ A;  3L2A A;  4AW4 A;  4LJ8 A;  1Z5B A;  1YSY A;  4FCT A;  4JI7 M;  2BJW A;  3GLH A;  1QAM A;  1XHB A;  3FYD A;  1HQY E;  2C96 A;  1PJJ A;  5ITY A;  1SXJ E;  4B3T M;  1OFI A;  4B3M M;  3U6P A;  2BJV A;  3TQS A;  3J7B A;  4LJ5 A;  3T1Y M;  4REZ A;  3UGJ A;  4R3D A;  5EXS A;  3J27 B;  3IG5 A;  1IN8 A;  5IWA M;  4KO8 A;  4FWH A;  4JI3 M;  4RNA A;  2QBY A;  1Z5C A;  4IBB A;  4LZZ A;  2J7N A;  1IBM M;  2XSZ D;  5JI2 E;  1QQW A;  3GPU A;  1N36 M;  1JR3 D;  4B3R M;  3HHX A;  4NOO B;  2M5Z A;  2DWN A;  1SXJ D;  3A42 A;  1TDH A;  1C1K A;  3D8L A;  4AKG A;  3FUV A;  2Z4R A;  2G5G X;  3SHG B;  1G59 A;  2DWL A;  4DR1 M;  2KRK A;  3H4M A;  3FUX A;  2QCU A;  4DV4 M;  2V1U A;  1GVN A;  2X49 A;  3KW6 A;  2RGH A;  3AOG A;  5ITR A;  1NJG A;  3KDS E;  1VDD A;  3VKG A;  2ZAO A;  4CGY B;  5FSW A;  3SAR A;  3GPY A;  4WUR A;  1NNJ A;  1QVR A;  1QZM A;  2UXB M;  2C9O A;  5ITX A;  3DZD A;  1L8Q A;  2FFJ A;  3TWK A;  1I94 M;  1D2N A;  3SAV A;  2OQ4 A;  3RGP A;  3W0L B;  4B08 A;  3JR5 A;  4B7H A;  5EP3 A;  4MM3 B;  4JI6 M;  5E6J A;  4JXJ A;  8CAT A;  5FLX S;  3U60 B;  2KRU A;  1PM5 A;  1NHW C;  3LVW A;  3KVW A;  3THG A;  4NXM M;  5IRE B;  2HHH M;  1TGU A;  3SC3 A;  1HNZ M;  1NSF A;  2R62 A;  3T15 A;  4PD2 A;  1MU5 A;  4LGY A;  3T38 A;  3MK6 A;  1K82 A;  1ORY B;  4IBI A;  5E26 A;  3E9S A;  4DV3 M;  4LF9 M;  3GLH B;  2LNH C;  2FOI C;  1IBK M;  2RKO A;  4IBC A;  3TPZ A;  4DV7 M;  3GLG A;  4AKI A;  1NHG C;  2Q2E B;  3KP0 E;  4GHA A;  4AG5 A;  3I51 A;  5ITU A;  4IIW A;  5LMN M;  4G6Z A;  4G4R A;  2K47 A;  2LH0 A;  1N34 M;  4X65 M;  3VK8 A;  4ZPX A;  5EP4 A;  2LXE A;  2QBY B;  2C9C A;  4TUW A;  3HJ8 A;  3SAU A;  1T3T A;  4DR6 M;  5KPZ A;  1TH3 A;  2RGO A;  4YY3 M;  2KZS A;  2XEP A;  5KQ8 A;  4G4Q A;  2KW0 A;  5EXT A;  4D80 A;  3FTC A;  3J2P B;  4NL4 H;  1HNW M;  4LJ4 A;  3GQ3 A;  1NNU C;  4QNM A;  4AKH A;  5KO3 A;  3U6L A;  1IY1 A;  2D7E A;  1K3X A;  3FTD A;  3U61 A;  1G3I A;  4LFA M;  3SMP A;  4MH0 E;  2D7H A;  2ZAM A;  3M6A A;  3FUW A;  3GRY A;  1DGG A;  4LF7 M;  1E9R A;  2DWZ B;  4AZF A;  3J81 S;  3CF2 A;  5EQT A;  4HL4 A;  3VDU A;  1KYI A;  3E4R A;  4I81 A;  1Q39 A;  1R6B X;  1HNX M;  3GRV A;  4B7F A;  1XXH B;  4D82 A;  4JI5 M;  3I4V A;  4P16 A;  4II7 A;  4WW0 A;  4LF4 M;  2CV1 A;  4BB9 A;  3HU2 A;  1NJF A;  2X8A A;  3PNV A;  3R8F A;  3QAU A;  1QAO A;  1IXR C;  1XWI A;  4DR7 M;  4IBK A;  4NSO B;  4I4L A;  3ZC7 B;  1HT2 E;  4OU7 A;  2UUC M;  1MX0 A;  2Z4S A;  4OW0 A;  4ITQ A;  4BLC A;  2DHR A;  4CIS A;  2KA6 B;  3TL4 X;  2HL7 A;  5JI3 E;  5ITQ A;  4G4N A;  3WHL A;  3QWL A;  1Z6T A;  3VK7 A;  2R18 A;  3HHW A;  3U6O A;  4M0D A;  4RF0 A;  3GLI A;  5FTN A;  3HWS A;  3KSX A;  1DGH A;  5EXX A;  2Y0Q A;  5BR8 M;  3C58 A;  3TWM A;  3U5Z A;  1LV7 A;  2XGN A;  4LJA A;  3VFD A;  1GKI A;  3HJS A;  3PVS A;  1TDZ A;  1IY2 A;  5ITT A;  2XF3 A;  3SFZ A;  1XNR M;  2C98 A;  3HJQ A;  1W5T A;  4GKJ M;  1Q3B A;  4XBO A;  2W82 A;  5EXP A;  3VDP A;  2LWX A;  2UUA M;  4NSR A;  1QAN A;  3D8B A;  1NVM A;  1G8P A;  2ERC A;  4DR3 M;  3SYK A;  4X66 M;  5GKN A;  4IBG A;  3U61 B;  1NY6 A;  1I4W A;  1YUB A;  2EUC A;  3U6M A;  2CV2 A;  2A5Y B;  3FUT A;  1N32 M;  5EP1 A;  2YFQ A;  2L09 A;  2O5R A;  1W5S A;  4PDG A;  4DV5 M;  1L2C A;  1X37 A;  1L1Z A;  4QHT A;  1Q3C A;  2V6Z M;  3K8Z A;  4M0W A;  2ZBK B;  3FUU A;  4QOS A;  3VLF B;  3HGI A;  3CF0 A;  2QEN A;  2QPA A;  4LRS A;  1HQC A;  1GLN A;  1HR0 M;  4S12 A;  4GH9 A;  5EJC A;  2F5S A;  1N33 M;  4I5S A;  3KXE C;  3L27 A;  3UK6 A;  3FTF A;  2Y21 A;  1KFV A;  1S3S A;  4DV0 M;  2R46 A;  3LMM A;  2XFT A;  5ITX E;  1E9S A;  3UJN A;  3KSJ A;  2F5N A;  2E5L M;  2KEB A;  4R7G A;  1ZQ9 A;  2F5P A;  1XNQ M;  3KOZ E;  4LRT A;  4MGI E;  3GPX A;  1IXS B;  4AQY M;  2I7N A;  4DV6 M;  3HKP A;  4FWD A;  1XMO M;  3GRR A;  3U6C A;  3TWL A;  3GLI B;  4K0K M;  3JAM S;  1DGH B;  5IZ7 D;  4MGZ E;  4AG6 A;  3GQ4 A;  3U5Z B;  1IXZ A;  2X4A A;  3RE8 A;  3AKZ A;  4KLN A;  5F3W A;  3BOS A;  4DR2 M;  3GQ5 A;  4LJ7 A;  3GLF A;  2XZF A;  1FNN A;  7CAT A;  4LF5 M;  2L7I A;  4YHH M;  2CEA A;  3PFI A;  4X62 M;  4Z6Y A;  2UUB M;  3M0E A;  1J5E M;  1TH2 A;  2QZ4 A;  4LJ9 A;  2JA2 A;  4JI0 M;  2VII A;  1H6U A;  3FTE A;  4NXN M;  2DXI A;  3DA1 A;  2EA0 A;  3HU1 A;  2HCB A;  2KZU A;  2VQE M;  2CHG A;  5C18 A;  2XSZ A;  2Y0T A;  4KHP M;  4IBJ A;  3CF6 E;  2R4E A;  1J7K A;  3SAS A;  1JR3 A;  1DO0 A;  4JN6 A;  2CE7 A;  4IBD A;  3J7A S;  1SXJ A;  3UZU A;  3TE6 A;  3K1J A;  3AJI B;  1R2Z A;  4FW9 A;  3GPP A;  2CFO A;  5DNY A;  1OFH A;  2C99 A;  2L6O A;  1OJL A;  1YE9 A;  3MHV C;  3LVV A;  4L4U A;  4LGM A;  3WHK A;  2XFS A;  2H1R A;  1IN6 A;  3DFZ A;  5DYI A;  3ILK A;  4D81 A;  4PDI A;  3AOE A;  1R7R A;  3NWL A;  2OPF A;  2F5Q A;  4JI2 M;  3GLG B;  2Z3X A;  2D7G A;  3M7G A;  4DR5 M;  3LQQ A;  3KOY E;  4W5W A;  1L1T A;  4LG2 A;  3JR4 A;  3PNY A;  2P5T A;  3GRU A;  4FWG A;  3RGS A;  2CUZ A;  1DGF A;  4OX9 M;  2G8L A;  4G4O A;  1XC8 A;  2DZN B;  1SXJ C;  5H37 D;  1IN4 A;  1R2Y A;  5LMU M;  4GC9 A;  1IN7 A;  3FYC A;  3L26 A;  5FTM A;  1N77 A;  4RF1 A;  2YNM D;  1XMQ M;  3K92 A;  4IBE A;  1PJI A;  2F4V M;  3KS4 A;  4L16 A;  3K2L A;  3RFW A;  4FCV A;  1IM2 A;  3AV0 A;  4FCW A;  4I8O A;  1IQP A;  1GL7 A;  2VQF M;  3AOE C;  3HHZ A;  3GLF B;  2DZO B;  2V1C A;  4MGY E;  1NY5 A;  3NBI A;  2XZU A;  4M9Z A;  3KFU G;  3FKE A;  4CHT B;  1FJG M;  2HKJ A;  3R9X B;  3HU3 A;  4HLQ A;  1E32 A;  4MGK E;  4DR4 M;  5FTL A;  3GP1 A;  2UXD M;  4GKK M;  3J80 S;  4M9X A;  1G41 A;  4IBF A;  1L2B A;  1K3W A;  4Z8X A;  3U6D A;  4DUY M;  3L25 A;  4B7G A;  2R45 A;  3GO8 A;  3UMM A;  1N78 A;  2C5R A;  3KOX E;  1ZAE A;  4LCB A;  2R65 A;  5DYG A;  1SXJ B;  5A2Q S;  4MGH A;  3IG8 A;  3PXG A;  4AI6 A;  4JI1 M;  4OVZ A;  1IY0 A;  2ZAN A;  1XXH A;  1UM8 A;  1KSF X;  3U6Q A;  2CHQ A;  1HT1 E;  4GIP A;  3SAT A;  4LFC M;  5KQD A;  1WXQ A;  3A45 A;  4NRV A;  4DUZ M;  4DV1 M;  3T1H M;  2NQ8 C;  2Y20 A;  1Z59 A;  3SMS A;  1TH4 A;  4L8R C;  4FVM A;  2R4J A;  1GL6 A;  3KS8 A;  4GMQ A;  4QNR A;  5FTK A;  5KPR A;  3B9P A;  2DWM A;  1IN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...