4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
1XXHB 5JI2E 1UM8A 1HQYE 2DZNB 1NY6A 2C9CA 1HT2E 4D80A 3H4MA 4QOSA 5FTMA 2V1UA 3U61B 3HWSA 1G3IA 3GLIA 5C1BA 5FTLA 4FD2A 5EP4A 3K1JA 5EP2A 1IY1A 5DYGA 2KRKA 4JN6A 3KW6A 4QNRA 3GLFB 1OJLA 2R62A 4I81A 3PXGA 3VLFB 3U60B 1NJFA 2ZAOA 2CHGA 2X8AA 4LJ8A 4A3VB 1HQCA 3B9PA 5EQTA 1W5SA 2DZOB 4QHSA 4LCBA 2ZAMA 1S3SA 1IN5A 1G41A 3SYKA 3VFDA 1IQPA 2Z4SA 2Z4RA 4FW9A 1IN4A 1IN6A 5DYIA 3MHVC 4QNMA 4Z8XA 2QPAA 1JQJC 4LJ9A 1DO0A 4FCWA 2QBYB 1IN8A 1SXJA 2HCBA 5EXPA 4L4UA 3M6AA 3ZH9B 4FCVA 3WHKA 1NVMA 4EIWA 2QZ4A 2BJVA 5FTNA 1SXJC 1E32A 1NJGA 4LJAA 3BOSA 4L15A 1L8QA 4LRTA 4QHTA 3GLGB 2XSZD 1IXRC 1SXJE 3GLGA 1KSFX 2R65A 2XSZA 2QP9X 4I4LA 1OFHA 2V6ZM 1IY0A 1R6BX 4FWHA 4FWGA 4LZZA 1X37A 4D82A 4LRSA 1HT1E 3U5ZB 3SC3A 4LGMA 3EIHA 3HU3A 1SXJD 3PFIA 2DVWB 4L16A 1SXJB 4LJ4A 2DHRA 4FCTA 1JR3A 5EP1A 4KO8A 5JI3E 1OFIA 5C18A 1D2NA 4LY6A 4LJ6A 3GLHB 2RKOA 3DZDA 4WW0A 3CF2A 4D81A 3WHLA 3SYLA 2VIIA 3UK6A 2CEAA 4KODA 3D8BA 3EIEA 5FTJA 1J7KA 1IXZA 5FTKA 5EP3A 3HU2A 1QVRA 4ZPXA 1JR3D 3AJIB 4LJ7A 1C1KA 1KYIA 1IM2A 1FNNA 3CF0A 5EXXA 1G4AE 2BJWA 3M0EA 3R8FA 2QBYA 2FNAA 2CE7A 1QZMA 3GLIB 1IN7A 1IY2A 3HU1A 1LV7A 2CHQA 2DWZB 3KDSE 3PVSA 1E94E 1W5TA 3GLFA 1NY5A 2CHVA 2ZANA 4LJ5A 2QENA 4FWDA 3GLHA 1NSFA 1IXSB 2C9OA 1R7RA 2C99A 2C96A 1XXHA 2C98A 1XWIA 4GITA 4KLNA 5EXTA 1DO2A 5EXSA
chains in the Genus database with same CATH superfamily
2YR0A 3J2PB 3U6PA 1R2YA 4JI6M 1EIJA 4OU7A 2C9CA 4L8RC 3H4MA 2MROB 2K47A 3J7BA 5KQ8A 3T1HM 5FTMA 5ITTA 2V1UA 3PNYA 4YY3M 1G3IA 3C3EA 2QCUA 4IBJA 2EKFA 3THGA 1GL6A 4MB7A 3E21A 1AIPC 2L7IA 2OOBA 2OOAA 5EP4A 5BR8M 4R7GA 1WGLA 4CHTB 2KRKA 4JN6A 2CRUA 3GLFB 3I01M 2EUCA 2WZJA 3LCUA 4LF8M 1DGHA 3GLHE 1G71A 3HHWA 1NJFA 3VLFB 2X8AA 3U60B 3AOEA 2J5YA 2DAGA 4PT5A 2UXDM 4QHSA 4YHHM 2EJSA 2RRUA 3JAMS 1EE8A 2ZAMA 4GIPA 1CUKA 4Q7JA 2K9DA 5GKNA 1XNQM 2LHCA 3KOYE 1IN6A 1VEJA 2KHHA 2M5ZA 1G59A 2FS1A 3LVWA 4Z8XA 2QPAA 7CATA 3KOXE 4FCWA 1OIZA 4KHPM 3OTOM 2CUZA 1IN8A 1WR1B 2HCBA 2AHMA 2VF8A 2ZBKB 5KQDA 1PJIA 2L2DA 1ZAEA 4IBBA 3ZH9B 3U6EA 1K3XA 4LF5M 4AKGA 3BXWA 3HJSA 1XB2B 2G3QA 4FCVA 3U60A 4BLCA 3HKPA 4EIWA 2QZ4A 1OIPA 2H5XA 1NJGA 4LJAA 2R45A 5ITYA 3U6LA 2JA2A 1L8QA 1OAOC 4HL4A 4B7FA 2JWSA 4P16A 4AKHA 2DWNA 1N33M 2CWBA 3GLGA 1RU3A 2R65A 4HLQA 3Q8GA 3HJQA 4JI3M 1HNWM 4DR5M 2K6BA 2QP9X 3GRYA 4I4LA 2V6ZM 1IY0A 4FWGA 1R5LA 3D8LA 2CV0A 4REZA 1Y8GA 3HHYA 5IZ7D 3FTEA 4ITQA 3CTWB 2ZTDA 3EIHA 3L2AA 2UUCM 4DR3M 3U6OA 1SXJB 4LJ4A 2HWJA 5EP1A 1PJJA 5JI3E 1OFIA 2N35A 1WGNA 2VF7A 4WW0A 5ITRA 5IREB 3U6DA 4B3TM 3A98B 4DR4M 4G4OA 2CEAA 2JY8A 3AFHA 2CFOA 4DV6M 2L4FA 1DGHB 4G4QA 1J7KA 2EO2A 4DV5M 4GHLA 2R6FA 2APLA 3GLGE 2Q2EB 1JR3D 3LMMA 2O01F 1XHBA 1C1KA 3VK8A 1KYIA 1FNNA 2WSEF 4LZJA 4MGHA 5EXXA 1G4AE 1GKIA 4NSRA 4OW0A 3TQSA 3R8FA 2QBYA 4OVZA 4LFBM 3GLIB 4IIWA 4PD2A 5KPRA 4P17A 1IN7A 3VDUA 3UJNA 4W5WA 1NNJA 1NNUC 3L28A 3FTDA 1Q3BA 5E6JA 1PJSA 1L2DA 4ANRA 1MN3A 2CHVA 2FE8A 2F5NA 3L27A 3U6SA 4NSOB 2OPFA 2QENA 1V34A 3AOEC 3M7GA 4FWDA 1NSFA 2C9OA 4KLNA 1ZMWA 3RGSA 2C5RA 4B3SM 1HJPA 5EXTA 2F5PA 1DO2A 4G4NA 1XXHB 1NV8A 4M0DA 5JI2E 1TGUA 3FTCA 2DAKA 1HQYE 2DNAA 5ITQA 1IBLM 1DGFA 3KFUG 3IG5A 1HT2E 2B3TA 1L1TA 4D80A 3A46A 1N36M 2DWLA 4CISA 3FD9A 3K2LA 4DUYM 4BBAA 1ZMVA 1Q02A 1IBMM 2LWXA 3MMPA 3J7AS 2DENA 2DI0A 3TWKA 4M9ZA 1MX0A 4GH9A 1PRBA 1QAOA 3SHGB 3RFWA 5EP2A 2V1CA 5DYGA 3A45A 2R46A 3FRHA 4LGYA 4IBFA 4B7HA 4AG6A 3FYCA 2CHGA 2UUAM 4Z6YA 2XH9A 5EQTA 3MJ5A 1XMQM 2DAEA 2DZOB 3UZUA 2XGNA 2L4EA 1PJQA 2RGHA 4DR1M 4GHAA 1IQPA 2DZLA 2Z4RA 1OKSA 3IG8A 5DYIA 3W68A 3A42A 1XMOM 1K82A 3MHVC 4MH0E 2KNAA 4MGIE 3UGJA 5KPTA 1JQJC 2FH0A 1N32M 3IECA 4CIZA 2XF3A 2OQ4A 2QBYB 2BWBA 4JI2M 3KS8A 4GMQA 3QYEA 4DR6M 3J80S 2KXEA 4GKJM 3T38A 3ZCBB 4IBKA 4CGYB 4TUWA 4G4RA 1NVMA 3DFZA 4R71A 3V76A 1SXJC 1E32A 3GPUA 2KA6B 4L15A 4LRTA 1IXRC 3JR4A 4JI4M 3Q8XA 2F5OA 4IBCA 1VEGA 1KSFX 3NBXX 2F5QA 1AUAA 4LZZA 4FWHA 3KXEC 4D82A 5ITXE 4AI6A 4AKIA 2R44A 1HT1E 4X66M 1PM5A 3NBIA 3LVVA 1SXJD 2YFQA 3PFIA 4UN2B 2YNMD 3KP0E 3GPYA 4X64M 1VDLA 2X4AA 2LVOC 4LY6A 3W0LB 3ILKA 4F1IA 4GRIA 3WHLA 5IT9S 2VIIA 1JB0F 1PJTA 3UK6A 2KNVA 4KODA 3D8BA 4M9XA 5KO3A 5LMUM 2LBCA 3KSXA 5EP3A 4DBGB 2DWMA 2UUBM 4LJ7A 3AJIB 4LF9M 3CF6E 2FFJA 1IM2A 1Q3CA 2X49A 3CF0A 1GABA 3H4JA 2JNHA 1IBKM 4JI5M 1GL7A 1Z5AA 4GC5A 4R3DA 2CHQA 1OTRA 3KDSE 3PVSA 3B89A 4NXNM 4IJFA 2JY6B 3SMPA 4JV5M 1WXQA 1W5TA 4IBDA 1TDZA 4LF6M 1NY5A 1TH2A 1ZQ9A 3TPZA 3UMMA 1I94M 2Z7JA 3SARA 4AG5A 2QSFX 4LF4M 2ZM6M 1C7YA 4AQYM 3J27B 1IXSB 4PCZA 1J5EM 3ZQJA 2C98A 1GLNA 3K9OA 5EXSA 2O25A 3GRUA 3TL4X 4NL4H 3AOGA 3QWLA 1UM8A 4II7A 2KRUA 4M0WA 3GLIE 3U6QA 4NXMM 2QNJA 1Q39A 1ZMUA 3KS4A 2JP7A 2QQ8A 3U61B 2D7HA 1D0KA 4OVZB 5IWAM 3GLIA 5C1BA 4GKKM 3L29A 1XXHE 1D0LA 3K92A 5FTLA 4L6V6 2LVPC 2JUJA 1YLAA 3RGPA 3SFZA 3K9PA 2KEBA 2XFTA 1IY1A 2XEPA 4DV1M 3KW6A 3T1YM 4MGYE 1D0MA 5ITUA 4JI1M 4I81A 2QHOB 5EJCA 3PXGA 3GQ4A 1NV9A 2ZAOA 4LJ8A 4DV0M 5F3WA 3GQ5A 1K3WA 2ZTCA 1HR0M 2M60A 3SATA 2KNZA 3C58A 3IHPA 4LCBA 1TH4A 2RGOA 3I4YA 1S3SA 1IN5A 2H1RA 1G41A 2L7HA 1WJ7A 3SYKA 1WIVA 3VFDA 2Z4SA 2Y0TA 2MGWA 4G3OA 4QNMA 5LMNM 3U61A 2DAIA 3AL0C 2DKLA 4LJ9A 1DO0A 4DV4M 2O5RA 2G5GX 2EKKA 2G8LA 2GQFA 1XNRM 1QUTA 2DXIA 3HX3A 4L4UA 4L78A 2HHHM 2GNOA 2R18A 4G6ZA 3FKEA 3WHKA 4OX9M 2VQFM 3E4RA 3JR5A 4B3MM 4WURA 3RE8A 3BOSA 3I51A 1DV0A 2JZ0A 4QHTA 4RNAA 4XGIA 2JXNA 2ERCA 2I7NA 2XSZD 4I5SA 3GLGB 2Z8YM 1GJSA 1IXSA 1SXJE 3HJ8A 4RF1A 2LXEA 2L6OA 1T43A 1FJGM 3LCVB 1N78A 1R6BX 1X37A 2XFSA 4LRSA 2I7PA 1SG9A 3U5ZB 3SC3A 4IBIA 2DAMA 3SMSA 2W82A 3J81S 3HU3A 1DGGA 3SAWA 4M9SA 1P3QQ 3KVWA 2UXCM 5L8RF 5C18A 3HY5A 1D2NA 4JXJA 4LJ6A 3GLHB 2RKOA 3DZDA 4D81A 2CP8A 3CF2A 1QQWA 4FVMA 3SYLA 5A2QS 4AW4A 1ORYB 2JY5A 2MR9A 5KPZA 1LTMA 3EIEA 1QAMA 3TWMA 2R4EA 3TWLA 3QAUA 1TTEA 3NWLA 2R4JA 5FTKA 1QVRA 4ZPXA 4JI8M 1H6UA 1GVNA 1TH3A 3M0EA 3U5ZA 2FNAA 2LNHC 2CE7A 3E9SA 3FE3A 3FUUA 3LW5F 1MJGM 4B3RM 3SAVA 3HU1A 1LV7A 3DOAA 3E46A 4LFAM 3U6CA 4K0KM 2KDLA 1NHGC 1VEKA 2J7NA 1EFUB 3GLFA 3L26A 4LG2A 1XC8A 2LVAA 4F2LA 3GLFE 4IBGA 4JI7M 1R7RA 2HL7A 4DR7M 1XXHA 3FUVA 4GITA 3I4VA 1YE9A 1QUSA 3T6PA 3F92A 1HNZM 1R4GA 5H37D 1J09A 2DZNB 1NY6A 3C3DA 2MJ5B 1TF0B 2Y0QA 3BBZA 3LQQA 4QOSA 4RKUF 1WHCA 4DV7M 2FOIC 4LF7M 1UFZA 3R9XB 4GEWA 3HWSA 1Z59A 3W0FA 1L1ZA 2JY7A 2OO9A 2YQZA 4DR2M 4GC9A 4FD2A 2F4VM 3PNVA 4JI0M 3K1JA 1N77A 4QNRA 1TR8A 2HAKA 2R0IA 1OJLA 1ZV1A 2R62A 5BPVA 4I8OA 3GPXA 4A3VB 3CGWA 3ZC7B 1HQCA 3B9PA 3L25A 2LVNC 1W5SA 4X65M 4JYAM 1HNXM 3HGIA 3GQ3A 3KOZE 4FW9A 3VKHA 1IN4A 4XK8F 3FTFA 3SBJA 1QZEA 2KZUA 1V92A 5ITXA 1TDHA 4XBOA 2A5YB 2KZSA 4CJ6A 2XLJA 2XZUA 1SXJA 2D7EA 3VKGA 3FUWA 5EXPA 3HZJA 3KSJA 3M6AA 5DNYA 1GO5A 1R2ZA 1A5TA 4HEOA 2HKJA 3GRVA 4B08A 2BJVA 2L09A 2LH0A 2LTUA 4S12A 5FTNA 3FYDA 1L2BA 2Z3XA 3SAUA 4AZFA 2KW0A 1YSYA 8CATA 1Z5BA 3I04M 4BB9A 3U6MA 2LVQD 3HHXA 1QDRA 1L2CA 1I4WA 1QDTA 1MU5A 3DA1A 2BWEA 3TE6A 3KOWE 4MGKE 4DUZM 2XSZA 3K8ZA 4LFCM 2NQ8C 4PDIA 1N75A 1OFHA 3LQRA 3QYBA 4MGZE 1Z6TA 3FUTA 5FLXS 2J7OA 2P5TA 1Z5CA 3SHFA 4QOZC 4DV3M 1VG5A 1T3TA 3AKZA 2DVWB 4L16A 2XZFA 3GPPA 1NO1A 2DHRA 4FCTA 1JR3A 1NHWC 1T6OA 2Y21A 4KO8A 1PGYA 5DFLA 4NRVA 3AV0A 3B74A 3B7NA 3GO8A 4NC6A 1YUBA 1F4IA 1VDDA 3SASA 3HHZA 4DV2M 2CV2A 1BVSA 4NRWA 2WSCF 4KT0F 5FTJA 3W67A 1IXZA 1QANA 2UU9M 3MK6A 3T15A 5FSWA 3HU2A 4MM3B 1VQ1A 2F5SA 1G8PA 1OAIA 1E9RA 1GJTA 2BNKA 1OQYA 3VDPA 3VK7A 1E9SA 3B7QA 2BJWA 3C9PA 4IJEA 4PDGA 2DHYA 1QZMA 2K0BX 3FUXA 2MH8A 2JZ1A 1QAQA 2CV1A 3FRIA 1IY2A 4IBEA 2DWZB 1QYRA 4RF0A 5E26A 1IFYA 4X62M 1JR3E 4WP2A 1E94E 4Y28F 2LHGA 3KP1E 4NOOB 1V33A 1N34M 2ZANA 4LJ5A 2Y20A 3B7ZA 1KFVA 2EA0A 3GLHA 2WSFF 2VDBB 1DGBA 2C99A 4B7GA 2VQEM 2C96A 3GP1A 1XWIA 2D7GA 3GRRA 2UXBM 4LGMA 2E5LM
chains in the Genus database with same CATH topology
2YR0A 3J2PB 3U6PA 1R2YA 4JI6M 4OU7A 2C9CA 4L8RC 3H4MA 2K47A 3J7BA 5KQ8A 3T1HM 5FTMA 5ITTA 2V1UA 3PNYA 4YY3M 1G3IA 2QCUA 4IBJA 3THGA 1GL6A 4MB7A 2L7IA 5EP4A 5BR8M 4R7GA 4CHTB 2KRKA 4JN6A 3GLFB 2EUCA 4LF8M 1DGHA 3HHWA 3VLFB 3U60B 1NJFA 2X8AA 3AOEA 4PT5A 2UXDM 4QHSA 4YHHM 3JAMS 1EE8A 2ZAMA 4GIPA 5GKNA 1XNQM 3KOYE 1IN6A 2M5ZA 1G59A 3LVWA 4Z8XA 2QPAA 7CATA 3KOXE 4FCWA 4KHPM 3OTOM 2CUZA 1IN8A 2HCBA 2AHMA 2ZBKB 5KQDA 1PJIA 4IBBA 1ZAEA 3ZH9B 3U6EA 1K3XA 4LF5M 4AKGA 3HJSA 4FCVA 3U60A 4BLCA 3HKPA 4EIWA 2QZ4A 1NJGA 4LJAA 2R45A 5ITYA 3U6LA 2JA2A 1L8QA 4HL4A 4B7FA 4P16A 4AKHA 2DWNA 1N33M 3GLGA 2R65A 4HLQA 3HJQA 4JI3M 1HNWM 4DR5M 2QP9X 3GRYA 4I4LA 2V6ZM 1IY0A 4FWGA 3D8LA 2CV0A 4REZA 3HHYA 5IZ7D 3FTEA 4ITQA 3CTWB 3EIHA 3L2AA 2UUCM 4DR3M 3U6OA 1SXJB 4LJ4A 5EP1A 1PJJA 5JI3E 1OFIA 4WW0A 5ITRA 5IREB 3U6DA 4B3TM 3A98B 4DR4M 4G4OA 2CEAA 3AFHA 2CFOA 4DV6M 4G4QA 1DGHB 1J7KA 2EO2A 4DV5M 4GHLA 2Q2EB 1JR3D 3LMMA 1XHBA 1C1KA 3VK8A 1KYIA 1FNNA 4LZJA 4MGHA 5EXXA 1G4AE 1GKIA 4NSRA 4OW0A 3TQSA 3R8FA 2QBYA 4OVZA 4LFBM 3GLIB 4IIWA 4PD2A 5KPRA 1IN7A 3VDUA 3UJNA 4W5WA 1NNJA 1NNUC 3L28A 3FTDA 1Q3BA 5E6JA 1L2DA 2CHVA 2FE8A 2F5NA 3L27A 3U6SA 4NSOB 2OPFA 2QENA 3AOEC 3M7GA 4FWDA 1NSFA 2C9OA 4KLNA 3RGSA 2C5RA 4B3SM 5EXTA 2F5PA 1DO2A 4G4NA 1XXHB 4M0DA 5JI2E 1TGUA 3FTCA 1HQYE 1IBLM 5ITQA 1DGFA 3KFUG 3IG5A 1HT2E 1L1TA 2DWLA 4D80A 3A46A 1N36M 4CISA 3FD9A 3K2LA 4DUYM 4BBAA 1IBMM 2LWXA 3J7AS 3TWKA 4M9ZA 1MX0A 4GH9A 1QAOA 3SHGB 3RFWA 5EP2A 2V1CA 5DYGA 3A45A 2R46A 4LGYA 4IBFA 4B7HA 4AG6A 3FYCA 2CHGA 2UUAM 4Z6YA 2XH9A 5EQTA 3MJ5A 1XMQM 2DZOB 3UZUA 2XGNA 2RGHA 4DR1M 4GHAA 1IQPA 2Z4RA 3IG8A 5DYIA 3A42A 1XMOM 1K82A 3MHVC 4MH0E 4MGIE 3UGJA 5KPTA 1JQJC 1N32M 2OQ4A 2QBYB 2XF3A 4JI2M 3KS8A 4GMQA 4DR6M 3J80S 2KXEA 4GKJM 3T38A 3ZCBB 4IBKA 4CGYB 4TUWA 4G4RA 1NVMA 3DFZA 1SXJC 1E32A 3GPUA 2KA6B 4L15A 4LRTA 1IXRC 3JR4A 4JI4M 3Q8XA 2F5OA 4IBCA 1KSFX 2F5QA 4LZZA 4FWHA 3KXEC 4D82A 5ITXE 4AI6A 4AKIA 1HT1E 4X66M 1PM5A 3NBIA 3LVVA 1SXJD 2YFQA 3PFIA 2YNMD 3KP0E 3GPYA 4X64M 2X4AA 4LY6A 3W0LB 3ILKA 4GRIA 3WHLA 5IT9S 2VIIA 3UK6A 4KODA 3D8BA 4M9XA 5KO3A 5LMUM 2DWMA 3KSXA 5EP3A 2UUBM 4LJ7A 3AJIB 4LF9M 3CF6E 2FFJA 1IM2A 1Q3CA 2X49A 3CF0A 1IBKM 4JI5M 1GL7A 1Z5AA 4GC5A 4R3DA 2CHQA 3KDSE 3PVSA 4NXNM 4IJFA 3SMPA 4JV5M 1WXQA 1W5TA 4IBDA 1TDZA 4LF6M 1NY5A 1TH2A 1ZQ9A 3TPZA 3UMMA 1I94M 2Z7JA 3SARA 4AG5A 4LF4M 2ZM6M 4AQYM 3J27B 1IXSB 4PCZA 1J5EM 2C98A 1GLNA 5EXSA 3GRUA 3TL4X 4NL4H 3AOGA 3QWLA 1UM8A 4II7A 2KRUA 4M0WA 3U6QA 4NXMM 1Q39A 3KS4A 3U61B 2D7HA 4OVZB 5IWAM 3GLIA 5C1BA 4GKKM 3L29A 3K92A 5FTLA 3SFZA 3RGPA 4DV1M 2KEBA 2XFTA 1IY1A 2XEPA 3KW6A 3T1YM 4MGYE 5ITUA 4JI1M 4I81A 5EJCA 3PXGA 3GQ4A 2ZAOA 4LJ8A 4DV0M 5F3WA 3GQ5A 1K3WA 1HR0M 2M60A 3SATA 3C58A 4LCBA 1TH4A 2RGOA 3I4YA 1S3SA 1IN5A 2H1RA 1G41A 2L7HA 3SYKA 3VFDA 2Z4SA 2Y0TA 4QNMA 5LMNM 3U61A 3AL0C 4LJ9A 1DO0A 4DV4M 2O5RA 2G5GX 1XNRM 2G8LA 2DXIA 4L4UA 4L78A 2HHHM 2R18A 4G6ZA 3FKEA 3WHKA 4OX9M 2VQFM 3E4RA 3JR5A 4B3MM 4WURA 3RE8A 3BOSA 3I51A 4QHTA 4RNAA 4XGIA 2ERCA 2I7NA 2XSZD 4I5SA 3GLGB 1SXJE 3HJ8A 4RF1A 2LXEA 2L6OA 1FJGM 1N78A 1R6BX 1X37A 2XFSA 4LRSA 2I7PA 3U5ZB 3SC3A 4IBIA 3SMSA 2W82A 3J81S 3HU3A 1DGGA 3SAWA 4M9SA 3KVWA 2UXCM 5C18A 1D2NA 4JXJA 4LJ6A 3GLHB 2RKOA 3DZDA 4D81A 3CF2A 1QQWA 4FVMA 3SYLA 5A2QS 4AW4A 1ORYB 5KPZA 3EIEA 3TWMA 1QAMA 2R4EA 3TWLA 3QAUA 3NWLA 2R4JA 5FTKA 1QVRA 4ZPXA 4JI8M 1H6UA 1GVNA 1TH3A 3M0EA 3U5ZA 2FNAA 2LNHC 2CE7A 3E9SA 3FUUA 4B3RM 3SAVA 3HU1A 1LV7A 3DOAA 4LFAM 3U6CA 4K0KM 3GLFA 1NHGC 4LG2A 2J7NA 3L26A 1XC8A 4IBGA 4JI7M 1R7RA 2HL7A 4DR7M 1XXHA 3FUVA 4GITA 3I4VA 1YE9A 1HNZM 5H37D 1J09A 2DZNB 1NY6A 2Y0QA 3LQQA 4QOSA 4DV7M 4LF7M 3R9XB 2FOIC 3HWSA 1Z59A 3W0FA 1L1ZA 2YQZA 4DR2M 4GC9A 4FD2A 2F4VM 3PNVA 4JI0M 3K1JA 1N77A 4QNRA 1OJLA 2R62A 5BPVA 4I8OA 3GPXA 4A3VB 3ZC7B 1HQCA 3B9PA 3L25A 1W5SA 4X65M 4JYAM 1HNXM 3HGIA 3GQ3A 3KOZE 4FW9A 3VKHA 1IN4A 3FTFA 3SBJA 2KZUA 5ITXA 1TDHA 4XBOA 2A5YB 2KZSA 2XZUA 2XLJA 3VKGA 1SXJA 2D7EA 3FUWA 5EXPA 3KSJA 3M6AA 5DNYA 1R2ZA 2HKJA 3GRVA 4B08A 2BJVA 2L09A 2LH0A 4S12A 5FTNA 3FYDA 1L2BA 2Z3XA 3SAUA 4AZFA 2KW0A 1YSYA 8CATA 1Z5BA 4BB9A 3U6MA 3HHXA 1L2CA 1I4WA 1MU5A 3DA1A 3TE6A 3KOWE 4MGKE 4DUZM 2XSZA 3K8ZA 4LFCM 2NQ8C 4PDIA 1N75A 3LQRA 1OFHA 4MGZE 5FLXS 1Z6TA 3FUTA 2J7OA 2P5TA 1Z5CA 3SHFA 4QOZC 4DV3M 1T3TA 3AKZA 2DVWB 4L16A 2XZFA 3GPPA 2DHRA 4FCTA 1JR3A 1NHWC 2Y21A 4KO8A 4NRVA 3AV0A 3GO8A 1YUBA 1VDDA 3SASA 3HHZA 4DV2M 2CV2A 4NRWA 5FTJA 1QANA 1IXZA 2UU9M 3MK6A 3T15A 5FSWA 3HU2A 4MM3B 2F5SA 1G8PA 1E9RA 2BNKA 3VK7A 3VDPA 1E9SA 2BJWA 4IJEA 4PDGA 1QZMA 3FUXA 1QAQA 2CV1A 1IY2A 4IBEA 2DWZB 1QYRA 4RF0A 5E26A 4X62M 1E94E 3KP1E 4NOOB 1N34M 2ZANA 4LJ5A 2Y20A 1KFVA 2EA0A 3GLHA 1DGBA 2C99A 4B7GA 2VQEM 2C96A 3GP1A 1XWIA 2D7GA 3GRRA 2UXBM 4LGMA 2E5LM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXH B;  5JI2 E;  1UM8 A;  1HQY E;  2DZN B;  1NY6 A;  2C9C A;  1HT2 E;  4D80 A;  3H4M A;  4QOS A;  5FTM A;  2V1U A;  3U61 B;  3HWS A;  1G3I A;  3GLI A;  5C1B A;  5FTL A;  4FD2 A;  5EP4 A;  3K1J A;  5EP2 A;  1IY1 A;  5DYG A;  2KRK A;  4JN6 A;  3KW6 A;  4QNR A;  3GLF B;  1OJL A;  2R62 A;  4I81 A;  3PXG A;  3VLF B;  3U60 B;  1NJF A;  2ZAO A;  2CHG A;  2X8A A;  4LJ8 A;  4A3V B;  1HQC A;  3B9P A;  5EQT A;  1W5S A;  2DZO B;  4QHS A;  4LCB A;  2ZAM A;  1S3S A;  1IN5 A;  1G41 A;  3SYK A;  3VFD A;  1IQP A;  2Z4S A;  2Z4R A;  4FW9 A;  1IN4 A;  1IN6 A;  5DYI A;  3MHV C;  4QNM A;  4Z8X A;  2QPA A;  1JQJ C;  4LJ9 A;  1DO0 A;  4FCW A;  2QBY B;  1IN8 A;  1SXJ A;  2HCB A;  5EXP A;  4L4U A;  3M6A A;  3ZH9 B;  4FCV A;  3WHK A;  1NVM A;  4EIW A;  2QZ4 A;  2BJV A;  5FTN A;  1SXJ C;  1E32 A;  1NJG A;  4LJA A;  3BOS A;  4L15 A;  1L8Q A;  4LRT A;  4QHT A;  3GLG B;  2XSZ D;  1IXR C;  1SXJ E;  3GLG A;  1KSF X;  2R65 A;  2XSZ A;  2QP9 X;  4I4L A;  1OFH A;  2V6Z M;  1IY0 A;  1R6B X;  4FWH A;  4FWG A;  4LZZ A;  1X37 A;  4D82 A;  4LRS A;  1HT1 E;  3U5Z B;  3SC3 A;  4LGM A;  3EIH A;  3HU3 A;  1SXJ D;  3PFI A;  2DVW B;  4L16 A;  1SXJ B;  4LJ4 A;  2DHR A;  4FCT A;  1JR3 A;  5EP1 A;  4KO8 A;  5JI3 E;  1OFI A;  5C18 A;  1D2N A;  4LY6 A;  4LJ6 A;  3GLH B;  2RKO A;  3DZD A;  4WW0 A;  3CF2 A;  4D81 A;  3WHL A;  3SYL A;  2VII A;  3UK6 A;  2CEA A;  4KOD A;  3D8B A;  3EIE A;  5FTJ A;  1J7K A;  1IXZ A;  5FTK A;  5EP3 A;  3HU2 A;  1QVR A;  4ZPX A;  1JR3 D;  3AJI B;  4LJ7 A;  1C1K A;  1KYI A;  1IM2 A;  1FNN A;  3CF0 A;  5EXX A;  1G4A E;  2BJW A;  3M0E A;  3R8F A;  2QBY A;  2FNA A;  2CE7 A;  1QZM A;  3GLI B;  1IN7 A;  1IY2 A;  3HU1 A;  1LV7 A;  2CHQ A;  2DWZ B;  3KDS E;  3PVS A;  1E94 E;  1W5T A;  3GLF A;  1NY5 A;  2CHV A;  2ZAN A;  4LJ5 A;  2QEN A;  4FWD A;  3GLH A;  1NSF A;  1IXS B;  2C9O A;  1R7R A;  2C99 A;  2C96 A;  1XXH A;  2C98 A;  1XWI A;  4GIT A;  4KLN A;  5EXT A;  1DO2 A;  5EXS A; 
#chains in the Genus database with same CATH topology
 2YR0 A;  3J2P B;  3U6P A;  1R2Y A;  4JI6 M;  1EIJ A;  4OU7 A;  2C9C A;  4L8R C;  3H4M A;  2MRO B;  2K47 A;  3J7B A;  5KQ8 A;  3T1H M;  5FTM A;  5ITT A;  2V1U A;  3PNY A;  4YY3 M;  1G3I A;  3C3E A;  2QCU A;  4IBJ A;  2EKF A;  3THG A;  1GL6 A;  4MB7 A;  3E21 A;  1AIP C;  2L7I A;  2OOB A;  2OOA A;  5EP4 A;  5BR8 M;  4R7G A;  1WGL A;  4CHT B;  2KRK A;  4JN6 A;  2CRU A;  3GLF B;  3I01 M;  2EUC A;  2WZJ A;  3LCU A;  4LF8 M;  1DGH A;  3GLH E;  1G71 A;  3HHW A;  1NJF A;  3VLF B;  2X8A A;  3U60 B;  3AOE A;  2J5Y A;  2DAG A;  4PT5 A;  2UXD M;  4QHS A;  4YHH M;  2EJS A;  2RRU A;  3JAM S;  1EE8 A;  2ZAM A;  4GIP A;  1CUK A;  4Q7J A;  2K9D A;  5GKN A;  1XNQ M;  2LHC A;  3KOY E;  1IN6 A;  1VEJ A;  2KHH A;  2M5Z A;  1G59 A;  2FS1 A;  3LVW A;  4Z8X A;  2QPA A;  7CAT A;  3KOX E;  4FCW A;  1OIZ A;  4KHP M;  3OTO M;  2CUZ A;  1IN8 A;  1WR1 B;  2HCB A;  2AHM A;  2VF8 A;  2ZBK B;  5KQD A;  1PJI A;  2L2D A;  1ZAE A;  4IBB A;  3ZH9 B;  3U6E A;  1K3X A;  4LF5 M;  4AKG A;  3BXW A;  3HJS A;  1XB2 B;  2G3Q A;  4FCV A;  3U60 A;  4BLC A;  3HKP A;  4EIW A;  2QZ4 A;  1OIP A;  2H5X A;  1NJG A;  4LJA A;  2R45 A;  5ITY A;  3U6L A;  2JA2 A;  1L8Q A;  1OAO C;  4HL4 A;  4B7F A;  2JWS A;  4P16 A;  4AKH A;  2DWN A;  1N33 M;  2CWB A;  3GLG A;  1RU3 A;  2R65 A;  4HLQ A;  3Q8G A;  3HJQ A;  4JI3 M;  1HNW M;  4DR5 M;  2K6B A;  2QP9 X;  3GRY A;  4I4L A;  2V6Z M;  1IY0 A;  4FWG A;  1R5L A;  3D8L A;  2CV0 A;  4REZ A;  1Y8G A;  3HHY A;  5IZ7 D;  3FTE A;  4ITQ A;  3CTW B;  2ZTD A;  3EIH A;  3L2A A;  2UUC M;  4DR3 M;  3U6O A;  1SXJ B;  4LJ4 A;  2HWJ A;  5EP1 A;  1PJJ A;  5JI3 E;  1OFI A;  2N35 A;  1WGN A;  2VF7 A;  4WW0 A;  5ITR A;  5IRE B;  3U6D A;  4B3T M;  3A98 B;  4DR4 M;  4G4O A;  2CEA A;  2JY8 A;  3AFH A;  2CFO A;  4DV6 M;  2L4F A;  1DGH B;  4G4Q A;  1J7K A;  2EO2 A;  4DV5 M;  4GHL A;  2R6F A;  2APL A;  3GLG E;  2Q2E B;  1JR3 D;  3LMM A;  2O01 F;  1XHB A;  1C1K A;  3VK8 A;  1KYI A;  1FNN A;  2WSE F;  4LZJ A;  4MGH A;  5EXX A;  1G4A E;  1GKI A;  4NSR A;  4OW0 A;  3TQS A;  3R8F A;  2QBY A;  4OVZ A;  4LFB M;  3GLI B;  4IIW A;  4PD2 A;  5KPR A;  4P17 A;  1IN7 A;  3VDU A;  3UJN A;  4W5W A;  1NNJ A;  1NNU C;  3L28 A;  3FTD A;  1Q3B A;  5E6J A;  1PJS A;  1L2D A;  4ANR A;  1MN3 A;  2CHV A;  2FE8 A;  2F5N A;  3L27 A;  3U6S A;  4NSO B;  2OPF A;  2QEN A;  1V34 A;  3AOE C;  3M7G A;  4FWD A;  1NSF A;  2C9O A;  4KLN A;  1ZMW A;  3RGS A;  2C5R A;  4B3S M;  1HJP A;  5EXT A;  2F5P A;  1DO2 A;  4G4N A;  1XXH B;  1NV8 A;  4M0D A;  5JI2 E;  1TGU A;  3FTC A;  2DAK A;  1HQY E;  2DNA A;  5ITQ A;  1IBL M;  1DGF A;  3KFU G;  3IG5 A;  1HT2 E;  2B3T A;  1L1T A;  4D80 A;  3A46 A;  1N36 M;  2DWL A;  4CIS A;  3FD9 A;  3K2L A;  4DUY M;  4BBA A;  1ZMV A;  1Q02 A;  1IBM M;  2LWX A;  3MMP A;  3J7A S;  2DEN A;  2DI0 A;  3TWK A;  4M9Z A;  1MX0 A;  4GH9 A;  1PRB A;  1QAO A;  3SHG B;  3RFW A;  5EP2 A;  2V1C A;  5DYG A;  3A45 A;  2R46 A;  3FRH A;  4LGY A;  4IBF A;  4B7H A;  4AG6 A;  3FYC A;  2CHG A;  2UUA M;  4Z6Y A;  2XH9 A;  5EQT A;  3MJ5 A;  1XMQ M;  2DAE A;  2DZO B;  3UZU A;  2XGN A;  2L4E A;  1PJQ A;  2RGH A;  4DR1 M;  4GHA A;  1IQP A;  2DZL A;  2Z4R A;  1OKS A;  3IG8 A;  5DYI A;  3W68 A;  3A42 A;  1XMO M;  1K82 A;  3MHV C;  4MH0 E;  2KNA A;  4MGI E;  3UGJ A;  5KPT A;  1JQJ C;  2FH0 A;  1N32 M;  3IEC A;  4CIZ A;  2XF3 A;  2OQ4 A;  2QBY B;  2BWB A;  4JI2 M;  3KS8 A;  4GMQ A;  3QYE A;  4DR6 M;  3J80 S;  2KXE A;  4GKJ M;  3T38 A;  3ZCB B;  4IBK A;  4CGY B;  4TUW A;  4G4R A;  1NVM A;  3DFZ A;  4R71 A;  3V76 A;  1SXJ C;  1E32 A;  3GPU A;  2KA6 B;  4L15 A;  4LRT A;  1IXR C;  3JR4 A;  4JI4 M;  3Q8X A;  2F5O A;  4IBC A;  1VEG A;  1KSF X;  3NBX X;  2F5Q A;  1AUA A;  4LZZ A;  4FWH A;  3KXE C;  4D82 A;  5ITX E;  4AI6 A;  4AKI A;  2R44 A;  1HT1 E;  4X66 M;  1PM5 A;  3NBI A;  3LVV A;  1SXJ D;  2YFQ A;  3PFI A;  4UN2 B;  2YNM D;  3KP0 E;  3GPY A;  4X64 M;  1VDL A;  2X4A A;  2LVO C;  4LY6 A;  3W0L B;  3ILK A;  4F1I A;  4GRI A;  3WHL A;  5IT9 S;  2VII A;  1JB0 F;  1PJT A;  3UK6 A;  2KNV A;  4KOD A;  3D8B A;  4M9X A;  5KO3 A;  5LMU M;  2LBC A;  3KSX A;  5EP3 A;  4DBG B;  2DWM A;  2UUB M;  4LJ7 A;  3AJI B;  4LF9 M;  3CF6 E;  2FFJ A;  1IM2 A;  1Q3C A;  2X49 A;  3CF0 A;  1GAB A;  3H4J A;  2JNH A;  1IBK M;  4JI5 M;  1GL7 A;  1Z5A A;  4GC5 A;  4R3D A;  2CHQ A;  1OTR A;  3KDS E;  3PVS A;  3B89 A;  4NXN M;  4IJF A;  2JY6 B;  3SMP A;  4JV5 M;  1WXQ A;  1W5T A;  4IBD A;  1TDZ A;  4LF6 M;  1NY5 A;  1TH2 A;  1ZQ9 A;  3TPZ A;  3UMM A;  1I94 M;  2Z7J A;  3SAR A;  4AG5 A;  2QSF X;  4LF4 M;  2ZM6 M;  1C7Y A;  4AQY M;  3J27 B;  1IXS B;  4PCZ A;  1J5E M;  3ZQJ A;  2C98 A;  1GLN A;  3K9O A;  5EXS A;  2O25 A;  3GRU A;  3TL4 X;  4NL4 H;  3AOG A;  3QWL A;  1UM8 A;  4II7 A;  2KRU A;  4M0W A;  3GLI E;  3U6Q A;  4NXM M;  2QNJ A;  1Q39 A;  1ZMU A;  3KS4 A;  2JP7 A;  2QQ8 A;  3U61 B;  2D7H A;  1D0K A;  4OVZ B;  5IWA M;  3GLI A;  5C1B A;  4GKK M;  3L29 A;  1XXH E;  1D0L A;  3K92 A;  5FTL A;  4L6V 6;  2LVP C;  2JUJ A;  1YLA A;  3RGP A;  3SFZ A;  3K9P A;  2KEB A;  2XFT A;  1IY1 A;  2XEP A;  4DV1 M;  3KW6 A;  3T1Y M;  4MGY E;  1D0M A;  5ITU A;  4JI1 M;  4I81 A;  2QHO B;  5EJC A;  3PXG A;  3GQ4 A;  1NV9 A;  2ZAO A;  4LJ8 A;  4DV0 M;  5F3W A;  3GQ5 A;  1K3W A;  2ZTC A;  1HR0 M;  2M60 A;  3SAT A;  2KNZ A;  3C58 A;  3IHP A;  4LCB A;  1TH4 A;  2RGO A;  3I4Y A;  1S3S A;  1IN5 A;  2H1R A;  1G41 A;  2L7H A;  1WJ7 A;  3SYK A;  1WIV A;  3VFD A;  2Z4S A;  2Y0T A;  2MGW A;  4G3O A;  4QNM A;  5LMN M;  3U61 A;  2DAI A;  3AL0 C;  2DKL A;  4LJ9 A;  1DO0 A;  4DV4 M;  2O5R A;  2G5G X;  2EKK A;  2G8L A;  2GQF A;  1XNR M;  1QUT A;  2DXI A;  3HX3 A;  4L4U A;  4L78 A;  2HHH M;  2GNO A;  2R18 A;  4G6Z A;  3FKE A;  3WHK A;  4OX9 M;  2VQF M;  3E4R A;  3JR5 A;  4B3M M;  4WUR A;  3RE8 A;  3BOS A;  3I51 A;  1DV0 A;  2JZ0 A;  4QHT A;  4RNA A;  4XGI A;  2JXN A;  2ERC A;  2I7N A;  2XSZ D;  4I5S A;  3GLG B;  2Z8Y M;  1GJS A;  1IXS A;  1SXJ E;  3HJ8 A;  4RF1 A;  2LXE A;  2L6O A;  1T43 A;  1FJG M;  3LCV B;  1N78 A;  1R6B X;  1X37 A;  2XFS A;  4LRS A;  2I7P A;  1SG9 A;  3U5Z B;  3SC3 A;  4IBI A;  2DAM A;  3SMS A;  2W82 A;  3J81 S;  3HU3 A;  1DGG A;  3SAW A;  4M9S A;  1P3Q Q;  3KVW A;  2UXC M;  5L8R F;  5C18 A;  3HY5 A;  1D2N A;  4JXJ A;  4LJ6 A;  3GLH B;  2RKO A;  3DZD A;  4D81 A;  2CP8 A;  3CF2 A;  1QQW A;  4FVM A;  3SYL A;  5A2Q S;  4AW4 A;  1ORY B;  2JY5 A;  2MR9 A;  5KPZ A;  1LTM A;  3EIE A;  1QAM A;  3TWM A;  2R4E A;  3TWL A;  3QAU A;  1TTE A;  3NWL A;  2R4J A;  5FTK A;  1QVR A;  4ZPX A;  4JI8 M;  1H6U A;  1GVN A;  1TH3 A;  3M0E A;  3U5Z A;  2FNA A;  2LNH C;  2CE7 A;  3E9S A;  3FE3 A;  3FUU A;  3LW5 F;  1MJG M;  4B3R M;  3SAV A;  3HU1 A;  1LV7 A;  3DOA A;  3E46 A;  4LFA M;  3U6C A;  4K0K M;  2KDL A;  1NHG C;  1VEK A;  2J7N A;  1EFU B;  3GLF A;  3L26 A;  4LG2 A;  1XC8 A;  2LVA A;  4F2L A;  3GLF E;  4IBG A;  4JI7 M;  1R7R A;  2HL7 A;  4DR7 M;  1XXH A;  3FUV A;  4GIT A;  3I4V A;  1YE9 A;  1QUS A;  3T6P A;  3F92 A;  1HNZ M;  1R4G A;  5H37 D;  1J09 A;  2DZN B;  1NY6 A;  3C3D A;  2MJ5 B;  1TF0 B;  2Y0Q A;  3BBZ A;  3LQQ A;  4QOS A;  4RKU F;  1WHC A;  4DV7 M;  2FOI C;  4LF7 M;  1UFZ A;  3R9X B;  4GEW A;  3HWS A;  1Z59 A;  3W0F A;  1L1Z A;  2JY7 A;  2OO9 A;  2YQZ A;  4DR2 M;  4GC9 A;  4FD2 A;  2F4V M;  3PNV A;  4JI0 M;  3K1J A;  1N77 A;  4QNR A;  1TR8 A;  2HAK A;  2R0I A;  1OJL A;  1ZV1 A;  2R62 A;  5BPV A;  4I8O A;  3GPX A;  4A3V B;  3CGW A;  3ZC7 B;  1HQC A;  3B9P A;  3L25 A;  2LVN C;  1W5S A;  4X65 M;  4JYA M;  1HNX M;  3HGI A;  3GQ3 A;  3KOZ E;  4FW9 A;  3VKH A;  1IN4 A;  4XK8 F;  3FTF A;  3SBJ A;  1QZE A;  2KZU A;  1V92 A;  5ITX A;  1TDH A;  4XBO A;  2A5Y B;  2KZS A;  4CJ6 A;  2XLJ A;  2XZU A;  1SXJ A;  2D7E A;  3VKG A;  3FUW A;  5EXP A;  3HZJ A;  3KSJ A;  3M6A A;  5DNY A;  1GO5 A;  1R2Z A;  1A5T A;  4HEO A;  2HKJ A;  3GRV A;  4B08 A;  2BJV A;  2L09 A;  2LH0 A;  2LTU A;  4S12 A;  5FTN A;  3FYD A;  1L2B A;  2Z3X A;  3SAU A;  4AZF A;  2KW0 A;  1YSY A;  8CAT A;  1Z5B A;  3I04 M;  4BB9 A;  3U6M A;  2LVQ D;  3HHX A;  1QDR A;  1L2C A;  1I4W A;  1QDT A;  1MU5 A;  3DA1 A;  2BWE A;  3TE6 A;  3KOW E;  4MGK E;  4DUZ M;  2XSZ A;  3K8Z A;  4LFC M;  2NQ8 C;  4PDI A;  1N75 A;  1OFH A;  3LQR A;  3QYB A;  4MGZ E;  1Z6T A;  3FUT A;  5FLX S;  2J7O A;  2P5T A;  1Z5C A;  3SHF A;  4QOZ C;  4DV3 M;  1VG5 A;  1T3T A;  3AKZ A;  2DVW B;  4L16 A;  2XZF A;  3GPP A;  1NO1 A;  2DHR A;  4FCT A;  1JR3 A;  1NHW C;  1T6O A;  2Y21 A;  4KO8 A;  1PGY A;  5DFL A;  4NRV A;  3AV0 A;  3B74 A;  3B7N A;  3GO8 A;  4NC6 A;  1YUB A;  1F4I A;  1VDD A;  3SAS A;  3HHZ A;  4DV2 M;  2CV2 A;  1BVS A;  4NRW A;  2WSC F;  4KT0 F;  5FTJ A;  3W67 A;  1IXZ A;  1QAN A;  2UU9 M;  3MK6 A;  3T15 A;  5FSW A;  3HU2 A;  4MM3 B;  1VQ1 A;  2F5S A;  1G8P A;  1OAI A;  1E9R A;  1GJT A;  2BNK A;  1OQY A;  3VDP A;  3VK7 A;  1E9S A;  3B7Q A;  2BJW A;  3C9P A;  4IJE A;  4PDG A;  2DHY A;  1QZM A;  2K0B X;  3FUX A;  2MH8 A;  2JZ1 A;  1QAQ A;  2CV1 A;  3FRI A;  1IY2 A;  4IBE A;  2DWZ B;  1QYR A;  4RF0 A;  5E26 A;  1IFY A;  4X62 M;  1JR3 E;  4WP2 A;  1E94 E;  4Y28 F;  2LHG A;  3KP1 E;  4NOO B;  1V33 A;  1N34 M;  2ZAN A;  4LJ5 A;  2Y20 A;  3B7Z A;  1KFV A;  2EA0 A;  3GLH A;  2WSF F;  2VDB B;  1DGB A;  2C99 A;  4B7G A;  2VQE M;  2C96 A;  3GP1 A;  1XWI A;  2D7G A;  3GRR A;  2UXB M;  4LGM A;  2E5L M; 
#chains in the Genus database with same CATH homology
 2YR0 A;  3J2P B;  3U6P A;  1R2Y A;  4JI6 M;  4OU7 A;  2C9C A;  4L8R C;  3H4M A;  2K47 A;  3J7B A;  5KQ8 A;  3T1H M;  5FTM A;  5ITT A;  2V1U A;  3PNY A;  4YY3 M;  1G3I A;  2QCU A;  4IBJ A;  3THG A;  1GL6 A;  4MB7 A;  2L7I A;  5EP4 A;  5BR8 M;  4R7G A;  4CHT B;  2KRK A;  4JN6 A;  3GLF B;  2EUC A;  4LF8 M;  1DGH A;  3HHW A;  3VLF B;  3U60 B;  1NJF A;  2X8A A;  3AOE A;  4PT5 A;  2UXD M;  4QHS A;  4YHH M;  3JAM S;  1EE8 A;  2ZAM A;  4GIP A;  5GKN A;  1XNQ M;  3KOY E;  1IN6 A;  2M5Z A;  1G59 A;  3LVW A;  4Z8X A;  2QPA A;  7CAT A;  3KOX E;  4FCW A;  4KHP M;  3OTO M;  2CUZ A;  1IN8 A;  2HCB A;  2AHM A;  2ZBK B;  5KQD A;  1PJI A;  4IBB A;  1ZAE A;  3ZH9 B;  3U6E A;  1K3X A;  4LF5 M;  4AKG A;  3HJS A;  4FCV A;  3U60 A;  4BLC A;  3HKP A;  4EIW A;  2QZ4 A;  1NJG A;  4LJA A;  2R45 A;  5ITY A;  3U6L A;  2JA2 A;  1L8Q A;  4HL4 A;  4B7F A;  4P16 A;  4AKH A;  2DWN A;  1N33 M;  3GLG A;  2R65 A;  4HLQ A;  3HJQ A;  4JI3 M;  1HNW M;  4DR5 M;  2QP9 X;  3GRY A;  4I4L A;  2V6Z M;  1IY0 A;  4FWG A;  3D8L A;  2CV0 A;  4REZ A;  3HHY A;  5IZ7 D;  3FTE A;  4ITQ A;  3CTW B;  3EIH A;  3L2A A;  2UUC M;  4DR3 M;  3U6O A;  1SXJ B;  4LJ4 A;  5EP1 A;  1PJJ A;  5JI3 E;  1OFI A;  4WW0 A;  5ITR A;  5IRE B;  3U6D A;  4B3T M;  3A98 B;  4DR4 M;  4G4O A;  2CEA A;  3AFH A;  2CFO A;  4DV6 M;  4G4Q A;  1DGH B;  1J7K A;  2EO2 A;  4DV5 M;  4GHL A;  2Q2E B;  1JR3 D;  3LMM A;  1XHB A;  1C1K A;  3VK8 A;  1KYI A;  1FNN A;  4LZJ A;  4MGH A;  5EXX A;  1G4A E;  1GKI A;  4NSR A;  4OW0 A;  3TQS A;  3R8F A;  2QBY A;  4OVZ A;  4LFB M;  3GLI B;  4IIW A;  4PD2 A;  5KPR A;  1IN7 A;  3VDU A;  3UJN A;  4W5W A;  1NNJ A;  1NNU C;  3L28 A;  3FTD A;  1Q3B A;  5E6J A;  1L2D A;  2CHV A;  2FE8 A;  2F5N A;  3L27 A;  3U6S A;  4NSO B;  2OPF A;  2QEN A;  3AOE C;  3M7G A;  4FWD A;  1NSF A;  2C9O A;  4KLN A;  3RGS A;  2C5R A;  4B3S M;  5EXT A;  2F5P A;  1DO2 A;  4G4N A;  1XXH B;  4M0D A;  5JI2 E;  1TGU A;  3FTC A;  1HQY E;  1IBL M;  5ITQ A;  1DGF A;  3KFU G;  3IG5 A;  1HT2 E;  1L1T A;  2DWL A;  4D80 A;  3A46 A;  1N36 M;  4CIS A;  3FD9 A;  3K2L A;  4DUY M;  4BBA A;  1IBM M;  2LWX A;  3J7A S;  3TWK A;  4M9Z A;  1MX0 A;  4GH9 A;  1QAO A;  3SHG B;  3RFW A;  5EP2 A;  2V1C A;  5DYG A;  3A45 A;  2R46 A;  4LGY A;  4IBF A;  4B7H A;  4AG6 A;  3FYC A;  2CHG A;  2UUA M;  4Z6Y A;  2XH9 A;  5EQT A;  3MJ5 A;  1XMQ M;  2DZO B;  3UZU A;  2XGN A;  2RGH A;  4DR1 M;  4GHA A;  1IQP A;  2Z4R A;  3IG8 A;  5DYI A;  3A42 A;  1XMO M;  1K82 A;  3MHV C;  4MH0 E;  4MGI E;  3UGJ A;  5KPT A;  1JQJ C;  1N32 M;  2OQ4 A;  2QBY B;  2XF3 A;  4JI2 M;  3KS8 A;  4GMQ A;  4DR6 M;  3J80 S;  2KXE A;  4GKJ M;  3T38 A;  3ZCB B;  4IBK A;  4CGY B;  4TUW A;  4G4R A;  1NVM A;  3DFZ A;  1SXJ C;  1E32 A;  3GPU A;  2KA6 B;  4L15 A;  4LRT A;  1IXR C;  3JR4 A;  4JI4 M;  3Q8X A;  2F5O A;  4IBC A;  1KSF X;  2F5Q A;  4LZZ A;  4FWH A;  3KXE C;  4D82 A;  5ITX E;  4AI6 A;  4AKI A;  1HT1 E;  4X66 M;  1PM5 A;  3NBI A;  3LVV A;  1SXJ D;  2YFQ A;  3PFI A;  2YNM D;  3KP0 E;  3GPY A;  4X64 M;  2X4A A;  4LY6 A;  3W0L B;  3ILK A;  4GRI A;  3WHL A;  5IT9 S;  2VII A;  3UK6 A;  4KOD A;  3D8B A;  4M9X A;  5KO3 A;  5LMU M;  2DWM A;  3KSX A;  5EP3 A;  2UUB M;  4LJ7 A;  3AJI B;  4LF9 M;  3CF6 E;  2FFJ A;  1IM2 A;  1Q3C A;  2X49 A;  3CF0 A;  1IBK M;  4JI5 M;  1GL7 A;  1Z5A A;  4GC5 A;  4R3D A;  2CHQ A;  3KDS E;  3PVS A;  4NXN M;  4IJF A;  3SMP A;  4JV5 M;  1WXQ A;  1W5T A;  4IBD A;  1TDZ A;  4LF6 M;  1NY5 A;  1TH2 A;  1ZQ9 A;  3TPZ A;  3UMM A;  1I94 M;  2Z7J A;  3SAR A;  4AG5 A;  4LF4 M;  2ZM6 M;  4AQY M;  3J27 B;  1IXS B;  4PCZ A;  1J5E M;  2C98 A;  1GLN A;  5EXS A;  3GRU A;  3TL4 X;  4NL4 H;  3AOG A;  3QWL A;  1UM8 A;  4II7 A;  2KRU A;  4M0W A;  3U6Q A;  4NXM M;  1Q39 A;  3KS4 A;  3U61 B;  2D7H A;  4OVZ B;  5IWA M;  3GLI A;  5C1B A;  4GKK M;  3L29 A;  3K92 A;  5FTL A;  3SFZ A;  3RGP A;  4DV1 M;  2KEB A;  2XFT A;  1IY1 A;  2XEP A;  3KW6 A;  3T1Y M;  4MGY E;  5ITU A;  4JI1 M;  4I81 A;  5EJC A;  3PXG A;  3GQ4 A;  2ZAO A;  4LJ8 A;  4DV0 M;  5F3W A;  3GQ5 A;  1K3W A;  1HR0 M;  2M60 A;  3SAT A;  3C58 A;  4LCB A;  1TH4 A;  2RGO A;  3I4Y A;  1S3S A;  1IN5 A;  2H1R A;  1G41 A;  2L7H A;  3SYK A;  3VFD A;  2Z4S A;  2Y0T A;  4QNM A;  5LMN M;  3U61 A;  3AL0 C;  4LJ9 A;  1DO0 A;  4DV4 M;  2O5R A;  2G5G X;  1XNR M;  2G8L A;  2DXI A;  4L4U A;  4L78 A;  2HHH M;  2R18 A;  4G6Z A;  3FKE A;  3WHK A;  4OX9 M;  2VQF M;  3E4R A;  3JR5 A;  4B3M M;  4WUR A;  3RE8 A;  3BOS A;  3I51 A;  4QHT A;  4RNA A;  4XGI A;  2ERC A;  2I7N A;  2XSZ D;  4I5S A;  3GLG B;  1SXJ E;  3HJ8 A;  4RF1 A;  2LXE A;  2L6O A;  1FJG M;  1N78 A;  1R6B X;  1X37 A;  2XFS A;  4LRS A;  2I7P A;  3U5Z B;  3SC3 A;  4IBI A;  3SMS A;  2W82 A;  3J81 S;  3HU3 A;  1DGG A;  3SAW A;  4M9S A;  3KVW A;  2UXC M;  5C18 A;  1D2N A;  4JXJ A;  4LJ6 A;  3GLH B;  2RKO A;  3DZD A;  4D81 A;  3CF2 A;  1QQW A;  4FVM A;  3SYL A;  5A2Q S;  4AW4 A;  1ORY B;  5KPZ A;  3EIE A;  3TWM A;  1QAM A;  2R4E A;  3TWL A;  3QAU A;  3NWL A;  2R4J A;  5FTK A;  1QVR A;  4ZPX A;  4JI8 M;  1H6U A;  1GVN A;  1TH3 A;  3M0E A;  3U5Z A;  2FNA A;  2LNH C;  2CE7 A;  3E9S A;  3FUU A;  4B3R M;  3SAV A;  3HU1 A;  1LV7 A;  3DOA A;  4LFA M;  3U6C A;  4K0K M;  3GLF A;  1NHG C;  4LG2 A;  2J7N A;  3L26 A;  1XC8 A;  4IBG A;  4JI7 M;  1R7R A;  2HL7 A;  4DR7 M;  1XXH A;  3FUV A;  4GIT A;  3I4V A;  1YE9 A;  1HNZ M;  5H37 D;  1J09 A;  2DZN B;  1NY6 A;  2Y0Q A;  3LQQ A;  4QOS A;  4DV7 M;  4LF7 M;  3R9X B;  2FOI C;  3HWS A;  1Z59 A;  3W0F A;  1L1Z A;  2YQZ A;  4DR2 M;  4GC9 A;  4FD2 A;  2F4V M;  3PNV A;  4JI0 M;  3K1J A;  1N77 A;  4QNR A;  1OJL A;  2R62 A;  5BPV A;  4I8O A;  3GPX A;  4A3V B;  3ZC7 B;  1HQC A;  3B9P A;  3L25 A;  1W5S A;  4X65 M;  4JYA M;  1HNX M;  3HGI A;  3GQ3 A;  3KOZ E;  4FW9 A;  3VKH A;  1IN4 A;  3FTF A;  3SBJ A;  2KZU A;  5ITX A;  1TDH A;  4XBO A;  2A5Y B;  2KZS A;  2XZU A;  2XLJ A;  3VKG A;  1SXJ A;  2D7E A;  3FUW A;  5EXP A;  3KSJ A;  3M6A A;  5DNY A;  1R2Z A;  2HKJ A;  3GRV A;  4B08 A;  2BJV A;  2L09 A;  2LH0 A;  4S12 A;  5FTN A;  3FYD A;  1L2B A;  2Z3X A;  3SAU A;  4AZF A;  2KW0 A;  1YSY A;  8CAT A;  1Z5B A;  4BB9 A;  3U6M A;  3HHX A;  1L2C A;  1I4W A;  1MU5 A;  3DA1 A;  3TE6 A;  3KOW E;  4MGK E;  4DUZ M;  2XSZ A;  3K8Z A;  4LFC M;  2NQ8 C;  4PDI A;  1N75 A;  3LQR A;  1OFH A;  4MGZ E;  5FLX S;  1Z6T A;  3FUT A;  2J7O A;  2P5T A;  1Z5C A;  3SHF A;  4QOZ C;  4DV3 M;  1T3T A;  3AKZ A;  2DVW B;  4L16 A;  2XZF A;  3GPP A;  2DHR A;  4FCT A;  1JR3 A;  1NHW C;  2Y21 A;  4KO8 A;  4NRV A;  3AV0 A;  3GO8 A;  1YUB A;  1VDD A;  3SAS A;  3HHZ A;  4DV2 M;  2CV2 A;  4NRW A;  5FTJ A;  1QAN A;  1IXZ A;  2UU9 M;  3MK6 A;  3T15 A;  5FSW A;  3HU2 A;  4MM3 B;  2F5S A;  1G8P A;  1E9R A;  2BNK A;  3VK7 A;  3VDP A;  1E9S A;  2BJW A;  4IJE A;  4PDG A;  1QZM A;  3FUX A;  1QAQ A;  2CV1 A;  1IY2 A;  4IBE A;  2DWZ B;  1QYR A;  4RF0 A;  5E26 A;  4X62 M;  1E94 E;  3KP1 E;  4NOO B;  1N34 M;  2ZAN A;  4LJ5 A;  2Y20 A;  1KFV A;  2EA0 A;  3GLH A;  1DGB A;  2C99 A;  4B7G A;  2VQE M;  2C96 A;  3GP1 A;  1XWI A;  2D7G A;  3GRR A;  2UXB M;  4LGM A;  2E5L M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...