4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/atp binding protein
molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
2QENA 2RKOA 3SYKA 5EP4A 2BJWA 3D8BA 2C9OA 1OFHA 4LCBA 1LV7A 4LJ9A 1NY6A 1R7RA 2DWZB 4LJ4A 3EIEA 4LJAA 5EXSA 2XSZA 1R6BX 1C1KA 4LJ7A 1SXJE 4I81A 3MHVC 3ZH9B 1KYIA 1IXRC 3M6AA 5EP1A 2CEAA 1XXHA 4FWGA 2V6ZM 2C99A 4FWHA 4I4LA 3GLGA 1G4AE 2KRKA 5FTJA 5C1BA 4EIWA 1W5TA 3PVSA 4LRTA 3GLIB 4D81A 2CHQA 3PXGA 3M0EA 4FCVA 2QBYA 4KO8A 1IM2A 1E32A 2DZOB 1HQCA 3KW6A 1HQYE 5C18A 3U60B 2BJVA 3HU3A 1QZMA 1UM8A 2DHRA 1DO2A 3GLHA 4GITA 2FNAA 3K1JA 5JI3E 4JN6A 1IN8A 2X8AA 5EXXA 1E94E 1D2NA 3VFDA 2QZ4A 3CF0A 4LGMA 5FTNA 1JQJC 1IXZA 3KDSE 2DZNB 3H4MA 1SXJC 1L8QA 5DYIA 5FTMA 1X37A 4D82A 4WW0A 3GLFB 3B9PA 5EXPA 2CE7A 5DYGA 3WHKA 4L16A 2V1UA 2DVWB 1J7KA 1NVMA 3SC3A 1SXJA 4ZPXA 2C96A 1NSFA 3HU2A 4LRSA 1G3IA 3DZDA 1IY2A 1IN7A 4KODA 2Z4RA 5EP3A 5JI2E 2C9CA 2ZANA 4LJ8A 2R65A 1XXHB 1FNNA 3GLGB 4FWDA 2CHVA 3SYLA 2ZAMA 4FCTA 1QVRA 4A3VB 1KSFX 2R62A 1SXJD 2CHGA 1NJFA 1IXSB 1S3SA 2Z4SA 3CF2A 2QP9X 3EIHA 4FCWA 4QNRA 3GLIA 3BOSA 1OJLA 3AJIB 5FTKA 4D80A 2QBYB 3VLFB 4LJ5A 4LZZA 2C98A 1IY1A 1JR3D 4QHSA 4LJ6A 5EP2A 3GLHB 1IQPA 4FD2A 1DO0A 4L4UA 4KLNA 5EXTA 3U5ZB 1IN6A 2QPAA 1XWIA 1HT1E 4QNMA 4LY6A 1JR3A 3HU1A 3HWSA 3R8FA 1NJGA 1W5SA 1IY0A 1IN5A 3U61B 4FW9A 4L15A 4Z8XA 2ZAOA 3PFIA 5EQTA 2XSZD 3UK6A 1G41A 5FTLA 4QHTA 3GLFA 1HT2E 2HCBA 1NY5A 4QOSA 1OFIA 2VIIA 1IN4A 1SXJB 3WHLA
chains in the Genus database with same CATH superfamily
3SHGB 5BR8M 1MJGM 3UJNA 5KPZA 4II7A 4LJ9A 2F5OA 4K0KM 3GRUA 4LJAA 3U6EA 1NHGC 3J80S 4TUWA 1G59A 1C1KA 5L8RF 1SXJE 1L2CA 2KRUA 4QOZC 4M9SA 5EP1A 3M6AA 3MK6A 4S12A 2V6ZM 2C99A 4CGYB 3K9PA 1XMQM 2OPFA 4EIWA 1W5TA 2C5RA 3W67A 4D81A 2WSCF 3RGSA 1PJTA 3PNVA 4GHAA 1IXSA 2XFSA 4BLCA 3JR4A 4DV6M 2R45A 3PXGA 3B7QA 3M0EA 3M7GA 3BXWA 1ZAEA 3SBJA 4FCVA 1EIJA 4Z6YA 1IM2A 2KNVA 3GRRA 3GPYA 2D7EA 2DZOB 4B3RM 3KW6A 1HQYE 5C18A 2R18A 1NNUC 1QZMA 1YSYA 2JY6B 3FTDA 3HJQA 2FNAA 2UXCM 1ZMUA 3K1JA 5JI3E 3SASA 1TTEA 5EXXA 4GC9A 3L27A 4B7HA 2MROB 3CF0A 4R7GA 3L29A 4AKHA 4DV2M 2JP7A 1SXJC 4MH0E 4XGIA 2F5SA 1L8QA 2K0BX 2EJSA 1ZMWA 4FVMA 2VF7A 1DGHA 4M0WA 5FTMA 4JI3M 2BNKA 2O25A 3GLFB 3U6LA 1IBMM 5EXPA 2JY5A 1IBKM 1D0MA 2CE7A 1IBLM 5DYGA 4JI7M 2X4AA 2O01F 5KO3A 2WSFF 3B7ZA 2XZUA 2D7HA 3J2PB 3A45A 2DAKA 3I51A 2FH0A 2L4FA 2C96A 2DWLA 4DV4M 4JYAM 2CV2A 3LCVB 1VEGA 2DNAA 3THGA 1IN7A 1IY2A 4JI8M 2RRUA 4LJ8A 2APLA 3FE3A 4IJEA 3GLGB 3FUVA 1G71A 2CHVA 2DAIA 2ZAMA 4FCTA 5ITXA 2Z8YM 3HX3A 2KA6B 1KSFX 4A3VB 4ITQA 2CV0A 2CHGA 2CUZA 2UUAM 3DOAA 3EIHA 3GLIA 2L2DA 1OJLA 1WXQA 2Y0TA 3AJIB 2RGHA 4OW0A 3VDPA 2LVNC 3KS4A 4LZZA 1E9RA 3HHYA 3CTWB 4JI4M 3KS8A 5IZ7D 4X65M 3LQQA 5EP2A 2Y0QA 4LGYA 2YNMD 3FD9A 3R9XB 3I4VA 1QAOA 4JXJA 4JI6M 2OOAA 1WJ7A 1Z5CA 4KT0F 1TF0B 3C3EA 4NSRA 2QPAA 1HNZM 4QNMA 2BWEA 3HHXA 4G4OA 3R8FA 1NJGA 1IY0A 1IN5A 4L15A 3FKEA 3LVWA 1MN3A 3QWLA 3U6CA 3CGWA 2CWBA 1XMOM 3UGJA 1HNWM 3C3DA 3MJ5A 4MGHA 4QHTA 5E26A 1HT2E 1NY5A 1HNXM 1XB2B 1XNQM 1IN4A 1D0LA 2YQZA 3U6PA 1PJSA 2JXNA 4R3DA 4HLQA 3OTOM 1P3QQ 2BJWA 2F5QA 4MM3B 4Q7JA 3FYCA 4B08A 1NY6A 2ERCA 5ITUA 2Z3XA 1GL7A 2XSZA 4AG6A 4GKKM 4JI2M 1R6BX 4LJ7A 3L26A 3B89A 1R4GA 4REZA 3ZH9B 1KYIA 2JNHA 1XXHA 4RF0A 4LF8M 4IBCA 4I4LA 3LCUA 4PT5A 5BPVA 1NHWC 2N35A 3RFWA 4M9XA 1GVNA 4LFCM 5C1BA 1A5TA 4LRTA 1QZEA 2FFJA 2LWXA 4GKJM 3FRHA 5ITXE 2CHQA 3IG8A 3J7AS 4IBIA 1Z5AA 1J5EM 2QBYA 3A46A 2R6FA 3KSXA 4BBAA 4R71A 2WSEF 2MH8A 3TQSA 3GLIE 1PJJA 1N33M 1UM8A 1TH2A 1OAOC 2Y21A 4IBKA 4MB7A 3U6DA 3U6MA 2LVOC 4JN6A 2DAMA 3Q8GA 2MR9A 2HAKA 1DGFA 2OO9A 2QZ4A 3Q8XA 4B7GA 1IXZA 3KDSE 2K9DA 2R0IA 3H4MA 3AL0C 4DV0M 2Z7JA 4NRWA 3U61A 3U6SA 1TR8A 1X37A 2LVPC 3VDUA 4D82A 4WW0A 4AW4A 4DR2M 4DV7M 2KEBA 3B9PA 3FUXA 3SFZA 2VQFM 3DFZA 2QCUA 4OVZA 1QAQA 3WHKA 5F3WA 1L1ZA 2V1UA 1J7KA 3W68A 7CATA 1NVMA 2QHOB 3SC3A 1G8PA 2UU9M 2JZ1A 1QAMA 3QYBA 4I5SA 1NV9A 4CHTB 3AOGA 4CIZA 2HL7A 1G3IA 2L7HA 3E4RA 2LH0A 4HL4A 2H1RA 4IBBA 4YHHM 3KFUG 3TWMA 2NQ8C 4DR1M 2XGNA 4X64M 2R65A 1QQWA 3DA1A 3L28A 3L2AA 1VDLA 4GH9A 1FNNA 4RKUF 2QNJA 3T15A 3SHFA 4M9ZA 4IBEA 3NWLA 3GPUA 4PD2A 1DGHB 3ZC7B 3GQ3A 1SXJD 2QSFX 1NV8A 1Y8GA 2Z4SA 1NJFA 1VEKA 1V92A 1WIVA 2K6BA 1N36M 4LF5M 2KHHA 1F4IA 2M5ZA 2B3TA 1XXHE 4QNRA 2H5XA 1L2DA 2KW0A 3BOSA 1ZMVA 2W82A 3FRIA 5FTKA 5LMNM 2O5RA 1QANA 1IY1A 2MGWA 2XH9A 4MGKE 4QHSA 1Z6TA 8CATA 1QUSA 2R4EA 1IQPA 3GLHB 3HZJA 4FD2A 3KSJA 2JZ0A 1VQ1A 1UFZA 4MGZE 2JY8A 2QQ8A 4L4UA 2DXIA 3F92A 2LNHC 1DGGA 2KZUA 5EXTA 4CISA 3FTFA 3IG5A 3LVVA 3U5ZB 1NO1A 3W0LB 3KXEC 2JY7A 4P16A 1JR3A 3HU1A 1W5SA 4P17A 3LMMA 4Z8XA 4PDIA 1QDTA 4LFBM 3IECA 3NBIA 3T38A 3KOXE 1N77A 2LHCA 4GIPA 2XSZD 3FTEA 1G41A 5FTLA 2UUCM 3GLFA 2HCBA 4QOSA 3U6OA 1OFIA 4G4RA 2J7NA 3FUWA 1SXJB 4OU7A 1YE9A 3WHLA 1EE8A 2DWMA 1PRBA 4DR5M 3D8BA 5A2QS 4JI1M 4GC5A 4LCBA 1IFYA 3HJ8A 3VKHA 3I01M 1R7RA 4LJ4A 4JI5M 1FJGM 3ZQJA 1H6UA 1V33A 1VG5A 2EKKA 5KQDA 1OAIA 4NRVA 1I94M 3MHVC 4G6ZA 1IXRC 3HJSA 4GMQA 1PGYA 2GQFA 4FWGA 1N34M 3GLGA 1G4AE 3GPXA 2FOIC 4WP2A 1N75A 2RGOA 4AKIA 1LTMA 4DV1M 5ITYA 3I04M 1K3XA 1PM5A 2JUJA 3SMPA 3E9SA 4GHLA 2XFTA 1J09A 4KO8A 1YUBA 3LW5F 2WZJA 1HQCA 1RU3A 3TE6A 3U60B 2BJVA 2G3QA 4XK8F 4GITA 4B3TM 3ILKA 5IWAM 1IN8A 2X8AA 3KOYE 3TWLA 3SMSA 2LHGA 1GO5A 2DZLA 3VFDA 3AV0A 1OTRA 4LGMA 3RE8A 1XHBA 2YFQA 2XLJA 2UXDM 3PNYA 2DZNB 3J7BA 3GQ4A 3T1HM 3GRVA 3GPPA 1BVSA 5KQ8A 4NSOB 4ANRA 2EA0A 1JR3E 4PDGA 3C9PA 5FLXS 4IBGA 4DR7M 4GEWA 2D7GA 2EUCA 1R2YA 4JV5M 1OIPA 4YY3M 4F2LA 2DAEA 1MU5A 2VF8A 3AFHA 5FSWA 2DI0A 3B7NA 2J5YA 3K9OA 4AZFA 1Q39A 1N32M 3GLFE 4LRSA 3BBZA 3HU2A 4KODA 4IBJA 3GO8A 2LVAA 2G8LA 3NBXX 5JI2E 4L6V6 1TH4A 1Z5BA 2HKJA 2J7OA 2XEPA 5KPRA 1QVRA 1V34A 4G4NA 2A5YB 2DKLA 2R62A 1R2ZA 1IXSB 2ZM6M 1GLNA 2QP9X 2G5GX 4FCWA 3GLGE 4D80A 1K82A 5KPTA 3VLFB 4DR3M 4DBGB 1JR3D 2F4VM 3AOEA 4HEOA 3SATA 4X62M 1GABA 3J81S 2DAGA 3UZUA 3TWKA 4LF9M 1AIPC 5IREB 2EKFA 3KOZE 1ZV1A 1VEJA 2JWSA 1HT1E 4AKGA 1JB0F 3LQRA 5DFLA 4NC6A 2XF3A 4NOOB 2ZTCA 4FW9A 4G3OA 3QAUA 4NXMM 2Q2EB 3JR5A 3SAWA 2ZAOA 1I4WA 1Q02A 3PFIA 3VKGA 1WGNA 3VK8A 2DWNA 3FUUA 1GJSA 3MMPA 4PCZA 1SG9A 4X66M 2LXEA 3B74A 3E46A 3HHZA 3A98B 2ZBKB 5IT9S 2VIIA 2K47A 3GRYA 2QENA 1WGLA 2RKOA 4AI6A 1GJTA 3SYKA 3CF6E 5EP4A 1PJIA 3KOWE 4IBFA 2C9OA 5DNYA 4DV3M 1OFHA 1LV7A 2CRUA 2F5NA 2DWZB 3HHWA 5EXSA 3EIEA 2CP8A 2L6OA 1ZQ9A 1QUTA 2CFOA 3J27B 4I81A 3SAVA 5E6JA 2CEAA 4FWHA 1TH3A 2HHHM 2L4EA 2GNOA 4LFAM 1K3WA 2KRKA 5FTJA 4IBDA 1NNJA 3PVSA 3GLIB 3IHPA 3QYEA 2L09A 1OQYA 3A42A 2R4JA 4WURA 3TL4X 1ORYB 2AHMA 1E32A 2R46A 4DR4M 4NXNM 1TDZA 1Z59A 3C58A 1WHCA 1GKIA 3HU3A 4B3SM 2KDLA 2DHRA 2FS1A 1XNRM 2M60A 2DHYA 1DO2A 3GLHA 4DR6M 4AG5A 1OKSA 2CV1A 3KVWA 1D0KA 1YLAA 2VQEM 1E94E 2V1CA 1D2NA 1Q3BA 2KXEA 4DUZM 4RF1A 4UN2B 4Y28F 5FTNA 2UUBM 1JQJC 3U5ZA 4AQYM 1R5LA 2OOBA 3H4JA 2KNZA 5DYIA 2R44A 5GKNA 3SAUA 3RGPA 1CUKA 4KHPM 3SARA 4LZJA 5ITQA 3GP1A 4MGIE 2DENA 3HGIA 3HKPA 5EJCA 2I7NA 4IIWA 4L16A 4L78A 3T1YM 2VDBB 2DVWB 3L25A 1KFVA 1MX0A 2LTUA 1Q3CA 1SXJA 1TDHA 2YR0A 2UXBM 1E9SA 4ZPXA 3ZCBB 5H37D 2F5PA 4B7FA 4OX9M 1NSFA 3DZDA 3FYDA 5ITRA 5EP3A 5ITTA 2Z4RA 4W5WA 1DV0A 2LBCA 1QYRA 4RNAA 4BB9A 4DV5M 2C9CA 2ZANA 2I7PA 1N78A 1XXHB 4DUYM 1QDRA 2L7IA 3AOEC 4FWDA 3SYLA 4JI0M 1VDDA 1DGBA 3KP0E 3K2LA 2JA2A 1S3SA 3CF2A 1T6OA 3K8ZA 4LF6M 4I8OA 1PJQA 2P5TA 2QBYB 2OQ4A 1C7YA 3V76A 3E21A 4LJ5A 4NL4H 4B3MM 4LG2A 2C98A 1L2BA 4F1IA 3AKZA 2XZFA 4LJ6A 1T3TA 1DO0A 3U60A 1OIZA 3FUTA 4CJ6A 4KLNA 3D8LA 1L1TA 2EO2A 2LVQD 3T6PA 4L8RC 2X49A 4GRIA 5LMUM 2ZTDA 3I4YA 1IN6A 3TPZA 1XWIA 4LF7M 4G4QA 4LY6A 3GLHE 3HWSA 3HY5A 2KZSA 3VK7A 1HJPA 2BWBA 3U61B 1TGUA 3W0FA 4LF4M 2E5LM 1AUAA 3JAMS 3GQ5A 2HWJA 2MJ5B 2Y20A 5EQTA 3U6QA 1HR0M 4M0DA 4XBOA 1EFUB 1GL6A 4OVZB 3UK6A 1WR1B 3KP1E 4IJFA 3UMMA 1T43A 3K92A 4MGYE 3FTCA 2KNAA 2FE8A 1XC8A
chains in the Genus database with same CATH topology
3SHGB 5BR8M 3UJNA 5KPZA 4II7A 4LJ9A 4K0KM 4TUWA 3GRUA 4LJAA 3U6EA 1NHGC 3J80S 1G59A 1C1KA 1L2CA 1SXJE 2KRUA 4QOZC 4M9SA 5EP1A 3M6AA 3MK6A 4S12A 2V6ZM 2C99A 4CGYB 1XMQM 2OPFA 4EIWA 1W5TA 2C5RA 4D81A 3RGSA 4GHAA 3PNVA 2XFSA 4BLCA 3JR4A 4DV6M 2R45A 3PXGA 3M0EA 3M7GA 1ZAEA 3SBJA 4FCVA 4Z6YA 1IM2A 3GPYA 3GRRA 2D7EA 2DZOB 4B3RM 3KW6A 1HQYE 5C18A 2R18A 1NNUC 1QZMA 1YSYA 3FTDA 3HJQA 2FNAA 2UXCM 3K1JA 5JI3E 3SASA 5EXXA 4GC9A 3L27A 4B7HA 3CF0A 4R7GA 3L29A 4AKHA 4DV2M 1SXJC 4MH0E 4XGIA 2F5SA 1L8QA 4FVMA 5FTMA 1DGHA 4M0WA 4JI3M 2BNKA 3GLFB 3U6LA 1IBMM 5EXPA 1IBKM 2CE7A 1IBLM 5DYGA 4JI7M 2X4AA 5KO3A 2XZUA 2D7HA 3J2PB 3A45A 3I51A 2DWLA 2C96A 4DV4M 4JYAM 2CV2A 3THGA 1IY2A 1IN7A 4JI8M 4LJ8A 4IJEA 3GLGB 3FUVA 2CHVA 2ZAMA 4FCTA 5ITXA 2KA6B 1KSFX 4A3VB 4ITQA 2CV0A 2CHGA 2CUZA 2UUAM 3DOAA 3EIHA 3GLIA 2Y0TA 1OJLA 1WXQA 3AJIB 4OW0A 2RGHA 3VDPA 4LZZA 3KS4A 3HHYA 1E9RA 3CTWB 4JI4M 3KS8A 5IZ7D 4X65M 3LQQA 5EP2A 2Y0QA 4LGYA 2YNMD 3FD9A 3R9XB 3I4VA 1QAOA 4JXJA 4JI6M 1Z5CA 4NSRA 2QPAA 1HNZM 4QNMA 3HHXA 4G4OA 3R8FA 1NJGA 1IY0A 1IN5A 4L15A 3FKEA 3LVWA 3QWLA 3U6CA 1XMOM 3UGJA 1HNWM 3MJ5A 4MGHA 4QHTA 5E26A 1HT2E 1NY5A 1HNXM 1XNQM 1IN4A 2YQZA 3U6PA 4R3DA 4HLQA 3OTOM 2BJWA 2F5QA 4MM3B 3FYCA 4B08A 1NY6A 2ERCA 5ITUA 2Z3XA 1GL7A 2XSZA 4AG6A 4GKKM 4JI2M 1R6BX 4LJ7A 3L26A 3ZH9B 4REZA 1KYIA 1XXHA 4RF0A 4LF8M 4IBCA 4I4LA 4PT5A 5BPVA 1NHWC 3RFWA 4M9XA 1GVNA 4LFCM 5C1BA 4LRTA 2FFJA 2LWXA 4GKJM 5ITXE 2CHQA 3IG8A 3J7AS 4IBIA 1Z5AA 1J5EM 2QBYA 3A46A 3KSXA 4BBAA 1N33M 3TQSA 1PJJA 1UM8A 1TH2A 2Y21A 4IBKA 4MB7A 3U6DA 3U6MA 4JN6A 2QZ4A 1DGFA 3Q8XA 4B7GA 1IXZA 3KDSE 3H4MA 3AL0C 4DV0M 2Z7JA 4NRWA 3U61A 1X37A 3VDUA 4D82A 4WW0A 4AW4A 4DR2M 4DV7M 2KEBA 3B9PA 3FUXA 3SFZA 2VQFM 3DFZA 2QCUA 4OVZA 1QAQA 3WHKA 5F3WA 1L1ZA 2V1UA 1J7KA 7CATA 1NVMA 3SC3A 2UU9M 1G8PA 1QAMA 4I5SA 4CHTB 3AOGA 2HL7A 1G3IA 2L7HA 3E4RA 2LH0A 4HL4A 2H1RA 4IBBA 4YHHM 3KFUG 3TWMA 2NQ8C 4DR1M 2XGNA 4X64M 2R65A 1QQWA 3DA1A 3L28A 3L2AA 4GH9A 3SHFA 1FNNA 3T15A 3U6SA 4M9ZA 4IBEA 3NWLA 3GPUA 4PD2A 1DGHB 3ZC7B 3GQ3A 1SXJD 2Z4SA 1NJFA 1N36M 4LF5M 2M5ZA 4QNRA 1L2DA 2KW0A 3BOSA 2W82A 5FTKA 5LMNM 2O5RA 1QANA 1IY1A 4MGKE 2XH9A 4QHSA 1Z6TA 8CATA 2R4EA 1IQPA 3GLHB 4FD2A 3KSJA 4MGZE 4L4UA 3FTFA 2DXIA 5EXTA 2LNHC 1DGGA 2KZUA 4CISA 3IG5A 3LVVA 3U5ZB 3W0LB 3KXEC 4P16A 1JR3A 3HU1A 1W5SA 3LMMA 4Z8XA 4PDIA 4LFBM 3NBIA 3T38A 3KOXE 1N77A 4GIPA 2XSZD 3FTEA 1G41A 5FTLA 2UUCM 3GLFA 2HCBA 4QOSA 3U6OA 1OFIA 4G4RA 2J7NA 3FUWA 1SXJB 4OU7A 1YE9A 3WHLA 1EE8A 2DWMA 4DR5M 3D8BA 5A2QS 4JI1M 4GC5A 4LCBA 3VKHA 3HJ8A 1R7RA 4LJ4A 4JI5M 1FJGM 1H6UA 5KQDA 4NRVA 1I94M 3MHVC 4G6ZA 1IXRC 3HJSA 4GMQA 4FWGA 1N34M 3GLGA 1G4AE 3GPXA 2FOIC 4AKIA 1N75A 2RGOA 4DV1M 5ITYA 1K3XA 1PM5A 3SMPA 4GHLA 3E9SA 2XFTA 1J09A 4KO8A 1YUBA 1HQCA 3TE6A 3U60B 2BJVA 4GITA 4B3TM 3ILKA 5IWAM 1IN8A 2X8AA 3KOYE 3TWLA 3SMSA 3VFDA 3AV0A 4LGMA 3RE8A 1XHBA 2YFQA 2XLJA 2UXDM 3PNYA 2DZNB 3J7BA 3GQ4A 3T1HM 3GRVA 3GPPA 5KQ8A 4NSOB 2EA0A 4PDGA 5FLXS 4IBGA 4DR7M 2D7GA 2EUCA 1R2YA 4JV5M 4YY3M 1MU5A 3AFHA 5FSWA 4AZFA 1Q39A 1N32M 4LRSA 3HU2A 4KODA 4IBJA 3GO8A 2G8LA 5JI2E 1TH4A 1Z5BA 2HKJA 2J7OA 2XEPA 5KPRA 1QVRA 4G4NA 2A5YB 2R62A 1R2ZA 1IXSB 2ZM6M 1GLNA 2QP9X 2G5GX 4FCWA 4D80A 1K82A 5KPTA 3VLFB 4DR3M 1JR3D 2F4VM 3AOEA 3SATA 4X62M 3J81S 3UZUA 3TWKA 4LF9M 5IREB 3KOZE 1HT1E 4AKGA 3LQRA 2XF3A 4NOOB 4FW9A 3QAUA 4NXMM 2Q2EB 3JR5A 3SAWA 2ZAOA 1I4WA 3PFIA 3VKGA 3VK8A 2DWNA 3FUUA 4PCZA 4X66M 2LXEA 3HHZA 3A98B 2ZBKB 5IT9S 2VIIA 2K47A 3GRYA 2QENA 2RKOA 4AI6A 3SYKA 1PJIA 3CF6E 5EP4A 2F5OA 3KOWE 4IBFA 2C9OA 5DNYA 4DV3M 1OFHA 1LV7A 2F5NA 2DWZB 3HHWA 5EXSA 3EIEA 2L6OA 1ZQ9A 2CFOA 3J27B 4I81A 3SAVA 5E6JA 2CEAA 4FWHA 1TH3A 2HHHM 4LFAM 1K3WA 2KRKA 5FTJA 4IBDA 1NNJA 3PVSA 3GLIB 2L09A 3A42A 2R4JA 4WURA 3TL4X 1ORYB 2AHMA 1E32A 2R46A 4DR4M 4NXNM 1TDZA 1Z59A 3C58A 1GKIA 3HU3A 4B3SM 2DHRA 1XNRM 2M60A 1DO2A 3GLHA 4DR6M 4AG5A 2CV1A 3KVWA 2VQEM 1E94E 2V1CA 1D2NA 1Q3BA 2KXEA 4DUZM 4RF1A 5FTNA 2UUBM 1JQJC 3U5ZA 4AQYM 5DYIA 5GKNA 3SAUA 3RGPA 4KHPM 3SARA 4LZJA 5ITQA 3GP1A 4MGIE 3HKPA 3HGIA 2I7NA 4IIWA 4L16A 4L78A 3T1YM 3L25A 2DVWB 1KFVA 1MX0A 2UXBM 1Q3CA 1SXJA 1TDHA 2YR0A 1E9SA 4ZPXA 3ZCBB 5H37D 2F5PA 4B7FA 4OX9M 1NSFA 3FYDA 3DZDA 5ITRA 5EP3A 5ITTA 2Z4RA 4W5WA 1QYRA 4RNAA 4BB9A 4DV5M 2C9CA 2ZANA 2I7PA 1N78A 1XXHB 4DUYM 2L7IA 3AOEC 4FWDA 3SYLA 4JI0M 1VDDA 1DGBA 3KP0E 3K2LA 2JA2A 1S3SA 3CF2A 3K8ZA 4LF6M 4I8OA 2P5TA 2QBYB 2OQ4A 4LG2A 4LJ5A 4NL4H 4B3MM 2C98A 1L2BA 3AKZA 2XZFA 4LJ6A 1T3TA 1DO0A 3U60A 3FUTA 4KLNA 3D8LA 1L1TA 2EO2A 4L8RC 2X49A 4GRIA 5LMUM 3I4YA 1IN6A 3TPZA 1XWIA 4LF7M 4G4QA 4LY6A 3HWSA 2KZSA 3VK7A 3U61B 1TGUA 3W0FA 4LF4M 2E5LM 3JAMS 3GQ5A 3U6QA 2Y20A 5EQTA 1HR0M 4M0DA 4XBOA 1GL6A 4OVZB 3UK6A 3KP1E 4IJFA 3UMMA 3K92A 4MGYE 3FTCA 5EJCA 2FE8A 1XC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEN A;  2RKO A;  3SYK A;  5EP4 A;  2BJW A;  3D8B A;  2C9O A;  1OFH A;  4LCB A;  1LV7 A;  4LJ9 A;  1NY6 A;  1R7R A;  2DWZ B;  4LJ4 A;  3EIE A;  4LJA A;  5EXS A;  2XSZ A;  1R6B X;  1C1K A;  4LJ7 A;  1SXJ E;  4I81 A;  3MHV C;  3ZH9 B;  1KYI A;  1IXR C;  3M6A A;  5EP1 A;  2CEA A;  1XXH A;  4FWG A;  2V6Z M;  2C99 A;  4FWH A;  4I4L A;  3GLG A;  1G4A E;  2KRK A;  5FTJ A;  5C1B A;  4EIW A;  1W5T A;  3PVS A;  4LRT A;  3GLI B;  4D81 A;  2CHQ A;  3PXG A;  3M0E A;  4FCV A;  2QBY A;  4KO8 A;  1IM2 A;  1E32 A;  2DZO B;  1HQC A;  3KW6 A;  1HQY E;  5C18 A;  3U60 B;  2BJV A;  3HU3 A;  1QZM A;  1UM8 A;  2DHR A;  1DO2 A;  3GLH A;  4GIT A;  2FNA A;  3K1J A;  5JI3 E;  4JN6 A;  1IN8 A;  2X8A A;  5EXX A;  1E94 E;  1D2N A;  3VFD A;  2QZ4 A;  3CF0 A;  4LGM A;  5FTN A;  1JQJ C;  1IXZ A;  3KDS E;  2DZN B;  3H4M A;  1SXJ C;  1L8Q A;  5DYI A;  5FTM A;  1X37 A;  4D82 A;  4WW0 A;  3GLF B;  3B9P A;  5EXP A;  2CE7 A;  5DYG A;  3WHK A;  4L16 A;  2V1U A;  2DVW B;  1J7K A;  1NVM A;  3SC3 A;  1SXJ A;  4ZPX A;  2C96 A;  1NSF A;  3HU2 A;  4LRS A;  1G3I A;  3DZD A;  1IY2 A;  1IN7 A;  4KOD A;  2Z4R A;  5EP3 A;  5JI2 E;  2C9C A;  2ZAN A;  4LJ8 A;  2R65 A;  1XXH B;  1FNN A;  3GLG B;  4FWD A;  2CHV A;  3SYL A;  2ZAM A;  4FCT A;  1QVR A;  4A3V B;  1KSF X;  2R62 A;  1SXJ D;  2CHG A;  1NJF A;  1IXS B;  1S3S A;  2Z4S A;  3CF2 A;  2QP9 X;  3EIH A;  4FCW A;  4QNR A;  3GLI A;  3BOS A;  1OJL A;  3AJI B;  5FTK A;  4D80 A;  2QBY B;  3VLF B;  4LJ5 A;  4LZZ A;  2C98 A;  1IY1 A;  1JR3 D;  4QHS A;  4LJ6 A;  5EP2 A;  3GLH B;  1IQP A;  4FD2 A;  1DO0 A;  4L4U A;  4KLN A;  5EXT A;  3U5Z B;  1IN6 A;  2QPA A;  1XWI A;  1HT1 E;  4QNM A;  4LY6 A;  1JR3 A;  3HU1 A;  3HWS A;  3R8F A;  1NJG A;  1W5S A;  1IY0 A;  1IN5 A;  3U61 B;  4FW9 A;  4L15 A;  4Z8X A;  2ZAO A;  3PFI A;  5EQT A;  2XSZ D;  3UK6 A;  1G41 A;  5FTL A;  4QHT A;  3GLF A;  1HT2 E;  2HCB A;  1NY5 A;  4QOS A;  1OFI A;  2VII A;  1IN4 A;  1SXJ B;  3WHL A; 
#chains in the Genus database with same CATH topology
 3SHG B;  5BR8 M;  1MJG M;  3UJN A;  5KPZ A;  4II7 A;  4LJ9 A;  2F5O A;  4K0K M;  3GRU A;  4LJA A;  3U6E A;  1NHG C;  3J80 S;  4TUW A;  1G59 A;  1C1K A;  5L8R F;  1SXJ E;  1L2C A;  2KRU A;  4QOZ C;  4M9S A;  5EP1 A;  3M6A A;  3MK6 A;  4S12 A;  2V6Z M;  2C99 A;  4CGY B;  3K9P A;  1XMQ M;  2OPF A;  4EIW A;  1W5T A;  2C5R A;  3W67 A;  4D81 A;  2WSC F;  3RGS A;  1PJT A;  3PNV A;  4GHA A;  1IXS A;  2XFS A;  4BLC A;  3JR4 A;  4DV6 M;  2R45 A;  3PXG A;  3B7Q A;  3M0E A;  3M7G A;  3BXW A;  1ZAE A;  3SBJ A;  4FCV A;  1EIJ A;  4Z6Y A;  1IM2 A;  2KNV A;  3GRR A;  3GPY A;  2D7E A;  2DZO B;  4B3R M;  3KW6 A;  1HQY E;  5C18 A;  2R18 A;  1NNU C;  1QZM A;  1YSY A;  2JY6 B;  3FTD A;  3HJQ A;  2FNA A;  2UXC M;  1ZMU A;  3K1J A;  5JI3 E;  3SAS A;  1TTE A;  5EXX A;  4GC9 A;  3L27 A;  4B7H A;  2MRO B;  3CF0 A;  4R7G A;  3L29 A;  4AKH A;  4DV2 M;  2JP7 A;  1SXJ C;  4MH0 E;  4XGI A;  2F5S A;  1L8Q A;  2K0B X;  2EJS A;  1ZMW A;  4FVM A;  2VF7 A;  1DGH A;  4M0W A;  5FTM A;  4JI3 M;  2BNK A;  2O25 A;  3GLF B;  3U6L A;  1IBM M;  5EXP A;  2JY5 A;  1IBK M;  1D0M A;  2CE7 A;  1IBL M;  5DYG A;  4JI7 M;  2X4A A;  2O01 F;  5KO3 A;  2WSF F;  3B7Z A;  2XZU A;  2D7H A;  3J2P B;  3A45 A;  2DAK A;  3I51 A;  2FH0 A;  2L4F A;  2C96 A;  2DWL A;  4DV4 M;  4JYA M;  2CV2 A;  3LCV B;  1VEG A;  2DNA A;  3THG A;  1IN7 A;  1IY2 A;  4JI8 M;  2RRU A;  4LJ8 A;  2APL A;  3FE3 A;  4IJE A;  3GLG B;  3FUV A;  1G71 A;  2CHV A;  2DAI A;  2ZAM A;  4FCT A;  5ITX A;  2Z8Y M;  3HX3 A;  2KA6 B;  1KSF X;  4A3V B;  4ITQ A;  2CV0 A;  2CHG A;  2CUZ A;  2UUA M;  3DOA A;  3EIH A;  3GLI A;  2L2D A;  1OJL A;  1WXQ A;  2Y0T A;  3AJI B;  2RGH A;  4OW0 A;  3VDP A;  2LVN C;  3KS4 A;  4LZZ A;  1E9R A;  3HHY A;  3CTW B;  4JI4 M;  3KS8 A;  5IZ7 D;  4X65 M;  3LQQ A;  5EP2 A;  2Y0Q A;  4LGY A;  2YNM D;  3FD9 A;  3R9X B;  3I4V A;  1QAO A;  4JXJ A;  4JI6 M;  2OOA A;  1WJ7 A;  1Z5C A;  4KT0 F;  1TF0 B;  3C3E A;  4NSR A;  2QPA A;  1HNZ M;  4QNM A;  2BWE A;  3HHX A;  4G4O A;  3R8F A;  1NJG A;  1IY0 A;  1IN5 A;  4L15 A;  3FKE A;  3LVW A;  1MN3 A;  3QWL A;  3U6C A;  3CGW A;  2CWB A;  1XMO M;  3UGJ A;  1HNW M;  3C3D A;  3MJ5 A;  4MGH A;  4QHT A;  5E26 A;  1HT2 E;  1NY5 A;  1HNX M;  1XB2 B;  1XNQ M;  1IN4 A;  1D0L A;  2YQZ A;  3U6P A;  1PJS A;  2JXN A;  4R3D A;  4HLQ A;  3OTO M;  1P3Q Q;  2BJW A;  2F5Q A;  4MM3 B;  4Q7J A;  3FYC A;  4B08 A;  1NY6 A;  2ERC A;  5ITU A;  2Z3X A;  1GL7 A;  2XSZ A;  4AG6 A;  4GKK M;  4JI2 M;  1R6B X;  4LJ7 A;  3L26 A;  3B89 A;  1R4G A;  4REZ A;  3ZH9 B;  1KYI A;  2JNH A;  1XXH A;  4RF0 A;  4LF8 M;  4IBC A;  4I4L A;  3LCU A;  4PT5 A;  5BPV A;  1NHW C;  2N35 A;  3RFW A;  4M9X A;  1GVN A;  4LFC M;  5C1B A;  1A5T A;  4LRT A;  1QZE A;  2FFJ A;  2LWX A;  4GKJ M;  3FRH A;  5ITX E;  2CHQ A;  3IG8 A;  3J7A S;  4IBI A;  1Z5A A;  1J5E M;  2QBY A;  3A46 A;  2R6F A;  3KSX A;  4BBA A;  4R71 A;  2WSE F;  2MH8 A;  3TQS A;  3GLI E;  1PJJ A;  1N33 M;  1UM8 A;  1TH2 A;  1OAO C;  2Y21 A;  4IBK A;  4MB7 A;  3U6D A;  3U6M A;  2LVO C;  4JN6 A;  2DAM A;  3Q8G A;  2MR9 A;  2HAK A;  1DGF A;  2OO9 A;  2QZ4 A;  3Q8X A;  4B7G A;  1IXZ A;  3KDS E;  2K9D A;  2R0I A;  3H4M A;  3AL0 C;  4DV0 M;  2Z7J A;  4NRW A;  3U61 A;  3U6S A;  1TR8 A;  1X37 A;  2LVP C;  3VDU A;  4D82 A;  4WW0 A;  4AW4 A;  4DR2 M;  4DV7 M;  2KEB A;  3B9P A;  3FUX A;  3SFZ A;  2VQF M;  3DFZ A;  2QCU A;  4OVZ A;  1QAQ A;  3WHK A;  5F3W A;  1L1Z A;  2V1U A;  1J7K A;  3W68 A;  7CAT A;  1NVM A;  2QHO B;  3SC3 A;  1G8P A;  2UU9 M;  2JZ1 A;  1QAM A;  3QYB A;  4I5S A;  1NV9 A;  4CHT B;  3AOG A;  4CIZ A;  2HL7 A;  1G3I A;  2L7H A;  3E4R A;  2LH0 A;  4HL4 A;  2H1R A;  4IBB A;  4YHH M;  3KFU G;  3TWM A;  2NQ8 C;  4DR1 M;  2XGN A;  4X64 M;  2R65 A;  1QQW A;  3DA1 A;  3L28 A;  3L2A A;  1VDL A;  4GH9 A;  1FNN A;  4RKU F;  2QNJ A;  3T15 A;  3SHF A;  4M9Z A;  4IBE A;  3NWL A;  3GPU A;  4PD2 A;  1DGH B;  3ZC7 B;  3GQ3 A;  1SXJ D;  2QSF X;  1NV8 A;  1Y8G A;  2Z4S A;  1NJF A;  1VEK A;  1V92 A;  1WIV A;  2K6B A;  1N36 M;  4LF5 M;  2KHH A;  1F4I A;  2M5Z A;  2B3T A;  1XXH E;  4QNR A;  2H5X A;  1L2D A;  2KW0 A;  3BOS A;  1ZMV A;  2W82 A;  3FRI A;  5FTK A;  5LMN M;  2O5R A;  1QAN A;  1IY1 A;  2MGW A;  2XH9 A;  4MGK E;  4QHS A;  1Z6T A;  8CAT A;  1QUS A;  2R4E A;  1IQP A;  3GLH B;  3HZJ A;  4FD2 A;  3KSJ A;  2JZ0 A;  1VQ1 A;  1UFZ A;  4MGZ E;  2JY8 A;  2QQ8 A;  4L4U A;  2DXI A;  3F92 A;  2LNH C;  1DGG A;  2KZU A;  5EXT A;  4CIS A;  3FTF A;  3IG5 A;  3LVV A;  3U5Z B;  1NO1 A;  3W0L B;  3KXE C;  2JY7 A;  4P16 A;  1JR3 A;  3HU1 A;  1W5S A;  4P17 A;  3LMM A;  4Z8X A;  4PDI A;  1QDT A;  4LFB M;  3IEC A;  3NBI A;  3T38 A;  3KOX E;  1N77 A;  2LHC A;  4GIP A;  2XSZ D;  3FTE A;  1G41 A;  5FTL A;  2UUC M;  3GLF A;  2HCB A;  4QOS A;  3U6O A;  1OFI A;  4G4R A;  2J7N A;  3FUW A;  1SXJ B;  4OU7 A;  1YE9 A;  3WHL A;  1EE8 A;  2DWM A;  1PRB A;  4DR5 M;  3D8B A;  5A2Q S;  4JI1 M;  4GC5 A;  4LCB A;  1IFY A;  3HJ8 A;  3VKH A;  3I01 M;  1R7R A;  4LJ4 A;  4JI5 M;  1FJG M;  3ZQJ A;  1H6U A;  1V33 A;  1VG5 A;  2EKK A;  5KQD A;  1OAI A;  4NRV A;  1I94 M;  3MHV C;  4G6Z A;  1IXR C;  3HJS A;  4GMQ A;  1PGY A;  2GQF A;  4FWG A;  1N34 M;  3GLG A;  1G4A E;  3GPX A;  2FOI C;  4WP2 A;  1N75 A;  2RGO A;  4AKI A;  1LTM A;  4DV1 M;  5ITY A;  3I04 M;  1K3X A;  1PM5 A;  2JUJ A;  3SMP A;  3E9S A;  4GHL A;  2XFT A;  1J09 A;  4KO8 A;  1YUB A;  3LW5 F;  2WZJ A;  1HQC A;  1RU3 A;  3TE6 A;  3U60 B;  2BJV A;  2G3Q A;  4XK8 F;  4GIT A;  4B3T M;  3ILK A;  5IWA M;  1IN8 A;  2X8A A;  3KOY E;  3TWL A;  3SMS A;  2LHG A;  1GO5 A;  2DZL A;  3VFD A;  3AV0 A;  1OTR A;  4LGM A;  3RE8 A;  1XHB A;  2YFQ A;  2XLJ A;  2UXD M;  3PNY A;  2DZN B;  3J7B A;  3GQ4 A;  3T1H M;  3GRV A;  3GPP A;  1BVS A;  5KQ8 A;  4NSO B;  4ANR A;  2EA0 A;  1JR3 E;  4PDG A;  3C9P A;  5FLX S;  4IBG A;  4DR7 M;  4GEW A;  2D7G A;  2EUC A;  1R2Y A;  4JV5 M;  1OIP A;  4YY3 M;  4F2L A;  2DAE A;  1MU5 A;  2VF8 A;  3AFH A;  5FSW A;  2DI0 A;  3B7N A;  2J5Y A;  3K9O A;  4AZF A;  1Q39 A;  1N32 M;  3GLF E;  4LRS A;  3BBZ A;  3HU2 A;  4KOD A;  4IBJ A;  3GO8 A;  2LVA A;  2G8L A;  3NBX X;  5JI2 E;  4L6V 6;  1TH4 A;  1Z5B A;  2HKJ A;  2J7O A;  2XEP A;  5KPR A;  1QVR A;  1V34 A;  4G4N A;  2A5Y B;  2DKL A;  2R62 A;  1R2Z A;  1IXS B;  2ZM6 M;  1GLN A;  2QP9 X;  2G5G X;  4FCW A;  3GLG E;  4D80 A;  1K82 A;  5KPT A;  3VLF B;  4DR3 M;  4DBG B;  1JR3 D;  2F4V M;  3AOE A;  4HEO A;  3SAT A;  4X62 M;  1GAB A;  3J81 S;  2DAG A;  3UZU A;  3TWK A;  4LF9 M;  1AIP C;  5IRE B;  2EKF A;  3KOZ E;  1ZV1 A;  1VEJ A;  2JWS A;  1HT1 E;  4AKG A;  1JB0 F;  3LQR A;  5DFL A;  4NC6 A;  2XF3 A;  4NOO B;  2ZTC A;  4FW9 A;  4G3O A;  3QAU A;  4NXM M;  2Q2E B;  3JR5 A;  3SAW A;  2ZAO A;  1I4W A;  1Q02 A;  3PFI A;  3VKG A;  1WGN A;  3VK8 A;  2DWN A;  3FUU A;  1GJS A;  3MMP A;  4PCZ A;  1SG9 A;  4X66 M;  2LXE A;  3B74 A;  3E46 A;  3HHZ A;  3A98 B;  2ZBK B;  5IT9 S;  2VII A;  2K47 A;  3GRY A;  2QEN A;  1WGL A;  2RKO A;  4AI6 A;  1GJT A;  3SYK A;  3CF6 E;  5EP4 A;  1PJI A;  3KOW E;  4IBF A;  2C9O A;  5DNY A;  4DV3 M;  1OFH A;  1LV7 A;  2CRU A;  2F5N A;  2DWZ B;  3HHW A;  5EXS A;  3EIE A;  2CP8 A;  2L6O A;  1ZQ9 A;  1QUT A;  2CFO A;  3J27 B;  4I81 A;  3SAV A;  5E6J A;  2CEA A;  4FWH A;  1TH3 A;  2HHH M;  2L4E A;  2GNO A;  4LFA M;  1K3W A;  2KRK A;  5FTJ A;  4IBD A;  1NNJ A;  3PVS A;  3GLI B;  3IHP A;  3QYE A;  2L09 A;  1OQY A;  3A42 A;  2R4J A;  4WUR A;  3TL4 X;  1ORY B;  2AHM A;  1E32 A;  2R46 A;  4DR4 M;  4NXN M;  1TDZ A;  1Z59 A;  3C58 A;  1WHC A;  1GKI A;  3HU3 A;  4B3S M;  2KDL A;  2DHR A;  2FS1 A;  1XNR M;  2M60 A;  2DHY A;  1DO2 A;  3GLH A;  4DR6 M;  4AG5 A;  1OKS A;  2CV1 A;  3KVW A;  1D0K A;  1YLA A;  2VQE M;  1E94 E;  2V1C A;  1D2N A;  1Q3B A;  2KXE A;  4DUZ M;  4RF1 A;  4UN2 B;  4Y28 F;  5FTN A;  2UUB M;  1JQJ C;  3U5Z A;  4AQY M;  1R5L A;  2OOB A;  3H4J A;  2KNZ A;  5DYI A;  2R44 A;  5GKN A;  3SAU A;  3RGP A;  1CUK A;  4KHP M;  3SAR A;  4LZJ A;  5ITQ A;  3GP1 A;  4MGI E;  2DEN A;  3HGI A;  3HKP A;  5EJC A;  2I7N A;  4IIW A;  4L16 A;  4L78 A;  3T1Y M;  2VDB B;  2DVW B;  3L25 A;  1KFV A;  1MX0 A;  2LTU A;  1Q3C A;  1SXJ A;  1TDH A;  2YR0 A;  2UXB M;  1E9S A;  4ZPX A;  3ZCB B;  5H37 D;  2F5P A;  4B7F A;  4OX9 M;  1NSF A;  3DZD A;  3FYD A;  5ITR A;  5EP3 A;  5ITT A;  2Z4R A;  4W5W A;  1DV0 A;  2LBC A;  1QYR A;  4RNA A;  4BB9 A;  4DV5 M;  2C9C A;  2ZAN A;  2I7P A;  1N78 A;  1XXH B;  4DUY M;  1QDR A;  2L7I A;  3AOE C;  4FWD A;  3SYL A;  4JI0 M;  1VDD A;  1DGB A;  3KP0 E;  3K2L A;  2JA2 A;  1S3S A;  3CF2 A;  1T6O A;  3K8Z A;  4LF6 M;  4I8O A;  1PJQ A;  2P5T A;  2QBY B;  2OQ4 A;  1C7Y A;  3V76 A;  3E21 A;  4LJ5 A;  4NL4 H;  4B3M M;  4LG2 A;  2C98 A;  1L2B A;  4F1I A;  3AKZ A;  2XZF A;  4LJ6 A;  1T3T A;  1DO0 A;  3U60 A;  1OIZ A;  3FUT A;  4CJ6 A;  4KLN A;  3D8L A;  1L1T A;  2EO2 A;  2LVQ D;  3T6P A;  4L8R C;  2X49 A;  4GRI A;  5LMU M;  2ZTD A;  3I4Y A;  1IN6 A;  3TPZ A;  1XWI A;  4LF7 M;  4G4Q A;  4LY6 A;  3GLH E;  3HWS A;  3HY5 A;  2KZS A;  3VK7 A;  1HJP A;  2BWB A;  3U61 B;  1TGU A;  3W0F A;  4LF4 M;  2E5L M;  1AUA A;  3JAM S;  3GQ5 A;  2HWJ A;  2MJ5 B;  2Y20 A;  5EQT A;  3U6Q A;  1HR0 M;  4M0D A;  4XBO A;  1EFU B;  1GL6 A;  4OVZ B;  3UK6 A;  1WR1 B;  3KP1 E;  4IJF A;  3UMM A;  1T43 A;  3K92 A;  4MGY E;  3FTC A;  2KNA A;  2FE8 A;  1XC8 A; 
#chains in the Genus database with same CATH homology
 3SHG B;  5BR8 M;  3UJN A;  5KPZ A;  4II7 A;  4LJ9 A;  4K0K M;  4TUW A;  3GRU A;  4LJA A;  3U6E A;  1NHG C;  3J80 S;  1G59 A;  1C1K A;  1L2C A;  1SXJ E;  2KRU A;  4QOZ C;  4M9S A;  5EP1 A;  3M6A A;  3MK6 A;  4S12 A;  2V6Z M;  2C99 A;  4CGY B;  1XMQ M;  2OPF A;  4EIW A;  1W5T A;  2C5R A;  4D81 A;  3RGS A;  4GHA A;  3PNV A;  2XFS A;  4BLC A;  3JR4 A;  4DV6 M;  2R45 A;  3PXG A;  3M0E A;  3M7G A;  1ZAE A;  3SBJ A;  4FCV A;  4Z6Y A;  1IM2 A;  3GPY A;  3GRR A;  2D7E A;  2DZO B;  4B3R M;  3KW6 A;  1HQY E;  5C18 A;  2R18 A;  1NNU C;  1QZM A;  1YSY A;  3FTD A;  3HJQ A;  2FNA A;  2UXC M;  3K1J A;  5JI3 E;  3SAS A;  5EXX A;  4GC9 A;  3L27 A;  4B7H A;  3CF0 A;  4R7G A;  3L29 A;  4AKH A;  4DV2 M;  1SXJ C;  4MH0 E;  4XGI A;  2F5S A;  1L8Q A;  4FVM A;  5FTM A;  1DGH A;  4M0W A;  4JI3 M;  2BNK A;  3GLF B;  3U6L A;  1IBM M;  5EXP A;  1IBK M;  2CE7 A;  1IBL M;  5DYG A;  4JI7 M;  2X4A A;  5KO3 A;  2XZU A;  2D7H A;  3J2P B;  3A45 A;  3I51 A;  2DWL A;  2C96 A;  4DV4 M;  4JYA M;  2CV2 A;  3THG A;  1IY2 A;  1IN7 A;  4JI8 M;  4LJ8 A;  4IJE A;  3GLG B;  3FUV A;  2CHV A;  2ZAM A;  4FCT A;  5ITX A;  2KA6 B;  1KSF X;  4A3V B;  4ITQ A;  2CV0 A;  2CHG A;  2CUZ A;  2UUA M;  3DOA A;  3EIH A;  3GLI A;  2Y0T A;  1OJL A;  1WXQ A;  3AJI B;  4OW0 A;  2RGH A;  3VDP A;  4LZZ A;  3KS4 A;  3HHY A;  1E9R A;  3CTW B;  4JI4 M;  3KS8 A;  5IZ7 D;  4X65 M;  3LQQ A;  5EP2 A;  2Y0Q A;  4LGY A;  2YNM D;  3FD9 A;  3R9X B;  3I4V A;  1QAO A;  4JXJ A;  4JI6 M;  1Z5C A;  4NSR A;  2QPA A;  1HNZ M;  4QNM A;  3HHX A;  4G4O A;  3R8F A;  1NJG A;  1IY0 A;  1IN5 A;  4L15 A;  3FKE A;  3LVW A;  3QWL A;  3U6C A;  1XMO M;  3UGJ A;  1HNW M;  3MJ5 A;  4MGH A;  4QHT A;  5E26 A;  1HT2 E;  1NY5 A;  1HNX M;  1XNQ M;  1IN4 A;  2YQZ A;  3U6P A;  4R3D A;  4HLQ A;  3OTO M;  2BJW A;  2F5Q A;  4MM3 B;  3FYC A;  4B08 A;  1NY6 A;  2ERC A;  5ITU A;  2Z3X A;  1GL7 A;  2XSZ A;  4AG6 A;  4GKK M;  4JI2 M;  1R6B X;  4LJ7 A;  3L26 A;  3ZH9 B;  4REZ A;  1KYI A;  1XXH A;  4RF0 A;  4LF8 M;  4IBC A;  4I4L A;  4PT5 A;  5BPV A;  1NHW C;  3RFW A;  4M9X A;  1GVN A;  4LFC M;  5C1B A;  4LRT A;  2FFJ A;  2LWX A;  4GKJ M;  5ITX E;  2CHQ A;  3IG8 A;  3J7A S;  4IBI A;  1Z5A A;  1J5E M;  2QBY A;  3A46 A;  3KSX A;  4BBA A;  1N33 M;  3TQS A;  1PJJ A;  1UM8 A;  1TH2 A;  2Y21 A;  4IBK A;  4MB7 A;  3U6D A;  3U6M A;  4JN6 A;  2QZ4 A;  1DGF A;  3Q8X A;  4B7G A;  1IXZ A;  3KDS E;  3H4M A;  3AL0 C;  4DV0 M;  2Z7J A;  4NRW A;  3U61 A;  1X37 A;  3VDU A;  4D82 A;  4WW0 A;  4AW4 A;  4DR2 M;  4DV7 M;  2KEB A;  3B9P A;  3FUX A;  3SFZ A;  2VQF M;  3DFZ A;  2QCU A;  4OVZ A;  1QAQ A;  3WHK A;  5F3W A;  1L1Z A;  2V1U A;  1J7K A;  7CAT A;  1NVM A;  3SC3 A;  2UU9 M;  1G8P A;  1QAM A;  4I5S A;  4CHT B;  3AOG A;  2HL7 A;  1G3I A;  2L7H A;  3E4R A;  2LH0 A;  4HL4 A;  2H1R A;  4IBB A;  4YHH M;  3KFU G;  3TWM A;  2NQ8 C;  4DR1 M;  2XGN A;  4X64 M;  2R65 A;  1QQW A;  3DA1 A;  3L28 A;  3L2A A;  4GH9 A;  3SHF A;  1FNN A;  3T15 A;  3U6S A;  4M9Z A;  4IBE A;  3NWL A;  3GPU A;  4PD2 A;  1DGH B;  3ZC7 B;  3GQ3 A;  1SXJ D;  2Z4S A;  1NJF A;  1N36 M;  4LF5 M;  2M5Z A;  4QNR A;  1L2D A;  2KW0 A;  3BOS A;  2W82 A;  5FTK A;  5LMN M;  2O5R A;  1QAN A;  1IY1 A;  4MGK E;  2XH9 A;  4QHS A;  1Z6T A;  8CAT A;  2R4E A;  1IQP A;  3GLH B;  4FD2 A;  3KSJ A;  4MGZ E;  4L4U A;  3FTF A;  2DXI A;  5EXT A;  2LNH C;  1DGG A;  2KZU A;  4CIS A;  3IG5 A;  3LVV A;  3U5Z B;  3W0L B;  3KXE C;  4P16 A;  1JR3 A;  3HU1 A;  1W5S A;  3LMM A;  4Z8X A;  4PDI A;  4LFB M;  3NBI A;  3T38 A;  3KOX E;  1N77 A;  4GIP A;  2XSZ D;  3FTE A;  1G41 A;  5FTL A;  2UUC M;  3GLF A;  2HCB A;  4QOS A;  3U6O A;  1OFI A;  4G4R A;  2J7N A;  3FUW A;  1SXJ B;  4OU7 A;  1YE9 A;  3WHL A;  1EE8 A;  2DWM A;  4DR5 M;  3D8B A;  5A2Q S;  4JI1 M;  4GC5 A;  4LCB A;  3VKH A;  3HJ8 A;  1R7R A;  4LJ4 A;  4JI5 M;  1FJG M;  1H6U A;  5KQD A;  4NRV A;  1I94 M;  3MHV C;  4G6Z A;  1IXR C;  3HJS A;  4GMQ A;  4FWG A;  1N34 M;  3GLG A;  1G4A E;  3GPX A;  2FOI C;  4AKI A;  1N75 A;  2RGO A;  4DV1 M;  5ITY A;  1K3X A;  1PM5 A;  3SMP A;  4GHL A;  3E9S A;  2XFT A;  1J09 A;  4KO8 A;  1YUB A;  1HQC A;  3TE6 A;  3U60 B;  2BJV A;  4GIT A;  4B3T M;  3ILK A;  5IWA M;  1IN8 A;  2X8A A;  3KOY E;  3TWL A;  3SMS A;  3VFD A;  3AV0 A;  4LGM A;  3RE8 A;  1XHB A;  2YFQ A;  2XLJ A;  2UXD M;  3PNY A;  2DZN B;  3J7B A;  3GQ4 A;  3T1H M;  3GRV A;  3GPP A;  5KQ8 A;  4NSO B;  2EA0 A;  4PDG A;  5FLX S;  4IBG A;  4DR7 M;  2D7G A;  2EUC A;  1R2Y A;  4JV5 M;  4YY3 M;  1MU5 A;  3AFH A;  5FSW A;  4AZF A;  1Q39 A;  1N32 M;  4LRS A;  3HU2 A;  4KOD A;  4IBJ A;  3GO8 A;  2G8L A;  5JI2 E;  1TH4 A;  1Z5B A;  2HKJ A;  2J7O A;  2XEP A;  5KPR A;  1QVR A;  4G4N A;  2A5Y B;  2R62 A;  1R2Z A;  1IXS B;  2ZM6 M;  1GLN A;  2QP9 X;  2G5G X;  4FCW A;  4D80 A;  1K82 A;  5KPT A;  3VLF B;  4DR3 M;  1JR3 D;  2F4V M;  3AOE A;  3SAT A;  4X62 M;  3J81 S;  3UZU A;  3TWK A;  4LF9 M;  5IRE B;  3KOZ E;  1HT1 E;  4AKG A;  3LQR A;  2XF3 A;  4NOO B;  4FW9 A;  3QAU A;  4NXM M;  2Q2E B;  3JR5 A;  3SAW A;  2ZAO A;  1I4W A;  3PFI A;  3VKG A;  3VK8 A;  2DWN A;  3FUU A;  4PCZ A;  4X66 M;  2LXE A;  3HHZ A;  3A98 B;  2ZBK B;  5IT9 S;  2VII A;  2K47 A;  3GRY A;  2QEN A;  2RKO A;  4AI6 A;  3SYK A;  1PJI A;  3CF6 E;  5EP4 A;  2F5O A;  3KOW E;  4IBF A;  2C9O A;  5DNY A;  4DV3 M;  1OFH A;  1LV7 A;  2F5N A;  2DWZ B;  3HHW A;  5EXS A;  3EIE A;  2L6O A;  1ZQ9 A;  2CFO A;  3J27 B;  4I81 A;  3SAV A;  5E6J A;  2CEA A;  4FWH A;  1TH3 A;  2HHH M;  4LFA M;  1K3W A;  2KRK A;  5FTJ A;  4IBD A;  1NNJ A;  3PVS A;  3GLI B;  2L09 A;  3A42 A;  2R4J A;  4WUR A;  3TL4 X;  1ORY B;  2AHM A;  1E32 A;  2R46 A;  4DR4 M;  4NXN M;  1TDZ A;  1Z59 A;  3C58 A;  1GKI A;  3HU3 A;  4B3S M;  2DHR A;  1XNR M;  2M60 A;  1DO2 A;  3GLH A;  4DR6 M;  4AG5 A;  2CV1 A;  3KVW A;  2VQE M;  1E94 E;  2V1C A;  1D2N A;  1Q3B A;  2KXE A;  4DUZ M;  4RF1 A;  5FTN A;  2UUB M;  1JQJ C;  3U5Z A;  4AQY M;  5DYI A;  5GKN A;  3SAU A;  3RGP A;  4KHP M;  3SAR A;  4LZJ A;  5ITQ A;  3GP1 A;  4MGI E;  3HKP A;  3HGI A;  2I7N A;  4IIW A;  4L16 A;  4L78 A;  3T1Y M;  3L25 A;  2DVW B;  1KFV A;  1MX0 A;  2UXB M;  1Q3C A;  1SXJ A;  1TDH A;  2YR0 A;  1E9S A;  4ZPX A;  3ZCB B;  5H37 D;  2F5P A;  4B7F A;  4OX9 M;  1NSF A;  3FYD A;  3DZD A;  5ITR A;  5EP3 A;  5ITT A;  2Z4R A;  4W5W A;  1QYR A;  4RNA A;  4BB9 A;  4DV5 M;  2C9C A;  2ZAN A;  2I7P A;  1N78 A;  1XXH B;  4DUY M;  2L7I A;  3AOE C;  4FWD A;  3SYL A;  4JI0 M;  1VDD A;  1DGB A;  3KP0 E;  3K2L A;  2JA2 A;  1S3S A;  3CF2 A;  3K8Z A;  4LF6 M;  4I8O A;  2P5T A;  2QBY B;  2OQ4 A;  4LG2 A;  4LJ5 A;  4NL4 H;  4B3M M;  2C98 A;  1L2B A;  3AKZ A;  2XZF A;  4LJ6 A;  1T3T A;  1DO0 A;  3U60 A;  3FUT A;  4KLN A;  3D8L A;  1L1T A;  2EO2 A;  4L8R C;  2X49 A;  4GRI A;  5LMU M;  3I4Y A;  1IN6 A;  3TPZ A;  1XWI A;  4LF7 M;  4G4Q A;  4LY6 A;  3HWS A;  2KZS A;  3VK7 A;  3U61 B;  1TGU A;  3W0F A;  4LF4 M;  2E5L M;  3JAM S;  3GQ5 A;  3U6Q A;  2Y20 A;  5EQT A;  1HR0 M;  4M0D A;  4XBO A;  1GL6 A;  4OVZ B;  3UK6 A;  3KP1 E;  4IJF A;  3UMM A;  3K92 A;  4MGY E;  3FTC A;  5EJC A;  2FE8 A;  1XC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...