4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
4LJ7A 3WHKA 3VFDA 4JN6A 1IXZA 2QBYA 2CHQA 1J7KA 1W5SA 3R8FA 3GLGA 1E32A 1SXJD 1SXJC 2CHVA 1IN6A 4QNMA 1OFIA 4ZPXA 3UK6A 3KDSE 2DHRA 3SYLA 3PVSA 1IN8A 4LJ8A 2KRKA 1C1KA 1SXJE 2DZOB 2ZAMA 4FCWA 5FTNA 1UM8A 3GLGB 1LV7A 5C1BA 1IN7A 4GITA 2C9OA 1R6BX 1D2NA 1NSFA 2CE7A 1IXRC 5FTJA 1FNNA 5FTKA 3PFIA 5C18A 1E94E 1R7RA 2ZANA 1KYIA 3WHLA 1NY6A 4QHTA 5EP2A 4FWHA 4D81A 3U61B 1XXHB 4FD2A 1NJGA 1L8QA 5JI3E 4D82A 4D80A 4L15A 3EIHA 2C98A 1KSFX 2RKOA 3K1JA 2DVWB 4LZZA 4KO8A 1S3SA 2X8AA 3PXGA 3VLFB 3GLHA 4EIWA 4LGMA 4Z8XA 1XXHA 2DZNB 4WW0A 1XWIA 4KODA 5EP1A 4L4UA 2BJWA 2Z4SA 3M6AA 3H4MA 1IY0A 4LY6A 1SXJA 4LRSA 4LJ9A 3U5ZB 2V1UA 4LCBA 1IN5A 1JR3D 1HT1E 4LJ6A 3CF2A 5DYGA 3GLFB 3SYKA 1OJLA 4FCVA 1X37A 4LJ4A 3U60B 4FWDA 2QENA 2R65A 1SXJB 4QHSA 5EP3A 5EXTA 3HU3A 5JI2E 3B9PA 4LRTA 3GLFA 3DZDA 1NY5A 4FW9A 3CF0A 5EXXA 1W5TA 3MHVC 4I4LA 3HU2A 1G4AE 2VIIA 2QBYB 3SC3A 2BJVA 5EXSA 4FWGA 3GLHB 1HQYE 1G41A 2XSZD 2QP9X 1IQPA 2DWZB 1G3IA 2C99A 1JQJC 1QZMA 1DO0A 5EQTA 2QZ4A 1QVRA 1OFHA 1HT2E 4QNRA 3GLIB 3AJIB 2C96A 3HWSA 3KW6A 3D8BA 1IY1A 4I81A 2Z4RA 4FCTA 2V6ZM 3BOSA 1NJFA 5FTMA 4L16A 5EP4A 5FTLA 1HQCA 5DYIA 2QPAA 2R62A 1IY2A 1IM2A 3GLIA 4KLNA 3ZH9B 2FNAA 5EXPA 1IXSB 1DO2A 3EIEA 3M0EA 3HU1A 2ZAOA 4A3VB 4LJ5A 2HCBA 4LJAA 1NVMA 4QOSA 1JR3A 2CHGA 2C9CA 2CEAA 2XSZA 1IN4A
chains in the Genus database with same CATH superfamily
4OU7A 1Z59A 4LJ7A 1IXSA 1IXZA 1LTMA 3FTCA 4M0DA 3R8FA 2CHQA 4GC5A 2F5OA 1MX0A 3E9SA 4IJFA 3RGSA 3TPZA 3GLGA 1E32A 2CHVA 1OTRA 2WZJA 3TQSA 3T1HM 3I51A 5F3WA 4L8RC 4DR7M 4GKKM 5FLXS 3VKHA 4ZPXA 3KDSE 3KFUG 3QYBA 3SYLA 2RRUA 1OIZA 5L8RF 2DWNA 2DZOB 4G4QA 3U6PA 1TH2A 1KFVA 4JV5M 1NNJA 3I4YA 3GLGB 1LV7A 5C1BA 4GITA 2C9OA 3FUWA 3KS4A 3D8LA 3U6SA 1OQYA 1NSFA 1MJGM 1IFYA 3KOWE 2OOAA 1FNNA 1R7RA 4F1IA 1Z5CA 1VEJA 1PM5A 3KP1E 2X49A 2L7IA 3UJNA 4PT5A 1TH3A 1NV9A 3HHZA 1DGBA 4LF6M 3KVWA 4XGIA 5KPRA 4MGZE 2CV2A 2JXNA 4L15A 1Q3CA 2V1CA 2C98A 3SHFA 2RKOA 5IZ7D 2DVWB 8CATA 4LZZA 1PJSA 1WGLA 1S3SA 2H5XA 3LVWA 2QHOB 3GLHA 4JI6M 3U61A 1NO1A 2VDBB 1PJIA 1QYRA 4B3TM 2DZNB 4GHLA 1DGHA 3GLHE 4KODA 3A46A 1TF0B 4G4NA 5EP1A 2OQ4A 2CUZA 3SMPA 2BJWA 1IBMM 1WGNA 1PJTA 1QUTA 5EJCA 3NWLA 3H4MA 3GPUA 1QUSA 2LVNC 4LJ9A 2R0IA 2AHMA 4R71A 3FE3A 4XBOA 1HT1E 4BLCA 1TDHA 3NBXX 5ITTA 4DV5M 2J5YA 3L29A 4LF7M 3CF2A 1Q02A 2YFQA 3GLFB 4K0KM 2UXBM 3C3DA 2EO2A 3B7QA 4FCVA 2FFJA 1E9SA 1X37A 1DV0A 4LJ4A 4AG5A 3THGA 4FWDA 2QENA 1WHCA 3L2AA 5EP3A 3GQ4A 4LZJA 1L1ZA 3T1YM 3HU3A 2HL7A 4IBJA 3JR4A 1ZMWA 2G5GX 2KDLA 3GLFA 3SFZA 4MB7A 3CF0A 1W5TA 5KQDA 4REZA 3SMSA 3T6PA 3SAVA 3JAMS 4OVZB 2M60A 2F5PA 2FH0A 2BJVA 2ZBKB 2KNZA 2BNKA 4FWGA 5EXSA 2R46A 1G41A 2QP9X 3FUXA 3UZUA 2ZM6M 1JQJC 2BWEA 3SARA 1DO0A 3MMPA 1QVRA 1L2CA 1HT2E 3GLIB 4TUWA 4M9SA 2C96A 3HWSA 4RKUF 3Q8GA 1HNXM 3SAUA 4FVMA 3SATA 1D0LA 2O25A 4ANRA 4PD2A 3SBJA 2DHYA 3IECA 2CRUA 1CUKA 1TGUA 1IM2A 3GLIA 4AI6A 4YY3M 2FNAA 1TH4A 3W68A 4LF5M 2BWBA 3B89A 3C3EA 2UXDM 4I8OA 1QDRA 2CEAA 3TWMA 1R2ZA 1XC8A 4DUZM 2R6FA 4WP2A 4P16A 2MGWA 4JI1M 3GQ3A 3HHYA 2QBYA 1N78A 2JY7A 2W82A 3QAUA 1J7KA 1HJPA 2Y20A 3HHWA 1G59A 2Z8YM 1XNQM 4MGIE 3GRUA 1JB0F 4CGYB 2DHRA 2K0BX 2EUCA 4NXNM 3PVSA 1HNWM 2Z3XA 2APLA 3IG8A 1NV8A 4M9XA 1C1KA 4FCWA 2DAKA 3E4RA 4IBGA 3F92A 4R3DA 4RF0A 5FTNA 3TE6A 4NRVA 2LHCA 3V76A 5H37D 4QOZC 2C5RA 2FOIC 2LVOC 1AUAA 1XXHE 1IXRC 2WSFF 3PFIA 3K9OA 3WHLA 2GNOA 3CGWA 3DFZA 4DV4M 4D81A 2XEPA 4FD2A 4Q7JA 1N32M 1L8QA 2DI0A 4D82A 2L6OA 1WR1B 3AOGA 1EFUB 2XZFA 3K1JA 3QWLA 3PNVA 3W0FA 2UUCM 4KO8A 2X8AA 1ZV1A 2L4EA 2M5ZA 3I04M 3VLFB 1OIPA 1Z5BA 2JP7A 4Z8XA 3LMMA 1QDTA 4WW0A 2F5SA 4LG2A 5ITQA 3KOYE 2MROB 3NBIA 2CV1A 2DXIA 3KSJA 3R9XB 3L25A 1K82A 1A5TA 4MGHA 2UXCM 1SXJA 2RGHA 5A2QS 2DWLA 2K6BA 4LJ6A 3TL4X 4NL4H 3L26A 4JXJA 5DYGA 5KQ8A 3HHXA 3HJQA 5ITRA 2L4FA 2LBCA 2Y0TA 3SYKA 3FTEA 3U6CA 3LQQA 5E26A 4IBFA 4NC6A 3KOXE 4I5SA 4DR6M 3J27B 2LVQD 4LF9M 4G3OA 2KHHA 3U6MA 1Z5AA 5ITXE 4B08A 3H4JA 1TTEA 1DGFA 4GMQA 2JZ1A 1NY5A 2D7HA 2HKJA 1D0MA 5EXXA 5DFLA 2EKFA 2QNJA 3K2LA 1QAOA 3AV0A 3W0LB 2L09A 2Y21A 2MH8A 1I94M 1G4AE 3A42A 1VDDA 2X4AA 2ZTCA 2N35A 4DUYM 3FUVA 2H1RA 4HEOA 1GJSA 1R5LA 4DV6M 1G8PA 4MGKE 4KHPM 5EQTA 1OFHA 2Z7JA 4DBGB 4P17A 3KW6A 4OW0A 1IY1A 1NHWC 2R44A 3GPXA 4GHAA 3BOSA 3E21A 2QSFX 3AOEA 5FTLA 1WIVA 3BBZA 1L2DA 5DYIA 3J7AS 3ZH9B 2LWXA 2JY5A 1GL6A 3HZJA 5IWAM 1EIJA 1R2YA 1DO2A 1WJ7A 3HU1A 2ZAOA 2DAIA 3MK6A 2J7OA 1I4WA 2GQFA 3GRRA 2FE8A 3B7NA 1JR3A 2CHGA 4IIWA 1T6OA 2LNHC 2A5YB 3GPYA 4IBEA 4KT0F 3SHGB 3C58A 4JYAM 1N75A 4B3SM 4X64M 1SXJD 1GLNA 1SXJC 2CP8A 3GRYA 4QNMA 3CTWB 1NNUC 2B3TA 3I4VA 1NHGC 5KO3A 4LGYA 3LW5F 3LQRA 2FS1A 2R45A 3FUTA 1GJTA 4NSOB 2HHHM 1IBKM 1ORYB 1UM8A 4DR5M 4PCZA 3FUUA 3C9PA 4IJEA 4MH0E 1IN7A 5ITYA 2D7EA 1J09A 1R6BX 3SAWA 3VK8A 3U60A 3AFHA 5C18A 1E94E 2LXEA 1VEGA 1Z6TA 1KYIA 4MGYE 5EP2A 1HR0M 2KRUA 4M0WA 2I7NA 2VQFM 5JI3E 4DR4M 2XH9A 3RE8A 2EKKA 4JI0M 1PRBA 3EIHA 4AKGA 4LF4M 2QCUA 4Z6YA 4JI7M 2MR9A 3LCVB 4GRIA 4IBDA 2K9DA 2JA2A 2DNAA 4GC9A 5GKNA 3T38A 3PXGA 4CHTB 2KNVA 4II7A 4WURA 4LGMA 2YQZA 3L28A 4AKIA 2EA0A 4L6V6 1QZEA 2Z4SA 4B3RM 3T15A 2LVAA 1IY0A 4X65M 4OX9M 2J7NA 4LRSA 3W67A 3GQ5A 2V1UA 4LCBA 2KA6B 2NQ8C 1T43A 2R18A 2R4EA 4CIZA 1EE8A 1GL7A 2LVPC 3DA1A 2DZLA 3GPPA 1ZMUA 3SASA 1OJLA 2XGNA 1YE9A 2KW0A 3K9PA 5BR8M 3TWLA 4DR3M 1UFZA 1SXJB 2E5LM 3J2PB 2KNAA 2R4JA 4UN2B 3VDUA 1V34A 5JI2E 2KZSA 3B9PA 4LRTA 3GRVA 2JZ0A 4NXMM 3AOEC 3DZDA 1RU3A 1Y8GA 4ITQA 2KZUA 5IREB 2ERCA 4JI8M 3MHVC 1V33A 4I4LA 3HU2A 5KPTA 3VKGA 2VIIA 2QBYB 1AIPC 4B7HA 3GLHB 1HQYE 1R4GA 3GLGE 3HX3A 2XSZD 3A98B 5KPZA 2L2DA 1IQPA 1DGHB 2DWZB 4DV7M 2C99A 3U6QA 4HL4A 1GKIA 3JR5A 1QZMA 3FYDA 2CV0A 2QZ4A 4QNRA 1XMOM 3LVVA 3KSXA 3AJIB 3OTOM 2P5TA 4DV3M 1JR3E 4PDIA 4L78A 2JUJA 3D8BA 2Y0QA 2Z4RA 1T3TA 4LFAM 1PGYA 1QANA 4L16A 3FD9A 1HQCA 4RF1A 2CWBA 1IY2A 1VG5A 4GKJM 1VQ1A 3HJSA 4KLNA 2CFOA 4IBKA 5EXPA 4JI3M 4IBCA 4AQYM 3EIEA 3M0EA 2HWJA 2K47A 3UGJA 2VQEM 4A3VB 2F5NA 2ZTDA 2RGOA 2XFSA 3U6LA 3IG5A 3U60B 2F4VM 3HKPA 5BPVA 1GABA 1NVMA 1K3XA 4BB9A 3B7ZA 3KXEC 1OAIA 2QQ8A 2R62A 1HNZM 5ITXA 1J5EM 4NRWA 1XMQM 2JWSA 4MM3B 5ITUA 2DAGA 4NSRA 3WHKA 2XF3A 4JN6A 2LH0A 4RNAA 4IBIA 3VFDA 4IBBA 1W5SA 1IN6A 3B74A 4CISA 1SG9A 3HY5A 2OPFA 1OFIA 1N33M 4GH9A 3UK6A 3E46A 2WSCF 3L27A 1WXQA 1IN8A 2D7GA 2KRKA 1SXJE 4LJ8A 3J81S 2ZAMA 1F4IA 4X62M 1XB2B 2OOBA 4M9ZA 4B7FA 4AKHA 4R7GA 4X66M 2O01F 2UUAM 2XZUA 4DV1M 3FYCA 3DOAA 1TDZA 4GEWA 2OO9A 1D2NA 4PDGA 2CE7A 1PJQA 4YHHM 2HAKA 5FTJA 3HGIA 5FTKA 3A45A 1P3QQ 4JI4M 1GO5A 2ZANA 2O5RA 1NY6A 4QHTA 4W5WA 4FWHA 1QAQA 3U61B 1XXHB 3KP0E 1NJGA 1V92A 3ILKA 3M7GA 4LFBM 4D80A 2YR0A 1L2BA 2WSEF 1KSFX 2XLJA 3FTDA 4OVZA 5LMUM 1GVNA 3U5ZA 3FRHA 2DWMA 4EIWA 4GIPA 4LFCM 4AG6A 3J7BA 1OKSA 1XXHA 1XWIA 1N77A 1N36M 1IBLM 4XK8F 4L4UA 1QQWA 2DENA 3M6AA 1YUBA 4B7GA 1C7YA 4LY6A 1H6UA 3U5ZB 2JNHA 3U6EA 1IN5A 2DAEA 1JR3D 2DKLA 3QYEA 4G4OA 4DR1M 3AL0C 1VEKA 2MJ5B 2EJSA 4LF8M 2XFTA 1E9RA 2Q2EB 2DAMA 3VK7A 2UUBM 2G8LA 2R65A 4QHSA 5EXTA 1XNRM 1DGGA 2F5QA 1K3WA 1QAMA 4DV0M 1MU5A 3IHPA 4FW9A 3VDPA 3ZQJA 1ZAEA 4S12A 1G71A 4B3MM 2I7PA 1FJGM 3SC3A 3GLIE 4AZFA 4CJ6A 3UMMA 4HLQA 3U6DA 2JY8A 4G4RA 2UU9M 1TR8A 1G3IA 7CATA 4DR2M 3ZCBB 2LTUA 5E6JA 4JI2M 5LMNM 3GO8A 3K92A 4Y28F 3BXWA 1Q3BA 2YNMD 1MN3A 3Q8XA 4G6ZA 3RGPA 3ZC7B 3RFWA 4I81A 5FSWA 1ZMVA 4FCTA 5DNYA 2V6ZM 2VF8A 5FTMA 1NJFA 3MJ5A 1OAOC 3FKEA 3KOZE 3CF6E 4NOOB 3GP1A 1PJJA 1YSYA 5EP4A 1N34M 3FTFA 1VDLA 2LHGA 3J80S 3I01M 2QPAA 2JY6B 1ZQ9A 4BBAA 3U6OA 1XHBA 2G3QA 1YLAA 1D0KA 1IXSB 2L7HA 3LCUA 1L1TA 4F2LA 5IT9S 1BVSA 2KEBA 2VF7A 2HCBA 3HJ8A 4LJ5A 4LJAA 3AKZA 4JI5M 1Q39A 4QOSA 3GLFE 3FRIA 4DV2M 4AW4A 3K8ZA 2C9CA 2KXEA 3TWKA 3KS8A 2XSZA 1IN4A 3PNYA
chains in the Genus database with same CATH topology
4OU7A 1Z59A 4LJ7A 3FTCA 1IXZA 4M0DA 2CHQA 4GC5A 2F5OA 1MX0A 3E9SA 4IJFA 3RGSA 3TPZA 3GLGA 1E32A 2CHVA 3TQSA 3T1HM 3R8FA 4GKKM 3I51A 5F3WA 4L8RC 4DR7M 3VKHA 5FLXS 4ZPXA 3KDSE 3KFUG 3SYLA 2DWNA 2DZOB 4G4QA 3U6PA 1TH2A 1KFVA 4JV5M 1NNJA 3I4YA 3GLGB 1LV7A 5C1BA 4GITA 2C9OA 3FUWA 3KS4A 3D8LA 3U6SA 1NSFA 3KOWE 1FNNA 1R7RA 1Z5CA 1PM5A 3KP1E 2X49A 2L7IA 3UJNA 4PT5A 1TH3A 3HHZA 1DGBA 4LF6M 3KVWA 4XGIA 5KPRA 4MGZE 2CV2A 4L15A 1Q3CA 2V1CA 2C98A 3SHFA 2RKOA 5IZ7D 2DVWB 8CATA 4LZZA 1S3SA 3LVWA 3GLHA 4JI6M 3U61A 1PJIA 4GHLA 1QYRA 4B3TM 2DZNB 1DGHA 4KODA 3A46A 4G4NA 5EP1A 2OQ4A 2CUZA 3SMPA 2BJWA 1IBMM 5EJCA 3NWLA 3H4MA 3GPUA 4LJ9A 2AHMA 4XBOA 1HT1E 4BLCA 1TDHA 5ITTA 4LF7M 4DV5M 3L29A 4K0KM 3CF2A 2YFQA 2UXBM 3GLFB 2EO2A 4FCVA 2FFJA 1E9SA 1X37A 4LJ4A 4AG5A 3THGA 4FWDA 2QENA 3GQ4A 3L2AA 5EP3A 3U60B 4LZJA 1L1ZA 3T1YM 3HU3A 2HL7A 4IBJA 3JR4A 2G5GX 3GLFA 3SFZA 4MB7A 3CF0A 1W5TA 5KQDA 4REZA 3SMSA 3SAVA 3JAMS 4OVZB 2M60A 2F5PA 2BJVA 2ZBKB 2BNKA 4FWGA 5EXSA 2R46A 1G41A 2QP9X 3FUXA 3UZUA 2ZM6M 1JQJC 3SARA 1DO0A 1L2CA 1QVRA 1HT2E 3GLIB 4TUWA 4M9SA 2C96A 3HWSA 1HNXM 3SAUA 4FVMA 3SATA 3SBJA 4PD2A 1TGUA 1IM2A 3GLIA 4AI6A 4YY3M 2FNAA 1TH4A 4LF5M 2UXDM 4I8OA 2CEAA 3TWMA 1R2ZA 1XC8A 4DUZM 4P16A 4JI1M 3GQ3A 3HHYA 2QBYA 1N78A 2W82A 3QAUA 1J7KA 2Y20A 3HHWA 1G59A 1XNQM 4MGIE 3GRUA 4CGYB 2DHRA 2EUCA 4NXNM 3PVSA 1HNWM 2Z3XA 3IG8A 4M9XA 1C1KA 4FCWA 3E4RA 4IBGA 5FTNA 4R3DA 4RF0A 3TE6A 4NRVA 5H37D 4QOZC 2C5RA 2FOIC 1IXRC 3PFIA 3WHLA 4DV4M 3DFZA 4D81A 2XEPA 4FD2A 1N32M 1L8QA 4D82A 2L6OA 3AOGA 2XZFA 3K1JA 3QWLA 3PNVA 3W0FA 2UUCM 4KO8A 2X8AA 3VLFB 2M5ZA 1Z5BA 4Z8XA 3LMMA 2F5SA 4WW0A 4LG2A 5ITQA 3KOYE 3NBIA 2CV1A 2DXIA 3KSJA 3R9XB 3L25A 1K82A 4MGHA 2UXCM 1SXJA 2RGHA 5A2QS 2DWLA 3TL4X 4LJ6A 4NL4H 3L26A 4JXJA 5DYGA 5KQ8A 3HHXA 3HJQA 5ITRA 3FTEA 2Y0TA 3SYKA 3U6CA 3LQQA 5E26A 4IBFA 3KOXE 4I5SA 4DR6M 3J27B 4LF9M 3U6MA 1Z5AA 5ITXE 4B08A 1DGFA 4GMQA 1NY5A 2D7HA 2HKJA 5EXXA 3K2LA 1QAOA 3AV0A 3W0LB 2L09A 2Y21A 1I94M 1G4AE 3A42A 1VDDA 2X4AA 4DUYM 3FUVA 2H1RA 4DV6M 1G8PA 4MGKE 4KHPM 5EQTA 1OFHA 2Z7JA 3KW6A 4OW0A 1IY1A 1NHWC 4GHAA 3GPXA 3BOSA 3AOEA 5FTLA 1L2DA 5DYIA 3J7AS 3ZH9B 2LWXA 1GL6A 5IWAM 1R2YA 1DO2A 3HU1A 2ZAOA 3MK6A 2J7OA 1I4WA 3GRRA 2FE8A 1JR3A 2CHGA 4IIWA 2LNHC 2A5YB 3GPYA 4IBEA 3SHGB 3C58A 4JYAM 1N75A 4B3SM 4X64M 1SXJD 1GLNA 1SXJC 3GRYA 4QNMA 3CTWB 1NNUC 3I4VA 1NHGC 5KO3A 4LGYA 3LQRA 2R45A 4NSOB 3FUTA 2HHHM 1IBKM 1ORYB 1UM8A 4DR5M 4PCZA 3FUUA 4IJEA 4MH0E 1IN7A 5ITYA 2D7EA 1J09A 1R6BX 3SAWA 3VK8A 3U60A 3AFHA 5C18A 1E94E 2LXEA 1Z6TA 1KYIA 4MGYE 5EP2A 1HR0M 2KRUA 4M0WA 2I7NA 2VQFM 5JI3E 4DR4M 2XH9A 3RE8A 4JI0M 3EIHA 4AKGA 4LF4M 2QCUA 4Z6YA 4JI7M 4GRIA 4IBDA 2JA2A 4GC9A 5GKNA 3T38A 3PXGA 4CHTB 4II7A 4WURA 4LGMA 2YQZA 3L28A 4AKIA 2EA0A 2Z4SA 4B3RM 3T15A 1IY0A 4X65M 4OX9M 2J7NA 4LRSA 3GQ5A 2V1UA 4LCBA 2KA6B 2NQ8C 2R18A 2R4EA 1EE8A 1GL7A 3DA1A 3GPPA 3SASA 1OJLA 2XGNA 1YE9A 2KW0A 5BR8M 3TWLA 4DR3M 1SXJB 2E5LM 3J2PB 2R4JA 3VDUA 5JI2E 2KZSA 3B9PA 4LRTA 3GRVA 4NXMM 3AOEC 3DZDA 4ITQA 2KZUA 5IREB 2ERCA 4JI8M 3MHVC 4I4LA 3HU2A 5KPTA 3VKGA 2VIIA 2QBYB 4B7HA 3GLHB 1HQYE 5KPZA 2XSZD 3A98B 4DV7M 1IQPA 1DGHB 2DWZB 2C99A 3U6QA 4HL4A 1GKIA 3JR5A 1QZMA 3FYDA 2CV0A 2QZ4A 4QNRA 1XMOM 3LVVA 3KSXA 3AJIB 3OTOM 2P5TA 4DV3M 4PDIA 4L78A 3D8BA 2Y0QA 2Z4RA 1T3TA 4LFAM 1QANA 4L16A 3FD9A 1HQCA 4RF1A 1IY2A 4GKJM 4KLNA 3HJSA 2CFOA 4IBKA 5EXPA 4JI3M 4IBCA 4AQYM 3EIEA 3M0EA 3UGJA 2K47A 2VQEM 2F5NA 4A3VB 2RGOA 2XFSA 3U6LA 3IG5A 2F4VM 3HKPA 5BPVA 1NVMA 1K3XA 4BB9A 3KXEC 2R62A 1HNZM 5ITXA 1J5EM 4NRWA 1XMQM 4MM3B 5ITUA 4NSRA 3WHKA 2XF3A 4JN6A 2LH0A 4RNAA 4IBIA 3VFDA 4IBBA 1W5SA 1IN6A 4CISA 2OPFA 1OFIA 1N33M 4GH9A 3UK6A 3L27A 1WXQA 1IN8A 2D7GA 2KRKA 1SXJE 4LJ8A 3J81S 2ZAMA 4X62M 4M9ZA 4B7FA 4AKHA 4R7GA 4X66M 2UUAM 2XZUA 4DV1M 3FYCA 3DOAA 1TDZA 4PDGA 1D2NA 2CE7A 4YHHM 5FTJA 3HGIA 5FTKA 3A45A 4JI4M 2ZANA 2O5RA 1NY6A 4QHTA 4W5WA 4FWHA 1QAQA 3U61B 1XXHB 3KP0E 1NJGA 4LFBM 3ILKA 3M7GA 4D80A 2YR0A 1L2BA 1KSFX 2XLJA 3FTDA 4OVZA 5LMUM 1GVNA 3U5ZA 2DWMA 4EIWA 4GIPA 4LFCM 4AG6A 3J7BA 1XXHA 1XWIA 1N77A 1N36M 1IBLM 4L4UA 1QQWA 3M6AA 1YUBA 4B7GA 4LY6A 1H6UA 3U5ZB 3U6EA 1IN5A 4G4OA 1JR3D 4DR1M 3AL0C 4LF8M 2XFTA 1E9RA 2Q2EB 3VK7A 2UUBM 2G8LA 2R65A 4QHSA 5EXTA 1XNRM 1DGGA 2F5QA 1K3WA 1QAMA 4DV0M 1MU5A 3VDPA 4FW9A 1ZAEA 4S12A 4B3MM 2I7PA 1FJGM 3SC3A 4AZFA 3UMMA 4HLQA 3U6DA 4G4RA 2UU9M 1G3IA 7CATA 4DR2M 3ZCBB 5E6JA 4JI2M 5LMNM 3GO8A 3K92A 1Q3BA 2YNMD 3ZC7B 3Q8XA 4G6ZA 3RGPA 3RFWA 4I81A 5FSWA 4FCTA 5DNYA 2V6ZM 5FTMA 1NJFA 3MJ5A 1PJJA 3FKEA 3KOZE 3CF6E 4NOOB 3GP1A 1N34M 1YSYA 5EP4A 3FTFA 3J80S 2QPAA 1ZQ9A 4BBAA 3U6OA 1XHBA 1IXSB 2L7HA 1L1TA 5IT9S 2KEBA 3HJ8A 4LJ5A 2HCBA 4LJAA 3AKZA 4JI5M 1Q39A 4QOSA 4DV2M 4AW4A 3K8ZA 2C9CA 2KXEA 3TWKA 3KS8A 2XSZA 1IN4A 3PNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJ7 A;  3WHK A;  3VFD A;  4JN6 A;  1IXZ A;  2QBY A;  2CHQ A;  1J7K A;  1W5S A;  3R8F A;  3GLG A;  1E32 A;  1SXJ D;  1SXJ C;  2CHV A;  1IN6 A;  4QNM A;  1OFI A;  4ZPX A;  3UK6 A;  3KDS E;  2DHR A;  3SYL A;  3PVS A;  1IN8 A;  4LJ8 A;  2KRK A;  1C1K A;  1SXJ E;  2DZO B;  2ZAM A;  4FCW A;  5FTN A;  1UM8 A;  3GLG B;  1LV7 A;  5C1B A;  1IN7 A;  4GIT A;  2C9O A;  1R6B X;  1D2N A;  1NSF A;  2CE7 A;  1IXR C;  5FTJ A;  1FNN A;  5FTK A;  3PFI A;  5C18 A;  1E94 E;  1R7R A;  2ZAN A;  1KYI A;  3WHL A;  1NY6 A;  4QHT A;  5EP2 A;  4FWH A;  4D81 A;  3U61 B;  1XXH B;  4FD2 A;  1NJG A;  1L8Q A;  5JI3 E;  4D82 A;  4D80 A;  4L15 A;  3EIH A;  2C98 A;  1KSF X;  2RKO A;  3K1J A;  2DVW B;  4LZZ A;  4KO8 A;  1S3S A;  2X8A A;  3PXG A;  3VLF B;  3GLH A;  4EIW A;  4LGM A;  4Z8X A;  1XXH A;  2DZN B;  4WW0 A;  1XWI A;  4KOD A;  5EP1 A;  4L4U A;  2BJW A;  2Z4S A;  3M6A A;  3H4M A;  1IY0 A;  4LY6 A;  1SXJ A;  4LRS A;  4LJ9 A;  3U5Z B;  2V1U A;  4LCB A;  1IN5 A;  1JR3 D;  1HT1 E;  4LJ6 A;  3CF2 A;  5DYG A;  3GLF B;  3SYK A;  1OJL A;  4FCV A;  1X37 A;  4LJ4 A;  3U60 B;  4FWD A;  2QEN A;  2R65 A;  1SXJ B;  4QHS A;  5EP3 A;  5EXT A;  3HU3 A;  5JI2 E;  3B9P A;  4LRT A;  3GLF A;  3DZD A;  1NY5 A;  4FW9 A;  3CF0 A;  5EXX A;  1W5T A;  3MHV C;  4I4L A;  3HU2 A;  1G4A E;  2VII A;  2QBY B;  3SC3 A;  2BJV A;  5EXS A;  4FWG A;  3GLH B;  1HQY E;  1G41 A;  2XSZ D;  2QP9 X;  1IQP A;  2DWZ B;  1G3I A;  2C99 A;  1JQJ C;  1QZM A;  1DO0 A;  5EQT A;  2QZ4 A;  1QVR A;  1OFH A;  1HT2 E;  4QNR A;  3GLI B;  3AJI B;  2C96 A;  3HWS A;  3KW6 A;  3D8B A;  1IY1 A;  4I81 A;  2Z4R A;  4FCT A;  2V6Z M;  3BOS A;  1NJF A;  5FTM A;  4L16 A;  5EP4 A;  5FTL A;  1HQC A;  5DYI A;  2QPA A;  2R62 A;  1IY2 A;  1IM2 A;  3GLI A;  4KLN A;  3ZH9 B;  2FNA A;  5EXP A;  1IXS B;  1DO2 A;  3EIE A;  3M0E A;  3HU1 A;  2ZAO A;  4A3V B;  4LJ5 A;  2HCB A;  4LJA A;  1NVM A;  4QOS A;  1JR3 A;  2CHG A;  2C9C A;  2CEA A;  2XSZ A;  1IN4 A; 
#chains in the Genus database with same CATH topology
 4OU7 A;  1Z59 A;  4LJ7 A;  1IXS A;  1IXZ A;  1LTM A;  3FTC A;  4M0D A;  3R8F A;  2CHQ A;  4GC5 A;  2F5O A;  1MX0 A;  3E9S A;  4IJF A;  3RGS A;  3TPZ A;  3GLG A;  1E32 A;  2CHV A;  1OTR A;  2WZJ A;  3TQS A;  3T1H M;  3I51 A;  5F3W A;  4L8R C;  4DR7 M;  4GKK M;  5FLX S;  3VKH A;  4ZPX A;  3KDS E;  3KFU G;  3QYB A;  3SYL A;  2RRU A;  1OIZ A;  5L8R F;  2DWN A;  2DZO B;  4G4Q A;  3U6P A;  1TH2 A;  1KFV A;  4JV5 M;  1NNJ A;  3I4Y A;  3GLG B;  1LV7 A;  5C1B A;  4GIT A;  2C9O A;  3FUW A;  3KS4 A;  3D8L A;  3U6S A;  1OQY A;  1NSF A;  1MJG M;  1IFY A;  3KOW E;  2OOA A;  1FNN A;  1R7R A;  4F1I A;  1Z5C A;  1VEJ A;  1PM5 A;  3KP1 E;  2X49 A;  2L7I A;  3UJN A;  4PT5 A;  1TH3 A;  1NV9 A;  3HHZ A;  1DGB A;  4LF6 M;  3KVW A;  4XGI A;  5KPR A;  4MGZ E;  2CV2 A;  2JXN A;  4L15 A;  1Q3C A;  2V1C A;  2C98 A;  3SHF A;  2RKO A;  5IZ7 D;  2DVW B;  8CAT A;  4LZZ A;  1PJS A;  1WGL A;  1S3S A;  2H5X A;  3LVW A;  2QHO B;  3GLH A;  4JI6 M;  3U61 A;  1NO1 A;  2VDB B;  1PJI A;  1QYR A;  4B3T M;  2DZN B;  4GHL A;  1DGH A;  3GLH E;  4KOD A;  3A46 A;  1TF0 B;  4G4N A;  5EP1 A;  2OQ4 A;  2CUZ A;  3SMP A;  2BJW A;  1IBM M;  1WGN A;  1PJT A;  1QUT A;  5EJC A;  3NWL A;  3H4M A;  3GPU A;  1QUS A;  2LVN C;  4LJ9 A;  2R0I A;  2AHM A;  4R71 A;  3FE3 A;  4XBO A;  1HT1 E;  4BLC A;  1TDH A;  3NBX X;  5ITT A;  4DV5 M;  2J5Y A;  3L29 A;  4LF7 M;  3CF2 A;  1Q02 A;  2YFQ A;  3GLF B;  4K0K M;  2UXB M;  3C3D A;  2EO2 A;  3B7Q A;  4FCV A;  2FFJ A;  1E9S A;  1X37 A;  1DV0 A;  4LJ4 A;  4AG5 A;  3THG A;  4FWD A;  2QEN A;  1WHC A;  3L2A A;  5EP3 A;  3GQ4 A;  4LZJ A;  1L1Z A;  3T1Y M;  3HU3 A;  2HL7 A;  4IBJ A;  3JR4 A;  1ZMW A;  2G5G X;  2KDL A;  3GLF A;  3SFZ A;  4MB7 A;  3CF0 A;  1W5T A;  5KQD A;  4REZ A;  3SMS A;  3T6P A;  3SAV A;  3JAM S;  4OVZ B;  2M60 A;  2F5P A;  2FH0 A;  2BJV A;  2ZBK B;  2KNZ A;  2BNK A;  4FWG A;  5EXS A;  2R46 A;  1G41 A;  2QP9 X;  3FUX A;  3UZU A;  2ZM6 M;  1JQJ C;  2BWE A;  3SAR A;  1DO0 A;  3MMP A;  1QVR A;  1L2C A;  1HT2 E;  3GLI B;  4TUW A;  4M9S A;  2C96 A;  3HWS A;  4RKU F;  3Q8G A;  1HNX M;  3SAU A;  4FVM A;  3SAT A;  1D0L A;  2O25 A;  4ANR A;  4PD2 A;  3SBJ A;  2DHY A;  3IEC A;  2CRU A;  1CUK A;  1TGU A;  1IM2 A;  3GLI A;  4AI6 A;  4YY3 M;  2FNA A;  1TH4 A;  3W68 A;  4LF5 M;  2BWB A;  3B89 A;  3C3E A;  2UXD M;  4I8O A;  1QDR A;  2CEA A;  3TWM A;  1R2Z A;  1XC8 A;  4DUZ M;  2R6F A;  4WP2 A;  4P16 A;  2MGW A;  4JI1 M;  3GQ3 A;  3HHY A;  2QBY A;  1N78 A;  2JY7 A;  2W82 A;  3QAU A;  1J7K A;  1HJP A;  2Y20 A;  3HHW A;  1G59 A;  2Z8Y M;  1XNQ M;  4MGI E;  3GRU A;  1JB0 F;  4CGY B;  2DHR A;  2K0B X;  2EUC A;  4NXN M;  3PVS A;  1HNW M;  2Z3X A;  2APL A;  3IG8 A;  1NV8 A;  4M9X A;  1C1K A;  4FCW A;  2DAK A;  3E4R A;  4IBG A;  3F92 A;  4R3D A;  4RF0 A;  5FTN A;  3TE6 A;  4NRV A;  2LHC A;  3V76 A;  5H37 D;  4QOZ C;  2C5R A;  2FOI C;  2LVO C;  1AUA A;  1XXH E;  1IXR C;  2WSF F;  3PFI A;  3K9O A;  3WHL A;  2GNO A;  3CGW A;  3DFZ A;  4DV4 M;  4D81 A;  2XEP A;  4FD2 A;  4Q7J A;  1N32 M;  1L8Q A;  2DI0 A;  4D82 A;  2L6O A;  1WR1 B;  3AOG A;  1EFU B;  2XZF A;  3K1J A;  3QWL A;  3PNV A;  3W0F A;  2UUC M;  4KO8 A;  2X8A A;  1ZV1 A;  2L4E A;  2M5Z A;  3I04 M;  3VLF B;  1OIP A;  1Z5B A;  2JP7 A;  4Z8X A;  3LMM A;  1QDT A;  4WW0 A;  2F5S A;  4LG2 A;  5ITQ A;  3KOY E;  2MRO B;  3NBI A;  2CV1 A;  2DXI A;  3KSJ A;  3R9X B;  3L25 A;  1K82 A;  1A5T A;  4MGH A;  2UXC M;  1SXJ A;  2RGH A;  5A2Q S;  2DWL A;  2K6B A;  4LJ6 A;  3TL4 X;  4NL4 H;  3L26 A;  4JXJ A;  5DYG A;  5KQ8 A;  3HHX A;  3HJQ A;  5ITR A;  2L4F A;  2LBC A;  2Y0T A;  3SYK A;  3FTE A;  3U6C A;  3LQQ A;  5E26 A;  4IBF A;  4NC6 A;  3KOX E;  4I5S A;  4DR6 M;  3J27 B;  2LVQ D;  4LF9 M;  4G3O A;  2KHH A;  3U6M A;  1Z5A A;  5ITX E;  4B08 A;  3H4J A;  1TTE A;  1DGF A;  4GMQ A;  2JZ1 A;  1NY5 A;  2D7H A;  2HKJ A;  1D0M A;  5EXX A;  5DFL A;  2EKF A;  2QNJ A;  3K2L A;  1QAO A;  3AV0 A;  3W0L B;  2L09 A;  2Y21 A;  2MH8 A;  1I94 M;  1G4A E;  3A42 A;  1VDD A;  2X4A A;  2ZTC A;  2N35 A;  4DUY M;  3FUV A;  2H1R A;  4HEO A;  1GJS A;  1R5L A;  4DV6 M;  1G8P A;  4MGK E;  4KHP M;  5EQT A;  1OFH A;  2Z7J A;  4DBG B;  4P17 A;  3KW6 A;  4OW0 A;  1IY1 A;  1NHW C;  2R44 A;  3GPX A;  4GHA A;  3BOS A;  3E21 A;  2QSF X;  3AOE A;  5FTL A;  1WIV A;  3BBZ A;  1L2D A;  5DYI A;  3J7A S;  3ZH9 B;  2LWX A;  2JY5 A;  1GL6 A;  3HZJ A;  5IWA M;  1EIJ A;  1R2Y A;  1DO2 A;  1WJ7 A;  3HU1 A;  2ZAO A;  2DAI A;  3MK6 A;  2J7O A;  1I4W A;  2GQF A;  3GRR A;  2FE8 A;  3B7N A;  1JR3 A;  2CHG A;  4IIW A;  1T6O A;  2LNH C;  2A5Y B;  3GPY A;  4IBE A;  4KT0 F;  3SHG B;  3C58 A;  4JYA M;  1N75 A;  4B3S M;  4X64 M;  1SXJ D;  1GLN A;  1SXJ C;  2CP8 A;  3GRY A;  4QNM A;  3CTW B;  1NNU C;  2B3T A;  3I4V A;  1NHG C;  5KO3 A;  4LGY A;  3LW5 F;  3LQR A;  2FS1 A;  2R45 A;  3FUT A;  1GJT A;  4NSO B;  2HHH M;  1IBK M;  1ORY B;  1UM8 A;  4DR5 M;  4PCZ A;  3FUU A;  3C9P A;  4IJE A;  4MH0 E;  1IN7 A;  5ITY A;  2D7E A;  1J09 A;  1R6B X;  3SAW A;  3VK8 A;  3U60 A;  3AFH A;  5C18 A;  1E94 E;  2LXE A;  1VEG A;  1Z6T A;  1KYI A;  4MGY E;  5EP2 A;  1HR0 M;  2KRU A;  4M0W A;  2I7N A;  2VQF M;  5JI3 E;  4DR4 M;  2XH9 A;  3RE8 A;  2EKK A;  4JI0 M;  1PRB A;  3EIH A;  4AKG A;  4LF4 M;  2QCU A;  4Z6Y A;  4JI7 M;  2MR9 A;  3LCV B;  4GRI A;  4IBD A;  2K9D A;  2JA2 A;  2DNA A;  4GC9 A;  5GKN A;  3T38 A;  3PXG A;  4CHT B;  2KNV A;  4II7 A;  4WUR A;  4LGM A;  2YQZ A;  3L28 A;  4AKI A;  2EA0 A;  4L6V 6;  1QZE A;  2Z4S A;  4B3R M;  3T15 A;  2LVA A;  1IY0 A;  4X65 M;  4OX9 M;  2J7N A;  4LRS A;  3W67 A;  3GQ5 A;  2V1U A;  4LCB A;  2KA6 B;  2NQ8 C;  1T43 A;  2R18 A;  2R4E A;  4CIZ A;  1EE8 A;  1GL7 A;  2LVP C;  3DA1 A;  2DZL A;  3GPP A;  1ZMU A;  3SAS A;  1OJL A;  2XGN A;  1YE9 A;  2KW0 A;  3K9P A;  5BR8 M;  3TWL A;  4DR3 M;  1UFZ A;  1SXJ B;  2E5L M;  3J2P B;  2KNA A;  2R4J A;  4UN2 B;  3VDU A;  1V34 A;  5JI2 E;  2KZS A;  3B9P A;  4LRT A;  3GRV A;  2JZ0 A;  4NXM M;  3AOE C;  3DZD A;  1RU3 A;  1Y8G A;  4ITQ A;  2KZU A;  5IRE B;  2ERC A;  4JI8 M;  3MHV C;  1V33 A;  4I4L A;  3HU2 A;  5KPT A;  3VKG A;  2VII A;  2QBY B;  1AIP C;  4B7H A;  3GLH B;  1HQY E;  1R4G A;  3GLG E;  3HX3 A;  2XSZ D;  3A98 B;  5KPZ A;  2L2D A;  1IQP A;  1DGH B;  2DWZ B;  4DV7 M;  2C99 A;  3U6Q A;  4HL4 A;  1GKI A;  3JR5 A;  1QZM A;  3FYD A;  2CV0 A;  2QZ4 A;  4QNR A;  1XMO M;  3LVV A;  3KSX A;  3AJI B;  3OTO M;  2P5T A;  4DV3 M;  1JR3 E;  4PDI A;  4L78 A;  2JUJ A;  3D8B A;  2Y0Q A;  2Z4R A;  1T3T A;  4LFA M;  1PGY A;  1QAN A;  4L16 A;  3FD9 A;  1HQC A;  4RF1 A;  2CWB A;  1IY2 A;  1VG5 A;  4GKJ M;  1VQ1 A;  3HJS A;  4KLN A;  2CFO A;  4IBK A;  5EXP A;  4JI3 M;  4IBC A;  4AQY M;  3EIE A;  3M0E A;  2HWJ A;  2K47 A;  3UGJ A;  2VQE M;  4A3V B;  2F5N A;  2ZTD A;  2RGO A;  2XFS A;  3U6L A;  3IG5 A;  3U60 B;  2F4V M;  3HKP A;  5BPV A;  1GAB A;  1NVM A;  1K3X A;  4BB9 A;  3B7Z A;  3KXE C;  1OAI A;  2QQ8 A;  2R62 A;  1HNZ M;  5ITX A;  1J5E M;  4NRW A;  1XMQ M;  2JWS A;  4MM3 B;  5ITU A;  2DAG A;  4NSR A;  3WHK A;  2XF3 A;  4JN6 A;  2LH0 A;  4RNA A;  4IBI A;  3VFD A;  4IBB A;  1W5S A;  1IN6 A;  3B74 A;  4CIS A;  1SG9 A;  3HY5 A;  2OPF A;  1OFI A;  1N33 M;  4GH9 A;  3UK6 A;  3E46 A;  2WSC F;  3L27 A;  1WXQ A;  1IN8 A;  2D7G A;  2KRK A;  1SXJ E;  4LJ8 A;  3J81 S;  2ZAM A;  1F4I A;  4X62 M;  1XB2 B;  2OOB A;  4M9Z A;  4B7F A;  4AKH A;  4R7G A;  4X66 M;  2O01 F;  2UUA M;  2XZU A;  4DV1 M;  3FYC A;  3DOA A;  1TDZ A;  4GEW A;  2OO9 A;  1D2N A;  4PDG A;  2CE7 A;  1PJQ A;  4YHH M;  2HAK A;  5FTJ A;  3HGI A;  5FTK A;  3A45 A;  1P3Q Q;  4JI4 M;  1GO5 A;  2ZAN A;  2O5R A;  1NY6 A;  4QHT A;  4W5W A;  4FWH A;  1QAQ A;  3U61 B;  1XXH B;  3KP0 E;  1NJG A;  1V92 A;  3ILK A;  3M7G A;  4LFB M;  4D80 A;  2YR0 A;  1L2B A;  2WSE F;  1KSF X;  2XLJ A;  3FTD A;  4OVZ A;  5LMU M;  1GVN A;  3U5Z A;  3FRH A;  2DWM A;  4EIW A;  4GIP A;  4LFC M;  4AG6 A;  3J7B A;  1OKS A;  1XXH A;  1XWI A;  1N77 A;  1N36 M;  1IBL M;  4XK8 F;  4L4U A;  1QQW A;  2DEN A;  3M6A A;  1YUB A;  4B7G A;  1C7Y A;  4LY6 A;  1H6U A;  3U5Z B;  2JNH A;  3U6E A;  1IN5 A;  2DAE A;  1JR3 D;  2DKL A;  3QYE A;  4G4O A;  4DR1 M;  3AL0 C;  1VEK A;  2MJ5 B;  2EJS A;  4LF8 M;  2XFT A;  1E9R A;  2Q2E B;  2DAM A;  3VK7 A;  2UUB M;  2G8L A;  2R65 A;  4QHS A;  5EXT A;  1XNR M;  1DGG A;  2F5Q A;  1K3W A;  1QAM A;  4DV0 M;  1MU5 A;  3IHP A;  4FW9 A;  3VDP A;  3ZQJ A;  1ZAE A;  4S12 A;  1G71 A;  4B3M M;  2I7P A;  1FJG M;  3SC3 A;  3GLI E;  4AZF A;  4CJ6 A;  3UMM A;  4HLQ A;  3U6D A;  2JY8 A;  4G4R A;  2UU9 M;  1TR8 A;  1G3I A;  7CAT A;  4DR2 M;  3ZCB B;  2LTU A;  5E6J A;  4JI2 M;  5LMN M;  3GO8 A;  3K92 A;  4Y28 F;  3BXW A;  1Q3B A;  2YNM D;  1MN3 A;  3Q8X A;  4G6Z A;  3RGP A;  3ZC7 B;  3RFW A;  4I81 A;  5FSW A;  1ZMV A;  4FCT A;  5DNY A;  2V6Z M;  2VF8 A;  5FTM A;  1NJF A;  3MJ5 A;  1OAO C;  3FKE A;  3KOZ E;  3CF6 E;  4NOO B;  3GP1 A;  1PJJ A;  1YSY A;  5EP4 A;  1N34 M;  3FTF A;  1VDL A;  2LHG A;  3J80 S;  3I01 M;  2QPA A;  2JY6 B;  1ZQ9 A;  4BBA A;  3U6O A;  1XHB A;  2G3Q A;  1YLA A;  1D0K A;  1IXS B;  2L7H A;  3LCU A;  1L1T A;  4F2L A;  5IT9 S;  1BVS A;  2KEB A;  2VF7 A;  2HCB A;  3HJ8 A;  4LJ5 A;  4LJA A;  3AKZ A;  4JI5 M;  1Q39 A;  4QOS A;  3GLF E;  3FRI A;  4DV2 M;  4AW4 A;  3K8Z A;  2C9C A;  2KXE A;  3TWK A;  3KS8 A;  2XSZ A;  1IN4 A;  3PNY A; 
#chains in the Genus database with same CATH homology
 4OU7 A;  1Z59 A;  4LJ7 A;  3FTC A;  1IXZ A;  4M0D A;  2CHQ A;  4GC5 A;  2F5O A;  1MX0 A;  3E9S A;  4IJF A;  3RGS A;  3TPZ A;  3GLG A;  1E32 A;  2CHV A;  3TQS A;  3T1H M;  3R8F A;  4GKK M;  3I51 A;  5F3W A;  4L8R C;  4DR7 M;  3VKH A;  5FLX S;  4ZPX A;  3KDS E;  3KFU G;  3SYL A;  2DWN A;  2DZO B;  4G4Q A;  3U6P A;  1TH2 A;  1KFV A;  4JV5 M;  1NNJ A;  3I4Y A;  3GLG B;  1LV7 A;  5C1B A;  4GIT A;  2C9O A;  3FUW A;  3KS4 A;  3D8L A;  3U6S A;  1NSF A;  3KOW E;  1FNN A;  1R7R A;  1Z5C A;  1PM5 A;  3KP1 E;  2X49 A;  2L7I A;  3UJN A;  4PT5 A;  1TH3 A;  3HHZ A;  1DGB A;  4LF6 M;  3KVW A;  4XGI A;  5KPR A;  4MGZ E;  2CV2 A;  4L15 A;  1Q3C A;  2V1C A;  2C98 A;  3SHF A;  2RKO A;  5IZ7 D;  2DVW B;  8CAT A;  4LZZ A;  1S3S A;  3LVW A;  3GLH A;  4JI6 M;  3U61 A;  1PJI A;  4GHL A;  1QYR A;  4B3T M;  2DZN B;  1DGH A;  4KOD A;  3A46 A;  4G4N A;  5EP1 A;  2OQ4 A;  2CUZ A;  3SMP A;  2BJW A;  1IBM M;  5EJC A;  3NWL A;  3H4M A;  3GPU A;  4LJ9 A;  2AHM A;  4XBO A;  1HT1 E;  4BLC A;  1TDH A;  5ITT A;  4LF7 M;  4DV5 M;  3L29 A;  4K0K M;  3CF2 A;  2YFQ A;  2UXB M;  3GLF B;  2EO2 A;  4FCV A;  2FFJ A;  1E9S A;  1X37 A;  4LJ4 A;  4AG5 A;  3THG A;  4FWD A;  2QEN A;  3GQ4 A;  3L2A A;  5EP3 A;  3U60 B;  4LZJ A;  1L1Z A;  3T1Y M;  3HU3 A;  2HL7 A;  4IBJ A;  3JR4 A;  2G5G X;  3GLF A;  3SFZ A;  4MB7 A;  3CF0 A;  1W5T A;  5KQD A;  4REZ A;  3SMS A;  3SAV A;  3JAM S;  4OVZ B;  2M60 A;  2F5P A;  2BJV A;  2ZBK B;  2BNK A;  4FWG A;  5EXS A;  2R46 A;  1G41 A;  2QP9 X;  3FUX A;  3UZU A;  2ZM6 M;  1JQJ C;  3SAR A;  1DO0 A;  1L2C A;  1QVR A;  1HT2 E;  3GLI B;  4TUW A;  4M9S A;  2C96 A;  3HWS A;  1HNX M;  3SAU A;  4FVM A;  3SAT A;  3SBJ A;  4PD2 A;  1TGU A;  1IM2 A;  3GLI A;  4AI6 A;  4YY3 M;  2FNA A;  1TH4 A;  4LF5 M;  2UXD M;  4I8O A;  2CEA A;  3TWM A;  1R2Z A;  1XC8 A;  4DUZ M;  4P16 A;  4JI1 M;  3GQ3 A;  3HHY A;  2QBY A;  1N78 A;  2W82 A;  3QAU A;  1J7K A;  2Y20 A;  3HHW A;  1G59 A;  1XNQ M;  4MGI E;  3GRU A;  4CGY B;  2DHR A;  2EUC A;  4NXN M;  3PVS A;  1HNW M;  2Z3X A;  3IG8 A;  4M9X A;  1C1K A;  4FCW A;  3E4R A;  4IBG A;  5FTN A;  4R3D A;  4RF0 A;  3TE6 A;  4NRV A;  5H37 D;  4QOZ C;  2C5R A;  2FOI C;  1IXR C;  3PFI A;  3WHL A;  4DV4 M;  3DFZ A;  4D81 A;  2XEP A;  4FD2 A;  1N32 M;  1L8Q A;  4D82 A;  2L6O A;  3AOG A;  2XZF A;  3K1J A;  3QWL A;  3PNV A;  3W0F A;  2UUC M;  4KO8 A;  2X8A A;  3VLF B;  2M5Z A;  1Z5B A;  4Z8X A;  3LMM A;  2F5S A;  4WW0 A;  4LG2 A;  5ITQ A;  3KOY E;  3NBI A;  2CV1 A;  2DXI A;  3KSJ A;  3R9X B;  3L25 A;  1K82 A;  4MGH A;  2UXC M;  1SXJ A;  2RGH A;  5A2Q S;  2DWL A;  3TL4 X;  4LJ6 A;  4NL4 H;  3L26 A;  4JXJ A;  5DYG A;  5KQ8 A;  3HHX A;  3HJQ A;  5ITR A;  3FTE A;  2Y0T A;  3SYK A;  3U6C A;  3LQQ A;  5E26 A;  4IBF A;  3KOX E;  4I5S A;  4DR6 M;  3J27 B;  4LF9 M;  3U6M A;  1Z5A A;  5ITX E;  4B08 A;  1DGF A;  4GMQ A;  1NY5 A;  2D7H A;  2HKJ A;  5EXX A;  3K2L A;  1QAO A;  3AV0 A;  3W0L B;  2L09 A;  2Y21 A;  1I94 M;  1G4A E;  3A42 A;  1VDD A;  2X4A A;  4DUY M;  3FUV A;  2H1R A;  4DV6 M;  1G8P A;  4MGK E;  4KHP M;  5EQT A;  1OFH A;  2Z7J A;  3KW6 A;  4OW0 A;  1IY1 A;  1NHW C;  4GHA A;  3GPX A;  3BOS A;  3AOE A;  5FTL A;  1L2D A;  5DYI A;  3J7A S;  3ZH9 B;  2LWX A;  1GL6 A;  5IWA M;  1R2Y A;  1DO2 A;  3HU1 A;  2ZAO A;  3MK6 A;  2J7O A;  1I4W A;  3GRR A;  2FE8 A;  1JR3 A;  2CHG A;  4IIW A;  2LNH C;  2A5Y B;  3GPY A;  4IBE A;  3SHG B;  3C58 A;  4JYA M;  1N75 A;  4B3S M;  4X64 M;  1SXJ D;  1GLN A;  1SXJ C;  3GRY A;  4QNM A;  3CTW B;  1NNU C;  3I4V A;  1NHG C;  5KO3 A;  4LGY A;  3LQR A;  2R45 A;  4NSO B;  3FUT A;  2HHH M;  1IBK M;  1ORY B;  1UM8 A;  4DR5 M;  4PCZ A;  3FUU A;  4IJE A;  4MH0 E;  1IN7 A;  5ITY A;  2D7E A;  1J09 A;  1R6B X;  3SAW A;  3VK8 A;  3U60 A;  3AFH A;  5C18 A;  1E94 E;  2LXE A;  1Z6T A;  1KYI A;  4MGY E;  5EP2 A;  1HR0 M;  2KRU A;  4M0W A;  2I7N A;  2VQF M;  5JI3 E;  4DR4 M;  2XH9 A;  3RE8 A;  4JI0 M;  3EIH A;  4AKG A;  4LF4 M;  2QCU A;  4Z6Y A;  4JI7 M;  4GRI A;  4IBD A;  2JA2 A;  4GC9 A;  5GKN A;  3T38 A;  3PXG A;  4CHT B;  4II7 A;  4WUR A;  4LGM A;  2YQZ A;  3L28 A;  4AKI A;  2EA0 A;  2Z4S A;  4B3R M;  3T15 A;  1IY0 A;  4X65 M;  4OX9 M;  2J7N A;  4LRS A;  3GQ5 A;  2V1U A;  4LCB A;  2KA6 B;  2NQ8 C;  2R18 A;  2R4E A;  1EE8 A;  1GL7 A;  3DA1 A;  3GPP A;  3SAS A;  1OJL A;  2XGN A;  1YE9 A;  2KW0 A;  5BR8 M;  3TWL A;  4DR3 M;  1SXJ B;  2E5L M;  3J2P B;  2R4J A;  3VDU A;  5JI2 E;  2KZS A;  3B9P A;  4LRT A;  3GRV A;  4NXM M;  3AOE C;  3DZD A;  4ITQ A;  2KZU A;  5IRE B;  2ERC A;  4JI8 M;  3MHV C;  4I4L A;  3HU2 A;  5KPT A;  3VKG A;  2VII A;  2QBY B;  4B7H A;  3GLH B;  1HQY E;  5KPZ A;  2XSZ D;  3A98 B;  4DV7 M;  1IQP A;  1DGH B;  2DWZ B;  2C99 A;  3U6Q A;  4HL4 A;  1GKI A;  3JR5 A;  1QZM A;  3FYD A;  2CV0 A;  2QZ4 A;  4QNR A;  1XMO M;  3LVV A;  3KSX A;  3AJI B;  3OTO M;  2P5T A;  4DV3 M;  4PDI A;  4L78 A;  3D8B A;  2Y0Q A;  2Z4R A;  1T3T A;  4LFA M;  1QAN A;  4L16 A;  3FD9 A;  1HQC A;  4RF1 A;  1IY2 A;  4GKJ M;  4KLN A;  3HJS A;  2CFO A;  4IBK A;  5EXP A;  4JI3 M;  4IBC A;  4AQY M;  3EIE A;  3M0E A;  3UGJ A;  2K47 A;  2VQE M;  2F5N A;  4A3V B;  2RGO A;  2XFS A;  3U6L A;  3IG5 A;  2F4V M;  3HKP A;  5BPV A;  1NVM A;  1K3X A;  4BB9 A;  3KXE C;  2R62 A;  1HNZ M;  5ITX A;  1J5E M;  4NRW A;  1XMQ M;  4MM3 B;  5ITU A;  4NSR A;  3WHK A;  2XF3 A;  4JN6 A;  2LH0 A;  4RNA A;  4IBI A;  3VFD A;  4IBB A;  1W5S A;  1IN6 A;  4CIS A;  2OPF A;  1OFI A;  1N33 M;  4GH9 A;  3UK6 A;  3L27 A;  1WXQ A;  1IN8 A;  2D7G A;  2KRK A;  1SXJ E;  4LJ8 A;  3J81 S;  2ZAM A;  4X62 M;  4M9Z A;  4B7F A;  4AKH A;  4R7G A;  4X66 M;  2UUA M;  2XZU A;  4DV1 M;  3FYC A;  3DOA A;  1TDZ A;  4PDG A;  1D2N A;  2CE7 A;  4YHH M;  5FTJ A;  3HGI A;  5FTK A;  3A45 A;  4JI4 M;  2ZAN A;  2O5R A;  1NY6 A;  4QHT A;  4W5W A;  4FWH A;  1QAQ A;  3U61 B;  1XXH B;  3KP0 E;  1NJG A;  4LFB M;  3ILK A;  3M7G A;  4D80 A;  2YR0 A;  1L2B A;  1KSF X;  2XLJ A;  3FTD A;  4OVZ A;  5LMU M;  1GVN A;  3U5Z A;  2DWM A;  4EIW A;  4GIP A;  4LFC M;  4AG6 A;  3J7B A;  1XXH A;  1XWI A;  1N77 A;  1N36 M;  1IBL M;  4L4U A;  1QQW A;  3M6A A;  1YUB A;  4B7G A;  4LY6 A;  1H6U A;  3U5Z B;  3U6E A;  1IN5 A;  4G4O A;  1JR3 D;  4DR1 M;  3AL0 C;  4LF8 M;  2XFT A;  1E9R A;  2Q2E B;  3VK7 A;  2UUB M;  2G8L A;  2R65 A;  4QHS A;  5EXT A;  1XNR M;  1DGG A;  2F5Q A;  1K3W A;  1QAM A;  4DV0 M;  1MU5 A;  3VDP A;  4FW9 A;  1ZAE A;  4S12 A;  4B3M M;  2I7P A;  1FJG M;  3SC3 A;  4AZF A;  3UMM A;  4HLQ A;  3U6D A;  4G4R A;  2UU9 M;  1G3I A;  7CAT A;  4DR2 M;  3ZCB B;  5E6J A;  4JI2 M;  5LMN M;  3GO8 A;  3K92 A;  1Q3B A;  2YNM D;  3ZC7 B;  3Q8X A;  4G6Z A;  3RGP A;  3RFW A;  4I81 A;  5FSW A;  4FCT A;  5DNY A;  2V6Z M;  5FTM A;  1NJF A;  3MJ5 A;  1PJJ A;  3FKE A;  3KOZ E;  3CF6 E;  4NOO B;  3GP1 A;  1N34 M;  1YSY A;  5EP4 A;  3FTF A;  3J80 S;  2QPA A;  1ZQ9 A;  4BBA A;  3U6O A;  1XHB A;  1IXS B;  2L7H A;  1L1T A;  5IT9 S;  2KEB A;  3HJ8 A;  4LJ5 A;  2HCB A;  4LJA A;  3AKZ A;  4JI5 M;  1Q39 A;  4QOS A;  4DV2 M;  4AW4 A;  3K8Z A;  2C9C A;  2KXE A;  3TWK A;  3KS8 A;  2XSZ A;  1IN4 A;  3PNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...