4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
4LJ9A 3GLFB 1KSFX 3UK6A 4FWGA 3WHLA 2V1UA 5EP2A 3PFIA 3GLIB 3DZDA 5EQTA 2C9OA 4FD2A 4A3VB 1HQCA 3CF0A 1IN4A 2C98A 2DHRA 2C99A 3KDSE 1SXJA 4QOSA 5FTNA 1SXJC 3AJIB 3EIHA 3GLHA 2CEAA 2QP9X 3HU3A 5C18A 1C1KA 1IN8A 3U61B 4Z8XA 3PXGA 3K1JA 1SXJD 1OFHA 3HWSA 2VIIA 2ZAOA 5C1BA 3GLGA 2BJVA 1NJGA 2V6ZM 5DYIA 3WHKA 4LJ4A 1JR3A 2QPAA 2DWZB 2X8AA 2BJWA 1UM8A 3KW6A 3VLFB 4L15A 5JI2E 4GITA 2R65A 4LRTA 4LJ7A 2QBYA 3EIEA 3M6AA 2KRKA 1JR3D 2Z4SA 1G4AE 5EXTA 5FTJA 2CHQA 5FTLA 1HT1E 1R6BX 2R62A 1S3SA 4FCWA 2XSZA 3H4MA 1QVRA 5EP1A 5DYGA 4JN6A 1NVMA 4LZZA 4LGMA 3GLFA 1G41A 2HCBA 4KLNA 4QNMA 2CHGA 1NJFA 1DO0A 1XXHB 1D2NA 1E32A 2C96A 4KO8A 5EP4A 5JI3E 2RKOA 3GLIA 4LJAA 4KODA 3U60B 1JQJC 5EP3A 1IXRC 5EXPA 5EXSA 3SYKA 4D82A 2ZANA 2ZAMA 1IN6A 2CHVA 4I81A 4LJ5A 1IN5A 3BOSA 4QNRA 1W5SA 1R7RA 1HQYE 5EXXA 5FTMA 4L4UA 2FNAA 4FWDA 3CF2A 4FCVA 4D80A 3SYLA 3U5ZB 2QBYB 4LCBA 4LY6A 4EIWA 1L8QA 1IY0A 4D81A 1OJLA 1SXJB 1IXZA 3HU2A 4FWHA 1QZMA 4LJ8A 4LJ6A 3PVSA 2C9CA 2QENA 3GLHB 1G3IA 3R8FA 3D8BA 1NSFA 1DO2A 1SXJE 1W5TA 2QZ4A 2XSZD 1XWIA 2CE7A 1LV7A 3GLGB 4LRSA 2DVWB 1FNNA 3B9PA 4QHSA 4WW0A 4I4LA 1IXSB 1E94E 1NY5A 4ZPXA 1IY2A 1IM2A 1OFIA 3SC3A 1X37A 2DZOB 1J7KA 2Z4RA 1NY6A 3M0EA 1XXHA 4FCTA 1HT2E 3HU1A 1KYIA 1IQPA 1IY1A 2DZNB 3MHVC 3ZH9B 4QHTA 5FTKA 4L16A 4FW9A 3VFDA 1IN7A
chains in the Genus database with same CATH superfamily
1OKSA 1J5EM 4I8OA 4PT5A 3WHLA 5EP2A 3U6LA 3U6CA 4AG5A 4BLCA 2RRUA 3FRHA 3SATA 1HQCA 1XC8A 1IN4A 3ILKA 4X65M 4GH9A 4L78A 4X66M 5ITXE 4QOSA 1QQWA 3KOXE 1L2BA 3AJIB 3EIHA 2Y20A 4HLQA 2CEAA 2QP9X 4DR5M 2MH8A 2A5YB 3J7AS 3I4YA 3QYBA 2WSFF 2LVNC 2DAKA 3PXGA 1Y8GA 1TF0B 4RKUF 4IJFA 2DAEA 2VIIA 4NOOB 1PJJA 2MROB 2XEPA 2D7GA 5C1BA 3TWMA 3ZQJA 1IFYA 2BJVA 3CGWA 2UUCM 2DWZB 1T3TA 2X4AA 5LMUM 2BJWA 4LGYA 2O25A 2HAKA 3MMPA 3RGPA 4AG6A 4LJ7A 5EJCA 3GRVA 1VEKA 1GL7A 2L6OA 3HJ8A 5FTLA 2EKFA 1TH2A 1V33A 2UUAM 2XGNA 2R62A 3CTWB 1NHWC 2EUCA 2XSZA 1QVRA 2JZ1A 4IBGA 5EP1A 2LHCA 2OQ4A 3FUWA 1C7YA 2KNZA 1G41A 4KLNA 4QNMA 5ITXA 1NJFA 2D7EA 1A5TA 5EP4A 4OW0A 3TWLA 3SFZA 5IREB 4LJAA 4KODA 2KEBA 3FUXA 2LTUA 3AL0C 2R46A 2JY7A 4M0WA 3E46A 1DGFA 2M5ZA 4IBFA 4LJ5A 4DV2M 2CHVA 4I81A 2YQZA 3T38A 1PJIA 2UXBM 3RGSA 1WJ7A 4NXNM 5EXXA 3AKZA 3L25A 4GHLA 2FNAA 4JYAM 2L4FA 4IBKA 2JA2A 4TUWA 2HHHM 4AKIA 2FFJA 2KNAA 1MX0A 3A98B 3KOZE 3L27A 1YLAA 1OJLA 3J80S 2EA0A 1HNZM 1HJPA 2KZSA 1ZMWA 3K92A 3Q8GA 2YNMD 2C9CA 3LMMA 1G3IA 4IIWA 4P17A 4LFCM 1DGGA 1F4IA 3FUUA 2RGOA 4LF8M 2Y21A 4M9XA 1DO2A 4ITQA 1N33M 3HJQA 3TE6A 1N78A 1G8PA 2H5XA 4AI6A 1Q39A 1LV7A 1FNNA 3B9PA 1G59A 2BWEA 1WGLA 5FSWA 4X62M 4YHHM 4LF6M 4QHSA 1IXSB 1I4WA 3U61A 1IBMM 2JUJA 2Z4RA 2HKJA 2XZFA 3JAMS 1IY1A 1NNUC 1P3QQ 4JXJA 3U60A 2JY8A 3AOGA 3HJSA 4L16A 4IBCA 3I51A 3W0LB 2K47A 1IN7A 2CUZA 1ZMVA 1Q3BA 2XFSA 3GLFB 2EO2A 5F3WA 4Q7JA 4M9ZA 3J2PB 3C9PA 3UZUA 3PFIA 4NXMM 3IHPA 1NV9A 3UGJA 4DV4M 2C9OA 4PDGA 3A45A 2VDBB 2L09A 2Z8YM 3CF6E 4JI8M 1DV0A 2Q2EB 2Y0QA 2OOAA 2I7NA 3JR4A 4GC9A 2CV1A 3HU3A 2LXEA 4BB9A 1C1KA 1Z6TA 1L2CA 5KPZA 1IN8A 3H4JA 3U61B 4Z8XA 1WXQA 4IBBA 2CWBA 1L1ZA 2JZ0A 2KNVA 3KS4A 3HWSA 1DGBA 4L6V6 4CGYB 3IG5A 1QAMA 3FYDA 4P16A 1VG5A 2VQFM 4DV3M 5IT9S 2R18A 2V6ZM 2J5YA 4LJ4A 2QSFX 1D0MA 1MN3A 2R45A 4DV1M 2X8AA 3C3EA 2O01F 2N35A 3KW6A 3VLFB 4L15A 1GABA 1TDZA 4MB7A 2K6BA 3L28A 4AZFA 5ITQA 5JI2E 2MGWA 3SARA 1Z5AA 3EIEA 4G6ZA 4GMQA 3SAUA 2XF3A 4JI2M 3VDUA 3GO8A 5FTJA 3OTOM 1GKIA 1R6BX 3HHXA 2BNKA 1PM5A 3HZJA 1NNJA 5IWAM 3J81S 2ZTCA 4I5SA 4LGMA 4DR2M 4JV5M 3VKGA 2CHGA 1DO0A 1CUKA 4NSOB 1E32A 4RF1A 4G4RA 4W5WA 2RKOA 3PNYA 3GLIA 1XMOM 1I94M 1N32M 2UXCM 3E9SA 1GVNA 3I04M 5EP3A 2G8LA 1IXRC 5EXSA 2BWBA 2KHHA 4D82A 2ZANA 2ZAMA 1IN6A 2WSEF 1HR0M 3R9XB 1W5SA 4G4NA 1HQYE 4LF5M 2CV2A 4FWDA 4L8RC 2KRUA 4D80A 4DR4M 4NC6A 3T6PA 2QCUA 3KVWA 1IXZA 2ZM6M 1GJTA 4YY3M 3A46A 4GHAA 1N36M 2D7HA 4DUYM 2V1CA 4LJ8A 3QAUA 4IBIA 2QENA 1V92A 2JNHA 4IBDA 5KQ8A 2DENA 1QAQA 2FE8A 4NRVA 3GQ3A 3HHZA 3GRYA 3IECA 5GKNA 2XH9A 3HKPA 3D8BA 3J7BA 5FLXS 1L2DA 1Q02A 1R4GA 2CP8A 1SXJE 1W5TA 2CFOA 4RNAA 2XSZD 3U6EA 1IBLM 1ZQ9A 5KO3A 3GLHE 4REZA 3JR5A 3FTDA 4DBGB 1RU3A 2DVWB 2ERCA 3NWLA 3KOWE 3ZC7B 4OU7A 2DAIA 1GLNA 4WW0A 1NY5A 2LVOC 4ZPXA 1QUTA 1EE8A 3FUVA 3SC3A 1X37A 4K0KM 5BR8M 5ITYA 1LTMA 1K82A 4AW4A 1OIZA 1XXHA 3C3DA 1BVSA 1GL6A 1KYIA 1IQPA 3LW5F 3SBJA 2C5RA 1T43A 3KXEC 1QDTA 3GRUA 1N75A 4GEWA 3ZH9B 1SG9A 3B7NA 4CISA 3SAVA 4F1IA 3VK7A 4KHPM 3DA1A 3BBZA 5ITUA 2B3TA 1D0KA 1R5LA 2L4EA 4NL4H 1TTEA 2DHYA 4UN2B 4B3SM 5EQTA 2VQEM 3GPXA 5LMNM 3FTFA 3U5ZA 3CF0A 4FVMA 2KW0A 3C58A 2C99A 3KDSE 3T1HM 1SXJA 2QHOB 2LHGA 3VKHA 2ZBKB 3TWKA 1JB0F 4DV5M 3GLHA 4KT0F 3FTCA 2R4JA 4S12A 3HHWA 4GKJM 4OVZA 3SASA 1SXJD 2E5LM 1EFUB 3HX3A 1YUBA 2APLA 2ZAOA 2L2DA 4MGHA 2RGHA 1J09A 3LVVA 3GLGA 3AV0A 1NJGA 3WHKA 3U6SA 3DFZA 2CV0A 2QPAA 3L29A 4QOZC 4B7HA 2VF7A 4OX9M 1UM8A 2AHMA 4GITA 1OIPA 4LRTA 4M0DA 2O5RA 2G5GX 3KSJA 3M6AA 4HEOA 3THGA 3TQSA 2KRKA 5KPRA 2QBYA 3U6DA 3KOYE 2Z4SA 1G4AE 3UMMA 2DKLA 3V76A 1OQYA 2DAMA 1XMQM 2DWNA 2HWJA 3GP1A 3GLIE 2Y0TA 5DYGA 1UFZA 4JN6A 1QUSA 4G4OA 2HCBA 4R7GA 2F5PA 2JP7A 3MK6A 2DZLA 4IBJA 2FOIC 5JI3E 3PNVA 2FS1A 4HL4A 3QWLA 2DWMA 3NBXX 3W0FA 3U60B 1JQJC 1Z5BA 3DOAA 3SYKA 4GC5A 1PRBA 3BXWA 4LG2A 2LVAA 1L1TA 1QYRA 3J27B 4GKKM 8CATA 3BOSA 3HY5A 2R4EA 1NO1A 2DXIA 3LVWA 1R7RA 2K9DA 3K2LA 5FTMA 3SHFA 3GQ4A 4JI4M 2P5TA 2KA6B 5E26A 3HGIA 1K3WA 2G3QA 4II7A 3GPYA 2QBYB 3D8LA 4EIWA 4LF9M 1R2ZA 1KFVA 4X64M 3HU2A 3QYEA 1AUAA 3B7QA 3NBIA 3GPUA 4GRIA 1R2YA 3K8ZA 5KPTA 3IG8A 2UU9M 1XNRM 1H6UA 4BBAA 4LFAM 1NHGC 3LCUA 2LWXA 1ZMUA 2QZ4A 3FE3A 2Z3XA 3LQQA 3K9PA 3W67A 4DV6M 4LF7M 4RF0A 3U6QA 1XWIA 4DV0M 4PCZA 2CE7A 5DFLA 1HNWM 3SMSA 4LRSA 4DR3M 1TH4A 1XXHE 3ZCBB 1VEJA 5H37D 4DV7M 4DR1M 4IBEA 2UUBM 3KP1E 1OAOC 4I4LA 2X49A 1GO5A 1IY2A 4G3OA 1OFIA 1IBKM 1DGHA 4MGKE 3E21A 2OOBA 4M9SA 1NY6A 3M0EA 2F5QA 4FCTA 1HT2E 1JR3E 3HU1A 2GNOA 1TH3A 2J7OA 4MGYE 4WP2A 4PDIA 2QQ8A 3K9OA 3KP0E 1XNQM 1ZAEA 4CIZA 4JI5M 3AOEA 5ITRA 1PGYA 3VFDA 2EKKA 2KZUA 4LJ9A 1VDDA 3U6PA 1KSFX 2WSCF 2XZUA 3UK6A 4FWGA 4CJ6A 2H1RA 1N34M 2ZTDA 2L7HA 1QAOA 3U6MA 2V1UA 3A42A 4F2LA 3T15A 3GLIB 3DZDA 2DWLA 3GQ5A 1PJSA 1VEGA 1QDRA 2J7NA 2R0IA 3B74A 4FD2A 4A3VB 2LVQD 1EIJA 1Z59A 5KQDA 2C98A 2DHRA 3FKEA 3GRRA 3GLFE 5FTNA 4MH0E 3UJNA 2R44A 1SXJC 5BPVA 1E9RA 5C18A 2Z7JA 3GLGE 1NV8A 1G71A 1DGHB 2YFQA 3K1JA 3HHYA 4LFBM 3FYCA 4JI1M 1OFHA 1WIVA 2W82A 2YR0A 4JI0M 2KXEA 2JXNA 3B89A 1K3XA 4JI6M 2R6FA 3L2AA 3RFWA 5E6JA 3SMPA 3E4RA 2F5SA 2UXDM 5DYIA 4B7GA 1PJTA 4B7FA 3TPZA 1JR3A 3Q8XA 2XLJA 5ITTA 2F4VM 1IXSA 3FD9A 2R65A 1PJQA 4MGIE 1TDHA 3VK8A 1TGUA 4GIPA 4JI7M 1GJSA 1JR3D 3RE8A 5EXTA 4LF4M 3KFUG 2MR9A 2NQ8C 2CHQA 1HT1E 4FCWA 1S3SA 3SHGB 3H4MA 2CRUA 1OTRA 3KS8A 1WHCA 1NVMA 2FH0A 1QANA 4LZZA 3GLFA 4CHTB 1Q3CA 2K0BX 5IZ7D 4G4QA 4AKGA 1D2NA 1XXHB 1V34A 2C96A 4KO8A 2F5OA 5L8RF 1ORYB 1OAIA 3LCVB 4XGIA 4DR6M 1QZEA 2I7PA 2LNHC 2QNJA 1MU5A 1YSYA 5EXPA 4Z6YA 2JY6B 1IN5A 4QNRA 2LBCA 4ANRA 4LZJA 1TR8A 2LVPC 2DAGA 3I4VA 2L7IA 4L4UA 4Y28F 1T6OA 2OPFA 4DUZM 3CF2A 4FCVA 2LH0A 2M60A 3SYLA 3U5ZB 4LCBA 1FJGM 4LY6A 1Z5CA 1L8QA 2KDLA 2MJ5B 1IY0A 5DNYA 4D81A 1SXJB 3FTEA 4FWHA 4NRWA 2WZJA 1QZMA 4R3DA 2VF8A 4LJ6A 3PVSA 3GLHB 4JI3M 1E9SA 2OO9A 3M7GA 3R8FA 2HL7A 5A2QS 1NSFA 4OVZB 1N77A 2EJSA 1MJGM 3AFHA 3KSXA 3T1YM 1ZV1A 4XK8F 4MM3B 4R71A 3GLGB 1AIPC 2GQFA 2DNAA 3FRIA 1VDLA 2XFTA 4XBOA 1XHBA 1WR1B 4B3TM 4IJEA 3F92A 4B08A 1E94E 1VQ1A 2F5NA 1IM2A 3VDPA 1YE9A 4NSRA 4MGZE 1D0LA 2DZOB 3GPPA 1J7KA 3U6OA 1HNXM 4B3MM 4AKHA 3LQRA 3B7ZA 3W68A 2DI0A 4WURA 3SAWA 3TL4X 1WGNA 4PD2A 7CATA 3L26A 4DR7M 2JY5A 2DZNB 3FUTA 3MHVC 4B3RM 2JWSA 3I01M 1XB2B 3MJ5A 4QHTA 5FTKA 4FW9A 4AQYM 3AOEC
chains in the Genus database with same CATH topology
1J5EM 4I8OA 4PT5A 3WHLA 5EP2A 3U6LA 3U6CA 4AG5A 4BLCA 3SATA 1HQCA 1XC8A 1IN4A 3ILKA 4X65M 4GH9A 4L78A 4X66M 5ITXE 4QOSA 1QQWA 3KOXE 1L2BA 3AJIB 3EIHA 2Y20A 4HLQA 2CEAA 2QP9X 4DR5M 2A5YB 3J7AS 3I4YA 3PXGA 4IJFA 2VIIA 4NOOB 1PJJA 2XEPA 2D7GA 5C1BA 3TWMA 2BJVA 2UUCM 2DWZB 1T3TA 2X4AA 5LMUM 2BJWA 4LGYA 3RGPA 4AG6A 4LJ7A 5EJCA 3GRVA 1GL7A 2L6OA 3HJ8A 5FTLA 1TH2A 2UUAM 2XGNA 2R62A 3CTWB 1NHWC 2EUCA 2XSZA 1QVRA 4IBGA 5EP1A 2OQ4A 3FUWA 1G41A 4KLNA 4QNMA 5ITXA 1NJFA 2D7EA 5EP4A 4OW0A 3TWLA 3SFZA 5IREB 4LJAA 4KODA 2KEBA 3FUXA 3AL0C 2R46A 4M0WA 1DGFA 2M5ZA 4IBFA 4LJ5A 4DV2M 2CHVA 4I81A 2YQZA 3T38A 1PJIA 2UXBM 3RGSA 4NXNM 5EXXA 3AKZA 3L25A 4GHLA 2FNAA 4JYAM 4IBKA 2JA2A 4TUWA 2HHHM 4AKIA 2FFJA 1MX0A 3A98B 3KOZE 3L27A 3J80S 1OJLA 2EA0A 1HNZM 2KZSA 3K92A 2YNMD 2C9CA 3LMMA 1G3IA 4IIWA 4LFCM 1DGGA 3FUUA 2RGOA 4LF8M 2Y21A 4M9XA 1DO2A 4ITQA 1N33M 3HJQA 3TE6A 1N78A 1G8PA 4AI6A 1Q39A 1LV7A 1FNNA 3B9PA 1G59A 5FSWA 4X62M 4YHHM 4LF6M 4QHSA 1IXSB 1I4WA 3U61A 1IBMM 2Z4RA 2HKJA 2XZFA 3JAMS 1IY1A 1NNUC 4JXJA 3U60A 3AOGA 3HJSA 4L16A 4IBCA 3I51A 3W0LB 2K47A 2XFSA 2CUZA 1IN7A 1Q3BA 5F3WA 3GLFB 2EO2A 4M9ZA 3J2PB 3UZUA 3PFIA 4NXMM 3UGJA 4DV4M 2C9OA 4PDGA 3A45A 2L09A 3CF6E 4JI8M 2Q2EB 2Y0QA 2I7NA 3JR4A 4GC9A 2CV1A 3HU3A 2LXEA 4BB9A 1C1KA 1Z6TA 1L2CA 5KPZA 1IN8A 3U61B 4Z8XA 1WXQA 4IBBA 1L1ZA 3KS4A 3HWSA 1DGBA 4CGYB 3IG5A 1QAMA 3FYDA 4P16A 2VQFM 4DV3M 5IT9S 2R18A 2V6ZM 4LJ4A 2R45A 4DV1M 2X8AA 3KW6A 3VLFB 4L15A 1TDZA 4MB7A 4AZFA 3L28A 5ITQA 5JI2E 3SARA 1Z5AA 3EIEA 4G6ZA 4GMQA 3SAUA 2XF3A 4JI2M 3VDUA 3GO8A 5FTJA 3OTOM 1GKIA 1R6BX 3HHXA 2BNKA 1PM5A 1NNJA 5IWAM 3J81S 4I5SA 4LGMA 4DR2M 4JV5M 3VKGA 2CHGA 1DO0A 4NSOB 1E32A 4RF1A 4G4RA 4W5WA 2RKOA 3PNYA 3GLIA 1XMOM 1I94M 1N32M 2UXCM 3E9SA 1GVNA 5EP3A 2G8LA 1IXRC 5EXSA 4D82A 2ZANA 2ZAMA 1IN6A 1HR0M 3R9XB 1W5SA 4G4NA 1HQYE 4LF5M 2CV2A 4FWDA 4L8RC 2KRUA 4D80A 2QCUA 3KVWA 1IXZA 4YY3M 3A46A 4GHAA 1N36M 2D7HA 4DUYM 2V1CA 4LJ8A 3QAUA 4IBIA 2QENA 4IBDA 5KQ8A 2ZM6M 4JI6M 1QAQA 2FE8A 4NRVA 3GQ3A 3HHZA 3GRYA 5GKNA 2XH9A 3HKPA 3D8BA 3J7BA 5FLXS 1L2DA 4RNAA 1SXJE 1W5TA 2CFOA 3U6EA 2XSZD 1IBLM 1ZQ9A 5KO3A 4REZA 3JR5A 3FTDA 2DVWB 2ERCA 3NWLA 3KOWE 3ZC7B 4OU7A 1GLNA 4WW0A 1NY5A 4ZPXA 1EE8A 3FUVA 3SC3A 1X37A 4K0KM 5BR8M 5ITYA 1K82A 4AW4A 1XXHA 1GL6A 1KYIA 1IQPA 3SBJA 2C5RA 3KXEC 3GRUA 3ZH9B 1N75A 4CISA 3SAVA 3VK7A 4KHPM 3DA1A 5ITUA 4NL4H 4B3SM 5EQTA 2VQEM 3GPXA 5LMNM 3FTFA 3U5ZA 3CF0A 4FVMA 2KW0A 3C58A 2C99A 3KDSE 3T1HM 1SXJA 3VKHA 2ZBKB 3TWKA 4DV5M 3GLHA 3FTCA 2R4JA 4S12A 3HHWA 4GKJM 4OVZA 3SASA 1SXJD 2E5LM 1YUBA 2ZAOA 4MGHA 2RGHA 1J09A 3LVVA 3GLGA 3AV0A 1NJGA 3WHKA 3U6SA 3DFZA 2CV0A 2QPAA 3L29A 4QOZC 4B7HA 4OX9M 1UM8A 2AHMA 4GITA 4M0DA 4LRTA 2O5RA 2G5GX 3KSJA 3M6AA 3THGA 5KPRA 3TQSA 2KRKA 2QBYA 3U6DA 3KOYE 2Z4SA 1G4AE 3UMMA 1XMQM 2DWNA 3GP1A 2Y0TA 5DYGA 4JN6A 4G4OA 2HCBA 4R7GA 2F5PA 3MK6A 4IBJA 2FOIC 5JI3E 3PNVA 4HL4A 3QWLA 2DWMA 3W0FA 3U60B 1JQJC 1Z5BA 3DOAA 3SYKA 4GC5A 4LG2A 1L1TA 1QYRA 3J27B 4GKKM 8CATA 3BOSA 2R4EA 2DXIA 3LVWA 1R7RA 3K2LA 5FTMA 3SHFA 3GQ4A 4JI4M 2P5TA 2KA6B 5E26A 3HGIA 1K3WA 4II7A 4JI7M 3GPYA 2QBYB 3D8LA 4EIWA 4LF9M 1R2ZA 1KFVA 4X64M 3HU2A 3NBIA 3GPUA 4GRIA 1R2YA 3K8ZA 5KPTA 3IG8A 2UU9M 1XNRM 1H6UA 4BBAA 4LFAM 1NHGC 2LWXA 2QZ4A 2Z3XA 3LQQA 4DV6M 4LF7M 4RF0A 3U6QA 1XWIA 4DV0M 4PCZA 2CE7A 1HNWM 3SMSA 4LRSA 4DR3M 1TH4A 3ZCBB 5H37D 4DV7M 4DR1M 4IBEA 2UUBM 3KP1E 4I4LA 2X49A 1IY2A 1OFIA 1IBKM 1DGHA 4MGKE 4M9SA 1NY6A 3M0EA 2F5QA 4FCTA 1HT2E 3HU1A 4PDIA 4MGYE 1TH3A 2J7OA 4DR4M 1XNQM 3KP0E 1ZAEA 4JI5M 3AOEA 5ITRA 3VFDA 2KZUA 4LJ9A 1VDDA 3U6PA 1KSFX 2XZUA 3UK6A 4FWGA 2H1RA 1N34M 3U6MA 2L7HA 1QAOA 2V1UA 3A42A 3T15A 3GLIB 3DZDA 2DWLA 3GQ5A 2J7NA 4FD2A 4A3VB 1Z59A 5KQDA 2C98A 2DHRA 3FKEA 3GRRA 5FTNA 4MH0E 3UJNA 1SXJC 5BPVA 1E9RA 5C18A 2Z7JA 1DGHB 2YFQA 3K1JA 3HHYA 4LFBM 3FYCA 4JI1M 1OFHA 2W82A 2YR0A 4JI0M 2KXEA 1K3XA 3L2AA 3RFWA 5E6JA 3SMPA 3E4RA 2F5SA 2UXDM 5DYIA 4B7GA 4B7FA 3TPZA 1JR3A 3Q8XA 2XLJA 5ITTA 2F4VM 3FD9A 2R65A 4MGIE 1TDHA 3VK8A 1TGUA 4GIPA 1JR3D 3RE8A 5EXTA 4LF4M 3KFUG 2NQ8C 2CHQA 1HT1E 4FCWA 1S3SA 3SHGB 3H4MA 3KS8A 1NVMA 1QANA 4LZZA 3GLFA 4CHTB 1Q3CA 4AKGA 5IZ7D 4G4QA 1D2NA 1XXHB 4KO8A 2C96A 2F5OA 1ORYB 4XGIA 4DR6M 2I7PA 2LNHC 5EXPA 1MU5A 1YSYA 4Z6YA 1IN5A 4QNRA 4LZJA 3I4VA 2L7IA 4L4UA 2OPFA 4DUZM 3CF2A 4FCVA 2LH0A 2M60A 3SYLA 3U5ZB 4LCBA 1FJGM 4LY6A 1Z5CA 1L8QA 1IY0A 5DNYA 4D81A 1SXJB 3FTEA 4FWHA 4NRWA 1QZMA 4R3DA 4LJ6A 3PVSA 3GLHB 4JI3M 1E9SA 3M7GA 3R8FA 2HL7A 5A2QS 1NSFA 4OVZB 1N77A 3AFHA 3KSXA 3T1YM 4MM3B 3GLGB 2XFTA 4XBOA 1XHBA 4B3TM 4IJEA 4B08A 1E94E 2F5NA 1IM2A 3VDPA 1YE9A 4NSRA 4MGZE 2DZOB 3GPPA 3U6OA 1J7KA 1HNXM 4B3MM 4AKHA 3LQRA 3SAWA 4WURA 4DR7M 3TL4X 4PD2A 7CATA 3L26A 2DZNB 3FUTA 3MHVC 4B3RM 3MJ5A 4QHTA 5FTKA 4FW9A 4AQYM 3AOEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJ9 A;  3GLF B;  1KSF X;  3UK6 A;  4FWG A;  3WHL A;  2V1U A;  5EP2 A;  3PFI A;  3GLI B;  3DZD A;  5EQT A;  2C9O A;  4FD2 A;  4A3V B;  1HQC A;  3CF0 A;  1IN4 A;  2C98 A;  2DHR A;  2C99 A;  3KDS E;  1SXJ A;  4QOS A;  5FTN A;  1SXJ C;  3AJI B;  3EIH A;  3GLH A;  2CEA A;  2QP9 X;  3HU3 A;  5C18 A;  1C1K A;  1IN8 A;  3U61 B;  4Z8X A;  3PXG A;  3K1J A;  1SXJ D;  1OFH A;  3HWS A;  2VII A;  2ZAO A;  5C1B A;  3GLG A;  2BJV A;  1NJG A;  2V6Z M;  5DYI A;  3WHK A;  4LJ4 A;  1JR3 A;  2QPA A;  2DWZ B;  2X8A A;  2BJW A;  1UM8 A;  3KW6 A;  3VLF B;  4L15 A;  5JI2 E;  4GIT A;  2R65 A;  4LRT A;  4LJ7 A;  2QBY A;  3EIE A;  3M6A A;  2KRK A;  1JR3 D;  2Z4S A;  1G4A E;  5EXT A;  5FTJ A;  2CHQ A;  5FTL A;  1HT1 E;  1R6B X;  2R62 A;  1S3S A;  4FCW A;  2XSZ A;  3H4M A;  1QVR A;  5EP1 A;  5DYG A;  4JN6 A;  1NVM A;  4LZZ A;  4LGM A;  3GLF A;  1G41 A;  2HCB A;  4KLN A;  4QNM A;  2CHG A;  1NJF A;  1DO0 A;  1XXH B;  1D2N A;  1E32 A;  2C96 A;  4KO8 A;  5EP4 A;  5JI3 E;  2RKO A;  3GLI A;  4LJA A;  4KOD A;  3U60 B;  1JQJ C;  5EP3 A;  1IXR C;  5EXP A;  5EXS A;  3SYK A;  4D82 A;  2ZAN A;  2ZAM A;  1IN6 A;  2CHV A;  4I81 A;  4LJ5 A;  1IN5 A;  3BOS A;  4QNR A;  1W5S A;  1R7R A;  1HQY E;  5EXX A;  5FTM A;  4L4U A;  2FNA A;  4FWD A;  3CF2 A;  4FCV A;  4D80 A;  3SYL A;  3U5Z B;  2QBY B;  4LCB A;  4LY6 A;  4EIW A;  1L8Q A;  1IY0 A;  4D81 A;  1OJL A;  1SXJ B;  1IXZ A;  3HU2 A;  4FWH A;  1QZM A;  4LJ8 A;  4LJ6 A;  3PVS A;  2C9C A;  2QEN A;  3GLH B;  1G3I A;  3R8F A;  3D8B A;  1NSF A;  1DO2 A;  1SXJ E;  1W5T A;  2QZ4 A;  2XSZ D;  1XWI A;  2CE7 A;  1LV7 A;  3GLG B;  4LRS A;  2DVW B;  1FNN A;  3B9P A;  4QHS A;  4WW0 A;  4I4L A;  1IXS B;  1E94 E;  1NY5 A;  4ZPX A;  1IY2 A;  1IM2 A;  1OFI A;  3SC3 A;  1X37 A;  2DZO B;  1J7K A;  2Z4R A;  1NY6 A;  3M0E A;  1XXH A;  4FCT A;  1HT2 E;  3HU1 A;  1KYI A;  1IQP A;  1IY1 A;  2DZN B;  3MHV C;  3ZH9 B;  4QHT A;  5FTK A;  4L16 A;  4FW9 A;  3VFD A;  1IN7 A; 
#chains in the Genus database with same CATH topology
 1OKS A;  1J5E M;  4I8O A;  4PT5 A;  3WHL A;  5EP2 A;  3U6L A;  3U6C A;  4AG5 A;  4BLC A;  2RRU A;  3FRH A;  3SAT A;  1HQC A;  1XC8 A;  1IN4 A;  3ILK A;  4X65 M;  4GH9 A;  4L78 A;  4X66 M;  5ITX E;  4QOS A;  1QQW A;  3KOX E;  1L2B A;  3AJI B;  3EIH A;  2Y20 A;  4HLQ A;  2CEA A;  2QP9 X;  4DR5 M;  2MH8 A;  2A5Y B;  3J7A S;  3I4Y A;  3QYB A;  2WSF F;  2LVN C;  2DAK A;  3PXG A;  1Y8G A;  1TF0 B;  4RKU F;  4IJF A;  2DAE A;  2VII A;  4NOO B;  1PJJ A;  2MRO B;  2XEP A;  2D7G A;  5C1B A;  3TWM A;  3ZQJ A;  1IFY A;  2BJV A;  3CGW A;  2UUC M;  2DWZ B;  1T3T A;  2X4A A;  5LMU M;  2BJW A;  4LGY A;  2O25 A;  2HAK A;  3MMP A;  3RGP A;  4AG6 A;  4LJ7 A;  5EJC A;  3GRV A;  1VEK A;  1GL7 A;  2L6O A;  3HJ8 A;  5FTL A;  2EKF A;  1TH2 A;  1V33 A;  2UUA M;  2XGN A;  2R62 A;  3CTW B;  1NHW C;  2EUC A;  2XSZ A;  1QVR A;  2JZ1 A;  4IBG A;  5EP1 A;  2LHC A;  2OQ4 A;  3FUW A;  1C7Y A;  2KNZ A;  1G41 A;  4KLN A;  4QNM A;  5ITX A;  1NJF A;  2D7E A;  1A5T A;  5EP4 A;  4OW0 A;  3TWL A;  3SFZ A;  5IRE B;  4LJA A;  4KOD A;  2KEB A;  3FUX A;  2LTU A;  3AL0 C;  2R46 A;  2JY7 A;  4M0W A;  3E46 A;  1DGF A;  2M5Z A;  4IBF A;  4LJ5 A;  4DV2 M;  2CHV A;  4I81 A;  2YQZ A;  3T38 A;  1PJI A;  2UXB M;  3RGS A;  1WJ7 A;  4NXN M;  5EXX A;  3AKZ A;  3L25 A;  4GHL A;  2FNA A;  4JYA M;  2L4F A;  4IBK A;  2JA2 A;  4TUW A;  2HHH M;  4AKI A;  2FFJ A;  2KNA A;  1MX0 A;  3A98 B;  3KOZ E;  3L27 A;  1YLA A;  1OJL A;  3J80 S;  2EA0 A;  1HNZ M;  1HJP A;  2KZS A;  1ZMW A;  3K92 A;  3Q8G A;  2YNM D;  2C9C A;  3LMM A;  1G3I A;  4IIW A;  4P17 A;  4LFC M;  1DGG A;  1F4I A;  3FUU A;  2RGO A;  4LF8 M;  2Y21 A;  4M9X A;  1DO2 A;  4ITQ A;  1N33 M;  3HJQ A;  3TE6 A;  1N78 A;  1G8P A;  2H5X A;  4AI6 A;  1Q39 A;  1LV7 A;  1FNN A;  3B9P A;  1G59 A;  2BWE A;  1WGL A;  5FSW A;  4X62 M;  4YHH M;  4LF6 M;  4QHS A;  1IXS B;  1I4W A;  3U61 A;  1IBM M;  2JUJ A;  2Z4R A;  2HKJ A;  2XZF A;  3JAM S;  1IY1 A;  1NNU C;  1P3Q Q;  4JXJ A;  3U60 A;  2JY8 A;  3AOG A;  3HJS A;  4L16 A;  4IBC A;  3I51 A;  3W0L B;  2K47 A;  1IN7 A;  2CUZ A;  1ZMV A;  1Q3B A;  2XFS A;  3GLF B;  2EO2 A;  5F3W A;  4Q7J A;  4M9Z A;  3J2P B;  3C9P A;  3UZU A;  3PFI A;  4NXM M;  3IHP A;  1NV9 A;  3UGJ A;  4DV4 M;  2C9O A;  4PDG A;  3A45 A;  2VDB B;  2L09 A;  2Z8Y M;  3CF6 E;  4JI8 M;  1DV0 A;  2Q2E B;  2Y0Q A;  2OOA A;  2I7N A;  3JR4 A;  4GC9 A;  2CV1 A;  3HU3 A;  2LXE A;  4BB9 A;  1C1K A;  1Z6T A;  1L2C A;  5KPZ A;  1IN8 A;  3H4J A;  3U61 B;  4Z8X A;  1WXQ A;  4IBB A;  2CWB A;  1L1Z A;  2JZ0 A;  2KNV A;  3KS4 A;  3HWS A;  1DGB A;  4L6V 6;  4CGY B;  3IG5 A;  1QAM A;  3FYD A;  4P16 A;  1VG5 A;  2VQF M;  4DV3 M;  5IT9 S;  2R18 A;  2V6Z M;  2J5Y A;  4LJ4 A;  2QSF X;  1D0M A;  1MN3 A;  2R45 A;  4DV1 M;  2X8A A;  3C3E A;  2O01 F;  2N35 A;  3KW6 A;  3VLF B;  4L15 A;  1GAB A;  1TDZ A;  4MB7 A;  2K6B A;  3L28 A;  4AZF A;  5ITQ A;  5JI2 E;  2MGW A;  3SAR A;  1Z5A A;  3EIE A;  4G6Z A;  4GMQ A;  3SAU A;  2XF3 A;  4JI2 M;  3VDU A;  3GO8 A;  5FTJ A;  3OTO M;  1GKI A;  1R6B X;  3HHX A;  2BNK A;  1PM5 A;  3HZJ A;  1NNJ A;  5IWA M;  3J81 S;  2ZTC A;  4I5S A;  4LGM A;  4DR2 M;  4JV5 M;  3VKG A;  2CHG A;  1DO0 A;  1CUK A;  4NSO B;  1E32 A;  4RF1 A;  4G4R A;  4W5W A;  2RKO A;  3PNY A;  3GLI A;  1XMO M;  1I94 M;  1N32 M;  2UXC M;  3E9S A;  1GVN A;  3I04 M;  5EP3 A;  2G8L A;  1IXR C;  5EXS A;  2BWB A;  2KHH A;  4D82 A;  2ZAN A;  2ZAM A;  1IN6 A;  2WSE F;  1HR0 M;  3R9X B;  1W5S A;  4G4N A;  1HQY E;  4LF5 M;  2CV2 A;  4FWD A;  4L8R C;  2KRU A;  4D80 A;  4DR4 M;  4NC6 A;  3T6P A;  2QCU A;  3KVW A;  1IXZ A;  2ZM6 M;  1GJT A;  4YY3 M;  3A46 A;  4GHA A;  1N36 M;  2D7H A;  4DUY M;  2V1C A;  4LJ8 A;  3QAU A;  4IBI A;  2QEN A;  1V92 A;  2JNH A;  4IBD A;  5KQ8 A;  2DEN A;  1QAQ A;  2FE8 A;  4NRV A;  3GQ3 A;  3HHZ A;  3GRY A;  3IEC A;  5GKN A;  2XH9 A;  3HKP A;  3D8B A;  3J7B A;  5FLX S;  1L2D A;  1Q02 A;  1R4G A;  2CP8 A;  1SXJ E;  1W5T A;  2CFO A;  4RNA A;  2XSZ D;  3U6E A;  1IBL M;  1ZQ9 A;  5KO3 A;  3GLH E;  4REZ A;  3JR5 A;  3FTD A;  4DBG B;  1RU3 A;  2DVW B;  2ERC A;  3NWL A;  3KOW E;  3ZC7 B;  4OU7 A;  2DAI A;  1GLN A;  4WW0 A;  1NY5 A;  2LVO C;  4ZPX A;  1QUT A;  1EE8 A;  3FUV A;  3SC3 A;  1X37 A;  4K0K M;  5BR8 M;  5ITY A;  1LTM A;  1K82 A;  4AW4 A;  1OIZ A;  1XXH A;  3C3D A;  1BVS A;  1GL6 A;  1KYI A;  1IQP A;  3LW5 F;  3SBJ A;  2C5R A;  1T43 A;  3KXE C;  1QDT A;  3GRU A;  1N75 A;  4GEW A;  3ZH9 B;  1SG9 A;  3B7N A;  4CIS A;  3SAV A;  4F1I A;  3VK7 A;  4KHP M;  3DA1 A;  3BBZ A;  5ITU A;  2B3T A;  1D0K A;  1R5L A;  2L4E A;  4NL4 H;  1TTE A;  2DHY A;  4UN2 B;  4B3S M;  5EQT A;  2VQE M;  3GPX A;  5LMN M;  3FTF A;  3U5Z A;  3CF0 A;  4FVM A;  2KW0 A;  3C58 A;  2C99 A;  3KDS E;  3T1H M;  1SXJ A;  2QHO B;  2LHG A;  3VKH A;  2ZBK B;  3TWK A;  1JB0 F;  4DV5 M;  3GLH A;  4KT0 F;  3FTC A;  2R4J A;  4S12 A;  3HHW A;  4GKJ M;  4OVZ A;  3SAS A;  1SXJ D;  2E5L M;  1EFU B;  3HX3 A;  1YUB A;  2APL A;  2ZAO A;  2L2D A;  4MGH A;  2RGH A;  1J09 A;  3LVV A;  3GLG A;  3AV0 A;  1NJG A;  3WHK A;  3U6S A;  3DFZ A;  2CV0 A;  2QPA A;  3L29 A;  4QOZ C;  4B7H A;  2VF7 A;  4OX9 M;  1UM8 A;  2AHM A;  4GIT A;  1OIP A;  4LRT A;  4M0D A;  2O5R A;  2G5G X;  3KSJ A;  3M6A A;  4HEO A;  3THG A;  3TQS A;  2KRK A;  5KPR A;  2QBY A;  3U6D A;  3KOY E;  2Z4S A;  1G4A E;  3UMM A;  2DKL A;  3V76 A;  1OQY A;  2DAM A;  1XMQ M;  2DWN A;  2HWJ A;  3GP1 A;  3GLI E;  2Y0T A;  5DYG A;  1UFZ A;  4JN6 A;  1QUS A;  4G4O A;  2HCB A;  4R7G A;  2F5P A;  2JP7 A;  3MK6 A;  2DZL A;  4IBJ A;  2FOI C;  5JI3 E;  3PNV A;  2FS1 A;  4HL4 A;  3QWL A;  2DWM A;  3NBX X;  3W0F A;  3U60 B;  1JQJ C;  1Z5B A;  3DOA A;  3SYK A;  4GC5 A;  1PRB A;  3BXW A;  4LG2 A;  2LVA A;  1L1T A;  1QYR A;  3J27 B;  4GKK M;  8CAT A;  3BOS A;  3HY5 A;  2R4E A;  1NO1 A;  2DXI A;  3LVW A;  1R7R A;  2K9D A;  3K2L A;  5FTM A;  3SHF A;  3GQ4 A;  4JI4 M;  2P5T A;  2KA6 B;  5E26 A;  3HGI A;  1K3W A;  2G3Q A;  4II7 A;  3GPY A;  2QBY B;  3D8L A;  4EIW A;  4LF9 M;  1R2Z A;  1KFV A;  4X64 M;  3HU2 A;  3QYE A;  1AUA A;  3B7Q A;  3NBI A;  3GPU A;  4GRI A;  1R2Y A;  3K8Z A;  5KPT A;  3IG8 A;  2UU9 M;  1XNR M;  1H6U A;  4BBA A;  4LFA M;  1NHG C;  3LCU A;  2LWX A;  1ZMU A;  2QZ4 A;  3FE3 A;  2Z3X A;  3LQQ A;  3K9P A;  3W67 A;  4DV6 M;  4LF7 M;  4RF0 A;  3U6Q A;  1XWI A;  4DV0 M;  4PCZ A;  2CE7 A;  5DFL A;  1HNW M;  3SMS A;  4LRS A;  4DR3 M;  1TH4 A;  1XXH E;  3ZCB B;  1VEJ A;  5H37 D;  4DV7 M;  4DR1 M;  4IBE A;  2UUB M;  3KP1 E;  1OAO C;  4I4L A;  2X49 A;  1GO5 A;  1IY2 A;  4G3O A;  1OFI A;  1IBK M;  1DGH A;  4MGK E;  3E21 A;  2OOB A;  4M9S A;  1NY6 A;  3M0E A;  2F5Q A;  4FCT A;  1HT2 E;  1JR3 E;  3HU1 A;  2GNO A;  1TH3 A;  2J7O A;  4MGY E;  4WP2 A;  4PDI A;  2QQ8 A;  3K9O A;  3KP0 E;  1XNQ M;  1ZAE A;  4CIZ A;  4JI5 M;  3AOE A;  5ITR A;  1PGY A;  3VFD A;  2EKK A;  2KZU A;  4LJ9 A;  1VDD A;  3U6P A;  1KSF X;  2WSC F;  2XZU A;  3UK6 A;  4FWG A;  4CJ6 A;  2H1R A;  1N34 M;  2ZTD A;  2L7H A;  1QAO A;  3U6M A;  2V1U A;  3A42 A;  4F2L A;  3T15 A;  3GLI B;  3DZD A;  2DWL A;  3GQ5 A;  1PJS A;  1VEG A;  1QDR A;  2J7N A;  2R0I A;  3B74 A;  4FD2 A;  4A3V B;  2LVQ D;  1EIJ A;  1Z59 A;  5KQD A;  2C98 A;  2DHR A;  3FKE A;  3GRR A;  3GLF E;  5FTN A;  4MH0 E;  3UJN A;  2R44 A;  1SXJ C;  5BPV A;  1E9R A;  5C18 A;  2Z7J A;  3GLG E;  1NV8 A;  1G71 A;  1DGH B;  2YFQ A;  3K1J A;  3HHY A;  4LFB M;  3FYC A;  4JI1 M;  1OFH A;  1WIV A;  2W82 A;  2YR0 A;  4JI0 M;  2KXE A;  2JXN A;  3B89 A;  1K3X A;  4JI6 M;  2R6F A;  3L2A A;  3RFW A;  5E6J A;  3SMP A;  3E4R A;  2F5S A;  2UXD M;  5DYI A;  4B7G A;  1PJT A;  4B7F A;  3TPZ A;  1JR3 A;  3Q8X A;  2XLJ A;  5ITT A;  2F4V M;  1IXS A;  3FD9 A;  2R65 A;  1PJQ A;  4MGI E;  1TDH A;  3VK8 A;  1TGU A;  4GIP A;  4JI7 M;  1GJS A;  1JR3 D;  3RE8 A;  5EXT A;  4LF4 M;  3KFU G;  2MR9 A;  2NQ8 C;  2CHQ A;  1HT1 E;  4FCW A;  1S3S A;  3SHG B;  3H4M A;  2CRU A;  1OTR A;  3KS8 A;  1WHC A;  1NVM A;  2FH0 A;  1QAN A;  4LZZ A;  3GLF A;  4CHT B;  1Q3C A;  2K0B X;  5IZ7 D;  4G4Q A;  4AKG A;  1D2N A;  1XXH B;  1V34 A;  2C96 A;  4KO8 A;  2F5O A;  5L8R F;  1ORY B;  1OAI A;  3LCV B;  4XGI A;  4DR6 M;  1QZE A;  2I7P A;  2LNH C;  2QNJ A;  1MU5 A;  1YSY A;  5EXP A;  4Z6Y A;  2JY6 B;  1IN5 A;  4QNR A;  2LBC A;  4ANR A;  4LZJ A;  1TR8 A;  2LVP C;  2DAG A;  3I4V A;  2L7I A;  4L4U A;  4Y28 F;  1T6O A;  2OPF A;  4DUZ M;  3CF2 A;  4FCV A;  2LH0 A;  2M60 A;  3SYL A;  3U5Z B;  4LCB A;  1FJG M;  4LY6 A;  1Z5C A;  1L8Q A;  2KDL A;  2MJ5 B;  1IY0 A;  5DNY A;  4D81 A;  1SXJ B;  3FTE A;  4FWH A;  4NRW A;  2WZJ A;  1QZM A;  4R3D A;  2VF8 A;  4LJ6 A;  3PVS A;  3GLH B;  4JI3 M;  1E9S A;  2OO9 A;  3M7G A;  3R8F A;  2HL7 A;  5A2Q S;  1NSF A;  4OVZ B;  1N77 A;  2EJS A;  1MJG M;  3AFH A;  3KSX A;  3T1Y M;  1ZV1 A;  4XK8 F;  4MM3 B;  4R71 A;  3GLG B;  1AIP C;  2GQF A;  2DNA A;  3FRI A;  1VDL A;  2XFT A;  4XBO A;  1XHB A;  1WR1 B;  4B3T M;  4IJE A;  3F92 A;  4B08 A;  1E94 E;  1VQ1 A;  2F5N A;  1IM2 A;  3VDP A;  1YE9 A;  4NSR A;  4MGZ E;  1D0L A;  2DZO B;  3GPP A;  1J7K A;  3U6O A;  1HNX M;  4B3M M;  4AKH A;  3LQR A;  3B7Z A;  3W68 A;  2DI0 A;  4WUR A;  3SAW A;  3TL4 X;  1WGN A;  4PD2 A;  7CAT A;  3L26 A;  4DR7 M;  2JY5 A;  2DZN B;  3FUT A;  3MHV C;  4B3R M;  2JWS A;  3I01 M;  1XB2 B;  3MJ5 A;  4QHT A;  5FTK A;  4FW9 A;  4AQY M;  3AOE C; 
#chains in the Genus database with same CATH homology
 1J5E M;  4I8O A;  4PT5 A;  3WHL A;  5EP2 A;  3U6L A;  3U6C A;  4AG5 A;  4BLC A;  3SAT A;  1HQC A;  1XC8 A;  1IN4 A;  3ILK A;  4X65 M;  4GH9 A;  4L78 A;  4X66 M;  5ITX E;  4QOS A;  1QQW A;  3KOX E;  1L2B A;  3AJI B;  3EIH A;  2Y20 A;  4HLQ A;  2CEA A;  2QP9 X;  4DR5 M;  2A5Y B;  3J7A S;  3I4Y A;  3PXG A;  4IJF A;  2VII A;  4NOO B;  1PJJ A;  2XEP A;  2D7G A;  5C1B A;  3TWM A;  2BJV A;  2UUC M;  2DWZ B;  1T3T A;  2X4A A;  5LMU M;  2BJW A;  4LGY A;  3RGP A;  4AG6 A;  4LJ7 A;  5EJC A;  3GRV A;  1GL7 A;  2L6O A;  3HJ8 A;  5FTL A;  1TH2 A;  2UUA M;  2XGN A;  2R62 A;  3CTW B;  1NHW C;  2EUC A;  2XSZ A;  1QVR A;  4IBG A;  5EP1 A;  2OQ4 A;  3FUW A;  1G41 A;  4KLN A;  4QNM A;  5ITX A;  1NJF A;  2D7E A;  5EP4 A;  4OW0 A;  3TWL A;  3SFZ A;  5IRE B;  4LJA A;  4KOD A;  2KEB A;  3FUX A;  3AL0 C;  2R46 A;  4M0W A;  1DGF A;  2M5Z A;  4IBF A;  4LJ5 A;  4DV2 M;  2CHV A;  4I81 A;  2YQZ A;  3T38 A;  1PJI A;  2UXB M;  3RGS A;  4NXN M;  5EXX A;  3AKZ A;  3L25 A;  4GHL A;  2FNA A;  4JYA M;  4IBK A;  2JA2 A;  4TUW A;  2HHH M;  4AKI A;  2FFJ A;  1MX0 A;  3A98 B;  3KOZ E;  3L27 A;  3J80 S;  1OJL A;  2EA0 A;  1HNZ M;  2KZS A;  3K92 A;  2YNM D;  2C9C A;  3LMM A;  1G3I A;  4IIW A;  4LFC M;  1DGG A;  3FUU A;  2RGO A;  4LF8 M;  2Y21 A;  4M9X A;  1DO2 A;  4ITQ A;  1N33 M;  3HJQ A;  3TE6 A;  1N78 A;  1G8P A;  4AI6 A;  1Q39 A;  1LV7 A;  1FNN A;  3B9P A;  1G59 A;  5FSW A;  4X62 M;  4YHH M;  4LF6 M;  4QHS A;  1IXS B;  1I4W A;  3U61 A;  1IBM M;  2Z4R A;  2HKJ A;  2XZF A;  3JAM S;  1IY1 A;  1NNU C;  4JXJ A;  3U60 A;  3AOG A;  3HJS A;  4L16 A;  4IBC A;  3I51 A;  3W0L B;  2K47 A;  2XFS A;  2CUZ A;  1IN7 A;  1Q3B A;  5F3W A;  3GLF B;  2EO2 A;  4M9Z A;  3J2P B;  3UZU A;  3PFI A;  4NXM M;  3UGJ A;  4DV4 M;  2C9O A;  4PDG A;  3A45 A;  2L09 A;  3CF6 E;  4JI8 M;  2Q2E B;  2Y0Q A;  2I7N A;  3JR4 A;  4GC9 A;  2CV1 A;  3HU3 A;  2LXE A;  4BB9 A;  1C1K A;  1Z6T A;  1L2C A;  5KPZ A;  1IN8 A;  3U61 B;  4Z8X A;  1WXQ A;  4IBB A;  1L1Z A;  3KS4 A;  3HWS A;  1DGB A;  4CGY B;  3IG5 A;  1QAM A;  3FYD A;  4P16 A;  2VQF M;  4DV3 M;  5IT9 S;  2R18 A;  2V6Z M;  4LJ4 A;  2R45 A;  4DV1 M;  2X8A A;  3KW6 A;  3VLF B;  4L15 A;  1TDZ A;  4MB7 A;  4AZF A;  3L28 A;  5ITQ A;  5JI2 E;  3SAR A;  1Z5A A;  3EIE A;  4G6Z A;  4GMQ A;  3SAU A;  2XF3 A;  4JI2 M;  3VDU A;  3GO8 A;  5FTJ A;  3OTO M;  1GKI A;  1R6B X;  3HHX A;  2BNK A;  1PM5 A;  1NNJ A;  5IWA M;  3J81 S;  4I5S A;  4LGM A;  4DR2 M;  4JV5 M;  3VKG A;  2CHG A;  1DO0 A;  4NSO B;  1E32 A;  4RF1 A;  4G4R A;  4W5W A;  2RKO A;  3PNY A;  3GLI A;  1XMO M;  1I94 M;  1N32 M;  2UXC M;  3E9S A;  1GVN A;  5EP3 A;  2G8L A;  1IXR C;  5EXS A;  4D82 A;  2ZAN A;  2ZAM A;  1IN6 A;  1HR0 M;  3R9X B;  1W5S A;  4G4N A;  1HQY E;  4LF5 M;  2CV2 A;  4FWD A;  4L8R C;  2KRU A;  4D80 A;  2QCU A;  3KVW A;  1IXZ A;  4YY3 M;  3A46 A;  4GHA A;  1N36 M;  2D7H A;  4DUY M;  2V1C A;  4LJ8 A;  3QAU A;  4IBI A;  2QEN A;  4IBD A;  5KQ8 A;  2ZM6 M;  4JI6 M;  1QAQ A;  2FE8 A;  4NRV A;  3GQ3 A;  3HHZ A;  3GRY A;  5GKN A;  2XH9 A;  3HKP A;  3D8B A;  3J7B A;  5FLX S;  1L2D A;  4RNA A;  1SXJ E;  1W5T A;  2CFO A;  3U6E A;  2XSZ D;  1IBL M;  1ZQ9 A;  5KO3 A;  4REZ A;  3JR5 A;  3FTD A;  2DVW B;  2ERC A;  3NWL A;  3KOW E;  3ZC7 B;  4OU7 A;  1GLN A;  4WW0 A;  1NY5 A;  4ZPX A;  1EE8 A;  3FUV A;  3SC3 A;  1X37 A;  4K0K M;  5BR8 M;  5ITY A;  1K82 A;  4AW4 A;  1XXH A;  1GL6 A;  1KYI A;  1IQP A;  3SBJ A;  2C5R A;  3KXE C;  3GRU A;  3ZH9 B;  1N75 A;  4CIS A;  3SAV A;  3VK7 A;  4KHP M;  3DA1 A;  5ITU A;  4NL4 H;  4B3S M;  5EQT A;  2VQE M;  3GPX A;  5LMN M;  3FTF A;  3U5Z A;  3CF0 A;  4FVM A;  2KW0 A;  3C58 A;  2C99 A;  3KDS E;  3T1H M;  1SXJ A;  3VKH A;  2ZBK B;  3TWK A;  4DV5 M;  3GLH A;  3FTC A;  2R4J A;  4S12 A;  3HHW A;  4GKJ M;  4OVZ A;  3SAS A;  1SXJ D;  2E5L M;  1YUB A;  2ZAO A;  4MGH A;  2RGH A;  1J09 A;  3LVV A;  3GLG A;  3AV0 A;  1NJG A;  3WHK A;  3U6S A;  3DFZ A;  2CV0 A;  2QPA A;  3L29 A;  4QOZ C;  4B7H A;  4OX9 M;  1UM8 A;  2AHM A;  4GIT A;  4M0D A;  4LRT A;  2O5R A;  2G5G X;  3KSJ A;  3M6A A;  3THG A;  5KPR A;  3TQS A;  2KRK A;  2QBY A;  3U6D A;  3KOY E;  2Z4S A;  1G4A E;  3UMM A;  1XMQ M;  2DWN A;  3GP1 A;  2Y0T A;  5DYG A;  4JN6 A;  4G4O A;  2HCB A;  4R7G A;  2F5P A;  3MK6 A;  4IBJ A;  2FOI C;  5JI3 E;  3PNV A;  4HL4 A;  3QWL A;  2DWM A;  3W0F A;  3U60 B;  1JQJ C;  1Z5B A;  3DOA A;  3SYK A;  4GC5 A;  4LG2 A;  1L1T A;  1QYR A;  3J27 B;  4GKK M;  8CAT A;  3BOS A;  2R4E A;  2DXI A;  3LVW A;  1R7R A;  3K2L A;  5FTM A;  3SHF A;  3GQ4 A;  4JI4 M;  2P5T A;  2KA6 B;  5E26 A;  3HGI A;  1K3W A;  4II7 A;  4JI7 M;  3GPY A;  2QBY B;  3D8L A;  4EIW A;  4LF9 M;  1R2Z A;  1KFV A;  4X64 M;  3HU2 A;  3NBI A;  3GPU A;  4GRI A;  1R2Y A;  3K8Z A;  5KPT A;  3IG8 A;  2UU9 M;  1XNR M;  1H6U A;  4BBA A;  4LFA M;  1NHG C;  2LWX A;  2QZ4 A;  2Z3X A;  3LQQ A;  4DV6 M;  4LF7 M;  4RF0 A;  3U6Q A;  1XWI A;  4DV0 M;  4PCZ A;  2CE7 A;  1HNW M;  3SMS A;  4LRS A;  4DR3 M;  1TH4 A;  3ZCB B;  5H37 D;  4DV7 M;  4DR1 M;  4IBE A;  2UUB M;  3KP1 E;  4I4L A;  2X49 A;  1IY2 A;  1OFI A;  1IBK M;  1DGH A;  4MGK E;  4M9S A;  1NY6 A;  3M0E A;  2F5Q A;  4FCT A;  1HT2 E;  3HU1 A;  4PDI A;  4MGY E;  1TH3 A;  2J7O A;  4DR4 M;  1XNQ M;  3KP0 E;  1ZAE A;  4JI5 M;  3AOE A;  5ITR A;  3VFD A;  2KZU A;  4LJ9 A;  1VDD A;  3U6P A;  1KSF X;  2XZU A;  3UK6 A;  4FWG A;  2H1R A;  1N34 M;  3U6M A;  2L7H A;  1QAO A;  2V1U A;  3A42 A;  3T15 A;  3GLI B;  3DZD A;  2DWL A;  3GQ5 A;  2J7N A;  4FD2 A;  4A3V B;  1Z59 A;  5KQD A;  2C98 A;  2DHR A;  3FKE A;  3GRR A;  5FTN A;  4MH0 E;  3UJN A;  1SXJ C;  5BPV A;  1E9R A;  5C18 A;  2Z7J A;  1DGH B;  2YFQ A;  3K1J A;  3HHY A;  4LFB M;  3FYC A;  4JI1 M;  1OFH A;  2W82 A;  2YR0 A;  4JI0 M;  2KXE A;  1K3X A;  3L2A A;  3RFW A;  5E6J A;  3SMP A;  3E4R A;  2F5S A;  2UXD M;  5DYI A;  4B7G A;  4B7F A;  3TPZ A;  1JR3 A;  3Q8X A;  2XLJ A;  5ITT A;  2F4V M;  3FD9 A;  2R65 A;  4MGI E;  1TDH A;  3VK8 A;  1TGU A;  4GIP A;  1JR3 D;  3RE8 A;  5EXT A;  4LF4 M;  3KFU G;  2NQ8 C;  2CHQ A;  1HT1 E;  4FCW A;  1S3S A;  3SHG B;  3H4M A;  3KS8 A;  1NVM A;  1QAN A;  4LZZ A;  3GLF A;  4CHT B;  1Q3C A;  4AKG A;  5IZ7 D;  4G4Q A;  1D2N A;  1XXH B;  4KO8 A;  2C96 A;  2F5O A;  1ORY B;  4XGI A;  4DR6 M;  2I7P A;  2LNH C;  5EXP A;  1MU5 A;  1YSY A;  4Z6Y A;  1IN5 A;  4QNR A;  4LZJ A;  3I4V A;  2L7I A;  4L4U A;  2OPF A;  4DUZ M;  3CF2 A;  4FCV A;  2LH0 A;  2M60 A;  3SYL A;  3U5Z B;  4LCB A;  1FJG M;  4LY6 A;  1Z5C A;  1L8Q A;  1IY0 A;  5DNY A;  4D81 A;  1SXJ B;  3FTE A;  4FWH A;  4NRW A;  1QZM A;  4R3D A;  4LJ6 A;  3PVS A;  3GLH B;  4JI3 M;  1E9S A;  3M7G A;  3R8F A;  2HL7 A;  5A2Q S;  1NSF A;  4OVZ B;  1N77 A;  3AFH A;  3KSX A;  3T1Y M;  4MM3 B;  3GLG B;  2XFT A;  4XBO A;  1XHB A;  4B3T M;  4IJE A;  4B08 A;  1E94 E;  2F5N A;  1IM2 A;  3VDP A;  1YE9 A;  4NSR A;  4MGZ E;  2DZO B;  3GPP A;  3U6O A;  1J7K A;  1HNX M;  4B3M M;  4AKH A;  3LQR A;  3SAW A;  4WUR A;  4DR7 M;  3TL4 X;  4PD2 A;  7CAT A;  3L26 A;  2DZN B;  3FUT A;  3MHV C;  4B3R M;  3MJ5 A;  4QHT A;  5FTK A;  4FW9 A;  4AQY M;  3AOE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...