4A3VB

Yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
SSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA MISMATCH REPAIR PROTEIN HSM3
publication title Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/atp binding protein
total genus 27
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4a3vB01
2R62A 1HQYE 4Z8XA 3EIHA 2DHRA 4I81A 5JI2E 1IY0A 3GLGA 1XXHB 4L16A 1IXRC 4L4UA 4LJ5A 4QHSA 4LJ6A 3DZDA 1R6BX 4LRSA 3VLFB 1SXJB 4KODA 1KSFX 2V6ZM 3HU1A 4KLNA 1UM8A 1E32A 4WW0A 2C99A 1FNNA 2QBYB 4LJ4A 1IN8A 1IN5A 1J7KA 3SYLA 1NVMA 1D2NA 1L8QA 2CEAA 3KW6A 1OJLA 5EXXA 1DO2A 4QNRA 2XSZA 2RKOA 3CF2A 3AJIB 2CHQA 1HQCA 4FWGA 1HT2E 1R7RA 5EP3A 3KDSE 3R8FA 5EXPA 1E94E 2BJVA 2BJWA 3K1JA 1IN7A 4LZZA 1IY2A 3SYKA 1OFIA 4FCVA 1IXZA 2X8AA 5DYIA 5FTKA 1IY1A 5EP4A 3GLIA 1JQJC 4FWDA 3ZH9B 5FTLA 4QHTA 2HCBA 3GLGB 3GLFA 5EXSA 3B9PA 1G41A 1XWIA 3MHVC 3UK6A 3WHLA 1W5SA 5FTMA 1NY6A 1C1KA 4D81A 5FTJA 2QPAA 4LJ7A 2CHGA 4EIWA 1IQPA 5FTNA 3U60B 3HWSA 1QVRA 3M0EA 2KRKA 4GITA 3PXGA 5C1BA 3U5ZB 1G3IA 2CHVA 4A3VB 3H4MA 1NJGA 2ZAMA 3WHKA 1NJFA 4ZPXA 1JR3A 2XSZD 4KO8A 1SXJE 1SXJC 1NSFA 3GLHA 4LJ8A 2C96A 4JN6A 3CF0A 2VIIA 2DZNB 3HU3A 1OFHA 1IN4A 5EP1A 3GLIB 4LJ9A 2CE7A 2C9OA 5DYGA 4FD2A 1NY5A 4FCTA 3GLFB 5EXTA 4D80A 1XXHA 2QP9X 1IM2A 4QNMA 4LCBA 1KYIA 2ZAOA 4L15A 2ZANA 1W5TA 1QZMA 1SXJA 1DO0A 4LJAA 3D8BA 2QZ4A 1HT1E 3VFDA 2FNAA 3BOSA 1S3SA 2QBYA 2Z4SA 4D82A 4FWHA 1IN6A 3U61B 2V1UA 4FCWA 2DWZB 2C9CA 3PVSA 1IXSB 5EP2A 5EQTA 5JI3E 5C18A 1SXJD 3SC3A 3HU2A 1X37A 2R65A 4I4LA 3EIEA 2DVWB 4FW9A 3GLHB 4LGMA 1JR3D 1LV7A 4QOSA 1G4AE 2DZOB 2Z4RA 4LY6A 2QENA 2C98A 4LRTA 3PFIA 3M6AA
chains in the Genus database with same CATH superfamily
4PDGA 4G4OA 1TH3A 1OIZA 3LQRA 4Z8XA 3EIHA 4IBEA 2UUBM 4L16A 1HNXM 1GLNA 2CV1A 4NXNM 4DUZM 3SMPA 4IJEA 4QHSA 1QZEA 3E46A 3DZDA 3I04M 2DAEA 3BXWA 1N33M 2V6ZM 3HU1A 3L2AA 2ZM6M 4NOOB 4L8RC 1GJSA 2DNAA 4WW0A 3K92A 1FNNA 2QBYB 4LJ4A 2QCUA 1YSYA 2DAIA 1IN5A 3KOZE 4LF6M 4LZJA 1TDHA 2L4EA 1HJPA 1HNWM 4TUWA 1L8QA 1ZAEA 2CEAA 1IFYA 5EXXA 5A2QS 2KNZA 1MN3A 1QAOA 1ZMVA 3RGPA 2RKOA 3A42A 3J7BA 2CHQA 4JI5M 4AKHA 2X4AA 3L29A 1Y8GA 5BPVA 5EP3A 3KDSE 4JI6M 2DZLA 2L7IA 5FLXS 4DR1M 3HHWA 1TTEA 3K1JA 3SYKA 3LVWA 2BWBA 5DYIA 1Z6TA 3HX3A 3KVWA 1VEGA 1I94M 4JI2M 5FTKA 4DR4M 5EP4A 4K0KM 3IECA 4IBJA 4QHTA 1IBMM 2LVQD 2O01F 2CV2A 3GRVA 3AOEC 5EXSA 3B9PA 1ORYB 1VDLA 1G41A 1GL6A 2FFJA 5KQDA 4NXMM 3J81S 4IBKA 3F92A 1K82A 4GC9A 3CF6E 2K47A 3BBZA 3GQ4A 1J5EM 1NY6A 1C1KA 3A45A 3TE6A 5FTJA 1OQYA 3GLHE 3PNYA 4LJ7A 3GP1A 3FTFA 5FTNA 4WP2A 3U61A 1AIPC 3U60B 2JWSA 4AQYM 1L2DA 2B3TA 2KRKA 3IG8A 2JY8A 4GITA 5C1BA 5H37D 4G4NA 3U5ZB 2VDBB 3IHPA 4A3VB 2G8LA 3H4MA 1NJGA 1PJSA 1T6OA 3TWKA 3VDUA 2UUAM 3I01M 3KOYE 1NJFA 1Z59A 1Q39A 2MH8A 3VK8A 2QHOB 4I5SA 3HZJA 4GEWA 5DFLA 3GPPA 4KO8A 3J2PB 4JV5M 1GKIA 4FVMA 2MR9A 2N35A 1J09A 4DR2M 4B3MM 4L6V6 4LF5M 1QUTA 2LHCA 2DZNB 3HU3A 4PD2A 1IN4A 1I4WA 3GRRA 2JNHA 1DGHA 4PT5A 1KFVA 5EP1A 4B3RM 1L2BA 1HNZM 2XEPA 4XGIA 1JR3E 3C9PA 1NV8A 1WXQA 1A5TA 3HKPA 4B7HA 4NL4H 2JY5A 2CV0A 3TPZA 2KW0A 4LCBA 2A5YB 2APLA 1GVNA 2I7PA 3THGA 4L15A 2ZANA 1ZMWA 3ZC7B 3FTEA 1DO0A 5E6JA 4PCZA 1CUKA 2D7GA 4Q7JA 3L27A 3TWLA 3BOSA 2QBYA 4FWHA 3CGWA 2DWLA 4FCWA 2DWZB 1LTMA 1Q3CA 2C9CA 1VG5A 4UN2B 5EQTA 1DGFA 2FH0A 3D8LA 2CWBA 3FKEA 4II7A 3L25A 4DV7M 1SXJD 3AL0C 3GLGE 1D0KA 1XMOM 4Y28F 3VKHA 4DR5M 4QOZC 2MJ5B 1ZMUA 1WR1B 2XLJA 1X37A 3FE3A 2DXIA 4I4LA 3U6QA 3UJNA 5DNYA 4FW9A 3U6CA 4DV3M 2GNOA 3AOGA 2Z4RA 1TF0B 3MMPA 4LY6A 4B7GA 2QENA 2C98A 4LRTA 2CUZA 4YY3M 2LNHC 4JI0M 3SHFA 3FUUA 3T38A 3GO8A 1XB2B 1HQYE 4I81A 4DUYM 1V34A 1NO1A 1IXRC 4JI7M 2EA0A 2UXCM 4LJ5A 1AUAA 4RNAA 4LJ6A 1R6BX 1SXJB 1V92A 4GHLA 1E32A 2D7EA 4LF7M 1GL7A 3AKZA 4G6ZA 2ZTDA 2DAKA 4P17A 3J80S 1J7KA 4LFBM 3ZCBB 5IWAM 3U5ZA 4AG6A 3AFHA 4M9SA 1D0MA 5E26A 2BNKA 4XK8F 3KS4A 1YE9A 1DGGA 3AV0A 2ZTCA 4R3DA 1HQCA 2HL7A 3QYBA 3R8FA 1E94E 2G3QA 4OVZB 1IN7A 2RGHA 1IY2A 3A98B 4HEOA 4M0DA 4JXJA 1IXZA 2X8AA 1N34M 2DKLA 2XF3A 2R18A 5EJCA 1IY1A 1JQJC 4B3TM 3RGSA 3ZH9B 2YQZA 3FRHA 3UK6A 3WHLA 4NSOB 2DHYA 2JY6B 5KPRA 4B7FA 1W5SA 2EO2A 2ZBKB 1T43A 5FTMA 3FUVA 4D81A 2L4FA 3R9XB 1WIVA 1QUSA 2CHGA 4EIWA 4MH0E 3M7GA 2Y20A 3U6DA 2UXDM 4AI6A 3K9PA 1QQWA 1QVRA 3E9SA 3PXGA 1OIPA 2CHVA 2KRUA 1K3WA 3B74A 4RF0A 2WSEF 3SMSA 3VKGA 3WHKA 4R71A 2R45A 3U6SA 1IBLM 2J5YA 1JR3A 2CFOA 3E4RA 3SATA 2KDLA 4DV0M 2L6OA 4R7GA 2C96A 1V33A 1GABA 1Q02A 3Q8XA 2K6BA 2WSCF 2VIIA 2H5XA 2UUCM 1DGBA 1F4IA 1OFHA 1N36M 3KFUG 3GPYA 2CE7A 3IG5A 5ITXE 2LVPC 1NY5A 2J7NA 2Z7JA 3U6LA 3U6OA 2Z3XA 2FE8A 5EXTA 1JB0F 2QP9X 1IM2A 2MROB 4DV5M 2YFQA 2R4JA 2LVOC 5GKNA 2EKKA 1W5TA 2JP7A 4CGYB 2M60A 4JI3M 1SXJA 3D8BA 2Q2EB 3SARA 1WGNA 1HT1E 1VEKA 3VK7A 2R6FA 3U6EA 2V1UA 4IBDA 4D82A 3HJQA 3ILKA 1XXHE 3QYEA 2DWNA 5EP2A 1IXSB 4AZFA 5C18A 4I8OA 5JI3E 3J27B 3SBJA 2H1RA 3HU2A 2R44A 4GIPA 1IBKM 3U6PA 4RF1A 1NHWC 2DVWB 4M0WA 1E9RA 2JZ0A 3GLHB 3QWLA 3C58A 1JR3D 3E21A 2RRUA 5IZ7D 4OVZA 1GO5A 1DV0A 4IBCA 1PRBA 3PNVA 3T6PA 4BBAA 2F5PA 3LW5F 1SG9A 3M6AA 2KA6B 3HY5A 2F5NA 1L1TA 5JI2E 1NHGC 2VF7A 3HJSA 1XXHB 3KSXA 1R2YA 2OOBA 4L4UA 1MX0A 2CP8A 2OOAA 2LH0A 4X64M 4DV4M 1WGLA 3I51A 4F1IA 1PJQA 3VLFB 3W0LB 4KODA 1KSFX 1VQ1A 2HKJA 3KP1E 1K3XA 2C99A 2KXEA 1NNUC 3C3EA 3SASA 3JAMS 1IN8A 5KPZA 4LGYA 2XFTA 4LFAM 3SFZA 4JI4M 3SYLA 3RE8A 3KW6A 1VDDA 1OJLA 2JY7A 1XNQM 2QSFX 3VDPA 2QNJA 4X66M 3FTCA 2D7HA 2NQ8C 1N75A 3CF2A 3AJIB 2YNMD 4G4QA 1HT2E 1R7RA 7CATA 2DI0A 1C7YA 5EXPA 5ITRA 2BJVA 1VEJA 2O25A 2JA2A 1WJ7A 2BJWA 4LZZA 4JYAM 1N78A 1OFIA 2EKFA 4MGKE 1TH2A 2BWEA 2LTUA 2YR0A 3UZUA 1XNRM 2C5RA 2K0BX 4BB9A 4FWDA 4AKIA 5FTLA 2KZSA 2OPFA 1Z5CA 2HCBA 2X49A 3KOWE 3GLGB 4DR6M 2OO9A 1PM5A 4GHAA 4LF4M 3NBIA 1MJGM 2K9DA 3HHZA 3CTWB 4HL4A 4MGZE 3GLIE 5KPTA 3FD9A 4AG5A 4LF9M 3KS8A 3GLFE 3KSJA 2L7HA 3HWSA 3M0EA 2LXEA 1N77A 1IXSA 3FYDA 2G5GX 1T3TA 2XH9A 3HHXA 3MK6A 4KHPM 2ZAMA 4W5WA 4OU7A 3B89A 1E9SA 1QAMA 3B7QA 2EJSA 4GKKM 3RFWA 3W67A 4ZPXA 3NBXX 2XFSA 2KNVA 3K2LA 3B7NA 5ITXA 3LQQA 1SXJC 4AKGA 1NSFA 3GLHA 3K9OA 2Y0QA 3DFZA 3GRYA 1QANA 3FYCA 3V76A 1G71A 3GLIB 1UFZA 3HHYA 2W82A 1GJTA 4F2LA 2KHHA 4B3SM 4S12A 2QQ8A 4HLQA 4DV1M 1PGYA 4RKUF 3GLFB 4MB7A 4D80A 1XXHA 4QNMA 4DBGB 4JI8M 3LVVA 2ZAOA 3HGIA 4OW0A 2QZ4A 2FOIC 4XBOA 3VFDA 2FNAA 4B08A 1S3SA 2Z4SA 1IN6A 1YLAA 2I7NA 4LG2A 2FS1A 3SAWA 1QDTA 3I4VA 4WURA 1NV9A 3LMMA 2DENA 5F3WA 4X62M 3EIEA 2VQFM 5ITUA 3Q8GA 4MGHA 2OQ4A 4LGMA 3GQ3A 2F5QA 4QOSA 1G4AE 2DZOB 3TWMA 1TDZA 2WSFF 4MGIE 3ZQJA 3NWLA 4MM3B 2E5LM 3QAUA 2RGOA 3A46A 3JR4A 2R62A 4KT0F 2R0IA 2DHRA 1IY0A 1XHBA 3W0FA 3GLGA 4L78A 1EIJA 3T1YM 2JUJA 4M9XA 3T1HM 4LRSA 1L1ZA 4KLNA 2LWXA 3FUTA 1UM8A 1PJTA 4Z6YA 2JZ1A 1P3QQ 3HJ8A 3TL4X 2XZFA 2Z8YM 1D0LA 4CIZA 1OKSA 1EE8A 1NVMA 1D2NA 2HWJA 2LVAA 2R46A 4IIWA 2L2DA 1L2CA 4IBGA 1DO2A 3LCVB 2XZUA 4QNRA 4GKJM 2VF8A 2XSZA 3GRUA 2KZUA 1G59A 3J7AS 1R5LA 4FWGA 4OX9M 5IT9S 1ZQ9A 4GMQA 4GC5A 4X65M 4M9ZA 3TQSA 2JXNA 4FCVA 4PDIA 4NSRA 3LCUA 3SAVA 3KP0E 3SHGB 2ERCA 1WHCA 3GLIA 4NRWA 2CRUA 5LMNM 4DR7M 1MU5A 1ZV1A 2GQFA 4AW4A 3GLFA 3SAUA 1XWIA 3MHVC 2F5SA 2HHHM 2UU9M 4DV6M 1OAOC 3FUWA 2J7OA 1PJIA 4NRVA 4IBIA 2Y21A 2QPAA 2R4EA 5ITTA 3GPUA 1HR0M 2UXBM 1IQPA 3K8ZA 2KEBA 1QYRA 5ITQA 2HAKA 5KO3A 3T15A 4CISA 4G4RA 1H6UA 1TGUA 1QDRA 8CATA 1Q3BA 1G3IA 2V1CA 1Z5AA 3UMMA 4DV2M 1G8PA 3AOEA 1R2ZA 4NC6A 4GH9A 1Z5BA 4GRIA 3OTOM 1TR8A 3H4JA 3GPXA 4DR3M 3U6MA 2M5ZA 4P16A 2XSZD 1SXJE 3KXEC 2WZJA 4CJ6A 4LJ8A 4JN6A 3MJ5A 4JI1M 3CF0A 4YHHM 1RU3A 3UGJA 2KNAA 3FRIA 1FJGM 4ITQA 5BR8M 1R4GA 1EFUB 1YUBA 2DWMA 4CHTB 4LJ9A 2VQEM 2L09A 2C9OA 2DAGA 5DYGA 4FD2A 5FSWA 4FCTA 4IBFA 2O5RA 3JR5A 2F5OA 3I4YA 1PJJA 4LF8M 1KYIA 3FUXA 1QZMA 1TH4A 2LVNC 4LJAA 3C3DA 1XC8A 5KQ8A 4ANRA 3KOXE 4IBBA 4IJFA 3U61B 2DAMA 5ITYA 3B7ZA 1OAIA 3PVSA 5LMUM 2LHGA 3DOAA 4BLCA 3L26A 3SC3A 3FTDA 1BVSA 2EUCA 2Y0TA 3W68A 4G3OA 3U60A 2R65A 5IREB 4REZA 1OTRA 2AHMA 3GQ5A 2MGWA 4LFCM 2LBCA 3DA1A 2F4VM 1LV7A 1QAQA 4MGYE 3L28A 5L8RF 1NNJA 1DGHB 2P5TA 1N32M 3PFIA 2XGNA 1XMQM
chains in the Genus database with same CATH topology
4PDGA 4G4OA 1TH3A 3LQRA 4Z8XA 3EIHA 4IBEA 2UUBM 4L16A 1HNXM 1GLNA 2CV1A 4NXNM 4DUZM 3SMPA 4IJEA 4QHSA 1N33M 3DZDA 2V6ZM 3HU1A 3L2AA 2ZM6M 4NOOB 4L8RC 4WW0A 3K92A 1FNNA 2QBYB 4LJ4A 2QCUA 1YSYA 3KOZE 1IN5A 4LF6M 4LZJA 1TDHA 1HNWM 4TUWA 1L8QA 1ZAEA 2CEAA 5EXXA 5A2QS 1QAOA 3RGPA 2RKOA 3A42A 3J7BA 2CHQA 4JI5M 4AKHA 2X4AA 3L29A 5BPVA 5EP3A 3KDSE 4JI6M 2L7IA 5FLXS 4DR1M 3HHWA 3K1JA 3SYKA 3LVWA 5DYIA 1I94M 1Z6TA 3KVWA 4DR4M 4JI2M 5FTKA 5EP4A 4K0KM 4IBJA 4QHTA 1IBMM 2CV2A 3GRVA 3AOEC 5EXSA 3B9PA 1ORYB 2FFJA 1G41A 1GL6A 4NXMM 5KQDA 3J81S 4IBKA 1K82A 4GC9A 3CF6E 2K47A 3GQ4A 1J5EM 1NY6A 1C1KA 3A45A 3TE6A 5FTJA 3PNYA 4LJ7A 3GP1A 3FTFA 5FTNA 3U61A 3U60B 4AQYM 1L2DA 2KRKA 3IG8A 4GITA 5C1BA 4G4NA 3U5ZB 5H37D 4A3VB 2G8LA 3H4MA 1NJGA 3TWKA 3VDUA 2UUAM 3KOYE 3VK8A 1NJFA 1Z59A 1Q39A 4I5SA 3GPPA 4JV5M 4KO8A 3J2PB 1GKIA 4FVMA 1J09A 4DR2M 4B3MM 4LF5M 2DZNB 3HU3A 4PD2A 1IN4A 1I4WA 3GRRA 4B3RM 1DGHA 4PT5A 1KFVA 5EP1A 1L2BA 1HNZM 2XEPA 4XGIA 1WXQA 3HKPA 4B7HA 4NL4H 2CV0A 3TPZA 2KW0A 4LCBA 2A5YB 1GVNA 2I7PA 3THGA 4L15A 2ZANA 3ZC7B 3FTEA 1DO0A 5E6JA 4PCZA 2D7GA 3L27A 3TWLA 3BOSA 2QBYA 4FWHA 2DWLA 4FCWA 2DWZB 1Q3CA 2C9CA 5EQTA 1DGFA 3D8LA 3FKEA 3L25A 4II7A 4DV7M 1SXJD 3AL0C 1XMOM 3VKHA 4DR5M 4QOZC 2XLJA 1X37A 2DXIA 4I4LA 3U6QA 3UJNA 5DNYA 4FW9A 3U6CA 4DV3M 3AOGA 2Z4RA 4LY6A 4YY3M 4B7GA 2QENA 2C98A 4LRTA 2CUZA 2LNHC 4JI0M 3SHFA 3FUUA 3T38A 3GO8A 1HQYE 4I81A 4DUYM 1IXRC 4JI7M 2EA0A 2UXCM 4LJ5A 4RNAA 4LJ6A 1R6BX 1SXJB 4GHLA 1E32A 2D7EA 4LF7M 1GL7A 3AKZA 4G6ZA 3J80S 1J7KA 4LFBM 3ZCBB 5IWAM 3U5ZA 4AG6A 3AFHA 4M9SA 5E26A 2BNKA 3KS4A 1YE9A 1DGGA 3AV0A 4R3DA 1HQCA 2HL7A 3R8FA 1E94E 4OVZB 1IN7A 2RGHA 1IY2A 3A98B 4M0DA 4JXJA 1IXZA 2X8AA 1N34M 2XF3A 2R18A 5EJCA 1IY1A 1JQJC 4B3TM 3RGSA 3ZH9B 2YQZA 3UK6A 3WHLA 4NSOB 5KPRA 4B7FA 1W5SA 2EO2A 2ZBKB 5FTMA 3FUVA 4D81A 3R9XB 4EIWA 2CHGA 4MH0E 3M7GA 2Y20A 3U6DA 2UXDM 4AI6A 1QQWA 1QVRA 3E9SA 3PXGA 2CHVA 2KRUA 1K3WA 4RF0A 3SMSA 3VKGA 3WHKA 2R45A 3U6SA 1IBLM 1JR3A 2CFOA 3E4RA 3SATA 4DV0M 2L6OA 4R7GA 2C96A 3Q8XA 2VIIA 2UUCM 1DGBA 1OFHA 1N36M 3KFUG 3GPYA 2CE7A 3IG5A 5ITXE 1NY5A 2J7NA 2Z7JA 3U6LA 3U6OA 2Z3XA 2FE8A 5EXTA 2QP9X 1IM2A 4DV5M 2YFQA 2R4JA 5GKNA 4CGYB 1W5TA 2M60A 4JI3M 1SXJA 3D8BA 2Q2EB 3SARA 1HT1E 3VK7A 3U6EA 2V1UA 4IBDA 4D82A 3HJQA 3ILKA 2DWNA 5EP2A 1IXSB 4AZFA 5C18A 4I8OA 5JI3E 3J27B 3SBJA 2H1RA 3HU2A 4GIPA 1IBKM 3U6PA 4RF1A 1NHWC 2DVWB 4M0WA 1E9RA 3GLHB 3QWLA 3C58A 1JR3D 5IZ7D 4OVZA 4IBCA 3PNVA 4BBAA 2F5PA 3M6AA 2KA6B 2F5NA 1L1TA 5JI2E 1NHGC 3HJSA 1XXHB 3KSXA 1R2YA 4L4UA 1MX0A 4X64M 2LH0A 4DV4M 3I51A 3W0LB 3VLFB 4KODA 1KSFX 2HKJA 3KP1E 1K3XA 2C99A 2KXEA 1NNUC 3SASA 3JAMS 1IN8A 5KPZA 4LGYA 2XFTA 4LFAM 3SFZA 4JI4M 3SYLA 3RE8A 3KW6A 1VDDA 1OJLA 1XNQM 3VDPA 4X66M 3FTCA 2D7HA 2NQ8C 1N75A 3CF2A 3AJIB 2YNMD 4G4QA 1HT2E 1R7RA 7CATA 5EXPA 5ITRA 2BJVA 4JYAM 2JA2A 2BJWA 4LZZA 1N78A 1OFIA 4MGKE 1TH2A 2YR0A 1XNRM 3UZUA 2C5RA 4BB9A 4AKIA 4FWDA 5FTLA 2KZSA 2OPFA 1Z5CA 2HCBA 2X49A 3KOWE 3GLGB 4DR6M 1PM5A 4GHAA 4LF4M 3NBIA 3HHZA 3CTWB 4HL4A 4MGZE 5KPTA 3FD9A 4AG5A 4LF9M 3KS8A 3KSJA 2L7HA 3HWSA 3M0EA 2LXEA 1N77A 3FYDA 2G5GX 1T3TA 3HHXA 2XH9A 3MK6A 4KHPM 2ZAMA 4W5WA 4OU7A 1E9SA 1QAMA 4GKKM 3RFWA 4ZPXA 2XFSA 3K2LA 5ITXA 3LQQA 1SXJC 4AKGA 1NSFA 3GLHA 2Y0QA 3DFZA 3GRYA 1QANA 3FYCA 3GLIB 3HHYA 2W82A 4B3SM 4S12A 4HLQA 4DV1M 3GLFB 4MB7A 4D80A 1XXHA 4QNMA 4JI8M 3LVVA 2ZAOA 3HGIA 4OW0A 2QZ4A 2FOIC 4XBOA 3VFDA 2FNAA 4B08A 1S3SA 2Z4SA 1IN6A 2I7NA 4LG2A 3SAWA 3I4VA 4WURA 3LMMA 5F3WA 4X62M 3EIEA 2VQFM 5ITUA 4MGHA 2OQ4A 4LGMA 3GQ3A 2F5QA 4QOSA 1G4AE 2DZOB 3TWMA 1TDZA 4MGIE 3NWLA 4MM3B 2E5LM 3QAUA 2RGOA 3A46A 3JR4A 2R62A 2DHRA 1IY0A 1XHBA 3W0FA 3GLGA 4L78A 3T1YM 4M9XA 3T1HM 4LRSA 1L1ZA 4KLNA 2LWXA 3FUTA 1UM8A 4Z6YA 3HJ8A 3TL4X 2XZFA 1EE8A 1NVMA 1D2NA 2R46A 4IIWA 1L2CA 4IBGA 1DO2A 2XZUA 4QNRA 4GKJM 2XSZA 3GRUA 1G59A 2KZUA 3J7AS 4FWGA 4OX9M 5IT9S 1ZQ9A 4GMQA 4GC5A 4X65M 4M9ZA 3TQSA 4FCVA 4PDIA 4NSRA 3SAVA 3KP0E 3SHGB 2ERCA 3GLIA 4NRWA 5LMNM 4DR7M 1MU5A 3GLFA 2F5SA 4AW4A 3SAUA 1XWIA 3MHVC 2HHHM 2UU9M 4DV6M 3FUWA 2J7OA 1PJIA 4NRVA 4IBIA 2Y21A 2QPAA 2R4EA 5ITTA 3GPUA 1HR0M 2UXBM 1IQPA 3K8ZA 2KEBA 1QYRA 5ITQA 5KO3A 3T15A 4CISA 4G4RA 1H6UA 1TGUA 8CATA 1Q3BA 1G3IA 2V1CA 1Z5AA 3UMMA 4DV2M 1G8PA 3AOEA 1R2ZA 4GH9A 1Z5BA 4GRIA 3OTOM 3GPXA 4DR3M 3U6MA 2M5ZA 4P16A 2XSZD 1SXJE 3KXEC 4LJ8A 4JN6A 3MJ5A 4JI1M 3CF0A 4YHHM 3UGJA 1FJGM 4ITQA 5BR8M 1YUBA 2DWMA 4CHTB 4LJ9A 2VQEM 2L09A 2C9OA 5DYGA 5FSWA 4FD2A 4FCTA 4IBFA 2O5RA 3JR5A 2F5OA 3I4YA 1PJJA 4LF8M 1KYIA 3FUXA 1QZMA 1TH4A 4LJAA 1XC8A 5KQ8A 3KOXE 4IBBA 4IJFA 3U61B 5ITYA 3PVSA 5LMUM 3DOAA 4BLCA 3L26A 3SC3A 3FTDA 2EUCA 2Y0TA 3U60A 2R65A 5IREB 4REZA 2AHMA 3GQ5A 4LFCM 3DA1A 2F4VM 1LV7A 1QAQA 4MGYE 3L28A 1NNJA 1DGHB 2P5TA 1N32M 3PFIA 2XGNA 1XMQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R62 A;  1HQY E;  4Z8X A;  3EIH A;  2DHR A;  4I81 A;  5JI2 E;  1IY0 A;  3GLG A;  1XXH B;  4L16 A;  1IXR C;  4L4U A;  4LJ5 A;  4QHS A;  4LJ6 A;  3DZD A;  1R6B X;  4LRS A;  3VLF B;  1SXJ B;  4KOD A;  1KSF X;  2V6Z M;  3HU1 A;  4KLN A;  1UM8 A;  1E32 A;  4WW0 A;  2C99 A;  1FNN A;  2QBY B;  4LJ4 A;  1IN8 A;  1IN5 A;  1J7K A;  3SYL A;  1NVM A;  1D2N A;  1L8Q A;  2CEA A;  3KW6 A;  1OJL A;  5EXX A;  1DO2 A;  4QNR A;  2XSZ A;  2RKO A;  3CF2 A;  3AJI B;  2CHQ A;  1HQC A;  4FWG A;  1HT2 E;  1R7R A;  5EP3 A;  3KDS E;  3R8F A;  5EXP A;  1E94 E;  2BJV A;  2BJW A;  3K1J A;  1IN7 A;  4LZZ A;  1IY2 A;  3SYK A;  1OFI A;  4FCV A;  1IXZ A;  2X8A A;  5DYI A;  5FTK A;  1IY1 A;  5EP4 A;  3GLI A;  1JQJ C;  4FWD A;  3ZH9 B;  5FTL A;  4QHT A;  2HCB A;  3GLG B;  3GLF A;  5EXS A;  3B9P A;  1G41 A;  1XWI A;  3MHV C;  3UK6 A;  3WHL A;  1W5S A;  5FTM A;  1NY6 A;  1C1K A;  4D81 A;  5FTJ A;  2QPA A;  4LJ7 A;  2CHG A;  4EIW A;  1IQP A;  5FTN A;  3U60 B;  3HWS A;  1QVR A;  3M0E A;  2KRK A;  4GIT A;  3PXG A;  5C1B A;  3U5Z B;  1G3I A;  2CHV A;  4A3V B;  3H4M A;  1NJG A;  2ZAM A;  3WHK A;  1NJF A;  4ZPX A;  1JR3 A;  2XSZ D;  4KO8 A;  1SXJ E;  1SXJ C;  1NSF A;  3GLH A;  4LJ8 A;  2C96 A;  4JN6 A;  3CF0 A;  2VII A;  2DZN B;  3HU3 A;  1OFH A;  1IN4 A;  5EP1 A;  3GLI B;  4LJ9 A;  2CE7 A;  2C9O A;  5DYG A;  4FD2 A;  1NY5 A;  4FCT A;  3GLF B;  5EXT A;  4D80 A;  1XXH A;  2QP9 X;  1IM2 A;  4QNM A;  4LCB A;  1KYI A;  2ZAO A;  4L15 A;  2ZAN A;  1W5T A;  1QZM A;  1SXJ A;  1DO0 A;  4LJA A;  3D8B A;  2QZ4 A;  1HT1 E;  3VFD A;  2FNA A;  3BOS A;  1S3S A;  2QBY A;  2Z4S A;  4D82 A;  4FWH A;  1IN6 A;  3U61 B;  2V1U A;  4FCW A;  2DWZ B;  2C9C A;  3PVS A;  1IXS B;  5EP2 A;  5EQT A;  5JI3 E;  5C18 A;  1SXJ D;  3SC3 A;  3HU2 A;  1X37 A;  2R65 A;  4I4L A;  3EIE A;  2DVW B;  4FW9 A;  3GLH B;  4LGM A;  1JR3 D;  1LV7 A;  4QOS A;  1G4A E;  2DZO B;  2Z4R A;  4LY6 A;  2QEN A;  2C98 A;  4LRT A;  3PFI A;  3M6A A; 
#chains in the Genus database with same CATH topology
 4PDG A;  4G4O A;  1TH3 A;  1OIZ A;  3LQR A;  4Z8X A;  3EIH A;  4IBE A;  2UUB M;  4L16 A;  1HNX M;  1GLN A;  2CV1 A;  4NXN M;  4DUZ M;  3SMP A;  4IJE A;  4QHS A;  1QZE A;  3E46 A;  3DZD A;  3I04 M;  2DAE A;  3BXW A;  1N33 M;  2V6Z M;  3HU1 A;  3L2A A;  2ZM6 M;  4NOO B;  4L8R C;  1GJS A;  2DNA A;  4WW0 A;  3K92 A;  1FNN A;  2QBY B;  4LJ4 A;  2QCU A;  1YSY A;  2DAI A;  1IN5 A;  3KOZ E;  4LF6 M;  4LZJ A;  1TDH A;  2L4E A;  1HJP A;  1HNW M;  4TUW A;  1L8Q A;  1ZAE A;  2CEA A;  1IFY A;  5EXX A;  5A2Q S;  2KNZ A;  1MN3 A;  1QAO A;  1ZMV A;  3RGP A;  2RKO A;  3A42 A;  3J7B A;  2CHQ A;  4JI5 M;  4AKH A;  2X4A A;  3L29 A;  1Y8G A;  5BPV A;  5EP3 A;  3KDS E;  4JI6 M;  2DZL A;  2L7I A;  5FLX S;  4DR1 M;  3HHW A;  1TTE A;  3K1J A;  3SYK A;  3LVW A;  2BWB A;  5DYI A;  1Z6T A;  3HX3 A;  3KVW A;  1VEG A;  1I94 M;  4JI2 M;  5FTK A;  4DR4 M;  5EP4 A;  4K0K M;  3IEC A;  4IBJ A;  4QHT A;  1IBM M;  2LVQ D;  2O01 F;  2CV2 A;  3GRV A;  3AOE C;  5EXS A;  3B9P A;  1ORY B;  1VDL A;  1G41 A;  1GL6 A;  2FFJ A;  5KQD A;  4NXM M;  3J81 S;  4IBK A;  3F92 A;  1K82 A;  4GC9 A;  3CF6 E;  2K47 A;  3BBZ A;  3GQ4 A;  1J5E M;  1NY6 A;  1C1K A;  3A45 A;  3TE6 A;  5FTJ A;  1OQY A;  3GLH E;  3PNY A;  4LJ7 A;  3GP1 A;  3FTF A;  5FTN A;  4WP2 A;  3U61 A;  1AIP C;  3U60 B;  2JWS A;  4AQY M;  1L2D A;  2B3T A;  2KRK A;  3IG8 A;  2JY8 A;  4GIT A;  5C1B A;  5H37 D;  4G4N A;  3U5Z B;  2VDB B;  3IHP A;  4A3V B;  2G8L A;  3H4M A;  1NJG A;  1PJS A;  1T6O A;  3TWK A;  3VDU A;  2UUA M;  3I01 M;  3KOY E;  1NJF A;  1Z59 A;  1Q39 A;  2MH8 A;  3VK8 A;  2QHO B;  4I5S A;  3HZJ A;  4GEW A;  5DFL A;  3GPP A;  4KO8 A;  3J2P B;  4JV5 M;  1GKI A;  4FVM A;  2MR9 A;  2N35 A;  1J09 A;  4DR2 M;  4B3M M;  4L6V 6;  4LF5 M;  1QUT A;  2LHC A;  2DZN B;  3HU3 A;  4PD2 A;  1IN4 A;  1I4W A;  3GRR A;  2JNH A;  1DGH A;  4PT5 A;  1KFV A;  5EP1 A;  4B3R M;  1L2B A;  1HNZ M;  2XEP A;  4XGI A;  1JR3 E;  3C9P A;  1NV8 A;  1WXQ A;  1A5T A;  3HKP A;  4B7H A;  4NL4 H;  2JY5 A;  2CV0 A;  3TPZ A;  2KW0 A;  4LCB A;  2A5Y B;  2APL A;  1GVN A;  2I7P A;  3THG A;  4L15 A;  2ZAN A;  1ZMW A;  3ZC7 B;  3FTE A;  1DO0 A;  5E6J A;  4PCZ A;  1CUK A;  2D7G A;  4Q7J A;  3L27 A;  3TWL A;  3BOS A;  2QBY A;  4FWH A;  3CGW A;  2DWL A;  4FCW A;  2DWZ B;  1LTM A;  1Q3C A;  2C9C A;  1VG5 A;  4UN2 B;  5EQT A;  1DGF A;  2FH0 A;  3D8L A;  2CWB A;  3FKE A;  4II7 A;  3L25 A;  4DV7 M;  1SXJ D;  3AL0 C;  3GLG E;  1D0K A;  1XMO M;  4Y28 F;  3VKH A;  4DR5 M;  4QOZ C;  2MJ5 B;  1ZMU A;  1WR1 B;  2XLJ A;  1X37 A;  3FE3 A;  2DXI A;  4I4L A;  3U6Q A;  3UJN A;  5DNY A;  4FW9 A;  3U6C A;  4DV3 M;  2GNO A;  3AOG A;  2Z4R A;  1TF0 B;  3MMP A;  4LY6 A;  4B7G A;  2QEN A;  2C98 A;  4LRT A;  2CUZ A;  4YY3 M;  2LNH C;  4JI0 M;  3SHF A;  3FUU A;  3T38 A;  3GO8 A;  1XB2 B;  1HQY E;  4I81 A;  4DUY M;  1V34 A;  1NO1 A;  1IXR C;  4JI7 M;  2EA0 A;  2UXC M;  4LJ5 A;  1AUA A;  4RNA A;  4LJ6 A;  1R6B X;  1SXJ B;  1V92 A;  4GHL A;  1E32 A;  2D7E A;  4LF7 M;  1GL7 A;  3AKZ A;  4G6Z A;  2ZTD A;  2DAK A;  4P17 A;  3J80 S;  1J7K A;  4LFB M;  3ZCB B;  5IWA M;  3U5Z A;  4AG6 A;  3AFH A;  4M9S A;  1D0M A;  5E26 A;  2BNK A;  4XK8 F;  3KS4 A;  1YE9 A;  1DGG A;  3AV0 A;  2ZTC A;  4R3D A;  1HQC A;  2HL7 A;  3QYB A;  3R8F A;  1E94 E;  2G3Q A;  4OVZ B;  1IN7 A;  2RGH A;  1IY2 A;  3A98 B;  4HEO A;  4M0D A;  4JXJ A;  1IXZ A;  2X8A A;  1N34 M;  2DKL A;  2XF3 A;  2R18 A;  5EJC A;  1IY1 A;  1JQJ C;  4B3T M;  3RGS A;  3ZH9 B;  2YQZ A;  3FRH A;  3UK6 A;  3WHL A;  4NSO B;  2DHY A;  2JY6 B;  5KPR A;  4B7F A;  1W5S A;  2EO2 A;  2ZBK B;  1T43 A;  5FTM A;  3FUV A;  4D81 A;  2L4F A;  3R9X B;  1WIV A;  1QUS A;  2CHG A;  4EIW A;  4MH0 E;  3M7G A;  2Y20 A;  3U6D A;  2UXD M;  4AI6 A;  3K9P A;  1QQW A;  1QVR A;  3E9S A;  3PXG A;  1OIP A;  2CHV A;  2KRU A;  1K3W A;  3B74 A;  4RF0 A;  2WSE F;  3SMS A;  3VKG A;  3WHK A;  4R71 A;  2R45 A;  3U6S A;  1IBL M;  2J5Y A;  1JR3 A;  2CFO A;  3E4R A;  3SAT A;  2KDL A;  4DV0 M;  2L6O A;  4R7G A;  2C96 A;  1V33 A;  1GAB A;  1Q02 A;  3Q8X A;  2K6B A;  2WSC F;  2VII A;  2H5X A;  2UUC M;  1DGB A;  1F4I A;  1OFH A;  1N36 M;  3KFU G;  3GPY A;  2CE7 A;  3IG5 A;  5ITX E;  2LVP C;  1NY5 A;  2J7N A;  2Z7J A;  3U6L A;  3U6O A;  2Z3X A;  2FE8 A;  5EXT A;  1JB0 F;  2QP9 X;  1IM2 A;  2MRO B;  4DV5 M;  2YFQ A;  2R4J A;  2LVO C;  5GKN A;  2EKK A;  1W5T A;  2JP7 A;  4CGY B;  2M60 A;  4JI3 M;  1SXJ A;  3D8B A;  2Q2E B;  3SAR A;  1WGN A;  1HT1 E;  1VEK A;  3VK7 A;  2R6F A;  3U6E A;  2V1U A;  4IBD A;  4D82 A;  3HJQ A;  3ILK A;  1XXH E;  3QYE A;  2DWN A;  5EP2 A;  1IXS B;  4AZF A;  5C18 A;  4I8O A;  5JI3 E;  3J27 B;  3SBJ A;  2H1R A;  3HU2 A;  2R44 A;  4GIP A;  1IBK M;  3U6P A;  4RF1 A;  1NHW C;  2DVW B;  4M0W A;  1E9R A;  2JZ0 A;  3GLH B;  3QWL A;  3C58 A;  1JR3 D;  3E21 A;  2RRU A;  5IZ7 D;  4OVZ A;  1GO5 A;  1DV0 A;  4IBC A;  1PRB A;  3PNV A;  3T6P A;  4BBA A;  2F5P A;  3LW5 F;  1SG9 A;  3M6A A;  2KA6 B;  3HY5 A;  2F5N A;  1L1T A;  5JI2 E;  1NHG C;  2VF7 A;  3HJS A;  1XXH B;  3KSX A;  1R2Y A;  2OOB A;  4L4U A;  1MX0 A;  2CP8 A;  2OOA A;  2LH0 A;  4X64 M;  4DV4 M;  1WGL A;  3I51 A;  4F1I A;  1PJQ A;  3VLF B;  3W0L B;  4KOD A;  1KSF X;  1VQ1 A;  2HKJ A;  3KP1 E;  1K3X A;  2C99 A;  2KXE A;  1NNU C;  3C3E A;  3SAS A;  3JAM S;  1IN8 A;  5KPZ A;  4LGY A;  2XFT A;  4LFA M;  3SFZ A;  4JI4 M;  3SYL A;  3RE8 A;  3KW6 A;  1VDD A;  1OJL A;  2JY7 A;  1XNQ M;  2QSF X;  3VDP A;  2QNJ A;  4X66 M;  3FTC A;  2D7H A;  2NQ8 C;  1N75 A;  3CF2 A;  3AJI B;  2YNM D;  4G4Q A;  1HT2 E;  1R7R A;  7CAT A;  2DI0 A;  1C7Y A;  5EXP A;  5ITR A;  2BJV A;  1VEJ A;  2O25 A;  2JA2 A;  1WJ7 A;  2BJW A;  4LZZ A;  4JYA M;  1N78 A;  1OFI A;  2EKF A;  4MGK E;  1TH2 A;  2BWE A;  2LTU A;  2YR0 A;  3UZU A;  1XNR M;  2C5R A;  2K0B X;  4BB9 A;  4FWD A;  4AKI A;  5FTL A;  2KZS A;  2OPF A;  1Z5C A;  2HCB A;  2X49 A;  3KOW E;  3GLG B;  4DR6 M;  2OO9 A;  1PM5 A;  4GHA A;  4LF4 M;  3NBI A;  1MJG M;  2K9D A;  3HHZ A;  3CTW B;  4HL4 A;  4MGZ E;  3GLI E;  5KPT A;  3FD9 A;  4AG5 A;  4LF9 M;  3KS8 A;  3GLF E;  3KSJ A;  2L7H A;  3HWS A;  3M0E A;  2LXE A;  1N77 A;  1IXS A;  3FYD A;  2G5G X;  1T3T A;  2XH9 A;  3HHX A;  3MK6 A;  4KHP M;  2ZAM A;  4W5W A;  4OU7 A;  3B89 A;  1E9S A;  1QAM A;  3B7Q A;  2EJS A;  4GKK M;  3RFW A;  3W67 A;  4ZPX A;  3NBX X;  2XFS A;  2KNV A;  3K2L A;  3B7N A;  5ITX A;  3LQQ A;  1SXJ C;  4AKG A;  1NSF A;  3GLH A;  3K9O A;  2Y0Q A;  3DFZ A;  3GRY A;  1QAN A;  3FYC A;  3V76 A;  1G71 A;  3GLI B;  1UFZ A;  3HHY A;  2W82 A;  1GJT A;  4F2L A;  2KHH A;  4B3S M;  4S12 A;  2QQ8 A;  4HLQ A;  4DV1 M;  1PGY A;  4RKU F;  3GLF B;  4MB7 A;  4D80 A;  1XXH A;  4QNM A;  4DBG B;  4JI8 M;  3LVV A;  2ZAO A;  3HGI A;  4OW0 A;  2QZ4 A;  2FOI C;  4XBO A;  3VFD A;  2FNA A;  4B08 A;  1S3S A;  2Z4S A;  1IN6 A;  1YLA A;  2I7N A;  4LG2 A;  2FS1 A;  3SAW A;  1QDT A;  3I4V A;  4WUR A;  1NV9 A;  3LMM A;  2DEN A;  5F3W A;  4X62 M;  3EIE A;  2VQF M;  5ITU A;  3Q8G A;  4MGH A;  2OQ4 A;  4LGM A;  3GQ3 A;  2F5Q A;  4QOS A;  1G4A E;  2DZO B;  3TWM A;  1TDZ A;  2WSF F;  4MGI E;  3ZQJ A;  3NWL A;  4MM3 B;  2E5L M;  3QAU A;  2RGO A;  3A46 A;  3JR4 A;  2R62 A;  4KT0 F;  2R0I A;  2DHR A;  1IY0 A;  1XHB A;  3W0F A;  3GLG A;  4L78 A;  1EIJ A;  3T1Y M;  2JUJ A;  4M9X A;  3T1H M;  4LRS A;  1L1Z A;  4KLN A;  2LWX A;  3FUT A;  1UM8 A;  1PJT A;  4Z6Y A;  2JZ1 A;  1P3Q Q;  3HJ8 A;  3TL4 X;  2XZF A;  2Z8Y M;  1D0L A;  4CIZ A;  1OKS A;  1EE8 A;  1NVM A;  1D2N A;  2HWJ A;  2LVA A;  2R46 A;  4IIW A;  2L2D A;  1L2C A;  4IBG A;  1DO2 A;  3LCV B;  2XZU A;  4QNR A;  4GKJ M;  2VF8 A;  2XSZ A;  3GRU A;  2KZU A;  1G59 A;  3J7A S;  1R5L A;  4FWG A;  4OX9 M;  5IT9 S;  1ZQ9 A;  4GMQ A;  4GC5 A;  4X65 M;  4M9Z A;  3TQS A;  2JXN A;  4FCV A;  4PDI A;  4NSR A;  3LCU A;  3SAV A;  3KP0 E;  3SHG B;  2ERC A;  1WHC A;  3GLI A;  4NRW A;  2CRU A;  5LMN M;  4DR7 M;  1MU5 A;  1ZV1 A;  2GQF A;  4AW4 A;  3GLF A;  3SAU A;  1XWI A;  3MHV C;  2F5S A;  2HHH M;  2UU9 M;  4DV6 M;  1OAO C;  3FUW A;  2J7O A;  1PJI A;  4NRV A;  4IBI A;  2Y21 A;  2QPA A;  2R4E A;  5ITT A;  3GPU A;  1HR0 M;  2UXB M;  1IQP A;  3K8Z A;  2KEB A;  1QYR A;  5ITQ A;  2HAK A;  5KO3 A;  3T15 A;  4CIS A;  4G4R A;  1H6U A;  1TGU A;  1QDR A;  8CAT A;  1Q3B A;  1G3I A;  2V1C A;  1Z5A A;  3UMM A;  4DV2 M;  1G8P A;  3AOE A;  1R2Z A;  4NC6 A;  4GH9 A;  1Z5B A;  4GRI A;  3OTO M;  1TR8 A;  3H4J A;  3GPX A;  4DR3 M;  3U6M A;  2M5Z A;  4P16 A;  2XSZ D;  1SXJ E;  3KXE C;  2WZJ A;  4CJ6 A;  4LJ8 A;  4JN6 A;  3MJ5 A;  4JI1 M;  3CF0 A;  4YHH M;  1RU3 A;  3UGJ A;  2KNA A;  3FRI A;  1FJG M;  4ITQ A;  5BR8 M;  1R4G A;  1EFU B;  1YUB A;  2DWM A;  4CHT B;  4LJ9 A;  2VQE M;  2L09 A;  2C9O A;  2DAG A;  5DYG A;  4FD2 A;  5FSW A;  4FCT A;  4IBF A;  2O5R A;  3JR5 A;  2F5O A;  3I4Y A;  1PJJ A;  4LF8 M;  1KYI A;  3FUX A;  1QZM A;  1TH4 A;  2LVN C;  4LJA A;  3C3D A;  1XC8 A;  5KQ8 A;  4ANR A;  3KOX E;  4IBB A;  4IJF A;  3U61 B;  2DAM A;  5ITY A;  3B7Z A;  1OAI A;  3PVS A;  5LMU M;  2LHG A;  3DOA A;  4BLC A;  3L26 A;  3SC3 A;  3FTD A;  1BVS A;  2EUC A;  2Y0T A;  3W68 A;  4G3O A;  3U60 A;  2R65 A;  5IRE B;  4REZ A;  1OTR A;  2AHM A;  3GQ5 A;  2MGW A;  4LFC M;  2LBC A;  3DA1 A;  2F4V M;  1LV7 A;  1QAQ A;  4MGY E;  3L28 A;  5L8R F;  1NNJ A;  1DGH B;  2P5T A;  1N32 M;  3PFI A;  2XGN A;  1XMQ M; 
#chains in the Genus database with same CATH homology
 4PDG A;  4G4O A;  1TH3 A;  3LQR A;  4Z8X A;  3EIH A;  4IBE A;  2UUB M;  4L16 A;  1HNX M;  1GLN A;  2CV1 A;  4NXN M;  4DUZ M;  3SMP A;  4IJE A;  4QHS A;  1N33 M;  3DZD A;  2V6Z M;  3HU1 A;  3L2A A;  2ZM6 M;  4NOO B;  4L8R C;  4WW0 A;  3K92 A;  1FNN A;  2QBY B;  4LJ4 A;  2QCU A;  1YSY A;  3KOZ E;  1IN5 A;  4LF6 M;  4LZJ A;  1TDH A;  1HNW M;  4TUW A;  1L8Q A;  1ZAE A;  2CEA A;  5EXX A;  5A2Q S;  1QAO A;  3RGP A;  2RKO A;  3A42 A;  3J7B A;  2CHQ A;  4JI5 M;  4AKH A;  2X4A A;  3L29 A;  5BPV A;  5EP3 A;  3KDS E;  4JI6 M;  2L7I A;  5FLX S;  4DR1 M;  3HHW A;  3K1J A;  3SYK A;  3LVW A;  5DYI A;  1I94 M;  1Z6T A;  3KVW A;  4DR4 M;  4JI2 M;  5FTK A;  5EP4 A;  4K0K M;  4IBJ A;  4QHT A;  1IBM M;  2CV2 A;  3GRV A;  3AOE C;  5EXS A;  3B9P A;  1ORY B;  2FFJ A;  1G41 A;  1GL6 A;  4NXM M;  5KQD A;  3J81 S;  4IBK A;  1K82 A;  4GC9 A;  3CF6 E;  2K47 A;  3GQ4 A;  1J5E M;  1NY6 A;  1C1K A;  3A45 A;  3TE6 A;  5FTJ A;  3PNY A;  4LJ7 A;  3GP1 A;  3FTF A;  5FTN A;  3U61 A;  3U60 B;  4AQY M;  1L2D A;  2KRK A;  3IG8 A;  4GIT A;  5C1B A;  4G4N A;  3U5Z B;  5H37 D;  4A3V B;  2G8L A;  3H4M A;  1NJG A;  3TWK A;  3VDU A;  2UUA M;  3KOY E;  3VK8 A;  1NJF A;  1Z59 A;  1Q39 A;  4I5S A;  3GPP A;  4JV5 M;  4KO8 A;  3J2P B;  1GKI A;  4FVM A;  1J09 A;  4DR2 M;  4B3M M;  4LF5 M;  2DZN B;  3HU3 A;  4PD2 A;  1IN4 A;  1I4W A;  3GRR A;  4B3R M;  1DGH A;  4PT5 A;  1KFV A;  5EP1 A;  1L2B A;  1HNZ M;  2XEP A;  4XGI A;  1WXQ A;  3HKP A;  4B7H A;  4NL4 H;  2CV0 A;  3TPZ A;  2KW0 A;  4LCB A;  2A5Y B;  1GVN A;  2I7P A;  3THG A;  4L15 A;  2ZAN A;  3ZC7 B;  3FTE A;  1DO0 A;  5E6J A;  4PCZ A;  2D7G A;  3L27 A;  3TWL A;  3BOS A;  2QBY A;  4FWH A;  2DWL A;  4FCW A;  2DWZ B;  1Q3C A;  2C9C A;  5EQT A;  1DGF A;  3D8L A;  3FKE A;  3L25 A;  4II7 A;  4DV7 M;  1SXJ D;  3AL0 C;  1XMO M;  3VKH A;  4DR5 M;  4QOZ C;  2XLJ A;  1X37 A;  2DXI A;  4I4L A;  3U6Q A;  3UJN A;  5DNY A;  4FW9 A;  3U6C A;  4DV3 M;  3AOG A;  2Z4R A;  4LY6 A;  4YY3 M;  4B7G A;  2QEN A;  2C98 A;  4LRT A;  2CUZ A;  2LNH C;  4JI0 M;  3SHF A;  3FUU A;  3T38 A;  3GO8 A;  1HQY E;  4I81 A;  4DUY M;  1IXR C;  4JI7 M;  2EA0 A;  2UXC M;  4LJ5 A;  4RNA A;  4LJ6 A;  1R6B X;  1SXJ B;  4GHL A;  1E32 A;  2D7E A;  4LF7 M;  1GL7 A;  3AKZ A;  4G6Z A;  3J80 S;  1J7K A;  4LFB M;  3ZCB B;  5IWA M;  3U5Z A;  4AG6 A;  3AFH A;  4M9S A;  5E26 A;  2BNK A;  3KS4 A;  1YE9 A;  1DGG A;  3AV0 A;  4R3D A;  1HQC A;  2HL7 A;  3R8F A;  1E94 E;  4OVZ B;  1IN7 A;  2RGH A;  1IY2 A;  3A98 B;  4M0D A;  4JXJ A;  1IXZ A;  2X8A A;  1N34 M;  2XF3 A;  2R18 A;  5EJC A;  1IY1 A;  1JQJ C;  4B3T M;  3RGS A;  3ZH9 B;  2YQZ A;  3UK6 A;  3WHL A;  4NSO B;  5KPR A;  4B7F A;  1W5S A;  2EO2 A;  2ZBK B;  5FTM A;  3FUV A;  4D81 A;  3R9X B;  4EIW A;  2CHG A;  4MH0 E;  3M7G A;  2Y20 A;  3U6D A;  2UXD M;  4AI6 A;  1QQW A;  1QVR A;  3E9S A;  3PXG A;  2CHV A;  2KRU A;  1K3W A;  4RF0 A;  3SMS A;  3VKG A;  3WHK A;  2R45 A;  3U6S A;  1IBL M;  1JR3 A;  2CFO A;  3E4R A;  3SAT A;  4DV0 M;  2L6O A;  4R7G A;  2C96 A;  3Q8X A;  2VII A;  2UUC M;  1DGB A;  1OFH A;  1N36 M;  3KFU G;  3GPY A;  2CE7 A;  3IG5 A;  5ITX E;  1NY5 A;  2J7N A;  2Z7J A;  3U6L A;  3U6O A;  2Z3X A;  2FE8 A;  5EXT A;  2QP9 X;  1IM2 A;  4DV5 M;  2YFQ A;  2R4J A;  5GKN A;  4CGY B;  1W5T A;  2M60 A;  4JI3 M;  1SXJ A;  3D8B A;  2Q2E B;  3SAR A;  1HT1 E;  3VK7 A;  3U6E A;  2V1U A;  4IBD A;  4D82 A;  3HJQ A;  3ILK A;  2DWN A;  5EP2 A;  1IXS B;  4AZF A;  5C18 A;  4I8O A;  5JI3 E;  3J27 B;  3SBJ A;  2H1R A;  3HU2 A;  4GIP A;  1IBK M;  3U6P A;  4RF1 A;  1NHW C;  2DVW B;  4M0W A;  1E9R A;  3GLH B;  3QWL A;  3C58 A;  1JR3 D;  5IZ7 D;  4OVZ A;  4IBC A;  3PNV A;  4BBA A;  2F5P A;  3M6A A;  2KA6 B;  2F5N A;  1L1T A;  5JI2 E;  1NHG C;  3HJS A;  1XXH B;  3KSX A;  1R2Y A;  4L4U A;  1MX0 A;  4X64 M;  2LH0 A;  4DV4 M;  3I51 A;  3W0L B;  3VLF B;  4KOD A;  1KSF X;  2HKJ A;  3KP1 E;  1K3X A;  2C99 A;  2KXE A;  1NNU C;  3SAS A;  3JAM S;  1IN8 A;  5KPZ A;  4LGY A;  2XFT A;  4LFA M;  3SFZ A;  4JI4 M;  3SYL A;  3RE8 A;  3KW6 A;  1VDD A;  1OJL A;  1XNQ M;  3VDP A;  4X66 M;  3FTC A;  2D7H A;  2NQ8 C;  1N75 A;  3CF2 A;  3AJI B;  2YNM D;  4G4Q A;  1HT2 E;  1R7R A;  7CAT A;  5EXP A;  5ITR A;  2BJV A;  4JYA M;  2JA2 A;  2BJW A;  4LZZ A;  1N78 A;  1OFI A;  4MGK E;  1TH2 A;  2YR0 A;  1XNR M;  3UZU A;  2C5R A;  4BB9 A;  4AKI A;  4FWD A;  5FTL A;  2KZS A;  2OPF A;  1Z5C A;  2HCB A;  2X49 A;  3KOW E;  3GLG B;  4DR6 M;  1PM5 A;  4GHA A;  4LF4 M;  3NBI A;  3HHZ A;  3CTW B;  4HL4 A;  4MGZ E;  5KPT A;  3FD9 A;  4AG5 A;  4LF9 M;  3KS8 A;  3KSJ A;  2L7H A;  3HWS A;  3M0E A;  2LXE A;  1N77 A;  3FYD A;  2G5G X;  1T3T A;  3HHX A;  2XH9 A;  3MK6 A;  4KHP M;  2ZAM A;  4W5W A;  4OU7 A;  1E9S A;  1QAM A;  4GKK M;  3RFW A;  4ZPX A;  2XFS A;  3K2L A;  5ITX A;  3LQQ A;  1SXJ C;  4AKG A;  1NSF A;  3GLH A;  2Y0Q A;  3DFZ A;  3GRY A;  1QAN A;  3FYC A;  3GLI B;  3HHY A;  2W82 A;  4B3S M;  4S12 A;  4HLQ A;  4DV1 M;  3GLF B;  4MB7 A;  4D80 A;  1XXH A;  4QNM A;  4JI8 M;  3LVV A;  2ZAO A;  3HGI A;  4OW0 A;  2QZ4 A;  2FOI C;  4XBO A;  3VFD A;  2FNA A;  4B08 A;  1S3S A;  2Z4S A;  1IN6 A;  2I7N A;  4LG2 A;  3SAW A;  3I4V A;  4WUR A;  3LMM A;  5F3W A;  4X62 M;  3EIE A;  2VQF M;  5ITU A;  4MGH A;  2OQ4 A;  4LGM A;  3GQ3 A;  2F5Q A;  4QOS A;  1G4A E;  2DZO B;  3TWM A;  1TDZ A;  4MGI E;  3NWL A;  4MM3 B;  2E5L M;  3QAU A;  2RGO A;  3A46 A;  3JR4 A;  2R62 A;  2DHR A;  1IY0 A;  1XHB A;  3W0F A;  3GLG A;  4L78 A;  3T1Y M;  4M9X A;  3T1H M;  4LRS A;  1L1Z A;  4KLN A;  2LWX A;  3FUT A;  1UM8 A;  4Z6Y A;  3HJ8 A;  3TL4 X;  2XZF A;  1EE8 A;  1NVM A;  1D2N A;  2R46 A;  4IIW A;  1L2C A;  4IBG A;  1DO2 A;  2XZU A;  4QNR A;  4GKJ M;  2XSZ A;  3GRU A;  1G59 A;  2KZU A;  3J7A S;  4FWG A;  4OX9 M;  5IT9 S;  1ZQ9 A;  4GMQ A;  4GC5 A;  4X65 M;  4M9Z A;  3TQS A;  4FCV A;  4PDI A;  4NSR A;  3SAV A;  3KP0 E;  3SHG B;  2ERC A;  3GLI A;  4NRW A;  5LMN M;  4DR7 M;  1MU5 A;  3GLF A;  2F5S A;  4AW4 A;  3SAU A;  1XWI A;  3MHV C;  2HHH M;  2UU9 M;  4DV6 M;  3FUW A;  2J7O A;  1PJI A;  4NRV A;  4IBI A;  2Y21 A;  2QPA A;  2R4E A;  5ITT A;  3GPU A;  1HR0 M;  2UXB M;  1IQP A;  3K8Z A;  2KEB A;  1QYR A;  5ITQ A;  5KO3 A;  3T15 A;  4CIS A;  4G4R A;  1H6U A;  1TGU A;  8CAT A;  1Q3B A;  1G3I A;  2V1C A;  1Z5A A;  3UMM A;  4DV2 M;  1G8P A;  3AOE A;  1R2Z A;  4GH9 A;  1Z5B A;  4GRI A;  3OTO M;  3GPX A;  4DR3 M;  3U6M A;  2M5Z A;  4P16 A;  2XSZ D;  1SXJ E;  3KXE C;  4LJ8 A;  4JN6 A;  3MJ5 A;  4JI1 M;  3CF0 A;  4YHH M;  3UGJ A;  1FJG M;  4ITQ A;  5BR8 M;  1YUB A;  2DWM A;  4CHT B;  4LJ9 A;  2VQE M;  2L09 A;  2C9O A;  5DYG A;  5FSW A;  4FD2 A;  4FCT A;  4IBF A;  2O5R A;  3JR5 A;  2F5O A;  3I4Y A;  1PJJ A;  4LF8 M;  1KYI A;  3FUX A;  1QZM A;  1TH4 A;  4LJA A;  1XC8 A;  5KQ8 A;  3KOX E;  4IBB A;  4IJF A;  3U61 B;  5ITY A;  3PVS A;  5LMU M;  3DOA A;  4BLC A;  3L26 A;  3SC3 A;  3FTD A;  2EUC A;  2Y0T A;  3U60 A;  2R65 A;  5IRE B;  4REZ A;  2AHM A;  3GQ5 A;  4LFC M;  3DA1 A;  2F4V M;  1LV7 A;  1QAQ A;  4MGY E;  3L28 A;  1NNJ A;  1DGH B;  2P5T A;  1N32 M;  3PFI A;  2XGN A;  1XMQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...