2XLJA

Crystal structure of the csy4-crrna complex, hexagonal form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
178
Chain Sequence
TMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDEEEARKRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 31
structure length 178
sequence length 188
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.890 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xljA02
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xljA01
2XLIA 4AL5A 2XLJA 2XLKA 4AL7A 4AL6A
chains in the Genus database with same CATH superfamily
3ZH9B 2P9GA 5IT9U 4QOTA 3NGKA 2MZTA 2QCUA 1Q53A 2JVOA 4M5IA 4AKGA 4J91A 5DETA 2NCKL 4DJBA 5I3QA 4U8VA 2K6BA 1V5VA 4OZLA 3FQLA 1VQYA 3HU3A 5M2PA 1PJ5A 1MW7A 2UVWA 1XMBA 4V1Ak 2UUWA 4I4LA 1RCOB 4F0HA 5IC6B 3FKBA 1U8SA 1NSFA 3JS9A 3KHHA 3H42A 2B6AA 3CGWA 1QZMA 1RTDA 1AA1B 4ECQA 2XYPB 3SXLA 3O6QA 3SIPB 2C42A 4I2QA 4DV2F 4EYHB 1RHQB 1GXUA 4A8YA 3KXEC 1S97A 3KDOA 1PC5A 5B0GA 2F1FA 3C46A 4WBFA 1CULB 3EYZA 2ATCB 3RYLA 4XIUA 1XR6A 5CCLA 4YY3J 4C2MA 2HQ3A 1PJQA 4HLQA 5C25B 3KOYE 3BGLA 5C42B 3DU5A 1HWKA 4QR0A 2YQZA 3C15B 4IDKB 2JXNA 5E3AA 1BHNA 2BANB 4P52A 1RU2A 1E6YB 4Q5VA 4RW8B 2H9ZA 2XYHB 1BVSA 2VG6B 3RBXA 2O3DA 2ZVSA 4DF4A 3KLFA 3GLIE 5HJXA 4ELVA 2XSFA 3U6EA 4CJ6A 1IM6A 4MK7A 2GHWA 1YITS 5HROB 2VDBB 2DPJA 1FJ7A 1SVDA 2N4CA 2EK6A 1P1TA 2CE7A 4JV5F 3MI7X 1Z2ZA 3I4HX 4WWSA 3QT8A 1HNXJ 2D9OA 4G6VB 1M5PC 1VOMA 4O44B 2XF3A 1HNIA 1F3FA 3S1TA 2B51A 1ORYB 3MMJA 4TY9A 2OHDA 2B43A 3N9UC 3H4DA 2ZKUA 1WHVA 2JRSA 4EZ9A 1YJ9S 4AQYM 4ENOA 2UXDM 4RNAA 4L4UA 4JI3M 1RHUB 5KFPA 4K4SA 3AT1B 1VYAA 3IM8A 4RX6A 4QBUA 3MEEA 2CQBA 1U1NA 2UUBJ 1SJ4P 2XGPA 4LF7J 3C6TB 4AL5A 1HNVA 2B4PA 1Q95G 2G5GX 4H4OA 1EX8A 2JEIA 4F8RA 5LT5A 1RWVB 5HK4A 3AOBA 3MR3A 4LF8M 3E01B 5KFDA 3TANA 2HSEB 1DTTA 2L9DA 1SIZA 2JY7A 3P49B 4NZ7A 1SCJB 2FYXA 4ZK7M 1F2HA 2QIFA 2FJBB 1G4CA 2VKRA 2M3DA 2EW9A 4ER8A 3HD1A 3ET6A 4REZA 3DLKB 1ZM4A 3UDLA 3R1HA 1S6OA 2NPFA 3DNCA 4ZVRB 3AODA 1WC6A 1NHWC 2V67A 4CGYB 1TDHA 1N32J 2UUAF 2B9YA 2NYHA 4XPCA 2C3PA 5KFMA 2J0XA 2Q6BA 4YDDB 4DU7A 4CH1A 1HT1E 2FDNA 1RLDA 3M2RA 4LFCF 1RAIB 4ZITA 2EC0A 4FW9A 3HO1A 4B3MM 1Z1ZA 2ADCA 3DA1A 2OO9A 4PCZA 1L1ZA 4TU9A 4LFBF 2KTQA 1I4WA 3TVYA 2CV0A 3U1LA 1CJKB 2GMHA 3U6OA 1RGVA 3OD2A 2XB2D 5AJ3J 3BXWA 3MPUB 2QLJB 4OX9M 1PJ6A 1UVJA 4KGXB 3C14A 3NWGA 1NPPA 1RYRA 2BKOA 2KNVA 3W5ZA 3FCHA 4IG0B 1JLAA 1VRTB 5E26A 3EWGA 4I69A 4UZCA 4BB9A 1R43A 3GCXP 3D1HA 4RKUC 3BF4A 4L8RC 3V6HA 4DR1F 1VQ4S 3H7HB 3G86A 3M7VA 1H2VZ 5B0FA 3KMSA 1PJSA 3M0EA 1JXEA 1U02A 4HEA9 3MD3A 2EFVA 2RDJA 3NBIA 2JHEA 4DR4F 4KR0B 2IRYA 2DNOA 3GMGA 2RNEA 1UKUA 4DI6A 4DN9A 4UOHA 1KWMA 2YH1A 2EG1A 2JC0A 4UUXA 2DEIA 3FBCA 3AFGA 4JYAJ 2BKPA 5D3GA 1SI9A 3UD5A 4J37A 5IREB 2NZCA 5LOQA 4KRWA 5KFNA 1TKXA 1WJ7A 1U09A 5HLFB 2ZANA 4OYXA 2WK4A 5DJBA 4F3MA 3AY0A 2XI2A 2YWGA 4F7VA 1UM8A 3OBIA 2DNMA 1R3NA 4F4WA 4LSLB 3KSJA 3K8ZA 1OSDA 1BLUA 1X4FA 2EXUA 3RJMB 1C1BA 2XO7A 3QGHA 1BE4A 4GKJM 1PBUA 1B0TA 4HHJA 2K47A 3PZPA 3W62A 2FIUA 4EO8A 2L41A 3TA2A 2C98A 2Z2LA 1TL1A 3OR2B 4NASA 1NSQA 4K4UA 3N5BA 2IJNA 1PRBA 3FBFA 1X4EA 1IKXA 1ZPWX 3VKHA 4A8FA 1B64A 2HQGA 5SZTA 4M9SA 5GAHI 2L4EA 4MGYE 1DLOB 4AQYJ 2UXDJ 1ZV1A 4MGZE 1FJEB 1FDDA 3C3EA 1REVB 3HK2A 2L48A 3OJUA 1FDBA 5KG2A 5IM0A 2DITA 3DC2A 3MTJA 1KHWA 1O51A 1M5KC 1IR2A 4AW4A 4FXDA 4ZP8A 1W7WA 2LLZA 1B0PA 4M5JA 3JR5A 2PD1A 1NUEA 3TRGA 4CO4A 4R0JA 5DDOC 2VICA 2E9RX 4CRJA 3D6TB 3HHLA 3R5DA 4LF8J 3RAXA 3TJ9A 3WC0A 3FUWA 2MGZB 2LDIA 5J2NB 4WFNQ 2KRUA 2B7CB 3GE9A 3IRXB 3X3UA 2VG5B 1BQNA 1SH0A 1YJNS 1NO1A 2MY7A 3V4IB 3H4BA 7FD1A 4JBCA 3SATA 2FLPA 2H48B 5KG6A 4LJ7A 4RWXA 5EUHA 5KFTA 4RW6A 3FCWA 1RT5B 2JDJA 2YNFB 4LF4M 1PC4A 3ZTPA 2C96A 4M0DA 4DSEA 2Q6CA 4YN3B 1RTJB 1HR0F 1FK9A 2DXEA 5BYQA 2UUAM 1WKKA 2DNHA 4KFBB 4FD2A 4KHPM 1EKRA 2RIJA 2FQQB 1ACMB 3KLGB 4B3MJ 3TA1A 4Y2MA 1HQUB 3GU0A 1CJVB 1PBAA 4KSEB 2NQPA 2OSQA 5CYQA 5A6WA 1XMOF 2DO4A 3I5BA 1Z6TA 4CLFA 3C19A 2DGUA 2IVYA 3BN4A 2WB4A 4B9UA 4RW9A 2RKIA 2KDLA 3BKUA 5ITQA 2E7VA 3J7YI 4OI2A 4QU6A 3M2VB 2FHJA 5BYSA 5ITUA 5A0YB 5KO3A 5AXNA 5ETNA 4LJ8A 2XEPA 4LJ9A 2H1YA 5E3QA 3PEJA 4IBBA 3AXMA 2WOMB 4DV7F 4X66J 3PX0A 1NPRA 3AL0C 3TZYA 1QDTA 3HSJA 3J7A1 1QAOA 2F3JA 5DQIA 2MHNA 2DHSA 1MSWD 3I55S 2XLJA 3MAHA 2DNYA 3PJ9A 3MF5A 3PCOB 5B0CA 3TPZA 1OY8A 5E7OB 3CE8A 4B9MA 4IBFA 2KU7A 1XNQM 3DDKA 4GVLA 4DR1M 1G59A 3EIHA 4HDHA 3DOLA 1TL5A 4MKVA 1YG0A 1J5OA 3KUEA 2QMXA 1CJUA 3NY0A 3BPSP 2QA1A 1VR6A 2CPFA 1UP1A 4NLVA 3D4JA 2WSCF 2CJXB 2DNPA 2FD2A 4QWCA 3SAWA 1WD6A 1JJ2R 2GJIA 3Q8YA 4M5NA 4I2PA 5H9EK 5DG9A 2ZHBA 2ZBKB 1PGYA 3WX8A 5DM7Q 4CO5A 1Q8KA 3TP2A 3B54A 3NL0A 1KHVA 5IQQA 4GKJJ 4K4VA 4WW0A 4DL6A 4E0DA 3ZO7A 3G4SS 1S3SA 4PXDA 1F9FA 4P74A 3W60A 3BBFA 4Y00A 4OJGA 5ETMA 2HBYB 5KT7A 4I4BA 3HKZD 3HHKA 3MEDB 4JV5J 1JXVA 4NLQA 3WBZA 3NAIA 4CIOA 3R1LA 1KR4A 1VBYA 3PIPQ 3G6VA 2C3OA 4F2SA 5HQLA 1U8WA 4ILLA 3TE6A 1OQYA 1RA7A 2V2VA 4QIEA 4LRFA 2C5RA 3LMMA 1HMVB 3PFEA 5DDQC 2VOPA 4FF2A 3QRQA 3F44A 2B4VA 3KP0E 4GRIA 3O5TB 5M2RA 2SXLA 4ED7A 2P6TA 1UW4A 4C0BA 2RD5C 4PWDB 1HPZA 3OR1A 3G82B 2BBEA 2QV6A 3OL8A 4FF4A 2P6SA 1LW0B 1N36M 1S1VB 1I94F 2V2ZA 3L9ZA 1DAXA 1LW2A 2GVDA 2LQ8A 5CA5A 3QWUA 3QAEA 4LF4J 3R6GB 3DXBA 3CJTA 3K92A 1MU2A 4ECVA 3T1YF 3PX6A 2VQEM 3W63A 1IXSB 3P4UB 4A48A 3AB2B 1GMWA 2OEJA 2DHYA 4OYOA 4GHAA 4CI0B 4BC7A 1IKYA 3C6UA 2UUAJ 3NRBA 1ZMVA 1C7YA 2R62A 2HNDA 2R45A 2CQGA 1GXLA 1JLEA 3K8VA 2DISA 3M4XA 4LRDA 2CWXA 4EFAC 3MR7A 3GTYX 1W25A 2OPQA 1HR0M 3OL7A 3ULHA 1T3NA 3PW5A 4A8KA 4OYBA 4KPYA 1T05B 1OIZA 2JLFA 3GO8A 1PJTA 2Z56B 4QWAA 2K8GA 2XQCA 2X1BA 3HI9A 2HHQA 4AL7A 3NNAA 1GJSA 1UL3A 3H25A 1TKTB 1RUSA 1WC0A 2LYVA 4GMKA 1UETA 1P9YA 2K3IA 1K1SA 3LOUA 5BYRA 1G71A 3FRIA 2OPRB 3I56S 2ZH5A 1F6TA 2BJ3A 3I04M 1ZS6A 5F9LA 4DV3M 2P5TA 3VZIA 3A4TA 3VFDA 2LCWA 1XNQJ 1KFVA 3ILJA 1YSYA 5J2QA 2J0WA 4DR1J 4PXCA 1HNZM 1S1XB 4EO6A 2XYGB 4OHZA 2OPSA 1S0MA 2XLIA 1OJ4A 5F8NA 3HVWA 5EP1A 2R7XA 4DR4J 4RWWA 1HNWM 1M5OC 3TL4X 5GMDA 2OH2A 3NBXX 3LAKA 3MCNA 3U61B 1R89A 1JLCA 2FHKA 4IFVA 4HYKA 3Q86A 1EP4A 2V8GA 1NSKL 5EQTA 2DI0A 1UVMA 2MLYA 3LCVB 5FTJA 3SCLE 4Q8FA 3A8IA 3SSQA 4K5SA 2DHAA 1QUTA 5GAEU 3N6LA 1DGBA 1FX2A 5I42B 2UU9F 1XC9A 1JKHB 4FVCA 5AXKA 4KGZB 3EDRB 1UVKA 3H2LA 4LREA 4X4QA 4O3PA 2K9DA 1J5EM 1F5BA 5E41A 2CPZA 2IMOA 1TL3A 2WSFF 2ZH3A 2A10A 2OAUA 2HVIA 3ICLA 5DO2A 1WORA 1WACA 3E4RA 3DU6A 3Q89A 2J7WA 4YHHF 2XSZD 2IM3A 1S9EA 2DGQA 2HWTA 2GC8A 4LFAF 2M70A 2GHPA 1U2FA 2E5LF 1BMQB 2VC0A 1VC0A 4B3TF 2RHQB 2OEKA 4QYZJ 1X37A 3R5JB 1C0TB 3FUTA 2QFJA 4ZIVA 2EG2A 2YNHA 3PFIA 3E46A 1Z5BA 3M30A 2ZITA 5HVFA 5KT4A 2YWKA 3MR2A 1G8PA 5C2GA 1GL6A 2VBYA 4R7GA 2KJVA 4I64A 2OO4A 3MCMA 2BE9B 2DWMA 3NOCA 3HJVA 1YE9A 1NM2A 2QL9B 4ZHRA 3DLGB 2UV8A 1SH2A 2H51B 3W68A 3UE2A 4BWMA 3MMCA 1N36J 4KC5A 3GR1A 2B8PA 5J2MA 1VQ5S 3QZ7A 3TVZA 1TH4A 1ZA2B 4WE1A 2EBEA 5KG4A 3QWPA 3D67A 1U0HA 1VDLA 2WW4A 3OFFA 1YJUA 2JWSA 1MG7A 4L78A 3QMQA 2KA6B 1HIYA 3RU0A 2RRAA 3PIOQ 1ZAXA 3H59A 3DOMB 2VQEJ 2MQNA 3G2XA 3BO2A 5CYMA 2JLGA 3KJQB 1WDTA 3MMPA 3THPA 4CLTA 3U6DA 3JAMY 2Y0QA 3SBJA 2CZ4A 4LR8A 2WVBA 1S10A 1S57A 2PI5A 3SAVA 4C8LA 3UFCX 3E8OA 1X9WA 3TQSA 1IWGA 2CQ0A 1R0AB 2YKNB 4ED6A 4IR9A 5C24A 3QO9B 4OI0A 4UZBA 4M5DB 3BBCA 2OPPB 3S8SA 3SQOP 3V81B 1MROB 4LR7A 1HR0J 3PG9A 3SDEA 3VTIA 5MAOA 2JVRA 3EGVA 5E33A 2CQDA 1NY5A 3M8QB 2QSFX 2Y9HA 4A4JA 3QBCA 2Z4PA 1SV5B 2V1UA 1U48A 4AXIA 2VF3A 1HFEL 3KLIB 2HHXA 1R0BG 2RUSA 2UXCF 3ZQJA 2XMAA 4X4VA 1WC1A 4WTYA 1B70B 3GSIA 1KRPA 1IXRC 3IGVA 3T9NA 4TN2A 4NLXA 1XWLA 3T38A 3MPWA 4GMQA 4MK9A 1BD6A 2JZ5A 1F0XA 2V6AA 2JA2A 4LSNB 3V6DA 4Z8XA 1R6VA 1XTZA 3GCWP 3LP0A 2YKMB 4OYZA 1U1PA 2DWLA 3L26A 1FKAF 2FJVA 5I3PA 3GP9A 5DFLA 4D3GA 5EP2A 1I3OB 2DXFA 2DXIA 2IJRA 3QYYA 2VG7A 3I4YA 4G3OA 1NH8A 1XMQM 4DMZA 1RWPB 3DLLQ 1G3IA 4U7UD 3A98B 1HNWJ 2YH0A 4G1IA 3M6AA 4N56A 5A8RB 3W8PA 2FLNA 4NYZA 3GQ3A 4U6PA 4DEZA 4DPXA 4KJIA 2BW2A 4IO9Q 3Q83A 1UFZA 4USUA 2M8HA 1J2VA 2ZTCA 3UZUA 4KB7A 2JNJA 2LDYA 4C6AA 4Q2MA 1S72S 2DNKA 4PQUA 4Z37A 2APOA 4NLGA 1SUQA 3FGVA 4CLYA 3H4JA 3E51A 1ZOTA 4O0NA 2KG0A 2VA2A 4DWIA 5EXXA 2LKZA 3FBBA 2W82A 2BJ7A 3Q8RB 2W9BA 3HHXA 2N82B 4ETXA 1SXLA 3ITHA 2Y0SD 1DFDA 5T7LB 5F3ZA 3PVXA 2Y0BB 4NCGB 2JOQA 1MWZA 3FE3A 2DB1A 2QSWA 2YFQA 3FYCA 2RQMA 2CPIA 3GLGE 1LKZA 2DWZB 1G4AE 1XNRF 1VC6A 4G4QA 2HAFA 2CQ1A 5KFHA 2FNAA 4QOSA 4PD2A 4X65M 2DNAA 4RNOA 4NYPA 4FWHA 2HEKA 2ASYA 4EUVA 4J9OA 2ZUGA 1JLGB 2BJWA 3LVWA 1B0VA 1U47A 1W2BR 1WIVA 5DYGA 4DV1F 3BGUA 1MJGM 3UDEA 1SG9A 3C58A 3HGIA 4JI2F 1HQ2A 1C1CB 2W2MP 4PQAA 1TK8A 1NZ8A 3DMJB 4U96A 4K2JA 2YNGA 2VONA 1D09B 1NK0A 3UGJA 5DLGA 1XHBA 2HNZA 2GS8A 2XWXA 3H2UB 5D0RA 5ADZA 2N7CA 1R4GA 2HHHM 1NZAA 2X8AA 2ZBPA 1SXJC 5F41A 3PR5B 5DG7A 1O0PA 1O8BA 1WR1B 3FTDA 1I94J 4K2XA 2ZJRQ 2GIQA 1GXTA 2W9CB 4MM3B 1LNQA 3H5UA 4Y34A 4QHTA 3VAIA 2E44A 1CPZA 4L6V6 2YWHA 2XNQA 1D1UA 3T1YJ 4N76A 2M5ZA 2KI2A 2DRAA 2WBMA 3P8BB 2NXNA 3SMZA 4GIPA 4DV4F 3KW6A 1XB2B 4R5PB 1OAOC 4LMZA 5HBMA 4MFBA 3G71S 1Y3JA 2OFGX 1NH7A 3IRWP 2WSFC 3KKFA 4USTA 1WHCA 2CXEA 1CEZA 3UVJA 2H1RA 2D69A 2DNLA 4JI4F 3I96A 2JLEA 1FTRA 4KLNA 1VJWA 3SQGA 4IH5A 5KFGA 1CQMA 2BACA 3CC4S 3Q22A 4ZPWR 3PRBA 4AT1B 4E2FB 2YKPA 3H4MA 1FWKA 3ELHA 4I8OA 4NA3A 3ZFVA 2ZZTA 3L27A 2UVVA 3M9MB 4ZCKA 3HFZB 2G2ZA 1J09A 4RBUA 1G3OA 3D28A 5HI7A 3Q8UA 5JUMA 3CCVS 2XZWA 3M6UA 1IY1A 2W2QP 1U2RA 3K7RA 4QPXA 2YWFA 3K9PA 1DJ0A 3GPUA 3M8RA 2YKAA 2FPHX 4WKRA 3LQVA 1UEUA 3AJ1A 2VV5A 1SKSA 1GNKA 2MMYA 4WURA 3MXHP 2YTCA 5KT5A 2PA3A 3GJRB 4DX5A 4V19X 2CG8A 1H73A 5CD4H 3BBBA 3IR5B 1WNEA 3UMMA 4CDIA 4ID5A 2DR8A 2Z2MA 3G8QA 3MDFA 3HXMA 1T94A 5C18A 4DPUA 4Y2AA 3J2PB 1RT7A 4LCBA 1FDAA 2RRNA 3VK8A 3NS6A 4C11A 2DHHA 1N8RT 3PKMA 4JI6M 1TKZB 2QLWA 4ZPDA 3QSYB 4NLTA 1KP6A 2V34A 4IFYB 2K1RA 3WIVA 4MB7A 2B8QA 2CQIA 1HBMA 2V68A 2NQ8C 3BYRA 1RDRA 2FS1A 2VBZA 2H5JB 2JEFA 4R0EA 4O4GB 1XK8A 4MH0E 1C2PA 1WTFA 5KFUA 1RWMB 1WSRA 2FC9A 3IBFB 5EXPA 4NRVA 1RYSA 2LEPA 2HBRB 4YHHJ 1QUPA 4MIWA 3DLJA 2IBOA 3P3DA 4LFAJ 1M1KT 2ZBIA 3SZ2A 1L3KA 4R71A 2ZH9A 4B3TJ 2MQPA 3NWRA 4IRCA 3GIRA 2AP6A 3AD8C 1FNXH 5E2QA 3V4MA 4ES3A 2KYZA 3IR7B 3K0JA 4YMEA 2V9WA 5ITRA 1TL7A 1Q78A 4OVZA 3NG8A 4GC9A 3NOGA 1VJQA 4OZNA 2B7BB 2JSXA 2JP7A 4L72B 4JI2M 3I5AA 3M8PA 5KPZA 1FKPA 5F8JA 4ZOSA 3UQSA 1U25A 3FFIA 2DAEA 4G65A 3DRYA 4C48A 1OYEA 2HKEA 1VQNS 2RJZA 2LECA 2XHCA 2D9PA 4AL6A 1Y5NB 2VH7A 1QM9A 5BJRA 2DGSA 1RT6A 3IWNC 2VFRA 2DRBA 3I82A 1KSFX 2LP4A 5B7WA 3Q8GA 5AXLA 4QZVB 1KQKA 1PJIA 2AGPA 2VIIA 3D1QA 2GQQA 1SJ3P 3N28A 1S9GA 1B3TA 4ZS6A 1SL2A 3P5TL 1XERA 5KG5A 1FFSB 5KTQA 4IOBA 2FVPA 4B3RM 2HQDA 2QN6B 1HBOA 1HNIB 4OZ3A 3D54A 2HBQB 3LGMA 4ITQA 3AOEC 1F2GA 4DL2A 2V2KA 5F8MA 4DV4M 1VEKA 1N4LA 2F4VM 4DR3M 4N8OA 2W25A 1KKHA 2RB7A 3RGIA 4ZPVR 2ALZA 3MECA 3BGFA 4H54A 5HL7Q 4LF5M 3BGRA 3H8YA 4DL7A 3CXCR 3G6ES 1BXNA 5A8WA 5D8HB 1VLOA 1H3DA 5DM6Q 2UXCJ 4DBQA 3AJDA 3K5MA 4WK3A 3PO4A 3V5RA 3N5FA 3KLEB 1QAIA 3O1LA 1S6QA 3W64A 3BQ0A 4LZZA 3QZ8A 1DTTB 4DPWA 2IBKA 1ZM2A 4OI1A 3J80Y 3SMPA 1FT8A 3ET6B 3UDCA 3V2UC 2G8LA 2AGQA 4YS2A 1RAFB 1UZHA 3SFGA 4RBVA 3NGDA 5IT0A 2J0QD 4X4RA 4FCTA 1PKUA 3CCQS 1UFLA 1X9SA 2B4UA 3AV0A 4QOZC 2DGTA 4DR6F 2ZH7A 4JV0A 1YRTA 1G1XA 4FWDA 4ED3A 4JI8M 1DGHA 2DH9A 4B3OB 3AJ2A 4HI1A 1KC8T 1IN6A 4FYWB 5L46A 4LIWA 3M2RB 4HKQA 4WXOA 1RWXB 2JEGA 2M8DB 1P27B 4F2RA 4CM2A 1FVSA 1MN3A 2CQ3A 2G9OA 2YNMD 1SXJD 5EGYA 1N6QA 5LSOA 2XY6A 4EI2A 1H6KX 4JI6J 1IXKA 1FE4A 4HR2A 3T9ZA 1NB7A 2R7OA 2HVDA 4U7CA 2GMLA 3TAMB 5J1NA 2GIFA 1WC5A 4IOCQ 2BKNA 1VK8A 4XBOA 3OJSA 3EIEA 1YK9A 3C14B 3MMAA 3UD4P 4UQTA 5KQ8A 3BS9A 2F65A 1TK0A 2MY8A 3PJWA 1YLXA 4KPCA 4NE9C 4FF1A 1JLAB 2OUGA 1CVJA 1T0TV 3JR4A 3CIMA 2ZD1A 2GNKA 4RUBA 3PR4A 4OHYA 1M90T 1DRZA 2UXBF 4ICLA 2F7VA 1UEKA 3IG5A 3GFYA 2CV2A 1QDUB 2GCFA 1UFWA 3T5KA 1HJPA 1A6LA 1TUWA 5KFLA 5DYIA 1DQ9A 2C2EA 1RI7A 3B8HA 1EAYC 1XNRJ 3TUJC 1Q8LA 3CO9A 5KFFA 1F9HA 4TU8A 2EKNA 1PM5A 1CSJA 1ZETA 2HHPA 2ROGA 3GV8B 1LV7A 1H0HB 2RF2A 1E6VA 5D3GB 3ENWA 3IR6B 3VQSA 4LGYA 4P71A 5HSPA 1NNJA 1A9NB 4JI2J 1MMNA 1RKIA 3RR7A 3A12A 1WUUA 4N47A 1QZEA 5G0RA 2RVJA 2GJFA 5LMUF 4KH1B 4LJMA 3B4DA 1A7GE 1U49A 5J1EA 2Y1IA 2PSZA 2H4WB 3BDEA 3HT0A 4CTAB 2WZJA 3Q24A 2XCPA 3MHVC 3WHIA 5CXTA 3LQQA 4ANCA 2AJ4A 1GQEA 4B7GA 1YRUA 1EHWA 4M63A 3I6PA 1FXRA 4TKTA 3J81j 3HKPA 1TL1B 5F3TA 4C3KA 1BWEA 2QYCA 1DO0A 2FHMA 4FN5A 2F5QA 1S4EA 4KH0B 3UDVA 3TX0A 2R4JA 4B7HA 4NEYA 4USKA 2R0IA 4E8UA 1QAXA 2H5XA 1IKXB 2PMZD 2AW0A 1FDNA 4L15A 3JYTA 3HHYA 4DV4J 1TZ0A 3LTOA 1WXQA 1Q5VA 1V9OA 2U1AA 2F4VJ 4K0KF 2PIIA 2VF8A 4DS5A 3M9OB 1RAOA 1P6TA 5BR8M 1IM4A 3MD1A 2DKLA 4V19J 1N54B 4B3SF 1T11A 4UQGA 1CC8A 1UWAA 2MXYA 4I67A 4O3SA 3GPPA 3GLFB 2RU9A 1NMEB 2VFUA 1VRUA 5ITXE 2W8LA 3QGGA 3MTKA 1F5AA 1U45A 2J76E 4IKAA 3HHLB 3PW4A 2MQLA 4ED0A 1NJFA 1WGLA 1AW0A 3VCDA 1UA0A 3U5ZA 2ZWPA 5EX3A 1UJ6A 1BQNB 3SCIE 4KHRA 2ZDOA 2XM3A 2E9TA 3GILA 3E21A 3RFWA 8ATCB 3C3DA 3HZEA 4TXSA 1YUBA 4RW6B 3A46A 5IV3A 3MFIA 3K17A 2OEMA 4LF9F 3ETOA 5ETOA 4JI8J 5ETTA 4M0WA 5BXIA 4WFXA 2C2KB 3MPDA 1FK9B 4YR3A 3OXLA 2KZMA 4YB7A 2W8KA 3U1NA 3CT9A 4HT7A 5LMNF 2C3UA 2D74B 1SXJE 2ZM6F 4NXMM 4MYUA 1UVNA 1TH2A 3HJSA 3RAQA 4RW9B 2MZJA 1AZSA 1RXOB 4DPYA 4RBTA 4KKOA 4AUKA 1VIXA 1BQXA 3OL6A 3QPIA 2X3GA 2WVFA 1Q3CA 1GEHA 1R7IA 1RADB 4MKAA 4FS2A 2FTRA 4JI5M 2F5PA 1UJ4A 2KZSA 1S1WB 1GX5A 2QO3A 1WC4A 3F56A 3RTVA 4LZJA 3DYAA 2RQCA 2UZAA 3GFXA 2KFNA 2JUJA 2EFPA 2R6FA 4GO7X 3B82A 1L2DA 1IJFB 3VLFB 4Q7JA 3NCRA 1YGYA 3JSRA 3DOLB 4HTJA 4YY3F 3JB9k 3RB6A 2OI2A 2MB0B 1NDPA 3TWZA 4ZVFA 1J5OB 4K50A 4DR7F 1CJUB 5CHCB 1U1QA 4U95A 2E5HA 2HFVA 5FSWA 3CO0P 4X64F 3HWSA 2OLWA 2A3JA 3B89A 1NDKA 4JB8B 1OFIA 2C3YA 1J27A 2HZAA 3PW7A 4I2PB 2Q43A 1F5CA 1D0MA 3W2VA 1AT1B 4DCPB 2V8DA 5LMUM 4DX8H 2KG1A 3OHBA 1RWKB 2J5YA 2YY3A 3CW2C 3MGJA 4FXWA 1HNXF 5IQ6A 2OELA 3BSCA 4F0KA 1Y5LB 3W65A 5KOXA 2Z30B 4OZ2A 2GHVC 3QGIA 4A46A 4FCVA 1ZM3A 2QBYA 2HZVA 4O23A 4AFFA 1TK5A 2LFVA 4IRKA 2GGPA 3RBDA 3RBEA 4KQZA 2UUBF 8AT1B 2G2OA 1YKWA 2AYGA 2VFTA 5GAGU 3M9NB 2IYGA 1OJLA 3QGPA 3L2AA 4IRDA 1K0VA 3I0SA 4BBYA 5B0DA 3DLBA 3C15A 3IWXA 1SJQA 3MM8A 5FLXY 3R8YA 1Z5CA 2R2TA 1E6YA 2ERRA 2PMWA 1NEEA 3IAS9 2VD3A 3SEOA 1J7KA 2AMCB 3I0RB 2P2CB 4B3SM 1NSPA 4XK8F 4XDCA 5SUHA 4L3NA 1V6HA 3NAHA 2I7NA 2DZNB 3IS9A 3SI8A 3T6BA 1YI2S 1WELA 1JMTA 1JX4A 2W7AA 4CCHA 5FIIA 1RWOB 1IN5A 1WOSA 1U1OA 2ADBA 1LW2B 2GVDB 1N32F 5LL6d 3ZTRA 4TYAA 1X31C 4RW7A 1JLFA 1NB2A 1U1KA 1UVLA 2HFNA 5CQGA 3RW6A 2Y0TA 5KG3A 4OJ3A 1Q39A 4QNMA 1X4CA 1MU2B 4JP8A 1TUGB 1Q7LB 3WIUA 3UR0A 2VQFM 4WK1A 4PPZA 3VGUA 3K89A 2FJXA 1HWUA 2BOPA 3TWMA 4LGMA 4HVZA 1IKYB 2GZOA 3C6UB 2E5JA 1PO6A 2DCUB 2HFUA 4QIWD 2HNDB 2ZZMA 2E7WA 2DIUA 3QFWA 1JLEB 1IXZA 1LFPA 2NSCA 4J5OA 4CO3A 1R6BX 4G6ZA 3WHLA 3C6TA 1EZZB 1JQJC 2FZKB 2OPQB 2YX4A 1OY6A 2XSJA 4LRAA 3BZQA 2V4JB 3MWBA 1JLQA 4DF8A 4JUZA 1GAOA 1OIPA 1NRKA 3E01A 1LWEA 3BV8A 3NKYA 3MPYA 2PI4A 4WU2A 1ZPVA 2CAJA 4MIBA 4FCWA 3PNYA 4YB1P 2HHSA 4F4AA 3IG1A 3MM5A 3VR1A 2KT2A 1YTYA 2CEAA 1FTCA 3N79A 1TKDA 3KHRA 4R8UB 1VGYA 2QTWA 1NLKL 4J9MA 2O67A 3IGNA 4WJBA 1FO1A 1X4DA 5J2QB 2UXBJ 1K82A 1IKVA 1FNNA 1T02A 3T3FA 4RNHA 3RB0A 2OPSB 4ITSA 1FXLA 3QJPA 2DWNA 3VHQA 2L08A 2VZ9A 3EZOA 5CH7B 3GPYA 4C98A 2KFZA 4I56A 3MPVA 4X62M 1U24A 2DENA 2Y21A 4DLGA 1N88A 1DTQB 5A76A 1JLCB 4IFVB 3HHLD 1Y11A 4ZPBA 5FTNA 4NL5A 1EP4B 3OVAA 1UVIA 3QQCD 4R3DA 2EKYA 2JL9A 2X7IA 1YIJS 1U4BA 3BH7B 3CDAA 4OI3A 4DR7M 2DYAA 4M9ZA 1Y9OA 3M2UB 5HP1A 2EO2A 3THGA 4X64M 3FVYA 5FDLA 4EK2A 5LMUJ 3AA9A 4R25A 3VGVA 1HLWA 3S01A 3MCOA 2MKCA 3D6FB 3IWLA 4P73A 1TL3B 1XN9A 4HL4A 4CLSA 2BX6A 4GC5A 3H20A 4AQYF 1RTHB 2UXDF 4CT9A 4JI3F 2PO4A 4X84A 4HH1A 1FRLA 3HHZA 3Q8SB 2K7JA 2YWEA 1T7PA 3OHAA 4FBTA 1NPKA 1QY7A 3E9SA 2C9OA 4NRWA 2FLLA 3I5CA 3GYXB 1KONA 3U6CA 3DLEA 4AG6A 1Q0NA 2YNHB 3WX4A 5HAOA 1UCNA 3M30B 1GT8A 4K0KJ 4F4XA 2RILA 3ZZYA 2HLUA 3SFZA 1IY2A 1K8AT 1Q8IA 4ZLJA 1WEZA 4B3SJ 3ENAA 4OV1A 3J27B 1TAUA 3CJKA 3AQPA 2DR7A 2YXLA 2DJWA 2F63A 2JNHA 4C97A 4NZ6A 4ERDA 3MMCB 2D7GA 1HQEA 3P96A 2QSFA 3CUNA 1M0SA 4WE1B 3OR2A 3AQOA 2R42A 2HQCA 2ZC4A 1U0HB 2NLWA 3POTB 4TQRA 1KLNA 1KDNA 2FFJA 4OX6A 1AROP 2KVIA 5L8RF 1OQ6A 3QT6A 1C0UA 2HNYA 5CYMB 4PDGA 1EJ7L 3K5LA 3HLUA 5KFCA 1NSAA 3D6MB 1VRQC 2WONB 1N0VC 2L3MA 2EUCA 4YFUA 3J7Z5 3BM7A 4JV2A 5C24B 4LJ4A 1TR8A 2HURA 3R97A 1SJFA 1FX4A 3MOJB 2C2MB 1NU4A 3U1MA 1DARA 4C8YA 3G8TA 3SDEB 3Q0AA 3BPDA 1WC3A 4OU7A 1JNRB 4OX9F 3NCPA 3CCUS 2FUG9 1GVNA 3IHPA 4DFMA 2F40A 3CEDA 3KJNB 2DVIA 3IO1A 4TNOA 4DV0M 1BWVA 2Y8WA 5LMNJ 2XHWA 2V94A 1OPIA 4AE5A 2IM1A 4A8SA 3HZGA 1JWWA 3AD9C 3D0HE 3EXYA 4ZPCA 3KOAA 1YBUA 4XTTA 2YKQA 4CLLA 3LCUA 1D0EA 2A6MA 4HEOA 3KMQA 1E9SA 4EBCA 2F9JA 2HAIA 3V6DB 3UCZP 1Q02A 2VC1A 3PRDA 3LP0B 5A2QS 4N8NA 4DG1A 1N75A 1YJRA 2XWYA 1Y0HA 2MGWA 5JVHQ 4XK8C 3RRKA 1QSSA 3MM7B 4ZVUB 1N48A 4DL5A 3GLFE 2F8HA 2XS2A 4PEOA 3KLHB 4X62J 5IC4B 2QA2A 5K8MA 2FZCB 1JR3A 5DS7A 3B74A 4UW2A 5ETSA 2MDAA 1X5OA 2KHCA 3CCWA 1ZMWA 4WZQA 2H3EB 4DR7J 1U6BA 3HJFA 4YUDA 2FH0A 2L7IA 1CS4B 4GKJF 2GIRA 3PVSA 1JNZB 2MSSA 2WOMA 4X64J 1R8AA 4PQUB 1M1HA 3L25A 1DZ5A 2BJEA 1SUQB 1MWYA 4LQ3A 1URNA 1NAQA 1OS5A 3EJMA 1GMWD 3FDSA 5AE1A 2YR0A 1R2ZA 5D0EA 5KFVA 4DCOB 3I9ZA 3VF0B 3ITHB 2Z58B 3LWLA 5KFSA 2I38A 4L75A 2KM8C 3CCZA 3GLHA 5I3UA 4Z6YA 2NYIA 2WVCA 1EETA 4J9RA 4Z7YA 3AOEA 3DM2B 2WSEC 1FXDA 3VAFA 4ZMMA 2VBXA 4IBKA 3W5XA 3ZCBB 4U8YA 4LJ5A 2DZLA 1WTBA 5E6JA 1WEXA 4GRSA 2XZFA 4QJVA 5L1JA 1NXIA 4OLOA 3BQ2A 4M8LA 2CRUA 1RU3A 2VBWA 1D3WA 3G96A 4YB6A 2RKOA 2YNGB 2M9KA 2OOAA 4MGKE 2VPZB 2HNZB 1OFHA 2ZTDA 4FXVA 3JQMA 4MMOA 5ETQA 3W9JA 5D0HA 4CO0A 4LF4F 4MJKA 1L3VA 4WFAQ 1F60B 1KLMB 4UN2B 4OYMA 5FLXS 2BWEA 1BUXA 1OO0B 2CJYB 2IA0A 3ZC4A 3QWLA 3QNWB 4OYAA 4D81A 2R4FA 3IFEA 1O5JA 1YZ6A 2RSQA 2KVQE 4KHPF 4W4MA 5IT4A 4PCQA 4DUZF 3ZZZA 4RF1A 2RS8A 2MKJA 1EFUB 1C4CA 1FCAA 1HMVA 1KN6A 1HHTP 1FEEA 3TI0A 3I32A 4UOCA 4S0MA 5HBMB 2DZOB 4MFBB 4Y65A 3B7ZA 4I0WA 5L39A 2L7HA 2L9NA 4ZP7A 2HIQA 4TLRA 2HQFA 3HHWA 1HYSB 2DHRA 2DR9A 2YKOA 1BY9A 2LXUA 3EZUA 3TAQA 2IAJA 2J9DA 5KPTA 3G82A 3SQGB 3OSPA 4A3VB 1UTAA 5K8NA 4XDDA 3KG1A 2OQ4A 1S1VA 1ULRA 4QWEA 3TX8A 3BBZA 3TEGA 3CCRS 1MX0A 2LVWA 4PUOA 4LR9A 1VISA 3MCSA 3Q2TC 1TQLA 2R8HA 4C4WA 3IMQJ 2J6TA 3HHEA 4XGIA 5F0WA 1RZMA 1XNQF 3KNGA 1H98A 3TZWA 3CDWA 2BUNA 1S4FA 1H7XA 2WRMA 4CM0A 4ECZA 1IXSA 3GG0A 5JI3E 3HSGA 2I0XA 2LVNC 1XR7A 2H5EA 3GFZA 3CJQA 1P9QC 4BBAA 1WI8A 3WZ0A 2ZE2A 4PKDB 3RB3A 4IOAQ 4AI6A 1AUSL 2AZ3A 5K5MA 3LQRA 2XMTA 2G0IA 3I51A 3H2VE 2MH8A 3I9V9 4B9VA 4FP9A 4H4MA 3CF0A 3CD7A 2FB0A 2BXJA 4ZVGA 3L3CA 4ILMA 5KFJA 1QVFR 2J9EA 5L8RC 1YDLA 1IM2A 3NNCA 4PDIA 4CO2A 4ID5B 2YQ0A 4P2SA 3IG8A 1TKTA 2GVZB 1RT7B 3N6MA 4CLWA 3TZZA 2CVIA 2O5DA 4PR6A 3BJYA 4C11B 2KHHA 4Q43A 3CF2A 2N35A 1QE1A 4P2MA 4WP9A 3HHDA 1EIJA 3W8GA 2K1RB 1U2CA 1F1BB 2JFKA 1HBMB 2DHXA 3TA0A 2ZOGA 2BJ8A 4LIRA 3BSNA 2E7XA 1OSCA 5ETKA 5L9XA 2CQCA 3DDIA 1NHVA 2LXEA 1V34A 4FVMA 1CQNA 4JI3J 4QU7A 3PKYA 1D9FA 2VFVA 4F26A 4B9TA 2MKHA 1GTHA 4JI1M 3VVUA 2Q66A 4DSIA 2QT7A 3HY5A 5E5NA 1AUDA 2AJ0A 2BR0A 5GADI 1A5TA 1TFWA 1K73T 1DGFA 3AFHA 1PCAA 4UTGA 3HU2A 1WKJA 4F36A 1TU0B 1HD1A 1RTIB 1OQ3A 1N36F 2XG8A 1LWXA 1TL7B 4OVZB 1ITPA 3QAUA 3CCSS 4OMFG 4C8MA 3TQ1A 2QZ8A 3M8PB 1WOOA 1FKPB 1Y4ZB 5EP4A 3FFIB 2HL7A 2XLKA 2MYFA 3MEGB 4F02A 1FEHA 3U7JA 4W92B 2DR6A 2VQEF 1YLAA 3BB5A 3D3CJ 5LJ3Y 3CJ2A 2CPDA 3T6PA 4IIWA 1VQKS 3CSKA 4WCEQ 2OP5A 4NEZA 3JSMA 1RT6B 4MYTA 3D1OA 3VK7A 2LEAA 2XMUA 1C0TA 1QQWA 4LF1A 4O3RA 1NK4A 1S9GB 2EWHA 3TUPA 5F9NA 3ISZA 1LWFA 1IR1A 2FJDB 1G6BA 5ITTA 4RJVA 3GB0A 2ASJA 1Y10A 2DTJA 1HBOB 2D3O1 4DUZM 2L6OA 2VB6A 3WC2A 3N0VA 1FNMA 5J2PA 4AG5A 2AX1A 2EFQA 4CHTB 2ZEJA 3GLGB 4NYOA 1QAJA 2C2OB 1T95A 4RO0A 3ZTQA 3CTRA 4OX9J 1D9AA 1VBKA 2OTJS 2O1PA 1Z4UA 2AEFA 1NV8A 2BJVA 1HBNA 3MECB 1VC5A 1YQHA 3QFHA 4MGIE 3F92A 3BGRB 2B3TA 4I6YA 3CULA 2OD6A 5A8WB 4TQSA 3D9BA 1NBEB 3FTEA 1VG5A 4DV3F 4ZA1A 3SV3A 2CNNB 3K5PA 2RAQA 3PX4A 1P8GA 3DOMA 3L28A 1S6QB 3H98A 2CJAA 1HNZF 1KD1T 2YPYA 2Q2EB 4M9XA 2JC1A 4C3MA 2XI3A 2R8JA 1X0FA 3KXDA 3R6LB 1TVRA 2ACYA 4N7TA 1HNWF 3JTOA 2LU2A 2BJ9A 4NXNF 2CDRB 3QYEA 2CV1A 2CJ9A 4F50A 4KV8A 4N41A 3K2LA 3B6BA 1X4GA 2PDAA 3SBMA 4U9RA 5EXSA 4ZVTB 1S76D 3M8QA 2EJSA 1DGHB 1T9UA 3WHKA 5KFBA 2QG9B 3L7OA 5K14B 3KLIA 2DD8S 3R9LA 3C16A 4USWA 3LANA 2EK1A 3NGRA 1B7FA 1N56A 4IG3A 5DGAA 3LWMA 5LM7E 2OKQA 4BDPA 4DR5M 1J5EF 2CHVA 1IBMM 2VJVA 2RDIA 3UPFA 3FRHA 4OLPA 4NLPA 2BM1A 2MKIA 3T6JA 2J0SD 4FDFA 4UUWA 3MMAB 4CLUA 5EHHA 4LRBA 4F4YA 3OTCA 1CBKA 2IFXA 2HPUA 4O4RA 2BVZA 2VASA 3KG0A 6FD1A 1SL1A 4GITA 4NA1A 2MQQA 1MLAA 2ZD1B 4GVBA 3JSYA 2G4BA 2QP9X 4FYYB 1S77D 2EPIA 2HFOA 4ICLB 1U1RA 1VQPS 2O25A 3K59A 2FE8A 2NXCA 4G3IA 4F4KA 3B7QA 4XAKA 4BC9A 4YDXA 8CATA 3I87A 4KE5A 2B4OA 1VQ6S 4PG5A 1GABA 1FRJA 1SBRA 2KZZA 4ZKAA 2E1MC 3FYDA 2HIYA 1OAIA 1PSDA 5DQGA 1IBLM 4KTQA 2QMUB 2RF2B 1JLBB 1E6VB 2IJFA 1HWJA 4Q0BA 1TR0A 4EYIB 5JJBA 2R18A 5DQHA 3R5GA 3MZIA 2AKWB 4JI0M 2HFZA 1SIWB 3QRRA 2NXEA 5A6PA 2ZH8A 3KJVA 2BJDA 2UVRA 4ANDA 5G0RB 2JZ1A 3HT3A 4OFZA 9RUBA 3HMJG 4Q7AA 3W67A 1OIAA 2FY8A 3DLHA 1TAQA 2DRDA 2FJEB 5J1EB 1N33M 2R8IA 4K5RA 2XMMA 4HTIA 1UEVA 4Q45A 1NKBA 4PXBA 2VIHA 2GW8A 2F5GA 1T3OA 7CATA 4GH9A 1QDRA 2R9LA 3LW5F 4P2FA 1QAMA 1HBUA 1IJEB 3IECA 2PN6A 1FRIA 5CZXA 3SCKE 2AYBA 4KHPJ 3VZHA 4NRTA 3HD2A 2W7PA 1FWLA 4L76A 4DUZJ 1TELA 4C8NA 2AIRB 3KOZE 2DGXA 4ECXA 4F04B 2KXHA 2GO8A 2KXEA 1H72C 1RT3A 3HSDA 2VDHA 3EXCX 1WEYA 4MKYA 4OV6A 1RHMB 1OWXA 3FBEA 1HHSA 1HKAA 4KYZA 5KG1A 1S1TB 2LQBA 2KRRA 3GONA 2KN4A 3EMTA 2HKJA 3J81Y 5FTLA 3T5JA 3U60A 3CJRA 1FD2A 2MLXA 3J80U 4NLWA 2GQFA 2GX8A 1CUKA 2X1GA 4ZVEA 5ETRA 4ED1A 2R7VA 5CABA 4Y28C 1XMQF 3KFWX 2F9DA 3CJ3A 3VGSA 3KK2B 1E32A 4ZVOB 1T3TA 3UW1A 2KYXA 3RZAA 4M5GA 3FJ2A 4CT8A 4K59A 3OFEA 2UVUA 2XMKA 1XXHA 4R5PA 2B0GA 2M5YA 2HZCA 1NDLA 1D8YA 4J9LA 4NXNM 3PYFA 4P17A 3CCTA 3BOSA 4USVA 3CC7S 5RUBA 1FFWB 1KQFB 1NO8A 2DCLA 3GIJA 2ZJPQ 3KS4A 4X4OA 1KVKA 5FTKA 2MSTA 5DG8A 2LVPC 3TJ8A 2ROPA 1C1KA 2I2YA 3SSSA 2OTLS 5T14A 5C2CA 1K0TA 4LF7M 3HM9A 2V6ZM 1Q79A 1HI1A 2BYCA 2LQ5A 2RQKA 2WB1D 4ANEA 1IBMJ 5EN1A 1WSVA 4RUHA 2HHWA 1TFYA 4CNYA 2DH7A 1NHUA 2G0CA 1LXJA 2MZ1A 1RP5A 2FJAB 3DOKA 2L4FA 4AD6A 4EIWA 2ZUAA 4KKOB 4G4NA 2KDOA 4OZ1A 2PA8D 3ZTSA 2KXNB 1W2IA 3CMAS 2VHGA 2XFSA 2XFTA 4J9NA 2Q3PA 4AKHA 2DBBA 4X65F 1QVRA 4RU2A 3ILKA 2V50A 3GQCA 1VS3A 5CAAA 1K47A 4PRFA 5EXTA 4O3QA 3BYPA 3DYAB 1SC3B 1AXQA 2OSRA 4WP2A 1RAHB 3D8LA 1HHQA 2LU1A 4UY85 3K2YA 1CG2A 1KFSA 2M7SA 1UPMB 2LTUA 3OXFA 1IBLJ 2DEJA 3UWTA 3LUYA 1KOHA 4LUBA 2IC3A 4ZVSB 3FUYA 4CNZA 3CDEA 1FKOB 1FE0A 1VLYA 4ALZA 2JY8A 4NRUA 1RAAB 1WF1A 2HHHF 3ILIA 3ZZRA 1X5TA 1TMMA 4N5SA 5MLCV 2DO0A 3I31A 3MAAB 2NXUA 3R7BB 2CFXA 4OIXA 1CLFA 3OSNA 2DAMA 3D0IE 5CYJA 1ROFA 2HK2A 3N4WA 4NSRA 4CH7A 2VPYB 1IY0A 2BMBA 3VAGA 1N33J 4DQRA 1H6UA 4ID8A 1NKEA 1DY3A 3CF5Q 5GKNA 1RSCA 5KFRA 3W2VB 4A8MP 2J9CA 2FVSA 4EZ6A 4O4GA 1S7IA 3W2WA 1RT4A 3CPWR 2PEHA 3DGPA 1N5YA 2NXJA 3FSYA 4X4TA 1JQGA 4L3KA 3H5XA 4FF3A 1UAWA 4DZ6A 3MR5A 1CJTA 1FFGB 3GJSB 3GJQB 1YBTA 4A8QA 2Z8QA 3HZJA 2ZJQQ 3QIPA 4IO1A 2QBYB 2QA4G 4L74A 4CLZA 4D3HA 2GGPB 1AFIA 1PILA 4QQBA 4JYAM 3G6YA 2JY5A 2UV8G 2E9ZA 1RBAA 4B17A 3NMAA 3DHXA 5HMXA 1PGZA 3I0SB 1K1QA 2C2ZB 1ZAEA 3Q8XA 3MM8B 1T9TA 2G0JA 3PYGA 2FGCA 3BR9A 1G41A 5F3WA 4WZMA 1LK7A 2B5JA 3HJQA 1VQSA 1ZAWA 1Y7PA 3LP1A 3TUIC 3R27A 1X4BA 5D77A 2MQOA 1XJWB 5DLFA 1UFKA 3IS9B 2EFGA 4DV3J 2KJWA 2A1BA 1HNZJ 1S1UA 4ZP6A 1OPZA 4RW7B 1L8QA 1JLFB 3AHPA 4ZPTR 4KO0A 2I1RA 2E5IA 5LXRA 3I4PA 4NXNJ 2E1CA 1KOOA 1W5TA 4NLSA 3QT7A 4NI2A 2GFFA 5A8KA 3HU1A 3DRPA 1I51B 4F25A 2CQ4A 3EVWA 1X8DA 1JXLA 4ZLPA 4JI6F 5A2QU 3LW5C 3LAMA 3NBPA 2OD4A 2HS4A 2AHOB 2HWHA 2XSJB 4M5LA 1FA0A 1LTMA 2FZGB 1JLQB 2XS7A 2XGNA 1N34M 4TLQA 1QTNB 2AYEA 2BRLA 1W26A 3NGSA 3KLEA 5U47A 2MJ5B 2D1CA 3A13A 5HN0A 1LWEB 1NHKL 2MKYA 3B78A 3BREA 5E0OA 1J5EJ 3OFHA 3O2IA 2M4MA 3KUHA 2M60A 3FMBA 4FKYA 1I1GA 1ZAVA 2L2DA 3IG1B 3MM5B 3CF6E 4YR2A 2GV1A 2AD9A 3FSXA 4PXEA 2A18A 3QRPA 5KFYA 3KK1A 4ED2A 3HVRA 4ZJLA 2ATLA 1M5VC 4TVAB 1U1MA 4F3OA 4DUYM 1QUVA 4OYIA 1ELOA 1S79A 4CYUA 2C2RA 1SQGA 4B3OA 2JY6B 4EWTA 4CP5A 1IKVB 2BW7A 2MQ8A 2Y1LB 2VDIA 2MLZA 4B9SA 1BQMA 4EEYA 1NHGC 2D7SA 3OVBA 5CD4A 3ZXWA 1APSA 4HI2A 3D7SB 3GRRA 4D80A 2HS0A 3G8SA 3J7AN 1QLNA 4KY3A 3MAQA 2YVSA 3TAMA 4L16A 1MN7A 1XQIA 1ZMUA 3PTWA 4A8WA 5HP1B 3T1HM 1UW9A 1SXJB 4X66M 1TL4A 5FDLB 4GHLA 5JMNA 4GKKF 4CWBA 1Z2LA 4NLOA 2KHDA 4M5KA 2OIHA 2G3QA 1FWPA 4O0IA 2QZ4A 4EBDA 5GAGI 4ZVPB 2CWKA 4B3RF 3JQJA 2F8EX 4KODA 2MKKA 5HQ8A 4PG7A 3IAM9 3LGNA 3VV2B 5EDWA 3D0GE 3CC2S 3T5LA 3U6SA 2F4VF 1PAUB 4OI6A 2CYYA 4DR3F 1VQ8S 2PMHA 3D3BJ 2JJ4D 2LHCA 4DV2M 2PC6A 4P2XA 5FLXU 1LOUA 1GH8A 2CHQA 4LF5F 1N5SA 3DLEB 1BGXT 5HMYA 3M8YA 4QCLA 3DRRA 4RNMA 2O66A 3K5NA 2EFNA 2W24A 3AA8A 5KQDA 1KS2A 5KG0A 4DLEA 2J7KA 9ATCB 4Y6IA 4CTAA 2Z3XA 3CJKB 4KO8A 1RHJB 1FRMA 4DQQA 2CG4A 4DL4A 4ZVHA 3N01A 2KKHA 2CPHA 5DRKA 2CKWA 4F1IA 4DX6A 4Z2XA 3DXSX 1I6JA 1HQEB 4QYRA 2CP8A 3FKEA 3UCGA 3SSRA 1S0OA 3AH6A 1RQ0A 1XMQJ 4JI8F 5IFMA 3CTWB 1RK8A 2JH3A 1S6PA 1C0UB 2HNYB 3EPIA 3UK6A 3PHTA 4ZLNA 4JV5M 3PV8A 1EE8A 3J81S 3AOGA 3MHYA 3WDOA 2R65A 2K2PA 3DGVA 2IY5B 3LA0A 1Q8BA 2XMVA 1FRHA 4DPOA 2J7UA 4NX9A 1MN9A 2HHVA 2WHOA 3FD9A 2COLA 3H0PA 2VL1A 3CCJS 4NOHA 1T9WA 4LBPA 3GIKA 5KAKA 3ZZTA 3TVKA 3GLFA 3F0NA 4OHXA 2ROEA 2UP1A 2CQHA 4IBIA 1N34J 1HT2E 1UWBA 2X4AA 3K1JA 3R2DJ 1EARA 4O3NA 1K3WA 2BQ3A 2HVHA 4WYLA 1S9FA 3EGWB 2XNRA 2BRKA 2W01A 3PFOA 5AT1B 2MPUA 3PXGA 2LXFA 4I5SA 2CVEA 1TTEA 2ILYA 5FJ4A 3GLIA 4URQU 2ZVIA 3QIDA 5KFEA 2G1HA 1IQZA 2LQ9A 4DUYJ 3PW0A 4X4PA 5F8HA 3QLHA 2XY5A 3GFHA 4KHMA 2I5JA 2QNJA 3L7PA 4F3QA 4DG1B 1PYTA 1IKWA 2M2BA 2DGWA 4X65J 2V0NA 1B99A 2B6AB 1VHIA 2QQ8A 1RTDB 1KTVA 4FYVB 3SV4A 3FUXA 4UY8T 3BQ1A 4I2QB 3KOWE 5CCMA 1NKCA 2W2NP 4BWJA 2VU5A 1TUVA 3HSZA 4Y0FA 3FUVA 3FEYB 3FZBA 2CPXA 3SYKA 1DV0A 2ZNYA 3W0LB 2D7HA 1NK6A 4JN6A 4LFCM 1LWCA 3FZ2A 1S5ZA 3M8ZA 3OXGA 4WIIA 2HHHJ 2OOBA 1VFJA 2R8KA 4LFBM 1AYEA 3FTCA 2DNZA 2X3DA 3C66A 3TNVA 3ZTOA 1IR0A 2LA4A 3T1HJ 3HVTA 3KLFB 2CJBA 3EGZA 4KGMA 1S1WA 1T9VA 4Y3CA 3TO8A 5AXMA 4KGKA 4BLCA 3RR8A 1JJ4A 5IXUA 1HQCA 4ZCMA 3CWJA 3R5CA 4GKKM 1SPBP 2R7RA 4FNIA 3RGPA 1B7YB 4DPTA 3HDSA 4QR1A 5L1KA 3U02A 4ELTA 2Q1LA 3US5A 2EA0A 4USHA 5KFWA 4ZIWA 1Q82T 1RT1A 5BR8F 3GLHB 4LRSA 5I3UB 3PEHA 3OQ2A 4DV2J 1ZA1B 4DR4M 2LNHC 1XR5A 1EETB 2QFIA 3VAHA 4USMA 4X4NA 4GC6A 2JFDA 2EVZA 3ZC7B 4F4ZA 1VBZA 4IBCA 3IBCB 4EBEA 1N0UA 5K8PA 2OMOA 1GMVA 3KK3A 1KVJA 3MEEB 3JAMS 1TV6A 3C2PA 4LVNP 4G4RA 2NR0A 1L3UA 5KT3A 1HNVB 3CMES 4GC7A 2ALYB 1NY6A 5IV4A 4NMLA 1EIYB 2J6UA 2XY7A 1T03A 4H4OB 3BSAA 1OYDA 3OT9A 4PPDA 2VOOA 3CMQA 4P10A 4J7CA 1EQMA 4DCJB 2BE2A 4DHVA 2VA3A 1AUAA 2MHEA 2QL5B 6FDRA 1RACB 1KYIA 2D7EA 1OY9A 3U6PA 1N77A 3MK6A 3QJLA 2V8HA 2KRBA 1VCTA 2RGHA 1X9MA 4ECRA 1SC1B 1QUSA 2LWXA 2ZAOA 5IOLA 4PWWA 5GMKa 3LGHA 1PJJA 5H1SV 2MEWA 3C8YA 5EX0A 1JK9B 1VQ7S 2XGQA 3R2CJ 2DXDA 4I7FA 1RAGB 3T41A 4X4UA 3AJIB 4ANRA 5CZVA 1NJYA 2HWIA 1WI6A 2XBPA 4NXMF 4B08A 2J5AA 1GJTA 1A0OB 5GMEA 2BZ2A 3IP0A 2ASLA 4OQJA 2QJ3A 1L5UA 1WDDA 1UMJA 2LHGA 2X1FA 3W0FA 2J7NA 3I0RA 3ILOA 3T1AA 2VUGA 1QAQA 2MZQA 2ZH4A 1D0LA 4M1KA 3UNGC 2CWBA 4HACA 3VAMA 2IAJB 4QWBA 4PZVA 3BO3A 4J9QA 3CD5A 4JI5F 1IN7A 3PM9A 3M32A 4J9PA 1EQ0A 3O3LA 2RH3A 1RKJA 3MM6A 2EBGA 4PUOB 2YNIA 3LVVA 4NSOB 4Y2CA 5F8LA 1WKLA 1Q3BA 4PWUA 3PHEA 3HFKA 5D0GA 2F5NA 3SASA 2DKOB 5JXSA 4X4SA 1T9XA 3ZNJ1 4ECYA 1NJGA 3R5BA 1MMDA 2BWBA 1LK5A 2WCXA 4J9UE 3DFZA 2NUHA 3SHGB 1BC6A 2ZE2B 4EU0A 3BSOA 2WBRA 5EP3A 2D3ZA 4ELUA 3L95X 3PYEA 1LV5A 2L09A 2XEXA 3RBZA 4LFCJ 2V4JA 4H4MB 4RR5A 3UO0A 4IQMA 2ZBCA 5D15A 3OUYA 3MURP 1TKXB 4KBIA 2RRUA 4AKIA 3P45B 3MM9A 1XMOM 4LFBJ 2Z7JA 4OJ1A 4MKBA 3GQ4A 4TYBA 1Y5IB 1YHQS 1U7LA 1C1BB 2HK3A 3AOCA 2LH0A 3A3OB 1FJGF 4CO1A 5IT9Y 4C3LA 1N5TA 1QE1B 4HT5A 2R7WA 5B0BA 4DV7M 4K8RA 4LF2A 2E66A 4GKKJ 3DI6A 4R8UA 3R9XB 2QHOB 4DFJA 1R2YA 4PABA 5LSRA 2Z0GA 2QX0A 2L9WA 2RUGA 2W4PA 1SQEA 3CDBA 4PT5A 5EWEA 2HRTA 5KT6A 3CD6S 4CQ1A 2HVZA 3PDNA 4USIA 2X51A 4B3RJ 3AOAA 3UNYA 4C8ZA 2CUZA 4WFBQ 3WQPA 1MU5A 2Y8YA 1DTQA 3U6QA 5KFZA 1YJVA 2BE7D 1WG4A 2XH9A 3E3XA 2FVQA 5DDRC 4DR3J 1NNUC 3FQKA 2HFSA 3S6EA 5IM0B 2K06A 2NREA 3DRSA 2ZOFA 3BKFA 4LT6A 2DVWB 2CHGA 4LF5J 1LXNA 3M2UA 1L1TA 2K3KA 4Z7CA 4RZRA 1OKSA 2RE1A 3HVAA 3IBWA 2CIMA 2ZDPA 2OPFA 3OFGA 3M8WA 3CJ4A 2IHR1 2XZTB 2VQFF 3G87A 3GIIA 2OGUA 4II7A 3KP1E 3W9IA 1VEGA 2XCAA 4DOZA 2GA7A 1RTHA 2HWJA 7FDRA 3JSMB 2H65B 2XMJA 5KFKA 2HCBA 2CDQA 4M95A 1JR3D 1DO2A 2KW0A 5I4MA 2HMIA 2DHGA 3KOXE 4Y2KA 5ETVA 2GQCA 2QEXS 4NLUA 2IRXA 1FVQA 1LWFB 3A3PB 1M5HA 4JOUA 2PE8A 4CLKA 1MWQA 1YVFA 4LF6F 3KNAA 1PYSB 4HHUA 2CJKA 2FY1A 1NNDA 1RABB 1ZTWA 4IJEA 4C8KA 5IZ7D 5CYQB 2IDLA 1VQLS 5J2PB 1RAJA 1UJ5A 2C3MA 3T15A 1YRXA 4RNFA 2ZZNA 1L3SA 3TUZC 3O8WA 2ZNZA 4RLEA 2RKIB 3LP2A 4NOOB 2CQ2A 3M1VA 3PW2A 4WF9Q 1HBNB 3C9PA 2YQ1A 4G1QA 1REGX 2C9CA 1QSLA 2B3TB 3V76A 3POTA 3KDNA 3ZZOA 2R46A 4RW4A 2AU0A 5JVGQ 2WSCC 1X4AA 4ZDNA 1JIHA 1I94M 5LSLA 3R3TA 2DT9A 4MH8A 2G2YA 2RRBA 4RUAA 2WONA 4P72A 1UZDA 5IWAF 4ES1A 5DGBA 1TVRB 4IYQA 1U6FA 1XBWA 4X62F 3T1YM 5HO4A 4NA2A 5HQMA 2Z4RA 1PAEX 4KV8B 4ZCLA 2JZ0A 2ZHOA 3JTNA 4TY8A 5L1LA 2MZRA 2RMLA 4YQWA 1SJ1A 1V92A 3EPGA 3KJFB 5ETLA 2FC8A 3VALA 3NNHA 2I9SA 4LRTA 4K4WA 1RT2A 3C16B 1XMOJ 3MMBA 3RW7A 1QAYA 5ITYA 2I7PA 4IG3B 1XWIA 1YJTA 1Y3KA 2WVDA 4QHSA 1ZQ9A 3D8BA 1DURA 1F4IA 3D66A 2EC2A 5BPVA 1XEZA 3HJ8A 1RWNB 4ZLLA 4U67Q 4DV7J 2HRYA 3GV5B 2GNOA 3X1LB 4CZCA 2Z2ZA 3NCQA 2CA9A 2E1RA 1FJGM 1V3ZA 4D82A 3K9OA 2KL8A 1RHRB 3MM7A 4ED8A 3EM1A 4RUCA 4OZJA 5B0EA 1VDHA 2LQJA 2ZKTA 4GVBB 4BHQA 1NK5A 3KLVA 2CUYA 4LG2A 3KLHA 2HG4A 4URGA 2VFSA 2H54B 1GL7A 1CULA 1SJRA 1Q1KA 4F0MA 5BR8J 4FYXB 2Z4SA 1NDCA 3D6HB 2J7OA 5C25A 4DQPA 3CD0A 5C42A 3W61A 1L2BA 1U6ZA 2A6OA 4IDKA 1KSPA 2BANA 2A0FB 4RL1A 3A42A 3I4VA 1HW9A 1CS4A 4RW8A 4L73A 3AXKA 4DV5F 4DQIA 2VG6A 1FI4A 2MROB 3B4MA 1D9DA 4Q0BB 1QVGR 2AEJA 1KTQA 3B9PA 3B7NA 1HPZB 3OR1B 2DAGA 2OMLA 5HROA 3KJVB 4B9NA 4IBGA 4P7VA 2UU9M 3Q2SC 3UR3C 4I81A 1RU1A 1RLCL 3J7BA 2JX2A 5H9FK 4HH0A 3UD3P 4ECWA 4O44A 1V3SA 5E3RA 5ITHA 1S99A 2XTJP 4M94A 1SL0A 2IA6A 2HHTA 1JR3E 3HFVA 2MJNA 1HBUB 3DM2A 4DSLA 2ACMA 2R7TA 4YHHM 3EUNA 2BNKA 4LFAM 2GMJA 3HKWA 4DL3A 1KQGB 5KFOA 3CJ0A 2B9XA 2E5LM 4N77A 3NWLA 2XO6A 4B3TM 4K4ZA 3J80S 4G1PA 4CH0S 4DV0F 4IJFA 2XC9A 5J1PA 1DBDA 3RUBL 1R8PA 4NXMJ 1I5OB 2EI5A 3ZZ0A 4LF6M 2LMIA 2P9EA 1VQOS 5GAHU 1RT3B 1SC6A 3K58A 3PACA 3IC1A 2QENA 1N5QA 1X7VA 4DSJA 4M5HA 2A2CA 2AWZA 1D0KA 5D4OA 3GRUA 2UUCF 2GAHC 5GADU 2WSEF 4NZ0A 5T41A 1KLMA 3DLKA 1RBOB 4JI5J 3RE8A 3NMRA 3U6LA 3FTFA 3U60B 5HATA 3GLHE 1LEOA 2KZUA 3NGUA 1S12A 5HVGA 3VGTA 5B09A 3UI3A 2FHOB 2R2RA 1RHKB 2ZH1A 2BOAA 4E98A 2AJQA 4P9SA 3EZ5A 4OX8A 1XXHB 1VQMS 3BKTA 5IWAM 3W1YC 2R44A 2YX1A 2DNQA 1HD0A 2J6SA 2R7UA 3VAJA 2W4CA 2PEBA 2OFHX 1D2NA 1HYSA 1U26A 1GFWB 2EEYA 1QSYA 4PG8A 2LBCA 1PG5B 1CJKA 1YJWS 4IH7A 1Q7YT 1WHXA 4OHWA 1M5SA 4G4OA 2V4QA 4H4KC 3PNVA 1NJWA 5LXYA 4DBGB 1X0PA 2CJQA 2XMWA 3A8KA 1S7HA 1JB0F 3EDQB 4BCAA 2RDDA 4GEWA 4IG0A 4QIGA 1VRTA 3OTBA 2UXCM 1VQ1A 1VIOA 1NK7A 4NCBA 3NS7B 4ZCIA 1RTZA 3UN3A 3DOKB 5KFXA 3J7YU 4L6V3 1RWWB 1WG5A 3ENVA 3KHGA 3GYGA 2Z2YB 1FJGJ 2AHMA 2R4EA 3OTEA 5D4PA 1RWUA 1X5PA 2IVFB 2R7QA 1IQTA 3Q8QB 4BLGA 2BEFA 3F73A 1S9EB 2DH8A 2BABA 3QATA 1G2EA 4WKYA 2NUUG 3NP5A 5K9FA 2ASDA 4MAKA 1WHWA 3DZDA 2DNRA 4QW8A 3W3SA 1O6XA 3S7RA 5IT9S 5KG7A 2XZDB 2J9DE 5HLFA 3OTOF 3ONQA 5EWGA 2PFFB 3VQTA 2E5GA 3ISNC 1NVMA 3GV7B 5D78A 1TP7A 1T6OA 3FUUA 2ZWOA 2IC3B 2GVZA 1H38A 4LSLA 1HI0P 2WAQD 4ZP9A 2MZSA 1IVZA 1R8CA 3V6KA 5D6GA 2ZFHA 4ZHRB 1ZTTA 2R8GA 1HQYE 4DV5M 2UU9J 1F9EB 3C3LA 2KFYA 4DZDA 5IZHA 2C1EB 3BGOP 5J2MB 1VMBA 1HA1A 4OZ5A 4QNRA 3KSXA 1N52B 3RAMA 4B02A 2WTFA 4MT1A 2V5HG 3HHNB 1FNOA 5DNYA 1JJHA 3TWLA 5DZ7A 3W2WB 1RT4B 2VQFJ 3DGPB 1YZ7A 2RT3A 3CJSA 1N5YB 2FVRA 2BQRA 1Q81T 3PNIA 4NL4H 2QLBB 1DLOA 4OHVA 2DNGA 5H37D 1REVA 2E5LJ 1CJTB 3HULA 5F8GA 4FYDA 3MUTP 3GYNA 2VKZG 4ZPAA 4NC6A 3R7SB 4KGVB 1XNRM 4DXLA 4WFZA 3QIPB 3K57A 2YWWA 2HLTA 4ZJQA 1SKRA 2HBZB 3SCJE 3TR5A 3BEGB 1RTIA 4LF6J 4OI4A 4OX7A 4JV1A 5HANA 4WIQA 2X1AA 4DV1M 4ILRA 2MJUA 4NMXA 4NLRA 2MGZA 3J81U 3U27A 5J2NA 2D3OR 2LXIA 3OL9A 3IN5A 3M7GA 4QIVA 3IRXA 3MEGA 2VG5A 4I1TA 4UOGA 3A8EA 2B5JB 3UJNA 2CZVC 3IM9A 1R5LA 2QA4S 3PJXA 4IBJA 3LP1B 4QPTA 3V4IA 4ECUA 2GQ2A 4MIAA 2UUCM 5C7PA 1RT5A 3ILLA 2YNFA 4ZPXA 5KOWA 2I8EA 1RBLA 1FHTA 2ABYA 4LJ6A 3CGIA 2UUTA 5HJYA 5FTMA 1X4HA 1HL6A 2DAKA 1S1UB 1RTJA 2DY1A 3UN5A 3R7NB 1M1GA 4WU3A 4KFBA 4KO0B 1U1LA 2E29A 2ZOMA 2KH9A 3KLGA 2DIVA 2G1DA 2VG7B 5IWAJ 3BO4A 2XSZA 3DHWC 5GAEI 2K7KA 1IQPA 1HARA 1K44A 1L3TA 1HQUA 1CJVA 7AT1B 3JQKA 4XO0A 2AV5A 3T5HA 3GLGA 1GTEA 4A47A 4A8XA 4NI2B 5A8KB 5AE3A 4BS2A 1H74A 5HMWA 3DRPB 4WXWA 3KVWA 4LQ9A 2JWNA 1MMLA 3M2VA 2IDEA 3VDPA 1K9MT 5A0YA 3QSIA 3NBPB 4NWBA 4JI4M 1X5SA 3KTQA 3RGSA 3SHFA 2W1BA 1HWLA 3T19A 3Q23A 2JEJA 4K4XA 5JI2E 4YEAA 2ZH6A 2W9AA 1ICEB 2D41A 1QANA 5IS2A 3G9CA 2QE5A 2HS3A 2W9BB 4CIZA 3HF5A 4W5WA 3FK4A 1NV9A 4AYBD 1R8BA 4WP3A 4F2LA 2NPIA 1YBAA 4IBDA 1Q4RA 2HYIB 1GKIA 3KK1B 1HW8A 2QRRA 4JI1F 5KPRA 3GP1A 3GPXA 5LJ5Y 2IPOB 2KM8B 5C1BA 4DDFA 1WF0A 1S0NA 2ZC3A 1KVIA 4CYUB 1Y8GA 2YX7A 4Q8EA 4HLBA 5K14A 4DFKA 3R5AA 4DX7A 4P16A 1BQMB 5F0UA 2LVQD 2HAKA 2CNKB 1TMJA 3OTOM 2VODA 2ZAMA 2FLOA 2RS2A 2KNAA 2DR5A 2HGMA 1RA6A 5KFAA 3A3NB 4RPFA 3U6MA 4J9KA 3GRVA 4DV5J 1EKSA 4B9LA 2GAGC 3OTDA 3DKDA 2N3LA 3DRXA 2LEBA 1ZH5A 2HGNA 3HX9A 2H4YB 4I68A 1P3QQ 2Y1JA 1P1LA 4FNHA 3OW2R 3JAMU 3GLJA 1Q5YA 3MEDA 2VPXB 3EGNA 2CPEA 4OYWA 1WJ9A 1YSJA 4EMDA 3CJ5A 3F41A 4CLPA 4M5MA 1TTHB 1SKUB 3DCAA 1JB0C 2ERCA 2F4FA 1KFDA 3ZZPA 3OPKA 4I6AA 5E3CA 1FRKA 2C99A 2AYMA 1S0VA 4PG6A 1JLBA 4USJC 4DS4A 4QW9A 2QYGA 1KBRA 4DN0A 2AT1B 4DV0J 4DV1J 3UVJB 2KT3A 4PWDA 4DV6F 2V69A 2EFOA 2WW8A 1PYOB 3DRRB 5C5JA 3MFHA 3THVA 3SYLA 2P8IA 4XPEA 1LW0A 2RGOA 3K5OA 3VWSA 4TU7A 3LPEA 2BM0A 1N5VA 1VDDA 4HDGA 3LALA 1TH3A 3CCLS 1UA1A 2UUCJ 3JSBA 4ETZA 4C7QA 5H9EJ 3TZXA 4ECSA 2DY9A 2BDPA 2FOIC 1VEJA 2IM0A 2YBVA 3RRHA 1SH3A 1Q16B 2XULA 3KDSE 4K7QA 2V1CA 3NGTA 3QJJA 1YX2A 2R3VA 4P75A 4IBEA 3Q8VA 4C0OC 3ISND 1S6PB 4WYWA 3DN9A 4EGLA 3NS5A 2FJWA 4HHHA 3LH2S 2HQIA 4LBHA 1T05A 2LA6A 2Y20A 4RNNA 2W4DA 1GLNA 2B56A 4DR5F 4KIAA 3M8SA 1IBCB 3KHLA 1GX6A 1IBMF 4JI4J 1RAEB 3NXZA 3FNNA 3PY8A 1S1TA 1Z59A 2R2SA 4DUTA 1UWBB 3HHLC 4URSA 1WHYA 1IBKF 4IR1A 2VF7A 3KUGA 3FC9A 1NJZA 2OPRA 4DU8A 1X60A 2IVMA 1R8HA 5AE2A 2IM2A 3MOZA 2O5RA 2CZ9A 3KK2A 3RRGA 1R0CB 2CFOA 3IA0A 1C4AA 4ED5A 4K4YA 3JXOA 3L7UA 2KEBA 4JI7F 2Y1RI 1S1XA 1T8EA 2QMWA 5G4DA 3FCVA 2AJ1A 3KG4A 3GLIB 2CADA 2F5OA 3D2WA 2EKKA 3CVKA 3MEKA 1URRA 3DDNA 3QLHB 1ZYQA 2I5JB 2MQMA 1GO5A 2KO1A 1IKWB 3U61A 1R7RA 1IBLF 1WOPA 3O44A 1T43A 4ZN1A 4FKXA 3SARA 4DR6M 3H90A 1V33A 2ILZA 2N3OA 3FEZA 4C8OA 4JI0F 3FRYA 1OMSA 4Y28F 2P9CA 3OTOJ 1OTRA 5B08A 2C2DA 1WWHA 5I42A 1H7WA 1W5SA 4OW0A 1JKHA 2CNLB 4O3OA 2LVOC 6AT1B 1LWCB 3W9HA 4DR2F 3J7AS 3CDUA 5A2QY 4YB5A 4YOEA 3L29A 1N33F 3E2EA 3KFUG 3MJ5A 1H2TZ 1WG1A 4ZN3A 5L38A 2QLFB 3HVTB 1XXHE 3PRVA 4OYPA 1TDZA 2ZH2A 4WPAA 1NJXA 2ZBQA 4Q2LA 4LSZB 1PJ7A 2WZ1A 3CJ8A 2IIHA 4UF4A 1RISA 4OJHA 2O01F 2RQ4A 4JXJA 4IQXA 1RB0A 2AZ1A 2MTLA 4I6WA 3H5YA 2HHUA 1Z5AA 2N4DA 3W5YA 3J7ZT 2YQ3A 1F3VA 3FEXB 3NLCA 4FWGA 3OLBA 2UXBM 2CNOB 1NCLA 1LQ9A 3VVTA 3UCUP 1PIEA 1RT1B 1FD8A 1D8ZA 1S59A 2Z57B 5HVHA 2FVCA 5KT2A 1FKOA 4QR2A 2V2QA 3LO3A 2IYIA 3AB4B 5K8OA 2QGFB 2C2NA 3ADAC 3MAAA 4C0HA 1VK3A 4FS1A 4DSKA 2B9WA 2W2OP 3DLGA 3KK3B 1R31A 1TV6B 3H40A 1RE1B 4NLDA 1CC7A 2HVEA 1T9YA 2N7YA 4DQSA 3EVOA 4J9VA 3VAKA 2DAIA 3A1YG 1VI7A 2LVAA 4DV6M 1HWIA 1SQFA 2KT5A 1L2CA 1T03B 4Q44A 2BV3A 2BQUA 1E9RA 3W7BA 2BE2B 2V9KA 1S6UA 1Q86T 3UN2A 3TJAA 2W7OA 4IUFA 1MNEA 4CISA 4KT0F 4J90A 2QL7B 1XC8A 3GZ7A 2FGOA 1R0AA 2YKNA 1IFYA 5D4LA 1QD1A 2WVEA 3QO9A 5DDPC 1K3XA 4M5DA 3HP6A 4RF0A 2OPPA 4Y2IA 1H2UX 1WF2A 5THWA 3L4BC 3V81A 1MROA 1R27B 3NEKA 2A5YB 1FESA 4ECTA 3GR0A 4FPIA 4YR0A 3CB4A 3GSDA 4I7FB 5KFQA 4NCAA 2V8PA 1SV5A 5KFIA 4LF7F 1TGUA 3HX3A 2D3UA 3BH6B 3L09A 5K20B 4P6QA 1AB8A 2RHSB 1VBXA 4FBUA 4K0KM 2M0GB 3TARA 5FD1A 1EB0A 1N6QB 5ETPA 3GRYA 3SYZA 2G13A 4B7FA 2BJ1A 1VHFA 2A2DA 4ZVQB 2APLA 4HACB 4LSNA 4DL0C 4U7UK 3RB4A 4YP3A 2NZ4A 4F67A 2KXFA 3EE3A 4WP8A 3M32B 2YKMA 3MM6B 1IBKM 2VJUA 2YNIB 4LY6A 2W2PP 3QYBA 1SC4B 2U2FA 8RUCA 2DPIA 3P6YC 1IN8A 1FRXA 1UPPA 3VDUA 5A8RA 4JI7M 4TUWA 5EWFA 2PT0A 2J8SA 3GG1A 4JI1J 2CPYA 4NLYA 4LF9M 1IUJA 2I6WA 4DR6J 3FRZA 2Z8YM 2HW3A 1LFWA 1Y00A 3EX7B 3GWCA 2AJ2A 1ZZFA 3N6NA 5F8IA 5AJ3F 3G6XA 1S49A 1AIPC 1DQAA 3D68A 3CCES 2AJFE 3OUYB 3OLAA 1HI8A 4K4TA 3OVSA 3PYDA 3M6XA 1RJJA 5LMNM 2NSBA 4HL9A 2B9EA 3MM9B 2ZM6M 3BN7A 3KWMA 5D4NA 2R2UA 4DR2M 3A45A 3TWKA 2E1PA 2V4RA 2PFDA 1KQSR 4IH6A 1ZBTA 2MKSA 2Y3YA 2AF6A 1B4SA 5T7LA 2GO9A 2AQ4A 3I01M 2VPWB 4NCGA 4QYZK 4FPRA 3ENQA 5ITXA 2M88A 4J9SA 5GVQA 2XZUA 1FERA 2BA9A 4GO5X 3DI6B 2POKA 3THTA 2F8MA 5E3PA 1V5IB 4DSFA 3SAUA 2H5IB 2DK2A 2V8VA 3DFEA 4QWDA 1E94E 1JLGA 2NS1B 4JYAF 3GQ5A 3KS8A 4W90B 1AFJA 2XS5A 4PG4A 3K8WA 3D5MA 3JYTB 1C1CA 4PYDA 3DMJA 2KNZA 4AZFA 1GK8A 4KAIA 3OV7A 4C9DA 2DGVA 1SKWA 5HMZA 4YY3M 2OJ3A 5L9NA 1KEKA 3CCMS 4LBIA 3DRSB 3CIZA 2CPJA 4DV6J 3P5BP 2J8AA 3TOQA 2F5SA 4WTOB 1FF2A 4PYAA 1SXJA 1VRUB 4LRCA 3TQEA 3FMWA 2W9CA 3KYLA 2C28A 4S12A 3U5ZB 3HCXA 1KNZA 3TW0A 2PGCA 2QPAA 3TYTA 4UOFA 2IMWP 3GJTB 3SC3A 1SB6A 1V3RA 3MUMP 4NPOA 1QJHA 1N78A 3AD7C 1HNXM 3BDPA 4ATNA 3PXGa 3GIMA 2KB2A 5H9FJ 3CNQP 1RCXB 3M6VA 1FJCA 2QLXA 3V6JA 3Q8PB 1XIQA 1YJ7A 4W98A 2ZBRA 1VQ9S 2HMIB 4MK8A 1IN0A 4P7TA 4AXJA 2CQPA 3PO5A 5L1IA 5EJCA 4PAAA 3MR6A 4QIFA 3TEHB 3GPAA 4FZVA 2K0BX 2FHJD 1ZZNA 4RKUF 5DZ6A 2UUBM 2DNNA 1N34F 4A8OA 1WGNA 4H4KA 4OL8A 2O01C 4LF8F 1G7CB 4DR5J 4LVOP 2HGLA 2Q79A 3RG6A 5M2UA 2DGOA 1ZM9A 3R8FA 3FSIA 4OZ0A 3M05A 2ZHAA 3LP2B 1NJIT 2R7SA 3M1VB 3A8JA 3M6WA 3AAWB 1AZSB 4ED4A 4WFYA 3SFUA 3ZNUA 3LPYA 1JJCB 3H5SA 1R6YA 2YPZA 4G1QB 3DOAA 2E1AA 1IBKJ 5B0AA 1NK9A 2RU3A 1U0SA 3IXQA 1GMUA 4DUYF 4LJAA 2M52A 3SMSA 4UT4A 2GJ2A 4RW4B 2C22A 2QC3A 4MGHA 3AKZA 4RU9A 2AGOA 2V63A 4JI7J 2X49A 1YWXA 2HRUA 1N32M 3TAPA 1IN4A 2IRUA 3ZZUA 1DQ8A 4B3MF 1QTMA 4LF9J 3MUVP 2EKFA 4DFPA 1DGGA 2MR9A 2P5VA 3EICA 3LF0A 1DHMA 1IWAA 1NK8A 3HPOA 4TY8B 1TF0B 3VKGA 1S48A 3BR8A 4KT0C 4ZJOA 3EVMA 3QT5A 2KRKA 2AEMA 3ETMA 4X2BA 4JI0J 4ES2A 1TKZA 1QYRA 3JTPA 1RT2B 3T1HF 3W66A 2CRLA 2ZM6J 3MMBB 4IFYA 4MTPA 2AX0A 4X66F 4DR2J
chains in the Genus database with same CATH topology
2V9WA 1JIHA 3ZH9B 2P9GA 3ISZA 1I94M 1LWFA 5ITRA 5LSLA 3R3TA 2DT9A 1Q78A 4OVZA 2FJDB 1G6BA 3NG8A 3NGKA 4GC9A 5ITTA 4MH8A 4QOTA 2RRBA 2MZTA 3GB0A 2ASJA 4OZNA 2B7BB 2DTJA 2QCUA 4RUAA 1HBOB 2JSXA 2WONA 1Q53A 4DUZM 2JVOA 2L6OA 4JI2M 3I5AA 4L72B 3M8PA 4ES1A 5IWAF 4AKGA 2VB6A 5DETA 5DGBA 5KPZA 1TVRB 4IYQA 4DJBA 1FKPA 5I3QA 1U6FA 1XBWA 4ZOSA 3WC2A 5F8JA 3N0VA 1FNMA 3UQSA 1U25A 4OZLA 3FQLA 5J2PA 1VQYA 4AG5A 4X62F 3T1YM 3HU3A 3FFIA 4NA2A 5HO4A 2AX1A 5M2PA 1MW7A 2EFQA 4CHTB 2UVWA 2Z4RA 4NYOA 3GLGB 1XMBA 4P7VA 2UUWA 1QAJA 4I4LA 3DRYA 4KV8B 1T95A 4ZCLA 2ZHOA 1VQNS 3CTRA 3JTNA 2RJZA 1U8SA 4TY8A 1NSFA 2LECA 3KHHA 2D9PA 2MZRA 1D9AA 5L1LA 4AL6A 2OTJS 1Y5NB 2B6AA 2O1PA 2VH7A 1Z4UA 1QZMA 2RMLA 1RTDA 2BJVA 1HBNA 4YQWA 1SJ1A 3EPGA 4ECQA 1QM9A 3SXLA 5BJRA 3O6QA 4DV2F 2FC8A 2C42A 3MECB 4I2QA 1VC5A 3VALA 4EYHB 3NNHA 2DGSA 1YQHA 1RT6A 3IWNC 2I9SA 4MGIE 2VFRA 2DRBA 3BGRB 4LRTA 3I82A 4I6YA 1KSFX 3CULA 2OD6A 5B7WA 5AXLA 5A8WB 4QZVB 4TQSA 4K4WA 1GXUA 1RT2A 1KQKA 1PJIA 4A8YA 2VIIA 3KXEC 2AGPA 3FTEA 3D1QA 3MMBA 1S97A 2GQQA 4DV3F 4ZA1A 1SJ3P 3SV3A 3N28A 1PC5A 1S9GA 2F1FA 4ZS6A 5B0GA 3K5PA 3RW7A 1QAYA 3PX4A 1SL2A 3C46A 1P8GA 1XERA 3DOMA 3P5TL 5ITYA 5KG5A 3L28A 2I7PA 1S6QB 3H98A 4IG3B 1XWIA 1YJTA 2CJAA 5KTQA 1HNZF 4IOBA 3EYZA 3RYLA 4XIUA 1Y3KA 1XR6A 5CCLA 1KD1T 2Q2EB 4M9XA 2JC1A 4C3MA 2FVPA 4QHSA 2HQ3A 4C2MA 1ZQ9A 2XI3A 3D8BA 4HLQA 4B3RM 5C25B 3KOYE 3BGLA 2R8JA 1HBOA 1X0FA 1HNIB 5C42B 3DU5A 3D54A 1DURA 1HWKA 4QR0A 2YQZA 3LGMA 4ITQA 3AOEC 1TVRA 2ACYA 4IDKB 5E3AA 5BPVA 1XEZA 2BANB 1HNWF 1F2GA 3JTOA 2LU2A 4DL2A 1E6YB 4NXNF 2V2KA 4Q5VA 5F8MA 4DV4M 2CV1A 3HJ8A 4RW8B 2CJ9A 4U67Q 4F50A 1N4LA 2HRYA 4KV8A 2H9ZA 3GV5B 2F4VM 4N41A 2VG6B 3K2LA 3X1LB 4DF4A 2O3DA 2ZVSA 3KLFA 4DR3M 4N8OA 4ELVA 2XSFA 1X4GA 3U6EA 2PDAA 2W25A 4CZCA 3NCQA 4U9RA 2E1RA 5EXSA 1FJGM 2RB7A 1S76D 4MK7A 1V3ZA 2GHWA 3M8QA 4D82A 4ZPVR 2ALZA 1YITS 3MM7A 3MECA 5HROB 4ED8A 4RUCA 4OZJA 1DGHB 5B0EA 3BGFA 4H54A 5HL7Q 4LF5M 3BGRA 3H8YA 4DL7A 3CXCR 2LQJA 2ZKTA 3G6ES 2DPJA 3WHKA 1FJ7A 5KFBA 4BHQA 3L7OA 5A8WA 5D8HB 1NK5A 5K14B 3KLIA 2DD8S 2N4CA 2EK6A 1H3DA 1P1TA 5DM6Q 3KLVA 4LG2A 3KLHA 2CE7A 3LANA 2HG4A 2EK1A 4JV5F 4DBQA 3MI7X 3K5MA 4WK3A 1Z2ZA 3PO4A 3V5RA 2VFSA 4URGA 1B7FA 3N5FA 3KLEB 3I4HX 1QAIA 1GL7A 3O1LA 1S6QA 1N56A 1SJRA 4IG3A 2D9OA 3BQ0A 1Q1KA 4LZZA 4G6VB 1M5PC 5DGAA 3LWMA 1VOMA 4O44B 1DTTB 3QZ8A 2Z4SA 2XF3A