2XLJA

Crystal structure of the csy4-crrna complex, hexagonal form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
178
Chain Sequence
b'TMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDEEEARKRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 31
structure length 178
sequence length 188
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.890 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xljA02
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xljA01
4AL5A 2XLJA 2XLIA 4AL7A 2XLKA 4AL6A
chains in the Genus database with same CATH superfamily
2ILYA 3M4XA 1UL3A 3QPIA 1IBMJ 1XR6A 4OZ3A 4ZVRB 1RABB 3TWLA 2P5VA 3J7AS 2OHDA 5LMUF 4ZIVA 2LMIA 1R27B 3MM5A 3U6CA 4WFZA 2DI0A 3R2CJ 1S6OA 1L1TA 3LP2A 4K4XA 4DR2F 3KLEA 1Q53A 3BGFA 3VAHA 4UOHA 3H40A 1TL7A 5C24B 3NNAA 2Z3XA 4L6V3 2M7SA 4NSRA 5F41A 4OI3A 2HWTA 4II7A 2WSFC 4NL5A 1QDTA 4DV5M 3B82A 5SZTA 1H2VZ 4IG3A 3D5MA 4DUZJ 3R27A 5F8GA 1GT8A 1X7VA 3KLHA 3PFEA 1G7CB 1N5YA 1XNRF 1S6PB 2YX7A 3D1OA 4QWEA 1ZETA 5CH7B 3DU6A 4C0HA 2YX1A 1REVA 3A3PB 1T43A 3OLBA 3QJLA 5KT7A 4UZBA 1S0MA 4KFBA 4IBCA 5F8LA 4PWDB 2DNNA 2VBZA 3M9NB 2OPSB 2BABA 3JTNA 5J2PB 5K14B 2DAKA 3H8YA 2R4EA 5KOWA 2ZBPA 3MMBA 8ATCB 4TYAA 3NNHA 3IM8A 2QG9B 4KH0B 1JLEA 1R31A 1OQ6A 3MF5A 2VV5A 3IMQJ 1ZQ9A 1EP4B 3G8SA 3KYLA 2H5IB 2Y3YA 2ERRA 3VWSA 2DH8A 3HHLB 2IFXA 2JHEA 1XNQF 3RBDA 3FCHA 2MSSA 2GIRA 3J7Z5 3C46A 2BKPA 1U8SA 1UFKA 3OL6A 3K5OA 1K44A 3FYCA 1NBEB 3PV8A 2DHXA 2G1HA 1RUSA 4XBOA 2XMKA 2GQ2A 5I42A 4UT4A 2BW7A 4H4MA 2DPIA 2JDJA 3FE3A 4X4VA 1BUXA 3NS5A 3EVWA 1BMQB 5DQIA 4IRKA 1VDLA 1PO6A 4RF0A 1WHWA 3D9BA 1T3OA 2KHCA 2DXDA 2WB4A 2F4FA 2E5GA 2AKWB 3ISZA 1YTYA 4C6AA 4B3SJ 4A3VB 3H59A 1HIYA 3W64A 1XIQA 1L3TA 1P9QC 4QIGA 3KK2A 4D3GA 2XZUA 3G4SS 2WSCF 2UP1A 1N33M 1MMDA 2QIFA 1TZ0A 1VRUA 4GVBB 1N6QA 1HI0P 3LANA 2DR9A 1KS2A 3ISNC 5L39A 5HN0A 1UW4A 3B78A 4ZVTB 2F9JA 4G4NA 1U1OA 2ZUGA 5M2RA 3L95X 3BDPA 1ZMVA 3R5DA 1FFGB 1RTJA 4JI6M 1CJTA 5A6PA 4OX7A 1IXKA 3BN4A 3AD8C 3CO0P 3I6PA 2Y0SD 3GLFE 1Q39A 1R8BA 1KFDA 5HMZA 1GXUA 5LXYA 2RS2A 1WORA 1K3XA 4CO2A 4IH5A 4LFAM 1OYEA 4TY9A 1H38A 5SUHA 3I87A 4K8RA 2ILZA 5CAAA 1RA6A 2C9CA 1JLAB 1SBRA 1TELA 4GKJM 3DHXA 1UA0A 3SCJE 4L76A 5CD4A 2WRMA 3FMWA 2FTRA 3HX9A 4RX6A 3M2UB 4OYZA 2CJXB 2KRKA 3Q8YA 3SFGA 2M5YA 4GKJF 7FDRA 4DU7A 4FVCA 3TUJC 1RHUB 1WACA 2YNIB 3R9XB 3OL8A 2M88A 2EC0A 1YGYA 4DUYM 4NLTA 1HNZM 4WTOB 4OYXA 4B3MJ 4K0KJ 1NSQA 8AT1B 4NRTA 4NZ0A 1WSRA 4O3PA 1NEEA 2I7NA 2MH8A 1U0HA 3TARA 1VK3A 2KXHA 3ILOA 4LF9F 2QL7B 3LP2B 3F73A 3EDQB 3DRPB 1HNZF 3G6ES 1RHQB 1TL7B 3Q83A 4H54A 2D7SA 2J6SA 3HHLD 1TAQA 3FK4A 1UCNA 1FXDA 1NK7A 2YBVA 4UOFA 3QAUA 2CUZA 1QAYA 1OY9A 1VQKS 1S9FA 3N6LA 2C2OB 2ZAOA 1CLFA 4IG3B 1RDRA 1WJ7A 3BO3A 3SQGA 3U27A 1HHSA 3UNYA 4R5PA 3W2VA 2AEFA 4PPDA 3IG1A 3KLHB 1N5YB 2L09A 2V94A 1SL1A 2RQ4A 5IFMA 1VHFA 2FZCB 1REVB 1VI7A 4MGIE 1OSDA 2MJUA 3KHRA 5D0HA 3SATA 3A12A 4CLWA 3HVTA 4WPAA 2DCLA 4OI1A 5IM0A 1JJCB 1XMQJ 3IWLA 4P2MA 5ETLA 1S77D 5J1NA 3K89A 5HAOA 4ED8A 1U0SA 4WZQA 1L3KA 4JYAJ 4NL4H 4EYIB 3BXWA 1U1KA 3DDKA 3U6EA 4NYOA 4QWDA 1IBKM 1E6YB 2CJBA 2MROB 2IAJA 2XC9A 4J90A 1RWVB 3IECA 4CISA 3PXGa 2OMLA 3J81S 1AFIA 2MKKA 2DENA 3TJ9A 4KY3A 1VQ8S 2D3ZA 4GO7X 1R7IA 3T1YF 2CQDA 4WXWA 4KLNA 4UUWA 4ZA1A 4LF6J 1RP5A 2YVSA 3RB0A 1V5VA 1X4EA 1WC4A 4RPFA 5I3PA 4DWIA 3NGRA 4H4MB 5KFQA 2XCAA 4IBFA 4DX5A 4LJ5A 1UVNA 3Q0AA 3NWLA 2ZHAA 2KKHA 1HD1A 1JQJC 2OOBA 5DG8A 1ZAXA 3MAQA 2DIUA 4H4KA 3SEOA 4ZVGA 2V34A 3CJSA 3OR2B 4NLSA 4JI2M 1VQOS 4ZITA 3TVKA 2YKNA 4ETZA 2V1UA 3MAHA 4YHHJ 1QTNB 4IDKA 1NUEA 2VFUA 5ITQA 2COLA 2DH9A 4N8OA 2R8KA 4DQSA 4J9PA 4JI2F 1DY3A 3KK2B 1ZTWA 2AV5A 4LCBA 2DHYA 5HSPA 2DGTA 2IRUA 3BREA 5EP1A 2C2MB 3WIVA 4L78A 1VRUB 3G6VA 1FI4A 1TQLA 1N6QB 2JOQA 2HVHA 1JLBB 1WD6A 2DTJA 3QYBA 2JLFA 4R0EA 1RBOB 1WGNA 4LVNP 1TKXA 2K0BX 1O5JA 1DGFA 5DETA 1MU2A 1SQEA 4V19X 1IM4A 1RTJB 3TQ1A 1N0VC 4KR0B 2GIQA 3DDNA 4NLXA 4PAAA 2XS7A 2EFNA 3AXMA 3MCNA 4UOCA 4B3RM 1HLWA 4V19J 2RRAA 4KBIA 5CABA 2CXEA 3I4VA 2BE9B 3ENAA 2UUAM 2HFUA 3L7UA 4ZLJA 4FNIA 1AROP 4P52A 2KRBA 4DPXA 4UY8T 4B3RF 2W7PA 3KK3A 3AA8A 4FNHA 3MPVA 4G4RA 3UNGC 2Z4PA 4G3IA 1NSKL 2XZDB 4QW8A 2QZ8A 3K59A 3CW2C 4LR7A 1AT1B 1MU5A 2QTWA 5LMNJ 4DF4A 1VQSA 2I9SA 2E9RX 4R8UA 4GIPA 1UP1A 2R62A 3CCWA 4I68A 2KDLA 5KFAA 2AX1A 1PC5A 3BQ0A 1F5BA 2JC0A 4LJ6A 5HQLA 1U0HB 3SV4A 3GSIA 4P7VA 1YBUA 4XAKA 2H5EA 2NLWA 4IKAA 2XHCA 4EI2A 1R7RA 3IRXA 1LK7A 4FZVA 4Z37A 2EFGA 4LFCJ 4CYUA 4IR9A 2C98A 3ENVA 4YY3J 3GRYA 2CJQA 2ATLA 3SCLE 3SQGB 2E5LM 2C3PA 4XPCA 4YQWA 4R5PB 3W2VB 1HQUB 3DLGA 1X4DA 1J09A 1IBCB 3IG1B 1KFSA 4NA3A 3SAUA 2P9EA 3BZQA 3B7ZA 5KFEA 2M5ZA 2CQ0A 1DTTA 3AH6A 2E5LF 3D4JA 3VF0B 3A8EA 4Y2CA 1WHVA 1TH4A 3P3DA 4C8MA 3CCJS 3HVTB 2HS4A 1NVMA 4P17A 2ZDOA 1GKIA 4JV5J 2YNGB 3BBZA 5IM0B 4K5SA 3BS9A 2CWXA 1JB0F 1IN7A 4L72B 1FKOA 2J9DA 1HWUA 4I6YA 4XGIA 3CC4S 2QYCA 5CQGA 3B74A 4FBUA 2PI5A 4AW4A 2VBXA 1HNXM 4GITA 2MQNA 3HVAA 3RGPA 3O5TB 2IAJB 2H4WB 3IA0A 1RKJA 5KPZA 3Q86A 1QSLA 1ORYB 4NXMM 1F3VA 4OZ2A 4DV1M 4RBTA 4CLYA 3GB0A 1X5TA 5D78A 2L6OA 3KDSE 3Q8RB 3EWGA 3MEDA 5GAEU 2R7RA 2EI5A 2BJWA 3I96A 4KT0C 2MY7A 2NQPA 4LUBA 2QE5A 5EXTA 3Q2SC 4QIWD 4UQTA 1GABA 4C11A 1DURA 1W5SA 4DV1F 4M5LA 1FJGM 4YOEA 4MFBA 1RAIB 3U6OA 1NH7A 1NSAA 4KHRA 4PR6A 5IV4A 2XULA 4PG6A 2CNKB 5FTJA 1KTQA 2B7BB 3TZYA 4JI4J 2NQ8C 3UQSA 4LFBM 2DZNB 4TLRA 4Q0BA 2W24A 4QNRA 2DD8S 3TW0A 3EVMA 3PCOB 2V68A 2XBPA 2R2UA 4I69A 3TL4X 1GK8A 3I0SA 3VAIA 1VQ9S 4LVOP 4CLFA 4I7FB 4IDKB 1HW9A 1GMUA 4LF7F 3AJ2A 3PJXA 1O6XA 4RUHA 2CAJA 5KQDA 4H4OA 4YS2A 4FN5A 3BH7B 4M9SA 1RAFB 4O23A 1K73T 2UUBJ 4DSJA 4A47A 4DXLA 1SJQA 1TKXB 4GC5A 4CNYA 2KG0A 5L8RC 4LF5F 1NNDA 1MU2B 2DK2A 2H4YB 2CDRB 2KT3A 4QQBA 2QP9X 1DARA 2C3MA 1HNIA 2YWGA 1TV6A 3C16A 3V6HA 1I6JA 2H51B 1UWBB 3GRRA 3KSJA 2XF3A 2QBYA 2KYZA 4R7GA 1OIAA 2CIMA 5B0GA 5FIIA 4DV0J 2AD9A 4KKOB 5C25A 2KZUA 1F9FA 4NZ7A 2YFQA 1R0AB 1SIWB 1Q7LB 1TR0A 5KFXA 4C4WA 3W1YC 2FNAA 3R6GB 4W92B 2FHKA 3IR7B 3KK3B 3VQSA 1T9XA 2RKOA 3EPIA 2VQEF 3TNVA 1R6BX 2R8HA 2FVSA 1T11A 2NZCA 5GADU 3JSRA 3PNYA 2HFNA 2W25A 2FJVA 3BOSA 2VG7A 3ZZTA 5F0WA 3ETMA 1SKUB 3KOYE 2P2CB 1NY5A 5B0BA 2YR0A 3NY0A 2ZZMA 3SBJA 1SQFA 2EKFA 5ITHA 2XGNA 2QZ4A 3LO3A 1N77A 3KHHA 2WB1D 2QPAA 1CJVA 2XNQA 3W0FA 3WBZA 1FEEA 3K5PA 3DN9A 2DVIA 2DWNA 3KXDA 3QT7A 3MUVP 4CZCA 4AG6A 4GRIA 2X8AA 3OVAA 3M7GA 2JRSA 4CYUB 2UXDJ 4ZVPB 4CLPA 2BANA 1TKDA 2LWXA 1LTMA 3F0NA 1HD0A 3NOCA 2YKMA 2R65A 1HI1A 2DGQA 3LMMA 1VBYA 3EMTA 1OIZA 2HVDA 2KT2A 3H4BA 3DLGB 4J9MA 2I6WA 3PW7A 2FJEB 4USUA 2IVFB 2EPIA 4DEZA 4U7UK 2X1FA 2LU1A 1DTTB 3BQ1A 2ROPA 1KQSR 2DZOB 2LLZA 4KIAA 3T41A 1U1RA 1H2TZ 4IFVA 3HHEA 2XSFA 1UJ6A 2F63A 3UO0A 4L16A 5LT5A 2M9KA 2AZ1A 2LQJA 5KFLA 4DR3J 2ZBCA 2R8GA 3A8IA 4TVAB 3I01M 2UUCJ 3EGNA 2Y0TA 1FKOB 3ZCBB 3QGIA 2M8DB 1RT2A 5KFTA 2H48B 2W4CA 2OIHA 1VDHA 1TTEA 3RBEA 2CJ9A 3GLIE 1F9EB 5H1SV 1EKRA 4QYZK 1V6HA 2OPPA 4B9NA 2LQ5A 2XNRA 3MEDB 2AHMA 3HD2A 2UXCF 4DV2M 4MGZE 3D0IE 2DNYA 1R6YA 4USVA 4C11B 2BM1A 3QLHA 2J5AA 4MFBB 4JI5M 3H5YA 3V81B 5IQQA 3KNAA 2KHHA 4QOZC 2J76E 1HHQA 4ED1A 2DHGA 2AGQA 2CQCA 5FTMA 2CV1A 2FVQA 3M32A 3RAMA 1KYIA 5I3QA 5DG9A 3CD6S 4JI3M 3CD5A 4MKBA 2FUG9 1TH3A 4OZ5A 2QA1A 4Q0BB 3GPPA 1S1TA 1T3NA 1KFVA 3JSBA 2CPFA 4BWMA 2GJIA 1K47A 3I0SB 4DPOA 1WEYA 1S0OA 2ASDA 2MQLA 4Y2AA 4FF2A 3GLHB 4ECUA 3ZZ0A 2GVDB 4RR5A 3BGLA 1QZMA 3VGTA 4L6V6 4H4OB 2IYIA 3KOAA 4PRFA 2XGQA 2HWHA 3VKGA 5DNYA 2EA0A 1Q8IA 3HU1A 5CD4H 4A8SA 3KOXE 3MI7X 2DXEA 3AODA 4WXOA 2KU7A 4WYLA 3DM2B 2VODA 1RAAB 1JNZB 2VFRA 4OJHA 4F36A 2NXCA 4CT8A 1HNIB 3MCSA 1TV6B 1UVKA 3C16B 1S99A 2QSWA 3FUUA 2CKWA 3ZTQA 4HEA9 1IR0A 5HMWA 1Q3CA 2QBYB 3T1HF 2RSQA 3NCRA 5C25B 1QY7A 3NBXX 4M5IA 4C0OC 4DV4J 1OAOC 4M5KA 4I56A 1KR4A 2XS5A 3HFKA 1CS4B 3HJ8A 3QWLA 3MPWA 4ZPBA 4LT6A 4TKTA 1X0FA 2VD3A 1U6ZA 2VG7B 3CT9A 4OHYA 2QL9B 2G9OA 1Q8KA 2UXBJ 4FYDA 2KJWA 4YB5A 1PJ5A 3TOQA 4LG2A 3LF0A 1VBXA 4IYQA 1SKSA 2D69A 2J7NA 2Z8QA 1S7IA 2KFZA 3PHTA 5A76A 4QWCA 2XO6A 1YI2S 4AQYF 2H54B 1HWIA 2E7XA 3KG0A 4MKAA 4LF8J 2KZMA 5BYSA 3TYTA 5MAOA 1U2FA 4DV7M 2ZDPA 2J0XA 3Q8QB 4ANEA 1SI9A 2J7WA 4C48A 5K20B 1XHBA 4PQUB 2JEIA 5M2PA 1GL6A 3UWTA 2C9OA 4X4UA 1HBMA 3LQRA 5ETRA 2YKMB 4DV7F 2E5JA 3VAMA 1EZZB 4NLOA 5C1BA 3GCWP 2N35A 3GE9A 3MM8A 2MGWA 1HARA 3FBFA 3W5YA 2BBEA 4QPXA 5A2QY 5CHCB 1SXLA 2DB1A 3LQVA 5CZXA 4DV3J 4B3TF 3GLGA 3GFHA 4X64J 4ZJOA 2HAFA 4PCZA 1RCXB 1PYSB 1U8WA 3U1MA 5D0GA 4IFVB 1NK5A 4KO0A 4FWDA 2HRUA 4O0NA 2VA3A 1M5PC 3MUTP 4AZFA 5HVHA 2DGXA 2FH0A 3Q8UA 2F5GA 3HZEA 5THWA 2ZEJA 2IBOA 1RT2B 2O1PA 2MZTA 1KHWA 1DQ8A 2RUSA 3PX6A 2AT1B 4ERDA 4CLZA 4LF4J 4FXWA 3KJVA 4DR6J 2OPPB 3PG9A 4J37A 2RH3A 3VQTA 2B7CB 2GX8A 1NHGC 2R45A 3RR8A 3WX8A 5CA5A 1UAWA 3HSJA 4A8FA 3PM9A 1X9SA 3C8YA 1QUPA 3R1HA 2VOPA 1S5ZA 4RF1A 3BGRB 3LW5F 1KD1T 5B08A 2Z56B 3QLHB 1RJJA 2UU9F 1VC5A 4DBGB 1YLAA 5KG2A 3UE2A 1C0TA 1NXIA 2LA6A 4GKKM 1GTHA 1VEJA 4ZVQB 1XR7A 2K1RB 1RLDA 4B9MA 3M32B 1ITPA 3B4DA 2E9ZA 2V2VA 3PHEA 3DLJA 1RWWB 1S1TB 4WK3A 4K4ZA 1JLCA 4GKKF 2CHGA 3CCSS 2NYHA 4ZKAA 4CH0S 1EQMA 2NPFA 2RJZA 3NGUA 3P4UB 3MMAA 1LW0A 3QSIA 1Z6TA 4CO4A 2LYVA 3K8VA 2OPRA 3L4BC 4WTYA 3PO4A 4BLGA 1N5QA 2MLYA 4KE5A 3GFXA 2ALYB 1TUGB 1JJ2R 5KG5A 4DPYA 2V4RA 2VHGA 4M5NA 2YKQA 2ZM6J 1WI6A 4DL4A 5IZ7D 2NCKL 5KFDA 4RU9A 4IBGA 2DIVA 2OUGA 4ICLA 3UR0A 2FIUA 2KDOA 2AWZA 2HL7A 4XDCA 5AJ3J 1OIPA 3NCQA 3PZPA 3PRDA 3HSGA 2QLJB 3I04M 1Z4UA 4NEZA 4F50A 3DFZA 1TAUA 1YLXA 2H3EB 2NSBA 5IXUA 4FS2A 3QGGA 3Q24A 3LW5C 4ECSA 3DOKB 3CCES 3K1JA 2HHHJ 5D15A 1G1XA 5EXXA 4FD2A 4TY8A 2BKNA 1FDBA 3KDOA 2JVOA 1NM2A 4KB7A 2VIHA 3UD3P 4JI0M 3KLIA 2B6AA 2YNMD 2L7HA 2UV8G 5F8HA 2OFGX 3VK8A 2V8VA 1VC6A 1XMBA 1ZBTA 4LR8A 5EUHA 4CLTA 1HR0F 4YB6A 3VAKA 2XLKA 5AT1B 4JI0F 4ITSA 1A6LA 1CJKA 5FJ4A 2QRRA 3UCZP 4O3OA 1R8CA 4X62F 4MM3B 4URGA 1Q82T 2MDAA 4ZJQA 1GX6A 1X5SA 3FDSA 1LQ9A 1WTFA 2ZJRQ 1S97A 2DZLA 3JAMY 3F44A 2Y20A 2HVIA 1YJTA 2FVPA 1FK9A 5EXPA 4WE1B 3VHQA 3HX3A 3PYEA 2CHQA 4QW9A 4KHPM 4UF4A 4MYUA 2XFTA 2FD2A 3EZOA 1HBMB 1T0TV 2LHCA 2IRXA 5HI7A 2PGCA 3V6JA 3D6MB 3HT3A 3OD2A 3HM9A 4DQQA 3MM8B 1Z59A 1QDRA 1YJWS 1VQ7S 3I4HX 1SJ1A 1XMOJ 3JYTA 1PJSA 3GLGB 2FY8A 3DGPB 1IBMF 1D9AA 3DKDA 2PFFB 4KO0B 3OHBA 2PT0A 1WF2A 3ZZYA 1UVLA 1EFUB 2DHHA 4EBDA 4NMXA 2LEBA 1FVQA 4K59A 4P74A 2K3IA 3B4MA 2MQPA 5LJ3Y 4ELUA 1WC6A 2YNHA 3F41A 3PYFA 1ULRA 3NXZA 3UI3A 3B7NA 5B0AA 3I4YA 3K7RA 2BE7D 4AUKA 3MEKA 1JX4A 2EFQA 1NB2A 1E94E 4KQZA 5IZHA 3KJVB 2YH1A 2G2YA 2J7KA 5BR8M 3HT0A 2PE8A 1S48A 1Z5AA 4MB7A 4A8YA 3BYPA 9ATCB 4IBEA 2DGSA 1KEKA 1FJEB 1EJ7L 2Q1LA 1Y9OA 3ZNJ1 3CCLS 3MWBA 5D6GA 5F3WA 3L7PA 3W5XA 1WC1A 4K50A 1KDNA 4IIWA 1I94M 3NBPA 1C0TB 3DRSA 4DR4M 4AKGA 4A46A 2O66A 2GCFA 3VGVA 5KPRA 3S01A 5FLXU 4KC5A 4EEYA 4OLPA 2M2BA 2L2DA 1NMEB 1JLCB 5LL6d 1YBAA 2CQPA 2F1FA 2H5XA 1ZYQA 2EO2A 2V9KA 2XZFA 4NLWA 3LQQA 1LW0B 4QIFA 1NCLA 2ZD1B 1PILA 4FCTA 5KFZA 2U2FA 1R89A 3MD3A 1WNEA 3KK1A 2HGMA 3WHKA 3HD1A 5ITRA 3L09A 1KSPA 2CWKA 1Q5YA 4WKRA 3EIEA 3BGOP 3OTDA 3ILJA 4CM2A 3H4JA 3J80U 3ZZZA 1TK0A 5IWAJ 1C7YA 3LWLA 1RWXB 3ISND 3U6MA 3MR7A 2CYYA 2RNEA 4LF1A 2LP4A 2JEGA 4L15A 2X1GA 3ICLA 3QZ8A 2VQFM 4I2PA 2BR0A 3HHZA 4CT9A 3CDAA 4K2JA 4C98A 3CULA 2LDIA 2IJRA 1AB8A 2CZVC 5KFYA 2RU9A 2RVJA 1YG0A 4TY8B 5KFVA 3J7YI 4B3SF 2EW9A 1I4WA 2W1BA 2HFOA 5DZ6A 2EKNA 3ZFVA 4QR2A 2Y0QA 3KLIB 2B6AB 3QZ7A 4ES1A 4NA1A 3PX4A 2VDHA 3A13A 3SSQA 3OW2R 1SIZA 1HW8A 4HR2A 2Z57B 1T9WA 2DY1A 4JBCA 4FS1A 2EUCA 1IFYA 5CYQA 5HL7Q 3KMSA 2GMLA 4OX6A 2DGUA 3HJSA 4X4SA 3D6TB 3CXCR 2HFSA 1S1VA 2WSEC 3M8PA 2VDIA 2CP8A 3PKMA 3BSCA 2FHJD 2BJVA 2GQCA 2HK3A 2YQ1A 1UA1A 1J5OA 4KPCA 3H4MA 1GTEA 1F6TA 4MIWA 2EG1A 2HRTA 2JL9A 1D8ZA 3TUIC 4LRCA 4WFNQ 2MKJA 3DLKB 4KPYA 1G4CA 1H2UX 1ZAEA 3M8QA 4Q7JA 1V3RA 3GLFB 1LWXA 5K9FA 2CPZA 4OYIA 1OQYA 1KRPA 1FDNA 2APLA 2DEJA 2SXLA 1DJ0A 3JYTB 2EBEA 4CTAA 1YK9A 4B3MF 4K0KF 2R0IA 3HJVA 3J81j 1CQNA 3T5KA 1U2RA 4OX9J 3BKTA 4L3KA 4ZP9A 2YNHB 5JUMA 4BWJA 3C58A 1QAXA 4M9XA 3DLBA 4NLYA 5KG6A 2L9NA 4ILLA 3KFWX 4A4JA 2UZAA 3GCXP 2PIIA 3OXGA 2KNVA 2GAGC 3OTBA 2MQMA 1PBUA 4UY85 2W9BA 2V1CA 4UZCA 1PAUB 2HAIA 1UEUA 3W62A 1T8EA 2DNGA 3HHXA 4CO1A 1GFWB 4NRVA 5EP2A 2JZ0A 4DSFA 2FLLA 1OJLA 1FX2A 3J2PB 1FFSB 1U45A 4DCOB 4RNHA 2W7OA 4X4NA 3DRSB 1RTDA 1W2BR 2J6TA 3G96A 1AUAA 5BYRA 1XMQF 4YR2A 3GQ3A 1HNWJ 4MH0E 2HQGA 3N01A 3K5NA 3DXSX 1NDCA 5GVQA 3M05A 4KSEB 2C2ZB 1HL6A 4DQRA 4JYAF 3AD9C 2OSQA 2B51A 2VFTA 3K0JA 1SC6A 1N36J 1VLYA 3GRUA 2AU0A 1VCTA 2AF6A 3HU2A 2DYAA 5LSOA 4FVMA 4PPZA 2V4JA 3JTOA 4C8YA 4ES3A 1EETA 4A48A 3I31A 3FSXA 2BW2A 2QNJA 3MAAA 3FZ2A 3OR1A 4LF6F 5B7WA 1QAOA 2HMIA 1D2NA 1FJ7A 1N32J 1AW0A 5KPTA 3IWNC 7AT1B 5T14A 4BC7A 5CZVA 2HCBA 3Q8XA 1F4IA 1Y5LB 3FBCA 3I4PA 4F4XA 1VIOA 2R7XA 2MHEA 4I2PB 1OFIA 2UVRA 2CUYA 4NLDA 2FLNA 2NUHA 3RGSA 3LUYA 1VQ4S 4F7VA 2R7QA 2KG1A 1LFWA 4DL0C 2XMUA 1C1CA 1J5EJ 2HHTA 1OAIA 2W8KA 1OY6A 1U26A 1T95A 2CPYA 1IBLM 4YEAA 1RTZA 3ZH9B 3NBIA 1DRZA 3RBXA 2MQQA 3R5AA 2X1AA 4C3LA 4NCBA 3FCVA 1UM8A 1Y00A 4NLVA 3VTIA 4YB7A 5CYQB 5HJYA 3CGWA 1HQEA 1R2YA 3DNCA 4QWBA 4OX8A 2XWXA 3HSDA 1S1VB 2RQKA 2B8PA 3CCQS 4LSZB 3M8PB 1TVRA 1LK5A 1RCOB 3H42A 4X66J 1S9GA 3MGJA 3MMJA 1Q95G 5C42A 1W7WA 1XBWA 2AW0A 1Z2LA 1J5OB 4QJVA 1D9FA 1RT3A 5A0YA 3SXLA 3L28A 2V8HA 4TLQA 1B0PA 2RIJA 2CNOB 3FEZA 4M5HA 3IFEA 2XZWA 3KNGA 2VJVA 2ROEA 5C2CA 4IRCA 3GU0A 3M8QB 1YBTA 3KUHA 5F8NA 2HZVA 4HEOA 5K8PA 2RQMA 4FP9A 3UGJA 3FUVA 5LMNF 1PGZA 4AD6A 3CCMS 3TAPA 2C28A 4IFYA 2D3UA 2FDNA 3KJQB 4CTAB 2P6TA 5F8MA 3KOZE 3U6DA 4KJIA 2LBCA 5KT3A 2BYCA 2JWNA 3GV8B 5KFSA 4NXNJ 4ELVA 2DKOB 2XI2A 3EZUA 4NCAA 2UUTA 3D54A 4PABA 5C7PA 2JX2A 1UFLA 4M9ZA 2VPWB 1M5OC 5DDRC 2Z58B 3FGVA 1FRHA 1OYDA 2UV8A 5LJ5Y 4DR7M 3HPOA 2KTQA 5J2QA 4LFCF 2LVNC 2CQIA 5IT4A 3W5ZA 4YY3F 5EP3A 1RTIB 3LA0A 4JB8B 2YWHA 4LBHA 2CVIA 3E9SA 3MPDA 3J7AN 4Z7YA 2W9BB 3NGTA 4KGKA 4YN3B 4DX7A 4RBUA 4P73A 2V50A 3OL7A 5EP4A 4LBIA 4M5GA 4U8VA 4JV5M 1IM2A 2HHQA 2NS1B 1DGHB 3HMJG 1G3OA 1S1XA 4P9SA 1C2PA 2PC6A 2NREA 4DV5J 3RGIA 5IS2A 2CPDA 4R25A 2GV1A 1RT5A 2VICA 2ZOFA 4DL6A 1YITS 3OL9A 2F8MA 1IQPA 3U7JA 4JV5F 5J2MB 1NSPA 4D80A 1VQ6S 1ZPWX 5B0FA 1MJGM 2M52A 2DR6A 2VPZB 4NASA 1UEKA 1SJ4P 3BDEA 3RW7A 5EGYA 1JQGA 4G1PA 2VASA 3MR6A 2F9DA 3W7BA 2ZBRA 1MWQA 1Q16B 2BJEA 4YDXA 4RNOA 4DOZA 2ZH8A 2AHOB 4Q45A 2K7KA 4OZJA 2FLOA 3TJ8A 2J8AA 2DISA 5BPVA 2QCUA 2ZTCA 1YKWA 2DWZB 5D0EA 2P9GA 3M1VA 3MAAB 3PKYA 3OR1B 4F02A 1P6TA 3CDBA 2HMIB 1BHNA 2BMBA 5KQ8A 3DHWC 2W7AA 4I6WA 4LGMA 3ENWA 4LIWA 2AMCB 2YWEA 2X4AA 1IR2A 4QWAA 2CQHA 3NGDA 4ENOA 1I1GA 4EFAC 3NKYA 4AKIA 4ZVSB 2D1CA 2G1DA 3MCMA 1VQPS 1NHKL 4JI4F 1HT1E 3D1QA 4FF3A 4ZK7M 5EHHA 2B4UA 3BYRA 3MM6A 3GILA 1RT4A 2GW8A 4B9TA 2C3UA 2MQOA 1U1PA 1MN7A 1C1CB 2V8PA 1YIJS 5JVGQ 3OFFA 2C1EB 5AE1A 4ZVUB 2DR5A 4BS2A 2HQDA 3H5UA 2LQBA 1IN4A 1KVKA 2CZ4A 1U1NA 1VQMS 2HYIB 3DLEA 1SVDA 3RRHA 4CCHA 2UUBF 3M30A 2BQ3A 4P2FA 1NHWC 2YPZA 3EVOA 4RWXA 2D41A 4ZVOB 1HQEB 3SMPA 1LEOA 4IH7A 5ETSA 3U1NA 3PIPQ 1QD1A 2BEFA 4B9VA 3EGWB 2QHOB 1N33J 1TVRB 4EK2A 2D7EA 2XB2D 4FBTA 1OPZA 2W82A 4CIZA 3W9HA 3TUZC 2O3DA 3VALA 3ZNUA 1M5KC 1OWXA 2I38A 2EK1A 4JUZA 5L9NA 2FPHX 3E01A 1S1UA 5KG0A 4DV0F 1RT3B 4F04B 5A0YB 5B0CA 5E26A 3AD7C 4JI6J 4AXIA 4JI7M 3R5BA 3L26A 3C19A 3IGVA 4USIA 2IC3B 3Q8VA 3UMMA 1MW7A 3KFUG 4ILMA 2QA4S 2KVQE 4C0BA 2BJ1A 2F4VM 2DCUB 2B9WA 1A5TA 5DDPC 4ZCKA 4LFAJ 1LKZA 4NLRA 2IA0A 4OMFG 3BGUA 3PNIA 2OP5A 4K4TA 1N4LA 4IFYB 1AZSA 4BBYA 2KI2A 2BV3A 3C6TB 3MR5A 5I3UB 2IPOB 1HNVA 2LVPC 1RE1B 4G1IA 5GMEA 2A1BA 3FSIA 1H6KX 4ECYA 3KMQA 3R7NB 1TDZA 1RAHB 5C5JA 4GEWA 3DA1A 3G87A 1CULA 5D4PA 2AYEA 3GIMA 1NZAA 3MM7A 5J2QB 4HH0A 2UXDF 4DUYJ 1QUSA 3WX4A 5KFOA 3SYZA 1UWAA 2CQBA 2MB0B 4AL7A 3MEEA 3DGVA 2CQGA 3GFYA 1HKAA 2BQUA 1WTBA 1QE1B 1JLGA 3OHAA 2PMHA 3PXGA 1UFZA 2OI2A 5D3GA 3K9OA 1P9YA 2G0JA 2G0IA 1G71A 4IBBA 4O3SA 3SMSA 1VYAA 2Q79A 4ECZA 4Q8EA 2XHWA 2EXUA 3ZXWA 5EWGA 3R5JB 1S1XB 3K58A 3BEGB 2F5NA 2UUCM 1TGUA 1PJ6A 3G8TA 3QIDA 4JI8M 3WC0A 4BHQA 1WDDA 1T05A 1BY9A 4O4GA 3PW2A 2LEPA 2R44A 1YJ9S 2EVZA 2XLJA 4DR3F 5KFJA 5HROB 2UUCF 2V63A 4PT5A 2E29A 2H65B 3D66A 2CV0A 1LWCA 3OJUA 1VGYA 4NX9A 1DQAA 3E2EA 4CRJA 3SC3A 3HHLC 1RSCA 3HVWA 5IV3A 3W8GA 1QYRA 3ILIA 2HK2A 4ED7A 5ITXA 3M9OB 4NEYA 2LQ8A 4F3MA 4BC9A 2MEWA 1RB0A 2JP7A 5GAGI 2HW3A 3CO9A 2KA6B 1G59A 2BACA 2WVCA 3T1AA 2HWJA 2DJWA 4G6VB 1FNNA 4P7TA 5C2GA 1WJ9A 4G1QA 3J81Y 2Z30B 4HTIA 2P5TA 3EZ5A 3M1VB 2BX6A 5IC4B 3PYGA 4A8XA 1IBKJ 5KFHA 4TQRA 2R2SA 5ETOA 2ZOMA 5F0UA 2CRLA 3MFIA 4EWTA 3UCGA 4QOSA 4O4RA 5HK4A 1MROA 4PWWA 2F65A 1FKAF 2D9OA 4EIWA 3JSYA 4RJVA 1RT4B 1U09A 3FFIA 3FUYA 1VMBA 2GO9A 1WG1A 3GLGE 3QYEA 2RRBA 2CVEA 2BWEA 2RRUA 3G9CA 1XWLA 2XY6A 3T6BA 2FOIC 4EZ6A 2MQ8A 1DAXA 5KFFA 4WBFA 1ZH5A 5C18A 1P8GA 4DSIA 3X1LB 3DLEB 4OVZA 5U47A 2ZTDA 3MD1A 1Q8BA 2RT3A 2WONA 5LMUM 2B43A 3V76A 1YJUA 1DTQA 2OEKA 3M30B 4HI2A 4DR2M 3PTWA 4OHZA 3QRPA 1DLOA 4U67Q 2VA2A 3GQ4A 4R71A 1PJ7A 2VBWA 3HLUA 3MDFA 1DFDA 4DV4M 2HEKA 3QIPA 1VR6A 1E6VB 2K47A 3E01B 1NHUA 4N56A 3E51A 2QJ3A 1S1UB 5I4MA 1YVFA 3CJ8A 5EXSA 1Q78A 1XNRM 1UMJA 4DV4F 3IBWA 1PJTA 1QM9A 2HHPA 4PXCA 4Q7AA 3GSDA 2PN6A 4ZP7A 4WW0A 4CQ1A 2CG4A 1U49A 3KXEC 1DHMA 5E5NA 4FDFA 2HGLA 4USMA 2HNZA 2J0SD 1FCAA 4WKYA 4O3QA 1IQTA 3CIZA 4ZIWA 5D4OA 1RHMB 1H74A 3AB4B 1AZSB 2UUAJ 2UXBF 2YX4A 3IG8A 1NLKL 4M8LA 3LH2S 3B8HA 1K0VA 4NC6A 4CO3A 3MM9A 4L74A 4C3KA 1J7KA 2ALZA 1XEZA 4EGLA 4HVZA 3A3OB 3IGNA 3HULA 5L38A 3V4IA 1JIHA 1NJFA 1Q1KA 1CULB 4F2RA 4LF8F 2VF3A 3MM7B 4GMKA 3QT6A 1WIVA 1XNQM 2AYMA 2LKZA 2Y9HA 3OVBA 4C8OA 2Y1LB 2KJVA 2QLFB 3MEEB 3ZC7B 3LOUA 3KKFA 5LSRA 1AYEA 3RTVA 3CF0A 4DV3M 3HDSA 4ZPDA 1JLGB 5D3GB 4K2XA 2MLXA 4J9KA 1D0MA 4DL3A 2V0NA 2RDJA 4MGHA 3M8SA 4DV3F 4X64F 2IMOA 2DAGA 1X9MA 5F9NA 2XQCA 1SG9A 4QHTA 4J9LA 4MAKA 4B17A 2A6MA 4GMQA 1T05B 2E44A 3M8YA 3H4DA 2BJ8A 3H0PA 5G0RA 1FKPB 1R5LA 4M0WA 3SFUA 3IS9A 4PG8A 3KLFB 3DFEA 1LWCB 4OZ1A 4C8ZA 1LWEA 1IJFB 2ZH4A 2PO4A 3RUBL 1BQNA 5L1IA 1IKVB 3AY0A 1Q4RA 1FD2A 3SDEA 4LF4F 4DR6F 5HMYA 2IDLA 2PMZD 1PJIA 3NEKA 1JLFA 1SC4B 1S6UA 4HDGA 4M63A 1UTAA 1VOMA 3BB5A 1RBLA 1X9WA 1ZMUA 4G1QB 2AJFE 1HNXJ 1YJNS 2LH0A 1X4CA 4FKXA 3W9JA 3TPZA 2VZ9A 2Q6BA 4RW8A 2NPIA 4NXMJ 1ZA2B 3SMZA 2L48A 2AX0A 2DBBA 3OVSA 2O67A 2D7HA 2I8EA 1QAJA 5IT0A 3VDPA 3I5AA 2F5OA 2JZ1A 1C4CA 1MROB 4GC6A 4PQAA 3QWPA 2BWBA 3GJRB 1KQGB 1VQYA 2MKSA 3EDRB 2E1AA 4LZZA 1C1KA 1FJGJ 3FFIB 3HJFA 5H37D 4L4UA 3DCAA 1WG5A 4C8KA 3KOWE 2WVDA 4WFXA 4I8OA 3GIRA 1S12A 1REGX 3CNQP 3K92A 2J0WA 4B02A 4RNMA 5B0DA 4OYOA 4LFBJ 2D3OR 2MMYA 2GQQA 5MLCV 1LW2B 1OQ3A 1U25A 4OVZB 4PWUA 3IXQA 3SAWA 2WONB 2LTUA 3WHIA 2ZM6F 2CADA 1DTQB 4LF9M 1F3FA 2XSJA 4G4QA 5ETTA 4WP2A 1M0SA 3NAHA 1OMSA 1KC8T 2D3O1 1DLOB 2OLWA 5AJ3F 2DKLA 2IDEA 2MKIA 3US5A 4GRSA 1NKCA 3MM5B 4QIEA 2HWIA 2RRNA 4QR1A 1P1TA 2HFVA 3MECA 3KLEB 4M5JA 1VEGA 2IYGA 2FFJA 3QIPB 1ZV1A 4BBAA 4LJMA 1U6FA 1Z5CA 2YH0A 3N79A 2HHHF 4TN2A 2OTLS 3B89A 5KFUA 2JA2A 3QWUA 2V2KA 4YFUA 3L25A 2IY5B 3AT1B 5FD1A 5A6WA 4PXBA 4QYZJ 4QNMA 4FYXB 5DM6Q 3IG5A 2ASYA 2VPXB 1U1MA 1XB2B 2HZCA 2HNZB 1ZZFA 4IH6A 3ZZPA 3KHLA 3KP1E 4J9UE 3KWMA 4P6QA 4J9NA 3AOGA 3GPXA 1RAEB 4NYZA 1RZMA 2C99A 4KFBB 3CJKA 2ZH1A 3MM9B 3UDLA 3LCVB 3MMBB 1SV5A 2BQRA 5GMKa 3GQ5A 1IR1A 1UVJA 1JLEB 1X5OA 4FWHA 3T15A 4UOGA 4WP9A 2BJDA 4OQJA 3PDNA 3AFHA 3N9UC 1RT6A 5DM7Q 2GZOA 3T1YM 3V4MA 1WXQA 4IR1A 3B9PA 4RUBA 1SC1B 2L9WA 3TP2A 2XMAA 1WF0A 2GJ2A 4RW9A 2ZJPQ 3H5XA 1F2GA 2JNHA 3H2LA 3GIJA 1H73A 4F0HA 3VVUA 1KVJA 3PY8A 3MHVC 2HVZA 1L2BA 2CFXA 3IO1A 3W68A 2WK4A 1WELA 3H7HB 3CUNA 2J6UA 1XMOF 2VBYA 2JNJA 4GH9A 4WZMA 4WWSA 2C22A 2JLEA 5D0RA 1YHQS 3LP0A 1NV8A 1VK8A 2Q43A 3IM9A 1YZ7A 5I42B 2K3KA 1HWJA 1G3IA 5ETNA 4J9OA 1NU4A 5G0RB 3GZ7A 2GFFA 4QZVB 3TA0A 2ZH6A 2J9CA 4J91A 1K1SA 3GYNA 5DYGA 3UD5A 1HBNA 5FTNA 4DL2A 1QAQA 1R8HA 3P8BB 4DR5J 2G13A 3QRRA 3T9ZA 1LWEB 4DV6J 2YKPA 4LF2A 4DJBA 1XN9A 4P75A 4CH1A 2X3GA 5H9EJ 2A2CA 3AOEA 2F3JA 4PUOA 1JLFB 2DHSA 1RWOB 1C0UA 1Q8LA 4RZRA 1TH2A 4G6ZA 4FPIA 2H1RA 2CG8A 2W2NP 3ONQA 4KGXB 5HQ8A 1M5HA 3O6QA 5DS7A 2FJXA 2GNKA 1PM5A 3BBCA 1NRKA 4RW8B 2HVEA 3H98A 3DYAA 4FYVB 3L2AA 3WQPA 1CJTB 4H4KC 1FRLA 2WVFA 4DV2J 5DGAA 3D8BA 3FNNA 1V3ZA 1DO2A 4FXDA 4JI5J 4ZPTR 3CC7S 4J5OA 2DHAA 2FLPA 1S0VA 3A8KA 4LRBA 4ZMMA 2HHWA 2YWWA 1NDLA 2GAHC 4JI3J 1S76D 3LCUA 3MEGA 3UZUA 3EICA 2JFKA 1FFWB 3N6MA 3DRYA 1TL3A 4RO0A 1NO8A 4P72A 1Q5VA 2UVWA 2QLWA 4L73A 5HVFA 2XSJB 1JJ4A 2KHDA 4LQ9A 1GNKA 5IWAF 1Q86T 2XMVA 1RYRA 2XMWA 1VHIA 1YDLA 2AP6A 3QGHA 3C9PA 4F4KA 3P6YC 3M6WA 4RWWA 5DGBA 1YE9A 5IC6B 2HIYA 2KL8A 4ECVA 4KT0F 2Y1RI 3HZJA 2BRKA 3MECB 4IG0A 4NSOB 1R2ZA 2IM1A 1XK8A 1QSYA 4RW6A 3GQCA 4RW4A 4OZLA 3UDVA 4FKYA 5T7LA 4WFYA 1MWYA 3JB9k 2W2OP 2DXIA 1WEXA 2HLTA 1KTVA 4M1KA 2ZVIA 3CJ5A 4OYPA 5F3TA 3THVA 1WOPA 3G6YA 4FXVA 4TUWA 2QMUB 3TAMA 1QUTA 2HSEB 4OYWA 3OSPA 2XLIA 2POKA 3ET6A 1HBUA 3VFDA 1FO1A 3EE3A 3FRHA 3SHFA 2ASLA 4CH7A 3CJKB 3CTRA 4ANCA 4PXEA 1RISA 2F8HA 2Y21A 1QDUB 1X0PA 1SV5B 4XK8F 2KVIA 2V6AA 5KFMA 4HT7A 3QYYA 5KT6A 2Q66A 5HATA 2OKQA 4OI6A 4OZNA 3NCPA 4M5MA 4WFBQ 2XYPB 2ADBA 4OHXA 5L8RF 5F8IA 4QOTA 4IO9Q 3VK7A 5K8MA 5E2QA 4GC7A 4DPTA 4KGZB 4NLGA 3NWRA 5ETVA 4RW9B 2FHOB 4F2LA 4DL7A 2E66A 2F5SA 2W9CA 4ECQA 2OD4A 3JQMA 2IVYA 3QMQA 5A2QU 3GYXB 3LP0B 4DR1J 4CP5A 2X51A 3GP9A 2E9TA 4CGYB 1GVNA 4EYHB 2Y0BB 4OX9F 4CHTB 2VF7A 1YRUA 2J0QD 4AXJA 1UVIA 2CZ9A 3SCIE 2V8DA 3FCWA 3PEJA 4LF7M 3TWMA 2GHWA 1HBNB 1PGYA 3ZO7A 1MN9A 3TUPA 1WEZA 5E7OB 1SKRA 5A8WA 2QENA 4ATNA 1S72S 2YKNB 2YQ0A 1NH8A 2UUWA 2KH9A 3LGMA 1I3OB 3LTOA 3SCKE 4LRDA 4U7UD 4PUOB 1RI7A 1I51B 1C0UB 3VAFA 4CM0A 4JV1A 4LF5M 4XK8C 2N82B 3BM7A 3MXHP 1CQMA 2C5RA 2C42A 3UFCX 2KRUA 1HNWM 4OFZA 1X60A 3H5SA 2XY5A 1S6PA 2R46A 1M1KT 1U2CA 1OS5A 4OI0A 2G2OA 3HF5A 2GIFA 4P2SA 3D67A 1PSDA 3OFEA 4P10A 4FF4A 3U6PA 5BJRA 4PYAA 1HNWF 1TF0B 4NE9C 5A8RA 3GIIA 1CPZA 2EBGA 4HKQA 1RQ0A 2B56A 1N36M 3VGUA 1HFEL 1JNRB 2FJDB 4X65J 3TZXA 4LSLA 2QLBB 3RB4A 2O5RA 2HQ3A 1RAGB 2J5YA 3ZTRA 3W3SA 2EFPA 2VQEM 2GHVC 2HAKA 5J2NA 4B7FA 2CRUA 2U1AA 3BKUA 3F92A 2FE8A 2K2PA 1N36F 2IMWP 1T9YA 3J7BA 4ID5A 2OD6A 2J9EA 4RUCA 4ANRA 3R3TA 3MEGB 3DRXA 2F40A 2GQFA 1WGLA 6FD1A 3OUYA 3K17A 4HHJA 4R8UB 5DFLA 2GJFA 4WURA 1N32F 1BLUA 3I56S 3RB3A 1FNOA 2XS2A 1S1WA 1Y5NB 1J5EM 3K2LA 4QPTA 2KFYA 4DSEA 1RAJA 4S12A 1TK5A 1FESA 1XQIA 3IRXB 4PG4A 3PFOA 3HFVA 4RW6B 1GAOA 3POTA 4URSA 2XTJP 1J5EF 1TU0B 5LSLA 5T7LB 1RHKB 2ZKUA 3HZGA 2OOAA 2BVZA 1SB6A 3U60A 1SH3A 2YQ3A 4X4PA 3D28A 5DLFA 3TWKA 2MY8A 3UN2A 1NK6A 4DCPB 3R97A 2P6SA 3LAKA 4RKUC 3TAMB 3BSNA 1IKYA 3IBCB 4X4QA 2OMOA 2N4DA 4FYWB 3ET6B 4LY6A 1HBUB 1NJYA 2WVBA 4AI6A 4ZPWR 2AJ4A 3SAVA 1H3DA 1RWMB 3A8JA 4ZPAA 4Y2MA 4C3MA 1P1LA 5L1KA 2HZAA 1Q7YT 4V1Ak 3HP6A 2QSFX 2CWBA 2FVRA 4Q43A 2OJ3A 3JAMU 3SQOP 2OELA 3X3UA 1R3NA 3W65A 2UXCM 2AZ3A 3WC2A 2ZBKB 5FTKA 2LVWA 2OAUA 3L7OA 2ERCA 1JWWA 4QBUA 3TEHB 3I9V9 2CJKA 3U02A 2WZJA 1D0EA 1FTCA 3BKFA 1FE0A 4YR0A 1NY6A 2DXFA 1GQEA 4ZP8A 5G4DA 4LRSA 4KHPJ 2QN6B 3M2UA 2EFVA 3QBCA 2W8LA 3CJRA 1OJ4A 1ELOA 2LQ9A 2DO0A 4NXNF 1RU2A 5FLXS 1FRJA 2RU3A 5E3CA 2B4PA 5CXTA 4P2XA 4HACA 5JVHQ 2DNKA 2NXEA 4IJEA 2B5JA 5HMXA 3SFZA 2CQ4A 4PXDA 4HLQA 4N8NA 3OXLA 2FB0A 1UZHA 1T03A 3DRPA 5A8WB 2K9DA 2JH3A 1SCJB 1SL0A 1HBOA 4ECXA 4ECWA 3N0VA 1TFYA 1PBAA 2KNAA 3EIHA 1IUJA 3ENQA 3R7BB 3BSAA 3HHNB 2N7CA 1LXJA 3G8QA 4IO1A 3HCXA 2KM8B 1KN6A 3GIKA 5ITUA 1FHTA 1SH2A 2JJ4D 1P27B 3ZC4A 2N4CA 3G82A 2MKCA 3J80S 1NZ8A 4ZS6A 2JC1A 4DV5F 4G4OA 3DDIA 3E46A 1DBDA 1GEHA 2DNHA 5BR8J 5T41A 3T1HM 1TMMA 3T3FA 2JEJA 2XYGB 2GNOA 3FRYA 5A8RB 2ZNYA 1T6OA 4USHA 1HQ2A 3RRGA 1VQ5S 3U6SA 1B99A 2FYXA 1SUQA 4LSLB 2RF2A 1D9DA 1I94J 1YQHA 2JZ5A 5H9EK 2DWLA 1VG5A 4AT1B 5J2NB 4DR4J 1SXJC 2B8QA 2O01C 1UFWA 2OPQA 1E6YA 4ID5B 4EBCA 3E8OA 4TYBA 2BRLA 3CJ0A 4W90B 3M8ZA 2N3LA 4ED4A 3CVKA 3OUYB 3A42A 2W9AA 2I7PA 3TX8A 2B9YA 3DC2A 4AQYM 2QA4G 1YWXA 2KXFA 3JR4A 4GC9A 1SC3B 1S1WB 2I0XA 1CJVB 2FJBB 2RUGA 3A4TA 3T5LA 4L8RC 2WW4A 3CF6E 2BUNA 3ETOA 4U8YA 2HBZB 2OH2A 1NK9A 3POTB 3BV8A 3FZBA 3S6EA 1WKKA 2BANB 1NNJA 1QVRA 1C1BA 3OR2A 2HBQB 3SI8A 3U60B 5GAEI 2Z2LA 4B3TM 5D8HB 2VQFJ 3U61A 2ZNZA 3FBEA 1RT7A 5EWEA 1S6QA 3OFGA 2HBRB 2KXNB 4MMOA 1V5IB 1KLMA 1IKYB 1YJVA 2DNZA 1NJZA 2XH9A 5LOQA 3O8WA 1TMJA 2K06A 1XWIA 2XG8A 4J9RA 3CD7A 4JV0A 3S7RA 1JLBA 2K8GA 1RAOA 2XM3A 1JKHA 1JXLA 5ITXE 5CCMA 2L9DA 1CEZA 4OZ0A 1K9MT 1N33F 4LRFA 4Z6YA 5KFGA 3A45A 2NZ4A 1CC7A 1NKEA 1ZM9A 1Y8GA 3SASA 3C6UA 4FCVA 2XMTA 2FHJA 3N28A 3NL0A 4JI6F 4J9SA 1CSJA 3WHLA 2WBRA 1N88A 4S0MA 2LCWA 1EAYC 1QQWA 2UU9M 3UVJA 2E5IA 3R6LB 1S3SA 1W2IA 4REZA 1N56A 2JSXA 4LFAF 4F4ZA 3GWCA 2UVVA 5IREB 3BBFA 5D77A 2MYFA 1DO0A 2FS1A 4ITQA 4CNZA 5IT9S 2Z7JA 3GG0A 3BR9A 5HLFA 3E21A 4TU9A 1IJEB 4JP8A 3PX0A 3DOLA 4WIQA 3MPUB 2FVCA 4HACB 4WCEQ 5KFKA 3OT9A 3SBMA 3NP5A 4IQXA 2B5JB 3DXBA 6AT1B 1X5PA 4E98A 2KO1A 4DUYF 1T03B 2WSCC 3HKWA 1IN5A 1U02A 2I5JA 1HBOB 1T94A 1RHRB 5GADI 5KG1A 2L08A 2J7UA 3MR2A 5KG3A 4OLOA 3RG6A 4YDDB 4J9QA 1IKXA 5ETKA 5DDOC 4I2QA 1HQUA 3VLFB 3G82B 4KGVB 4DX6A 1N34J 1RT1A 3KG4A 2G8LA 4HHUA 4G3OA 1KHVA 2APOA 3GTYX 2XGPA 5DO2A 2D7GA 5LM7E 4N76A 3W0LB 2R2RA 1ZPVA 4N47A 3EGVA 2YNGA 1MLAA 1FNMA 1MMNA 3M8WA 3DOAA 4K4VA 5E3PA 2R18A 2VC0A 4LGYA 1SUQB 3B7QA 5K5MA 2RF2B 1ZAVA 4GO5X 4DN9A 5HJXA 2QL5B 1GJTA 1JR3A 3H20A 2LNHC 1CVJA 1HR0M 1VQLS 1NSFA 5M2UA 1VRQC 1UZDA 1GX5A 2ZC4A 1U47A 3ILKA 2OPQB 2H5JB 1D09B 1XC9A 1RWPB 2MZQA 3KTQA 5DRKA 5EDWA 3NOGA 2W4PA 4LBPA 4X62M 4MK7A 2PEHA 3ZTSA 2NR0A 1V34A 1O0PA 4KODA 1IBKF 1CUKA 2KRRA 2M70A 1O51A 3NS6A 1GXTA 4E0DA 1H0HB 1VRTA 1K1QA 3GJSB 2WTFA 4E8UA 2F7VA 3RFWA 4UTGA 2DITA 4N5SA 3CF2A 2B0GA 4WU3A 3EPGA 4KH1B 4DQIA 3JXOA 2CQ1A 4FYYB 3VGSA 2KNZA 3PW5A 4GHLA 4DPUA 4RLEA 2R7WA 4ZJLA 1DQ9A 1ZM4A 1DV0A 1C1BB 2A5YB 3OTEA 2HKJA 4QCLA 2ZKTA 4KTQA 3U61B 1TDHA 1RT7B 1H98A 1S6QB 2R3VA 3VV2B 3EGZA 1DGBA 3OBIA 1T7PA 4I7FA 3DMJA 1IBMM 4RUAA 2L4FA 2I1RA 3S1TA 1IWGA 1WOSA 1U1LA 1KLMB 4XIUA 4XDDA 1LFPA 1Q02A 4LSNA 3CDUA 1LV7A 1IBLJ 4Y2KA 2GO8A 3AA9A 3U1LA 3C15A 4QYRA 1JKHB 5AXNA 1RA7A 3K8WA 1KNZA 4CLSA 3NG8A 1I5OB 2GGPA 2ZC3A 5H9FJ 2R7SA 4Z2XA 3HI9A 3TI0A 2VG5A 4DUZM 3C6UB 1VIXA 1UWBA 2XMJA 2CA9A 1FWLA 1BQXA 3AL0C 2EWHA 1SJ3P 4KKOA 4LJAA 2ADCA 4O0IA 3LGNA 3QQCD 3J27B 4LREA 3UVJB 1R0AA 4DUZF 4MT1A 1WDTA 3NAIA 2MKHA 4PCQA 3FUTA 3NLCA 4B08A 5KT2A 2Z0GA 2HNDA 5CCLA 2BKOA 2EKYA 2WZ1A 3CCZA 1S0NA 4TU8A 5ETQA 3NWGA 2IM3A 4DSLA 4I4LA 2QA2A 3CGIA 1OFHA 2UUAF 3RYLA 1VBZA 2R4JA 1IXZA 5HLFB 4JI1J 4CJ6A 2G4BA 4I81A 1QUVA 5KFBA 3DOLB 2WVEA 2OEJA 3SHGB 2QX0A 3IP0A 3MR3A 3FTCA 4LQ3A 3KUEA 3OLAA 4ID8A 4M0DA 3U5ZA 1RGVA 3CJQA 4HL4A 4OI4A 1BE4A 3JQKA 1GH8A 3R7SB 4QU7A 4U6PA 3NRBA 2FGOA 1YZ6A 4ECRA 2I5JB 3MMAB 2DAIA 2WSEF 3NGKA 2EJSA 2OPRB 2JWSA 4K5RA 1G6BA 4Y65A 3OTOJ 4YR3A 3MMCA 4L3NA 4G65A 3RB6A 6FDRA 4DR7J 1IKXB 1TP7A 2FJAB 4I2QB 1IXRC 2CPJA 2X49A 4MK8A 2DRBA 4CO0A 1RT1B 4ICLB 2KXEA 5HVGA 1YJ7A 3UW1A 3K8ZA 2HQCA 2DNPA 1WKLA 2G5GX 3D3CJ 2ZWOA 3LAMA 1YJRA 3TRGA 4URQU 4B3SM 3UDCA 1N5VA 2ZZTA 2Q3PA 5KAKA 1VBKA 4PDIA 1X4AA 2LDYA 1UKUA 4TNOA 4HDHA 4NLUA 2MHNA 3CCVS 1SPBP 2CV2A 1X4GA 1LV5A 1QJHA 1ZTTA 5E33A 1B0TA 2LVOC 1EHWA 2OSRA 2PA3A 1TL4A 3GPUA 3M2RA 2LECA 1K8AT 1IQZA 3DU5A 3TJAA 2NUUG 1MX0A 2RDIA 5HBMA 2ZH9A 1XXHE 3TVYA 3MPYA 3R9LA 4W5WA 3BN7A 1HNXF 2RQCA 3MOZA 2NXNA 5EX0A 3V5RA 2A2DA 1CJKB 2L7IA 4NA2A 2E1CA 4MH8A 3D68A 4NXMF 1VRTB 1ROFA 3V81A 2H9ZA 3D7SB 1LXNA 2PFDA 3T6JA 1WWHA 3GR0A 3EXCX 5GMDA 1B7YB 2AGPA 1KOOA 2IA6A 3VKHA 1YSJA 3W60A 1FJGF 1FK9B 1PCAA 2QV6A 1BC6A 4WK1A 1R0CB 1BGXT 3L29A 2HHXA 2M4MA 2QQ8A 1KLNA 1FXLA 4C7QA 1K0TA 4I1TA 2V8GA 1QSSA 4DFKA 1TUWA 4LFBF 4AKHA 3GLHA 5EWFA 3DMJB 4DL5A 4B3MM 2GVDA 4K0KM 2MZ1A 2BOPA 4B9LA 3OTCA 3M7VA 2C2KB 3EYZA 3TO8A 2FC8A 4FCWA 3OV7A 3TAQA 2IIHA 4OW0A 3K2YA 4LSNB 2KZZA 1JLQA 1JB0C 1G8PA 4DU8A 1PAEX 4ZVHA 2ZBIA 2VKZG 4DQPA 3C15B 3H25A 3KVWA 1GLNA 3FTDA 3O1LA 3DM2A 4OYBA 1EKSA 2CQ2A 1M5VC 4KO8A 1L3UA 3ZTOA 2GGPB 1R4GA 4ED0A 4JXJA 2MPUA 3RU0A 4NMLA 3T6PA 2VG5B 3CSKA 5E3QA 1NJXA 4NI2A 4O3RA 2IM2A 1D1UA 3GP1A 2DGWA 2L3MA 2DO4A 4JV2A 2YTCA 4DN0A 3I9ZA 3A3NB 2Y8WA 4RW7A 2HNDB 1CS4A 1EIYB 1L2DA 3CIMA 2K7JA 1XMQM 4WF9Q 2BJ7A 2V2QA 1M5SA 2NXUA 4ZLPA 4JI7J 3FTFA 1FWPA 3NBPB 1FJCA 2AGOA 3W63A 2MZSA 4JYAM 4AL6A 5ADZA 3T5JA 5JI3E 1TL1A 3MUMP 4MJKA 4E2FB 2Z2MA 1GO5A 2F4VJ 2BXJA 5BXIA 1X8DA 4DZDA 2LA4A 1JR3D 4W4MA 5DYIA 2G0CA 1FWKA 4DHVA 4F4YA 4Y34A 2AYBA 3U5ZB 2DNLA 1H72C 4ZPVR 2QT7A 3DOMA 1L2CA 2WBMA 1GMWA 4CDIA 2J7OA 4B9UA 5EX3A 4LF6M 4PQUA 1R0BG 3MMCB 1Q81T 3KK1B 4KV8A 3GV5B 3VZHA 5KOXA 5BYQA 3UN3A 2JXNA 4WU2A 4R3DA 3MMPA 1KKHA 4ED5A 3CEDA 1NAQA 4NOHA 4DR5M 1JK9B 3D0GE 4DV6M 1IWAA 2R4FA 3IR6B 4ZCMA 4LJ9A 1ACMB 4LIRA 1NJWA 4YHHM 3NMAA 2QFJA 2ZH5A 3BPSP 3M9MB 4KHMA 1WC5A 1S4EA 4DR5F 4O3NA 2JY8A 4USJC 4HTJA 4DV6F 3AB2B 1RWKB 4JI8J 1IXSA 2A3JA 5IOLA 4YHHF 3TQSA 4PKDB 1JMTA 4OJ3A 3IBFB 3TR5A 3ULHA 1RK8A 2KN4A 1WC0A 1YRTA 2LXFA 4IBDA 1L3VA 2E7WA 3M2RB 3W67A 3R8FA 2YPYA 2DEIA 3LPYA 3N5BA 5HBMB 1AFJA 4B7GA 1UPMB 2DRDA 1JXVA 3FKEA 4USWA 3J81U 3TQEA 3KW6A 2EK6A 3BGRA 4MGYE 3CDEA 1PIEA 2UVUA 2R7OA 3FBBA 5HQMA 4DV2F 1WC3A 3NGSA 1N75A 2DH7A 1NPKA 2K1RA 4OYAA 3W2WA 2OO4A 3CJ3A 3OQ2A 2VF8A 2CPEA 2ZBQA 4JI5F 4MKVA 3C14A 3SSRA 2OO9A 4BLCA 3C3LA 3AQPA 4K4YA 3Q2TC 5LMNM 4ILRA 2MJ5B 3MTJA 2D74B 3LP1A 1TKZA 4JI3F 4FW9A 3AOBA 3UCUP 3OXFA 4IRDA 5L9XA 1L5UA 1TUVA 4K4SA 1O8BA 2F8EX 1PJJA 4AL5A 2VL1A 4Z8XA 4MKYA 1H7WA 2R8IA 1SXJA 2QFIA 1UEVA 4IQMA 1JLQB 1NB7A 1PYOB 1OSCA 4Q5VA 3FUWA 4LJ8A 1NPRA 1RWNB 1WUUA 3PRVA 2VU5A 1F5AA 4LFCM 3V6DA 4YY3M 2VJUA 2DR8A 3N5FA 5LMUJ 4Q2MA 3R2DJ 2MJNA 1G41A 1Y5IB 3HHDA 4LZJA 5L46A 2HHUA 3AFGA 3W8PA 4DR2J 2ZJQQ 4HLBA 2ZH2A 2LEAA 3C66A 4NI2B 1OKSA 2DNAA 2ACYA 4HL9A 3DLLQ 3CTWB 1SQGA 3DOKA 5JMNA 4DSKA 5J1PA 2YKOA 3AQOA 3M0EA 3MFHA 5KFIA 5AE2A 3MHYA 1MWZA 2ATCB 4TXSA 4RW7B 3PJ9A 4IBIA 5HO4A 2AJ2A 2VIIA 2BDPA 3TZWA 2XCPA 1XNRJ 3FSYA 5B09A 2NSCA 5IQ6A 3KSXA 5KG4A 2HS3A 2LXEA 2FJWA 1RTDB 1UJ5A 4DDFA 1ZM2A 1TL1B 3JS9A 4EMDA 2ZUAA 5ITTA 1R6VA 1T9UA 4MTPA 5H9FK 3J7A1 4F3QA 1FE4A 2QEXS 1GXLA 2JFDA 4OL8A 3ZQJA 1V9OA 2C2EA 3ITHA 3CJ2A 3M2VA 5DDQC 1B7FA 2BOAA 1ZA1B 3A46A 4EZ9A 3DOMB 2V6ZM 3ADAC 1PJQA 2VUGA 2RGOA 3HHYA 4WE1A 2E1MC 3QAEA 4ZP6A 3THTA 5KT4A 1NHVA 1J2VA 4PD2A 3AJ1A 4J7CA 1PKUA 2V4JB 4DF8A 1G2EA 4DR1M 3CD0A 4ETXA 2XMMA 2RKIA 1EETB 4KV8B 2W01A 3J7YU 1SKWA 1XNQJ 1CBKA 5AXMA 5EJCA 5CYJA 3CDWA 4JI4M 4C97A 2CHVA 4F8RA 1VISA 4DR1F 3KS4A 1VC0A 2Y1IA 3DGPA 4K4WA 5HP1A 5KT5A 1UVMA 3IN5A 2PSZA 3WIUA 3SYKA 2Y8YA 2B9XA 4B3OA 3RE8A 1WOOA 1T9TA 3BPDA 1IN0A 4OV6A 2R7VA 2DGOA 4ES2A 3PNVA 3V2UC 2B3TA 2RS8A 3CC2S 3SZ2A 4ZPCA 1X37A 5DQGA 4DPWA 1IXSB 3KG1A 1Q3BA 2IM0A 1UJ4A 5EQTA 1GJSA 2VKRA 1R8PA 3SSSA 2UUBM 3EXYA 1Y4ZB 3LGHA 2N7YA 3PIOQ 4I0WA 4UN2B 2AIRB 5JI2E 4ZN1A 1ZAWA 2ZH3A 2CPHA 2X3DA 1U7LA 1PC4A 1RLCL 2HG4A 4LRTA 1WR1B 4Q44A 2L4EA 3FEXB 4X65M 4DV0M 2M0GB 1D0LA 1RU1A 5KO3A 1KOHA 1S9GB 2XEPA 1N48A 5C42B 1FEHA 3W2WB 3KLVA 2ZHOA 2W2MP 2RMLA 3DI6A 2Y1JA 4X65F 4XTTA 3ZZUA 1RACB 2DAMA 1NJGA 5D4LA 3C14B 3CCUS 3MTKA 2NYIA 2XY7A 3LP1B 1TKZB 3V6KA 1IM6A 1DGGA 4LRAA 5L1LA 5KG7A 2IBKA 4WFAQ 3Q22A 1S59A 2ZD1A 3L3CA 4ECTA 3BO4A 1N8RT 3TA2A 3Q8SB 4PG7A 1SXJB 3LWMA 1RHJB 4EO6A 3NMRA 4GKJJ 4M94A 3KUGA 1F0XA 1VQ1A 2UXDM 2BJ3A 2CEAA 2CPIA 2X1BA 2EEYA 4JN6A 3V6DB 4K7QA 4F4WA 1WG4A 1GMWD 4LF9J 3QJJA 2MTLA 2HGNA 1U1QA 2HS0A 2RHSB 1HNZJ 4WP3A 1JJHA 2LXUA 2BE2A 4BB9A 1IKWA 1KQKA 2GVZA 3M6XA 4KYZA 3C3EA 2HHSA 4PDGA 1NO1A 3HFZB 1K82A 2HURA 1KQFB 2C2DA 2KEBA 4UW2A 5E3AA 3FD9A 2B4OA 4M5DA 3J7ZT 4DR3M 2OEMA 1IY0A 3CPWR 1X4FA 7FD1A 5D4NA 2HLUA 1RT5B 2DWMA 3SARA 2EC2A 5E0OA 1E9RA 3O2IA 1W5TA 2F5QA 2V69A 3ZTPA 4CLKA 4A8MP 3FTEA 3GV7B 3HK2A 1F1BB 3QJPA 4D82A 3ITHB 5KTQA 1ZOTA 2VFSA 3M2VB 3RR7A 1GMVA 2IJNA 3HHWA 4Y0FA 7CATA 3I51A 4NLQA 3D0HE 3MURP 2Z2ZA 3LVVA 5K8NA 3U6QA 3RAQA 3DLKA 2RKIB 3FC9A 3E3XA 4ED6A 3QO9A 3GLFA 4KHPF 3TEGA 4EU0A 3T1YJ 2RAQA 2KT5A 3LPEA 3UD4P 1A9NB 4CLUA 4DG1A 5HP1B 3FMBA 4OIXA 2KW0A 4KRWA 3JSMA 4BDPA 3W61A 3AV0A 2XI3A 4B3OB 3MM6B 2K6BA 3TANA 5FTLA 4DCJB 1TK8A 4OV1A 2B3TB 5KFNA 3Q8GA 1RKIA 1T02A 1OTRA 2ZANA 3G71S 1FD8A 2NXJA 4CLLA 4A8OA 2MXYA 1ZZNA 2VC1A 1SXJD 4A8WA 1CG2A 1QTMA 4MK9A 1MMLA 4JI2J 2OTJS 2FGCA 3TX0A 4DS5A 1K3WA 3CCRS 1DZ5A 4DMZA 4N77A 2DAEA 3GPAA 2FC9A 4NPOA 2XO7A 5BR8F 2A18A 3B54A 3I55S 3M8RA 3PACA 4NWBA 1FVSA 4Q8FA 4ZN3A 2JY5A 3TWZA 3I5CA 3K5MA 3AXKA 3CF5Q 5DJBA 1BVSA 3PR5B 1RU3A 3DI6B 1I94F 1URNA 3G86A 4C8LA 5B0EA 1NK0A 1M1HA 8CATA 1S9EA 3TVZA 4DR4F 1H6UA 2KZSA 4TU7A 3SIPB 4ALZA 1WSVA 4RNAA 1C4AA 1OPIA 3SYLA 5FSWA 2LVAA 2UXBM 2XZTB 3AOAA 1KWMA 3KS8A 2R6FA 5DQHA 4B3RJ 4YB1P 1FERA 2R2TA 4QIVA 4A8QA 3GMGA 3RZAA 3VR1A 2C96A 1FDDA 5E3RA 1WHXA 1HQYE 3UJNA 4PYDA 1LOUA 1TTHB 3VDUA 1ZM3A 2A10A 1HNVB 3CMQA 4LF8M 2RDDA 2XSZA 3N6NA 2MZJA 1F9HA 4WYWA 4D81A 4OHWA 1FF2A 4K4UA 4NRUA 3PW0A 3FRZA 3ZZOA 1V92A 3FEYB 1WKJA 3W66A 1N54B 3PJWA 1XERA 4JOUA 4Y28F 1Y10A 2CNLB 4P16A 2BE2B 1IKWB 1S7HA 2YWKA 1MG7A 2HFZA 1LWFA 2GVZB 1F60B 2X7IA 1A0OB 2VQFF 4X64M 3D1HA 2DPJA 2E7VA 1RTHA 3BSOA 2DR7A 1XJWB 3VAGA 2MR9A 3PW4A 1RYSA 3G2XA 1NJIT 1NDKA 1B70B 5A2QS 4IOCQ 4M5DB 1QAIA 4AYBD 4DZ6A 1HI8A 2YKAA 4HT5A 2DNMA 1NV9A 3HJQA 1H7XA 2PDAA 3HVRA 1JR3E 1FRMA 2E5LJ 4O4GB 2OQ4A 2M8HA 2AJ1A 3MOJB 3BQ2A 1U48A 3KP0E 2L41A 1FNXH 2HHVA 4LF4M 1HYSA 4DR6M 2VG6A 2CFOA 1FRKA 3CJ4A 1F5CA 3VVTA 2Z4SA 1EARA 2GA7A 4Y6IA 2V9WA 1ZS6A 5FDLA 1R43A 2JVRA 4Y00A 3GRVA 2FZGB 3IR5B 3W9IA 1RXOB 4F1IA 3GJQB 2AJQA 2DNOA 2KFNA 2QC3A 3IAM9 2ZHBA 1OY8A 3QO9B 3I82A 1QVGR 2PI4A 2C2NA 3Q23A 4DFJA 3AJDA 1UW9A 2WCXA 3BF4A 2BJ9A 4Y28C 2ABYA 1M1GA 3L9ZA 2ZZNA 3H2UB 4DV1J 5GAHI 4DG1B 3GG1A 1EX8A 3M6UA 1IN8A 2C3YA 3QT5A 3M6AA 3JSMB 4DUTA 3GLJA 3NS7B 1Y0HA 1BWVA 3JQJA 2ZWPA 3LVWA 4U95A 1FDAA 2C2RA 2VDBB 4YP3A 1G4AE 5KFRA 4P71A 2ZITA 1OO0B 5HANA 2R7UA 2FHMA 3H90A 4XO0A 5CYMA 1D8YA 2M3DA 1NK8A 3NNCA 2VPYB 1CC8A 1HHTP 1RWUA 2ZH7A 1R8AA 1HPZA 2ZM6M 4PEOA 2WW8A 4AG5A 2DRAA 1N34M 1MNEA 5L1JA 1RTIA 3GR1A 4KGMA 2MGZA 2PEBA 4LF7J 2QO3A 1RBAA 3PFIA 1TR8A 1AUDA 4PG5A 2ZVSA 2RD5C 4IOAQ 3UK6A 1N34F 1IY1A 5F9LA 4C9DA 3QRQA 2HRYA 1DGHA 2YQZA 1WHYA 3GFZA 4FWGA 1QVFR 3GJTB 1X31C 1P3QQ 3U6LA 2HHHM 3IAS9 1PRBA 1S4FA 3K57A 3HKPA 4LF5J 2ZAMA 1S10A 2XWYA 3M6VA 2DHRA 4NOOB 1LNQA 1Z1ZA 2JUJA 5IT9U 5J2MA 4C8NA 1WHCA 1X4BA 4XPEA 3AHPA 1HWKA 5DLGA 5RUBA 4ZDNA 5KFCA 1QANA 1NKBA 2WAQD 4OYMA 1S9EB 4RNFA 2RHQB 4ER8A 3P5BP 1BQMA 4AE5A 4HH1A 1SJRA 2LU2A 2LVQD 3D6FB 1APSA 1VJWA 3MZIA 5ETMA 1UETA 3HKZD 1HMVA 3C3DA 3QATA 4HI1A 2VQEJ 3T19A 4I4BA 2Z8YM 1W26A 3Q89A 1U6BA 1A7GE 2A6OA 2H1YA 1VQNS 2HQIA 1N5SA 3HY5A 2ACMA 1Q0NA 1FA0A 1MSWD 2CDQA 3BBBA 2PA8D 3IC1A 1FRXA 3V4IB 4F4AA 1XXHA 1E9SA 4O44A 3CB4A 3JAMS 3QNWB 1TKTA 2BZ2A 8RUCA 3VZIA 4HYKA 3EM1A 2CNNB 1FTRA 5JXSA 1VJQA 2DVWB 4U96A 1YX2A 2O5DA 2XYHB 5A8KA 2MLZA 4ED2A 1XMOM 3PYDA 1LWFB 2EFOA 2QGFB 3CMES 3KDNA 4Y2IA 1YRXA 1RTHB 4CWBA 3DLHA 2IHR1 4X4RA 2N3OA 2DGVA 3SV3A 2B4VA 4GHAA 3A98B 4I6AA 4ZPXA 5GAGU 2KYXA 1AA1B 4J9VA 3D3BJ 1IBLF 3R1LA 1B3TA 2J9DE 5KFWA 2VH7A 2CPXA 4R0JA 4WJBA 2OGUA 4DLEA 1GL7A 2EG2A 2R7TA 4LJ7A 3IS9B 1D3WA 2JY6B 1CJUA 4A8KA 1L3SA 4DX8H 1HYSB 2VG6B 1SL2A 4X2BA 4AFFA 3E4RA 1EB0A 1FRIA 3UPFA 1BQNB 3FYDA 1BXNA 2YY3A 1AIPC 3SDEB 2RE1A 3CCTA 5FDLB 4UUXA 4QHSA 1XC8A 3GPYA 2ZFHA 4F67A 4OI2A 2IC3A 4OJ1A 4ZLNA 4JI1M 3RAXA 1VDDA 3IWXA 2UXCJ 3I32A 2LFVA 2AJ0A 2KB2A 5AXLA 1V3SA 3PVXA 1AXQA 4F3OA 2M60A 4JI1F 3QSYB 3C6TA 1ICEB 5J1EA 2GS8A 5I3UA 4OHVA 1N52B 3KJFB 3HGIA 5FLXY 4ZHRA 2E5HA 3GLHE 3GONA 4F2SA 3KLGA 4Q2LA 2OPFA 2DNRA 3PR4A 2IVMA 3BO2A 1SH0A 2GMHA 4W98A 3AOEC 3OTOM 5E41A 1QLNA 1S79A 3CJTA 5CYMB 2R8JA 3FVYA 4DLGA 4TQSA 4DI6A 3AKZA 3DZDA 4ANDA 1HPZB 4ZOSA 1X4HA 1N5TA 1U4BA 4EBEA 3OTOF 3WDOA 4IUFA 4C2MA 2MGZB 2E1PA 5DG7A 4U7CA 5IWAM 1QE1A 2LXIA 4DR7F 3P45B 2PD1A 2XSZD 1VS3A 2WOMA 4USTA 1S49A 2GC8A 2QYGA 3J80Y 2FZKB 3D6HB 9RUBA 4EO8A 4WIIA 1MN3A 5ITYA 3BH6B 3P5TL 2Q6CA 3BJYA 3RRKA 3DRRA 1QZEA 2GMJA 5K8OA 4QU6A 1BWEA 4B7HA 1NK4A 1KSFX 3VAJA 1B64A 4M95A 3CWJA 5HROA 3AAWB 2RILA 2CE7A 1Y11A 1IVZA 2HNYA 3T9NA 3HHKA 3RJMB 3LALA 2YNFA 3IHPA 3N4WA 2W2QP 3G6XA 3T1HJ 2BNKA 2ROGA 4ZLLA 2VONA 4BCAA 4ELTA 3OSNA 4Z7CA 2QMWA 1BQMB 3JTPA 4IBJA 3PEHA 3O3LA 1XR5A 4CO5A 3FRIA 2V5HG 1TFWA 1NNUC 3MCOA 1EQ0A 1E32A 3MJ5A 2JEFA 2FY1A 1HMVB 1KONA 4LJ4A 4NCGA 2V4QA 5EN1A 3THPA 3TA1A 4F26A 2A0FB 2YWFA 3K5LA 3BR8A 3GLIA 3EJMA 2B9EA 2VFVA 3FQKA 3I0RA 3IRWP 1S57A 2G2ZA 2P9CA 1Z2ZA 1XXHB 1RADB 4IBKA 3GYGA 3T38A 2MSTA 4O44B 3O44A 4NRWA 1TKTB 2CJYB 2LHGA 1FXRA 2ASJA 4AQYJ 2P8IA 3FUXA 2Q2EB 1EE8A 2JY7A 1ZMWA 3B6BA 1F2HA 1RT6B 2DT9A 5A8KB 3UN5A 2RGHA 2HKEA 4MYTA 1Y7PA 1HWLA 4HHHA 3CE8A 3R5GA 4DV7J 3FQLA 5ETPA 4MGKE 2FQQB 1URRA 4OX9M 1HQCA 3FJ2A 2MZRA 3KHGA 1PYTA 1Q79A 3ELHA 2QMXA 3ZZRA 4B3TJ 2MKYA 3AJIB 4DBQA 1WI8A 2ZE2A 4OU7A 3T5HA 3QGPA 2JLGA 5GKNA 1L8QA 3L27A 3TZZA 5KFPA 2BM0A 1AUSL 1CJUB 1Y3JA 4I5SA 2YXLA 1FX4A 3OJSA 5E6JA 4B9SA 2HIQA 2OFHX 4ZCLA 5GAHU 5C24A 4PZVA 1E6VA 2HBYB 4I67A 1JXEA 3HO1A 4NLPA 4X4TA 1B0VA 2R9LA 2IRYA 3QFHA 3OFHA 4U9RA 4QR0A 1VLOA 4UQGA 2PMWA 1IY2A 2O25A 3MK6A 3P49B 2W2PP 3FKBA 4X84A 4JI7F 5AE3A 4USKA 2UU9J 3DYAB 5IT9Y 5J1EB 4FPRA 3K9PA 2CQ3A 4MIBA 2F4VF 4PWDA 3CMAS 4RKUF 2OPSA 5J2PA 4DFPA 5K14A 4ZHRB 3R5CA 3THGA 3KLGB 2BA9A 1Y3KA 2HPUA 1YUBA 1BD6A 1Z5BA 3JR5A 2C3OA 1SXJE 1T3TA 2AEJA 2G3QA 5JJBA 4GKKJ 2KM8C 1EP4A 5AXKA 1SJFA 4WP8A 3QFWA 2HQFA 1N32M 2AEMA 2R42A 2ZOGA 1U24A 4D3HA 3D8LA 3HHLA 3A1YG 4CI0B 1EIJA 1TL5A 5F8JA 1TL3B 2EKKA 2WOMB 3PRBA 4KAIA 2I2YA 2DNQA 3HXMA 4LR9A 5F3ZA 2VOOA 3S8SA 4ZCIA 3DRRB 1NPPA 4OJGA 3TE6A 4NZ6A 2CJAA 4IG0B 1VFJA 3HSZA 3EUNA 4IOBA 1FKPA 1YSYA 4YUDA 1KBRA 3I5BA 2DY9A 4RW4B 3HWSA 2J8SA 3KLFA 2QLXA 2HNYB 4JI8F 4ZVFA 2RB7A 3Q8PB 2YNFB 2F5PA 3WZ0A 1HA1A 3EX7B 1HT2E 3KJNB 2V67A 1IKVA 4ED3A 2AYGA 4DFMA 1XTZA 1N0UA 4F25A 1HJPA 4N7TA 4F0MA 4Y3CA 1PG5B 3ILLA 2W4DA 2IJFA 1UPPA 4NCGB 3H2VE 1N78A 2VB6A 4I64A 1FT8A 1HR0J 3AOCA 4X66M 4RBVA 4NYPA 1VEKA 4GVBA 4DS4A 3RW6A 4JI0J 3GLIB 2WSFF 1KP6A 1D0KA 3I0RB 3R8YA 2WHOA 1B4SA 3UDEA 4GVLA 4X62J 4X66F 1J27A 1IN6A 3UR3C 4X4OA 1V33A 4ZVEA 2AQ4A 4F0KA 3F56A 2QSFA 3OPKA 1M90T 2V2ZA 4IJFA 2E1RA 2Z2YB 3PO5A 2Z4RA 4EUVA 4RNNA 3GO8A 1JLAA 1NDPA 1T9VA 4L75A 2W9CB 4CIOA 1KVIA 4RU2A 4NXNM 2D9PA 3QT8A 2XEXA 3C2PA 5DZ7A 1L1ZA 4LMZA 4N41A 3P96A 1LW2A 2XFSA 3HU3A 5LXRA 3D2WA 3VCDA 1QAMA 4RL1A 3RBZA 4FF1A 1W25A 2GHPA 2O01F 2YNIA 3PVSA 4YMEA 1WF1A 2ZE2B 4MIAA
chains in the Genus database with same CATH topology
2ILYA 1TKZA 3H98A 3LP1A 3M4XA 1UL3A 3DYAA 3QPIA 3L2AA 1E94E 1XR6A 4KQZA 4JI3F 5IZHA 4H4KC 1FRLA 4FW9A 3KJVB 3UCUP 2YH1A 3OXFA 3TWLA 2P5VA 3J7AS 4IRDA 5L9XA 5LMUF 2J7KA 1L5UA 5BR8M 5DGAA 1TUVA 2LMIA 1R27B 4K4SA 3MM5A 1O8BA 2F8EX 3U6CA 3D8BA 2PE8A 4WFZA 1PJJA 1S48A 3FNNA 4AL5A 1Z5AA 2VL1A 4MB7A 4A8YA 1S6OA 4Z8XA 1L1TA 1V3ZA 4MKYA 4IBEA 3LP2A 4K4XA 1DO2A 4FXDA 2DGSA 1H7WA 1KEKA 4DR2F 1FJEB 2R8IA 2Q1LA 1Y9OA 2R7SA 3KLEA 1Q53A 3BGFA 1SXJA 3VAHA 3H40A 5C24B 3CCLS 1UEVA 4IQMA 3NNAA 2Z3XA 3MWBA 4L6V3 4ZPTR 5D6GA 1JLQB 4J5OA 3CC7S 5F3WA 1NB7A 2M7SA 3L7PA 4NSRA 1OSCA 5F41A 4Q5VA 2DHAA 3FUWA 4LJ8A 2FLPA 1S0VA 4K50A 4IIWA 4OI3A 1I94M 3NBPA 2HWTA 4II7A 2WSFC 4NL5A 4ZMMA 2HHWA 1F5AA 4LFCM 1C0TB 4DV5M 3DRSA 3B82A 5SZTA 4DR4M 1H2VZ 4IG3A 1S76D 4AKGA 4A46A 2O66A 3MEGA 3V6DA 4YY3M 2GCFA 2DR8A 3D5MA 5KPRA 3N5FA 3UZUA 4Q2MA 3S01A 3R27A 4KC5A 2MJNA 5F8GA 1G41A 4EEYA 1Y5IB 1GT8A 1X7VA 2JFKA 4OLPA 3HHDA 4LZJA 3N6MA 3DRYA 1TL3A 3KLHA 2HHUA 2M2BA 1G7CB 3PFEA 1N5YA 1NO8A 1XNRF 2ZJQQ 1S6PB 1JLCB 4HLBA 5LL6d 2ZH2A 2YX7A 2LEAA 1YBAA 3C66A 3D1OA 4QWEA 1ZETA 2UVWA 2QLWA 3DU6A 5CH7B 2XSJB 4C0HA 2YX1A 1JJ4A 1REVA 2CQPA 2KHDA 2ACYA 4HL9A 3OLBA 3DLLQ 4LQ9A 5KT7A 2F1FA 3CTWB 1GNKA 5IWAF 3DOKA 1ZYQA 1Q86T 4DSKA 2EO2A 2V9KA 2XZFA 2XMVA 1S0MA 5J1PA 2XMWA 1RYRA 4KFBA 2AP6A 4IBCA 3QGHA 4F4KA 3P6YC 2YKOA 3M6WA 3LQQA 4NLWA 3AQOA 5F8LA 1LW0B 4PWDB 4QIFA 3M0EA 2DNNA 3MFHA 4RWWA 2VBZA 5DGBA 3M9NB 5KFIA 2OPSB 5AE2A 1YE9A 2BABA 3JTNA 5J2PB 4ECVA 2ZD1B 3MHYA 1MWZA 1PILA 5K14B 2Y1RI 3H8YA 4FCTA 2R4EA 2BRKA 4TXSA 5KOWA 5KFZA 3MMBA 2U2FA 4RW7B 1R89A 4IBIA 3MD3A 3MECB 1WNEA 4IG0A 5HO4A 3KK1A 4TYAA 3NNHA 4NSOB 1R2ZA 2IM1A 1XK8A 1QSYA 4RW6A 2HGMA 3WHKA 3GQCA 5ITRA 2VIIA 3L09A 4RW4A 4OZLA 1JLEA 2BDPA 1R31A 1OQ6A 1KSPA 2XCPA 4WKRA 3MF5A 3EIEA 3FSYA 2VV5A 5B09A 5T7LA 4WFYA 1ZQ9A 1EP4B 1MWYA 2NSCA 3OTDA 3JB9k 3G8SA 5IQ6A 3KSXA 3KYLA 2DXIA 5KG4A 1WEXA 3ZZZA 2HS3A 2LXEA 1TK0A 3LWLA 2HLTA 2FJWA 1RTDB 1KTVA 1UJ5A 4DDFA 1ZM2A 3ISND 3U6MA 2ERRA 4M1KA 1TL1B 2CYYA 2RNEA 4MTPA 5ITTA 3CJ5A 2JEGA 4L15A 3VWSA 5F3TA 2DH8A 2X1GA 3THVA 3J7A1 3HHLB 2IFXA 4F3QA 2JHEA 3ICLA 1FE4A 3QZ8A 2VQFM 4I2PA 4FXVA 3G6YA 2BR0A 4TUWA 3RBDA 2QEXS 1GXLA 1XNQF 3HHZA 3FCHA 2JFDA 4CT9A 3TAMA 2MSSA 3CDAA 2GIRA 4OL8A 1V9OA 2C2EA 3OSPA 3ITHA 3J7Z5 3CJ2A 3M2VA 5DDQC 1B7FA 2XLIA 4C98A 3CULA 2LDIA 2POKA 3C46A 3A46A 1HBUA 1U8S