2XLJA

Crystal structure of the csy4-crrna complex, hexagonal form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
178
Chain Sequence
TMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDEEEARKRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 31
structure length 178
sequence length 188
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.890 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xljA02
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xljA01
4AL7A 4AL5A 2XLKA 4AL6A 2XLJA 2XLIA
chains in the Genus database with same CATH superfamily
3MR5A 3DOKB 3ENWA 5HMWA 2AW0A 3F56A 2HHHF 5J2QB 4QIGA 1HNIB 3OFFA 4Q8EA 4LFCF 1HT2E 1Q8BA 3RGIA 2W2QP 2JY6B 1RT5B 1SJFA 2FJBB 3R3TA 3AOAA 1WG4A 3H4JA 4MB7A 2Y1JA 3A8IA 1OIZA 2C3OA 2GGPB 5JUMA 3MPWA 4U95A 2CUZA 4YDXA 2B8QA 2EFNA 4DL2A 4MK7A 1NH8A 3D4JA 3MK6A 2BA9A 3G6YA 1Z4UA 4PPZA 1RT4B 3MECA 2E66A 1IR2A 1R2ZA 3I96A 4FWDA 1GK8A 2AZ1A 3CEDA 2K2PA 4O0IA 2ZH7A 2FVSA 4RKUC 3DN9A 3UW1A 4KIAA 1Q3CA 2F5PA 2MQNA 3T1AA 3MAHA 3PM9A 5KAKA 5HLFB 5B0FA 2FLPA 2LXUA 5ETRA 2CKWA 4P2XA 3JS9A 4ILRA 3PX4A 3QJPA 2YWKA 2VKRA 4OJHA 4Y65A 5KFRA 4LF7F 4L15A 2HNDB 4DV3F 3TWZA 1YSJA 3AJ1A 4WPAA 3G6VA 3PDNA 2YKQA 2JC1A 1UEKA 3X1LB 1NU4A 2F1FA 4GVLA 1TL3B 4DR7J 3C3DA 2IDLA 1SB6A 4A8YA 3IG1A 1WHYA 4ECVA 4RW4B 2WCXA 3M32A 3ITHA 4X84A 2CFOA 2ZAMA 4C48A 4DX5A 3R5GA 3M6WA 4DXLA 4RLEA 2I38A 2KL8A 2GO8A 4ZVRB 1R3NA 2MJ5B 3B6BA 5ITQA 4NX9A 2OOBA 3AJ2A 1N88A 2HHHJ 4N7TA 4LFCJ 2YY3A 4KC5A 3RW7A 1VIXA 1ULRA 2BM1A 3IP0A 1D0MA 3M8QB 5LXYA 2CHGA 3BGFA 1WEZA 2LEBA 2F4VF 4CHTB 3MWBA 4AD6A 1KDNA 2ZTDA 4LF9F 3NXZA 4CJ6A 3UO0A 4AW4A 1XWLA 3UDEA 2VG6A 4N56A 4MFBB 2BMBA 2KKHA 4B9LA 4DCJB 3SDEB 3TJAA 3CW2C 2O25A 1NK8A 5F3TA 2M52A 3MTKA 4MYUA 4RBTA 4WE1A 4EO6A 3L28A 1FVQA 2BJ8A 4QBUA 2NR0A 4FN5A 4RW8B 3RRHA 1UPMB 4NL4H 3KK1A 5F0UA 2KNVA 3MFIA 1EETB 2JZ0A 1C0TB 2XZDB 1UL3A 2QFIA 1AA1B 2FHJD 1I3OB 2AEJA 1KSPA 4NEZA 3Q8SB 1R5LA 3EMTA 3OL6A 3RB0A 2KHDA 3QGHA 3CMAS 4LF7J 3CCQS 3PYFA 3GFYA 4DV3J 1V33A 2VIIA 4PQUB 1VR6A 3L09A 4CH0S 4DQSA 1BLUA 5IC6B 3D3CJ 2CHQA 2GO9A 4WIQA 1AT1B 5CA5A 2FLNA 4G4RA 2QSFX 2R7XA 1DTTA 4X64M 1FNMA 2FOIC 5KG1A 2G2OA 1XERA 2XEXA 2V63A 3I0SB 2M8DB 1IUJA 4WK1A 4K0KM 3ADAC 3MHVC 4I69A 5CAAA 2FZGB 3B82A 3MEDA 2WZ1A 3HDSA 1C0UA 3C6UA 2CPHA 3TAMA 2GHPA 4RW6B 2DR9A 4DMZA 3CCWA 5DDRC 4B3MF 4ZLJA 3ILKA 3U6QA 2DNKA 2F4VJ 3FUXA 5H9EK 4ED1A 4LF9J 4WF9Q 4RR5A 4QWDA 2WSCC 4EZ9A 2E5LM 1IJFB 2N82B 3HFZB 4NYPA 1EX8A 2D3ZA 3GCWP 1HMVA 4W92B 5HBMB 1XC8A 2Z2MA 3DXBA 3SCJE 2Y1IA 1IXRC 3GV5B 1QD1A 3QWUA 3QT7A 4PG5A 4G1IA 2J6SA 4I2QA 2XNQA 2ZKUA 4M1KA 3JQMA 5L46A 2OPSA 1HNXM 3CJ4A 1JLFB 3R2DJ 4A8QA 5DNYA 3KVWA 3FKEA 4OI6A 4BS2A 3CJKB 4DLGA 2V69A 2FPHX 2IRXA 4DSKA 4F4AA 2DJWA 4TU9A 2ZVIA 2NXNA 3DLLQ 2K7KA 7FD1A 4TU7A 3W67A 4ZPAA 4M94A 4O4GB 4UUXA 5J2NB 1U1KA 2W4DA 1DGHB 5CYJA 1RP5A 2V2VA 4U8VA 2W7PA 1U09A 4DR4M 2QLBB 1X4CA 2CPJA 2RNEA 4ZN3A 1XXHB 4ED2A 1UVLA 3MAAA 5KPZA 1CJTA 1JJHA 4IJEA 4L6V6 4IRDA 4I6WA 1JR3E 1RAOA 2H1YA 3Q24A 1RYRA 2IVMA 1L3UA 2H9ZA 2KRRA 4KT0F 3DRSA 3R97A 3VAKA 4WFZA 2YNHA 3LVWA 3IM8A 1W2BR 1G41A 2D41A 4KY3A 4C9DA 1RTJB 4FPIA 4B3MJ 4KFBB 4UZCA 3CCTA 1T8EA 4MIWA 8RUCA 3H5SA 1TP7A 3B89A 3M8ZA 4DR3F 2DT9A 2P2CB 4JI2M 2OJ3A 2F9DA 2IFXA 2YWFA 4FS1A 4KHPF 3FBEA 3RGSA 2HRTA 3KFUG 1PSDA 3D0HE 5B0EA 2KO1A 4WP2A 2OPRA 1RT2A 1KS2A 2F5QA 2E1MC 1QY7A 3L25A 3DU5A 3GRVA 3OT9A 2ZAOA 2RS2A 3HHLC 2G1DA 3FRIA 1V92A 3V5RA 1NB2A 3NGDA 4EO8A 1NMEB 1YX2A 1SBRA 3NS6A 1TK8A 2LVPC 3ETMA 1T0TV 1SH2A 1TR8A 4LJ9A 5CHCB 4M0WA 2VFSA 4DEZA 4IDKB 3IHPA 4OYMA 2XSJB 4HLBA 5KG4A 3W0FA 2GVZA 2AHMA 3K9PA 4DR1M 2XZWA 2J0WA 2DAKA 4LT6A 2YKNA 1TL1A 4U96A 2H4YB 3MEEB 4IFVB 4ZVPB 1XIQA 3QIPB 3US5A 4ZMMA 4OX9M 3BGOP 3WX4A 4KLNA 2R7UA 3HHNB 5E0OA 4DZ6A 4B3OB 2UXCF 2ZBQA 1KKHA 3M8RA 4Z37A 5DETA 2FDNA 3RAQA 1V9OA 3U5ZA 3EIHA 3UR0A 4R0JA 4ELVA 3UD3P 4N41A 2G13A 2NPIA 4C8NA 5DQHA 2CQHA 5K8OA 2R45A 1TR0A 4C3MA 1RHRB 3DOLB 2W8KA 3R7SB 4WFBQ 5IS2A 2NYHA 4ZDNA 5MLCV 2VG7B 4EYIB 2M70A 4DR3J 2LU2A 2V4QA 1MMNA 1RWOB 3HVTB 3OUYB 4FZVA 3A3OB 2QL5B 4KHPJ 5ITYA 5DG9A 3M6XA 5FJ4A 4IKAA 4ILLA 1NXIA 4DS4A 3HHLB 1NY5A 3TAQA 5HMYA 1YWXA 2WK4A 3SEOA 3QAEA 1IBKM 2MZSA 2ZUAA 3IMQJ 4X62M 4DSIA 5ETMA 2Z4SA 2JLFA 1S48A 3V6DA 5FSWA 1JLQA 2KH9A 4ALZA 1S0MA 3M6UA 5IT9U 5EWEA 2DITA 1XMBA 3KG4A 4C11A 1WF2A 1Y7PA 5KFVA 4DS5A 3BGLA 3FK4A 4G3IA 3CXCR 2AYBA 2HPUA 1ZA2B 4IYQA 3GRRA 3JAMU 4RNMA 2UUTA 3SI8A 1FK9A 4ZVTB 5KFOA 5FDLB 2VJUA 1JLBA 1YITS 4PEOA 5ITRA 5DGBA 4QYRA 4NLQA 3V6JA 5C24A 3ILLA 3NOCA 1W2IA 3QQCD 1F0XA 1ZTWA 5G0RA 4RW7A 3TJ8A 4GVBB 2LXFA 2UXCJ 5DYGA 2DH9A 2WBMA 2QIFA 3B78A 3IECA 5IWAM 2C42A 2XEPA 3D1HA 5DZ6A 5GADU 3T1HF 2ZHOA 1BQNB 1DBDA 4TY8A 3DLKA 1F9EB 1TKXB 3GILA 1U8SA 3TRGA 2W24A 5EUHA 4HYKA 2KDOA 3DLGB 1FRIA 1RWXB 3I31A 2QFJA 4IBEA 3NBIA 3GTYX 4WKRA 3H90A 2AJ4A 3UFCX 4DU8A 3KLGB 5KT7A 4DR7M 2C2EA 2QO3A 4CNYA 1PGZA 1HWKA 1TH2A 4HL9A 5BXIA 3O3LA 2ZH9A 1N56A 4LF2A 5KOXA 4XK8F 2PD1A 2D74B 3Q8PB 1FRMA 3EXYA 4J9RA 3VGVA 1T3NA 5EJCA 3CDAA 4D3HA 3M2VB 2JVOA 4FP9A 3GG0A 5L1KA 3B7ZA 2HHHM 2F7VA 5KPRA 4LZJA 3I55S 1FXRA 3HJSA 2ASDA 4WYWA 1LWFB 2OO9A 3KOZE 1FWPA 3GFHA 3W8PA 2B9EA 3SBJA 1S7IA 3HSJA 3M1VB 2QA4S 3CD0A 1P3QQ 1IN8A 3L29A 4DBQA 1DO0A 1BD6A 2B5JA 3EX7B 5J2MA 2AJ2A 1BWEA 1HHSA 3QFWA 2LTUA 1HD1A 2CPXA 4MKYA 4RW9B 4KGXB 4GC9A 5FTKA 3V81B 2BRLA 2XGPA 3IS9B 4YFUA 1KQKA 3Q8GA 3ZZOA 1SIZA 5LXRA 2MB0B 3PIPQ 1WOPA 4EZ6A 1N75A 2QZ4A 4ZPVR 3HD1A 3T1HJ 2FZCB 1QAMA 3CCES 4NI2A 1ZOTA 4AKHA 2XMMA 3U6MA 3N9UC 4LF7M 2QL9B 3D8LA 1H98A 2Q6BA 3MMAB 1N77A 2G0CA 2WTFA 2E1PA 3IWXA 5JI2E 1HBNA 3M8PA 1S5ZA 1OAIA 1MROA 3G8QA 1MNEA 3M05A 1R8CA 5I3UA 1RCXB 1KFVA 3L7OA 4B9NA 4KAIA 1WEYA 3WQPA 2NZCA 1NM2A 2RU3A 2VBXA 4PXEA 2XMWA 1KVJA 3HJQA 2V34A 1T9VA 1WHCA 2XS5A 1D8YA 1S77D 3DYAA 3M6VA 5KFIA 4F4YA 2YNGA 1JJ2R 3QLHB 2F4VM 1BE4A 1GTHA 2ABYA 2CE7A 4OI1A 4LF9M 1MN3A 4YB6A 5KO3A 4ELTA 3DLBA 2R9LA 4QYZK 1VRTA 2MXYA 3OSNA 3FRZA 1HYSB 4LBHA 4ED4A 1B0TA 1M5PC 1K47A 1FRKA 1F2HA 3I5BA 2DH7A 5F8GA 1TK5A 2OOAA 2VBYA 5IV3A 2ZC4A 1FWLA 2EFGA 3R7BB 2CPEA 4IFYA 2K3IA 2KVIA 1MU2B 1TL7B 3TJ9A 2ZJPQ 2FHOB 1S1VB 3QRRA 2H51B 5IZ7D 3H59A 3AFHA 3SV3A 2GA7A 3IWLA 1XQIA 2NXJA 3KLEB 2DHYA 1Y3JA 3P5BP 2J7NA 2CYYA 3IG5A 4RUBA 5L1JA 4DG1A 4A4JA 3MJ5A 1KQSR 2OFHX 1ZTTA 4X4UA 5F8IA 3MTJA 3LCVB 3RAMA 3HHXA 4ZOSA 1R8PA 2JSXA 3UVJA 4OLPA 2XHCA 1DGFA 1KRPA 4EUVA 4DFMA 4KRWA 2BDPA 4JUZA 2A1BA 2VDBB 2K1RB 2Q66A 4GC7A 3GLGE 1RBAA 4B3MM 1D0LA 3NEKA 1N4LA 3HY5A 4NYZA 1N0VC 4CTAA 3CGWA 1AUSL 2ZJRQ 4J9OA 1EB0A 3ULHA 3SQGA 3H4MA 1VDLA 2N7CA 1H7WA 1FDAA 4W90B 3TI0A 4TQSA 3LCUA 1T3TA 3VALA 5LSRA 2WSFF 1FKPA 2V94A 2W25A 1SV5A 4IH7A 3H25A 1FJGF 2V4RA 3CUNA 1G4AE 1TFWA 3AJDA 3ET6B 2MQPA 3SARA 3DA1A 5KOWA 3QZ7A 3J80Y 4J9VA 2RDIA 1K0TA 3KSJA 3U02A 1I94F 1TH4A 1UCNA 1TKTA 3I0RA 3ZTRA 4GO7X 3JQJA 2NPFA 4CNZA 3RR8A 3MPYA 3E3XA 4Y0FA 4OI4A 5A6PA 2XSZD 3SQOP 1U2CA 4LZZA 2DNGA 2OH2A 1RT1B 1GXUA 3RJMB 4ED8A 2MZJA 2W01A 1A6LA 2KYZA 1MSWD 2DENA 2KNZA 5B0DA 3R9LA 1U0SA 1NJIT 4Q2LA 1HBMB 3ILOA 3BGRB 1OMSA 4JI6M 4ECWA 4MH8A 4OVZA 2KZUA 3GV8B 4USTA 5C18A 2D3UA 1ACMB 1PAUB 2DR5A 2F8HA 4Y28F 2LA4A 5E3QA 3TQSA 3DGVA 3J7A1 4OI3A 4TVAB 2RIJA 3HHLD 1JLCB 4NLTA 3DOMB 3GLFB 2EBGA 1ZAXA 4B7FA 3Q89A 5L8RC 2EW9A 3X3UA 2JY7A 1C1CA 3PRVA 4Y28C 2XZUA 3SYKA 4DR6M 4DR3M 1RTIB 2NSBA 2FVPA 1WKLA 1KN6A 3V4IA 4YB5A 1JWWA 4KHPM 1T02A 1RTDB 1T9TA 3KJVB 1M0SA 2YWWA 1NSPA 2F8EX 4YR2A 5A0YB 3RZAA 1AZSB 2D7EA 4G65A 3M9MB 3B4MA 1FJGJ 1LW0B 3N6MA 4Y2MA 1XNRF 3BV8A 1O0PA 2GMHA 2OTJS 5K5MA 1C1BB 2UUAM 3OTBA 4MIAA 2HHPA 2HQFA 4AUKA 3SATA 5KFAA 4DV7F 1I94J 5H9EJ 3DM2B 4WP3A 1VBZA 4K5RA 4ZN1A 3U6SA 5KT5A 3J27B 3FTFA 4M9SA 5HVHA 5F41A 4HI1A 3SSSA 1QUSA 3H7HB 2DRAA 4H4MB 3I4PA 2VONA 1RB0A 3GWCA 4RNNA 4YHHF 1DLOB 1GAOA 4WFNQ 3SC3A 2E1RA 3LAKA 4MGKE 1H3DA 4CGYB 4K4YA 1X5PA 3GCXP 2OHDA 2V67A 4XPCA 2ZH2A 5KFQA 5KFCA 3TUZC 1GMWA 1R27B 1X0FA 1PJ5A 2MZ1A 2PT0A 4R5PB 1AUAA 1EARA 4WFAQ 4Y00A 1RXOB 3S7RA 1R4GA 1QLNA 2RT3A 2JLGA 4ECYA 1J09A 1Y5LB 2O3DA 4IBFA 2HL7A 5ITTA 1VRUA 3W61A 3I87A 2UVVA 1YI2S 1NSKL 2JOQA 3W5YA 4M5KA 2O67A 3ONQA 3VK7A 3BF4A 3I4HX 2V8HA 2FGOA 5GAHI 3V4MA 3ELHA 3CF5Q 4C8ZA 3EZ5A 3PRBA 3M8YA 4ZLNA 1XNRJ 1GNKA 5KFNA 1IQZA 4M5NA 4YOEA 5DRKA 2IA6A 1U24A 5D6GA 2IC3B 1WR1B 4NSOB 4DV7J 4IQXA 4YEAA 3D6TB 3C9PA 2DAMA 2C2OB 2R2SA 2VASA 1PYSB 3ENVA 3WIVA 3D6MB 3W64A 5CYQA 1UW9A 5KFGA 1N6QA 3AV0A 4DN0A 1K8AT 2P5VA 4R8UA 3DRPB 3HZGA 4QW8A 4YHHJ 1EZZB 5JXSA 3H98A 2CWXA 4ZITA 4KO0B 2HHQA 3EIEA 1S1UA 2DNRA 2L09A 5LT5A 4FD2A 2BANB 2BQUA 4PQAA 2D3O1 3LW5C 3A46A 3MEGA 5E26A 2CUYA 4LF4F 1FA0A 2ZE2B 4HACA 2XLJA 3G6XA 3V6HA 2I2YA 3RBXA 2M5ZA 4R0EA 1MJGM 2FGCA 2PSZA 1WI6A 4IOBA 2D1CA 4LRDA 4MTPA 3CF0A 4FBUA 5HL7Q 2JZ5A 3T1HM 4FPRA 1X4FA 3CPWR 2K0BX 2DCLA 1XTZA 2DR7A 4B7HA 4C8MA 2DXDA 3MM6B 2BQRA 3ZZUA 2OEJA 2QTWA 5DG8A 4CH1A 3NCQA 3KLFA 2E29A 5FLXU 4DF8A 3GFXA 3OTCA 4IR1A 2VODA 2FY8A 2C9CA 4ECXA 3NOGA 4QR1A 2HQ3A 4E8UA 5A2QY 1Q79A 2HWIA 3GQ5A 4ETZA 2ZDOA 1RISA 1CEZA 2KJVA 3KHGA 2FJVA 4I81A 1LWEA 2YNIA 3U61A 2QENA 2IAJA 2ASLA 4HEOA 1QDTA 4TN2A 1WHWA 2I5JA 5ETOA 4DPXA 2JNJA 3HPOA 4E2FB 1LNQA 3CJ0A 3Q8QB 1S4EA 3CTWB 4QIFA 3CF6E 3DMJB 2V6AA 2CPFA 1A5TA 1CULA 1RLCL 4G6ZA 1S1TA 1XJWB 1MU5A 2HFVA 1F4IA 4FKYA 2ALZA 2FHJA 3VZIA 3GLIA 2LEPA 1HWLA 1VQPS 3SAVA 2HQIA 4NZ0A 4LF4J 2BJ1A 4C8OA 4ZKAA 4QWAA 2H1RA 2Z2YB 4LREA 3K8WA 2DIUA 2B3TA 2H48B 1R7IA 2MKYA 1E94E 2V4JA 1KLNA 3GQCA 4D82A 3FUTA 3FC9A 2R8HA 2HBZB 2W82A 1VQMS 2OLWA 1FTCA 3KK3B 5IREB 4ZHRB 2GCFA 3B54A 1REGX 3MR7A 3OW2R 2MZTA 4KBIA 2IRYA 3MM5B 2PFFB 2HAKA 3NY0A 3VAFA 2AYGA 1RK8A 3K5OA 2KG1A 1IWGA 4QR2A 3MCMA 3CMES 4RBVA 1IXZA 2RILA 2HSEB 1S9EB 2IMOA 2QHOB 1RU3A 3L26A 4GKKF 1KQGB 4G4OA 2D3OR 1SUQA 1WJ7A 2DGUA 1DHMA 4LFBF 3HMJG 5AJ3F 1TAQA 3V2UC 3C6TB 2WSEF 4G3OA 3IRWP 4L73A 3HKZD 1WGLA 3TUIC 1X7VA 3CCMS 2CADA 3QO9A 4TU8A 3MF5A 1E6YA 5HSPA 4WBFA 2LXIA 2DAGA 3DI6A 1U2RA 2J0XA 4F2RA 4NLPA 4ZP8A 1BQXA 1T9XA 3K59A 3L27A 2HNZB 2GJIA 4O3QA 1QAJA 3IWNC 2WSEC 3VVUA 4CLUA 2BM0A 2A6MA 2I1RA 4OHXA 2RGHA 1XMOF 1JB0F 1XR7A 2EKNA 3D0GE 4LIWA 2P8IA 3NGSA 2EO2A 3FSIA 4BLCA 2X49A 2MSSA 4A8FA 3MUTP 1D9DA 3CC7S 4W98A 3OHAA 2EG2A 4OYZA 4P71A 3IRXA 2BKNA 5GVQA 4JYAM 5B0GA 2OQ4A 2RJZA 3NL0A 2O01C 3KDSE 3L3CA 4MGYE 2JWSA 4JI3F 2ADCA 3J7BA 3UK6A 1U8WA 1HW9A 4X4SA 3SAWA 3I32A 4OYWA 2WVDA 3AD7C 4F50A 5C2GA 4KO8A 5GMKa 5DDOC 3M2UA 1JXLA 4LRCA 3BOSA 4ZCLA 2V1UA 3BREA 4DL0C 2KM8B 2JP7A 4GKKJ 2PMWA 4M9XA 3B9PA 4ZPDA 1O8BA 4NMLA 1RWPB 4DV0F 2IVFB 2BKOA 4LFBJ 1HARA 2R3VA 5AJ3J 1YTYA 4OMFG 5HJYA 4L75A 1NK5A 2HFOA 3GYNA 2MHNA 5F9LA 4M5HA 2O66A 5EP4A 4C7QA 3MUVP 3RB4A 5IT4A 4WJBA 4ECUA 3IG8A 1CC8A 1FEEA 1MMLA 2XMAA 3KP0E 2MMYA 4XGIA 2OPPB 1WHXA 1U0HB 2W9AA 5FIIA 4C98A 3RTVA 1X9MA 4L74A 2R7RA 5K8PA 3W60A 3T1YF 4NCBA 2KG0A 1XMOJ 4B3SF 3PR4A 4ZPXA 1IKYA 3A1YG 4FWGA 3QSIA 2Z8YM 4HVZA 1IN4A 4L3NA 1FKAF 2ADBA 4NCAA 2ZM6F 1ZM9A 2JEFA 3W2VB 1BXNA 3LP0A 4X4OA 3HGIA 4JI3J 4I0WA 4IBCA 4HHUA 2JY8A 1TH3A 2N7YA 3IBWA 2V9WA 1IM6A 4KKOA 4O3NA 3G82B 1LXNA 1U6ZA 3DLHA 4LSLA 2C2MB 1M1KT 2HMIB 2OPFA 1LTMA 2J5YA 2VZ9A 1F9FA 1KOOA 3MPUB 2AIRB 5KG5A 2EKKA 3GQ3A 3W65A 3C15B 4DV0J 3DOKA 4J5OA 2N3LA 3NGTA 5J2QA 2B4UA 2WVCA 3FGVA 5HMXA 1WHVA 5BYRA 3LP2B 2HVHA 1N36J 4F3MA 2YKMB 2KYXA 4HI2A 4YB1P 3AOBA 1RT5A 3BBZA 1M5VC 4UOGA 2GGPA 4IG3A 1FHTA 1WKJA 3I56S 3KLIB 1RTHB 4ZVQB 3QT5A 5DZ7A 1RWKB 2YX4A 2HKEA 1JMTA 2O5DA 5HANA 3AA8A 4Z7CA 1NPRA 3ZZTA 1XNRM 3T1YJ 5K14B 4F0KA 4B3SJ 5IT9S 3TUPA 1S6UA 5HLFA 2CV1A 1P9QC 4V19J 2MKIA 4DV7M 1GMUA 4OJ3A 3SYLA 4B3TF 4M8LA 2ZM6J 3MMJA 1GKIA 1VMBA 1D0KA 3JAMS 4C0OC 3MOJB 1UZDA 2QA1A 3CCRS 3AOEA 4WFXA 4RO0A 5H9FJ 2HNDA 3CJSA 2XSFA 3KTQA 2XB2D 4FXDA 3BN7A 3EE3A 4NLDA 1K3WA 4YHHM 3UCZP 2EK6A 3PNYA 3BXWA 1TL3A 3AAWB 2NLWA 1LK5A 1RLDA 4FF3A 2AU0A 4IBDA 4B3RF 2MKCA 3BO4A 1H2VZ 3WHKA 3DRXA 3KSXA 3FUVA 2BABA 3KJQB 1NDPA 2MQ8A 1FFGB 1AXQA 1IKVB 3FD9A 4DV1M 1N32F 1U1PA 4NLYA 3HHDA 2DWNA 2AF6A 5E3PA 4ICLA 4PG6A 4J91A 2YWGA 2Q1LA 2RSQA 4DL3A 2JEJA 1FNXH 3CGIA 3CJ5A 2C3MA 2CHVA 2YFQA 5GAGU 1T43A 1JLAA 3TQEA 1KQFB 1UEUA 1VS3A 1Z2LA 2DWLA 3SDEA 4ES2A 3LVVA 1EQMA 2BQ3A 5I4MA 3I51A 2HZAA 3IG1B 2B8PA 3PIOQ 1WELA 5KFEA 3D67A 2NZ4A 1D1UA 2F4FA 4M5DB 3A3NB 3HVWA 4RW8A 3OR1B 2QGFB 1C0TA 2ZBRA 4LCBA 1LV7A 5EXTA 4KGMA 1EJ7L 1LXJA 2QLFB 4DSEA 1YJTA 2WRMA 2BJWA 4BWJA 2HEKA 3I04M 4TKTA 3SSQA 3AHPA 2DAEA 3PXGa 5EP2A 4F0HA 3KHRA 3HD2A 3PACA 3GPXA 2K06A 4PQUA 2DB1A 3D6HB 4ECQA 3BBCA 1PJQA 1PJJA 2PIIA 3KJNB 2MQQA 3QYEA 2GV1A 3RBZA 1NJFA 2F8MA 4B9VA 1GTEA 4B3RJ 1X4AA 2Q43A 3FZBA 1PJTA 1RU1A 2J9DE 4WE1B 4LF4M 1IWAA 3DC2A 3K7RA 3KUGA 2DY1A 4ZA1A 4I7FA 3KXDA 3N6LA 2ZTCA 3MMBB 1FRLA 3ZZPA 1N32J 3KK1B 1N0UA 2CQ4A 3KKFA 2LWXA 1G71A 2NQPA 3U1NA 1WD6A 2FYXA 3K17A 2AJ0A 1Y9OA 4Y2KA 2AZ3A 2HLUA 1KFSA 1SI9A 2LEAA 2BE2A 4KHRA 3VAJA 2NQ8C 2MY7A 4DUTA 5KG0A 4I56A 1M5OC 1QYRA 1RWUA 2J7WA 5HBMA 1J7KA 2XYPB 3E21A 2R7TA 4G1QA 2CZ9A 2PFDA 3P5TL 4CLTA 2R8KA 2W4PA 2ALYB 4NLOA 5LL6d 1S6PA 2Z57B 3JTPA 5LJ3Y 1UM8A 4RF1A 1JLFA 2C9OA 2GVDB 4OZJA 3GJTB 2HHUA 2HVIA 3IO1A 3W9JA 2EUCA 3CJKA 1C0UB 2IBOA 3C6UB 3R2CJ 4ZIVA 1NHGC 3TVZA 4ZJQA 1S99A 5DLFA 1X4DA 5J2NA 1L8QA 2JZ1A 1RKIA 1DGHA 2GQFA 4USUA 1H74A 3OXFA 4UY8T 2FH0A 3J7YU 3OTEA 3JYTB 1WC4A 5EP1A 3KOAA 1XXHA 2QLWA 1JKHA 4KH0B 4QPTA 4J9LA 2EJSA 3H40A 2KRUA 1Z5CA 1RHKB 3K89A 3BN4A 3D1QA 1VC5A 1OO0B 3G87A 1IR1A 1S1XB 5HK4A 2WZJA 3QMQA 4I2QB 3D28A 1R7RA 3OL7A 3K1JA 2V68A 3QGGA 3K2LA 3T41A 1AFJA 3QGPA 4N8NA 3UD4P 2QN6B 2JXNA 2V5HG 4OZ1A 2LH0A 3LGMA 3IC1A 1YJRA 1RTJA 4KFBA 3KJFB 3MCNA 2CQIA 5CZXA 2CDQA 3MDFA 4URSA 1TL4A 3OQ2A 2VH7A 4TYBA 5GAHU 4A48A 3GLJA 1HQCA 3FCVA 1FJCA 3RU0A 1T9WA 2ZOMA 3KYLA 2F5GA 1UFLA 1TDHA 2RRUA 4RJVA 2DO0A 2HAFA 2MYFA 4PUOA 2M7SA 4PWWA 2GQCA 2RB7A 1YBUA 3CC2S 3GFZA 3IXQA 2DBBA 4AKGA 1IVZA 3CJTA 4LFBM 1DGBA 2BJVA 3OL9A 2KVQE 2AX0A 4EYHB 4JI8J 5C1BA 3L7UA 4N77A 5HP1B 2MJNA 4ZJLA 3BR9A 3HHWA 2L3MA 4IDKA 2GQQA 3EPGA 5D0EA 1RAFB 3J7AN 3U60B 3S6EA 2DAIA 3JSBA 3GJRB 3IGNA 3VKHA 2QNJA 4USIA 1XMQF 4LY6A 3PV8A 4F4KA 1QSLA 3M6AA 2E5GA 1GX6A 2MPUA 1YJNS 3NBXX 4UT4A 1A0OB 3DRRB 3JXOA 3MEEA 1DTQB 4IFVA 5B0BA 2OPRB 4RF0A 2A2DA 3I6PA 1RAIB 4MGZE 3QIPA 1XMOM 2HWTA 3K92A 2ZWPA 1KSFX 2XSZA 2VBWA 1SQGA 4Q5VA 2HVZA 2DZOB 4ANEA 2VF7A 2VPWB 3T6BA 2QCUA 4JP8A 4YQWA 1G3IA 5EXXA 1UWBB 2HQGA 4P10A 4Y2CA 1YJVA 4L76A 3VAHA 3OTOF 4BCAA 3DOLA 3QYBA 4JI3M 3FRYA 5AXKA 3UNYA 1HBUB 2K7JA 2VG7A 4BC9A 1HQUB 4GITA 3ZTOA 1WDDA 3QBCA 3OUYA 5KT6A 4IQMA 2FJWA 2XZTB 3B4DA 4A8KA 4H4OB 1BQMB 4WU3A 1QTMA 2YKNB 1JK9B 1UVNA 3HHLA 5EX0A 1QM9A 2XTJP 3FTDA 5F8JA 1Q53A 3SCLE 4DV0M 4D81A 2Z30B 2HYIB 2QYGA 3OL8A 3CO9A 1RT6B 4A8XA 1HWJA 4HLQA 1PJ6A 1VBXA 3M4XA 1RT7B 5CXTA 1IY0A 5E2QA 2GFFA 3BS9A 4CLSA 2XY5A 2FZKB 4CCHA 1SC4B 5JJBA 1XMQJ 3HVAA 3OFEA 2DGWA 1L2CA 1PM5A 1NLKL 1YRUA 3ICLA 5FDLA 2JDJA 2A5YB 2MKSA 1T3OA 3JSRA 1VQSA 3J81U 1YK9A 3BM7A 4NL5A 4RBUA 1ZPVA 3TA2A 4IOCQ 2PA8D 4OX6A 1OY9A 4B3SM 3HX9A 5KFUA 2VC0A 2NUHA 2RS8A 4GVBA 4GO5X 4UQTA 2ZOFA 2AWZA 5HMZA 3CO0P 3CCVS 3KK2B 2FB0A 2AEFA 3BDEA 3V6DB 2ZM6M 4DR2F 4ZLPA 4LVNP 1RKJA 3MHYA 3K5MA 3B74A 2R44A 5CABA 4LRSA 2DGQA 3OTOJ 2HZVA 2M88A 4ED6A 1TKXA 3OSPA 4UTGA 1D8ZA 1TTHB 3ZTSA 2R8IA 3RGPA 5DGAA 3DLGA 5LMUF 2HS0A 3GR0A 1W26A 3U1LA 3QJJA 3KLGA 1M90T 2W2PP 2K3KA 4NCGA 2ZKTA 1GXTA 2NSCA 4F4ZA 1QUVA 3AFGA 1PC5A 2JRSA 5C24B 1Z2ZA 2HK3A 1B4SA 5KFKA 1FNOA 1JXVA 1RT3A 3LMMA 1HI1A 2R7WA 1IBMF 3IM9A 3P45B 1OYEA 3M2VA 1X60A 3CCLS 1QJHA 3BEGB 2WB4A 2P9CA 3OPKA 4OI2A 2R2UA 1PC4A 2RHSB 1EKRA 4NLXA 4C2MA 4AG6A 1BGXT 2ACMA 3NCRA 1YDLA 3POTB 2BKPA 4TY8B 3DLKB 1R0CB 2IM1A 4Z8XA 2E9TA 4TLQA 4NMXA 4R7GA 2MZQA 3MI7X 4JI0F 2XCPA 3M1VA 4CT8A 3E2EA 1JR3D 1IN7A 4GC6A 2Y3YA 2H5EA 1P9YA 4XDCA 2AP6A 4LSNB 3H20A 3LWLA 3MMCB 2CJXB 3LQQA 3ZZZA 3LGHA 3NNCA 2AGOA 5A76A 4RW9A 3LGNA 2XS2A 4P7TA 3KHLA 3V81A 2MR9A 4FCVA 4GHLA 3G9CA 2LQ5A 3RAXA 2CG4A 2FVCA 4B3TM 1JLEB 1X31C 3ETOA 3GJSB 2V8DA 1QAIA 3K9OA 5CYMB 2KZMA 3I01M 1TMMA 5J1EB 2NXUA 1D3WA 5IOLA 3LALA 3BZQA 3GLGB 3MMAA 2MROB 1EIYB 4CT9A 5LMUJ 1VK8A 3MPVA 3K5LA 5AE3A 1VQOS 3HSGA 3HI9A 4B7GA 1B0VA 4Q43A 2M9KA 3U6CA 2B5JB 4B3RM 5J2MB 3T38A 3F73A 3GLHA 1T9UA 4FDFA 4EI2A 2RRAA 3ENQA 2FVRA 1IBMJ 3QAUA 2W8LA 3PG9A 1N32M 2VC1A 2B9WA 3WBZA 4HTJA 2XFSA 4JI5F 5FLXS 1S72S 4YY3F 3QLHA 2J9EA 1YBAA 3DHXA 4RKUF 1PCAA 3W9HA 5F8MA 4KR0B 3F41A 4LJ7A 2ZANA 2Q3PA 4NRUA 4WKYA 4JI0J 5M2PA 2HIYA 1HYSA 1ZAEA 2KT3A 4J7CA 1VHIA 3KW6A 5AT1B 4ERDA 3BPDA 5DS7A 1HBNB 2OKQA 3DDKA 2BBEA 3LP1B 5HVGA 3HHEA 2WVBA 1ITPA 2RF2B 3IA0A 2OPQB 5D4OA 3TO8A 5I3UB 2N3OA 4BBAA 2R7QA 4NXMM 3NP5A 4LJAA 2OO4A 2IRUA 5LJ5Y 1CLFA 3PRDA 1UA1A 1AIPC 4ZCKA 3MM7A 4C97A 1TL7A 5A8KB 1IBLF 2XFTA 1NSQA 1S1VA 3Q8VA 3CSKA 1U2FA 4WYLA 1R8BA 1U7LA 4FXWA 2HGMA 2M2BA 1S0VA 2CVIA 4PG7A 1QDRA 3KLEA 1VIOA 4WZMA 4X4QA 3UZUA 3LWMA 1U26A 3UE2A 1X37A 1N5YB 3WHIA 1Y3KA 4LR8A 4DQIA 1SXJA 3VDUA 4F2LA 3W0LB 2LQ9A 1QE1B 1NK9A 2CJQA 5T7LA 2G2YA 2B4OA 2L08A 2GHVC 4WK3A 2P6SA 1RA7A 4CLLA 2BOAA 1T03B 3VGUA 5IZHA 1REVB 2CJYB 2HS4A 2UV8A 2K1RA 1G8PA 1BHNA 2DHAA 2E1AA 4JI5J 3K8VA 3SHGB 3QPIA 2B43A 3N01A 4YY3J 3L9ZA 4EU0A 1Q8KA 2WOMA 2L48A 1IY2A 3KOXE 2DCUB 4B9UA 2LNHC 1VQ6S 4WP9A 1HI8A 3M9OB 5EWGA 4DFKA 1RCOB 5M2UA 4NRTA 4LF5M 3VHQA 2XY6A 3KWMA 1V5VA 1TV6B 2RH3A 5JMNA 1BUXA 2G1HA 1TKDA 4DV4F 3UVJB 5HATA 3ET6A 1PO6A 2ERCA 2ZBIA 4CM2A 3S01A 4B9MA 3J80S 1CS4B 4LUBA 1IBLJ 1Z5BA 5KQ8A 2BE9B 2UVRA 5J1NA 3TARA 1XNQF 4DX8H 1CBKA 3THPA 1X8DA 1H6KX 2AJFE 1FDDA 4FCTA 3WDOA 1FKOB 2U2FA 2DHHA 4USVA 2BNKA 2YX1A 4AL7A 2KI2A 2C2KB 3EGVA 4CTAB 1HWIA 2RRNA 2HCBA 3SQGB 5MAOA 3AL0C 4AXIA 1M5SA 3TEHB 4U8YA 3GLHE 1GT8A 2RRBA 1QSYA 1HBMA 5F3ZA 1GLNA 2CWKA 3FEYB 2CIMA 1OY8A 2OIHA 3M30B 1NSFA 3FBBA 4JN6A 2WSCF 3LQRA 5CH7B 1OSCA 4PCQA 2ZH8A 4L8RC 2VPYB 2UUBF 4PWDB 3KXEC 1D9AA 2CZVC 2PO4A 4OZ0A 2CEAA 1JLCA 4WURA 3DOMA 3GLFA 2JY5A 4XDDA 1TDZA 2B51A 3RB3A 5DQIA 3N5FA 2IJNA 3FZ2A 3GIJA 3EZOA 2KA6B 4HEA9 4K5SA 1RTIA 1IBCB 3HCXA 5F8HA 4GC5A 5AE1A 3HHZA 1RTDA 3DGPB 2HURA 2JWNA 2OEMA 2YKPA 5KFJA 3NGKA 5A0YA 2OMLA 4OX7A 1AZSA 2ASYA 4QWCA 1L3TA 2R2RA 1Q3BA 4CIOA 1UWAA 1LW0A 3N28A 1RUSA 5EQTA 4DV4J 2Q6CA 5B08A 2RQCA 4IRCA 1Q7LB 1C1BA 3W63A 4OVZB 2JH3A 3DZDA 3E46A 2Y9HA 1MN9A 2Z58B 3P6YC 2OAUA 3GJQB 2YPZA 1VG5A 2E5IA 3EDRB 4UY85 3CT9A 4F3QA 1XNQJ 1S10A 4U6PA 2YNFA 1NVMA 2KW0A 3OR2B 3EXCX 3GPYA 2BOPA 2BW7A 4H4MA 4D80A 3E8OA 2AKWB 4DBGB 3JTNA 3PR5B 1IQTA 1S4FA 4QOTA 3N5BA 1VOMA 1J5EJ 1QVFR 4NE9C 2XY7A 1DGGA 3OXGA 4XAKA 3FEZA 4PYDA 4MGHA 3PHTA 1ZM3A 1URNA 2CRUA 3G4SS 1RI7A 3SYZA 2RUGA 1HWUA 1NSAA 2CQCA 2L6OA 1YRXA 2UUBJ 1AB8A 2DTJA 1I4WA 3LANA 3TUJC 4ZP9A 1S9GB 3OTOM 1B70B 5F0WA 1YJUA 1WIVA 2DVIA 4ZCIA 1NK6A 3UCGA 5C42B 3HHKA 4MKBA 4PD2A 1VQLS 2V2KA 2VDIA 2CV0A 2MH8A 3CC4S 1UPPA 5KPTA 5E3AA 5KFHA 1PILA 1NHWC 2VQEM 1HL6A 2PA3A 3VLFB 3B8HA 3G96A 1TL5A 3GPUA 1S59A 5DDPC 1N8RT 2IM2A 2ZDPA 2BR0A 2EKFA 2WB1D 4PYAA 5C5JA 2IC3A 2YH0A 3HJ8A 3FUWA 4PG4A 3PKYA 3FQLA 2CFXA 1U47A 2DISA 4FYYB 2NUUG 3TNVA 4DUZM 2KN4A 1M1HA 1YBTA 3SSRA 2H54B 2QSWA 1F3VA 1P8GA 3P3DA 2C28A 4TLRA 4IRKA 2VPXB 1QZMA 4JI1F 3DRPA 1Q5YA 4CYUB 2JJ4D 4O3RA 3HZJA 2Z3XA 3K2YA 3I4YA 1RTZA 3DFEA 2CAJA 4KO0A 2Z8QA 3W7BA 2BANA 4BBYA 4IBKA 2IA0A 4OQJA 5CCMA 3RRKA 5CZVA 2EWHA 3D0IE 1KLMB 2GMJA 3QRQA 3PO5A 2ZE2A 1T6OA 1G4CA 3CCJS 1FESA 5H37D 2ZBPA 4CP5A 1J5OA 2HBYB 4DL6A 4DR2M 4M95A 3TX8A 2W9CB 2GAGC 4PKDB 5K8NA 5A8RB 3GSDA 3B7NA 1ZZFA 2CPIA 2MTLA 3MM6A 3EGZA 1R0BG 4X4NA 3P4UB 3SAUA 1CJUB 4U7UK 1N6QB 4AKIA 5LMUM 2CNKB 4Q0BB 2ZNZA 5KFXA 4F26A 3U27A 2DNYA 4LMZA 4F02A 3OVBA 4ELUA 3ZZRA 4TXSA 4H4KA 4GHAA 4OZ2A 2H3EB 4GKJF 2CQ0A 2Y20A 3SFZA 1I5OB 1CUKA 1XN9A 3PCOB 1PG5B 2G2ZA 2KT2A 1MLAA 3D54A 2FUG9 1S9FA 1JQJC 3EZUA 3J7ZT 3OLBA 5ETNA 4DSLA 2EFPA 2DEIA 1KHWA 1IBMM 1E6VB 1L2BA 2Y1LB 4NWBA 3GR1A 5L9XA 5LM7E 2I7PA 4WU2A 4USWA 3LQVA 4P17A 4ATNA 2AJQA 3TA0A 4OI0A 4HHHA 3FUUA 5KTQA 1HFEL 1KR4A 5JVHQ 1DQ8A 5J2PB 3BO2A 2DHSA 4GRSA 2HHVA 4NOHA 2LHCA 4RUAA 2B0GA 1KTVA 4JI1J 4JI0M 3DMJA 2CNOB 2RHQB 2AT1B 4ZJOA 2E5LF 5ETLA 3U7JA 2ZH3A 3UD5A 2DO4A 5KFMA 1KOHA 1FJEB 1ZMWA 1I51B 3W2WB 2VPZB 5KFBA 3H4BA 1RAJA 2KXFA 1O6XA 2AX1A 2J9CA 1LWCB 2C2DA 3SMSA 4ZVFA 4DX6A 2XGQA 2IYGA 1FRHA 1I6JA 3TVYA 5DG7A 1LWEB 1IN5A 1SKSA 2AV5A 1YKWA 1CG2A 2IAJB 1IR0A 4NLSA 3PVXA 1FRXA 4EMDA 2I8EA 3KK3A 1Y8GA 3ZFVA 1S3SA 4ZHRA 1BC6A 3CDWA 1WTFA 2BXJA 3CD7A 1K73T 3E01B 5ETQA 2VG5A 4DWIA 2FHKA 4GKJJ 4ED3A 1X9WA 4TNOA 2OP5A 3M8SA 2GW8A 1C4CA 2Z2LA 1HHTP 1S9EA 1R6YA 2F5OA 2MLZA 4K4VA 2FTRA 1JX4A 4KTQA 4RPFA 3M2RB 3VGSA 2ZUGA 3UCUP 5D3GA 2I0XA 1B64A 4K0KJ 4DOZA 4K2XA 4LFCM 4OV1A 1D2NA 3CF2A 2BJ3A 2KXNB 4JI5M 2B3TB 4LGMA 3R5CA 3IGVA 4YY3M 1R2YA 2Q2EB 3C3LA 2X4AA 3QRPA 3A3PB 3SHFA 3JSMB 2OSRA 1OSDA 4RWXA 1ZA1B 4JI2F 2LQ8A 2E5LJ 2BX6A 2K47A 2Y21A 3FE3A 2HNZA 1F9HA 4AZFA 4P73A 2FC8A 4B9SA 3DCAA 3OFGA 1NKCA 1OTRA 4OYBA 2LCWA 2LKZA 3CD6S 3T6JA 1NDKA 4FYDA 5I3QA 2CQ2A 4LF6F 1FDBA 4LJ6A 3K58A 3EJMA 2EC0A 1VJQA 1VQKS 2LBCA 1SUQB 1UA0A 4QU6A 4AE5A 2AEMA 5KFSA 2ZHBA 3GMGA 5EXSA 2EPIA 4WTOB 4DV3M 1NH7A 4QR0A 3TWMA 4LJ5A 1WORA 2GQ2A 3KNGA 2HVDA 3PFEA 5L38A 4DV2F 3QO9B 1E6YB 2GIRA 2J7UA 5KT2A 4JI4F 4Y34A 2AJ1A 3BR8A 4QW9A 2ASJA 4K4TA 4DR4J 5F8NA 1Y4ZB 4QIVA 3NAIA 2SXLA 4NLUA 3ILIA 1RWNB 3MCSA 5I42B 3PNIA 1JNZB 3GIIA 4F4XA 1Z5AA 3W3SA 4RNFA 2VQFF 5AXLA 4OX9F 1SKWA 3UPFA 3ISNC 1HJPA 3NMRA 1GO5A 3KLVA 2CQGA 1HIYA 2OTLS 3NWLA 3O1LA 3R5DA 4F8RA 1SL0A 2XHWA 4O44B 2A2CA 2KHHA 1X9SA 3DOAA 3HJVA 1F5AA 4LBPA 2PN6A 4M5LA 3G8SA 5SUHA 1JLGB 1B7FA 5HN0A 3V76A 2QLJB 4PWUA 1M5KC 1U1MA 3EDQB 1NCLA 2ZOGA 3UI3A 4UF4A 1V34A 4JI2J 2OPPA 1LKZA 1WTBA 2IJFA 3GSIA 4EEYA 2QV6A 4OFZA 4OYIA 1RJJA 4MK9A 3KS8A 2GX8A 1IKWB 3LAMA 1EE8A 1WSVA 3FFIB 3A45A 3G71S 4LF6J 1IBKF 1V3ZA 1VQ9S 1S1WB 4ES3A 1Q5VA 1UP1A 3C8YA 5A8WA 2UU9F 4GIPA 1XNQM 2L2DA 2E7XA 4Q7JA 3W2VA 1N5TA 2CJKA 3O2IA 1NBEB 3J81j 4ZPTR 3KNAA 1GQEA 4DL5A 3GZ7A 2YWHA 1FFSB 2B6AB 4DR5F 3T19A 2Y0SD 3THTA 4DJBA 1RWVB 1VEKA 4DV2J 1IM2A 2X1BA 4FVCA 5EDWA 1SQFA 3TX0A 4JI4J 1SC3B 1IXSA 2N35A 2KRBA 1JNRB 5D4LA 4C8LA 2VU5A 2G9OA 2EFVA 2HMIA 4FCWA 3VV2B 4CLFA 4L3KA 2PDAA 5L39A 2VQFJ 3BPSP 4OX9J 2GNOA 4DFPA 1TUVA 3BKTA 4ZVHA 4DZDA 2HNYB 3K0JA 2L41A 3C15A 1L5UA 2HFZA 1ZV1A 3NKYA 4Q2MA 1GJTA 2DNOA 3U6OA 3SMZA 5IQ6A 3MM8B 2UUBM 5IWAF 1GX5A 1OY6A 2YKMA 3LOUA 1N5SA 1O51A 1F60B 3AOGA 4J9QA 1GMWD 1OIPA 1TTEA 2VFVA 4A47A 2E9RX 1IJEB 1Z6TA 2DNZA 2PI4A 3KLIA 2RD5C 1RTHA 5GAGI 1S6OA 5H9FK 3UMMA 4P2SA 3FUYA 2JX2A 3NWGA 1FD8A 2IVYA 2HLTA 2ZH6A 3Q2TC 2VDHA 1R0AB 1ZYQA 1HT1E 4L72B 4P6QA 5K14A 2HGNA 5HO4A 3WX8A 2XS7A 4IBJA 1IBKJ 2XWYA 4P2MA 3H4DA 1HQEB 2MEWA 2KDLA 1UAWA 3BSNA 4B08A 2OD4A 2XO6A 2UU9J 4BWMA 2LXEA 4NSRA 3CIZA 4MK8A 4DX7A 3U6DA 3HU1A 3EGWB 2IHR1 2A6OA 4J90A 4DR5J 3CJQA 4NZ7A 2O5RA 4IG3B 3HHYA 1CJVA 3J81S 3MM9A 3IAM9 1R89A 5ADZA 5C25B 1C7YA 4L6V3 4CWBA 2R8JA 3FCWA 4TYAA 4ZVEA 3TWLA 4ZPBA 5L8RF 1RWMB 1EQ0A 3AB4B 5IT9Y 2WW8A 1IKVA 2X3DA 2EKYA 2WHOA 2DI0A 4LVOP 1YG0A 2XMKA 5IWAJ 4DL7A 3FYCA 3HLUA 1LQ9A 2ZZNA 2CNNB 1Z59A 2LP4A 4PXBA 3JAMY 3FTCA 3KS4A 2QMWA 4OHWA 1RWWB 1K44A 4UW2A 2GJFA 1Y5NB 4OJGA 1FI4A 1ZMVA 1YSYA 2ZZTA 3ZQJA 2L9DA 1QVGR 2UZAA 3CDBA 4DPYA 4X4PA 2NYIA 3W5ZA 2XO7A 3A42A 1Q81T 3G2XA 1C4AA 1T95A 4USMA 4IG0B 5KT4A 5HQLA 3PXGA 2C5RA 4M5DA 1T7PA 1NNUC 2PGCA 3H42A 2BUNA 3CJ3A 3FCHA 1LW2B 1XB2B 1SL1A 2HHXA 3OR1A 3TL4X 2BACA 1E32A 4F25A 3R6GB 2P9EA 2QMXA 2YWEA 1S49A 1JR3A 1HPZB 1IKXA 1GXLA 4ICLB 1GABA 4KPCA 2NXCA 3RYLA 3E9SA 1G7CB 3BDPA 4JI1M 2C2RA 1VGYA 3NCPA 5ETPA 1BMQB 2HHSA 2HRYA 2R8GA 1JLAB 3IR7B 2AGPA 4B17A 1WOSA 1ZPWX 2PMZD 2DR8A 1QUPA 1T94A 4CH7A 3J7YI 3NMAA 5B09A 3FBFA 4ES1A 4CO1A 2BJDA 3D6FB 2XC9A 4OHVA 1F5BA 2UXCM 1RADB 2QL7B 2DXFA 3MMBA 1QAYA 4AL6A 1SVDA 3QT8A 2MHEA 1IN0A 2MJUA 2LVWA 1VFJA 2CJBA 3HM9A 1SJQA 5BPVA 2MSTA 3G8TA 1T9YA 3IR5B 1E9SA 4P74A 1S76D 2FLLA 4LF1A 1DURA 3QIDA 2RMLA 3CDEA 1FWKA 3VTIA 2C98A 3Q8YA 4I5SA 4OU7A 4RNOA 4JV5F 3KMSA 4GKJM 2X51A 1NHKL 1EIJA 2CG8A 3QT6A 3FNNA 1LV5A 1U25A 2W2MP 3GRUA 3PEHA 4CLYA 2X1GA 1AROP 2RKOA 2GVDA 1NEEA 1NO1A 3U1MA 2R4EA 4J9PA 4I7FB 2J5AA 1UKUA 1QAQA 2XGNA 3KG0A 3LPYA 1N78A 2XI3A 7FDRA 5HJXA 3TZZA 1OQYA 3MFHA 3LW5F 4FXVA 5HAOA 1M1GA 2JFKA 1S6QB 2U1AA 5F9NA 5AE2A 4I6AA 4NLVA 4K2JA 3TYTA 2NXEA 1JIHA 3HU3A 3N4WA 2J7KA 4Y2AA 2VFRA 2IJRA 4KE5A 3HU2A 2BE2B 2YKAA 4ZPWR 4U7CA 1CJKB 1GFWB 2MQMA 1VQ5S 3JYTA 2FLOA 2VIHA 4OV6A 2Y0QA 2Y8YA 1XBWA 4DV6F 4G1QB 3ZTPA 3QJLA 4A8OA 2FNAA 1S1XA 8CATA 2ZH5A 1S6PB 5DO2A 3OJSA 3SIPB 3CULA 4NRVA 1X4HA 1FJ7A 1SG9A 4ANRA 2D69A 1Q7YT 3IBFB 3TQ1A 2J8SA 4KHMA 1HI0P 3B7QA 3L4BC 2R0IA 4LRBA 1RHJB 3WIUA 5DYIA 4LRAA 3UGJA 1P6TA 1HNVB 3J7Z5 4QHSA 1KVIA 4Q8FA 4FYVB 5B0AA 3IBCB 3ZZYA 3PW2A 3L2AA 1NK0A 2BJ9A 1HNZF 4JV5J 2A10A 1Q1KA 1NZAA 4KJIA 4F67A 4I2PA 5H1SV 1JKHB 1YUBA 1SJ1A 1HKAA 3BKUA 1QDUB 4JI6F 5DDQC 3T15A 4CQ1A 2CV2A 4EFAC 4PZVA 1VQ4S 1S7HA 4DQRA 3I9V9 4P2FA 3Q86A 2K8GA 6FDRA 2XG8A 5KFWA 2VJVA 4FF2A 5HP1A 2RKIA 1SC1B 4FF4A 1U48A 3C2PA 3U60A 4PXDA 2CQBA 1HR0F 4E0DA 3DDNA 4I4LA 4KT0C 4J9UE 4JBCA 4AL5A 4Y6IA 4DR6F 3HXMA 4AI6A 1YE9A 3JR4A 1G2EA 3KLHB 3JSYA 1N34F 1Q16B 2WVEA 3W5XA 3D7SB 3DRRA 3K5PA 4IH5A 1FCAA 1DTQA 4YUDA 4QIWD 1TKZB 4DV6J 3CE8A 4O3SA 4LF6M 1WACA 2ZHAA 4PUOB 1K9MT 4RUHA 2ZD1B 1A7GE 5KG2A 2UUAF 3OV7A 2WVFA 4NOOB 2H65B 2UXDF 2QQ8A 1NK7A 3E4RA 3ISND 2IMWP 1UWBA 5K20B 5IM0A 4ZLLA 1PYTA 4KGKA 4KB7A 4DL4A 1DQ9A 1L3SA 4DPTA 2BYCA 2W1BA 2XMUA 1U45A 1HBUA 1QVRA 3BGUA 3P49B 4DV2M 1HQUA 4ID5B 4JI4M 5KFDA 4HT5A 2LMIA 3TEGA 1FXLA 2ZITA 2BEFA 2YQ3A 2W7OA 1HNZJ 2HS3A 4H4OA 1BQMA 3CTRA 1NJGA 1VC6A 3ZC4A 2DHXA 2RVJA 2AMCB 3MR6A 2VQFM 3LF0A 1XHBA 2KZZA 2W7AA 4JI6J 1NPKA 4X4TA 4DCOB 4OIXA 1DJ0A 2UUCF 3DLEA 3CCZA 3T5KA 1JQGA 2D7HA 3CMQA 2Z2ZA 1RT6A 4ZP7A 4E98A 1X0PA 2LLZA 2H5XA 2R7VA 3J80U 2MGZB 1RT7A 3RW6A 1GJSA 3J2PB 3MPDA 2C2NA 5ETKA 3R1LA 1HR0J 3GP1A 1MWQA 3NRBA 3BJYA 3AT1B 1JXEA 2ZH4A 3OTDA 4DR6J 5FTJA 1FERA 2BVZA 5A6WA 4QCLA 1N34J 4LJMA 4DUYF 2W2OP 1WEXA 4A8WA 1K82A 2CJAA 1OQ6A 4KGVB 2MQOA 4WCEQ 2O01F 4WTYA 1FRJA 4M5IA 3JQKA 1FE0A 1WF0A 1NKEA 2G4BA 1Q78A 2QBYB 1A9NB 5KQDA 1IXKA 4CIZA 1EP4B 2UUAJ 1X4GA 2PI5A 2EG1A 1RA6A 2UXDJ 3CIMA 2EA0A 4YR3A 4DSJA 3KK2A 1VQYA 2B4VA 3PW4A 2J6UA 2UU9M 4KV8B 3IN5A 3BH6B 4ED5A 1VK3A 2W9BB 1R31A 4YMEA 4I1TA 3HULA 2J8AA 1TZ0A 4AQYF 4DR5M 2XMJA 1X5OA 3AXKA 3MR2A 4K59A 4C0BA 2P5TA 1NDLA 3NBPB 3NNAA 1AFIA 3BSOA 4USKA 3NNHA 3FTEA 3RRGA 5L9NA 3RG6A 4CISA 4QPXA 4ENOA 1R8AA 2VHGA 3T6PA 2R65A 1PIEA 2L4EA 3AQOA 4LJ4A 2C96A 4ANCA 1UEVA 4I8OA 4ZK7M 4CO4A 4N5SA 5FTNA 3VGTA 2IPOB 1M5HA 2UUCJ 2DNHA 1SH0A 1N36F 3M7VA 3BQ2A 4YDDB 3FEXB 2GZOA 2KJWA 3MAQA 2XLKA 3POTA 2VF8A 1WSRA 3VAGA 1WOOA 2CXEA 4FNIA 4DLEA 4OYOA 4HH1A 1IY1A 4KH1B 2CDRB 1UTAA 1HBOA 3GLIE 1NY6A 3D68A 2ACYA 1G3OA 1L2DA 4DUYJ 4LSNA 1U1QA 4O0NA 3MMCA 3NLCA 1ICEB 1FJGM 2HFNA 4NCGB 4DPUA 2V9KA 3L7PA 2OD6A 2G0IA 3WC2A 1IQPA 1RT3B 2DKOB 5E33A 2UVUA 1TFYA 1I94M 4L78A 1JLEA 3LUYA 3PJXA 1WC6A 3ISZA 1Y10A 1SQEA 1FFWB 2RQ4A 4CZCA 1VQ7S 5CYMA 2HZCA 3BSCA 3CCSS 5D0RA 5J1EA 4P72A 4PPDA 5KFZA 3C14B 4XK8C 4AQYJ 3GLGA 4LG2A 1OPZA 1X5SA 2DNPA 5THWA 2DXIA 2YXLA 2RUSA 8AT1B 4LRTA 3FKBA 3M0EA 4U67Q 2XULA 2WONB 1KWMA 4R25A 4C0HA 3C16B 2M60A 2DWMA 3FSYA 3AOCA 2GNKA 2F3JA 4S12A 1DAXA 1YZ6A 5D4PA 3NGUA 4ED0A 1TVRB 2APLA 1GEHA 1T05B 1H6UA 4QWEA 3Q83A 5HROB 3H5YA 4YP3A 2B9YA 4HDGA 1DY3A 1HNIA 4J9SA 2MGWA 4WW0A 2GS8A 1SJ3P 1B3TA 4OYPA 1H38A 3FQKA 2GMLA 4PT5A 5E3RA 1ZQ9A 3PJ9A 3LPEA 3GIKA 2VICA 1NO8A 2KHCA 1WNEA 3FMBA 2XBPA 1H2UX 1RU2A 1D9FA 4MH0E 3RE8A 3THVA 1RAGB 1L3KA 2OMOA 3F44A 4IH6A 2VKZG 1RT4A 3PKMA 3U6LA 3DHWC 3LP1A 2LHGA 2RF2A 4NLRA 2OPQA 3GYGA 2P9GA 3I9ZA 1OJLA 1Y0HA 1SXJC 3D66A 1QSSA 4PG8A 3GLHB 4ER8A 4M5MA 1XWIA 1CSJA 2C1EB 1HQYE 1VHFA 4Q44A 5T41A 4UQGA 5A8KA 3MURP 3VR1A 1YLAA 2PMHA 4GMQA 2PEHA 4UZBA 1NUEA 5FLXY 1SL2A 2CQ1A 3DLJA 2J0SD 2Z7JA 2V6ZM 5I3PA 1N5YA 3WHLA 1QE1A 1NV8A 1RAEB 4OJ1A 3MECB 4RW4A 2JL9A 4UOFA 3AQPA 1FT8A 1T03A 3RBEA 5D77A 4IJFA 3KFWX 3QYYA 1UVMA 1REVA 1RDRA 3DDIA 4DU7A 2KFZA 3CJ2A 1TUGB 2L9WA 2ZZMA 5A2QU 1EFUB 3MM7B 2XQCA 3P96A 3M8QA 2HW3A 1NAQA 2QP9X 4HTIA 3GP9A 4RWWA 4OW0A 4Y2IA 4JYAF 2YR0A 3LO3A 2M3DA 3CWJA 1YQHA 4ZIWA 2GAHC 4MFBA 3GIRA 4UOHA 1EHWA 1VYAA 5DQGA 3ZTQA 2V2ZA 4DV5F 5GAEI 1HHQA 4H54A 4KODA 4JV5M 1SXJB 2I9SA 3I5AA 4KQZA 5T7LB 3Q0AA 4GH9A 1TV6A 3M32B 3ITHB 2LVOC 1N54B 2ZC3A 1RHQB 2XYHB 3UDLA 3OHBA 2DIVA 2BJ7A 1KC8T 5GMDA 1EETA 5ITHA 1CS4A 3TW0A 2OSQA 3VKGA 2BE7D 1F1BB 1PJIA 3R8FA 3HFVA 1ZM4A 2YQ1A 1QANA 1BY9A 2RU9A 3I5CA 1FKOA 2WOMB 2XMVA 2A3JA 2RDDA 4ZVSB 2X8AA 1RGVA 4OZNA 2DGTA 2VG6B 1PBUA 1KVKA 5DM7Q 3TE6A 2XCAA 1W7WA 4RU2A 1WJ9A 1RBOB 2B7BB 3D1OA 3AA9A 4PXCA 3I0SA 1X4EA 4DV6M 2XYGB 1PBAA 2QEXS 1TU0B 3M30A 3UDVA 2V2QA 2HHTA 2LYVA 4PWDA 4RW6A 2HVEA 4OL8A 3EICA 3OJUA 1WC3A 4IBGA 1NJWA 1R6VA 2WSFC 4YR0A 4PR6A 4JYAJ 3C66A 4AT1B 4B02A 2O1PA 4EWTA 2WBRA 4BHQA 4PAAA 1NJYA 3DGPA 1S0NA 1KBRA 2QE5A 4DV5J 1HNZM 3OFHA 2Z0GA 1DTTB 4QOZC 6AT1B 2N4CA 1MG7A 4AYBD 1OPIA 4IO1A 2M0GB 1NZ8A 1OYDA 4QNRA 3W68A 1FE4A 4CM0A 4DQPA 4YB7A 3SXLA 3MCOA 2IIHA 1VLYA 2UV8G 3MEDB 1MWYA 4JI8F 4MJKA 2CVEA 5KG3A 4NXNF 7CATA 3TAMB 4CO3A 4O4GA 2OELA 4J9NA 2FC9A 2QSFA 3GYXB 3OR2A 2UUWA 5LSOA 1IFYA 1NRKA 4CO0A 1MW7A 4WFYA 2OFGX 5GKNA 2ROEA 3HVRA 3HP6A 1B0PA 1HR0M 3MUMP 3PO4A 2BWBA 3L95X 1J27A 1UJ4A 4LSZB 1OKSA 2FS1A 4M5JA 3PVSA 1N34M 1HMVB 2I7NA 3TWKA 1NDCA 1QQWA 4NYOA 2VA2A 1O5JA 2H5JB 3H0PA 3BYPA 3C3EA 4AXJA 2OPSB 4Z6YA 1G1XA 4XO0A 3BB5A 2EVZA 2UXDM 1KYIA 1FTRA 5GMEA 2F5SA 2W2NP 1S9GA 1SJRA 2YNFB 4CO2A 3BQ0A 5C42A 1ZMUA 4LFAF 1H73A 4IIWA 4F1IA 1PGYA 4K7QA 2BV3A 2DGXA 2MZRA 1OIAA 1SJ4P 1XR6A 5E5NA 4CLKA 1LFWA 4FWHA 4RU9A 2NREA 3MAAB 4ZP6A 4FVMA 1CJTB 3PYEA 4NA3A 4GKKM 3A4TA 3EVWA 5BR8F 4HKQA 1QZEA 2QC3A 3D8BA 2CRLA 3KUHA 2KU7A 2JEIA 2YBVA 4M5GA 2DPJA 2UUCM 3HWSA 2Y1RI 3SZ2A 3DRSB 3S1TA 4A3VB 2YNHB 4DV1F 4A46A 2C3YA 1MWZA 2VF3A 4NXNJ 2D9OA 1DFDA 2CPZA 1U1NA 1RE1B 3GIMA 1HNWF 3CDUA 4REZA 1YJ7A 4LIRA 4MM3B 1LFPA 2DGOA 5HI7A 4HT7A 2XSJA 1NNJA 4CYUA 2EK1A 5CQGA 2CZ4A 1WG1A 4FYWB 5EN1A 5KFFA 1OQ3A 4DUYM 1L1ZA 2DWZB 1RT2B 2DRBA 4H4KC 4TUWA 1KLMA 2Z4PA 2DNLA 4B3OA 4ZVUB 3T9NA 2G3QA 2GJ2A 1KNZA 1R8HA 1HQ2A 4CLZA 2W9CA 3QNWB 4G1PA 1BWVA 5A8RA 1TELA 4UUWA 4HL4A 2IBKA 3TA1A 4D3GA 4MMOA 4AQYM 3AD9C 4NLGA 1CJUA 4LFAJ 3EVOA 2L7HA 3T9ZA 1PJSA 2HBRB 2DKLA 3HSDA 3HVTA 4Q0BA 5IC4B 2GVZB 3EWGA 3OLAA 3SFUA 4QJVA 1UVJA 2RDJA 4C8YA 3OVSA 9ATCB 5BYQA 1FX4A 1TL1B 2JHEA 3H2UB 3I82A 2VFTA 1TGUA 5BR8J 3QATA 1YZ7A 4FYXB 3RUBL 2D9PA 3CB4A 1E6VA 2EC2A 2RQMA 4FBTA 4F04B 3CD5A 4CRJA 3BBBA 4OHZA 3GU0A 3PW5A 3U5ZB 4JV2A 3AODA 4NA1A 3BYRA 1BVSA 2UVWA 4DV1J 1N36M 2VB6A 1J5OB 2F9JA 2KFYA 4LQ3A 1HNWJ 2XWXA 5J2PA 2R4JA 3H2LA 1Q02A 2IY5B 2KXHA 4L16A 3BQ1A 3QGIA 3EPIA 1XXHE 1RAHB 5ITXA 1GMVA 3TPZA 4QZVB 2M4MA 2Q79A 1LEOA 4I64A 3PX6A 4U9RA 1Y11A 3T1YM 3HKWA 4HR2A 3W2WA 1CQNA 5ITUA 3SMPA 3GRYA 1LWCA 2DK2A 4UOCA 1VBKA 4RUCA 2ROPA 2OEKA 2RQKA 2HFSA 1HD0A 1NNDA 1BQNA 1JLQB 2R7OA 2DNQA 2QA2A 3FDSA 4OLOA 1H7XA 4JV1A 3LH2S 3Q22A 4C3KA 4LR7A 3F0NA 3R5JB 4C11B 5C2CA 1WG5A 1FD2A 1UZHA 2D7SA 2R6FA 3LA0A 3ZNJ1 1X4BA 1QAOA 3VF0B 2PEBA 1E9RA 9RUBA 3E01A 1C2PA 4A8MP 4J9KA 1K0VA 1RBLA 1FK9B 2JNHA 1WC1A 1R6BX 1JLBB 3D9BA 2R18A 4BLGA 3PZPA 4DCPB 3HX3A 2V0NA 3ZZ0A 1W25A 3KDOA 2EEYA 4FF1A 5G0RB 1F6TA 2KT5A 3M2RA 3AB2B 4RW7B 1L1TA 1Q95G 2OI2A 2DPIA 2C3UA 1SXJD 2UXBF 2CQ3A 3A8JA 4OYAA 3O6QA 1EAYC 2I6WA 1LWFA 4EIWA 2KTQA 1RAAB 3K5NA 3JSMA 5C7PA 1P27B 3VQTA 1QTNB 3GV7B 1NB7A 3ZXWA 3FMWA 2COLA 3T5HA 2MKJA 4K8RA 1PJ7A 2FVQA 2J6TA 3H2VE 4WWSA 3V6KA 1S97A 3VDPA 2QA4G 2LQJA 1G6BA 1XC9A 2VG5B 2DGSA 5FTLA 1UVIA 5D0GA 4RL1A 2XMTA 3PW0A 2JEGA 3U6PA 3IS9A 3KOWE 5LOQA 2LQBA 5D3GB 1ZAVA 3SCIE 3NS7B 3UWTA 4F3OA 4OX8A 1NHUA 1VDHA 2KM8C 3KDNA 3EVMA 5B7WA 2YVSA 4F36A 2JUJA 5ETSA 1TUWA 3BBFA 4O3PA 5JI3E 1W5SA 1AYEA 2K9DA 4JI7F 3ENAA 4Y3CA 3IAS9 4GEWA 1K3XA 1Q82T 1RHMB 4K4UA 1WDTA 2MLXA 4O23A 2FJXA 1WI8A 3HK2A 1CVJA 5KFTA 2X1AA 5I42A 1UJ6A 4PABA 2V8GA 2MDAA 2AYMA 1VQ1A 4ECTA 4OHYA 1WC0A 3QWPA 4DN9A 4LBIA 4IOAQ 2YQZA 2C3PA 3HSZA 2UXBJ 5LMNF 3GO8A 4O44A 2JVRA 2FHMA 2VD3A 2FE8A 4NI2B 1VCTA 1TAUA 4CO5A 1K1SA 4X4RA 1JLGA 1HA1A 3FJ2A 1N48A 5ITXE 1JB0C 2IM3A 2MY8A 2FFJA 3KHHA 2GHWA 4DF4A 3M8PB 4DV5M 2G0JA 1MROB 1U1RA 4ETXA 3FRHA 4FNHA 3VK8A 1AUDA 1UJ5A 2YKOA 2IDEA 3MXHP 4B9TA 1IKWA 4TQRA 4C3LA 3R6LB 2UP1A 4LF8F 1CPZA 1UFZA 2XH9A 3FFIA 1PAEX 1VQ8S 1MU2A 2HFUA 2CA9A 2ZEJA 4DPWA 3Q2SC 1S1WA 2FJAB 2XI2A 1YJ9S 3DNCA 2ROGA 1FF2A 3DYAB 2HG4A 2R46A 1TMJA 2VL1A 2YNGB 4MKAA 2E5JA 4NRWA 2DNAA 4N8OA 4F2SA 1RHUB 2B6AA 1MMDA 2ZVSA 1VRTB 4JI7J 4X66F 2G8LA 2HRUA 3FBCA 3A12A 4LRFA 3PFIA 2LVAA 3NGRA 5SZTA 1YIJS 1QAXA 2IYIA 4M63A 1N5QA 3BSAA 3TZXA 1SKRA 3VAMA 2AHOB 1GVNA 5D78A 2FQQB 2BRKA 2HQDA 4G6VB 4IFYB 2LDIA 3R5AA 2HNYA 5DLGA 1TQLA 5K9FA 8ATCB 1H0HB 4Q7AA 3MM8A 1VDDA 5LMNJ 2XNRA 1X5TA 1VISA 2C2ZB 5A8WB 2QT7A 1Q86T 1D0EA 1ZZNA 1G59A 1Y5IB 4W5WA 4QYZJ 1ZS6A 4RNAA 1YLXA 3HKPA 2F63A 3S8SA 3SASA 1URRA 3HF5A 4URQU 2WAQD 1UFKA 4FKXA 4ED7A 4DG1B 4MT1A 3VWSA 4QU7A 1HW8A 1WF1A 2R7SA 4V1Ak 1SCJB 2QRRA 3AXMA 1IXSB 5L1IA 1SIWB 1R0AA 1N33F 4K50A 1ORYB 4V19X 1KD1T 5D4NA 2HWJA 1F5CA 4LF8J 1OFIA 2YNMD 2KZSA 1NJZA 1DRZA 5IQQA 2L4FA 5J1PA 2B9XA 4QIEA 3GB0A 1B7YB 2VBZA 4K4ZA 3VZHA 1DQAA 1HQEA 1KONA 2J9DA 4JI8M 5EWFA 5AXNA 4ITQA 4NXNM 5M2RA 5KFLA 5KT3A 3ZO7A 5D0HA 2DNMA 3M8WA 5E6JA 1WWHA 3HO1A 2D7GA 1WC5A 3MGJA 4X65F 3RB6A 4PDGA 7AT1B 1RT1A 1IM4A 3G6ES 2KXEA 2R62A 4FW9A 4F7VA 1APSA 4X66J 3W8GA 4QWBA 2CPYA 3WZ0A 1FDNA 1J5EF 4Z2XA 1S0OA 1YHQS 2YH1A 5C25A 3BGRA 3PNVA 2DYAA 1FKPB 1SV5B 3M7GA 2HWHA 4KSEB 1TF0B 3D3BJ 1NHVA 3HJFA 1SXLA 3AJIB 1PKUA 2DRDA 2AGQA 3VAIA 2FJDB 4DHVA 3HZEA 2IM0A 3KG1A 4EBEA 1WXQA 1TKTB 2ZBCA 3I0RB 4XIUA 2F40A 2DZNB 3T5LA 1SH3A 3UQSA 4R71A 4LGYA 1PRBA 3T3FA 4LFAM 1FO1A 3DFZA 3GPAA 4Q45A 3R1HA 3BH7B 5GAEU 3O44A 3J81Y 1CJVB 2FY1A 3KJVA 3MM9B 3TVKA 3R8YA 3MR3A 5U47A 4OZ3A 1N5VA 1N33J 2CP8A 2JFDA 1ZETA 2CPDA 1FEHA 1P1TA 5EX3A 2RE1A 4IG0A 3J7AS 5BR8M 2X7IA 4JV0A 1LW2A 4ECSA 4LJ8A 3GQ4A 4I67A 4N76A 2ZBKB 2DD8S 3DM2A 3PX0A 4MYTA 2VOPA 2X3GA 1HPZA 4GMKA 2DH8A 1XR5A 2YQ0A 1HNWM 2ILZA 3QWLA 1J2VA 2QLXA 4EK2A 4X65J 5AXMA 1SXJE 2DZLA 2DNNA 3AY0A 1C1CB 1XMQM 4JXJA 1DLOA 1UFWA 2KB2A 3V4IB 2LECA 2HQCA 1PYOB 5E7OB 4IUFA 2DEJA 3U6EA 5LSLA 5IT0A 3QFHA 1UW4A 5HQ8A 4PCZA 1SC6A 4QHTA 2J7OA 3P8BB 3N79A 2CJ9A 4R5PA 5EGYA 1GL6A 4U7UD 4DQQA 4NXMF 4K4WA 2J76E 2BJEA 1DV0A 1OFHA 3UN5A 3AKZA 4B3TJ 5IFMA 4L4UA 2DGVA 3LTOA 3EM1A 5KG7A 3VCDA 1IKXB 4IBBA 3PYGA 2MQLA 5FD1A 2EBEA 2DHGA 2LDYA 1ELOA 3C19A 3EUNA 3TANA 2R2TA 3C58A 3D2WA 2Z56B 2YX7A 4DDFA 4KGZB 2E7VA 4YS2A 1R43A 5D15A 4IR9A 3PYDA 4P75A 4JB8B 1WGNA 1HLWA 3MZIA 1V3RA 4NEYA 1P1LA 4I4BA 2VOOA 5KG6A 4ZCMA 2HHWA 3IR6B 5CCLA 3SBMA 1I1GA 2KFNA 4ECZA 4RZRA 5RUBA 2NS1B 5DJBA 3W9IA 4XTTA 5L1LA 1VEGA 2LA6A 2W4CA 2CWBA 4HDHA 3PHEA 4CDIA 5ETTA 2AQ4A 1ZAWA 1LWXA 3BKFA 1VRUB 3CVKA 1S6QA 2CNLB 3Q23A 2HK2A 5EP3A 3FVYA 1KP6A 4JOUA 3AD8C 3TZWA 5K8MA 3PTWA 3Q8RB 1CJKA 4MIBA 1FXDA 2LVNC 1LK7A 3ZCBB 4DI6A 3TAPA 2CQPA 2QZ8A 4MGIE 4LF5F 2ATLA 2NCKL 1YRTA 1U49A 2V8VA 4F0MA 4M0DA 3JB9k 3PEJA 1FNNA 2GC8A 4I6YA 2X1FA 1U02A 2APOA 1Q8IA 4NXMJ 1KEKA 3GLFE 1ROFA 1MN7A 1V6HA 2LFVA 5BYSA 5G4DA 1VLOA 2ATCB 1NV9A 1LOUA 1W5TA 5CYQB 2K6BA 1DZ5A 3E51A 4XBOA 1RYSA 3SV4A 1HNVA 3A8EA 4R8UB 1NJXA 3RR7A 4WXOA 2EFQA 3SCKE 1SPBP 3UN3A 2Y8WA 3OD2A 3GPPA 4OZLA 2R42A 1C1KA 1VBYA 4BDPA 2B7CB 5DM6Q 3N0VA 4KPYA 2JC0A 1S1UB 4GRIA 2GIFA 1MX0A 2XF3A 3H5XA 4X64F 3K8ZA 2ERRA 5KFYA 3JTOA 4DSFA 5B0CA 5A2QS 3MEGB 2HKJA 3DXSX 2E7WA 3OBIA 4HACB 3CCUS 4K0KF 3CNQP 1S12A 1F2GA 2BW2A 4PRFA 5E3CA 2E9ZA 2AD9A 2UXBM 5FTMA 2QYCA 3H8YA 1NK4A 1B99A 4R3DA 2P6TA 1WKKA 4C8KA 5T14A 1Q39A 2BWEA 2G5GX 4ANDA 4II7A 2V50A 3R9XB 6FD1A 3KUEA 3FSXA 2MKHA 3KLFB 3KLHA 2YPYA 4LF5J 2C22A 4QOSA 3MEKA 1OAOC 2DY9A 2B4PA 5CD4A 1TKZA 4I2PB 4WIIA 3R27A 2MKKA 3VFDA 4J37A 2ZD1A 1HNXF 1UMJA 4P7VA 4IO9Q 3A13A 2N4DA 3K57A 4ECRA 2YNIB 2EI5A 3U61B 2YTCA 3UN2A 1F3FA 3MD3A 4WXWA 3OVAA 1SKUB 3TZYA 4X4VA 4OZ5A 3H5UA 1U1LA 2I5JB 2RKIB 3TR5A 4HHJA 1VJWA 3C46A 4EBDA 4FS2A 4JI7M 3TP2A 4ID5A 4NC6A 1CULB 4DR4F 2B56A 3MM5A 1VEJA 1S1TB 2R4FA 2JLEA 2M8HA 4X64J 1DARA 4P52A 2E44A 3GLIB 4TY9A 4CI0B 2Y0TA 3G86A 4ZVOB 1VRQC 2VV5A 3QZ8A 2E1CA 1V3SA 3UDCA 4DFJA 5BJRA 4CLPA 3CJ8A 4QNMA 2V8PA 5E41A 3C6TA 5LMNM 3GE9A 2L9NA 4W4MA 2ZNYA 2XZFA 2V4JB 3I4VA 2HAIA 3WC0A 1V5IB 2LU1A 5IM0B 3UNGC 3RBDA 3AH6A 2H5IB 2MGZA 5GADI 3CJRA 4EGLA 2AYEA 2EFOA 1IN6A 5JVGQ 1KFDA 2XM3A 4G4QA 3O5TB 2QMUB 1RZMA 3R5BA 2F65A 3NWRA 2JA2A 3JR5A 2HGLA 1RSCA 2OGUA 5EHHA 4AG5A 2E5HA 4N47A 3VVTA 3A98B 4NA2A 2VQEF 4F4WA 2QX0A 4LF8M 2CQDA 1Q0NA 2FIUA 1RABB 2PC6A 4ZPCA 1RQ0A 2DHRA 2QBYA 2WW4A 3A8KA 1HNXJ 3VQSA 4MKVA 4NZ6A 1EP4A 3DKDA 1IBLM 2F5NA 1U6BA 2ZWOA 3DRYA 4ZS6A 1KTQA 3DLEB 1OS5A 1U4BA 2RGOA 4RNHA 5D8HB 2LVQD 4KV8A 2W9BA 4A8SA 1ZM2A 4I68A 4DUZF 4USJC 3MD1A 3UJNA 1KHVA 1UVKA 1GH8A 1VC0A 3OXLA 5F8LA 4AFFA 3NBPA 2A18A 4X66M 1UETA 1K1QA 3DI6B 1CQMA 4YN3B 2BZ2A 2FJEB 4DR1F 4WZQA 4URGA 2Y0BB 2DVWB 5HVFA 1T11A 4ITSA 3NS5A 4BC7A 4M9ZA 3Q8UA 2KEBA 4NASA 2HIQA 3W62A 2DXEA 4ILMA 2QG9B 2KRKA 1XEZA 5HQMA 2KNAA 4ID8A 1RACB 1VI7A 2C99A 1H72C 2ZFHA 5CD4H 2GIQA 4CLWA 2ZJQQ 5IV4A 3PFOA 3THGA 1JJ4A 4WP8A 3IRXB 2ZH1A 2PE8A 3EGNA 4O4RA 4MAKA 1TK0A 4IBIA 3NAHA 3GONA 4C4WA 3W66A 2VFUA 2XLIA 1S57A 1U6FA 3KP1E 4S0MA 1U0HA 1N33M 4NPOA 2VQEJ 1VQNS 4O3OA 4DV4M 3M2UB 3D5MA 1ZBTA 3UR3C 1S79A 1Q8LA 4P9SA 1FVSA 4X62F 3TOQA 2L7IA 1Y00A 4J9MA 4HH0A 3HFKA 5ETVA 2MLYA 4KYZA 4LQ9A 4X2BA 3IFEA 1YJWS 4QQBA 3QSYB 4ZVGA 4K4SA 1CC7A 5EXPA 4DUZJ 1U1OA 1D09B 3C14A 1L3VA 4X65M 3GG1A 3KMQA 2EXUA 1N52B 5KFPA 3O8WA 1NKBA 3PJWA 3ZH9B 3RFWA 1YVFA 2QJ3A 3DU6A 2DR6A 1OJ4A 3G82A 2WONA 1NPPA 1HBOB 4DR1J 3C16A 4XPEA 3PY8A 2ILYA 1J5EM 3M9NB 4C6AA 4PDIA 3NG8A 4RX6A 2Z4RA 3N6NA 1TVRA 1Q4RA 4LR9A 1T05A 5DFLA 3KOYE 2H4WB 5HROA 4Z7YA 1IKYB 3MOZA 2HBQB 4EBCA 4OYXA 2A0FB 3F92A 3ZNUA 1EKSA 3LP2A 4G4NA 3ZC7B 1OWXA 5IXUA 5F3WA 3HT3A 2FD2A 4DR2J 1FX2A 2RAQA 3LP0B 1ZH5A 3MMPA 3T5JA 1JJCB 2VUGA 1WUUA 2J0QD 2POKA 4DPOA 1XK8A 1AW0A 4K4XA 3W1YC 4KKOB 3ILJA 3AOEC 1H2TZ 4P16A 3HT0A 2V1CA 4BB9A 2QPAA 4DR7F 3EYZA 3BO3A 4LSLB 1Z1ZA 2VA3A 3FYDA 3Q8XA 1QUTA 4NLWA 1GL7A 4UN2B 4USHA 3SFGA 3R7NB 2OUGA 2M5YA 1YGYA 1DO2A 3PW7A 4X62J
chains in the Genus database with same CATH topology
5H37D 4NLPA 1J5OA 4DL6A 3MR5A 3DOKB 3ENWA 5HMWA 2AW0A 3F56A 3DGPA 4ZP8A 1S0NA 5J2QB 2HHHF 1BQXA 2QE5A 1HNIB 3OFFA 3L27A 1HNZM 3OFHA 4QIGA 3K59A 1HT2E 4DR2M 4LFCF 2HNZB 2GJIA 2Z0GA 4O3QA 1QAJA 4M95A 3IWNC 2WSEC 1Q8BA 3TX8A 2W9CB 4PKDB 5K8NA 1DTTB 4QOZC 5A8RB 2BM0A 3GSDA 2N4CA 1RT5B 1SJFA 2FJBB 3R3TA 1ZZFA 2CPIA 3MM6A 3EGZA 1WG4A 4MB7A 2I1RA 4OHXA 2Y1JA 4AYBD 2RGHA 4X4NA 1OPIA 4IO1A 1XMOF 2C3OA 2GGPB 2M0GB 3MPWA 5JUMA 3SAUA 1XR7A 2CUZA 4QNRA 1FE4A 4YDXA 4U7UK 1N6QB 4DQPA 4AKIA 5LMUM 4YB7A 2EFNA 3D0GE 4LIWA 3SXLA 4DL2A 4Q0BB 2ZNZA 5KFXA 2EO2A 4F26A 3U27A 2DNYA 3FSIA 1VLYA 4BLCA 4LMZA 4F02A 2X49A 2MSSA 4ELUA 2UV8G 4MK7A 3OVBA 3ZZRA 1NH8A 3MEDB 4TXSA 3MK6A 1MWYA 4JI8F 2BA9A 4H4KA 2CVEA 4MJKA 5KG3A 3G6YA 3MUTP 4NXNF 4GHAA 1Z4UA 4PPZA 1D9DA 3CC7S 1RT4B 3MECA 3OHAA 2E66A 2CQ0A 2EG2A 7CATA 3TAMB 2Y20A 4O4GA 4CO3A 4GKJF 4J9NA 3IRXA 2FC9A 3SFZA 1R2ZA 5GVQA 3I96A 4FWDA 1XN9A 2QSFA 4JYAM 3GYXB 2OQ4A 2RJZA 2K2PA 3CEDA 2UUWA 3OR2A 5B0GA 2O01C 5LSOA 4O0IA 2ZH7A 4CO0A 1NRKA 2FVSA 2KT2A 4RKUC 1MW7A 3D54A 3KDSE 2FUG9 3DN9A 4MGYE 3UW1A 3L3CA 4WFYA 1S9FA 4JI3F 1JQJC 2OFGX 3EZUA 5GKNA 2ROEA 2ADCA 4KIAA 3HVRA 3J7BA 1Q3CA 3UK6A 3J7ZT 3HP6A 1HW9A 3OLBA 2F5PA 4DSLA 2EFPA 2MQNA 1B0PA 3T1AA 4X4SA 1HR0M 3MAHA 3PM9A 1KHWA 1IBMM 1E6VB 3MUMP 3PO4A 3SAWA 1L2BA 4NWBA 5KAKA 3I32A 5HLFB 3GR1A 3L95X 1UJ4A 5B0FA 5L9XA 2FLPA 2I7PA 4WU2A 2LXUA 2CKWA 3PVSA 3LQVA 1N34M 1HMVB 4ATNA 2AJQA 3TA0A 4ILRA 4F50A 2I7NA 4OI0A 3TWKA 3FUUA 5KTQA 3PX4A 3QJPA 2YWKA 1HFEL 1KR4A 2VKRA 4KO8A 1DQ8A 4OJHA 5GMKa 5J2PB 3BO2A 1QQWA 2DHSA 5DDOC 2HHVA 4NYOA 3M2UA 1JXLA 4NOHA 3BOSA 4ZCLA 4Y65A 2V1UA 3BREA 5KFRA 4LF7F 4DL0C 2VA2A 1O5JA 4RUAA 2KM8B 4L15A 2B0GA 2HNDB 4DV3F 1KTVA 4AXJA 4JI0M 1YSJA 2OPSB 4M9XA 3B9PA 4Z6YA 3NL0A 3AJ1A 3DMJA 3G6VA 4ZPDA 1G1XA 4XO0A 1O8BA 3BB5A 2EVZA 3PDNA 4NMLA 2YKQA 4DV0F 2UXDM 2JC1A 1KYIA 2IVFB 1FTRA 3X1LB 1HARA 1NU4A 2F1FA 1TL3B 2E5LF 3U7JA 1YTYA 2ZH3A 2DO4A 2F5SA 4OMFG 1SB6A 4A8YA 1S9GA 3IG1A 1WHYA 4ECVA 4RW4B 5KFMA 1SJRA 1KOHA 2HFOA 2WCXA 3GYNA 1NK5A 2YNFB 3M32A 3ITHA 4CO2A 2MHNA 1FJEB 4X84A 3W2WB 2CFOA 2VPZB 5F9LA 2ZAMA 3BQ0A 2O66A 5C42A 5EP4A 3M6WA 5KFBA 4RLEA 3H4BA 1RAJA 2I38A 4C7QA 3MUVP 2KXFA 3RB4A 4LFAF 5IT4A 2GO8A 4WJBA 2AX1A 1R3NA 2J9CA 4ECUA 3IG8A 1LWCB 1CC8A 5ITQA 2C2DA 4IIWA 3SMSA 4NX9A 1FEEA 1MMLA 3KP0E 2MMYA 3AJ2A 4ZVFA 2BV3A 2DGXA 2XGQA 2MZRA 4XGIA