4XK8F

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
total genus 45
structure length 151
sequence length 151
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 4xk8F00
4KT0F 4XK8F 2WSFF 4L6V6 2O01F 2WSCF 4Y28F 1JB0F 2WSEF 5L8RF 3LW5F 4RKUF
chains in the Genus database with same CATH superfamily
1R6BX 3U61A 4QOSA 2DAKA 2UU9M 3B9PA 4NC6A 5IWAM 3A98B 2CHGA 2QP9X 5ITXA 4LJ4A 4FWGA 5LMNM 2CE7A 3HZJA 4M9ZA 4LF5M 1J09A 2V1CA 1FJGM 1CUKA 4D81A 1GLNA 2MJ5B 2R65A 1T43A 4KO8A 5FLXS 4L16A 2JZ0A 1A5TA 1L8QA 3CF0A 3OTOM 3I51A 2KNVA 4JI5M 1HNWM 2A5YB 3QAUA 2KRUA 2MR9A 3UK6A 4L6V6 2O25A 3A45A 2L7HA 2G3QA 3CF6E 3EIEA 4LF9M 4DV1M 3FE3A 1QAMA 3GLGE 5ITQA 2Z4RA 1DGGA 2DZLA 4GRIA 1ZQ9A 4IBDA 4DV0M 2M5ZA 2F5OA 2DZOB 5EXPA 3B7NA 3U6SA 1Q3BA 3CGWA 3E21A 4YHHM 1EE8A 2Y20A 2DKLA 3TL4X 1J5EM 5FTJA 3HGIA 3KW6A 2VF8A 4QNMA 2XEPA 2OPFA 3ZC7B 1TTEA 2J7NA 4AI6A 3W68A 3ZQJA 3SHFA 1Q39A 3GLGA 2LVAA 3RGPA 2KNAA 2R46A 3A46A 1NJFA 4DUZM 3J7BA 1KSFX 2MGWA 5KQDA 4LZZA 1QANA 4NL4H 4IBGA 4LJ7A 4DV6M 3U6EA 4GKJM 1KYIA 2R44A 4CGYB 2EUCA 1WGLA 1Z6TA 1TH3A 2XFTA 5IREB 3TE6A 4BLCA 4K0KM 3PVSA 5C18A 1Z5CA 1VQ1A 1QAOA 5EP1A 3K1JA 5FTLA 3D8LA 2KA6B 1VDDA 4PCZA 3GQ3A 3AOGA 2BWEA 2XGNA 2YNMD 1NNJA 4JI6M 4AQYM 3BOSA 3L2AA 2FE8A 2CFOA 3LW5F 3MK6A 2DWNA 1IN5A 1XHBA 4D82A 1HR0M 4B3MM 1MU5A 3GLHE 3KOWE 3DZDA 4OW0A 3VK7A 2V6ZM 3I01M 1IXZA 1V33A 1VEKA 4Z6YA 3FYCA 4LCBA 3U6PA 4R3DA 2JY6B 3HJQA 5EXSA 4CIZA 4DUYM 5GKNA 2UXCM 4FW9A 2JA2A 2F5QA 2X8AA 3FTCA 5LMUM 4NRWA 4QHTA 2Z8YM 2X49A 4KODA 1LTMA 3HU2A 3Q8GA 4LJ6A 2FH0A 1P3QQ 4FCTA 1NVMA 3LQQA 4NRVA 3QWLA 2G8LA 3KXEC 3SBJA 3C58A 4JI0M 3WHKA 5BR8M 3SAUA 3GLHA 4G4QA 3KDSE 4XGIA 4PT5A 4QOZC 1XXHB 1SXJE 2LTUA 3TQSA 4OVZA 3GQ4A 1V34A 2DAEA 3I4VA 4JI3M 3GP1A 5JI3E 1WR1B 2K6BA 3U6QA 1J7KA 4QHSA 1E32A 4W5WA 3FD9A 1T6OA 3R9XB 3V76A 4R71A 4DR7M 4KT0F 1QYRA 4IBCA 1IBLM 1ZV1A 2LXEA 2DHRA 3EIHA 2R18A 4G6ZA 2ZTCA 4II7A 4M9XA 1XNQM 3SAWA 3AJIB 1GL7A 2Y0TA 3IECA 4IBIA 5BPVA 2F5NA 2BJWA 3UMMA 3JR4A 3DA1A 4AG5A 1XB2B 1SXJA 2AHMA 4DR2M 5JI2E 1NY5A 1OTRA 1NHWC 2W82A 3VFDA 1NY6A 1IXSA 1ZMUA 2P5TA 3JR5A 1OIZA 2CP8A 4MGHA 3VDPA 2KNZA 4LGYA 1G4AE 4ZPXA 3SMPA 3CTWB 1NV9A 4GEWA 3U5ZB 2C96A 3IG8A 4LZJA 2DHYA 5EP2A 2VIIA 4IBFA 3FUUA 1QZEA 2LVOC 4KLNA 4DV2M 1Q02A 5FTNA 2KHHA 4KHPM 3KS4A 3SASA 3NBXX 4LF8M 2XSZA 5EQTA 2OO9A 1VEGA 3AFHA 4LY6A 1R5LA 1W5TA 3L29A 1G3IA 4MH0E 1DGHB 3GO8A 1QQWA 3K92A 1WIVA 3JAMS 2CV0A 5DFLA 3LCVB 1QVRA 1WJ7A 2JNHA 2EJSA 2RGHA 2RGOA 3HWSA 2Y21A 1SXJC 2CV2A 4DV7M 4HL4A 3HHXA 1HNZM 4DR3M 4JXJA 4CHTB 4DR1M 2VQEM 4B3TM 4CISA 2DVWB 1HT2E 1JR3D 4NOOB 5EXXA 4YY3M 3U6MA 3R8FA 4IBKA 4GKKM 3U5ZA 2UXDM 4IJFA 2GQFA 1TH2A 5KQ8A 3T15A 3HJ8A 3I04M 4DV5M 1N34M 4QNRA 4L4UA 3FYDA 4Y28F 2XLJA 2X4AA 2KZUA 3FKEA 1ZMVA 2HWJA 4AKHA 1UM8A 4DV4M 4HLQA 1VDLA 2BWBA 3M6AA 1OQYA 1GVNA 1DGHA 1V92A 3KSJA 4MM3B 1FNNA 3HU3A 4PDIA 2HL7A 1NJGA 5C1BA 4A3VB 4NXMM 1GJSA 1YUBA 4X66M 3SC3A 3SAVA 3IHPA 3NBIA 3H4JA 3U6DA 3KS8A 4JI8M 4RF1A 1IN7A 3UGJA 3KOYE 3Q8XA 5A2QS 4B3RM 1YSYA 1JQJC 4B7FA 1IQPA 1G8PA 2CHVA 4FWDA 3IG5A 2I7PA 3PNVA 4IJEA 3FUVA 4WP2A 4X65M 2Z3XA 4MGIE 3T1HM 5EJCA 4FVMA 2E5LM 4I4LA 4LJ9A 2L4EA 1I4WA 3W67A 4DR6M 2DI0A 4LFAM 1K82A 2UUCM 4GH9A 2K0BX 3GRUA 2JY8A 2WZJA 3FTDA 4RNAA 3KSXA 3T38A 4D80A 4B08A 3GPXA 4FCWA 4AKGA 4P16A 1L1TA 2MROB 4WW0A 4L8RC 2UUBM 1PRBA 3U60B 3GLFB 5ITRA 2R4JA 1HQCA 1DO0A 5DNYA 1RU3A 3THGA 1TF0B 2BNKA 4NXNM 2DAMA 1XC8A 2F5PA 2Z7JA 3H4MA 1NHGC 4G4NA 3E46A 1IN4A 2KDLA 4AZFA 1TDZA 4XK8F 7CATA 4G4OA 3L28A 1L2DA 5IT9S 3B89A 3GLIB 1QDRA 1TGUA 5KPZA 3J80S 3LCUA 4Z8XA 2QPAA 2F4VM 4DR5M 3RGSA 3HY5A 1SXJD 4BB9A 2B3TA 2O01F 2L6OA 2CWBA 2LVNC 1XXHE 5KPTA 1JB0F 2KXEA 1NV8A 1MN3A 4PD2A 4X64M 1GABA 2CHQA 3J27B 5KPRA 3U6CA 1D0MA 3MJ5A 1E94E 2UUAM 4FD2A 1F4IA 2QBYB 4AKIA 3AL0C 2EKKA 3HU1A 4GMQA 2QNJA 2RKOA 2R6FA 1QDTA 2DWZB 2KW0A 3W0FA 2NQ8C 5EP4A 1IY1A 2JY7A 1N78A 1OFHA 4LGMA 4LG2A 2D7HA 3J81S 1IN6A 3AV0A 3B7ZA 1K3XA 2APLA 2G5GX 2Z4SA 3FRHA 4B7HA 3U61B 2CRUA 1R2ZA 2MH8A 1XXHA 3A42A 5EP3A 3K9OA 4JYAM 2ERCA 2D7EA 3K8ZA 1C7YA 3C3EA 2XH9A 2EO2A 2KEBA 1K3WA 1QZMA 3QYBA 1YE9A 5ITXE 2L09A 1W5SA 3GRVA 4X62M 1N32M 1Z59A 4UN2B 3NWLA 2VDBB 3UJNA 3F92A 1GO5A 3KOXE 3PXGA 3U6LA 3UZUA 5ITYA 4JI1M 1AUAA 1X37A 2C99A 4JI7M 3GQ5A 2JXNA 4DV3M 3MMPA 4ITQA 1D0LA 3AKZA 4AG6A 3VKHA 2LBCA 4REZA 1GL6A 1G41A 1R4GA 2EA0A 1GKIA 1IM2A 2C5RA 3KVWA 1DGFA 1QAQA 3LVVA 2C9CA 3TWKA 4B3SM 3TWLA 3LQRA 1PM5A 2DWMA 4ANRA 1WHCA 4RF0A 2FFJA 5E6JA 2D7GA 3FUWA 8CATA 2XZFA 3KOZE 4IBBA 2DZNB 3TPZA 1WGNA 1NNUC 3I4YA 4G4RA 1TR8A 3SMSA 4MGZE 3C3DA 1HJPA 1ZAEA 4FCVA 5ITUA 4JI4M 4DR4M 1OAOC 4WURA 1YLAA 2EKFA 3VDUA 2J5YA 2R45A 2VF7A 5DYIA 1I94M 3GRYA 1H6UA 1L1ZA 5FTMA 1Z5BA 5L8RF 3GLGB 2LVPC 2KRKA 1IXRC 2RRUA 4I5SA 3HHYA 1KFVA 1OFIA 3B7QA 1XNRM 1PJQA 3E9SA 4GC9A 3ZCBB 1L2CA 3SARA 3SHGB 2JP7A 4OU7A 1G71A 1WXQA 2WSEF 4LF6M 1IFYA 1PGYA 1XWIA 1JR3E 1QUSA 4JI2M 2GNOA 2M60A 3VLFB 1VG5A 2Q2EB 3MHVC 2L4FA 4LFCM 2YFQA 4LF7M 3GRRA 4CJ6A 1HNXM 1IBMM 2L2DA 3HKPA 5EXTA 1R7RA 3DFZA 2DAGA 1L2BA 4JN6A 2C9OA 2H1RA 4NSOB 2I7NA 3HX3A 4TUWA 3RFWA 2CUZA 1N36M 1IN8A 2QCUA 2XZUA 2WSCF 3ZH9B 3K2LA 2ZAOA 3L25A 2LVQD 2QQ8A 1AIPC 4GHLA 4GIPA 4AW4A 2OQ4A 2HHHM 4RKUF 2O5RA 4PDGA 1JR3A 3TWMA 1DO2A 4IBJA 3T6PA 2R0IA 1EFUB 2DNAA 3VK8A 3HHWA 4XBOA 2CEAA 3FTFA 1IBKM 1OAIA 3W0LB 4R7GA 2ZBKB 2ZTDA 3SYLA 3B74A 2YR0A 1TH4A 1UFZA 3K9PA 1ZMWA 3HJSA 1R2YA 2ZAMA 1SG9A 3SATA 4LF4M 2K9DA 4NSRA 2H5XA 1DV0A 4MGKE 1PJJA 1Y8GA 4Q7JA 1XMQM 3J7AS 3GLHB 4LJ5A 4L15A 3WHLA 2OOAA 1Z5AA 1XMOM 2F5SA 3J2PB 4LRSA 1Q3CA 3M7GA 5F3WA 3GLFE 1N33M 1D0KA 4OVZB 4B7GA 3FUTA 2XFSA 2VQFM 3RE8A 4M0WA 3BXWA 5ITTA 3M0EA 2QZ4A 4F2LA 2QHOB 3CF2A 2N35A 1TDHA 2KZSA 3KP1E 4LJAA 3VKGA 4GITA 2JWSA 2BJVA 2J7OA 4BBAA 4OX9M 1IY0A 1OJLA 2R4EA 3C9PA 2FS1A 3FUXA 1NSFA 3GPPA 3GLIE 4JV5M 1C1KA 3HHZA 1N75A 1E9SA 2DXIA 2XF3A 3LMMA 4IBEA 3GPUA 2DWLA 4I81A 3D8BA 3KP0E 5FTKA 4MB7A 1D2NA 1IY2A 1OIPA 2HCBA 2JY5A 3BBZA 5E26A 1BVSA 4EIWA 1SXJB 4L78A 3U60A 2L7IA 1HQYE 3GLFA 1OKSA 2JZ1A 3SFZA 3AOEA 4LJ8A 3L27A 4LFBM 4S12A 1T3TA 1IXSB 3U6OA 1S3SA 2UXBM 2LHCA 2JUJA 3PNYA 1HT1E 3L26A 3T1YM 3ILKA 4IIWA 1QUTA 2XSZD 1PJIA 2Y0QA 2R62A 3GLIA 5KO3A 2CV1A 3FRIA 1LV7A 2HKJA 4M9SA 1ORYB 1NO1A 1MX0A 3FTEA 1G59A 5DYGA 3KFUG 1PJSA 4P17A 1MJGM 4GHAA 2C98A 4G3OA 4FWHA 4MGYE 4LRTA 2LH0A 4F1IA 5H37D 2V1UA 2YQZA 1GJTA 2ZANA 3E4RA 4I8OA 2WSFF 1VEJA 2QBYA 2FOIC 2LWXA 3PFIA 2FNAA 2DENA 4DBGB 3DOAA 2DAIA 2HAKA 2OOBA 3LVWA 3QYEA 5FSWA 2ZM6M 4GC5A 2LNHC 3SYKA 3GPYA 1DGBA 4M0DA 4HEOA 1E9RA 2K47A 2QSFX 1PJTA 1EIJA 2QENA 3AOEC 2LHGA 5IZ7D 1N77A
chains in the Genus database with same CATH topology
4KT0F 4XK8F 2WSFF 4L6V6 2O01F 2WSCF 4Y28F 1JB0F 2WSEF 5L8RF 3LW5F 4RKUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 F;  4XK8 F;  2WSF F;  4L6V 6;  2O01 F;  2WSC F;  4Y28 F;  1JB0 F;  2WSE F;  5L8R F;  3LW5 F;  4RKU F; 
#chains in the Genus database with same CATH topology
 1R6B X;  3U61 A;  4QOS A;  2DAK A;  2UU9 M;  3B9P A;  4NC6 A;  5IWA M;  3A98 B;  2CHG A;  2QP9 X;  5ITX A;  4LJ4 A;  4FWG A;  5LMN M;  2CE7 A;  3HZJ A;  4M9Z A;  4LF5 M;  1J09 A;  2V1C A;  1FJG M;  1CUK A;  4D81 A;  1GLN A;  2MJ5 B;  2R65 A;  1T43 A;  4KO8 A;  5FLX S;  4L16 A;  2JZ0 A;  1A5T A;  1L8Q A;  3CF0 A;  3OTO M;  3I51 A;  2KNV A;  4JI5 M;  1HNW M;  2A5Y B;  3QAU A;  2KRU A;  2MR9 A;  3UK6 A;  4L6V 6;  2O25 A;  3A45 A;  2L7H A;  2G3Q A;  3CF6 E;  3EIE A;  4LF9 M;  4DV1 M;  3FE3 A;  1QAM A;  3GLG E;  5ITQ A;  2Z4R A;  1DGG A;  2DZL A;  4GRI A;  1ZQ9 A;  4IBD A;  4DV0 M;  2M5Z A;  2F5O A;  2DZO B;  5EXP A;  3B7N A;  3U6S A;  1Q3B A;  3CGW A;  3E21 A;  4YHH M;  1EE8 A;  2Y20 A;  2DKL A;  3TL4 X;  1J5E M;  5FTJ A;  3HGI A;  3KW6 A;  2VF8 A;  4QNM A;  2XEP A;  2OPF A;  3ZC7 B;  1TTE A;  2J7N A;  4AI6 A;  3W68 A;  3ZQJ A;  3SHF A;  1Q39 A;  3GLG A;  2LVA A;  3RGP A;  2KNA A;  2R46 A;  3A46 A;  1NJF A;  4DUZ M;  3J7B A;  1KSF X;  2MGW A;  5KQD A;  4LZZ A;  1QAN A;  4NL4 H;  4IBG A;  4LJ7 A;  4DV6 M;  3U6E A;  4GKJ M;  1KYI A;  2R44 A;  4CGY B;  2EUC A;  1WGL A;  1Z6T A;  1TH3 A;  2XFT A;  5IRE B;  3TE6 A;  4BLC A;  4K0K M;  3PVS A;  5C18 A;  1Z5C A;  1VQ1 A;  1QAO A;  5EP1 A;  3K1J A;  5FTL A;  3D8L A;  2KA6 B;  1VDD A;  4PCZ A;  3GQ3 A;  3AOG A;  2BWE A;  2XGN A;  2YNM D;  1NNJ A;  4JI6 M;  4AQY M;  3BOS A;  3L2A A;  2FE8 A;  2CFO A;  3LW5 F;  3MK6 A;  2DWN A;  1IN5 A;  1XHB A;  4D82 A;  1HR0 M;  4B3M M;  1MU5 A;  3GLH E;  3KOW E;  3DZD A;  4OW0 A;  3VK7 A;  2V6Z M;  3I01 M;  1IXZ A;  1V33 A;  1VEK A;  4Z6Y A;  3FYC A;  4LCB A;  3U6P A;  4R3D A;  2JY6 B;  3HJQ A;  5EXS A;  4CIZ A;  4DUY M;  5GKN A;  2UXC M;  4FW9 A;  2JA2 A;  2F5Q A;  2X8A A;  3FTC A;  5LMU M;  4NRW A;  4QHT A;  2Z8Y M;  2X49 A;  4KOD A;  1LTM A;  3HU2 A;  3Q8G A;  4LJ6 A;  2FH0 A;  1P3Q Q;  4FCT A;  1NVM A;  3LQQ A;  4NRV A;  3QWL A;  2G8L A;  3KXE C;  3SBJ A;  3C58 A;  4JI0 M;  3WHK A;  5BR8 M;  3SAU A;  3GLH A;  4G4Q A;  3KDS E;  4XGI A;  4PT5 A;  4QOZ C;  1XXH B;  1SXJ E;  2LTU A;  3TQS A;  4OVZ A;  3GQ4 A;  1V34 A;  2DAE A;  3I4V A;  4JI3 M;  3GP1 A;  5JI3 E;  1WR1 B;  2K6B A;  3U6Q A;  1J7K A;  4QHS A;  1E32 A;  4W5W A;  3FD9 A;  1T6O A;  3R9X B;  3V76 A;  4R71 A;  4DR7 M;  4KT0 F;  1QYR A;  4IBC A;  1IBL M;  1ZV1 A;  2LXE A;  2DHR A;  3EIH A;  2R18 A;  4G6Z A;  2ZTC A;  4II7 A;  4M9X A;  1XNQ M;  3SAW A;  3AJI B;  1GL7 A;  2Y0T A;  3IEC A;  4IBI A;  5BPV A;  2F5N A;  2BJW A;  3UMM A;  3JR4 A;  3DA1 A;  4AG5 A;  1XB2 B;  1SXJ A;  2AHM A;  4DR2 M;  5JI2 E;  1NY5 A;  1OTR A;  1NHW C;  2W82 A;  3VFD A;  1NY6 A;  1IXS A;  1ZMU A;  2P5T A;  3JR5 A;  1OIZ A;  2CP8 A;  4MGH A;  3VDP A;  2KNZ A;  4LGY A;  1G4A E;  4ZPX A;  3SMP A;  3CTW B;  1NV9 A;  4GEW A;  3U5Z B;  2C96 A;  3IG8 A;  4LZJ A;  2DHY A;  5EP2 A;  2VII A;  4IBF A;  3FUU A;  1QZE A;  2LVO C;  4KLN A;  4DV2 M;  1Q02 A;  5FTN A;  2KHH A;  4KHP M;  3KS4 A;  3SAS A;  3NBX X;  4LF8 M;  2XSZ A;  5EQT A;  2OO9 A;  1VEG A;  3AFH A;  4LY6 A;  1R5L A;  1W5T A;  3L29 A;  1G3I A;  4MH0 E;  1DGH B;  3GO8 A;  1QQW A;  3K92 A;  1WIV A;  3JAM S;  2CV0 A;  5DFL A;  3LCV B;  1QVR A;  1WJ7 A;  2JNH A;  2EJS A;  2RGH A;  2RGO A;  3HWS A;  2Y21 A;  1SXJ C;  2CV2 A;  4DV7 M;  4HL4 A;  3HHX A;  1HNZ M;  4DR3 M;  4JXJ A;  4CHT B;  4DR1 M;  2VQE M;  4B3T M;  4CIS A;  2DVW B;  1HT2 E;  1JR3 D;  4NOO B;  5EXX A;  4YY3 M;  3U6M A;  3R8F A;  4IBK A;  4GKK M;  3U5Z A;  2UXD M;  4IJF A;  2GQF A;  1TH2 A;  5KQ8 A;  3T15 A;  3HJ8 A;  3I04 M;  4DV5 M;  1N34 M;  4QNR A;  4L4U A;  3FYD A;  4Y28 F;  2XLJ A;  2X4A A;  2KZU A;  3FKE A;  1ZMV A;  2HWJ A;  4AKH A;  1UM8 A;  4DV4 M;  4HLQ A;  1VDL A;  2BWB A;  3M6A A;  1OQY A;  1GVN A;  1DGH A;  1V92 A;  3KSJ A;  4MM3 B;  1FNN A;  3HU3 A;  4PDI A;  2HL7 A;  1NJG A;  5C1B A;  4A3V B;  4NXM M;  1GJS A;  1YUB A;  4X66 M;  3SC3 A;  3SAV A;  3IHP A;  3NBI A;  3H4J A;  3U6D A;  3KS8 A;  4JI8 M;  4RF1 A;  1IN7 A;  3UGJ A;  3KOY E;  3Q8X A;  5A2Q S;  4B3R M;  1YSY A;  1JQJ C;  4B7F A;  1IQP A;  1G8P A;  2CHV A;  4FWD A;  3IG5 A;  2I7P A;  3PNV A;  4IJE A;  3FUV A;  4WP2 A;  4X65 M;  2Z3X A;  4MGI E;  3T1H M;  5EJC A;  4FVM A;  2E5L M;  4I4L A;  4LJ9 A;  2L4E A;  1I4W A;  3W67 A;  4DR6 M;  2DI0 A;  4LFA M;  1K82 A;  2UUC M;  4GH9 A;  2K0B X;  3GRU A;  2JY8 A;  2WZJ A;  3FTD A;  4RNA A;  3KSX A;  3T38 A;  4D80 A;  4B08 A;  3GPX A;  4FCW A;  4AKG A;  4P16 A;  1L1T A;  2MRO B;  4WW0 A;  4L8R C;  2UUB M;  1PRB A;  3U60 B;  3GLF B;  5ITR A;  2R4J A;  1HQC A;  1DO0 A;  5DNY A;  1RU3 A;  3THG A;  1TF0 B;  2BNK A;  4NXN M;  2DAM A;  1XC8 A;  2F5P A;  2Z7J A;  3H4M A;  1NHG C;  4G4N A;  3E46 A;  1IN4 A;  2KDL A;  4AZF A;  1TDZ A;  4XK8 F;  7CAT A;  4G4O A;  3L28 A;  1L2D A;  5IT9 S;  3B89 A;  3GLI B;  1QDR A;  1TGU A;  5KPZ A;  3J80 S;  3LCU A;  4Z8X A;  2QPA A;  2F4V M;  4DR5 M;  3RGS A;  3HY5 A;  1SXJ D;  4BB9 A;  2B3T A;  2O01 F;  2L6O A;  2CWB A;  2LVN C;  1XXH E;  5KPT A;  1JB0 F;  2KXE A;  1NV8 A;  1MN3 A;  4PD2 A;  4X64 M;  1GAB A;  2CHQ A;  3J27 B;  5KPR A;  3U6C A;  1D0M A;  3MJ5 A;  1E94 E;  2UUA M;  4FD2 A;  1F4I A;  2QBY B;  4AKI A;  3AL0 C;  2EKK A;  3HU1 A;  4GMQ A;  2QNJ A;  2RKO A;  2R6F A;  1QDT A;  2DWZ B;  2KW0 A;  3W0F A;  2NQ8 C;  5EP4 A;  1IY1 A;  2JY7 A;  1N78 A;  1OFH A;  4LGM A;  4LG2 A;  2D7H A;  3J81 S;  1IN6 A;  3AV0 A;  3B7Z A;  1K3X A;  2APL A;  2G5G X;  2Z4S A;  3FRH A;  4B7H A;  3U61 B;  2CRU A;  1R2Z A;  2MH8 A;  1XXH A;  3A42 A;  5EP3 A;  3K9O A;  4JYA M;  2ERC A;  2D7E A;  3K8Z A;  1C7Y A;  3C3E A;  2XH9 A;  2EO2 A;  2KEB A;  1K3W A;  1QZM A;  3QYB A;  1YE9 A;  5ITX E;  2L09 A;  1W5S A;  3GRV A;  4X62 M;  1N32 M;  1Z59 A;  4UN2 B;  3NWL A;  2VDB B;  3UJN A;  3F92 A;  1GO5 A;  3KOX E;  3PXG A;  3U6L A;  3UZU A;  5ITY A;  4JI1 M;  1AUA A;  1X37 A;  2C99 A;  4JI7 M;  3GQ5 A;  2JXN A;  4DV3 M;  3MMP A;  4ITQ A;  1D0L A;  3AKZ A;  4AG6 A;  3VKH A;  2LBC A;  4REZ A;  1GL6 A;  1G41 A;  1R4G A;  2EA0 A;  1GKI A;  1IM2 A;  2C5R A;  3KVW A;  1DGF A;  1QAQ A;  3LVV A;  2C9C A;  3TWK A;  4B3S M;  3TWL A;  3LQR A;  1PM5 A;  2DWM A;  4ANR A;  1WHC A;  4RF0 A;  2FFJ A;  5E6J A;  2D7G A;  3FUW A;  8CAT A;  2XZF A;  3KOZ E;  4IBB A;  2DZN B;  3TPZ A;  1WGN A;  1NNU C;  3I4Y A;  4G4R A;  1TR8 A;  3SMS A;  4MGZ E;  3C3D A;  1HJP A;  1ZAE A;  4FCV A;  5ITU A;  4JI4 M;  4DR4 M;  1OAO C;  4WUR A;  1YLA A;  2EKF A;  3VDU A;  2J5Y A;  2R45 A;  2VF7 A;  5DYI A;  1I94 M;  3GRY A;  1H6U A;  1L1Z A;  5FTM A;  1Z5B A;  5L8R F;  3GLG B;  2LVP C;  2KRK A;  1IXR C;  2RRU A;  4I5S A;  3HHY A;  1KFV A;  1OFI A;  3B7Q A;  1XNR M;  1PJQ A;  3E9S A;  4GC9 A;  3ZCB B;  1L2C A;  3SAR A;  3SHG B;  2JP7 A;  4OU7 A;  1G71 A;  1WXQ A;  2WSE F;  4LF6 M;  1IFY A;  1PGY A;  1XWI A;  1JR3 E;  1QUS A;  4JI2 M;  2GNO A;  2M60 A;  3VLF B;  1VG5 A;  2Q2E B;  3MHV C;  2L4F A;  4LFC M;  2YFQ A;  4LF7 M;  3GRR A;  4CJ6 A;  1HNX M;  1IBM M;  2L2D A;  3HKP A;  5EXT A;  1R7R A;  3DFZ A;  2DAG A;  1L2B A;  4JN6 A;  2C9O A;  2H1R A;  4NSO B;  2I7N A;  3HX3 A;  4TUW A;  3RFW A;  2CUZ A;  1N36 M;  1IN8 A;  2QCU A;  2XZU A;  2WSC F;  3ZH9 B;  3K2L A;  2ZAO A;  3L25 A;  2LVQ D;  2QQ8 A;  1AIP C;  4GHL A;  4GIP A;  4AW4 A;  2OQ4 A;  2HHH M;  4RKU F;  2O5R A;  4PDG A;  1JR3 A;  3TWM A;  1DO2 A;  4IBJ A;  3T6P A;  2R0I A;  1EFU B;  2DNA A;  3VK8 A;  3HHW A;  4XBO A;  2CEA A;  3FTF A;  1IBK M;  1OAI A;  3W0L B;  4R7G A;  2ZBK B;  2ZTD A;  3SYL A;  3B74 A;  2YR0 A;  1TH4 A;  1UFZ A;  3K9P A;  1ZMW A;  3HJS A;  1R2Y A;  2ZAM A;  1SG9 A;  3SAT A;  4LF4 M;  2K9D A;  4NSR A;  2H5X A;  1DV0 A;  4MGK E;  1PJJ A;  1Y8G A;  4Q7J A;  1XMQ M;  3J7A S;  3GLH B;  4LJ5 A;  4L15 A;  3WHL A;  2OOA A;  1Z5A A;  1XMO M;  2F5S A;  3J2P B;  4LRS A;  1Q3C A;  3M7G A;  5F3W A;  3GLF E;  1N33 M;  1D0K A;  4OVZ B;  4B7G A;  3FUT A;  2XFS A;  2VQF M;  3RE8 A;  4M0W A;  3BXW A;  5ITT A;  3M0E A;  2QZ4 A;  4F2L A;  2QHO B;  3CF2 A;  2N35 A;  1TDH A;  2KZS A;  3KP1 E;  4LJA A;  3VKG A;  4GIT A;  2JWS A;  2BJV A;  2J7O A;  4BBA A;  4OX9 M;  1IY0 A;  1OJL A;  2R4E A;  3C9P A;  2FS1 A;  3FUX A;  1NSF A;  3GPP A;  3GLI E;  4JV5 M;  1C1K A;  3HHZ A;  1N75 A;  1E9S A;  2DXI A;  2XF3 A;  3LMM A;  4IBE A;  3GPU A;  2DWL A;  4I81 A;  3D8B A;  3KP0 E;  5FTK A;  4MB7 A;  1D2N A;  1IY2 A;  1OIP A;  2HCB A;  2JY5 A;  3BBZ A;  5E26 A;  1BVS A;  4EIW A;  1SXJ B;  4L78 A;  3U60 A;  2L7I A;  1HQY E;  3GLF A;  1OKS A;  2JZ1 A;  3SFZ A;  3AOE A;  4LJ8 A;  3L27 A;  4LFB M;  4S12 A;  1T3T A;  1IXS B;  3U6O A;  1S3S A;  2UXB M;  2LHC A;  2JUJ A;  3PNY A;  1HT1 E;  3L26 A;  3T1Y M;  3ILK A;  4IIW A;  1QUT A;  2XSZ D;  1PJI A;  2Y0Q A;  2R62 A;  3GLI A;  5KO3 A;  2CV1 A;  3FRI A;  1LV7 A;  2HKJ A;  4M9S A;  1ORY B;  1NO1 A;  1MX0 A;  3FTE A;  1G59 A;  5DYG A;  3KFU G;  1PJS A;  4P17 A;  1MJG M;  4GHA A;  2C98 A;  4G3O A;  4FWH A;  4MGY E;  4LRT A;  2LH0 A;  4F1I A;  5H37 D;  2V1U A;  2YQZ A;  1GJT A;  2ZAN A;  3E4R A;  4I8O A;  2WSF F;  1VEJ A;  2QBY A;  2FOI C;  2LWX A;  3PFI A;  2FNA A;  2DEN A;  4DBG B;  3DOA A;  2DAI A;  2HAK A;  2OOB A;  3LVW A;  3QYE A;  5FSW A;  2ZM6 M;  4GC5 A;  2LNH C;  3SYK A;  3GPY A;  1DGB A;  4M0D A;  4HEO A;  1E9R A;  2K47 A;  2QSF X;  1PJT A;  1EIJ A;  2QEN A;  3AOE C;  2LHG A;  5IZ7 D;  1N77 A; 
#chains in the Genus database with same CATH homology
 4KT0 F;  4XK8 F;  2WSF F;  4L6V 6;  2O01 F;  2WSC F;  4Y28 F;  1JB0 F;  2WSE F;  5L8R F;  3LW5 F;  4RKU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...