4XK8F

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 45
structure length 151
sequence length 151
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 4xk8F00
2WSFF 1JB0F 4L6V6 4XK8F 5L8RF 2WSCF 2WSEF 4RKUF 2O01F 3LW5F 4Y28F 4KT0F
chains in the Genus database with same CATH superfamily
1GKIA 3L27A 3K9OA 2HHHM 1I94M 4DV4M 2LHCA 4AKGA 3GLHB 2DAEA 2Y21A 3GPYA 3A46A 3NWLA 1R4GA 3FUWA 3R9XB 5DYIA 2CV1A 4II7A 1HQYE 1LTMA 3FRIA 3GRYA 1J09A 1OJLA 1QUTA 2MH8A 3K8ZA 4M9SA 3FTCA 4NC6A 2QENA 2EJSA 2F5PA 3EIHA 1NVMA 3FUUA 1KSFX 2C9OA 2M60A 2Z4SA 3M6AA 2KEBA 2KW0A 2KHHA 3KP1E 5FTLA 4X64M 3E9SA 5ITRA 2L09A 1GABA 4IBJA 4KO8A 2D7GA 1E9SA 3A42A 1V34A 3GLFB 1DV0A 2J5YA 4LGMA 1D2NA 1ORYB 4NXNM 3SMPA 5IREB 3T15A 4DV3M 1UM8A 1FNNA 2DXIA 3AOEA 3QWLA 4HLQA 2UXDM 2JNHA 1DGGA 2B3TA 1TH2A 3FYDA 1DGHB 3ZC7B 3LW5F 3GLFA 3UK6A 3GLIA 2R0IA 1SG9A 1OIPA 2DAKA 2BWEA 1PJTA 3NBXX 3PVSA 4CGYB 3KOZE 1T43A 3U6EA 2HAKA 3W67A 3VLFB 4CJ6A 1GJSA 1DGFA 1NO1A 3MMPA 4GKJM 2LVAA 4I5SA 5DFLA 2YFQA 2QBYA 5EP4A 2R45A 3VK7A 2CHVA 2CRUA 5LMUM 2DWMA 3L29A 2I7NA 3HZJA 1NJFA 4FVMA 3CF0A 1A5TA 4QNRA 2EKKA 2YQZA 4D80A 4G4NA 2EO2A 4M0WA 1N75A 4LJAA 5EP3A 2VF8A 4HL4A 4DV0M 4QNMA 4G4RA 1Z59A 4L8RC 2XLJA 4QOZC 1XHBA 3U6MA 3HHWA 3DZDA 5E6JA 2CP8A 4A3VB 2JY8A 2CEAA 4JI6M 3I01M 2DHRA 4DV6M 4GKKM 1JR3E 1WXQA 2W82A 1IN7A 5C1BA 2UUCM 3QYBA 3LQRA 4AI6A 4L4UA 5FLXS 2ZTDA 2LTUA 3TE6A 2F5NA 2DAGA 2DZOB 4GC5A 4KODA 2ZM6M 2I7PA 2K6BA 2LVNC 3HU1A 3TWMA 1OAIA 5EJCA 2KXEA 3EIEA 2DHYA 1DO0A 3LVWA 3TPZA 1L1TA 2X4AA 3KDSE 4QHTA 1OIZA 1F4IA 2OO9A 2R4JA 3OTOM 1LV7A 1R6BX 1H6UA 1N36M 1NY6A 3J80S 4RKUF 1MN3A 1XMQM 1TGUA 1XXHB 2DNAA 2GNOA 2KZUA 3L2AA 4UN2B 2BWBA 1PJSA 5ITTA 4JI7M 1AUAA 1I4WA 2LHGA 3FD9A 4X62M 4DV2M 1TDZA 2ZBKB 1G3IA 1NHGC 2C5RA 3E46A 4NRVA 3W0FA 3I4VA 1HQCA 1GO5A 5H37D 3SBJA 1ZMVA 3A98B 1G41A 3KFUG 2JP7A 3J2PB 1OQYA 3LCVB 3GLFE 1PM5A 2R4EA 4LF8M 2E5LM 3HGIA 1E94E 2R6FA 2WSEF 2K9DA 1NNUC 1T6OA 1QDTA 1WHCA 2CE7A 3GQ3A 2VQFM 3W0LB 3WHLA 2QZ4A 1N78A 4MGKE 3U5ZA 3U60B 2YR0A 2C9CA 4PD2A 1IY1A 4LZZA 4DR6M 1TF0B 4FCVA 3KS8A 1HT1E 3BXWA 4LF7M 2DVWB 3B89A 4ZPXA 3SHFA 4KLNA 5KQDA 4DR4M 2V1UA 1QDRA 2L2DA 1QYRA 4HEOA 4PT5A 4AG6A 5EXXA 2HWJA 3FUXA 3M0EA 4LJ4A 3TQSA 3GLGE 4IBKA 3ZCBB 1GVNA 1NHWC 1ZMWA 3Q8XA 4Y28F 2APLA 1XXHA 4IBGA 2KNAA 5EP2A 1HNZM 2DWZB 4G4OA 2BNKA 3U6CA 2O01F 4IBCA 3T38A 4LZJA 1K82A 3FTFA 1JQJC 3KXEC 2F5OA 1W5TA 4QHSA 4B3TM 1XNRM 1TH3A 2VDBB 1S3SA 4LRTA 4OVZB 1HJPA 1QAQA 1E32A 1SXJA 1VEGA 3FKEA 4FCWA 4LRSA 4MGIE 5IWAM 2UU9M 1D0LA 4M0DA 8CATA 2LH0A 3JR5A 2X8AA 3F92A 4XBOA 1N34M 4B3RM 2C99A 4LFBM 3GQ4A 3B74A 4K0KM 4GRIA 4D82A 4B3MM 1QZEA 3VK8A 1P3QQ 2KNZA 2XH9A 3LQQA 2UXCM 1GL6A 2QBYB 1WIVA 2DENA 1K3WA 2YNMD 2DI0A 5EP1A 1DGBA 2DZNB 3MHVC 1N32M 3C58A 3R8FA 4B7GA 2DWLA 1VEKA 2F5SA 4IIWA 1IXZA 3FTEA 2RGOA 1GLNA 2K0BX 3PXGA 3B9PA 2LWXA 2WSFF 4NOOB 4MB7A 3RE8A 3GQ5A 3GLIB 3RGSA 5C18A 2FOIC 3SASA 2MROB 3PNVA 3K1JA 4KT0F 3W68A 1IN8A 3SYKA 3TWKA 1IXSB 1XB2B 1ZV1A 3AV0A 4M9ZA 1J5EM 4JI2M 3AOGA 1R7RA 3B7ZA 4M9XA 3SHGB 4DR3M 2JY6B 1YSYA 2Y20A 3HU3A 1IY2A 1Q39A 1T3TA 1L2BA 3HJSA 3GPXA 5EQTA 2RKOA 3L26A 2DKLA 1MJGM 1QUSA 3HWSA 1HNXM 2R62A 4RF0A 4WURA 4GHLA 3IHPA 4RF1A 4LJ9A 4DBGB 4F1IA 4GMQA 4LY6A 3JAMS 4LG2A 1XXHE 2CV0A 2R65A 1K3XA 3UZUA 1G59A 1G71A 1KYIA 1CUKA 1QAMA 4I8OA 4WW0A 5EXPA 3PFIA 1OFHA 2XFTA 1Q3BA 4EIWA 4D81A 1YUBA 4PDGA 4WP2A 4R71A 4MGZE 2LXEA 2F4VM 3SYLA 2QPAA 4B7FA 4OVZA 4XK8F 2N35A 3I51A 2EA0A 2L7IA 1XMOM 1IN4A 1EE8A 1QAOA 2G8LA 4JI4M 3M7GA 2FE8A 3HU2A 1JB0F 4IBEA 4IBIA 3GPUA 4XGIA 5KPZA 1WR1B 1IBKM 2K47A 3KSJA 1V92A 3FTDA 1Y8GA 4IJEA 1GJTA 2G5GX 2R44A 2ZTCA 3U61A 1IQPA 3B7QA 4B08A 2AHMA 4LJ7A 1IBLM 4LCBA 5A2QS 4Q7JA 2KZSA 2KRKA 1HR0M 3C3DA 2A5YB 4L78A 1Q3CA 3E21A 4PDIA 4JI1M 1YE9A 1UFZA 2RRUA 2XSZA 2L4EA 3AKZA 3U60A 3U61B 3QAUA 2G3QA 4L15A 3FE3A 3HHZA 3IG5A 3KVWA 4I81A 3VDUA 4DV7M 2ERCA 1PJIA 3LVVA 2VIIA 3ZH9B 5EXSA 3V76A 2FS1A 2GQFA 3TL4X 4REZA 4Z6YA 1PRBA 5LMNM 1E9RA 2DZLA 5KPTA 3C9PA 1VQ1A 4QOSA 5FTNA 1VDLA 4BLCA 4G4QA 3FUTA 4P17A 3KW6A 5IZ7D 1VG5A 2HL7A 4DR7M 3PNYA 2ZAOA 3QYEA 2J7NA 3K2LA 4GHAA 2XZUA 3KOWE 2XGNA 5GKNA 2X49A 3RFWA 3VKGA 2D7HA 4LJ6A 1OFIA 2C98A 2CFOA 2LVPC 2M5ZA 2UUBM 1FJGM 1C7YA 3JR4A 2CHQA 1QQWA 4LJ8A 4R3DA 2J7OA 3SAVA 1DO2A 4GIPA 3L25A 1XNQM 2LVOC 3D8BA 4NSRA 4DR2M 4W5WA 3T6PA 3HJQA 4OX9M 1Q02A 2R46A 2DAIA 4MH0E 4PCZA 3SARA 4YY3M 3SAUA 3KS4A 4JN6A 1QZMA 2CV2A 2EUCA 1HT2E 1VDDA 1Z5AA 1D0MA 2MGWA 3L28A 3CF6E 1IFYA 1N33M 2L4FA 3KP0E 5E26A 3DOAA 1Z5BA 1YLAA 2KRUA 2MJ5B 1L1ZA 3A45A 2OPFA 1NY5A 2MR9A 1SXJE 2H5XA 1NV8A 3SC3A 3U6PA 4JI8M 3BOSA 4NXMM 1W5SA 1R2YA 2NQ8C 4AW4A 4IJFA 2QHOB 2JA2A 2ZANA 4DV1M 2XZFA 3HKPA 1R5LA 2P5TA 3LCUA 5FSWA 1SXJC 5IT9S 3GRVA 4FWDA 1TTEA 2LBCA 2DWNA 3H4JA 2JY7A 2JXNA 2CUZA 3AL0C 2Z4RA 3AFHA 3MK6A 3K92A 5JI3E 4TUWA 2XEPA 1L8QA 1C1KA 2V1CA 3CTWB 2DAMA 2KNVA 1WGNA 3C3EA 2Z8YM 2RGHA 2O25A 4LF9M 4LGYA 4NRWA 3CGWA 4MGYE 1MU5A 5DNYA 1XC8A 3SFZA 4DUYM 1TH4A 2EKFA 2LNHC 4MM3B 3DA1A 4ANRA 2Z7JA 3GP1A 4ITQA 2JZ1A 3HHXA 5DYGA 3U6LA 3WHKA 5FTMA 1HNWM 2Z3XA 4MGHA 5F3WA 4OU7A 4FW9A 3THGA 3FRHA 3KSXA 1TDHA 2UXBM 3NBIA 3T1HM 3UMMA 4DR1M 1NNJA 2H1RA 2QP9X 4RNAA 3CF2A 3UJNA 2BJVA 4LF5M 2FNAA 1IBMM 3I4YA 2Y0TA 3GRUA 1J7KA 2V6ZM 3FYCA 3I04M 1L2CA 2D7EA 3SATA 1D0KA 3J27B 3U6QA 2QSFX 4OW0A 4P16A 2JUJA 1XWIA 2JY5A 1IY0A 1QANA 7CATA 5L8RF 3SAWA 5FTJA 4JI5M 4LF4M 3J7BA 3GO8A 1JR3D 5ITUA 2VQEM 3VFDA 1SXJB 3GLGB 2FFJA 1PJQA 4X65M 4BB9A 4CIZA 2WSCF 2QCUA 2CWBA 1EFUB 2QQ8A 4IBFA 4KHPM 4GH9A 4JV5M 1N77A 2HCBA 1PGYA 2L7HA 3DFZA 2BJWA 3GLHE 4BBAA 5KPRA 3Q8GA 4DR5M 3UGJA 3VKHA 1ZAEA 1IN6A 2OQ4A 1NJGA 5ITXA 5KO3A 5FTKA 4GC9A 5ITQA 1WGLA 3KOYE 4FD2A 4JI0M 2OOBA 4JI3M 3LMMA 1VEJA 1BVSA 4FCTA 1AIPC 1Z6TA 1GL7A 1L2DA 4R7GA 3IG8A 4AKHA 3GRRA 1V33A 5KQ8A 1NV9A 2O5RA 4FWHA 5BPVA 3T1YM 3BBZA 3U6DA 3U6SA 2JWSA 2VF7A 4AZFA 4G3OA 2UUAM 4X66M 3HJ8A 2FH0A 1OKSA 4JXJA 1SXJD 2Y0QA 2KA6B 4L16A 4LJ5A 4NSOB 4AQYM 1IXSA 3U6OA 5ITYA 3SMSA 4LFCM 3HY5A 3D8LA 2C96A 3FUVA 1EIJA 4L6V6 3K9PA 1ZMUA 3GPPA 2F5QA 2XFSA 2JZ0A 3TWLA 4CHTB 1PJJA 3HX3A 3GLIE 4FWGA 3ZQJA 2XF3A 3IECA 1G4AE 4JYAM 5BR8M 2QNJA 4AG5A 1ZQ9A 1OAOC 4YHHM 3KOXE 1RU3A 4F2LA 4S12A 4GEWA 2R18A 4G6ZA 3AJIB 4NL4H 3AOEC 2HKJA 3E4RA 3GLGA 4LF6M 4IBDA 4CISA 4DUZM 4B3SM 1G8PA 1MX0A 1WJ7A 4GITA 1NSFA 3RGPA 3MJ5A 3B7NA 1X37A 2CHGA 2L6OA 4LFAM 3VDPA 2WZJA 4IBBA 3H4MA 1IXRC 2KDLA 4Z8XA 3HHYA 1KFVA 1QVRA 5EXTA 1Z5CA 1R2ZA 1DGHA 2XSZD 4DV5M 2ZAMA 2LVQD 1IM2A 3GLHA 3J7AS 5JI2E 2OOAA 2Q2EB 3ILKA 4I4LA 1TR8A 4B7HA 1IN5A 3J81S 5ITXE 1OTRA 1JR3A 4AKIA 3U5ZB
chains in the Genus database with same CATH topology
2WSFF 1JB0F 4L6V6 4XK8F 5L8RF 2WSCF 2WSEF 4RKUF 2O01F 3LW5F 4Y28F 4KT0F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF F;  1JB0 F;  4L6V 6;  4XK8 F;  5L8R F;  2WSC F;  2WSE F;  4RKU F;  2O01 F;  3LW5 F;  4Y28 F;  4KT0 F; 
#chains in the Genus database with same CATH topology
 1GKI A;  3L27 A;  3K9O A;  2HHH M;  1I94 M;  4DV4 M;  2LHC A;  4AKG A;  3GLH B;  2DAE A;  2Y21 A;  3GPY A;  3A46 A;  3NWL A;  1R4G A;  3FUW A;  3R9X B;  5DYI A;  2CV1 A;  4II7 A;  1HQY E;  1LTM A;  3FRI A;  3GRY A;  1J09 A;  1OJL A;  1QUT A;  2MH8 A;  3K8Z A;  4M9S A;  3FTC A;  4NC6 A;  2QEN A;  2EJS A;  2F5P A;  3EIH A;  1NVM A;  3FUU A;  1KSF X;  2C9O A;  2M60 A;  2Z4S A;  3M6A A;  2KEB A;  2KW0 A;  2KHH A;  3KP1 E;  5FTL A;  4X64 M;  3E9S A;  5ITR A;  2L09 A;  1GAB A;  4IBJ A;  4KO8 A;  2D7G A;  1E9S A;  3A42 A;  1V34 A;  3GLF B;  1DV0 A;  2J5Y A;  4LGM A;  1D2N A;  1ORY B;  4NXN M;  3SMP A;  5IRE B;  3T15 A;  4DV3 M;  1UM8 A;  1FNN A;  2DXI A;  3AOE A;  3QWL A;  4HLQ A;  2UXD M;  2JNH A;  1DGG A;  2B3T A;  1TH2 A;  3FYD A;  1DGH B;  3ZC7 B;  3LW5 F;  3GLF A;  3UK6 A;  3GLI A;  2R0I A;  1SG9 A;  1OIP A;  2DAK A;  2BWE A;  1PJT A;  3NBX X;  3PVS A;  4CGY B;  3KOZ E;  1T43 A;  3U6E A;  2HAK A;  3W67 A;  3VLF B;  4CJ6 A;  1GJS A;  1DGF A;  1NO1 A;  3MMP A;  4GKJ M;  2LVA A;  4I5S A;  5DFL A;  2YFQ A;  2QBY A;  5EP4 A;  2R45 A;  3VK7 A;  2CHV A;  2CRU A;  5LMU M;  2DWM A;  3L29 A;  2I7N A;  3HZJ A;  1NJF A;  4FVM A;  3CF0 A;  1A5T A;  4QNR A;  2EKK A;  2YQZ A;  4D80 A;  4G4N A;  2EO2 A;  4M0W A;  1N75 A;  4LJA A;  5EP3 A;  2VF8 A;  4HL4 A;  4DV0 M;  4QNM A;  4G4R A;  1Z59 A;  4L8R C;  2XLJ A;  4QOZ C;  1XHB A;  3U6M A;  3HHW A;  3DZD A;  5E6J A;  2CP8 A;  4A3V B;  2JY8 A;  2CEA A;  4JI6 M;  3I01 M;  2DHR A;  4DV6 M;  4GKK M;  1JR3 E;  1WXQ A;  2W82 A;  1IN7 A;  5C1B A;  2UUC M;  3QYB A;  3LQR A;  4AI6 A;  4L4U A;  5FLX S;  2ZTD A;  2LTU A;  3TE6 A;  2F5N A;  2DAG A;  2DZO B;  4GC5 A;  4KOD A;  2ZM6 M;  2I7P A;  2K6B A;  2LVN C;  3HU1 A;  3TWM A;  1OAI A;  5EJC A;  2KXE A;  3EIE A;  2DHY A;  1DO0 A;  3LVW A;  3TPZ A;  1L1T A;  2X4A A;  3KDS E;  4QHT A;  1OIZ A;  1F4I A;  2OO9 A;  2R4J A;  3OTO M;  1LV7 A;  1R6B X;  1H6U A;  1N36 M;  1NY6 A;  3J80 S;  4RKU F;  1MN3 A;  1XMQ M;  1TGU A;  1XXH B;  2DNA A;  2GNO A;  2KZU A;  3L2A A;  4UN2 B;  2BWB A;  1PJS A;  5ITT A;  4JI7 M;  1AUA A;  1I4W A;  2LHG A;  3FD9 A;  4X62 M;  4DV2 M;  1TDZ A;  2ZBK B;  1G3I A;  1NHG C;  2C5R A;  3E46 A;  4NRV A;  3W0F A;  3I4V A;  1HQC A;  1GO5 A;  5H37 D;  3SBJ A;  1ZMV A;  3A98 B;  1G41 A;  3KFU G;  2JP7 A;  3J2P B;  1OQY A;  3LCV B;  3GLF E;  1PM5 A;  2R4E A;  4LF8 M;  2E5L M;  3HGI A;  1E94 E;  2R6F A;  2WSE F;  2K9D A;  1NNU C;  1T6O A;  1QDT A;  1WHC A;  2CE7 A;  3GQ3 A;  2VQF M;  3W0L B;  3WHL A;  2QZ4 A;  1N78 A;  4MGK E;  3U5Z A;  3U60 B;  2YR0 A;  2C9C A;  4PD2 A;  1IY1 A;  4LZZ A;  4DR6 M;  1TF0 B;  4FCV A;  3KS8 A;  1HT1 E;  3BXW A;  4LF7 M;  2DVW B;  3B89 A;  4ZPX A;  3SHF A;  4KLN A;  5KQD A;  4DR4 M;  2V1U A;  1QDR A;  2L2D A;  1QYR A;  4HEO A;  4PT5 A;  4AG6 A;  5EXX A;  2HWJ A;  3FUX A;  3M0E A;  4LJ4 A;  3TQS A;  3GLG E;  4IBK A;  3ZCB B;  1GVN A;  1NHW C;  1ZMW A;  3Q8X A;  4Y28 F;  2APL A;  1XXH A;  4IBG A;  2KNA A;  5EP2 A;  1HNZ M;  2DWZ B;  4G4O A;  2BNK A;  3U6C A;  2O01 F;  4IBC A;  3T38 A;  4LZJ A;  1K82 A;  3FTF A;  1JQJ C;  3KXE C;  2F5O A;  1W5T A;  4QHS A;  4B3T M;  1XNR M;  1TH3 A;  2VDB B;  1S3S A;  4LRT A;  4OVZ B;  1HJP A;  1QAQ A;  1E32 A;  1SXJ A;  1VEG A;  3FKE A;  4FCW A;  4LRS A;  4MGI E;  5IWA M;  2UU9 M;  1D0L A;  4M0D A;  8CAT A;  2LH0 A;  3JR5 A;  2X8A A;  3F92 A;  4XBO A;  1N34 M;  4B3R M;  2C99 A;  4LFB M;  3GQ4 A;  3B74 A;  4K0K M;  4GRI A;  4D82 A;  4B3M M;  1QZE A;  3VK8 A;  1P3Q Q;  2KNZ A;  2XH9 A;  3LQQ A;  2UXC M;  1GL6 A;  2QBY B;  1WIV A;  2DEN A;  1K3W A;  2YNM D;  2DI0 A;  5EP1 A;  1DGB A;  2DZN B;  3MHV C;  1N32 M;  3C58 A;  3R8F A;  4B7G A;  2DWL A;  1VEK A;  2F5S A;  4IIW A;  1IXZ A;  3FTE A;  2RGO A;  1GLN A;  2K0B X;  3PXG A;  3B9P A;  2LWX A;  2WSF F;  4NOO B;  4MB7 A;  3RE8 A;  3GQ5 A;  3GLI B;  3RGS A;  5C18 A;  2FOI C;  3SAS A;  2MRO B;  3PNV A;  3K1J A;  4KT0 F;  3W68 A;  1IN8 A;  3SYK A;  3TWK A;  1IXS B;  1XB2 B;  1ZV1 A;  3AV0 A;  4M9Z A;  1J5E M;  4JI2 M;  3AOG A;  1R7R A;  3B7Z A;  4M9X A;  3SHG B;  4DR3 M;  2JY6 B;  1YSY A;  2Y20 A;  3HU3 A;  1IY2 A;  1Q39 A;  1T3T A;  1L2B A;  3HJS A;  3GPX A;  5EQT A;  2RKO A;  3L26 A;  2DKL A;  1MJG M;  1QUS A;  3HWS A;  1HNX M;  2R62 A;  4RF0 A;  4WUR A;  4GHL A;  3IHP A;  4RF1 A;  4LJ9 A;  4DBG B;  4F1I A;  4GMQ A;  4LY6 A;  3JAM S;  4LG2 A;  1XXH E;  2CV0 A;  2R65 A;  1K3X A;  3UZU A;  1G59 A;  1G71 A;  1KYI A;  1CUK A;  1QAM A;  4I8O A;  4WW0 A;  5EXP A;  3PFI A;  1OFH A;  2XFT A;  1Q3B A;  4EIW A;  4D81 A;  1YUB A;  4PDG A;  4WP2 A;  4R71 A;  4MGZ E;  2LXE A;  2F4V M;  3SYL A;  2QPA A;  4B7F A;  4OVZ A;  4XK8 F;  2N35 A;  3I51 A;  2EA0 A;  2L7I A;  1XMO M;  1IN4 A;  1EE8 A;  1QAO A;  2G8L A;  4JI4 M;  3M7G A;  2FE8 A;  3HU2 A;  1JB0 F;  4IBE A;  4IBI A;  3GPU A;  4XGI A;  5KPZ A;  1WR1 B;  1IBK M;  2K47 A;  3KSJ A;  1V92 A;  3FTD A;  1Y8G A;  4IJE A;  1GJT A;  2G5G X;  2R44 A;  2ZTC A;  3U61 A;  1IQP A;  3B7Q A;  4B08 A;  2AHM A;  4LJ7 A;  1IBL M;  4LCB A;  5A2Q S;  4Q7J A;  2KZS A;  2KRK A;  1HR0 M;  3C3D A;  2A5Y B;  4L78 A;  1Q3C A;  3E21 A;  4PDI A;  4JI1 M;  1YE9 A;  1UFZ A;  2RRU A;  2XSZ A;  2L4E A;  3AKZ A;  3U60 A;  3U61 B;  3QAU A;  2G3Q A;  4L15 A;  3FE3 A;  3HHZ A;  3IG5 A;  3KVW A;  4I81 A;  3VDU A;  4DV7 M;  2ERC A;  1PJI A;  3LVV A;  2VII A;  3ZH9 B;  5EXS A;  3V76 A;  2FS1 A;  2GQF A;  3TL4 X;  4REZ A;  4Z6Y A;  1PRB A;  5LMN M;  1E9R A;  2DZL A;  5KPT A;  3C9P A;  1VQ1 A;  4QOS A;  5FTN A;  1VDL A;  4BLC A;  4G4Q A;  3FUT A;  4P17 A;  3KW6 A;  5IZ7 D;  1VG5 A;  2HL7 A;  4DR7 M;  3PNY A;  2ZAO A;  3QYE A;  2J7N A;  3K2L A;  4GHA A;  2XZU A;  3KOW E;  2XGN A;  5GKN A;  2X49 A;  3RFW A;  3VKG A;  2D7H A;  4LJ6 A;  1OFI A;  2C98 A;  2CFO A;  2LVP C;  2M5Z A;  2UUB M;  1FJG M;  1C7Y A;  3JR4 A;  2CHQ A;  1QQW A;  4LJ8 A;  4R3D A;  2J7O A;  3SAV A;  1DO2 A;  4GIP A;  3L25 A;  1XNQ M;  2LVO C;  3D8B A;  4NSR A;  4DR2 M;  4W5W A;  3T6P A;  3HJQ A;  4OX9 M;  1Q02 A;  2R46 A;  2DAI A;  4MH0 E;  4PCZ A;  3SAR A;  4YY3 M;  3SAU A;  3KS4 A;  4JN6 A;  1QZM A;  2CV2 A;  2EUC A;  1HT2 E;  1VDD A;  1Z5A A;  1D0M A;  2MGW A;  3L28 A;  3CF6 E;  1IFY A;  1N33 M;  2L4F A;  3KP0 E;  5E26 A;  3DOA A;  1Z5B A;  1YLA A;  2KRU A;  2MJ5 B;  1L1Z A;  3A45 A;  2OPF A;  1NY5 A;  2MR9 A;  1SXJ E;  2H5X A;  1NV8 A;  3SC3 A;  3U6P A;  4JI8 M;  3BOS A;  4NXM M;  1W5S A;  1R2Y A;  2NQ8 C;  4AW4 A;  4IJF A;  2QHO B;  2JA2 A;  2ZAN A;  4DV1 M;  2XZF A;  3HKP A;  1R5L A;  2P5T A;  3LCU A;  5FSW A;  1SXJ C;  5IT9 S;  3GRV A;  4FWD A;  1TTE A;  2LBC A;  2DWN A;  3H4J A;  2JY7 A;  2JXN A;  2CUZ A;  3AL0 C;  2Z4R A;  3AFH A;  3MK6 A;  3K92 A;  5JI3 E;  4TUW A;  2XEP A;  1L8Q A;  1C1K A;  2V1C A;  3CTW B;  2DAM A;  2KNV A;  1WGN A;  3C3E A;  2Z8Y M;  2RGH A;  2O25 A;  4LF9 M;  4LGY A;  4NRW A;  3CGW A;  4MGY E;  1MU5 A;  5DNY A;  1XC8 A;  3SFZ A;  4DUY M;  1TH4 A;  2EKF A;  2LNH C;  4MM3 B;  3DA1 A;  4ANR A;  2Z7J A;  3GP1 A;  4ITQ A;  2JZ1 A;  3HHX A;  5DYG A;  3U6L A;  3WHK A;  5FTM A;  1HNW M;  2Z3X A;  4MGH A;  5F3W A;  4OU7 A;  4FW9 A;  3THG A;  3FRH A;  3KSX A;  1TDH A;  2UXB M;  3NBI A;  3T1H M;  3UMM A;  4DR1 M;  1NNJ A;  2H1R A;  2QP9 X;  4RNA A;  3CF2 A;  3UJN A;  2BJV A;  4LF5 M;  2FNA A;  1IBM M;  3I4Y A;  2Y0T A;  3GRU A;  1J7K A;  2V6Z M;  3FYC A;  3I04 M;  1L2C A;  2D7E A;  3SAT A;  1D0K A;  3J27 B;  3U6Q A;  2QSF X;  4OW0 A;  4P16 A;  2JUJ A;  1XWI A;  2JY5 A;  1IY0 A;  1QAN A;  7CAT A;  5L8R F;  3SAW A;  5FTJ A;  4JI5 M;  4LF4 M;  3J7B A;  3GO8 A;  1JR3 D;  5ITU A;  2VQE M;  3VFD A;  1SXJ B;  3GLG B;  2FFJ A;  1PJQ A;  4X65 M;  4BB9 A;  4CIZ A;  2WSC F;  2QCU A;  2CWB A;  1EFU B;  2QQ8 A;  4IBF A;  4KHP M;  4GH9 A;  4JV5 M;  1N77 A;  2HCB A;  1PGY A;  2L7H A;  3DFZ A;  2BJW A;  3GLH E;  4BBA A;  5KPR A;  3Q8G A;  4DR5 M;  3UGJ A;  3VKH A;  1ZAE A;  1IN6 A;  2OQ4 A;  1NJG A;  5ITX A;  5KO3 A;  5FTK A;  4GC9 A;  5ITQ A;  1WGL A;  3KOY E;  4FD2 A;  4JI0 M;  2OOB A;  4JI3 M;  3LMM A;  1VEJ A;  1BVS A;  4FCT A;  1AIP C;  1Z6T A;  1GL7 A;  1L2D A;  4R7G A;  3IG8 A;  4AKH A;  3GRR A;  1V33 A;  5KQ8 A;  1NV9 A;  2O5R A;  4FWH A;  5BPV A;  3T1Y M;  3BBZ A;  3U6D A;  3U6S A;  2JWS A;  2VF7 A;  4AZF A;  4G3O A;  2UUA M;  4X66 M;  3HJ8 A;  2FH0 A;  1OKS A;  4JXJ A;  1SXJ D;  2Y0Q A;  2KA6 B;  4L16 A;  4LJ5 A;  4NSO B;  4AQY M;  1IXS A;  3U6O A;  5ITY A;  3SMS A;  4LFC M;  3HY5 A;  3D8L A;  2C96 A;  3FUV A;  1EIJ A;  4L6V 6;  3K9P A;  1ZMU A;  3GPP A;  2F5Q A;  2XFS A;  2JZ0 A;  3TWL A;  4CHT B;  1PJJ A;  3HX3 A;  3GLI E;  4FWG A;  3ZQJ A;  2XF3 A;  3IEC A;  1G4A E;  4JYA M;  5BR8 M;  2QNJ A;  4AG5 A;  1ZQ9 A;  1OAO C;  4YHH M;  3KOX E;  1RU3 A;  4F2L A;  4S12 A;  4GEW A;  2R18 A;  4G6Z A;  3AJI B;  4NL4 H;  3AOE C;  2HKJ A;  3E4R A;  3GLG A;  4LF6 M;  4IBD A;  4CIS A;  4DUZ M;  4B3S M;  1G8P A;  1MX0 A;  1WJ7 A;  4GIT A;  1NSF A;  3RGP A;  3MJ5 A;  3B7N A;  1X37 A;  2CHG A;  2L6O A;  4LFA M;  3VDP A;  2WZJ A;  4IBB A;  3H4M A;  1IXR C;  2KDL A;  4Z8X A;  3HHY A;  1KFV A;  1QVR A;  5EXT A;  1Z5C A;  1R2Z A;  1DGH A;  2XSZ D;  4DV5 M;  2ZAM A;  2LVQ D;  1IM2 A;  3GLH A;  3J7A S;  5JI2 E;  2OOA A;  2Q2E B;  3ILK A;  4I4L A;  1TR8 A;  4B7H A;  1IN5 A;  3J81 S;  5ITX E;  1OTR A;  1JR3 A;  4AKI A;  3U5Z B; 
#chains in the Genus database with same CATH homology
 2WSF F;  1JB0 F;  4L6V 6;  4XK8 F;  5L8R F;  2WSC F;  2WSE F;  4RKU F;  2O01 F;  3LW5 F;  4Y28 F;  4KT0 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...