4XK8F

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 45
structure length 151
sequence length 151
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 4xk8F00
3LW5F 4XK8F 4Y28F 4KT0F 1JB0F 4L6V6 2WSFF 2WSEF 5L8RF 4RKUF 2WSCF 2O01F
chains in the Genus database with same CATH superfamily
3ILKA 4IJEA 1IN5A 1LTMA 3M7GA 3J80S 4AW4A 5A2QS 2C9CA 1GLNA 4ANRA 1V33A 2KHHA 4QNRA 4PDGA 4DV6M 3SAVA 1S3SA 3M6AA 4GITA 4P16A 1AUAA 3SFZA 2JA2A 2ZANA 3ZH9B 2D7HA 2XSZD 1VDLA 1E32A 1WR1B 2DAKA 2O5RA 2Y0TA 3TWLA 2MR9A 3C3DA 3HHZA 4XBOA 1HT2E 2QHOB 2EO2A 2MGWA 2QP9X 3HHXA 2FS1A 4BB9A 1UFZA 1R2ZA 5FTJA 4K0KM 1ZMWA 3SMSA 4KLNA 2I7NA 2CUZA 1E9SA 2MROB 5EJCA 2C5RA 4TUWA 1V34A 2LNHC 3DFZA 2F4VM 4JN6A 1TH3A 2EKFA 5EXPA 1QANA 1G71A 2FE8A 1Q3CA 2O01F 3TL4X 3SASA 4LZZA 3CGWA 2R44A 3FD9A 1L8QA 4G4NA 4OU7A 5ITXA 2LVPC 3FYCA 2MJ5B 2OO9A 3HJSA 4X65M 3GLFA 4JI7M 1WJ7A 3MK6A 3T6PA 5ITXE 4DR1M 4AKHA 2XEPA 4I81A 4LFCM 3H4MA 4IBKA 5DYIA 4LGYA 4GEWA 4NXMM 1VEGA 4IBEA 4LJ7A 1K3WA 1PJJA 3K9OA 2OOAA 4CJ6A 2R62A 2R6FA 2L4FA 3CTWB 4KO8A 4QHTA 3T15A 3KVWA 3VK8A 3UZUA 1IXRC 1K3XA 2JY6B 2A5YB 1GABA 2LVQD 3I4YA 4B3TM 3HU1A 2JWSA 4JI4M 4JI6M 1OAIA 5EP3A 2KA6B 2M5ZA 4G6ZA 4XK8F 8CATA 1NNUC 1T43A 2YNMD 4JI5M 2C98A 1N36M 1AIPC 3LVVA 2QCUA 3UK6A 3V76A 1N32M 1NNJA 1VEJA 2KRKA 3C58A 2QBYA 4OVZB 1OFHA 1D0KA 1XB2B 4ITQA 1R6BX 2H1RA 3HZJA 3B89A 3K1JA 3QYBA 2VQEM 4B7FA 3TWMA 1G59A 4MGYE 3GPUA 2DNAA 4FCTA 4WW0A 4MGHA 3Q8XA 3AOEC 2YFQA 2QSFX 4B7HA 3GQ5A 3J27B 3M0EA 2GNOA 2OOBA 1XXHE 2AHMA 4FCVA 2ZBKB 3IG8A 5ITYA 1OQYA 1GVNA 1XMOM 1XXHA 3H4JA 3FTFA 1D0LA 2JY7A 4L16A 2LVNC 3D8BA 2K9DA 3J7BA 2W82A 3GQ4A 1TGUA 2C96A 1NJGA 2EUCA 3EIEA 3U6MA 4HL4A 2XFTA 3HGIA 5EP4A 3LMMA 2BJWA 1YE9A 3QAUA 3K92A 4MH0E 4G4QA 1QAQA 2CHVA 2X8AA 4LF5M 4B3MM 5EXSA 4NOOB 4Z6YA 2F5OA 1PRBA 3DZDA 3VLFB 3VK7A 2F5NA 5KO3A 2DKLA 3SAUA 1J5EM 3U61A 1N77A 5DFLA 1G41A 1JR3D 1YLAA 3GRVA 3I04M 5EQTA 5IREB 2CV0A 2DHYA 4R71A 5KQ8A 5E6JA 2DZOB 1GJTA 2L7HA 1DGFA 3FRIA 1IBLM 3U6OA 1VG5A 2Z4SA 5FTMA 3W0LB 3L26A 3GLFE 4M0WA 2DAIA 4FW9A 4M9ZA 2DENA 1R7RA 3C3EA 1QDRA 2LVOC 2DAEA 2LBCA 1Z59A 1N34M 1QUTA 3SATA 3MHVC 3U6CA 2D7GA 5IT9S 3BOSA 1G3IA 1QYRA 3SHFA 5DNYA 1P3QQ 4MB7A 2R45A 4Q7JA 3GQ3A 3LQQA 5BR8M 3HU3A 4DBGB 3GLIA 4HLQA 4DR3M 1HNXM 4X62M 2L2DA 3GPPA 1VQ1A 3VDUA 3AOGA 3KDSE 2KDLA 4PDIA 4I5SA 3SBJA 1H6UA 3SYKA 3VFDA 3W68A 4PCZA 2LH0A 2JZ0A 3R8FA 1XHBA 3IECA 5BPVA 1W5TA 1SXJA 4KODA 2RGHA 1QZEA 4GH9A 3GP1A 3L25A 2G8LA 3GRUA 4DV5M 3AKZA 3HY5A 4IBCA 2DAGA 2R18A 4FWDA 2F5PA 4X66M 3RE8A 1DO2A 2I7PA 3FTCA 4GC5A 4DUZM 2V6ZM 1GJSA 1OFIA 3F92A 1XMQM 2J7OA 4LGMA 4IBBA 1EFUB 2KNZA 5KPZA 2ZAMA 1JQJC 3WHKA 1QQWA 4G4RA 3JR4A 4FCWA 3JR5A 2Z4RA 1FJGM 1N33M 4D80A 1QAMA 2DZNB 3L27A 5C18A 3D8LA 4MGIE 2CV2A 1LV7A 1OIZA 2X4AA 4IJFA 3GLGA 4DV7M 2E5LM 2QBYB 1EE8A 2UUAM 2LVAA 3W67A 2WSEF 4A3VB 5L8RF 1HJPA 1XWIA 3CF2A 4DR6M 4DUYM 3KSXA 4Y28F 2CHGA 2L09A 3C9PA 3E46A 3QYEA 4HEOA 1NY5A 2CWBA 5IWAM 4DV2M 2HCBA 1QDTA 1R5LA 4DV0M 2R65A 1TH4A 4MGZE 1DGHA 3JAMS 1OJLA 5FSWA 2YQZA 3VDPA 2XLJA 3CF6E 2FNAA 2XF3A 2NQ8C 2RGOA 4YY3M 1TTEA 2KZSA 3HJ8A 3U6PA 4RF0A 2QZ4A 1SXJC 1GL7A 2DVWB 2JY8A 3E4RA 3T1HM 2F5SA 3KXEC 2ZM6M 2Q2EB 1NV9A 3KOZE 5FTLA 1ZMVA 2VF8A 1IM2A 3AL0C 4LRTA 4RF1A 1NO1A 2G5GX 2OQ4A 1IBKM 3NWLA 2BWEA 2DWMA 3B9PA 2CE7A 4L8RC 1VDDA 3IG5A 1OKSA 4JI2M 4LJ4A 3U5ZB 4D81A 5EXXA 3FTDA 4CIZA 4GKJM 3ZCBB 3A46A 3TE6A 3THGA 3U5ZA 2JUJA 2L7IA 4B7GA 2BJVA 1WGLA 2DWLA 3NBXX 4LJAA 1UM8A 3R9XB 1TH2A 3KW6A 4LCBA 3A42A 4OW0A 5JI2E 3SMPA 4ZPXA 4Z8XA 4F2LA 2KNVA 3GLHE 4JI3M 3Q8GA 3LCVB 1MJGM 2DHRA 3HU2A 1Z5BA 3GLHB 2J5YA 5KPRA 3TPZA 4AG5A 2FH0A 2R46A 2XH9A 4BBAA 5LMUM 1IFYA 3K9PA 4W5WA 2V1UA 5ITUA 4GIPA 3SC3A 4LY6A 2LWXA 2C99A 1KYIA 4FD2A 4FWHA 2X49A 2RRUA 3GPXA 3B7QA 3FYDA 2DAMA 2C9OA 1N78A 1IY0A 2CP8A 1Q3BA 1D2NA 2DWNA 4M9SA 4QNMA 3HX3A 2HAKA 1X37A 2Z8YM 1PGYA 3RGPA 1WXQA 4WP2A 4JV5M 4KHPM 5F3WA 2F5QA 2V1CA 1PJIA 3L29A 1HR0M 3I01M 1WHCA 4R3DA 3K2LA 1DO0A 1IN4A 1SXJD 5EXTA 1IY2A 4DV4M 2DXIA 2CV1A 4DV1M 4LF4M 2XZFA 1DGBA 4LFBM 2WZJA 1I94M 3A98B 2KNAA 3K8ZA 4REZA 1WIVA 4JI0M 1YSYA 2JXNA 2XSZA 5C1BA 3KP0E 4P17A 4AG6A 1G4AE 4GRIA 4CHTB 1HNWM 1NJFA 1ZQ9A 1HNZM 2XGNA 5FTKA 3E21A 1HT1E 2XFSA 4M0DA 1Q39A 2Y20A 3KOYE 3VKHA 2QNJA 2EA0A 2HWJA 1JB0F 1Z5AA 3EIHA 2CEAA 2R0IA 4UN2B 3PXGA 5KPTA 1OAOC 2CFOA 2GQFA 4XGIA 4GKKM 4LJ8A 1TDHA 5KQDA 3GLGB 1HQCA 2JY5A 2UXCM 2WSFF 1SXJE 4EIWA 2N35A 2ZTCA 2JP7A 4DV3M 3NBIA 4B08A 1NVMA 4GHAA 3FTEA 1QUSA 3LW5F 5H37D 3BBZA 1SG9A 2D7EA 1XNRM 3U6LA 1KFVA 2QPAA 3HHWA 3GLIB 4OX9M 2QENA 1V92A 2ERCA 5DYGA 4AZFA 3DA1A 2FOIC 2J7NA 4L6V6 5LMNM 1VEKA 2LTUA 2Y21A 1HQYE 2Z3XA 3HHYA 4LZJA 3T1YM 3QWLA 1K82A 2UXBM 2UU9M 2KZUA 4LJ6A 2EKKA 4NL4H 1IN6A 1R2YA 3U60A 2R4EA 2M60A 4JI1M 2BNKA 2KEBA 3KSJA 2VDBB 5IZ7D 4LF8M 1IN8A 3SHGB 2VIIA 4G4OA 4AKGA 1OTRA 5FLXS 4QHSA 3PNVA 4DR5M 5EP1A 1W5SA 4B3RM 1J7KA 2YR0A 2KW0A 1GO5A 3TQSA 2KRUA 1Q02A 3U61B 1RU3A 2DI0A 4I8OA 4L78A 1I4WA 3PFIA 4IBIA 2B3TA 4LG2A 1D0MA 1BVSA 1NV8A 4GC9A 4QOSA 3AFHA 5ITRA 4IBGA 3MJ5A 3KOXE 3J7AS 1YUBA 3KS8A 1IXZA 3PNYA 3CF0A 3FUVA 1PJSA 4NRWA 3FUTA 2DWZB 3KP1E 3LVWA 4LJ5A 4B3SM 3GO8A 1T3TA 1L1TA 3AJIB 3GLHA 5E26A 3B74A 1MX0A 3ZQJA 7CATA 4IIWA 1N75A 1IBMM 1TF0B 2APLA 4CISA 1T6OA 1E9RA 1PM5A 3B7ZA 1DGHB 1MN3A 4AKIA 2BWBA 2DZLA 1G8PA 1KSFX 3KOWE 5ITQA 3U6QA 4WURA 3KFUG 1MU5A 3AV0A 3MMPA 4IBFA 4AQYM 3FRHA 1CUKA 2L6OA 4RKUF 3I4VA 1E94E 2O25A 4FVMA 2ZAOA 4PD2A 2K47A 1L2CA 4JI8M 2JNHA 4LF6M 1PJTA 3J81S 4DR7M 3U6SA 3HKPA 4RNAA 4NRVA 1A5TA 3U60B 2HHHM 1JR3A 4BLCA 3ZC7B 4LF9M 4PT5A 4I4LA 3GRRA 4R7GA 1L2DA 1OIPA 2CHQA 1DGGA 2QQ8A 4NSOB 1R4GA 1JR3E 3L28A 1XC8A 3SAWA 1XNQM 3OTOM 2HKJA 1TR8A 1NY6A 2G3QA 1ZAEA 3KS4A 2Z7JA 3U6DA 3DOAA 3GLGE 1NHWC 3E9SA 1QAOA 2UUCM 4OVZA 4NXNM 4L15A 3GPYA 3AOEA 3FKEA 1EIJA 1IXSA 1QZMA 4G3OA 3UMMA 4S12A 3UJNA 2WSCF 2LHCA 2CRUA 1DV0A 1IXSB 3FUXA 2VQFM 2MH8A 2R4JA 1L2BA 1IQPA 5EP2A 2UUBM 1GL6A 1Y8GA 1WGNA 1L1ZA 4LRSA 4YHHM 1IN7A 1ZV1A 3RGSA 1QVRA 1ZMUA 2JZ1A 4NSRA 4MM3B 1Z6TA 2LXEA 1NSFA 1IY1A 3J2PB 3HWSA 1NHGC 2VF7A 3PVSA 2K0BX 4D82A 4NC6A 3W0FA 5ITTA 1PJQA 1C1KA 2HL7A 1XXHB 4II7A 1J09A 4FWGA 4LJ9A 4DR4M 4LFAM 3FE3A 4L4UA 3B7NA 3I51A 2P5TA 3FUUA 3WHLA 4GHLA 1F4IA 3HJQA 3GLFB 3GRYA 2UXDM 1C7YA 4JXJA 3GLIE 3U6EA 4IBDA 3L2AA 3TWKA 5JI3E 2OPFA 4JYAM 2ZTDA 3LCUA 1SXJB 2Y0QA 3IHPA 3SYLA 3UGJA 2FFJA 3A45A 1ORYB 3T38A 4KT0F 4F1IA 1Z5CA 4GMQA 4CGYB 2EJSA 4MGKE 3RFWA 4LF7M 3VKGA 2H5XA 3FUWA 1GKIA 4DR2M 3BXWA 3SARA 1FNNA 2KXEA 5FTNA 1TDZA 5GKNA 2RKOA 3LQRA 2XZUA 4M9XA 4X64M 4AI6A 4IBJA 2K6BA 2LHGA 2L4EA 4QOZC
chains in the Genus database with same CATH topology
3LW5F 4XK8F 4Y28F 4KT0F 1JB0F 4L6V6 2WSFF 2WSEF 5L8RF 4RKUF 2WSCF 2O01F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 F;  4XK8 F;  4Y28 F;  4KT0 F;  1JB0 F;  4L6V 6;  2WSF F;  2WSE F;  5L8R F;  4RKU F;  2WSC F;  2O01 F; 
#chains in the Genus database with same CATH topology
 3ILK A;  4IJE A;  1IN5 A;  1LTM A;  3M7G A;  3J80 S;  4AW4 A;  5A2Q S;  2C9C A;  1GLN A;  4ANR A;  1V33 A;  2KHH A;  4QNR A;  4PDG A;  4DV6 M;  3SAV A;  1S3S A;  3M6A A;  4GIT A;  4P16 A;  1AUA A;  3SFZ A;  2JA2 A;  2ZAN A;  3ZH9 B;  2D7H A;  2XSZ D;  1VDL A;  1E32 A;  1WR1 B;  2DAK A;  2O5R A;  2Y0T A;  3TWL A;  2MR9 A;  3C3D A;  3HHZ A;  4XBO A;  1HT2 E;  2QHO B;  2EO2 A;  2MGW A;  2QP9 X;  3HHX A;  2FS1 A;  4BB9 A;  1UFZ A;  1R2Z A;  5FTJ A;  4K0K M;  1ZMW A;  3SMS A;  4KLN A;  2I7N A;  2CUZ A;  1E9S A;  2MRO B;  5EJC A;  2C5R A;  4TUW A;  1V34 A;  2LNH C;  3DFZ A;  2F4V M;  4JN6 A;  1TH3 A;  2EKF A;  5EXP A;  1QAN A;  1G71 A;  2FE8 A;  1Q3C A;  2O01 F;  3TL4 X;  3SAS A;  4LZZ A;  3CGW A;  2R44 A;  3FD9 A;  1L8Q A;  4G4N A;  4OU7 A;  5ITX A;  2LVP C;  3FYC A;  2MJ5 B;  2OO9 A;  3HJS A;  4X65 M;  3GLF A;  4JI7 M;  1WJ7 A;  3MK6 A;  3T6P A;  5ITX E;  4DR1 M;  4AKH A;  2XEP A;  4I81 A;  4LFC M;  3H4M A;  4IBK A;  5DYI A;  4LGY A;  4GEW A;  4NXM M;  1VEG A;  4IBE A;  4LJ7 A;  1K3W A;  1PJJ A;  3K9O A;  2OOA A;  4CJ6 A;  2R62 A;  2R6F A;  2L4F A;  3CTW B;  4KO8 A;  4QHT A;  3T15 A;  3KVW A;  3VK8 A;  3UZU A;  1IXR C;  1K3X A;  2JY6 B;  2A5Y B;  1GAB A;  2LVQ D;  3I4Y A;  4B3T M;  3HU1 A;  2JWS A;  4JI4 M;  4JI6 M;  1OAI A;  5EP3 A;  2KA6 B;  2M5Z A;  4G6Z A;  4XK8 F;  8CAT A;  1NNU C;  1T43 A;  2YNM D;  4JI5 M;  2C98 A;  1N36 M;  1AIP C;  3LVV A;  2QCU A;  3UK6 A;  3V76 A;  1N32 M;  1NNJ A;  1VEJ A;  2KRK A;  3C58 A;  2QBY A;  4OVZ B;  1OFH A;  1D0K A;  1XB2 B;  4ITQ A;  1R6B X;  2H1R A;  3HZJ A;  3B89 A;  3K1J A;  3QYB A;  2VQE M;  4B7F A;  3TWM A;  1G59 A;  4MGY E;  3GPU A;  2DNA A;  4FCT A;  4WW0 A;  4MGH A;  3Q8X A;  3AOE C;  2YFQ A;  2QSF X;  4B7H A;  3GQ5 A;  3J27 B;  3M0E A;  2GNO A;  2OOB A;  1XXH E;  2AHM A;  4FCV A;  2ZBK B;  3IG8 A;  5ITY A;  1OQY A;  1GVN A;  1XMO M;  1XXH A;  3H4J A;  3FTF A;  1D0L A;  2JY7 A;  4L16 A;  2LVN C;  3D8B A;  2K9D A;  3J7B A;  2W82 A;  3GQ4 A;  1TGU A;  2C96 A;  1NJG A;  2EUC A;  3EIE A;  3U6M A;  4HL4 A;  2XFT A;  3HGI A;  5EP4 A;  3LMM A;  2BJW A;  1YE9 A;  3QAU A;  3K92 A;  4MH0 E;  4G4Q A;  1QAQ A;  2CHV A;  2X8A A;  4LF5 M;  4B3M M;  5EXS A;  4NOO B;  4Z6Y A;  2F5O A;  1PRB A;  3DZD A;  3VLF B;  3VK7 A;  2F5N A;  5KO3 A;  2DKL A;  3SAU A;  1J5E M;  3U61 A;  1N77 A;  5DFL A;  1G41 A;  1JR3 D;  1YLA A;  3GRV A;  3I04 M;  5EQT A;  5IRE B;  2CV0 A;  2DHY A;  4R71 A;  5KQ8 A;  5E6J A;  2DZO B;  1GJT A;  2L7H A;  1DGF A;  3FRI A;  1IBL M;  3U6O A;  1VG5 A;  2Z4S A;  5FTM A;  3W0L B;  3L26 A;  3GLF E;  4M0W A;  2DAI A;  4FW9 A;  4M9Z A;  2DEN A;  1R7R A;  3C3E A;  1QDR A;  2LVO C;  2DAE A;  2LBC A;  1Z59 A;  1N34 M;  1QUT A;  3SAT A;  3MHV C;  3U6C A;  2D7G A;  5IT9 S;  3BOS A;  1G3I A;  1QYR A;  3SHF A;  5DNY A;  1P3Q Q;  4MB7 A;  2R45 A;  4Q7J A;  3GQ3 A;  3LQQ A;  5BR8 M;  3HU3 A;  4DBG B;  3GLI A;  4HLQ A;  4DR3 M;  1HNX M;  4X62 M;  2L2D A;  3GPP A;  1VQ1 A;  3VDU A;  3AOG A;  3KDS E;  2KDL A;  4PDI A;  4I5S A;  3SBJ A;  1H6U A;  3SYK A;  3VFD A;  3W68 A;  4PCZ A;  2LH0 A;  2JZ0 A;  3R8F A;  1XHB A;  3IEC A;  5BPV A;  1W5T A;  1SXJ A;  4KOD A;  2RGH A;  1QZE A;  4GH9 A;  3GP1 A;  3L25 A;  2G8L A;  3GRU A;  4DV5 M;  3AKZ A;  3HY5 A;  4IBC A;  2DAG A;  2R18 A;  4FWD A;  2F5P A;  4X66 M;  3RE8 A;  1DO2 A;  2I7P A;  3FTC A;  4GC5 A;  4DUZ M;  2V6Z M;  1GJS A;  1OFI A;  3F92 A;  1XMQ M;  2J7O A;  4LGM A;  4IBB A;  1EFU B;  2KNZ A;  5KPZ A;  2ZAM A;  1JQJ C;  3WHK A;  1QQW A;  4G4R A;  3JR4 A;  4FCW A;  3JR5 A;  2Z4R A;  1FJG M;  1N33 M;  4D80 A;  1QAM A;  2DZN B;  3L27 A;  5C18 A;  3D8L A;  4MGI E;  2CV2 A;  1LV7 A;  1OIZ A;  2X4A A;  4IJF A;  3GLG A;  4DV7 M;  2E5L M;  2QBY B;  1EE8 A;  2UUA M;  2LVA A;  3W67 A;  2WSE F;  4A3V B;  5L8R F;  1HJP A;  1XWI A;  3CF2 A;  4DR6 M;  4DUY M;  3KSX A;  4Y28 F;  2CHG A;  2L09 A;  3C9P A;  3E46 A;  3QYE A;  4HEO A;  1NY5 A;  2CWB A;  5IWA M;  4DV2 M;  2HCB A;  1QDT A;  1R5L A;  4DV0 M;  2R65 A;  1TH4 A;  4MGZ E;  1DGH A;  3JAM S;  1OJL A;  5FSW A;  2YQZ A;  3VDP A;  2XLJ A;  3CF6 E;  2FNA A;  2XF3 A;  2NQ8 C;  2RGO A;  4YY3 M;  1TTE A;  2KZS A;  3HJ8 A;  3U6P A;  4RF0 A;  2QZ4 A;  1SXJ C;  1GL7 A;  2DVW B;  2JY8 A;  3E4R A;  3T1H M;  2F5S A;  3KXE C;  2ZM6 M;  2Q2E B;  1NV9 A;  3KOZ E;  5FTL A;  1ZMV A;  2VF8 A;  1IM2 A;  3AL0 C;  4LRT A;  4RF1 A;  1NO1 A;  2G5G X;  2OQ4 A;  1IBK M;  3NWL A;  2BWE A;  2DWM A;  3B9P A;  2CE7 A;  4L8R C;  1VDD A;  3IG5 A;  1OKS A;  4JI2 M;  4LJ4 A;  3U5Z B;  4D81 A;  5EXX A;  3FTD A;  4CIZ A;  4GKJ M;  3ZCB B;  3A46 A;  3TE6 A;  3THG A;  3U5Z A;  2JUJ A;  2L7I A;  4B7G A;  2BJV A;  1WGL A;  2DWL A;  3NBX X;  4LJA A;  1UM8 A;  3R9X B;  1TH2 A;  3KW6 A;  4LCB A;  3A42 A;  4OW0 A;  5JI2 E;  3SMP A;  4ZPX A;  4Z8X A;  4F2L A;  2KNV A;  3GLH E;  4JI3 M;  3Q8G A;  3LCV B;  1MJG M;  2DHR A;  3HU2 A;  1Z5B A;  3GLH B;  2J5Y A;  5KPR A;  3TPZ A;  4AG5 A;  2FH0 A;  2R46 A;  2XH9 A;  4BBA A;  5LMU M;  1IFY A;  3K9P A;  4W5W A;  2V1U A;  5ITU A;  4GIP A;  3SC3 A;  4LY6 A;  2LWX A;  2C99 A;  1KYI A;  4FD2 A;  4FWH A;  2X49 A;  2RRU A;  3GPX A;  3B7Q A;  3FYD A;  2DAM A;  2C9O A;  1N78 A;  1IY0 A;  2CP8 A;  1Q3B A;  1D2N A;  2DWN A;  4M9S A;  4QNM A;  3HX3 A;  2HAK A;  1X37 A;  2Z8Y M;  1PGY A;  3RGP A;  1WXQ A;  4WP2 A;  4JV5 M;  4KHP M;  5F3W A;  2F5Q A;  2V1C A;  1PJI A;  3L29 A;  1HR0 M;  3I01 M;  1WHC A;  4R3D A;  3K2L A;  1DO0 A;  1IN4 A;  1SXJ D;  5EXT A;  1IY2 A;  4DV4 M;  2DXI A;  2CV1 A;  4DV1 M;  4LF4 M;  2XZF A;  1DGB A;  4LFB M;  2WZJ A;  1I94 M;  3A98 B;  2KNA A;  3K8Z A;  4REZ A;  1WIV A;  4JI0 M;  1YSY A;  2JXN A;  2XSZ A;  5C1B A;  3KP0 E;  4P17 A;  4AG6 A;  1G4A E;  4GRI A;  4CHT B;  1HNW M;  1NJF A;  1ZQ9 A;  1HNZ M;  2XGN A;  5FTK A;  3E21 A;  1HT1 E;  2XFS A;  4M0D A;  1Q39 A;  2Y20 A;  3KOY E;  3VKH A;  2QNJ A;  2EA0 A;  2HWJ A;  1JB0 F;  1Z5A A;  3EIH A;  2CEA A;  2R0I A;  4UN2 B;  3PXG A;  5KPT A;  1OAO C;  2CFO A;  2GQF A;  4XGI A;  4GKK M;  4LJ8 A;  1TDH A;  5KQD A;  3GLG B;  1HQC A;  2JY5 A;  2UXC M;  2WSF F;  1SXJ E;  4EIW A;  2N35 A;  2ZTC A;  2JP7 A;  4DV3 M;  3NBI A;  4B08 A;  1NVM A;  4GHA A;  3FTE A;  1QUS A;  3LW5 F;  5H37 D;  3BBZ A;  1SG9 A;  2D7E A;  1XNR M;  3U6L A;  1KFV A;  2QPA A;  3HHW A;  3GLI B;  4OX9 M;  2QEN A;  1V92 A;  2ERC A;  5DYG A;  4AZF A;  3DA1 A;  2FOI C;  2J7N A;  4L6V 6;  5LMN M;  1VEK A;  2LTU A;  2Y21 A;  1HQY E;  2Z3X A;  3HHY A;  4LZJ A;  3T1Y M;  3QWL A;  1K82 A;  2UXB M;  2UU9 M;  2KZU A;  4LJ6 A;  2EKK A;  4NL4 H;  1IN6 A;  1R2Y A;  3U60 A;  2R4E A;  2M60 A;  4JI1 M;  2BNK A;  2KEB A;  3KSJ A;  2VDB B;  5IZ7 D;  4LF8 M;  1IN8 A;  3SHG B;  2VII A;  4G4O A;  4AKG A;  1OTR A;  5FLX S;  4QHS A;  3PNV A;  4DR5 M;  5EP1 A;  1W5S A;  4B3R M;  1J7K A;  2YR0 A;  2KW0 A;  1GO5 A;  3TQS A;  2KRU A;  1Q02 A;  3U61 B;  1RU3 A;  2DI0 A;  4I8O A;  4L78 A;  1I4W A;  3PFI A;  4IBI A;  2B3T A;  4LG2 A;  1D0M A;  1BVS A;  1NV8 A;  4GC9 A;  4QOS A;  3AFH A;  5ITR A;  4IBG A;  3MJ5 A;  3KOX E;  3J7A S;  1YUB A;  3KS8 A;  1IXZ A;  3PNY A;  3CF0 A;  3FUV A;  1PJS A;  4NRW A;  3FUT A;  2DWZ B;  3KP1 E;  3LVW A;  4LJ5 A;  4B3S M;  3GO8 A;  1T3T A;  1L1T A;  3AJI B;  3GLH A;  5E26 A;  3B74 A;  1MX0 A;  3ZQJ A;  7CAT A;  4IIW A;  1N75 A;  1IBM M;  1TF0 B;  2APL A;  4CIS A;  1T6O A;  1E9R A;  1PM5 A;  3B7Z A;  1DGH B;  1MN3 A;  4AKI A;  2BWB A;  2DZL A;  1G8P A;  1KSF X;  3KOW E;  5ITQ A;  3U6Q A;  4WUR A;  3KFU G;  1MU5 A;  3AV0 A;  3MMP A;  4IBF A;  4AQY M;  3FRH A;  1CUK A;  2L6O A;  4RKU F;  3I4V A;  1E94 E;  2O25 A;  4FVM A;  2ZAO A;  4PD2 A;  2K47 A;  1L2C A;  4JI8 M;  2JNH A;  4LF6 M;  1PJT A;  3J81 S;  4DR7 M;  3U6S A;  3HKP A;  4RNA A;  4NRV A;  1A5T A;  3U60 B;  2HHH M;  1JR3 A;  4BLC A;  3ZC7 B;  4LF9 M;  4PT5 A;  4I4L A;  3GRR A;  4R7G A;  1L2D A;  1OIP A;  2CHQ A;  1DGG A;  2QQ8 A;  4NSO B;  1R4G A;  1JR3 E;  3L28 A;  1XC8 A;  3SAW A;  1XNQ M;  3OTO M;  2HKJ A;  1TR8 A;  1NY6 A;  2G3Q A;  1ZAE A;  3KS4 A;  2Z7J A;  3U6D A;  3DOA A;  3GLG E;  1NHW C;  3E9S A;  1QAO A;  2UUC M;  4OVZ A;  4NXN M;  4L15 A;  3GPY A;  3AOE A;  3FKE A;  1EIJ A;  1IXS A;  1QZM A;  4G3O A;  3UMM A;  4S12 A;  3UJN A;  2WSC F;  2LHC A;  2CRU A;  1DV0 A;  1IXS B;  3FUX A;  2VQF M;  2MH8 A;  2R4J A;  1L2B A;  1IQP A;  5EP2 A;  2UUB M;  1GL6 A;  1Y8G A;  1WGN A;  1L1Z A;  4LRS A;  4YHH M;  1IN7 A;  1ZV1 A;  3RGS A;  1QVR A;  1ZMU A;  2JZ1 A;  4NSR A;  4MM3 B;  1Z6T A;  2LXE A;  1NSF A;  1IY1 A;  3J2P B;  3HWS A;  1NHG C;  2VF7 A;  3PVS A;  2K0B X;  4D82 A;  4NC6 A;  3W0F A;  5ITT A;  1PJQ A;  1C1K A;  2HL7 A;  1XXH B;  4II7 A;  1J09 A;  4FWG A;  4LJ9 A;  4DR4 M;  4LFA M;  3FE3 A;  4L4U A;  3B7N A;  3I51 A;  2P5T A;  3FUU A;  3WHL A;  4GHL A;  1F4I A;  3HJQ A;  3GLF B;  3GRY A;  2UXD M;  1C7Y A;  4JXJ A;  3GLI E;  3U6E A;  4IBD A;  3L2A A;  3TWK A;  5JI3 E;  2OPF A;  4JYA M;  2ZTD A;  3LCU A;  1SXJ B;  2Y0Q A;  3IHP A;  3SYL A;  3UGJ A;  2FFJ A;  3A45 A;  1ORY B;  3T38 A;  4KT0 F;  4F1I A;  1Z5C A;  4GMQ A;  4CGY B;  2EJS A;  4MGK E;  3RFW A;  4LF7 M;  3VKG A;  2H5X A;  3FUW A;  1GKI A;  4DR2 M;  3BXW A;  3SAR A;  1FNN A;  2KXE A;  5FTN A;  1TDZ A;  5GKN A;  2RKO A;  3LQR A;  2XZU A;  4M9X A;  4X64 M;  4AI6 A;  4IBJ A;  2K6B A;  2LHG A;  2L4E A;  4QOZ C; 
#chains in the Genus database with same CATH homology
 3LW5 F;  4XK8 F;  4Y28 F;  4KT0 F;  1JB0 F;  4L6V 6;  2WSF F;  2WSE F;  5L8R F;  4RKU F;  2WSC F;  2O01 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...