4XK8F

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 45
structure length 151
sequence length 151
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 4xk8F00
2WSFF 5L8RF 1JB0F 3LW5F 4RKUF 4Y28F 4XK8F 4KT0F 4L6V6 2WSCF 2O01F 2WSEF
chains in the Genus database with same CATH superfamily
1C7YA 3B74A 2P5TA 2M60A 4LZJA 2JWSA 3BOSA 2L4FA 2QP9X 2K6BA 4LY6A 3RGSA 2X4AA 3SMPA 1Q02A 1QDRA 1L8QA 4R3DA 1UFZA 4OU7A 4G4RA 5EP3A 1GABA 1J7KA 1EFUB 4WURA 4FD2A 1QAMA 4FWHA 3IG5A 5L8RF 1IBKM 3FRIA 4JXJA 4WP2A 3SMSA 2DVWB 3GQ4A 4Q7JA 3KOXE 2DZOB 4DR5M 1WGLA 4DUZM 2OOAA 3TE6A 3TWKA 5JI2E 3U6OA 1UM8A 2Y21A 4L6V6 2EA0A 3K9OA 3FE3A 4EIWA 3C3DA 2R46A 5C1BA 3GPUA 4L8RC 4DR7M 3F92A 2O25A 4FCVA 2CEAA 2KNVA 2L7HA 1E9SA 4LRSA 3VDPA 1SXJC 3Q8GA 4B3RM 4DR6M 4FWDA 1F4IA 2FNAA 4JI0M 1L2BA 5ITUA 4GH9A 3FTEA 2F4VM 1VEGA 4A3VB 2OPFA 1IY2A 1V92A 4IBDA 4JI6M 1ZAEA 3B89A 5KQDA 1NJFA 1PJQA 2OQ4A 4LG2A 4GEWA 4X66M 4UN2B 4M0DA 2I7PA 1YE9A 1IXZA 1TR8A 4ZPXA 4DV7M 1WXQA 2LBCA 1NY6A 2KXEA 2QPAA 2GQFA 3MK6A 4MGYE 4Y28F 2XLJA 2E5LM 3CTWB 2QNJA 3AL0C 3KDSE 4FW9A 4LFBM 1NHGC 4JI8M 1V33A 2DENA 4DR2M 3AOEA 1X37A 4TUWA 3MHVC 3KVWA 3FUWA 1E94E 2J5YA 2YFQA 2DNAA 5BR8M 4D82A 1K82A 4DR3M 3EIEA 2VF7A 1QZMA 3FUTA 3AKZA 2H5XA 2J7OA 3IG8A 4DV1M 1D0LA 1AIPC 2JA2A 1OTRA 3I51A 4REZA 2JY7A 1D0KA 1TDHA 1TH3A 3TWLA 1NV8A 3HHXA 5FLXS 3L26A 3U6QA 4QHSA 3ZC7B 1KSFX 2XFTA 4PT5A 1Z59A 4Z6YA 2QBYA 4MB7A 1LV7A 3GP1A 2QBYB 3SASA 1IY0A 1QUSA 2L2DA 2CV0A 5KQ8A 3VLFB 1GJTA 3GLGE 3FTDA 4B7GA 2F5SA 3GLFA 4GMQA 1OJLA 1NJGA 3LMMA 3GLFB 5ITQA 1TF0B 1VQ1A 3BXWA 4MM3B 3C3EA 4IBEA 3GPPA 3ILKA 5EXXA 1N36M 5EXTA 3W0LB 5KO3A 3GRYA 1XWIA 4LJAA 3U6LA 3CF6E 4R7GA 4MGHA 1HQYE 1G3IA 2LVQD 1HR0M 4JI5M 4DV5M 1PRBA 1MU5A 4PDGA 4ITQA 4Z8XA 3PXGA 4CHTB 3U6EA 3UZUA 1W5SA 2DWMA 1IBMM 2DWNA 3NBXX 1YSYA 2JY8A 5DNYA 4W5WA 3D8BA 3SBJA 3U5ZA 5IT9S 1I4WA 3U5ZB 1YLAA 1GVNA 2WSFF 4JYAM 3R8FA 5EP4A 5ITXA 1OKSA 5FTJA 4XGIA 4QNMA 4NRWA 4YY3M 1K3WA 2XSZA 4LF4M 4G4NA 2KZSA 1DV0A 3I01M 4LFCM 1TH4A 3E21A 3DA1A 4X65M 1SXJA 3M6AA 3HHWA 4CIZA 4DV4M 2DAMA 1SXJB 2CHGA 3KP1E 4X62M 4MH0E 2C99A 1Q39A 1N33M 4LF5M 1R2ZA 5JI3E 3RGPA 2KRKA 1QUTA 4QHTA 2CHQA 2CP8A 2Y0TA 2XSZD 2DHRA 1G71A 3TPZA 2ZAOA 3VK8A 1P3QQ 3AOGA 2EUCA 2ZM6M 2ERCA 3GQ5A 2LXEA 2VDBB 1WJ7A 4RF1A 4LRTA 1OQYA 3K8ZA 4AI6A 5ITTA 2CFOA 2BJWA 2N35A 2ZAMA 2QHOB 2KW0A 1NHWC 3DOAA 4LZZA 4JI1M 5EXSA 1N34M 2ZANA 4WW0A 3SYLA 2JZ0A 3OTOM 1CUKA 4IBJA 2MJ5B 4IBCA 2Z8YM 2EO2A 3HKPA 3W68A 3ZQJA 3KS8A 1Q3BA 2DAEA 5ITYA 2RGOA 3E4RA 4L15A 4LJ6A 1TH2A 4IJFA 2DZLA 1H6UA 3ZH9B 3GQ3A 1QQWA 5F3WA 4GHLA 5KPRA 4NC6A 2LVNC 4GRIA 4MGIE 1LTMA 4IBGA 4S12A 4GC9A 2DI0A 4M9XA 4F2LA 1IXSB 1XXHA 3A42A 3BBZA 1GLNA 3GLHA 4MGZE 1XXHB 4QOZC 2F5PA 3GLHB 3FTFA 1L1TA 1OFHA 2KRUA 1N78A 1DO2A 4CISA 1QZEA 5C18A 1DGGA 2G5GX 4KT0F 5EP2A 2OO9A 4B7FA 1E32A 2K9DA 4XK8F 4LJ8A 4IBIA 4YHHM 3KSXA 2AHMA 3HWSA 1HQCA 3U61A 4L4UA 4OW0A 3B7QA 3U61B 1QAQA 4FWGA 4ANRA 1KYIA 3QAUA 5GKNA 5H37D 2LVOC 1GL7A 3RE8A 3SYKA 3TWMA 4L16A 3AFHA 2XZUA 2O5RA 3J80S 1L2CA 3LW5F 2G3QA 3L27A 4R71A 2DZNB 3M0EA 4LFAM 2LVPC 4QOSA 2V1UA 1T3TA 1C1KA 3FRHA 2ZBKB 3W0FA 1AUAA 1PJTA 4X64M 1XC8A 4AKGA 3SATA 2VF8A 1N32M 1IY1A 3FUXA 2QQ8A 4IJEA 5FTMA 1EE8A 3KP0E 2CRUA 1VEJA 3PNYA 1D2NA 3T1HM 4F1IA 2Y20A 2MROB 2VQFM 3FD9A 2R65A 1DGFA 3PFIA 1SG9A 3KOYE 3MJ5A 3J7AS 2Z7JA 3CF2A 2DKLA 1J5EM 2CV2A 1GKIA 1PGYA 3FTCA 4OVZA 4RNAA 3A98B 4L78A 3UMMA 2H1RA 3U6MA 5EQTA 1L1ZA 4OVZB 4P17A 2UXBM 4AKIA 1ZV1A 1DGHB 1XHBA 2RKOA 2XF3A 3GLIA 1NNJA 1HT1E 4JI4M 5DYGA 3T38A 4AG5A 3GLIB 2QSFX 3THGA 4DV6M 2OOBA 2MR9A 1JB0F 2K47A 1WR1B 3VFDA 2UUBM 3I4VA 5E26A 1YUBA 2L6OA 2R18A 2Z4RA 1PJIA 1T6OA 2JP7A 1K3XA 4JI3M 1VEKA 1TTEA 1RU3A 2GNOA 3HU3A 4NXMM 3FKEA 2R0IA 4AW4A 3WHLA 2R4EA 4KODA 3GPYA 4GC5A 1OAOC 3KOZE 4PCZA 2XH9A 2KEBA 3U60B 2CE7A 1FNNA 1S3SA 3QYEA 3I04M 5E6JA 3KS4A 4CJ6A 2DWZB 3QWLA 1NO1A 1NSFA 3VDUA 2F5QA 3HHYA 1XNQM 2M5ZA 4B3MM 1PJJA 1XMQM 2FFJA 4P16A 4FCTA 4G3OA 5A2QS 2C96A 3IECA 2Q2EB 3I4YA 3KXEC 1JR3A 3NWLA 5LMNM 1MJGM 3HU2A 3LVVA 2DAIA 4LJ5A 2QZ4A 2XEPA 7CATA 3SAUA 1IN8A 5BPVA 1G59A 4JI7M 3FUVA 1GO5A 2DWLA 4B7HA 3UJNA 4OX9M 4IBFA 4DR1M 2KZUA 3LQRA 2DHYA 3E46A 2UXCM 5FTKA 4QNRA 3HGIA 3GLFE 2J7NA 5LMUM 1N77A 2D7HA 2JY5A 1Z5BA 4BB9A 4AQYM 3K1JA 3Q8XA 1WHCA 1V34A 3U6SA 2LHGA 2UXDM 4NOOB 3SARA 4B3SM 5KPZA 3A45A 4LGMA 2V6ZM 1IN5A 1WGNA 3KSJA 2APLA 2JXNA 1SXJD 1A5TA 2EKFA 4K0KM 4I4LA 3KOWE 1VDLA 5FTNA 4I5SA 2L7IA 2Z4SA 8CATA 1OFIA 3GO8A 1T43A 1PM5A 1I94M 1HNXM 1QAOA 4B3TM 4HEOA 2K0BX 4II7A 2VIIA 3FYCA 2MH8A 2R6FA 2ZTDA 1J09A 2WSEF 3DZDA 2DAGA 1IN4A 2HL7A 5ITXE 4AZFA 1IN6A 3JR5A 3HJ8A 4HL4A 3TL4X 1XB2B 3LCUA 3LCVB 3T15A 3HHZA 2HCBA 2Y0QA 1R4GA 4I8OA 4PDIA 1SXJE 1DO0A 4LJ4A 2YNMD 1R7RA 5IWAM 4NSRA 2R44A 1IXSA 4FVMA 4XBOA 2A5YB 4M0WA 4KLNA 3GRVA 2FS1A 3LVWA 4KO8A 2JUJA 2LTUA 3D8LA 1XMOM 1Z5AA 2D7EA 3K9PA 2X49A 2BWEA 2VQEM 4G4OA 3A46A 2WSCF 4DV3M 2O01F 2HHHM 4DBGB 1IFYA 3M7GA 4LF8M 2MGWA 4IBKA 4LJ7A 4DV0M 2EKKA 4LGYA 4LF7M 4GKJM 2D7GA 1E9RA 3K92A 4GITA 1QANA 2RGHA 2HKJA 1OIPA 2RRUA 4MGKE 4RKUF 3T6PA 3U6DA 2W82A 3AJIB 2DAKA 3H4JA 3AV0A 1GJSA 3U6CA 2XFSA 3JR4A 3PVSA 5IZ7D 3QYBA 3H4MA 1NNUC 1W5TA 2LWXA 1XNRM 1IM2A 5DFLA 1Z6TA 4PD2A 3J27B 5DYIA 2NQ8C 3IHPA 5EP1A 3GLGA 1XXHE 2KDLA 3GLHE 2C9OA 4RF0A 3GLGB 4G6ZA 1NVMA 2FOIC 4LF9M 3CGWA 1G41A 1MN3A 4JV5M 3VKHA 2JZ1A 2R4JA 4JN6A 3LQQA 1D0MA 3WHKA 2Z3XA 2XZFA 2CV1A 2C9CA 3J2PB 3E9SA 3VKGA 1HJPA 4NXNM 4I81A 3SFZA 2F5NA 3PNVA 2DXIA 3B9PA 1OIZA 1DGHA 4D81A 4DUYM 2C5RA 2F5OA 1IQPA 2XGNA 2ZTCA 2LH0A 2WZJA 3ZCBB 1KFVA 3C58A 1MX0A 5EJCA 2BJVA 1GL6A 2I7NA 2FE8A 3L28A 4IIWA 4NL4H 2FH0A 4DR4M 3KW6A 3HZJA 4HLQA 5ITRA 2JNHA 3KFUG 3L25A 4D80A 1QVRA 4AKHA 4LJ9A 2X8AA 1BVSA 4GHAA 3GRRA 3C9PA 1G8PA 1R5LA 3JAMS 2JY6B 3FYDA 1VG5A 2KA6B 2KNZA 3W67A 4BBAA 4G4QA 3U60A 3SHFA 3VK7A 3R9XB 1Y8GA 1FJGM 4NRVA 4GKKM 2QENA 4AG6A 4CGYB 5FSWA 4IBBA 3HJSA 3J81S 2UU9M 2HWJA 3UGJA 3GPXA 1HNZM 2UUCM 3FUUA 1OAIA 4DV2M 1IN7A 1ZMWA 3HU1A 1R6BX 2YQZA 2C98A 3J7BA 2LVAA 3GRUA 3L2AA 4NSOB 3V76A 1PJSA 1ZMUA 4BLCA 3U6PA 5FTLA 1NY5A 2KNAA 2CHVA 3K2LA 3B7NA 1IXRC 2L4EA 1NV9A 5IREB 4LF6M 1HT2E 1DGBA 3TQSA 3GLIE 3T1YM 3SAVA 4GIPA 2EJSA 2HAKA 3AOEC 1VDDA 3SC3A 1QDTA 1ORYB 1JR3D 2KHHA 2V1CA 2R45A 2R62A 1HNWM 1JQJC 4KHPM 2CUZA 3MMPA 3HX3A 1IBLM 2BWBA 4LCBA 1Q3CA 2BNKA 3RFWA 4B08A 2LNHC 1EIJA 2QCUA 4FCWA 3UK6A 3B7ZA 2YR0A 3L29A 3NBIA 1N75A 1QYRA 1TGUA 1TDZA 1L2DA 2B3TA 3HY5A 4M9SA 2L09A 3SHGB 2G8LA 5EXPA 3SAWA 3EIHA 3DFZA 4JI2M 2LHCA 3HJQA 3CF0A 1R2YA 1Z5CA 1WIVA 1JR3E 2UUAM 1G4AE 4M9ZA 1ZQ9A 1ZMVA 2CWBA 5KPTA
chains in the Genus database with same CATH topology
2WSFF 5L8RF 1JB0F 3LW5F 4RKUF 4Y28F 4XK8F 4KT0F 4L6V6 2WSCF 2O01F 2WSEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF F;  5L8R F;  1JB0 F;  3LW5 F;  4RKU F;  4Y28 F;  4XK8 F;  4KT0 F;  4L6V 6;  2WSC F;  2O01 F;  2WSE F; 
#chains in the Genus database with same CATH topology
 1C7Y A;  3B74 A;  2P5T A;  2M60 A;  4LZJ A;  2JWS A;  3BOS A;  2L4F A;  2QP9 X;  2K6B A;  4LY6 A;  3RGS A;  2X4A A;  3SMP A;  1Q02 A;  1QDR A;  1L8Q A;  4R3D A;  1UFZ A;  4OU7 A;  4G4R A;  5EP3 A;  1GAB A;  1J7K A;  1EFU B;  4WUR A;  4FD2 A;  1QAM A;  4FWH A;  3IG5 A;  5L8R F;  1IBK M;  3FRI A;  4JXJ A;  4WP2 A;  3SMS A;  2DVW B;  3GQ4 A;  4Q7J A;  3KOX E;  2DZO B;  4DR5 M;  1WGL A;  4DUZ M;  2OOA A;  3TE6 A;  3TWK A;  5JI2 E;  3U6O A;  1UM8 A;  2Y21 A;  4L6V 6;  2EA0 A;  3K9O A;  3FE3 A;  4EIW A;  3C3D A;  2R46 A;  5C1B A;  3GPU A;  4L8R C;  4DR7 M;  3F92 A;  2O25 A;  4FCV A;  2CEA A;  2KNV A;  2L7H A;  1E9S A;  4LRS A;  3VDP A;  1SXJ C;  3Q8G A;  4B3R M;  4DR6 M;  4FWD A;  1F4I A;  2FNA A;  4JI0 M;  1L2B A;  5ITU A;  4GH9 A;  3FTE A;  2F4V M;  1VEG A;  4A3V B;  2OPF A;  1IY2 A;  1V92 A;  4IBD A;  4JI6 M;  1ZAE A;  3B89 A;  5KQD A;  1NJF A;  1PJQ A;  2OQ4 A;  4LG2 A;  4GEW A;  4X66 M;  4UN2 B;  4M0D A;  2I7P A;  1YE9 A;  1IXZ A;  1TR8 A;  4ZPX A;  4DV7 M;  1WXQ A;  2LBC A;  1NY6 A;  2KXE A;  2QPA A;  2GQF A;  3MK6 A;  4MGY E;  4Y28 F;  2XLJ A;  2E5L M;  3CTW B;  2QNJ A;  3AL0 C;  3KDS E;  4FW9 A;  4LFB M;  1NHG C;  4JI8 M;  1V33 A;  2DEN A;  4DR2 M;  3AOE A;  1X37 A;  4TUW A;  3MHV C;  3KVW A;  3FUW A;  1E94 E;  2J5Y A;  2YFQ A;  2DNA A;  5BR8 M;  4D82 A;  1K82 A;  4DR3 M;  3EIE A;  2VF7 A;  1QZM A;  3FUT A;  3AKZ A;  2H5X A;  2J7O A;  3IG8 A;  4DV1 M;  1D0L A;  1AIP C;  2JA2 A;  1OTR A;  3I51 A;  4REZ A;  2JY7 A;  1D0K A;  1TDH A;  1TH3 A;  3TWL A;  1NV8 A;  3HHX A;  5FLX S;  3L26 A;  3U6Q A;  4QHS A;  3ZC7 B;  1KSF X;  2XFT A;  4PT5 A;  1Z59 A;  4Z6Y A;  2QBY A;  4MB7 A;  1LV7 A;  3GP1 A;  2QBY B;  3SAS A;  1IY0 A;  1QUS A;  2L2D A;  2CV0 A;  5KQ8 A;  3VLF B;  1GJT A;  3GLG E;  3FTD A;  4B7G A;  2F5S A;  3GLF A;  4GMQ A;  1OJL A;  1NJG A;  3LMM A;  3GLF B;  5ITQ A;  1TF0 B;  1VQ1 A;  3BXW A;  4MM3 B;  3C3E A;  4IBE A;  3GPP A;  3ILK A;  5EXX A;  1N36 M;  5EXT A;  3W0L B;  5KO3 A;  3GRY A;  1XWI A;  4LJA A;  3U6L A;  3CF6 E;  4R7G A;  4MGH A;  1HQY E;  1G3I A;  2LVQ D;  1HR0 M;  4JI5 M;  4DV5 M;  1PRB A;  1MU5 A;  4PDG A;  4ITQ A;  4Z8X A;  3PXG A;  4CHT B;  3U6E A;  3UZU A;  1W5S A;  2DWM A;  1IBM M;  2DWN A;  3NBX X;  1YSY A;  2JY8 A;  5DNY A;  4W5W A;  3D8B A;  3SBJ A;  3U5Z A;  5IT9 S;  1I4W A;  3U5Z B;  1YLA A;  1GVN A;  2WSF F;  4JYA M;  3R8F A;  5EP4 A;  5ITX A;  1OKS A;  5FTJ A;  4XGI A;  4QNM A;  4NRW A;  4YY3 M;  1K3W A;  2XSZ A;  4LF4 M;  4G4N A;  2KZS A;  1DV0 A;  3I01 M;  4LFC M;  1TH4 A;  3E21 A;  3DA1 A;  4X65 M;  1SXJ A;  3M6A A;  3HHW A;  4CIZ A;  4DV4 M;  2DAM A;  1SXJ B;  2CHG A;  3KP1 E;  4X62 M;  4MH0 E;  2C99 A;  1Q39 A;  1N33 M;  4LF5 M;  1R2Z A;  5JI3 E;  3RGP A;  2KRK A;  1QUT A;  4QHT A;  2CHQ A;  2CP8 A;  2Y0T A;  2XSZ D;  2DHR A;  1G71 A;  3TPZ A;  2ZAO A;  3VK8 A;  1P3Q Q;  3AOG A;  2EUC A;  2ZM6 M;  2ERC A;  3GQ5 A;  2LXE A;  2VDB B;  1WJ7 A;  4RF1 A;  4LRT A;  1OQY A;  3K8Z A;  4AI6 A;  5ITT A;  2CFO A;  2BJW A;  2N35 A;  2ZAM A;  2QHO B;  2KW0 A;  1NHW C;  3DOA A;  4LZZ A;  4JI1 M;  5EXS A;  1N34 M;  2ZAN A;  4WW0 A;  3SYL A;  2JZ0 A;  3OTO M;  1CUK A;  4IBJ A;  2MJ5 B;  4IBC A;  2Z8Y M;  2EO2 A;  3HKP A;  3W68 A;  3ZQJ A;  3KS8 A;  1Q3B A;  2DAE A;  5ITY A;  2RGO A;  3E4R A;  4L15 A;  4LJ6 A;  1TH2 A;  4IJF A;  2DZL A;  1H6U A;  3ZH9 B;  3GQ3 A;  1QQW A;  5F3W A;  4GHL A;  5KPR A;  4NC6 A;  2LVN C;  4GRI A;  4MGI E;  1LTM A;  4IBG A;  4S12 A;  4GC9 A;  2DI0 A;  4M9X A;  4F2L A;  1IXS B;  1XXH A;  3A42 A;  3BBZ A;  1GLN A;  3GLH A;  4MGZ E;  1XXH B;  4QOZ C;  2F5P A;  3GLH B;  3FTF A;  1L1T A;  1OFH A;  2KRU A;  1N78 A;  1DO2 A;  4CIS A;  1QZE A;  5C18 A;  1DGG A;  2G5G X;  4KT0 F;  5EP2 A;  2OO9 A;  4B7F A;  1E32 A;  2K9D A;  4XK8 F;  4LJ8 A;  4IBI A;  4YHH M;  3KSX A;  2AHM A;  3HWS A;  1HQC A;  3U61 A;  4L4U A;  4OW0 A;  3B7Q A;  3U61 B;  1QAQ A;  4FWG A;  4ANR A;  1KYI A;  3QAU A;  5GKN A;  5H37 D;  2LVO C;  1GL7 A;  3RE8 A;  3SYK A;  3TWM A;  4L16 A;  3AFH A;  2XZU A;  2O5R A;  3J80 S;  1L2C A;  3LW5 F;  2G3Q A;  3L27 A;  4R71 A;  2DZN B;  3M0E A;  4LFA M;  2LVP C;  4QOS A;  2V1U A;  1T3T A;  1C1K A;  3FRH A;  2ZBK B;  3W0F A;  1AUA A;  1PJT A;  4X64 M;  1XC8 A;  4AKG A;  3SAT A;  2VF8 A;  1N32 M;  1IY1 A;  3FUX A;  2QQ8 A;  4IJE A;  5FTM A;  1EE8 A;  3KP0 E;  2CRU A;  1VEJ A;  3PNY A;  1D2N A;  3T1H M;  4F1I A;  2Y20 A;  2MRO B;  2VQF M;  3FD9 A;  2R65 A;  1DGF A;  3PFI A;  1SG9 A;  3KOY E;  3MJ5 A;  3J7A S;  2Z7J A;  3CF2 A;  2DKL A;  1J5E M;  2CV2 A;  1GKI A;  1PGY A;  3FTC A;  4OVZ A;  4RNA A;  3A98 B;  4L78 A;  3UMM A;  2H1R A;  3U6M A;  5EQT A;  1L1Z A;  4OVZ B;  4P17 A;  2UXB M;  4AKI A;  1ZV1 A;  1DGH B;  1XHB A;  2RKO A;  2XF3 A;  3GLI A;  1NNJ A;  1HT1 E;  4JI4 M;  5DYG A;  3T38 A;  4AG5 A;  3GLI B;  2QSF X;  3THG A;  4DV6 M;  2OOB A;  2MR9 A;  1JB0 F;  2K47 A;  1WR1 B;  3VFD A;  2UUB M;  3I4V A;  5E26 A;  1YUB A;  2L6O A;  2R18 A;  2Z4R A;  1PJI A;  1T6O A;  2JP7 A;  1K3X A;  4JI3 M;  1VEK A;  1TTE A;  1RU3 A;  2GNO A;  3HU3 A;  4NXM M;  3FKE A;  2R0I A;  4AW4 A;  3WHL A;  2R4E A;  4KOD A;  3GPY A;  4GC5 A;  1OAO C;  3KOZ E;  4PCZ A;  2XH9 A;  2KEB A;  3U60 B;  2CE7 A;  1FNN A;  1S3S A;  3QYE A;  3I04 M;  5E6J A;  3KS4 A;  4CJ6 A;  2DWZ B;  3QWL A;  1NO1 A;  1NSF A;  3VDU A;  2F5Q A;  3HHY A;  1XNQ M;  2M5Z A;  4B3M M;  1PJJ A;  1XMQ M;  2FFJ A;  4P16 A;  4FCT A;  4G3O A;  5A2Q S;  2C96 A;  3IEC A;  2Q2E B;  3I4Y A;  3KXE C;  1JR3 A;  3NWL A;  5LMN M;  1MJG M;  3HU2 A;  3LVV A;  2DAI A;  4LJ5 A;  2QZ4 A;  2XEP A;  7CAT A;  3SAU A;  1IN8 A;  5BPV A;  1G59 A;  4JI7 M;  3FUV A;  1GO5 A;  2DWL A;  4B7H A;  3UJN A;  4OX9 M;  4IBF A;  4DR1 M;  2KZU A;  3LQR A;  2DHY A;  3E46 A;  2UXC M;  5FTK A;  4QNR A;  3HGI A;  3GLF E;  2J7N A;  5LMU M;  1N77 A;  2D7H A;  2JY5 A;  1Z5B A;  4BB9 A;  4AQY M;  3K1J A;  3Q8X A;  1WHC A;  1V34 A;  3U6S A;  2LHG A;  2UXD M;  4NOO B;  3SAR A;  4B3S M;  5KPZ A;  3A45 A;  4LGM A;  2V6Z M;  1IN5 A;  1WGN A;  3KSJ A;  2APL A;  2JXN A;  1SXJ D;  1A5T A;  2EKF A;  4K0K M;  4I4L A;  3KOW E;  1VDL A;  5FTN A;  4I5S A;  2L7I A;  2Z4S A;  8CAT A;  1OFI A;  3GO8 A;  1T43 A;  1PM5 A;  1I94 M;  1HNX M;  1QAO A;  4B3T M;  4HEO A;  2K0B X;  4II7 A;  2VII A;  3FYC A;  2MH8 A;  2R6F A;  2ZTD A;  1J09 A;  2WSE F;  3DZD A;  2DAG A;  1IN4 A;  2HL7 A;  5ITX E;  4AZF A;  1IN6 A;  3JR5 A;  3HJ8 A;  4HL4 A;  3TL4 X;  1XB2 B;  3LCU A;  3LCV B;  3T15 A;  3HHZ A;  2HCB A;  2Y0Q A;  1R4G A;  4I8O A;  4PDI A;  1SXJ E;  1DO0 A;  4LJ4 A;  2YNM D;  1R7R A;  5IWA M;  4NSR A;  2R44 A;  1IXS A;  4FVM A;  4XBO A;  2A5Y B;  4M0W A;  4KLN A;  3GRV A;  2FS1 A;  3LVW A;  4KO8 A;  2JUJ A;  2LTU A;  3D8L A;  1XMO M;  1Z5A A;  2D7E A;  3K9P A;  2X49 A;  2BWE A;  2VQE M;  4G4O A;  3A46 A;  2WSC F;  4DV3 M;  2O01 F;  2HHH M;  4DBG B;  1IFY A;  3M7G A;  4LF8 M;  2MGW A;  4IBK A;  4LJ7 A;  4DV0 M;  2EKK A;  4LGY A;  4LF7 M;  4GKJ M;  2D7G A;  1E9R A;  3K92 A;  4GIT A;  1QAN A;  2RGH A;  2HKJ A;  1OIP A;  2RRU A;  4MGK E;  4RKU F;  3T6P A;  3U6D A;  2W82 A;  3AJI B;  2DAK A;  3H4J A;  3AV0 A;  1GJS A;  3U6C A;  2XFS A;  3JR4 A;  3PVS A;  5IZ7 D;  3QYB A;  3H4M A;  1NNU C;  1W5T A;  2LWX A;  1XNR M;  1IM2 A;  5DFL A;  1Z6T A;  4PD2 A;  3J27 B;  5DYI A;  2NQ8 C;  3IHP A;  5EP1 A;  3GLG A;  1XXH E;  2KDL A;  3GLH E;  2C9O A;  4RF0 A;  3GLG B;  4G6Z A;  1NVM A;  2FOI C;  4LF9 M;  3CGW A;  1G41 A;  1MN3 A;  4JV5 M;  3VKH A;  2JZ1 A;  2R4J A;  4JN6 A;  3LQQ A;  1D0M A;  3WHK A;  2Z3X A;  2XZF A;  2CV1 A;  2C9C A;  3J2P B;  3E9S A;  3VKG A;  1HJP A;  4NXN M;  4I81 A;  3SFZ A;  2F5N A;  3PNV A;  2DXI A;  3B9P A;  1OIZ A;  1DGH A;  4D81 A;  4DUY M;  2C5R A;  2F5O A;  1IQP A;  2XGN A;  2ZTC A;  2LH0 A;  2WZJ A;  3ZCB B;  1KFV A;  3C58 A;  1MX0 A;  5EJC A;  2BJV A;  1GL6 A;  2I7N A;  2FE8 A;  3L28 A;  4IIW A;  4NL4 H;  2FH0 A;  4DR4 M;  3KW6 A;  3HZJ A;  4HLQ A;  5ITR A;  2JNH A;  3KFU G;  3L25 A;  4D80 A;  1QVR A;  4AKH A;  4LJ9 A;  2X8A A;  1BVS A;  4GHA A;  3GRR A;  3C9P A;  1G8P A;  1R5L A;  3JAM S;  2JY6 B;  3FYD A;  1VG5 A;  2KA6 B;  2KNZ A;  3W67 A;  4BBA A;  4G4Q A;  3U60 A;  3SHF A;  3VK7 A;  3R9X B;  1Y8G A;  1FJG M;  4NRV A;  4GKK M;  2QEN A;  4AG6 A;  4CGY B;  5FSW A;  4IBB A;  3HJS A;  3J81 S;  2UU9 M;  2HWJ A;  3UGJ A;  3GPX A;  1HNZ M;  2UUC M;  3FUU A;  1OAI A;  4DV2 M;  1IN7 A;  1ZMW A;  3HU1 A;  1R6B X;  2YQZ A;  2C98 A;  3J7B A;  2LVA A;  3GRU A;  3L2A A;  4NSO B;  3V76 A;  1PJS A;  1ZMU A;  4BLC A;  3U6P A;  5FTL A;  1NY5 A;  2KNA A;  2CHV A;  3K2L A;  3B7N A;  1IXR C;  2L4E A;  1NV9 A;  5IRE B;  4LF6 M;  1HT2 E;  1DGB A;  3TQS A;  3GLI E;  3T1Y M;  3SAV A;  4GIP A;  2EJS A;  2HAK A;  3AOE C;  1VDD A;  3SC3 A;  1QDT A;  1ORY B;  1JR3 D;  2KHH A;  2V1C A;  2R45 A;  2R62 A;  1HNW M;  1JQJ C;  4KHP M;  2CUZ A;  3MMP A;  3HX3 A;  1IBL M;  2BWB A;  4LCB A;  1Q3C A;  2BNK A;  3RFW A;  4B08 A;  2LNH C;  1EIJ A;  2QCU A;  4FCW A;  3UK6 A;  3B7Z A;  2YR0 A;  3L29 A;  3NBI A;  1N75 A;  1QYR A;  1TGU A;  1TDZ A;  1L2D A;  2B3T A;  3HY5 A;  4M9S A;  2L09 A;  3SHG B;  2G8L A;  5EXP A;  3SAW A;  3EIH A;  3DFZ A;  4JI2 M;  2LHC A;  3HJQ A;  3CF0 A;  1R2Y A;  1Z5C A;  1WIV A;  1JR3 E;  2UUA M;  1G4A E;  4M9Z A;  1ZQ9 A;  1ZMV A;  2CWB A;  5KPT A; 
#chains in the Genus database with same CATH homology
 2WSF F;  5L8R F;  1JB0 F;  3LW5 F;  4RKU F;  4Y28 F;  4XK8 F;  4KT0 F;  4L6V 6;  2WSC F;  2O01 F;  2WSE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...