4XK8F

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
b'DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 45
structure length 151
sequence length 151
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 4xk8F00
4L6V6 4XK8F 2WSEF 3LW5F 2WSCF 1JB0F 2WSFF 4Y28F 5L8RF 4KT0F 4RKUF 2O01F
chains in the Genus database with same CATH superfamily
4IIWA 4KODA 1N36M 3SAVA 1IN6A 1NVMA 2XSZD 1QUSA 3TE6A 1YLAA 1S3SA 2L7HA 1WHCA 1YUBA 3MHVC 5FTLA 2L4EA 2BWBA 4DUZM 4G4RA 3SFZA 3HU2A 4Y28F 2FNAA 5E26A 2DZOB 5FSWA 1GJSA 3U6SA 4B7FA 3U6DA 2JNHA 3RGSA 1NHGC 1TDHA 3FUVA 3KS4A 5EP3A 1ORYB 5BR8M 3I4YA 5DFLA 4LF7M 2OPFA 1NV8A 4LJAA 4II7A 2Y0QA 1QYRA 3ZC7B 4F1IA 2R4EA 3C58A 3U5ZB 1ZAEA 3VK7A 3LQRA 1OFIA 1WR1B 3BBZA 3MMPA 2DWNA 3SATA 2ERCA 1J5EM 5IWAM 4LJ8A 4GHAA 2XH9A 2YQZA 4L8RC 5ITYA 3MK6A 1NY5A 1JB0F 4BB9A 4LJ6A 2CV2A 2HAKA 2F4VM 1MX0A 1NJFA 2XLJA 4KHPM 1IBLM 1QZEA 1JR3D 3A45A 3J2PB 4NC6A 1VDDA 3CTWB 1SXJD 4WW0A 2VQFM 3LMMA 1QDTA 2LVOC 3HHXA 2Z3XA 4KO8A 3TWMA 1L1ZA 4OW0A 4LF6M 1DV0A 4BLCA 1R7RA 1WGNA 4Z8XA 3SAUA 4RF1A 3J7AS 1XHBA 2D7GA 3C3EA 4AZFA 1HNZM 4B08A 1EIJA 1GL7A 3WHKA 3K2LA 4DR4M 4REZA 2JP7A 3M7GA 3LVWA 1IXZA 4LFCM 1J7KA 3FE3A 4HLQA 4IBIA 1CUKA 4JI7M 3IHPA 2LXEA 2KA6B 3NWLA 1T3TA 3UGJA 1Z6TA 2DAMA 1PGYA 1V92A 4M0WA 3GQ5A 1NNUC 1PJJA 4JI1M 1T43A 2UXBM 3B7ZA 2FE8A 1FNNA 2EKFA 4DV3M 2EA0A 2QENA 4PDIA 2DXIA 4LF5M 2KRUA 3B74A 1IY0A 1NJGA 1L2DA 3UJNA 5A2QS 1IN4A 2O25A 1D0LA 4LJ7A 4R71A 4Z6YA 2DWLA 2APLA 4B3MM 2RRUA 4PDGA 2LNHC 3C9PA 3VLFB 5LMUM 2Y21A 2EKKA 2DNAA 1SXJC 3M0EA 3U61A 2OQ4A 4X62M 1OIZA 2YR0A 3L27A 4X65M 4G3OA 1Y8GA 4FD2A 3Q8GA 4LF8M 3VK8A 5GKNA 4X64M 1TGUA 2LHCA 4NOOB 3J7BA 3FUWA 2I7PA 4GH9A 2HKJA 3FYDA 2LBCA 1XWIA 5EXSA 4P16A 1N75A 1C1KA 3U6MA 4LY6A 4AW4A 2KNVA 3K92A 4WP2A 4XK8F 5EQTA 3U6OA 1XMOM 1L1TA 1HNWM 2WSFF 1LV7A 3D8BA 3PXGA 4A3VB 3HHWA 1VEGA 1PJTA 2QZ4A 3UK6A 3J80S 3BXWA 1XC8A 2HL7A 3CF2A 2G5GX 1PJIA 2XSZA 3AKZA 4B3RM 4NSRA 1XNQM 2ZTCA 3LQQA 5FTNA 2F5OA 2UXDM 4JI5M 2D7EA 4ANRA 4L78A 4D81A 2KDLA 1OQYA 4PCZA 3B89A 4B3TM 3HJSA 1ZMWA 4NXNM 2V1CA 1XXHA 5FTJA 3VKHA 4L15A 1R4GA 4OU7A 3JR4A 4RKUF 3F92A 3DZDA 2Z4SA 2ZAOA 3GLHE 1L2CA 1E94E 2K9DA 2C9CA 1Z5AA 4DV7M 2BJVA 4QNRA 4PD2A 2LWXA 3TWLA 1HT2E 2K47A 2YFQA 1OTRA 1QZMA 2J5YA 4KT0F 4M9XA 1MU5A 1Z5CA 4IBGA 3T1YM 5FTKA 3I01M 4MM3B 4DR2M 3E21A 1PJQA 2L6OA 3KP0E 1VEKA 2R65A 4IJFA 2DHYA 2CHGA 4JN6A 2NQ8C 3TQSA 5DYGA 1HR0M 4IBDA 1A5TA 4AI6A 2XEPA 5KPZA 1OJLA 4S12A 5KQDA 4M9SA 1JR3A 1HQYE 3HJQA 1KFVA 2QPAA 1VQ1A 2DHRA 2ZBKB 2VQEM 2CEAA 3GPXA 1FJGM 2JWSA 3J27B 4DUYM 3KSXA 4KLNA 3HGIA 5ITXE 2QHOB 2DZNB 4JI0M 3VDUA 2R62A 2WSCF 2M60A 1AIPC 3B9PA 4G4OA 1QQWA 4LF9M 2UXCM 3UMMA 5EP1A 2I7NA 2F5QA 3ILKA 3AOEC 5ITUA 4FWGA 1XXHB 1R2YA 1Q02A 2O5RA 3R9XB 2DI0A 2R18A 2K0BX 1J09A 1WGLA 2C9OA 3FRIA 5EXPA 2DAKA 3HU1A 1L8QA 1YE9A 2JY7A 2L4FA 2Y20A 2DAGA 1SG9A 3AFHA 4RNAA 1IQPA 3QYEA 5EXXA 2DWMA 2F5SA 2L2DA 3DA1A 4WURA 4L16A 4LGMA 3QYBA 4LCBA 4P17A 3W0LB 2R6FA 3I51A 1F4IA 3A98B 2XF3A 1IXSA 4LFAM 5ITQA 3KDSE 3R8FA 2V6ZM 3E4RA 3QWLA 4R7GA 3TWKA 3H4JA 4MH0E 3GLIA 4GC5A 1HT1E 4MGKE 3HX3A 3KSJA 2QCUA 1N77A 2BNKA 3FTDA 1IFYA 4R3DA 3CF0A 5C18A 5F3WA 2HWJA 2GNOA 4UN2B 1SXJB 3DFZA 4G6ZA 3KW6A 1V33A 2R45A 4X66M 1IBKM 1HNXM 3K8ZA 1YSYA 1PJSA 5IZ7D 4DR1M 1K82A 3GLFE 1BVSA 1IY1A 1QDRA 5FLXS 4NL4H 1IBMM 4CHTB 4D80A 2C99A 4PT5A 1XMQM 3GLGE 4GKJM 5BPVA 2KXEA 2UUCM 4AQYM 2Z8YM 2LH0A 2LVAA 2DZLA 1NY6A 2JY8A 2J7OA 3EIEA 4IBFA 4JI3M 2KHHA 3AJIB 3RGPA 2XGNA 2MROB 1IXRC 3B7QA 1R2ZA 1K3WA 3HJ8A 3T38A 4BBAA 1AUAA 1VG5A 3LVVA 2KZUA 3PNVA 4I5SA 2XFTA 2ZTDA 3SMPA 4AG5A 1QUTA 4XGIA 5EXTA 3L25A 3OTOM 1D2NA 2CRUA 3RE8A 1X37A 1IXSB 4FVMA 1PM5A 3K9PA 1GKIA 3SASA 3M6AA 3FRHA 1GVNA 2F5PA 3RFWA 4DV1M 1NSFA 4GMQA 3FD9A 3GLIB 2QP9X 2JZ0A 4HEOA 4K0KM 1NNJA 5EJCA 1OKSA 4I8OA 2XZFA 2C98A 3SAWA 2FS1A 2CHVA 3FUUA 3SMSA 3GRYA 4D82A 4IBKA 4IBJA 4DR6M 3FKEA 4FCTA 1G3IA 3KXEC 1ZMUA 3KOZE 2LHGA 1DO0A 3GQ4A 4DV2M 2HCBA 4LRSA 3HY5A 2G8LA 4MGYE 1TH4A 2Q2EB 4GRIA 4CIZA 4MGZE 3U6QA 3FTCA 1W5SA 8CATA 3L26A 2XZUA 3GO8A 4MGIE 1QVRA 1E9SA 1MJGM 2LVPC 1Z59A 1DGBA 4MB7A 3K9OA 1XB2B 2R44A 2F5NA 4JI2M 1TH2A 4W5WA 5KPTA 1PRBA 3E9SA 4HL4A 3HZJA 1IM2A 3TPZA 3HU3A 3HHYA 5H37D 2HHHM 4ITQA 3GRVA 3BOSA 3EIHA 1WXQA 1GO5A 3KP1E 1D0KA 1TR8A 4G4QA 2JA2A 4LJ9A 1N32M 3KS8A 4LZJA 4I81A 4G4NA 2J7NA 1K3XA 2FH0A 2WSEF 3D8LA 2DAEA 3VDPA 2K6BA 4FCWA 5IT9S 1E9RA 2H1RA 2H5XA 2Z7JA 3KVWA 2UUBM 4LFBM 5DYIA 4GKKM 2VF8A 3AV0A 3PFIA 3GPYA 5EP2A 1UM8A 4QOSA 1IN8A 2R0IA 5JI3E 3A42A 1I4WA 2KNZA 4CISA 1N78A 1LTMA 1W5TA 2FOIC 1SXJA 3FUXA 3GLGB 2ZAMA 4L4UA 5C1BA 1XNRM 3TL4X 3U6PA 4YHHM 2JY6B 2UUAM 4B7HA 4DV6M 3W67A 5IREB 1T6OA 1TH3A 1IY2A 4AKIA 3KOWE 1RU3A 3LCVB 4LJ4A 3W0FA 4I4LA 2JXNA 3CF6E 4LZZA 1G8PA 2XFSA 2EO2A 1OFHA 3GLHA 4FW9A 3IG5A 3GPPA 3FTFA 2JY5A 4DV4M 2VDBB 4AKHA 3LCUA 1DGHB 4DBGB 3SARA 1E32A 3C3DA 4B3SM 2EUCA 1KSFX 4QHSA 2DVWB 1G59A 2WZJA 1Z5BA 2O01F 3Q8XA 1WIVA 3L2AA 3FYCA 7CATA 3B7NA 3VFDA 4LF4M 2CUZA 2YNMD 3NBXX 4GIPA 4LG2A 2C5RA 1G4AE 4NRVA 2L09A 4MGHA 2RGHA 1GLNA 3THGA 1ZQ9A 4QOZC 3T1HM 1EE8A 4F2LA 2CV1A 2BWEA 1DGFA 1MN3A 2G3QA 1GABA 3SHFA 1TF0B 5FTMA 2BJWA 4NXMM 5ITXA 1GL6A 2KEBA 4DR5M 3SYKA 3U60A 2A5YB 2KZSA 2QQ8A 2Y0TA 1OAOC 4AG6A 3IG8A 3GRRA 2OOAA 4JI8M 4AKGA 2CWBA 4JXJA 1H6UA 5L8RF 4TUWA 3IECA 1HQCA 3FTEA 2P5TA 3GLHB 5EP4A 1QANA 4GITA 1DGGA 4LRTA 4YY3M 2MJ5B 4RF0A 3JAMS 1GJTA 3GQ3A 3H4MA 3SBJA 3GPUA 4M9ZA 2KRKA 2CFOA 3KOXE 1JQJC 2L7IA 5LMNM 3HWSA 2R46A 1ZV1A 2VF7A 3E46A 4IJEA 4DV0M 3AOEA 4DR7M 1N33M 2B3TA 4OVZA 5JI2E 2DWZB 4LJ5A 2X49A 1R5LA 5KQ8A 1QAMA 1EFUB 3PNYA 1Q39A 3ZH9B 2DAIA 2X4AA 4EIWA 4NSOB 4JI6M 2KNAA 2QNJA 2M5ZA 1OIPA 1QAOA 1XXHE 2VIIA 4QHTA 1L2BA 5KO3A 4FWHA 4LGYA 4ZPXA 1HJPA 4XBOA 3I4VA 3L28A 3U6CA 1ZMVA 4L6V6 4GEWA 3GLFA 2W82A 3SYLA 1NHWC 2R4JA 3VKGA 3U60B 2OO9A 5ITRA 1C7YA 2QBYA 3KOYE 3HHZA 4CGYB 3J81S 3GRUA 3GLGA 1UFZA 2C96A 2DENA 1G41A 3DOAA 4B7GA 3GP1A 2EJSA 2RGOA 4QNMA 1NO1A 3T15A 3ZCBB 2FFJA 1VEJA 3L29A 2E5LM 1WJ7A 3SC3A 2D7HA 2KW0A 3T6PA 3ZQJA 3V76A 2LVQD 2RKOA 4IBEA 5ITTA 3SHGB 3I04M 4Q7JA 1Q3CA 4JI4M 2JUJA 5E6JA 3A46A 2N35A 3KFUG 2MH8A 1JR3E 3MJ5A 2OOBA 4FWDA 4DR3M 1N34M 4JYAM 2MR9A 4OX9M 1SXJE 2UU9M 2JZ1A 2LTUA 2X8AA 1V34A 4IBCA 2CV0A 4OVZB 1DGHA 1KYIA 2ZANA 3LW5F 2V1UA 2MGWA 1VDLA 1IN5A 1R6BX 2CE7A 1I94M 2AHMA 1D0MA 3HKPA 3UZUA 5DNYA 3PVSA 1G71A 1Q3BA 1QAQA 2DKLA 3WHLA 4GHLA 4M0DA 2CHQA 1OAIA 4IBBA 3GLFB 2Z4RA 4DV5M 1IN7A 3U5ZA 3U61B 2QBYB 2QSFX 4NRWA 1P3QQ 3U6EA 1TDZA 3JR5A 3FUTA 3AL0C 3QAUA 4FCVA 4JV5M 2LVNC 3AOGA 5KPRA 4CJ6A 2GQFA 1DO2A 3W68A 1TTEA 3U6LA 3CGWA 4GC9A 2CP8A 3NBIA 3GLIE 1NV9A 3K1JA 2ZM6M
chains in the Genus database with same CATH topology
4L6V6 4XK8F 2WSEF 3LW5F 2WSCF 1JB0F 2WSFF 4Y28F 5L8RF 4KT0F 4RKUF 2O01F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6V 6;  4XK8 F;  2WSE F;  3LW5 F;  2WSC F;  1JB0 F;  2WSF F;  4Y28 F;  5L8R F;  4KT0 F;  4RKU F;  2O01 F; 
#chains in the Genus database with same CATH topology
 4IIW A;  4KOD A;  1N36 M;  3SAV A;  1IN6 A;  1NVM A;  2XSZ D;  1QUS A;  3TE6 A;  1YLA A;  1S3S A;  2L7H A;  1WHC A;  1YUB A;  3MHV C;  5FTL A;  2L4E A;  2BWB A;  4DUZ M;  4G4R A;  3SFZ A;  3HU2 A;  4Y28 F;  2FNA A;  5E26 A;  2DZO B;  5FSW A;  1GJS A;  3U6S A;  4B7F A;  3U6D A;  2JNH A;  3RGS A;  1NHG C;  1TDH A;  3FUV A;  3KS4 A;  5EP3 A;  1ORY B;  5BR8 M;  3I4Y A;  5DFL A;  4LF7 M;  2OPF A;  1NV8 A;  4LJA A;  4II7 A;  2Y0Q A;  1QYR A;  3ZC7 B;  4F1I A;  2R4E A;  3C58 A;  3U5Z B;  1ZAE A;  3VK7 A;  3LQR A;  1OFI A;  1WR1 B;  3BBZ A;  3MMP A;  2DWN A;  3SAT A;  2ERC A;  1J5E M;  5IWA M;  4LJ8 A;  4GHA A;  2XH9 A;  2YQZ A;  4L8R C;  5ITY A;  3MK6 A;  1NY5 A;  1JB0 F;  4BB9 A;  4LJ6 A;  2CV2 A;  2HAK A;  2F4V M;  1MX0 A;  1NJF A;  2XLJ A;  4KHP M;  1IBL M;  1QZE A;  1JR3 D;  3A45 A;  3J2P B;  4NC6 A;  1VDD A;  3CTW B;  1SXJ D;  4WW0 A;  2VQF M;  3LMM A;  1QDT A;  2LVO C;  3HHX A;  2Z3X A;  4KO8 A;  3TWM A;  1L1Z A;  4OW0 A;  4LF6 M;  1DV0 A;  4BLC A;  1R7R A;  1WGN A;  4Z8X A;  3SAU A;  4RF1 A;  3J7A S;  1XHB A;  2D7G A;  3C3E A;  4AZF A;  1HNZ M;  4B08 A;  1EIJ A;  1GL7 A;  3WHK A;  3K2L A;  4DR4 M;  4REZ A;  2JP7 A;  3M7G A;  3LVW A;  1IXZ A;  4LFC M;  1J7K A;  3FE3 A;  4HLQ A;  4IBI A;  1CUK A;  4JI7 M;  3IHP A;  2LXE A;  2KA6 B;  3NWL A;  1T3T A;  3UGJ A;  1Z6T A;  2DAM A;  1PGY A;  1V92 A;  4M0W A;  3GQ5 A;  1NNU C;  1PJJ A;  4JI1 M;  1T43 A;  2UXB M;  3B7Z A;  2FE8 A;  1FNN A;  2EKF A;  4DV3 M;  2EA0 A;  2QEN A;  4PDI A;  2DXI A;  4LF5 M;  2KRU A;  3B74 A;  1IY0 A;  1NJG A;  1L2D A;  3UJN A;  5A2Q S;  1IN4 A;  2O25 A;  1D0L A;  4LJ7 A;  4R71 A;  4Z6Y A;  2DWL A;  2APL A;  4B3M M;  2RRU A;  4PDG A;  2LNH C;  3C9P A;  3VLF B;  5LMU M;  2Y21 A;  2EKK A;  2DNA A;  1SXJ C;  3M0E A;  3U61 A;  2OQ4 A;  4X62 M;  1OIZ A;  2YR0 A;  3L27 A;  4X65 M;  4G3O A;  1Y8G A;  4FD2 A;  3Q8G A;  4LF8 M;  3VK8 A;  5GKN A;  4X64 M;  1TGU A;  2LHC A;  4NOO B;  3J7B A;  3FUW A;  2I7P A;  4GH9 A;  2HKJ A;  3FYD A;  2LBC A;  1XWI A;  5EXS A;  4P16 A;  1N75 A;  1C1K A;  3U6M A;  4LY6 A;  4AW4 A;  2KNV A;  3K92 A;  4WP2 A;  4XK8 F;  5EQT A;  3U6O A;  1XMO M;  1L1T A;  1HNW M;  2WSF F;  1LV7 A;  3D8B A;  3PXG A;  4A3V B;  3HHW A;  1VEG A;  1PJT A;  2QZ4 A;  3UK6 A;  3J80 S;  3BXW A;  1XC8 A;  2HL7 A;  3CF2 A;  2G5G X;  1PJI A;  2XSZ A;  3AKZ A;  4B3R M;  4NSR A;  1XNQ M;  2ZTC A;  3LQQ A;  5FTN A;  2F5O A;  2UXD M;  4JI5 M;  2D7E A;  4ANR A;  4L78 A;  4D81 A;  2KDL A;  1OQY A;  4PCZ A;  3B89 A;  4B3T M;  3HJS A;  1ZMW A;  4NXN M;  2V1C A;  1XXH A;  5FTJ A;  3VKH A;  4L15 A;  1R4G A;  4OU7 A;  3JR4 A;  4RKU F;  3F92 A;  3DZD A;  2Z4S A;  2ZAO A;  3GLH E;  1L2C A;  1E94 E;  2K9D A;  2C9C A;  1Z5A A;  4DV7 M;  2BJV A;  4QNR A;  4PD2 A;  2LWX A;  3TWL A;  1HT2 E;  2K47 A;  2YFQ A;  1OTR A;  1QZM A;  2J5Y A;  4KT0 F;  4M9X A;  1MU5 A;  1Z5C A;  4IBG A;  3T1Y M;  5FTK A;  3I01 M;  4MM3 B;  4DR2 M;  3E21 A;  1PJQ A;  2L6O A;  3KP0 E;  1VEK A;  2R65 A;  4IJF A;  2DHY A;  2CHG A;  4JN6 A;  2NQ8 C;  3TQS A;  5DYG A;  1HR0 M;  4IBD A;  1A5T A;  4AI6 A;  2XEP A;  5KPZ A;  1OJL A;  4S12 A;  5KQD A;  4M9S A;  1JR3 A;  1HQY E;  3HJQ A;  1KFV A;  2QPA A;  1VQ1 A;  2DHR A;  2ZBK B;  2VQE M;  2CEA A;  3GPX A;  1FJG M;  2JWS A;  3J27 B;  4DUY M;  3KSX A;  4KLN A;  3HGI A;  5ITX E;  2QHO B;  2DZN B;  4JI0 M;  3VDU A;  2R62 A;  2WSC F;  2M60 A;  1AIP C;  3B9P A;  4G4O A;  1QQW A;  4LF9 M;  2UXC M;  3UMM A;  5EP1 A;  2I7N A;  2F5Q A;  3ILK A;  3AOE C;  5ITU A;  4FWG A;  1XXH B;  1R2Y A;  1Q02 A;  2O5R A;  3R9X B;  2DI0 A;  2R18 A;  2K0B X;  1J09 A;  1WGL A;  2C9O A;  3FRI A;  5EXP A;  2DAK A;  3HU1 A;  1L8Q A;  1YE9 A;  2JY7 A;  2L4F A;  2Y20 A;  2DAG A;  1SG9 A;  3AFH A;  4RNA A;  1IQP A;  3QYE A;  5EXX A;  2DWM A;  2F5S A;  2L2D A;  3DA1 A;  4WUR A;  4L16 A;  4LGM A;  3QYB A;  4LCB A;  4P17 A;  3W0L B;  2R6F A;  3I51 A;  1F4I A;  3A98 B;  2XF3 A;  1IXS A;  4LFA M;  5ITQ A;  3KDS E;  3R8F A;  2V6Z M;  3E4R A;  3QWL A;  4R7G A;  3TWK A;  3H4J A;  4MH0 E;  3GLI A;  4GC5 A;  1HT1 E;  4MGK E;  3HX3 A;  3KSJ A;  2QCU A;  1N77 A;  2BNK A;  3FTD A;  1IFY A;  4R3D A;  3CF0 A;  5C18 A;  5F3W A;  2HWJ A;  2GNO A;  4UN2 B;  1SXJ B;  3DFZ A;  4G6Z A;  3KW6 A;  1V33 A;  2R45 A;  4X66 M;  1IBK M;  1HNX M;  3K8Z A;  1YSY A;  1PJS A;  5IZ7 D;  4DR1 M;  1K82 A;  3GLF E;  1BVS A;  1IY1 A;  1QDR A;  5FLX S;  4NL4 H;  1IBM M;  4CHT B;  4D80 A;  2C99 A;  4PT5 A;  1XMQ M;  3GLG E;  4GKJ M;  5BPV A;  2KXE A;  2UUC M;  4AQY M;  2Z8Y M;  2LH0 A;  2LVA A;  2DZL A;  1NY6 A;  2JY8 A;  2J7O A;  3EIE A;  4IBF A;  4JI3 M;  2KHH A;  3AJI B;  3RGP A;  2XGN A;  2MRO B;  1IXR C;  3B7Q A;  1R2Z A;  1K3W A;  3HJ8 A;  3T38 A;  4BBA A;  1AUA A;  1VG5 A;  3LVV A;  2KZU A;  3PNV A;  4I5S A;  2XFT A;  2ZTD A;  3SMP A;  4AG5 A;  1QUT A;  4XGI A;  5EXT A;  3L25 A;  3OTO M;  1D2N A;  2CRU A;  3RE8 A;  1X37 A;  1IXS B;  4FVM A;  1PM5 A;  3K9P A;  1GKI A;  3SAS A;  3M6A A;  3FRH A;  1GVN A;  2F5P A;  3RFW A;  4DV1 M;  1NSF A;  4GMQ A;  3FD9 A;  3GLI B;  2QP9 X;  2JZ0 A;  4HEO A;  4K0K M;  1NNJ A;  5EJC A;  1OKS A;  4I8O A;  2XZF A;  2C98 A;  3SAW A;  2FS1 A;  2CHV A;  3FUU A;  3SMS A;  3GRY A;  4D82 A;  4IBK A;  4IBJ A;  4DR6 M;  3FKE A;  4FCT A;  1G3I A;  3KXE C;  1ZMU A;  3KOZ E;  2LHG A;  1DO0 A;  3GQ4 A;  4DV2 M;  2HCB A;  4LRS A;  3HY5 A;  2G8L A;  4MGY E;  1TH4 A;  2Q2E B;  4GRI A;  4CIZ A;  4MGZ E;  3U6Q A;  3FTC A;  1W5S A;  8CAT A;  3L26 A;  2XZU A;  3GO8 A;  4MGI E;  1QVR A;  1E9S A;  1MJG M;  2LVP C;  1Z59 A;  1DGB A;  4MB7 A;  3K9O A;  1XB2 B;  2R44 A;  2F5N A;  4JI2 M;  1TH2 A;  4W5W A;  5KPT A;  1PRB A;  3E9S A;  4HL4 A;  3HZJ A;  1IM2 A;  3TPZ A;  3HU3 A;  3HHY A;  5H37 D;  2HHH M;  4ITQ A;  3GRV A;  3BOS A;  3EIH A;  1WXQ A;  1GO5 A;  3KP1 E;  1D0K A;  1TR8 A;  4G4Q A;  2JA2 A;  4LJ9 A;  1N32 M;  3KS8 A;  4LZJ A;  4I81 A;  4G4N A;  2J7N A;  1K3X A;  2FH0 A;  2WSE F;  3D8L A;  2DAE A;  3VDP A;  2K6B A;  4FCW A;  5IT9 S;  1E9R A;  2H1R A;  2H5X A;  2Z7J A;  3KVW A;  2UUB M;  4LFB M;  5DYI A;  4GKK M;  2VF8 A;  3AV0 A;  3PFI A;  3GPY A;  5EP2 A;  1UM8 A;  4QOS A;  1IN8 A;  2R0I A;  5JI3 E;  3A42 A;  1I4W A;  2KNZ A;  4CIS A;  1N78 A;  1LTM A;  1W5T A;  2FOI C;  1SXJ A;  3FUX A;  3GLG B;  2ZAM A;  4L4U A;  5C1B A;  1XNR M;  3TL4 X;  3U6P A;  4YHH M;  2JY6 B;  2UUA M;  4B7H A;  4DV6 M;  3W67 A;  5IRE B;  1T6O A;  1TH3 A;  1IY2 A;  4AKI A;  3KOW E;  1RU3 A;  3LCV B;  4LJ4 A;  3W0F A;  4I4L A;  2JXN A;  3CF6 E;  4LZZ A;  1G8P A;  2XFS A;  2EO2 A;  1OFH A;  3GLH A;  4FW9 A;  3IG5 A;  3GPP A;  3FTF A;  2JY5 A;  4DV4 M;  2VDB B;  4AKH A;  3LCU A;  1DGH B;  4DBG B;  3SAR A;  1E32 A;  3C3D A;  4B3S M;  2EUC A;  1KSF X;  4QHS A;  2DVW B;  1G59 A;  2WZJ A;  1Z5B A;  2O01 F;  3Q8X A;  1WIV A;  3L2A A;  3FYC A;  7CAT A;  3B7N A;  3VFD A;  4LF4 M;  2CUZ A;  2YNM D;  3NBX X;  4GIP A;  4LG2 A;  2C5R A;  1G4A E;  4NRV A;  2L09 A;  4MGH A;  2RGH A;  1GLN A;  3THG A;  1ZQ9 A;  4QOZ C;  3T1H M;  1EE8 A;  4F2L A;  2CV1 A;  2BWE A;  1DGF A;  1MN3 A;  2G3Q A;  1GAB A;  3SHF A;  1TF0 B;  5FTM A;  2BJW A;  4NXM M;  5ITX A;  1GL6 A;  2KEB A;  4DR5 M;  3SYK A;  3U60 A;  2A5Y B;  2KZS A;  2QQ8 A;  2Y0T A;  1OAO C;  4AG6 A;  3IG8 A;  3GRR A;  2OOA A;  4JI8 M;  4AKG A;  2CWB A;  4JXJ A;  1H6U A;  5L8R F;  4TUW A;  3IEC A;  1HQC A;  3FTE A;  2P5T A;  3GLH B;  5EP4 A;  1QAN A;  4GIT A;  1DGG A;  4LRT A;  4YY3 M;  2MJ5 B;  4RF0 A;  3JAM S;  1GJT A;  3GQ3 A;  3H4M A;  3SBJ A;  3GPU A;  4M9Z A;  2KRK A;  2CFO A;  3KOX E;  1JQJ C;  2L7I A;  5LMN M;  3HWS A;  2R46 A;  1ZV1 A;  2VF7 A;  3E46 A;  4IJE A;  4DV0 M;  3AOE A;  4DR7 M;  1N33 M;  2B3T A;  4OVZ A;  5JI2 E;  2DWZ B;  4LJ5 A;  2X49 A;  1R5L A;  5KQ8 A;  1QAM A;  1EFU B;  3PNY A;  1Q39 A;  3ZH9 B;  2DAI A;  2X4A A;  4EIW A;  4NSO B;  4JI6 M;  2KNA A;  2QNJ A;  2M5Z A;  1OIP A;  1QAO A;  1XXH E;  2VII A;  4QHT A;  1L2B A;  5KO3 A;  4FWH A;  4LGY A;  4ZPX A;  1HJP A;  4XBO A;  3I4V A;  3L28 A;  3U6C A;  1ZMV A;  4L6V 6;  4GEW A;  3GLF A;  2W82 A;  3SYL A;  1NHW C;  2R4J A;  3VKG A;  3U60 B;  2OO9 A;  5ITR A;  1C7Y A;  2QBY A;  3KOY E;  3HHZ A;  4CGY B;  3J81 S;  3GRU A;  3GLG A;  1UFZ A;  2C96 A;  2DEN A;  1G41 A;  3DOA A;  4B7G A;  3GP1 A;  2EJS A;  2RGO A;  4QNM A;  1NO1 A;  3T15 A;  3ZCB B;  2FFJ A;  1VEJ A;  3L29 A;  2E5L M;  1WJ7 A;  3SC3 A;  2D7H A;  2KW0 A;  3T6P A;  3ZQJ A;  3V76 A;  2LVQ D;  2RKO A;  4IBE A;  5ITT A;  3SHG B;  3I04 M;  4Q7J A;  1Q3C A;  4JI4 M;  2JUJ A;  5E6J A;  3A46 A;  2N35 A;  3KFU G;  2MH8 A;  1JR3 E;  3MJ5 A;  2OOB A;  4FWD A;  4DR3 M;  1N34 M;  4JYA M;  2MR9 A;  4OX9 M;  1SXJ E;  2UU9 M;  2JZ1 A;  2LTU A;  2X8A A;  1V34 A;  4IBC A;  2CV0 A;  4OVZ B;  1DGH A;  1KYI A;  2ZAN A;  3LW5 F;  2V1U A;  2MGW A;  1VDL A;  1IN5 A;  1R6B X;  2CE7 A;  1I94 M;  2AHM A;  1D0M A;  3HKP A;  3UZU A;  5DNY A;  3PVS A;  1G71 A;  1Q3B A;  1QAQ A;  2DKL A;  3WHL A;  4GHL A;  4M0D A;  2CHQ A;  1OAI A;  4IBB A;  3GLF B;  2Z4R A;  4DV5 M;  1IN7 A;  3U5Z A;  3U61 B;  2QBY B;  2QSF X;  4NRW A;  1P3Q Q;  3U6E A;  1TDZ A;  3JR5 A;  3FUT A;  3AL0 C;  3QAU A;  4FCV A;  4JV5 M;  2LVN C;  3AOG A;  5KPR A;  4CJ6 A;  2GQF A;  1DO2 A;  3W68 A;  1TTE A;  3U6L A;  3CGW A;  4GC9 A;  2CP8 A;  3NBI A;  3GLI E;  1NV9 A;  3K1J A;  2ZM6 M; 
#chains in the Genus database with same CATH homology
 4L6V 6;  4XK8 F;  2WSE F;  3LW5 F;  2WSC F;  1JB0 F;  2WSF F;  4Y28 F;  5L8R F;  4KT0 F;  4RKU F;  2O01 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...