2DNAA

Solution structure of rsgi ruh-056, a uba domain from mouse cdna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGPSHSLQAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIYKLKSSQGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords unnamed protein product
publication title Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2006-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dnaA00
2DENA 1XXHE 2LVOC 3GLHE 3GLIE 2JP7A 1HJPA 1GO5A 2R0IA 2DAKA 2DZLA 2WZJA 2DAMA 2DKLA 2KNAA 1YLAA 1VG5A 2MROB 1E94E 1G3IA 1BVSA 1G41A 1WR1B 2JUJA 1T43A 4UN2B 2EJSA 1Y8GA 2HAKA 1VQ1A 1R4GA 2MR9A 2ZTCA 4F1IA 2DI0A 1ZMVA 1TR8A 2KNZA 4G3OA 1OKSA 1G4AE 3E46A 2EKKA 2JZ1A 1JR3E 1WGLA 2EKFA 1DV0A 1UFZA 1OQYA 1WIVA 2JY6B 3E21A 2KNVA 1DO0A 3K9OA 2DHYA 2JNHA 2JY8A 3F92A 4Q7JA 2ZTDA 4DBGB 1IXSA 3K9PA 2BWBA 4HEOA 2CP8A 2QHOB 1P3QQ 3GLFE 2QSFX 1V92A 1F4IA 1WGNA 1ZV1A 4GEWA 1HT2E 3FE3A 2DAEA 4WP2A 2K9DA 2HWJA 4R71A 3B89A 2LVNC 1NV9A 3FRHA 3IECA 2MJ5B 1AIPC 1VEKA 2RRUA 1IM2A 1IFYA 2L4EA 1VEGA 1KYIA 5DFLA 1EFUB 2JY5A 2LBCA 1QZEA 2DAIA 1HT1E 2L2DA 1HQYE 2LTUA 2LVPC 2L4FA 1MN3A 1DO2A 1ZMWA 3GLGE 2MGWA 1CUKA 2JY7A 1A5TA 3H4JA 1C7YA 1OAIA 1WHCA 2LVAA 3LCVB 1WJ7A 2DAGA 3FRIA 1VEJA 2BWEA 1Q02A 2DNAA 2O25A 2JZ0A 2OOAA 2OOBA 2CWBA 3T6PA 2KHHA 1TTEA 1T6OA 1VDLA 2K0BX 1NV8A 2G3QA 2H5XA 2OO9A 1OTRA 1SG9A 2B3TA 3MMPA 5JI2E 1ZMUA 3IHPA 3LCUA 4F2LA 1XB2B 1PGYA 2LVQD 3BBZA 2QNJA
chains in the Genus database with same CATH superfamily
3LVWA 5ITTA 4KODA 2ZAMA 5BR8M 4G4NA 4LFCM 3AOEC 1L8QA 5KPZA 2KXEA 5EP1A 4NRWA 3VDPA 5ITRA 1IXRC 1NHGC 1Z5BA 3GPYA 1IN8A 3BXWA 2DAKA 2DZLA 4LF5M 3I01M 1TH4A 3HHXA 5EJCA 4KLNA 1L2DA 4IBDA 2RKOA 1G41A 4LJAA 4FWHA 1KFVA 3HU1A 4IBFA 4AKIA 3L2AA 7CATA 4DUZM 2R65A 1VQ1A 3KOWE 2R44A 4FCVA 2ZTCA 4LRSA 4LY6A 4DR7M 1OAOC 1NJFA 3ZQJA 4JI0M 4G3OA 1TR8A 2CEAA 1R2YA 4LF6M 3E46A 1SXJA 3IG5A 3V76A 1TDHA 2UUBM 4XK8F 2C9OA 2EKFA 4G6ZA 1DGHB 3SAUA 2LNHC 1PRBA 2N35A 4B3MM 1Z5CA 5EXPA 2UUAM 2CV0A 3FD9A 2Z3XA 5C1BA 3AOGA 1VDDA 5DNYA 4IJEA 2M5ZA 3HU3A 3A46A 3I4YA 5FTMA 2D7GA 2Y20A 3F92A 4L6V6 1NVMA 4Q7JA 2ZTDA 5IWAM 1K82A 1IXSA 3NBXX 1SXJD 1OIZA 3FTFA 3HJ8A 4FWGA 4HEOA 2H1RA 1P3QQ 5IREB 3GLFE 2EA0A 3LMMA 3QYEA 1N36M 4GKJM 1F4IA 1ZV1A 1ORYB 2Z4RA 3FE3A 1MJGM 2V1UA 3CF0A 3KSXA 4M9SA 1IN5A 4D81A 4GHAA 2QQ8A 2X8AA 2K9DA 4NSRA 2HCBA 1FNNA 2QPAA 1XWIA 1H6UA 3KSJA 3JR5A 4LF9M 3U6CA 4Z6YA 4G4OA 2GNOA 3AOEA 2L4EA 4ZPXA 3LVVA 1R7RA 2DAIA 3FUUA 2JWSA 4Z8XA 2L2DA 1HT1E 1ZQ9A 1HQYE 3SMSA 2JA2A 3GQ5A 4YY3M 4GHLA 3DZDA 1QUSA 1NJGA 2C96A 2CE7A 3HWSA 3L27A 1ZMWA 4IBBA 2KEBA 2MGWA 3RFWA 3UJNA 1IBMM 2UUCM 4LG2A 1CUKA 3TQSA 2F4VM 3W68A 1D2NA 3B7QA 1Z5AA 3C9PA 4GH9A 3W0FA 2X49A 2E5LM 3H4JA 3GRRA 1OAIA 4CHTB 4ITQA 3LCVB 3CF6E 4DV0M 1G59A 3MK6A 1XXHA 3GLIA 1NHWC 4FD2A 2JZ0A 3HX3A 3NWLA 3T6PA 4LJ7A 2VF7A 3DA1A 3I04M 2DHRA 3UK6A 2XZFA 4RKUF 4L78A 1T6OA 4MB7A 5FTKA 1I4WA 1NSFA 3VKGA 3GRUA 1X37A 3SAVA 2F5NA 4M0DA 4JI5M 2KRUA 2KA6B 2DWZB 2H5XA 2OO9A 2F5OA 2R4EA 1JQJC 3VK8A 1QZMA 1SG9A 3K8ZA 1K3WA 2B3TA 1QDRA 2QBYB 4DV5M 1D0KA 2XSZA 4DV7M 3IHPA 3SHFA 3LW5F 2O01F 3PNVA 4REZA 1SXJC 3B9PA 5E26A 1JR3A 5ITXE 3A45A 3TWKA 3J27B 5E6JA 4D80A 4RF0A 2LVOC 4KO8A 4EIWA 1XNRM 4LJ5A 1QYRA 2JP7A 1LTMA 2ZAOA 3FTCA 2DZNB 4I8OA 5FTNA 1TDZA 4AG5A 2YR0A 2XSZD 4LFAM 3GLGB 2KDLA 1E32A 2KNAA 1XC8A 1YLAA 4GC5A 1EIJA 1E94E 2Y0TA 1HNZM 2EO2A 1JR3D 1FJGM 4UN2B 2UXBM 2EJSA 1TH3A 2HAKA 1DGBA 3GPUA 2MR9A 1V34A 4LJ6A 5FLXS 4I4LA 3J7BA 2DI0A 1ZMVA 2JXNA 1OKSA 1G4AE 2BJVA 5EP2A 3A42A 1R2ZA 2CUZA 4AKGA 4FWDA 1IY1A 1GABA 3PFIA 2Q2EB 3GO8A 4OX9M 5KPTA 3KOXE 1QANA 2CV1A 4AQYM 1DO0A 2K6BA 5KPRA 4I81A 4JI4M 1IQPA 3FYDA 3HKPA 1UM8A 1TH2A 1C1KA 2DHYA 4IBCA 2JY8A 3KW6A 4G4QA 1N34M 4DR4M 1N32M 3PVSA 3CTWB 1IBLM 3D8BA 4KT0F 3U61B 3AV0A 2X4AA 2CP8A 5ITQA 4PCZA 2QSFX 2XF3A 3SYLA 1V92A 2P5TA 5IT9S 4BLCA 2UU9M 3SFZA 3U60B 3ILKA 3HJSA 3U6PA 3GLHB 1GVNA 3ZC7B 4WP2A 5L8RF 3KXEC 4PDGA 4B7HA 4PT5A 1G8PA 2ERCA 3SBJA 1NV9A 3FRHA 3TL4X 4LZJA 3QAUA 3KOYE 1IFYA 4DUYM 1VEGA 5EQTA 4B08A 4LF7M 1IXZA 3AFHA 2LBCA 3LQRA 4WURA 4AZFA 4DV2M 4JI7M 3EIEA 2DWMA 2YQZA 3E9SA 4QOSA 3HZJA 3HU2A 5JI3E 1DO2A 3GLGE 4HLQA 2L09A 2JY7A 3GP1A 3HY5A 3DOAA 1XMOM 3EIHA 3U5ZA 4CGYB 2R6FA 4W5WA 4M0WA 3AKZA 3FKEA 3UGJA 2LH0A 4JN6A 2LVAA 3HJQA 2FH0A 1PJIA 1YSYA 2APLA 2MH8A 3C58A 3VDUA 1Q02A 4NL4H 3PXGA 2OPFA 3SATA 2CWBA 1QAQA 3W0LB 2VIIA 4RF1A 3U6OA 1NY6A 2WSFF 5EP4A 4IBIA 5EXXA 2R62A 2M60A 2F5QA 3MHVC 4QOZC 1XNQM 1R6BX 4ANRA 4AG6A 4IBGA 3SHGB 3CF2A 5LMNM 1HR0M 2OQ4A 4LJ4A 1D0LA 3TE6A 4AW4A 4B3TM 4MH0E 3FUTA 1Z6TA 2BJWA 5JI2E 4GMQA 3B7ZA 1YUBA 3LCUA 3J81S 2DXIA 2J7NA 4LF8M 1SXJB 3BBZA 2I7NA 2V1CA 2VDBB 3IG8A 2VQFM 4GRIA 3Q8XA 4MGHA 4DR1M 3A98B 4OVZA 1IN7A 1NNUC 2DENA 1LV7A 2LHCA 3FTEA 4AKHA 3GLHE 2K47A 4NRVA 2QZ4A 1Z59A 1J09A 2V6ZM 5DYIA 1HJPA 1GO5A 1XMQM 1IBKM 1IN6A 2R0IA 5KQ8A 1GL6A 3ZCBB 2Z8YM 2DKLA 1IXSB 4P17A 2MROB 1QQWA 2HL7A 1G3IA 1BVSA 4NSOB 3W67A 3HGIA 3OTOM 2A5YB 4IJFA 3GLFA 1Y8GA 3T15A 2CRUA 3R8FA 2ZANA 3R9XB 2XH9A 4F1IA 3FUXA 2R18A 2XFSA 1W5SA 1Q3CA 2CFOA 4B7GA 3GRYA 1NY5A 5F3WA 2CV2A 2YFQA 2DWNA 2JZ1A 3L29A 4M9ZA 3I51A 1N78A 3J80S 2GQFA 2QP9X 4RNAA 3ZH9B 3THGA 4MGZE 1MX0A 1W5TA 1E9SA 3M0EA 3E21A 3J7AS 4IIWA 3E4RA 4HL4A 1TF0B 3C3DA 5BPVA 5EXTA 3FTDA 4DBGB 4NOOB 2BWBA 3VK7A 4CISA 2C99A 2KZSA 3TPZA 8CATA 4X62M 1WGNA 3D8LA 2F5PA 4MGIE 1GKIA 1XXHB 3GLIB 2UXDM 1SXJE 4FCTA 5A2QS 4MGYE 2J7OA 2HWJA 4R71A 3GPXA 2LVNC 4DV4M 3SARA 4DV3M 2AHMA 1G71A 3IECA 1GJSA 1VEKA 1QUTA 4QNMA 4PD2A 4LGMA 4R7GA 1D0MA 1GLNA 1QZEA 3HHZA 4JI1M 3KFUG 2HKJA 2LTUA 1NNJA 1L2CA 1OIPA 3T38A 3L25A 2KRKA 2L4FA 3CGWA 4JXJA 2RGHA 1YE9A 4NXNM 2C98A 1OFHA 2CHGA 2O5RA 2QENA 3KDSE 3TWLA 1L1TA 4FW9A 5EXSA 2FE8A 4LF4M 4JI8M 3DFZA 4LJ8A 1WHCA 4MGKE 5ITXA 3WHLA 1WJ7A 4LZZA 3FRIA 4XBOA 4BBAA 3QYBA 1VEJA 1DGGA 1R5LA 2BWEA 2FNAA 4NXMM 2O25A 2OOAA 4LJ9A 3SC3A 2DVWB 3KVWA 4JYAM 3VLFB 4II7A 4JI2M 2XGNA 3L28A 5C18A 1TTEA 1VDLA 2K0BX 2XEPA 4A3VB 2BNKA 1J7KA 4WW0A 5IZ7D 2G3QA 4DR6M 3RGSA 4DR3M 3J2PB 3PNYA 2LHGA 2FS1A 4D82A 3AL0C 3MMPA 3L26A 2EUCA 3SASA 4L8RC 4BB9A 1PGYA 2WSCF 3C3EA 4JI6M 2L6OA 3SAWA 4P16A 2Z4SA 4L16A 1XXHE 3GLIE 1EE8A 1JB0F 1QAMA 4MM3B 4M9XA 2LWXA 3RE8A 1GL7A 3B74A 2WZJA 2DAMA 4YHHM 2HHHM 2KW0A 2ZBKB 3KS8A 1N33M 1VG5A 1N77A 2XLJA 3U6MA 1HNXM 4X66M 4LRTA 1WR1B 3I4VA 2JUJA 1T43A 3M6AA 4B7FA 2VF8A 2D7EA 3HHYA 2RGOA 1R4GA 1OFIA 2QBYA 3Q8GA 2FFJA 5LMUM 3K1JA 3SYKA 2C5RA 2UXCM 2D7HA 2KNZA 3FUWA 5GKNA 2DZOB 4IBJA 4FVMA 1TGUA 3T1HM 4GKKM 2EKKA 3M7GA 1JR3E 1WGLA 4OW0A 4DR5M 3GPPA 5DYGA 1DV0A 1UFZA 1OQYA 5ITUA 1WIVA 3QWLA 4LFBM 4XGIA 3U6QA 3FYCA 4LGYA 2JY6B 4R3DA 5KO3A 2ZM6M 1QDTA 4G4RA 3U6EA 2KNVA 4DR2M 3K9OA 4FCWA 3B7NA 1V33A 2Y21A 5EP3A 2JNHA 1L1ZA 2R4JA 3GLGA 1PJTA 4DV1M 1NO1A 3K9PA 1XHBA 4X65M 3U6DA 1T3TA 2QHOB 3U5ZB 4JI3M 3VKHA 1IY2A 4KHPM 1PM5A 4GEWA 1HT2E 3K92A 2R46A 2DAEA 2XFTA 1PJJA 3H4MA 5KQDA 1QAOA 3B89A 1J5EM 2G8LA 1L2BA 2J5YA 2MJ5B 1AIPC 3KP0E 1PJSA 2RRUA 3MJ5A 1K3XA 1IM2A 2Y0QA 3T1YM 1IY0A 1KYIA 3GRVA 3BOSA 5DFLA 1EFUB 1S3SA 2JY5A 4X64M 3GQ4A 1I94M 2R45A 4GITA 4IBKA 1OJLA 1Q39A 1DGFA 2LVPC 4OU7A 3KS4A 1MN3A 4IBEA 2I7PA 1PJQA 1N75A 4B3RM 2KZUA 1GJTA 1A5TA 1IN4A 2C9CA 2XZUA 4AI6A 4QNRA 4QHTA 4L4UA 3U6LA 1QVRA 3U61A 2L7IA 4DV6M 4I5SA 4QHSA 3RGPA 5FTJA 2YNMD 2CHQA 1C7YA 4OVZB 3K2LA 3JAMS 2QCUA 4LCBA 3U60A 4B3SM 1AUAA 2DAGA 4TUWA 3KP1E 2WSEF 3GLHA 1HQCA 3SMPA 4PDIA 3TWMA 2DNAA 3U6SA 4NC6A 3LQQA 2OOBA 2VQEM 4CJ6A 1WXQA 2KHHA 3JR4A 3AJIB 1DGHA 2LXEA 3VFDA 1NV8A 3HHWA 2DWLA 5FSWA 1HNWM 1Q3BA 1RU3A 4CIZA 5H37D 4S12A 5ITYA 2NQ8C 2L7HA 2CHVA 3FUVA 4GC9A 3GLFB 1KSFX 1OTRA 3UZUA 3WHKA 4JV5M 2G5GX 2F5SA 4K0KM 2W82A 1ZMUA 1ZAEA 3KOZE 4Y28F 4F2LA 1XB2B 4L15A 2LVQD 3NBIA 5FTLA 1MU5A 1E9RA 2QNJA 4GIPA 3GQ3A 3UMMA 2FOIC 2Z7JA
chains in the Genus database with same CATH topology
2DENA 1XXHE 2LVOC 3GLHE 3GLIE 2JP7A 1HJPA 1GO5A 2R0IA 2DAKA 2DZLA 2WZJA 2DAMA 2DKLA 2KNAA 1YLAA 1VG5A 2MROB 1E94E 1G3IA 1BVSA 1G41A 1WR1B 2JUJA 1T43A 4UN2B 2EJSA 1Y8GA 2HAKA 1VQ1A 1R4GA 2MR9A 2ZTCA 4F1IA 2DI0A 1ZMVA 1TR8A 2KNZA 4G3OA 1OKSA 1G4AE 3E46A 2EKKA 2JZ1A 1JR3E 1WGLA 2EKFA 1DV0A 1UFZA 1OQYA 1WIVA 2JY6B 3E21A 2KNVA 1DO0A 3K9OA 2DHYA 2JNHA 2JY8A 3F92A 4Q7JA 2ZTDA 4DBGB 1IXSA 3K9PA 2BWBA 4HEOA 2CP8A 2QHOB 1P3QQ 3GLFE 2QSFX 1V92A 1F4IA 1WGNA 1ZV1A 4GEWA 1HT2E 3FE3A 2DAEA 4WP2A 2K9DA 2HWJA 4R71A 3B89A 2LVNC 1NV9A 3FRHA 3IECA 2MJ5B 1AIPC 1VEKA 2RRUA 1IM2A 1IFYA 2L4EA 1VEGA 1KYIA 5DFLA 1EFUB 2JY5A 2LBCA 1QZEA 2DAIA 1HT1E 2L2DA 1HQYE 2LTUA 2LVPC 2L4FA 1MN3A 1DO2A 1ZMWA 3GLGE 2MGWA 1CUKA 2JY7A 1A5TA 3H4JA 1C7YA 1OAIA 1WHCA 2LVAA 3LCVB 1WJ7A 2DAGA 3FRIA 1VEJA 2BWEA 1Q02A 2DNAA 2O25A 2JZ0A 2OOAA 2OOBA 2CWBA 3T6PA 2KHHA 1TTEA 1T6OA 1VDLA 2K0BX 1NV8A 2G3QA 2H5XA 2OO9A 1OTRA 1SG9A 2B3TA 3MMPA 5JI2E 1ZMUA 3IHPA 3LCUA 4F2LA 1XB2B 1PGYA 2LVQD 3BBZA 2QNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEN A;  1XXH E;  2LVO C;  3GLH E;  3GLI E;  2JP7 A;  1HJP A;  1GO5 A;  2R0I A;  2DAK A;  2DZL A;  2WZJ A;  2DAM A;  2DKL A;  2KNA A;  1YLA A;  1VG5 A;  2MRO B;  1E94 E;  1G3I A;  1BVS A;  1G41 A;  1WR1 B;  2JUJ A;  1T43 A;  4UN2 B;  2EJS A;  1Y8G A;  2HAK A;  1VQ1 A;  1R4G A;  2MR9 A;  2ZTC A;  4F1I A;  2DI0 A;  1ZMV A;  1TR8 A;  2KNZ A;  4G3O A;  1OKS A;  1G4A E;  3E46 A;  2EKK A;  2JZ1 A;  1JR3 E;  1WGL A;  2EKF A;  1DV0 A;  1UFZ A;  1OQY A;  1WIV A;  2JY6 B;  3E21 A;  2KNV A;  1DO0 A;  3K9O A;  2DHY A;  2JNH A;  2JY8 A;  3F92 A;  4Q7J A;  2ZTD A;  4DBG B;  1IXS A;  3K9P A;  2BWB A;  4HEO A;  2CP8 A;  2QHO B;  1P3Q Q;  3GLF E;  2QSF X;  1V92 A;  1F4I A;  1WGN A;  1ZV1 A;  4GEW A;  1HT2 E;  3FE3 A;  2DAE A;  4WP2 A;  2K9D A;  2HWJ A;  4R71 A;  3B89 A;  2LVN C;  1NV9 A;  3FRH A;  3IEC A;  2MJ5 B;  1AIP C;  1VEK A;  2RRU A;  1IM2 A;  1IFY A;  2L4E A;  1VEG A;  1KYI A;  5DFL A;  1EFU B;  2JY5 A;  2LBC A;  1QZE A;  2DAI A;  1HT1 E;  2L2D A;  1HQY E;  2LTU A;  2LVP C;  2L4F A;  1MN3 A;  1DO2 A;  1ZMW A;  3GLG E;  2MGW A;  1CUK A;  2JY7 A;  1A5T A;  3H4J A;  1C7Y A;  1OAI A;  1WHC A;  2LVA A;  3LCV B;  1WJ7 A;  2DAG A;  3FRI A;  1VEJ A;  2BWE A;  1Q02 A;  2DNA A;  2O25 A;  2JZ0 A;  2OOA A;  2OOB A;  2CWB A;  3T6P A;  2KHH A;  1TTE A;  1T6O A;  1VDL A;  2K0B X;  1NV8 A;  2G3Q A;  2H5X A;  2OO9 A;  1OTR A;  1SG9 A;  2B3T A;  3MMP A;  5JI2 E;  1ZMU A;  3IHP A;  3LCU A;  4F2L A;  1XB2 B;  1PGY A;  2LVQ D;  3BBZ A;  2QNJ A; 
#chains in the Genus database with same CATH topology
 3LVW A;  5ITT A;  4KOD A;  2ZAM A;  5BR8 M;  4G4N A;  4LFC M;  3AOE C;  1L8Q A;  5KPZ A;  2KXE A;  5EP1 A;  4NRW A;  3VDP A;  5ITR A;  1IXR C;  1NHG C;  1Z5B A;  3GPY A;  1IN8 A;  3BXW A;  2DAK A;  2DZL A;  4LF5 M;  3I01 M;  1TH4 A;  3HHX A;  5EJC A;  4KLN A;  1L2D A;  4IBD A;  2RKO A;  1G41 A;  4LJA A;  4FWH A;  1KFV A;  3HU1 A;  4IBF A;  4AKI A;  3L2A A;  7CAT A;  4DUZ M;  2R65 A;  1VQ1 A;  3KOW E;  2R44 A;  4FCV A;  2ZTC A;  4LRS A;  4LY6 A;  4DR7 M;  1OAO C;  1NJF A;  3ZQJ A;  4JI0 M;  4G3O A;  1TR8 A;  2CEA A;  1R2Y A;  4LF6 M;  3E46 A;  1SXJ A;  3IG5 A;  3V76 A;  1TDH A;  2UUB M;  4XK8 F;  2C9O A;  2EKF A;  4G6Z A;  1DGH B;  3SAU A;  2LNH C;  1PRB A;  2N35 A;  4B3M M;  1Z5C A;  5EXP A;  2UUA M;  2CV0 A;  3FD9 A;  2Z3X A;  5C1B A;  3AOG A;  1VDD A;  5DNY A;  4IJE A;  2M5Z A;  3HU3 A;  3A46 A;  3I4Y A;  5FTM A;  2D7G A;  2Y20 A;  3F92 A;  4L6V 6;  1NVM A;  4Q7J A;  2ZTD A;  5IWA M;  1K82 A;  1IXS A;  3NBX X;  1SXJ D;  1OIZ A;  3FTF A;  3HJ8 A;  4FWG A;  4HEO A;  2H1R A;  1P3Q Q;  5IRE B;  3GLF E;  2EA0 A;  3LMM A;  3QYE A;  1N36 M;  4GKJ M;  1F4I A;  1ZV1 A;  1ORY B;  2Z4R A;  3FE3 A;  1MJG M;  2V1U A;  3CF0 A;  3KSX A;  4M9S A;  1IN5 A;  4D81 A;  4GHA A;  2QQ8 A;  2X8A A;  2K9D A;  4NSR A;  2HCB A;  1FNN A;  2QPA A;  1XWI A;  1H6U A;  3KSJ A;  3JR5 A;  4LF9 M;  3U6C A;  4Z6Y A;  4G4O A;  2GNO A;  3AOE A;  2L4E A;  4ZPX A;  3LVV A;  1R7R A;  2DAI A;  3FUU A;  2JWS A;  4Z8X A;  2L2D A;  1HT1 E;  1ZQ9 A;  1HQY E;  3SMS A;  2JA2 A;  3GQ5 A;  4YY3 M;  4GHL A;  3DZD A;  1QUS A;  1NJG A;  2C96 A;  2CE7 A;  3HWS A;  3L27 A;  1ZMW A;  4IBB A;  2KEB A;  2MGW A;  3RFW A;  3UJN A;  1IBM M;  2UUC M;  4LG2 A;  1CUK A;  3TQS A;  2F4V M;  3W68 A;  1D2N A;  3B7Q A;  1Z5A A;  3C9P A;  4GH9 A;  3W0F A;  2X49 A;  2E5L M;  3H4J A;  3GRR A;  1OAI A;  4CHT B;  4ITQ A;  3LCV B;  3CF6 E;  4DV0 M;  1G59 A;  3MK6 A;  1XXH A;  3GLI A;  1NHW C;  4FD2 A;  2JZ0 A;  3HX3 A;  3NWL A;  3T6P A;  4LJ7 A;  2VF7 A;  3DA1 A;  3I04 M;  2DHR A;  3UK6 A;  2XZF A;  4RKU F;  4L78 A;  1T6O A;  4MB7 A;  5FTK A;  1I4W A;  1NSF A;  3VKG A;  3GRU A;  1X37 A;  3SAV A;  2F5N A;  4M0D A;  4JI5 M;  2KRU A;  2KA6 B;  2DWZ B;  2H5X A;  2OO9 A;  2F5O A;  2R4E A;  1JQJ C;  3VK8 A;  1QZM A;  1SG9 A;  3K8Z A;  1K3W A;  2B3T A;  1QDR A;  2QBY B;  4DV5 M;  1D0K A;  2XSZ A;  4DV7 M;  3IHP A;  3SHF A;  3LW5 F;  2O01 F;  3PNV A;  4REZ A;  1SXJ C;  3B9P A;  5E26 A;  1JR3 A;  5ITX E;  3A45 A;  3TWK A;  3J27 B;  5E6J A;  4D80 A;  4RF0 A;  2LVO C;  4KO8 A;  4EIW A;  1XNR M;  4LJ5 A;  1QYR A;  2JP7 A;  1LTM A;  2ZAO A;  3FTC A;  2DZN B;  4I8O A;  5FTN A;  1TDZ A;  4AG5 A;  2YR0 A;  2XSZ D;  4LFA M;  3GLG B;  2KDL A;  1E32 A;  2KNA A;  1XC8 A;  1YLA A;  4GC5 A;  1EIJ A;  1E94 E;  2Y0T A;  1HNZ M;  2EO2 A;  1JR3 D;  1FJG M;  4UN2 B;  2UXB M;  2EJS A;  1TH3 A;  2HAK A;  1DGB A;  3GPU A;  2MR9 A;  1V34 A;  4LJ6 A;  5FLX S;  4I4L A;  3J7B A;  2DI0 A;  1ZMV A;  2JXN A;  1OKS A;  1G4A E;  2BJV A;  5EP2 A;  3A42 A;  1R2Z A;  2CUZ A;  4AKG A;  4FWD A;  1IY1 A;  1GAB A;  3PFI A;  2Q2E B;  3GO8 A;  4OX9 M;  5KPT A;  3KOX E;  1QAN A;  2CV1 A;  4AQY M;  1DO0 A;  2K6B A;  5KPR A;  4I81 A;  4JI4 M;  1IQP A;  3FYD A;  3HKP A;  1UM8 A;  1TH2 A;  1C1K A;  2DHY A;  4IBC A;  2JY8 A;  3KW6 A;  4G4Q A;  1N34 M;  4DR4 M;  1N32 M;  3PVS A;  3CTW B;  1IBL M;  3D8B A;  4KT0 F;  3U61 B;  3AV0 A;  2X4A A;  2CP8 A;  5ITQ A;  4PCZ A;  2QSF X;  2XF3 A;  3SYL A;  1V92 A;  2P5T A;  5IT9 S;  4BLC A;  2UU9 M;  3SFZ A;  3U60 B;  3ILK A;  3HJS A;  3U6P A;  3GLH B;  1GVN A;  3ZC7 B;  4WP2 A;  5L8R F;  3KXE C;  4PDG A;  4B7H A;  4PT5 A;  1G8P A;  2ERC A;  3SBJ A;  1NV9 A;  3FRH A;  3TL4 X;  4LZJ A;  3QAU A;  3KOY E;  1IFY A;  4DUY M;  1VEG A;  5EQT A;  4B08 A;  4LF7 M;  1IXZ A;  3AFH A;  2LBC A;  3LQR A;  4WUR A;  4AZF A;  4DV2 M;  4JI7 M;  3EIE A;  2DWM A;  2YQZ A;  3E9S A;  4QOS A;  3HZJ A;  3HU2 A;  5JI3 E;  1DO2 A;  3GLG E;  4HLQ A;  2L09 A;  2JY7 A;  3GP1 A;  3HY5 A;  3DOA A;  1XMO M;  3EIH A;  3U5Z A;  4CGY B;  2R6F A;  4W5W A;  4M0W A;  3AKZ A;  3FKE A;  3UGJ A;  2LH0 A;  4JN6 A;  2LVA A;  3HJQ A;  2FH0 A;  1PJI A;  1YSY A;  2APL A;  2MH8 A;  3C58 A;  3VDU A;  1Q02 A;  4NL4 H;  3PXG A;  2OPF A;  3SAT A;  2CWB A;  1QAQ A;  3W0L B;  2VII A;  4RF1 A;  3U6O A;  1NY6 A;  2WSF F;  5EP4 A;  4IBI A;  5EXX A;  2R62 A;  2M60 A;  2F5Q A;  3MHV C;  4QOZ C;  1XNQ M;  1R6B X;  4ANR A;  4AG6 A;  4IBG A;  3SHG B;  3CF2 A;  5LMN M;  1HR0 M;  2OQ4 A;  4LJ4 A;  1D0L A;  3TE6 A;  4AW4 A;  4B3T M;  4MH0 E;  3FUT A;  1Z6T A;  2BJW A;  5JI2 E;  4GMQ A;  3B7Z A;  1YUB A;  3LCU A;  3J81 S;  2DXI A;  2J7N A;  4LF8 M;  1SXJ B;  3BBZ A;  2I7N A;  2V1C A;  2VDB B;  3IG8 A;  2VQF M;  4GRI A;  3Q8X A;  4MGH A;  4DR1 M;  3A98 B;  4OVZ A;  1IN7 A;  1NNU C;  2DEN A;  1LV7 A;  2LHC A;  3FTE A;  4AKH A;  3GLH E;  2K47 A;  4NRV A;  2QZ4 A;  1Z59 A;  1J09 A;  2V6Z M;  5DYI A;  1HJP A;  1GO5 A;  1XMQ M;  1IBK M;  1IN6 A;  2R0I A;  5KQ8 A;  1GL6 A;  3ZCB B;  2Z8Y M;  2DKL A;  1IXS B;  4P17 A;  2MRO B;  1QQW A;  2HL7 A;  1G3I A;  1BVS A;  4NSO B;  3W67 A;  3HGI A;  3OTO M;  2A5Y B;  4IJF A;  3GLF A;  1Y8G A;  3T15 A;  2CRU A;  3R8F A;  2ZAN A;  3R9X B;  2XH9 A;  4F1I A;  3FUX A;  2R18 A;  2XFS A;  1W5S A;  1Q3C A;  2CFO A;  4B7G A;  3GRY A;  1NY5 A;  5F3W A;  2CV2 A;  2YFQ A;  2DWN A;  2JZ1 A;  3L29 A;  4M9Z A;  3I51 A;  1N78 A;  3J80 S;  2GQF A;  2QP9 X;  4RNA A;  3ZH9 B;  3THG A;  4MGZ E;  1MX0 A;  1W5T A;  1E9S A;  3M0E A;  3E21 A;  3J7A S;  4IIW A;  3E4R A;  4HL4 A;  1TF0 B;  3C3D A;  5BPV A;  5EXT A;  3FTD A;  4DBG B;  4NOO B;  2BWB A;  3VK7 A;  4CIS A;  2C99 A;  2KZS A;  3TPZ A;  8CAT A;  4X62 M;  1WGN A;  3D8L A;  2F5P A;  4MGI E;  1GKI A;  1XXH B;  3GLI B;  2UXD M;  1SXJ E;  4FCT A;  5A2Q S;  4MGY E;  2J7O A;  2HWJ A;  4R71 A;  3GPX A;  2LVN C;  4DV4 M;  3SAR A;  4DV3 M;  2AHM A;  1G71 A;  3IEC A;  1GJS A;  1VEK A;  1QUT A;  4QNM A;  4PD2 A;  4LGM A;  4R7G A;  1D0M A;  1GLN A;  1QZE A;  3HHZ A;  4JI1 M;  3KFU G;  2HKJ A;  2LTU A;  1NNJ A;  1L2C A;  1OIP A;  3T38 A;  3L25 A;  2KRK A;  2L4F A;  3CGW A;  4JXJ A;  2RGH A;  1YE9 A;  4NXN M;  2C98 A;  1OFH A;  2CHG A;  2O5R A;  2QEN A;  3KDS E;  3TWL A;  1L1T A;  4FW9 A;  5EXS A;  2FE8 A;  4LF4 M;  4JI8 M;  3DFZ A;  4LJ8 A;  1WHC A;  4MGK E;  5ITX A;  3WHL A;  1WJ7 A;  4LZZ A;  3FRI A;  4XBO A;  4BBA A;  3QYB A;  1VEJ A;  1DGG A;  1R5L A;  2BWE A;  2FNA A;  4NXM M;  2O25 A;  2OOA A;  4LJ9 A;  3SC3 A;  2DVW B;  3KVW A;  4JYA M;  3VLF B;  4II7 A;  4JI2 M;  2XGN A;  3L28 A;  5C18 A;  1TTE A;  1VDL A;  2K0B X;  2XEP A;  4A3V B;  2BNK A;  1J7K A;  4WW0 A;  5IZ7 D;  2G3Q A;  4DR6 M;  3RGS A;  4DR3 M;  3J2P B;  3PNY A;  2LHG A;  2FS1 A;  4D82 A;  3AL0 C;  3MMP A;  3L26 A;  2EUC A;  3SAS A;  4L8R C;  4BB9 A;  1PGY A;  2WSC F;  3C3E A;  4JI6 M;  2L6O A;  3SAW A;  4P16 A;  2Z4S A;  4L16 A;  1XXH E;  3GLI E;  1EE8 A;  1JB0 F;  1QAM A;  4MM3 B;  4M9X A;  2LWX A;  3RE8 A;  1GL7 A;  3B74 A;  2WZJ A;  2DAM A;  4YHH M;  2HHH M;  2KW0 A;  2ZBK B;  3KS8 A;  1N33 M;  1VG5 A;  1N77 A;  2XLJ A;  3U6M A;  1HNX M;  4X66 M;  4LRT A;  1WR1 B;  3I4V A;  2JUJ A;  1T43 A;  3M6A A;  4B7F A;  2VF8 A;  2D7E A;  3HHY A;  2RGO A;  1R4G A;  1OFI A;  2QBY A;  3Q8G A;  2FFJ A;  5LMU M;  3K1J A;  3SYK A;  2C5R A;  2UXC M;  2D7H A;  2KNZ A;  3FUW A;  5GKN A;  2DZO B;  4IBJ A;  4FVM A;  1TGU A;  3T1H M;  4GKK M;  2EKK A;  3M7G A;  1JR3 E;  1WGL A;  4OW0 A;  4DR5 M;  3GPP A;  5DYG A;  1DV0 A;  1UFZ A;  1OQY A;  5ITU A;  1WIV A;  3QWL A;  4LFB M;  4XGI A;  3U6Q A;  3FYC A;  4LGY A;  2JY6 B;  4R3D A;  5KO3 A;  2ZM6 M;  1QDT A;  4G4R A;  3U6E A;  2KNV A;  4DR2 M;  3K9O A;  4FCW A;  3B7N A;  1V33 A;  2Y21 A;  5EP3 A;  2JNH A;  1L1Z A;  2R4J A;  3GLG A;  1PJT A;  4DV1 M;  1NO1 A;  3K9P A;  1XHB A;  4X65 M;  3U6D A;  1T3T A;  2QHO B;  3U5Z B;  4JI3 M;  3VKH A;  1IY2 A;  4KHP M;  1PM5 A;  4GEW A;  1HT2 E;  3K92 A;  2R46 A;  2DAE A;  2XFT A;  1PJJ A;  3H4M A;  5KQD A;  1QAO A;  3B89 A;  1J5E M;  2G8L A;  1L2B A;  2J5Y A;  2MJ5 B;  1AIP C;  3KP0 E;  1PJS A;  2RRU A;  3MJ5 A;  1K3X A;  1IM2 A;  2Y0Q A;  3T1Y M;  1IY0 A;  1KYI A;  3GRV A;  3BOS A;  5DFL A;  1EFU B;  1S3S A;  2JY5 A;  4X64 M;  3GQ4 A;  1I94 M;  2R45 A;  4GIT A;  4IBK A;  1OJL A;  1Q39 A;  1DGF A;  2LVP C;  4OU7 A;  3KS4 A;  1MN3 A;  4IBE A;  2I7P A;  1PJQ A;  1N75 A;  4B3R M;  2KZU A;  1GJT A;  1A5T A;  1IN4 A;  2C9C A;  2XZU A;  4AI6 A;  4QNR A;  4QHT A;  4L4U A;  3U6L A;  1QVR A;  3U61 A;  2L7I A;  4DV6 M;  4I5S A;  4QHS A;  3RGP A;  5FTJ A;  2YNM D;  2CHQ A;  1C7Y A;  4OVZ B;  3K2L A;  3JAM S;  2QCU A;  4LCB A;  3U60 A;  4B3S M;  1AUA A;  2DAG A;  4TUW A;  3KP1 E;  2WSE F;  3GLH A;  1HQC A;  3SMP A;  4PDI A;  3TWM A;  2DNA A;  3U6S A;  4NC6 A;  3LQQ A;  2OOB A;  2VQE M;  4CJ6 A;  1WXQ A;  2KHH A;  3JR4 A;  3AJI B;  1DGH A;  2LXE A;  3VFD A;  1NV8 A;  3HHW A;  2DWL A;  5FSW A;  1HNW M;  1Q3B A;  1RU3 A;  4CIZ A;  5H37 D;  4S12 A;  5ITY A;  2NQ8 C;  2L7H A;  2CHV A;  3FUV A;  4GC9 A;  3GLF B;  1KSF X;  1OTR A;  3UZU A;  3WHK A;  4JV5 M;  2G5G X;  2F5S A;  4K0K M;  2W82 A;  1ZMU A;  1ZAE A;  3KOZ E;  4Y28 F;  4F2L A;  1XB2 B;  4L15 A;  2LVQ D;  3NBI A;  5FTL A;  1MU5 A;  1E9R A;  2QNJ A;  4GIP A;  3GQ3 A;  3UMM A;  2FOI C;  2Z7J A; 
#chains in the Genus database with same CATH homology
 2DEN A;  1XXH E;  2LVO C;  3GLH E;  3GLI E;  2JP7 A;  1HJP A;  1GO5 A;  2R0I A;  2DAK A;  2DZL A;  2WZJ A;  2DAM A;  2DKL A;  2KNA A;  1YLA A;  1VG5 A;  2MRO B;  1E94 E;  1G3I A;  1BVS A;  1G41 A;  1WR1 B;  2JUJ A;  1T43 A;  4UN2 B;  2EJS A;  1Y8G A;  2HAK A;  1VQ1 A;  1R4G A;  2MR9 A;  2ZTC A;  4F1I A;  2DI0 A;  1ZMV A;  1TR8 A;  2KNZ A;  4G3O A;  1OKS A;  1G4A E;  3E46 A;  2EKK A;  2JZ1 A;  1JR3 E;  1WGL A;  2EKF A;  1DV0 A;  1UFZ A;  1OQY A;  1WIV A;  2JY6 B;  3E21 A;  2KNV A;  1DO0 A;  3K9O A;  2DHY A;  2JNH A;  2JY8 A;  3F92 A;  4Q7J A;  2ZTD A;  4DBG B;  1IXS A;  3K9P A;  2BWB A;  4HEO A;  2CP8 A;  2QHO B;  1P3Q Q;  3GLF E;  2QSF X;  1V92 A;  1F4I A;  1WGN A;  1ZV1 A;  4GEW A;  1HT2 E;  3FE3 A;  2DAE A;  4WP2 A;  2K9D A;  2HWJ A;  4R71 A;  3B89 A;  2LVN C;  1NV9 A;  3FRH A;  3IEC A;  2MJ5 B;  1AIP C;  1VEK A;  2RRU A;  1IM2 A;  1IFY A;  2L4E A;  1VEG A;  1KYI A;  5DFL A;  1EFU B;  2JY5 A;  2LBC A;  1QZE A;  2DAI A;  1HT1 E;  2L2D A;  1HQY E;  2LTU A;  2LVP C;  2L4F A;  1MN3 A;  1DO2 A;  1ZMW A;  3GLG E;  2MGW A;  1CUK A;  2JY7 A;  1A5T A;  3H4J A;  1C7Y A;  1OAI A;  1WHC A;  2LVA A;  3LCV B;  1WJ7 A;  2DAG A;  3FRI A;  1VEJ A;  2BWE A;  1Q02 A;  2DNA A;  2O25 A;  2JZ0 A;  2OOA A;  2OOB A;  2CWB A;  3T6P A;  2KHH A;  1TTE A;  1T6O A;  1VDL A;  2K0B X;  1NV8 A;  2G3Q A;  2H5X A;  2OO9 A;  1OTR A;  1SG9 A;  2B3T A;  3MMP A;  5JI2 E;  1ZMU A;  3IHP A;  3LCU A;  4F2L A;  1XB2 B;  1PGY A;  2LVQ D;  3BBZ A;  2QNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...