2DNAA

Solution structure of rsgi ruh-056, a uba domain from mouse cdna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'GSSGSSGPSHSLQAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIYKLKSSQGFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unnamed protein product
publication title Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2006-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dnaA00
3LCUA 2MROB 4GEWA 2DAMA 1G4AE 1GO5A 2DAGA 1DV0A 1VEGA 2DKLA 2RRUA 1ZMWA 1AIPC 1TR8A 2LBCA 1WGNA 1T6OA 3F92A 2LTUA 2DAKA 1VG5A 2DHYA 2KNVA 1WHCA 1VEJA 4DBGB 1OQYA 2L4EA 3GLHE 4HEOA 3GLFE 1Y8GA 2JY6B 1OTRA 1EFUB 2DAIA 1WJ7A 1XXHE 2BWEA 2JZ1A 2B3TA 3MMPA 2LVOC 2JY7A 1BVSA 1VEKA 1C7YA 1DO2A 2MR9A 1SG9A 2K0BX 1ZMVA 3K9OA 1WGLA 2HAKA 1TTEA 3K9PA 2DNAA 2ZTDA 2LVPC 2ZTCA 1PGYA 3E46A 2OOAA 1MN3A 2JNHA 1ZMUA 2EKFA 2O25A 3FRHA 3H4JA 3GLIE 1V92A 2K9DA 2DI0A 2DENA 5DFLA 1G41A 2QNJA 2WZJA 5JI2E 2JP7A 3B89A 1CUKA 4F2LA 2MJ5B 1XB2B 1HT2E 1IXSA 4UN2B 1HT1E 2CWBA 2KHHA 1R4GA 1T43A 4Q7JA 1A5TA 1VQ1A 4WP2A 3FRIA 2DAEA 1NV8A 2KNZA 1HJPA 4R71A 2L4FA 2EJSA 2JZ0A 1QZEA 3LCVB 1G3IA 1OAIA 2LVQD 1VDLA 2EKKA 1JR3E 2LVNC 4F1IA 2BWBA 1DO0A 2JY8A 2JUJA 3FE3A 2QHOB 2L2DA 3E21A 4G3OA 1E94E 2OO9A 1F4IA 3T6PA 2H5XA 2MGWA 2JY5A 3GLGE 3IECA 2KNAA 1NV9A 1OKSA 2OOBA 1WIVA 2QSFX 2CP8A 1IM2A 1UFZA 3IHPA 1YLAA 2LVAA 2HWJA 1WR1B 1KYIA 1HQYE 1ZV1A 3BBZA 2R0IA 1Q02A 1IFYA 2DZLA 1P3QQ 2G3QA
chains in the Genus database with same CATH superfamily
3LCUA 2MROB 4GEWA 1D2NA 1N75A 1K3WA 1IN6A 1PM5A 2AHMA 2DAGA 1HQCA 3GLFA 1DV0A 2D7HA 2WSFF 2DKLA 1C1KA 2VDBB 3JAMS 3J81S 2XLJA 3U6SA 4TUWA 4LY6A 4D80A 8CATA 1I94M 4S12A 1D0KA 4M0DA 2KNVA 4P17A 1WHCA 1VEJA 4NXMM 3GLHE 4JI5M 4L4UA 5C1BA 4YY3M 3SAWA 3THGA 3LW5F 3L28A 4Z6YA 1IXSB 3KW6A 4PT5A 2BWEA 4PDGA 3KSJA 3KOXE 2B3TA 3MMPA 3AV0A 3SHFA 4GKKM 2JY7A 1VEKA 3L26A 2CRUA 2MR9A 2HCBA 4D82A 3GPPA 3KP0E 1LTMA 1EIJA 1UM8A 3C9PA 4ZPXA 1XNRM 4DR6M 5KQ8A 5EXXA 3U5ZB 2W82A 2HHHM 4LJ4A 3QYBA 4QHTA 4NRWA 3DZDA 5E6JA 3HX3A 3B74A 1NY5A 2CUZA 2ZTCA 1DGFA 2Y0TA 3HJ8A 2NQ8C 3L27A 1IQPA 3I01M 1MN3A 2O5RA 4M9XA 3A45A 5FTKA 2EA0A 3FYCA 5ITQA 2ZBKB 5IT9S 1OJLA 2K9DA 3B7ZA 4IBBA 3FYDA 4BBAA 4JI8M 1W5TA 2KRKA 1N32M 2WZJA 3TWMA 4DV4M 4M9ZA 1IN7A 1E9RA 1DGHA 1H6UA 2A5YB 3J27B 4R3DA 3HHYA 3RFWA 4R7GA 2ZM6M 4LJ5A 4UN2B 5BPVA 2CWBA 2KHHA 1NNJA 4MM3B 1I4WA 1V33A 1R4GA 1Z6TA 3TPZA 2QQ8A 2C5RA 1NV8A 4IBJA 2UXDM 1KSFX 4DR3M 1HNXM 2ZANA 4P16A 2JZ0A 4FVMA 4X62M 3LCVB 4B3SM 3UGJA 4GHAA 4OVZA 2GNOA 4LJ8A 1VDLA 2EKKA 2RKOA 1KFVA 2Z4SA 4F1IA 2BWBA 4LF9M 5DYGA 4MH0E 4G4QA 3HJSA 3DOAA 3I04M 3E21A 3QAUA 1N34M 2OO9A 1IBLM 4JI2M 1F4IA 4LG2A 2GQFA 1SXJD 3MK6A 5EXPA 3GP1A 2CE7A 1K82A 3J7AS 5EP2A 1NV9A 1SXJB 1QUTA 2XGNA 2K47A 3U6EA 4LRSA 2CV0A 2OQ4A 1L2BA 2OOBA 2X8AA 3E9SA 3FKEA 4B7FA 4GC9A 1IM2A 1Q3BA 2KDLA 1YLAA 1IN8A 1XMOM 3SMPA 5FTJA 2HWJA 4I8OA 4Z8XA 1NHWC 5FTNA 4BB9A 3BBZA 1Q02A 3LQRA 4DV5M 3KS8A 2DZLA 3PFIA 1PJQA 3GLIB 1IFYA 1QAOA 2QP9X 3Q8GA 2LNHC 1NNUC 2G3QA 3DFZA 3UMMA 3GPYA 2N35A 2DAMA 1TGUA 1G4AE 3GLHA 3R8FA 3GLGB 1HNWM 4LGMA 1TF0B 1J09A 4XGIA 1ZMWA 1AIPC 1HR0M 3UJNA 2LBCA 1WGNA 1T6OA 2R6FA 3F92A 2DAKA 4LZZA 1PJJA 2E5LM 3HGIA 4MGKE 2JWSA 2FOIC 4LJ6A 4DBGB 3GPXA 3HHZA 1J7KA 1ZAEA 1PJIA 1K3XA 3PXGA 1OIPA 2Z7JA 3AJIB 3I4YA 1QDTA 2Q2EB 1GLNA 4D81A 2JY6B 3NBXX 1JR3D 3GRRA 1EFUB 3LMMA 2F5OA 3JR4A 2DZNB 3ZQJA 1L1TA 3HHXA 1OIZA 4KODA 2F5PA 3SAVA 1TH2A 1GL7A 2XSZA 3GRYA 3IG8A 1C7YA 3FUUA 1SG9A 4G6ZA 4JI3M 2HKJA 1Z5CA 4KLNA 2KEBA 4GC5A 3W68A 2R4JA 3EIEA 3SATA 2YNMD 4PDIA 1ZMVA 4IJFA 1GJTA 3SHGB 3R9XB 1W5SA 5KPTA 2BJVA 2XFTA 3KOZE 3U61B 3CGWA 3M6AA 3U6MA 1Q39A 2ZTDA 1IXZA 4X65M 4DV7M 2Y21A 3LVWA 1XMQM 4XBOA 2Z8YM 3RGSA 3E46A 3KOYE 4KO8A 4BLCA 1ORYB 3B7QA 3FTCA 3SMSA 5ITTA 3FRHA 3VLFB 3H4JA 2L7IA 3I51A 3U6OA 3FTFA 2MH8A 5H37D 4DR7M 4FWHA 5DFLA 2L6OA 2QNJA 5EXSA 4G4RA 3TWKA 5JI2E 1MX0A 1QDRA 4B3MM 1CUKA 1XC8A 4IBEA 1HT1E 2ZAMA 3BOSA 2QENA 2KXEA 4IBGA 1WXQA 1T43A 2YQZA 3B7NA 4Q7JA 1VQ1A 4WP2A 4MGZE 4DR5M 4QOZC 2DAEA 2KNZA 4CGYB 2RGHA 3KP1E 1N33M 3GLFB 3PNYA 4FCTA 4R71A 5EJCA 3U6PA 2O01F 2EJSA 3MJ5A 4GIPA 2FNAA 3ILKA 4FWGA 1N36M 1FNNA 4IJEA 2LVQD 4RNAA 4LGYA 1TDHA 3TQSA 1JB0F 3CTWB 4ANRA 1DO0A 3U60A 4LF4M 4OX9M 2JY8A 1R2YA 2QHOB 4W5WA 2J7OA 4G3OA 1E94E 2CFOA 2V6ZM 2H5XA 5ITXE 1JQJC 4Y28F 2G8LA 4KT0F 4DV0M 5FLXS 1SXJC 3E4RA 2H1RA 1XXHA 2YR0A 3KOWE 4LJAA 1NHGC 2VIIA 1YE9A 3HZJA 1IN5A 1QAQA 2RGOA 3SYLA 4LF6M 4B3RM 1OKSA 4I5SA 4JI7M 4LJ7A 1GKIA 2CP8A 3KS4A 4LJ9A 5FTMA 1UFZA 3B9PA 3IHPA 4L6V6 2XEPA 3GRVA 2LH0A 1XHBA 3HWSA 1HQYE 3SYKA 2CV2A 4WW0A 3MHVC 1ZV1A 2QBYA 2R0IA 1T3TA 3AOEC 1TDZA 3SARA 1V34A 2LHCA 2HL7A 1P3QQ 2Z3XA 2I7PA 3QYEA 1TH3A 1VDDA 1OFIA 3A98B 1Z5BA 3TWLA 1VEGA 3T15A 2RRUA 3SC3A 1OAOC 4GHLA 1TR8A 2VF8A 2FH0A 2LTUA 3AKZA 1YSYA 3VDUA 2DHYA 4X66M 2KZUA 4IIWA 2DZOB 2C99A 2X49A 4AW4A 4CISA 1OQYA 1D0MA 2FFJA 2L4EA 3J2PB 5IWAM 1IBMM 2R46A 1HNZM 2L7HA 1DGGA 1PJTA 3AL0C 1DGHB 3HJQA 1PRBA 1OTRA 2UUCM 3NWLA 1R6BX 3J7BA 3LQQA 4IBIA 4RKUF 4NXNM 1XXHE 3UZUA 3ZH9B 4AG6A 5EP3A 4AKIA 2LWXA 1E9SA 2ZAOA 1BVSA 3D8LA 1DO2A 2WSEF 1IY0A 3H4MA 2KRUA 4AG5A 2D7GA 5DNYA 2J7NA 2CV1A 2UXBM 4OVZB 4AKHA 1SXJE 3U6CA 2DWLA 3ZCBB 3VKHA 3CF2A 1IXRC 1ZQ9A 4GMQA 4CHTB 3WHKA 3C3DA 2I7NA 3K9PA 1NO1A 2DNAA 5EXTA 2C96A 3GO8A 3PVSA 3VKGA 1QVRA 5GKNA 2KW0A 4B08A 1PGYA 3GRUA 4LCBA 4K0KM 2OOAA 2FS1A 2XFSA 3C3EA 5ITRA 3VK7A 4OW0A 1ZMUA 2UUBM 2EKFA 2XF3A 2CHVA 3SBJA 2O25A 1MU5A 2M60A 5ITYA 3GLIE 1V92A 2DI0A 2DENA 5KPZA 1DGBA 4QNRA 5EP4A 4AI6A 4GH9A 4JI0M 5EQTA 2EUCA 2QCUA 2VF7A 3UK6A 1Z5AA 3AFHA 1L1ZA 2JP7A 4LFBM 4FCVA 2F4VM 3FTEA 3HU3A 2F5NA 3TE6A 3K2LA 2EO2A 1XB2B 1HT2E 1IXSA 3JR5A 2V1CA 1S3SA 3HKPA 4QHSA 4MB7A 4CJ6A 3M7GA 1A5TA 3FRIA 3GLHB 4REZA 1HJPA 4EIWA 2LXEA 5ITXA 2L09A 2L4FA 1QZEA 4HLQA 4NSRA 1G8PA 1N78A 3D8BA 5KQDA 2LHGA 4II7A 1JR3E 2DWZB 2LVNC 4I81A 3T1HM 3U5ZA 3U6DA 3C58A 2JUJA 3FE3A 1NY6A 2CEAA 3RE8A 3SASA 2L2DA 4GITA 3A42A 4A3VB 2KA6B 4FW9A 5FTLA 4LFAM 1Z59A 1D0LA 2JY5A 3FUXA 4JN6A 3T38A 4RF1A 4FCWA 3IECA 2KNAA 3HU2A 4AZFA 1IY2A 3A46A 1QUSA 2XSZD 2XZUA 1J5EM 3CF6E 3HY5A 2R62A 3EIHA 3IG5A 4M0WA 4NOOB 2DWMA 3CF0A 4MGIE 2LVAA 5DYIA 5L8RF 1WR1B 1NSFA 2DXIA 4B7HA 2QZ4A 3NBIA 5IREB 3GQ4A 2JXNA 3KVWA 1IN4A 4LF5M 4DUYM 4LRTA 3VFDA 4LZJA 2G5GX 3K1JA 4JYAM 1QQWA 3FUVA 4ITQA 1GO5A 2R65A 4GRIA 1L2DA 1LV7A 4LF8M 3L2AA 2M5ZA 3FUWA 1QYRA 4PD2A 1VG5A 1NJGA 2C9CA 4QNMA 3VDPA 4DR2M 4QOSA 5C18A 1IBKM 2UXCM 4RF0A 4HL4A 1GJSA 2K6BA 2KZSA 3GPUA 3GQ5A 3BXWA 3KSXA 2F5QA 1G59A 4HEOA 3GLFE 1RU3A 1Y8GA 4IBFA 4NRVA 4PCZA 1PJSA 4IBKA 1WJ7A 1SXJA 2DAIA 2JZ1A 2UU9M 4LFCM 2OPFA 3K8ZA 2CHQA 7CATA 1L2CA 4M9SA 2LVOC 3FUTA 3U6LA 4CIZA 4DR4M 2X4AA 2R45A 2K0BX 2FE8A 2YFQA 3U6QA 3QWLA 3LVVA 4XK8F 2Y20A 1L8QA 3K9OA 3SFZA 4MGYE 2JA2A 4JXJA 1WGLA 2HAKA 4I4LA 3AOEA 2R44A 3U60B 1TTEA 2WSCF 3GLIA 4WURA 1AUAA 3V76A 2LVPC 3GLGA 4JI6M 3VK8A 5LMNM 4NSOB 2D7EA 4OU7A 5F3WA 3L29A 4G4NA 4DV1M 1XXHB 2F5SA 2JNHA 2XZFA 1XNQM 2VQFM 5FSWA 3HU1A 1QZMA 2J5YA 2P5TA 4DV6M 3FTDA 3K92A 4L15A 4AQYM 4IBDA 1G41A 5JI3E 2V1UA 5EP1A 4DR1M 3B89A 4DV2M 5LMUM 1R2ZA 1G71A 2QBYB 1GL6A 4B7GA 4F2LA 2MJ5B 3TL4X 4L78A 4NL4H 2APLA 3W67A 4L16A 1JR3A 4JI4M 1IY1A 5IZ7D 3RGPA 5BR8M 2BJWA 4NC6A 4MGHA 4JI1M 1EE8A 2C9OA 3DA1A 3Q8XA 3ZC7B 2XH9A 4FWDA 3PNVA 3L25A 4AKGA 4L8RC 3I4VA 1TH4A 1G3IA 1OAIA 1QANA 1XWIA 2R18A 5KPRA 5KO3A 3OTOM 3W0LB 2VQEM 4KHPM 1R7RA 4LF7M 2QPAA 2Y0QA 3U61A 1FJGM 1Q3CA 4JV5M 1MJGM 2DVWB 2ERCA 3J80S 3T1YM 3T6PA 5ITUA 1N77A 2MGWA 3WHLA 3KXEC 3GLGE 1E32A 4FD2A 4X64M 2DWNA 2UUAM 4G4OA 4B3TM 2C98A 4YHHM 2Z4RA 3GQ3A 3W0FA 1QAMA 1WIVA 1GVNA 2BNKA 2QSFX 4IBCA 1GABA 1OFHA 3SAUA 1NJFA 3AOGA 2CHGA 2R4EA 5A2QS 1R5LA 5E26A 4DUZM 1X37A 1KYIA 2DHRA 3M0EA 1NVMA 3HHWA 3KDSE 4GKJM 4DV3M 3KFUG 1YUBA 3FD9A
chains in the Genus database with same CATH topology
3LCUA 2MROB 4GEWA 2DAMA 1G4AE 1GO5A 2DAGA 1DV0A 1VEGA 2DKLA 2RRUA 1ZMWA 1AIPC 1TR8A 2LBCA 1WGNA 1T6OA 3F92A 2LTUA 2DAKA 1VG5A 2DHYA 2KNVA 1WHCA 1VEJA 4DBGB 1OQYA 2L4EA 3GLHE 4HEOA 3GLFE 1Y8GA 2JY6B 1OTRA 1EFUB 2DAIA 1WJ7A 1XXHE 2BWEA 2JZ1A 2B3TA 3MMPA 2LVOC 2JY7A 1BVSA 1VEKA 1C7YA 1DO2A 2MR9A 1SG9A 2K0BX 1ZMVA 3K9OA 1WGLA 2HAKA 1TTEA 3K9PA 2DNAA 2ZTDA 2LVPC 2ZTCA 1PGYA 3E46A 2OOAA 1MN3A 2JNHA 1ZMUA 2EKFA 2O25A 3FRHA 3H4JA 3GLIE 1V92A 2K9DA 2DI0A 2DENA 5DFLA 1G41A 2QNJA 2WZJA 5JI2E 2JP7A 3B89A 1CUKA 4F2LA 2MJ5B 1XB2B 1HT2E 1IXSA 4UN2B 1HT1E 2CWBA 2KHHA 1R4GA 1T43A 4Q7JA 1A5TA 1VQ1A 4WP2A 3FRIA 2DAEA 1NV8A 2KNZA 1HJPA 4R71A 2L4FA 2EJSA 2JZ0A 1QZEA 3LCVB 1G3IA 1OAIA 2LVQD 1VDLA 2EKKA 1JR3E 2LVNC 4F1IA 2BWBA 1DO0A 2JY8A 2JUJA 3FE3A 2QHOB 2L2DA 3E21A 4G3OA 1E94E 2OO9A 1F4IA 3T6PA 2H5XA 2MGWA 2JY5A 3GLGE 3IECA 2KNAA 1NV9A 1OKSA 2OOBA 1WIVA 2QSFX 2CP8A 1IM2A 1UFZA 3IHPA 1YLAA 2LVAA 2HWJA 1WR1B 1KYIA 1HQYE 1ZV1A 3BBZA 2R0IA 1Q02A 1IFYA 2DZLA 1P3QQ 2G3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCU A;  2MRO B;  4GEW A;  2DAM A;  1G4A E;  1GO5 A;  2DAG A;  1DV0 A;  1VEG A;  2DKL A;  2RRU A;  1ZMW A;  1AIP C;  1TR8 A;  2LBC A;  1WGN A;  1T6O A;  3F92 A;  2LTU A;  2DAK A;  1VG5 A;  2DHY A;  2KNV A;  1WHC A;  1VEJ A;  4DBG B;  1OQY A;  2L4E A;  3GLH E;  4HEO A;  3GLF E;  1Y8G A;  2JY6 B;  1OTR A;  1EFU B;  2DAI A;  1WJ7 A;  1XXH E;  2BWE A;  2JZ1 A;  2B3T A;  3MMP A;  2LVO C;  2JY7 A;  1BVS A;  1VEK A;  1C7Y A;  1DO2 A;  2MR9 A;  1SG9 A;  2K0B X;  1ZMV A;  3K9O A;  1WGL A;  2HAK A;  1TTE A;  3K9P A;  2DNA A;  2ZTD A;  2LVP C;  2ZTC A;  1PGY A;  3E46 A;  2OOA A;  1MN3 A;  2JNH A;  1ZMU A;  2EKF A;  2O25 A;  3FRH A;  3H4J A;  3GLI E;  1V92 A;  2K9D A;  2DI0 A;  2DEN A;  5DFL A;  1G41 A;  2QNJ A;  2WZJ A;  5JI2 E;  2JP7 A;  3B89 A;  1CUK A;  4F2L A;  2MJ5 B;  1XB2 B;  1HT2 E;  1IXS A;  4UN2 B;  1HT1 E;  2CWB A;  2KHH A;  1R4G A;  1T43 A;  4Q7J A;  1A5T A;  1VQ1 A;  4WP2 A;  3FRI A;  2DAE A;  1NV8 A;  2KNZ A;  1HJP A;  4R71 A;  2L4F A;  2EJS A;  2JZ0 A;  1QZE A;  3LCV B;  1G3I A;  1OAI A;  2LVQ D;  1VDL A;  2EKK A;  1JR3 E;  2LVN C;  4F1I A;  2BWB A;  1DO0 A;  2JY8 A;  2JUJ A;  3FE3 A;  2QHO B;  2L2D A;  3E21 A;  4G3O A;  1E94 E;  2OO9 A;  1F4I A;  3T6P A;  2H5X A;  2MGW A;  2JY5 A;  3GLG E;  3IEC A;  2KNA A;  1NV9 A;  1OKS A;  2OOB A;  1WIV A;  2QSF X;  2CP8 A;  1IM2 A;  1UFZ A;  3IHP A;  1YLA A;  2LVA A;  2HWJ A;  1WR1 B;  1KYI A;  1HQY E;  1ZV1 A;  3BBZ A;  2R0I A;  1Q02 A;  1IFY A;  2DZL A;  1P3Q Q;  2G3Q A; 
#chains in the Genus database with same CATH topology
 3LCU A;  2MRO B;  4GEW A;  1D2N A;  1N75 A;  1K3W A;  1IN6 A;  1PM5 A;  2AHM A;  2DAG A;  1HQC A;  3GLF A;  1DV0 A;  2D7H A;  2WSF F;  2DKL A;  1C1K A;  2VDB B;  3JAM S;  3J81 S;  2XLJ A;  3U6S A;  4TUW A;  4LY6 A;  4D80 A;  8CAT A;  1I94 M;  4S12 A;  1D0K A;  4M0D A;  2KNV A;  4P17 A;  1WHC A;  1VEJ A;  4NXM M;  3GLH E;  4JI5 M;  4L4U A;  5C1B A;  4YY3 M;  3SAW A;  3THG A;  3LW5 F;  3L28 A;  4Z6Y A;  1IXS B;  3KW6 A;  4PT5 A;  2BWE A;  4PDG A;  3KSJ A;  3KOX E;  2B3T A;  3MMP A;  3AV0 A;  3SHF A;  4GKK M;  2JY7 A;  1VEK A;  3L26 A;  2CRU A;  2MR9 A;  2HCB A;  4D82 A;  3GPP A;  3KP0 E;  1LTM A;  1EIJ A;  1UM8 A;  3C9P A;  4ZPX A;  1XNR M;  4DR6 M;  5KQ8 A;  5EXX A;  3U5Z B;  2W82 A;  2HHH M;  4LJ4 A;  3QYB A;  4QHT A;  4NRW A;  3DZD A;  5E6J A;  3HX3 A;  3B74 A;  1NY5 A;  2CUZ A;  2ZTC A;  1DGF A;  2Y0T A;  3HJ8 A;  2NQ8 C;  3L27 A;  1IQP A;  3I01 M;  1MN3 A;  2O5R A;  4M9X A;  3A45 A;  5FTK A;  2EA0 A;  3FYC A;  5ITQ A;  2ZBK B;  5IT9 S;  1OJL A;  2K9D A;  3B7Z A;  4IBB A;  3FYD A;  4BBA A;  4JI8 M;  1W5T A;  2KRK A;  1N32 M;  2WZJ A;  3TWM A;  4DV4 M;  4M9Z A;  1IN7 A;  1E9R A;  1DGH A;  1H6U A;  2A5Y B;  3J27 B;  4R3D A;  3HHY A;  3RFW A;  4R7G A;  2ZM6 M;  4LJ5 A;  4UN2 B;  5BPV A;  2CWB A;  2KHH A;  1NNJ A;  4MM3 B;  1I4W A;  1V33 A;  1R4G A;  1Z6T A;  3TPZ A;  2QQ8 A;  2C5R A;  1NV8 A;  4IBJ A;  2UXD M;  1KSF X;  4DR3 M;  1HNX M;  2ZAN A;  4P16 A;  2JZ0 A;  4FVM A;  4X62 M;  3LCV B;  4B3S M;  3UGJ A;  4GHA A;  4OVZ A;  2GNO A;  4LJ8 A;  1VDL A;  2EKK A;  2RKO A;  1KFV A;  2Z4S A;  4F1I A;  2BWB A;  4LF9 M;  5DYG A;  4MH0 E;  4G4Q A;  3HJS A;  3DOA A;  3I04 M;  3E21 A;  3QAU A;  1N34 M;  2OO9 A;  1IBL M;  4JI2 M;  1F4I A;  4LG2 A;  2GQF A;  1SXJ D;  3MK6 A;  5EXP A;  3GP1 A;  2CE7 A;  1K82 A;  3J7A S;  5EP2 A;  1NV9 A;  1SXJ B;  1QUT A;  2XGN A;  2K47 A;  3U6E A;  4LRS A;  2CV0 A;  2OQ4 A;  1L2B A;  2OOB A;  2X8A A;  3E9S A;  3FKE A;  4B7F A;  4GC9 A;  1IM2 A;  1Q3B A;  2KDL A;  1YLA A;  1IN8 A;  1XMO M;  3SMP A;  5FTJ A;  2HWJ A;  4I8O A;  4Z8X A;  1NHW C;  5FTN A;  4BB9 A;  3BBZ A;  1Q02 A;  3LQR A;  4DV5 M;  3KS8 A;  2DZL A;  3PFI A;  1PJQ A;  3GLI B;  1IFY A;  1QAO A;  2QP9 X;  3Q8G A;  2LNH C;  1NNU C;  2G3Q A;  3DFZ A;  3UMM A;  3GPY A;  2N35 A;  2DAM A;  1TGU A;  1G4A E;  3GLH A;  3R8F A;  3GLG B;  1HNW M;  4LGM A;  1TF0 B;  1J09 A;  4XGI A;  1ZMW A;  1AIP C;  1HR0 M;  3UJN A;  2LBC A;  1WGN A;  1T6O A;  2R6F A;  3F92 A;  2DAK A;  4LZZ A;  1PJJ A;  2E5L M;  3HGI A;  4MGK E;  2JWS A;  2FOI C;  4LJ6 A;  4DBG B;  3GPX A;  3HHZ A;  1J7K A;  1ZAE A;  1PJI A;  1K3X A;  3PXG A;  1OIP A;  2Z7J A;  3AJI B;  3I4Y A;  1QDT A;  2Q2E B;  1GLN A;  4D81 A;  2JY6 B;  3NBX X;  1JR3 D;  3GRR A;  1EFU B;  3LMM A;  2F5O A;  3JR4 A;  2DZN B;  3ZQJ A;  1L1T A;  3HHX A;  1OIZ A;  4KOD A;  2F5P A;  3SAV A;  1TH2 A;  1GL7 A;  2XSZ A;  3GRY A;  3IG8 A;  1C7Y A;  3FUU A;  1SG9 A;  4G6Z A;  4JI3 M;  2HKJ A;  1Z5C A;  4KLN A;  2KEB A;  4GC5 A;  3W68 A;  2R4J A;  3EIE A;  3SAT A;  2YNM D;  4PDI A;  1ZMV A;  4IJF A;  1GJT A;  3SHG B;  3R9X B;  1W5S A;  5KPT A;  2BJV A;  2XFT A;  3KOZ E;  3U61 B;  3CGW A;  3M6A A;  3U6M A;  1Q39 A;  2ZTD A;  1IXZ A;  4X65 M;  4DV7 M;  2Y21 A;  3LVW A;  1XMQ M;  4XBO A;  2Z8Y M;  3RGS A;  3E46 A;  3KOY E;  4KO8 A;  4BLC A;  1ORY B;  3B7Q A;  3FTC A;  3SMS A;  5ITT A;  3FRH A;  3VLF B;  3H4J A;  2L7I A;  3I51 A;  3U6O A;  3FTF A;  2MH8 A;  5H37 D;  4DR7 M;  4FWH A;  5DFL A;  2L6O A;  2QNJ A;  5EXS A;  4G4R A;  3TWK A;  5JI2 E;  1MX0 A;  1QDR A;  4B3M M;  1CUK A;  1XC8 A;  4IBE A;  1HT1 E;  2ZAM A;  3BOS A;  2QEN A;  2KXE A;  4IBG A;  1WXQ A;  1T43 A;  2YQZ A;  3B7N A;  4Q7J A;  1VQ1 A;  4WP2 A;  4MGZ E;  4DR5 M;  4QOZ C;  2DAE A;  2KNZ A;  4CGY B;  2RGH A;  3KP1 E;  1N33 M;  3GLF B;  3PNY A;  4FCT A;  4R71 A;  5EJC A;  3U6P A;  2O01 F;  2EJS A;  3MJ5 A;  4GIP A;  2FNA A;  3ILK A;  4FWG A;  1N36 M;  1FNN A;  4IJE A;  2LVQ D;  4RNA A;  4LGY A;  1TDH A;  3TQS A;  1JB0 F;  3CTW B;  4ANR A;  1DO0 A;  3U60 A;  4LF4 M;  4OX9 M;  2JY8 A;  1R2Y A;  2QHO B;  4W5W A;  2J7O A;  4G3O A;  1E94 E;  2CFO A;  2V6Z M;  2H5X A;  5ITX E;  1JQJ C;  4Y28 F;  2G8L A;  4KT0 F;  4DV0 M;  5FLX S;  1SXJ C;  3E4R A;  2H1R A;  1XXH A;  2YR0 A;  3KOW E;  4LJA A;  1NHG C;  2VII A;  1YE9 A;  3HZJ A;  1IN5 A;  1QAQ A;  2RGO A;  3SYL A;  4LF6 M;  4B3R M;  1OKS A;  4I5S A;  4JI7 M;  4LJ7 A;  1GKI A;  2CP8 A;  3KS4 A;  4LJ9 A;  5FTM A;  1UFZ A;  3B9P A;  3IHP A;  4L6V 6;  2XEP A;  3GRV A;  2LH0 A;  1XHB A;  3HWS A;  1HQY E;  3SYK A;  2CV2 A;  4WW0 A;  3MHV C;  1ZV1 A;  2QBY A;  2R0I A;  1T3T A;  3AOE C;  1TDZ A;  3SAR A;  1V34 A;  2LHC A;  2HL7 A;  1P3Q Q;  2Z3X A;  2I7P A;  3QYE A;  1TH3 A;  1VDD A;  1OFI A;  3A98 B;  1Z5B A;  3TWL A;  1VEG A;  3T15 A;  2RRU A;  3SC3 A;  1OAO C;  4GHL A;  1TR8 A;  2VF8 A;  2FH0 A;  2LTU A;  3AKZ A;  1YSY A;  3VDU A;  2DHY A;  4X66 M;  2KZU A;  4IIW A;  2DZO B;  2C99 A;  2X49 A;  4AW4 A;  4CIS A;  1OQY A;  1D0M A;  2FFJ A;  2L4E A;  3J2P B;  5IWA M;  1IBM M;  2R46 A;  1HNZ M;  2L7H A;  1DGG A;  1PJT A;  3AL0 C;  1DGH B;  3HJQ A;  1PRB A;  1OTR A;  2UUC M;  3NWL A;  1R6B X;  3J7B A;  3LQQ A;  4IBI A;  4RKU F;  4NXN M;  1XXH E;  3UZU A;  3ZH9 B;  4AG6 A;  5EP3 A;  4AKI A;  2LWX A;  1E9S A;  2ZAO A;  1BVS A;  3D8L A;  1DO2 A;  2WSE F;  1IY0 A;  3H4M A;  2KRU A;  4AG5 A;  2D7G A;  5DNY A;  2J7N A;  2CV1 A;  2UXB M;  4OVZ B;  4AKH A;  1SXJ E;  3U6C A;  2DWL A;  3ZCB B;  3VKH A;  3CF2 A;  1IXR C;  1ZQ9 A;  4GMQ A;  4CHT B;  3WHK A;  3C3D A;  2I7N A;  3K9P A;  1NO1 A;  2DNA A;  5EXT A;  2C96 A;  3GO8 A;  3PVS A;  3VKG A;  1QVR A;  5GKN A;  2KW0 A;  4B08 A;  1PGY A;  3GRU A;  4LCB A;  4K0K M;  2OOA A;  2FS1 A;  2XFS A;  3C3E A;  5ITR A;  3VK7 A;  4OW0 A;  1ZMU A;  2UUB M;  2EKF A;  2XF3 A;  2CHV A;  3SBJ A;  2O25 A;  1MU5 A;  2M60 A;  5ITY A;  3GLI E;  1V92 A;  2DI0 A;  2DEN A;  5KPZ A;  1DGB A;  4QNR A;  5EP4 A;  4AI6 A;  4GH9 A;  4JI0 M;  5EQT A;  2EUC A;  2QCU A;  2VF7 A;  3UK6 A;  1Z5A A;  3AFH A;  1L1Z A;  2JP7 A;  4LFB M;  4FCV A;  2F4V M;  3FTE A;  3HU3 A;  2F5N A;  3TE6 A;  3K2L A;  2EO2 A;  1XB2 B;  1HT2 E;  1IXS A;  3JR5 A;  2V1C A;  1S3S A;  3HKP A;  4QHS A;  4MB7 A;  4CJ6 A;  3M7G A;  1A5T A;  3FRI A;  3GLH B;  4REZ A;  1HJP A;  4EIW A;  2LXE A;  5ITX A;  2L09 A;  2L4F A;  1QZE A;  4HLQ A;  4NSR A;  1G8P A;  1N78 A;  3D8B A;  5KQD A;  2LHG A;  4II7 A;  1JR3 E;  2DWZ B;  2LVN C;  4I81 A;  3T1H M;  3U5Z A;  3U6D A;  3C58 A;  2JUJ A;  3FE3 A;  1NY6 A;  2CEA A;  3RE8 A;  3SAS A;  2L2D A;  4GIT A;  3A42 A;  4A3V B;  2KA6 B;  4FW9 A;  5FTL A;  4LFA M;  1Z59 A;  1D0L A;  2JY5 A;  3FUX A;  4JN6 A;  3T38 A;  4RF1 A;  4FCW A;  3IEC A;  2KNA A;  3HU2 A;  4AZF A;  1IY2 A;  3A46 A;  1QUS A;  2XSZ D;  2XZU A;  1J5E M;  3CF6 E;  3HY5 A;  2R62 A;  3EIH A;  3IG5 A;  4M0W A;  4NOO B;  2DWM A;  3CF0 A;  4MGI E;  2LVA A;  5DYI A;  5L8R F;  1WR1 B;  1NSF A;  2DXI A;  4B7H A;  2QZ4 A;  3NBI A;  5IRE B;  3GQ4 A;  2JXN A;  3KVW A;  1IN4 A;  4LF5 M;  4DUY M;  4LRT A;  3VFD A;  4LZJ A;  2G5G X;  3K1J A;  4JYA M;  1QQW A;  3FUV A;  4ITQ A;  1GO5 A;  2R65 A;  4GRI A;  1L2D A;  1LV7 A;  4LF8 M;  3L2A A;  2M5Z A;  3FUW A;  1QYR A;  4PD2 A;  1VG5 A;  1NJG A;  2C9C A;  4QNM A;  3VDP A;  4DR2 M;  4QOS A;  5C18 A;  1IBK M;  2UXC M;  4RF0 A;  4HL4 A;  1GJS A;  2K6B A;  2KZS A;  3GPU A;  3GQ5 A;  3BXW A;  3KSX A;  2F5Q A;  1G59 A;  4HEO A;  3GLF E;  1RU3 A;  1Y8G A;  4IBF A;  4NRV A;  4PCZ A;  1PJS A;  4IBK A;  1WJ7 A;  1SXJ A;  2DAI A;  2JZ1 A;  2UU9 M;  4LFC M;  2OPF A;  3K8Z A;  2CHQ A;  7CAT A;  1L2C A;  4M9S A;  2LVO C;  3FUT A;  3U6L A;  4CIZ A;  4DR4 M;  2X4A A;  2R45 A;  2K0B X;  2FE8 A;  2YFQ A;  3U6Q A;  3QWL A;  3LVV A;  4XK8 F;  2Y20 A;  1L8Q A;  3K9O A;  3SFZ A;  4MGY E;  2JA2 A;  4JXJ A;  1WGL A;  2HAK A;  4I4L A;  3AOE A;  2R44 A;  3U60 B;  1TTE A;  2WSC F;  3GLI A;  4WUR A;  1AUA A;  3V76 A;  2LVP C;  3GLG A;  4JI6 M;  3VK8 A;  5LMN M;  4NSO B;  2D7E A;  4OU7 A;  5F3W A;  3L29 A;  4G4N A;  4DV1 M;  1XXH B;  2F5S A;  2JNH A;  2XZF A;  1XNQ M;  2VQF M;  5FSW A;  3HU1 A;  1QZM A;  2J5Y A;  2P5T A;  4DV6 M;  3FTD A;  3K92 A;  4L15 A;  4AQY M;  4IBD A;  1G41 A;  5JI3 E;  2V1U A;  5EP1 A;  4DR1 M;  3B89 A;  4DV2 M;  5LMU M;  1R2Z A;  1G71 A;  2QBY B;  1GL6 A;  4B7G A;  4F2L A;  2MJ5 B;  3TL4 X;  4L78 A;  4NL4 H;  2APL A;  3W67 A;  4L16 A;  1JR3 A;  4JI4 M;  1IY1 A;  5IZ7 D;  3RGP A;  5BR8 M;  2BJW A;  4NC6 A;  4MGH A;  4JI1 M;  1EE8 A;  2C9O A;  3DA1 A;  3Q8X A;  3ZC7 B;  2XH9 A;  4FWD A;  3PNV A;  3L25 A;  4AKG A;  4L8R C;  3I4V A;  1TH4 A;  1G3I A;  1OAI A;  1QAN A;  1XWI A;  2R18 A;  5KPR A;  5KO3 A;  3OTO M;  3W0L B;  2VQE M;  4KHP M;  1R7R A;  4LF7 M;  2QPA A;  2Y0Q A;  3U61 A;  1FJG M;  1Q3C A;  4JV5 M;  1MJG M;  2DVW B;  2ERC A;  3J80 S;  3T1Y M;  3T6P A;  5ITU A;  1N77 A;  2MGW A;  3WHL A;  3KXE C;  3GLG E;  1E32 A;  4FD2 A;  4X64 M;  2DWN A;  2UUA M;  4G4O A;  4B3T M;  2C98 A;  4YHH M;  2Z4R A;  3GQ3 A;  3W0F A;  1QAM A;  1WIV A;  1GVN A;  2BNK A;  2QSF X;  4IBC A;  1GAB A;  1OFH A;  3SAU A;  1NJF A;  3AOG A;  2CHG A;  2R4E A;  5A2Q S;  1R5L A;  5E26 A;  4DUZ M;  1X37 A;  1KYI A;  2DHR A;  3M0E A;  1NVM A;  3HHW A;  3KDS E;  4GKJ M;  4DV3 M;  3KFU G;  1YUB A;  3FD9 A; 
#chains in the Genus database with same CATH homology
 3LCU A;  2MRO B;  4GEW A;  2DAM A;  1G4A E;  1GO5 A;  2DAG A;  1DV0 A;  1VEG A;  2DKL A;  2RRU A;  1ZMW A;  1AIP C;  1TR8 A;  2LBC A;  1WGN A;  1T6O A;  3F92 A;  2LTU A;  2DAK A;  1VG5 A;  2DHY A;  2KNV A;  1WHC A;  1VEJ A;  4DBG B;  1OQY A;  2L4E A;  3GLH E;  4HEO A;  3GLF E;  1Y8G A;  2JY6 B;  1OTR A;  1EFU B;  2DAI A;  1WJ7 A;  1XXH E;  2BWE A;  2JZ1 A;  2B3T A;  3MMP A;  2LVO C;  2JY7 A;  1BVS A;  1VEK A;  1C7Y A;  1DO2 A;  2MR9 A;  1SG9 A;  2K0B X;  1ZMV A;  3K9O A;  1WGL A;  2HAK A;  1TTE A;  3K9P A;  2DNA A;  2ZTD A;  2LVP C;  2ZTC A;  1PGY A;  3E46 A;  2OOA A;  1MN3 A;  2JNH A;  1ZMU A;  2EKF A;  2O25 A;  3FRH A;  3H4J A;  3GLI E;  1V92 A;  2K9D A;  2DI0 A;  2DEN A;  5DFL A;  1G41 A;  2QNJ A;  2WZJ A;  5JI2 E;  2JP7 A;  3B89 A;  1CUK A;  4F2L A;  2MJ5 B;  1XB2 B;  1HT2 E;  1IXS A;  4UN2 B;  1HT1 E;  2CWB A;  2KHH A;  1R4G A;  1T43 A;  4Q7J A;  1A5T A;  1VQ1 A;  4WP2 A;  3FRI A;  2DAE A;  1NV8 A;  2KNZ A;  1HJP A;  4R71 A;  2L4F A;  2EJS A;  2JZ0 A;  1QZE A;  3LCV B;  1G3I A;  1OAI A;  2LVQ D;  1VDL A;  2EKK A;  1JR3 E;  2LVN C;  4F1I A;  2BWB A;  1DO0 A;  2JY8 A;  2JUJ A;  3FE3 A;  2QHO B;  2L2D A;  3E21 A;  4G3O A;  1E94 E;  2OO9 A;  1F4I A;  3T6P A;  2H5X A;  2MGW A;  2JY5 A;  3GLG E;  3IEC A;  2KNA A;  1NV9 A;  1OKS A;  2OOB A;  1WIV A;  2QSF X;  2CP8 A;  1IM2 A;  1UFZ A;  3IHP A;  1YLA A;  2LVA A;  2HWJ A;  1WR1 B;  1KYI A;  1HQY E;  1ZV1 A;  3BBZ A;  2R0I A;  1Q02 A;  1IFY A;  2DZL A;  1P3Q Q;  2G3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...