2DNAA

Solution structure of rsgi ruh-056, a uba domain from mouse cdna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GSSGSSGPSHSLQAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIYKLKSSQGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unnamed protein product
publication title Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2006-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dnaA00
3E21A 1VQ1A 2OO9A 3FE3A 2JP7A 2K9DA 2QNJA 3IHPA 2B3TA 2O25A 2DENA 1KYIA 3F92A 1G4AE 4DBGB 3GLIE 3MMPA 2EKFA 2CWBA 1BVSA 2DZLA 2LVAA 1DV0A 3GLHE 1VEGA 2K0BX 1HQYE 3GLGE 2KNVA 1SG9A 2JY6B 1PGYA 1F4IA 2MROB 2DKLA 1HJPA 1P3QQ 1YLAA 2WZJA 4R71A 2RRUA 1OKSA 2JY7A 1ZMWA 2MR9A 2JNHA 1HT1E 1WIVA 2LVOC 2DAGA 2BWBA 1XXHE 2LBCA 1VEJA 3B89A 2JY8A 1EFUB 1WHCA 2JUJA 4Q7JA 2CP8A 3K9PA 2HAKA 1ZV1A 2L2DA 1WGNA 1VEKA 1T6OA 2DNAA 3K9OA 1UFZA 2JZ1A 1OQYA 3FRHA 2JY5A 1A5TA 1T43A 3E46A 4GEWA 2HWJA 2ZTCA 2OOBA 2MGWA 1JR3E 2EKKA 1IXSA 2DAKA 4UN2B 1IM2A 5JI2E 1WJ7A 2KHHA 2OOAA 1WGLA 2LVNC 1Y8GA 2EJSA 4G3OA 4HEOA 2LTUA 1MN3A 2MJ5B 3BBZA 4F2LA 2L4EA 1DO2A 2JZ0A 2QSFX 1HT2E 1QZEA 3T6PA 1G3IA 1E94E 2R0IA 3GLFE 3FRIA 1DO0A 2H5XA 1OAIA 2KNAA 1XB2B 2KNZA 1NV9A 1TTEA 1G41A 1OTRA 2ZTDA 2LVPC 2BWEA 5DFLA 1R4GA 2DAMA 1GO5A 1AIPC 1Q02A 1IFYA 2DAEA 1VG5A 2DHYA 1TR8A 1ZMUA 1NV8A 1V92A 1VDLA 3LCUA 2G3QA 3IECA 1C7YA 2DI0A 3LCVB 2LVQD 1CUKA 1ZMVA 3H4JA 4WP2A 1WR1B 2QHOB 4F1IA 2DAIA 2L4FA
chains in the Genus database with same CATH superfamily
2VF8A 1VQ1A 4LJ7A 3B7NA 1EE8A 3DZDA 4JI8M 3GO8A 2L7IA 1R7RA 1QANA 3FE3A 2KA6B 4HLQA 2QNJA 4MGYE 5FSWA 5ITYA 3SFZA 3U5ZB 3SBJA 1E32A 2B3TA 4BB9A 2YFQA 3VK7A 4IBCA 3F92A 3GRYA 1IN5A 3A45A 5EXSA 3QYBA 1GKIA 3I04M 4G6ZA 4DV4M 4AG5A 1NHWC 1PJIA 3GLHE 2K0BX 5KQDA 1HQYE 3GRUA 4FWGA 3VFDA 1QZMA 3PNYA 1N32M 3QWLA 4AZFA 2R4EA 3AJIB 1NSFA 3TL4X 2D7GA 1L2DA 4S12A 4GHAA 4KLNA 1HNXM 3U6PA 3CF0A 3MK6A 3WHKA 4CJ6A 2XEPA 2BNKA 4X66M 3T38A 4XK8F 3HJ8A 3GLIA 1V33A 4JI1M 4L15A 2MR9A 2JNHA 3FYDA 4JXJA 1HT1E 1ZAEA 1XXHE 4YY3M 4LFCM 3KW6A 2I7PA 5FTJA 3FYCA 4JI6M 4DV2M 4I81A 1Z5AA 4QNMA 2C98A 3FTEA 4QNRA 1N78A 4Q7JA 3VDPA 1D0KA 2CP8A 3THGA 3K9PA 2OQ4A 3KOYE 4IBIA 1QVRA 2LXEA 2D7HA 3HHXA 3U6EA 2R45A 4OX9M 3HU2A 1W5SA 1HR0M 1VEKA 1HNWM 2DNAA 3SARA 3QAUA 2JZ1A 1OQYA 3J81S 2VIIA 3C3EA 4IBKA 2XSZD 4GIPA 5FTMA 2JY5A 3MHVC 4IIWA 3W68A 4NXNM 1R2ZA 4JI2M 1L1ZA 4GMQA 4GEWA 1IY2A 3GQ5A 2ZTCA 2LWXA 1QQWA 1GVNA 2QZ4A 4LJ6A 4LFBM 1AUAA 2Z3XA 4MM3B 3W0FA 3T1YM 1JQJC 2OOAA 2KHHA 4RKUF 3I01M 2ZM6M 1WGLA 2KRKA 4LY6A 2XLJA 2XSZA 2XF3A 4G3OA 2YQZA 4HEOA 1TH2A 4GC9A 1NNJA 3KXEC 1MN3A 4GKKM 1DO2A 2J7OA 1X37A 1GLNA 1LTMA 1TF0B 4XGIA 3C9PA 2K6BA 2R0IA 3JAMS 4M0DA 2DVWB 2XH9A 1DO0A 1QAMA 3LQRA 4Y28F 5ITRA 2ERCA 1N36M 2KNAA 1VDDA 2RKOA 2L6OA 4FW9A 3WHLA 1DGHA 3AOGA 3LQQA 2Z8YM 1D2NA 3DFZA 4AQYM 3HWSA 3U6MA 3L25A 1GO5A 2J7NA 4P16A 2QPAA 3SHFA 2KZSA 3Q8XA 2EO2A 1VG5A 4IBJA 1Q39A 1ZMUA 2QENA 2G3QA 2DI0A 3KP0E 3J2PB 3V76A 2XFTA 4XBOA 5KQ8A 2LVQD 4LG2A 3EIHA 4WP2A 7CATA 2KDLA 4RF1A 2I7NA 2QHOB 3FTFA 4B3RM 1D0MA 1N34M 1JB0F 2M60A 4KO8A 3SMSA 5GKNA 4DUZM 3U61A 1J09A 2DXIA 1GJSA 4MGIE 1R2YA 1GL7A 4DR4M 3U60A 5IWAM 1TH4A 3L26A 3I4YA 2K47A 3CTWB 3HU3A 4DR1M 3GLIB 3FTDA 1SXJE 2UXBM 4LJ9A 1G59A 1G4AE 4I4LA 1J7KA 3HHYA 1YSYA 2QQ8A 4R3DA 2DZLA 2RGOA 4IBDA 3ZCBB 1Z5BA 4OU7A 2KW0A 2Y20A 4LF7M 1VEGA 2Z7JA 3GLGE 2R46A 2JY6B 3FUWA 4WW0A 1QDRA 2X8AA 4QHSA 1IN6A 2UXDM 1NO1A 2FH0A 2MROB 3I51A 4DUYM 2DKLA 2E5LM 1HJPA 1YLAA 3UZUA 3BOSA 5EXPA 4R71A 2RRUA 4IJEA 1OKSA 1NVMA 3AOEC 1ZMWA 1MX0A 1D0LA 3GQ3A 1LV7A 2QCUA 4AW4A 3L29A 2BWBA 2LBCA 1Z6TA 3B89A 5BPVA 3GLHA 1R6BX 4IBFA 3VLFB 4MGKE 4NRVA 4B7GA 4DR6M 3KS8A 3A98B 4KODA 2WSEF 2ZANA 4OW0A 1ZV1A 2L2DA 4KT0F 1T6OA 1TH3A 3K9OA 1PJSA 3Q8GA 4FCTA 4LGMA 4NC6A 3K92A 4REZA 5EJCA 4DR5M 1PJJA 5KPZA 2DWLA 1A5TA 3RGSA 2F4VM 1ZQ9A 1T43A 2RGHA 3NWLA 2C5RA 3CF2A 3SYKA 2N35A 2HWJA 4G4NA 2CHGA 5F3WA 1ORYB 2OOBA 1JR3E 4ANRA 4PCZA 3B7ZA 1XXHA 2EKKA 1IXSA 1DGHB 4ITQA 4TUWA 1K3WA 4GITA 1IM2A 3FUUA 1SXJC 5EP3A 1XHBA 4D81A 1FNNA 2M5ZA 4Z8XA 4NOOB 5DYIA 4LGYA 3DOAA 2F5QA 2KEBA 4FWHA 3GPXA 3KP1E 2DWZB 3BBZA 3RGPA 3D8LA 4LF5M 4YHHM 2UXCM 4D80A 5L8RF 4DV7M 4IJFA 2FE8A 3GLFE 3FRIA 4FD2A 4M9ZA 3T15A 3TPZA 4K0KM 4AG6A 2Z4SA 3UJNA 3KOWE 3VDUA 1OAIA 4LFAM 1HNZM 2F5OA 1XB2B 3FD9A 4FWDA 3AFHA 4LJ8A 4R7GA 1QAOA 2YR0A 3RE8A 3U61B 3OTOM 1R4GA 1I94M 2DAMA 1HQCA 4IBEA 4CIZA 1Z59A 4II7A 5JI3E 3U60B 1QYRA 3R8FA 2QBYA 3U6LA 2Y0QA 1IFYA 2DAEA 4WURA 2Y21A 1TDZA 2CUZA 1V92A 1VDLA 2V1CA 3FUXA 4LRSA 5KPTA 4X65M 1C7YA 4MGHA 2KRUA 4NSOB 1QAQA 1CUKA 5FTNA 3H4JA 3GQ4A 4G4RA 3TE6A 1N33M 1XWIA 3GPPA 2DWMA 3K1JA 2O5RA 3J27B 4B7HA 5IT9S 3E21A 4IBBA 1L8QA 2APLA 4JV5M 2UUBM 4B3MM 2R65A 3IG8A 3VK8A 1YUBA 1PJTA 2JP7A 2K9DA 1OIZA 2JA2A 5EQTA 2UUAM 1T3TA 1H6UA 4FCWA 2LH0A 2DENA 1QUSA 3PVSA 1KYIA 4LJAA 3PXGA 2CV0A 2C9CA 2EUCA 4JI4M 4DR7M 4DBGB 4QOZC 3MMPA 2EKFA 2HCBA 2CWBA 2YNMD 1BVSA 2QP9X 3B9PA 1OJLA 2LVAA 5C1BA 3GLHB 3AKZA 2DWNA 8CATA 4B3SM 3E4RA 4CISA 1DV0A 3M0EA 5EP4A 5LMNM 1E9SA 3H4MA 3L2AA 4MB7A 4JYAM 3HGIA 2WSCF 1S3SA 1L2CA 4G4OA 5H37D 5ITTA 4DV6M 1XNRM 4HL4A 5EXXA 2XGNA 2W82A 3KSXA 1FJGM 1F4IA 2ZAMA 3MJ5A 4GC5A 3TWLA 1IY0A 2O01F 2GQFA 4DV5M 1SXJA 1NY6A 5ITXE 4B08A 4JI7M 1YE9A 1XXHB 4DV0M 4CHTB 4JI5M 1IXSB 2V6ZM 4L16A 5IREB 5C18A 2LVOC 4X64M 1Q3CA 1NJGA 4AKIA 1VEJA 3R9XB 3U6CA 5KPRA 3A42A 3C3DA 3GLGA 1EFUB 1WHCA 1DGFA 2HKJA 2JXNA 3E9SA 2CEAA 3SAWA 4NL4H 1IN7A 2A5YB 3PFIA 1WGNA 4PD2A 2CRUA 2L7HA 1OAOC 1UFZA 3FRHA 3LVVA 2NQ8C 2C9OA 2WSFF 3E46A 3TQSA 4LF8M 2UUCM 5E6JA 1C1KA 4NSRA 3KOXE 2CV1A 5BR8M 1OFIA 1EIJA 1IY1A 2HL7A 4LZZA 4UN2B 4BBAA 2VQFM 2R62A 1RU3A 1IN4A 4FVMA 2QBYB 3VKGA 2LVNC 4EIWA 3HU1A 1IQPA 3J7AS 2F5PA 4PDGA 2LHGA 2G5GX 3ILKA 2KZUA 1XMQM 3KS4A 2LTUA 4JN6A 3HY5A 3KDSE 4M9SA 2L4EA 2JZ0A 2QSFX 5FLXS 2EA0A 1HT2E 1KFVA 2F5NA 1QZEA 4GRIA 4LF6M 4W5WA 1G8PA 3T6PA 4AKHA 1E94E 3HJSA 1JR3A 3K2LA 3KOZE 2H5XA 3NBIA 4M9XA 4ZPXA 3AL0C 1J5EM 2KNZA 3SAVA 1TTEA 1OTRA 1GABA 4LCBA 2LVPC 1OIPA 4AKGA 1R5LA 3TWKA 1L1TA 2P5TA 4AI6A 3QYEA 1K3XA 1I4WA 1L2BA 1KSFX 1V34A 4BLCA 1XMOM 2C96A 1PJQA 2VDBB 3IECA 2H1RA 2BJVA 3LCVB 4JI3M 3A46A 4L6V6 2XZFA 5EP2A 3GLFA 3M7GA 3CF6E 3JR4A 4L4UA 1ZMVA 4I8OA 3ZH9B 3LW5F 2HHHM 4I5SA 4MGZE 2DAIA 5IZ7D 2ZTDA 3C58A 1IXRC 3ZC7B 3D8BA 1OFHA 3L27A 4A3VB 2OO9A 2C99A 4DR3M 3RFWA 4D82A 2R44A 3JR5A 1SXJB 3W0LB 3IHPA 3GPYA 4GHLA 1QUTA 3AV0A 5KO3A 3T1HM 2O25A 1UM8A 4LF4M 2FFJA 4RNAA 2CE7A 4DV1M 2Z4RA 3GLIE 1W5TA 3SASA 1IBLM 1MU5A 2KXEA 2XFSA 1N77A 4LF9M 1PM5A 4OVZA 1XC8A 4LJ5A 1G71A 3GLGB 1WXQA 1Q3BA 5E26A 4G4QA 3U6DA 4GH9A 3SHGB 2X49A 1NY5A 3DA1A 2FOIC 2FS1A 2KNVA 1SG9A 3B74A 3J7BA 3U6QA 2V1UA 3M6AA 1PGYA 2GNOA 3B7QA 3FKEA 3GRRA 3UGJA 4LJ4A 1P3QQ 3KSJA 2DZNB 2WZJA 3AOEA 3HHWA 4QOSA 2UU9M 3U5ZA 4B7FA 5DNYA 3HHZA 4RF0A 3LMMA 2JY7A 1PRBA 1IXZA 2CFOA 1K82A 1WIVA 2DAGA 4LRTA 3SC3A 3HZJA 2JY8A 1DGBA 1TGUA 2JUJA 1SXJD 2G8LA 3FUVA 1NJFA 2L09A 2J5YA 3EIEA 5ITUA 3PNVA 4JI0M 3TWMA 3NBXX 5EXTA 2HAKA 3HJQA 1GJTA 1E9RA 2Q2EB 3SAUA 4PDIA 2FNAA 2R4JA 5ITXA 4L78A 2F5SA 2MH8A 3HX3A 4MH0E 3U6OA 1XNQM 3KVWA 1QDTA 2MGWA 3SMPA 3UK6A 3SYLA 3GP1A 1IN8A 2DAKA 3J80S 5JI2E 2VQEM 5FTKA 2XZUA 1WJ7A 1TDHA 2CHQA 4X62M 4IBGA 4NRWA 1NNUC 5FTLA 1MJGM 2CHVA 1Y8GA 3BXWA 2EJSA 3U6SA 2DHRA 5A2QS 4FCVA 2MJ5B 4F2LA 2Y0TA 2ZBKB 3W67A 3GLFB 4QHTA 1IBKM 3HKPA 4L8RC 1G3IA 3KFUG 4NXMM 4B3TM 2AHMA 2LHCA 3IG5A 5ITQA 4GKJM 1IBMM 4DV3M 3I4VA 2DZOB 5DYGA 3ZQJA 4DR2M 1NV9A 4CGYB 1G41A 2R18A 3FUTA 5LMUM 3LVWA 4Z6YA 2BWEA 5DFLA 2OPFA 3L28A 1N75A 4M0WA 3FTCA 3CGWA 1JR3D 3UMMA 1AIPC 1Q02A 2DHYA 1TR8A 2CV2A 3VKHA 3GPUA 1Z5CA 1NV8A 3LCUA 4PT5A 2ZAOA 2D7EA 2LNHC 1DGGA 3GRVA 4LZJA 1GL6A 4OVZB 4KHPM 2VF7A 5EP1A 3SATA 2JWSA 1WR1B 4F1IA 2X4AA 2R6FA 1NHGC 3K8ZA 4P17A 2BJWA 2L4FA
chains in the Genus database with same CATH topology
3E21A 1VQ1A 2OO9A 3FE3A 2JP7A 2K9DA 2QNJA 3IHPA 2B3TA 2O25A 2DENA 1KYIA 3F92A 1G4AE 4DBGB 3GLIE 3MMPA 2EKFA 2CWBA 1BVSA 2DZLA 2LVAA 1DV0A 3GLHE 1VEGA 2K0BX 1HQYE 3GLGE 2KNVA 1SG9A 2JY6B 1PGYA 1F4IA 2MROB 2DKLA 1HJPA 1P3QQ 1YLAA 2WZJA 4R71A 2RRUA 1OKSA 2JY7A 1ZMWA 2MR9A 2JNHA 1HT1E 1WIVA 2LVOC 2DAGA 2BWBA 1XXHE 2LBCA 1VEJA 3B89A 2JY8A 1EFUB 1WHCA 2JUJA 4Q7JA 2CP8A 3K9PA 2HAKA 1ZV1A 2L2DA 1WGNA 1VEKA 1T6OA 2DNAA 3K9OA 1UFZA 2JZ1A 1OQYA 3FRHA 2JY5A 1A5TA 1T43A 3E46A 4GEWA 2HWJA 2ZTCA 2OOBA 2MGWA 1JR3E 2EKKA 1IXSA 2DAKA 4UN2B 1IM2A 5JI2E 1WJ7A 2KHHA 2OOAA 1WGLA 2LVNC 1Y8GA 2EJSA 4G3OA 4HEOA 2LTUA 1MN3A 2MJ5B 3BBZA 4F2LA 2L4EA 1DO2A 2JZ0A 2QSFX 1HT2E 1QZEA 3T6PA 1G3IA 1E94E 2R0IA 3GLFE 3FRIA 1DO0A 2H5XA 1OAIA 2KNAA 1XB2B 2KNZA 1NV9A 1TTEA 1G41A 1OTRA 2ZTDA 2LVPC 2BWEA 5DFLA 1R4GA 2DAMA 1GO5A 1AIPC 1Q02A 1IFYA 2DAEA 1VG5A 2DHYA 1TR8A 1ZMUA 1NV8A 1V92A 1VDLA 3LCUA 2G3QA 3IECA 1C7YA 2DI0A 3LCVB 2LVQD 1CUKA 1ZMVA 3H4JA 4WP2A 1WR1B 2QHOB 4F1IA 2DAIA 2L4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E21 A;  1VQ1 A;  2OO9 A;  3FE3 A;  2JP7 A;  2K9D A;  2QNJ A;  3IHP A;  2B3T A;  2O25 A;  2DEN A;  1KYI A;  3F92 A;  1G4A E;  4DBG B;  3GLI E;  3MMP A;  2EKF A;  2CWB A;  1BVS A;  2DZL A;  2LVA A;  1DV0 A;  3GLH E;  1VEG A;  2K0B X;  1HQY E;  3GLG E;  2KNV A;  1SG9 A;  2JY6 B;  1PGY A;  1F4I A;  2MRO B;  2DKL A;  1HJP A;  1P3Q Q;  1YLA A;  2WZJ A;  4R71 A;  2RRU A;  1OKS A;  2JY7 A;  1ZMW A;  2MR9 A;  2JNH A;  1HT1 E;  1WIV A;  2LVO C;  2DAG A;  2BWB A;  1XXH E;  2LBC A;  1VEJ A;  3B89 A;  2JY8 A;  1EFU B;  1WHC A;  2JUJ A;  4Q7J A;  2CP8 A;  3K9P A;  2HAK A;  1ZV1 A;  2L2D A;  1WGN A;  1VEK A;  1T6O A;  2DNA A;  3K9O A;  1UFZ A;  2JZ1 A;  1OQY A;  3FRH A;  2JY5 A;  1A5T A;  1T43 A;  3E46 A;  4GEW A;  2HWJ A;  2ZTC A;  2OOB A;  2MGW A;  1JR3 E;  2EKK A;  1IXS A;  2DAK A;  4UN2 B;  1IM2 A;  5JI2 E;  1WJ7 A;  2KHH A;  2OOA A;  1WGL A;  2LVN C;  1Y8G A;  2EJS A;  4G3O A;  4HEO A;  2LTU A;  1MN3 A;  2MJ5 B;  3BBZ A;  4F2L A;  2L4E A;  1DO2 A;  2JZ0 A;  2QSF X;  1HT2 E;  1QZE A;  3T6P A;  1G3I A;  1E94 E;  2R0I A;  3GLF E;  3FRI A;  1DO0 A;  2H5X A;  1OAI A;  2KNA A;  1XB2 B;  2KNZ A;  1NV9 A;  1TTE A;  1G41 A;  1OTR A;  2ZTD A;  2LVP C;  2BWE A;  5DFL A;  1R4G A;  2DAM A;  1GO5 A;  1AIP C;  1Q02 A;  1IFY A;  2DAE A;  1VG5 A;  2DHY A;  1TR8 A;  1ZMU A;  1NV8 A;  1V92 A;  1VDL A;  3LCU A;  2G3Q A;  3IEC A;  1C7Y A;  2DI0 A;  3LCV B;  2LVQ D;  1CUK A;  1ZMV A;  3H4J A;  4WP2 A;  1WR1 B;  2QHO B;  4F1I A;  2DAI A;  2L4F A; 
#chains in the Genus database with same CATH topology
 2VF8 A;  1VQ1 A;  4LJ7 A;  3B7N A;  1EE8 A;  3DZD A;  4JI8 M;  3GO8 A;  2L7I A;  1R7R A;  1QAN A;  3FE3 A;  2KA6 B;  4HLQ A;  2QNJ A;  4MGY E;  5FSW A;  5ITY A;  3SFZ A;  3U5Z B;  3SBJ A;  1E32 A;  2B3T A;  4BB9 A;  2YFQ A;  3VK7 A;  4IBC A;  3F92 A;  3GRY A;  1IN5 A;  3A45 A;  5EXS A;  3QYB A;  1GKI A;  3I04 M;  4G6Z A;  4DV4 M;  4AG5 A;  1NHW C;  1PJI A;  3GLH E;  2K0B X;  5KQD A;  1HQY E;  3GRU A;  4FWG A;  3VFD A;  1QZM A;  3PNY A;  1N32 M;  3QWL A;  4AZF A;  2R4E A;  3AJI B;  1NSF A;  3TL4 X;  2D7G A;  1L2D A;  4S12 A;  4GHA A;  4KLN A;  1HNX M;  3U6P A;  3CF0 A;  3MK6 A;  3WHK A;  4CJ6 A;  2XEP A;  2BNK A;  4X66 M;  3T38 A;  4XK8 F;  3HJ8 A;  3GLI A;  1V33 A;  4JI1 M;  4L15 A;  2MR9 A;  2JNH A;  3FYD A;  4JXJ A;  1HT1 E;  1ZAE A;  1XXH E;  4YY3 M;  4LFC M;  3KW6 A;  2I7P A;  5FTJ A;  3FYC A;  4JI6 M;  4DV2 M;  4I81 A;  1Z5A A;  4QNM A;  2C98 A;  3FTE A;  4QNR A;  1N78 A;  4Q7J A;  3VDP A;  1D0K A;  2CP8 A;  3THG A;  3K9P A;  2OQ4 A;  3KOY E;  4IBI A;  1QVR A;  2LXE A;  2D7H A;  3HHX A;  3U6E A;  2R45 A;  4OX9 M;  3HU2 A;  1W5S A;  1HR0 M;  1VEK A;  1HNW M;  2DNA A;  3SAR A;  3QAU A;  2JZ1 A;  1OQY A;  3J81 S;  2VII A;  3C3E A;  4IBK A;  2XSZ D;  4GIP A;  5FTM A;  2JY5 A;  3MHV C;  4IIW A;  3W68 A;  4NXN M;  1R2Z A;  4JI2 M;  1L1Z A;  4GMQ A;  4GEW A;  1IY2 A;  3GQ5 A;  2ZTC A;  2LWX A;  1QQW A;  1GVN A;  2QZ4 A;  4LJ6 A;  4LFB M;  1AUA A;  2Z3X A;  4MM3 B;  3W0F A;  3T1Y M;  1JQJ C;  2OOA A;  2KHH A;  4RKU F;  3I01 M;  2ZM6 M;  1WGL A;  2KRK A;  4LY6 A;  2XLJ A;  2XSZ A;  2XF3 A;  4G3O A;  2YQZ A;  4HEO A;  1TH2 A;  4GC9 A;  1NNJ A;  3KXE C;  1MN3 A;  4GKK M;  1DO2 A;  2J7O A;  1X37 A;  1GLN A;  1LTM A;  1TF0 B;  4XGI A;  3C9P A;  2K6B A;  2R0I A;  3JAM S;  4M0D A;  2DVW B;  2XH9 A;  1DO0 A;  1QAM A;  3LQR A;  4Y28 F;  5ITR A;  2ERC A;  1N36 M;  2KNA A;  1VDD A;  2RKO A;  2L6O A;  4FW9 A;  3WHL A;  1DGH A;  3AOG A;  3LQQ A;  2Z8Y M;  1D2N A;  3DFZ A;  4AQY M;  3HWS A;  3U6M A;  3L25 A;  1GO5 A;  2J7N A;  4P16 A;  2QPA A;  3SHF A;  2KZS A;  3Q8X A;  2EO2 A;  1VG5 A;  4IBJ A;  1Q39 A;  1ZMU A;  2QEN A;  2G3Q A;  2DI0 A;  3KP0 E;  3J2P B;  3V76 A;  2XFT A;  4XBO A;  5KQ8 A;  2LVQ D;  4LG2 A;  3EIH A;  4WP2 A;  7CAT A;  2KDL A;  4RF1 A;  2I7N A;  2QHO B;  3FTF A;  4B3R M;  1D0M A;  1N34 M;  1JB0 F;  2M60 A;  4KO8 A;  3SMS A;  5GKN A;  4DUZ M;  3U61 A;  1J09 A;  2DXI A;  1GJS A;  4MGI E;  1R2Y A;  1GL7 A;  4DR4 M;  3U60 A;  5IWA M;  1TH4 A;  3L26 A;  3I4Y A;  2K47 A;  3CTW B;  3HU3 A;  4DR1 M;  3GLI B;  3FTD A;  1SXJ E;  2UXB M;  4LJ9 A;  1G59 A;  1G4A E;  4I4L A;  1J7K A;  3HHY A;  1YSY A;  2QQ8 A;  4R3D A;  2DZL A;  2RGO A;  4IBD A;  3ZCB B;  1Z5B A;  4OU7 A;  2KW0 A;  2Y20 A;  4LF7 M;  1VEG A;  2Z7J A;  3GLG E;  2R46 A;  2JY6 B;  3FUW A;  4WW0 A;  1QDR A;  2X8A A;  4QHS A;  1IN6 A;  2UXD M;  1NO1 A;  2FH0 A;  2MRO B;  3I51 A;  4DUY M;  2DKL A;  2E5L M;  1HJP A;  1YLA A;  3UZU A;  3BOS A;  5EXP A;  4R71 A;  2RRU A;  4IJE A;  1OKS A;  1NVM A;  3AOE C;  1ZMW A;  1MX0 A;  1D0L A;  3GQ3 A;  1LV7 A;  2QCU A;  4AW4 A;  3L29 A;  2BWB A;  2LBC A;  1Z6T A;  3B89 A;  5BPV A;  3GLH A;  1R6B X;  4IBF A;  3VLF B;  4MGK E;  4NRV A;  4B7G A;  4DR6 M;  3KS8 A;  3A98 B;  4KOD A;  2WSE F;  2ZAN A;  4OW0 A;  1ZV1 A;  2L2D A;  4KT0 F;  1T6O A;  1TH3 A;  3K9O A;  1PJS A;  3Q8G A;  4FCT A;  4LGM A;  4NC6 A;  3K92 A;  4REZ A;  5EJC A;  4DR5 M;  1PJJ A;  5KPZ A;  2DWL A;  1A5T A;  3RGS A;  2F4V M;  1ZQ9 A;  1T43 A;  2RGH A;  3NWL A;  2C5R A;  3CF2 A;  3SYK A;  2N35 A;  2HWJ A;  4G4N A;  2CHG A;  5F3W A;  1ORY B;  2OOB A;  1JR3 E;  4ANR A;  4PCZ A;  3B7Z A;  1XXH A;  2EKK A;  1IXS A;  1DGH B;  4ITQ A;  4TUW A;  1K3W A;  4GIT A;  1IM2 A;  3FUU A;  1SXJ C;  5EP3 A;  1XHB A;  4D81 A;  1FNN A;  2M5Z A;  4Z8X A;  4NOO B;  5DYI A;  4LGY A;  3DOA A;  2F5Q A;  2KEB A;  4FWH A;  3GPX A;  3KP1 E;  2DWZ B;  3BBZ A;  3RGP A;  3D8L A;  4LF5 M;  4YHH M;  2UXC M;  4D80 A;  5L8R F;  4DV7 M;  4IJF A;  2FE8 A;  3GLF E;  3FRI A;  4FD2 A;  4M9Z A;  3T15 A;  3TPZ A;  4K0K M;  4AG6 A;  2Z4S A;  3UJN A;  3KOW E;  3VDU A;  1OAI A;  4LFA M;  1HNZ M;  2F5O A;  1XB2 B;  3FD9 A;  4FWD A;  3AFH A;  4LJ8 A;  4R7G A;  1QAO A;  2YR0 A;  3RE8 A;  3U61 B;  3OTO M;  1R4G A;  1I94 M;  2DAM A;  1HQC A;  4IBE A;  4CIZ A;  1Z59 A;  4II7 A;  5JI3 E;  3U60 B;  1QYR A;  3R8F A;  2QBY A;  3U6L A;  2Y0Q A;  1IFY A;  2DAE A;  4WUR A;  2Y21 A;  1TDZ A;  2CUZ A;  1V92 A;  1VDL A;  2V1C A;  3FUX A;  4LRS A;  5KPT A;  4X65 M;  1C7Y A;  4MGH A;  2KRU A;  4NSO B;  1QAQ A;  1CUK A;  5FTN A;  3H4J A;  3GQ4 A;  4G4R A;  3TE6 A;  1N33 M;  1XWI A;  3GPP A;  2DWM A;  3K1J A;  2O5R A;  3J27 B;  4B7H A;  5IT9 S;  3E21 A;  4IBB A;  1L8Q A;  2APL A;  4JV5 M;  2UUB M;  4B3M M;  2R65 A;  3IG8 A;  3VK8 A;  1YUB A;  1PJT A;  2JP7 A;  2K9D A;  1OIZ A;  2JA2 A;  5EQT A;  2UUA M;  1T3T A;  1H6U A;  4FCW A;  2LH0 A;  2DEN A;  1QUS A;  3PVS A;  1KYI A;  4LJA A;  3PXG A;  2CV0 A;  2C9C A;  2EUC A;  4JI4 M;  4DR7 M;  4DBG B;  4QOZ C;  3MMP A;  2EKF A;  2HCB A;  2CWB A;  2YNM D;  1BVS A;  2QP9 X;  3B9P A;  1OJL A;  2LVA A;  5C1B A;  3GLH B;  3AKZ A;  2DWN A;  8CAT A;  4B3S M;  3E4R A;  4CIS A;  1DV0 A;  3M0E A;  5EP4 A;  5LMN M;  1E9S A;  3H4M A;  3L2A A;  4MB7 A;  4JYA M;  3HGI A;  2WSC F;  1S3S A;  1L2C A;  4G4O A;  5H37 D;  5ITT A;  4DV6 M;  1XNR M;  4HL4 A;  5EXX A;  2XGN A;  2W82 A;  3KSX A;  1FJG M;  1F4I A;  2ZAM A;  3MJ5 A;  4GC5 A;  3TWL A;  1IY0 A;  2O01 F;  2GQF A;  4DV5 M;  1SXJ A;  1NY6 A;  5ITX E;  4B08 A;  4JI7 M;  1YE9 A;  1XXH B;  4DV0 M;  4CHT B;  4JI5 M;  1IXS B;  2V6Z M;  4L16 A;  5IRE B;  5C18 A;  2LVO C;  4X64 M;  1Q3C A;  1NJG A;  4AKI A;  1VEJ A;  3R9X B;  3U6C A;  5KPR A;  3A42 A;  3C3D A;  3GLG A;  1EFU B;  1WHC A;  1DGF A;  2HKJ A;  2JXN A;  3E9S A;  2CEA A;  3SAW A;  4NL4 H;  1IN7 A;  2A5Y B;  3PFI A;  1WGN A;  4PD2 A;  2CRU A;  2L7H A;  1OAO C;  1UFZ A;  3FRH A;  3LVV A;  2NQ8 C;  2C9O A;  2WSF F;  3E46 A;  3TQS A;  4LF8 M;  2UUC M;  5E6J A;  1C1K A;  4NSR A;  3KOX E;  2CV1 A;  5BR8 M;  1OFI A;  1EIJ A;  1IY1 A;  2HL7 A;  4LZZ A;  4UN2 B;  4BBA A;  2VQF M;  2R62 A;  1RU3 A;  1IN4 A;  4FVM A;  2QBY B;  3VKG A;  2LVN C;  4EIW A;  3HU1 A;  1IQP A;  3J7A S;  2F5P A;  4PDG A;  2LHG A;  2G5G X;  3ILK A;  2KZU A;  1XMQ M;  3KS4 A;  2LTU A;  4JN6 A;  3HY5 A;  3KDS E;  4M9S A;  2L4E A;  2JZ0 A;  2QSF X;  5FLX S;  2EA0 A;  1HT2 E;  1KFV A;  2F5N A;  1QZE A;  4GRI A;  4LF6 M;  4W5W A;  1G8P A;  3T6P A;  4AKH A;  1E94 E;  3HJS A;  1JR3 A;  3K2L A;  3KOZ E;  2H5X A;  3NBI A;  4M9X A;  4ZPX A;  3AL0 C;  1J5E M;  2KNZ A;  3SAV A;  1TTE A;  1OTR A;  1GAB A;  4LCB A;  2LVP C;  1OIP A;  4AKG A;  1R5L A;  3TWK A;  1L1T A;  2P5T A;  4AI6 A;  3QYE A;  1K3X A;  1I4W A;  1L2B A;  1KSF X;  1V34 A;  4BLC A;  1XMO M;  2C96 A;  1PJQ A;  2VDB B;  3IEC A;  2H1R A;  2BJV A;  3LCV B;  4JI3 M;  3A46 A;  4L6V 6;  2XZF A;  5EP2 A;  3GLF A;  3M7G A;  3CF6 E;  3JR4 A;  4L4U A;  1ZMV A;  4I8O A;  3ZH9 B;  3LW5 F;  2HHH M;  4I5S A;  4MGZ E;  2DAI A;  5IZ7 D;  2ZTD A;  3C58 A;  1IXR C;  3ZC7 B;  3D8B A;  1OFH A;  3L27 A;  4A3V B;  2OO9 A;  2C99 A;  4DR3 M;  3RFW A;  4D82 A;  2R44 A;  3JR5 A;  1SXJ B;  3W0L B;  3IHP A;  3GPY A;  4GHL A;  1QUT A;  3AV0 A;  5KO3 A;  3T1H M;  2O25 A;  1UM8 A;  4LF4 M;  2FFJ A;  4RNA A;  2CE7 A;  4DV1 M;  2Z4R A;  3GLI E;  1W5T A;  3SAS A;  1IBL M;  1MU5 A;  2KXE A;  2XFS A;  1N77 A;  4LF9 M;  1PM5 A;  4OVZ A;  1XC8 A;  4LJ5 A;  1G71 A;  3GLG B;  1WXQ A;  1Q3B A;  5E26 A;  4G4Q A;  3U6D A;  4GH9 A;  3SHG B;  2X49 A;  1NY5 A;  3DA1 A;  2FOI C;  2FS1 A;  2KNV A;  1SG9 A;  3B74 A;  3J7B A;  3U6Q A;  2V1U A;  3M6A A;  1PGY A;  2GNO A;  3B7Q A;  3FKE A;  3GRR A;  3UGJ A;  4LJ4 A;  1P3Q Q;  3KSJ A;  2DZN B;  2WZJ A;  3AOE A;  3HHW A;  4QOS A;  2UU9 M;  3U5Z A;  4B7F A;  5DNY A;  3HHZ A;  4RF0 A;  3LMM A;  2JY7 A;  1PRB A;  1IXZ A;  2CFO A;  1K82 A;  1WIV A;  2DAG A;  4LRT A;  3SC3 A;  3HZJ A;  2JY8 A;  1DGB A;  1TGU A;  2JUJ A;  1SXJ D;  2G8L A;  3FUV A;  1NJF A;  2L09 A;  2J5Y A;  3EIE A;  5ITU A;  3PNV A;  4JI0 M;  3TWM A;  3NBX X;  5EXT A;  2HAK A;  3HJQ A;  1GJT A;  1E9R A;  2Q2E B;  3SAU A;  4PDI A;  2FNA A;  2R4J A;  5ITX A;  4L78 A;  2F5S A;  2MH8 A;  3HX3 A;  4MH0 E;  3U6O A;  1XNQ M;  3KVW A;  1QDT A;  2MGW A;  3SMP A;  3UK6 A;  3SYL A;  3GP1 A;  1IN8 A;  2DAK A;  3J80 S;  5JI2 E;  2VQE M;  5FTK A;  2XZU A;  1WJ7 A;  1TDH A;  2CHQ A;  4X62 M;  4IBG A;  4NRW A;  1NNU C;  5FTL A;  1MJG M;  2CHV A;  1Y8G A;  3BXW A;  2EJS A;  3U6S A;  2DHR A;  5A2Q S;  4FCV A;  2MJ5 B;  4F2L A;  2Y0T A;  2ZBK B;  3W67 A;  3GLF B;  4QHT A;  1IBK M;  3HKP A;  4L8R C;  1G3I A;  3KFU G;  4NXM M;  4B3T M;  2AHM A;  2LHC A;  3IG5 A;  5ITQ A;  4GKJ M;  1IBM M;  4DV3 M;  3I4V A;  2DZO B;  5DYG A;  3ZQJ A;  4DR2 M;  1NV9 A;  4CGY B;  1G41 A;  2R18 A;  3FUT A;  5LMU M;  3LVW A;  4Z6Y A;  2BWE A;  5DFL A;  2OPF A;  3L28 A;  1N75 A;  4M0W A;  3FTC A;  3CGW A;  1JR3 D;  3UMM A;  1AIP C;  1Q02 A;  2DHY A;  1TR8 A;  2CV2 A;  3VKH A;  3GPU A;  1Z5C A;  1NV8 A;  3LCU A;  4PT5 A;  2ZAO A;  2D7E A;  2LNH C;  1DGG A;  3GRV A;  4LZJ A;  1GL6 A;  4OVZ B;  4KHP M;  2VF7 A;  5EP1 A;  3SAT A;  2JWS A;  1WR1 B;  4F1I A;  2X4A A;  2R6F A;  1NHG C;  3K8Z A;  4P17 A;  2BJW A;  2L4F A; 
#chains in the Genus database with same CATH homology
 3E21 A;  1VQ1 A;  2OO9 A;  3FE3 A;  2JP7 A;  2K9D A;  2QNJ A;  3IHP A;  2B3T A;  2O25 A;  2DEN A;  1KYI A;  3F92 A;  1G4A E;  4DBG B;  3GLI E;  3MMP A;  2EKF A;  2CWB A;  1BVS A;  2DZL A;  2LVA A;  1DV0 A;  3GLH E;  1VEG A;  2K0B X;  1HQY E;  3GLG E;  2KNV A;  1SG9 A;  2JY6 B;  1PGY A;  1F4I A;  2MRO B;  2DKL A;  1HJP A;  1P3Q Q;  1YLA A;  2WZJ A;  4R71 A;  2RRU A;  1OKS A;  2JY7 A;  1ZMW A;  2MR9 A;  2JNH A;  1HT1 E;  1WIV A;  2LVO C;  2DAG A;  2BWB A;  1XXH E;  2LBC A;  1VEJ A;  3B89 A;  2JY8 A;  1EFU B;  1WHC A;  2JUJ A;  4Q7J A;  2CP8 A;  3K9P A;  2HAK A;  1ZV1 A;  2L2D A;  1WGN A;  1VEK A;  1T6O A;  2DNA A;  3K9O A;  1UFZ A;  2JZ1 A;  1OQY A;  3FRH A;  2JY5 A;  1A5T A;  1T43 A;  3E46 A;  4GEW A;  2HWJ A;  2ZTC A;  2OOB A;  2MGW A;  1JR3 E;  2EKK A;  1IXS A;  2DAK A;  4UN2 B;  1IM2 A;  5JI2 E;  1WJ7 A;  2KHH A;  2OOA A;  1WGL A;  2LVN C;  1Y8G A;  2EJS A;  4G3O A;  4HEO A;  2LTU A;  1MN3 A;  2MJ5 B;  3BBZ A;  4F2L A;  2L4E A;  1DO2 A;  2JZ0 A;  2QSF X;  1HT2 E;  1QZE A;  3T6P A;  1G3I A;  1E94 E;  2R0I A;  3GLF E;  3FRI A;  1DO0 A;  2H5X A;  1OAI A;  2KNA A;  1XB2 B;  2KNZ A;  1NV9 A;  1TTE A;  1G41 A;  1OTR A;  2ZTD A;  2LVP C;  2BWE A;  5DFL A;  1R4G A;  2DAM A;  1GO5 A;  1AIP C;  1Q02 A;  1IFY A;  2DAE A;  1VG5 A;  2DHY A;  1TR8 A;  1ZMU A;  1NV8 A;  1V92 A;  1VDL A;  3LCU A;  2G3Q A;  3IEC A;  1C7Y A;  2DI0 A;  3LCV B;  2LVQ D;  1CUK A;  1ZMV A;  3H4J A;  4WP2 A;  1WR1 B;  2QHO B;  4F1I A;  2DAI A;  2L4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...