2DENA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
b'GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
molecule tags Protein binding
source organism Streptococcus sp., homo sapiens
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin
pubmed doi rcsb
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2denA00
2RRUA 1E94E 1TTEA 1OAIA 1OQYA 1P3QQ 1WHCA 2JY7A 1ZV1A 1BVSA 2LBCA 1VDLA 2O25A 1A5TA 2HAKA 1ZMWA 1WJ7A 1IM2A 2L2DA 3B89A 3T6PA 1WGNA 3K9PA 1VQ1A 3IECA 2DI0A 1YLAA 3E21A 2DHYA 2BWBA 1JR3E 2JY6B 1Q02A 3IHPA 2JNHA 2LVAA 2OOBA 1SG9A 4DBGB 1HQYE 1TR8A 2JY5A 2EKFA 5JI2E 2DKLA 3F92A 2H5XA 1EFUB 1IXSA 2DAEA 3MMPA 2K9DA 1T43A 1KYIA 3K9OA 1DO0A 3FRIA 2EJSA 2LVQD 2QHOB 2DZLA 2MGWA 4HEOA 4WP2A 1PGYA 1DV0A 2LVNC 2L4EA 2DNAA 1AIPC 2OOAA 1DO2A 4UN2B 2K0BX 4Q7JA 2KNVA 2DAIA 2LVPC 1CUKA 4F2LA 2JP7A 2DENA 3FE3A 2CP8A 1QZEA 1NV8A 3LCUA 1G3IA 1Y8GA 3GLGE 1WIVA 5DFLA 2ZTDA 2KHHA 2OO9A 2DAKA 1HT2E 1XXHE 3GLFE 2LVOC 1C7YA 1G41A 3E46A 2EKKA 1ZMUA 4G3OA 1OKSA 2BWEA 2ZTCA 2JZ1A 2MJ5B 1VEGA 2JZ0A 1ZMVA 3H4JA 4GEWA 2DAGA 1UFZA 1F4IA 2HWJA 3GLIE 2B3TA 2MROB 2MR9A 2LTUA 1VG5A 1HT1E 1IFYA 1T6OA 2KNAA 2CWBA 1MN3A 3GLHE 4R71A 2R0IA 1WGLA 1HJPA 1G4AE 2DAMA 2KNZA 2WZJA 1OTRA 2QNJA 3BBZA 4F1IA 1R4GA 2QSFX 1NV9A 1V92A 1WR1B 2L4FA 2JUJA 2G3QA 2JY8A 1VEJA 1GO5A 1XB2B 3LCVB 1VEKA 3FRHA
chains in the Genus database with same CATH superfamily
5E6JA 3KVWA 1OAIA 1V33A 1QQWA 4NL4H 3U6DA 1BVSA 2YFQA 2FFJA 4XBOA 1GL7A 5FTMA 3SAUA 1WJ7A 3GP1A 4LFBM 3K9PA 4X66M 1VQ1A 3IECA 1NJGA 2QPAA 1YLAA 1DGHB 4RF0A 2XF3A 1Q39A 1XNQM 1ZAEA 3IHPA 2YNMD 3FYCA 3MJ5A 3TL4X 4JI5M 3R9XB 3FTDA 3SMPA 3W68A 1TGUA 4B7GA 2F4VM 3GPUA 1UM8A 2QP9X 2ZANA 1XC8A 2C5RA 2EKFA 4DV0M 4LF5M 4FW9A 3TE6A 2H5XA 1RU3A 4XK8F 2Y0QA 1IXSA 2DAEA 2K9DA 2O5RA 4MGHA 3LVWA 1T43A 3DOAA 4QHSA 2ZM6M 4X62M 1FJGM 5ITQA 4LGMA 4IJFA 2LVQD 2K47A 5DYGA 2F5QA 1PGYA 1K82A 4DR6M 1DV0A 3ZC7B 4NSOB 1IN6A 1DGFA 4B7FA 1IXZA 5C1BA 3SHGB 2K0BX 3SBJA 4Q7JA 3LW5F 3T1YM 2F5PA 1IY1A 2JP7A 2LH0A 3AOEA 3J7BA 3ZCBB 4JI8M 3D8BA 3KS8A 3PXGA 3TWLA 4EIWA 1G71A 2K6BA 5L8RF 4LF7M 4AI6A 1WIVA 5DFLA 4L8RC 2AHMA 2ZTDA 5JI3E 4QOSA 1E9RA 3U6PA 1FNNA 1HNXM 1XXHE 4MB7A 4HLQA 4GC5A 4FCWA 3AOGA 3U6CA 3NWLA 1ZQ9A 3FUVA 2A5YB 1IXRC 5EP4A 5KQDA 1ZMUA 1IY0A 4LG2A 1HNWM 2EO2A 2XFTA 4JXJA 4REZA 1E32A 2D7GA 4IBEA 1EIJA 2MJ5B 3TQSA 3C3DA 3EIHA 4IBIA 2R45A 1VEGA 2JZ0A 1IBLM 1QVRA 3VLFB 4DV4M 3Q8GA 2DHRA 2KZUA 2B3TA 2R4JA 3GRVA 5C18A 3GQ3A 3GLIE 3CTWB 3GRRA 3KS4A 4D81A 3KP0E 4NXMM 3K1JA 5H37D 1HT1E 1JR3A 1NNUC 2DWMA 4KO8A 3AV0A 4CGYB 3SATA 3AFHA 1N78A 3A46A 3J80S 3HU3A 1OTRA 1PRBA 4FVMA 1E9SA 3RE8A 2NQ8C 1PM5A 1OFIA 4LZJA 1QAQA 3T15A 2F5OA 4LF8M 2QSFX 3B7NA 3HHWA 4QNRA 1WR1B 3Q8XA 2QZ4A 3VKGA 3HGIA 2G3QA 5BPVA 1LV7A 3LCVB 1L2DA 4LF6M 3D8LA 1VEKA 1Q3CA 3HU1A 2R62A 3K8ZA 5EXPA 3JAMS 3UMMA 3FRHA 3SYKA 1IY2A 1D2NA 1E94E 3B7ZA 2W82A 3KSJA 3GLIB 1XNRM 5EQTA 4X64M 4BLCA 4DR7M 3L25A 4NOOB 2UU9M 2LBCA 1W5SA 2V6ZM 1VDLA 2O25A 1SXJD 3SARA 4L4UA 1ZMWA 4DR1M 1L2BA 3T6PA 4AKIA 1S3SA 3A45A 1QUSA 2CV0A 2DHYA 4M9SA 1Q02A 3M7GA 1N34M 1NHWC 5FTJA 3HU2A 1XXHB 2JNHA 2CFOA 2LVAA 3J81S 2DZNB 4CISA 4GITA 1KFVA 2DZOB 2DWLA 3SC3A 3SASA 1TR8A 5JI2E 4L15A 4PDGA 4MH0E 3U6EA 4AKHA 1Q3BA 1EFUB 1ORYB 3JR5A 5ITUA 2F5SA 3GQ5A 3MMPA 3UJNA 1NNJA 3H4MA 1LTMA 2J5YA 3B7QA 3FTCA 3GQ4A 2CV1A 1DO0A 1YSYA 3FRIA 3KP1E 3UZUA 4AW4A 2EJSA 2QHOB 2DZLA 4WP2A 4NSRA 3TWKA 2G8LA 4GIPA 3PFIA 5FSWA 4KHPM 3DZDA 2DXIA 4AQYM 3HKPA 3WHKA 4DR3M 4G4QA 4PT5A 1JQJC 2V1CA 1G8PA 3CF0A 4JI3M 5FTKA 2DWZB 1CUKA 4L6V6 1MJGM 4M9XA 1SXJB 4D82A 2X49A 2XZUA 4G6ZA 2OQ4A 1QAOA 3T1HM 3LCUA 1PJIA 3GLGE 3B9PA 4IIWA 5ITYA 5KPTA 2Z8YM 3HHZA 1QDRA 3GLFE 2LVOC 1YE9A 3CF6E 1C7YA 4M9ZA 2CRUA 4Y28F 2XH9A 2HHHM 3FUXA 3FUTA 3VKHA 4YHHM 4WURA 2BWEA 4ZPXA 1OFHA 3GLFA 4LJ6A 4L78A 3GO8A 2ZTCA 2JZ1A 1R7RA 3U5ZA 8CATA 4MM3B 1JB0F 3GLFB 4LF9M 3KSXA 3I4YA 4KT0F 2EUCA 5ITTA 1KSFX 3H4JA 4GEWA 5KPZA 1NO1A 2ZAMA 3HZJA 3KOWE 3B74A 3FYDA 4FWGA 5ITRA 1N36M 1OIZA 1VDDA 1T6OA 2KNAA 2QQ8A 2VDBB 1MN3A 2CEAA 3GPXA 2VQFM 2UUBM 2X4AA 1DGBA 1I94M 1N32M 1R4GA 2XSZA 3TPZA 5FLXS 2CE7A 2I7NA 2FOIC 1QDTA 4PDIA 3LQQA 3R8FA 4I8OA 3WHLA 2JUJA 4MGIE 4QNMA 5EJCA 4B3SM 1GO5A 1XB2B 3J27B 3RGPA 4JV5M 5EXXA 4GC9A 2VF8A 1NHGC 2RRUA 5EP2A 4DV5M 1I4WA 1TTEA 1IN7A 2C9OA 1L8QA 1WHCA 1Z5AA 2C96A 2JY7A 3I4VA 3QYBA 1ZV1A 3GPYA 3GLGB 3RGSA 3FUWA 4A3VB 3RFWA 1A5TA 1PJTA 4I81A 4R7GA 4G4RA 1SXJE 2DI0A 2GNOA 2UUAM 5LMNM 4DV2M 2BWBA 1PJQA 2J7NA 2ZAOA 5EXSA 2OOBA 1GL6A 3W67A 4DBGB 4TUWA 1HQYE 4ANRA 2JY5A 3U6QA 2DKLA 4RKUF 2RGHA 2P5TA 1C1KA 1J09A 4LF4M 1QYRA 1V34A 2HCBA 7CATA 4RF1A 5IT9S 3K9OA 4KLNA 1NJFA 4CIZA 4JI2M 2VIIA 3GLHA 3CGWA 1N77A 3K2LA 4JI7M 2MGWA 1TDHA 2V1UA 3ILKA 1TDZA 2KZSA 1T3TA 4GRIA 4B08A 4M0DA 2L4EA 4FD2A 2DNAA 3A98B 1AIPC 4L16A 3U60A 3U61B 4D80A 2OOAA 4HL4A 2KW0A 4MGZE 2Y21A 4RNAA 3UGJA 4JYAM 5BR8M 2DAIA 3GRUA 5EP3A 4F2LA 1GKIA 3JR4A 3C9PA 1GJTA 4G4NA 2CP8A 2YR0A 2BJWA 4GKJM 4LRSA 1TH4A 1R2ZA 3U61A 3U60B 4LJ7A 1Y8GA 2KEBA 3C3EA 4IBGA 4OW0A 2EA0A 4PCZA 5A2QS 3BOSA 3GPPA 2DVWB 2DAKA 2CHGA 3W0LB 1J7KA 3KXEC 4DR2M 1IN8A 1H6UA 1G41A 3HX3A 1D0MA 2QCUA 4LRTA 3U5ZB 3FD9A 2L7HA 3DA1A 4II7A 3AL0C 4JI4M 1OKSA 1XWIA 4LJAA 1IN4A 3E4RA 2HKJA 3PNVA 1NY5A 2UUCM 4BBAA 2Z4RA 1XXHA 3A42A 5FTNA 1K3XA 1D0KA 1JR3D 3VK8A 3NBIA 4KODA 4DR5M 2APLA 2R65A 3FUUA 4I4LA 4P16A 3KOYE 1OJLA 3SYLA 2DAGA 1F4IA 2D7EA 1MU5A 1X37A 2HWJA 2LWXA 4GH9A 4JN6A 4P17A 4G4OA 2MROB 1XMQM 4NRWA 2L6OA 2BNKA 1L1ZA 1QUTA 1W5TA 4FCTA 3SFZA 2Y0TA 4MGYE 1IBKM 3HJSA 4QHTA 1IFYA 4LZZA 2I7PA 5KPRA 3KDSE 3HJQA 2CWBA 2R0IA 2JA2A 3I51A 4LFAM 1IXSB 2MH8A 3AOEC 1G4AE 2XSZD 4XGIA 4FCVA 4QOZC 2CHQA 1AUAA 2WSFF 4LJ9A 4LJ8A 4R3DA 4GHLA 3V76A 3K92A 3LMMA 5GKNA 3QWLA 3AKZA 2UXDM 2ERCA 3HY5A 3HJ8A 2L4FA 4DUZM 2Z4SA 4NC6A 1QAMA 2R44A 2JY8A 1TF0B 4LY6A 1VEJA 4IBBA 4BB9A 4FWHA 2M5ZA 2XFSA 2UXCM 2O01F 2G5GX 2Z3XA 2CUZA 2LHGA 4NRVA 2KDLA 4YY3M 3SAWA 1N75A 1PJSA 2CHVA 3MK6A 4JI0M 4B7HA 2JXNA 1L1TA 3J2PB 3EIEA 1GJSA 1P3QQ 1OQYA 2FNAA 3CF2A 3L27A 2D7HA 1Z5BA 4IJEA 3AJIB 2X8AA 1PJJA 4B3RM 3U6MA 4GKKM 4DV1M 1HNZM 4B3MM 5FTLA 1Z5CA 2HAKA 2R46A 4AG5A 3L2AA 4LJ5A 3IG8A 1IM2A 3L29A 2L2DA 2LHCA 3B89A 1WGNA 3KW6A 4MGKE 3E21A 3GRYA 3VDPA 2N35A 4X65M 2VF7A 2JY6B 2QENA 1JR3E 1K3WA 2E5LM 3HWSA 3GLHB 1Z6TA 3U6LA 4JI1M 4GHAA 3KFUG 1WXQA 4NXNM 1XHBA 5IWAM 2DWNA 4DV3M 4AZFA 1SG9A 2XEPA 3THGA 3GLIA 1OIPA 3LVVA 4GMQA 1MX0A 2GQFA 2J7OA 3F92A 3MHVC 4S12A 2H1RA 2QBYA 1SXJA 4IBJA 4DR4M 3PNYA 4IBFA 2WSEF 1DGHA 3VFDA 1KYIA 3U6SA 1YUBA 4I5SA 1QZMA 2WSCF 3I04M 2RGOA 5IZ7D 3C58A 2QBYB 3QAUA 2L09A 2M60A 4HEOA 2ZBKB 3KOXE 5DYIA 1HR0M 2LVNC 2BJVA 2KRKA 4DV7M 3J7AS 5EXTA 4Z8XA 4IBDA 3W0FA 4UN2B 1DO2A 2JWSA 3HHXA 4OU7A 2KNVA 2C9CA 2LVPC 3ZQJA 1IBMM 3SMSA 4CHTB 5E26A 2DENA 3ZH9B 2R4EA 4ITQA 3FE3A 3T38A 5F3WA 3FTFA 1QZEA 1NV8A 2KXEA 1EE8A 1IQPA 3UK6A 2UXBM 1G3IA 2VQEM 2LXEA 4OX9M 3M0EA 1OAOC 3BXWA 2YQZA 3M6AA 4OVZA 1R6BX 2R18A 2OO9A 1HQCA 2KHHA 1NVMA 1GLNA 1HT2E 5DNYA 4Z6YA 3FTEA 3LQRA 3TWMA 4DUYM 4OVZB 1R5LA 4M0WA 4AG6A 3E9SA 3E46A 4LJ4A 3OTOM 2EKKA 4G3OA 1GVNA 2L7IA 1NY6A 4PD2A 5KO3A 3L28A 4LGYA 2FH0A 1Z59A 4W5WA 2XZFA 2Z7JA 4LFCM 1SXJC 5IREB 2R6FA 2Q2EB 1G59A 4IBKA 3NBXX 1N33M 3L26A 2FS1A 1ZMVA 2C98A 1NSFA 1UFZA 2XGNA 4DV6M 4B3TM 2LNHC 2CV2A 2MR9A 3HHYA 2LTUA 2Y20A 3FKEA 1VG5A 3SHFA 3DFZA 2KRUA 4FWDA 3VK7A 3VDUA 3GLHE 5EP1A 4R71A 1D0LA 2OPFA 1GABA 1QANA 1WGLA 1J5EM 2HL7A 1HJPA 2DAMA 2KNZA 2WZJA 1L2CA 2RKOA 2FE8A 3IG5A 5KQ8A 2XLJA 2QNJA 3BBZA 4F1IA 3GLGA 1XMOM 2F5NA 4AKGA 4IBCA 2KA6B 1TH3A 1R2YA 4WW0A 2C99A 5LMUM 1NV9A 3QYEA 1V92A 4LCBA 3U6OA 3KOZE 1DGGA 3I01M 3SAVA 3PVSA 1IN5A 1TH2A 4JI6M 5ITXA 4K0KM 4CJ6A 5ITXE
chains in the Genus database with same CATH topology
2RRUA 1E94E 1TTEA 1OAIA 1OQYA 1P3QQ 1WHCA 2JY7A 1ZV1A 1BVSA 2LBCA 1VDLA 2O25A 1A5TA 2HAKA 1ZMWA 1WJ7A 1IM2A 2L2DA 3B89A 3T6PA 1WGNA 3K9PA 1VQ1A 3IECA 2DI0A 1YLAA 3E21A 2DHYA 2BWBA 1JR3E 2JY6B 1Q02A 3IHPA 2JNHA 2LVAA 2OOBA 1SG9A 4DBGB 1HQYE 1TR8A 2JY5A 2EKFA 5JI2E 2DKLA 3F92A 2H5XA 1EFUB 1IXSA 2DAEA 3MMPA 2K9DA 1T43A 1KYIA 3K9OA 1DO0A 3FRIA 2EJSA 2LVQD 2QHOB 2DZLA 2MGWA 4HEOA 4WP2A 1PGYA 1DV0A 2LVNC 2L4EA 2DNAA 1AIPC 2OOAA 1DO2A 4UN2B 2K0BX 4Q7JA 2KNVA 2DAIA 2LVPC 1CUKA 4F2LA 2JP7A 2DENA 3FE3A 2CP8A 1QZEA 1NV8A 3LCUA 1G3IA 1Y8GA 3GLGE 1WIVA 5DFLA 2ZTDA 2KHHA 2OO9A 2DAKA 1HT2E 1XXHE 3GLFE 2LVOC 1C7YA 1G41A 3E46A 2EKKA 1ZMUA 4G3OA 1OKSA 2BWEA 2ZTCA 2JZ1A 2MJ5B 1VEGA 2JZ0A 1ZMVA 3H4JA 4GEWA 2DAGA 1UFZA 1F4IA 2HWJA 3GLIE 2B3TA 2MROB 2MR9A 2LTUA 1VG5A 1HT1E 1IFYA 1T6OA 2KNAA 2CWBA 1MN3A 3GLHE 4R71A 2R0IA 1WGLA 1HJPA 1G4AE 2DAMA 2KNZA 2WZJA 1OTRA 2QNJA 3BBZA 4F1IA 1R4GA 2QSFX 1NV9A 1V92A 1WR1B 2L4FA 2JUJA 2G3QA 2JY8A 1VEJA 1GO5A 1XB2B 3LCVB 1VEKA 3FRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRU A;  1E94 E;  1TTE A;  1OAI A;  1OQY A;  1P3Q Q;  1WHC A;  2JY7 A;  1ZV1 A;  1BVS A;  2LBC A;  1VDL A;  2O25 A;  1A5T A;  2HAK A;  1ZMW A;  1WJ7 A;  1IM2 A;  2L2D A;  3B89 A;  3T6P A;  1WGN A;  3K9P A;  1VQ1 A;  3IEC A;  2DI0 A;  1YLA A;  3E21 A;  2DHY A;  2BWB A;  1JR3 E;  2JY6 B;  1Q02 A;  3IHP A;  2JNH A;  2LVA A;  2OOB A;  1SG9 A;  4DBG B;  1HQY E;  1TR8 A;  2JY5 A;  2EKF A;  5JI2 E;  2DKL A;  3F92 A;  2H5X A;  1EFU B;  1IXS A;  2DAE A;  3MMP A;  2K9D A;  1T43 A;  1KYI A;  3K9O A;  1DO0 A;  3FRI A;  2EJS A;  2LVQ D;  2QHO B;  2DZL A;  2MGW A;  4HEO A;  4WP2 A;  1PGY A;  1DV0 A;  2LVN C;  2L4E A;  2DNA A;  1AIP C;  2OOA A;  1DO2 A;  4UN2 B;  2K0B X;  4Q7J A;  2KNV A;  2DAI A;  2LVP C;  1CUK A;  4F2L A;  2JP7 A;  2DEN A;  3FE3 A;  2CP8 A;  1QZE A;  1NV8 A;  3LCU A;  1G3I A;  1Y8G A;  3GLG E;  1WIV A;  5DFL A;  2ZTD A;  2KHH A;  2OO9 A;  2DAK A;  1HT2 E;  1XXH E;  3GLF E;  2LVO C;  1C7Y A;  1G41 A;  3E46 A;  2EKK A;  1ZMU A;  4G3O A;  1OKS A;  2BWE A;  2ZTC A;  2JZ1 A;  2MJ5 B;  1VEG A;  2JZ0 A;  1ZMV A;  3H4J A;  4GEW A;  2DAG A;  1UFZ A;  1F4I A;  2HWJ A;  3GLI E;  2B3T A;  2MRO B;  2MR9 A;  2LTU A;  1VG5 A;  1HT1 E;  1IFY A;  1T6O A;  2KNA A;  2CWB A;  1MN3 A;  3GLH E;  4R71 A;  2R0I A;  1WGL A;  1HJP A;  1G4A E;  2DAM A;  2KNZ A;  2WZJ A;  1OTR A;  2QNJ A;  3BBZ A;  4F1I A;  1R4G A;  2QSF X;  1NV9 A;  1V92 A;  1WR1 B;  2L4F A;  2JUJ A;  2G3Q A;  2JY8 A;  1VEJ A;  1GO5 A;  1XB2 B;  3LCV B;  1VEK A;  3FRH A; 
#chains in the Genus database with same CATH topology
 5E6J A;  3KVW A;  1OAI A;  1V33 A;  1QQW A;  4NL4 H;  3U6D A;  1BVS A;  2YFQ A;  2FFJ A;  4XBO A;  1GL7 A;  5FTM A;  3SAU A;  1WJ7 A;  3GP1 A;  4LFB M;  3K9P A;  4X66 M;  1VQ1 A;  3IEC A;  1NJG A;  2QPA A;  1YLA A;  1DGH B;  4RF0 A;  2XF3 A;  1Q39 A;  1XNQ M;  1ZAE A;  3IHP A;  2YNM D;  3FYC A;  3MJ5 A;  3TL4 X;  4JI5 M;  3R9X B;  3FTD A;  3SMP A;  3W68 A;  1TGU A;  4B7G A;  2F4V M;  3GPU A;  1UM8 A;  2QP9 X;  2ZAN A;  1XC8 A;  2C5R A;  2EKF A;  4DV0 M;  4LF5 M;  4FW9 A;  3TE6 A;  2H5X A;  1RU3 A;  4XK8 F;  2Y0Q A;  1IXS A;  2DAE A;  2K9D A;  2O5R A;  4MGH A;  3LVW A;  1T43 A;  3DOA A;  4QHS A;  2ZM6 M;  4X62 M;  1FJG M;  5ITQ A;  4LGM A;  4IJF A;  2LVQ D;  2K47 A;  5DYG A;  2F5Q A;  1PGY A;  1K82 A;  4DR6 M;  1DV0 A;  3ZC7 B;  4NSO B;  1IN6 A;  1DGF A;  4B7F A;  1IXZ A;  5C1B A;  3SHG B;  2K0B X;  3SBJ A;  4Q7J A;  3LW5 F;  3T1Y M;  2F5P A;  1IY1 A;  2JP7 A;  2LH0 A;  3AOE A;  3J7B A;  3ZCB B;  4JI8 M;  3D8B A;  3KS8 A;  3PXG A;  3TWL A;  4EIW A;  1G71 A;  2K6B A;  5L8R F;  4LF7 M;  4AI6 A;  1WIV A;  5DFL A;  4L8R C;  2AHM A;  2ZTD A;  5JI3 E;  4QOS A;  1E9R A;  3U6P A;  1FNN A;  1HNX M;  1XXH E;  4MB7 A;  4HLQ A;  4GC5 A;  4FCW A;  3AOG A;  3U6C A;  3NWL A;  1ZQ9 A;  3FUV A;  2A5Y B;  1IXR C;  5EP4 A;  5KQD A;  1ZMU A;  1IY0 A;  4LG2 A;  1HNW M;  2EO2 A;  2XFT A;  4JXJ A;  4REZ A;  1E32 A;  2D7G A;  4IBE A;  1EIJ A;  2MJ5 B;  3TQS A;  3C3D A;  3EIH A;  4IBI A;  2R45 A;  1VEG A;  2JZ0 A;  1IBL M;  1QVR A;  3VLF B;  4DV4 M;  3Q8G A;  2DHR A;  2KZU A;  2B3T A;  2R4J A;  3GRV A;  5C18 A;  3GQ3 A;  3GLI E;  3CTW B;  3GRR A;  3KS4 A;  4D81 A;  3KP0 E;  4NXM M;  3K1J A;  5H37 D;  1HT1 E;  1JR3 A;  1NNU C;  2DWM A;  4KO8 A;  3AV0 A;  4CGY B;  3SAT A;  3AFH A;  1N78 A;  3A46 A;  3J80 S;  3HU3 A;  1OTR A;  1PRB A;  4FVM A;  1E9S A;  3RE8 A;  2NQ8 C;  1PM5 A;  1OFI A;  4LZJ A;  1QAQ A;  3T15 A;  2F5O A;  4LF8 M;  2QSF X;  3B7N A;  3HHW A;  4QNR A;  1WR1 B;  3Q8X A;  2QZ4 A;  3VKG A;  3HGI A;  2G3Q A;  5BPV A;  1LV7 A;  3LCV B;  1L2D A;  4LF6 M;  3D8L A;  1VEK A;  1Q3C A;  3HU1 A;  2R62 A;  3K8Z A;  5EXP A;  3JAM S;  3UMM A;  3FRH A;  3SYK A;  1IY2 A;  1D2N A;  1E94 E;  3B7Z A;  2W82 A;  3KSJ A;  3GLI B;  1XNR M;  5EQT A;  4X64 M;  4BLC A;  4DR7 M;  3L25 A;  4NOO B;  2UU9 M;  2LBC A;  1W5S A;  2V6Z M;  1VDL A;  2O25 A;  1SXJ D;  3SAR A;  4L4U A;  1ZMW A;  4DR1 M;  1L2B A;  3T6P A;  4AKI A;  1S3S A;  3A45 A;  1QUS A;  2CV0 A;  2DHY A;  4M9S A;  1Q02 A;  3M7G A;  1N34 M;  1NHW C;  5FTJ A;  3HU2 A;  1XXH B;  2JNH A;  2CFO A;  2LVA A;  3J81 S;  2DZN B;  4CIS A;  4GIT A;  1KFV A;  2DZO B;  2DWL A;  3SC3 A;  3SAS A;  1TR8 A;  5JI2 E;  4L15 A;  4PDG A;  4MH0 E;  3U6E A;  4AKH A;  1Q3B A;  1EFU B;  1ORY B;  3JR5 A;  5ITU A;  2F5S A;  3GQ5 A;  3MMP A;  3UJN A;  1NNJ A;  3H4M A;  1LTM A;  2J5Y A;  3B7Q A;  3FTC A;  3GQ4 A;  2CV1 A;  1DO0 A;  1YSY A;  3FRI A;  3KP1 E;  3UZU A;  4AW4 A;  2EJS A;  2QHO B;  2DZL A;  4WP2 A;  4NSR A;  3TWK A;  2G8L A;  4GIP A;  3PFI A;  5FSW A;  4KHP M;  3DZD A;  2DXI A;  4AQY M;  3HKP A;  3WHK A;  4DR3 M;  4G4Q A;  4PT5 A;  1JQJ C;  2V1C A;  1G8P A;  3CF0 A;  4JI3 M;  5FTK A;  2DWZ B;  1CUK A;  4L6V 6;  1MJG M;  4M9X A;  1SXJ B;  4D82 A;  2X49 A;  2XZU A;  4G6Z A;  2OQ4 A;  1QAO A;  3T1H M;  3LCU A;  1PJI A;  3GLG E;  3B9P A;  4IIW A;  5ITY A;  5KPT A;  2Z8Y M;  3HHZ A;  1QDR A;  3GLF E;  2LVO C;  1YE9 A;  3CF6 E;  1C7Y A;  4M9Z A;  2CRU A;  4Y28 F;  2XH9 A;  2HHH M;  3FUX A;  3FUT A;  3VKH A;  4YHH M;  4WUR A;  2BWE A;  4ZPX A;  1OFH A;  3GLF A;  4LJ6 A;  4L78 A;  3GO8 A;  2ZTC A;  2JZ1 A;  1R7R A;  3U5Z A;  8CAT A;  4MM3 B;  1JB0 F;  3GLF B;  4LF9 M;  3KSX A;  3I4Y A;  4KT0 F;  2EUC A;  5ITT A;  1KSF X;  3H4J A;  4GEW A;  5KPZ A;  1NO1 A;  2ZAM A;  3HZJ A;  3KOW E;  3B74 A;  3FYD A;  4FWG A;  5ITR A;  1N36 M;  1OIZ A;  1VDD A;  1T6O A;  2KNA A;  2QQ8 A;  2VDB B;  1MN3 A;  2CEA A;  3GPX A;  2VQF M;  2UUB M;  2X4A A;  1DGB A;  1I94 M;  1N32 M;  1R4G A;  2XSZ A;  3TPZ A;  5FLX S;  2CE7 A;  2I7N A;  2FOI C;  1QDT A;  4PDI A;  3LQQ A;  3R8F A;  4I8O A;  3WHL A;  2JUJ A;  4MGI E;  4QNM A;  5EJC A;  4B3S M;  1GO5 A;  1XB2 B;  3J27 B;  3RGP A;  4JV5 M;  5EXX A;  4GC9 A;  2VF8 A;  1NHG C;  2RRU A;  5EP2 A;  4DV5 M;  1I4W A;  1TTE A;  1IN7 A;  2C9O A;  1L8Q A;  1WHC A;  1Z5A A;  2C96 A;  2JY7 A;  3I4V A;  3QYB A;  1ZV1 A;  3GPY A;  3GLG B;  3RGS A;  3FUW A;  4A3V B;  3RFW A;  1A5T A;  1PJT A;  4I81 A;  4R7G A;  4G4R A;  1SXJ E;  2DI0 A;  2GNO A;  2UUA M;  5LMN M;  4DV2 M;  2BWB A;  1PJQ A;  2J7N A;  2ZAO A;  5EXS A;  2OOB A;  1GL6 A;  3W67 A;  4DBG B;  4TUW A;  1HQY E;  4ANR A;  2JY5 A;  3U6Q A;  2DKL A;  4RKU F;  2RGH A;  2P5T A;  1C1K A;  1J09 A;  4LF4 M;  1QYR A;  1V34 A;  2HCB A;  7CAT A;  4RF1 A;  5IT9 S;  3K9O A;  4KLN A;  1NJF A;  4CIZ A;  4JI2 M;  2VII A;  3GLH A;  3CGW A;  1N77 A;  3K2L A;  4JI7 M;  2MGW A;  1TDH A;  2V1U A;  3ILK A;  1TDZ A;  2KZS A;  1T3T A;  4GRI A;  4B08 A;  4M0D A;  2L4E A;  4FD2 A;  2DNA A;  3A98 B;  1AIP C;  4L16 A;  3U60 A;  3U61 B;  4D80 A;  2OOA A;  4HL4 A;  2KW0 A;  4MGZ E;  2Y21 A;  4RNA A;  3UGJ A;  4JYA M;  5BR8 M;  2DAI A;  3GRU A;  5EP3 A;  4F2L A;  1GKI A;  3JR4 A;  3C9P A;  1GJT A;  4G4N A;  2CP8 A;  2YR0 A;  2BJW A;  4GKJ M;  4LRS A;  1TH4 A;  1R2Z A;  3U61 A;  3U60 B;  4LJ7 A;  1Y8G A;  2KEB A;  3C3E A;  4IBG A;  4OW0 A;  2EA0 A;  4PCZ A;  5A2Q S;  3BOS A;  3GPP A;  2DVW B;  2DAK A;  2CHG A;  3W0L B;  1J7K A;  3KXE C;  4DR2 M;  1IN8 A;  1H6U A;  1G41 A;  3HX3 A;  1D0M A;  2QCU A;  4LRT A;  3U5Z B;  3FD9 A;  2L7H A;  3DA1 A;  4II7 A;  3AL0 C;  4JI4 M;  1OKS A;  1XWI A;  4LJA A;  1IN4 A;  3E4R A;  2HKJ A;  3PNV A;  1NY5 A;  2UUC M;  4BBA A;  2Z4R A;  1XXH A;  3A42 A;  5FTN A;  1K3X A;  1D0K A;  1JR3 D;  3VK8 A;  3NBI A;  4KOD A;  4DR5 M;  2APL A;  2R65 A;  3FUU A;  4I4L A;  4P16 A;  3KOY E;  1OJL A;  3SYL A;  2DAG A;  1F4I A;  2D7E A;  1MU5 A;  1X37 A;  2HWJ A;  2LWX A;  4GH9 A;  4JN6 A;  4P17 A;  4G4O A;  2MRO B;  1XMQ M;  4NRW A;  2L6O A;  2BNK A;  1L1Z A;  1QUT A;  1W5T A;  4FCT A;  3SFZ A;  2Y0T A;  4MGY E;  1IBK M;  3HJS A;  4QHT A;  1IFY A;  4LZZ A;  2I7P A;  5KPR A;  3KDS E;  3HJQ A;  2CWB A;  2R0I A;  2JA2 A;  3I51 A;  4LFA M;  1IXS B;  2MH8 A;  3AOE C;  1G4A E;  2XSZ D;  4XGI A;  4FCV A;  4QOZ C;  2CHQ A;  1AUA A;  2WSF F;  4LJ9 A;  4LJ8 A;  4R3D A;  4GHL A;  3V76 A;  3K92 A;  3LMM A;  5GKN A;  3QWL A;  3AKZ A;  2UXD M;  2ERC A;  3HY5 A;  3HJ8 A;  2L4F A;  4DUZ M;  2Z4S A;  4NC6 A;  1QAM A;  2R44 A;  2JY8 A;  1TF0 B;  4LY6 A;  1VEJ A;  4IBB A;  4BB9 A;  4FWH A;  2M5Z A;  2XFS A;  2UXC M;  2O01 F;  2G5G X;  2Z3X A;  2CUZ A;  2LHG A;  4NRV A;  2KDL A;  4YY3 M;  3SAW A;  1N75 A;  1PJS A;  2CHV A;  3MK6 A;  4JI0 M;  4B7H A;  2JXN A;  1L1T A;  3J2P B;  3EIE A;  1GJS A;  1P3Q Q;  1OQY A;  2FNA A;  3CF2 A;  3L27 A;  2D7H A;  1Z5B A;  4IJE A;  3AJI B;  2X8A A;  1PJJ A;  4B3R M;  3U6M A;  4GKK M;  4DV1 M;  1HNZ M;  4B3M M;  5FTL A;  1Z5C A;  2HAK A;  2R46 A;  4AG5 A;  3L2A A;  4LJ5 A;  3IG8 A;  1IM2 A;  3L29 A;  2L2D A;  2LHC A;  3B89 A;  1WGN A;  3KW6 A;  4MGK E;  3E21 A;  3GRY A;  3VDP A;  2N35 A;  4X65 M;  2VF7 A;  2JY6 B;  2QEN A;  1JR3 E;  1K3W A;  2E5L M;  3HWS A;  3GLH B;  1Z6T A;  3U6L A;  4JI1 M;  4GHA A;  3KFU G;  1WXQ A;  4NXN M;  1XHB A;  5IWA M;  2DWN A;  4DV3 M;  4AZF A;  1SG9 A;  2XEP A;  3THG A;  3GLI A;  1OIP A;  3LVV A;  4GMQ A;  1MX0 A;  2GQF A;  2J7O A;  3F92 A;  3MHV C;  4S12 A;  2H1R A;  2QBY A;  1SXJ A;  4IBJ A;  4DR4 M;  3PNY A;  4IBF A;  2WSE F;  1DGH A;  3VFD A;  1KYI A;  3U6S A;  1YUB A;  4I5S A;  1QZM A;  2WSC F;  3I04 M;  2RGO A;  5IZ7 D;  3C58 A;  2QBY B;  3QAU A;  2L09 A;  2M60 A;  4HEO A;  2ZBK B;  3KOX E;  5DYI A;  1HR0 M;  2LVN C;  2BJV A;  2KRK A;  4DV7 M;  3J7A S;  5EXT A;  4Z8X A;  4IBD A;  3W0F A;  4UN2 B;  1DO2 A;  2JWS A;  3HHX A;  4OU7 A;  2KNV A;  2C9C A;  2LVP C;  3ZQJ A;  1IBM M;  3SMS A;  4CHT B;  5E26 A;  2DEN A;  3ZH9 B;  2R4E A;  4ITQ A;  3FE3 A;  3T38 A;  5F3W A;  3FTF A;  1QZE A;  1NV8 A;  2KXE A;  1EE8 A;  1IQP A;  3UK6 A;  2UXB M;  1G3I A;  2VQE M;  2LXE A;  4OX9 M;  3M0E A;  1OAO C;  3BXW A;  2YQZ A;  3M6A A;  4OVZ A;  1R6B X;  2R18 A;  2OO9 A;  1HQC A;  2KHH A;  1NVM A;  1GLN A;  1HT2 E;  5DNY A;  4Z6Y A;  3FTE A;  3LQR A;  3TWM A;  4DUY M;  4OVZ B;  1R5L A;  4M0W A;  4AG6 A;  3E9S A;  3E46 A;  4LJ4 A;  3OTO M;  2EKK A;  4G3O A;  1GVN A;  2L7I A;  1NY6 A;  4PD2 A;  5KO3 A;  3L28 A;  4LGY A;  2FH0 A;  1Z59 A;  4W5W A;  2XZF A;  2Z7J A;  4LFC M;  1SXJ C;  5IRE B;  2R6F A;  2Q2E B;  1G59 A;  4IBK A;  3NBX X;  1N33 M;  3L26 A;  2FS1 A;  1ZMV A;  2C98 A;  1NSF A;  1UFZ A;  2XGN A;  4DV6 M;  4B3T M;  2LNH C;  2CV2 A;  2MR9 A;  3HHY A;  2LTU A;  2Y20 A;  3FKE A;  1VG5 A;  3SHF A;  3DFZ A;  2KRU A;  4FWD A;  3VK7 A;  3VDU A;  3GLH E;  5EP1 A;  4R71 A;  1D0L A;  2OPF A;  1GAB A;  1QAN A;  1WGL A;  1J5E M;  2HL7 A;  1HJP A;  2DAM A;  2KNZ A;  2WZJ A;  1L2C A;  2RKO A;  2FE8 A;  3IG5 A;  5KQ8 A;  2XLJ A;  2QNJ A;  3BBZ A;  4F1I A;  3GLG A;  1XMO M;  2F5N A;  4AKG A;  4IBC A;  2KA6 B;  1TH3 A;  1R2Y A;  4WW0 A;  2C99 A;  5LMU M;  1NV9 A;  3QYE A;  1V92 A;  4LCB A;  3U6O A;  3KOZ E;  1DGG A;  3I01 M;  3SAV A;  3PVS A;  1IN5 A;  1TH2 A;  4JI6 M;  5ITX A;  4K0K M;  4CJ6 A;  5ITX E; 
#chains in the Genus database with same CATH homology
 2RRU A;  1E94 E;  1TTE A;  1OAI A;  1OQY A;  1P3Q Q;  1WHC A;  2JY7 A;  1ZV1 A;  1BVS A;  2LBC A;  1VDL A;  2O25 A;  1A5T A;  2HAK A;  1ZMW A;  1WJ7 A;  1IM2 A;  2L2D A;  3B89 A;  3T6P A;  1WGN A;  3K9P A;  1VQ1 A;  3IEC A;  2DI0 A;  1YLA A;  3E21 A;  2DHY A;  2BWB A;  1JR3 E;  2JY6 B;  1Q02 A;  3IHP A;  2JNH A;  2LVA A;  2OOB A;  1SG9 A;  4DBG B;  1HQY E;  1TR8 A;  2JY5 A;  2EKF A;  5JI2 E;  2DKL A;  3F92 A;  2H5X A;  1EFU B;  1IXS A;  2DAE A;  3MMP A;  2K9D A;  1T43 A;  1KYI A;  3K9O A;  1DO0 A;  3FRI A;  2EJS A;  2LVQ D;  2QHO B;  2DZL A;  2MGW A;  4HEO A;  4WP2 A;  1PGY A;  1DV0 A;  2LVN C;  2L4E A;  2DNA A;  1AIP C;  2OOA A;  1DO2 A;  4UN2 B;  2K0B X;  4Q7J A;  2KNV A;  2DAI A;  2LVP C;  1CUK A;  4F2L A;  2JP7 A;  2DEN A;  3FE3 A;  2CP8 A;  1QZE A;  1NV8 A;  3LCU A;  1G3I A;  1Y8G A;  3GLG E;  1WIV A;  5DFL A;  2ZTD A;  2KHH A;  2OO9 A;  2DAK A;  1HT2 E;  1XXH E;  3GLF E;  2LVO C;  1C7Y A;  1G41 A;  3E46 A;  2EKK A;  1ZMU A;  4G3O A;  1OKS A;  2BWE A;  2ZTC A;  2JZ1 A;  2MJ5 B;  1VEG A;  2JZ0 A;  1ZMV A;  3H4J A;  4GEW A;  2DAG A;  1UFZ A;  1F4I A;  2HWJ A;  3GLI E;  2B3T A;  2MRO B;  2MR9 A;  2LTU A;  1VG5 A;  1HT1 E;  1IFY A;  1T6O A;  2KNA A;  2CWB A;  1MN3 A;  3GLH E;  4R71 A;  2R0I A;  1WGL A;  1HJP A;  1G4A E;  2DAM A;  2KNZ A;  2WZJ A;  1OTR A;  2QNJ A;  3BBZ A;  4F1I A;  1R4G A;  2QSF X;  1NV9 A;  1V92 A;  1WR1 B;  2L4F A;  2JUJ A;  2G3Q A;  2JY8 A;  1VEJ A;  1GO5 A;  1XB2 B;  3LCV B;  1VEK A;  3FRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...