2DENA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
molecule tags Protein binding
molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2denA00
5DFLA 1ZMUA 2R0IA 1XB2B 3GLFE 1WIVA 1MN3A 4UN2B 1AIPC 1HJPA 3FRIA 4HEOA 4Q7JA 3K9PA 2BWBA 1DO2A 3E46A 3GLGE 1UFZA 3H4JA 2LVAA 2DAEA 2DENA 1E94E 2DHYA 2JY5A 3T6PA 2EKFA 2DAKA 1WR1B 1DO0A 1EFUB 1QZEA 2MR9A 1G3IA 2QSFX 2DAGA 1IXSA 1GO5A 1IM2A 1VDLA 3F92A 3IECA 1T6OA 2B3TA 2HWJA 2JZ0A 3B89A 2H5XA 1OAIA 2DKLA 1KYIA 1P3QQ 2OOAA 2MROB 1TR8A 1OTRA 3GLIE 2JY7A 4R71A 4GEWA 2JP7A 2O25A 2LVPC 1WJ7A 3FRHA 4F2LA 1ZMVA 2MJ5B 2RRUA 1V92A 1VEJA 2LTUA 2DAIA 2JNHA 1NV8A 1ZV1A 2EJSA 2LVOC 3LCVB 2KHHA 3MMPA 2JZ1A 2LVQD 2ZTDA 2BWEA 1YLAA 4F1IA 2WZJA 2KNAA 3FE3A 1F4IA 1OQYA 1VEGA 2OO9A 4WP2A 1TTEA 5JI2E 1G4AE 2JY8A 1G41A 2L4FA 2ZTCA 3IHPA 1R4GA 1SG9A 2CWBA 1IFYA 2K0BX 1VG5A 1HT2E 2CP8A 1XXHE 1ZMWA 2G3QA 1BVSA 2DZLA 2QNJA 1Y8GA 1HT1E 1DV0A 2MGWA 1NV9A 4DBGB 3K9OA 1A5TA 1PGYA 2K9DA 2LVNC 2DNAA 4G3OA 1OKSA 2DI0A 2JY6B 2HAKA 2KNZA 2LBCA 3GLHE 1C7YA 1VEKA 2QHOB 2L2DA 1WHCA 1CUKA 3LCUA 3E21A 1WGNA 1HQYE 1WGLA 2DAMA 2L4EA 2OOBA 2EKKA 1T43A 2JUJA 1JR3E 3BBZA 2KNVA 1Q02A 1VQ1A
chains in the Genus database with same CATH superfamily
1ZMUA 3TWMA 2R0IA 4NXMM 1Q39A 5IT9S 4PT5A 4GITA 4DV1M 4I8OA 3L29A 3J80S 1L2BA 2XFSA 1AIPC 3FYDA 3I4YA 4Q7JA 2YR0A 3HHXA 5LMUM 1L1TA 3Q8GA 1XXHA 2F5PA 2Y20A 3FUUA 1UM8A 1TH3A 3NBIA 4Z8XA 1Q3CA 1PM5A 4LZZA 2DAEA 3VKHA 4DR1M 1QANA 2DAKA 4AKHA 2D7HA 3HJ8A 3HZJA 4KHPM 2MR9A 3I04M 5IWAM 1ZQ9A 4LJ9A 1G3IA 4GHLA 2C99A 4LF8M 2LHCA 3F92A 4DR7M 3MK6A 4OU7A 3NWLA 3U6OA 2H5XA 4IIWA 3FUVA 2DKLA 3ZCBB 2OOAA 4I81A 3KSJA 1DGHB 4ANRA 5EXSA 3GLIE 2V1CA 2FE8A 2JY7A 2UU9M 4R71A 4MGZE 2XZFA 2M5ZA 3U60A 1QVRA 4GEWA 1GKIA 2MH8A 4AI6A 3HHWA 2LVPC 1SXJB 1LTMA 3WHLA 2YFQA 3VFDA 4BB9A 4F2LA 4MM3B 5ITXA 4K0KM 1N78A 2F5OA 1V34A 1ZMVA 2MJ5B 2RRUA 5FTLA 3FTDA 3KFUG 4REZA 3VLFB 4M0DA 2QBYB 4PD2A 1NV8A 1L8QA 2L7HA 1EE8A 1L1ZA 4QOZC 2LVOC 2WSCF 2KHHA 3LQQA 3MMPA 4LRTA 2Z3XA 4NL4H 3CF6E 3GLIA 4CHTB 2YQZA 3HJSA 1MU5A 4FCTA 2CFOA 3M6AA 1HNWM 3AJIB 3RFWA 4D82A 1N32M 4F1IA 2WZJA 2H1RA 1VEGA 2OO9A 4G4NA 1NJFA 3M0EA 4DR5M 7CATA 3T1YM 3B7QA 5JI2E 3U61A 5FTJA 4B08A 1G8PA 1N75A 3HU1A 3T1HM 1NSFA 3J2PB 3HJQA 2C96A 3SHGB 2DHRA 4R7GA 3D8LA 1SG9A 2CWBA 4NSOB 4IBBA 2ZAMA 1QYRA 2L6OA 4OVZA 1XXHE 2APLA 3BOSA 1KSFX 2G3QA 1BVSA 3Q8XA 3SMPA 5BPVA 2FOIC 1TGUA 1FNNA 1TDHA 1IBMM 4QHSA 2V6ZM 1DV0A 1EIJA 1MX0A 1NV9A 1NY6A 1QAOA 5EQTA 4LF5M 3L25A 4IBKA 3GRVA 1PGYA 4AKGA 2K9DA 5FTKA 5EP2A 2UUCM 4G3OA 3W0LB 2Y0TA 4ZPXA 2KRUA 3K8ZA 1C1KA 1G71A 3SARA 2CRUA 3ZC7B 1MJGM 1R5LA 3QAUA 4M0WA 5ITXE 1GJSA 3E21A 4CGYB 4CJ6A 1OJLA 1GL6A 1Z6TA 3IG5A 3GPXA 1T43A 4AG6A 4LY6A 1JR3A 3BBZA 2BJWA 4NSRA 1OIZA 2ERCA 3UK6A 4YY3M 4DR2M 2KRKA 3KOYE 3GLFE 1WIVA 1MN3A 1VDDA 1W5SA 4LJ8A 3VDPA 1YUBA 2JWSA 4IJFA 2VQFM 2XGNA 2Q2EB 2XEPA 1R2ZA 1XWIA 3KS4A 3L27A 2BWBA 1DO2A 3UMMA 5IREB 4DV5M 1X37A 3U6MA 1XMOM 2UUBM 3I4VA 4KO8A 3GLGE 2WSEF 5ITYA 3DFZA 2ZANA 2KW0A 4B3RM 2JY5A 2EKFA 2KA6B 2F5QA 1TF0B 4JYAM 4WW0A 2C5RA 2XH9A 1R6BX 4NOOB 3SMSA 3U60B 4B7HA 2DAGA 3QWLA 3OTOM 3JR5A 1XC8A 1QAMA 3IECA 5A2QS 3U61B 1T6OA 2JZ0A 1XMQM 1Q3BA 3B89A 3KP0E 1OAIA 1E9RA 5IZ7D 5C1BA 1KYIA 3VK8A 1P3QQ 2MROB 4GKKM 2QP9X 2F5SA 2O25A 4G6ZA 5FTNA 4LJ7A 3FD9A 4IBDA 4JI8M 3GLIB 4YHHM 3I01M 3TWKA 2R62A 1WJ7A 3U5ZB 1NNJA 2QPAA 3C3DA 3U6LA 3FKEA 4LF6M 2WSFF 2Y21A 1E32A 1VEJA 2LTUA 2KZSA 3ILKA 3GLFB 2QBYA 3UJNA 1GABA 1QDRA 4X66M 4JXJA 4G4QA 2EJSA 2HKJA 3IG8A 4W5WA 3DZDA 5KPTA 4CIZA 4AW4A 2JZ1A 2LVQD 2X4AA 4EIWA 2UXCM 1T3TA 4DV2M 3BXWA 3GQ4A 4DV7M 2VF8A 2V1UA 2KNAA 3GPUA 5EJCA 1HNZM 1PJQA 3HX3A 4JI2M 3SASA 2HHHM 5E6JA 2JY8A 2JXNA 5KO3A 1G41A 2EUCA 3A42A 2L4FA 2XSZD 2RGOA 2L09A 1PRBA 3A45A 4LJ5A 1L2DA 4MGKE 4MH0E 2Y0QA 3HHYA 3EIHA 4DV6M 4L8RC 3J7BA 4GIPA 4QNRA 2HL7A 2ZBKB 2R45A 3A98B 3SAWA 1SXJC 4KODA 2CV0A 4D81A 4JI7M 2DZLA 2D7EA 4JI5M 2DVWB 4AG5A 1HT1E 3GRUA 4DBGB 4MGYE 3SHFA 3AV0A 2YNMD 1H6UA 1OKSA 4LZJA 4QNMA 3W67A 3QYBA 2EO2A 2L7IA 2L2DA 1DGFA 1WHCA 5E26A 2GNOA 1JQJC 4M9XA 3U6QA 2Z7JA 1HQYE 4IBJA 4LF4M 1WGLA 1Z5AA 4FWDA 2L4EA 2EKKA 2G8LA 2JA2A 5EXTA 1R7RA 2KXEA 1Q02A 1HNXM 1VQ1A 2CE7A 1IXSB 2CHGA 3CF2A 5C18A 3MHVC 4GRIA 1W5TA 4FW9A 1DGBA 3KW6A 4MB7A 4HL4A 4JI3M 3KOWE 3UGJA 1TH2A 2X8AA 3FRIA 3FUTA 4XGIA 3GRRA 4HEOA 5DYGA 2Z8YM 3H4MA 3WHKA 2LWXA 3HWSA 3J81S 2CEAA 2NQ8C 3E4RA 3K9PA 2QZ4A 2CHQA 2R6FA 2ZAOA 4GC5A 1IY0A 1OAOC 3TWLA 4JI0M 2LVAA 2DENA 2DWZB 3W68A 2DHYA 5JI3E 4LFCM 1K82A 3GQ5A 2CV1A 4LJAA 3CGWA 5EXPA 2KZUA 1DO0A 3C58A 5LMNM 1XHBA 1QZEA 4G4RA 1D0LA 2OQ4A 3U6SA 4DV4M 3HGIA 2R46A 1VDLA 4M9ZA 1RU3A 2HWJA 4L4UA 1WXQA 3LMMA 1Z5BA 5KQDA 2F5NA 4R3DA 2P5TA 2X49A 3R8FA 4B3MM 3AL0C 1N33M 1QDTA 3HU2A 4IBEA 3U6CA 2VIIA 4NRVA 4Z6YA 2VF7A 3C9PA 1IN5A 1E9SA 2XF3A 4I5SA 1NNUC 4LGYA 2JP7A 1YE9A 4XBOA 3SFZA 2C9CA 1QUTA 4B7GA 3SAVA 2DXIA 4FCVA 1SXJA 4DV3M 3EIEA 5KQ8A 4PDIA 1NHWC 2KEBA 2VDBB 1V92A 1HQCA 4ITQA 4MGHA 2DAIA 4DUYM 1DGHA 3AOEC 5F3WA 2JNHA 4IBIA 3UZUA 3GLHA 3LVWA 4IJEA 2R44A 3RGSA 3LCVB 4LF7M 4DR4M 1J09A 3FYCA 3KVWA 3GRYA 2DWLA 4RF0A 3KSXA 1Z5CA 3W0FA 4FVMA 2G5GX 3D8BA 1YLAA 2K47A 3B9PA 3TPZA 1F4IA 5ITQA 1HR0M 4DUZM 3TE6A 4DV0M 1QAQA 1D2NA 3PVSA 3MJ5A 4FCWA 4WP2A 4QHTA 3AKZA 4JI1M 1FJGM 3U5ZA 1TTEA 3SYLA 5L8RF 1N77A 3T15A 5EP1A 1V33A 2XSZA 4B7FA 1OFIA 3FTCA 4L78A 4PDGA 2XLJA 1K3WA 3RGPA 4CISA 3HY5A 1R4GA 3IHPA 4B3TM 1XNQM 4JI6M 3KDSE 3LVVA 2LHGA 2F4VM 3SYKA 5EXXA 3J7AS 2K0BX 1IN4A 1IXZA 2O01F 2C98A 2A5YB 2CP8A 2D7GA 1IBLM 1ZMWA 2FFJA 5KPRA 3J27B 4KT0F 4GC9A 3SAUA 4IBCA 3GPYA 2RGHA 3V76A 1QUSA 3GO8A 1GL7A 5H37D 1I4WA 2QENA 4GH9A 3U6EA 3B7ZA 4A3VB 2LVNC 1NJGA 4PCZA 3NBXX 1GVNA 1SXJD 1K3XA 2R18A 2KNZA 3GLHE 2BJVA 4BLCA 2QHOB 4XK8F 1N34M 1IY2A 4AQYM 4B3SM 4LJ6A 3HHZA 2XFTA 2R65A 4L15A 5KPZA 4FD2A 2W82A 3VK7A 2OOBA 2DAMA 2FNAA 1J5EM 1IBKM 3K2LA 1JR3E 3L26A 2KNVA 3KOXE 5EP4A 1OTRA 1GJTA 3C3EA 4OVZB 5DFLA 1TH4A 4LFAM 2LXEA 3KP1E 1XB2B 4IBGA 4JI4M 2AHMA 3ZQJA 2CHVA 4Y28F 4UN2B 3RE8A 1PJJA 1HJPA 3TQSA 5ITUA 3GLHB 2UXDM 1ZAEA 3CF0A 5FTMA 1D0MA 4AZFA 3E46A 3AOEA 3L2AA 3FUWA 4M9SA 4LRSA 1UFZA 3PXGA 1XNRM 3H4JA 4P17A 1PJSA 4NRWA 3VDUA 4JV5M 3T6PA 1E94E 4JN6A 4DR3M 1WR1B 5FLXS 4L6V6 1EFUB 1IY1A 4DR6M 3B7NA 4BBAA 2QSFX 1S3SA 1G59A 1IXSA 2HCBA 1GO5A 5DYIA 1IM2A 5EP3A 4LG2A 3U6DA 1NHGC 3QYEA 2B3TA 4NC6A 4KLNA 3FTFA 2XZUA 2FH0A 5FSWA 3GPPA 2GQFA 3AOGA 1IXRC 1OIPA 5DNYA 2Z4RA 4X62M 1TR8A 4GMQA 4X65M 4OX9M 5GKNA 3TL4X 5ITTA 2J7NA 1XXHB 2Z4SA 2DZOB 3R9XB 4FWHA 4OW0A 3CTWB 4G4OA 3M7GA 1Z59A 1QZMA 2N35A 1JB0F 3GP1A 2CUZA 3FRHA 1NY5A 2J5YA 1QQWA 3AFHA 3E9SA 3JR4A 1LV7A 1IN8A 2LH0A 4HLQA 3SBJA 1JR3D 1ZV1A 3DOAA 1AUAA 2R4EA 3HKPA 4TUWA 1J7KA 2ZTDA 3A46A 3KOZE 1ORYB 3PNVA 2BNKA 3PFIA 2R4JA 2BWEA 2C9OA 2KDLA 3FE3A 3T38A 3KS8A 3PNYA 4S12A 1N36M 1OQYA 3K92A 2OPFA 2ZM6M 4II7A 2VQEM 3KXEC 1G4AE 4IBFA 3FUXA 3JAMS 1IN7A 1D0KA 2DWNA 2ZTCA 1KFVA 3ZH9B 4X64M 3THGA 5ITRA 1PJTA 2QQ8A 3DA1A 2QCUA 1IFYA 3U6PA 4NXNM 1NVMA 1VG5A 2I7PA 1HT2E 1IN6A 3LQRA 3GLGB 3GLGA 4RNAA 8CATA 4RF1A 2M60A 5BR8M 3FTEA 2K6BA 1OFHA 3I51A 2QNJA 4L16A 1Y8GA 1L2CA 3SC3A 1TDZA 4FWGA 2MGWA 1R2YA 3L28A 3K9OA 3HU3A 4LCBA 1A5TA 1NO1A 2LNHC 3GLFA 1PJIA 2FS1A 4RKUF 3VKGA 2DNAA 2DI0A 2DWMA 2E5LM 2RKOA 4P16A 2I7NA 2JY6B 3SATA 2HAKA 4AKIA 2LBCA 3B74A 4LGMA 3GQ3A 1GLNA 1VEKA 3LW5F 4D80A 1C7YA 4GHAA 2J7OA 2DZNB 4I4LA 4MGIE 4LFBM 2UXBM 4QOSA 2O5RA 4LJ4A 1IQPA 1CUKA 3LCUA 4WURA 2CV2A 1WGNA 1DGGA 2EA0A 2UUAM 3K1JA 4LF9M 1SXJE 1I94M 2JUJA 1YSYA 4GKJM
chains in the Genus database with same CATH topology
5DFLA 1ZMUA 2R0IA 1XB2B 3GLFE 1WIVA 1MN3A 4UN2B 1AIPC 1HJPA 3FRIA 4HEOA 4Q7JA 3K9PA 2BWBA 1DO2A 3E46A 3GLGE 1UFZA 3H4JA 2LVAA 2DAEA 2DENA 1E94E 2DHYA 2JY5A 3T6PA 2EKFA 2DAKA 1WR1B 1DO0A 1EFUB 1QZEA 2MR9A 1G3IA 2QSFX 2DAGA 1IXSA 1GO5A 1IM2A 1VDLA 3F92A 3IECA 1T6OA 2B3TA 2HWJA 2JZ0A 3B89A 2H5XA 1OAIA 2DKLA 1KYIA 1P3QQ 2OOAA 2MROB 1TR8A 1OTRA 3GLIE 2JY7A 4R71A 4GEWA 2JP7A 2O25A 2LVPC 1WJ7A 3FRHA 4F2LA 1ZMVA 2MJ5B 2RRUA 1V92A 1VEJA 2LTUA 2DAIA 2JNHA 1NV8A 1ZV1A 2EJSA 2LVOC 3LCVB 2KHHA 3MMPA 2JZ1A 2LVQD 2ZTDA 2BWEA 1YLAA 4F1IA 2WZJA 2KNAA 3FE3A 1F4IA 1OQYA 1VEGA 2OO9A 4WP2A 1TTEA 5JI2E 1G4AE 2JY8A 1G41A 2L4FA 2ZTCA 3IHPA 1R4GA 1SG9A 2CWBA 1IFYA 2K0BX 1VG5A 1HT2E 2CP8A 1XXHE 1ZMWA 2G3QA 1BVSA 2DZLA 2QNJA 1Y8GA 1HT1E 1DV0A 2MGWA 1NV9A 4DBGB 3K9OA 1A5TA 1PGYA 2K9DA 2LVNC 2DNAA 4G3OA 1OKSA 2DI0A 2JY6B 2HAKA 2KNZA 2LBCA 3GLHE 1C7YA 1VEKA 2QHOB 2L2DA 1WHCA 1CUKA 3LCUA 3E21A 1WGNA 1HQYE 1WGLA 2DAMA 2L4EA 2OOBA 2EKKA 1T43A 2JUJA 1JR3E 3BBZA 2KNVA 1Q02A 1VQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFL A;  1ZMU A;  2R0I A;  1XB2 B;  3GLF E;  1WIV A;  1MN3 A;  4UN2 B;  1AIP C;  1HJP A;  3FRI A;  4HEO A;  4Q7J A;  3K9P A;  2BWB A;  1DO2 A;  3E46 A;  3GLG E;  1UFZ A;  3H4J A;  2LVA A;  2DAE A;  2DEN A;  1E94 E;  2DHY A;  2JY5 A;  3T6P A;  2EKF A;  2DAK A;  1WR1 B;  1DO0 A;  1EFU B;  1QZE A;  2MR9 A;  1G3I A;  2QSF X;  2DAG A;  1IXS A;  1GO5 A;  1IM2 A;  1VDL A;  3F92 A;  3IEC A;  1T6O A;  2B3T A;  2HWJ A;  2JZ0 A;  3B89 A;  2H5X A;  1OAI A;  2DKL A;  1KYI A;  1P3Q Q;  2OOA A;  2MRO B;  1TR8 A;  1OTR A;  3GLI E;  2JY7 A;  4R71 A;  4GEW A;  2JP7 A;  2O25 A;  2LVP C;  1WJ7 A;  3FRH A;  4F2L A;  1ZMV A;  2MJ5 B;  2RRU A;  1V92 A;  1VEJ A;  2LTU A;  2DAI A;  2JNH A;  1NV8 A;  1ZV1 A;  2EJS A;  2LVO C;  3LCV B;  2KHH A;  3MMP A;  2JZ1 A;  2LVQ D;  2ZTD A;  2BWE A;  1YLA A;  4F1I A;  2WZJ A;  2KNA A;  3FE3 A;  1F4I A;  1OQY A;  1VEG A;  2OO9 A;  4WP2 A;  1TTE A;  5JI2 E;  1G4A E;  2JY8 A;  1G41 A;  2L4F A;  2ZTC A;  3IHP A;  1R4G A;  1SG9 A;  2CWB A;  1IFY A;  2K0B X;  1VG5 A;  1HT2 E;  2CP8 A;  1XXH E;  1ZMW A;  2G3Q A;  1BVS A;  2DZL A;  2QNJ A;  1Y8G A;  1HT1 E;  1DV0 A;  2MGW A;  1NV9 A;  4DBG B;  3K9O A;  1A5T A;  1PGY A;  2K9D A;  2LVN C;  2DNA A;  4G3O A;  1OKS A;  2DI0 A;  2JY6 B;  2HAK A;  2KNZ A;  2LBC A;  3GLH E;  1C7Y A;  1VEK A;  2QHO B;  2L2D A;  1WHC A;  1CUK A;  3LCU A;  3E21 A;  1WGN A;  1HQY E;  1WGL A;  2DAM A;  2L4E A;  2OOB A;  2EKK A;  1T43 A;  2JUJ A;  1JR3 E;  3BBZ A;  2KNV A;  1Q02 A;  1VQ1 A; 
#chains in the Genus database with same CATH topology
 1ZMU A;  3TWM A;  2R0I A;  4NXM M;  1Q39 A;  5IT9 S;  4PT5 A;  4GIT A;  4DV1 M;  4I8O A;  3L29 A;  3J80 S;  1L2B A;  2XFS A;  1AIP C;  3FYD A;  3I4Y A;  4Q7J A;  2YR0 A;  3HHX A;  5LMU M;  1L1T A;  3Q8G A;  1XXH A;  2F5P A;  2Y20 A;  3FUU A;  1UM8 A;  1TH3 A;  3NBI A;  4Z8X A;  1Q3C A;  1PM5 A;  4LZZ A;  2DAE A;  3VKH A;  4DR1 M;  1QAN A;  2DAK A;  4AKH A;  2D7H A;  3HJ8 A;  3HZJ A;  4KHP M;  2MR9 A;  3I04 M;  5IWA M;  1ZQ9 A;  4LJ9 A;  1G3I A;  4GHL A;  2C99 A;  4LF8 M;  2LHC A;  3F92 A;  4DR7 M;  3MK6 A;  4OU7 A;  3NWL A;  3U6O A;  2H5X A;  4IIW A;  3FUV A;  2DKL A;  3ZCB B;  2OOA A;  4I81 A;  3KSJ A;  1DGH B;  4ANR A;  5EXS A;  3GLI E;  2V1C A;  2FE8 A;  2JY7 A;  2UU9 M;  4R71 A;  4MGZ E;  2XZF A;  2M5Z A;  3U60 A;  1QVR A;  4GEW A;  1GKI A;  2MH8 A;  4AI6 A;  3HHW A;  2LVP C;  1SXJ B;  1LTM A;  3WHL A;  2YFQ A;  3VFD A;  4BB9 A;  4F2L A;  4MM3 B;  5ITX A;  4K0K M;  1N78 A;  2F5O A;  1V34 A;  1ZMV A;  2MJ5 B;  2RRU A;  5FTL A;  3FTD A;  3KFU G;  4REZ A;  3VLF B;  4M0D A;  2QBY B;  4PD2 A;  1NV8 A;  1L8Q A;  2L7H A;  1EE8 A;  1L1Z A;  4QOZ C;  2LVO C;  2WSC F;  2KHH A;  3LQQ A;  3MMP A;  4LRT A;  2Z3X A;  4NL4 H;  3CF6 E;  3GLI A;  4CHT B;  2YQZ A;  3HJS A;  1MU5 A;  4FCT A;  2CFO A;  3M6A A;  1HNW M;  3AJI B;  3RFW A;  4D82 A;  1N32 M;  4F1I A;  2WZJ A;  2H1R A;  1VEG A;  2OO9 A;  4G4N A;  1NJF A;  3M0E A;  4DR5 M;  7CAT A;  3T1Y M;  3B7Q A;  5JI2 E;  3U61 A;  5FTJ A;  4B08 A;  1G8P A;  1N75 A;  3HU1 A;  3T1H M;  1NSF A;  3J2P B;  3HJQ A;  2C96 A;  3SHG B;  2DHR A;  4R7G A;  3D8L A;  1SG9 A;  2CWB A;  4NSO B;  4IBB A;  2ZAM A;  1QYR A;  2L6O A;  4OVZ A;  1XXH E;  2APL A;  3BOS A;  1KSF X;  2G3Q A;  1BVS A;  3Q8X A;  3SMP A;  5BPV A;  2FOI C;  1TGU A;  1FNN A;  1TDH A;  1IBM M;  4QHS A;  2V6Z M;  1DV0 A;  1EIJ A;  1MX0 A;  1NV9 A;  1NY6 A;  1QAO A;  5EQT A;  4LF5 M;  3L25 A;  4IBK A;  3GRV A;  1PGY A;  4AKG A;  2K9D A;  5FTK A;  5EP2 A;  2UUC M;  4G3O A;  3W0L B;  2Y0T A;  4ZPX A;  2KRU A;  3K8Z A;  1C1K A;  1G71 A;  3SAR A;  2CRU A;  3ZC7 B;  1MJG M;  1R5L A;  3QAU A;  4M0W A;  5ITX E;  1GJS A;  3E21 A;  4CGY B;  4CJ6 A;  1OJL A;  1GL6 A;  1Z6T A;  3IG5 A;  3GPX A;  1T43 A;  4AG6 A;  4LY6 A;  1JR3 A;  3BBZ A;  2BJW A;  4NSR A;  1OIZ A;  2ERC A;  3UK6 A;  4YY3 M;  4DR2 M;  2KRK A;  3KOY E;  3GLF E;  1WIV A;  1MN3 A;  1VDD A;  1W5S A;  4LJ8 A;  3VDP A;  1YUB A;  2JWS A;  4IJF A;  2VQF M;  2XGN A;  2Q2E B;  2XEP A;  1R2Z A;  1XWI A;  3KS4 A;  3L27 A;  2BWB A;  1DO2 A;  3UMM A;  5IRE B;  4DV5 M;  1X37 A;  3U6M A;  1XMO M;  2UUB M;  3I4V A;  4KO8 A;  3GLG E;  2WSE F;  5ITY A;  3DFZ A;  2ZAN A;  2KW0 A;  4B3R M;  2JY5 A;  2EKF A;  2KA6 B;  2F5Q A;  1TF0 B;  4JYA M;  4WW0 A;  2C5R A;  2XH9 A;  1R6B X;  4NOO B;  3SMS A;  3U60 B;  4B7H A;  2DAG A;  3QWL A;  3OTO M;  3JR5 A;  1XC8 A;  1QAM A;  3IEC A;  5A2Q S;  3U61 B;  1T6O A;  2JZ0 A;  1XMQ M;  1Q3B A;  3B89 A;  3KP0 E;  1OAI A;  1E9R A;  5IZ7 D;  5C1B A;  1KYI A;  3VK8 A;  1P3Q Q;  2MRO B;  4GKK M;  2QP9 X;  2F5S A;  2O25 A;  4G6Z A;  5FTN A;  4LJ7 A;  3FD9 A;  4IBD A;  4JI8 M;  3GLI B;  4YHH M;  3I01 M;  3TWK A;  2R62 A;  1WJ7 A;  3U5Z B;  1NNJ A;  2QPA A;  3C3D A;  3U6L A;  3FKE A;  4LF6 M;  2WSF F;  2Y21 A;  1E32 A;  1VEJ A;  2LTU A;  2KZS A;  3ILK A;  3GLF B;  2QBY A;  3UJN A;  1GAB A;  1QDR A;  4X66 M;  4JXJ A;  4G4Q A;  2EJS A;  2HKJ A;  3IG8 A;  4W5W A;  3DZD A;  5KPT A;  4CIZ A;  4AW4 A;  2JZ1 A;  2LVQ D;  2X4A A;  4EIW A;  2UXC M;  1T3T A;  4DV2 M;  3BXW A;  3GQ4 A;  4DV7 M;  2VF8 A;  2V1U A;  2KNA A;  3GPU A;  5EJC A;  1HNZ M;  1PJQ A;  3HX3 A;  4JI2 M;  3SAS A;  2HHH M;  5E6J A;  2JY8 A;  2JXN A;  5KO3 A;  1G41 A;  2EUC A;  3A42 A;  2L4F A;  2XSZ D;  2RGO A;  2L09 A;  1PRB A;  3A45 A;  4LJ5 A;  1L2D A;  4MGK E;  4MH0 E;  2Y0Q A;  3HHY A;  3EIH A;  4DV6 M;  4L8R C;  3J7B A;  4GIP A;  4QNR A;  2HL7 A;  2ZBK B;  2R45 A;  3A98 B;  3SAW A;  1SXJ C;  4KOD A;  2CV0 A;  4D81 A;  4JI7 M;  2DZL A;  2D7E A;  4JI5 M;  2DVW B;  4AG5 A;  1HT1 E;  3GRU A;  4DBG B;  4MGY E;  3SHF A;  3AV0 A;  2YNM D;  1H6U A;  1OKS A;  4LZJ A;  4QNM A;  3W67 A;  3QYB A;  2EO2 A;  2L7I A;  2L2D A;  1DGF A;  1WHC A;  5E26 A;  2GNO A;  1JQJ C;  4M9X A;  3U6Q A;  2Z7J A;  1HQY E;  4IBJ A;  4LF4 M;  1WGL A;  1Z5A A;  4FWD A;  2L4E A;  2EKK A;  2G8L A;  2JA2 A;  5EXT A;  1R7R A;  2KXE A;  1Q02 A;  1HNX M;  1VQ1 A;  2CE7 A;  1IXS B;  2CHG A;  3CF2 A;  5C18 A;  3MHV C;  4GRI A;  1W5T A;  4FW9 A;  1DGB A;  3KW6 A;  4MB7 A;  4HL4 A;  4JI3 M;  3KOW E;  3UGJ A;  1TH2 A;  2X8A A;  3FRI A;  3FUT A;  4XGI A;  3GRR A;  4HEO A;  5DYG A;  2Z8Y M;  3H4M A;  3WHK A;  2LWX A;  3HWS A;  3J81 S;  2CEA A;  2NQ8 C;  3E4R A;  3K9P A;  2QZ4 A;  2CHQ A;  2R6F A;  2ZAO A;  4GC5 A;  1IY0 A;  1OAO C;  3TWL A;  4JI0 M;  2LVA A;  2DEN A;  2DWZ B;  3W68 A;  2DHY A;  5JI3 E;  4LFC M;  1K82 A;  3GQ5 A;  2CV1 A;  4LJA A;  3CGW A;  5EXP A;  2KZU A;  1DO0 A;  3C58 A;  5LMN M;  1XHB A;  1QZE A;  4G4R A;  1D0L A;  2OQ4 A;  3U6S A;  4DV4 M;  3HGI A;  2R46 A;  1VDL A;  4M9Z A;  1RU3 A;  2HWJ A;  4L4U A;  1WXQ A;  3LMM A;  1Z5B A;  5KQD A;  2F5N A;  4R3D A;  2P5T A;  2X49 A;  3R8F A;  4B3M M;  3AL0 C;  1N33 M;  1QDT A;  3HU2 A;  4IBE A;  3U6C A;  2VII A;  4NRV A;  4Z6Y A;  2VF7 A;  3C9P A;  1IN5 A;  1E9S A;  2XF3 A;  4I5S A;  1NNU C;  4LGY A;  2JP7 A;  1YE9 A;  4XBO A;  3SFZ A;  2C9C A;  1QUT A;  4B7G A;  3SAV A;  2DXI A;  4FCV A;  1SXJ A;  4DV3 M;  3EIE A;  5KQ8 A;  4PDI A;  1NHW C;  2KEB A;  2VDB B;  1V92 A;  1HQC A;  4ITQ A;  4MGH A;  2DAI A;  4DUY M;  1DGH A;  3AOE C;  5F3W A;  2JNH A;  4IBI A;  3UZU A;  3GLH A;  3LVW A;  4IJE A;  2R44 A;  3RGS A;  3LCV B;  4LF7 M;  4DR4 M;  1J09 A;  3FYC A;  3KVW A;  3GRY A;  2DWL A;  4RF0 A;  3KSX A;  1Z5C A;  3W0F A;  4FVM A;  2G5G X;  3D8B A;  1YLA A;  2K47 A;  3B9P A;  3TPZ A;  1F4I A;  5ITQ A;  1HR0 M;  4DUZ M;  3TE6 A;  4DV0 M;  1QAQ A;  1D2N A;  3PVS A;  3MJ5 A;  4FCW A;  4WP2 A;  4QHT A;  3AKZ A;  4JI1 M;  1FJG M;  3U5Z A;  1TTE A;  3SYL A;  5L8R F;  1N77 A;  3T15 A;  5EP1 A;  1V33 A;  2XSZ A;  4B7F A;  1OFI A;  3FTC A;  4L78 A;  4PDG A;  2XLJ A;  1K3W A;  3RGP A;  4CIS A;  3HY5 A;  1R4G A;  3IHP A;  4B3T M;  1XNQ M;  4JI6 M;  3KDS E;  3LVV A;  2LHG A;  2F4V M;  3SYK A;  5EXX A;  3J7A S;  2K0B X;  1IN4 A;  1IXZ A;  2O01 F;  2C98 A;  2A5Y B;  2CP8 A;  2D7G A;  1IBL M;  1ZMW A;  2FFJ A;  5KPR A;  3J27 B;  4KT0 F;  4GC9 A;  3SAU A;  4IBC A;  3GPY A;  2RGH A;  3V76 A;  1QUS A;  3GO8 A;  1GL7 A;  5H37 D;  1I4W A;  2QEN A;  4GH9 A;  3U6E A;  3B7Z A;  4A3V B;  2LVN C;  1NJG A;  4PCZ A;  3NBX X;  1GVN A;  1SXJ D;  1K3X A;  2R18 A;  2KNZ A;  3GLH E;  2BJV A;  4BLC A;  2QHO B;  4XK8 F;  1N34 M;  1IY2 A;  4AQY M;  4B3S M;  4LJ6 A;  3HHZ A;  2XFT A;  2R65 A;  4L15 A;  5KPZ A;  4FD2 A;  2W82 A;  3VK7 A;  2OOB A;  2DAM A;  2FNA A;  1J5E M;  1IBK M;  3K2L A;  1JR3 E;  3L26 A;  2KNV A;  3KOX E;  5EP4 A;  1OTR A;  1GJT A;  3C3E A;  4OVZ B;  5DFL A;  1TH4 A;  4LFA M;  2LXE A;  3KP1 E;  1XB2 B;  4IBG A;  4JI4 M;  2AHM A;  3ZQJ A;  2CHV A;  4Y28 F;  4UN2 B;  3RE8 A;  1PJJ A;  1HJP A;  3TQS A;  5ITU A;  3GLH B;  2UXD M;  1ZAE A;  3CF0 A;  5FTM A;  1D0M A;  4AZF A;  3E46 A;  3AOE A;  3L2A A;  3FUW A;  4M9S A;  4LRS A;  1UFZ A;  3PXG A;  1XNR M;  3H4J A;  4P17 A;  1PJS A;  4NRW A;  3VDU A;  4JV5 M;  3T6P A;  1E94 E;  4JN6 A;  4DR3 M;  1WR1 B;  5FLX S;  4L6V 6;  1EFU B;  1IY1 A;  4DR6 M;  3B7N A;  4BBA A;  2QSF X;  1S3S A;  1G59 A;  1IXS A;  2HCB A;  1GO5 A;  5DYI A;  1IM2 A;  5EP3 A;  4LG2 A;  3U6D A;  1NHG C;  3QYE A;  2B3T A;  4NC6 A;  4KLN A;  3FTF A;  2XZU A;  2FH0 A;  5FSW A;  3GPP A;  2GQF A;  3AOG A;  1IXR C;  1OIP A;  5DNY A;  2Z4R A;  4X62 M;  1TR8 A;  4GMQ A;  4X65 M;  4OX9 M;  5GKN A;  3TL4 X;  5ITT A;  2J7N A;  1XXH B;  2Z4S A;  2DZO B;  3R9X B;  4FWH A;  4OW0 A;  3CTW B;  4G4O A;  3M7G A;  1Z59 A;  1QZM A;  2N35 A;  1JB0 F;  3GP1 A;  2CUZ A;  3FRH A;  1NY5 A;  2J5Y A;  1QQW A;  3AFH A;  3E9S A;  3JR4 A;  1LV7 A;  1IN8 A;  2LH0 A;  4HLQ A;  3SBJ A;  1JR3 D;  1ZV1 A;  3DOA A;  1AUA A;  2R4E A;  3HKP A;  4TUW A;  1J7K A;  2ZTD A;  3A46 A;  3KOZ E;  1ORY B;  3PNV A;  2BNK A;  3PFI A;  2R4J A;  2BWE A;  2C9O A;  2KDL A;  3FE3 A;  3T38 A;  3KS8 A;  3PNY A;  4S12 A;  1N36 M;  1OQY A;  3K92 A;  2OPF A;  2ZM6 M;  4II7 A;  2VQE M;  3KXE C;  1G4A E;  4IBF A;  3FUX A;  3JAM S;  1IN7 A;  1D0K A;  2DWN A;  2ZTC A;  1KFV A;  3ZH9 B;  4X64 M;  3THG A;  5ITR A;  1PJT A;  2QQ8 A;  3DA1 A;  2QCU A;  1IFY A;  3U6P A;  4NXN M;  1NVM A;  1VG5 A;  2I7P A;  1HT2 E;  1IN6 A;  3LQR A;  3GLG B;  3GLG A;  4RNA A;  8CAT A;  4RF1 A;  2M60 A;  5BR8 M;  3FTE A;  2K6B A;  1OFH A;  3I51 A;  2QNJ A;  4L16 A;  1Y8G A;  1L2C A;  3SC3 A;  1TDZ A;  4FWG A;  2MGW A;  1R2Y A;  3L28 A;  3K9O A;  3HU3 A;  4LCB A;  1A5T A;  1NO1 A;  2LNH C;  3GLF A;  1PJI A;  2FS1 A;  4RKU F;  3VKG A;  2DNA A;  2DI0 A;  2DWM A;  2E5L M;  2RKO A;  4P16 A;  2I7N A;  2JY6 B;  3SAT A;  2HAK A;  4AKI A;  2LBC A;  3B74 A;  4LGM A;  3GQ3 A;  1GLN A;  1VEK A;  3LW5 F;  4D80 A;  1C7Y A;  4GHA A;  2J7O A;  2DZN B;  4I4L A;  4MGI E;  4LFB M;  2UXB M;  4QOS A;  2O5R A;  4LJ4 A;  1IQP A;  1CUK A;  3LCU A;  4WUR A;  2CV2 A;  1WGN A;  1DGG A;  2EA0 A;  2UUA M;  3K1J A;  4LF9 M;  1SXJ E;  1I94 M;  2JUJ A;  1YSY A;  4GKJ M; 
#chains in the Genus database with same CATH homology
 5DFL A;  1ZMU A;  2R0I A;  1XB2 B;  3GLF E;  1WIV A;  1MN3 A;  4UN2 B;  1AIP C;  1HJP A;  3FRI A;  4HEO A;  4Q7J A;  3K9P A;  2BWB A;  1DO2 A;  3E46 A;  3GLG E;  1UFZ A;  3H4J A;  2LVA A;  2DAE A;  2DEN A;  1E94 E;  2DHY A;  2JY5 A;  3T6P A;  2EKF A;  2DAK A;  1WR1 B;  1DO0 A;  1EFU B;  1QZE A;  2MR9 A;  1G3I A;  2QSF X;  2DAG A;  1IXS A;  1GO5 A;  1IM2 A;  1VDL A;  3F92 A;  3IEC A;  1T6O A;  2B3T A;  2HWJ A;  2JZ0 A;  3B89 A;  2H5X A;  1OAI A;  2DKL A;  1KYI A;  1P3Q Q;  2OOA A;  2MRO B;  1TR8 A;  1OTR A;  3GLI E;  2JY7 A;  4R71 A;  4GEW A;  2JP7 A;  2O25 A;  2LVP C;  1WJ7 A;  3FRH A;  4F2L A;  1ZMV A;  2MJ5 B;  2RRU A;  1V92 A;  1VEJ A;  2LTU A;  2DAI A;  2JNH A;  1NV8 A;  1ZV1 A;  2EJS A;  2LVO C;  3LCV B;  2KHH A;  3MMP A;  2JZ1 A;  2LVQ D;  2ZTD A;  2BWE A;  1YLA A;  4F1I A;  2WZJ A;  2KNA A;  3FE3 A;  1F4I A;  1OQY A;  1VEG A;  2OO9 A;  4WP2 A;  1TTE A;  5JI2 E;  1G4A E;  2JY8 A;  1G41 A;  2L4F A;  2ZTC A;  3IHP A;  1R4G A;  1SG9 A;  2CWB A;  1IFY A;  2K0B X;  1VG5 A;  1HT2 E;  2CP8 A;  1XXH E;  1ZMW A;  2G3Q A;  1BVS A;  2DZL A;  2QNJ A;  1Y8G A;  1HT1 E;  1DV0 A;  2MGW A;  1NV9 A;  4DBG B;  3K9O A;  1A5T A;  1PGY A;  2K9D A;  2LVN C;  2DNA A;  4G3O A;  1OKS A;  2DI0 A;  2JY6 B;  2HAK A;  2KNZ A;  2LBC A;  3GLH E;  1C7Y A;  1VEK A;  2QHO B;  2L2D A;  1WHC A;  1CUK A;  3LCU A;  3E21 A;  1WGN A;  1HQY E;  1WGL A;  2DAM A;  2L4E A;  2OOB A;  2EKK A;  1T43 A;  2JUJ A;  1JR3 E;  3BBZ A;  2KNV A;  1Q02 A;  1VQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...