2DENA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
molecule tags Protein binding
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2denA00
1OQYA 4F1IA 3GLIE 1YLAA 2B3TA 2JUJA 1Y8GA 2WZJA 4G3OA 2DAIA 2OOAA 4R71A 1VQ1A 1G4AE 3E46A 1A5TA 1KYIA 2L4EA 1NV9A 2DAKA 3H4JA 1CUKA 2EKKA 2G3QA 3GLGE 5JI2E 1TTEA 2DAMA 4HEOA 4DBGB 2MGWA 1VEGA 1PGYA 2QNJA 3IECA 2LVQD 1OTRA 2DI0A 1NV8A 1ZMWA 2JY6B 2QSFX 2OO9A 2K9DA 2DHYA 2JP7A 1HJPA 2DKLA 3IHPA 1QZEA 2LVNC 2LVOC 1HT2E 1T43A 1WIVA 3GLHE 1P3QQ 3FRIA 1WGLA 3LCUA 2JY8A 2JNHA 1WGNA 2JZ0A 2R0IA 2O25A 1JR3E 1WR1B 1VEJA 2HWJA 1XB2B 2KNZA 2H5XA 4Q7JA 2L2DA 1UFZA 2QHOB 2JZ1A 1HT1E 2BWBA 2EKFA 1IM2A 1AIPC 1F4IA 1G3IA 1C7YA 2DZLA 1MN3A 1IXSA 1XXHE 1EFUB 1DO2A 1IFYA 2DAGA 1ZMVA 3FRHA 1BVSA 1GO5A 2KHHA 2HAKA 1R4GA 1DO0A 2RRUA 2ZTDA 2CP8A 3K9OA 3FE3A 2KNVA 2K0BX 3MMPA 2DENA 1DV0A 1E94E 2JY5A 1VDLA 2BWEA 2OOBA 3E21A 3F92A 2JY7A 1VEKA 1OAIA 3BBZA 2DNAA 1ZMUA 2LVPC 3B89A 5DFLA 1SG9A 4GEWA 2L4FA 1Q02A 1VG5A 3LCVB 2CWBA 2EJSA 1ZV1A 2LTUA 1V92A 2MROB 1WJ7A 1T6OA 2MR9A 2ZTCA 4UN2B 3K9PA 1TR8A 1OKSA 1HQYE 2LBCA 4WP2A 3T6PA 2MJ5B 2LVAA 2KNAA 1WHCA 1G41A 3GLFE 4F2LA 2DAEA
chains in the Genus database with same CATH superfamily
1QUTA 4I4LA 2CFOA 4F1IA 1N75A 3GLIE 4IBGA 2B3TA 1Y8GA 2WZJA 2J7NA 1MJGM 4AKHA 1A5TA 1GJTA 5FLXS 1QDTA 4K0KM 1KYIA 3AL0C 2XGNA 4DV3M 3LVWA 3M0EA 2I7NA 4GRIA 4IBDA 2FS1A 4IJEA 2R65A 2CEAA 4A3VB 3T1YM 3SAUA 1TTEA 5LMUM 3BOSA 1PJIA 2X4AA 2MGWA 4MGYE 3L25A 2Z7JA 4KT0F 1PGYA 3IECA 4GC5A 1E9SA 1G8PA 1OTRA 4OW0A 1SXJD 4JI6M 3KSXA 1IN7A 4B08A 3GLIB 3GPPA 8CATA 2BJVA 3U6OA 2JY6B 2Z8YM 1I94M 4Y28F 4JYAM 2K9DA 2DHYA 3E9SA 4MGZE 4NRWA 3EIHA 1HJPA 1PJJA 4DR4M 4GKJM 1Z5CA 2DKLA 1DGHA 2XSZA 2AHMA 3FTEA 3KFUG 4M9ZA 1QZEA 3ZQJA 4IIWA 3K92A 2L6OA 2UUAM 3FRIA 2H1RA 4MH0E 2QBYB 4DV0M 2R62A 2JZ0A 2Z4RA 4AQYM 3U6MA 1V34A 3U5ZA 1N78A 2R4JA 3MJ5A 2D7GA 1NO1A 2HWJA 4B7GA 4L6V6 1S3SA 1QQWA 4DV6M 1TGUA 4NL4H 4L78A 3W67A 1XMOM 4NOOB 1KSFX 3TWLA 1XC8A 2C98A 3KOXE 2LXEA 3GRUA 3L28A 5KQ8A 3U61B 2XH9A 3GO8A 1SXJE 2EKFA 3TWKA 4FW9A 1AIPC 4B7FA 1HNZM 4KHPM 1GABA 4AI6A 2L7HA 1G3IA 1Z6TA 3FYDA 5ITUA 3J27B 1Q39A 3A45A 4FCTA 4GITA 1MN3A 2ERCA 5EXPA 1ZQ9A 4QHTA 3J2PB 1DO2A 1IN6A 1QVRA 3D8LA 3FUXA 3U6SA 1R2YA 2CV2A 3A42A 1BVSA 5KPZA 1NSFA 3K8ZA 1NJGA 4GH9A 2Y21A 5FTMA 2LWXA 2K47A 2RRUA 4FD2A 2RGHA 3TL4X 3VFDA 4YY3M 2VQFM 2E5LM 1OIZA 2KNVA 2K0BX 5E6JA 3KOWE 2LH0A 3A98B 4OX9M 2ZANA 3CF6E 2OQ4A 4JI2M 1I4WA 4FCWA 2HL7A 4LZZA 4X65M 3GPXA 3BBZA 1VDDA 5ITTA 3PNVA 5EP2A 1XWIA 4M0WA 2V1UA 1EIJA 3T15A 3U60A 3UJNA 3B74A 3AKZA 1L2BA 2QPAA 4CHTB 4AKGA 1R6BX 3GLHB 2HKJA 4L15A 2EJSA 4AZFA 1L1TA 1YSYA 3SHFA 1H6UA 2C96A 4DR3M 1TR8A 2JWSA 1OKSA 3HJQA 4MGIE 3HHXA 1ZAEA 3GQ5A 2ZAOA 3U6DA 3SBJA 3JAMS 4REZA 4M9XA 2KZSA 2DZOB 4LF4M 1LTMA 3GRYA 3FUWA 3PVSA 4QHSA 3GLFE 1QYRA 3ILKA 4GMQA 4M0DA 4IJFA 2DAEA 1L8QA 1OQYA 3J7BA 3ZCBB 4AG5A 4DR5M 2FOIC 1IQPA 2JUJA 4FVMA 5EP3A 3VK7A 1R2ZA 1XXHB 3HKPA 1G4AE 1IXSB 3E46A 3HJ8A 3TE6A 2QENA 4IBEA 3SAWA 3AV0A 2L4EA 3B9PA 3H4JA 3M6AA 5FTNA 3HJSA 4LFBM 1GJSA 1CUKA 1JR3A 3J80S 5IREB 1NHWC 5A2QS 5JI2E 3K1JA 3GLGE 3U6QA 1WXQA 4TUWA 1TF0B 1K3XA 4JI0M 1GL7A 2XFSA 3KXEC 2ZBKB 2DWZB 2DWNA 3OTOM 3GLFB 4FCVA 5EJCA 3H4MA 3SMPA 1NV8A 5EXSA 2DWLA 1TDHA 3SFZA 3I04M 1N77A 1HNXM 4KO8A 3R8FA 4JI5M 4Z6YA 3JR4A 3M7GA 2XSZD 4LY6A 4CJ6A 4D82A 1OIPA 2LVOC 2R4EA 3BXWA 3A46A 4DV4M 4DV5M 4LF7M 1WIVA 3RGSA 4BBAA 1EE8A 3U6CA 4HL4A 2LNHC 3LCUA 4RF0A 2F5PA 4AW4A 1WR1B 3KVWA 4DR6M 4PDGA 5KQDA 3FTFA 1QAMA 3HZJA 4KODA 4JI4M 5KO3A 4DR2M 1NVMA 3I4VA 2H5XA 2KW0A 4Q7JA 1QDRA 5EXXA 2QHOB 3WHLA 1NNUC 2XEPA 3SATA 2YR0A 2C9CA 1JQJC 2BWBA 4MGHA 1F4IA 3UZUA 3KOYE 2FNAA 4NC6A 4HLQA 1HQCA 1EFUB 3HX3A 3QAUA 5F3WA 3NBXX 2KRKA 3WHKA 2OPFA 2X49A 4MM3B 4G4QA 4B3SM 1IXZA 1QAQA 4II7A 2R45A 4LRSA 2J7OA 4LCBA 3GP1A 3FKEA 3C3EA 4QNRA 3VKHA 3MMPA 3UMMA 2FFJA 2DENA 2CHVA 2F4VM 1N36M 2UXBM 5KPTA 2V6ZM 1XHBA 3U61A 4LFAM 2VDBB 2MH8A 3LW5F 1IN8A 1W5TA 1YE9A 3CGWA 5EP1A 3E21A 3F92A 4G4OA 2JY7A 3EIEA 1XNQM 2ZAMA 2G5GX 4DUYM 2BNKA 5FTJA 3ZC7B 1T3TA 4LGYA 2LVPC 3B89A 4CIZA 4DR7M 4XBOA 3KSJA 1Q02A 2I7PA 4BB9A 3AOEC 1XMQM 2KRUA 4QOZC 2GNOA 2CWBA 3VLFB 1V92A 1WJ7A 2Q2EB 3LQRA 3CF2A 4LF8M 1N33M 1HQYE 5GKNA 1QUSA 2APLA 2V1CA 5EQTA 3CF0A 3U6LA 2L09A 4I81A 2XZFA 3AOGA 3K2LA 1L2CA 2A5YB 2G8LA 1IBKM 3QYEA 2X8AA 1G41A 4DV7M 4F2LA 1SXJB 4XK8F 4LF5M 3I51A 4EIWA 4G4RA 1YLAA 1QAOA 4G3OA 4R3DA 4P16A 3L27A 3MK6A 2DAIA 3TQSA 4R71A 1VQ1A 1IXRC 3GLHA 4GIPA 2KXEA 2M60A 2R44A 1MU5A 4LF9M 1NV9A 4CISA 2R18A 2VIIA 3Q8GA 2EKKA 3GQ4A 4WURA 1JR3D 4JXJA 4OVZA 5IWAM 1HNWM 2BJWA 4HEOA 4DBGB 1UM8A 1C1KA 5EXTA 3HY5A 2QNJA 4XGIA 4DR1M 2LVQD 1D0LA 4R7GA 3IG8A 2F5SA 1R5LA 2DI0A 3TPZA 1GKIA 1ZMWA 3B7QA 2QSFX 3T38A 2CHQA 2LHCA 1G71A 2OO9A 1XXHA 3FTDA 2JP7A 2RGOA 2YFQA 3U60B 4PDIA 2ZM6M 1HT2E 1RU3A 3IG5A 1T43A 1P3QQ 4RKUF 3W68A 4NSRA 1D0MA 2JY8A 1N32M 2JNHA 1WGNA 2JA2A 4IBFA 3KS8A 2O25A 1JR3E 4M9SA 2Z3XA 1VEJA 2M5ZA 3RFWA 3MHVC 2EA0A 1Q3BA 5C1BA 4GKKM 1E32A 4AKIA 2KNZA 1Q3CA 1YUBA 2P5TA 2L2DA 3FTCA 3C58A 2DZNB 2JZ1A 4KLNA 2KZUA 1IN5A 1D2NA 1HT1E 3DA1A 1OJLA 2HHHM 3SHGB 3THGA 3L26A 1C7YA 2EO2A 3VK8A 2DZLA 3AFHA 3C9PA 4P17A 3W0LB 4LJ4A 3NWLA 2Y20A 3V76A 1J5EM 2O5RA 3FUVA 1IFYA 2DAGA 1ZMVA 5EP4A 4B3RM 4W5WA 2JXNA 3HGIA 4ZPXA 4G6ZA 4JV5M 2KHHA 3RGPA 5IT9S 2HAKA 2WSEF 4IBCA 4RNAA 5BR8M 3GLGB 4I8OA 2L7IA 1DO0A 5FSWA 3HHYA 2XFTA 1J7KA 3DOAA 2Z4SA 3LVVA 4X64M 3B7ZA 4LF6M 3FUTA 4I5SA 1DV0A 1D0KA 5DYIA 2FH0A 3GLIA 2VF7A 1VDLA 2BWEA 2HCBA 2QP9X 3E4RA 1DGGA 1VEKA 1OAIA 4B3TM 2WSFF 2CRUA 5FTLA 3DFZA 1NY6A 1PM5A 1LV7A 1AUAA 4LJ7A 5DFLA 1QZMA 1SG9A 1IY1A 4GEWA 2CV1A 4DV2M 4JI7M 2KA6B 5ITRA 2F5OA 3U6PA 2QBYA 1ZV1A 2F5QA 3R9XB 1PRBA 2MR9A 1T6OA 2RKOA 2ZTCA 5DNYA 1OFHA 4FWGA 1K3WA 4X62M 3K9PA 2C99A 3LMMA 2W82A 1PJQA 3GPYA 2LBCA 4Z8XA 4MGKE 4B7HA 2XZUA 7CATA 3T6PA 3DZDA 2MJ5B 1NHGC 3L2AA 2KNAA 3AOEA 4OU7A 3C3DA 1Z5AA 3I4YA 4ANRA 2Y0QA 4NXNM 3Q8XA 2D7EA 4PT5A 1QANA 3UK6A 5H37D 1NNJA 4IBJA 1K82A 3SARA 1IN4A 4LG2A 2J5YA 4LGMA 5DYGA 1IBMM 2OOAA 1KFVA 4LZJA 2F5NA 1DGHB 2C9OA 3HHZA 1Z59A 2DAKA 2NQ8C 3QYBA 3KS4A 1TDZA 1Z5BA 5IZ7D 2G3QA 3FD9A 4RF1A 4L8RC 4X66M 3QWLA 1X37A 3NBIA 1NY5A 2DAMA 4NSOB 1VEGA 4IBKA 2GQFA 2WSCF 3U5ZB 3LQQA 1IBLM 3HU2A 4D81A 5FTKA 3J81S 3UGJA 2DWMA 3U6EA 1TH4A 1SXJA 2D7HA 2DHRA 2YNMD 3PNYA 4FWHA 2C5RA 4LFCM 2CV0A 4MB7A 4LJAA 2CHGA 3GPUA 4YHHM 3HU1A 2QZ4A 3HWSA 3GRRA 4DV1M 4L16A 3KW6A 4S12A 3IHPA 3VKGA 2LVNC 1L1ZA 4QNMA 3GLHE 3SAVA 2EUCA 2Y0TA 1WGLA 2DVWB 1SXJC 4LRTA 2R0IA 3T1HM 3D8BA 2KDLA 1G59A 4CGYB 3SC3A 1XB2B 4LJ6A 4WW0A 3SMSA 1UFZA 5ITXA 3KP0E 1W5SA 2QQ8A 1PJSA 5KPRA 5ITXE 1N34M 1DGBA 2UUCM 4GHLA 1PJTA 1IM2A 5E26A 2XF3A 2QCUA 3L29A 3TWMA 1MX0A 1TH3A 3GRVA 4PD2A 1IXSA 1XXHE 3ZH9B 4G4NA 3VDUA 4NXMM 5ITQA 1TH2A 3CTWB 4GHAA 1V33A 3FRHA 1XNRM 1IY2A 1DGFA 4JI1M 4L4UA 4JI3M 4ITQA 1GO5A 2CE7A 1OAOC 1R4GA 3PXGA 4OVZB 4LJ9A 4AG6A 2YQZA 3W0FA 1GVNA 2ZTDA 2CP8A 3K9OA 3FE3A 4JN6A 3PFIA 2UXDM 1J09A 2UU9M 3GLFA 3KP1E 4JI8M 2XLJA 3AJIB 3JR5A 1L2DA 1E94E 2R46A 3HU3A 2JY5A 2UUBM 3B7NA 2OOBA 2CUZA 2K6BA 3KDSE 4IBIA 3SASA 5JI3E 4B3MM 2DNAA 1ZMUA 3SYLA 4BLCA 4DUZM 2KEBA 3RE8A 5C18A 2L4FA 1HR0M 1VG5A 5L8RF 1JB0F 1IY0A 3LCVB 1GLNA 3GLGA 2DXIA 3J7AS 2LTUA 4LJ5A 4PCZA 2MROB 4UN2B 1FNNA 3FYCA 1FJGM 2UXCM 1ORYB 5BPVA 1R7RA 3HHWA 5ITYA 2N35A 3I01M 3KOZE 2VF8A 4WP2A 3SYKA 4IBBA 4D80A 1NJFA 2LVAA 3FUUA 4QOSA 2FE8A 1WHCA 4LJ8A 2VQEM 1E9RA 1OFIA 3VDPA 5LMNM 3GQ3A 2O01F 4NRVA 1GL6A 2LHGA 4FWDA 4GC9A 2R6FA
chains in the Genus database with same CATH topology
1OQYA 4F1IA 3GLIE 1YLAA 2B3TA 2JUJA 1Y8GA 2WZJA 4G3OA 2DAIA 2OOAA 4R71A 1VQ1A 1G4AE 3E46A 1A5TA 1KYIA 2L4EA 1NV9A 2DAKA 3H4JA 1CUKA 2EKKA 2G3QA 3GLGE 5JI2E 1TTEA 2DAMA 4HEOA 4DBGB 2MGWA 1VEGA 1PGYA 2QNJA 3IECA 2LVQD 1OTRA 2DI0A 1NV8A 1ZMWA 2JY6B 2QSFX 2OO9A 2K9DA 2DHYA 2JP7A 1HJPA 2DKLA 3IHPA 1QZEA 2LVNC 2LVOC 1HT2E 1T43A 1WIVA 3GLHE 1P3QQ 3FRIA 1WGLA 3LCUA 2JY8A 2JNHA 1WGNA 2JZ0A 2R0IA 2O25A 1JR3E 1WR1B 1VEJA 2HWJA 1XB2B 2KNZA 2H5XA 4Q7JA 2L2DA 1UFZA 2QHOB 2JZ1A 1HT1E 2BWBA 2EKFA 1IM2A 1AIPC 1F4IA 1G3IA 1C7YA 2DZLA 1MN3A 1IXSA 1XXHE 1EFUB 1DO2A 1IFYA 2DAGA 1ZMVA 3FRHA 1BVSA 1GO5A 2KHHA 2HAKA 1R4GA 1DO0A 2RRUA 2ZTDA 2CP8A 3K9OA 3FE3A 2KNVA 2K0BX 3MMPA 2DENA 1DV0A 1E94E 2JY5A 1VDLA 2BWEA 2OOBA 3E21A 3F92A 2JY7A 1VEKA 1OAIA 3BBZA 2DNAA 1ZMUA 2LVPC 3B89A 5DFLA 1SG9A 4GEWA 2L4FA 1Q02A 1VG5A 3LCVB 2CWBA 2EJSA 1ZV1A 2LTUA 1V92A 2MROB 1WJ7A 1T6OA 2MR9A 2ZTCA 4UN2B 3K9PA 1TR8A 1OKSA 1HQYE 2LBCA 4WP2A 3T6PA 2MJ5B 2LVAA 2KNAA 1WHCA 1G41A 3GLFE 4F2LA 2DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  4F1I A;  3GLI E;  1YLA A;  2B3T A;  2JUJ A;  1Y8G A;  2WZJ A;  4G3O A;  2DAI A;  2OOA A;  4R71 A;  1VQ1 A;  1G4A E;  3E46 A;  1A5T A;  1KYI A;  2L4E A;  1NV9 A;  2DAK A;  3H4J A;  1CUK A;  2EKK A;  2G3Q A;  3GLG E;  5JI2 E;  1TTE A;  2DAM A;  4HEO A;  4DBG B;  2MGW A;  1VEG A;  1PGY A;  2QNJ A;  3IEC A;  2LVQ D;  1OTR A;  2DI0 A;  1NV8 A;  1ZMW A;  2JY6 B;  2QSF X;  2OO9 A;  2K9D A;  2DHY A;  2JP7 A;  1HJP A;  2DKL A;  3IHP A;  1QZE A;  2LVN C;  2LVO C;  1HT2 E;  1T43 A;  1WIV A;  3GLH E;  1P3Q Q;  3FRI A;  1WGL A;  3LCU A;  2JY8 A;  2JNH A;  1WGN A;  2JZ0 A;  2R0I A;  2O25 A;  1JR3 E;  1WR1 B;  1VEJ A;  2HWJ A;  1XB2 B;  2KNZ A;  2H5X A;  4Q7J A;  2L2D A;  1UFZ A;  2QHO B;  2JZ1 A;  1HT1 E;  2BWB A;  2EKF A;  1IM2 A;  1AIP C;  1F4I A;  1G3I A;  1C7Y A;  2DZL A;  1MN3 A;  1IXS A;  1XXH E;  1EFU B;  1DO2 A;  1IFY A;  2DAG A;  1ZMV A;  3FRH A;  1BVS A;  1GO5 A;  2KHH A;  2HAK A;  1R4G A;  1DO0 A;  2RRU A;  2ZTD A;  2CP8 A;  3K9O A;  3FE3 A;  2KNV A;  2K0B X;  3MMP A;  2DEN A;  1DV0 A;  1E94 E;  2JY5 A;  1VDL A;  2BWE A;  2OOB A;  3E21 A;  3F92 A;  2JY7 A;  1VEK A;  1OAI A;  3BBZ A;  2DNA A;  1ZMU A;  2LVP C;  3B89 A;  5DFL A;  1SG9 A;  4GEW A;  2L4F A;  1Q02 A;  1VG5 A;  3LCV B;  2CWB A;  2EJS A;  1ZV1 A;  2LTU A;  1V92 A;  2MRO B;  1WJ7 A;  1T6O A;  2MR9 A;  2ZTC A;  4UN2 B;  3K9P A;  1TR8 A;  1OKS A;  1HQY E;  2LBC A;  4WP2 A;  3T6P A;  2MJ5 B;  2LVA A;  2KNA A;  1WHC A;  1G41 A;  3GLF E;  4F2L A;  2DAE A; 
#chains in the Genus database with same CATH topology
 1QUT A;  4I4L A;  2CFO A;  4F1I A;  1N75 A;  3GLI E;  4IBG A;  2B3T A;  1Y8G A;  2WZJ A;  2J7N A;  1MJG M;  4AKH A;  1A5T A;  1GJT A;  5FLX S;  1QDT A;  4K0K M;  1KYI A;  3AL0 C;  2XGN A;  4DV3 M;  3LVW A;  3M0E A;  2I7N A;  4GRI A;  4IBD A;  2FS1 A;  4IJE A;  2R65 A;  2CEA A;  4A3V B;  3T1Y M;  3SAU A;  1TTE A;  5LMU M;  3BOS A;  1PJI A;  2X4A A;  2MGW A;  4MGY E;  3L25 A;  2Z7J A;  4KT0 F;  1PGY A;  3IEC A;  4GC5 A;  1E9S A;  1G8P A;  1OTR A;  4OW0 A;  1SXJ D;  4JI6 M;  3KSX A;  1IN7 A;  4B08 A;  3GLI B;  3GPP A;  8CAT A;  2BJV A;  3U6O A;  2JY6 B;  2Z8Y M;  1I94 M;  4Y28 F;  4JYA M;  2K9D A;  2DHY A;  3E9S A;  4MGZ E;  4NRW A;  3EIH A;  1HJP A;  1PJJ A;  4DR4 M;  4GKJ M;  1Z5C A;  2DKL A;  1DGH A;  2XSZ A;  2AHM A;  3FTE A;  3KFU G;  4M9Z A;  1QZE A;  3ZQJ A;  4IIW A;  3K92 A;  2L6O A;  2UUA M;  3FRI A;  2H1R A;  4MH0 E;  2QBY B;  4DV0 M;  2R62 A;  2JZ0 A;  2Z4R A;  4AQY M;  3U6M A;  1V34 A;  3U5Z A;  1N78 A;  2R4J A;  3MJ5 A;  2D7G A;  1NO1 A;  2HWJ A;  4B7G A;  4L6V 6;  1S3S A;  1QQW A;  4DV6 M;  1TGU A;  4NL4 H;  4L78 A;  3W67 A;  1XMO M;  4NOO B;  1KSF X;  3TWL A;  1XC8 A;  2C98 A;  3KOX E;  2LXE A;  3GRU A;  3L28 A;  5KQ8 A;  3U61 B;  2XH9 A;  3GO8 A;  1SXJ E;  2EKF A;  3TWK A;  4FW9 A;  1AIP C;  4B7F A;  1HNZ M;  4KHP M;  1GAB A;  4AI6 A;  2L7H A;  1G3I A;  1Z6T A;  3FYD A;  5ITU A;  3J27 B;  1Q39 A;  3A45 A;  4FCT A;  4GIT A;  1MN3 A;  2ERC A;  5EXP A;  1ZQ9 A;  4QHT A;  3J2P B;  1DO2 A;  1IN6 A;  1QVR A;  3D8L A;  3FUX A;  3U6S A;  1R2Y A;  2CV2 A;  3A42 A;  1BVS A;  5KPZ A;  1NSF A;  3K8Z A;  1NJG A;  4GH9 A;  2Y21 A;  5FTM A;  2LWX A;  2K47 A;  2RRU A;  4FD2 A;  2RGH A;  3TL4 X;  3VFD A;  4YY3 M;  2VQF M;  2E5L M;  1OIZ A;  2KNV A;  2K0B X;  5E6J A;  3KOW E;  2LH0 A;  3A98 B;  4OX9 M;  2ZAN A;  3CF6 E;  2OQ4 A;  4JI2 M;  1I4W A;  4FCW A;  2HL7 A;  4LZZ A;  4X65 M;  3GPX A;  3BBZ A;  1VDD A;  5ITT A;  3PNV A;  5EP2 A;  1XWI A;  4M0W A;  2V1U A;  1EIJ A;  3T15 A;  3U60 A;  3UJN A;  3B74 A;  3AKZ A;  1L2B A;  2QPA A;  4CHT B;  4AKG A;  1R6B X;  3GLH B;  2HKJ A;  4L15 A;  2EJS A;  4AZF A;  1L1T A;  1YSY A;  3SHF A;  1H6U A;  2C96 A;  4DR3 M;  1TR8 A;  2JWS A;  1OKS A;  3HJQ A;  4MGI E;  3HHX A;  1ZAE A;  3GQ5 A;  2ZAO A;  3U6D A;  3SBJ A;  3JAM S;  4REZ A;  4M9X A;  2KZS A;  2DZO B;  4LF4 M;  1LTM A;  3GRY A;  3FUW A;  3PVS A;  4QHS A;  3GLF E;  1QYR A;  3ILK A;  4GMQ A;  4M0D A;  4IJF A;  2DAE A;  1L8Q A;  1OQY A;  3J7B A;  3ZCB B;  4AG5 A;  4DR5 M;  2FOI C;  1IQP A;  2JUJ A;  4FVM A;  5EP3 A;  3VK7 A;  1R2Z A;  1XXH B;  3HKP A;  1G4A E;  1IXS B;  3E46 A;  3HJ8 A;  3TE6 A;  2QEN A;  4IBE A;  3SAW A;  3AV0 A;  2L4E A;  3B9P A;  3H4J A;  3M6A A;  5FTN A;  3HJS A;  4LFB M;  1GJS A;  1CUK A;  1JR3 A;  3J80 S;  5IRE B;  1NHW C;  5A2Q S;  5JI2 E;  3K1J A;  3GLG E;  3U6Q A;  1WXQ A;  4TUW A;  1TF0 B;  1K3X A;  4JI0 M;  1GL7 A;  2XFS A;  3KXE C;  2ZBK B;  2DWZ B;  2DWN A;  3OTO M;  3GLF B;  4FCV A;  5EJC A;  3H4M A;  3SMP A;  1NV8 A;  5EXS A;  2DWL A;  1TDH A;  3SFZ A;  3I04 M;  1N77 A;  1HNX M;  4KO8 A;  3R8F A;  4JI5 M;  4Z6Y A;  3JR4 A;  3M7G A;  2XSZ D;  4LY6 A;  4CJ6 A;  4D82 A;  1OIP A;  2LVO C;  2R4E A;  3BXW A;  3A46 A;  4DV4 M;  4DV5 M;  4LF7 M;  1WIV A;  3RGS A;  4BBA A;  1EE8 A;  3U6C A;  4HL4 A;  2LNH C;  3LCU A;  4RF0 A;  2F5P A;  4AW4 A;  1WR1 B;  3KVW A;  4DR6 M;  4PDG A;  5KQD A;  3FTF A;  1QAM A;  3HZJ A;  4KOD A;  4JI4 M;  5KO3 A;  4DR2 M;  1NVM A;  3I4V A;  2H5X A;  2KW0 A;  4Q7J A;  1QDR A;  5EXX A;  2QHO B;  3WHL A;  1NNU C;  2XEP A;  3SAT A;  2YR0 A;  2C9C A;  1JQJ C;  2BWB A;  4MGH A;  1F4I A;  3UZU A;  3KOY E;  2FNA A;  4NC6 A;  4HLQ A;  1HQC A;  1EFU B;  3HX3 A;  3QAU A;  5F3W A;  3NBX X;  2KRK A;  3WHK A;  2OPF A;  2X49 A;  4MM3 B;  4G4Q A;  4B3S M;  1IXZ A;  1QAQ A;  4II7 A;  2R45 A;  4LRS A;  2J7O A;  4LCB A;  3GP1 A;  3FKE A;  3C3E A;  4QNR A;  3VKH A;  3MMP A;  3UMM A;  2FFJ A;  2DEN A;  2CHV A;  2F4V M;  1N36 M;  2UXB M;  5KPT A;  2V6Z M;  1XHB A;  3U61 A;  4LFA M;  2VDB B;  2MH8 A;  3LW5 F;  1IN8 A;  1W5T A;  1YE9 A;  3CGW A;  5EP1 A;  3E21 A;  3F92 A;  4G4O A;  2JY7 A;  3EIE A;  1XNQ M;  2ZAM A;  2G5G X;  4DUY M;  2BNK A;  5FTJ A;  3ZC7 B;  1T3T A;  4LGY A;  2LVP C;  3B89 A;  4CIZ A;  4DR7 M;  4XBO A;  3KSJ A;  1Q02 A;  2I7P A;  4BB9 A;  3AOE C;  1XMQ M;  2KRU A;  4QOZ C;  2GNO A;  2CWB A;  3VLF B;  1V92 A;  1WJ7 A;  2Q2E B;  3LQR A;  3CF2 A;  4LF8 M;  1N33 M;  1HQY E;  5GKN A;  1QUS A;  2APL A;  2V1C A;  5EQT A;  3CF0 A;  3U6L A;  2L09 A;  4I81 A;  2XZF A;  3AOG A;  3K2L A;  1L2C A;  2A5Y B;  2G8L A;  1IBK M;  3QYE A;  2X8A A;  1G41 A;  4DV7 M;  4F2L A;  1SXJ B;  4XK8 F;  4LF5 M;  3I51 A;  4EIW A;  4G4R A;  1YLA A;  1QAO A;  4G3O A;  4R3D A;  4P16 A;  3L27 A;  3MK6 A;  2DAI A;  3TQS A;  4R71 A;  1VQ1 A;  1IXR C;  3GLH A;  4GIP A;  2KXE A;  2M60 A;  2R44 A;  1MU5 A;  4LF9 M;  1NV9 A;  4CIS A;  2R18 A;  2VII A;  3Q8G A;  2EKK A;  3GQ4 A;  4WUR A;  1JR3 D;  4JXJ A;  4OVZ A;  5IWA M;  1HNW M;  2BJW A;  4HEO A;  4DBG B;  1UM8 A;  1C1K A;  5EXT A;  3HY5 A;  2QNJ A;  4XGI A;  4DR1 M;  2LVQ D;  1D0L A;  4R7G A;  3IG8 A;  2F5S A;  1R5L A;  2DI0 A;  3TPZ A;  1GKI A;  1ZMW A;  3B7Q A;  2QSF X;  3T38 A;  2CHQ A;  2LHC A;  1G71 A;  2OO9 A;  1XXH A;  3FTD A;  2JP7 A;  2RGO A;  2YFQ A;  3U60 B;  4PDI A;  2ZM6 M;  1HT2 E;  1RU3 A;  3IG5 A;  1T43 A;  1P3Q Q;  4RKU F;  3W68 A;  4NSR A;  1D0M A;  2JY8 A;  1N32 M;  2JNH A;  1WGN A;  2JA2 A;  4IBF A;  3KS8 A;  2O25 A;  1JR3 E;  4M9S A;  2Z3X A;  1VEJ A;  2M5Z A;  3RFW A;  3MHV C;  2EA0 A;  1Q3B A;  5C1B A;  4GKK M;  1E32 A;  4AKI A;  2KNZ A;  1Q3C A;  1YUB A;  2P5T A;  2L2D A;  3FTC A;  3C58 A;  2DZN B;  2JZ1 A;  4KLN A;  2KZU A;  1IN5 A;  1D2N A;  1HT1 E;  3DA1 A;  1OJL A;  2HHH M;  3SHG B;  3THG A;  3L26 A;  1C7Y A;  2EO2 A;  3VK8 A;  2DZL A;  3AFH A;  3C9P A;  4P17 A;  3W0L B;  4LJ4 A;  3NWL A;  2Y20 A;  3V76 A;  1J5E M;  2O5R A;  3FUV A;  1IFY A;  2DAG A;  1ZMV A;  5EP4 A;  4B3R M;  4W5W A;  2JXN A;  3HGI A;  4ZPX A;  4G6Z A;  4JV5 M;  2KHH A;  3RGP A;  5IT9 S;  2HAK A;  2WSE F;  4IBC A;  4RNA A;  5BR8 M;  3GLG B;  4I8O A;  2L7I A;  1DO0 A;  5FSW A;  3HHY A;  2XFT A;  1J7K A;  3DOA A;  2Z4S A;  3LVV A;  4X64 M;  3B7Z A;  4LF6 M;  3FUT A;  4I5S A;  1DV0 A;  1D0K A;  5DYI A;  2FH0 A;  3GLI A;  2VF7 A;  1VDL A;  2BWE A;  2HCB A;  2QP9 X;  3E4R A;  1DGG A;  1VEK A;  1OAI A;  4B3T M;  2WSF F;  2CRU A;  5FTL A;  3DFZ A;  1NY6 A;  1PM5 A;  1LV7 A;  1AUA A;  4LJ7 A;  5DFL A;  1QZM A;  1SG9 A;  1IY1 A;  4GEW A;  2CV1 A;  4DV2 M;  4JI7 M;  2KA6 B;  5ITR A;  2F5O A;  3U6P A;  2QBY A;  1ZV1 A;  2F5Q A;  3R9X B;  1PRB A;  2MR9 A;  1T6O A;  2RKO A;  2ZTC A;  5DNY A;  1OFH A;  4FWG A;  1K3W A;  4X62 M;  3K9P A;  2C99 A;  3LMM A;  2W82 A;  1PJQ A;  3GPY A;  2LBC A;  4Z8X A;  4MGK E;  4B7H A;  2XZU A;  7CAT A;  3T6P A;  3DZD A;  2MJ5 B;  1NHG C;  3L2A A;  2KNA A;  3AOE A;  4OU7 A;  3C3D A;  1Z5A A;  3I4Y A;  4ANR A;  2Y0Q A;  4NXN M;  3Q8X A;  2D7E A;  4PT5 A;  1QAN A;  3UK6 A;  5H37 D;  1NNJ A;  4IBJ A;  1K82 A;  3SAR A;  1IN4 A;  4LG2 A;  2J5Y A;  4LGM A;  5DYG A;  1IBM M;  2OOA A;  1KFV A;  4LZJ A;  2F5N A;  1DGH B;  2C9O A;  3HHZ A;  1Z59 A;  2DAK A;  2NQ8 C;  3QYB A;  3KS4 A;  1TDZ A;  1Z5B A;  5IZ7 D;  2G3Q A;  3FD9 A;  4RF1 A;  4L8R C;  4X66 M;  3QWL A;  1X37 A;  3NBI A;  1NY5 A;  2DAM A;  4NSO B;  1VEG A;  4IBK A;  2GQF A;  2WSC F;  3U5Z B;  3LQQ A;  1IBL M;  3HU2 A;  4D81 A;  5FTK A;  3J81 S;  3UGJ A;  2DWM A;  3U6E A;  1TH4 A;  1SXJ A;  2D7H A;  2DHR A;  2YNM D;  3PNY A;  4FWH A;  2C5R A;  4LFC M;  2CV0 A;  4MB7 A;  4LJA A;  2CHG A;  3GPU A;  4YHH M;  3HU1 A;  2QZ4 A;  3HWS A;  3GRR A;  4DV1 M;  4L16 A;  3KW6 A;  4S12 A;  3IHP A;  3VKG A;  2LVN C;  1L1Z A;  4QNM A;  3GLH E;  3SAV A;  2EUC A;  2Y0T A;  1WGL A;  2DVW B;  1SXJ C;  4LRT A;  2R0I A;  3T1H M;  3D8B A;  2KDL A;  1G59 A;  4CGY B;  3SC3 A;  1XB2 B;  4LJ6 A;  4WW0 A;  3SMS A;  1UFZ A;  5ITX A;  3KP0 E;  1W5S A;  2QQ8 A;  1PJS A;  5KPR A;  5ITX E;  1N34 M;  1DGB A;  2UUC M;  4GHL A;  1PJT A;  1IM2 A;  5E26 A;  2XF3 A;  2QCU A;  3L29 A;  3TWM A;  1MX0 A;  1TH3 A;  3GRV A;  4PD2 A;  1IXS A;  1XXH E;  3ZH9 B;  4G4N A;  3VDU A;  4NXM M;  5ITQ A;  1TH2 A;  3CTW B;  4GHA A;  1V33 A;  3FRH A;  1XNR M;  1IY2 A;  1DGF A;  4JI1 M;  4L4U A;  4JI3 M;  4ITQ A;  1GO5 A;  2CE7 A;  1OAO C;  1R4G A;  3PXG A;  4OVZ B;  4LJ9 A;  4AG6 A;  2YQZ A;  3W0F A;  1GVN A;  2ZTD A;  2CP8 A;  3K9O A;  3FE3 A;  4JN6 A;  3PFI A;  2UXD M;  1J09 A;  2UU9 M;  3GLF A;  3KP1 E;  4JI8 M;  2XLJ A;  3AJI B;  3JR5 A;  1L2D A;  1E94 E;  2R46 A;  3HU3 A;  2JY5 A;  2UUB M;  3B7N A;  2OOB A;  2CUZ A;  2K6B A;  3KDS E;  4IBI A;  3SAS A;  5JI3 E;  4B3M M;  2DNA A;  1ZMU A;  3SYL A;  4BLC A;  4DUZ M;  2KEB A;  3RE8 A;  5C18 A;  2L4F A;  1HR0 M;  1VG5 A;  5L8R F;  1JB0 F;  1IY0 A;  3LCV B;  1GLN A;  3GLG A;  2DXI A;  3J7A S;  2LTU A;  4LJ5 A;  4PCZ A;  2MRO B;  4UN2 B;  1FNN A;  3FYC A;  1FJG M;  2UXC M;  1ORY B;  5BPV A;  1R7R A;  3HHW A;  5ITY A;  2N35 A;  3I01 M;  3KOZ E;  2VF8 A;  4WP2 A;  3SYK A;  4IBB A;  4D80 A;  1NJF A;  2LVA A;  3FUU A;  4QOS A;  2FE8 A;  1WHC A;  4LJ8 A;  2VQE M;  1E9R A;  1OFI A;  3VDP A;  5LMN M;  3GQ3 A;  2O01 F;  4NRV A;  1GL6 A;  2LHG A;  4FWD A;  4GC9 A;  2R6F A; 
#chains in the Genus database with same CATH homology
 1OQY A;  4F1I A;  3GLI E;  1YLA A;  2B3T A;  2JUJ A;  1Y8G A;  2WZJ A;  4G3O A;  2DAI A;  2OOA A;  4R71 A;  1VQ1 A;  1G4A E;  3E46 A;  1A5T A;  1KYI A;  2L4E A;  1NV9 A;  2DAK A;  3H4J A;  1CUK A;  2EKK A;  2G3Q A;  3GLG E;  5JI2 E;  1TTE A;  2DAM A;  4HEO A;  4DBG B;  2MGW A;  1VEG A;  1PGY A;  2QNJ A;  3IEC A;  2LVQ D;  1OTR A;  2DI0 A;  1NV8 A;  1ZMW A;  2JY6 B;  2QSF X;  2OO9 A;  2K9D A;  2DHY A;  2JP7 A;  1HJP A;  2DKL A;  3IHP A;  1QZE A;  2LVN C;  2LVO C;  1HT2 E;  1T43 A;  1WIV A;  3GLH E;  1P3Q Q;  3FRI A;  1WGL A;  3LCU A;  2JY8 A;  2JNH A;  1WGN A;  2JZ0 A;  2R0I A;  2O25 A;  1JR3 E;  1WR1 B;  1VEJ A;  2HWJ A;  1XB2 B;  2KNZ A;  2H5X A;  4Q7J A;  2L2D A;  1UFZ A;  2QHO B;  2JZ1 A;  1HT1 E;  2BWB A;  2EKF A;  1IM2 A;  1AIP C;  1F4I A;  1G3I A;  1C7Y A;  2DZL A;  1MN3 A;  1IXS A;  1XXH E;  1EFU B;  1DO2 A;  1IFY A;  2DAG A;  1ZMV A;  3FRH A;  1BVS A;  1GO5 A;  2KHH A;  2HAK A;  1R4G A;  1DO0 A;  2RRU A;  2ZTD A;  2CP8 A;  3K9O A;  3FE3 A;  2KNV A;  2K0B X;  3MMP A;  2DEN A;  1DV0 A;  1E94 E;  2JY5 A;  1VDL A;  2BWE A;  2OOB A;  3E21 A;  3F92 A;  2JY7 A;  1VEK A;  1OAI A;  3BBZ A;  2DNA A;  1ZMU A;  2LVP C;  3B89 A;  5DFL A;  1SG9 A;  4GEW A;  2L4F A;  1Q02 A;  1VG5 A;  3LCV B;  2CWB A;  2EJS A;  1ZV1 A;  2LTU A;  1V92 A;  2MRO B;  1WJ7 A;  1T6O A;  2MR9 A;  2ZTC A;  4UN2 B;  3K9P A;  1TR8 A;  1OKS A;  1HQY E;  2LBC A;  4WP2 A;  3T6P A;  2MJ5 B;  2LVA A;  2KNA A;  1WHC A;  1G41 A;  3GLF E;  4F2L A;  2DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...