2DENA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2denA00
1F4IA 1IFYA 1XB2B 1P3QQ 1VQ1A 1HT1E 1V92A 4WP2A 1DO2A 3LCVB 2WZJA 5DFLA 3F92A 3LCUA 2CP8A 3E46A 1BVSA 1YLAA 1XXHE 2L4EA 1TR8A 2LBCA 1WR1B 3FE3A 3BBZA 2DI0A 2DHYA 2OO9A 1G3IA 1CUKA 4F1IA 2MJ5B 1GO5A 2OOBA 1R4GA 1NV8A 1PGYA 2K9DA 1WIVA 1UFZA 2JY5A 2JP7A 1NV9A 3GLFE 1E94E 1DV0A 2JY7A 1WJ7A 1HQYE 2MGWA 1HT2E 1WHCA 3IHPA 3IECA 2JZ0A 2G3QA 3H4JA 3T6PA 2JNHA 2O25A 1VG5A 3FRIA 3MMPA 2B3TA 2DNAA 2L4FA 1HJPA 2H5XA 2MROB 1ZV1A 1Q02A 2MR9A 1Y8GA 1A5TA 3GLGE 2DAIA 1JR3E 1VEGA 2JY8A 1T43A 2LVAA 4G3OA 1TTEA 1ZMUA 2KNVA 2HAKA 1QZEA 2RRUA 2BWEA 3FRHA 2L2DA 2OOAA 4R71A 2KNZA 2R0IA 3K9PA 5JI2E 4F2LA 1EFUB 2DKLA 2ZTCA 2QHOB 2QNJA 1IM2A 1AIPC 2KNAA 2BWBA 2HWJA 4DBGB 1OKSA 2LVNC 2ZTDA 1OQYA 1VDLA 2EKFA 1WGLA 1OAIA 1DO0A 2EKKA 4UN2B 1G4AE 2QSFX 1C7YA 4Q7JA 2CWBA 1T6OA 4GEWA 1ZMVA 1MN3A 1VEJA 1WGNA 2LVOC 2K0BX 2DZLA 2LTUA 2KHHA 1KYIA 1VEKA 4HEOA 3E21A 3B89A 1OTRA 1IXSA 1SG9A 2DAGA 2LVPC 2JUJA 3GLIE 2EJSA 1G41A 2DAKA 2DENA 2LVQD 3GLHE 1ZMWA 2DAEA 2JY6B 2DAMA 3K9OA 2JZ1A
chains in the Genus database with same CATH superfamily
1IFYA 2EO2A 4R7GA 1XB2B 2L7HA 2BJVA 1VQ1A 2F5NA 4MH0E 1HT1E 4WP2A 2VF7A 1IBKM 3KS8A 4AKIA 3LCVB 4L78A 3AL0C 3LCUA 1TH3A 4LZJA 1NHWC 5LMUM 1IN8A 4L4UA 4KLNA 2Z8YM 4Y28F 1BVSA 1W5TA 3FD9A 5BR8M 3TWKA 2C99A 1WR1B 3MJ5A 3GLFA 1IBMM 4I5SA 4AG5A 3FUVA 2DI0A 2DWZB 3ZH9B 4QOSA 1CUKA 1N75A 2VF8A 2L09A 3KP1E 4G4RA 1Z5BA 1HR0M 3QYBA 3EIEA 2RKOA 1R4GA 3EIHA 3KVWA 1C1KA 3HU3A 5KPRA 4LFBM 2JY5A 3KP0E 4QNMA 4IBIA 3U6EA 3GLHB 1DV0A 3GP1A 2QPAA 3L2AA 2JXNA 2XF3A 3U61A 3LVWA 1D0LA 3AFHA 3FTFA 1XHBA 3VKGA 4IBBA 5ITYA 5KPZA 5L8RF 4RNAA 3PVSA 2L4FA 1HJPA 4RKUF 1PJJA 1IXSB 1SXJA 4X62M 4XBOA 4LRTA 5ITRA 4L15A 4REZA 1DGBA 1WXQA 2X8AA 4LZZA 4DV1M 3SAVA 1PJIA 2QBYA 5KQDA 1GL6A 1L8QA 2LVAA 3ZQJA 3HHXA 4WURA 1GL7A 1IN5A 1QZEA 2CV1A 5KQ8A 3AOEA 5E26A 3FRHA 2L2DA 3AKZA 4R71A 2UU9M 3D8LA 2HHHM 4LCBA 3GQ3A 4DV6M 4NOOB 5JI2E 4OVZB 2KA6B 3FUTA 5EJCA 3KDSE 1Z5AA 2QHOB 3I04M 4JI2M 1Z59A 1AIPC 1GVNA 1DGHB 2KNAA 3MHVC 4FW9A 3J81S 3C3EA 3DZDA 2LVNC 3U60B 3KFUG 1L2BA 5FTNA 1L1ZA 4LFAM 3R8FA 1ZQ9A 1OAIA 1J09A 4FCWA 2V1UA 3DOAA 3HJ8A 3GLIA 4IBKA 4FCVA 2XSZA 2CRUA 2R4JA 4AZFA 2KDLA 3LW5F 4P16A 4I8OA 5KPTA 1VEJA 3I01M 3TL4X 2DZLA 2KRKA 1VEKA 3U6SA 4AKGA 4W5WA 2L6OA 3GLGB 4DV3M 3K2LA 3SYKA 3FYDA 3UJNA 4JI6M 3B7QA 2JUJA 3R9XB 2EJSA 3DA1A 3PNVA 2DAKA 2JWSA 3GLHE 3HJSA 5EXPA 3UK6A 3C58A 4B7GA 2BNKA 3NWLA 5FTLA 3SC3A 2CHGA 1D0MA 4I4LA 3SAWA 1MX0A 4HEOA 3HJQA 2O5RA 1YE9A 2R6FA 3CTWB 3B9PA 3KOXE 2UUAM 4KHPM 3QWLA 4LF5M 4DUZM 4IBFA 4LF8M 2WZJA 1RU3A 2DHRA 2FOIC 1V34A 3F92A 3KOZE 2CUZA 2C9CA 2MH8A 2J7NA 3E46A 4B3RM 3RFWA 2VQEM 1MU5A 2F4VM 2APLA 2Q2EB 1GLNA 4X65M 3K1JA 1JB0F 4JN6A 5GKNA 1G8PA 4WW0A 3GQ4A 1Q3CA 2DHYA 2J5YA 1G3IA 3JR4A 3M6AA 2YFQA 3U5ZA 3L28A 1I4WA 3GRVA 4LJ7A 2EA0A 1NY5A 2DZOB 3ZCBB 2OOBA 1N77A 2QZ4A 3TQSA 1JR3D 2Y21A 1LV7A 3WHLA 2K9DA 5ITQA 4S12A 3CGWA 4B7FA 1XNQM 4FWHA 1TF0B 4OX9M 3PFIA 2JY7A 2UXDM 3GRYA 2FS1A 3HU2A 3T15A 1E9SA 4OW0A 3IECA 4X64M 1XMOM 2ERCA 3HHWA 3H4JA 4HL4A 2JNHA 3TPZA 3NBIA 1OJLA 3M7GA 1J7KA 4PT5A 3UZUA 3FRIA 5IT9S 2H5XA 3Q8GA 3KSXA 3HU1A 3HHYA 3CF2A 4LF4M 1EIJA 5DYIA 4LF7M 3TE6A 3W0LB 5ITXE 4LJ8A 1Y8GA 4CISA 1XXHB 1MJGM 1A5TA 4B3SM 3GLGE 4M9ZA 1R2ZA 4DV4M 1SXJC 3J2PB 3SAUA 2JY8A 1T43A 3GPPA 2R45A 4KODA 4G3OA 3SYLA 4QOZC 3GO8A 4NC6A 4MGHA 3J80S 3U6LA 2CHVA 1TDHA 4RF1A 1V33A 1Z5CA 2OOAA 1IY2A 4LGMA 2KNZA 2R0IA 3K9PA 3U61B 4GMQA 4MGZE 4F2LA 1EFUB 3VDUA 1I94M 5F3WA 1FNNA 3AOEC 3HKPA 3M0EA 2ZTCA 4JI1M 4IJEA 4II7A 1NJGA 4JI8M 1IM2A 4X66M 4G6ZA 4BLCA 1OIZA 3B74A 4JI0M 3HY5A 1IXZA 3B7ZA 2X4AA 4IIWA 4DBGB 1OKSA 4EIWA 1IY0A 2G5GX 2ZTDA 2EKFA 5IZ7D 2HCBA 4MGYE 1WGLA 3QAUA 3DFZA 2EKKA 4YHHM 4UN2B 3A45A 1QYRA 5FLXS 4B3TM 1G4AE 2XZFA 2ZM6M 3U6CA 1K82A 3GLHA 2CWBA 4M0DA 2M5ZA 5BPVA 3B7NA 1ZMVA 3T1HM 1NNJA 3JAMS 4I81A 3HHZA 2HKJA 2YQZA 2LTUA 4B7HA 4DV7M 2KHHA 3J7BA 4P17A 4DR1M 1XWIA 1OIPA 4BB9A 1N33M 3SATA 2XGNA 2R62A 1OTRA 3LQQA 5DYGA 4RF0A 3VK8A 1IXSA 1SG9A 3KW6A 4QHSA 4JV5M 3FTEA 4PD2A 3VKHA 1OFHA 5A2QS 1AUAA 1PRBA 3I51A 1QANA 2QP9X 2DAEA 3NBXX 2F5QA 1Z6TA 2FNAA 2DAMA 3K9OA 2JZ1A 4GC5A 4ANRA 1R2YA 4JI5M 4M9XA 4XGIA 2F5PA 1P3QQ 3VDPA 2XH9A 5FTJA 2G8LA 1V92A 2Z7JA 1DO2A 3HWSA 4FVMA 1DGFA 4LJAA 3SBJA 5DFLA 4LFCM 2L7IA 1H6UA 2CP8A 2XEPA 3BOSA 2NQ8C 2N35A 4OVZA 1UM8A 2QENA 4CIZA 5EP4A 1YLAA 2CV2A 1XXHE 2L4EA 4MM3B 5EXSA 5FTKA 2LBCA 1IXRC 3GRRA 1DGHA 4GIPA 3D8BA 3FE3A 5EP1A 4TUWA 4CGYB 4M9SA 4BBAA 3LQRA 3BBZA 4XK8F 2OO9A 5EP3A 2DWNA 1NO1A 3AOGA 2QCUA 1TGUA 1XMQM 2D7HA 2CHQA 2F5SA 4LF6M 3TWLA 3UMMA 1NV8A 3E4RA 3C3DA 3H4MA 3FUUA 1WIVA 1UFZA 5EP2A 3GPXA 1QUTA 2JP7A 2M60A 5ITXA 5EXTA 3FYCA 5IWAM 3U6MA 4D80A 1WJ7A 1HQYE 3RGPA 1QVRA 1HT2E 1WHCA 1SXJD 3BXWA 2JZ0A 1Q39A 4A3VB 3L26A 3T6PA 4IBEA 2R18A 4NSRA 2DXIA 3K8ZA 2ZAMA 1R5LA 4Z8XA 1S3SA 4CJ6A 3GPUA 1QDTA 2DNAA 3IG5A 2C9OA 3THGA 4GKJM 2XFTA 1W5SA 3Q8XA 3GRUA 1PM5A 1Q02A 4MGKE 3RGSA 3SHGB 2UUCM 2ZANA 2MR9A 3FTDA 4DR6M 4JI7M 1R7RA 2DAIA 4AI6A 1JR3E 3IG8A 1IN6A 5E6JA 3SMSA 2XLJA 3J27B 2K6BA 1PJQA 2OPFA 1N34M 1HNZM 1PJTA 4NXNM 3QYEA 4YY3M 2HAKA 3ILKA 1TH2A 1LTMA 5EQTA 2BWEA 4LGYA 3SARA 4JI4M 4K0KM 4QHTA 2RGHA 3HZJA 5FSWA 3SASA 2UXBM 4AG6A 2UXCM 4JXJA 4DR2M 3TWMA 2DKLA 4GITA 4NSOB 3FKEA 4DV2M 3U6DA 3SFZA 4ITQA 4FCTA 3SHFA 3GLFB 2BWBA 4PCZA 2D7EA 2HWJA 1XNRM 2J7OA 2XSZD 5EXXA 2R44A 1VDLA 2LH0A 1NSFA 4Z6YA 1DO0A 2HL7A 2KZSA 3C9PA 2R4EA 2QSFX 1C7YA 4Q7JA 3OTOM 3VK7A 1T6OA 2D7GA 2Z4SA 4QNRA 2Y0TA 4GEWA 1WGNA 4FWGA 2QQ8A 3FUXA 3LMMA 2OQ4A 2F5OA 1NY6A 3B89A 1JQJC 1TH4A 1KFVA 1D2NA 4DR5M 4GH9A 1HQCA 2C98A 3J7AS 2ZAOA 2DAGA 2R65A 4FWDA 2LVQD 4PDIA 2FH0A 1XXHA 1ZMWA 4B3MM 8CATA 1SXJB 2JY6B 4GC9A 3MK6A 3E9SA 2LNHC 5ITUA 4DUYM 1F4IA 4NL4H 5FTMA 4CHTB 4GRIA 3KSJA 3UGJA 1YSYA 2XZUA 2A5YB 2Y20A 2QBYB 1TDZA 4HLQA 5ITTA 1L2DA 2CE7A 2VIIA 4ZPXA 4NXMM 2WSFF 2I7PA 2KRUA 5H37D 3U6QA 4DR7M 3W68A 1QDRA 3WHKA 4LRSA 1OAOC 3L25A 1NJFA 3PXGA 4LJ6A 4DV5M 1NHGC 1FJGM 1TR8A 2AHMA 3RE8A 4G4QA 3PNYA 4IJFA 4IBCA 4MB7A 4NRWA 3JR5A 4L16A 1YUBA 2K47A 1QAQA 4G4NA 2YR0A 1N78A 5IREB 3I4VA 3AV0A 4JI3M 4F1IA 1G59A 1QAMA 1IY1A 2MJ5B 1GO5A 2Z4RA 4NRVA 3A98B 3FTCA 1PGYA 2W82A 3K92A 2LWXA 4LJ4A 7CATA 2X49A 2E5LM 3KXEC 3GLIB 3U6OA 3VLFB 2DWLA 1NV9A 3GLFE 1E94E 3CF6E 4R3DA 2LHGA 2MGWA 4GHAA 3IHPA 3W0FA 1JR3A 1VDDA 4D82A 2DZNB 2KZUA 3ZC7B 4PDGA 1L1TA 1L2CA 2G3QA 4AW4A 2FE8A 3GQ5A 4LJ5A 2O25A 5C18A 1VG5A 4FD2A 1GJTA 4JYAM 3L27A 3MMPA 1QZMA 2P5TA 2B3TA 3SMPA 3U6PA 4LY6A 1EE8A 3FUWA 2KEBA 2MROB 1ZV1A 3U60A 2C5RA 4IBJA 3VFDA 2YNMD 1ORYB 4GKKM 4AKHA 4KT0F 2BJWA 2VQFM 3V76A 1PJSA 1G71A 2DVWB 3AJIB 1R6BX 1IBLM 1VEGA 3LVVA 1IN4A 5JI3E 3A46A 2KXEA 4LG2A 2KW0A 1TTEA 4GHLA 5KO3A 1ZMUA 2KNVA 4D81A 2RRUA 4MGIE 2GQFA 1E32A 1QQWA 1K3WA 4M0WA 2CV0A 1DGGA 2V6ZM 4AQYM 1SXJE 3GLGA 1QUSA 2LXEA 5DNYA 3KS4A 1GKIA 1KSFX 2CEAA 2GNOA 2QNJA 2O01F 4L6V6 1HNXM 5C1BA 3KOWE 1E9RA 1Q3BA 1OQYA 2UUBM 3GPYA 4KO8A 1K3XA 3U5ZB 2WSCF 2R46A 3CF0A 1GABA 1D0KA 3L29A 4LJ9A 4DR3M 2I7NA 2ZBKB 1GJSA 1MN3A 3HX3A 3T38A 1QAOA 2LVOC 5LMNM 4L8RC 2K0BX 4DR4M 1KYIA 4G4OA 1IN7A 1HNWM 2Y0QA 1T3TA 1OFIA 3A42A 3KOYE 3E21A 2V1CA 1ZAEA 2RGOA 4IBGA 1X37A 2Z3XA 3I4YA 4B08A 2XFSA 1IQPA 4IBDA 1NNUC 1NVMA 2VDBB 2EUCA 2LVPC 3GLIE 1XC8A 3T1YM 1N32M 1G41A 2DENA 4LF9M 2DWMA 3HGIA 4DV0M 3W67A 2JA2A 2CFOA 2C96A 2H1RA 1J5EM 2WSEF 2FFJA 2LHCA 1N36M 4OU7A
chains in the Genus database with same CATH topology
1F4IA 1IFYA 1XB2B 1P3QQ 1VQ1A 1HT1E 1V92A 4WP2A 1DO2A 3LCVB 2WZJA 5DFLA 3F92A 3LCUA 2CP8A 3E46A 1BVSA 1YLAA 1XXHE 2L4EA 1TR8A 2LBCA 1WR1B 3FE3A 3BBZA 2DI0A 2DHYA 2OO9A 1G3IA 1CUKA 4F1IA 2MJ5B 1GO5A 2OOBA 1R4GA 1NV8A 1PGYA 2K9DA 1WIVA 1UFZA 2JY5A 2JP7A 1NV9A 3GLFE 1E94E 1DV0A 2JY7A 1WJ7A 1HQYE 2MGWA 1HT2E 1WHCA 3IHPA 3IECA 2JZ0A 2G3QA 3H4JA 3T6PA 2JNHA 2O25A 1VG5A 3FRIA 3MMPA 2B3TA 2DNAA 2L4FA 1HJPA 2H5XA 2MROB 1ZV1A 1Q02A 2MR9A 1Y8GA 1A5TA 3GLGE 2DAIA 1JR3E 1VEGA 2JY8A 1T43A 2LVAA 4G3OA 1TTEA 1ZMUA 2KNVA 2HAKA 1QZEA 2RRUA 2BWEA 3FRHA 2L2DA 2OOAA 4R71A 2KNZA 2R0IA 3K9PA 5JI2E 4F2LA 1EFUB 2DKLA 2ZTCA 2QHOB 2QNJA 1IM2A 1AIPC 2KNAA 2BWBA 2HWJA 4DBGB 1OKSA 2LVNC 2ZTDA 1OQYA 1VDLA 2EKFA 1WGLA 1OAIA 1DO0A 2EKKA 4UN2B 1G4AE 2QSFX 1C7YA 4Q7JA 2CWBA 1T6OA 4GEWA 1ZMVA 1MN3A 1VEJA 1WGNA 2LVOC 2K0BX 2DZLA 2LTUA 2KHHA 1KYIA 1VEKA 4HEOA 3E21A 3B89A 1OTRA 1IXSA 1SG9A 2DAGA 2LVPC 2JUJA 3GLIE 2EJSA 1G41A 2DAKA 2DENA 2LVQD 3GLHE 1ZMWA 2DAEA 2JY6B 2DAMA 3K9OA 2JZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4I A;  1IFY A;  1XB2 B;  1P3Q Q;  1VQ1 A;  1HT1 E;  1V92 A;  4WP2 A;  1DO2 A;  3LCV B;  2WZJ A;  5DFL A;  3F92 A;  3LCU A;  2CP8 A;  3E46 A;  1BVS A;  1YLA A;  1XXH E;  2L4E A;  1TR8 A;  2LBC A;  1WR1 B;  3FE3 A;  3BBZ A;  2DI0 A;  2DHY A;  2OO9 A;  1G3I A;  1CUK A;  4F1I A;  2MJ5 B;  1GO5 A;  2OOB A;  1R4G A;  1NV8 A;  1PGY A;  2K9D A;  1WIV A;  1UFZ A;  2JY5 A;  2JP7 A;  1NV9 A;  3GLF E;  1E94 E;  1DV0 A;  2JY7 A;  1WJ7 A;  1HQY E;  2MGW A;  1HT2 E;  1WHC A;  3IHP A;  3IEC A;  2JZ0 A;  2G3Q A;  3H4J A;  3T6P A;  2JNH A;  2O25 A;  1VG5 A;  3FRI A;  3MMP A;  2B3T A;  2DNA A;  2L4F A;  1HJP A;  2H5X A;  2MRO B;  1ZV1 A;  1Q02 A;  2MR9 A;  1Y8G A;  1A5T A;  3GLG E;  2DAI A;  1JR3 E;  1VEG A;  2JY8 A;  1T43 A;  2LVA A;  4G3O A;  1TTE A;  1ZMU A;  2KNV A;  2HAK A;  1QZE A;  2RRU A;  2BWE A;  3FRH A;  2L2D A;  2OOA A;  4R71 A;  2KNZ A;  2R0I A;  3K9P A;  5JI2 E;  4F2L A;  1EFU B;  2DKL A;  2ZTC A;  2QHO B;  2QNJ A;  1IM2 A;  1AIP C;  2KNA A;  2BWB A;  2HWJ A;  4DBG B;  1OKS A;  2LVN C;  2ZTD A;  1OQY A;  1VDL A;  2EKF A;  1WGL A;  1OAI A;  1DO0 A;  2EKK A;  4UN2 B;  1G4A E;  2QSF X;  1C7Y A;  4Q7J A;  2CWB A;  1T6O A;  4GEW A;  1ZMV A;  1MN3 A;  1VEJ A;  1WGN A;  2LVO C;  2K0B X;  2DZL A;  2LTU A;  2KHH A;  1KYI A;  1VEK A;  4HEO A;  3E21 A;  3B89 A;  1OTR A;  1IXS A;  1SG9 A;  2DAG A;  2LVP C;  2JUJ A;  3GLI E;  2EJS A;  1G41 A;  2DAK A;  2DEN A;  2LVQ D;  3GLH E;  1ZMW A;  2DAE A;  2JY6 B;  2DAM A;  3K9O A;  2JZ1 A; 
#chains in the Genus database with same CATH topology
 1IFY A;  2EO2 A;  4R7G A;  1XB2 B;  2L7H A;  2BJV A;  1VQ1 A;  2F5N A;  4MH0 E;  1HT1 E;  4WP2 A;  2VF7 A;  1IBK M;  3KS8 A;  4AKI A;  3LCV B;  4L78 A;  3AL0 C;  3LCU A;  1TH3 A;  4LZJ A;  1NHW C;  5LMU M;  1IN8 A;  4L4U A;  4KLN A;  2Z8Y M;  4Y28 F;  1BVS A;  1W5T A;  3FD9 A;  5BR8 M;  3TWK A;  2C99 A;  1WR1 B;  3MJ5 A;  3GLF A;  1IBM M;  4I5S A;  4AG5 A;  3FUV A;  2DI0 A;  2DWZ B;  3ZH9 B;  4QOS A;  1CUK A;  1N75 A;  2VF8 A;  2L09 A;  3KP1 E;  4G4R A;  1Z5B A;  1HR0 M;  3QYB A;  3EIE A;  2RKO A;  1R4G A;  3EIH A;  3KVW A;  1C1K A;  3HU3 A;  5KPR A;  4LFB M;  2JY5 A;  3KP0 E;  4QNM A;  4IBI A;  3U6E A;  3GLH B;  1DV0 A;  3GP1 A;  2QPA A;  3L2A A;  2JXN A;  2XF3 A;  3U61 A;  3LVW A;  1D0L A;  3AFH A;  3FTF A;  1XHB A;  3VKG A;  4IBB A;  5ITY A;  5KPZ A;  5L8R F;  4RNA A;  3PVS A;  2L4F A;  1HJP A;  4RKU F;  1PJJ A;  1IXS B;  1SXJ A;  4X62 M;  4XBO A;  4LRT A;  5ITR A;  4L15 A;  4REZ A;  1DGB A;  1WXQ A;  2X8A A;  4LZZ A;  4DV1 M;  3SAV A;  1PJI A;  2QBY A;  5KQD A;  1GL6 A;  1L8Q A;  2LVA A;  3ZQJ A;  3HHX A;  4WUR A;  1GL7 A;  1IN5 A;  1QZE A;  2CV1 A;  5KQ8 A;  3AOE A;  5E26 A;  3FRH A;  2L2D A;  3AKZ A;  4R71 A;  2UU9 M;  3D8L A;  2HHH M;  4LCB A;  3GQ3 A;  4DV6 M;  4NOO B;  5JI2 E;  4OVZ B;  2KA6 B;  3FUT A;  5EJC A;  3KDS E;  1Z5A A;  2QHO B;  3I04 M;  4JI2 M;  1Z59 A;  1AIP C;  1GVN A;  1DGH B;  2KNA A;  3MHV C;  4FW9 A;  3J81 S;  3C3E A;  3DZD A;  2LVN C;  3U60 B;  3KFU G;  1L2B A;  5FTN A;  1L1Z A;  4LFA M;  3R8F A;  1ZQ9 A;  1OAI A;  1J09 A;  4FCW A;  2V1U A;  3DOA A;  3HJ8 A;  3GLI A;  4IBK A;  4FCV A;  2XSZ A;  2CRU A;  2R4J A;  4AZF A;  2KDL A;  3LW5 F;  4P16 A;  4I8O A;  5KPT A;  1VEJ A;  3I01 M;  3TL4 X;  2DZL A;  2KRK A;  1VEK A;  3U6S A;  4AKG A;  4W5W A;  2L6O A;  3GLG B;  4DV3 M;  3K2L A;  3SYK A;  3FYD A;  3UJN A;  4JI6 M;  3B7Q A;  2JUJ A;  3R9X B;  2EJS A;  3DA1 A;  3PNV A;  2DAK A;  2JWS A;  3GLH E;  3HJS A;  5EXP A;  3UK6 A;  3C58 A;  4B7G A;  2BNK A;  3NWL A;  5FTL A;  3SC3 A;  2CHG A;  1D0M A;  4I4L A;  3SAW A;  1MX0 A;  4HEO A;  3HJQ A;  2O5R A;  1YE9 A;  2R6F A;  3CTW B;  3B9P A;  3KOX E;  2UUA M;  4KHP M;  3QWL A;  4LF5 M;  4DUZ M;  4IBF A;  4LF8 M;  2WZJ A;  1RU3 A;  2DHR A;  2FOI C;  1V34 A;  3F92 A;  3KOZ E;  2CUZ A;  2C9C A;  2MH8 A;  2J7N A;  3E46 A;  4B3R M;  3RFW A;  2VQE M;  1MU5 A;  2F4V M;  2APL A;  2Q2E B;  1GLN A;  4X65 M;  3K1J A;  1JB0 F;  4JN6 A;  5GKN A;  1G8P A;  4WW0 A;  3GQ4 A;  1Q3C A;  2DHY A;  2J5Y A;  1G3I A;  3JR4 A;  3M6A A;  2YFQ A;  3U5Z A;  3L28 A;  1I4W A;  3GRV A;  4LJ7 A;  2EA0 A;  1NY5 A;  2DZO B;  3ZCB B;  2OOB A;  1N77 A;  2QZ4 A;  3TQS A;  1JR3 D;  2Y21 A;  1LV7 A;  3WHL A;  2K9D A;  5ITQ A;  4S12 A;  3CGW A;  4B7F A;  1XNQ M;  4FWH A;  1TF0 B;  4OX9 M;  3PFI A;  2JY7 A;  2UXD M;  3GRY A;  2FS1 A;  3HU2 A;  3T15 A;  1E9S A;  4OW0 A;  3IEC A;  4X64 M;  1XMO M;  2ERC A;  3HHW A;  3H4J A;  4HL4 A;  2JNH A;  3TPZ A;  3NBI A;  1OJL A;  3M7G A;  1J7K A;  4PT5 A;  3UZU A;  3FRI A;  5IT9 S;  2H5X A;  3Q8G A;  3KSX A;  3HU1 A;  3HHY A;  3CF2 A;  4LF4 M;  1EIJ A;  5DYI A;  4LF7 M;  3TE6 A;  3W0L B;  5ITX E;  4LJ8 A;  1Y8G A;  4CIS A;  1XXH B;  1MJG M;  1A5T A;  4B3S M;  3GLG E;  4M9Z A;  1R2Z A;  4DV4 M;  1SXJ C;  3J2P B;  3SAU A;  2JY8 A;  1T43 A;  3GPP A;  2R45 A;  4KOD A;  4G3O A;  3SYL A;  4QOZ C;  3GO8 A;  4NC6 A;  4MGH A;  3J80 S;  3U6L A;  2CHV A;  1TDH A;  4RF1 A;  1V33 A;  1Z5C A;  2OOA A;  1IY2 A;  4LGM A;  2KNZ A;  2R0I A;  3K9P A;  3U61 B;  4GMQ A;  4MGZ E;  4F2L A;  1EFU B;  3VDU A;  1I94 M;  5F3W A;  1FNN A;  3AOE C;  3HKP A;  3M0E A;  2ZTC A;  4JI1 M;  4IJE A;  4II7 A;  1NJG A;  4JI8 M;  1IM2 A;  4X66 M;  4G6Z A;  4BLC A;  1OIZ A;  3B74 A;  4JI0 M;  3HY5 A;  1IXZ A;  3B7Z A;  2X4A A;  4IIW A;  4DBG B;  1OKS A;  4EIW A;  1IY0 A;  2G5G X;  2ZTD A;  2EKF A;  5IZ7 D;  2HCB A;  4MGY E;  1WGL A;  3QAU A;  3DFZ A;  2EKK A;  4YHH M;  4UN2 B;  3A45 A;  1QYR A;  5FLX S;  4B3T M;  1G4A E;  2XZF A;  2ZM6 M;  3U6C A;  1K82 A;  3GLH A;  2CWB A;  4M0D A;  2M5Z A;  5BPV A;  3B7N A;  1ZMV A;  3T1H M;  1NNJ A;  3JAM S;  4I81 A;  3HHZ A;  2HKJ A;  2YQZ A;  2LTU A;  4B7H A;  4DV7 M;  2KHH A;  3J7B A;  4P17 A;  4DR1 M;  1XWI A;  1OIP A;  4BB9 A;  1N33 M;  3SAT A;  2XGN A;  2R62 A;  1OTR A;  3LQQ A;  5DYG A;  4RF0 A;  3VK8 A;  1IXS A;  1SG9 A;  3KW6 A;  4QHS A;  4JV5 M;  3FTE A;  4PD2 A;  3VKH A;  1OFH A;  5A2Q S;  1AUA A;  1PRB A;  3I51 A;  1QAN A;  2QP9 X;  2DAE A;  3NBX X;  2F5Q A;  1Z6T A;  2FNA A;  2DAM A;  3K9O A;  2JZ1 A;  4GC5 A;  4ANR A;  1R2Y A;  4JI5 M;  4M9X A;  4XGI A;  2F5P A;  1P3Q Q;  3VDP A;  2XH9 A;  5FTJ A;  2G8L A;  1V92 A;  2Z7J A;  1DO2 A;  3HWS A;  4FVM A;  1DGF A;  4LJA A;  3SBJ A;  5DFL A;  4LFC M;  2L7I A;  1H6U A;  2CP8 A;  2XEP A;  3BOS A;  2NQ8 C;  2N35 A;  4OVZ A;  1UM8 A;  2QEN A;  4CIZ A;  5EP4 A;  1YLA A;  2CV2 A;  1XXH E;  2L4E A;  4MM3 B;  5EXS A;  5FTK A;  2LBC A;  1IXR C;  3GRR A;  1DGH A;  4GIP A;  3D8B A;  3FE3 A;  5EP1 A;  4TUW A;  4CGY B;  4M9S A;  4BBA A;  3LQR A;  3BBZ A;  4XK8 F;  2OO9 A;  5EP3 A;  2DWN A;  1NO1 A;  3AOG A;  2QCU A;  1TGU A;  1XMQ M;  2D7H A;  2CHQ A;  2F5S A;  4LF6 M;  3TWL A;  3UMM A;  1NV8 A;  3E4R A;  3C3D A;  3H4M A;  3FUU A;  1WIV A;  1UFZ A;  5EP2 A;  3GPX A;  1QUT A;  2JP7 A;  2M60 A;  5ITX A;  5EXT A;  3FYC A;  5IWA M;  3U6M A;  4D80 A;  1WJ7 A;  1HQY E;  3RGP A;  1QVR A;  1HT2 E;  1WHC A;  1SXJ D;  3BXW A;  2JZ0 A;  1Q39 A;  4A3V B;  3L26 A;  3T6P A;  4IBE A;  2R18 A;  4NSR A;  2DXI A;  3K8Z A;  2ZAM A;  1R5L A;  4Z8X A;  1S3S A;  4CJ6 A;  3GPU A;  1QDT A;  2DNA A;  3IG5 A;  2C9O A;  3THG A;  4GKJ M;  2XFT A;  1W5S A;  3Q8X A;  3GRU A;  1PM5 A;  1Q02 A;  4MGK E;  3RGS A;  3SHG B;  2UUC M;  2ZAN A;  2MR9 A;  3FTD A;  4DR6 M;  4JI7 M;  1R7R A;  2DAI A;  4AI6 A;  1JR3 E;  3IG8 A;  1IN6 A;  5E6J A;  3SMS A;  2XLJ A;  3J27 B;  2K6B A;  1PJQ A;  2OPF A;  1N34 M;  1HNZ M;  1PJT A;  4NXN M;  3QYE A;  4YY3 M;  2HAK A;  3ILK A;  1TH2 A;  1LTM A;  5EQT A;  2BWE A;  4LGY A;  3SAR A;  4JI4 M;  4K0K M;  4QHT A;  2RGH A;  3HZJ A;  5FSW A;  3SAS A;  2UXB M;  4AG6 A;  2UXC M;  4JXJ A;  4DR2 M;  3TWM A;  2DKL A;  4GIT A;  4NSO B;  3FKE A;  4DV2 M;  3U6D A;  3SFZ A;  4ITQ A;  4FCT A;  3SHF A;  3GLF B;  2BWB A;  4PCZ A;  2D7E A;  2HWJ A;  1XNR M;  2J7O A;  2XSZ D;  5EXX A;  2R44 A;  1VDL A;  2LH0 A;  1NSF A;  4Z6Y A;  1DO0 A;  2HL7 A;  2KZS A;  3C9P A;  2R4E A;  2QSF X;  1C7Y A;  4Q7J A;  3OTO M;  3VK7 A;  1T6O A;  2D7G A;  2Z4S A;  4QNR A;  2Y0T A;  4GEW A;  1WGN A;  4FWG A;  2QQ8 A;  3FUX A;  3LMM A;  2OQ4 A;  2F5O A;  1NY6 A;  3B89 A;  1JQJ C;  1TH4 A;  1KFV A;  1D2N A;  4DR5 M;  4GH9 A;  1HQC A;  2C98 A;  3J7A S;  2ZAO A;  2DAG A;  2R65 A;  4FWD A;  2LVQ D;  4PDI A;  2FH0 A;  1XXH A;  1ZMW A;  4B3M M;  8CAT A;  1SXJ B;  2JY6 B;  4GC9 A;  3MK6 A;  3E9S A;  2LNH C;  5ITU A;  4DUY M;  1F4I A;  4NL4 H;  5FTM A;  4CHT B;  4GRI A;  3KSJ A;  3UGJ A;  1YSY A;  2XZU A;  2A5Y B;  2Y20 A;  2QBY B;  1TDZ A;  4HLQ A;  5ITT A;  1L2D A;  2CE7 A;  2VII A;  4ZPX A;  4NXM M;  2WSF F;  2I7P A;  2KRU A;  5H37 D;  3U6Q A;  4DR7 M;  3W68 A;  1QDR A;  3WHK A;  4LRS A;  1OAO C;  3L25 A;  1NJF A;  3PXG A;  4LJ6 A;  4DV5 M;  1NHG C;  1FJG M;  1TR8 A;  2AHM A;  3RE8 A;  4G4Q A;  3PNY A;  4IJF A;  4IBC A;  4MB7 A;  4NRW A;  3JR5 A;  4L16 A;  1YUB A;  2K47 A;  1QAQ A;  4G4N A;  2YR0 A;  1N78 A;  5IRE B;  3I4V A;  3AV0 A;  4JI3 M;  4F1I A;  1G59 A;  1QAM A;  1IY1 A;  2MJ5 B;  1GO5 A;  2Z4R A;  4NRV A;  3A98 B;  3FTC A;  1PGY A;  2W82 A;  3K92 A;  2LWX A;  4LJ4 A;  7CAT A;  2X49 A;  2E5L M;  3KXE C;  3GLI B;  3U6O A;  3VLF B;  2DWL A;  1NV9 A;  3GLF E;  1E94 E;  3CF6 E;  4R3D A;  2LHG A;  2MGW A;  4GHA A;  3IHP A;  3W0F A;  1JR3 A;  1VDD A;  4D82 A;  2DZN B;  2KZU A;  3ZC7 B;  4PDG A;  1L1T A;  1L2C A;  2G3Q A;  4AW4 A;  2FE8 A;  3GQ5 A;  4LJ5 A;  2O25 A;  5C18 A;  1VG5 A;  4FD2 A;  1GJT A;  4JYA M;  3L27 A;  3MMP A;  1QZM A;  2P5T A;  2B3T A;  3SMP A;  3U6P A;  4LY6 A;  1EE8 A;  3FUW A;  2KEB A;  2MRO B;  1ZV1 A;  3U60 A;  2C5R A;  4IBJ A;  3VFD A;  2YNM D;  1ORY B;  4GKK M;  4AKH A;  4KT0 F;  2BJW A;  2VQF M;  3V76 A;  1PJS A;  1G71 A;  2DVW B;  3AJI B;  1R6B X;  1IBL M;  1VEG A;  3LVV A;  1IN4 A;  5JI3 E;  3A46 A;  2KXE A;  4LG2 A;  2KW0 A;  1TTE A;  4GHL A;  5KO3 A;  1ZMU A;  2KNV A;  4D81 A;  2RRU A;  4MGI E;  2GQF A;  1E32 A;  1QQW A;  1K3W A;  4M0W A;  2CV0 A;  1DGG A;  2V6Z M;  4AQY M;  1SXJ E;  3GLG A;  1QUS A;  2LXE A;  5DNY A;  3KS4 A;  1GKI A;  1KSF X;  2CEA A;  2GNO A;  2QNJ A;  2O01 F;  4L6V 6;  1HNX M;  5C1B A;  3KOW E;  1E9R A;  1Q3B A;  1OQY A;  2UUB M;  3GPY A;  4KO8 A;  1K3X A;  3U5Z B;  2WSC F;  2R46 A;  3CF0 A;  1GAB A;  1D0K A;  3L29 A;  4LJ9 A;  4DR3 M;  2I7N A;  2ZBK B;  1GJS A;  1MN3 A;  3HX3 A;  3T38 A;  1QAO A;  2LVO C;  5LMN M;  4L8R C;  2K0B X;  4DR4 M;  1KYI A;  4G4O A;  1IN7 A;  1HNW M;  2Y0Q A;  1T3T A;  1OFI A;  3A42 A;  3KOY E;  3E21 A;  2V1C A;  1ZAE A;  2RGO A;  4IBG A;  1X37 A;  2Z3X A;  3I4Y A;  4B08 A;  2XFS A;  1IQP A;  4IBD A;  1NNU C;  1NVM A;  2VDB B;  2EUC A;  2LVP C;  3GLI E;  1XC8 A;  3T1Y M;  1N32 M;  1G41 A;  2DEN A;  4LF9 M;  2DWM A;  3HGI A;  4DV0 M;  3W67 A;  2JA2 A;  2CFO A;  2C96 A;  2H1R A;  1J5E M;  2WSE F;  2FFJ A;  2LHC A;  1N36 M;  4OU7 A; 
#chains in the Genus database with same CATH homology
 1F4I A;  1IFY A;  1XB2 B;  1P3Q Q;  1VQ1 A;  1HT1 E;  1V92 A;  4WP2 A;  1DO2 A;  3LCV B;  2WZJ A;  5DFL A;  3F92 A;  3LCU A;  2CP8 A;  3E46 A;  1BVS A;  1YLA A;  1XXH E;  2L4E A;  1TR8 A;  2LBC A;  1WR1 B;  3FE3 A;  3BBZ A;  2DI0 A;  2DHY A;  2OO9 A;  1G3I A;  1CUK A;  4F1I A;  2MJ5 B;  1GO5 A;  2OOB A;  1R4G A;  1NV8 A;  1PGY A;  2K9D A;  1WIV A;  1UFZ A;  2JY5 A;  2JP7 A;  1NV9 A;  3GLF E;  1E94 E;  1DV0 A;  2JY7 A;  1WJ7 A;  1HQY E;  2MGW A;  1HT2 E;  1WHC A;  3IHP A;  3IEC A;  2JZ0 A;  2G3Q A;  3H4J A;  3T6P A;  2JNH A;  2O25 A;  1VG5 A;  3FRI A;  3MMP A;  2B3T A;  2DNA A;  2L4F A;  1HJP A;  2H5X A;  2MRO B;  1ZV1 A;  1Q02 A;  2MR9 A;  1Y8G A;  1A5T A;  3GLG E;  2DAI A;  1JR3 E;  1VEG A;  2JY8 A;  1T43 A;  2LVA A;  4G3O A;  1TTE A;  1ZMU A;  2KNV A;  2HAK A;  1QZE A;  2RRU A;  2BWE A;  3FRH A;  2L2D A;  2OOA A;  4R71 A;  2KNZ A;  2R0I A;  3K9P A;  5JI2 E;  4F2L A;  1EFU B;  2DKL A;  2ZTC A;  2QHO B;  2QNJ A;  1IM2 A;  1AIP C;  2KNA A;  2BWB A;  2HWJ A;  4DBG B;  1OKS A;  2LVN C;  2ZTD A;  1OQY A;  1VDL A;  2EKF A;  1WGL A;  1OAI A;  1DO0 A;  2EKK A;  4UN2 B;  1G4A E;  2QSF X;  1C7Y A;  4Q7J A;  2CWB A;  1T6O A;  4GEW A;  1ZMV A;  1MN3 A;  1VEJ A;  1WGN A;  2LVO C;  2K0B X;  2DZL A;  2LTU A;  2KHH A;  1KYI A;  1VEK A;  4HEO A;  3E21 A;  3B89 A;  1OTR A;  1IXS A;  1SG9 A;  2DAG A;  2LVP C;  2JUJ A;  3GLI E;  2EJS A;  1G41 A;  2DAK A;  2DEN A;  2LVQ D;  3GLH E;  1ZMW A;  2DAE A;  2JY6 B;  2DAM A;  3K9O A;  2JZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...