2DENA

Solution structure of the ubiquitin-associated domain of human bmsc-ubp and its complex with ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
b'GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords chimera of Immunoglobulin G binding protein G and Ubiquitin-
publication title Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin
pubmed doi rcsb
source organism Streptococcus sp., homo sapiens
molecule tags Protein binding
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2denA00
2LVOC 2CP8A 2MJ5B 2O25A 1V92A 2HWJA 2LVPC 2MGWA 2DNAA 2K9DA 2DAMA 1A5TA 3MMPA 1HT2E 2LVQD 4R71A 1VQ1A 1ZMVA 2QSFX 3FRIA 2EJSA 2KNVA 2BWEA 1WGLA 1WGNA 1VDLA 2JZ1A 2DZLA 4GEWA 1Y8GA 1T43A 3FE3A 1DV0A 2BWBA 1ZV1A 3GLFE 2JY6B 1DO0A 3GLHE 1OKSA 1VG5A 2G3QA 1IM2A 1ZMUA 1WR1B 3GLIE 2DKLA 2OOAA 1VEJA 1XXHE 2LTUA 1AIPC 2QHOB 1DO2A 1TTEA 2R0IA 1P3QQ 1EFUB 1F4IA 1MN3A 1NV8A 1OQYA 2KHHA 2JY8A 1UFZA 1WJ7A 1HQYE 2EKKA 3E21A 2DI0A 2HAKA 1OAIA 2JP7A 1SG9A 2MR9A 3F92A 1G4AE 1R4GA 2DAEA 2DAKA 2MROB 1HJPA 3LCUA 3K9PA 1BVSA 4UN2B 2RRUA 3E46A 2ZTCA 3BBZA 1KYIA 4Q7JA 2WZJA 3LCVB 1ZMWA 1G3IA 3K9OA 4WP2A 2ZTDA 2LVNC 1XB2B 2OO9A 2H5XA 1JR3E 2B3TA 1NV9A 4F2LA 2DHYA 2DAIA 4DBGB 2DAGA 1Q02A 2JY5A 1WHCA 1VEKA 2L4EA 1GO5A 2LVAA 1VEGA 5JI2E 1T6OA 5DFLA 1IXSA 2KNZA 1C7YA 1E94E 1IFYA 2JNHA 3IECA 2KNAA 3B89A 2DENA 1TR8A 4HEOA 3T6PA 2JZ0A 1G41A 1YLAA 2L4FA 3FRHA 2JY7A 1PGYA 3GLGE 1HT1E 1OTRA 2JUJA 2K0BX 1CUKA 2CWBA 3IHPA 2OOBA 2LBCA 2L2DA 3H4JA 2QNJA 2EKFA 4G3OA 4F1IA 1WIVA 1QZEA
chains in the Genus database with same CATH superfamily
3FTCA 3RFWA 4GHAA 2CHVA 2QQ8A 3B7ZA 4GRIA 4B7FA 2LVOC 3HU1A 2XGNA 4CGYB 2FNAA 2J7NA 1Q3BA 4IBBA 1L1ZA 4L4UA 3C9PA 2DNAA 2K9DA 2ZAMA 3VK7A 3PVSA 1KFVA 3QAUA 3RE8A 2DWLA 4FCWA 1YSYA 3FUWA 2OPFA 2LVQD 1HR0M 3IG5A 3FYDA 4R71A 2QSFX 4KT0F 2V1CA 4GEWA 5EP4A 4GH9A 2DZLA 2R18A 1DV0A 4JI3M 4IIWA 4AW4A 3ZC7B 2JY6B 3FUTA 1IN5A 1C1KA 1Z5AA 1VG5A 3K8ZA 3SBJA 4K0KM 3I51A 1XXHB 2HL7A 3LMMA 2I7NA 1VEJA 2XFTA 1J09A 3KOYE 3NBIA 4NSRA 1AIPC 3KVWA 1RU3A 3JR5A 2QHOB 2X8AA 3U6SA 3R8FA 3K1JA 3NWLA 1J5EM 3U6OA 4G6ZA 2LHGA 2L6OA 1L2CA 4NXMM 4RF0A 2CE7A 2HHHM 4LGYA 1OQYA 3AL0C 3TPZA 1IXRC 1QVRA 4MGHA 3HX3A 3SYLA 4P17A 3PXGA 4LF9M 4R3DA 4JI0M 3GQ4A 2VIIA 3SMSA 4LF8M 2DXIA 3E21A 4LJ7A 2C96A 1QZMA 2DI0A 2HAKA 2Z4RA 4RKUF 1L2DA 3C3EA 1R4GA 3SAWA 1QANA 2DVWB 4L15A 1HJPA 4DR7M 2M5ZA 1OJLA 1BVSA 4IBEA 4QNRA 4UN2B 2RRUA 5ITXA 3BBZA 3L2AA 3J7AS 3KOXE 1TDHA 1IXZA 1NNJA 2WZJA 3LCVB 5ITYA 3U60A 2GQFA 1QDTA 3KOZE 4Z6YA 2YFQA 1JR3D 3E4RA 3FYCA 3M0EA 4X66M 3AKZA 4LF6M 1E9RA 4LFBM 1I4WA 2N35A 2OO9A 3GLGB 8CATA 2H5XA 1R5LA 2F5PA 2VDBB 1JQJC 2XEPA 3SATA 2JWSA 5FTLA 2R44A 4F2LA 5IZ7D 1I94M 2VQFM 3B7QA 2D7GA 5LMNM 2ZBKB 2DAGA 3GRRA 3L25A 3GRVA 1GO5A 3GP1A 2LVAA 3B7NA 3ILKA 5FTNA 1TH2A 2FFJA 2XSZA 4OX9M 1T6OA 1IXSA 1PJIA 4LF7M 1VDDA 3HHZA 1E94E 2JNHA 3IECA 1Q39A 4IBFA 4MGIE 2CEAA 1XNQM 1TF0B 4B3RM 4B3TM 2LH0A 4LJ5A 1NVMA 1PJQA 5FTKA 2F5NA 1XNRM 1W5TA 1V33A 3SMPA 4AG5A 3RGSA 3DOAA 4OVZA 1TH3A 3U61B 2UXDM 2JY7A 3GLFB 2QBYA 4DR3M 3GLGE 2D7EA 2F4VM 2NQ8C 1CUKA 5ITRA 5A2QS 2LBCA 3HY5A 5C1BA 2QNJA 3AV0A 2EKFA 4G3OA 4JXJA 4MGZE 5KPTA 3H4MA 2EUCA 1SXJB 4JN6A 1IN7A 4F1IA 3GPUA 1L1TA 4JI4M 2FOIC 4GITA 2UUAM 4PDIA 4REZA 1D0MA 2K47A 3LVVA 3SAVA 4LJ8A 4LJ6A 1V92A 2HWJA 1FJGM 1XC8A 4IBKA 4AKHA 1H6UA 3U6QA 4ANRA 4I8OA 2D7HA 4QOSA 5EXTA 4AQYM 4ITQA 1HNZM 4JI5M 1HT2E 1QAQA 1R7RA 2DZNB 2FH0A 3AFHA 1VQ1A 1N78A 2EJSA 2JXNA 2KNVA 1WGLA 2JZ1A 3CTWB 4LFAM 1NO1A 1Y8GA 4X62M 1NJGA 3TWLA 2BWBA 1ZV1A 3LW5F 3HJSA 3GLFE 3BOSA 3SFZA 3DFZA 4M9XA 1NNUC 4NRVA 2G3QA 4QHTA 4AZFA 4HLQA 1YUBA 4PCZA 1ZMUA 1WR1B 2WSFF 4MGKE 4B3SM 3W0LB 2DKLA 3GQ3A 2V6ZM 4I81A 3SARA 1SXJE 3A98B 3CF6E 3I4YA 1T3TA 3FUVA 2UXCM 1J7KA 3JR4A 1ORYB 4FWGA 5EP1A 2R0IA 1EFUB 1QAMA 3TL4X 3VDPA 4YHHM 4IBJA 5C18A 5F3WA 4GHLA 4I5SA 3KW6A 1NY6A 1HNXM 2GNOA 5FLXS 4M0WA 3UMMA 2LXEA 3LVWA 4IBCA 2ZAOA 4HL4A 1HQYE 1PJSA 4CIZA 2RGHA 4FW9A 5IWAM 4WW0A 2K6BA 3HHXA 4DV3M 3M6AA 1G4AE 3M7GA 4S12A 3AOEC 4BBAA 1XMQM 4DR4M 4JI7M 2DAKA 4X64M 4QOZC 2Q2EB 2ERCA 3FKEA 1OFIA 2R62A 3K9PA 1PM5A 4FD2A 2XFSA 3QYBA 5ITQA 4Q7JA 2Z8YM 4JI2M 1ZMWA 1R2YA 1PJTA 2KDLA 2ZTDA 4XBOA 2LVNC 1XB2B 2AHMA 1D2NA 2Z4SA 5BR8M 5KO3A 4JI1M 2W82A 1W5SA 3HJQA 3KXEC 2VF8A 4DUYM 1ZAEA 5H37D 4GIPA 2Z7JA 3JAMS 2KZSA 5ITUA 5LMUM 1IBMM 1WHCA 3FUXA 1VEKA 2UUBM 3HWSA 4DV2M 3D8BA 4RF1A 2BJVA 1WXQA 2KA6B 3GLHA 2CV1A 2KNZA 3TE6A 1IFYA 2KNAA 1IY2A 3GLIA 2KZUA 4DV6M 3B89A 4LF5M 3UK6A 3VKHA 1N77A 1MJGM 1D0KA 1TGUA 3GRYA 4MGYE 4L78A 2JZ0A 2KRKA 2XLJA 2YR0A 2VQEM 1NY5A 3KS4A 2CHGA 2E5LM 3U5ZA 3A45A 1GLNA 4LJAA 2EA0A 1JR3A 4B7GA 4GMQA 3SHGB 1MU5A 1HT1E 4BLCA 4D82A 3Q8XA 4LJ4A 4XGIA 2F5SA 2L2DA 1LV7A 2O01F 3I01M 3ZH9B 3UGJA 3FTDA 3L27A 4II7A 1QQWA 1N75A 3J2PB 4FCTA 5GKNA 1GJTA 3U60B 3HZJA 4IBGA 3T38A 2Y0QA 4QNMA 1JB0F 2CP8A 2MH8A 3BXWA 2MJ5B 1Z5BA 2MGWA 4X65M 3EIEA 1X37A 4KHPM 5IT9S 3AOEA 2DAMA 1TH4A 3MMPA 4KO8A 4NL4H 3TQSA 2QZ4A 3KOWE 1IN6A 5KQDA 5E6JA 4G4OA 4M0DA 2UU9M 2YQZA 2LHCA 1IQPA 1OIPA 2XZUA 1GL7A 1T43A 5EXSA 3GPYA 4DV1M 3GO8A 4NRWA 1IXSB 3CGWA 1L8QA 4L6V6 4JYAM 2VF7A 3GLHE 4BB9A 3FTFA 1PRBA 2ZANA 1SXJD 2C98A 4JI8M 4EIWA 3GLIE 4AKGA 5ITXE 2LTUA 2X4AA 3I4VA 2YNMD 3Q8GA 4JI6M 5EXXA 1DO2A 3U6LA 1TTEA 1E32A 1P3QQ 2Y0TA 3FD9A 3NBXX 3EIHA 4OVZB 3T1YM 1F4IA 2QBYB 1MN3A 3HGIA 4G4RA 1S3SA 2Y20A 2Y21A 4QHSA 2KHHA 4LG2A 3R9XB 1HNWM 2JY8A 3AJIB 1GKIA 1TDZA 1UM8A 1DGHA 1DGGA 2EKKA 4NSOB 3KSXA 5FSWA 3PFIA 4DUZM 5EP3A 5EQTA 2JP7A 4FWHA 4PD2A 1G8PA 5EP2A 2OQ4A 3F92A 5E26A 2HCBA 3LCUA 4MB7A 1LTMA 2X49A 2KXEA 2ZTCA 1K3XA 2G5GX 4YY3M 2QCUA 1G3IA 2JA2A 3A42A 3ZQJA 1QYRA 4W5WA 2UUCM 2R45A 1EIJA 1ZQ9A 1GVNA 3E9SA 4M9ZA 4D81A 3HU3A 4RNAA 3SHFA 5ITTA 1GABA 2KEBA 2R65A 3TWMA 2B3TA 1QUSA 2R4EA 4DV0M 1NV9A 5EJCA 4LFCM 3WHKA 2CV0A 3KS8A 4KODA 2EO2A 7CATA 3IG8A 3HU2A 3PNYA 1Q02A 4CISA 3CF2A 4FVMA 1N36M 2R46A 3C3DA 2L4EA 2UXBM 3MHVC 4NC6A 2H1RA 5JI3E 1IY0A 1V34A 1VEGA 5DFLA 3J81S 1QUTA 2FS1A 1C7YA 1OIZA 1Z5CA 3VK8A 4DR6M 3I04M 2QENA 3FUUA 4R7GA 3HHYA 4DR1M 1XXHA 2DENA 2DHRA 1Q3CA 3TWKA 1DGFA 4CJ6A 3L28A 2ZM6M 3QYEA 5DNYA 2V1UA 2L4FA 4ZPXA 3CF0A 4GC5A 1PGYA 4OU7A 3U6MA 4I4LA 1OTRA 2K0BX 3IHPA 2LNHC 2OOBA 1IN8A 1SXJC 3K92A 3U6EA 1OFHA 1PJJA 3VDUA 3B74A 4FWDA 1WIVA 2CUZA 4LRTA 2KRUA 2Z3XA 2L09A 1IBKM 2O25A 1IY1A 4LJ9A 2LVPC 4CHTB 2BNKA 3A46A 4DV4M 1G59A 1A5TA 2O5RA 3B9PA 5KPZA 3SYKA 2WSEF 4DR2M 4L8RC 4TUWA 1GL6A 4LY6A 1ZMVA 1XHBA 2CRUA 2M60A 3FRIA 5EXPA 2DWNA 2BWEA 1WGNA 1VDLA 3KDSE 1E9SA 3FE3A 3W0FA 2KW0A 4Z8XA 5DYGA 3GPPA 2RKOA 3GLHB 3GLGA 4G4QA 5KQ8A 4PDGA 2L7HA 3U6DA 1DO0A 2XH9A 2WSCF 3GLIB 1OKSA 2FE8A 1IM2A 2C5RA 3GPXA 5IREB 4MH0E 1NHWC 2C99A 3T15A 1GJSA 2BJWA 2OOAA 3DZDA 4LRSA 3THGA 2XZFA 3J27B 3KFUG 4GKJM 1XXHE 1L2BA 4IBIA 3SASA 4LCBA 3D8LA 2C9CA 3U5ZB 1K3WA 1N34M 3K2LA 5BPVA 1QAOA 1NV8A 2CV2A 4PT5A 1FNNA 2HKJA 2QP9X 4GC9A 3VFDA 3U6CA 2R4JA 3HKPA 1AUAA 5FTMA 4DR5M 1Z59A 1UFZA 4LF4M 4KLNA 4DV5M 1R6BX 1WJ7A 1MX0A 2XSZD 2LWXA 3KP0E 4GKKM 1OAIA 4P16A 3LQQA 3OTOM 3U61A 3UJNA 3GLFA 1NJFA 1NSFA 1SG9A 2MR9A 3AOGA 3KSJA 3WHLA 2DAEA 1KSFX 1K82A 3U6PA 2MROB 2A5YB 1EE8A 3J80S 3ZCBB 3SAUA 3E46A 1KYIA 1SXJA 3HHWA 5FTJA 2CFOA 4OW0A 4WP2A 3K9OA 4AG6A 2CHQA 2DWZB 3HJ8A 1JR3E 2RGOA 2F5QA 2G8LA 2DHYA 3J7BA 2DAIA 5DYIA 4JV5M 4AKIA 2R6FA 2F5OA 3MJ5A 4DBGB 1G71A 1HQCA 2JY5A 3DA1A 5L8RF 2XF3A 1N33M 4Y28F 4IJFA 2I7PA 4MM3B 2J7OA 1R2ZA 3W67A 4B08A 4NOOB 1IN4A 1OAOC 4FCVA 5JI2E 2C9OA 4DV7M 3L29A 3FTEA 1Z6TA 3SC3A 1NHGC 2L7IA 3VLFB 4M9SA 3C58A 3GRUA 3MK6A 1TR8A 2J5YA 2DZOB 1QDRA 4HEOA 1IBLM 3T6PA 3V76A 5KPRA 2DWMA 4D80A 1DGHB 1G41A 2P5TA 3RGPA 1YLAA 4AI6A 1XWIA 4L16A 3VKGA 3UZUA 1YE9A 2QPAA 4IJEA 4LZZA 3FRHA 3L26A 4LGMA 4G4NA 4B7HA 1N32M 3KP1E 4IBDA 3QWLA 2JUJA 1XMOM 1D0LA 2CWBA 4B3MM 3PNVA 3H4JA 4XK8F 4LZJA 2APLA 3T1HM 3GQ5A 1DGBA 4NXNM 4A3VB 3LQRA 4WURA 3W68A 1QZEA
chains in the Genus database with same CATH topology
2LVOC 2CP8A 2MJ5B 2O25A 1V92A 2HWJA 2LVPC 2MGWA 2DNAA 2K9DA 2DAMA 1A5TA 3MMPA 1HT2E 2LVQD 4R71A 1VQ1A 1ZMVA 2QSFX 3FRIA 2EJSA 2KNVA 2BWEA 1WGLA 1WGNA 1VDLA 2JZ1A 2DZLA 4GEWA 1Y8GA 1T43A 3FE3A 1DV0A 2BWBA 1ZV1A 3GLFE 2JY6B 1DO0A 3GLHE 1OKSA 1VG5A 2G3QA 1IM2A 1ZMUA 1WR1B 3GLIE 2DKLA 2OOAA 1VEJA 1XXHE 2LTUA 1AIPC 2QHOB 1DO2A 1TTEA 2R0IA 1P3QQ 1EFUB 1F4IA 1MN3A 1NV8A 1OQYA 2KHHA 2JY8A 1UFZA 1WJ7A 1HQYE 2EKKA 3E21A 2DI0A 2HAKA 1OAIA 2JP7A 1SG9A 2MR9A 3F92A 1G4AE 1R4GA 2DAEA 2DAKA 2MROB 1HJPA 3LCUA 3K9PA 1BVSA 4UN2B 2RRUA 3E46A 2ZTCA 3BBZA 1KYIA 4Q7JA 2WZJA 3LCVB 1ZMWA 1G3IA 3K9OA 4WP2A 2ZTDA 2LVNC 1XB2B 2OO9A 2H5XA 1JR3E 2B3TA 1NV9A 4F2LA 2DHYA 2DAIA 4DBGB 2DAGA 1Q02A 2JY5A 1WHCA 1VEKA 2L4EA 1GO5A 2LVAA 1VEGA 5JI2E 1T6OA 5DFLA 1IXSA 2KNZA 1C7YA 1E94E 1IFYA 2JNHA 3IECA 2KNAA 3B89A 2DENA 1TR8A 4HEOA 3T6PA 2JZ0A 1G41A 1YLAA 2L4FA 3FRHA 2JY7A 1PGYA 3GLGE 1HT1E 1OTRA 2JUJA 2K0BX 1CUKA 2CWBA 3IHPA 2OOBA 2LBCA 2L2DA 3H4JA 2QNJA 2EKFA 4G3OA 4F1IA 1WIVA 1QZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO C;  2CP8 A;  2MJ5 B;  2O25 A;  1V92 A;  2HWJ A;  2LVP C;  2MGW A;  2DNA A;  2K9D A;  2DAM A;  1A5T A;  3MMP A;  1HT2 E;  2LVQ D;  4R71 A;  1VQ1 A;  1ZMV A;  2QSF X;  3FRI A;  2EJS A;  2KNV A;  2BWE A;  1WGL A;  1WGN A;  1VDL A;  2JZ1 A;  2DZL A;  4GEW A;  1Y8G A;  1T43 A;  3FE3 A;  1DV0 A;  2BWB A;  1ZV1 A;  3GLF E;  2JY6 B;  1DO0 A;  3GLH E;  1OKS A;  1VG5 A;  2G3Q A;  1IM2 A;  1ZMU A;  1WR1 B;  3GLI E;  2DKL A;  2OOA A;  1VEJ A;  1XXH E;  2LTU A;  1AIP C;  2QHO B;  1DO2 A;  1TTE A;  2R0I A;  1P3Q Q;  1EFU B;  1F4I A;  1MN3 A;  1NV8 A;  1OQY A;  2KHH A;  2JY8 A;  1UFZ A;  1WJ7 A;  1HQY E;  2EKK A;  3E21 A;  2DI0 A;  2HAK A;  1OAI A;  2JP7 A;  1SG9 A;  2MR9 A;  3F92 A;  1G4A E;  1R4G A;  2DAE A;  2DAK A;  2MRO B;  1HJP A;  3LCU A;  3K9P A;  1BVS A;  4UN2 B;  2RRU A;  3E46 A;  2ZTC A;  3BBZ A;  1KYI A;  4Q7J A;  2WZJ A;  3LCV B;  1ZMW A;  1G3I A;  3K9O A;  4WP2 A;  2ZTD A;  2LVN C;  1XB2 B;  2OO9 A;  2H5X A;  1JR3 E;  2B3T A;  1NV9 A;  4F2L A;  2DHY A;  2DAI A;  4DBG B;  2DAG A;  1Q02 A;  2JY5 A;  1WHC A;  1VEK A;  2L4E A;  1GO5 A;  2LVA A;  1VEG A;  5JI2 E;  1T6O A;  5DFL A;  1IXS A;  2KNZ A;  1C7Y A;  1E94 E;  1IFY A;  2JNH A;  3IEC A;  2KNA A;  3B89 A;  2DEN A;  1TR8 A;  4HEO A;  3T6P A;  2JZ0 A;  1G41 A;  1YLA A;  2L4F A;  3FRH A;  2JY7 A;  1PGY A;  3GLG E;  1HT1 E;  1OTR A;  2JUJ A;  2K0B X;  1CUK A;  2CWB A;  3IHP A;  2OOB A;  2LBC A;  2L2D A;  3H4J A;  2QNJ A;  2EKF A;  4G3O A;  4F1I A;  1WIV A;  1QZE A; 
#chains in the Genus database with same CATH topology
 3FTC A;  3RFW A;  4GHA A;  2CHV A;  2QQ8 A;  3B7Z A;  4GRI A;  4B7F A;  2LVO C;  3HU1 A;  2XGN A;  4CGY B;  2FNA A;  2J7N A;  1Q3B A;  4IBB A;  1L1Z A;  4L4U A;  3C9P A;  2DNA A;  2K9D A;  2ZAM A;  3VK7 A;  3PVS A;  1KFV A;  3QAU A;  3RE8 A;  2DWL A;  4FCW A;  1YSY A;  3FUW A;  2OPF A;  2LVQ D;  1HR0 M;  3IG5 A;  3FYD A;  4R71 A;  2QSF X;  4KT0 F;  2V1C A;  4GEW A;  5EP4 A;  4GH9 A;  2DZL A;  2R18 A;  1DV0 A;  4JI3 M;  4IIW A;  4AW4 A;  3ZC7 B;  2JY6 B;  3FUT A;  1IN5 A;  1C1K A;  1Z5A A;  1VG5 A;  3K8Z A;  3SBJ A;  4K0K M;  3I51 A;  1XXH B;  2HL7 A;  3LMM A;  2I7N A;  1VEJ A;  2XFT A;  1J09 A;  3KOY E;  3NBI A;  4NSR A;  1AIP C;  3KVW A;  1RU3 A;  3JR5 A;  2QHO B;  2X8A A;  3U6S A;  3R8F A;  3K1J A;  3NWL A;  1J5E M;  3U6O A;  4G6Z A;  2LHG A;  2L6O A;  1L2C A;  4NXM M;  4RF0 A;  2CE7 A;  2HHH M;  4LGY A;  1OQY A;  3AL0 C;  3TPZ A;  1IXR C;  1QVR A;  4MGH A;  3HX3 A;  3SYL A;  4P17 A;  3PXG A;  4LF9 M;  4R3D A;  4JI0 M;  3GQ4 A;  2VII A;  3SMS A;  4LF8 M;  2DXI A;  3E21 A;  4LJ7 A;  2C96 A;  1QZM A;  2DI0 A;  2HAK A;  2Z4R A;  4RKU F;  1L2D A;  3C3E A;  1R4G A;  3SAW A;  1QAN A;  2DVW B;  4L15 A;  1HJP A;  4DR7 M;  2M5Z A;  1OJL A;  1BVS A;  4IBE A;  4QNR A;  4UN2 B;  2RRU A;  5ITX A;  3BBZ A;  3L2A A;  3J7A S;  3KOX E;  1TDH A;  1IXZ A;  1NNJ A;  2WZJ A;  3LCV B;  5ITY A;  3U60 A;  2GQF A;  1QDT A;  3KOZ E;  4Z6Y A;  2YFQ A;  1JR3 D;  3E4R A;  3FYC A;  3M0E A;  4X66 M;  3AKZ A;  4LF6 M;  1E9R A;  4LFB M;  1I4W A;  2N35 A;  2OO9 A;  3GLG B;  8CAT A;  2H5X A;  1R5L A;  2F5P A;  2VDB B;  1JQJ C;  2XEP A;  3SAT A;  2JWS A;  5FTL A;  2R44 A;  4F2L A;  5IZ7 D;  1I94 M;  2VQF M;  3B7Q A;  2D7G A;  5LMN M;  2ZBK B;  2DAG A;  3GRR A;  3L25 A;  3GRV A;  1GO5 A;  3GP1 A;  2LVA A;  3B7N A;  3ILK A;  5FTN A;  1TH2 A;  2FFJ A;  2XSZ A;  4OX9 M;  1T6O A;  1IXS A;  1PJI A;  4LF7 M;  1VDD A;  3HHZ A;  1E94 E;  2JNH A;  3IEC A;  1Q39 A;  4IBF A;  4MGI E;  2CEA A;  1XNQ M;  1TF0 B;  4B3R M;  4B3T M;  2LH0 A;  4LJ5 A;  1NVM A;  1PJQ A;  5FTK A;  2F5N A;  1XNR M;  1W5T A;  1V33 A;  3SMP A;  4AG5 A;  3RGS A;  3DOA A;  4OVZ A;  1TH3 A;  3U61 B;  2UXD M;  2JY7 A;  3GLF B;  2QBY A;  4DR3 M;  3GLG E;  2D7E A;  2F4V M;  2NQ8 C;  1CUK A;  5ITR A;  5A2Q S;  2LBC A;  3HY5 A;  5C1B A;  2QNJ A;  3AV0 A;  2EKF A;  4G3O A;  4JXJ A;  4MGZ E;  5KPT A;  3H4M A;  2EUC A;  1SXJ B;  4JN6 A;  1IN7 A;  4F1I A;  3GPU A;  1L1T A;  4JI4 M;  2FOI C;  4GIT A;  2UUA M;  4PDI A;  4REZ A;  1D0M A;  2K47 A;  3LVV A;  3SAV A;  4LJ8 A;  4LJ6 A;  1V92 A;  2HWJ A;  1FJG M;  1XC8 A;  4IBK A;  4AKH A;  1H6U A;  3U6Q A;  4ANR A;  4I8O A;  2D7H A;  4QOS A;  5EXT A;  4AQY M;  4ITQ A;  1HNZ M;  4JI5 M;  1HT2 E;  1QAQ A;  1R7R A;  2DZN B;  2FH0 A;  3AFH A;  1VQ1 A;  1N78 A;  2EJS A;  2JXN A;  2KNV A;  1WGL A;  2JZ1 A;  3CTW B;  4LFA M;  1NO1 A;  1Y8G A;  4X62 M;  1NJG A;  3TWL A;  2BWB A;  1ZV1 A;  3LW5 F;  3HJS A;  3GLF E;  3BOS A;  3SFZ A;  3DFZ A;  4M9X A;  1NNU C;  4NRV A;  2G3Q A;  4QHT A;  4AZF A;  4HLQ A;  1YUB A;  4PCZ A;  1ZMU A;  1WR1 B;  2WSF F;  4MGK E;  4B3S M;  3W0L B;  2DKL A;  3GQ3 A;  2V6Z M;  4I81 A;  3SAR A;  1SXJ E;  3A98 B;  3CF6 E;  3I4Y A;  1T3T A;  3FUV A;  2UXC M;  1J7K A;  3JR4 A;  1ORY B;  4FWG A;  5EP1 A;  2R0I A;  1EFU B;  1QAM A;  3TL4 X;  3VDP A;  4YHH M;  4IBJ A;  5C18 A;  5F3W A;  4GHL A;  4I5S A;  3KW6 A;  1NY6 A;  1HNX M;  2GNO A;  5FLX S;  4M0W A;  3UMM A;  2LXE A;  3LVW A;  4IBC A;  2ZAO A;  4HL4 A;  1HQY E;  1PJS A;  4CIZ A;  2RGH A;  4FW9 A;  5IWA M;  4WW0 A;  2K6B A;  3HHX A;  4DV3 M;  3M6A A;  1G4A E;  3M7G A;  4S12 A;  3AOE C;  4BBA A;  1XMQ M;  4DR4 M;  4JI7 M;  2DAK A;  4X64 M;  4QOZ C;  2Q2E B;  2ERC A;  3FKE A;  1OFI A;  2R62 A;  3K9P A;  1PM5 A;  4FD2 A;  2XFS A;  3QYB A;  5ITQ A;  4Q7J A;  2Z8Y M;  4JI2 M;  1ZMW A;  1R2Y A;  1PJT A;  2KDL A;  2ZTD A;  4XBO A;  2LVN C;  1XB2 B;  2AHM A;  1D2N A;  2Z4S A;  5BR8 M;  5KO3 A;  4JI1 M;  2W82 A;  1W5S A;  3HJQ A;  3KXE C;  2VF8 A;  4DUY M;  1ZAE A;  5H37 D;  4GIP A;  2Z7J A;  3JAM S;  2KZS A;  5ITU A;  5LMU M;  1IBM M;  1WHC A;  3FUX A;  1VEK A;  2UUB M;  3HWS A;  4DV2 M;  3D8B A;  4RF1 A;  2BJV A;  1WXQ A;  2KA6 B;  3GLH A;  2CV1 A;  2KNZ A;  3TE6 A;  1IFY A;  2KNA A;  1IY2 A;  3GLI A;  2KZU A;  4DV6 M;  3B89 A;  4LF5 M;  3UK6 A;  3VKH A;  1N77 A;  1MJG M;  1D0K A;  1TGU A;  3GRY A;  4MGY E;  4L78 A;  2JZ0 A;  2KRK A;  2XLJ A;  2YR0 A;  2VQE M;  1NY5 A;  3KS4 A;  2CHG A;  2E5L M;  3U5Z A;  3A45 A;  1GLN A;  4LJA A;  2EA0 A;  1JR3 A;  4B7G A;  4GMQ A;  3SHG B;  1MU5 A;  1HT1 E;  4BLC A;  4D82 A;  3Q8X A;  4LJ4 A;  4XGI A;  2F5S A;  2L2D A;  1LV7 A;  2O01 F;  3I01 M;  3ZH9 B;  3UGJ A;  3FTD A;  3L27 A;  4II7 A;  1QQW A;  1N75 A;  3J2P B;  4FCT A;  5GKN A;  1GJT A;  3U60 B;  3HZJ A;  4IBG A;  3T38 A;  2Y0Q A;  4QNM A;  1JB0 F;  2CP8 A;  2MH8 A;  3BXW A;  2MJ5 B;  1Z5B A;  2MGW A;  4X65 M;  3EIE A;  1X37 A;  4KHP M;  5IT9 S;  3AOE A;  2DAM A;  1TH4 A;  3MMP A;  4KO8 A;  4NL4 H;  3TQS A;  2QZ4 A;  3KOW E;  1IN6 A;  5KQD A;  5E6J A;  4G4O A;  4M0D A;  2UU9 M;  2YQZ A;  2LHC A;  1IQP A;  1OIP A;  2XZU A;  1GL7 A;  1T43 A;  5EXS A;  3GPY A;  4DV1 M;  3GO8 A;  4NRW A;  1IXS B;  3CGW A;  1L8Q A;  4L6V 6;  4JYA M;  2VF7 A;  3GLH E;  4BB9 A;  3FTF A;  1PRB A;  2ZAN A;  1SXJ D;  2C98 A;  4JI8 M;  4EIW A;  3GLI E;  4AKG A;  5ITX E;  2LTU A;  2X4A A;  3I4V A;  2YNM D;  3Q8G A;  4JI6 M;  5EXX A;  1DO2 A;  3U6L A;  1TTE A;  1E32 A;  1P3Q Q;  2Y0T A;  3FD9 A;  3NBX X;  3EIH A;  4OVZ B;  3T1Y M;  1F4I A;  2QBY B;  1MN3 A;  3HGI A;  4G4R A;  1S3S A;  2Y20 A;  2Y21 A;  4QHS A;  2KHH A;  4LG2 A;  3R9X B;  1HNW M;  2JY8 A;  3AJI B;  1GKI A;  1TDZ A;  1UM8 A;  1DGH A;  1DGG A;  2EKK A;  4NSO B;  3KSX A;  5FSW A;  3PFI A;  4DUZ M;  5EP3 A;  5EQT A;  2JP7 A;  4FWH A;  4PD2 A;  1G8P A;  5EP2 A;  2OQ4 A;  3F92 A;  5E26 A;  2HCB A;  3LCU A;  4MB7 A;  1LTM A;  2X49 A;  2KXE A;  2ZTC A;  1K3X A;  2G5G X;  4YY3 M;  2QCU A;  1G3I A;  2JA2 A;  3A42 A;  3ZQJ A;  1QYR A;  4W5W A;  2UUC M;  2R45 A;  1EIJ A;  1ZQ9 A;  1GVN A;  3E9S A;  4M9Z A;  4D81 A;  3HU3 A;  4RNA A;  3SHF A;  5ITT A;  1GAB A;  2KEB A;  2R65 A;  3TWM A;  2B3T A;  1QUS A;  2R4E A;  4DV0 M;  1NV9 A;  5EJC A;  4LFC M;  3WHK A;  2CV0 A;  3KS8 A;  4KOD A;  2EO2 A;  7CAT A;  3IG8 A;  3HU2 A;  3PNY A;  1Q02 A;  4CIS A;  3CF2 A;  4FVM A;  1N36 M;  2R46 A;  3C3D A;  2L4E A;  2UXB M;  3MHV C;  4NC6 A;  2H1R A;  5JI3 E;  1IY0 A;  1V34 A;  1VEG A;  5DFL A;  3J81 S;  1QUT A;  2FS1 A;  1C7Y A;  1OIZ A;  1Z5C A;  3VK8 A;  4DR6 M;  3I04 M;  2QEN A;  3FUU A;  4R7G A;  3HHY A;  4DR1 M;  1XXH A;  2DEN A;  2DHR A;  1Q3C A;  3TWK A;  1DGF A;  4CJ6 A;  3L28 A;  2ZM6 M;  3QYE A;  5DNY A;  2V1U A;  2L4F A;  4ZPX A;  3CF0 A;  4GC5 A;  1PGY A;  4OU7 A;  3U6M A;  4I4L A;  1OTR A;  2K0B X;  3IHP A;  2LNH C;  2OOB A;  1IN8 A;  1SXJ C;  3K92 A;  3U6E A;  1OFH A;  1PJJ A;  3VDU A;  3B74 A;  4FWD A;  1WIV A;  2CUZ A;  4LRT A;  2KRU A;  2Z3X A;  2L09 A;  1IBK M;  2O25 A;  1IY1 A;  4LJ9 A;  2LVP C;  4CHT B;  2BNK A;  3A46 A;  4DV4 M;  1G59 A;  1A5T A;  2O5R A;  3B9P A;  5KPZ A;  3SYK A;  2WSE F;  4DR2 M;  4L8R C;  4TUW A;  1GL6 A;  4LY6 A;  1ZMV A;  1XHB A;  2CRU A;  2M60 A;  3FRI A;  5EXP A;  2DWN A;  2BWE A;  1WGN A;  1VDL A;  3KDS E;  1E9S A;  3FE3 A;  3W0F A;  2KW0 A;  4Z8X A;  5DYG A;  3GPP A;  2RKO A;  3GLH B;  3GLG A;  4G4Q A;  5KQ8 A;  4PDG A;  2L7H A;  3U6D A;  1DO0 A;  2XH9 A;  2WSC F;  3GLI B;  1OKS A;  2FE8 A;  1IM2 A;  2C5R A;  3GPX A;  5IRE B;  4MH0 E;  1NHW C;  2C99 A;  3T15 A;  1GJS A;  2BJW A;  2OOA A;  3DZD A;  4LRS A;  3THG A;  2XZF A;  3J27 B;  3KFU G;  4GKJ M;  1XXH E;  1L2B A;  4IBI A;  3SAS A;  4LCB A;  3D8L A;  2C9C A;  3U5Z B;  1K3W A;  1N34 M;  3K2L A;  5BPV A;  1QAO A;  1NV8 A;  2CV2 A;  4PT5 A;  1FNN A;  2HKJ A;  2QP9 X;  4GC9 A;  3VFD A;  3U6C A;  2R4J A;  3HKP A;  1AUA A;  5FTM A;  4DR5 M;  1Z59 A;  1UFZ A;  4LF4 M;  4KLN A;  4DV5 M;  1R6B X;  1WJ7 A;  1MX0 A;  2XSZ D;  2LWX A;  3KP0 E;  4GKK M;  1OAI A;  4P16 A;  3LQQ A;  3OTO M;  3U61 A;  3UJN A;  3GLF A;  1NJF A;  1NSF A;  1SG9 A;  2MR9 A;  3AOG A;  3KSJ A;  3WHL A;  2DAE A;  1KSF X;  1K82 A;  3U6P A;  2MRO B;  2A5Y B;  1EE8 A;  3J80 S;  3ZCB B;  3SAU A;  3E46 A;  1KYI A;  1SXJ A;  3HHW A;  5FTJ A;  2CFO A;  4OW0 A;  4WP2 A;  3K9O A;  4AG6 A;  2CHQ A;  2DWZ B;  3HJ8 A;  1JR3 E;  2RGO A;  2F5Q A;  2G8L A;  2DHY A;  3J7B A;  2DAI A;  5DYI A;  4JV5 M;  4AKI A;  2R6F A;  2F5O A;  3MJ5 A;  4DBG B;  1G71 A;  1HQC A;  2JY5 A;  3DA1 A;  5L8R F;  2XF3 A;  1N33 M;  4Y28 F;  4IJF A;  2I7P A;  4MM3 B;  2J7O A;  1R2Z A;  3W67 A;  4B08 A;  4NOO B;  1IN4 A;  1OAO C;  4FCV A;  5JI2 E;  2C9O A;  4DV7 M;  3L29 A;  3FTE A;  1Z6T A;  3SC3 A;  1NHG C;  2L7I A;  3VLF B;  4M9S A;  3C58 A;  3GRU A;  3MK6 A;  1TR8 A;  2J5Y A;  2DZO B;  1QDR A;  4HEO A;  1IBL M;  3T6P A;  3V76 A;  5KPR A;  2DWM A;  4D80 A;  1DGH B;  1G41 A;  2P5T A;  3RGP A;  1YLA A;  4AI6 A;  1XWI A;  4L16 A;  3VKG A;  3UZU A;  1YE9 A;  2QPA A;  4IJE A;  4LZZ A;  3FRH A;  3L26 A;  4LGM A;  4G4N A;  4B7H A;  1N32 M;  3KP1 E;  4IBD A;  3QWL A;  2JUJ A;  1XMO M;  1D0L A;  2CWB A;  4B3M M;  3PNV A;  3H4J A;  4XK8 F;  4LZJ A;  2APL A;  3T1H M;  3GQ5 A;  1DGB A;  4NXN M;  4A3V B;  3LQR A;  4WUR A;  3W68 A;  1QZE A; 
#chains in the Genus database with same CATH homology
 2LVO C;  2CP8 A;  2MJ5 B;  2O25 A;  1V92 A;  2HWJ A;  2LVP C;  2MGW A;  2DNA A;  2K9D A;  2DAM A;  1A5T A;  3MMP A;  1HT2 E;  2LVQ D;  4R71 A;  1VQ1 A;  1ZMV A;  2QSF X;  3FRI A;  2EJS A;  2KNV A;  2BWE A;  1WGL A;  1WGN A;  1VDL A;  2JZ1 A;  2DZL A;  4GEW A;  1Y8G A;  1T43 A;  3FE3 A;  1DV0 A;  2BWB A;  1ZV1 A;  3GLF E;  2JY6 B;  1DO0 A;  3GLH E;  1OKS A;  1VG5 A;  2G3Q A;  1IM2 A;  1ZMU A;  1WR1 B;  3GLI E;  2DKL A;  2OOA A;  1VEJ A;  1XXH E;  2LTU A;  1AIP C;  2QHO B;  1DO2 A;  1TTE A;  2R0I A;  1P3Q Q;  1EFU B;  1F4I A;  1MN3 A;  1NV8 A;  1OQY A;  2KHH A;  2JY8 A;  1UFZ A;  1WJ7 A;  1HQY E;  2EKK A;  3E21 A;  2DI0 A;  2HAK A;  1OAI A;  2JP7 A;  1SG9 A;  2MR9 A;  3F92 A;  1G4A E;  1R4G A;  2DAE A;  2DAK A;  2MRO B;  1HJP A;  3LCU A;  3K9P A;  1BVS A;  4UN2 B;  2RRU A;  3E46 A;  2ZTC A;  3BBZ A;  1KYI A;  4Q7J A;  2WZJ A;  3LCV B;  1ZMW A;  1G3I A;  3K9O A;  4WP2 A;  2ZTD A;  2LVN C;  1XB2 B;  2OO9 A;  2H5X A;  1JR3 E;  2B3T A;  1NV9 A;  4F2L A;  2DHY A;  2DAI A;  4DBG B;  2DAG A;  1Q02 A;  2JY5 A;  1WHC A;  1VEK A;  2L4E A;  1GO5 A;  2LVA A;  1VEG A;  5JI2 E;  1T6O A;  5DFL A;  1IXS A;  2KNZ A;  1C7Y A;  1E94 E;  1IFY A;  2JNH A;  3IEC A;  2KNA A;  3B89 A;  2DEN A;  1TR8 A;  4HEO A;  3T6P A;  2JZ0 A;  1G41 A;  1YLA A;  2L4F A;  3FRH A;  2JY7 A;  1PGY A;  3GLG E;  1HT1 E;  1OTR A;  2JUJ A;  2K0B X;  1CUK A;  2CWB A;  3IHP A;  2OOB A;  2LBC A;  2L2D A;  3H4J A;  2QNJ A;  2EKF A;  4G3O A;  4F1I A;  1WIV A;  1QZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...