4JI2M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji2M02
1XNRM 3SAVA 4DR7M 4PDGA 3TWMA 4NXMM 2ZM6M 4JI4M 3U6LA 3U6PA 3SAUA 1N36M 4PCZA 3VK8A 3GP1A 4X62M 4YHHM 3U6EA 3U6QA 1KFVA 3A42A 4PD2A 1TDHA 3TWKA 3J7AS 4JI0M 4AQYM 3GQ4A 4X64M 3JR4A 4LF6M 4JI2M 3SAWA 4DV7M 4ITQA 2HKJA 3W0FA 2UU9M 4OX9M 4DV0M 2XZUA 1XMOM 5ITYA 1Q3CA 1N34M 3SASA 4JI7M 1K82A 2F5OA 1PM5A 1EE8A 4K0KM 4KHPM 2F5NA 5ITTA 1Q3BA 3U6CA 5IT9S 4NRWA 4X66M 3JR5A 5LMUM 3JAMS 3U6SA 4JI8M 1XNQM 4DV2M 3GPUA 4LF4M 4DV3M 4LF8M 1Z5BA 1HNZM 4PDIA 4G4OA 3C58A 4DR2M 1Z5CA 3SBJA 3TWLA 3GPPA 2UUBM 4DR6M 4X65M 2F5SA 4B3RM 4JYAM 4NXNM 2VQEM 3GO8A 5FLXS 4G4QA 1R2ZA 1Z59A 4YY3M 4DV4M 2EA0A 1IBMM 2HHHM 4MB7A 4DR5M 1TDZA 4LFCM 2OPFA 1L2CA 1MX0A 5ITXE 1HNXM 2XZFA 5IWAM 3A45A 1L1TA 3U6DA 2UUCM 4NRVA 4DR3M 2Q2EB 1J5EM 1XC8A 4GKJM 1N32M 1HR0M 2UUAM 3J81S 4DUYM 3SATA 1L2DA 3U6MA 2UXBM 3DOAA 4DV1M 1K3XA 1IBLM 3GPYA 5ITQA 2VQFM 4JI5M 5LMNM 1Q39A 3A46A 1L1ZA 4B3TM 3VK7A 5ITXA 1XMQM 1I94M 1MU5A 1FJGM 3T1YM 4JI3M 3U6OA 2F5PA 5A2QS 4B3MM 1N33M 3SARA 4GKKM 1PJJA 5BR8M 2F5QA 4LF5M 4G4NA 5ITRA 1HNWM 2UXCM 4LF7M 4DV6M 4DUZM 4DR1M 4JI1M 2UXDM 4B3SM 1K3WA 1IBKM 3T1HM 4LFAM 1PJIA 1L2BA 1R2YA 4CISA 4LFBM 1Z5AA 2ZBKB 1NNJA 2E5LM 4LF9M 4DR4M 3GQ3A 4JI6M 3GQ5A 4G4RA 3J80S 2F4VM 4JV5M 3OTOM 4DV5M 2OQ4A 3GPXA 5ITUA
chains in the Genus database with same CATH superfamily
2D7GA 2YNMD 2CP8A 4GH9A 3SAVA 4GMQA 3L28A 1NO1A 1VQ1A 2KRKA 3LCUA 5EP2A 2AHMA 1DGBA 2XSZA 1OFIA 1OAIA 3DFZA 3HJSA 1GJTA 2DZOB 2M60A 3SC3A 4B7HA 4R71A 4PCZA 3SAUA 3VK8A 1N36M 1KSFX 3LVVA 3GLFE 5FTLA 4D81A 3QYEA 2KXEA 2CHGA 2DENA 2L7IA 3FUXA 1TDHA 4FCTA 4RF1A 5EQTA 5C1BA 1JR3D 2EUCA 3HGIA 4LGMA 1FNNA 2L4FA 2H1RA 3GQ4A 3JR4A 4LJ9A 3C3DA 4MH0E 2DAKA 3KOYE 4OVZA 3E9SA 2CV2A 3BBZA 3FRHA 1PRBA 1OTRA 3FRIA 4JI2M 4LF6M 2CFOA 1H6UA 2G3QA 3UJNA 3RFWA 4WURA 4QOZC 3FUVA 2VDBB 4WW0A 4DBGB 2XH9A 1IN8A 2XZUA 2Y20A 4B7GA 2LNHC 1PM5A 4MGHA 3PVSA 2Z8YM 1JR3A 4G6ZA 3UZUA 3RGSA 1IXRC 5GKNA 5LMUM 4IBKA 1SG9A 4B7FA 2D7HA 4L4UA 3NBXX 4QHTA 3TQSA 4LF8M 1Z5BA 3C58A 3VKHA 1Z5CA 4S12A 3TPZA 3GLGA 4LCBA 3VKGA 4NOOB 3LVWA 3VDUA 3L26A 3U60B 4B3RM 3K2LA 3UGJA 4NXNM 4IBJA 4KO8A 2JUJA 2VQEM 1QANA 2ZAMA 5KPRA 2KW0A 4WP2A 1Z59A 1TF0B 4QOSA 2EA0A 3VDPA 1G71A 1WR1B 1WIVA 3H4JA 1WHCA 3PNVA 4MB7A 4MM3B 4LJ7A 3THGA 4I5SA 2ZAOA 4DR5M 3J27B 1D0LA 2L4EA 2G5GX 5ITXE 2XZFA 1PGYA 2QBYB 1A5TA 1QAOA 2MGWA 4NL4H 3FYCA 2Q2EB 5EJCA 1P3QQ 3HWSA 3BOSA 5EXPA 1J5EM 2BJVA 3UK6A 1NY6A 2C9OA 4JXJA 2JZ0A 1XC8A 4AI6A 3J81S 4DUYM 1ZAEA 3AOEC 4L6V6 2FH0A 4IBCA 1G4AE 2R6FA 3NBIA 2XF3A 2A5YB 3HHXA 4TUWA 1D0KA 2YQZA 2XEPA 3R8FA 3GPYA 4GITA 1SXJC 2GQFA 1QUSA 2VF8A 4ANRA 5JI3E 3TE6A 3A46A 2EKFA 2BWBA 2CRUA 3KOZE 3L29A 2CE7A 1VDLA 2LVPC 5IREB 3VK7A 4RNAA 1OFHA 3E46A 1MU5A 2LHGA 3KP0E 5DNYA 3T1YM 1GO5A 2DWMA 5A2QS 3PNYA 1N33M 1TR8A 3KP1E 1V33A 3PXGA 5ITRA 1XB2B 1QAQA 1Q02A 3Q8GA 2UXDM 1IY1A 3WHLA 4I8OA 3FTFA 2H5XA 2VF7A 4Q7JA 5EP3A 3K92A 3PFIA 3KXEC 4LFAM 2RGOA 3V76A 1PJIA 1IFYA 1D0MA 1Z5AA 2J7OA 1LTMA 3GQ3A 1V34A 3H4MA 4DR4M 2APLA 2N35A 2MJ5B 4FWGA 4GC9A 2Z4SA 1ZMUA 3IECA 4FWHA 1UM8A 4L78A 2YFQA 5KPTA 5ITUA 3AL0C 1TGUA 4DR7M 7CATA 1UFZA 4PDGA 1DO0A 2L7HA 3KOXE 1NJGA 1NV9A 2K6BA 1E9RA 3FUTA 3KSXA 3SFZA 3CF0A 3GP1A 4ZPXA 3BXWA 1RU3A 1GVNA 2VIIA 2I7PA 3A42A 3U6EA 3U6QA 1QZEA 4XBOA 4AW4A 2JA2A 2QQ8A 2KHHA 4DR6M 4IJEA 3TWKA 2B3TA 4IIWA 3J7AS 1TH3A 1OKSA 2MH8A 1CUKA 3R9XB 2HAKA 5DYIA 2R44A 4IJFA 3AJIB 2LH0A 2HKJA 1GL7A 4LJAA 5DYGA 1LV7A 1QVRA 1QUTA 4NSOB 5ITYA 2JNHA 3U61B 4AKIA 1K82A 1WXQA 3L27A 4HEOA 1C7YA 3QWLA 5ITTA 3U6CA 4FD2A 1SXJE 4NRWA 1IXSB 3UMMA 2CV0A 1XNQM 2KRUA 2QCUA 4LF4M 3ZCBB 2JWSA 1TTEA 1KYIA 4RF0A 2JY6B 3FUWA 3GPPA 3SBJA 4LRSA 2OO9A 1ZMVA 3ZH9B 1ZQ9A 4Z6YA 4BB9A 3I4YA 1VEKA 3B89A 4G4QA 1R2ZA 2QBYA 4DV4M 3LCVB 3T38A 2CEAA 2ZTDA 1TDZA 1TH4A 1WGNA 2KA6B 2OPFA 1DGFA 4LFCM 1ZV1A 4CJ6A 1R5LA 4D82A 1IY0A 1HNXM 1XXHE 3A45A 3J2PB 1L1TA 4G3OA 4I81A 4NRVA 2V6ZM 3DA1A 3KVWA 4M9ZA 1XHBA 1F4IA 2ZTCA 2D7EA 2WSCF 4GKJM 4RKUF 2WSEF 4HLQA 1N32M 3DZDA 2UUAM 1NNUC 1S3SA 3SATA 3CTWB 1IN6A 2FFJA 2UXBM 1R4GA 2C99A 2KZUA 1L8QA 1IBLM 5ITQA 3GRRA 1DGGA 4Y28F 3C9PA 3L2AA 3GLIE 1Q39A 5LMNM 2BWEA 4FCVA 2L2DA 3I04M 4B3TM 3SHFA 1EFUB 4M0DA 1I94M 1D2NA 3GLHA 2X8AA 5E26A 3J7BA 5FTMA 1NV8A 2Y0QA 3U6OA 1X37A 5E6JA 4MGKE 4QNMA 5KPZA 5KQ8A 4GKKM 2Y21A 2LVNC 3ILKA 2UXCM 1OQYA 1T6OA 3CF6E 3U6PA 2YR0A 1NJFA 1JQJC 4L15A 2BJWA 4CIZA 4GHLA 1J09A 2V1CA 1IBKM 2WZJA 2LWXA 3HX3A 4GRIA 3VLFB 1R2YA 4LFBM 4MGIE 2C9CA 1NNJA 3QYBA 2DZLA 4JI6M 3HKPA 3GQ5A 4G4RA 2F4VM 3C3EA 3HU1A 4JV5M 2DHRA 3HHZA 2OQ4A 1T43A 1C1KA 1XNRM 2DVWB 2RKOA 4FWDA 3TWMA 4NXMM 4EIWA 2ZM6M 4JI4M 4GIPA 3KS4A 3U6LA 2OOAA 3U5ZB 2GNOA 4MGZE 3L25A 2LTUA 1JR3E 2CWBA 4IBBA 4P16A 1KFVA 3GLHB 4REZA 4QHSA 1QDRA 2JY7A 2R62A 2HCBA 4JI0M 2HL7A 3K1JA 3HU2A 3D8BA 3SMSA 1Z6TA 2KNAA 4X64M 1HT1E 3U61A 4MGYE 1N78A 2DNAA 2KEBA 5KO3A 3GLGE 3LMMA 4ITQA 4IBEA 1G41A 3EIEA 2QP9X 2K0BX 3RGPA 4NC6A 1IXSA 2ZANA 3IHPA 3E21A 3Q8XA 4A3VB 2XFTA 3W68A 1XMOM 2FS1A 1N34M 3SASA 3FTDA 3MK6A 4JI7M 1NVMA 2F5OA 4GHAA 1J7KA 1EE8A 3B7NA 3B9PA 5EXTA 2QPAA 4IBIA 1QAMA 3FTEA 2KNZA 3CF2A 4IBGA 4QNRA 3HY5A 2QENA 4X66M 5EXSA 4JI8M 2RGHA 4DV2M 2V1UA 3AOGA 1HNZM 4LZJA 4PDIA 2R0IA 5KQDA 1VEJA 1QZMA 2DWZB 2KNVA 3HJQA 3TWLA 4Z8XA 3FKEA 2BNKA 5C18A 1OIPA 2DAIA 2F5SA 2UUBM 1IN7A 4AZFA 4CGYB 3A98B 1IN4A 3GO8A 3KDSE 3I51A 5FLXS 1E94E 2DAGA 5FSWA 1Y8GA 2Z4RA 2CHQA 5FTKA 1N75A 1IQPA 3RE8A 3TL4X 1MX0A 3SYLA 2EJSA 3AFHA 1WGLA 2HWJA 5DFLA 3U6DA 3GRYA 2DWNA 1XWIA 2JP7A 2EO2A 4I4LA 2R4EA 1HJPA 1BVSA 1YUBA 5EP1A 1SXJB 4M9XA 4NSRA 2QZ4A 1AUAA 3MHVC 3AV0A 1HR0M 3KS8A 3FYDA 1MJGM 3U6MA 3GLFB 4IBDA 3EIHA 4OW0A 3B7ZA 3W67A 4LRTA 1K3XA 2Y0TA 2M5ZA 1NSFA 1W5SA 1AIPC 2LXEA 3W0LB 2VQFM 4FVMA 4AG5A 2JXNA 3I01M 4KT0F 5ITXA 1XMQM 1GKIA 3HU3A 2LHCA 4JI3M 4KLNA 1IM2A 3KOWE 2F5PA 2O25A 1GLNA 4GC5A 2QHOB 1DGHB 4L16A 3IG8A 4B3MM 3HHWA 2DZNB 5BR8M 2F5QA 4LF5M 4G4NA 1R7RA 2LBCA 2QSFX 2CUZA 2LVAA 2O5RA 3M0EA 1XXHB 4W5WA 5EP4A 5EXXA 2WSFF 2C98A 4LF7M 3KFUG 4OU7A 2JY8A 3K8ZA 4DUZM 4DR1M 2ERCA 4JI1M 4LG2A 2LVQD 8CATA 4B3SM 3B74A 3T1HM 4R3DA 3ZQJA 3AKZA 1G8PA 3KSJA 4R7GA 1NY5A 4JN6A 3I4VA 4CISA 3F92A 1VG5A 2ZBKB 3HZJA 2E5LM 5BPVA 3OTOM 3U5ZA 4IBFA 2I7NA 1E9SA 1I4WA 1IY2A 3GLIB 1VDDA 3VFDA 1TH2A 3M6AA 3MMPA 2L09A 2X4AA 2DAMA 3SHGB 4BBAA 4X62M 1HQCA 4YHHM 1IXZA 2CV1A 4PD2A 1YSYA 4FW9A 3T6PA 1YE9A 3E4RA 4M0WA 2OOBA 4AQYM 1GABA 1DO2A 4AG6A 2P5TA 2J7NA 4LY6A 2XLJA 3SAWA 4DV7M 2X49A 3SYKA 2K9DA 5FTJA 2FNAA 4PT5A 1NHWC 3W0FA 1QYRA 1GL6A 2UU9M 4OX9M 4DV0M 2C5RA 1Q3CA 1ORYB 4OVZB 4L8RC 1E32A 5F3WA 4LJ5A 2DWLA 1OIZA 3WHKA 3K9PA 3FTCA 4K0KM 4KHPM 5L8RF 2F5NA 1Q3BA 3FUUA 3GRUA 4HL4A 5IT9S 2R4JA 2LVOC 3JR5A 3U6SA 3JAMS 2DAEA 4BLCA 3GPUA 4DV3M 1SXJD 2CHVA 2DI0A 1G3IA 1QDTA 2QNJA 4G4OA 4DR2M 2MROB 1T3TA 4X65M 3QAUA 2R65A 4JYAM 3LQQA 2J5YA 2KDLA 2R18A 4LGYA 3D8LA 4LJ6A 1V92A 3AOEA 4LJ4A 2R45A 1IBMM 2C96A 4YY3M 4XK8F 1MN3A 2DHYA 3GLGB 2HHHM 3KW6A 4F2LA 2Z3XA 2RRUA 1SXJA 1L2CA 3GRVA 1PJQA 3GLHE 5IWAM 2XFSA 3GLFA 3MJ5A 2JY5A 2UUCM 4B08A 4DR3M 1OJLA 1QQWA 4GEWA 3U60A 2DXIA 2W82A 4M9SA 3LQRA 1N77A 4D80A 1L2DA 3T15A 2O01F 1OAOC 4XGIA 1WJ7A 5FTNA 4AKGA 3DOAA 4DV1M 4FCWA 1IN5A 4JI5M 1DGHA 1JB0F 1NHGC 1PJTA 2R46A 4UN2B 2FE8A 1R6BX 1W5TA 3CGWA 2MR9A 1YLAA 1L1ZA 2Z7JA 2JZ1A 2DKLA 4AKHA 2KZSA 2EKKA 1XXHA 1FJGM 4P17A 3HJ8A 3IG5A 3NWLA 3FE3A 3HHYA 1EIJA 1G59A 5IZ7D 1VEGA 4F1IA 5JI2E 3SARA 4LZZA 1PJJA 3LW5F 2L6OA 3K9OA 2NQ8C 1HNWM 3FD9A 1PJSA 4KODA 1GJSA 3M7GA 5H37D 4DV6M 2FOIC 4II7A 1HQYE 2XSZD 1K3WA 3GLIA 3B7QA 4LJ8A 1L2BA 4LF9M 1DV0A 2XGNA 3J80S 1HT2E 2K47A 3ZC7B 4DV5M 2G8LA 4CHTB 1ZMWA 3GPXA 3SMPA
chains in the Genus database with same CATH topology
2D7GA 2YNMD 4GH9A 3SAVA 4GMQA 3L28A 2KRKA 5EP2A 2AHMA 1DGBA 2XSZA 1OFIA 3DFZA 4B7HA 3HJSA 2DZOB 2M60A 3SC3A 4PCZA 3U6PA 3SAUA 3U60A 3VK8A 1N36M 1KSFX 3LVVA 5FTLA 4D81A 2KXEA 2CHGA 2L7IA 3FUXA 1TDHA 4FCTA 4RF1A 5EQTA 5C1BA 1JR3D 2EUCA 3HGIA 4LGMA 1FNNA 2H1RA 3GQ4A 3JR4A 4LJ9A 4MH0E 4OVZA 4LF6M 3KOYE 2CV2A 3E9SA 4JI2M 2CFOA 1H6UA 3UJNA 3RFWA 4WURA 4QOZC 3FUVA 4WW0A 2XZUA 2XH9A 1IN8A 2Y20A 4B7GA 2LNHC 1PM5A 4MGHA 3PVSA 1JR3A 4G6ZA 3UZUA 3RGSA 1IXRC 5GKNA 5LMUM 4IBKA 4B7FA 2D7HA 4L4UA 3TQSA 4QHTA 4LF8M 1Z5BA 3C58A 3VKHA 1Z5CA 4S12A 3TPZA 3GLGA 4LCBA 3VKGA 4NOOB 3LVWA 3VDUA 3L26A 3U60B 4B3RM 3K2LA 3UGJA 4NXNM 4IBJA 4KO8A 2VQEM 1QANA 2ZAMA 5KPRA 2KW0A 1Z59A 4QOSA 2EA0A 3VDPA 3PNVA 4MB7A 4MM3B 4LJ7A 3THGA 4I5SA 2ZAOA 4DR5M 3J27B 2G5GX 5ITXE 2XZFA 2QBYB 1QAOA 4NL4H 3FYCA 2Q2EB 5EJCA 3HWSA 5EXPA 3BOSA 1J5EM 2BJVA 3UK6A 1NY6A 2C9OA 4JXJA 1XC8A 4AI6A 3J81S 4DUYM 1ZAEA 3AOEC 4IBCA 1G4AE 3NBIA 3HHXA 2XF3A 2A5YB 4TUWA 2YQZA 2XEPA 3R8FA 3GPYA 4GITA 1SXJC 5JI3E 3TE6A 3A46A 3KOZE 3L29A 2CE7A 3VK7A 5IREB 4RNAA 1OFHA 1MU5A 3T1YM 3KP0E 5DNYA 2DWMA 5A2QS 3PNYA 1N33M 3KP1E 3PXGA 5ITRA 1QAQA 2UXDM 1IY1A 3WHLA 4I8OA 3FTFA 5EP3A 3K92A 3PFIA 3KXEC 4LFAM 2RGOA 1PJIA 1Z5AA 2J7OA 4DR4M 3GQ3A 3H4MA 4FWGA 4GC9A 2Z4SA 4FWHA 1UM8A 4L78A 2YFQA 5KPTA 5ITUA 3AL0C 1TGUA 4DR7M 7CATA 4PDGA 1DO0A 2L7HA 3KOXE 1NJGA 1E9RA 3FUTA 3KSXA 3SFZA 3CF0A 3GP1A 4ZPXA 3U6EA 1GVNA 2VIIA 2I7PA 3A42A 3U6QA 4XBOA 4AW4A 2JA2A 4IJEA 3TWKA 4IIWA 3J7AS 1TH3A 3R9XB 5DYIA 4IJFA 3AJIB 2LH0A 2HKJA 1GL7A 4LJAA 5DYGA 1LV7A 1QVRA 4NSOB 5ITYA 4AKIA 3U61B 1K82A 1WXQA 3L27A 3QWLA 5ITTA 3U6CA 4FD2A 1SXJE 4NRWA 1IXSB 3UMMA 2CV0A 1XNQM 2KRUA 2QCUA 4LF4M 3ZCBB 1KYIA 4RF0A 3FUWA 3GPPA 3SBJA 4LRSA 3ZH9B 1ZQ9A 4Z6YA 4BB9A 3I4YA 4G4QA 1R2ZA 2QBYA 4DV4M 3T38A 2CEAA 1TDZA 1TH4A 2KA6B 2OPFA 4LFCM 1DGFA 4D82A 1HNXM 1IY0A 3J2PB 3A45A 1L1TA 4I81A 4NRVA 2V6ZM 3DA1A 3KVWA 4M9ZA 1XHBA 2D7EA 4GKJM 1N32M 4HLQA 3DZDA 2UUAM 1NNUC 1S3SA 3SATA 3CTWB 1IN6A 2FFJA 2UXBM 2C99A 2KZUA 1L8QA 1IBLM 5ITQA 3GRRA 1DGGA 5LMNM 3L2AA 1Q39A 4FCVA 4B3TM 3SHFA 4M0DA 1I94M 1D2NA 3GLHA 2X8AA 5E26A 3J7BA 5FTMA 2Y0QA 3U6OA 1X37A 5E6JA 4MGKE 4QNMA 5KPZA 5KQ8A 4GKKM 2Y21A 3ILKA 2UXCM 3CF6E 2YR0A 1NJFA 1JQJC 4L15A 2BJWA 4GHLA 1J09A 2V1CA 1IBKM 2LWXA 3VLFB 4GRIA 1R2YA 4LFBM 4MGIE 2C9CA 1NNJA 4JI6M 3HKPA 3GQ5A 4G4RA 2F4VM 3HU1A 4JV5M 2DHRA 3HHZA 2OQ4A 1C1KA 1XNRM 2DVWB 2RKOA 4FWDA 3TWMA 4NXMM 4EIWA 2ZM6M 4JI4M 4GIPA 3KS4A 3U6LA 3U5ZB 3L25A 4MGZE 4IBBA 4P16A 1KFVA 3GLHB 4REZA 4QHSA 2R62A 2HCBA 4JI0M 2HL7A 3K1JA 3HU2A 3D8BA 3SMSA 1Z6TA 4X64M 1HT1E 3U61A 4MGYE 1N78A 2KEBA 5KO3A 4ITQA 3LMMA 4IBEA 1G41A 3EIEA 2QP9X 3RGPA 2ZANA 4A3VB 3Q8XA 2XFTA 1XMOM 1N34M 3SASA 3FTDA 3MK6A 4JI7M 1NVMA 2F5OA 4GHAA 1J7KA 1EE8A 3B9PA 5EXTA 3FTEA 2QPAA 4IBIA 1QAMA 4IBGA 3CF2A 4QNRA 2QENA 4X66M 5EXSA 4JI8M 2RGHA 4DV2M 2V1UA 3AOGA 1HNZM 4LZJA 4PDIA 5KQDA 2DWZB 1QZMA 5C18A 3TWLA 3HJQA 2UUBM 4Z8XA 3FKEA 2BNKA 4DR6M 2F5SA 1IN7A 4AZFA 4CGYB 3A98B 1IN4A 3GO8A 3KDSE 3I51A 5FLXS 1E94E 5FSWA 2Z4RA 2CHQA 5FTKA 1N75A 1IQPA 3RE8A 3TL4X 1MX0A 3SYLA 3AFHA 2DWNA 3U6DA 3GRYA 1XWIA 2EO2A 4I4LA 2R4EA 1YUBA 5EP1A 1SXJB 4M9XA 4NSRA 2QZ4A 3MHVC 3AV0A 1HR0M 3KS8A 3FYDA 3U6MA 3GLFB 4IBDA 3EIHA 4OW0A 4LRTA 1K3XA 2Y0TA 2M5ZA 1NSFA 1W5SA 2LXEA 3W0LB 2VQFM 4FVMA 4AG5A 5ITXA 1XMQM 3HU3A 1GKIA 4JI3M 4KLNA 1IM2A 3KOWE 2F5PA 1GLNA 4GC5A 4L16A 1DGHB 3IG8A 4B3MM 3HHWA 2DZNB 5BR8M 2F5QA 4LF5M 4G4NA 1R7RA 5EP4A 2CUZA 2O5RA 4W5WA 3M0EA 1XXHB 3KFUG 5EXXA 4LF7M 2C98A 4OU7A 3K8ZA 4DUZM 4DR1M 2ERCA 4JI1M 4LG2A 8CATA 4B3SM 3T1HM 4R3DA 3AKZA 1G8PA 3KSJA 4R7GA 1NY5A 4JN6A 3I4VA 4CISA 2ZBKB 2E5LM 5BPVA 3OTOM 3U5ZA 4IBFA 2I7NA 1E9SA 1I4WA 1IY2A 3GLIB 1VDDA 3VFDA 1TH2A 3M6AA 2L09A 2X4AA 3SHGB 4BBAA 4X62M 1HQCA 4YHHM 1IXZA 2CV1A 4PD2A 1YSYA 4FW9A 1YE9A 3E4RA 4M0WA 4AQYM 1DO2A 4AG6A 2P5TA 2J7NA 4LY6A 2XLJA 3SAWA 4DV7M 2X49A 3SYKA 5FTJA 2FNAA 4PT5A 1NHWC 3W0FA 1QYRA 1GL6A 2UU9M 4OX9M 4DV0M 2C5RA 1Q3CA 1ORYB 4OVZB 4L8RC 1E32A 5F3WA 4LJ5A 2DWLA 3WHKA 3FTCA 4K0KM 4KHPM 2F5NA 1Q3BA 3FUUA 3GRUA 4HL4A 5IT9S 2R4JA 3JR5A 3U6SA 3JAMS 4BLCA 3GPUA 4DV3M 1SXJD 2CHVA 1G3IA 4G4OA 4DR2M 1T3TA 4X65M 3QAUA 2R65A 4JYAM 3LQQA 4LGYA 2R18A 3D8LA 4LJ6A 3AOEA 4LJ4A 2R45A 1IBMM 2C96A 4YY3M 2HHHM 3GLGB 3KW6A 2Z3XA 1SXJA 1L2CA 3GRVA 5IWAM 2XFSA 3GLFA 3MJ5A 2UUCM 4B08A 4DR3M 1OJLA 1QQWA 2DXIA 2W82A 4M9SA 3LQRA 1N77A 4D80A 1L2DA 3T15A 4XGIA 5FTNA 4AKGA 3DOAA 4DV1M 4FCWA 1IN5A 4JI5M 1DGHA 1NHGC 2R46A 2FE8A 1R6BX 1W5TA 1L1ZA 2Z7JA 4AKHA 2KZSA 1FJGM 1XXHA 3HJ8A 3IG5A 3NWLA 3HHYA 1G59A 5IZ7D 5JI2E 3SARA 4LZZA 1PJJA 2L6OA 2NQ8C 1HNWM 3FD9A 4KODA 3M7GA 5H37D 4DV6M 2FOIC 4II7A 1HQYE 2XSZD 1K3WA 3GLIA 4LJ8A 1L2BA 4LF9M 2XGNA 3J80S 1HT2E 2K47A 3ZC7B 4DV5M 2G8LA 4CHTB 3GPXA 3SMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR M;  3SAV A;  4DR7 M;  4PDG A;  3TWM A;  4NXM M;  2ZM6 M;  4JI4 M;  3U6L A;  3U6P A;  3SAU A;  1N36 M;  4PCZ A;  3VK8 A;  3GP1 A;  4X62 M;  4YHH M;  3U6E A;  3U6Q A;  1KFV A;  3A42 A;  4PD2 A;  1TDH A;  3TWK A;  3J7A S;  4JI0 M;  4AQY M;  3GQ4 A;  4X64 M;  3JR4 A;  4LF6 M;  4JI2 M;  3SAW A;  4DV7 M;  4ITQ A;  2HKJ A;  3W0F A;  2UU9 M;  4OX9 M;  4DV0 M;  2XZU A;  1XMO M;  5ITY A;  1Q3C A;  1N34 M;  3SAS A;  4JI7 M;  1K82 A;  2F5O A;  1PM5 A;  1EE8 A;  4K0K M;  4KHP M;  2F5N A;  5ITT A;  1Q3B A;  3U6C A;  5IT9 S;  4NRW A;  4X66 M;  3JR5 A;  5LMU M;  3JAM S;  3U6S A;  4JI8 M;  1XNQ M;  4DV2 M;  3GPU A;  4LF4 M;  4DV3 M;  4LF8 M;  1Z5B A;  1HNZ M;  4PDI A;  4G4O A;  3C58 A;  4DR2 M;  1Z5C A;  3SBJ A;  3TWL A;  3GPP A;  2UUB M;  4DR6 M;  4X65 M;  2F5S A;  4B3R M;  4JYA M;  4NXN M;  2VQE M;  3GO8 A;  5FLX S;  4G4Q A;  1R2Z A;  1Z59 A;  4YY3 M;  4DV4 M;  2EA0 A;  1IBM M;  2HHH M;  4MB7 A;  4DR5 M;  1TDZ A;  4LFC M;  2OPF A;  1L2C A;  1MX0 A;  5ITX E;  1HNX M;  2XZF A;  5IWA M;  3A45 A;  1L1T A;  3U6D A;  2UUC M;  4NRV A;  4DR3 M;  2Q2E B;  1J5E M;  1XC8 A;  4GKJ M;  1N32 M;  1HR0 M;  2UUA M;  3J81 S;  4DUY M;  3SAT A;  1L2D A;  3U6M A;  2UXB M;  3DOA A;  4DV1 M;  1K3X A;  1IBL M;  3GPY A;  5ITQ A;  2VQF M;  4JI5 M;  5LMN M;  1Q39 A;  3A46 A;  1L1Z A;  4B3T M;  3VK7 A;  5ITX A;  1XMQ M;  1I94 M;  1MU5 A;  1FJG M;  3T1Y M;  4JI3 M;  3U6O A;  2F5P A;  5A2Q S;  4B3M M;  1N33 M;  3SAR A;  4GKK M;  1PJJ A;  5BR8 M;  2F5Q A;  4LF5 M;  4G4N A;  5ITR A;  1HNW M;  2UXC M;  4LF7 M;  4DV6 M;  4DUZ M;  4DR1 M;  4JI1 M;  2UXD M;  4B3S M;  1K3W A;  1IBK M;  3T1H M;  4LFA M;  1PJI A;  1L2B A;  1R2Y A;  4CIS A;  4LFB M;  1Z5A A;  2ZBK B;  1NNJ A;  2E5L M;  4LF9 M;  4DR4 M;  3GQ3 A;  4JI6 M;  3GQ5 A;  4G4R A;  3J80 S;  2F4V M;  4JV5 M;  3OTO M;  4DV5 M;  2OQ4 A;  3GPX A;  5ITU A; 
#chains in the Genus database with same CATH topology
 2D7G A;  2YNM D;  2CP8 A;  4GH9 A;  3SAV A;  4GMQ A;  3L28 A;  1NO1 A;  1VQ1 A;  2KRK A;  3LCU A;  5EP2 A;  2AHM A;  1DGB A;  2XSZ A;  1OFI A;  1OAI A;  3DFZ A;  3HJS A;  1GJT A;  2DZO B;  2M60 A;  3SC3 A;  4B7H A;  4R71 A;  4PCZ A;  3SAU A;  3VK8 A;  1N36 M;  1KSF X;  3LVV A;  3GLF E;  5FTL A;  4D81 A;  3QYE A;  2KXE A;  2CHG A;  2DEN A;  2L7I A;  3FUX A;  1TDH A;  4FCT A;  4RF1 A;  5EQT A;  5C1B A;  1JR3 D;  2EUC A;  3HGI A;  4LGM A;  1FNN A;  2L4F A;  2H1R A;  3GQ4 A;  3JR4 A;  4LJ9 A;  3C3D A;  4MH0 E;  2DAK A;  3KOY E;  4OVZ A;  3E9S A;  2CV2 A;  3BBZ A;  3FRH A;  1PRB A;  1OTR A;  3FRI A;  4JI2 M;  4LF6 M;  2CFO A;  1H6U A;  2G3Q A;  3UJN A;  3RFW A;  4WUR A;  4QOZ C;  3FUV A;  2VDB B;  4WW0 A;  4DBG B;  2XH9 A;  1IN8 A;  2XZU A;  2Y20 A;  4B7G A;  2LNH C;  1PM5 A;  4MGH A;  3PVS A;  2Z8Y M;  1JR3 A;  4G6Z A;  3UZU A;  3RGS A;  1IXR C;  5GKN A;  5LMU M;  4IBK A;  1SG9 A;  4B7F A;  2D7H A;  4L4U A;  3NBX X;  4QHT A;  3TQS A;  4LF8 M;  1Z5B A;  3C58 A;  3VKH A;  1Z5C A;  4S12 A;  3TPZ A;  3GLG A;  4LCB A;  3VKG A;  4NOO B;  3LVW A;  3VDU A;  3L26 A;  3U60 B;  4B3R M;  3K2L A;  3UGJ A;  4NXN M;  4IBJ A;  4KO8 A;  2JUJ A;  2VQE M;  1QAN A;  2ZAM A;  5KPR A;  2KW0 A;  4WP2 A;  1Z59 A;  1TF0 B;  4QOS A;  2EA0 A;  3VDP A;  1G71 A;  1WR1 B;  1WIV A;  3H4J A;  1WHC A;  3PNV A;  4MB7 A;  4MM3 B;  4LJ7 A;  3THG A;  4I5S A;  2ZAO A;  4DR5 M;  3J27 B;  1D0L A;  2L4E A;  2G5G X;  5ITX E;  2XZF A;  1PGY A;  2QBY B;  1A5T A;  1QAO A;  2MGW A;  4NL4 H;  3FYC A;  2Q2E B;  5EJC A;  1P3Q Q;  3HWS A;  3BOS A;  5EXP A;  1J5E M;  2BJV A;  3UK6 A;  1NY6 A;  2C9O A;  4JXJ A;  2JZ0 A;  1XC8 A;  4AI6 A;  3J81 S;  4DUY M;  1ZAE A;  3AOE C;  4L6V 6;  2FH0 A;  4IBC A;  1G4A E;  2R6F A;  3NBI A;  2XF3 A;  2A5Y B;  3HHX A;  4TUW A;  1D0K A;  2YQZ A;  2XEP A;  3R8F A;  3GPY A;  4GIT A;  1SXJ C;  2GQF A;  1QUS A;  2VF8 A;  4ANR A;  5JI3 E;  3TE6 A;  3A46 A;  2EKF A;  2BWB A;  2CRU A;  3KOZ E;  3L29 A;  2CE7 A;  1VDL A;  2LVP C;  5IRE B;  3VK7 A;  4RNA A;  1OFH A;  3E46 A;  1MU5 A;  2LHG A;  3KP0 E;  5DNY A;  3T1Y M;  1GO5 A;  2DWM A;  5A2Q S;  3PNY A;  1N33 M;  1TR8 A;  3KP1 E;  1V33 A;  3PXG A;  5ITR A;  1XB2 B;  1QAQ A;  1Q02 A;  3Q8G A;  2UXD M;  1IY1 A;  3WHL A;  4I8O A;  3FTF A;  2H5X A;  2VF7 A;  4Q7J A;  5EP3 A;  3K92 A;  3PFI A;  3KXE C;  4LFA M;  2RGO A;  3V76 A;  1PJI A;  1IFY A;  1D0M A;  1Z5A A;  2J7O A;  1LTM A;  3GQ3 A;  1V34 A;  3H4M A;  4DR4 M;  2APL A;  2N35 A;  2MJ5 B;  4FWG A;  4GC9 A;  2Z4S A;  1ZMU A;  3IEC A;  4FWH A;  1UM8 A;  4L78 A;  2YFQ A;  5KPT A;  5ITU A;  3AL0 C;  1TGU A;  4DR7 M;  7CAT A;  1UFZ A;  4PDG A;  1DO0 A;  2L7H A;  3KOX E;  1NJG A;  1NV9 A;  2K6B A;  1E9R A;  3FUT A;  3KSX A;  3SFZ A;  3CF0 A;  3GP1 A;  4ZPX A;  3BXW A;  1RU3 A;  1GVN A;  2VII A;  2I7P A;  3A42 A;  3U6E A;  3U6Q A;  1QZE A;  4XBO A;  4AW4 A;  2JA2 A;  2QQ8 A;  2KHH A;  4DR6 M;  4IJE A;  3TWK A;  2B3T A;  4IIW A;  3J7A S;  1TH3 A;  1OKS A;  2MH8 A;  1CUK A;  3R9X B;  2HAK A;  5DYI A;  2R44 A;  4IJF A;  3AJI B;  2LH0 A;  2HKJ A;  1GL7 A;  4LJA A;  5DYG A;  1LV7 A;  1QVR A;  1QUT A;  4NSO B;  5ITY A;  2JNH A;  3U61 B;  4AKI A;  1K82 A;  1WXQ A;  3L27 A;  4HEO A;  1C7Y A;  3QWL A;  5ITT A;  3U6C A;  4FD2 A;  1SXJ E;  4NRW A;  1IXS B;  3UMM A;  2CV0 A;  1XNQ M;  2KRU A;  2QCU A;  4LF4 M;  3ZCB B;  2JWS A;  1TTE A;  1KYI A;  4RF0 A;  2JY6 B;  3FUW A;  3GPP A;  3SBJ A;  4LRS A;  2OO9 A;  1ZMV A;  3ZH9 B;  1ZQ9 A;  4Z6Y A;  4BB9 A;  3I4Y A;  1VEK A;  3B89 A;  4G4Q A;  1R2Z A;  2QBY A;  4DV4 M;  3LCV B;  3T38 A;  2CEA A;  2ZTD A;  1TDZ A;  1TH4 A;  1WGN A;  2KA6 B;  2OPF A;  1DGF A;  4LFC M;  1ZV1 A;  4CJ6 A;  1R5L A;  4D82 A;  1IY0 A;  1HNX M;  1XXH E;  3A45 A;  3J2P B;  1L1T A;  4G3O A;  4I81 A;  4NRV A;  2V6Z M;  3DA1 A;  3KVW A;  4M9Z A;  1XHB A;  1F4I A;  2ZTC A;  2D7E A;  2WSC F;  4GKJ M;  4RKU F;  2WSE F;  4HLQ A;  1N32 M;  3DZD A;  2UUA M;  1NNU C;  1S3S A;  3SAT A;  3CTW B;  1IN6 A;  2FFJ A;  2UXB M;  1R4G A;  2C99 A;  2KZU A;  1L8Q A;  1IBL M;  5ITQ A;  3GRR A;  1DGG A;  4Y28 F;  3C9P A;  3L2A A;  3GLI E;  1Q39 A;  5LMN M;  2BWE A;  4FCV A;  2L2D A;  3I04 M;  4B3T M;  3SHF A;  1EFU B;  4M0D A;  1I94 M;  1D2N A;  3GLH A;  2X8A A;  5E26 A;  3J7B A;  5FTM A;  1NV8 A;  2Y0Q A;  3U6O A;  1X37 A;  5E6J A;  4MGK E;  4QNM A;  5KPZ A;  5KQ8 A;  4GKK M;  2Y21 A;  2LVN C;  3ILK A;  2UXC M;  1OQY A;  1T6O A;  3CF6 E;  3U6P A;  2YR0 A;  1NJF A;  1JQJ C;  4L15 A;  2BJW A;  4CIZ A;  4GHL A;  1J09 A;  2V1C A;  1IBK M;  2WZJ A;  2LWX A;  3HX3 A;  4GRI A;  3VLF B;  1R2Y A;  4LFB M;  4MGI E;  2C9C A;  1NNJ A;  3QYB A;  2DZL A;  4JI6 M;  3HKP A;  3GQ5 A;  4G4R A;  2F4V M;  3C3E A;  3HU1 A;  4JV5 M;  2DHR A;  3HHZ A;  2OQ4 A;  1T43 A;  1C1K A;  1XNR M;  2DVW B;  2RKO A;  4FWD A;  3TWM A;  4NXM M;  4EIW A;  2ZM6 M;  4JI4 M;  4GIP A;  3KS4 A;  3U6L A;  2OOA A;  3U5Z B;  2GNO A;  4MGZ E;  3L25 A;  2LTU A;  1JR3 E;  2CWB A;  4IBB A;  4P16 A;  1KFV A;  3GLH B;  4REZ A;  4QHS A;  1QDR A;  2JY7 A;  2R62 A;  2HCB A;  4JI0 M;  2HL7 A;  3K1J A;  3HU2 A;  3D8B A;  3SMS A;  1Z6T A;  2KNA A;  4X64 M;  1HT1 E;  3U61 A;  4MGY E;  1N78 A;  2DNA A;  2KEB A;  5KO3 A;  3GLG E;  3LMM A;  4ITQ A;  4IBE A;  1G41 A;  3EIE A;  2QP9 X;  2K0B X;  3RGP A;  4NC6 A;  1IXS A;  2ZAN A;  3IHP A;  3E21 A;  3Q8X A;  4A3V B;  2XFT A;  3W68 A;  1XMO M;  2FS1 A;  1N34 M;  3SAS A;  3FTD A;  3MK6 A;  4JI7 M;  1NVM A;  2F5O A;  4GHA A;  1J7K A;  1EE8 A;  3B7N A;  3B9P A;  5EXT A;  2QPA A;  4IBI A;  1QAM A;  3FTE A;  2KNZ A;  3CF2 A;  4IBG A;  4QNR A;  3HY5 A;  2QEN A;  4X66 M;  5EXS A;  4JI8 M;  2RGH A;  4DV2 M;  2V1U A;  3AOG A;  1HNZ M;  4LZJ A;  4PDI A;  2R0I A;  5KQD A;  1VEJ A;  1QZM A;  2DWZ B;  2KNV A;  3HJQ A;  3TWL A;  4Z8X A;  3FKE A;  2BNK A;  5C18 A;  1OIP A;  2DAI A;  2F5S A;  2UUB M;  1IN7 A;  4AZF A;  4CGY B;  3A98 B;  1IN4 A;  3GO8 A;  3KDS E;  3I51 A;  5FLX S;  1E94 E;  2DAG A;  5FSW A;  1Y8G A;  2Z4R A;  2CHQ A;  5FTK A;  1N75 A;  1IQP A;  3RE8 A;  3TL4 X;  1MX0 A;  3SYL A;  2EJS A;  3AFH A;  1WGL A;  2HWJ A;  5DFL A;  3U6D A;  3GRY A;  2DWN A;  1XWI A;  2JP7 A;  2EO2 A;  4I4L A;  2R4E A;  1HJP A;  1BVS A;  1YUB A;  5EP1 A;  1SXJ B;  4M9X A;  4NSR A;  2QZ4 A;  1AUA A;  3MHV C;  3AV0 A;  1HR0 M;  3KS8 A;  3FYD A;  1MJG M;  3U6M A;  3GLF B;  4IBD A;  3EIH A;  4OW0 A;  3B7Z A;  3W67 A;  4LRT A;  1K3X A;  2Y0T A;  2M5Z A;  1NSF A;  1W5S A;  1AIP C;  2LXE A;  3W0L B;  2VQF M;  4FVM A;  4AG5 A;  2JXN A;  3I01 M;  4KT0 F;  5ITX A;  1XMQ M;  1GKI A;  3HU3 A;  2LHC A;  4JI3 M;  4KLN A;  1IM2 A;  3KOW E;  2F5P A;  2O25 A;  1GLN A;  4GC5 A;  2QHO B;  1DGH B;  4L16 A;  3IG8 A;  4B3M M;  3HHW A;  2DZN B;  5BR8 M;  2F5Q A;  4LF5 M;  4G4N A;  1R7R A;  2LBC A;  2QSF X;  2CUZ A;  2LVA A;  2O5R A;  3M0E A;  1XXH B;  4W5W A;  5EP4 A;  5EXX A;  2WSF F;  2C98 A;  4LF7 M;  3KFU G;  4OU7 A;  2JY8 A;  3K8Z A;  4DUZ M;  4DR1 M;  2ERC A;  4JI1 M;  4LG2 A;  2LVQ D;  8CAT A;  4B3S M;  3B74 A;  3T1H M;  4R3D A;  3ZQJ A;  3AKZ A;  1G8P A;  3KSJ A;  4R7G A;  1NY5 A;  4JN6 A;  3I4V A;  4CIS A;  3F92 A;  1VG5 A;  2ZBK B;  3HZJ A;  2E5L M;  5BPV A;  3OTO M;  3U5Z A;  4IBF A;  2I7N A;  1E9S A;  1I4W A;  1IY2 A;  3GLI B;  1VDD A;  3VFD A;  1TH2 A;  3M6A A;  3MMP A;  2L09 A;  2X4A A;  2DAM A;  3SHG B;  4BBA A;  4X62 M;  1HQC A;  4YHH M;  1IXZ A;  2CV1 A;  4PD2 A;  1YSY A;  4FW9 A;  3T6P A;  1YE9 A;  3E4R A;  4M0W A;  2OOB A;  4AQY M;  1GAB A;  1DO2 A;  4AG6 A;  2P5T A;  2J7N A;  4LY6 A;  2XLJ A;  3SAW A;  4DV7 M;  2X49 A;  3SYK A;  2K9D A;  5FTJ A;  2FNA A;  4PT5 A;  1NHW C;  3W0F A;  1QYR A;  1GL6 A;  2UU9 M;  4OX9 M;  4DV0 M;  2C5R A;  1Q3C A;  1ORY B;  4OVZ B;  4L8R C;  1E32 A;  5F3W A;  4LJ5 A;  2DWL A;  1OIZ A;  3WHK A;  3K9P A;  3FTC A;  4K0K M;  4KHP M;  5L8R F;  2F5N A;  1Q3B A;  3FUU A;  3GRU A;  4HL4 A;  5IT9 S;  2R4J A;  2LVO C;  3JR5 A;  3U6S A;  3JAM S;  2DAE A;  4BLC A;  3GPU A;  4DV3 M;  1SXJ D;  2CHV A;  2DI0 A;  1G3I A;  1QDT A;  2QNJ A;  4G4O A;  4DR2 M;  2MRO B;  1T3T A;  4X65 M;  3QAU A;  2R65 A;  4JYA M;  3LQQ A;  2J5Y A;  2KDL A;  2R18 A;  4LGY A;  3D8L A;  4LJ6 A;  1V92 A;  3AOE A;  4LJ4 A;  2R45 A;  1IBM M;  2C96 A;  4YY3 M;  4XK8 F;  1MN3 A;  2DHY A;  3GLG B;  2HHH M;  3KW6 A;  4F2L A;  2Z3X A;  2RRU A;  1SXJ A;  1L2C A;  3GRV A;  1PJQ A;  3GLH E;  5IWA M;  2XFS A;  3GLF A;  3MJ5 A;  2JY5 A;  2UUC M;  4B08 A;  4DR3 M;  1OJL A;  1QQW A;  4GEW A;  3U60 A;  2DXI A;  2W82 A;  4M9S A;  3LQR A;  1N77 A;  4D80 A;  1L2D A;  3T15 A;  2O01 F;  1OAO C;  4XGI A;  1WJ7 A;  5FTN A;  4AKG A;  3DOA A;  4DV1 M;  4FCW A;  1IN5 A;  4JI5 M;  1DGH A;  1JB0 F;  1NHG C;  1PJT A;  2R46 A;  4UN2 B;  2FE8 A;  1R6B X;  1W5T A;  3CGW A;  2MR9 A;  1YLA A;  1L1Z A;  2Z7J A;  2JZ1 A;  2DKL A;  4AKH A;  2KZS A;  2EKK A;  1XXH A;  1FJG M;  4P17 A;  3HJ8 A;  3IG5 A;  3NWL A;  3FE3 A;  3HHY A;  1EIJ A;  1G59 A;  5IZ7 D;  1VEG A;  4F1I A;  5JI2 E;  3SAR A;  4LZZ A;  1PJJ A;  3LW5 F;  2L6O A;  3K9O A;  2NQ8 C;  1HNW M;  3FD9 A;  1PJS A;  4KOD A;  1GJS A;  3M7G A;  5H37 D;  4DV6 M;  2FOI C;  4II7 A;  1HQY E;  2XSZ D;  1K3W A;  3GLI A;  3B7Q A;  4LJ8 A;  1L2B A;  4LF9 M;  1DV0 A;  2XGN A;  3J80 S;  1HT2 E;  2K47 A;  3ZC7 B;  4DV5 M;  2G8L A;  4CHT B;  1ZMW A;  3GPX A;  3SMP A; 
#chains in the Genus database with same CATH homology
 2D7G A;  2YNM D;  4GH9 A;  3SAV A;  4GMQ A;  3L28 A;  2KRK A;  5EP2 A;  2AHM A;  1DGB A;  2XSZ A;  1OFI A;  3DFZ A;  4B7H A;  3HJS A;  2DZO B;  2M60 A;  3SC3 A;  4PCZ A;  3U6P A;  3SAU A;  3U60 A;  3VK8 A;  1N36 M;  1KSF X;  3LVV A;  5FTL A;  4D81 A;  2KXE A;  2CHG A;  2L7I A;  3FUX A;  1TDH A;  4FCT A;  4RF1 A;  5EQT A;  5C1B A;  1JR3 D;  2EUC A;  3HGI A;  4LGM A;  1FNN A;  2H1R A;  3GQ4 A;  3JR4 A;  4LJ9 A;  4MH0 E;  4OVZ A;  4LF6 M;  3KOY E;  2CV2 A;  3E9S A;  4JI2 M;  2CFO A;  1H6U A;  3UJN A;  3RFW A;  4WUR A;  4QOZ C;  3FUV A;  4WW0 A;  2XZU A;  2XH9 A;  1IN8 A;  2Y20 A;  4B7G A;  2LNH C;  1PM5 A;  4MGH A;  3PVS A;  1JR3 A;  4G6Z A;  3UZU A;  3RGS A;  1IXR C;  5GKN A;  5LMU M;  4IBK A;  4B7F A;  2D7H A;  4L4U A;  3TQS A;  4QHT A;  4LF8 M;  1Z5B A;  3C58 A;  3VKH A;  1Z5C A;  4S12 A;  3TPZ A;  3GLG A;  4LCB A;  3VKG A;  4NOO B;  3LVW A;  3VDU A;  3L26 A;  3U60 B;  4B3R M;  3K2L A;  3UGJ A;  4NXN M;  4IBJ A;  4KO8 A;  2VQE M;  1QAN A;  2ZAM A;  5KPR A;  2KW0 A;  1Z59 A;  4QOS A;  2EA0 A;  3VDP A;  3PNV A;  4MB7 A;  4MM3 B;  4LJ7 A;  3THG A;  4I5S A;  2ZAO A;  4DR5 M;  3J27 B;  2G5G X;  5ITX E;  2XZF A;  2QBY B;  1QAO A;  4NL4 H;  3FYC A;  2Q2E B;  5EJC A;  3HWS A;  5EXP A;  3BOS A;  1J5E M;  2BJV A;  3UK6 A;  1NY6 A;  2C9O A;  4JXJ A;  1XC8 A;  4AI6 A;  3J81 S;  4DUY M;  1ZAE A;  3AOE C;  4IBC A;  1G4A E;  3NBI A;  3HHX A;  2XF3 A;  2A5Y B;  4TUW A;  2YQZ A;  2XEP A;  3R8F A;  3GPY A;  4GIT A;  1SXJ C;  5JI3 E;  3TE6 A;  3A46 A;  3KOZ E;  3L29 A;  2CE7 A;  3VK7 A;  5IRE B;  4RNA A;  1OFH A;  1MU5 A;  3T1Y M;  3KP0 E;  5DNY A;  2DWM A;  5A2Q S;  3PNY A;  1N33 M;  3KP1 E;  3PXG A;  5ITR A;  1QAQ A;  2UXD M;  1IY1 A;  3WHL A;  4I8O A;  3FTF A;  5EP3 A;  3K92 A;  3PFI A;  3KXE C;  4LFA M;  2RGO A;  1PJI A;  1Z5A A;  2J7O A;  4DR4 M;  3GQ3 A;  3H4M A;  4FWG A;  4GC9 A;  2Z4S A;  4FWH A;  1UM8 A;  4L78 A;  2YFQ A;  5KPT A;  5ITU A;  3AL0 C;  1TGU A;  4DR7 M;  7CAT A;  4PDG A;  1DO0 A;  2L7H A;  3KOX E;  1NJG A;  1E9R A;  3FUT A;  3KSX A;  3SFZ A;  3CF0 A;  3GP1 A;  4ZPX A;  3U6E A;  1GVN A;  2VII A;  2I7P A;  3A42 A;  3U6Q A;  4XBO A;  4AW4 A;  2JA2 A;  4IJE A;  3TWK A;  4IIW A;  3J7A S;  1TH3 A;  3R9X B;  5DYI A;  4IJF A;  3AJI B;  2LH0 A;  2HKJ A;  1GL7 A;  4LJA A;  5DYG A;  1LV7 A;  1QVR A;  4NSO B;  5ITY A;  4AKI A;  3U61 B;  1K82 A;  1WXQ A;  3L27 A;  3QWL A;  5ITT A;  3U6C A;  4FD2 A;  1SXJ E;  4NRW A;  1IXS B;  3UMM A;  2CV0 A;  1XNQ M;  2KRU A;  2QCU A;  4LF4 M;  3ZCB B;  1KYI A;  4RF0 A;  3FUW A;  3GPP A;  3SBJ A;  4LRS A;  3ZH9 B;  1ZQ9 A;  4Z6Y A;  4BB9 A;  3I4Y A;  4G4Q A;  1R2Z A;  2QBY A;  4DV4 M;  3T38 A;  2CEA A;  1TDZ A;  1TH4 A;  2KA6 B;  2OPF A;  4LFC M;  1DGF A;  4D82 A;  1HNX M;  1IY0 A;  3J2P B;  3A45 A;  1L1T A;  4I81 A;  4NRV A;  2V6Z M;  3DA1 A;  3KVW A;  4M9Z A;  1XHB A;  2D7E A;  4GKJ M;  1N32 M;  4HLQ A;  3DZD A;  2UUA M;  1NNU C;  1S3S A;  3SAT A;  3CTW B;  1IN6 A;  2FFJ A;  2UXB M;  2C99 A;  2KZU A;  1L8Q A;  1IBL M;  5ITQ A;  3GRR A;  1DGG A;  5LMN M;  3L2A A;  1Q39 A;  4FCV A;  4B3T M;  3SHF A;  4M0D A;  1I94 M;  1D2N A;  3GLH A;  2X8A A;  5E26 A;  3J7B A;  5FTM A;  2Y0Q A;  3U6O A;  1X37 A;  5E6J A;  4MGK E;  4QNM A;  5KPZ A;  5KQ8 A;  4GKK M;  2Y21 A;  3ILK A;  2UXC M;  3CF6 E;  2YR0 A;  1NJF A;  1JQJ C;  4L15 A;  2BJW A;  4GHL A;  1J09 A;  2V1C A;  1IBK M;  2LWX A;  3VLF B;  4GRI A;  1R2Y A;  4LFB M;  4MGI E;  2C9C A;  1NNJ A;  4JI6 M;  3HKP A;  3GQ5 A;  4G4R A;  2F4V M;  3HU1 A;  4JV5 M;  2DHR A;  3HHZ A;  2OQ4 A;  1C1K A;  1XNR M;  2DVW B;  2RKO A;  4FWD A;  3TWM A;  4NXM M;  4EIW A;  2ZM6 M;  4JI4 M;  4GIP A;  3KS4 A;  3U6L A;  3U5Z B;  3L25 A;  4MGZ E;  4IBB A;  4P16 A;  1KFV A;  3GLH B;  4REZ A;  4QHS A;  2R62 A;  2HCB A;  4JI0 M;  2HL7 A;  3K1J A;  3HU2 A;  3D8B A;  3SMS A;  1Z6T A;  4X64 M;  1HT1 E;  3U61 A;  4MGY E;  1N78 A;  2KEB A;  5KO3 A;  4ITQ A;  3LMM A;  4IBE A;  1G41 A;  3EIE A;  2QP9 X;  3RGP A;  2ZAN A;  4A3V B;  3Q8X A;  2XFT A;  1XMO M;  1N34 M;  3SAS A;  3FTD A;  3MK6 A;  4JI7 M;  1NVM A;  2F5O A;  4GHA A;  1J7K A;  1EE8 A;  3B9P A;  5EXT A;  3FTE A;  2QPA A;  4IBI A;  1QAM A;  4IBG A;  3CF2 A;  4QNR A;  2QEN A;  4X66 M;  5EXS A;  4JI8 M;  2RGH A;  4DV2 M;  2V1U A;  3AOG A;  1HNZ M;  4LZJ A;  4PDI A;  5KQD A;  2DWZ B;  1QZM A;  5C18 A;  3TWL A;  3HJQ A;  2UUB M;  4Z8X A;  3FKE A;  2BNK A;  4DR6 M;  2F5S A;  1IN7 A;  4AZF A;  4CGY B;  3A98 B;  1IN4 A;  3GO8 A;  3KDS E;  3I51 A;  5FLX S;  1E94 E;  5FSW A;  2Z4R A;  2CHQ A;  5FTK A;  1N75 A;  1IQP A;  3RE8 A;  3TL4 X;  1MX0 A;  3SYL A;  3AFH A;  2DWN A;  3U6D A;  3GRY A;  1XWI A;  2EO2 A;  4I4L A;  2R4E A;  1YUB A;  5EP1 A;  1SXJ B;  4M9X A;  4NSR A;  2QZ4 A;  3MHV C;  3AV0 A;  1HR0 M;  3KS8 A;  3FYD A;  3U6M A;  3GLF B;  4IBD A;  3EIH A;  4OW0 A;  4LRT A;  1K3X A;  2Y0T A;  2M5Z A;  1NSF A;  1W5S A;  2LXE A;  3W0L B;  2VQF M;  4FVM A;  4AG5 A;  5ITX A;  1XMQ M;  3HU3 A;  1GKI A;  4JI3 M;  4KLN A;  1IM2 A;  3KOW E;  2F5P A;  1GLN A;  4GC5 A;  4L16 A;  1DGH B;  3IG8 A;  4B3M M;  3HHW A;  2DZN B;  5BR8 M;  2F5Q A;  4LF5 M;  4G4N A;  1R7R A;  5EP4 A;  2CUZ A;  2O5R A;  4W5W A;  3M0E A;  1XXH B;  3KFU G;  5EXX A;  4LF7 M;  2C98 A;  4OU7 A;  3K8Z A;  4DUZ M;  4DR1 M;  2ERC A;  4JI1 M;  4LG2 A;  8CAT A;  4B3S M;  3T1H M;  4R3D A;  3AKZ A;  1G8P A;  3KSJ A;  4R7G A;  1NY5 A;  4JN6 A;  3I4V A;  4CIS A;  2ZBK B;  2E5L M;  5BPV A;  3OTO M;  3U5Z A;  4IBF A;  2I7N A;  1E9S A;  1I4W A;  1IY2 A;  3GLI B;  1VDD A;  3VFD A;  1TH2 A;  3M6A A;  2L09 A;  2X4A A;  3SHG B;  4BBA A;  4X62 M;  1HQC A;  4YHH M;  1IXZ A;  2CV1 A;  4PD2 A;  1YSY A;  4FW9 A;  1YE9 A;  3E4R A;  4M0W A;  4AQY M;  1DO2 A;  4AG6 A;  2P5T A;  2J7N A;  4LY6 A;  2XLJ A;  3SAW A;  4DV7 M;  2X49 A;  3SYK A;  5FTJ A;  2FNA A;  4PT5 A;  1NHW C;  3W0F A;  1QYR A;  1GL6 A;  2UU9 M;  4OX9 M;  4DV0 M;  2C5R A;  1Q3C A;  1ORY B;  4OVZ B;  4L8R C;  1E32 A;  5F3W A;  4LJ5 A;  2DWL A;  3WHK A;  3FTC A;  4K0K M;  4KHP M;  2F5N A;  1Q3B A;  3FUU A;  3GRU A;  4HL4 A;  5IT9 S;  2R4J A;  3JR5 A;  3U6S A;  3JAM S;  4BLC A;  3GPU A;  4DV3 M;  1SXJ D;  2CHV A;  1G3I A;  4G4O A;  4DR2 M;  1T3T A;  4X65 M;  3QAU A;  2R65 A;  4JYA M;  3LQQ A;  4LGY A;  2R18 A;  3D8L A;  4LJ6 A;  3AOE A;  4LJ4 A;  2R45 A;  1IBM M;  2C96 A;  4YY3 M;  2HHH M;  3GLG B;  3KW6 A;  2Z3X A;  1SXJ A;  1L2C A;  3GRV A;  5IWA M;  2XFS A;  3GLF A;  3MJ5 A;  2UUC M;  4B08 A;  4DR3 M;  1OJL A;  1QQW A;  2DXI A;  2W82 A;  4M9S A;  3LQR A;  1N77 A;  4D80 A;  1L2D A;  3T15 A;  4XGI A;  5FTN A;  4AKG A;  3DOA A;  4DV1 M;  4FCW A;  1IN5 A;  4JI5 M;  1DGH A;  1NHG C;  2R46 A;  2FE8 A;  1R6B X;  1W5T A;  1L1Z A;  2Z7J A;  4AKH A;  2KZS A;  1FJG M;  1XXH A;  3HJ8 A;  3IG5 A;  3NWL A;  3HHY A;  1G59 A;  5IZ7 D;  5JI2 E;  3SAR A;  4LZZ A;  1PJJ A;  2L6O A;  2NQ8 C;  1HNW M;  3FD9 A;  4KOD A;  3M7G A;  5H37 D;  4DV6 M;  2FOI C;  4II7 A;  1HQY E;  2XSZ D;  1K3W A;  3GLI A;  4LJ8 A;  1L2B A;  4LF9 M;  2XGN A;  3J80 S;  1HT2 E;  2K47 A;  3ZC7 B;  4DV5 M;  2G8L A;  4CHT B;  3GPX A;  3SMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...