4JI2M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji2M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji2M02
2UU9M 4X65M 3U6MA 2HHHM 3SATA 1L1TA 3GPYA 4DUZM 1PJJA 1N36M 5IWAM 3W0FA 1Z59A 4KHPM 3SARA 3SAVA 3SASA 4DUYM 4GKKM 4JI8M 4PDGA 3T1YM 1IBLM 3SAUA 1XNRM 2UXDM 1Q3CA 1TDHA 4AQYM 1MX0A 1NNJA 4X66M 4B3SM 4LFBM 4DR6M 1L2CA 3C58A 1K3XA 5ITTA 3U6OA 1IBMM 4DR3M 4JV5M 5A2QS 1R2ZA 4YHHM 1L2DA 1XMOM 5ITUA 2UUAM 1HNXM 3TWMA 1IBKM 4DV1M 2OQ4A 5LMUM 4K0KM 4DV5M 4ITQA 3DOAA 3TWKA 4G4RA 1PJIA 3VK7A 1XNQM 1R2YA 4NRWA 3GQ4A 3SAWA 1XC8A 1J5EM 4DV0M 4CISA 4JI5M 1Q39A 3GO8A 4NXNM 2XZUA 4GKJM 5ITQA 4YY3M 4B3MM 4X62M 1Z5AA 4DV4M 3J80S 2F5PA 4JI1M 3JR4A 4MB7A 1Q3BA 1L1ZA 4JI7M 1K3WA 1HNWM 4G4NA 1KFVA 4DR7M 4DV7M 4NXMM 2OPFA 5LMNM 3GPUA 3T1HM 1K82A 2EA0A 1MU5A 2XZFA 1N33M 3JR5A 4JI2M 3JAMS 3A45A 3A46A 5ITXA 4B3RM 5ITXE 3GQ3A 3SBJA 4LF4M 4LF8M 1XMQM 3U6LA 4X64M 4LFCM 4DR2M 1N34M 4LFAM 1EE8A 4JI3M 1Z5BA 5IT9S 2Q2EB 3GPPA 3J7AS 1L2BA 2UXCM 4DV2M 4G4OA 4LF9M 3U6DA 1HNZM 1Z5CA 3GP1A 2F4VM 3VK8A 2F5SA 3U6QA 1N32M 1HR0M 4LF6M 4DR5M 2ZBKB 2F5NA 3U6EA 5ITYA 2VQEM 4LF7M 4OX9M 1FJGM 4DR4M 4DV6M 3TWLA 2ZM6M 2UUCM 3OTOM 1I94M 4PCZA 3U6SA 4LF5M 5ITRA 3U6PA 2HKJA 2VQFM 3U6CA 3J81S 4NRVA 4DV3M 4JYAM 5FLXS 1TDZA 5BR8M 2UUBM 3GPXA 2E5LM 4JI6M 4PDIA 2UXBM 4G4QA 4DR1M 3GQ5A 3A42A 4PD2A 2F5QA 2F5OA 1PM5A 4B3TM 4JI4M 4JI0M
chains in the Genus database with same CATH superfamily
3UGJA 1DO2A 4LJ6A 3VFDA 3LQRA 5F3WA 2HHHM 2AHMA 3SATA 3GPYA 1PJJA 3FE3A 1HT1E 1QDRA 3SHFA 2O5RA 2C9CA 3R8FA 3NBXX 4CGYB 3TQSA 1TR8A 4IJFA 2G8LA 2EUCA 4KHPM 1GO5A 3SARA 1W5TA 3FTDA 4FWDA 4D80A 3A98B 3FUUA 1QUTA 1QQWA 2BWBA 4JI8M 2ZANA 4NOOB 2Z4SA 5FSWA 2JY5A 1IBLM 4MGIE 4AQYM 2WZJA 5EXPA 3GLHA 1IXZA 1MX0A 3I51A 2NQ8C 4GC9A 4X66M 1T6OA 4B3SM 2Y0TA 3KP1E 3M0EA 4DR6M 1OAIA 1L2CA 2K0BX 4LRSA 3HJSA 3MHVC 4HLQA 2KNZA 3U6OA 1R7RA 1SXJE 1NNUC 1IBMM 4GHAA 3DZDA 4GEWA 1N78A 3FYCA 5ITUA 1XMOM 1HNXM 3TWMA 2JXNA 1GKIA 2OQ4A 1PJTA 2KNVA 5GKNA 3HY5A 4ITQA 2CFOA 2D7GA 2FOIC 2LVNC 3F92A 4FCWA 3TWKA 5JI2E 2QBYA 2XSZA 1PJIA 3AKZA 1XNQM 3LVVA 5C1BA 2MR9A 2L7HA 4NRWA 3FUTA 1VEKA 1ZMUA 3FRIA 2L4FA 2BJVA 2KW0A 1G41A 3PVSA 4DV0M 1G4AE 2LXEA 4RKUF 4MH0E 5ITQA 2XH9A 4B3MM 4X62M 2LHCA 2ZTDA 4DV4M 3J80S 3Q8GA 3JR4A 2J5YA 1JR3E 3BXWA 3VDUA 2LHGA 1D0KA 3CF0A 3U61A 1L1ZA 2R44A 4QNRA 4DR7M 3QAUA 4MGHA 4DV7M 2HWJA 4R71A 3I04M 3KOZE 3T1HM 1N75A 4Z6YA 3JAMS 4LJ5A 1ZMVA 5ITXA 2G5GX 3IG5A 2KNAA 3I4YA 5IZ7D 3UMMA 1SG9A 2A5YB 2DZOB 3DFZA 3SBJA 4LF4M 3GRVA 4DR2M 1ZAEA 4LFAM 4M0WA 2YR0A 5IT9S 2K47A 2Q2EB 3CF6E 3MJ5A 4W5WA 4AKIA 4IBDA 1L2BA 1SXJD 5BPVA 4G4OA 4LF9M 2RGHA 2R46A 1GABA 3AL0C 1IY0A 2F4VM 1OFIA 1QAQA 2VIIA 4IBFA 3VK8A 3L25A 4B08A 1G3IA 4XBOA 2F5NA 3U6EA 3TWLA 1OTRA 2DI0A 3SHGB 1GL7A 3B7QA 2XEPA 2XGNA 2B3TA 3LW5F 1T3TA 1IXSB 2MH8A 4LF5M 3KVWA 1XXHB 4ANRA 2VQFM 3I01M 1OQYA 1WHCA 2ZTCA 3HU2A 3GRRA 1IXRC 4FD2A 1TF0B 3U5ZB 3PFIA 2JNHA 4NSRA 3KW6A 3IHPA 4L8RC 1E32A 3HHWA 4PDIA 2UXBM 1JR3D 2APLA 2QSFX 3FUWA 2XLJA 2QHOB 3A42A 3K9OA 3EIHA 5DYIA 2F5QA 1KSFX 2VF8A 1QANA 4L4UA 1D2NA 1PM5A 3T15A 4JI4M 4RF0A 1YE9A 2RGOA 1HQCA 5EQTA 1C7YA 2JA2A 1G8PA 3B74A 3SYKA 1IN8A 4PT5A 3U60A 1NJFA 3Q8XA 1YSYA 1H6UA 2CRUA 3TE6A 5EP1A 3LCVB 4LRTA 4AG6A 1IFYA 2N35A 1E9SA 3SAVA 3E21A 5KPZA 5KQDA 3CGWA 3HJ8A 3GLIA 2DWNA 4BB9A 4TUWA 4MGZE 2JWSA 1IN7A 3H4JA 4P16A 2DAKA 3ILKA 1XXHE 2DAEA 4B7GA 1OKSA 2CWBA 2DNAA 2KRKA 4R3DA 4GHLA 1IY1A 1JR3A 2DAMA 3PXGA 2BWEA 1DGGA 2V1UA 2JY8A 2O01F 1NY6A 1TH3A 1K3XA 2V1CA 1QYRA 3D8LA 2R0IA 1L2DA 4YHHM 3L26A 4NL4H 2JY6B 2CUZA 3KS8A 4DV1M 5LMUM 3MK6A 4FVMA 3KFUG 1DGBA 3DOAA 3FUXA 5DNYA 2R45A 3GLGB 1R2YA 3FD9A 2J7NA 1NV8A 1YUBA 4NC6A 4QOZC 4QHTA 2Z8YM 3HHZA 3AV0A 1J5EM 2M60A 1VDLA 2GNOA 4AKGA 4IBCA 1R5LA 1GL6A 2RKOA 4JI5M 1Q39A 4GKJM 5EJCA 1IN4A 1Q02A 2H5XA 3C3DA 3K92A 4JI1M 1VEGA 2HAKA 2KZUA 3LMMA 1D0LA 3QYEA 3RFWA 1T43A 3HHXA 2OOBA 2VF7A 1AIPC 3AOEA 2DAIA 2EA0A 1WGLA 3E9SA 4HL4A 2L6OA 2QZ4A 1FNNA 1OIPA 3MMPA 1N77A 4JI2M 3A46A 1QUSA 1MJGM 3K9PA 3B9PA 5JI3E 4M9SA 1JB0F 4LFCM 1N34M 1WJ7A 1EE8A 2Y0QA 4NSOB 3GLGE 1QAOA 3B7ZA 3CTWB 3J7AS 3M7GA 1VEJA 1KYIA 4Y28F 4LJ9A 1PRBA 4I4LA 3W0LB 3KDSE 4GH9A 3U6QA 1N32M 1WIVA 1VQ1A 1NV9A 4D82A 1WGNA 4M9XA 4LF6M 4DR5M 2ZBKB 2LWXA 5ITYA 4LF7M 2HCBA 4L16A 4S12A 2LH0A 5E6JA 2M5ZA 3K2LA 3KOWE 2ERCA 2CE7A 3KOXE 2CV2A 2KDLA 4LY6A 4WW0A 4LJAA 3U6SA 2LBCA 3U6PA 3T38A 2XF3A 2DZLA 5IREB 5FTLA 2OOAA 4JN6A 2BNKA 1QDTA 4JYAM 3J2PB 5FLXS 1TDZA 2DHRA 2P5TA 5BR8M 4B7FA 4LJ7A 2E5LM 1NVMA 3B89A 1TH2A 1OIZA 3UK6A 2Y20A 4MGKE 1ZQ9A 3HU3A 2X4AA 4LJ8A 4M9ZA 2Z3XA 2C9OA 4X65M 3U6MA 2G3QA 1L1TA 2I7NA 4DUZM 2O25A 2QBYB 2X8AA 5EP4A 1N36M 1D0MA 1XB2B 3LVWA 3VKGA 2C99A 1I4WA 3THGA 1XHBA 3CF2A 2C5RA 4IBJA 3W0FA 2JP7A 3AOGA 4GKKM 4QHSA 4PDGA 3T1YM 1XNRM 2QENA 2UXDM 1Q3CA 4CIZA 3NWLA 2R6FA 3VKHA 2R62A 3U61B 4OVZA 2LVAA 3I4VA 5DYGA 1SXJA 1V33A 2XFTA 1TH4A 3GLFB 2MGWA 4JV5M 1GLNA 2R4EA 3FKEA 1Y8GA 2FE8A 2MJ5B 1IBKM 5DFLA 2KA6B 2CP8A 3QWLA 2DWMA 4G3OA 4G4RA 1DO0A 4AKHA 4KODA 1QZMA 2W82A 2KRUA 1PGYA 4AI6A 2EJSA 1QVRA 4IIWA 2QCUA 2LVOC 4GITA 3HGIA 2L09A 1LV7A 4CISA 2R18A 1X37A 4XGIA 1IY2A 2JUJA 2XZUA 4NXNM 5KQ8A 3ZCBB 4YY3M 1EFUB 1OAOC 5EXXA 2F5PA 4MB7A 2K6BA 1Q3BA 2KEBA 3KP0E 2HL7A 3ZC7B 4JI7M 1HNWM 3FTFA 3L29A 1RU3A 2CHGA 4NXMM 4IBEA 4RNAA 3RE8A 1PJQA 4XK8F 3GLFE 5LMNM 1K82A 2XZFA 4HEOA 3AFHA 4FWGA 4LGMA 1N33M 1ORYB 4QOSA 4LJ4A 3JR5A 2J7OA 3J7BA 1ZV1A 2LNHC 1QAMA 3L27A 2CV1A 3R9XB 2WSFF 5ITXE 3GQ3A 2D7HA 1XMQM 3NBIA 3FYDA 3V76A 4EIWA 1DGFA 4X64M 5L8RF 4JI3M 1Z5BA 2I7PA 1E94E 2DENA 3KSJA 2KZSA 2EKKA 5EP3A 1VG5A 2Z7JA 4DV2M 2UXCM 3U6DA 1V92A 1GJTA 3BOSA 4B7HA 3K8ZA 3RGPA 3UZUA 1HNZM 1TTEA 2FH0A 3LCUA 3SMPA 4GIPA 2LVQD 3K1JA 5H37D 1C1KA 2JZ1A 3IECA 3U60B 2RRUA 4OX9M 4DV6M 5FTMA 3VLFB 4I8OA 1TGUA 4AZFA 2UUCM 1R6BX 2FFJA 2LVPC 2XSZD 1R4GA 2ZAOA 4Q7JA 4L6V6 2OO9A 4ZPXA 1I94M 1F4IA 3FRHA 3QYBA 4PCZA 3TL4X 2DHYA 3GLIB 5ITRA 4F1IA 2CHVA 1P3QQ 1NO1A 2CV0A 3U6CA 1DGHB 1YLAA 3HX3A 1ZMWA 3W68A 4BBAA 1IN6A 1S3SA 4DV3M 3AOEC 4LG2A 5FTKA 4CJ6A 2FNAA 4IBKA 4GC5A 4F2LA 4IBIA 2C98A 3GPXA 2OPFA 2UUBM 4JI6M 4M0DA 4G4QA 4DR1M 4MGYE 2R65A 2VDBB 4PD2A 4OU7A 3C3EA 2F5OA 4B3TM 4LFBM 1Z5AA 3AJIB 4JI0M 3KS4A 3FTEA 4FW9A 1VDDA 2UU9M 1AUAA 4L78A 3HHYA 4II7A 4LZZA 2EO2A 2YFQA 2DZNB 1IN5A 3KXEC 4Z8XA 5IWAM 1WR1B 5EXSA 4IBBA 1Z59A 1EIJA 1IXSA 3SASA 4DUYM 1CUKA 2WSEF 4KLNA 1XXHA 4IJEA 3WHKA 3J27B 3GLHB 3SAUA 4UN2B 1TDHA 2L7IA 4P17A 3GLIE 1NSFA 1NJGA 4QNMA 1NNJA 5EP2A 3KOYE 3U5ZA 2GQFA 1XWIA 5C18A 5KO3A 2EKFA 4MM3B 3C58A 2DXIA 3SMSA 3SC3A 3SYLA 5ITTA 3IG8A 2KHHA 4DR3M 3GLFA 4L15A 2YQZA 4LZJA 2MROB 5A2QS 4CHTB 1R2ZA 2UUAM 1WXQA 2D7EA 4GMQA 3ZQJA 4WP2A 4K0KM 1NHGC 4FCTA 1JQJC 2DAGA 4DBGB 3E4RA 4LCBA 4REZA 3PNYA 1OFHA 4DV5M 3HWSA 3VK7A 1HT2E 3HKPA 1J7KA 3GQ4A 3WHLA 8CATA 3SAWA 1A5TA 1XC8A 3H4MA 2CHQA 4RF1A 1IM2A 4WURA 3GO8A 1MN3A 1GVNA 1E9RA 3GLHE 4FCVA 4I5SA 5KPRA 4FWHA 1QZEA 1HJPA 2CEAA 2JZ0A 4AW4A 2R4JA 3TPZA 1L8QA 1NHWC 2DKLA 4OW0A 1IQPA 4D81A 4G4NA 1K3WA 1KFVA 1G59A 4LGYA 1OJLA 3T6PA 2Y21A 5FTNA 3KSXA 1W5SA 2JY7A 3ZH9B 3B7NA 4A3VB 5KPTA 1MU5A 3GPUA 5FTJA 1SXJC 2DWLA 3A45A 4B3RM 1G71A 4AG5A 1J09A 3GLGA 4LF8M 3L28A 4GRIA 3U6LA 2L2DA 4JXJA 3W67A 3L2AA 2C96A 2LTUA 3SFZA 3DA1A 4R7GA 3GPPA 2DVWB 3EIEA 1Z6TA 3E46A 1PJSA 4KT0F 3PNVA 1Z5CA 3GP1A 4KO8A 2F5SA 2WSCF 2H1RA 2QQ8A 1HR0M 3GRYA 3HJQA 2QP9X 1FJGM 4DR4M 3VDPA 2VQEM 1LTMA 2Z4RA 2QPAA 7CATA 2ZM6M 2QNJA 1NY5A 1UFZA 3OTOM 2YNMD 4G6ZA 2ZAMA 3C9PA 3D8BA 3GRUA 1DV0A 2FS1A 1UM8A 2X49A 4I81A 2XFSA 2HKJA 3M6AA 4BLCA 3LQQA 3BBZA 2BJWA 3HU1A 4NRVA 1DGHA 3RGSA 3J81S 5E26A 3FUVA 1BVSA 1V34A 4OVZB 1SXJB 1GJSA 1HQYE 4IBGA 3GQ5A 2V6ZM 3FTCA 3HZJA 2DWZB 2KXEA 3UJNA 5EXTA 2K9DA 2L4EA
chains in the Genus database with same CATH topology
3UGJA 1DO2A 4LJ6A 3VFDA 3LQRA 5F3WA 2HHHM 2AHMA 3SATA 3GPYA 1PJJA 1HT1E 3SHFA 2O5RA 2C9CA 3R8FA 4CGYB 3TQSA 4IJFA 2G8LA 2EUCA 4KHPM 3SARA 1W5TA 3FTDA 4FWDA 4D80A 3A98B 3FUUA 1QQWA 4JI8M 2ZANA 4NOOB 2Z4SA 5FSWA 1IBLM 4MGIE 4AQYM 5EXPA 3GLHA 1IXZA 1MX0A 3I51A 2NQ8C 4GC9A 4X66M 4B3SM 2Y0TA 3KP1E 3M0EA 4DR6M 1L2CA 4LRSA 3HJSA 3MHVC 4HLQA 3U6OA 1R7RA 1SXJE 1NNUC 1IBMM 4GHAA 3DZDA 1N78A 3FYCA 5ITUA 1XMOM 1HNXM 3TWMA 1GKIA 2OQ4A 5GKNA 4ITQA 2CFOA 2D7GA 2FOIC 4FCWA 3TWKA 2QBYA 5JI2E 2XSZA 1PJIA 3AKZA 1XNQM 3LVVA 5C1BA 2L7HA 4NRWA 3FUTA 2BJVA 2KW0A 1G41A 3PVSA 4DV0M 1G4AE 2LXEA 4MH0E 5ITQA 2XH9A 4B3MM 4X62M 4DV4M 3J80S 3JR4A 3VDUA 3U61A 3CF0A 1L1ZA 4QNRA 4DR7M 3QAUA 4MGHA 4DV7M 3KOZE 3T1HM 1N75A 4Z6YA 3JAMS 4LJ5A 5ITXA 2G5GX 3IG5A 5IZ7D 3I4YA 3UMMA 2A5YB 3SBJA 2DZOB 3DFZA 4LF4M 3GRVA 4DR2M 1ZAEA 4LFAM 4M0WA 2YR0A 5IT9S 2K47A 2Q2EB 3CF6E 3MJ5A 4W5WA 4AKIA 4IBDA 1L2BA 1SXJD 5BPVA 4G4OA 4LF9M 2RGHA 2R46A 3AL0C 1IY0A 2F4VM 1QAQA 1OFIA 2VIIA 4IBFA 3VK8A 3L25A 4B08A 1G3IA 4XBOA 2F5NA 3U6EA 3TWLA 3SHGB 1GL7A 2XEPA 2XGNA 1T3TA 1IXSB 4LF5M 3KVWA 1XXHB 2VQFM 3HU2A 3GRRA 1IXRC 4FD2A 3U5ZB 3PFIA 4NSRA 3KW6A 4L8RC 1E32A 3HHWA 4PDIA 2UXBM 1JR3D 3FUWA 2XLJA 3A42A 3EIHA 5DYIA 2F5QA 1KSFX 4L4UA 1QANA 1PM5A 1D2NA 3T15A 4JI4M 4RF0A 1YE9A 2RGOA 1HQCA 5EQTA 2JA2A 1G8PA 3SYKA 1IN8A 4PT5A 3U60A 1NJFA 3Q8XA 1YSYA 1H6UA 3TE6A 5EP1A 4LRTA 4AG6A 1E9SA 3SAVA 5KPZA 5KQDA 3HJ8A 3GLIA 2DWNA 4BB9A 4TUWA 4MGZE 1IN7A 4P16A 3ILKA 4B7GA 2KRKA 4R3DA 4GHLA 1IY1A 1JR3A 3PXGA 1DGGA 2V1UA 1K3XA 1NY6A 1TH3A 2V1CA 1QYRA 3D8LA 1L2DA 4YHHM 3L26A 4NL4H 3KS8A 2CUZA 4DV1M 5LMUM 3MK6A 4FVMA 3KFUG 1DGBA 3DOAA 3FUXA 5DNYA 2R45A 3GLGB 1R2YA 3FD9A 2J7NA 1YUBA 4QOZC 4QHTA 3HHZA 3AV0A 1J5EM 2M60A 4AKGA 4IBCA 2RKOA 1GL6A 4JI5M 1Q39A 4GKJM 5EJCA 1IN4A 3K92A 4JI1M 2KZUA 3LMMA 3RFWA 3HHXA 3AOEA 2EA0A 3E9SA 4HL4A 2L6OA 2QZ4A 1FNNA 1N77A 4JI2M 3A46A 3B9PA 5JI3E 4M9SA 4LFCM 1N34M 2Y0QA 1EE8A 4NSOB 1QAOA 3CTWB 3J7AS 3M7GA 1KYIA 4LJ9A 4I4LA 3W0LB 3KDSE 4GH9A 3U6QA 1N32M 4D82A 4M9XA 4LF6M 4DR5M 2ZBKB 2LWXA 5ITYA 4LF7M 2HCBA 4L16A 4S12A 2LH0A 5E6JA 2M5ZA 3K2LA 3KOWE 2ERCA 2CE7A 3KOXE 2CV2A 4LY6A 4WW0A 3U6SA 4LJAA 3U6PA 3T38A 2XF3A 5IREB 5FTLA 4JN6A 2BNKA 4JYAM 3J2PB 5FLXS 1TDZA 2DHRA 2P5TA 5BR8M 4B7FA 4LJ7A 2E5LM 1NVMA 1TH2A 3UK6A 2Y20A 4MGKE 1ZQ9A 3HU3A 2X4AA 4LJ8A 4M9ZA 2Z3XA 2C9OA 4X65M 3U6MA 1L1TA 2I7NA 4DUZM 2QBYB 2X8AA 5EP4A 1N36M 3LVWA 3VKGA 2C99A 1I4WA 3THGA 1XHBA 3CF2A 2C5RA 4IBJA 3W0FA 3AOGA 4GKKM 4QHSA 4PDGA 3T1YM 1XNRM 2QENA 2UXDM 1Q3CA 3NWLA 3VKHA 2R62A 3U61B 4OVZA 3I4VA 5DYGA 1SXJA 2XFTA 1TH4A 3GLFB 4JV5M 1GLNA 2R4EA 3FKEA 2FE8A 1IBKM 2KA6B 3QWLA 2DWMA 4G4RA 1DO0A 4AKHA 4KODA 1QZMA 2W82A 2KRUA 4AI6A 1QVRA 4IIWA 2QCUA 4GITA 3HGIA 2L09A 1LV7A 4CISA 2R18A 1X37A 4XGIA 1IY2A 2XZUA 4NXNM 5KQ8A 3ZCBB 4YY3M 5EXXA 2F5PA 4MB7A 1Q3BA 2KEBA 3KP0E 2HL7A 3ZC7B 4JI7M 1HNWM 3FTFA 3L29A 2CHGA 4NXMM 4IBEA 4RNAA 3RE8A 5LMNM 1K82A 2XZFA 1N33M 3AFHA 4FWGA 4LGMA 1ORYB 4QOSA 4LJ4A 3JR5A 2J7OA 3J7BA 2LNHC 1QAMA 3L27A 2CV1A 3R9XB 5ITXE 3GQ3A 2D7HA 1XMQM 3NBIA 3FYDA 4EIWA 4X64M 1DGFA 4JI3M 1Z5BA 2I7PA 1E94E 3KSJA 2KZSA 5EP3A 2UXCM 2Z7JA 4DV2M 3U6DA 3BOSA 4B7HA 3K8ZA 3RGPA 3UZUA 1HNZM 3SMPA 4GIPA 3K1JA 5H37D 1C1KA 3U60B 4OX9M 4DV6M 5FTMA 3VLFB 4I8OA 1TGUA 4AZFA 2UUCM 1R6BX 2FFJA 2XSZD 2ZAOA 1I94M 4ZPXA 4PCZA 3TL4X 3GLIB 5ITRA 2CHVA 2CV0A 3U6CA 1DGHB 4BBAA 1IN6A 1S3SA 4DV3M 3AOEC 4LG2A 5FTKA 2FNAA 4IBKA 4GC5A 2UUBM 4IBIA 2C98A 3GPXA 4JI6M 4M0DA 4G4QA 4DR1M 4MGYE 2R65A 4PD2A 4OU7A 2F5OA 4B3TM 4LFBM 3AJIB 1Z5AA 4JI0M 3KS4A 3FTEA 4FW9A 1VDDA 2UU9M 4L78A 3HHYA 4II7A 4LZZA 2EO2A 2YFQA 2DZNB 1IN5A 3KXEC 4Z8XA 5IWAM 5EXSA 4IBBA 1Z59A 3SASA 4DUYM 4KLNA 1XXHA 4IJEA 3WHKA 3J27B 3GLHB 3SAUA 1TDHA 2L7IA 1NSFA 1NJGA 4QNMA 1NNJA 5EP2A 3KOYE 3U5ZA 5C18A 1XWIA 5KO3A 4MM3B 3C58A 2DXIA 3SMSA 3SC3A 3SYLA 5ITTA 3IG8A 4DR3M 3GLFA 4L15A 2YQZA 4LZJA 5A2QS 4CHTB 1R2ZA 2UUAM 1WXQA 2D7EA 4GMQA 4K0KM 1NHGC 4FCTA 1JQJC 4DV5M 3E4RA 4LCBA 4REZA 3PNYA 1OFHA 3HWSA 3VK7A 1HT2E 3HKPA 1J7KA 3GQ4A 3WHLA 8CATA 3SAWA 1XC8A 3H4MA 2CHQA 4RF1A 1IM2A 4WURA 3GO8A 1GVNA 1E9RA 4FCVA 4I5SA 5KPRA 4FWHA 2CEAA 4AW4A 2R4JA 3TPZA 1L8QA 1NHWC 4OW0A 4D81A 1IQPA 4G4NA 1K3WA 1KFVA 1G59A 4LGYA 1OJLA 2Y21A 5FTNA 3KSXA 1W5SA 4A3VB 3ZH9B 5KPTA 3GPUA 2OPFA 1MU5A 5FTJA 1SXJC 2DWLA 3A45A 4B3RM 4AG5A 1J09A 3GLGA 4LF8M 3L28A 4GRIA 3U6LA 4JXJA 3L2AA 2C96A 3SFZA 3DA1A 4R7GA 3GPPA 2DVWB 3EIEA 1Z6TA 3PNVA 1Z5CA 3GP1A 4KO8A 2F5SA 2H1RA 1HR0M 3GRYA 3HJQA 2QP9X 1FJGM 4DR4M 3VDPA 2VQEM 2Z4RA 2QPAA 7CATA 2ZM6M 1NY5A 3OTOM 2YNMD 4G6ZA 3D8BA 2ZAMA 3GRUA 1UM8A 2X49A 4I81A 2XFSA 2HKJA 3M6AA 4BLCA 3LQQA 2BJWA 3HU1A 4NRVA 1DGHA 3RGSA 3J81S 5E26A 3FUVA 4OVZB 1SXJB 1HQYE 4IBGA 3GQ5A 2V6ZM 3FTCA 2DWZB 2KXEA 3UJNA 5EXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 M;  4X65 M;  3U6M A;  2HHH M;  3SAT A;  1L1T A;  3GPY A;  4DUZ M;  1PJJ A;  1N36 M;  5IWA M;  3W0F A;  1Z59 A;  4KHP M;  3SAR A;  3SAV A;  3SAS A;  4DUY M;  4GKK M;  4JI8 M;  4PDG A;  3T1Y M;  1IBL M;  3SAU A;  1XNR M;  2UXD M;  1Q3C A;  1TDH A;  4AQY M;  1MX0 A;  1NNJ A;  4X66 M;  4B3S M;  4LFB M;  4DR6 M;  1L2C A;  3C58 A;  1K3X A;  5ITT A;  3U6O A;  1IBM M;  4DR3 M;  4JV5 M;  5A2Q S;  1R2Z A;  4YHH M;  1L2D A;  1XMO M;  5ITU A;  2UUA M;  1HNX M;  3TWM A;  1IBK M;  4DV1 M;  2OQ4 A;  5LMU M;  4K0K M;  4DV5 M;  4ITQ A;  3DOA A;  3TWK A;  4G4R A;  1PJI A;  3VK7 A;  1XNQ M;  1R2Y A;  4NRW A;  3GQ4 A;  3SAW A;  1XC8 A;  1J5E M;  4DV0 M;  4CIS A;  4JI5 M;  1Q39 A;  3GO8 A;  4NXN M;  2XZU A;  4GKJ M;  5ITQ A;  4YY3 M;  4B3M M;  4X62 M;  1Z5A A;  4DV4 M;  3J80 S;  2F5P A;  4JI1 M;  3JR4 A;  4MB7 A;  1Q3B A;  1L1Z A;  4JI7 M;  1K3W A;  1HNW M;  4G4N A;  1KFV A;  4DR7 M;  4DV7 M;  4NXM M;  2OPF A;  5LMN M;  3GPU A;  3T1H M;  1K82 A;  2EA0 A;  1MU5 A;  2XZF A;  1N33 M;  3JR5 A;  4JI2 M;  3JAM S;  3A45 A;  3A46 A;  5ITX A;  4B3R M;  5ITX E;  3GQ3 A;  3SBJ A;  4LF4 M;  4LF8 M;  1XMQ M;  3U6L A;  4X64 M;  4LFC M;  4DR2 M;  1N34 M;  4LFA M;  1EE8 A;  4JI3 M;  1Z5B A;  5IT9 S;  2Q2E B;  3GPP A;  3J7A S;  1L2B A;  2UXC M;  4DV2 M;  4G4O A;  4LF9 M;  3U6D A;  1HNZ M;  1Z5C A;  3GP1 A;  2F4V M;  3VK8 A;  2F5S A;  3U6Q A;  1N32 M;  1HR0 M;  4LF6 M;  4DR5 M;  2ZBK B;  2F5N A;  3U6E A;  5ITY A;  2VQE M;  4LF7 M;  4OX9 M;  1FJG M;  4DR4 M;  4DV6 M;  3TWL A;  2ZM6 M;  2UUC M;  3OTO M;  1I94 M;  4PCZ A;  3U6S A;  4LF5 M;  5ITR A;  3U6P A;  2HKJ A;  2VQF M;  3U6C A;  3J81 S;  4NRV A;  4DV3 M;  4JYA M;  5FLX S;  1TDZ A;  5BR8 M;  2UUB M;  3GPX A;  2E5L M;  4JI6 M;  4PDI A;  2UXB M;  4G4Q A;  4DR1 M;  3GQ5 A;  3A42 A;  4PD2 A;  2F5Q A;  2F5O A;  1PM5 A;  4B3T M;  4JI4 M;  4JI0 M; 
#chains in the Genus database with same CATH topology
 3UGJ A;  1DO2 A;  4LJ6 A;  3VFD A;  3LQR A;  5F3W A;  2HHH M;  2AHM A;  3SAT A;  3GPY A;  1PJJ A;  3FE3 A;  1HT1 E;  1QDR A;  3SHF A;  2O5R A;  2C9C A;  3R8F A;  3NBX X;  4CGY B;  3TQS A;  1TR8 A;  4IJF A;  2G8L A;  2EUC A;  4KHP M;  1GO5 A;  3SAR A;  1W5T A;  3FTD A;  4FWD A;  4D80 A;  3A98 B;  3FUU A;  1QUT A;  1QQW A;  2BWB A;  4JI8 M;  2ZAN A;  4NOO B;  2Z4S A;  5FSW A;  2JY5 A;  1IBL M;  4MGI E;  4AQY M;  2WZJ A;  5EXP A;  3GLH A;  1IXZ A;  1MX0 A;  3I51 A;  2NQ8 C;  4GC9 A;  4X66 M;  1T6O A;  4B3S M;  2Y0T A;  3KP1 E;  3M0E A;  4DR6 M;  1OAI A;  1L2C A;  2K0B X;  4LRS A;  3HJS A;  3MHV C;  4HLQ A;  2KNZ A;  3U6O A;  1R7R A;  1SXJ E;  1NNU C;  1IBM M;  4GHA A;  3DZD A;  4GEW A;  1N78 A;  3FYC A;  5ITU A;  1XMO M;  1HNX M;  3TWM A;  2JXN A;  1GKI A;  2OQ4 A;  1PJT A;  2KNV A;  5GKN A;  3HY5 A;  4ITQ A;  2CFO A;  2D7G A;  2FOI C;  2LVN C;  3F92 A;  4FCW A;  3TWK A;  5JI2 E;  2QBY A;  2XSZ A;  1PJI A;  3AKZ A;  1XNQ M;  3LVV A;  5C1B A;  2MR9 A;  2L7H A;  4NRW A;  3FUT A;  1VEK A;  1ZMU A;  3FRI A;  2L4F A;  2BJV A;  2KW0 A;  1G41 A;  3PVS A;  4DV0 M;  1G4A E;  2LXE A;  4RKU F;  4MH0 E;  5ITQ A;  2XH9 A;  4B3M M;  4X62 M;  2LHC A;  2ZTD A;  4DV4 M;  3J80 S;  3Q8G A;  3JR4 A;  2J5Y A;  1JR3 E;  3BXW A;  3VDU A;  2LHG A;  1D0K A;  3CF0 A;  3U61 A;  1L1Z A;  2R44 A;  4QNR A;  4DR7 M;  3QAU A;  4MGH A;  4DV7 M;  2HWJ A;  4R71 A;  3I04 M;  3KOZ E;  3T1H M;  1N75 A;  4Z6Y A;  3JAM S;  4LJ5 A;  1ZMV A;  5ITX A;  2G5G X;  3IG5 A;  2KNA A;  3I4Y A;  5IZ7 D;  3UMM A;  1SG9 A;  2A5Y B;  2DZO B;  3DFZ A;  3SBJ A;  4LF4 M;  3GRV A;  4DR2 M;  1ZAE A;  4LFA M;  4M0W A;  2YR0 A;  5IT9 S;  2K47 A;  2Q2E B;  3CF6 E;  3MJ5 A;  4W5W A;  4AKI A;  4IBD A;  1L2B A;  1SXJ D;  5BPV A;  4G4O A;  4LF9 M;  2RGH A;  2R46 A;  1GAB A;  3AL0 C;  1IY0 A;  2F4V M;  1OFI A;  1QAQ A;  2VII A;  4IBF A;  3VK8 A;  3L25 A;  4B08 A;  1G3I A;  4XBO A;  2F5N A;  3U6E A;  3TWL A;  1OTR A;  2DI0 A;  3SHG B;  1GL7 A;  3B7Q A;  2XEP A;  2XGN A;  2B3T A;  3LW5 F;  1T3T A;  1IXS B;  2MH8 A;  4LF5 M;  3KVW A;  1XXH B;  4ANR A;  2VQF M;  3I01 M;  1OQY A;  1WHC A;  2ZTC A;  3HU2 A;  3GRR A;  1IXR C;  4FD2 A;  1TF0 B;  3U5Z B;  3PFI A;  2JNH A;  4NSR A;  3KW6 A;  3IHP A;  4L8R C;  1E32 A;  3HHW A;  4PDI A;  2UXB M;  1JR3 D;  2APL A;  2QSF X;  3FUW A;  2XLJ A;  2QHO B;  3A42 A;  3K9O A;  3EIH A;  5DYI A;  2F5Q A;  1KSF X;  2VF8 A;  1QAN A;  4L4U A;  1D2N A;  1PM5 A;  3T15 A;  4JI4 M;  4RF0 A;  1YE9 A;  2RGO A;  1HQC A;  5EQT A;  1C7Y A;  2JA2 A;  1G8P A;  3B74 A;  3SYK A;  1IN8 A;  4PT5 A;  3U60 A;  1NJF A;  3Q8X A;  1YSY A;  1H6U A;  2CRU A;  3TE6 A;  5EP1 A;  3LCV B;  4LRT A;  4AG6 A;  1IFY A;  2N35 A;  1E9S A;  3SAV A;  3E21 A;  5KPZ A;  5KQD A;  3CGW A;  3HJ8 A;  3GLI A;  2DWN A;  4BB9 A;  4TUW A;  4MGZ E;  2JWS A;  1IN7 A;  3H4J A;  4P16 A;  2DAK A;  3ILK A;  1XXH E;  2DAE A;  4B7G A;  1OKS A;  2CWB A;  2DNA A;  2KRK A;  4R3D A;  4GHL A;  1IY1 A;  1JR3 A;  2DAM A;  3PXG A;  2BWE A;  1DGG A;  2V1U A;  2JY8 A;  2O01 F;  1NY6 A;  1TH3 A;  1K3X A;  2V1C A;  1QYR A;  3D8L A;  2R0I A;  1L2D A;  4YHH M;  3L26 A;  4NL4 H;  2JY6 B;  2CUZ A;  3KS8 A;  4DV1 M;  5LMU M;  3MK6 A;  4FVM A;  3KFU G;  1DGB A;  3DOA A;  3FUX A;  5DNY A;  2R45 A;  3GLG B;  1R2Y A;  3FD9 A;  2J7N A;  1NV8 A;  1YUB A;  4NC6 A;  4QOZ C;  4QHT A;  2Z8Y M;  3HHZ A;  3AV0 A;  1J5E M;  2M60 A;  1VDL A;  2GNO A;  4AKG A;  4IBC A;  1R5L A;  1GL6 A;  2RKO A;  4JI5 M;  1Q39 A;  4GKJ M;  5EJC A;  1IN4 A;  1Q02 A;  2H5X A;  3C3D A;  3K92 A;  4JI1 M;  1VEG A;  2HAK A;  2KZU A;  3LMM A;  1D0L A;  3QYE A;  3RFW A;  1T43 A;  3HHX A;  2OOB A;  2VF7 A;  1AIP C;  3AOE A;  2DAI A;  2EA0 A;  1WGL A;  3E9S A;  4HL4 A;  2L6O A;  2QZ4 A;  1FNN A;  1OIP A;  3MMP A;  1N77 A;  4JI2 M;  3A46 A;  1QUS A;  1MJG M;  3K9P A;  3B9P A;  5JI3 E;  4M9S A;  1JB0 F;  4LFC M;  1N34 M;  1WJ7 A;  1EE8 A;  2Y0Q A;  4NSO B;  3GLG E;  1QAO A;  3B7Z A;  3CTW B;  3J7A S;  3M7G A;  1VEJ A;  1KYI A;  4Y28 F;  4LJ9 A;  1PRB A;  4I4L A;  3W0L B;  3KDS E;  4GH9 A;  3U6Q A;  1N32 M;  1WIV A;  1VQ1 A;  1NV9 A;  4D82 A;  1WGN A;  4M9X A;  4LF6 M;  4DR5 M;  2ZBK B;  2LWX A;  5ITY A;  4LF7 M;  2HCB A;  4L16 A;  4S12 A;  2LH0 A;  5E6J A;  2M5Z A;  3K2L A;  3KOW E;  2ERC A;  2CE7 A;  3KOX E;  2CV2 A;  2KDL A;  4LY6 A;  4WW0 A;  4LJA A;  3U6S A;  2LBC A;  3U6P A;  3T38 A;  2XF3 A;  2DZL A;  5IRE B;  5FTL A;  2OOA A;  4JN6 A;  2BNK A;  1QDT A;  4JYA M;  3J2P B;  5FLX S;  1TDZ A;  2DHR A;  2P5T A;  5BR8 M;  4B7F A;  4LJ7 A;  2E5L M;  1NVM A;  3B89 A;  1TH2 A;  1OIZ A;  3UK6 A;  2Y20 A;  4MGK E;  1ZQ9 A;  3HU3 A;  2X4A A;  4LJ8 A;  4M9Z A;  2Z3X A;  2C9O A;  4X65 M;  3U6M A;  2G3Q A;  1L1T A;  2I7N A;  4DUZ M;  2O25 A;  2QBY B;  2X8A A;  5EP4 A;  1N36 M;  1D0M A;  1XB2 B;  3LVW A;  3VKG A;  2C99 A;  1I4W A;  3THG A;  1XHB A;  3CF2 A;  2C5R A;  4IBJ A;  3W0F A;  2JP7 A;  3AOG A;  4GKK M;  4QHS A;  4PDG A;  3T1Y M;  1XNR M;  2QEN A;  2UXD M;  1Q3C A;  4CIZ A;  3NWL A;  2R6F A;  3VKH A;  2R62 A;  3U61 B;  4OVZ A;  2LVA A;  3I4V A;  5DYG A;  1SXJ A;  1V33 A;  2XFT A;  1TH4 A;  3GLF B;  2MGW A;  4JV5 M;  1GLN A;  2R4E A;  3FKE A;  1Y8G A;  2FE8 A;  2MJ5 B;  1IBK M;  5DFL A;  2KA6 B;  2CP8 A;  3QWL A;  2DWM A;  4G3O A;  4G4R A;  1DO0 A;  4AKH A;  4KOD A;  1QZM A;  2W82 A;  2KRU A;  1PGY A;  4AI6 A;  2EJS A;  1QVR A;  4IIW A;  2QCU A;  2LVO C;  4GIT A;  3HGI A;  2L09 A;  1LV7 A;  4CIS A;  2R18 A;  1X37 A;  4XGI A;  1IY2 A;  2JUJ A;  2XZU A;  4NXN M;  5KQ8 A;  3ZCB B;  4YY3 M;  1EFU B;  1OAO C;  5EXX A;  2F5P A;  4MB7 A;  2K6B A;  1Q3B A;  2KEB A;  3KP0 E;  2HL7 A;  3ZC7 B;  4JI7 M;  1HNW M;  3FTF A;  3L29 A;  1RU3 A;  2CHG A;  4NXM M;  4IBE A;  4RNA A;  3RE8 A;  1PJQ A;  4XK8 F;  3GLF E;  5LMN M;  1K82 A;  2XZF A;  4HEO A;  3AFH A;  4FWG A;  4LGM A;  1N33 M;  1ORY B;  4QOS A;  4LJ4 A;  3JR5 A;  2J7O A;  3J7B A;  1ZV1 A;  2LNH C;  1QAM A;  3L27 A;  2CV1 A;  3R9X B;  2WSF F;  5ITX E;  3GQ3 A;  2D7H A;  1XMQ M;  3NBI A;  3FYD A;  3V76 A;  4EIW A;  1DGF A;  4X64 M;  5L8R F;  4JI3 M;  1Z5B A;  2I7P A;  1E94 E;  2DEN A;  3KSJ A;  2KZS A;  2EKK A;  5EP3 A;  1VG5 A;  2Z7J A;  4DV2 M;  2UXC M;  3U6D A;  1V92 A;  1GJT A;  3BOS A;  4B7H A;  3K8Z A;  3RGP A;  3UZU A;  1HNZ M;  1TTE A;  2FH0 A;  3LCU A;  3SMP A;  4GIP A;  2LVQ D;  3K1J A;  5H37 D;  1C1K A;  2JZ1 A;  3IEC A;  3U60 B;  2RRU A;  4OX9 M;  4DV6 M;  5FTM A;  3VLF B;  4I8O A;  1TGU A;  4AZF A;  2UUC M;  1R6B X;  2FFJ A;  2LVP C;  2XSZ D;  1R4G A;  2ZAO A;  4Q7J A;  4L6V 6;  2OO9 A;  4ZPX A;  1I94 M;  1F4I A;  3FRH A;  3QYB A;  4PCZ A;  3TL4 X;  2DHY A;  3GLI B;  5ITR A;  4F1I A;  2CHV A;  1P3Q Q;  1NO1 A;  2CV0 A;  3U6C A;  1DGH B;  1YLA A;  3HX3 A;  1ZMW A;  3W68 A;  4BBA A;  1IN6 A;  1S3S A;  4DV3 M;  3AOE C;  4LG2 A;  5FTK A;  4CJ6 A;  2FNA A;  4IBK A;  4GC5 A;  4F2L A;  4IBI A;  2C98 A;  3GPX A;  2OPF A;  2UUB M;  4JI6 M;  4M0D A;  4G4Q A;  4DR1 M;  4MGY E;  2R65 A;  2VDB B;  4PD2 A;  4OU7 A;  3C3E A;  2F5O A;  4B3T M;  4LFB M;  1Z5A A;  3AJI B;  4JI0 M;  3KS4 A;  3FTE A;  4FW9 A;  1VDD A;  2UU9 M;  1AUA A;  4L78 A;  3HHY A;  4II7 A;  4LZZ A;  2EO2 A;  2YFQ A;  2DZN B;  1IN5 A;  3KXE C;  4Z8X A;  5IWA M;  1WR1 B;  5EXS A;  4IBB A;  1Z59 A;  1EIJ A;  1IXS A;  3SAS A;  4DUY M;  1CUK A;  2WSE F;  4KLN A;  1XXH A;  4IJE A;  3WHK A;  3J27 B;  3GLH B;  3SAU A;  4UN2 B;  1TDH A;  2L7I A;  4P17 A;  3GLI E;  1NSF A;  1NJG A;  4QNM A;  1NNJ A;  5EP2 A;  3KOY E;  3U5Z A;  2GQF A;  1XWI A;  5C18 A;  5KO3 A;  2EKF A;  4MM3 B;  3C58 A;  2DXI A;  3SMS A;  3SC3 A;  3SYL A;  5ITT A;  3IG8 A;  2KHH A;  4DR3 M;  3GLF A;  4L15 A;  2YQZ A;  4LZJ A;  2MRO B;  5A2Q S;  4CHT B;  1R2Z A;  2UUA M;  1WXQ A;  2D7E A;  4GMQ A;  3ZQJ A;  4WP2 A;  4K0K M;  1NHG C;  4FCT A;  1JQJ C;  2DAG A;  4DBG B;  3E4R A;  4LCB A;  4REZ A;  3PNY A;  1OFH A;  4DV5 M;  3HWS A;  3VK7 A;  1HT2 E;  3HKP A;  1J7K A;  3GQ4 A;  3WHL A;  8CAT A;  3SAW A;  1A5T A;  1XC8 A;  3H4M A;  2CHQ A;  4RF1 A;  1IM2 A;  4WUR A;  3GO8 A;  1MN3 A;  1GVN A;  1E9R A;  3GLH E;  4FCV A;  4I5S A;  5KPR A;  4FWH A;  1QZE A;  1HJP A;  2CEA A;  2JZ0 A;  4AW4 A;  2R4J A;  3TPZ A;  1L8Q A;  1NHW C;  2DKL A;  4OW0 A;  1IQP A;  4D81 A;  4G4N A;  1K3W A;  1KFV A;  1G59 A;  4LGY A;  1OJL A;  3T6P A;  2Y21 A;  5FTN A;  3KSX A;  1W5S A;  2JY7 A;  3ZH9 B;  3B7N A;  4A3V B;  5KPT A;  1MU5 A;  3GPU A;  5FTJ A;  1SXJ C;  2DWL A;  3A45 A;  4B3R M;  1G71 A;  4AG5 A;  1J09 A;  3GLG A;  4LF8 M;  3L28 A;  4GRI A;  3U6L A;  2L2D A;  4JXJ A;  3W67 A;  3L2A A;  2C96 A;  2LTU A;  3SFZ A;  3DA1 A;  4R7G A;  3GPP A;  2DVW B;  3EIE A;  1Z6T A;  3E46 A;  1PJS A;  4KT0 F;  3PNV A;  1Z5C A;  3GP1 A;  4KO8 A;  2F5S A;  2WSC F;  2H1R A;  2QQ8 A;  1HR0 M;  3GRY A;  3HJQ A;  2QP9 X;  1FJG M;  4DR4 M;  3VDP A;  2VQE M;  1LTM A;  2Z4R A;  2QPA A;  7CAT A;  2ZM6 M;  2QNJ A;  1NY5 A;  1UFZ A;  3OTO M;  2YNM D;  4G6Z A;  2ZAM A;  3C9P A;  3D8B A;  3GRU A;  1DV0 A;  2FS1 A;  1UM8 A;  2X49 A;  4I81 A;  2XFS A;  2HKJ A;  3M6A A;  4BLC A;  3LQQ A;  3BBZ A;  2BJW A;  3HU1 A;  4NRV A;  1DGH A;  3RGS A;  3J81 S;  5E26 A;  3FUV A;  1BVS A;  1V34 A;  4OVZ B;  1SXJ B;  1GJS A;  1HQY E;  4IBG A;  3GQ5 A;  2V6Z M;  3FTC A;  3HZJ A;  2DWZ B;  2KXE A;  3UJN A;  5EXT A;  2K9D A;  2L4E A; 
#chains in the Genus database with same CATH homology
 3UGJ A;  1DO2 A;  4LJ6 A;  3VFD A;  3LQR A;  5F3W A;  2HHH M;  2AHM A;  3SAT A;  3GPY A;  1PJJ A;  1HT1 E;  3SHF A;  2O5R A;  2C9C A;  3R8F A;  4CGY B;  3TQS A;  4IJF A;  2G8L A;  2EUC A;  4KHP M;  3SAR A;  1W5T A;  3FTD A;  4FWD A;  4D80 A;  3A98 B;  3FUU A;  1QQW A;  4JI8 M;  2ZAN A;  4NOO B;  2Z4S A;  5FSW A;  1IBL M;  4MGI E;  4AQY M;  5EXP A;  3GLH A;  1IXZ A;  1MX0 A;  3I51 A;  2NQ8 C;  4GC9 A;  4X66 M;  4B3S M;  2Y0T A;  3KP1 E;  3M0E A;  4DR6 M;  1L2C A;  4LRS A;  3HJS A;  3MHV C;  4HLQ A;  3U6O A;  1R7R A;  1SXJ E;  1NNU C;  1IBM M;  4GHA A;  3DZD A;  1N78 A;  3FYC A;  5ITU A;  1XMO M;  1HNX M;  3TWM A;  1GKI A;  2OQ4 A;  5GKN A;  4ITQ A;  2CFO A;  2D7G A;  2FOI C;  4FCW A;  3TWK A;  2QBY A;  5JI2 E;  2XSZ A;  1PJI A;  3AKZ A;  1XNQ M;  3LVV A;  5C1B A;  2L7H A;  4NRW A;  3FUT A;  2BJV A;  2KW0 A;  1G41 A;  3PVS A;  4DV0 M;  1G4A E;  2LXE A;  4MH0 E;  5ITQ A;  2XH9 A;  4B3M M;  4X62 M;  4DV4 M;  3J80 S;  3JR4 A;  3VDU A;  3U61 A;  3CF0 A;  1L1Z A;  4QNR A;  4DR7 M;  3QAU A;  4MGH A;  4DV7 M;  3KOZ E;  3T1H M;  1N75 A;  4Z6Y A;  3JAM S;  4LJ5 A;  5ITX A;  2G5G X;  3IG5 A;  5IZ7 D;  3I4Y A;  3UMM A;  2A5Y B;  3SBJ A;  2DZO B;  3DFZ A;  4LF4 M;  3GRV A;  4DR2 M;  1ZAE A;  4LFA M;  4M0W A;  2YR0 A;  5IT9 S;  2K47 A;  2Q2E B;  3CF6 E;  3MJ5 A;  4W5W A;  4AKI A;  4IBD A;  1L2B A;  1SXJ D;  5BPV A;  4G4O A;  4LF9 M;  2RGH A;  2R46 A;  3AL0 C;  1IY0 A;  2F4V M;  1QAQ A;  1OFI A;  2VII A;  4IBF A;  3VK8 A;  3L25 A;  4B08 A;  1G3I A;  4XBO A;  2F5N A;  3U6E A;  3TWL A;  3SHG B;  1GL7 A;  2XEP A;  2XGN A;  1T3T A;  1IXS B;  4LF5 M;  3KVW A;  1XXH B;  2VQF M;  3HU2 A;  3GRR A;  1IXR C;  4FD2 A;  3U5Z B;  3PFI A;  4NSR A;  3KW6 A;  4L8R C;  1E32 A;  3HHW A;  4PDI A;  2UXB M;  1JR3 D;  3FUW A;  2XLJ A;  3A42 A;  3EIH A;  5DYI A;  2F5Q A;  1KSF X;  4L4U A;  1QAN A;  1PM5 A;  1D2N A;  3T15 A;  4JI4 M;  4RF0 A;  1YE9 A;  2RGO A;  1HQC A;  5EQT A;  2JA2 A;  1G8P A;  3SYK A;  1IN8 A;  4PT5 A;  3U60 A;  1NJF A;  3Q8X A;  1YSY A;  1H6U A;  3TE6 A;  5EP1 A;  4LRT A;  4AG6 A;  1E9S A;  3SAV A;  5KPZ A;  5KQD A;  3HJ8 A;  3GLI A;  2DWN A;  4BB9 A;  4TUW A;  4MGZ E;  1IN7 A;  4P16 A;  3ILK A;  4B7G A;  2KRK A;  4R3D A;  4GHL A;  1IY1 A;  1JR3 A;  3PXG A;  1DGG A;  2V1U A;  1K3X A;  1NY6 A;  1TH3 A;  2V1C A;  1QYR A;  3D8L A;  1L2D A;  4YHH M;  3L26 A;  4NL4 H;  3KS8 A;  2CUZ A;  4DV1 M;  5LMU M;  3MK6 A;  4FVM A;  3KFU G;  1DGB A;  3DOA A;  3FUX A;  5DNY A;  2R45 A;  3GLG B;  1R2Y A;  3FD9 A;  2J7N A;  1YUB A;  4QOZ C;  4QHT A;  3HHZ A;  3AV0 A;  1J5E M;  2M60 A;  4AKG A;  4IBC A;  2RKO A;  1GL6 A;  4JI5 M;  1Q39 A;  4GKJ M;  5EJC A;  1IN4 A;  3K92 A;  4JI1 M;  2KZU A;  3LMM A;  3RFW A;  3HHX A;  3AOE A;  2EA0 A;  3E9S A;  4HL4 A;  2L6O A;  2QZ4 A;  1FNN A;  1N77 A;  4JI2 M;  3A46 A;  3B9P A;  5JI3 E;  4M9S A;  4LFC M;  1N34 M;  2Y0Q A;  1EE8 A;  4NSO B;  1QAO A;  3CTW B;  3J7A S;  3M7G A;  1KYI A;  4LJ9 A;  4I4L A;  3W0L B;  3KDS E;  4GH9 A;  3U6Q A;  1N32 M;  4D82 A;  4M9X A;  4LF6 M;  4DR5 M;  2ZBK B;  2LWX A;  5ITY A;  4LF7 M;  2HCB A;  4L16 A;  4S12 A;  2LH0 A;  5E6J A;  2M5Z A;  3K2L A;  3KOW E;  2ERC A;  2CE7 A;  3KOX E;  2CV2 A;  4LY6 A;  4WW0 A;  3U6S A;  4LJA A;  3U6P A;  3T38 A;  2XF3 A;  5IRE B;  5FTL A;  4JN6 A;  2BNK A;  4JYA M;  3J2P B;  5FLX S;  1TDZ A;  2DHR A;  2P5T A;  5BR8 M;  4B7F A;  4LJ7 A;  2E5L M;  1NVM A;  1TH2 A;  3UK6 A;  2Y20 A;  4MGK E;  1ZQ9 A;  3HU3 A;  2X4A A;  4LJ8 A;  4M9Z A;  2Z3X A;  2C9O A;  4X65 M;  3U6M A;  1L1T A;  2I7N A;  4DUZ M;  2QBY B;  2X8A A;  5EP4 A;  1N36 M;  3LVW A;  3VKG A;  2C99 A;  1I4W A;  3THG A;  1XHB A;  3CF2 A;  2C5R A;  4IBJ A;  3W0F A;  3AOG A;  4GKK M;  4QHS A;  4PDG A;  3T1Y M;  1XNR M;  2QEN A;  2UXD M;  1Q3C A;  3NWL A;  3VKH A;  2R62 A;  3U61 B;  4OVZ A;  3I4V A;  5DYG A;  1SXJ A;  2XFT A;  1TH4 A;  3GLF B;  4JV5 M;  1GLN A;  2R4E A;  3FKE A;  2FE8 A;  1IBK M;  2KA6 B;  3QWL A;  2DWM A;  4G4R A;  1DO0 A;  4AKH A;  4KOD A;  1QZM A;  2W82 A;  2KRU A;  4AI6 A;  1QVR A;  4IIW A;  2QCU A;  4GIT A;  3HGI A;  2L09 A;  1LV7 A;  4CIS A;  2R18 A;  1X37 A;  4XGI A;  1IY2 A;  2XZU A;  4NXN M;  5KQ8 A;  3ZCB B;  4YY3 M;  5EXX A;  2F5P A;  4MB7 A;  1Q3B A;  2KEB A;  3KP0 E;  2HL7 A;  3ZC7 B;  4JI7 M;  1HNW M;  3FTF A;  3L29 A;  2CHG A;  4NXM M;  4IBE A;  4RNA A;  3RE8 A;  5LMN M;  1K82 A;  2XZF A;  1N33 M;  3AFH A;  4FWG A;  4LGM A;  1ORY B;  4QOS A;  4LJ4 A;  3JR5 A;  2J7O A;  3J7B A;  2LNH C;  1QAM A;  3L27 A;  2CV1 A;  3R9X B;  5ITX E;  3GQ3 A;  2D7H A;  1XMQ M;  3NBI A;  3FYD A;  4EIW A;  4X64 M;  1DGF A;  4JI3 M;  1Z5B A;  2I7P A;  1E94 E;  3KSJ A;  2KZS A;  5EP3 A;  2UXC M;  2Z7J A;  4DV2 M;  3U6D A;  3BOS A;  4B7H A;  3K8Z A;  3RGP A;  3UZU A;  1HNZ M;  3SMP A;  4GIP A;  3K1J A;  5H37 D;  1C1K A;  3U60 B;  4OX9 M;  4DV6 M;  5FTM A;  3VLF B;  4I8O A;  1TGU A;  4AZF A;  2UUC M;  1R6B X;  2FFJ A;  2XSZ D;  2ZAO A;  1I94 M;  4ZPX A;  4PCZ A;  3TL4 X;  3GLI B;  5ITR A;  2CHV A;  2CV0 A;  3U6C A;  1DGH B;  4BBA A;  1IN6 A;  1S3S A;  4DV3 M;  3AOE C;  4LG2 A;  5FTK A;  2FNA A;  4IBK A;  4GC5 A;  2UUB M;  4IBI A;  2C98 A;  3GPX A;  4JI6 M;  4M0D A;  4G4Q A;  4DR1 M;  4MGY E;  2R65 A;  4PD2 A;  4OU7 A;  2F5O A;  4B3T M;  4LFB M;  3AJI B;  1Z5A A;  4JI0 M;  3KS4 A;  3FTE A;  4FW9 A;  1VDD A;  2UU9 M;  4L78 A;  3HHY A;  4II7 A;  4LZZ A;  2EO2 A;  2YFQ A;  2DZN B;  1IN5 A;  3KXE C;  4Z8X A;  5IWA M;  5EXS A;  4IBB A;  1Z59 A;  3SAS A;  4DUY M;  4KLN A;  1XXH A;  4IJE A;  3WHK A;  3J27 B;  3GLH B;  3SAU A;  1TDH A;  2L7I A;  1NSF A;  1NJG A;  4QNM A;  1NNJ A;  5EP2 A;  3KOY E;  3U5Z A;  5C18 A;  1XWI A;  5KO3 A;  4MM3 B;  3C58 A;  2DXI A;  3SMS A;  3SC3 A;  3SYL A;  5ITT A;  3IG8 A;  4DR3 M;  3GLF A;  4L15 A;  2YQZ A;  4LZJ A;  5A2Q S;  4CHT B;  1R2Z A;  2UUA M;  1WXQ A;  2D7E A;  4GMQ A;  4K0K M;  1NHG C;  4FCT A;  1JQJ C;  4DV5 M;  3E4R A;  4LCB A;  4REZ A;  3PNY A;  1OFH A;  3HWS A;  3VK7 A;  1HT2 E;  3HKP A;  1J7K A;  3GQ4 A;  3WHL A;  8CAT A;  3SAW A;  1XC8 A;  3H4M A;  2CHQ A;  4RF1 A;  1IM2 A;  4WUR A;  3GO8 A;  1GVN A;  1E9R A;  4FCV A;  4I5S A;  5KPR A;  4FWH A;  2CEA A;  4AW4 A;  2R4J A;  3TPZ A;  1L8Q A;  1NHW C;  4OW0 A;  4D81 A;  1IQP A;  4G4N A;  1K3W A;  1KFV A;  1G59 A;  4LGY A;  1OJL A;  2Y21 A;  5FTN A;  3KSX A;  1W5S A;  4A3V B;  3ZH9 B;  5KPT A;  3GPU A;  2OPF A;  1MU5 A;  5FTJ A;  1SXJ C;  2DWL A;  3A45 A;  4B3R M;  4AG5 A;  1J09 A;  3GLG A;  4LF8 M;  3L28 A;  4GRI A;  3U6L A;  4JXJ A;  3L2A A;  2C96 A;  3SFZ A;  3DA1 A;  4R7G A;  3GPP A;  2DVW B;  3EIE A;  1Z6T A;  3PNV A;  1Z5C A;  3GP1 A;  4KO8 A;  2F5S A;  2H1R A;  1HR0 M;  3GRY A;  3HJQ A;  2QP9 X;  1FJG M;  4DR4 M;  3VDP A;  2VQE M;  2Z4R A;  2QPA A;  7CAT A;  2ZM6 M;  1NY5 A;  3OTO M;  2YNM D;  4G6Z A;  3D8B A;  2ZAM A;  3GRU A;  1UM8 A;  2X49 A;  4I81 A;  2XFS A;  2HKJ A;  3M6A A;  4BLC A;  3LQQ A;  2BJW A;  3HU1 A;  4NRV A;  1DGH A;  3RGS A;  3J81 S;  5E26 A;  3FUV A;  4OVZ B;  1SXJ B;  1HQY E;  4IBG A;  3GQ5 A;  2V6Z M;  3FTC A;  2DWZ B;  2KXE A;  3UJN A;  5EXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...