3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nitrate transport protein
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
1QUJA 3C35A 4FATA 4PFUA 1VFDA 2QPQA 2OJTA 1YAEA 2HAUA 3O28A 3IAZA 3T96B 4IGTA 2GRVA 4LQ2A 2ONRA 3SEXA 1M5BA 1QVSA 1VSOA 4DXUA 2Y7KA 5L8DA 3HCQA 4R9FA 2RF1A 4R73A 4ND9A 3K00A 4JB7A 2DWIA 4IY5A 3S2VA 1FCKA 3ODBA 1ZLQA 3IOVA 3G3GA 1LFIA 1OQHA 1MQHA 3PPQA 5AE4A 1FTMA 5DT6A 1KWHA 3H6TA 2I3VA 2PT1A 3EHUA 3H6WA 4N13A 4Q5TA 3VDFA 2P1SA 3N94A 1FTLA 4IO7A 3IB0A 2X26A 3MPKA 3SEYA 1LFHA 3IORA 5TU0A 2A5TA 3S9MC 3G3IA 3K0VA 2Z23A 2HZLA 4U21A 5I57B 4HCWA 3KOSA 2DE4A 3FXQA 1MPBA 1MY3A 4KYDA 2B3BA 3FZVA 2AL5A 1OVTA 4C1UA 2R6GE 3SKPA 3RT8A 2Z8FA 1A8FA 4H5FA 3KOTA 1XHYA 5ICQA 1ZJLA 1MG1A 1OVBA 2PYYA 4F2QA 2OLBA 3T9UA 4WEPA 3PU5A 1NNKA 2I49A 4GIZA 5I57A 4H0WA 1VE4A 4C1TA 3F11A 2QRYA 4BLAA 1BP5A 1DMBA 3VE1B 1TWYA 2XD2A 2RINA 1O64A 5AA2D 3VVFA 2ONKE 1EZOA 1LAXA 2XXRA 3U94A 3IL1B 1H76A 4Z7EA 2I48A 3CI8A 3ZSFA 1URDA 3EPEA 2F7AA 3QIMA 2OBGA 3IO4A 3T9HB 1I69A 3TELA 4DDDA 2XXIA 3CVGA 1B46A 2ALUA 4LUBA 3WAEA 3KEIA 3DM0A 4ZEDA 1SBPA 3EF7A 3MVWA 5AA3A 3IR1A 4XKRA 1B52A 4XIGQ 1PC3A 1F9BA 2RC7A 3O6GA 1HSLA 2G93A 2AYSA 2ZXTA 4YKKA 3C33A 3GZGA 1MDQA 1SYHA 3N26A 4O3AA 5H8QB 4X9TA 3MQ9A 3A09A 1P1QA 2H98A 2DS9A 3PMVA 3FVNA 5DVFA 3VLWA 1YTVA 1D3KA 2ZMBA 4X1BA 1B3FA 4MBPA 1B5IA 3QAXA 5EYFA 2DSFA 4ESWA 4GVOA 4OTEA 5CBRA 2AL4A 1B0LA 1MH3A 1AL3A 3GXAA 1B7HA 3LUYA 1B5HA 4C0RA 2HQ0A 3H6UA 3RQTA 1B7UA 1N3XA 1A54A 1YPNA 1IXCA 5DTBA 2PX1A 4QFLA 1CE2A 1USYH 3K1MA 4PP0A 3N6TA 1A8EA 2P0SA 3KJTA 4IO6A 4E0XA 4NF6B 1S9TA 3O6HA 1B3EA 2E0SA 3B7DA 2QJEA 2NUVA 1B51A 4THIA 1Z7NE 3FVGA 3GBAA 5CMBA 5KCJB 1QULA 4LP2B 4P11A 3SERA 4I62A 4ZEIA 4TQUQ 4Z0IA 4M4GA 4YB6A 5CI5A 4RXLA 4NF6A 1URGA 5ELVA 4NWCA 1B5JA 1BIYA 4H8JA 1IIWA 3ILTB 4ZE8A 3MVYA 4RK9A 2RCAA 4DZ1A 4DCYA 4R2FA 5AA4B 5KCJA 4ELOA 2V93A 2ZNUA 3BFUA 1NMUA 1ELJA 4EF1A 4POWA 2ONSA 3RTWB 1IXHA 3SDFA 3ZKKA 4M1VA 5KDTA 3VLVA 1QUIA 1Y1ZA 4H8IA 4YKJA 5I56B 3KG2A 3KSXA 3IK6B 3CFXA 2Y84A 4AQ4A 3RLFE 4OFLA 3TTKA 1FW0A 4U4XA 3QXMA 2DE2A 3ZS6A 2NXOA 3PPPA 3H4ZA 5CMCA 4XXUA 5DYHA 1LBBA 3TYHA 3R26A 3JZJA 2OK2A 3U8QA 1LB8A 2REGA 2YPNA 1B05A 1MY2A 1N7WA 2ESNA 3MP1A 3TAJA 2VOZA 4G4PA 3G7WA 4G68C 4F1YA 1P99A 3K6UA 2Y7WA 5HM4B 1JQFA 4QRZA 5I56A 3OO8A 2NVUB 2ANJA 2XXYA 5AA2A 2UXAA 3MZBA 1N3WA 1Q35A 4MFIA 3OO6A 2H4IA 4F29A 1SDXA 2ZYMA 2GHBA 4MH5A 3LC8A 4ELQA 3QUFA 5TP9A 2DYXA 1T0KA 3Q25A 1RYXA 3ZKLA 2F97A 3K6WA 5EHSA 5H8SA 4JDFA 4ZEBA 4G8NA 2G29A 4H1XA 4I9DA 4NE4A 4LZ5A 1RKMA 3TKDA 2V3QA 1M5FA 3ECRA 3FVOA 3W9WA 1POY1 4GQOA 2O7IA 3O66A 1UTHB 3EHTA 3FJMA 2XXPA 1XC1A 3LSXA 3K6VA 3KZGA 5I2NB 1QUKA 3OSQA 4ZE9A 3DELB 2UYEA 4PFWA 5L9SA 4BDQA 4L17A 3TFLA 1US5A 5A5XB 3MVZA 3RTFB 1NFTA 1Y4TA 3RT6B 4OFOA 4FAJA 1MXVA 1UTHA 4U1ZA 4IY6A 3O97A 1NL5A 4YMBA 4OZ9A 1OQGA 3BBRA 4QSCA 3HSTA 3JV9A 5I2NA 4H65A 4UA8A 1FQFA 1B1XA 4P0IA 3IB1A 2V3UA 5JEIA 4F3BA 3A3CA 1JEUA 4F1VA 2X7PA 3MZ1A 4K3FA 2XXVA 1ZKBA 4RNSA 5A5XA 2THIA 3TDJA 1MY0A 1P1WA 4F39A 4R72A 4Q30B 4N6PA 2O6AA 2LAOA 5I59B 4YB5A 2I6EA 2A5TB 3HHFA 1NH7A 3CFZA 3PGFA 3VV5A 3PPOA 2YLNA 2DE3A 1SW5A 1OMPA 2R71A 3R7XA 5H8NB 1A40A 1QKAA 4JWOA 5I84A 5J1DA 2FA7A 4GXSB 3RNNA 3THIA 1MS7A 4QSDA 1MXWA 4U1OA 2KLFA 4G2ZA 3U1OA 4PFYA 1LFGA 3IJOB 2HZKA 1MXXA 2DVCA 4GL0A 5I59A 2QMXA 3BKIB 1MXZA 3T93B 4G8MA 2XXHA 3MZ9A 4R6YA 4OMBA 4F3SA 1SI0A 1FTJA 1ANFA 2GHAA 2DVZA 3TEPA 3WAFA 3A3UA 2OWSA 4DIGA 1CB6A 5H8NA 4KI0E 3OXNA 1Y4CA 3MWBA 3AXFA 2DQVA 4QFPA 3E4RA 3FD3A 3U72A 1FQCA 1LB9A 3RUMA 2O1LA 3MJNA 3CG3A 1DTGA 4ELRA 3I5OA 3EHSA 2DOJA 4F19A 3PPNA 4KHZE 1IUDA 4RJZA 3N6UA 1EZPA 1AOVA 4ZEFA 2HAVA 5IAIA 5I58A 4ISUA 3L6HA 1YCJA 2O84X 4AB5A 1PB7A 1EH3A 1B32A 3OD7A 4DXBA 4IO4A 1SQYA 3G3JA 1A55A 1I6AA 4R6HA 1P1UA 2B3FA 4QSEA 4KCDA 1M5DA 1O63A 2HXWA 1PB9A 3MVXA 3UA8A 1GV8A 3RY3A 1BTJA 3QYTA 4FIMA 3QK6A 4NF8A 4NF4B 1B3GA 1B9JA 1B2HA 1IZ1A 1S7YA 4NMYA 4JXIA 4DXCA 3PD8A 1VR5A 3U93A 3Q26A 1ATGA 3O6IA 1B40A 3MBPA 4BDRA 4U22A 4X1DA 1FTKA 2UVGA 2XX7A 3JYRA 1LBCA 3N5LA 4FEDA 4NF4A 1JVXA 4NEDA 4F1UA 2FYIA 1P1OA 1LLSA 3DP4A 3OELA 4H67A 1B3LA 1H44A 5K2XA 2UYFA 4LQ5A 2AIXA 1SW2A 2V84A 3RN8A 5DEXA 1SI1A 4WXJA 3V83A 5L9MA 4OEUA 1H3DA 3TTRA 3LSWA 2ABHA 3KJ7A 3S4UA 2QS2A 5HBCA 4OHNA 4XTCQ 2XX8A 2I4CA 4LZ8A 4YMAA 3MW0A 4MLVA 3C9HA 2V3TA 3KBRA 5FHMA 4E0WA 3M3KA 2DXRA 2PVUA 4QFOA 4R9GA 3W9VA 5I2KA 1WODA 1XOCA 3CSGA 3LBSA 1FTOA 2RCBA 3O9PA 2O68A 3FATA 5TPAA 4XKQA 4P0GA 3I3VA 1URSA 1AH5A 2H5YA 4ZECA 2B65A 2DXYA 3B6TA 4OENA 1A99A 2PT2A 3PPRA 5CRYA 1MRPA 4YU0A 3C31A 5KDTB 4RPOA 2QMWA 1UQWA 4IO2A 2ZNTA 3IJXB 3H6VA 4GRKA 3UK4A 3PUXE 3T22A 5FTIA 5JTYA 2XXTA 1O7TA 4FJPA 2Q8JA 3TCFA 5ITPA 3R6UA 1NNPA 1R9LA 5LOMA 4F3GA 5F1QA 3K02A 3TQWA 4DCXA 1N04A 3IOWA 2XXXA 5BUUA 4GXAA 4FECA 2Q89A 2F35A 3D4CA 3KN8A 5AA2B 3O2AA 5H8FB 4KQPA 5K2YA 2Y7IA 2H99A 3MC2A 4KFQA 1MY1A 2Y7RA 1MXYA 2DP8A 5TP9B 1WDNA 3KN3A 3VLUA 3HV1A 1Y3PA 1Q1KA 3O29A 3OOAA 3FV2A 1PBQA 4QFKA 3SEWA 4G68A 3CSBA 1II5A 4OWDA 5H8FA 3UIFA 2M8CA 3W15C 1US4A 1LAFE 4U2RA 4OEVA 4EXLA 1MPCA 4KYSA 1PB8A 1B1HA 3ILUB 5EHMA 1FQAA 3FUZA 3L6GA 3FV1A 4YAHX 1NKXA 3K01A 2Q2CA 3BFTA 2F78A 1XS5A 3VVEA 3C34A 1IEJA 3T9XB 3FGSA 3PUYE 1I6QA 3RGYA 2H9BA 2I4BA 4ELPA 5BWJA 3H7MA 1H43A 1XVYA 3PMWA 1NNTA 2HEUA 3SETA 1BKAA 1R6ZA 1BLFA 4QHQA 4BDNA 4PQJA 1JNFA 1MY4A 2D3IA 4EF2A 2O1MA 2OWTA 2ZNSA 3DP6A 1D4NA 1DTZA 2O69A 1DOTA 2UVHA 4FE8A 2CZLA 3SEUA 3E13X 1QJMA 1JW1A 3FXRA 1UTBA 3IOUA 2QS3A 1MH4A 2DWAA 4O3CA 3S9NC 1LCFA 1SW1A 3USDA 4GOTA 2F6PA 4KD5A 1B7ZA 3PD9A 4GWOA 1B6HA 1IXIA 2PBWA 2IEEA 3B6WA 3IOTA 5B7DA 5ICTA 3CR9A 5CM6A 2X7QA 3GBBA 1LSTA 4JSOA 1QKBA 3FJGA 4ZZAA 1B4HA 1TFDA 4NF5B 4Q0CA 2RC9A 4OERA 1AIVA 1VFEA 1DPEA 3E3KA 1B4ZA 2DWJA 2E1SA 3TCGA 3MP6A 4Q8RA 4RY1A 4GL8A 3TTNA 1N0TA 4AB6A 3M3FA 1D9YA 2Q9TA 1XT8A 2PMSA 3PUZE 2F5XA 3CIJA 4BDMA 3TQLA 3V8XB 4NF5A 4HW8A 2O51A 4BDOA 5M2VA 4JWXA 2Q88A 4EDPA 2NWJA 1MDP1 4TLLB 1DPPA 1J1NA 4U4SA 1ZMGA 4EXKA 3K1NA 3TMGA 3MUQA 4QFNA 2XX9A 5HPQA 1N76A 1R9QA 5I58B 1GVCA 2Q2AA 2RC8A 2F34A 1HSJA 2IA4A 5FHNA 1ZU0A 4MLQA 3SEVA 4OETA 1M5EA 2VHAA 4PE5B 4F3PA 3V5AA 3TUSA 1Y3QA 4HTGA 4R75A 1SVXB 2I58A 1LCTA 4ZEKA 3KGCA 2HCAA 3CG1A 5FTHA 3ONMA 1HSEA 4YKPA 2R9JA 1LAHE 3P7IA 3B6QA 4PFTA 3PUVE 3HN0A 4EQBA 4RYAA 4NF8B 5DVJA 2FNCA 5H8HB 2I0CA 5L9OA 5ITOA 1FQBA 3LR1A 3K2DA 3RPWA 1Y20A 3H06B 2A5SA 3OO9A 1MQGA 2H25A 3S9LC 4OXVA 3SESA 3TZAA 1JETA 2I0BA 2V25A 1Y1MA 3VFJA 2NOOA 1L5TA 3KN7A 1D9VA 4EQ9A 3UGWA 4RPNA 5H8HA 3FVKA 3KSJA 1TT1A 4XKPA 2REJA 3M8UA 5CMMA 1MXUA 3C4MA 2W7YA 1MQIA 4DLDA 1GTKA 3LSFB 2XD3A 1ZTYA 2QS1A 4R2BA 4R74A 3EQ1A 2ZYOA 3CRBA 1Y3NA 5DEXB 4POXA 1RYOA 2YJPA 3Q27A 4N07A 4YB7A 4ZS9A 4IO3A 4LONB 3D4GA 2WKYA 4GF8A 2XXUA 3OO7A 4YKIA 2ZYKA 3C32A 4KCCA 2O7UA 3E9XA 4H6DA 2F36A 1PDAA 2Z8DA 3I6VA 3OEKA 4GD5A 3G3FA 3G3HA 1POTA 4I1DA 5IKBA 5I2KB 5CBSA 3C36A 3CFLA 4G8HA 2XHDA 4R6KA 3UN6A 5H8QA 4TOZA 3HHGA 1JW4A 4JBZA 1H45A 4WEDA 5TPAB 3M3LA 3H03A 1IXGA 2DWHA 3PV0E 4UACA 1GR2A 4NWDA 3V89B 4YZZA 2I3WA 4U23A 3QSLA 1A7LA 4IO5A 2P2AA 4EQ7A 4EUOA 5JTYB 1FQDA 4IGRA 4LATA 3T9VA 4O3BA 4HCYA 1UIVA 1GGGA 1SD3A 1TFAA 4KR5A 3EN3A 1P1NA 4LVQA 2BJJX 1OIBA 4RA1A 4ONYA 4FEBA 3IO6A 4FORA 5DVIA 4PETA 4BDLA 2RKMA 5JK4A 4JWYA 3TCHA 2Y7PA 2HFBA 1PEBA 3OENA 3OEMA 1NNFA 4OESA 5AA1A 2Z22A 1N7XA 1I6BA 3G3KA 3FJ7A 3UP9A 4IB2A 1Z7ME 5F7VA 1MM6A 1ZIUA 3IB2A 1IITA 4H5GA 4LA9A 1MM7A 4G68B 2QS4A 1TXFA 1PBPA 1FQEA 3T66A 4XKNA 3TODA 2QSXA 4GLIA 4DE8A 2VGQA 2OCUA 2CMOA 3PMXA 3H3GA 2VD2A 3LSLA 3Q29A 1EU8A 1MQDA 3U92A 5AA4A 3QUJA 1QW0A 4QF9A 4F31B 3OMBA 3MAMA 5ISUA 3VXCA 1JW5A 3MP8A 3TTLA 3K6XA 1LGBC 4KYEA 1IQ7A 1OLAA 3DP8A 1LAGE 4ZDMA 5CC2A 1MQJA 3TTMA 3TPAA 2F7BA 4OVJA 5FHOA 1S50A 1DSNA 3VVDA 4KPTA 5CMKA 2UVJA 1Y9UA 4G77A 4X48A 3FXUA 4OYVA 1ZBMA 3OSRA 1JVYA 4ZZEA 2ZYNA 3GLBA 4JSDA 1UTBB 2Z8EA 2F7CA 4WKMA 2VP1A 4ECFA 1B0HA 1JEVA 3FASA 1WVJA 1NH8A 3Q28A 1N84A 3S9EA 4HS7A 1M5CA 4TLMB 4MF3A 2UVIA 4F22A 2XXQA 2OZZA 4GFRA 1OLCA 3IX1A 1XVXA 1SYIA 4OFJA 4I8CA 3K1PA 3KFMA 2F8DA 4YICA 5B70A 1R1NA 3K4UA 4RK2A 4F18A 2F6GA 2VD3A 2D21A 5KZTA 1EZ9A 4LZ7A 2GH9A 1AMFA 2XXWA 3DLNA 3VXBA 2GFEA 1UIUA 1B3HA 1B58A 2D5WA 4F2OA 3FIRA 1MPDA 1USYE 3PUWE 4NTLA 4OQOA 3MPLA 3HO7A 4ESXA 1SW4A 2QL3A 3HPIA 3UORA
chains in the Genus database with same CATH superfamily
1NO1A 1QUJA 3C35A 4BBAA 4FATA 4G4RA 4PFUA 1VFDA 2QPQA 2OJTA 2Q8MA 2G8LA 4Y28F 1YAEA 2HAUA 3GRVA 3O28A 3IAZA 3T96B 1OFIA 2CHQA 2DWLA 4WURA 4IGTA 3SAWA 2GRVA 4LQ2A 2ONRA 3SEXA 1M5BA 1AUAA 3L26A 1QVSA 1VSOA 4DXUA 2Y7KA 5L8DA 3HCQA 4R9FA 3MMPA 2RF1A 4HL4A 5FTKA 1DGGA 4LGYA 4R73A 2CEXA 4ND9A 3SMPA 3K00A 4JB7A 2R62A 2DWIA 4IY5A 3S2VA 1FCKA 3ODBA 1ZLQA 3IOVA 4LFAM 4DR2M 3G3GA 3CF0A 1LFIA 1NI9A 1FJ9A 1OQHA 4IR8A 4LJ4A 1MQHA 3PPQA 2KNZA 3LVVA 5AE4A 1FTMA 5DT6A 1KWHA 3H6TA 2I3VA 2PT1A 4GRIA 2WZJA 3EHUA 3H6WA 1LEVA 4N13A 4Q5TA 1OAOC 3VDFA 2P1SA 3N94A 2YQZA 4IBBA 1FTLA 4IO7A 4P17A 3IB0A 2X26A 2LBCA 3MPKA 3SEYA 1LFHA 5LMUM 3KC0A 1FBFA 3IORA 1N78A 5TU0A 1YE9A 2A5TA 3HKPA 2YFQA 3GRUA 1NV6A 3S9MC 3G3IA 3U6MA 3K0VA 2Z23A 2HZLA 4PGNA 3BIHA 1XNRM 1SXJB 4U21A 2KRKA 1Q39A 5I57B 4HCWA 2WEFA 3KOSA 3LVWA 2DE4A 4DBGB 3K9OA 1NUZA 3FXQA 4IBJA 1XB2B 3WHLA 2C5RA 1MPBA 4AKGA 1MY3A 5DNYA 2HHHM 4FCWA 4KYDA 2B3BA 1KA1A 3FZVA 1NHWC 2AL5A 3MK6A 1OVTA 4C1UA 2R6GE 3SKPA 3RT8A 3AKZA 2Z8FA 1A8FA 4H5FA 4LF6M 3KOTA 4I5SA 2ERCA 4M0DA 1XHYA 5ICQA 1ZJLA 1MG1A 1OVBA 2PYYA 5JI3E 3J7BA 4F2QA 1TR8A 2JWSA 3SBJA 2OLBA 3A46A 4HLQA 2D7GA 3T9UA 1G8PA 1GKIA 4WEPA 2BWEA 2CEAA 3PU5A 1NNKA 2I49A 4GIZA 5I57A 4H0WA 2M5ZA 1N34M 4P1LA 1VE4A 4L78A 2P3NA 4C1TA 3F11A 3SHGB 2KQZA 2QRYA 4BLAA 1BP5A 1DMBA 4M9XA 4AS5A 3VE1B 1TWYA 1FPFA 2XD2A 5IREB 2RINA 1O64A 5AA2D 1FBGA 3FYDA 4JV5M 3FKEA 4P16A 3VVFA 4B7HA 2ONKE 3MJ5A 1EZOA 1LAXA 2XXRA 3KP1E 2ZZWA 3U94A 2CZHA 3IL1B 4N8GA 3K92A 1H76A 4Z7EA 1Q3CA 1K9YA 2I48A 3U6EA 3CI8A 2UXBM 3ZSFA 2WSCF 2RRUA 1FPKA 1URDA 2QVUA 2OX3A 2V1CA 3EPEA 2XGNA 4PCDA 2F7AA 3QIMA 1NY5A 2L4FA 3KOXE 3IG5A 4GH9A 2OBGA 3IO4A 3T9HB 2ZZXA 4MAGA 1I69A 1PJJA 4XF5A 4I4LA 4AI6A 4N6DA 2JZ1A 3TELA 4DDDA 1VEGA 1ZMUA 2XXIA 3CVGA 1KSFX 2P5TA 1B46A 2ALUA 4LUBA 3WAEA 3KEIA 3DM0A 4ZEDA 1SBPA 4NSOB 3EF7A 5I3SA 4G4OA 3HJQA 3MVWA 5AA3A 1ZMVA 3IR1A 4XKRA 1W5TA 1R4GA 4DR3M 1B52A 4XIGQ 1D9QA 1PC3A 1F9BA 2RC7A 3O6GA 1HSLA 2G93A 2VQFM 1ZAEA 2AYSA 4IBCA 2DAEA 3MSTA 2ZXTA 4JI2M 4X04A 4YKKA 5ESYA 3C33A 3GZGA 1MDQA 1SYHA 3N26A 4O3AA 2LHGA 1XWIA 1OTRA 4X9TA 1DGHB 5H8QB 2XZUA 3B74A 2WX9A 3MQ9A 1NV9A 3A09A 3T1YM 1P1QA 1P3QQ 2H98A 2DS9A 1VEKA 3GP1A 4TUWA 3PMVA 1IN8A 2X49A 3FVNA 5DVFA 3VLWA 1YTVA 1D3KA 4P9KA 2ZMBA 3J7AS 2XWKA 5EXTA 4X1BA 1B3FA 4MBPA 3HZJA 3GYYA 3E46A 1B5IA 2JA2A 4DUYM 2RGOA 1EFUB 4AW4A 3QAXA 5EYFA 4MB7A 1G0IA 2NQ8C 1RU3A 2DSFA 4ESWA 4QOSA 4GVOA 3GLGB 3NBIA 4OTEA 5CBRA 2AL4A 4XEQA 1NV1A 1D0KA 1B0LA 1MH3A 1AL3A 1DGHA 2JZ0A 3GXAA 3TQSA 4PE3A 1G3IA 2XA5A 2ZAMA 1B7HA 5EJCA 3LUYA 1FBHA 3HU2A 1B5HA 4C0RA 2HQ0A 4NHBA 1HQCA 3H6UA 3RQTA 3GLIA 1B7UA 1N3XA 1A54A 3SC3A 1YPNA 1IXCA 5DTBA 2PX1A 3R8FA 4QFLA 3SAUA 3I51A 4PFIA 3TL4X 1IMFA 1CE2A 1USYH 3K1MA 3C3DA 3A45A 4LRSA 4PP0A 3THGA 1JP4A 3N6TA 5DYIA 5LMNM 3QYBA 3RGPA 1A8EA 3Q8GA 2MROB 2CHGA 2HHMA 4W5WA 2P0SA 3KJTA 1IY0A 3TWKA 4L6V6 4PFRA 4IO6A 4E0XA 3VLFB 2D7EA 4PF8A 4DR4M 3D8LA 3JAMS 4NF6B 5BR8M 3UZUA 1S9TA 3O6HA 3AOEC 3U60A 5DW8A 1HNZM 5A5LA 1B3EA 5F3WA 1AIPC 4HXVA 2E0SA 3B7DA 3C9PA 2QJEA 3IFCA 4JI4M 2NUVA 3ROJA 2OOAA 1B51A 2FFJA 4THIA 1FJGM 1Z7NE 2DNAA 3U61B 3FVGA 1G71A 3GBAA 5CMBA 5KCJB 4MEVA 3A98B 5KPTA 4B7FA 1QULA 4LP2B 2KXEA 4P11A 3GLFB 4MNPA 3SERA 1NV3A 4FWHA 4B3MM 4I62A 4ZEIA 2ZTDA 4TQUQ 2H5XA 4M4GA 4Z0IA 2Q74A 4AS4A 4YB6A 2B3TA 5CI5A 4JI5M 4II7A 4RXLA 5IM2A 4NF6A 2HWJA 2QBYA 1URGA 4MH0E 5ELVA 4NWCA 3KDSE 2UUAM 1B5JA 1BIYA 4GBVA 4H8JA 2V1UA 1IIWA 2FVZA 1FPLA 3ILTB 4ZE8A 2F4VM 3GQ5A 3MVYA 3C3EA 4RK9A 2RCAA 3AV0A 5DFLA 4DCYA 4DZ1A 3BBZA 5EP4A 4MJOA 4R2FA 5AA4B 5KCJA 1WIVA 1E32A 3HWSA 1XXHA 3PTYA 4ELOA 3VDUA 2V93A 2ZNUA 3BFUA 1NMUA 1ELJA 2KZUA 1LBXA 4EF1A 3BOSA 5ITXE 3L29A 4POWA 2ONSA 4MGZE 3HHXA 3RTWB 1GL7A 1KYIA 1IXHA 3Q8XA 3SDFA 3ZKKA 3QYEA 4M1VA 5KDTA 3VLVA 4N6KA 1QUIA 1Y1ZA 3KFUG 4H8IA 4YKJA 5I56B 3KG2A 3KSXA 4JI7M 4B7GA 3IK6B 1LBVA 3GLHB 3CFXA 4R71A 2KZSA 4NL4H 2Y84A 4P47A 1OIZA 3T38A 4AQ4A 3RLFE 2GQFA 2QPAA 4OFLA 4MNCA 2KR0A 3TTKA 1FW0A 5EQTA 2CE7A 3NBXX 3QXMA 4U4XA 2DE2A 3ZS6A 2NXOA 3PPPA 4X64M 3H4ZA 5CMCA 4GX4A 4XXUA 5DYHA 5FBPA 1LBBA 4L15A 3TYHA 2QENA 3R26A 4OA4A 3DZDA 3RPLB 4MIJA 3JZJA 2OK2A 3U8QA 2QNJA 1LB8A 2REGA 2O01F 2YPNA 1B05A 4Q7JA 1MY2A 1N7WA 2ESNA 1QUSA 3I4YA 3MP1A 3TAJA 2VOZA 4G4PA 1QVRA 3G7WA 4G68C 4F1YA 4DV4M 1P99A 3K6UA 2Y7WA 5HM4B 1JQFA 4QRZA 5I56A 3OO8A 3QMFA 2NVUB 2ANJA 4MMPA 3HU3A 1AWBA 1T43A 1UFZA 2XXYA 5AA2A 2UXAA 2AHMA 3FTFA 3MZBA 1N3WA 1HQYE 1Q35A 2FIEA 4MFIA 3OO6A 2H4IA 4F29A 1SDXA 3J81S 2Y21A 2ZYMA 1PJTA 2GHBA 4MH5A 3LC8A 1WHCA 4O8MA 4ELQA 3QUFA 5TP9A 2DYXA 1T0KA 3Q25A 1Z5CA 1IM2A 1RYXA 1XXHE 2UUBM 3ZKLA 2O25A 3QWLA 4QNRA 2F97A 3K6WA 4B3SM 5EHSA 1HT2E 5H8SA 1XHBA 4JDFA 4ZEBA 1J09A 4G8NA 5EQAA 2G29A 4H1XA 4XK8F 4I9DA 4LZ5A 4NE4A 1RKMA 3TKDA 2V3QA 1DK4A 1M5FA 3ECRA 3FVOA 3VK8A 3GPUA 3W9WA 1GJTA 4K0KM 2R4JA 3FUXA 1GL6A 5T3JA 4ANRA 1FPIA 3PNYA 1KZ8A 1POY1 4GQOA 1R2ZA 2O7IA 3O66A 1UTHB 2C9CA 3EHTA 3KS8A 3FJMA 2XXPA 1XC1A 2JUJA 3LSXA 3K6VA 4PT5A 4JI3M 3KZGA 1L2BA 3EKIA 2ZBKB 5I2NB 1IMCA 1QUKA 3OSQA 1KFVA 4ZE9A 3DELB 2UYEA 4PFWA 2C96A 1TH4A 3FUTA 4N81A 5L9SA 2EKFA 4BDQA 3FYCA 4L17A 1WGLA 4LJ7A 3TFLA 1NUYA 5EXSA 3L28A 2PCRA 1US5A 5A5XB 2BJIA 3MVZA 1I4WA 3RTFB 1NFTA 2JY5A 2DKLA 1Y4TA 3RT6B 4OFOA 5EP3A 4FAJA 3SFZA 1MXVA 4REZA 1UTHA 2C9OA 4PDHA 4U1ZA 4NXNM 4IY6A 3O97A 1TH2A 2R65A 1YYZA 1NL5A 4RF0A 3HHYA 5ITRA 4YMBA 2LVNC 2HL7A 3A29A 1QYRA 3GRYA 2Y5KA 4OZ9A 1EYIA 1OQGA 3BBRA 4QSCA 3HSTA 3JV9A 5I2NA 4H65A 4P8BA 4UA8A 1FQFA 2CFOA 1B1XA 4P0IA 3IB1A 1QAOA 4I3EA 2V3UA 2Z4RA 5JEIA 1EE8A 4FD2A 3MHVC 4F3BA 2M60A 3A3CA 1OKSA 1JEUA 4F1VA 2X7PA 4D82A 3MZ1A 4K3FA 2MH8A 2XXVA 1ZKBA 4RNSA 5A5XA 5ITQA 2THIA 3TDJA 2KHHA 3U6DA 1MY0A 2ZANA 3GPXA 4GHLA 1L1ZA 5EYHA 3H4JA 4N17A 4LF7M 1P1WA 1XI6A 4F39A 4R72A 4Q30B 4N6PA 2O6AA 3LCUA 2LAOA 4A3VB 4YB5A 5I59B 2I6EA 2A5TB 3HHFA 1NH7A 4GWZA 3CFZA 1IXRC 3PGFA 5EXPA 3VV5A 2LVQD 4LF5M 2WBBA 4RF1A 3PPOA 3VDPA 2YLNA 2DE3A 1SW5A 1OMPA 2R71A 3R7XA 2QQ8A 5H8NB 1A40A 1QKAA 4JWOA 5I84A 5J1DA 2FA7A 5J16A 4GXSB 3RNNA 3THIA 1MS7A 4QSDA 4LJAA 1MXWA 4U1OA 1WXQA 2KLFA 4G2ZA 3U1OA 3VFDA 4PFYA 1DBZA 1LFGA 2X4AA 3IJOB 2HZKA 2QFLA 1MXXA 2DVCA 4GL0A 1GLNA 1K9ZA 1IY2A 4QHSA 4FWGA 5I59A 3M7GA 2QMXA 5I5PA 3BKIB 1MXZA 1CUKA 3T93B 4G8MA 2Z8YM 3GPYA 2XXHA 3MZ9A 4R6YA 4OMBA 4F3SA 3I01M 1FBEA 2CV2A 1SI0A 1IMBA 1QANA 3ZH9B 2DWMA 1FTJA 1ANFA 2GHAA 4GKJM 2DVZA 3TEPA 3WAFA 3M6AA 4ITQA 3A3UA 1NSFA 2OWSA 4DIGA 3PXGA 1NHGC 1CB6A 5H8NA 4KT0F 4KI0E 2XWIA 3OXNA 1EIJA 4G6ZA 5DYGA 1Y4CA 3MWBA 3FXBA 2XFSA 3AXFA 2Q2EB 2DZLA 2B4MA 4MM3B 2DQVA 4QFPA 3E4RA 3B89A 3FD3A 3U72A 4PAIA 1IXSA 1K3XA 3VKHA 1FPEA 1FNNA 1BK4A 1NJFA 5EQ8A 1FQCA 1LB9A 3RUMA 2O1LA 3MJNA 1Q9DA 3CG3A 1DTGA 4ELRA 3I5OA 3EHSA 4CGYB 2DOJA 3SAVA 4F19A 3PPNA 4KHZE 3AJIB 4N4UA 1IN5A 4BLCA 1IUDA 1FRPA 4RJZA 4HE1A 3N6UA 1SXJC 1EZPA 1AOVA 4ZEFA 2HAVA 4PBHA 3VK7A 4LCBA 4JI0M 5IAIA 5I58A 2RKOA 4ISUA 1NV2A 3L6HA 1YCJA 1J5EM 2O84X 4AB5A 3IFAA 1PB7A 3K8ZA 4LFBM 1EH3A 1R5LA 3GPPA 1B32A 3OD7A 3FUUA 4DXBA 3KBZA 4DV6M 4IO4A 1SQYA 2UU9M 3G3JA 2XXKA 1R6BX 4ZPXA 3HGIA 2WBDA 1A55A 1I6AA 4R6HA 3U65A 4IBGA 4AZFA 1XMQM 1P1UA 2B3FA 3LUZA 4QSEA 1OIPA 4KCDA 1M5DA 2WYPA 3QAUA 1O63A 2HXWA 1PB9A 2XSZA 1ORYB 3K1JA 3U5ZB 1INPA 3MVXA 3UA8A 1GV8A 3RY3A 1BTJA 1NV7A 4PAFA 2FS1A 1TF0B 1JR3E 2JNHA 3QYTA 4IJFA 4FIMA 2HAKA 2I7NA 4F2LA 3QK6A 4NF8A 3FRIA 4NF4B 4JVCA 1YUBA 2KNAA 2QCUA 4DV2M 1B3GA 2QHOB 4I81A 1B9JA 5IZ7D 1FPGA 1B2HA 1IZ1A 4R3DA 1S7YA 4NMYA 4P56A 4JXIA 2LH0A 3M0EA 4DXCA 4RKUF 2ZZVA 3PD8A 1VR5A 4LG2A 3U93A 3LW5F 1TGUA 3Q26A 1ATGA 3GRRA 3VKGA 2XEPA 3JR4A 4QHTA 3FBPA 3O6IA 3C58A 3U5ZA 1B40A 3MBPA 4U22A 4BDRA 4X1DA 4BB9A 5GKNA 4EIWA 1FTKA 2UVGA 4IBEA 2XX7A 4AKIA 3GLIB 3JYRA 1EYKA 2KA6B 3U6LA 4G4QA 1LBCA 3N5LA 4N8YA 4FEDA 4NF4A 2PFYA 1IN6A 1JVXA 4NEDA 4F1UA 4GHAA 1P1OA 1DV0A 1SXJE 1T6OA 2DAKA 1LLSA 2FYIA 1Z5BA 2BJVA 3B8BA 3J2PB 3T1HM 1QZMA 3DP4A 2LXEA 3OELA 2BNKA 3FTCA 4H67A 1MJGM 1B3LA 2A5YB 2CUZA 1H44A 4NF0A 5KQ8A 1Z6TA 5K2XA 2OWZA 2UYFA 1DCUA 4LQ5A 2AIXA 1C7YA 1SW2A 4I3YA 2V84A 3KOZE 3RN8A 5DEXA 1NUWA 1SI1A 3U60B 4OW0A 1LTMA 4JYAM 5LDZA 4WXJA 3V83A 5IZ3A 5L9MA 1JQJC 4WW0A 4OEUA 1H3DA 1JB0F 3TTRA 4CIZA 3LSWA 2ABHA 4GITA 3KJ7A 3S4UA 2QS2A 5HBCA 4OHNA 4XTCQ 2XX8A 2I4CA 1YLAA 5ITXA 2CEYA 4LZ8A 4YMAA 3MW0A 4MLVA 3C9HA 2V3TA 3KBRA 2DI0A 5FHMA 4E0WA 2R46A 3M3KA 4MCOA 2KW0A 4CISA 1VEJA 2QBYB 4MHFA 2F3BA 3FTDA 3NOHA 2DXRA 2PVUA 4QFOA 4R9GA 3W9VA 5I2KA 2Z7JA 1Q3BA 1FPBA 2VDBB 1WODA 1XOCA 3CSGA 3LBSA 4JI6M 1FTOA 2RCBA 3O9PA 3HHWA 4MGHA 2O68A 4NRWA 3FATA 2UUCM 3AOEA 1PJQA 3ZCBB 4HE0A 5TPAA 3FUVA 4XKQA 1NVMA 4P0GA 3I3VA 1XXHB 1URSA 2WSFF 4IJEA 2V4CA 1AH5A 2H5YA 4ZECA 2B65A 2DXYA 3TWMA 3B6TA 4DV1M 3SASA 4OENA 1A99A 2PT2A 3PPRA 5CRYA 1MRPA 4YU0A 3C31A 5KDTB 4IBKA 4DR5M 4RPOA 2QMWA 1UQWA 3E9SA 4IO2A 2WYKA 2ZNTA 3GQ3A 3IJXB 3UMMA 3H6VA 4GRKA 4GMQA 1JR3D 3U6CA 4PCZA 3I04M 1Z5AA 1K3WA 1L2DA 1IBLM 1YZ0A 3UK4A 3PUXE 3T22A 3MYUA 3RFWA 3JR5A 1G59A 3T15A 5FTIA 4R7GA 2FBPA 1PRBA 2CV1A 5JTYA 2XXTA 1YSYA 1O7TA 4FJPA 2Q8JA 3TCFA 5ITPA 1TTEA 3R6UA 1NNUC 1NNPA 4H45A 1R9LA 5LOMA 4DV5M 1IY1A 4F3GA 4KO8A 4XFEA 1FBDA 5F1QA 3K02A 4OVZA 3TQWA 2F3DA 4DCXA 1N04A 3IOWA 2XXXA 5BUUA 4YHHM 4MGYE 2O5RA 4GXAA 4JXJA 3ISPA 1FTAA 4FECA 1V33A 2K6BA 2Q89A 2F35A 2VF8A 3D4CA 4PDDA 1TDHA 3KN8A 5AA2B 3O2AA 5H8FB 4KQPA 4M9ZA 5K2YA 2Y7IA 2H99A 3GLGE 3MC2A 3IECA 4KFQA 1MY1A 1PM5A 1SXJD 3EIHA 2K9DA 4M0WA 2Y7RA 4B3TM 4GKKM 1MXYA 4QXDA 1GO5A 2QZ4A 2OOBA 2GQ1A 2OO9A 2DP8A 5TP9B 1OFHA 2HKJA 1WDNA 2YR0A 5FTMA 3KN3A 3VLUA 3HV1A 1W5SA 2BWBA 3E79A 1Y3PA 2D7HA 1Q1KA 3O29A 3OOAA 3FV2A 1PBQA 4QFKA 4GWXA 3SEWA 4GX6A 2XSZD 2R0IA 2OPFA 4G68A 3CSBA 5ET5A 1II5A 1A5TA 4OWDA 5H8FA 4GBWA 5I7IA 3UIFA 1IMAA 2DXIA 1G0HA 2M8CA 1S3SA 3W15C 3IG8A 1US4A 4NGUA 2DENA 1LAFE 2OQ4A 4U2RA 4OEVA 3U6SA 4EXLA 1MPCA 3OTOM 7CATA 3W67A 4P3LA 4DR6M 4KYSA 2F5NA 3E21A 1PB8A 1N33M 1B1HA 1FPDA 3ILUB 1QAQA 2F5SA 5EHMA 1VQ1A 4JN6A 1FQAA 4NAPA 3FUZA 1CNQA 2MKZA 4X65M 3AOGA 1GJSA 3L6GA 3FV1A 5E6JA 1L8QA 4YAHX 1NKXA 3K01A 5EQ9A 4DI3D 2Q2CA 3ILKA 3CHGA 3BFTA 1WJ7A 2F78A 1XS5A 2F5PA 3VVEA 2VIIA 3UJNA 2F5QA 3AL0C 3C34A 1IEJA 3T1BA 2EA0A 3E78A 3GLFE 3T9XB 3FGSA 3PUYE 1I6QA 2JP7A 3U6QA 3RGYA 1YXIA 1KA0A 1HNWM 2H9BA 2I4BA 4ELPA 2KEBA 5BWJA 2DHYA 3H7MA 1H43A 3TE6A 4LFCM 1XVYA 4I40A 3DFZA 3TWLA 3PMWA 1NNTA 2HEUA 3ZC7B 3SETA 1RDZA 1BKAA 1R6ZA 1BLFA 4D80A 2EKKA 4L16A 4QHQA 4BDNA 4HE2A 4PQJA 1JNFA 1MY4A 2D3IA 4GEWA 4P1EA 4LF9M 4EF2A 2O1MA 2OWTA 3DOAA 2ZNSA 2FOIC 1D0MA 3DP6A 1D4NA 1DTZA 2O69A 1GVNA 1DOTA 2UVHA 4LJ8A 2CZLA 4FE8A 3SEUA 3E13X 2FNAA 1NY6A 5FTLA 1QJMA 1JW1A 4OVPA 3FXRA 1UTBA 3IOUA 2QS3A 1MH4A 2DWAA 4O3CA 3S9NC 1LCFA 1SW1A 1QDTA 3USDA 2MR9A 1PGYA 4GOTA 2F6PA 2DDKA 5IWAM 2VQEM 3KOYE 4KD5A 1B7ZA 3PD9A 4GWOA 3CGWA 4G4NA 1B6HA 2V6ZM 1IXIA 2PBWA 2IEEA 3B6WA 1IBKM 3IOTA 2XH9A 5B7DA 5ICTA 3ZQJA 3CR9A 2C99A 2K47A 5CM6A 4X62M 4FCVA 4Z8XA 1LBYA 4JVIA 2X7QA 3GBBA 1LSTA 4JSOA 1T3TA 1FBCA 1QKBA 3FJGA 4ZZAA 2DHRA 2J7OA 1B4HA 1TFDA 4NF5B 4Q0CA 2EUCA 2RC9A 1MX0A 4OERA 5ET8A 1AIVA 4IBIA 3EIEA 5ITYA 1VFEA 1DPEA 3FUWA 3E3KA 2L7IA 1V34A 5C1BA 1G4AE 2R6FA 2UXDM 1B4ZA 3A42A 2DWJA 2E1SA 3MP6A 3TCGA 4Q8RA 4RY1A 4NXMM 2ZTCA 4GL8A 3TTNA 1N0TA 4AB6A 3CF2A 2WSEF 3M3FA 1Y8GA 5FSWA 1D9YA 2Y20A 1Q02A 2Q9TA 1N36M 1XT8A 4H46A 1EYJA 2PMSA 3PUZE 2F5XA 3CIJA 4BDMA 3TQLA 3V8XB 4NF5A 4HW8A 2DWZB 2O51A 4BDOA 4LZJA 2KRUA 3R9XB 4MNIA 5M2VA 4XGIA 4OVQA 1IXSB 2CZKA 4JWXA 4FCTA 2HXRA 2Q88A 4EDPA 4LGMA 1NV5A 2NWJA 5EXXA 1MDP1 3KS4A 2L6OA 4TLLB 1DPPA 1J1NA 4U4SA 5EYGA 1ZMGA 4EXKA 2R45A 3K1NA 2Z3XA 3TMGA 3MUQA 3BXWA 2UXCM 4QFNA 1IN7A 4OANA 2XX9A 1JR3A 4KODA 5HPQA 1N76A 2P3VA 1K82A 3D8BA 2KDLA 2LVOC 1FSAA 1R9QA 1NV8A 5I58B 1GVCA 4QBAA 2Q2AA 2RC8A 2F34A 1HSJA 2IA4A 5FHNA 1ZU0A 4MLQA 1PJIA 3SEVA 4OETA 2CZIA 2KNVA 1M5EA 1N75A 3RE8A 2FH0A 4D81A 1IXZA 2VHAA 4PE5B 4F3PA 4OU7A 3V5AA 1TDZA 4FWDA 2JY7A 4JVDA 5EP2A 3HHZA 1Y3QA 3TUSA 4PGPA 3SZPA 4HTGA 3KC1A 4UABA 5L8RF 4R75A 4IIWA 3PNVA 1SVXB 3B7QA 2I58A 1LCTA 2Y0QA 3KGCA 4ZEKA 2HCAA 3CG1A 5KO3A 5FTHA 4PDGA 5H37D 1IFYA 2LWXA 1LBZA 3ONMA 1HSEA 4YKPA 1DO0A 1VDWA 2R9JA 4NQ8A 3V76A 1V92A 3SYLA 1LAHE 3B6QA 3P7IA 4NOOB 4PFTA 3PUVE 3KP0E 3HN0A 4EQBA 4RYAA 4GWSA 2MGWA 4NF8B 5A2QS 1E9SA 1SXJA 5DVJA 2FNCA 5H8HB 3CTWB 1F4IA 2I0CA 5L9OA 3LQRA 5ITOA 4AG6A 2DZOB 1FQBA 2CV0A 3LR1A 3K2DA 3RPWA 1Y20A 3H06B 2A5SA 4XBOA 3OO9A 4DUZM 1MQGA 3LMMA 1HT1E 2H25A 4DI4B 3S9LC 4KHPM 5FTJA 4OXVA 1ZV1A 2CWBA 3SESA 5C18A 3TZAA 4G61A 1JETA 1H6UA 2I0BA 2V25A 3UGJA 4KLNA 1Y1MA 3FD9A 4JI8M 1PJSA 3VFJA 2NOOA 1L5TA 3FRHA 5ET6A 4L4UA 3KN7A 1FJ6A 1D9VA 4EQ9A 4O7IA 3UGWA 4RPNA 1R7RA 5H8HA 2XWVA 4LZZA 3FVKA 4KXPA 3KSJA 3KOWE 4AG5A 1TT1A 4XKPA 2REJA 3DA1A 1N32M 3M8UA 2EJSA 5CMMA 2XLJA 2E5LM 3CF6E 3K9PA 1MXUA 3C4MA 2W7YA 1GABA 1MQIA 4DLDA 3FE3A 1GTKA 3KVWA 3LSFB 2XD3A 1ZTYA 2QS1A 4R2BA 4R74A 4LF4M 3EQ1A 2QP9X 2ZYOA 1XMOM 3CRBA 4JI1M 1Z59A 1Y3NA 5DEXB 1N77A 4POXA 1RYOA 2B4LA 2YJPA 3Q27A 4N07A 4YB7A 1E9RA 4ZS9A 4IO3A 4LONB 5F24A 5ITTA 5IT9S 3B7NA 3D4GA 1OQYA 2WKYA 4CJ6A 1IMEA 4GF8A 4PC9A 2XXUA 3OO7A 5IZ3B 2DAGA 4YKIA 3F92A 1VDLA 1VG5A 4DR7M 2ZYKA 3C32A 4KCCA 4IBFA 2CRUA 1E94E 2O7UA 2L4EA 4NX1A 3E9XA 2CHVA 3H4MA 1NNJA 4PDIA 4H6DA 2EO2A 2APLA 2F36A 5ITUA 1PDAA 2QVRA 2Z8DA 3B7ZA 1R2YA 4LJ9A 3I6VA 3OEKA 1FBPA 2JY8A 4GD5A 1BVSA 2MJ5B 3W68A 3G3HA 4G3OA 3G3FA 1POTA 2G5GX 4I1DA 3SYKA 2VPOA 3HY5A 1MN3A 5IKBA 5I2KB 4GIPA 1X37A 3C36A 5CBSA 3CFLA 3B9PA 4G8HA 4LF8M 1XC8A 2XHDA 4CHTB 4R6KA 3UN6A 2PFZA 3KW6A 2ZM6M 4PAKA 1SPIA 5H8QA 4TOZA 1XNQM 2LTUA 1JW4A 3HHGA 4N15A 4JBZA 1H45A 4WEDA 5TPAB 3M3LA 3H03A 1IXGA 2DWHA 2XFTA 4X8RA 3PV0E 4UACA 1GR2A 2JXNA 3HJSA 4NRVA 4NWDA 4YY3M 2J7NA 3V89B 3HFUA 2W82A 1L1TA 4OVTA 4YZZA 1NV0A 4LY6A 3J80S 4LJ5A 4DR1M 2HPGA 2VT5A 2I3WA 4U23A 5EQ7A 1QQWA 4PF6A 1G41A 4GWUA 1WR1B 3GLGA 4PBQA 3NWLA 1IBMM 3QSLA 1A7LA 2FIXA 4IO5A 2P2AA 1SG9A 4EQ7A 4MGKE 5JTYB 4EUOA 1FQDA 4LN5A 2L09A 4IGRA 3HU1A 3U6OA 3RYDA 3KXEC 4LATA 2FHYA 3L25A 3T9VA 4WP2A 4O3BA 4HCYA 4OVZB 5IZZA 1UIVA 1GGGA 1SD3A 1TFAA 4KR5A 3PFIA 5FLXS 3EN3A 2Y0TA 1P1NA 4LVQA 2R4EA 2BJJX 1OIBA 4RA1A 4ONYA 3SATA 3T0JA 4FEBA 3IO6A 4GC9A 4S12A 4FORA 5DVIA 4PETA 2QSFX 4LJ6A 4BDLA 2RKMA 4B08A 3B50A 5JK4A 3SHFA 4JWYA 3TCHA 5FTNA 2Y7PA 4O7MA 4DV3M 2I7PA 2HFBA 1PEBA 2J5YA 3OENA 1RDXA 3LV0A 4PTKA 3GLIE 2LVAA 3OEMA 1NNFA 3TPZA 4NSRA 4OESA 2F5OA 2Z22A 5AA1A 1N7XA 1I6BA 2LNHC 3G3KA 3FJ7A 3UP9A 3U61A 4IB2A 1Z7ME 1HNXM 5F7VA 1MM6A 1WGNA 1ZIUA 3IB2A 1IITA 1IN4A 4H5GA 2H1RA 4LA9A 1MM7A 3GLFA 4G68B 2QS4A 5KQDA 1TXFA 1PBPA 1FQEA 1I94M 3L2AA 3T66A 1HR0M 4O94A 4XKNA 1ZQ9A 3TODA 1HJPA 4UN2B 2VF7A 4X66M 1DO2A 2QSXA 4GLIA 5BPVA 2R8TA 4F1IA 4DE8A 2VGQA 3J27B 4QOZC 2OCUA 2CMOA 1FPJA 2R18A 3PMXA 3H3GA 4FVMA 4GWYA 2VD2A 3LSLA 1QUTA 3PVSA 1EU8A 3Q29A 2K0BX 5IZ1A 3GO8A 1MQDA 3U92A 4GWWA 1C1KA 3AFHA 5AA4A 4I8OA 3QUJA 4L8RC 1QW0A 1QDRA 4QF9A 5ET7A 3SMSA 1MU5A 2R44A 3OMBA 4F31B 3MAMA 2N35A 5ISUA 3VXCA 4OVRA 1JW5A 2DZNB 1L2CA 5E26A 2L7HA 3MP8A 3D1RA 3TTLA 3RGSA 3K6XA 3HX3A 1LGBC 4KYEA 1IQ7A 1OLAA 3L27A 3DP8A 2L2DA 1LAGE 4ZDMA 2DAIA 2C98A 3K2LA 3LCVB 5CC2A 1MQJA 3TTMA 3TPAA 3GLHA 2F7BA 2LHCA 4OVJA 1NV4A 5FHOA 2X8AA 1S50A 1DSNA 3VVDA 4GC5A 1IMDA 1QAMA 4KPTA 5CMKA 2DAMA 5IGAA 2UVJA 5LTCA 4QNMA 1D0LA 4NN3A 3LQQA 4AKHA 1Y9UA 4G77A 4X48A 3FXUA 3RPLA 4OYVA 1ZBMA 3OSRA 1JVYA 4ZZEA 2ZYNA 2ZAOA 2DWNA 4B3RM 2JJKA 3GLBA 2GNOA 4JSDA 1D2NA 1UTBB 4N91A 2L5VA 2Z8EA 2F7CA 3I4VA 2XWOA 1ZMWA 4DV0M 2VPNA 4WKMA 2Y5LA 1DGBA 2VP1A 1LV7A 5KPZA 2CP8A 2XF3A 4NC6A 4ECFA 1B0HA 3SARA 4M9SA 2BJWA 1JEVA 1VDDA 3FASA 3U6PA 4MGIE 1WVJA 1UM8A 2QVVA 1QZEA 1NH8A 2FE8A 4LRTA 3W0LB 2LVPC 3Q28A 1N84A 2DVWB 3BIGA 4HEOA 3FTEA 4FBPA 3S9EA 4HS7A 1M5CA 1J7KA 1LBWA 4TLMB 4MF3A 2UVIA 4F22A 3W0FA 1OAIA 3IHPA 2XXQA 4IBDA 1RDYA 4NG7A 2OZZA 4GFRA 2RGHA 1OLCA 3IX1A 4GX3A 2Z4SA 1XVXA 1SYIA 4OFJA 4OVSA 2JY6B 1OJLA 5JI2E 4I8CA 3K1PA 3KFMA 8CATA 1QGXA 2F8DA 4YICA 5B70A 1R1NA 2YNMD 3K4UA 4RK2A 3UK6A 3GQ4A 4PFBA 4RNAA 4F18A 3GLHE 2F6GA 2VD3A 2D21A 5KZTA 1EZ9A 1DGFA 2G3QA 1IQPA 4LZ7A 3HJ8A 4PD2A 2GH9A 4FW9A 1AMFA 2XXWA 3DLNA 1NJGA 1TH3A 3VXBA 2GFEA 1UIUA 1B3HA 5KPRA 1B58A 2XZFA 2D5WA 4F2OA 3FIRA 1MPDA 3WHKA 1USYE 3PUWE 1NUXA 2HCBA 4NTLA 4OQOA 3MPLA 4Z6YA 3T6PA 4MX6A 5EP1A 4AQYM 3HO7A 4OX9M 4ESXA 1SW4A 2QL3A 3HPIA 4DV7M 3UORA
chains in the Genus database with same CATH topology
1QUJA 3C35A 4BBAA 4FATA 4G4RA 4PFUA 1VFDA 2QPQA 2OJTA 2G8LA 1YAEA 2HAUA 3GRVA 3O28A 3IAZA 3T96B 1OFIA 2CHQA 2DWLA 4WURA 4IGTA 3SAWA 2GRVA 4LQ2A 2ONRA 3SEXA 1M5BA 3L26A 1QVSA 1VSOA 4DXUA 2Y7KA 5L8DA 3HCQA 4R9FA 2RF1A 4HL4A 5FTKA 1DGGA 4LGYA 4R73A 4ND9A 3SMPA 3K00A 4JB7A 2R62A 2DWIA 4IY5A 3S2VA 1FCKA 3ODBA 1ZLQA 3IOVA 4LFAM 4DR2M 3G3GA 3CF0A 1LFIA 1OQHA 4LJ4A 1MQHA 3PPQA 3LVVA 5AE4A 1FTMA 5DT6A 1KWHA 3H6TA 2I3VA 2PT1A 4GRIA 3EHUA 3H6WA 4N13A 4Q5TA 3VDFA 2P1SA 3N94A 2YQZA 4IBBA 1FTLA 4IO7A 3IB0A 2X26A 3MPKA 3SEYA 1LFHA 5LMUM 3IORA 1N78A 5TU0A 1YE9A 2A5TA 3HKPA 2YFQA 3GRUA 3S9MC 3G3IA 3U6MA 3K0VA 2Z23A 2HZLA 1XNRM 1SXJB 4U21A 2KRKA 1Q39A 5I57B 4HCWA 3KOSA 3LVWA 2DE4A 3FXQA 4IBJA 3WHLA 2C5RA 1MPBA 4AKGA 1MY3A 5DNYA 2HHHM 4FCWA 4KYDA 2B3BA 3FZVA 1NHWC 2AL5A 3MK6A 1OVTA 4C1UA 2R6GE 3SKPA 3RT8A 3AKZA 2Z8FA 1A8FA 4H5FA 4LF6M 3KOTA 4I5SA 2ERCA 4M0DA 1XHYA 5ICQA 1ZJLA 1MG1A 1OVBA 2PYYA 5JI3E 3J7BA 4F2QA 3SBJA 2OLBA 3A46A 4HLQA 2D7GA 3T9UA 1G8PA 1GKIA 4WEPA 2CEAA 3PU5A 1NNKA 2I49A 4GIZA 5I57A 4H0WA 2M5ZA 1N34M 1VE4A 4L78A 4C1TA 3F11A 3SHGB 2QRYA 4BLAA 1BP5A 1DMBA 4M9XA 3VE1B 1TWYA 2XD2A 5IREB 2RINA 1O64A 5AA2D 3FYDA 4JV5M 3FKEA 4P16A 3VVFA 4B7HA 2ONKE 3MJ5A 1EZOA 1LAXA 2XXRA 3KP1E 3U94A 3IL1B 3K92A 1H76A 4Z7EA 1Q3CA 2I48A 3CI8A 3U6EA 2UXBM 3ZSFA 1URDA 2V1CA 3EPEA 2XGNA 2F7AA 3QIMA 1NY5A 3KOXE 3IG5A 4GH9A 2OBGA 3IO4A 3T9HB 1I69A 1PJJA 4I4LA 4AI6A 3TELA 4DDDA 2XXIA 3CVGA 1KSFX 2P5TA 1B46A 2ALUA 4LUBA 3WAEA 3KEIA 3DM0A 4ZEDA 1SBPA 4NSOB 3EF7A 4G4OA 3HJQA 3MVWA 5AA3A 3IR1A 4XKRA 1W5TA 4DR3M 1B52A 4XIGQ 1PC3A 1F9BA 2RC7A 3O6GA 1HSLA 2G93A 2VQFM 1ZAEA 2AYSA 4IBCA 2ZXTA 4JI2M 4YKKA 3C33A 3GZGA 1MDQA 1SYHA 3N26A 4O3AA 1XWIA 5H8QB 4X9TA 1DGHB 2XZUA 3MQ9A 3A09A 3T1YM 1P1QA 2H98A 2DS9A 3GP1A 4TUWA 3PMVA 1IN8A 2X49A 3FVNA 5DVFA 3VLWA 1YTVA 1D3KA 2ZMBA 3J7AS 5EXTA 4X1BA 1B3FA 4MBPA 1B5IA 2JA2A 4DUYM 2RGOA 4AW4A 3QAXA 5EYFA 4MB7A 2NQ8C 2DSFA 4ESWA 4QOSA 4GVOA 3GLGB 3NBIA 4OTEA 5CBRA 2AL4A 1B0LA 1MH3A 1AL3A 1DGHA 3GXAA 3TQSA 1G3IA 2ZAMA 1B7HA 5EJCA 3LUYA 3HU2A 1B5HA 4C0RA 2HQ0A 1HQCA 3H6UA 3RQTA 3GLIA 1B7UA 1N3XA 1A54A 3SC3A 1YPNA 1IXCA 5DTBA 2PX1A 3R8FA 4QFLA 3SAUA 3I51A 3TL4X 1CE2A 1USYH 3K1MA 3A45A 4LRSA 4PP0A 3THGA 3N6TA 5DYIA 5LMNM 3RGPA 1A8EA 2CHGA 2P0SA 4W5WA 3KJTA 1IY0A 3TWKA 4IO6A 4E0XA 3VLFB 2D7EA 4DR4M 3D8LA 3JAMS 4NF6B 5BR8M 3UZUA 1S9TA 3O6HA 3AOEC 3U60A 1HNZM 1B3EA 5F3WA 2E0SA 3B7DA 2QJEA 4JI4M 2NUVA 1B51A 2FFJA 4THIA 1FJGM 1Z7NE 3U61B 3FVGA 3GBAA 5CMBA 5KCJB 3A98B 5KPTA 4B7FA 1QULA 4LP2B 2KXEA 4P11A 3GLFB 3SERA 4FWHA 4B3MM 4I62A 4ZEIA 4TQUQ 4Z0IA 4M4GA 4YB6A 5CI5A 4JI5M 4II7A 4RXLA 4NF6A 2QBYA 1URGA 4MH0E 5ELVA 4NWCA 3KDSE 2UUAM 1B5JA 1BIYA 4H8JA 2V1UA 1IIWA 3ILTB 4ZE8A 2F4VM 3GQ5A 3MVYA 4RK9A 2RCAA 3AV0A 4DZ1A 4DCYA 5EP4A 4R2FA 5AA4B 5KCJA 1E32A 3HWSA 1XXHA 4ELOA 3VDUA 2V93A 2ZNUA 3BFUA 1NMUA 1ELJA 2KZUA 4EF1A 3BOSA 5ITXE 3L29A 4POWA 2ONSA 4MGZE 3HHXA 3RTWB 1GL7A 1KYIA 1IXHA 3Q8XA 3SDFA 3ZKKA 4M1VA 5KDTA 3VLVA 1QUIA 1Y1ZA 3KFUG 4H8IA 4YKJA 5I56B 3KG2A 3KSXA 4JI7M 4B7GA 3IK6B 3GLHB 3CFXA 2Y84A 2KZSA 4NL4H 3T38A 4AQ4A 3RLFE 2QPAA 4OFLA 3TTKA 1FW0A 5EQTA 2CE7A 4U4XA 3QXMA 2DE2A 3ZS6A 2NXOA 3PPPA 4X64M 3H4ZA 5CMCA 4XXUA 5DYHA 1LBBA 4L15A 3TYHA 2QENA 3R26A 3DZDA 3JZJA 2OK2A 3U8QA 1LB8A 2REGA 2YPNA 1B05A 1MY2A 1N7WA 2ESNA 3I4YA 3MP1A 3TAJA 2VOZA 4G4PA 1QVRA 3G7WA 4G68C 4F1YA 4DV4M 1P99A 3K6UA 2Y7WA 5HM4B 1JQFA 4QRZA 5I56A 3OO8A 2NVUB 2ANJA 3HU3A 2XXYA 5AA2A 2UXAA 2AHMA 3FTFA 3MZBA 1N3WA 1HQYE 1Q35A 4MFIA 3OO6A 2H4IA 4F29A 1SDXA 3J81S 2Y21A 2ZYMA 2GHBA 4MH5A 3LC8A 4ELQA 3QUFA 5TP9A 2DYXA 1T0KA 3Q25A 1Z5CA 1IM2A 1RYXA 2UUBM 3ZKLA 3QWLA 4QNRA 2F97A 3K6WA 4B3SM 5EHSA 1HT2E 5H8SA 1XHBA 4JDFA 4ZEBA 1J09A 4G8NA 2G29A 4H1XA 4I9DA 4NE4A 4LZ5A 1RKMA 3TKDA 2V3QA 1M5FA 3ECRA 3FVOA 3VK8A 3GPUA 3W9WA 2R4JA 3FUXA 4K0KM 1GL6A 3PNYA 1POY1 4GQOA 1R2ZA 2O7IA 3O66A 1UTHB 2C9CA 3EHTA 3KS8A 3FJMA 2XXPA 1XC1A 3LSXA 3K6VA 4PT5A 4JI3M 3KZGA 1L2BA 2ZBKB 5I2NB 1QUKA 3OSQA 1KFVA 4ZE9A 3DELB 2UYEA 4PFWA 2C96A 1TH4A 3FUTA 5L9SA 4BDQA 3FYCA 4L17A 4LJ7A 3TFLA 5EXSA 3L28A 1US5A 5A5XB 3MVZA 1I4WA 3RTFB 1NFTA 1Y4TA 3RT6B 4OFOA 5EP3A 4FAJA 3SFZA 1MXVA 4REZA 1UTHA 2C9OA 4U1ZA 4NXNM 4IY6A 3O97A 1TH2A 2R65A 1NL5A 4RF0A 3HHYA 5ITRA 4YMBA 2HL7A 1QYRA 3GRYA 4OZ9A 1OQGA 3BBRA 4QSCA 3HSTA 3JV9A 5I2NA 4H65A 4UA8A 1FQFA 2CFOA 1B1XA 4P0IA 3IB1A 1QAOA 2V3UA 2Z4RA 5JEIA 1EE8A 4FD2A 3MHVC 4F3BA 2M60A 3A3CA 1JEUA 4F1VA 2X7PA 4D82A 3MZ1A 4K3FA 2XXVA 1ZKBA 4RNSA 5A5XA 5ITQA 2THIA 3TDJA 3U6DA 1MY0A 2ZANA 3GPXA 4GHLA 1L1ZA 4LF7M 1P1WA 4F39A 4R72A 4Q30B 4N6PA 2O6AA 2LAOA 4A3VB 4YB5A 5I59B 2I6EA 2A5TB 3HHFA 1NH7A 3CFZA 1IXRC 3PGFA 5EXPA 3VV5A 4LF5M 3PPOA 4RF1A 3VDPA 2YLNA 2DE3A 1SW5A 1OMPA 2R71A 3R7XA 5H8NB 1A40A 1QKAA 4JWOA 5I84A 5J1DA 2FA7A 4GXSB 3RNNA 3THIA 1MS7A 4QSDA 4LJAA 1MXWA 4U1OA 1WXQA 2KLFA 4G2ZA 3U1OA 3VFDA 4PFYA 1LFGA 2X4AA 3IJOB 2HZKA 1MXXA 2DVCA 4GL0A 1GLNA 1IY2A 4QHSA 4FWGA 5I59A 3M7GA 2QMXA 3BKIB 1MXZA 3T93B 4G8MA 3GPYA 2XXHA 3MZ9A 4R6YA 4OMBA 4F3SA 2CV2A 1SI0A 1QANA 3ZH9B 2DWMA 1FTJA 1ANFA 2GHAA 4GKJM 2DVZA 3TEPA 3WAFA 3M6AA 4ITQA 3A3UA 1NSFA 2OWSA 4DIGA 3PXGA 1NHGC 1CB6A 5H8NA 4KI0E 3OXNA 4G6ZA 5DYGA 1Y4CA 3MWBA 2XFSA 3AXFA 2Q2EB 4MM3B 2DQVA 4QFPA 3E4RA 3FD3A 3U72A 1K3XA 3VKHA 1FNNA 1NJFA 1FQCA 1LB9A 3RUMA 2O1LA 3MJNA 3CG3A 1DTGA 4ELRA 3I5OA 3EHSA 4CGYB 2DOJA 3SAVA 4F19A 3PPNA 4KHZE 3AJIB 1IN5A 4BLCA 1IUDA 4RJZA 3N6UA 1SXJC 1EZPA 1AOVA 4ZEFA 2HAVA 3VK7A 4LCBA 4JI0M 5IAIA 5I58A 2RKOA 4ISUA 3L6HA 1YCJA 1J5EM 2O84X 4AB5A 1PB7A 3K8ZA 4LFBM 1EH3A 3GPPA 1B32A 3OD7A 3FUUA 4DXBA 4DV6M 4IO4A 1SQYA 2UU9M 3G3JA 1R6BX 4ZPXA 3HGIA 1A55A 1I6AA 4R6HA 4IBGA 4AZFA 1XMQM 1P1UA 2B3FA 4QSEA 4KCDA 1M5DA 3QAUA 1O63A 2HXWA 1PB9A 2XSZA 1ORYB 3K1JA 3U5ZB 3MVXA 3UA8A 1GV8A 3RY3A 1BTJA 3QYTA 4IJFA 4FIMA 3QK6A 2I7NA 4NF8A 4NF4B 1YUBA 2QCUA 4DV2M 1B3GA 4I81A 1B9JA 5IZ7D 1B2HA 1IZ1A 4R3DA 1S7YA 4NMYA 4JXIA 2LH0A 3M0EA 4DXCA 3PD8A 1VR5A 4LG2A 3U93A 1TGUA 3Q26A 1ATGA 3GRRA 3VKGA 2XEPA 3JR4A 4QHTA 3O6IA 3C58A 3U5ZA 1B40A 3MBPA 4U22A 4BDRA 4X1DA 4BB9A 5GKNA 4EIWA 1FTKA 2UVGA 4IBEA 2XX7A 4AKIA 3GLIB 3JYRA 2KA6B 3U6LA 4G4QA 1LBCA 3N5LA 4FEDA 4NF4A 1IN6A 1JVXA 4NEDA 4F1UA 4GHAA 1P1OA 2FYIA 1SXJE 1LLSA 1Z5BA 2BJVA 3J2PB 3T1HM 1QZMA 3DP4A 2LXEA 3OELA 2BNKA 3FTCA 4H67A 1B3LA 2A5YB 2CUZA 1H44A 5KQ8A 1Z6TA 5K2XA 2UYFA 4LQ5A 2AIXA 1SW2A 2V84A 3KOZE 3RN8A 5DEXA 1SI1A 3U60B 4OW0A 4JYAM 4WXJA 3V83A 5L9MA 1JQJC 4WW0A 4OEUA 1H3DA 3TTRA 3LSWA 2ABHA 4GITA 3KJ7A 3S4UA 2QS2A 5HBCA 4OHNA 4XTCQ 2XX8A 2I4CA 5ITXA 4LZ8A 4YMAA 3MW0A 4MLVA 3C9HA 2V3TA 3KBRA 5FHMA 4E0WA 2R46A 3M3KA 2KW0A 4CISA 2QBYB 3FTDA 2DXRA 2PVUA 4QFOA 4R9GA 3W9VA 5I2KA 2Z7JA 1Q3BA 1WODA 1XOCA 3CSGA 3LBSA 4JI6M 1FTOA 2RCBA 3O9PA 3HHWA 4MGHA 2O68A 4NRWA 3FATA 2UUCM 3AOEA 3ZCBB 5TPAA 3FUVA 4XKQA 1NVMA 4P0GA 3I3VA 1XXHB 1URSA 4IJEA 1AH5A 2H5YA 4ZECA 2B65A 2DXYA 3TWMA 3B6TA 4DV1M 3SASA 4OENA 1A99A 2PT2A 3PPRA 5CRYA 1MRPA 4YU0A 3C31A 5KDTB 4IBKA 4DR5M 4RPOA 2QMWA 1UQWA 3E9SA 4IO2A 2ZNTA 3GQ3A 3IJXB 3UMMA 3H6VA 4GRKA 4GMQA 1JR3D 3U6CA 4PCZA 1K3WA 1Z5AA 1L2DA 1IBLM 3UK4A 3PUXE 3T22A 3RFWA 3JR5A 1G59A 3T15A 5FTIA 4R7GA 2CV1A 5JTYA 2XXTA 1YSYA 1O7TA 4FJPA 2Q8JA 3TCFA 5ITPA 3R6UA 1NNUC 1NNPA 1R9LA 5LOMA 4DV5M 1IY1A 4F3GA 4KO8A 5F1QA 3K02A 4OVZA 3TQWA 4DCXA 1N04A 3IOWA 2XXXA 5BUUA 4YHHM 4MGYE 2O5RA 4GXAA 4JXJA 4FECA 2Q89A 2F35A 3D4CA 1TDHA 3KN8A 5AA2B 3O2AA 5H8FB 4KQPA 4M9ZA 5K2YA 2Y7IA 2H99A 3MC2A 4KFQA 1MY1A 1PM5A 1SXJD 3EIHA 4M0WA 2Y7RA 4B3TM 4GKKM 1MXYA 2QZ4A 2DP8A 5TP9B 1OFHA 2HKJA 1WDNA 2YR0A 5FTMA 3KN3A 3VLUA 3HV1A 1W5SA 1Y3PA 2D7HA 1Q1KA 3O29A 3OOAA 3FV2A 1PBQA 4QFKA 3SEWA 2XSZD 2OPFA 4G68A 3CSBA 1II5A 4OWDA 5H8FA 3UIFA 2DXIA 2M8CA 1S3SA 3W15C 3IG8A 1US4A 1LAFE 2OQ4A 4U2RA 4OEVA 3U6SA 4EXLA 1MPCA 3OTOM 7CATA 4DR6M 4KYSA 2F5NA 1PB8A 1N33M 1B1HA 3ILUB 5EHMA 1QAQA 2F5SA 4JN6A 1FQAA 3FUZA 4X65M 3AOGA 3L6GA 3FV1A 5E6JA 1L8QA 4YAHX 1NKXA 3K01A 2Q2CA 3ILKA 3BFTA 2F78A 1XS5A 2F5PA 3VVEA 2VIIA 3UJNA 2F5QA 3AL0C 3C34A 1IEJA 2EA0A 3T9XB 3FGSA 3PUYE 1I6QA 3U6QA 3RGYA 1HNWM 2H9BA 2I4BA 4ELPA 2KEBA 5BWJA 3H7MA 1H43A 3TE6A 4LFCM 1XVYA 3DFZA 3TWLA 3PMWA 1NNTA 2HEUA 3ZC7B 3SETA 1BKAA 1R6ZA 1BLFA 4D80A 4L16A 4QHQA 4BDNA 4PQJA 1JNFA 1MY4A 2D3IA 4LF9M 4EF2A 2O1MA 2OWTA 3DOAA 2ZNSA 2FOIC 3DP6A 1D4NA 1DTZA 2O69A 1GVNA 1DOTA 2UVHA 4LJ8A 2CZLA 4FE8A 3SEUA 3E13X 2FNAA 1NY6A 5FTLA 1QJMA 1JW1A 3FXRA 1UTBA 3IOUA 2QS3A 1MH4A 2DWAA 4O3CA 3S9NC 1LCFA 1SW1A 3USDA 4GOTA 2F6PA 5IWAM 2VQEM 3KOYE 4KD5A 1B7ZA 3PD9A 4GWOA 4G4NA 1B6HA 2V6ZM 1IXIA 2PBWA 2IEEA 3B6WA 1IBKM 3IOTA 2XH9A 5B7DA 5ICTA 3CR9A 2C99A 2K47A 5CM6A 4X62M 4FCVA 4Z8XA 2X7QA 3GBBA 1LSTA 4JSOA 1T3TA 1QKBA 3FJGA 4ZZAA 2DHRA 2J7OA 1B4HA 1TFDA 4NF5B 4Q0CA 2EUCA 2RC9A 1MX0A 4OERA 1AIVA 4IBIA 3EIEA 5ITYA 1VFEA 1DPEA 3FUWA 3E3KA 2L7IA 5C1BA 1G4AE 2UXDM 1B4ZA 3A42A 2E1SA 2DWJA 3MP6A 3TCGA 4Q8RA 4RY1A 4NXMM 4GL8A 3TTNA 1N0TA 4AB6A 3CF2A 3M3FA 5FSWA 1D9YA 2Y20A 2Q9TA 1N36M 1XT8A 2PMSA 3PUZE 2F5XA 3CIJA 4BDMA 3TQLA 3V8XB 4NF5A 4HW8A 2DWZB 2O51A 4BDOA 4LZJA 2KRUA 3R9XB 5M2VA 4XGIA 1IXSB 4JWXA 4FCTA 2Q88A 4EDPA 4LGMA 2NWJA 5EXXA 1MDP1 3KS4A 2L6OA 4TLLB 1DPPA 1J1NA 4U4SA 1ZMGA 4EXKA 2R45A 3K1NA 2Z3XA 3TMGA 3MUQA 2UXCM 4QFNA 1IN7A 2XX9A 1JR3A 4KODA 5HPQA 1N76A 1K82A 3D8BA 1R9QA 5I58B 1GVCA 2Q2AA 2RC8A 2F34A 1HSJA 2IA4A 5FHNA 1ZU0A 4MLQA 1PJIA 3SEVA 4OETA 1M5EA 1N75A 3RE8A 4D81A 1IXZA 2VHAA 4PE5B 4F3PA 4OU7A 3V5AA 1TDZA 4FWDA 5EP2A 3HHZA 1Y3QA 3TUSA 4HTGA 4R75A 4IIWA 3PNVA 1SVXB 2I58A 1LCTA 2Y0QA 3KGCA 4ZEKA 2HCAA 3CG1A 5KO3A 5FTHA 4PDGA 5H37D 2LWXA 3ONMA 1HSEA 4YKPA 1DO0A 2R9JA 1LAHE 3SYLA 3P7IA 3B6QA 4NOOB 4PFTA 3PUVE 3KP0E 3HN0A 4EQBA 4RYAA 4NF8B 5A2QS 1E9SA 1SXJA 5DVJA 2FNCA 5H8HB 3CTWB 2I0CA 5L9OA 3LQRA 5ITOA 4AG6A 2DZOB 1FQBA 2CV0A 3LR1A 3K2DA 3RPWA 1Y20A 3H06B 2A5SA 4XBOA 3OO9A 4DUZM 1MQGA 3LMMA 1HT1E 2H25A 3S9LC 4KHPM 5FTJA 4OXVA 3SESA 5C18A 3TZAA 1JETA 1H6UA 2I0BA 2V25A 3UGJA 4KLNA 1Y1MA 3FD9A 4JI8M 3VFJA 2NOOA 1L5TA 4L4UA 3KN7A 1D9VA 4EQ9A 3UGWA 4RPNA 1R7RA 5H8HA 4LZZA 3FVKA 3KSJA 3KOWE 4AG5A 1TT1A 4XKPA 2REJA 3DA1A 1N32M 3M8UA 5CMMA 2XLJA 2E5LM 3CF6E 1MXUA 3C4MA 2W7YA 1MQIA 4DLDA 1GTKA 3KVWA 3LSFB 2XD3A 1ZTYA 2QS1A 4R2BA 4R74A 4LF4M 3EQ1A 2QP9X 2ZYOA 1XMOM 3CRBA 4JI1M 1Z59A 1Y3NA 5DEXB 1N77A 4POXA 1RYOA 2YJPA 3Q27A 4N07A 4YB7A 1E9RA 4ZS9A 4IO3A 4LONB 5ITTA 5IT9S 3D4GA 2WKYA 4GF8A 2XXUA 3OO7A 4YKIA 4DR7M 2ZYKA 3C32A 4KCCA 4IBFA 1E94E 2O7UA 3E9XA 2CHVA 3H4MA 1NNJA 4PDIA 4H6DA 2EO2A 2F36A 5ITUA 1PDAA 2Z8DA 1R2YA 4LJ9A 3I6VA 3OEKA 4GD5A 3G3FA 3G3HA 1POTA 2G5GX 4I1DA 3SYKA 5IKBA 5I2KB 4GIPA 1X37A 3C36A 5CBSA 3CFLA 3B9PA 4G8HA 4LF8M 1XC8A 2XHDA 4CHTB 4R6KA 3UN6A 3KW6A 2ZM6M 5H8QA 4TOZA 1XNQM 1JW4A 3HHGA 4JBZA 1H45A 4WEDA 5TPAB 3M3LA 3H03A 1IXGA 2DWHA 2XFTA 3PV0E 4UACA 1GR2A 3HJSA 4NRVA 4NWDA 4YY3M 2J7NA 3V89B 2W82A 1L1TA 4YZZA 4LY6A 3J80S 4LJ5A 4DR1M 2I3WA 4U23A 1QQWA 1G41A 3GLGA 3NWLA 1IBMM 3QSLA 1A7LA 4IO5A 2P2AA 4EQ7A 4MGKE 5JTYB 4EUOA 1FQDA 2L09A 4IGRA 3HU1A 3U6OA 3KXEC 4LATA 3L25A 3T9VA 4O3BA 4HCYA 4OVZB 1UIVA 1GGGA 1SD3A 1TFAA 4KR5A 3PFIA 5FLXS 3EN3A 2Y0TA 1P1NA 4LVQA 2R4EA 2BJJX 1OIBA 4RA1A 4ONYA 3SATA 4FEBA 3IO6A 4GC9A 4S12A 4FORA 5DVIA 4PETA 4LJ6A 4BDLA 2RKMA 4B08A 5JK4A 3SHFA 4JWYA 3TCHA 5FTNA 2Y7PA 4DV3M 2I7PA 2HFBA 1PEBA 3OENA 3OEMA 3TPZA 4NSRA 1NNFA 4OESA 2F5OA 2Z22A 5AA1A 1N7XA 1I6BA 2LNHC 3G3KA 3FJ7A 3UP9A 3U61A 4IB2A 1Z7ME 1HNXM 5F7VA 1MM6A 1ZIUA 3IB2A 1IITA 1IN4A 4H5GA 2H1RA 4LA9A 1MM7A 3GLFA 4G68B 2QS4A 5KQDA 1TXFA 1PBPA 1FQEA 1I94M 3L2AA 3T66A 1HR0M 4XKNA 1ZQ9A 3TODA 4X66M 1DO2A 2QSXA 4GLIA 5BPVA 4DE8A 2VGQA 3J27B 4QOZC 2OCUA 2CMOA 2R18A 3PMXA 3H3GA 4FVMA 2VD2A 3LSLA 3PVSA 1EU8A 3Q29A 3GO8A 1MQDA 3U92A 1C1KA 3AFHA 5AA4A 4I8OA 3QUJA 4L8RC 1QW0A 4QF9A 3SMSA 1MU5A 4F31B 3OMBA 3MAMA 5ISUA 3VXCA 1JW5A 2DZNB 1L2CA 5E26A 2L7HA 3MP8A 3TTLA 3RGSA 3K6XA 1LGBC 4KYEA 1IQ7A 1OLAA 3L27A 3DP8A 1LAGE 4ZDMA 2C98A 3K2LA 5CC2A 1MQJA 3TTMA 3TPAA 3GLHA 2F7BA 4OVJA 5FHOA 2X8AA 1S50A 1DSNA 3VVDA 4GC5A 1QAMA 4KPTA 5CMKA 2UVJA 4QNMA 3LQQA 4AKHA 1Y9UA 4G77A 4X48A 3FXUA 4OYVA 1ZBMA 3OSRA 1JVYA 4ZZEA 2ZYNA 2ZAOA 2DWNA 4B3RM 3GLBA 4JSDA 1D2NA 1UTBB 2Z8EA 2F7CA 3I4VA 4DV0M 4WKMA 1DGBA 2VP1A 1LV7A 5KPZA 2XF3A 4ECFA 1B0HA 3SARA 4M9SA 2BJWA 1JEVA 1VDDA 3FASA 3U6PA 4MGIE 1WVJA 1UM8A 1NH8A 2FE8A 4LRTA 3W0LB 3Q28A 1N84A 2DVWB 3FTEA 3S9EA 4HS7A 1M5CA 1J7KA 4TLMB 4MF3A 2UVIA 4F22A 3W0FA 2XXQA 4IBDA 2OZZA 4GFRA 2RGHA 1OLCA 3IX1A 2Z4SA 1XVXA 1SYIA 4OFJA 5JI2E 1OJLA 4I8CA 3K1PA 3KFMA 8CATA 2F8DA 4YICA 5B70A 1R1NA 2YNMD 3K4UA 4RK2A 3UK6A 3GQ4A 4RNAA 4F18A 2F6GA 2VD3A 2D21A 5KZTA 1EZ9A 1DGFA 1IQPA 4LZ7A 3HJ8A 2GH9A 4PD2A 4FW9A 1AMFA 2XXWA 3DLNA 1NJGA 1TH3A 3VXBA 2GFEA 1UIUA 1B3HA 5KPRA 1B58A 2XZFA 2D5WA 4F2OA 3FIRA 1MPDA 3WHKA 1USYE 3PUWE 2HCBA 4NTLA 4OQOA 3MPLA 4Z6YA 5EP1A 4AQYM 3HO7A 4OX9M 4ESXA 1SW4A 2QL3A 3HPIA 4DV7M 3UORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUJ A;  3C35 A;  4FAT A;  4PFU A;  1VFD A;  2QPQ A;  2OJT A;  1YAE A;  2HAU A;  3O28 A;  3IAZ A;  3T96 B;  4IGT A;  2GRV A;  4LQ2 A;  2ONR A;  3SEX A;  1M5B A;  1QVS A;  1VSO A;  4DXU A;  2Y7K A;  5L8D A;  3HCQ A;  4R9F A;  2RF1 A;  4R73 A;  4ND9 A;  3K00 A;  4JB7 A;  2DWI A;  4IY5 A;  3S2V A;  1FCK A;  3ODB A;  1ZLQ A;  3IOV A;  3G3G A;  1LFI A;  1OQH A;  1MQH A;  3PPQ A;  5AE4 A;  1FTM A;  5DT6 A;  1KWH A;  3H6T A;  2I3V A;  2PT1 A;  3EHU A;  3H6W A;  4N13 A;  4Q5T A;  3VDF A;  2P1S A;  3N94 A;  1FTL A;  4IO7 A;  3IB0 A;  2X26 A;  3MPK A;  3SEY A;  1LFH A;  3IOR A;  5TU0 A;  2A5T A;  3S9M C;  3G3I A;  3K0V A;  2Z23 A;  2HZL A;  4U21 A;  5I57 B;  4HCW A;  3KOS A;  2DE4 A;  3FXQ A;  1MPB A;  1MY3 A;  4KYD A;  2B3B A;  3FZV A;  2AL5 A;  1OVT A;  4C1U A;  2R6G E;  3SKP A;  3RT8 A;  2Z8F A;  1A8F A;  4H5F A;  3KOT A;  1XHY A;  5ICQ A;  1ZJL A;  1MG1 A;  1OVB A;  2PYY A;  4F2Q A;  2OLB A;  3T9U A;  4WEP A;  3PU5 A;  1NNK A;  2I49 A;  4GIZ A;  5I57 A;  4H0W A;  1VE4 A;  4C1T A;  3F11 A;  2QRY A;  4BLA A;  1BP5 A;  1DMB A;  3VE1 B;  1TWY A;  2XD2 A;  2RIN A;  1O64 A;  5AA2 D;  3VVF A;  2ONK E;  1EZO A;  1LAX A;  2XXR A;  3U94 A;  3IL1 B;  1H76 A;  4Z7E A;  2I48 A;  3CI8 A;  3ZSF A;  1URD A;  3EPE A;  2F7A A;  3QIM A;  2OBG A;  3IO4 A;  3T9H B;  1I69 A;  3TEL A;  4DDD A;  2XXI A;  3CVG A;  1B46 A;  2ALU A;  4LUB A;  3WAE A;  3KEI A;  3DM0 A;  4ZED A;  1SBP A;  3EF7 A;  3MVW A;  5AA3 A;  3IR1 A;  4XKR A;  1B52 A;  4XIG Q;  1PC3 A;  1F9B A;  2RC7 A;  3O6G A;  1HSL A;  2G93 A;  2AYS A;  2ZXT A;  4YKK A;  3C33 A;  3GZG A;  1MDQ A;  1SYH A;  3N26 A;  4O3A A;  5H8Q B;  4X9T A;  3MQ9 A;  3A09 A;  1P1Q A;  2H98 A;  2DS9 A;  3PMV A;  3FVN A;  5DVF A;  3VLW A;  1YTV A;  1D3K A;  2ZMB A;  4X1B A;  1B3F A;  4MBP A;  1B5I A;  3QAX A;  5EYF A;  2DSF A;  4ESW A;  4GVO A;  4OTE A;  5CBR A;  2AL4 A;  1B0L A;  1MH3 A;  1AL3 A;  3GXA A;  1B7H A;  3LUY A;  1B5H A;  4C0R A;  2HQ0 A;  3H6U A;  3RQT A;  1B7U A;  1N3X A;  1A54 A;  1YPN A;  1IXC A;  5DTB A;  2PX1 A;  4QFL A;  1CE2 A;  1USY H;  3K1M A;  4PP0 A;  3N6T A;  1A8E A;  2P0S A;  3KJT A;  4IO6 A;  4E0X A;  4NF6 B;  1S9T A;  3O6H A;  1B3E A;  2E0S A;  3B7D A;  2QJE A;  2NUV A;  1B51 A;  4THI A;  1Z7N E;  3FVG A;  3GBA A;  5CMB A;  5KCJ B;  1QUL A;  4LP2 B;  4P11 A;  3SER A;  4I62 A;  4ZEI A;  4TQU Q;  4Z0I A;  4M4G A;  4YB6 A;  5CI5 A;  4RXL A;  4NF6 A;  1URG A;  5ELV A;  4NWC A;  1B5J A;  1BIY A;  4H8J A;  1IIW A;  3ILT B;  4ZE8 A;  3MVY A;  4RK9 A;  2RCA A;  4DZ1 A;  4DCY A;  4R2F A;  5AA4 B;  5KCJ A;  4ELO A;  2V93 A;  2ZNU A;  3BFU A;  1NMU A;  1ELJ A;  4EF1 A;  4POW A;  2ONS A;  3RTW B;  1IXH A;  3SDF A;  3ZKK A;  4M1V A;  5KDT A;  3VLV A;  1QUI A;  1Y1Z A;  4H8I A;  4YKJ A;  5I56 B;  3KG2 A;  3KSX A;  3IK6 B;  3CFX A;  2Y84 A;  4AQ4 A;  3RLF E;  4OFL A;  3TTK A;  1FW0 A;  4U4X A;  3QXM A;  2DE2 A;  3ZS6 A;  2NXO A;  3PPP A;  3H4Z A;  5CMC A;  4XXU A;  5DYH A;  1LBB A;  3TYH A;  3R26 A;  3JZJ A;  2OK2 A;  3U8Q A;  1LB8 A;  2REG A;  2YPN A;  1B05 A;  1MY2 A;  1N7W A;  2ESN A;  3MP1 A;  3TAJ A;  2VOZ A;  4G4P A;  3G7W A;  4G68 C;  4F1Y A;  1P99 A;  3K6U A;  2Y7W A;  5HM4 B;  1JQF A;  4QRZ A;  5I56 A;  3OO8 A;  2NVU B;  2ANJ A;  2XXY A;  5AA2 A;  2UXA A;  3MZB A;  1N3W A;  1Q35 A;  4MFI A;  3OO6 A;  2H4I A;  4F29 A;  1SDX A;  2ZYM A;  2GHB A;  4MH5 A;  3LC8 A;  4ELQ A;  3QUF A;  5TP9 A;  2DYX A;  1T0K A;  3Q25 A;  1RYX A;  3ZKL A;  2F97 A;  3K6W A;  5EHS A;  5H8S A;  4JDF A;  4ZEB A;  4G8N A;  2G29 A;  4H1X A;  4I9D A;  4NE4 A;  4LZ5 A;  1RKM A;  3TKD A;  2V3Q A;  1M5F A;  3ECR A;  3FVO A;  3W9W A;  1POY 1;  4GQO A;  2O7I A;  3O66 A;  1UTH B;  3EHT A;  3FJM A;  2XXP A;  1XC1 A;  3LSX A;  3K6V A;  3KZG A;  5I2N B;  1QUK A;  3OSQ A;  4ZE9 A;  3DEL B;  2UYE A;  4PFW A;  5L9S A;  4BDQ A;  4L17 A;  3TFL A;  1US5 A;  5A5X B;  3MVZ A;  3RTF B;  1NFT A;  1Y4T A;  3RT6 B;  4OFO A;  4FAJ A;  1MXV A;  1UTH A;  4U1Z A;  4IY6 A;  3O97 A;  1NL5 A;  4YMB A;  4OZ9 A;  1OQG A;  3BBR A;  4QSC A;  3HST A;  3JV9 A;  5I2N A;  4H65 A;  4UA8 A;  1FQF A;  1B1X A;  4P0I A;  3IB1 A;  2V3U A;  5JEI A;  4F3B A;  3A3C A;  1JEU A;  4F1V A;  2X7P A;  3MZ1 A;  4K3F A;  2XXV A;  1ZKB A;  4RNS A;  5A5X A;  2THI A;  3TDJ A;  1MY0 A;  1P1W A;  4F39 A;  4R72 A;  4Q30 B;  4N6P A;  2O6A A;  2LAO A;  5I59 B;  4YB5 A;  2I6E A;  2A5T B;  3HHF A;  1NH7 A;  3CFZ A;  3PGF A;  3VV5 A;  3PPO A;  2YLN A;  2DE3 A;  1SW5 A;  1OMP A;  2R71 A;  3R7X A;  5H8N B;  1A40 A;  1QKA A;  4JWO A;  5I84 A;  5J1D A;  2FA7 A;  4GXS B;  3RNN A;  3THI A;  1MS7 A;  4QSD A;  1MXW A;  4U1O A;  2KLF A;  4G2Z A;  3U1O A;  4PFY A;  1LFG A;  3IJO B;  2HZK A;  1MXX A;  2DVC A;  4GL0 A;  5I59 A;  2QMX A;  3BKI B;  1MXZ A;  3T93 B;  4G8M A;  2XXH A;  3MZ9 A;  4R6Y A;  4OMB A;  4F3S A;  1SI0 A;  1FTJ A;  1ANF A;  2GHA A;  2DVZ A;  3TEP A;  3WAF A;  3A3U A;  2OWS A;  4DIG A;  1CB6 A;  5H8N A;  4KI0 E;  3OXN A;  1Y4C A;  3MWB A;  3AXF A;  2DQV A;  4QFP A;  3E4R A;  3FD3 A;  3U72 A;  1FQC A;  1LB9 A;  3RUM A;  2O1L A;  3MJN A;  3CG3 A;  1DTG A;  4ELR A;  3I5O A;  3EHS A;  2DOJ A;  4F19 A;  3PPN A;  4KHZ E;  1IUD A;  4RJZ A;  3N6U A;  1EZP A;  1AOV A;  4ZEF A;  2HAV A;  5IAI A;  5I58 A;  4ISU A;  3L6H A;  1YCJ A;  2O84 X;  4AB5 A;  1PB7 A;  1EH3 A;  1B32 A;  3OD7 A;  4DXB A;  4IO4 A;  1SQY A;  3G3J A;  1A55 A;  1I6A A;  4R6H A;  1P1U A;  2B3F A;  4QSE A;  4KCD A;  1M5D A;  1O63 A;  2HXW A;  1PB9 A;  3MVX A;  3UA8 A;  1GV8 A;  3RY3 A;  1BTJ A;  3QYT A;  4FIM A;  3QK6 A;  4NF8 A;  4NF4 B;  1B3G A;  1B9J A;  1B2H A;  1IZ1 A;  1S7Y A;  4NMY A;  4JXI A;  4DXC A;  3PD8 A;  1VR5 A;  3U93 A;  3Q26 A;  1ATG A;  3O6I A;  1B40 A;  3MBP A;  4BDR A;  4U22 A;  4X1D A;  1FTK A;  2UVG A;  2XX7 A;  3JYR A;  1LBC A;  3N5L A;  4FED A;  4NF4 A;  1JVX A;  4NED A;  4F1U A;  2FYI A;  1P1O A;  1LLS A;  3DP4 A;  3OEL A;  4H67 A;  1B3L A;  1H44 A;  5K2X A;  2UYF A;  4LQ5 A;  2AIX A;  1SW2 A;  2V84 A;  3RN8 A;  5DEX A;  1SI1 A;  4WXJ A;  3V83 A;  5L9M A;  4OEU A;  1H3D A;  3TTR A;  3LSW A;  2ABH A;  3KJ7 A;  3S4U A;  2QS2 A;  5HBC A;  4OHN A;  4XTC Q;  2XX8 A;  2I4C A;  4LZ8 A;  4YMA A;  3MW0 A;  4MLV A;  3C9H A;  2V3T A;  3KBR A;  5FHM A;  4E0W A;  3M3K A;  2DXR A;  2PVU A;  4QFO A;  4R9G A;  3W9V A;  5I2K A;  1WOD A;  1XOC A;  3CSG A;  3LBS A;  1FTO A;  2RCB A;  3O9P A;  2O68 A;  3FAT A;  5TPA A;  4XKQ A;  4P0G A;  3I3V A;  1URS A;  1AH5 A;  2H5Y A;  4ZEC A;  2B65 A;  2DXY A;  3B6T A;  4OEN A;  1A99 A;  2PT2 A;  3PPR A;  5CRY A;  1MRP A;  4YU0 A;  3C31 A;  5KDT B;  4RPO A;  2QMW A;  1UQW A;  4IO2 A;  2ZNT A;  3IJX B;  3H6V A;  4GRK A;  3UK4 A;  3PUX E;  3T22 A;  5FTI A;  5JTY A;  2XXT A;  1O7T A;  4FJP A;  2Q8J A;  3TCF A;  5ITP A;  3R6U A;  1NNP A;  1R9L A;  5LOM A;  4F3G A;  5F1Q A;  3K02 A;  3TQW A;  4DCX A;  1N04 A;  3IOW A;  2XXX A;  5BUU A;  4GXA A;  4FEC A;  2Q89 A;  2F35 A;  3D4C A;  3KN8 A;  5AA2 B;  3O2A A;  5H8F B;  4KQP A;  5K2Y A;  2Y7I A;  2H99 A;  3MC2 A;  4KFQ A;  1MY1 A;  2Y7R A;  1MXY A;  2DP8 A;  5TP9 B;  1WDN A;  3KN3 A;  3VLU A;  3HV1 A;  1Y3P A;  1Q1K A;  3O29 A;  3OOA A;  3FV2 A;  1PBQ A;  4QFK A;  3SEW A;  4G68 A;  3CSB A;  1II5 A;  4OWD A;  5H8F A;  3UIF A;  2M8C A;  3W15 C;  1US4 A;  1LAF E;  4U2R A;  4OEV A;  4EXL A;  1MPC A;  4KYS A;  1PB8 A;  1B1H A;  3ILU B;  5EHM A;  1FQA A;  3FUZ A;  3L6G A;  3FV1 A;  4YAH X;  1NKX A;  3K01 A;  2Q2C A;  3BFT A;  2F78 A;  1XS5 A;  3VVE A;  3C34 A;  1IEJ A;  3T9X B;  3FGS A;  3PUY E;  1I6Q A;  3RGY A;  2H9B A;  2I4B A;  4ELP A;  5BWJ A;  3H7M A;  1H43 A;  1XVY A;  3PMW A;  1NNT A;  2HEU A;  3SET A;  1BKA A;  1R6Z A;  1BLF A;  4QHQ A;  4BDN A;  4PQJ A;  1JNF A;  1MY4 A;  2D3I A;  4EF2 A;  2O1M A;  2OWT A;  2ZNS A;  3DP6 A;  1D4N A;  1DTZ A;  2O69 A;  1DOT A;  2UVH A;  4FE8 A;  2CZL A;  3SEU A;  3E13 X;  1QJM A;  1JW1 A;  3FXR A;  1UTB A;  3IOU A;  2QS3 A;  1MH4 A;  2DWA A;  4O3C A;  3S9N C;  1LCF A;  1SW1 A;  3USD A;  4GOT A;  2F6P A;  4KD5 A;  1B7Z A;  3PD9 A;  4GWO A;  1B6H A;  1IXI A;  2PBW A;  2IEE A;  3B6W A;  3IOT A;  5B7D A;  5ICT A;  3CR9 A;  5CM6 A;  2X7Q A;  3GBB A;  1LST A;  4JSO A;  1QKB A;  3FJG A;  4ZZA A;  1B4H A;  1TFD A;  4NF5 B;  4Q0C A;  2RC9 A;  4OER A;  1AIV A;  1VFE A;  1DPE A;  3E3K A;  1B4Z A;  2DWJ A;  2E1S A;  3TCG A;  3MP6 A;  4Q8R A;  4RY1 A;  4GL8 A;  3TTN A;  1N0T A;  4AB6 A;  3M3F A;  1D9Y A;  2Q9T A;  1XT8 A;  2PMS A;  3PUZ E;  2F5X A;  3CIJ A;  4BDM A;  3TQL A;  3V8X B;  4NF5 A;  4HW8 A;  2O51 A;  4BDO A;  5M2V A;  4JWX A;  2Q88 A;  4EDP A;  2NWJ A;  1MDP 1;  4TLL B;  1DPP A;  1J1N A;  4U4S A;  1ZMG A;  4EXK A;  3K1N A;  3TMG A;  3MUQ A;  4QFN A;  2XX9 A;  5HPQ A;  1N76 A;  1R9Q A;  5I58 B;  1GVC A;  2Q2A A;  2RC8 A;  2F34 A;  1HSJ A;  2IA4 A;  5FHN A;  1ZU0 A;  4MLQ A;  3SEV A;  4OET A;  1M5E A;  2VHA A;  4PE5 B;  4F3P A;  3V5A A;  3TUS A;  1Y3Q A;  4HTG A;  4R75 A;  1SVX B;  2I58 A;  1LCT A;  4ZEK A;  3KGC A;  2HCA A;  3CG1 A;  5FTH A;  3ONM A;  1HSE A;  4YKP A;  2R9J A;  1LAH E;  3P7I A;  3B6Q A;  4PFT A;  3PUV E;  3HN0 A;  4EQB A;  4RYA A;  4NF8 B;  5DVJ A;  2FNC A;  5H8H B;  2I0C A;  5L9O A;  5ITO A;  1FQB A;  3LR1 A;  3K2D A;  3RPW A;  1Y20 A;  3H06 B;  2A5S A;  3OO9 A;  1MQG A;  2H25 A;  3S9L C;  4OXV A;  3SES A;  3TZA A;  1JET A;  2I0B A;  2V25 A;  1Y1M A;  3VFJ A;  2NOO A;  1L5T A;  3KN7 A;  1D9V A;  4EQ9 A;  3UGW A;  4RPN A;  5H8H A;  3FVK A;  3KSJ A;  1TT1 A;  4XKP A;  2REJ A;  3M8U A;  5CMM A;  1MXU A;  3C4M A;  2W7Y A;  1MQI A;  4DLD A;  1GTK A;  3LSF B;  2XD3 A;  1ZTY A;  2QS1 A;  4R2B A;  4R74 A;  3EQ1 A;  2ZYO A;  3CRB A;  1Y3N A;  5DEX B;  4POX A;  1RYO A;  2YJP A;  3Q27 A;  4N07 A;  4YB7 A;  4ZS9 A;  4IO3 A;  4LON B;  3D4G A;  2WKY A;  4GF8 A;  2XXU A;  3OO7 A;  4YKI A;  2ZYK A;  3C32 A;  4KCC A;  2O7U A;  3E9X A;  4H6D A;  2F36 A;  1PDA A;  2Z8D A;  3I6V A;  3OEK A;  4GD5 A;  3G3F A;  3G3H A;  1POT A;  4I1D A;  5IKB A;  5I2K B;  5CBS A;  3C36 A;  3CFL A;  4G8H A;  2XHD A;  4R6K A;  3UN6 A;  5H8Q A;  4TOZ A;  3HHG A;  1JW4 A;  4JBZ A;  1H45 A;  4WED A;  5TPA B;  3M3L A;  3H03 A;  1IXG A;  2DWH A;  3PV0 E;  4UAC A;  1GR2 A;  4NWD A;  3V89 B;  4YZZ A;  2I3W A;  4U23 A;  3QSL A;  1A7L A;  4IO5 A;  2P2A A;  4EQ7 A;  4EUO A;  5JTY B;  1FQD A;  4IGR A;  4LAT A;  3T9V A;  4O3B A;  4HCY A;  1UIV A;  1GGG A;  1SD3 A;  1TFA A;  4KR5 A;  3EN3 A;  1P1N A;  4LVQ A;  2BJJ X;  1OIB A;  4RA1 A;  4ONY A;  4FEB A;  3IO6 A;  4FOR A;  5DVI A;  4PET A;  4BDL A;  2RKM A;  5JK4 A;  4JWY A;  3TCH A;  2Y7P A;  2HFB A;  1PEB A;  3OEN A;  3OEM A;  1NNF A;  4OES A;  5AA1 A;  2Z22 A;  1N7X A;  1I6B A;  3G3K A;  3FJ7 A;  3UP9 A;  4IB2 A;  1Z7M E;  5F7V A;  1MM6 A;  1ZIU A;  3IB2 A;  1IIT A;  4H5G A;  4LA9 A;  1MM7 A;  4G68 B;  2QS4 A;  1TXF A;  1PBP A;  1FQE A;  3T66 A;  4XKN A;  3TOD A;  2QSX A;  4GLI A;  4DE8 A;  2VGQ A;  2OCU A;  2CMO A;  3PMX A;  3H3G A;  2VD2 A;  3LSL A;  3Q29 A;  1EU8 A;  1MQD A;  3U92 A;  5AA4 A;  3QUJ A;  1QW0 A;  4QF9 A;  4F31 B;  3OMB A;  3MAM A;  5ISU A;  3VXC A;  1JW5 A;  3MP8 A;  3TTL A;  3K6X A;  1LGB C;  4KYE A;  1IQ7 A;  1OLA A;  3DP8 A;  1LAG E;  4ZDM A;  5CC2 A;  1MQJ A;  3TTM A;  3TPA A;  2F7B A;  4OVJ A;  5FHO A;  1S50 A;  1DSN A;  3VVD A;  4KPT A;  5CMK A;  2UVJ A;  1Y9U A;  4G77 A;  4X48 A;  3FXU A;  4OYV A;  1ZBM A;  3OSR A;  1JVY A;  4ZZE A;  2ZYN A;  3GLB A;  4JSD A;  1UTB B;  2Z8E A;  2F7C A;  4WKM A;  2VP1 A;  4ECF A;  1B0H A;  1JEV A;  3FAS A;  1WVJ A;  1NH8 A;  3Q28 A;  1N84 A;  3S9E A;  4HS7 A;  1M5C A;  4TLM B;  4MF3 A;  2UVI A;  4F22 A;  2XXQ A;  2OZZ A;  4GFR A;  1OLC A;  3IX1 A;  1XVX A;  1SYI A;  4OFJ A;  4I8C A;  3K1P A;  3KFM A;  2F8D A;  4YIC A;  5B70 A;  1R1N A;  3K4U A;  4RK2 A;  4F18 A;  2F6G A;  2VD3 A;  2D21 A;  5KZT A;  1EZ9 A;  4LZ7 A;  2GH9 A;  1AMF A;  2XXW A;  3DLN A;  3VXB A;  2GFE A;  1UIU A;  1B3H A;  1B58 A;  2D5W A;  4F2O A;  3FIR A;  1MPD A;  1USY E;  3PUW E;  4NTL A;  4OQO A;  3MPL A;  3HO7 A;  4ESX A;  1SW4 A;  2QL3 A;  3HPI A;  3UOR A; 
#chains in the Genus database with same CATH topology
 1NO1 A;  1QUJ A;  3C35 A;  4BBA A;  4FAT A;  4G4R A;  4PFU A;  1VFD A;  2QPQ A;  2OJT A;  2Q8M A;  2G8L A;  4Y28 F;  1YAE A;  2HAU A;  3GRV A;  3O28 A;  3IAZ A;  3T96 B;  1OFI A;  2CHQ A;  2DWL A;  4WUR A;  4IGT A;  3SAW A;  2GRV A;  4LQ2 A;  2ONR A;  3SEX A;  1M5B A;  1AUA A;  3L26 A;  1QVS A;  1VSO A;  4DXU A;  2Y7K A;  5L8D A;  3HCQ A;  4R9F A;  3MMP A;  2RF1 A;  4HL4 A;  5FTK A;  1DGG A;  4LGY A;  4R73 A;  2CEX A;  4ND9 A;  3SMP A;  3K00 A;  4JB7 A;  2R62 A;  2DWI A;  4IY5 A;  3S2V A;  1FCK A;  3ODB A;  1ZLQ A;  3IOV A;  4LFA M;  4DR2 M;  3G3G A;  3CF0 A;  1LFI A;  1NI9 A;  1FJ9 A;  1OQH A;  4IR8 A;  4LJ4 A;  1MQH A;  3PPQ A;  2KNZ A;  3LVV A;  5AE4 A;  1FTM A;  5DT6 A;  1KWH A;  3H6T A;  2I3V A;  2PT1 A;  4GRI A;  2WZJ A;  3EHU A;  3H6W A;  1LEV A;  4N13 A;  4Q5T A;  1OAO C;  3VDF A;  2P1S A;  3N94 A;  2YQZ A;  4IBB A;  1FTL A;  4IO7 A;  4P17 A;  3IB0 A;  2X26 A;  2LBC A;  3MPK A;  3SEY A;  1LFH A;  5LMU M;  3KC0 A;  1FBF A;  3IOR A;  1N78 A;  5TU0 A;  1YE9 A;  2A5T A;  3HKP A;  2YFQ A;  3GRU A;  1NV6 A;  3S9M C;  3G3I A;  3U6M A;  3K0V A;  2Z23 A;  2HZL A;  4PGN A;  3BIH A;  1XNR M;  1SXJ B;  4U21 A;  2KRK A;  1Q39 A;  5I57 B;  4HCW A;  2WEF A;  3KOS A;  3LVW A;  2DE4 A;  4DBG B;  3K9O A;  1NUZ A;  3FXQ A;  4IBJ A;  1XB2 B;  3WHL A;  2C5R A;  1MPB A;  4AKG A;  1MY3 A;  5DNY A;  2HHH M;  4FCW A;  4KYD A;  2B3B A;  1KA1 A;  3FZV A;  1NHW C;  2AL5 A;  3MK6 A;  1OVT A;  4C1U A;  2R6G E;  3SKP A;  3RT8 A;  3AKZ A;  2Z8F A;  1A8F A;  4H5F A;  4LF6 M;  3KOT A;  4I5S A;  2ERC A;  4M0D A;  1XHY A;  5ICQ A;  1ZJL A;  1MG1 A;  1OVB A;  2PYY A;  5JI3 E;  3J7B A;  4F2Q A;  1TR8 A;  2JWS A;  3SBJ A;  2OLB A;  3A46 A;  4HLQ A;  2D7G A;  3T9U A;  1G8P A;  1GKI A;  4WEP A;  2BWE A;  2CEA A;  3PU5 A;  1NNK A;  2I49 A;  4GIZ A;  5I57 A;  4H0W A;  2M5Z A;  1N34 M;  4P1L A;  1VE4 A;  4L78 A;  2P3N A;  4C1T A;  3F11 A;  3SHG B;  2KQZ A;  2QRY A;  4BLA A;  1BP5 A;  1DMB A;  4M9X A;  4AS5 A;  3VE1 B;  1TWY A;  1FPF A;  2XD2 A;  5IRE B;  2RIN A;  1O64 A;  5AA2 D;  1FBG A;  3FYD A;  4JV5 M;  3FKE A;  4P16 A;  3VVF A;  4B7H A;  2ONK E;  3MJ5 A;  1EZO A;  1LAX A;  2XXR A;  3KP1 E;  2ZZW A;  3U94 A;  2CZH A;  3IL1 B;  4N8G A;  3K92 A;  1H76 A;  4Z7E A;  1Q3C A;  1K9Y A;  2I48 A;  3U6E A;  3CI8 A;  2UXB M;  3ZSF A;  2WSC F;  2RRU A;  1FPK A;  1URD A;  2QVU A;  2OX3 A;  2V1C A;  3EPE A;  2XGN A;  4PCD A;  2F7A A;  3QIM A;  1NY5 A;  2L4F A;  3KOX E;  3IG5 A;  4GH9 A;  2OBG A;  3IO4 A;  3T9H B;  2ZZX A;  4MAG A;  1I69 A;  1PJJ A;  4XF5 A;  4I4L A;  4AI6 A;  4N6D A;  2JZ1 A;  3TEL A;  4DDD A;  1VEG A;  1ZMU A;  2XXI A;  3CVG A;  1KSF X;  2P5T A;  1B46 A;  2ALU A;  4LUB A;  3WAE A;  3KEI A;  3DM0 A;  4ZED A;  1SBP A;  4NSO B;  3EF7 A;  5I3S A;  4G4O A;  3HJQ A;  3MVW A;  5AA3 A;  1ZMV A;  3IR1 A;  4XKR A;  1W5T A;  1R4G A;  4DR3 M;  1B52 A;  4XIG Q;  1D9Q A;  1PC3 A;  1F9B A;  2RC7 A;  3O6G A;  1HSL A;  2G93 A;  2VQF M;  1ZAE A;  2AYS A;  4IBC A;  2DAE A;  3MST A;  2ZXT A;  4JI2 M;  4X04 A;  4YKK A;  5ESY A;  3C33 A;  3GZG A;  1MDQ A;  1SYH A;  3N26 A;  4O3A A;  2LHG A;  1XWI A;  1OTR A;  4X9T A;  1DGH B;  5H8Q B;  2XZU A;  3B74 A;  2WX9 A;  3MQ9 A;  1NV9 A;  3A09 A;  3T1Y M;  1P1Q A;  1P3Q Q;  2H98 A;  2DS9 A;  1VEK A;  3GP1 A;  4TUW A;  3PMV A;  1IN8 A;  2X49 A;  3FVN A;  5DVF A;  3VLW A;  1YTV A;  1D3K A;  4P9K A;  2ZMB A;  3J7A S;  2XWK A;  5EXT A;  4X1B A;  1B3F A;  4MBP A;  3HZJ A;  3GYY A;  3E46 A;  1B5I A;  2JA2 A;  4DUY M;  2RGO A;  1EFU B;  4AW4 A;  3QAX A;  5EYF A;  4MB7 A;  1G0I A;  2NQ8 C;  1RU3 A;  2DSF A;  4ESW A;  4QOS A;  4GVO A;  3GLG B;  3NBI A;  4OTE A;  5CBR A;  2AL4 A;  4XEQ A;  1NV1 A;  1D0K A;  1B0L A;  1MH3 A;  1AL3 A;  1DGH A;  2JZ0 A;  3GXA A;  3TQS A;  4PE3 A;  1G3I A;  2XA5 A;  2ZAM A;  1B7H A;  5EJC A;  3LUY A;  1FBH A;  3HU2 A;  1B5H A;  4C0R A;  2HQ0 A;  4NHB A;  1HQC A;  3H6U A;  3RQT A;  3GLI A;  1B7U A;  1N3X A;  1A54 A;  3SC3 A;  1YPN A;  1IXC A;  5DTB A;  2PX1 A;  3R8F A;  4QFL A;  3SAU A;  3I51 A;  4PFI A;  3TL4 X;  1IMF A;  1CE2 A;  1USY H;  3K1M A;  3C3D A;  3A45 A;  4LRS A;  4PP0 A;  3THG A;  1JP4 A;  3N6T A;  5DYI A;  5LMN M;  3QYB A;  3RGP A;  1A8E A;  3Q8G A;  2MRO B;  2CHG A;  2HHM A;  4W5W A;  2P0S A;  3KJT A;  1IY0 A;  3TWK A;  4L6V 6;  4PFR A;  4IO6 A;  4E0X A;  3VLF B;  2D7E A;  4PF8 A;  4DR4 M;  3D8L A;  3JAM S;  4NF6 B;  5BR8 M;  3UZU A;  1S9T A;  3O6H A;  3AOE C;  3U60 A;  5DW8 A;  1HNZ M;  5A5L A;  1B3E A;  5F3W A;  1AIP C;  4HXV A;  2E0S A;  3B7D A;  3C9P A;  2QJE A;  3IFC A;  4JI4 M;  2NUV A;  3ROJ A;  2OOA A;  1B51 A;  2FFJ A;  4THI A;  1FJG M;  1Z7N E;  2DNA A;  3U61 B;  3FVG A;  1G71 A;  3GBA A;  5CMB A;  5KCJ B;  4MEV A;  3A98 B;  5KPT A;  4B7F A;  1QUL A;  4LP2 B;  2KXE A;  4P11 A;  3GLF B;  4MNP A;  3SER A;  1NV3 A;  4FWH A;  4B3M M;  4I62 A;  4ZEI A;  2ZTD A;  4TQU Q;  2H5X A;  4M4G A;  4Z0I A;  2Q74 A;  4AS4 A;  4YB6 A;  2B3T A;  5CI5 A;  4JI5 M;  4II7 A;  4RXL A;  5IM2 A;  4NF6 A;  2HWJ A;  2QBY A;  1URG A;  4MH0 E;  5ELV A;  4NWC A;  3KDS E;  2UUA M;  1B5J A;  1BIY A;  4GBV A;  4H8J A;  2V1U A;  1IIW A;  2FVZ A;  1FPL A;  3ILT B;  4ZE8 A;  2F4V M;  3GQ5 A;  3MVY A;  3C3E A;  4RK9 A;  2RCA A;  3AV0 A;  5DFL A;  4DCY A;  4DZ1 A;  3BBZ A;  5EP4 A;  4MJO A;  4R2F A;  5AA4 B;  5KCJ A;  1WIV A;  1E32 A;  3HWS A;  1XXH A;  3PTY A;  4ELO A;  3VDU A;  2V93 A;  2ZNU A;  3BFU A;  1NMU A;  1ELJ A;  2KZU A;  1LBX A;  4EF1 A;  3BOS A;  5ITX E;  3L29 A;  4POW A;  2ONS A;  4MGZ E;  3HHX A;  3RTW B;  1GL7 A;  1KYI A;  1IXH A;  3Q8X A;  3SDF A;  3ZKK A;  3QYE A;  4M1V A;  5KDT A;  3VLV A;  4N6K A;  1QUI A;  1Y1Z A;  3KFU G;  4H8I A;  4YKJ A;  5I56 B;  3KG2 A;  3KSX A;  4JI7 M;  4B7G A;  3IK6 B;  1LBV A;  3GLH B;  3CFX A;  4R71 A;  2KZS A;  4NL4 H;  2Y84 A;  4P47 A;  1OIZ A;  3T38 A;  4AQ4 A;  3RLF E;  2GQF A;  2QPA A;  4OFL A;  4MNC A;  2KR0 A;  3TTK A;  1FW0 A;  5EQT A;  2CE7 A;  3NBX X;  3QXM A;  4U4X A;  2DE2 A;  3ZS6 A;  2NXO A;  3PPP A;  4X64 M;  3H4Z A;  5CMC A;  4GX4 A;  4XXU A;  5DYH A;  5FBP A;  1LBB A;  4L15 A;  3TYH A;  2QEN A;  3R26 A;  4OA4 A;  3DZD A;  3RPL B;  4MIJ A;  3JZJ A;  2OK2 A;  3U8Q A;  2QNJ A;  1LB8 A;  2REG A;  2O01 F;  2YPN A;  1B05 A;  4Q7J A;  1MY2 A;  1N7W A;  2ESN A;  1QUS A;  3I4Y A;  3MP1 A;  3TAJ A;  2VOZ A;  4G4P A;  1QVR A;  3G7W A;  4G68 C;  4F1Y A;  4DV4 M;  1P99 A;  3K6U A;  2Y7W A;  5HM4 B;  1JQF A;  4QRZ A;  5I56 A;  3OO8 A;  3QMF A;  2NVU B;  2ANJ A;  4MMP A;  3HU3 A;  1AWB A;  1T43 A;  1UFZ A;  2XXY A;  5AA2 A;  2UXA A;  2AHM A;  3FTF A;  3MZB A;  1N3W A;  1HQY E;  1Q35 A;  2FIE A;  4MFI A;  3OO6 A;  2H4I A;  4F29 A;  1SDX A;  3J81 S;  2Y21 A;  2ZYM A;  1PJT A;  2GHB A;  4MH5 A;  3LC8 A;  1WHC A;  4O8M A;  4ELQ A;  3QUF A;  5TP9 A;  2DYX A;  1T0K A;  3Q25 A;  1Z5C A;  1IM2 A;  1RYX A;  1XXH E;  2UUB M;  3ZKL A;  2O25 A;  3QWL A;  4QNR A;  2F97 A;  3K6W A;  4B3S M;  5EHS A;  1HT2 E;  5H8S A;  1XHB A;  4JDF A;  4ZEB A;  1J09 A;  4G8N A;  5EQA A;  2G29 A;  4H1X A;  4XK8 F;  4I9D A;  4LZ5 A;  4NE4 A;  1RKM A;  3TKD A;  2V3Q A;  1DK4 A;  1M5F A;  3ECR A;  3FVO A;  3VK8 A;  3GPU A;  3W9W A;  1GJT A;  4K0K M;  2R4J A;  3FUX A;  1GL6 A;  5T3J A;  4ANR A;  1FPI A;  3PNY A;  1KZ8 A;  1POY 1;  4GQO A;  1R2Z A;  2O7I A;  3O66 A;  1UTH B;  2C9C A;  3EHT A;  3KS8 A;  3FJM A;  2XXP A;  1XC1 A;  2JUJ A;  3LSX A;  3K6V A;  4PT5 A;  4JI3 M;  3KZG A;  1L2B A;  3EKI A;  2ZBK B;  5I2N B;  1IMC A;  1QUK A;  3OSQ A;  1KFV A;  4ZE9 A;  3DEL B;  2UYE A;  4PFW A;  2C96 A;  1TH4 A;  3FUT A;  4N81 A;  5L9S A;  2EKF A;  4BDQ A;  3FYC A;  4L17 A;  1WGL A;  4LJ7 A;  3TFL A;  1NUY A;  5EXS A;  3L28 A;  2PCR A;  1US5 A;  5A5X B;  2BJI A;  3MVZ A;  1I4W A;  3RTF B;  1NFT A;  2JY5 A;  2DKL A;  1Y4T A;  3RT6 B;  4OFO A;  5EP3 A;  4FAJ A;  3SFZ A;  1MXV A;  4REZ A;  1UTH A;  2C9O A;  4PDH A;  4U1Z A;  4NXN M;  4IY6 A;  3O97 A;  1TH2 A;  2R65 A;  1YYZ A;  1NL5 A;  4RF0 A;  3HHY A;  5ITR A;  4YMB A;  2LVN C;  2HL7 A;  3A29 A;  1QYR A;  3GRY A;  2Y5K A;  4OZ9 A;  1EYI A;  1OQG A;  3BBR A;  4QSC A;  3HST A;  3JV9 A;  5I2N A;  4H65 A;  4P8B A;  4UA8 A;  1FQF A;  2CFO A;  1B1X A;  4P0I A;  3IB1 A;  1QAO A;  4I3E A;  2V3U A;  2Z4R A;  5JEI A;  1EE8 A;  4FD2 A;  3MHV C;  4F3B A;  2M60 A;  3A3C A;  1OKS A;  1JEU A;  4F1V A;  2X7P A;  4D82 A;  3MZ1 A;  4K3F A;  2MH8 A;  2XXV A;  1ZKB A;  4RNS A;  5A5X A;  5ITQ A;  2THI A;  3TDJ A;  2KHH A;  3U6D A;  1MY0 A;  2ZAN A;  3GPX A;  4GHL A;  1L1Z A;  5EYH A;  3H4J A;  4N17 A;  4LF7 M;  1P1W A;  1XI6 A;  4F39 A;  4R72 A;  4Q30 B;  4N6P A;  2O6A A;  3LCU A;  2LAO A;  4A3V B;  4YB5 A;  5I59 B;  2I6E A;  2A5T B;  3HHF A;  1NH7 A;  4GWZ A;  3CFZ A;  1IXR C;  3PGF A;  5EXP A;  3VV5 A;  2LVQ D;  4LF5 M;  2WBB A;  4RF1 A;  3PPO A;  3VDP A;  2YLN A;  2DE3 A;  1SW5 A;  1OMP A;  2R71 A;  3R7X A;  2QQ8 A;  5H8N B;  1A40 A;  1QKA A;  4JWO A;  5I84 A;  5J1D A;  2FA7 A;  5J16 A;  4GXS B;  3RNN A;  3THI A;  1MS7 A;  4QSD A;  4LJA A;  1MXW A;  4U1O A;  1WXQ A;  2KLF A;  4G2Z A;  3U1O A;  3VFD A;  4PFY A;  1DBZ A;  1LFG A;  2X4A A;  3IJO B;  2HZK A;  2QFL A;  1MXX A;  2DVC A;  4GL0 A;  1GLN A;  1K9Z A;  1IY2 A;  4QHS A;  4FWG A;  5I59 A;  3M7G A;  2QMX A;  5I5P A;  3BKI B;  1MXZ A;  1CUK A;  3T93 B;  4G8M A;  2Z8Y M;  3GPY A;  2XXH A;  3MZ9 A;  4R6Y A;  4OMB A;  4F3S A;  3I01 M;  1FBE A;  2CV2 A;  1SI0 A;  1IMB A;  1QAN A;  3ZH9 B;  2DWM A;  1FTJ A;  1ANF A;  2GHA A;  4GKJ M;  2DVZ A;  3TEP A;  3WAF A;  3M6A A;  4ITQ A;  3A3U A;  1NSF A;  2OWS A;  4DIG A;  3PXG A;  1NHG C;  1CB6 A;  5H8N A;  4KT0 F;  4KI0 E;  2XWI A;  3OXN A;  1EIJ A;  4G6Z A;  5DYG A;  1Y4C A;  3MWB A;  3FXB A;  2XFS A;  3AXF A;  2Q2E B;  2DZL A;  2B4M A;  4MM3 B;  2DQV A;  4QFP A;  3E4R A;  3B89 A;  3FD3 A;  3U72 A;  4PAI A;  1IXS A;  1K3X A;  3VKH A;  1FPE A;  1FNN A;  1BK4 A;  1NJF A;  5EQ8 A;  1FQC A;  1LB9 A;  3RUM A;  2O1L A;  3MJN A;  1Q9D A;  3CG3 A;  1DTG A;  4ELR A;  3I5O A;  3EHS A;  4CGY B;  2DOJ A;  3SAV A;  4F19 A;  3PPN A;  4KHZ E;  3AJI B;  4N4U A;  1IN5 A;  4BLC A;  1IUD A;  1FRP A;  4RJZ A;  4HE1 A;  3N6U A;  1SXJ C;  1EZP A;  1AOV A;  4ZEF A;  2HAV A;  4PBH A;  3VK7 A;  4LCB A;  4JI0 M;  5IAI A;  5I58 A;  2RKO A;  4ISU A;  1NV2 A;  3L6H A;  1YCJ A;  1J5E M;  2O84 X;  4AB5 A;  3IFA A;  1PB7 A;  3K8Z A;  4LFB M;  1EH3 A;  1R5L A;  3GPP A;  1B32 A;  3OD7 A;  3FUU A;  4DXB A;  3KBZ A;  4DV6 M;  4IO4 A;  1SQY A;  2UU9 M;  3G3J A;  2XXK A;  1R6B X;  4ZPX A;  3HGI A;  2WBD A;  1A55 A;  1I6A A;  4R6H A;  3U65 A;  4IBG A;  4AZF A;  1XMQ M;  1P1U A;  2B3F A;  3LUZ A;  4QSE A;  1OIP A;  4KCD A;  1M5D A;  2WYP A;  3QAU A;  1O63 A;  2HXW A;  1PB9 A;  2XSZ A;  1ORY B;  3K1J A;  3U5Z B;  1INP A;  3MVX A;  3UA8 A;  1GV8 A;  3RY3 A;  1BTJ A;  1NV7 A;  4PAF A;  2FS1 A;  1TF0 B;  1JR3 E;  2JNH A;  3QYT A;  4IJF A;  4FIM A;  2HAK A;  2I7N A;  4F2L A;  3QK6 A;  4NF8 A;  3FRI A;  4NF4 B;  4JVC A;  1YUB A;  2KNA A;  2QCU A;  4DV2 M;  1B3G A;  2QHO B;  4I81 A;  1B9J A;  5IZ7 D;  1FPG A;  1B2H A;  1IZ1 A;  4R3D A;  1S7Y A;  4NMY A;  4P56 A;  4JXI A;  2LH0 A;  3M0E A;  4DXC A;  4RKU F;  2ZZV A;  3PD8 A;  1VR5 A;  4LG2 A;  3U93 A;  3LW5 F;  1TGU A;  3Q26 A;  1ATG A;  3GRR A;  3VKG A;  2XEP A;  3JR4 A;  4QHT A;  3FBP A;  3O6I A;  3C58 A;  3U5Z A;  1B40 A;  3MBP A;  4U22 A;  4BDR A;  4X1D A;  4BB9 A;  5GKN A;  4EIW A;  1FTK A;  2UVG A;  4IBE A;  2XX7 A;  4AKI A;  3GLI B;  3JYR A;  1EYK A;  2KA6 B;  3U6L A;  4G4Q A;  1LBC A;  3N5L A;  4N8Y A;  4FED A;  4NF4 A;  2PFY A;  1IN6 A;  1JVX A;  4NED A;  4F1U A;  4GHA A;  1P1O A;  1DV0 A;  1SXJ E;  1T6O A;  2DAK A;  1LLS A;  2FYI A;  1Z5B A;  2BJV A;  3B8B A;  3J2P B;  3T1H M;  1QZM A;  3DP4 A;  2LXE A;  3OEL A;  2BNK A;  3FTC A;  4H67 A;  1MJG M;  1B3L A;  2A5Y B;  2CUZ A;  1H44 A;  4NF0 A;  5KQ8 A;  1Z6T A;  5K2X A;  2OWZ A;  2UYF A;  1DCU A;  4LQ5 A;  2AIX A;  1C7Y A;  1SW2 A;  4I3Y A;  2V84 A;  3KOZ E;  3RN8 A;  5DEX A;  1NUW A;  1SI1 A;  3U60 B;  4OW0 A;  1LTM A;  4JYA M;  5LDZ A;  4WXJ A;  3V83 A;  5IZ3 A;  5L9M A;  1JQJ C;  4WW0 A;  4OEU A;  1H3D A;  1JB0 F;  3TTR A;  4CIZ A;  3LSW A;  2ABH A;  4GIT A;  3KJ7 A;  3S4U A;  2QS2 A;  5HBC A;  4OHN A;  4XTC Q;  2XX8 A;  2I4C A;  1YLA A;  5ITX A;  2CEY A;  4LZ8 A;  4YMA A;  3MW0 A;  4MLV A;  3C9H A;  2V3T A;  3KBR A;  2DI0 A;  5FHM A;  4E0W A;  2R46 A;  3M3K A;  4MCO A;  2KW0 A;  4CIS A;  1VEJ A;  2QBY B;  4MHF A;  2F3B A;  3FTD A;  3NOH A;  2DXR A;  2PVU A;  4QFO A;  4R9G A;  3W9V A;  5I2K A;  2Z7J A;  1Q3B A;  1FPB A;  2VDB B;  1WOD A;  1XOC A;  3CSG A;  3LBS A;  4JI6 M;  1FTO A;  2RCB A;  3O9P A;  3HHW A;  4MGH A;  2O68 A;  4NRW A;  3FAT A;  2UUC M;  3AOE A;  1PJQ A;  3ZCB B;  4HE0 A;  5TPA A;  3FUV A;  4XKQ A;  1NVM A;  4P0G A;  3I3V A;  1XXH B;  1URS A;  2WSF F;  4IJE A;  2V4C A;  1AH5 A;  2H5Y A;  4ZEC A;  2B65 A;  2DXY A;  3TWM A;  3B6T A;  4DV1 M;  3SAS A;  4OEN A;  1A99 A;  2PT2 A;  3PPR A;  5CRY A;  1MRP A;  4YU0 A;  3C31 A;  5KDT B;  4IBK A;  4DR5 M;  4RPO A;  2QMW A;  1UQW A;  3E9S A;  4IO2 A;  2WYK A;  2ZNT A;  3GQ3 A;  3IJX B;  3UMM A;  3H6V A;  4GRK A;  4GMQ A;  1JR3 D;  3U6C A;  4PCZ A;  3I04 M;  1Z5A A;  1K3W A;  1L2D A;  1IBL M;  1YZ0 A;  3UK4 A;  3PUX E;  3T22 A;  3MYU A;  3RFW A;  3JR5 A;  1G59 A;  3T15 A;  5FTI A;  4R7G A;  2FBP A;  1PRB A;  2CV1 A;  5JTY A;  2XXT A;  1YSY A;  1O7T A;  4FJP A;  2Q8J A;  3TCF A;  5ITP A;  1TTE A;  3R6U A;  1NNU C;  1NNP A;  4H45 A;  1R9L A;  5LOM A;  4DV5 M;  1IY1 A;  4F3G A;  4KO8 A;  4XFE A;  1FBD A;  5F1Q A;  3K02 A;  4OVZ A;  3TQW A;  2F3D A;  4DCX A;  1N04 A;  3IOW A;  2XXX A;  5BUU A;  4YHH M;  4MGY E;  2O5R A;  4GXA A;  4JXJ A;  3ISP A;  1FTA A;  4FEC A;  1V33 A;  2K6B A;  2Q89 A;  2F35 A;  2VF8 A;  3D4C A;  4PDD A;  1TDH A;  3KN8 A;  5AA2 B;  3O2A A;  5H8F B;  4KQP A;  4M9Z A;  5K2Y A;  2Y7I A;  2H99 A;  3GLG E;  3MC2 A;  3IEC A;  4KFQ A;  1MY1 A;  1PM5 A;  1SXJ D;  3EIH A;  2K9D A;  4M0W A;  2Y7R A;  4B3T M;  4GKK M;  1MXY A;  4QXD A;  1GO5 A;  2QZ4 A;  2OOB A;  2GQ1 A;  2OO9 A;  2DP8 A;  5TP9 B;  1OFH A;  2HKJ A;  1WDN A;  2YR0 A;  5FTM A;  3KN3 A;  3VLU A;  3HV1 A;  1W5S A;  2BWB A;  3E79 A;  1Y3P A;  2D7H A;  1Q1K A;  3O29 A;  3OOA A;  3FV2 A;  1PBQ A;  4QFK A;  4GWX A;  3SEW A;  4GX6 A;  2XSZ D;  2R0I A;  2OPF A;  4G68 A;  3CSB A;  5ET5 A;  1II5 A;  1A5T A;  4OWD A;  5H8F A;  4GBW A;  5I7I A;  3UIF A;  1IMA A;  2DXI A;  1G0H A;  2M8C A;  1S3S A;  3W15 C;  3IG8 A;  1US4 A;  4NGU A;  2DEN A;  1LAF E;  2OQ4 A;  4U2R A;  4OEV A;  3U6S A;  4EXL A;  1MPC A;  3OTO M;  7CAT A;  3W67 A;  4P3L A;  4DR6 M;  4KYS A;  2F5N A;  3E21 A;  1PB8 A;  1N33 M;  1B1H A;  1FPD A;  3ILU B;  1QAQ A;  2F5S A;  5EHM A;  1VQ1 A;  4JN6 A;  1FQA A;  4NAP A;  3FUZ A;  1CNQ A;  2MKZ A;  4X65 M;  3AOG A;  1GJS A;  3L6G A;  3FV1 A;  5E6J A;  1L8Q A;  4YAH X;  1NKX A;  3K01 A;  5EQ9 A;  4DI3 D;  2Q2C A;  3ILK A;  3CHG A;  3BFT A;  1WJ7 A;  2F78 A;  1XS5 A;  2F5P A;  3VVE A;  2VII A;  3UJN A;  2F5Q A;  3AL0 C;  3C34 A;  1IEJ A;  3T1B A;  2EA0 A;  3E78 A;  3GLF E;  3T9X B;  3FGS A;  3PUY E;  1I6Q A;  2JP7 A;  3U6Q A;  3RGY A;  1YXI A;  1KA0 A;  1HNW M;  2H9B A;  2I4B A;  4ELP A;  2KEB A;  5BWJ A;  2DHY A;  3H7M A;  1H43 A;  3TE6 A;  4LFC M;  1XVY A;  4I40 A;  3DFZ A;  3TWL A;  3PMW A;  1NNT A;  2HEU A;  3ZC7 B;  3SET A;  1RDZ A;  1BKA A;  1R6Z A;  1BLF A;  4D80 A;  2EKK A;  4L16 A;  4QHQ A;  4BDN A;  4HE2 A;  4PQJ A;  1JNF A;  1MY4 A;  2D3I A;  4GEW A;  4P1E A;  4LF9 M;  4EF2 A;  2O1M A;  2OWT A;  3DOA A;  2ZNS A;  2FOI C;  1D0M A;  3DP6 A;  1D4N A;  1DTZ A;  2O69 A;  1GVN A;  1DOT A;  2UVH A;  4LJ8 A;  2CZL A;  4FE8 A;  3SEU A;  3E13 X;  2FNA A;  1NY6 A;  5FTL A;  1QJM A;  1JW1 A;  4OVP A;  3FXR A;  1UTB A;  3IOU A;  2QS3 A;  1MH4 A;  2DWA A;  4O3C A;  3S9N C;  1LCF A;  1SW1 A;  1QDT A;  3USD A;  2MR9 A;  1PGY A;  4GOT A;  2F6P A;  2DDK A;  5IWA M;  2VQE M;  3KOY E;  4KD5 A;  1B7Z A;  3PD9 A;  4GWO A;  3CGW A;  4G4N A;  1B6H A;  2V6Z M;  1IXI A;  2PBW A;  2IEE A;  3B6W A;  1IBK M;  3IOT A;  2XH9 A;  5B7D A;  5ICT A;  3ZQJ A;  3CR9 A;  2C99 A;  2K47 A;  5CM6 A;  4X62 M;  4FCV A;  4Z8X A;  1LBY A;  4JVI A;  2X7Q A;  3GBB A;  1LST A;  4JSO A;  1T3T A;  1FBC A;  1QKB A;  3FJG A;  4ZZA A;  2DHR A;  2J7O A;  1B4H A;  1TFD A;  4NF5 B;  4Q0C A;  2EUC A;  2RC9 A;  1MX0 A;  4OER A;  5ET8 A;  1AIV A;  4IBI A;  3EIE A;  5ITY A;  1VFE A;  1DPE A;  3FUW A;  3E3K A;  2L7I A;  1V34 A;  5C1B A;  1G4A E;  2R6F A;  2UXD M;  1B4Z A;  3A42 A;  2DWJ A;  2E1S A;  3MP6 A;  3TCG A;  4Q8R A;  4RY1 A;  4NXM M;  2ZTC A;  4GL8 A;  3TTN A;  1N0T A;  4AB6 A;  3CF2 A;  2WSE F;  3M3F A;  1Y8G A;  5FSW A;  1D9Y A;  2Y20 A;  1Q02 A;  2Q9T A;  1N36 M;  1XT8 A;  4H46 A;  1EYJ A;  2PMS A;  3PUZ E;  2F5X A;  3CIJ A;  4BDM A;  3TQL A;  3V8X B;  4NF5 A;  4HW8 A;  2DWZ B;  2O51 A;  4BDO A;  4LZJ A;  2KRU A;  3R9X B;  4MNI A;  5M2V A;  4XGI A;  4OVQ A;  1IXS B;  2CZK A;  4JWX A;  4FCT A;  2HXR A;  2Q88 A;  4EDP A;  4LGM A;  1NV5 A;  2NWJ A;  5EXX A;  1MDP 1;  3KS4 A;  2L6O A;  4TLL B;  1DPP A;  1J1N A;  4U4S A;  5EYG A;  1ZMG A;  4EXK A;  2R45 A;  3K1N A;  2Z3X A;  3TMG A;  3MUQ A;  3BXW A;  2UXC M;  4QFN A;  1IN7 A;  4OAN A;  2XX9 A;  1JR3 A;  4KOD A;  5HPQ A;  1N76 A;  2P3V A;  1K82 A;  3D8B A;  2KDL A;  2LVO C;  1FSA A;  1R9Q A;  1NV8 A;  5I58 B;  1GVC A;  4QBA A;  2Q2A A;  2RC8 A;  2F34 A;  1HSJ A;  2IA4 A;  5FHN A;  1ZU0 A;  4MLQ A;  1PJI A;  3SEV A;  4OET A;  2CZI A;  2KNV A;  1M5E A;  1N75 A;  3RE8 A;  2FH0 A;  4D81 A;  1IXZ A;  2VHA A;  4PE5 B;  4F3P A;  4OU7 A;  3V5A A;  1TDZ A;  4FWD A;  2JY7 A;  4JVD A;  5EP2 A;  3HHZ A;  1Y3Q A;  3TUS A;  4PGP A;  3SZP A;  4HTG A;  3KC1 A;  4UAB A;  5L8R F;  4R75 A;  4IIW A;  3PNV A;  1SVX B;  3B7Q A;  2I58 A;  1LCT A;  2Y0Q A;  3KGC A;  4ZEK A;  2HCA A;  3CG1 A;  5KO3 A;  5FTH A;  4PDG A;  5H37 D;  1IFY A;  2LWX A;  1LBZ A;  3ONM A;  1HSE A;  4YKP A;  1DO0 A;  1VDW A;  2R9J A;  4NQ8 A;  3V76 A;  1V92 A;  3SYL A;  1LAH E;  3B6Q A;  3P7I A;  4NOO B;  4PFT A;  3PUV E;  3KP0 E;  3HN0 A;  4EQB A;  4RYA A;  4GWS A;  2MGW A;  4NF8 B;  5A2Q S;  1E9S A;  1SXJ A;  5DVJ A;  2FNC A;  5H8H B;  3CTW B;  1F4I A;  2I0C A;  5L9O A;  3LQR A;  5ITO A;  4AG6 A;  2DZO B;  1FQB A;  2CV0 A;  3LR1 A;  3K2D A;  3RPW A;  1Y20 A;  3H06 B;  2A5S A;  4XBO A;  3OO9 A;  4DUZ M;  1MQG A;  3LMM A;  1HT1 E;  2H25 A;  4DI4 B;  3S9L C;  4KHP M;  5FTJ A;  4OXV A;  1ZV1 A;  2CWB A;  3SES A;  5C18 A;  3TZA A;  4G61 A;  1JET A;  1H6U A;  2I0B A;  2V25 A;  3UGJ A;  4KLN A;  1Y1M A;  3FD9 A;  4JI8 M;  1PJS A;  3VFJ A;  2NOO A;  1L5T A;  3FRH A;  5ET6 A;  4L4U A;  3KN7 A;  1FJ6 A;  1D9V A;  4EQ9 A;  4O7I A;  3UGW A;  4RPN A;  1R7R A;  5H8H A;  2XWV A;  4LZZ A;  3FVK A;  4KXP A;  3KSJ A;  3KOW E;  4AG5 A;  1TT1 A;  4XKP A;  2REJ A;  3DA1 A;  1N32 M;  3M8U A;  2EJS A;  5CMM A;  2XLJ A;  2E5L M;  3CF6 E;  3K9P A;  1MXU A;  3C4M A;  2W7Y A;  1GAB A;  1MQI A;  4DLD A;  3FE3 A;  1GTK A;  3KVW A;  3LSF B;  2XD3 A;  1ZTY A;  2QS1 A;  4R2B A;  4R74 A;  4LF4 M;  3EQ1 A;  2QP9 X;  2ZYO A;  1XMO M;  3CRB A;  4JI1 M;  1Z59 A;  1Y3N A;  5DEX B;  1N77 A;  4POX A;  1RYO A;  2B4L A;  2YJP A;  3Q27 A;  4N07 A;  4YB7 A;  1E9R A;  4ZS9 A;  4IO3 A;  4LON B;  5F24 A;  5ITT A;  5IT9 S;  3B7N A;  3D4G A;  1OQY A;  2WKY A;  4CJ6 A;  1IME A;  4GF8 A;  4PC9 A;  2XXU A;  3OO7 A;  5IZ3 B;  2DAG A;  4YKI A;  3F92 A;  1VDL A;  1VG5 A;  4DR7 M;  2ZYK A;  3C32 A;  4KCC A;  4IBF A;  2CRU A;  1E94 E;  2O7U A;  2L4E A;  4NX1 A;  3E9X A;  2CHV A;  3H4M A;  1NNJ A;  4PDI A;  4H6D A;  2EO2 A;  2APL A;  2F36 A;  5ITU A;  1PDA A;  2QVR A;  2Z8D A;  3B7Z A;  1R2Y A;  4LJ9 A;  3I6V A;  3OEK A;  1FBP A;  2JY8 A;  4GD5 A;  1BVS A;  2MJ5 B;  3W68 A;  3G3H A;  4G3O A;  3G3F A;  1POT A;  2G5G X;  4I1D A;  3SYK A;  2VPO A;  3HY5 A;  1MN3 A;  5IKB A;  5I2K B;  4GIP A;  1X37 A;  3C36 A;  5CBS A;  3CFL A;  3B9P A;  4G8H A;  4LF8 M;  1XC8 A;  2XHD A;  4CHT B;  4R6K A;  3UN6 A;  2PFZ A;  3KW6 A;  2ZM6 M;  4PAK A;  1SPI A;  5H8Q A;  4TOZ A;  1XNQ M;  2LTU A;  1JW4 A;  3HHG A;  4N15 A;  4JBZ A;  1H45 A;  4WED A;  5TPA B;  3M3L A;  3H03 A;  1IXG A;  2DWH A;  2XFT A;  4X8R A;  3PV0 E;  4UAC A;  1GR2 A;  2JXN A;  3HJS A;  4NRV A;  4NWD A;  4YY3 M;  2J7N A;  3V89 B;  3HFU A;  2W82 A;  1L1T A;  4OVT A;  4YZZ A;  1NV0 A;  4LY6 A;  3J80 S;  4LJ5 A;  4DR1 M;  2HPG A;  2VT5 A;  2I3W A;  4U23 A;  5EQ7 A;  1QQW A;  4PF6 A;  1G41 A;  4GWU A;  1WR1 B;  3GLG A;  4PBQ A;  3NWL A;  1IBM M;  3QSL A;  1A7L A;  2FIX A;  4IO5 A;  2P2A A;  1SG9 A;  4EQ7 A;  4MGK E;  5JTY B;  4EUO A;  1FQD A;  4LN5 A;  2L09 A;  4IGR A;  3HU1 A;  3U6O A;  3RYD A;  3KXE C;  4LAT A;  2FHY A;  3L25 A;  3T9V A;  4WP2 A;  4O3B A;  4HCY A;  4OVZ B;  5IZZ A;  1UIV A;  1GGG A;  1SD3 A;  1TFA A;  4KR5 A;  3PFI A;  5FLX S;  3EN3 A;  2Y0T A;  1P1N A;  4LVQ A;  2R4E A;  2BJJ X;  1OIB A;  4RA1 A;  4ONY A;  3SAT A;  3T0J A;  4FEB A;  3IO6 A;  4GC9 A;  4S12 A;  4FOR A;  5DVI A;  4PET A;  2QSF X;  4LJ6 A;  4BDL A;  2RKM A;  4B08 A;  3B50 A;  5JK4 A;  3SHF A;  4JWY A;  3TCH A;  5FTN A;  2Y7P A;  4O7M A;  4DV3 M;  2I7P A;  2HFB A;  1PEB A;  2J5Y A;  3OEN A;  1RDX A;  3LV0 A;  4PTK A;  3GLI E;  2LVA A;  3OEM A;  1NNF A;  3TPZ A;  4NSR A;  4OES A;  2F5O A;  2Z22 A;  5AA1 A;  1N7X A;  1I6B A;  2LNH C;  3G3K A;  3FJ7 A;  3UP9 A;  3U61 A;  4IB2 A;  1Z7M E;  1HNX M;  5F7V A;  1MM6 A;  1WGN A;  1ZIU A;  3IB2 A;  1IIT A;  1IN4 A;  4H5G A;  2H1R A;  4LA9 A;  1MM7 A;  3GLF A;  4G68 B;  2QS4 A;  5KQD A;  1TXF A;  1PBP A;  1FQE A;  1I94 M;  3L2A A;  3T66 A;  1HR0 M;  4O94 A;  4XKN A;  1ZQ9 A;  3TOD A;  1HJP A;  4UN2 B;  2VF7 A;  4X66 M;  1DO2 A;  2QSX A;  4GLI A;  5BPV A;  2R8T A;  4F1I A;  4DE8 A;  2VGQ A;  3J27 B;  4QOZ C;  2OCU A;  2CMO A;  1FPJ A;  2R18 A;  3PMX A;  3H3G A;  4FVM A;  4GWY A;  2VD2 A;  3LSL A;  1QUT A;  3PVS A;  1EU8 A;  3Q29 A;  2K0B X;  5IZ1 A;  3GO8 A;  1MQD A;  3U92 A;  4GWW A;  1C1K A;  3AFH A;  5AA4 A;  4I8O A;  3QUJ A;  4L8R C;  1QW0 A;  1QDR A;  4QF9 A;  5ET7 A;  3SMS A;  1MU5 A;  2R44 A;  3OMB A;  4F31 B;  3MAM A;  2N35 A;  5ISU A;  3VXC A;  4OVR A;  1JW5 A;  2DZN B;  1L2C A;  5E26 A;  2L7H A;  3MP8 A;  3D1R A;  3TTL A;  3RGS A;  3K6X A;  3HX3 A;  1LGB C;  4KYE A;  1IQ7 A;  1OLA A;  3L27 A;  3DP8 A;  2L2D A;  1LAG E;  4ZDM A;  2DAI A;  2C98 A;  3K2L A;  3LCV B;  5CC2 A;  1MQJ A;  3TTM A;  3TPA A;  3GLH A;  2F7B A;  2LHC A;  4OVJ A;  1NV4 A;  5FHO A;  2X8A A;  1S50 A;  1DSN A;  3VVD A;  4GC5 A;  1IMD A;  1QAM A;  4KPT A;  5CMK A;  2DAM A;  5IGA A;  2UVJ A;  5LTC A;  4QNM A;  1D0L A;  4NN3 A;  3LQQ A;  4AKH A;  1Y9U A;  4G77 A;  4X48 A;  3FXU A;  3RPL A;  4OYV A;  1ZBM A;  3OSR A;  1JVY A;  4ZZE A;  2ZYN A;  2ZAO A;  2DWN A;  4B3R M;  2JJK A;  3GLB A;  2GNO A;  4JSD A;  1D2N A;  1UTB B;  4N91 A;  2L5V A;  2Z8E A;  2F7C A;  3I4V A;  2XWO A;  1ZMW A;  4DV0 M;  2VPN A;  4WKM A;  2Y5L A;  1DGB A;  2VP1 A;  1LV7 A;  5KPZ A;  2CP8 A;  2XF3 A;  4NC6 A;  4ECF A;  1B0H A;  3SAR A;  4M9S A;  2BJW A;  1JEV A;  1VDD A;  3FAS A;  3U6P A;  4MGI E;  1WVJ A;  1UM8 A;  2QVV A;  1QZE A;  1NH8 A;  2FE8 A;  4LRT A;  3W0L B;  2LVP C;  3Q28 A;  1N84 A;  2DVW B;  3BIG A;  4HEO A;  3FTE A;  4FBP A;  3S9E A;  4HS7 A;  1M5C A;  1J7K A;  1LBW A;  4TLM B;  4MF3 A;  2UVI A;  4F22 A;  3W0F A;  1OAI A;  3IHP A;  2XXQ A;  4IBD A;  1RDY A;  4NG7 A;  2OZZ A;  4GFR A;  2RGH A;  1OLC A;  3IX1 A;  4GX3 A;  2Z4S A;  1XVX A;  1SYI A;  4OFJ A;  4OVS A;  2JY6 B;  1OJL A;  5JI2 E;  4I8C A;  3K1P A;  3KFM A;  8CAT A;  1QGX A;  2F8D A;  4YIC A;  5B70 A;  1R1N A;  2YNM D;  3K4U A;  4RK2 A;  3UK6 A;  3GQ4 A;  4PFB A;  4RNA A;  4F18 A;  3GLH E;  2F6G A;  2VD3 A;  2D21 A;  5KZT A;  1EZ9 A;  1DGF A;  2G3Q A;  1IQP A;  4LZ7 A;  3HJ8 A;  4PD2 A;  2GH9 A;  4FW9 A;  1AMF A;  2XXW A;  3DLN A;  1NJG A;  1TH3 A;  3VXB A;  2GFE A;  1UIU A;  1B3H A;  5KPR A;  1B58 A;  2XZF A;  2D5W A;  4F2O A;  3FIR A;  1MPD A;  3WHK A;  1USY E;  3PUW E;  1NUX A;  2HCB A;  4NTL A;  4OQO A;  3MPL A;  4Z6Y A;  3T6P A;  4MX6 A;  5EP1 A;  4AQY M;  3HO7 A;  4OX9 M;  4ESX A;  1SW4 A;  2QL3 A;  3HPI A;  4DV7 M;  3UOR A; 
#chains in the Genus database with same CATH homology
 1QUJ A;  3C35 A;  4BBA A;  4FAT A;  4G4R A;  4PFU A;  1VFD A;  2QPQ A;  2OJT A;  2G8L A;  1YAE A;  2HAU A;  3GRV A;  3O28 A;  3IAZ A;  3T96 B;  1OFI A;  2CHQ A;  2DWL A;  4WUR A;  4IGT A;  3SAW A;  2GRV A;  4LQ2 A;  2ONR A;  3SEX A;  1M5B A;  3L26 A;  1QVS A;  1VSO A;  4DXU A;  2Y7K A;  5L8D A;  3HCQ A;  4R9F A;  2RF1 A;  4HL4 A;  5FTK A;  1DGG A;  4LGY A;  4R73 A;  4ND9 A;  3SMP A;  3K00 A;  4JB7 A;  2R62 A;  2DWI A;  4IY5 A;  3S2V A;  1FCK A;  3ODB A;  1ZLQ A;  3IOV A;  4LFA M;  4DR2 M;  3G3G A;  3CF0 A;  1LFI A;  1OQH A;  4LJ4 A;  1MQH A;  3PPQ A;  3LVV A;  5AE4 A;  1FTM A;  5DT6 A;  1KWH A;  3H6T A;  2I3V A;  2PT1 A;  4GRI A;  3EHU A;  3H6W A;  4N13 A;  4Q5T A;  3VDF A;  2P1S A;  3N94 A;  2YQZ A;  4IBB A;  1FTL A;  4IO7 A;  3IB0 A;  2X26 A;  3MPK A;  3SEY A;  1LFH A;  5LMU M;  3IOR A;  1N78 A;  5TU0 A;  1YE9 A;  2A5T A;  3HKP A;  2YFQ A;  3GRU A;  3S9M C;  3G3I A;  3U6M A;  3K0V A;  2Z23 A;  2HZL A;  1XNR M;  1SXJ B;  4U21 A;  2KRK A;  1Q39 A;  5I57 B;  4HCW A;  3KOS A;  3LVW A;  2DE4 A;  3FXQ A;  4IBJ A;  3WHL A;  2C5R A;  1MPB A;  4AKG A;  1MY3 A;  5DNY A;  2HHH M;  4FCW A;  4KYD A;  2B3B A;  3FZV A;  1NHW C;  2AL5 A;  3MK6 A;  1OVT A;  4C1U A;  2R6G E;  3SKP A;  3RT8 A;  3AKZ A;  2Z8F A;  1A8F A;  4H5F A;  4LF6 M;  3KOT A;  4I5S A;  2ERC A;  4M0D A;  1XHY A;  5ICQ A;  1ZJL A;  1MG1 A;  1OVB A;  2PYY A;  5JI3 E;  3J7B A;  4F2Q A;  3SBJ A;  2OLB A;  3A46 A;  4HLQ A;  2D7G A;  3T9U A;  1G8P A;  1GKI A;  4WEP A;  2CEA A;  3PU5 A;  1NNK A;  2I49 A;  4GIZ A;  5I57 A;  4H0W A;  2M5Z A;  1N34 M;  1VE4 A;  4L78 A;  4C1T A;  3F11 A;  3SHG B;  2QRY A;  4BLA A;  1BP5 A;  1DMB A;  4M9X A;  3VE1 B;  1TWY A;  2XD2 A;  5IRE B;  2RIN A;  1O64 A;  5AA2 D;  3FYD A;  4JV5 M;  3FKE A;  4P16 A;  3VVF A;  4B7H A;  2ONK E;  3MJ5 A;  1EZO A;  1LAX A;  2XXR A;  3KP1 E;  3U94 A;  3IL1 B;  3K92 A;  1H76 A;  4Z7E A;  1Q3C A;  2I48 A;  3CI8 A;  3U6E A;  2UXB M;  3ZSF A;  1URD A;  2V1C A;  3EPE A;  2XGN A;  2F7A A;  3QIM A;  1NY5 A;  3KOX E;  3IG5 A;  4GH9 A;  2OBG A;  3IO4 A;  3T9H B;  1I69 A;  1PJJ A;  4I4L A;  4AI6 A;  3TEL A;  4DDD A;  2XXI A;  3CVG A;  1KSF X;  2P5T A;  1B46 A;  2ALU A;  4LUB A;  3WAE A;  3KEI A;  3DM0 A;  4ZED A;  1SBP A;  4NSO B;  3EF7 A;  4G4O A;  3HJQ A;  3MVW A;  5AA3 A;  3IR1 A;  4XKR A;  1W5T A;  4DR3 M;  1B52 A;  4XIG Q;  1PC3 A;  1F9B A;  2RC7 A;  3O6G A;  1HSL A;  2G93 A;  2VQF M;  1ZAE A;  2AYS A;  4IBC A;  2ZXT A;  4JI2 M;  4YKK A;  3C33 A;  3GZG A;  1MDQ A;  1SYH A;  3N26 A;  4O3A A;  1XWI A;  5H8Q B;  4X9T A;  1DGH B;  2XZU A;  3MQ9 A;  3A09 A;  3T1Y M;  1P1Q A;  2H98 A;  2DS9 A;  3GP1 A;  4TUW A;  3PMV A;  1IN8 A;  2X49 A;  3FVN A;  5DVF A;  3VLW A;  1YTV A;  1D3K A;  2ZMB A;  3J7A S;  5EXT A;  4X1B A;  1B3F A;  4MBP A;  1B5I A;  2JA2 A;  4DUY M;  2RGO A;  4AW4 A;  3QAX A;  5EYF A;  4MB7 A;  2NQ8 C;  2DSF A;  4ESW A;  4QOS A;  4GVO A;  3GLG B;  3NBI A;  4OTE A;  5CBR A;  2AL4 A;  1B0L A;  1MH3 A;  1AL3 A;  1DGH A;  3GXA A;  3TQS A;  1G3I A;  2ZAM A;  1B7H A;  5EJC A;  3LUY A;  3HU2 A;  1B5H A;  4C0R A;  2HQ0 A;  1HQC A;  3H6U A;  3RQT A;  3GLI A;  1B7U A;  1N3X A;  1A54 A;  3SC3 A;  1YPN A;  1IXC A;  5DTB A;  2PX1 A;  3R8F A;  4QFL A;  3SAU A;  3I51 A;  3TL4 X;  1CE2 A;  1USY H;  3K1M A;  3A45 A;  4LRS A;  4PP0 A;  3THG A;  3N6T A;  5DYI A;  5LMN M;  3RGP A;  1A8E A;  2CHG A;  2P0S A;  4W5W A;  3KJT A;  1IY0 A;  3TWK A;  4IO6 A;  4E0X A;  3VLF B;  2D7E A;  4DR4 M;  3D8L A;  3JAM S;  4NF6 B;  5BR8 M;  3UZU A;  1S9T A;  3O6H A;  3AOE C;  3U60 A;  1HNZ M;  1B3E A;  5F3W A;  2E0S A;  3B7D A;  2QJE A;  4JI4 M;  2NUV A;  1B51 A;  2FFJ A;  4THI A;  1FJG M;  1Z7N E;  3U61 B;  3FVG A;  3GBA A;  5CMB A;  5KCJ B;  3A98 B;  5KPT A;  4B7F A;  1QUL A;  4LP2 B;  2KXE A;  4P11 A;  3GLF B;  3SER A;  4FWH A;  4B3M M;  4I62 A;  4ZEI A;  4TQU Q;  4Z0I A;  4M4G A;  4YB6 A;  5CI5 A;  4JI5 M;  4II7 A;  4RXL A;  4NF6 A;  2QBY A;  1URG A;  4MH0 E;  5ELV A;  4NWC A;  3KDS E;  2UUA M;  1B5J A;  1BIY A;  4H8J A;  2V1U A;  1IIW A;  3ILT B;  4ZE8 A;  2F4V M;  3GQ5 A;  3MVY A;  4RK9 A;  2RCA A;  3AV0 A;  4DZ1 A;  4DCY A;  5EP4 A;  4R2F A;  5AA4 B;  5KCJ A;  1E32 A;  3HWS A;  1XXH A;  4ELO A;  3VDU A;  2V93 A;  2ZNU A;  3BFU A;  1NMU A;  1ELJ A;  2KZU A;  4EF1 A;  3BOS A;  5ITX E;  3L29 A;  4POW A;  2ONS A;  4MGZ E;  3HHX A;  3RTW B;  1GL7 A;  1KYI A;  1IXH A;  3Q8X A;  3SDF A;  3ZKK A;  4M1V A;  5KDT A;  3VLV A;  1QUI A;  1Y1Z A;  3KFU G;  4H8I A;  4YKJ A;  5I56 B;  3KG2 A;  3KSX A;  4JI7 M;  4B7G A;  3IK6 B;  3GLH B;  3CFX A;  2Y84 A;  2KZS A;  4NL4 H;  3T38 A;  4AQ4 A;  3RLF E;  2QPA A;  4OFL A;  3TTK A;  1FW0 A;  5EQT A;  2CE7 A;  4U4X A;  3QXM A;  2DE2 A;  3ZS6 A;  2NXO A;  3PPP A;  4X64 M;  3H4Z A;  5CMC A;  4XXU A;  5DYH A;  1LBB A;  4L15 A;  3TYH A;  2QEN A;  3R26 A;  3DZD A;  3JZJ A;  2OK2 A;  3U8Q A;  1LB8 A;  2REG A;  2YPN A;  1B05 A;  1MY2 A;  1N7W A;  2ESN A;  3I4Y A;  3MP1 A;  3TAJ A;  2VOZ A;  4G4P A;  1QVR A;  3G7W A;  4G68 C;  4F1Y A;  4DV4 M;  1P99 A;  3K6U A;  2Y7W A;  5HM4 B;  1JQF A;  4QRZ A;  5I56 A;  3OO8 A;  2NVU B;  2ANJ A;  3HU3 A;  2XXY A;  5AA2 A;  2UXA A;  2AHM A;  3FTF A;  3MZB A;  1N3W A;  1HQY E;  1Q35 A;  4MFI A;  3OO6 A;  2H4I A;  4F29 A;  1SDX A;  3J81 S;  2Y21 A;  2ZYM A;  2GHB A;  4MH5 A;  3LC8 A;  4ELQ A;  3QUF A;  5TP9 A;  2DYX A;  1T0K A;  3Q25 A;  1Z5C A;  1IM2 A;  1RYX A;  2UUB M;  3ZKL A;  3QWL A;  4QNR A;  2F97 A;  3K6W A;  4B3S M;  5EHS A;  1HT2 E;  5H8S A;  1XHB A;  4JDF A;  4ZEB A;  1J09 A;  4G8N A;  2G29 A;  4H1X A;  4I9D A;  4NE4 A;  4LZ5 A;  1RKM A;  3TKD A;  2V3Q A;  1M5F A;  3ECR A;  3FVO A;  3VK8 A;  3GPU A;  3W9W A;  2R4J A;  3FUX A;  4K0K M;  1GL6 A;  3PNY A;  1POY 1;  4GQO A;  1R2Z A;  2O7I A;  3O66 A;  1UTH B;  2C9C A;  3EHT A;  3KS8 A;  3FJM A;  2XXP A;  1XC1 A;  3LSX A;  3K6V A;  4PT5 A;  4JI3 M;  3KZG A;  1L2B A;  2ZBK B;  5I2N B;  1QUK A;  3OSQ A;  1KFV A;  4ZE9 A;  3DEL B;  2UYE A;  4PFW A;  2C96 A;  1TH4 A;  3FUT A;  5L9S A;  4BDQ A;  3FYC A;  4L17 A;  4LJ7 A;  3TFL A;  5EXS A;  3L28 A;  1US5 A;  5A5X B;  3MVZ A;  1I4W A;  3RTF B;  1NFT A;  1Y4T A;  3RT6 B;  4OFO A;  5EP3 A;  4FAJ A;  3SFZ A;  1MXV A;  4REZ A;  1UTH A;  2C9O A;  4U1Z A;  4NXN M;  4IY6 A;  3O97 A;  1TH2 A;  2R65 A;  1NL5 A;  4RF0 A;  3HHY A;  5ITR A;  4YMB A;  2HL7 A;  1QYR A;  3GRY A;  4OZ9 A;  1OQG A;  3BBR A;  4QSC A;  3HST A;  3JV9 A;  5I2N A;  4H65 A;  4UA8 A;  1FQF A;  2CFO A;  1B1X A;  4P0I A;  3IB1 A;  1QAO A;  2V3U A;  2Z4R A;  5JEI A;  1EE8 A;  4FD2 A;  3MHV C;  4F3B A;  2M60 A;  3A3C A;  1JEU A;  4F1V A;  2X7P A;  4D82 A;  3MZ1 A;  4K3F A;  2XXV A;  1ZKB A;  4RNS A;  5A5X A;  5ITQ A;  2THI A;  3TDJ A;  3U6D A;  1MY0 A;  2ZAN A;  3GPX A;  4GHL A;  1L1Z A;  4LF7 M;  1P1W A;  4F39 A;  4R72 A;  4Q30 B;  4N6P A;  2O6A A;  2LAO A;  4A3V B;  4YB5 A;  5I59 B;  2I6E A;  2A5T B;  3HHF A;  1NH7 A;  3CFZ A;  1IXR C;  3PGF A;  5EXP A;  3VV5 A;  4LF5 M;  3PPO A;  4RF1 A;  3VDP A;  2YLN A;  2DE3 A;  1SW5 A;  1OMP A;  2R71 A;  3R7X A;  5H8N B;  1A40 A;  1QKA A;  4JWO A;  5I84 A;  5J1D A;  2FA7 A;  4GXS B;  3RNN A;  3THI A;  1MS7 A;  4QSD A;  4LJA A;  1MXW A;  4U1O A;  1WXQ A;  2KLF A;  4G2Z A;  3U1O A;  3VFD A;  4PFY A;  1LFG A;  2X4A A;  3IJO B;  2HZK A;  1MXX A;  2DVC A;  4GL0 A;  1GLN A;  1IY2 A;  4QHS A;  4FWG A;  5I59 A;  3M7G A;  2QMX A;  3BKI B;  1MXZ A;  3T93 B;  4G8M A;  3GPY A;  2XXH A;  3MZ9 A;  4R6Y A;  4OMB A;  4F3S A;  2CV2 A;  1SI0 A;  1QAN A;  3ZH9 B;  2DWM A;  1FTJ A;  1ANF A;  2GHA A;  4GKJ M;  2DVZ A;  3TEP A;  3WAF A;  3M6A A;  4ITQ A;  3A3U A;  1NSF A;  2OWS A;  4DIG A;  3PXG A;  1NHG C;  1CB6 A;  5H8N A;  4KI0 E;  3OXN A;  4G6Z A;  5DYG A;  1Y4C A;  3MWB A;  2XFS A;  3AXF A;  2Q2E B;  4MM3 B;  2DQV A;  4QFP A;  3E4R A;  3FD3 A;  3U72 A;  1K3X A;  3VKH A;  1FNN A;  1NJF A;  1FQC A;  1LB9 A;  3RUM A;  2O1L A;  3MJN A;  3CG3 A;  1DTG A;  4ELR A;  3I5O A;  3EHS A;  4CGY B;  2DOJ A;  3SAV A;  4F19 A;  3PPN A;  4KHZ E;  3AJI B;  1IN5 A;  4BLC A;  1IUD A;  4RJZ A;  3N6U A;  1SXJ C;  1EZP A;  1AOV A;  4ZEF A;  2HAV A;  3VK7 A;  4LCB A;  4JI0 M;  5IAI A;  5I58 A;  2RKO A;  4ISU A;  3L6H A;  1YCJ A;  1J5E M;  2O84 X;  4AB5 A;  1PB7 A;  3K8Z A;  4LFB M;  1EH3 A;  3GPP A;  1B32 A;  3OD7 A;  3FUU A;  4DXB A;  4DV6 M;  4IO4 A;  1SQY A;  2UU9 M;  3G3J A;  1R6B X;  4ZPX A;  3HGI A;  1A55 A;  1I6A A;  4R6H A;  4IBG A;  4AZF A;  1XMQ M;  1P1U A;  2B3F A;  4QSE A;  4KCD A;  1M5D A;  3QAU A;  1O63 A;  2HXW A;  1PB9 A;  2XSZ A;  1ORY B;  3K1J A;  3U5Z B;  3MVX A;  3UA8 A;  1GV8 A;  3RY3 A;  1BTJ A;  3QYT A;  4IJF A;  4FIM A;  3QK6 A;  2I7N A;  4NF8 A;  4NF4 B;  1YUB A;  2QCU A;  4DV2 M;  1B3G A;  4I81 A;  1B9J A;  5IZ7 D;  1B2H A;  1IZ1 A;  4R3D A;  1S7Y A;  4NMY A;  4JXI A;  2LH0 A;  3M0E A;  4DXC A;  3PD8 A;  1VR5 A;  4LG2 A;  3U93 A;  1TGU A;  3Q26 A;  1ATG A;  3GRR A;  3VKG A;  2XEP A;  3JR4 A;  4QHT A;  3O6I A;  3C58 A;  3U5Z A;  1B40 A;  3MBP A;  4U22 A;  4BDR A;  4X1D A;  4BB9 A;  5GKN A;  4EIW A;  1FTK A;  2UVG A;  4IBE A;  2XX7 A;  4AKI A;  3GLI B;  3JYR A;  2KA6 B;  3U6L A;  4G4Q A;  1LBC A;  3N5L A;  4FED A;  4NF4 A;  1IN6 A;  1JVX A;  4NED A;  4F1U A;  4GHA A;  1P1O A;  2FYI A;  1SXJ E;  1LLS A;  1Z5B A;  2BJV A;  3J2P B;  3T1H M;  1QZM A;  3DP4 A;  2LXE A;  3OEL A;  2BNK A;  3FTC A;  4H67 A;  1B3L A;  2A5Y B;  2CUZ A;  1H44 A;  5KQ8 A;  1Z6T A;  5K2X A;  2UYF A;  4LQ5 A;  2AIX A;  1SW2 A;  2V84 A;  3KOZ E;  3RN8 A;  5DEX A;  1SI1 A;  3U60 B;  4OW0 A;  4JYA M;  4WXJ A;  3V83 A;  5L9M A;  1JQJ C;  4WW0 A;  4OEU A;  1H3D A;  3TTR A;  3LSW A;  2ABH A;  4GIT A;  3KJ7 A;  3S4U A;  2QS2 A;  5HBC A;  4OHN A;  4XTC Q;  2XX8 A;  2I4C A;  5ITX A;  4LZ8 A;  4YMA A;  3MW0 A;  4MLV A;  3C9H A;  2V3T A;  3KBR A;  5FHM A;  4E0W A;  2R46 A;  3M3K A;  2KW0 A;  4CIS A;  2QBY B;  3FTD A;  2DXR A;  2PVU A;  4QFO A;  4R9G A;  3W9V A;  5I2K A;  2Z7J A;  1Q3B A;  1WOD A;  1XOC A;  3CSG A;  3LBS A;  4JI6 M;  1FTO A;  2RCB A;  3O9P A;  3HHW A;  4MGH A;  2O68 A;  4NRW A;  3FAT A;  2UUC M;  3AOE A;  3ZCB B;  5TPA A;  3FUV A;  4XKQ A;  1NVM A;  4P0G A;  3I3V A;  1XXH B;  1URS A;  4IJE A;  1AH5 A;  2H5Y A;  4ZEC A;  2B65 A;  2DXY A;  3TWM A;  3B6T A;  4DV1 M;  3SAS A;  4OEN A;  1A99 A;  2PT2 A;  3PPR A;  5CRY A;  1MRP A;  4YU0 A;  3C31 A;  5KDT B;  4IBK A;  4DR5 M;  4RPO A;  2QMW A;  1UQW A;  3E9S A;  4IO2 A;  2ZNT A;  3GQ3 A;  3IJX B;  3UMM A;  3H6V A;  4GRK A;  4GMQ A;  1JR3 D;  3U6C A;  4PCZ A;  1K3W A;  1Z5A A;  1L2D A;  1IBL M;  3UK4 A;  3PUX E;  3T22 A;  3RFW A;  3JR5 A;  1G59 A;  3T15 A;  5FTI A;  4R7G A;  2CV1 A;  5JTY A;  2XXT A;  1YSY A;  1O7T A;  4FJP A;  2Q8J A;  3TCF A;  5ITP A;  3R6U A;  1NNU C;  1NNP A;  1R9L A;  5LOM A;  4DV5 M;  1IY1 A;  4F3G A;  4KO8 A;  5F1Q A;  3K02 A;  4OVZ A;  3TQW A;  4DCX A;  1N04 A;  3IOW A;  2XXX A;  5BUU A;  4YHH M;  4MGY E;  2O5R A;  4GXA A;  4JXJ A;  4FEC A;  2Q89 A;  2F35 A;  3D4C A;  1TDH A;  3KN8 A;  5AA2 B;  3O2A A;  5H8F B;  4KQP A;  4M9Z A;  5K2Y A;  2Y7I A;  2H99 A;  3MC2 A;  4KFQ A;  1MY1 A;  1PM5 A;  1SXJ D;  3EIH A;  4M0W A;  2Y7R A;  4B3T M;  4GKK M;  1MXY A;  2QZ4 A;  2DP8 A;  5TP9 B;  1OFH A;  2HKJ A;  1WDN A;  2YR0 A;  5FTM A;  3KN3 A;  3VLU A;  3HV1 A;  1W5S A;  1Y3P A;  2D7H A;  1Q1K A;  3O29 A;  3OOA A;  3FV2 A;  1PBQ A;  4QFK A;  3SEW A;  2XSZ D;  2OPF A;  4G68 A;  3CSB A;  1II5 A;  4OWD A;  5H8F A;  3UIF A;  2DXI A;  2M8C A;  1S3S A;  3W15 C;  3IG8 A;  1US4 A;  1LAF E;  2OQ4 A;  4U2R A;  4OEV A;  3U6S A;  4EXL A;  1MPC A;  3OTO M;  7CAT A;  4DR6 M;  4KYS A;  2F5N A;  1PB8 A;  1N33 M;  1B1H A;  3ILU B;  5EHM A;  1QAQ A;  2F5S A;  4JN6 A;  1FQA A;  3FUZ A;  4X65 M;  3AOG A;  3L6G A;  3FV1 A;  5E6J A;  1L8Q A;  4YAH X;  1NKX A;  3K01 A;  2Q2C A;  3ILK A;  3BFT A;  2F78 A;  1XS5 A;  2F5P A;  3VVE A;  2VII A;  3UJN A;  2F5Q A;  3AL0 C;  3C34 A;  1IEJ A;  2EA0 A;  3T9X B;  3FGS A;  3PUY E;  1I6Q A;  3U6Q A;  3RGY A;  1HNW M;  2H9B A;  2I4B A;  4ELP A;  2KEB A;  5BWJ A;  3H7M A;  1H43 A;  3TE6 A;  4LFC M;  1XVY A;  3DFZ A;  3TWL A;  3PMW A;  1NNT A;  2HEU A;  3ZC7 B;  3SET A;  1BKA A;  1R6Z A;  1BLF A;  4D80 A;  4L16 A;  4QHQ A;  4BDN A;  4PQJ A;  1JNF A;  1MY4 A;  2D3I A;  4LF9 M;  4EF2 A;  2O1M A;  2OWT A;  3DOA A;  2ZNS A;  2FOI C;  3DP6 A;  1D4N A;  1DTZ A;  2O69 A;  1GVN A;  1DOT A;  2UVH A;  4LJ8 A;  2CZL A;  4FE8 A;  3SEU A;  3E13 X;  2FNA A;  1NY6 A;  5FTL A;  1QJM A;  1JW1 A;  3FXR A;  1UTB A;  3IOU A;  2QS3 A;  1MH4 A;  2DWA A;  4O3C A;  3S9N C;  1LCF A;  1SW1 A;  3USD A;  4GOT A;  2F6P A;  5IWA M;  2VQE M;  3KOY E;  4KD5 A;  1B7Z A;  3PD9 A;  4GWO A;  4G4N A;  1B6H A;  2V6Z M;  1IXI A;  2PBW A;  2IEE A;  3B6W A;  1IBK M;  3IOT A;  2XH9 A;  5B7D A;  5ICT A;  3CR9 A;  2C99 A;  2K47 A;  5CM6 A;  4X62 M;  4FCV A;  4Z8X A;  2X7Q A;  3GBB A;  1LST A;  4JSO A;  1T3T A;  1QKB A;  3FJG A;  4ZZA A;  2DHR A;  2J7O A;  1B4H A;  1TFD A;  4NF5 B;  4Q0C A;  2EUC A;  2RC9 A;  1MX0 A;  4OER A;  1AIV A;  4IBI A;  3EIE A;  5ITY A;  1VFE A;  1DPE A;  3FUW A;  3E3K A;  2L7I A;  5C1B A;  1G4A E;  2UXD M;  1B4Z A;  3A42 A;  2E1S A;  2DWJ A;  3MP6 A;  3TCG A;  4Q8R A;  4RY1 A;  4NXM M;  4GL8 A;  3TTN A;  1N0T A;  4AB6 A;  3CF2 A;  3M3F A;  5FSW A;  1D9Y A;  2Y20 A;  2Q9T A;  1N36 M;  1XT8 A;  2PMS A;  3PUZ E;  2F5X A;  3CIJ A;  4BDM A;  3TQL A;  3V8X B;  4NF5 A;  4HW8 A;  2DWZ B;  2O51 A;  4BDO A;  4LZJ A;  2KRU A;  3R9X B;  5M2V A;  4XGI A;  1IXS B;  4JWX A;  4FCT A;  2Q88 A;  4EDP A;  4LGM A;  2NWJ A;  5EXX A;  1MDP 1;  3KS4 A;  2L6O A;  4TLL B;  1DPP A;  1J1N A;  4U4S A;  1ZMG A;  4EXK A;  2R45 A;  3K1N A;  2Z3X A;  3TMG A;  3MUQ A;  2UXC M;  4QFN A;  1IN7 A;  2XX9 A;  1JR3 A;  4KOD A;  5HPQ A;  1N76 A;  1K82 A;  3D8B A;  1R9Q A;  5I58 B;  1GVC A;  2Q2A A;  2RC8 A;  2F34 A;  1HSJ A;  2IA4 A;  5FHN A;  1ZU0 A;  4MLQ A;  1PJI A;  3SEV A;  4OET A;  1M5E A;  1N75 A;  3RE8 A;  4D81 A;  1IXZ A;  2VHA A;  4PE5 B;  4F3P A;  4OU7 A;  3V5A A;  1TDZ A;  4FWD A;  5EP2 A;  3HHZ A;  1Y3Q A;  3TUS A;  4HTG A;  4R75 A;  4IIW A;  3PNV A;  1SVX B;  2I58 A;  1LCT A;  2Y0Q A;  3KGC A;  4ZEK A;  2HCA A;  3CG1 A;  5KO3 A;  5FTH A;  4PDG A;  5H37 D;  2LWX A;  3ONM A;  1HSE A;  4YKP A;  1DO0 A;  2R9J A;  1LAH E;  3SYL A;  3P7I A;  3B6Q A;  4NOO B;  4PFT A;  3PUV E;  3KP0 E;  3HN0 A;  4EQB A;  4RYA A;  4NF8 B;  5A2Q S;  1E9S A;  1SXJ A;  5DVJ A;  2FNC A;  5H8H B;  3CTW B;  2I0C A;  5L9O A;  3LQR A;  5ITO A;  4AG6 A;  2DZO B;  1FQB A;  2CV0 A;  3LR1 A;  3K2D A;  3RPW A;  1Y20 A;  3H06 B;  2A5S A;  4XBO A;  3OO9 A;  4DUZ M;  1MQG A;  3LMM A;  1HT1 E;  2H25 A;  3S9L C;  4KHP M;  5FTJ A;  4OXV A;  3SES A;  5C18 A;  3TZA A;  1JET A;  1H6U A;  2I0B A;  2V25 A;  3UGJ A;  4KLN A;  1Y1M A;  3FD9 A;  4JI8 M;  3VFJ A;  2NOO A;  1L5T A;  4L4U A;  3KN7 A;  1D9V A;  4EQ9 A;  3UGW A;  4RPN A;  1R7R A;  5H8H A;  4LZZ A;  3FVK A;  3KSJ A;  3KOW E;  4AG5 A;  1TT1 A;  4XKP A;  2REJ A;  3DA1 A;  1N32 M;  3M8U A;  5CMM A;  2XLJ A;  2E5L M;  3CF6 E;  1MXU A;  3C4M A;  2W7Y A;  1MQI A;  4DLD A;  1GTK A;  3KVW A;  3LSF B;  2XD3 A;  1ZTY A;  2QS1 A;  4R2B A;  4R74 A;  4LF4 M;  3EQ1 A;  2QP9 X;  2ZYO A;  1XMO M;  3CRB A;  4JI1 M;  1Z59 A;  1Y3N A;  5DEX B;  1N77 A;  4POX A;  1RYO A;  2YJP A;  3Q27 A;  4N07 A;  4YB7 A;  1E9R A;  4ZS9 A;  4IO3 A;  4LON B;  5ITT A;  5IT9 S;  3D4G A;  2WKY A;  4GF8 A;  2XXU A;  3OO7 A;  4YKI A;  4DR7 M;  2ZYK A;  3C32 A;  4KCC A;  4IBF A;  1E94 E;  2O7U A;  3E9X A;  2CHV A;  3H4M A;  1NNJ A;  4PDI A;  4H6D A;  2EO2 A;  2F36 A;  5ITU A;  1PDA A;  2Z8D A;  1R2Y A;  4LJ9 A;  3I6V A;  3OEK A;  4GD5 A;  3G3F A;  3G3H A;  1POT A;  2G5G X;  4I1D A;  3SYK A;  5IKB A;  5I2K B;  4GIP A;  1X37 A;  3C36 A;  5CBS A;  3CFL A;  3B9P A;  4G8H A;  4LF8 M;  1XC8 A;  2XHD A;  4CHT B;  4R6K A;  3UN6 A;  3KW6 A;  2ZM6 M;  5H8Q A;  4TOZ A;  1XNQ M;  1JW4 A;  3HHG A;  4JBZ A;  1H45 A;  4WED A;  5TPA B;  3M3L A;  3H03 A;  1IXG A;  2DWH A;  2XFT A;  3PV0 E;  4UAC A;  1GR2 A;  3HJS A;  4NRV A;  4NWD A;  4YY3 M;  2J7N A;  3V89 B;  2W82 A;  1L1T A;  4YZZ A;  4LY6 A;  3J80 S;  4LJ5 A;  4DR1 M;  2I3W A;  4U23 A;  1QQW A;  1G41 A;  3GLG A;  3NWL A;  1IBM M;  3QSL A;  1A7L A;  4IO5 A;  2P2A A;  4EQ7 A;  4MGK E;  5JTY B;  4EUO A;  1FQD A;  2L09 A;  4IGR A;  3HU1 A;  3U6O A;  3KXE C;  4LAT A;  3L25 A;  3T9V A;  4O3B A;  4HCY A;  4OVZ B;  1UIV A;  1GGG A;  1SD3 A;  1TFA A;  4KR5 A;  3PFI A;  5FLX S;  3EN3 A;  2Y0T A;  1P1N A;  4LVQ A;  2R4E A;  2BJJ X;  1OIB A;  4RA1 A;  4ONY A;  3SAT A;  4FEB A;  3IO6 A;  4GC9 A;  4S12 A;  4FOR A;  5DVI A;  4PET A;  4LJ6 A;  4BDL A;  2RKM A;  4B08 A;  5JK4 A;  3SHF A;  4JWY A;  3TCH A;  5FTN A;  2Y7P A;  4DV3 M;  2I7P A;  2HFB A;  1PEB A;  3OEN A;  3OEM A;  3TPZ A;  4NSR A;  1NNF A;  4OES A;  2F5O A;  2Z22 A;  5AA1 A;  1N7X A;  1I6B A;  2LNH C;  3G3K A;  3FJ7 A;  3UP9 A;  3U61 A;  4IB2 A;  1Z7M E;  1HNX M;  5F7V A;  1MM6 A;  1ZIU A;  3IB2 A;  1IIT A;  1IN4 A;  4H5G A;  2H1R A;  4LA9 A;  1MM7 A;  3GLF A;  4G68 B;  2QS4 A;  5KQD A;  1TXF A;  1PBP A;  1FQE A;  1I94 M;  3L2A A;  3T66 A;  1HR0 M;  4XKN A;  1ZQ9 A;  3TOD A;  4X66 M;  1DO2 A;  2QSX A;  4GLI A;  5BPV A;  4DE8 A;  2VGQ A;  3J27 B;  4QOZ C;  2OCU A;  2CMO A;  2R18 A;  3PMX A;  3H3G A;  4FVM A;  2VD2 A;  3LSL A;  3PVS A;  1EU8 A;  3Q29 A;  3GO8 A;  1MQD A;  3U92 A;  1C1K A;  3AFH A;  5AA4 A;  4I8O A;  3QUJ A;  4L8R C;  1QW0 A;  4QF9 A;  3SMS A;  1MU5 A;  4F31 B;  3OMB A;  3MAM A;  5ISU A;  3VXC A;  1JW5 A;  2DZN B;  1L2C A;  5E26 A;  2L7H A;  3MP8 A;  3TTL A;  3RGS A;  3K6X A;  1LGB C;  4KYE A;  1IQ7 A;  1OLA A;  3L27 A;  3DP8 A;  1LAG E;  4ZDM A;  2C98 A;  3K2L A;  5CC2 A;  1MQJ A;  3TTM A;  3TPA A;  3GLH A;  2F7B A;  4OVJ A;  5FHO A;  2X8A A;  1S50 A;  1DSN A;  3VVD A;  4GC5 A;  1QAM A;  4KPT A;  5CMK A;  2UVJ A;  4QNM A;  3LQQ A;  4AKH A;  1Y9U A;  4G77 A;  4X48 A;  3FXU A;  4OYV A;  1ZBM A;  3OSR A;  1JVY A;  4ZZE A;  2ZYN A;  2ZAO A;  2DWN A;  4B3R M;  3GLB A;  4JSD A;  1D2N A;  1UTB B;  2Z8E A;  2F7C A;  3I4V A;  4DV0 M;  4WKM A;  1DGB A;  2VP1 A;  1LV7 A;  5KPZ A;  2XF3 A;  4ECF A;  1B0H A;  3SAR A;  4M9S A;  2BJW A;  1JEV A;  1VDD A;  3FAS A;  3U6P A;  4MGI E;  1WVJ A;  1UM8 A;  1NH8 A;  2FE8 A;  4LRT A;  3W0L B;  3Q28 A;  1N84 A;  2DVW B;  3FTE A;  3S9E A;  4HS7 A;  1M5C A;  1J7K A;  4TLM B;  4MF3 A;  2UVI A;  4F22 A;  3W0F A;  2XXQ A;  4IBD A;  2OZZ A;  4GFR A;  2RGH A;  1OLC A;  3IX1 A;  2Z4S A;  1XVX A;  1SYI A;  4OFJ A;  5JI2 E;  1OJL A;  4I8C A;  3K1P A;  3KFM A;  8CAT A;  2F8D A;  4YIC A;  5B70 A;  1R1N A;  2YNM D;  3K4U A;  4RK2 A;  3UK6 A;  3GQ4 A;  4RNA A;  4F18 A;  2F6G A;  2VD3 A;  2D21 A;  5KZT A;  1EZ9 A;  1DGF A;  1IQP A;  4LZ7 A;  3HJ8 A;  2GH9 A;  4PD2 A;  4FW9 A;  1AMF A;  2XXW A;  3DLN A;  1NJG A;  1TH3 A;  3VXB A;  2GFE A;  1UIU A;  1B3H A;  5KPR A;  1B58 A;  2XZF A;  2D5W A;  4F2O A;  3FIR A;  1MPD A;  3WHK A;  1USY E;  3PUW E;  2HCB A;  4NTL A;  4OQO A;  3MPL A;  4Z6Y A;  5EP1 A;  4AQY M;  3HO7 A;  4OX9 M;  4ESX A;  1SW4 A;  2QL3 A;  3HPI A;  4DV7 M;  3UOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...