3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
b'AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
molecule tags Transport protein
source organism Xanthomonas axonopodis pv. citri
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
4KD5A 5CBSA 1VE4A 1ZJLA 4MF3A 3RN8A 2V84A 3K6UA 2G93A 3OSRA 1EU8A 5KZTA 1FQDA 1A40A 1FTLA 4UA8A 1AH5A 4OTEA 5I2KB 4ZEBA 3VLUA 3E3KA 3PPRA 2OJTA 3KSXA 4I9DA 1B5JA 3MVXA 3PUYE 4O3AA 4TLMB 1P1WA 1P1OA 3TTNA 3AXFA 4GOTA 1NFTA 2CZLA 3V5AA 4FEDA 1ELJA 5H8FA 1GGGA 3THIA 3G3KA 4IY6A 3A09A 2XD2A 3UN6A 4AB5A 2GRVA 3KOTA 4EUOA 3KSJA 1PB7A 4BLAA 1URSA 2H4IA 3CI8A 3H06B 4GXSB 3UORA 4ZEDA 1WODA 4NEDA 2WKYA 3PUWE 1B3LA 3OO9A 4OEVA 1AL3A 1XC1A 2ONKE 3TELA 1IXHA 4ZECA 3TCGA 4GXAA 1LSTA 4YKPA 2HAVA 4H8JA 4FORA 1FW0A 4AB6A 4F3SA 2RCAA 1MM7A 3S2VA 3TAJA 4Q5TA 4JWYA 4RNSA 2V3QA 4H1XA 5FTIA 2UYEA 4H0WA 3SEXA 5A5XB 3N94A 5H8QB 1LGBC 2NXOA 4ONYA 5ITOA 3OMBA 4JDFA 1ZIUA 4DXCA 2O7UA 1ATGA 5ELVA 1OVBA 1MDQA 4LZ5A 2YLNA 4LA9A 5I59B 5JEIA 2Y7RA 1N76A 1SDXA 5I56B 3KJTA 3K1MA 4OEUA 3K6VA 3D4GA 1N0TA 4IO4A 3T9HB 3FJGA 4LVQA 4K3FA 4R2FA 1B46A 3B6QA 3M3FA 4G68C 2Q89A 3PMXA 4G8MA 1XHYA 2O1MA 3M3LA 4LQ5A 4M4GA 5I57A 1KWHA 1SW4A 4F19A 5AA4A 4EF1A 4OETA 4R2BA 1QKBA 2GH9A 5DTBA 5H8NA 2BJJX 3PUZE 4YB5A 4ZZAA 1A54A 4U4XA 3MZ1A 5I2KA 1BTJA 1OQGA 2HZKA 3O97A 1QUJA 1FTMA 3IK6B 3O2AA 1MPCA 1B2HA 2I49A 4NTLA 1LB9A 3IOVA 3Q27A 4RXLA 1Y3NA 3DELB 3MPKA 3O9PA 1A8EA 4QFPA 2D21A 2F5XA 3VLVA 2PT2A 3FD3A 3U94A 3KN7A 2B3FA 2DXYA 2E1SA 4LZ7A 2XXYA 1JEUA 2OK2A 4F3BA 2DYXA 2O7IA 4FE8A 4OFOA 1URGA 1JW4A 5DEXB 4H5FA 1TFAA 4DE8A 3FXRA 4YZZA 2V3TA 4F39A 1DTZA 1MY0A 1PEBA 2XX8A 2H5YA 3OENA 4NF4B 1NMUA 3U93A 4ELRA 2VP1A 4U4SA 4JXIA 3CR9A 4OESA 3TTKA 4FATA 5CMKA 4WEDA 4Q8RA 2AL5A 2O51A 1MS7A 1MXZA 2DVZA 2KLFA 3DP6A 3H03A 2RKMA 2F7AA 1B7HA 1H44A 1ZTYA 4NF5B 2QS3A 4F2QA 3S9EA 1B58A 2R9JA 4KHZE 2XHDA 2IEEA 1QJMA 3RY3A 2OLBA 1B3EA 2CMOA 5H8SA 4PFTA 3LSLA 1IIWA 5CRYA 4EXKA 3K0VA 5TPAB 1MH4A 3O66A 4PP0A 1AIVA 3CSBA 5CC2A 5CM6A 2I48A 2I4CA 1RKMA 1OIBA 3M8UA 3IO6A 1UTHB 4JSDA 2Y7KA 1R9QA 2RINA 3LUYA 3N5LA 4NMYA 4QSCA 2DP8A 3W9WA 4BDMA 2Y84A 5L9MA 1LFHA 1H3DA 1DPEA 1II5A 1QULA 2F36A 2OCUA 4OERA 5TP9A 1Y1ZA 2Z8FA 4YKKA 3PGFA 2VGQA 2Y7PA 4YKIA 2I0BA 1I6AA 1B3FA 3DLNA 1MQJA 4R6KA 3FIRA 3ILUB 2I4BA 3TUSA 1POTA 2I3WA 3VDFA 1IITA 4C0RA 3SEWA 1USYH 4LZ8A 2Q2CA 1TT1A 1P1NA 2NUVA 4RK9A 3LBSA 3FVKA 4RY1A 4LQ2A 3SERA 1S9TA 1N3WA 5L9OA 2B3BA 4U21A 5B70A 3C35A 1ZU0A 1VFEA 1P1UA 5I56A 2A5SA 3CG3A 3HCQA 3G3IA 4MH5A 1IUDA 3I3VA 3K1PA 4JB7A 3JZJA 2I3VA 2NWJA 4WKMA 2ZYNA 4BDLA 2F34A 4ESXA 4O3BA 4PFWA 5F1QA 1D4NA 4G68B 1PBPA 1QUIA 3EF7A 1UTBA 3O6GA 4YKJA 4F1VA 4ZE9A 5A5XA 5AA2A 4G2ZA 3ILTB 3M3KA 5H8NB 3OO7A 4BDOA 1B52A 3C33A 4GRKA 1FTOA 2DE3A 3U8QA 2QMWA 3GBAA 1URDA 4ESWA 4U23A 3N26A 3OOAA 4GF8A 4FEBA 1IEJA 3K01A 3I6VA 3V89B 1I6QA 2XXXA 1QKAA 1SD3A 3QK6A 1JW5A 5DVFA 1NNFA 5B7DA 2OBGA 3FGSA 2R6GE 2UXAA 3PU5A 4JWXA 1DMBA 1USYE 3TFLA 4OZ9A 1RYOA 5L8DA 1UTHA 4ZE8A 1US5A 2F7CA 1B1XA 1NNKA 2HXWA 1B5HA 2Z22A 2ZNUA 4ECFA 3H6WA 3IO4A 5HPQA 1EZOA 4F29A 1DPPA 4XIGQ 2I6EA 4KI0E 5H8FB 5JK4A 2X7PA 4H6DA 4DZ1A 3R7XA 3MVZA 1AOVA 1A99A 3FVGA 3OO6A 4DCYA 1MH3A 3UIFA 3MUQA 3MW0A 2D5WA 2GFEA 2OWTA 2F8DA 2QSXA 4U1OA 3JV9A 3T22A 1O7TA 2UVGA 4EF2A 2PX1A 4QRZA 4R9FA 5AA2B 3TQWA 4GD5A 5M2VA 1B5IA 4DDDA 5ICQA 3FV2A 3RT6B 3PMVA 3EHTA 4XTCQ 3OEKA 5JTYA 4N13A 3SEYA 2X7QA 3RTWB 3TKDA 1IZ1A 3S9MC 2W7YA 2H9BA 1NL5A 2YJPA 3PMWA 4JWOA 4XKRA 4DCXA 2REGA 4PFYA 2Y7IA 4RPOA 4IGRA 4P0GA 2Z23A 2ZYKA 3MVYA 3PUVE 1YPNA 1I6BA 1R1NA 3Q26A 4OENA 3K00A 5K2XA 2FYIA 3T66A 3VVEA 3OELA 3R6UA 2V3UA 5CMCA 3ZKLA 4ELOA 5BUUA 3K6XA 1PBQA 5JTYB 1VFDA 3BFUA 3C4MA 1P99A 1SW2A 4G8HA 3ZSFA 3O6HA 1F9BA 3UK4A 2QPQA 3FVNA 2VHAA 4WXJA 4ZEFA 2ANJA 4XKQA 3IJXB 1MRPA 4TLLB 3FXUA 4F1UA 1XVXA 1MY2A 2GHBA 3CVGA 3L6GA 4O3CA 4F2OA 3OD7A 1PC3A 4RA1A 1Y20A 1B51A 3QXMA 3B6WA 4IO5A 4OYVA 2XXPA 5F7VA 4TOZA 4YU0A 4GWOA 3G3GA 4R6HA 3RT8A 2UVIA 2HEUA 4NF8A 1R6ZA 2H99A 4H65A 4OXVA 4X1DA 1AMFA 5EYFA 4I1DA 3SKPA 1OVTA 2V25A 2F6GA 3TTLA 3WAEA 4MLVA 3VVDA 4ELPA 2O84X 4QFNA 1M5FA 3EPEA 3PV0E 1FQEA 3Q25A 4NE4A 1T0KA 4HCYA 4ZEIA 5KCJA 3OSQA 1JQFA 3FVOA 4H5GA 1FQBA 3CRBA 3DP8A 5LOMA 2XXIA 3H6UA 1LAXA 1B0LA 1LCFA 2UYFA 2XXVA 4FECA 4R75A 3TCFA 2Q9TA 1BKAA 1MXXA 3KJ7A 1HSLA 2AL4A 1O63A 2QMXA 2UVJA 1L5TA 4NWDA 3TMGA 5HM4B 3KN3A 1A7LA 1SYIA 4G68A 4YAHX 3TODA 1NKXA 1RYXA 2HAUA 3C32A 3O6IA 3U72A 3OXNA 4POXA 4YMAA 2QS1A 4DLDA 3E4RA 2H98A 2Z8EA 3MZBA 1BIYA 2DWIA 1B3HA 3C31A 4ZEKA 2PVUA 3G3HA 2O1LA 4PFUA 3T9XB 4LATA 2F97A 3OEMA 3N6TA 3P7IA 3VLWA 4KR5A 4OFJA 4XKPA 3WAFA 5J1DA 3CFZA 1FTJA 1FCKA 1QVSA 3ZS6A 4EXLA 1DOTA 3BBRA 4N07A 3CFXA 3KZGA 1B3GA 4ISUA 1MM6A 3SDFA 1B4ZA 1B6HA 4MFIA 4GFRA 1PB8A 3VFJA 1B7ZA 5BWJA 3KGCA 2VD3A 4GQOA 3MBPA 1B05A 1MXUA 2M8CA 1Q1KA 3PPOA 4POWA 4FAJA 1NH7A 3V8XB 4OVJA 2DXRA 1D9VA 3B7DA 5TP9B 1MQDA 1D9YA 3G3FA 3T9VA 4PQJA 4HW8A 3S9NC 2H25A 3E9XA 2DS9A 2XXUA 1OQHA 2P1SA 3H6TA 3K02A 3VV5A 4M1VA 4ELQA 4F3GA 3D4CA 4E0WA 4FIMA 2X26A 5HBCA 5AA1A 2NVUB 4E0XA 4KQPA 3TEPA 3T96B 3EHUA 4LP2B 3QSLA 2VD2A 1PB9A 1YTVA 3H7MA 4QSEA 5TU0A 4KYSA 2XXHA 2XXTA 5ITPA 1GVCA 3B6TA 3BFTA 2QRYA 4TQUQ 1H76A 4G8NA 1H45A 1S7YA 4YMBA 4NF6A 1FQAA 2ABHA 2PBWA 5K2YA 4C1TA 5KCJB 4RPNA 1NNTA 2FA7A 4BDRA 3S9LC 1MQHA 4KYEA 2XX9A 1O64A 1JW1A 3PD9A 1MXYA 2F6PA 1ANFA 5L9SA 1VSOA 2Q8JA 2QL3A 5KDTA 3IX1A 2P0SA 5I2NA 3Q28A 4XKNA 5FHMA 2I0CA 2RF1A 4GL8A 3MC2A 2Z8DA 2XX7A 2XD3A 3K4UA 4ZS9A 4Z7EA 1UIUA 4NF8B 1WVJA 1GR2A 3HHGA 2E0SA 3GBBA 3KOSA 3IB0A 5ICTA 1LLSA 3A3UA 1M5CA 2PT1A 3CFLA 4I8CA 4AQ4A 1IXCA 1SI0A 5CMBA 4YICA 1B32A 1JVYA 3FATA 4UACA 3VE1B 2ALUA 5FTHA 3K2DA 2I58A 3N6UA 3LSWA 3ECRA 3FUZA 4P0IA 4X1BA 4ZZEA 3T93B 1EZ9A 4EQ9A 2AIXA 3MQ9A 5I2NB 2DWJA 3H3GA 3HHFA 3IJOB 3LC8A 4F1YA 1JNFA 1P1QA 1I69A 3KBRA 4QFKA 1CB6A 1DTGA 2DQVA 1MDP1 1IQ7A 1FQFA 1QUKA 3EQ1A 3IB2A 2QS2A 3RGYA 1D3KA 4EQBA 4F3PA 1SBPA 2THIA 3OO8A 4KPTA 2HQ0A 2DVCA 4NF6B 3V83A 2XXQA 3VXCA 3H4ZA 1XVYA 4R74A 2O69A 1UQWA 3R26A 1SI1A 4ND9A 1CE2A 1JETA 1TWYA 2DSFA 2R71A 3QUFA 4L17A 4NF5A 1LB8A 4Z0IA 3RQTA 3SEVA 2HZLA 5FHOA 1UTBB 1JEVA 5KDTB 5DVIA 2G29A 1LAHE 3LR1A 4OHNA 1FTKA 1ZBMA 2QJEA 1BLFA 4PE5B 5I59A 2Q88A 4I62A 3RUMA 1OMPA 4H8IA 4U2RA 5H8HA 5DEXA 5CI5A 2DWHA 1SVXB 3A3CA 3CG1A 1M5DA 1Y4CA 1Y3QA 2DE4A 3FV1A 3JYRA 4JBZA 4N6PA 1LAGE 2IA4A 3QUJA 4HCWA 4C1UA 3PPPA 3U92A 1MG1A 5I58B 1PDAA 4QSDA 5IKBA 3USDA 2P2AA 3HN0A 2RC9A 5I57B 3FJMA 4JSOA 3UP9A 4QHQA 4LONB 4RK2A 1EZPA 3IOUA 5FHNA 3SESA 2XXRA 1HSJA 3MWBA 3MP1A 1Q35A 1MQIA 1Y3PA 1M5BA 1US4A 1MPBA 2FNCA 3IOWA 4RJZA 3RTFB 2HCAA 3W15C 3G7WA 4R72A 1Z7NE 4RYAA 4QF9A 2NOOA 3KFMA 1WDNA 2RC7A 3FASA 2REJA 4G77A 1VR5A 2ONRA 3IR1A 3PPQA 4IB2A 4GVOA 4Q30B 3K1NA 4FJPA 4QFLA 1J1NA 1XS5A 2ONSA 3DP4A 1R9LA 5AA3A 1TFDA 1JVXA 1SW5A 3CSGA 3VVFA 2F78A 2QS4A 3EHSA 3LSFB 3QIMA 1QW0A 3MVWA 3KN8A 4IY5A 3SEUA 1IXIA 1Z7ME 1HSEA 1N3XA 2F7BA 2Y7WA 3MAMA 1MY3A 3IL1B 4OWDA 3DM0A 3C34A 2V93A 3K6WA 3HO7A 3TQLA 1LAFE 1Y1MA 2ZXTA 5EHMA 3L6HA 4EDPA 3CIJA 1B40A 2Q2AA 3GXAA 4THIA 2O68A 3TTRA 5I84A 4F22A 3C9HA 3UGWA 1MY1A 1XOCA 4YB7A 1NH8A 1B9JA 5EHSA 3TPAA 3MP8A 5DYHA 3W9VA 4Q0CA 4YB6A 3TYHA 2RCBA 3MP6A 1MPDA 4MBPA 1UIVA 3PUXE 4P11A 3I5OA 1DSNA 4HTGA 4QFOA 3MZ9A 4X48A 5DT6A 1ZKBA 4OQOA 4R6YA 2YPNA 1A55A 5DVJA 4ZDMA 1H43A 1YCJA 2ZYMA 2ZNTA 4GIZA 2ESNA 1LFIA 1B4HA 2PMSA 4IO6A 2A5TB 1MXWA 1A8FA 1SYHA 2VOZA 1B1HA 1POY1 5ISUA 2ZYOA 4BDNA 1ZLQA 2XXWA 4WEPA 4OMBA 3IB1A 5AA2D 4KCDA 2D3IA 1N7XA 3HSTA 3IOTA 4X9TA 4KYDA 1M5EA 1OLCA 2B65A 3IORA 4R9GA 3S4UA 2UVHA 1SQYA 3G3JA 3BKIB 2O6AA 4F18A 1YAEA 2ZNSA 2LAOA 1B7UA 1FQCA 2DWAA 2PYYA 2RC8A 4U22A 4PETA 1S50A 1GV8A 3SETA 3TCHA 3FXQA 4G4PA 2ZMBA 1XT8A 3FJ7A 4IGTA 4XXUA 5TPAA 4DXUA 1LCTA 2F35A 4GL0A 2HFBA 2OZZA 4IO3A 2DE2A 5I58A 3IAZA 1N84A 1Y9UA 2DOJA 3FZVA 3ODBA 4IO7A 3QYTA 3RNNA 3Q29A 1EH3A 3PD8A 3GZGA 3MJNA 2OWSA 4U1ZA 3U1OA 3PPNA 5H8HB 4MLQA 4LUBA 4GLIA 3LSXA 4R73A 3VXBA 1LBCA 3E13X 4IO2A 1MQGA 4NF4A 3MPLA 4BDQA 1NNPA 1MXVA 4HS7A 3HV1A 4KFQA 5CMMA 2A5TA 3C36A 5AA4B 1OLAA 3HPIA 2GHAA 3ONMA 1MY4A 5H8QA 4EQ7A 5IAIA 5CBRA 4H67A 3ZKKA 4DIGA 3TDJA 3F11A 1IXGA 1LBBA 3T9UA 2AYSA 3H6VA 1B0HA 1LFGA 3O29A 1GTKA 4OFLA 3EN3A 3O28A 1N7WA 1TXFA 1BP5A 1ZMGA 3RLFE 3RPWA 4NWCA 3KG2A 3TTMA 3UA8A 1Y4TA 4DXBA 4KCCA 3GLBA 3TZAA 5AE4A 3KEIA 1N04A 1SW1A 3QAXA 4F31B
chains in the Genus database with same CATH superfamily
4GHAA 2C99A 2DI0A 3FUWA 2QVUA 1NSFA 1QDTA 4GIPA 3K6UA 2G93A 4B3SM 5KZTA 3FUTA 4UABA 3KOXE 3UK6A 3L29A 3MYUA 1VQ1A 3VK7A 3PUYE 5F3WA 1P1WA 4I3EA 3TTNA 1C1KA 4FEDA 1ELJA 3SAUA 5H8FA 2R18A 3A09A 2QBYB 2CRUA 3KSJA 3CI8A 5EQ9A 2WKYA 3PUWE 3C9PA 3K9PA 1XC1A 3TELA 4MGIE 4GXAA 4HEOA 4CIZA 3KC0A 3T1HM 4YKPA 2XA5A 4H8JA 4P47A 5ET8A 1FTAA 4RNSA 3C3EA 2UYEA 5ITOA 4ONYA 3BOSA 1ZIUA 4DXCA 2V6ZM 2R45A 2Y7RA 2R6FA 3GLGA 3D4GA 3EIHA 4IO4A 3T9HB 4K3FA 2WBBA 3FTFA 3M3FA 2Q89A 1J5EM 4LQ5A 5I57A 1SW4A 4OETA 2GH9A 1A54A 1NV7A 4PFIA 4N81A 2FOIC 1AWBA 3IK6B 1MN3A 2Z7JA 1LB9A 4NTLA 2OOBA 1A8EA 1ZMWA 1JR3A 3SBJA 5I7IA 1FBDA 3U6QA 2F5XA 3VLVA 2K47A 3KN7A 4MGHA 2DXYA 2PFYA 4LZ7A 1JEUA 4F3BA 4FE8A 1JW4A 4LF6M 2XX8A 1MY0A 1PEBA 3U93A 1L2CA 4U4SA 2WZJA 1DGBA 2AL5A 2O51A 3DP6A 3H03A 1G59A 4NF5B 2F7AA 1NHWC 1XWIA 2QS3A 2R9JA 4KHZE 1QAQA 2XHDA 4G61A 4NRWA 4OVQA 5TPAB 4PP0A 1AIVA 4KHPM 1RKMA 1FJ9A 3N5LA 2Y84A 1QULA 1II5A 5TP9A 3GLGE 3SHFA 4YKKA 2DHYA 4I5SA 3U6DA 3FIRA 2Y0QA 1POTA 3VDFA 4IJFA 1TR8A 1XB2B 3SERA 1S9TA 1N3WA 1QDRA 3GPUA 4LF5M 1ZU0A 4QXDA 2NWJA 4LJ4A 3KOZE 4GWSA 4O3BA 4G68B 5A5XA 3EF7A 3TWLA 1F4IA 3M3KA 1FJGM 2LWXA 1FTOA 2QMWA 3I01M 1URDA 4MNPA 3V89B 2H1RA 2CHQA 1SD3A 4JXJA 1NNFA 2VIIA 5BR8M 1N34M 3K8ZA 3TFLA 4OZ9A 4ZE8A 1B5HA 2Z22A 3H6WA 4O7MA 1N32M 1DPPA 1EFUB 4IBEA 4KI0E 1XC8A 4BB9A 3T1BA 2LBCA 4X8RA 1AOVA 1A99A 1HNZM 3L2AA 5KQDA 3MW0A 4U1OA 2QSXA 2EKFA 4P1LA 2UVGA 4R9FA 5LTCA 4IBGA 1B5IA 1FJ6A 4AS4A 1DGHA 2EKKA 5JTYA 3AFHA 2X7QA 3LVVA 1R7RA 4B3RM 2W7YA 2WBDA 3PMWA 4XKRA 4LJAA 4IGRA 3L28A 2LVQD 5EJCA 5EXSA 3OELA 5CMCA 2V3UA 4DR3M 1PBQA 5JTYB 1Q9DA 4DUZM 4FWGA 3O6HA 3FVNA 2LVAA 4XGIA 4B7HA 2ANJA 1K9ZA 1NV5A 1MRPA 4TLLB 1XVXA 2GHBA 1N77A 5EXXA 3RGSA 1PC3A 4NAPA 3SATA 4RA1A 3RYDA 3HY5A 4AKIA 4LGMA 5F7VA 3B6WA 4OYVA 2XGNA 4YU0A 1R5LA 2DAGA 2HEUA 3GRYA 4OXVA 4P56A 1FBPA 5EYFA 4I1DA 2V25A 4MLVA 3M7GA 1PM5A 3LQQA 3BIGA 3OSQA 4X66M 2XXIA 4DR2M 3D8BA 1B0LA 3TCFA 1L5TA 2NQ8C 2AL4A 3H4MA 8CATA 1A7LA 1SYIA 4G68A 2HAUA 2FBPA 5FTJA 3MZBA 1BIYA 3VE1B 3FYDA 4OVZA 2O1LA 4DR7M 3VLWA 4KR5A 4OFJA 3WAFA 2QBYA 1YXIA 3CFZA 1FTJA 3M6AA 5ITXE 1QVSA 4EXLA 5ITUA 4N07A 4OVTA 3KZGA 4ISUA 5J16A 1B6HA 1WIVA 3TWMA 1GO5A 1PB8A 2F3BA 5BWJA 3KGCA 3MBPA 3PPOA 1MXUA 2M8CA 4OANA 2L2DA 4BBAA 1NV1A 5TP9B 3DZDA 3KC1A 1G3IA 2FHYA 3E9XA 2DS9A 3H6TA 4GX6A 4M1VA 1J7KA 1V34A 5HBCA 3AOGA 2DZOB 2NVUB 3QSLA 2VD2A 1PB9A 1E9SA 2R4JA 3HKPA 2XXHA 1IN4A 3BFTA 2Z4SA 1S7YA 4QOZC 2ABHA 2PBWA 3J2PB 2ZTDA 1HJPA 1NNTA 2JP7A 7CATA 2C96A 4DV7M 1JW1A 1IY2A 1N78A 1IN7A 5EP2A 2LVNC 5FHMA 1CNQA 4XKNA 2I0CA 3RGPA 3GYYA 1UIUA 3VLFB 4PGNA 1GR2A 2E0SA 1FPDA 4O7IA 3A3UA 2PT1A 4MGYE 1GL6A 2ALUA 5E6JA 4MM3B 3LSWA 4P0IA 3GRUA 2OOAA 1XXHE 4GC5A 4LF9M 3TPZA 3H3GA 3HHFA 1Z6TA 3U6PA 4JI7M 1DGFA 1IQ7A 1FQFA 3EQ1A 2DAIA 3IB2A 2QS2A 2UXBM 2O69A 4RKUF 4PDGA 3TL4X 1IY1A 1MJGM 3SMSA 1JETA 1TWYA 2WSEF 5KDTB 1UTBB 3B7ZA 1OFIA 2QJEA 3E21A 2Q88A 3RUMA 5IGAA 4H8IA 5H8HA 5EQTA 2DWHA 3CG1A 5CI5A 1P3QQ 1Y4CA 4ITQA 3JYRA 5FSWA 1Q3CA 4IBJA 1NUYA 5I58B 4PDIA 4G4RA 2P2AA 2RC9A 3FJMA 4NOOB 4QHQA 1EZPA 3MWBA 1M5BA 4JI5M 3RTFB 2HCAA 3W15C 3SASA 1Z7NE 2NOOA 5DVFA 3QYEA 2OPFA 3IR1A 4IB2A 4QFLA 1J1NA 2ONSA 1OIZA 1JVXA 5ITQA 3LQRA 4XK8F 2F78A 2PFZA 3EHSA 3B9PA 1N3XA 4OWDA 3GO8A 3VKHA 3DM0A 2V93A 4JVCA 1PJSA 3TQLA 3CGWA 2KR0A 3L6HA 2UXDM 2DNAA 1QGXA 2DZNB 2R8TA 3C9HA 3UGWA 3HFUA 4IBDA 3W9VA 4GWWA 4P11A 4NXNM 3MZ9A 5ET5A 1ZKBA 4OQOA 4ZDMA 5DVJA 1H43A 2ESNA 3A29A 2MROB 3Q8GA 2A5TB 2VOZA 4PFBA 5ISUA 2EO2A 4LZZA 1NV6A 3IB1A 2D3IA 4KYDA 1M5EA 3UGJA 3G3JA 1SQYA 3BKIB 2XWKA 4GKJM 1B7UA 1ORYB 2O01F 4PETA 3TCHA 4IGTA 4DXUA 3FJ7A 3GQ4A 4IBBA 2HFBA 2OZZA 4FBPA 3FZVA 5ESYA 2QP9X 1GLNA 2OWSA 1HNWM 5FTNA 4QOSA 5E26A 4R73A 4DR6M 2WSCF 4BDQA 4D81A 4HS7A 4KFQA 3HV1A 5IAIA 1OLAA 3HPIA 1K3XA 2CZHA 1L1ZA 3GP1A 2KQZA 3F11A 1IXGA 3TDJA 4DIGA 3H6VA 3O29A 4OFLA 4ELOA 4I81A 3RLFE 4XEQA 5AE4A 1D0LA 4JI4M 3KEIA 1N04A 4LG2A 4YB5A 4OX9M 3DA1A 4MX6A 3K9OA 5C1BA 3T38A 3RN8A 5EYGA 1EU8A 1FQDA 1FTLA 1AH5A 4WEPA 3PPRA 2OJTA 3KSXA 4O3AA 4TLMB 4GOTA 4AB5A 2XD2A 4P17A 2CFOA 4Z8XA 3KOTA 4EUOA 1CUKA 2H4IA 4ZEDA 4DR1M 4MJOA 1B3LA 3OO9A 4ZECA 1IXHA 4OVZB 5ET6A 1LSTA 3HJSA 4JVIA 4F3SA 1SXJE 1MM7A 3S2VA 4Q5TA 3L26A 1LGBC 3MMPA 3OMBA 4JDFA 1Z59A 2I7PA 1WGNA 5ELVA 2ZM6M 4I40A 3RFWA 2FE8A 1HQCA 3KJTA 2ZTCA 3K1MA 4JI0M 1GABA 4GWXA 1N0TA 2B4LA 2CEYA 2DVWB 4G8MA 4DI4B 3M3LA 1Q02A 4HW8A 4R2BA 2APLA 2D7HA 5DTBA 3QMFA 3IHPA 2GQ1A 2L5VA 3FXBA 3RE8A 2HZKA 3WHKA 1FPEA 1B2HA 3IOVA 1IN8A 3MPKA 4LZJA 3FD3A 1NV4A 2B3FA 4DR4M 3HGIA 1AUAA 1VEGA 3GLFA 2DYXA 2O7IA 4OFOA 3M0EA 1DV0A 3U6EA 4YZZA 2V3TA 1DTZA 3CHGA 1Q3BA 3AV0A 2VP1A 3EIEA 3GLHA 4IBCA 4Q8RA 1MXZA 2KLFA 4IBKA 3GLFB 2H5XA 3RY3A 3ZQJA 2IEEA 4X62M 5LMNM 1B3EA 5CRYA 1LBWA 1MH4A 3LCVB 4G6ZA 2F5PA 3CSBA 5CM6A 2I48A 3SAVA 1R9QA 3LUYA 1NUWA 1KA1A 1DPEA 2F5NA 5B7DA 1Y1ZA 3HU2A 5KQ8A 4LRTA 2VGQA 2Y7PA 1NV8A 2F3DA 1I6AA 1G71A 3ZC7B 2I0BA 3DLNA 4LF4M 1MQJA 3TUSA 3ILUB 3I4YA 2D7GA 1FPGA 3LV0A 1IITA 4C0RA 3SEWA 2EA0A 1VG5A 5BPVA 1RDZA 3LBSA 5FTLA 1VFEA 2A5SA 5IZ3A 1IUDA 2PCRA 3K1PA 3JZJA 2Y5LA 4WKMA 4B08A 4BDLA 2L6OA 4PFWA 4PAIA 1QUIA 4ZE9A 2CV0A 3LCUA 1FPLA 2DAMA 1B52A 4GRKA 3C3DA 1IN6A 2WSFF 5ITYA 4I4LA 4FEBA 3CTWB 3I6VA 3GPXA 1QKAA 4MGZE 1JW5A 2OBGA 3FGSA 3PU5A 4JWXA 1NNJA 5FTKA 1NY5A 1QAOA 1RYOA 5L8DA 4PE3A 1NV2A 2J7OA 1EZOA 4F29A 3E79A 2DAEA 4KXPA 4H6DA 2VQEM 3MVZA 3R7XA 2O25A 3E46A 3MUQA 1NV3A 2D5WA 2GFEA 4RF0A 2F8DA 2OWTA 4B3TM 3JV9A 1O7TA 4EF2A 2PX1A 4QRZA 5AA2B 2LHGA 3FYCA 3TQWA 4GD5A 5M2VA 5T3JA 1JP4A 4BLCA 3PMVA 5EP4A 4MNIA 4PF8A 4N13A 1EE8A 1IMDA 3S9MC 4CISA 1PJIA 3U5ZB 2REGA 2Y7IA 4Y28F 2Z23A 1GKIA 3GLHE 2QSFX 4OENA 1I6BA 4EQBA 2XLJA 3K00A 5K2XA 4W5WA 4FW9A 1L2BA 2DKLA 3R6UA 3VVEA 1PGYA 2V1CA 5BUUA 5LDZA 3K6XA 1VFDA 1NV0A 3C4MA 1P99A 3GLFE 1SW2A 2QQ8A 2QPQA 2VHAA 4XKQA 2WYPA 2DENA 3FXUA 3L6GA 3I04M 3OD7A 5JI2E 3QXMA 2XXPA 4TOZA 4GX4A 4OVRA 2J5YA 2MJ5B 2R0IA 3FUVA 2H99A 4AG6A 1AMFA 1BK4A 4GBVA 4ELPA 2O84X 4QFNA 3DOAA 1N33M 2ZAOA 1YZ0A 3PV0E 4PDHA 1FQEA 4ZEIA 3KVWA 4JI2M 3FVOA 3DP8A 1TDHA 3H6UA 1LAXA 4R75A 2XXVA 1VEKA 1HSLA 2UVJA 3NBXX 2OQ4A 4FCVA 3TE6A 4AI6A 3KN3A 4P3LA 4YAHX 3U72A 1ZV1A 1NKXA 3C32A 3O6IA 4I3YA 1OFHA 4POXA 4YMAA 4DLDA 3E4RA 2H98A 1LBZA 2Z8EA 2DWIA 3C31A 2PVUA 3G3HA 1OTRA 3OEMA 3N6TA 3PNYA 3U65A 3CFXA 2ZANA 3SDFA 2ZZXA 1B4ZA 4LY6A 3VFJA 4GFRA 2VD3A 3SZPA 1B05A 1DO0A 2YR0A 1DGHB 4N4UA 1K3WA 3G3FA 5ITTA 3T9VA 4PQJA 3S9NC 4NSOB 1XNRM 5IZ3B 3K02A 3ZCBB 4F3GA 3D4CA 4E0WA 4FIMA 2X26A 4E0XA 2BJWA 3TEPA 3T96B 4LP2B 1QZMA 1BVSA 3H7MA 4QSEA 4M9SA 5KPTA 3QYBA 2XXTA 1KFVA 2QRYA 4YMBA 1H45A 1FQAA 4C1TA 4RPNA 2KXEA 3VFDA 2XX9A 1MXYA 1ANFA 2DDKA 2QL3A 3IX1A 4CGYB 2RF1A 4GL8A 3MC2A 5IZ7D 4AZFA 4LCBA 2XD3A 4ZS9A 4Z7EA 3K1JA 2XZFA 4DUYM 3IB0A 1M5CA 3CFLA 3E78A 4FVMA 1IXCA 4F2LA 4YICA 1JVYA 3FATA 5FTHA 3N6UA 2V4CA 4AW4A 5I2NB 1EIJA 1P1QA 4P8BA 1CB6A 4N6KA 2CV2A 1WXQA 1QUKA 2JY8A 1D3KA 4NF6B 1IN5A 3V83A 2DVCA 2XXQA 1XVYA 3AKZA 4UN2B 4LJ5A 5AA4A 3HHZA 3SEVA 1TTEA 2HZLA 5FHOA 5DVIA 1XI6A 1YLAA 3IG5A 1ZBMA 1BLFA 3SYKA 3MHVC 2M5ZA 4M9ZA 3A3CA 1Y3QA 1OIPA 4JBZA 2IA4A 3QUJA 4HCWA 2Q8MA 4C1UA 4LJ8A 3IECA 1MG1A 4QSDA 1IFYA 1NHGC 3USDA 2OX3A 3HN0A 2C9OA 3IOUA 1HNXM 4NN3A 4II7A 3MP1A 3IOWA 1DK4A 4HL4A 1TH4A 4RYAA 2Y0TA 1XS5A 3DP4A 1ZMVA 3CSGA 3VVFA 2QVRA 3SFZA 1QW0A 2CE7A 3MVWA 2HKJA 1HSEA 2GQFA 3FRIA 4DV2M 2KA6B 2KW0A 3K6WA 1LAFE 2ZXTA 5EHMA 2EUCA 3CIJA 2YQZA 3GXAA 3GLHB 3FD9A 1FBCA 3H4JA 4YB7A 1OAOC 1B9JA 5DYHA 4Q0CA 2RCBA 3MP6A 1MPDA 1MX0A 3PTYA 3PUXE 1QQWA 3I5OA 4HTGA 4X48A 3U61A 5DT6A 3BXWA 4GH9A 2ZNTA 4GIZA 1LFIA 4IO6A 2FS1A 1A8FA 1SYHA 4H45A 1POY1 1IQPA 4BDNA 4PBQA 1ZLQA 2XXWA 4OMBA 5AA2D 5DFLA 2M60A 1PRBA 3HSTA 1Z5CA 4FWHA 2B65A 2O6AA 2LAOA 1FPFA 3I51A 2ZMBA 4MHFA 1LCTA 4Q7JA 1N84A 3ODBA 2XXKA 1XXHB 4IO7A 3QYTA 2L7HA 3W68A 2JY5A 4MLQA 4LUBA 3LSXA 2CEXA 3GLIE 4IO2A 4CJ6A 3MPLA 5AA4B 5H8QA 2GHAA 3NOHA 2F5SA 1MY4A 1GVNA 5IZZA 4H67A 3ZKKA 4M0WA 1XXHA 1LBBA 4PBHA 5KPZA 2AYSA 4QFKA 1TXFA 1BP5A 3RPWA 1JB0F 4KO8A 5GKNA 3TTMA 4Z6YA 4XF5A 4KCCA 4DXBA 1FQCA 3U6MA 4LJ7A 1R2YA 2PT2A 4N8YA 1K82A 1VE4A 3KXEC 1L8QA 3OSRA 3VLUA 4ZEBA 2ZBKB 4I9DA 3MVXA 2UXCM 3V5AA 1NFTA 2CZLA 1GGGA 3G3KA 4IY6A 4YHHM 2X8AA 1URSA 3H06B 3UORA 2CZIA 1WODA 4O8MA 4OEVA 3U6SA 1AL3A 2ONKE 3A42A 2QFLA 4PD2A 3HX3A 5EP3A 5ITXA 2UUCM 4EIWA 4FORA 3U61B 4JWYA 3BIHA 4PAFA 4GWZA 4P9KA 4H0WA 3SEXA 5A5XB 3N94A 5H8QB 2NXOA 2V1UA 2O7UA 1ATGA 2QVVA 5I59B 4JV5M 5I56B 2VDBB 4OEUA 3K6VA 2QZ4A 3FUUA 1D2NA 4N8GA 4ZPXA 4XBOA 2KDLA 1B46A 4G68C 4PCZA 2RKOA 2O1MA 2LVPC 2CV1A 4S12A 1KWHA 4LJ6A 4IBFA 1G8PA 3HJQA 2J7NA 3MZ1A 1OQGA 1FBFA 3O97A 1QUJA 1FTMA 2LTUA 3Q27A 4RXLA 1MU5A 1WR1B 1VDDA 1T43A 4NF0A 1R6BX 1OKSA 4GRIA 2D21A 3U94A 3U6OA 1RU3A 2DXIA 2CEAA 2E1SA 2RGOA 2OK2A 3AOEC 3T15A 2VF7A 1WGLA 1URGA 4H5FA 1TFAA 2ZAMA 2R62A 1YSYA 1OJLA 1V33A 4ELRA 4F39A 2H5YA 3OENA 1NMUA 4OESA 5F24A 5CMKA 1T3TA 1QAMA 4X65M 2DVZA 3A98B 1ZTYA 4F2QA 2MH8A 2OLBA 5H8SA 2CMOA 4PFTA 2I7NA 5IWAM 1IIWA 2B4MA 4EXKA 3K0VA 3O66A 3B7QA 2WYKA 3MJ5A 1LV7A 1OIBA 4PCDA 3IO6A 2JZ0A 2Y7KA 4NMYA 4HLQA 2LNHC 3SAWA 2WEFA 4BDMA 5L9MA 1LFHA 1H3DA 1DCUA 2JWSA 5H37D 2OCUA 3PGFA 1Q39A 4YKIA 4LRSA 1B3FA 3IG8A 2G5GX 3BBZA 4R6KA 1LBXA 2I4BA 4PF6A 2I3WA 1NUZA 4G3OA 2LVOC 2OWZA 4LQ2A 4DR5M 4U21A 2JA2A 1P1UA 1FBGA 3G3IA 3I3VA 2I3VA 3C58A 2ERCA 1FBEA 4L15A 2F34A 4ESXA 1D4NA 1PBPA 2DHRA 3O6GA 4YKJA 3NBIA 4CHTB 3ILKA 5AA2A 5FTMA 4DBGB 3ILTB 5KO3A 1NO1A 5H8NB 4BDOA 1IXSB 2DE3A 4LF8M 3U8QA 3GBAA 4AKGA 4ESWA 4U23A 2WX9A 3OOAA 4GF8A 4NSRA 3QK6A 2R6GE 2UXAA 3AOEA 2JNHA 1UTHA 1B1XA 1NNKA 2ZNUA 3ROJA 4ECFA 5HPQA 3VDUA 4XFEA 1XMOM 2HXRA 3LW5F 5H8FB 5JK4A 4DZ1A 3R9XB 3OO6A 4AG5A 1MH3A 3PNVA 3T22A 5DW8A 3B8BA 2DZLA 4GC9A 1H6UA 2Q74A 3FV2A 3A45A 5DYGA 4XTCQ 4GMQA 2QNJA 5ITRA 3OEKA 3KBZA 1XHBA 3RTWB 1YYZA 2YJPA 4DCXA 4PFYA 2KZUA 3PFIA 3IFCA 4RPOA 4P0GA 4FD2A 3MVYA 3Q26A 3PUVE 4JI6M 2FYIA 1GJTA 3RPLB 3VK8A 5LMUM 4B3MM 2RGHA 4G8HA 3ZSFA 3V76A 4GHLA 1IY0A 3HU1A 4F1UA 1MY2A 5FLXS 4GBWA 3GRRA 1B51A 1Y20A 4DV5M 2XEPA 3ISPA 3L25A 4NQ8A 1XMQM 2DWNA 3FKEA 3MK6A 2F5OA 4JYAM 4H65A 4NF8A 4X1DA 1OVTA 1NNUC 2F6GA 3WAEA 3VVDA 2K6BA 1M5FA 4OVSA 3EPEA 3Q25A 1JQFA 2XWVA 1FQBA 3CRBA 1QUTA 1IXSA 2UYFA 1IBKM 2C9CA 2Q2EB 3FTCA 1MXXA 1L2DA 1BKAA 3TQSA 1O63A 3KOWE 2QMXA 3KJ7A 1HQYE 1KA0A 2XWIA 3TODA 2QS1A 2KNAA 4ZEKA 1B3HA 3CF0A 1NV9A 3P7IA 2Z4RA 5J1DA 1NVMA 3ZS6A 3BBRA 1MM6A 2YFQA 4MFIA 4F1IA 1B7ZA 4GQOA 3PXGA 2RRUA 1Q1KA 1R4GA 4WW0A 2Y21A 4POWA 1NH7A 3HHXA 4OVJA 4REZA 1MQDA 1NUXA 3D1RA 2H25A 2XXUA 1OQHA 3VV5A 3NWLA 4ELQA 1WHCA 3WHLA 2KHHA 2Y20A 1G0HA 3KW6A 1K9YA 5ITPA 1GVCA 3J80S 3B6TA 1I4WA 5K2YA 2FA7A 1MQHA 4KYEA 5A2QS 3PD9A 1NY6A 2R65A 5L9SA 4MCOA 4HE1A 2Q8JA 3B7NA 2QPAA 3Q28A 4MMPA 1QANA 3THGA 1DGGA 4IJEA 3HHGA 3GBBA 3GLIA 1AIPC 2E5LM 2ZZVA 5IREB 4UACA 2I58A 3T93B 3FUZA 4EQ9A 1EZ9A 3GQ3A 1J09A 2DWJA 2P3VA 3IJOB 4F1YA 1JNFA 1I69A 4O94A 3KBRA 3AJIB 1TH2A 1MDP1 3GLIB 3RGYA 4F3PA 4GITA 4KPTA 2THIA 2L4FA 4L8RC 5IZ1A 4LFCM 2QHOB 3R26A 1HR0M 1CE2A 2R71A 2VPNA 4NF5A 4Z0IA 1E9RA 1LB8A 3RQTA 2HWJA 1JEVA 4AQYM 2G29A 1LAHE 4IR8A 4OHNA 2K0BX 4PDDA 4G4OA 2HCBA 4JN6A 5I59A 4I62A 1OMPA 4U2RA 1SVXB 3LUZA 1M5DA 2DE4A 2FNAA 4N6PA 1DBZA 1LAGE 3PPPA 3U92A 5DYIA 1PDAA 1JR3E 5I57B 3UP9A 1IMFA 4DV3M 2D7EA 4GKKM 5FHNA 2XXRA 1HSJA 4GX3A 1Q35A 1MQIA 4JI8M 1US4A 2FNCA 4PTKA 4RJZA 4N17A 1E32A 3G7WA 4R72A 2CWBA 3J7AS 4QF9A 3KFMA 4RK9A 1WDNA 2RC7A 3FASA 2REJA 4G77A 3J7BA 1TDZA 4FJPA 4G4QA 5IM2A 3B50A 4DI3D 5AA3A 1TFDA 3IFAA 1SW5A 3KP1E 1NJFA 1E94E 4LJ9A 3JR4A 3SEUA 1Z7ME 4DV6M 3MAMA 1IMAA 1MY3A 3IL1B 4D82A 1SXJB 1N75A 2G8LA 3UJNA 4EDPA 4OVPA 2O68A 3TTRA 5I84A 2KZSA 4LGYA 1XOCA 3TPAA 3MP8A 4YB6A 4JVDA 3HHWA 3TYHA 4MBPA 4QFOA 5EQAA 4R7GA 3JR5A 4R6YA 2L7IA 2YPNA 2MR9A 1YCJA 2ZYMA 1I94M 1B4HA 1B1HA 3U6LA 4K0KM 1IMEA 4RF1A 1N7XA 4X9TA 1PJJA 3IORA 4R9GA 1IMBA 4NGUA 2ZNSA 4MB7A 2PYYA 2RC8A 4U22A 1S50A 1LTMA 3SETA 4YY3M 3VDPA 3FXQA 1XT8A 4XXUA 5TPAA 2F35A 2F4VM 3IAZA 1Y9UA 2JJKA 3K2LA 3RNNA 3JAMS 2Z3XA 2MKZA 3PD8A 3GZGA 3MJNA 4GLIA 4P1EA 1QZEA 1VDLA 3E13X 1MQGA 1EYKA 1NNPA 1MXVA 5CMMA 3VKGA 2BJIA 2C5RA 5CBRA 4L16A 3T9UA 2CZKA 1GTKA 3EN3A 3O28A 1N7WA 1ZMGA 4AKHA 1UFZA 3UA8A 3HJ8A 3TZAA 3GLBA 3MQ9A 3QAXA 4F31B 2DWLA 4N6DA 4KD5A 5CBSA 2W82A 2BNKA 4X04A 5EXTA 1ZJLA 4MF3A 2V84A 1YUBA 2FIEA 1W5TA 1A40A 4UA8A 3RPLA 1V92A 4OTEA 5I2KB 3E3KA 3GRVA 4NL4H 1B5JA 1P1OA 2VT5A 3AXFA 4IBIA 4H46A 1PJQA 3THIA 1OAIA 2GRVA 1PB7A 4BLAA 3CF6E 4GXSB 4LFAM 4NEDA 1SPIA 2BWEA 4MIJA 3TCGA 1VEJA 1T6OA 2HAVA 1FW0A 4AB6A 4TUWA 2RCAA 3TAJA 3AL0C 2V3QA 4H1XA 5FTIA 1ZMUA 2HL7A 1MDQA 1OVBA 4LZ5A 2YLNA 4LA9A 5JEIA 2G3QA 1N76A 1SDXA 1IMCA 4HE0A 4D80A 5DNYA 3FJGA 4M9XA 4LVQA 4R2FA 3B6QA 3PMXA 1XHYA 4HE2A 4M4GA 2C98A 4EF1A 5H8NA 1QKBA 4ZZAA 2UUAM 4N15A 3U60A 2BJJX 3PUZE 4U4XA 5I2KA 1LEVA 1BTJA 1D0KA 1TH3A 1NJGA 3O2AA 1MPCA 1DO2A 2I49A 1G4AE 1Y3NA 3DELB 3O9PA 2BWBA 3FE3A 4QFPA 2XSZA 1UM8A 4PT5A 5EQ7A 2L4EA 2LHCA 2XXYA 3J27B 3HZJA 5DEXB 4DE8A 4MGKE 3FXRA 1XNQM 4NF4B 1JQJC 4JXIA 3CR9A 3TTKA 4FATA 1S3SA 4WEDA 2BJVA 5KDTA 1MS7A 2RKMA 3D8LA 1B7HA 1H44A 3S9EA 1B58A 2Y5KA 1QJMA 1VDWA 2KEBA 3LSLA 2UU9M 1D9QA 3SYLA 3GPPA 1SXJD 5CC2A 2I4CA 3M8UA 4JSDA 3KDSE 1UTHB 1R2ZA 2RINA 1W5SA 4QSCA 2DP8A 3KOYE 1QUSA 3W9WA 4WP2A 3UN6A 4OERA 2F36A 4MNCA 3F92A 5EP1A 2Z8FA 2R44A 3U60B 1ZQ9A 1TGUA 4G4NA 4HXVA 4QHTA 1USYH 4LZ8A 2Q2CA 4OU7A 1TT1A 1P1NA 2NUVA 1RDXA 3FVKA 4RY1A 2XFTA 5L9OA 3U5ZA 2B3BA 5B70A 3C35A 5I56A 3CG3A 3HCQA 1EYJA 4MH5A 2ZZWA 1IXZA 4QNMA 4JB7A 1FPBA 2ZYNA 5F1QA 2CHVA 1UTBA 1RDYA 4G2ZA 3FRHA 3W67A 1D0MA 1EYIA 3OO7A 4L4UA 2HHMA 3C33A 4MEVA 3CF2A 5A5LA 1FNNA 1LBYA 3KS8A 3N26A 1IEJA 1IBMM 3K01A 1I6QA 4X64M 2XXXA 1DMBA 2A5YB 1USYE 3A46A 1OQYA 1FPJA 2FFJA 1US5A 2F7CA 2HXWA 4OA4A 2P5TA 3IO4A 3R8FA 4XIGQ 2I6EA 2X7PA 1KSFX 2DAKA 3FVGA 4LF7M 4DCYA 4MAGA 3UIFA 5L8RF 1N36M 2CP8A 4DV1M 3T6PA 5EXPA 2XF3A 3U6CA 2DWMA 4DDDA 5ICQA 2XFSA 3RT6B 4NRVA 3I4VA 3EHTA 3SEYA 3TKDA 1IZ1A 3LMMA 3SHGB 1SXJA 3OTOM 1GL7A 1NL5A 1G0IA 2H9BA 4JWOA 2OO9A 2L09A 4QBAA 4DV0M 2ZYKA 4R3DA 1YPNA 1R1NA 3T66A 2CUZA 3W0LB 3ZKLA 2VQFM 3BFUA 2X49A 4KODA 3UK4A 1F9BA 2UUBM 2VPOA 4WXJA 4ZEFA 3IJXB 3CVGA 4O3CA 4F2OA 1FPKA 4NC6A 4IO5A 4FWDA 4M0DA 4GWOA 3G3GA 4R6HA 3RT8A 2KRUA 2UVIA 1R6ZA 2K9DA 3SKPA 4NXMM 1Y8GA 3LVWA 3TTLA 2HPGA 3HHYA 4I8OA 1PJTA 4NE4A 5EQ8A 1T0KA 4HCYA 5KCJA 4H5GA 1FBHA 4FCTA 3B89A 5LOMA 2R46A 1LCFA 4FECA 1G41A 2Q9TA 3TMGA 4P16A 4NWDA 5HM4B 3SARA 1RYXA 3OXNA 1TF0B 3T9XB 4PFUA 1L1TA 4LATA 2F97A 3ZH9B 4XKPA 1FCKA 1DOTA 4N91A 1B3GA 1X37A 2LXEA 2KNVA 4FAJA 1GJSA 2DWZB 3V8XB 2DXRA 1D9VA 3B7DA 2KRKA 2N35A 1D9YA 2QCUA 2GNOA 2P1SA 4RNAA 2FH0A 5AA1A 3HWSA 4KQPA 5FBPA 3EHUA 1YTVA 2KNZA 5TU0A 4KYSA 2X4AA 1Z5BA 1IBLM 4JI1M 1QVRA 4TQUQ 1H76A 4G8NA 2HHHM 4NHBA 4NF6A 5KCJB 4MH0E 4BDRA 3SC3A 3S9LC 3KS4A 5C18A 1O64A 3T0JA 2F6PA 3T1YM 1VSOA 5KPRA 4LFBM 2P0SA 5I2NA 3PVSA 1Z5AA 2Z8DA 2XX7A 3TWKA 3K4UA 4NF8B 4PAKA 1WVJA 3KOSA 3FTDA 2MGWA 1LLSA 5ICTA 1FSAA 4I8CA 1HT1E 4AQ4A 1SI0A 5CMBA 1B32A 3K2DA 1FPIA 3ECRA 4X1BA 4ZZEA 2R4EA 2AIXA 1SG9A 2JUJA 3LC8A 4WURA 2LH0A 2EJSA 1DTGA 2DQVA 2XH9A 4ANRA 1C7YA 1SBPA 4B7FA 3OO8A 2HQ0A 3VXCA 3H4ZA 4R74A 1UQWA 1SI1A 2QENA 3QUFA 4L17A 4ND9A 2DSFA 4F1VA 1INPA 4GWYA 3LR1A 3QWLA 1FTKA 4PE5B 5I5PA 4LN5A 4DV4M 5DEXA 3FV1A 1ZAEA 5EYHA 4B7GA 4KLNA 2O5RA 2FVZA 4PC9A 5IKBA 1YE9A 1KZ8A 4JSOA 4LONB 3GPYA 4RK2A 2VF8A 3SESA 4AS5A 4FCWA 1Y3PA 3KFUG 1MPBA 2JXNA 3SMPA 3Q8XA 3B74A 4NX1A 1WJ7A 4F19A 3GQ5A 1VR5A 2ONRA 3PPQA 4GVOA 4Q30B 3K1NA 3W0FA 1R9LA 3EKIA 2QS4A 3QIMA 3LSFB 1A5TA 3KN8A 4IY5A 1IXIA 2Y7WA 2F7BA 2P3NA 3GLGB 3C34A 4PFRA 3HO7A 5I3SA 3K92A 1Y1MA 3FTEA 1SXJC 1JR3D 2F5QA 1B40A 2YNMD 2Q2AA 4THIA 2JZ1A 3MSTA 1MY1A 5EHSA 1NH8A 1KYIA 2JY7A 1LBVA 4OW0A 3L27A 4A3VB 1UIVA 3FBPA 3J81S 1DSNA 4NG7A 1HT2E 2AHMA 3UZUA 1A55A 5JI3E 4L78A 3HU3A 3E9SA 2PMSA 1MXWA 1NI9A 2ZYOA 4KCDA 2HAKA 3IOTA 4PGPA 3DFZA 1IXRC 4IIWA 1OLCA 5ET7A 3S4UA 4GEWA 2UVHA 4F18A 3KP0E 1YAEA 2DWAA 2JY6B 1GV8A 2FIXA 4G4PA 3QAUA 5IT9S 4QHSA 4GL0A 5I58A 4IO3A 2DE2A 1IM2A 4JI3M 2DOJA 3UMMA 2B3TA 4KT0F 3Q29A 1EH3A 4U1ZA 3U1OA 3PPNA 5H8HB 4R71A 3VXBA 1LBCA 4NF4A 4L6V6 2XWOA 4QNRA 3FUXA 1QYRA 2A5TA 3C36A 4EQ7A 3ONMA 4GWUA 1FRPA 2Z8YM 2XSZD 1B0HA 2CHGA 1LFGA 4NWCA 3KG2A 1Y4TA 4F22A 1SW1A 2XZUA
chains in the Genus database with same CATH topology
4GHAA 2C99A 3FUWA 1NSFA 4GIPA 3K6UA 2G93A 4B3SM 5KZTA 3FUTA 3KOXE 3UK6A 3L29A 3VK7A 3PUYE 5F3WA 1P1WA 3TTNA 1C1KA 4FEDA 1ELJA 3SAUA 5H8FA 2R18A 3A09A 2QBYB 3KSJA 3CI8A 2WKYA 3PUWE 1XC1A 3TELA 4MGIE 4GXAA 4YKPA 3T1HM 4H8JA 4RNSA 2UYEA 5ITOA 4ONYA 3BOSA 1ZIUA 4DXCA 2V6ZM 2R45A 2Y7RA 3GLGA 3D4GA 3EIHA 4IO4A 3T9HB 4K3FA 3FTFA 3M3FA 2Q89A 1J5EM 4LQ5A 5I57A 1SW4A 4OETA 2GH9A 1A54A 2FOIC 3IK6B 2Z7JA 1LB9A 4NTLA 1A8EA 1JR3A 3SBJA 3U6QA 2F5XA 3VLVA 2K47A 3KN7A 4MGHA 2DXYA 4LZ7A 1JEUA 4F3BA 4FE8A 1JW4A 4LF6M 2XX8A 1MY0A 1PEBA 3U93A 1L2CA 4U4SA 1DGBA 2AL5A 3DP6A 2O51A 3H03A 1G59A 4NF5B 2F7AA 1NHWC 1XWIA 2QS3A 2R9JA 4KHZE 1QAQA 2XHDA 4NRWA 5TPAB 4PP0A 1AIVA 4KHPM 1RKMA 3N5LA 2Y84A 1QULA 1II5A 5TP9A 3SHFA 4YKKA 4I5SA 3U6DA 3FIRA 2Y0QA 1POTA 3VDFA 4IJFA 3SERA 1S9TA 1N3WA 3GPUA 4LF5M 1ZU0A 2NWJA 4LJ4A 3KOZE 4O3BA 4G68B 5A5XA 3EF7A 3TWLA 3M3KA 1FJGM 2LWXA 1FTOA 2QMWA 1URDA 3V89B 2H1RA 2CHQA 1SD3A 4JXJA 1NNFA 2VIIA 5BR8M 1N34M 3K8ZA 3TFLA 4OZ9A 4ZE8A 1B5HA 2Z22A 3H6WA 1N32M 1DPPA 4IBEA 4KI0E 1XC8A 4BB9A 1AOVA 1A99A 1HNZM 3L2AA 5KQDA 3MW0A 4U1OA 2QSXA 2UVGA 4R9FA 4IBGA 1B5IA 1DGHA 5JTYA 3AFHA 2X7QA 3LVVA 1R7RA 4B3RM 2W7YA 3PMWA 4XKRA 4LJAA 4IGRA 3L28A 5EJCA 5EXSA 3OELA 5CMCA 2V3UA 4DR3M 1PBQA 5JTYB 4DUZM 4FWGA 3O6HA 3FVNA 4XGIA 4B7HA 2ANJA 1MRPA 4TLLB 1XVXA 2GHBA 1N77A 5EXXA 3RGSA 1PC3A 4RA1A 3SATA 4AKIA 4LGMA 5F7VA 3B6WA 4OYVA 2XGNA 4YU0A 2HEUA 3GRYA 4OXVA 5EYFA 4I1DA 2V25A 4MLVA 3M7GA 1PM5A 3LQQA 3OSQA 4X66M 2XXIA 4DR2M 3D8BA 1B0LA 3TCFA 1L5TA 2AL4A 2NQ8C 3H4MA 8CATA 1A7LA 1SYIA 4G68A 2HAUA 5FTJA 3MZBA 1BIYA 3VE1B 3FYDA 4OVZA 2O1LA 4DR7M 3VLWA 4KR5A 4OFJA 3WAFA 2QBYA 3CFZA 1FTJA 3M6AA 5ITXE 1QVSA 4EXLA 5ITUA 4N07A 3KZGA 4ISUA 1B6HA 1PB8A 3TWMA 5BWJA 3KGCA 3MBPA 3PPOA 1MXUA 2M8CA 4BBAA 5TP9B 3DZDA 1G3IA 3E9XA 2DS9A 3H6TA 4M1VA 1J7KA 5HBCA 3AOGA 2DZOB 2NVUB 3QSLA 2VD2A 1PB9A 1E9SA 2R4JA 3HKPA 2XXHA 1IN4A 3BFTA 2Z4SA 1S7YA 4QOZC 2ABHA 2PBWA 3J2PB 1NNTA 7CATA 2C96A 4DV7M 1JW1A 1IY2A 1N78A 1IN7A 5EP2A 5FHMA 4XKNA 2I0CA 3RGPA 1UIUA 3VLFB 1GR2A 2E0SA 3A3UA 2PT1A 4MGYE 1GL6A 2ALUA 5E6JA 4MM3B 3LSWA 4P0IA 3GRUA 4GC5A 4LF9M 3TPZA 3H3GA 3HHFA 1Z6TA 3U6PA 4JI7M 1DGFA 1IQ7A 1FQFA 3EQ1A 3IB2A 2QS2A 2UXBM 2O69A 4PDGA 3TL4X 1IY1A 3SMSA 1JETA 1TWYA 5KDTB 1UTBB 1OFIA 2QJEA 2Q88A 3RUMA 4H8IA 5H8HA 5EQTA 2DWHA 3CG1A 5CI5A 4ITQA 1Y4CA 3JYRA 5FSWA 1Q3CA 4IBJA 5I58B 4PDIA 4G4RA 2P2AA 2RC9A 3FJMA 4NOOB 4QHQA 1EZPA 3MWBA 1M5BA 4JI5M 3RTFB 2HCAA 3W15C 3SASA 1Z7NE 2NOOA 5DVFA 2OPFA 3IR1A 4IB2A 4QFLA 1J1NA 2ONSA 1JVXA 5ITQA 3LQRA 2F78A 3EHSA 3B9PA 1N3XA 4OWDA 3GO8A 3VKHA 3DM0A 2V93A 3TQLA 3L6HA 2UXDM 2DZNB 3C9HA 3UGWA 4IBDA 3W9VA 4P11A 4NXNM 3MZ9A 1ZKBA 4OQOA 4ZDMA 5DVJA 1H43A 2ESNA 2A5TB 2VOZA 5ISUA 2EO2A 4LZZA 3IB1A 2D3IA 4KYDA 1M5EA 3UGJA 3G3JA 1SQYA 3BKIB 4GKJM 1B7UA 1ORYB 4PETA 3TCHA 4IGTA 4DXUA 3FJ7A 3GQ4A 4IBBA 2HFBA 2OZZA 3FZVA 2QP9X 1GLNA 2OWSA 1HNWM 5FTNA 4QOSA 5E26A 4R73A 4DR6M 4BDQA 4D81A 4HS7A 4KFQA 3HV1A 5IAIA 1OLAA 3HPIA 1K3XA 4DIGA 1L1ZA 3GP1A 3TDJA 3F11A 1IXGA 3H6VA 3O29A 4OFLA 4ELOA 4I81A 3RLFE 5AE4A 4JI4M 3KEIA 1N04A 4LG2A 4YB5A 4OX9M 3DA1A 5C1BA 3T38A 3RN8A 1EU8A 1FQDA 1FTLA 1AH5A 4WEPA 3PPRA 2OJTA 3KSXA 4O3AA 4TLMB 4GOTA 4AB5A 2XD2A 2CFOA 4Z8XA 3KOTA 4EUOA 2H4IA 4ZEDA 4DR1M 1B3LA 3OO9A 4ZECA 1IXHA 4OVZB 1LSTA 3HJSA 4F3SA 1SXJE 1MM7A 3S2VA 4Q5TA 3L26A 1LGBC 3OMBA 4JDFA 1Z59A 2I7PA 5ELVA 2ZM6M 3RFWA 2FE8A 1HQCA 3KJTA 3K1MA 4JI0M 1N0TA 2DVWB 4G8MA 3M3LA 4HW8A 4R2BA 2D7HA 5DTBA 3RE8A 2HZKA 3WHKA 1B2HA 3IOVA 1IN8A 3MPKA 4LZJA 3FD3A 2B3FA 4DR4M 3HGIA 3GLFA 2DYXA 2O7IA 4OFOA 3M0EA 3U6EA 4YZZA 2V3TA 1DTZA 1Q3BA 3AV0A 2VP1A 3EIEA 3GLHA 4IBCA 4Q8RA 1MXZA 2KLFA 4IBKA 3GLFB 3RY3A 2IEEA 4X62M 5LMNM 1B3EA 5CRYA 1MH4A 2F5PA 4G6ZA 3CSBA 5CM6A 2I48A 3SAVA 1R9QA 3LUYA 1DPEA 2F5NA 5B7DA 1Y1ZA 3HU2A 5KQ8A 4LRTA 2VGQA 2Y7PA 2I0BA 1I6AA 3ZC7B 3DLNA 4LF4M 1MQJA 3TUSA 3ILUB 3I4YA 2D7GA 1IITA 4C0RA 3SEWA 2EA0A 5BPVA 3LBSA 5FTLA 1VFEA 2A5SA 1IUDA 3K1PA 3JZJA 4WKMA 4B08A 4BDLA 2L6OA 4PFWA 1QUIA 4ZE9A 2CV0A 1B52A 4GRKA 1IN6A 5ITYA 4I4LA 4FEBA 3CTWB 3I6VA 3GPXA 1QKAA 4MGZE 1JW5A 2OBGA 3FGSA 3PU5A 4JWXA 1NNJA 5FTKA 1NY5A 1QAOA 1RYOA 5L8DA 2J7OA 1EZOA 4F29A 4H6DA 2VQEM 3MVZA 3R7XA 3MUQA 2D5WA 2GFEA 2OWTA 4RF0A 2F8DA 4B3TM 3JV9A 1O7TA 4EF2A 2PX1A 4QRZA 5AA2B 3FYCA 3TQWA 4GD5A 5M2VA 4BLCA 3PMVA 5EP4A 4N13A 1EE8A 3S9MC 4CISA 1PJIA 3U5ZB 2REGA 2Y7IA 2Z23A 1GKIA 4OENA 4EQBA 1I6BA 2XLJA 3K00A 5K2XA 4W5WA 4FW9A 1L2BA 3VVEA 3R6UA 2V1CA 5BUUA 3K6XA 1VFDA 3C4MA 1P99A 1SW2A 2QPQA 2VHAA 4XKQA 3FXUA 3L6GA 3OD7A 5JI2E 3QXMA 2XXPA 4TOZA 3FUVA 2H99A 4AG6A 1AMFA 4ELPA 2O84X 4QFNA 3DOAA 1N33M 2ZAOA 3PV0E 1FQEA 4ZEIA 3KVWA 4JI2M 3FVOA 3DP8A 1TDHA 3H6UA 1LAXA 4R75A 2XXVA 1HSLA 2UVJA 2OQ4A 4FCVA 3TE6A 4AI6A 3KN3A 4YAHX 3U72A 1NKXA 3C32A 3O6IA 4POXA 1OFHA 4YMAA 4DLDA 3E4RA 2H98A 2Z8EA 2DWIA 3C31A 2PVUA 3G3HA 3OEMA 3N6TA 3PNYA 3CFXA 2ZANA 3SDFA 1B4ZA 4LY6A 3VFJA 4GFRA 2VD3A 1B05A 1DO0A 2YR0A 1DGHB 1K3WA 3G3FA 5ITTA 3T9VA 4PQJA 3S9NC 4NSOB 1XNRM 3K02A 3ZCBB 4F3GA 3D4CA 4E0WA 4FIMA 2X26A 4E0XA 2BJWA 3TEPA 3T96B 4LP2B 1QZMA 3H7MA 4QSEA 4M9SA 5KPTA 2XXTA 1KFVA 2QRYA 4YMBA 1H45A 1FQAA 4C1TA 4RPNA 2KXEA 2XX9A 3VFDA 1MXYA 1ANFA 2QL3A 3IX1A 4CGYB 2RF1A 4GL8A 3MC2A 5IZ7D 4AZFA 4LCBA 2XD3A 4ZS9A 4Z7EA 3K1JA 2XZFA 4DUYM 3IB0A 1M5CA 3CFLA 4FVMA 1IXCA 4YICA 1JVYA 3FATA 5FTHA 3N6UA 4AW4A 5I2NB 1P1QA 1CB6A 2CV2A 1WXQA 1QUKA 1D3KA 4NF6B 1IN5A 3V83A 2DVCA 2XXQA 1XVYA 3AKZA 4LJ5A 5AA4A 3HHZA 3SEVA 2HZLA 5FHOA 5DVIA 3IG5A 1ZBMA 1BLFA 3SYKA 3MHVC 2M5ZA 4M9ZA 3A3CA 1Y3QA 4JBZA 2IA4A 3QUJA 4HCWA 4C1UA 4LJ8A 1MG1A 4QSDA 1NHGC 3USDA 3HN0A 2C9OA 3IOUA 1HNXM 4II7A 3MP1A 3IOWA 4HL4A 1TH4A 4RYAA 2Y0TA 1XS5A 3DP4A 3CSGA 3VVFA 3SFZA 1QW0A 2CE7A 3MVWA 2HKJA 1HSEA 4DV2M 2KA6B 2KW0A 3K6WA 2ZXTA 1LAFE 5EHMA 2EUCA 3CIJA 2YQZA 3GXAA 3GLHB 3FD9A 4YB7A 1B9JA 5DYHA 4Q0CA 2RCBA 3MP6A 1MPDA 1MX0A 3PUXE 1QQWA 3I5OA 4HTGA 4X48A 3U61A 5DT6A 4GH9A 2ZNTA 4GIZA 1LFIA 4IO6A 1A8FA 1SYHA 1POY1 1IQPA 4BDNA 1ZLQA 2XXWA 4OMBA 5AA2D 2M60A 3HSTA 1Z5CA 4FWHA 2B65A 2O6AA 2LAOA 3I51A 2ZMBA 1LCTA 1N84A 3ODBA 1XXHB 4IO7A 3QYTA 2L7HA 4MLQA 4LUBA 3LSXA 4IO2A 3MPLA 5AA4B 5H8QA 2GHAA 2F5SA 1MY4A 1GVNA 4H67A 3ZKKA 4M0WA 1XXHA 1LBBA 5KPZA 2AYSA 4QFKA 1TXFA 1BP5A 3RPWA 4KO8A 5GKNA 3TTMA 4Z6YA 4DXBA 4KCCA 1FQCA 2PT2A 3U6MA 4LJ7A 1R2YA 1K82A 1VE4A 3KXEC 1L8QA 3OSRA 3VLUA 4ZEBA 2ZBKB 4I9DA 3MVXA 2UXCM 3V5AA 1NFTA 2CZLA 1GGGA 3G3KA 4IY6A 4YHHM 2X8AA 1URSA 3H06B 3UORA 1WODA 4OEVA 3U6SA 1AL3A 2ONKE 3A42A 4PD2A 5EP3A 5ITXA 2UUCM 4EIWA 4FORA 3U61B 4JWYA 4H0WA 3SEXA 5A5XB 3N94A 5H8QB 2NXOA 2V1UA 2O7UA 1ATGA 5I59B 4JV5M 5I56B 4OEUA 3K6VA 2QZ4A 3FUUA 1D2NA 4ZPXA 4XBOA 1B46A 4G68C 4PCZA 2RKOA 2O1MA 2CV1A 1KWHA 4S12A 4LJ6A 4IBFA 1G8PA 3HJQA 2J7NA 3MZ1A 1OQGA 3O97A 1QUJA 1FTMA 3Q27A 4RXLA 1MU5A 1VDDA 1R6BX 4GRIA 2D21A 3U94A 3U6OA 2DXIA 2CEAA 2E1SA 2RGOA 2OK2A 3AOEC 3T15A 1URGA 4H5FA 1TFAA 2ZAMA 2R62A 1YSYA 1OJLA 4ELRA 4F39A 2H5YA 3OENA 1NMUA 4OESA 5CMKA 1T3TA 1QAMA 4X65M 2DVZA 3A98B 1ZTYA 4F2QA 2OLBA 5H8SA 2CMOA 4PFTA 2I7NA 5IWAM 1IIWA 4EXKA 3K0VA 3O66A 3MJ5A 1LV7A 1OIBA 3IO6A 2Y7KA 4NMYA 4HLQA 2LNHC 3SAWA 4BDMA 5L9MA 1LFHA 1H3DA 5H37D 2OCUA 3PGFA 1Q39A 4YKIA 4LRSA 1B3FA 3IG8A 2G5GX 4R6KA 2I4BA 2I3WA 4LQ2A 4DR5M 4U21A 2JA2A 1P1UA 3G3IA 3I3VA 2I3VA 3C58A 2ERCA 4L15A 2F34A 4ESXA 1D4NA 1PBPA 2DHRA 3O6GA 4YKJA 3NBIA 4CHTB 3ILKA 5AA2A 5FTMA 3ILTB 5KO3A 5H8NB 4BDOA 1IXSB 2DE3A 4LF8M 3U8QA 3GBAA 4AKGA 4ESWA 4U23A 3OOAA 4GF8A 4NSRA 3QK6A 2R6GE 2UXAA 3AOEA 1UTHA 1B1XA 1NNKA 2ZNUA 4ECFA 5HPQA 3VDUA 1XMOM 5H8FB 5JK4A 4DZ1A 3R9XB 3OO6A 4AG5A 1MH3A 3PNVA 3T22A 4GC9A 1H6UA 3FV2A 3A45A 5DYGA 4XTCQ 4GMQA 5ITRA 3OEKA 1XHBA 3RTWB 2YJPA 4DCXA 4PFYA 2KZUA 3PFIA 4RPOA 4P0GA 4FD2A 3MVYA 3Q26A 3PUVE 4JI6M 2FYIA 3VK8A 5LMUM 4B3MM 2RGHA 4G8HA 3ZSFA 4GHLA 1IY0A 3HU1A 4F1UA 1MY2A 5FLXS 3GRRA 1B51A 1Y20A 4DV5M 2XEPA 3L25A 1XMQM 2DWNA 3FKEA 3MK6A 2F5OA 4JYAM 4H65A 4NF8A 4X1DA 1OVTA 1NNUC 2F6GA 3WAEA 3VVDA 1M5FA 3EPEA 3Q25A 1JQFA 1FQBA 3CRBA 2UYFA 1IBKM 2C9CA 2Q2EB 3FTCA 1BKAA 1L2DA 1MXXA 2QMXA 1O63A 3TQSA 3KOWE 3KJ7A 1HQYE 3TODA 2QS1A 4ZEKA 1B3HA 3CF0A 3P7IA 2Z4RA 5J1DA 1NVMA 3ZS6A 3BBRA 1MM6A 2YFQA 4MFIA 1B7ZA 4GQOA 3PXGA 1Q1KA 4WW0A 2Y21A 4POWA 1NH7A 3HHXA 4OVJA 4REZA 1MQDA 2H25A 2XXUA 1OQHA 3VV5A 3NWLA 4ELQA 3WHLA 2Y20A 3KW6A 5ITPA 1GVCA 3B6TA 3J80S 1I4WA 5K2YA 2FA7A 1MQHA 4KYEA 5A2QS 3PD9A 1NY6A 2R65A 5L9SA 2Q8JA 2QPAA 3Q28A 1QANA 3THGA 1DGGA 4IJEA 3HHGA 3GBBA 3GLIA 2E5LM 5IREB 4UACA 2I58A 3T93B 3FUZA 4EQ9A 1EZ9A 2DWJA 1J09A 3GQ3A 3IJOB 4F1YA 1JNFA 1I69A 3KBRA 3AJIB 1TH2A 1MDP1 3GLIB 3RGYA 4F3PA 4GITA 4KPTA 2THIA 4L8RC 4LFCM 3R26A 1HR0M 1CE2A 2R71A 4NF5A 4Z0IA 1E9RA 1LB8A 3RQTA 1JEVA 4AQYM 2G29A 1LAHE 4OHNA 4G4OA 2HCBA 4JN6A 5I59A 4I62A 1OMPA 4U2RA 1SVXB 1M5DA 2DE4A 2FNAA 4N6PA 1LAGE 3PPPA 3U92A 5DYIA 1PDAA 5I57B 3UP9A 4DV3M 2D7EA 4GKKM 5FHNA 2XXRA 1HSJA 1Q35A 1MQIA 4JI8M 1US4A 2FNCA 4RJZA 1E32A 3G7WA 4R72A 3J7AS 4QF9A 3KFMA 4RK9A 1WDNA 2RC7A 3FASA 2REJA 4G77A 3J7BA 1TDZA 4FJPA 4G4QA 5AA3A 1TFDA 3KP1E 1NJFA 1SW5A 1E94E 4LJ9A 3JR4A 3SEUA 1Z7ME 4DV6M 3MAMA 1MY3A 3IL1B 4D82A 1SXJB 1N75A 2G8LA 3UJNA 4EDPA 2O68A 3TTRA 5I84A 2KZSA 4LGYA 1XOCA 3TPAA 3MP8A 4YB6A 3TYHA 3HHWA 4MBPA 4QFOA 4R7GA 3JR5A 4R6YA 2L7IA 2YPNA 2ZYMA 1YCJA 1I94M 1B4HA 1B1HA 3U6LA 4K0KM 4RF1A 1N7XA 4X9TA 1PJJA 3IORA 4R9GA 2ZNSA 4MB7A 2PYYA 2RC8A 4U22A 1S50A 3SETA 4YY3M 3VDPA 3FXQA 1XT8A 4XXUA 5TPAA 2F35A 2F4VM 3IAZA 1Y9UA 3K2LA 3RNNA 3JAMS 2Z3XA 3PD8A 3GZGA 3MJNA 4GLIA 3E13X 1MQGA 1NNPA 1MXVA 5CMMA 3VKGA 2C5RA 5CBRA 4L16A 3T9UA 1GTKA 3EN3A 3O28A 1N7WA 1ZMGA 4AKHA 3UA8A 3HJ8A 3TZAA 3GLBA 3MQ9A 3QAXA 4F31B 2DWLA 4KD5A 5CBSA 2W82A 2BNKA 5EXTA 1ZJLA 4MF3A 2V84A 1YUBA 1W5TA 1A40A 4UA8A 4OTEA 5I2KB 3E3KA 3GRVA 4NL4H 1B5JA 1P1OA 3AXFA 4IBIA 3THIA 2GRVA 1PB7A 4BLAA 3CF6E 4GXSB 4LFAM 4NEDA 3TCGA 2HAVA 1FW0A 4AB6A 4TUWA 2RCAA 3TAJA 3AL0C 2V3QA 4H1XA 5FTIA 2HL7A 1MDQA 1OVBA 4LZ5A 2YLNA 4LA9A 5JEIA 1N76A 1SDXA 4D80A 5DNYA 3FJGA 4M9XA 4LVQA 4R2FA 3B6QA 3PMXA 1XHYA 4M4GA 2C98A 4EF1A 5H8NA 1QKBA 4ZZAA 2UUAM 3U60A 2BJJX 3PUZE 4U4XA 5I2KA 1BTJA 1TH3A 1NJGA 3O2AA 1MPCA 1DO2A 2I49A 1G4AE 1Y3NA 3DELB 3O9PA 4QFPA 2XSZA 1UM8A 4PT5A 2XXYA 3J27B 5DEXB 4DE8A 4MGKE 3FXRA 1XNQM 4NF4B 1JQJC 4JXIA 3CR9A 3TTKA 4FATA 1S3SA 4WEDA 2BJVA 5KDTA 1MS7A 2RKMA 3D8LA 1B7HA 1H44A 3S9EA 1B58A 1QJMA 2KEBA 3LSLA 2UU9M 3SYLA 3GPPA 1SXJD 5CC2A 2I4CA 3M8UA 4JSDA 3KDSE 1UTHB 1R2ZA 2RINA 1W5SA 4QSCA 2DP8A 3KOYE 3W9WA 3UN6A 4OERA 2F36A 5EP1A 2Z8FA 3U60B 1ZQ9A 1TGUA 4G4NA 4QHTA 1USYH 4LZ8A 2Q2CA 4OU7A 1TT1A 1P1NA 2NUVA 3FVKA 4RY1A 2XFTA 5L9OA 3U5ZA 2B3BA 5B70A 3C35A 5I56A 3CG3A 3HCQA 4MH5A 1IXZA 4QNMA 4JB7A 2ZYNA 5F1QA 2CHVA 1UTBA 4G2ZA 3OO7A 4L4UA 3C33A 3CF2A 1FNNA 3KS8A 3N26A 1IEJA 1IBMM 3K01A 1I6QA 4X64M 2XXXA 1DMBA 2A5YB 1USYE 3A46A 2FFJA 1US5A 2F7CA 2HXWA 2P5TA 3IO4A 3R8FA 4XIGQ 2I6EA 2X7PA 1KSFX 3FVGA 4LF7M 4DCYA 3UIFA 1N36M 4DV1M 5EXPA 2XF3A 3U6CA 2DWMA 4DDDA 5ICQA 2XFSA 3RT6B 4NRVA 3I4VA 3EHTA 3SEYA 3TKDA 1IZ1A 3LMMA 3SHGB 1SXJA 3OTOM 1GL7A 1NL5A 2H9BA 4JWOA 2L09A 4DV0M 2ZYKA 4R3DA 1YPNA 1R1NA 3T66A 2CUZA 3W0LB 3ZKLA 2VQFM 3BFUA 2X49A 4KODA 3UK4A 1F9BA 2UUBM 4WXJA 4ZEFA 3IJXB 3CVGA 4O3CA 4F2OA 4IO5A 4FWDA 4M0DA 4GWOA 3G3GA 4R6HA 3RT8A 2KRUA 2UVIA 1R6ZA 3SKPA 4NXMM 3LVWA 3TTLA 3HHYA 4I8OA 4NE4A 1T0KA 4HCYA 5KCJA 4H5GA 4FCTA 5LOMA 2R46A 1LCFA 4FECA 1G41A 2Q9TA 3TMGA 4P16A 4NWDA 5HM4B 3SARA 1RYXA 3OXNA 3T9XB 4PFUA 1L1TA 4LATA 2F97A 3ZH9B 4XKPA 1FCKA 1DOTA 1B3GA 1X37A 2LXEA 4FAJA 2DWZB 3V8XB 2DXRA 1D9VA 3B7DA 2KRKA 1D9YA 2QCUA 2P1SA 4RNAA 5AA1A 3HWSA 4KQPA 3EHUA 1YTVA 5TU0A 4KYSA 2X4AA 1Z5BA 1IBLM 4JI1M 1QVRA 4TQUQ 1H76A 4G8NA 2HHHM 4NF6A 5KCJB 4MH0E 4BDRA 3SC3A 3S9LC 3KS4A 5C18A 1O64A 2F6PA 3T1YM 1VSOA 5KPRA 4LFBM 2P0SA 5I2NA 3PVSA 1Z5AA 2Z8DA 2XX7A 3TWKA 3K4UA 4NF8B 1WVJA 3KOSA 3FTDA 5ICTA 1LLSA 4I8CA 1HT1E 4AQ4A 1SI0A 5CMBA 1B32A 3K2DA 4ZZEA 3ECRA 4X1BA 2R4EA 2AIXA 3LC8A 4WURA 2LH0A 2DQVA 1DTGA 2XH9A 1SBPA 4B7FA 3OO8A 2HQ0A 3VXCA 3H4ZA 4R74A 1UQWA 1SI1A 2QENA 3QUFA 4L17A 4ND9A 2DSFA 4F1VA 3LR1A 3QWLA 1FTKA 4PE5B 4DV4M 5DEXA 3FV1A 1ZAEA 4B7GA 4KLNA 2O5RA 5IKBA 1YE9A 4JSOA 4LONB 3GPYA 4RK2A 3SESA 4FCWA 1Y3PA 3KFUG 1MPBA 3SMPA 3Q8XA 4F19A 3GQ5A 1VR5A 2ONRA 3PPQA 4GVOA 4Q30B 3K1NA 3W0FA 1R9LA 2QS4A 3QIMA 3LSFB 3KN8A 4IY5A 1IXIA 2Y7WA 2F7BA 3GLGB 3C34A 3HO7A 3K92A 1Y1MA 3FTEA 1SXJC 1JR3D 2F5QA 1B40A 2YNMD 2Q2AA 4THIA 1MY1A 5EHSA 1NH8A 1KYIA 4OW0A 3L27A 4A3VB 1UIVA 3J81S 1DSNA 1HT2E 2AHMA 3UZUA 1A55A 5JI3E 4L78A 3HU3A 3E9SA 2PMSA 1MXWA 2ZYOA 4KCDA 3IOTA 3DFZA 1IXRC 4IIWA 1OLCA 3S4UA 4F18A 2UVHA 3KP0E 1YAEA 2DWAA 1GV8A 4G4PA 3QAUA 5IT9S 4QHSA 4GL0A 5I58A 4IO3A 2DE2A 1IM2A 4JI3M 2DOJA 3UMMA 3Q29A 1EH3A 4U1ZA 3U1OA 3PPNA 5H8HB 3VXBA 1LBCA 4NF4A 4QNRA 3FUXA 1QYRA 2A5TA 3C36A 4EQ7A 3ONMA 2XSZD 1B0HA 2CHGA 1LFGA 4NWCA 3KG2A 1Y4TA 4F22A 1SW1A 2XZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD5 A;  5CBS A;  1VE4 A;  1ZJL A;  4MF3 A;  3RN8 A;  2V84 A;  3K6U A;  2G93 A;  3OSR A;  1EU8 A;  5KZT A;  1FQD A;  1A40 A;  1FTL A;  4UA8 A;  1AH5 A;  4OTE A;  5I2K B;  4ZEB A;  3VLU A;  3E3K A;  3PPR A;  2OJT A;  3KSX A;  4I9D A;  1B5J A;  3MVX A;  3PUY E;  4O3A A;  4TLM B;  1P1W A;  1P1O A;  3TTN A;  3AXF A;  4GOT A;  1NFT A;  2CZL A;  3V5A A;  4FED A;  1ELJ A;  5H8F A;  1GGG A;  3THI A;  3G3K A;  4IY6 A;  3A09 A;  2XD2 A;  3UN6 A;  4AB5 A;  2GRV A;  3KOT A;  4EUO A;  3KSJ A;  1PB7 A;  4BLA A;  1URS A;  2H4I A;  3CI8 A;  3H06 B;  4GXS B;  3UOR A;  4ZED A;  1WOD A;  4NED A;  2WKY A;  3PUW E;  1B3L A;  3OO9 A;  4OEV A;  1AL3 A;  1XC1 A;  2ONK E;  3TEL A;  1IXH A;  4ZEC A;  3TCG A;  4GXA A;  1LST A;  4YKP A;  2HAV A;  4H8J A;  4FOR A;  1FW0 A;  4AB6 A;  4F3S A;  2RCA A;  1MM7 A;  3S2V A;  3TAJ A;  4Q5T A;  4JWY A;  4RNS A;  2V3Q A;  4H1X A;  5FTI A;  2UYE A;  4H0W A;  3SEX A;  5A5X B;  3N94 A;  5H8Q B;  1LGB C;  2NXO A;  4ONY A;  5ITO A;  3OMB A;  4JDF A;  1ZIU A;  4DXC A;  2O7U A;  1ATG A;  5ELV A;  1OVB A;  1MDQ A;  4LZ5 A;  2YLN A;  4LA9 A;  5I59 B;  5JEI A;  2Y7R A;  1N76 A;  1SDX A;  5I56 B;  3KJT A;  3K1M A;  4OEU A;  3K6V A;  3D4G A;  1N0T A;  4IO4 A;  3T9H B;  3FJG A;  4LVQ A;  4K3F A;  4R2F A;  1B46 A;  3B6Q A;  3M3F A;  4G68 C;  2Q89 A;  3PMX A;  4G8M A;  1XHY A;  2O1M A;  3M3L A;  4LQ5 A;  4M4G A;  5I57 A;  1KWH A;  1SW4 A;  4F19 A;  5AA4 A;  4EF1 A;  4OET A;  4R2B A;  1QKB A;  2GH9 A;  5DTB A;  5H8N A;  2BJJ X;  3PUZ E;  4YB5 A;  4ZZA A;  1A54 A;  4U4X A;  3MZ1 A;  5I2K A;  1BTJ A;  1OQG A;  2HZK A;  3O97 A;  1QUJ A;  1FTM A;  3IK6 B;  3O2A A;  1MPC A;  1B2H A;  2I49 A;  4NTL A;  1LB9 A;  3IOV A;  3Q27 A;  4RXL A;  1Y3N A;  3DEL B;  3MPK A;  3O9P A;  1A8E A;  4QFP A;  2D21 A;  2F5X A;  3VLV A;  2PT2 A;  3FD3 A;  3U94 A;  3KN7 A;  2B3F A;  2DXY A;  2E1S A;  4LZ7 A;  2XXY A;  1JEU A;  2OK2 A;  4F3B A;  2DYX A;  2O7I A;  4FE8 A;  4OFO A;  1URG A;  1JW4 A;  5DEX B;  4H5F A;  1TFA A;  4DE8 A;  3FXR A;  4YZZ A;  2V3T A;  4F39 A;  1DTZ A;  1MY0 A;  1PEB A;  2XX8 A;  2H5Y A;  3OEN A;  4NF4 B;  1NMU A;  3U93 A;  4ELR A;  2VP1 A;  4U4S A;  4JXI A;  3CR9 A;  4OES A;  3TTK A;  4FAT A;  5CMK A;  4WED A;  4Q8R A;  2AL5 A;  2O51 A;  1MS7 A;  1MXZ A;  2DVZ A;  2KLF A;  3DP6 A;  3H03 A;  2RKM A;  2F7A A;  1B7H A;  1H44 A;  1ZTY A;  4NF5 B;  2QS3 A;  4F2Q A;  3S9E A;  1B58 A;  2R9J A;  4KHZ E;  2XHD A;  2IEE A;  1QJM A;  3RY3 A;  2OLB A;  1B3E A;  2CMO A;  5H8S A;  4PFT A;  3LSL A;  1IIW A;  5CRY A;  4EXK A;  3K0V A;  5TPA B;  1MH4 A;  3O66 A;  4PP0 A;  1AIV A;  3CSB A;  5CC2 A;  5CM6 A;  2I48 A;  2I4C A;  1RKM A;  1OIB A;  3M8U A;  3IO6 A;  1UTH B;  4JSD A;  2Y7K A;  1R9Q A;  2RIN A;  3LUY A;  3N5L A;  4NMY A;  4QSC A;  2DP8 A;  3W9W A;  4BDM A;  2Y84 A;  5L9M A;  1LFH A;  1H3D A;  1DPE A;  1II5 A;  1QUL A;  2F36 A;  2OCU A;  4OER A;  5TP9 A;  1Y1Z A;  2Z8F A;  4YKK A;  3PGF A;  2VGQ A;  2Y7P A;  4YKI A;  2I0B A;  1I6A A;  1B3F A;  3DLN A;  1MQJ A;  4R6K A;  3FIR A;  3ILU B;  2I4B A;  3TUS A;  1POT A;  2I3W A;  3VDF A;  1IIT A;  4C0R A;  3SEW A;  1USY H;  4LZ8 A;  2Q2C A;  1TT1 A;  1P1N A;  2NUV A;  4RK9 A;  3LBS A;  3FVK A;  4RY1 A;  4LQ2 A;  3SER A;  1S9T A;  1N3W A;  5L9O A;  2B3B A;  4U21 A;  5B70 A;  3C35 A;  1ZU0 A;  1VFE A;  1P1U A;  5I56 A;  2A5S A;  3CG3 A;  3HCQ A;  3G3I A;  4MH5 A;  1IUD A;  3I3V A;  3K1P A;  4JB7 A;  3JZJ A;  2I3V A;  2NWJ A;  4WKM A;  2ZYN A;  4BDL A;  2F34 A;  4ESX A;  4O3B A;  4PFW A;  5F1Q A;  1D4N A;  4G68 B;  1PBP A;  1QUI A;  3EF7 A;  1UTB A;  3O6G A;  4YKJ A;  4F1V A;  4ZE9 A;  5A5X A;  5AA2 A;  4G2Z A;  3ILT B;  3M3K A;  5H8N B;  3OO7 A;  4BDO A;  1B52 A;  3C33 A;  4GRK A;  1FTO A;  2DE3 A;  3U8Q A;  2QMW A;  3GBA A;  1URD A;  4ESW A;  4U23 A;  3N26 A;  3OOA A;  4GF8 A;  4FEB A;  1IEJ A;  3K01 A;  3I6V A;  3V89 B;  1I6Q A;  2XXX A;  1QKA A;  1SD3 A;  3QK6 A;  1JW5 A;  5DVF A;  1NNF A;  5B7D A;  2OBG A;  3FGS A;  2R6G E;  2UXA A;  3PU5 A;  4JWX A;  1DMB A;  1USY E;  3TFL A;  4OZ9 A;  1RYO A;  5L8D A;  1UTH A;  4ZE8 A;  1US5 A;  2F7C A;  1B1X A;  1NNK A;  2HXW A;  1B5H A;  2Z22 A;  2ZNU A;  4ECF A;  3H6W A;  3IO4 A;  5HPQ A;  1EZO A;  4F29 A;  1DPP A;  4XIG Q;  2I6E A;  4KI0 E;  5H8F B;  5JK4 A;  2X7P A;  4H6D A;  4DZ1 A;  3R7X A;  3MVZ A;  1AOV A;  1A99 A;  3FVG A;  3OO6 A;  4DCY A;  1MH3 A;  3UIF A;  3MUQ A;  3MW0 A;  2D5W A;  2GFE A;  2OWT A;  2F8D A;  2QSX A;  4U1O A;  3JV9 A;  3T22 A;  1O7T A;  2UVG A;  4EF2 A;  2PX1 A;  4QRZ A;  4R9F A;  5AA2 B;  3TQW A;  4GD5 A;  5M2V A;  1B5I A;  4DDD A;  5ICQ A;  3FV2 A;  3RT6 B;  3PMV A;  3EHT A;  4XTC Q;  3OEK A;  5JTY A;  4N13 A;  3SEY A;  2X7Q A;  3RTW B;  3TKD A;  1IZ1 A;  3S9M C;  2W7Y A;  2H9B A;  1NL5 A;  2YJP A;  3PMW A;  4JWO A;  4XKR A;  4DCX A;  2REG A;  4PFY A;  2Y7I A;  4RPO A;  4IGR A;  4P0G A;  2Z23 A;  2ZYK A;  3MVY A;  3PUV E;  1YPN A;  1I6B A;  1R1N A;  3Q26 A;  4OEN A;  3K00 A;  5K2X A;  2FYI A;  3T66 A;  3VVE A;  3OEL A;  3R6U A;  2V3U A;  5CMC A;  3ZKL A;  4ELO A;  5BUU A;  3K6X A;  1PBQ A;  5JTY B;  1VFD A;  3BFU A;  3C4M A;  1P99 A;  1SW2 A;  4G8H A;  3ZSF A;  3O6H A;  1F9B A;  3UK4 A;  2QPQ A;  3FVN A;  2VHA A;  4WXJ A;  4ZEF A;  2ANJ A;  4XKQ A;  3IJX B;  1MRP A;  4TLL B;  3FXU A;  4F1U A;  1XVX A;  1MY2 A;  2GHB A;  3CVG A;  3L6G A;  4O3C A;  4F2O A;  3OD7 A;  1PC3 A;  4RA1 A;  1Y20 A;  1B51 A;  3QXM A;  3B6W A;  4IO5 A;  4OYV A;  2XXP A;  5F7V A;  4TOZ A;  4YU0 A;  4GWO A;  3G3G A;  4R6H A;  3RT8 A;  2UVI A;  2HEU A;  4NF8 A;  1R6Z A;  2H99 A;  4H65 A;  4OXV A;  4X1D A;  1AMF A;  5EYF A;  4I1D A;  3SKP A;  1OVT A;  2V25 A;  2F6G A;  3TTL A;  3WAE A;  4MLV A;  3VVD A;  4ELP A;  2O84 X;  4QFN A;  1M5F A;  3EPE A;  3PV0 E;  1FQE A;  3Q25 A;  4NE4 A;  1T0K A;  4HCY A;  4ZEI A;  5KCJ A;  3OSQ A;  1JQF A;  3FVO A;  4H5G A;  1FQB A;  3CRB A;  3DP8 A;  5LOM A;  2XXI A;  3H6U A;  1LAX A;  1B0L A;  1LCF A;  2UYF A;  2XXV A;  4FEC A;  4R75 A;  3TCF A;  2Q9T A;  1BKA A;  1MXX A;  3KJ7 A;  1HSL A;  2AL4 A;  1O63 A;  2QMX A;  2UVJ A;  1L5T A;  4NWD A;  3TMG A;  5HM4 B;  3KN3 A;  1A7L A;  1SYI A;  4G68 A;  4YAH X;  3TOD A;  1NKX A;  1RYX A;  2HAU A;  3C32 A;  3O6I A;  3U72 A;  3OXN A;  4POX A;  4YMA A;  2QS1 A;  4DLD A;  3E4R A;  2H98 A;  2Z8E A;  3MZB A;  1BIY A;  2DWI A;  1B3H A;  3C31 A;  4ZEK A;  2PVU A;  3G3H A;  2O1L A;  4PFU A;  3T9X B;  4LAT A;  2F97 A;  3OEM A;  3N6T A;  3P7I A;  3VLW A;  4KR5 A;  4OFJ A;  4XKP A;  3WAF A;  5J1D A;  3CFZ A;  1FTJ A;  1FCK A;  1QVS A;  3ZS6 A;  4EXL A;  1DOT A;  3BBR A;  4N07 A;  3CFX A;  3KZG A;  1B3G A;  4ISU A;  1MM6 A;  3SDF A;  1B4Z A;  1B6H A;  4MFI A;  4GFR A;  1PB8 A;  3VFJ A;  1B7Z A;  5BWJ A;  3KGC A;  2VD3 A;  4GQO A;  3MBP A;  1B05 A;  1MXU A;  2M8C A;  1Q1K A;  3PPO A;  4POW A;  4FAJ A;  1NH7 A;  3V8X B;  4OVJ A;  2DXR A;  1D9V A;  3B7D A;  5TP9 B;  1MQD A;  1D9Y A;  3G3F A;  3T9V A;  4PQJ A;  4HW8 A;  3S9N C;  2H25 A;  3E9X A;  2DS9 A;  2XXU A;  1OQH A;  2P1S A;  3H6T A;  3K02 A;  3VV5 A;  4M1V A;  4ELQ A;  4F3G A;  3D4C A;  4E0W A;  4FIM A;  2X26 A;  5HBC A;  5AA1 A;  2NVU B;  4E0X A;  4KQP A;  3TEP A;  3T96 B;  3EHU A;  4LP2 B;  3QSL A;  2VD2 A;  1PB9 A;  1YTV A;  3H7M A;  4QSE A;  5TU0 A;  4KYS A;  2XXH A;  2XXT A;  5ITP A;  1GVC A;  3B6T A;  3BFT A;  2QRY A;  4TQU Q;  1H76 A;  4G8N A;  1H45 A;  1S7Y A;  4YMB A;  4NF6 A;  1FQA A;  2ABH A;  2PBW A;  5K2Y A;  4C1T A;  5KCJ B;  4RPN A;  1NNT A;  2FA7 A;  4BDR A;  3S9L C;  1MQH A;  4KYE A;  2XX9 A;  1O64 A;  1JW1 A;  3PD9 A;  1MXY A;  2F6P A;  1ANF A;  5L9S A;  1VSO A;  2Q8J A;  2QL3 A;  5KDT A;  3IX1 A;  2P0S A;  5I2N A;  3Q28 A;  4XKN A;  5FHM A;  2I0C A;  2RF1 A;  4GL8 A;  3MC2 A;  2Z8D A;  2XX7 A;  2XD3 A;  3K4U A;  4ZS9 A;  4Z7E A;  1UIU A;  4NF8 B;  1WVJ A;  1GR2 A;  3HHG A;  2E0S A;  3GBB A;  3KOS A;  3IB0 A;  5ICT A;  1LLS A;  3A3U A;  1M5C A;  2PT1 A;  3CFL A;  4I8C A;  4AQ4 A;  1IXC A;  1SI0 A;  5CMB A;  4YIC A;  1B32 A;  1JVY A;  3FAT A;  4UAC A;  3VE1 B;  2ALU A;  5FTH A;  3K2D A;  2I58 A;  3N6U A;  3LSW A;  3ECR A;  3FUZ A;  4P0I A;  4X1B A;  4ZZE A;  3T93 B;  1EZ9 A;  4EQ9 A;  2AIX A;  3MQ9 A;  5I2N B;  2DWJ A;  3H3G A;  3HHF A;  3IJO B;  3LC8 A;  4F1Y A;  1JNF A;  1P1Q A;  1I69 A;  3KBR A;  4QFK A;  1CB6 A;  1DTG A;  2DQV A;  1MDP 1;  1IQ7 A;  1FQF A;  1QUK A;  3EQ1 A;  3IB2 A;  2QS2 A;  3RGY A;  1D3K A;  4EQB A;  4F3P A;  1SBP A;  2THI A;  3OO8 A;  4KPT A;  2HQ0 A;  2DVC A;  4NF6 B;  3V83 A;  2XXQ A;  3VXC A;  3H4Z A;  1XVY A;  4R74 A;  2O69 A;  1UQW A;  3R26 A;  1SI1 A;  4ND9 A;  1CE2 A;  1JET A;  1TWY A;  2DSF A;  2R71 A;  3QUF A;  4L17 A;  4NF5 A;  1LB8 A;  4Z0I A;  3RQT A;  3SEV A;  2HZL A;  5FHO A;  1UTB B;  1JEV A;  5KDT B;  5DVI A;  2G29 A;  1LAH E;  3LR1 A;  4OHN A;  1FTK A;  1ZBM A;  2QJE A;  1BLF A;  4PE5 B;  5I59 A;  2Q88 A;  4I62 A;  3RUM A;  1OMP A;  4H8I A;  4U2R A;  5H8H A;  5DEX A;  5CI5 A;  2DWH A;  1SVX B;  3A3C A;  3CG1 A;  1M5D A;  1Y4C A;  1Y3Q A;  2DE4 A;  3FV1 A;  3JYR A;  4JBZ A;  4N6P A;  1LAG E;  2IA4 A;  3QUJ A;  4HCW A;  4C1U A;  3PPP A;  3U92 A;  1MG1 A;  5I58 B;  1PDA A;  4QSD A;  5IKB A;  3USD A;  2P2A A;  3HN0 A;  2RC9 A;  5I57 B;  3FJM A;  4JSO A;  3UP9 A;  4QHQ A;  4LON B;  4RK2 A;  1EZP A;  3IOU A;  5FHN A;  3SES A;  2XXR A;  1HSJ A;  3MWB A;  3MP1 A;  1Q35 A;  1MQI A;  1Y3P A;  1M5B A;  1US4 A;  1MPB A;  2FNC A;  3IOW A;  4RJZ A;  3RTF B;  2HCA A;  3W15 C;  3G7W A;  4R72 A;  1Z7N E;  4RYA A;  4QF9 A;  2NOO A;  3KFM A;  1WDN A;  2RC7 A;  3FAS A;  2REJ A;  4G77 A;  1VR5 A;  2ONR A;  3IR1 A;  3PPQ A;  4IB2 A;  4GVO A;  4Q30 B;  3K1N A;  4FJP A;  4QFL A;  1J1N A;  1XS5 A;  2ONS A;  3DP4 A;  1R9L A;  5AA3 A;  1TFD A;  1JVX A;  1SW5 A;  3CSG A;  3VVF A;  2F78 A;  2QS4 A;  3EHS A;  3LSF B;  3QIM A;  1QW0 A;  3MVW A;  3KN8 A;  4IY5 A;  3SEU A;  1IXI A;  1Z7M E;  1HSE A;  1N3X A;  2F7B A;  2Y7W A;  3MAM A;  1MY3 A;  3IL1 B;  4OWD A;  3DM0 A;  3C34 A;  2V93 A;  3K6W A;  3HO7 A;  3TQL A;  1LAF E;  1Y1M A;  2ZXT A;  5EHM A;  3L6H A;  4EDP A;  3CIJ A;  1B40 A;  2Q2A A;  3GXA A;  4THI A;  2O68 A;  3TTR A;  5I84 A;  4F22 A;  3C9H A;  3UGW A;  1MY1 A;  1XOC A;  4YB7 A;  1NH8 A;  1B9J A;  5EHS A;  3TPA A;  3MP8 A;  5DYH A;  3W9V A;  4Q0C A;  4YB6 A;  3TYH A;  2RCB A;  3MP6 A;  1MPD A;  4MBP A;  1UIV A;  3PUX E;  4P11 A;  3I5O A;  1DSN A;  4HTG A;  4QFO A;  3MZ9 A;  4X48 A;  5DT6 A;  1ZKB A;  4OQO A;  4R6Y A;  2YPN A;  1A55 A;  5DVJ A;  4ZDM A;  1H43 A;  1YCJ A;  2ZYM A;  2ZNT A;  4GIZ A;  2ESN A;  1LFI A;  1B4H A;  2PMS A;  4IO6 A;  2A5T B;  1MXW A;  1A8F A;  1SYH A;  2VOZ A;  1B1H A;  1POY 1;  5ISU A;  2ZYO A;  4BDN A;  1ZLQ A;  2XXW A;  4WEP A;  4OMB A;  3IB1 A;  5AA2 D;  4KCD A;  2D3I A;  1N7X A;  3HST A;  3IOT A;  4X9T A;  4KYD A;  1M5E A;  1OLC A;  2B65 A;  3IOR A;  4R9G A;  3S4U A;  2UVH A;  1SQY A;  3G3J A;  3BKI B;  2O6A A;  4F18 A;  1YAE A;  2ZNS A;  2LAO A;  1B7U A;  1FQC A;  2DWA A;  2PYY A;  2RC8 A;  4U22 A;  4PET A;  1S50 A;  1GV8 A;  3SET A;  3TCH A;  3FXQ A;  4G4P A;  2ZMB A;  1XT8 A;  3FJ7 A;  4IGT A;  4XXU A;  5TPA A;  4DXU A;  1LCT A;  2F35 A;  4GL0 A;  2HFB A;  2OZZ A;  4IO3 A;  2DE2 A;  5I58 A;  3IAZ A;  1N84 A;  1Y9U A;  2DOJ A;  3FZV A;  3ODB A;  4IO7 A;  3QYT A;  3RNN A;  3Q29 A;  1EH3 A;  3PD8 A;  3GZG A;  3MJN A;  2OWS A;  4U1Z A;  3U1O A;  3PPN A;  5H8H B;  4MLQ A;  4LUB A;  4GLI A;  3LSX A;  4R73 A;  3VXB A;  1LBC A;  3E13 X;  4IO2 A;  1MQG A;  4NF4 A;  3MPL A;  4BDQ A;  1NNP A;  1MXV A;  4HS7 A;  3HV1 A;  4KFQ A;  5CMM A;  2A5T A;  3C36 A;  5AA4 B;  1OLA A;  3HPI A;  2GHA A;  3ONM A;  1MY4 A;  5H8Q A;  4EQ7 A;  5IAI A;  5CBR A;  4H67 A;  3ZKK A;  4DIG A;  3TDJ A;  3F11 A;  1IXG A;  1LBB A;  3T9U A;  2AYS A;  3H6V A;  1B0H A;  1LFG A;  3O29 A;  1GTK A;  4OFL A;  3EN3 A;  3O28 A;  1N7W A;  1TXF A;  1BP5 A;  1ZMG A;  3RLF E;  3RPW A;  4NWC A;  3KG2 A;  3TTM A;  3UA8 A;  1Y4T A;  4DXB A;  4KCC A;  3GLB A;  3TZA A;  5AE4 A;  3KEI A;  1N04 A;  1SW1 A;  3QAX A;  4F31 B; 
#chains in the Genus database with same CATH topology
 4GHA A;  2C99 A;  2DI0 A;  3FUW A;  2QVU A;  1NSF A;  1QDT A;  4GIP A;  3K6U A;  2G93 A;  4B3S M;  5KZT A;  3FUT A;  4UAB A;  3KOX E;  3UK6 A;  3L29 A;  3MYU A;  1VQ1 A;  3VK7 A;  3PUY E;  5F3W A;  1P1W A;  4I3E A;  3TTN A;  1C1K A;  4FED A;  1ELJ A;  3SAU A;  5H8F A;  2R18 A;  3A09 A;  2QBY B;  2CRU A;  3KSJ A;  3CI8 A;  5EQ9 A;  2WKY A;  3PUW E;  3C9P A;  3K9P A;  1XC1 A;  3TEL A;  4MGI E;  4GXA A;  4HEO A;  4CIZ A;  3KC0 A;  3T1H M;  4YKP A;  2XA5 A;  4H8J A;  4P47 A;  5ET8 A;  1FTA A;  4RNS A;  3C3E A;  2UYE A;  5ITO A;  4ONY A;  3BOS A;  1ZIU A;  4DXC A;  2V6Z M;  2R45 A;  2Y7R A;  2R6F A;  3GLG A;  3D4G A;  3EIH A;  4IO4 A;  3T9H B;  4K3F A;  2WBB A;  3FTF A;  3M3F A;  2Q89 A;  1J5E M;  4LQ5 A;  5I57 A;  1SW4 A;  4OET A;  2GH9 A;  1A54 A;  1NV7 A;  4PFI A;  4N81 A;  2FOI C;  1AWB A;  3IK6 B;  1MN3 A;  2Z7J A;  1LB9 A;  4NTL A;  2OOB A;  1A8E A;  1ZMW A;  1JR3 A;  3SBJ A;  5I7I A;  1FBD A;  3U6Q A;  2F5X A;  3VLV A;  2K47 A;  3KN7 A;  4MGH A;  2DXY A;  2PFY A;  4LZ7 A;  1JEU A;  4F3B A;  4FE8 A;  1JW4 A;  4LF6 M;  2XX8 A;  1MY0 A;  1PEB A;  3U93 A;  1L2C A;  4U4S A;  2WZJ A;  1DGB A;  2AL5 A;  2O51 A;  3DP6 A;  3H03 A;  1G59 A;  4NF5 B;  2F7A A;  1NHW C;  1XWI A;  2QS3 A;  2R9J A;  4KHZ E;  1QAQ A;  2XHD A;  4G61 A;  4NRW A;  4OVQ A;  5TPA B;  4PP0 A;  1AIV A;  4KHP M;  1RKM A;  1FJ9 A;  3N5L A;  2Y84 A;  1QUL A;  1II5 A;  5TP9 A;  3GLG E;  3SHF A;  4YKK A;  2DHY A;  4I5S A;  3U6D A;  3FIR A;  2Y0Q A;  1POT A;  3VDF A;  4IJF A;  1TR8 A;  1XB2 B;  3SER A;  1S9T A;  1N3W A;  1QDR A;  3GPU A;  4LF5 M;  1ZU0 A;  4QXD A;  2NWJ A;  4LJ4 A;  3KOZ E;  4GWS A;  4O3B A;  4G68 B;  5A5X A;  3EF7 A;  3TWL A;  1F4I A;  3M3K A;  1FJG M;  2LWX A;  1FTO A;  2QMW A;  3I01 M;  1URD A;  4MNP A;  3V89 B;  2H1R A;  2CHQ A;  1SD3 A;  4JXJ A;  1NNF A;  2VII A;  5BR8 M;  1N34 M;  3K8Z A;  3TFL A;  4OZ9 A;  4ZE8 A;  1B5H A;  2Z22 A;  3H6W A;  4O7M A;  1N32 M;  1DPP A;  1EFU B;  4IBE A;  4KI0 E;  1XC8 A;  4BB9 A;  3T1B A;  2LBC A;  4X8R A;  1AOV A;  1A99 A;  1HNZ M;  3L2A A;  5KQD A;  3MW0 A;  4U1O A;  2QSX A;  2EKF A;  4P1L A;  2UVG A;  4R9F A;  5LTC A;  4IBG A;  1B5I A;  1FJ6 A;  4AS4 A;  1DGH A;  2EKK A;  5JTY A;  3AFH A;  2X7Q A;  3LVV A;  1R7R A;  4B3R M;  2W7Y A;  2WBD A;  3PMW A;  4XKR A;  4LJA A;  4IGR A;  3L28 A;  2LVQ D;  5EJC A;  5EXS A;  3OEL A;  5CMC A;  2V3U A;  4DR3 M;  1PBQ A;  5JTY B;  1Q9D A;  4DUZ M;  4FWG A;  3O6H A;  3FVN A;  2LVA A;  4XGI A;  4B7H A;  2ANJ A;  1K9Z A;  1NV5 A;  1MRP A;  4TLL B;  1XVX A;  2GHB A;  1N77 A;  5EXX A;  3RGS A;  1PC3 A;  4NAP A;  3SAT A;  4RA1 A;  3RYD A;  3HY5 A;  4AKI A;  4LGM A;  5F7V A;  3B6W A;  4OYV A;  2XGN A;  4YU0 A;  1R5L A;  2DAG A;  2HEU A;  3GRY A;  4OXV A;  4P56 A;  1FBP A;  5EYF A;  4I1D A;  2V25 A;  4MLV A;  3M7G A;  1PM5 A;  3LQQ A;  3BIG A;  3OSQ A;  4X66 M;  2XXI A;  4DR2 M;  3D8B A;  1B0L A;  3TCF A;  1L5T A;  2NQ8 C;  2AL4 A;  3H4M A;  8CAT A;  1A7L A;  1SYI A;  4G68 A;  2HAU A;  2FBP A;  5FTJ A;  3MZB A;  1BIY A;  3VE1 B;  3FYD A;  4OVZ A;  2O1L A;  4DR7 M;  3VLW A;  4KR5 A;  4OFJ A;  3WAF A;  2QBY A;  1YXI A;  3CFZ A;  1FTJ A;  3M6A A;  5ITX E;  1QVS A;  4EXL A;  5ITU A;  4N07 A;  4OVT A;  3KZG A;  4ISU A;  5J16 A;  1B6H A;  1WIV A;  3TWM A;  1GO5 A;  1PB8 A;  2F3B A;  5BWJ A;  3KGC A;  3MBP A;  3PPO A;  1MXU A;  2M8C A;  4OAN A;  2L2D A;  4BBA A;  1NV1 A;  5TP9 B;  3DZD A;  3KC1 A;  1G3I A;  2FHY A;  3E9X A;  2DS9 A;  3H6T A;  4GX6 A;  4M1V A;  1J7K A;  1V34 A;  5HBC A;  3AOG A;  2DZO B;  2NVU B;  3QSL A;  2VD2 A;  1PB9 A;  1E9S A;  2R4J A;  3HKP A;  2XXH A;  1IN4 A;  3BFT A;  2Z4S A;  1S7Y A;  4QOZ C;  2ABH A;  2PBW A;  3J2P B;  2ZTD A;  1HJP A;  1NNT A;  2JP7 A;  7CAT A;  2C96 A;  4DV7 M;  1JW1 A;  1IY2 A;  1N78 A;  1IN7 A;  5EP2 A;  2LVN C;  5FHM A;  1CNQ A;  4XKN A;  2I0C A;  3RGP A;  3GYY A;  1UIU A;  3VLF B;  4PGN A;  1GR2 A;  2E0S A;  1FPD A;  4O7I A;  3A3U A;  2PT1 A;  4MGY E;  1GL6 A;  2ALU A;  5E6J A;  4MM3 B;  3LSW A;  4P0I A;  3GRU A;  2OOA A;  1XXH E;  4GC5 A;  4LF9 M;  3TPZ A;  3H3G A;  3HHF A;  1Z6T A;  3U6P A;  4JI7 M;  1DGF A;  1IQ7 A;  1FQF A;  3EQ1 A;  2DAI A;  3IB2 A;  2QS2 A;  2UXB M;  2O69 A;  4RKU F;  4PDG A;  3TL4 X;  1IY1 A;  1MJG M;  3SMS A;  1JET A;  1TWY A;  2WSE F;  5KDT B;  1UTB B;  3B7Z A;  1OFI A;  2QJE A;  3E21 A;  2Q88 A;  3RUM A;  5IGA A;  4H8I A;  5H8H A;  5EQT A;  2DWH A;  3CG1 A;  5CI5 A;  1P3Q Q;  1Y4C A;  4ITQ A;  3JYR A;  5FSW A;  1Q3C A;  4IBJ A;  1NUY A;  5I58 B;  4PDI A;  4G4R A;  2P2A A;  2RC9 A;  3FJM A;  4NOO B;  4QHQ A;  1EZP A;  3MWB A;  1M5B A;  4JI5 M;  3RTF B;  2HCA A;  3W15 C;  3SAS A;  1Z7N E;  2NOO A;  5DVF A;  3QYE A;  2OPF A;  3IR1 A;  4IB2 A;  4QFL A;  1J1N A;  2ONS A;  1OIZ A;  1JVX A;  5ITQ A;  3LQR A;  4XK8 F;  2F78 A;  2PFZ A;  3EHS A;  3B9P A;  1N3X A;  4OWD A;  3GO8 A;  3VKH A;  3DM0 A;  2V93 A;  4JVC A;  1PJS A;  3TQL A;  3CGW A;  2KR0 A;  3L6H A;  2UXD M;  2DNA A;  1QGX A;  2DZN B;  2R8T A;  3C9H A;  3UGW A;  3HFU A;  4IBD A;  3W9V A;  4GWW A;  4P11 A;  4NXN M;  3MZ9 A;  5ET5 A;  1ZKB A;  4OQO A;  4ZDM A;  5DVJ A;  1H43 A;  2ESN A;  3A29 A;  2MRO B;  3Q8G A;  2A5T B;  2VOZ A;  4PFB A;  5ISU A;  2EO2 A;  4LZZ A;  1NV6 A;  3IB1 A;  2D3I A;  4KYD A;  1M5E A;  3UGJ A;  3G3J A;  1SQY A;  3BKI B;  2XWK A;  4GKJ M;  1B7U A;  1ORY B;  2O01 F;  4PET A;  3TCH A;  4IGT A;  4DXU A;  3FJ7 A;  3GQ4 A;  4IBB A;  2HFB A;  2OZZ A;  4FBP A;  3FZV A;  5ESY A;  2QP9 X;  1GLN A;  2OWS A;  1HNW M;  5FTN A;  4QOS A;  5E26 A;  4R73 A;  4DR6 M;  2WSC F;  4BDQ A;  4D81 A;  4HS7 A;  4KFQ A;  3HV1 A;  5IAI A;  1OLA A;  3HPI A;  1K3X A;  2CZH A;  1L1Z A;  3GP1 A;  2KQZ A;  3F11 A;  1IXG A;  3TDJ A;  4DIG A;  3H6V A;  3O29 A;  4OFL A;  4ELO A;  4I81 A;  3RLF E;  4XEQ A;  5AE4 A;  1D0L A;  4JI4 M;  3KEI A;  1N04 A;  4LG2 A;  4YB5 A;  4OX9 M;  3DA1 A;  4MX6 A;  3K9O A;  5C1B A;  3T38 A;  3RN8 A;  5EYG A;  1EU8 A;  1FQD A;  1FTL A;  1AH5 A;  4WEP A;  3PPR A;  2OJT A;  3KSX A;  4O3A A;  4TLM B;  4GOT A;  4AB5 A;  2XD2 A;  4P17 A;  2CFO A;  4Z8X A;  3KOT A;  4EUO A;  1CUK A;  2H4I A;  4ZED A;  4DR1 M;  4MJO A;  1B3L A;  3OO9 A;  4ZEC A;  1IXH A;  4OVZ B;  5ET6 A;  1LST A;  3HJS A;  4JVI A;  4F3S A;  1SXJ E;  1MM7 A;  3S2V A;  4Q5T A;  3L26 A;  1LGB C;  3MMP A;  3OMB A;  4JDF A;  1Z59 A;  2I7P A;  1WGN A;  5ELV A;  2ZM6 M;  4I40 A;  3RFW A;  2FE8 A;  1HQC A;  3KJT A;  2ZTC A;  3K1M A;  4JI0 M;  1GAB A;  4GWX A;  1N0T A;  2B4L A;  2CEY A;  2DVW B;  4G8M A;  4DI4 B;  3M3L A;  1Q02 A;  4HW8 A;  4R2B A;  2APL A;  2D7H A;  5DTB A;  3QMF A;  3IHP A;  2GQ1 A;  2L5V A;  3FXB A;  3RE8 A;  2HZK A;  3WHK A;  1FPE A;  1B2H A;  3IOV A;  1IN8 A;  3MPK A;  4LZJ A;  3FD3 A;  1NV4 A;  2B3F A;  4DR4 M;  3HGI A;  1AUA A;  1VEG A;  3GLF A;  2DYX A;  2O7I A;  4OFO A;  3M0E A;  1DV0 A;  3U6E A;  4YZZ A;  2V3T A;  1DTZ A;  3CHG A;  1Q3B A;  3AV0 A;  2VP1 A;  3EIE A;  3GLH A;  4IBC A;  4Q8R A;  1MXZ A;  2KLF A;  4IBK A;  3GLF B;  2H5X A;  3RY3 A;  3ZQJ A;  2IEE A;  4X62 M;  5LMN M;  1B3E A;  5CRY A;  1LBW A;  1MH4 A;  3LCV B;  4G6Z A;  2F5P A;  3CSB A;  5CM6 A;  2I48 A;  3SAV A;  1R9Q A;  3LUY A;  1NUW A;  1KA1 A;  1DPE A;  2F5N A;  5B7D A;  1Y1Z A;  3HU2 A;  5KQ8 A;  4LRT A;  2VGQ A;  2Y7P A;  1NV8 A;  2F3D A;  1I6A A;  1G71 A;  3ZC7 B;  2I0B A;  3DLN A;  4LF4 M;  1MQJ A;  3TUS A;  3ILU B;  3I4Y A;  2D7G A;  1FPG A;  3LV0 A;  1IIT A;  4C0R A;  3SEW A;  2EA0 A;  1VG5 A;  5BPV A;  1RDZ A;  3LBS A;  5FTL A;  1VFE A;  2A5S A;  5IZ3 A;  1IUD A;  2PCR A;  3K1P A;  3JZJ A;  2Y5L A;  4WKM A;  4B08 A;  4BDL A;  2L6O A;  4PFW A;  4PAI A;  1QUI A;  4ZE9 A;  2CV0 A;  3LCU A;  1FPL A;  2DAM A;  1B52 A;  4GRK A;  3C3D A;  1IN6 A;  2WSF F;  5ITY A;  4I4L A;  4FEB A;  3CTW B;  3I6V A;  3GPX A;  1QKA A;  4MGZ E;  1JW5 A;  2OBG A;  3FGS A;  3PU5 A;  4JWX A;  1NNJ A;  5FTK A;  1NY5 A;  1QAO A;  1RYO A;  5L8D A;  4PE3 A;  1NV2 A;  2J7O A;  1EZO A;  4F29 A;  3E79 A;  2DAE A;  4KXP A;  4H6D A;  2VQE M;  3MVZ A;  3R7X A;  2O25 A;  3E46 A;  3MUQ A;  1NV3 A;  2D5W A;  2GFE A;  4RF0 A;  2F8D A;  2OWT A;  4B3T M;  3JV9 A;  1O7T A;  4EF2 A;  2PX1 A;  4QRZ A;  5AA2 B;  2LHG A;  3FYC A;  3TQW A;  4GD5 A;  5M2V A;  5T3J A;  1JP4 A;  4BLC A;  3PMV A;  5EP4 A;  4MNI A;  4PF8 A;  4N13 A;  1EE8 A;  1IMD A;  3S9M C;  4CIS A;  1PJI A;  3U5Z B;  2REG A;  2Y7I A;  4Y28 F;  2Z23 A;  1GKI A;  3GLH E;  2QSF X;  4OEN A;  1I6B A;  4EQB A;  2XLJ A;  3K00 A;  5K2X A;  4W5W A;  4FW9 A;  1L2B A;  2DKL A;  3R6U A;  3VVE A;  1PGY A;  2V1C A;  5BUU A;  5LDZ A;  3K6X A;  1VFD A;  1NV0 A;  3C4M A;  1P99 A;  3GLF E;  1SW2 A;  2QQ8 A;  2QPQ A;  2VHA A;  4XKQ A;  2WYP A;  2DEN A;  3FXU A;  3L6G A;  3I04 M;  3OD7 A;  5JI2 E;  3QXM A;  2XXP A;  4TOZ A;  4GX4 A;  4OVR A;  2J5Y A;  2MJ5 B;  2R0I A;  3FUV A;  2H99 A;  4AG6 A;  1AMF A;  1BK4 A;  4GBV A;  4ELP A;  2O84 X;  4QFN A;  3DOA A;  1N33 M;  2ZAO A;  1YZ0 A;  3PV0 E;  4PDH A;  1FQE A;  4ZEI A;  3KVW A;  4JI2 M;  3FVO A;  3DP8 A;  1TDH A;  3H6U A;  1LAX A;  4R75 A;  2XXV A;  1VEK A;  1HSL A;  2UVJ A;  3NBX X;  2OQ4 A;  4FCV A;  3TE6 A;  4AI6 A;  3KN3 A;  4P3L A;  4YAH X;  3U72 A;  1ZV1 A;  1NKX A;  3C32 A;  3O6I A;  4I3Y A;  1OFH A;  4POX A;  4YMA A;  4DLD A;  3E4R A;  2H98 A;  1LBZ A;  2Z8E A;  2DWI A;  3C31 A;  2PVU A;  3G3H A;  1OTR A;  3OEM A;  3N6T A;  3PNY A;  3U65 A;  3CFX A;  2ZAN A;  3SDF A;  2ZZX A;  1B4Z A;  4LY6 A;  3VFJ A;  4GFR A;  2VD3 A;  3SZP A;  1B05 A;  1DO0 A;  2YR0 A;  1DGH B;  4N4U A;  1K3W A;  3G3F A;  5ITT A;  3T9V A;  4PQJ A;  3S9N C;  4NSO B;  1XNR M;  5IZ3 B;  3K02 A;  3ZCB B;  4F3G A;  3D4C A;  4E0W A;  4FIM A;  2X26 A;  4E0X A;  2BJW A;  3TEP A;  3T96 B;  4LP2 B;  1QZM A;  1BVS A;  3H7M A;  4QSE A;  4M9S A;  5KPT A;  3QYB A;  2XXT A;  1KFV A;  2QRY A;  4YMB A;  1H45 A;  1FQA A;  4C1T A;  4RPN A;  2KXE A;  3VFD A;  2XX9 A;  1MXY A;  1ANF A;  2DDK A;  2QL3 A;  3IX1 A;  4CGY B;  2RF1 A;  4GL8 A;  3MC2 A;  5IZ7 D;  4AZF A;  4LCB A;  2XD3 A;  4ZS9 A;  4Z7E A;  3K1J A;  2XZF A;  4DUY M;  3IB0 A;  1M5C A;  3CFL A;  3E78 A;  4FVM A;  1IXC A;  4F2L A;  4YIC A;  1JVY A;  3FAT A;  5FTH A;  3N6U A;  2V4C A;  4AW4 A;  5I2N B;  1EIJ A;  1P1Q A;  4P8B A;  1CB6 A;  4N6K A;  2CV2 A;  1WXQ A;  1QUK A;  2JY8 A;  1D3K A;  4NF6 B;  1IN5 A;  3V83 A;  2DVC A;  2XXQ A;  1XVY A;  3AKZ A;  4UN2 B;  4LJ5 A;  5AA4 A;  3HHZ A;  3SEV A;  1TTE A;  2HZL A;  5FHO A;  5DVI A;  1XI6 A;  1YLA A;  3IG5 A;  1ZBM A;  1BLF A;  3SYK A;  3MHV C;  2M5Z A;  4M9Z A;  3A3C A;  1Y3Q A;  1OIP A;  4JBZ A;  2IA4 A;  3QUJ A;  4HCW A;  2Q8M A;  4C1U A;  4LJ8 A;  3IEC A;  1MG1 A;  4QSD A;  1IFY A;  1NHG C;  3USD A;  2OX3 A;  3HN0 A;  2C9O A;  3IOU A;  1HNX M;  4NN3 A;  4II7 A;  3MP1 A;  3IOW A;  1DK4 A;  4HL4 A;  1TH4 A;  4RYA A;  2Y0T A;  1XS5 A;  3DP4 A;  1ZMV A;  3CSG A;  3VVF A;  2QVR A;  3SFZ A;  1QW0 A;  2CE7 A;  3MVW A;  2HKJ A;  1HSE A;  2GQF A;  3FRI A;  4DV2 M;  2KA6 B;  2KW0 A;  3K6W A;  1LAF E;  2ZXT A;  5EHM A;  2EUC A;  3CIJ A;  2YQZ A;  3GXA A;  3GLH B;  3FD9 A;  1FBC A;  3H4J A;  4YB7 A;  1OAO C;  1B9J A;  5DYH A;  4Q0C A;  2RCB A;  3MP6 A;  1MPD A;  1MX0 A;  3PTY A;  3PUX E;  1QQW A;  3I5O A;  4HTG A;  4X48 A;  3U61 A;  5DT6 A;  3BXW A;  4GH9 A;  2ZNT A;  4GIZ A;  1LFI A;  4IO6 A;  2FS1 A;  1A8F A;  1SYH A;  4H45 A;  1POY 1;  1IQP A;  4BDN A;  4PBQ A;  1ZLQ A;  2XXW A;  4OMB A;  5AA2 D;  5DFL A;  2M60 A;  1PRB A;  3HST A;  1Z5C A;  4FWH A;  2B65 A;  2O6A A;  2LAO A;  1FPF A;  3I51 A;  2ZMB A;  4MHF A;  1LCT A;  4Q7J A;  1N84 A;  3ODB A;  2XXK A;  1XXH B;  4IO7 A;  3QYT A;  2L7H A;  3W68 A;  2JY5 A;  4MLQ A;  4LUB A;  3LSX A;  2CEX A;  3GLI E;  4IO2 A;  4CJ6 A;  3MPL A;  5AA4 B;  5H8Q A;  2GHA A;  3NOH A;  2F5S A;  1MY4 A;  1GVN A;  5IZZ A;  4H67 A;  3ZKK A;  4M0W A;  1XXH A;  1LBB A;  4PBH A;  5KPZ A;  2AYS A;  4QFK A;  1TXF A;  1BP5 A;  3RPW A;  1JB0 F;  4KO8 A;  5GKN A;  3TTM A;  4Z6Y A;  4XF5 A;  4KCC A;  4DXB A;  1FQC A;  3U6M A;  4LJ7 A;  1R2Y A;  2PT2 A;  4N8Y A;  1K82 A;  1VE4 A;  3KXE C;  1L8Q A;  3OSR A;  3VLU A;  4ZEB A;  2ZBK B;  4I9D A;  3MVX A;  2UXC M;  3V5A A;  1NFT A;  2CZL A;  1GGG A;  3G3K A;  4IY6 A;  4YHH M;  2X8A A;  1URS A;  3H06 B;  3UOR A;  2CZI A;  1WOD A;  4O8M A;  4OEV A;  3U6S A;  1AL3 A;  2ONK E;  3A42 A;  2QFL A;  4PD2 A;  3HX3 A;  5EP3 A;  5ITX A;  2UUC M;  4EIW A;  4FOR A;  3U61 B;  4JWY A;  3BIH A;  4PAF A;  4GWZ A;  4P9K A;  4H0W A;  3SEX A;  5A5X B;  3N94 A;  5H8Q B;  2NXO A;  2V1U A;  2O7U A;  1ATG A;  2QVV A;  5I59 B;  4JV5 M;  5I56 B;  2VDB B;  4OEU A;  3K6V A;  2QZ4 A;  3FUU A;  1D2N A;  4N8G A;  4ZPX A;  4XBO A;  2KDL A;  1B46 A;  4G68 C;  4PCZ A;  2RKO A;  2O1M A;  2LVP C;  2CV1 A;  4S12 A;  1KWH A;  4LJ6 A;  4IBF A;  1G8P A;  3HJQ A;  2J7N A;  3MZ1 A;  1OQG A;  1FBF A;  3O97 A;  1QUJ A;  1FTM A;  2LTU A;  3Q27 A;  4RXL A;  1MU5 A;  1WR1 B;  1VDD A;  1T43 A;  4NF0 A;  1R6B X;  1OKS A;  4GRI A;  2D21 A;  3U94 A;  3U6O A;  1RU3 A;  2DXI A;  2CEA A;  2E1S A;  2RGO A;  2OK2 A;  3AOE C;  3T15 A;  2VF7 A;  1WGL A;  1URG A;  4H5F A;  1TFA A;  2ZAM A;  2R62 A;  1YSY A;  1OJL A;  1V33 A;  4ELR A;  4F39 A;  2H5Y A;  3OEN A;  1NMU A;  4OES A;  5F24 A;  5CMK A;  1T3T A;  1QAM A;  4X65 M;  2DVZ A;  3A98 B;  1ZTY A;  4F2Q A;  2MH8 A;  2OLB A;  5H8S A;  2CMO A;  4PFT A;  2I7N A;  5IWA M;  1IIW A;  2B4M A;  4EXK A;  3K0V A;  3O66 A;  3B7Q A;  2WYK A;  3MJ5 A;  1LV7 A;  1OIB A;  4PCD A;  3IO6 A;  2JZ0 A;  2Y7K A;  4NMY A;  4HLQ A;  2LNH C;  3SAW A;  2WEF A;  4BDM A;  5L9M A;  1LFH A;  1H3D A;  1DCU A;  2JWS A;  5H37 D;  2OCU A;  3PGF A;  1Q39 A;  4YKI A;  4LRS A;  1B3F A;  3IG8 A;  2G5G X;  3BBZ A;  4R6K A;  1LBX A;  2I4B A;  4PF6 A;  2I3W A;  1NUZ A;  4G3O A;  2LVO C;  2OWZ A;  4LQ2 A;  4DR5 M;  4U21 A;  2JA2 A;  1P1U A;  1FBG A;  3G3I A;  3I3V A;  2I3V A;  3C58 A;  2ERC A;  1FBE A;  4L15 A;  2F34 A;  4ESX A;  1D4N A;  1PBP A;  2DHR A;  3O6G A;  4YKJ A;  3NBI A;  4CHT B;  3ILK A;  5AA2 A;  5FTM A;  4DBG B;  3ILT B;  5KO3 A;  1NO1 A;  5H8N B;  4BDO A;  1IXS B;  2DE3 A;  4LF8 M;  3U8Q A;  3GBA A;  4AKG A;  4ESW A;  4U23 A;  2WX9 A;  3OOA A;  4GF8 A;  4NSR A;  3QK6 A;  2R6G E;  2UXA A;  3AOE A;  2JNH A;  1UTH A;  1B1X A;  1NNK A;  2ZNU A;  3ROJ A;  4ECF A;  5HPQ A;  3VDU A;  4XFE A;  1XMO M;  2HXR A;  3LW5 F;  5H8F B;  5JK4 A;  4DZ1 A;  3R9X B;  3OO6 A;  4AG5 A;  1MH3 A;  3PNV A;  3T22 A;  5DW8 A;  3B8B A;  2DZL A;  4GC9 A;  1H6U A;  2Q74 A;  3FV2 A;  3A45 A;  5DYG A;  4XTC Q;  4GMQ A;  2QNJ A;  5ITR A;  3OEK A;  3KBZ A;  1XHB A;  3RTW B;  1YYZ A;  2YJP A;  4DCX A;  4PFY A;  2KZU A;  3PFI A;  3IFC A;  4RPO A;  4P0G A;  4FD2 A;  3MVY A;  3Q26 A;  3PUV E;  4JI6 M;  2FYI A;  1GJT A;  3RPL B;  3VK8 A;  5LMU M;  4B3M M;  2RGH A;  4G8H A;  3ZSF A;  3V76 A;  4GHL A;  1IY0 A;  3HU1 A;  4F1U A;  1MY2 A;  5FLX S;  4GBW A;  3GRR A;  1B51 A;  1Y20 A;  4DV5 M;  2XEP A;  3ISP A;  3L25 A;  4NQ8 A;  1XMQ M;  2DWN A;  3FKE A;  3MK6 A;  2F5O A;  4JYA M;  4H65 A;  4NF8 A;  4X1D A;  1OVT A;  1NNU C;  2F6G A;  3WAE A;  3VVD A;  2K6B A;  1M5F A;  4OVS A;  3EPE A;  3Q25 A;  1JQF A;  2XWV A;  1FQB A;  3CRB A;  1QUT A;  1IXS A;  2UYF A;  1IBK M;  2C9C A;  2Q2E B;  3FTC A;  1MXX A;  1L2D A;  1BKA A;  3TQS A;  1O63 A;  3KOW E;  2QMX A;  3KJ7 A;  1HQY E;  1KA0 A;  2XWI A;  3TOD A;  2QS1 A;  2KNA A;  4ZEK A;  1B3H A;  3CF0 A;  1NV9 A;  3P7I A;  2Z4R A;  5J1D A;  1NVM A;  3ZS6 A;  3BBR A;  1MM6 A;  2YFQ A;  4MFI A;  4F1I A;  1B7Z A;  4GQO A;  3PXG A;  2RRU A;  1Q1K A;  1R4G A;  4WW0 A;  2Y21 A;  4POW A;  1NH7 A;  3HHX A;  4OVJ A;  4REZ A;  1MQD A;  1NUX A;  3D1R A;  2H25 A;  2XXU A;  1OQH A;  3VV5 A;  3NWL A;  4ELQ A;  1WHC A;  3WHL A;  2KHH A;  2Y20 A;  1G0H A;  3KW6 A;  1K9Y A;  5ITP A;  1GVC A;  3J80 S;  3B6T A;  1I4W A;  5K2Y A;  2FA7 A;  1MQH A;  4KYE A;  5A2Q S;  3PD9 A;  1NY6 A;  2R65 A;  5L9S A;  4MCO A;  4HE1 A;  2Q8J A;  3B7N A;  2QPA A;  3Q28 A;  4MMP A;  1QAN A;  3THG A;  1DGG A;  4IJE A;  3HHG A;  3GBB A;  3GLI A;  1AIP C;  2E5L M;  2ZZV A;  5IRE B;  4UAC A;  2I58 A;  3T93 B;  3FUZ A;  4EQ9 A;  1EZ9 A;  3GQ3 A;  1J09 A;  2DWJ A;  2P3V A;  3IJO B;  4F1Y A;  1JNF A;  1I69 A;  4O94 A;  3KBR A;  3AJI B;  1TH2 A;  1MDP 1;  3GLI B;  3RGY A;  4F3P A;  4GIT A;  4KPT A;  2THI A;  2L4F A;  4L8R C;  5IZ1 A;  4LFC M;  2QHO B;  3R26 A;  1HR0 M;  1CE2 A;  2R71 A;  2VPN A;  4NF5 A;  4Z0I A;  1E9R A;  1LB8 A;  3RQT A;  2HWJ A;  1JEV A;  4AQY M;  2G29 A;  1LAH E;  4IR8 A;  4OHN A;  2K0B X;  4PDD A;  4G4O A;  2HCB A;  4JN6 A;  5I59 A;  4I62 A;  1OMP A;  4U2R A;  1SVX B;  3LUZ A;  1M5D A;  2DE4 A;  2FNA A;  4N6P A;  1DBZ A;  1LAG E;  3PPP A;  3U92 A;  5DYI A;  1PDA A;  1JR3 E;  5I57 B;  3UP9 A;  1IMF A;  4DV3 M;  2D7E A;  4GKK M;  5FHN A;  2XXR A;  1HSJ A;  4GX3 A;  1Q35 A;  1MQI A;  4JI8 M;  1US4 A;  2FNC A;  4PTK A;  4RJZ A;  4N17 A;  1E32 A;  3G7W A;  4R72 A;  2CWB A;  3J7A S;  4QF9 A;  3KFM A;  4RK9 A;  1WDN A;  2RC7 A;  3FAS A;  2REJ A;  4G77 A;  3J7B A;  1TDZ A;  4FJP A;  4G4Q A;  5IM2 A;  3B50 A;  4DI3 D;  5AA3 A;  1TFD A;  3IFA A;  1SW5 A;  3KP1 E;  1NJF A;  1E94 E;  4LJ9 A;  3JR4 A;  3SEU A;  1Z7M E;  4DV6 M;  3MAM A;  1IMA A;  1MY3 A;  3IL1 B;  4D82 A;  1SXJ B;  1N75 A;  2G8L A;  3UJN A;  4EDP A;  4OVP A;  2O68 A;  3TTR A;  5I84 A;  2KZS A;  4LGY A;  1XOC A;  3TPA A;  3MP8 A;  4YB6 A;  4JVD A;  3HHW A;  3TYH A;  4MBP A;  4QFO A;  5EQA A;  4R7G A;  3JR5 A;  4R6Y A;  2L7I A;  2YPN A;  2MR9 A;  1YCJ A;  2ZYM A;  1I94 M;  1B4H A;  1B1H A;  3U6L A;  4K0K M;  1IME A;  4RF1 A;  1N7X A;  4X9T A;  1PJJ A;  3IOR A;  4R9G A;  1IMB A;  4NGU A;  2ZNS A;  4MB7 A;  2PYY A;  2RC8 A;  4U22 A;  1S50 A;  1LTM A;  3SET A;  4YY3 M;  3VDP A;  3FXQ A;  1XT8 A;  4XXU A;  5TPA A;  2F35 A;  2F4V M;  3IAZ A;  1Y9U A;  2JJK A;  3K2L A;  3RNN A;  3JAM S;  2Z3X A;  2MKZ A;  3PD8 A;  3GZG A;  3MJN A;  4GLI A;  4P1E A;  1QZE A;  1VDL A;  3E13 X;  1MQG A;  1EYK A;  1NNP A;  1MXV A;  5CMM A;  3VKG A;  2BJI A;  2C5R A;  5CBR A;  4L16 A;  3T9U A;  2CZK A;  1GTK A;  3EN3 A;  3O28 A;  1N7W A;  1ZMG A;  4AKH A;  1UFZ A;  3UA8 A;  3HJ8 A;  3TZA A;  3GLB A;  3MQ9 A;  3QAX A;  4F31 B;  2DWL A;  4N6D A;  4KD5 A;  5CBS A;  2W82 A;  2BNK A;  4X04 A;  5EXT A;  1ZJL A;  4MF3 A;  2V84 A;  1YUB A;  2FIE A;  1W5T A;  1A40 A;  4UA8 A;  3RPL A;  1V92 A;  4OTE A;  5I2K B;  3E3K A;  3GRV A;  4NL4 H;  1B5J A;  1P1O A;  2VT5 A;  3AXF A;  4IBI A;  4H46 A;  1PJQ A;  3THI A;  1OAI A;  2GRV A;  1PB7 A;  4BLA A;  3CF6 E;  4GXS B;  4LFA M;  4NED A;  1SPI A;  2BWE A;  4MIJ A;  3TCG A;  1VEJ A;  1T6O A;  2HAV A;  1FW0 A;  4AB6 A;  4TUW A;  2RCA A;  3TAJ A;  3AL0 C;  2V3Q A;  4H1X A;  5FTI A;  1ZMU A;  2HL7 A;  1MDQ A;  1OVB A;  4LZ5 A;  2YLN A;  4LA9 A;  5JEI A;  2G3Q A;  1N76 A;  1SDX A;  1IMC A;  4HE0 A;  4D80 A;  5DNY A;  3FJG A;  4M9X A;  4LVQ A;  4R2F A;  3B6Q A;  3PMX A;  1XHY A;  4HE2 A;  4M4G A;  2C98 A;  4EF1 A;  5H8N A;  1QKB A;  4ZZA A;  2UUA M;  4N15 A;  3U60 A;  2BJJ X;  3PUZ E;  4U4X A;  5I2K A;  1LEV A;  1BTJ A;  1D0K A;  1TH3 A;  1NJG A;  3O2A A;  1MPC A;  1DO2 A;  2I49 A;  1G4A E;  1Y3N A;  3DEL B;  3O9P A;  2BWB A;  3FE3 A;  4QFP A;  2XSZ A;  1UM8 A;  4PT5 A;  5EQ7 A;  2L4E A;  2LHC A;  2XXY A;  3J27 B;  3HZJ A;  5DEX B;  4DE8 A;  4MGK E;  3FXR A;  1XNQ M;  4NF4 B;  1JQJ C;  4JXI A;  3CR9 A;  3TTK A;  4FAT A;  1S3S A;  4WED A;  2BJV A;  5KDT A;  1MS7 A;  2RKM A;  3D8L A;  1B7H A;  1H44 A;  3S9E A;  1B58 A;  2Y5K A;  1QJM A;  1VDW A;  2KEB A;  3LSL A;  2UU9 M;  1D9Q A;  3SYL A;  3GPP A;  1SXJ D;  5CC2 A;  2I4C A;  3M8U A;  4JSD A;  3KDS E;  1UTH B;  1R2Z A;  2RIN A;  1W5S A;  4QSC A;  2DP8 A;  3KOY E;  1QUS A;  3W9W A;  4WP2 A;  3UN6 A;  4OER A;  2F36 A;  4MNC A;  3F92 A;  5EP1 A;  2Z8F A;  2R44 A;  3U60 B;  1ZQ9 A;  1TGU A;  4G4N A;  4HXV A;  4QHT A;  1USY H;  4LZ8 A;  2Q2C A;  4OU7 A;  1TT1 A;  1P1N A;  2NUV A;  1RDX A;  3FVK A;  4RY1 A;  2XFT A;  5L9O A;  3U5Z A;  2B3B A;  5B70 A;  3C35 A;  5I56 A;  3CG3 A;  3HCQ A;  1EYJ A;  4MH5 A;  2ZZW A;  1IXZ A;  4QNM A;  4JB7 A;  1FPB A;  2ZYN A;  5F1Q A;  2CHV A;  1UTB A;  1RDY A;  4G2Z A;  3FRH A;  3W67 A;  1D0M A;  1EYI A;  3OO7 A;  4L4U A;  2HHM A;  3C33 A;  4MEV A;  3CF2 A;  5A5L A;  1FNN A;  1LBY A;  3KS8 A;  3N26 A;  1IEJ A;  1IBM M;  3K01 A;  1I6Q A;  4X64 M;  2XXX A;  1DMB A;  2A5Y B;  1USY E;  3A46 A;  1OQY A;  1FPJ A;  2FFJ A;  1US5 A;  2F7C A;  2HXW A;  4OA4 A;  2P5T A;  3IO4 A;  3R8F A;  4XIG Q;  2I6E A;  2X7P A;  1KSF X;  2DAK A;  3FVG A;  4LF7 M;  4DCY A;  4MAG A;  3UIF A;  5L8R F;  1N36 M;  2CP8 A;  4DV1 M;  3T6P A;  5EXP A;  2XF3 A;  3U6C A;  2DWM A;  4DDD A;  5ICQ A;  2XFS A;  3RT6 B;  4NRV A;  3I4V A;  3EHT A;  3SEY A;  3TKD A;  1IZ1 A;  3LMM A;  3SHG B;  1SXJ A;  3OTO M;  1GL7 A;  1NL5 A;  1G0I A;  2H9B A;  4JWO A;  2OO9 A;  2L09 A;  4QBA A;  4DV0 M;  2ZYK A;  4R3D A;  1YPN A;  1R1N A;  3T66 A;  2CUZ A;  3W0L B;  3ZKL A;  2VQF M;  3BFU A;  2X49 A;  4KOD A;  3UK4 A;  1F9B A;  2UUB M;  2VPO A;  4WXJ A;  4ZEF A;  3IJX B;  3CVG A;  4O3C A;  4F2O A;  1FPK A;  4NC6 A;  4IO5 A;  4FWD A;  4M0D A;  4GWO A;  3G3G A;  4R6H A;  3RT8 A;  2KRU A;  2UVI A;  1R6Z A;  2K9D A;  3SKP A;  4NXM M;  1Y8G A;  3LVW A;  3TTL A;  2HPG A;  3HHY A;  4I8O A;  1PJT A;  4NE4 A;  5EQ8 A;  1T0K A;  4HCY A;  5KCJ A;  4H5G A;  1FBH A;  4FCT A;  3B89 A;  5LOM A;  2R46 A;  1LCF A;  4FEC A;  1G41 A;  2Q9T A;  3TMG A;  4P16 A;  4NWD A;  5HM4 B;  3SAR A;  1RYX A;  3OXN A;  1TF0 B;  3T9X B;  4PFU A;  1L1T A;  4LAT A;  2F97 A;  3ZH9 B;  4XKP A;  1FCK A;  1DOT A;  4N91 A;  1B3G A;  1X37 A;  2LXE A;  2KNV A;  4FAJ A;  1GJS A;  2DWZ B;  3V8X B;  2DXR A;  1D9V A;  3B7D A;  2KRK A;  2N35 A;  1D9Y A;  2QCU A;  2GNO A;  2P1S A;  4RNA A;  2FH0 A;  5AA1 A;  3HWS A;  4KQP A;  5FBP A;  3EHU A;  1YTV A;  2KNZ A;  5TU0 A;  4KYS A;  2X4A A;  1Z5B A;  1IBL M;  4JI1 M;  1QVR A;  4TQU Q;  1H76 A;  4G8N A;  2HHH M;  4NHB A;  4NF6 A;  5KCJ B;  4MH0 E;  4BDR A;  3SC3 A;  3S9L C;  3KS4 A;  5C18 A;  1O64 A;  3T0J A;  2F6P A;  3T1Y M;  1VSO A;  5KPR A;  4LFB M;  2P0S A;  5I2N A;  3PVS A;  1Z5A A;  2Z8D A;  2XX7 A;  3TWK A;  3K4U A;  4NF8 B;  4PAK A;  1WVJ A;  3KOS A;  3FTD A;  2MGW A;  1LLS A;  5ICT A;  1FSA A;  4I8C A;  1HT1 E;  4AQ4 A;  1SI0 A;  5CMB A;  1B32 A;  3K2D A;  1FPI A;  3ECR A;  4X1B A;  4ZZE A;  2R4E A;  2AIX A;  1SG9 A;  2JUJ A;  3LC8 A;  4WUR A;  2LH0 A;  2EJS A;  1DTG A;  2DQV A;  2XH9 A;  4ANR A;  1C7Y A;  1SBP A;  4B7F A;  3OO8 A;  2HQ0 A;  3VXC A;  3H4Z A;  4R74 A;  1UQW A;  1SI1 A;  2QEN A;  3QUF A;  4L17 A;  4ND9 A;  2DSF A;  4F1V A;  1INP A;  4GWY A;  3LR1 A;  3QWL A;  1FTK A;  4PE5 B;  5I5P A;  4LN5 A;  4DV4 M;  5DEX A;  3FV1 A;  1ZAE A;  5EYH A;  4B7G A;  4KLN A;  2O5R A;  2FVZ A;  4PC9 A;  5IKB A;  1YE9 A;  1KZ8 A;  4JSO A;  4LON B;  3GPY A;  4RK2 A;  2VF8 A;  3SES A;  4AS5 A;  4FCW A;  1Y3P A;  3KFU G;  1MPB A;  2JXN A;  3SMP A;  3Q8X A;  3B74 A;  4NX1 A;  1WJ7 A;  4F19 A;  3GQ5 A;  1VR5 A;  2ONR A;  3PPQ A;  4GVO A;  4Q30 B;  3K1N A;  3W0F A;  1R9L A;  3EKI A;  2QS4 A;  3QIM A;  3LSF B;  1A5T A;  3KN8 A;  4IY5 A;  1IXI A;  2Y7W A;  2F7B A;  2P3N A;  3GLG B;  3C34 A;  4PFR A;  3HO7 A;  5I3S A;  3K92 A;  1Y1M A;  3FTE A;  1SXJ C;  1JR3 D;  2F5Q A;  1B40 A;  2YNM D;  2Q2A A;  4THI A;  2JZ1 A;  3MST A;  1MY1 A;  5EHS A;  1NH8 A;  1KYI A;  2JY7 A;  1LBV A;  4OW0 A;  3L27 A;  4A3V B;  1UIV A;  3FBP A;  3J81 S;  1DSN A;  4NG7 A;  1HT2 E;  2AHM A;  3UZU A;  1A55 A;  5JI3 E;  4L78 A;  3HU3 A;  3E9S A;  2PMS A;  1MXW A;  1NI9 A;  2ZYO A;  4KCD A;  2HAK A;  3IOT A;  4PGP A;  3DFZ A;  1IXR C;  4IIW A;  1OLC A;  5ET7 A;  3S4U A;  4GEW A;  2UVH A;  4F18 A;  3KP0 E;  1YAE A;  2DWA A;  2JY6 B;  1GV8 A;  2FIX A;  4G4P A;  3QAU A;  5IT9 S;  4QHS A;  4GL0 A;  5I58 A;  4IO3 A;  2DE2 A;  1IM2 A;  4JI3 M;  2DOJ A;  3UMM A;  2B3T A;  4KT0 F;  3Q29 A;  1EH3 A;  4U1Z A;  3U1O A;  3PPN A;  5H8H B;  4R71 A;  3VXB A;  1LBC A;  4NF4 A;  4L6V 6;  2XWO A;  4QNR A;  3FUX A;  1QYR A;  2A5T A;  3C36 A;  4EQ7 A;  3ONM A;  4GWU A;  1FRP A;  2Z8Y M;  2XSZ D;  1B0H A;  2CHG A;  1LFG A;  4NWC A;  3KG2 A;  1Y4T A;  4F22 A;  1SW1 A;  2XZU A; 
#chains in the Genus database with same CATH homology
 4GHA A;  2C99 A;  3FUW A;  1NSF A;  4GIP A;  3K6U A;  2G93 A;  4B3S M;  5KZT A;  3FUT A;  3KOX E;  3UK6 A;  3L29 A;  3VK7 A;  3PUY E;  5F3W A;  1P1W A;  3TTN A;  1C1K A;  4FED A;  1ELJ A;  3SAU A;  5H8F A;  2R18 A;  3A09 A;  2QBY B;  3KSJ A;  3CI8 A;  2WKY A;  3PUW E;  1XC1 A;  3TEL A;  4MGI E;  4GXA A;  4YKP A;  3T1H M;  4H8J A;  4RNS A;  2UYE A;  5ITO A;  4ONY A;  3BOS A;  1ZIU A;  4DXC A;  2V6Z M;  2R45 A;  2Y7R A;  3GLG A;  3D4G A;  3EIH A;  4IO4 A;  3T9H B;  4K3F A;  3FTF A;  3M3F A;  2Q89 A;  1J5E M;  4LQ5 A;  5I57 A;  1SW4 A;  4OET A;  2GH9 A;  1A54 A;  2FOI C;  3IK6 B;  2Z7J A;  1LB9 A;  4NTL A;  1A8E A;  1JR3 A;  3SBJ A;  3U6Q A;  2F5X A;  3VLV A;  2K47 A;  3KN7 A;  4MGH A;  2DXY A;  4LZ7 A;  1JEU A;  4F3B A;  4FE8 A;  1JW4 A;  4LF6 M;  2XX8 A;  1MY0 A;  1PEB A;  3U93 A;  1L2C A;  4U4S A;  1DGB A;  2AL5 A;  3DP6 A;  2O51 A;  3H03 A;  1G59 A;  4NF5 B;  2F7A A;  1NHW C;  1XWI A;  2QS3 A;  2R9J A;  4KHZ E;  1QAQ A;  2XHD A;  4NRW A;  5TPA B;  4PP0 A;  1AIV A;  4KHP M;  1RKM A;  3N5L A;  2Y84 A;  1QUL A;  1II5 A;  5TP9 A;  3SHF A;  4YKK A;  4I5S A;  3U6D A;  3FIR A;  2Y0Q A;  1POT A;  3VDF A;  4IJF A;  3SER A;  1S9T A;  1N3W A;  3GPU A;  4LF5 M;  1ZU0 A;  2NWJ A;  4LJ4 A;  3KOZ E;  4O3B A;  4G68 B;  5A5X A;  3EF7 A;  3TWL A;  3M3K A;  1FJG M;  2LWX A;  1FTO A;  2QMW A;  1URD A;  3V89 B;  2H1R A;  2CHQ A;  1SD3 A;  4JXJ A;  1NNF A;  2VII A;  5BR8 M;  1N34 M;  3K8Z A;  3TFL A;  4OZ9 A;  4ZE8 A;  1B5H A;  2Z22 A;  3H6W A;  1N32 M;  1DPP A;  4IBE A;  4KI0 E;  1XC8 A;  4BB9 A;  1AOV A;  1A99 A;  1HNZ M;  3L2A A;  5KQD A;  3MW0 A;  4U1O A;  2QSX A;  2UVG A;  4R9F A;  4IBG A;  1B5I A;  1DGH A;  5JTY A;  3AFH A;  2X7Q A;  3LVV A;  1R7R A;  4B3R M;  2W7Y A;  3PMW A;  4XKR A;  4LJA A;  4IGR A;  3L28 A;  5EJC A;  5EXS A;  3OEL A;  5CMC A;  2V3U A;  4DR3 M;  1PBQ A;  5JTY B;  4DUZ M;  4FWG A;  3O6H A;  3FVN A;  4XGI A;  4B7H A;  2ANJ A;  1MRP A;  4TLL B;  1XVX A;  2GHB A;  1N77 A;  5EXX A;  3RGS A;  1PC3 A;  4RA1 A;  3SAT A;  4AKI A;  4LGM A;  5F7V A;  3B6W A;  4OYV A;  2XGN A;  4YU0 A;  2HEU A;  3GRY A;  4OXV A;  5EYF A;  4I1D A;  2V25 A;  4MLV A;  3M7G A;  1PM5 A;  3LQQ A;  3OSQ A;  4X66 M;  2XXI A;  4DR2 M;  3D8B A;  1B0L A;  3TCF A;  1L5T A;  2AL4 A;  2NQ8 C;  3H4M A;  8CAT A;  1A7L A;  1SYI A;  4G68 A;  2HAU A;  5FTJ A;  3MZB A;  1BIY A;  3VE1 B;  3FYD A;  4OVZ A;  2O1L A;  4DR7 M;  3VLW A;  4KR5 A;  4OFJ A;  3WAF A;  2QBY A;  3CFZ A;  1FTJ A;  3M6A A;  5ITX E;  1QVS A;  4EXL A;  5ITU A;  4N07 A;  3KZG A;  4ISU A;  1B6H A;  1PB8 A;  3TWM A;  5BWJ A;  3KGC A;  3MBP A;  3PPO A;  1MXU A;  2M8C A;  4BBA A;  5TP9 B;  3DZD A;  1G3I A;  3E9X A;  2DS9 A;  3H6T A;  4M1V A;  1J7K A;  5HBC A;  3AOG A;  2DZO B;  2NVU B;  3QSL A;  2VD2 A;  1PB9 A;  1E9S A;  2R4J A;  3HKP A;  2XXH A;  1IN4 A;  3BFT A;  2Z4S A;  1S7Y A;  4QOZ C;  2ABH A;  2PBW A;  3J2P B;  1NNT A;  7CAT A;  2C96 A;  4DV7 M;  1JW1 A;  1IY2 A;  1N78 A;  1IN7 A;  5EP2 A;  5FHM A;  4XKN A;  2I0C A;  3RGP A;  1UIU A;  3VLF B;  1GR2 A;  2E0S A;  3A3U A;  2PT1 A;  4MGY E;  1GL6 A;  2ALU A;  5E6J A;  4MM3 B;  3LSW A;  4P0I A;  3GRU A;  4GC5 A;  4LF9 M;  3TPZ A;  3H3G A;  3HHF A;  1Z6T A;  3U6P A;  4JI7 M;  1DGF A;  1IQ7 A;  1FQF A;  3EQ1 A;  3IB2 A;  2QS2 A;  2UXB M;  2O69 A;  4PDG A;  3TL4 X;  1IY1 A;  3SMS A;  1JET A;  1TWY A;  5KDT B;  1UTB B;  1OFI A;  2QJE A;  2Q88 A;  3RUM A;  4H8I A;  5H8H A;  5EQT A;  2DWH A;  3CG1 A;  5CI5 A;  4ITQ A;  1Y4C A;  3JYR A;  5FSW A;  1Q3C A;  4IBJ A;  5I58 B;  4PDI A;  4G4R A;  2P2A A;  2RC9 A;  3FJM A;  4NOO B;  4QHQ A;  1EZP A;  3MWB A;  1M5B A;  4JI5 M;  3RTF B;  2HCA A;  3W15 C;  3SAS A;  1Z7N E;  2NOO A;  5DVF A;  2OPF A;  3IR1 A;  4IB2 A;  4QFL A;  1J1N A;  2ONS A;  1JVX A;  5ITQ A;  3LQR A;  2F78 A;  3EHS A;  3B9P A;  1N3X A;  4OWD A;  3GO8 A;  3VKH A;  3DM0 A;  2V93 A;  3TQL A;  3L6H A;  2UXD M;  2DZN B;  3C9H A;  3UGW A;  4IBD A;  3W9V A;  4P11 A;  4NXN M;  3MZ9 A;  1ZKB A;  4OQO A;  4ZDM A;  5DVJ A;  1H43 A;  2ESN A;  2A5T B;  2VOZ A;  5ISU A;  2EO2 A;  4LZZ A;  3IB1 A;  2D3I A;  4KYD A;  1M5E A;  3UGJ A;  3G3J A;  1SQY A;  3BKI B;  4GKJ M;  1B7U A;  1ORY B;  4PET A;  3TCH A;  4IGT A;  4DXU A;  3FJ7 A;  3GQ4 A;  4IBB A;  2HFB A;  2OZZ A;  3FZV A;  2QP9 X;  1GLN A;  2OWS A;  1HNW M;  5FTN A;  4QOS A;  5E26 A;  4R73 A;  4DR6 M;  4BDQ A;  4D81 A;  4HS7 A;  4KFQ A;  3HV1 A;  5IAI A;  1OLA A;  3HPI A;  1K3X A;  4DIG A;  1L1Z A;  3GP1 A;  3TDJ A;  3F11 A;  1IXG A;  3H6V A;  3O29 A;  4OFL A;  4ELO A;  4I81 A;  3RLF E;  5AE4 A;  4JI4 M;  3KEI A;  1N04 A;  4LG2 A;  4YB5 A;  4OX9 M;  3DA1 A;  5C1B A;  3T38 A;  3RN8 A;  1EU8 A;  1FQD A;  1FTL A;  1AH5 A;  4WEP A;  3PPR A;  2OJT A;  3KSX A;  4O3A A;  4TLM B;  4GOT A;  4AB5 A;  2XD2 A;  2CFO A;  4Z8X A;  3KOT A;  4EUO A;  2H4I A;  4ZED A;  4DR1 M;  1B3L A;  3OO9 A;  4ZEC A;  1IXH A;  4OVZ B;  1LST A;  3HJS A;  4F3S A;  1SXJ E;  1MM7 A;  3S2V A;  4Q5T A;  3L26 A;  1LGB C;  3OMB A;  4JDF A;  1Z59 A;  2I7P A;  5ELV A;  2ZM6 M;  3RFW A;  2FE8 A;  1HQC A;  3KJT A;  3K1M A;  4JI0 M;  1N0T A;  2DVW B;  4G8M A;  3M3L A;  4HW8 A;  4R2B A;  2D7H A;  5DTB A;  3RE8 A;  2HZK A;  3WHK A;  1B2H A;  3IOV A;  1IN8 A;  3MPK A;  4LZJ A;  3FD3 A;  2B3F A;  4DR4 M;  3HGI A;  3GLF A;  2DYX A;  2O7I A;  4OFO A;  3M0E A;  3U6E A;  4YZZ A;  2V3T A;  1DTZ A;  1Q3B A;  3AV0 A;  2VP1 A;  3EIE A;  3GLH A;  4IBC A;  4Q8R A;  1MXZ A;  2KLF A;  4IBK A;  3GLF B;  3RY3 A;  2IEE A;  4X62 M;  5LMN M;  1B3E A;  5CRY A;  1MH4 A;  2F5P A;  4G6Z A;  3CSB A;  5CM6 A;  2I48 A;  3SAV A;  1R9Q A;  3LUY A;  1DPE A;  2F5N A;  5B7D A;  1Y1Z A;  3HU2 A;  5KQ8 A;  4LRT A;  2VGQ A;  2Y7P A;  2I0B A;  1I6A A;  3ZC7 B;  3DLN A;  4LF4 M;  1MQJ A;  3TUS A;  3ILU B;  3I4Y A;  2D7G A;  1IIT A;  4C0R A;  3SEW A;  2EA0 A;  5BPV A;  3LBS A;  5FTL A;  1VFE A;  2A5S A;  1IUD A;  3K1P A;  3JZJ A;  4WKM A;  4B08 A;  4BDL A;  2L6O A;  4PFW A;  1QUI A;  4ZE9 A;  2CV0 A;  1B52 A;  4GRK A;  1IN6 A;  5ITY A;  4I4L A;  4FEB A;  3CTW B;  3I6V A;  3GPX A;  1QKA A;  4MGZ E;  1JW5 A;  2OBG A;  3FGS A;  3PU5 A;  4JWX A;  1NNJ A;  5FTK A;  1NY5 A;  1QAO A;  1RYO A;  5L8D A;  2J7O A;  1EZO A;  4F29 A;  4H6D A;  2VQE M;  3MVZ A;  3R7X A;  3MUQ A;  2D5W A;  2GFE A;  2OWT A;  4RF0 A;  2F8D A;  4B3T M;  3JV9 A;  1O7T A;  4EF2 A;  2PX1 A;  4QRZ A;  5AA2 B;  3FYC A;  3TQW A;  4GD5 A;  5M2V A;  4BLC A;  3PMV A;  5EP4 A;  4N13 A;  1EE8 A;  3S9M C;  4CIS A;  1PJI A;  3U5Z B;  2REG A;  2Y7I A;  2Z23 A;  1GKI A;  4OEN A;  4EQB A;  1I6B A;  2XLJ A;  3K00 A;  5K2X A;  4W5W A;  4FW9 A;  1L2B A;  3VVE A;  3R6U A;  2V1C A;  5BUU A;  3K6X A;  1VFD A;  3C4M A;  1P99 A;  1SW2 A;  2QPQ A;  2VHA A;  4XKQ A;  3FXU A;  3L6G A;  3OD7 A;  5JI2 E;  3QXM A;  2XXP A;  4TOZ A;  3FUV A;  2H99 A;  4AG6 A;  1AMF A;  4ELP A;  2O84 X;  4QFN A;  3DOA A;  1N33 M;  2ZAO A;  3PV0 E;  1FQE A;  4ZEI A;  3KVW A;  4JI2 M;  3FVO A;  3DP8 A;  1TDH A;  3H6U A;  1LAX A;  4R75 A;  2XXV A;  1HSL A;  2UVJ A;  2OQ4 A;  4FCV A;  3TE6 A;  4AI6 A;  3KN3 A;  4YAH X;  3U72 A;  1NKX A;  3C32 A;  3O6I A;  4POX A;  1OFH A;  4YMA A;  4DLD A;  3E4R A;  2H98 A;  2Z8E A;  2DWI A;  3C31 A;  2PVU A;  3G3H A;  3OEM A;  3N6T A;  3PNY A;  3CFX A;  2ZAN A;  3SDF A;  1B4Z A;  4LY6 A;  3VFJ A;  4GFR A;  2VD3 A;  1B05 A;  1DO0 A;  2YR0 A;  1DGH B;  1K3W A;  3G3F A;  5ITT A;  3T9V A;  4PQJ A;  3S9N C;  4NSO B;  1XNR M;  3K02 A;  3ZCB B;  4F3G A;  3D4C A;  4E0W A;  4FIM A;  2X26 A;  4E0X A;  2BJW A;  3TEP A;  3T96 B;  4LP2 B;  1QZM A;  3H7M A;  4QSE A;  4M9S A;  5KPT A;  2XXT A;  1KFV A;  2QRY A;  4YMB A;  1H45 A;  1FQA A;  4C1T A;  4RPN A;  2KXE A;  2XX9 A;  3VFD A;  1MXY A;  1ANF A;  2QL3 A;  3IX1 A;  4CGY B;  2RF1 A;  4GL8 A;  3MC2 A;  5IZ7 D;  4AZF A;  4LCB A;  2XD3 A;  4ZS9 A;  4Z7E A;  3K1J A;  2XZF A;  4DUY M;  3IB0 A;  1M5C A;  3CFL A;  4FVM A;  1IXC A;  4YIC A;  1JVY A;  3FAT A;  5FTH A;  3N6U A;  4AW4 A;  5I2N B;  1P1Q A;  1CB6 A;  2CV2 A;  1WXQ A;  1QUK A;  1D3K A;  4NF6 B;  1IN5 A;  3V83 A;  2DVC A;  2XXQ A;  1XVY A;  3AKZ A;  4LJ5 A;  5AA4 A;  3HHZ A;  3SEV A;  2HZL A;  5FHO A;  5DVI A;  3IG5 A;  1ZBM A;  1BLF A;  3SYK A;  3MHV C;  2M5Z A;  4M9Z A;  3A3C A;  1Y3Q A;  4JBZ A;  2IA4 A;  3QUJ A;  4HCW A;  4C1U A;  4LJ8 A;  1MG1 A;  4QSD A;  1NHG C;  3USD A;  3HN0 A;  2C9O A;  3IOU A;  1HNX M;  4II7 A;  3MP1 A;  3IOW A;  4HL4 A;  1TH4 A;  4RYA A;  2Y0T A;  1XS5 A;  3DP4 A;  3CSG A;  3VVF A;  3SFZ A;  1QW0 A;  2CE7 A;  3MVW A;  2HKJ A;  1HSE A;  4DV2 M;  2KA6 B;  2KW0 A;  3K6W A;  2ZXT A;  1LAF E;  5EHM A;  2EUC A;  3CIJ A;  2YQZ A;  3GXA A;  3GLH B;  3FD9 A;  4YB7 A;  1B9J A;  5DYH A;  4Q0C A;  2RCB A;  3MP6 A;  1MPD A;  1MX0 A;  3PUX E;  1QQW A;  3I5O A;  4HTG A;  4X48 A;  3U61 A;  5DT6 A;  4GH9 A;  2ZNT A;  4GIZ A;  1LFI A;  4IO6 A;  1A8F A;  1SYH A;  1POY 1;  1IQP A;  4BDN A;  1ZLQ A;  2XXW A;  4OMB A;  5AA2 D;  2M60 A;  3HST A;  1Z5C A;  4FWH A;  2B65 A;  2O6A A;  2LAO A;  3I51 A;  2ZMB A;  1LCT A;  1N84 A;  3ODB A;  1XXH B;  4IO7 A;  3QYT A;  2L7H A;  4MLQ A;  4LUB A;  3LSX A;  4IO2 A;  3MPL A;  5AA4 B;  5H8Q A;  2GHA A;  2F5S A;  1MY4 A;  1GVN A;  4H67 A;  3ZKK A;  4M0W A;  1XXH A;  1LBB A;  5KPZ A;  2AYS A;  4QFK A;  1TXF A;  1BP5 A;  3RPW A;  4KO8 A;  5GKN A;  3TTM A;  4Z6Y A;  4DXB A;  4KCC A;  1FQC A;  2PT2 A;  3U6M A;  4LJ7 A;  1R2Y A;  1K82 A;  1VE4 A;  3KXE C;  1L8Q A;  3OSR A;  3VLU A;  4ZEB A;  2ZBK B;  4I9D A;  3MVX A;  2UXC M;  3V5A A;  1NFT A;  2CZL A;  1GGG A;  3G3K A;  4IY6 A;  4YHH M;  2X8A A;  1URS A;  3H06 B;  3UOR A;  1WOD A;  4OEV A;  3U6S A;  1AL3 A;  2ONK E;  3A42 A;  4PD2 A;  5EP3 A;  5ITX A;  2UUC M;  4EIW A;  4FOR A;  3U61 B;  4JWY A;  4H0W A;  3SEX A;  5A5X B;  3N94 A;  5H8Q B;  2NXO A;  2V1U A;  2O7U A;  1ATG A;  5I59 B;  4JV5 M;  5I56 B;  4OEU A;  3K6V A;  2QZ4 A;  3FUU A;  1D2N A;  4ZPX A;  4XBO A;  1B46 A;  4G68 C;  4PCZ A;  2RKO A;  2O1M A;  2CV1 A;  1KWH A;  4S12 A;  4LJ6 A;  4IBF A;  1G8P A;  3HJQ A;  2J7N A;  3MZ1 A;  1OQG A;  3O97 A;  1QUJ A;  1FTM A;  3Q27 A;  4RXL A;  1MU5 A;  1VDD A;  1R6B X;  4GRI A;  2D21 A;  3U94 A;  3U6O A;  2DXI A;  2CEA A;  2E1S A;  2RGO A;  2OK2 A;  3AOE C;  3T15 A;  1URG A;  4H5F A;  1TFA A;  2ZAM A;  2R62 A;  1YSY A;  1OJL A;  4ELR A;  4F39 A;  2H5Y A;  3OEN A;  1NMU A;  4OES A;  5CMK A;  1T3T A;  1QAM A;  4X65 M;  2DVZ A;  3A98 B;  1ZTY A;  4F2Q A;  2OLB A;  5H8S A;  2CMO A;  4PFT A;  2I7N A;  5IWA M;  1IIW A;  4EXK A;  3K0V A;  3O66 A;  3MJ5 A;  1LV7 A;  1OIB A;  3IO6 A;  2Y7K A;  4NMY A;  4HLQ A;  2LNH C;  3SAW A;  4BDM A;  5L9M A;  1LFH A;  1H3D A;  5H37 D;  2OCU A;  3PGF A;  1Q39 A;  4YKI A;  4LRS A;  1B3F A;  3IG8 A;  2G5G X;  4R6K A;  2I4B A;  2I3W A;  4LQ2 A;  4DR5 M;  4U21 A;  2JA2 A;  1P1U A;  3G3I A;  3I3V A;  2I3V A;  3C58 A;  2ERC A;  4L15 A;  2F34 A;  4ESX A;  1D4N A;  1PBP A;  2DHR A;  3O6G A;  4YKJ A;  3NBI A;  4CHT B;  3ILK A;  5AA2 A;  5FTM A;  3ILT B;  5KO3 A;  5H8N B;  4BDO A;  1IXS B;  2DE3 A;  4LF8 M;  3U8Q A;  3GBA A;  4AKG A;  4ESW A;  4U23 A;  3OOA A;  4GF8 A;  4NSR A;  3QK6 A;  2R6G E;  2UXA A;  3AOE A;  1UTH A;  1B1X A;  1NNK A;  2ZNU A;  4ECF A;  5HPQ A;  3VDU A;  1XMO M;  5H8F B;  5JK4 A;  4DZ1 A;  3R9X B;  3OO6 A;  4AG5 A;  1MH3 A;  3PNV A;  3T22 A;  4GC9 A;  1H6U A;  3FV2 A;  3A45 A;  5DYG A;  4XTC Q;  4GMQ A;  5ITR A;  3OEK A;  1XHB A;  3RTW B;  2YJP A;  4DCX A;  4PFY A;  2KZU A;  3PFI A;  4RPO A;  4P0G A;  4FD2 A;  3MVY A;  3Q26 A;  3PUV E;  4JI6 M;  2FYI A;  3VK8 A;  5LMU M;  4B3M M;  2RGH A;  4G8H A;  3ZSF A;  4GHL A;  1IY0 A;  3HU1 A;  4F1U A;  1MY2 A;  5FLX S;  3GRR A;  1B51 A;  1Y20 A;  4DV5 M;  2XEP A;  3L25 A;  1XMQ M;  2DWN A;  3FKE A;  3MK6 A;  2F5O A;  4JYA M;  4H65 A;  4NF8 A;  4X1D A;  1OVT A;  1NNU C;  2F6G A;  3WAE A;  3VVD A;  1M5F A;  3EPE A;  3Q25 A;  1JQF A;  1FQB A;  3CRB A;  2UYF A;  1IBK M;  2C9C A;  2Q2E B;  3FTC A;  1BKA A;  1L2D A;  1MXX A;  2QMX A;  1O63 A;  3TQS A;  3KOW E;  3KJ7 A;  1HQY E;  3TOD A;  2QS1 A;  4ZEK A;  1B3H A;  3CF0 A;  3P7I A;  2Z4R A;  5J1D A;  1NVM A;  3ZS6 A;  3BBR A;  1MM6 A;  2YFQ A;  4MFI A;  1B7Z A;  4GQO A;  3PXG A;  1Q1K A;  4WW0 A;  2Y21 A;  4POW A;  1NH7 A;  3HHX A;  4OVJ A;  4REZ A;  1MQD A;  2H25 A;  2XXU A;  1OQH A;  3VV5 A;  3NWL A;  4ELQ A;  3WHL A;  2Y20 A;  3KW6 A;  5ITP A;  1GVC A;  3B6T A;  3J80 S;  1I4W A;  5K2Y A;  2FA7 A;  1MQH A;  4KYE A;  5A2Q S;  3PD9 A;  1NY6 A;  2R65 A;  5L9S A;  2Q8J A;  2QPA A;  3Q28 A;  1QAN A;  3THG A;  1DGG A;  4IJE A;  3HHG A;  3GBB A;  3GLI A;  2E5L M;  5IRE B;  4UAC A;  2I58 A;  3T93 B;  3FUZ A;  4EQ9 A;  1EZ9 A;  2DWJ A;  1J09 A;  3GQ3 A;  3IJO B;  4F1Y A;  1JNF A;  1I69 A;  3KBR A;  3AJI B;  1TH2 A;  1MDP 1;  3GLI B;  3RGY A;  4F3P A;  4GIT A;  4KPT A;  2THI A;  4L8R C;  4LFC M;  3R26 A;  1HR0 M;  1CE2 A;  2R71 A;  4NF5 A;  4Z0I A;  1E9R A;  1LB8 A;  3RQT A;  1JEV A;  4AQY M;  2G29 A;  1LAH E;  4OHN A;  4G4O A;  2HCB A;  4JN6 A;  5I59 A;  4I62 A;  1OMP A;  4U2R A;  1SVX B;  1M5D A;  2DE4 A;  2FNA A;  4N6P A;  1LAG E;  3PPP A;  3U92 A;  5DYI A;  1PDA A;  5I57 B;  3UP9 A;  4DV3 M;  2D7E A;  4GKK M;  5FHN A;  2XXR A;  1HSJ A;  1Q35 A;  1MQI A;  4JI8 M;  1US4 A;  2FNC A;  4RJZ A;  1E32 A;  3G7W A;  4R72 A;  3J7A S;  4QF9 A;  3KFM A;  4RK9 A;  1WDN A;  2RC7 A;  3FAS A;  2REJ A;  4G77 A;  3J7B A;  1TDZ A;  4FJP A;  4G4Q A;  5AA3 A;  1TFD A;  3KP1 E;  1NJF A;  1SW5 A;  1E94 E;  4LJ9 A;  3JR4 A;  3SEU A;  1Z7M E;  4DV6 M;  3MAM A;  1MY3 A;  3IL1 B;  4D82 A;  1SXJ B;  1N75 A;  2G8L A;  3UJN A;  4EDP A;  2O68 A;  3TTR A;  5I84 A;  2KZS A;  4LGY A;  1XOC A;  3TPA A;  3MP8 A;  4YB6 A;  3TYH A;  3HHW A;  4MBP A;  4QFO A;  4R7G A;  3JR5 A;  4R6Y A;  2L7I A;  2YPN A;  2ZYM A;  1YCJ A;  1I94 M;  1B4H A;  1B1H A;  3U6L A;  4K0K M;  4RF1 A;  1N7X A;  4X9T A;  1PJJ A;  3IOR A;  4R9G A;  2ZNS A;  4MB7 A;  2PYY A;  2RC8 A;  4U22 A;  1S50 A;  3SET A;  4YY3 M;  3VDP A;  3FXQ A;  1XT8 A;  4XXU A;  5TPA A;  2F35 A;  2F4V M;  3IAZ A;  1Y9U A;  3K2L A;  3RNN A;  3JAM S;  2Z3X A;  3PD8 A;  3GZG A;  3MJN A;  4GLI A;  3E13 X;  1MQG A;  1NNP A;  1MXV A;  5CMM A;  3VKG A;  2C5R A;  5CBR A;  4L16 A;  3T9U A;  1GTK A;  3EN3 A;  3O28 A;  1N7W A;  1ZMG A;  4AKH A;  3UA8 A;  3HJ8 A;  3TZA A;  3GLB A;  3MQ9 A;  3QAX A;  4F31 B;  2DWL A;  4KD5 A;  5CBS A;  2W82 A;  2BNK A;  5EXT A;  1ZJL A;  4MF3 A;  2V84 A;  1YUB A;  1W5T A;  1A40 A;  4UA8 A;  4OTE A;  5I2K B;  3E3K A;  3GRV A;  4NL4 H;  1B5J A;  1P1O A;  3AXF A;  4IBI A;  3THI A;  2GRV A;  1PB7 A;  4BLA A;  3CF6 E;  4GXS B;  4LFA M;  4NED A;  3TCG A;  2HAV A;  1FW0 A;  4AB6 A;  4TUW A;  2RCA A;  3TAJ A;  3AL0 C;  2V3Q A;  4H1X A;  5FTI A;  2HL7 A;  1MDQ A;  1OVB A;  4LZ5 A;  2YLN A;  4LA9 A;  5JEI A;  1N76 A;  1SDX A;  4D80 A;  5DNY A;  3FJG A;  4M9X A;  4LVQ A;  4R2F A;  3B6Q A;  3PMX A;  1XHY A;  4M4G A;  2C98 A;  4EF1 A;  5H8N A;  1QKB A;  4ZZA A;  2UUA M;  3U60 A;  2BJJ X;  3PUZ E;  4U4X A;  5I2K A;  1BTJ A;  1TH3 A;  1NJG A;  3O2A A;  1MPC A;  1DO2 A;  2I49 A;  1G4A E;  1Y3N A;  3DEL B;  3O9P A;  4QFP A;  2XSZ A;  1UM8 A;  4PT5 A;  2XXY A;  3J27 B;  5DEX B;  4DE8 A;  4MGK E;  3FXR A;  1XNQ M;  4NF4 B;  1JQJ C;  4JXI A;  3CR9 A;  3TTK A;  4FAT A;  1S3S A;  4WED A;  2BJV A;  5KDT A;  1MS7 A;  2RKM A;  3D8L A;  1B7H A;  1H44 A;  3S9E A;  1B58 A;  1QJM A;  2KEB A;  3LSL A;  2UU9 M;  3SYL A;  3GPP A;  1SXJ D;  5CC2 A;  2I4C A;  3M8U A;  4JSD A;  3KDS E;  1UTH B;  1R2Z A;  2RIN A;  1W5S A;  4QSC A;  2DP8 A;  3KOY E;  3W9W A;  3UN6 A;  4OER A;  2F36 A;  5EP1 A;  2Z8F A;  3U60 B;  1ZQ9 A;  1TGU A;  4G4N A;  4QHT A;  1USY H;  4LZ8 A;  2Q2C A;  4OU7 A;  1TT1 A;  1P1N A;  2NUV A;  3FVK A;  4RY1 A;  2XFT A;  5L9O A;  3U5Z A;  2B3B A;  5B70 A;  3C35 A;  5I56 A;  3CG3 A;  3HCQ A;  4MH5 A;  1IXZ A;  4QNM A;  4JB7 A;  2ZYN A;  5F1Q A;  2CHV A;  1UTB A;  4G2Z A;  3OO7 A;  4L4U A;  3C33 A;  3CF2 A;  1FNN A;  3KS8 A;  3N26 A;  1IEJ A;  1IBM M;  3K01 A;  1I6Q A;  4X64 M;  2XXX A;  1DMB A;  2A5Y B;  1USY E;  3A46 A;  2FFJ A;  1US5 A;  2F7C A;  2HXW A;  2P5T A;  3IO4 A;  3R8F A;  4XIG Q;  2I6E A;  2X7P A;  1KSF X;  3FVG A;  4LF7 M;  4DCY A;  3UIF A;  1N36 M;  4DV1 M;  5EXP A;  2XF3 A;  3U6C A;  2DWM A;  4DDD A;  5ICQ A;  2XFS A;  3RT6 B;  4NRV A;  3I4V A;  3EHT A;  3SEY A;  3TKD A;  1IZ1 A;  3LMM A;  3SHG B;  1SXJ A;  3OTO M;  1GL7 A;  1NL5 A;  2H9B A;  4JWO A;  2L09 A;  4DV0 M;  2ZYK A;  4R3D A;  1YPN A;  1R1N A;  3T66 A;  2CUZ A;  3W0L B;  3ZKL A;  2VQF M;  3BFU A;  2X49 A;  4KOD A;  3UK4 A;  1F9B A;  2UUB M;  4WXJ A;  4ZEF A;  3IJX B;  3CVG A;  4O3C A;  4F2O A;  4IO5 A;  4FWD A;  4M0D A;  4GWO A;  3G3G A;  4R6H A;  3RT8 A;  2KRU A;  2UVI A;  1R6Z A;  3SKP A;  4NXM M;  3LVW A;  3TTL A;  3HHY A;  4I8O A;  4NE4 A;  1T0K A;  4HCY A;  5KCJ A;  4H5G A;  4FCT A;  5LOM A;  2R46 A;  1LCF A;  4FEC A;  1G41 A;  2Q9T A;  3TMG A;  4P16 A;  4NWD A;  5HM4 B;  3SAR A;  1RYX A;  3OXN A;  3T9X B;  4PFU A;  1L1T A;  4LAT A;  2F97 A;  3ZH9 B;  4XKP A;  1FCK A;  1DOT A;  1B3G A;  1X37 A;  2LXE A;  4FAJ A;  2DWZ B;  3V8X B;  2DXR A;  1D9V A;  3B7D A;  2KRK A;  1D9Y A;  2QCU A;  2P1S A;  4RNA A;  5AA1 A;  3HWS A;  4KQP A;  3EHU A;  1YTV A;  5TU0 A;  4KYS A;  2X4A A;  1Z5B A;  1IBL M;  4JI1 M;  1QVR A;  4TQU Q;  1H76 A;  4G8N A;  2HHH M;  4NF6 A;  5KCJ B;  4MH0 E;  4BDR A;  3SC3 A;  3S9L C;  3KS4 A;  5C18 A;  1O64 A;  2F6P A;  3T1Y M;  1VSO A;  5KPR A;  4LFB M;  2P0S A;  5I2N A;  3PVS A;  1Z5A A;  2Z8D A;  2XX7 A;  3TWK A;  3K4U A;  4NF8 B;  1WVJ A;  3KOS A;  3FTD A;  5ICT A;  1LLS A;  4I8C A;  1HT1 E;  4AQ4 A;  1SI0 A;  5CMB A;  1B32 A;  3K2D A;  4ZZE A;  3ECR A;  4X1B A;  2R4E A;  2AIX A;  3LC8 A;  4WUR A;  2LH0 A;  2DQV A;  1DTG A;  2XH9 A;  1SBP A;  4B7F A;  3OO8 A;  2HQ0 A;  3VXC A;  3H4Z A;  4R74 A;  1UQW A;  1SI1 A;  2QEN A;  3QUF A;  4L17 A;  4ND9 A;  2DSF A;  4F1V A;  3LR1 A;  3QWL A;  1FTK A;  4PE5 B;  4DV4 M;  5DEX A;  3FV1 A;  1ZAE A;  4B7G A;  4KLN A;  2O5R A;  5IKB A;  1YE9 A;  4JSO A;  4LON B;  3GPY A;  4RK2 A;  3SES A;  4FCW A;  1Y3P A;  3KFU G;  1MPB A;  3SMP A;  3Q8X A;  4F19 A;  3GQ5 A;  1VR5 A;  2ONR A;  3PPQ A;  4GVO A;  4Q30 B;  3K1N A;  3W0F A;  1R9L A;  2QS4 A;  3QIM A;  3LSF B;  3KN8 A;  4IY5 A;  1IXI A;  2Y7W A;  2F7B A;  3GLG B;  3C34 A;  3HO7 A;  3K92 A;  1Y1M A;  3FTE A;  1SXJ C;  1JR3 D;  2F5Q A;  1B40 A;  2YNM D;  2Q2A A;  4THI A;  1MY1 A;  5EHS A;  1NH8 A;  1KYI A;  4OW0 A;  3L27 A;  4A3V B;  1UIV A;  3J81 S;  1DSN A;  1HT2 E;  2AHM A;  3UZU A;  1A55 A;  5JI3 E;  4L78 A;  3HU3 A;  3E9S A;  2PMS A;  1MXW A;  2ZYO A;  4KCD A;  3IOT A;  3DFZ A;  1IXR C;  4IIW A;  1OLC A;  3S4U A;  4F18 A;  2UVH A;  3KP0 E;  1YAE A;  2DWA A;  1GV8 A;  4G4P A;  3QAU A;  5IT9 S;  4QHS A;  4GL0 A;  5I58 A;  4IO3 A;  2DE2 A;  1IM2 A;  4JI3 M;  2DOJ A;  3UMM A;  3Q29 A;  1EH3 A;  4U1Z A;  3U1O A;  3PPN A;  5H8H B;  3VXB A;  1LBC A;  4NF4 A;  4QNR A;  3FUX A;  1QYR A;  2A5T A;  3C36 A;  4EQ7 A;  3ONM A;  2XSZ D;  1B0H A;  2CHG A;  1LFG A;  4NWC A;  3KG2 A;  1Y4T A;  4F22 A;  1SW1 A;  2XZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...