3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
5I59A 4QFNA 1NNTA 2H5YA 2I3VA 1XVXA 4ELRA 4IY5A 2I49A 2I4BA 1LSTA 1QKAA 3IJOB 1N04A 2IA4A 1DMBA 5TP9B 2Z22A 5AA4A 2H25A 1NFTA 3MPKA 5B70A 4AB5A 1HSEA 3RY3A 3IOUA 2DP8A 3FUZA 1MXXA 3PD9A 1Y20A 3JYRA 1I6BA 4LONB 4FORA 2Y7RA 3B7DA 4IO7A 3PUZE 3LSWA 1OLCA 5H8HB 3SDFA 1Y1MA 1FTMA 1TWYA 5TU0A 3VFJA 4EDPA 4XXUA 1A8EA 2GHAA 4U1OA 2XD2A 3MP1A 3K1PA 1ATGA 5DYHA 1PBQA 1QUJA 3CFXA 3IO4A 1BIYA 1ZBMA 4H0WA 3M3KA 3TZAA 2R71A 1ZTYA 3RUMA 2GFEA 3TCHA 1SI0A 4QRZA 3H03A 1EU8A 4WKMA 3OENA 4IO6A 1JEUA 3TCGA 1USYH 3KOSA 4FEBA 4X48A 4ESXA 3N6UA 4GLIA 1GGGA 4I62A 2A5TB 5I2NA 2HZKA 3KG2A 1P1NA 4M1VA 3OEKA 4YKIA 3G3IA 3EHTA 1MQIA 4YB5A 4ELQA 3T66A 1J1NA 1LBBA 4BDLA 3C32A 4ZS9A 4KYDA 3SESA 2AL5A 4ZECA 5AA4B 1PB8A 3DP8A 1I6AA 3FVKA 4KCCA 3MAMA 3PMVA 1A99A 3B6WA 1DTZA 2PT1A 3PMWA 1IQ7A 2O68A 4DCYA 4LUBA 1SW5A 4HS7A 1PB9A 5BWJA 4ECFA 5CI5A 1B1HA 3IL1B 5EHMA 3UN6A 4XKNA 1URGA 3PV0E 4FECA 2F6PA 2PYYA 4OESA 3FGSA 4KI0E 2D3IA 2QS4A 2DE2A 3H4ZA 3PUXE 2I48A 1LAGE 4NF4A 4KYEA 2OK2A 5I56A 3H06B 4XKPA 3MQ9A 2UYFA 2QL3A 1Y3NA 4F3BA 2E0SA 1MPDA 3Q29A 2XXVA 1QKBA 3EN3A 1IUDA 2Q88A 2ONRA 4KD5A 1MY0A 3TTLA 2PMSA 2QSXA 2PT2A 4DE8A 3BFUA 3TTKA 4AQ4A 3IB0A 2HXWA 2RINA 2ALUA 2V84A 3FASA 3DLNA 3K6WA 2Y7IA 3MWBA 2CMOA 4QFPA 1GR2A 2Q2AA 5CBSA 1P1QA 1AH5A 1FQDA 1WDNA 3HO7A 1FTOA 5DTBA 3UGWA 1B52A 2O69A 1FCKA 2Q89A 3MC2A 1S9TA 2W7YA 3T96B 5BUUA 3PGFA 5KDTA 2O6AA 2FA7A 2VP1A 3U1OA 4PQJA 1NH7A 3IB1A 4BDMA 3U72A 4I1DA 4UACA 2DXYA 4H8IA 3C36A 4I9DA 4IO2A 4R72A 4ESWA 2F8DA 4FIMA 4EQ9A 4Q0CA 3PUYE 2OLBA 3S9LC 3KZGA 1MH4A 2XXQA 1UTHA 3PPPA 3MBPA 1ANFA 1Y9UA 1B0LA 4Q30B 4KCDA 3TEPA 3MVZA 1P1OA 1FQCA 1R9LA 3ODBA 4F3GA 2ZYMA 2O1MA 1EZ9A 4KPTA 2VHAA 4HW8A 2B65A 2UXAA 2V93A 1MG1A 1DPEA 1LCFA 4NWDA 3TTMA 1FTJA 2D21A 3EQ1A 1JW1A 5IKBA 2DWJA 4ZEIA 4YU0A 1ZU0A 1UQWA 4H6DA 1VSOA 2RCBA 1A7LA 2ZNTA 1RKMA 3PPNA 2Q2CA 2NWJA 1S7YA 5KDTB 1SVXB 3IOVA 1IIWA 3QIMA 3UK4A 5AA3A 2F5XA 2DWHA 1GVCA 1QJMA 4IY6A 3EHSA 3VVFA 1N76A 1OVBA 1VE4A 3KSJA 1USYE 2QS2A 4EQBA 2CZLA 2ZYKA 3CVGA 4NWCA 1QVSA 4NEDA 2F34A 5DEXB 3MP6A 3MZBA 4G77A 1MQDA 3R6UA 2BJJX 1RYOA 1ZMGA 2UYEA 3O28A 3HCQA 4OFLA 1IXGA 3SKPA 3QK6A 4OEUA 4GFRA 4QFOA 4GIZA 5TP9A 3Q27A 2THIA 4H5GA 1B3HA 4G68C 1POY1 1QW0A 2XHDA 1ELJA 4OFOA 1MY3A 1LFIA 2P1SA 4RNSA 1OIBA 5KCJB 1LAFE 1LB9A 5H8HA 1SI1A 1FQFA 4THIA 2Z23A 3HN0A 4HCYA 1HSLA 1TXFA 2X26A 5K2YA 4G4PA 4OZ9A 1JEVA 3V5AA 3E4RA 3KBRA 3USDA 5LOMA 3RT8A 4LZ5A 4MH5A 4K3FA 2F7CA 1B40A 2ZMBA 4ND9A 1R9QA 3O6HA 3HHFA 2XX7A 4IO5A 2D5WA 2O1LA 1R6ZA 3IR1A 3O29A 1XVYA 3B6QA 3H7MA 1UTBA 5KZTA 2ZYOA 1KWHA 3H6UA 2A5TA 1B3LA 1I6QA 4LQ2A 4X1BA 5JTYB 3VDFA 3TFLA 3IJXB 1YCJA 3THIA 4PP0A 4ZDMA 2QMXA 4DCXA 3TKDA 1UIVA 4LZ8A 2NUVA 1P99A 3LSXA 4DZ1A 2HCAA 1OLAA 1LB8A 3O97A 1H3DA 1EZOA 1S50A 3TTRA 1IITA 1B5HA 2H4IA 4ZE8A 1DPPA 4NF6A 3SEYA 4HCWA 4OVJA 2VD3A 4NTLA 4OWDA 1D9VA 1HSJA 4NMYA 3CRBA 5AA2A 3CFZA 3IO6A 5ELVA 4GD5A 4MLVA 3FJGA 2DWAA 4RPNA 1B3FA 2B3BA 3TUSA 1B5IA 2V25A 5CMMA 2RCAA 1VFDA 3KN3A 2H9BA 3QUJA 2VD2A 1LGBC 3G3JA 1MY1A 3QYTA 3JZJA 3N94A 4EF1A 4OEVA 2PX1A 3MP8A 2XXPA 4RK2A 1TFAA 4DXUA 1UTBB 3FIRA 2Z8EA 1D3KA 3S9NC 5K2XA 4F3SA 2X7QA 4FAJA 3U94A 2I0BA 1SW4A 2Y84A 3CSBA 1POTA 2QS1A 1MXYA 1D9YA 1UIUA 1H45A 4YAHX 3W15C 3K4UA 3TODA 4OFJA 5HBCA 2F6GA 5L8DA 3K2DA 1VR5A 2O84X 4MFIA 2ONKE 4BDOA 3LC8A 3WAFA 2M8CA 1OQHA 1IEJA 2V3TA 1P1UA 1Z7ME 2ZXTA 4MF3A 4P0IA 3LBSA 1WVJA 1M5BA 1A40A 1VFEA 1MQJA 4NF6B 3G3GA 2ANJA 3EF7A 1SQYA 3HV1A 4GL8A 5AA2B 3FV2A 3ZKLA 2UVJA 2RC7A 3C34A 2OBGA 3RQTA 3K6VA 1JW5A 4F19A 4LATA 4BDRA 3QUFA 4WEPA 1QUIA 1N84A 4LP2B 1I69A 3DELB 5HPQA 1FTKA 5DVIA 4GF8A 3KN8A 2V3UA 4N13A 3G3HA 3TQWA 1QUKA 1LBCA 1B0HA 3S4UA 2DWIA 2NOOA 4GQOA 3Q28A 1BP5A 2E1SA 4R75A 4F1VA 3KJ7A 3TCFA 1OMPA 5CRYA 3BKIB 4QFKA 1SW2A 3SEWA 3T9UA 3OMBA 2F97A 3CIJA 2QPQA 4QSCA 3OOAA 3MJNA 2REJA 3OO6A 2XXIA 3V8XB 4DDDA 2ABHA 2RKMA 4QSEA 3M3FA 3K6XA 3MVXA 3F11A 2DVZA 1Y3PA 1JQFA 4O3AA 1B2HA 3K02A 1SYHA 4H1XA 2Z8FA 2P2AA 5A5XA 4YKKA 2F7AA 4ZEFA 3VVDA 4RPOA 3G3FA 4OERA 4XTCQ 1B7ZA 3BBRA 2WKYA 5AE4A 3VLUA 4DLDA 4OTEA 1MM6A 2H98A 4C1TA 4ZEBA 1N0TA 3CFLA 2OWTA 3OXNA 4H8JA 3I5OA 2AIXA 4F31B 3Q26A 3OO9A 5B7DA 4U22A 1MS7A 2NXOA 2AL4A 2XXRA 3CG1A 4F39A 5JK4A 5DEXA 5H8NB 2HQ0A 3E3KA 4L17A 1MY2A 2XX8A 2I58A 1PDAA 4JSDA 1AL3A 4NF5A 1B7UA 2UVHA 1B58A 2I3WA 2QRYA 2RF1A 1FQAA 5FTIA 2Y7WA 1CB6A 1FW0A 5F7VA 1B4ZA 3RNNA 2VOZA 1Y1ZA 2RC8A 4OXVA 3PUWE 1A54A 1JNFA 3MZ1A 2ZNSA 2DQVA 5KCJA 4UA8A 2R9JA 4YICA 4OENA 3LSLA 2HZLA 4XIGQ 4ZEDA 3U93A 1LFGA 3T93B 4RJZA 3N26A 2XXHA 3I3VA 3OSQA 1TFDA 5A5XB 2V3QA 3C31A 1FQBA 5AA2D 4HTGA 3H6VA 2DVCA 3FD3A 3AXFA 3RGYA 1Q35A 4BDQA 1MRPA 2FYIA 2I0CA 3H3GA 3DP4A 4G8HA 2F35A 3KN7A 5H8QB 1Q1KA 1AOVA 4U23A 3MW0A 2Y7KA 1FQEA 4R6KA 3V89B 1RYXA 3E9XA 1B3GA 4R6HA 1US4A 4C0RA 1R1NA 4MBPA 1N7WA 3S9EA 1LLSA 3UORA 2QJEA 2Y7PA 2UVGA 3IORA 5JTYA 3ILUB 1B1XA 4GVOA 2GHBA 3FJ7A 3IB2A 1II5A 1MQGA 5TPAA 3FATA 3VVEA 1DTGA 4NF5B 1IZ1A 4XKRA 1CE2A 1BLFA 4KYSA 3WAEA 4KQPA 2O51A 4RYAA 4PFYA 4YB7A 3LUYA 3CG3A 2YJPA 5L9MA 1M5DA 1M5EA 3L6HA 3O66A 3K1MA 3C4MA 1B05A 3G7WA 4JWXA 4R2FA 4POXA 5ITPA 3N5LA 4ZEKA 4ZE9A 5CBRA 1MY4A 3PUVE 1H44A 1URSA 3B6TA 5CMBA 3KEIA 1Y3QA 4GWOA 3C9HA 2DXRA 3GBAA 5L9SA 2G93A 5CM6A 4R73A 2HAUA 3EPEA 3U92A 1M5CA 3ZKKA 1B46A 5M2VA 1MPCA 2VGQA 1N3WA 3R26A 3W9VA 4E0XA 3O9PA 4H5FA 1XT8A 2B3FA 4F22A 1SYIA 1FTLA 4R6YA 4PETA 4AB6A 5H8FA 5I84A 3FVNA 1MPBA 4ISUA 4FJPA 4H67A 3KGCA 2DE4A 5I2KA 1LCTA 5IAIA 1O7TA 1OVTA 3HHGA 3V83A 3T9XB 1OQGA 5TPAB 3K0VA 3GXAA 4RA1A 3D4CA 4FE8A 1B7HA 1NL5A 4O3BA 3KJTA 1YAEA 5ICTA 1ZJLA 3IOWA 2DOJA 3W9WA 2UVIA 5F1QA 3TMGA 3SETA 4RY1A 5H8SA 1L5TA 4YB6A 4OMBA 3LSFB 4YZZA 4NF8A 5CC2A 1ZLQA 1A55A 3IK6B 4DXCA 4ZZAA 4EUOA 3GLBA 4BLAA 3VLVA 5L9OA 1GTKA 3VLWA 1SBPA 3VXBA 1JVXA 3K6UA 4PFUA 5I58B 2XXTA 4XKQA 4G8NA 3M3LA 4EXKA 4GXSB 2P0SA 4C1UA 5I57A 3G3KA 2I6EA 3S9MC 3ONMA 3UIFA 1MXZA 5H8FB 2Q9TA 4F2OA 1LAXA 5JEIA 2Q8JA 1NNKA 5FHOA 3IX1A 3T9VA 3PMXA 5I2KB 1N7XA 4X1DA 4EXLA 4QHQA 2OJTA 1M5FA 1MXUA 3O6IA 4IO3A 4ZZEA 3ZSFA 3VXCA 5FTHA 5ITOA 1MM7A 5I59B 1F9BA 3SEVA 2AYSA 1SD3A 2OWSA 4OYVA 4LVQA 2XXWA 5FHNA 2R6GE 4G68A 5J1DA 3MUQA 2IEEA 2OZZA 4NE4A 4U1ZA 3A3CA 5DVFA 2PVUA 2GH9A 4G2ZA 4OHNA 4PFTA 4JWOA 2ZNUA 3MVWA 4NF8B 3FVGA 1MDQA 2X7PA 2H99A 4KR5A 2PBWA 5EHSA 4Q5TA 2RC9A 1MXVA 2I4CA 4N6PA 4O3CA 3JV9A 4G8MA 3QSLA 2F78A 3T9HB 4P11A 1EH3A 3N6TA 1JETA 4WXJA 2KLFA 4Z0IA 2OCUA 1O63A 1SDXA 2A5SA 5EYFA 5I57B 3DM0A 2ESNA 1T0KA 3OO8A 4R9GA 3SEUA 2ZYNA 1B32A 5H8NA 1N3XA 3R7XA 1B51A 1PB7A 1Z7NE 3FXRA 2G29A 4TLMB 4F2QA 3FXQA 3ILTB 3VE1B 3SEXA 4YKJA 4X9TA 1LAHE 3S2VA 2HEUA 3A3UA 1B3EA 3KSXA 1IXIA 3C35A 3E13X 4FEDA 5I2NB 4U2RA 1US5A 1B9JA 2DE3A 4TLLB 3LR1A 3QAXA 3OELA 3GZGA 1MH3A 2O7IA 1TT1A 3OO7A 4OQOA 4LQ5A 4POWA 3MPLA 4G68B 4JDFA 3TELA 3FJMA 1URDA 2F36A 4YMBA 4F3PA 2QS3A 3OSRA 4F1UA 1NH8A 3QXMA 4PE5B 2YLNA 1IXCA 4ONYA 4JB7A 1PBPA 4N07A 4F18A 4WEDA 3KFMA 3TQLA 4JWYA 5ISUA 3OD7A 4JXIA 5H8QA 1PEBA 3K01A 1PC3A 3SERA 3TDJA 4NF4B 3PD8A 4KHZE 1AIVA 1BTJA 1XHYA 4Q8RA 5I56B 4TOZA 4LA9A 3ECRA 4IGRA 1DOTA 4DXBA 4M4GA 4R2BA 3RN8A 3TAJA 1XOCA 3CR9A 3O6GA 3MZ9A 3FXUA 4IO4A 3UA8A 2QMWA 4QSDA 4EQ7A 4U4XA 4GXAA 1BKAA 4GRKA 2ONSA 3IOTA 3OEMA 3FVOA 1YPNA 3C33A 3K00A 4EF2A 1XC1A 2NVUB 4F29A 2HFBA 1GV8A 1NNPA 2FNCA 3O2AA 1IXHA 2YPNA 1A8FA 4KFQA 4DIGA 1DSNA 2XXUA 3M8UA 3PPRA 3RT6B 4MLQA 2DYXA 4R9FA 4ELOA 4I8CA 1XS5A 1QULA 5AA1A 2REGA 3EHUA 2XXYA 3U8QA 1B6HA 3D4GA 1MQHA 1JW4A 1SW1A 3TYHA 1AMFA 1MDP1 4TQUQ 3RTWB 1O64A 3H6WA 1B4HA 4QFLA 3T22A 1UTHB 3FV1A 2XD3A 4JSOA 2O7UA 4OETA 4QF9A 4LZ7A 5CMCA 4U21A 3GBBA 4P0GA 4YKPA 1JVYA 1ZKBA 4U4SA 3TPAA 3K1NA 3PU5A 2XX9A 1H43A 4R74A 4F1YA 3PPOA 1B5JA 3PPQA 2HAVA 1Y4TA 1NMUA 4IB2A 5DVJA 2Z8DA 4Z7EA 3VV5A 2F7BA 4E0WA 1WODA 3IAZA 1ZIUA 3HPIA 4RXLA 1Y4CA 3KOTA 3I6VA 2DSFA 1YTVA 4ELPA 5FHMA 5HM4B 5ICQA 3RLFE 5CMKA 4JBZA 3H6TA 3Q25A 3MVYA 5I58A 3CI8A 2XXXA 4RK9A 3RPWA 4BDNA 4FATA 3CSGA 2GRVA 3UP9A 1EZPA 1MXWA 1NKXA 4H65A 3BFTA 1P1WA 4GL0A 3A09A 3HSTA 4GOTA 3RTFB 3L6GA 1D4NA 3ZS6A 1LFHA 5DT6A 2DS9A 4IGTA 3FZVA 4YMAA 4PFWA 2LAOA 1NNFA 3DP6A 1H76A 3TTNA 3P7IA
chains in the Genus database with same CATH superfamily
5I59A 4I4LA 4QFNA 1NNTA 3SHGB 2H5YA 2I3VA 4ITQA 1XVXA 4MGKE 1LBYA 4ELRA 5FTKA 1TR8A 2RGHA 4IY5A 2I49A 2I4BA 1LSTA 1YXIA 1OJLA 1QKAA 3IJOB 1N04A 2IA4A 2DAIA 1DMBA 2CV0A 4LJ5A 1D0KA 5TP9B 2Z22A 2V1CA 5AA4A 2QQ8A 1XC8A 2H25A 1NFTA 3MPKA 5B70A 4QOZC 4AB5A 3CF2A 1HSEA 4PBHA 3IOUA 3RY3A 5J16A 3I01M 1MX0A 2DP8A 1ZV1A 2BNKA 3FUZA 1MXXA 1R5LA 3B8BA 3PD9A 5F3WA 1Y20A 1T43A 1I6BA 3JYRA 5FLXS 4LONB 4PAIA 4FORA 2Y7RA 3B7DA 4IO7A 5FSWA 3PUZE 4LRTA 3LSWA 1FBDA 1OLCA 4NSRA 2R45A 5H8HB 3SDFA 1QYRA 4LF7M 1Y1MA 1NUXA 1FTMA 2BJIA 3KC0A 2CHGA 1TWYA 1DK4A 5TU0A 3VFJA 4EDPA 4AI6A 4XXUA 5E6JA 4L78A 1A8EA 2GHAA 4JI8M 3KOZE 1IMCA 4U1OA 1QAOA 5EP1A 2XD2A 1WGNA 3MP1A 4MX6A 3K1PA 1ATGA 3BIHA 1YE9A 5DYHA 1PBQA 1QUJA 3CFXA 3IO4A 4F2LA 1KFVA 1BIYA 1ZBMA 1E94E 4H0WA 4LF4M 3M3KA 4S12A 3TZAA 1QUTA 2WSEF 2R71A 1ZTYA 4P9KA 4DUZM 3RUMA 8CATA 2GFEA 1D2NA 5EP3A 3TCHA 2DWZB 1SI0A 4QRZA 3H03A 1EU8A 4WKMA 4DR4M 3OENA 3U60B 4IO6A 1JEUA 1TDHA 1T3TA 4P1LA 3TCGA 2JY8A 1USYH 3VFDA 3KOSA 4FEBA 4X48A 4ESXA 3N6UA 4GLIA 1GGGA 1W5TA 4I62A 4L16A 3GRYA 2A5TB 5I2NA 1L2BA 2HZKA 4OVZB 3KG2A 2Y20A 4RF0A 1P1NA 3PXGA 3IHPA 4M1VA 2QPAA 3OEKA 4YKIA 3G3IA 3EHTA 1MQIA 2KXEA 4YB5A 4XBOA 4ELQA 2DKLA 3T66A 1J1NA 1LBBA 3GPXA 4BDLA 3GLHE 1LV7A 3C32A 4ZS9A 4G4RA 4KYDA 4F1IA 4NHBA 3SESA 4WP2A 1K3WA 2AL5A 3HHWA 1VG5A 4ZECA 5AA4B 1PB8A 3DP8A 2L2DA 1I6AA 5ITTA 2HL7A 2X4AA 1NNUC 1Q3CA 5EJCA 3FVKA 4KCCA 2L4EA 2CRUA 1AWBA 4R3DA 4NRVA 3PTYA 3MAMA 3J27B 2JXNA 3PMVA 1A99A 3B6WA 3TWMA 1DTZA 3B7ZA 4DR5M 2PT1A 2Y0QA 4PE3A 3PMWA 4PD2A 2E5LM 2DZNB 1IQ7A 2O68A 1IY1A 4DCYA 4LFBM 1ZMVA 4LUBA 1SW5A 4HS7A 1PB9A 4MEVA 2JJKA 5BWJA 4ECFA 5CI5A 1B1HA 3IL1B 1FJ6A 5EHMA 1DGBA 1JR3D 3UN6A 2DVWB 4XKNA 1G4AE 2CEYA 1URGA 2XWOA 3PV0E 4FECA 2F6PA 2PYYA 5GKNA 4OESA 3FGSA 4KI0E 5DFLA 2K6BA 2D3IA 2QS4A 3LCUA 2HKJA 2DE2A 3H4ZA 4BB9A 2I48A 3PUXE 1LAGE 4NF4A 4KYEA 3UZUA 2OK2A 2WSFF 2QP9X 3AKZA 5I56A 2JY6B 3H06B 4XKPA 2XGNA 3MQ9A 1SXJD 2UYFA 2QL3A 1IFYA 1Y3NA 4F3BA 4II7A 3FE3A 2E0SA 1MPDA 5KO3A 3AV0A 1HT1E 5E26A 1OIZA 3Q29A 4G4QA 1J7KA 2XXVA 4XGIA 1QKBA 3EN3A 1IUDA 2Q88A 1VDLA 2ONRA 4KD5A 2CUZA 1MY0A 3TTLA 4DV0M 2Y21A 2PMSA 3I4YA 1OKSA 3L26A 2QSXA 2PT2A 4DE8A 4M9SA 1G0IA 1R2YA 3BFUA 2DAGA 2JZ1A 3HGIA 3TTKA 4AQ4A 3L2AA 2F5SA 3IB0A 4PFIA 2DENA 4NGUA 1OTRA 2HXWA 2RINA 2ALUA 2V84A 3FASA 4PF6A 3DLNA 3K6WA 2Y7IA 2VT5A 3MWBA 5EXSA 2CMOA 2KRUA 4QFPA 1GR2A 2Q2AA 4LY6A 2O01F 1IM2A 5CBSA 1P1QA 4MB7A 1K82A 1AH5A 3A45A 4DV1M 4CJ6A 1GO5A 1FQDA 5ITXA 1WDNA 3HO7A 2CV1A 1FTOA 2JZ0A 2CE7A 2Q74A 5DTBA 3UGWA 4LF9M 1B52A 2C9CA 2O69A 1XNQM 1FCKA 2Q89A 2CWBA 3MC2A 1S9TA 2CHVA 4FD2A 4IBGA 2W7YA 3T96B 5ITQA 5BUUA 4PT5A 3PGFA 2R4EA 4PF8A 5KDTA 4LJ6A 2O6AA 2FA7A 2VP1A 3U1OA 4PQJA 1NH7A 3IB1A 4BDMA 3U72A 2ZTCA 3ZH9B 4I1DA 4UACA 2DXYA 1GKIA 4H8IA 3C36A 4I9DA 4DV2M 1G41A 4IO2A 4HE2A 3OTOM 4R72A 4FCTA 4ESWA 2F8DA 4FIMA 1NV7A 5JI2E 2B3TA 1EYKA 4EQ9A 4Q0CA 2QSFX 3KP1E 2OLBA 3PUYE 3S9LC 3KZGA 2HWJA 2FVZA 1MH4A 2ZAOA 2XXQA 1UTHA 3D8LA 2LHCA 3HZJA 3PPPA 3K1JA 1LBWA 4IBBA 3MBPA 2D7EA 1E32A 1ANFA 1Y9UA 1QDRA 1B0LA 4Q30B 4KCDA 3TEPA 3BIGA 4P1EA 3MVZA 2ZZXA 3K9OA 4DR2M 4IIWA 2HPGA 2QVVA 5F24A 3CF0A 1GLNA 2Z4SA 1P1OA 1FQCA 1R9LA 3ODBA 2DWLA 4F3GA 2ZYMA 2O1MA 4QBAA 3GLIB 2GNOA 2VF7A 1EZ9A 4KPTA 4R71A 4I81A 2VHAA 3VLFB 4HW8A 2QHOB 3DFZA 3DOAA 2B65A 3GLFA 2UXAA 3CF6E 2V93A 1MG1A 4MMPA 1DPEA 2HHMA 3W0LB 1HNZM 1LCFA 4NWDA 3TTMA 1FTJA 2WBBA 2Y5LA 2RKOA 2DAEA 2D21A 4ZPXA 4LJ9A 2XSZD 1TH4A 3E46A 3HJQA 3EQ1A 1YSYA 1DCUA 1JW1A 5IKBA 4B7GA 2DWJA 4ZEIA 4YU0A 1ZU0A 4LGYA 1UQWA 4H6DA 3IG5A 1VSOA 1NSFA 2RCBA 1A7LA 2ZNTA 4GWXA 1RKMA 3PPNA 3UJNA 1ZMWA 4NOOB 2Z7JA 5JI3E 1JQJC 2Q2CA 3THGA 2NWJA 4PGPA 1S7YA 4HE1A 5KDTB 5BPVA 1SVXB 2FHYA 3IOVA 1IIWA 3QIMA 3JR4A 5FTNA 3UK4A 2Y0TA 2F5OA 1XI6A 3J7AS 2P3VA 4JI6M 5AA3A 1XXHA 2F5NA 7CATA 2F5XA 2DWHA 1FPGA 3SMPA 5EYHA 2XFSA 1GVCA 1Q3BA 1DV0A 4O7IA 1GJSA 2MROB 1QJMA 4DI3D 3FUTA 5IZZA 2QNJA 1SXJA 3R8FA 4IY6A 3EHSA 2WSCF 4L15A 2OWZA 1IMBA 4NC6A 1FBGA 3VVFA 2LWXA 1N76A 5DYGA 1OVBA 1VE4A 1WIVA 2JY5A 3KSJA 4EIWA 1USYE 2P5TA 3CHGA 2QS2A 4EQBA 1F4IA 2CZLA 2ZYKA 5ITYA 3CVGA 4NWCA 1QVSA 4NEDA 2JY7A 2F34A 5DEXB 3MP6A 3MZBA 4G77A 1QANA 1MQDA 3R6UA 4LGMA 5ESYA 1IY0A 4GHLA 1LBZA 1NV8A 2BJJX 3U5ZB 4O8MA 1RYOA 1IBKM 1ZMGA 4B3RM 2UYEA 4LJ7A 3O28A 5EXPA 3HCQA 4OFLA 1AIPC 1IXGA 3SFZA 3SKPA 2X49A 3QK6A 1QGXA 4OEUA 3U65A 4GFRA 4QFOA 3FRIA 1MU5A 4GIZA 5TP9A 3Q27A 2THIA 1IMDA 4H5GA 1B3HA 4G68C 3U6QA 1POY1 1QW0A 1N34M 2DXIA 3VK7A 2XHDA 3JR5A 1ELJA 3HHZA 1HR0M 4O7MA 3FTFA 4OFOA 1MY3A 1LFIA 2P1SA 4RNSA 1IXZA 2HCBA 1OIBA 5KCJB 3HX3A 1LAFE 4QOSA 3GO8A 3T1HM 1LB9A 4H45A 5H8HA 2D7GA 1SI1A 1FQFA 4THIA 2VPOA 4GX3A 2Z23A 3HN0A 5C18A 4HCYA 1HSLA 1TXFA 2G3QA 2QVUA 2X26A 3B7QA 5FBPA 1XHBA 1CNQA 5K2YA 4JYAM 4N4UA 4G4PA 4OZ9A 2VQEM 1WR1B 1JEVA 3V5AA 3E4RA 3KBRA 3LQRA 3ZC7B 3USDA 5LOMA 4PTKA 3RT8A 3VKGA 4LZ5A 4K3FA 4MH5A 3GLFE 1I94M 2F7CA 1B40A 1GJTA 2ZMBA 1N77A 4ND9A 4PGNA 1GL7A 4JVDA 4DV4M 1R9QA 3O6HA 2UXCM 3HHFA 3AOEA 2XX7A 1QDTA 4IO5A 1LBVA 3IECA 2D5WA 2O1LA 1IN8A 1R6ZA 3A46A 4PAKA 2XWIA 4KHPM 1KYIA 3IR1A 2VIIA 3U60A 4IBIA 1XVYA 3O29A 4HLQA 3T6PA 2C9OA 1Q9DA 3B6QA 1RDXA 3H7MA 1UTBA 5KZTA 2ZYOA 3FUUA 1KWHA 3H6UA 1JR3E 2A5TA 4JI0M 2B4MA 1D9QA 1B3LA 1I6QA 3QYEA 4LQ2A 4X1BA 5JTYB 1NO1A 2MJ5B 3VDFA 1BK4A 1DGHB 3TFLA 2XZUA 3IJXB 4X64M 1YCJA 3THIA 1MN3A 4PDDA 3LW5F 1XXHE 1GABA 4PP0A 4ZDMA 2M60A 1NV6A 2QMXA 4DCXA 3TKDA 1UIVA 3E79A 4KO8A 1DGFA 4LZ8A 2NUVA 1P99A 3LSXA 4DZ1A 2CZHA 1SXJE 2HCAA 1OLAA 3SYLA 1FJ9A 1LB8A 3TPZA 3O97A 3KC1A 4L6V6 4N6KA 1H3DA 1EZOA 4JI7M 4XEQA 2XSZA 1PGYA 1VDWA 2VPNA 2LVAA 3KOWE 1S50A 3FRHA 4AZFA 3TTRA 1IITA 4QHTA 2ZZWA 1B5HA 1Z5CA 4QNRA 2H4IA 4JI3M 4ZE8A 1DPPA 3KXEC 4NF6A 3SEYA 4HCWA 4OVJA 1EYJA 1WHCA 2VD3A 3RGPA 3PNVA 3L28A 3T1YM 4GBVA 1PJTA 4NTLA 4OWDA 1YUBA 1D9VA 1HSJA 4NMYA 3CRBA 5AA2A 2PFZA 1L8QA 4OVTA 3CFZA 2FH0A 3HY5A 3IO6A 3KOYE 5ELVA 1NJFA 1HQCA 4GD5A 4W5WA 4MLVA 3FJGA 2DWAA 3HU3A 4RKUF 4DV7M 4RPNA 1B3FA 2B3BA 4GBWA 3TUSA 1B5IA 2GQFA 2V25A 5CMMA 2RCAA 2XH9A 1VFDA 3KN3A 4LF5M 2H9BA 3QUJA 1VEKA 2VD2A 2FOIC 1LGBC 4I40A 3G3JA 5L8RF 1MY1A 3QYTA 5LMUM 3NBIA 4DR3M 3JZJA 3N94A 4EF1A 4OEVA 2PX1A 4OVPA 3SAUA 3MP8A 2XXPA 4RK2A 4OANA 1KZ8A 2XXKA 4X8RA 1TFAA 4DXUA 4LN5A 1UTBB 3FIRA 2Z8EA 3ZCBB 1D3KA 3S9NC 5K2XA 4RNAA 1J5EM 3MSTA 2KRKA 1IBMM 1D0MA 4F3SA 1HJPA 2X7QA 4FAJA 3U94A 2I0BA 1SW4A 2Y84A 3CSBA 1POTA 2QS1A 1MXYA 1D9YA 3KVWA 4MM3B 1H45A 1UIUA 4YAHX 3W15C 1G59A 5IZ1A 4XK8F 1SPIA 3K4UA 2V6ZM 1PJJA 3TODA 4OFJA 5HBCA 1N32M 2F6GA 5L8DA 3K2DA 1VR5A 2O84X 4LZJA 4MFIA 5KPTA 4N6DA 2ONKE 4BDOA 2J5YA 3LC8A 5KQDA 3WAFA 2M8CA 1OQHA 4I3EA 1FBHA 1Z6TA 3AOGA 2LVQD 1YLAA 1IEJA 3GPPA 2V3TA 1P1UA 1Z7ME 2ZXTA 4MF3A 3WHLA 2HXRA 4P0IA 3LBSA 1WVJA 2KDLA 1M5BA 2AHMA 1A40A 1VFEA 4DI4B 1MQJA 4NF6B 4GX4A 3G3GA 2ANJA 3EF7A 1ZQ9A 1SQYA 3HV1A 3C3EA 3KW6A 4NRWA 4GL8A 5AA2B 3FV2A 1MJGM 4MGHA 3ZKLA 3LV0A 1T6OA 4PCZA 2UVJA 2CFOA 2C98A 1WXQA 4REZA 2RC7A 5EQ8A 1FBPA 3C34A 2OBGA 3RQTA 3K6VA 4JXJA 1JW5A 4FW9A 1QZEA 3T15A 4OVRA 4F19A 4LATA 4BDRA 3U6CA 3QUFA 4B08A 4WEPA 3FD9A 1OQYA 1QUIA 1N84A 4LP2B 1SXJC 3BOSA 1I69A 2H1RA 4DV3M 3DELB 5HPQA 1FTKA 5DVIA 4GF8A 3KN8A 2V3UA 4N13A 3G3HA 3TQWA 4G4NA 1QUKA 3E21A 1QQWA 4IBFA 2K0BX 3ILKA 1LBCA 1B0HA 3S4UA 3GQ5A 2JA2A 4MGIE 2DWIA 4UABA 2NOOA 3IFAA 1QUSA 4GQOA 3Q28A 1BP5A 2E1SA 4R75A 3GLIA 2K47A 4F1VA 3KJ7A 3L29A 4MGYE 3TCFA 4YY3M 1FSAA 1NUZA 3VK8A 1OMPA 5CRYA 3BKIB 4G4OA 4QFKA 1SW2A 1FBEA 3FBPA 2C96A 3SEWA 4WURA 3T9UA 3OMBA 1FPKA 2UUBM 2F97A 2UU9M 3CIJA 2LVOC 1NNJA 2QPQA 2KNZA 3TWLA 4QSCA 5EQTA 3OOAA 2WEFA 1CUKA 3MJNA 3A98B 4MNIA 2REJA 3OO6A 2XXIA 3V8XB 2OPFA 1EIJA 3ZQJA 4DDDA 2ABHA 2RKMA 4QSEA 3M3FA 3K6XA 4GWUA 3MVXA 1WGLA 3D8BA 2ZTDA 3F11A 5FTLA 2OQ4A 2DVZA 1Y3PA 1JQFA 4O3AA 1B2HA 1QZMA 1SYHA 3K02A 4D82A 3H4JA 4H1XA 2Z8FA 2P2AA 5A5XA 3PVSA 4NAPA 3SYKA 3RYDA 4YKKA 4DR6M 1Y8GA 2F7AA 4ZEFA 1RDYA 3VVDA 4RPOA 5EQ9A 4FVMA 4OU7A 3G3FA 4OERA 4NXNM 4XTCQ 1B7ZA 3BBRA 2WKYA 3RPLA 1JP4A 2BJWA 2ZZVA 5AE4A 4GWSA 3VLUA 4DLDA 4OTEA 3K9PA 3IG8A 1MM6A 2H98A 4C1TA 4ZEBA 1N0TA 1NV4A 1NV2A 3CFLA 2OWTA 3AOEC 3OXNA 3L25A 4H8JA 3I5OA 2AIXA 4F31B 5LMNM 3Q26A 3OO9A 5B7DA 4U22A 1MS7A 2NXOA 2AL4A 2XXRA 3CG1A 4F39A 1Z5BA 3MK6A 5JK4A 4WW0A 3V76A 3FUWA 5DEXA 1NI9A 3QMFA 5H8NB 2HQ0A 4NSOB 4PFBA 3E3KA 4L17A 1MY2A 3TWKA 3U5ZA 2XX8A 2DAKA 5IZ7D 2I58A 3LVWA 3W67A 5EQ7A 1IXSB 1XMOM 4B3MM 1PDAA 4KLNA 4JSDA 3GLGB 1AL3A 4NF5A 1B7UA 2UVHA 1B58A 3KFUG 2I3WA 2QRYA 1TGUA 4IBEA 2RF1A 1FQAA 5FTIA 1Z5AA 2Y7WA 5FTJA 2HHHM 4P8BA 4KT0F 1CB6A 3DA1A 1FW0A 2DZLA 3U6PA 5F7VA 1B4ZA 1NV1A 3RNNA 1FPLA 2VOZA 1SG9A 1NVMA 2ZM6M 1Y1ZA 2RC8A 4OXVA 2KNAA 2O5RA 3A42A 1NHWC 3PUWE 1A54A 4H46A 1OFIA 1JNFA 3MZ1A 2ZNSA 5ET7A 2DQVA 3C58A 4QXDA 5KCJA 4AKIA 2APLA 4UA8A 3HU1A 2R9JA 3B50A 3U61A 1OAOC 2L5VA 4YICA 4P3LA 3LMMA 4OENA 3LSLA 2HZLA 2KA6B 5DYIA 4XIGQ 4ZEDA 3U93A 1LFGA 3T93B 5H37D 2QENA 3GQ4A 4RJZA 3N26A 2XXHA 1NHGC 4PFRA 3I3VA 3OSQA 1ZMUA 3GLIE 4A3VB 4FWDA 1TFDA 5A5XB 1FPBA 4G6ZA 2V3QA 3C31A 1FQBA 1K9YA 3FUXA 5FTMA 5AA2D 4HTGA 4NQ8A 3H6VA 2DVCA 1PJIA 3FD3A 5IM2A 3AXFA 1FPEA 3HKPA 3RPLB 4N17A 2EO2A 3RGYA 1YYZA 1Q35A 2QZ4A 4GWYA 4BDQA 1MRPA 2YR0A 2FYIA 3HFUA 2I0CA 3H3GA 3J7BA 3SAVA 2EA0A 3DP4A 4G8HA 4Q7JA 1EE8A 2F35A 3R9XB 2JWSA 3KN7A 3I04M 5ITXE 2HAKA 1Q1KA 5H8QB 1AOVA 4U23A 4LFCM 3MW0A 2LNHC 2CZKA 2Y7KA 1FQEA 4R6KA 3V89B 1RYXA 1EFUB 3E9XA 1B3GA 4R6HA 4G61A 1US4A 4C0RA 4L4UA 1R1NA 2GQ1A 4CIZA 4MBPA 1N7WA 1NV3A 3S9EA 1LLSA 5EQAA 3UORA 2KEBA 2QJEA 2UUCM 2Y7PA 4GKKM 3B74A 2UVGA 3IORA 3J2PB 5JTYA 5I3SA 1FTAA 3ILUB 1DGHA 1FNNA 1B1XA 4GVOA 2GHBA 3FJ7A 3IB2A 4QHSA 1II5A 1MQGA 5TPAA 3FATA 3VVEA 1DTGA 4NF5B 1IZ1A 4OVQA 3BBZA 1N75A 4MNCA 4XKRA 1CE2A 1BLFA 4KYSA 3WAEA 4KQPA 2XEPA 2O51A 4RYAA 4QNMA 4PFYA 4AS4A 2XZFA 4YB7A 3LUYA 3CG3A 4MNPA 2YJPA 5L9MA 1M5DA 4N91A 2KHHA 1M5EA 3H4MA 3U6LA 3L6HA 3O66A 4B3SM 5BR8M 3K1MA 3KDSE 4R7GA 3C4MA 5I7IA 1G71A 4MH0E 1B05A 2Y5KA 3G7WA 4JWXA 2ERCA 4R2FA 4POXA 5ITPA 3N5LA 2MR9A 3GRVA 4JI1M 3GRRA 2FIXA 2KZUA 4ZEKA 3FYCA 4ZE9A 3ROJA 3U61B 3CTWB 5CBRA 3HJSA 3KS4A 1N36M 1MY4A 3PUVE 4I5SA 1H44A 1KA0A 2R46A 1URSA 3B6TA 5CMBA 3KEIA 1Y3QA 4GWOA 3C9HA 2VDBB 3FUVA 2DXRA 3GBAA 1V92A 2ZAMA 5L9SA 5DNYA 1V33A 1PM5A 2G93A 5CM6A 2MGWA 4R73A 2D7HA 2HAUA 3EPEA 1IBLM 2WX9A 3U92A 2KR0A 4UN2B 1XWIA 1M5CA 2PCRA 3ZKKA 1B46A 1NV9A 1MPCA 5M2VA 2LTUA 2VGQA 3A29A 1N3WA 1G0HA 3R26A 1BVSA 3W9VA 4E0XA 1INPA 3PFIA 1UFZA 3O9PA 4H5FA 4PDGA 5LTCA 2UUAM 1J09A 1L1ZA 4DBGB 2XFTA 1XT8A 2B3FA 4F22A 1SYIA 1FTLA 3M0EA 2CP8A 4AS5A 3GLHA 2ZBKB 4R6YA 2WYKA 4GH9A 4PETA 5ET5A 1QAQA 3FYDA 4AB6A 5H8FA 1P3QQ 5I84A 3MHVC 3FVNA 2K9DA 1MPBA 4ISUA 4FJPA 4H67A 3KGCA 2DE4A 1R6BX 5I2KA 2V4CA 1LCTA 4M9ZA 5IAIA 1O7TA 1OVTA 3HHGA 3V83A 1TH2A 2UXBM 3T9XB 1OQGA 3WHKA 4X62M 5TPAB 1HQYE 3K0VA 4XFEA 3SASA 3GXAA 4RA1A 4N8GA 3D4CA 3HWSA 4FE8A 1LBXA 5IT9S 3SATA 3FTCA 2L6OA 1B7HA 1NL5A 5C1BA 4O3BA 3E9SA 4RF1A 3KJTA 3SAWA 3U6MA 4GMQA 3NBXX 2R65A 4OVSA 2J7NA 5EP4A 3JAMS 3QAUA 1YAEA 4NG7A 5ICTA 2QBYB 2R44A 1ZJLA 3IOWA 2DOJA 3W9WA 3RGSA 2UVIA 5KQ8A 2W82A 5F1QA 3TMGA 3SETA 4RY1A 1IY2A 5H8SA 2R18A 1L5TA 4YB6A 3GPUA 2FS1A 4I8OA 4OMBA 3LSFB 4YZZA 3ISPA 4NF8A 3TQSA 4LRSA 5CC2A 1ZLQA 4IBKA 1A55A 3IK6B 2Q2EB 4DXCA 4ZZAA 4EUOA 1VEJA 2YFQA 1XNRM 3GLBA 4BLAA 4DR1M 3VLVA 5L9OA 1GTKA 3AL0C 3VLWA 1SBPA 4OA4A 5KPZA 3VXBA 1JVXA 3K6UA 2JP7A 4PDIA 4PFUA 5I58B 2XXTA 2XLJA 4XKQA 2DWNA 2BWBA 4AKHA 4G8NA 3M3LA 4EXKA 3NWLA 3FXBA 3GQ3A 2C99A 3F92A 2VF8A 3TL4X 4NL4H 3U6DA 4GXSB 2M5ZA 3UMMA 4OW0A 4N15A 1TF0B 2P0SA 4C1UA 4X65M 3UGJA 3GP1A 1EYIA 3G3KA 5I57A 2V1UA 4DV5M 1H6UA 2I6EA 4YHHM 3S9MC 5ET6A 4FWGA 3ONMA 3GLHB 4D81A 5I5PA 3UIFA 1MXZA 2Z8YM 5H8FB 2L4FA 2FE8A 2Q9TA 4F2OA 1LAXA 2DAMA 5JEIA 2L7IA 4IR8A 2Q8JA 3U6EA 2LH0A 1NNKA 3IX1A 5FHOA 3T9VA 4GHAA 3PMXA 3B89A 5I2KB 1IN7A 2N35A 3W0FA 1N7XA 1QAMA 4X1DA 2LVPC 4EXLA 3AFHA 4QHQA 2OJTA 4NX1A 4LF8M 2EUCA 2LHGA 5IWAM 1M5FA 1MXUA 4B7FA 3O6IA 4IO3A 4ZZEA 3M6AA 3ZSFA 3VXCA 5FTHA 4JI5M 1XMQM 4D80A 5ITOA 2CHQA 1MM7A 5I59B 3MMPA 1F9BA 2YNMD 2CV2A 4AG6A 3SEVA 2JUJA 4LJ8A 4O94A 2AYSA 2WBDA 1SD3A 2OWSA 4OYVA 1KSFX 4LVQA 2FNAA 2XXWA 5FHNA 2R6GE 4G68A 1LEVA 3IFCA 5J1DA 3VDUA 3MUQA 3FTEA 3MYUA 4L8RC 3HU2A 2IEEA 1NV5A 2OZZA 4NE4A 4JVCA 1R7RA 4U1ZA 3A3CA 5DVFA 2PVUA 2QVRA 4KXPA 4DV6M 2GH9A 4G2ZA 4OHNA 4PFTA 4M9XA 2ZNUA 4JWOA 5IGAA 3MVWA 4NF8B 3FVGA 1MDQA 2X7PA 3Q8GA 5LDZA 4GWWA 3L27A 1NJGA 2H99A 4KR5A 2XF3A 2PBWA 2FFJA 3W68A 5EHSA 5A2QS 4Q5TA 4FBPA 2RC9A 1MXVA 2I4CA 4N6PA 4O3CA 1DBZA 3JV9A 4G8MA 2OOBA 3QSLA 2F78A 3T9HB 4P11A 1GVNA 3SBJA 1EH3A 1JETA 3N6TA 4WXJA 1HT2E 2KLFA 4Z0IA 2KW0A 1L2DA 2OCUA 2XWKA 3HHYA 1O63A 1DO2A 3U6SA 4GKJM 1SDXA 3EKIA 1R2ZA 2A5SA 5EYFA 2P3NA 5I57B 4GX6A 3DM0A 2ESNA 1T0KA 3OO8A 2JNHA 5DW8A 1FPIA 4JI2M 4R9GA 4MJOA 3SEUA 2ZYNA 1ZAEA 3KOXE 2F5PA 1B32A 4JVIA 5H8NA 4PAFA 4MCOA 1N3XA 3R7XA 1B51A 3AJIB 1NUYA 1DGGA 1PB7A 1Z7NE 4HXVA 1N78A 3FXRA 4OX9M 1NV0A 2G29A 2PFYA 2MH8A 4TLMB 4F2QA 1IXSA 3FKEA 3FXQA 3ILTB 3VE1B 3B9PA 4DUYM 2F3BA 3SEXA 4LG2A 4IBJA 3GLGA 2G5GX 4YKJA 4X9TA 1LAHE 3S2VA 2QCUA 1FBCA 2HEUA 3A3UA 1W5SA 1B3EA 1IMEA 3KSXA 1IXIA 1NY6A 4GIPA 3C35A 3E13X 2RGOA 4FEDA 5I2NB 3J81S 4U2RA 4MIJA 4LFAM 3SHFA 1US5A 1NY5A 5A5LA 2KQZA 2R6FA 1B9JA 2DE3A 4XF5A 2FIEA 3GYYA 3CGWA 4BLCA 4TLLB 2FBPA 3HHXA 3LR1A 3QAXA 1IN6A 3OELA 5KPRA 3GZGA 2A5YB 3SARA 2BJVA 1FJGM 1MH3A 2LBCA 2O7IA 4K0KM 1E9RA 1TT1A 3OO7A 4OQOA 2R0IA 1FPFA 4LJ4A 4KODA 4LQ5A 4POWA 3MPLA 4G68B 4JDFA 2Q8MA 2I7PA 3TELA 3FJMA 1IN4A 3MJ5A 4CGYB 1URDA 2F36A 1TTEA 1V34A 4YMBA 4AKGA 4F3PA 4JV5M 2QS3A 3OSRA 4Y28F 1NH8A 4F1UA 2CEXA 3QXMA 4PE5B 4MGZE 4Z8XA 2YLNA 1KA1A 2DI0A 1IXCA 4ONYA 2WZJA 3QWLA 1D0LA 1OFHA 4JB7A 1PBPA 4GWZA 4N07A 4F18A 1FBFA 4WEDA 3KP0E 4AW4A 3KFMA 3TQLA 3T0JA 1PJQA 4JWYA 2OX3A 5ISUA 3OD7A 4JXIA 5H8QA 1IMFA 4FCWA 1PEBA 3T38A 3K01A 1PC3A 4CISA 3SERA 1VQ1A 3TDJA 4NF4B 3PD8A 4KHZE 4NF0A 2Z4RA 1AIVA 5T3JA 2NQ8C 3KS8A 1AUAA 1BTJA 1XHYA 3I51A 4Q8RA 4X66M 4MAGA 4LCBA 5I56B 2DDKA 4M0WA 4LA9A 3ECRA 4TOZA 4IGRA 1DOTA 3B7NA 4DXBA 4M4GA 4JN6A 4R2BA 3RN8A 3TAJA 1XOCA 1TH3A 3CR9A 1TDZA 2CEAA 1PJSA 2KZSA 1G3IA 3K8ZA 3O6GA 1A5TA 4NN3A 3MZ9A 3EIEA 3FXUA 4IO4A 2XWVA 4AQYM 2DHYA 3LVVA 3UA8A 2QMWA 4HL4A 4QSDA 3LCVB 3SZPA 1RDZA 4Z6YA 4EQ7A 4U4XA 4GXAA 1Q02A 1BKAA 4GRKA 4IBCA 2KNVA 1Z59A 2Z3XA 2ONSA 3IOTA 3OEMA 3GRUA 5ET8A 1R4GA 2MKZA 3FVOA 1YPNA 3C33A 4ANRA 3TE6A 3K00A 3Q8XA 4HE0A 3C9PA 3GPYA 1XC1A 4EF2A 3UK6A 2NVUB 4F29A 1IN5A 2HFBA 1GV8A 1NNPA 1DO0A 3E78A 2L09A 2FNCA 3O2AA 4HEOA 2VQFM 1IXHA 2YPNA 3SMSA 1A8FA 2DNAA 4MHFA 4KFQA 4DIGA 1DSNA 2XXUA 3M8UA 1G8PA 3GLGE 3RE8A 4JI4M 3PNYA 1FPJA 3PPRA 1YZ0A 2J7OA 3RT6B 4P47A 4MLQA 5IZ3A 3EIHA 2B4LA 2OO9A 4DR7M 2DYXA 4R9FA 2O25A 4ELOA 1JR3A 3HJ8A 4B7HA 4I8CA 1XS5A 1QULA 2DWMA 2G8LA 5AA1A 2REGA 2YQZA 3EHUA 4FCVA 1S3SA 2XXYA 3U8QA 1B6HA 1L1TA 2BWEA 1HNWM 4GITA 3VKHA 3D4GA 1MQHA 1JW4A 1SW1A 4CHTB 3TYHA 3M7GA 1AMFA 4LF6M 2LXEA 1MDP1 2F5QA 3SC3A 3QYBA 5IREB 2H5XA 4FWHA 1N33M 4TQUQ 3RTWB 1K9ZA 4LJAA 1O64A 3LQQA 5EXTA 5ITUA 2CZIA 3H6WA 1B4HA 2C5RA 4QFLA 4IBDA 4X04A 3T22A 1UTHB 1VDDA 3FV1A 4P56A 1HNXM 4AG5A 4BBAA 2XD3A 4JSOA 2O7UA 4OETA 3VDPA 4QF9A 3J80S 4LZ7A 5CMCA 4U21A 3GBBA 1VEGA 4P0GA 4YKPA 4PBQA 4PDHA 4P16A 1JVYA 1ZKBA 4U4SA 4NXMM 1LTMA 3TPAA 1PRBA 5EP2A 4GEWA 2QFLA 2XX9A 3K1NA 3PU5A 1UM8A 1H43A 4PC9A 3I4VA 4GC9A 4M0DA 2R62A 4R74A 1FPDA 4F1YA 3PPOA 1E9SA 1Q39A 1B5JA 2QBYA 3PPQA 3KBZA 5EXXA 2HAVA 1L2CA 1Y4TA 1NMUA 4IB2A 5DVJA 1JB0F 3RFWA 2Z8DA 2F4VM 4Z7EA 1K3XA 3GLFB 3VV5A 2EKFA 2F7BA 4E0WA 3K2LA 2R8TA 1WODA 3IAZA 1ZIUA 3HPIA 2RRUA 3C3DA 4RXLA 3DZDA 1Y4CA 2OOAA 2WYPA 3KOTA 3I6VA 3BXWA 2DSFA 1YTVA 1FRPA 3FTDA 4ELPA 5FHMA 5HM4B 5EYGA 5IZ3B 5ICQA 4B3TM 2XA5A 4N81A 3RLFE 5CMKA 4JBZA 2EJSA 3H6TA 3Q25A 1OAIA 2UXDM 3MVYA 5I58A 2LVNC 3CI8A 4LZZA 3NOHA 2R4JA 2XXXA 4RK9A 1GL6A 3RPWA 1WJ7A 1QVRA 4TUWA 2EKKA 1I4WA 4G3OA 4BDNA 4FATA 1IMAA 1RU3A 1C7YA 2GRVA 3CSGA 4I3YA 3UP9A 1XXHB 1EZPA 1XB2B 4P17A 3K92A 1C1KA 2DZOB 1MXWA 1NKXA 4H65A 3D1RA 4N8YA 2L7HA 1X37A 1NUWA 3BFTA 4PCDA 1P1WA 2ZANA 4GL0A 3T1BA 1IXRC 1SXJB 3A09A 3HSTA 4GOTA 2F3DA 3RTFB 1IQPA 5ITRA 3L6GA 1D4NA 3ZS6A 1LFHA 2I7NA 4IJFA 1ORYB 5DT6A 1OIPA 4GRIA 2DS9A 4IGTA 3FZVA 4YMAA 4PFWA 4IJEA 2LAOA 3U6OA 4GC5A 1NNFA 3DP6A 1H76A 4OVZA 3TTNA 3LUZA 2DHRA 3P7IA 2X8AA
chains in the Genus database with same CATH topology
5I59A 4I4LA 4QFNA 1NNTA 3SHGB 2H5YA 2I3VA 4ITQA 1XVXA 4MGKE 4ELRA 5FTKA 2RGHA 4IY5A 2I49A 2I4BA 1LSTA 1OJLA 1QKAA 3IJOB 1N04A 2IA4A 1DMBA 2CV0A 4LJ5A 5TP9B 2Z22A 2V1CA 5AA4A 1XC8A 2H25A 1NFTA 3MPKA 5B70A 4QOZC 4AB5A 3CF2A 1HSEA 3RY3A 3IOUA 1MX0A 2DP8A 2BNKA 3FUZA 1MXXA 3PD9A 5F3WA 1Y20A 3JYRA 1I6BA 4LONB 5FLXS 4FORA 2Y7RA 3B7DA 4IO7A 5FSWA 3PUZE 4LRTA 3LSWA 1OLCA 4NSRA 2R45A 5H8HB 3SDFA 1QYRA 4LF7M 1Y1MA 1FTMA 2CHGA 1TWYA 5TU0A 3VFJA 4EDPA 4AI6A 4XXUA 5E6JA 4L78A 1A8EA 2GHAA 4JI8M 3KOZE 4U1OA 1QAOA 5EP1A 2XD2A 3MP1A 3K1PA 1ATGA 5DYHA 1YE9A 1PBQA 1QUJA 3CFXA 3IO4A 1KFVA 1BIYA 1ZBMA 1E94E 4H0WA 4LF4M 3M3KA 4S12A 3TZAA 2R71A 1ZTYA 4DUZM 3RUMA 8CATA 2GFEA 1D2NA 5EP3A 3TCHA 2DWZB 1SI0A 4QRZA 3H03A 1EU8A 4WKMA 4DR4M 3OENA 3U60B 4IO6A 1JEUA 1TDHA 1T3TA 3TCGA 1USYH 3VFDA 3KOSA 4FEBA 4X48A 4ESXA 3N6UA 4GLIA 1GGGA 1W5TA 4I62A 4L16A 3GRYA 2A5TB 5I2NA 1L2BA 2HZKA 4OVZB 3KG2A 2Y20A 4RF0A 1P1NA 3PXGA 4M1VA 2QPAA 3OEKA 4YKIA 3G3IA 3EHTA 1MQIA 2KXEA 4YB5A 4XBOA 4ELQA 3T66A 1J1NA 1LBBA 3GPXA 4BDLA 1LV7A 3C32A 4ZS9A 4G4RA 4KYDA 3SESA 1K3WA 2AL5A 3HHWA 4ZECA 5AA4B 1PB8A 3DP8A 1I6AA 5ITTA 2HL7A 2X4AA 1NNUC 1Q3CA 5EJCA 3FVKA 4KCCA 4R3DA 4NRVA 3MAMA 3J27B 3PMVA 1A99A 3B6WA 3TWMA 1DTZA 4DR5M 2PT1A 2Y0QA 3PMWA 4PD2A 2E5LM 2DZNB 1IQ7A 2O68A 1IY1A 4DCYA 4LFBM 4LUBA 1SW5A 4HS7A 1PB9A 5BWJA 4ECFA 5CI5A 1B1HA 3IL1B 5EHMA 1DGBA 1JR3D 3UN6A 2DVWB 4XKNA 1G4AE 1URGA 3PV0E 4FECA 2F6PA 2PYYA 5GKNA 4OESA 3FGSA 4KI0E 2D3IA 2QS4A 2HKJA 2DE2A 3H4ZA 4BB9A 2I48A 3PUXE 1LAGE 4NF4A 4KYEA 3UZUA 2OK2A 2QP9X 3AKZA 5I56A 3H06B 4XKPA 2XGNA 3MQ9A 1SXJD 2UYFA 2QL3A 1Y3NA 4F3BA 4II7A 2E0SA 1MPDA 5KO3A 3AV0A 1HT1E 5E26A 3Q29A 4G4QA 1J7KA 2XXVA 4XGIA 1QKBA 3EN3A 1IUDA 2Q88A 2ONRA 4KD5A 2CUZA 1MY0A 3TTLA 4DV0M 2Y21A 2PMSA 3I4YA 3L26A 2QSXA 2PT2A 4DE8A 4M9SA 1R2YA 3BFUA 3HGIA 3TTKA 4AQ4A 3L2AA 2F5SA 3IB0A 2HXWA 2RINA 2ALUA 2V84A 3FASA 3DLNA 3K6WA 2Y7IA 3MWBA 5EXSA 2CMOA 2KRUA 4QFPA 1GR2A 2Q2AA 4LY6A 1IM2A 5CBSA 1P1QA 4MB7A 1K82A 1AH5A 3A45A 4DV1M 1FQDA 5ITXA 1WDNA 3HO7A 2CV1A 1FTOA 2CE7A 5DTBA 3UGWA 4LF9M 1B52A 2C9CA 2O69A 1XNQM 1FCKA 2Q89A 3MC2A 1S9TA 2CHVA 4FD2A 4IBGA 2W7YA 3T96B 5ITQA 5BUUA 4PT5A 3PGFA 2R4EA 5KDTA 4LJ6A 2VP1A 2O6AA 2FA7A 3U1OA 4PQJA 1NH7A 3IB1A 4BDMA 3U72A 3ZH9B 4I1DA 4UACA 2DXYA 1GKIA 4H8IA 3C36A 4I9DA 4DV2M 1G41A 4IO2A 3OTOM 4R72A 4FCTA 4ESWA 2F8DA 4FIMA 5JI2E 4EQ9A 4Q0CA 3PUYE 3KP1E 2OLBA 3S9LC 3KZGA 1MH4A 2ZAOA 2XXQA 1UTHA 3D8LA 3PPPA 3K1JA 4IBBA 3MBPA 2D7EA 1E32A 1ANFA 1Y9UA 1B0LA 4Q30B 4KCDA 3TEPA 3MVZA 4DR2M 4IIWA 3CF0A 1GLNA 2Z4SA 1P1OA 1FQCA 1R9LA 3ODBA 2DWLA 4F3GA 2ZYMA 2O1MA 3GLIB 1EZ9A 4KPTA 4I81A 2VHAA 3VLFB 4HW8A 3DFZA 3DOAA 2B65A 3GLFA 2UXAA 3CF6E 2V93A 1MG1A 1DPEA 3W0LB 1HNZM 1LCFA 4NWDA 3TTMA 1FTJA 2RKOA 2D21A 4ZPXA 4LJ9A 2XSZD 1TH4A 3HJQA 3EQ1A 1YSYA 1JW1A 5IKBA 4B7GA 2DWJA 4ZEIA 4YU0A 1ZU0A 4LGYA 1UQWA 4H6DA 3IG5A 1VSOA 1NSFA 2RCBA 1A7LA 2ZNTA 1RKMA 3PPNA 3UJNA 4NOOB 2Z7JA 5JI3E 1JQJC 2Q2CA 3THGA 2NWJA 1S7YA 5KDTB 5BPVA 1SVXB 3IOVA 1IIWA 3QIMA 3JR4A 5FTNA 3UK4A 2Y0TA 2F5OA 3J7AS 4JI6M 5AA3A 1XXHA 2F5NA 7CATA 2F5XA 2DWHA 3SMPA 2XFSA 1GVCA 1Q3BA 1QJMA 3FUTA 1SXJA 3R8FA 4IY6A 3EHSA 4L15A 3VVFA 2LWXA 1N76A 5DYGA 1OVBA 1VE4A 3KSJA 4EIWA 1USYE 2P5TA 2QS2A 4EQBA 2CZLA 2ZYKA 5ITYA 3CVGA 4NWCA 1QVSA 4NEDA 2F34A 5DEXB 3MP6A 3MZBA 4G77A 1QANA 1MQDA 3R6UA 4LGMA 1IY0A 4GHLA 2BJJX 3U5ZB 1RYOA 1IBKM 1ZMGA 4B3RM 2UYEA 4LJ7A 3O28A 5EXPA 3HCQA 4OFLA 1IXGA 3SKPA 3SFZA 2X49A 3QK6A 4OEUA 4GFRA 4QFOA 1MU5A 4GIZA 5TP9A 3Q27A 2THIA 4H5GA 1B3HA 4G68C 3U6QA 1POY1 1QW0A 1N34M 2DXIA 3VK7A 2XHDA 3JR5A 1ELJA 3HHZA 1HR0M 3FTFA 4OFOA 1MY3A 1LFIA 2P1SA 4RNSA 1IXZA 2HCBA 1OIBA 5KCJB 1LAFE 4QOSA 3GO8A 3T1HM 1LB9A 5H8HA 2D7GA 1SI1A 1FQFA 4THIA 2Z23A 3HN0A 5C18A 4HCYA 1HSLA 1TXFA 2X26A 1XHBA 5K2YA 4JYAM 4G4PA 4OZ9A 2VQEM 1JEVA 3V5AA 3E4RA 3KBRA 3LQRA 3ZC7B 3USDA 5LOMA 3RT8A 3VKGA 4LZ5A 4K3FA 4MH5A 1I94M 2F7CA 1B40A 2ZMBA 1N77A 4ND9A 1GL7A 4DV4M 1R9QA 3O6HA 2UXCM 3HHFA 3AOEA 2XX7A 4IO5A 2D5WA 2O1LA 1IN8A 1R6ZA 3A46A 4KHPM 1KYIA 3IR1A 2VIIA 3U60A 4IBIA 1XVYA 3O29A 4HLQA 2C9OA 3B6QA 3H7MA 1UTBA 5KZTA 2ZYOA 3FUUA 1KWHA 3H6UA 2A5TA 4JI0M 1B3LA 1I6QA 4LQ2A 4X1BA 5JTYB 3VDFA 1DGHB 3TFLA 2XZUA 3IJXB 4X64M 1YCJA 3THIA 4PP0A 4ZDMA 2M60A 2QMXA 4DCXA 3TKDA 1UIVA 4KO8A 1DGFA 4LZ8A 2NUVA 1P99A 3LSXA 4DZ1A 1SXJE 2HCAA 1OLAA 3SYLA 1LB8A 3TPZA 3O97A 1H3DA 1EZOA 4JI7M 2XSZA 3KOWE 1S50A 4AZFA 3TTRA 1IITA 4QHTA 1B5HA 1Z5CA 4QNRA 2H4IA 4JI3M 4ZE8A 1DPPA 3KXEC 4NF6A 3SEYA 4HCWA 4OVJA 2VD3A 3RGPA 3PNVA 3L28A 3T1YM 4NTLA 4OWDA 1YUBA 1D9VA 1HSJA 4NMYA 3CRBA 5AA2A 1L8QA 3CFZA 3IO6A 3KOYE 5ELVA 1NJFA 1HQCA 4GD5A 4W5WA 4MLVA 3FJGA 2DWAA 3HU3A 4DV7M 4RPNA 1B3FA 2B3BA 3TUSA 1B5IA 2V25A 5CMMA 2RCAA 2XH9A 1VFDA 3KN3A 4LF5M 2H9BA 3QUJA 2VD2A 2FOIC 1LGBC 3G3JA 1MY1A 3QYTA 5LMUM 3NBIA 4DR3M 3JZJA 3N94A 4EF1A 4OEVA 2PX1A 3SAUA 3MP8A 2XXPA 4RK2A 1TFAA 4DXUA 1UTBB 3FIRA 2Z8EA 3ZCBB 1D3KA 3S9NC 5K2XA 4RNAA 1J5EM 2KRKA 1IBMM 4F3SA 2X7QA 4FAJA 3U94A 2I0BA 1SW4A 2Y84A 3CSBA 1POTA 2QS1A 1MXYA 1D9YA 3KVWA 4MM3B 1H45A 1UIUA 4YAHX 3W15C 1G59A 3K4UA 2V6ZM 1PJJA 3TODA 4OFJA 5HBCA 1N32M 2F6GA 5L8DA 3K2DA 1VR5A 2O84X 4LZJA 4MFIA 5KPTA 2ONKE 4BDOA 3LC8A 5KQDA 3WAFA 2M8CA 1OQHA 1Z6TA 3AOGA 1IEJA 3GPPA 2V3TA 1P1UA 1Z7ME 2ZXTA 4MF3A 3WHLA 4P0IA 3LBSA 1WVJA 1M5BA 2AHMA 1A40A 1VFEA 1MQJA 4NF6B 3G3GA 2ANJA 3EF7A 1ZQ9A 1SQYA 3HV1A 3KW6A 4NRWA 4GL8A 5AA2B 3FV2A 4MGHA 3ZKLA 4PCZA 2UVJA 2CFOA 2C98A 1WXQA 4REZA 2RC7A 3C34A 2OBGA 3RQTA 3K6VA 4JXJA 1JW5A 4FW9A 3T15A 4F19A 4LATA 4BDRA 3U6CA 3QUFA 4B08A 4WEPA 3FD9A 1QUIA 1N84A 4LP2B 1SXJC 3BOSA 1I69A 2H1RA 4DV3M 3DELB 5HPQA 1FTKA 5DVIA 4GF8A 3KN8A 2V3UA 4N13A 3G3HA 3TQWA 4G4NA 1QUKA 1QQWA 4IBFA 3ILKA 1LBCA 1B0HA 3S4UA 3GQ5A 2JA2A 4MGIE 2DWIA 2NOOA 4GQOA 3Q28A 1BP5A 2E1SA 4R75A 3GLIA 2K47A 4F1VA 3KJ7A 3L29A 4MGYE 3TCFA 4YY3M 3VK8A 1OMPA 5CRYA 3BKIB 4G4OA 4QFKA 1SW2A 2C96A 3SEWA 4WURA 3T9UA 3OMBA 2UUBM 2F97A 2UU9M 3CIJA 1NNJA 2QPQA 3TWLA 4QSCA 5EQTA 3OOAA 3MJNA 3A98B 2REJA 3OO6A 2XXIA 3V8XB 2OPFA 4DDDA 2ABHA 2RKMA 4QSEA 3M3FA 3K6XA 3MVXA 3D8BA 3F11A 5FTLA 2OQ4A 2DVZA 1Y3PA 1JQFA 4O3AA 1B2HA 1QZMA 1SYHA 3K02A 4D82A 4H1XA 2Z8FA 2P2AA 5A5XA 3PVSA 3SYKA 4YKKA 4DR6M 2F7AA 4ZEFA 3VVDA 4RPOA 4FVMA 4OU7A 3G3FA 4OERA 4NXNM 4XTCQ 1B7ZA 3BBRA 2WKYA 2BJWA 5AE4A 3VLUA 4DLDA 4OTEA 3IG8A 1MM6A 2H98A 4C1TA 4ZEBA 1N0TA 3CFLA 2OWTA 3AOEC 3OXNA 3L25A 4H8JA 3I5OA 2AIXA 4F31B 5LMNM 3Q26A 3OO9A 5B7DA 4U22A 1MS7A 2NXOA 2AL4A 2XXRA 3CG1A 4F39A 1Z5BA 3MK6A 5JK4A 4WW0A 3FUWA 5DEXA 5H8NB 2HQ0A 4NSOB 3E3KA 4L17A 1MY2A 3TWKA 3U5ZA 2XX8A 5IZ7D 2I58A 3LVWA 1IXSB 1XMOM 4B3MM 1PDAA 4KLNA 4JSDA 3GLGB 1AL3A 4NF5A 1B7UA 2UVHA 1B58A 3KFUG 2I3WA 2QRYA 1TGUA 4IBEA 2RF1A 1FQAA 5FTIA 1Z5AA 2Y7WA 5FTJA 2HHHM 1CB6A 3DA1A 1FW0A 3U6PA 5F7VA 1B4ZA 3RNNA 2VOZA 1NVMA 2ZM6M 1Y1ZA 2RC8A 4OXVA 2O5RA 3A42A 1NHWC 3PUWE 1A54A 1OFIA 1JNFA 3MZ1A 2ZNSA 2DQVA 3C58A 5KCJA 4AKIA 4UA8A 3HU1A 2R9JA 3U61A 4YICA 3LMMA 4OENA 3LSLA 2HZLA 2KA6B 5DYIA 4XIGQ 4ZEDA 3U93A 1LFGA 3T93B 5H37D 2QENA 3GQ4A 4RJZA 3N26A 2XXHA 1NHGC 3I3VA 3OSQA 4A3VB 4FWDA 1TFDA 5A5XB 4G6ZA 2V3QA 3C31A 1FQBA 3FUXA 5FTMA 5AA2D 4HTGA 3H6VA 2DVCA 1PJIA 3FD3A 3AXFA 3HKPA 2EO2A 3RGYA 1Q35A 2QZ4A 4BDQA 1MRPA 2YR0A 2FYIA 2I0CA 3H3GA 3J7BA 3SAVA 2EA0A 3DP4A 4G8HA 2F35A 1EE8A 3R9XB 3KN7A 5ITXE 5H8QB 1Q1KA 1AOVA 4U23A 4LFCM 3MW0A 2LNHC 2Y7KA 1FQEA 4R6KA 3V89B 1RYXA 3E9XA 1B3GA 4R6HA 1US4A 4C0RA 4L4UA 1R1NA 4MBPA 1N7WA 3S9EA 1LLSA 3UORA 2KEBA 2QJEA 2UUCM 2Y7PA 4GKKM 2UVGA 3IORA 3J2PB 5JTYA 3ILUB 1DGHA 1FNNA 1B1XA 4GVOA 2GHBA 3FJ7A 3IB2A 4QHSA 1II5A 1MQGA 5TPAA 3FATA 3VVEA 1DTGA 4NF5B 1IZ1A 1N75A 4XKRA 1CE2A 1BLFA 4KYSA 3WAEA 4KQPA 2XEPA 2O51A 4RYAA 4QNMA 4PFYA 2XZFA 4YB7A 3LUYA 3CG3A 2YJPA 5L9MA 1M5DA 1M5EA 3H4MA 3U6LA 3L6HA 3O66A 4B3SM 5BR8M 3K1MA 3KDSE 4R7GA 3C4MA 4MH0E 1B05A 3G7WA 4JWXA 2ERCA 4R2FA 4POXA 5ITPA 3N5LA 3GRVA 4JI1M 3GRRA 4ZEKA 2KZUA 3FYCA 4ZE9A 3U61B 3CTWB 5CBRA 3HJSA 3KS4A 1N36M 1MY4A 3PUVE 4I5SA 1H44A 2R46A 1URSA 3B6TA 5CMBA 3KEIA 1Y3QA 4GWOA 3C9HA 3FUVA 2DXRA 3GBAA 2ZAMA 5L9SA 5DNYA 1PM5A 2G93A 5CM6A 4R73A 2D7HA 2HAUA 3EPEA 1IBLM 3U92A 1XWIA 1M5CA 3ZKKA 1B46A 5M2VA 1MPCA 2VGQA 1N3WA 3R26A 3W9VA 4E0XA 3PFIA 3O9PA 4H5FA 4PDGA 2UUAM 1J09A 1L1ZA 2XFTA 1XT8A 2B3FA 4F22A 1SYIA 1FTLA 3M0EA 3GLHA 2ZBKB 4R6YA 4GH9A 4PETA 1QAQA 3FYDA 4AB6A 5H8FA 5I84A 3MHVC 3FVNA 1MPBA 4ISUA 4FJPA 4H67A 3KGCA 2DE4A 1R6BX 5I2KA 1LCTA 4M9ZA 5IAIA 1O7TA 1OVTA 3HHGA 3V83A 1TH2A 2UXBM 3T9XB 1OQGA 3WHKA 4X62M 5TPAB 1HQYE 3K0VA 3SASA 3GXAA 4RA1A 3D4CA 3HWSA 4FE8A 5IT9S 3SATA 3FTCA 2L6OA 1B7HA 1NL5A 5C1BA 4O3BA 3E9SA 4RF1A 3KJTA 3SAWA 3U6MA 4GMQA 2R65A 2J7NA 5EP4A 3JAMS 3QAUA 1YAEA 5ICTA 2QBYB 1ZJLA 3IOWA 2DOJA 3W9WA 3RGSA 2UVIA 5KQ8A 2W82A 5F1QA 3TMGA 3SETA 4RY1A 1IY2A 5H8SA 2R18A 1L5TA 4YB6A 3GPUA 4I8OA 4OMBA 3LSFB 4YZZA 4NF8A 3TQSA 4LRSA 5CC2A 1ZLQA 4IBKA 1A55A 3IK6B 2Q2EB 4DXCA 4ZZAA 4EUOA 1XNRM 2YFQA 3GLBA 4BLAA 4DR1M 3VLVA 5L9OA 1GTKA 3AL0C 3VLWA 1SBPA 5KPZA 3VXBA 1JVXA 3K6UA 4PDIA 4PFUA 5I58B 2XXTA 2XLJA 4XKQA 2DWNA 4AKHA 4G8NA 3M3LA 4EXKA 3NWLA 3GQ3A 2C99A 3TL4X 4NL4H 3U6DA 4GXSB 2M5ZA 3UMMA 4OW0A 2P0SA 4C1UA 4X65M 3UGJA 3GP1A 3G3KA 5I57A 2V1UA 4DV5M 1H6UA 2I6EA 4YHHM 3S9MC 4FWGA 3ONMA 3GLHB 4D81A 3UIFA 1MXZA 5H8FB 2FE8A 2Q9TA 4F2OA 1LAXA 5JEIA 2L7IA 2Q8JA 3U6EA 2LH0A 1NNKA 3IX1A 5FHOA 3T9VA 4GHAA 3PMXA 5I2KB 1IN7A 3W0FA 1N7XA 1QAMA 4X1DA 4EXLA 3AFHA 4QHQA 2OJTA 4LF8M 2EUCA 5IWAM 1M5FA 1MXUA 4B7FA 3O6IA 4IO3A 4ZZEA 3M6AA 3ZSFA 3VXCA 5FTHA 4JI5M 1XMQM 4D80A 5ITOA 2CHQA 1MM7A 5I59B 1F9BA 2YNMD 2CV2A 4AG6A 3SEVA 4LJ8A 2AYSA 1SD3A 2OWSA 4OYVA 1KSFX 4LVQA 2FNAA 2XXWA 5FHNA 2R6GE 4G68A 5J1DA 3VDUA 3MUQA 3FTEA 4L8RC 3HU2A 2IEEA 2OZZA 4NE4A 1R7RA 4U1ZA 3A3CA 5DVFA 2PVUA 4DV6M 2GH9A 4G2ZA 4OHNA 4PFTA 4M9XA 2ZNUA 4JWOA 3MVWA 4NF8B 3FVGA 1MDQA 2X7PA 3L27A 1NJGA 2H99A 4KR5A 2XF3A 2PBWA 2FFJA 5EHSA 5A2QS 4Q5TA 2RC9A 1MXVA 2I4CA 4N6PA 4O3CA 3JV9A 4G8MA 3QSLA 2F78A 3T9HB 4P11A 1GVNA 3SBJA 1EH3A 1JETA 3N6TA 4WXJA 1HT2E 2KLFA 4Z0IA 2KW0A 1L2DA 2OCUA 3HHYA 1O63A 1DO2A 3U6SA 4GKJM 1SDXA 1R2ZA 2A5SA 5EYFA 5I57B 3DM0A 2ESNA 1T0KA 3OO8A 4JI2M 4R9GA 3SEUA 2ZYNA 1ZAEA 3KOXE 2F5PA 1B32A 5H8NA 1N3XA 3R7XA 1B51A 3AJIB 1DGGA 1PB7A 1Z7NE 1N78A 3FXRA 4OX9M 2G29A 4TLMB 4F2QA 3FKEA 3FXQA 3ILTB 3VE1B 3B9PA 4DUYM 3SEXA 4LG2A 4IBJA 3GLGA 2G5GX 4YKJA 4X9TA 1LAHE 3S2VA 2QCUA 2HEUA 3A3UA 1W5SA 1B3EA 3KSXA 1IXIA 1NY6A 4GIPA 3C35A 3E13X 2RGOA 4FEDA 5I2NB 3J81S 4U2RA 4LFAM 3SHFA 1US5A 1NY5A 1B9JA 2DE3A 4BLCA 4TLLB 3HHXA 3LR1A 3QAXA 1IN6A 3OELA 5KPRA 3GZGA 2A5YB 3SARA 2BJVA 1FJGM 1MH3A 2O7IA 4K0KM 1E9RA 1TT1A 3OO7A 4OQOA 4LJ4A 4KODA 4LQ5A 4POWA 3MPLA 4G68B 4JDFA 2I7PA 3TELA 3FJMA 1IN4A 3MJ5A 4CGYB 1URDA 2F36A 4YMBA 4AKGA 4F3PA 4JV5M 2QS3A 3OSRA 4F1UA 1NH8A 3QXMA 4PE5B 4MGZE 4Z8XA 2YLNA 1IXCA 4ONYA 3QWLA 1OFHA 4JB7A 1PBPA 4N07A 4F18A 4WEDA 3KP0E 4AW4A 3KFMA 3TQLA 4JWYA 5ISUA 3OD7A 4JXIA 5H8QA 4FCWA 1PEBA 3T38A 3K01A 1PC3A 4CISA 3SERA 3TDJA 4NF4B 3PD8A 4KHZE 2Z4RA 1AIVA 2NQ8C 3KS8A 1BTJA 1XHYA 4Q8RA 3I51A 4X66M 4LCBA 5I56B 4TOZA 4M0WA 4LA9A 3ECRA 4IGRA 1DOTA 4DXBA 4M4GA 4JN6A 4R2BA 3RN8A 3TAJA 1XOCA 1TH3A 3CR9A 1TDZA 2CEAA 2KZSA 1G3IA 3K8ZA 3O6GA 3MZ9A 3EIEA 3FXUA 4IO4A 4AQYM 3LVVA 3UA8A 2QMWA 4HL4A 4QSDA 4Z6YA 4EQ7A 4U4XA 4GXAA 1BKAA 4GRKA 4IBCA 1Z59A 2Z3XA 2ONSA 3IOTA 3OEMA 3GRUA 3FVOA 1YPNA 3C33A 3TE6A 3K00A 3Q8XA 3GPYA 1XC1A 4EF2A 3UK6A 2NVUB 4F29A 1IN5A 2HFBA 1GV8A 1NNPA 1DO0A 2L09A 2FNCA 3O2AA 2VQFM 1IXHA 2YPNA 3SMSA 1A8FA 4KFQA 4DIGA 1DSNA 2XXUA 3M8UA 1G8PA 4JI4M 3RE8A 3PNYA 3PPRA 2J7OA 3RT6B 4MLQA 3EIHA 4DR7M 2DYXA 4R9FA 4ELOA 1JR3A 3HJ8A 4B7HA 4I8CA 1XS5A 1QULA 2DWMA 2G8LA 5AA1A 2REGA 2YQZA 3EHUA 4FCVA 1S3SA 2XXYA 3U8QA 1B6HA 1L1TA 1HNWM 4GITA 3VKHA 3D4GA 1MQHA 1JW4A 1SW1A 4CHTB 3TYHA 3M7GA 1AMFA 4LF6M 2LXEA 1MDP1 2F5QA 3SC3A 5IREB 4FWHA 1N33M 4TQUQ 3RTWB 4LJAA 1O64A 3LQQA 5EXTA 5ITUA 3H6WA 1B4HA 2C5RA 4QFLA 4IBDA 3T22A 1UTHB 1VDDA 3FV1A 1HNXM 4AG5A 4BBAA 2XD3A 4JSOA 2O7UA 4OETA 3VDPA 4QF9A 3J80S 4LZ7A 5CMCA 4U21A 3GBBA 4P0GA 4YKPA 4P16A 1JVYA 1ZKBA 4U4SA 4NXMM 3TPAA 5EP2A 3K1NA 3PU5A 2XX9A 1UM8A 1H43A 3I4VA 4GC9A 4M0DA 2R62A 4R74A 4F1YA 3PPOA 1E9SA 1Q39A 1B5JA 2QBYA 3PPQA 5EXXA 2HAVA 1L2CA 1Y4TA 1NMUA 4IB2A 5DVJA 3RFWA 2Z8DA 2F4VM 4Z7EA 1K3XA 3GLFB 3VV5A 2F7BA 4E0WA 3K2LA 1WODA 3IAZA 1ZIUA 3HPIA 4RXLA 3DZDA 1Y4CA 3KOTA 3I6VA 2DSFA 1YTVA 3FTDA 4ELPA 5FHMA 5HM4B 5ICQA 4B3TM 3RLFE 5CMKA 4JBZA 3H6TA 3Q25A 2UXDM 3MVYA 5I58A 3CI8A 4LZZA 2R4JA 2XXXA 4RK9A 1GL6A 3RPWA 1QVRA 4TUWA 1I4WA 4BDNA 4FATA 3CSGA 2GRVA 3UP9A 1XXHB 1EZPA 3K92A 1C1KA 2DZOB 1MXWA 1NKXA 4H65A 2L7HA 1X37A 3BFTA 1P1WA 2ZANA 4GL0A 1IXRC 1SXJB 3A09A 3HSTA 4GOTA 3RTFB 1IQPA 5ITRA 3L6GA 1D4NA 3ZS6A 1LFHA 2I7NA 4IJFA 1ORYB 5DT6A 4GRIA 2DS9A 4IGTA 3FZVA 4YMAA 4PFWA 4IJEA 2LAOA 3U6OA 4GC5A 1NNFA 3DP6A 1H76A 4OVZA 3TTNA 2DHRA 3P7IA 2X8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I59 A;  4QFN A;  1NNT A;  2H5Y A;  2I3V A;  1XVX A;  4ELR A;  4IY5 A;  2I49 A;  2I4B A;  1LST A;  1QKA A;  3IJO B;  1N04 A;  2IA4 A;  1DMB A;  5TP9 B;  2Z22 A;  5AA4 A;  2H25 A;  1NFT A;  3MPK A;  5B70 A;  4AB5 A;  1HSE A;  3RY3 A;  3IOU A;  2DP8 A;  3FUZ A;  1MXX A;  3PD9 A;  1Y20 A;  3JYR A;  1I6B A;  4LON B;  4FOR A;  2Y7R A;  3B7D A;  4IO7 A;  3PUZ E;  3LSW A;  1OLC A;  5H8H B;  3SDF A;  1Y1M A;  1FTM A;  1TWY A;  5TU0 A;  3VFJ A;  4EDP A;  4XXU A;  1A8E A;  2GHA A;  4U1O A;  2XD2 A;  3MP1 A;  3K1P A;  1ATG A;  5DYH A;  1PBQ A;  1QUJ A;  3CFX A;  3IO4 A;  1BIY A;  1ZBM A;  4H0W A;  3M3K A;  3TZA A;  2R71 A;  1ZTY A;  3RUM A;  2GFE A;  3TCH A;  1SI0 A;  4QRZ A;  3H03 A;  1EU8 A;  4WKM A;  3OEN A;  4IO6 A;  1JEU A;  3TCG A;  1USY H;  3KOS A;  4FEB A;  4X48 A;  4ESX A;  3N6U A;  4GLI A;  1GGG A;  4I62 A;  2A5T B;  5I2N A;  2HZK A;  3KG2 A;  1P1N A;  4M1V A;  3OEK A;  4YKI A;  3G3I A;  3EHT A;  1MQI A;  4YB5 A;  4ELQ A;  3T66 A;  1J1N A;  1LBB A;  4BDL A;  3C32 A;  4ZS9 A;  4KYD A;  3SES A;  2AL5 A;  4ZEC A;  5AA4 B;  1PB8 A;  3DP8 A;  1I6A A;  3FVK A;  4KCC A;  3MAM A;  3PMV A;  1A99 A;  3B6W A;  1DTZ A;  2PT1 A;  3PMW A;  1IQ7 A;  2O68 A;  4DCY A;  4LUB A;  1SW5 A;  4HS7 A;  1PB9 A;  5BWJ A;  4ECF A;  5CI5 A;  1B1H A;  3IL1 B;  5EHM A;  3UN6 A;  4XKN A;  1URG A;  3PV0 E;  4FEC A;  2F6P A;  2PYY A;  4OES A;  3FGS A;  4KI0 E;  2D3I A;  2QS4 A;  2DE2 A;  3H4Z A;  3PUX E;  2I48 A;  1LAG E;  4NF4 A;  4KYE A;  2OK2 A;  5I56 A;  3H06 B;  4XKP A;  3MQ9 A;  2UYF A;  2QL3 A;  1Y3N A;  4F3B A;  2E0S A;  1MPD A;  3Q29 A;  2XXV A;  1QKB A;  3EN3 A;  1IUD A;  2Q88 A;  2ONR A;  4KD5 A;  1MY0 A;  3TTL A;  2PMS A;  2QSX A;  2PT2 A;  4DE8 A;  3BFU A;  3TTK A;  4AQ4 A;  3IB0 A;  2HXW A;  2RIN A;  2ALU A;  2V84 A;  3FAS A;  3DLN A;  3K6W A;  2Y7I A;  3MWB A;  2CMO A;  4QFP A;  1GR2 A;  2Q2A A;  5CBS A;  1P1Q A;  1AH5 A;  1FQD A;  1WDN A;  3HO7 A;  1FTO A;  5DTB A;  3UGW A;  1B52 A;  2O69 A;  1FCK A;  2Q89 A;  3MC2 A;  1S9T A;  2W7Y A;  3T96 B;  5BUU A;  3PGF A;  5KDT A;  2O6A A;  2FA7 A;  2VP1 A;  3U1O A;  4PQJ A;  1NH7 A;  3IB1 A;  4BDM A;  3U72 A;  4I1D A;  4UAC A;  2DXY A;  4H8I A;  3C36 A;  4I9D A;  4IO2 A;  4R72 A;  4ESW A;  2F8D A;  4FIM A;  4EQ9 A;  4Q0C A;  3PUY E;  2OLB A;  3S9L C;  3KZG A;  1MH4 A;  2XXQ A;  1UTH A;  3PPP A;  3MBP A;  1ANF A;  1Y9U A;  1B0L A;  4Q30 B;  4KCD A;  3TEP A;  3MVZ A;  1P1O A;  1FQC A;  1R9L A;  3ODB A;  4F3G A;  2ZYM A;  2O1M A;  1EZ9 A;  4KPT A;  2VHA A;  4HW8 A;  2B65 A;  2UXA A;  2V93 A;  1MG1 A;  1DPE A;  1LCF A;  4NWD A;  3TTM A;  1FTJ A;  2D21 A;  3EQ1 A;  1JW1 A;  5IKB A;  2DWJ A;  4ZEI A;  4YU0 A;  1ZU0 A;  1UQW A;  4H6D A;  1VSO A;  2RCB A;  1A7L A;  2ZNT A;  1RKM A;  3PPN A;  2Q2C A;  2NWJ A;  1S7Y A;  5KDT B;  1SVX B;  3IOV A;  1IIW A;  3QIM A;  3UK4 A;  5AA3 A;  2F5X A;  2DWH A;  1GVC A;  1QJM A;  4IY6 A;  3EHS A;  3VVF A;  1N76 A;  1OVB A;  1VE4 A;  3KSJ A;  1USY E;  2QS2 A;  4EQB A;  2CZL A;  2ZYK A;  3CVG A;  4NWC A;  1QVS A;  4NED A;  2F34 A;  5DEX B;  3MP6 A;  3MZB A;  4G77 A;  1MQD A;  3R6U A;  2BJJ X;  1RYO A;  1ZMG A;  2UYE A;  3O28 A;  3HCQ A;  4OFL A;  1IXG A;  3SKP A;  3QK6 A;  4OEU A;  4GFR A;  4QFO A;  4GIZ A;  5TP9 A;  3Q27 A;  2THI A;  4H5G A;  1B3H A;  4G68 C;  1POY 1;  1QW0 A;  2XHD A;  1ELJ A;  4OFO A;  1MY3 A;  1LFI A;  2P1S A;  4RNS A;  1OIB A;  5KCJ B;  1LAF E;  1LB9 A;  5H8H A;  1SI1 A;  1FQF A;  4THI A;  2Z23 A;  3HN0 A;  4HCY A;  1HSL A;  1TXF A;  2X26 A;  5K2Y A;  4G4P A;  4OZ9 A;  1JEV A;  3V5A A;  3E4R A;  3KBR A;  3USD A;  5LOM A;  3RT8 A;  4LZ5 A;  4MH5 A;  4K3F A;  2F7C A;  1B40 A;  2ZMB A;  4ND9 A;  1R9Q A;  3O6H A;  3HHF A;  2XX7 A;  4IO5 A;  2D5W A;  2O1L A;  1R6Z A;  3IR1 A;  3O29 A;  1XVY A;  3B6Q A;  3H7M A;  1UTB A;  5KZT A;  2ZYO A;  1KWH A;  3H6U A;  2A5T A;  1B3L A;  1I6Q A;  4LQ2 A;  4X1B A;  5JTY B;  3VDF A;  3TFL A;  3IJX B;  1YCJ A;  3THI A;  4PP0 A;  4ZDM A;  2QMX A;  4DCX A;  3TKD A;  1UIV A;  4LZ8 A;  2NUV A;  1P99 A;  3LSX A;  4DZ1 A;  2HCA A;  1OLA A;  1LB8 A;  3O97 A;  1H3D A;  1EZO A;  1S50 A;  3TTR A;  1IIT A;  1B5H A;  2H4I A;  4ZE8 A;  1DPP A;  4NF6 A;  3SEY A;  4HCW A;  4OVJ A;  2VD3 A;  4NTL A;  4OWD A;  1D9V A;  1HSJ A;  4NMY A;  3CRB A;  5AA2 A;  3CFZ A;  3IO6 A;  5ELV A;  4GD5 A;  4MLV A;  3FJG A;  2DWA A;  4RPN A;  1B3F A;  2B3B A;  3TUS A;  1B5I A;  2V25 A;  5CMM A;  2RCA A;  1VFD A;  3KN3 A;  2H9B A;  3QUJ A;  2VD2 A;  1LGB C;  3G3J A;  1MY1 A;  3QYT A;  3JZJ A;  3N94 A;  4EF1 A;  4OEV A;  2PX1 A;  3MP8 A;  2XXP A;  4RK2 A;  1TFA A;  4DXU A;  1UTB B;  3FIR A;  2Z8E A;  1D3K A;  3S9N C;  5K2X A;  4F3S A;  2X7Q A;  4FAJ A;  3U94 A;  2I0B A;  1SW4 A;  2Y84 A;  3CSB A;  1POT A;  2QS1 A;  1MXY A;  1D9Y A;  1UIU A;  1H45 A;  4YAH X;  3W15 C;  3K4U A;  3TOD A;  4OFJ A;  5HBC A;  2F6G A;  5L8D A;  3K2D A;  1VR5 A;  2O84 X;  4MFI A;  2ONK E;  4BDO A;  3LC8 A;  3WAF A;  2M8C A;  1OQH A;  1IEJ A;  2V3T A;  1P1U A;  1Z7M E;  2ZXT A;  4MF3 A;  4P0I A;  3LBS A;  1WVJ A;  1M5B A;  1A40 A;  1VFE A;  1MQJ A;  4NF6 B;  3G3G A;  2ANJ A;  3EF7 A;  1SQY A;  3HV1 A;  4GL8 A;  5AA2 B;  3FV2 A;  3ZKL A;  2UVJ A;  2RC7 A;  3C34 A;  2OBG A;  3RQT A;  3K6V A;  1JW5 A;  4F19 A;  4LAT A;  4BDR A;  3QUF A;  4WEP A;  1QUI A;  1N84 A;  4LP2 B;  1I69 A;  3DEL B;  5HPQ A;  1FTK A;  5DVI A;  4GF8 A;  3KN8 A;  2V3U A;  4N13 A;  3G3H A;  3TQW A;  1QUK A;  1LBC A;  1B0H A;  3S4U A;  2DWI A;  2NOO A;  4GQO A;  3Q28 A;  1BP5 A;  2E1S A;  4R75 A;  4F1V A;  3KJ7 A;  3TCF A;  1OMP A;  5CRY A;  3BKI B;  4QFK A;  1SW2 A;  3SEW A;  3T9U A;  3OMB A;  2F97 A;  3CIJ A;  2QPQ A;  4QSC A;  3OOA A;  3MJN A;  2REJ A;  3OO6 A;  2XXI A;  3V8X B;  4DDD A;  2ABH A;  2RKM A;  4QSE A;  3M3F A;  3K6X A;  3MVX A;  3F11 A;  2DVZ A;  1Y3P A;  1JQF A;  4O3A A;  1B2H A;  3K02 A;  1SYH A;  4H1X A;  2Z8F A;  2P2A A;  5A5X A;  4YKK A;  2F7A A;  4ZEF A;  3VVD A;  4RPO A;  3G3F A;  4OER A;  4XTC Q;  1B7Z A;  3BBR A;  2WKY A;  5AE4 A;  3VLU A;  4DLD A;  4OTE A;  1MM6 A;  2H98 A;  4C1T A;  4ZEB A;  1N0T A;  3CFL A;  2OWT A;  3OXN A;  4H8J A;  3I5O A;  2AIX A;  4F31 B;  3Q26 A;  3OO9 A;  5B7D A;  4U22 A;  1MS7 A;  2NXO A;  2AL4 A;  2XXR A;  3CG1 A;  4F39 A;  5JK4 A;  5DEX A;  5H8N B;  2HQ0 A;  3E3K A;  4L17 A;  1MY2 A;  2XX8 A;  2I58 A;  1PDA A;  4JSD A;  1AL3 A;  4NF5 A;  1B7U A;  2UVH A;  1B58 A;  2I3W A;  2QRY A;  2RF1 A;  1FQA A;  5FTI A;  2Y7W A;  1CB6 A;  1FW0 A;  5F7V A;  1B4Z A;  3RNN A;  2VOZ A;  1Y1Z A;  2RC8 A;  4OXV A;  3PUW E;  1A54 A;  1JNF A;  3MZ1 A;  2ZNS A;  2DQV A;  5KCJ A;  4UA8 A;  2R9J A;  4YIC A;  4OEN A;  3LSL A;  2HZL A;  4XIG Q;  4ZED A;  3U93 A;  1LFG A;  3T93 B;  4RJZ A;  3N26 A;  2XXH A;  3I3V A;  3OSQ A;  1TFD A;  5A5X B;  2V3Q A;  3C31 A;  1FQB A;  5AA2 D;  4HTG A;  3H6V A;  2DVC A;  3FD3 A;  3AXF A;  3RGY A;  1Q35 A;  4BDQ A;  1MRP A;  2FYI A;  2I0C A;  3H3G A;  3DP4 A;  4G8H A;  2F35 A;  3KN7 A;  5H8Q B;  1Q1K A;  1AOV A;  4U23 A;  3MW0 A;  2Y7K A;  1FQE A;  4R6K A;  3V89 B;  1RYX A;  3E9X A;  1B3G A;  4R6H A;  1US4 A;  4C0R A;  1R1N A;  4MBP A;  1N7W A;  3S9E A;  1LLS A;  3UOR A;  2QJE A;  2Y7P A;  2UVG A;  3IOR A;  5JTY A;  3ILU B;  1B1X A;  4GVO A;  2GHB A;  3FJ7 A;  3IB2 A;  1II5 A;  1MQG A;  5TPA A;  3FAT A;  3VVE A;  1DTG A;  4NF5 B;  1IZ1 A;  4XKR A;  1CE2 A;  1BLF A;  4KYS A;  3WAE A;  4KQP A;  2O51 A;  4RYA A;  4PFY A;  4YB7 A;  3LUY A;  3CG3 A;  2YJP A;  5L9M A;  1M5D A;  1M5E A;  3L6H A;  3O66 A;  3K1M A;  3C4M A;  1B05 A;  3G7W A;  4JWX A;  4R2F A;  4POX A;  5ITP A;  3N5L A;  4ZEK A;  4ZE9 A;  5CBR A;  1MY4 A;  3PUV E;  1H44 A;  1URS A;  3B6T A;  5CMB A;  3KEI A;  1Y3Q A;  4GWO A;  3C9H A;  2DXR A;  3GBA A;  5L9S A;  2G93 A;  5CM6 A;  4R73 A;  2HAU A;  3EPE A;  3U92 A;  1M5C A;  3ZKK A;  1B46 A;  5M2V A;  1MPC A;  2VGQ A;  1N3W A;  3R26 A;  3W9V A;  4E0X A;  3O9P A;  4H5F A;  1XT8 A;  2B3F A;  4F22 A;  1SYI A;  1FTL A;  4R6Y A;  4PET A;  4AB6 A;  5H8F A;  5I84 A;  3FVN A;  1MPB A;  4ISU A;  4FJP A;  4H67 A;  3KGC A;  2DE4 A;  5I2K A;  1LCT A;  5IAI A;  1O7T A;  1OVT A;  3HHG A;  3V83 A;  3T9X B;  1OQG A;  5TPA B;  3K0V A;  3GXA A;  4RA1 A;  3D4C A;  4FE8 A;  1B7H A;  1NL5 A;  4O3B A;  3KJT A;  1YAE A;  5ICT A;  1ZJL A;  3IOW A;  2DOJ A;  3W9W A;  2UVI A;  5F1Q A;  3TMG A;  3SET A;  4RY1 A;  5H8S A;  1L5T A;  4YB6 A;  4OMB A;  3LSF B;  4YZZ A;  4NF8 A;  5CC2 A;  1ZLQ A;  1A55 A;  3IK6 B;  4DXC A;  4ZZA A;  4EUO A;  3GLB A;  4BLA A;  3VLV A;  5L9O A;  1GTK A;  3VLW A;  1SBP A;  3VXB A;  1JVX A;  3K6U A;  4PFU A;  5I58 B;  2XXT A;  4XKQ A;  4G8N A;  3M3L A;  4EXK A;  4GXS B;  2P0S A;  4C1U A;  5I57 A;  3G3K A;  2I6E A;  3S9M C;  3ONM A;  3UIF A;  1MXZ A;  5H8F B;  2Q9T A;  4F2O A;  1LAX A;  5JEI A;  2Q8J A;  1NNK A;  5FHO A;  3IX1 A;  3T9V A;  3PMX A;  5I2K B;  1N7X A;  4X1D A;  4EXL A;  4QHQ A;  2OJT A;  1M5F A;  1MXU A;  3O6I A;  4IO3 A;  4ZZE A;  3ZSF A;  3VXC A;  5FTH A;  5ITO A;  1MM7 A;  5I59 B;  1F9B A;  3SEV A;  2AYS A;  1SD3 A;  2OWS A;  4OYV A;  4LVQ A;  2XXW A;  5FHN A;  2R6G E;  4G68 A;  5J1D A;  3MUQ A;  2IEE A;  2OZZ A;  4NE4 A;  4U1Z A;  3A3C A;  5DVF A;  2PVU A;  2GH9 A;  4G2Z A;  4OHN A;  4PFT A;  4JWO A;  2ZNU A;  3MVW A;  4NF8 B;  3FVG A;  1MDQ A;  2X7P A;  2H99 A;  4KR5 A;  2PBW A;  5EHS A;  4Q5T A;  2RC9 A;  1MXV A;  2I4C A;  4N6P A;  4O3C A;  3JV9 A;  4G8M A;  3QSL A;  2F78 A;  3T9H B;  4P11 A;  1EH3 A;  3N6T A;  1JET A;  4WXJ A;  2KLF A;  4Z0I A;  2OCU A;  1O63 A;  1SDX A;  2A5S A;  5EYF A;  5I57 B;  3DM0 A;  2ESN A;  1T0K A;  3OO8 A;  4R9G A;  3SEU A;  2ZYN A;  1B32 A;  5H8N A;  1N3X A;  3R7X A;  1B51 A;  1PB7 A;  1Z7N E;  3FXR A;  2G29 A;  4TLM B;  4F2Q A;  3FXQ A;  3ILT B;  3VE1 B;  3SEX A;  4YKJ A;  4X9T A;  1LAH E;  3S2V A;  2HEU A;  3A3U A;  1B3E A;  3KSX A;  1IXI A;  3C35 A;  3E13 X;  4FED A;  5I2N B;  4U2R A;  1US5 A;  1B9J A;  2DE3 A;  4TLL B;  3LR1 A;  3QAX A;  3OEL A;  3GZG A;  1MH3 A;  2O7I A;  1TT1 A;  3OO7 A;  4OQO A;  4LQ5 A;  4POW A;  3MPL A;  4G68 B;  4JDF A;  3TEL A;  3FJM A;  1URD A;  2F36 A;  4YMB A;  4F3P A;  2QS3 A;  3OSR A;  4F1U A;  1NH8 A;  3QXM A;  4PE5 B;  2YLN A;  1IXC A;  4ONY A;  4JB7 A;  1PBP A;  4N07 A;  4F18 A;  4WED A;  3KFM A;  3TQL A;  4JWY A;  5ISU A;  3OD7 A;  4JXI A;  5H8Q A;  1PEB A;  3K01 A;  1PC3 A;  3SER A;  3TDJ A;  4NF4 B;  3PD8 A;  4KHZ E;  1AIV A;  1BTJ A;  1XHY A;  4Q8R A;  5I56 B;  4TOZ A;  4LA9 A;  3ECR A;  4IGR A;  1DOT A;  4DXB A;  4M4G A;  4R2B A;  3RN8 A;  3TAJ A;  1XOC A;  3CR9 A;  3O6G A;  3MZ9 A;  3FXU A;  4IO4 A;  3UA8 A;  2QMW A;  4QSD A;  4EQ7 A;  4U4X A;  4GXA A;  1BKA A;  4GRK A;  2ONS A;  3IOT A;  3OEM A;  3FVO A;  1YPN A;  3C33 A;  3K00 A;  4EF2 A;  1XC1 A;  2NVU B;  4F29 A;  2HFB A;  1GV8 A;  1NNP A;  2FNC A;  3O2A A;  1IXH A;  2YPN A;  1A8F A;  4KFQ A;  4DIG A;  1DSN A;  2XXU A;  3M8U A;  3PPR A;  3RT6 B;  4MLQ A;  2DYX A;  4R9F A;  4ELO A;  4I8C A;  1XS5 A;  1QUL A;  5AA1 A;  2REG A;  3EHU A;  2XXY A;  3U8Q A;  1B6H A;  3D4G A;  1MQH A;  1JW4 A;  1SW1 A;  3TYH A;  1AMF A;  1MDP 1;  4TQU Q;  3RTW B;  1O64 A;  3H6W A;  1B4H A;  4QFL A;  3T22 A;  1UTH B;  3FV1 A;  2XD3 A;  4JSO A;  2O7U A;  4OET A;  4QF9 A;  4LZ7 A;  5CMC A;  4U21 A;  3GBB A;  4P0G A;  4YKP A;  1JVY A;  1ZKB A;  4U4S A;  3TPA A;  3K1N A;  3PU5 A;  2XX9 A;  1H43 A;  4R74 A;  4F1Y A;  3PPO A;  1B5J A;  3PPQ A;  2HAV A;  1Y4T A;  1NMU A;  4IB2 A;  5DVJ A;  2Z8D A;  4Z7E A;  3VV5 A;  2F7B A;  4E0W A;  1WOD A;  3IAZ A;  1ZIU A;  3HPI A;  4RXL A;  1Y4C A;  3KOT A;  3I6V A;  2DSF A;  1YTV A;  4ELP A;  5FHM A;  5HM4 B;  5ICQ A;  3RLF E;  5CMK A;  4JBZ A;  3H6T A;  3Q25 A;  3MVY A;  5I58 A;  3CI8 A;  2XXX A;  4RK9 A;  3RPW A;  4BDN A;  4FAT A;  3CSG A;  2GRV A;  3UP9 A;  1EZP A;  1MXW A;  1NKX A;  4H65 A;  3BFT A;  1P1W A;  4GL0 A;  3A09 A;  3HST A;  4GOT A;  3RTF B;  3L6G A;  1D4N A;  3ZS6 A;  1LFH A;  5DT6 A;  2DS9 A;  4IGT A;  3FZV A;  4YMA A;  4PFW A;  2LAO A;  1NNF A;  3DP6 A;  1H76 A;  3TTN A;  3P7I A; 
#chains in the Genus database with same CATH topology
 5I59 A;  4I4L A;  4QFN A;  1NNT A;  3SHG B;  2H5Y A;  2I3V A;  4ITQ A;  1XVX A;  4MGK E;  1LBY A;  4ELR A;  5FTK A;  1TR8 A;  2RGH A;  4IY5 A;  2I49 A;  2I4B A;  1LST A;  1YXI A;  1OJL A;  1QKA A;  3IJO B;  1N04 A;  2IA4 A;  2DAI A;  1DMB A;  2CV0 A;  4LJ5 A;  1D0K A;  5TP9 B;  2Z22 A;  2V1C A;  5AA4 A;  2QQ8 A;  1XC8 A;  2H25 A;  1NFT A;  3MPK A;  5B70 A;  4QOZ C;  4AB5 A;  3CF2 A;  1HSE A;  4PBH A;  3IOU A;  3RY3 A;  5J16 A;  3I01 M;  1MX0 A;  2DP8 A;  1ZV1 A;  2BNK A;  3FUZ A;  1MXX A;  1R5L A;  3B8B A;  3PD9 A;  5F3W A;  1Y20 A;  1T43 A;  1I6B A;  3JYR A;  5FLX S;  4LON B;  4PAI A;  4FOR A;  2Y7R A;  3B7D A;  4IO7 A;  5FSW A;  3PUZ E;  4LRT A;  3LSW A;  1FBD A;  1OLC A;  4NSR A;  2R45 A;  5H8H B;  3SDF A;  1QYR A;  4LF7 M;  1Y1M A;  1NUX A;  1FTM A;  2BJI A;  3KC0 A;  2CHG A;  1TWY A;  1DK4 A;  5TU0 A;  3VFJ A;  4EDP A;  4AI6 A;  4XXU A;  5E6J A;  4L78 A;  1A8E A;  2GHA A;  4JI8 M;  3KOZ E;  1IMC A;  4U1O A;  1QAO A;  5EP1 A;  2XD2 A;  1WGN A;  3MP1 A;  4MX6 A;  3K1P A;  1ATG A;  3BIH A;  1YE9 A;  5DYH A;  1PBQ A;  1QUJ A;  3CFX A;  3IO4 A;  4F2L A;  1KFV A;  1BIY A;  1ZBM A;  1E94 E;  4H0W A;  4LF4 M;  3M3K A;  4S12 A;  3TZA A;  1QUT A;  2WSE F;  2R71 A;  1ZTY A;  4P9K A;  4DUZ M;  3RUM A;  8CAT A;  2GFE A;  1D2N A;  5EP3 A;  3TCH A;  2DWZ B;  1SI0 A;  4QRZ A;  3H03 A;  1EU8 A;  4WKM A;  4DR4 M;  3OEN A;  3U60 B;  4IO6 A;  1JEU A;  1TDH A;  1T3T A;  4P1L A;  3TCG A;  2JY8 A;  1USY H;  3VFD A;  3KOS A;  4FEB A;  4X48 A;  4ESX A;  3N6U A;  4GLI A;  1GGG A;  1W5T A;  4I62 A;  4L16 A;  3GRY A;  2A5T B;  5I2N A;  1L2B A;  2HZK A;  4OVZ B;  3KG2 A;  2Y20 A;  4RF0 A;  1P1N A;  3PXG A;  3IHP A;  4M1V A;  2QPA A;  3OEK A;  4YKI A;  3G3I A;  3EHT A;  1MQI A;  2KXE A;  4YB5 A;  4XBO A;  4ELQ A;  2DKL A;  3T66 A;  1J1N A;  1LBB A;  3GPX A;  4BDL A;  3GLH E;  1LV7 A;  3C32 A;  4ZS9 A;  4G4R A;  4KYD A;  4F1I A;  4NHB A;  3SES A;  4WP2 A;  1K3W A;  2AL5 A;  3HHW A;  1VG5 A;  4ZEC A;  5AA4 B;  1PB8 A;  3DP8 A;  2L2D A;  1I6A A;  5ITT A;  2HL7 A;  2X4A A;  1NNU C;  1Q3C A;  5EJC A;  3FVK A;  4KCC A;  2L4E A;  2CRU A;  1AWB A;  4R3D A;  4NRV A;  3PTY A;  3MAM A;  3J27 B;  2JXN A;  3PMV A;  1A99 A;  3B6W A;  3TWM A;  1DTZ A;  3B7Z A;  4DR5 M;  2PT1 A;  2Y0Q A;  4PE3 A;  3PMW A;  4PD2 A;  2E5L M;  2DZN B;  1IQ7 A;  2O68 A;  1IY1 A;  4DCY A;  4LFB M;  1ZMV A;  4LUB A;  1SW5 A;  4HS7 A;  1PB9 A;  4MEV A;  2JJK A;  5BWJ A;  4ECF A;  5CI5 A;  1B1H A;  3IL1 B;  1FJ6 A;  5EHM A;  1DGB A;  1JR3 D;  3UN6 A;  2DVW B;  4XKN A;  1G4A E;  2CEY A;  1URG A;  2XWO A;  3PV0 E;  4FEC A;  2F6P A;  2PYY A;  5GKN A;  4OES A;  3FGS A;  4KI0 E;  5DFL A;  2K6B A;  2D3I A;  2QS4 A;  3LCU A;  2HKJ A;  2DE2 A;  3H4Z A;  4BB9 A;  2I48 A;  3PUX E;  1LAG E;  4NF4 A;  4KYE A;  3UZU A;  2OK2 A;  2WSF F;  2QP9 X;  3AKZ A;  5I56 A;  2JY6 B;  3H06 B;  4XKP A;  2XGN A;  3MQ9 A;  1SXJ D;  2UYF A;  2QL3 A;  1IFY A;  1Y3N A;  4F3B A;  4II7 A;  3FE3 A;  2E0S A;  1MPD A;  5KO3 A;  3AV0 A;  1HT1 E;  5E26 A;  1OIZ A;  3Q29 A;  4G4Q A;  1J7K A;  2XXV A;  4XGI A;  1QKB A;  3EN3 A;  1IUD A;  2Q88 A;  1VDL A;  2ONR A;  4KD5 A;  2CUZ A;  1MY0 A;  3TTL A;  4DV0 M;  2Y21 A;  2PMS A;  3I4Y A;  1OKS A;  3L26 A;  2QSX A;  2PT2 A;  4DE8 A;  4M9S A;  1G0I A;  1R2Y A;  3BFU A;  2DAG A;  2JZ1 A;  3HGI A;  3TTK A;  4AQ4 A;  3L2A A;  2F5S A;  3IB0 A;  4PFI A;  2DEN A;  4NGU A;  1OTR A;  2HXW A;  2RIN A;  2ALU A;  2V84 A;  3FAS A;  4PF6 A;  3DLN A;  3K6W A;  2Y7I A;  2VT5 A;  3MWB A;  5EXS A;  2CMO A;  2KRU A;  4QFP A;  1GR2 A;  2Q2A A;  4LY6 A;  2O01 F;  1IM2 A;  5CBS A;  1P1Q A;  4MB7 A;  1K82 A;  1AH5 A;  3A45 A;  4DV1 M;  4CJ6 A;  1GO5 A;  1FQD A;  5ITX A;  1WDN A;  3HO7 A;  2CV1 A;  1FTO A;  2JZ0 A;  2CE7 A;  2Q74 A;  5DTB A;  3UGW A;  4LF9 M;  1B52 A;  2C9C A;  2O69 A;  1XNQ M;  1FCK A;  2Q89 A;  2CWB A;  3MC2 A;  1S9T A;  2CHV A;  4FD2 A;  4IBG A;  2W7Y A;  3T96 B;  5ITQ A;  5BUU A;  4PT5 A;  3PGF A;  2R4E A;  4PF8 A;  5KDT A;  4LJ6 A;  2O6A A;  2FA7 A;  2VP1 A;  3U1O A;  4PQJ A;  1NH7 A;  3IB1 A;  4BDM A;  3U72 A;  2ZTC A;  3ZH9 B;  4I1D A;  4UAC A;  2DXY A;  1GKI A;  4H8I A;  3C36 A;  4I9D A;  4DV2 M;  1G41 A;  4IO2 A;  4HE2 A;  3OTO M;  4R72 A;  4FCT A;  4ESW A;  2F8D A;  4FIM A;  1NV7 A;  5JI2 E;  2B3T A;  1EYK A;  4EQ9 A;  4Q0C A;  2QSF X;  3KP1 E;  2OLB A;  3PUY E;  3S9L C;  3KZG A;  2HWJ A;  2FVZ A;  1MH4 A;  2ZAO A;  2XXQ A;  1UTH A;  3D8L A;  2LHC A;  3HZJ A;  3PPP A;  3K1J A;  1LBW A;  4IBB A;  3MBP A;  2D7E A;  1E32 A;  1ANF A;  1Y9U A;  1QDR A;  1B0L A;  4Q30 B;  4KCD A;  3TEP A;  3BIG A;  4P1E A;  3MVZ A;  2ZZX A;  3K9O A;  4DR2 M;  4IIW A;  2HPG A;  2QVV A;  5F24 A;  3CF0 A;  1GLN A;  2Z4S A;  1P1O A;  1FQC A;  1R9L A;  3ODB A;  2DWL A;  4F3G A;  2ZYM A;  2O1M A;  4QBA A;  3GLI B;  2GNO A;  2VF7 A;  1EZ9 A;  4KPT A;  4R71 A;  4I81 A;  2VHA A;  3VLF B;  4HW8 A;  2QHO B;  3DFZ A;  3DOA A;  2B65 A;  3GLF A;  2UXA A;  3CF6 E;  2V93 A;  1MG1 A;  4MMP A;  1DPE A;  2HHM A;  3W0L B;  1HNZ M;  1LCF A;  4NWD A;  3TTM A;  1FTJ A;  2WBB A;  2Y5L A;  2RKO A;  2DAE A;  2D21 A;  4ZPX A;  4LJ9 A;  2XSZ D;  1TH4 A;  3E46 A;  3HJQ A;  3EQ1 A;  1YSY A;  1DCU A;  1JW1 A;  5IKB A;  4B7G A;  2DWJ A;  4ZEI A;  4YU0 A;  1ZU0 A;  4LGY A;  1UQW A;  4H6D A;  3IG5 A;  1VSO A;  1NSF A;  2RCB A;  1A7L A;  2ZNT A;  4GWX A;  1RKM A;  3PPN A;  3UJN A;  1ZMW A;  4NOO B;  2Z7J A;  5JI3 E;  1JQJ C;  2Q2C A;  3THG A;  2NWJ A;  4PGP A;  1S7Y A;  4HE1 A;  5KDT B;  5BPV A;  1SVX B;  2FHY A;  3IOV A;  1IIW A;  3QIM A;  3JR4 A;  5FTN A;  3UK4 A;  2Y0T A;  2F5O A;  1XI6 A;  3J7A S;  2P3V A;  4JI6 M;  5AA3 A;  1XXH A;  2F5N A;  7CAT A;  2F5X A;  2DWH A;  1FPG A;  3SMP A;  5EYH A;  2XFS A;  1GVC A;  1Q3B A;  1DV0 A;  4O7I A;  1GJS A;  2MRO B;  1QJM A;  4DI3 D;  3FUT A;  5IZZ A;  2QNJ A;  1SXJ A;  3R8F A;  4IY6 A;  3EHS A;  2WSC F;  4L15 A;  2OWZ A;  1IMB A;  4NC6 A;  1FBG A;  3VVF A;  2LWX A;  1N76 A;  5DYG A;  1OVB A;  1VE4 A;  1WIV A;  2JY5 A;  3KSJ A;  4EIW A;  1USY E;  2P5T A;  3CHG A;  2QS2 A;  4EQB A;  1F4I A;  2CZL A;  2ZYK A;  5ITY A;  3CVG A;  4NWC A;  1QVS A;  4NED A;  2JY7 A;  2F34 A;  5DEX B;  3MP6 A;  3MZB A;  4G77 A;  1QAN A;  1MQD A;  3R6U A;  4LGM A;  5ESY A;  1IY0 A;  4GHL A;  1LBZ A;  1NV8 A;  2BJJ X;  3U5Z B;  4O8M A;  1RYO A;  1IBK M;  1ZMG A;  4B3R M;  2UYE A;  4LJ7 A;  3O28 A;  5EXP A;  3HCQ A;  4OFL A;  1AIP C;  1IXG A;  3SFZ A;  3SKP A;  2X49 A;  3QK6 A;  1QGX A;  4OEU A;  3U65 A;  4GFR A;  4QFO A;  3FRI A;  1MU5 A;  4GIZ A;  5TP9 A;  3Q27 A;  2THI A;  1IMD A;  4H5G A;  1B3H A;  4G68 C;  3U6Q A;  1POY 1;  1QW0 A;  1N34 M;  2DXI A;  3VK7 A;  2XHD A;  3JR5 A;  1ELJ A;  3HHZ A;  1HR0 M;  4O7M A;  3FTF A;  4OFO A;  1MY3 A;  1LFI A;  2P1S A;  4RNS A;  1IXZ A;  2HCB A;  1OIB A;  5KCJ B;  3HX3 A;  1LAF E;  4QOS A;  3GO8 A;  3T1H M;  1LB9 A;  4H45 A;  5H8H A;  2D7G A;  1SI1 A;  1FQF A;  4THI A;  2VPO A;  4GX3 A;  2Z23 A;  3HN0 A;  5C18 A;  4HCY A;  1HSL A;  1TXF A;  2G3Q A;  2QVU A;  2X26 A;  3B7Q A;  5FBP A;  1XHB A;  1CNQ A;  5K2Y A;  4JYA M;  4N4U A;  4G4P A;  4OZ9 A;  2VQE M;  1WR1 B;  1JEV A;  3V5A A;  3E4R A;  3KBR A;  3LQR A;  3ZC7 B;  3USD A;  5LOM A;  4PTK A;  3RT8 A;  3VKG A;  4LZ5 A;  4K3F A;  4MH5 A;  3GLF E;  1I94 M;  2F7C A;  1B40 A;  1GJT A;  2ZMB A;  1N77 A;  4ND9 A;  4PGN A;  1GL7 A;  4JVD A;  4DV4 M;  1R9Q A;  3O6H A;  2UXC M;  3HHF A;  3AOE A;  2XX7 A;  1QDT A;  4IO5 A;  1LBV A;  3IEC A;  2D5W A;  2O1L A;  1IN8 A;  1R6Z A;  3A46 A;  4PAK A;  2XWI A;  4KHP M;  1KYI A;  3IR1 A;  2VII A;  3U60 A;  4IBI A;  1XVY A;  3O29 A;  4HLQ A;  3T6P A;  2C9O A;  1Q9D A;  3B6Q A;  1RDX A;  3H7M A;  1UTB A;  5KZT A;  2ZYO A;  3FUU A;  1KWH A;  3H6U A;  1JR3 E;  2A5T A;  4JI0 M;  2B4M A;  1D9Q A;  1B3L A;  1I6Q A;  3QYE A;  4LQ2 A;  4X1B A;  5JTY B;  1NO1 A;  2MJ5 B;  3VDF A;  1BK4 A;  1DGH B;  3TFL A;  2XZU A;  3IJX B;  4X64 M;  1YCJ A;  3THI A;  1MN3 A;  4PDD A;  3LW5 F;  1XXH E;  1GAB A;  4PP0 A;  4ZDM A;  2M60 A;  1NV6 A;  2QMX A;  4DCX A;  3TKD A;  1UIV A;  3E79 A;  4KO8 A;  1DGF A;  4LZ8 A;  2NUV A;  1P99 A;  3LSX A;  4DZ1 A;  2CZH A;  1SXJ E;  2HCA A;  1OLA A;  3SYL A;  1FJ9 A;  1LB8 A;  3TPZ A;  3O97 A;  3KC1 A;  4L6V 6;  4N6K A;  1H3D A;  1EZO A;  4JI7 M;  4XEQ A;  2XSZ A;  1PGY A;  1VDW A;  2VPN A;  2LVA A;  3KOW E;  1S50 A;  3FRH A;  4AZF A;  3TTR A;  1IIT A;  4QHT A;  2ZZW A;  1B5H A;  1Z5C A;  4QNR A;  2H4I A;  4JI3 M;  4ZE8 A;  1DPP A;  3KXE C;  4NF6 A;  3SEY A;  4HCW A;  4OVJ A;  1EYJ A;  1WHC A;  2VD3 A;  3RGP A;  3PNV A;  3L28 A;  3T1Y M;  4GBV A;  1PJT A;  4NTL A;  4OWD A;  1YUB A;  1D9V A;  1HSJ A;  4NMY A;  3CRB A;  5AA2 A;  2PFZ A;  1L8Q A;  4OVT A;  3CFZ A;  2FH0 A;  3HY5 A;  3IO6 A;  3KOY E;  5ELV A;  1NJF A;  1HQC A;  4GD5 A;  4W5W A;  4MLV A;  3FJG A;  2DWA A;  3HU3 A;  4RKU F;  4DV7 M;  4RPN A;  1B3F A;  2B3B A;  4GBW A;  3TUS A;  1B5I A;  2GQF A;  2V25 A;  5CMM A;  2RCA A;  2XH9 A;  1VFD A;  3KN3 A;  4LF5 M;  2H9B A;  3QUJ A;  1VEK A;  2VD2 A;  2FOI C;  1LGB C;  4I40 A;  3G3J A;  5L8R F;  1MY1 A;  3QYT A;  5LMU M;  3NBI A;  4DR3 M;  3JZJ A;  3N94 A;  4EF1 A;  4OEV A;  2PX1 A;  4OVP A;  3SAU A;  3MP8 A;  2XXP A;  4RK2 A;  4OAN A;  1KZ8 A;  2XXK A;  4X8R A;  1TFA A;  4DXU A;  4LN5 A;  1UTB B;  3FIR A;  2Z8E A;  3ZCB B;  1D3K A;  3S9N C;  5K2X A;  4RNA A;  1J5E M;  3MST A;  2KRK A;  1IBM M;  1D0M A;  4F3S A;  1HJP A;  2X7Q A;  4FAJ A;  3U94 A;  2I0B A;  1SW4 A;  2Y84 A;  3CSB A;  1POT A;  2QS1 A;  1MXY A;  1D9Y A;  3KVW A;  4MM3 B;  1H45 A;  1UIU A;  4YAH X;  3W15 C;  1G59 A;  5IZ1 A;  4XK8 F;  1SPI A;  3K4U A;  2V6Z M;  1PJJ A;  3TOD A;  4OFJ A;  5HBC A;  1N32 M;  2F6G A;  5L8D A;  3K2D A;  1VR5 A;  2O84 X;  4LZJ A;  4MFI A;  5KPT A;  4N6D A;  2ONK E;  4BDO A;  2J5Y A;  3LC8 A;  5KQD A;  3WAF A;  2M8C A;  1OQH A;  4I3E A;  1FBH A;  1Z6T A;  3AOG A;  2LVQ D;  1YLA A;  1IEJ A;  3GPP A;  2V3T A;  1P1U A;  1Z7M E;  2ZXT A;  4MF3 A;  3WHL A;  2HXR A;  4P0I A;  3LBS A;  1WVJ A;  2KDL A;  1M5B A;  2AHM A;  1A40 A;  1VFE A;  4DI4 B;  1MQJ A;  4NF6 B;  4GX4 A;  3G3G A;  2ANJ A;  3EF7 A;  1ZQ9 A;  1SQY A;  3HV1 A;  3C3E A;  3KW6 A;  4NRW A;  4GL8 A;  5AA2 B;  3FV2 A;  1MJG M;  4MGH A;  3ZKL A;  3LV0 A;  1T6O A;  4PCZ A;  2UVJ A;  2CFO A;  2C98 A;  1WXQ A;  4REZ A;  2RC7 A;  5EQ8 A;  1FBP A;  3C34 A;  2OBG A;  3RQT A;  3K6V A;  4JXJ A;  1JW5 A;  4FW9 A;  1QZE A;  3T15 A;  4OVR A;  4F19 A;  4LAT A;  4BDR A;  3U6C A;  3QUF A;  4B08 A;  4WEP A;  3FD9 A;  1OQY A;  1QUI A;  1N84 A;  4LP2 B;  1SXJ C;  3BOS A;  1I69 A;  2H1R A;  4DV3 M;  3DEL B;  5HPQ A;  1FTK A;  5DVI A;  4GF8 A;  3KN8 A;  2V3U A;  4N13 A;  3G3H A;  3TQW A;  4G4N A;  1QUK A;  3E21 A;  1QQW A;  4IBF A;  2K0B X;  3ILK A;  1LBC A;  1B0H A;  3S4U A;  3GQ5 A;  2JA2 A;  4MGI E;  2DWI A;  4UAB A;  2NOO A;  3IFA A;  1QUS A;  4GQO A;  3Q28 A;  1BP5 A;  2E1S A;  4R75 A;  3GLI A;  2K47 A;  4F1V A;  3KJ7 A;  3L29 A;  4MGY E;  3TCF A;  4YY3 M;  1FSA A;  1NUZ A;  3VK8 A;  1OMP A;  5CRY A;  3BKI B;  4G4O A;  4QFK A;  1SW2 A;  1FBE A;  3FBP A;  2C96 A;  3SEW A;  4WUR A;  3T9U A;  3OMB A;  1FPK A;  2UUB M;  2F97 A;  2UU9 M;  3CIJ A;  2LVO C;  1NNJ A;  2QPQ A;  2KNZ A;  3TWL A;  4QSC A;  5EQT A;  3OOA A;  2WEF A;  1CUK A;  3MJN A;  3A98 B;  4MNI A;  2REJ A;  3OO6 A;  2XXI A;  3V8X B;  2OPF A;  1EIJ A;  3ZQJ A;  4DDD A;  2ABH A;  2RKM A;  4QSE A;  3M3F A;  3K6X A;  4GWU A;  3MVX A;  1WGL A;  3D8B A;  2ZTD A;  3F11 A;  5FTL A;  2OQ4 A;  2DVZ A;  1Y3P A;  1JQF A;  4O3A A;  1B2H A;  1QZM A;  1SYH A;  3K02 A;  4D82 A;  3H4J A;  4H1X A;  2Z8F A;  2P2A A;  5A5X A;  3PVS A;  4NAP A;  3SYK A;  3RYD A;  4YKK A;  4DR6 M;  1Y8G A;  2F7A A;  4ZEF A;  1RDY A;  3VVD A;  4RPO A;  5EQ9 A;  4FVM A;  4OU7 A;  3G3F A;  4OER A;  4NXN M;  4XTC Q;  1B7Z A;  3BBR A;  2WKY A;  3RPL A;  1JP4 A;  2BJW A;  2ZZV A;  5AE4 A;  4GWS A;  3VLU A;  4DLD A;  4OTE A;  3K9P A;  3IG8 A;  1MM6 A;  2H98 A;  4C1T A;  4ZEB A;  1N0T A;  1NV4 A;  1NV2 A;  3CFL A;  2OWT A;  3AOE C;  3OXN A;  3L25 A;  4H8J A;  3I5O A;  2AIX A;  4F31 B;  5LMN M;  3Q26 A;  3OO9 A;  5B7D A;  4U22 A;  1MS7 A;  2NXO A;  2AL4 A;  2XXR A;  3CG1 A;  4F39 A;  1Z5B A;  3MK6 A;  5JK4 A;  4WW0 A;  3V76 A;  3FUW A;  5DEX A;  1NI9 A;  3QMF A;  5H8N B;  2HQ0 A;  4NSO B;  4PFB A;  3E3K A;  4L17 A;  1MY2 A;  3TWK A;  3U5Z A;  2XX8 A;  2DAK A;  5IZ7 D;  2I58 A;  3LVW A;  3W67 A;  5EQ7 A;  1IXS B;  1XMO M;  4B3M M;  1PDA A;  4KLN A;  4JSD A;  3GLG B;  1AL3 A;  4NF5 A;  1B7U A;  2UVH A;  1B58 A;  3KFU G;  2I3W A;  2QRY A;  1TGU A;  4IBE A;  2RF1 A;  1FQA A;  5FTI A;  1Z5A A;  2Y7W A;  5FTJ A;  2HHH M;  4P8B A;  4KT0 F;  1CB6 A;  3DA1 A;  1FW0 A;  2DZL A;  3U6P A;  5F7V A;  1B4Z A;  1NV1 A;  3RNN A;  1FPL A;  2VOZ A;  1SG9 A;  1NVM A;  2ZM6 M;  1Y1Z A;  2RC8 A;  4OXV A;  2KNA A;  2O5R A;  3A42 A;  1NHW C;  3PUW E;  1A54 A;  4H46 A;  1OFI A;  1JNF A;  3MZ1 A;  2ZNS A;  5ET7 A;  2DQV A;  3C58 A;  4QXD A;  5KCJ A;  4AKI A;  2APL A;  4UA8 A;  3HU1 A;  2R9J A;  3B50 A;  3U61 A;  1OAO C;  2L5V A;  4YIC A;  4P3L A;  3LMM A;  4OEN A;  3LSL A;  2HZL A;  2KA6 B;  5DYI A;  4XIG Q;  4ZED A;  3U93 A;  1LFG A;  3T93 B;  5H37 D;  2QEN A;  3GQ4 A;  4RJZ A;  3N26 A;  2XXH A;  1NHG C;  4PFR A;  3I3V A;  3OSQ A;  1ZMU A;  3GLI E;  4A3V B;  4FWD A;  1TFD A;  5A5X B;  1FPB A;  4G6Z A;  2V3Q A;  3C31 A;  1FQB A;  1K9Y A;  3FUX A;  5FTM A;  5AA2 D;  4HTG A;  4NQ8 A;  3H6V A;  2DVC A;  1PJI A;  3FD3 A;  5IM2 A;  3AXF A;  1FPE A;  3HKP A;  3RPL B;  4N17 A;  2EO2 A;  3RGY A;  1YYZ A;  1Q35 A;  2QZ4 A;  4GWY A;  4BDQ A;  1MRP A;  2YR0 A;  2FYI A;  3HFU A;  2I0C A;  3H3G A;  3J7B A;  3SAV A;  2EA0 A;  3DP4 A;  4G8H A;  4Q7J A;  1EE8 A;  2F35 A;  3R9X B;  2JWS A;  3KN7 A;  3I04 M;  5ITX E;  2HAK A;  1Q1K A;  5H8Q B;  1AOV A;  4U23 A;  4LFC M;  3MW0 A;  2LNH C;  2CZK A;  2Y7K A;  1FQE A;  4R6K A;  3V89 B;  1RYX A;  1EFU B;  3E9X A;  1B3G A;  4R6H A;  4G61 A;  1US4 A;  4C0R A;  4L4U A;  1R1N A;  2GQ1 A;  4CIZ A;  4MBP A;  1N7W A;  1NV3 A;  3S9E A;  1LLS A;  5EQA A;  3UOR A;  2KEB A;  2QJE A;  2UUC M;  2Y7P A;  4GKK M;  3B74 A;  2UVG A;  3IOR A;  3J2P B;  5JTY A;  5I3S A;  1FTA A;  3ILU B;  1DGH A;  1FNN A;  1B1X A;  4GVO A;  2GHB A;  3FJ7 A;  3IB2 A;  4QHS A;  1II5 A;  1MQG A;  5TPA A;  3FAT A;  3VVE A;  1DTG A;  4NF5 B;  1IZ1 A;  4OVQ A;  3BBZ A;  1N75 A;  4MNC A;  4XKR A;  1CE2 A;  1BLF A;  4KYS A;  3WAE A;  4KQP A;  2XEP A;  2O51 A;  4RYA A;  4QNM A;  4PFY A;  4AS4 A;  2XZF A;  4YB7 A;  3LUY A;  3CG3 A;  4MNP A;  2YJP A;  5L9M A;  1M5D A;  4N91 A;  2KHH A;  1M5E A;  3H4M A;  3U6L A;  3L6H A;  3O66 A;  4B3S M;  5BR8 M;  3K1M A;  3KDS E;  4R7G A;  3C4M A;  5I7I A;  1G71 A;  4MH0 E;  1B05 A;  2Y5K A;  3G7W A;  4JWX A;  2ERC A;  4R2F A;  4POX A;  5ITP A;  3N5L A;  2MR9 A;  3GRV A;  4JI1 M;  3GRR A;  2FIX A;  2KZU A;  4ZEK A;  3FYC A;  4ZE9 A;  3ROJ A;  3U61 B;  3CTW B;  5CBR A;  3HJS A;  3KS4 A;  1N36 M;  1MY4 A;  3PUV E;  4I5S A;  1H44 A;  1KA0 A;  2R46 A;  1URS A;  3B6T A;  5CMB A;  3KEI A;  1Y3Q A;  4GWO A;  3C9H A;  2VDB B;  3FUV A;  2DXR A;  3GBA A;  1V92 A;  2ZAM A;  5L9S A;  5DNY A;  1V33 A;  1PM5 A;  2G93 A;  5CM6 A;  2MGW A;  4R73 A;  2D7H A;  2HAU A;  3EPE A;  1IBL M;  2WX9 A;  3U92 A;  2KR0 A;  4UN2 B;  1XWI A;  1M5C A;  2PCR A;  3ZKK A;  1B46 A;  1NV9 A;  1MPC A;  5M2V A;  2LTU A;  2VGQ A;  3A29 A;  1N3W A;  1G0H A;  3R26 A;  1BVS A;  3W9V A;  4E0X A;  1INP A;  3PFI A;  1UFZ A;  3O9P A;  4H5F A;  4PDG A;  5LTC A;  2UUA M;  1J09 A;  1L1Z A;  4DBG B;  2XFT A;  1XT8 A;  2B3F A;  4F22 A;  1SYI A;  1FTL A;  3M0E A;  2CP8 A;  4AS5 A;  3GLH A;  2ZBK B;  4R6Y A;  2WYK A;  4GH9 A;  4PET A;  5ET5 A;  1QAQ A;  3FYD A;  4AB6 A;  5H8F A;  1P3Q Q;  5I84 A;  3MHV C;  3FVN A;  2K9D A;  1MPB A;  4ISU A;  4FJP A;  4H67 A;  3KGC A;  2DE4 A;  1R6B X;  5I2K A;  2V4C A;  1LCT A;  4M9Z A;  5IAI A;  1O7T A;  1OVT A;  3HHG A;  3V83 A;  1TH2 A;  2UXB M;  3T9X B;  1OQG A;  3WHK A;  4X62 M;  5TPA B;  1HQY E;  3K0V A;  4XFE A;  3SAS A;  3GXA A;  4RA1 A;  4N8G A;  3D4C A;  3HWS A;  4FE8 A;  1LBX A;  5IT9 S;  3SAT A;  3FTC A;  2L6O A;  1B7H A;  1NL5 A;  5C1B A;  4O3B A;  3E9S A;  4RF1 A;  3KJT A;  3SAW A;  3U6M A;  4GMQ A;  3NBX X;  2R65 A;  4OVS A;  2J7N A;  5EP4 A;  3JAM S;  3QAU A;  1YAE A;  4NG7 A;  5ICT A;  2QBY B;  2R44 A;  1ZJL A;  3IOW A;  2DOJ A;  3W9W A;  3RGS A;  2UVI A;  5KQ8 A;  2W82 A;  5F1Q A;  3TMG A;  3SET A;  4RY1 A;  1IY2 A;  5H8S A;  2R18 A;  1L5T A;  4YB6 A;  3GPU A;  2FS1 A;  4I8O A;  4OMB A;  3LSF B;  4YZZ A;  3ISP A;  4NF8 A;  3TQS A;  4LRS A;  5CC2 A;  1ZLQ A;  4IBK A;  1A55 A;  3IK6 B;  2Q2E B;  4DXC A;  4ZZA A;  4EUO A;  1VEJ A;  2YFQ A;  1XNR M;  3GLB A;  4BLA A;  4DR1 M;  3VLV A;  5L9O A;  1GTK A;  3AL0 C;  3VLW A;  1SBP A;  4OA4 A;  5KPZ A;  3VXB A;  1JVX A;  3K6U A;  2JP7 A;  4PDI A;  4PFU A;  5I58 B;  2XXT A;  2XLJ A;  4XKQ A;  2DWN A;  2BWB A;  4AKH A;  4G8N A;  3M3L A;  4EXK A;  3NWL A;  3FXB A;  3GQ3 A;  2C99 A;  3F92 A;  2VF8 A;  3TL4 X;  4NL4 H;  3U6D A;  4GXS B;  2M5Z A;  3UMM A;  4OW0 A;  4N15 A;  1TF0 B;  2P0S A;  4C1U A;  4X65 M;  3UGJ A;  3GP1 A;  1EYI A;  3G3K A;  5I57 A;  2V1U A;  4DV5 M;  1H6U A;  2I6E A;  4YHH M;  3S9M C;  5ET6 A;  4FWG A;  3ONM A;  3GLH B;  4D81 A;  5I5P A;  3UIF A;  1MXZ A;  2Z8Y M;  5H8F B;  2L4F A;  2FE8 A;  2Q9T A;  4F2O A;  1LAX A;  2DAM A;  5JEI A;  2L7I A;  4IR8 A;  2Q8J A;  3U6E A;  2LH0 A;  1NNK A;  3IX1 A;  5FHO A;  3T9V A;  4GHA A;  3PMX A;  3B89 A;  5I2K B;  1IN7 A;  2N35 A;  3W0F A;  1N7X A;  1QAM A;  4X1D A;  2LVP C;  4EXL A;  3AFH A;  4QHQ A;  2OJT A;  4NX1 A;  4LF8 M;  2EUC A;  2LHG A;  5IWA M;  1M5F A;  1MXU A;  4B7F A;  3O6I A;  4IO3 A;  4ZZE A;  3M6A A;  3ZSF A;  3VXC A;  5FTH A;  4JI5 M;  1XMQ M;  4D80 A;  5ITO A;  2CHQ A;  1MM7 A;  5I59 B;  3MMP A;  1F9B A;  2YNM D;  2CV2 A;  4AG6 A;  3SEV A;  2JUJ A;  4LJ8 A;  4O94 A;  2AYS A;  2WBD A;  1SD3 A;  2OWS A;  4OYV A;  1KSF X;  4LVQ A;  2FNA A;  2XXW A;  5FHN A;  2R6G E;  4G68 A;  1LEV A;  3IFC A;  5J1D A;  3VDU A;  3MUQ A;  3FTE A;  3MYU A;  4L8R C;  3HU2 A;  2IEE A;  1NV5 A;  2OZZ A;  4NE4 A;  4JVC A;  1R7R A;  4U1Z A;  3A3C A;  5DVF A;  2PVU A;  2QVR A;  4KXP A;  4DV6 M;  2GH9 A;  4G2Z A;  4OHN A;  4PFT A;  4M9X A;  2ZNU A;  4JWO A;  5IGA A;  3MVW A;  4NF8 B;  3FVG A;  1MDQ A;  2X7P A;  3Q8G A;  5LDZ A;  4GWW A;  3L27 A;  1NJG A;  2H99 A;  4KR5 A;  2XF3 A;  2PBW A;  2FFJ A;  3W68 A;  5EHS A;  5A2Q S;  4Q5T A;  4FBP A;  2RC9 A;  1MXV A;  2I4C A;  4N6P A;  4O3C A;  1DBZ A;  3JV9 A;  4G8M A;  2OOB A;  3QSL A;  2F78 A;  3T9H B;  4P11 A;  1GVN A;  3SBJ A;  1EH3 A;  1JET A;  3N6T A;  4WXJ A;  1HT2 E;  2KLF A;  4Z0I A;  2KW0 A;  1L2D A;  2OCU A;  2XWK A;  3HHY A;  1O63 A;  1DO2 A;  3U6S A;  4GKJ M;  1SDX A;  3EKI A;  1R2Z A;  2A5S A;  5EYF A;  2P3N A;  5I57 B;  4GX6 A;  3DM0 A;  2ESN A;  1T0K A;  3OO8 A;  2JNH A;  5DW8 A;  1FPI A;  4JI2 M;  4R9G A;  4MJO A;  3SEU A;  2ZYN A;  1ZAE A;  3KOX E;  2F5P A;  1B32 A;  4JVI A;  5H8N A;  4PAF A;  4MCO A;  1N3X A;  3R7X A;  1B51 A;  3AJI B;  1NUY A;  1DGG A;  1PB7 A;  1Z7N E;  4HXV A;  1N78 A;  3FXR A;  4OX9 M;  1NV0 A;  2G29 A;  2PFY A;  2MH8 A;  4TLM B;  4F2Q A;  1IXS A;  3FKE A;  3FXQ A;  3ILT B;  3VE1 B;  3B9P A;  4DUY M;  2F3B A;  3SEX A;  4LG2 A;  4IBJ A;  3GLG A;  2G5G X;  4YKJ A;  4X9T A;  1LAH E;  3S2V A;  2QCU A;  1FBC A;  2HEU A;  3A3U A;  1W5S A;  1B3E A;  1IME A;  3KSX A;  1IXI A;  1NY6 A;  4GIP A;  3C35 A;  3E13 X;  2RGO A;  4FED A;  5I2N B;  3J81 S;  4U2R A;  4MIJ A;  4LFA M;  3SHF A;  1US5 A;  1NY5 A;  5A5L A;  2KQZ A;  2R6F A;  1B9J A;  2DE3 A;  4XF5 A;  2FIE A;  3GYY A;  3CGW A;  4BLC A;  4TLL B;  2FBP A;  3HHX A;  3LR1 A;  3QAX A;  1IN6 A;  3OEL A;  5KPR A;  3GZG A;  2A5Y B;  3SAR A;  2BJV A;  1FJG M;  1MH3 A;  2LBC A;  2O7I A;  4K0K M;  1E9R A;  1TT1 A;  3OO7 A;  4OQO A;  2R0I A;  1FPF A;  4LJ4 A;  4KOD A;  4LQ5 A;  4POW A;  3MPL A;  4G68 B;  4JDF A;  2Q8M A;  2I7P A;  3TEL A;  3FJM A;  1IN4 A;  3MJ5 A;  4CGY B;  1URD A;  2F36 A;  1TTE A;  1V34 A;  4YMB A;  4AKG A;  4F3P A;  4JV5 M;  2QS3 A;  3OSR A;  4Y28 F;  1NH8 A;  4F1U A;  2CEX A;  3QXM A;  4PE5 B;  4MGZ E;  4Z8X A;  2YLN A;  1KA1 A;  2DI0 A;  1IXC A;  4ONY A;  2WZJ A;  3QWL A;  1D0L A;  1OFH A;  4JB7 A;  1PBP A;  4GWZ A;  4N07 A;  4F18 A;  1FBF A;  4WED A;  3KP0 E;  4AW4 A;  3KFM A;  3TQL A;  3T0J A;  1PJQ A;  4JWY A;  2OX3 A;  5ISU A;  3OD7 A;  4JXI A;  5H8Q A;  1IMF A;  4FCW A;  1PEB A;  3T38 A;  3K01 A;  1PC3 A;  4CIS A;  3SER A;  1VQ1 A;  3TDJ A;  4NF4 B;  3PD8 A;  4KHZ E;  4NF0 A;  2Z4R A;  1AIV A;  5T3J A;  2NQ8 C;  3KS8 A;  1AUA A;  1BTJ A;  1XHY A;  3I51 A;  4Q8R A;  4X66 M;  4MAG A;  4LCB A;  5I56 B;  2DDK A;  4M0W A;  4LA9 A;  3ECR A;  4TOZ A;  4IGR A;  1DOT A;  3B7N A;  4DXB A;  4M4G A;  4JN6 A;  4R2B A;  3RN8 A;  3TAJ A;  1XOC A;  1TH3 A;  3CR9 A;  1TDZ A;  2CEA A;  1PJS A;  2KZS A;  1G3I A;  3K8Z A;  3O6G A;  1A5T A;  4NN3 A;  3MZ9 A;  3EIE A;  3FXU A;  4IO4 A;  2XWV A;  4AQY M;  2DHY A;  3LVV A;  3UA8 A;  2QMW A;  4HL4 A;  4QSD A;  3LCV B;  3SZP A;  1RDZ A;  4Z6Y A;  4EQ7 A;  4U4X A;  4GXA A;  1Q02 A;  1BKA A;  4GRK A;  4IBC A;  2KNV A;  1Z59 A;  2Z3X A;  2ONS A;  3IOT A;  3OEM A;  3GRU A;  5ET8 A;  1R4G A;  2MKZ A;  3FVO A;  1YPN A;  3C33 A;  4ANR A;  3TE6 A;  3K00 A;  3Q8X A;  4HE0 A;  3C9P A;  3GPY A;  1XC1 A;  4EF2 A;  3UK6 A;  2NVU B;  4F29 A;  1IN5 A;  2HFB A;  1GV8 A;  1NNP A;  1DO0 A;  3E78 A;  2L09 A;  2FNC A;  3O2A A;  4HEO A;  2VQF M;  1IXH A;  2YPN A;  3SMS A;  1A8F A;  2DNA A;  4MHF A;  4KFQ A;  4DIG A;  1DSN A;  2XXU A;  3M8U A;  1G8P A;  3GLG E;  3RE8 A;  4JI4 M;  3PNY A;  1FPJ A;  3PPR A;  1YZ0 A;  2J7O A;  3RT6 B;  4P47 A;  4MLQ A;  5IZ3 A;  3EIH A;  2B4L A;  2OO9 A;  4DR7 M;  2DYX A;  4R9F A;  2O25 A;  4ELO A;  1JR3 A;  3HJ8 A;  4B7H A;  4I8C A;  1XS5 A;  1QUL A;  2DWM A;  2G8L A;  5AA1 A;  2REG A;  2YQZ A;  3EHU A;  4FCV A;  1S3S A;  2XXY A;  3U8Q A;  1B6H A;  1L1T A;  2BWE A;  1HNW M;  4GIT A;  3VKH A;  3D4G A;  1MQH A;  1JW4 A;  1SW1 A;  4CHT B;  3TYH A;  3M7G A;  1AMF A;  4LF6 M;  2LXE A;  1MDP 1;  2F5Q A;  3SC3 A;  3QYB A;  5IRE B;  2H5X A;  4FWH A;  1N33 M;  4TQU Q;  3RTW B;  1K9Z A;  4LJA A;  1O64 A;  3LQQ A;  5EXT A;  5ITU A;  2CZI A;  3H6W A;  1B4H A;  2C5R A;  4QFL A;  4IBD A;  4X04 A;  3T22 A;  1UTH B;  1VDD A;  3FV1 A;  4P56 A;  1HNX M;  4AG5 A;  4BBA A;  2XD3 A;  4JSO A;  2O7U A;  4OET A;  3VDP A;  4QF9 A;  3J80 S;  4LZ7 A;  5CMC A;  4U21 A;  3GBB A;  1VEG A;  4P0G A;  4YKP A;  4PBQ A;  4PDH A;  4P16 A;  1JVY A;  1ZKB A;  4U4S A;  4NXM M;  1LTM A;  3TPA A;  1PRB A;  5EP2 A;  4GEW A;  2QFL A;  2XX9 A;  3K1N A;  3PU5 A;  1UM8 A;  1H43 A;  4PC9 A;  3I4V A;  4GC9 A;  4M0D A;  2R62 A;  4R74 A;  1FPD A;  4F1Y A;  3PPO A;  1E9S A;  1Q39 A;  1B5J A;  2QBY A;  3PPQ A;  3KBZ A;  5EXX A;  2HAV A;  1L2C A;  1Y4T A;  1NMU A;  4IB2 A;  5DVJ A;  1JB0 F;  3RFW A;  2Z8D A;  2F4V M;  4Z7E A;  1K3X A;  3GLF B;  3VV5 A;  2EKF A;  2F7B A;  4E0W A;  3K2L A;  2R8T A;  1WOD A;  3IAZ A;  1ZIU A;  3HPI A;  2RRU A;  3C3D A;  4RXL A;  3DZD A;  1Y4C A;  2OOA A;  2WYP A;  3KOT A;  3I6V A;  3BXW A;  2DSF A;  1YTV A;  1FRP A;  3FTD A;  4ELP A;  5FHM A;  5HM4 B;  5EYG A;  5IZ3 B;  5ICQ A;  4B3T M;  2XA5 A;  4N81 A;  3RLF E;  5CMK A;  4JBZ A;  2EJS A;  3H6T A;  3Q25 A;  1OAI A;  2UXD M;  3MVY A;  5I58 A;  2LVN C;  3CI8 A;  4LZZ A;  3NOH A;  2R4J A;  2XXX A;  4RK9 A;  1GL6 A;  3RPW A;  1WJ7 A;  1QVR A;  4TUW A;  2EKK A;  1I4W A;  4G3O A;  4BDN A;  4FAT A;  1IMA A;  1RU3 A;  1C7Y A;  2GRV A;  3CSG A;  4I3Y A;  3UP9 A;  1XXH B;  1EZP A;  1XB2 B;  4P17 A;  3K92 A;  1C1K A;  2DZO B;  1MXW A;  1NKX A;  4H65 A;  3D1R A;  4N8Y A;  2L7H A;  1X37 A;  1NUW A;  3BFT A;  4PCD A;  1P1W A;  2ZAN A;  4GL0 A;  3T1B A;  1IXR C;  1SXJ B;  3A09 A;  3HST A;  4GOT A;  2F3D A;  3RTF B;  1IQP A;  5ITR A;  3L6G A;  1D4N A;  3ZS6 A;  1LFH A;  2I7N A;  4IJF A;  1ORY B;  5DT6 A;  1OIP A;  4GRI A;  2DS9 A;  4IGT A;  3FZV A;  4YMA A;  4PFW A;  4IJE A;  2LAO A;  3U6O A;  4GC5 A;  1NNF A;  3DP6 A;  1H76 A;  4OVZ A;  3TTN A;  3LUZ A;  2DHR A;  3P7I A;  2X8A A; 
#chains in the Genus database with same CATH homology
 5I59 A;  4I4L A;  4QFN A;  1NNT A;  3SHG B;  2H5Y A;  2I3V A;  4ITQ A;  1XVX A;  4MGK E;  4ELR A;  5FTK A;  2RGH A;  4IY5 A;  2I49 A;  2I4B A;  1LST A;  1OJL A;  1QKA A;  3IJO B;  1N04 A;  2IA4 A;  1DMB A;  2CV0 A;  4LJ5 A;  5TP9 B;  2Z22 A;  2V1C A;  5AA4 A;  1XC8 A;  2H25 A;  1NFT A;  3MPK A;  5B70 A;  4QOZ C;  4AB5 A;  3CF2 A;  1HSE A;  3RY3 A;  3IOU A;  1MX0 A;  2DP8 A;  2BNK A;  3FUZ A;  1MXX A;  3PD9 A;  5F3W A;  1Y20 A;  3JYR A;  1I6B A;  4LON B;  5FLX S;  4FOR A;  2Y7R A;  3B7D A;  4IO7 A;  5FSW A;  3PUZ E;  4LRT A;  3LSW A;  1OLC A;  4NSR A;  2R45 A;  5H8H B;  3SDF A;  1QYR A;  4LF7 M;  1Y1M A;  1FTM A;  2CHG A;  1TWY A;  5TU0 A;  3VFJ A;  4EDP A;  4AI6 A;  4XXU A;  5E6J A;  4L78 A;  1A8E A;  2GHA A;  4JI8 M;  3KOZ E;  4U1O A;  1QAO A;  5EP1 A;  2XD2 A;  3MP1 A;  3K1P A;  1ATG A;  5DYH A;  1YE9 A;  1PBQ A;  1QUJ A;  3CFX A;  3IO4 A;  1KFV A;  1BIY A;  1ZBM A;  1E94 E;  4H0W A;  4LF4 M;  3M3K A;  4S12 A;  3TZA A;  2R71 A;  1ZTY A;  4DUZ M;  3RUM A;  8CAT A;  2GFE A;  1D2N A;  5EP3 A;  3TCH A;  2DWZ B;  1SI0 A;  4QRZ A;  3H03 A;  1EU8 A;  4WKM A;  4DR4 M;  3OEN A;  3U60 B;  4IO6 A;  1JEU A;  1TDH A;  1T3T A;  3TCG A;  1USY H;  3VFD A;  3KOS A;  4FEB A;  4X48 A;  4ESX A;  3N6U A;  4GLI A;  1GGG A;  1W5T A;  4I62 A;  4L16 A;  3GRY A;  2A5T B;  5I2N A;  1L2B A;  2HZK A;  4OVZ B;  3KG2 A;  2Y20 A;  4RF0 A;  1P1N A;  3PXG A;  4M1V A;  2QPA A;  3OEK A;  4YKI A;  3G3I A;  3EHT A;  1MQI A;  2KXE A;  4YB5 A;  4XBO A;  4ELQ A;  3T66 A;  1J1N A;  1LBB A;  3GPX A;  4BDL A;  1LV7 A;  3C32 A;  4ZS9 A;  4G4R A;  4KYD A;  3SES A;  1K3W A;  2AL5 A;  3HHW A;  4ZEC A;  5AA4 B;  1PB8 A;  3DP8 A;  1I6A A;  5ITT A;  2HL7 A;  2X4A A;  1NNU C;  1Q3C A;  5EJC A;  3FVK A;  4KCC A;  4R3D A;  4NRV A;  3MAM A;  3J27 B;  3PMV A;  1A99 A;  3B6W A;  3TWM A;  1DTZ A;  4DR5 M;  2PT1 A;  2Y0Q A;  3PMW A;  4PD2 A;  2E5L M;  2DZN B;  1IQ7 A;  2O68 A;  1IY1 A;  4DCY A;  4LFB M;  4LUB A;  1SW5 A;  4HS7 A;  1PB9 A;  5BWJ A;  4ECF A;  5CI5 A;  1B1H A;  3IL1 B;  5EHM A;  1DGB A;  1JR3 D;  3UN6 A;  2DVW B;  4XKN A;  1G4A E;  1URG A;  3PV0 E;  4FEC A;  2F6P A;  2PYY A;  5GKN A;  4OES A;  3FGS A;  4KI0 E;  2D3I A;  2QS4 A;  2HKJ A;  2DE2 A;  3H4Z A;  4BB9 A;  2I48 A;  3PUX E;  1LAG E;  4NF4 A;  4KYE A;  3UZU A;  2OK2 A;  2QP9 X;  3AKZ A;  5I56 A;  3H06 B;  4XKP A;  2XGN A;  3MQ9 A;  1SXJ D;  2UYF A;  2QL3 A;  1Y3N A;  4F3B A;  4II7 A;  2E0S A;  1MPD A;  5KO3 A;  3AV0 A;  1HT1 E;  5E26 A;  3Q29 A;  4G4Q A;  1J7K A;  2XXV A;  4XGI A;  1QKB A;  3EN3 A;  1IUD A;  2Q88 A;  2ONR A;  4KD5 A;  2CUZ A;  1MY0 A;  3TTL A;  4DV0 M;  2Y21 A;  2PMS A;  3I4Y A;  3L26 A;  2QSX A;  2PT2 A;  4DE8 A;  4M9S A;  1R2Y A;  3BFU A;  3HGI A;  3TTK A;  4AQ4 A;  3L2A A;  2F5S A;  3IB0 A;  2HXW A;  2RIN A;  2ALU A;  2V84 A;  3FAS A;  3DLN A;  3K6W A;  2Y7I A;  3MWB A;  5EXS A;  2CMO A;  2KRU A;  4QFP A;  1GR2 A;  2Q2A A;  4LY6 A;  1IM2 A;  5CBS A;  1P1Q A;  4MB7 A;  1K82 A;  1AH5 A;  3A45 A;  4DV1 M;  1FQD A;  5ITX A;  1WDN A;  3HO7 A;  2CV1 A;  1FTO A;  2CE7 A;  5DTB A;  3UGW A;  4LF9 M;  1B52 A;  2C9C A;  2O69 A;  1XNQ M;  1FCK A;  2Q89 A;  3MC2 A;  1S9T A;  2CHV A;  4FD2 A;  4IBG A;  2W7Y A;  3T96 B;  5ITQ A;  5BUU A;  4PT5 A;  3PGF A;  2R4E A;  5KDT A;  4LJ6 A;  2VP1 A;  2O6A A;  2FA7 A;  3U1O A;  4PQJ A;  1NH7 A;  3IB1 A;  4BDM A;  3U72 A;  3ZH9 B;  4I1D A;  4UAC A;  2DXY A;  1GKI A;  4H8I A;  3C36 A;  4I9D A;  4DV2 M;  1G41 A;  4IO2 A;  3OTO M;  4R72 A;  4FCT A;  4ESW A;  2F8D A;  4FIM A;  5JI2 E;  4EQ9 A;  4Q0C A;  3PUY E;  3KP1 E;  2OLB A;  3S9L C;  3KZG A;  1MH4 A;  2ZAO A;  2XXQ A;  1UTH A;  3D8L A;  3PPP A;  3K1J A;  4IBB A;  3MBP A;  2D7E A;  1E32 A;  1ANF A;  1Y9U A;  1B0L A;  4Q30 B;  4KCD A;  3TEP A;  3MVZ A;  4DR2 M;  4IIW A;  3CF0 A;  1GLN A;  2Z4S A;  1P1O A;  1FQC A;  1R9L A;  3ODB A;  2DWL A;  4F3G A;  2ZYM A;  2O1M A;  3GLI B;  1EZ9 A;  4KPT A;  4I81 A;  2VHA A;  3VLF B;  4HW8 A;  3DFZ A;  3DOA A;  2B65 A;  3GLF A;  2UXA A;  3CF6 E;  2V93 A;  1MG1 A;  1DPE A;  3W0L B;  1HNZ M;  1LCF A;  4NWD A;  3TTM A;  1FTJ A;  2RKO A;  2D21 A;  4ZPX A;  4LJ9 A;  2XSZ D;  1TH4 A;  3HJQ A;  3EQ1 A;  1YSY A;  1JW1 A;  5IKB A;  4B7G A;  2DWJ A;  4ZEI A;  4YU0 A;  1ZU0 A;  4LGY A;  1UQW A;  4H6D A;  3IG5 A;  1VSO A;  1NSF A;  2RCB A;  1A7L A;  2ZNT A;  1RKM A;  3PPN A;  3UJN A;  4NOO B;  2Z7J A;  5JI3 E;  1JQJ C;  2Q2C A;  3THG A;  2NWJ A;  1S7Y A;  5KDT B;  5BPV A;  1SVX B;  3IOV A;  1IIW A;  3QIM A;  3JR4 A;  5FTN A;  3UK4 A;  2Y0T A;  2F5O A;  3J7A S;  4JI6 M;  5AA3 A;  1XXH A;  2F5N A;  7CAT A;  2F5X A;  2DWH A;  3SMP A;  2XFS A;  1GVC A;  1Q3B A;  1QJM A;  3FUT A;  1SXJ A;  3R8F A;  4IY6 A;  3EHS A;  4L15 A;  3VVF A;  2LWX A;  1N76 A;  5DYG A;  1OVB A;  1VE4 A;  3KSJ A;  4EIW A;  1USY E;  2P5T A;  2QS2 A;  4EQB A;  2CZL A;  2ZYK A;  5ITY A;  3CVG A;  4NWC A;  1QVS A;  4NED A;  2F34 A;  5DEX B;  3MP6 A;  3MZB A;  4G77 A;  1QAN A;  1MQD A;  3R6U A;  4LGM A;  1IY0 A;  4GHL A;  2BJJ X;  3U5Z B;  1RYO A;  1IBK M;  1ZMG A;  4B3R M;  2UYE A;  4LJ7 A;  3O28 A;  5EXP A;  3HCQ A;  4OFL A;  1IXG A;  3SKP A;  3SFZ A;  2X49 A;  3QK6 A;  4OEU A;  4GFR A;  4QFO A;  1MU5 A;  4GIZ A;  5TP9 A;  3Q27 A;  2THI A;  4H5G A;  1B3H A;  4G68 C;  3U6Q A;  1POY 1;  1QW0 A;  1N34 M;  2DXI A;  3VK7 A;  2XHD A;  3JR5 A;  1ELJ A;  3HHZ A;  1HR0 M;  3FTF A;  4OFO A;  1MY3 A;  1LFI A;  2P1S A;  4RNS A;  1IXZ A;  2HCB A;  1OIB A;  5KCJ B;  1LAF E;  4QOS A;  3GO8 A;  3T1H M;  1LB9 A;  5H8H A;  2D7G A;  1SI1 A;  1FQF A;  4THI A;  2Z23 A;  3HN0 A;  5C18 A;  4HCY A;  1HSL A;  1TXF A;  2X26 A;  1XHB A;  5K2Y A;  4JYA M;  4G4P A;  4OZ9 A;  2VQE M;  1JEV A;  3V5A A;  3E4R A;  3KBR A;  3LQR A;  3ZC7 B;  3USD A;  5LOM A;  3RT8 A;  3VKG A;  4LZ5 A;  4K3F A;  4MH5 A;  1I94 M;  2F7C A;  1B40 A;  2ZMB A;  1N77 A;  4ND9 A;  1GL7 A;  4DV4 M;  1R9Q A;  3O6H A;  2UXC M;  3HHF A;  3AOE A;  2XX7 A;  4IO5 A;  2D5W A;  2O1L A;  1IN8 A;  1R6Z A;  3A46 A;  4KHP M;  1KYI A;  3IR1 A;  2VII A;  3U60 A;  4IBI A;  1XVY A;  3O29 A;  4HLQ A;  2C9O A;  3B6Q A;  3H7M A;  1UTB A;  5KZT A;  2ZYO A;  3FUU A;  1KWH A;  3H6U A;  2A5T A;  4JI0 M;  1B3L A;  1I6Q A;  4LQ2 A;  4X1B A;  5JTY B;  3VDF A;  1DGH B;  3TFL A;  2XZU A;  3IJX B;  4X64 M;  1YCJ A;  3THI A;  4PP0 A;  4ZDM A;  2M60 A;  2QMX A;  4DCX A;  3TKD A;  1UIV A;  4KO8 A;  1DGF A;  4LZ8 A;  2NUV A;  1P99 A;  3LSX A;  4DZ1 A;  1SXJ E;  2HCA A;  1OLA A;  3SYL A;  1LB8 A;  3TPZ A;  3O97 A;  1H3D A;  1EZO A;  4JI7 M;  2XSZ A;  3KOW E;  1S50 A;  4AZF A;  3TTR A;  1IIT A;  4QHT A;  1B5H A;  1Z5C A;  4QNR A;  2H4I A;  4JI3 M;  4ZE8 A;  1DPP A;  3KXE C;  4NF6 A;  3SEY A;  4HCW A;  4OVJ A;  2VD3 A;  3RGP A;  3PNV A;  3L28 A;  3T1Y M;  4NTL A;  4OWD A;  1YUB A;  1D9V A;  1HSJ A;  4NMY A;  3CRB A;  5AA2 A;  1L8Q A;  3CFZ A;  3IO6 A;  3KOY E;  5ELV A;  1NJF A;  1HQC A;  4GD5 A;  4W5W A;  4MLV A;  3FJG A;  2DWA A;  3HU3 A;  4DV7 M;  4RPN A;  1B3F A;  2B3B A;  3TUS A;  1B5I A;  2V25 A;  5CMM A;  2RCA A;  2XH9 A;  1VFD A;  3KN3 A;  4LF5 M;  2H9B A;  3QUJ A;  2VD2 A;  2FOI C;  1LGB C;  3G3J A;  1MY1 A;  3QYT A;  5LMU M;  3NBI A;  4DR3 M;  3JZJ A;  3N94 A;  4EF1 A;  4OEV A;  2PX1 A;  3SAU A;  3MP8 A;  2XXP A;  4RK2 A;  1TFA A;  4DXU A;  1UTB B;  3FIR A;  2Z8E A;  3ZCB B;  1D3K A;  3S9N C;  5K2X A;  4RNA A;  1J5E M;  2KRK A;  1IBM M;  4F3S A;  2X7Q A;  4FAJ A;  3U94 A;  2I0B A;  1SW4 A;  2Y84 A;  3CSB A;  1POT A;  2QS1 A;  1MXY A;  1D9Y A;  3KVW A;  4MM3 B;  1H45 A;  1UIU A;  4YAH X;  3W15 C;  1G59 A;  3K4U A;  2V6Z M;  1PJJ A;  3TOD A;  4OFJ A;  5HBC A;  1N32 M;  2F6G A;  5L8D A;  3K2D A;  1VR5 A;  2O84 X;  4LZJ A;  4MFI A;  5KPT A;  2ONK E;  4BDO A;  3LC8 A;  5KQD A;  3WAF A;  2M8C A;  1OQH A;  1Z6T A;  3AOG A;  1IEJ A;  3GPP A;  2V3T A;  1P1U A;  1Z7M E;  2ZXT A;  4MF3 A;  3WHL A;  4P0I A;  3LBS A;  1WVJ A;  1M5B A;  2AHM A;  1A40 A;  1VFE A;  1MQJ A;  4NF6 B;  3G3G A;  2ANJ A;  3EF7 A;  1ZQ9 A;  1SQY A;  3HV1 A;  3KW6 A;  4NRW A;  4GL8 A;  5AA2 B;  3FV2 A;  4MGH A;  3ZKL A;  4PCZ A;  2UVJ A;  2CFO A;  2C98 A;  1WXQ A;  4REZ A;  2RC7 A;  3C34 A;  2OBG A;  3RQT A;  3K6V A;  4JXJ A;  1JW5 A;  4FW9 A;  3T15 A;  4F19 A;  4LAT A;  4BDR A;  3U6C A;  3QUF A;  4B08 A;  4WEP A;  3FD9 A;  1QUI A;  1N84 A;  4LP2 B;  1SXJ C;  3BOS A;  1I69 A;  2H1R A;  4DV3 M;  3DEL B;  5HPQ A;  1FTK A;  5DVI A;  4GF8 A;  3KN8 A;  2V3U A;  4N13 A;  3G3H A;  3TQW A;  4G4N A;  1QUK A;  1QQW A;  4IBF A;  3ILK A;  1LBC A;  1B0H A;  3S4U A;  3GQ5 A;  2JA2 A;  4MGI E;  2DWI A;  2NOO A;  4GQO A;  3Q28 A;  1BP5 A;  2E1S A;  4R75 A;  3GLI A;  2K47 A;  4F1V A;  3KJ7 A;  3L29 A;  4MGY E;  3TCF A;  4YY3 M;  3VK8 A;  1OMP A;  5CRY A;  3BKI B;  4G4O A;  4QFK A;  1SW2 A;  2C96 A;  3SEW A;  4WUR A;  3T9U A;  3OMB A;  2UUB M;  2F97 A;  2UU9 M;  3CIJ A;  1NNJ A;  2QPQ A;  3TWL A;  4QSC A;  5EQT A;  3OOA A;  3MJN A;  3A98 B;  2REJ A;  3OO6 A;  2XXI A;  3V8X B;  2OPF A;  4DDD A;  2ABH A;  2RKM A;  4QSE A;  3M3F A;  3K6X A;  3MVX A;  3D8B A;  3F11 A;  5FTL A;  2OQ4 A;  2DVZ A;  1Y3P A;  1JQF A;  4O3A A;  1B2H A;  1QZM A;  1SYH A;  3K02 A;  4D82 A;  4H1X A;  2Z8F A;  2P2A A;  5A5X A;  3PVS A;  3SYK A;  4YKK A;  4DR6 M;  2F7A A;  4ZEF A;  3VVD A;  4RPO A;  4FVM A;  4OU7 A;  3G3F A;  4OER A;  4NXN M;  4XTC Q;  1B7Z A;  3BBR A;  2WKY A;  2BJW A;  5AE4 A;  3VLU A;  4DLD A;  4OTE A;  3IG8 A;  1MM6 A;  2H98 A;  4C1T A;  4ZEB A;  1N0T A;  3CFL A;  2OWT A;  3AOE C;  3OXN A;  3L25 A;  4H8J A;  3I5O A;  2AIX A;  4F31 B;  5LMN M;  3Q26 A;  3OO9 A;  5B7D A;  4U22 A;  1MS7 A;  2NXO A;  2AL4 A;  2XXR A;  3CG1 A;  4F39 A;  1Z5B A;  3MK6 A;  5JK4 A;  4WW0 A;  3FUW A;  5DEX A;  5H8N B;  2HQ0 A;  4NSO B;  3E3K A;  4L17 A;  1MY2 A;  3TWK A;  3U5Z A;  2XX8 A;  5IZ7 D;  2I58 A;  3LVW A;  1IXS B;  1XMO M;  4B3M M;  1PDA A;  4KLN A;  4JSD A;  3GLG B;  1AL3 A;  4NF5 A;  1B7U A;  2UVH A;  1B58 A;  3KFU G;  2I3W A;  2QRY A;  1TGU A;  4IBE A;  2RF1 A;  1FQA A;  5FTI A;  1Z5A A;  2Y7W A;  5FTJ A;  2HHH M;  1CB6 A;  3DA1 A;  1FW0 A;  3U6P A;  5F7V A;  1B4Z A;  3RNN A;  2VOZ A;  1NVM A;  2ZM6 M;  1Y1Z A;  2RC8 A;  4OXV A;  2O5R A;  3A42 A;  1NHW C;  3PUW E;  1A54 A;  1OFI A;  1JNF A;  3MZ1 A;  2ZNS A;  2DQV A;  3C58 A;  5KCJ A;  4AKI A;  4UA8 A;  3HU1 A;  2R9J A;  3U61 A;  4YIC A;  3LMM A;  4OEN A;  3LSL A;  2HZL A;  2KA6 B;  5DYI A;  4XIG Q;  4ZED A;  3U93 A;  1LFG A;  3T93 B;  5H37 D;  2QEN A;  3GQ4 A;  4RJZ A;  3N26 A;  2XXH A;  1NHG C;  3I3V A;  3OSQ A;  4A3V B;  4FWD A;  1TFD A;  5A5X B;  4G6Z A;  2V3Q A;  3C31 A;  1FQB A;  3FUX A;  5FTM A;  5AA2 D;  4HTG A;  3H6V A;  2DVC A;  1PJI A;  3FD3 A;  3AXF A;  3HKP A;  2EO2 A;  3RGY A;  1Q35 A;  2QZ4 A;  4BDQ A;  1MRP A;  2YR0 A;  2FYI A;  2I0C A;  3H3G A;  3J7B A;  3SAV A;  2EA0 A;  3DP4 A;  4G8H A;  2F35 A;  1EE8 A;  3R9X B;  3KN7 A;  5ITX E;  5H8Q B;  1Q1K A;  1AOV A;  4U23 A;  4LFC M;  3MW0 A;  2LNH C;  2Y7K A;  1FQE A;  4R6K A;  3V89 B;  1RYX A;  3E9X A;  1B3G A;  4R6H A;  1US4 A;  4C0R A;  4L4U A;  1R1N A;  4MBP A;  1N7W A;  3S9E A;  1LLS A;  3UOR A;  2KEB A;  2QJE A;  2UUC M;  2Y7P A;  4GKK M;  2UVG A;  3IOR A;  3J2P B;  5JTY A;  3ILU B;  1DGH A;  1FNN A;  1B1X A;  4GVO A;  2GHB A;  3FJ7 A;  3IB2 A;  4QHS A;  1II5 A;  1MQG A;  5TPA A;  3FAT A;  3VVE A;  1DTG A;  4NF5 B;  1IZ1 A;  1N75 A;  4XKR A;  1CE2 A;  1BLF A;  4KYS A;  3WAE A;  4KQP A;  2XEP A;  2O51 A;  4RYA A;  4QNM A;  4PFY A;  2XZF A;  4YB7 A;  3LUY A;  3CG3 A;  2YJP A;  5L9M A;  1M5D A;  1M5E A;  3H4M A;  3U6L A;  3L6H A;  3O66 A;  4B3S M;  5BR8 M;  3K1M A;  3KDS E;  4R7G A;  3C4M A;  4MH0 E;  1B05 A;  3G7W A;  4JWX A;  2ERC A;  4R2F A;  4POX A;  5ITP A;  3N5L A;  3GRV A;  4JI1 M;  3GRR A;  4ZEK A;  2KZU A;  3FYC A;  4ZE9 A;  3U61 B;  3CTW B;  5CBR A;  3HJS A;  3KS4 A;  1N36 M;  1MY4 A;  3PUV E;  4I5S A;  1H44 A;  2R46 A;  1URS A;  3B6T A;  5CMB A;  3KEI A;  1Y3Q A;  4GWO A;  3C9H A;  3FUV A;  2DXR A;  3GBA A;  2ZAM A;  5L9S A;  5DNY A;  1PM5 A;  2G93 A;  5CM6 A;  4R73 A;  2D7H A;  2HAU A;  3EPE A;  1IBL M;  3U92 A;  1XWI A;  1M5C A;  3ZKK A;  1B46 A;  5M2V A;  1MPC A;  2VGQ A;  1N3W A;  3R26 A;  3W9V A;  4E0X A;  3PFI A;  3O9P A;  4H5F A;  4PDG A;  2UUA M;  1J09 A;  1L1Z A;  2XFT A;  1XT8 A;  2B3F A;  4F22 A;  1SYI A;  1FTL A;  3M0E A;  3GLH A;  2ZBK B;  4R6Y A;  4GH9 A;  4PET A;  1QAQ A;  3FYD A;  4AB6 A;  5H8F A;  5I84 A;  3MHV C;  3FVN A;  1MPB A;  4ISU A;  4FJP A;  4H67 A;  3KGC A;  2DE4 A;  1R6B X;  5I2K A;  1LCT A;  4M9Z A;  5IAI A;  1O7T A;  1OVT A;  3HHG A;  3V83 A;  1TH2 A;  2UXB M;  3T9X B;  1OQG A;  3WHK A;  4X62 M;  5TPA B;  1HQY E;  3K0V A;  3SAS A;  3GXA A;  4RA1 A;  3D4C A;  3HWS A;  4FE8 A;  5IT9 S;  3SAT A;  3FTC A;  2L6O A;  1B7H A;  1NL5 A;  5C1B A;  4O3B A;  3E9S A;  4RF1 A;  3KJT A;  3SAW A;  3U6M A;  4GMQ A;  2R65 A;  2J7N A;  5EP4 A;  3JAM S;  3QAU A;  1YAE A;  5ICT A;  2QBY B;  1ZJL A;  3IOW A;  2DOJ A;  3W9W A;  3RGS A;  2UVI A;  5KQ8 A;  2W82 A;  5F1Q A;  3TMG A;  3SET A;  4RY1 A;  1IY2 A;  5H8S A;  2R18 A;  1L5T A;  4YB6 A;  3GPU A;  4I8O A;  4OMB A;  3LSF B;  4YZZ A;  4NF8 A;  3TQS A;  4LRS A;  5CC2 A;  1ZLQ A;  4IBK A;  1A55 A;  3IK6 B;  2Q2E B;  4DXC A;  4ZZA A;  4EUO A;  1XNR M;  2YFQ A;  3GLB A;  4BLA A;  4DR1 M;  3VLV A;  5L9O A;  1GTK A;  3AL0 C;  3VLW A;  1SBP A;  5KPZ A;  3VXB A;  1JVX A;  3K6U A;  4PDI A;  4PFU A;  5I58 B;  2XXT A;  2XLJ A;  4XKQ A;  2DWN A;  4AKH A;  4G8N A;  3M3L A;  4EXK A;  3NWL A;  3GQ3 A;  2C99 A;  3TL4 X;  4NL4 H;  3U6D A;  4GXS B;  2M5Z A;  3UMM A;  4OW0 A;  2P0S A;  4C1U A;  4X65 M;  3UGJ A;  3GP1 A;  3G3K A;  5I57 A;  2V1U A;  4DV5 M;  1H6U A;  2I6E A;  4YHH M;  3S9M C;  4FWG A;  3ONM A;  3GLH B;  4D81 A;  3UIF A;  1MXZ A;  5H8F B;  2FE8 A;  2Q9T A;  4F2O A;  1LAX A;  5JEI A;  2L7I A;  2Q8J A;  3U6E A;  2LH0 A;  1NNK A;  3IX1 A;  5FHO A;  3T9V A;  4GHA A;  3PMX A;  5I2K B;  1IN7 A;  3W0F A;  1N7X A;  1QAM A;  4X1D A;  4EXL A;  3AFH A;  4QHQ A;  2OJT A;  4LF8 M;  2EUC A;  5IWA M;  1M5F A;  1MXU A;  4B7F A;  3O6I A;  4IO3 A;  4ZZE A;  3M6A A;  3ZSF A;  3VXC A;  5FTH A;  4JI5 M;  1XMQ M;  4D80 A;  5ITO A;  2CHQ A;  1MM7 A;  5I59 B;  1F9B A;  2YNM D;  2CV2 A;  4AG6 A;  3SEV A;  4LJ8 A;  2AYS A;  1SD3 A;  2OWS A;  4OYV A;  1KSF X;  4LVQ A;  2FNA A;  2XXW A;  5FHN A;  2R6G E;  4G68 A;  5J1D A;  3VDU A;  3MUQ A;  3FTE A;  4L8R C;  3HU2 A;  2IEE A;  2OZZ A;  4NE4 A;  1R7R A;  4U1Z A;  3A3C A;  5DVF A;  2PVU A;  4DV6 M;  2GH9 A;  4G2Z A;  4OHN A;  4PFT A;  4M9X A;  2ZNU A;  4JWO A;  3MVW A;  4NF8 B;  3FVG A;  1MDQ A;  2X7P A;  3L27 A;  1NJG A;  2H99 A;  4KR5 A;  2XF3 A;  2PBW A;  2FFJ A;  5EHS A;  5A2Q S;  4Q5T A;  2RC9 A;  1MXV A;  2I4C A;  4N6P A;  4O3C A;  3JV9 A;  4G8M A;  3QSL A;  2F78 A;  3T9H B;  4P11 A;  1GVN A;  3SBJ A;  1EH3 A;  1JET A;  3N6T A;  4WXJ A;  1HT2 E;  2KLF A;  4Z0I A;  2KW0 A;  1L2D A;  2OCU A;  3HHY A;  1O63 A;  1DO2 A;  3U6S A;  4GKJ M;  1SDX A;  1R2Z A;  2A5S A;  5EYF A;  5I57 B;  3DM0 A;  2ESN A;  1T0K A;  3OO8 A;  4JI2 M;  4R9G A;  3SEU A;  2ZYN A;  1ZAE A;  3KOX E;  2F5P A;  1B32 A;  5H8N A;  1N3X A;  3R7X A;  1B51 A;  3AJI B;  1DGG A;  1PB7 A;  1Z7N E;  1N78 A;  3FXR A;  4OX9 M;  2G29 A;  4TLM B;  4F2Q A;  3FKE A;  3FXQ A;  3ILT B;  3VE1 B;  3B9P A;  4DUY M;  3SEX A;  4LG2 A;  4IBJ A;  3GLG A;  2G5G X;  4YKJ A;  4X9T A;  1LAH E;  3S2V A;  2QCU A;  2HEU A;  3A3U A;  1W5S A;  1B3E A;  3KSX A;  1IXI A;  1NY6 A;  4GIP A;  3C35 A;  3E13 X;  2RGO A;  4FED A;  5I2N B;  3J81 S;  4U2R A;  4LFA M;  3SHF A;  1US5 A;  1NY5 A;  1B9J A;  2DE3 A;  4BLC A;  4TLL B;  3HHX A;  3LR1 A;  3QAX A;  1IN6 A;  3OEL A;  5KPR A;  3GZG A;  2A5Y B;  3SAR A;  2BJV A;  1FJG M;  1MH3 A;  2O7I A;  4K0K M;  1E9R A;  1TT1 A;  3OO7 A;  4OQO A;  4LJ4 A;  4KOD A;  4LQ5 A;  4POW A;  3MPL A;  4G68 B;  4JDF A;  2I7P A;  3TEL A;  3FJM A;  1IN4 A;  3MJ5 A;  4CGY B;  1URD A;  2F36 A;  4YMB A;  4AKG A;  4F3P A;  4JV5 M;  2QS3 A;  3OSR A;  4F1U A;  1NH8 A;  3QXM A;  4PE5 B;  4MGZ E;  4Z8X A;  2YLN A;  1IXC A;  4ONY A;  3QWL A;  1OFH A;  4JB7 A;  1PBP A;  4N07 A;  4F18 A;  4WED A;  3KP0 E;  4AW4 A;  3KFM A;  3TQL A;  4JWY A;  5ISU A;  3OD7 A;  4JXI A;  5H8Q A;  4FCW A;  1PEB A;  3T38 A;  3K01 A;  1PC3 A;  4CIS A;  3SER A;  3TDJ A;  4NF4 B;  3PD8 A;  4KHZ E;  2Z4R A;  1AIV A;  2NQ8 C;  3KS8 A;  1BTJ A;  1XHY A;  4Q8R A;  3I51 A;  4X66 M;  4LCB A;  5I56 B;  4TOZ A;  4M0W A;  4LA9 A;  3ECR A;  4IGR A;  1DOT A;  4DXB A;  4M4G A;  4JN6 A;  4R2B A;  3RN8 A;  3TAJ A;  1XOC A;  1TH3 A;  3CR9 A;  1TDZ A;  2CEA A;  2KZS A;  1G3I A;  3K8Z A;  3O6G A;  3MZ9 A;  3EIE A;  3FXU A;  4IO4 A;  4AQY M;  3LVV A;  3UA8 A;  2QMW A;  4HL4 A;  4QSD A;  4Z6Y A;  4EQ7 A;  4U4X A;  4GXA A;  1BKA A;  4GRK A;  4IBC A;  1Z59 A;  2Z3X A;  2ONS A;  3IOT A;  3OEM A;  3GRU A;  3FVO A;  1YPN A;  3C33 A;  3TE6 A;  3K00 A;  3Q8X A;  3GPY A;  1XC1 A;  4EF2 A;  3UK6 A;  2NVU B;  4F29 A;  1IN5 A;  2HFB A;  1GV8 A;  1NNP A;  1DO0 A;  2L09 A;  2FNC A;  3O2A A;  2VQF M;  1IXH A;  2YPN A;  3SMS A;  1A8F A;  4KFQ A;  4DIG A;  1DSN A;  2XXU A;  3M8U A;  1G8P A;  4JI4 M;  3RE8 A;  3PNY A;  3PPR A;  2J7O A;  3RT6 B;  4MLQ A;  3EIH A;  4DR7 M;  2DYX A;  4R9F A;  4ELO A;  1JR3 A;  3HJ8 A;  4B7H A;  4I8C A;  1XS5 A;  1QUL A;  2DWM A;  2G8L A;  5AA1 A;  2REG A;  2YQZ A;  3EHU A;  4FCV A;  1S3S A;  2XXY A;  3U8Q A;  1B6H A;  1L1T A;  1HNW M;  4GIT A;  3VKH A;  3D4G A;  1MQH A;  1JW4 A;  1SW1 A;  4CHT B;  3TYH A;  3M7G A;  1AMF A;  4LF6 M;  2LXE A;  1MDP 1;  2F5Q A;  3SC3 A;  5IRE B;  4FWH A;  1N33 M;  4TQU Q;  3RTW B;  4LJA A;  1O64 A;  3LQQ A;  5EXT A;  5ITU A;  3H6W A;  1B4H A;  2C5R A;  4QFL A;  4IBD A;  3T22 A;  1UTH B;  1VDD A;  3FV1 A;  1HNX M;  4AG5 A;  4BBA A;  2XD3 A;  4JSO A;  2O7U A;  4OET A;  3VDP A;  4QF9 A;  3J80 S;  4LZ7 A;  5CMC A;  4U21 A;  3GBB A;  4P0G A;  4YKP A;  4P16 A;  1JVY A;  1ZKB A;  4U4S A;  4NXM M;  3TPA A;  5EP2 A;  3K1N A;  3PU5 A;  2XX9 A;  1UM8 A;  1H43 A;  3I4V A;  4GC9 A;  4M0D A;  2R62 A;  4R74 A;  4F1Y A;  3PPO A;  1E9S A;  1Q39 A;  1B5J A;  2QBY A;  3PPQ A;  5EXX A;  2HAV A;  1L2C A;  1Y4T A;  1NMU A;  4IB2 A;  5DVJ A;  3RFW A;  2Z8D A;  2F4V M;  4Z7E A;  1K3X A;  3GLF B;  3VV5 A;  2F7B A;  4E0W A;  3K2L A;  1WOD A;  3IAZ A;  1ZIU A;  3HPI A;  4RXL A;  3DZD A;  1Y4C A;  3KOT A;  3I6V A;  2DSF A;  1YTV A;  3FTD A;  4ELP A;  5FHM A;  5HM4 B;  5ICQ A;  4B3T M;  3RLF E;  5CMK A;  4JBZ A;  3H6T A;  3Q25 A;  2UXD M;  3MVY A;  5I58 A;  3CI8 A;  4LZZ A;  2R4J A;  2XXX A;  4RK9 A;  1GL6 A;  3RPW A;  1QVR A;  4TUW A;  1I4W A;  4BDN A;  4FAT A;  3CSG A;  2GRV A;  3UP9 A;  1XXH B;  1EZP A;  3K92 A;  1C1K A;  2DZO B;  1MXW A;  1NKX A;  4H65 A;  2L7H A;  1X37 A;  3BFT A;  1P1W A;  2ZAN A;  4GL0 A;  1IXR C;  1SXJ B;  3A09 A;  3HST A;  4GOT A;  3RTF B;  1IQP A;  5ITR A;  3L6G A;  1D4N A;  3ZS6 A;  1LFH A;  2I7N A;  4IJF A;  1ORY B;  5DT6 A;  4GRI A;  2DS9 A;  4IGT A;  3FZV A;  4YMA A;  4PFW A;  4IJE A;  2LAO A;  3U6O A;  4GC5 A;  1NNF A;  3DP6 A;  1H76 A;  4OVZ A;  3TTN A;  2DHR A;  3P7I A;  2X8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...