3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
4GWOA 2VOZA 5CC2A 3SEVA 2F97A 4XKRA 1HSLA 2REGA 1SD3A 4R72A 5FHMA 3H06B 3SERA 2XXTA 3GZGA 2AYSA 3OOAA 3JV9A 4LATA 1SW5A 3MQ9A 3W9VA 1MPDA 1SW4A 1B5JA 4IO7A 2NOOA 3CFXA 1Y4CA 5H8NA 3MVXA 1NNFA 2E0SA 3T96B 1EU8A 1OQHA 3G7WA 4RNSA 1B3GA 2QRYA 1N7WA 3HSTA 3S4UA 2R9JA 1Y4TA 2F6GA 2ZNSA 1NFTA 2OBGA 3TYHA 2H9BA 3TCFA 4F31B 3SETA 3GLBA 5DVFA 1P1NA 4F22A 4H8IA 4P11A 3TCHA 3VLWA 3FATA 2I49A 1IZ1A 3N94A 1M5EA 3OENA 1IXCA 2H98A 3SEYA 2VD3A 2XHDA 1AOVA 1MDP1 4EQ9A 3S9EA 4OHNA 1Z7NE 4Q5TA 2GH9A 4F1UA 3HCQA 4NF4A 4MFIA 2VD2A 3E9XA 3H3GA 3OO9A 1LAGE 1A54A 2DQVA 2OLBA 2ZYMA 1H43A 3KGCA 3S2VA 5CI5A 1FCKA 1N76A 1QKBA 2D21A 3LC8A 3ZKKA 3O9PA 2UXAA 4BLAA 1Y3NA 4MLQA 2Q2CA 1N84A 1MXXA 4U1ZA 1SW2A 2REJA 1SI1A 4I62A 3FV1A 3LSXA 1J1NA 1B52A 5I58A 2M8CA 4OQOA 3DP8A 3FVGA 3UA8A 5I84A 4OESA 1FQEA 1Y3PA 1UIVA 4JWYA 3RN8A 3FVKA 3K4UA 3PU5A 3IOTA 1OLAA 1B32A 1XOCA 1LAXA 4GL8A 3TTKA 1USYE 3VXBA 5L8DA 1OVTA 2RCBA 5ITPA 4OFLA 1MY3A 4FE8A 4KCDA 2KLFA 2I0CA 5DT6A 2XX9A 3VLVA 4PETA 1GTKA 4H6DA 4AQ4A 5AA4A 1B3LA 2NXOA 2PT1A 2XXRA 3I5OA 4ZZAA 1OLCA 4F2OA 4F39A 4IY5A 5I59B 1USYH 2XXWA 3TDJA 4DXCA 5KCJA 3K6UA 1AL3A 1YCJA 1M5DA 3K01A 3OO6A 4JSDA 2UVHA 3V8XB 2CZLA 1P1UA 5HBCA 2ABHA 2BJJX 2YPNA 3MW0A 4OEUA 4OFJA 3TAJA 1P1WA 3IJXB 2WKYA 1B1XA 4LZ5A 1SDXA 1QKAA 1MRPA 4OZ9A 2Y7PA 5DEXB 4ZE8A 4U23A 2O84X 2Y7IA 1B9JA 1B1HA 1LGBC 4I8CA 3CG1A 1DPEA 4RK2A 4TOZA 5K2XA 2ZYKA 1H45A 3IB2A 4R2FA 4ESXA 1B0LA 3V83A 1P1OA 4YB5A 1FTOA 4JDFA 3IOWA 2F35A 2DE3A 5H8QB 4IO4A 4NF5A 5FHNA 4EUOA 1B4ZA 4RXLA 2O68A 1PEBA 2QMXA 3PMWA 1LSTA 2DYXA 3PUWE 4G8MA 5AA1A 1A99A 4O3AA 3QUFA 5H8HA 1IUDA 1URSA 3MP8A 3C4MA 4KCCA 2H4IA 3KSXA 1ZJLA 2I58A 4QSCA 4ELOA 1YTVA 1SBPA 4YKJA 1A8FA 3DM0A 1P99A 3O97A 4ZS9A 1H3DA 3T9VA 5I2NB 1MM7A 3D4CA 1URDA 1XC1A 3T22A 1KWHA 3OMBA 4HS7A 3EN3A 4NTLA 3QSLA 4RY1A 2E1SA 4EXKA 2DOJA 2X7PA 1SQYA 1VR5A 2P2AA 4OEVA 4XTCQ 2Z8FA 1US4A 4TLLB 2RKMA 1JEUA 1QJMA 1ZBMA 2OJTA 3K00A 1MQIA 5FTHA 5IKBA 1MS7A 4DIGA 1FTMA 1QW0A 5DVIA 3ZS6A 4K3FA 1JETA 5L9MA 1ZU0A 2Q9TA 2V3QA 4YICA 1N04A 1B6HA 4N6PA 3KN8A 1LB9A 5M2VA 3T66A 3PPQA 1AH5A 4GXSB 2GHAA 4NEDA 2RF1A 3G3GA 2QS4A 1SYHA 2XXVA 1B40A 1POY1 3PUYE 1II5A 4H67A 2F6PA 5CBSA 5JEIA 3T9UA 1QUJA 1JEVA 1GGGA 4ZDMA 2F5XA 1UQWA 3KEIA 3JYRA 4BDMA 2HQ0A 4OWDA 1FQBA 4U4XA 1NNKA 3LR1A 1MH4A 3OEKA 4HW8A 1NH8A 1MY4A 4H0WA 4LZ7A 5EHSA 1GV8A 3C35A 3O6GA 4MF3A 4THIA 3FXUA 3U92A 4GOTA 3PUZE 4C1UA 2O1LA 1XT8A 1FQDA 3A3CA 1WDNA 3IAZA 3IO4A 2XXXA 2Z8DA 3VDFA 1Q35A 1O63A 3B7DA 1YPNA 3O29A 3FIRA 3QUJA 1EH3A 3L6GA 3LUYA 1M5BA 1Y3QA 2OWTA 2R6GE 3N6TA 4LA9A 3IOVA 1A55A 4ND9A 3RQTA 3TUSA 4YAHX 1BKAA 1NKXA 3O6IA 4X1BA 1UTHB 5I57B 3TQLA 3FD3A 1EZOA 1N3WA 4POWA 1CB6A 2XXQA 1A8EA 2XXHA 3QXMA 3A3UA 1VFDA 1Y9UA 2HAVA 3GBAA 4JWOA 4QF9A 3W9WA 2AL4A 2DE2A 3H6VA 3HHGA 4P0IA 2XX7A 4EF2A 1IIWA 1Y1MA 2XXYA 3MVYA 3OSQA 4JB7A 4YMBA 5ISUA 2P0SA 5JTYB 5BWJA 1SW1A 2PMSA 1MXYA 1LAFE 3JZJA 3RT6B 1MXUA 3K1PA 1BLFA 3UN6A 3T93B 3KSJA 1NNPA 2HAUA 2H5YA 1LB8A 1MY1A 2OCUA 3TTRA 2B3FA 2NVUB 3CIJA 1RKMA 3KJ7A 3GBBA 3G3FA 5AA2D 2B3BA 5CBRA 5CMBA 4Z0IA 4OETA 2I4BA 1ELJA 1JVXA 3PUVE 5LOMA 5AA4B 3RTFB 1IXGA 4KQPA 2AL5A 1PBQA 1B7HA 5IAIA 2Q88A 2D3IA 3R6UA 3AXFA 4H5FA 2V3TA 2I3WA 3O6HA 1FTKA 3FJGA 5AA3A 3KFMA 4DE8A 2X26A 4OMBA 1H76A 1MXVA 3F11A 3H6WA 2Q89A 3K6VA 4IB2A 4PQJA 4R9FA 4RJZA 3VV5A 3O2AA 4NMYA 4BDNA 1LFHA 3EHUA 3IB1A 4U1OA 3IO6A 1MQJA 1DOTA 5K2YA 5CM6A 4YKPA 4YKKA 2ZYNA 1R6ZA 2O7IA 1DMBA 3DLNA 1QUIA 2DXRA 1JW5A 3ILUB 4KD5A 3U72A 2ONRA 4NF8B 3K1MA 2V93A 4ZEBA 1ZLQA 4G8HA 1TFDA 4C0RA 2DVZA 2Z22A 3CRBA 3MBPA 4KYDA 4BDRA 4GRKA 2O1MA 1IEJA 3PPPA 4FJPA 4G68B 4KI0E 1XS5A 1P1QA 4IO5A 4NF4B 3TTLA 2QS2A 3M3KA 2QSXA 4ZEDA 4GL0A 3LBSA 3PPRA 3UP9A 5EHMA 4ZEIA 5BUUA 1YAEA 1RYXA 4ONYA 4GD5A 3ZSFA 1LBBA 3D4GA 5A5XB 1EZPA 4ZECA 4TQUQ 3B6QA 3M3FA 3QK6A 3TPAA 1S50A 3RNNA 1S7YA 3HV1A 4ZZEA 1MQDA 2A5SA 3Q29A 2FA7A 3ZKLA 5ICQA 1JNFA 3VXCA 1HSEA 2Z8EA 4IGTA 1XHYA 4MH5A 1H44A 4DCYA 4TLMB 4E0WA 2F7AA 3OSRA 1MG1A 4JXIA 5KCJB 3MAMA 3C9HA 4O3BA 1B5HA 2OK2A 3T9XB 4LQ2A 3KBRA 4Q8RA 2A5TB 1PB9A 4U2RA 5H8FA 3MP6A 3U94A 4QFLA 1B58A 5F1QA 3OEMA 4YU0A 2QS1A 3O28A 3VLUA 2O7UA 3C34A 4PFYA 4DDDA 1B7UA 2CMOA 2HFBA 3BBRA 4IY6A 2ZNTA 3TMGA 4R74A 3MVZA 5KDTB 5B70A 1LAHE 2DE4A 3QYTA 3SEXA 1O64A 3FVOA 3IB0A 2X7QA 4NWDA 2ZYOA 4XXUA 4HCWA 4QFPA 3S9MC 4RYAA 2DP8A 5H8QA 1TFAA 4FORA 3FZVA 4U22A 3H6UA 4PFWA 3OO7A 3IOUA 2G93A 3VVEA 3ODBA 1NH7A 4G77A 1WODA 1B2HA 3QAXA 2O51A 4IO6A 2AIXA 3H6TA 4QFKA 5CMCA 4NF5B 1L5TA 3CFLA 4LUBA 3SEUA 4LVQA 5H8FB 2D5WA 3PMVA 3PMXA 2FNCA 2Y7WA 3FV2A 5AA2B 4WKMA 2UYEA 1MPBA 4FAJA 2F36A 1N3XA 3M8UA 2I3VA 1UTHA 1FTJA 2DXYA 3VVDA 1NMUA 5I57A 2PYYA 5AE4A 4GLIA 3FVNA 3HHFA 2QS3A 4BDLA 3CR9A 5CMKA 3TQWA 2XXUA 1MY2A 4G4PA 1ZTYA 5F7VA 5KDTA 3LSLA 3KN3A 3R26A 3MPKA 4GQOA 3KZGA 1IXIA 1FQCA 1GR2A 1MQHA 2UVIA 3HN0A 3A09A 1OIBA 4PFUA 5CMMA 1MQGA 3PUXE 4EQBA 2F7BA 2HCAA 1MY0A 4XKNA 4N13A 4F18A 1MDQA 4N07A 3UORA 3TTMA 2PX1A 1B3FA 2Y7KA 3C32A 1ZKBA 3WAEA 5I2KA 2UVJA 1MM6A 3H7MA 1HSJA 4LP2B 2I0BA 1LCFA 3PPOA 4MBPA 2GRVA 4KYSA 4YB6A 2Q2AA 1BTJA 3K6XA 4ISUA 4LQ5A 3BKIB 5TPAA 3V5AA 4ECFA 1AMFA 1B05A 1DTGA 1F9BA 3FXRA 5DEXA 2ZNUA 3GXAA 3RLFE 3U93A 4ESWA 4BDOA 4F3SA 3TODA 4I9DA 1Y20A 1MH3A 4R6HA 1A40A 3FXQA 3B6WA 1R9LA 5TPAB 2I4CA 3VE1B 2HZKA 2IA4A 3PD8A 3V89B 3BFTA 1LFIA 1OMPA 1N0TA 1SI0A 4C1TA 3S9LC 1GVCA 4HTGA 5I2KB 5DYHA 3CSBA 3EPEA 4EF1A 1I6AA 1D9VA 4YMAA 3HPIA 2RC7A 3G3KA 3K02A 4F1YA 3I6VA 4QRZA 4G68C 4R9GA 5I56A 1WVJA 4OFOA 4KHZE 3FUZA 3CFZA 3IJOB 4PP0A 4F2QA 2ESNA 3EHSA 3Q28A 4E0XA 1ZMGA 3E3KA 3TKDA 3EQ1A 3FGSA 2RCAA 3MZ1A 3PV0E 4QFNA 3SESA 3U1OA 4Z7EA 2RINA 1UTBB 3DP4A 1Q1KA 2ALUA 2F7CA 5DVJA 2P1SA 2VP1A 2Q8JA 3RPWA 4AB5A 2ANJA 1B51A 1NL5A 1PC3A 3SEWA 2XXIA 3K6WA 3FJMA 1EZ9A 3O66A 1IQ7A 2HEUA 3IX1A 4QSEA 5H8HB 3OO8A 1LCTA 3I3VA 4R75A 1LBCA 3RT8A 4DXUA 4AB6A 5FHOA 4F29A 5TP9A 4F3BA 1URGA 4RK9A 4FATA 4IGRA 4R2BA 4WXJA 3N6UA 3T9HB 3UK4A 3W15C 3L6HA 4LONB 4DLDA 4F19A 5J1DA 1I6QA 1PDAA 4G2ZA 1UIUA 4U21A 1B0HA 2DWHA 2I48A 2ONSA 3ILTB 4MLVA 3TTNA 4BDQA 2QJEA 2ZMBA 1MXZA 3ONMA 1T0KA 1FTLA 5HM4B 4QSDA 5L9SA 1R1NA 4X9TA 4ZEKA 1LLSA 1PB7A 4GXAA 1VSOA 4OYVA 2OWSA 1I6BA 2H99A 2PT2A 3MPLA 3K1NA 4OTEA 3KJTA 4XIGQ 1IITA 1M5FA 2F34A 4PE5B 1POTA 3CVGA 2YLNA 3BFUA 3N5LA 4KPTA 1BIYA 2UYFA 4H65A 1N7XA 4GFRA 5I59A 3G3HA 1B46A 2DSFA 4H5GA 3E13X 4I1DA 5AA2A 4R73A 3MC2A 3DP6A 5DTBA 1MPCA 2W7YA 3FJ7A 3IK6B 1US5A 3MWBA 3MZ9A 3H03A 4XKQA 3CSGA 4F1VA 3CI8A 4OENA 2IEEA 4X1DA 3VFJA 3U8QA 1XVXA 4ZEFA 5A5XA 4WEPA 3PD9A 1I69A 4U4SA 4NE4A 1NNTA 1FQAA 1PBPA 3B6TA 4Q30B 3THIA 4GIZA 4YKIA 2F78A 2ONKE 3LSFB 4ELPA 1PB8A 1JVYA 3UGWA 2PVUA 3MVWA 2I6EA 3C33A 5JTYA 4R6YA 1OVBA 5EYFA 3IL1B 2F8DA 4POXA 2R71A 4OERA 3RTWB 4L17A 2Y84A 3TEPA 1MXWA 3KOSA 1XVYA 4FECA 1QULA 3PPNA 2YJPA 4OVJA 3TELA 3VVFA 1CE2A 4GF8A 4P0GA 1RYOA 4F3PA 4YZZA 5L9OA 4JSOA 4RA1A 5KZTA 1FW0A 2DVCA 3OXNA 2O6AA 1Y1ZA 3KOTA 2Y7RA 3LSWA 3RUMA 2FYIA 4EXLA 1UTBA 2DWAA 3FASA 4RPOA 4UA8A 3R7XA 3G3JA 5JK4A 1QVSA 1B3EA 2QPQA 4NWCA 3PGFA 4PFTA 1B4HA 1JW1A 3QIMA 4R6KA 2PBWA 3M3LA 3C36A 2OZZA 2ZXTA 3MUQA 5H8NB 2XD2A 3C31A 1ANFA 3OD7A 1ATGA 4IO2A 4JBZA 4DXBA 3EHTA 1S9TA 1TXFA 3G3IA 4X48A 1SYIA 5ICTA 2UVGA 1JQFA 1OQGA 1D9YA 3WAFA 2H25A 3S9NC 3KN7A 1BP5A 3H4ZA 4NF8A 5H8SA 4KR5A 2V3UA 3USDA 4YB7A 3Q25A 4UACA 3OELA 3UIFA 1VE4A 5HPQA 5B7DA 4DCXA 4F3GA 4FIMA 2B65A 2NWJA 1TWYA 1B5IA 4G68A 3SDFA 2VGQA 4ELQA 3K0VA 1D3KA 1A7LA 1B3HA 3IR1A 3N26A 1D4NA 3HO7A 3KG2A 2O69A 1M5CA 4H1XA 3MZBA 2XX8A 1VFEA 4JWXA 1DTZA 1IXHA 2DWIA 3K2DA 3MP1A 1O7TA 3DELB 4M4GA 4NF6B 1ZIUA 4QHQA 4IO3A 2HXWA 3Q26A 2DS9A 4QFOA 2QL3A 4RPNA 5TU0A 2DWJA 2RC9A 4FEBA 1AIVA 3EF7A 1DSNA 5ELVA 4DZ1A 1R9QA 2HZLA 3SKPA 1Z7ME 3P7IA 3MJNA 4Q0CA 4XKPA 4WEDA 3CG3A 4ZE9A 5I2NA 3TCGA 4O3CA 1LFGA 4OXVA 5CRYA 2A5TA 2GFEA 4HCYA 5I56B 1B7ZA 2V25A 2VHAA 2XXPA 1SVXB 2LAOA 4G8NA 4GVOA 4LZ8A 5ITOA 3TZAA 5I58B 2XD3A 1TT1A 2NUVA 3Q27A 3RY3A 1FQFA 5TP9B 4EQ7A 1QUKA 3E4RA 4KYEA 3TFLA 2V84A 4ELRA 4NF6A 2G29A 2GHBA 2QMWA 2RC8A 4KFQA 1DPPA 3IORA 5FTIA 1JW4A 4H8JA 4EDPA 2Z23A 3RGYA 2THIA 3ECRA 4FEDA 4M1VA
chains in the Genus database with same CATH superfamily
1YSYA 2DHRA 4MGKE 2LBCA 4KT0F 1HSLA 1FSAA 3H06B 1UFZA 3OOAA 4M9SA 4NL4H 3Q8XA 4JI3M 1R5LA 3MHVC 4L4UA 2QRYA 2ZNSA 1VQ1A 1NFTA 1Z6TA 3TCFA 2PFZA 2H1RA 1EYKA 2XWVA 3SETA 4F31B 1IXRC 4F22A 4P11A 4LJ7A 3W0FA 2V4CA 3OENA 3R9XB 1W5TA 2QCUA 1QYRA 2K0BX 4OHNA 4MFIA 3H3GA 3JR5A 3DA1A 3ZKKA 3JAMS 2UXAA 3B9PA 3O9PA 1Y3NA 4PAIA 2Q2CA 1N84A 1SW2A 3J2PB 2XFSA 4I62A 3B7QA 4JXJA 1J1NA 4IBJA 5EYGA 5I58A 2M8CA 3FVGA 3RFWA 4JWYA 4PCDA 1R6BX 3FVKA 3PU5A 4GL8A 3VK7A 2FE8A 4D80A 1AWBA 3VXBA 2RCBA 4FE8A 4H6DA 1OAIA 4TUWA 1B3LA 2NXOA 2PT1A 4F2OA 2Z3XA 5KCJA 2XXWA 4LRTA 3K6UA 1M5DA 3V8XB 2VF8A 2CZLA 1PJQA 4OFJA 3M0EA 2WKYA 4MEVA 2OPFA 2Y7PA 2O84X 1PJJA 2Y7IA 4TOZA 2ZYKA 4R2FA 1FTOA 2L4FA 3THGA 5H8QB 5FHNA 5AA1A 1A99A 1URSA 4BBAA 5F24A 1NHGC 2KR0A 4YKJA 4GHAA 3QAUA 1A8FA 3DM0A 3O97A 1H3DA 3D4CA 1XC1A 4HS7A 3EN3A 4NTLA 4I8OA 3HHZA 2E1SA 2LWXA 1Q02A 4LF4M 4OEVA 2Z8FA 3GLIB 1US4A 3FBPA 2RKMA 1GKIA 1OIZA 1MQIA 1MS7A 3ZS6A 4K3FA 2QHOB 4P17A 1N32M 1ZMUA 3T66A 3KN8A 2W82A 3PPQA 2RF1A 1L2DA 2F6PA 5F3WA 5CBSA 3U6CA 3VFDA 4ZDMA 2Y0TA 4QBAA 4U4XA 3LR1A 2K47A 1NH8A 1MY4A 3KFUG 1GV8A 2V1UA 4DV0M 3KBZA 2Y20A 5DFLA 1RDYA 4C1UA 3IO4A 1WDNA 1Q35A 3QUJA 3FIRA 1NUYA 3TWMA 3L6GA 2L5VA 1A55A 1OQYA 3TUSA 3KOZE 1NKXA 4PCZA 1UTHB 3TQLA 1EZOA 1N3WA 4PBQA 1VFDA 1PM5A 3MVYA 2BNKA 1OIPA 2P0SA 3JZJA 3T1YM 1R2YA 1KFVA 1LAFE 3K1PA 3T93B 2HAUA 4HE1A 1LB8A 4B7HA 1NNJA 3GBBA 4DR3M 5CMBA 4OETA 3VK8A 1ELJA 1JVXA 2ERCA 4LJAA 4KQPA 2R6FA 4XGIA 1B7HA 2CWBA 2D3IA 3R6UA 1FPDA 2V3TA 1FTKA 3KFMA 2QBYA 3BXWA 3SFZA 3F11A 3ILKA 2Q89A 1LFHA 4PAFA 2RKOA 4U1OA 3IO6A 1MQJA 1DOTA 4YKKA 1R6ZA 2O7IA 3AFHA 1K82A 4KD5A 4N8YA 1YXIA 2BJWA 2ONRA 3PNVA 3UK6A 2V93A 1ZLQA 4ZEBA 1G3IA 1V34A 2LHGA 3IG5A 2Z22A 4I5SA 4LF5M 4KYDA 1SXJE 1NI9A 1IEJA 2Y5KA 4IO5A 2QS2A 4NAPA 4GL0A 4JVDA 5A5XB 3GO8A 3B7ZA 3RNNA 1IN8A 1S7YA 2WYPA 3HV1A 4ZZEA 2K9DA 1IQPA 1QUTA 1SXJB 4JYAM 4IGTA 3AJIB 4IBBA 3C9PA 5KCJB 1MG1A 3C9HA 4GC5A 2YFQA 1IBKM 2A5TB 5H8FA 1NY6A 1ZQ9A 5FTJA 3VLUA 2B4MA 2HXRA 2O7UA 1JB0F 3K9OA 2HFBA 4YHHM 1LBYA 1LAHE 4MH0E 2QVUA 1IY2A 2ZYOA 4XXUA 1XXHB 3A46A 2FH0A 3U6MA 4QFPA 4F1IA 5I7IA 4MNIA 3S9MC 5H8QA 4I40A 4U22A 1P3QQ 3OO7A 2G93A 2YQZA 4IBKA 4M9XA 2AIXA 1L5TA 1L1TA 3PMVA 4BLCA 2Y7WA 2UYEA 1N3XA 3VVDA 2KRUA 2XGNA 1DK4A 3TQWA 2WBDA 3LSLA 3KZGA 5EHMA 1FQCA 1MQHA 2UVIA 1IN4A 2HCAA 2RGHA 1IMDA 3RGSA 4GRIA 3FTFA 3TTMA 1EIJA 3C32A 5I2KA 5FTKA 1MM6A 1Q3CA 2XZFA 3PPOA 4DR1M 4MBPA 2LVAA 2Q2AA 5TPAA 5ET6A 3EIHA 4OU7A 1AMFA 1DTGA 5DEXA 2Z4SA 3RLFE 3U93A 4ESWA 1K3XA 3T0JA 4KO8A 1A40A 3FKEA 1R9LA 2I4CA 1LFIA 1OMPA 1SI0A 3S9LC 2XWIA 4LFAM 1PGYA 1D9VA 1LBVA 4MCOA 2CEAA 3GQ3A 5JI2E 2JWSA 2OO9A 4PT5A 4PP0A 4R71A 4GH9A 3GRVA 3J7BA 3Q28A 3HJSA 2FVZA 3FGSA 4QFNA 1EFUB 2F5PA 4OVTA 2RINA 1Q1KA 3L27A 2F5OA 2ALUA 2F7CA 2VP1A 5DVJA 3RPWA 1OKSA 1FBDA 1FPLA 2ANJA 4GWYA 3RPLB 3K6WA 3W0LB 2CUZA 2HEUA 4G4QA 5DYGA 2EA0A 3W15C 3N6UA 1INPA 3L6HA 1MJGM 4U21A 4LCBA 3GPUA 3VKGA 3U65A 2QJEA 3LVWA 4H46A 3ZCBB 3I4YA 2H99A 2PT2A 3E9SA 1IITA 2BWEA 2F34A 1PJSA 3CVGA 2YLNA 3BFUA 1XXHA 4KODA 5I59A 1TTEA 3FD9A 5AA2A 4B7GA 4I1DA 2L7IA 2W7YA 4LJ4A 1US5A 3KP1E 4F1VA 3CSGA 4OENA 4ZEFA 5A5XA 4WEPA 1I69A 1NNTA 3THIA 1FPKA 4ELPA 2MKZA 1PB8A 3UGWA 3C33A 4R6YA 5EYFA 2D7EA 1GVNA 1SXJA 2VPNA 4L17A 2Y84A 3VVFA 1XVYA 2L7HA 4GF8A 4P0GA 1FBCA 1RYOA 4F3PA 3EKIA 4JSOA 1GLNA 3OXNA 4MIJA 1TF0B 3RUMA 3FASA 2Q8MA 4LN5A 1JW1A 1C1KA 4QHSA 4LZJA 1DV0A 2O5RA 3MUQA 3C31A 4FBPA 2BJVA 4CIZA 1TXFA 4JN6A 3KVWA 4GX6A 2H25A 3S9NC 4JVCA 2LNHC 4KR5A 3Q25A 2Q74A 2WSEF 1VE4A 5HPQA 4DCXA 3KOWE 2B65A 2NWJA 3MK6A 3SDFA 1VEGA 3HKPA 1A7LA 3GLHA 1D4NA 3KG2A 4H1XA 1M5CA 4JWXA 3MZBA 2X4AA 5ITXE 1ZIUA 3RGPA 4EIWA 1LBXA 1RDZA 1NHWC 3EF7A 1DSNA 5ELVA 1R9QA 2HZLA 3SKPA 2I7NA 3B89A 3MJNA 3AOGA 4WEDA 2ZZVA 5CRYA 5EXPA 1NVMA 2NQ8C 3GLIE 1NV7A 2V25A 2VHAA 4MB7A 5IZZA 4GVOA 1FPEA 4GWWA 5I58B 4A3VB 3WHKA 4L78A 1FQFA 3RY3A 2V84A 2R45A 2VDBB 4NF6A 4ELRA 3FUXA 3HY5A 3FUUA 5EJCA 4XKRA 3SERA 3LQRA 1IN5A 4GWZA 4R72A 1NSFA 4JI8M 3GZGA 2AYSA 1SW5A 3W9VA 1MPDA 3LV0A 4DR5M 2HCBA 4DV6M 3CFXA 2FNAA 1Y4CA 3T96B 3G7WA 1B3GA 1N7WA 2LH0A 2KXEA 2R9JA 2X8AA 1Y4TA 2F6GA 3TYHA 4PDIA 5LMNM 2H9BA 4G4RA 2XZUA 1HNZM 3U6SA 5DVFA 4H8IA 1GABA 3VLWA 4NOOB 3SEYA 1WR1B 2OX3A 2XHDA 1MDP1 3TE6A 4AQYM 2DZLA 2UU9M 1Z7NE 2GH9A 4Q5TA 3HCQA 4NF4A 2VD2A 2Y5LA 1LAGE 2OLBA 4X65M 2P3NA 3KGCA 4N4UA 3S2VA 3GLGB 1FCKA 1N76A 4GEWA 3LC8A 3BOSA 1QAMA 4BLAA 4MLQA 2JY5A 3K2LA 1SI1A 2REJA 3FV1A 1B52A 5EP3A 4LJ5A 2E5LM 3DP8A 4OESA 1Y3PA 1UIVA 1NV5A 1D0MA 3TTKA 3K4UA 1XOCA 3HJ8A 5DYIA 1WXQA 1E9RA 3SASA 5L8DA 4OFLA 2XX9A 2MGWA 4PETA 1GTKA 1NV6A 1DGHB 3A45A 4AQ4A 4ZZAA 3I5OA 5I59B 1USYH 3TDJA 2L6OA 2KNAA 1AL3A 2UVHA 3U6OA 1P1UA 3TAJA 1K9ZA 4WURA 3IJXB 4LZ5A 3A98B 3SATA 1SDXA 2KDLA 4OZ9A 1LGBC 1DPEA 4RK2A 3IB2A 1B0LA 1P1OA 4YB5A 4EUOA 4NF5A 4AKHA 2DI0A 4RXLA 2DYXA 4G8MA 2UUCM 4O3AA 4Q7JA 4DBGB 5H8HA 2P3VA 3CF0A 3C4MA 2H4IA 3KSXA 1ZJLA 2I58A 2CP8A 4QSCA 4WW0A 4CGYB 1SBPA 1FPJA 1P99A 3T9VA 1GJSA 1URDA 3T22A 3OMBA 4EXKA 3J27B 2DOJA 2X7PA 1VR5A 4TLLB 3H4JA 1ZBMA 1QJMA 3UZUA 1IMCA 4GX3A 4YY3M 1XNRM 1JETA 2CZKA 1W5SA 1ZU0A 4X62M 4YICA 3LQQA 5M2VA 1NV1A 1AH5A 4GXSB 2GHAA 1XMQM 5GKNA 2QNJA 1SYHA 2XXVA 4HXVA 2VIIA 2F5XA 3KEIA 1Z59A 1QZEA 3JYRA 4BDMA 4NXNM 3GLHB 1NNKA 4HW8A 3HU3A 5EHSA 4MF3A 3FXUA 1JR3A 4GOTA 2XA5A 3K1JA 1XXHE 3PUZE 1XT8A 2XXXA 4LFBM 3RQTA 3N6TA 2P5TA 4QOSA 5BPVA 2F5NA 3B7NA 4HE0A 5I57B 2DAKA 1CB6A 2XXHA 4MGIE 4QF9A 3GBAA 3W9WA 5C18A 2QP9X 2AL4A 2QVRA 3NOHA 4P0IA 5ISUA 4OVPA 5BWJA 3NWLA 1SW1A 1MXYA 1MXUA 4B3TM 3KSJA 4QNMA 3Q8GA 2NVUB 1RKMA 2F3BA 3IFCA 3PTYA 5IZ3A 2CEXA 3PUVE 1DGHA 1PBQA 1NNUC 1JQJC 2Q88A 4H5FA 3D8LA 1VDWA 3RYDA 3L29A 2XWOA 4LGYA 4H45A 3K6VA 4R9FA 4IB2A 4PQJA 3VV5A 3FTEA 3O2AA 4NMYA 1LTMA 4BDNA 3M6AA 3EHUA 5K2YA 4AG6A 2PFYA 1IY0A 1JW5A 5ET5A 4NF0A 3K1MA 2UXDM 4CISA 3VDUA 3EIEA 1N77A 4IBEA 4REZA 4BDRA 4GRKA 2O1MA 4G68B 2J5YA 2R8TA 1N36M 3M3KA 2QSXA 4ZEDA 3UP9A 1NV9A 1FJGM 1LBBA 2GQFA 3D4GA 4ZECA 2O01F 4FCTA 4S12A 3HZJA 2I7PA 3M3FA 4P1EA 4F29A 1AIPC 1MQDA 3ZKLA 2FA7A 5ICQA 1T43A 1JNFA 1G41A 1XHYA 4DCYA 3GRRA 4AI6A 4JXIA 4O3BA 3T9XB 3KBRA 4U2RA 1MU5A 4YU0A 1YZ0A 4PFYA 1B7UA 4RKUF 4NRWA 4IY6A 3TMGA 4DV2M 3MVZA 4R74A 2DE4A 3QYTA 3FVOA 4MHFA 2X7QA 4NWDA 2CFOA 1GJTA 3SC3A 4HCWA 4RYAA 2LTUA 1ZMWA 2KZSA 3H6UA 4PFWA 3IOUA 5IREB 1FJ6A 4DV7M 3ODBA 3HWSA 1B2HA 2O51A 2R4EA 3H6TA 5CMCA 4WP2A 3CFLA 4N81A 4LVQA 2D5WA 1XC8A 2LVQD 4FAJA 2F36A 3M8UA 1V92A 2I3VA 4N17A 1FTJA 4AW4A 2PYYA 4O94A 4GLIA 3FVNA 2QS3A 3CR9A 4G4PA 1ZTYA 2C99A 3R26A 3MPKA 3RT6B 3HN0A 1OIBA 4MGHA 1MQGA 4N13A 4NC6A 4F18A 3GLFB 1MDQA 3AOEA 3BIGA 4O7MA 1HSJA 2CE7A 2I0BA 1N34M 1LCFA 2RGOA 2GRVA 1T6OA 4ISUA 2KNVA 3OTOM 3FXBA 5JI3E 5DNYA 4PD2A 2DVWB 4MNCA 3FXRA 1J09A 1NUZA 4FWDA 1N75A 2UXCM 1FPIA 4I9DA 2M5ZA 1ZMVA 3FXQA 1LV7A 5L8RF 2OWZA 2IA4A 2DKLA 3PD8A 4X66M 5I2KB 5DYHA 4M0WA 3CSBA 3EPEA 4PGPA 4EF1A 4YMAA 3HPIA 2RC7A 3K02A 4P56A 1WGNA 4R9GA 5I56A 4MGZE 1LBZA 1ZMGA 2G3QA 1IXZA 4OVZA 3MZ1A 2K6BA 3PV0E 4ANRA 3HJQA 8CATA 1B51A 4Y28F 5EQTA 2HHHM 1PC3A 4PGNA 1FBPA 4R75A 1LBCA 1NO1A 1EYIA 5TP9A 4G6ZA 4F3BA 1QGXA 3FUVA 4LONB 2UUBM 4DV1M 1UIUA 2DWHA 2I48A 4P8BA 3F92A 4BDQA 2V1CA 3SAVA 1T0KA 1FTLA 4QSDA 4X9TA 4N6KA 1QVRA 4L15A 4GXAA 4OYVA 2OWSA 4XIGQ 2APLA 2DWZB 2DXIA 3FTCA 3KXEC 3G3HA 3L2AA 1N78A 4JI5M 4H5GA 4R73A 5IKBA 3DP6A 5DTBA 1MPCA 3IK6B 1XVXA 3NBIA 3PD9A 5IZ7D 4XEQA 4NE4A 1YLAA 4I3EA 4Q30B 4DI4B 1CNQA 3LSFB 1R2ZA 4OANA 2PVUA 5JTYA 3IL1B 4UN2B 1QULA 4PDGA 4YZZA 4RA1A 4GKKM 1FW0A 2DVCA 2Y0QA 2O6AA 2Y7RA 2DZOB 5KPRA 2DWAA 1E32A 4UA8A 3VDPA 5JK4A 4PFBA 4ITQA 1Q3BA 1XMOM 4GKJM 5H8NB 2XEPA 1FPGA 2OOBA 4DXBA 1JQFA 2VQEM 2MR9A 3GPPA 3GYYA 1T3TA 3U6EA 3USDA 4YB7A 5B7DA 4FIMA 3U5ZB 1PRBA 1WHCA 4ELQA 3K0VA 2WSFF 3HO7A 1NV2A 4PFIA 2XX8A 1VFEA 1IXHA 4MNPA 5IZ3B 1GO5A 3E46A 4IO3A 3FRIA 2DS9A 4RPNA 2QL3A 2RC9A 3P7IA 4DR2M 4ZE9A 5I2NA 2VF7A 3C3EA 4OXVA 2MJ5B 3BBZA 2Y21A 2FOIC 1B7ZA 2XXPA 4G8NA 1SVXB 2NUVA 3Q27A 5TP9B 2DDKA 2KEBA 4KYEA 2KA6B 1CUKA 2EJSA 1DPPA 5FTIA 1JW4A 3AKZA 4H8JA 3ECRA 4OX9M 1NV4A 1YUBA 2VOZA 1QZMA 4G4OA 3SEVA 5CC2A 1E9SA 5FHMA 4P9KA 2L2DA 1TDHA 4LATA 3MQ9A 3IFAA 1SW4A 1B5JA 4IO7A 4GMQA 1IFYA 1DGGA 3MVXA 4DR4M 4RNSA 3HFUA 3S4UA 4NHBA 3FUTA 4LJ6A 2Z4RA 2OBGA 4W5WA 5KO3A 2HPGA 1P1NA 2DAMA 4JV5M 5T3JA 3N94A 1M5EA 1IXCA 2H98A 4EQ9A 4F1UA 2XWKA 2DQVA 4PDDA 1H43A 1E94E 2D21A 3GPXA 2N35A 1HJPA 5KPZA 4JI7M 4LF6M 2UUAM 2BWBA 5FSWA 3R8FA 2X49A 2CHGA 4HL4A 3LSXA 4OQOA 5I84A 3UA8A 1FQEA 1N33M 5C1BA 3HU1A 3IOTA 1LAXA 3LVVA 1USYE 2V6ZM 1OVTA 5ITPA 2QQ8A 1S3SA 5AA4A 4UABA 4F39A 1OLCA 4LY6A 3UMMA 1YCJA 3OO6A 3B8BA 1LBWA 2C9OA 5HBCA 1XWIA 2ABHA 5DEXB 4ZE8A 4AG5A 4I8CA 1XB2B 1B9JA 1B1HA 4U23A 3CG1A 5K2XA 3FTDA 4ESXA 1H45A 2ZZWA 3V83A 4JDFA 1SXJD 4IO4A 2O68A 2QMXA 3PMWA 3SZPA 3QUFA 1IUDA 2XXKA 4PTKA 3KDSE 2C5RA 1DBZA 1MM7A 5I5PA 1FBGA 4GWXA 1KWHA 1QANA 1BK4A 1HT2E 1V33A 2PCRA 5FTHA 4DIGA 2CEYA 1FTMA 1FRPA 1EE8A 5L9MA 1OJLA 4PAKA 5E6JA 2VT5A 4N6PA 1LB9A 1NV0A 3GPYA 3G3GA 2QS4A 4H67A 1B40A 4QHTA 2CHQA 1QUJA 4PF8A 1LEVA 4PC9A 2ZANA 4XBOA 4MGYE 1FQBA 1MH4A 3QYEA 3H4MA 4LZ7A 1R4GA 4MX6A 4B3RM 3U92A 4G4NA 1IBLM 3IAZA 4JVIA 3B7DA 1YPNA 1TGUA 5EQAA 2B4LA 3LUYA 1Y3QA 4LA9A 2OWTA 3IOVA 4Z6YA 4YAHX 2VQFM 3KOXE 3O6IA 2ZAMA 3FD3A 4DR7M 2XXQA 3QXMA 3A3UA 1Y9UA 3HHGA 2XX7A 4LJ8A 1IIWA 1Y1MA 2XXYA 3OSQA 4YMBA 3PFIA 1KSFX 1MN3A 3KOYE 1VDLA 3MJ5A 2H5YA 1MY1A 3KS8A 3KC1A 3KJ7A 3G3FA 2JP7A 3FE3A 3LW5F 5CBRA 3WHLA 3AOEC 2I4BA 1IM2A 5LOMA 5AA4B 3RTFB 1FBFA 2AL5A 3AXFA 2I3WA 3O6HA 3FJGA 2X26A 4XF5A 2JY6B 2KHHA 3SBJA 1IBMM 2HHMA 3QMFA 4RJZA 3HHWA 3IB1A 4DUYM 4DV5M 1KYIA 1DMBA 5H37D 1QUIA 3U72A 4NN3A 2CV2A 1TFDA 2DVZA 3CRBA 3MBPA 2XH9A 5EXTA 3MYUA 2G5GX 5ITQA 3PPPA 1XS5A 1P1QA 5ITTA 3SMPA 3LBSA 1YAEA 1RYXA 3ZSFA 2F3DA 4TQUQ 2JZ0A 3B6QA 3TPAA 1S50A 1SG9A 1Z5CA 3U61B 2Z8YM 2Z8EA 1JR3E 4MH5A 1SPIA 4JI6M 4TLMB 4Q8RA 2OK2A 1I4WA 1PB9A 4GC9A 1HNXM 3U94A 4QFLA 1B58A 5F1QA 1R7RA 4O8MA 3C34A 4G61A 4FCVA 1Z5AA 5I3SA 2EUCA 3TWLA 3DOAA 1O64A 3IB0A 3KP0E 2JZ1A 2D7HA 2FIEA 2DP8A 1TFAA 1TDZA 3FZVA 3L26A 4K0KM 3K8ZA 3I4VA 4NX1A 3CHGA 3SARA 2J7NA 2HKJA 3IHPA 4LUBA 4PF6A 4AKIA 3TQSA 2QFLA 3PMXA 3FV2A 4RF1A 4OVQA 4WKMA 5AA2B 1MPBA 1UTHA 2C98A 2HWJA 3E21A 1NMUA 1AOVA 5AE4A 2WYKA 3GLFA 1MY2A 5F7VA 5KDTA 4B3SM 3KN3A 1IXIA 1GR2A 5CMMA 4JI2M 4PFUA 4PE3A 4XKNA 3W68A 1ZV1A 1Z5BA 4N07A 2FS1A 2PX1A 1B3FA 4NGUA 1ZKBA 3WAEA 5FBPA 2UVJA 4LP2B 4ZPXA 4YB6A 3K6XA 1BTJA 3V5AA 3BKIB 1F9BA 1YYZA 4L8RC 4LF9M 1VG5A 3TL4X 3TODA 2DWLA 1MH3A 2QPAA 1ZAEA 3T38A 3NBXX 3VE1B 5A2QS 2HZKA 4IR8A 5E26A 1N0TA 2JY7A 1I6AA 3DFZA 1KA0A 3L25A 4F1YA 3GLFE 3I6VA 4QRZA 4G68C 1YE9A 4KHZE 3ISPA 3FUZA 4JI0M 3IJOB 4F2QA 1FTAA 2ESNA 4E0XA 4HLQA 5LMUM 3EQ1A 3SESA 1MX0A 2RCAA 2ZTDA 3QYBA 4Z7EA 1D9QA 1UTBB 1IN7A 3DP4A 5EP1A 1H6UA 3B50A 4M0DA 2XXIA 1EZ9A 5H8HB 3OO8A 5KPTA 2AHMA 3SYKA 4RK9A 4WXJA 3T9HB 3UK4A 3ZH9B 4F19A 3I01M 1NV8A 1PDAA 1NUWA 2FBPA 1B0HA 4MLVA 3T6PA 2ZMBA 4R3DA 1MXZA 4B08A 1TH4A 1R1NA 5L9SA 4ZEKA 1LLSA 1PB7A 4QXDA 4OTEA 3MPLA 2ZBKB 3K1NA 4DR6M 3KJTA 5EXXA 2QBYB 1M5FA 2DZNB 5EQ7A 1POTA 3L28A 4D82A 2QVVA 3N5LA 2UYFA 1N7XA 4GFRA 2XFTA 1B46A 2DSFA 3E13X 4DE8A 4MM3B 3GLGA 1XHBA 4DV4M 3CI8A 4X1DA 2M60A 1L2BA 4U4SA 2DWNA 1PBPA 1FQAA 3B6TA 1VDDA 4GIZA 2F78A 4MJOA 4M9ZA 1JVYA 4AZFA 3U6LA 4POXA 3TEPA 4FECA 3KOSA 3CF6E 4OVJA 3PVSA 2YJPA 3TELA 5L9OA 1WJ7A 2ZM6M 2EKKA 5KZTA 2G8LA 1Y1ZA 3KOTA 2R65A 2FYIA 4GBVA 3G3JA 1QVSA 4PFTA 3CTWB 1B4HA 1QQWA 1RU3A 3QIMA 1QDTA 2F5SA 3GP1A 3C36A 3M3LA 2OZZA 3GRYA 3HHXA 2XSZD 1NV3A 1ANFA 3E79A 3OD7A 1ATGA 4CJ6A 4IO2A 4JBZA 1S9TA 3G3IA 5ICTA 1SYIA 2UVGA 1I94M 1D9YA 1BP5A 3H4ZA 4NF8A 3U6PA 2GNOA 4RF0A 3J80S 3OELA 3UIFA 4L16A 4F3GA 3SMSA 3UJNA 4DI3D 1D3KA 1VEKA 3IR1A 3N26A 3FRHA 1DTZA 2DWIA 3MP1A 3DELB 3FUWA 4NF6B 1Y8GA 5EQ8A 3K9PA 3T15A 2HXWA 1X37A 3SHFA 3Q26A 1AIVA 2DWJA 4QNRA 1TH3A 1Z7ME 2J7OA 4Q0CA 3CG3A 4N91A 1AUAA 2KQZA 1LFGA 2ZTCA 2GFEA 4HCYA 4OW0A 1WGLA 2L09A 3PNYA 2ZZXA 2XD3A 1TT1A 4GHLA 4B7FA 2OOAA 4EQ7A 2DAEA 1IN6A 1QUKA 2G29A 4NRVA 3IORA 4LF7M 3RPLA 3GLGE 3GRUA 4IBDA 2THIA 2Q2EB 4FEDA 1NUXA 4M1VA 4GWOA 4NXMM 2A5YB 2F97A 3DZDA 2REGA 1SD3A 1JR3D 1NJFA 2XXTA 3JV9A 5FTLA 1L2CA 2NOOA 2QSFX 5H8NA 1NNFA 2E0SA 2R46A 3AV0A 1EU8A 1OQHA 2B3TA 1FBEA 3HSTA 1KZ8A 4GITA 4OVZB 1DCUA 3GLBA 3TCHA 2LVPC 3FATA 1D0KA 1IZ1A 2I49A 5KQDA 2VD3A 3S9EA 2KW0A 5A5LA 4LF8M 3E9XA 3OO9A 1A54A 3SAUA 3IG8A 2ZYMA 5CI5A 1QKBA 5EP2A 4F2LA 1MXXA 4U1ZA 3VLFB 2KRKA 3HX3A 4RNAA 3LCVB 4N8GA 4PFRA 3RN8A 5ITXA 1BVSA 1OLAA 1B32A 2YNMD 1MY3A 4KCDA 2CV1A 2I0CA 2KLFA 5DT6A 3VLVA 2XXRA 4XK8F 4FCWA 4II7A 4IY5A 4DXCA 4GWUA 3K01A 4JSDA 3D1RA 4AS5A 2CZIA 1DO0A 2EKFA 2BJJX 4OEUA 2YPNA 3MW0A 1P1WA 1SXJC 1B1XA 3U5ZA 1QKAA 1MRPA 2LXEA 3K92A 2WX9A 4NSOB 4L6V6 2KNZA 4P16A 2OQ4A 4Z8XA 5EP4A 3ZC7B 2ZAOA 2F35A 2WSCF 2DE3A 3IOWA 1B4ZA 2WBBA 1PEBA 4NG7A 4KHPM 1WIVA 1NY5A 1LSTA 3PUWE 2XLJA 3MP8A 4KCCA 1Q39A 1OTRA 4ELOA 2CV0A 1YTVA 5I2NB 4ZS9A 2JXNA 3C3DA 4LJ9A 3LUZA 3QSLA 4RY1A 1SQYA 2P2AA 4P3LA 4FW9A 2RRUA 4XTCQ 2R4JA 4O7IA 1JEUA 1KA1A 2OJTA 3K00A 1QW0A 5DVIA 2L4EA 2Q9TA 2V3QA 1N04A 1B6HA 3A29A 4OVSA 4NEDA 3PUYE 3AL0C 1POY1 1II5A 5JEIA 2HL7A 3T9UA 1JEVA 1GGGA 5IM2A 1UQWA 5IZ1A 2HQ0A 4OWDA 3OEKA 4H0WA 1DGFA 1OFIA 3SAWA 3C35A 1HQCA 1IMAA 2R0IA 1OAOC 3O6GA 5DW8A 4THIA 3KW6A 2Z7JA 4IJEA 4GWSA 2O1LA 5FLXS 1IXSB 1FQDA 4JI1M 3A3CA 4HE2A 3VDFA 2Z8DA 2C96A 1O63A 3O29A 1FBHA 1EH3A 2MROB 1M5BA 4ND9A 2R6GE 3VKHA 1TH2A 1BKAA 1A5TA 2R62A 4X1BA 3FYDA 4POWA 1A8EA 2HAVA 1QUSA 3TWKA 2LHCA 4JWOA 1IY1A 2XF3A 2DE2A 3H6VA 4D81A 4EF2A 4JB7A 5JTYB 2PMSA 2C9CA 7CATA 3IECA 1TR8A 3FYCA 1BLFA 3UN6A 1NNPA 3SHGB 2F5QA 2OCUA 2B3FA 3CIJA 1FPFA 3MSTA 5AA2D 2B3BA 2FIXA 4Z0IA 2MH8A 3M7GA 4IBFA 4AS4A 1IXGA 5IAIA 5H8SA 4F3SA 3B74A 4B3MM 5AA3A 3C58A 4OMBA 1IMBA 4KXPA 1H76A 1MXVA 3H6WA 2DENA 3UGJA 3D8BA 3JR4A 1DGBA 3KS4A 5CM6A 4P1LA 2QENA 1HR0M 2CZHA 4YKPA 1OFHA 2ZYNA 3HGIA 5J16A 3DLNA 3ILUB 2DXRA 4MMPA 2FHYA 2KZUA 2JJKA 4I4LA 4NF8B 4DV3M 3HU2A 4G8HA 3J81S 4C0RA 4R7GA 3W67A 1PJIA 4GX4A 2D7GA 2QZ4A 4FWGA 4FJPA 4KI0E 2DAGA 3TTLA 4NF4B 3A42A 1L1ZA 3PPRA 4ZEIA 5BUUA 4ONYA 4GD5A 3SYLA 1D0LA 1EZPA 4IBIA 3QWLA 3QK6A 3MMPA 1Q9DA 2A5SA 3Q29A 2CHVA 3VXCA 2H5XA 1HSEA 3LMMA 1H44A 4E0WA 2F7AA 2LVNC 3OSRA 2FFJA 3MAMA 1B5HA 1K3WA 4LQ2A 3MP6A 2R18A 3CGWA 1G0HA 3OEMA 1QAOA 4FWHA 2QS1A 3O28A 4DDDA 2CMOA 3BBRA 2ZNTA 5KDTB 1PJTA 2O25A 4G3OA 4IJFA 3SEXA 2XSZA 4X64M 2DAIA 4FD2A 3PXGA 4FORA 2CRUA 3VVEA 4X8RA 1NH7A 4G77A 1WODA 1F4IA 1JP4A 4IIWA 5ITYA 4LFCM 3QAXA 4IO6A 4QFKA 1UM8A 4MAGA 4NF5B 3SEUA 5H8FB 4QOZC 2FNCA 2UXBM 3E78A 5I57A 2DXYA 1FJ9A 2HAKA 3HHFA 4PDHA 2JUJA 4BDLA 5CMKA 2XXUA 4GQOA 3A09A 3PUXE 4EQBA 1VEJA 2F7BA 1MY0A 1GL6A 3GQ5A 3UORA 4IBGA 2DWMA 2Y7KA 3H7MA 2WEFA 2JNHA 4LRSA 4AKGA 4LZZA 4KYSA 4LQ5A 4ECFA 1B05A 3U6DA 2ZNUA 3GXAA 4BDOA 4P47A 5IGAA 1Y20A 4R6HA 3B6WA 5TPAB 2WZJA 3V89B 3BFTA 5ITUA 4JI4M 4C1TA 1GVCA 4HTGA 2YR0A 3G3KA 5IT9S 1WVJA 4OFOA 2JY8A 1IMEA 4PBHA 5KQ8A 3BIHA 3CFZA 4I3YA 3EHSA 3KC0A 3E3KA 3TKDA 4KLNA 2BJIA 3U1OA 3ROJA 3V76A 4OVRA 2P1SA 1G59A 2Q8JA 4AB5A 1C7YA 1NL5A 3SEWA 3FJMA 5EXSA 3O66A 2EO2A 3I51A 1GL7A 3CF2A 1IQ7A 3IX1A 4QSEA 1LCTA 3I3VA 3RT8A 1FNNA 4DXUA 4AB6A 5FHOA 1URGA 4FATA 4IGRA 4R2BA 4DLDA 5J1DA 2VPOA 1IXSA 1I6QA 4G2ZA 1L8QA 3TTNA 3ILTB 2ONSA 1ORYB 1K9YA 3TPZA 4NQ8A 4GIPA 3T1HM 3ONMA 5HM4B 3U6QA 1VSOA 5EQ9A 4N6DA 1I6BA 4OA4A 4PE5B 3I04M 4KPTA 1BIYA 1EYJA 4H65A 5FTNA 1QAQA 3MC2A 3FJ7A 5EYHA 3MWBA 3MZ9A 3H03A 4XKQA 1J7KA 3GQ4A 2IEEA 3VFJA 3U8QA 3LCUA 5LDZA 4YKIA 2DHYA 2ONKE 2JA2A 3MVWA 2I6EA 1IMFA 2F4VM 1OVBA 4FVMA 5ET8A 4BB9A 2F8DA 2R71A 4N15A 4OERA 3RTWB 3HHYA 1MXWA 5IWAM 3ZQJA 1G0IA 3PPNA 1CE2A 3J7AS 1XNQM 3LSWA 3U61A 4EXLA 1UTBA 4RPOA 3R7XA 2QPQA 1B3EA 4NWCA 3PGFA 1G71A 4R6KA 4LG2A 2PBWA 4DUZM 2ZXTA 2XD2A 1RDXA 3GLIA 1FPBA 3EHTA 2GQ1A 5LTCA 4X48A 1D2NA 1G8PA 1OQGA 1J5EM 3WAFA 2R44A 4CHTB 3KN7A 2V3UA 4UACA 2LVOC 4LGMA 5BR8M 3RE8A 5FTMA 1TWYA 1B5IA 4G68A 2VGQA 1QDRA 1B3HA 2O69A 3GLHE 1HNWM 4XFEA 1HQYE 3K2DA 1G4AE 5ITRA 1O7TA 4M4GA 4X04A 4HEOA 4QHQA 1XI6A 4QFOA 5TU0A 5B70A 4FEBA 1NJGA 1DO2A 4DZ1A 3U60A 4XKPA 3TCGA 4O3CA 2DNAA 2A5TA 5I56B 3U60B 2LAOA 5ITOA 4LZ8A 5ET7A 3TZAA 3T1BA 1HT1E 5ESYA 3TFLA 3E4RA 4I81A 4IBCA 2GHBA 2QMWA 2RC8A 4KFQA 4EDPA 2Z23A 3RGYA 4NSRA 3TTRA 4GBWA
chains in the Genus database with same CATH topology
1YSYA 2DHRA 4MGKE 1HSLA 3H06B 3OOAA 4M9SA 4NL4H 3Q8XA 4JI3M 3MHVC 4L4UA 2QRYA 2ZNSA 1NFTA 1Z6TA 3TCFA 2H1RA 4F31B 3SETA 1IXRC 4F22A 4P11A 4LJ7A 3W0FA 3OENA 3R9XB 1W5TA 2QCUA 1QYRA 4OHNA 4MFIA 3H3GA 3JR5A 3DA1A 3ZKKA 3JAMS 2UXAA 3B9PA 3O9PA 1Y3NA 2Q2CA 1N84A 1SW2A 3J2PB 2XFSA 4I62A 4JXJA 1J1NA 4IBJA 5I58A 2M8CA 3FVGA 3RFWA 4JWYA 1R6BX 3FVKA 3PU5A 4GL8A 3VK7A 2FE8A 4D80A 3VXBA 2RCBA 4FE8A 4H6DA 4TUWA 1B3LA 2NXOA 2PT1A 4F2OA 2Z3XA 5KCJA 2XXWA 4LRTA 3K6UA 1M5DA 3V8XB 2CZLA 4OFJA 3M0EA 2WKYA 2OPFA 2Y7PA 2O84X 1PJJA 2Y7IA 4TOZA 2ZYKA 4R2FA 1FTOA 3THGA 5H8QB 5FHNA 5AA1A 1A99A 1URSA 4BBAA 1NHGC 4YKJA 4GHAA 3QAUA 1A8FA 3DM0A 3O97A 1H3DA 3D4CA 1XC1A 4HS7A 3EN3A 4NTLA 4I8OA 3HHZA 2E1SA 2LWXA 4LF4M 4OEVA 2Z8FA 3GLIB 1US4A 2RKMA 1GKIA 1MQIA 1MS7A 3ZS6A 4K3FA 1N32M 3T66A 3KN8A 2W82A 3PPQA 2RF1A 1L2DA 2F6PA 5F3WA 5CBSA 3U6CA 3VFDA 4ZDMA 2Y0TA 4U4XA 3LR1A 2K47A 1NH8A 1MY4A 3KFUG 1GV8A 2V1UA 4DV0M 2Y20A 4C1UA 3IO4A 1WDNA 1Q35A 3QUJA 3FIRA 3TWMA 3L6GA 1A55A 3TUSA 3KOZE 1NKXA 4PCZA 1UTHB 3TQLA 1EZOA 1N3WA 1VFDA 1PM5A 3MVYA 2BNKA 2P0SA 3JZJA 3T1YM 1R2YA 1KFVA 1LAFE 3K1PA 3T93B 2HAUA 1LB8A 4B7HA 1NNJA 3GBBA 4DR3M 5CMBA 4OETA 3VK8A 1ELJA 1JVXA 2ERCA 4LJAA 4KQPA 4XGIA 1B7HA 2D3IA 3R6UA 2V3TA 1FTKA 3KFMA 2QBYA 3SFZA 3F11A 3ILKA 2Q89A 1LFHA 2RKOA 4U1OA 3IO6A 1MQJA 1DOTA 4YKKA 1R6ZA 2O7IA 3AFHA 1K82A 4KD5A 2BJWA 2ONRA 3PNVA 2V93A 3UK6A 1ZLQA 4ZEBA 1G3IA 3IG5A 2Z22A 4I5SA 4LF5M 4KYDA 1SXJE 1IEJA 4IO5A 2QS2A 4GL0A 5A5XB 3GO8A 3RNNA 1IN8A 1S7YA 3HV1A 4ZZEA 1IQPA 1SXJB 4JYAM 4IGTA 3AJIB 4IBBA 5KCJB 1MG1A 3C9HA 4GC5A 2YFQA 1IBKM 2A5TB 5H8FA 1NY6A 1ZQ9A 5FTJA 3VLUA 2O7UA 2HFBA 4YHHM 1LAHE 4MH0E 1IY2A 2ZYOA 4XXUA 1XXHB 3A46A 3U6MA 4QFPA 3S9MC 5H8QA 4U22A 3OO7A 2G93A 2YQZA 4IBKA 4M9XA 2AIXA 1L5TA 1L1TA 3PMVA 4BLCA 2Y7WA 2UYEA 1N3XA 3VVDA 2KRUA 2XGNA 3TQWA 3LSLA 3KZGA 5EHMA 1FQCA 1MQHA 2UVIA 1IN4A 2HCAA 2RGHA 3RGSA 4GRIA 3FTFA 3TTMA 3C32A 5I2KA 5FTKA 1MM6A 1Q3CA 2XZFA 3PPOA 4DR1M 4MBPA 2Q2AA 5TPAA 3EIHA 4OU7A 1AMFA 1DTGA 5DEXA 2Z4SA 3RLFE 3U93A 4ESWA 1K3XA 4KO8A 1A40A 3FKEA 1R9LA 2I4CA 1LFIA 1OMPA 1SI0A 3S9LC 4LFAM 1D9VA 2CEAA 3GQ3A 5JI2E 4PT5A 4PP0A 4GH9A 3GRVA 3J7BA 3Q28A 3HJSA 3FGSA 4QFNA 2F5PA 2RINA 1Q1KA 3L27A 2F5OA 2ALUA 2F7CA 2VP1A 5DVJA 3RPWA 2ANJA 3K6WA 3W0LB 2CUZA 2HEUA 4G4QA 5DYGA 2EA0A 3W15C 3N6UA 3L6HA 4U21A 4LCBA 3GPUA 3VKGA 2QJEA 3LVWA 3ZCBB 3I4YA 2H99A 2PT2A 3E9SA 1IITA 2F34A 3CVGA 2YLNA 3BFUA 1XXHA 4KODA 5I59A 3FD9A 5AA2A 4B7GA 4I1DA 2L7IA 2W7YA 4LJ4A 1US5A 3KP1E 4F1VA 3CSGA 4OENA 4ZEFA 5A5XA 4WEPA 1I69A 1NNTA 3THIA 4ELPA 1PB8A 3UGWA 3C33A 4R6YA 5EYFA 2D7EA 1GVNA 1SXJA 4L17A 2Y84A 3VVFA 1XVYA 2L7HA 4GF8A 4P0GA 1RYOA 4F3PA 4JSOA 1GLNA 3OXNA 3RUMA 3FASA 1JW1A 1C1KA 4QHSA 4LZJA 2O5RA 3MUQA 3C31A 2BJVA 1TXFA 4JN6A 3KVWA 2H25A 3S9NC 2LNHC 4KR5A 3Q25A 1VE4A 5HPQA 4DCXA 3KOWE 2B65A 2NWJA 3MK6A 3SDFA 3HKPA 1A7LA 3GLHA 1D4NA 3KG2A 4H1XA 1M5CA 4JWXA 3MZBA 2X4AA 5ITXE 1ZIUA 3RGPA 4EIWA 1NHWC 3EF7A 1DSNA 5ELVA 1R9QA 2HZLA 3SKPA 2I7NA 3MJNA 3AOGA 4WEDA 5CRYA 5EXPA 1NVMA 2NQ8C 2V25A 2VHAA 4MB7A 4GVOA 5I58B 4A3VB 3WHKA 4L78A 1FQFA 3RY3A 2V84A 2R45A 4NF6A 4ELRA 3FUXA 3FUUA 5EJCA 4XKRA 3SERA 3LQRA 1IN5A 4R72A 1NSFA 4JI8M 3GZGA 2AYSA 1SW5A 3W9VA 1MPDA 4DR5M 2HCBA 4DV6M 3CFXA 2FNAA 1Y4CA 3T96B 3G7WA 1B3GA 1N7WA 2LH0A 2KXEA 2R9JA 2X8AA 1Y4TA 2F6GA 3TYHA 4PDIA 5LMNM 2H9BA 4G4RA 2XZUA 1HNZM 3U6SA 5DVFA 4H8IA 3VLWA 4NOOB 3SEYA 2XHDA 1MDP1 3TE6A 4AQYM 2UU9M 1Z7NE 4Q5TA 2GH9A 3HCQA 4NF4A 2VD2A 1LAGE 2OLBA 4X65M 3KGCA 3S2VA 3GLGB 1FCKA 1N76A 3LC8A 3BOSA 1QAMA 4BLAA 4MLQA 3K2LA 2REJA 1SI1A 3FV1A 1B52A 5EP3A 4LJ5A 2E5LM 3DP8A 4OESA 1Y3PA 1UIVA 3TTKA 3K4UA 1XOCA 3HJ8A 5DYIA 1WXQA 1E9RA 3SASA 5L8DA 4OFLA 2XX9A 4PETA 1GTKA 4AQ4A 1DGHB 3A45A 4ZZAA 3I5OA 5I59B 1USYH 3TDJA 2L6OA 1AL3A 2UVHA 3U6OA 1P1UA 3TAJA 3IJXB 4WURA 4LZ5A 3A98B 3SATA 1SDXA 4OZ9A 1LGBC 1DPEA 4RK2A 3IB2A 1B0LA 1P1OA 4YB5A 4EUOA 4NF5A 4AKHA 4RXLA 2DYXA 4G8MA 2UUCM 4O3AA 5H8HA 3CF0A 3C4MA 2H4IA 3KSXA 1ZJLA 2I58A 4QSCA 4WW0A 4CGYB 1SBPA 1P99A 3T9VA 1URDA 3T22A 3OMBA 4EXKA 3J27B 2DOJA 2X7PA 1VR5A 4TLLB 1ZBMA 1QJMA 3UZUA 4YY3M 1XNRM 1JETA 1W5SA 1ZU0A 4X62M 4YICA 3LQQA 5M2VA 1AH5A 4GXSB 2GHAA 1XMQM 5GKNA 2XXVA 1SYHA 2VIIA 2F5XA 3KEIA 1Z59A 3JYRA 4BDMA 4NXNM 3GLHB 1NNKA 4HW8A 3HU3A 5EHSA 4MF3A 3FXUA 1JR3A 4GOTA 3K1JA 3PUZE 1XT8A 2XXXA 4LFBM 3RQTA 3N6TA 2P5TA 4QOSA 5BPVA 2F5NA 5I57B 1CB6A 2XXHA 4MGIE 4QF9A 3GBAA 3W9WA 5C18A 2QP9X 2AL4A 4P0IA 5ISUA 5BWJA 3NWLA 1SW1A 1MXYA 1MXUA 4B3TM 3KSJA 4QNMA 2NVUB 1RKMA 3PUVE 1DGHA 1PBQA 1NNUC 1JQJC 2Q88A 4H5FA 3D8LA 3L29A 4R9FA 4LGYA 3VV5A 3K6VA 4IB2A 4PQJA 3FTEA 3O2AA 4NMYA 4BDNA 3M6AA 3EHUA 5K2YA 4AG6A 1IY0A 1JW5A 3K1MA 2UXDM 4CISA 3VDUA 3EIEA 1N77A 4IBEA 4REZA 4BDRA 4GRKA 2O1MA 4G68B 1N36M 3M3KA 2QSXA 4ZEDA 3UP9A 1FJGM 1LBBA 3D4GA 4ZECA 4S12A 4FCTA 2I7PA 3M3FA 4F29A 1MQDA 3ZKLA 2FA7A 5ICQA 1JNFA 1G41A 1XHYA 4DCYA 3GRRA 4AI6A 4JXIA 4O3BA 3T9XB 3KBRA 4U2RA 1MU5A 4YU0A 4PFYA 1B7UA 4NRWA 4IY6A 3TMGA 4DV2M 3MVZA 4R74A 2DE4A 3QYTA 3FVOA 2X7QA 4NWDA 2CFOA 3SC3A 4HCWA 4RYAA 2KZSA 3H6UA 4PFWA 3IOUA 5IREB 4DV7M 3ODBA 3HWSA 1B2HA 2O51A 2R4EA 3H6TA 5CMCA 3CFLA 4LVQA 2D5WA 1XC8A 4FAJA 2F36A 3M8UA 2I3VA 1FTJA 4AW4A 2PYYA 4GLIA 3FVNA 2QS3A 3CR9A 4G4PA 1ZTYA 2C99A 3R26A 3MPKA 3RT6B 3HN0A 1OIBA 4MGHA 1MQGA 4N13A 4F18A 3GLFB 1MDQA 3AOEA 1HSJA 2CE7A 2I0BA 1N34M 1LCFA 2RGOA 2GRVA 4ISUA 3OTOM 5JI3E 5DNYA 4PD2A 2DVWB 3FXRA 1J09A 4FWDA 1N75A 2UXCM 4I9DA 2M5ZA 3FXQA 1LV7A 2IA4A 3PD8A 4X66M 5I2KB 5DYHA 4M0WA 3CSBA 3EPEA 4EF1A 4YMAA 3HPIA 2RC7A 3K02A 4R9GA 5I56A 4MGZE 1ZMGA 4OVZA 1IXZA 3MZ1A 3PV0E 3HJQA 8CATA 1B51A 5EQTA 2HHHM 1PC3A 4R75A 1LBCA 5TP9A 4G6ZA 4F3BA 3FUVA 4LONB 2UUBM 4DV1M 1UIUA 2DWHA 2I48A 4BDQA 2V1CA 3SAVA 1T0KA 1FTLA 4QSDA 4X9TA 1QVRA 4L15A 4GXAA 4OYVA 2OWSA 4XIGQ 2DWZB 2DXIA 3FTCA 3KXEC 3G3HA 3L2AA 1N78A 4JI5M 4H5GA 4R73A 5IKBA 3DP6A 5DTBA 1MPCA 3IK6B 1XVXA 3NBIA 3PD9A 5IZ7D 4NE4A 4Q30B 3LSFB 1R2ZA 2PVUA 5JTYA 3IL1B 1QULA 4PDGA 4YZZA 4RA1A 4GKKM 1FW0A 2DVCA 2Y0QA 2O6AA 2Y7RA 2DZOB 5KPRA 2DWAA 1E32A 4UA8A 3VDPA 5JK4A 4ITQA 1Q3BA 1XMOM 4GKJM 5H8NB 2XEPA 4DXBA 1JQFA 2VQEM 3GPPA 1T3TA 3U6EA 3USDA 4YB7A 5B7DA 4FIMA 3U5ZB 4ELQA 3K0VA 3HO7A 2XX8A 1VFEA 1IXHA 4IO3A 2DS9A 4RPNA 2QL3A 2RC9A 3P7IA 4DR2M 4ZE9A 5I2NA 4OXVA 2Y21A 2FOIC 2XXPA 1B7ZA 4G8NA 1SVXB 2NUVA 3Q27A 5TP9B 2KEBA 4KYEA 2KA6B 1DPPA 5FTIA 1JW4A 3AKZA 4H8JA 3ECRA 4OX9M 1YUBA 2VOZA 1QZMA 4G4OA 3SEVA 5CC2A 1E9SA 5FHMA 1TDHA 4LATA 3MQ9A 1SW4A 1B5JA 4IO7A 4GMQA 1DGGA 3MVXA 4DR4M 4RNSA 3S4UA 3FUTA 4LJ6A 2Z4RA 2OBGA 4W5WA 5KO3A 1P1NA 4JV5M 3N94A 1M5EA 1IXCA 2H98A 4EQ9A 4F1UA 2DQVA 1H43A 1E94E 2D21A 3GPXA 4JI7M 5KPZA 4LF6M 2UUAM 5FSWA 3R8FA 2X49A 2CHGA 4HL4A 3LSXA 4OQOA 5I84A 3UA8A 1FQEA 1N33M 5C1BA 3HU1A 3IOTA 1LAXA 3LVVA 1USYE 2V6ZM 1OVTA 5ITPA 1S3SA 5AA4A 4F39A 1OLCA 4LY6A 3UMMA 1YCJA 3OO6A 2C9OA 5HBCA 1XWIA 2ABHA 5DEXB 4ZE8A 4AG5A 4I8CA 4U23A 1B9JA 1B1HA 3CG1A 5K2XA 3FTDA 4ESXA 1H45A 3V83A 4JDFA 1SXJD 4IO4A 2O68A 2QMXA 3PMWA 3QUFA 1IUDA 3KDSE 2C5RA 1MM7A 1KWHA 1QANA 1HT2E 5FTHA 4DIGA 1FTMA 1EE8A 5L9MA 1OJLA 5E6JA 4N6PA 1LB9A 3GPYA 3G3GA 2QS4A 4H67A 1B40A 4QHTA 2CHQA 1QUJA 2ZANA 4XBOA 4MGYE 1FQBA 1MH4A 3H4MA 4LZ7A 4B3RM 3U92A 4G4NA 1IBLM 3IAZA 3B7DA 1YPNA 1TGUA 3LUYA 1Y3QA 4LA9A 2OWTA 3IOVA 4Z6YA 4YAHX 2VQFM 3KOXE 3O6IA 2ZAMA 3FD3A 4DR7M 2XXQA 3QXMA 3A3UA 1Y9UA 3HHGA 2XX7A 4LJ8A 1IIWA 1Y1MA 2XXYA 3OSQA 4YMBA 3PFIA 1KSFX 3KOYE 3MJ5A 2H5YA 1MY1A 3KS8A 3KJ7A 3G3FA 5CBRA 3WHLA 3AOEC 2I4BA 1IM2A 5LOMA 5AA4B 3RTFB 2AL5A 3AXFA 2I3WA 3O6HA 3FJGA 2X26A 3SBJA 4RJZA 1IBMM 3HHWA 3IB1A 4DUYM 4DV5M 1KYIA 1DMBA 5H37D 1QUIA 3U72A 2CV2A 1TFDA 2DVZA 3CRBA 3MBPA 2XH9A 5EXTA 2G5GX 5ITQA 3PPPA 1XS5A 1P1QA 5ITTA 3SMPA 3LBSA 1YAEA 1RYXA 3ZSFA 4TQUQ 3B6QA 3TPAA 1S50A 1Z5CA 3U61B 2Z8EA 4MH5A 4JI6M 4TLMB 4Q8RA 2OK2A 1I4WA 1PB9A 4GC9A 1HNXM 3U94A 4QFLA 1B58A 5F1QA 1R7RA 3C34A 4FCVA 1Z5AA 2EUCA 3TWLA 3DOAA 1O64A 3IB0A 3KP0E 2D7HA 2DP8A 1TFAA 1TDZA 3FZVA 3L26A 4K0KM 3K8ZA 3I4VA 3SARA 2J7NA 2HKJA 4LUBA 4AKIA 3TQSA 3PMXA 3FV2A 4RF1A 5AA2B 4WKMA 1MPBA 1UTHA 2C98A 1AOVA 1NMUA 5AE4A 3GLFA 1MY2A 5F7VA 5KDTA 4B3SM 3KN3A 1IXIA 1GR2A 5CMMA 4JI2M 4PFUA 4XKNA 1Z5BA 4N07A 2PX1A 1B3FA 1ZKBA 3WAEA 2UVJA 4LP2B 4ZPXA 4YB6A 3K6XA 1BTJA 3V5AA 3BKIB 1F9BA 4L8RC 4LF9M 3TL4X 3TODA 2DWLA 1MH3A 2QPAA 1ZAEA 3T38A 3VE1B 5A2QS 2HZKA 5E26A 1N0TA 1I6AA 3DFZA 3L25A 4F1YA 3I6VA 4QRZA 4G68C 1YE9A 4KHZE 3FUZA 4JI0M 3IJOB 4F2QA 2ESNA 4E0XA 4HLQA 5LMUM 3EQ1A 3SESA 1MX0A 2RCAA 4Z7EA 1UTBB 1IN7A 3DP4A 5EP1A 1H6UA 4M0DA 2XXIA 1EZ9A 5H8HB 3OO8A 5KPTA 2AHMA 3SYKA 4RK9A 4WXJA 3T9HB 3UK4A 3ZH9B 4F19A 1PDAA 1B0HA 4MLVA 2ZMBA 4R3DA 1MXZA 4B08A 1TH4A 1R1NA 5L9SA 4ZEKA 1LLSA 1PB7A 4OTEA 3MPLA 2ZBKB 3K1NA 4DR6M 3KJTA 5EXXA 2QBYB 1M5FA 2DZNB 1POTA 3L28A 4D82A 3N5LA 2UYFA 1N7XA 4GFRA 2XFTA 1B46A 2DSFA 3E13X 4DE8A 4MM3B 3GLGA 1XHBA 4DV4M 3CI8A 4X1DA 2M60A 1L2BA 4U4SA 2DWNA 1PBPA 1FQAA 3B6TA 1VDDA 4GIZA 2F78A 4M9ZA 1JVYA 4AZFA 3U6LA 4POXA 3TEPA 4FECA 3KOSA 3CF6E 4OVJA 3PVSA 2YJPA 3TELA 5L9OA 2ZM6M 5KZTA 2G8LA 1Y1ZA 3KOTA 2R65A 2FYIA 3G3JA 1QVSA 4PFTA 3CTWB 1B4HA 1QQWA 3QIMA 2F5SA 3GP1A 3C36A 3M3LA 2OZZA 3GRYA 3HHXA 2XSZD 1ANFA 3OD7A 1ATGA 4IO2A 4JBZA 1S9TA 3G3IA 5ICTA 1SYIA 2UVGA 1I94M 1D9YA 1BP5A 3H4ZA 4NF8A 3U6PA 4RF0A 3J80S 3OELA 3UIFA 4L16A 4F3GA 3SMSA 3UJNA 1D3KA 3IR1A 3N26A 1DTZA 2DWIA 3MP1A 3DELB 3FUWA 4NF6B 3T15A 2HXWA 1X37A 3SHFA 3Q26A 1AIVA 2DWJA 4QNRA 1TH3A 1Z7ME 2J7OA 4Q0CA 3CG3A 1LFGA 2GFEA 4HCYA 4OW0A 2L09A 3PNYA 2XD3A 1TT1A 4GHLA 4B7FA 4EQ7A 1IN6A 1QUKA 2G29A 4NRVA 3IORA 4LF7M 3GRUA 4IBDA 2THIA 2Q2EB 4FEDA 4M1VA 4GWOA 4NXMM 2A5YB 2F97A 3DZDA 2REGA 1SD3A 1JR3D 1NJFA 2XXTA 3JV9A 5FTLA 1L2CA 2NOOA 5H8NA 1NNFA 2E0SA 2R46A 3AV0A 1EU8A 1OQHA 3HSTA 4GITA 4OVZB 3GLBA 3TCHA 3FATA 2I49A 1IZ1A 5KQDA 2VD3A 3S9EA 2KW0A 4LF8M 3E9XA 3OO9A 1A54A 3SAUA 3IG8A 2ZYMA 5CI5A 1QKBA 5EP2A 1MXXA 4U1ZA 3VLFB 2KRKA 4RNAA 3RN8A 5ITXA 1OLAA 1B32A 2YNMD 1MY3A 4KCDA 2CV1A 2I0CA 2KLFA 5DT6A 3VLVA 2XXRA 4FCWA 4II7A 4IY5A 4DXCA 3K01A 4JSDA 1DO0A 2BJJX 4OEUA 2YPNA 3MW0A 1P1WA 1SXJC 1B1XA 3U5ZA 1QKAA 1MRPA 2LXEA 3K92A 4NSOB 4P16A 2OQ4A 4Z8XA 5EP4A 3ZC7B 2ZAOA 2F35A 2DE3A 3IOWA 1B4ZA 1PEBA 4KHPM 1LSTA 1NY5A 3PUWE 2XLJA 3MP8A 4KCCA 1Q39A 4ELOA 2CV0A 1YTVA 5I2NB 4ZS9A 4LJ9A 4RY1A 3QSLA 1SQYA 2P2AA 4FW9A 4XTCQ 2R4JA 1JEUA 3K00A 2OJTA 1QW0A 5DVIA 2Q9TA 2V3QA 1N04A 1B6HA 4NEDA 3PUYE 3AL0C 1POY1 1II5A 5JEIA 2HL7A 3T9UA 1JEVA 1GGGA 1UQWA 2HQ0A 4OWDA 3OEKA 4H0WA 1DGFA 1OFIA 3SAWA 3C35A 1HQCA 3O6GA 4THIA 3KW6A 2Z7JA 4IJEA 2O1LA 5FLXS 1IXSB 1FQDA 4JI1M 3A3CA 3VDFA 2Z8DA 2C96A 1O63A 3O29A 1EH3A 1M5BA 4ND9A 2R6GE 3VKHA 1TH2A 1BKAA 2R62A 4X1BA 3FYDA 4POWA 1A8EA 2HAVA 3TWKA 4JWOA 1IY1A 2XF3A 2DE2A 3H6VA 4D81A 4EF2A 4JB7A 5JTYB 2PMSA 2C9CA 7CATA 3FYCA 1BLFA 3UN6A 1NNPA 3SHGB 2F5QA 2OCUA 2B3FA 3CIJA 5AA2D 2B3BA 4Z0IA 3M7GA 4IBFA 1IXGA 5IAIA 5H8SA 4F3SA 5AA3A 4B3MM 3C58A 4OMBA 1H76A 1MXVA 3H6WA 3UGJA 3D8BA 3JR4A 1DGBA 3KS4A 5CM6A 2QENA 1HR0M 4YKPA 1OFHA 2ZYNA 3HGIA 3DLNA 3ILUB 2DXRA 2KZUA 4NF8B 4I4LA 4DV3M 3HU2A 4G8HA 3J81S 4C0RA 4R7GA 1PJIA 2D7GA 2QZ4A 4FWGA 4FJPA 4KI0E 3TTLA 4NF4B 3A42A 1L1ZA 3PPRA 4ZEIA 5BUUA 4ONYA 4GD5A 3SYLA 1EZPA 4IBIA 3QWLA 3QK6A 2A5SA 3Q29A 2CHVA 3VXCA 1HSEA 3LMMA 1H44A 4E0WA 2F7AA 3OSRA 2FFJA 3MAMA 1B5HA 1K3WA 4LQ2A 3MP6A 2R18A 3OEMA 4FWHA 1QAOA 2QS1A 3O28A 4DDDA 2CMOA 3BBRA 2ZNTA 5KDTB 4IJFA 3SEXA 2XSZA 4X64M 4FD2A 3PXGA 4FORA 3VVEA 1NH7A 4G77A 1WODA 4IIWA 5ITYA 4LFCM 3QAXA 4IO6A 4QFKA 1UM8A 4NF5B 3SEUA 5H8FB 4QOZC 2FNCA 2UXBM 5I57A 2DXYA 3HHFA 4BDLA 5CMKA 2XXUA 4GQOA 3A09A 3PUXE 4EQBA 2F7BA 1MY0A 1GL6A 3GQ5A 3UORA 4IBGA 2DWMA 2Y7KA 3H7MA 4LRSA 4AKGA 4LZZA 4KYSA 4LQ5A 4ECFA 1B05A 3U6DA 2ZNUA 3GXAA 4BDOA 1Y20A 4R6HA 3B6WA 5TPAB 3V89B 3BFTA 5ITUA 4JI4M 4C1TA 1GVCA 4HTGA 2YR0A 3G3KA 5IT9S 1WVJA 4OFOA 5KQ8A 3CFZA 3EHSA 3E3KA 3TKDA 4KLNA 3U1OA 2Q8JA 2P1SA 1G59A 4AB5A 1NL5A 3SEWA 3FJMA 5EXSA 3O66A 3I51A 2EO2A 1GL7A 3CF2A 1IQ7A 3IX1A 4QSEA 1LCTA 3I3VA 3RT8A 1FNNA 4DXUA 4AB6A 5FHOA 1URGA 4FATA 4IGRA 4R2BA 4DLDA 5J1DA 1I6QA 4G2ZA 1L8QA 3TTNA 3ILTB 2ONSA 1ORYB 3TPZA 4GIPA 3T1HM 3ONMA 5HM4B 3U6QA 1VSOA 1I6BA 4PE5B 4KPTA 1BIYA 4H65A 5FTNA 1QAQA 3MC2A 3FJ7A 3MWBA 3MZ9A 3H03A 4XKQA 1J7KA 3GQ4A 2IEEA 3VFJA 3U8QA 4YKIA 2ONKE 2JA2A 3MVWA 2I6EA 2F4VM 1OVBA 4FVMA 4BB9A 2F8DA 2R71A 4OERA 3RTWB 3HHYA 1MXWA 5IWAM 3PPNA 1CE2A 3J7AS 1XNQM 3LSWA 3U61A 4EXLA 1UTBA 4RPOA 3R7XA 2QPQA 1B3EA 4NWCA 3PGFA 4R6KA 4LG2A 2PBWA 4DUZM 2ZXTA 2XD2A 3GLIA 3EHTA 4X48A 1D2NA 1G8PA 1OQGA 1J5EM 3WAFA 4CHTB 3KN7A 2V3UA 4UACA 4LGMA 5BR8M 3RE8A 5FTMA 1TWYA 1B5IA 4G68A 2VGQA 1B3HA 2O69A 1HNWM 1HQYE 3K2DA 1G4AE 5ITRA 1O7TA 4M4GA 4QHQA 4QFOA 5B70A 5TU0A 4FEBA 1NJGA 1DO2A 4DZ1A 3U60A 4XKPA 3TCGA 4O3CA 2A5TA 5I56B 3U60B 2LAOA 5ITOA 4LZ8A 3TZAA 1HT1E 3TFLA 3E4RA 4I81A 4IBCA 2GHBA 2QMWA 2RC8A 4KFQA 4EDPA 2Z23A 3RGYA 4NSRA 3TTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWO A;  2VOZ A;  5CC2 A;  3SEV A;  2F97 A;  4XKR A;  1HSL A;  2REG A;  1SD3 A;  4R72 A;  5FHM A;  3H06 B;  3SER A;  2XXT A;  3GZG A;  2AYS A;  3OOA A;  3JV9 A;  4LAT A;  1SW5 A;  3MQ9 A;  3W9V A;  1MPD A;  1SW4 A;  1B5J A;  4IO7 A;  2NOO A;  3CFX A;  1Y4C A;  5H8N A;  3MVX A;  1NNF A;  2E0S A;  3T96 B;  1EU8 A;  1OQH A;  3G7W A;  4RNS A;  1B3G A;  2QRY A;  1N7W A;  3HST A;  3S4U A;  2R9J A;  1Y4T A;  2F6G A;  2ZNS A;  1NFT A;  2OBG A;  3TYH A;  2H9B A;  3TCF A;  4F31 B;  3SET A;  3GLB A;  5DVF A;  1P1N A;  4F22 A;  4H8I A;  4P11 A;  3TCH A;  3VLW A;  3FAT A;  2I49 A;  1IZ1 A;  3N94 A;  1M5E A;  3OEN A;  1IXC A;  2H98 A;  3SEY A;  2VD3 A;  2XHD A;  1AOV A;  1MDP 1;  4EQ9 A;  3S9E A;  4OHN A;  1Z7N E;  4Q5T A;  2GH9 A;  4F1U A;  3HCQ A;  4NF4 A;  4MFI A;  2VD2 A;  3E9X A;  3H3G A;  3OO9 A;  1LAG E;  1A54 A;  2DQV A;  2OLB A;  2ZYM A;  1H43 A;  3KGC A;  3S2V A;  5CI5 A;  1FCK A;  1N76 A;  1QKB A;  2D21 A;  3LC8 A;  3ZKK A;  3O9P A;  2UXA A;  4BLA A;  1Y3N A;  4MLQ A;  2Q2C A;  1N84 A;  1MXX A;  4U1Z A;  1SW2 A;  2REJ A;  1SI1 A;  4I62 A;  3FV1 A;  3LSX A;  1J1N A;  1B52 A;  5I58 A;  2M8C A;  4OQO A;  3DP8 A;  3FVG A;  3UA8 A;  5I84 A;  4OES A;  1FQE A;  1Y3P A;  1UIV A;  4JWY A;  3RN8 A;  3FVK A;  3K4U A;  3PU5 A;  3IOT A;  1OLA A;  1B32 A;  1XOC A;  1LAX A;  4GL8 A;  3TTK A;  1USY E;  3VXB A;  5L8D A;  1OVT A;  2RCB A;  5ITP A;  4OFL A;  1MY3 A;  4FE8 A;  4KCD A;  2KLF A;  2I0C A;  5DT6 A;  2XX9 A;  3VLV A;  4PET A;  1GTK A;  4H6D A;  4AQ4 A;  5AA4 A;  1B3L A;  2NXO A;  2PT1 A;  2XXR A;  3I5O A;  4ZZA A;  1OLC A;  4F2O A;  4F39 A;  4IY5 A;  5I59 B;  1USY H;  2XXW A;  3TDJ A;  4DXC A;  5KCJ A;  3K6U A;  1AL3 A;  1YCJ A;  1M5D A;  3K01 A;  3OO6 A;  4JSD A;  2UVH A;  3V8X B;  2CZL A;  1P1U A;  5HBC A;  2ABH A;  2BJJ X;  2YPN A;  3MW0 A;  4OEU A;  4OFJ A;  3TAJ A;  1P1W A;  3IJX B;  2WKY A;  1B1X A;  4LZ5 A;  1SDX A;  1QKA A;  1MRP A;  4OZ9 A;  2Y7P A;  5DEX B;  4ZE8 A;  4U23 A;  2O84 X;  2Y7I A;  1B9J A;  1B1H A;  1LGB C;  4I8C A;  3CG1 A;  1DPE A;  4RK2 A;  4TOZ A;  5K2X A;  2ZYK A;  1H45 A;  3IB2 A;  4R2F A;  4ESX A;  1B0L A;  3V83 A;  1P1O A;  4YB5 A;  1FTO A;  4JDF A;  3IOW A;  2F35 A;  2DE3 A;  5H8Q B;  4IO4 A;  4NF5 A;  5FHN A;  4EUO A;  1B4Z A;  4RXL A;  2O68 A;  1PEB A;  2QMX A;  3PMW A;  1LST A;  2DYX A;  3PUW E;  4G8M A;  5AA1 A;  1A99 A;  4O3A A;  3QUF A;  5H8H A;  1IUD A;  1URS A;  3MP8 A;  3C4M A;  4KCC A;  2H4I A;  3KSX A;  1ZJL A;  2I58 A;  4QSC A;  4ELO A;  1YTV A;  1SBP A;  4YKJ A;  1A8F A;  3DM0 A;  1P99 A;  3O97 A;  4ZS9 A;  1H3D A;  3T9V A;  5I2N B;  1MM7 A;  3D4C A;  1URD A;  1XC1 A;  3T22 A;  1KWH A;  3OMB A;  4HS7 A;  3EN3 A;  4NTL A;  3QSL A;  4RY1 A;  2E1S A;  4EXK A;  2DOJ A;  2X7P A;  1SQY A;  1VR5 A;  2P2A A;  4OEV A;  4XTC Q;  2Z8F A;  1US4 A;  4TLL B;  2RKM A;  1JEU A;  1QJM A;  1ZBM A;  2OJT A;  3K00 A;  1MQI A;  5FTH A;  5IKB A;  1MS7 A;  4DIG A;  1FTM A;  1QW0 A;  5DVI A;  3ZS6 A;  4K3F A;  1JET A;  5L9M A;  1ZU0 A;  2Q9T A;  2V3Q A;  4YIC A;  1N04 A;  1B6H A;  4N6P A;  3KN8 A;  1LB9 A;  5M2V A;  3T66 A;  3PPQ A;  1AH5 A;  4GXS B;  2GHA A;  4NED A;  2RF1 A;  3G3G A;  2QS4 A;  1SYH A;  2XXV A;  1B40 A;  1POY 1;  3PUY E;  1II5 A;  4H67 A;  2F6P A;  5CBS A;  5JEI A;  3T9U A;  1QUJ A;  1JEV A;  1GGG A;  4ZDM A;  2F5X A;  1UQW A;  3KEI A;  3JYR A;  4BDM A;  2HQ0 A;  4OWD A;  1FQB A;  4U4X A;  1NNK A;  3LR1 A;  1MH4 A;  3OEK A;  4HW8 A;  1NH8 A;  1MY4 A;  4H0W A;  4LZ7 A;  5EHS A;  1GV8 A;  3C35 A;  3O6G A;  4MF3 A;  4THI A;  3FXU A;  3U92 A;  4GOT A;  3PUZ E;  4C1U A;  2O1L A;  1XT8 A;  1FQD A;  3A3C A;  1WDN A;  3IAZ A;  3IO4 A;  2XXX A;  2Z8D A;  3VDF A;  1Q35 A;  1O63 A;  3B7D A;  1YPN A;  3O29 A;  3FIR A;  3QUJ A;  1EH3 A;  3L6G A;  3LUY A;  1M5B A;  1Y3Q A;  2OWT A;  2R6G E;  3N6T A;  4LA9 A;  3IOV A;  1A55 A;  4ND9 A;  3RQT A;  3TUS A;  4YAH X;  1BKA A;  1NKX A;  3O6I A;  4X1B A;  1UTH B;  5I57 B;  3TQL A;  3FD3 A;  1EZO A;  1N3W A;  4POW A;  1CB6 A;  2XXQ A;  1A8E A;  2XXH A;  3QXM A;  3A3U A;  1VFD A;  1Y9U A;  2HAV A;  3GBA A;  4JWO A;  4QF9 A;  3W9W A;  2AL4 A;  2DE2 A;  3H6V A;  3HHG A;  4P0I A;  2XX7 A;  4EF2 A;  1IIW A;  1Y1M A;  2XXY A;  3MVY A;  3OSQ A;  4JB7 A;  4YMB A;  5ISU A;  2P0S A;  5JTY B;  5BWJ A;  1SW1 A;  2PMS A;  1MXY A;  1LAF E;  3JZJ A;  3RT6 B;  1MXU A;  3K1P A;  1BLF A;  3UN6 A;  3T93 B;  3KSJ A;  1NNP A;  2HAU A;  2H5Y A;  1LB8 A;  1MY1 A;  2OCU A;  3TTR A;  2B3F A;  2NVU B;  3CIJ A;  1RKM A;  3KJ7 A;  3GBB A;  3G3F A;  5AA2 D;  2B3B A;  5CBR A;  5CMB A;  4Z0I A;  4OET A;  2I4B A;  1ELJ A;  1JVX A;  3PUV E;  5LOM A;  5AA4 B;  3RTF B;  1IXG A;  4KQP A;  2AL5 A;  1PBQ A;  1B7H A;  5IAI A;  2Q88 A;  2D3I A;  3R6U A;  3AXF A;  4H5F A;  2V3T A;  2I3W A;  3O6H A;  1FTK A;  3FJG A;  5AA3 A;  3KFM A;  4DE8 A;  2X26 A;  4OMB A;  1H76 A;  1MXV A;  3F11 A;  3H6W A;  2Q89 A;  3K6V A;  4IB2 A;  4PQJ A;  4R9F A;  4RJZ A;  3VV5 A;  3O2A A;  4NMY A;  4BDN A;  1LFH A;  3EHU A;  3IB1 A;  4U1O A;  3IO6 A;  1MQJ A;  1DOT A;  5K2Y A;  5CM6 A;  4YKP A;  4YKK A;  2ZYN A;  1R6Z A;  2O7I A;  1DMB A;  3DLN A;  1QUI A;  2DXR A;  1JW5 A;  3ILU B;  4KD5 A;  3U72 A;  2ONR A;  4NF8 B;  3K1M A;  2V93 A;  4ZEB A;  1ZLQ A;  4G8H A;  1TFD A;  4C0R A;  2DVZ A;  2Z22 A;  3CRB A;  3MBP A;  4KYD A;  4BDR A;  4GRK A;  2O1M A;  1IEJ A;  3PPP A;  4FJP A;  4G68 B;  4KI0 E;  1XS5 A;  1P1Q A;  4IO5 A;  4NF4 B;  3TTL A;  2QS2 A;  3M3K A;  2QSX A;  4ZED A;  4GL0 A;  3LBS A;  3PPR A;  3UP9 A;  5EHM A;  4ZEI A;  5BUU A;  1YAE A;  1RYX A;  4ONY A;  4GD5 A;  3ZSF A;  1LBB A;  3D4G A;  5A5X B;  1EZP A;  4ZEC A;  4TQU Q;  3B6Q A;  3M3F A;  3QK6 A;  3TPA A;  1S50 A;  3RNN A;  1S7Y A;  3HV1 A;  4ZZE A;  1MQD A;  2A5S A;  3Q29 A;  2FA7 A;  3ZKL A;  5ICQ A;  1JNF A;  3VXC A;  1HSE A;  2Z8E A;  4IGT A;  1XHY A;  4MH5 A;  1H44 A;  4DCY A;  4TLM B;  4E0W A;  2F7A A;  3OSR A;  1MG1 A;  4JXI A;  5KCJ B;  3MAM A;  3C9H A;  4O3B A;  1B5H A;  2OK2 A;  3T9X B;  4LQ2 A;  3KBR A;  4Q8R A;  2A5T B;  1PB9 A;  4U2R A;  5H8F A;  3MP6 A;  3U94 A;  4QFL A;  1B58 A;  5F1Q A;  3OEM A;  4YU0 A;  2QS1 A;  3O28 A;  3VLU A;  2O7U A;  3C34 A;  4PFY A;  4DDD A;  1B7U A;  2CMO A;  2HFB A;  3BBR A;  4IY6 A;  2ZNT A;  3TMG A;  4R74 A;  3MVZ A;  5KDT B;  5B70 A;  1LAH E;  2DE4 A;  3QYT A;  3SEX A;  1O64 A;  3FVO A;  3IB0 A;  2X7Q A;  4NWD A;  2ZYO A;  4XXU A;  4HCW A;  4QFP A;  3S9M C;  4RYA A;  2DP8 A;  5H8Q A;  1TFA A;  4FOR A;  3FZV A;  4U22 A;  3H6U A;  4PFW A;  3OO7 A;  3IOU A;  2G93 A;  3VVE A;  3ODB A;  1NH7 A;  4G77 A;  1WOD A;  1B2H A;  3QAX A;  2O51 A;  4IO6 A;  2AIX A;  3H6T A;  4QFK A;  5CMC A;  4NF5 B;  1L5T A;  3CFL A;  4LUB A;  3SEU A;  4LVQ A;  5H8F B;  2D5W A;  3PMV A;  3PMX A;  2FNC A;  2Y7W A;  3FV2 A;  5AA2 B;  4WKM A;  2UYE A;  1MPB A;  4FAJ A;  2F36 A;  1N3X A;  3M8U A;  2I3V A;  1UTH A;  1FTJ A;  2DXY A;  3VVD A;  1NMU A;  5I57 A;  2PYY A;  5AE4 A;  4GLI A;  3FVN A;  3HHF A;  2QS3 A;  4BDL A;  3CR9 A;  5CMK A;  3TQW A;  2XXU A;  1MY2 A;  4G4P A;  1ZTY A;  5F7V A;  5KDT A;  3LSL A;  3KN3 A;  3R26 A;  3MPK A;  4GQO A;  3KZG A;  1IXI A;  1FQC A;  1GR2 A;  1MQH A;  2UVI A;  3HN0 A;  3A09 A;  1OIB A;  4PFU A;  5CMM A;  1MQG A;  3PUX E;  4EQB A;  2F7B A;  2HCA A;  1MY0 A;  4XKN A;  4N13 A;  4F18 A;  1MDQ A;  4N07 A;  3UOR A;  3TTM A;  2PX1 A;  1B3F A;  2Y7K A;  3C32 A;  1ZKB A;  3WAE A;  5I2K A;  2UVJ A;  1MM6 A;  3H7M A;  1HSJ A;  4LP2 B;  2I0B A;  1LCF A;  3PPO A;  4MBP A;  2GRV A;  4KYS A;  4YB6 A;  2Q2A A;  1BTJ A;  3K6X A;  4ISU A;  4LQ5 A;  3BKI B;  5TPA A;  3V5A A;  4ECF A;  1AMF A;  1B05 A;  1DTG A;  1F9B A;  3FXR A;  5DEX A;  2ZNU A;  3GXA A;  3RLF E;  3U93 A;  4ESW A;  4BDO A;  4F3S A;  3TOD A;  4I9D A;  1Y20 A;  1MH3 A;  4R6H A;  1A40 A;  3FXQ A;  3B6W A;  1R9L A;  5TPA B;  2I4C A;  3VE1 B;  2HZK A;  2IA4 A;  3PD8 A;  3V89 B;  3BFT A;  1LFI A;  1OMP A;  1N0T A;  1SI0 A;  4C1T A;  3S9L C;  1GVC A;  4HTG A;  5I2K B;  5DYH A;  3CSB A;  3EPE A;  4EF1 A;  1I6A A;  1D9V A;  4YMA A;  3HPI A;  2RC7 A;  3G3K A;  3K02 A;  4F1Y A;  3I6V A;  4QRZ A;  4G68 C;  4R9G A;  5I56 A;  1WVJ A;  4OFO A;  4KHZ E;  3FUZ A;  3CFZ A;  3IJO B;  4PP0 A;  4F2Q A;  2ESN A;  3EHS A;  3Q28 A;  4E0X A;  1ZMG A;  3E3K A;  3TKD A;  3EQ1 A;  3FGS A;  2RCA A;  3MZ1 A;  3PV0 E;  4QFN A;  3SES A;  3U1O A;  4Z7E A;  2RIN A;  1UTB B;  3DP4 A;  1Q1K A;  2ALU A;  2F7C A;  5DVJ A;  2P1S A;  2VP1 A;  2Q8J A;  3RPW A;  4AB5 A;  2ANJ A;  1B51 A;  1NL5 A;  1PC3 A;  3SEW A;  2XXI A;  3K6W A;  3FJM A;  1EZ9 A;  3O66 A;  1IQ7 A;  2HEU A;  3IX1 A;  4QSE A;  5H8H B;  3OO8 A;  1LCT A;  3I3V A;  4R75 A;  1LBC A;  3RT8 A;  4DXU A;  4AB6 A;  5FHO A;  4F29 A;  5TP9 A;  4F3B A;  1URG A;  4RK9 A;  4FAT A;  4IGR A;  4R2B A;  4WXJ A;  3N6U A;  3T9H B;  3UK4 A;  3W15 C;  3L6H A;  4LON B;  4DLD A;  4F19 A;  5J1D A;  1I6Q A;  1PDA A;  4G2Z A;  1UIU A;  4U21 A;  1B0H A;  2DWH A;  2I48 A;  2ONS A;  3ILT B;  4MLV A;  3TTN A;  4BDQ A;  2QJE A;  2ZMB A;  1MXZ A;  3ONM A;  1T0K A;  1FTL A;  5HM4 B;  4QSD A;  5L9S A;  1R1N A;  4X9T A;  4ZEK A;  1LLS A;  1PB7 A;  4GXA A;  1VSO A;  4OYV A;  2OWS A;  1I6B A;  2H99 A;  2PT2 A;  3MPL A;  3K1N A;  4OTE A;  3KJT A;  4XIG Q;  1IIT A;  1M5F A;  2F34 A;  4PE5 B;  1POT A;  3CVG A;  2YLN A;  3BFU A;  3N5L A;  4KPT A;  1BIY A;  2UYF A;  4H65 A;  1N7X A;  4GFR A;  5I59 A;  3G3H A;  1B46 A;  2DSF A;  4H5G A;  3E13 X;  4I1D A;  5AA2 A;  4R73 A;  3MC2 A;  3DP6 A;  5DTB A;  1MPC A;  2W7Y A;  3FJ7 A;  3IK6 B;  1US5 A;  3MWB A;  3MZ9 A;  3H03 A;  4XKQ A;  3CSG A;  4F1V A;  3CI8 A;  4OEN A;  2IEE A;  4X1D A;  3VFJ A;  3U8Q A;  1XVX A;  4ZEF A;  5A5X A;  4WEP A;  3PD9 A;  1I69 A;  4U4S A;  4NE4 A;  1NNT A;  1FQA A;  1PBP A;  3B6T A;  4Q30 B;  3THI A;  4GIZ A;  4YKI A;  2F78 A;  2ONK E;  3LSF B;  4ELP A;  1PB8 A;  1JVY A;  3UGW A;  2PVU A;  3MVW A;  2I6E A;  3C33 A;  5JTY A;  4R6Y A;  1OVB A;  5EYF A;  3IL1 B;  2F8D A;  4POX A;  2R71 A;  4OER A;  3RTW B;  4L17 A;  2Y84 A;  3TEP A;  1MXW A;  3KOS A;  1XVY A;  4FEC A;  1QUL A;  3PPN A;  2YJP A;  4OVJ A;  3TEL A;  3VVF A;  1CE2 A;  4GF8 A;  4P0G A;  1RYO A;  4F3P A;  4YZZ A;  5L9O A;  4JSO A;  4RA1 A;  5KZT A;  1FW0 A;  2DVC A;  3OXN A;  2O6A A;  1Y1Z A;  3KOT A;  2Y7R A;  3LSW A;  3RUM A;  2FYI A;  4EXL A;  1UTB A;  2DWA A;  3FAS A;  4RPO A;  4UA8 A;  3R7X A;  3G3J A;  5JK4 A;  1QVS A;  1B3E A;  2QPQ A;  4NWC A;  3PGF A;  4PFT A;  1B4H A;  1JW1 A;  3QIM A;  4R6K A;  2PBW A;  3M3L A;  3C36 A;  2OZZ A;  2ZXT A;  3MUQ A;  5H8N B;  2XD2 A;  3C31 A;  1ANF A;  3OD7 A;  1ATG A;  4IO2 A;  4JBZ A;  4DXB A;  3EHT A;  1S9T A;  1TXF A;  3G3I A;  4X48 A;  1SYI A;  5ICT A;  2UVG A;  1JQF A;  1OQG A;  1D9Y A;  3WAF A;  2H25 A;  3S9N C;  3KN7 A;  1BP5 A;  3H4Z A;  4NF8 A;  5H8S A;  4KR5 A;  2V3U A;  3USD A;  4YB7 A;  3Q25 A;  4UAC A;  3OEL A;  3UIF A;  1VE4 A;  5HPQ A;  5B7D A;  4DCX A;  4F3G A;  4FIM A;  2B65 A;  2NWJ A;  1TWY A;  1B5I A;  4G68 A;  3SDF A;  2VGQ A;  4ELQ A;  3K0V A;  1D3K A;  1A7L A;  1B3H A;  3IR1 A;  3N26 A;  1D4N A;  3HO7 A;  3KG2 A;  2O69 A;  1M5C A;  4H1X A;  3MZB A;  2XX8 A;  1VFE A;  4JWX A;  1DTZ A;  1IXH A;  2DWI A;  3K2D A;  3MP1 A;  1O7T A;  3DEL B;  4M4G A;  4NF6 B;  1ZIU A;  4QHQ A;  4IO3 A;  2HXW A;  3Q26 A;  2DS9 A;  4QFO A;  2QL3 A;  4RPN A;  5TU0 A;  2DWJ A;  2RC9 A;  4FEB A;  1AIV A;  3EF7 A;  1DSN A;  5ELV A;  4DZ1 A;  1R9Q A;  2HZL A;  3SKP A;  1Z7M E;  3P7I A;  3MJN A;  4Q0C A;  4XKP A;  4WED A;  3CG3 A;  4ZE9 A;  5I2N A;  3TCG A;  4O3C A;  1LFG A;  4OXV A;  5CRY A;  2A5T A;  2GFE A;  4HCY A;  5I56 B;  1B7Z A;  2V25 A;  2VHA A;  2XXP A;  1SVX B;  2LAO A;  4G8N A;  4GVO A;  4LZ8 A;  5ITO A;  3TZA A;  5I58 B;  2XD3 A;  1TT1 A;  2NUV A;  3Q27 A;  3RY3 A;  1FQF A;  5TP9 B;  4EQ7 A;  1QUK A;  3E4R A;  4KYE A;  3TFL A;  2V84 A;  4ELR A;  4NF6 A;  2G29 A;  2GHB A;  2QMW A;  2RC8 A;  4KFQ A;  1DPP A;  3IOR A;  5FTI A;  1JW4 A;  4H8J A;  4EDP A;  2Z23 A;  3RGY A;  2THI A;  3ECR A;  4FED A;  4M1V A; 
#chains in the Genus database with same CATH topology
 1YSY A;  2DHR A;  4MGK E;  2LBC A;  4KT0 F;  1HSL A;  1FSA A;  3H06 B;  1UFZ A;  3OOA A;  4M9S A;  4NL4 H;  3Q8X A;  4JI3 M;  1R5L A;  3MHV C;  4L4U A;  2QRY A;  2ZNS A;  1VQ1 A;  1NFT A;  1Z6T A;  3TCF A;  2PFZ A;  2H1R A;  1EYK A;  2XWV A;  3SET A;  4F31 B;  1IXR C;  4F22 A;  4P11 A;  4LJ7 A;  3W0F A;  2V4C A;  3OEN A;  3R9X B;  1W5T A;  2QCU A;  1QYR A;  2K0B X;  4OHN A;  4MFI A;  3H3G A;  3JR5 A;  3DA1 A;  3ZKK A;  3JAM S;  2UXA A;  3B9P A;  3O9P A;  1Y3N A;  4PAI A;  2Q2C A;  1N84 A;  1SW2 A;  3J2P B;  2XFS A;  4I62 A;  3B7Q A;  4JXJ A;  1J1N A;  4IBJ A;  5EYG A;  5I58 A;  2M8C A;  3FVG A;  3RFW A;  4JWY A;  4PCD A;  1R6B X;  3FVK A;  3PU5 A;  4GL8 A;  3VK7 A;  2FE8 A;  4D80 A;  1AWB A;  3VXB A;  2RCB A;  4FE8 A;  4H6D A;  1OAI A;  4TUW A;  1B3L A;  2NXO A;  2PT1 A;  4F2O A;  2Z3X A;  5KCJ A;  2XXW A;  4LRT A;  3K6U A;  1M5D A;  3V8X B;  2VF8 A;  2CZL A;  1PJQ A;  4OFJ A;  3M0E A;  2WKY A;  4MEV A;  2OPF A;  2Y7P A;  2O84 X;  1PJJ A;  2Y7I A;  4TOZ A;  2ZYK A;  4R2F A;  1FTO A;  2L4F A;  3THG A;  5H8Q B;  5FHN A;  5AA1 A;  1A99 A;  1URS A;  4BBA A;  5F24 A;  1NHG C;  2KR0 A;  4YKJ A;  4GHA A;  3QAU A;  1A8F A;  3DM0 A;  3O97 A;  1H3D A;  3D4C A;  1XC1 A;  4HS7 A;  3EN3 A;  4NTL A;  4I8O A;  3HHZ A;  2E1S A;  2LWX A;  1Q02 A;  4LF4 M;  4OEV A;  2Z8F A;  3GLI B;  1US4 A;  3FBP A;  2RKM A;  1GKI A;  1OIZ A;  1MQI A;  1MS7 A;  3ZS6 A;  4K3F A;  2QHO B;  4P17 A;  1N32 M;  1ZMU A;  3T66 A;  3KN8 A;  2W82 A;  3PPQ A;  2RF1 A;  1L2D A;  2F6P A;  5F3W A;  5CBS A;  3U6C A;  3VFD A;  4ZDM A;  2Y0T A;  4QBA A;  4U4X A;  3LR1 A;  2K47 A;  1NH8 A;  1MY4 A;  3KFU G;  1GV8 A;  2V1U A;  4DV0 M;  3KBZ A;  2Y20 A;  5DFL A;  1RDY A;  4C1U A;  3IO4 A;  1WDN A;  1Q35 A;  3QUJ A;  3FIR A;  1NUY A;  3TWM A;  3L6G A;  2L5V A;  1A55 A;  1OQY A;  3TUS A;  3KOZ E;  1NKX A;  4PCZ A;  1UTH B;  3TQL A;  1EZO A;  1N3W A;  4PBQ A;  1VFD A;  1PM5 A;  3MVY A;  2BNK A;  1OIP A;  2P0S A;  3JZJ A;  3T1Y M;  1R2Y A;  1KFV A;  1LAF E;  3K1P A;  3T93 B;  2HAU A;  4HE1 A;  1LB8 A;  4B7H A;  1NNJ A;  3GBB A;  4DR3 M;  5CMB A;  4OET A;  3VK8 A;  1ELJ A;  1JVX A;  2ERC A;  4LJA A;  4KQP A;  2R6F A;  4XGI A;  1B7H A;  2CWB A;  2D3I A;  3R6U A;  1FPD A;  2V3T A;  1FTK A;  3KFM A;  2QBY A;  3BXW A;  3SFZ A;  3F11 A;  3ILK A;  2Q89 A;  1LFH A;  4PAF A;  2RKO A;  4U1O A;  3IO6 A;  1MQJ A;  1DOT A;  4YKK A;  1R6Z A;  2O7I A;  3AFH A;  1K82 A;  4KD5 A;  4N8Y A;  1YXI A;  2BJW A;  2ONR A;  3PNV A;  3UK6 A;  2V93 A;  1ZLQ A;  4ZEB A;  1G3I A;  1V34 A;  2LHG A;  3IG5 A;  2Z22 A;  4I5S A;  4LF5 M;  4KYD A;  1SXJ E;  1NI9 A;  1IEJ A;  2Y5K A;  4IO5 A;  2QS2 A;  4NAP A;  4GL0 A;  4JVD A;  5A5X B;  3GO8 A;  3B7Z A;  3RNN A;  1IN8 A;  1S7Y A;  2WYP A;  3HV1 A;  4ZZE A;  2K9D A;  1IQP A;  1QUT A;  1SXJ B;  4JYA M;  4IGT A;  3AJI B;  4IBB A;  3C9P A;  5KCJ B;  1MG1 A;  3C9H A;  4GC5 A;  2YFQ A;  1IBK M;  2A5T B;  5H8F A;  1NY6 A;  1ZQ9 A;  5FTJ A;  3VLU A;  2B4M A;  2HXR A;  2O7U A;  1JB0 F;  3K9O A;  2HFB A;  4YHH M;  1LBY A;  1LAH E;  4MH0 E;  2QVU A;  1IY2 A;  2ZYO A;  4XXU A;  1XXH B;  3A46 A;  2FH0 A;  3U6M A;  4QFP A;  4F1I A;  5I7I A;  4MNI A;  3S9M C;  5H8Q A;  4I40 A;  4U22 A;  1P3Q Q;  3OO7 A;  2G93 A;  2YQZ A;  4IBK A;  4M9X A;  2AIX A;  1L5T A;  1L1T A;  3PMV A;  4BLC A;  2Y7W A;  2UYE A;  1N3X A;  3VVD A;  2KRU A;  2XGN A;  1DK4 A;  3TQW A;  2WBD A;  3LSL A;  3KZG A;  5EHM A;  1FQC A;  1MQH A;  2UVI A;  1IN4 A;  2HCA A;  2RGH A;  1IMD A;  3RGS A;  4GRI A;  3FTF A;  3TTM A;  1EIJ A;  3C32 A;  5I2K A;  5FTK A;  1MM6 A;  1Q3C A;  2XZF A;  3PPO A;  4DR1 M;  4MBP A;  2LVA A;  2Q2A A;  5TPA A;  5ET6 A;  3EIH A;  4OU7 A;  1AMF A;  1DTG A;  5DEX A;  2Z4S A;  3RLF E;  3U93 A;  4ESW A;  1K3X A;  3T0J A;  4KO8 A;  1A40 A;  3FKE A;  1R9L A;  2I4C A;  1LFI A;  1OMP A;  1SI0 A;  3S9L C;  2XWI A;  4LFA M;  1PGY A;  1D9V A;  1LBV A;  4MCO A;  2CEA A;  3GQ3 A;  5JI2 E;  2JWS A;  2OO9 A;  4PT5 A;  4PP0 A;  4R71 A;  4GH9 A;  3GRV A;  3J7B A;  3Q28 A;  3HJS A;  2FVZ A;  3FGS A;  4QFN A;  1EFU B;  2F5P A;  4OVT A;  2RIN A;  1Q1K A;  3L27 A;  2F5O A;  2ALU A;  2F7C A;  2VP1 A;  5DVJ A;  3RPW A;  1OKS A;  1FBD A;  1FPL A;  2ANJ A;  4GWY A;  3RPL B;  3K6W A;  3W0L B;  2CUZ A;  2HEU A;  4G4Q A;  5DYG A;  2EA0 A;  3W15 C;  3N6U A;  1INP A;  3L6H A;  1MJG M;  4U21 A;  4LCB A;  3GPU A;  3VKG A;  3U65 A;  2QJE A;  3LVW A;  4H46 A;  3ZCB B;  3I4Y A;  2H99 A;  2PT2 A;  3E9S A;  1IIT A;  2BWE A;  2F34 A;  1PJS A;  3CVG A;  2YLN A;  3BFU A;  1XXH A;  4KOD A;  5I59 A;  1TTE A;  3FD9 A;  5AA2 A;  4B7G A;  4I1D A;  2L7I A;  2W7Y A;  4LJ4 A;  1US5 A;  3KP1 E;  4F1V A;  3CSG A;  4OEN A;  4ZEF A;  5A5X A;  4WEP A;  1I69 A;  1NNT A;  3THI A;  1FPK A;  4ELP A;  2MKZ A;  1PB8 A;  3UGW A;  3C33 A;  4R6Y A;  5EYF A;  2D7E A;  1GVN A;  1SXJ A;  2VPN A;  4L17 A;  2Y84 A;  3VVF A;  1XVY A;  2L7H A;  4GF8 A;  4P0G A;  1FBC A;  1RYO A;  4F3P A;  3EKI A;  4JSO A;  1GLN A;  3OXN A;  4MIJ A;  1TF0 B;  3RUM A;  3FAS A;  2Q8M A;  4LN5 A;  1JW1 A;  1C1K A;  4QHS A;  4LZJ A;  1DV0 A;  2O5R A;  3MUQ A;  3C31 A;  4FBP A;  2BJV A;  4CIZ A;  1TXF A;  4JN6 A;  3KVW A;  4GX6 A;  2H25 A;  3S9N C;  4JVC A;  2LNH C;  4KR5 A;  3Q25 A;  2Q74 A;  2WSE F;  1VE4 A;  5HPQ A;  4DCX A;  3KOW E;  2B65 A;  2NWJ A;  3MK6 A;  3SDF A;  1VEG A;  3HKP A;  1A7L A;  3GLH A;  1D4N A;  3KG2 A;  4H1X A;  1M5C A;  4JWX A;  3MZB A;  2X4A A;  5ITX E;  1ZIU A;  3RGP A;  4EIW A;  1LBX A;  1RDZ A;  1NHW C;  3EF7 A;  1DSN A;  5ELV A;  1R9Q A;  2HZL A;  3SKP A;  2I7N A;  3B89 A;  3MJN A;  3AOG A;  4WED A;  2ZZV A;  5CRY A;  5EXP A;  1NVM A;  2NQ8 C;  3GLI E;  1NV7 A;  2V25 A;  2VHA A;  4MB7 A;  5IZZ A;  4GVO A;  1FPE A;  4GWW A;  5I58 B;  4A3V B;  3WHK A;  4L78 A;  1FQF A;  3RY3 A;  2V84 A;  2R45 A;  2VDB B;  4NF6 A;  4ELR A;  3FUX A;  3HY5 A;  3FUU A;  5EJC A;  4XKR A;  3SER A;  3LQR A;  1IN5 A;  4GWZ A;  4R72 A;  1NSF A;  4JI8 M;  3GZG A;  2AYS A;  1SW5 A;  3W9V A;  1MPD A;  3LV0 A;  4DR5 M;  2HCB A;  4DV6 M;  3CFX A;  2FNA A;  1Y4C A;  3T96 B;  3G7W A;  1B3G A;  1N7W A;  2LH0 A;  2KXE A;  2R9J A;  2X8A A;  1Y4T A;  2F6G A;  3TYH A;  4PDI A;  5LMN M;  2H9B A;  4G4R A;  2XZU A;  1HNZ M;  3U6S A;  5DVF A;  4H8I A;  1GAB A;  3VLW A;  4NOO B;  3SEY A;  1WR1 B;  2OX3 A;  2XHD A;  1MDP 1;  3TE6 A;  4AQY M;  2DZL A;  2UU9 M;  1Z7N E;  2GH9 A;  4Q5T A;  3HCQ A;  4NF4 A;  2VD2 A;  2Y5L A;  1LAG E;  2OLB A;  4X65 M;  2P3N A;  3KGC A;  4N4U A;  3S2V A;  3GLG B;  1FCK A;  1N76 A;  4GEW A;  3LC8 A;  3BOS A;  1QAM A;  4BLA A;  4MLQ A;  2JY5 A;  3K2L A;  1SI1 A;  2REJ A;  3FV1 A;  1B52 A;  5EP3 A;  4LJ5 A;  2E5L M;  3DP8 A;  4OES A;  1Y3P A;  1UIV A;  1NV5 A;  1D0M A;  3TTK A;  3K4U A;  1XOC A;  3HJ8 A;  5DYI A;  1WXQ A;  1E9R A;  3SAS A;  5L8D A;  4OFL A;  2XX9 A;  2MGW A;  4PET A;  1GTK A;  1NV6 A;  1DGH B;  3A45 A;  4AQ4 A;  4ZZA A;  3I5O A;  5I59 B;  1USY H;  3TDJ A;  2L6O A;  2KNA A;  1AL3 A;  2UVH A;  3U6O A;  1P1U A;  3TAJ A;  1K9Z A;  4WUR A;  3IJX B;  4LZ5 A;  3A98 B;  3SAT A;  1SDX A;  2KDL A;  4OZ9 A;  1LGB C;  1DPE A;  4RK2 A;  3IB2 A;  1B0L A;  1P1O A;  4YB5 A;  4EUO A;  4NF5 A;  4AKH A;  2DI0 A;  4RXL A;  2DYX A;  4G8M A;  2UUC M;  4O3A A;  4Q7J A;  4DBG B;  5H8H A;  2P3V A;  3CF0 A;  3C4M A;  2H4I A;  3KSX A;  1ZJL A;  2I58 A;  2CP8 A;  4QSC A;  4WW0 A;  4CGY B;  1SBP A;  1FPJ A;  1P99 A;  3T9V A;  1GJS A;  1URD A;  3T22 A;  3OMB A;  4EXK A;  3J27 B;  2DOJ A;  2X7P A;  1VR5 A;  4TLL B;  3H4J A;  1ZBM A;  1QJM A;  3UZU A;  1IMC A;  4GX3 A;  4YY3 M;  1XNR M;  1JET A;  2CZK A;  1W5S A;  1ZU0 A;  4X62 M;  4YIC A;  3LQQ A;  5M2V A;  1NV1 A;  1AH5 A;  4GXS B;  2GHA A;  1XMQ M;  5GKN A;  2QNJ A;  1SYH A;  2XXV A;  4HXV A;  2VII A;  2F5X A;  3KEI A;  1Z59 A;  1QZE A;  3JYR A;  4BDM A;  4NXN M;  3GLH B;  1NNK A;  4HW8 A;  3HU3 A;  5EHS A;  4MF3 A;  3FXU A;  1JR3 A;  4GOT A;  2XA5 A;  3K1J A;  1XXH E;  3PUZ E;  1XT8 A;  2XXX A;  4LFB M;  3RQT A;  3N6T A;  2P5T A;  4QOS A;  5BPV A;  2F5N A;  3B7N A;  4HE0 A;  5I57 B;  2DAK A;  1CB6 A;  2XXH A;  4MGI E;  4QF9 A;  3GBA A;  3W9W A;  5C18 A;  2QP9 X;  2AL4 A;  2QVR A;  3NOH A;  4P0I A;  5ISU A;  4OVP A;  5BWJ A;  3NWL A;  1SW1 A;  1MXY A;  1MXU A;  4B3T M;  3KSJ A;  4QNM A;  3Q8G A;  2NVU B;  1RKM A;  2F3B A;  3IFC A;  3PTY A;  5IZ3 A;  2CEX A;  3PUV E;  1DGH A;  1PBQ A;  1NNU C;  1JQJ C;  2Q88 A;  4H5F A;  3D8L A;  1VDW A;  3RYD A;  3L29 A;  2XWO A;  4LGY A;  4H45 A;  3K6V A;  4R9F A;  4IB2 A;  4PQJ A;  3VV5 A;  3FTE A;  3O2A A;  4NMY A;  1LTM A;  4BDN A;  3M6A A;  3EHU A;  5K2Y A;  4AG6 A;  2PFY A;  1IY0 A;  1JW5 A;  5ET5 A;  4NF0 A;  3K1M A;  2UXD M;  4CIS A;  3VDU A;  3EIE A;  1N77 A;  4IBE A;  4REZ A;  4BDR A;  4GRK A;  2O1M A;  4G68 B;  2J5Y A;  2R8T A;  1N36 M;  3M3K A;  2QSX A;  4ZED A;  3UP9 A;  1NV9 A;  1FJG M;  1LBB A;  2GQF A;  3D4G A;  4ZEC A;  2O01 F;  4FCT A;  4S12 A;  3HZJ A;  2I7P A;  3M3F A;  4P1E A;  4F29 A;  1AIP C;  1MQD A;  3ZKL A;  2FA7 A;  5ICQ A;  1T43 A;  1JNF A;  1G41 A;  1XHY A;  4DCY A;  3GRR A;  4AI6 A;  4JXI A;  4O3B A;  3T9X B;  3KBR A;  4U2R A;  1MU5 A;  4YU0 A;  1YZ0 A;  4PFY A;  1B7U A;  4RKU F;  4NRW A;  4IY6 A;  3TMG A;  4DV2 M;  3MVZ A;  4R74 A;  2DE4 A;  3QYT A;  3FVO A;  4MHF A;  2X7Q A;  4NWD A;  2CFO A;  1GJT A;  3SC3 A;  4HCW A;  4RYA A;  2LTU A;  1ZMW A;  2KZS A;  3H6U A;  4PFW A;  3IOU A;  5IRE B;  1FJ6 A;  4DV7 M;  3ODB A;  3HWS A;  1B2H A;  2O51 A;  2R4E A;  3H6T A;  5CMC A;  4WP2 A;  3CFL A;  4N81 A;  4LVQ A;  2D5W A;  1XC8 A;  2LVQ D;  4FAJ A;  2F36 A;  3M8U A;  1V92 A;  2I3V A;  4N17 A;  1FTJ A;  4AW4 A;  2PYY A;  4O94 A;  4GLI A;  3FVN A;  2QS3 A;  3CR9 A;  4G4P A;  1ZTY A;  2C99 A;  3R26 A;  3MPK A;  3RT6 B;  3HN0 A;  1OIB A;  4MGH A;  1MQG A;  4N13 A;  4NC6 A;  4F18 A;  3GLF B;  1MDQ A;  3AOE A;  3BIG A;  4O7M A;  1HSJ A;  2CE7 A;  2I0B A;  1N34 M;  1LCF A;  2RGO A;  2GRV A;  1T6O A;  4ISU A;  2KNV A;  3OTO M;  3FXB A;  5JI3 E;  5DNY A;  4PD2 A;  2DVW B;  4MNC A;  3FXR A;  1J09 A;  1NUZ A;  4FWD A;  1N75 A;  2UXC M;  1FPI A;  4I9D A;  2M5Z A;  1ZMV A;  3FXQ A;  1LV7 A;  5L8R F;  2OWZ A;  2IA4 A;  2DKL A;  3PD8 A;  4X66 M;  5I2K B;  5DYH A;  4M0W A;  3CSB A;  3EPE A;  4PGP A;  4EF1 A;  4YMA A;  3HPI A;  2RC7 A;  3K02 A;  4P56 A;  1WGN A;  4R9G A;  5I56 A;  4MGZ E;  1LBZ A;  1ZMG A;  2G3Q A;  1IXZ A;  4OVZ A;  3MZ1 A;  2K6B A;  3PV0 E;  4ANR A;  3HJQ A;  8CAT A;  1B51 A;  4Y28 F;  5EQT A;  2HHH M;  1PC3 A;  4PGN A;  1FBP A;  4R75 A;  1LBC A;  1NO1 A;  1EYI A;  5TP9 A;  4G6Z A;  4F3B A;  1QGX A;  3FUV A;  4LON B;  2UUB M;  4DV1 M;  1UIU A;  2DWH A;  2I48 A;  4P8B A;  3F92 A;  4BDQ A;  2V1C A;  3SAV A;  1T0K A;  1FTL A;  4QSD A;  4X9T A;  4N6K A;  1QVR A;  4L15 A;  4GXA A;  4OYV A;  2OWS A;  4XIG Q;  2APL A;  2DWZ B;  2DXI A;  3FTC A;  3KXE C;  3G3H A;  3L2A A;  1N78 A;  4JI5 M;  4H5G A;  4R73 A;  5IKB A;  3DP6 A;  5DTB A;  1MPC A;  3IK6 B;  1XVX A;  3NBI A;  3PD9 A;  5IZ7 D;  4XEQ A;  4NE4 A;  1YLA A;  4I3E A;  4Q30 B;  4DI4 B;  1CNQ A;  3LSF B;  1R2Z A;  4OAN A;  2PVU A;  5JTY A;  3IL1 B;  4UN2 B;  1QUL A;  4PDG A;  4YZZ A;  4RA1 A;  4GKK M;  1FW0 A;  2DVC A;  2Y0Q A;  2O6A A;  2Y7R A;  2DZO B;  5KPR A;  2DWA A;  1E32 A;  4UA8 A;  3VDP A;  5JK4 A;  4PFB A;  4ITQ A;  1Q3B A;  1XMO M;  4GKJ M;  5H8N B;  2XEP A;  1FPG A;  2OOB A;  4DXB A;  1JQF A;  2VQE M;  2MR9 A;  3GPP A;  3GYY A;  1T3T A;  3U6E A;  3USD A;  4YB7 A;  5B7D A;  4FIM A;  3U5Z B;  1PRB A;  1WHC A;  4ELQ A;  3K0V A;  2WSF F;  3HO7 A;  1NV2 A;  4PFI A;  2XX8 A;  1VFE A;  1IXH A;  4MNP A;  5IZ3 B;  1GO5 A;  3E46 A;  4IO3 A;  3FRI A;  2DS9 A;  4RPN A;  2QL3 A;  2RC9 A;  3P7I A;  4DR2 M;  4ZE9 A;  5I2N A;  2VF7 A;  3C3E A;  4OXV A;  2MJ5 B;  3BBZ A;  2Y21 A;  2FOI C;  1B7Z A;  2XXP A;  4G8N A;  1SVX B;  2NUV A;  3Q27 A;  5TP9 B;  2DDK A;  2KEB A;  4KYE A;  2KA6 B;  1CUK A;  2EJS A;  1DPP A;  5FTI A;  1JW4 A;  3AKZ A;  4H8J A;  3ECR A;  4OX9 M;  1NV4 A;  1YUB A;  2VOZ A;  1QZM A;  4G4O A;  3SEV A;  5CC2 A;  1E9S A;  5FHM A;  4P9K A;  2L2D A;  1TDH A;  4LAT A;  3MQ9 A;  3IFA A;  1SW4 A;  1B5J A;  4IO7 A;  4GMQ A;  1IFY A;  1DGG A;  3MVX A;  4DR4 M;  4RNS A;  3HFU A;  3S4U A;  4NHB A;  3FUT A;  4LJ6 A;  2Z4R A;  2OBG A;  4W5W A;  5KO3 A;  2HPG A;  1P1N A;  2DAM A;  4JV5 M;  5T3J A;  3N94 A;  1M5E A;  1IXC A;  2H98 A;  4EQ9 A;  4F1U A;  2XWK A;  2DQV A;  4PDD A;  1H43 A;  1E94 E;  2D21 A;  3GPX A;  2N35 A;  1HJP A;  5KPZ A;  4JI7 M;  4LF6 M;  2UUA M;  2BWB A;  5FSW A;  3R8F A;  2X49 A;  2CHG A;  4HL4 A;  3LSX A;  4OQO A;  5I84 A;  3UA8 A;  1FQE A;  1N33 M;  5C1B A;  3HU1 A;  3IOT A;  1LAX A;  3LVV A;  1USY E;  2V6Z M;  1OVT A;  5ITP A;  2QQ8 A;  1S3S A;  5AA4 A;  4UAB A;  4F39 A;  1OLC A;  4LY6 A;  3UMM A;  1YCJ A;  3OO6 A;  3B8B A;  1LBW A;  2C9O A;  5HBC A;  1XWI A;  2ABH A;  5DEX B;  4ZE8 A;  4AG5 A;  4I8C A;  1XB2 B;  1B9J A;  1B1H A;  4U23 A;  3CG1 A;  5K2X A;  3FTD A;  4ESX A;  1H45 A;  2ZZW A;  3V83 A;  4JDF A;  1SXJ D;  4IO4 A;  2O68 A;  2QMX A;  3PMW A;  3SZP A;  3QUF A;  1IUD A;  2XXK A;  4PTK A;  3KDS E;  2C5R A;  1DBZ A;  1MM7 A;  5I5P A;  1FBG A;  4GWX A;  1KWH A;  1QAN A;  1BK4 A;  1HT2 E;  1V33 A;  2PCR A;  5FTH A;  4DIG A;  2CEY A;  1FTM A;  1FRP A;  1EE8 A;  5L9M A;  1OJL A;  4PAK A;  5E6J A;  2VT5 A;  4N6P A;  1LB9 A;  1NV0 A;  3GPY A;  3G3G A;  2QS4 A;  4H67 A;  1B40 A;  4QHT A;  2CHQ A;  1QUJ A;  4PF8 A;  1LEV A;  4PC9 A;  2ZAN A;  4XBO A;  4MGY E;  1FQB A;  1MH4 A;  3QYE A;  3H4M A;  4LZ7 A;  1R4G A;  4MX6 A;  4B3R M;  3U92 A;  4G4N A;  1IBL M;  3IAZ A;  4JVI A;  3B7D A;  1YPN A;  1TGU A;  5EQA A;  2B4L A;  3LUY A;  1Y3Q A;  4LA9 A;  2OWT A;  3IOV A;  4Z6Y A;  4YAH X;  2VQF M;  3KOX E;  3O6I A;  2ZAM A;  3FD3 A;  4DR7 M;  2XXQ A;  3QXM A;  3A3U A;  1Y9U A;  3HHG A;  2XX7 A;  4LJ8 A;  1IIW A;  1Y1M A;  2XXY A;  3OSQ A;  4YMB A;  3PFI A;  1KSF X;  1MN3 A;  3KOY E;  1VDL A;  3MJ5 A;  2H5Y A;  1MY1 A;  3KS8 A;  3KC1 A;  3KJ7 A;  3G3F A;  2JP7 A;  3FE3 A;  3LW5 F;  5CBR A;  3WHL A;  3AOE C;  2I4B A;  1IM2 A;  5LOM A;  5AA4 B;  3RTF B;  1FBF A;  2AL5 A;  3AXF A;  2I3W A;  3O6H A;  3FJG A;  2X26 A;  4XF5 A;  2JY6 B;  2KHH A;  3SBJ A;  1IBM M;  2HHM A;  3QMF A;  4RJZ A;  3HHW A;  3IB1 A;  4DUY M;  4DV5 M;  1KYI A;  1DMB A;  5H37 D;  1QUI A;  3U72 A;  4NN3 A;  2CV2 A;  1TFD A;  2DVZ A;  3CRB A;  3MBP A;  2XH9 A;  5EXT A;  3MYU A;  2G5G X;  5ITQ A;  3PPP A;  1XS5 A;  1P1Q A;  5ITT A;  3SMP A;  3LBS A;  1YAE A;  1RYX A;  3ZSF A;  2F3D A;  4TQU Q;  2JZ0 A;  3B6Q A;  3TPA A;  1S50 A;  1SG9 A;  1Z5C A;  3U61 B;  2Z8Y M;  2Z8E A;  1JR3 E;  4MH5 A;  1SPI A;  4JI6 M;  4TLM B;  4Q8R A;  2OK2 A;  1I4W A;  1PB9 A;  4GC9 A;  1HNX M;  3U94 A;  4QFL A;  1B58 A;  5F1Q A;  1R7R A;  4O8M A;  3C34 A;  4G61 A;  4FCV A;  1Z5A A;  5I3S A;  2EUC A;  3TWL A;  3DOA A;  1O64 A;  3IB0 A;  3KP0 E;  2JZ1 A;  2D7H A;  2FIE A;  2DP8 A;  1TFA A;  1TDZ A;  3FZV A;  3L26 A;  4K0K M;  3K8Z A;  3I4V A;  4NX1 A;  3CHG A;  3SAR A;  2J7N A;  2HKJ A;  3IHP A;  4LUB A;  4PF6 A;  4AKI A;  3TQS A;  2QFL A;  3PMX A;  3FV2 A;  4RF1 A;  4OVQ A;  4WKM A;  5AA2 B;  1MPB A;  1UTH A;  2C98 A;  2HWJ A;  3E21 A;  1NMU A;  1AOV A;  5AE4 A;  2WYK A;  3GLF A;  1MY2 A;  5F7V A;  5KDT A;  4B3S M;  3KN3 A;  1IXI A;  1GR2 A;  5CMM A;  4JI2 M;  4PFU A;  4PE3 A;  4XKN A;  3W68 A;  1ZV1 A;  1Z5B A;  4N07 A;  2FS1 A;  2PX1 A;  1B3F A;  4NGU A;  1ZKB A;  3WAE A;  5FBP A;  2UVJ A;  4LP2 B;  4ZPX A;  4YB6 A;  3K6X A;  1BTJ A;  3V5A A;  3BKI B;  1F9B A;  1YYZ A;  4L8R C;  4LF9 M;  1VG5 A;  3TL4 X;  3TOD A;  2DWL A;  1MH3 A;  2QPA A;  1ZAE A;  3T38 A;  3NBX X;  3VE1 B;  5A2Q S;  2HZK A;  4IR8 A;  5E26 A;  1N0T A;  2JY7 A;  1I6A A;  3DFZ A;  1KA0 A;  3L25 A;  4F1Y A;  3GLF E;  3I6V A;  4QRZ A;  4G68 C;  1YE9 A;  4KHZ E;  3ISP A;  3FUZ A;  4JI0 M;  3IJO B;  4F2Q A;  1FTA A;  2ESN A;  4E0X A;  4HLQ A;  5LMU M;  3EQ1 A;  3SES A;  1MX0 A;  2RCA A;  2ZTD A;  3QYB A;  4Z7E A;  1D9Q A;  1UTB B;  1IN7 A;  3DP4 A;  5EP1 A;  1H6U A;  3B50 A;  4M0D A;  2XXI A;  1EZ9 A;  5H8H B;  3OO8 A;  5KPT A;  2AHM A;  3SYK A;  4RK9 A;  4WXJ A;  3T9H B;  3UK4 A;  3ZH9 B;  4F19 A;  3I01 M;  1NV8 A;  1PDA A;  1NUW A;  2FBP A;  1B0H A;  4MLV A;  3T6P A;  2ZMB A;  4R3D A;  1MXZ A;  4B08 A;  1TH4 A;  1R1N A;  5L9S A;  4ZEK A;  1LLS A;  1PB7 A;  4QXD A;  4OTE A;  3MPL A;  2ZBK B;  3K1N A;  4DR6 M;  3KJT A;  5EXX A;  2QBY B;  1M5F A;  2DZN B;  5EQ7 A;  1POT A;  3L28 A;  4D82 A;  2QVV A;  3N5L A;  2UYF A;  1N7X A;  4GFR A;  2XFT A;  1B46 A;  2DSF A;  3E13 X;  4DE8 A;  4MM3 B;  3GLG A;  1XHB A;  4DV4 M;  3CI8 A;  4X1D A;  2M60 A;  1L2B A;  4U4S A;  2DWN A;  1PBP A;  1FQA A;  3B6T A;  1VDD A;  4GIZ A;  2F78 A;  4MJO A;  4M9Z A;  1JVY A;  4AZF A;  3U6L A;  4POX A;  3TEP A;  4FEC A;  3KOS A;  3CF6 E;  4OVJ A;  3PVS A;  2YJP A;  3TEL A;  5L9O A;  1WJ7 A;  2ZM6 M;  2EKK A;  5KZT A;  2G8L A;  1Y1Z A;  3KOT A;  2R65 A;  2FYI A;  4GBV A;  3G3J A;  1QVS A;  4PFT A;  3CTW B;  1B4H A;  1QQW A;  1RU3 A;  3QIM A;  1QDT A;  2F5S A;  3GP1 A;  3C36 A;  3M3L A;  2OZZ A;  3GRY A;  3HHX A;  2XSZ D;  1NV3 A;  1ANF A;  3E79 A;  3OD7 A;  1ATG A;  4CJ6 A;  4IO2 A;  4JBZ A;  1S9T A;  3G3I A;  5ICT A;  1SYI A;  2UVG A;  1I94 M;  1D9Y A;  1BP5 A;  3H4Z A;  4NF8 A;  3U6P A;  2GNO A;  4RF0 A;  3J80 S;  3OEL A;  3UIF A;  4L16 A;  4F3G A;  3SMS A;  3UJN A;  4DI3 D;  1D3K A;  1VEK A;  3IR1 A;  3N26 A;  3FRH A;  1DTZ A;  2DWI A;  3MP1 A;  3DEL B;  3FUW A;  4NF6 B;  1Y8G A;  5EQ8 A;  3K9P A;  3T15 A;  2HXW A;  1X37 A;  3SHF A;  3Q26 A;  1AIV A;  2DWJ A;  4QNR A;  1TH3 A;  1Z7M E;  2J7O A;  4Q0C A;  3CG3 A;  4N91 A;  1AUA A;  2KQZ A;  1LFG A;  2ZTC A;  2GFE A;  4HCY A;  4OW0 A;  1WGL A;  2L09 A;  3PNY A;  2ZZX A;  2XD3 A;  1TT1 A;  4GHL A;  4B7F A;  2OOA A;  4EQ7 A;  2DAE A;  1IN6 A;  1QUK A;  2G29 A;  4NRV A;  3IOR A;  4LF7 M;  3RPL A;  3GLG E;  3GRU A;  4IBD A;  2THI A;  2Q2E B;  4FED A;  1NUX A;  4M1V A;  4GWO A;  4NXM M;  2A5Y B;  2F97 A;  3DZD A;  2REG A;  1SD3 A;  1JR3 D;  1NJF A;  2XXT A;  3JV9 A;  5FTL A;  1L2C A;  2NOO A;  2QSF X;  5H8N A;  1NNF A;  2E0S A;  2R46 A;  3AV0 A;  1EU8 A;  1OQH A;  2B3T A;  1FBE A;  3HST A;  1KZ8 A;  4GIT A;  4OVZ B;  1DCU A;  3GLB A;  3TCH A;  2LVP C;  3FAT A;  1D0K A;  1IZ1 A;  2I49 A;  5KQD A;  2VD3 A;  3S9E A;  2KW0 A;  5A5L A;  4LF8 M;  3E9X A;  3OO9 A;  1A54 A;  3SAU A;  3IG8 A;  2ZYM A;  5CI5 A;  1QKB A;  5EP2 A;  4F2L A;  1MXX A;  4U1Z A;  3VLF B;  2KRK A;  3HX3 A;  4RNA A;  3LCV B;  4N8G A;  4PFR A;  3RN8 A;  5ITX A;  1BVS A;  1OLA A;  1B32 A;  2YNM D;  1MY3 A;  4KCD A;  2CV1 A;  2I0C A;  2KLF A;  5DT6 A;  3VLV A;  2XXR A;  4XK8 F;  4FCW A;  4II7 A;  4IY5 A;  4DXC A;  4GWU A;  3K01 A;  4JSD A;  3D1R A;  4AS5 A;  2CZI A;  1DO0 A;  2EKF A;  2BJJ X;  4OEU A;  2YPN A;  3MW0 A;  1P1W A;  1SXJ C;  1B1X A;  3U5Z A;  1QKA A;  1MRP A;  2LXE A;  3K92 A;  2WX9 A;  4NSO B;  4L6V 6;  2KNZ A;  4P16 A;  2OQ4 A;  4Z8X A;  5EP4 A;  3ZC7 B;  2ZAO A;  2F35 A;  2WSC F;  2DE3 A;  3IOW A;  1B4Z A;  2WBB A;  1PEB A;  4NG7 A;  4KHP M;  1WIV A;  1NY5 A;  1LST A;  3PUW E;  2XLJ A;  3MP8 A;  4KCC A;  1Q39 A;  1OTR A;  4ELO A;  2CV0 A;  1YTV A;  5I2N B;  4ZS9 A;  2JXN A;  3C3D A;  4LJ9 A;  3LUZ A;  3QSL A;  4RY1 A;  1SQY A;  2P2A A;  4P3L A;  4FW9 A;  2RRU A;  4XTC Q;  2R4J A;  4O7I A;  1JEU A;  1KA1 A;  2OJT A;  3K00 A;  1QW0 A;  5DVI A;  2L4E A;  2Q9T A;  2V3Q A;  1N04 A;  1B6H A;  3A29 A;  4OVS A;  4NED A;  3PUY E;  3AL0 C;  1POY 1;  1II5 A;  5JEI A;  2HL7 A;  3T9U A;  1JEV A;  1GGG A;  5IM2 A;  1UQW A;  5IZ1 A;  2HQ0 A;  4OWD A;  3OEK A;  4H0W A;  1DGF A;  1OFI A;  3SAW A;  3C35 A;  1HQC A;  1IMA A;  2R0I A;  1OAO C;  3O6G A;  5DW8 A;  4THI A;  3KW6 A;  2Z7J A;  4IJE A;  4GWS A;  2O1L A;  5FLX S;  1IXS B;  1FQD A;  4JI1 M;  3A3C A;  4HE2 A;  3VDF A;  2Z8D A;  2C96 A;  1O63 A;  3O29 A;  1FBH A;  1EH3 A;  2MRO B;  1M5B A;  4ND9 A;  2R6G E;  3VKH A;  1TH2 A;  1BKA A;  1A5T A;  2R62 A;  4X1B A;  3FYD A;  4POW A;  1A8E A;  2HAV A;  1QUS A;  3TWK A;  2LHC A;  4JWO A;  1IY1 A;  2XF3 A;  2DE2 A;  3H6V A;  4D81 A;  4EF2 A;  4JB7 A;  5JTY B;  2PMS A;  2C9C A;  7CAT A;  3IEC A;  1TR8 A;  3FYC A;  1BLF A;  3UN6 A;  1NNP A;  3SHG B;  2F5Q A;  2OCU A;  2B3F A;  3CIJ A;  1FPF A;  3MST A;  5AA2 D;  2B3B A;  2FIX A;  4Z0I A;  2MH8 A;  3M7G A;  4IBF A;  4AS4 A;  1IXG A;  5IAI A;  5H8S A;  4F3S A;  3B74 A;  4B3M M;  5AA3 A;  3C58 A;  4OMB A;  1IMB A;  4KXP A;  1H76 A;  1MXV A;  3H6W A;  2DEN A;  3UGJ A;  3D8B A;  3JR4 A;  1DGB A;  3KS4 A;  5CM6 A;  4P1L A;  2QEN A;  1HR0 M;  2CZH A;  4YKP A;  1OFH A;  2ZYN A;  3HGI A;  5J16 A;  3DLN A;  3ILU B;  2DXR A;  4MMP A;  2FHY A;  2KZU A;  2JJK A;  4I4L A;  4NF8 B;  4DV3 M;  3HU2 A;  4G8H A;  3J81 S;  4C0R A;  4R7G A;  3W67 A;  1PJI A;  4GX4 A;  2D7G A;  2QZ4 A;  4FWG A;  4FJP A;  4KI0 E;  2DAG A;  3TTL A;  4NF4 B;  3A42 A;  1L1Z A;  3PPR A;  4ZEI A;  5BUU A;  4ONY A;  4GD5 A;  3SYL A;  1D0L A;  1EZP A;  4IBI A;  3QWL A;  3QK6 A;  3MMP A;  1Q9D A;  2A5S A;  3Q29 A;  2CHV A;  3VXC A;  2H5X A;  1HSE A;  3LMM A;  1H44 A;  4E0W A;  2F7A A;  2LVN C;  3OSR A;  2FFJ A;  3MAM A;  1B5H A;  1K3W A;  4LQ2 A;  3MP6 A;  2R18 A;  3CGW A;  1G0H A;  3OEM A;  1QAO A;  4FWH A;  2QS1 A;  3O28 A;  4DDD A;  2CMO A;  3BBR A;  2ZNT A;  5KDT B;  1PJT A;  2O25 A;  4G3O A;  4IJF A;  3SEX A;  2XSZ A;  4X64 M;  2DAI A;  4FD2 A;  3PXG A;  4FOR A;  2CRU A;  3VVE A;  4X8R A;  1NH7 A;  4G77 A;  1WOD A;  1F4I A;  1JP4 A;  4IIW A;  5ITY A;  4LFC M;  3QAX A;  4IO6 A;  4QFK A;  1UM8 A;  4MAG A;  4NF5 B;  3SEU A;  5H8F B;  4QOZ C;  2FNC A;  2UXB M;  3E78 A;  5I57 A;  2DXY A;  1FJ9 A;  2HAK A;  3HHF A;  4PDH A;  2JUJ A;  4BDL A;  5CMK A;  2XXU A;  4GQO A;  3A09 A;  3PUX E;  4EQB A;  1VEJ A;  2F7B A;  1MY0 A;  1GL6 A;  3GQ5 A;  3UOR A;  4IBG A;  2DWM A;  2Y7K A;  3H7M A;  2WEF A;  2JNH A;  4LRS A;  4AKG A;  4LZZ A;  4KYS A;  4LQ5 A;  4ECF A;  1B05 A;  3U6D A;  2ZNU A;  3GXA A;  4BDO A;  4P47 A;  5IGA A;  1Y20 A;  4R6H A;  3B6W A;  5TPA B;  2WZJ A;  3V89 B;  3BFT A;  5ITU A;  4JI4 M;  4C1T A;  1GVC A;  4HTG A;  2YR0 A;  3G3K A;  5IT9 S;  1WVJ A;  4OFO A;  2JY8 A;  1IME A;  4PBH A;  5KQ8 A;  3BIH A;  3CFZ A;  4I3Y A;  3EHS A;  3KC0 A;  3E3K A;  3TKD A;  4KLN A;  2BJI A;  3U1O A;  3ROJ A;  3V76 A;  4OVR A;  2P1S A;  1G59 A;  2Q8J A;  4AB5 A;  1C7Y A;  1NL5 A;  3SEW A;  3FJM A;  5EXS A;  3O66 A;  2EO2 A;  3I51 A;  1GL7 A;  3CF2 A;  1IQ7 A;  3IX1 A;  4QSE A;  1LCT A;  3I3V A;  3RT8 A;  1FNN A;  4DXU A;  4AB6 A;  5FHO A;  1URG A;  4FAT A;  4IGR A;  4R2B A;  4DLD A;  5J1D A;  2VPO A;  1IXS A;  1I6Q A;  4G2Z A;  1L8Q A;  3TTN A;  3ILT B;  2ONS A;  1ORY B;  1K9Y A;  3TPZ A;  4NQ8 A;  4GIP A;  3T1H M;  3ONM A;  5HM4 B;  3U6Q A;  1VSO A;  5EQ9 A;  4N6D A;  1I6B A;  4OA4 A;  4PE5 B;  3I04 M;  4KPT A;  1BIY A;  1EYJ A;  4H65 A;  5FTN A;  1QAQ A;  3MC2 A;  3FJ7 A;  5EYH A;  3MWB A;  3MZ9 A;  3H03 A;  4XKQ A;  1J7K A;  3GQ4 A;  2IEE A;  3VFJ A;  3U8Q A;  3LCU A;  5LDZ A;  4YKI A;  2DHY A;  2ONK E;  2JA2 A;  3MVW A;  2I6E A;  1IMF A;  2F4V M;  1OVB A;  4FVM A;  5ET8 A;  4BB9 A;  2F8D A;  2R71 A;  4N15 A;  4OER A;  3RTW B;  3HHY A;  1MXW A;  5IWA M;  3ZQJ A;  1G0I A;  3PPN A;  1CE2 A;  3J7A S;  1XNQ M;  3LSW A;  3U61 A;  4EXL A;  1UTB A;  4RPO A;  3R7X A;  2QPQ A;  1B3E A;  4NWC A;  3PGF A;  1G71 A;  4R6K A;  4LG2 A;  2PBW A;  4DUZ M;  2ZXT A;  2XD2 A;  1RDX A;  3GLI A;  1FPB A;  3EHT A;  2GQ1 A;  5LTC A;  4X48 A;  1D2N A;  1G8P A;  1OQG A;  1J5E M;  3WAF A;  2R44 A;  4CHT B;  3KN7 A;  2V3U A;  4UAC A;  2LVO C;  4LGM A;  5BR8 M;  3RE8 A;  5FTM A;  1TWY A;  1B5I A;  4G68 A;  2VGQ A;  1QDR A;  1B3H A;  2O69 A;  3GLH E;  1HNW M;  4XFE A;  1HQY E;  3K2D A;  1G4A E;  5ITR A;  1O7T A;  4M4G A;  4X04 A;  4HEO A;  4QHQ A;  1XI6 A;  4QFO A;  5TU0 A;  5B70 A;  4FEB A;  1NJG A;  1DO2 A;  4DZ1 A;  3U60 A;  4XKP A;  3TCG A;  4O3C A;  2DNA A;  2A5T A;  5I56 B;  3U60 B;  2LAO A;  5ITO A;  4LZ8 A;  5ET7 A;  3TZA A;  3T1B A;  1HT1 E;  5ESY A;  3TFL A;  3E4R A;  4I81 A;  4IBC A;  2GHB A;  2QMW A;  2RC8 A;  4KFQ A;  4EDP A;  2Z23 A;  3RGY A;  4NSR A;  3TTR A;  4GBW A; 
#chains in the Genus database with same CATH homology
 1YSY A;  2DHR A;  4MGK E;  1HSL A;  3H06 B;  3OOA A;  4M9S A;  4NL4 H;  3Q8X A;  4JI3 M;  3MHV C;  4L4U A;  2QRY A;  2ZNS A;  1NFT A;  1Z6T A;  3TCF A;  2H1R A;  4F31 B;  3SET A;  1IXR C;  4F22 A;  4P11 A;  4LJ7 A;  3W0F A;  3OEN A;  3R9X B;  1W5T A;  2QCU A;  1QYR A;  4OHN A;  4MFI A;  3H3G A;  3JR5 A;  3DA1 A;  3ZKK A;  3JAM S;  2UXA A;  3B9P A;  3O9P A;  1Y3N A;  2Q2C A;  1N84 A;  1SW2 A;  3J2P B;  2XFS A;  4I62 A;  4JXJ A;  1J1N A;  4IBJ A;  5I58 A;  2M8C A;  3FVG A;  3RFW A;  4JWY A;  1R6B X;  3FVK A;  3PU5 A;  4GL8 A;  3VK7 A;  2FE8 A;  4D80 A;  3VXB A;  2RCB A;  4FE8 A;  4H6D A;  4TUW A;  1B3L A;  2NXO A;  2PT1 A;  4F2O A;  2Z3X A;  5KCJ A;  2XXW A;  4LRT A;  3K6U A;  1M5D A;  3V8X B;  2CZL A;  4OFJ A;  3M0E A;  2WKY A;  2OPF A;  2Y7P A;  2O84 X;  1PJJ A;  2Y7I A;  4TOZ A;  2ZYK A;  4R2F A;  1FTO A;  3THG A;  5H8Q B;  5FHN A;  5AA1 A;  1A99 A;  1URS A;  4BBA A;  1NHG C;  4YKJ A;  4GHA A;  3QAU A;  1A8F A;  3DM0 A;  3O97 A;  1H3D A;  3D4C A;  1XC1 A;  4HS7 A;  3EN3 A;  4NTL A;  4I8O A;  3HHZ A;  2E1S A;  2LWX A;  4LF4 M;  4OEV A;  2Z8F A;  3GLI B;  1US4 A;  2RKM A;  1GKI A;  1MQI A;  1MS7 A;  3ZS6 A;  4K3F A;  1N32 M;  3T66 A;  3KN8 A;  2W82 A;  3PPQ A;  2RF1 A;  1L2D A;  2F6P A;  5F3W A;  5CBS A;  3U6C A;  3VFD A;  4ZDM A;  2Y0T A;  4U4X A;  3LR1 A;  2K47 A;  1NH8 A;  1MY4 A;  3KFU G;  1GV8 A;  2V1U A;  4DV0 M;  2Y20 A;  4C1U A;  3IO4 A;  1WDN A;  1Q35 A;  3QUJ A;  3FIR A;  3TWM A;  3L6G A;  1A55 A;  3TUS A;  3KOZ E;  1NKX A;  4PCZ A;  1UTH B;  3TQL A;  1EZO A;  1N3W A;  1VFD A;  1PM5 A;  3MVY A;  2BNK A;  2P0S A;  3JZJ A;  3T1Y M;  1R2Y A;  1KFV A;  1LAF E;  3K1P A;  3T93 B;  2HAU A;  1LB8 A;  4B7H A;  1NNJ A;  3GBB A;  4DR3 M;  5CMB A;  4OET A;  3VK8 A;  1ELJ A;  1JVX A;  2ERC A;  4LJA A;  4KQP A;  4XGI A;  1B7H A;  2D3I A;  3R6U A;  2V3T A;  1FTK A;  3KFM A;  2QBY A;  3SFZ A;  3F11 A;  3ILK A;  2Q89 A;  1LFH A;  2RKO A;  4U1O A;  3IO6 A;  1MQJ A;  1DOT A;  4YKK A;  1R6Z A;  2O7I A;  3AFH A;  1K82 A;  4KD5 A;  2BJW A;  2ONR A;  3PNV A;  2V93 A;  3UK6 A;  1ZLQ A;  4ZEB A;  1G3I A;  3IG5 A;  2Z22 A;  4I5S A;  4LF5 M;  4KYD A;  1SXJ E;  1IEJ A;  4IO5 A;  2QS2 A;  4GL0 A;  5A5X B;  3GO8 A;  3RNN A;  1IN8 A;  1S7Y A;  3HV1 A;  4ZZE A;  1IQP A;  1SXJ B;  4JYA M;  4IGT A;  3AJI B;  4IBB A;  5KCJ B;  1MG1 A;  3C9H A;  4GC5 A;  2YFQ A;  1IBK M;  2A5T B;  5H8F A;  1NY6 A;  1ZQ9 A;  5FTJ A;  3VLU A;  2O7U A;  2HFB A;  4YHH M;  1LAH E;  4MH0 E;  1IY2 A;  2ZYO A;  4XXU A;  1XXH B;  3A46 A;  3U6M A;  4QFP A;  3S9M C;  5H8Q A;  4U22 A;  3OO7 A;  2G93 A;  2YQZ A;  4IBK A;  4M9X A;  2AIX A;  1L5T A;  1L1T A;  3PMV A;  4BLC A;  2Y7W A;  2UYE A;  1N3X A;  3VVD A;  2KRU A;  2XGN A;  3TQW A;  3LSL A;  3KZG A;  5EHM A;  1FQC A;  1MQH A;  2UVI A;  1IN4 A;  2HCA A;  2RGH A;  3RGS A;  4GRI A;  3FTF A;  3TTM A;  3C32 A;  5I2K A;  5FTK A;  1MM6 A;  1Q3C A;  2XZF A;  3PPO A;  4DR1 M;  4MBP A;  2Q2A A;  5TPA A;  3EIH A;  4OU7 A;  1AMF A;  1DTG A;  5DEX A;  2Z4S A;  3RLF E;  3U93 A;  4ESW A;  1K3X A;  4KO8 A;  1A40 A;  3FKE A;  1R9L A;  2I4C A;  1LFI A;  1OMP A;  1SI0 A;  3S9L C;  4LFA M;  1D9V A;  2CEA A;  3GQ3 A;  5JI2 E;  4PT5 A;  4PP0 A;  4GH9 A;  3GRV A;  3J7B A;  3Q28 A;  3HJS A;  3FGS A;  4QFN A;  2F5P A;  2RIN A;  1Q1K A;  3L27 A;  2F5O A;  2ALU A;  2F7C A;  2VP1 A;  5DVJ A;  3RPW A;  2ANJ A;  3K6W A;  3W0L B;  2CUZ A;  2HEU A;  4G4Q A;  5DYG A;  2EA0 A;  3W15 C;  3N6U A;  3L6H A;  4U21 A;  4LCB A;  3GPU A;  3VKG A;  2QJE A;  3LVW A;  3ZCB B;  3I4Y A;  2H99 A;  2PT2 A;  3E9S A;  1IIT A;  2F34 A;  3CVG A;  2YLN A;  3BFU A;  1XXH A;  4KOD A;  5I59 A;  3FD9 A;  5AA2 A;  4B7G A;  4I1D A;  2L7I A;  2W7Y A;  4LJ4 A;  1US5 A;  3KP1 E;  4F1V A;  3CSG A;  4OEN A;  4ZEF A;  5A5X A;  4WEP A;  1I69 A;  1NNT A;  3THI A;  4ELP A;  1PB8 A;  3UGW A;  3C33 A;  4R6Y A;  5EYF A;  2D7E A;  1GVN A;  1SXJ A;  4L17 A;  2Y84 A;  3VVF A;  1XVY A;  2L7H A;  4GF8 A;  4P0G A;  1RYO A;  4F3P A;  4JSO A;  1GLN A;  3OXN A;  3RUM A;  3FAS A;  1JW1 A;  1C1K A;  4QHS A;  4LZJ A;  2O5R A;  3MUQ A;  3C31 A;  2BJV A;  1TXF A;  4JN6 A;  3KVW A;  2H25 A;  3S9N C;  2LNH C;  4KR5 A;  3Q25 A;  1VE4 A;  5HPQ A;  4DCX A;  3KOW E;  2B65 A;  2NWJ A;  3MK6 A;  3SDF A;  3HKP A;  1A7L A;  3GLH A;  1D4N A;  3KG2 A;  4H1X A;  1M5C A;  4JWX A;  3MZB A;  2X4A A;  5ITX E;  1ZIU A;  3RGP A;  4EIW A;  1NHW C;  3EF7 A;  1DSN A;  5ELV A;  1R9Q A;  2HZL A;  3SKP A;  2I7N A;  3MJN A;  3AOG A;  4WED A;  5CRY A;  5EXP A;  1NVM A;  2NQ8 C;  2V25 A;  2VHA A;  4MB7 A;  4GVO A;  5I58 B;  4A3V B;  3WHK A;  4L78 A;  1FQF A;  3RY3 A;  2V84 A;  2R45 A;  4NF6 A;  4ELR A;  3FUX A;  3FUU A;  5EJC A;  4XKR A;  3SER A;  3LQR A;  1IN5 A;  4R72 A;  1NSF A;  4JI8 M;  3GZG A;  2AYS A;  1SW5 A;  3W9V A;  1MPD A;  4DR5 M;  2HCB A;  4DV6 M;  3CFX A;  2FNA A;  1Y4C A;  3T96 B;  3G7W A;  1B3G A;  1N7W A;  2LH0 A;  2KXE A;  2R9J A;  2X8A A;  1Y4T A;  2F6G A;  3TYH A;  4PDI A;  5LMN M;  2H9B A;  4G4R A;  2XZU A;  1HNZ M;  3U6S A;  5DVF A;  4H8I A;  3VLW A;  4NOO B;  3SEY A;  2XHD A;  1MDP 1;  3TE6 A;  4AQY M;  2UU9 M;  1Z7N E;  4Q5T A;  2GH9 A;  3HCQ A;  4NF4 A;  2VD2 A;  1LAG E;  2OLB A;  4X65 M;  3KGC A;  3S2V A;  3GLG B;  1FCK A;  1N76 A;  3LC8 A;  3BOS A;  1QAM A;  4BLA A;  4MLQ A;  3K2L A;  2REJ A;  1SI1 A;  3FV1 A;  1B52 A;  5EP3 A;  4LJ5 A;  2E5L M;  3DP8 A;  4OES A;  1Y3P A;  1UIV A;  3TTK A;  3K4U A;  1XOC A;  3HJ8 A;  5DYI A;  1WXQ A;  1E9R A;  3SAS A;  5L8D A;  4OFL A;  2XX9 A;  4PET A;  1GTK A;  4AQ4 A;  1DGH B;  3A45 A;  4ZZA A;  3I5O A;  5I59 B;  1USY H;  3TDJ A;  2L6O A;  1AL3 A;  2UVH A;  3U6O A;  1P1U A;  3TAJ A;  3IJX B;  4WUR A;  4LZ5 A;  3A98 B;  3SAT A;  1SDX A;  4OZ9 A;  1LGB C;  1DPE A;  4RK2 A;  3IB2 A;  1B0L A;  1P1O A;  4YB5 A;  4EUO A;  4NF5 A;  4AKH A;  4RXL A;  2DYX A;  4G8M A;  2UUC M;  4O3A A;  5H8H A;  3CF0 A;  3C4M A;  2H4I A;  3KSX A;  1ZJL A;  2I58 A;  4QSC A;  4WW0 A;  4CGY B;  1SBP A;  1P99 A;  3T9V A;  1URD A;  3T22 A;  3OMB A;  4EXK A;  3J27 B;  2DOJ A;  2X7P A;  1VR5 A;  4TLL B;  1ZBM A;  1QJM A;  3UZU A;  4YY3 M;  1XNR M;  1JET A;  1W5S A;  1ZU0 A;  4X62 M;  4YIC A;  3LQQ A;  5M2V A;  1AH5 A;  4GXS B;  2GHA A;  1XMQ M;  5GKN A;  2XXV A;  1SYH A;  2VII A;  2F5X A;  3KEI A;  1Z59 A;  3JYR A;  4BDM A;  4NXN M;  3GLH B;  1NNK A;  4HW8 A;  3HU3 A;  5EHS A;  4MF3 A;  3FXU A;  1JR3 A;  4GOT A;  3K1J A;  3PUZ E;  1XT8 A;  2XXX A;  4LFB M;  3RQT A;  3N6T A;  2P5T A;  4QOS A;  5BPV A;  2F5N A;  5I57 B;  1CB6 A;  2XXH A;  4MGI E;  4QF9 A;  3GBA A;  3W9W A;  5C18 A;  2QP9 X;  2AL4 A;  4P0I A;  5ISU A;  5BWJ A;  3NWL A;  1SW1 A;  1MXY A;  1MXU A;  4B3T M;  3KSJ A;  4QNM A;  2NVU B;  1RKM A;  3PUV E;  1DGH A;  1PBQ A;  1NNU C;  1JQJ C;  2Q88 A;  4H5F A;  3D8L A;  3L29 A;  4R9F A;  4LGY A;  3VV5 A;  3K6V A;  4IB2 A;  4PQJ A;  3FTE A;  3O2A A;  4NMY A;  4BDN A;  3M6A A;  3EHU A;  5K2Y A;  4AG6 A;  1IY0 A;  1JW5 A;  3K1M A;  2UXD M;  4CIS A;  3VDU A;  3EIE A;  1N77 A;  4IBE A;  4REZ A;  4BDR A;  4GRK A;  2O1M A;  4G68 B;  1N36 M;  3M3K A;  2QSX A;  4ZED A;  3UP9 A;  1FJG M;  1LBB A;  3D4G A;  4ZEC A;  4S12 A;  4FCT A;  2I7P A;  3M3F A;  4F29 A;  1MQD A;  3ZKL A;  2FA7 A;  5ICQ A;  1JNF A;  1G41 A;  1XHY A;  4DCY A;  3GRR A;  4AI6 A;  4JXI A;  4O3B A;  3T9X B;  3KBR A;  4U2R A;  1MU5 A;  4YU0 A;  4PFY A;  1B7U A;  4NRW A;  4IY6 A;  3TMG A;  4DV2 M;  3MVZ A;  4R74 A;  2DE4 A;  3QYT A;  3FVO A;  2X7Q A;  4NWD A;  2CFO A;  3SC3 A;  4HCW A;  4RYA A;  2KZS A;  3H6U A;  4PFW A;  3IOU A;  5IRE B;  4DV7 M;  3ODB A;  3HWS A;  1B2H A;  2O51 A;  2R4E A;  3H6T A;  5CMC A;  3CFL A;  4LVQ A;  2D5W A;  1XC8 A;  4FAJ A;  2F36 A;  3M8U A;  2I3V A;  1FTJ A;  4AW4 A;  2PYY A;  4GLI A;  3FVN A;  2QS3 A;  3CR9 A;  4G4P A;  1ZTY A;  2C99 A;  3R26 A;  3MPK A;  3RT6 B;  3HN0 A;  1OIB A;  4MGH A;  1MQG A;  4N13 A;  4F18 A;  3GLF B;  1MDQ A;  3AOE A;  1HSJ A;  2CE7 A;  2I0B A;  1N34 M;  1LCF A;  2RGO A;  2GRV A;  4ISU A;  3OTO M;  5JI3 E;  5DNY A;  4PD2 A;  2DVW B;  3FXR A;  1J09 A;  4FWD A;  1N75 A;  2UXC M;  4I9D A;  2M5Z A;  3FXQ A;  1LV7 A;  2IA4 A;  3PD8 A;  4X66 M;  5I2K B;  5DYH A;  4M0W A;  3CSB A;  3EPE A;  4EF1 A;  4YMA A;  3HPI A;  2RC7 A;  3K02 A;  4R9G A;  5I56 A;  4MGZ E;  1ZMG A;  4OVZ A;  1IXZ A;  3MZ1 A;  3PV0 E;  3HJQ A;  8CAT A;  1B51 A;  5EQT A;  2HHH M;  1PC3 A;  4R75 A;  1LBC A;  5TP9 A;  4G6Z A;  4F3B A;  3FUV A;  4LON B;  2UUB M;  4DV1 M;  1UIU A;  2DWH A;  2I48 A;  4BDQ A;  2V1C A;  3SAV A;  1T0K A;  1FTL A;  4QSD A;  4X9T A;  1QVR A;  4L15 A;  4GXA A;  4OYV A;  2OWS A;  4XIG Q;  2DWZ B;  2DXI A;  3FTC A;  3KXE C;  3G3H A;  3L2A A;  1N78 A;  4JI5 M;  4H5G A;  4R73 A;  5IKB A;  3DP6 A;  5DTB A;  1MPC A;  3IK6 B;  1XVX A;  3NBI A;  3PD9 A;  5IZ7 D;  4NE4 A;  4Q30 B;  3LSF B;  1R2Z A;  2PVU A;  5JTY A;  3IL1 B;  1QUL A;  4PDG A;  4YZZ A;  4RA1 A;  4GKK M;  1FW0 A;  2DVC A;  2Y0Q A;  2O6A A;  2Y7R A;  2DZO B;  5KPR A;  2DWA A;  1E32 A;  4UA8 A;  3VDP A;  5JK4 A;  4ITQ A;  1Q3B A;  1XMO M;  4GKJ M;  5H8N B;  2XEP A;  4DXB A;  1JQF A;  2VQE M;  3GPP A;  1T3T A;  3U6E A;  3USD A;  4YB7 A;  5B7D A;  4FIM A;  3U5Z B;  4ELQ A;  3K0V A;  3HO7 A;  2XX8 A;  1VFE A;  1IXH A;  4IO3 A;  2DS9 A;  4RPN A;  2QL3 A;  2RC9 A;  3P7I A;  4DR2 M;  4ZE9 A;  5I2N A;  4OXV A;  2Y21 A;  2FOI C;  2XXP A;  1B7Z A;  4G8N A;  1SVX B;  2NUV A;  3Q27 A;  5TP9 B;  2KEB A;  4KYE A;  2KA6 B;  1DPP A;  5FTI A;  1JW4 A;  3AKZ A;  4H8J A;  3ECR A;  4OX9 M;  1YUB A;  2VOZ A;  1QZM A;  4G4O A;  3SEV A;  5CC2 A;  1E9S A;  5FHM A;  1TDH A;  4LAT A;  3MQ9 A;  1SW4 A;  1B5J A;  4IO7 A;  4GMQ A;  1DGG A;  3MVX A;  4DR4 M;  4RNS A;  3S4U A;  3FUT A;  4LJ6 A;  2Z4R A;  2OBG A;  4W5W A;  5KO3 A;  1P1N A;  4JV5 M;  3N94 A;  1M5E A;  1IXC A;  2H98 A;  4EQ9 A;  4F1U A;  2DQV A;  1H43 A;  1E94 E;  2D21 A;  3GPX A;  4JI7 M;  5KPZ A;  4LF6 M;  2UUA M;  5FSW A;  3R8F A;  2X49 A;  2CHG A;  4HL4 A;  3LSX A;  4OQO A;  5I84 A;  3UA8 A;  1FQE A;  1N33 M;  5C1B A;  3HU1 A;  3IOT A;  1LAX A;  3LVV A;  1USY E;  2V6Z M;  1OVT A;  5ITP A;  1S3S A;  5AA4 A;  4F39 A;  1OLC A;  4LY6 A;  3UMM A;  1YCJ A;  3OO6 A;  2C9O A;  5HBC A;  1XWI A;  2ABH A;  5DEX B;  4ZE8 A;  4AG5 A;  4I8C A;  4U23 A;  1B9J A;  1B1H A;  3CG1 A;  5K2X A;  3FTD A;  4ESX A;  1H45 A;  3V83 A;  4JDF A;  1SXJ D;  4IO4 A;  2O68 A;  2QMX A;  3PMW A;  3QUF A;  1IUD A;  3KDS E;  2C5R A;  1MM7 A;  1KWH A;  1QAN A;  1HT2 E;  5FTH A;  4DIG A;  1FTM A;  1EE8 A;  5L9M A;  1OJL A;  5E6J A;  4N6P A;  1LB9 A;  3GPY A;  3G3G A;  2QS4 A;  4H67 A;  1B40 A;  4QHT A;  2CHQ A;  1QUJ A;  2ZAN A;  4XBO A;  4MGY E;  1FQB A;  1MH4 A;  3H4M A;  4LZ7 A;  4B3R M;  3U92 A;  4G4N A;  1IBL M;  3IAZ A;  3B7D A;  1YPN A;  1TGU A;  3LUY A;  1Y3Q A;  4LA9 A;  2OWT A;  3IOV A;  4Z6Y A;  4YAH X;  2VQF M;  3KOX E;  3O6I A;  2ZAM A;  3FD3 A;  4DR7 M;  2XXQ A;  3QXM A;  3A3U A;  1Y9U A;  3HHG A;  2XX7 A;  4LJ8 A;  1IIW A;  1Y1M A;  2XXY A;  3OSQ A;  4YMB A;  3PFI A;  1KSF X;  3KOY E;  3MJ5 A;  2H5Y A;  1MY1 A;  3KS8 A;  3KJ7 A;  3G3F A;  5CBR A;  3WHL A;  3AOE C;  2I4B A;  1IM2 A;  5LOM A;  5AA4 B;  3RTF B;  2AL5 A;  3AXF A;  2I3W A;  3O6H A;  3FJG A;  2X26 A;  3SBJ A;  4RJZ A;  1IBM M;  3HHW A;  3IB1 A;  4DUY M;  4DV5 M;  1KYI A;  1DMB A;  5H37 D;  1QUI A;  3U72 A;  2CV2 A;  1TFD A;  2DVZ A;  3CRB A;  3MBP A;  2XH9 A;  5EXT A;  2G5G X;  5ITQ A;  3PPP A;  1XS5 A;  1P1Q A;  5ITT A;  3SMP A;  3LBS A;  1YAE A;  1RYX A;  3ZSF A;  4TQU Q;  3B6Q A;  3TPA A;  1S50 A;  1Z5C A;  3U61 B;  2Z8E A;  4MH5 A;  4JI6 M;  4TLM B;  4Q8R A;  2OK2 A;  1I4W A;  1PB9 A;  4GC9 A;  1HNX M;  3U94 A;  4QFL A;  1B58 A;  5F1Q A;  1R7R A;  3C34 A;  4FCV A;  1Z5A A;  2EUC A;  3TWL A;  3DOA A;  1O64 A;  3IB0 A;  3KP0 E;  2D7H A;  2DP8 A;  1TFA A;  1TDZ A;  3FZV A;  3L26 A;  4K0K M;  3K8Z A;  3I4V A;  3SAR A;  2J7N A;  2HKJ A;  4LUB A;  4AKI A;  3TQS A;  3PMX A;  3FV2 A;  4RF1 A;  5AA2 B;  4WKM A;  1MPB A;  1UTH A;  2C98 A;  1AOV A;  1NMU A;  5AE4 A;  3GLF A;  1MY2 A;  5F7V A;  5KDT A;  4B3S M;  3KN3 A;  1IXI A;  1GR2 A;  5CMM A;  4JI2 M;  4PFU A;  4XKN A;  1Z5B A;  4N07 A;  2PX1 A;  1B3F A;  1ZKB A;  3WAE A;  2UVJ A;  4LP2 B;  4ZPX A;  4YB6 A;  3K6X A;  1BTJ A;  3V5A A;  3BKI B;  1F9B A;  4L8R C;  4LF9 M;  3TL4 X;  3TOD A;  2DWL A;  1MH3 A;  2QPA A;  1ZAE A;  3T38 A;  3VE1 B;  5A2Q S;  2HZK A;  5E26 A;  1N0T A;  1I6A A;  3DFZ A;  3L25 A;  4F1Y A;  3I6V A;  4QRZ A;  4G68 C;  1YE9 A;  4KHZ E;  3FUZ A;  4JI0 M;  3IJO B;  4F2Q A;  2ESN A;  4E0X A;  4HLQ A;  5LMU M;  3EQ1 A;  3SES A;  1MX0 A;  2RCA A;  4Z7E A;  1UTB B;  1IN7 A;  3DP4 A;  5EP1 A;  1H6U A;  4M0D A;  2XXI A;  1EZ9 A;  5H8H B;  3OO8 A;  5KPT A;  2AHM A;  3SYK A;  4RK9 A;  4WXJ A;  3T9H B;  3UK4 A;  3ZH9 B;  4F19 A;  1PDA A;  1B0H A;  4MLV A;  2ZMB A;  4R3D A;  1MXZ A;  4B08 A;  1TH4 A;  1R1N A;  5L9S A;  4ZEK A;  1LLS A;  1PB7 A;  4OTE A;  3MPL A;  2ZBK B;  3K1N A;  4DR6 M;  3KJT A;  5EXX A;  2QBY B;  1M5F A;  2DZN B;  1POT A;  3L28 A;  4D82 A;  3N5L A;  2UYF A;  1N7X A;  4GFR A;  2XFT A;  1B46 A;  2DSF A;  3E13 X;  4DE8 A;  4MM3 B;  3GLG A;  1XHB A;  4DV4 M;  3CI8 A;  4X1D A;  2M60 A;  1L2B A;  4U4S A;  2DWN A;  1PBP A;  1FQA A;  3B6T A;  1VDD A;  4GIZ A;  2F78 A;  4M9Z A;  1JVY A;  4AZF A;  3U6L A;  4POX A;  3TEP A;  4FEC A;  3KOS A;  3CF6 E;  4OVJ A;  3PVS A;  2YJP A;  3TEL A;  5L9O A;  2ZM6 M;  5KZT A;  2G8L A;  1Y1Z A;  3KOT A;  2R65 A;  2FYI A;  3G3J A;  1QVS A;  4PFT A;  3CTW B;  1B4H A;  1QQW A;  3QIM A;  2F5S A;  3GP1 A;  3C36 A;  3M3L A;  2OZZ A;  3GRY A;  3HHX A;  2XSZ D;  1ANF A;  3OD7 A;  1ATG A;  4IO2 A;  4JBZ A;  1S9T A;  3G3I A;  5ICT A;  1SYI A;  2UVG A;  1I94 M;  1D9Y A;  1BP5 A;  3H4Z A;  4NF8 A;  3U6P A;  4RF0 A;  3J80 S;  3OEL A;  3UIF A;  4L16 A;  4F3G A;  3SMS A;  3UJN A;  1D3K A;  3IR1 A;  3N26 A;  1DTZ A;  2DWI A;  3MP1 A;  3DEL B;  3FUW A;  4NF6 B;  3T15 A;  2HXW A;  1X37 A;  3SHF A;  3Q26 A;  1AIV A;  2DWJ A;  4QNR A;  1TH3 A;  1Z7M E;  2J7O A;  4Q0C A;  3CG3 A;  1LFG A;  2GFE A;  4HCY A;  4OW0 A;  2L09 A;  3PNY A;  2XD3 A;  1TT1 A;  4GHL A;  4B7F A;  4EQ7 A;  1IN6 A;  1QUK A;  2G29 A;  4NRV A;  3IOR A;  4LF7 M;  3GRU A;  4IBD A;  2THI A;  2Q2E B;  4FED A;  4M1V A;  4GWO A;  4NXM M;  2A5Y B;  2F97 A;  3DZD A;  2REG A;  1SD3 A;  1JR3 D;  1NJF A;  2XXT A;  3JV9 A;  5FTL A;  1L2C A;  2NOO A;  5H8N A;  1NNF A;  2E0S A;  2R46 A;  3AV0 A;  1EU8 A;  1OQH A;  3HST A;  4GIT A;  4OVZ B;  3GLB A;  3TCH A;  3FAT A;  2I49 A;  1IZ1 A;  5KQD A;  2VD3 A;  3S9E A;  2KW0 A;  4LF8 M;  3E9X A;  3OO9 A;  1A54 A;  3SAU A;  3IG8 A;  2ZYM A;  5CI5 A;  1QKB A;  5EP2 A;  1MXX A;  4U1Z A;  3VLF B;  2KRK A;  4RNA A;  3RN8 A;  5ITX A;  1OLA A;  1B32 A;  2YNM D;  1MY3 A;  4KCD A;  2CV1 A;  2I0C A;  2KLF A;  5DT6 A;  3VLV A;  2XXR A;  4FCW A;  4II7 A;  4IY5 A;  4DXC A;  3K01 A;  4JSD A;  1DO0 A;  2BJJ X;  4OEU A;  2YPN A;  3MW0 A;  1P1W A;  1SXJ C;  1B1X A;  3U5Z A;  1QKA A;  1MRP A;  2LXE A;  3K92 A;  4NSO B;  4P16 A;  2OQ4 A;  4Z8X A;  5EP4 A;  3ZC7 B;  2ZAO A;  2F35 A;  2DE3 A;  3IOW A;  1B4Z A;  1PEB A;  4KHP M;  1LST A;  1NY5 A;  3PUW E;  2XLJ A;  3MP8 A;  4KCC A;  1Q39 A;  4ELO A;  2CV0 A;  1YTV A;  5I2N B;  4ZS9 A;  4LJ9 A;  4RY1 A;  3QSL A;  1SQY A;  2P2A A;  4FW9 A;  4XTC Q;  2R4J A;  1JEU A;  3K00 A;  2OJT A;  1QW0 A;  5DVI A;  2Q9T A;  2V3Q A;  1N04 A;  1B6H A;  4NED A;  3PUY E;  3AL0 C;  1POY 1;  1II5 A;  5JEI A;  2HL7 A;  3T9U A;  1JEV A;  1GGG A;  1UQW A;  2HQ0 A;  4OWD A;  3OEK A;  4H0W A;  1DGF A;  1OFI A;  3SAW A;  3C35 A;  1HQC A;  3O6G A;  4THI A;  3KW6 A;  2Z7J A;  4IJE A;  2O1L A;  5FLX S;  1IXS B;  1FQD A;  4JI1 M;  3A3C A;  3VDF A;  2Z8D A;  2C96 A;  1O63 A;  3O29 A;  1EH3 A;  1M5B A;  4ND9 A;  2R6G E;  3VKH A;  1TH2 A;  1BKA A;  2R62 A;  4X1B A;  3FYD A;  4POW A;  1A8E A;  2HAV A;  3TWK A;  4JWO A;  1IY1 A;  2XF3 A;  2DE2 A;  3H6V A;  4D81 A;  4EF2 A;  4JB7 A;  5JTY B;  2PMS A;  2C9C A;  7CAT A;  3FYC A;  1BLF A;  3UN6 A;  1NNP A;  3SHG B;  2F5Q A;  2OCU A;  2B3F A;  3CIJ A;  5AA2 D;  2B3B A;  4Z0I A;  3M7G A;  4IBF A;  1IXG A;  5IAI A;  5H8S A;  4F3S A;  5AA3 A;  4B3M M;  3C58 A;  4OMB A;  1H76 A;  1MXV A;  3H6W A;  3UGJ A;  3D8B A;  3JR4 A;  1DGB A;  3KS4 A;  5CM6 A;  2QEN A;  1HR0 M;  4YKP A;  1OFH A;  2ZYN A;  3HGI A;  3DLN A;  3ILU B;  2DXR A;  2KZU A;  4NF8 B;  4I4L A;  4DV3 M;  3HU2 A;  4G8H A;  3J81 S;  4C0R A;  4R7G A;  1PJI A;  2D7G A;  2QZ4 A;  4FWG A;  4FJP A;  4KI0 E;  3TTL A;  4NF4 B;  3A42 A;  1L1Z A;  3PPR A;  4ZEI A;  5BUU A;  4ONY A;  4GD5 A;  3SYL A;  1EZP A;  4IBI A;  3QWL A;  3QK6 A;  2A5S A;  3Q29 A;  2CHV A;  3VXC A;  1HSE A;  3LMM A;  1H44 A;  4E0W A;  2F7A A;  3OSR A;  2FFJ A;  3MAM A;  1B5H A;  1K3W A;  4LQ2 A;  3MP6 A;  2R18 A;  3OEM A;  4FWH A;  1QAO A;  2QS1 A;  3O28 A;  4DDD A;  2CMO A;  3BBR A;  2ZNT A;  5KDT B;  4IJF A;  3SEX A;  2XSZ A;  4X64 M;  4FD2 A;  3PXG A;  4FOR A;  3VVE A;  1NH7 A;  4G77 A;  1WOD A;  4IIW A;  5ITY A;  4LFC M;  3QAX A;  4IO6 A;  4QFK A;  1UM8 A;  4NF5 B;  3SEU A;  5H8F B;  4QOZ C;  2FNC A;  2UXB M;  5I57 A;  2DXY A;  3HHF A;  4BDL A;  5CMK A;  2XXU A;  4GQO A;  3A09 A;  3PUX E;  4EQB A;  2F7B A;  1MY0 A;  1GL6 A;  3GQ5 A;  3UOR A;  4IBG A;  2DWM A;  2Y7K A;  3H7M A;  4LRS A;  4AKG A;  4LZZ A;  4KYS A;  4LQ5 A;  4ECF A;  1B05 A;  3U6D A;  2ZNU A;  3GXA A;  4BDO A;  1Y20 A;  4R6H A;  3B6W A;  5TPA B;  3V89 B;  3BFT A;  5ITU A;  4JI4 M;  4C1T A;  1GVC A;  4HTG A;  2YR0 A;  3G3K A;  5IT9 S;  1WVJ A;  4OFO A;  5KQ8 A;  3CFZ A;  3EHS A;  3E3K A;  3TKD A;  4KLN A;  3U1O A;  2Q8J A;  2P1S A;  1G59 A;  4AB5 A;  1NL5 A;  3SEW A;  3FJM A;  5EXS A;  3O66 A;  3I51 A;  2EO2 A;  1GL7 A;  3CF2 A;  1IQ7 A;  3IX1 A;  4QSE A;  1LCT A;  3I3V A;  3RT8 A;  1FNN A;  4DXU A;  4AB6 A;  5FHO A;  1URG A;  4FAT A;  4IGR A;  4R2B A;  4DLD A;  5J1D A;  1I6Q A;  4G2Z A;  1L8Q A;  3TTN A;  3ILT B;  2ONS A;  1ORY B;  3TPZ A;  4GIP A;  3T1H M;  3ONM A;  5HM4 B;  3U6Q A;  1VSO A;  1I6B A;  4PE5 B;  4KPT A;  1BIY A;  4H65 A;  5FTN A;  1QAQ A;  3MC2 A;  3FJ7 A;  3MWB A;  3MZ9 A;  3H03 A;  4XKQ A;  1J7K A;  3GQ4 A;  2IEE A;  3VFJ A;  3U8Q A;  4YKI A;  2ONK E;  2JA2 A;  3MVW A;  2I6E A;  2F4V M;  1OVB A;  4FVM A;  4BB9 A;  2F8D A;  2R71 A;  4OER A;  3RTW B;  3HHY A;  1MXW A;  5IWA M;  3PPN A;  1CE2 A;  3J7A S;  1XNQ M;  3LSW A;  3U61 A;  4EXL A;  1UTB A;  4RPO A;  3R7X A;  2QPQ A;  1B3E A;  4NWC A;  3PGF A;  4R6K A;  4LG2 A;  2PBW A;  4DUZ M;  2ZXT A;  2XD2 A;  3GLI A;  3EHT A;  4X48 A;  1D2N A;  1G8P A;  1OQG A;  1J5E M;  3WAF A;  4CHT B;  3KN7 A;  2V3U A;  4UAC A;  4LGM A;  5BR8 M;  3RE8 A;  5FTM A;  1TWY A;  1B5I A;  4G68 A;  2VGQ A;  1B3H A;  2O69 A;  1HNW M;  1HQY E;  3K2D A;  1G4A E;  5ITR A;  1O7T A;  4M4G A;  4QHQ A;  4QFO A;  5B70 A;  5TU0 A;  4FEB A;  1NJG A;  1DO2 A;  4DZ1 A;  3U60 A;  4XKP A;  3TCG A;  4O3C A;  2A5T A;  5I56 B;  3U60 B;  2LAO A;  5ITO A;  4LZ8 A;  3TZA A;  1HT1 E;  3TFL A;  3E4R A;  4I81 A;  4IBC A;  2GHB A;  2QMW A;  2RC8 A;  4KFQ A;  4EDP A;  2Z23 A;  3RGY A;  4NSR A;  3TTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...