3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
b'AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
3G3HA 5H8FB 4HS7A 2QS1A 4FE8A 2H99A 3G7WA 3VLWA 1SW5A 4H6DA 1B3EA 3HV1A 2O51A 2AYSA 2ZXTA 3TZAA 3ONMA 1B3GA 3PMXA 3FXRA 3T93B 3MP8A 4QFKA 3OOAA 4O3CA 1PB8A 1MQGA 2B3BA 3MAMA 4YMBA 1N76A 1LSTA 3DP6A 1Y20A 1PB7A 4ECFA 3CFLA 5BWJA 1HSLA 1Y4CA 3OSQA 4WEPA 4EQBA 5CI5A 3B7DA 3CR9A 1B2HA 4ZS9A 4OTEA 1L5TA 3KGCA 4RJZA 2XXTA 1Y1ZA 3H03A 1IQ7A 1MDP1 4U23A 4G77A 4G8NA 4X9TA 3V5AA 2GRVA 2ZNTA 2IA4A 1POY1 2UXAA 1AMFA 3IOTA 3C4MA 2DXRA 2GFEA 1B6HA 1B1HA 1D4NA 3M3KA 1Y3NA 2DWAA 4QSCA 2DVZA 5AA4B 4AB5A 1II5A 1FTLA 3OXNA 4NWDA 2O68A 1URDA 3VXCA 2NUVA 3GBAA 3LSXA 4QSDA 4OFOA 4P0IA 5J1DA 3EPEA 1FW0A 4ESWA 1LAHE 4Q0CA 3FVGA 1B3LA 3N5LA 1B5IA 4LVQA 4POWA 3KN8A 4KHZE 1SYIA 3FV2A 3R6UA 3TTKA 3MVXA 3HCQA 1ZU0A 4FEDA 5F1QA 1IXCA 4N6PA 3PMVA 2QRYA 1QKBA 3MUQA 2F7CA 3JV9A 2O69A 3LR1A 4F39A 4EF2A 1US5A 4OERA 1JVXA 2H25A 3S2VA 3SEUA 5ITOA 4IO6A 3C34A 1OQHA 1PC3A 5H8QB 3CSGA 3VVEA 1AIVA 3OELA 2NVUB 1P1OA 1SBPA 5TU0A 3PPOA 5DTBA 1XVXA 3U1OA 2REGA 4DCXA 3Q28A 2DE3A 3TQLA 4GWOA 4TLLB 1S7YA 4YB6A 4PFUA 3ZS6A 1ELJA 3O9PA 2YJPA 1Q1KA 3WAEA 3FJ7A 3FASA 4XKPA 2Z8EA 3PUZE 3G3FA 4AB6A 3KEIA 2Y7WA 4P11A 3K0VA 3T66A 2XHDA 4YKPA 3G3GA 3KBRA 3SEWA 2Z23A 2FNCA 1GVCA 1Y3PA 2OZZA 3SETA 3OENA 2RC9A 4ZE8A 4LONB 2RCBA 2DYXA 2F6PA 4RXLA 3RNNA 1JEUA 4YKKA 1NKXA 1A8EA 1MS7A 2UVGA 3T9XB 1MPDA 5CMBA 4BDNA 3FVKA 5JK4A 2F34A 4X48A 1IZ1A 1VSOA 2Z22A 1SW1A 4KCCA 3M3LA 5FHNA 2Z8FA 3IOWA 1EU8A 3VVFA 1YCJA 1N7XA 2OWSA 1BP5A 3JYRA 4WKMA 4ND9A 2GH9A 1B32A 3O6IA 2Y7PA 4BDLA 3QUJA 3K6XA 2PX1A 2E1SA 2O1LA 4DXUA 4C0RA 2Y84A 3O6GA 4QFNA 4YU0A 4KFQA 1QUJA 4RK9A 3K00A 3KOSA 4NE4A 3CSBA 4H1XA 2V3UA 3PPQA 1MM6A 1MY3A 4TLMB 4FATA 2A5TB 1JW5A 4G8MA 1PDAA 3K6UA 3SESA 3QAXA 4RY1A 1MY2A 2M8CA 4KI0E 3H6UA 3G3IA 1UIVA 3K1PA 1T0KA 1DSNA 3VLVA 2F5XA 5EHSA 1B1XA 4ZZAA 1UQWA 3B6QA 2YPNA 3MWBA 5FTIA 1B5JA 4FECA 4F3GA 4F3SA 1EZPA 1USYH 3DP8A 2QSXA 4U22A 5IAIA 1M5FA 3FIRA 3HSTA 3RGYA 1UTHA 1B7HA 1NH7A 4OZ9A 5L9MA 1WVJA 2VHAA 4OHNA 1P99A 4IGRA 1LAXA 5FHOA 4ZEDA 4IB2A 4I62A 3KN7A 4HTGA 1JNFA 1N3WA 4I9DA 3CVGA 2F78A 2ONKE 2H98A 2XXPA 2OCUA 1Y1MA 4HCWA 2UVJA 1DTGA 2AIXA 2I6EA 4G4PA 1URGA 2VOZA 3MZBA 5B7DA 5CMMA 2QL3A 2YLNA 2DS9A 3K6WA 3C35A 2OK2A 3S9NC 2V3QA 4YB5A 2HZKA 1LLSA 4DCYA 3Q26A 1XVYA 5ITPA 3V83A 1XS5A 4EXLA 2P0SA 2XX7A 3IK6B 4QFLA 1S9TA 3RLFE 5TPAA 4MFIA 3BKIB 2ZNSA 4NF6B 3SKPA 2QMWA 3Q29A 5ISUA 1SD3A 1B52A 1ZTYA 4X1BA 2O1MA 3VLUA 3TQWA 1P1WA 3RT8A 4DLDA 4ESXA 2V3TA 4KD5A 2QPQA 4GD5A 1MH3A 1FQBA 3IR1A 4ZEBA 3MZ1A 4FORA 2ZYOA 3HN0A 3K01A 3N26A 3C36A 4QRZA 4I8CA 2CMOA 4KQPA 3USDA 3K2DA 3MJNA 4G68C 1Q35A 3RN8A 3K02A 4OVJA 2GHAA 4Z7EA 4NF4A 3O6HA 4Q5TA 3ZSFA 2OBGA 2O7UA 1MQHA 3HHFA 3MZ9A 4FEBA 2ONRA 3CFXA 3IOVA 1N04A 3O28A 2ZNUA 4YICA 2NWJA 2Q9TA 3U93A 4BDQA 2DWJA 4GXAA 3GLBA 3MPKA 1IUDA 3OEKA 3S9LC 2DE2A 3IB0A 4Q8RA 5I58B 4H8IA 3PUWE 4GXSB 2DSFA 4BDRA 3E4RA 2VD3A 1UTHB 1LAGE 3M8UA 1D9YA 3VFJA 1LCTA 2Y7RA 4GRKA 4NMYA 4OQOA 1VE4A 2RC8A 5CMKA 4ZE9A 3FATA 3VDFA 3K1NA 2I49A 4F1YA 1B7UA 4LZ7A 5FHMA 3I5OA 3K4UA 3MBPA 1QW0A 1ZBMA 1LAFE 1IXGA 2BJJX 1A40A 2H9BA 2I0CA 3O97A 2Q89A 1TT1A 3IJOB 3UN6A 3IORA 4RA1A 3IX1A 2FA7A 4ZEFA 3PGFA 4RK2A 1B3HA 4OWDA 4R74A 2ABHA 2QS2A 3EHUA 1UIUA 3Q25A 5TPAB 4R72A 4C1TA 4F2OA 4GFRA 1IXIA 4DE8A 4LQ5A 1LGBC 1XOCA 3TTRA 5DVFA 1ZJLA 3TTNA 3FUZA 3C9HA 5I84A 3IL1B 2A5TA 4U1OA 4GQOA 2UVIA 3B6WA 1FTOA 1IEJA 1LFGA 1OIBA 1ZLQA 1PB9A 2F7AA 1N7WA 1N3XA 1B58A 3KG2A 1A8FA 1QJMA 2RF1A 4EDPA 4EQ9A 3VVDA 4PP0A 3U8QA 1A54A 4NF4B 4GIZA 4HW8A 3MPLA 4ONYA 1BTJA 3OO6A 2QMXA 3FXUA 4KYSA 3GBBA 5CBRA 1GV8A 4IO2A 4PFYA 1FQFA 1A55A 3MC2A 4OEUA 5KCJB 4OFLA 4C1UA 1B40A 1IIWA 4ZZEA 1MXZA 2ZYNA 1VFEA 2RCAA 4JSOA 1KWHA 5AA1A 1B4ZA 4GLIA 3K1MA 1MXVA 3UK4A 2DXYA 3O2AA 1SI0A 2DWHA 3RUMA 1YPNA 3OEMA 3KJ7A 4JBZA 2THIA 3QSLA 2X7QA 1BLFA 4YKIA 1SW2A 1TXFA 3TMGA 5A5XA 4OYVA 1GR2A 3T9VA 4RPOA 1QULA 4F18A 2VGQA 1FQEA 2H4IA 2HAUA 5H8HA 1H45A 3SEVA 3SDFA 2PT1A 3H6TA 3FGSA 2HCAA 4U1ZA 1M5EA 4R75A 2F36A 3UIFA 3T22A 1FQAA 4F1VA 2DQVA 4IO5A 4ELOA 3DLNA 4I1DA 1R6ZA 4KCDA 4O3AA 4G2ZA 3U94A 5L9SA 3FJMA 3HO7A 2OLBA 4LA9A 3PPRA 4MBPA 4NF6A 2O7IA 1SDXA 4LQ2A 4YB7A 4JB7A 1H43A 4PE5B 2Q88A 3QIMA 4AQ4A 3D4GA 3QK6A 3EQ1A 4BDOA 4U4XA 1QUIA 1XT8A 2DOJA 4MLQA 3T9HB 1DTZA 1QUKA 1IXHA 1Y9UA 4OXVA 3QXMA 2NXOA 5FTHA 3T96B 1B7ZA 5DYHA 2Y7KA 1H44A 4Q30B 3S4UA 3TYHA 4E0WA 3TFLA 4TOZA 4ELPA 1JW4A 1Z7NE 3TCFA 4NF5B 1S50A 4RYAA 4TQUQ 4JXIA 1LBCA 1OMPA 4QF9A 3ZKKA 3KN3A 3G3JA 3C32A 5AA3A 4PFTA 3K6VA 2F35A 2XD2A 4NEDA 2UYEA 3W15C 2XXXA 4OFJA 5I58A 3KSJA 2XXRA 1ZIUA 3P7IA 5I56A 3CG3A 1B5HA 4RPNA 2PYYA 2B3FA 3CFZA 3S9MC 1DPPA 2F6GA 1M5BA 5HM4B 4OESA 5K2XA 2CZLA 1MQJA 1I6BA 3KZGA 2XXYA 1NFTA 4IY5A 1UTBA 2PVUA 3ODBA 2V84A 3KSXA 2GHBA 5A5XB 3W9VA 4UA8A 3N94A 1RKMA 1POTA 4MLVA 2X26A 1OLCA 5AA2A 4WEDA 5I57A 5H8HB 3OSRA 1MXYA 2XD3A 4MF3A 4K3FA 2Q8JA 1A7LA 1JVYA 3FD3A 3MW0A 4OETA 2HEUA 1XHYA 3BFUA 3O29A 1MG1A 2R6GE 4OMBA 2H5YA 3QUFA 3U72A 2QS4A 1H3DA 1TWYA 4YKJA 3QYTA 4YZZA 1RYXA 1VFDA 3H6WA 3BFTA 1OQGA 5K2YA 3I6VA 2PT2A 2FYIA 4R9GA 1O64A 4F22A 3GZGA 4GVOA 4JDFA 3PMWA 3UP9A 3IB1A 5L8DA 4GOTA 3B6TA 4KR5A 1A99A 1NNTA 1SVXB 4R9FA 2I4BA 4NF8A 1CE2A 3WAFA 2PBWA 1B0LA 4OEVA 3H3GA 3UORA 3F11A 3W9WA 1URSA 2IEEA 2X7PA 1LFIA 3LC8A 4UACA 5CMCA 1TFAA 4JWXA 1D3KA 3PV0E 5DEXB 3ZKLA 3VV5A 4R73A 4LZ5A 3RT6B 5KCJA 2XX9A 1SI1A 1MQIA 3JZJA 5HPQA 3TAJA 3DELB 5AE4A 1OLAA 3LUYA 5I59A 4DZ1A 4G68A 3OO9A 5I2KA 2ESNA 5I56B 3LSFB 3LSLA 4ELQA 4U2RA 5ICTA 3KOTA 4ISUA 4QHQA 3FVNA 3DP4A 4GL8A 4NTLA 1ATGA 3C33A 3D4CA 4IO7A 1EZ9A 3CG1A 2KLFA 2RKMA 3FVOA 3OO7A 4LATA 3U92A 5DVJA 3OD7A 1YAEA 1UTBB 3MQ9A 2ZMBA 1P1NA 1R9LA 1NH8A 4XKNA 1MPCA 5AA2B 5H8SA 5I57B 1XC1A 2D3IA 3CI8A 3TDJA 1B9JA 2V25A 5I2NA 1FTKA 1B3FA 5H8NA 1FCKA 2P2AA 4ZECA 1I6AA 3ILTB 4GF8A 5ICQA 1MH4A 3TELA 1N84A 1GTKA 2WKYA 3IO4A 1QKAA 4KYEA 3TCGA 5KDTB 4R2FA 3THIA 3TTMA 1NNKA 4ZEIA 2F8DA 3PU5A 4DIGA 2D5WA 1US4A 1NMUA 5TP9B 3MVWA 2P1SA 3CRBA 4XIGQ 5BUUA 1D9VA 4BDMA 1LCFA 3GXAA 1AH5A 5L9OA 2XX8A 2ZYMA 3C31A 4DXCA 1TFDA 1MM7A 1ZMGA 2LAOA 1QVSA 4H8JA 3VE1B 5DT6A 3TODA 1MXUA 4NF8B 1EH3A 4JSDA 3ECRA 3Q27A 4JWYA 1PBPA 1R1NA 2AL5A 3RTFB 4N07A 3CIJA 3PUVE 1N0TA 4NF5A 4DDDA 4M4GA 2F97A 4IGTA 3PPPA 1IITA 4R6HA 4QFPA 2ALUA 4IY6A 1B05A 3R26A 3MP1A 1DPEA 3KJTA 4N13A 5ELVA 3I3VA 5EYFA 3A3CA 1MQDA 4ELRA 4F1UA 2R71A 1GGGA 2HZLA 1HSJA 3HPIA 2E0SA 1SW4A 2NOOA 2XXVA 5I59B 3PUXE 4G68B 5I2KB 2W7YA 4IO3A 3VXBA 2I3VA 1PEBA 3FJGA 3N6TA 3TCHA 1H76A 1O7TA 4F31B 3OMBA 4X1DA 3IOUA 4F3BA 4H5GA 5AA2D 4G8HA 4E0XA 2B65A 3TKDA 4U21A 3V89B 1JETA 1AOVA 3BBRA 4EXKA 2HXWA 2DP8A 4KYDA 1ANFA 2ONSA 1FQDA 2I0BA 1LFHA 5I2NB 4F19A 2OJTA 5H8NB 4MH5A 1AL3A 3H06B 1Z7ME 2XXQA 3PD9A 1I6QA 3TPAA 3L6GA 3V8XB 1DOTA 5IKBA 4HCYA 1NNPA 4OENA 3EF7A 4GL0A 1VR5A 2AL4A 3IAZA 2OWTA 1P1QA 4PQJA 3H7MA 3SERA 4THIA 1MY0A 1RYOA 5CRYA 4ZDMA 3AXFA 5B70A 4H65A 3EN3A 2DVCA 3LBSA 2REJA 4LP2B 2HAVA 5M2VA 4H0WA 1Y4TA 4JWOA 1MDQA 5CC2A 2O6AA 1MPBA 4M1VA 4LZ8A 1SQYA 2HQ0A 3HHGA 4XXUA 3FV1A 3O66A 2UYFA 4F3PA 2Q2AA 3H4ZA 1ZKBA 1MY4A 2UVHA 2VP1A 2VD2A 1LBBA 3LSWA 1OVTA 3OO8A 3UGWA 5JTYA 1B0HA 2DWIA 2G93A 3ILUB 3E13X 4P0GA 4H5FA 3TEPA 4YMAA 4EF1A 3TUSA 1FQCA 1FTJA 1CB6A 3E3KA 5DEXA 2O84X 5F7VA 1HSEA 4LUBA 1JQFA 1Y3QA 1OVBA 3MP6A 5JEIA 1DMBA 5H8FA 3FZVA 2QJEA 3MVZA 5KZTA 4DXBA 3RTWB 1LB8A 3A3UA 3SEYA 3EHSA 2A5SA 4IO4A 4XTCQ 1NL5A 3L6HA 3MVYA 2R9JA 3UA8A 3IB2A 3PD8A 4KPTA 2I48A 1PBQA 3T9UA 4WXJA 1R9QA 5LOMA 4O3BA 1USYE 1JEVA 4EUOA 5HBCA 2DE4A 1EZOA 3IO6A 4QFOA 1WDNA 4EQ7A 1MXWA 2Y7IA 1SYHA 3G3KA 3R7XA 2RINA 1F9BA 5CM6A 1NNFA 4YAHX 4RNSA 1M5DA 4PETA 4BLAA 1P1UA 2XXHA 1YTVA 2G29A 3H6VA 4R6YA 3S9EA 3M3FA 3KFMA 4XKQA 1BIYA 3N6UA 5CBSA 4XKRA 1BKAA 2ZYKA 1M5CA 5KDTA 4L17A 4POXA 3TTLA 2Q2CA 5TP9A 5DVIA 5AA4A 2I58A 2PMSA 4FJPA 4U4SA 3FXQA 2I3WA 4FAJA 1B4HA 4F2QA 3SEXA 3PPNA 1J1NA 2Z8DA 3RQTA 3EHTA 4NWCA 2XXIA 2XXWA 3A09A 4PFWA 4ZEKA 3IJXB 2I4CA 3DM0A 2RC7A 1MRPA 2QS3A 4QSEA 2D21A 2HFBA 1B46A 1FTMA 2V93A 4R2BA 5JTYB 1I69A 4FIMA 4H67A 1B51A 1WODA 1LB9A 1MXXA 2F7BA 3E9XA 1MY1A 3RY3A 2XXUA 4R6KA 1JW1A 4F29A 5EHMA 2ANJA 5H8QA 4Z0IA 3PUYE 3RPWA 1O63A
chains in the Genus database with same CATH superfamily
3G3HA 5H8FB 4HS7A 2X49A 2HKJA 2QS1A 4FE8A 2H99A 5DYGA 4DV0M 3U6PA 3EIEA 3G7WA 4D80A 4F2LA 3VLWA 1SW5A 4H6DA 2JZ0A 1B3EA 1R5LA 3AOEC 1KYIA 1FPGA 5JI3E 3HV1A 2O51A 2AYSA 3RPLA 2ZXTA 3GLIB 4NXMM 3TZAA 4REZA 3ONMA 1FPDA 1B3GA 1NUWA 1I4WA 3ZQJA 3PMXA 1Z5BA 3FXRA 3T93B 3MP8A 4QFKA 3OOAA 1D2NA 4O3CA 3FKEA 1PB8A 1MQGA 2B3BA 1NSFA 2Z8YM 3MAMA 3PFIA 4YMBA 1S3SA 3MSTA 2YNMD 3J27B 4NSOB 3KOZE 1N76A 4QNMA 4GEWA 1LSTA 1MJGM 1Y20A 3DP6A 1VEKA 1L1TA 1PB7A 4AKGA 5I5PA 3FBPA 4ECFA 1IN4A 3CFLA 5BWJA 1HSLA 3BIHA 4PDGA 1Y4CA 3OSQA 4WEPA 4EQBA 5CI5A 4LF6M 5IZ3A 3LMMA 3B7DA 3CR9A 1B2HA 4ZS9A 4I8OA 4OTEA 1L5TA 3KGCA 4RJZA 1JB0F 2XXTA 4LF9M 1QAQA 1IMFA 1Y1ZA 4P8BA 1FBFA 3H03A 4FW9A 1IQ7A 1MDP1 3J2PB 4U23A 4G77A 4G8NA 4FCTA 3E79A 4X9TA 3V5AA 4LCBA 2GRVA 3NWLA 4JN6A 2ZNTA 5EJCA 2IA4A 1POY1 3L28A 2UXAA 2B3TA 1AMFA 3IOTA 1VEGA 4B08A 3C4MA 3SAWA 2DXRA 2GFEA 1B6HA 3W68A 3K9PA 1B1HA 4MM3B 1K9ZA 1CNQA 2QPAA 1WHCA 1D4NA 3M3KA 4O8MA 1Y3NA 2DWAA 4QSCA 3SASA 2DVZA 3L29A 5AA4B 3GLHA 1NNUC 4AB5A 4PD2A 4DUZM 1HT1E 1II5A 2KRUA 1FTLA 3OXNA 4NWDA 1NHWC 1URDA 2O68A 3VXCA 2NUVA 3GBAA 4O94A 3LSXA 4QSDA 4OFOA 4P0IA 3LVWA 5J1DA 4LRSA 5ESYA 4N6DA 3EPEA 1FW0A 4ESWA 4JI7M 2CRUA 4B3SM 1FPLA 2KZUA 1LAHE 4Q0CA 2V6ZM 2F3DA 3FVGA 1B3LA 3FTDA 3N5LA 2DXIA 1B5IA 1IQPA 4LVQA 5KPTA 4POWA 3KN8A 2CV2A 4KHZE 1SYIA 3FV2A 3R6UA 3TTKA 2LNHC 3MVXA 1FPBA 4LF5M 4DR2M 1PM5A 2FIEA 2D7HA 3HCQA 2UUCM 1ZU0A 4FEDA 5F1QA 1IXCA 4N6PA 3PMVA 2QRYA 2F5QA 1QKBA 3MUQA 4GX3A 2F7CA 1LBXA 1GL7A 3JV9A 2O69A 3LR1A 4F39A 4ANRA 4EF2A 1US5A 1VEJA 4OERA 4NSRA 1JVXA 2H25A 3S2VA 3SEUA 4EIWA 5ITOA 4CJ6A 4FWGA 1WIVA 4IO6A 2LVQD 1GABA 1K3WA 3C34A 1OQHA 1Q39A 3KP0E 1PC3A 5H8QB 2XSZA 5I7IA 2QSFX 3FRIA 1DO2A 3PNYA 4MNPA 2D7GA 3CSGA 3GRVA 3VVEA 1AIVA 1Q3BA 4JXJA 3OELA 2NVUB 1P1OA 4B7FA 1SBPA 1J5EM 5TU0A 3PPOA 5IZZA 5DTBA 1NV5A 1XVXA 3U1OA 4GWYA 2REGA 3I01M 3D8LA 3HJSA 1YZ0A 4PFBA 2C96A 3Q28A 4DCXA 1TH3A 3U6MA 4MNCA 4GKKM 2K47A 3MK6A 3RGPA 2DE3A 4LJ4A 4GWOA 3RPLB 3TQLA 5J16A 2MGWA 4TLLB 1S7YA 4YB6A 4PFUA 3ZS6A 1D0KA 2ZAMA 1ELJA 3O9PA 2YJPA 4GITA 1Q1KA 2MKZA 2CUZA 4WW0A 3WAEA 3A98B 3FJ7A 1FBCA 3D8BA 3KOYE 3FASA 4XKPA 1G3IA 2Z8EA 3PUZE 1OQYA 4D82A 3G3FA 4AB6A 3KEIA 3PXGA 2Y0TA 2Y7WA 4CHTB 5EXSA 5IZ7D 4ITQA 4P11A 4KODA 3K0VA 1H6UA 3T66A 5ET8A 1TDZA 3FUVA 2XHDA 4YKPA 3G3GA 3KBRA 3FD9A 5IZ3B 3SEWA 2Z23A 2XFSA 1TR8A 2FNCA 1GVCA 1Y3PA 3Q8XA 2OZZA 4UN2B 3SETA 3OENA 2RC9A 2QHOB 4ZE8A 4LONB 1IY0A 1TF0B 2O25A 1IMCA 4M9ZA 2RCBA 3W0LB 3T0JA 2DYXA 2F6PA 4RXLA 3RNNA 5H37D 1JEUA 2XF3A 3QYBA 4YKKA 1NKXA 1A8EA 1MS7A 2UVGA 3T9XB 1MPDA 1WGNA 4IBCA 5CMBA 4BDNA 2PCRA 2XWIA 3FVKA 5JK4A 2F34A 2DAGA 4X48A 1IZ1A 4MH0E 3BOSA 2I7NA 1VSOA 2Z22A 1SW1A 5FTLA 4KCCA 3M3LA 4AKIA 2XZUA 3H4JA 3B7ZA 4I40A 5FHNA 4I4LA 5ITUA 2Z8FA 1PJSA 3M0EA 5I3SA 3IOWA 1G4AE 1EU8A 3A42A 3GLHB 3VVFA 5GKNA 1YCJA 1N7XA 4LGYA 2ZTDA 2OWSA 3AL0C 4DI4B 3JAMS 1BP5A 3JYRA 4WKMA 3HHZA 4ND9A 2GH9A 1B32A 3O6IA 4L6V6 2Y7PA 4BDLA 3QUJA 2ZBKB 3K6XA 4N8YA 2PX1A 5ET6A 2XH9A 1QZEA 2E1SA 2O1LA 4DXUA 2QQ8A 4C0RA 1LTMA 2Y84A 3O6GA 4QFNA 4YU0A 4KFQA 1KA1A 5ITRA 1QUJA 4RK9A 3K00A 3KOSA 4NE4A 2QNJA 3HU2A 1J09A 3CSBA 4JI8M 1R6BX 2Y20A 4H1XA 2V3UA 3PPQA 3KS8A 1MM6A 3V76A 1MY3A 4TLMB 4FATA 4PFIA 2A5TB 1IXSA 1QVRA 1SXJC 1QDTA 1XB2B 1JW5A 1EYIA 1Z5CA 4GMQA 3J7AS 3U5ZA 2C5RA 3DZDA 4G8MA 4KT0F 1PDAA 2Y5LA 3K6UA 3SESA 3QAXA 4RY1A 3FXBA 1MY2A 2M8CA 4KI0E 3H6UA 4NN3A 4Z6YA 2ZZVA 3G3IA 3FUWA 1UIVA 3K1PA 1R7RA 1T0KA 1DSNA 4AS4A 3VLVA 5ITQA 2HXRA 3F92A 2F5XA 5EHSA 1B1XA 4ZZAA 4BBAA 1NUXA 3B7NA 3SARA 2DNAA 3FUTA 2R18A 1G8PA 1UQWA 3B6QA 2YPNA 1GJTA 3MWBA 2UUBM 4JI6M 1BVSA 5FTIA 3ROJA 1B5JA 2JNHA 4FECA 4F3GA 4F3SA 3JR5A 1EZPA 3AFHA 1USYH 2JA2A 4XEQA 3KOWE 3RFWA 4PBQA 3DP8A 2QSXA 4U22A 5IAIA 1M5FA 1EE8A 3FIRA 2K6BA 2QP9X 3HSTA 1P3QQ 3E78A 3RGYA 3KC1A 1UTHA 1B7HA 1NH7A 4OZ9A 4X8RA 5L9MA 1WVJA 2VHAA 4OU7A 3HJ8A 4OHNA 1P99A 3SYKA 1Q9DA 1VDDA 4OW0A 4IGRA 1LAXA 5FHOA 4ZEDA 2L4FA 4B3MM 2XA5A 4IB2A 1XWIA 4I62A 3KN7A 4DV4M 4HTGA 2FS1A 5FTMA 1X37A 4PTKA 1YSYA 2WX9A 1JNFA 1OAIA 1N3WA 1NY6A 4I9DA 3CVGA 2F78A 2VPOA 2ONKE 1FBPA 3UK6A 3U60B 2H98A 2XXPA 2OCUA 1Y1MA 4I5SA 4HCWA 2UVJA 1DTGA 1QAOA 2AIXA 2I6EA 3CHGA 4G4PA 1URGA 2VOZA 2DWZB 2CEYA 3MZBA 3HJQA 2DZNB 5B7DA 5CMMA 2QL3A 1NUYA 2YLNA 4DV2M 2DS9A 1IMAA 1OFIA 2HHHM 2P5TA 2CEXA 1IN5A 3C35A 2GQFA 2OK2A 3K6WA 3S9NC 3J81S 2V3QA 4YB5A 2HZKA 1LLSA 2R6FA 4DCYA 3Q26A 1XVYA 4LF7M 5ITPA 1IXZA 1XS5A 4EXLA 3V83A 2P0SA 2DAKA 2XX7A 3SAVA 3IK6B 4N6KA 4QFLA 1KA0A 1S9TA 3RLFE 2UU9M 3TWMA 4MFIA 5TPAA 3BKIB 3SYLA 2DHRA 2ZNSA 3VK8A 4NF6B 3B89A 3SKPA 2QMWA 3Q29A 4JI5M 1WXQA 1BK4A 5ISUA 1SD3A 1TTEA 1B52A 3I51A 1ZTYA 4X1BA 5L8RF 2O1MA 1XHBA 3VLUA 3TQWA 1P1WA 2L7HA 2OQ4A 3FTFA 3RT8A 4DLDA 4ESXA 2V3TA 4KD5A 1Z6TA 3BXWA 1ZMWA 2QPQA 2LTUA 3GRUA 4AW4A 4GD5A 1MH3A 4DV6M 1FQBA 3IR1A 4OVZB 4ZEBA 3MZ1A 4IBBA 4FORA 1INPA 2ZYOA 2I7PA 3LUZA 1IXSB 3HN0A 3K01A 3N26A 4MGYE 3C36A 4LRTA 4QRZA 4I8CA 2CMOA 3HU1A 2X4AA 2F3BA 3U5ZB 4KQPA 3USDA 3K2DA 3MJNA 4G68C 1Q35A 3RN8A 3NOHA 4K0KM 5ET5A 2EKKA 3K02A 4S12A 4OVJA 2GHAA 2L2DA 4Z7EA 4NF4A 3VKHA 2XSZD 3O6HA 3U65A 4MGIE 2LXEA 3DA1A 4X64M 3GPUA 1HR0M 4Q5TA 3BIGA 3ZSFA 2OBGA 2O7UA 1MQHA 2LH0A 4II7A 1E9RA 3HHFA 3FE3A 3RE8A 3MZ9A 4FEBA 2ONRA 3CFXA 1XNQM 2V4CA 3IOVA 1N04A 5EQTA 3O28A 2ZNUA 5FTKA 4YICA 2NWJA 2Q9TA 3U93A 4BDQA 2DWJA 4GXAA 4MGHA 3GLBA 3MPKA 1IUDA 3OEKA 1LBVA 3S9LC 5IGAA 2VIIA 1GKIA 2DE2A 3IB0A 2WZJA 4NG7A 3AV0A 1PJJA 4Q8RA 5I58B 4IBIA 2BJIA 4H8IA 3PUWE 2KEBA 4GXSB 2UUAM 2LVAA 2DSFA 4BDRA 3E4RA 2VD3A 1XMOM 3EKIA 1UTHB 3GPXA 1LAGE 2ZZWA 3M8UA 3C3DA 4FVMA 1DV0A 1D9YA 2QENA 3VFJA 4AS5A 2XWKA 4AZFA 2WEFA 1LCTA 2Y7RA 4GRKA 4NMYA 4OQOA 1WGLA 2F4VM 1VE4A 2RC8A 5CMKA 1YXIA 4ZE9A 4H46A 1V33A 2CV1A 3FATA 5T3JA 4RF0A 3VDFA 3K1NA 4QHSA 2I49A 4F1YA 3C9PA 3GRRA 4N81A 1B7UA 5EQ8A 1IMBA 2YFQA 4LZ7A 3HHYA 3MHVC 5FHMA 1T6OA 3I5OA 3KP1E 2Q74A 3UZUA 1QAMA 3K4UA 3MBPA 1QW0A 1ZBMA 3T1YM 4PDIA 1LAFE 3LQRA 1ZMVA 2KHHA 1IXGA 4WURA 2BJJX 1A40A 2H9BA 2I0CA 4IJEA 5F24A 3O97A 2Q89A 1TT1A 1MN3A 3HZJA 1LEVA 4G61A 3IJOB 1RDZA 3PNVA 4NGUA 1T43A 1DO0A 3UN6A 4AKHA 3IORA 2CV0A 1DBZA 1KZ8A 4RA1A 3IX1A 2FA7A 4ZEFA 3PGFA 1EFUB 1Z59A 3U6OA 1K82A 1JR3E 4RK2A 4PCZA 4GWZA 1B3HA 1ZAEA 4OWDA 4NHBA 3J80S 4R74A 3W0FA 4R7GA 2ZZXA 2ABHA 2QS2A 4OX9M 3KDSE 3EHUA 2LVNC 4FD2A 1FPKA 1UIUA 3Q25A 4R72A 5TPAB 4JI0M 3QWLA 2G3QA 4C1TA 2JZ1A 4YHHM 2LHCA 4F2OA 1OTRA 3L25A 4GFRA 1IXIA 4DE8A 4MEVA 4QHTA 4LQ5A 3JR4A 1LGBC 1XOCA 5ET7A 1I94M 3TTRA 4P9KA 5DVFA 3VDUA 5F3WA 4ZPXA 1ZJLA 4LFBM 4BLCA 3TTNA 2UXDM 3FUZA 3C9HA 5I84A 3IL1B 1ZMUA 1N78A 2UXBM 4NQ8A 2A5TA 4U1OA 1VDLA 2JY5A 4GQOA 2UVIA 4DV5M 1OIZA 1FTOA 1IEJA 3B6WA 1LFGA 2GQ1A 1OIBA 2H5XA 3KFUG 1VQ1A 1LBZA 1ZLQA 1PB9A 2F7AA 2RRUA 1N7WA 4X65M 1N3XA 3B74A 1B58A 3KG2A 2DWNA 1A8FA 1QJMA 1OAOC 2RF1A 4EDPA 4RKUF 4EQ9A 2AHMA 3VVDA 4PP0A 3U8QA 1A54A 4NF4B 3IECA 3IFAA 4NF0A 4GIZA 1DGGA 4HW8A 3U6QA 3MPLA 2HAKA 3K2LA 4ONYA 1BTJA 2LVOC 1DGBA 2V1CA 2QMXA 3FXUA 3OO6A 4KYSA 2G5GX 3GBBA 5CBRA 2FOIC 4P16A 1GV8A 4IO2A 4PFYA 1FQFA 4DR6M 1A55A 3MC2A 5LMNM 4PAKA 4OEUA 2DWMA 5KCJB 4OFLA 4C1UA 4P3LA 5EXXA 1RU3A 1B40A 1FJ9A 1IIWA 4PAFA 4ZZEA 1MXZA 2ZYNA 1FJ6A 2LBCA 4AQYM 5EQ9A 2FNAA 3ISPA 1JQJC 1VFEA 2RCAA 3THGA 4JSOA 3SZPA 3UJNA 1KWHA 1AWBA 4FCVA 3R9XB 2WYPA 5AA1A 3A29A 3LV0A 2NQ8C 5DFLA 1B4ZA 4GLIA 4NAPA 2P3NA 3K1MA 1MXVA 2JY7A 3GP1A 4LZJA 4LJ6A 3UK4A 2DXYA 3O2AA 4DR3M 2QCUA 1SI0A 2DWHA 1QUSA 3RUMA 2Y0QA 1FPFA 1YPNA 3OEMA 3KJ7A 4JBZA 2THIA 3QSLA 4RF1A 1MX0A 2X7QA 4N4UA 3SC3A 1BLFA 4YKIA 4UABA 1SW2A 2OO9A 4MGKE 1TXFA 3TMGA 5A5XA 4OYVA 1GR2A 4N17A 3U60A 3T9VA 4RPOA 3GLGA 2DWLA 1QULA 2C99A 4GWWA 4F18A 2VGQA 5E26A 1N36M 1FQEA 2H4IA 2HAUA 4JVIA 5H8HA 2DKLA 1H45A 3SEVA 2L5VA 3QMFA 3SDFA 2PT1A 4DV3M 2R46A 1GLNA 2FHYA 3H6TA 3FGSA 2HCAA 3HKPA 4OVRA 2QVRA 4U1ZA 1M5EA 4R75A 2F36A 3UIFA 3SATA 3T22A 5LDZA 3AKZA 1FQAA 4F1VA 2DQVA 1IBKM 1FJGM 4IO5A 2DAMA 4ELOA 3DLNA 4DR1M 1W5TA 1DK4A 4GBWA 4I1DA 3AJIB 4FWDA 1R6ZA 4F1IA 4KCDA 4O3AA 2Z7JA 4G2ZA 1AUAA 3U94A 5L9SA 3FJMA 3HO7A 1N33M 4Z8XA 2OLBA 4LA9A 2M5ZA 3PPRA 1F4IA 4MBPA 5BPVA 2CE7A 4NF6A 7CATA 4NRWA 4NX1A 3E9SA 2EO2A 2Z4SA 1QZMA 2O7IA 4IJFA 2C98A 1SDXA 4LQ2A 2OOAA 4YB7A 4JB7A 5IT9S 1IMEA 1H43A 4PE5B 2Q88A 3LCVB 3QIMA 2DAIA 4AQ4A 5ITXE 1XC8A 3D4GA 3QK6A 2LVPC 1N32M 3EQ1A 1FBHA 4BDOA 1L8QA 3HX3A 1FRPA 4U4XA 1QUIA 1XT8A 1NV9A 2DOJA 3J7BA 4MLQA 3T9HB 4G3OA 3PTYA 1DTZA 4OVZA 1QUKA 2VT5A 1UM8A 1IXHA 3TL4X 1N77A 4JVDA 1Y9UA 4HLQA 4OXVA 3QXMA 2NXOA 5FTHA 3T96B 4KLNA 1B7ZA 4NRVA 3GPYA 5DYHA 1WR1B 2Y7KA 1H44A 4N91A 3CF2A 1IBLM 1FBEA 4Q30B 3S4UA 3TYHA 2DENA 8CATA 3HY5A 3K1JA 3B50A 4E0WA 5IM2A 3TFLA 4TOZA 2CZKA 2J5YA 2CEAA 1D0MA 3HHXA 4KHPM 4ELPA 1JW4A 1Z7NE 3TCFA 4NF5B 1S50A 4RYAA 4TQUQ 5EXPA 3FYCA 4MB7A 4JXIA 2EA0A 1LBCA 4H45A 3GLFA 1D9QA 3T15A 1OMPA 2F5NA 4QF9A 3ZKKA 3KN3A 4G4NA 3G3JA 3BBZA 3C32A 1SXJA 5AA3A 4PFTA 4M0DA 2JXNA 3K6VA 4O7IA 2F35A 2XD2A 4G6ZA 4NEDA 2UYEA 3W15C 2XXXA 4OFJA 1RDYA 5I58A 3KSJA 4A3VB 5LTCA 4TUWA 2XXRA 2FH0A 1QGXA 1ZIUA 3P7IA 5I56A 2DDKA 3CG3A 4LF4M 1B5HA 1ZV1A 1D0LA 2JWSA 4YY3M 4RPNA 3EIHA 2FE8A 2PYYA 3IFCA 5DW8A 2B3FA 4PC9A 2R44A 4B7HA 3CFZA 3S9MC 1NY5A 1DPPA 1LBYA 1NUZA 2D7EA 2F6GA 1M5BA 5HM4B 4OESA 5K2XA 2DZLA 1XMQM 1R2ZA 1V34A 2QFLA 2E5LM 4LFCM 1MQJA 4XBOA 2CZLA 1I6BA 2WYKA 2MJ5B 2XXYA 3KZGA 3T38A 3FTEA 1NFTA 3M7GA 4IY5A 1UTBA 2PVUA 3ODBA 2V84A 3KSXA 4OVSA 2A5YB 3IHPA 3KVWA 2GHBA 3SHGB 5A5XB 3W9VA 4UA8A 1E94E 3NBIA 3GLGE 1RKMA 3N94A 2H1RA 4MNIA 1POTA 5EYGA 3GLGB 4MLVA 4O7MA 3B9PA 2X26A 1OLCA 5AA2A 3CGWA 4WEDA 3T6PA 5I57A 5H8HB 3OSRA 3U6EA 5FLXS 4DV1M 1MXYA 2XD3A 1L1ZA 2WSFF 4MF3A 4K3FA 2X8AA 2Q8JA 4MMPA 2DI0A 3KS4A 1A7LA 1JVYA 3FD3A 2R62A 4OVQA 3MW0A 4OETA 2FFJA 2HEUA 3L2AA 1XHYA 1JR3A 3GO8A 1QUTA 1TH2A 1NJGA 3BFUA 3O29A 1VDWA 1MG1A 2R6GE 5IWAM 4OMBA 2HCBA 2H5YA 3QUFA 1Q3CA 3U72A 1G59A 2QS4A 3QAUA 4LN5A 1H3DA 2VF8A 4JV5M 2C9OA 1TWYA 4YKJA 2PFYA 4LJ7A 3QYTA 4M9XA 1TDHA 1HQYE 4YZZA 4DR7M 5ITTA 1RYXA 4IBEA 1VFDA 3H6WA 3BFTA 1OQGA 4L16A 5K2YA 4JI1M 1K9YA 4DBGB 1LBWA 3I6VA 2PT2A 2O5RA 2BJWA 2FYIA 4DR5M 4R9GA 1O64A 1TH4A 4F22A 4PBHA 5ITYA 3LQQA 2XWOA 3GZGA 4PDHA 3UMMA 4GVOA 4JDFA 3PMWA 3UP9A 3IB1A 5L8DA 4GWXA 4P17A 3GYYA 4GOTA 1FBGA 3B6TA 1HNXM 1A99A 4KR5A 1PGYA 1NNTA 1SVXB 2EUCA 4R9FA 2KR0A 4N8GA 2L4EA 3A46A 2I4BA 3T1HM 5BR8M 4HE2A 4NF8A 2JY8A 1CE2A 3WAFA 4L78A 4XK8F 2PBWA 1V92A 5EXTA 2DZOB 3SHFA 1B0LA 4QBAA 4OEVA 2OPFA 1HT2E 3H3GA 3UORA 3F11A 3E21A 4LY6A 3W9WA 4QNRA 4IBGA 1URSA 4P56A 1HQCA 2IEEA 3U6CA 2X7PA 1LFIA 3LC8A 4UACA 5CMCA 1TFAA 4JWXA 2XGNA 4N15A 1D3KA 3PV0E 3GLFE 2J7NA 3I4YA 5DEXB 3ZKLA 3VV5A 4R73A 3GLFB 1C7YA 4LZ5A 1SPIA 3TWLA 3C3EA 3FUXA 3FUUA 5EYHA 3RT6B 5KCJA 1NVMA 2DHYA 5EQAA 2XX9A 1SXJE 3I4VA 1SI1A 1MQIA 1SXJB 3JZJA 5HPQA 3HFUA 3U6SA 3TAJA 3DELB 5AE4A 4PT5A 4MGZE 1OLAA 3LUYA 4PAIA 2L09A 5I59A 4CIZA 4DZ1A 4G68A 4NL4H 3OO9A 5I2KA 2ESNA 5I56B 2CZIA 3LSFB 4LJAA 3LSLA 2BJVA 4ELQA 4U2RA 1OJLA 3GLIE 3FRHA 5ICTA 3KOTA 4ISUA 4QHQA 3SMSA 2KQZA 3FVNA 3DP4A 3TE6A 4GL8A 4FWHA 4NTLA 1ATGA 3C33A 3D4CA 4IO7A 1EZ9A 3LW5F 4IIWA 4L8RC 3CG1A 2KLFA 2RKMA 4LGMA 3FVOA 4GRIA 4MHFA 3OO7A 4LATA 1GJSA 3U92A 5DVJA 3AOEA 5EP2A 3M6AA 3OD7A 2ZTCA 1YAEA 1UTBB 2FVZA 3MQ9A 2ZMBA 2WSCF 1P1NA 5FTJA 1R9LA 2FBPA 4DV7M 4KXPA 2O01F 2CP8A 1NHGC 1C1KA 1NH8A 4DI3D 1IBMM 4GWUA 2CHGA 4XKNA 1MPCA 5AA2B 4FBPA 5H8SA 2RGHA 4CGYB 1L2BA 5I57B 1XC1A 2D3IA 3CI8A 4P1EA 3TDJA 5LMUM 2ZAOA 1B9JA 2V25A 1AIPC 2OOBA 5I2NA 1FTKA 2UXCM 2B4LA 1B3FA 3CTWB 5H8NA 1FCKA 2P2AA 4ZECA 1I6AA 3ILTB 4MIJA 4GF8A 1G0HA 5ICQA 1MH4A 3TELA 2VQEM 4LFAM 1QQWA 1N84A 1DGHA 4L4UA 1GTKA 2WKYA 3IO4A 1QKAA 2KNAA 2K9DA 1OIPA 1E9SA 4NOOB 4KYEA 2Y5KA 1FNNA 3TCGA 5KDTB 1J7KA 4R2FA 3THIA 3TTMA 1NNKA 4ZEIA 4PF8A 2F8DA 4QOSA 2PFZA 3PU5A 4DIGA 3AOGA 3VFDA 2D5WA 2XXKA 3OTOM 1US4A 1NMUA 5TP9B 4OANA 3HU3A 1XXHE 5C18A 2BNKA 2HHMA 5A5LA 1XXHB 5KPRA 3MVWA 2P1SA 2KNVA 3CRBA 3SMPA 4HEOA 4XIGQ 5BUUA 1D9VA 5ITXA 4BDMA 1LCFA 3GXAA 1DGFA 4CISA 1AH5A 4LJ8A 2G8LA 4IBJA 5L9OA 2XX8A 2ZYMA 3C31A 2OX3A 1G71A 2R4JA 3CF0A 4DXCA 1TFDA 1MM7A 1ZMGA 1GVNA 2LAOA 1QVSA 3VKGA 4HL4A 3U6DA 2MROB 3KOXE 4H8JA 3VE1B 2CFOA 5DT6A 3TODA 4MAGA 1WJ7A 1MXUA 4NF8B 1PRBA 1EH3A 4JSDA 3TWKA 2ZM6M 3ECRA 2MR9A 3Q27A 4JWYA 3SFZA 1PBPA 1R1NA 2AL5A 3RTFB 2N35A 4HE1A 4N07A 3CIJA 3PUVE 1N0TA 3D1RA 2GNOA 1NV3A 4NF5A 2DVWB 4M4GA 4DDDA 2F97A 2KZSA 4IGTA 4MX6A 3PPPA 3SAUA 2QVUA 1IITA 1N34M 4AG6A 4R6HA 3FTCA 4QFPA 2VQFM 2ALUA 4GHAA 2JP7A 4FCWA 4Y28F 4GC9A 4IY6A 1B05A 3R26A 1YE9A 1IN6A 3MP1A 4PGNA 1DPEA 2B4MA 1IY2A 3KJTA 1FSAA 4N13A 5ELVA 3I3VA 4OVTA 5EYFA 1SXJD 3A3CA 1MQDA 4LZZA 4XF5A 4GIPA 2QZ4A 4ELRA 4F1UA 2R71A 1JP4A 1KSFX 2JJKA 1GGGA 2HZLA 1HSJA 2LWXA 3HPIA 2E0SA 4IBFA 1SW4A 2NOOA 2XXVA 5I59B 3KXEC 2RGOA 3K92A 3PUXE 3SBJA 2F5OA 4G68B 2R0IA 2MH8A 1NV1A 1GO5A 2W7YA 4PDDA 5I2KB 4I3YA 5EP4A 4IO3A 2J7OA 3MYUA 2QBYA 1NV2A 3U61A 3VXBA 2I3VA 4MJOA 1Z5AA 5KQDA 2JUJA 1PEBA 2YR0A 3FJGA 3B8BA 2P3VA 4JI2M 3N6TA 3TCHA 1H76A 4PCDA 1OKSA 1O7TA 3R8FA 4F31B 4B3RM 1XI6A 3OMBA 5FBPA 4X1DA 4OA4A 2K0BX 3IOUA 4F3BA 3KW6A 1ZQ9A 4IBKA 1NV8A 4H5GA 3VLFB 5AA2D 4G8HA 4E0XA 4BB9A 2B65A 1PJTA 3TKDA 3I04M 2ZANA 4U21A 3V89B 1PJQA 1JETA 1AOVA 3BBRA 4EXKA 3VK7A 2HXWA 2DP8A 4KYDA 1NV4A 2CWBA 2KA6B 1ANFA 2ONSA 1FQDA 2I0BA 1R4GA 1LFHA 5I2NB 3VDPA 1R2YA 4F19A 4NC6A 1JR3D 2RKOA 1FPJA 5FSWA 4D81A 2OJTA 5H8NB 2VDBB 1NV7A 4MH5A 4PFRA 1AL3A 3H06B 1Z7ME 2XXQA 3PD9A 5FTNA 2XEPA 2OWZA 1I6QA 4X04A 1DGHB 2BWEA 2F5PA 3TPAA 3L6GA 1FPIA 1YUBA 3V8XB 4GC5A 1QDRA 1IXRC 1DOTA 5IKBA 1OFHA 5DNYA 4HCYA 4B3TM 1NNPA 4PF6A 4OENA 3U6LA 4G4QA 3EF7A 4GL0A 1VR5A 2KRKA 2AL4A 3IAZA 2OWTA 3L27A 3W67A 1P1QA 2V1UA 2L6OA 4PQJA 3H7MA 2HWJA 4B7GA 3SERA 3PVSA 4THIA 1MY0A 1RYOA 5CRYA 4ZDMA 3AXFA 5B70A 3HHWA 3HWSA 2XLJA 1FTAA 3GLHE 3EN3A 4H65A 2DVCA 1ORYB 3LBSA 2REJA 4LP2B 2HAVA 1TGUA 4G4OA 5M2VA 4H0WA 1Y4TA 4JWOA 3DFZA 1MDQA 5CC2A 5IREB 4JI4M 1YLAA 1CUKA 2O6AA 1MPBA 4M1VA 2WSEF 4LZ8A 1SQYA 2HQ0A 5EQ7A 1LV7A 3HHGA 1G0IA 2WBDA 4XXUA 2KDLA 3HGIA 3FV1A 3O66A 4W5WA 4KO8A 3T1BA 2UYFA 4F3PA 2Q2AA 3H4ZA 1T3TA 1MY4A 1ZKBA 2UVHA 2F5SA 2VP1A 2VD2A 1LBBA 3LSWA 1OVTA 3OO8A 3UGWA 5JTYA 2R65A 1UFZA 3KBZA 4PE3A 3L26A 1B0HA 2DWIA 3KC0A 2G93A 3ILUB 3E13X 4P0GA 4H5FA 3TEPA 4YMAA 4QOZC 1DCUA 1SG9A 4EF1A 2R8TA 4DUYM 3TUSA 4R3DA 1FQCA 1NV6A 1FTJA 4OVPA 1CB6A 3E3KA 5DEXA 2O84X 4P47A 5F7VA 4AI6A 2L7IA 1EIJA 1EYKA 3K9OA 4P1LA 1HSEA 4XFEA 4LUBA 1JQFA 4JVCA 1Y3QA 1OVBA 3MP6A 3RYDA 1RDXA 2XZFA 4LG2A 3TPZA 2KNZA 1IMDA 1DMBA 5JEIA 3C58A 5H8FA 3GQ3A 3FZVA 5KQ8A 3NBXX 2QJEA 3MVZA 1K3XA 5KZTA 1A5TA 4DXBA 4HE0A 4JI3M 3TQSA 3RTWB 1LB8A 3A3UA 1NI9A 3A45A 1XNRM 1IN7A 3SEYA 3EHSA 1MU5A 2WBBA 2A5SA 3GQ5A 4IO4A 4XTCQ 1NL5A 3H4MA 3L6HA 3GLIA 3MVYA 3E46A 3LCUA 2R9JA 4XGIA 3LVVA 2QBYB 4HXVA 3U61B 1QANA 3MMPA 2R4EA 1KFVA 3UA8A 3IB2A 4GX4A 3PD8A 4KPTA 4WP2A 4DR4M 3IG5A 5JI2E 2I48A 4G4RA 1PBQA 3T9UA 4M9SA 3WHKA 4GHLA 4WXJA 5A2QS 1IM2A 1R9QA 3K8ZA 5LOMA 4O3BA 1USYE 1JEVA 4EUOA 5HBCA 2HPGA 2DE4A 1EZOA 1QYRA 3IO6A 2Z3XA 3CF6E 4QFOA 2LHGA 4MCOA 4NXNM 1WDNA 4EQ7A 2CHQA 1MXWA 4M0WA 2VPNA 2Q8MA 2Y7IA 1SYHA 3G3KA 3ILKA 3R7XA 2RINA 1IFYA 4GKJM 1F9BA 1NNFA 5CM6A 4YAHX 4RNSA 4AG5A 1M5DA 4PETA 4BLAA 1P1UA 2XXHA 1YTVA 3B7QA 2G29A 3H6VA 4I3EA 4R6YA 1EYJA 4QXDA 3S9EA 3GRYA 5KPZA 1YYZA 1PJIA 5E6JA 1HJPA 2CZHA 3M3FA 3KFMA 4XKQA 1BIYA 2EKFA 2FIXA 3N6UA 5CBSA 1HNZM 4PGPA 2R45A 4XKRA 4L15A 4IR8A 1BKAA 2QVVA 2Q2EB 2ZYKA 2YQZA 2HL7A 1M5CA 2DAEA 2M60A 3FYDA 5KDTA 4L17A 3WHLA 4POXA 3TTLA 5EP1A 5IZ1A 1IY1A 4X62M 2Q2CA 3DOAA 1NV0A 5TP9A 4LJ9A 5DVIA 4GBVA 1NNJA 3ZCBB 1VG5A 1XXHA 4GH9A 1GL6A 5AA4A 2I58A 2PMSA 4FJPA 4U4SA 2Z4RA 2VF7A 3FXQA 2I3WA 4RNAA 1E32A 3MJ5A 3UGJA 2BWBA 1N75A 4FAJA 1B4HA 4F2QA 3SEXA 3PPNA 4IBDA 1J1NA 2Z8DA 3RQTA 3ZH9B 4LJ5A 3RGSA 1FBDA 2CHVA 2JY6B 4JYAM 3EHTA 2KXEA 2Y21A 4NWCA 2XXIA 2XXWA 3A09A 4PFWA 2ERCA 4ZEKA 3IG8A 3IJXB 2I4CA 3DM0A 1Q02A 2RC7A 1MRPA 1IN8A 2QS3A 3GPPA 4QSEA 2D21A 2HFBA 1L2CA 1B46A 4Q7JA 5DYIA 1FTMA 2V93A 4R71A 3GQ4A 1NJFA 4R2BA 2C9CA 5JTYB 5KO3A 2EJSA 4I81A 2XFTA 4GX6A 1FPEA 1I69A 4FIMA 4H67A 1B51A 4X66M 3ZC7B 2KW0A 1WODA 4GWSA 1LB9A 1MXXA 4LF8M 1W5SA 2F7BA 1L2DA 1Y8GA 3E9XA 2APLA 1HNWM 1MY1A 3RY3A 1G41A 2XXUA 4R6KA 3Q8GA 3QYEA 1JW1A 5C1BA 4F29A 5EHMA 2W82A 5EP3A 2ANJA 1NO1A 5H8QA 2XWVA 4Z0IA 3PUYE 3RPWA 1O63A
chains in the Genus database with same CATH topology
3G3HA 5H8FB 4HS7A 2X49A 2HKJA 2QS1A 4FE8A 2H99A 5DYGA 4DV0M 3U6PA 3EIEA 3G7WA 4D80A 3VLWA 1SW5A 4H6DA 1B3EA 3AOEC 1KYIA 5JI3E 3HV1A 2O51A 2AYSA 2ZXTA 3GLIB 4NXMM 3TZAA 4REZA 3ONMA 1B3GA 1I4WA 3PMXA 1Z5BA 3FXRA 3T93B 3MP8A 4QFKA 3OOAA 1D2NA 4O3CA 3FKEA 1PB8A 1MQGA 2B3BA 1NSFA 3MAMA 4YMBA 3PFIA 1S3SA 2YNMD 3J27B 4NSOB 3KOZE 1N76A 4QNMA 1LSTA 3DP6A 1Y20A 1L1TA 1PB7A 4AKGA 4ECFA 1IN4A 3CFLA 5BWJA 1HSLA 4PDGA 1Y4CA 3OSQA 4WEPA 4EQBA 5CI5A 4LF6M 3LMMA 3B7DA 3CR9A 1B2HA 4ZS9A 4I8OA 4OTEA 1L5TA 3KGCA 4RJZA 2XXTA 4LF9M 1QAQA 1Y1ZA 3H03A 4FW9A 1IQ7A 1MDP1 3J2PB 4U23A 4G77A 4G8NA 4FCTA 4X9TA 3V5AA 4LCBA 2GRVA 3NWLA 4JN6A 2ZNTA 5EJCA 2IA4A 1POY1 3L28A 2UXAA 1AMFA 3IOTA 4B08A 3C4MA 3SAWA 2DXRA 2GFEA 1B6HA 1B1HA 4MM3B 2QPAA 1D4NA 3M3KA 1Y3NA 2DWAA 4QSCA 3SASA 2DVZA 3L29A 5AA4B 3GLHA 1NNUC 4AB5A 4PD2A 4DUZM 1HT1E 1II5A 2KRUA 1FTLA 3OXNA 4NWDA 1NHWC 1URDA 2O68A 3VXCA 2NUVA 3GBAA 3LSXA 4QSDA 4OFOA 4P0IA 3LVWA 5J1DA 4LRSA 3EPEA 1FW0A 4ESWA 4JI7M 4B3SM 2KZUA 1LAHE 4Q0CA 2V6ZM 3FVGA 1B3LA 3FTDA 3N5LA 2DXIA 1B5IA 1IQPA 4LVQA 5KPTA 4POWA 3KN8A 2CV2A 4KHZE 1SYIA 3FV2A 3R6UA 3TTKA 2LNHC 3MVXA 4LF5M 4DR2M 1PM5A 2D7HA 3HCQA 2UUCM 1ZU0A 4FEDA 5F1QA 1IXCA 4N6PA 3PMVA 2QRYA 2F5QA 1QKBA 3MUQA 2F7CA 1GL7A 3JV9A 2O69A 3LR1A 4F39A 4EF2A 1US5A 4OERA 4NSRA 1JVXA 2H25A 3S2VA 3SEUA 4EIWA 5ITOA 4FWGA 4IO6A 1K3WA 3C34A 1OQHA 1Q39A 3KP0E 1PC3A 5H8QB 2XSZA 1DO2A 3PNYA 2D7GA 3CSGA 3GRVA 3VVEA 1AIVA 1Q3BA 4JXJA 3OELA 2NVUB 1P1OA 4B7FA 1SBPA 1J5EM 5TU0A 3PPOA 5DTBA 1XVXA 3U1OA 2REGA 3D8LA 3HJSA 4DCXA 2C96A 3Q28A 1TH3A 3U6MA 4GKKM 2K47A 3MK6A 3RGPA 2DE3A 4LJ4A 4GWOA 3TQLA 4TLLB 1S7YA 4YB6A 4PFUA 3ZS6A 2ZAMA 1ELJA 3O9PA 2YJPA 4GITA 1Q1KA 2CUZA 4WW0A 3WAEA 3A98B 3FJ7A 3D8BA 3KOYE 3FASA 4XKPA 1G3IA 2Z8EA 3PUZE 4D82A 3G3FA 4AB6A 3KEIA 3PXGA 2Y0TA 2Y7WA 4CHTB 5EXSA 5IZ7D 4ITQA 4P11A 4KODA 3K0VA 1H6UA 3T66A 1TDZA 3FUVA 2XHDA 4YKPA 3G3GA 3KBRA 3FD9A 3SEWA 2Z23A 2XFSA 2FNCA 1GVCA 1Y3PA 3Q8XA 2OZZA 3SETA 3OENA 2RC9A 4ZE8A 4LONB 1IY0A 4M9ZA 2RCBA 3W0LB 2DYXA 2F6PA 4RXLA 3RNNA 5H37D 1JEUA 2XF3A 4YKKA 1NKXA 1A8EA 1MS7A 2UVGA 3T9XB 1MPDA 4IBCA 5CMBA 4BDNA 3FVKA 5JK4A 2F34A 4X48A 1IZ1A 4MH0E 3BOSA 2I7NA 1VSOA 2Z22A 1SW1A 5FTLA 4KCCA 3M3LA 4AKIA 2XZUA 5FHNA 4I4LA 5ITUA 2Z8FA 3M0EA 3IOWA 1G4AE 1EU8A 3A42A 3GLHB 3VVFA 5GKNA 1YCJA 1N7XA 4LGYA 2OWSA 3AL0C 3JAMS 1BP5A 3JYRA 4WKMA 3HHZA 4ND9A 2GH9A 1B32A 3O6IA 2Y7PA 4BDLA 3QUJA 2ZBKB 3K6XA 2PX1A 2XH9A 2E1SA 2O1LA 4DXUA 4C0RA 2Y84A 3O6GA 4QFNA 4YU0A 4KFQA 5ITRA 1QUJA 4RK9A 3K00A 3KOSA 4NE4A 3HU2A 1J09A 3CSBA 4JI8M 1R6BX 2Y20A 4H1XA 2V3UA 3PPQA 3KS8A 1MM6A 1MY3A 4TLMB 4FATA 2A5TB 1QVRA 1SXJC 1JW5A 1Z5CA 4GMQA 3J7AS 3U5ZA 2C5RA 3DZDA 4G8MA 1PDAA 3K6UA 3SESA 3QAXA 4RY1A 1MY2A 2M8CA 4KI0E 3H6UA 4Z6YA 3G3IA 3FUWA 1UIVA 3K1PA 1R7RA 1T0KA 1DSNA 3VLVA 5ITQA 2F5XA 5EHSA 1B1XA 4ZZAA 4BBAA 3SARA 3FUTA 2R18A 1G8PA 1UQWA 3B6QA 2YPNA 3MWBA 2UUBM 4JI6M 5FTIA 1B5JA 4FECA 4F3GA 4F3SA 3JR5A 1EZPA 3AFHA 1USYH 2JA2A 3KOWE 3RFWA 3DP8A 2QSXA 4U22A 5IAIA 1M5FA 1EE8A 3FIRA 2QP9X 3HSTA 3RGYA 1UTHA 1B7HA 1NH7A 4OZ9A 5L9MA 1WVJA 2VHAA 4OU7A 3HJ8A 4OHNA 1P99A 3SYKA 1VDDA 4OW0A 4IGRA 1LAXA 5FHOA 4ZEDA 4B3MM 4IB2A 1XWIA 4I62A 3KN7A 4DV4M 4HTGA 5FTMA 1X37A 1YSYA 1JNFA 1N3WA 1NY6A 4I9DA 3CVGA 2F78A 2ONKE 3UK6A 3U60B 2H98A 2XXPA 2OCUA 1Y1MA 4I5SA 4HCWA 2UVJA 1DTGA 1QAOA 2AIXA 2I6EA 4G4PA 1URGA 2VOZA 2DWZB 3MZBA 3HJQA 2DZNB 5B7DA 5CMMA 2QL3A 2YLNA 4DV2M 2DS9A 1OFIA 2HHHM 2P5TA 3K6WA 1IN5A 3C35A 2OK2A 3S9NC 3J81S 2V3QA 4YB5A 2HZKA 1LLSA 4DCYA 3Q26A 1XVYA 4LF7M 5ITPA 1IXZA 1XS5A 4EXLA 3V83A 2P0SA 2XX7A 3SAVA 3IK6B 4QFLA 1S9TA 3RLFE 2UU9M 3TWMA 4MFIA 5TPAA 3BKIB 3SYLA 2DHRA 2ZNSA 3VK8A 4NF6B 3SKPA 2QMWA 3Q29A 4JI5M 1WXQA 5ISUA 1SD3A 1B52A 3I51A 1ZTYA 4X1BA 2O1MA 1XHBA 3VLUA 3TQWA 1P1WA 2L7HA 2OQ4A 3FTFA 3RT8A 4DLDA 4ESXA 2V3TA 4KD5A 1Z6TA 2QPQA 3GRUA 4AW4A 4GD5A 1MH3A 4DV6M 1FQBA 3IR1A 4OVZB 4ZEBA 3MZ1A 4IBBA 4FORA 2ZYOA 2I7PA 1IXSB 3HN0A 3K01A 3N26A 4MGYE 3C36A 4LRTA 4QRZA 4I8CA 2CMOA 3HU1A 2X4AA 3U5ZB 4KQPA 3USDA 3K2DA 3MJNA 4G68C 1Q35A 3RN8A 4K0KM 3K02A 4S12A 4OVJA 2GHAA 4Z7EA 4NF4A 3VKHA 2XSZD 3O6HA 4MGIE 2LXEA 3DA1A 4X64M 3GPUA 1HR0M 4Q5TA 3ZSFA 2OBGA 2O7UA 1MQHA 2LH0A 4II7A 1E9RA 3HHFA 3RE8A 3MZ9A 4FEBA 2ONRA 3CFXA 1XNQM 3IOVA 1N04A 5EQTA 3O28A 2ZNUA 5FTKA 4YICA 2NWJA 2Q9TA 3U93A 4BDQA 2DWJA 4GXAA 4MGHA 3GLBA 3MPKA 1IUDA 3OEKA 3S9LC 2VIIA 1GKIA 2DE2A 3IB0A 3AV0A 1PJJA 4Q8RA 5I58B 4IBIA 4H8IA 3PUWE 2KEBA 4GXSB 2UUAM 2DSFA 4BDRA 3E4RA 2VD3A 1XMOM 1UTHB 3GPXA 1LAGE 3M8UA 4FVMA 1D9YA 3VFJA 2QENA 4AZFA 1LCTA 2Y7RA 4GRKA 4NMYA 4OQOA 2F4VM 1VE4A 2RC8A 5CMKA 4ZE9A 2CV1A 3FATA 4RF0A 3VDFA 3K1NA 4QHSA 2I49A 4F1YA 3GRRA 1B7UA 2YFQA 4LZ7A 3HHYA 3MHVC 5FHMA 3I5OA 3KP1E 3UZUA 1QAMA 3K4UA 3MBPA 1QW0A 1ZBMA 3T1YM 4PDIA 1LAFE 3LQRA 1IXGA 4WURA 2BJJX 1A40A 2H9BA 2I0CA 4IJEA 3O97A 2Q89A 1TT1A 3IJOB 3PNVA 1DO0A 3UN6A 4AKHA 3IORA 2CV0A 4RA1A 3IX1A 2FA7A 4ZEFA 3PGFA 1Z59A 3U6OA 1K82A 4RK2A 4PCZA 1B3HA 1ZAEA 4OWDA 3J80S 4R74A 3W0FA 4R7GA 2ABHA 2QS2A 4OX9M 3KDSE 3EHUA 4FD2A 1UIUA 3Q25A 5TPAB 4R72A 4JI0M 3QWLA 4C1TA 4YHHM 4F2OA 3L25A 4GFRA 1IXIA 4DE8A 4QHTA 4LQ5A 3JR4A 1LGBC 1XOCA 3TTRA 1I94M 5DVFA 3VDUA 5F3WA 4ZPXA 1ZJLA 4LFBM 4BLCA 3TTNA 2UXDM 3FUZA 3C9HA 5I84A 3IL1B 1N78A 2UXBM 2A5TA 4U1OA 4GQOA 2UVIA 4DV5M 1FTOA 3B6WA 1IEJA 1LFGA 1OIBA 3KFUG 1ZLQA 1PB9A 2F7AA 1N7WA 4X65M 1N3XA 1B58A 3KG2A 2DWNA 1A8FA 1QJMA 2RF1A 4EDPA 4EQ9A 2AHMA 3VVDA 4PP0A 3U8QA 1A54A 4NF4B 4GIZA 1DGGA 4HW8A 3U6QA 3MPLA 3K2LA 4ONYA 1BTJA 3OO6A 1DGBA 2V1CA 2QMXA 3FXUA 4KYSA 2G5GX 3GBBA 5CBRA 2FOIC 4P16A 1GV8A 4IO2A 4PFYA 1FQFA 4DR6M 1A55A 3MC2A 5LMNM 4OEUA 2DWMA 5KCJB 4OFLA 4C1UA 5EXXA 1B40A 1IIWA 4ZZEA 1MXZA 2ZYNA 4AQYM 2FNAA 1JQJC 1VFEA 2RCAA 3THGA 4JSOA 3UJNA 1KWHA 4FCVA 3R9XB 5AA1A 2NQ8C 1B4ZA 4GLIA 3K1MA 1MXVA 3GP1A 4LZJA 4LJ6A 3UK4A 2DXYA 3O2AA 4DR3M 2QCUA 1SI0A 2DWHA 3RUMA 2Y0QA 1YPNA 3OEMA 3KJ7A 4JBZA 2THIA 3QSLA 4RF1A 1MX0A 2X7QA 3SC3A 1BLFA 4YKIA 1SW2A 4MGKE 1TXFA 3TMGA 5A5XA 4OYVA 1GR2A 3U60A 3T9VA 4RPOA 3GLGA 2DWLA 1QULA 2C99A 4F18A 2VGQA 5E26A 1N36M 1FQEA 2H4IA 2HAUA 5H8HA 1H45A 3SEVA 3SDFA 2PT1A 4DV3M 2R46A 1GLNA 3H6TA 3FGSA 2HCAA 3HKPA 4U1ZA 1M5EA 4R75A 2F36A 3UIFA 3SATA 3T22A 3AKZA 1FQAA 4F1VA 2DQVA 1IBKM 1FJGM 4IO5A 4ELOA 3DLNA 4DR1M 1W5TA 4I1DA 3AJIB 1R6ZA 4FWDA 4KCDA 4O3AA 2Z7JA 4G2ZA 3U94A 5L9SA 3FJMA 3HO7A 1N33M 4Z8XA 2OLBA 4LA9A 2M5ZA 3PPRA 4MBPA 5BPVA 2CE7A 4NF6A 7CATA 4NRWA 3E9SA 2EO2A 2Z4SA 1QZMA 2O7IA 4IJFA 2C98A 1SDXA 4LQ2A 4YB7A 4JB7A 5IT9S 1H43A 4PE5B 2Q88A 3QIMA 4AQ4A 5ITXE 1XC8A 3D4GA 3QK6A 1N32M 3EQ1A 4BDOA 1L8QA 4U4XA 1QUIA 1XT8A 2DOJA 3J7BA 4MLQA 3T9HB 1DTZA 4OVZA 1QUKA 1UM8A 1IXHA 3TL4X 1N77A 1Y9UA 4HLQA 4OXVA 3QXMA 2NXOA 5FTHA 3T96B 4KLNA 1B7ZA 4NRVA 3GPYA 5DYHA 2Y7KA 1H44A 3CF2A 1IBLM 4Q30B 3S4UA 3TYHA 8CATA 3K1JA 4E0WA 3TFLA 4TOZA 2CEAA 3HHXA 4KHPM 4ELPA 1JW4A 1Z7NE 3TCFA 4NF5B 1S50A 4RYAA 4TQUQ 5EXPA 3FYCA 4MB7A 4JXIA 2EA0A 1LBCA 3GLFA 3T15A 1OMPA 2F5NA 4QF9A 3ZKKA 3KN3A 4G4NA 3G3JA 3C32A 1SXJA 5AA3A 4PFTA 4M0DA 3K6VA 2F35A 2XD2A 4G6ZA 4NEDA 2UYEA 3W15C 2XXXA 4OFJA 5I58A 3KSJA 4A3VB 4TUWA 2XXRA 1ZIUA 3P7IA 5I56A 3CG3A 4LF4M 1B5HA 4YY3M 4RPNA 3EIHA 2FE8A 2PYYA 2B3FA 4B7HA 3CFZA 3S9MC 1NY5A 1DPPA 2D7EA 2F6GA 1M5BA 5HM4B 4OESA 5K2XA 1XMQM 1R2ZA 2E5LM 4LFCM 1MQJA 4XBOA 2CZLA 1I6BA 3KZGA 2XXYA 3T38A 3FTEA 1NFTA 3M7GA 4IY5A 1UTBA 2PVUA 3ODBA 2V84A 3KSXA 2A5YB 3KVWA 2GHBA 3SHGB 5A5XB 3W9VA 4UA8A 1E94E 3NBIA 3N94A 1RKMA 2H1RA 1POTA 3GLGB 4MLVA 3B9PA 2X26A 1OLCA 5AA2A 4WEDA 5I57A 5H8HB 3OSRA 3U6EA 5FLXS 4DV1M 1MXYA 2XD3A 1L1ZA 4MF3A 4K3FA 2X8AA 2Q8JA 1A7LA 3KS4A 1JVYA 3FD3A 2R62A 3MW0A 4OETA 2FFJA 2HEUA 3L2AA 1XHYA 1JR3A 3GO8A 1TH2A 1NJGA 3BFUA 3O29A 1MG1A 2R6GE 5IWAM 4OMBA 2HCBA 2H5YA 3QUFA 1Q3CA 3U72A 1G59A 2QS4A 3QAUA 1H3DA 4JV5M 2C9OA 1TWYA 4YKJA 4LJ7A 3QYTA 4M9XA 1TDHA 1HQYE 4YZZA 4DR7M 5ITTA 1RYXA 4IBEA 1VFDA 3H6WA 3BFTA 1OQGA 4L16A 5K2YA 4JI1M 3I6VA 2PT2A 2O5RA 2BJWA 2FYIA 4DR5M 4R9GA 1O64A 1TH4A 4F22A 5ITYA 3LQQA 3GZGA 3UMMA 4GVOA 4JDFA 3PMWA 3UP9A 3IB1A 5L8DA 4GOTA 3B6TA 1HNXM 1A99A 4KR5A 1NNTA 1SVXB 2EUCA 4R9FA 3A46A 2I4BA 3T1HM 5BR8M 4NF8A 1CE2A 3WAFA 4L78A 2PBWA 5EXTA 2DZOB 3SHFA 1B0LA 4OEVA 2OPFA 1HT2E 3H3GA 3UORA 3F11A 4LY6A 3W9WA 4QNRA 4IBGA 1URSA 1HQCA 2IEEA 3U6CA 2X7PA 1LFIA 3LC8A 4UACA 5CMCA 1TFAA 4JWXA 2XGNA 1D3KA 3PV0E 5DEXB 2J7NA 3I4YA 3ZKLA 3VV5A 4R73A 3GLFB 4LZ5A 3TWLA 3FUXA 3FUUA 3RT6B 5KCJA 1NVMA 2XX9A 1SXJE 3I4VA 1SI1A 1MQIA 1SXJB 3JZJA 5HPQA 3U6SA 3TAJA 3DELB 5AE4A 4PT5A 4MGZE 1OLAA 3LUYA 2L09A 5I59A 4DZ1A 4G68A 4NL4H 3OO9A 5I2KA 2ESNA 5I56B 3LSFB 4LJAA 3LSLA 2BJVA 4ELQA 4U2RA 1OJLA 5ICTA 3KOTA 4ISUA 4QHQA 3SMSA 3FVNA 3DP4A 3TE6A 4GL8A 4FWHA 4NTLA 1ATGA 3C33A 3D4CA 4IO7A 1EZ9A 4IIWA 4L8RC 3CG1A 2KLFA 2RKMA 4LGMA 3FVOA 4GRIA 3OO7A 4LATA 3U92A 5DVJA 3AOEA 5EP2A 3M6AA 3OD7A 1YAEA 1UTBB 3MQ9A 2ZMBA 1P1NA 1R9LA 5FTJA 4DV7M 1NHGC 1C1KA 1NH8A 1IBMM 4XKNA 2CHGA 1MPCA 5AA2B 5H8SA 2RGHA 4CGYB 1L2BA 5I57B 1XC1A 2D3IA 3CI8A 3TDJA 5LMUM 2ZAOA 1B9JA 2V25A 5I2NA 1FTKA 2UXCM 1B3FA 3CTWB 5H8NA 1FCKA 2P2AA 4ZECA 1I6AA 3ILTB 4GF8A 5ICQA 1MH4A 3TELA 2VQEM 4LFAM 1QQWA 1N84A 1DGHA 4L4UA 1GTKA 2WKYA 3IO4A 1QKAA 1E9SA 4NOOB 4KYEA 1FNNA 3TCGA 5KDTB 1J7KA 4R2FA 3THIA 3TTMA 1NNKA 4ZEIA 2F8DA 4QOSA 3PU5A 4DIGA 3AOGA 3VFDA 2D5WA 3OTOM 1US4A 1NMUA 5TP9B 3HU3A 5C18A 2BNKA 1XXHB 5KPRA 3MVWA 2P1SA 3CRBA 3SMPA 4XIGQ 5BUUA 1D9VA 5ITXA 4BDMA 1LCFA 3GXAA 1DGFA 4CISA 1AH5A 4LJ8A 2G8LA 4IBJA 5L9OA 2XX8A 2ZYMA 3C31A 2R4JA 3CF0A 4DXCA 1TFDA 1MM7A 1ZMGA 1GVNA 2LAOA 1QVSA 3VKGA 4HL4A 3U6DA 3KOXE 4H8JA 3VE1B 2CFOA 5DT6A 3TODA 1MXUA 4NF8B 1EH3A 4JSDA 3TWKA 2ZM6M 3ECRA 3Q27A 4JWYA 3SFZA 1PBPA 1R1NA 2AL5A 3RTFB 4N07A 3CIJA 3PUVE 1N0TA 4NF5A 2DVWB 4M4GA 4DDDA 2F97A 2KZSA 4IGTA 3PPPA 3SAUA 1IITA 1N34M 4AG6A 4R6HA 3FTCA 4QFPA 2VQFM 2ALUA 4GHAA 4FCWA 4GC9A 4IY6A 1B05A 3R26A 1YE9A 1IN6A 3MP1A 1DPEA 1IY2A 3KJTA 4N13A 5ELVA 3I3VA 5EYFA 1SXJD 3A3CA 1MQDA 4LZZA 4GIPA 2QZ4A 4ELRA 4F1UA 2R71A 1KSFX 1GGGA 2HZLA 1HSJA 2LWXA 3HPIA 2E0SA 4IBFA 1SW4A 2NOOA 2XXVA 5I59B 3KXEC 2RGOA 3K92A 3PUXE 3SBJA 2F5OA 4G68B 5I2KB 2W7YA 5EP4A 4IO3A 2J7OA 2QBYA 3VXBA 3U61A 2I3VA 1Z5AA 5KQDA 1PEBA 2YR0A 3FJGA 4JI2M 3N6TA 3TCHA 1H76A 1O7TA 3R8FA 4F31B 4B3RM 3OMBA 4X1DA 3IOUA 4F3BA 3KW6A 1ZQ9A 4IBKA 4H5GA 3VLFB 5AA2D 4G8HA 4E0XA 4BB9A 2B65A 3TKDA 2ZANA 4U21A 3V89B 1JETA 1AOVA 3BBRA 4EXKA 3VK7A 2HXWA 2DP8A 4KYDA 2KA6B 1ANFA 2ONSA 1FQDA 2I0BA 1LFHA 5I2NB 3VDPA 1R2YA 4F19A 1JR3D 2RKOA 5FSWA 4D81A 2OJTA 5H8NB 4MH5A 1AL3A 3H06B 1Z7ME 2XXQA 3PD9A 5FTNA 2XEPA 1I6QA 1DGHB 2F5PA 3TPAA 3L6GA 1YUBA 3V8XB 4GC5A 1IXRC 1DOTA 5IKBA 1OFHA 5DNYA 4HCYA 4B3TM 1NNPA 4OENA 3U6LA 4G4QA 3EF7A 4GL0A 1VR5A 2KRKA 2AL4A 3IAZA 2OWTA 3L27A 1P1QA 2V1UA 2L6OA 4PQJA 3H7MA 4B7GA 3SERA 3PVSA 4THIA 1MY0A 1RYOA 5CRYA 4ZDMA 3AXFA 5B70A 3HHWA 3HWSA 2XLJA 4H65A 3EN3A 2DVCA 1ORYB 3LBSA 2REJA 4LP2B 2HAVA 1TGUA 4G4OA 5M2VA 4H0WA 1Y4TA 4JWOA 3DFZA 1MDQA 5CC2A 5IREB 4JI4M 2O6AA 1MPBA 4M1VA 4LZ8A 1SQYA 2HQ0A 1LV7A 3HHGA 4XXUA 3HGIA 3FV1A 3O66A 4W5WA 4KO8A 2UYFA 4F3PA 2Q2AA 3H4ZA 1T3TA 1MY4A 1ZKBA 2UVHA 2F5SA 2VP1A 2VD2A 1LBBA 3LSWA 1OVTA 3OO8A 3UGWA 5JTYA 2R65A 3L26A 1B0HA 2DWIA 2G93A 3ILUB 3E13X 4P0GA 4H5FA 3TEPA 4YMAA 4QOZC 4EF1A 4DUYM 3TUSA 4R3DA 1FQCA 1FTJA 1CB6A 3E3KA 5DEXA 2O84X 5F7VA 4AI6A 2L7IA 1HSEA 4LUBA 1JQFA 1Y3QA 1OVBA 3MP6A 2XZFA 4LG2A 3TPZA 5JEIA 1DMBA 3C58A 5H8FA 3GQ3A 3FZVA 5KQ8A 2QJEA 3MVZA 1K3XA 5KZTA 4DXBA 4JI3M 3TQSA 3RTWB 1LB8A 3A3UA 3A45A 1XNRM 1IN7A 3SEYA 3EHSA 1MU5A 2A5SA 3GQ5A 4IO4A 4XTCQ 1NL5A 3H4MA 3L6HA 3GLIA 3MVYA 2R9JA 4XGIA 3LVVA 2QBYB 3U61B 1QANA 2R4EA 1KFVA 3UA8A 3IB2A 3PD8A 4KPTA 4DR4M 3IG5A 5JI2E 2I48A 4G4RA 1PBQA 3T9UA 4M9SA 3WHKA 4GHLA 4WXJA 5A2QS 1IM2A 1R9QA 3K8ZA 5LOMA 4O3BA 1USYE 1JEVA 4EUOA 5HBCA 2DE4A 1EZOA 1QYRA 3IO6A 2Z3XA 3CF6E 4QFOA 4NXNM 1WDNA 4EQ7A 2CHQA 1MXWA 4M0WA 2Y7IA 1SYHA 3G3KA 3ILKA 3R7XA 2RINA 1F9BA 4GKJM 5CM6A 1NNFA 4YAHX 4RNSA 4AG5A 1M5DA 4PETA 4BLAA 1P1UA 2XXHA 1YTVA 2G29A 3H6VA 4R6YA 3S9EA 3GRYA 5KPZA 1PJIA 5E6JA 3M3FA 3KFMA 4XKQA 1BIYA 3N6UA 5CBSA 1HNZM 4XKRA 2R45A 4L15A 1BKAA 2Q2EB 2ZYKA 2YQZA 2HL7A 1M5CA 2M60A 3FYDA 5KDTA 4L17A 3WHLA 4POXA 3TTLA 5EP1A 1IY1A 4X62M 2Q2CA 3DOAA 5TP9A 4LJ9A 5DVIA 1NNJA 3ZCBB 1XXHA 4GH9A 1GL6A 5AA4A 2I58A 2PMSA 4FJPA 4U4SA 2Z4RA 3FXQA 2I3WA 4RNAA 1E32A 3MJ5A 3UGJA 1N75A 4FAJA 1B4HA 4F2QA 3SEXA 3PPNA 4IBDA 1J1NA 2Z8DA 3RQTA 3ZH9B 4LJ5A 3RGSA 2CHVA 4JYAM 3EHTA 2KXEA 2Y21A 4NWCA 2XXIA 2XXWA 3A09A 4PFWA 2ERCA 4ZEKA 3IG8A 3IJXB 2I4CA 3DM0A 2RC7A 1MRPA 1IN8A 2QS3A 3GPPA 4QSEA 2D21A 2HFBA 1L2CA 1B46A 1FTMA 5DYIA 2V93A 3GQ4A 1NJFA 4R2BA 2C9CA 5JTYB 5KO3A 4I81A 2XFTA 1I69A 4FIMA 4H67A 1B51A 4X66M 3ZC7B 2KW0A 1WODA 1LB9A 1MXXA 4LF8M 1W5SA 2F7BA 1L2DA 3E9XA 1HNWM 1MY1A 3RY3A 1G41A 2XXUA 4R6KA 1JW1A 5C1BA 4F29A 5EHMA 2W82A 5EP3A 2ANJA 5H8QA 4Z0IA 3PUYE 3RPWA 1O63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3H A;  5H8F B;  4HS7 A;  2QS1 A;  4FE8 A;  2H99 A;  3G7W A;  3VLW A;  1SW5 A;  4H6D A;  1B3E A;  3HV1 A;  2O51 A;  2AYS A;  2ZXT A;  3TZA A;  3ONM A;  1B3G A;  3PMX A;  3FXR A;  3T93 B;  3MP8 A;  4QFK A;  3OOA A;  4O3C A;  1PB8 A;  1MQG A;  2B3B A;  3MAM A;  4YMB A;  1N76 A;  1LST A;  3DP6 A;  1Y20 A;  1PB7 A;  4ECF A;  3CFL A;  5BWJ A;  1HSL A;  1Y4C A;  3OSQ A;  4WEP A;  4EQB A;  5CI5 A;  3B7D A;  3CR9 A;  1B2H A;  4ZS9 A;  4OTE A;  1L5T A;  3KGC A;  4RJZ A;  2XXT A;  1Y1Z A;  3H03 A;  1IQ7 A;  1MDP 1;  4U23 A;  4G77 A;  4G8N A;  4X9T A;  3V5A A;  2GRV A;  2ZNT A;  2IA4 A;  1POY 1;  2UXA A;  1AMF A;  3IOT A;  3C4M A;  2DXR A;  2GFE A;  1B6H A;  1B1H A;  1D4N A;  3M3K A;  1Y3N A;  2DWA A;  4QSC A;  2DVZ A;  5AA4 B;  4AB5 A;  1II5 A;  1FTL A;  3OXN A;  4NWD A;  2O68 A;  1URD A;  3VXC A;  2NUV A;  3GBA A;  3LSX A;  4QSD A;  4OFO A;  4P0I A;  5J1D A;  3EPE A;  1FW0 A;  4ESW A;  1LAH E;  4Q0C A;  3FVG A;  1B3L A;  3N5L A;  1B5I A;  4LVQ A;  4POW A;  3KN8 A;  4KHZ E;  1SYI A;  3FV2 A;  3R6U A;  3TTK A;  3MVX A;  3HCQ A;  1ZU0 A;  4FED A;  5F1Q A;  1IXC A;  4N6P A;  3PMV A;  2QRY A;  1QKB A;  3MUQ A;  2F7C A;  3JV9 A;  2O69 A;  3LR1 A;  4F39 A;  4EF2 A;  1US5 A;  4OER A;  1JVX A;  2H25 A;  3S2V A;  3SEU A;  5ITO A;  4IO6 A;  3C34 A;  1OQH A;  1PC3 A;  5H8Q B;  3CSG A;  3VVE A;  1AIV A;  3OEL A;  2NVU B;  1P1O A;  1SBP A;  5TU0 A;  3PPO A;  5DTB A;  1XVX A;  3U1O A;  2REG A;  4DCX A;  3Q28 A;  2DE3 A;  3TQL A;  4GWO A;  4TLL B;  1S7Y A;  4YB6 A;  4PFU A;  3ZS6 A;  1ELJ A;  3O9P A;  2YJP A;  1Q1K A;  3WAE A;  3FJ7 A;  3FAS A;  4XKP A;  2Z8E A;  3PUZ E;  3G3F A;  4AB6 A;  3KEI A;  2Y7W A;  4P11 A;  3K0V A;  3T66 A;  2XHD A;  4YKP A;  3G3G A;  3KBR A;  3SEW A;  2Z23 A;  2FNC A;  1GVC A;  1Y3P A;  2OZZ A;  3SET A;  3OEN A;  2RC9 A;  4ZE8 A;  4LON B;  2RCB A;  2DYX A;  2F6P A;  4RXL A;  3RNN A;  1JEU A;  4YKK A;  1NKX A;  1A8E A;  1MS7 A;  2UVG A;  3T9X B;  1MPD A;  5CMB A;  4BDN A;  3FVK A;  5JK4 A;  2F34 A;  4X48 A;  1IZ1 A;  1VSO A;  2Z22 A;  1SW1 A;  4KCC A;  3M3L A;  5FHN A;  2Z8F A;  3IOW A;  1EU8 A;  3VVF A;  1YCJ A;  1N7X A;  2OWS A;  1BP5 A;  3JYR A;  4WKM A;  4ND9 A;  2GH9 A;  1B32 A;  3O6I A;  2Y7P A;  4BDL A;  3QUJ A;  3K6X A;  2PX1 A;  2E1S A;  2O1L A;  4DXU A;  4C0R A;  2Y84 A;  3O6G A;  4QFN A;  4YU0 A;  4KFQ A;  1QUJ A;  4RK9 A;  3K00 A;  3KOS A;  4NE4 A;  3CSB A;  4H1X A;  2V3U A;  3PPQ A;  1MM6 A;  1MY3 A;  4TLM B;  4FAT A;  2A5T B;  1JW5 A;  4G8M A;  1PDA A;  3K6U A;  3SES A;  3QAX A;  4RY1 A;  1MY2 A;  2M8C A;  4KI0 E;  3H6U A;  3G3I A;  1UIV A;  3K1P A;  1T0K A;  1DSN A;  3VLV A;  2F5X A;  5EHS A;  1B1X A;  4ZZA A;  1UQW A;  3B6Q A;  2YPN A;  3MWB A;  5FTI A;  1B5J A;  4FEC A;  4F3G A;  4F3S A;  1EZP A;  1USY H;  3DP8 A;  2QSX A;  4U22 A;  5IAI A;  1M5F A;  3FIR A;  3HST A;  3RGY A;  1UTH A;  1B7H A;  1NH7 A;  4OZ9 A;  5L9M A;  1WVJ A;  2VHA A;  4OHN A;  1P99 A;  4IGR A;  1LAX A;  5FHO A;  4ZED A;  4IB2 A;  4I62 A;  3KN7 A;  4HTG A;  1JNF A;  1N3W A;  4I9D A;  3CVG A;  2F78 A;  2ONK E;  2H98 A;  2XXP A;  2OCU A;  1Y1M A;  4HCW A;  2UVJ A;  1DTG A;  2AIX A;  2I6E A;  4G4P A;  1URG A;  2VOZ A;  3MZB A;  5B7D A;  5CMM A;  2QL3 A;  2YLN A;  2DS9 A;  3K6W A;  3C35 A;  2OK2 A;  3S9N C;  2V3Q A;  4YB5 A;  2HZK A;  1LLS A;  4DCY A;  3Q26 A;  1XVY A;  5ITP A;  3V83 A;  1XS5 A;  4EXL A;  2P0S A;  2XX7 A;  3IK6 B;  4QFL A;  1S9T A;  3RLF E;  5TPA A;  4MFI A;  3BKI B;  2ZNS A;  4NF6 B;  3SKP A;  2QMW A;  3Q29 A;  5ISU A;  1SD3 A;  1B52 A;  1ZTY A;  4X1B A;  2O1M A;  3VLU A;  3TQW A;  1P1W A;  3RT8 A;  4DLD A;  4ESX A;  2V3T A;  4KD5 A;  2QPQ A;  4GD5 A;  1MH3 A;  1FQB A;  3IR1 A;  4ZEB A;  3MZ1 A;  4FOR A;  2ZYO A;  3HN0 A;  3K01 A;  3N26 A;  3C36 A;  4QRZ A;  4I8C A;  2CMO A;  4KQP A;  3USD A;  3K2D A;  3MJN A;  4G68 C;  1Q35 A;  3RN8 A;  3K02 A;  4OVJ A;  2GHA A;  4Z7E A;  4NF4 A;  3O6H A;  4Q5T A;  3ZSF A;  2OBG A;  2O7U A;  1MQH A;  3HHF A;  3MZ9 A;  4FEB A;  2ONR A;  3CFX A;  3IOV A;  1N04 A;  3O28 A;  2ZNU A;  4YIC A;  2NWJ A;  2Q9T A;  3U93 A;  4BDQ A;  2DWJ A;  4GXA A;  3GLB A;  3MPK A;  1IUD A;  3OEK A;  3S9L C;  2DE2 A;  3IB0 A;  4Q8R A;  5I58 B;  4H8I A;  3PUW E;  4GXS B;  2DSF A;  4BDR A;  3E4R A;  2VD3 A;  1UTH B;  1LAG E;  3M8U A;  1D9Y A;  3VFJ A;  1LCT A;  2Y7R A;  4GRK A;  4NMY A;  4OQO A;  1VE4 A;  2RC8 A;  5CMK A;  4ZE9 A;  3FAT A;  3VDF A;  3K1N A;  2I49 A;  4F1Y A;  1B7U A;  4LZ7 A;  5FHM A;  3I5O A;  3K4U A;  3MBP A;  1QW0 A;  1ZBM A;  1LAF E;  1IXG A;  2BJJ X;  1A40 A;  2H9B A;  2I0C A;  3O97 A;  2Q89 A;  1TT1 A;  3IJO B;  3UN6 A;  3IOR A;  4RA1 A;  3IX1 A;  2FA7 A;  4ZEF A;  3PGF A;  4RK2 A;  1B3H A;  4OWD A;  4R74 A;  2ABH A;  2QS2 A;  3EHU A;  1UIU A;  3Q25 A;  5TPA B;  4R72 A;  4C1T A;  4F2O A;  4GFR A;  1IXI A;  4DE8 A;  4LQ5 A;  1LGB C;  1XOC A;  3TTR A;  5DVF A;  1ZJL A;  3TTN A;  3FUZ A;  3C9H A;  5I84 A;  3IL1 B;  2A5T A;  4U1O A;  4GQO A;  2UVI A;  3B6W A;  1FTO A;  1IEJ A;  1LFG A;  1OIB A;  1ZLQ A;  1PB9 A;  2F7A A;  1N7W A;  1N3X A;  1B58 A;  3KG2 A;  1A8F A;  1QJM A;  2RF1 A;  4EDP A;  4EQ9 A;  3VVD A;  4PP0 A;  3U8Q A;  1A54 A;  4NF4 B;  4GIZ A;  4HW8 A;  3MPL A;  4ONY A;  1BTJ A;  3OO6 A;  2QMX A;  3FXU A;  4KYS A;  3GBB A;  5CBR A;  1GV8 A;  4IO2 A;  4PFY A;  1FQF A;  1A55 A;  3MC2 A;  4OEU A;  5KCJ B;  4OFL A;  4C1U A;  1B40 A;  1IIW A;  4ZZE A;  1MXZ A;  2ZYN A;  1VFE A;  2RCA A;  4JSO A;  1KWH A;  5AA1 A;  1B4Z A;  4GLI A;  3K1M A;  1MXV A;  3UK4 A;  2DXY A;  3O2A A;  1SI0 A;  2DWH A;  3RUM A;  1YPN A;  3OEM A;  3KJ7 A;  4JBZ A;  2THI A;  3QSL A;  2X7Q A;  1BLF A;  4YKI A;  1SW2 A;  1TXF A;  3TMG A;  5A5X A;  4OYV A;  1GR2 A;  3T9V A;  4RPO A;  1QUL A;  4F18 A;  2VGQ A;  1FQE A;  2H4I A;  2HAU A;  5H8H A;  1H45 A;  3SEV A;  3SDF A;  2PT1 A;  3H6T A;  3FGS A;  2HCA A;  4U1Z A;  1M5E A;  4R75 A;  2F36 A;  3UIF A;  3T22 A;  1FQA A;  4F1V A;  2DQV A;  4IO5 A;  4ELO A;  3DLN A;  4I1D A;  1R6Z A;  4KCD A;  4O3A A;  4G2Z A;  3U94 A;  5L9S A;  3FJM A;  3HO7 A;  2OLB A;  4LA9 A;  3PPR A;  4MBP A;  4NF6 A;  2O7I A;  1SDX A;  4LQ2 A;  4YB7 A;  4JB7 A;  1H43 A;  4PE5 B;  2Q88 A;  3QIM A;  4AQ4 A;  3D4G A;  3QK6 A;  3EQ1 A;  4BDO A;  4U4X A;  1QUI A;  1XT8 A;  2DOJ A;  4MLQ A;  3T9H B;  1DTZ A;  1QUK A;  1IXH A;  1Y9U A;  4OXV A;  3QXM A;  2NXO A;  5FTH A;  3T96 B;  1B7Z A;  5DYH A;  2Y7K A;  1H44 A;  4Q30 B;  3S4U A;  3TYH A;  4E0W A;  3TFL A;  4TOZ A;  4ELP A;  1JW4 A;  1Z7N E;  3TCF A;  4NF5 B;  1S50 A;  4RYA A;  4TQU Q;  4JXI A;  1LBC A;  1OMP A;  4QF9 A;  3ZKK A;  3KN3 A;  3G3J A;  3C32 A;  5AA3 A;  4PFT A;  3K6V A;  2F35 A;  2XD2 A;  4NED A;  2UYE A;  3W15 C;  2XXX A;  4OFJ A;  5I58 A;  3KSJ A;  2XXR A;  1ZIU A;  3P7I A;  5I56 A;  3CG3 A;  1B5H A;  4RPN A;  2PYY A;  2B3F A;  3CFZ A;  3S9M C;  1DPP A;  2F6G A;  1M5B A;  5HM4 B;  4OES A;  5K2X A;  2CZL A;  1MQJ A;  1I6B A;  3KZG A;  2XXY A;  1NFT A;  4IY5 A;  1UTB A;  2PVU A;  3ODB A;  2V84 A;  3KSX A;  2GHB A;  5A5X B;  3W9V A;  4UA8 A;  3N94 A;  1RKM A;  1POT A;  4MLV A;  2X26 A;  1OLC A;  5AA2 A;  4WED A;  5I57 A;  5H8H B;  3OSR A;  1MXY A;  2XD3 A;  4MF3 A;  4K3F A;  2Q8J A;  1A7L A;  1JVY A;  3FD3 A;  3MW0 A;  4OET A;  2HEU A;  1XHY A;  3BFU A;  3O29 A;  1MG1 A;  2R6G E;  4OMB A;  2H5Y A;  3QUF A;  3U72 A;  2QS4 A;  1H3D A;  1TWY A;  4YKJ A;  3QYT A;  4YZZ A;  1RYX A;  1VFD A;  3H6W A;  3BFT A;  1OQG A;  5K2Y A;  3I6V A;  2PT2 A;  2FYI A;  4R9G A;  1O64 A;  4F22 A;  3GZG A;  4GVO A;  4JDF A;  3PMW A;  3UP9 A;  3IB1 A;  5L8D A;  4GOT A;  3B6T A;  4KR5 A;  1A99 A;  1NNT A;  1SVX B;  4R9F A;  2I4B A;  4NF8 A;  1CE2 A;  3WAF A;  2PBW A;  1B0L A;  4OEV A;  3H3G A;  3UOR A;  3F11 A;  3W9W A;  1URS A;  2IEE A;  2X7P A;  1LFI A;  3LC8 A;  4UAC A;  5CMC A;  1TFA A;  4JWX A;  1D3K A;  3PV0 E;  5DEX B;  3ZKL A;  3VV5 A;  4R73 A;  4LZ5 A;  3RT6 B;  5KCJ A;  2XX9 A;  1SI1 A;  1MQI A;  3JZJ A;  5HPQ A;  3TAJ A;  3DEL B;  5AE4 A;  1OLA A;  3LUY A;  5I59 A;  4DZ1 A;  4G68 A;  3OO9 A;  5I2K A;  2ESN A;  5I56 B;  3LSF B;  3LSL A;  4ELQ A;  4U2R A;  5ICT A;  3KOT A;  4ISU A;  4QHQ A;  3FVN A;  3DP4 A;  4GL8 A;  4NTL A;  1ATG A;  3C33 A;  3D4C A;  4IO7 A;  1EZ9 A;  3CG1 A;  2KLF A;  2RKM A;  3FVO A;  3OO7 A;  4LAT A;  3U92 A;  5DVJ A;  3OD7 A;  1YAE A;  1UTB B;  3MQ9 A;  2ZMB A;  1P1N A;  1R9L A;  1NH8 A;  4XKN A;  1MPC A;  5AA2 B;  5H8S A;  5I57 B;  1XC1 A;  2D3I A;  3CI8 A;  3TDJ A;  1B9J A;  2V25 A;  5I2N A;  1FTK A;  1B3F A;  5H8N A;  1FCK A;  2P2A A;  4ZEC A;  1I6A A;  3ILT B;  4GF8 A;  5ICQ A;  1MH4 A;  3TEL A;  1N84 A;  1GTK A;  2WKY A;  3IO4 A;  1QKA A;  4KYE A;  3TCG A;  5KDT B;  4R2F A;  3THI A;  3TTM A;  1NNK A;  4ZEI A;  2F8D A;  3PU5 A;  4DIG A;  2D5W A;  1US4 A;  1NMU A;  5TP9 B;  3MVW A;  2P1S A;  3CRB A;  4XIG Q;  5BUU A;  1D9V A;  4BDM A;  1LCF A;  3GXA A;  1AH5 A;  5L9O A;  2XX8 A;  2ZYM A;  3C31 A;  4DXC A;  1TFD A;  1MM7 A;  1ZMG A;  2LAO A;  1QVS A;  4H8J A;  3VE1 B;  5DT6 A;  3TOD A;  1MXU A;  4NF8 B;  1EH3 A;  4JSD A;  3ECR A;  3Q27 A;  4JWY A;  1PBP A;  1R1N A;  2AL5 A;  3RTF B;  4N07 A;  3CIJ A;  3PUV E;  1N0T A;  4NF5 A;  4DDD A;  4M4G A;  2F97 A;  4IGT A;  3PPP A;  1IIT A;  4R6H A;  4QFP A;  2ALU A;  4IY6 A;  1B05 A;  3R26 A;  3MP1 A;  1DPE A;  3KJT A;  4N13 A;  5ELV A;  3I3V A;  5EYF A;  3A3C A;  1MQD A;  4ELR A;  4F1U A;  2R71 A;  1GGG A;  2HZL A;  1HSJ A;  3HPI A;  2E0S A;  1SW4 A;  2NOO A;  2XXV A;  5I59 B;  3PUX E;  4G68 B;  5I2K B;  2W7Y A;  4IO3 A;  3VXB A;  2I3V A;  1PEB A;  3FJG A;  3N6T A;  3TCH A;  1H76 A;  1O7T A;  4F31 B;  3OMB A;  4X1D A;  3IOU A;  4F3B A;  4H5G A;  5AA2 D;  4G8H A;  4E0X A;  2B65 A;  3TKD A;  4U21 A;  3V89 B;  1JET A;  1AOV A;  3BBR A;  4EXK A;  2HXW A;  2DP8 A;  4KYD A;  1ANF A;  2ONS A;  1FQD A;  2I0B A;  1LFH A;  5I2N B;  4F19 A;  2OJT A;  5H8N B;  4MH5 A;  1AL3 A;  3H06 B;  1Z7M E;  2XXQ A;  3PD9 A;  1I6Q A;  3TPA A;  3L6G A;  3V8X B;  1DOT A;  5IKB A;  4HCY A;  1NNP A;  4OEN A;  3EF7 A;  4GL0 A;  1VR5 A;  2AL4 A;  3IAZ A;  2OWT A;  1P1Q A;  4PQJ A;  3H7M A;  3SER A;  4THI A;  1MY0 A;  1RYO A;  5CRY A;  4ZDM A;  3AXF A;  5B70 A;  4H65 A;  3EN3 A;  2DVC A;  3LBS A;  2REJ A;  4LP2 B;  2HAV A;  5M2V A;  4H0W A;  1Y4T A;  4JWO A;  1MDQ A;  5CC2 A;  2O6A A;  1MPB A;  4M1V A;  4LZ8 A;  1SQY A;  2HQ0 A;  3HHG A;  4XXU A;  3FV1 A;  3O66 A;  2UYF A;  4F3P A;  2Q2A A;  3H4Z A;  1ZKB A;  1MY4 A;  2UVH A;  2VP1 A;  2VD2 A;  1LBB A;  3LSW A;  1OVT A;  3OO8 A;  3UGW A;  5JTY A;  1B0H A;  2DWI A;  2G93 A;  3ILU B;  3E13 X;  4P0G A;  4H5F A;  3TEP A;  4YMA A;  4EF1 A;  3TUS A;  1FQC A;  1FTJ A;  1CB6 A;  3E3K A;  5DEX A;  2O84 X;  5F7V A;  1HSE A;  4LUB A;  1JQF A;  1Y3Q A;  1OVB A;  3MP6 A;  5JEI A;  1DMB A;  5H8F A;  3FZV A;  2QJE A;  3MVZ A;  5KZT A;  4DXB A;  3RTW B;  1LB8 A;  3A3U A;  3SEY A;  3EHS A;  2A5S A;  4IO4 A;  4XTC Q;  1NL5 A;  3L6H A;  3MVY A;  2R9J A;  3UA8 A;  3IB2 A;  3PD8 A;  4KPT A;  2I48 A;  1PBQ A;  3T9U A;  4WXJ A;  1R9Q A;  5LOM A;  4O3B A;  1USY E;  1JEV A;  4EUO A;  5HBC A;  2DE4 A;  1EZO A;  3IO6 A;  4QFO A;  1WDN A;  4EQ7 A;  1MXW A;  2Y7I A;  1SYH A;  3G3K A;  3R7X A;  2RIN A;  1F9B A;  5CM6 A;  1NNF A;  4YAH X;  4RNS A;  1M5D A;  4PET A;  4BLA A;  1P1U A;  2XXH A;  1YTV A;  2G29 A;  3H6V A;  4R6Y A;  3S9E A;  3M3F A;  3KFM A;  4XKQ A;  1BIY A;  3N6U A;  5CBS A;  4XKR A;  1BKA A;  2ZYK A;  1M5C A;  5KDT A;  4L17 A;  4POX A;  3TTL A;  2Q2C A;  5TP9 A;  5DVI A;  5AA4 A;  2I58 A;  2PMS A;  4FJP A;  4U4S A;  3FXQ A;  2I3W A;  4FAJ A;  1B4H A;  4F2Q A;  3SEX A;  3PPN A;  1J1N A;  2Z8D A;  3RQT A;  3EHT A;  4NWC A;  2XXI A;  2XXW A;  3A09 A;  4PFW A;  4ZEK A;  3IJX B;  2I4C A;  3DM0 A;  2RC7 A;  1MRP A;  2QS3 A;  4QSE A;  2D21 A;  2HFB A;  1B46 A;  1FTM A;  2V93 A;  4R2B A;  5JTY B;  1I69 A;  4FIM A;  4H67 A;  1B51 A;  1WOD A;  1LB9 A;  1MXX A;  2F7B A;  3E9X A;  1MY1 A;  3RY3 A;  2XXU A;  4R6K A;  1JW1 A;  4F29 A;  5EHM A;  2ANJ A;  5H8Q A;  4Z0I A;  3PUY E;  3RPW A;  1O63 A; 
#chains in the Genus database with same CATH topology
 3G3H A;  5H8F B;  4HS7 A;  2X49 A;  2HKJ A;  2QS1 A;  4FE8 A;  2H99 A;  5DYG A;  4DV0 M;  3U6P A;  3EIE A;  3G7W A;  4D80 A;  4F2L A;  3VLW A;  1SW5 A;  4H6D A;  2JZ0 A;  1B3E A;  1R5L A;  3AOE C;  1KYI A;  1FPG A;  5JI3 E;  3HV1 A;  2O51 A;  2AYS A;  3RPL A;  2ZXT A;  3GLI B;  4NXM M;  3TZA A;  4REZ A;  3ONM A;  1FPD A;  1B3G A;  1NUW A;  1I4W A;  3ZQJ A;  3PMX A;  1Z5B A;  3FXR A;  3T93 B;  3MP8 A;  4QFK A;  3OOA A;  1D2N A;  4O3C A;  3FKE A;  1PB8 A;  1MQG A;  2B3B A;  1NSF A;  2Z8Y M;  3MAM A;  3PFI A;  4YMB A;  1S3S A;  3MST A;  2YNM D;  3J27 B;  4NSO B;  3KOZ E;  1N76 A;  4QNM A;  4GEW A;  1LST A;  1MJG M;  1Y20 A;  3DP6 A;  1VEK A;  1L1T A;  1PB7 A;  4AKG A;  5I5P A;  3FBP A;  4ECF A;  1IN4 A;  3CFL A;  5BWJ A;  1HSL A;  3BIH A;  4PDG A;  1Y4C A;  3OSQ A;  4WEP A;  4EQB A;  5CI5 A;  4LF6 M;  5IZ3 A;  3LMM A;  3B7D A;  3CR9 A;  1B2H A;  4ZS9 A;  4I8O A;  4OTE A;  1L5T A;  3KGC A;  4RJZ A;  1JB0 F;  2XXT A;  4LF9 M;  1QAQ A;  1IMF A;  1Y1Z A;  4P8B A;  1FBF A;  3H03 A;  4FW9 A;  1IQ7 A;  1MDP 1;  3J2P B;  4U23 A;  4G77 A;  4G8N A;  4FCT A;  3E79 A;  4X9T A;  3V5A A;  4LCB A;  2GRV A;  3NWL A;  4JN6 A;  2ZNT A;  5EJC A;  2IA4 A;  1POY 1;  3L28 A;  2UXA A;  2B3T A;  1AMF A;  3IOT A;  1VEG A;  4B08 A;  3C4M A;  3SAW A;  2DXR A;  2GFE A;  1B6H A;  3W68 A;  3K9P A;  1B1H A;  4MM3 B;  1K9Z A;  1CNQ A;  2QPA A;  1WHC A;  1D4N A;  3M3K A;  4O8M A;  1Y3N A;  2DWA A;  4QSC A;  3SAS A;  2DVZ A;  3L29 A;  5AA4 B;  3GLH A;  1NNU C;  4AB5 A;  4PD2 A;  4DUZ M;  1HT1 E;  1II5 A;  2KRU A;  1FTL A;  3OXN A;  4NWD A;  1NHW C;  1URD A;  2O68 A;  3VXC A;  2NUV A;  3GBA A;  4O94 A;  3LSX A;  4QSD A;  4OFO A;  4P0I A;  3LVW A;  5J1D A;  4LRS A;  5ESY A;  4N6D A;  3EPE A;  1FW0 A;  4ESW A;  4JI7 M;  2CRU A;  4B3S M;  1FPL A;  2KZU A;  1LAH E;  4Q0C A;  2V6Z M;  2F3D A;  3FVG A;  1B3L A;  3FTD A;  3N5L A;  2DXI A;  1B5I A;  1IQP A;  4LVQ A;  5KPT A;  4POW A;  3KN8 A;  2CV2 A;  4KHZ E;  1SYI A;  3FV2 A;  3R6U A;  3TTK A;  2LNH C;  3MVX A;  1FPB A;  4LF5 M;  4DR2 M;  1PM5 A;  2FIE A;  2D7H A;  3HCQ A;  2UUC M;  1ZU0 A;  4FED A;  5F1Q A;  1IXC A;  4N6P A;  3PMV A;  2QRY A;  2F5Q A;  1QKB A;  3MUQ A;  4GX3 A;  2F7C A;  1LBX A;  1GL7 A;  3JV9 A;  2O69 A;  3LR1 A;  4F39 A;  4ANR A;  4EF2 A;  1US5 A;  1VEJ A;  4OER A;  4NSR A;  1JVX A;  2H25 A;  3S2V A;  3SEU A;  4EIW A;  5ITO A;  4CJ6 A;  4FWG A;  1WIV A;  4IO6 A;  2LVQ D;  1GAB A;  1K3W A;  3C34 A;  1OQH A;  1Q39 A;  3KP0 E;  1PC3 A;  5H8Q B;  2XSZ A;  5I7I A;  2QSF X;  3FRI A;  1DO2 A;  3PNY A;  4MNP A;  2D7G A;  3CSG A;  3GRV A;  3VVE A;  1AIV A;  1Q3B A;  4JXJ A;  3OEL A;  2NVU B;  1P1O A;  4B7F A;  1SBP A;  1J5E M;  5TU0 A;  3PPO A;  5IZZ A;  5DTB A;  1NV5 A;  1XVX A;  3U1O A;  4GWY A;  2REG A;  3I01 M;  3D8L A;  3HJS A;  1YZ0 A;  4PFB A;  2C96 A;  3Q28 A;  4DCX A;  1TH3 A;  3U6M A;  4MNC A;  4GKK M;  2K47 A;  3MK6 A;  3RGP A;  2DE3 A;  4LJ4 A;  4GWO A;  3RPL B;  3TQL A;  5J16 A;  2MGW A;  4TLL B;  1S7Y A;  4YB6 A;  4PFU A;  3ZS6 A;  1D0K A;  2ZAM A;  1ELJ A;  3O9P A;  2YJP A;  4GIT A;  1Q1K A;  2MKZ A;  2CUZ A;  4WW0 A;  3WAE A;  3A98 B;  3FJ7 A;  1FBC A;  3D8B A;  3KOY E;  3FAS A;  4XKP A;  1G3I A;  2Z8E A;  3PUZ E;  1OQY A;  4D82 A;  3G3F A;  4AB6 A;  3KEI A;  3PXG A;  2Y0T A;  2Y7W A;  4CHT B;  5EXS A;  5IZ7 D;  4ITQ A;  4P11 A;  4KOD A;  3K0V A;  1H6U A;  3T66 A;  5ET8 A;  1TDZ A;  3FUV A;  2XHD A;  4YKP A;  3G3G A;  3KBR A;  3FD9 A;  5IZ3 B;  3SEW A;  2Z23 A;  2XFS A;  1TR8 A;  2FNC A;  1GVC A;  1Y3P A;  3Q8X A;  2OZZ A;  4UN2 B;  3SET A;  3OEN A;  2RC9 A;  2QHO B;  4ZE8 A;  4LON B;  1IY0 A;  1TF0 B;  2O25 A;  1IMC A;  4M9Z A;  2RCB A;  3W0L B;  3T0J A;  2DYX A;  2F6P A;  4RXL A;  3RNN A;  5H37 D;  1JEU A;  2XF3 A;  3QYB A;  4YKK A;  1NKX A;  1A8E A;  1MS7 A;  2UVG A;  3T9X B;  1MPD A;  1WGN A;  4IBC A;  5CMB A;  4BDN A;  2PCR A;  2XWI A;  3FVK A;  5JK4 A;  2F34 A;  2DAG A;  4X48 A;  1IZ1 A;  4MH0 E;  3BOS A;  2I7N A;  1VSO A;  2Z22 A;  1SW1 A;  5FTL A;  4KCC A;  3M3L A;  4AKI A;  2XZU A;  3H4J A;  3B7Z A;  4I40 A;  5FHN A;  4I4L A;  5ITU A;  2Z8F A;  1PJS A;  3M0E A;  5I3S A;  3IOW A;  1G4A E;  1EU8 A;  3A42 A;  3GLH B;  3VVF A;  5GKN A;  1YCJ A;  1N7X A;  4LGY A;  2ZTD A;  2OWS A;  3AL0 C;  4DI4 B;  3JAM S;  1BP5 A;  3JYR A;  4WKM A;  3HHZ A;  4ND9 A;  2GH9 A;  1B32 A;  3O6I A;  4L6V 6;  2Y7P A;  4BDL A;  3QUJ A;  2ZBK B;  3K6X A;  4N8Y A;  2PX1 A;  5ET6 A;  2XH9 A;  1QZE A;  2E1S A;  2O1L A;  4DXU A;  2QQ8 A;  4C0R A;  1LTM A;  2Y84 A;  3O6G A;  4QFN A;  4YU0 A;  4KFQ A;  1KA1 A;  5ITR A;  1QUJ A;  4RK9 A;  3K00 A;  3KOS A;  4NE4 A;  2QNJ A;  3HU2 A;  1J09 A;  3CSB A;  4JI8 M;  1R6B X;  2Y20 A;  4H1X A;  2V3U A;  3PPQ A;  3KS8 A;  1MM6 A;  3V76 A;  1MY3 A;  4TLM B;  4FAT A;  4PFI A;  2A5T B;  1IXS A;  1QVR A;  1SXJ C;  1QDT A;  1XB2 B;  1JW5 A;  1EYI A;  1Z5C A;  4GMQ A;  3J7A S;  3U5Z A;  2C5R A;  3DZD A;  4G8M A;  4KT0 F;  1PDA A;  2Y5L A;  3K6U A;  3SES A;  3QAX A;  4RY1 A;  3FXB A;  1MY2 A;  2M8C A;  4KI0 E;  3H6U A;  4NN3 A;  4Z6Y A;  2ZZV A;  3G3I A;  3FUW A;  1UIV A;  3K1P A;  1R7R A;  1T0K A;  1DSN A;  4AS4 A;  3VLV A;  5ITQ A;  2HXR A;  3F92 A;  2F5X A;  5EHS A;  1B1X A;  4ZZA A;  4BBA A;  1NUX A;  3B7N A;  3SAR A;  2DNA A;  3FUT A;  2R18 A;  1G8P A;  1UQW A;  3B6Q A;  2YPN A;  1GJT A;  3MWB A;  2UUB M;  4JI6 M;  1BVS A;  5FTI A;  3ROJ A;  1B5J A;  2JNH A;  4FEC A;  4F3G A;  4F3S A;  3JR5 A;  1EZP A;  3AFH A;  1USY H;  2JA2 A;  4XEQ A;  3KOW E;  3RFW A;  4PBQ A;  3DP8 A;  2QSX A;  4U22 A;  5IAI A;  1M5F A;  1EE8 A;  3FIR A;  2K6B A;  2QP9 X;  3HST A;  1P3Q Q;  3E78 A;  3RGY A;  3KC1 A;  1UTH A;  1B7H A;  1NH7 A;  4OZ9 A;  4X8R A;  5L9M A;  1WVJ A;  2VHA A;  4OU7 A;  3HJ8 A;  4OHN A;  1P99 A;  3SYK A;  1Q9D A;  1VDD A;  4OW0 A;  4IGR A;  1LAX A;  5FHO A;  4ZED A;  2L4F A;  4B3M M;  2XA5 A;  4IB2 A;  1XWI A;  4I62 A;  3KN7 A;  4DV4 M;  4HTG A;  2FS1 A;  5FTM A;  1X37 A;  4PTK A;  1YSY A;  2WX9 A;  1JNF A;  1OAI A;  1N3W A;  1NY6 A;  4I9D A;  3CVG A;  2F78 A;  2VPO A;  2ONK E;  1FBP A;  3UK6 A;  3U60 B;  2H98 A;  2XXP A;  2OCU A;  1Y1M A;  4I5S A;  4HCW A;  2UVJ A;  1DTG A;  1QAO A;  2AIX A;  2I6E A;  3CHG A;  4G4P A;  1URG A;  2VOZ A;  2DWZ B;  2CEY A;  3MZB A;  3HJQ A;  2DZN B;  5B7D A;  5CMM A;  2QL3 A;  1NUY A;  2YLN A;  4DV2 M;  2DS9 A;  1IMA A;  1OFI A;  2HHH M;  2P5T A;  2CEX A;  1IN5 A;  3C35 A;  2GQF A;  2OK2 A;  3K6W A;  3S9N C;  3J81 S;  2V3Q A;  4YB5 A;  2HZK A;  1LLS A;  2R6F A;  4DCY A;  3Q26 A;  1XVY A;  4LF7 M;  5ITP A;  1IXZ A;  1XS5 A;  4EXL A;  3V83 A;  2P0S A;  2DAK A;  2XX7 A;  3SAV A;  3IK6 B;  4N6K A;  4QFL A;  1KA0 A;  1S9T A;  3RLF E;  2UU9 M;  3TWM A;  4MFI A;  5TPA A;  3BKI B;  3SYL A;  2DHR A;  2ZNS A;  3VK8 A;  4NF6 B;  3B89 A;  3SKP A;  2QMW A;  3Q29 A;  4JI5 M;  1WXQ A;  1BK4 A;  5ISU A;  1SD3 A;  1TTE A;  1B52 A;  3I51 A;  1ZTY A;  4X1B A;  5L8R F;  2O1M A;  1XHB A;  3VLU A;  3TQW A;  1P1W A;  2L7H A;  2OQ4 A;  3FTF A;  3RT8 A;  4DLD A;  4ESX A;  2V3T A;  4KD5 A;  1Z6T A;  3BXW A;  1ZMW A;  2QPQ A;  2LTU A;  3GRU A;  4AW4 A;  4GD5 A;  1MH3 A;  4DV6 M;  1FQB A;  3IR1 A;  4OVZ B;  4ZEB A;  3MZ1 A;  4IBB A;  4FOR A;  1INP A;  2ZYO A;  2I7P A;  3LUZ A;  1IXS B;  3HN0 A;  3K01 A;  3N26 A;  4MGY E;  3C36 A;  4LRT A;  4QRZ A;  4I8C A;  2CMO A;  3HU1 A;  2X4A A;  2F3B A;  3U5Z B;  4KQP A;  3USD A;  3K2D A;  3MJN A;  4G68 C;  1Q35 A;  3RN8 A;  3NOH A;  4K0K M;  5ET5 A;  2EKK A;  3K02 A;  4S12 A;  4OVJ A;  2GHA A;  2L2D A;  4Z7E A;  4NF4 A;  3VKH A;  2XSZ D;  3O6H A;  3U65 A;  4MGI E;  2LXE A;  3DA1 A;  4X64 M;  3GPU A;  1HR0 M;  4Q5T A;  3BIG A;  3ZSF A;  2OBG A;  2O7U A;  1MQH A;  2LH0 A;  4II7 A;  1E9R A;  3HHF A;  3FE3 A;  3RE8 A;  3MZ9 A;  4FEB A;  2ONR A;  3CFX A;  1XNQ M;  2V4C A;  3IOV A;  1N04 A;  5EQT A;  3O28 A;  2ZNU A;  5FTK A;  4YIC A;  2NWJ A;  2Q9T A;  3U93 A;  4BDQ A;  2DWJ A;  4GXA A;  4MGH A;  3GLB A;  3MPK A;  1IUD A;  3OEK A;  1LBV A;  3S9L C;  5IGA A;  2VII A;  1GKI A;  2DE2 A;  3IB0 A;  2WZJ A;  4NG7 A;  3AV0 A;  1PJJ A;  4Q8R A;  5I58 B;  4IBI A;  2BJI A;  4H8I A;  3PUW E;  2KEB A;  4GXS B;  2UUA M;  2LVA A;  2DSF A;  4BDR A;  3E4R A;  2VD3 A;  1XMO M;  3EKI A;  1UTH B;  3GPX A;  1LAG E;  2ZZW A;  3M8U A;  3C3D A;  4FVM A;  1DV0 A;  1D9Y A;  2QEN A;  3VFJ A;  4AS5 A;  2XWK A;  4AZF A;  2WEF A;  1LCT A;  2Y7R A;  4GRK A;  4NMY A;  4OQO A;  1WGL A;  2F4V M;  1VE4 A;  2RC8 A;  5CMK A;  1YXI A;  4ZE9 A;  4H46 A;  1V33 A;  2CV1 A;  3FAT A;  5T3J A;  4RF0 A;  3VDF A;  3K1N A;  4QHS A;  2I49 A;  4F1Y A;  3C9P A;  3GRR A;  4N81 A;  1B7U A;  5EQ8 A;  1IMB A;  2YFQ A;  4LZ7 A;  3HHY A;  3MHV C;  5FHM A;  1T6O A;  3I5O A;  3KP1 E;  2Q74 A;  3UZU A;  1QAM A;  3K4U A;  3MBP A;  1QW0 A;  1ZBM A;  3T1Y M;  4PDI A;  1LAF E;  3LQR A;  1ZMV A;  2KHH A;  1IXG A;  4WUR A;  2BJJ X;  1A40 A;  2H9B A;  2I0C A;  4IJE A;  5F24 A;  3O97 A;  2Q89 A;  1TT1 A;  1MN3 A;  3HZJ A;  1LEV A;  4G61 A;  3IJO B;  1RDZ A;  3PNV A;  4NGU A;  1T43 A;  1DO0 A;  3UN6 A;  4AKH A;  3IOR A;  2CV0 A;  1DBZ A;  1KZ8 A;  4RA1 A;  3IX1 A;  2FA7 A;  4ZEF A;  3PGF A;  1EFU B;  1Z59 A;  3U6O A;  1K82 A;  1JR3 E;  4RK2 A;  4PCZ A;  4GWZ A;  1B3H A;  1ZAE A;  4OWD A;  4NHB A;  3J80 S;  4R74 A;  3W0F A;  4R7G A;  2ZZX A;  2ABH A;  2QS2 A;  4OX9 M;  3KDS E;  3EHU A;  2LVN C;  4FD2 A;  1FPK A;  1UIU A;  3Q25 A;  4R72 A;  5TPA B;  4JI0 M;  3QWL A;  2G3Q A;  4C1T A;  2JZ1 A;  4YHH M;  2LHC A;  4F2O A;  1OTR A;  3L25 A;  4GFR A;  1IXI A;  4DE8 A;  4MEV A;  4QHT A;  4LQ5 A;  3JR4 A;  1LGB C;  1XOC A;  5ET7 A;  1I94 M;  3TTR A;  4P9K A;  5DVF A;  3VDU A;  5F3W A;  4ZPX A;  1ZJL A;  4LFB M;  4BLC A;  3TTN A;  2UXD M;  3FUZ A;  3C9H A;  5I84 A;  3IL1 B;  1ZMU A;  1N78 A;  2UXB M;  4NQ8 A;  2A5T A;  4U1O A;  1VDL A;  2JY5 A;  4GQO A;  2UVI A;  4DV5 M;  1OIZ A;  1FTO A;  1IEJ A;  3B6W A;  1LFG A;  2GQ1 A;  1OIB A;  2H5X A;  3KFU G;  1VQ1 A;  1LBZ A;  1ZLQ A;  1PB9 A;  2F7A A;  2RRU A;  1N7W A;  4X65 M;  1N3X A;  3B74 A;  1B58 A;  3KG2 A;  2DWN A;  1A8F A;  1QJM A;  1OAO C;  2RF1 A;  4EDP A;  4RKU F;  4EQ9 A;  2AHM A;  3VVD A;  4PP0 A;  3U8Q A;  1A54 A;  4NF4 B;  3IEC A;  3IFA A;  4NF0 A;  4GIZ A;  1DGG A;  4HW8 A;  3U6Q A;  3MPL A;  2HAK A;  3K2L A;  4ONY A;  1BTJ A;  2LVO C;  1DGB A;  2V1C A;  2QMX A;  3FXU A;  3OO6 A;  4KYS A;  2G5G X;  3GBB A;  5CBR A;  2FOI C;  4P16 A;  1GV8 A;  4IO2 A;  4PFY A;  1FQF A;  4DR6 M;  1A55 A;  3MC2 A;  5LMN M;  4PAK A;  4OEU A;  2DWM A;  5KCJ B;  4OFL A;  4C1U A;  4P3L A;  5EXX A;  1RU3 A;  1B40 A;  1FJ9 A;  1IIW A;  4PAF A;  4ZZE A;  1MXZ A;  2ZYN A;  1FJ6 A;  2LBC A;  4AQY M;  5EQ9 A;  2FNA A;  3ISP A;  1JQJ C;  1VFE A;  2RCA A;  3THG A;  4JSO A;  3SZP A;  3UJN A;  1KWH A;  1AWB A;  4FCV A;  3R9X B;  2WYP A;  5AA1 A;  3A29 A;  3LV0 A;  2NQ8 C;  5DFL A;  1B4Z A;  4GLI A;  4NAP A;  2P3N A;  3K1M A;  1MXV A;  2JY7 A;  3GP1 A;  4LZJ A;  4LJ6 A;  3UK4 A;  2DXY A;  3O2A A;  4DR3 M;  2QCU A;  1SI0 A;  2DWH A;  1QUS A;  3RUM A;  2Y0Q A;  1FPF A;  1YPN A;  3OEM A;  3KJ7 A;  4JBZ A;  2THI A;  3QSL A;  4RF1 A;  1MX0 A;  2X7Q A;  4N4U A;  3SC3 A;  1BLF A;  4YKI A;  4UAB A;  1SW2 A;  2OO9 A;  4MGK E;  1TXF A;  3TMG A;  5A5X A;  4OYV A;  1GR2 A;  4N17 A;  3U60 A;  3T9V A;  4RPO A;  3GLG A;  2DWL A;  1QUL A;  2C99 A;  4GWW A;  4F18 A;  2VGQ A;  5E26 A;  1N36 M;  1FQE A;  2H4I A;  2HAU A;  4JVI A;  5H8H A;  2DKL A;  1H45 A;  3SEV A;  2L5V A;  3QMF A;  3SDF A;  2PT1 A;  4DV3 M;  2R46 A;  1GLN A;  2FHY A;  3H6T A;  3FGS A;  2HCA A;  3HKP A;  4OVR A;  2QVR A;  4U1Z A;  1M5E A;  4R75 A;  2F36 A;  3UIF A;  3SAT A;  3T22 A;  5LDZ A;  3AKZ A;  1FQA A;  4F1V A;  2DQV A;  1IBK M;  1FJG M;  4IO5 A;  2DAM A;  4ELO A;  3DLN A;  4DR1 M;  1W5T A;  1DK4 A;  4GBW A;  4I1D A;  3AJI B;  4FWD A;  1R6Z A;  4F1I A;  4KCD A;  4O3A A;  2Z7J A;  4G2Z A;  1AUA A;  3U94 A;  5L9S A;  3FJM A;  3HO7 A;  1N33 M;  4Z8X A;  2OLB A;  4LA9 A;  2M5Z A;  3PPR A;  1F4I A;  4MBP A;  5BPV A;  2CE7 A;  4NF6 A;  7CAT A;  4NRW A;  4NX1 A;  3E9S A;  2EO2 A;  2Z4S A;  1QZM A;  2O7I A;  4IJF A;  2C98 A;  1SDX A;  4LQ2 A;  2OOA A;  4YB7 A;  4JB7 A;  5IT9 S;  1IME A;  1H43 A;  4PE5 B;  2Q88 A;  3LCV B;  3QIM A;  2DAI A;  4AQ4 A;  5ITX E;  1XC8 A;  3D4G A;  3QK6 A;  2LVP C;  1N32 M;  3EQ1 A;  1FBH A;  4BDO A;  1L8Q A;  3HX3 A;  1FRP A;  4U4X A;  1QUI A;  1XT8 A;  1NV9 A;  2DOJ A;  3J7B A;  4MLQ A;  3T9H B;  4G3O A;  3PTY A;  1DTZ A;  4OVZ A;  1QUK A;  2VT5 A;  1UM8 A;  1IXH A;  3TL4 X;  1N77 A;  4JVD A;  1Y9U A;  4HLQ A;  4OXV A;  3QXM A;  2NXO A;  5FTH A;  3T96 B;  4KLN A;  1B7Z A;  4NRV A;  3GPY A;  5DYH A;  1WR1 B;  2Y7K A;  1H44 A;  4N91 A;  3CF2 A;  1IBL M;  1FBE A;  4Q30 B;  3S4U A;  3TYH A;  2DEN A;  8CAT A;  3HY5 A;  3K1J A;  3B50 A;  4E0W A;  5IM2 A;  3TFL A;  4TOZ A;  2CZK A;  2J5Y A;  2CEA A;  1D0M A;  3HHX A;  4KHP M;  4ELP A;  1JW4 A;  1Z7N E;  3TCF A;  4NF5 B;  1S50 A;  4RYA A;  4TQU Q;  5EXP A;  3FYC A;  4MB7 A;  4JXI A;  2EA0 A;  1LBC A;  4H45 A;  3GLF A;  1D9Q A;  3T15 A;  1OMP A;  2F5N A;  4QF9 A;  3ZKK A;  3KN3 A;  4G4N A;  3G3J A;  3BBZ A;  3C32 A;  1SXJ A;  5AA3 A;  4PFT A;  4M0D A;  2JXN A;  3K6V A;  4O7I A;  2F35 A;  2XD2 A;  4G6Z A;  4NED A;  2UYE A;  3W15 C;  2XXX A;  4OFJ A;  1RDY A;  5I58 A;  3KSJ A;  4A3V B;  5LTC A;  4TUW A;  2XXR A;  2FH0 A;  1QGX A;  1ZIU A;  3P7I A;  5I56 A;  2DDK A;  3CG3 A;  4LF4 M;  1B5H A;  1ZV1 A;  1D0L A;  2JWS A;  4YY3 M;  4RPN A;  3EIH A;  2FE8 A;  2PYY A;  3IFC A;  5DW8 A;  2B3F A;  4PC9 A;  2R44 A;  4B7H A;  3CFZ A;  3S9M C;  1NY5 A;  1DPP A;  1LBY A;  1NUZ A;  2D7E A;  2F6G A;  1M5B A;  5HM4 B;  4OES A;  5K2X A;  2DZL A;  1XMQ M;  1R2Z A;  1V34 A;  2QFL A;  2E5L M;  4LFC M;  1MQJ A;  4XBO A;  2CZL A;  1I6B A;  2WYK A;  2MJ5 B;  2XXY A;  3KZG A;  3T38 A;  3FTE A;  1NFT A;  3M7G A;  4IY5 A;  1UTB A;  2PVU A;  3ODB A;  2V84 A;  3KSX A;  4OVS A;  2A5Y B;  3IHP A;  3KVW A;  2GHB A;  3SHG B;  5A5X B;  3W9V A;  4UA8 A;  1E94 E;  3NBI A;  3GLG E;  1RKM A;  3N94 A;  2H1R A;  4MNI A;  1POT A;  5EYG A;  3GLG B;  4MLV A;  4O7M A;  3B9P A;  2X26 A;  1OLC A;  5AA2 A;  3CGW A;  4WED A;  3T6P A;  5I57 A;  5H8H B;  3OSR A;  3U6E A;  5FLX S;  4DV1 M;  1MXY A;  2XD3 A;  1L1Z A;  2WSF F;  4MF3 A;  4K3F A;  2X8A A;  2Q8J A;  4MMP A;  2DI0 A;  3KS4 A;  1A7L A;  1JVY A;  3FD3 A;  2R62 A;  4OVQ A;  3MW0 A;  4OET A;  2FFJ A;  2HEU A;  3L2A A;  1XHY A;  1JR3 A;  3GO8 A;  1QUT A;  1TH2 A;  1NJG A;  3BFU A;  3O29 A;  1VDW A;  1MG1 A;  2R6G E;  5IWA M;  4OMB A;  2HCB A;  2H5Y A;  3QUF A;  1Q3C A;  3U72 A;  1G59 A;  2QS4 A;  3QAU A;  4LN5 A;  1H3D A;  2VF8 A;  4JV5 M;  2C9O A;  1TWY A;  4YKJ A;  2PFY A;  4LJ7 A;  3QYT A;  4M9X A;  1TDH A;  1HQY E;  4YZZ A;  4DR7 M;  5ITT A;  1RYX A;  4IBE A;  1VFD A;  3H6W A;  3BFT A;  1OQG A;  4L16 A;  5K2Y A;  4JI1 M;  1K9Y A;  4DBG B;  1LBW A;  3I6V A;  2PT2 A;  2O5R A;  2BJW A;  2FYI A;  4DR5 M;  4R9G A;  1O64 A;  1TH4 A;  4F22 A;  4PBH A;  5ITY A;  3LQQ A;  2XWO A;  3GZG A;  4PDH A;  3UMM A;  4GVO A;  4JDF A;  3PMW A;  3UP9 A;  3IB1 A;  5L8D A;  4GWX A;  4P17 A;  3GYY A;  4GOT A;  1FBG A;  3B6T A;  1HNX M;  1A99 A;  4KR5 A;  1PGY A;  1NNT A;  1SVX B;  2EUC A;  4R9F A;  2KR0 A;  4N8G A;  2L4E A;  3A46 A;  2I4B A;  3T1H M;  5BR8 M;  4HE2 A;  4NF8 A;  2JY8 A;  1CE2 A;  3WAF A;  4L78 A;  4XK8 F;  2PBW A;  1V92 A;  5EXT A;  2DZO B;  3SHF A;  1B0L A;  4QBA A;  4OEV A;  2OPF A;  1HT2 E;  3H3G A;  3UOR A;  3F11 A;  3E21 A;  4LY6 A;  3W9W A;  4QNR A;  4IBG A;  1URS A;  4P56 A;  1HQC A;  2IEE A;  3U6C A;  2X7P A;  1LFI A;  3LC8 A;  4UAC A;  5CMC A;  1TFA A;  4JWX A;  2XGN A;  4N15 A;  1D3K A;  3PV0 E;  3GLF E;  2J7N A;  3I4Y A;  5DEX B;  3ZKL A;  3VV5 A;  4R73 A;  3GLF B;  1C7Y A;  4LZ5 A;  1SPI A;  3TWL A;  3C3E A;  3FUX A;  3FUU A;  5EYH A;  3RT6 B;  5KCJ A;  1NVM A;  2DHY A;  5EQA A;  2XX9 A;  1SXJ E;  3I4V A;  1SI1 A;  1MQI A;  1SXJ B;  3JZJ A;  5HPQ A;  3HFU A;  3U6S A;  3TAJ A;  3DEL B;  5AE4 A;  4PT5 A;  4MGZ E;  1OLA A;  3LUY A;  4PAI A;  2L09 A;  5I59 A;  4CIZ A;  4DZ1 A;  4G68 A;  4NL4 H;  3OO9 A;  5I2K A;  2ESN A;  5I56 B;  2CZI A;  3LSF B;  4LJA A;  3LSL A;  2BJV A;  4ELQ A;  4U2R A;  1OJL A;  3GLI E;  3FRH A;  5ICT A;  3KOT A;  4ISU A;  4QHQ A;  3SMS A;  2KQZ A;  3FVN A;  3DP4 A;  3TE6 A;  4GL8 A;  4FWH A;  4NTL A;  1ATG A;  3C33 A;  3D4C A;  4IO7 A;  1EZ9 A;  3LW5 F;  4IIW A;  4L8R C;  3CG1 A;  2KLF A;  2RKM A;  4LGM A;  3FVO A;  4GRI A;  4MHF A;  3OO7 A;  4LAT A;  1GJS A;  3U92 A;  5DVJ A;  3AOE A;  5EP2 A;  3M6A A;  3OD7 A;  2ZTC A;  1YAE A;  1UTB B;  2FVZ A;  3MQ9 A;  2ZMB A;  2WSC F;  1P1N A;  5FTJ A;  1R9L A;  2FBP A;  4DV7 M;  4KXP A;  2O01 F;  2CP8 A;  1NHG C;  1C1K A;  1NH8 A;  4DI3 D;  1IBM M;  4GWU A;  2CHG A;  4XKN A;  1MPC A;  5AA2 B;  4FBP A;  5H8S A;  2RGH A;  4CGY B;  1L2B A;  5I57 B;  1XC1 A;  2D3I A;  3CI8 A;  4P1E A;  3TDJ A;  5LMU M;  2ZAO A;  1B9J A;  2V25 A;  1AIP C;  2OOB A;  5I2N A;  1FTK A;  2UXC M;  2B4L A;  1B3F A;  3CTW B;  5H8N A;  1FCK A;  2P2A A;  4ZEC A;  1I6A A;  3ILT B;  4MIJ A;  4GF8 A;  1G0H A;  5ICQ A;  1MH4 A;  3TEL A;  2VQE M;  4LFA M;  1QQW A;  1N84 A;  1DGH A;  4L4U A;  1GTK A;  2WKY A;  3IO4 A;  1QKA A;  2KNA A;  2K9D A;  1OIP A;  1E9S A;  4NOO B;  4KYE A;  2Y5K A;  1FNN A;  3TCG A;  5KDT B;  1J7K A;  4R2F A;  3THI A;  3TTM A;  1NNK A;  4ZEI A;  4PF8 A;  2F8D A;  4QOS A;  2PFZ A;  3PU5 A;  4DIG A;  3AOG A;  3VFD A;  2D5W A;  2XXK A;  3OTO M;  1US4 A;  1NMU A;  5TP9 B;  4OAN A;  3HU3 A;  1XXH E;  5C18 A;  2BNK A;  2HHM A;  5A5L A;  1XXH B;  5KPR A;  3MVW A;  2P1S A;  2KNV A;  3CRB A;  3SMP A;  4HEO A;  4XIG Q;  5BUU A;  1D9V A;  5ITX A;  4BDM A;  1LCF A;  3GXA A;  1DGF A;  4CIS A;  1AH5 A;  4LJ8 A;  2G8L A;  4IBJ A;  5L9O A;  2XX8 A;  2ZYM A;  3C31 A;  2OX3 A;  1G71 A;  2R4J A;  3CF0 A;  4DXC A;  1TFD A;  1MM7 A;  1ZMG A;  1GVN A;  2LAO A;  1QVS A;  3VKG A;  4HL4 A;  3U6D A;  2MRO B;  3KOX E;  4H8J A;  3VE1 B;  2CFO A;  5DT6 A;  3TOD A;  4MAG A;  1WJ7 A;  1MXU A;  4NF8 B;  1PRB A;  1EH3 A;  4JSD A;  3TWK A;  2ZM6 M;  3ECR A;  2MR9 A;  3Q27 A;  4JWY A;  3SFZ A;  1PBP A;  1R1N A;  2AL5 A;  3RTF B;  2N35 A;  4HE1 A;  4N07 A;  3CIJ A;  3PUV E;  1N0T A;  3D1R A;  2GNO A;  1NV3 A;  4NF5 A;  2DVW B;  4M4G A;  4DDD A;  2F97 A;  2KZS A;  4IGT A;  4MX6 A;  3PPP A;  3SAU A;  2QVU A;  1IIT A;  1N34 M;  4AG6 A;  4R6H A;  3FTC A;  4QFP A;  2VQF M;  2ALU A;  4GHA A;  2JP7 A;  4FCW A;  4Y28 F;  4GC9 A;  4IY6 A;  1B05 A;  3R26 A;  1YE9 A;  1IN6 A;  3MP1 A;  4PGN A;  1DPE A;  2B4M A;  1IY2 A;  3KJT A;  1FSA A;  4N13 A;  5ELV A;  3I3V A;  4OVT A;  5EYF A;  1SXJ D;  3A3C A;  1MQD A;  4LZZ A;  4XF5 A;  4GIP A;  2QZ4 A;  4ELR A;  4F1U A;  2R71 A;  1JP4 A;  1KSF X;  2JJK A;  1GGG A;  2HZL A;  1HSJ A;  2LWX A;  3HPI A;  2E0S A;  4IBF A;  1SW4 A;  2NOO A;  2XXV A;  5I59 B;  3KXE C;  2RGO A;  3K92 A;  3PUX E;  3SBJ A;  2F5O A;  4G68 B;  2R0I A;  2MH8 A;  1NV1 A;  1GO5 A;  2W7Y A;  4PDD A;  5I2K B;  4I3Y A;  5EP4 A;  4IO3 A;  2J7O A;  3MYU A;  2QBY A;  1NV2 A;  3U61 A;  3VXB A;  2I3V A;  4MJO A;  1Z5A A;  5KQD A;  2JUJ A;  1PEB A;  2YR0 A;  3FJG A;  3B8B A;  2P3V A;  4JI2 M;  3N6T A;  3TCH A;  1H76 A;  4PCD A;  1OKS A;  1O7T A;  3R8F A;  4F31 B;  4B3R M;  1XI6 A;  3OMB A;  5FBP A;  4X1D A;  4OA4 A;  2K0B X;  3IOU A;  4F3B A;  3KW6 A;  1ZQ9 A;  4IBK A;  1NV8 A;  4H5G A;  3VLF B;  5AA2 D;  4G8H A;  4E0X A;  4BB9 A;  2B65 A;  1PJT A;  3TKD A;  3I04 M;  2ZAN A;  4U21 A;  3V89 B;  1PJQ A;  1JET A;  1AOV A;  3BBR A;  4EXK A;  3VK7 A;  2HXW A;  2DP8 A;  4KYD A;  1NV4 A;  2CWB A;  2KA6 B;  1ANF A;  2ONS A;  1FQD A;  2I0B A;  1R4G A;  1LFH A;  5I2N B;  3VDP A;  1R2Y A;  4F19 A;  4NC6 A;  1JR3 D;  2RKO A;  1FPJ A;  5FSW A;  4D81 A;  2OJT A;  5H8N B;  2VDB B;  1NV7 A;  4MH5 A;  4PFR A;  1AL3 A;  3H06 B;  1Z7M E;  2XXQ A;  3PD9 A;  5FTN A;  2XEP A;  2OWZ A;  1I6Q A;  4X04 A;  1DGH B;  2BWE A;  2F5P A;  3TPA A;  3L6G A;  1FPI A;  1YUB A;  3V8X B;  4GC5 A;  1QDR A;  1IXR C;  1DOT A;  5IKB A;  1OFH A;  5DNY A;  4HCY A;  4B3T M;  1NNP A;  4PF6 A;  4OEN A;  3U6L A;  4G4Q A;  3EF7 A;  4GL0 A;  1VR5 A;  2KRK A;  2AL4 A;  3IAZ A;  2OWT A;  3L27 A;  3W67 A;  1P1Q A;  2V1U A;  2L6O A;  4PQJ A;  3H7M A;  2HWJ A;  4B7G A;  3SER A;  3PVS A;  4THI A;  1MY0 A;  1RYO A;  5CRY A;  4ZDM A;  3AXF A;  5B70 A;  3HHW A;  3HWS A;  2XLJ A;  1FTA A;  3GLH E;  3EN3 A;  4H65 A;  2DVC A;  1ORY B;  3LBS A;  2REJ A;  4LP2 B;  2HAV A;  1TGU A;  4G4O A;  5M2V A;  4H0W A;  1Y4T A;  4JWO A;  3DFZ A;  1MDQ A;  5CC2 A;  5IRE B;  4JI4 M;  1YLA A;  1CUK A;  2O6A A;  1MPB A;  4M1V A;  2WSE F;  4LZ8 A;  1SQY A;  2HQ0 A;  5EQ7 A;  1LV7 A;  3HHG A;  1G0I A;  2WBD A;  4XXU A;  2KDL A;  3HGI A;  3FV1 A;  3O66 A;  4W5W A;  4KO8 A;  3T1B A;  2UYF A;  4F3P A;  2Q2A A;  3H4Z A;  1T3T A;  1MY4 A;  1ZKB A;  2UVH A;  2F5S A;  2VP1 A;  2VD2 A;  1LBB A;  3LSW A;  1OVT A;  3OO8 A;  3UGW A;  5JTY A;  2R65 A;  1UFZ A;  3KBZ A;  4PE3 A;  3L26 A;  1B0H A;  2DWI A;  3KC0 A;  2G93 A;  3ILU B;  3E13 X;  4P0G A;  4H5F A;  3TEP A;  4YMA A;  4QOZ C;  1DCU A;  1SG9 A;  4EF1 A;  2R8T A;  4DUY M;  3TUS A;  4R3D A;  1FQC A;  1NV6 A;  1FTJ A;  4OVP A;  1CB6 A;  3E3K A;  5DEX A;  2O84 X;  4P47 A;  5F7V A;  4AI6 A;  2L7I A;  1EIJ A;  1EYK A;  3K9O A;  4P1L A;  1HSE A;  4XFE A;  4LUB A;  1JQF A;  4JVC A;  1Y3Q A;  1OVB A;  3MP6 A;  3RYD A;  1RDX A;  2XZF A;  4LG2 A;  3TPZ A;  2KNZ A;  1IMD A;  1DMB A;  5JEI A;  3C58 A;  5H8F A;  3GQ3 A;  3FZV A;  5KQ8 A;  3NBX X;  2QJE A;  3MVZ A;  1K3X A;  5KZT A;  1A5T A;  4DXB A;  4HE0 A;  4JI3 M;  3TQS A;  3RTW B;  1LB8 A;  3A3U A;  1NI9 A;  3A45 A;  1XNR M;  1IN7 A;  3SEY A;  3EHS A;  1MU5 A;  2WBB A;  2A5S A;  3GQ5 A;  4IO4 A;  4XTC Q;  1NL5 A;  3H4M A;  3L6H A;  3GLI A;  3MVY A;  3E46 A;  3LCU A;  2R9J A;  4XGI A;  3LVV A;  2QBY B;  4HXV A;  3U61 B;  1QAN A;  3MMP A;  2R4E A;  1KFV A;  3UA8 A;  3IB2 A;  4GX4 A;  3PD8 A;  4KPT A;  4WP2 A;  4DR4 M;  3IG5 A;  5JI2 E;  2I48 A;  4G4R A;  1PBQ A;  3T9U A;  4M9S A;  3WHK A;  4GHL A;  4WXJ A;  5A2Q S;  1IM2 A;  1R9Q A;  3K8Z A;  5LOM A;  4O3B A;  1USY E;  1JEV A;  4EUO A;  5HBC A;  2HPG A;  2DE4 A;  1EZO A;  1QYR A;  3IO6 A;  2Z3X A;  3CF6 E;  4QFO A;  2LHG A;  4MCO A;  4NXN M;  1WDN A;  4EQ7 A;  2CHQ A;  1MXW A;  4M0W A;  2VPN A;  2Q8M A;  2Y7I A;  1SYH A;  3G3K A;  3ILK A;  3R7X A;  2RIN A;  1IFY A;  4GKJ M;  1F9B A;  1NNF A;  5CM6 A;  4YAH X;  4RNS A;  4AG5 A;  1M5D A;  4PET A;  4BLA A;  1P1U A;  2XXH A;  1YTV A;  3B7Q A;  2G29 A;  3H6V A;  4I3E A;  4R6Y A;  1EYJ A;  4QXD A;  3S9E A;  3GRY A;  5KPZ A;  1YYZ A;  1PJI A;  5E6J A;  1HJP A;  2CZH A;  3M3F A;  3KFM A;  4XKQ A;  1BIY A;  2EKF A;  2FIX A;  3N6U A;  5CBS A;  1HNZ M;  4PGP A;  2R45 A;  4XKR A;  4L15 A;  4IR8 A;  1BKA A;  2QVV A;  2Q2E B;  2ZYK A;  2YQZ A;  2HL7 A;  1M5C A;  2DAE A;  2M60 A;  3FYD A;  5KDT A;  4L17 A;  3WHL A;  4POX A;  3TTL A;  5EP1 A;  5IZ1 A;  1IY1 A;  4X62 M;  2Q2C A;  3DOA A;  1NV0 A;  5TP9 A;  4LJ9 A;  5DVI A;  4GBV A;  1NNJ A;  3ZCB B;  1VG5 A;  1XXH A;  4GH9 A;  1GL6 A;  5AA4 A;  2I58 A;  2PMS A;  4FJP A;  4U4S A;  2Z4R A;  2VF7 A;  3FXQ A;  2I3W A;  4RNA A;  1E32 A;  3MJ5 A;  3UGJ A;  2BWB A;  1N75 A;  4FAJ A;  1B4H A;  4F2Q A;  3SEX A;  3PPN A;  4IBD A;  1J1N A;  2Z8D A;  3RQT A;  3ZH9 B;  4LJ5 A;  3RGS A;  1FBD A;  2CHV A;  2JY6 B;  4JYA M;  3EHT A;  2KXE A;  2Y21 A;  4NWC A;  2XXI A;  2XXW A;  3A09 A;  4PFW A;  2ERC A;  4ZEK A;  3IG8 A;  3IJX B;  2I4C A;  3DM0 A;  1Q02 A;  2RC7 A;  1MRP A;  1IN8 A;  2QS3 A;  3GPP A;  4QSE A;  2D21 A;  2HFB A;  1L2C A;  1B46 A;  4Q7J A;  5DYI A;  1FTM A;  2V93 A;  4R71 A;  3GQ4 A;  1NJF A;  4R2B A;  2C9C A;  5JTY B;  5KO3 A;  2EJS A;  4I81 A;  2XFT A;  4GX6 A;  1FPE A;  1I69 A;  4FIM A;  4H67 A;  1B51 A;  4X66 M;  3ZC7 B;  2KW0 A;  1WOD A;  4GWS A;  1LB9 A;  1MXX A;  4LF8 M;  1W5S A;  2F7B A;  1L2D A;  1Y8G A;  3E9X A;  2APL A;  1HNW M;  1MY1 A;  3RY3 A;  1G41 A;  2XXU A;  4R6K A;  3Q8G A;  3QYE A;  1JW1 A;  5C1B A;  4F29 A;  5EHM A;  2W82 A;  5EP3 A;  2ANJ A;  1NO1 A;  5H8Q A;  2XWV A;  4Z0I A;  3PUY E;  3RPW A;  1O63 A; 
#chains in the Genus database with same CATH homology
 3G3H A;  5H8F B;  4HS7 A;  2X49 A;  2HKJ A;  2QS1 A;  4FE8 A;  2H99 A;  5DYG A;  4DV0 M;  3U6P A;  3EIE A;  3G7W A;  4D80 A;  3VLW A;  1SW5 A;  4H6D A;  1B3E A;  3AOE C;  1KYI A;  5JI3 E;  3HV1 A;  2O51 A;  2AYS A;  2ZXT A;  3GLI B;  4NXM M;  3TZA A;  4REZ A;  3ONM A;  1B3G A;  1I4W A;  3PMX A;  1Z5B A;  3FXR A;  3T93 B;  3MP8 A;  4QFK A;  3OOA A;  1D2N A;  4O3C A;  3FKE A;  1PB8 A;  1MQG A;  2B3B A;  1NSF A;  3MAM A;  4YMB A;  3PFI A;  1S3S A;  2YNM D;  3J27 B;  4NSO B;  3KOZ E;  1N76 A;  4QNM A;  1LST A;  3DP6 A;  1Y20 A;  1L1T A;  1PB7 A;  4AKG A;  4ECF A;  1IN4 A;  3CFL A;  5BWJ A;  1HSL A;  4PDG A;  1Y4C A;  3OSQ A;  4WEP A;  4EQB A;  5CI5 A;  4LF6 M;  3LMM A;  3B7D A;  3CR9 A;  1B2H A;  4ZS9 A;  4I8O A;  4OTE A;  1L5T A;  3KGC A;  4RJZ A;  2XXT A;  4LF9 M;  1QAQ A;  1Y1Z A;  3H03 A;  4FW9 A;  1IQ7 A;  1MDP 1;  3J2P B;  4U23 A;  4G77 A;  4G8N A;  4FCT A;  4X9T A;  3V5A A;  4LCB A;  2GRV A;  3NWL A;  4JN6 A;  2ZNT A;  5EJC A;  2IA4 A;  1POY 1;  3L28 A;  2UXA A;  1AMF A;  3IOT A;  4B08 A;  3C4M A;  3SAW A;  2DXR A;  2GFE A;  1B6H A;  1B1H A;  4MM3 B;  2QPA A;  1D4N A;  3M3K A;  1Y3N A;  2DWA A;  4QSC A;  3SAS A;  2DVZ A;  3L29 A;  5AA4 B;  3GLH A;  1NNU C;  4AB5 A;  4PD2 A;  4DUZ M;  1HT1 E;  1II5 A;  2KRU A;  1FTL A;  3OXN A;  4NWD A;  1NHW C;  1URD A;  2O68 A;  3VXC A;  2NUV A;  3GBA A;  3LSX A;  4QSD A;  4OFO A;  4P0I A;  3LVW A;  5J1D A;  4LRS A;  3EPE A;  1FW0 A;  4ESW A;  4JI7 M;  4B3S M;  2KZU A;  1LAH E;  4Q0C A;  2V6Z M;  3FVG A;  1B3L A;  3FTD A;  3N5L A;  2DXI A;  1B5I A;  1IQP A;  4LVQ A;  5KPT A;  4POW A;  3KN8 A;  2CV2 A;  4KHZ E;  1SYI A;  3FV2 A;  3R6U A;  3TTK A;  2LNH C;  3MVX A;  4LF5 M;  4DR2 M;  1PM5 A;  2D7H A;  3HCQ A;  2UUC M;  1ZU0 A;  4FED A;  5F1Q A;  1IXC A;  4N6P A;  3PMV A;  2QRY A;  2F5Q A;  1QKB A;  3MUQ A;  2F7C A;  1GL7 A;  3JV9 A;  2O69 A;  3LR1 A;  4F39 A;  4EF2 A;  1US5 A;  4OER A;  4NSR A;  1JVX A;  2H25 A;  3S2V A;  3SEU A;  4EIW A;  5ITO A;  4FWG A;  4IO6 A;  1K3W A;  3C34 A;  1OQH A;  1Q39 A;  3KP0 E;  1PC3 A;  5H8Q B;  2XSZ A;  1DO2 A;  3PNY A;  2D7G A;  3CSG A;  3GRV A;  3VVE A;  1AIV A;  1Q3B A;  4JXJ A;  3OEL A;  2NVU B;  1P1O A;  4B7F A;  1SBP A;  1J5E M;  5TU0 A;  3PPO A;  5DTB A;  1XVX A;  3U1O A;  2REG A;  3D8L A;  3HJS A;  4DCX A;  2C96 A;  3Q28 A;  1TH3 A;  3U6M A;  4GKK M;  2K47 A;  3MK6 A;  3RGP A;  2DE3 A;  4LJ4 A;  4GWO A;  3TQL A;  4TLL B;  1S7Y A;  4YB6 A;  4PFU A;  3ZS6 A;  2ZAM A;  1ELJ A;  3O9P A;  2YJP A;  4GIT A;  1Q1K A;  2CUZ A;  4WW0 A;  3WAE A;  3A98 B;  3FJ7 A;  3D8B A;  3KOY E;  3FAS A;  4XKP A;  1G3I A;  2Z8E A;  3PUZ E;  4D82 A;  3G3F A;  4AB6 A;  3KEI A;  3PXG A;  2Y0T A;  2Y7W A;  4CHT B;  5EXS A;  5IZ7 D;  4ITQ A;  4P11 A;  4KOD A;  3K0V A;  1H6U A;  3T66 A;  1TDZ A;  3FUV A;  2XHD A;  4YKP A;  3G3G A;  3KBR A;  3FD9 A;  3SEW A;  2Z23 A;  2XFS A;  2FNC A;  1GVC A;  1Y3P A;  3Q8X A;  2OZZ A;  3SET A;  3OEN A;  2RC9 A;  4ZE8 A;  4LON B;  1IY0 A;  4M9Z A;  2RCB A;  3W0L B;  2DYX A;  2F6P A;  4RXL A;  3RNN A;  5H37 D;  1JEU A;  2XF3 A;  4YKK A;  1NKX A;  1A8E A;  1MS7 A;  2UVG A;  3T9X B;  1MPD A;  4IBC A;  5CMB A;  4BDN A;  3FVK A;  5JK4 A;  2F34 A;  4X48 A;  1IZ1 A;  4MH0 E;  3BOS A;  2I7N A;  1VSO A;  2Z22 A;  1SW1 A;  5FTL A;  4KCC A;  3M3L A;  4AKI A;  2XZU A;  5FHN A;  4I4L A;  5ITU A;  2Z8F A;  3M0E A;  3IOW A;  1G4A E;  1EU8 A;  3A42 A;  3GLH B;  3VVF A;  5GKN A;  1YCJ A;  1N7X A;  4LGY A;  2OWS A;  3AL0 C;  3JAM S;  1BP5 A;  3JYR A;  4WKM A;  3HHZ A;  4ND9 A;  2GH9 A;  1B32 A;  3O6I A;  2Y7P A;  4BDL A;  3QUJ A;  2ZBK B;  3K6X A;  2PX1 A;  2XH9 A;  2E1S A;  2O1L A;  4DXU A;  4C0R A;  2Y84 A;  3O6G A;  4QFN A;  4YU0 A;  4KFQ A;  5ITR A;  1QUJ A;  4RK9 A;  3K00 A;  3KOS A;  4NE4 A;  3HU2 A;  1J09 A;  3CSB A;  4JI8 M;  1R6B X;  2Y20 A;  4H1X A;  2V3U A;  3PPQ A;  3KS8 A;  1MM6 A;  1MY3 A;  4TLM B;  4FAT A;  2A5T B;  1QVR A;  1SXJ C;  1JW5 A;  1Z5C A;  4GMQ A;  3J7A S;  3U5Z A;  2C5R A;  3DZD A;  4G8M A;  1PDA A;  3K6U A;  3SES A;  3QAX A;  4RY1 A;  1MY2 A;  2M8C A;  4KI0 E;  3H6U A;  4Z6Y A;  3G3I A;  3FUW A;  1UIV A;  3K1P A;  1R7R A;  1T0K A;  1DSN A;  3VLV A;  5ITQ A;  2F5X A;  5EHS A;  1B1X A;  4ZZA A;  4BBA A;  3SAR A;  3FUT A;  2R18 A;  1G8P A;  1UQW A;  3B6Q A;  2YPN A;  3MWB A;  2UUB M;  4JI6 M;  5FTI A;  1B5J A;  4FEC A;  4F3G A;  4F3S A;  3JR5 A;  1EZP A;  3AFH A;  1USY H;  2JA2 A;  3KOW E;  3RFW A;  3DP8 A;  2QSX A;  4U22 A;  5IAI A;  1M5F A;  1EE8 A;  3FIR A;  2QP9 X;  3HST A;  3RGY A;  1UTH A;  1B7H A;  1NH7 A;  4OZ9 A;  5L9M A;  1WVJ A;  2VHA A;  4OU7 A;  3HJ8 A;  4OHN A;  1P99 A;  3SYK A;  1VDD A;  4OW0 A;  4IGR A;  1LAX A;  5FHO A;  4ZED A;  4B3M M;  4IB2 A;  1XWI A;  4I62 A;  3KN7 A;  4DV4 M;  4HTG A;  5FTM A;  1X37 A;  1YSY A;  1JNF A;  1N3W A;  1NY6 A;  4I9D A;  3CVG A;  2F78 A;  2ONK E;  3UK6 A;  3U60 B;  2H98 A;  2XXP A;  2OCU A;  1Y1M A;  4I5S A;  4HCW A;  2UVJ A;  1DTG A;  1QAO A;  2AIX A;  2I6E A;  4G4P A;  1URG A;  2VOZ A;  2DWZ B;  3MZB A;  3HJQ A;  2DZN B;  5B7D A;  5CMM A;  2QL3 A;  2YLN A;  4DV2 M;  2DS9 A;  1OFI A;  2HHH M;  2P5T A;  3K6W A;  1IN5 A;  3C35 A;  2OK2 A;  3S9N C;  3J81 S;  2V3Q A;  4YB5 A;  2HZK A;  1LLS A;  4DCY A;  3Q26 A;  1XVY A;  4LF7 M;  5ITP A;  1IXZ A;  1XS5 A;  4EXL A;  3V83 A;  2P0S A;  2XX7 A;  3SAV A;  3IK6 B;  4QFL A;  1S9T A;  3RLF E;  2UU9 M;  3TWM A;  4MFI A;  5TPA A;  3BKI B;  3SYL A;  2DHR A;  2ZNS A;  3VK8 A;  4NF6 B;  3SKP A;  2QMW A;  3Q29 A;  4JI5 M;  1WXQ A;  5ISU A;  1SD3 A;  1B52 A;  3I51 A;  1ZTY A;  4X1B A;  2O1M A;  1XHB A;  3VLU A;  3TQW A;  1P1W A;  2L7H A;  2OQ4 A;  3FTF A;  3RT8 A;  4DLD A;  4ESX A;  2V3T A;  4KD5 A;  1Z6T A;  2QPQ A;  3GRU A;  4AW4 A;  4GD5 A;  1MH3 A;  4DV6 M;  1FQB A;  3IR1 A;  4OVZ B;  4ZEB A;  3MZ1 A;  4IBB A;  4FOR A;  2ZYO A;  2I7P A;  1IXS B;  3HN0 A;  3K01 A;  3N26 A;  4MGY E;  3C36 A;  4LRT A;  4QRZ A;  4I8C A;  2CMO A;  3HU1 A;  2X4A A;  3U5Z B;  4KQP A;  3USD A;  3K2D A;  3MJN A;  4G68 C;  1Q35 A;  3RN8 A;  4K0K M;  3K02 A;  4S12 A;  4OVJ A;  2GHA A;  4Z7E A;  4NF4 A;  3VKH A;  2XSZ D;  3O6H A;  4MGI E;  2LXE A;  3DA1 A;  4X64 M;  3GPU A;  1HR0 M;  4Q5T A;  3ZSF A;  2OBG A;  2O7U A;  1MQH A;  2LH0 A;  4II7 A;  1E9R A;  3HHF A;  3RE8 A;  3MZ9 A;  4FEB A;  2ONR A;  3CFX A;  1XNQ M;  3IOV A;  1N04 A;  5EQT A;  3O28 A;  2ZNU A;  5FTK A;  4YIC A;  2NWJ A;  2Q9T A;  3U93 A;  4BDQ A;  2DWJ A;  4GXA A;  4MGH A;  3GLB A;  3MPK A;  1IUD A;  3OEK A;  3S9L C;  2VII A;  1GKI A;  2DE2 A;  3IB0 A;  3AV0 A;  1PJJ A;  4Q8R A;  5I58 B;  4IBI A;  4H8I A;  3PUW E;  2KEB A;  4GXS B;  2UUA M;  2DSF A;  4BDR A;  3E4R A;  2VD3 A;  1XMO M;  1UTH B;  3GPX A;  1LAG E;  3M8U A;  4FVM A;  1D9Y A;  3VFJ A;  2QEN A;  4AZF A;  1LCT A;  2Y7R A;  4GRK A;  4NMY A;  4OQO A;  2F4V M;  1VE4 A;  2RC8 A;  5CMK A;  4ZE9 A;  2CV1 A;  3FAT A;  4RF0 A;  3VDF A;  3K1N A;  4QHS A;  2I49 A;  4F1Y A;  3GRR A;  1B7U A;  2YFQ A;  4LZ7 A;  3HHY A;  3MHV C;  5FHM A;  3I5O A;  3KP1 E;  3UZU A;  1QAM A;  3K4U A;  3MBP A;  1QW0 A;  1ZBM A;  3T1Y M;  4PDI A;  1LAF E;  3LQR A;  1IXG A;  4WUR A;  2BJJ X;  1A40 A;  2H9B A;  2I0C A;  4IJE A;  3O97 A;  2Q89 A;  1TT1 A;  3IJO B;  3PNV A;  1DO0 A;  3UN6 A;  4AKH A;  3IOR A;  2CV0 A;  4RA1 A;  3IX1 A;  2FA7 A;  4ZEF A;  3PGF A;  1Z59 A;  3U6O A;  1K82 A;  4RK2 A;  4PCZ A;  1B3H A;  1ZAE A;  4OWD A;  3J80 S;  4R74 A;  3W0F A;  4R7G A;  2ABH A;  2QS2 A;  4OX9 M;  3KDS E;  3EHU A;  4FD2 A;  1UIU A;  3Q25 A;  5TPA B;  4R72 A;  4JI0 M;  3QWL A;  4C1T A;  4YHH M;  4F2O A;  3L25 A;  4GFR A;  1IXI A;  4DE8 A;  4QHT A;  4LQ5 A;  3JR4 A;  1LGB C;  1XOC A;  3TTR A;  1I94 M;  5DVF A;  3VDU A;  5F3W A;  4ZPX A;  1ZJL A;  4LFB M;  4BLC A;  3TTN A;  2UXD M;  3FUZ A;  3C9H A;  5I84 A;  3IL1 B;  1N78 A;  2UXB M;  2A5T A;  4U1O A;  4GQO A;  2UVI A;  4DV5 M;  1FTO A;  3B6W A;  1IEJ A;  1LFG A;  1OIB A;  3KFU G;  1ZLQ A;  1PB9 A;  2F7A A;  1N7W A;  4X65 M;  1N3X A;  1B58 A;  3KG2 A;  2DWN A;  1A8F A;  1QJM A;  2RF1 A;  4EDP A;  4EQ9 A;  2AHM A;  3VVD A;  4PP0 A;  3U8Q A;  1A54 A;  4NF4 B;  4GIZ A;  1DGG A;  4HW8 A;  3U6Q A;  3MPL A;  3K2L A;  4ONY A;  1BTJ A;  3OO6 A;  1DGB A;  2V1C A;  2QMX A;  3FXU A;  4KYS A;  2G5G X;  3GBB A;  5CBR A;  2FOI C;  4P16 A;  1GV8 A;  4IO2 A;  4PFY A;  1FQF A;  4DR6 M;  1A55 A;  3MC2 A;  5LMN M;  4OEU A;  2DWM A;  5KCJ B;  4OFL A;  4C1U A;  5EXX A;  1B40 A;  1IIW A;  4ZZE A;  1MXZ A;  2ZYN A;  4AQY M;  2FNA A;  1JQJ C;  1VFE A;  2RCA A;  3THG A;  4JSO A;  3UJN A;  1KWH A;  4FCV A;  3R9X B;  5AA1 A;  2NQ8 C;  1B4Z A;  4GLI A;  3K1M A;  1MXV A;  3GP1 A;  4LZJ A;  4LJ6 A;  3UK4 A;  2DXY A;  3O2A A;  4DR3 M;  2QCU A;  1SI0 A;  2DWH A;  3RUM A;  2Y0Q A;  1YPN A;  3OEM A;  3KJ7 A;  4JBZ A;  2THI A;  3QSL A;  4RF1 A;  1MX0 A;  2X7Q A;  3SC3 A;  1BLF A;  4YKI A;  1SW2 A;  4MGK E;  1TXF A;  3TMG A;  5A5X A;  4OYV A;  1GR2 A;  3U60 A;  3T9V A;  4RPO A;  3GLG A;  2DWL A;  1QUL A;  2C99 A;  4F18 A;  2VGQ A;  5E26 A;  1N36 M;  1FQE A;  2H4I A;  2HAU A;  5H8H A;  1H45 A;  3SEV A;  3SDF A;  2PT1 A;  4DV3 M;  2R46 A;  1GLN A;  3H6T A;  3FGS A;  2HCA A;  3HKP A;  4U1Z A;  1M5E A;  4R75 A;  2F36 A;  3UIF A;  3SAT A;  3T22 A;  3AKZ A;  1FQA A;  4F1V A;  2DQV A;  1IBK M;  1FJG M;  4IO5 A;  4ELO A;  3DLN A;  4DR1 M;  1W5T A;  4I1D A;  3AJI B;  1R6Z A;  4FWD A;  4KCD A;  4O3A A;  2Z7J A;  4G2Z A;  3U94 A;  5L9S A;  3FJM A;  3HO7 A;  1N33 M;  4Z8X A;  2OLB A;  4LA9 A;  2M5Z A;  3PPR A;  4MBP A;  5BPV A;  2CE7 A;  4NF6 A;  7CAT A;  4NRW A;  3E9S A;  2EO2 A;  2Z4S A;  1QZM A;  2O7I A;  4IJF A;  2C98 A;  1SDX A;  4LQ2 A;  4YB7 A;  4JB7 A;  5IT9 S;  1H43 A;  4PE5 B;  2Q88 A;  3QIM A;  4AQ4 A;  5ITX E;  1XC8 A;  3D4G A;  3QK6 A;  1N32 M;  3EQ1 A;  4BDO A;  1L8Q A;  4U4X A;  1QUI A;  1XT8 A;  2DOJ A;  3J7B A;  4MLQ A;  3T9H B;  1DTZ A;  4OVZ A;  1QUK A;  1UM8 A;  1IXH A;  3TL4 X;  1N77 A;  1Y9U A;  4HLQ A;  4OXV A;  3QXM A;  2NXO A;  5FTH A;  3T96 B;  4KLN A;  1B7Z A;  4NRV A;  3GPY A;  5DYH A;  2Y7K A;  1H44 A;  3CF2 A;  1IBL M;  4Q30 B;  3S4U A;  3TYH A;  8CAT A;  3K1J A;  4E0W A;  3TFL A;  4TOZ A;  2CEA A;  3HHX A;  4KHP M;  4ELP A;  1JW4 A;  1Z7N E;  3TCF A;  4NF5 B;  1S50 A;  4RYA A;  4TQU Q;  5EXP A;  3FYC A;  4MB7 A;  4JXI A;  2EA0 A;  1LBC A;  3GLF A;  3T15 A;  1OMP A;  2F5N A;  4QF9 A;  3ZKK A;  3KN3 A;  4G4N A;  3G3J A;  3C32 A;  1SXJ A;  5AA3 A;  4PFT A;  4M0D A;  3K6V A;  2F35 A;  2XD2 A;  4G6Z A;  4NED A;  2UYE A;  3W15 C;  2XXX A;  4OFJ A;  5I58 A;  3KSJ A;  4A3V B;  4TUW A;  2XXR A;  1ZIU A;  3P7I A;  5I56 A;  3CG3 A;  4LF4 M;  1B5H A;  4YY3 M;  4RPN A;  3EIH A;  2FE8 A;  2PYY A;  2B3F A;  4B7H A;  3CFZ A;  3S9M C;  1NY5 A;  1DPP A;  2D7E A;  2F6G A;  1M5B A;  5HM4 B;  4OES A;  5K2X A;  1XMQ M;  1R2Z A;  2E5L M;  4LFC M;  1MQJ A;  4XBO A;  2CZL A;  1I6B A;  3KZG A;  2XXY A;  3T38 A;  3FTE A;  1NFT A;  3M7G A;  4IY5 A;  1UTB A;  2PVU A;  3ODB A;  2V84 A;  3KSX A;  2A5Y B;  3KVW A;  2GHB A;  3SHG B;  5A5X B;  3W9V A;  4UA8 A;  1E94 E;  3NBI A;  3N94 A;  1RKM A;  2H1R A;  1POT A;  3GLG B;  4MLV A;  3B9P A;  2X26 A;  1OLC A;  5AA2 A;  4WED A;  5I57 A;  5H8H B;  3OSR A;  3U6E A;  5FLX S;  4DV1 M;  1MXY A;  2XD3 A;  1L1Z A;  4MF3 A;  4K3F A;  2X8A A;  2Q8J A;  1A7L A;  3KS4 A;  1JVY A;  3FD3 A;  2R62 A;  3MW0 A;  4OET A;  2FFJ A;  2HEU A;  3L2A A;  1XHY A;  1JR3 A;  3GO8 A;  1TH2 A;  1NJG A;  3BFU A;  3O29 A;  1MG1 A;  2R6G E;  5IWA M;  4OMB A;  2HCB A;  2H5Y A;  3QUF A;  1Q3C A;  3U72 A;  1G59 A;  2QS4 A;  3QAU A;  1H3D A;  4JV5 M;  2C9O A;  1TWY A;  4YKJ A;  4LJ7 A;  3QYT A;  4M9X A;  1TDH A;  1HQY E;  4YZZ A;  4DR7 M;  5ITT A;  1RYX A;  4IBE A;  1VFD A;  3H6W A;  3BFT A;  1OQG A;  4L16 A;  5K2Y A;  4JI1 M;  3I6V A;  2PT2 A;  2O5R A;  2BJW A;  2FYI A;  4DR5 M;  4R9G A;  1O64 A;  1TH4 A;  4F22 A;  5ITY A;  3LQQ A;  3GZG A;  3UMM A;  4GVO A;  4JDF A;  3PMW A;  3UP9 A;  3IB1 A;  5L8D A;  4GOT A;  3B6T A;  1HNX M;  1A99 A;  4KR5 A;  1NNT A;  1SVX B;  2EUC A;  4R9F A;  3A46 A;  2I4B A;  3T1H M;  5BR8 M;  4NF8 A;  1CE2 A;  3WAF A;  4L78 A;  2PBW A;  5EXT A;  2DZO B;  3SHF A;  1B0L A;  4OEV A;  2OPF A;  1HT2 E;  3H3G A;  3UOR A;  3F11 A;  4LY6 A;  3W9W A;  4QNR A;  4IBG A;  1URS A;  1HQC A;  2IEE A;  3U6C A;  2X7P A;  1LFI A;  3LC8 A;  4UAC A;  5CMC A;  1TFA A;  4JWX A;  2XGN A;  1D3K A;  3PV0 E;  5DEX B;  2J7N A;  3I4Y A;  3ZKL A;  3VV5 A;  4R73 A;  3GLF B;  4LZ5 A;  3TWL A;  3FUX A;  3FUU A;  3RT6 B;  5KCJ A;  1NVM A;  2XX9 A;  1SXJ E;  3I4V A;  1SI1 A;  1MQI A;  1SXJ B;  3JZJ A;  5HPQ A;  3U6S A;  3TAJ A;  3DEL B;  5AE4 A;  4PT5 A;  4MGZ E;  1OLA A;  3LUY A;  2L09 A;  5I59 A;  4DZ1 A;  4G68 A;  4NL4 H;  3OO9 A;  5I2K A;  2ESN A;  5I56 B;  3LSF B;  4LJA A;  3LSL A;  2BJV A;  4ELQ A;  4U2R A;  1OJL A;  5ICT A;  3KOT A;  4ISU A;  4QHQ A;  3SMS A;  3FVN A;  3DP4 A;  3TE6 A;  4GL8 A;  4FWH A;  4NTL A;  1ATG A;  3C33 A;  3D4C A;  4IO7 A;  1EZ9 A;  4IIW A;  4L8R C;  3CG1 A;  2KLF A;  2RKM A;  4LGM A;  3FVO A;  4GRI A;  3OO7 A;  4LAT A;  3U92 A;  5DVJ A;  3AOE A;  5EP2 A;  3M6A A;  3OD7 A;  1YAE A;  1UTB B;  3MQ9 A;  2ZMB A;  1P1N A;  1R9L A;  5FTJ A;  4DV7 M;  1NHG C;  1C1K A;  1NH8 A;  1IBM M;  4XKN A;  2CHG A;  1MPC A;  5AA2 B;  5H8S A;  2RGH A;  4CGY B;  1L2B A;  5I57 B;  1XC1 A;  2D3I A;  3CI8 A;  3TDJ A;  5LMU M;  2ZAO A;  1B9J A;  2V25 A;  5I2N A;  1FTK A;  2UXC M;  1B3F A;  3CTW B;  5H8N A;  1FCK A;  2P2A A;  4ZEC A;  1I6A A;  3ILT B;  4GF8 A;  5ICQ A;  1MH4 A;  3TEL A;  2VQE M;  4LFA M;  1QQW A;  1N84 A;  1DGH A;  4L4U A;  1GTK A;  2WKY A;  3IO4 A;  1QKA A;  1E9S A;  4NOO B;  4KYE A;  1FNN A;  3TCG A;  5KDT B;  1J7K A;  4R2F A;  3THI A;  3TTM A;  1NNK A;  4ZEI A;  2F8D A;  4QOS A;  3PU5 A;  4DIG A;  3AOG A;  3VFD A;  2D5W A;  3OTO M;  1US4 A;  1NMU A;  5TP9 B;  3HU3 A;  5C18 A;  2BNK A;  1XXH B;  5KPR A;  3MVW A;  2P1S A;  3CRB A;  3SMP A;  4XIG Q;  5BUU A;  1D9V A;  5ITX A;  4BDM A;  1LCF A;  3GXA A;  1DGF A;  4CIS A;  1AH5 A;  4LJ8 A;  2G8L A;  4IBJ A;  5L9O A;  2XX8 A;  2ZYM A;  3C31 A;  2R4J A;  3CF0 A;  4DXC A;  1TFD A;  1MM7 A;  1ZMG A;  1GVN A;  2LAO A;  1QVS A;  3VKG A;  4HL4 A;  3U6D A;  3KOX E;  4H8J A;  3VE1 B;  2CFO A;  5DT6 A;  3TOD A;  1MXU A;  4NF8 B;  1EH3 A;  4JSD A;  3TWK A;  2ZM6 M;  3ECR A;  3Q27 A;  4JWY A;  3SFZ A;  1PBP A;  1R1N A;  2AL5 A;  3RTF B;  4N07 A;  3CIJ A;  3PUV E;  1N0T A;  4NF5 A;  2DVW B;  4M4G A;  4DDD A;  2F97 A;  2KZS A;  4IGT A;  3PPP A;  3SAU A;  1IIT A;  1N34 M;  4AG6 A;  4R6H A;  3FTC A;  4QFP A;  2VQF M;  2ALU A;  4GHA A;  4FCW A;  4GC9 A;  4IY6 A;  1B05 A;  3R26 A;  1YE9 A;  1IN6 A;  3MP1 A;  1DPE A;  1IY2 A;  3KJT A;  4N13 A;  5ELV A;  3I3V A;  5EYF A;  1SXJ D;  3A3C A;  1MQD A;  4LZZ A;  4GIP A;  2QZ4 A;  4ELR A;  4F1U A;  2R71 A;  1KSF X;  1GGG A;  2HZL A;  1HSJ A;  2LWX A;  3HPI A;  2E0S A;  4IBF A;  1SW4 A;  2NOO A;  2XXV A;  5I59 B;  3KXE C;  2RGO A;  3K92 A;  3PUX E;  3SBJ A;  2F5O A;  4G68 B;  5I2K B;  2W7Y A;  5EP4 A;  4IO3 A;  2J7O A;  2QBY A;  3VXB A;  3U61 A;  2I3V A;  1Z5A A;  5KQD A;  1PEB A;  2YR0 A;  3FJG A;  4JI2 M;  3N6T A;  3TCH A;  1H76 A;  1O7T A;  3R8F A;  4F31 B;  4B3R M;  3OMB A;  4X1D A;  3IOU A;  4F3B A;  3KW6 A;  1ZQ9 A;  4IBK A;  4H5G A;  3VLF B;  5AA2 D;  4G8H A;  4E0X A;  4BB9 A;  2B65 A;  3TKD A;  2ZAN A;  4U21 A;  3V89 B;  1JET A;  1AOV A;  3BBR A;  4EXK A;  3VK7 A;  2HXW A;  2DP8 A;  4KYD A;  2KA6 B;  1ANF A;  2ONS A;  1FQD A;  2I0B A;  1LFH A;  5I2N B;  3VDP A;  1R2Y A;  4F19 A;  1JR3 D;  2RKO A;  5FSW A;  4D81 A;  2OJT A;  5H8N B;  4MH5 A;  1AL3 A;  3H06 B;  1Z7M E;  2XXQ A;  3PD9 A;  5FTN A;  2XEP A;  1I6Q A;  1DGH B;  2F5P A;  3TPA A;  3L6G A;  1YUB A;  3V8X B;  4GC5 A;  1IXR C;  1DOT A;  5IKB A;  1OFH A;  5DNY A;  4HCY A;  4B3T M;  1NNP A;  4OEN A;  3U6L A;  4G4Q A;  3EF7 A;  4GL0 A;  1VR5 A;  2KRK A;  2AL4 A;  3IAZ A;  2OWT A;  3L27 A;  1P1Q A;  2V1U A;  2L6O A;  4PQJ A;  3H7M A;  4B7G A;  3SER A;  3PVS A;  4THI A;  1MY0 A;  1RYO A;  5CRY A;  4ZDM A;  3AXF A;  5B70 A;  3HHW A;  3HWS A;  2XLJ A;  4H65 A;  3EN3 A;  2DVC A;  1ORY B;  3LBS A;  2REJ A;  4LP2 B;  2HAV A;  1TGU A;  4G4O A;  5M2V A;  4H0W A;  1Y4T A;  4JWO A;  3DFZ A;  1MDQ A;  5CC2 A;  5IRE B;  4JI4 M;  2O6A A;  1MPB A;  4M1V A;  4LZ8 A;  1SQY A;  2HQ0 A;  1LV7 A;  3HHG A;  4XXU A;  3HGI A;  3FV1 A;  3O66 A;  4W5W A;  4KO8 A;  2UYF A;  4F3P A;  2Q2A A;  3H4Z A;  1T3T A;  1MY4 A;  1ZKB A;  2UVH A;  2F5S A;  2VP1 A;  2VD2 A;  1LBB A;  3LSW A;  1OVT A;  3OO8 A;  3UGW A;  5JTY A;  2R65 A;  3L26 A;  1B0H A;  2DWI A;  2G93 A;  3ILU B;  3E13 X;  4P0G A;  4H5F A;  3TEP A;  4YMA A;  4QOZ C;  4EF1 A;  4DUY M;  3TUS A;  4R3D A;  1FQC A;  1FTJ A;  1CB6 A;  3E3K A;  5DEX A;  2O84 X;  5F7V A;  4AI6 A;  2L7I A;  1HSE A;  4LUB A;  1JQF A;  1Y3Q A;  1OVB A;  3MP6 A;  2XZF A;  4LG2 A;  3TPZ A;  5JEI A;  1DMB A;  3C58 A;  5H8F A;  3GQ3 A;  3FZV A;  5KQ8 A;  2QJE A;  3MVZ A;  1K3X A;  5KZT A;  4DXB A;  4JI3 M;  3TQS A;  3RTW B;  1LB8 A;  3A3U A;  3A45 A;  1XNR M;  1IN7 A;  3SEY A;  3EHS A;  1MU5 A;  2A5S A;  3GQ5 A;  4IO4 A;  4XTC Q;  1NL5 A;  3H4M A;  3L6H A;  3GLI A;  3MVY A;  2R9J A;  4XGI A;  3LVV A;  2QBY B;  3U61 B;  1QAN A;  2R4E A;  1KFV A;  3UA8 A;  3IB2 A;  3PD8 A;  4KPT A;  4DR4 M;  3IG5 A;  5JI2 E;  2I48 A;  4G4R A;  1PBQ A;  3T9U A;  4M9S A;  3WHK A;  4GHL A;  4WXJ A;  5A2Q S;  1IM2 A;  1R9Q A;  3K8Z A;  5LOM A;  4O3B A;  1USY E;  1JEV A;  4EUO A;  5HBC A;  2DE4 A;  1EZO A;  1QYR A;  3IO6 A;  2Z3X A;  3CF6 E;  4QFO A;  4NXN M;  1WDN A;  4EQ7 A;  2CHQ A;  1MXW A;  4M0W A;  2Y7I A;  1SYH A;  3G3K A;  3ILK A;  3R7X A;  2RIN A;  1F9B A;  4GKJ M;  5CM6 A;  1NNF A;  4YAH X;  4RNS A;  4AG5 A;  1M5D A;  4PET A;  4BLA A;  1P1U A;  2XXH A;  1YTV A;  2G29 A;  3H6V A;  4R6Y A;  3S9E A;  3GRY A;  5KPZ A;  1PJI A;  5E6J A;  3M3F A;  3KFM A;  4XKQ A;  1BIY A;  3N6U A;  5CBS A;  1HNZ M;  4XKR A;  2R45 A;  4L15 A;  1BKA A;  2Q2E B;  2ZYK A;  2YQZ A;  2HL7 A;  1M5C A;  2M60 A;  3FYD A;  5KDT A;  4L17 A;  3WHL A;  4POX A;  3TTL A;  5EP1 A;  1IY1 A;  4X62 M;  2Q2C A;  3DOA A;  5TP9 A;  4LJ9 A;  5DVI A;  1NNJ A;  3ZCB B;  1XXH A;  4GH9 A;  1GL6 A;  5AA4 A;  2I58 A;  2PMS A;  4FJP A;  4U4S A;  2Z4R A;  3FXQ A;  2I3W A;  4RNA A;  1E32 A;  3MJ5 A;  3UGJ A;  1N75 A;  4FAJ A;  1B4H A;  4F2Q A;  3SEX A;  3PPN A;  4IBD A;  1J1N A;  2Z8D A;  3RQT A;  3ZH9 B;  4LJ5 A;  3RGS A;  2CHV A;  4JYA M;  3EHT A;  2KXE A;  2Y21 A;  4NWC A;  2XXI A;  2XXW A;  3A09 A;  4PFW A;  2ERC A;  4ZEK A;  3IG8 A;  3IJX B;  2I4C A;  3DM0 A;  2RC7 A;  1MRP A;  1IN8 A;  2QS3 A;  3GPP A;  4QSE A;  2D21 A;  2HFB A;  1L2C A;  1B46 A;  1FTM A;  5DYI A;  2V93 A;  3GQ4 A;  1NJF A;  4R2B A;  2C9C A;  5JTY B;  5KO3 A;  4I81 A;  2XFT A;  1I69 A;  4FIM A;  4H67 A;  1B51 A;  4X66 M;  3ZC7 B;  2KW0 A;  1WOD A;  1LB9 A;  1MXX A;  4LF8 M;  1W5S A;  2F7B A;  1L2D A;  3E9X A;  1HNW M;  1MY1 A;  3RY3 A;  1G41 A;  2XXU A;  4R6K A;  1JW1 A;  5C1B A;  4F29 A;  5EHM A;  2W82 A;  5EP3 A;  2ANJ A;  5H8Q A;  4Z0I A;  3PUY E;  3RPW A;  1O63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...