3E4RA

Crystal structure of the alkanesulfonate binding protein (ssua) from the phytopathogenic bacteria xanthomonas axonopodis pv. citri bound to hepes
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the alkanesulfonate binding protein (SsuA) from the phytopathogenic bacteria Xanthomonas axonopodis pv. citri bound to HEPES
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 98
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3e4rA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3e4rA02
1B40A 4F3BA 2XHDA 3CSBA 3HHGA 3IJXB 4JSOA 4AB5A 4KYDA 1Y3NA 3VVFA 1N84A 1Z7ME 3FIRA 4IO3A 3CG1A 2QS2A 3TQLA 2ABHA 3C31A 2H9BA 4ZS9A 1IXHA 1NH8A 2OZZA 4IO7A 3EHSA 5CC2A 1MQDA 4IY6A 4POWA 3TELA 1T0KA 1NMUA 3MZ9A 4NF4B 2OCUA 4LQ5A 2DWIA 2RC7A 4DCXA 4MF3A 1PDAA 2ZNTA 3FXQA 4DXUA 3TUSA 1N04A 5CBRA 4KD5A 4EUOA 2RCAA 1UTBA 4IO5A 1P1UA 2QS3A 1O64A 4WEDA 4FEDA 1B1XA 1KWHA 4KPTA 4IY5A 4AB6A 1B51A 4DLDA 3IR1A 3Q26A 3QK6A 1D4NA 1N0TA 3AXFA 2OBGA 2ANJA 1RYXA 2X7QA 3OO6A 3SEXA 3U92A 1TXFA 3PD8A 3RNNA 3PMXA 2O7UA 1SW4A 4PFUA 1NH7A 4OYVA 3MZBA 1GR2A 3G3FA 1B6HA 3RTFB 3S9NC 1ZIUA 4GVOA 4KFQA 2R71A 3VDFA 4E0XA 3KSJA 4F19A 1M5BA 5ISUA 1OVBA 4ND9A 2REJA 3MVZA 4ZZAA 2Q2AA 4JBZA 3N94A 4YKJA 5H8NA 5EHSA 3KG2A 1POTA 3FASA 1WODA 3FVNA 3VFJA 4EXLA 2B3BA 2QL3A 3L6HA 3LSLA 4MFIA 1FTJA 3QSLA 3V89B 2NUVA 4IO2A 4XIGQ 1D3KA 5KDTB 1NNPA 3K00A 1FTLA 2FNCA 2YJPA 2QRYA 2OK2A 3VVEA 4ZECA 1JQFA 4NF6A 1MS7A 1LCFA 3C34A 3HCQA 3MP8A 4G68C 2GFEA 4IGTA 2ZYOA 1LSTA 4ELQA 4QFKA 3N26A 2V3UA 4K3FA 1QJMA 4O3CA 1GV8A 3CR9A 1US4A 2QS4A 3C35A 3DP6A 3UA8A 2ESNA 2Z8EA 4OETA 3ZKKA 3IOTA 1WDNA 1TFAA 3G3IA 3R26A 5AA1A 1S9TA 3KFMA 3M8UA 4QFNA 4Q0CA 1O63A 3TPAA 2F7CA 3S9MC 4FEBA 2Q9TA 3GLBA 1XOCA 2XXXA 2ZYKA 3JV9A 3RY3A 4KCCA 3FVGA 1F9BA 2XX9A 2VGQA 5H8QB 4IB2A 1Y3PA 1B58A 2VP1A 3FXRA 1QULA 1SBPA 1SDXA 4TQUQ 1Y4TA 2QMXA 4ZEFA 4RY1A 3OMBA 5FHMA 4ELOA 5DVIA 5M2VA 2DP8A 4H5GA 5I2NB 1UTBB 3T66A 1RYOA 3CRBA 5EYFA 1PB8A 3KSXA 5BUUA 2DQVA 4I8CA 3I6VA 1AIVA 2GH9A 2ZYNA 2REGA 3ONMA 1R1NA 4H0WA 4U22A 4KI0E 2Q89A 1D9VA 2DE3A 2VD2A 3UORA 4BDLA 4XKRA 2QS1A 1IQ7A 2FA7A 2NXOA 1MXZA 3FJGA 3T9VA 1EZPA 1B3GA 4ESXA 3H6TA 4WXJA 4EF1A 1IZ1A 2HEUA 3PMWA 3DLNA 4YZZA 2D5WA 4F31B 1XVYA 1ZTYA 4NF8B 3T9XB 3V5AA 5K2XA 4BDRA 3C33A 4Q8RA 1EZOA 1I69A 4BDQA 1SD3A 3G7WA 3K1NA 3MQ9A 2P0SA 1BTJA 4FECA 1B7HA 1SW5A 4X1DA 1MDQA 4HS7A 1XC1A 2AL4A 1PBQA 2F6GA 3MVYA 2I4BA 4G4PA 4F3GA 1SQYA 3IORA 4N6PA 2P2AA 2I3WA 1ATGA 1N7XA 2RINA 3OO8A 4U4SA 1MQHA 4YB5A 4R6HA 3VE1B 4BDOA 2D3IA 1SI0A 3HHFA 4FAJA 3TQWA 2M8CA 1MPDA 2HAVA 5K2YA 2B65A 2VOZA 4MBPA 4LZ7A 1B5JA 1ZKBA 3FZVA 4FJPA 3FD3A 4R9FA 1B46A 5AE4A 4YICA 1VE4A 3VV5A 3BFTA 5JTYA 1DPPA 1JEVA 1FCKA 4OERA 4RYAA 5DT6A 3BBRA 1XVXA 3LBSA 1M5FA 4F2OA 2XD2A 4Z7EA 4RPOA 3EF7A 4JSDA 1R9QA 2I48A 3Q25A 5I59A 4G77A 5L9SA 2I58A 2AL5A 3RTWB 5I2NA 3RGYA 1VFDA 3LSXA 4H8IA 1Q35A 3PMVA 4HW8A 3KJ7A 4YKIA 3IOWA 3LC8A 4HCYA 2Q88A 3RPWA 3LSFB 1LAFE 2I0CA 1LFGA 1ZBMA 2DVZA 3CI8A 3GBBA 3DP8A 3I5OA 1LLSA 4YKPA 4MLQA 5CI5A 5DTBA 1B5IA 1O7TA 3TEPA 2PMSA 4Z0IA 1MM6A 2F5XA 2HQ0A 2VD3A 3PUXE 5FHOA 2XX7A 1QW0A 3CFLA 2YLNA 4FE8A 5TP9B 4ZEDA 5L9OA 1SI1A 1IUDA 4QFOA 2QMWA 1MY3A 1MXUA 1I6QA 2THIA 4JWOA 2XXUA 3O6IA 4TLLB 4GRKA 4UA8A 1LBBA 2Y7KA 1AMFA 4ELPA 2KLFA 3EHTA 3HO7A 3PPOA 3H03A 2O1MA 5CRYA 5I58A 3MPLA 3S9LC 3OSRA 2ZYMA 2Q8JA 1B4HA 4R9GA 2IEEA 1L5TA 3FATA 4G8HA 1B3EA 1IEJA 3HPIA 4NWDA 1JEUA 1Y3QA 3ZSFA 1S7YA 5H8HA 3UN6A 2DYXA 2I6EA 3IB1A 4NMYA 4IO4A 2PYYA 4XKPA 3K4UA 3A09A 4WKMA 3FVOA 3WAFA 1RKMA 1AH5A 1Q1KA 2PT2A 4KR5A 4ZZEA 1D9YA 4UACA 3PPPA 3M3LA 1B1HA 1B32A 1I6AA 3EQ1A 3THIA 1ZJLA 1CE2A 1JVYA 2A5SA 3IL1B 4QRZA 5KDTA 2PX1A 3IO4A 4ZEKA 3PUZE 1JW1A 5IKBA 3K02A 2QPQA 1TFDA 4YB6A 4GF8A 4KQPA 1ANFA 4U1ZA 1FTKA 2V3QA 1CB6A 3P7IA 4P0IA 1MH3A 5I59B 1YTVA 2F36A 5B70A 2DWJA 4GQOA 3LSWA 1PC3A 1P1OA 3GXAA 4M4GA 4NF5A 3B6TA 2DOJA 1UTHA 3FXUA 1SYHA 4H8JA 4XKQA 4F39A 3I3VA 5CM6A 1FQEA 3M3KA 3TTMA 4OQOA 2UVHA 1ZU0A 3TODA 1GVCA 3TCHA 3QUJA 3H6UA 3TYHA 4R74A 3S9EA 1MXWA 3RN8A 3O29A 3D4CA 4OZ9A 2Z23A 2Y7WA 1NKXA 2UVIA 4KHZE 3U8QA 2DE2A 3CIJA 1FW0A 1UIUA 2XXWA 4HTGA 3PUVE 4QF9A 3C9HA 1A99A 3MJNA 3USDA 2Y7IA 4BLAA 1UTHB 2AIXA 4PFTA 4R6KA 2ZNUA 2I49A 1NFTA 1M5DA 5ICTA 3O28A 2PBWA 5HM4B 2PVUA 4O3AA 1H45A 3UP9A 3KGCA 1OQHA 1IITA 4NF5B 1P99A 1M5CA 2V3TA 3UGWA 5I2KB 4GWOA 2NOOA 5I57B 3TZAA 2ONSA 1WVJA 3HSTA 1QKAA 3DELB 2HZLA 4P0GA 5I84A 3MP1A 4ZEBA 3K2DA 3U1OA 2XXIA 1BLFA 5H8NB 3CG3A 1SVXB 4R2BA 1P1WA 3IK6B 2O1LA 4JWXA 5AA4A 1USYH 2UVGA 3SETA 1A40A 3KZGA 3PPNA 4QSDA 5BWJA 2W7YA 2F34A 5DVJA 3TMGA 1FTMA 3T9HB 2ONKE 3KN3A 3RT6B 2WKYA 3E9XA 1BKAA 1QUIA 1II5A 4GD5A 3VXBA 1B0LA 2F7AA 4FORA 4N07A 1DOTA 3G3HA 4OTEA 4EXKA 1B2HA 1A54A 3MBPA 4PP0A 2XXHA 5H8QA 1JNFA 3O6HA 4QSCA 5A5XA 5EHMA 2A5TA 2HZKA 3VVDA 3C4MA 4NF8A 4X9TA 2B3FA 3DM0A 4G68A 3CFZA 5AA4B 2QSXA 4IO6A 4U23A 3KJTA 3FJMA 5TPAB 2F6PA 3G3JA 2DSFA 2XXTA 4I9DA 4DIGA 4Q30B 2E0SA 3MC2A 3RT8A 3SESA 5DYHA 3V8XB 1IXIA 2Z8FA 2RF1A 1MM7A 5KCJB 1PB7A 1H43A 3JYRA 4GL0A 4QFPA 5FHNA 4OHNA 4Q5TA 2O6AA 3WAEA 2XXQA 3PUYE 4U2RA 3MWBA 1Y1MA 4OESA 3OENA 4EQ9A 4LUBA 2DS9A 1M5EA 3KEIA 5DEXA 4PFWA 1QUKA 1SYIA 3N5LA 1GGGA 1BP5A 4GLIA 3MVXA 4BDMA 4M1VA 4G8NA 4R75A 1HSLA 4YMBA 3FVKA 1B0HA 2OJTA 3KBRA 3PU5A 3K1MA 4G8MA 3O97A 1HSJA 1NL5A 1US5A 3BKIB 1NNTA 3ECRA 1A8FA 1FQAA 3H7MA 3N6UA 4LZ5A 3Q29A 3S2VA 3SDFA 3SEVA 2V84A 1QVSA 3OD7A 5FTIA 4FATA 3Q27A 4OXVA 3CVGA 4PFYA 4RNSA 5AA3A 2XXPA 3KN8A 1ZLQA 3PGFA 1FTOA 1ELJA 2UVJA 1N7WA 4KYEA 1MXVA 1GTKA 2DXYA 2H25A 3A3CA 3ZS6A 5H8FB 5I56A 3B6WA 3OO7A 4RPNA 3K1PA 4NF4A 3JZJA 2Y7PA 3R7XA 4TOZA 3S4UA 1BIYA 3KOSA 1B9JA 1PEBA 4JWYA 4ELRA 3GBAA 2ALUA 4OFLA 4LP2B 3IB0A 1B3HA 2F7BA 4OEUA 5AA2A 1LFHA 3ZKLA 3EPEA 1R6ZA 3ODBA 4DXCA 3U94A 3IJOB 3QXMA 4MLVA 3MZ1A 4ONYA 4DDDA 5TU0A 1B3LA 2Y7RA 3K6WA 3T93B 4YMAA 5HPQA 2F97A 3QUFA 4OVJA 5CBSA 3FGSA 4H67A 1TWYA 2NWJA 1MDP1 1LB8A 3EHUA 5B7DA 3U72A 2E1SA 2P1SA 4F1UA 4F2QA 1MH4A 4LVQA 4WEPA 3TTNA 5AA2B 1FQCA 1MXXA 4OFJA 4ZDMA 3W9WA 2DE4A 2A5TB 2H99A 1NNKA 2DXRA 2HXWA 3G3KA 1MY4A 2DVCA 4U1OA 5CMBA 2HCAA 3TAJA 2H98A 3C32A 4G68B 1IXCA 2AYSA 3K6XA 4GOTA 4TLMB 4DZ1A 1Z7NE 2I3VA 1PB9A 3OOAA 2D21A 4U21A 2H4IA 5I57A 1Y4CA 3MPKA 3IAZA 2CZLA 2XX8A 3C36A 4OFOA 4X1BA 5ITOA 2Q2CA 4AQ4A 4ZE9A 4NTLA 2RC9A 4OWDA 3H06B 4I62A 3SERA 2LAOA 3TKDA 2O51A 4DXBA 4R2FA 3G3GA 3IX1A 5ITPA 1DTZA 1EZ9A 1QKBA 4GXSB 1I6BA 1MY0A 2UYFA 3H4ZA 4NE4A 3RLFE 3TTRA 1POY1 2HAUA 5CMMA 3EN3A 1P1NA 4YB7A 1MQGA 1MXYA 5TP9A 3TCFA 4F29A 1J1NA 2FYIA 1QUJA 3SKPA 4OMBA 1XS5A 4GL8A 2RC8A 1MQJA 2X26A 1B52A 1LAHE 1OLCA 4H5FA 3LR1A 4GFRA 4RXLA 1N3XA 2I0BA 3VLWA 3PPRA 4C1UA 3MAMA 4EQBA 1H3DA 4R73A 4EQ7A 2R6GE 1ZMGA 3V83A 3OSQA 1B7UA 1FQDA 1A55A 1UIVA 3FV2A 3W9VA 2ZMBA 3T9UA 1A7LA 3OEKA 5JTYB 4PE5B 5F1QA 5FTHA 1P1QA 3B7DA 1VR5A 4JDFA 3QYTA 1LFIA 2I4CA 3SEUA 3E3KA 1S50A 3MP6A 3PV0E 1USYE 5I2KA 1N76A 1DPEA 3TCGA 4ECFA 1OQGA 2GRVA 1AL3A 5H8HB 1URGA 2BJJX 3N6TA 1YCJA 2O68A 4XTCQ 3U93A 2O84X 5KZTA 1LAXA 3T22A 3HV1A 1JETA 3PUWE 2IA4A 4ZE8A 1OIBA 3Q28A 4ZEIA 3IO6A 2GHAA 5H8SA 3VXCA 4C0RA 5I58B 1XT8A 3KOTA 2OWTA 1IIWA 3OXNA 4PQJA 4HCWA 3LUYA 3F11A 1H76A 4X48A 2R9JA 4JXIA 4YU0A 5I56B 5IAIA 1MRPA 4RJZA 2NVUB 3A3UA 5J1DA 4I1DA 5ICQA 1SW1A 3OO9A 5LOMA 1IXGA 5AA2D 3IOVA 3RQTA 3M3FA 1MQIA 2O69A 3H6VA 3OEMA 4JB7A 1R9LA 4O3BA 4R72A 5F7VA 4F1VA 1LBCA 1LCTA 2X7PA 3IOUA 3K0VA 3VLUA 2F8DA 1URDA 3L6GA 2ZXTA 5H8FA 3CFXA 2H5YA 1UQWA 4ESWA 1JW5A 3KN7A 3FUZA 4ISUA 2XD3A 3CSGA 3DP4A 3ILUB 3QIMA 1Y20A 1JVXA 4LATA 4POXA 4QHQA 4LZ8A 5DEXB 3W15C 1MPBA 5JK4A 1YPNA 1EU8A 4DE8A 1SW2A 2ZNSA 1OVTA 4GXAA 5A5XB 2CMOA 2F78A 4THIA 2F35A 1LAGE 1XHYA 4KYSA 4YKKA 1H44A 2VHAA 1Y1ZA 4NWCA 4OEVA 2UXAA 4PETA 4R6YA 4F18A 1MY2A 2O7IA 3O2AA 5TPAA 3E4RA 2ONRA 1FQBA 3MW0A 3O66A 3MUQA 3QAXA 4RA1A 2RCBA 1AOVA 2V25A 1B4ZA 4MH5A 4EF2A 3BFUA 5L9MA 4FIMA 2XXVA 3IB2A 2PT1A 2UYEA 2Z22A 3H6WA 4LQ2A 3ILTB 3MVWA 1VFEA 4H6DA 4QFLA 3UIFA 1DSNA 4RK2A 5JEIA 2QJEA 3D4GA 4KCDA 4F3SA 1FQFA 3HN0A 1N3WA 4XXUA 5CMCA 3SEYA 1B05A 1PBPA 2V93A 3RUMA 2G29A 4GIZA 3R6UA 1YAEA 4H1XA 3TDJA 4F22A 4LA9A 4NF6B 4DCYA 4F1YA 1MG1A 3GZGA 4H65A 1HSEA 4BDNA 4YAHX 2DWAA 1OLAA 4RK9A 2GHBA 3SEWA 2Y84A 1TT1A 1B7ZA 5L8DA 1OMPA 1LGBC 3PD9A 4L17A 1A8EA 1B3FA 4G2ZA 3FV1A 5DVFA 5CMKA 2DWHA 5KCJA 3K01A 4E0WA 3K6UA 3T96B 4P11A 1VSOA 4N13A 3B6QA 1DTGA 2G93A 3E13X 1EH3A 2XXRA 1NNFA 4U4XA 2XXYA 3TTLA 2OLBA 1Y9UA 1URSA 4OENA 3TFLA 3TTKA 5HBCA 4C1TA 2HFBA 1B5HA 3O9PA 2RKMA 4F3PA 3K6VA 2Z8DA 4LONB 1JW4A 4NEDA 5ELVA 4QSEA 2YPNA 4XKNA 3O6GA 3PPQA 1MPCA 1LB9A 1MY1A 3FJ7A 3UK4A 3VLVA 3H3GA 1DMBA 4IGRA 4EDPA 3OELA 2OWSA
chains in the Genus database with same CATH superfamily
3HHGA 3HKPA 2Z4RA 3H4JA 4XGIA 4OU7A 4FD2A 1Z7ME 3FIRA 2ABHA 5F3WA 4ZS9A 1NH8A 2Y20A 4IO7A 3EHSA 1N78A 1VEGA 4GWXA 1NMUA 3MZ9A 4NF4B 2OCUA 1L2CA 2RC7A 1PDAA 4DXUA 3FTFA 1P1UA 4AKHA 4AB6A 1B51A 2HHHM 3U6SA 3AXFA 1RYXA 4NX1A 3OO6A 1XNRM 1TXFA 3PD8A 3RNNA 2Z4SA 3B8BA 1GR2A 3G3FA 1B6HA 4AKIA 2H1RA 2R71A 3BIGA 3SARA 1M5BA 1OVBA 2BJIA 4JBZA 5IZ7D 5EYGA 3HJSA 3VFJA 4EXLA 2B3BA 2QL3A 3EIEA 4KHPM 2QVUA 4MFIA 1DCUA 1FTJA 3QSLA 2QFLA 1NNPA 4LJ6A 4DV7M 2AHMA 4NG7A 4OVPA 2QRYA 4OVZA 2BJVA 5DYGA 1MS7A 2GFEA 2V4CA 3UMMA 2VPOA 1LSTA 4K3FA 3EKIA 4S12A 1US4A 3SHFA 4LCBA 1Z59A 3R26A 3G3IA 5AA1A 5DNYA 4FEBA 2Q9TA 2ZYKA 3FVGA 2DAKA 3W68A 3FXRA 1SBPA 5C18A 4TQUQ 3GPXA 3OMBA 2JXNA 3A29A 4ELOA 1KA0A 4TUWA 3D1RA 1MU5A 4M0WA 2VIIA 1NV9A 2GH9A 3ONMA 4O7MA 4BDLA 2KQZA 3FJGA 3NWLA 2VF7A 4P9KA 4ESXA 4I4LA 8CATA 3DLNA 1YZ0A 4Q8RA 1ZTYA 3C33A 3MQ9A 1BTJA 1VG5A 2UXCM 1Q9DA 1UFZA 2VQFM 1SQYA 1MN3A 2RINA 3CF2A 1N7XA 2N35A 3TWLA 1MQHA 4FAJA 4X04A 2F5NA 5KQ8A 1ZKBA 1FPBA 4FJPA 3RPLA 2UU9M 4RYAA 2CHGA 1L2DA 3BBRA 1PM5A 1NI9A 1HJPA 2XD2A 5EYHA 4QOZC 4Z7EA 3Q25A 2XWKA 2KEBA 1VFDA 2EUCA 3IG5A 4LZZA 3KJ7A 4N4UA 3C58A 2Q88A 1LFGA 3I5OA 4YKPA 5DTBA 1HQYE 1LLSA 3ZCBB 1NUWA 1C7YA 4LJ4A 3E21A 3PUXE 1QW0A 3CFLA 2YLNA 4ZEDA 1SI1A 1IUDA 2QMWA 4G6ZA 2MH8A 5KQDA 4GKKM 4ELPA 1EFUB 3MPLA 1LTMA 2ZYMA 3OSRA 5FBPA 1L5TA 2Y21A 3ZSFA 4PAKA 4IO4A 4XKPA 3K4UA 3A09A 3Q8GA 3FVOA 3WAFA 1RKMA 1OIPA 4ZZEA 4GC9A 2Z3XA 1GO5A 3PPPA 4O94A 1B1HA 3THIA 1OKSA 3FD9A 3GRVA 1TDHA 4MJOA 3PUZE 1JW1A 1V34A 5IKBA 4YB6A 5I59B 3P7IA 1IY1A 1YTVA 2F36A 3W67A 2DDKA 4GQOA 4M4GA 3FXUA 1UTHA 2VT5A 4XKQA 4F39A 4PD2A 3HX3A 3A46A 1ZU0A 2UVHA 1GVCA 3QUJA 3HGIA 2CEYA 1PJQA 3U8QA 2UVIA 3B74A 4JN6A 3EIHA 1AUAA 2XH9A 2EA0A 1UTHB 3PFIA 1NFTA 4BLCA 2FIEA 3O28A 1H45A 3D8LA 4AQYM 2L6OA 5EQ8A 2JY6B 1IITA 1P99A 2C98A 2V3TA 2CZHA 5I2KB 5I57B 3TZAA 3B9PA 1WVJA 3FUXA 5I84A 2LVPC 1WR1B 3J81S 1BLFA 4R2BA 1PJIA 5AA4A 4JWXA 2DZOB 2HXRA 3PPNA 1J7KA 4ANRA 4M9ZA 1BKAA 2NQ8C 1WIVA 4FORA 4FWDA 3G3HA 4OTEA 3KBZA 5FLXS 4DV4M 4PP0A 3RE8A 2HL7A 4P3LA 2HZKA 1IN7A 3C4MA 5ITRA 5LTCA 2LVNC 2F5SA 3FTDA 4IO6A 2CZIA 3FJMA 2F6PA 3G3JA 2C9OA 4II7A 2E0SA 3MC2A 3V8XB 3SYLA 1IMCA 1ZMWA 1IXIA 2J7OA 2KNAA 1OFHA 2UUBM 3MWBA 5A5LA 2DAIA 1R2YA 1QUKA 4XF5A 2C96A 4BDMA 3LQRA 4MGHA 4R75A 4G8NA 1B0HA 4H46A 1HSJA 2KDLA 3TWKA 1FBHA 4PFYA 1IN6A 4RNSA 3KN8A 3PGFA 2QVRA 4KYEA 1XXHA 1GLNA 5ITUA 1I94M 1VEKA 1R2ZA 1BIYA 1OIZA 2ALUA 4OFLA 4LP2B 2F4VM 4OEUA 5AA2A 4MLVA 3J27B 3KDSE 3L25A 4YMAA 4L15A 1LBWA 4OVJA 1FJ9A 4LN5A 5CBSA 4NL4H 2NWJA 1EYIA 1LB8A 4F2QA 1XI6A 1MH4A 4LVQA 4WEPA 3TTNA 1FQCA 1MXXA 4OFJA 3W9WA 1XMQM 3G3KA 4U1OA 1MY4A 2XFSA 4LFCM 2HCAA 1IXCA 1Z7NE 3GLIB 4U21A 1Y4CA 3IAZA 2Q2EB 2CZLA 2I7NA 4ZE9A 4AQ4A 3H06B 2LAOA 4HE1A 3G3GA 3IX1A 1EZ9A 4GXSB 3RLFE 3TTRA 1MJGM 2ZANA 4F29A 1ZAEA 1XS5A 1CUKA 3B7ZA 4GL8A 4PDHA 3VLWA 1LAHE 3GYYA 4H5FA 2WYKA 5EQAA 4EQ7A 2O5RA 3OSQA 1FQDA 1UIVA 4MNIA 3IFAA 5JTYB 2RRUA 4GEWA 1VR5A 2LTUA 3SEUA 3GLGB 3E3KA 1GABA 3PV0E 4L6V6 3HU2A 1PJJA 1NJGA 1FRPA 3MMPA 4YY3M 3U93A 3MSTA 2XLJA 1LAXA 4ZE8A 3SMSA 3KOTA 2ZM6M 1H6UA 4JXJA 4P56A 4RJZA 3A3UA 5E6JA 1XHBA 1SW1A 4LY6A 5LOMA 3M6AA 2O69A 3H6VA 3OEMA 3VLFB 1R9LA 4O3BA 4R72A 5F7VA 3S9EA 1LBCA 2F8DA 3L6GA 4FW9A 4L4UA 4LF5M 4ESWA 1JW5A 4NAPA 2F3BA 3KN7A 3FUZA 4ISUA 3QIMA 3GRYA 4QHQA 5JK4A 4IBIA 4OVRA 3SASA 1XHYA 2JP7A 1TDZA 4KYSA 1Q3BA 2UXAA 4JI6M 2FH0A 1MY2A 2C99A 3E4RA 3KS4A 1QUSA 1FQBA 3O66A 4RA1A 1DO0A 3UZUA 2V25A 1B4ZA 4MH5A 4EF2A 5L9MA 1SXJC 3ILTB 4I81A 1P3QQ 4MGIE 1FQFA 4XXUA 1N3WA 1B05A 2G29A 2KRKA 2EJSA 4N91A 2JUJA 4DCYA 1QAQA 3HJQA 4GWYA 3GZGA 4H65A 1OLAA 4M9SA 3SEWA 4MGYE 1B7ZA 5L8DA 1OMPA 4G2ZA 2R18A 3HU1A 5IWAM 3K6UA 5IZZA 4N13A 1DTGA 2G93A 4DV1M 3TFLA 3TTKA 5HBCA 1DGGA 2CWBA 1NVMA 4GITA 3HHXA 3LVWA 2XWIA 5BPVA 3U5ZB 5EXTA 1MY1A 3UK4A 2HWJA 7CATA 3FBPA 4IGRA 2X49A 3MK6A 2L4EA 4JSOA 4KYDA 3KS8A 2YNMD 1Y3NA 1NNUC 3CG1A 1IY0A 2QS2A 3TQLA 2H9BA 2F5QA 3LW5F 1MQDA 4IY6A 4H45A 2R45A 4GWUA 2DWIA 3E79A 1TH3A 4EUOA 2RCAA 1UTBA 4IO5A 3JAMS 2QS3A 1O64A 4KPTA 1KWHA 4IY5A 4X65M 2OBGA 5BR8M 1OFIA 2KW0A 5IZ3B 3PMXA 2O7UA 1SW4A 1GKIA 1TTEA 1X37A 4OYVA 3MZBA 2V1CA 3RTFB 3GLIA 2ZTCA 1ZIUA 3S9NC 5DW8A 3KSJA 4F19A 2CE7A 1DGHB 4ND9A 4R3DA 1NY5A 4NOOB 5EHSA 2Q74A 3KG2A 5H8NA 1DO2A 1WODA 5EP4A 2NUVA 4IO2A 4XIGQ 4LJ9A 3K00A 3SATA 3L27A 4HXVA 1WGNA 1A5TA 3MP8A 4IGTA 4ELQA 2BWEA 2V3UA 3VKGA 2KNVA 3DP6A 4OETA 3ZKKA 1WDNA 5FSWA 1F4IA 3M8UA 1NV3A 3S9MC 4GHLA 2F7CA 3GLBA 4OVQA 1NHWC 3AFHA 3JV9A 1F9BA 2VPNA 4IB2A 3UGJA 2WYPA 4BB9A 3MYUA 1Y4TA 4OA4A 4ZEFA 2HHMA 3L29A 4FCTA 3KC0A 5DVIA 2W82A 2DP8A 4H5GA 2X8AA 1D0MA 1PB8A 3FTEA 3KSXA 1IBMM 4IBDA 2DWNA 5BUUA 4U22A 4H0WA 4WURA 2REGA 4G61A 4KI0E 2Q89A 5EJCA 1MXZA 2BJWA 3H6TA 1IZ1A 2MJ5B 1Y8GA 2D5WA 1N36M 4F31B 1XVYA 3T9XB 3V5AA 4BDRA 2HCBA 1SD3A 3K1NA 1OJLA 1XWIA 1B7HA 4X1DA 1MDQA 5EP2A 1PBQA 2F6GA 3H4MA 3IORA 2EKFA 2DNAA 2YR0A 1ATGA 1TGUA 3OO8A 3K8ZA 4N6PA 4U4SA 4YB5A 2JY5A 3VE1B 4BDOA 1SI0A 3HHFA 2M8CA 2HAVA 5K2YA 5EP3A 4MBPA 1B5JA 1QGXA 3FZVA 4R9FA 4AW4A 4LRSA 2DHYA 4YICA 3VV5A 5J16A 4P17A 5JTYA 1DPPA 1JEVA 1IMEA 4OERA 1R7RA 1OAIA 3EF7A 1R9QA 2I48A 3RTWB 1WHCA 3LSXA 3QAUA 3PMVA 1FBGA 2OO9A 4KLNA 4HCYA 3RPWA 1LAFE 3GBBA 3DP8A 1TH4A 1B5IA 1LV7A 1O7TA 2PMSA 2EKKA 1FPKA 2HQ0A 1OQYA 3TL4X 1TF0B 2BWBA 1I4WA 2THIA 2XXUA 3O6IA 4UA8A 1LBBA 2L2DA 3S9LC 3C3DA 2LH0A 2CFOA 4R9GA 1VDDA 3FATA 4G8HA 1D0LA 1B3EA 3HPIA 4DI4B 1Y3QA 2D7HA 4LF9M 4MNCA 4MEVA 1QZMA 2PT2A 2J7NA 2K6BA 1D9YA 4UACA 1I6AA 1B32A 4N6KA 1K3WA 4KO8A 4JVIA 4PF6A 2QPQA 4KQPA 1ANFA 2V3QA 2CV2A 4P0IA 3LSWA 2UUCM 3THGA 3B6TA 1SYHA 4GWSA 2DKLA 2E5LM 3I3VA 3M3KA 4MIJA 3H6UA 1W5TA 3TYHA 3O29A 3B89A 2R65A 1T43A 2Y7WA 4OZ9A 3WHKA 1UIUA 4QF9A 1INPA 4JI8M 3MJNA 3USDA 2Y7IA 4BLAA 2AIXA 2Y5KA 4PFTA 4R6KA 2ZNUA 3MJ5A 2PBWA 3UP9A 1KA1A 1OQHA 3DA1A 3LVVA 1QQWA 2L4FA 2I7PA 4GWOA 2KZUA 2LXEA 3AL0C 1NUYA 3DELB 2HZLA 1KFVA 3MP1A 4ZEBA 3K2DA 1YSYA 2XXIA 4XEQA 3CG3A 3T6PA 1P1WA 1QDTA 4LZJA 3L2AA 4FWGA 4XFEA 2DAMA 4D82A 1EE8A 2G3QA 5BWJA 3SMPA 2F34A 2WKYA 3VXBA 1B0LA 2F7AA 1DOTA 4QOSA 1B2HA 1A54A 5KPTA 3VDUA 2O01F 4GKJM 2A5TA 3VVDA 2PFZA 4X9TA 5EXSA 2B3FA 4G68A 5C1BA 5AA4B 2M60A 3JR5A 1K9YA 2XXTA 1MX0A 1E32A 4Q30B 2YQZA 2PFYA 4DR5M 2RF1A 3FUTA 3JYRA 4GL0A 4QFPA 3U6LA 2O6AA 4IBJA 2XFTA 4B3MM 3T0JA 4EQ9A 2DS9A 4DUYM 1SYIA 4PFRA 2P5TA 1GGGA 2FFJA 4CJ6A 3FVKA 2OJTA 4G8MA 3K1MA 3UORA 5H8FA 1NL5A 3BKIB 1N75A 1A8FA 1HQCA 5FTMA 3OD7A 2QCUA 4PFIA 3CVGA 3LQQA 4GRIA 1FTOA 1ELJA 3A3CA 4NXNM 1EYKA 3R8FA 5H8FB 2WZJA 3K1PA 4PDDA 4NF4A 3R7XA 1QDRA 2P3NA 3V76A 3IB0A 1LFHA 2QHOB 1K9ZA 3AOEC 3ODBA 4JI5M 3U94A 4PDIA 4ONYA 4DDDA 1OAOC 3K6WA 3T93B 3QUFA 3FGSA 2Z8YM 4UABA 3KOZE 5AA2B 4JI4M 3KP0E 2QZ4A 3SAUA 2XGNA 2A5TB 1NNKA 5CMBA 2H98A 1RDXA 2OOBA 2AYSA 4TLMB 3U5ZA 3SAVA 2I3VA 2HAKA 3U60B 5I57A 2K47A 2XX8A 3SFZA 4OWDA 4MHFA 3SERA 3TKDA 3KFUG 1QKBA 5DFLA 1I6BA 2UYFA 2FS1A 3HY5A 2UUAM 4PCZA 4B7FA 4YB7A 1MQGA 3SKPA 1QUJA 4IJFA 1QANA 2D7GA 2RC8A 1MQJA 3LR1A 4GFRA 3PPRA 4C1UA 3MAMA 4HEOA 2OOAA 3FV2A 3T9UA 3BBZA 5FTHA 2C9CA 4PBQA 4JDFA 4R71A 1LFIA 4RKUF 2JWSA 1S50A 3Q8XA 3TQSA 4PE3A 2G5GX 3ILKA 2Y0QA 2GRVA 3FXBA 1URGA 2BJJX 4FCVA 2O68A 4X62M 5EXPA 5KZTA 3PUWE 3Q28A 4ZEIA 2Q8MA 2GHAA 2CZKA 1N77A 1XT8A 2OWTA 1IIWA 3OXNA 1W5SA 3CTWB 4LF7M 3LUYA 4HCWA 2L5VA 5IM2A 4YU0A 2V6ZM 4I1DA 3FUUA 5ICQA 3M0EA 1NV2A 3GPPA 3IOVA 3RQTA 1MQIA 1YXIA 4JB7A 4DV0M 2R0IA 1FBFA 4OANA 4F1VA 2X7PA 1LEVA 2ZXTA 2H5YA 2XSZD 3IFCA 2XD3A 1WJ7A 3DP4A 1Y20A 4POXA 4LZ8A 1MPBA 4ZPXA 2FE8A 1K82A 4DE8A 2XWOA 2ZNSA 2KR0A 4THIA 2F35A 3FKEA 2CEXA 4NWCA 1DGFA 3A45A 4OX9M 3MW0A 3UJNA 3RFWA 2XXKA 1AOVA 3PXGA 3BFUA 3KVWA 1IN5A 3IB2A 2Z22A 3UIFA 3MVWA 4H6DA 4IBFA 1Q02A 3KOYE 3U60A 4L78A 5IGAA 2QJEA 3D4GA 4KCDA 2KA6B 4JV5M 1LBXA 1PBPA 4H1XA 3TDJA 4LA9A 3LMMA 1MG1A 4A3VB 5ET7A 4MB7A 1HSEA 3K2LA 4BDNA 2LHCA 1VDWA 4OVSA 4P1LA 1QAOA 3GRUA 3VKHA 2XEPA 3PD9A 1B3FA 1A8EA 3CF0A 4RF1A 3FV1A 5KCJA 4ITQA 1VSOA 1IMAA 1HT2E 1EH3A 3TTLA 3PVSA 2XXYA 3J7BA 4OENA 3K9PA 2HFBA 1B5HA 3O9PA 4F3PA 3K6VA 2Z8DA 4NEDA 3O6GA 2V1UA 3FJ7A 2JNHA 2DZNB 2QPAA 4EDPA 1NV7A 2DWLA 2OWSA 4PF8A 2WEFA 4DBGB 1B40A 4F3BA 1QYRA 1XB2B 3CSBA 1Z5AA 1N84A 4IO3A 3C31A 1IN4A 1IXHA 1SXJA 2OZZA 2P3VA 4POWA 3TELA 4DR7M 4P47A 4DCXA 1HT1E 4MF3A 1N04A 5CBRA 3I51A 4FEDA 1B1XA 2LBCA 3CF6E 1G71A 1WGLA 2KXEA 4GIPA 3IR1A 3QK6A 4DLDA 1N0TA 1C1KA 4NXMM 3KW6A 2ANJA 2X7QA 1DBZA 1NH7A 4MAGA 1R4GA 4DR3M 2WBDA 3VDFA 4E0XA 4MMPA 3SHGB 5ISUA 4NN3A 4ZZAA 3HHWA 5EQTA 1D9QA 1POTA 4Q7JA 3FVNA 1IXRC 3L6HA 4N17A 4GWWA 2GNOA 5KDTB 1FTLA 2YJPA 3VVEA 2OK2A 4NF6A 4GC5A 1FJ6A 1LCFA 1D2NA 4G68C 3VK8A 4QFKA 3N26A 1GV8A 1QJMA 4N6DA 3U6PA 1T3TA 3FTCA 4R7GA 3TE6A 3CR9A 1GJTA 3IOTA 1TFAA 1S9TA 4B7GA 4QFNA 4Q0CA 1RDYA 3TPAA 1N33M 5GKNA 1XOCA 4NQ8A 2XXXA 4KCCA 2XX9A 2VGQA 2WSCF 1Y3PA 2VP1A 4DUZM 1SDXA 2KHHA 2DHRA 5M2VA 1JR3E 3IHPA 3GQ3A 1BVSA 3GPYA 2C5RA 1FPGA 5I2NB 3T66A 1RYOA 4AS4A 2ZAOA 3FRIA 5EQ7A 2XA5A 1D9VA 2Y5LA 2VD2A 4XKRA 2FA7A 5ITXA 2NXOA 1ZMVA 3T9VA 1EZPA 1B3GA 1QUTA 3HU3A 4EF1A 3KC1A 1FBEA 3PMWA 4L16A 2R8TA 4YZZA 2CV1A 3LV0A 5K2XA 3ZQJA 2MR9A 3G7WA 4FECA 5LDZA 1XC1A 5ET5A 4G4PA 2I4BA 4F3GA 2MROB 4DR4M 4R6HA 1G0IA 3GLFB 5IZ3A 1MPDA 2VOZA 4MX6A 4PAIA 4LZ7A 5AE4A 4IBBA 4QNMA 4B7HA 1VE4A 1NV0A 1FCKA 4MGZE 1XVXA 3LBSA 1M5FA 4RPOA 4JSDA 5I59A 5ET6A 2AL5A 3QWLA 5I2NA 3RGYA 3AOGA 2ZAMA 3IG8A 1NO1A 1Q35A 5ESYA 4HW8A 4N8YA 3LC8A 2I0CA 2DVZA 1ZBMA 3U1OA 3CI8A 3U6OA 5ET8A 4Z0IA 1MM6A 2XX7A 5TP9B 3BXWA 1I6QA 4WW0A 4JWOA 4TLLB 1AMFA 3HO7A 5CRYA 5I58A 3PPOA 3H03A 3M7GA 1B4HA 2Q8JA 2IEEA 4NWDA 4JI3M 1S7YA 4RF0A 5H8HA 2DYXA 3IB1A 4NMYA 1Z5CA 1AH5A 1VDLA 4QHTA 4KR5A 1FPFA 2DAEA 3NOHA 3M3LA 3EQ1A 4X8RA 2A5SA 4LJAA 3PNYA 2PX1A 3IO4A 5KDTA 3SC3A 3SAWA 4NC6A 2QBYB 4GF8A 1FTKA 4DV5M 3I04M 3NBXX 1CB6A 1MH3A 4I3YA 1LBZA 2ZZWA 4HE2A 3GLFE 1P1OA 3GXAA 4NF5A 3I4YA 5CM6A 2DOJA 4H8JA 3TTMA 3L28A 4OQOA 3U65A 2JA2A 1E94E 3TCHA 3RN8A 3D4CA 4KHZE 1XMOM 1TH2A 1QVRA 2XXWA 3CIJA 4HTGA 2KZSA 1A99A 3C9HA 4G4OA 4X64M 3RGSA 2B4LA 3HJ8A 5HM4B 2PVUA 3KGCA 3FRHA 4N15A 4FWHA 4NF5B 3MHVC 3UGWA 2ONSA 2OQ4A 3HSTA 1QKAA 4QXDA 4P0GA 4PBHA 4GX4A 2CHVA 1FBCA 5H8NB 4CGYB 3GLFA 1SVXB 1DV0A 3IK6B 2O1LA 5ITYA 3J80S 2ZZXA 2UVGA 3SETA 4GMQA 1IN8A 3KZGA 4PCDA 2W7YA 3TMGA 3T9HB 2ONKE 3KN3A 3RT6B 4PGPA 3E9XA 1II5A 4GD5A 4NGUA 2KRUA 4N07A 1ZQ9A 3MBPA 1TR8A 2JZ1A 1ZMUA 2QSFX 3GRRA 4DV6M 1JNFA 5A5XA 5EHMA 4NF8A 3DM0A 5I3SA 3CFZA 2K0BX 3KJTA 4I9DA 3DFZA 2DSFA 2RGOA 1JP4A 3RT8A 5KCJB 1MM7A 1PB7A 1FPDA 4U2RA 3OENA 4LUBA 1M5EA 5DEXA 4AG6A 5EXXA 4M1VA 2JJKA 3PU5A 1XXHB 2FNAA 4LZ5A 1FQAA 3SDFA 3Q29A 4DR1M 2F3DA 1IY2A 1QVSA 4Z8XA 5FTIA 3J7AS 4FATA 1PGYA 4OXVA 1Q39A 5AA3A 2XXPA 1ZLQA 4QHSA 2LHGA 1N7WA 2UVJA 3ZS6A 1E9SA 3GP1A 2DXYA 5I56A 2Z7JA 3JZJA 4TOZA 2X4AA 1LBVA 1B9JA 4JWYA 4ELRA 3GBAA 2CHQA 4M9XA 1B3HA 2F7BA 5T3JA 3ZKLA 3OTOM 3IJOB 5I5PA 5I7IA 3T1HM 5TU0A 1B3LA 2RGHA 1IFYA 2Y7RA 2R44A 4O7IA 1IBLM 4LF4M 5B7DA 4Y28F 1MDP1 2QVVA 2E1SA 4F1UA 1BK4A 1PRBA 2DE4A 2DXRA 5LMUM 4GBVA 2L7HA 4G68B 4REZA 4GOTA 2JY7A 1PB9A 2D21A 3KXEC 1N32M 5ITOA 1S3SA 2RC9A 3CHGA 5ITPA 2XWVA 4NE4A 1MY0A 2HAUA 5KO3A 2OWZA 3T1YM 3TCFA 1J1NA 2FYIA 1SXJB 4OMBA 3VFDA 2X26A 2CRUA 4EQBA 4KT0F 1H3DA 4DI3D 4R73A 3V83A 4XBOA 1A55A 3E78A 1A7LA 3OEKA 4PE5B 5F1QA 2UXBM 3B7DA 3TWMA 3GQ4A 1USYE 1DPEA 4BBAA 5H8HB 1AL3A 1IBKM 1YCJA 3N6TA 4XTCQ 2O84X 3T22A 1JETA 1OIBA 3IO6A 5H8SA 1NSFA 5I58B 2G8LA 1IQPA 2ZTDA 1H76A 2KNZA 2FVZA 4X48A 4KODA 4JXIA 3U61A 2NVUB 1EYJA 3GLGA 2VDBB 3OO9A 4QBAA 1IXGA 2CV0A 5AA2D 3M3FA 2WBBA 1LCTA 3K0VA 3VLVA 5FTLA 4N8GA 1GL6A 3CFXA 4IIWA 1UQWA 1PJSA 3SBJA 3CSGA 4M0DA 3ILUB 1NV5A 4HE0A 4LATA 4CISA 3W15C 1XXHE 2WX9A 1YPNA 1EU8A 1HR0M 3ROJA 1FPIA 4GXAA 5A5XB 2CMOA 4PTKA 3CGWA 4PT5A 2J5YA 4DV2M 4NF0A 4YKKA 4AKGA 2VHAA 1Y1ZA 2YFQA 4GBWA 3O2AA 3GLHE 5TPAA 1KZ8A 1DGHA 3QAXA 2RCBA 2GQFA 2H5XA 4MCOA 4NRWA 2MKZA 1YUBA 5F24A 3WHLA 4LGYA 2XXVA 5ITTA 3H6WA 4QFLA 3QMFA 1VFEA 4FBPA 1DSNA 4O8MA 4IBGA 4B3RM 5JEIA 5KPRA 3HHZA 4F3SA 1J09A 4GIZA 1YAEA 1D0KA 4QNRA 5A2QS 4F1YA 1FSAA 4YAHX 2DWAA 2GHBA 2LWXA 2Y84A 1QAMA 1K3XA 5DVFA 1QZEA 1UM8A 2DWHA 1NNJA 4E0WA 3VDPA 3B7NA 3U61B 3T96B 3B6QA 3QYBA 1NNFA 2OLBA 1Y9UA 4D80A 1OTRA 3F92A 2RKMA 2JZ0A 3E9SA 4LONB 5ELVA 3T15A 4XKNA 2YPNA 4I3EA 2XZFA 3PPQA 1IMDA 3KOXE 3H3GA 2LVAA 5DYIA 2XHDA 3IJXB 4HL4A 4AB5A 3VVFA 4NRVA 4PAFA 5CC2A 3R9XB 1T0KA 2FHYA 4F2LA 4LQ5A 3GLHB 2ZNTA 3FXQA 3TUSA 4KD5A 1L2BA 5FTKA 4WEDA 1FBPA 3Q26A 2FOIC 1D4NA 4G4NA 3LCVB 2FIXA 3BOSA 4L8RC 2D7EA 3SEXA 3U92A 1G8PA 4KXPA 5JI3E 4PFUA 2ERCA 2BNKA 1Z5BA 5FTJA 4N81A 4GVOA 4KFQA 3ZH9B 2REJA 3MVZA 2Q2AA 4YKJA 3N94A 3UK6A 4YHHM 1FPLA 1GVNA 3FASA 3W0FA 3TPZA 2QQ8A 3LSLA 3V89B 1D3KA 1IMBA 1IXSB 2PCRA 2FNCA 3LUZA 4ZECA 1JQFA 1SXJD 1HNWM 3C34A 3HCQA 3RGPA 2L7IA 2ZYOA 4O3CA 2CUZA 4W5WA 2ZBKB 1L1TA 2QS4A 3C35A 3QYEA 3UA8A 2ESNA 2Z8EA 1G3IA 3KFMA 1O63A 3GLGE 4NHBA 4LJ8A 3GPUA 3RY3A 5H8QB 1B58A 1QULA 1VQ1A 1V92A 1JQJC 2QMXA 1FPEA 4PGNA 4RY1A 4B3SM 5FHMA 1PJTA 1UTBB 3CRBA 2HPGA 5EYFA 4DR6M 4IBKA 4P16A 2DQVA 3I6VA 4I8CA 1AIVA 2ZYNA 1R1NA 5IZ1A 2DE3A 2JY8A 2R46A 1HNXM 2QS1A 1IQ7A 2VF8A 4Z6YA 1FTAA 3KP1E 3U6EA 3JR4A 1XNQM 3NBIA 4WXJA 1FJGM 2HEUA 3K9OA 4LFAM 3T1BA 2DENA 4NF8B 1EZOA 4GX3A 1I69A 4BDQA 2GQ1A 2P0SA 4JI7M 4I5SA 1SW5A 4HS7A 2AL4A 3ISPA 3MVYA 2P2AA 2I3WA 4K0KM 3A42A 4P1EA 2D3IA 5L8RF 3TQWA 2QENA 4RNAA 2B65A 1RDZA 1ORYB 5LMNM 3FD3A 1B46A 1XC8A 3L26A 3BFTA 2LNHC 3B7QA 4F2OA 5L9SA 1NUZA 4G77A 2I58A 4H8IA 3ZC7B 4F1IA 3RPLB 4YKIA 3IOWA 3DZDA 2XSZA 3K1JA 5FTNA 3HFUA 3LSFB 1IXSA 4XK8F 3GO8A 4MLQA 5CI5A 3T38A 3IECA 2DI0A 1CNQA 3TEPA 3J2PB 2F5XA 2VD3A 5FHOA 4FE8A 1NUXA 5L9OA 4QFOA 1WXQA 4I8OA 1MY3A 1MXUA 4LJ5A 4GRKA 2Y7KA 2KLFA 3EHTA 2O1MA 3KOWE 1DGBA 2R4EA 4G3OA 1IEJA 1JEUA 3UN6A 2I6EA 2PYYA 2QBYA 4WKMA 3D8BA 1IM2A 1E9RA 1Q1KA 4MM3B 1NV4A 1ZJLA 5E26A 4JYAM 3PNVA 1IMFA 1CE2A 1JVYA 3IL1B 4QRZA 5JI2E 4ZEKA 3K02A 1TFDA 4U1ZA 2APLA 2R62A 5B70A 1GL7A 2DWJA 1PC3A 4WP2A 1R5LA 4NSOB 1NY6A 1FQEA 2WSEF 3TODA 4R74A 1GJSA 1MXWA 3AJIB 2Z23A 1NKXA 2DE2A 1FW0A 3PUVE 5H37D 2L09A 1SPIA 2I49A 1M5DA 5ICTA 2R4JA 4IR8A 4O3AA 4LG2A 1M5CA 2NOOA 4OVZB 4FCWA 2DAGA 1USYH 1A40A 4AS5A 4QSDA 5DVJA 1FTMA 2F5OA 1QUIA 2LVQD 3B50A 1NV6A 2XXHA 5H8QA 4IJEA 3O6HA 4QSCA 3HWSA 3GQ5A 2CEAA 1AWBA 2QSXA 2K9DA 4U23A 5TPAB 4DIGA 4HLQA 3SESA 2WSFF 5DYHA 2Z8FA 4NSRA 1H43A 1LBYA 5FHNA 4OHNA 4Q5TA 4LF8M 3WAEA 1KSFX 2DVWB 2XXQA 3PUYE 4MNPA 1Y1MA 4OESA 3KEIA 4LFBM 4P8BA 3N5LA 4PFWA 4OW0A 1BP5A 4GLIA 3MVXA 1JB0F 1HSLA 4YMBA 3KBRA 4EXKA 3O97A 1US5A 1ZV1A 3ECRA 1NNTA 3H7MA 3N6UA 5DT6A 3S2VA 1NJFA 3SEVA 3FUVA 2V84A 1JR3A 3U6MA 3RYDA 3Q27A 1FNNA 2FBPA 1MXVA 1GTKA 1R6BX 2H25A 3B6WA 3OO7A 3LCUA 4RPNA 2Y7PA 3S4UA 3KOSA 1PEBA 4OVTA 5IT9S 3SZPA 2XF3A 3EPEA 1R6ZA 4DXCA 3QXMA 3MZ1A 2CP8A 3E46A 5HPQA 2F97A 3AKZA 4H67A 1TWYA 3EHUA 3U72A 5ITQA 2P1SA 3FUWA 4DV3M 2QP9X 4MH0E 3C9PA 4ZDMA 2H99A 4X66M 2HXWA 3TAJA 1FBDA 2DVCA 5ITXE 2M5ZA 2OX3A 3C32A 3A98B 3K6XA 4DZ1A 2UXDM 3OOAA 4JVDA 2H4IA 3MPKA 4B08A 3C36A 4OFOA 4X1BA 2Q2CA 3C3EA 4NTLA 4DXBA 4I62A 2O51A 1KYIA 4R2FA 2XZUA 1DTZA 1DK4A 3H4ZA 4LF6M 3U6CA 1EIJA 1POY1 2B4MA 5CMMA 3EN3A 1P1NA 4CIZA 1MXYA 5TP9A 3W0LB 2A5YB 1L8QA 4B3TM 1G0HA 4JVCA 3BIHA 2DZLA 1B52A 3AV0A 1AIPC 1OLCA 4RXLA 1RU3A 1N3XA 2I0BA 1L1ZA 1FPJA 3K92A 2R6GE 1ZMGA 4PFBA 1B7UA 4I40A 2QNJA 3DOAA 2ZMBA 3W9VA 3AOEA 1P1QA 1G4AE 3QYTA 2I4CA 3U6QA 4JI2M 3MP6A 5I2KA 1N76A 5KPZA 3TCGA 4ECFA 1OQGA 4LGMA 4G4RA 4FVMA 4DR2M 1Z6TA 4UN2B 2EO2A 3HV1A 2IA4A 3U6DA 3VXCA 4C0RA 2OPFA 4JI0M 4PQJA 2VQEM 3F11A 1YLAA 4AZFA 2ZZVA 2R9JA 2DWMA 5I56B 5IAIA 1MRPA 5J1DA 2O25A 2MGWA 2DXIA 1NHGC 3IOUA 1URDA 4LRTA 3VLUA 2DWZB 3VK7A 1JVXA 5DEXB 1G41A 4PC9A 1NV1A 4G4QA 1JR3D 1SW2A 1OVTA 2F78A 3I01M 4MGKE 4EIWA 1LAGE 4GX6A 1T6OA 1H44A 1VEJA 4OEVA 4R6YA 4PETA 4F18A 2O7IA 2ONRA 3MUQA 1NV8A 3HHYA 2Y0TA 1G59A 2B3TA 3FYDA 3FYCA 3GLHA 4IBEA 1N34M 1YYZA 2PT1A 2UYEA 4FIMA 4LQ2A 1Q3CA 4RK2A 1SG9A 3HN0A 3SEYA 5CMCA 4JI1M 2V93A 3RUMA 5EQ9A 3FE3A 5EP1A 4PDGA 3R6UA 4AG5A 4F22A 4NF6B 1V33A 2R6FA 1YE9A 3HZJA 1HNZM 4RK9A 2HKJA 4LJ7A 4GHAA 1TT1A 1LGBC 4GWZA 1SXJE 5IREB 3SYKA 4L17A 5CMKA 3K01A 2RKOA 4IBCA 4P11A 4GH9A 3E13X 2LVOC 2XXRA 4U4XA 1URSA 4C1TA 4AI6A 1JW4A 2F5PA 4D81A 4QSEA 3PTYA 1J5EM 3I4VA 1MPCA 1LB9A 1IXZA 1DMBA 3OELA 4CHTB 3GLIE
chains in the Genus database with same CATH topology
3HHGA 3HKPA 2Z4RA 4XGIA 4OU7A 4FD2A 1Z7ME 3FIRA 2ABHA 5F3WA 4ZS9A 1NH8A 2Y20A 4IO7A 3EHSA 1N78A 1NMUA 3MZ9A 4NF4B 2OCUA 1L2CA 2RC7A 1PDAA 4DXUA 3FTFA 1P1UA 4AKHA 4AB6A 1B51A 2HHHM 3U6SA 3AXFA 1RYXA 3OO6A 1XNRM 1TXFA 3PD8A 3RNNA 2Z4SA 1GR2A 3G3FA 1B6HA 4AKIA 2H1RA 2R71A 3SARA 1M5BA 1OVBA 4JBZA 5IZ7D 3HJSA 3VFJA 4EXLA 2B3BA 2QL3A 3EIEA 4KHPM 4MFIA 1FTJA 3QSLA 1NNPA 4LJ6A 4DV7M 2AHMA 2QRYA 4OVZA 2BJVA 5DYGA 1MS7A 2GFEA 3UMMA 1LSTA 4K3FA 4S12A 1US4A 3SHFA 4LCBA 1Z59A 3R26A 3G3IA 5AA1A 5DNYA 4FEBA 2Q9TA 2ZYKA 3FVGA 3FXRA 1SBPA 5C18A 4TQUQ 3GPXA 3OMBA 4ELOA 4TUWA 1MU5A 4M0WA 2VIIA 2GH9A 3ONMA 4BDLA 3FJGA 3NWLA 4ESXA 4I4LA 8CATA 3DLNA 4Q8RA 1ZTYA 3C33A 3MQ9A 1BTJA 2UXCM 2VQFM 1SQYA 2RINA 3CF2A 1N7XA 3TWLA 1MQHA 4FAJA 2F5NA 5KQ8A 1ZKBA 4FJPA 2UU9M 4RYAA 2CHGA 1L2DA 3BBRA 1PM5A 2XD2A 4Z7EA 4QOZC 3Q25A 2KEBA 1VFDA 2EUCA 3IG5A 4LZZA 3KJ7A 3C58A 2Q88A 1LFGA 3I5OA 4YKPA 5DTBA 1HQYE 1LLSA 3ZCBB 4LJ4A 3PUXE 1QW0A 3CFLA 2YLNA 4ZEDA 1SI1A 1IUDA 2QMWA 4G6ZA 5KQDA 4GKKM 4ELPA 3MPLA 3OSRA 2ZYMA 1L5TA 2Y21A 3ZSFA 4IO4A 4XKPA 3K4UA 3A09A 3WAFA 3FVOA 1RKMA 4ZZEA 4GC9A 2Z3XA 3PPPA 1B1HA 3THIA 3FD9A 3GRVA 1TDHA 3PUZE 1JW1A 5IKBA 4YB6A 5I59B 3P7IA 1IY1A 1YTVA 2F36A 4GQOA 4M4GA 3FXUA 1UTHA 4XKQA 4F39A 4PD2A 3A46A 2UVHA 1ZU0A 1GVCA 3QUJA 3HGIA 3U8QA 2UVIA 4JN6A 3EIHA 2XH9A 2EA0A 1UTHB 3PFIA 1NFTA 4BLCA 3O28A 1H45A 3D8LA 4AQYM 2L6OA 1IITA 1P99A 2C98A 2V3TA 5I2KB 5I57B 3TZAA 3B9PA 1WVJA 3FUXA 5I84A 3J81S 1BLFA 4R2BA 1PJIA 5AA4A 4JWXA 2DZOB 3PPNA 1J7KA 4M9ZA 1BKAA 2NQ8C 4FORA 4FWDA 3G3HA 4OTEA 5FLXS 4DV4M 4PP0A 3RE8A 2HL7A 2HZKA 1IN7A 3C4MA 5ITRA 2F5SA 3FTDA 4IO6A 3FJMA 2F6PA 3G3JA 2C9OA 4II7A 2E0SA 3MC2A 3V8XB 3SYLA 1IXIA 2J7OA 1OFHA 2UUBM 3MWBA 1R2YA 1QUKA 2C96A 4BDMA 3LQRA 4MGHA 4R75A 4G8NA 1B0HA 1HSJA 3TWKA 4PFYA 1IN6A 4RNSA 3KN8A 3PGFA 4KYEA 1XXHA 1GLNA 5ITUA 1I94M 1R2ZA 1BIYA 2ALUA 4OFLA 4LP2B 2F4VM 4OEUA 5AA2A 4MLVA 3J27B 3KDSE 3L25A 4YMAA 4L15A 4OVJA 5CBSA 4NL4H 2NWJA 1LB8A 4F2QA 1MH4A 4LVQA 4WEPA 3TTNA 1FQCA 1MXXA 4OFJA 3W9WA 1XMQM 3G3KA 4U1OA 1MY4A 2XFSA 4LFCM 2HCAA 1IXCA 1Z7NE 3GLIB 4U21A 1Y4CA 3IAZA 2Q2EB 2CZLA 2I7NA 4ZE9A 4AQ4A 3H06B 2LAOA 3G3GA 3IX1A 1EZ9A 4GXSB 3RLFE 3TTRA 2ZANA 4F29A 1ZAEA 1XS5A 4GL8A 3VLWA 1LAHE 4H5FA 4EQ7A 2O5RA 3OSQA 1FQDA 1UIVA 5JTYB 1VR5A 3SEUA 3GLGB 3E3KA 3PV0E 3HU2A 1PJJA 1NJGA 4YY3M 3U93A 2XLJA 1LAXA 4ZE8A 3SMSA 3KOTA 2ZM6M 1H6UA 4JXJA 4RJZA 3A3UA 5E6JA 1XHBA 1SW1A 4LY6A 5LOMA 3M6AA 2O69A 3H6VA 3OEMA 3VLFB 1R9LA 4O3BA 4R72A 5F7VA 3S9EA 1LBCA 2F8DA 3L6GA 4FW9A 4L4UA 4LF5M 4ESWA 1JW5A 3KN7A 3FUZA 4ISUA 3QIMA 3GRYA 4QHQA 5JK4A 4IBIA 3SASA 1XHYA 1TDZA 4KYSA 1Q3BA 2UXAA 4JI6M 1MY2A 2C99A 3E4RA 3KS4A 1FQBA 3O66A 4RA1A 1DO0A 3UZUA 2V25A 1B4ZA 4MH5A 4EF2A 5L9MA 1SXJC 3ILTB 4I81A 4MGIE 1FQFA 4XXUA 1N3WA 1B05A 2G29A 2KRKA 4DCYA 1QAQA 3HJQA 3GZGA 4H65A 1OLAA 4M9SA 3SEWA 4MGYE 1B7ZA 5L8DA 1OMPA 4G2ZA 2R18A 3HU1A 5IWAM 3K6UA 4N13A 1DTGA 2G93A 4DV1M 3TFLA 3TTKA 5HBCA 1DGGA 1NVMA 4GITA 3HHXA 3LVWA 5BPVA 3U5ZB 5EXTA 1MY1A 3UK4A 7CATA 4IGRA 2X49A 3MK6A 4JSOA 4KYDA 3KS8A 2YNMD 1Y3NA 1NNUC 3CG1A 1IY0A 2QS2A 3TQLA 2H9BA 2F5QA 1MQDA 4IY6A 2R45A 2DWIA 1TH3A 4EUOA 2RCAA 1UTBA 4IO5A 3JAMS 2QS3A 1O64A 4KPTA 1KWHA 4IY5A 4X65M 2OBGA 5BR8M 1OFIA 2KW0A 3PMXA 2O7UA 1SW4A 1GKIA 1X37A 4OYVA 3MZBA 2V1CA 3RTFB 3GLIA 1ZIUA 3S9NC 3KSJA 4F19A 2CE7A 1DGHB 4ND9A 4R3DA 1NY5A 4NOOB 5EHSA 3KG2A 5H8NA 1DO2A 1WODA 5EP4A 2NUVA 4IO2A 4XIGQ 4LJ9A 3K00A 3SATA 3L27A 3MP8A 4IGTA 4ELQA 2V3UA 3VKGA 3DP6A 4OETA 3ZKKA 1WDNA 5FSWA 3M8UA 3S9MC 4GHLA 2F7CA 3GLBA 1NHWC 3AFHA 3JV9A 1F9BA 4IB2A 3UGJA 4BB9A 1Y4TA 4ZEFA 3L29A 4FCTA 5DVIA 2W82A 2DP8A 4H5GA 2X8AA 1PB8A 3FTEA 3KSXA 1IBMM 4IBDA 2DWNA 5BUUA 4U22A 4H0WA 4WURA 2REGA 4KI0E 2Q89A 5EJCA 1MXZA 2BJWA 3H6TA 1IZ1A 2D5WA 1N36M 4F31B 1XVYA 3T9XB 3V5AA 4BDRA 2HCBA 1SD3A 3K1NA 1OJLA 1XWIA 1B7HA 4X1DA 1MDQA 5EP2A 1PBQA 2F6GA 3H4MA 3IORA 2YR0A 4N6PA 1ATGA 1TGUA 3OO8A 3K8ZA 4U4SA 4YB5A 3VE1B 4BDOA 1SI0A 3HHFA 2M8CA 2HAVA 5K2YA 5EP3A 4MBPA 1B5JA 3FZVA 4R9FA 4AW4A 4LRSA 4YICA 3VV5A 5JTYA 1DPPA 1JEVA 4OERA 1R7RA 3EF7A 1R9QA 2I48A 3RTWB 3LSXA 3QAUA 3PMVA 4KLNA 4HCYA 3RPWA 1LAFE 3GBBA 3DP8A 1TH4A 1B5IA 1LV7A 1O7TA 2PMSA 2HQ0A 3TL4X 1I4WA 2THIA 2XXUA 3O6IA 4UA8A 1LBBA 3S9LC 2LH0A 2CFOA 4R9GA 1VDDA 3FATA 4G8HA 1B3EA 3HPIA 1Y3QA 2D7HA 4LF9M 1QZMA 2PT2A 2J7NA 1D9YA 4UACA 1I6AA 1B32A 1K3WA 4KO8A 2QPQA 4KQPA 1ANFA 2V3QA 2CV2A 4P0IA 3LSWA 2UUCM 3THGA 3B6TA 1SYHA 3I3VA 2E5LM 3M3KA 3H6UA 1W5TA 3TYHA 3O29A 4OZ9A 2R65A 2Y7WA 3WHKA 1UIUA 4QF9A 4JI8M 3MJNA 3USDA 2Y7IA 4BLAA 2AIXA 4PFTA 4R6KA 2ZNUA 3MJ5A 2PBWA 3UP9A 1OQHA 3DA1A 3LVVA 1QQWA 2I7PA 4GWOA 2KZUA 2LXEA 3AL0C 3DELB 2HZLA 1KFVA 3MP1A 4ZEBA 3K2DA 1YSYA 2XXIA 3CG3A 1P1WA 4LZJA 3L2AA 4FWGA 4D82A 1EE8A 5BWJA 3SMPA 2F34A 2WKYA 3VXBA 1B0LA 2F7AA 1DOTA 4QOSA 1B2HA 1A54A 5KPTA 3VDUA 4GKJM 2A5TA 3VVDA 4X9TA 5EXSA 2B3FA 4G68A 5C1BA 5AA4B 2M60A 3JR5A 2XXTA 1MX0A 1E32A 4Q30B 2YQZA 4DR5M 2RF1A 3FUTA 3JYRA 4GL0A 4QFPA 3U6LA 2O6AA 4IBJA 2XFTA 4B3MM 4EQ9A 2DS9A 4DUYM 1SYIA 2P5TA 1GGGA 2FFJA 3FVKA 2OJTA 4G8MA 3K1MA 3UORA 5H8FA 1NL5A 3BKIB 1N75A 1A8FA 1HQCA 5FTMA 3OD7A 2QCUA 3CVGA 3LQQA 4GRIA 1FTOA 1ELJA 3A3CA 4NXNM 3R8FA 5H8FB 3K1PA 4NF4A 3R7XA 1LFHA 3IB0A 3AOEC 3ODBA 4JI5M 3U94A 4PDIA 4ONYA 4DDDA 3K6WA 3T93B 3QUFA 3FGSA 3KOZE 5AA2B 4JI4M 3KP0E 2QZ4A 3SAUA 2XGNA 2A5TB 1NNKA 5CMBA 2H98A 2AYSA 4TLMB 3U5ZA 3SAVA 2I3VA 3U60B 5I57A 2K47A 2XX8A 3SFZA 4OWDA 3TKDA 3SERA 3KFUG 1QKBA 1I6BA 2UYFA 2UUAM 4PCZA 4B7FA 4YB7A 1MQGA 3SKPA 4IJFA 1QUJA 1QANA 2D7GA 2RC8A 1MQJA 3LR1A 4GFRA 3PPRA 4C1UA 3MAMA 3FV2A 3T9UA 5FTHA 2C9CA 4JDFA 1LFIA 1S50A 3Q8XA 3TQSA 2G5GX 3ILKA 2Y0QA 2GRVA 2BJJX 1URGA 4FCVA 2O68A 4X62M 5EXPA 5KZTA 3PUWE 3Q28A 4ZEIA 2GHAA 1N77A 1XT8A 2OWTA 1IIWA 3OXNA 1W5SA 3CTWB 4LF7M 3LUYA 4HCWA 4YU0A 2V6ZM 4I1DA 3FUUA 5ICQA 3M0EA 3GPPA 3IOVA 3RQTA 1MQIA 4JB7A 4DV0M 4F1VA 2X7PA 2ZXTA 2H5YA 2XSZD 3DP4A 2XD3A 1Y20A 4POXA 4LZ8A 1MPBA 4ZPXA 2FE8A 1K82A 4DE8A 2ZNSA 4THIA 2F35A 3FKEA 4NWCA 1DGFA 3A45A 4OX9M 3MW0A 3UJNA 3RFWA 1AOVA 3PXGA 3BFUA 3KVWA 1IN5A 3IB2A 2Z22A 3UIFA 3MVWA 4H6DA 4IBFA 3KOYE 3U60A 4L78A 2QJEA 3D4GA 4KCDA 2KA6B 4JV5M 1PBPA 4H1XA 3TDJA 4LA9A 3LMMA 1MG1A 4A3VB 4MB7A 1HSEA 3K2LA 4BDNA 1QAOA 3GRUA 3VKHA 2XEPA 3PD9A 1A8EA 1B3FA 3CF0A 3FV1A 4RF1A 5KCJA 4ITQA 1VSOA 3TTLA 1HT2E 1EH3A 3PVSA 2XXYA 3J7BA 4OENA 2HFBA 1B5HA 3O9PA 4F3PA 3K6VA 2Z8DA 4NEDA 3O6GA 2V1UA 3FJ7A 2DZNB 2QPAA 4EDPA 2DWLA 2OWSA 1B40A 4F3BA 1QYRA 3CSBA 1Z5AA 1N84A 4IO3A 3C31A 1IN4A 1IXHA 1SXJA 2OZZA 4POWA 3TELA 4DR7M 4DCXA 1HT1E 4MF3A 1N04A 5CBRA 3I51A 4FEDA 1B1XA 3CF6E 2KXEA 4GIPA 4DLDA 3IR1A 3QK6A 1N0TA 1C1KA 4NXMM 3KW6A 2ANJA 2X7QA 1NH7A 4DR3M 3VDFA 4E0XA 3SHGB 5ISUA 4ZZAA 3HHWA 5EQTA 1POTA 3FVNA 1IXRC 3L6HA 5KDTB 1FTLA 2YJPA 3VVEA 2OK2A 4NF6A 4GC5A 1LCFA 1D2NA 4G68C 3VK8A 4QFKA 3N26A 1GV8A 1QJMA 3U6PA 1T3TA 3CR9A 3FTCA 4R7GA 3TE6A 3IOTA 1TFAA 1S9TA 4B7GA 4QFNA 4Q0CA 3TPAA 1N33M 5GKNA 1XOCA 2XXXA 4KCCA 2XX9A 2VGQA 1Y3PA 2VP1A 4DUZM 1SDXA 2DHRA 5M2VA 3GQ3A 3GPYA 2C5RA 5I2NB 3T66A 1RYOA 2ZAOA 1D9VA 2VD2A 4XKRA 2FA7A 5ITXA 2NXOA 3T9VA 1EZPA 1B3GA 3HU3A 4EF1A 3PMWA 4L16A 4YZZA 2CV1A 5K2XA 3G7WA 4FECA 1XC1A 4G4PA 2I4BA 4F3GA 4DR4M 4R6HA 3GLFB 1MPDA 2VOZA 4LZ7A 5AE4A 4IBBA 4QNMA 4B7HA 1VE4A 1FCKA 4MGZE 1XVXA 3LBSA 1M5FA 4RPOA 4JSDA 5I59A 2AL5A 3QWLA 5I2NA 3RGYA 3IG8A 3AOGA 2ZAMA 1Q35A 4HW8A 3LC8A 2I0CA 2DVZA 1ZBMA 3U1OA 3CI8A 3U6OA 4Z0IA 1MM6A 2XX7A 5TP9B 1I6QA 4WW0A 4JWOA 4TLLB 1AMFA 3HO7A 5CRYA 5I58A 3PPOA 3H03A 3M7GA 1B4HA 2Q8JA 2IEEA 4NWDA 4JI3M 1S7YA 4RF0A 5H8HA 2DYXA 3IB1A 4NMYA 1Z5CA 1AH5A 4KR5A 4QHTA 3M3LA 3EQ1A 2A5SA 4LJAA 3PNYA 2PX1A 3IO4A 5KDTA 3SC3A 3SAWA 2QBYB 4GF8A 1FTKA 4DV5M 1CB6A 1MH3A 1P1OA 3GXAA 4NF5A 3I4YA 5CM6A 2DOJA 4H8JA 3TTMA 3L28A 4OQOA 2JA2A 1E94E 3TCHA 3RN8A 3D4CA 4KHZE 1XMOM 1TH2A 1QVRA 2XXWA 3CIJA 4HTGA 2KZSA 1A99A 3C9HA 4G4OA 4X64M 3RGSA 3HJ8A 5HM4B 2PVUA 3KGCA 4FWHA 4NF5B 3MHVC 3UGWA 2ONSA 2OQ4A 3HSTA 1QKAA 4P0GA 2CHVA 5H8NB 4CGYB 3GLFA 1SVXB 3IK6B 2O1LA 5ITYA 3J80S 2UVGA 3SETA 4GMQA 1IN8A 3KZGA 2W7YA 3TMGA 3T9HB 2ONKE 3KN3A 3RT6B 3E9XA 1II5A 4GD5A 2KRUA 4N07A 1ZQ9A 3MBPA 4DV6M 3GRRA 1JNFA 5A5XA 5EHMA 4NF8A 3DM0A 3CFZA 3KJTA 4I9DA 3DFZA 2DSFA 2RGOA 3RT8A 5KCJB 1MM7A 1PB7A 4U2RA 3OENA 4LUBA 1M5EA 5DEXA 4AG6A 5EXXA 4M1VA 3PU5A 1XXHB 2FNAA 4LZ5A 1FQAA 3SDFA 3Q29A 4DR1M 1IY2A 1QVSA 4Z8XA 5FTIA 3J7AS 4FATA 4OXVA 1Q39A 5AA3A 2XXPA 1ZLQA 4QHSA 2UVJA 1N7WA 3ZS6A 1E9SA 3GP1A 2DXYA 5I56A 2Z7JA 3JZJA 4TOZA 2X4AA 1B9JA 4JWYA 4ELRA 3GBAA 2CHQA 4M9XA 1B3HA 2F7BA 3ZKLA 3OTOM 3IJOB 3T1HM 5TU0A 1B3LA 2RGHA 2Y7RA 1IBLM 4LF4M 5B7DA 1MDP1 2E1SA 4F1UA 2DE4A 2DXRA 5LMUM 2L7HA 4G68B 4REZA 4GOTA 1PB9A 2D21A 3KXEC 1N32M 5ITOA 1S3SA 2RC9A 5ITPA 4NE4A 1MY0A 2HAUA 5KO3A 3T1YM 3TCFA 1J1NA 2FYIA 1SXJB 4OMBA 3VFDA 2X26A 4EQBA 1H3DA 4R73A 3V83A 4XBOA 1A55A 1A7LA 3OEKA 4PE5B 5F1QA 2UXBM 3B7DA 3TWMA 3GQ4A 1USYE 1DPEA 4BBAA 5H8HB 1AL3A 1IBKM 1YCJA 3N6TA 4XTCQ 2O84X 3T22A 1JETA 1OIBA 3IO6A 5H8SA 1NSFA 5I58B 2G8LA 1IQPA 1H76A 4X48A 4KODA 4JXIA 3U61A 2NVUB 3GLGA 3OO9A 1IXGA 2CV0A 5AA2D 3M3FA 1LCTA 3K0VA 3VLVA 5FTLA 1GL6A 3CFXA 4IIWA 1UQWA 3SBJA 3CSGA 4M0DA 3ILUB 4LATA 4CISA 3W15C 1YPNA 1EU8A 1HR0M 4GXAA 5A5XB 2CMOA 4PT5A 4DV2M 4YKKA 4AKGA 2VHAA 1Y1ZA 2YFQA 3O2AA 5TPAA 1DGHA 3QAXA 2RCBA 4NRWA 1YUBA 3WHLA 4LGYA 2XXVA 5ITTA 3H6WA 4QFLA 1VFEA 1DSNA 4IBGA 4B3RM 5JEIA 5KPRA 3HHZA 4F3SA 1J09A 4GIZA 1YAEA 4QNRA 5A2QS 4F1YA 4YAHX 2DWAA 2GHBA 2LWXA 2Y84A 1QAMA 1K3XA 5DVFA 1UM8A 2DWHA 1NNJA 4E0WA 3VDPA 3U61B 3T96B 3B6QA 1NNFA 2OLBA 1Y9UA 4D80A 2RKMA 4LONB 3E9SA 5ELVA 3T15A 4XKNA 2YPNA 2XZFA 3PPQA 3KOXE 3H3GA 5DYIA 2XHDA 3IJXB 4HL4A 4AB5A 3VVFA 4NRVA 5CC2A 3R9XB 1T0KA 4LQ5A 3GLHB 2ZNTA 3FXQA 3TUSA 4KD5A 1L2BA 5FTKA 4WEDA 3Q26A 2FOIC 1D4NA 4G4NA 3BOSA 4L8RC 2D7EA 3SEXA 3U92A 1G8PA 5JI3E 4PFUA 2ERCA 2BNKA 1Z5BA 5FTJA 4GVOA 4KFQA 3ZH9B 2REJA 3MVZA 2Q2AA 4YKJA 3N94A 3UK6A 4YHHM 1GVNA 3FASA 3W0FA 3TPZA 3LSLA 3V89B 1D3KA 1IXSB 2FNCA 4ZECA 1JQFA 1SXJD 1HNWM 3C34A 3HCQA 3RGPA 2L7IA 2ZYOA 4O3CA 2CUZA 4W5WA 2ZBKB 1L1TA 2QS4A 3C35A 3UA8A 2ESNA 2Z8EA 1G3IA 3KFMA 1O63A 4LJ8A 3GPUA 3RY3A 5H8QB 1B58A 1QULA 1JQJC 2QMXA 4RY1A 4B3SM 5FHMA 1UTBB 3CRBA 5EYFA 4DR6M 4IBKA 4P16A 2DQVA 3I6VA 4I8CA 1AIVA 2ZYNA 1R1NA 2DE3A 1HNXM 2R46A 2QS1A 1IQ7A 4Z6YA 3KP1E 3U6EA 3JR4A 1XNQM 3NBIA 4WXJA 1FJGM 2HEUA 4LFAM 4NF8B 1EZOA 1I69A 4BDQA 2P0SA 4JI7M 4I5SA 1SW5A 4HS7A 2AL4A 3MVYA 2P2AA 2I3WA 4K0KM 3A42A 2D3IA 3TQWA 2QENA 4RNAA 2B65A 1ORYB 5LMNM 3FD3A 1B46A 1XC8A 3L26A 3BFTA 2LNHC 4F2OA 5L9SA 4G77A 2I58A 4H8IA 3ZC7B 4YKIA 3IOWA 3DZDA 2XSZA 3K1JA 5FTNA 3LSFB 3GO8A 4MLQA 5CI5A 3T38A 3TEPA 3J2PB 2F5XA 2VD3A 5FHOA 4FE8A 5L9OA 4QFOA 1WXQA 4I8OA 1MY3A 1MXUA 4LJ5A 4GRKA 2Y7KA 2KLFA 3EHTA 2O1MA 3KOWE 1DGBA 2R4EA 1IEJA 1JEUA 3UN6A 2I6EA 2PYYA 2QBYA 4WKMA 3D8BA 1IM2A 1E9RA 1Q1KA 4MM3B 1ZJLA 5E26A 4JYAM 3PNVA 1CE2A 1JVYA 3IL1B 4QRZA 5JI2E 4ZEKA 3K02A 1TFDA 4U1ZA 2R62A 5B70A 1GL7A 2DWJA 1PC3A 4NSOB 1NY6A 1FQEA 3TODA 4R74A 1MXWA 3AJIB 2Z23A 1NKXA 2DE2A 1FW0A 3PUVE 5H37D 2L09A 2I49A 1M5DA 5ICTA 2R4JA 4O3AA 4LG2A 1M5CA 2NOOA 4OVZB 4FCWA 1USYH 1A40A 4QSDA 5DVJA 1FTMA 2F5OA 1QUIA 2XXHA 5H8QA 4IJEA 3O6HA 4QSCA 3HWSA 3GQ5A 2CEAA 2QSXA 4U23A 5TPAB 4DIGA 4HLQA 3SESA 5DYHA 2Z8FA 4NSRA 1H43A 5FHNA 4OHNA 4Q5TA 4LF8M 3WAEA 1KSFX 2DVWB 2XXQA 3PUYE 1Y1MA 4OESA 3KEIA 4LFBM 4PFWA 3N5LA 4OW0A 1BP5A 4GLIA 3MVXA 1HSLA 4YMBA 3KBRA 4EXKA 3O97A 1US5A 3H7MA 3ECRA 1NNTA 3N6UA 5DT6A 3S2VA 3SEVA 1NJFA 3FUVA 2V84A 1JR3A 3U6MA 3Q27A 1FNNA 1MXVA 1GTKA 1R6BX 2H25A 3B6WA 3OO7A 4RPNA 2Y7PA 3S4UA 3KOSA 1PEBA 5IT9S 2XF3A 3EPEA 1R6ZA 4DXCA 3QXMA 3MZ1A 5HPQA 2F97A 3AKZA 4H67A 1TWYA 3EHUA 3U72A 5ITQA 2P1SA 3FUWA 4DV3M 2QP9X 4MH0E 4ZDMA 2H99A 4X66M 2HXWA 3TAJA 2DVCA 5ITXE 2M5ZA 3C32A 3A98B 3K6XA 4DZ1A 2UXDM 3OOAA 2H4IA 3MPKA 4B08A 3C36A 4OFOA 4X1BA 2Q2CA 4NTLA 4DXBA 4I62A 2O51A 1KYIA 4R2FA 2XZUA 1DTZA 3H4ZA 4LF6M 3U6CA 1POY1 5CMMA 3EN3A 1P1NA 1MXYA 5TP9A 3W0LB 2A5YB 1L8QA 4B3TM 1B52A 1OLCA 3AV0A 4RXLA 1N3XA 2I0BA 1L1ZA 3K92A 2R6GE 1ZMGA 1B7UA 3DOAA 2ZMBA 3W9VA 3AOEA 1P1QA 1G4AE 3QYTA 2I4CA 3U6QA 4JI2M 3MP6A 5I2KA 1N76A 5KPZA 3TCGA 4ECFA 1OQGA 4LGMA 4G4RA 4FVMA 4DR2M 1Z6TA 2EO2A 3HV1A 2IA4A 3U6DA 3VXCA 4C0RA 2OPFA 4JI0M 4PQJA 2VQEM 3F11A 4AZFA 2R9JA 2DWMA 5I56B 5IAIA 1MRPA 5J1DA 2DXIA 1NHGC 3IOUA 1URDA 4LRTA 3VLUA 2DWZB 3VK7A 1JVXA 5DEXB 1G41A 4G4QA 1JR3D 1SW2A 1OVTA 2F78A 4EIWA 4MGKE 1LAGE 1H44A 4OEVA 4R6YA 4PETA 4F18A 2O7IA 2ONRA 3MUQA 3HHYA 2Y0TA 1G59A 3FYDA 4IBEA 3FYCA 3GLHA 4FIMA 1N34M 2PT1A 2UYEA 4LQ2A 1Q3CA 4RK2A 3HN0A 3SEYA 5CMCA 4JI1M 2V93A 3RUMA 5EP1A 4PDGA 3R6UA 4AG5A 4F22A 4NF6B 1YE9A 1HNZM 4RK9A 2HKJA 4LJ7A 4GHAA 1TT1A 1LGBC 4L17A 1SXJE 5IREB 3SYKA 5CMKA 3K01A 2RKOA 4IBCA 4P11A 4GH9A 3E13X 2XXRA 4U4XA 1URSA 4C1TA 4AI6A 1JW4A 2F5PA 4D81A 4QSEA 1J5EM 3I4VA 1MPCA 1LB9A 1IXZA 1DMBA 3OELA 4CHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B40 A;  4F3B A;  2XHD A;  3CSB A;  3HHG A;  3IJX B;  4JSO A;  4AB5 A;  4KYD A;  1Y3N A;  3VVF A;  1N84 A;  1Z7M E;  3FIR A;  4IO3 A;  3CG1 A;  2QS2 A;  3TQL A;  2ABH A;  3C31 A;  2H9B A;  4ZS9 A;  1IXH A;  1NH8 A;  2OZZ A;  4IO7 A;  3EHS A;  5CC2 A;  1MQD A;  4IY6 A;  4POW A;  3TEL A;  1T0K A;  1NMU A;  3MZ9 A;  4NF4 B;  2OCU A;  4LQ5 A;  2DWI A;  2RC7 A;  4DCX A;  4MF3 A;  1PDA A;  2ZNT A;  3FXQ A;  4DXU A;  3TUS A;  1N04 A;  5CBR A;  4KD5 A;  4EUO A;  2RCA A;  1UTB A;  4IO5 A;  1P1U A;  2QS3 A;  1O64 A;  4WED A;  4FED A;  1B1X A;  1KWH A;  4KPT A;  4IY5 A;  4AB6 A;  1B51 A;  4DLD A;  3IR1 A;  3Q26 A;  3QK6 A;  1D4N A;  1N0T A;  3AXF A;  2OBG A;  2ANJ A;  1RYX A;  2X7Q A;  3OO6 A;  3SEX A;  3U92 A;  1TXF A;  3PD8 A;  3RNN A;  3PMX A;  2O7U A;  1SW4 A;  4PFU A;  1NH7 A;  4OYV A;  3MZB A;  1GR2 A;  3G3F A;  1B6H A;  3RTF B;  3S9N C;  1ZIU A;  4GVO A;  4KFQ A;  2R71 A;  3VDF A;  4E0X A;  3KSJ A;  4F19 A;  1M5B A;  5ISU A;  1OVB A;  4ND9 A;  2REJ A;  3MVZ A;  4ZZA A;  2Q2A A;  4JBZ A;  3N94 A;  4YKJ A;  5H8N A;  5EHS A;  3KG2 A;  1POT A;  3FAS A;  1WOD A;  3FVN A;  3VFJ A;  4EXL A;  2B3B A;  2QL3 A;  3L6H A;  3LSL A;  4MFI A;  1FTJ A;  3QSL A;  3V89 B;  2NUV A;  4IO2 A;  4XIG Q;  1D3K A;  5KDT B;  1NNP A;  3K00 A;  1FTL A;  2FNC A;  2YJP A;  2QRY A;  2OK2 A;  3VVE A;  4ZEC A;  1JQF A;  4NF6 A;  1MS7 A;  1LCF A;  3C34 A;  3HCQ A;  3MP8 A;  4G68 C;  2GFE A;  4IGT A;  2ZYO A;  1LST A;  4ELQ A;  4QFK A;  3N26 A;  2V3U A;  4K3F A;  1QJM A;  4O3C A;  1GV8 A;  3CR9 A;  1US4 A;  2QS4 A;  3C35 A;  3DP6 A;  3UA8 A;  2ESN A;  2Z8E A;  4OET A;  3ZKK A;  3IOT A;  1WDN A;  1TFA A;  3G3I A;  3R26 A;  5AA1 A;  1S9T A;  3KFM A;  3M8U A;  4QFN A;  4Q0C A;  1O63 A;  3TPA A;  2F7C A;  3S9M C;  4FEB A;  2Q9T A;  3GLB A;  1XOC A;  2XXX A;  2ZYK A;  3JV9 A;  3RY3 A;  4KCC A;  3FVG A;  1F9B A;  2XX9 A;  2VGQ A;  5H8Q B;  4IB2 A;  1Y3P A;  1B58 A;  2VP1 A;  3FXR A;  1QUL A;  1SBP A;  1SDX A;  4TQU Q;  1Y4T A;  2QMX A;  4ZEF A;  4RY1 A;  3OMB A;  5FHM A;  4ELO A;  5DVI A;  5M2V A;  2DP8 A;  4H5G A;  5I2N B;  1UTB B;  3T66 A;  1RYO A;  3CRB A;  5EYF A;  1PB8 A;  3KSX A;  5BUU A;  2DQV A;  4I8C A;  3I6V A;  1AIV A;  2GH9 A;  2ZYN A;  2REG A;  3ONM A;  1R1N A;  4H0W A;  4U22 A;  4KI0 E;  2Q89 A;  1D9V A;  2DE3 A;  2VD2 A;  3UOR A;  4BDL A;  4XKR A;  2QS1 A;  1IQ7 A;  2FA7 A;  2NXO A;  1MXZ A;  3FJG A;  3T9V A;  1EZP A;  1B3G A;  4ESX A;  3H6T A;  4WXJ A;  4EF1 A;  1IZ1 A;  2HEU A;  3PMW A;  3DLN A;  4YZZ A;  2D5W A;  4F31 B;  1XVY A;  1ZTY A;  4NF8 B;  3T9X B;  3V5A A;  5K2X A;  4BDR A;  3C33 A;  4Q8R A;  1EZO A;  1I69 A;  4BDQ A;  1SD3 A;  3G7W A;  3K1N A;  3MQ9 A;  2P0S A;  1BTJ A;  4FEC A;  1B7H A;  1SW5 A;  4X1D A;  1MDQ A;  4HS7 A;  1XC1 A;  2AL4 A;  1PBQ A;  2F6G A;  3MVY A;  2I4B A;  4G4P A;  4F3G A;  1SQY A;  3IOR A;  4N6P A;  2P2A A;  2I3W A;  1ATG A;  1N7X A;  2RIN A;  3OO8 A;  4U4S A;  1MQH A;  4YB5 A;  4R6H A;  3VE1 B;  4BDO A;  2D3I A;  1SI0 A;  3HHF A;  4FAJ A;  3TQW A;  2M8C A;  1MPD A;  2HAV A;  5K2Y A;  2B65 A;  2VOZ A;  4MBP A;  4LZ7 A;  1B5J A;  1ZKB A;  3FZV A;  4FJP A;  3FD3 A;  4R9F A;  1B46 A;  5AE4 A;  4YIC A;  1VE4 A;  3VV5 A;  3BFT A;  5JTY A;  1DPP A;  1JEV A;  1FCK A;  4OER A;  4RYA A;  5DT6 A;  3BBR A;  1XVX A;  3LBS A;  1M5F A;  4F2O A;  2XD2 A;  4Z7E A;  4RPO A;  3EF7 A;  4JSD A;  1R9Q A;  2I48 A;  3Q25 A;  5I59 A;  4G77 A;  5L9S A;  2I58 A;  2AL5 A;  3RTW B;  5I2N A;  3RGY A;  1VFD A;  3LSX A;  4H8I A;  1Q35 A;  3PMV A;  4HW8 A;  3KJ7 A;  4YKI A;  3IOW A;  3LC8 A;  4HCY A;  2Q88 A;  3RPW A;  3LSF B;  1LAF E;  2I0C A;  1LFG A;  1ZBM A;  2DVZ A;  3CI8 A;  3GBB A;  3DP8 A;  3I5O A;  1LLS A;  4YKP A;  4MLQ A;  5CI5 A;  5DTB A;  1B5I A;  1O7T A;  3TEP A;  2PMS A;  4Z0I A;  1MM6 A;  2F5X A;  2HQ0 A;  2VD3 A;  3PUX E;  5FHO A;  2XX7 A;  1QW0 A;  3CFL A;  2YLN A;  4FE8 A;  5TP9 B;  4ZED A;  5L9O A;  1SI1 A;  1IUD A;  4QFO A;  2QMW A;  1MY3 A;  1MXU A;  1I6Q A;  2THI A;  4JWO A;  2XXU A;  3O6I A;  4TLL B;  4GRK A;  4UA8 A;  1LBB A;  2Y7K A;  1AMF A;  4ELP A;  2KLF A;  3EHT A;  3HO7 A;  3PPO A;  3H03 A;  2O1M A;  5CRY A;  5I58 A;  3MPL A;  3S9L C;  3OSR A;  2ZYM A;  2Q8J A;  1B4H A;  4R9G A;  2IEE A;  1L5T A;  3FAT A;  4G8H A;  1B3E A;  1IEJ A;  3HPI A;  4NWD A;  1JEU A;  1Y3Q A;  3ZSF A;  1S7Y A;  5H8H A;  3UN6 A;  2DYX A;  2I6E A;  3IB1 A;  4NMY A;  4IO4 A;  2PYY A;  4XKP A;  3K4U A;  3A09 A;  4WKM A;  3FVO A;  3WAF A;  1RKM A;  1AH5 A;  1Q1K A;  2PT2 A;  4KR5 A;  4ZZE A;  1D9Y A;  4UAC A;  3PPP A;  3M3L A;  1B1H A;  1B32 A;  1I6A A;  3EQ1 A;  3THI A;  1ZJL A;  1CE2 A;  1JVY A;  2A5S A;  3IL1 B;  4QRZ A;  5KDT A;  2PX1 A;  3IO4 A;  4ZEK A;  3PUZ E;  1JW1 A;  5IKB A;  3K02 A;  2QPQ A;  1TFD A;  4YB6 A;  4GF8 A;  4KQP A;  1ANF A;  4U1Z A;  1FTK A;  2V3Q A;  1CB6 A;  3P7I A;  4P0I A;  1MH3 A;  5I59 B;  1YTV A;  2F36 A;  5B70 A;  2DWJ A;  4GQO A;  3LSW A;  1PC3 A;  1P1O A;  3GXA A;  4M4G A;  4NF5 A;  3B6T A;  2DOJ A;  1UTH A;  3FXU A;  1SYH A;  4H8J A;  4XKQ A;  4F39 A;  3I3V A;  5CM6 A;  1FQE A;  3M3K A;  3TTM A;  4OQO A;  2UVH A;  1ZU0 A;  3TOD A;  1GVC A;  3TCH A;  3QUJ A;  3H6U A;  3TYH A;  4R74 A;  3S9E A;  1MXW A;  3RN8 A;  3O29 A;  3D4C A;  4OZ9 A;  2Z23 A;  2Y7W A;  1NKX A;  2UVI A;  4KHZ E;  3U8Q A;  2DE2 A;  3CIJ A;  1FW0 A;  1UIU A;  2XXW A;  4HTG A;  3PUV E;  4QF9 A;  3C9H A;  1A99 A;  3MJN A;  3USD A;  2Y7I A;  4BLA A;  1UTH B;  2AIX A;  4PFT A;  4R6K A;  2ZNU A;  2I49 A;  1NFT A;  1M5D A;  5ICT A;  3O28 A;  2PBW A;  5HM4 B;  2PVU A;  4O3A A;  1H45 A;  3UP9 A;  3KGC A;  1OQH A;  1IIT A;  4NF5 B;  1P99 A;  1M5C A;  2V3T A;  3UGW A;  5I2K B;  4GWO A;  2NOO A;  5I57 B;  3TZA A;  2ONS A;  1WVJ A;  3HST A;  1QKA A;  3DEL B;  2HZL A;  4P0G A;  5I84 A;  3MP1 A;  4ZEB A;  3K2D A;  3U1O A;  2XXI A;  1BLF A;  5H8N B;  3CG3 A;  1SVX B;  4R2B A;  1P1W A;  3IK6 B;  2O1L A;  4JWX A;  5AA4 A;  1USY H;  2UVG A;  3SET A;  1A40 A;  3KZG A;  3PPN A;  4QSD A;  5BWJ A;  2W7Y A;  2F34 A;  5DVJ A;  3TMG A;  1FTM A;  3T9H B;  2ONK E;  3KN3 A;  3RT6 B;  2WKY A;  3E9X A;  1BKA A;  1QUI A;  1II5 A;  4GD5 A;  3VXB A;  1B0L A;  2F7A A;  4FOR A;  4N07 A;  1DOT A;  3G3H A;  4OTE A;  4EXK A;  1B2H A;  1A54 A;  3MBP A;  4PP0 A;  2XXH A;  5H8Q A;  1JNF A;  3O6H A;  4QSC A;  5A5X A;  5EHM A;  2A5T A;  2HZK A;  3VVD A;  3C4M A;  4NF8 A;  4X9T A;  2B3F A;  3DM0 A;  4G68 A;  3CFZ A;  5AA4 B;  2QSX A;  4IO6 A;  4U23 A;  3KJT A;  3FJM A;  5TPA B;  2F6P A;  3G3J A;  2DSF A;  2XXT A;  4I9D A;  4DIG A;  4Q30 B;  2E0S A;  3MC2 A;  3RT8 A;  3SES A;  5DYH A;  3V8X B;  1IXI A;  2Z8F A;  2RF1 A;  1MM7 A;  5KCJ B;  1PB7 A;  1H43 A;  3JYR A;  4GL0 A;  4QFP A;  5FHN A;  4OHN A;  4Q5T A;  2O6A A;  3WAE A;  2XXQ A;  3PUY E;  4U2R A;  3MWB A;  1Y1M A;  4OES A;  3OEN A;  4EQ9 A;  4LUB A;  2DS9 A;  1M5E A;  3KEI A;  5DEX A;  4PFW A;  1QUK A;  1SYI A;  3N5L A;  1GGG A;  1BP5 A;  4GLI A;  3MVX A;  4BDM A;  4M1V A;  4G8N A;  4R75 A;  1HSL A;  4YMB A;  3FVK A;  1B0H A;  2OJT A;  3KBR A;  3PU5 A;  3K1M A;  4G8M A;  3O97 A;  1HSJ A;  1NL5 A;  1US5 A;  3BKI B;  1NNT A;  3ECR A;  1A8F A;  1FQA A;  3H7M A;  3N6U A;  4LZ5 A;  3Q29 A;  3S2V A;  3SDF A;  3SEV A;  2V84 A;  1QVS A;  3OD7 A;  5FTI A;  4FAT A;  3Q27 A;  4OXV A;  3CVG A;  4PFY A;  4RNS A;  5AA3 A;  2XXP A;  3KN8 A;  1ZLQ A;  3PGF A;  1FTO A;  1ELJ A;  2UVJ A;  1N7W A;  4KYE A;  1MXV A;  1GTK A;  2DXY A;  2H25 A;  3A3C A;  3ZS6 A;  5H8F B;  5I56 A;  3B6W A;  3OO7 A;  4RPN A;  3K1P A;  4NF4 A;  3JZJ A;  2Y7P A;  3R7X A;  4TOZ A;  3S4U A;  1BIY A;  3KOS A;  1B9J A;  1PEB A;  4JWY A;  4ELR A;  3GBA A;  2ALU A;  4OFL A;  4LP2 B;  3IB0 A;  1B3H A;  2F7B A;  4OEU A;  5AA2 A;  1LFH A;  3ZKL A;  3EPE A;  1R6Z A;  3ODB A;  4DXC A;  3U94 A;  3IJO B;  3QXM A;  4MLV A;  3MZ1 A;  4ONY A;  4DDD A;  5TU0 A;  1B3L A;  2Y7R A;  3K6W A;  3T93 B;  4YMA A;  5HPQ A;  2F97 A;  3QUF A;  4OVJ A;  5CBS A;  3FGS A;  4H67 A;  1TWY A;  2NWJ A;  1MDP 1;  1LB8 A;  3EHU A;  5B7D A;  3U72 A;  2E1S A;  2P1S A;  4F1U A;  4F2Q A;  1MH4 A;  4LVQ A;  4WEP A;  3TTN A;  5AA2 B;  1FQC A;  1MXX A;  4OFJ A;  4ZDM A;  3W9W A;  2DE4 A;  2A5T B;  2H99 A;  1NNK A;  2DXR A;  2HXW A;  3G3K A;  1MY4 A;  2DVC A;  4U1O A;  5CMB A;  2HCA A;  3TAJ A;  2H98 A;  3C32 A;  4G68 B;  1IXC A;  2AYS A;  3K6X A;  4GOT A;  4TLM B;  4DZ1 A;  1Z7N E;  2I3V A;  1PB9 A;  3OOA A;  2D21 A;  4U21 A;  2H4I A;  5I57 A;  1Y4C A;  3MPK A;  3IAZ A;  2CZL A;  2XX8 A;  3C36 A;  4OFO A;  4X1B A;  5ITO A;  2Q2C A;  4AQ4 A;  4ZE9 A;  4NTL A;  2RC9 A;  4OWD A;  3H06 B;  4I62 A;  3SER A;  2LAO A;  3TKD A;  2O51 A;  4DXB A;  4R2F A;  3G3G A;  3IX1 A;  5ITP A;  1DTZ A;  1EZ9 A;  1QKB A;  4GXS B;  1I6B A;  1MY0 A;  2UYF A;  3H4Z A;  4NE4 A;  3RLF E;  3TTR A;  1POY 1;  2HAU A;  5CMM A;  3EN3 A;  1P1N A;  4YB7 A;  1MQG A;  1MXY A;  5TP9 A;  3TCF A;  4F29 A;  1J1N A;  2FYI A;  1QUJ A;  3SKP A;  4OMB A;  1XS5 A;  4GL8 A;  2RC8 A;  1MQJ A;  2X26 A;  1B52 A;  1LAH E;  1OLC A;  4H5F A;  3LR1 A;  4GFR A;  4RXL A;  1N3X A;  2I0B A;  3VLW A;  3PPR A;  4C1U A;  3MAM A;  4EQB A;  1H3D A;  4R73 A;  4EQ7 A;  2R6G E;  1ZMG A;  3V83 A;  3OSQ A;  1B7U A;  1FQD A;  1A55 A;  1UIV A;  3FV2 A;  3W9V A;  2ZMB A;  3T9U A;  1A7L A;  3OEK A;  5JTY B;  4PE5 B;  5F1Q A;  5FTH A;  1P1Q A;  3B7D A;  1VR5 A;  4JDF A;  3QYT A;  1LFI A;  2I4C A;  3SEU A;  3E3K A;  1S50 A;  3MP6 A;  3PV0 E;  1USY E;  5I2K A;  1N76 A;  1DPE A;  3TCG A;  4ECF A;  1OQG A;  2GRV A;  1AL3 A;  5H8H B;  1URG A;  2BJJ X;  3N6T A;  1YCJ A;  2O68 A;  4XTC Q;  3U93 A;  2O84 X;  5KZT A;  1LAX A;  3T22 A;  3HV1 A;  1JET A;  3PUW E;  2IA4 A;  4ZE8 A;  1OIB A;  3Q28 A;  4ZEI A;  3IO6 A;  2GHA A;  5H8S A;  3VXC A;  4C0R A;  5I58 B;  1XT8 A;  3KOT A;  2OWT A;  1IIW A;  3OXN A;  4PQJ A;  4HCW A;  3LUY A;  3F11 A;  1H76 A;  4X48 A;  2R9J A;  4JXI A;  4YU0 A;  5I56 B;  5IAI A;  1MRP A;  4RJZ A;  2NVU B;  3A3U A;  5J1D A;  4I1D A;  5ICQ A;  1SW1 A;  3OO9 A;  5LOM A;  1IXG A;  5AA2 D;  3IOV A;  3RQT A;  3M3F A;  1MQI A;  2O69 A;  3H6V A;  3OEM A;  4JB7 A;  1R9L A;  4O3B A;  4R72 A;  5F7V A;  4F1V A;  1LBC A;  1LCT A;  2X7P A;  3IOU A;  3K0V A;  3VLU A;  2F8D A;  1URD A;  3L6G A;  2ZXT A;  5H8F A;  3CFX A;  2H5Y A;  1UQW A;  4ESW A;  1JW5 A;  3KN7 A;  3FUZ A;  4ISU A;  2XD3 A;  3CSG A;  3DP4 A;  3ILU B;  3QIM A;  1Y20 A;  1JVX A;  4LAT A;  4POX A;  4QHQ A;  4LZ8 A;  5DEX B;  3W15 C;  1MPB A;  5JK4 A;  1YPN A;  1EU8 A;  4DE8 A;  1SW2 A;  2ZNS A;  1OVT A;  4GXA A;  5A5X B;  2CMO A;  2F78 A;  4THI A;  2F35 A;  1LAG E;  1XHY A;  4KYS A;  4YKK A;  1H44 A;  2VHA A;  1Y1Z A;  4NWC A;  4OEV A;  2UXA A;  4PET A;  4R6Y A;  4F18 A;  1MY2 A;  2O7I A;  3O2A A;  5TPA A;  3E4R A;  2ONR A;  1FQB A;  3MW0 A;  3O66 A;  3MUQ A;  3QAX A;  4RA1 A;  2RCB A;  1AOV A;  2V25 A;  1B4Z A;  4MH5 A;  4EF2 A;  3BFU A;  5L9M A;  4FIM A;  2XXV A;  3IB2 A;  2PT1 A;  2UYE A;  2Z22 A;  3H6W A;  4LQ2 A;  3ILT B;  3MVW A;  1VFE A;  4H6D A;  4QFL A;  3UIF A;  1DSN A;  4RK2 A;  5JEI A;  2QJE A;  3D4G A;  4KCD A;  4F3S A;  1FQF A;  3HN0 A;  1N3W A;  4XXU A;  5CMC A;  3SEY A;  1B05 A;  1PBP A;  2V93 A;  3RUM A;  2G29 A;  4GIZ A;  3R6U A;  1YAE A;  4H1X A;  3TDJ A;  4F22 A;  4LA9 A;  4NF6 B;  4DCY A;  4F1Y A;  1MG1 A;  3GZG A;  4H65 A;  1HSE A;  4BDN A;  4YAH X;  2DWA A;  1OLA A;  4RK9 A;  2GHB A;  3SEW A;  2Y84 A;  1TT1 A;  1B7Z A;  5L8D A;  1OMP A;  1LGB C;  3PD9 A;  4L17 A;  1A8E A;  1B3F A;  4G2Z A;  3FV1 A;  5DVF A;  5CMK A;  2DWH A;  5KCJ A;  3K01 A;  4E0W A;  3K6U A;  3T96 B;  4P11 A;  1VSO A;  4N13 A;  3B6Q A;  1DTG A;  2G93 A;  3E13 X;  1EH3 A;  2XXR A;  1NNF A;  4U4X A;  2XXY A;  3TTL A;  2OLB A;  1Y9U A;  1URS A;  4OEN A;  3TFL A;  3TTK A;  5HBC A;  4C1T A;  2HFB A;  1B5H A;  3O9P A;  2RKM A;  4F3P A;  3K6V A;  2Z8D A;  4LON B;  1JW4 A;  4NED A;  5ELV A;  4QSE A;  2YPN A;  4XKN A;  3O6G A;  3PPQ A;  1MPC A;  1LB9 A;  1MY1 A;  3FJ7 A;  3UK4 A;  3VLV A;  3H3G A;  1DMB A;  4IGR A;  4EDP A;  3OEL A;  2OWS A; 
#chains in the Genus database with same CATH topology
 3HHG A;  3HKP A;  2Z4R A;  3H4J A;  4XGI A;  4OU7 A;  4FD2 A;  1Z7M E;  3FIR A;  2ABH A;  5F3W A;  4ZS9 A;  1NH8 A;  2Y20 A;  4IO7 A;  3EHS A;  1N78 A;  1VEG A;  4GWX A;  1NMU A;  3MZ9 A;  4NF4 B;  2OCU A;  1L2C A;  2RC7 A;  1PDA A;  4DXU A;  3FTF A;  1P1U A;  4AKH A;  4AB6 A;  1B51 A;  2HHH M;  3U6S A;  3AXF A;  1RYX A;  4NX1 A;  3OO6 A;  1XNR M;  1TXF A;  3PD8 A;  3RNN A;  2Z4S A;  3B8B A;  1GR2 A;  3G3F A;  1B6H A;  4AKI A;  2H1R A;  2R71 A;  3BIG A;  3SAR A;  1M5B A;  1OVB A;  2BJI A;  4JBZ A;  5IZ7 D;  5EYG A;  3HJS A;  3VFJ A;  4EXL A;  2B3B A;  2QL3 A;  3EIE A;  4KHP M;  2QVU A;  4MFI A;  1DCU A;  1FTJ A;  3QSL A;  2QFL A;  1NNP A;  4LJ6 A;  4DV7 M;  2AHM A;  4NG7 A;  4OVP A;  2QRY A;  4OVZ A;  2BJV A;  5DYG A;  1MS7 A;  2GFE A;  2V4C A;  3UMM A;  2VPO A;  1LST A;  4K3F A;  3EKI A;  4S12 A;  1US4 A;  3SHF A;  4LCB A;  1Z59 A;  3R26 A;  3G3I A;  5AA1 A;  5DNY A;  4FEB A;  2Q9T A;  2ZYK A;  3FVG A;  2DAK A;  3W68 A;  3FXR A;  1SBP A;  5C18 A;  4TQU Q;  3GPX A;  3OMB A;  2JXN A;  3A29 A;  4ELO A;  1KA0 A;  4TUW A;  3D1R A;  1MU5 A;  4M0W A;  2VII A;  1NV9 A;  2GH9 A;  3ONM A;  4O7M A;  4BDL A;  2KQZ A;  3FJG A;  3NWL A;  2VF7 A;  4P9K A;  4ESX A;  4I4L A;  8CAT A;  3DLN A;  1YZ0 A;  4Q8R A;  1ZTY A;  3C33 A;  3MQ9 A;  1BTJ A;  1VG5 A;  2UXC M;  1Q9D A;  1UFZ A;  2VQF M;  1SQY A;  1MN3 A;  2RIN A;  3CF2 A;  1N7X A;  2N35 A;  3TWL A;  1MQH A;  4FAJ A;  4X04 A;  2F5N A;  5KQ8 A;  1ZKB A;  1FPB A;  4FJP A;  3RPL A;  2UU9 M;  4RYA A;  2CHG A;  1L2D A;  3BBR A;  1PM5 A;  1NI9 A;  1HJP A;  2XD2 A;  5EYH A;  4QOZ C;  4Z7E A;  3Q25 A;  2XWK A;  2KEB A;  1VFD A;  2EUC A;  3IG5 A;  4LZZ A;  3KJ7 A;  4N4U A;  3C58 A;  2Q88 A;  1LFG A;  3I5O A;  4YKP A;  5DTB A;  1HQY E;  1LLS A;  3ZCB B;  1NUW A;  1C7Y A;  4LJ4 A;  3E21 A;  3PUX E;  1QW0 A;  3CFL A;  2YLN A;  4ZED A;  1SI1 A;  1IUD A;  2QMW A;  4G6Z A;  2MH8 A;  5KQD A;  4GKK M;  4ELP A;  1EFU B;  3MPL A;  1LTM A;  2ZYM A;  3OSR A;  5FBP A;  1L5T A;  2Y21 A;  3ZSF A;  4PAK A;  4IO4 A;  4XKP A;  3K4U A;  3A09 A;  3Q8G A;  3FVO A;  3WAF A;  1RKM A;  1OIP A;  4ZZE A;  4GC9 A;  2Z3X A;  1GO5 A;  3PPP A;  4O94 A;  1B1H A;  3THI A;  1OKS A;  3FD9 A;  3GRV A;  1TDH A;  4MJO A;  3PUZ E;  1JW1 A;  1V34 A;  5IKB A;  4YB6 A;  5I59 B;  3P7I A;  1IY1 A;  1YTV A;  2F36 A;  3W67 A;  2DDK A;  4GQO A;  4M4G A;  3FXU A;  1UTH A;  2VT5 A;  4XKQ A;  4F39 A;  4PD2 A;  3HX3 A;  3A46 A;  1ZU0 A;  2UVH A;  1GVC A;  3QUJ A;  3HGI A;  2CEY A;  1PJQ A;  3U8Q A;  2UVI A;  3B74 A;  4JN6 A;  3EIH A;  1AUA A;  2XH9 A;  2EA0 A;  1UTH B;  3PFI A;  1NFT A;  4BLC A;  2FIE A;  3O28 A;  1H45 A;  3D8L A;  4AQY M;  2L6O A;  5EQ8 A;  2JY6 B;  1IIT A;  1P99 A;  2C98 A;  2V3T A;  2CZH A;  5I2K B;  5I57 B;  3TZA A;  3B9P A;  1WVJ A;  3FUX A;  5I84 A;  2LVP C;  1WR1 B;  3J81 S;  1BLF A;  4R2B A;  1PJI A;  5AA4 A;  4JWX A;  2DZO B;  2HXR A;  3PPN A;  1J7K A;  4ANR A;  4M9Z A;  1BKA A;  2NQ8 C;  1WIV A;  4FOR A;  4FWD A;  3G3H A;  4OTE A;  3KBZ A;  5FLX S;  4DV4 M;  4PP0 A;  3RE8 A;  2HL7 A;  4P3L A;  2HZK A;  1IN7 A;  3C4M A;  5ITR A;  5LTC A;  2LVN C;  2F5S A;  3FTD A;  4IO6 A;  2CZI A;  3FJM A;  2F6P A;  3G3J A;  2C9O A;  4II7 A;  2E0S A;  3MC2 A;  3V8X B;  3SYL A;  1IMC A;  1ZMW A;  1IXI A;  2J7O A;  2KNA A;  1OFH A;  2UUB M;  3MWB A;  5A5L A;  2DAI A;  1R2Y A;  1QUK A;  4XF5 A;  2C96 A;  4BDM A;  3LQR A;  4MGH A;  4R75 A;  4G8N A;  1B0H A;  4H46 A;  1HSJ A;  2KDL A;  3TWK A;  1FBH A;  4PFY A;  1IN6 A;  4RNS A;  3KN8 A;  3PGF A;  2QVR A;  4KYE A;  1XXH A;  1GLN A;  5ITU A;  1I94 M;  1VEK A;  1R2Z A;  1BIY A;  1OIZ A;  2ALU A;  4OFL A;  4LP2 B;  2F4V M;  4OEU A;  5AA2 A;  4MLV A;  3J27 B;  3KDS E;  3L25 A;  4YMA A;  4L15 A;  1LBW A;  4OVJ A;  1FJ9 A;  4LN5 A;  5CBS A;  4NL4 H;  2NWJ A;  1EYI A;  1LB8 A;  4F2Q A;  1XI6 A;  1MH4 A;  4LVQ A;  4WEP A;  3TTN A;  1FQC A;  1MXX A;  4OFJ A;  3W9W A;  1XMQ M;  3G3K A;  4U1O A;  1MY4 A;  2XFS A;  4LFC M;  2HCA A;  1IXC A;  1Z7N E;  3GLI B;  4U21 A;  1Y4C A;  3IAZ A;  2Q2E B;  2CZL A;  2I7N A;  4ZE9 A;  4AQ4 A;  3H06 B;  2LAO A;  4HE1 A;  3G3G A;  3IX1 A;  1EZ9 A;  4GXS B;  3RLF E;  3TTR A;  1MJG M;  2ZAN A;  4F29 A;  1ZAE A;  1XS5 A;  1CUK A;  3B7Z A;  4GL8 A;  4PDH A;  3VLW A;  1LAH E;  3GYY A;  4H5F A;  2WYK A;  5EQA A;  4EQ7 A;  2O5R A;  3OSQ A;  1FQD A;  1UIV A;  4MNI A;  3IFA A;  5JTY B;  2RRU A;  4GEW A;  1VR5 A;  2LTU A;  3SEU A;  3GLG B;  3E3K A;  1GAB A;  3PV0 E;  4L6V 6;  3HU2 A;  1PJJ A;  1NJG A;  1FRP A;  3MMP A;  4YY3 M;  3U93 A;  3MST A;  2XLJ A;  1LAX A;  4ZE8 A;  3SMS A;  3KOT A;  2ZM6 M;  1H6U A;  4JXJ A;  4P56 A;  4RJZ A;  3A3U A;  5E6J A;  1XHB A;  1SW1 A;  4LY6 A;  5LOM A;  3M6A A;  2O69 A;  3H6V A;  3OEM A;  3VLF B;  1R9L A;  4O3B A;  4R72 A;  5F7V A;  3S9E A;  1LBC A;  2F8D A;  3L6G A;  4FW9 A;  4L4U A;  4LF5 M;  4ESW A;  1JW5 A;  4NAP A;  2F3B A;  3KN7 A;  3FUZ A;  4ISU A;  3QIM A;  3GRY A;  4QHQ A;  5JK4 A;  4IBI A;  4OVR A;  3SAS A;  1XHY A;  2JP7 A;  1TDZ A;  4KYS A;  1Q3B A;  2UXA A;  4JI6 M;  2FH0 A;  1MY2 A;  2C99 A;  3E4R A;  3KS4 A;  1QUS A;  1FQB A;  3O66 A;  4RA1 A;  1DO0 A;  3UZU A;  2V25 A;  1B4Z A;  4MH5 A;  4EF2 A;  5L9M A;  1SXJ C;  3ILT B;  4I81 A;  1P3Q Q;  4MGI E;  1FQF A;  4XXU A;  1N3W A;  1B05 A;  2G29 A;  2KRK A;  2EJS A;  4N91 A;  2JUJ A;  4DCY A;  1QAQ A;  3HJQ A;  4GWY A;  3GZG A;  4H65 A;  1OLA A;  4M9S A;  3SEW A;  4MGY E;  1B7Z A;  5L8D A;  1OMP A;  4G2Z A;  2R18 A;  3HU1 A;  5IWA M;  3K6U A;  5IZZ A;  4N13 A;  1DTG A;  2G93 A;  4DV1 M;  3TFL A;  3TTK A;  5HBC A;  1DGG A;  2CWB A;  1NVM A;  4GIT A;  3HHX A;  3LVW A;  2XWI A;  5BPV A;  3U5Z B;  5EXT A;  1MY1 A;  3UK4 A;  2HWJ A;  7CAT A;  3FBP A;  4IGR A;  2X49 A;  3MK6 A;  2L4E A;  4JSO A;  4KYD A;  3KS8 A;  2YNM D;  1Y3N A;  1NNU C;  3CG1 A;  1IY0 A;  2QS2 A;  3TQL A;  2H9B A;  2F5Q A;  3LW5 F;  1MQD A;  4IY6 A;  4H45 A;  2R45 A;  4GWU A;  2DWI A;  3E79 A;  1TH3 A;  4EUO A;  2RCA A;  1UTB A;  4IO5 A;  3JAM S;  2QS3 A;  1O64 A;  4KPT A;  1KWH A;  4IY5 A;  4X65 M;  2OBG A;  5BR8 M;  1OFI A;  2KW0 A;  5IZ3 B;  3PMX A;  2O7U A;  1SW4 A;  1GKI A;  1TTE A;  1X37 A;  4OYV A;  3MZB A;  2V1C A;  3RTF B;  3GLI A;  2ZTC A;  1ZIU A;  3S9N C;  5DW8 A;  3KSJ A;  4F19 A;  2CE7 A;  1DGH B;  4ND9 A;  4R3D A;  1NY5 A;  4NOO B;  5EHS A;  2Q74 A;  3KG2 A;  5H8N A;  1DO2 A;  1WOD A;  5EP4 A;  2NUV A;  4IO2 A;  4XIG Q;  4LJ9 A;  3K00 A;  3SAT A;  3L27 A;  4HXV A;  1WGN A;  1A5T A;  3MP8 A;  4IGT A;  4ELQ A;  2BWE A;  2V3U A;  3VKG A;  2KNV A;  3DP6 A;  4OET A;  3ZKK A;  1WDN A;  5FSW A;  1F4I A;  3M8U A;  1NV3 A;  3S9M C;  4GHL A;  2F7C A;  3GLB A;  4OVQ A;  1NHW C;  3AFH A;  3JV9 A;  1F9B A;  2VPN A;  4IB2 A;  3UGJ A;  2WYP A;  4BB9 A;  3MYU A;  1Y4T A;  4OA4 A;  4ZEF A;  2HHM A;  3L29 A;  4FCT A;  3KC0 A;  5DVI A;  2W82 A;  2DP8 A;  4H5G A;  2X8A A;  1D0M A;  1PB8 A;  3FTE A;  3KSX A;  1IBM M;  4IBD A;  2DWN A;  5BUU A;  4U22 A;  4H0W A;  4WUR A;  2REG A;  4G61 A;  4KI0 E;  2Q89 A;  5EJC A;  1MXZ A;  2BJW A;  3H6T A;  1IZ1 A;  2MJ5 B;  1Y8G A;  2D5W A;  1N36 M;  4F31 B;  1XVY A;  3T9X B;  3V5A A;  4BDR A;  2HCB A;  1SD3 A;  3K1N A;  1OJL A;  1XWI A;  1B7H A;  4X1D A;  1MDQ A;  5EP2 A;  1PBQ A;  2F6G A;  3H4M A;  3IOR A;  2EKF A;  2DNA A;  2YR0 A;  1ATG A;  1TGU A;  3OO8 A;  3K8Z A;  4N6P A;  4U4S A;  4YB5 A;  2JY5 A;  3VE1 B;  4BDO A;  1SI0 A;  3HHF A;  2M8C A;  2HAV A;  5K2Y A;  5EP3 A;  4MBP A;  1B5J A;  1QGX A;  3FZV A;  4R9F A;  4AW4 A;  4LRS A;  2DHY A;  4YIC A;  3VV5 A;  5J16 A;  4P17 A;  5JTY A;  1DPP A;  1JEV A;  1IME A;  4OER A;  1R7R A;  1OAI A;  3EF7 A;  1R9Q A;  2I48 A;  3RTW B;  1WHC A;  3LSX A;  3QAU A;  3PMV A;  1FBG A;  2OO9 A;  4KLN A;  4HCY A;  3RPW A;  1LAF E;  3GBB A;  3DP8 A;  1TH4 A;  1B5I A;  1LV7 A;  1O7T A;  2PMS A;  2EKK A;  1FPK A;  2HQ0 A;  1OQY A;  3TL4 X;  1TF0 B;  2BWB A;  1I4W A;  2THI A;  2XXU A;  3O6I A;  4UA8 A;  1LBB A;  2L2D A;  3S9L C;  3C3D A;  2LH0 A;  2CFO A;  4R9G A;  1VDD A;  3FAT A;  4G8H A;  1D0L A;  1B3E A;  3HPI A;  4DI4 B;  1Y3Q A;  2D7H A;  4LF9 M;  4MNC A;  4MEV A;  1QZM A;  2PT2 A;  2J7N A;  2K6B A;  1D9Y A;  4UAC A;  1I6A A;  1B32 A;  4N6K A;  1K3W A;  4KO8 A;  4JVI A;  4PF6 A;  2QPQ A;  4KQP A;  1ANF A;  2V3Q A;  2CV2 A;  4P0I A;  3LSW A;  2UUC M;  3THG A;  3B6T A;  1SYH A;  4GWS A;  2DKL A;  2E5L M;  3I3V A;  3M3K A;  4MIJ A;  3H6U A;  1W5T A;  3TYH A;  3O29 A;  3B89 A;  2R65 A;  1T43 A;  2Y7W A;  4OZ9 A;  3WHK A;  1UIU A;  4QF9 A;  1INP A;  4JI8 M;  3MJN A;  3USD A;  2Y7I A;  4BLA A;  2AIX A;  2Y5K A;  4PFT A;  4R6K A;  2ZNU A;  3MJ5 A;  2PBW A;  3UP9 A;  1KA1 A;  1OQH A;  3DA1 A;  3LVV A;  1QQW A;  2L4F A;  2I7P A;  4GWO A;  2KZU A;  2LXE A;  3AL0 C;  1NUY A;  3DEL B;  2HZL A;  1KFV A;  3MP1 A;  4ZEB A;  3K2D A;  1YSY A;  2XXI A;  4XEQ A;  3CG3 A;  3T6P A;  1P1W A;  1QDT A;  4LZJ A;  3L2A A;  4FWG A;  4XFE A;  2DAM A;  4D82 A;  1EE8 A;  2G3Q A;  5BWJ A;  3SMP A;  2F34 A;  2WKY A;  3VXB A;  1B0L A;  2F7A A;  1DOT A;  4QOS A;  1B2H A;  1A54 A;  5KPT A;  3VDU A;  2O01 F;  4GKJ M;  2A5T A;  3VVD A;  2PFZ A;  4X9T A;  5EXS A;  2B3F A;  4G68 A;  5C1B A;  5AA4 B;  2M60 A;  3JR5 A;  1K9Y A;  2XXT A;  1MX0 A;  1E32 A;  4Q30 B;  2YQZ A;  2PFY A;  4DR5 M;  2RF1 A;  3FUT A;  3JYR A;  4GL0 A;  4QFP A;  3U6L A;  2O6A A;  4IBJ A;  2XFT A;  4B3M M;  3T0J A;  4EQ9 A;  2DS9 A;  4DUY M;  1SYI A;  4PFR A;  2P5T A;  1GGG A;  2FFJ A;  4CJ6 A;  3FVK A;  2OJT A;  4G8M A;  3K1M A;  3UOR A;  5H8F A;  1NL5 A;  3BKI B;  1N75 A;  1A8F A;  1HQC A;  5FTM A;  3OD7 A;  2QCU A;  4PFI A;  3CVG A;  3LQQ A;  4GRI A;  1FTO A;  1ELJ A;  3A3C A;  4NXN M;  1EYK A;  3R8F A;  5H8F B;  2WZJ A;  3K1P A;  4PDD A;  4NF4 A;  3R7X A;  1QDR A;  2P3N A;  3V76 A;  3IB0 A;  1LFH A;  2QHO B;  1K9Z A;  3AOE C;  3ODB A;  4JI5 M;  3U94 A;  4PDI A;  4ONY A;  4DDD A;  1OAO C;  3K6W A;  3T93 B;  3QUF A;  3FGS A;  2Z8Y M;  4UAB A;  3KOZ E;  5AA2 B;  4JI4 M;  3KP0 E;  2QZ4 A;  3SAU A;  2XGN A;  2A5T B;  1NNK A;  5CMB A;  2H98 A;  1RDX A;  2OOB A;  2AYS A;  4TLM B;  3U5Z A;  3SAV A;  2I3V A;  2HAK A;  3U60 B;  5I57 A;  2K47 A;  2XX8 A;  3SFZ A;  4OWD A;  4MHF A;  3SER A;  3TKD A;  3KFU G;  1QKB A;  5DFL A;  1I6B A;  2UYF A;  2FS1 A;  3HY5 A;  2UUA M;  4PCZ A;  4B7F A;  4YB7 A;  1MQG A;  3SKP A;  1QUJ A;  4IJF A;  1QAN A;  2D7G A;  2RC8 A;  1MQJ A;  3LR1 A;  4GFR A;  3PPR A;  4C1U A;  3MAM A;  4HEO A;  2OOA A;  3FV2 A;  3T9U A;  3BBZ A;  5FTH A;  2C9C A;  4PBQ A;  4JDF A;  4R71 A;  1LFI A;  4RKU F;  2JWS A;  1S50 A;  3Q8X A;  3TQS A;  4PE3 A;  2G5G X;  3ILK A;  2Y0Q A;  2GRV A;  3FXB A;  1URG A;  2BJJ X;  4FCV A;  2O68 A;  4X62 M;  5EXP A;  5KZT A;  3PUW E;  3Q28 A;  4ZEI A;  2Q8M A;  2GHA A;  2CZK A;  1N77 A;  1XT8 A;  2OWT A;  1IIW A;  3OXN A;  1W5S A;  3CTW B;  4LF7 M;  3LUY A;  4HCW A;  2L5V A;  5IM2 A;  4YU0 A;  2V6Z M;  4I1D A;  3FUU A;  5ICQ A;  3M0E A;  1NV2 A;  3GPP A;  3IOV A;  3RQT A;  1MQI A;  1YXI A;  4JB7 A;  4DV0 M;  2R0I A;  1FBF A;  4OAN A;  4F1V A;  2X7P A;  1LEV A;  2ZXT A;  2H5Y A;  2XSZ D;  3IFC A;  2XD3 A;  1WJ7 A;  3DP4 A;  1Y20 A;  4POX A;  4LZ8 A;  1MPB A;  4ZPX A;  2FE8 A;  1K82 A;  4DE8 A;  2XWO A;  2ZNS A;  2KR0 A;  4THI A;  2F35 A;  3FKE A;  2CEX A;  4NWC A;  1DGF A;  3A45 A;  4OX9 M;  3MW0 A;  3UJN A;  3RFW A;  2XXK A;  1AOV A;  3PXG A;  3BFU A;  3KVW A;  1IN5 A;  3IB2 A;  2Z22 A;  3UIF A;  3MVW A;  4H6D A;  4IBF A;  1Q02 A;  3KOY E;  3U60 A;  4L78 A;  5IGA A;  2QJE A;  3D4G A;  4KCD A;  2KA6 B;  4JV5 M;  1LBX A;  1PBP A;  4H1X A;  3TDJ A;  4LA9 A;  3LMM A;  1MG1 A;  4A3V B;  5ET7 A;  4MB7 A;  1HSE A;  3K2L A;  4BDN A;  2LHC A;  1VDW A;  4OVS A;  4P1L A;  1QAO A;  3GRU A;  3VKH A;  2XEP A;  3PD9 A;  1B3F A;  1A8E A;  3CF0 A;  4RF1 A;  3FV1 A;  5KCJ A;  4ITQ A;  1VSO A;  1IMA A;  1HT2 E;  1EH3 A;  3TTL A;  3PVS A;  2XXY A;  3J7B A;  4OEN A;  3K9P A;  2HFB A;  1B5H A;  3O9P A;  4F3P A;  3K6V A;  2Z8D A;  4NED A;  3O6G A;  2V1U A;  3FJ7 A;  2JNH A;  2DZN B;  2QPA A;  4EDP A;  1NV7 A;  2DWL A;  2OWS A;  4PF8 A;  2WEF A;  4DBG B;  1B40 A;  4F3B A;  1QYR A;  1XB2 B;  3CSB A;  1Z5A A;  1N84 A;  4IO3 A;  3C31 A;  1IN4 A;  1IXH A;  1SXJ A;  2OZZ A;  2P3V A;  4POW A;  3TEL A;  4DR7 M;  4P47 A;  4DCX A;  1HT1 E;  4MF3 A;  1N04 A;  5CBR A;  3I51 A;  4FED A;  1B1X A;  2LBC A;  3CF6 E;  1G71 A;  1WGL A;  2KXE A;  4GIP A;  3IR1 A;  3QK6 A;  4DLD A;  1N0T A;  1C1K A;  4NXM M;  3KW6 A;  2ANJ A;  2X7Q A;  1DBZ A;  1NH7 A;  4MAG A;  1R4G A;  4DR3 M;  2WBD A;  3VDF A;  4E0X A;  4MMP A;  3SHG B;  5ISU A;  4NN3 A;  4ZZA A;  3HHW A;  5EQT A;  1D9Q A;  1POT A;  4Q7J A;  3FVN A;  1IXR C;  3L6H A;  4N17 A;  4GWW A;  2GNO A;  5KDT B;  1FTL A;  2YJP A;  3VVE A;  2OK2 A;  4NF6 A;  4GC5 A;  1FJ6 A;  1LCF A;  1D2N A;  4G68 C;  3VK8 A;  4QFK A;  3N26 A;  1GV8 A;  1QJM A;  4N6D A;  3U6P A;  1T3T A;  3FTC A;  4R7G A;  3TE6 A;  3CR9 A;  1GJT A;  3IOT A;  1TFA A;  1S9T A;  4B7G A;  4QFN A;  4Q0C A;  1RDY A;  3TPA A;  1N33 M;  5GKN A;  1XOC A;  4NQ8 A;  2XXX A;  4KCC A;  2XX9 A;  2VGQ A;  2WSC F;  1Y3P A;  2VP1 A;  4DUZ M;  1SDX A;  2KHH A;  2DHR A;  5M2V A;  1JR3 E;  3IHP A;  3GQ3 A;  1BVS A;  3GPY A;  2C5R A;  1FPG A;  5I2N B;  3T66 A;  1RYO A;  4AS4 A;  2ZAO A;  3FRI A;  5EQ7 A;  2XA5 A;  1D9V A;  2Y5L A;  2VD2 A;  4XKR A;  2FA7 A;  5ITX A;  2NXO A;  1ZMV A;  3T9V A;  1EZP A;  1B3G A;  1QUT A;  3HU3 A;  4EF1 A;  3KC1 A;  1FBE A;  3PMW A;  4L16 A;  2R8T A;  4YZZ A;  2CV1 A;  3LV0 A;  5K2X A;  3ZQJ A;  2MR9 A;  3G7W A;  4FEC A;  5LDZ A;  1XC1 A;  5ET5 A;  4G4P A;  2I4B A;  4F3G A;  2MRO B;  4DR4 M;  4R6H A;  1G0I A;  3GLF B;  5IZ3 A;  1MPD A;  2VOZ A;  4MX6 A;  4PAI A;  4LZ7 A;  5AE4 A;  4IBB A;  4QNM A;  4B7H A;  1VE4 A;  1NV0 A;  1FCK A;  4MGZ E;  1XVX A;  3LBS A;  1M5F A;  4RPO A;  4JSD A;  5I59 A;  5ET6 A;  2AL5 A;  3QWL A;  5I2N A;  3RGY A;  3AOG A;  2ZAM A;  3IG8 A;  1NO1 A;  1Q35 A;  5ESY A;  4HW8 A;  4N8Y A;  3LC8 A;  2I0C A;  2DVZ A;  1ZBM A;  3U1O A;  3CI8 A;  3U6O A;  5ET8 A;  4Z0I A;  1MM6 A;  2XX7 A;  5TP9 B;  3BXW A;  1I6Q A;  4WW0 A;  4JWO A;  4TLL B;  1AMF A;  3HO7 A;  5CRY A;  5I58 A;  3PPO A;  3H03 A;  3M7G A;  1B4H A;  2Q8J A;  2IEE A;  4NWD A;  4JI3 M;  1S7Y A;  4RF0 A;  5H8H A;  2DYX A;  3IB1 A;  4NMY A;  1Z5C A;  1AH5 A;  1VDL A;  4QHT A;  4KR5 A;  1FPF A;  2DAE A;  3NOH A;  3M3L A;  3EQ1 A;  4X8R A;  2A5S A;  4LJA A;  3PNY A;  2PX1 A;  3IO4 A;  5KDT A;  3SC3 A;  3SAW A;  4NC6 A;  2QBY B;  4GF8 A;  1FTK A;  4DV5 M;  3I04 M;  3NBX X;  1CB6 A;  1MH3 A;  4I3Y A;  1LBZ A;  2ZZW A;  4HE2 A;  3GLF E;  1P1O A;  3GXA A;  4NF5 A;  3I4Y A;  5CM6 A;  2DOJ A;  4H8J A;  3TTM A;  3L28 A;  4OQO A;  3U65 A;  2JA2 A;  1E94 E;  3TCH A;  3RN8 A;  3D4C A;  4KHZ E;  1XMO M;  1TH2 A;  1QVR A;  2XXW A;  3CIJ A;  4HTG A;  2KZS A;  1A99 A;  3C9H A;  4G4O A;  4X64 M;  3RGS A;  2B4L A;  3HJ8 A;  5HM4 B;  2PVU A;  3KGC A;  3FRH A;  4N15 A;  4FWH A;  4NF5 B;  3MHV C;  3UGW A;  2ONS A;  2OQ4 A;  3HST A;  1QKA A;  4QXD A;  4P0G A;  4PBH A;  4GX4 A;  2CHV A;  1FBC A;  5H8N B;  4CGY B;  3GLF A;  1SVX B;  1DV0 A;  3IK6 B;  2O1L A;  5ITY A;  3J80 S;  2ZZX A;  2UVG A;  3SET A;  4GMQ A;  1IN8 A;  3KZG A;  4PCD A;  2W7Y A;  3TMG A;  3T9H B;  2ONK E;  3KN3 A;  3RT6 B;  4PGP A;  3E9X A;  1II5 A;  4GD5 A;  4NGU A;  2KRU A;  4N07 A;  1ZQ9 A;  3MBP A;  1TR8 A;  2JZ1 A;  1ZMU A;  2QSF X;  3GRR A;  4DV6 M;  1JNF A;  5A5X A;  5EHM A;  4NF8 A;  3DM0 A;  5I3S A;  3CFZ A;  2K0B X;  3KJT A;  4I9D A;  3DFZ A;  2DSF A;  2RGO A;  1JP4 A;  3RT8 A;  5KCJ B;  1MM7 A;  1PB7 A;  1FPD A;  4U2R A;  3OEN A;  4LUB A;  1M5E A;  5DEX A;  4AG6 A;  5EXX A;  4M1V A;  2JJK A;  3PU5 A;  1XXH B;  2FNA A;  4LZ5 A;  1FQA A;  3SDF A;  3Q29 A;  4DR1 M;  2F3D A;  1IY2 A;  1QVS A;  4Z8X A;  5FTI A;  3J7A S;  4FAT A;  1PGY A;  4OXV A;  1Q39 A;  5AA3 A;  2XXP A;  1ZLQ A;  4QHS A;  2LHG A;  1N7W A;  2UVJ A;  3ZS6 A;  1E9S A;  3GP1 A;  2DXY A;  5I56 A;  2Z7J A;  3JZJ A;  4TOZ A;  2X4A A;  1LBV A;  1B9J A;  4JWY A;  4ELR A;  3GBA A;  2CHQ A;  4M9X A;  1B3H A;  2F7B A;  5T3J A;  3ZKL A;  3OTO M;  3IJO B;  5I5P A;  5I7I A;  3T1H M;  5TU0 A;  1B3L A;  2RGH A;  1IFY A;  2Y7R A;  2R44 A;  4O7I A;  1IBL M;  4LF4 M;  5B7D A;  4Y28 F;  1MDP 1;  2QVV A;  2E1S A;  4F1U A;  1BK4 A;  1PRB A;  2DE4 A;  2DXR A;  5LMU M;  4GBV A;  2L7H A;  4G68 B;  4REZ A;  4GOT A;  2JY7 A;  1PB9 A;  2D21 A;  3KXE C;  1N32 M;  5ITO A;  1S3S A;  2RC9 A;  3CHG A;  5ITP A;  2XWV A;  4NE4 A;  1MY0 A;  2HAU A;  5KO3 A;  2OWZ A;  3T1Y M;  3TCF A;  1J1N A;  2FYI A;  1SXJ B;  4OMB A;  3VFD A;  2X26 A;  2CRU A;  4EQB A;  4KT0 F;  1H3D A;  4DI3 D;  4R73 A;  3V83 A;  4XBO A;  1A55 A;  3E78 A;  1A7L A;  3OEK A;  4PE5 B;  5F1Q A;  2UXB M;  3B7D A;  3TWM A;  3GQ4 A;  1USY E;  1DPE A;  4BBA A;  5H8H B;  1AL3 A;  1IBK M;  1YCJ A;  3N6T A;  4XTC Q;  2O84 X;  3T22 A;  1JET A;  1OIB A;  3IO6 A;  5H8S A;  1NSF A;  5I58 B;  2G8L A;  1IQP A;  2ZTD A;  1H76 A;  2KNZ A;  2FVZ A;  4X48 A;  4KOD A;  4JXI A;  3U61 A;  2NVU B;  1EYJ A;  3GLG A;  2VDB B;  3OO9 A;  4QBA A;  1IXG A;  2CV0 A;  5AA2 D;  3M3F A;  2WBB A;  1LCT A;  3K0V A;  3VLV A;  5FTL A;  4N8G A;  1GL6 A;  3CFX A;  4IIW A;  1UQW A;  1PJS A;  3SBJ A;  3CSG A;  4M0D A;  3ILU B;  1NV5 A;  4HE0 A;  4LAT A;  4CIS A;  3W15 C;  1XXH E;  2WX9 A;  1YPN A;  1EU8 A;  1HR0 M;  3ROJ A;  1FPI A;  4GXA A;  5A5X B;  2CMO A;  4PTK A;  3CGW A;  4PT5 A;  2J5Y A;  4DV2 M;  4NF0 A;  4YKK A;  4AKG A;  2VHA A;  1Y1Z A;  2YFQ A;  4GBW A;  3O2A A;  3GLH E;  5TPA A;  1KZ8 A;  1DGH A;  3QAX A;  2RCB A;  2GQF A;  2H5X A;  4MCO A;  4NRW A;  2MKZ A;  1YUB A;  5F24 A;  3WHL A;  4LGY A;  2XXV A;  5ITT A;  3H6W A;  4QFL A;  3QMF A;  1VFE A;  4FBP A;  1DSN A;  4O8M A;  4IBG A;  4B3R M;  5JEI A;  5KPR A;  3HHZ A;  4F3S A;  1J09 A;  4GIZ A;  1YAE A;  1D0K A;  4QNR A;  5A2Q S;  4F1Y A;  1FSA A;  4YAH X;  2DWA A;  2GHB A;  2LWX A;  2Y84 A;  1QAM A;  1K3X A;  5DVF A;  1QZE A;  1UM8 A;  2DWH A;  1NNJ A;  4E0W A;  3VDP A;  3B7N A;  3U61 B;  3T96 B;  3B6Q A;  3QYB A;  1NNF A;  2OLB A;  1Y9U A;  4D80 A;  1OTR A;  3F92 A;  2RKM A;  2JZ0 A;  3E9S A;  4LON B;  5ELV A;  3T15 A;  4XKN A;  2YPN A;  4I3E A;  2XZF A;  3PPQ A;  1IMD A;  3KOX E;  3H3G A;  2LVA A;  5DYI A;  2XHD A;  3IJX B;  4HL4 A;  4AB5 A;  3VVF A;  4NRV A;  4PAF A;  5CC2 A;  3R9X B;  1T0K A;  2FHY A;  4F2L A;  4LQ5 A;  3GLH B;  2ZNT A;  3FXQ A;  3TUS A;  4KD5 A;  1L2B A;  5FTK A;  4WED A;  1FBP A;  3Q26 A;  2FOI C;  1D4N A;  4G4N A;  3LCV B;  2FIX A;  3BOS A;  4L8R C;  2D7E A;  3SEX A;  3U92 A;  1G8P A;  4KXP A;  5JI3 E;  4PFU A;  2ERC A;  2BNK A;  1Z5B A;  5FTJ A;  4N81 A;  4GVO A;  4KFQ A;  3ZH9 B;  2REJ A;  3MVZ A;  2Q2A A;  4YKJ A;  3N94 A;  3UK6 A;  4YHH M;  1FPL A;  1GVN A;  3FAS A;  3W0F A;  3TPZ A;  2QQ8 A;  3LSL A;  3V89 B;  1D3K A;  1IMB A;  1IXS B;  2PCR A;  2FNC A;  3LUZ A;  4ZEC A;  1JQF A;  1SXJ D;  1HNW M;  3C34 A;  3HCQ A;  3RGP A;  2L7I A;  2ZYO A;  4O3C A;  2CUZ A;  4W5W A;  2ZBK B;  1L1T A;  2QS4 A;  3C35 A;  3QYE A;  3UA8 A;  2ESN A;  2Z8E A;  1G3I A;  3KFM A;  1O63 A;  3GLG E;  4NHB A;  4LJ8 A;  3GPU A;  3RY3 A;  5H8Q B;  1B58 A;  1QUL A;  1VQ1 A;  1V92 A;  1JQJ C;  2QMX A;  1FPE A;  4PGN A;  4RY1 A;  4B3S M;  5FHM A;  1PJT A;  1UTB B;  3CRB A;  2HPG A;  5EYF A;  4DR6 M;  4IBK A;  4P16 A;  2DQV A;  3I6V A;  4I8C A;  1AIV A;  2ZYN A;  1R1N A;  5IZ1 A;  2DE3 A;  2JY8 A;  2R46 A;  1HNX M;  2QS1 A;  1IQ7 A;  2VF8 A;  4Z6Y A;  1FTA A;  3KP1 E;  3U6E A;  3JR4 A;  1XNQ M;  3NBI A;  4WXJ A;  1FJG M;  2HEU A;  3K9O A;  4LFA M;  3T1B A;  2DEN A;  4NF8 B;  1EZO A;  4GX3 A;  1I69 A;  4BDQ A;  2GQ1 A;  2P0S A;  4JI7 M;  4I5S A;  1SW5 A;  4HS7 A;  2AL4 A;  3ISP A;  3MVY A;  2P2A A;  2I3W A;  4K0K M;  3A42 A;  4P1E A;  2D3I A;  5L8R F;  3TQW A;  2QEN A;  4RNA A;  2B65 A;  1RDZ A;  1ORY B;  5LMN M;  3FD3 A;  1B46 A;  1XC8 A;  3L26 A;  3BFT A;  2LNH C;  3B7Q A;  4F2O A;  5L9S A;  1NUZ A;  4G77 A;  2I58 A;  4H8I A;  3ZC7 B;  4F1I A;  3RPL B;  4YKI A;  3IOW A;  3DZD A;  2XSZ A;  3K1J A;  5FTN A;  3HFU A;  3LSF B;  1IXS A;  4XK8 F;  3GO8 A;  4MLQ A;  5CI5 A;  3T38 A;  3IEC A;  2DI0 A;  1CNQ A;  3TEP A;  3J2P B;  2F5X A;  2VD3 A;  5FHO A;  4FE8 A;  1NUX A;  5L9O A;  4QFO A;  1WXQ A;  4I8O A;  1MY3 A;  1MXU A;  4LJ5 A;  4GRK A;  2Y7K A;  2KLF A;  3EHT A;  2O1M A;  3KOW E;  1DGB A;  2R4E A;  4G3O A;  1IEJ A;  1JEU A;  3UN6 A;  2I6E A;  2PYY A;  2QBY A;  4WKM A;  3D8B A;  1IM2 A;  1E9R A;  1Q1K A;  4MM3 B;  1NV4 A;  1ZJL A;  5E26 A;  4JYA M;  3PNV A;  1IMF A;  1CE2 A;  1JVY A;  3IL1 B;  4QRZ A;  5JI2 E;  4ZEK A;  3K02 A;  1TFD A;  4U1Z A;  2APL A;  2R62 A;  5B70 A;  1GL7 A;  2DWJ A;  1PC3 A;  4WP2 A;  1R5L A;  4NSO B;  1NY6 A;  1FQE A;  2WSE F;  3TOD A;  4R74 A;  1GJS A;  1MXW A;  3AJI B;  2Z23 A;  1NKX A;  2DE2 A;  1FW0 A;  3PUV E;  5H37 D;  2L09 A;  1SPI A;  2I49 A;  1M5D A;  5ICT A;  2R4J A;  4IR8 A;  4O3A A;  4LG2 A;  1M5C A;  2NOO A;  4OVZ B;  4FCW A;  2DAG A;  1USY H;  1A40 A;  4AS5 A;  4QSD A;  5DVJ A;  1FTM A;  2F5O A;  1QUI A;  2LVQ D;  3B50 A;  1NV6 A;  2XXH A;  5H8Q A;  4IJE A;  3O6H A;  4QSC A;  3HWS A;  3GQ5 A;  2CEA A;  1AWB A;  2QSX A;  2K9D A;  4U23 A;  5TPA B;  4DIG A;  4HLQ A;  3SES A;  2WSF F;  5DYH A;  2Z8F A;  4NSR A;  1H43 A;  1LBY A;  5FHN A;  4OHN A;  4Q5T A;  4LF8 M;  3WAE A;  1KSF X;  2DVW B;  2XXQ A;  3PUY E;  4MNP A;  1Y1M A;  4OES A;  3KEI A;  4LFB M;  4P8B A;  3N5L A;  4PFW A;  4OW0 A;  1BP5 A;  4GLI A;  3MVX A;  1JB0 F;  1HSL A;  4YMB A;  3KBR A;  4EXK A;  3O97 A;  1US5 A;  1ZV1 A;  3ECR A;  1NNT A;  3H7M A;  3N6U A;  5DT6 A;  3S2V A;  1NJF A;  3SEV A;  3FUV A;  2V84 A;  1JR3 A;  3U6M A;  3RYD A;  3Q27 A;  1FNN A;  2FBP A;  1MXV A;  1GTK A;  1R6B X;  2H25 A;  3B6W A;  3OO7 A;  3LCU A;  4RPN A;  2Y7P A;  3S4U A;  3KOS A;  1PEB A;  4OVT A;  5IT9 S;  3SZP A;  2XF3 A;  3EPE A;  1R6Z A;  4DXC A;  3QXM A;  3MZ1 A;  2CP8 A;  3E46 A;  5HPQ A;  2F97 A;  3AKZ A;  4H67 A;  1TWY A;  3EHU A;  3U72 A;  5ITQ A;  2P1S A;  3FUW A;  4DV3 M;  2QP9 X;  4MH0 E;  3C9P A;  4ZDM A;  2H99 A;  4X66 M;  2HXW A;  3TAJ A;  1FBD A;  2DVC A;  5ITX E;  2M5Z A;  2OX3 A;  3C32 A;  3A98 B;  3K6X A;  4DZ1 A;  2UXD M;  3OOA A;  4JVD A;  2H4I A;  3MPK A;  4B08 A;  3C36 A;  4OFO A;  4X1B A;  2Q2C A;  3C3E A;  4NTL A;  4DXB A;  4I62 A;  2O51 A;  1KYI A;  4R2F A;  2XZU A;  1DTZ A;  1DK4 A;  3H4Z A;  4LF6 M;  3U6C A;  1EIJ A;  1POY 1;  2B4M A;  5CMM A;  3EN3 A;  1P1N A;  4CIZ A;  1MXY A;  5TP9 A;  3W0L B;  2A5Y B;  1L8Q A;  4B3T M;  1G0H A;  4JVC A;  3BIH A;  2DZL A;  1B52 A;  3AV0 A;  1AIP C;  1OLC A;  4RXL A;  1RU3 A;  1N3X A;  2I0B A;  1L1Z A;  1FPJ A;  3K92 A;  2R6G E;  1ZMG A;  4PFB A;  1B7U A;  4I40 A;  2QNJ A;  3DOA A;  2ZMB A;  3W9V A;  3AOE A;  1P1Q A;  1G4A E;  3QYT A;  2I4C A;  3U6Q A;  4JI2 M;  3MP6 A;  5I2K A;  1N76 A;  5KPZ A;  3TCG A;  4ECF A;  1OQG A;  4LGM A;  4G4R A;  4FVM A;  4DR2 M;  1Z6T A;  4UN2 B;  2EO2 A;  3HV1 A;  2IA4 A;  3U6D A;  3VXC A;  4C0R A;  2OPF A;  4JI0 M;  4PQJ A;  2VQE M;  3F11 A;  1YLA A;  4AZF A;  2ZZV A;  2R9J A;  2DWM A;  5I56 B;  5IAI A;  1MRP A;  5J1D A;  2O25 A;  2MGW A;  2DXI A;  1NHG C;  3IOU A;  1URD A;  4LRT A;  3VLU A;  2DWZ B;  3VK7 A;  1JVX A;  5DEX B;  1G41 A;  4PC9 A;  1NV1 A;  4G4Q A;  1JR3 D;  1SW2 A;  1OVT A;  2F78 A;  3I01 M;  4MGK E;  4EIW A;  1LAG E;  4GX6 A;  1T6O A;  1H44 A;  1VEJ A;  4OEV A;  4R6Y A;  4PET A;  4F18 A;  2O7I A;  2ONR A;  3MUQ A;  1NV8 A;  3HHY A;  2Y0T A;  1G59 A;  2B3T A;  3FYD A;  3FYC A;  3GLH A;  4IBE A;  1N34 M;  1YYZ A;  2PT1 A;  2UYE A;  4FIM A;  4LQ2 A;  1Q3C A;  4RK2 A;  1SG9 A;  3HN0 A;  3SEY A;  5CMC A;  4JI1 M;  2V93 A;  3RUM A;  5EQ9 A;  3FE3 A;  5EP1 A;  4PDG A;  3R6U A;  4AG5 A;  4F22 A;  4NF6 B;  1V33 A;  2R6F A;  1YE9 A;  3HZJ A;  1HNZ M;  4RK9 A;  2HKJ A;  4LJ7 A;  4GHA A;  1TT1 A;  1LGB C;  4GWZ A;  1SXJ E;  5IRE B;  3SYK A;  4L17 A;  5CMK A;  3K01 A;  2RKO A;  4IBC A;  4P11 A;  4GH9 A;  3E13 X;  2LVO C;  2XXR A;  4U4X A;  1URS A;  4C1T A;  4AI6 A;  1JW4 A;  2F5P A;  4D81 A;  4QSE A;  3PTY A;  1J5E M;  3I4V A;  1MPC A;  1LB9 A;  1IXZ A;  1DMB A;  3OEL A;  4CHT B;  3GLI E; 
#chains in the Genus database with same CATH homology
 3HHG A;  3HKP A;  2Z4R A;  4XGI A;  4OU7 A;  4FD2 A;  1Z7M E;  3FIR A;  2ABH A;  5F3W A;  4ZS9 A;  1NH8 A;  2Y20 A;  4IO7 A;  3EHS A;  1N78 A;  1NMU A;  3MZ9 A;  4NF4 B;  2OCU A;  1L2C A;  2RC7 A;  1PDA A;  4DXU A;  3FTF A;  1P1U A;  4AKH A;  4AB6 A;  1B51 A;  2HHH M;  3U6S A;  3AXF A;  1RYX A;  3OO6 A;  1XNR M;  1TXF A;  3PD8 A;  3RNN A;  2Z4S A;  1GR2 A;  3G3F A;  1B6H A;  4AKI A;  2H1R A;  2R71 A;  3SAR A;  1M5B A;  1OVB A;  4JBZ A;  5IZ7 D;  3HJS A;  3VFJ A;  4EXL A;  2B3B A;  2QL3 A;  3EIE A;  4KHP M;  4MFI A;  1FTJ A;  3QSL A;  1NNP A;  4LJ6 A;  4DV7 M;  2AHM A;  2QRY A;  4OVZ A;  2BJV A;  5DYG A;  1MS7 A;  2GFE A;  3UMM A;  1LST A;  4K3F A;  4S12 A;  1US4 A;  3SHF A;  4LCB A;  1Z59 A;  3R26 A;  3G3I A;  5AA1 A;  5DNY A;  4FEB A;  2Q9T A;  2ZYK A;  3FVG A;  3FXR A;  1SBP A;  5C18 A;  4TQU Q;  3GPX A;  3OMB A;  4ELO A;  4TUW A;  1MU5 A;  4M0W A;  2VII A;  2GH9 A;  3ONM A;  4BDL A;  3FJG A;  3NWL A;  4ESX A;  4I4L A;  8CAT A;  3DLN A;  4Q8R A;  1ZTY A;  3C33 A;  3MQ9 A;  1BTJ A;  2UXC M;  2VQF M;  1SQY A;  2RIN A;  3CF2 A;  1N7X A;  3TWL A;  1MQH A;  4FAJ A;  2F5N A;  5KQ8 A;  1ZKB A;  4FJP A;  2UU9 M;  4RYA A;  2CHG A;  1L2D A;  3BBR A;  1PM5 A;  2XD2 A;  4Z7E A;  4QOZ C;  3Q25 A;  2KEB A;  1VFD A;  2EUC A;  3IG5 A;  4LZZ A;  3KJ7 A;  3C58 A;  2Q88 A;  1LFG A;  3I5O A;  4YKP A;  5DTB A;  1HQY E;  1LLS A;  3ZCB B;  4LJ4 A;  3PUX E;  1QW0 A;  3CFL A;  2YLN A;  4ZED A;  1SI1 A;  1IUD A;  2QMW A;  4G6Z A;  5KQD A;  4GKK M;  4ELP A;  3MPL A;  3OSR A;  2ZYM A;  1L5T A;  2Y21 A;  3ZSF A;  4IO4 A;  4XKP A;  3K4U A;  3A09 A;  3WAF A;  3FVO A;  1RKM A;  4ZZE A;  4GC9 A;  2Z3X A;  3PPP A;  1B1H A;  3THI A;  3FD9 A;  3GRV A;  1TDH A;  3PUZ E;  1JW1 A;  5IKB A;  4YB6 A;  5I59 B;  3P7I A;  1IY1 A;  1YTV A;  2F36 A;  4GQO A;  4M4G A;  3FXU A;  1UTH A;  4XKQ A;  4F39 A;  4PD2 A;  3A46 A;  2UVH A;  1ZU0 A;  1GVC A;  3QUJ A;  3HGI A;  3U8Q A;  2UVI A;  4JN6 A;  3EIH A;  2XH9 A;  2EA0 A;  1UTH B;  3PFI A;  1NFT A;  4BLC A;  3O28 A;  1H45 A;  3D8L A;  4AQY M;  2L6O A;  1IIT A;  1P99 A;  2C98 A;  2V3T A;  5I2K B;  5I57 B;  3TZA A;  3B9P A;  1WVJ A;  3FUX A;  5I84 A;  3J81 S;  1BLF A;  4R2B A;  1PJI A;  5AA4 A;  4JWX A;  2DZO B;  3PPN A;  1J7K A;  4M9Z A;  1BKA A;  2NQ8 C;  4FOR A;  4FWD A;  3G3H A;  4OTE A;  5FLX S;  4DV4 M;  4PP0 A;  3RE8 A;  2HL7 A;  2HZK A;  1IN7 A;  3C4M A;  5ITR A;  2F5S A;  3FTD A;  4IO6 A;  3FJM A;  2F6P A;  3G3J A;  2C9O A;  4II7 A;  2E0S A;  3MC2 A;  3V8X B;  3SYL A;  1IXI A;  2J7O A;  1OFH A;  2UUB M;  3MWB A;  1R2Y A;  1QUK A;  2C96 A;  4BDM A;  3LQR A;  4MGH A;  4R75 A;  4G8N A;  1B0H A;  1HSJ A;  3TWK A;  4PFY A;  1IN6 A;  4RNS A;  3KN8 A;  3PGF A;  4KYE A;  1XXH A;  1GLN A;  5ITU A;  1I94 M;  1R2Z A;  1BIY A;  2ALU A;  4OFL A;  4LP2 B;  2F4V M;  4OEU A;  5AA2 A;  4MLV A;  3J27 B;  3KDS E;  3L25 A;  4YMA A;  4L15 A;  4OVJ A;  5CBS A;  4NL4 H;  2NWJ A;  1LB8 A;  4F2Q A;  1MH4 A;  4LVQ A;  4WEP A;  3TTN A;  1FQC A;  1MXX A;  4OFJ A;  3W9W A;  1XMQ M;  3G3K A;  4U1O A;  1MY4 A;  2XFS A;  4LFC M;  2HCA A;  1IXC A;  1Z7N E;  3GLI B;  4U21 A;  1Y4C A;  3IAZ A;  2Q2E B;  2CZL A;  2I7N A;  4ZE9 A;  4AQ4 A;  3H06 B;  2LAO A;  3G3G A;  3IX1 A;  1EZ9 A;  4GXS B;  3RLF E;  3TTR A;  2ZAN A;  4F29 A;  1ZAE A;  1XS5 A;  4GL8 A;  3VLW A;  1LAH E;  4H5F A;  4EQ7 A;  2O5R A;  3OSQ A;  1FQD A;  1UIV A;  5JTY B;  1VR5 A;  3SEU A;  3GLG B;  3E3K A;  3PV0 E;  3HU2 A;  1PJJ A;  1NJG A;  4YY3 M;  3U93 A;  2XLJ A;  1LAX A;  4ZE8 A;  3SMS A;  3KOT A;  2ZM6 M;  1H6U A;  4JXJ A;  4RJZ A;  3A3U A;  5E6J A;  1XHB A;  1SW1 A;  4LY6 A;  5LOM A;  3M6A A;  2O69 A;  3H6V A;  3OEM A;  3VLF B;  1R9L A;  4O3B A;  4R72 A;  5F7V A;  3S9E A;  1LBC A;  2F8D A;  3L6G A;  4FW9 A;  4L4U A;  4LF5 M;  4ESW A;  1JW5 A;  3KN7 A;  3FUZ A;  4ISU A;  3QIM A;  3GRY A;  4QHQ A;  5JK4 A;  4IBI A;  3SAS A;  1XHY A;  1TDZ A;  4KYS A;  1Q3B A;  2UXA A;  4JI6 M;  1MY2 A;  2C99 A;  3E4R A;  3KS4 A;  1FQB A;  3O66 A;  4RA1 A;  1DO0 A;  3UZU A;  2V25 A;  1B4Z A;  4MH5 A;  4EF2 A;  5L9M A;  1SXJ C;  3ILT B;  4I81 A;  4MGI E;  1FQF A;  4XXU A;  1N3W A;  1B05 A;  2G29 A;  2KRK A;  4DCY A;  1QAQ A;  3HJQ A;  3GZG A;  4H65 A;  1OLA A;  4M9S A;  3SEW A;  4MGY E;  1B7Z A;  5L8D A;  1OMP A;  4G2Z A;  2R18 A;  3HU1 A;  5IWA M;  3K6U A;  4N13 A;  1DTG A;  2G93 A;  4DV1 M;  3TFL A;  3TTK A;  5HBC A;  1DGG A;  1NVM A;  4GIT A;  3HHX A;  3LVW A;  5BPV A;  3U5Z B;  5EXT A;  1MY1 A;  3UK4 A;  7CAT A;  4IGR A;  2X49 A;  3MK6 A;  4JSO A;  4KYD A;  3KS8 A;  2YNM D;  1Y3N A;  1NNU C;  3CG1 A;  1IY0 A;  2QS2 A;  3TQL A;  2H9B A;  2F5Q A;  1MQD A;  4IY6 A;  2R45 A;  2DWI A;  1TH3 A;  4EUO A;  2RCA A;  1UTB A;  4IO5 A;  3JAM S;  2QS3 A;  1O64 A;  4KPT A;  1KWH A;  4IY5 A;  4X65 M;  2OBG A;  5BR8 M;  1OFI A;  2KW0 A;  3PMX A;  2O7U A;  1SW4 A;  1GKI A;  1X37 A;  4OYV A;  3MZB A;  2V1C A;  3RTF B;  3GLI A;  1ZIU A;  3S9N C;  3KSJ A;  4F19 A;  2CE7 A;  1DGH B;  4ND9 A;  4R3D A;  1NY5 A;  4NOO B;  5EHS A;  3KG2 A;  5H8N A;  1DO2 A;  1WOD A;  5EP4 A;  2NUV A;  4IO2 A;  4XIG Q;  4LJ9 A;  3K00 A;  3SAT A;  3L27 A;  3MP8 A;  4IGT A;  4ELQ A;  2V3U A;  3VKG A;  3DP6 A;  4OET A;  3ZKK A;  1WDN A;  5FSW A;  3M8U A;  3S9M C;  4GHL A;  2F7C A;  3GLB A;  1NHW C;  3AFH A;  3JV9 A;  1F9B A;  4IB2 A;  3UGJ A;  4BB9 A;  1Y4T A;  4ZEF A;  3L29 A;  4FCT A;  5DVI A;  2W82 A;  2DP8 A;  4H5G A;  2X8A A;  1PB8 A;  3FTE A;  3KSX A;  1IBM M;  4IBD A;  2DWN A;  5BUU A;  4U22 A;  4H0W A;  4WUR A;  2REG A;  4KI0 E;  2Q89 A;  5EJC A;  1MXZ A;  2BJW A;  3H6T A;  1IZ1 A;  2D5W A;  1N36 M;  4F31 B;  1XVY A;  3T9X B;  3V5A A;  4BDR A;  2HCB A;  1SD3 A;  3K1N A;  1OJL A;  1XWI A;  1B7H A;  4X1D A;  1MDQ A;  5EP2 A;  1PBQ A;  2F6G A;  3H4M A;  3IOR A;  2YR0 A;  4N6P A;  1ATG A;  1TGU A;  3OO8 A;  3K8Z A;  4U4S A;  4YB5 A;  3VE1 B;  4BDO A;  1SI0 A;  3HHF A;  2M8C A;  2HAV A;  5K2Y A;  5EP3 A;  4MBP A;  1B5J A;  3FZV A;  4R9F A;  4AW4 A;  4LRS A;  4YIC A;  3VV5 A;  5JTY A;  1DPP A;  1JEV A;  4OER A;  1R7R A;  3EF7 A;  1R9Q A;  2I48 A;  3RTW B;  3LSX A;  3QAU A;  3PMV A;  4KLN A;  4HCY A;  3RPW A;  1LAF E;  3GBB A;  3DP8 A;  1TH4 A;  1B5I A;  1LV7 A;  1O7T A;  2PMS A;  2HQ0 A;  3TL4 X;  1I4W A;  2THI A;  2XXU A;  3O6I A;  4UA8 A;  1LBB A;  3S9L C;  2LH0 A;  2CFO A;  4R9G A;  1VDD A;  3FAT A;  4G8H A;  1B3E A;  3HPI A;  1Y3Q A;  2D7H A;  4LF9 M;  1QZM A;  2PT2 A;  2J7N A;  1D9Y A;  4UAC A;  1I6A A;  1B32 A;  1K3W A;  4KO8 A;  2QPQ A;  4KQP A;  1ANF A;  2V3Q A;  2CV2 A;  4P0I A;  3LSW A;  2UUC M;  3THG A;  3B6T A;  1SYH A;  3I3V A;  2E5L M;  3M3K A;  3H6U A;  1W5T A;  3TYH A;  3O29 A;  4OZ9 A;  2R65 A;  2Y7W A;  3WHK A;  1UIU A;  4QF9 A;  4JI8 M;  3MJN A;  3USD A;  2Y7I A;  4BLA A;  2AIX A;  4PFT A;  4R6K A;  2ZNU A;  3MJ5 A;  2PBW A;  3UP9 A;  1OQH A;  3DA1 A;  3LVV A;  1QQW A;  2I7P A;  4GWO A;  2KZU A;  2LXE A;  3AL0 C;  3DEL B;  2HZL A;  1KFV A;  3MP1 A;  4ZEB A;  3K2D A;  1YSY A;  2XXI A;  3CG3 A;  1P1W A;  4LZJ A;  3L2A A;  4FWG A;  4D82 A;  1EE8 A;  5BWJ A;  3SMP A;  2F34 A;  2WKY A;  3VXB A;  1B0L A;  2F7A A;  1DOT A;  4QOS A;  1B2H A;  1A54 A;  5KPT A;  3VDU A;  4GKJ M;  2A5T A;  3VVD A;  4X9T A;  5EXS A;  2B3F A;  4G68 A;  5C1B A;  5AA4 B;  2M60 A;  3JR5 A;  2XXT A;  1MX0 A;  1E32 A;  4Q30 B;  2YQZ A;  4DR5 M;  2RF1 A;  3FUT A;  3JYR A;  4GL0 A;  4QFP A;  3U6L A;  2O6A A;  4IBJ A;  2XFT A;  4B3M M;  4EQ9 A;  2DS9 A;  4DUY M;  1SYI A;  2P5T A;  1GGG A;  2FFJ A;  3FVK A;  2OJT A;  4G8M A;  3K1M A;  3UOR A;  5H8F A;  1NL5 A;  3BKI B;  1N75 A;  1A8F A;  1HQC A;  5FTM A;  3OD7 A;  2QCU A;  3CVG A;  3LQQ A;  4GRI A;  1FTO A;  1ELJ A;  3A3C A;  4NXN M;  3R8F A;  5H8F B;  3K1P A;  4NF4 A;  3R7X A;  1LFH A;  3IB0 A;  3AOE C;  3ODB A;  4JI5 M;  3U94 A;  4PDI A;  4ONY A;  4DDD A;  3K6W A;  3T93 B;  3QUF A;  3FGS A;  3KOZ E;  5AA2 B;  4JI4 M;  3KP0 E;  2QZ4 A;  3SAU A;  2XGN A;  2A5T B;  1NNK A;  5CMB A;  2H98 A;  2AYS A;  4TLM B;  3U5Z A;  3SAV A;  2I3V A;  3U60 B;  5I57 A;  2K47 A;  2XX8 A;  3SFZ A;  4OWD A;  3TKD A;  3SER A;  3KFU G;  1QKB A;  1I6B A;  2UYF A;  2UUA M;  4PCZ A;  4B7F A;  4YB7 A;  1MQG A;  3SKP A;  4IJF A;  1QUJ A;  1QAN A;  2D7G A;  2RC8 A;  1MQJ A;  3LR1 A;  4GFR A;  3PPR A;  4C1U A;  3MAM A;  3FV2 A;  3T9U A;  5FTH A;  2C9C A;  4JDF A;  1LFI A;  1S50 A;  3Q8X A;  3TQS A;  2G5G X;  3ILK A;  2Y0Q A;  2GRV A;  2BJJ X;  1URG A;  4FCV A;  2O68 A;  4X62 M;  5EXP A;  5KZT A;  3PUW E;  3Q28 A;  4ZEI A;  2GHA A;  1N77 A;  1XT8 A;  2OWT A;  1IIW A;  3OXN A;  1W5S A;  3CTW B;  4LF7 M;  3LUY A;  4HCW A;  4YU0 A;  2V6Z M;  4I1D A;  3FUU A;  5ICQ A;  3M0E A;  3GPP A;  3IOV A;  3RQT A;  1MQI A;  4JB7 A;  4DV0 M;  4F1V A;  2X7P A;  2ZXT A;  2H5Y A;  2XSZ D;  3DP4 A;  2XD3 A;  1Y20 A;  4POX A;  4LZ8 A;  1MPB A;  4ZPX A;  2FE8 A;  1K82 A;  4DE8 A;  2ZNS A;  4THI A;  2F35 A;  3FKE A;  4NWC A;  1DGF A;  3A45 A;  4OX9 M;  3MW0 A;  3UJN A;  3RFW A;  1AOV A;  3PXG A;  3BFU A;  3KVW A;  1IN5 A;  3IB2 A;  2Z22 A;  3UIF A;  3MVW A;  4H6D A;  4IBF A;  3KOY E;  3U60 A;  4L78 A;  2QJE A;  3D4G A;  4KCD A;  2KA6 B;  4JV5 M;  1PBP A;  4H1X A;  3TDJ A;  4LA9 A;  3LMM A;  1MG1 A;  4A3V B;  4MB7 A;  1HSE A;  3K2L A;  4BDN A;  1QAO A;  3GRU A;  3VKH A;  2XEP A;  3PD9 A;  1A8E A;  1B3F A;  3CF0 A;  3FV1 A;  4RF1 A;  5KCJ A;  4ITQ A;  1VSO A;  3TTL A;  1HT2 E;  1EH3 A;  3PVS A;  2XXY A;  3J7B A;  4OEN A;  2HFB A;  1B5H A;  3O9P A;  4F3P A;  3K6V A;  2Z8D A;  4NED A;  3O6G A;  2V1U A;  3FJ7 A;  2DZN B;  2QPA A;  4EDP A;  2DWL A;  2OWS A;  1B40 A;  4F3B A;  1QYR A;  3CSB A;  1Z5A A;  1N84 A;  4IO3 A;  3C31 A;  1IN4 A;  1IXH A;  1SXJ A;  2OZZ A;  4POW A;  3TEL A;  4DR7 M;  4DCX A;  1HT1 E;  4MF3 A;  1N04 A;  5CBR A;  3I51 A;  4FED A;  1B1X A;  3CF6 E;  2KXE A;  4GIP A;  4DLD A;  3IR1 A;  3QK6 A;  1N0T A;  1C1K A;  4NXM M;  3KW6 A;  2ANJ A;  2X7Q A;  1NH7 A;  4DR3 M;  3VDF A;  4E0X A;  3SHG B;  5ISU A;  4ZZA A;  3HHW A;  5EQT A;  1POT A;  3FVN A;  1IXR C;  3L6H A;  5KDT B;  1FTL A;  2YJP A;  3VVE A;  2OK2 A;  4NF6 A;  4GC5 A;  1LCF A;  1D2N A;  4G68 C;  3VK8 A;  4QFK A;  3N26 A;  1GV8 A;  1QJM A;  3U6P A;  1T3T A;  3CR9 A;  3FTC A;  4R7G A;  3TE6 A;  3IOT A;  1TFA A;  1S9T A;  4B7G A;  4QFN A;  4Q0C A;  3TPA A;  1N33 M;  5GKN A;  1XOC A;  2XXX A;  4KCC A;  2XX9 A;  2VGQ A;  1Y3P A;  2VP1 A;  4DUZ M;  1SDX A;  2DHR A;  5M2V A;  3GQ3 A;  3GPY A;  2C5R A;  5I2N B;  3T66 A;  1RYO A;  2ZAO A;  1D9V A;  2VD2 A;  4XKR A;  2FA7 A;  5ITX A;  2NXO A;  3T9V A;  1EZP A;  1B3G A;  3HU3 A;  4EF1 A;  3PMW A;  4L16 A;  4YZZ A;  2CV1 A;  5K2X A;  3G7W A;  4FEC A;  1XC1 A;  4G4P A;  2I4B A;  4F3G A;  4DR4 M;  4R6H A;  3GLF B;  1MPD A;  2VOZ A;  4LZ7 A;  5AE4 A;  4IBB A;  4QNM A;  4B7H A;  1VE4 A;  1FCK A;  4MGZ E;  1XVX A;  3LBS A;  1M5F A;  4RPO A;  4JSD A;  5I59 A;  2AL5 A;  3QWL A;  5I2N A;  3RGY A;  3IG8 A;  3AOG A;  2ZAM A;  1Q35 A;  4HW8 A;  3LC8 A;  2I0C A;  2DVZ A;  1ZBM A;  3U1O A;  3CI8 A;  3U6O A;  4Z0I A;  1MM6 A;  2XX7 A;  5TP9 B;  1I6Q A;  4WW0 A;  4JWO A;  4TLL B;  1AMF A;  3HO7 A;  5CRY A;  5I58 A;  3PPO A;  3H03 A;  3M7G A;  1B4H A;  2Q8J A;  2IEE A;  4NWD A;  4JI3 M;  1S7Y A;  4RF0 A;  5H8H A;  2DYX A;  3IB1 A;  4NMY A;  1Z5C A;  1AH5 A;  4KR5 A;  4QHT A;  3M3L A;  3EQ1 A;  2A5S A;  4LJA A;  3PNY A;  2PX1 A;  3IO4 A;  5KDT A;  3SC3 A;  3SAW A;  2QBY B;  4GF8 A;  1FTK A;  4DV5 M;  1CB6 A;  1MH3 A;  1P1O A;  3GXA A;  4NF5 A;  3I4Y A;  5CM6 A;  2DOJ A;  4H8J A;  3TTM A;  3L28 A;  4OQO A;  2JA2 A;  1E94 E;  3TCH A;  3RN8 A;  3D4C A;  4KHZ E;  1XMO M;  1TH2 A;  1QVR A;  2XXW A;  3CIJ A;  4HTG A;  2KZS A;  1A99 A;  3C9H A;  4G4O A;  4X64 M;  3RGS A;  3HJ8 A;  5HM4 B;  2PVU A;  3KGC A;  4FWH A;  4NF5 B;  3MHV C;  3UGW A;  2ONS A;  2OQ4 A;  3HST A;  1QKA A;  4P0G A;  2CHV A;  5H8N B;  4CGY B;  3GLF A;  1SVX B;  3IK6 B;  2O1L A;  5ITY A;  3J80 S;  2UVG A;  3SET A;  4GMQ A;  1IN8 A;  3KZG A;  2W7Y A;  3TMG A;  3T9H B;  2ONK E;  3KN3 A;  3RT6 B;  3E9X A;  1II5 A;  4GD5 A;  2KRU A;  4N07 A;  1ZQ9 A;  3MBP A;  4DV6 M;  3GRR A;  1JNF A;  5A5X A;  5EHM A;  4NF8 A;  3DM0 A;  3CFZ A;  3KJT A;  4I9D A;  3DFZ A;  2DSF A;  2RGO A;  3RT8 A;  5KCJ B;  1MM7 A;  1PB7 A;  4U2R A;  3OEN A;  4LUB A;  1M5E A;  5DEX A;  4AG6 A;  5EXX A;  4M1V A;  3PU5 A;  1XXH B;  2FNA A;  4LZ5 A;  1FQA A;  3SDF A;  3Q29 A;  4DR1 M;  1IY2 A;  1QVS A;  4Z8X A;  5FTI A;  3J7A S;  4FAT A;  4OXV A;  1Q39 A;  5AA3 A;  2XXP A;  1ZLQ A;  4QHS A;  2UVJ A;  1N7W A;  3ZS6 A;  1E9S A;  3GP1 A;  2DXY A;  5I56 A;  2Z7J A;  3JZJ A;  4TOZ A;  2X4A A;  1B9J A;  4JWY A;  4ELR A;  3GBA A;  2CHQ A;  4M9X A;  1B3H A;  2F7B A;  3ZKL A;  3OTO M;  3IJO B;  3T1H M;  5TU0 A;  1B3L A;  2RGH A;  2Y7R A;  1IBL M;  4LF4 M;  5B7D A;  1MDP 1;  2E1S A;  4F1U A;  2DE4 A;  2DXR A;  5LMU M;  2L7H A;  4G68 B;  4REZ A;  4GOT A;  1PB9 A;  2D21 A;  3KXE C;  1N32 M;  5ITO A;  1S3S A;  2RC9 A;  5ITP A;  4NE4 A;  1MY0 A;  2HAU A;  5KO3 A;  3T1Y M;  3TCF A;  1J1N A;  2FYI A;  1SXJ B;  4OMB A;  3VFD A;  2X26 A;  4EQB A;  1H3D A;  4R73 A;  3V83 A;  4XBO A;  1A55 A;  1A7L A;  3OEK A;  4PE5 B;  5F1Q A;  2UXB M;  3B7D A;  3TWM A;  3GQ4 A;  1USY E;  1DPE A;  4BBA A;  5H8H B;  1AL3 A;  1IBK M;  1YCJ A;  3N6T A;  4XTC Q;  2O84 X;  3T22 A;  1JET A;  1OIB A;  3IO6 A;  5H8S A;  1NSF A;  5I58 B;  2G8L A;  1IQP A;  1H76 A;  4X48 A;  4KOD A;  4JXI A;  3U61 A;  2NVU B;  3GLG A;  3OO9 A;  1IXG A;  2CV0 A;  5AA2 D;  3M3F A;  1LCT A;  3K0V A;  3VLV A;  5FTL A;  1GL6 A;  3CFX A;  4IIW A;  1UQW A;  3SBJ A;  3CSG A;  4M0D A;  3ILU B;  4LAT A;  4CIS A;  3W15 C;  1YPN A;  1EU8 A;  1HR0 M;  4GXA A;  5A5X B;  2CMO A;  4PT5 A;  4DV2 M;  4YKK A;  4AKG A;  2VHA A;  1Y1Z A;  2YFQ A;  3O2A A;  5TPA A;  1DGH A;  3QAX A;  2RCB A;  4NRW A;  1YUB A;  3WHL A;  4LGY A;  2XXV A;  5ITT A;  3H6W A;  4QFL A;  1VFE A;  1DSN A;  4IBG A;  4B3R M;  5JEI A;  5KPR A;  3HHZ A;  4F3S A;  1J09 A;  4GIZ A;  1YAE A;  4QNR A;  5A2Q S;  4F1Y A;  4YAH X;  2DWA A;  2GHB A;  2LWX A;  2Y84 A;  1QAM A;  1K3X A;  5DVF A;  1UM8 A;  2DWH A;  1NNJ A;  4E0W A;  3VDP A;  3U61 B;  3T96 B;  3B6Q A;  1NNF A;  2OLB A;  1Y9U A;  4D80 A;  2RKM A;  4LON B;  3E9S A;  5ELV A;  3T15 A;  4XKN A;  2YPN A;  2XZF A;  3PPQ A;  3KOX E;  3H3G A;  5DYI A;  2XHD A;  3IJX B;  4HL4 A;  4AB5 A;  3VVF A;  4NRV A;  5CC2 A;  3R9X B;  1T0K A;  4LQ5 A;  3GLH B;  2ZNT A;  3FXQ A;  3TUS A;  4KD5 A;  1L2B A;  5FTK A;  4WED A;  3Q26 A;  2FOI C;  1D4N A;  4G4N A;  3BOS A;  4L8R C;  2D7E A;  3SEX A;  3U92 A;  1G8P A;  5JI3 E;  4PFU A;  2ERC A;  2BNK A;  1Z5B A;  5FTJ A;  4GVO A;  4KFQ A;  3ZH9 B;  2REJ A;  3MVZ A;  2Q2A A;  4YKJ A;  3N94 A;  3UK6 A;  4YHH M;  1GVN A;  3FAS A;  3W0F A;  3TPZ A;  3LSL A;  3V89 B;  1D3K A;  1IXS B;  2FNC A;  4ZEC A;  1JQF A;  1SXJ D;  1HNW M;  3C34 A;  3HCQ A;  3RGP A;  2L7I A;  2ZYO A;  4O3C A;  2CUZ A;  4W5W A;  2ZBK B;  1L1T A;  2QS4 A;  3C35 A;  3UA8 A;  2ESN A;  2Z8E A;  1G3I A;  3KFM A;  1O63 A;  4LJ8 A;  3GPU A;  3RY3 A;  5H8Q B;  1B58 A;  1QUL A;  1JQJ C;  2QMX A;  4RY1 A;  4B3S M;  5FHM A;  1UTB B;  3CRB A;  5EYF A;  4DR6 M;  4IBK A;  4P16 A;  2DQV A;  3I6V A;  4I8C A;  1AIV A;  2ZYN A;  1R1N A;  2DE3 A;  1HNX M;  2R46 A;  2QS1 A;  1IQ7 A;  4Z6Y A;  3KP1 E;  3U6E A;  3JR4 A;  1XNQ M;  3NBI A;  4WXJ A;  1FJG M;  2HEU A;  4LFA M;  4NF8 B;  1EZO A;  1I69 A;  4BDQ A;  2P0S A;  4JI7 M;  4I5S A;  1SW5 A;  4HS7 A;  2AL4 A;  3MVY A;  2P2A A;  2I3W A;  4K0K M;  3A42 A;  2D3I A;  3TQW A;  2QEN A;  4RNA A;  2B65 A;  1ORY B;  5LMN M;  3FD3 A;  1B46 A;  1XC8 A;  3L26 A;  3BFT A;  2LNH C;  4F2O A;  5L9S A;  4G77 A;  2I58 A;  4H8I A;  3ZC7 B;  4YKI A;  3IOW A;  3DZD A;  2XSZ A;  3K1J A;  5FTN A;  3LSF B;  3GO8 A;  4MLQ A;  5CI5 A;  3T38 A;  3TEP A;  3J2P B;  2F5X A;  2VD3 A;  5FHO A;  4FE8 A;  5L9O A;  4QFO A;  1WXQ A;  4I8O A;  1MY3 A;  1MXU A;  4LJ5 A;  4GRK A;  2Y7K A;  2KLF A;  3EHT A;  2O1M A;  3KOW E;  1DGB A;  2R4E A;  1IEJ A;  1JEU A;  3UN6 A;  2I6E A;  2PYY A;  2QBY A;  4WKM A;  3D8B A;  1IM2 A;  1E9R A;  1Q1K A;  4MM3 B;  1ZJL A;  5E26 A;  4JYA M;  3PNV A;  1CE2 A;  1JVY A;  3IL1 B;  4QRZ A;  5JI2 E;  4ZEK A;  3K02 A;  1TFD A;  4U1Z A;  2R62 A;  5B70 A;  1GL7 A;  2DWJ A;  1PC3 A;  4NSO B;  1NY6 A;  1FQE A;  3TOD A;  4R74 A;  1MXW A;  3AJI B;  2Z23 A;  1NKX A;  2DE2 A;  1FW0 A;  3PUV E;  5H37 D;  2L09 A;  2I49 A;  1M5D A;  5ICT A;  2R4J A;  4O3A A;  4LG2 A;  1M5C A;  2NOO A;  4OVZ B;  4FCW A;  1USY H;  1A40 A;  4QSD A;  5DVJ A;  1FTM A;  2F5O A;  1QUI A;  2XXH A;  5H8Q A;  4IJE A;  3O6H A;  4QSC A;  3HWS A;  3GQ5 A;  2CEA A;  2QSX A;  4U23 A;  5TPA B;  4DIG A;  4HLQ A;  3SES A;  5DYH A;  2Z8F A;  4NSR A;  1H43 A;  5FHN A;  4OHN A;  4Q5T A;  4LF8 M;  3WAE A;  1KSF X;  2DVW B;  2XXQ A;  3PUY E;  1Y1M A;  4OES A;  3KEI A;  4LFB M;  4PFW A;  3N5L A;  4OW0 A;  1BP5 A;  4GLI A;  3MVX A;  1HSL A;  4YMB A;  3KBR A;  4EXK A;  3O97 A;  1US5 A;  3H7M A;  3ECR A;  1NNT A;  3N6U A;  5DT6 A;  3S2V A;  3SEV A;  1NJF A;  3FUV A;  2V84 A;  1JR3 A;  3U6M A;  3Q27 A;  1FNN A;  1MXV A;  1GTK A;  1R6B X;  2H25 A;  3B6W A;  3OO7 A;  4RPN A;  2Y7P A;  3S4U A;  3KOS A;  1PEB A;  5IT9 S;  2XF3 A;  3EPE A;  1R6Z A;  4DXC A;  3QXM A;  3MZ1 A;  5HPQ A;  2F97 A;  3AKZ A;  4H67 A;  1TWY A;  3EHU A;  3U72 A;  5ITQ A;  2P1S A;  3FUW A;  4DV3 M;  2QP9 X;  4MH0 E;  4ZDM A;  2H99 A;  4X66 M;  2HXW A;  3TAJ A;  2DVC A;  5ITX E;  2M5Z A;  3C32 A;  3A98 B;  3K6X A;  4DZ1 A;  2UXD M;  3OOA A;  2H4I A;  3MPK A;  4B08 A;  3C36 A;  4OFO A;  4X1B A;  2Q2C A;  4NTL A;  4DXB A;  4I62 A;  2O51 A;  1KYI A;  4R2F A;  2XZU A;  1DTZ A;  3H4Z A;  4LF6 M;  3U6C A;  1POY 1;  5CMM A;  3EN3 A;  1P1N A;  1MXY A;  5TP9 A;  3W0L B;  2A5Y B;  1L8Q A;  4B3T M;  1B52 A;  1OLC A;  3AV0 A;  4RXL A;  1N3X A;  2I0B A;  1L1Z A;  3K92 A;  2R6G E;  1ZMG A;  1B7U A;  3DOA A;  2ZMB A;  3W9V A;  3AOE A;  1P1Q A;  1G4A E;  3QYT A;  2I4C A;  3U6Q A;  4JI2 M;  3MP6 A;  5I2K A;  1N76 A;  5KPZ A;  3TCG A;  4ECF A;  1OQG A;  4LGM A;  4G4R A;  4FVM A;  4DR2 M;  1Z6T A;  2EO2 A;  3HV1 A;  2IA4 A;  3U6D A;  3VXC A;  4C0R A;  2OPF A;  4JI0 M;  4PQJ A;  2VQE M;  3F11 A;  4AZF A;  2R9J A;  2DWM A;  5I56 B;  5IAI A;  1MRP A;  5J1D A;  2DXI A;  1NHG C;  3IOU A;  1URD A;  4LRT A;  3VLU A;  2DWZ B;  3VK7 A;  1JVX A;  5DEX B;  1G41 A;  4G4Q A;  1JR3 D;  1SW2 A;  1OVT A;  2F78 A;  4EIW A;  4MGK E;  1LAG E;  1H44 A;  4OEV A;  4R6Y A;  4PET A;  4F18 A;  2O7I A;  2ONR A;  3MUQ A;  3HHY A;  2Y0T A;  1G59 A;  3FYD A;  4IBE A;  3FYC A;  3GLH A;  4FIM A;  1N34 M;  2PT1 A;  2UYE A;  4LQ2 A;  1Q3C A;  4RK2 A;  3HN0 A;  3SEY A;  5CMC A;  4JI1 M;  2V93 A;  3RUM A;  5EP1 A;  4PDG A;  3R6U A;  4AG5 A;  4F22 A;  4NF6 B;  1YE9 A;  1HNZ M;  4RK9 A;  2HKJ A;  4LJ7 A;  4GHA A;  1TT1 A;  1LGB C;  4L17 A;  1SXJ E;  5IRE B;  3SYK A;  5CMK A;  3K01 A;  2RKO A;  4IBC A;  4P11 A;  4GH9 A;  3E13 X;  2XXR A;  4U4X A;  1URS A;  4C1T A;  4AI6 A;  1JW4 A;  2F5P A;  4D81 A;  4QSE A;  1J5E M;  3I4V A;  1MPC A;  1LB9 A;  1IXZ A;  1DMB A;  3OEL A;  4CHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...