4DUYM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duyM02
4OX9M 1HR0M 1R2ZA 4B3MM 1XC8A 4JI4M 5IWAM 1I94M 3GPPA 4DR1M 4LF9M 2UUAM 3U6MA 3SASA 1PM5A 1K3WA 1TDHA 2HKJA 4NRVA 4GKJM 5FLXS 4AQYM 4DUZM 4JI0M 3SATA 4X62M 1PJIA 4ITQA 1HNWM 2UXBM 3A45A 1K82A 4CISA 3A46A 2UUBM 1HNXM 2HHHM 1L1TA 4JI1M 2ZBKB 4PDIA 4YHHM 5LMUM 4X64M 4DR4M 4JYAM 3VK8A 1L2DA 4LF5M 3SAUA 4LFBM 4MB7A 3VK7A 3C58A 4LF6M 4G4RA 4LF4M 1MX0A 1Z5CA 3SAVA 4PCZA 2F5PA 1XMQM 1NNJA 4DR7M 2F5NA 3GQ4A 3U6DA 4NXMM 4NXNM 3T1YM 2F4VM 3SBJA 4LF8M 1Q3CA 2OPFA 4K0KM 4DV1M 5ITXA 1Z5AA 1MU5A 4PDGA 2OQ4A 3U6CA 1Z5BA 4DR5M 1N32M 3TWKA 5ITYA 1Q3BA 3U6PA 1IBLM 3J7AS 4JV5M 4DUYM 5ITUA 2UXCM 4B3TM 3GPUA 1HNZM 4JI6M 4DR2M 5ITQA 1IBKM 1FJGM 4G4NA 4JI7M 5LMNM 3JR4A 3U6QA 4LFAM 5ITRA 1R2YA 2UUCM 4JI3M 3W0FA 5ITXE 3SAWA 3GO8A 4NRWA 4B3RM 5BR8M 3A42A 4DV3M 4G4OA 2UU9M 4LF7M 4G4QA 2VQFM 1N34M 2XZFA 4DV5M 4YY3M 3SARA 4DV4M 3GP1A 2VQEM 4KHPM 3TWLA 1L2CA 1XNRM 1Z59A 1N36M 5IT9S 1EE8A 1IBMM 1K3XA 2E5LM 3JAMS 2F5OA 4DR3M 4DV2M 1L1ZA 4JI5M 2XZUA 3TWMA 1J5EM 4LFCM 4DV7M 4DR6M 3T1HM 1KFVA 2F5SA 4DV0M 1N33M 3J80S 2ZM6M 1Q39A 4X65M 1TDZA 4JI2M 3U6EA 3GQ5A 3JR5A 2UXDM 5ITTA 1XMOM 1L2BA 4B3SM 1XNQM 3U6OA 4X66M 3GQ3A 3U6LA 2F5QA 4PD2A 5A2QS 3U6SA 4JI8M 3OTOM 2Q2EB 3DOAA 2EA0A 1PJJA 3J81S 4GKKM 4DV6M 3GPXA 3GPYA
chains in the Genus database with same CATH superfamily
4OX9M 1R2ZA 4FCVA 1DGHA 3U60A 3GPPA 4GITA 4DR1M 2UUAM 3RGSA 5DYIA 1OIPA 1TF0B 1V34A 2V1CA 2XGNA 5KPTA 4RKUF 1DGHB 2XH9A 3AFHA 1Q02A 1JB0F 4MGZE 2BJVA 1SXJB 1C1KA 2JZ1A 3FRIA 2HAKA 2P5TA 1RU3A 5IZ7D 3SATA 4LG2A 3GLHE 1NO1A 2LVAA 1EFUB 2CV1A 4I81A 2MH8A 1G8PA 3T38A 3MJ5A 5BPVA 2UUBM 1CUKA 1ORYB 1R5LA 2Y21A 3VFDA 2DWNA 4IBDA 2ZTDA 3VKHA 4IBKA 4X64M 2KNZA 2DHRA 1YUBA 3NBXX 1PJSA 1T6OA 2Z8YM 3KVWA 3C58A 1N75A 2R62A 3HU3A 4TUWA 1R4GA 2X4AA 3L28A 1N78A 3HHXA 2C98A 2F5NA 2KW0A 2JY6B 2LH0A 1SXJA 2Z3XA 4II7A 3SFZA 3TL4X 2JUJA 4DV1M 1MU5A 2DVWB 2L4FA 3U6CA 1UM8A 2JY8A 3HU2A 4DR5M 3SYLA 3J7AS 3U6PA 5EXTA 3GLIA 3KFUG 4DUYM 1WJ7A 3Q8XA 1MJGM 1P3QQ 4IBEA 5L8RF 4HLQA 1HNZM 3C3EA 4JI6M 4LGMA 2FFJA 4IBCA 2XSZD 5DYGA 5ITQA 1FJGM 1D0KA 4G4NA 2KXEA 2XF3A 5FTMA 4WURA 3FUXA 5ITRA 4JN6A 1QUTA 5ITXE 3SAWA 2FE8A 3GLGE 4DV3M 3L2AA 5FTKA 3KOWE 4L15A 4G4QA 1N34M 4D81A 1WHCA 4FVMA 4D82A 4DV5M 2XZFA 1IXZA 3IHPA 1H6UA 2EO2A 4DV4M 1OJLA 3FTEA 4JXJA 3FUTA 4KO8A 1QAOA 3PNYA 4QOZC 1VEGA 1UFZA 2Z4SA 1JR3E 1ZV1A 2ERCA 2Z4RA 3UK6A 1C7YA 4KODA 5IT9S 1EE8A 3SHFA 3UJNA 2C9OA 3CF6E 3HHWA 3I51A 3JAMS 2F5OA 3VDUA 1VG5A 1J5EM 2VF8A 4FD2A 2HCBA 4LFCM 4RNAA 1HQCA 2N35A 3W68A 3GRVA 4FWHA 5GKNA 4DR6M 2WSCF 2KNAA 3C3DA 4AZFA 3R9XB 3ZCBB 1QYRA 2WZJA 3W67A 2HL7A 2ZM6M 4X65M 2R4EA 2KRUA 2MROB 3TE6A 4JI2M 1DO0A 2LHGA 3U6EA 3DZDA 2QENA 2UXDM 2KZSA 2K0BX 2L6OA 1XMOM 2RGHA 3CF2A 1OAIA 4XK8F 2QPAA 2WSEF 5KPZA 2LWXA 2QCUA 4F1IA 1E9RA 4NSOB 3AL0C 5IREB 2CV0A 2EA0A 1DV0A 1OFHA 4FW9A 3J81S 4LRTA 3LVVA 3A45A 1YE9A 2JP7A 2DZOB 4JI4M 2KEBA 1I94M 3U61B 2CRUA 1IY2A 3AOGA 1PM5A 4IIWA 1GL7A 3D8LA 3HHYA 3HHZA 1TDHA 1TR8A 2DNAA 4NRVA 2C5RA 5FLXS 4AQYM 4DUZM 2LVOC 2DI0A 4KLNA 3PFIA 1HNWM 2O01F 2DZLA 2UXBM 3LCUA 1K82A 5C1BA 1ZQ9A 2MGWA 7CATA 3NBIA 1HNXM 1R7RA 2CHQA 3KP1E 3LVWA 3H4JA 1HT2E 5E6JA 3W0LB 3EIHA 1IY1A 1NHGC 1Y8GA 2RRUA 5LMUM 2J5YA 4I4LA 3VK8A 4L16A 4L78A 3DA1A 4XBOA 1XB2B 5H37D 3KOXE 4LF6M 4G4RA 1T43A 2LVNC 2FNAA 4PCZA 2KNVA 1NJFA 2F5PA 4AKIA 1XMQM 1NNUC 1V33A 3D8BA 3GQ4A 4B08A 2FH0A 4XGIA 4GRIA 4BBAA 4MH0E 3GRUA 3I4VA 3T1YM 3A98B 3J7BA 4GMQA 1G71A 4DBGB 4K0KM 5E26A 3DFZA 2VIIA 5ITXA 1Z5AA 2DHYA 3GLFA 4L4UA 1DGFA 3HWSA 2OQ4A 2LTUA 1VEKA 1G3IA 1Z5BA 5ITYA 1IXRC 1IXSA 3GRRA 3FKEA 3LCVB 4WP2A 5EP4A 3HX3A 3J2PB 3PNVA 2A5YB 3K8ZA 4DR2M 1WIVA 4JI7M 1R6BX 2HWJA 3AJIB 4NOOB 3U6QA 1QANA 3LQQA 3LMMA 4UN2B 3RE8A 1R2YA 4I5SA 1WGLA 4FWGA 4OU7A 4NRWA 3J27B 4ANRA 4Z6YA 4Z8XA 2KDLA 5C18A 2LNHC 1IY0A 5DFLA 1X37A 2DAKA 2C9CA 4HEOA 4G4OA 2UU9M 4LF7M 2JXNA 1TH2A 1WGNA 3SARA 8CATA 4BLCA 3FTFA 2QQ8A 3ZC7B 4LJ7A 5FTLA 4OVZB 1XNRM 1TTEA 2DAMA 3HY5A 1YLAA 2LHCA 4GIPA 2DKLA 4RF1A 2VF7A 5FTNA 2DAIA 1EIJA 3CF0A 2YR0A 1F4IA 4NSRA 1OKSA 3FRHA 3BXWA 3B7QA 3VKGA 3T1HM 1KFVA 4M9XA 3KDSE 2KZUA 2YQZA 3KOZE 3J80S 1NJGA 3WHKA 4QOSA 4B7HA 4GC5A 5EXPA 3TQSA 2QP9X 4LJAA 3GQ5A 4EIWA 3GRYA 4B3SM 4R7GA 1GJSA 1XNQM 2OOAA 3KXEC 3U6LA 1IN6A 2ZAOA 4PD2A 3HGIA 3GLIE 3U6SA 1NV8A 1ZMWA 3L29A 3QWLA 2ZAMA 4LJ5A 4OW0A 3OTOM 3ILKA 1KYIA 3L25A 2O25A 2CUZA 4GKKM 4DV6M 4CGYB 2EUCA 2W82A 1QDTA 3B7ZA 3UZUA 1XC8A 1VDDA 5IWAM 2X49A 4LF9M 3SMPA 2AHMA 2DWZB 1D2NA 1NHWC 2BWBA 3GLGA 4MM3B 1OTRA 3QYBA 1DGBA 2BJWA 4JI0M 2WSFF 3FD9A 4X62M 4ITQA 4CJ6A 2RKOA 3AKZA 2CWBA 2JZ0A 2M5ZA 1QDRA 1TH3A 5JI2E 3WHLA 4LZJA 3HZJA 4QNRA 4JI1M 3GLIB 2ZBKB 4PDIA 2QZ4A 5FTJA 4YHHM 4DR4M 4JYAM 3FTCA 5KQDA 3KS4A 3SAUA 4LJ6A 4LZZA 4MB7A 3VK7A 4MGHA 3GLFE 4BB9A 3HJQA 5EJCA 4MGKE 1WR1B 1XXHA 3U5ZA 5EP2A 3SAVA 1QZMA 3SC3A 2CEAA 4DR7M 2VDBB 3B7NA 3HKPA 1DGGA 1LV7A 1SXJC 1QVRA 2DZNB 3GLHA 1E9SA 3E4RA 5EXXA 4NXNM 4LF8M 2F4VM 3IECA 3PVSA 1Q3CA 2K9DA 4IJFA 2OPFA 4I8OA 4NL4H 2L7IA 1T3TA 3IG5A 4M0WA 4R3DA 2DWMA 3NWLA 2L4EA 1Z6TA 3KSXA 1SXJD 4JV5M 2KRKA 3M7GA 3I04M 5ITUA 3FYCA 4GC9A 1IQPA 3RFWA 2QBYB 2UXCM 4LJ8A 3VDPA 1PGYA 3QYEA 2CV2A 2R18A 3T15A 4A3VB 1E32A 4QHSA 2EKFA 3RGPA 3BOSA 5LMNM 3JR4A 5EP1A 2UUCM 3AOEA 3C9PA 3GLHB 2D7HA 1JQJC 3Q8GA 4ZPXA 4JI3M 1VQ1A 4Q7JA 4QHTA 3W0FA 2V1UA 1IN5A 3HJ8A 5BR8M 4KT0F 2MJ5B 1GABA 1TGUA 1OAOC 1OIZA 2R65A 4PT5A 1XXHB 3U5ZB 2VQFM 2CHGA 1QAQA 3UGJA 1AIPC 2DXIA 3GP1A 2J7NA 4KHPM 3K9OA 3TWLA 3KSJA 3KS8A 1W5SA 1HQYE 2D7EA 3AV0A 3L27A 2CP8A 3CTWB 3SMSA 3PXGA 2O5RA 4AG5A 1BVSA 2L7HA 3FUUA 4IBBA 2E5LM 4DR3M 1JR3D 2V6ZM 1L1ZA 2DWLA 4JI5M 2CHVA 4D80A 2EKKA 3TWMA 2XZUA 1G59A 5F3WA 4GEWA 4IJEA 5FSWA 2OO9A 4CHTB 1W5TA 4AI6A 2F5SA 4DV0M 3SHGB 2LXEA 1G4AE 2Y0QA 3E21A 1QZEA 1KSFX 4IBJA 3U60B 4B7GA 3JR5A 2G5GX 4L8RC 2Z7JA 1L2BA 1IN4A 4LJ9A 1D0LA 4S12A 3FE3A 3K2LA 4LJ4A 2Y20A 2R45A 3U6OA 2M60A 3GQ3A 1WXQA 3K92A 3M6AA 2F5QA 5A2QS 2G8LA 3H4MA 2KHHA 4JI8M 3I01M 4P16A 3FUWA 3LW5F 1GVNA 4OVZA 4LRSA 3GPXA 1QAMA 5EXSA 1HR0M 1N77A 1J7KA 4B3MM 4M0DA 3GLGB 2ZTCA 1TH4A 2CFOA 3SASA 3U6MA 3UMMA 2XFSA 3U61A 1K3WA 1IN7A 1NV9A 2QNJA 2YNMD 1NY5A 2HKJA 4GKJM 4QNMA 2LVPC 2DAEA 2ZANA 1DO2A 1PJIA 2QBYA 1E94E 2BWEA 3E9SA 2R0IA 2R4JA 1XXHE 4CISA 3ZQJA 3A46A 1ZAEA 2HHHM 1L1TA 1OFIA 3QAUA 1IFYA 1IXSB 4AKHA 3V76A 2QHOB 4LY6A 4AW4A 2APLA 3KW6A 2JWSA 1LTMA 1L2DA 4LF5M 2K47A 4LFBM 1AUAA 4LCBA 4W5WA 2GQFA 3L26A 4Y28F 1PJQA 4LF4M 1MX0A 1Z5CA 1IN8A 2JY5A 2DAGA 4WW0A 1NNJA 4M9ZA 4FCWA 5JI3E 3LQRA 4IBIA 2FS1A 2JA2A 2MR9A 1GLNA 2L09A 2K6BA 3U6DA 1QUSA 1YSYA 3AOEC 3K1JA 3SBJA 4NXMM 4MGYE 3B74A 1SG9A 3VLFB 1ZMVA 1MN3A 2X8AA 2D7GA 5KPRA 3ZH9B 2XEPA 3R8FA 4PDGA 4AKGA 4IBFA 3FUVA 1NSFA 3TWKA 1Q3BA 1IBLM 1N32M 1GJTA 4GHLA 1PJTA 2XFTA 4L6V6 1ZMUA 4CIZA 3GPUA 4B3TM 2FOIC 1GKIA 3GLFB 3SYKA 1IBKM 2JNHA 1SXJE 2QSFX 1XHBA 1A5TA 4LFAM 3MHVC 1D0MA 1GL6A 4F2LA 1PRBA 3GO8A 4B3RM 1XWIA 3THGA 4LGYA 2XSZA 3A42A 2L2DA 3KP0E 4AG6A 3HJSA 2BNKA 4FWDA 2H5XA 4NC6A 3MK6A 2CE7A 4G3OA 4YY3M 2JY7A 1IM2A 2VQEM 1L8QA 1V92A 3BBZA 2EJSA 2I7NA 4GH9A 5EP3A 1L2CA 3T6PA 1Z59A 2LVQD 1HT1E 2R6FA 2XLJA 1N36M 3HU1A 2OOBA 1J09A 5EQTA 2KA6B 3K9PA 1VEJA 4RF0A 4GHAA 1OQYA 2RGOA 4IBGA 1IBMM 1K3XA 4G6ZA 2DENA 4DV2M 1NVMA 4MGIE 1S3SA 5DNYA 1NY6A 2H1RA 3KOYE 4FCTA 1I4WA 3B89A 2C99A 4DV7M 2Y0TA 1GO5A 1JR3A 2NQ8C 3IG8A 1N33M 3CGWA 1Q39A 1TDZA 3MMPA 5KO3A 4B7FA 3B9PA 3M0EA 5ITTA 2G3QA 3EIEA 2GNOA 1FNNA 2R46A 1G41A 4REZA 3FYDA 5KQ8A 2C96A 2J7OA 2LBCA 2I7PA 2R44A 1HJPA 4X66M 3F92A 4HL4A 4R71A 2B3TA 4P17A 2YFQA 3I4YA 3E46A 4M9SA 1QQWA 3FTDA 3TPZA 2Q2EB 3DOAA 1PJJA 1VDLA 3GPYA
chains in the Genus database with same CATH topology
4OX9M 1R2ZA 4FCVA 1DGHA 3U60A 3GPPA 4GITA 4DR1M 2UUAM 3RGSA 5DYIA 2XGNA 2V1CA 5KPTA 1DGHB 2XH9A 3AFHA 4MGZE 2BJVA 1SXJB 1C1KA 5IZ7D 3SATA 4LG2A 2P5TA 2CV1A 4I81A 1G8PA 3T38A 3MJ5A 5BPVA 2UUBM 1ORYB 3VFDA 2Y21A 2DWNA 4IBDA 3VKHA 4IBKA 4X64M 2DHRA 1YUBA 3KVWA 3C58A 1N75A 2R62A 3HU3A 4TUWA 2X4AA 3L28A 1N78A 3HHXA 2C98A 2F5NA 2KW0A 2LH0A 1SXJA 2Z3XA 4II7A 3SFZA 3TL4X 4DV1M 1MU5A 2DVWB 3U6CA 1UM8A 4DR5M 3HU2A 3J7AS 3SYLA 3U6PA 5EXTA 3GLIA 3KFUG 4DUYM 3Q8XA 4IBEA 4HLQA 1HNZM 4JI6M 4LGMA 2FFJA 4IBCA 2XSZD 5DYGA 5ITQA 1FJGM 4G4NA 2KXEA 2XF3A 5FTMA 4WURA 3FUXA 5ITRA 4JN6A 5ITXE 3SAWA 2FE8A 4DV3M 3L2AA 5FTKA 3KOWE 4L15A 4G4QA 1N34M 4D81A 2XZFA 4FVMA 4D82A 4DV5M 1IXZA 1H6UA 2EO2A 4DV4M 1OJLA 3FTEA 4JXJA 3FUTA 4KO8A 1QAOA 3PNYA 4QOZC 2Z4SA 3UK6A 2ERCA 2Z4RA 4KODA 5IT9S 1EE8A 3SHFA 3UJNA 2C9OA 3CF6E 3HHWA 3I51A 3JAMS 2F5OA 3VDUA 1J5EM 4FD2A 2HCBA 4LFCM 4RNAA 1HQCA 3GRVA 4FWHA 5GKNA 4DR6M 3R9XB 4AZFA 3ZCBB 1QYRA 2HL7A 2ZM6M 4X65M 2R4EA 2KRUA 4JI2M 3TE6A 1DO0A 3U6EA 3DZDA 2QENA 2UXDM 2KZSA 2L6OA 1XMOM 2RGHA 3CF2A 2QPAA 5KPZA 2LWXA 2QCUA 3AL0C 1E9RA 4NSOB 5IREB 2CV0A 2EA0A 1OFHA 4FW9A 3J81S 4LRTA 3LVVA 3A45A 1YE9A 2DZOB 4JI4M 2KEBA 1I94M 3U61B 1IY2A 3AOGA 1PM5A 4IIWA 1GL7A 3D8LA 3HHYA 3HHZA 1TDHA 4NRVA 2C5RA 5FLXS 4AQYM 4DUZM 4KLNA 3PFIA 1HNWM 2UXBM 1K82A 5C1BA 1ZQ9A 7CATA 3NBIA 1HNXM 1R7RA 2CHQA 3KP1E 3LVWA 5E6JA 1HT2E 3W0LB 3EIHA 1IY1A 1NHGC 5LMUM 4I4LA 3VK8A 4L16A 4L78A 3DA1A 4XBOA 5H37D 3KOXE 4LF6M 4G4RA 2FNAA 4PCZA 2F5PA 1NJFA 4AKIA 1XMQM 1NNUC 3D8BA 3GQ4A 4B08A 4XGIA 4GRIA 4BBAA 4MH0E 3GRUA 3I4VA 3T1YM 3A98B 3J7BA 4GMQA 4K0KM 5E26A 3DFZA 2VIIA 5ITXA 1Z5AA 3GLFA 4L4UA 1DGFA 3HWSA 2OQ4A 1Z5BA 1G3IA 5ITYA 1IXRC 3GRRA 3FKEA 5EP4A 3J2PB 3PNVA 2A5YB 3K8ZA 4DR2M 4JI7M 1R6BX 3AJIB 4NOOB 3U6QA 1QANA 3LQQA 3LMMA 1R2YA 3RE8A 4I5SA 4OU7A 4FWGA 4NRWA 3J27B 4Z6YA 4Z8XA 5C18A 2LNHC 1IY0A 1X37A 2C9CA 4G4OA 2UU9M 4LF7M 1TH2A 3SARA 8CATA 4BLCA 3FTFA 3ZC7B 4LJ7A 5FTLA 4OVZB 1XNRM 4GIPA 4RF1A 5FTNA 3CF0A 2YR0A 4NSRA 3VKGA 3T1HM 1KFVA 4M9XA 3KDSE 2KZUA 2YQZA 3KOZE 3J80S 1NJGA 3WHKA 4QOSA 4B7HA 4GC5A 5EXPA 3TQSA 2QP9X 4LJAA 3GQ5A 4EIWA 3GRYA 4B3SM 4R7GA 1XNQM 3KXEC 3U6LA 1IN6A 2ZAOA 4PD2A 3HGIA 3U6SA 3L29A 3QWLA 2ZAMA 4LJ5A 4OW0A 3OTOM 3ILKA 1KYIA 3L25A 2CUZA 4GKKM 4DV6M 4CGYB 2EUCA 2W82A 3UZUA 1XC8A 1VDDA 5IWAM 2X49A 4LF9M 3SMPA 2AHMA 2DWZB 1D2NA 1NHWC 3GLGA 4MM3B 1DGBA 2BJWA 4JI0M 3FD9A 4X62M 4ITQA 2RKOA 3AKZA 2M5ZA 1TH3A 5JI2E 3WHLA 4LZJA 4QNRA 4JI1M 3GLIB 2ZBKB 4PDIA 2QZ4A 5FTJA 4YHHM 4DR4M 4JYAM 3FTCA 5KQDA 3KS4A 3SAUA 4LJ6A 4LZZA 4MB7A 3VK7A 4MGHA 4BB9A 3HJQA 5EJCA 4MGKE 1XXHA 3U5ZA 5EP2A 3SAVA 1QZMA 3SC3A 2CEAA 4DR7M 3HKPA 1DGGA 1LV7A 1SXJC 1QVRA 2DZNB 3GLHA 1E9SA 3E4RA 5EXXA 4NXNM 4LF8M 2F4VM 3PVSA 1Q3CA 2OPFA 4IJFA 4I8OA 4NL4H 2L7IA 1T3TA 3IG5A 4M0WA 4R3DA 2DWMA 3NWLA 1Z6TA 3KSXA 1SXJD 4JV5M 2KRKA 3M7GA 5ITUA 3FYCA 4GC9A 1IQPA 3RFWA 2QBYB 2UXCM 4LJ8A 3VDPA 2CV2A 2R18A 3T15A 4A3VB 1E32A 4QHSA 3RGPA 3BOSA 5LMNM 3JR4A 5EP1A 2UUCM 3AOEA 3GLHB 4ZPXA 2D7HA 1JQJC 4JI3M 3W0FA 4QHTA 2V1UA 1IN5A 3HJ8A 5BR8M 1TGUA 2R65A 4PT5A 1XXHB 3U5ZB 2VQFM 2CHGA 1QAQA 3UGJA 2DXIA 3GP1A 2J7NA 4KHPM 3TWLA 3KSJA 3KS8A 1W5SA 1HQYE 2D7EA 3AV0A 3L27A 3CTWB 3SMSA 3PXGA 2O5RA 4AG5A 2L7HA 3FUUA 4IBBA 2E5LM 4DR3M 1JR3D 2V6ZM 1L1ZA 2DWLA 4JI5M 2CHVA 4D80A 2XZUA 3TWMA 1G59A 5F3WA 4IJEA 5FSWA 4CHTB 1W5TA 4AI6A 2F5SA 4DV0M 3SHGB 2LXEA 1G4AE 2Y0QA 1KSFX 4IBJA 3U60B 4B7GA 3JR5A 2G5GX 4L8RC 2Z7JA 1L2BA 1IN4A 4LJ9A 4S12A 3K2LA 4LJ4A 2Y20A 2R45A 3U6OA 2M60A 3GQ3A 1WXQA 3K92A 3M6AA 2F5QA 5A2QS 2G8LA 3H4MA 4JI8M 4P16A 3FUWA 1GVNA 4OVZA 4LRSA 3GPXA 1QAMA 5EXSA 1HR0M 1N77A 1J7KA 4B3MM 4M0DA 3GLGB 1TH4A 2CFOA 3SASA 3U6MA 3UMMA 2XFSA 3U61A 1K3WA 1IN7A 2YNMD 1NY5A 2HKJA 4GKJM 4QNMA 1PJIA 2ZANA 1DO2A 2QBYA 1E94E 3E9SA 2R4JA 4CISA 3A46A 1ZAEA 2HHHM 1L1TA 1OFIA 3QAUA 1IXSB 4AKHA 4LY6A 4AW4A 3KW6A 1L2DA 4LF5M 4LFBM 2K47A 4LCBA 4W5WA 3L26A 4LF4M 1MX0A 1Z5CA 1IN8A 4WW0A 1NNJA 4M9ZA 4FCWA 5JI3E 3LQRA 4IBIA 2JA2A 1GLNA 2L09A 3U6DA 4NXMM 3K1JA 1YSYA 3AOEC 3SBJA 4MGYE 3VLFB 2X8AA 2D7GA 5KPRA 3ZH9B 2XEPA 3R8FA 4PDGA 4AKGA 4IBFA 3FUVA 1NSFA 3TWKA 1Q3BA 1IBLM 1N32M 4GHLA 2XFTA 4B3TM 3GPUA 2FOIC 1GKIA 3GLFB 3SYKA 1IBKM 1SXJE 1XHBA 4LFAM 3MHVC 1GL6A 3GO8A 4B3RM 1XWIA 3THGA 4LGYA 2XSZA 3A42A 3KP0E 4AG6A 3HJSA 2BNKA 4FWDA 3MK6A 2CE7A 4YY3M 1IM2A 2VQEM 1L8QA 2I7NA 4GH9A 5EP3A 1L2CA 1Z59A 2XLJA 1HT1E 1N36M 3HU1A 1J09A 5EQTA 2KA6B 4RF0A 4GHAA 4IBGA 2RGOA 1IBMM 1K3XA 4G6ZA 4DV2M 1NVMA 4MGIE 1S3SA 5DNYA 1NY6A 2H1RA 3KOYE 4FCTA 1I4WA 2C99A 4DV7M 2Y0TA 1JR3A 2NQ8C 3IG8A 1N33M 1Q39A 1TDZA 5KO3A 4B7FA 3B9PA 3M0EA 5ITTA 3EIEA 1FNNA 2R46A 1G41A 4REZA 3FYDA 5KQ8A 2C96A 2J7OA 2I7PA 4X66M 4HL4A 2YFQA 3I4YA 4M9SA 1QQWA 3FTDA 3TPZA 2Q2EB 3DOAA 1PJJA 3GPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 M;  1HR0 M;  1R2Z A;  4B3M M;  1XC8 A;  4JI4 M;  5IWA M;  1I94 M;  3GPP A;  4DR1 M;  4LF9 M;  2UUA M;  3U6M A;  3SAS A;  1PM5 A;  1K3W A;  1TDH A;  2HKJ A;  4NRV A;  4GKJ M;  5FLX S;  4AQY M;  4DUZ M;  4JI0 M;  3SAT A;  4X62 M;  1PJI A;  4ITQ A;  1HNW M;  2UXB M;  3A45 A;  1K82 A;  4CIS A;  3A46 A;  2UUB M;  1HNX M;  2HHH M;  1L1T A;  4JI1 M;  2ZBK B;  4PDI A;  4YHH M;  5LMU M;  4X64 M;  4DR4 M;  4JYA M;  3VK8 A;  1L2D A;  4LF5 M;  3SAU A;  4LFB M;  4MB7 A;  3VK7 A;  3C58 A;  4LF6 M;  4G4R A;  4LF4 M;  1MX0 A;  1Z5C A;  3SAV A;  4PCZ A;  2F5P A;  1XMQ M;  1NNJ A;  4DR7 M;  2F5N A;  3GQ4 A;  3U6D A;  4NXM M;  4NXN M;  3T1Y M;  2F4V M;  3SBJ A;  4LF8 M;  1Q3C A;  2OPF A;  4K0K M;  4DV1 M;  5ITX A;  1Z5A A;  1MU5 A;  4PDG A;  2OQ4 A;  3U6C A;  1Z5B A;  4DR5 M;  1N32 M;  3TWK A;  5ITY A;  1Q3B A;  3U6P A;  1IBL M;  3J7A S;  4JV5 M;  4DUY M;  5ITU A;  2UXC M;  4B3T M;  3GPU A;  1HNZ M;  4JI6 M;  4DR2 M;  5ITQ A;  1IBK M;  1FJG M;  4G4N A;  4JI7 M;  5LMN M;  3JR4 A;  3U6Q A;  4LFA M;  5ITR A;  1R2Y A;  2UUC M;  4JI3 M;  3W0F A;  5ITX E;  3SAW A;  3GO8 A;  4NRW A;  4B3R M;  5BR8 M;  3A42 A;  4DV3 M;  4G4O A;  2UU9 M;  4LF7 M;  4G4Q A;  2VQF M;  1N34 M;  2XZF A;  4DV5 M;  4YY3 M;  3SAR A;  4DV4 M;  3GP1 A;  2VQE M;  4KHP M;  3TWL A;  1L2C A;  1XNR M;  1Z59 A;  1N36 M;  5IT9 S;  1EE8 A;  1IBM M;  1K3X A;  2E5L M;  3JAM S;  2F5O A;  4DR3 M;  4DV2 M;  1L1Z A;  4JI5 M;  2XZU A;  3TWM A;  1J5E M;  4LFC M;  4DV7 M;  4DR6 M;  3T1H M;  1KFV A;  2F5S A;  4DV0 M;  1N33 M;  3J80 S;  2ZM6 M;  1Q39 A;  4X65 M;  1TDZ A;  4JI2 M;  3U6E A;  3GQ5 A;  3JR5 A;  2UXD M;  5ITT A;  1XMO M;  1L2B A;  4B3S M;  1XNQ M;  3U6O A;  4X66 M;  3GQ3 A;  3U6L A;  2F5Q A;  4PD2 A;  5A2Q S;  3U6S A;  4JI8 M;  3OTO M;  2Q2E B;  3DOA A;  2EA0 A;  1PJJ A;  3J81 S;  4GKK M;  4DV6 M;  3GPX A;  3GPY A; 
#chains in the Genus database with same CATH topology
 4OX9 M;  1R2Z A;  4FCV A;  1DGH A;  3U60 A;  3GPP A;  4GIT A;  4DR1 M;  2UUA M;  3RGS A;  5DYI A;  1OIP A;  1TF0 B;  1V34 A;  2V1C A;  2XGN A;  5KPT A;  4RKU F;  1DGH B;  2XH9 A;  3AFH A;  1Q02 A;  1JB0 F;  4MGZ E;  2BJV A;  1SXJ B;  1C1K A;  2JZ1 A;  3FRI A;  2HAK A;  2P5T A;  1RU3 A;  5IZ7 D;  3SAT A;  4LG2 A;  3GLH E;  1NO1 A;  2LVA A;  1EFU B;  2CV1 A;  4I81 A;  2MH8 A;  1G8P A;  3T38 A;  3MJ5 A;  5BPV A;  2UUB M;  1CUK A;  1ORY B;  1R5L A;  2Y21 A;  3VFD A;  2DWN A;  4IBD A;  2ZTD A;  3VKH A;  4IBK A;  4X64 M;  2KNZ A;  2DHR A;  1YUB A;  3NBX X;  1PJS A;  1T6O A;  2Z8Y M;  3KVW A;  3C58 A;  1N75 A;  2R62 A;  3HU3 A;  4TUW A;  1R4G A;  2X4A A;  3L28 A;  1N78 A;  3HHX A;  2C98 A;  2F5N A;  2KW0 A;  2JY6 B;  2LH0 A;  1SXJ A;  2Z3X A;  4II7 A;  3SFZ A;  3TL4 X;  2JUJ A;  4DV1 M;  1MU5 A;  2DVW B;  2L4F A;  3U6C A;  1UM8 A;  2JY8 A;  3HU2 A;  4DR5 M;  3SYL A;  3J7A S;  3U6P A;  5EXT A;  3GLI A;  3KFU G;  4DUY M;  1WJ7 A;  3Q8X A;  1MJG M;  1P3Q Q;  4IBE A;  5L8R F;  4HLQ A;  1HNZ M;  3C3E A;  4JI6 M;  4LGM A;  2FFJ A;  4IBC A;  2XSZ D;  5DYG A;  5ITQ A;  1FJG M;  1D0K A;  4G4N A;  2KXE A;  2XF3 A;  5FTM A;  4WUR A;  3FUX A;  5ITR A;  4JN6 A;  1QUT A;  5ITX E;  3SAW A;  2FE8 A;  3GLG E;  4DV3 M;  3L2A A;  5FTK A;  3KOW E;  4L15 A;  4G4Q A;  1N34 M;  4D81 A;  1WHC A;  4FVM A;  4D82 A;  4DV5 M;  2XZF A;  1IXZ A;  3IHP A;  1H6U A;  2EO2 A;  4DV4 M;  1OJL A;  3FTE A;  4JXJ A;  3FUT A;  4KO8 A;  1QAO A;  3PNY A;  4QOZ C;  1VEG A;  1UFZ A;  2Z4S A;  1JR3 E;  1ZV1 A;  2ERC A;  2Z4R A;  3UK6 A;  1C7Y A;  4KOD A;  5IT9 S;  1EE8 A;  3SHF A;  3UJN A;  2C9O A;  3CF6 E;  3HHW A;  3I51 A;  3JAM S;  2F5O A;  3VDU A;  1VG5 A;  1J5E M;  2VF8 A;  4FD2 A;  2HCB A;  4LFC M;  4RNA A;  1HQC A;  2N35 A;  3W68 A;  3GRV A;  4FWH A;  5GKN A;  4DR6 M;  2WSC F;  2KNA A;  3C3D A;  4AZF A;  3R9X B;  3ZCB B;  1QYR A;  2WZJ A;  3W67 A;  2HL7 A;  2ZM6 M;  4X65 M;  2R4E A;  2KRU A;  2MRO B;  3TE6 A;  4JI2 M;  1DO0 A;  2LHG A;  3U6E A;  3DZD A;  2QEN A;  2UXD M;  2KZS A;  2K0B X;  2L6O A;  1XMO M;  2RGH A;  3CF2 A;  1OAI A;  4XK8 F;  2QPA A;  2WSE F;  5KPZ A;  2LWX A;  2QCU A;  4F1I A;  1E9R A;  4NSO B;  3AL0 C;  5IRE B;  2CV0 A;  2EA0 A;  1DV0 A;  1OFH A;  4FW9 A;  3J81 S;  4LRT A;  3LVV A;  3A45 A;  1YE9 A;  2JP7 A;  2DZO B;  4JI4 M;  2KEB A;  1I94 M;  3U61 B;  2CRU A;  1IY2 A;  3AOG A;  1PM5 A;  4IIW A;  1GL7 A;  3D8L A;  3HHY A;  3HHZ A;  1TDH A;  1TR8 A;  2DNA A;  4NRV A;  2C5R A;  5FLX S;  4AQY M;  4DUZ M;  2LVO C;  2DI0 A;  4KLN A;  3PFI A;  1HNW M;  2O01 F;  2DZL A;  2UXB M;  3LCU A;  1K82 A;  5C1B A;  1ZQ9 A;  2MGW A;  7CAT A;  3NBI A;  1HNX M;  1R7R A;  2CHQ A;  3KP1 E;  3LVW A;  3H4J A;  1HT2 E;  5E6J A;  3W0L B;  3EIH A;  1IY1 A;  1NHG C;  1Y8G A;  2RRU A;  5LMU M;  2J5Y A;  4I4L A;  3VK8 A;  4L16 A;  4L78 A;  3DA1 A;  4XBO A;  1XB2 B;  5H37 D;  3KOX E;  4LF6 M;  4G4R A;  1T43 A;  2LVN C;  2FNA A;  4PCZ A;  2KNV A;  1NJF A;  2F5P A;  4AKI A;  1XMQ M;  1NNU C;  1V33 A;  3D8B A;  3GQ4 A;  4B08 A;  2FH0 A;  4XGI A;  4GRI A;  4BBA A;  4MH0 E;  3GRU A;  3I4V A;  3T1Y M;  3A98 B;  3J7B A;  4GMQ A;  1G71 A;  4DBG B;  4K0K M;  5E26 A;  3DFZ A;  2VII A;  5ITX A;  1Z5A A;  2DHY A;  3GLF A;  4L4U A;  1DGF A;  3HWS A;  2OQ4 A;  2LTU A;  1VEK A;  1G3I A;  1Z5B A;  5ITY A;  1IXR C;  1IXS A;  3GRR A;  3FKE A;  3LCV B;  4WP2 A;  5EP4 A;  3HX3 A;  3J2P B;  3PNV A;  2A5Y B;  3K8Z A;  4DR2 M;  1WIV A;  4JI7 M;  1R6B X;  2HWJ A;  3AJI B;  4NOO B;  3U6Q A;  1QAN A;  3LQQ A;  3LMM A;  4UN2 B;  3RE8 A;  1R2Y A;  4I5S A;  1WGL A;  4FWG A;  4OU7 A;  4NRW A;  3J27 B;  4ANR A;  4Z6Y A;  4Z8X A;  2KDL A;  5C18 A;  2LNH C;  1IY0 A;  5DFL A;  1X37 A;  2DAK A;  2C9C A;  4HEO A;  4G4O A;  2UU9 M;  4LF7 M;  2JXN A;  1TH2 A;  1WGN A;  3SAR A;  8CAT A;  4BLC A;  3FTF A;  2QQ8 A;  3ZC7 B;  4LJ7 A;  5FTL A;  4OVZ B;  1XNR M;  1TTE A;  2DAM A;  3HY5 A;  1YLA A;  2LHC A;  4GIP A;  2DKL A;  4RF1 A;  2VF7 A;  5FTN A;  2DAI A;  1EIJ A;  3CF0 A;  2YR0 A;  1F4I A;  4NSR A;  1OKS A;  3FRH A;  3BXW A;  3B7Q A;  3VKG A;  3T1H M;  1KFV A;  4M9X A;  3KDS E;  2KZU A;  2YQZ A;  3KOZ E;  3J80 S;  1NJG A;  3WHK A;  4QOS A;  4B7H A;  4GC5 A;  5EXP A;  3TQS A;  2QP9 X;  4LJA A;  3GQ5 A;  4EIW A;  3GRY A;  4B3S M;  4R7G A;  1GJS A;  1XNQ M;  2OOA A;  3KXE C;  3U6L A;  1IN6 A;  2ZAO A;  4PD2 A;  3HGI A;  3GLI E;  3U6S A;  1NV8 A;  1ZMW A;  3L29 A;  3QWL A;  2ZAM A;  4LJ5 A;  4OW0 A;  3OTO M;  3ILK A;  1KYI A;  3L25 A;  2O25 A;  2CUZ A;  4GKK M;  4DV6 M;  4CGY B;  2EUC A;  2W82 A;  1QDT A;  3B7Z A;  3UZU A;  1XC8 A;  1VDD A;  5IWA M;  2X49 A;  4LF9 M;  3SMP A;  2AHM A;  2DWZ B;  1D2N A;  1NHW C;  2BWB A;  3GLG A;  4MM3 B;  1OTR A;  3QYB A;  1DGB A;  2BJW A;  4JI0 M;  2WSF F;  3FD9 A;  4X62 M;  4ITQ A;  4CJ6 A;  2RKO A;  3AKZ A;  2CWB A;  2JZ0 A;  2M5Z A;  1QDR A;  1TH3 A;  5JI2 E;  3WHL A;  4LZJ A;  3HZJ A;  4QNR A;  4JI1 M;  3GLI B;  2ZBK B;  4PDI A;  2QZ4 A;  5FTJ A;  4YHH M;  4DR4 M;  4JYA M;  3FTC A;  5KQD A;  3KS4 A;  3SAU A;  4LJ6 A;  4LZZ A;  4MB7 A;  3VK7 A;  4MGH A;  3GLF E;  4BB9 A;  3HJQ A;  5EJC A;  4MGK E;  1WR1 B;  1XXH A;  3U5Z A;  5EP2 A;  3SAV A;  1QZM A;  3SC3 A;  2CEA A;  4DR7 M;  2VDB B;  3B7N A;  3HKP A;  1DGG A;  1LV7 A;  1SXJ C;  1QVR A;  2DZN B;  3GLH A;  1E9S A;  3E4R A;  5EXX A;  4NXN M;  4LF8 M;  2F4V M;  3IEC A;  3PVS A;  1Q3C A;  2K9D A;  4IJF A;  2OPF A;  4I8O A;  4NL4 H;  2L7I A;  1T3T A;  3IG5 A;  4M0W A;  4R3D A;  2DWM A;  3NWL A;  2L4E A;  1Z6T A;  3KSX A;  1SXJ D;  4JV5 M;  2KRK A;  3M7G A;  3I04 M;  5ITU A;  3FYC A;  4GC9 A;  1IQP A;  3RFW A;  2QBY B;  2UXC M;  4LJ8 A;  3VDP A;  1PGY A;  3QYE A;  2CV2 A;  2R18 A;  3T15 A;  4A3V B;  1E32 A;  4QHS A;  2EKF A;  3RGP A;  3BOS A;  5LMN M;  3JR4 A;  5EP1 A;  2UUC M;  3AOE A;  3C9P A;  3GLH B;  2D7H A;  1JQJ C;  3Q8G A;  4ZPX A;  4JI3 M;  1VQ1 A;  4Q7J A;  4QHT A;  3W0F A;  2V1U A;  1IN5 A;  3HJ8 A;  5BR8 M;  4KT0 F;  2MJ5 B;  1GAB A;  1TGU A;  1OAO C;  1OIZ A;  2R65 A;  4PT5 A;  1XXH B;  3U5Z B;  2VQF M;  2CHG A;  1QAQ A;  3UGJ A;  1AIP C;  2DXI A;  3GP1 A;  2J7N A;  4KHP M;  3K9O A;  3TWL A;  3KSJ A;  3KS8 A;  1W5S A;  1HQY E;  2D7E A;  3AV0 A;  3L27 A;  2CP8 A;  3CTW B;  3SMS A;  3PXG A;  2O5R A;  4AG5 A;  1BVS A;  2L7H A;  3FUU A;  4IBB A;  2E5L M;  4DR3 M;  1JR3 D;  2V6Z M;  1L1Z A;  2DWL A;  4JI5 M;  2CHV A;  4D80 A;  2EKK A;  3TWM A;  2XZU A;  1G59 A;  5F3W A;  4GEW A;  4IJE A;  5FSW A;  2OO9 A;  4CHT B;  1W5T A;  4AI6 A;  2F5S A;  4DV0 M;  3SHG B;  2LXE A;  1G4A E;  2Y0Q A;  3E21 A;  1QZE A;  1KSF X;  4IBJ A;  3U60 B;  4B7G A;  3JR5 A;  2G5G X;  4L8R C;  2Z7J A;  1L2B A;  1IN4 A;  4LJ9 A;  1D0L A;  4S12 A;  3FE3 A;  3K2L A;  4LJ4 A;  2Y20 A;  2R45 A;  3U6O A;  2M60 A;  3GQ3 A;  1WXQ A;  3K92 A;  3M6A A;  2F5Q A;  5A2Q S;  2G8L A;  3H4M A;  2KHH A;  4JI8 M;  3I01 M;  4P16 A;  3FUW A;  3LW5 F;  1GVN A;  4OVZ A;  4LRS A;  3GPX A;  1QAM A;  5EXS A;  1HR0 M;  1N77 A;  1J7K A;  4B3M M;  4M0D A;  3GLG B;  2ZTC A;  1TH4 A;  2CFO A;  3SAS A;  3U6M A;  3UMM A;  2XFS A;  3U61 A;  1K3W A;  1IN7 A;  1NV9 A;  2QNJ A;  2YNM D;  1NY5 A;  2HKJ A;  4GKJ M;  4QNM A;  2LVP C;  2DAE A;  2ZAN A;  1DO2 A;  1PJI A;  2QBY A;  1E94 E;  2BWE A;  3E9S A;  2R0I A;  2R4J A;  1XXH E;  4CIS A;  3ZQJ A;  3A46 A;  1ZAE A;  2HHH M;  1L1T A;  1OFI A;  3QAU A;  1IFY A;  1IXS B;  4AKH A;  3V76 A;  2QHO B;  4LY6 A;  4AW4 A;  2APL A;  3KW6 A;  2JWS A;  1LTM A;  1L2D A;  4LF5 M;  2K47 A;  4LFB M;  1AUA A;  4LCB A;  4W5W A;  2GQF A;  3L26 A;  4Y28 F;  1PJQ A;  4LF4 M;  1MX0 A;  1Z5C A;  1IN8 A;  2JY5 A;  2DAG A;  4WW0 A;  1NNJ A;  4M9Z A;  4FCW A;  5JI3 E;  3LQR A;  4IBI A;  2FS1 A;  2JA2 A;  2MR9 A;  1GLN A;  2L09 A;  2K6B A;  3U6D A;  1QUS A;  1YSY A;  3AOE C;  3K1J A;  3SBJ A;  4NXM M;  4MGY E;  3B74 A;  1SG9 A;  3VLF B;  1ZMV A;  1MN3 A;  2X8A A;  2D7G A;  5KPR A;  3ZH9 B;  2XEP A;  3R8F A;  4PDG A;  4AKG A;  4IBF A;  3FUV A;  1NSF A;  3TWK A;  1Q3B A;  1IBL M;  1N32 M;  1GJT A;  4GHL A;  1PJT A;  2XFT A;  4L6V 6;  1ZMU A;  4CIZ A;  3GPU A;  4B3T M;  2FOI C;  1GKI A;  3GLF B;  3SYK A;  1IBK M;  2JNH A;  1SXJ E;  2QSF X;  1XHB A;  1A5T A;  4LFA M;  3MHV C;  1D0M A;  1GL6 A;  4F2L A;  1PRB A;  3GO8 A;  4B3R M;  1XWI A;  3THG A;  4LGY A;  2XSZ A;  3A42 A;  2L2D A;  3KP0 E;  4AG6 A;  3HJS A;  2BNK A;  4FWD A;  2H5X A;  4NC6 A;  3MK6 A;  2CE7 A;  4G3O A;  4YY3 M;  2JY7 A;  1IM2 A;  2VQE M;  1L8Q A;  1V92 A;  3BBZ A;  2EJS A;  2I7N A;  4GH9 A;  5EP3 A;  1L2C A;  3T6P A;  1Z59 A;  2LVQ D;  1HT1 E;  2R6F A;  2XLJ A;  1N36 M;  3HU1 A;  2OOB A;  1J09 A;  5EQT A;  2KA6 B;  3K9P A;  1VEJ A;  4RF0 A;  4GHA A;  1OQY A;  2RGO A;  4IBG A;  1IBM M;  1K3X A;  4G6Z A;  2DEN A;  4DV2 M;  1NVM A;  4MGI E;  1S3S A;  5DNY A;  1NY6 A;  2H1R A;  3KOY E;  4FCT A;  1I4W A;  3B89 A;  2C99 A;  4DV7 M;  2Y0T A;  1GO5 A;  1JR3 A;  2NQ8 C;  3IG8 A;  1N33 M;  3CGW A;  1Q39 A;  1TDZ A;  3MMP A;  5KO3 A;  4B7F A;  3B9P A;  3M0E A;  5ITT A;  2G3Q A;  3EIE A;  2GNO A;  1FNN A;  2R46 A;  1G41 A;  4REZ A;  3FYD A;  5KQ8 A;  2C96 A;  2J7O A;  2LBC A;  2I7P A;  2R44 A;  1HJP A;  4X66 M;  3F92 A;  4HL4 A;  4R71 A;  2B3T A;  4P17 A;  2YFQ A;  3I4Y A;  3E46 A;  4M9S A;  1QQW A;  3FTD A;  3TPZ A;  2Q2E B;  3DOA A;  1PJJ A;  1VDL A;  3GPY A; 
#chains in the Genus database with same CATH homology
 4OX9 M;  1R2Z A;  4FCV A;  1DGH A;  3U60 A;  3GPP A;  4GIT A;  4DR1 M;  2UUA M;  3RGS A;  5DYI A;  2XGN A;  2V1C A;  5KPT A;  1DGH B;  2XH9 A;  3AFH A;  4MGZ E;  2BJV A;  1SXJ B;  1C1K A;  5IZ7 D;  3SAT A;  4LG2 A;  2P5T A;  2CV1 A;  4I81 A;  1G8P A;  3T38 A;  3MJ5 A;  5BPV A;  2UUB M;  1ORY B;  3VFD A;  2Y21 A;  2DWN A;  4IBD A;  3VKH A;  4IBK A;  4X64 M;  2DHR A;  1YUB A;  3KVW A;  3C58 A;  1N75 A;  2R62 A;  3HU3 A;  4TUW A;  2X4A A;  3L28 A;  1N78 A;  3HHX A;  2C98 A;  2F5N A;  2KW0 A;  2LH0 A;  1SXJ A;  2Z3X A;  4II7 A;  3SFZ A;  3TL4 X;  4DV1 M;  1MU5 A;  2DVW B;  3U6C A;  1UM8 A;  4DR5 M;  3HU2 A;  3J7A S;  3SYL A;  3U6P A;  5EXT A;  3GLI A;  3KFU G;  4DUY M;  3Q8X A;  4IBE A;  4HLQ A;  1HNZ M;  4JI6 M;  4LGM A;  2FFJ A;  4IBC A;  2XSZ D;  5DYG A;  5ITQ A;  1FJG M;  4G4N A;  2KXE A;  2XF3 A;  5FTM A;  4WUR A;  3FUX A;  5ITR A;  4JN6 A;  5ITX E;  3SAW A;  2FE8 A;  4DV3 M;  3L2A A;  5FTK A;  3KOW E;  4L15 A;  4G4Q A;  1N34 M;  4D81 A;  2XZF A;  4FVM A;  4D82 A;  4DV5 M;  1IXZ A;  1H6U A;  2EO2 A;  4DV4 M;  1OJL A;  3FTE A;  4JXJ A;  3FUT A;  4KO8 A;  1QAO A;  3PNY A;  4QOZ C;  2Z4S A;  3UK6 A;  2ERC A;  2Z4R A;  4KOD A;  5IT9 S;  1EE8 A;  3SHF A;  3UJN A;  2C9O A;  3CF6 E;  3HHW A;  3I51 A;  3JAM S;  2F5O A;  3VDU A;  1J5E M;  4FD2 A;  2HCB A;  4LFC M;  4RNA A;  1HQC A;  3GRV A;  4FWH A;  5GKN A;  4DR6 M;  3R9X B;  4AZF A;  3ZCB B;  1QYR A;  2HL7 A;  2ZM6 M;  4X65 M;  2R4E A;  2KRU A;  4JI2 M;  3TE6 A;  1DO0 A;  3U6E A;  3DZD A;  2QEN A;  2UXD M;  2KZS A;  2L6O A;  1XMO M;  2RGH A;  3CF2 A;  2QPA A;  5KPZ A;  2LWX A;  2QCU A;  3AL0 C;  1E9R A;  4NSO B;  5IRE B;  2CV0 A;  2EA0 A;  1OFH A;  4FW9 A;  3J81 S;  4LRT A;  3LVV A;  3A45 A;  1YE9 A;  2DZO B;  4JI4 M;  2KEB A;  1I94 M;  3U61 B;  1IY2 A;  3AOG A;  1PM5 A;  4IIW A;  1GL7 A;  3D8L A;  3HHY A;  3HHZ A;  1TDH A;  4NRV A;  2C5R A;  5FLX S;  4AQY M;  4DUZ M;  4KLN A;  3PFI A;  1HNW M;  2UXB M;  1K82 A;  5C1B A;  1ZQ9 A;  7CAT A;  3NBI A;  1HNX M;  1R7R A;  2CHQ A;  3KP1 E;  3LVW A;  5E6J A;  1HT2 E;  3W0L B;  3EIH A;  1IY1 A;  1NHG C;  5LMU M;  4I4L A;  3VK8 A;  4L16 A;  4L78 A;  3DA1 A;  4XBO A;  5H37 D;  3KOX E;  4LF6 M;  4G4R A;  2FNA A;  4PCZ A;  2F5P A;  1NJF A;  4AKI A;  1XMQ M;  1NNU C;  3D8B A;  3GQ4 A;  4B08 A;  4XGI A;  4GRI A;  4BBA A;  4MH0 E;  3GRU A;  3I4V A;  3T1Y M;  3A98 B;  3J7B A;  4GMQ A;  4K0K M;  5E26 A;  3DFZ A;  2VII A;  5ITX A;  1Z5A A;  3GLF A;  4L4U A;  1DGF A;  3HWS A;  2OQ4 A;  1Z5B A;  1G3I A;  5ITY A;  1IXR C;  3GRR A;  3FKE A;  5EP4 A;  3J2P B;  3PNV A;  2A5Y B;  3K8Z A;  4DR2 M;  4JI7 M;  1R6B X;  3AJI B;  4NOO B;  3U6Q A;  1QAN A;  3LQQ A;  3LMM A;  1R2Y A;  3RE8 A;  4I5S A;  4OU7 A;  4FWG A;  4NRW A;  3J27 B;  4Z6Y A;  4Z8X A;  5C18 A;  2LNH C;  1IY0 A;  1X37 A;  2C9C A;  4G4O A;  2UU9 M;  4LF7 M;  1TH2 A;  3SAR A;  8CAT A;  4BLC A;  3FTF A;  3ZC7 B;  4LJ7 A;  5FTL A;  4OVZ B;  1XNR M;  4GIP A;  4RF1 A;  5FTN A;  3CF0 A;  2YR0 A;  4NSR A;  3VKG A;  3T1H M;  1KFV A;  4M9X A;  3KDS E;  2KZU A;  2YQZ A;  3KOZ E;  3J80 S;  1NJG A;  3WHK A;  4QOS A;  4B7H A;  4GC5 A;  5EXP A;  3TQS A;  2QP9 X;  4LJA A;  3GQ5 A;  4EIW A;  3GRY A;  4B3S M;  4R7G A;  1XNQ M;  3KXE C;  3U6L A;  1IN6 A;  2ZAO A;  4PD2 A;  3HGI A;  3U6S A;  3L29 A;  3QWL A;  2ZAM A;  4LJ5 A;  4OW0 A;  3OTO M;  3ILK A;  1KYI A;  3L25 A;  2CUZ A;  4GKK M;  4DV6 M;  4CGY B;  2EUC A;  2W82 A;  3UZU A;  1XC8 A;  1VDD A;  5IWA M;  2X49 A;  4LF9 M;  3SMP A;  2AHM A;  2DWZ B;  1D2N A;  1NHW C;  3GLG A;  4MM3 B;  1DGB A;  2BJW A;  4JI0 M;  3FD9 A;  4X62 M;  4ITQ A;  2RKO A;  3AKZ A;  2M5Z A;  1TH3 A;  5JI2 E;  3WHL A;  4LZJ A;  4QNR A;  4JI1 M;  3GLI B;  2ZBK B;  4PDI A;  2QZ4 A;  5FTJ A;  4YHH M;  4DR4 M;  4JYA M;  3FTC A;  5KQD A;  3KS4 A;  3SAU A;  4LJ6 A;  4LZZ A;  4MB7 A;  3VK7 A;  4MGH A;  4BB9 A;  3HJQ A;  5EJC A;  4MGK E;  1XXH A;  3U5Z A;  5EP2 A;  3SAV A;  1QZM A;  3SC3 A;  2CEA A;  4DR7 M;  3HKP A;  1DGG A;  1LV7 A;  1SXJ C;  1QVR A;  2DZN B;  3GLH A;  1E9S A;  3E4R A;  5EXX A;  4NXN M;  4LF8 M;  2F4V M;  3PVS A;  1Q3C A;  2OPF A;  4IJF A;  4I8O A;  4NL4 H;  2L7I A;  1T3T A;  3IG5 A;  4M0W A;  4R3D A;  2DWM A;  3NWL A;  1Z6T A;  3KSX A;  1SXJ D;  4JV5 M;  2KRK A;  3M7G A;  5ITU A;  3FYC A;  4GC9 A;  1IQP A;  3RFW A;  2QBY B;  2UXC M;  4LJ8 A;  3VDP A;  2CV2 A;  2R18 A;  3T15 A;  4A3V B;  1E32 A;  4QHS A;  3RGP A;  3BOS A;  5LMN M;  3JR4 A;  5EP1 A;  2UUC M;  3AOE A;  3GLH B;  4ZPX A;  2D7H A;  1JQJ C;  4JI3 M;  3W0F A;  4QHT A;  2V1U A;  1IN5 A;  3HJ8 A;  5BR8 M;  1TGU A;  2R65 A;  4PT5 A;  1XXH B;  3U5Z B;  2VQF M;  2CHG A;  1QAQ A;  3UGJ A;  2DXI A;  3GP1 A;  2J7N A;  4KHP M;  3TWL A;  3KSJ A;  3KS8 A;  1W5S A;  1HQY E;  2D7E A;  3AV0 A;  3L27 A;  3CTW B;  3SMS A;  3PXG A;  2O5R A;  4AG5 A;  2L7H A;  3FUU A;  4IBB A;  2E5L M;  4DR3 M;  1JR3 D;  2V6Z M;  1L1Z A;  2DWL A;  4JI5 M;  2CHV A;  4D80 A;  2XZU A;  3TWM A;  1G59 A;  5F3W A;  4IJE A;  5FSW A;  4CHT B;  1W5T A;  4AI6 A;  2F5S A;  4DV0 M;  3SHG B;  2LXE A;  1G4A E;  2Y0Q A;  1KSF X;  4IBJ A;  3U60 B;  4B7G A;  3JR5 A;  2G5G X;  4L8R C;  2Z7J A;  1L2B A;  1IN4 A;  4LJ9 A;  4S12 A;  3K2L A;  4LJ4 A;  2Y20 A;  2R45 A;  3U6O A;  2M60 A;  3GQ3 A;  1WXQ A;  3K92 A;  3M6A A;  2F5Q A;  5A2Q S;  2G8L A;  3H4M A;  4JI8 M;  4P16 A;  3FUW A;  1GVN A;  4OVZ A;  4LRS A;  3GPX A;  1QAM A;  5EXS A;  1HR0 M;  1N77 A;  1J7K A;  4B3M M;  4M0D A;  3GLG B;  1TH4 A;  2CFO A;  3SAS A;  3U6M A;  3UMM A;  2XFS A;  3U61 A;  1K3W A;  1IN7 A;  2YNM D;  1NY5 A;  2HKJ A;  4GKJ M;  4QNM A;  1PJI A;  2ZAN A;  1DO2 A;  2QBY A;  1E94 E;  3E9S A;  2R4J A;  4CIS A;  3A46 A;  1ZAE A;  2HHH M;  1L1T A;  1OFI A;  3QAU A;  1IXS B;  4AKH A;  4LY6 A;  4AW4 A;  3KW6 A;  1L2D A;  4LF5 M;  4LFB M;  2K47 A;  4LCB A;  4W5W A;  3L26 A;  4LF4 M;  1MX0 A;  1Z5C A;  1IN8 A;  4WW0 A;  1NNJ A;  4M9Z A;  4FCW A;  5JI3 E;  3LQR A;  4IBI A;  2JA2 A;  1GLN A;  2L09 A;  3U6D A;  4NXM M;  3K1J A;  1YSY A;  3AOE C;  3SBJ A;  4MGY E;  3VLF B;  2X8A A;  2D7G A;  5KPR A;  3ZH9 B;  2XEP A;  3R8F A;  4PDG A;  4AKG A;  4IBF A;  3FUV A;  1NSF A;  3TWK A;  1Q3B A;  1IBL M;  1N32 M;  4GHL A;  2XFT A;  4B3T M;  3GPU A;  2FOI C;  1GKI A;  3GLF B;  3SYK A;  1IBK M;  1SXJ E;  1XHB A;  4LFA M;  3MHV C;  1GL6 A;  3GO8 A;  4B3R M;  1XWI A;  3THG A;  4LGY A;  2XSZ A;  3A42 A;  3KP0 E;  4AG6 A;  3HJS A;  2BNK A;  4FWD A;  3MK6 A;  2CE7 A;  4YY3 M;  1IM2 A;  2VQE M;  1L8Q A;  2I7N A;  4GH9 A;  5EP3 A;  1L2C A;  1Z59 A;  2XLJ A;  1HT1 E;  1N36 M;  3HU1 A;  1J09 A;  5EQT A;  2KA6 B;  4RF0 A;  4GHA A;  4IBG A;  2RGO A;  1IBM M;  1K3X A;  4G6Z A;  4DV2 M;  1NVM A;  4MGI E;  1S3S A;  5DNY A;  1NY6 A;  2H1R A;  3KOY E;  4FCT A;  1I4W A;  2C99 A;  4DV7 M;  2Y0T A;  1JR3 A;  2NQ8 C;  3IG8 A;  1N33 M;  1Q39 A;  1TDZ A;  5KO3 A;  4B7F A;  3B9P A;  3M0E A;  5ITT A;  3EIE A;  1FNN A;  2R46 A;  1G41 A;  4REZ A;  3FYD A;  5KQ8 A;  2C96 A;  2J7O A;  2I7P A;  4X66 M;  4HL4 A;  2YFQ A;  3I4Y A;  4M9S A;  1QQW A;  3FTD A;  3TPZ A;  2Q2E B;  3DOA A;  1PJJ A;  3GPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...