4DUYM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duyM02
5ITYA 1Q3CA 5A2QS 4JI5M 3GO8A 3U6SA 4OX9M 3SASA 4PCZA 5ITTA 1N34M 1L2DA 4JI7M 1TDHA 2VQFM 3T1HM 3GP1A 4PDIA 4LF4M 4GKJM 1K3WA 3TWMA 4B3SM 2UUCM 3J81S 3C58A 1HNXM 4B3TM 1KFVA 5ITQA 3SAWA 1XNQM 1I94M 3GPUA 1XMQM 3VK8A 1IBLM 4CISA 2XZFA 1K3XA 1Q3BA 5FLXS 3W0FA 1Z59A 3U6OA 1PJJA 3TWKA 3A45A 5ITXA 1IBMM 4AQYM 2UXCM 3OTOM 4X65M 1Z5CA 4JI0M 1EE8A 4X62M 4DR4M 5LMUM 1MU5A 5IT9S 1Q39A 4DV1M 4G4NA 3SARA 4LF7M 2UXDM 3JR5A 1HNZM 4DUZM 4DR2M 4PDGA 2E5LM 1FJGM 3GPXA 3SAVA 3SAUA 2HHHM 1Z5BA 3TWLA 4NXMM 3U6CA 3GQ3A 4B3MM 4DV2M 4B3RM 4DR5M 3DOAA 4DV6M 4DR3M 1J5EM 1L1TA 4X66M 1L2BA 2UUAM 4NXNM 3U6QA 2F4VM 3GPPA 5ITRA 2XZUA 4DV5M 4JV5M 4MB7A 2F5OA 4PD2A 2VQEM 3GQ4A 2F5PA 4GKKM 3U6PA 1TDZA 4G4RA 1N33M 4DR1M 4LFBM 1MX0A 2HKJA 1HR0M 4DV0M 3VK7A 4YHHM 1L2CA 2UXBM 3JR4A 4YY3M 4DV7M 2Q2EB 1NNJA 5IWAM 4LFAM 4X64M 3A42A 3T1YM 1XC8A 4LF5M 4DR6M 2F5QA 4G4QA 2ZM6M 2OPFA 3JAMS 2F5NA 1PM5A 1XNRM 4LF8M 4NRWA 5LMNM 1PJIA 4JI1M 4DV3M 4JI8M 4KHPM 4LF9M 1XMOM 4LFCM 1R2YA 1L1ZA 4JYAM 4JI6M 1IBKM 2EA0A 1N32M 3J80S 3U6MA 1N36M 1K82A 2ZBKB 4LF6M 3U6LA 3J7AS 4DV4M 5ITXE 3GPYA 4DR7M 4JI2M 5ITUA 4DUYM 1HNWM 4K0KM 4G4OA 3U6DA 4NRVA 4JI3M 3A46A 2OQ4A 5BR8M 3U6EA 1R2ZA 2UU9M 4JI4M 2F5SA 3GQ5A 2UUBM 3SBJA 3SATA 1Z5AA 4ITQA
chains in the Genus database with same CATH superfamily
1E94E 2HCBA 5DYGA 5EP2A 4LRSA 5ITYA 5KO3A 3C3EA 3GO8A 4GEWA 4AG6A 4OX9M 2X8AA 1X37A 2D7HA 2KA6B 3VLFB 3I51A 1IBKM 1N34M 2X4AA 3FUXA 4JI7M 4AI6A 5EP1A 1TDHA 4Z6YA 2CV2A 1N33M 1IXZA 4KT0F 2RGHA 3IHPA 1OAIA 1K3WA 2R18A 4II7A 3H4JA 1NV9A 3HJ8A 2G5GX 3C58A 2BWEA 4L4UA 3AOEA 1IXRC 1XMQM 5JI2E 4CISA 2DAEA 3HY5A 1Z6TA 1HT2E 2M60A 5FLXS 3GLIE 1XB2B 3KS4A 3AJIB 4UN2B 1PJJA 5DFLA 1D2NA 4NOOB 1XWIA 4JI0M 4F2LA 2DAGA 4X62M 4DR4M 4FCVA 4DV1M 4G4NA 1V34A 3SARA 3JR5A 1HNZM 4PDGA 7CATA 2H5XA 3SAUA 4PT5A 2HHHM 4CHTB 2L4FA 1Z5BA 4NXMM 1NY6A 1OIZA 1R4GA 2G3QA 2LH0A 2G8LA 3U6CA 2WSCF 3GLIB 4B3RM 4KO8A 4QHTA 2HAKA 3DOAA 3IG8A 4GC9A 4GMQA 3VFDA 2OOBA 1NHWC 3HU3A 2FFJA 2F4VM 1OIPA 3TQSA 1QAMA 3MMPA 3E21A 4DV5M 1QZMA 4Q7JA 2Y21A 4IBIA 4PD2A 3GLGE 3R8FA 5E26A 3FUVA 4G3OA 5GKNA 1LV7A 3RGPA 3PFIA 2R4EA 3KP1E 2JUJA 2P5TA 2R45A 3LQRA 3QYEA 4WURA 3TE6A 4FWHA 1VG5A 2ZANA 2HKJA 1C7YA 1HR0M 1VEKA 4IBGA 1GJTA 3L26A 2UXBM 5KPRA 3JR4A 2O25A 1IXSB 4LZZA 2KNVA 2VF8A 1AIPC 2Q2EB 4RKUF 1DGBA 3A42A 1NSFA 3K8ZA 1NVMA 2FNAA 3AFHA 2K47A 3J27B 4XGIA 1WGNA 1R5LA 1SXJC 3CF6E 4G4QA 2LVPC 2R4JA 3KXEC 3I4YA 2H1RA 1P3QQ 4KODA 1XNRM 2V1CA 2DAMA 1VDDA 4LF8M 4NRWA 4FVMA 1PJIA 1R7RA 3UGJA 4AKIA 3RFWA 4JI8M 4KHPM 4LJ4A 4QOSA 1XMOM 4LFCM 4JI6M 1OFIA 1OFHA 4IBBA 3MJ5A 4LJ5A 5FTLA 3GLFA 2GNOA 4LCBA 3LQQA 2RRUA 5EXXA 1N36M 3U6LA 1QQWA 1Y8GA 3HHWA 3KOZE 1HNWM 1IN5A 5EXPA 2QENA 4NRVA 3K1JA 3KOYE 3A46A 2CV0A 2C9OA 2WZJA 1HJPA 1OQYA 2L7HA 1QDTA 3HJQA 2YFQA 3DA1A 2KW0A 2KHHA 4L78A 3GRRA 3EIHA 3SATA 2DZLA 2Z3XA 4TUWA 1GJSA 1XXHE 4B08A 4FD2A 1LTMA 4PCZA 1ORYB 4MM3B 2YR0A 2ZTCA 2L2DA 2JNHA 2DZNB 1D0KA 1TH4A 3SYKA 3E46A 2R0IA 2WSFF 4B7GA 2VQFM 3T1HM 3GP1A 1TGUA 2B3TA 2NQ8C 3K9PA 2JY6B 2KEBA 3CF0A 5IREB 4GKJM 3TWMA 4B3SM 4NSOB 2L6OA 2CP8A 2J7OA 4HEOA 3HU1A 2Z4RA 3MK6A 4LGMA 1HNXM 2DWLA 4M9ZA 5ITQA 2VF7A 1T3TA 2DZOB 2K6BA 2KNAA 3VK8A 1SXJA 2XZFA 1JR3D 3W0FA 3UJNA 2QNJA 2MJ5B 3TWKA 3R9XB 1DGFA 3K9OA 4LJ9A 4AQYM 1PJTA 2CE7A 2QQ8A 5KPZA 5C1BA 4X65M 2UXCM 1KSFX 1ZAEA 3W0LB 3KOWE 1Z5CA 2CRUA 4IBDA 3EIEA 4FCWA 1Q39A 2LHCA 4OVZB 4LF7M 2UXDM 4DUZM 4DR2M 2KDLA 3GPXA 1NNUC 2EKFA 2ZTDA 1PJQA 4Z8XA 3GLGA 1GL6A 3GQ3A 1KYIA 4AG5A 3KDSE 4DV2M 2FS1A 2LTUA 2Y20A 1RU3A 4R3DA 1J5EM 3K2LA 4X66M 3QWLA 1TR8A 1XHBA 2KXEA 1L2BA 1G59A 1IY1A 3C9PA 1YE9A 2DAIA 2I7NA 2R62A 4LJ6A 1QAQA 4MGIE 5EP4A 2D7GA 1W5SA 4D82A 5ITRA 3U61B 5H37D 3M7GA 2F5OA 2X49A 3VKGA 3GRUA 2RGOA 3GQ4A 3KFUG 1QYRA 2LHGA 4GKKM 2HWJA 4M0DA 3U6PA 1TDZA 3QAUA 1IQPA 1VEGA 1MN3A 3KP0E 2ZAMA 1MX0A 3GLHE 3VK7A 1D0LA 3SC3A 1JR3A 4YY3M 3UMMA 3UZUA 2DHYA 5E6JA 2GQFA 2R46A 4CIZA 4LGYA 2C96A 1R6BX 1XC8A 3PVSA 4IJEA 1AUAA 2KRKA 3HU2A 1GABA 2OPFA 1I4WA 1E9RA 3AOEC 2F5NA 3BXWA 1EFUB 3L29A 1PM5A 1TH2A 3ILKA 3M6AA 3HHYA 4XBOA 4JI1M 3LVVA 1QZEA 2LVOC 3UK6A 4DV3M 4FWGA 3ZC7B 2QBYA 1SXJB 1L1ZA 4D81A 3NBXX 1IN8A 3PNYA 2C99A 2ZBKB 3THGA 4LF6M 3J7AS 1N78A 2FE8A 2CHGA 3RGSA 4JN6A 5ITXE 4DR7M 3RE8A 2DVWB 8CATA 1XXHA 2ERCA 4M0WA 3FYCA 2QHOB 1W5TA 2DI0A 2MR9A 1DO2A 1ZQ9A 2QCUA 3B89A 4MGHA 5JI3E 2C5RA 5KQDA 2K0BX 4WW0A 4BLCA 1R2ZA 2KRUA 4RF1A 3CGWA 4HLQA 5FTJA 2F5SA 1SXJE 2OOAA 2UUBM 3GLIA 3KS8A 2XSZA 1OAOC 1JQJC 4JXJA 3FTDA 3QYBA 2YQZA 4ITQA 1N77A 1ZMUA 4OU7A 1Q3CA 3ZCBB 4JI5M 1V92A 4M9SA 2DNAA 4W5WA 3SHGB 1IN4A 1OKSA 3C3DA 3U6SA 3SASA 1G4AE 4GRIA 1UM8A 4FW9A 4LJAA 3B7ZA 5FTKA 4LZJA 2JY7A 1GKIA 4PDIA 2KZUA 4R71A 4AKHA 2BWBA 2CWBA 3SMPA 3KVWA 1IY2A 4GC5A 1QANA 1ZMVA 4B3TM 3ZQJA 4A3VB 3FE3A 1XNQM 3NWLA 4QNRA 2JZ0A 3LVWA 3HX3A 2JP7A 3Q8GA 4GIPA 3T6PA 1IBLM 2XH9A 2LXEA 3FYDA 2EKKA 1Z59A 3U5ZB 4IBKA 2DAKA 3J2PB 3U60B 3A45A 5ITXA 2R44A 4NSRA 1GO5A 1L8QA 3HHZA 4F1IA 3NBIA 4BBAA 3OTOM 2MROB 1EIJA 3L25A 3CF2A 3SHFA 1EE8A 3VKHA 2JXNA 2LVNC 1MU5A 2R65A 3U60A 3U5ZA 5EQTA 3VDUA 2E5LM 4BB9A 3SAVA 1QAOA 4GITA 1TTEA 4I8OA 5IZ7D 2EUCA 4NC6A 2L4EA 4REZA 4L15A 2L09A 1WXQA 1OTRA 4IIWA 5DNYA 3LW5F 2UUAM 4NL4H 4NXNM 1H6UA 3AV0A 3FUWA 3KW6A 3KSXA 3T38A 2XZUA 1ZMWA 3D8BA 4G6ZA 4MB7A 3KOXE 4RNAA 2K9DA 3DZDA 1BVSA 4G4RA 5L8RF 2DKLA 2APLA 3TPZA 5C18A 4LFBM 2L7IA 4DV0M 1WHCA 1L2CA 1J09A 4IJFA 1N75A 4EIWA 2LWXA 3GLHB 4WP2A 1NNJA 2JA2A 2XF3A 4HL4A 4CJ6A 3SFZA 5IWAM 4I5SA 4X64M 3T1YM 1QVRA 3BOSA 1XXHB 4R7GA 1G41A 4RF0A 4LF5M 4DR6M 2F5QA 3FTEA 1PGYA 2VIIA 1GVNA 4OW0A 3JAMS 5FTNA 2FH0A 4ZPXA 2HL7A 4MH0E 2QBYB 4FCTA 3H4MA 2YNMD 2CEAA 1Q02A 5EJCA 5KQ8A 5EXTA 4LF9M 4IBFA 1GLNA 3AOGA 4JYAM 1T43A 1WR1B 4MGKE 5FSWA 1PJSA 3DFZA 1N32M 2Z7JA 3J80S 2DWNA 2JY5A 1K82A 4L16A 1YLAA 2EJSA 4DV4M 3GPYA 1GL7A 2XGNA 2A5YB 3LCUA 5EXSA 1A5TA 3BBZA 3HWSA 2DHRA 2XFSA 1IN6A 4JI2M 4K0KM 4QOZC 2C9CA 3L2AA 1J7KA 4G4OA 2V1UA 3FD9A 2OQ4A 3LMMA 1NO1A 2W82A 4LRTA 2CUZA 3HZJA 2WSEF 1MJGM 1QUTA 1VDLA 1YUBA 3GQ5A 3ZH9B 1DGGA 4CGYB 3WHLA 1ZV1A 2QP9X 3SBJA 3FTFA 4P16A 3F92A 3MHVC 5A2QS 2BNKA 2QZ4A 4LY6A 3B74A 4L6V6 5EP3A 2V6ZM 5ITTA 1L2DA 4GHLA 3FRHA 4AW4A 2LVAA 4LG2A 2CFOA 1DGHA 3I04M 4LF4M 3V76A 4S12A 1HQYE 4I81A 2UUCM 2QPAA 3VDPA 1NY5A 3J81S 3GRVA 1KFVA 3SAWA 1I94M 3GPUA 4XK8F 1K3XA 2FOIC 1Q3BA 2M5ZA 3TL4X 3U6OA 4AKGA 1IBMM 3IECA 3FTCA 3D8LA 1CUKA 2J7NA 2Z4SA 3J7BA 3T15A 2XSZD 3FKEA 3GLFE 5LMUM 1OJLA 1VQ1A 5IT9S 3I4VA 2ZAOA 3U61A 4ANRA 3B7QA 1JB0F 1FJGM 3HGIA 1WGLA 3TWLA 2JWSA 1JR3E 4B3MM 2JZ1A 4DR5M 4IBJA 3GRYA 4DV6M 4DR3M 1G3IA 1L1TA 1C1KA 1TH3A 2O01F 3FRIA 3FUTA 3GLGB 1V33A 3HKPA 3M0EA 3U6QA 3PNVA 2DXIA 2D7EA 1FNNA 1NV8A 1WIVA 3GPPA 2CHVA 4JV5M 3IG5A 4OVZA 4AZFA 1G71A 3L28A 1F4IA 3HHXA 3W68A 2VQEM 1E32A 4B7HA 2F5PA 1NJFA 3FUUA 2C98A 4DBGB 2Y0QA 2Y0TA 2XLJA 3CTWB 4FWDA 4L8RC 2XFTA 1SXJD 2MGWA 2RKOA 4DR1M 2KNZA 2Z8YM 1IY0A 4YHHM 4GHAA 1QUSA 1DV0A 1IFYA 3E4RA 3AKZA 2DWZB 3PXGA 4DV7M 3B9PA 4D80A 4IBEA 4LFAM 1SG9A 3K92A 5DYIA 1WJ7A 1E9SA 2LVQD 3I01M 4MGZE 1DO0A 2JY8A 1HT1E 2DENA 4LJ8A 4Y28F 3L27A 4GH9A 2ZM6M 2OO9A 5BPVA 4LJ7A 3GLHA 2N35A 3B7NA 4B7FA 3A98B 3GLFB 1TF0B 2LNHC 3SMSA 5LMNM 2XEPA 1QDRA 3LCVB 2BJWA 2VDBB 5FTMA 1S3SA 2AHMA 3KSJA 2EO2A 1R2YA 1G8PA 2KZSA 2R6FA 1VEJA 3W67A 3HJSA 3AL0C 2EA0A 2I7PA 2O5RA 3Q8XA 2MH8A 4KLNA 3U6MA 2DWMA 2BJVA 4IBCA 5KPTA 1UFZA 3SYLA 2CV1A 2QSFX 1IM2A 5F3WA 5ITUA 4DUYM 4QHSA 1NHGC 4M9XA 1HQCA 1DGHB 3U6DA 1T6OA 1IN7A 1D0MA 2CHQA 4JI3M 1IXSA 3E9SA 1PRBA 4QNMA 3WHKA 5BR8M 3U6EA 2UU9M 1YSYA 4P17A 4JI4M 4I4LA 2J5YA 2LBCA 1NJGA 4MGYE 1Z5AA
chains in the Genus database with same CATH topology
1E94E 2HCBA 5DYGA 5EP2A 4LRSA 5ITYA 5KO3A 3GO8A 4AG6A 4OX9M 2X8AA 1X37A 2D7HA 2KA6B 3VLFB 3I51A 1N34M 2X4AA 3FUXA 4JI7M 4AI6A 5EP1A 1TDHA 4Z6YA 2CV2A 1IXZA 2RGHA 1K3WA 2R18A 4II7A 3HJ8A 2G5GX 3C58A 4L4UA 3AOEA 1IXRC 1XMQM 5JI2E 4CISA 1Z6TA 1HT2E 2M60A 5FLXS 3KS4A 3AJIB 1PJJA 1D2NA 4NOOB 1XWIA 4JI0M 4X62M 4DR4M 4FCVA 4DV1M 4G4NA 3SARA 3JR5A 1HNZM 4PDGA 7CATA 3SAUA 4PT5A 2HHHM 4CHTB 1Z5BA 4NXMM 1NY6A 2LH0A 3U6CA 2G8LA 3GLIB 4B3RM 4KO8A 4QHTA 3DOAA 3IG8A 4GC9A 4GMQA 3VFDA 1NHWC 3HU3A 2FFJA 2F4VM 3TQSA 1QAMA 4DV5M 1QZMA 3R8FA 2Y21A 4IBIA 4PD2A 5E26A 3FUVA 5GKNA 1LV7A 3RGPA 3PFIA 2R4EA 3KP1E 2P5TA 2R45A 4WURA 3TE6A 1N33M 4FWHA 2ZANA 2HKJA 1HR0M 4IBGA 3L26A 2UXBM 5KPRA 3JR4A 1IXSB 4LZZA 2Q2EB 1DGBA 3A42A 1NSFA 3K8ZA 1NVMA 2FNAA 3AFHA 2K47A 3J27B 4XGIA 1SXJC 3CF6E 4G4QA 2R4JA 3KXEC 3I4YA 2H1RA 4KODA 1XNRM 2V1CA 1VDDA 4LF8M 4NRWA 4FVMA 1PJIA 1R7RA 3UGJA 4AKIA 3RFWA 4JI8M 4KHPM 4LJ4A 4QOSA 1XMOM 4LFCM 4JI6M 1OFIA 1OFHA 4IBBA 3MJ5A 4LJ5A 5FTLA 3GLFA 1IBKM 4LCBA 3LQQA 1N36M 5EXXA 3U6LA 1QQWA 3HHWA 3KOZE 1HNWM 1IN5A 5EXPA 2QENA 4NRVA 3K1JA 3KOYE 3A46A 2CV0A 2C9OA 2L7HA 3HJQA 2YFQA 3DA1A 2KW0A 4L78A 3GRRA 3EIHA 3SATA 2Z3XA 4TUWA 4B08A 4FD2A 4PCZA 1ORYB 4MM3B 2YR0A 2DZNB 1TH4A 3SYKA 4B7GA 2VQFM 3T1HM 3GP1A 1TGUA 2NQ8C 5IREB 4GKJM 2KEBA 3CF0A 3TWMA 4B3SM 4NSOB 2L6OA 2J7OA 3HU1A 2Z4RA 3MK6A 4LGMA 1HNXM 2DWLA 4M9ZA 5ITQA 1T3TA 2DZOB 3VK8A 1SXJA 2XZFA 1JR3D 3W0FA 3UJNA 3TWKA 3R9XB 1DGFA 4LJ9A 4AQYM 5KPZA 2CE7A 2UXCM 5C1BA 4X65M 1KSFX 1ZAEA 3W0LB 3KOWE 1Z5CA 4IBDA 3EIEA 4FCWA 1Q39A 4OVZB 4LF7M 2UXDM 4DUZM 4DR2M 3GPXA 1NNUC 4Z8XA 3GLGA 1GL6A 3GQ3A 1KYIA 4AG5A 3KDSE 4DV2M 2Y20A 4R3DA 1J5EM 3K2LA 4X66M 3QWLA 2KXEA 1XHBA 1L2BA 1G59A 1IY1A 4LJ6A 1YE9A 2I7NA 2R62A 5EP4A 4MGIE 1QAQA 4D82A 2D7GA 1W5SA 5ITRA 3U61B 5H37D 3M7GA 2F5OA 2X49A 3GRUA 2RGOA 3GQ4A 3KFUG 1QYRA 4GKKM 4M0DA 3U6PA 1TDZA 3QAUA 1IQPA 3KP0E 2ZAMA 1MX0A 3VK7A 3SC3A 1JR3A 4YY3M 3UMMA 3UZUA 5E6JA 2R46A 4LGYA 2C96A 1R6BX 1XC8A 3PVSA 4IJEA 2KRKA 3HU2A 2OPFA 1I4WA 1E9RA 3AOEC 2F5NA 3L29A 1PM5A 1TH2A 3ILKA 3M6AA 3HHYA 4XBOA 4JI1M 3LVVA 3UK6A 4DV3M 4FWGA 3ZC7B 2QBYA 1SXJB 1L1ZA 4D81A 1IN8A 3PNYA 2C99A 2ZBKB 3THGA 4LF6M 3J7AS 1N78A 2FE8A 2CHGA 3RGSA 4JN6A 5ITXE 4DR7M 3RE8A 2DVWB 8CATA 1XXHA 2ERCA 4M0WA 3FYCA 1W5TA 1DO2A 1ZQ9A 2QCUA 4MGHA 5JI3E 2C5RA 5KQDA 4BLCA 4WW0A 1R2ZA 2KRUA 4RF1A 4HLQA 5FTJA 2F5SA 1SXJE 2UUBM 3GLIA 3KS8A 2XSZA 1JQJC 4JXJA 3FTDA 2YQZA 4ITQA 1N77A 4OU7A 1Q3CA 3ZCBB 4JI5M 4M9SA 4W5WA 3SHGB 1IN4A 3U6SA 3SASA 1G4AE 4GRIA 1UM8A 4FW9A 4LJAA 5FTKA 4LZJA 1GKIA 4PDIA 2KZUA 4AKHA 3SMPA 3KVWA 1IY2A 4GC5A 1QANA 4B3TM 4A3VB 1XNQM 3NWLA 4QNRA 3LVWA 3VKGA 1IBLM 4GIPA 2XH9A 2LXEA 3FYDA 1Z59A 3U5ZB 4IBKA 3J2PB 3U60B 3A45A 5ITXA 4NSRA 1L8QA 3HHZA 3NBIA 4BBAA 3OTOM 3L25A 3CF2A 3SHFA 1EE8A 3VKHA 1MU5A 2R65A 3U60A 3U5ZA 5EQTA 3VDUA 2E5LM 4BB9A 3SAVA 1QAOA 4GITA 4I8OA 5IZ7D 2EUCA 4REZA 4L15A 2L09A 1WXQA 4IIWA 5DNYA 2UUAM 4NL4H 4NXNM 1H6UA 3AV0A 3KW6A 3FUWA 3KSXA 3T38A 2XZUA 3D8BA 4G6ZA 4MB7A 3KOXE 4RNAA 3DZDA 4G4RA 3TPZA 5C18A 4LFBM 2L7IA 4DV0M 1L2CA 1J09A 4IJFA 1N75A 4EIWA 2LWXA 3GLHB 1NNJA 2JA2A 2XF3A 4HL4A 5IWAM 3SFZA 4I5SA 4X64M 3T1YM 1QVRA 3BOSA 1XXHB 4R7GA 1G41A 4RF0A 4LF5M 4DR6M 2F5QA 3FTEA 2VIIA 1GVNA 4OW0A 3JAMS 5FTNA 4ZPXA 2HL7A 4MH0E 2QBYB 4FCTA 3H4MA 2YNMD 2CEAA 5KQ8A 5EJCA 5EXTA 4LF9M 4IBFA 1GLNA 3AOGA 4JYAM 4MGKE 5FSWA 3DFZA 1N32M 2Z7JA 3J80S 2DWNA 1K82A 4L16A 4DV4M 3GPYA 1GL7A 2XGNA 2A5YB 5EXSA 4JI2M 3HWSA 2DHRA 2XFSA 1IN6A 4K0KM 4QOZC 2C9CA 3L2AA 1J7KA 4G4OA 2V1UA 3FD9A 2OQ4A 3LMMA 2W82A 4LRTA 2CUZA 1YUBA 3GQ5A 3ZH9B 1DGGA 4CGYB 3WHLA 2QP9X 3SBJA 3FTFA 4P16A 3MHVC 5A2QS 2BNKA 2QZ4A 4LY6A 5EP3A 2V6ZM 5ITTA 1L2DA 4GHLA 4AW4A 4LG2A 2CFOA 1DGHA 4LF4M 4S12A 1HQYE 4I81A 2UUCM 2QPAA 3VDPA 1NY5A 3J81S 3GRVA 1KFVA 3SAWA 1I94M 3GPUA 1K3XA 2FOIC 1Q3BA 2M5ZA 3TL4X 3U6OA 4AKGA 1IBMM 3FTCA 3D8LA 2J7NA 2Z4SA 3J7BA 3T15A 2XSZD 3FKEA 5LMUM 1OJLA 5IT9S 3I4VA 2ZAOA 3U61A 1FJGM 3HGIA 3TWLA 4B3MM 4DR5M 4IBJA 3GRYA 4DV6M 4DR3M 1G3IA 1L1TA 1C1KA 1TH3A 3FUTA 3GLGB 3HKPA 3M0EA 3U6QA 3PNVA 2DXIA 2D7EA 1FNNA 3GPPA 2CHVA 4JV5M 3IG5A 4OVZA 4AZFA 3L28A 3HHXA 2VQEM 1E32A 4B7HA 2F5PA 1NJFA 3FUUA 2C98A 2Y0QA 2Y0TA 2XLJA 3CTWB 4FWDA 4L8RC 2XFTA 1SXJD 4DR1M 2RKOA 1IY0A 4YHHM 4GHAA 3E4RA 3AKZA 2DWZB 3PXGA 4DV7M 3B9PA 4D80A 4IBEA 4LFAM 3K92A 5DYIA 1E9SA 4MGZE 1DO0A 1NJGA 1HT1E 4LJ8A 3L27A 4GH9A 2ZM6M 5BPVA 4LJ7A 3GLHA 4B7FA 3A98B 3GLFB 2LNHC 3SMSA 5LMNM 2XEPA 2BJWA 5FTMA 1S3SA 2AHMA 3KSJA 2EO2A 1R2YA 1G8PA 2KZSA 3AL0C 3HJSA 2EA0A 2I7PA 2O5RA 3Q8XA 4KLNA 3U6MA 2DWMA 2BJVA 4IBCA 5KPTA 3SYLA 2CV1A 1IM2A 5F3WA 5ITUA 4DUYM 4QHSA 1NHGC 4M9XA 1HQCA 1DGHB 3U6DA 2CHQA 1IN7A 4JI3M 3E9SA 4QNMA 5BR8M 3WHKA 3U6EA 2UU9M 1YSYA 4JI4M 4I4LA 3LQRA 4MGYE 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITY A;  1Q3C A;  5A2Q S;  4JI5 M;  3GO8 A;  3U6S A;  4OX9 M;  3SAS A;  4PCZ A;  5ITT A;  1N34 M;  1L2D A;  4JI7 M;  1TDH A;  2VQF M;  3T1H M;  3GP1 A;  4PDI A;  4LF4 M;  4GKJ M;  1K3W A;  3TWM A;  4B3S M;  2UUC M;  3J81 S;  3C58 A;  1HNX M;  4B3T M;  1KFV A;  5ITQ A;  3SAW A;  1XNQ M;  1I94 M;  3GPU A;  1XMQ M;  3VK8 A;  1IBL M;  4CIS A;  2XZF A;  1K3X A;  1Q3B A;  5FLX S;  3W0F A;  1Z59 A;  3U6O A;  1PJJ A;  3TWK A;  3A45 A;  5ITX A;  1IBM M;  4AQY M;  2UXC M;  3OTO M;  4X65 M;  1Z5C A;  4JI0 M;  1EE8 A;  4X62 M;  4DR4 M;  5LMU M;  1MU5 A;  5IT9 S;  1Q39 A;  4DV1 M;  4G4N A;  3SAR A;  4LF7 M;  2UXD M;  3JR5 A;  1HNZ M;  4DUZ M;  4DR2 M;  4PDG A;  2E5L M;  1FJG M;  3GPX A;  3SAV A;  3SAU A;  2HHH M;  1Z5B A;  3TWL A;  4NXM M;  3U6C A;  3GQ3 A;  4B3M M;  4DV2 M;  4B3R M;  4DR5 M;  3DOA A;  4DV6 M;  4DR3 M;  1J5E M;  1L1T A;  4X66 M;  1L2B A;  2UUA M;  4NXN M;  3U6Q A;  2F4V M;  3GPP A;  5ITR A;  2XZU A;  4DV5 M;  4JV5 M;  4MB7 A;  2F5O A;  4PD2 A;  2VQE M;  3GQ4 A;  2F5P A;  4GKK M;  3U6P A;  1TDZ A;  4G4R A;  1N33 M;  4DR1 M;  4LFB M;  1MX0 A;  2HKJ A;  1HR0 M;  4DV0 M;  3VK7 A;  4YHH M;  1L2C A;  2UXB M;  3JR4 A;  4YY3 M;  4DV7 M;  2Q2E B;  1NNJ A;  5IWA M;  4LFA M;  4X64 M;  3A42 A;  3T1Y M;  1XC8 A;  4LF5 M;  4DR6 M;  2F5Q A;  4G4Q A;  2ZM6 M;  2OPF A;  3JAM S;  2F5N A;  1PM5 A;  1XNR M;  4LF8 M;  4NRW A;  5LMN M;  1PJI A;  4JI1 M;  4DV3 M;  4JI8 M;  4KHP M;  4LF9 M;  1XMO M;  4LFC M;  1R2Y A;  1L1Z A;  4JYA M;  4JI6 M;  1IBK M;  2EA0 A;  1N32 M;  3J80 S;  3U6M A;  1N36 M;  1K82 A;  2ZBK B;  4LF6 M;  3U6L A;  3J7A S;  4DV4 M;  5ITX E;  3GPY A;  4DR7 M;  4JI2 M;  5ITU A;  4DUY M;  1HNW M;  4K0K M;  4G4O A;  3U6D A;  4NRV A;  4JI3 M;  3A46 A;  2OQ4 A;  5BR8 M;  3U6E A;  1R2Z A;  2UU9 M;  4JI4 M;  2F5S A;  3GQ5 A;  2UUB M;  3SBJ A;  3SAT A;  1Z5A A;  4ITQ A; 
#chains in the Genus database with same CATH topology
 1E94 E;  2HCB A;  5DYG A;  5EP2 A;  4LRS A;  5ITY A;  5KO3 A;  3C3E A;  3GO8 A;  4GEW A;  4AG6 A;  4OX9 M;  2X8A A;  1X37 A;  2D7H A;  2KA6 B;  3VLF B;  3I51 A;  1IBK M;  1N34 M;  2X4A A;  3FUX A;  4JI7 M;  4AI6 A;  5EP1 A;  1TDH A;  4Z6Y A;  2CV2 A;  1N33 M;  1IXZ A;  4KT0 F;  2RGH A;  3IHP A;  1OAI A;  1K3W A;  2R18 A;  4II7 A;  3H4J A;  1NV9 A;  3HJ8 A;  2G5G X;  3C58 A;  2BWE A;  4L4U A;  3AOE A;  1IXR C;  1XMQ M;  5JI2 E;  4CIS A;  2DAE A;  3HY5 A;  1Z6T A;  1HT2 E;  2M60 A;  5FLX S;  3GLI E;  1XB2 B;  3KS4 A;  3AJI B;  4UN2 B;  1PJJ A;  5DFL A;  1D2N A;  4NOO B;  1XWI A;  4JI0 M;  4F2L A;  2DAG A;  4X62 M;  4DR4 M;  4FCV A;  4DV1 M;  4G4N A;  1V34 A;  3SAR A;  3JR5 A;  1HNZ M;  4PDG A;  7CAT A;  2H5X A;  3SAU A;  4PT5 A;  2HHH M;  4CHT B;  2L4F A;  1Z5B A;  4NXM M;  1NY6 A;  1OIZ A;  1R4G A;  2G3Q A;  2LH0 A;  2G8L A;  3U6C A;  2WSC F;  3GLI B;  4B3R M;  4KO8 A;  4QHT A;  2HAK A;  3DOA A;  3IG8 A;  4GC9 A;  4GMQ A;  3VFD A;  2OOB A;  1NHW C;  3HU3 A;  2FFJ A;  2F4V M;  1OIP A;  3TQS A;  1QAM A;  3MMP A;  3E21 A;  4DV5 M;  1QZM A;  4Q7J A;  2Y21 A;  4IBI A;  4PD2 A;  3GLG E;  3R8F A;  5E26 A;  3FUV A;  4G3O A;  5GKN A;  1LV7 A;  3RGP A;  3PFI A;  2R4E A;  3KP1 E;  2JUJ A;  2P5T A;  2R45 A;  3LQR A;  3QYE A;  4WUR A;  3TE6 A;  4FWH A;  1VG5 A;  2ZAN A;  2HKJ A;  1C7Y A;  1HR0 M;  1VEK A;  4IBG A;  1GJT A;  3L26 A;  2UXB M;  5KPR A;  3JR4 A;  2O25 A;  1IXS B;  4LZZ A;  2KNV A;  2VF8 A;  1AIP C;  2Q2E B;  4RKU F;  1DGB A;  3A42 A;  1NSF A;  3K8Z A;  1NVM A;  2FNA A;  3AFH A;  2K47 A;  3J27 B;  4XGI A;  1WGN A;  1R5L A;  1SXJ C;  3CF6 E;  4G4Q A;  2LVP C;  2R4J A;  3KXE C;  3I4Y A;  2H1R A;  1P3Q Q;  4KOD A;  1XNR M;  2V1C A;  2DAM A;  1VDD A;  4LF8 M;  4NRW A;  4FVM A;  1PJI A;  1R7R A;  3UGJ A;  4AKI A;  3RFW A;  4JI8 M;  4KHP M;  4LJ4 A;  4QOS A;  1XMO M;  4LFC M;  4JI6 M;  1OFI A;  1OFH A;  4IBB A;  3MJ5 A;  4LJ5 A;  5FTL A;  3GLF A;  2GNO A;  4LCB A;  3LQQ A;  2RRU A;  5EXX A;  1N36 M;  3U6L A;  1QQW A;  1Y8G A;  3HHW A;  3KOZ E;  1HNW M;  1IN5 A;  5EXP A;  2QEN A;  4NRV A;  3K1J A;  3KOY E;  3A46 A;  2CV0 A;  2C9O A;  2WZJ A;  1HJP A;  1OQY A;  2L7H A;  1QDT A;  3HJQ A;  2YFQ A;  3DA1 A;  2KW0 A;  2KHH A;  4L78 A;  3GRR A;  3EIH A;  3SAT A;  2DZL A;  2Z3X A;  4TUW A;  1GJS A;  1XXH E;  4B08 A;  4FD2 A;  1LTM A;  4PCZ A;  1ORY B;  4MM3 B;  2YR0 A;  2ZTC A;  2L2D A;  2JNH A;  2DZN B;  1D0K A;  1TH4 A;  3SYK A;  3E46 A;  2R0I A;  2WSF F;  4B7G A;  2VQF M;  3T1H M;  3GP1 A;  1TGU A;  2B3T A;  2NQ8 C;  3K9P A;  2JY6 B;  2KEB A;  3CF0 A;  5IRE B;  4GKJ M;  3TWM A;  4B3S M;  4NSO B;  2L6O A;  2CP8 A;  2J7O A;  4HEO A;  3HU1 A;  2Z4R A;  3MK6 A;  4LGM A;  1HNX M;  2DWL A;  4M9Z A;  5ITQ A;  2VF7 A;  1T3T A;  2DZO B;  2K6B A;  2KNA A;  3VK8 A;  1SXJ A;  2XZF A;  1JR3 D;  3W0F A;  3UJN A;  2QNJ A;  2MJ5 B;  3TWK A;  3R9X B;  1DGF A;  3K9O A;  4LJ9 A;  4AQY M;  1PJT A;  2CE7 A;  2QQ8 A;  5KPZ A;  5C1B A;  4X65 M;  2UXC M;  1KSF X;  1ZAE A;  3W0L B;  3KOW E;  1Z5C A;  2CRU A;  4IBD A;  3EIE A;  4FCW A;  1Q39 A;  2LHC A;  4OVZ B;  4LF7 M;  2UXD M;  4DUZ M;  4DR2 M;  2KDL A;  3GPX A;  1NNU C;  2EKF A;  2ZTD A;  1PJQ A;  4Z8X A;  3GLG A;  1GL6 A;  3GQ3 A;  1KYI A;  4AG5 A;  3KDS E;  4DV2 M;  2FS1 A;  2LTU A;  2Y20 A;  1RU3 A;  4R3D A;  1J5E M;  3K2L A;  4X66 M;  3QWL A;  1TR8 A;  1XHB A;  2KXE A;  1L2B A;  1G59 A;  1IY1 A;  3C9P A;  1YE9 A;  2DAI A;  2I7N A;  2R62 A;  4LJ6 A;  1QAQ A;  4MGI E;  5EP4 A;  2D7G A;  1W5S A;  4D82 A;  5ITR A;  3U61 B;  5H37 D;  3M7G A;  2F5O A;  2X49 A;  3VKG A;  3GRU A;  2RGO A;  3GQ4 A;  3KFU G;  1QYR A;  2LHG A;  4GKK M;  2HWJ A;  4M0D A;  3U6P A;  1TDZ A;  3QAU A;  1IQP A;  1VEG A;  1MN3 A;  3KP0 E;  2ZAM A;  1MX0 A;  3GLH E;  3VK7 A;  1D0L A;  3SC3 A;  1JR3 A;  4YY3 M;  3UMM A;  3UZU A;  2DHY A;  5E6J A;  2GQF A;  2R46 A;  4CIZ A;  4LGY A;  2C96 A;  1R6B X;  1XC8 A;  3PVS A;  4IJE A;  1AUA A;  2KRK A;  3HU2 A;  1GAB A;  2OPF A;  1I4W A;  1E9R A;  3AOE C;  2F5N A;  3BXW A;  1EFU B;  3L29 A;  1PM5 A;  1TH2 A;  3ILK A;  3M6A A;  3HHY A;  4XBO A;  4JI1 M;  3LVV A;  1QZE A;  2LVO C;  3UK6 A;  4DV3 M;  4FWG A;  3ZC7 B;  2QBY A;  1SXJ B;  1L1Z A;  4D81 A;  3NBX X;  1IN8 A;  3PNY A;  2C99 A;  2ZBK B;  3THG A;  4LF6 M;  3J7A S;  1N78 A;  2FE8 A;  2CHG A;  3RGS A;  4JN6 A;  5ITX E;  4DR7 M;  3RE8 A;  2DVW B;  8CAT A;  1XXH A;  2ERC A;  4M0W A;  3FYC A;  2QHO B;  1W5T A;  2DI0 A;  2MR9 A;  1DO2 A;  1ZQ9 A;  2QCU A;  3B89 A;  4MGH A;  5JI3 E;  2C5R A;  5KQD A;  2K0B X;  4WW0 A;  4BLC A;  1R2Z A;  2KRU A;  4RF1 A;  3CGW A;  4HLQ A;  5FTJ A;  2F5S A;  1SXJ E;  2OOA A;  2UUB M;  3GLI A;  3KS8 A;  2XSZ A;  1OAO C;  1JQJ C;  4JXJ A;  3FTD A;  3QYB A;  2YQZ A;  4ITQ A;  1N77 A;  1ZMU A;  4OU7 A;  1Q3C A;  3ZCB B;  4JI5 M;  1V92 A;  4M9S A;  2DNA A;  4W5W A;  3SHG B;  1IN4 A;  1OKS A;  3C3D A;  3U6S A;  3SAS A;  1G4A E;  4GRI A;  1UM8 A;  4FW9 A;  4LJA A;  3B7Z A;  5FTK A;  4LZJ A;  2JY7 A;  1GKI A;  4PDI A;  2KZU A;  4R71 A;  4AKH A;  2BWB A;  2CWB A;  3SMP A;  3KVW A;  1IY2 A;  4GC5 A;  1QAN A;  1ZMV A;  4B3T M;  3ZQJ A;  4A3V B;  3FE3 A;  1XNQ M;  3NWL A;  4QNR A;  2JZ0 A;  3LVW A;  3HX3 A;  2JP7 A;  3Q8G A;  4GIP A;  3T6P A;  1IBL M;  2XH9 A;  2LXE A;  3FYD A;  2EKK A;  1Z59 A;  3U5Z B;  4IBK A;  2DAK A;  3J2P B;  3U60 B;  3A45 A;  5ITX A;  2R44 A;  4NSR A;  1GO5 A;  1L8Q A;  3HHZ A;  4F1I A;  3NBI A;  4BBA A;  3OTO M;  2MRO B;  1EIJ A;  3L25 A;  3CF2 A;  3SHF A;  1EE8 A;  3VKH A;  2JXN A;  2LVN C;  1MU5 A;  2R65 A;  3U60 A;  3U5Z A;  5EQT A;  3VDU A;  2E5L M;  4BB9 A;  3SAV A;  1QAO A;  4GIT A;  1TTE A;  4I8O A;  5IZ7 D;  2EUC A;  4NC6 A;  2L4E A;  4REZ A;  4L15 A;  2L09 A;  1WXQ A;  1OTR A;  4IIW A;  5DNY A;  3LW5 F;  2UUA M;  4NL4 H;  4NXN M;  1H6U A;  3AV0 A;  3FUW A;  3KW6 A;  3KSX A;  3T38 A;  2XZU A;  1ZMW A;  3D8B A;  4G6Z A;  4MB7 A;  3KOX E;  4RNA A;  2K9D A;  3DZD A;  1BVS A;  4G4R A;  5L8R F;  2DKL A;  2APL A;  3TPZ A;  5C18 A;  4LFB M;  2L7I A;  4DV0 M;  1WHC A;  1L2C A;  1J09 A;  4IJF A;  1N75 A;  4EIW A;  2LWX A;  3GLH B;  4WP2 A;  1NNJ A;  2JA2 A;  2XF3 A;  4HL4 A;  4CJ6 A;  3SFZ A;  5IWA M;  4I5S A;  4X64 M;  3T1Y M;  1QVR A;  3BOS A;  1XXH B;  4R7G A;  1G41 A;  4RF0 A;  4LF5 M;  4DR6 M;  2F5Q A;  3FTE A;  1PGY A;  2VII A;  1GVN A;  4OW0 A;  3JAM S;  5FTN A;  2FH0 A;  4ZPX A;  2HL7 A;  4MH0 E;  2QBY B;  4FCT A;  3H4M A;  2YNM D;  2CEA A;  1Q02 A;  5EJC A;  5KQ8 A;  5EXT A;  4LF9 M;  4IBF A;  1GLN A;  3AOG A;  4JYA M;  1T43 A;  1WR1 B;  4MGK E;  5FSW A;  1PJS A;  3DFZ A;  1N32 M;  2Z7J A;  3J80 S;  2DWN A;  2JY5 A;  1K82 A;  4L16 A;  1YLA A;  2EJS A;  4DV4 M;  3GPY A;  1GL7 A;  2XGN A;  2A5Y B;  3LCU A;  5EXS A;  1A5T A;  3BBZ A;  3HWS A;  2DHR A;  2XFS A;  1IN6 A;  4JI2 M;  4K0K M;  4QOZ C;  2C9C A;  3L2A A;  1J7K A;  4G4O A;  2V1U A;  3FD9 A;  2OQ4 A;  3LMM A;  1NO1 A;  2W82 A;  4LRT A;  2CUZ A;  3HZJ A;  2WSE F;  1MJG M;  1QUT A;  1VDL A;  1YUB A;  3GQ5 A;  3ZH9 B;  1DGG A;  4CGY B;  3WHL A;  1ZV1 A;  2QP9 X;  3SBJ A;  3FTF A;  4P16 A;  3F92 A;  3MHV C;  5A2Q S;  2BNK A;  2QZ4 A;  4LY6 A;  3B74 A;  4L6V 6;  5EP3 A;  2V6Z M;  5ITT A;  1L2D A;  4GHL A;  3FRH A;  4AW4 A;  2LVA A;  4LG2 A;  2CFO A;  1DGH A;  3I04 M;  4LF4 M;  3V76 A;  4S12 A;  1HQY E;  4I81 A;  2UUC M;  2QPA A;  3VDP A;  1NY5 A;  3J81 S;  3GRV A;  1KFV A;  3SAW A;  1I94 M;  3GPU A;  4XK8 F;  1K3X A;  2FOI C;  1Q3B A;  2M5Z A;  3TL4 X;  3U6O A;  4AKG A;  1IBM M;  3IEC A;  3FTC A;  3D8L A;  1CUK A;  2J7N A;  2Z4S A;  3J7B A;  3T15 A;  2XSZ D;  3FKE A;  3GLF E;  5LMU M;  1OJL A;  1VQ1 A;  5IT9 S;  3I4V A;  2ZAO A;  3U61 A;  4ANR A;  3B7Q A;  1JB0 F;  1FJG M;  3HGI A;  1WGL A;  3TWL A;  2JWS A;  1JR3 E;  4B3M M;  2JZ1 A;  4DR5 M;  4IBJ A;  3GRY A;  4DV6 M;  4DR3 M;  1G3I A;  1L1T A;  1C1K A;  1TH3 A;  2O01 F;  3FRI A;  3FUT A;  3GLG B;  1V33 A;  3HKP A;  3M0E A;  3U6Q A;  3PNV A;  2DXI A;  2D7E A;  1FNN A;  1NV8 A;  1WIV A;  3GPP A;  2CHV A;  4JV5 M;  3IG5 A;  4OVZ A;  4AZF A;  1G71 A;  3L28 A;  1F4I A;  3HHX A;  3W68 A;  2VQE M;  1E32 A;  4B7H A;  2F5P A;  1NJF A;  3FUU A;  2C98 A;  4DBG B;  2Y0Q A;  2Y0T A;  2XLJ A;  3CTW B;  4FWD A;  4L8R C;  2XFT A;  1SXJ D;  2MGW A;  2RKO A;  4DR1 M;  2KNZ A;  2Z8Y M;  1IY0 A;  4YHH M;  4GHA A;  1QUS A;  1DV0 A;  1IFY A;  3E4R A;  3AKZ A;  2DWZ B;  3PXG A;  4DV7 M;  3B9P A;  4D80 A;  4IBE A;  4LFA M;  1SG9 A;  3K92 A;  5DYI A;  1WJ7 A;  1E9S A;  2LVQ D;  3I01 M;  4MGZ E;  1DO0 A;  2JY8 A;  1HT1 E;  2DEN A;  4LJ8 A;  4Y28 F;  3L27 A;  4GH9 A;  2ZM6 M;  2OO9 A;  5BPV A;  4LJ7 A;  3GLH A;  2N35 A;  3B7N A;  4B7F A;  3A98 B;  3GLF B;  1TF0 B;  2LNH C;  3SMS A;  5LMN M;  2XEP A;  1QDR A;  3LCV B;  2BJW A;  2VDB B;  5FTM A;  1S3S A;  2AHM A;  3KSJ A;  2EO2 A;  1R2Y A;  1G8P A;  2KZS A;  2R6F A;  1VEJ A;  3W67 A;  3HJS A;  3AL0 C;  2EA0 A;  2I7P A;  2O5R A;  3Q8X A;  2MH8 A;  4KLN A;  3U6M A;  2DWM A;  2BJV A;  4IBC A;  5KPT A;  1UFZ A;  3SYL A;  2CV1 A;  2QSF X;  1IM2 A;  5F3W A;  5ITU A;  4DUY M;  4QHS A;  1NHG C;  4M9X A;  1HQC A;  1DGH B;  3U6D A;  1T6O A;  1IN7 A;  1D0M A;  2CHQ A;  4JI3 M;  1IXS A;  3E9S A;  1PRB A;  4QNM A;  3WHK A;  5BR8 M;  3U6E A;  2UU9 M;  1YSY A;  4P17 A;  4JI4 M;  4I4L A;  2J5Y A;  2LBC A;  1NJG A;  4MGY E;  1Z5A A; 
#chains in the Genus database with same CATH homology
 1E94 E;  2HCB A;  5DYG A;  5EP2 A;  4LRS A;  5ITY A;  5KO3 A;  3GO8 A;  4AG6 A;  4OX9 M;  2X8A A;  1X37 A;  2D7H A;  2KA6 B;  3VLF B;  3I51 A;  1N34 M;  2X4A A;  3FUX A;  4JI7 M;  4AI6 A;  5EP1 A;  1TDH A;  4Z6Y A;  2CV2 A;  1IXZ A;  2RGH A;  1K3W A;  2R18 A;  4II7 A;  3HJ8 A;  2G5G X;  3C58 A;  4L4U A;  3AOE A;  1IXR C;  1XMQ M;  5JI2 E;  4CIS A;  1Z6T A;  1HT2 E;  2M60 A;  5FLX S;  3KS4 A;  3AJI B;  1PJJ A;  1D2N A;  4NOO B;  1XWI A;  4JI0 M;  4X62 M;  4DR4 M;  4FCV A;  4DV1 M;  4G4N A;  3SAR A;  3JR5 A;  1HNZ M;  4PDG A;  7CAT A;  3SAU A;  4PT5 A;  2HHH M;  4CHT B;  1Z5B A;  4NXM M;  1NY6 A;  2LH0 A;  3U6C A;  2G8L A;  3GLI B;  4B3R M;  4KO8 A;  4QHT A;  3DOA A;  3IG8 A;  4GC9 A;  4GMQ A;  3VFD A;  1NHW C;  3HU3 A;  2FFJ A;  2F4V M;  3TQS A;  1QAM A;  4DV5 M;  1QZM A;  3R8F A;  2Y21 A;  4IBI A;  4PD2 A;  5E26 A;  3FUV A;  5GKN A;  1LV7 A;  3RGP A;  3PFI A;  2R4E A;  3KP1 E;  2P5T A;  2R45 A;  4WUR A;  3TE6 A;  1N33 M;  4FWH A;  2ZAN A;  2HKJ A;  1HR0 M;  4IBG A;  3L26 A;  2UXB M;  5KPR A;  3JR4 A;  1IXS B;  4LZZ A;  2Q2E B;  1DGB A;  3A42 A;  1NSF A;  3K8Z A;  1NVM A;  2FNA A;  3AFH A;  2K47 A;  3J27 B;  4XGI A;  1SXJ C;  3CF6 E;  4G4Q A;  2R4J A;  3KXE C;  3I4Y A;  2H1R A;  4KOD A;  1XNR M;  2V1C A;  1VDD A;  4LF8 M;  4NRW A;  4FVM A;  1PJI A;  1R7R A;  3UGJ A;  4AKI A;  3RFW A;  4JI8 M;  4KHP M;  4LJ4 A;  4QOS A;  1XMO M;  4LFC M;  4JI6 M;  1OFI A;  1OFH A;  4IBB A;  3MJ5 A;  4LJ5 A;  5FTL A;  3GLF A;  1IBK M;  4LCB A;  3LQQ A;  1N36 M;  5EXX A;  3U6L A;  1QQW A;  3HHW A;  3KOZ E;  1HNW M;  1IN5 A;  5EXP A;  2QEN A;  4NRV A;  3K1J A;  3KOY E;  3A46 A;  2CV0 A;  2C9O A;  2L7H A;  3HJQ A;  2YFQ A;  3DA1 A;  2KW0 A;  4L78 A;  3GRR A;  3EIH A;  3SAT A;  2Z3X A;  4TUW A;  4B08 A;  4FD2 A;  4PCZ A;  1ORY B;  4MM3 B;  2YR0 A;  2DZN B;  1TH4 A;  3SYK A;  4B7G A;  2VQF M;  3T1H M;  3GP1 A;  1TGU A;  2NQ8 C;  5IRE B;  4GKJ M;  2KEB A;  3CF0 A;  3TWM A;  4B3S M;  4NSO B;  2L6O A;  2J7O A;  3HU1 A;  2Z4R A;  3MK6 A;  4LGM A;  1HNX M;  2DWL A;  4M9Z A;  5ITQ A;  1T3T A;  2DZO B;  3VK8 A;  1SXJ A;  2XZF A;  1JR3 D;  3W0F A;  3UJN A;  3TWK A;  3R9X B;  1DGF A;  4LJ9 A;  4AQY M;  5KPZ A;  2CE7 A;  2UXC M;  5C1B A;  4X65 M;  1KSF X;  1ZAE A;  3W0L B;  3KOW E;  1Z5C A;  4IBD A;  3EIE A;  4FCW A;  1Q39 A;  4OVZ B;  4LF7 M;  2UXD M;  4DUZ M;  4DR2 M;  3GPX A;  1NNU C;  4Z8X A;  3GLG A;  1GL6 A;  3GQ3 A;  1KYI A;  4AG5 A;  3KDS E;  4DV2 M;  2Y20 A;  4R3D A;  1J5E M;  3K2L A;  4X66 M;  3QWL A;  2KXE A;  1XHB A;  1L2B A;  1G59 A;  1IY1 A;  4LJ6 A;  1YE9 A;  2I7N A;  2R62 A;  5EP4 A;  4MGI E;  1QAQ A;  4D82 A;  2D7G A;  1W5S A;  5ITR A;  3U61 B;  5H37 D;  3M7G A;  2F5O A;  2X49 A;  3GRU A;  2RGO A;  3GQ4 A;  3KFU G;  1QYR A;  4GKK M;  4M0D A;  3U6P A;  1TDZ A;  3QAU A;  1IQP A;  3KP0 E;  2ZAM A;  1MX0 A;  3VK7 A;  3SC3 A;  1JR3 A;  4YY3 M;  3UMM A;  3UZU A;  5E6J A;  2R46 A;  4LGY A;  2C96 A;  1R6B X;  1XC8 A;  3PVS A;  4IJE A;  2KRK A;  3HU2 A;  2OPF A;  1I4W A;  1E9R A;  3AOE C;  2F5N A;  3L29 A;  1PM5 A;  1TH2 A;  3ILK A;  3M6A A;  3HHY A;  4XBO A;  4JI1 M;  3LVV A;  3UK6 A;  4DV3 M;  4FWG A;  3ZC7 B;  2QBY A;  1SXJ B;  1L1Z A;  4D81 A;  1IN8 A;  3PNY A;  2C99 A;  2ZBK B;  3THG A;  4LF6 M;  3J7A S;  1N78 A;  2FE8 A;  2CHG A;  3RGS A;  4JN6 A;  5ITX E;  4DR7 M;  3RE8 A;  2DVW B;  8CAT A;  1XXH A;  2ERC A;  4M0W A;  3FYC A;  1W5T A;  1DO2 A;  1ZQ9 A;  2QCU A;  4MGH A;  5JI3 E;  2C5R A;  5KQD A;  4BLC A;  4WW0 A;  1R2Z A;  2KRU A;  4RF1 A;  4HLQ A;  5FTJ A;  2F5S A;  1SXJ E;  2UUB M;  3GLI A;  3KS8 A;  2XSZ A;  1JQJ C;  4JXJ A;  3FTD A;  2YQZ A;  4ITQ A;  1N77 A;  4OU7 A;  1Q3C A;  3ZCB B;  4JI5 M;  4M9S A;  4W5W A;  3SHG B;  1IN4 A;  3U6S A;  3SAS A;  1G4A E;  4GRI A;  1UM8 A;  4FW9 A;  4LJA A;  5FTK A;  4LZJ A;  1GKI A;  4PDI A;  2KZU A;  4AKH A;  3SMP A;  3KVW A;  1IY2 A;  4GC5 A;  1QAN A;  4B3T M;  4A3V B;  1XNQ M;  3NWL A;  4QNR A;  3LVW A;  3VKG A;  1IBL M;  4GIP A;  2XH9 A;  2LXE A;  3FYD A;  1Z59 A;  3U5Z B;  4IBK A;  3J2P B;  3U60 B;  3A45 A;  5ITX A;  4NSR A;  1L8Q A;  3HHZ A;  3NBI A;  4BBA A;  3OTO M;  3L25 A;  3CF2 A;  3SHF A;  1EE8 A;  3VKH A;  1MU5 A;  2R65 A;  3U60 A;  3U5Z A;  5EQT A;  3VDU A;  2E5L M;  4BB9 A;  3SAV A;  1QAO A;  4GIT A;  4I8O A;  5IZ7 D;  2EUC A;  4REZ A;  4L15 A;  2L09 A;  1WXQ A;  4IIW A;  5DNY A;  2UUA M;  4NL4 H;  4NXN M;  1H6U A;  3AV0 A;  3KW6 A;  3FUW A;  3KSX A;  3T38 A;  2XZU A;  3D8B A;  4G6Z A;  4MB7 A;  3KOX E;  4RNA A;  3DZD A;  4G4R A;  3TPZ A;  5C18 A;  4LFB M;  2L7I A;  4DV0 M;  1L2C A;  1J09 A;  4IJF A;  1N75 A;  4EIW A;  2LWX A;  3GLH B;  1NNJ A;  2JA2 A;  2XF3 A;  4HL4 A;  5IWA M;  3SFZ A;  4I5S A;  4X64 M;  3T1Y M;  1QVR A;  3BOS A;  1XXH B;  4R7G A;  1G41 A;  4RF0 A;  4LF5 M;  4DR6 M;  2F5Q A;  3FTE A;  2VII A;  1GVN A;  4OW0 A;  3JAM S;  5FTN A;  4ZPX A;  2HL7 A;  4MH0 E;  2QBY B;  4FCT A;  3H4M A;  2YNM D;  2CEA A;  5KQ8 A;  5EJC A;  5EXT A;  4LF9 M;  4IBF A;  1GLN A;  3AOG A;  4JYA M;  4MGK E;  5FSW A;  3DFZ A;  1N32 M;  2Z7J A;  3J80 S;  2DWN A;  1K82 A;  4L16 A;  4DV4 M;  3GPY A;  1GL7 A;  2XGN A;  2A5Y B;  5EXS A;  4JI2 M;  3HWS A;  2DHR A;  2XFS A;  1IN6 A;  4K0K M;  4QOZ C;  2C9C A;  3L2A A;  1J7K A;  4G4O A;  2V1U A;  3FD9 A;  2OQ4 A;  3LMM A;  2W82 A;  4LRT A;  2CUZ A;  1YUB A;  3GQ5 A;  3ZH9 B;  1DGG A;  4CGY B;  3WHL A;  2QP9 X;  3SBJ A;  3FTF A;  4P16 A;  3MHV C;  5A2Q S;  2BNK A;  2QZ4 A;  4LY6 A;  5EP3 A;  2V6Z M;  5ITT A;  1L2D A;  4GHL A;  4AW4 A;  4LG2 A;  2CFO A;  1DGH A;  4LF4 M;  4S12 A;  1HQY E;  4I81 A;  2UUC M;  2QPA A;  3VDP A;  1NY5 A;  3J81 S;  3GRV A;  1KFV A;  3SAW A;  1I94 M;  3GPU A;  1K3X A;  2FOI C;  1Q3B A;  2M5Z A;  3TL4 X;  3U6O A;  4AKG A;  1IBM M;  3FTC A;  3D8L A;  2J7N A;  2Z4S A;  3J7B A;  3T15 A;  2XSZ D;  3FKE A;  5LMU M;  1OJL A;  5IT9 S;  3I4V A;  2ZAO A;  3U61 A;  1FJG M;  3HGI A;  3TWL A;  4B3M M;  4DR5 M;  4IBJ A;  3GRY A;  4DV6 M;  4DR3 M;  1G3I A;  1L1T A;  1C1K A;  1TH3 A;  3FUT A;  3GLG B;  3HKP A;  3M0E A;  3U6Q A;  3PNV A;  2DXI A;  2D7E A;  1FNN A;  3GPP A;  2CHV A;  4JV5 M;  3IG5 A;  4OVZ A;  4AZF A;  3L28 A;  3HHX A;  2VQE M;  1E32 A;  4B7H A;  2F5P A;  1NJF A;  3FUU A;  2C98 A;  2Y0Q A;  2Y0T A;  2XLJ A;  3CTW B;  4FWD A;  4L8R C;  2XFT A;  1SXJ D;  4DR1 M;  2RKO A;  1IY0 A;  4YHH M;  4GHA A;  3E4R A;  3AKZ A;  2DWZ B;  3PXG A;  4DV7 M;  3B9P A;  4D80 A;  4IBE A;  4LFA M;  3K92 A;  5DYI A;  1E9S A;  4MGZ E;  1DO0 A;  1NJG A;  1HT1 E;  4LJ8 A;  3L27 A;  4GH9 A;  2ZM6 M;  5BPV A;  4LJ7 A;  3GLH A;  4B7F A;  3A98 B;  3GLF B;  2LNH C;  3SMS A;  5LMN M;  2XEP A;  2BJW A;  5FTM A;  1S3S A;  2AHM A;  3KSJ A;  2EO2 A;  1R2Y A;  1G8P A;  2KZS A;  3AL0 C;  3HJS A;  2EA0 A;  2I7P A;  2O5R A;  3Q8X A;  4KLN A;  3U6M A;  2DWM A;  2BJV A;  4IBC A;  5KPT A;  3SYL A;  2CV1 A;  1IM2 A;  5F3W A;  5ITU A;  4DUY M;  4QHS A;  1NHG C;  4M9X A;  1HQC A;  1DGH B;  3U6D A;  2CHQ A;  1IN7 A;  4JI3 M;  3E9S A;  4QNM A;  5BR8 M;  3WHK A;  3U6E A;  2UU9 M;  1YSY A;  4JI4 M;  4I4L A;  3LQR A;  4MGY E;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...