4DUYM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duyM02
1XC8A 3A46A 4DR1M 4JI4M 4DV4M 1N32M 2UUCM 1Q3BA 4DR5M 1N36M 3GPUA 2UXCM 4DV0M 4KHPM 5ITRA 4DV7M 3U6EA 4PCZA 3SAWA 3J7AS 4B3SM 3VK7A 1XNRM 4GKKM 5ITUA 1Z59A 4JV5M 2HKJA 2VQEM 3SAUA 5IT9S 4LF6M 4DV3M 4LFBM 3U6LA 3SAVA 1TDZA 4JI3M 1XNQM 1J5EM 4LF9M 1MU5A 1Z5BA 4DUYM 1L1ZA 1L2CA 2UUAM 4PDGA 1MX0A 2F4VM 1L1TA 1L2DA 4JI1M 4MB7A 1HNXM 3C58A 2F5QA 4OX9M 5ITYA 3GQ5A 4PD2A 5LMNM 4DR6M 4JYAM 4AQYM 3J81S 2EA0A 4G4OA 3U6CA 4X66M 3U6SA 4YY3M 2F5PA 3GO8A 3SARA 3J80S 3GPPA 2OQ4A 4G4NA 4DR2M 3U6DA 3U6QA 4ITQA 3SATA 1HR0M 4JI8M 4X62M 3OTOM 5BR8M 1Q39A 4X65M 2VQFM 3TWMA 4JI0M 4B3TM 1I94M 1TDHA 1HNWM 4JI2M 4LF8M 1K82A 1N33M 5ITQA 4LF7M 1IBLM 3JAMS 3T1HM 4LFAM 1KFVA 4PDIA 1N34M 1XMOM 1K3XA 1PJJA 2E5LM 2XZUA 4B3MM 1NNJA 3GP1A 4B3RM 1R2YA 4DV1M 3A45A 1PM5A 5A2QS 4YHHM 4LF4M 2XZFA 5IWAM 4DV6M 2OPFA 4DR3M 4G4RA 1IBMM 5ITTA 1XMQM 3JR4A 1L2BA 2UU9M 5ITXE 2UXDM 2UXBM 4GKJM 4DUZM 3GQ4A 4NRVA 2ZBKB 4JI6M 1Q3CA 3SBJA 1Z5CA 4CISA 4X64M 4DR7M 2F5OA 1EE8A 5FLXS 4NXNM 2UUBM 3TWKA 3VK8A 1R2ZA 3W0FA 5LMUM 3T1YM 4LFCM 4DV2M 3U6OA 5ITXA 2F5SA 4JI7M 3GPYA 3GPXA 4NXMM 4DV5M 3SASA 3A42A 4G4QA 1K3WA 4LF5M 1Z5AA 4JI5M 2ZM6M 3GQ3A 1FJGM 1PJIA 3TWLA 1HNZM 1IBKM 2F5NA 3JR5A 4K0KM 3DOAA 4NRWA 2HHHM 3U6MA 3U6PA 4DR4M 2Q2EB
chains in the Genus database with same CATH superfamily
4A3VB 2N35A 3DFZA 1N32M 3RE8A 2EKKA 4UN2B 1SG9A 2KXEA 3ZC7B 2UXCM 1OKSA 4B7GA 4BB9A 3U6EA 3FUUA 1H6UA 5E26A 3J7AS 1XNRM 3VK7A 4B7FA 1NHWC 4I8OA 2HKJA 4IBBA 4L78A 4DV3M 4B7HA 3R8FA 3C3EA 2CHQA 3HU1A 3U6LA 4I81A 1GABA 1GJSA 1Z5BA 3ZQJA 1LTMA 1WXQA 1IXSB 4WP2A 4PDGA 1MX0A 2FH0A 1XXHA 4MB7A 1OIPA 4JN6A 3GLGE 1QQWA 4LCBA 5FSWA 2L09A 1JQJC 2I7NA 4QNRA 5ITYA 2D7EA 1JR3D 3K9PA 4RF1A 1QDTA 4QOZC 1IXRC 2K6BA 2ZANA 3AFHA 3KOWE 4XGIA 2C5RA 7CATA 1TF0B 4L8RC 2W82A 2VF8A 1OAOC 2P5TA 2F5PA 1OQYA 2FE8A 5KO3A 3GPPA 2LH0A 3U6QA 3MHVC 1V33A 3H4JA 4WW0A 2CV2A 4QHSA 4FD2A 2LWXA 1RU3A 4MGIE 1DGGA 1OJLA 3TWMA 4TUWA 1G3IA 2DXIA 3HJSA 4B3TM 4W5WA 4R7GA 2QPAA 1HNWM 2XFSA 1QUSA 2D7GA 3SMPA 3SYLA 3AKZA 3K8ZA 2D7HA 2V1CA 3FRIA 3SC3A 1AUAA 2XSZA 4IBIA 1PGYA 2KNAA 4HL4A 1ZAEA 4B3MM 2DAEA 4GITA 2CV1A 3I4YA 2L2DA 3FUVA 1TGUA 1NHGC 1ZMWA 5EQTA 2FFJA 4IBJA 5IWAM 2DHRA 3M7GA 3TE6A 1W5TA 2MROB 1DGBA 2KZUA 3QYBA 3HJQA 5ITXE 2UXDM 3KW6A 4RKUF 3LW5F 1D2NA 2C9OA 4Y28F 2R4EA 1VEKA 4EIWA 4DUZM 4JI6M 2XSZD 4MGKE 1OTRA 3FTCA 3MJ5A 4M0WA 2JY7A 3UK6A 4CISA 3TPZA 2F5OA 2CE7A 3VDPA 2APLA 4M9ZA 1R2ZA 4L15A 3J7BA 3T1YM 1DGFA 1E94E 1WGLA 1IY0A 3IECA 1IXSA 2YNMD 4NSRA 1SXJE 2DZLA 3A98B 1GL6A 2BWEA 3FKEA 4F1IA 4DV5M 4GHAA 1IN6A 4QNMA 4JI5M 2A5YB 2ZM6M 3GQ3A 2DWMA 2KRKA 2RRUA 5L8RF 1LV7A 2Y21A 1PJIA 3Q8XA 1IBKM 4K0KM 1VG5A 2WSCF 3L2AA 1V34A 3U6MA 2QHOB 2H5XA 3WHLA 3U5ZB 4GC9A 4IIWA 8CATA 1Q02A 2DNAA 2JZ1A 4KODA 3HX3A 4GC5A 3HZJA 1N36M 3KXEC 4LJ5A 1W5SA 4DV0M 3SMSA 1IQPA 4OU7A 4BLCA 4PCZA 3SAWA 2FNAA 2XGNA 1TH2A 2VF7A 4GKKM 1SXJB 2B3TA 1QYRA 3CF6E 3FYCA 3GLGA 3IHPA 1G41A 5EP1A 2G8LA 2BWBA 2G5GX 4QHTA 2DWNA 1XNQM 1OIZA 1J5EM 3B89A 4LGYA 4LF9M 1GVNA 4DUYM 1L1ZA 3HHZA 4AG5A 1ZV1A 3SHGB 1L1TA 2ZTDA 3E4RA 2DVWB 4GRIA 1G59A 4S12A 3C58A 4KLNA 3L29A 4OX9M 4FWGA 3GQ5A 1I4WA 4DR6M 2DHYA 3L28A 3J27B 4Z6YA 4G3OA 5JI2E 4LJ6A 3LQRA 1P3QQ 3KOYE 3RGPA 4D81A 2Z4RA 1HQYE 1TTEA 2QBYB 2DAIA 3KOXE 4GH9A 4L4UA 1GO5A 1T43A 2MGWA 3U6DA 4DR2M 2V6ZM 1GL7A 5FTJA 3SATA 1JR3A 1IY1A 4CGYB 3GLIA 3DZDA 3DA1A 2V1UA 3QWLA 2R4JA 2VQFM 1J7KA 1WHCA 3B7NA 3HKPA 4JXJA 4LJ9A 4JI0M 2LHCA 4PT5A 4LRTA 1TDHA 3I51A 2JY5A 4BBAA 2LXEA 4NOOB 3U60A 2JY6B 2WZJA 1V92A 3LVVA 1K82A 3W67A 3HU2A 2OOAA 3E46A 1IBLM 3T1HM 3HHXA 3Q8GA 3ILKA 1C7YA 1N34M 1IXZA 2YR0A 1XMOM 5EXSA 1PJJA 1NY5A 2J7OA 4IJEA 1S3SA 1QUTA 3U5ZA 1NNJA 1WIVA 2QENA 3A45A 1PM5A 1DGHB 1IM2A 2R18A 2CP8A 2CHVA 2MH8A 4DV6M 3NBIA 2L6OA 3VFDA 3I04M 2JZ0A 4OVZB 1PJQA 3SFZA 2OPFA 4DR3M 2Z4SA 3K2LA 3KP1E 1Z6TA 4REZA 3GQ4A 4NRVA 2I7PA 3HGIA 1Q3CA 2JUJA 1ZQ9A 1A5TA 1SXJA 1IN8A 4M9XA 3FTEA 3GLHB 4Q7JA 5FLXS 4NXNM 3M0EA 2CV0A 3VK8A 2KHHA 2QQ8A 5LMUM 3WHKA 1Y8GA 1G4AE 2M60A 2KNZA 3QYEA 4JI7M 2ZTCA 3MMPA 4CJ6A 2M5ZA 3GPXA 5EP4A 1K3WA 2CFOA 1SXJD 3FUWA 4R71A 1NV8A 1WR1B 3MK6A 5EXXA 3T38A 3B74A 1MJGM 3V76A 3HHWA 3JR5A 5KPRA 5KQ8A 5IZ7D 3LMMA 2QBYA 2X8AA 2Q2EB 3BXWA 4QOSA 2R62A 1YLAA 3GRVA 2LVOC 2JA2A 4DR1M 2DZOB 1OFIA 2QCUA 3HHYA 1R7RA 4DR5M 4II7A 2Z3XA 5C1BA 3GPUA 3KVWA 4AKIA 4KHPM 5ITRA 3TQSA 1IN7A 5DYGA 2Z7JA 1XXHE 4B3SM 2DWZB 3IG5A 5ITUA 1Z59A 3GRUA 3R9XB 4JV5M 3SAUA 4KT0F 2WSFF 3CF0A 4LJ7A 2DAGA 1YUBA 2RGHA 3KP0E 4RF0A 3PFIA 3BBZA 2HCBA 3D8LA 3EIEA 4AG6A 3CF2A 4JI3M 1QZMA 2HAKA 3UGJA 1MU5A 2LNHC 2K47A 2YQZA 2X49A 4FCVA 3UZUA 4I4LA 4NL4H 1L2CA 2UUAM 4B08A 5BPVA 1BVSA 2FOIC 3C3DA 4LZJA 2F4VM 1UM8A 4GMQA 1HNXM 3HJ8A 3K92A 1QDRA 1MN3A 2C99A 4OVZA 3LCVB 5KPTA 2ZAMA 5DFLA 5LMNM 4JYAM 4AQYM 4M0DA 3J81S 1R6BX 2EA0A 4G4OA 5KQDA 1QANA 2XLJA 2OO9A 2VDBB 4X66M 2KZSA 3W0LB 1NVMA 2O5RA 1C1KA 4IBKA 4YY3M 2J5YA 1XXHB 4GHLA 2ERCA 1WGNA 3J80S 1QAMA 2G3QA 4LJ8A 4IBDA 1N77A 4ITQA 4JI8M 2MJ5B 1HR0M 3AL0C 1E32A 4X62M 1HQCA 4ZPXA 1VEGA 2KW0A 3D8BA 3FYDA 3UJNA 1IFYA 1NNUC 2ZAOA 3AJIB 2AHMA 2HWJA 4HEOA 5KPZA 1I94M 2R45A 3W68A 3UMMA 5EJCA 4L6V6 4JI2M 1UFZA 2XH9A 3NBXX 2R0IA 1N33M 4AI6A 1TH4A 2C96A 4LY6A 5ITQA 4GEWA 2KA6B 3JAMS 4LFAM 4MGZE 1KFVA 3AV0A 1NY6A 2DAMA 2E5LM 2LVPC 2QZ4A 2LVQD 3I4VA 3IG8A 2XZUA 5F3WA 4B3RM 4GIPA 3FTDA 3ZCBB 5A2QS 4YHHM 3FD9A 4LF4M 1N75A 4MGYE 2H1RA 4IBFA 2XEPA 2CUZA 3I01M 2L4EA 2XFTA 1GKIA 3FUXA 4AW4A 3KFUG 2R65A 3L27A 3KOZE 1JB0F 2UXBM 4GKJM 4FCTA 3FRHA 1TH3A 2ZBKB 3H4MA 1KSFX 3CTWB 3F92A 4DBGB 3THGA 4DR7M 3T6PA 1YE9A 3GLHE 2CWBA 3TWKA 1KYIA 1T6OA 3NWLA 4R3DA 4AKGA 4MH0E 3PXGA 2EJSA 3U6OA 5ITXA 1NV9A 1DO0A 3GPYA 3GLFE 4NXMM 2DZNB 4CIZA 2RGOA 4LF5M 3EIHA 3M6AA 4IJFA 2BJVA 3AOGA 3CGWA 4FCWA 1DV0A 2JP7A 2KDLA 1D0LA 4FW9A 3TWLA 1D0KA 2KEBA 2O25A 3HU3A 4L16A 1HNZM 3K9OA 4NRWA 2HHHM 3U6PA 3A42A 2L7IA 3B7ZA 5H37D 3GRYA 1OAIA 1IN4A 1EIJA 5FTKA 2QNJA 1XC8A 3A46A 4JI4M 2GQFA 4DV4M 1GLNA 2L7HA 2UUCM 3FTFA 2K9DA 1PJTA 1T3TA 1Q3BA 4XBOA 4RNAA 3PVSA 1PRBA 4WURA 4DV7M 1F4IA 4FVMA 4D80A 3AOEA 3VDUA 1E9RA 2YFQA 4LZZA 3GLFB 1X37A 2X4AA 3QAUA 2VQEM 5FTMA 5IT9S 2DAKA 2CEAA 5EP2A 4LF6M 4LFBM 2VIIA 1TR8A 3SAVA 1TDZA 3U61B 5GKNA 2QP9X 1D0MA 1G8PA 3VKHA 4IBGA 2R44A 4NSOB 4KO8A 2OOBA 4XK8F 1VQ1A 3E9SA 1NO1A 2XF3A 2R46A 1L2DA 4JI1M 4P17A 2J7NA 1JR3E 2NQ8C 5E6JA 3GLIE 2BNKA 2WSEF 1FNNA 3LVWA 3GLGB 1EFUB 2F5QA 4PD2A 2O01F 4LJ4A 2JNHA 3RGSA 3KS4A 3PNYA 4M9SA 2LHGA 2HL7A 1E9SA 2LVNC 4LGMA 2KRUA 3FE3A 4FWHA 3C9PA 2DWLA 3U6CA 1N78A 1NJGA 1HJPA 1YSYA 2Y20A 3U6SA 1NSFA 1QAOA 2EO2A 3KS8A 4HLQA 3SARA 2JWSA 1R5LA 2C98A 2Y0QA 5FTNA 3GO8A 2EUCA 1XWIA 2R6FA 2OQ4A 4G4NA 3B9PA 4LG2A 4CHTB 2FS1A 3B7QA 1HT1E 2DI0A 4P16A 3OTOM 5BR8M 3L26A 4LRSA 2C9CA 1Q39A 4X65M 1OFHA 5IREB 1PJSA 3ZH9B 2CRUA 4G6ZA 1SXJC 3FUTA 5EXPA 1HT2E 2GNOA 2Y0TA 5FTLA 3LCUA 1XHBA 1DGHA 1VEJA 4LF8M 3GLIB 3PNVA 1VDDA 2MR9A 4LF7M 3AOEC 2EKFA 5DNYA 1QZEA 4PDIA 2JY8A 2RKOA 5DYIA 1K3XA 3K1JA 4IBCA 4OW0A 2JXNA 3GP1A 1GJTA 1AIPC 1J09A 3U60B 2KNVA 1R2YA 5JI3E 4DV1M 2XZFA 3E21A 4LJAA 3VKGA 4Z8XA 2Z8YM 3GLHA 3RFWA 3VLFB 1IBMM 2CHGA 5ITTA 1XMQM 3JR4A 1L2BA 5C18A 2UU9M 4F2LA 2K0BX 4ANRA 3BOSA 1ZMVA 3HY5A 3SBJA 1Z5CA 3GLFA 4X64M 1L8QA 3KSJA 1EE8A 3TL4X 5EXTA 2UUBM 4AZFA 3U61A 1IY2A 3LQQA 1IN5A 3W0FA 4LFCM 4DV2M 1QVRA 2LTUA 4AKHA 3HWSA 3J2PB 2F5SA 3T15A 1ZMUA 1VDLA 3SASA 3GRRA 1XB2B 4IBEA 4MM3B 5EP3A 4G4QA 1WJ7A 1Z5AA 2DKLA 3L25A 1NJFA 3KSXA 1QAQA 4MGHA 1FJGM 1R4GA 2DENA 1DO2A 2LBCA 4NC6A 4D82A 2QSFX 1G71A 2BJWA 2L4FA 2F5NA 3DOAA 2LVAA 3KDSE 4I5SA 1CUKA 3SYKA 4DR4M 4G4RA 1ORYB 3SHFA 4FWDA
chains in the Genus database with same CATH topology
4A3VB 3DFZA 1N32M 3RE8A 2KXEA 3ZC7B 2UXCM 4B7GA 4BB9A 3U6EA 3FUUA 1H6UA 5E26A 3J7AS 1XNRM 3VK7A 4B7FA 1NHWC 4I8OA 2HKJA 4IBBA 4L78A 4DV3M 4B7HA 3R8FA 2CHQA 3HU1A 3U6LA 4I81A 1Z5BA 1WXQA 1IXSB 4PDGA 1MX0A 1XXHA 4MB7A 4JN6A 1QQWA 4LCBA 5FSWA 2L09A 1JQJC 2I7NA 4QNRA 5ITYA 2D7EA 1JR3D 4RF1A 4QOZC 1IXRC 2ZANA 3AFHA 3KOWE 4XGIA 2C5RA 7CATA 4L8RC 2W82A 2P5TA 2F5PA 2FE8A 3GPPA 2LH0A 3U6QA 3MHVC 4WW0A 2CV2A 4QHSA 4FD2A 2LWXA 4MGIE 1DGGA 1OJLA 3TWMA 4TUWA 1G3IA 2DXIA 3HJSA 4B3TM 4W5WA 4R7GA 2QPAA 1HNWM 2XFSA 2D7GA 3SMPA 3SYLA 3AKZA 3K8ZA 2D7HA 2V1CA 3SC3A 2XSZA 4IBIA 4HL4A 1ZAEA 4B3MM 4GITA 2CV1A 3I4YA 3FUVA 1TGUA 1NHGC 5EQTA 2FFJA 4IBJA 5IWAM 2DHRA 3M7GA 3TE6A 1W5TA 1DGBA 2KZUA 3HJQA 5ITXE 2UXDM 3KW6A 1D2NA 2C9OA 4EIWA 2R4EA 4DUZM 4JI6M 2XSZD 4MGKE 3FTCA 3MJ5A 4M0WA 3UK6A 4CISA 3TPZA 2F5OA 2CE7A 3VDPA 4M9ZA 1R2ZA 4L15A 3J7BA 3T1YM 1DGFA 1E94E 1IY0A 2YNMD 4NSRA 1SXJE 3FKEA 3A98B 1GL6A 4DV5M 4GHAA 1IN6A 4QNMA 4JI5M 2A5YB 2ZM6M 3GQ3A 2DWMA 2KRKA 1LV7A 2Y21A 1PJIA 3Q8XA 1IBKM 4K0KM 3U6MA 3L2AA 3WHLA 3U5ZB 4GC9A 4IIWA 8CATA 4KODA 4GC5A 1N36M 3KXEC 4LJ5A 1W5SA 4DV0M 3SMSA 1IQPA 4OU7A 4BLCA 4PCZA 3SAWA 2FNAA 2XGNA 1TH2A 4GKKM 1SXJB 1QYRA 3CF6E 3FYCA 3GLGA 1G41A 5EP1A 2G8LA 2G5GX 2DWNA 4QHTA 1XNQM 1J5EM 4LGYA 4LF9M 1GVNA 4DUYM 1L1ZA 3HHZA 4AG5A 3SHGB 1L1TA 3E4RA 4GRIA 2DVWB 1G59A 4S12A 3C58A 4KLNA 3L29A 4OX9M 4FWGA 3GQ5A 1I4WA 4DR6M 3L28A 3J27B 4Z6YA 5JI2E 4LJ6A 3LQRA 3KOYE 3RGPA 4D81A 2Z4RA 1HQYE 2QBYB 3KOXE 4GH9A 4L4UA 3U6DA 4DR2M 2V6ZM 1GL7A 5FTJA 3SATA 1JR3A 1IY1A 4CGYB 3GLIA 3DZDA 3DA1A 2V1UA 3QWLA 2R4JA 2VQFM 1J7KA 3HKPA 4JXJA 4LJ9A 4JI0M 4PT5A 4LRTA 1TDHA 3I51A 4BBAA 2LXEA 4NOOB 3U60A 3LVVA 1K82A 3HU2A 1IBLM 3T1HM 3HHXA 3ILKA 1N34M 1IXZA 2YR0A 1XMOM 5EXSA 1PJJA 1NY5A 2J7OA 4IJEA 1S3SA 1NNJA 3U5ZA 2QENA 3A45A 1PM5A 1DGHB 1IM2A 2R18A 2CHVA 4DV6M 3NBIA 2L6OA 3VFDA 2OPFA 4DR3M 4OVZB 3SFZA 2Z4SA 3K2LA 3KP1E 1Z6TA 4REZA 3GQ4A 4NRVA 2I7PA 3HGIA 1Q3CA 1ZQ9A 1SXJA 1IN8A 4M9XA 3FTEA 3GLHB 5FLXS 4NXNM 3M0EA 2CV0A 3VK8A 5LMUM 3WHKA 1G4AE 2M60A 4JI7M 2M5ZA 3GPXA 5EP4A 1K3WA 2CFOA 1SXJD 3FUWA 5EXXA 3T38A 3MK6A 3HHWA 3JR5A 5KPRA 5KQ8A 5IZ7D 3LMMA 2QBYA 2X8AA 2Q2EB 4QOSA 2R62A 3GRVA 2JA2A 4DR1M 2DZOB 1OFIA 2QCUA 3HHYA 1R7RA 4DR5M 4II7A 2Z3XA 5C1BA 3GPUA 3KVWA 4AKIA 4KHPM 5ITRA 3TQSA 1IN7A 5DYGA 2Z7JA 4B3SM 2DWZB 3IG5A 5ITUA 1Z59A 3GRUA 3R9XB 4JV5M 3SAUA 4LJ7A 3CF0A 3KP0E 1YUBA 2RGHA 4RF0A 5KO3A 3PFIA 4AG6A 2HCBA 3D8LA 3EIEA 3CF2A 4JI3M 1QZMA 3UGJA 1MU5A 2LNHC 2K47A 2YQZA 2X49A 4FCVA 3UZUA 4I4LA 4NL4H 1L2CA 2UUAM 4B08A 5BPVA 2FOIC 4LZJA 2F4VM 1UM8A 4GMQA 1HNXM 3HJ8A 3K92A 2C99A 4OVZA 5KPTA 5LMNM 2ZAMA 4JYAM 4AQYM 4M0DA 3J81S 1R6BX 2EA0A 4G4OA 5KQDA 1QANA 2XLJA 4X66M 2KZSA 3W0LB 1NVMA 2O5RA 1C1KA 4IBKA 4YY3M 1XXHB 4GHLA 2ERCA 3J80S 1QAMA 4LJ8A 4IBDA 1N77A 4ITQA 4JI8M 1HR0M 3AL0C 1E32A 4X62M 1HQCA 4ZPXA 2KW0A 3D8BA 3FYDA 3UJNA 1NNUC 2ZAOA 3AJIB 2AHMA 5KPZA 1I94M 2R45A 3UMMA 5EJCA 4JI2M 2XH9A 4AI6A 1N33M 1TH4A 2C96A 4LY6A 5ITQA 2KA6B 3JAMS 4LFAM 4MGZE 1KFVA 3AV0A 1NY6A 2E5LM 3I4VA 2QZ4A 3IG8A 5F3WA 2XZUA 4B3RM 4GIPA 3FTDA 3ZCBB 5A2QS 4YHHM 3FD9A 4LF4M 1N75A 4MGYE 2H1RA 4IBFA 2XEPA 2CUZA 2XFTA 1GKIA 3FUXA 4AW4A 3KFUG 2R65A 3L27A 3KOZE 2UXBM 4GKJM 4FCTA 1TH3A 2ZBKB 3H4MA 1KSFX 3CTWB 3THGA 4DR7M 1YE9A 3TWKA 1KYIA 3NWLA 4R3DA 4AKGA 4MH0E 3PXGA 3U6OA 5ITXA 1DO0A 3GPYA 4NXMM 2DZNB 2RGOA 4LF5M 3EIHA 3M6AA 4IJFA 2BJVA 3AOGA 4FCWA 4FW9A 3TWLA 1HNZM 2KEBA 3HU3A 4L16A 4NRWA 2HHHM 3U6PA 3A42A 2L7IA 5H37D 3GRYA 1IN4A 5FTKA 1XC8A 3A46A 4JI4M 4DV4M 1GLNA 2L7HA 2UUCM 3FTFA 1T3TA 1Q3BA 4XBOA 4RNAA 3PVSA 4WURA 4DV7M 4FVMA 4D80A 3AOEA 3VDUA 1E9RA 2YFQA 4LZZA 3GLFB 1X37A 2X4AA 3QAUA 2VQEM 5FTMA 5IT9S 2CEAA 5EP2A 4LF6M 4LFBM 2VIIA 3SAVA 1TDZA 3U61B 5GKNA 2QP9X 1G8PA 3VKHA 4IBGA 4NSOB 4KO8A 3E9SA 2XF3A 2R46A 1L2DA 4JI1M 2J7NA 5E6JA 2NQ8C 2F5QA 2BNKA 3GLGB 1FNNA 3LVWA 4PD2A 4LJ4A 3RGSA 3KS4A 3PNYA 4M9SA 2HL7A 1E9SA 4LGMA 2KRUA 4FWHA 2DWLA 3U6CA 1N78A 1NJGA 1YSYA 2Y20A 3U6SA 1NSFA 1QAOA 2EO2A 3KS8A 4HLQA 3SARA 5FTNA 3GO8A 2C98A 2Y0QA 4G4NA 2EUCA 1XWIA 2OQ4A 4LG2A 3B9PA 4CHTB 1HT1E 4P16A 3OTOM 3L26A 5BR8M 4LRSA 2C9CA 1Q39A 4X65M 1OFHA 5IREB 3ZH9B 4G6ZA 1SXJC 3FUTA 5EXPA 1HT2E 2Y0TA 5FTLA 1XHBA 1DGHA 4LF8M 3GLIB 3PNVA 1VDDA 4LF7M 3AOEC 5DNYA 4PDIA 2RKOA 5DYIA 1K3XA 3K1JA 4IBCA 4OW0A 3GP1A 1R2YA 1J09A 3U60B 5JI3E 4DV1M 2XZFA 4LJAA 3VKGA 4Z8XA 3GLHA 3RFWA 3VLFB 1IBMM 2CHGA 5ITTA 1XMQM 3JR4A 1L2BA 5C18A 2UU9M 3BOSA 3SBJA 1Z5CA 3GLFA 4X64M 1L8QA 3KSJA 1EE8A 3TL4X 5EXTA 2UUBM 4AZFA 3U61A 1IY2A 3LQQA 1IN5A 3W0FA 4LFCM 4DV2M 1QVRA 4AKHA 3HWSA 3J2PB 2F5SA 3T15A 3SASA 3GRRA 4IBEA 5EP3A 4MM3B 4G4QA 1Z5AA 3L25A 1NJFA 3KSXA 1QAQA 4MGHA 1FJGM 1DO2A 4D82A 2BJWA 2F5NA 3DOAA 3KDSE 4I5SA 3SYKA 4DR4M 4G4RA 1ORYB 3SHFA 4FWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC8 A;  3A46 A;  4DR1 M;  4JI4 M;  4DV4 M;  1N32 M;  2UUC M;  1Q3B A;  4DR5 M;  1N36 M;  3GPU A;  2UXC M;  4DV0 M;  4KHP M;  5ITR A;  4DV7 M;  3U6E A;  4PCZ A;  3SAW A;  3J7A S;  4B3S M;  3VK7 A;  1XNR M;  4GKK M;  5ITU A;  1Z59 A;  4JV5 M;  2HKJ A;  2VQE M;  3SAU A;  5IT9 S;  4LF6 M;  4DV3 M;  4LFB M;  3U6L A;  3SAV A;  1TDZ A;  4JI3 M;  1XNQ M;  1J5E M;  4LF9 M;  1MU5 A;  1Z5B A;  4DUY M;  1L1Z A;  1L2C A;  2UUA M;  4PDG A;  1MX0 A;  2F4V M;  1L1T A;  1L2D A;  4JI1 M;  4MB7 A;  1HNX M;  3C58 A;  2F5Q A;  4OX9 M;  5ITY A;  3GQ5 A;  4PD2 A;  5LMN M;  4DR6 M;  4JYA M;  4AQY M;  3J81 S;  2EA0 A;  4G4O A;  3U6C A;  4X66 M;  3U6S A;  4YY3 M;  2F5P A;  3GO8 A;  3SAR A;  3J80 S;  3GPP A;  2OQ4 A;  4G4N A;  4DR2 M;  3U6D A;  3U6Q A;  4ITQ A;  3SAT A;  1HR0 M;  4JI8 M;  4X62 M;  3OTO M;  5BR8 M;  1Q39 A;  4X65 M;  2VQF M;  3TWM A;  4JI0 M;  4B3T M;  1I94 M;  1TDH A;  1HNW M;  4JI2 M;  4LF8 M;  1K82 A;  1N33 M;  5ITQ A;  4LF7 M;  1IBL M;  3JAM S;  3T1H M;  4LFA M;  1KFV A;  4PDI A;  1N34 M;  1XMO M;  1K3X A;  1PJJ A;  2E5L M;  2XZU A;  4B3M M;  1NNJ A;  3GP1 A;  4B3R M;  1R2Y A;  4DV1 M;  3A45 A;  1PM5 A;  5A2Q S;  4YHH M;  4LF4 M;  2XZF A;  5IWA M;  4DV6 M;  2OPF A;  4DR3 M;  4G4R A;  1IBM M;  5ITT A;  1XMQ M;  3JR4 A;  1L2B A;  2UU9 M;  5ITX E;  2UXD M;  2UXB M;  4GKJ M;  4DUZ M;  3GQ4 A;  4NRV A;  2ZBK B;  4JI6 M;  1Q3C A;  3SBJ A;  1Z5C A;  4CIS A;  4X64 M;  4DR7 M;  2F5O A;  1EE8 A;  5FLX S;  4NXN M;  2UUB M;  3TWK A;  3VK8 A;  1R2Z A;  3W0F A;  5LMU M;  3T1Y M;  4LFC M;  4DV2 M;  3U6O A;  5ITX A;  2F5S A;  4JI7 M;  3GPY A;  3GPX A;  4NXM M;  4DV5 M;  3SAS A;  3A42 A;  4G4Q A;  1K3W A;  4LF5 M;  1Z5A A;  4JI5 M;  2ZM6 M;  3GQ3 A;  1FJG M;  1PJI A;  3TWL A;  1HNZ M;  1IBK M;  2F5N A;  3JR5 A;  4K0K M;  3DOA A;  4NRW A;  2HHH M;  3U6M A;  3U6P A;  4DR4 M;  2Q2E B; 
#chains in the Genus database with same CATH topology
 4A3V B;  2N35 A;  3DFZ A;  1N32 M;  3RE8 A;  2EKK A;  4UN2 B;  1SG9 A;  2KXE A;  3ZC7 B;  2UXC M;  1OKS A;  4B7G A;  4BB9 A;  3U6E A;  3FUU A;  1H6U A;  5E26 A;  3J7A S;  1XNR M;  3VK7 A;  4B7F A;  1NHW C;  4I8O A;  2HKJ A;  4IBB A;  4L78 A;  4DV3 M;  4B7H A;  3R8F A;  3C3E A;  2CHQ A;  3HU1 A;  3U6L A;  4I81 A;  1GAB A;  1GJS A;  1Z5B A;  3ZQJ A;  1LTM A;  1WXQ A;  1IXS B;  4WP2 A;  4PDG A;  1MX0 A;  2FH0 A;  1XXH A;  4MB7 A;  1OIP A;  4JN6 A;  3GLG E;  1QQW A;  4LCB A;  5FSW A;  2L09 A;  1JQJ C;  2I7N A;  4QNR A;  5ITY A;  2D7E A;  1JR3 D;  3K9P A;  4RF1 A;  1QDT A;  4QOZ C;  1IXR C;  2K6B A;  2ZAN A;  3AFH A;  3KOW E;  4XGI A;  2C5R A;  7CAT A;  1TF0 B;  4L8R C;  2W82 A;  2VF8 A;  1OAO C;  2P5T A;  2F5P A;  1OQY A;  2FE8 A;  5KO3 A;  3GPP A;  2LH0 A;  3U6Q A;  3MHV C;  1V33 A;  3H4J A;  4WW0 A;  2CV2 A;  4QHS A;  4FD2 A;  2LWX A;  1RU3 A;  4MGI E;  1DGG A;  1OJL A;  3TWM A;  4TUW A;  1G3I A;  2DXI A;  3HJS A;  4B3T M;  4W5W A;  4R7G A;  2QPA A;  1HNW M;  2XFS A;  1QUS A;  2D7G A;  3SMP A;  3SYL A;  3AKZ A;  3K8Z A;  2D7H A;  2V1C A;  3FRI A;  3SC3 A;  1AUA A;  2XSZ A;  4IBI A;  1PGY A;  2KNA A;  4HL4 A;  1ZAE A;  4B3M M;  2DAE A;  4GIT A;  2CV1 A;  3I4Y A;  2L2D A;  3FUV A;  1TGU A;  1NHG C;  1ZMW A;  5EQT A;  2FFJ A;  4IBJ A;  5IWA M;  2DHR A;  3M7G A;  3TE6 A;  1W5T A;  2MRO B;  1DGB A;  2KZU A;  3QYB A;  3HJQ A;  5ITX E;  2UXD M;  3KW6 A;  4RKU F;  3LW5 F;  1D2N A;  2C9O A;  4Y28 F;  2R4E A;  1VEK A;  4EIW A;  4DUZ M;  4JI6 M;  2XSZ D;  4MGK E;  1OTR A;  3FTC A;  3MJ5 A;  4M0W A;  2JY7 A;  3UK6 A;  4CIS A;  3TPZ A;  2F5O A;  2CE7 A;  3VDP A;  2APL A;  4M9Z A;  1R2Z A;  4L15 A;  3J7B A;  3T1Y M;  1DGF A;  1E94 E;  1WGL A;  1IY0 A;  3IEC A;  1IXS A;  2YNM D;  4NSR A;  1SXJ E;  2DZL A;  3A98 B;  1GL6 A;  2BWE A;  3FKE A;  4F1I A;  4DV5 M;  4GHA A;  1IN6 A;  4QNM A;  4JI5 M;  2A5Y B;  2ZM6 M;  3GQ3 A;  2DWM A;  2KRK A;  2RRU A;  5L8R F;  1LV7 A;  2Y21 A;  1PJI A;  3Q8X A;  1IBK M;  4K0K M;  1VG5 A;  2WSC F;  3L2A A;  1V34 A;  3U6M A;  2QHO B;  2H5X A;  3WHL A;  3U5Z B;  4GC9 A;  4IIW A;  8CAT A;  1Q02 A;  2DNA A;  2JZ1 A;  4KOD A;  3HX3 A;  4GC5 A;  3HZJ A;  1N36 M;  3KXE C;  4LJ5 A;  1W5S A;  4DV0 M;  3SMS A;  1IQP A;  4OU7 A;  4BLC A;  4PCZ A;  3SAW A;  2FNA A;  2XGN A;  1TH2 A;  2VF7 A;  4GKK M;  1SXJ B;  2B3T A;  1QYR A;  3CF6 E;  3FYC A;  3GLG A;  3IHP A;  1G41 A;  5EP1 A;  2G8L A;  2BWB A;  2G5G X;  4QHT A;  2DWN A;  1XNQ M;  1OIZ A;  1J5E M;  3B89 A;  4LGY A;  4LF9 M;  1GVN A;  4DUY M;  1L1Z A;  3HHZ A;  4AG5 A;  1ZV1 A;  3SHG B;  1L1T A;  2ZTD A;  3E4R A;  2DVW B;  4GRI A;  1G59 A;  4S12 A;  3C58 A;  4KLN A;  3L29 A;  4OX9 M;  4FWG A;  3GQ5 A;  1I4W A;  4DR6 M;  2DHY A;  3L28 A;  3J27 B;  4Z6Y A;  4G3O A;  5JI2 E;  4LJ6 A;  3LQR A;  1P3Q Q;  3KOY E;  3RGP A;  4D81 A;  2Z4R A;  1HQY E;  1TTE A;  2QBY B;  2DAI A;  3KOX E;  4GH9 A;  4L4U A;  1GO5 A;  1T43 A;  2MGW A;  3U6D A;  4DR2 M;  2V6Z M;  1GL7 A;  5FTJ A;  3SAT A;  1JR3 A;  1IY1 A;  4CGY B;  3GLI A;  3DZD A;  3DA1 A;  2V1U A;  3QWL A;  2R4J A;  2VQF M;  1J7K A;  1WHC A;  3B7N A;  3HKP A;  4JXJ A;  4LJ9 A;  4JI0 M;  2LHC A;  4PT5 A;  4LRT A;  1TDH A;  3I51 A;  2JY5 A;  4BBA A;  2LXE A;  4NOO B;  3U60 A;  2JY6 B;  2WZJ A;  1V92 A;  3LVV A;  1K82 A;  3W67 A;  3HU2 A;  2OOA A;  3E46 A;  1IBL M;  3T1H M;  3HHX A;  3Q8G A;  3ILK A;  1C7Y A;  1N34 M;  1IXZ A;  2YR0 A;  1XMO M;  5EXS A;  1PJJ A;  1NY5 A;  2J7O A;  4IJE A;  1S3S A;  1QUT A;  3U5Z A;  1NNJ A;  1WIV A;  2QEN A;  3A45 A;  1PM5 A;  1DGH B;  1IM2 A;  2R18 A;  2CP8 A;  2CHV A;  2MH8 A;  4DV6 M;  3NBI A;  2L6O A;  3VFD A;  3I04 M;  2JZ0 A;  4OVZ B;  1PJQ A;  3SFZ A;  2OPF A;  4DR3 M;  2Z4S A;  3K2L A;  3KP1 E;  1Z6T A;  4REZ A;  3GQ4 A;  4NRV A;  2I7P A;  3HGI A;  1Q3C A;  2JUJ A;  1ZQ9 A;  1A5T A;  1SXJ A;  1IN8 A;  4M9X A;  3FTE A;  3GLH B;  4Q7J A;  5FLX S;  4NXN M;  3M0E A;  2CV0 A;  3VK8 A;  2KHH A;  2QQ8 A;  5LMU M;  3WHK A;  1Y8G A;  1G4A E;  2M60 A;  2KNZ A;  3QYE A;  4JI7 M;  2ZTC A;  3MMP A;  4CJ6 A;  2M5Z A;  3GPX A;  5EP4 A;  1K3W A;  2CFO A;  1SXJ D;  3FUW A;  4R71 A;  1NV8 A;  1WR1 B;  3MK6 A;  5EXX A;  3T38 A;  3B74 A;  1MJG M;  3V76 A;  3HHW A;  3JR5 A;  5KPR A;  5KQ8 A;  5IZ7 D;  3LMM A;  2QBY A;  2X8A A;  2Q2E B;  3BXW A;  4QOS A;  2R62 A;  1YLA A;  3GRV A;  2LVO C;  2JA2 A;  4DR1 M;  2DZO B;  1OFI A;  2QCU A;  3HHY A;  1R7R A;  4DR5 M;  4II7 A;  2Z3X A;  5C1B A;  3GPU A;  3KVW A;  4AKI A;  4KHP M;  5ITR A;  3TQS A;  1IN7 A;  5DYG A;  2Z7J A;  1XXH E;  4B3S M;  2DWZ B;  3IG5 A;  5ITU A;  1Z59 A;  3GRU A;  3R9X B;  4JV5 M;  3SAU A;  4KT0 F;  2WSF F;  3CF0 A;  4LJ7 A;  2DAG A;  1YUB A;  2RGH A;  3KP0 E;  4RF0 A;  3PFI A;  3BBZ A;  2HCB A;  3D8L A;  3EIE A;  4AG6 A;  3CF2 A;  4JI3 M;  1QZM A;  2HAK A;  3UGJ A;  1MU5 A;  2LNH C;  2K47 A;  2YQZ A;  2X49 A;  4FCV A;  3UZU A;  4I4L A;  4NL4 H;  1L2C A;  2UUA M;  4B08 A;  5BPV A;  1BVS A;  2FOI C;  3C3D A;  4LZJ A;  2F4V M;  1UM8 A;  4GMQ A;  1HNX M;  3HJ8 A;  3K92 A;  1QDR A;  1MN3 A;  2C99 A;  4OVZ A;  3LCV B;  5KPT A;  2ZAM A;  5DFL A;  5LMN M;  4JYA M;  4AQY M;  4M0D A;  3J81 S;  1R6B X;  2EA0 A;  4G4O A;  5KQD A;  1QAN A;  2XLJ A;  2OO9 A;  2VDB B;  4X66 M;  2KZS A;  3W0L B;  1NVM A;  2O5R A;  1C1K A;  4IBK A;  4YY3 M;  2J5Y A;  1XXH B;  4GHL A;  2ERC A;  1WGN A;  3J80 S;  1QAM A;  2G3Q A;  4LJ8 A;  4IBD A;  1N77 A;  4ITQ A;  4JI8 M;  2MJ5 B;  1HR0 M;  3AL0 C;  1E32 A;  4X62 M;  1HQC A;  4ZPX A;  1VEG A;  2KW0 A;  3D8B A;  3FYD A;  3UJN A;  1IFY A;  1NNU C;  2ZAO A;  3AJI B;  2AHM A;  2HWJ A;  4HEO A;  5KPZ A;  1I94 M;  2R45 A;  3W68 A;  3UMM A;  5EJC A;  4L6V 6;  4JI2 M;  1UFZ A;  2XH9 A;  3NBX X;  2R0I A;  1N33 M;  4AI6 A;  1TH4 A;  2C96 A;  4LY6 A;  5ITQ A;  4GEW A;  2KA6 B;  3JAM S;  4LFA M;  4MGZ E;  1KFV A;  3AV0 A;  1NY6 A;  2DAM A;  2E5L M;  2LVP C;  2QZ4 A;  2LVQ D;  3I4V A;  3IG8 A;  2XZU A;  5F3W A;  4B3R M;  4GIP A;  3FTD A;  3ZCB B;  5A2Q S;  4YHH M;  3FD9 A;  4LF4 M;  1N75 A;  4MGY E;  2H1R A;  4IBF A;  2XEP A;  2CUZ A;  3I01 M;  2L4E A;  2XFT A;  1GKI A;  3FUX A;  4AW4 A;  3KFU G;  2R65 A;  3L27 A;  3KOZ E;  1JB0 F;  2UXB M;  4GKJ M;  4FCT A;  3FRH A;  1TH3 A;  2ZBK B;  3H4M A;  1KSF X;  3CTW B;  3F92 A;  4DBG B;  3THG A;  4DR7 M;  3T6P A;  1YE9 A;  3GLH E;  2CWB A;  3TWK A;  1KYI A;  1T6O A;  3NWL A;  4R3D A;  4AKG A;  4MH0 E;  3PXG A;  2EJS A;  3U6O A;  5ITX A;  1NV9 A;  1DO0 A;  3GPY A;  3GLF E;  4NXM M;  2DZN B;  4CIZ A;  2RGO A;  4LF5 M;  3EIH A;  3M6A A;  4IJF A;  2BJV A;  3AOG A;  3CGW A;  4FCW A;  1DV0 A;  2JP7 A;  2KDL A;  1D0L A;  4FW9 A;  3TWL A;  1D0K A;  2KEB A;  2O25 A;  3HU3 A;  4L16 A;  1HNZ M;  3K9O A;  4NRW A;  2HHH M;  3U6P A;  3A42 A;  2L7I A;  3B7Z A;  5H37 D;  3GRY A;  1OAI A;  1IN4 A;  1EIJ A;  5FTK A;  2QNJ A;  1XC8 A;  3A46 A;  4JI4 M;  2GQF A;  4DV4 M;  1GLN A;  2L7H A;  2UUC M;  3FTF A;  2K9D A;  1PJT A;  1T3T A;  1Q3B A;  4XBO A;  4RNA A;  3PVS A;  1PRB A;  4WUR A;  4DV7 M;  1F4I A;  4FVM A;  4D80 A;  3AOE A;  3VDU A;  1E9R A;  2YFQ A;  4LZZ A;  3GLF B;  1X37 A;  2X4A A;  3QAU A;  2VQE M;  5FTM A;  5IT9 S;  2DAK A;  2CEA A;  5EP2 A;  4LF6 M;  4LFB M;  2VII A;  1TR8 A;  3SAV A;  1TDZ A;  3U61 B;  5GKN A;  2QP9 X;  1D0M A;  1G8P A;  3VKH A;  4IBG A;  2R44 A;  4NSO B;  4KO8 A;  2OOB A;  4XK8 F;  1VQ1 A;  3E9S A;  1NO1 A;  2XF3 A;  2R46 A;  1L2D A;  4JI1 M;  4P17 A;  2J7N A;  1JR3 E;  2NQ8 C;  5E6J A;  3GLI E;  2BNK A;  2WSE F;  1FNN A;  3LVW A;  3GLG B;  1EFU B;  2F5Q A;  4PD2 A;  2O01 F;  4LJ4 A;  2JNH A;  3RGS A;  3KS4 A;  3PNY A;  4M9S A;  2LHG A;  2HL7 A;  1E9S A;  2LVN C;  4LGM A;  2KRU A;  3FE3 A;  4FWH A;  3C9P A;  2DWL A;  3U6C A;  1N78 A;  1NJG A;  1HJP A;  1YSY A;  2Y20 A;  3U6S A;  1NSF A;  1QAO A;  2EO2 A;  3KS8 A;  4HLQ A;  3SAR A;  2JWS A;  1R5L A;  2C98 A;  2Y0Q A;  5FTN A;  3GO8 A;  2EUC A;  1XWI A;  2R6F A;  2OQ4 A;  4G4N A;  3B9P A;  4LG2 A;  4CHT B;  2FS1 A;  3B7Q A;  1HT1 E;  2DI0 A;  4P16 A;  3OTO M;  5BR8 M;  3L26 A;  4LRS A;  2C9C A;  1Q39 A;  4X65 M;  1OFH A;  5IRE B;  1PJS A;  3ZH9 B;  2CRU A;  4G6Z A;  1SXJ C;  3FUT A;  5EXP A;  1HT2 E;  2GNO A;  2Y0T A;  5FTL A;  3LCU A;  1XHB A;  1DGH A;  1VEJ A;  4LF8 M;  3GLI B;  3PNV A;  1VDD A;  2MR9 A;  4LF7 M;  3AOE C;  2EKF A;  5DNY A;  1QZE A;  4PDI A;  2JY8 A;  2RKO A;  5DYI A;  1K3X A;  3K1J A;  4IBC A;  4OW0 A;  2JXN A;  3GP1 A;  1GJT A;  1AIP C;  1J09 A;  3U60 B;  2KNV A;  1R2Y A;  5JI3 E;  4DV1 M;  2XZF A;  3E21 A;  4LJA A;  3VKG A;  4Z8X A;  2Z8Y M;  3GLH A;  3RFW A;  3VLF B;  1IBM M;  2CHG A;  5ITT A;  1XMQ M;  3JR4 A;  1L2B A;  5C18 A;  2UU9 M;  4F2L A;  2K0B X;  4ANR A;  3BOS A;  1ZMV A;  3HY5 A;  3SBJ A;  1Z5C A;  3GLF A;  4X64 M;  1L8Q A;  3KSJ A;  1EE8 A;  3TL4 X;  5EXT A;  2UUB M;  4AZF A;  3U61 A;  1IY2 A;  3LQQ A;  1IN5 A;  3W0F A;  4LFC M;  4DV2 M;  1QVR A;  2LTU A;  4AKH A;  3HWS A;  3J2P B;  2F5S A;  3T15 A;  1ZMU A;  1VDL A;  3SAS A;  3GRR A;  1XB2 B;  4IBE A;  4MM3 B;  5EP3 A;  4G4Q A;  1WJ7 A;  1Z5A A;  2DKL A;  3L25 A;  1NJF A;  3KSX A;  1QAQ A;  4MGH A;  1FJG M;  1R4G A;  2DEN A;  1DO2 A;  2LBC A;  4NC6 A;  4D82 A;  2QSF X;  1G71 A;  2BJW A;  2L4F A;  2F5N A;  3DOA A;  2LVA A;  3KDS E;  4I5S A;  1CUK A;  3SYK A;  4DR4 M;  4G4R A;  1ORY B;  3SHF A;  4FWD A; 
#chains in the Genus database with same CATH homology
 4A3V B;  3DFZ A;  1N32 M;  3RE8 A;  2KXE A;  3ZC7 B;  2UXC M;  4B7G A;  4BB9 A;  3U6E A;  3FUU A;  1H6U A;  5E26 A;  3J7A S;  1XNR M;  3VK7 A;  4B7F A;  1NHW C;  4I8O A;  2HKJ A;  4IBB A;  4L78 A;  4DV3 M;  4B7H A;  3R8F A;  2CHQ A;  3HU1 A;  3U6L A;  4I81 A;  1Z5B A;  1WXQ A;  1IXS B;  4PDG A;  1MX0 A;  1XXH A;  4MB7 A;  4JN6 A;  1QQW A;  4LCB A;  5FSW A;  2L09 A;  1JQJ C;  2I7N A;  4QNR A;  5ITY A;  2D7E A;  1JR3 D;  4RF1 A;  4QOZ C;  1IXR C;  2ZAN A;  3AFH A;  3KOW E;  4XGI A;  2C5R A;  7CAT A;  4L8R C;  2W82 A;  2P5T A;  2F5P A;  2FE8 A;  3GPP A;  2LH0 A;  3U6Q A;  3MHV C;  4WW0 A;  2CV2 A;  4QHS A;  4FD2 A;  2LWX A;  4MGI E;  1DGG A;  1OJL A;  3TWM A;  4TUW A;  1G3I A;  2DXI A;  3HJS A;  4B3T M;  4W5W A;  4R7G A;  2QPA A;  1HNW M;  2XFS A;  2D7G A;  3SMP A;  3SYL A;  3AKZ A;  3K8Z A;  2D7H A;  2V1C A;  3SC3 A;  2XSZ A;  4IBI A;  4HL4 A;  1ZAE A;  4B3M M;  4GIT A;  2CV1 A;  3I4Y A;  3FUV A;  1TGU A;  1NHG C;  5EQT A;  2FFJ A;  4IBJ A;  5IWA M;  2DHR A;  3M7G A;  3TE6 A;  1W5T A;  1DGB A;  2KZU A;  3HJQ A;  5ITX E;  2UXD M;  3KW6 A;  1D2N A;  2C9O A;  4EIW A;  2R4E A;  4DUZ M;  4JI6 M;  2XSZ D;  4MGK E;  3FTC A;  3MJ5 A;  4M0W A;  3UK6 A;  4CIS A;  3TPZ A;  2F5O A;  2CE7 A;  3VDP A;  4M9Z A;  1R2Z A;  4L15 A;  3J7B A;  3T1Y M;  1DGF A;  1E94 E;  1IY0 A;  2YNM D;  4NSR A;  1SXJ E;  3FKE A;  3A98 B;  1GL6 A;  4DV5 M;  4GHA A;  1IN6 A;  4QNM A;  4JI5 M;  2A5Y B;  2ZM6 M;  3GQ3 A;  2DWM A;  2KRK A;  1LV7 A;  2Y21 A;  1PJI A;  3Q8X A;  1IBK M;  4K0K M;  3U6M A;  3L2A A;  3WHL A;  3U5Z B;  4GC9 A;  4IIW A;  8CAT A;  4KOD A;  4GC5 A;  1N36 M;  3KXE C;  4LJ5 A;  1W5S A;  4DV0 M;  3SMS A;  1IQP A;  4OU7 A;  4BLC A;  4PCZ A;  3SAW A;  2FNA A;  2XGN A;  1TH2 A;  4GKK M;  1SXJ B;  1QYR A;  3CF6 E;  3FYC A;  3GLG A;  1G41 A;  5EP1 A;  2G8L A;  2G5G X;  2DWN A;  4QHT A;  1XNQ M;  1J5E M;  4LGY A;  4LF9 M;  1GVN A;  4DUY M;  1L1Z A;  3HHZ A;  4AG5 A;  3SHG B;  1L1T A;  3E4R A;  4GRI A;  2DVW B;  1G59 A;  4S12 A;  3C58 A;  4KLN A;  3L29 A;  4OX9 M;  4FWG A;  3GQ5 A;  1I4W A;  4DR6 M;  3L28 A;  3J27 B;  4Z6Y A;  5JI2 E;  4LJ6 A;  3LQR A;  3KOY E;  3RGP A;  4D81 A;  2Z4R A;  1HQY E;  2QBY B;  3KOX E;  4GH9 A;  4L4U A;  3U6D A;  4DR2 M;  2V6Z M;  1GL7 A;  5FTJ A;  3SAT A;  1JR3 A;  1IY1 A;  4CGY B;  3GLI A;  3DZD A;  3DA1 A;  2V1U A;  3QWL A;  2R4J A;  2VQF M;  1J7K A;  3HKP A;  4JXJ A;  4LJ9 A;  4JI0 M;  4PT5 A;  4LRT A;  1TDH A;  3I51 A;  4BBA A;  2LXE A;  4NOO B;  3U60 A;  3LVV A;  1K82 A;  3HU2 A;  1IBL M;  3T1H M;  3HHX A;  3ILK A;  1N34 M;  1IXZ A;  2YR0 A;  1XMO M;  5EXS A;  1PJJ A;  1NY5 A;  2J7O A;  4IJE A;  1S3S A;  1NNJ A;  3U5Z A;  2QEN A;  3A45 A;  1PM5 A;  1DGH B;  1IM2 A;  2R18 A;  2CHV A;  4DV6 M;  3NBI A;  2L6O A;  3VFD A;  2OPF A;  4DR3 M;  4OVZ B;  3SFZ A;  2Z4S A;  3K2L A;  3KP1 E;  1Z6T A;  4REZ A;  3GQ4 A;  4NRV A;  2I7P A;  3HGI A;  1Q3C A;  1ZQ9 A;  1SXJ A;  1IN8 A;  4M9X A;  3FTE A;  3GLH B;  5FLX S;  4NXN M;  3M0E A;  2CV0 A;  3VK8 A;  5LMU M;  3WHK A;  1G4A E;  2M60 A;  4JI7 M;  2M5Z A;  3GPX A;  5EP4 A;  1K3W A;  2CFO A;  1SXJ D;  3FUW A;  5EXX A;  3T38 A;  3MK6 A;  3HHW A;  3JR5 A;  5KPR A;  5KQ8 A;  5IZ7 D;  3LMM A;  2QBY A;  2X8A A;  2Q2E B;  4QOS A;  2R62 A;  3GRV A;  2JA2 A;  4DR1 M;  2DZO B;  1OFI A;  2QCU A;  3HHY A;  1R7R A;  4DR5 M;  4II7 A;  2Z3X A;  5C1B A;  3GPU A;  3KVW A;  4AKI A;  4KHP M;  5ITR A;  3TQS A;  1IN7 A;  5DYG A;  2Z7J A;  4B3S M;  2DWZ B;  3IG5 A;  5ITU A;  1Z59 A;  3GRU A;  3R9X B;  4JV5 M;  3SAU A;  4LJ7 A;  3CF0 A;  3KP0 E;  1YUB A;  2RGH A;  4RF0 A;  5KO3 A;  3PFI A;  4AG6 A;  2HCB A;  3D8L A;  3EIE A;  3CF2 A;  4JI3 M;  1QZM A;  3UGJ A;  1MU5 A;  2LNH C;  2K47 A;  2YQZ A;  2X49 A;  4FCV A;  3UZU A;  4I4L A;  4NL4 H;  1L2C A;  2UUA M;  4B08 A;  5BPV A;  2FOI C;  4LZJ A;  2F4V M;  1UM8 A;  4GMQ A;  1HNX M;  3HJ8 A;  3K92 A;  2C99 A;  4OVZ A;  5KPT A;  5LMN M;  2ZAM A;  4JYA M;  4AQY M;  4M0D A;  3J81 S;  1R6B X;  2EA0 A;  4G4O A;  5KQD A;  1QAN A;  2XLJ A;  4X66 M;  2KZS A;  3W0L B;  1NVM A;  2O5R A;  1C1K A;  4IBK A;  4YY3 M;  1XXH B;  4GHL A;  2ERC A;  3J80 S;  1QAM A;  4LJ8 A;  4IBD A;  1N77 A;  4ITQ A;  4JI8 M;  1HR0 M;  3AL0 C;  1E32 A;  4X62 M;  1HQC A;  4ZPX A;  2KW0 A;  3D8B A;  3FYD A;  3UJN A;  1NNU C;  2ZAO A;  3AJI B;  2AHM A;  5KPZ A;  1I94 M;  2R45 A;  3UMM A;  5EJC A;  4JI2 M;  2XH9 A;  4AI6 A;  1N33 M;  1TH4 A;  2C96 A;  4LY6 A;  5ITQ A;  2KA6 B;  3JAM S;  4LFA M;  4MGZ E;  1KFV A;  3AV0 A;  1NY6 A;  2E5L M;  3I4V A;  2QZ4 A;  3IG8 A;  5F3W A;  2XZU A;  4B3R M;  4GIP A;  3FTD A;  3ZCB B;  5A2Q S;  4YHH M;  3FD9 A;  4LF4 M;  1N75 A;  4MGY E;  2H1R A;  4IBF A;  2XEP A;  2CUZ A;  2XFT A;  1GKI A;  3FUX A;  4AW4 A;  3KFU G;  2R65 A;  3L27 A;  3KOZ E;  2UXB M;  4GKJ M;  4FCT A;  1TH3 A;  2ZBK B;  3H4M A;  1KSF X;  3CTW B;  3THG A;  4DR7 M;  1YE9 A;  3TWK A;  1KYI A;  3NWL A;  4R3D A;  4AKG A;  4MH0 E;  3PXG A;  3U6O A;  5ITX A;  1DO0 A;  3GPY A;  4NXM M;  2DZN B;  2RGO A;  4LF5 M;  3EIH A;  3M6A A;  4IJF A;  2BJV A;  3AOG A;  4FCW A;  4FW9 A;  3TWL A;  1HNZ M;  2KEB A;  3HU3 A;  4L16 A;  4NRW A;  2HHH M;  3U6P A;  3A42 A;  2L7I A;  5H37 D;  3GRY A;  1IN4 A;  5FTK A;  1XC8 A;  3A46 A;  4JI4 M;  4DV4 M;  1GLN A;  2L7H A;  2UUC M;  3FTF A;  1T3T A;  1Q3B A;  4XBO A;  4RNA A;  3PVS A;  4WUR A;  4DV7 M;  4FVM A;  4D80 A;  3AOE A;  3VDU A;  1E9R A;  2YFQ A;  4LZZ A;  3GLF B;  1X37 A;  2X4A A;  3QAU A;  2VQE M;  5FTM A;  5IT9 S;  2CEA A;  5EP2 A;  4LF6 M;  4LFB M;  2VII A;  3SAV A;  1TDZ A;  3U61 B;  5GKN A;  2QP9 X;  1G8P A;  3VKH A;  4IBG A;  4NSO B;  4KO8 A;  3E9S A;  2XF3 A;  2R46 A;  1L2D A;  4JI1 M;  2J7N A;  5E6J A;  2NQ8 C;  2F5Q A;  2BNK A;  3GLG B;  1FNN A;  3LVW A;  4PD2 A;  4LJ4 A;  3RGS A;  3KS4 A;  3PNY A;  4M9S A;  2HL7 A;  1E9S A;  4LGM A;  2KRU A;  4FWH A;  2DWL A;  3U6C A;  1N78 A;  1NJG A;  1YSY A;  2Y20 A;  3U6S A;  1NSF A;  1QAO A;  2EO2 A;  3KS8 A;  4HLQ A;  3SAR A;  5FTN A;  3GO8 A;  2C98 A;  2Y0Q A;  4G4N A;  2EUC A;  1XWI A;  2OQ4 A;  4LG2 A;  3B9P A;  4CHT B;  1HT1 E;  4P16 A;  3OTO M;  3L26 A;  5BR8 M;  4LRS A;  2C9C A;  1Q39 A;  4X65 M;  1OFH A;  5IRE B;  3ZH9 B;  4G6Z A;  1SXJ C;  3FUT A;  5EXP A;  1HT2 E;  2Y0T A;  5FTL A;  1XHB A;  1DGH A;  4LF8 M;  3GLI B;  3PNV A;  1VDD A;  4LF7 M;  3AOE C;  5DNY A;  4PDI A;  2RKO A;  5DYI A;  1K3X A;  3K1J A;  4IBC A;  4OW0 A;  3GP1 A;  1R2Y A;  1J09 A;  3U60 B;  5JI3 E;  4DV1 M;  2XZF A;  4LJA A;  3VKG A;  4Z8X A;  3GLH A;  3RFW A;  3VLF B;  1IBM M;  2CHG A;  5ITT A;  1XMQ M;  3JR4 A;  1L2B A;  5C18 A;  2UU9 M;  3BOS A;  3SBJ A;  1Z5C A;  3GLF A;  4X64 M;  1L8Q A;  3KSJ A;  1EE8 A;  3TL4 X;  5EXT A;  2UUB M;  4AZF A;  3U61 A;  1IY2 A;  3LQQ A;  1IN5 A;  3W0F A;  4LFC M;  4DV2 M;  1QVR A;  4AKH A;  3HWS A;  3J2P B;  2F5S A;  3T15 A;  3SAS A;  3GRR A;  4IBE A;  5EP3 A;  4MM3 B;  4G4Q A;  1Z5A A;  3L25 A;  1NJF A;  3KSX A;  1QAQ A;  4MGH A;  1FJG M;  1DO2 A;  4D82 A;  2BJW A;  2F5N A;  3DOA A;  3KDS E;  4I5S A;  3SYK A;  4DR4 M;  4G4R A;  1ORY B;  3SHF A;  4FWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...