4DUYM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duyM02
3TWLA 3J81S 5ITXA 3U6LA 5IWAM 4JI6M 4K0KM 4G4NA 1HNZM 3GQ5A 2F4VM 4GKJM 1Z5BA 2OQ4A 4JV5M 3U6OA 1IBMM 4LF9M 3U6DA 2HKJA 4DR4M 4DR7M 1N32M 1IBLM 4JI0M 1TDHA 3GP1A 1MX0A 2UXDM 4B3RM 2F5NA 1K3XA 2XZUA 2F5OA 3C58A 4YY3M 1Z5CA 4DV1M 3A42A 3JR5A 2ZM6M 4LF5M 4NRWA 3U6EA 4JI1M 3SAVA 2HHHM 4PD2A 4DV2M 5ITYA 5ITXE 1Q3BA 5BR8M 4G4OA 3SAUA 4X65M 3JAMS 4LFAM 4DV3M 2VQEM 2VQFM 5LMNM 2F5PA 3OTOM 1R2YA 4JI2M 5ITQA 4JI4M 4LFCM 1L1ZA 2F5QA 3T1YM 1TDZA 2ZBKB 3TWKA 1KFVA 3GPPA 1Z5AA 4DR6M 4DUZM 2Q2EB 4JI7M 2UXCM 1L2CA 4JI5M 2EA0A 4DR1M 1L2BA 3SATA 2OPFA 2UXBM 2UUCM 4ITQA 1HR0M 1FJGM 4PDIA 1XNQM 4B3MM 4G4RA 3U6QA 1J5EM 3SARA 4LF4M 1IBKM 1K3WA 4DV0M 3U6MA 3GO8A 5LMUM 4DV4M 1I94M 1XNRM 4X66M 1L2DA 1Z59A 1N36M 1XC8A 2UU9M 1N34M 1NNJA 3U6SA 5ITTA 3SBJA 5ITUA 3GQ4A 1N33M 4LF7M 4PDGA 3T1HM 4NRVA 4LF6M 4JYAM 3DOAA 1L1TA 5IT9S 3J7AS 2XZFA 3U6CA 1PJJA 4NXNM 3TWMA 4LFBM 1EE8A 4OX9M 4GKKM 1MU5A 4YHHM 4AQYM 4X64M 4B3TM 5FLXS 2UUBM 1R2ZA 5ITRA 4DR2M 1XMOM 4X62M 3GPYA 4DR5M 4DUYM 3U6PA 3GPXA 1HNXM 3VK7A 3A46A 4KHPM 4LF8M 4DV5M 3W0FA 3SAWA 3JR4A 4NXMM 1PJIA 2UUAM 2F5SA 4MB7A 5A2QS 4B3SM 4DV6M 1Q3CA 4CISA 2E5LM 3GPUA 3VK8A 4JI3M 3GQ3A 4G4QA 1PM5A 1Q39A 3A45A 4DR3M 4DV7M 1HNWM 1K82A 4JI8M 1XMQM 3J80S 4PCZA 3SASA
chains in the Genus database with same CATH superfamily
1QAMA 1T6OA 3L28A 4JI6M 2O01F 4K0KM 1LTMA 3KOZE 2F4VM 1NJFA 2XSZA 4NL4H 4MGZE 4CJ6A 4NSRA 2C98A 5C18A 1GLNA 3M6AA 2C9CA 3B7ZA 4I81A 4P17A 3SC3A 3HKPA 3E21A 1V92A 2M5ZA 1ZMUA 4KO8A 1HQCA 4M9XA 2C5RA 2V6ZM 1JR3D 4B7FA 3U60B 4B3RM 4AG5A 1UFZA 2JY7A 2F5OA 2KXEA 4YY3M 3U5ZA 3K9OA 3KOWE 3F92A 3K1JA 4F2LA 2ZM6M 4DV1M 3ZH9B 4B7GA 1ZV1A 2V1UA 1GABA 2XLJA 4LJ7A 3SAVA 4DV2M 1Q3BA 2KW0A 5KQ8A 5BR8M 2R6FA 2DWNA 4X65M 1X37A 1SXJD 4LZJA 2DAGA 4JI2M 1R2YA 2CWBA 3GLHB 1TDZA 2ZBKB 3TWKA 3FKEA 4HEOA 4LY6A 4RF1A 1Z5AA 2Q2EB 3LW5F 1NY6A 4BBAA 1UM8A 1IN5A 2KHHA 2CRUA 3HJ8A 4IBDA 2EA0A 1L2BA 3BOSA 4IBIA 2OPFA 1KSFX 1IXSB 2KZSA 2UUCM 5BPVA 2KNAA 2R0IA 3U61A 1HR0M 1SG9A 4XK8F 2ZANA 1QZMA 3NBIA 2LTUA 4G4RA 3U6QA 1VEKA 3FUUA 1VG5A 4LRSA 1K3WA 1G8PA 1HQYE 3GO8A 4DV4M 1OQYA 1QANA 1I94M 3SYKA 1XNRM 1IQPA 2GQFA 4D80A 1N36M 2YFQA 3V76A 2Z4SA 3T38A 2EJSA 5E6JA 3A98B 2JZ1A 7CATA 2K47A 3D8BA 4G6ZA 3GRUA 1EIJA 2L09A 4RKUF 2BJVA 4JN6A 4M9SA 4F1IA 1N77A 2KNZA 3AOEC 4IJFA 4NRVA 4LF7M 4JYAM 2GNOA 1R6BX 2XFSA 2DWLA 4OVZB 4Z8XA 3LVVA 4GH9A 5EP4A 4NXNM 3SMSA 2VF8A 1HT1E 3FRHA 1EE8A 4IIWA 1WR1B 1MU5A 3BXWA 2JZ0A 5FLXS 3I01M 1R2ZA 4FCWA 2YNMD 1GL7A 1XMOM 3LCUA 3GPYA 4Y28F 5IREB 4DR5M 1YSYA 4MGIE 1HNXM 2LVQD 3EIHA 4PCZA 4L6V6 2D7GA 1DGBA 1HT2E 1QYRA 3VDPA 2DXIA 4KHPM 3HJSA 4LF8M 4NC6A 2VDBB 3W0FA 3JR4A 4R7GA 4LJ5A 3UMMA 1T43A 4LCBA 3VLFB 4DV6M 1BVSA 4AW4A 2J7NA 1SXJB 2XEPA 3KVWA 2E5LM 2XSZD 3GPUA 2G3QA 4JI3M 1J7KA 2ZTCA 2WSCF 2LHCA 2M60A 3A45A 3FRIA 2DAMA 3GLFB 3J80S 2L7HA 2CHQA 4FWDA 1GO5A 3K2LA 3SASA 3I51A 4BB9A 2DZNB 3TWLA 3U6LA 1G59A 5IWAM 3HU1A 3HGIA 1EFUB 1PRBA 3IECA 5KPRA 4G4NA 3GQ5A 1IN7A 1HNZM 1V33A 3PVSA 3C3EA 4LGMA 4JV5M 3TL4X 3U6OA 4LF9M 3TPZA 4DR7M 1E94E 1IBLM 5KQDA 1QUSA 1TGUA 2O25A 4JI0M 1XHBA 1DGHB 2VIIA 4IBCA 4IBFA 3HJQA 2UXDM 1IY2A 5FTNA 3R9XB 3RFWA 2WZJA 2F5NA 3AOGA 3C58A 3QYEA 1IM2A 5FSWA 1TTEA 2KRKA 3A42A 3JR5A 2BNKA 3U6EA 4W5WA 4JI1M 2Y0TA 4BLCA 1WIVA 4KODA 2LH0A 5IZ7D 2P5TA 2JA2A 2C99A 5ITYA 2G8LA 1IY0A 4L4UA 3R8FA 4LFAM 5LMNM 2VQFM 3QAUA 4JI4M 3OTOM 1LV7A 4LFCM 3MMPA 2MGWA 1L1ZA 2BWBA 1JQJC 2RKOA 1TH4A 4QHSA 3GLGE 3GRVA 3VKGA 2Z7JA 1DO0A 4DUZM 4JI7M 3GLGB 1KYIA 1QUTA 1WGLA 1XXHA 3HHZA 1L2CA 2VF7A 3KOXE 3W67A 5KPZA 3K92A 5KO3A 4DR1M 2EO2A 1VDDA 1P3QQ 1VEJA 2OOBA 1XWIA 2DHRA 1F4IA 4PDIA 3FYDA 4B3MM 4MM3B 3J27B 3KS4A 2DENA 4DV0M 3AOEA 2LVNC 3U6MA 3ZCBB 2V1CA 3RGPA 1QAOA 1E9SA 2JY6B 1IN6A 4HLQA 4LJ9A 1QDRA 3L27A 1L2DA 2UU9M 1TR8A 2J7OA 4LG2A 1PGYA 1IN4A 5DFLA 1D0LA 3RGSA 2CHVA 1NNJA 3HZJA 3UZUA 5ITTA 4DBGB 3FTFA 5L8RF 3QWLA 1XXHE 4ANRA 2Z3XA 4A3VB 3SBJA 4FWHA 2YQZA 1N33M 2XFTA 4I4LA 3T1HM 2H1RA 2KRUA 2QHOB 4IBBA 4FWGA 1GL6A 3DOAA 2EKFA 1TH2A 3J7AS 5IT9S 4AKIA 3T6PA 3FE3A 1R4GA 4KLNA 4MGYE 3FTDA 2A5YB 3AJIB 3TQSA 2R62A 4LRTA 4LZZA 3U5ZB 4OX9M 5C1BA 4X64M 2D7EA 3EIEA 3FUXA 3H4MA 3CTWB 2MJ5B 2QPAA 2C96A 3ILKA 5JI2E 1R7RA 5EXTA 3FYCA 3GLIA 4DUYM 3GPXA 3U6PA 3A46A 2LVOC 4M9ZA 3KW6A 3SMPA 4LJ6A 4DV5M 2I7PA 4D81A 4NXMM 2UUAM 2Y20A 5H37D 1NNUC 2Y0QA 4M0WA 2L7IA 2MROB 5A2QS 2J5YA 4B3SM 2FFJA 2LBCA 4KT0F 2JWSA 3SHGB 2DI0A 2R4JA 4CISA 2HCBA 4TUWA 2I7NA 1PJQA 3CF0A 1N78A 2LHGA 3KP0E 3GQ3A 3U61B 2ZAMA 4B08A 1IN8A 3KOYE 3WHLA 1K82A 3FTEA 4AZFA 2CFOA 1WXQA 3J81S 4B7HA 1NY5A 3HHWA 4GRIA 4Z6YA 2K9DA 1Z5BA 1FNNA 3B74A 1Q02A 3KSXA 2OQ4A 2XF3A 1WHCA 1QAQA 2Y21A 1IBMM 2HKJA 4DR4M 1N32M 3NBXX 1CUKA 1JB0F 1TDHA 3AL0C 1E32A 3I4YA 1OAIA 3UGJA 4OU7A 2CHGA 1D0KA 1YLAA 1Z5CA 5EP3A 3DZDA 3FUTA 3SYLA 2R18A 2R44A 4LJ8A 1Y8GA 2L2DA 4Q7JA 1A5TA 2WSFF 1W5SA 3PXGA 4PD2A 3WHKA 2HHHM 2HL7A 4AI6A 1NSFA 2FE8A 4IBJA 3SAUA 2JUJA 3LQQA 3JAMS 3AV0A 3HU3A 2F5PA 2G5GX 1OAOC 1S3SA 5ITQA 2R45A 3CF6E 2F5QA 2QENA 2K0BX 2KNVA 4FVMA 1QQWA 4HL4A 3CF2A 4JI5M 4WURA 3J7BA 5EJCA 3PNYA 4WW0A 4L8RC 3HHXA 3UJNA 3UK6A 1G71A 2JP7A 4UN2B 2XH9A 3VKHA 3L26A 3B89A 1PJSA 2QBYA 3K9PA 2L4EA 4P16A 3MHVC 4NSOB 2DAIA 3KSJA 1J5EM 1Z6TA 1QVRA 5EXXA 1IXRC 4LF4M 2Z8YM 3MJ5A 3HWSA 5LMUM 1HJPA 2L6OA 2X4AA 3L29A 4X66M 4GEWA 1SXJC 1Z59A 2BWEA 5JI3E 4GIPA 3E4RA 5DYIA 1VDLA 1GJSA 4FD2A 4GC5A 2DVWB 3U6SA 4GHLA 3B9PA 4RNAA 1QDTA 1J09A 4JXJA 5DNYA 1OIPA 3U60A 1W5TA 1L1TA 2HAKA 2XZFA 2N35A 1PJJA 1WJ7A 1ORYB 1T3TA 2JXNA 5EP1A 3KFUG 2W82A 4GKKM 4REZA 1AUAA 1I4WA 4YHHM 1GKIA 2L4FA 1DV0A 5ITRA 4IBEA 4DR2M 1G3IA 2AHMA 3PFIA 3AKZA 4FCTA 2OOAA 3GLHA 3FUVA 2DKLA 2X8AA 4II7A 2QP9X 5EXPA 3PNVA 2QSFX 4NOOB 4MGHA 4AKHA 2CE7A 4I8OA 1V34A 1OFIA 3SAWA 1NJGA 2DZLA 3K8ZA 2DNAA 4M0DA 1PJIA 8CATA 2YR0A 3J2PB 1IXSA 1DGGA 1XXHB 1D0MA 2LXEA 2B3TA 2FOIC 2ZAOA 2QCUA 3MK6A 2DWZB 5EXSA 3Q8GA 2H5XA 3I4VA 5DYGA 3E9SA 4G4QA 1PM5A 4DV7M 4L78A 4OW0A 2RRUA 1XMQM 5GKNA 3GRRA 3LVWA 4FCVA 4GC9A 4GITA 4PT5A 1YUBA 5ITXA 3TE6A 3GLHE 1GVNA 1YE9A 2FNAA 1QZEA 5FTJA 2R46A 3ZQJA 4GKJM 1NV9A 5FTKA 1D2NA 2QZ4A 5FTMA 4AKGA 3U6DA 3AFHA 1XB2B 4GHAA 3GRYA 2LVPC 1ZMVA 3LMMA 1IFYA 3GP1A 3D8LA 4OVZA 1MX0A 2R4EA 1N75A 4L15A 3C9PA 4G3OA 1K3XA 3QYBA 2XZUA 5E26A 1NVMA 2EKKA 4LJ4A 1DO2A 4NRWA 2HWJA 2ZTDA 3HX3A 2QNJA 4LF5M 1E9RA 1H6UA 4CHTB 2C9OA 4XBOA 1TH3A 4AG6A 4QHTA 5ITXE 4G4OA 1JR3A 2APLA 4XGIA 4QOZC 1VEGA 4GMQA 1RU3A 4WP2A 3GLIE 2VQEM 3E46A 4DV3M 2OO9A 4EIWA 5EP2A 2NQ8C 3GLIB 3T1YM 1G4AE 3KP1E 1KFVA 3NWLA 3IG5A 3GPPA 4R71A 4DR6M 2UXCM 1OFHA 3CGWA 3SHFA 4QNRA 1C1KA 2D7HA 3FTCA 4R3DA 3IG8A 3SATA 1SXJA 2RGHA 4L16A 2UXBM 4IBGA 4ZPXA 1NHGC 3I04M 4CIZA 2MR9A 1C7YA 4ITQA 1FJGM 5KPTA 1ZAEA 1XNQM 2X49A 1MN3A 3GLFA 3SARA 3ZC7B 4FW9A 4I5SA 3SFZA 1IBKM 1AIPC 1ZQ9A 1JR3E 3C3DA 2CEAA 3FD9A 3FUWA 1IY1A 2CUZA 2CV2A 2DAKA 3B7QA 4RF0A 1XC8A 2FH0A 1GJTA 1NV8A 1N34M 1L8QA 1OJLA 2R65A 2CV0A 1TF0B 1NHWC 2JY8A 2JY5A 2BJWA 1DGHA 3HY5A 3L2AA 4LJAA 5ITUA 3GQ4A 4PDGA 2EUCA 4LF6M 2MH8A 2LVAA 1SXJE 4IJEA 3B7NA 4S12A 2DZOB 4D82A 3KXEC 3M0EA 3U6CA 1OIZA 3L25A 3Q8XA 3M7GA 1OTRA 3GLFE 3TWMA 4LFBM 4AQYM 5F3WA 2DWMA 4B3TM 2UUBM 2QQ8A 3BBZA 4LGYA 4CGYB 3KS8A 2KZUA 4QNMA 4X62M 2CP8A 2XGNA 1OKSA 3VK7A 3GLGA 3KDSE 5FTLA 3T15A 4MH0E 2DHYA 1ZMWA 2ERCA 1G41A 3LQRA 2CV1A 2F5SA 3H4JA 3HHYA 1NO1A 4MGKE 3HU2A 2LNHC 3LCVB 4MB7A 3W68A 2DAEA 3VDUA 2KEBA 3THGA 1VQ1A 2KDLA 3RE8A 3DA1A 3VFDA 3DFZA 2FS1A 1WGNA 1Q3CA 4IBKA 2K6BA 2LWXA 3W0LB 3VK8A 2JNHA 2QBYB 3IHPA 1R5LA 1Q39A 1DGFA 1MJGM 5EQTA 1PJTA 2O5RA 4DR3M 2Z4RA 1HNWM 4JI8M 2RGOA 2KA6B 4QOSA 1IXZA 2WSEF
chains in the Genus database with same CATH topology
1QAMA 3L28A 4JI6M 4K0KM 3KOZE 2F4VM 1NJFA 2XSZA 4NL4H 4MGZE 4NSRA 2C98A 5C18A 1GLNA 3M6AA 2C9CA 3SC3A 4I81A 3HKPA 4KO8A 2M5ZA 4M9XA 2C5RA 1HQCA 2V6ZM 1JR3D 4B7FA 3U60B 4B3RM 4AG5A 2F5OA 2KXEA 4YY3M 3U5ZA 3KOWE 4DV1M 3K1JA 2ZM6M 3ZH9B 4B7GA 2V1UA 2XLJA 4LJ7A 3SAVA 4DV2M 1Q3BA 2KW0A 5KQ8A 5BR8M 2DWNA 4X65M 1X37A 1SXJD 4LZJA 4JI2M 1R2YA 3GLHB 1TDZA 2ZBKB 3TWKA 3FKEA 4LY6A 4RF1A 1Z5AA 2Q2EB 1NY6A 4BBAA 1UM8A 1IN5A 3HJ8A 4IBDA 2EA0A 1L2BA 3BOSA 4IBIA 2OPFA 1KSFX 1IXSB 2KZSA 2UUCM 5BPVA 3U61A 1HR0M 2ZANA 1QZMA 3NBIA 4G4RA 3U6QA 3FUUA 4LRSA 1K3WA 1G8PA 1HQYE 3GO8A 4DV4M 1QANA 1I94M 3SYKA 1XNRM 1IQPA 4D80A 1N36M 2YFQA 2Z4SA 3T38A 5E6JA 3A98B 7CATA 2K47A 3D8BA 4G6ZA 3GRUA 2L09A 2BJVA 4JN6A 4M9SA 1N77A 4LF7M 4NRVA 3AOEC 4IJFA 4JYAM 1R6BX 2XFSA 2DWLA 4OVZB 4Z8XA 3LVVA 4GH9A 5EP4A 4NXNM 3SMSA 1HT1E 4IIWA 1EE8A 1MU5A 5FLXS 1R2ZA 4FCWA 2YNMD 1GL7A 1XMOM 3GPYA 5IREB 4DR5M 1YSYA 4MGIE 1HNXM 3EIHA 4PCZA 2DXIA 2D7GA 1DGBA 1HT2E 1QYRA 3VDPA 4KHPM 3HJSA 4LF8M 3W0FA 3JR4A 4R7GA 4LJ5A 3UMMA 4LCBA 3VLFB 4DV6M 4AW4A 2J7NA 1SXJB 2XEPA 3KVWA 2E5LM 2XSZD 3GPUA 4JI3M 1J7KA 2M60A 3A45A 3GLFB 3J80S 2L7HA 2CHQA 4FWDA 3K2LA 3SASA 3I51A 4BB9A 2DZNB 3TWLA 3U6LA 1G59A 5IWAM 3HU1A 3HGIA 4G4NA 5KPRA 1HNZM 3GQ5A 1IN7A 3PVSA 4LGMA 4JV5M 3TL4X 3U6OA 4LF9M 3TPZA 4DR7M 1E94E 1IBLM 5KQDA 1TGUA 4JI0M 1XHBA 1DGHB 2VIIA 4IBCA 4IBFA 3HJQA 2UXDM 1IY2A 5FTNA 3R9XB 3RFWA 2F5NA 3AOGA 3C58A 1IM2A 5FSWA 2KRKA 3A42A 3JR5A 2BNKA 3U6EA 4W5WA 4JI1M 2Y0TA 4BLCA 4KODA 2LH0A 5IZ7D 2P5TA 2JA2A 2C99A 5ITYA 2G8LA 1IY0A 4L4UA 3R8FA 4LFAM 5LMNM 2VQFM 3QAUA 4JI4M 3OTOM 1LV7A 4LFCM 1L1ZA 2RKOA 1JQJC 4QHSA 1TH4A 3GRVA 3VKGA 2Z7JA 1DO0A 4DUZM 4JI7M 3GLGB 1KYIA 3HHZA 1XXHA 1L2CA 3KOXE 5KPZA 3K92A 5KO3A 4DR1M 2EO2A 1VDDA 1XWIA 2DHRA 4PDIA 3FYDA 4B3MM 4MM3B 3J27B 3KS4A 4DV0M 3AOEA 3U6MA 3ZCBB 2V1CA 3RGPA 1QAOA 1E9SA 4HLQA 1IN6A 4LJ9A 1L2DA 3L27A 2UU9M 2J7OA 4LG2A 1IN4A 3RGSA 2CHVA 1NNJA 3UZUA 5ITTA 3FTFA 3QWLA 2Z3XA 3SBJA 4A3VB 4FWHA 2YQZA 1N33M 2XFTA 4I4LA 3T1HM 2H1RA 2KRUA 4IBBA 4FWGA 1GL6A 3DOAA 5IT9S 1TH2A 3J7AS 4AKIA 4KLNA 4MGYE 3FTDA 2A5YB 3AJIB 3TQSA 2R62A 4LRTA 4LZZA 3U5ZB 4OX9M 5C1BA 4X64M 2D7EA 3EIEA 3FUXA 3H4MA 3CTWB 2QPAA 2C96A 3ILKA 5JI2E 1R7RA 5EXTA 3FYCA 3GLIA 4DUYM 3GPXA 3U6PA 3A46A 4M9ZA 3KW6A 3SMPA 4LJ6A 4DV5M 2I7PA 4D81A 4NXMM 2UUAM 2Y20A 5H37D 1NNUC 2Y0QA 4M0WA 2L7IA 5A2QS 4B3SM 2FFJA 3SHGB 2R4JA 4CISA 2HCBA 4TUWA 2I7NA 3CF0A 1N78A 3KP0E 3GQ3A 3U61B 2ZAMA 4B08A 1IN8A 3KOYE 3WHLA 1K82A 3FTEA 4AZFA 2CFOA 1WXQA 3J81S 4B7HA 1NY5A 3HHWA 4GRIA 4Z6YA 1Z5BA 1FNNA 3KSXA 2OQ4A 1IBMM 2XF3A 2Y21A 1QAQA 2HKJA 4DR4M 1N32M 1TDHA 3AL0C 1E32A 3I4YA 3UGJA 4OU7A 2CHGA 1Z5CA 5EP3A 3DZDA 3FUTA 3SYLA 2R18A 4LJ8A 3PXGA 1W5SA 2HHHM 4PD2A 3WHKA 2HL7A 4AI6A 1NSFA 2FE8A 4IBJA 3SAUA 3LQQA 3JAMS 3AV0A 3HU3A 2F5PA 2G5GX 1S3SA 5ITQA 2R45A 3CF6E 2F5QA 2QENA 4FVMA 1QQWA 4HL4A 3CF2A 4JI5M 4WURA 3J7BA 5EJCA 3PNYA 4WW0A 4L8RC 3HHXA 3UJNA 3UK6A 2XH9A 3VKHA 3L26A 2QBYA 4P16A 3MHVC 4NSOB 3KSJA 1J5EM 1Z6TA 1QVRA 5EXXA 1IXRC 4LF4M 3MJ5A 3HWSA 5LMUM 3L29A 2L6OA 2X4AA 4X66M 5JI3E 1SXJC 1Z59A 4GIPA 3E4RA 5DYIA 4FD2A 4GC5A 2DVWB 3U6SA 4GHLA 3B9PA 4RNAA 4JXJA 1J09A 5DNYA 3U60A 1W5TA 1L1TA 2XZFA 1PJJA 1ORYB 1T3TA 5EP1A 3KFUG 2W82A 4GKKM 4REZA 4YHHM 1I4WA 1GKIA 5ITRA 4IBEA 4DR2M 1G3IA 2AHMA 3PFIA 3AKZA 4FCTA 3GLHA 3FUVA 2X8AA 4II7A 2QP9X 5EXPA 3PNVA 4NOOB 4MGHA 4AKHA 2CE7A 4I8OA 1OFIA 3SAWA 1NJGA 3K8ZA 4M0DA 1PJIA 8CATA 2YR0A 3J2PB 2ZAOA 1DGGA 1XXHB 2FOIC 2LXEA 3MK6A 2QCUA 2DWZB 5EXSA 3I4VA 5DYGA 3E9SA 4G4QA 1PM5A 4DV7M 4L78A 4OW0A 1XMQM 5GKNA 3GRRA 3LVWA 4FCVA 4GC9A 4GITA 4PT5A 1YUBA 5ITXA 3TE6A 1GVNA 1YE9A 2FNAA 5FTJA 2R46A 4GKJM 5FTKA 1D2NA 2QZ4A 5FTMA 4AKGA 3U6DA 3AFHA 4GHAA 3GRYA 3LMMA 3GP1A 3D8LA 4OVZA 1MX0A 2R4EA 1N75A 4L15A 1K3XA 2XZUA 5E26A 1NVMA 4LJ4A 1DO2A 4NRWA 4LF5M 1E9RA 1H6UA 4CHTB 2C9OA 4XBOA 1TH3A 4AG6A 4QHTA 5ITXE 4G4OA 1JR3A 4XGIA 4QOZC 4GMQA 4DV3M 2VQEM 4EIWA 5EP2A 2NQ8C 3GLIB 3T1YM 1G4AE 3KP1E 1KFVA 3NWLA 3IG5A 3GPPA 4DR6M 2UXCM 1OFHA 3SHFA 4QNRA 1C1KA 2D7HA 3FTCA 4R3DA 3IG8A 3SATA 1SXJA 2RGHA 4L16A 2UXBM 4IBGA 4ZPXA 1NHGC 4ITQA 1FJGM 5KPTA 1ZAEA 1XNQM 2X49A 3GLFA 3SARA 3ZC7B 4FW9A 4I5SA 3SFZA 1IBKM 1ZQ9A 3FUWA 2CEAA 3FD9A 2CV2A 1IY1A 2CUZA 4RF0A 1XC8A 1N34M 1L8QA 1OJLA 2R65A 2CV0A 1NHWC 2BJWA 1DGHA 3L2AA 4LJAA 5ITUA 3GQ4A 4PDGA 2EUCA 4LF6M 1SXJE 4IJEA 4S12A 2DZOB 4D82A 3KXEC 3M0EA 3U6CA 3L25A 3Q8XA 3M7GA 3TWMA 4LFBM 4AQYM 5F3WA 2DWMA 4B3TM 2UUBM 4LGYA 4CGYB 3KS8A 2KZUA 4QNMA 4X62M 2XGNA 3VK7A 3GLGA 3KDSE 5FTLA 3T15A 4MH0E 2ERCA 1G41A 3LQRA 2CV1A 2F5SA 3HHYA 4MGKE 3HU2A 2LNHC 4MB7A 3VDUA 2KEBA 3THGA 3RE8A 3VFDA 3DA1A 3DFZA 1Q3CA 4IBKA 2LWXA 3VK8A 3W0LB 2QBYB 1Q39A 1DGFA 5EQTA 4DR3M 2O5RA 1HNWM 2Z4RA 4JI8M 2RGOA 2KA6B 4QOSA 1IXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWL A;  3J81 S;  5ITX A;  3U6L A;  5IWA M;  4JI6 M;  4K0K M;  4G4N A;  1HNZ M;  3GQ5 A;  2F4V M;  4GKJ M;  1Z5B A;  2OQ4 A;  4JV5 M;  3U6O A;  1IBM M;  4LF9 M;  3U6D A;  2HKJ A;  4DR4 M;  4DR7 M;  1N32 M;  1IBL M;  4JI0 M;  1TDH A;  3GP1 A;  1MX0 A;  2UXD M;  4B3R M;  2F5N A;  1K3X A;  2XZU A;  2F5O A;  3C58 A;  4YY3 M;  1Z5C A;  4DV1 M;  3A42 A;  3JR5 A;  2ZM6 M;  4LF5 M;  4NRW A;  3U6E A;  4JI1 M;  3SAV A;  2HHH M;  4PD2 A;  4DV2 M;  5ITY A;  5ITX E;  1Q3B A;  5BR8 M;  4G4O A;  3SAU A;  4X65 M;  3JAM S;  4LFA M;  4DV3 M;  2VQE M;  2VQF M;  5LMN M;  2F5P A;  3OTO M;  1R2Y A;  4JI2 M;  5ITQ A;  4JI4 M;  4LFC M;  1L1Z A;  2F5Q A;  3T1Y M;  1TDZ A;  2ZBK B;  3TWK A;  1KFV A;  3GPP A;  1Z5A A;  4DR6 M;  4DUZ M;  2Q2E B;  4JI7 M;  2UXC M;  1L2C A;  4JI5 M;  2EA0 A;  4DR1 M;  1L2B A;  3SAT A;  2OPF A;  2UXB M;  2UUC M;  4ITQ A;  1HR0 M;  1FJG M;  4PDI A;  1XNQ M;  4B3M M;  4G4R A;  3U6Q A;  1J5E M;  3SAR A;  4LF4 M;  1IBK M;  1K3W A;  4DV0 M;  3U6M A;  3GO8 A;  5LMU M;  4DV4 M;  1I94 M;  1XNR M;  4X66 M;  1L2D A;  1Z59 A;  1N36 M;  1XC8 A;  2UU9 M;  1N34 M;  1NNJ A;  3U6S A;  5ITT A;  3SBJ A;  5ITU A;  3GQ4 A;  1N33 M;  4LF7 M;  4PDG A;  3T1H M;  4NRV A;  4LF6 M;  4JYA M;  3DOA A;  1L1T A;  5IT9 S;  3J7A S;  2XZF A;  3U6C A;  1PJJ A;  4NXN M;  3TWM A;  4LFB M;  1EE8 A;  4OX9 M;  4GKK M;  1MU5 A;  4YHH M;  4AQY M;  4X64 M;  4B3T M;  5FLX S;  2UUB M;  1R2Z A;  5ITR A;  4DR2 M;  1XMO M;  4X62 M;  3GPY A;  4DR5 M;  4DUY M;  3U6P A;  3GPX A;  1HNX M;  3VK7 A;  3A46 A;  4KHP M;  4LF8 M;  4DV5 M;  3W0F A;  3SAW A;  3JR4 A;  4NXM M;  1PJI A;  2UUA M;  2F5S A;  4MB7 A;  5A2Q S;  4B3S M;  4DV6 M;  1Q3C A;  4CIS A;  2E5L M;  3GPU A;  3VK8 A;  4JI3 M;  3GQ3 A;  4G4Q A;  1PM5 A;  1Q39 A;  3A45 A;  4DR3 M;  4DV7 M;  1HNW M;  1K82 A;  4JI8 M;  1XMQ M;  3J80 S;  4PCZ A;  3SAS A; 
#chains in the Genus database with same CATH topology
 1QAM A;  1T6O A;  3L28 A;  4JI6 M;  2O01 F;  4K0K M;  1LTM A;  3KOZ E;  2F4V M;  1NJF A;  2XSZ A;  4NL4 H;  4MGZ E;  4CJ6 A;  4NSR A;  2C98 A;  5C18 A;  1GLN A;  3M6A A;  2C9C A;  3B7Z A;  4I81 A;  4P17 A;  3SC3 A;  3HKP A;  3E21 A;  1V92 A;  2M5Z A;  1ZMU A;  4KO8 A;  1HQC A;  4M9X A;  2C5R A;  2V6Z M;  1JR3 D;  4B7F A;  3U60 B;  4B3R M;  4AG5 A;  1UFZ A;  2JY7 A;  2F5O A;  2KXE A;  4YY3 M;  3U5Z A;  3K9O A;  3KOW E;  3F92 A;  3K1J A;  4F2L A;  2ZM6 M;  4DV1 M;  3ZH9 B;  4B7G A;  1ZV1 A;  2V1U A;  1GAB A;  2XLJ A;  4LJ7 A;  3SAV A;  4DV2 M;  1Q3B A;  2KW0 A;  5KQ8 A;  5BR8 M;  2R6F A;  2DWN A;  4X65 M;  1X37 A;  1SXJ D;  4LZJ A;  2DAG A;  4JI2 M;  1R2Y A;  2CWB A;  3GLH B;  1TDZ A;  2ZBK B;  3TWK A;  3FKE A;  4HEO A;  4LY6 A;  4RF1 A;  1Z5A A;  2Q2E B;  3LW5 F;  1NY6 A;  4BBA A;  1UM8 A;  1IN5 A;  2KHH A;  2CRU A;  3HJ8 A;  4IBD A;  2EA0 A;  1L2B A;  3BOS A;  4IBI A;  2OPF A;  1KSF X;  1IXS B;  2KZS A;  2UUC M;  5BPV A;  2KNA A;  2R0I A;  3U61 A;  1HR0 M;  1SG9 A;  4XK8 F;  2ZAN A;  1QZM A;  3NBI A;  2LTU A;  4G4R A;  3U6Q A;  1VEK A;  3FUU A;  1VG5 A;  4LRS A;  1K3W A;  1G8P A;  1HQY E;  3GO8 A;  4DV4 M;  1OQY A;  1QAN A;  1I94 M;  3SYK A;  1XNR M;  1IQP A;  2GQF A;  4D80 A;  1N36 M;  2YFQ A;  3V76 A;  2Z4S A;  3T38 A;  2EJS A;  5E6J A;  3A98 B;  2JZ1 A;  7CAT A;  2K47 A;  3D8B A;  4G6Z A;  3GRU A;  1EIJ A;  2L09 A;  4RKU F;  2BJV A;  4JN6 A;  4M9S A;  4F1I A;  1N77 A;  2KNZ A;  3AOE C;  4IJF A;  4NRV A;  4LF7 M;  4JYA M;  2GNO A;  1R6B X;  2XFS A;  2DWL A;  4OVZ B;  4Z8X A;  3LVV A;  4GH9 A;  5EP4 A;  4NXN M;  3SMS A;  2VF8 A;  1HT1 E;  3FRH A;  1EE8 A;  4IIW A;  1WR1 B;  1MU5 A;  3BXW A;  2JZ0 A;  5FLX S;  3I01 M;  1R2Z A;  4FCW A;  2YNM D;  1GL7 A;  1XMO M;  3LCU A;  3GPY A;  4Y28 F;  5IRE B;  4DR5 M;  1YSY A;  4MGI E;  1HNX M;  2LVQ D;  3EIH A;  4PCZ A;  4L6V 6;  2D7G A;  1DGB A;  1HT2 E;  1QYR A;  3VDP A;  2DXI A;  4KHP M;  3HJS A;  4LF8 M;  4NC6 A;  2VDB B;  3W0F A;  3JR4 A;  4R7G A;  4LJ5 A;  3UMM A;  1T43 A;  4LCB A;  3VLF B;  4DV6 M;  1BVS A;  4AW4 A;  2J7N A;  1SXJ B;  2XEP A;  3KVW A;  2E5L M;  2XSZ D;  3GPU A;  2G3Q A;  4JI3 M;  1J7K A;  2ZTC A;  2WSC F;  2LHC A;  2M60 A;  3A45 A;  3FRI A;  2DAM A;  3GLF B;  3J80 S;  2L7H A;  2CHQ A;  4FWD A;  1GO5 A;  3K2L A;  3SAS A;  3I51 A;  4BB9 A;  2DZN B;  3TWL A;  3U6L A;  1G59 A;  5IWA M;  3HU1 A;  3HGI A;  1EFU B;  1PRB A;  3IEC A;  5KPR A;  4G4N A;  3GQ5 A;  1IN7 A;  1HNZ M;  1V33 A;  3PVS A;  3C3E A;  4LGM A;  4JV5 M;  3TL4 X;  3U6O A;  4LF9 M;  3TPZ A;  4DR7 M;  1E94 E;  1IBL M;  5KQD A;  1QUS A;  1TGU A;  2O25 A;  4JI0 M;  1XHB A;  1DGH B;  2VII A;  4IBC A;  4IBF A;  3HJQ A;  2UXD M;  1IY2 A;  5FTN A;  3R9X B;  3RFW A;  2WZJ A;  2F5N A;  3AOG A;  3C58 A;  3QYE A;  1IM2 A;  5FSW A;  1TTE A;  2KRK A;  3A42 A;  3JR5 A;  2BNK A;  3U6E A;  4W5W A;  4JI1 M;  2Y0T A;  4BLC A;  1WIV A;  4KOD A;  2LH0 A;  5IZ7 D;  2P5T A;  2JA2 A;  2C99 A;  5ITY A;  2G8L A;  1IY0 A;  4L4U A;  3R8F A;  4LFA M;  5LMN M;  2VQF M;  3QAU A;  4JI4 M;  3OTO M;  1LV7 A;  4LFC M;  3MMP A;  2MGW A;  1L1Z A;  2BWB A;  1JQJ C;  2RKO A;  1TH4 A;  4QHS A;  3GLG E;  3GRV A;  3VKG A;  2Z7J A;  1DO0 A;  4DUZ M;  4JI7 M;  3GLG B;  1KYI A;  1QUT A;  1WGL A;  1XXH A;  3HHZ A;  1L2C A;  2VF7 A;  3KOX E;  3W67 A;  5KPZ A;  3K92 A;  5KO3 A;  4DR1 M;  2EO2 A;  1VDD A;  1P3Q Q;  1VEJ A;  2OOB A;  1XWI A;  2DHR A;  1F4I A;  4PDI A;  3FYD A;  4B3M M;  4MM3 B;  3J27 B;  3KS4 A;  2DEN A;  4DV0 M;  3AOE A;  2LVN C;  3U6M A;  3ZCB B;  2V1C A;  3RGP A;  1QAO A;  1E9S A;  2JY6 B;  1IN6 A;  4HLQ A;  4LJ9 A;  1QDR A;  3L27 A;  1L2D A;  2UU9 M;  1TR8 A;  2J7O A;  4LG2 A;  1PGY A;  1IN4 A;  5DFL A;  1D0L A;  3RGS A;  2CHV A;  1NNJ A;  3HZJ A;  3UZU A;  5ITT A;  4DBG B;  3FTF A;  5L8R F;  3QWL A;  1XXH E;  4ANR A;  2Z3X A;  4A3V B;  3SBJ A;  4FWH A;  2YQZ A;  1N33 M;  2XFT A;  4I4L A;  3T1H M;  2H1R A;  2KRU A;  2QHO B;  4IBB A;  4FWG A;  1GL6 A;  3DOA A;  2EKF A;  1TH2 A;  3J7A S;  5IT9 S;  4AKI A;  3T6P A;  3FE3 A;  1R4G A;  4KLN A;  4MGY E;  3FTD A;  2A5Y B;  3AJI B;  3TQS A;  2R62 A;  4LRT A;  4LZZ A;  3U5Z B;  4OX9 M;  5C1B A;  4X64 M;  2D7E A;  3EIE A;  3FUX A;  3H4M A;  3CTW B;  2MJ5 B;  2QPA A;  2C96 A;  3ILK A;  5JI2 E;  1R7R A;  5EXT A;  3FYC A;  3GLI A;  4DUY M;  3GPX A;  3U6P A;  3A46 A;  2LVO C;  4M9Z A;  3KW6 A;  3SMP A;  4LJ6 A;  4DV5 M;  2I7P A;  4D81 A;  4NXM M;  2UUA M;  2Y20 A;  5H37 D;  1NNU C;  2Y0Q A;  4M0W A;  2L7I A;  2MRO B;  5A2Q S;  2J5Y A;  4B3S M;  2FFJ A;  2LBC A;  4KT0 F;  2JWS A;  3SHG B;  2DI0 A;  2R4J A;  4CIS A;  2HCB A;  4TUW A;  2I7N A;  1PJQ A;  3CF0 A;  1N78 A;  2LHG A;  3KP0 E;  3GQ3 A;  3U61 B;  2ZAM A;  4B08 A;  1IN8 A;  3KOY E;  3WHL A;  1K82 A;  3FTE A;  4AZF A;  2CFO A;  1WXQ A;  3J81 S;  4B7H A;  1NY5 A;  3HHW A;  4GRI A;  4Z6Y A;  2K9D A;  1Z5B A;  1FNN A;  3B74 A;  1Q02 A;  3KSX A;  2OQ4 A;  2XF3 A;  1WHC A;  1QAQ A;  2Y21 A;  1IBM M;  2HKJ A;  4DR4 M;  1N32 M;  3NBX X;  1CUK A;  1JB0 F;  1TDH A;  3AL0 C;  1E32 A;  3I4Y A;  1OAI A;  3UGJ A;  4OU7 A;  2CHG A;  1D0K A;  1YLA A;  1Z5C A;  5EP3 A;  3DZD A;  3FUT A;  3SYL A;  2R18 A;  2R44 A;  4LJ8 A;  1Y8G A;  2L2D A;  4Q7J A;  1A5T A;  2WSF F;  1W5S A;  3PXG A;  4PD2 A;  3WHK A;  2HHH M;  2HL7 A;  4AI6 A;  1NSF A;  2FE8 A;  4IBJ A;  3SAU A;  2JUJ A;  3LQQ A;  3JAM S;  3AV0 A;  3HU3 A;  2F5P A;  2G5G X;  1OAO C;  1S3S A;  5ITQ A;  2R45 A;  3CF6 E;  2F5Q A;  2QEN A;  2K0B X;  2KNV A;  4FVM A;  1QQW A;  4HL4 A;  3CF2 A;  4JI5 M;  4WUR A;  3J7B A;  5EJC A;  3PNY A;  4WW0 A;  4L8R C;  3HHX A;  3UJN A;  3UK6 A;  1G71 A;  2JP7 A;  4UN2 B;  2XH9 A;  3VKH A;  3L26 A;  3B89 A;  1PJS A;  2QBY A;  3K9P A;  2L4E A;  4P16 A;  3MHV C;  4NSO B;  2DAI A;  3KSJ A;  1J5E M;  1Z6T A;  1QVR A;  5EXX A;  1IXR C;  4LF4 M;  2Z8Y M;  3MJ5 A;  3HWS A;  5LMU M;  1HJP A;  2L6O A;  2X4A A;  3L29 A;  4X66 M;  4GEW A;  1SXJ C;  1Z59 A;  2BWE A;  5JI3 E;  4GIP A;  3E4R A;  5DYI A;  1VDL A;  1GJS A;  4FD2 A;  4GC5 A;  2DVW B;  3U6S A;  4GHL A;  3B9P A;  4RNA A;  1QDT A;  1J09 A;  4JXJ A;  5DNY A;  1OIP A;  3U60 A;  1W5T A;  1L1T A;  2HAK A;  2XZF A;  2N35 A;  1PJJ A;  1WJ7 A;  1ORY B;  1T3T A;  2JXN A;  5EP1 A;  3KFU G;  2W82 A;  4GKK M;  4REZ A;  1AUA A;  1I4W A;  4YHH M;  1GKI A;  2L4F A;  1DV0 A;  5ITR A;  4IBE A;  4DR2 M;  1G3I A;  2AHM A;  3PFI A;  3AKZ A;  4FCT A;  2OOA A;  3GLH A;  3FUV A;  2DKL A;  2X8A A;  4II7 A;  2QP9 X;  5EXP A;  3PNV A;  2QSF X;  4NOO B;  4MGH A;  4AKH A;  2CE7 A;  4I8O A;  1V34 A;  1OFI A;  3SAW A;  1NJG A;  2DZL A;  3K8Z A;  2DNA A;  4M0D A;  1PJI A;  8CAT A;  2YR0 A;  3J2P B;  1IXS A;  1DGG A;  1XXH B;  1D0M A;  2LXE A;  2B3T A;  2FOI C;  2ZAO A;  2QCU A;  3MK6 A;  2DWZ B;  5EXS A;  3Q8G A;  2H5X A;  3I4V A;  5DYG A;  3E9S A;  4G4Q A;  1PM5 A;  4DV7 M;  4L78 A;  4OW0 A;  2RRU A;  1XMQ M;  5GKN A;  3GRR A;  3LVW A;  4FCV A;  4GC9 A;  4GIT A;  4PT5 A;  1YUB A;  5ITX A;  3TE6 A;  3GLH E;  1GVN A;  1YE9 A;  2FNA A;  1QZE A;  5FTJ A;  2R46 A;  3ZQJ A;  4GKJ M;  1NV9 A;  5FTK A;  1D2N A;  2QZ4 A;  5FTM A;  4AKG A;  3U6D A;  3AFH A;  1XB2 B;  4GHA A;  3GRY A;  2LVP C;  1ZMV A;  3LMM A;  1IFY A;  3GP1 A;  3D8L A;  4OVZ A;  1MX0 A;  2R4E A;  1N75 A;  4L15 A;  3C9P A;  4G3O A;  1K3X A;  3QYB A;  2XZU A;  5E26 A;  1NVM A;  2EKK A;  4LJ4 A;  1DO2 A;  4NRW A;  2HWJ A;  2ZTD A;  3HX3 A;  2QNJ A;  4LF5 M;  1E9R A;  1H6U A;  4CHT B;  2C9O A;  4XBO A;  1TH3 A;  4AG6 A;  4QHT A;  5ITX E;  4G4O A;  1JR3 A;  2APL A;  4XGI A;  4QOZ C;  1VEG A;  4GMQ A;  1RU3 A;  4WP2 A;  3GLI E;  2VQE M;  3E46 A;  4DV3 M;  2OO9 A;  4EIW A;  5EP2 A;  2NQ8 C;  3GLI B;  3T1Y M;  1G4A E;  3KP1 E;  1KFV A;  3NWL A;  3IG5 A;  3GPP A;  4R71 A;  4DR6 M;  2UXC M;  1OFH A;  3CGW A;  3SHF A;  4QNR A;  1C1K A;  2D7H A;  3FTC A;  4R3D A;  3IG8 A;  3SAT A;  1SXJ A;  2RGH A;  4L16 A;  2UXB M;  4IBG A;  4ZPX A;  1NHG C;  3I04 M;  4CIZ A;  2MR9 A;  1C7Y A;  4ITQ A;  1FJG M;  5KPT A;  1ZAE A;  1XNQ M;  2X49 A;  1MN3 A;  3GLF A;  3SAR A;  3ZC7 B;  4FW9 A;  4I5S A;  3SFZ A;  1IBK M;  1AIP C;  1ZQ9 A;  1JR3 E;  3C3D A;  2CEA A;  3FD9 A;  3FUW A;  1IY1 A;  2CUZ A;  2CV2 A;  2DAK A;  3B7Q A;  4RF0 A;  1XC8 A;  2FH0 A;  1GJT A;  1NV8 A;  1N34 M;  1L8Q A;  1OJL A;  2R65 A;  2CV0 A;  1TF0 B;  1NHW C;  2JY8 A;  2JY5 A;  2BJW A;  1DGH A;  3HY5 A;  3L2A A;  4LJA A;  5ITU A;  3GQ4 A;  4PDG A;  2EUC A;  4LF6 M;  2MH8 A;  2LVA A;  1SXJ E;  4IJE A;  3B7N A;  4S12 A;  2DZO B;  4D82 A;  3KXE C;  3M0E A;  3U6C A;  1OIZ A;  3L25 A;  3Q8X A;  3M7G A;  1OTR A;  3GLF E;  3TWM A;  4LFB M;  4AQY M;  5F3W A;  2DWM A;  4B3T M;  2UUB M;  2QQ8 A;  3BBZ A;  4LGY A;  4CGY B;  3KS8 A;  2KZU A;  4QNM A;  4X62 M;  2CP8 A;  2XGN A;  1OKS A;  3VK7 A;  3GLG A;  3KDS E;  5FTL A;  3T15 A;  4MH0 E;  2DHY A;  1ZMW A;  2ERC A;  1G41 A;  3LQR A;  2CV1 A;  2F5S A;  3H4J A;  3HHY A;  1NO1 A;  4MGK E;  3HU2 A;  2LNH C;  3LCV B;  4MB7 A;  3W68 A;  2DAE A;  3VDU A;  2KEB A;  3THG A;  1VQ1 A;  2KDL A;  3RE8 A;  3DA1 A;  3VFD A;  3DFZ A;  2FS1 A;  1WGN A;  1Q3C A;  4IBK A;  2K6B A;  2LWX A;  3W0L B;  3VK8 A;  2JNH A;  2QBY B;  3IHP A;  1R5L A;  1Q39 A;  1DGF A;  1MJG M;  5EQT A;  1PJT A;  2O5R A;  4DR3 M;  2Z4R A;  1HNW M;  4JI8 M;  2RGO A;  2KA6 B;  4QOS A;  1IXZ A;  2WSE F; 
#chains in the Genus database with same CATH homology
 1QAM A;  3L28 A;  4JI6 M;  4K0K M;  3KOZ E;  2F4V M;  1NJF A;  2XSZ A;  4NL4 H;  4MGZ E;  4NSR A;  2C98 A;  5C18 A;  1GLN A;  3M6A A;  2C9C A;  3SC3 A;  4I81 A;  3HKP A;  4KO8 A;  2M5Z A;  4M9X A;  2C5R A;  1HQC A;  2V6Z M;  1JR3 D;  4B7F A;  3U60 B;  4B3R M;  4AG5 A;  2F5O A;  2KXE A;  4YY3 M;  3U5Z A;  3KOW E;  4DV1 M;  3K1J A;  2ZM6 M;  3ZH9 B;  4B7G A;  2V1U A;  2XLJ A;  4LJ7 A;  3SAV A;  4DV2 M;  1Q3B A;  2KW0 A;  5KQ8 A;  5BR8 M;  2DWN A;  4X65 M;  1X37 A;  1SXJ D;  4LZJ A;  4JI2 M;  1R2Y A;  3GLH B;  1TDZ A;  2ZBK B;  3TWK A;  3FKE A;  4LY6 A;  4RF1 A;  1Z5A A;  2Q2E B;  1NY6 A;  4BBA A;  1UM8 A;  1IN5 A;  3HJ8 A;  4IBD A;  2EA0 A;  1L2B A;  3BOS A;  4IBI A;  2OPF A;  1KSF X;  1IXS B;  2KZS A;  2UUC M;  5BPV A;  3U61 A;  1HR0 M;  2ZAN A;  1QZM A;  3NBI A;  4G4R A;  3U6Q A;  3FUU A;  4LRS A;  1K3W A;  1G8P A;  1HQY E;  3GO8 A;  4DV4 M;  1QAN A;  1I94 M;  3SYK A;  1XNR M;  1IQP A;  4D80 A;  1N36 M;  2YFQ A;  2Z4S A;  3T38 A;  5E6J A;  3A98 B;  7CAT A;  2K47 A;  3D8B A;  4G6Z A;  3GRU A;  2L09 A;  2BJV A;  4JN6 A;  4M9S A;  1N77 A;  4LF7 M;  4NRV A;  3AOE C;  4IJF A;  4JYA M;  1R6B X;  2XFS A;  2DWL A;  4OVZ B;  4Z8X A;  3LVV A;  4GH9 A;  5EP4 A;  4NXN M;  3SMS A;  1HT1 E;  4IIW A;  1EE8 A;  1MU5 A;  5FLX S;  1R2Z A;  4FCW A;  2YNM D;  1GL7 A;  1XMO M;  3GPY A;  5IRE B;  4DR5 M;  1YSY A;  4MGI E;  1HNX M;  3EIH A;  4PCZ A;  2DXI A;  2D7G A;  1DGB A;  1HT2 E;  1QYR A;  3VDP A;  4KHP M;  3HJS A;  4LF8 M;  3W0F A;  3JR4 A;  4R7G A;  4LJ5 A;  3UMM A;  4LCB A;  3VLF B;  4DV6 M;  4AW4 A;  2J7N A;  1SXJ B;  2XEP A;  3KVW A;  2E5L M;  2XSZ D;  3GPU A;  4JI3 M;  1J7K A;  2M60 A;  3A45 A;  3GLF B;  3J80 S;  2L7H A;  2CHQ A;  4FWD A;  3K2L A;  3SAS A;  3I51 A;  4BB9 A;  2DZN B;  3TWL A;  3U6L A;  1G59 A;  5IWA M;  3HU1 A;  3HGI A;  4G4N A;  5KPR A;  1HNZ M;  3GQ5 A;  1IN7 A;  3PVS A;  4LGM A;  4JV5 M;  3TL4 X;  3U6O A;  4LF9 M;  3TPZ A;  4DR7 M;  1E94 E;  1IBL M;  5KQD A;  1TGU A;  4JI0 M;  1XHB A;  1DGH B;  2VII A;  4IBC A;  4IBF A;  3HJQ A;  2UXD M;  1IY2 A;  5FTN A;  3R9X B;  3RFW A;  2F5N A;  3AOG A;  3C58 A;  1IM2 A;  5FSW A;  2KRK A;  3A42 A;  3JR5 A;  2BNK A;  3U6E A;  4W5W A;  4JI1 M;  2Y0T A;  4BLC A;  4KOD A;  2LH0 A;  5IZ7 D;  2P5T A;  2JA2 A;  2C99 A;  5ITY A;  2G8L A;  1IY0 A;  4L4U A;  3R8F A;  4LFA M;  5LMN M;  2VQF M;  3QAU A;  4JI4 M;  3OTO M;  1LV7 A;  4LFC M;  1L1Z A;  2RKO A;  1JQJ C;  4QHS A;  1TH4 A;  3GRV A;  3VKG A;  2Z7J A;  1DO0 A;  4DUZ M;  4JI7 M;  3GLG B;  1KYI A;  3HHZ A;  1XXH A;  1L2C A;  3KOX E;  5KPZ A;  3K92 A;  5KO3 A;  4DR1 M;  2EO2 A;  1VDD A;  1XWI A;  2DHR A;  4PDI A;  3FYD A;  4B3M M;  4MM3 B;  3J27 B;  3KS4 A;  4DV0 M;  3AOE A;  3U6M A;  3ZCB B;  2V1C A;  3RGP A;  1QAO A;  1E9S A;  4HLQ A;  1IN6 A;  4LJ9 A;  1L2D A;  3L27 A;  2UU9 M;  2J7O A;  4LG2 A;  1IN4 A;  3RGS A;  2CHV A;  1NNJ A;  3UZU A;  5ITT A;  3FTF A;  3QWL A;  2Z3X A;  3SBJ A;  4A3V B;  4FWH A;  2YQZ A;  1N33 M;  2XFT A;  4I4L A;  3T1H M;  2H1R A;  2KRU A;  4IBB A;  4FWG A;  1GL6 A;  3DOA A;  5IT9 S;  1TH2 A;  3J7A S;  4AKI A;  4KLN A;  4MGY E;  3FTD A;  2A5Y B;  3AJI B;  3TQS A;  2R62 A;  4LRT A;  4LZZ A;  3U5Z B;  4OX9 M;  5C1B A;  4X64 M;  2D7E A;  3EIE A;  3FUX A;  3H4M A;  3CTW B;  2QPA A;  2C96 A;  3ILK A;  5JI2 E;  1R7R A;  5EXT A;  3FYC A;  3GLI A;  4DUY M;  3GPX A;  3U6P A;  3A46 A;  4M9Z A;  3KW6 A;  3SMP A;  4LJ6 A;  4DV5 M;  2I7P A;  4D81 A;  4NXM M;  2UUA M;  2Y20 A;  5H37 D;  1NNU C;  2Y0Q A;  4M0W A;  2L7I A;  5A2Q S;  4B3S M;  2FFJ A;  3SHG B;  2R4J A;  4CIS A;  2HCB A;  4TUW A;  2I7N A;  3CF0 A;  1N78 A;  3KP0 E;  3GQ3 A;  3U61 B;  2ZAM A;  4B08 A;  1IN8 A;  3KOY E;  3WHL A;  1K82 A;  3FTE A;  4AZF A;  2CFO A;  1WXQ A;  3J81 S;  4B7H A;  1NY5 A;  3HHW A;  4GRI A;  4Z6Y A;  1Z5B A;  1FNN A;  3KSX A;  2OQ4 A;  1IBM M;  2XF3 A;  2Y21 A;  1QAQ A;  2HKJ A;  4DR4 M;  1N32 M;  1TDH A;  3AL0 C;  1E32 A;  3I4Y A;  3UGJ A;  4OU7 A;  2CHG A;  1Z5C A;  5EP3 A;  3DZD A;  3FUT A;  3SYL A;  2R18 A;  4LJ8 A;  3PXG A;  1W5S A;  2HHH M;  4PD2 A;  3WHK A;  2HL7 A;  4AI6 A;  1NSF A;  2FE8 A;  4IBJ A;  3SAU A;  3LQQ A;  3JAM S;  3AV0 A;  3HU3 A;  2F5P A;  2G5G X;  1S3S A;  5ITQ A;  2R45 A;  3CF6 E;  2F5Q A;  2QEN A;  4FVM A;  1QQW A;  4HL4 A;  3CF2 A;  4JI5 M;  4WUR A;  3J7B A;  5EJC A;  3PNY A;  4WW0 A;  4L8R C;  3HHX A;  3UJN A;  3UK6 A;  2XH9 A;  3VKH A;  3L26 A;  2QBY A;  4P16 A;  3MHV C;  4NSO B;  3KSJ A;  1J5E M;  1Z6T A;  1QVR A;  5EXX A;  1IXR C;  4LF4 M;  3MJ5 A;  3HWS A;  5LMU M;  3L29 A;  2L6O A;  2X4A A;  4X66 M;  5JI3 E;  1SXJ C;  1Z59 A;  4GIP A;  3E4R A;  5DYI A;  4FD2 A;  4GC5 A;  2DVW B;  3U6S A;  4GHL A;  3B9P A;  4RNA A;  4JXJ A;  1J09 A;  5DNY A;  3U60 A;  1W5T A;  1L1T A;  2XZF A;  1PJJ A;  1ORY B;  1T3T A;  5EP1 A;  3KFU G;  2W82 A;  4GKK M;  4REZ A;  4YHH M;  1I4W A;  1GKI A;  5ITR A;  4IBE A;  4DR2 M;  1G3I A;  2AHM A;  3PFI A;  3AKZ A;  4FCT A;  3GLH A;  3FUV A;  2X8A A;  4II7 A;  2QP9 X;  5EXP A;  3PNV A;  4NOO B;  4MGH A;  4AKH A;  2CE7 A;  4I8O A;  1OFI A;  3SAW A;  1NJG A;  3K8Z A;  4M0D A;  1PJI A;  8CAT A;  2YR0 A;  3J2P B;  2ZAO A;  1DGG A;  1XXH B;  2FOI C;  2LXE A;  3MK6 A;  2QCU A;  2DWZ B;  5EXS A;  3I4V A;  5DYG A;  3E9S A;  4G4Q A;  1PM5 A;  4DV7 M;  4L78 A;  4OW0 A;  1XMQ M;  5GKN A;  3GRR A;  3LVW A;  4FCV A;  4GC9 A;  4GIT A;  4PT5 A;  1YUB A;  5ITX A;  3TE6 A;  1GVN A;  1YE9 A;  2FNA A;  5FTJ A;  2R46 A;  4GKJ M;  5FTK A;  1D2N A;  2QZ4 A;  5FTM A;  4AKG A;  3U6D A;  3AFH A;  4GHA A;  3GRY A;  3LMM A;  3GP1 A;  3D8L A;  4OVZ A;  1MX0 A;  2R4E A;  1N75 A;  4L15 A;  1K3X A;  2XZU A;  5E26 A;  1NVM A;  4LJ4 A;  1DO2 A;  4NRW A;  4LF5 M;  1E9R A;  1H6U A;  4CHT B;  2C9O A;  4XBO A;  1TH3 A;  4AG6 A;  4QHT A;  5ITX E;  4G4O A;  1JR3 A;  4XGI A;  4QOZ C;  4GMQ A;  4DV3 M;  2VQE M;  4EIW A;  5EP2 A;  2NQ8 C;  3GLI B;  3T1Y M;  1G4A E;  3KP1 E;  1KFV A;  3NWL A;  3IG5 A;  3GPP A;  4DR6 M;  2UXC M;  1OFH A;  3SHF A;  4QNR A;  1C1K A;  2D7H A;  3FTC A;  4R3D A;  3IG8 A;  3SAT A;  1SXJ A;  2RGH A;  4L16 A;  2UXB M;  4IBG A;  4ZPX A;  1NHG C;  4ITQ A;  1FJG M;  5KPT A;  1ZAE A;  1XNQ M;  2X49 A;  3GLF A;  3SAR A;  3ZC7 B;  4FW9 A;  4I5S A;  3SFZ A;  1IBK M;  1ZQ9 A;  3FUW A;  2CEA A;  3FD9 A;  2CV2 A;  1IY1 A;  2CUZ A;  4RF0 A;  1XC8 A;  1N34 M;  1L8Q A;  1OJL A;  2R65 A;  2CV0 A;  1NHW C;  2BJW A;  1DGH A;  3L2A A;  4LJA A;  5ITU A;  3GQ4 A;  4PDG A;  2EUC A;  4LF6 M;  1SXJ E;  4IJE A;  4S12 A;  2DZO B;  4D82 A;  3KXE C;  3M0E A;  3U6C A;  3L25 A;  3Q8X A;  3M7G A;  3TWM A;  4LFB M;  4AQY M;  5F3W A;  2DWM A;  4B3T M;  2UUB M;  4LGY A;  4CGY B;  3KS8 A;  2KZU A;  4QNM A;  4X62 M;  2XGN A;  3VK7 A;  3GLG A;  3KDS E;  5FTL A;  3T15 A;  4MH0 E;  2ERC A;  1G41 A;  3LQR A;  2CV1 A;  2F5S A;  3HHY A;  4MGK E;  3HU2 A;  2LNH C;  4MB7 A;  3VDU A;  2KEB A;  3THG A;  3RE8 A;  3VFD A;  3DA1 A;  3DFZ A;  1Q3C A;  4IBK A;  2LWX A;  3VK8 A;  3W0L B;  2QBY B;  1Q39 A;  1DGF A;  5EQT A;  4DR3 M;  2O5R A;  1HNW M;  2Z4R A;  4JI8 M;  2RGO A;  2KA6 B;  4QOS A;  1IXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...