4DUYM

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4duyM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4duyM02
4LFAM 2OPFA 1K3WA 3W0FA 4PD2A 4GKJM 2F5SA 3OTOM 4DR1M 3GQ4A 3J80S 3A42A 3U6SA 5ITUA 1MX0A 2XZUA 3SARA 4DR6M 3U6MA 1HNXM 5BR8M 2VQEM 4KHPM 4B3SM 4B3MM 1N32M 3SAVA 1HR0M 3GQ3A 4DR5M 3VK8A 1IBLM 1L2CA 4LFBM 1Z5AA 5ITXA 4GKKM 2Q2EB 4DV4M 3A46A 1Z5CA 5ITYA 3U6EA 4ITQA 4LF5M 1R2YA 3JAMS 5IWAM 2F5NA 2UXDM 4LF7M 1TDHA 1R2ZA 1XMOM 1FJGM 4JI1M 1L1TA 1IBMM 4NRVA 2F4VM 1IBKM 1N33M 5ITXE 4G4QA 4YY3M 4G4RA 4LF6M 1EE8A 1HNWM 3GPPA 4LFCM 1PM5A 4JI5M 4X62M 1N36M 4DR7M 4DR4M 3U6DA 3GP1A 3T1HM 4YHHM 4JYAM 3DOAA 4NRWA 3GO8A 4B3RM 1XNRM 4JI8M 3T1YM 1K82A 4DV3M 2OQ4A 4X64M 4PDIA 5ITRA 2E5LM 1Z5BA 3JR4A 4DUYM 3J7AS 1MU5A 3GPXA 4NXNM 2UUAM 3TWLA 1Q3BA 4PDGA 3U6CA 3GPYA 2HHHM 3SASA 4JI7M 4DV7M 1J5EM 1KFVA 3TWMA 3SAUA 4DV0M 4DV1M 3J81S 1N34M 4JI6M 1Z59A 3JR5A 4G4NA 1XC8A 2UUBM 5ITQA 2ZM6M 4NXMM 5LMNM 4DUZM 1I94M 4DR3M 2EA0A 4LF4M 4JV5M 4X66M 3U6QA 3C58A 2XZFA 4OX9M 4JI3M 2UXBM 3SBJA 4LF9M 3GQ5A 3TWKA 3U6OA 5A2QS 1NNJA 4JI4M 3GPUA 1PJJA 4DV6M 5FLXS 1PJIA 2F5OA 2HKJA 4AQYM 3U6PA 3VK7A 2VQFM 2UUCM 3U6LA 4DR2M 3SATA 1Q3CA 2UXCM 4JI0M 4X65M 4K0KM 1HNZM 4G4OA 2UU9M 1XMQM 4LF8M 3SAWA 4B3TM 1TDZA 2ZBKB 1L2DA 2F5QA 1L2BA 1XNQM 1L1ZA 3A45A 4MB7A 4DV2M 5IT9S 4CISA 4DV5M 2F5PA 1Q39A 4PCZA 4JI2M 5LMUM 1K3XA 5ITTA
chains in the Genus database with same CATH superfamily
3HHWA 2DWMA 2EKKA 2H1RA 5FTLA 2OPFA 1V33A 2ZTDA 3K8ZA 3KSXA 3MHVC 1E32A 2BJVA 3PNYA 2XEPA 3ZC7B 4MGKE 1MX0A 4NOOB 2XZUA 2Z3XA 2XGNA 1OTRA 2YR0A 4OVZA 5EXXA 3K9OA 3M0EA 4B3SM 3PNVA 5EP3A 4ANRA 3SAVA 3UZUA 3H4JA 3GQ3A 1JB0F 2G3QA 3UMMA 1IN4A 3HZJA 2DHRA 1L2CA 4KT0F 1OFIA 3HU3A 4FVMA 4Z6YA 5ITYA 4CGYB 1P3QQ 3AOEC 4CHTB 2JZ0A 3K2LA 3GLIE 4D80A 3J7BA 2FE8A 1L8QA 3WHKA 2QBYB 1QAOA 4G6ZA 4R7GA 4B7GA 1R2ZA 2O01F 1MJGM 3W67A 3RGSA 3AFHA 2JY5A 1L1TA 2VIIA 2F4VM 3IHPA 1N77A 1V92A 3LW5F 1QDRA 3FRHA 1WR1B 4YY3M 4XBOA 4G4RA 1GABA 4LJ4A 1JR3E 1GL6A 1N36M 1PJSA 4DR4M 4DR7M 3LCUA 2KXEA 2WSEF 3L26A 2Y0TA 3BOSA 3SYKA 3F92A 3AOEA 3FYDA 1IFYA 4A3VB 5JI3E 3NWLA 1IY2A 1PRBA 3L29A 2Y20A 1TR8A 3IG5A 1SXJA 1NO1A 1XNRM 4L78A 1K82A 5F3WA 1GL7A 5IZ7D 1G41A 3VFDA 2BJWA 4LRSA 1NVMA 2HCBA 2E5LM 3RGPA 1Z5BA 4I8OA 3FTDA 2R46A 4DUYM 3J7AS 3L2AA 4I81A 1D0MA 1OIZA 1C1KA 2CE7A 1JR3D 2YFQA 3LQQA 2V6ZM 1Q3BA 3TWLA 2HHHM 4JI7M 2DWNA 4GEWA 2JUJA 4FD2A 2KNVA 1SXJE 4KODA 3UJNA 4DV1M 2Z4SA 2Z8YM 4FCVA 1EFUB 3Q8XA 4CIZA 3HHYA 2ZM6M 3U6SA 5LMNM 2JP7A 1OFHA 2DXIA 3U6QA 3KOYE 3U5ZA 3UK6A 2C5RA 2L4EA 2FOIC 3HHXA 2XF3A 3QYEA 1VDDA 4FWGA 3V76A 3GPUA 1D0KA 3HY5A 3TQSA 4LZZA 2ZTCA 2EJSA 3VK7A 2VQFM 2RKOA 3KOZE 4IBBA 3U61B 2CWBA 2EO2A 3CGWA 2EUCA 2L7HA 4G4OA 1PGYA 2R4EA 1LV7A 1ZMUA 2X4AA 3AOGA 2KHHA 3KVWA 3VDUA 1XXHA 2KNZA 4RF0A 1L2BA 1Q02A 4DV2M 2K6BA 1Q39A 3D8BA 3T15A 1K3XA 2D7GA 2RGOA 4M9ZA 5DYGA 5FTJA 1GVNA 3J27B 3OTOM 3SYLA 3HHZA 3J80S 2L7IA 1QUTA 5ITUA 2MJ5B 1JR3A 2G5GX 4IBCA 3NBIA 4UN2B 3T6PA 1IY0A 1XHBA 1XXHE 3SMPA 2XFSA 5BR8M 3R9XB 4KHPM 2MROB 1IXRC 4B3MM 3VK8A 1WGLA 4LRTA 2LHGA 4TUWA 1T43A 4BB9A 1VEGA 1TGUA 1YUBA 3DZDA 2H5XA 3FUXA 4GKKM 2Q2EB 2WSFF 3MJ5A 2CP8A 3E46A 1Z5CA 3NBXX 4BLCA 4DV4M 1NY5A 2GQFA 1G71A 2OOBA 3ZCBB 4OVZB 2HL7A 4MGHA 4FWDA 3AL0C 3GLFA 1NV8A 3JAMS 2YNMD 4LY6A 3VDPA 2OO9A 4NSRA 3E9SA 1QYRA 4LGMA 1EIJA 4P17A 1IBKM 3U61A 2KNAA 1N33M 2QSFX 4G4QA 1WXQA 7CATA 3LCVB 1UFZA 4LF6M 4LFCM 3Q8GA 2LTUA 1PM5A 2FH0A 4HLQA 2KZSA 4LGYA 3KXEC 3FTCA 3TPZA 2R0IA 3FRIA 2BNKA 4IBFA 3IECA 4QHTA 3TL4X 3GLGB 4MGIE 2DNAA 3CF6E 3KOWE 4YHHM 1SG9A 2JNHA 2C96A 1MN3A 1WIVA 3DOAA 4GHLA 2W82A 3T1YM 1J7KA 3I4VA 2CV1A 2QPAA 4WP2A 5KPTA 4DBGB 2A5YB 2Y21A 5DFLA 4AZFA 3JR4A 4S12A 3GPXA 2O5RA 2DAIA 1KYIA 2Z4RA 2UUAM 2WSCF 3SASA 1KFVA 2FFJA 4DV0M 3SC3A 3J81S 1IN5A 4JI6M 3HGIA 1Z59A 1T3TA 5KQDA 3JR5A 3GLHE 1VQ1A 4F1IA 2DAMA 3VKGA 1IXSB 2DWLA 1T6OA 5ITQA 2UUBM 1VEKA 3K92A 1SXJB 1I94M 1UM8A 4DR3M 4JV5M 3EIEA 1DGGA 1YE9A 1IN6A 1PJQA 3C3EA 3GLFE 3HJ8A 4FW9A 2LH0A 2LXEA 2DHYA 2XZFA 2KEBA 2XSZA 3SBJA 3UGJA 4MGYE 2DWZB 3U6OA 2QQ8A 3GRUA 1NNJA 2R65A 2DZOB 2LNHC 1HNWM 2R45A 3KP1E 1NJGA 2LWXA 5EP1A 5FTNA 4AQYM 5E6JA 2C98A 3I51A 1TH2A 3SATA 2WZJA 4MH0E 5GKNA 1A5TA 1QAQA 3B89A 4LZJA 1DO2A 4JI0M 5DNYA 4X65M 2L09A 1HNZM 4NL4H 4GC5A 4LF8M 1J09A 1SXJC 1Y8GA 3BBZA 5EJCA 4B3TM 2ZBKB 2DZLA 5KO3A 4I5SA 2F5QA 4HEOA 2ZAOA 1R7RA 2LVOC 5FTKA 5H37D 2CHQA 2MH8A 2QNJA 4AW4A 4GITA 2F5PA 4JI2M 2KW0A 1YSYA 5LMUM 1OIPA 4IBEA 1K3WA 3L28A 3FD9A 4GHAA 1IQPA 1TF0B 1G4AE 1I4WA 4PD2A 1GJTA 2XFTA 4FCWA 1DO0A 5IREB 4LCBA 3GQ4A 1QZMA 1LTMA 4DR1M 2AHMA 3A42A 3KP0E 4IJEA 4NSOB 1IN8A 5DYIA 1IY1A 3SHGB 3U6MA 2VQEM 4ZPXA 5KPZA 3KDSE 1SXJD 3C3DA 1HR0M 1R4GA 2Z7JA 1XXHB 2CUZA 3FUUA 1IM2A 2JWSA 1GLNA 1NSFA 2M5ZA 3M6AA 4IBKA 3IG8A 4PT5A 2X49A 1Z5AA 2Y0QA 5ITXA 3GLIA 3E4RA 4REZA 3VKHA 4XK8F 2K0BX 4R71A 3GLHB 3FYCA 1W5TA 4NC6A 4GIPA 4LF5M 2P5TA 2BWBA 1R2YA 4LJ5A 1CUKA 4IBJA 3A98B 5C1BA 4LF7M 1TDHA 2V1CA 2VDBB 4QOZC 4QOSA 5BPVA 2JY6B 3U6DA 4JI1M 4M9XA 4NRVA 1JQJC 3H4MA 1IXSA 4FCTA 2KZUA 5ITXE 3LQRA 5E26A 5EXSA 1DV0A 4AKHA 1WGNA 1NJFA 4M9SA 4I4LA 2DENA 4IBDA 3GP1A 1S3SA 1ORYB 2VF7A 2MR9A 2LVNC 3T1HM 1QAMA 4GMQA 4P16A 4JI8M 1NY6A 4AKGA 4B7HA 3KSJA 2XSZD 3M7GA 1YLAA 4DV3M 3B7ZA 2OQ4A 1E9SA 4PDIA 4IBGA 3HU1A 4WURA 4D81A 2CRUA 3FKEA 2QZ4A 3R8FA 1MU5A 4LJ9A 2VF8A 4NXNM 3SHFA 1C7YA 1XB2B 3K1JA 1OAOC 2R6FA 4FWHA 4L6V6 2RGHA 2N35A 3CTWB 1QDTA 3I01M 4KO8A 4F2LA 4PDGA 3GPYA 4DV7M 1J5EM 2D7EA 2C99A 3LVWA 4LJ7A 1RU3A 3HJQA 4Y28F 3K9PA 1D0LA 3HWSA 2CEAA 4II7A 3KFUG 2I7PA 4NXMM 1R6BX 4R3DA 2CV0A 2JZ1A 1NHWC 3GLIB 3FUWA 1HT1E 2HAKA 1HT2E 4RKUF 1F4IA 2OOAA 3D8LA 4GRIA 1AUAA 2NQ8C 4D82A 4JI3M 4Q7JA 4OX9M 2UXBM 5KPRA 3W68A 3QWLA 5JI2E 3GQ5A 3QAUA 2ERCA 4LJ6A 5FTMA 3AV0A 1VDLA 5FLXS 1OJLA 2DAKA 2JY7A 2HKJA 4DV6M 2ZANA 3B7NA 1OKSA 2D7HA 1NNUC 4L4UA 4DR2M 1Q3CA 2LHCA 3U6LA 4WW0A 4K0KM 1G3IA 3WHLA 3ZH9B 3PVSA 4L16A 1QVRA 4AKIA 4M0WA 4QNRA 2DZNB 1FNNA 1TDZA 1L2DA 2QBYA 4L8RC 1X37A 5EXPA 4KLNA 1G59A 2XH9A 4LG2A 3GRYA 4AG6A 1L1ZA 1KSFX 3A45A 4MB7A 5IT9S 3W0LB 4CISA 3ILKA 4G3OA 4DV5M 3E21A 1D2NA 3B74A 4B08A 5ITTA 1XNQM 4LFAM 4GC9A 3ZQJA 4XGIA 5EXTA 3W0FA 4GKJM 2F5SA 4BBAA 4HL4A 2L2DA 3KOXE 1AIPC 2LBCA 1OAIA 2DAEA 3SARA 4DR6M 3KS4A 1HNXM 2DAGA 3KS8A 3RFWA 3GLGE 1N78A 1HJPA 2K47A 3FE3A 4JN6A 1N32M 1NV9A 4DR5M 2YQZA 1IBLM 3SMSA 4IJFA 2QP9X 4IBIA 1QZEA 3MK6A 4LFBM 5EQTA 3SFZA 1ZMWA 1OQYA 1V34A 3A46A 2L6OA 3U6EA 4ITQA 1R5LA 4B7FA 4LJ8A 2DKLA 4AG5A 4QNMA 2JA2A 4QHSA 2K9DA 3VLFB 2ZAMA 1DGBA 1G8PA 5IWAM 3LVVA 8CATA 2F5NA 2UXDM 2DVWB 2CHVA 1XMOM 1FJGM 3GRRA 2C9OA 1IBMM 3AJIB 1NHGC 1TTEA 2J7NA 3GRVA 4EIWA 1GO5A 2R4JA 2J5YA 2QENA 1EE8A 3U5ZB 3GPPA 3HU2A 2KDLA 2M60A 4L15A 4X62M 4JI5M 2KRUA 2QHOB 3BXWA 3I04M 5EP4A 3GLFB 2B3TA 2LVAA 4MM3B 2X8AA 5FSWA 1IXZA 3J2PB 3HKPA 4GH9A 1TH3A 1IN7A 2DI0A 4JYAM 1WHCA 3PFIA 4W5WA 3FUVA 3DFZA 2G8LA 4NRWA 2J7OA 3GO8A 2V1UA 4B3RM 4M0DA 5EP2A 2FNAA 1BVSA 2CFOA 3U60B 2BWEA 1E9RA 2LVPC 3L27A 1N75A 3I4YA 4X64M 3AKZA 1WJ7A 3FUTA 5ITRA 1ZQ9A 1PJTA 4LJAA 3T38A 4OW0A 3FTEA 1Z6TA 2MGWA 2R44A 2R18A 2CHGA 4CJ6A 3GLGA 1DGHB 1GJSA 2O25A 1ZAEA 1W5SA 1HQYE 3QYBA 3U6CA 1VEJA 1DGHA 2KRKA 3TE6A 2CV2A 5KQ8A 3TWMA 3SAUA 1QANA 1N34M 1TH4A 4Z8XA 4OU7A 3U60A 3MMPA 4G4NA 4AI6A 1XC8A 1VG5A 3B9PA 3B7QA 3C9PA 3HX3A 4DUZM 3HJSA 4IIWA 2KA6B 2EA0A 2C9CA 4LF4M 2LVQD 4X66M 2XLJA 5C18A 2HWJA 3C58A 1E94E 1QUSA 3RE8A 1XWIA 3THGA 3FTFA 1ZMVA 4LF9M 1GKIA 3EIHA 3TWKA 5A2QS 3CF0A 4JI4M 1PJJA 4RNAA 1PJIA 1HQCA 2APLA 2QCUA 2F5OA 2GNOA 3LMMA 3U6PA 1QQWA 2UUCM 2L4FA 2R62A 2UXCM 2I7NA 2JXNA 3KW6A 1DGFA 4JXJA 2UU9M 1XMQM 2EKFA 4RF1A 3PXGA 3SAWA 2RRUA 2JY8A 5L8RF 3GLHA 1ZV1A 2FS1A 3DA1A 4PCZA 4MGZE 3CF2A 1H6UA 3L25A
chains in the Genus database with same CATH topology
3HHWA 2DWMA 2H1RA 5FTLA 2OPFA 3K8ZA 3KSXA 3MHVC 1E32A 2BJVA 3PNYA 2XEPA 3ZC7B 4MGKE 1MX0A 4NOOB 2XZUA 2Z3XA 2XGNA 2YR0A 4OVZA 5EXXA 3M0EA 4B3SM 3PNVA 5EP3A 3SAVA 3UZUA 3GQ3A 3UMMA 1IN4A 2DHRA 1L2CA 1OFIA 3HU3A 4FVMA 4Z6YA 5ITYA 4CGYB 3AOEC 4CHTB 3K2LA 4D80A 3J7BA 2FE8A 1L8QA 3WHKA 2QBYB 1QAOA 4G6ZA 4R7GA 4B7GA 1R2ZA 3RGSA 3AFHA 1L1TA 2VIIA 2F4VM 1N77A 4YY3M 4G4RA 4XBOA 4LJ4A 1GL6A 1N36M 4DR7M 4DR4M 2KXEA 3L26A 2Y0TA 3BOSA 3SYKA 3AOEA 3FYDA 4A3VB 5JI3E 3NWLA 1IY2A 3L29A 2Y20A 3IG5A 1SXJA 1XNRM 4L78A 1K82A 5F3WA 1GL7A 5IZ7D 1G41A 3VFDA 2BJWA 4LRSA 1NVMA 2HCBA 2E5LM 3RGPA 1Z5BA 4I8OA 3FTDA 2R46A 4DUYM 3J7AS 3L2AA 4I81A 1C1KA 2CE7A 1JR3D 2YFQA 3LQQA 2V6ZM 1Q3BA 3TWLA 2HHHM 4JI7M 2DWNA 4FD2A 4KODA 1SXJE 3UJNA 4DV1M 2Z4SA 4FCVA 3Q8XA 3HHYA 2ZM6M 5LMNM 1OFHA 2DXIA 3U6QA 3KOYE 3U5ZA 3UK6A 2C5RA 2FOIC 3HHXA 2XF3A 1VDDA 4FWGA 3GPUA 3TQSA 4LZZA 3VK7A 2VQFM 3KOZE 2RKOA 4IBBA 3U61B 2EO2A 2EUCA 2L7HA 4G4OA 2R4EA 1LV7A 2X4AA 3AOGA 3KVWA 3VDUA 1XXHA 4RF0A 1L2BA 4DV2M 1Q39A 3D8BA 3T15A 1K3XA 2D7GA 2RGOA 4M9ZA 5DYGA 5FTJA 1GVNA 3J27B 3OTOM 3SYLA 3HHZA 3J80S 2L7IA 5ITUA 1JR3A 2G5GX 4IBCA 3NBIA 1IY0A 1XHBA 3SMPA 5BR8M 2XFSA 3R9XB 4KHPM 1IXRC 4B3MM 3VK8A 4LRTA 4TUWA 4BB9A 1TGUA 1YUBA 3DZDA 3FUXA 4GKKM 2Q2EB 3MJ5A 4BLCA 4DV4M 1Z5CA 1NY5A 3ZCBB 4OVZB 2HL7A 4MGHA 4FWDA 3AL0C 3GLFA 3JAMS 2YNMD 4LY6A 3VDPA 4NSRA 3E9SA 1QYRA 4LGMA 1IBKM 3U61A 1N33M 4G4QA 1WXQA 7CATA 4LF6M 1HNWM 4LFCM 1PM5A 4HLQA 2KZSA 4LGYA 3KXEC 3FTCA 3TPZA 2BNKA 4IBFA 4QHTA 3TL4X 3GLGB 4MGIE 3CF6E 3KOWE 4YHHM 2C96A 3DOAA 4GHLA 2W82A 3T1YM 1J7KA 3I4VA 2CV1A 2QPAA 5KPTA 2A5YB 2Y21A 4AZFA 3JR4A 4S12A 3GPXA 2O5RA 1KYIA 2Z4RA 2UUAM 3SASA 1KFVA 2FFJA 4DV0M 3SC3A 3J81S 1IN5A 4JI6M 3HGIA 1Z59A 1T3TA 5KQDA 3JR5A 3VKGA 1IXSB 2UUBM 5ITQA 3K92A 1SXJB 1I94M 1UM8A 4DR3M 4JV5M 3EIEA 1DGGA 1YE9A 1IN6A 3HJ8A 4FW9A 2LH0A 2LXEA 2XZFA 2KEBA 2XSZA 3SBJA 3UGJA 4MGYE 2DWZB 3U6OA 3GRUA 1NNJA 2R65A 2DZOB 2LNHC 2R45A 3KP1E 1NJGA 2LWXA 5EP1A 5FTNA 4AQYM 5E6JA 2C98A 3I51A 1TH2A 3SATA 4MH0E 5GKNA 1QAQA 4LZJA 4JI0M 5DNYA 1DO2A 4X65M 1HNZM 2L09A 4NL4H 4GC5A 4LF8M 1J09A 1SXJC 5EJCA 4B3TM 2ZBKB 5KO3A 4I5SA 2F5QA 2ZAOA 1R7RA 5FTKA 5H37D 2F5PA 2CHQA 4AW4A 4GITA 4JI2M 2KW0A 1YSYA 5LMUM 1K3WA 4IBEA 3L28A 3FD9A 4GHAA 1IQPA 1G4AE 1I4WA 4PD2A 4FCWA 2XFTA 5IREB 1DO0A 4DR1M 4LCBA 3GQ4A 1QZMA 3U6SA 2AHMA 3A42A 3KP0E 4IJEA 4NSOB 1IN8A 5DYIA 1IY1A 3SHGB 3U6MA 2VQEM 4ZPXA 5KPZA 3KDSE 1SXJD 1HR0M 2Z7JA 3M6AA 1XXHB 2CUZA 3FUUA 1IM2A 4IBKA 1GLNA 1NSFA 2M5ZA 4PT5A 3GLFB 3IG8A 2X49A 1Z5AA 2Y0QA 5ITXA 3GLIA 3E4RA 4REZA 3VKHA 3GLHB 3FYCA 1W5TA 4GIPA 4LF5M 2P5TA 1R2YA 4LJ5A 4IBJA 3A98B 5C1BA 4LF7M 1TDHA 2V1CA 4QOZC 4QOSA 5BPVA 4JI1M 4M9XA 4NRVA 1JQJC 3H4MA 4FCTA 2KZUA 5ITXE 3LQRA 5E26A 5EXSA 4AKHA 1NJFA 4M9SA 4I4LA 4IBDA 3GP1A 1S3SA 1ORYB 3T1HM 1QAMA 4GMQA 4P16A 4JI8M 1NY6A 4AKGA 4B7HA 3KSJA 2XSZD 3M7GA 4DV3M 2OQ4A 1E9SA 4PDIA 4IBGA 3HU1A 4WURA 4D81A 3FKEA 2QZ4A 3R8FA 1MU5A 4LJ9A 4NXNM 3SHFA 3K1JA 4FWHA 2RGHA 3CTWB 4KO8A 4PDGA 3GPYA 4DV7M 1J5EM 2D7EA 2C99A 3LVWA 4LJ7A 3HJQA 3HWSA 2CEAA 4II7A 3KFUG 2I7PA 4NXMM 1R6BX 4R3DA 2CV0A 1NHWC 3GLIB 3FUWA 1HT1E 1HT2E 3D8LA 4GRIA 2NQ8C 4OX9M 4D82A 4JI3M 2UXBM 5KPRA 3QWLA 5JI2E 3GQ5A 3QAUA 2ERCA 4LJ6A 5FTMA 3AV0A 5FLXS 4DV6M 1OJLA 2HKJA 2ZANA 2D7HA 1NNUC 4L4UA 4DR2M 1Q3CA 3U6LA 4K0KM 4WW0A 1G3IA 3WHLA 3ZH9B 3PVSA 4L16A 1QVRA 4AKIA 4M0WA 4QNRA 2DZNB 1FNNA 1TDZA 1L2DA 2QBYA 4L8RC 1X37A 5EXPA 4KLNA 1G59A 2XH9A 4LG2A 3GRYA 4AG6A 1L1ZA 1KSFX 3A45A 4MB7A 5IT9S 3W0LB 4CISA 3ILKA 4DV5M 1D2NA 4B08A 5ITTA 1XNQM 4LFAM 4GC9A 4XGIA 5EXTA 3W0FA 4GKJM 2F5SA 4BBAA 4HL4A 3KOXE 3SARA 4DR6M 3KS4A 1HNXM 3KS8A 3RFWA 1N78A 2K47A 4JN6A 1N32M 4DR5M 2YQZA 1IBLM 3SMSA 4IJFA 2QP9X 4IBIA 3MK6A 4LFBM 5EQTA 3SFZA 3A46A 2L6OA 3U6EA 4ITQA 4B7FA 4LJ8A 4AG5A 4QNMA 2JA2A 4QHSA 3VLFB 2ZAMA 1DGBA 1G8PA 5IWAM 3LVVA 8CATA 2F5NA 2UXDM 2DVWB 2CHVA 1XMOM 1FJGM 3GRRA 2C9OA 1IBMM 3AJIB 1NHGC 3GRVA 2J7NA 4EIWA 2R4JA 2QENA 1EE8A 3U5ZB 3GPPA 3HU2A 2M60A 4L15A 4X62M 4JI5M 2KRUA 3U6DA 2DWLA 5EP4A 4MM3B 5FSWA 2X8AA 1IXZA 3J2PB 3HKPA 4GH9A 1TH3A 1IN7A 4JYAM 3PFIA 4W5WA 3FUVA 3DFZA 2G8LA 4NRWA 2J7OA 3GO8A 2V1UA 4B3RM 4M0DA 5EP2A 2FNAA 2CFOA 3U60B 1E9RA 3L27A 1N75A 3I4YA 4X64M 3AKZA 5ITRA 3FUTA 1ZQ9A 4LJAA 3T38A 4OW0A 3FTEA 1Z6TA 2R18A 2CHGA 3GLGA 1DGHB 1ZAEA 1W5SA 1HQYE 3U6CA 1DGHA 2KRKA 3TE6A 2CV2A 5KQ8A 3TWMA 3SAUA 1QANA 1N34M 1TH4A 4Z8XA 4OU7A 3U60A 4AI6A 4G4NA 1XC8A 3B9PA 4DUZM 3HJSA 4IIWA 2KA6B 2EA0A 2C9CA 4LF4M 4X66M 2XLJA 5C18A 3C58A 1E94E 3RE8A 1XWIA 3THGA 3FTFA 4LF9M 1GKIA 3EIHA 3TWKA 5A2QS 3CF0A 4JI4M 1PJJA 4RNAA 1PJIA 1HQCA 2F5OA 2QCUA 3LMMA 3U6PA 1QQWA 2UUCM 2R62A 2UXCM 2I7NA 3KW6A 1DGFA 4JXJA 2UU9M 1XMQM 4RF1A 3PXGA 3SAWA 3GLHA 3DA1A 4PCZA 4MGZE 3CF2A 1H6UA 3L25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA M;  2OPF A;  1K3W A;  3W0F A;  4PD2 A;  4GKJ M;  2F5S A;  3OTO M;  4DR1 M;  3GQ4 A;  3J80 S;  3A42 A;  3U6S A;  5ITU A;  1MX0 A;  2XZU A;  3SAR A;  4DR6 M;  3U6M A;  1HNX M;  5BR8 M;  2VQE M;  4KHP M;  4B3S M;  4B3M M;  1N32 M;  3SAV A;  1HR0 M;  3GQ3 A;  4DR5 M;  3VK8 A;  1IBL M;  1L2C A;  4LFB M;  1Z5A A;  5ITX A;  4GKK M;  2Q2E B;  4DV4 M;  3A46 A;  1Z5C A;  5ITY A;  3U6E A;  4ITQ A;  4LF5 M;  1R2Y A;  3JAM S;  5IWA M;  2F5N A;  2UXD M;  4LF7 M;  1TDH A;  1R2Z A;  1XMO M;  1FJG M;  4JI1 M;  1L1T A;  1IBM M;  4NRV A;  2F4V M;  1IBK M;  1N33 M;  5ITX E;  4G4Q A;  4YY3 M;  4G4R A;  4LF6 M;  1EE8 A;  1HNW M;  3GPP A;  4LFC M;  1PM5 A;  4JI5 M;  4X62 M;  1N36 M;  4DR7 M;  4DR4 M;  3U6D A;  3GP1 A;  3T1H M;  4YHH M;  4JYA M;  3DOA A;  4NRW A;  3GO8 A;  4B3R M;  1XNR M;  4JI8 M;  3T1Y M;  1K82 A;  4DV3 M;  2OQ4 A;  4X64 M;  4PDI A;  5ITR A;  2E5L M;  1Z5B A;  3JR4 A;  4DUY M;  3J7A S;  1MU5 A;  3GPX A;  4NXN M;  2UUA M;  3TWL A;  1Q3B A;  4PDG A;  3U6C A;  3GPY A;  2HHH M;  3SAS A;  4JI7 M;  4DV7 M;  1J5E M;  1KFV A;  3TWM A;  3SAU A;  4DV0 M;  4DV1 M;  3J81 S;  1N34 M;  4JI6 M;  1Z59 A;  3JR5 A;  4G4N A;  1XC8 A;  2UUB M;  5ITQ A;  2ZM6 M;  4NXM M;  5LMN M;  4DUZ M;  1I94 M;  4DR3 M;  2EA0 A;  4LF4 M;  4JV5 M;  4X66 M;  3U6Q A;  3C58 A;  2XZF A;  4OX9 M;  4JI3 M;  2UXB M;  3SBJ A;  4LF9 M;  3GQ5 A;  3TWK A;  3U6O A;  5A2Q S;  1NNJ A;  4JI4 M;  3GPU A;  1PJJ A;  4DV6 M;  5FLX S;  1PJI A;  2F5O A;  2HKJ A;  4AQY M;  3U6P A;  3VK7 A;  2VQF M;  2UUC M;  3U6L A;  4DR2 M;  3SAT A;  1Q3C A;  2UXC M;  4JI0 M;  4X65 M;  4K0K M;  1HNZ M;  4G4O A;  2UU9 M;  1XMQ M;  4LF8 M;  3SAW A;  4B3T M;  1TDZ A;  2ZBK B;  1L2D A;  2F5Q A;  1L2B A;  1XNQ M;  1L1Z A;  3A45 A;  4MB7 A;  4DV2 M;  5IT9 S;  4CIS A;  4DV5 M;  2F5P A;  1Q39 A;  4PCZ A;  4JI2 M;  5LMU M;  1K3X A;  5ITT A; 
#chains in the Genus database with same CATH topology
 3HHW A;  2DWM A;  2EKK A;  2H1R A;  5FTL A;  2OPF A;  1V33 A;  2ZTD A;  3K8Z A;  3KSX A;  3MHV C;  1E32 A;  2BJV A;  3PNY A;  2XEP A;  3ZC7 B;  4MGK E;  1MX0 A;  4NOO B;  2XZU A;  2Z3X A;  2XGN A;  1OTR A;  2YR0 A;  4OVZ A;  5EXX A;  3K9O A;  3M0E A;  4B3S M;  3PNV A;  5EP3 A;  4ANR A;  3SAV A;  3UZU A;  3H4J A;  3GQ3 A;  1JB0 F;  2G3Q A;  3UMM A;  1IN4 A;  3HZJ A;  2DHR A;  1L2C A;  4KT0 F;  1OFI A;  3HU3 A;  4FVM A;  4Z6Y A;  5ITY A;  4CGY B;  1P3Q Q;  3AOE C;  4CHT B;  2JZ0 A;  3K2L A;  3GLI E;  4D80 A;  3J7B A;  2FE8 A;  1L8Q A;  3WHK A;  2QBY B;  1QAO A;  4G6Z A;  4R7G A;  4B7G A;  1R2Z A;  2O01 F;  1MJG M;  3W67 A;  3RGS A;  3AFH A;  2JY5 A;  1L1T A;  2VII A;  2F4V M;  3IHP A;  1N77 A;  1V92 A;  3LW5 F;  1QDR A;  3FRH A;  1WR1 B;  4YY3 M;  4XBO A;  4G4R A;  1GAB A;  4LJ4 A;  1JR3 E;  1GL6 A;  1N36 M;  1PJS A;  4DR4 M;  4DR7 M;  3LCU A;  2KXE A;  2WSE F;  3L26 A;  2Y0T A;  3BOS A;  3SYK A;  3F92 A;  3AOE A;  3FYD A;  1IFY A;  4A3V B;  5JI3 E;  3NWL A;  1IY2 A;  1PRB A;  3L29 A;  2Y20 A;  1TR8 A;  3IG5 A;  1SXJ A;  1NO1 A;  1XNR M;  4L78 A;  1K82 A;  5F3W A;  1GL7 A;  5IZ7 D;  1G41 A;  3VFD A;  2BJW A;  4LRS A;  1NVM A;  2HCB A;  2E5L M;  3RGP A;  1Z5B A;  4I8O A;  3FTD A;  2R46 A;  4DUY M;  3J7A S;  3L2A A;  4I81 A;  1D0M A;  1OIZ A;  1C1K A;  2CE7 A;  1JR3 D;  2YFQ A;  3LQQ A;  2V6Z M;  1Q3B A;  3TWL A;  2HHH M;  4JI7 M;  2DWN A;  4GEW A;  2JUJ A;  4FD2 A;  2KNV A;  1SXJ E;  4KOD A;  3UJN A;  4DV1 M;  2Z4S A;  2Z8Y M;  4FCV A;  1EFU B;  3Q8X A;  4CIZ A;  3HHY A;  2ZM6 M;  3U6S A;  5LMN M;  2JP7 A;  1OFH A;  2DXI A;  3U6Q A;  3KOY E;  3U5Z A;  3UK6 A;  2C5R A;  2L4E A;  2FOI C;  3HHX A;  2XF3 A;  3QYE A;  1VDD A;  4FWG A;  3V76 A;  3GPU A;  1D0K A;  3HY5 A;  3TQS A;  4LZZ A;  2ZTC A;  2EJS A;  3VK7 A;  2VQF M;  2RKO A;  3KOZ E;  4IBB A;  3U61 B;  2CWB A;  2EO2 A;  3CGW A;  2EUC A;  2L7H A;  4G4O A;  1PGY A;  2R4E A;  1LV7 A;  1ZMU A;  2X4A A;  3AOG A;  2KHH A;  3KVW A;  3VDU A;  1XXH A;  2KNZ A;  4RF0 A;  1L2B A;  1Q02 A;  4DV2 M;  2K6B A;  1Q39 A;  3D8B A;  3T15 A;  1K3X A;  2D7G A;  2RGO A;  4M9Z A;  5DYG A;  5FTJ A;  1GVN A;  3J27 B;  3OTO M;  3SYL A;  3HHZ A;  3J80 S;  2L7I A;  1QUT A;  5ITU A;  2MJ5 B;  1JR3 A;  2G5G X;  4IBC A;  3NBI A;  4UN2 B;  3T6P A;  1IY0 A;  1XHB A;  1XXH E;  3SMP A;  2XFS A;  5BR8 M;  3R9X B;  4KHP M;  2MRO B;  1IXR C;  4B3M M;  3VK8 A;  1WGL A;  4LRT A;  2LHG A;  4TUW A;  1T43 A;  4BB9 A;  1VEG A;  1TGU A;  1YUB A;  3DZD A;  2H5X A;  3FUX A;  4GKK M;  2Q2E B;  2WSF F;  3MJ5 A;  2CP8 A;  3E46 A;  1Z5C A;  3NBX X;  4BLC A;  4DV4 M;  1NY5 A;  2GQF A;  1G71 A;  2OOB A;  3ZCB B;  4OVZ B;  2HL7 A;  4MGH A;  4FWD A;  3AL0 C;  3GLF A;  1NV8 A;  3JAM S;  2YNM D;  4LY6 A;  3VDP A;  2OO9 A;  4NSR A;  3E9S A;  1QYR A;  4LGM A;  1EIJ A;  4P17 A;  1IBK M;  3U61 A;  2KNA A;  1N33 M;  2QSF X;  4G4Q A;  1WXQ A;  7CAT A;  3LCV B;  1UFZ A;  4LF6 M;  4LFC M;  3Q8G A;  2LTU A;  1PM5 A;  2FH0 A;  4HLQ A;  2KZS A;  4LGY A;  3KXE C;  3FTC A;  3TPZ A;  2R0I A;  3FRI A;  2BNK A;  4IBF A;  3IEC A;  4QHT A;  3TL4 X;  3GLG B;  4MGI E;  2DNA A;  3CF6 E;  3KOW E;  4YHH M;  1SG9 A;  2JNH A;  2C96 A;  1MN3 A;  1WIV A;  3DOA A;  4GHL A;  2W82 A;  3T1Y M;  1J7K A;  3I4V A;  2CV1 A;  2QPA A;  4WP2 A;  5KPT A;  4DBG B;  2A5Y B;  2Y21 A;  5DFL A;  4AZF A;  3JR4 A;  4S12 A;  3GPX A;  2O5R A;  2DAI A;  1KYI A;  2Z4R A;  2UUA M;  2WSC F;  3SAS A;  1KFV A;  2FFJ A;  4DV0 M;  3SC3 A;  3J81 S;  1IN5 A;  4JI6 M;  3HGI A;  1Z59 A;  1T3T A;  5KQD A;  3JR5 A;  3GLH E;  1VQ1 A;  4F1I A;  2DAM A;  3VKG A;  1IXS B;  2DWL A;  1T6O A;  5ITQ A;  2UUB M;  1VEK A;  3K92 A;  1SXJ B;  1I94 M;  1UM8 A;  4DR3 M;  4JV5 M;  3EIE A;  1DGG A;  1YE9 A;  1IN6 A;  1PJQ A;  3C3E A;  3GLF E;  3HJ8 A;  4FW9 A;  2LH0 A;  2LXE A;  2DHY A;  2XZF A;  2KEB A;  2XSZ A;  3SBJ A;  3UGJ A;  4MGY E;  2DWZ B;  3U6O A;  2QQ8 A;  3GRU A;  1NNJ A;  2R65 A;  2DZO B;  2LNH C;  1HNW M;  2R45 A;  3KP1 E;  1NJG A;  2LWX A;  5EP1 A;  5FTN A;  4AQY M;  5E6J A;  2C98 A;  3I51 A;  1TH2 A;  3SAT A;  2WZJ A;  4MH0 E;  5GKN A;  1A5T A;  1QAQ A;  3B89 A;  4LZJ A;  1DO2 A;  4JI0 M;  5DNY A;  4X65 M;  2L09 A;  1HNZ M;  4NL4 H;  4GC5 A;  4LF8 M;  1J09 A;  1SXJ C;  1Y8G A;  3BBZ A;  5EJC A;  4B3T M;  2ZBK B;  2DZL A;  5KO3 A;  4I5S A;  2F5Q A;  4HEO A;  2ZAO A;  1R7R A;  2LVO C;  5FTK A;  5H37 D;  2CHQ A;  2MH8 A;  2QNJ A;  4AW4 A;  4GIT A;  2F5P A;  4JI2 M;  2KW0 A;  1YSY A;  5LMU M;  1OIP A;  4IBE A;  1K3W A;  3L28 A;  3FD9 A;  4GHA A;  1IQP A;  1TF0 B;  1G4A E;  1I4W A;  4PD2 A;  1GJT A;  2XFT A;  4FCW A;  1DO0 A;  5IRE B;  4LCB A;  3GQ4 A;  1QZM A;  1LTM A;  4DR1 M;  2AHM A;  3A42 A;  3KP0 E;  4IJE A;  4NSO B;  1IN8 A;  5DYI A;  1IY1 A;  3SHG B;  3U6M A;  2VQE M;  4ZPX A;  5KPZ A;  3KDS E;  1SXJ D;  3C3D A;  1HR0 M;  1R4G A;  2Z7J A;  1XXH B;  2CUZ A;  3FUU A;  1IM2 A;  2JWS A;  1GLN A;  1NSF A;  2M5Z A;  3M6A A;  4IBK A;  3IG8 A;  4PT5 A;  2X49 A;  1Z5A A;  2Y0Q A;  5ITX A;  3GLI A;  3E4R A;  4REZ A;  3VKH A;  4XK8 F;  2K0B X;  4R71 A;  3GLH B;  3FYC A;  1W5T A;  4NC6 A;  4GIP A;  4LF5 M;  2P5T A;  2BWB A;  1R2Y A;  4LJ5 A;  1CUK A;  4IBJ A;  3A98 B;  5C1B A;  4LF7 M;  1TDH A;  2V1C A;  2VDB B;  4QOZ C;  4QOS A;  5BPV A;  2JY6 B;  3U6D A;  4JI1 M;  4M9X A;  4NRV A;  1JQJ C;  3H4M A;  1IXS A;  4FCT A;  2KZU A;  5ITX E;  3LQR A;  5E26 A;  5EXS A;  1DV0 A;  4AKH A;  1WGN A;  1NJF A;  4M9S A;  4I4L A;  2DEN A;  4IBD A;  3GP1 A;  1S3S A;  1ORY B;  2VF7 A;  2MR9 A;  2LVN C;  3T1H M;  1QAM A;  4GMQ A;  4P16 A;  4JI8 M;  1NY6 A;  4AKG A;  4B7H A;  3KSJ A;  2XSZ D;  3M7G A;  1YLA A;  4DV3 M;  3B7Z A;  2OQ4 A;  1E9S A;  4PDI A;  4IBG A;  3HU1 A;  4WUR A;  4D81 A;  2CRU A;  3FKE A;  2QZ4 A;  3R8F A;  1MU5 A;  4LJ9 A;  2VF8 A;  4NXN M;  3SHF A;  1C7Y A;  1XB2 B;  3K1J A;  1OAO C;  2R6F A;  4FWH A;  4L6V 6;  2RGH A;  2N35 A;  3CTW B;  1QDT A;  3I01 M;  4KO8 A;  4F2L A;  4PDG A;  3GPY A;  4DV7 M;  1J5E M;  2D7E A;  2C99 A;  3LVW A;  4LJ7 A;  1RU3 A;  3HJQ A;  4Y28 F;  3K9P A;  1D0L A;  3HWS A;  2CEA A;  4II7 A;  3KFU G;  2I7P A;  4NXM M;  1R6B X;  4R3D A;  2CV0 A;  2JZ1 A;  1NHW C;  3GLI B;  3FUW A;  1HT1 E;  2HAK A;  1HT2 E;  4RKU F;  1F4I A;  2OOA A;  3D8L A;  4GRI A;  1AUA A;  2NQ8 C;  4D82 A;  4JI3 M;  4Q7J A;  4OX9 M;  2UXB M;  5KPR A;  3W68 A;  3QWL A;  5JI2 E;  3GQ5 A;  3QAU A;  2ERC A;  4LJ6 A;  5FTM A;  3AV0 A;  1VDL A;  5FLX S;  1OJL A;  2DAK A;  2JY7 A;  2HKJ A;  4DV6 M;  2ZAN A;  3B7N A;  1OKS A;  2D7H A;  1NNU C;  4L4U A;  4DR2 M;  1Q3C A;  2LHC A;  3U6L A;  4WW0 A;  4K0K M;  1G3I A;  3WHL A;  3ZH9 B;  3PVS A;  4L16 A;  1QVR A;  4AKI A;  4M0W A;  4QNR A;  2DZN B;  1FNN A;  1TDZ A;  1L2D A;  2QBY A;  4L8R C;  1X37 A;  5EXP A;  4KLN A;  1G59 A;  2XH9 A;  4LG2 A;  3GRY A;  4AG6 A;  1L1Z A;  1KSF X;  3A45 A;  4MB7 A;  5IT9 S;  3W0L B;  4CIS A;  3ILK A;  4G3O A;  4DV5 M;  3E21 A;  1D2N A;  3B74 A;  4B08 A;  5ITT A;  1XNQ M;  4LFA M;  4GC9 A;  3ZQJ A;  4XGI A;  5EXT A;  3W0F A;  4GKJ M;  2F5S A;  4BBA A;  4HL4 A;  2L2D A;  3KOX E;  1AIP C;  2LBC A;  1OAI A;  2DAE A;  3SAR A;  4DR6 M;  3KS4 A;  1HNX M;  2DAG A;  3KS8 A;  3RFW A;  3GLG E;  1N78 A;  1HJP A;  2K47 A;  3FE3 A;  4JN6 A;  1N32 M;  1NV9 A;  4DR5 M;  2YQZ A;  1IBL M;  3SMS A;  4IJF A;  2QP9 X;  4IBI A;  1QZE A;  3MK6 A;  4LFB M;  5EQT A;  3SFZ A;  1ZMW A;  1OQY A;  1V34 A;  3A46 A;  2L6O A;  3U6E A;  4ITQ A;  1R5L A;  4B7F A;  4LJ8 A;  2DKL A;  4AG5 A;  4QNM A;  2JA2 A;  4QHS A;  2K9D A;  3VLF B;  2ZAM A;  1DGB A;  1G8P A;  5IWA M;  3LVV A;  8CAT A;  2F5N A;  2UXD M;  2DVW B;  2CHV A;  1XMO M;  1FJG M;  3GRR A;  2C9O A;  1IBM M;  3AJI B;  1NHG C;  1TTE A;  2J7N A;  3GRV A;  4EIW A;  1GO5 A;  2R4J A;  2J5Y A;  2QEN A;  1EE8 A;  3U5Z B;  3GPP A;  3HU2 A;  2KDL A;  2M60 A;  4L15 A;  4X62 M;  4JI5 M;  2KRU A;  2QHO B;  3BXW A;  3I04 M;  5EP4 A;  3GLF B;  2B3T A;  2LVA A;  4MM3 B;  2X8A A;  5FSW A;  1IXZ A;  3J2P B;  3HKP A;  4GH9 A;  1TH3 A;  1IN7 A;  2DI0 A;  4JYA M;  1WHC A;  3PFI A;  4W5W A;  3FUV A;  3DFZ A;  2G8L A;  4NRW A;  2J7O A;  3GO8 A;  2V1U A;  4B3R M;  4M0D A;  5EP2 A;  2FNA A;  1BVS A;  2CFO A;  3U60 B;  2BWE A;  1E9R A;  2LVP C;  3L27 A;  1N75 A;  3I4Y A;  4X64 M;  3AKZ A;  1WJ7 A;  3FUT A;  5ITR A;  1ZQ9 A;  1PJT A;  4LJA A;  3T38 A;  4OW0 A;  3FTE A;  1Z6T A;  2MGW A;  2R44 A;  2R18 A;  2CHG A;  4CJ6 A;  3GLG A;  1DGH B;  1GJS A;  2O25 A;  1ZAE A;  1W5S A;  1HQY E;  3QYB A;  3U6C A;  1VEJ A;  1DGH A;  2KRK A;  3TE6 A;  2CV2 A;  5KQ8 A;  3TWM A;  3SAU A;  1QAN A;  1N34 M;  1TH4 A;  4Z8X A;  4OU7 A;  3U60 A;  3MMP A;  4G4N A;  4AI6 A;  1XC8 A;  1VG5 A;  3B9P A;  3B7Q A;  3C9P A;  3HX3 A;  4DUZ M;  3HJS A;  4IIW A;  2KA6 B;  2EA0 A;  2C9C A;  4LF4 M;  2LVQ D;  4X66 M;  2XLJ A;  5C18 A;  2HWJ A;  3C58 A;  1E94 E;  1QUS A;  3RE8 A;  1XWI A;  3THG A;  3FTF A;  1ZMV A;  4LF9 M;  1GKI A;  3EIH A;  3TWK A;  5A2Q S;  3CF0 A;  4JI4 M;  1PJJ A;  4RNA A;  1PJI A;  1HQC A;  2APL A;  2QCU A;  2F5O A;  2GNO A;  3LMM A;  3U6P A;  1QQW A;  2UUC M;  2L4F A;  2R62 A;  2UXC M;  2I7N A;  2JXN A;  3KW6 A;  1DGF A;  4JXJ A;  2UU9 M;  1XMQ M;  2EKF A;  4RF1 A;  3PXG A;  3SAW A;  2RRU A;  2JY8 A;  5L8R F;  3GLH A;  1ZV1 A;  2FS1 A;  3DA1 A;  4PCZ A;  4MGZ E;  3CF2 A;  1H6U A;  3L25 A; 
#chains in the Genus database with same CATH homology
 3HHW A;  2DWM A;  2H1R A;  5FTL A;  2OPF A;  3K8Z A;  3KSX A;  3MHV C;  1E32 A;  2BJV A;  3PNY A;  2XEP A;  3ZC7 B;  4MGK E;  1MX0 A;  4NOO B;  2XZU A;  2Z3X A;  2XGN A;  2YR0 A;  4OVZ A;  5EXX A;  3M0E A;  4B3S M;  3PNV A;  5EP3 A;  3SAV A;  3UZU A;  3GQ3 A;  3UMM A;  1IN4 A;  2DHR A;  1L2C A;  1OFI A;  3HU3 A;  4FVM A;  4Z6Y A;  5ITY A;  4CGY B;  3AOE C;  4CHT B;  3K2L A;  4D80 A;  3J7B A;  2FE8 A;  1L8Q A;  3WHK A;  2QBY B;  1QAO A;  4G6Z A;  4R7G A;  4B7G A;  1R2Z A;  3RGS A;  3AFH A;  1L1T A;  2VII A;  2F4V M;  1N77 A;  4YY3 M;  4G4R A;  4XBO A;  4LJ4 A;  1GL6 A;  1N36 M;  4DR7 M;  4DR4 M;  2KXE A;  3L26 A;  2Y0T A;  3BOS A;  3SYK A;  3AOE A;  3FYD A;  4A3V B;  5JI3 E;  3NWL A;  1IY2 A;  3L29 A;  2Y20 A;  3IG5 A;  1SXJ A;  1XNR M;  4L78 A;  1K82 A;  5F3W A;  1GL7 A;  5IZ7 D;  1G41 A;  3VFD A;  2BJW A;  4LRS A;  1NVM A;  2HCB A;  2E5L M;  3RGP A;  1Z5B A;  4I8O A;  3FTD A;  2R46 A;  4DUY M;  3J7A S;  3L2A A;  4I81 A;  1C1K A;  2CE7 A;  1JR3 D;  2YFQ A;  3LQQ A;  2V6Z M;  1Q3B A;  3TWL A;  2HHH M;  4JI7 M;  2DWN A;  4FD2 A;  4KOD A;  1SXJ E;  3UJN A;  4DV1 M;  2Z4S A;  4FCV A;  3Q8X A;  3HHY A;  2ZM6 M;  5LMN M;  1OFH A;  2DXI A;  3U6Q A;  3KOY E;  3U5Z A;  3UK6 A;  2C5R A;  2FOI C;  3HHX A;  2XF3 A;  1VDD A;  4FWG A;  3GPU A;  3TQS A;  4LZZ A;  3VK7 A;  2VQF M;  3KOZ E;  2RKO A;  4IBB A;  3U61 B;  2EO2 A;  2EUC A;  2L7H A;  4G4O A;  2R4E A;  1LV7 A;  2X4A A;  3AOG A;  3KVW A;  3VDU A;  1XXH A;  4RF0 A;  1L2B A;  4DV2 M;  1Q39 A;  3D8B A;  3T15 A;  1K3X A;  2D7G A;  2RGO A;  4M9Z A;  5DYG A;  5FTJ A;  1GVN A;  3J27 B;  3OTO M;  3SYL A;  3HHZ A;  3J80 S;  2L7I A;  5ITU A;  1JR3 A;  2G5G X;  4IBC A;  3NBI A;  1IY0 A;  1XHB A;  3SMP A;  5BR8 M;  2XFS A;  3R9X B;  4KHP M;  1IXR C;  4B3M M;  3VK8 A;  4LRT A;  4TUW A;  4BB9 A;  1TGU A;  1YUB A;  3DZD A;  3FUX A;  4GKK M;  2Q2E B;  3MJ5 A;  4BLC A;  4DV4 M;  1Z5C A;  1NY5 A;  3ZCB B;  4OVZ B;  2HL7 A;  4MGH A;  4FWD A;  3AL0 C;  3GLF A;  3JAM S;  2YNM D;  4LY6 A;  3VDP A;  4NSR A;  3E9S A;  1QYR A;  4LGM A;  1IBK M;  3U61 A;  1N33 M;  4G4Q A;  1WXQ A;  7CAT A;  4LF6 M;  1HNW M;  4LFC M;  1PM5 A;  4HLQ A;  2KZS A;  4LGY A;  3KXE C;  3FTC A;  3TPZ A;  2BNK A;  4IBF A;  4QHT A;  3TL4 X;  3GLG B;  4MGI E;  3CF6 E;  3KOW E;  4YHH M;  2C96 A;  3DOA A;  4GHL A;  2W82 A;  3T1Y M;  1J7K A;  3I4V A;  2CV1 A;  2QPA A;  5KPT A;  2A5Y B;  2Y21 A;  4AZF A;  3JR4 A;  4S12 A;  3GPX A;  2O5R A;  1KYI A;  2Z4R A;  2UUA M;  3SAS A;  1KFV A;  2FFJ A;  4DV0 M;  3SC3 A;  3J81 S;  1IN5 A;  4JI6 M;  3HGI A;  1Z59 A;  1T3T A;  5KQD A;  3JR5 A;  3VKG A;  1IXS B;  2UUB M;  5ITQ A;  3K92 A;  1SXJ B;  1I94 M;  1UM8 A;  4DR3 M;  4JV5 M;  3EIE A;  1DGG A;  1YE9 A;  1IN6 A;  3HJ8 A;  4FW9 A;  2LH0 A;  2LXE A;  2XZF A;  2KEB A;  2XSZ A;  3SBJ A;  3UGJ A;  4MGY E;  2DWZ B;  3U6O A;  3GRU A;  1NNJ A;  2R65 A;  2DZO B;  2LNH C;  2R45 A;  3KP1 E;  1NJG A;  2LWX A;  5EP1 A;  5FTN A;  4AQY M;  5E6J A;  2C98 A;  3I51 A;  1TH2 A;  3SAT A;  4MH0 E;  5GKN A;  1QAQ A;  4LZJ A;  4JI0 M;  5DNY A;  1DO2 A;  4X65 M;  1HNZ M;  2L09 A;  4NL4 H;  4GC5 A;  4LF8 M;  1J09 A;  1SXJ C;  5EJC A;  4B3T M;  2ZBK B;  5KO3 A;  4I5S A;  2F5Q A;  2ZAO A;  1R7R A;  5FTK A;  5H37 D;  2F5P A;  2CHQ A;  4AW4 A;  4GIT A;  4JI2 M;  2KW0 A;  1YSY A;  5LMU M;  1K3W A;  4IBE A;  3L28 A;  3FD9 A;  4GHA A;  1IQP A;  1G4A E;  1I4W A;  4PD2 A;  4FCW A;  2XFT A;  5IRE B;  1DO0 A;  4DR1 M;  4LCB A;  3GQ4 A;  1QZM A;  3U6S A;  2AHM A;  3A42 A;  3KP0 E;  4IJE A;  4NSO B;  1IN8 A;  5DYI A;  1IY1 A;  3SHG B;  3U6M A;  2VQE M;  4ZPX A;  5KPZ A;  3KDS E;  1SXJ D;  1HR0 M;  2Z7J A;  3M6A A;  1XXH B;  2CUZ A;  3FUU A;  1IM2 A;  4IBK A;  1GLN A;  1NSF A;  2M5Z A;  4PT5 A;  3GLF B;  3IG8 A;  2X49 A;  1Z5A A;  2Y0Q A;  5ITX A;  3GLI A;  3E4R A;  4REZ A;  3VKH A;  3GLH B;  3FYC A;  1W5T A;  4GIP A;  4LF5 M;  2P5T A;  1R2Y A;  4LJ5 A;  4IBJ A;  3A98 B;  5C1B A;  4LF7 M;  1TDH A;  2V1C A;  4QOZ C;  4QOS A;  5BPV A;  4JI1 M;  4M9X A;  4NRV A;  1JQJ C;  3H4M A;  4FCT A;  2KZU A;  5ITX E;  3LQR A;  5E26 A;  5EXS A;  4AKH A;  1NJF A;  4M9S A;  4I4L A;  4IBD A;  3GP1 A;  1S3S A;  1ORY B;  3T1H M;  1QAM A;  4GMQ A;  4P16 A;  4JI8 M;  1NY6 A;  4AKG A;  4B7H A;  3KSJ A;  2XSZ D;  3M7G A;  4DV3 M;  2OQ4 A;  1E9S A;  4PDI A;  4IBG A;  3HU1 A;  4WUR A;  4D81 A;  3FKE A;  2QZ4 A;  3R8F A;  1MU5 A;  4LJ9 A;  4NXN M;  3SHF A;  3K1J A;  4FWH A;  2RGH A;  3CTW B;  4KO8 A;  4PDG A;  3GPY A;  4DV7 M;  1J5E M;  2D7E A;  2C99 A;  3LVW A;  4LJ7 A;  3HJQ A;  3HWS A;  2CEA A;  4II7 A;  3KFU G;  2I7P A;  4NXM M;  1R6B X;  4R3D A;  2CV0 A;  1NHW C;  3GLI B;  3FUW A;  1HT1 E;  1HT2 E;  3D8L A;  4GRI A;  2NQ8 C;  4OX9 M;  4D82 A;  4JI3 M;  2UXB M;  5KPR A;  3QWL A;  5JI2 E;  3GQ5 A;  3QAU A;  2ERC A;  4LJ6 A;  5FTM A;  3AV0 A;  5FLX S;  4DV6 M;  1OJL A;  2HKJ A;  2ZAN A;  2D7H A;  1NNU C;  4L4U A;  4DR2 M;  1Q3C A;  3U6L A;  4K0K M;  4WW0 A;  1G3I A;  3WHL A;  3ZH9 B;  3PVS A;  4L16 A;  1QVR A;  4AKI A;  4M0W A;  4QNR A;  2DZN B;  1FNN A;  1TDZ A;  1L2D A;  2QBY A;  4L8R C;  1X37 A;  5EXP A;  4KLN A;  1G59 A;  2XH9 A;  4LG2 A;  3GRY A;  4AG6 A;  1L1Z A;  1KSF X;  3A45 A;  4MB7 A;  5IT9 S;  3W0L B;  4CIS A;  3ILK A;  4DV5 M;  1D2N A;  4B08 A;  5ITT A;  1XNQ M;  4LFA M;  4GC9 A;  4XGI A;  5EXT A;  3W0F A;  4GKJ M;  2F5S A;  4BBA A;  4HL4 A;  3KOX E;  3SAR A;  4DR6 M;  3KS4 A;  1HNX M;  3KS8 A;  3RFW A;  1N78 A;  2K47 A;  4JN6 A;  1N32 M;  4DR5 M;  2YQZ A;  1IBL M;  3SMS A;  4IJF A;  2QP9 X;  4IBI A;  3MK6 A;  4LFB M;  5EQT A;  3SFZ A;  3A46 A;  2L6O A;  3U6E A;  4ITQ A;  4B7F A;  4LJ8 A;  4AG5 A;  4QNM A;  2JA2 A;  4QHS A;  3VLF B;  2ZAM A;  1DGB A;  1G8P A;  5IWA M;  3LVV A;  8CAT A;  2F5N A;  2UXD M;  2DVW B;  2CHV A;  1XMO M;  1FJG M;  3GRR A;  2C9O A;  1IBM M;  3AJI B;  1NHG C;  3GRV A;  2J7N A;  4EIW A;  2R4J A;  2QEN A;  1EE8 A;  3U5Z B;  3GPP A;  3HU2 A;  2M60 A;  4L15 A;  4X62 M;  4JI5 M;  2KRU A;  3U6D A;  2DWL A;  5EP4 A;  4MM3 B;  5FSW A;  2X8A A;  1IXZ A;  3J2P B;  3HKP A;  4GH9 A;  1TH3 A;  1IN7 A;  4JYA M;  3PFI A;  4W5W A;  3FUV A;  3DFZ A;  2G8L A;  4NRW A;  2J7O A;  3GO8 A;  2V1U A;  4B3R M;  4M0D A;  5EP2 A;  2FNA A;  2CFO A;  3U60 B;  1E9R A;  3L27 A;  1N75 A;  3I4Y A;  4X64 M;  3AKZ A;  5ITR A;  3FUT A;  1ZQ9 A;  4LJA A;  3T38 A;  4OW0 A;  3FTE A;  1Z6T A;  2R18 A;  2CHG A;  3GLG A;  1DGH B;  1ZAE A;  1W5S A;  1HQY E;  3U6C A;  1DGH A;  2KRK A;  3TE6 A;  2CV2 A;  5KQ8 A;  3TWM A;  3SAU A;  1QAN A;  1N34 M;  1TH4 A;  4Z8X A;  4OU7 A;  3U60 A;  4AI6 A;  4G4N A;  1XC8 A;  3B9P A;  4DUZ M;  3HJS A;  4IIW A;  2KA6 B;  2EA0 A;  2C9C A;  4LF4 M;  4X66 M;  2XLJ A;  5C18 A;  3C58 A;  1E94 E;  3RE8 A;  1XWI A;  3THG A;  3FTF A;  4LF9 M;  1GKI A;  3EIH A;  3TWK A;  5A2Q S;  3CF0 A;  4JI4 M;  1PJJ A;  4RNA A;  1PJI A;  1HQC A;  2F5O A;  2QCU A;  3LMM A;  3U6P A;  1QQW A;  2UUC M;  2R62 A;  2UXC M;  2I7N A;  3KW6 A;  1DGF A;  4JXJ A;  2UU9 M;  1XMQ M;  4RF1 A;  3PXG A;  3SAW A;  3GLH A;  3DA1 A;  4PCZ A;  4MGZ E;  3CF2 A;  1H6U A;  3L25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...