3ZC7B

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
63
structure length
63
Chain Sequence
MVLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
total genus 25
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zc7B00
3ZC7B 3ZCBB 3SHGB
chains in the Genus database with same CATH superfamily
5GKNA 1WIVA 2AHMA 2ZANA 3MMPA 3HHWA 2DAGA 2EUCA 5ITQA 4LF4M 1MU5A 3U6LA 4LG2A 4DR1M 3ZH9B 1IN8A 2BWBA 1OJLA 2H5XA 5KPTA 3KS4A 4FCVA 2DENA 2QNJA 3A45A 2J7NA 1NO1A 3GLIA 4LJ6A 2L4EA 2R46A 3CF6E 3T1YM 2JUJA 3K9OA 2W82A 1E9RA 2Z4RA 5ITXA 5IZ7D 2XZUA 1SXJD 1IN5A 2Y20A 2I7PA 3GLGB 1EFUB 1XHBA 2MROB 3IHPA 4II7A 4Y28F 1GL7A 2X4AA 2L6OA 2OO9A 4XK8F 4HEOA 2RRUA 3PXGA 4LFBM 3LW5F 5JI2E 1XMQM 1FNNA 3V76A 4OVZB 3SHGB 1LV7A 3KS8A 2R6FA 4GHAA 1NY5A 3GLFA 3VLFB 4REZA 3W67A 2Y0TA 3PNVA 3C3EA 2N35A 1Q3CA 1MX0A 2F5SA 1TH3A 3UK6A 4X66M 2R65A 2XFTA 1WHCA 3LQQA 3U6PA 4GC5A 5FLXS 4FWHA 1NY6A 5JI3E 3HGIA 5IWAM 2QCUA 1D0LA 4FWDA 2LWXA 3K9PA 3GRYA 4M0DA 3U6OA 3VK7A 3B7NA 2C99A 1A5TA 1WJ7A 2ERCA 2JY7A 3RFWA 3SAVA 2HAKA 2DAEA 2UUBM 1T43A 3AFHA 3GPPA 4R3DA 4YHHM 3D8LA 3RE8A 2LVPC 3J80S 2QBYB 4ITQA 4B3TM 4TUWA 3SAWA 4UN2B 3K8ZA 4MGKE 4A3VB 2XFSA 5EP3A 2G8LA 1D0MA 4XBOA 2ZM6M 1PJSA 1K3XA 2HCBA 2DAKA 3SAUA 1N32M 2Z7JA 2CP8A 4BLCA 1ZV1A 1Q02A 1VQ1A 3KOYE 2KZSA 3KDSE 3U6MA 1HNXM 2M60A 1HQYE 3R9XB 2QP9X 3T38A 3VKHA 2JY8A 1YLAA 2ZTDA 3U6QA 2V1CA 4G4RA 1Q3BA 3JR5A 5F3WA 1UFZA 2XSZA 1VDLA 3T15A 5ITXE 3RGSA 4DUYM 1SG9A 2XEPA 4DV1M 4DV2M 1ZQ9A 3J81S 2VDBB 3A46A 3J7BA 1YUBA 3A98B 1QDRA 1VEKA 3J7AS 3FUWA 1R2YA 4MM3B 1DGBA 1XB2B 3K92A 1E94E 2LHCA 2JY6B 3FTFA 4QNRA 2VQEM 4AQYM 4NRWA 1TTEA 3E9SA 3BXWA 3FUUA 4L16A 1QQWA 2DWZB 3UZUA 3WHLA 2KNVA 2FS1A 5BR8M 3U5ZA 5E26A 4LF8M 3PNYA 2MR9A 3KP1E 3KSJA 2R18A 4ANRA 2D7GA 4KT0F 4IBFA 4L8RC 1OKSA 3L2AA 2DZNB 5ITTA 2FNAA 3FTCA 4EIWA 2VQFM 4OVZA 4JI2M 2J5YA 3K2LA 2JP7A 2D7HA 3FRHA 2WSFF 1XMOM 1L2CA 2HKJA 3GPXA 1GL6A 2BWEA 4FVMA 2EKFA 4FD2A 4M9SA 3ZCBB 4GIPA 1HR0M 3KFUG 3B7ZA 4DR6M 4LJ4A 3FE3A 1V92A 2Y0QA 1NJFA 4HL4A 2UXCM 1R4GA 3HJQA 2L7IA 1PM5A 1GKIA 4GKJM 2K0BX 1DGGA 4B7FA 1AUAA 3GPUA 3FRIA 1DO0A 1UM8A 3GRVA 2MH8A 4XGIA 4AG5A 5EXPA 2DWMA 2DWLA 1Z59A 4M0WA 4OX9M 3FTEA 1GABA 1HJPA 1E9SA 2XH9A 4JI6M 4G4QA 2DZOB 2ZAMA 1W5SA 1Z5CA 4FWGA 4W5WA 5FTJA 1ZMWA 4RF0A 1KSFX 1PRBA 4HLQA 1DO2A 2KZUA 4WW0A 4PDGA 3L28A 4NXNM 4DV0M 2KA6B 3CTWB 4KODA 4OW0A 4DV7M 3B7QA 3LCVB 3L29A 4JI8M 2C98A 3SFZA 4B7GA 4X65M 4GHLA 3LMMA 2H1RA 2UUCM 4LF7M 4IJEA 1G41A 3HHXA 1PGYA 4LJ9A 3GRRA 2EO2A 5KPRA 5ITUA 1Z6TA 2VIIA 3A42A 3E21A 3KOXE 3L27A 2L2DA 3Q8GA 3JAMS 1HNWM 3LVVA 4B3MM 1LTMA 1TR8A 1PJJA 1P3QQ 3GLHB 4JI4M 1G8PA 2DVWB 1IFYA 2R45A 3JR4A 3VKGA 2QSFX 3HZJA 1H6UA 5H37D 3HJSA 3ZC7B 2QHOB 1OTRA 2F4VM 4GC9A 3CF2A 1KFVA 1SXJE 4LCBA 2MJ5B 3AOEC 3QAUA 2KRKA 2VF8A 5EXXA 3GLGE 2O01F 2ZAOA 1GJSA 2DWNA 2KXEA 1G3IA 1JQJC 4X62M 1NJGA 1TF0B 1AIPC 3FUVA 4I4LA 2CHVA 4LJ5A 4DR5M 2KNAA 1YSYA 3KP0E 5LMNM 1R5LA 4JI1M 4IBGA 4LF6M 2LBCA 3D8BA 1XWIA 3VDPA 1ZMUA 4AW4A 2CE7A 4IBCA 4DBGB 4PD2A 1IN6A 3HY5A 1K3WA 5EP1A 5FTNA 2LNHC 1IXSB 2CV0A 3FTDA 1VG5A 2V1UA 3TPZA 2LTUA 3RGPA 1G71A 1N33M 3PFIA 5C18A 3AV0A 2G3QA 1IY0A 4P16A 2CV1A 3TL4X 4LGYA 1QVRA 1DV0A 4P17A 1WR1B 2KDLA 3CF0A 2JWSA 3W0LB 2GNOA 2BJVA 1K82A 3QWLA 2DHYA 3HWSA 1NHGC 2WZJA 2X8AA 1GJTA 4MB7A 2WSCF 1Q39A 2YFQA 2GQFA 3VK8A 1GVNA 5FTMA 4IIWA 4NSRA 4DR7M 2KHHA 2OOBA 1T3TA 3THGA 2CRUA 4QHTA 2APLA 2L09A 1OFIA 1IBKM 1W5TA 5EXSA 4D82A 3FUXA 3I01M 1FJGM 2QZ4A 1KYIA 1GO5A 1GLNA 2MGWA 3W68A 4YY3M 1VEJA 4GITA 1NNUC 3HX3A 4LY6A 4NOOB 3U61A 3J2PB 2DHRA 1L1TA 1SXJC 1R7RA 3SC3A 1QZMA 4QOZC 3HKPA 4AKHA 2LHGA 4Q7JA 3BBZA 4LZJA 3UGJA 3SYLA 3I51A 2F5NA 4G4OA 2F5QA 2A5YB 1XXHA 3M6AA 5ITRA 1DGHB 1F4IA 1MN3A 4BBAA 1R6BX 2R62A 4X64M 3K1JA 3EIHA 3FD9A 2LVQD 1DGHA 3B89A 4JI7M 1XNRM 3C58A 1MJGM 1D2NA 2JXNA 1D0KA 4IBEA 4KO8A 3I4YA 3LQRA 3CGWA 3IECA 4G3OA 1ORYB 4RNAA 3SATA 5C1BA 4DV3M 4DUZM 4DR2M 1OFHA 1HNZM 2UU9M 2XZFA 2O5RA 2RGHA 5DYGA 2JZ0A 4IJFA 2K6BA 4JN6A 2O25A 1L1ZA 4FCTA 1TGUA 4PCZA 1JR3D 1HQCA 1HT2E 2KW0A 1I4WA 3AKZA 2ZTCA 3KVWA 3SASA 2JA2A 3ILKA 2R4JA 3U5ZB 1SXJA 1V34A 3KOWE 4RF1A 3UJNA 4LF9M 1PJQA 2EJSA 3H4JA 1T6OA 2L7HA 3KXEC 4L78A 3DOAA 2RGOA 3LCUA 2RKOA 3KW6A 1EE8A 2FE8A 5LMUM 3UMMA 1XC8A 3QYEA 3FKEA 2CFOA 2QPAA 2OPFA 4AI6A 1XXHB 5EP4A 3U6SA 2CHQA 1DGFA 4IBJA 4MGZE 4LZZA 2B3TA 4RKUF 1NV8A 4L15A 4CISA 3B9PA 2CHGA 2YNMD 2LVNC 2QBYA 4IBKA 3PVSA 4MH0E 3VFDA 2DZLA 2DXIA 4NRVA 1OQYA 1N36M 3FUTA 1G4AE 3AOEA 1C7YA 4K0KM 1QZEA 4R7GA 4DV5M 2QENA 4LF5M 2DAIA 2JZ1A 3DA1A 1XNQM 4GKKM 3GPYA 3FYDA 4LGMA 2CV2A 4JI0M 3GLFB 1OIZA 4IBBA 2HWJA 2LVOC 2R44A 3QYBA 3T6PA 4AG6A 1IXZA 2R0IA 4QOSA 1RU3A 5EQTA 4LJ8A 2P5TA 2DI0A 2I7NA 5KO3A 3HHZA 4FW9A 4AKGA 2J7OA 4BB9A 1QAMA 2D7EA 3GLFE 2Y21A 2QQ8A 1N78A 2C96A 2G5GX 3DZDA 3SYKA 1IY2A 3TWMA 3H4MA 1NVMA 4L4UA 3F92A 3U6EA 4DR4M 3AOGA 1N77A 3GQ5A 3MK6A 3GRUA 1JR3E 5FSWA 1L2DA 5BPVA 5EJCA 2E5LM 1J7KA 2UUAM 2NQ8C 2DNAA 3U60B 5E6JA 7CATA 4B3SM 1QAOA 2KRUA 4L6V6 4LRSA 4FCWA 2K47A 4M9XA 1WXQA 1R2ZA 4GEWA 3MHVC 1IN4A 2X49A 5DNYA 4LJ7A 1CUKA 2C9CA 3GP1A 3E46A 3HHYA 5A2QS 1L8QA 3VDUA 2CWBA 2JY5A 2XF3A 4PDIA 4D81A 4GMQA 4LFCM 2XSZD 4CGYB 4LJAA 2M5ZA 3W0FA 4JI3M 2L4FA 4B3RM 4CJ6A 1TDZA 2UXDM 2LVAA 1EIJA 1Z5BA 2HL7A 3GLIE 1ZAEA 3AJIB 4WP2A 2F5OA 4LFAM 3M0EA 2V6ZM 5KPZA 4G4NA 2YQZA 3IG5A 2DKLA 3R8FA 4S12A 2FOIC 1SXJB 3NBXX 4IBDA 3IG8A 1TH2A 3HU3A 4PT5A 5KQ8A 1N75A 3TWKA 5L8RF 2R4EA 4QHSA 5KQDA 1NHWC 3U60A 1E32A 1OIPA 4CHTB 2KNZA 1TH4A 2K9DA 3Q8XA 1QDTA 3AL0C 2DAMA 2EKKA 1S3SA 4ZPXA 1WGLA 3NWLA 3BOSA 1IBLM 3KSXA 4NXMM 1NV9A 1Z5AA 1VEGA 2FH0A 1PJIA 2XGNA 4JYAM 2F5PA 4NC6A 3WHKA 3GO8A 3GLGA 3U6CA 3SMPA 3TE6A 2VF7A 4Z6YA 3HJ8A 5DYIA 3B74A 2WSEF 4JI5M 2CUZA 4I8OA 4M9ZA 1JR3A 4NL4H 3M7GA 2Z4SA 2Z3XA 4GH9A 3GLHE 4F2LA 2C5RA 1N34M 4DV6M 3DFZA 2FFJA 3T1HM 3HU1A 1G59A 3J27B 2LH0A 3EIEA 3HU2A 2OQ4A 2Q2EB 3TQSA 3U61B 1IXSA 3I4VA 4KLNA 4MGIE 5EXTA 2OOAA 4OU7A 4NSOB 1NNJA 4DR3M 3ZQJA 2EA0A 3SARA 1ZMVA 2BJWA 1IM2A 1QYRA 2KEBA 4MGHA 4JXJA 3GQ4A 3C3DA 1IXRC 1IQPA 1IY1A 5FTLA 1YE9A 1I94M 1BVSA 1C1KA 1VDDA 3GLIB 4CIZA 5FTKA 4I81A 1TDHA 3C9PA 2HHHM 5ITYA 4AKIA 2YR0A 3LVWA 4G6ZA 1HT1E 1X37A 3MJ5A 3FYCA 2UXBM 5IREB 3KOZE 2CEAA 1QAQA 3SBJA 5EP2A 1QUTA 8CATA 1Y8GA 4I5SA 2BNKA 3SHFA 2XLJA 1OAOC 4GRIA 3L26A 4LRTA 4AZFA 4DV4M 1JB0F 3E4RA 2JNHA 3GLHA 4R71A 2C9OA 1NSFA 4F1IA 3I04M 3L25A 3SMSA 4QNMA 3TWLA 3GQ3A 4B7HA 1V33A 4Z8XA 4IBIA 1L2BA 1J5EM 4JV5M 1WGNA 1IN7A 2LXEA 1J09A 2ZBKB 4D80A 3OTOM 1PJTA 4KHPM 1OAIA 1QANA 3NBIA 3U6DA 4MGYE 2Z8YM 5IT9S 4B08A 1QUSA 5DFLA 4WURA 1IBMM 1XXHE
chains in the Genus database with same CATH topology
5GKNA 2AHMA 2ZANA 3HHWA 2EUCA 5ITQA 4LF4M 1MU5A 3U6LA 4LG2A 4DR1M 3ZH9B 1IN8A 1OJLA 5KPTA 3KS4A 4FCVA 3A45A 2J7NA 3GLIA 2R46A 3CF6E 3T1YM 5ITXA 2W82A 1E9RA 2Z4RA 5IZ7D 2XZUA 1SXJD 1IN5A 2Y20A 2I7PA 3GLGB 1XHBA 4II7A 1GL7A 2X4AA 2L6OA 3PXGA 4LFBM 5JI2E 1FNNA 4OVZB 3SHGB 1LV7A 3KS8A 4GHAA 1NY5A 3GLFA 3VLFB 4REZA 2Y0TA 3PNVA 1Q3CA 1MX0A 2F5SA 1TH3A 3UK6A 4X66M 2R65A 2XFTA 3LQQA 3U6PA 4GC5A 5FLXS 4FWHA 1NY6A 5JI3E 3HGIA 5IWAM 2QCUA 4FWDA 2LWXA 4M0DA 3GRYA 3VK7A 3U6OA 2C99A 2ERCA 3RFWA 3SAVA 2UUBM 3AFHA 3GPPA 4R3DA 4YHHM 3D8LA 3RE8A 3J80S 2QBYB 4ITQA 4B3TM 4TUWA 3SAWA 3K8ZA 4MGKE 4A3VB 2XFSA 5EP3A 2G8LA 4XBOA 2ZM6M 1K3XA 2HCBA 3SAUA 1N32M 2Z7JA 4BLCA 3KOYE 1HNXM 2KZSA 3KDSE 3U6MA 1HQYE 2M60A 3R9XB 2QP9X 3T38A 3VKHA 3U6QA 2V1CA 4G4RA 1Q3BA 3JR5A 5F3WA 2XSZA 3T15A 5ITXE 3RGSA 4DUYM 2XEPA 4DV1M 4DV2M 1ZQ9A 3J81S 3A46A 3J7BA 1YUBA 3A98B 3J7AS 3FUWA 1R2YA 4MM3B 1DGBA 3K92A 1E94E 3FTFA 4QNRA 2VQEM 4AQYM 4NRWA 3FUUA 3E9SA 4L16A 3UZUA 3WHLA 1QQWA 2DWZB 1XMQM 4LF8M 3U5ZA 5BR8M 5E26A 3PNYA 3KP1E 3KSJA 2R18A 2D7GA 4L8RC 4IBFA 3L2AA 2DZNB 5ITTA 2FNAA 3FTCA 4EIWA 2VQFM 4OVZA 4JI2M 3K2LA 2D7HA 1XMOM 1L2CA 2HKJA 3GPXA 4FVMA 1GL6A 4M9SA 4FD2A 3ZCBB 1HR0M 4GIPA 3KFUG 4DR6M 4LJ4A 2Y0QA 1NJFA 4HL4A 2UXCM 3HJQA 2L7IA 1PM5A 1GKIA 4GKJM 1DGGA 4B7FA 3GPUA 1DO0A 1UM8A 3GRVA 4XGIA 4AG5A 2DWMA 5EXPA 2DWLA 4OX9M 1Z59A 4M0WA 3FTEA 1E9SA 2XH9A 4JI6M 4G4QA 2DZOB 2ZAMA 1W5SA 1Z5CA 4FWGA 4W5WA 5FTJA 4RF0A 4PDGA 1KSFX 4WW0A 4HLQA 1DO2A 2KZUA 3L28A 4NXNM 4DV0M 2KA6B 3CTWB 4KODA 4OW0A 4DV7M 3L29A 4JI8M 2C98A 3SFZA 4B7GA 4X65M 4GHLA 3LMMA 2H1RA 2UUCM 4LF7M 4IJEA 1G41A 3HHXA 4LJ9A 3GRRA 2EO2A 5KPRA 5ITUA 1Z6TA 2VIIA 3A42A 3KOXE 3L27A 3JAMS 1HNWM 3LVVA 4B3MM 1PJJA 3GLHB 4JI4M 1G8PA 2DVWB 2R45A 3JR4A 3VKGA 1H6UA 5H37D 3HJSA 3ZC7B 2F4VM 4GC9A 3CF2A 1KFVA 1SXJE 4LCBA 3AOEC 3QAUA 2KRKA 5EXXA 2ZAOA 2DWNA 2KXEA 1G3IA 1JQJC 4X62M 1NJGA 3FUVA 4I4LA 2CHVA 4LJ5A 4DR5M 1YSYA 3KP0E 5LMNM 4JI1M 4LF6M 4IBGA 3D8BA 1XWIA 3VDPA 4AW4A 4PD2A 2CE7A 4IBCA 1K3WA 1IN6A 5EP1A 5FTNA 2LNHC 1IXSB 2CV0A 3FTDA 2V1UA 3TPZA 3RGPA 1N33M 3PFIA 5C18A 3AV0A 1IY0A 4P16A 2CV1A 3TL4X 4LGYA 1QVRA 3CF0A 3W0LB 2BJVA 1K82A 3QWLA 3HWSA 1NHGC 2X8AA 4MB7A 1Q39A 2YFQA 3VK8A 1GVNA 5FTMA 4IIWA 4NSRA 4DR7M 1T3TA 3THGA 4QHTA 2L09A 1OFIA 1IBKM 1W5TA 5EXSA 4D82A 3FUXA 1FJGM 2QZ4A 1KYIA 1GLNA 4YY3M 4GITA 1NNUC 4LY6A 4NOOB 3U61A 3J2PB 2DHRA 1L1TA 1SXJC 1R7RA 3SC3A 1QZMA 4QOZC 3HKPA 4AKHA 4LZJA 3UGJA 3SYLA 3I51A 2F5NA 4G4OA 2F5QA 2A5YB 1XXHA 3M6AA 5ITRA 1DGHB 4BBAA 1R6BX 2R62A 4X64M 3K1JA 3EIHA 3FD9A 1DGHA 4JI7M 1XNRM 3C58A 1D2NA 4IBEA 4KO8A 3I4YA 3LQRA 1ORYB 4RNAA 3SATA 5C1BA 4DV3M 4DUZM 4DR2M 1OFHA 1HNZM 2UU9M 2XZFA 2O5RA 2RGHA 5DYGA 4IJFA 4JN6A 1L1ZA 4FCTA 1TGUA 4PCZA 1JR3D 1HQCA 1HT2E 2KW0A 1I4WA 3AKZA 3KVWA 3SASA 2JA2A 3ILKA 2R4JA 3U5ZB 1SXJA 3KOWE 4RF1A 3UJNA 4LF9M 2L7HA 3KXEC 4L78A 3DOAA 2RGOA 2RKOA 3KW6A 1EE8A 2FE8A 5LMUM 3UMMA 1XC8A 3FKEA 2CFOA 2QPAA 2OPFA 4AI6A 1XXHB 5EP4A 3U6SA 2CHQA 1DGFA 4IBJA 4MGZE 4LZZA 4L15A 4CISA 3B9PA 2CHGA 2YNMD 2QBYA 4IBKA 3PVSA 4MH0E 3VFDA 2DXIA 4NRVA 1N36M 3FUTA 1G4AE 3AOEA 4K0KM 4R7GA 4DV5M 2QENA 4LF5M 3DA1A 1XNQM 4GKKM 3GPYA 3FYDA 4LGMA 2CV2A 4JI0M 3GLFB 4IBBA 4AG6A 1IXZA 4QOSA 5EQTA 4LJ8A 2P5TA 5KO3A 2I7NA 3HHZA 4FW9A 4AKGA 2J7OA 4BB9A 1QAMA 2D7EA 1N78A 2Y21A 2C96A 2G5GX 3DZDA 3SYKA 1IY2A 3TWMA 3H4MA 1NVMA 4L4UA 3U6EA 4DR4M 3AOGA 1N77A 3GQ5A 3MK6A 3GRUA 5FSWA 1L2DA 5BPVA 5EJCA 2E5LM 1J7KA 2UUAM 2NQ8C 3U60B 5E6JA 7CATA 4B3SM 1QAOA 2KRUA 4LRSA 4FCWA 2K47A 4M9XA 1WXQA 1R2ZA 3MHVC 1IN4A 2X49A 5DNYA 4LJ7A 2C9CA 3GP1A 3HHYA 5A2QS 1L8QA 3VDUA 2XF3A 4PDIA 4D81A 4GMQA 4LFCM 2XSZD 4CGYB 4LJAA 2M5ZA 3W0FA 4JI3M 4B3RM 1TDZA 2UXDM 1Z5BA 2HL7A 1ZAEA 3AJIB 2F5OA 4LFAM 3M0EA 2V6ZM 5KPZA 4G4NA 2YQZA 3IG5A 3R8FA 4S12A 2FOIC 1SXJB 4IBDA 3IG8A 1TH2A 3HU3A 4PT5A 5KQ8A 1N75A 3TWKA 2R4EA 4QHSA 5KQDA 1NHWC 3U60A 1E32A 4CHTB 1TH4A 3Q8XA 3AL0C 1S3SA 4ZPXA 3NWLA 3BOSA 1IBLM 3KSXA 4NXMM 1Z5AA 1PJIA 2XGNA 4JYAM 2F5PA 3WHKA 3GLGA 3GO8A 3U6CA 3SMPA 3TE6A 4Z6YA 3HJ8A 5DYIA 4JI5M 2CUZA 4I8OA 4M9ZA 1JR3A 4NL4H 3M7GA 2Z4SA 2Z3XA 4GH9A 1N34M 2C5RA 4DV6M 3DFZA 2FFJA 3T1HM 3HU1A 1G59A 3J27B 2LH0A 3EIEA 3HU2A 2OQ4A 2Q2EB 3TQSA 3U61B 3I4VA 4KLNA 4MGIE 5EXTA 4OU7A 4NSOB 1NNJA 4DR3M 2EA0A 3SARA 2BJWA 4MGHA 1IM2A 1QYRA 2KEBA 4JXJA 3GQ4A 1IXRC 1IQPA 1IY1A 5FTLA 1YE9A 1I94M 1C1KA 1VDDA 3GLIB 5FTKA 4I81A 1TDHA 2HHHM 4AKIA 5ITYA 2YR0A 3LVWA 4G6ZA 1HT1E 1X37A 3MJ5A 3FYCA 2UXBM 5IREB 3KOZE 2CEAA 1QAQA 3SBJA 5EP2A 8CATA 4I5SA 2BNKA 3SHFA 2XLJA 4GRIA 3L26A 4LRTA 4AZFA 4DV4M 3E4RA 3GLHA 2C9OA 1NSFA 3L25A 3SMSA 4QNMA 3TWLA 3GQ3A 4B7HA 4Z8XA 4IBIA 1L2BA 1J5EM 4JV5M 1IN7A 2LXEA 1J09A 2ZBKB 4D80A 3OTOM 4KHPM 1QANA 3NBIA 3U6DA 4MGYE 5IT9S 4B08A 4WURA 1IBMM 4LJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC7 B;  3ZCB B;  3SHG B; 
#chains in the Genus database with same CATH topology
 5GKN A;  1WIV A;  2AHM A;  2ZAN A;  3MMP A;  3HHW A;  2DAG A;  2EUC A;  5ITQ A;  4LF4 M;  1MU5 A;  3U6L A;  4LG2 A;  4DR1 M;  3ZH9 B;  1IN8 A;  2BWB A;  1OJL A;  2H5X A;  5KPT A;  3KS4 A;  4FCV A;  2DEN A;  2QNJ A;  3A45 A;  2J7N A;  1NO1 A;  3GLI A;  4LJ6 A;  2L4E A;  2R46 A;  3CF6 E;  3T1Y M;  2JUJ A;  3K9O A;  2W82 A;  1E9R A;  2Z4R A;  5ITX A;  5IZ7 D;  2XZU A;  1SXJ D;  1IN5 A;  2Y20 A;  2I7P A;  3GLG B;  1EFU B;  1XHB A;  2MRO B;  3IHP A;  4II7 A;  4Y28 F;  1GL7 A;  2X4A A;  2L6O A;  2OO9 A;  4XK8 F;  4HEO A;  2RRU A;  3PXG A;  4LFB M;  3LW5 F;  5JI2 E;  1XMQ M;  1FNN A;  3V76 A;  4OVZ B;  3SHG B;  1LV7 A;  3KS8 A;  2R6F A;  4GHA A;  1NY5 A;  3GLF A;  3VLF B;  4REZ A;  3W67 A;  2Y0T A;  3PNV A;  3C3E A;  2N35 A;  1Q3C A;  1MX0 A;  2F5S A;  1TH3 A;  3UK6 A;  4X66 M;  2R65 A;  2XFT A;  1WHC A;  3LQQ A;  3U6P A;  4GC5 A;  5FLX S;  4FWH A;  1NY6 A;  5JI3 E;  3HGI A;  5IWA M;  2QCU A;  1D0L A;  4FWD A;  2LWX A;  3K9P A;  3GRY A;  4M0D A;  3U6O A;  3VK7 A;  3B7N A;  2C99 A;  1A5T A;  1WJ7 A;  2ERC A;  2JY7 A;  3RFW A;  3SAV A;  2HAK A;  2DAE A;  2UUB M;  1T43 A;  3AFH A;  3GPP A;  4R3D A;  4YHH M;  3D8L A;  3RE8 A;  2LVP C;  3J80 S;  2QBY B;  4ITQ A;  4B3T M;  4TUW A;  3SAW A;  4UN2 B;  3K8Z A;  4MGK E;  4A3V B;  2XFS A;  5EP3 A;  2G8L A;  1D0M A;  4XBO A;  2ZM6 M;  1PJS A;  1K3X A;  2HCB A;  2DAK A;  3SAU A;  1N32 M;  2Z7J A;  2CP8 A;  4BLC A;  1ZV1 A;  1Q02 A;  1VQ1 A;  3KOY E;  2KZS A;  3KDS E;  3U6M A;  1HNX M;  2M60 A;  1HQY E;  3R9X B;  2QP9 X;  3T38 A;  3VKH A;  2JY8 A;  1YLA A;  2ZTD A;  3U6Q A;  2V1C A;  4G4R A;  1Q3B A;  3JR5 A;  5F3W A;  1UFZ A;  2XSZ A;  1VDL A;  3T15 A;  5ITX E;  3RGS A;  4DUY M;  1SG9 A;  2XEP A;  4DV1 M;  4DV2 M;  1ZQ9 A;  3J81 S;  2VDB B;  3A46 A;  3J7B A;  1YUB A;  3A98 B;  1QDR A;  1VEK A;  3J7A S;  3FUW A;  1R2Y A;  4MM3 B;  1DGB A;  1XB2 B;  3K92 A;  1E94 E;  2LHC A;  2JY6 B;  3FTF A;  4QNR A;  2VQE M;  4AQY M;  4NRW A;  1TTE A;  3E9S A;  3BXW A;  3FUU A;  4L16 A;  1QQW A;  2DWZ B;  3UZU A;  3WHL A;  2KNV A;  2FS1 A;  5BR8 M;  3U5Z A;  5E26 A;  4LF8 M;  3PNY A;  2MR9 A;  3KP1 E;  3KSJ A;  2R18 A;  4ANR A;  2D7G A;  4KT0 F;  4IBF A;  4L8R C;  1OKS A;  3L2A A;  2DZN B;  5ITT A;  2FNA A;  3FTC A;  4EIW A;  2VQF M;  4OVZ A;  4JI2 M;  2J5Y A;  3K2L A;  2JP7 A;  2D7H A;  3FRH A;  2WSF F;  1XMO M;  1L2C A;  2HKJ A;  3GPX A;  1GL6 A;  2BWE A;  4FVM A;  2EKF A;  4FD2 A;  4M9S A;  3ZCB B;  4GIP A;  1HR0 M;  3KFU G;  3B7Z A;  4DR6 M;  4LJ4 A;  3FE3 A;  1V92 A;  2Y0Q A;  1NJF A;  4HL4 A;  2UXC M;  1R4G A;  3HJQ A;  2L7I A;  1PM5 A;  1GKI A;  4GKJ M;  2K0B X;  1DGG A;  4B7F A;  1AUA A;  3GPU A;  3FRI A;  1DO0 A;  1UM8 A;  3GRV A;  2MH8 A;  4XGI A;  4AG5 A;  5EXP A;  2DWM A;  2DWL A;  1Z59 A;  4M0W A;  4OX9 M;  3FTE A;  1GAB A;  1HJP A;  1E9S A;  2XH9 A;  4JI6 M;  4G4Q A;  2DZO B;  2ZAM A;  1W5S A;  1Z5C A;  4FWG A;  4W5W A;  5FTJ A;  1ZMW A;  4RF0 A;  1KSF X;  1PRB A;  4HLQ A;  1DO2 A;  2KZU A;  4WW0 A;  4PDG A;  3L28 A;  4NXN M;  4DV0 M;  2KA6 B;  3CTW B;  4KOD A;  4OW0 A;  4DV7 M;  3B7Q A;  3LCV B;  3L29 A;  4JI8 M;  2C98 A;  3SFZ A;  4B7G A;  4X65 M;  4GHL A;  3LMM A;  2H1R A;  2UUC M;  4LF7 M;  4IJE A;  1G41 A;  3HHX A;  1PGY A;  4LJ9 A;  3GRR A;  2EO2 A;  5KPR A;  5ITU A;  1Z6T A;  2VII A;  3A42 A;  3E21 A;  3KOX E;  3L27 A;  2L2D A;  3Q8G A;  3JAM S;  1HNW M;  3LVV A;  4B3M M;  1LTM A;  1TR8 A;  1PJJ A;  1P3Q Q;  3GLH B;  4JI4 M;  1G8P A;  2DVW B;  1IFY A;  2R45 A;  3JR4 A;  3VKG A;  2QSF X;  3HZJ A;  1H6U A;  5H37 D;  3HJS A;  3ZC7 B;  2QHO B;  1OTR A;  2F4V M;  4GC9 A;  3CF2 A;  1KFV A;  1SXJ E;  4LCB A;  2MJ5 B;  3AOE C;  3QAU A;  2KRK A;  2VF8 A;  5EXX A;  3GLG E;  2O01 F;  2ZAO A;  1GJS A;  2DWN A;  2KXE A;  1G3I A;  1JQJ C;  4X62 M;  1NJG A;  1TF0 B;  1AIP C;  3FUV A;  4I4L A;  2CHV A;  4LJ5 A;  4DR5 M;  2KNA A;  1YSY A;  3KP0 E;  5LMN M;  1R5L A;  4JI1 M;  4IBG A;  4LF6 M;  2LBC A;  3D8B A;  1XWI A;  3VDP A;  1ZMU A;  4AW4 A;  2CE7 A;  4IBC A;  4DBG B;  4PD2 A;  1IN6 A;  3HY5 A;  1K3W A;  5EP1 A;  5FTN A;  2LNH C;  1IXS B;  2CV0 A;  3FTD A;  1VG5 A;  2V1U A;  3TPZ A;  2LTU A;  3RGP A;  1G71 A;  1N33 M;  3PFI A;  5C18 A;  3AV0 A;  2G3Q A;  1IY0 A;  4P16 A;  2CV1 A;  3TL4 X;  4LGY A;  1QVR A;  1DV0 A;  4P17 A;  1WR1 B;  2KDL A;  3CF0 A;  2JWS A;  3W0L B;  2GNO A;  2BJV A;  1K82 A;  3QWL A;  2DHY A;  3HWS A;  1NHG C;  2WZJ A;  2X8A A;  1GJT A;  4MB7 A;  2WSC F;  1Q39 A;  2YFQ A;  2GQF A;  3VK8 A;  1GVN A;  5FTM A;  4IIW A;  4NSR A;  4DR7 M;  2KHH A;  2OOB A;  1T3T A;  3THG A;  2CRU A;  4QHT A;  2APL A;  2L09 A;  1OFI A;  1IBK M;  1W5T A;  5EXS A;  4D82 A;  3FUX A;  3I01 M;  1FJG M;  2QZ4 A;  1KYI A;  1GO5 A;  1GLN A;  2MGW A;  3W68 A;  4YY3 M;  1VEJ A;  4GIT A;  1NNU C;  3HX3 A;  4LY6 A;  4NOO B;  3U61 A;  3J2P B;  2DHR A;  1L1T A;  1SXJ C;  1R7R A;  3SC3 A;  1QZM A;  4QOZ C;  3HKP A;  4AKH A;  2LHG A;  4Q7J A;  3BBZ A;  4LZJ A;  3UGJ A;  3SYL A;  3I51 A;  2F5N A;  4G4O A;  2F5Q A;  2A5Y B;  1XXH A;  3M6A A;  5ITR A;  1DGH B;  1F4I A;  1MN3 A;  4BBA A;  1R6B X;  2R62 A;  4X64 M;  3K1J A;  3EIH A;  3FD9 A;  2LVQ D;  1DGH A;  3B89 A;  4JI7 M;  1XNR M;  3C58 A;  1MJG M;  1D2N A;  2JXN A;  1D0K A;  4IBE A;  4KO8 A;  3I4Y A;  3LQR A;  3CGW A;  3IEC A;  4G3O A;  1ORY B;  4RNA A;  3SAT A;  5C1B A;  4DV3 M;  4DUZ M;  4DR2 M;  1OFH A;  1HNZ M;  2UU9 M;  2XZF A;  2O5R A;  2RGH A;  5DYG A;  2JZ0 A;  4IJF A;  2K6B A;  4JN6 A;  2O25 A;  1L1Z A;  4FCT A;  1TGU A;  4PCZ A;  1JR3 D;  1HQC A;  1HT2 E;  2KW0 A;  1I4W A;  3AKZ A;  2ZTC A;  3KVW A;  3SAS A;  2JA2 A;  3ILK A;  2R4J A;  3U5Z B;  1SXJ A;  1V34 A;  3KOW E;  4RF1 A;  3UJN A;  4LF9 M;  1PJQ A;  2EJS A;  3H4J A;  1T6O A;  2L7H A;  3KXE C;  4L78 A;  3DOA A;  2RGO A;  3LCU A;  2RKO A;  3KW6 A;  1EE8 A;  2FE8 A;  5LMU M;  3UMM A;  1XC8 A;  3QYE A;  3FKE A;  2CFO A;  2QPA A;  2OPF A;  4AI6 A;  1XXH B;  5EP4 A;  3U6S A;  2CHQ A;  1DGF A;  4IBJ A;  4MGZ E;  4LZZ A;  2B3T A;  4RKU F;  1NV8 A;  4L15 A;  4CIS A;  3B9P A;  2CHG A;  2YNM D;  2LVN C;  2QBY A;  4IBK A;  3PVS A;  4MH0 E;  3VFD A;  2DZL A;  2DXI A;  4NRV A;  1OQY A;  1N36 M;  3FUT A;  1G4A E;  3AOE A;  1C7Y A;  4K0K M;  1QZE A;  4R7G A;  4DV5 M;  2QEN A;  4LF5 M;  2DAI A;  2JZ1 A;  3DA1 A;  1XNQ M;  4GKK M;  3GPY A;  3FYD A;  4LGM A;  2CV2 A;  4JI0 M;  3GLF B;  1OIZ A;  4IBB A;  2HWJ A;  2LVO C;  2R44 A;  3QYB A;  3T6P A;  4AG6 A;  1IXZ A;  2R0I A;  4QOS A;  1RU3 A;  5EQT A;  4LJ8 A;  2P5T A;  2DI0 A;  2I7N A;  5KO3 A;  3HHZ A;  4FW9 A;  4AKG A;  2J7O A;  4BB9 A;  1QAM A;  2D7E A;  3GLF E;  2Y21 A;  2QQ8 A;  1N78 A;  2C96 A;  2G5G X;  3DZD A;  3SYK A;  1IY2 A;  3TWM A;  3H4M A;  1NVM A;  4L4U A;  3F92 A;  3U6E A;  4DR4 M;  3AOG A;  1N77 A;  3GQ5 A;  3MK6 A;  3GRU A;  1JR3 E;  5FSW A;  1L2D A;  5BPV A;  5EJC A;  2E5L M;  1J7K A;  2UUA M;  2NQ8 C;  2DNA A;  3U60 B;  5E6J A;  7CAT A;  4B3S M;  1QAO A;  2KRU A;  4L6V 6;  4LRS A;  4FCW A;  2K47 A;  4M9X A;  1WXQ A;  1R2Z A;  4GEW A;  3MHV C;  1IN4 A;  2X49 A;  5DNY A;  4LJ7 A;  1CUK A;  2C9C A;  3GP1 A;  3E46 A;  3HHY A;  5A2Q S;  1L8Q A;  3VDU A;  2CWB A;  2JY5 A;  2XF3 A;  4PDI A;  4D81 A;  4GMQ A;  4LFC M;  2XSZ D;  4CGY B;  4LJA A;  2M5Z A;  3W0F A;  4JI3 M;  2L4F A;  4B3R M;  4CJ6 A;  1TDZ A;  2UXD M;  2LVA A;  1EIJ A;  1Z5B A;  2HL7 A;  3GLI E;  1ZAE A;  3AJI B;  4WP2 A;  2F5O A;  4LFA M;  3M0E A;  2V6Z M;  5KPZ A;  4G4N A;  2YQZ A;  3IG5 A;  2DKL A;  3R8F A;  4S12 A;  2FOI C;  1SXJ B;  3NBX X;  4IBD A;  3IG8 A;  1TH2 A;  3HU3 A;  4PT5 A;  5KQ8 A;  1N75 A;  3TWK A;  5L8R F;  2R4E A;  4QHS A;  5KQD A;  1NHW C;  3U60 A;  1E32 A;  1OIP A;  4CHT B;  2KNZ A;  1TH4 A;  2K9D A;  3Q8X A;  1QDT A;  3AL0 C;  2DAM A;  2EKK A;  1S3S A;  4ZPX A;  1WGL A;  3NWL A;  3BOS A;  1IBL M;  3KSX A;  4NXM M;  1NV9 A;  1Z5A A;  1VEG A;  2FH0 A;  1PJI A;  2XGN A;  4JYA M;  2F5P A;  4NC6 A;  3WHK A;  3GO8 A;  3GLG A;  3U6C A;  3SMP A;  3TE6 A;  2VF7 A;  4Z6Y A;  3HJ8 A;  5DYI A;  3B74 A;  2WSE F;  4JI5 M;  2CUZ A;  4I8O A;  4M9Z A;  1JR3 A;  4NL4 H;  3M7G A;  2Z4S A;  2Z3X A;  4GH9 A;  3GLH E;  4F2L A;  2C5R A;  1N34 M;  4DV6 M;  3DFZ A;  2FFJ A;  3T1H M;  3HU1 A;  1G59 A;  3J27 B;  2LH0 A;  3EIE A;  3HU2 A;  2OQ4 A;  2Q2E B;  3TQS A;  3U61 B;  1IXS A;  3I4V A;  4KLN A;  4MGI E;  5EXT A;  2OOA A;  4OU7 A;  4NSO B;  1NNJ A;  4DR3 M;  3ZQJ A;  2EA0 A;  3SAR A;  1ZMV A;  2BJW A;  1IM2 A;  1QYR A;  2KEB A;  4MGH A;  4JXJ A;  3GQ4 A;  3C3D A;  1IXR C;  1IQP A;  1IY1 A;  5FTL A;  1YE9 A;  1I94 M;  1BVS A;  1C1K A;  1VDD A;  3GLI B;  4CIZ A;  5FTK A;  4I81 A;  1TDH A;  3C9P A;  2HHH M;  5ITY A;  4AKI A;  2YR0 A;  3LVW A;  4G6Z A;  1HT1 E;  1X37 A;  3MJ5 A;  3FYC A;  2UXB M;  5IRE B;  3KOZ E;  2CEA A;  1QAQ A;  3SBJ A;  5EP2 A;  1QUT A;  8CAT A;  1Y8G A;  4I5S A;  2BNK A;  3SHF A;  2XLJ A;  1OAO C;  4GRI A;  3L26 A;  4LRT A;  4AZF A;  4DV4 M;  1JB0 F;  3E4R A;  2JNH A;  3GLH A;  4R71 A;  2C9O A;  1NSF A;  4F1I A;  3I04 M;  3L25 A;  3SMS A;  4QNM A;  3TWL A;  3GQ3 A;  4B7H A;  1V33 A;  4Z8X A;  4IBI A;  1L2B A;  1J5E M;  4JV5 M;  1WGN A;  1IN7 A;  2LXE A;  1J09 A;  2ZBK B;  4D80 A;  3OTO M;  1PJT A;  4KHP M;  1OAI A;  1QAN A;  3NBI A;  3U6D A;  4MGY E;  2Z8Y M;  5IT9 S;  4B08 A;  1QUS A;  5DFL A;  4WUR A;  1IBM M;  1XXH E; 
#chains in the Genus database with same CATH homology
 5GKN A;  2AHM A;  2ZAN A;  3HHW A;  2EUC A;  5ITQ A;  4LF4 M;  1MU5 A;  3U6L A;  4LG2 A;  4DR1 M;  3ZH9 B;  1IN8 A;  1OJL A;  5KPT A;  3KS4 A;  4FCV A;  3A45 A;  2J7N A;  3GLI A;  2R46 A;  3CF6 E;  3T1Y M;  5ITX A;  2W82 A;  1E9R A;  2Z4R A;  5IZ7 D;  2XZU A;  1SXJ D;  1IN5 A;  2Y20 A;  2I7P A;  3GLG B;  1XHB A;  4II7 A;  1GL7 A;  2X4A A;  2L6O A;  3PXG A;  4LFB M;  5JI2 E;  1FNN A;  4OVZ B;  3SHG B;  1LV7 A;  3KS8 A;  4GHA A;  1NY5 A;  3GLF A;  3VLF B;  4REZ A;  2Y0T A;  3PNV A;  1Q3C A;  1MX0 A;  2F5S A;  1TH3 A;  3UK6 A;  4X66 M;  2R65 A;  2XFT A;  3LQQ A;  3U6P A;  4GC5 A;  5FLX S;  4FWH A;  1NY6 A;  5JI3 E;  3HGI A;  5IWA M;  2QCU A;  4FWD A;  2LWX A;  4M0D A;  3GRY A;  3VK7 A;  3U6O A;  2C99 A;  2ERC A;  3RFW A;  3SAV A;  2UUB M;  3AFH A;  3GPP A;  4R3D A;  4YHH M;  3D8L A;  3RE8 A;  3J80 S;  2QBY B;  4ITQ A;  4B3T M;  4TUW A;  3SAW A;  3K8Z A;  4MGK E;  4A3V B;  2XFS A;  5EP3 A;  2G8L A;  4XBO A;  2ZM6 M;  1K3X A;  2HCB A;  3SAU A;  1N32 M;  2Z7J A;  4BLC A;  3KOY E;  1HNX M;  2KZS A;  3KDS E;  3U6M A;  1HQY E;  2M60 A;  3R9X B;  2QP9 X;  3T38 A;  3VKH A;  3U6Q A;  2V1C A;  4G4R A;  1Q3B A;  3JR5 A;  5F3W A;  2XSZ A;  3T15 A;  5ITX E;  3RGS A;  4DUY M;  2XEP A;  4DV1 M;  4DV2 M;  1ZQ9 A;  3J81 S;  3A46 A;  3J7B A;  1YUB A;  3A98 B;  3J7A S;  3FUW A;  1R2Y A;  4MM3 B;  1DGB A;  3K92 A;  1E94 E;  3FTF A;  4QNR A;  2VQE M;  4AQY M;  4NRW A;  3FUU A;  3E9S A;  4L16 A;  3UZU A;  3WHL A;  1QQW A;  2DWZ B;  1XMQ M;  4LF8 M;  3U5Z A;  5BR8 M;  5E26 A;  3PNY A;  3KP1 E;  3KSJ A;  2R18 A;  2D7G A;  4L8R C;  4IBF A;  3L2A A;  2DZN B;  5ITT A;  2FNA A;  3FTC A;  4EIW A;  2VQF M;  4OVZ A;  4JI2 M;  3K2L A;  2D7H A;  1XMO M;  1L2C A;  2HKJ A;  3GPX A;  4FVM A;  1GL6 A;  4M9S A;  4FD2 A;  3ZCB B;  1HR0 M;  4GIP A;  3KFU G;  4DR6 M;  4LJ4 A;  2Y0Q A;  1NJF A;  4HL4 A;  2UXC M;  3HJQ A;  2L7I A;  1PM5 A;  1GKI A;  4GKJ M;  1DGG A;  4B7F A;  3GPU A;  1DO0 A;  1UM8 A;  3GRV A;  4XGI A;  4AG5 A;  2DWM A;  5EXP A;  2DWL A;  4OX9 M;  1Z59 A;  4M0W A;  3FTE A;  1E9S A;  2XH9 A;  4JI6 M;  4G4Q A;  2DZO B;  2ZAM A;  1W5S A;  1Z5C A;  4FWG A;  4W5W A;  5FTJ A;  4RF0 A;  4PDG A;  1KSF X;  4WW0 A;  4HLQ A;  1DO2 A;  2KZU A;  3L28 A;  4NXN M;  4DV0 M;  2KA6 B;  3CTW B;  4KOD A;  4OW0 A;  4DV7 M;  3L29 A;  4JI8 M;  2C98 A;  3SFZ A;  4B7G A;  4X65 M;  4GHL A;  3LMM A;  2H1R A;  2UUC M;  4LF7 M;  4IJE A;  1G41 A;  3HHX A;  4LJ9 A;  3GRR A;  2EO2 A;  5KPR A;  5ITU A;  1Z6T A;  2VII A;  3A42 A;  3KOX E;  3L27 A;  3JAM S;  1HNW M;  3LVV A;  4B3M M;  1PJJ A;  3GLH B;  4JI4 M;  1G8P A;  2DVW B;  2R45 A;  3JR4 A;  3VKG A;  1H6U A;  5H37 D;  3HJS A;  3ZC7 B;  2F4V M;  4GC9 A;  3CF2 A;  1KFV A;  1SXJ E;  4LCB A;  3AOE C;  3QAU A;  2KRK A;  5EXX A;  2ZAO A;  2DWN A;  2KXE A;  1G3I A;  1JQJ C;  4X62 M;  1NJG A;  3FUV A;  4I4L A;  2CHV A;  4LJ5 A;  4DR5 M;  1YSY A;  3KP0 E;  5LMN M;  4JI1 M;  4LF6 M;  4IBG A;  3D8B A;  1XWI A;  3VDP A;  4AW4 A;  4PD2 A;  2CE7 A;  4IBC A;  1K3W A;  1IN6 A;  5EP1 A;  5FTN A;  2LNH C;  1IXS B;  2CV0 A;  3FTD A;  2V1U A;  3TPZ A;  3RGP A;  1N33 M;  3PFI A;  5C18 A;  3AV0 A;  1IY0 A;  4P16 A;  2CV1 A;  3TL4 X;  4LGY A;  1QVR A;  3CF0 A;  3W0L B;  2BJV A;  1K82 A;  3QWL A;  3HWS A;  1NHG C;  2X8A A;  4MB7 A;  1Q39 A;  2YFQ A;  3VK8 A;  1GVN A;  5FTM A;  4IIW A;  4NSR A;  4DR7 M;  1T3T A;  3THG A;  4QHT A;  2L09 A;  1OFI A;  1IBK M;  1W5T A;  5EXS A;  4D82 A;  3FUX A;  1FJG M;  2QZ4 A;  1KYI A;  1GLN A;  4YY3 M;  4GIT A;  1NNU C;  4LY6 A;  4NOO B;  3U61 A;  3J2P B;  2DHR A;  1L1T A;  1SXJ C;  1R7R A;  3SC3 A;  1QZM A;  4QOZ C;  3HKP A;  4AKH A;  4LZJ A;  3UGJ A;  3SYL A;  3I51 A;  2F5N A;  4G4O A;  2F5Q A;  2A5Y B;  1XXH A;  3M6A A;  5ITR A;  1DGH B;  4BBA A;  1R6B X;  2R62 A;  4X64 M;  3K1J A;  3EIH A;  3FD9 A;  1DGH A;  4JI7 M;  1XNR M;  3C58 A;  1D2N A;  4IBE A;  4KO8 A;  3I4Y A;  3LQR A;  1ORY B;  4RNA A;  3SAT A;  5C1B A;  4DV3 M;  4DUZ M;  4DR2 M;  1OFH A;  1HNZ M;  2UU9 M;  2XZF A;  2O5R A;  2RGH A;  5DYG A;  4IJF A;  4JN6 A;  1L1Z A;  4FCT A;  1TGU A;  4PCZ A;  1JR3 D;  1HQC A;  1HT2 E;  2KW0 A;  1I4W A;  3AKZ A;  3KVW A;  3SAS A;  2JA2 A;  3ILK A;  2R4J A;  3U5Z B;  1SXJ A;  3KOW E;  4RF1 A;  3UJN A;  4LF9 M;  2L7H A;  3KXE C;  4L78 A;  3DOA A;  2RGO A;  2RKO A;  3KW6 A;  1EE8 A;  2FE8 A;  5LMU M;  3UMM A;  1XC8 A;  3FKE A;  2CFO A;  2QPA A;  2OPF A;  4AI6 A;  1XXH B;  5EP4 A;  3U6S A;  2CHQ A;  1DGF A;  4IBJ A;  4MGZ E;  4LZZ A;  4L15 A;  4CIS A;  3B9P A;  2CHG A;  2YNM D;  2QBY A;  4IBK A;  3PVS A;  4MH0 E;  3VFD A;  2DXI A;  4NRV A;  1N36 M;  3FUT A;  1G4A E;  3AOE A;  4K0K M;  4R7G A;  4DV5 M;  2QEN A;  4LF5 M;  3DA1 A;  1XNQ M;  4GKK M;  3GPY A;  3FYD A;  4LGM A;  2CV2 A;  4JI0 M;  3GLF B;  4IBB A;  4AG6 A;  1IXZ A;  4QOS A;  5EQT A;  4LJ8 A;  2P5T A;  5KO3 A;  2I7N A;  3HHZ A;  4FW9 A;  4AKG A;  2J7O A;  4BB9 A;  1QAM A;  2D7E A;  1N78 A;  2Y21 A;  2C96 A;  2G5G X;  3DZD A;  3SYK A;  1IY2 A;  3TWM A;  3H4M A;  1NVM A;  4L4U A;  3U6E A;  4DR4 M;  3AOG A;  1N77 A;  3GQ5 A;  3MK6 A;  3GRU A;  5FSW A;  1L2D A;  5BPV A;  5EJC A;  2E5L M;  1J7K A;  2UUA M;  2NQ8 C;  3U60 B;  5E6J A;  7CAT A;  4B3S M;  1QAO A;  2KRU A;  4LRS A;  4FCW A;  2K47 A;  4M9X A;  1WXQ A;  1R2Z A;  3MHV C;  1IN4 A;  2X49 A;  5DNY A;  4LJ7 A;  2C9C A;  3GP1 A;  3HHY A;  5A2Q S;  1L8Q A;  3VDU A;  2XF3 A;  4PDI A;  4D81 A;  4GMQ A;  4LFC M;  2XSZ D;  4CGY B;  4LJA A;  2M5Z A;  3W0F A;  4JI3 M;  4B3R M;  1TDZ A;  2UXD M;  1Z5B A;  2HL7 A;  1ZAE A;  3AJI B;  2F5O A;  4LFA M;  3M0E A;  2V6Z M;  5KPZ A;  4G4N A;  2YQZ A;  3IG5 A;  3R8F A;  4S12 A;  2FOI C;  1SXJ B;  4IBD A;  3IG8 A;  1TH2 A;  3HU3 A;  4PT5 A;  5KQ8 A;  1N75 A;  3TWK A;  2R4E A;  4QHS A;  5KQD A;  1NHW C;  3U60 A;  1E32 A;  4CHT B;  1TH4 A;  3Q8X A;  3AL0 C;  1S3S A;  4ZPX A;  3NWL A;  3BOS A;  1IBL M;  3KSX A;  4NXM M;  1Z5A A;  1PJI A;  2XGN A;  4JYA M;  2F5P A;  3WHK A;  3GLG A;  3GO8 A;  3U6C A;  3SMP A;  3TE6 A;  4Z6Y A;  3HJ8 A;  5DYI A;  4JI5 M;  2CUZ A;  4I8O A;  4M9Z A;  1JR3 A;  4NL4 H;  3M7G A;  2Z4S A;  2Z3X A;  4GH9 A;  1N34 M;  2C5R A;  4DV6 M;  3DFZ A;  2FFJ A;  3T1H M;  3HU1 A;  1G59 A;  3J27 B;  2LH0 A;  3EIE A;  3HU2 A;  2OQ4 A;  2Q2E B;  3TQS A;  3U61 B;  3I4V A;  4KLN A;  4MGI E;  5EXT A;  4OU7 A;  4NSO B;  1NNJ A;  4DR3 M;  2EA0 A;  3SAR A;  2BJW A;  4MGH A;  1IM2 A;  1QYR A;  2KEB A;  4JXJ A;  3GQ4 A;  1IXR C;  1IQP A;  1IY1 A;  5FTL A;  1YE9 A;  1I94 M;  1C1K A;  1VDD A;  3GLI B;  5FTK A;  4I81 A;  1TDH A;  2HHH M;  4AKI A;  5ITY A;  2YR0 A;  3LVW A;  4G6Z A;  1HT1 E;  1X37 A;  3MJ5 A;  3FYC A;  2UXB M;  5IRE B;  3KOZ E;  2CEA A;  1QAQ A;  3SBJ A;  5EP2 A;  8CAT A;  4I5S A;  2BNK A;  3SHF A;  2XLJ A;  4GRI A;  3L26 A;  4LRT A;  4AZF A;  4DV4 M;  3E4R A;  3GLH A;  2C9O A;  1NSF A;  3L25 A;  3SMS A;  4QNM A;  3TWL A;  3GQ3 A;  4B7H A;  4Z8X A;  4IBI A;  1L2B A;  1J5E M;  4JV5 M;  1IN7 A;  2LXE A;  1J09 A;  2ZBK B;  4D80 A;  3OTO M;  4KHP M;  1QAN A;  3NBI A;  3U6D A;  4MGY E;  5IT9 S;  4B08 A;  4WUR A;  1IBM M;  4LJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...