3ZC7B

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
63
structure length
63
Chain Sequence
MVLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
total genus 25
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zc7B00
3SHGB 3ZC7B 3ZCBB
chains in the Genus database with same CATH superfamily
1IQPA 4JI6M 2UXBM 4FVMA 3B7ZA 4FWDA 1R2YA 1IXZA 3PNYA 2DWMA 2XSZA 4ITQA 4AKIA 5DFLA 4DBGB 4DR3M 2R0IA 1XB2B 3MJ5A 3BOSA 3HWSA 1ZAEA 2ZAOA 4R3DA 2FOIC 2ZANA 2CHGA 3T1YM 3FD9A 3AJIB 4NC6A 2BJWA 1WXQA 2MGWA 3GPYA 3J7BA 2XLJA 4DV7M 1OQYA 4IBJA 3SHGB 1QUTA 1VDDA 3I51A 4DR4M 1VDLA 3GLHB 3QWLA 2JWSA 4CIZA 2FE8A 3B9PA 5A2QS 2EKFA 3HJ8A 4ZPXA 1G3IA 1V33A 3U6EA 4B3RM 1IN4A 1HR0M 4AG6A 1GJSA 3FYDA 1KSFX 1IXSA 1SXJD 3GLFE 2R6FA 4B3TM 3AOEA 2LVOC 1FNNA 3B89A 2R62A 3WHLA 4LJ5A 4MH0E 4D80A 4F2LA 5JI2E 3K1JA 1L2BA 2JZ0A 2DAKA 4P16A 4L4UA 3A98B 1WHCA 4MGHA 2GNOA 2LHGA 2VDBB 1MN3A 3SMPA 3TWMA 2C98A 2QCUA 3GPPA 5E6JA 1XHBA 2ERCA 1OJLA 2M5ZA 3A45A 1A5TA 2N35A 2FNAA 3PVSA 3SMSA 4G4RA 4MGIE 3SATA 1XWIA 1G71A 4B7GA 2XEPA 2D7GA 3ZCBB 2HWJA 3LVVA 2CWBA 2WSEF 4DV2M 3RFWA 3HHYA 3GPXA 1TDZA 1GLNA 2YNMD 3BBZA 4JI7M 2DWNA 3H4JA 2LWXA 1ORYB 5IZ7D 1IXSB 3B74A 3SYLA 3SAVA 4JI0M 1R6BX 2JZ1A 3EIEA 3SHFA 3SARA 1E9RA 4FCWA 2DAEA 4GC5A 4WURA 5LMNM 2KHHA 1E9SA 3DA1A 4OW0A 4R7GA 4FWGA 3U6SA 1DO0A 1NV8A 4PD2A 2DXIA 2H1RA 1K3XA 2HHHM 3SBJA 3SASA 2C99A 3I4VA 3T6PA 1YLAA 1PM5A 3HHWA 3AL0C 4RKUF 3UZUA 5KPRA 2RGHA 2DENA 1TR8A 1XXHA 1VEKA 1GO5A 3M6AA 3GRRA 2BNKA 4M9SA 3GQ5A 4LJ4A 1RU3A 2JY6B 1R2ZA 2WSFF 4EIWA 3LVWA 1Q02A 4BBAA 4JI1M 3GLGA 2KRKA 3M0EA 5DNYA 1N75A 5IT9S 1IFYA 1K3WA 3K92A 5ITXE 1TH4A 1L8QA 4RF1A 5ITYA 1JR3D 1SXJE 5KPZA 5EXPA 2CRUA 2BWEA 4AW4A 4G4OA 2FS1A 1YUBA 2HCBA 4RF0A 2VF7A 1WGNA 1DGHB 2K0BX 2JUJA 2JY7A 3GRVA 2DHRA 3IG5A 2CHVA 1HT2E 2X49A 3CF6E 1JR3E 3HX3A 1L2CA 2W82A 3HKPA 1N33M 4AKHA 3ZH9B 2F5OA 2AHMA 1QZEA 3QYBA 4JXJA 3FYCA 5FLXS 2O25A 5IWAM 2B3TA 3C3EA 2LVAA 2ZTCA 2XFTA 4IBDA 4WP2A 3W68A 3AOGA 4XBOA 1FJGM 4LF8M 4I4LA 1VQ1A 4QOZC 2EJSA 3F92A 2UXDM 1W5SA 3U6LA 4GRIA 2ZM6M 2LVQD 3U60A 2CV2A 3SC3A 3U61B 1OFIA 4F1IA 1NY5A 1Z6TA 3RGPA 5KO3A 4XGIA 4MB7A 4L8RC 2NQ8C 4Y28F 4GMQA 3K9PA 3VDUA 5BPVA 3GLIE 2VQFM 4LF9M 1N78A 1ZMUA 3HHXA 1LTMA 3WHKA 1TGUA 4PT5A 3D8LA 3HHZA 4KO8A 4DR5M 2R44A 2F4VM 4DR7M 1PJTA 3J81S 2RGOA 5DYGA 3GLGE 1NNJA 3FE3A 2OOAA 3E46A 2QQ8A 4UN2B 5DYIA 5EXTA 3KS8A 2YR0A 3ILKA 1SXJA 3KDSE 1HQYE 1KYIA 3FUUA 4HL4A 1Y8GA 2BWBA 3DZDA 4IJFA 1GKIA 3H4MA 2R65A 2F5NA 3HJSA 2LVNC 3MK6A 3FTDA 2QBYA 4LF7M 1XXHB 4GHLA 4M0WA 3KOWE 3KOXE 2D7EA 3U61A 1JB0F 2DAGA 1NJFA 3J2PB 1K82A 4GKKM 5F3WA 3LW5F 3GLFB 4FWHA 1QUSA 1UFZA 1EIJA 4LY6A 4Z8XA 4MM3B 1P3QQ 3I01M 1TH3A 4G6ZA 2Y0TA 3FKEA 3FTFA 4G4NA 4LGMA 3LQRA 2C9CA 2R4EA 4A3VB 4NXMM 2KZUA 1H6UA 2XH9A 1IN6A 2LBCA 2QP9X 1XNQM 4CGYB 3J80S 5EP4A 3U6OA 4OVZA 3L29A 2UUAM 3K2LA 3MHVC 1NV9A 3E4RA 2Y20A 3EIHA 3R8FA 1Z5CA 1XMQM 1HNWM 2KNVA 2GQFA 1GVNA 1TH2A 3KFUG 1T3TA 1QAOA 2V6ZM 4REZA 4PCZA 4FD2A 2JNHA 7CATA 3L26A 3U6QA 2XZFA 1IY0A 3GQ3A 2Z4SA 1N34M 2KNAA 2J7OA 4L6V6 4LCBA 2L7HA 3HY5A 4M9XA 3VK8A 1Z5AA 2D7HA 2R46A 1DO2A 2O5RA 3UJNA 3U5ZB 1J09A 1PJIA 4LZJA 2VIIA 4NL4H 3KSJA 4LGYA 1NSFA 1ZQ9A 2XFSA 2XF3A 3GRUA 1E94E 5FSWA 1XMOM 1L1ZA 2CV0A 2H5XA 4NOOB 5KQ8A 4LJ6A 4OU7A 1HQCA 1IY1A 1L1TA 5GKNA 1IBMM 3KOYE 4LF4M 4DR1M 1SXJB 1V92A 1TDHA 3IECA 4KLNA 1XC8A 2HL7A 4QHSA 4LJ9A 2ZBKB 2ZAMA 2I7NA 3U6MA 3KW6A 3UMMA 2KW0A 2DHYA 3Q8XA 4DUYM 1WGLA 1QZMA 3VK7A 2YQZA 3NBXX 4LJAA 2CE7A 4I5SA 4LF5M 4NSRA 4DV1M 2HAKA 3TWLA 4LF6M 3K9OA 3R9XB 1PJSA 1VEJA 3AFHA 3NBIA 4JN6A 1R5LA 2R18A 2QSFX 2Z4RA 2QENA 1SXJC 1HNZM 1CUKA 3JR4A 2L2DA 3FRIA 4DV4M 1DGFA 4DUZM 1AIPC 1OIZA 2APLA 5FTNA 1MU5A 4X64M 4IBIA 2LH0A 2P5TA 4OVZB 3TL4X 2WZJA 1QDTA 2DNAA 2MROB 5FTJA 1NVMA 1Q3BA 4QNMA 3I04M 3GLIB 3BXWA 3FUWA 3PXGA 3VLFB 4X65M 2F5QA 3VKGA 5FTLA 2BJVA 1WIVA 3FUXA 4GITA 1C1KA 4DR2M 3MMPA 3C9PA 2V1UA 3L25A 2LNHC 3A42A 2OOBA 4IJEA 1YE9A 2Z8YM 2MH8A 1D0KA 4AKGA 3U6PA 2O01F 3E21A 1NO1A 3U5ZA 1F4IA 2XZUA 2LTUA 2Z7JA 2M60A 3DFZA 1W5TA 1ZMVA 5IREB 2UUBM 1I94M 1PRBA 3HZJA 4B3MM 2DZOB 4L78A 4JI4M 4R71A 2XSZD 2KA6B 4AI6A 2QPAA 2C96A 2CUZA 3VFDA 1JQJC 1NNUC 2WSCF 2UXCM 3FUTA 1IXRC 2CV1A 1XNRM 1IN7A 4K0KM 3LMMA 1ZV1A 2KNZA 1QQWA 2DWLA 3HU2A 4AZFA 2CHQA 3HU1A 2DVWB 3C3DA 3ZQJA 2QBYB 5FTKA 3CGWA 4MGZE 5ITUA 4LZZA 4D82A 1J5EM 2F5PA 2J5YA 3THGA 2EUCA 3W67A 3UK6A 2QZ4A 2KEBA 4IIWA 4IBKA 1QAMA 3GQ4A 1D0LA 1G4AE 3FUVA 1DGGA 4TUWA 3T15A 2DAMA 2K6BA 4DV0M 1QVRA 1OAOC 2DZNB 2FFJA 2DZLA 4FW9A 1NJGA 4GC9A 1TF0B 4G4QA 1DGHA 4NRWA 1V34A 2UUCM 5EXSA 5E26A 3J7AS 1C7YA 2VF8A 3D8BA 4ANRA 4HEOA 4LRTA 3GRYA 3T1HM 5EP1A 3SFZA 2K9DA 1T6OA 2L4FA 5H37D 5KPTA 4DV3M 1IBKM 2CEAA 3TE6A 1QANA 1WJ7A 3V76A 2Z3XA 1J7KA 1Z5BA 3W0FA 4IBGA 1Q3CA 2DI0A 3LCUA 2OQ4A 4CJ6A 3AV0A 2X4AA 5ITRA 3DOAA 4Q7JA 1IBLM 1S3SA 2DKLA 1NHGC 4NSOB 5C1BA 1N36M 4DR6M 4YHHM 3FTCA 1DGBA 3J27B 1SG9A 3GP1A 4GHAA 1N77A 2C9OA 5KQDA 2MR9A 1WR1B 2EO2A 2FH0A 2I7PA 3VDPA 5ITTA 3SYKA 4JI2M 2RKOA 4I8OA 3KP0E 1G8PA 4IBEA 4XK8F 4X66M 4MGKE 3HJQA 3FTEA 3KP1E 1Z59A 3M7GA 4G3OA 4M0DA 4PDGA 2JY8A 3GLGB 4L16A 3CTWB 1E32A 2Y21A 1BVSA 2KDLA 2RRUA 1QAQA 2JY5A 5EP2A 1D2NA 4GH9A 1UM8A 2L6OA 4OX9M 5EQTA 2QNJA 2C5RA 3TQSA 4JYAM 1XXHE 4AQYM 3ZC7B 4CISA 4QHTA 2L4EA 4QNRA 4DV5M 1OTRA 4II7A 2OPFA 2G5GX 4HLQA 2A5YB 1D0MA 1NY6A 3PNVA 3C58A 3LCVB 5ITXA 2DAIA 3TWKA 3W0LB 1I4WA 1QYRA 3PFIA 3KXEC 3AKZA 2K47A 4NXNM 4B3SM 3OTOM 3QAUA 1VEGA 3RE8A 3L2AA 1GL7A 3NWLA 4AG5A 2F5SA 3B7NA 4RNAA 1IN5A 4B08A 1VG5A 3B7QA 4JI8M 2EKKA 4S12A 4JI5M 1X37A 1PGYA 2CP8A 3L27A 1L2DA 4JI3M 4LG2A 4D81A 2JA2A 4GKJM 1IN8A 3GLHA 4GIPA 4LFBM 4CHTB 2G3QA 5C18A 1ZMWA 1OIPA 1T43A 2LVPC 2QHOB 4B7HA 3HGIA 1EFUB 1Q39A 4FCTA 4Z6YA 1GJTA 2XGNA 4MGYE 1IY2A 4PDIA 3U60B 5EXXA 2YFQA 2ZTDA 4M9ZA 2Q2EB 4WW0A 1R7RA 4FCVA 3UGJA 1QDRA 3E9SA 3K8ZA 4DV6M 2KXEA 3AOEC 4B7FA 1HNXM 1MJGM 3HU3A 3Q8GA 3IG8A 4IBBA 3GLHE 4KODA 2OO9A 2MJ5B 2L7IA 2EA0A 5FTMA 3IHPA 2HKJA 4KT0F 2UU9M 1OKSA 2J7NA 3TPZA 2KRUA 4LJ7A 5EJCA 4P17A 1NHWC 1GABA 3RGSA 4LFAM 5L8RF 4YY3M 2R4JA 3LQQA 3T38A 3QYEA 5LMUM 2Y0QA 3A46A 1GL6A 1N32M 1R4GA 4LFCM 4BLCA 4NRVA 1DV0A 1OFHA 2LHCA 4IBCA 2LXEA 2V1CA 2R45A 3KOZE 3GLFA 3JAMS 3FRHA 2JXNA 3KVWA 2DWZB 8CATA 4JV5M 3KS4A 1YSYA 1KFVA 4LJ8A 2E5LM 2KZSA 3CF2A 4QOSA 2L09A 4W5WA 1MX0A 1PJJA 5BR8M 1EE8A 1G59A 1G41A 1HJPA 1TTEA 2G8LA 1JR3A 3U6CA 3CF0A 4X62M 3I4YA 3VKHA 4BB9A 4KHPM 5JI3E 2CFOA 1LV7A 1OAIA 4LRSA 4IBFA 5ITQA 3GO8A 3SAUA 3L28A 1PJQA 3GLIA 2VQEM 1AUAA 2X8AA 1HT1E 4L15A 3KSXA 3JR5A 4I81A 3U6DA 1IM2A 4GEWA 3GPUA 3SAWA 5EP3A 2JP7A
chains in the Genus database with same CATH topology
1IQPA 4JI6M 2UXBM 4FVMA 4FWDA 1R2YA 1IXZA 3PNYA 2DWMA 2XSZA 4ITQA 4AKIA 4DR3M 3MJ5A 3BOSA 3HWSA 1ZAEA 2ZAOA 4R3DA 2FOIC 2ZANA 2CHGA 3T1YM 3FD9A 3AJIB 2BJWA 1WXQA 3GPYA 3J7BA 2XLJA 4DV7M 4IBJA 3SHGB 1VDDA 3I51A 4DR4M 3GLHB 3QWLA 2FE8A 3B9PA 5A2QS 3HJ8A 4ZPXA 1G3IA 3U6EA 4B3RM 1IN4A 1HR0M 4AG6A 3FYDA 1KSFX 1SXJD 4B3TM 3AOEA 1FNNA 3WHLA 2R62A 4D80A 4LJ5A 4MH0E 5JI2E 3K1JA 1L2BA 4P16A 4L4UA 3A98B 4MGHA 3SMPA 3TWMA 2C98A 2QCUA 3GPPA 5E6JA 1XHBA 2ERCA 1OJLA 2M5ZA 3A45A 4G4RA 2FNAA 3PVSA 3SMSA 4MGIE 3SATA 1XWIA 4B7GA 2XEPA 2D7GA 3ZCBB 3LVVA 4DV2M 3RFWA 3HHYA 3GPXA 1TDZA 1GLNA 2YNMD 4JI7M 2DWNA 2LWXA 1ORYB 5IZ7D 1IXSB 3SAVA 3SYLA 4JI0M 1R6BX 3EIEA 3SHFA 3SARA 1E9RA 4FCWA 4GC5A 4WURA 5LMNM 3DA1A 1E9SA 4OW0A 4R7GA 4FWGA 3U6SA 1DO0A 4PD2A 2DXIA 2H1RA 1K3XA 2HHHM 3SBJA 3SASA 2C99A 3I4VA 1PM5A 3HHWA 3AL0C 3UZUA 5KPRA 2RGHA 1XXHA 3M6AA 3GRRA 2BNKA 4M9SA 3GQ5A 4LJ4A 1R2ZA 4EIWA 3LVWA 4BBAA 4JI1M 3GLGA 2KRKA 3M0EA 5DNYA 1N75A 5IT9S 1K3WA 3K92A 5ITXE 1TH4A 1L8QA 4RF1A 5ITYA 1JR3D 1SXJE 5KPZA 5EXPA 4AW4A 4G4OA 1YUBA 2HCBA 4RF0A 1DGHB 3GRVA 3IG5A 2DHRA 2CHVA 1HT2E 2X49A 3CF6E 1L2CA 2W82A 3HKPA 1N33M 4AKHA 3ZH9B 2F5OA 2AHMA 5FLXS 4JXJA 3FYCA 5IWAM 2XFTA 4IBDA 3AOGA 4XBOA 1FJGM 4LF8M 4I4LA 4QOZC 2UXDM 1W5SA 3U6LA 4GRIA 2ZM6M 3U60A 2CV2A 3SC3A 3U61B 1OFIA 1NY5A 1Z6TA 3RGPA 5KO3A 4XGIA 4MB7A 4L8RC 2NQ8C 4GMQA 5BPVA 3VDUA 4LF9M 2VQFM 1N78A 3HHXA 3WHKA 1TGUA 4PT5A 3D8LA 3HHZA 4KO8A 4DR5M 2F4VM 4DR7M 3J81S 2RGOA 5DYGA 1NNJA 5DYIA 3KS8A 5EXTA 2YR0A 3ILKA 1SXJA 3KDSE 1HQYE 1KYIA 3FUUA 4HL4A 4IJFA 3DZDA 1GKIA 3H4MA 2R65A 2F5NA 3HJSA 3MK6A 3FTDA 2QBYA 4LF7M 1XXHB 4GHLA 4M0WA 3KOWE 3KOXE 2D7EA 3U61A 4GKKM 1NJFA 3J2PB 1K82A 5F3WA 3GLFB 4FWHA 4LY6A 4Z8XA 4MM3B 1TH3A 4G6ZA 2Y0TA 3FKEA 3FTFA 4G4NA 4LGMA 3LQRA 2C9CA 2R4EA 4A3VB 4NXMM 2KZUA 1H6UA 2XH9A 1IN6A 2QP9X 1XNQM 4CGYB 3J80S 5EP4A 3U6OA 4OVZA 3L29A 2UUAM 3K2LA 3MHVC 3E4RA 2Y20A 3EIHA 3R8FA 1Z5CA 1XMQM 1HNWM 1GVNA 1TH2A 3KFUG 1T3TA 1QAOA 2V6ZM 4REZA 4PCZA 4FD2A 3L26A 7CATA 3U6QA 2XZFA 1IY0A 3GQ3A 2Z4SA 1N34M 2J7OA 4LCBA 2L7HA 4M9XA 3VK8A 1Z5AA 2D7HA 2O5RA 1DO2A 2R46A 3UJNA 3U5ZB 1J09A 1PJIA 4LZJA 2VIIA 4NL4H 3KSJA 4LGYA 1NSFA 1ZQ9A 2XFSA 2XF3A 3GRUA 1E94E 5FSWA 1XMOM 1L1ZA 2CV0A 5KQ8A 4NOOB 4LJ6A 4OU7A 1HQCA 1IY1A 1L1TA 5GKNA 1IBMM 3KOYE 4LF4M 4DR1M 1SXJB 1TDHA 4KLNA 1XC8A 2HL7A 4QHSA 4LJ9A 2ZBKB 2ZAMA 2I7NA 3U6MA 3KW6A 3UMMA 2KW0A 3Q8XA 4DUYM 3VK7A 1QZMA 2YQZA 4LJAA 2CE7A 4I5SA 4LF5M 4NSRA 4DV1M 3TWLA 4LF6M 3R9XB 3AFHA 3NBIA 4JN6A 2R18A 2Z4RA 2QENA 1SXJC 1HNZM 3JR4A 4DV4M 1DGFA 4DUZM 5FTNA 1MU5A 4X64M 4IBIA 2LH0A 2P5TA 4OVZB 3TL4X 5FTJA 1NVMA 1Q3BA 4QNMA 3GLIB 3PXGA 3FUWA 4X65M 3VLFB 2F5QA 3VKGA 5FTLA 2BJVA 3FUXA 4GITA 1C1KA 4DR2M 2V1UA 3L25A 2LNHC 3A42A 4IJEA 1YE9A 4AKGA 3U6PA 3U5ZA 2XZUA 2Z7JA 2M60A 3DFZA 1W5TA 5IREB 2UUBM 1I94M 4B3MM 2DZOB 4L78A 4JI4M 2XSZD 2KA6B 4AI6A 2QPAA 2C96A 2CUZA 3VFDA 1JQJC 1NNUC 2UXCM 3FUTA 1IXRC 2CV1A 1XNRM 1IN7A 4K0KM 3LMMA 1QQWA 2DWLA 3HU2A 4AZFA 2CHQA 3HU1A 2DVWB 2QBYB 5FTKA 4MGZE 5ITUA 4LZZA 4D82A 1J5EM 2F5PA 3THGA 2EUCA 3UK6A 2QZ4A 2KEBA 4IIWA 4IBKA 1QAMA 3GQ4A 1G4AE 3FUVA 1DGGA 4TUWA 3T15A 4DV0M 1QVRA 2DZNB 2FFJA 4FW9A 1NJGA 4GC9A 4G4QA 1DGHA 4NRWA 2UUCM 5EXSA 5E26A 3J7AS 3D8BA 4LRTA 3GRYA 3T1HM 5EP1A 3SFZA 5KPTA 1IBKM 5H37D 4DV3M 2CEAA 3TE6A 1QANA 2Z3XA 1J7KA 1Z5BA 3W0FA 4IBGA 1Q3CA 2OQ4A 3AV0A 2X4AA 5ITRA 3DOAA 1IBLM 1S3SA 1NHGC 4NSOB 5C1BA 1N36M 4DR6M 4YHHM 3FTCA 1DGBA 3J27B 3GP1A 4GHAA 1N77A 2C9OA 5KQDA 2EO2A 2I7PA 3VDPA 5ITTA 3SYKA 4JI2M 2RKOA 4I8OA 3KP0E 1G8PA 4IBEA 4X66M 4MGKE 3HJQA 3FTEA 3KP1E 1Z59A 3M7GA 4M0DA 4PDGA 3GLGB 4L16A 3CTWB 1E32A 2Y21A 1QAQA 5EP2A 1D2NA 4GH9A 1UM8A 2L6OA 4OX9M 5EQTA 2C5RA 3TQSA 4JYAM 4AQYM 3ZC7B 4CISA 4QHTA 4QNRA 4DV5M 2OPFA 4II7A 2G5GX 4HLQA 2A5YB 1NY6A 3PNVA 3C58A 5ITXA 3TWKA 3W0LB 1I4WA 1QYRA 3PFIA 3KXEC 3AKZA 2K47A 4NXNM 4B3SM 3OTOM 3QAUA 3RE8A 2F5SA 3L2AA 1GL7A 3NWLA 4AG5A 4RNAA 1IN5A 4B08A 4JI8M 4S12A 4JI5M 1X37A 3L27A 1L2DA 4JI3M 4LG2A 4D81A 2JA2A 4GKJM 1IN8A 3GLHA 4GIPA 4LFBM 4CHTB 5C18A 4B7HA 3HGIA 1Q39A 4FCTA 4Z6YA 2XGNA 4MGYE 1IY2A 4PDIA 3U60B 5EXXA 2YFQA 4M9ZA 2Q2EB 4WW0A 1R7RA 4FCVA 3UGJA 3E9SA 3K8ZA 4DV6M 2KXEA 3AOEC 4B7FA 1HNXM 3HU3A 3IG8A 4IBBA 4KODA 2L7IA 2EA0A 5FTMA 2HKJA 2UU9M 2J7NA 3TPZA 2KRUA 4LJ7A 5EJCA 1NHWC 3RGSA 4LFAM 4YY3M 2R4JA 3LQQA 3T38A 5LMUM 2Y0QA 3A46A 1GL6A 1N32M 4LFCM 4BLCA 4NRVA 1OFHA 4IBCA 2LXEA 2V1CA 2R45A 3KOZE 3GLFA 3JAMS 3KVWA 2DWZB 8CATA 4JV5M 3KS4A 1YSYA 1KFVA 4LJ8A 2E5LM 2KZSA 3CF2A 4QOSA 2L09A 4W5WA 1MX0A 1PJJA 5BR8M 1EE8A 1G59A 1G41A 3U6CA 2G8LA 1JR3A 3CF0A 4X62M 3I4YA 3VKHA 4BB9A 4KHPM 5JI3E 2CFOA 1LV7A 4LRSA 4IBFA 5ITQA 3GO8A 3SAUA 3L28A 3GLIA 2VQEM 2X8AA 1HT1E 4L15A 3KSXA 3JR5A 4I81A 3U6DA 1IM2A 3GPUA 3SAWA 5EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZC7 B;  3ZCB B; 
#chains in the Genus database with same CATH topology
 1IQP A;  4JI6 M;  2UXB M;  4FVM A;  3B7Z A;  4FWD A;  1R2Y A;  1IXZ A;  3PNY A;  2DWM A;  2XSZ A;  4ITQ A;  4AKI A;  5DFL A;  4DBG B;  4DR3 M;  2R0I A;  1XB2 B;  3MJ5 A;  3BOS A;  3HWS A;  1ZAE A;  2ZAO A;  4R3D A;  2FOI C;  2ZAN A;  2CHG A;  3T1Y M;  3FD9 A;  3AJI B;  4NC6 A;  2BJW A;  1WXQ A;  2MGW A;  3GPY A;  3J7B A;  2XLJ A;  4DV7 M;  1OQY A;  4IBJ A;  3SHG B;  1QUT A;  1VDD A;  3I51 A;  4DR4 M;  1VDL A;  3GLH B;  3QWL A;  2JWS A;  4CIZ A;  2FE8 A;  3B9P A;  5A2Q S;  2EKF A;  3HJ8 A;  4ZPX A;  1G3I A;  1V33 A;  3U6E A;  4B3R M;  1IN4 A;  1HR0 M;  4AG6 A;  1GJS A;  3FYD A;  1KSF X;  1IXS A;  1SXJ D;  3GLF E;  2R6F A;  4B3T M;  3AOE A;  2LVO C;  1FNN A;  3B89 A;  2R62 A;  3WHL A;  4LJ5 A;  4MH0 E;  4D80 A;  4F2L A;  5JI2 E;  3K1J A;  1L2B A;  2JZ0 A;  2DAK A;  4P16 A;  4L4U A;  3A98 B;  1WHC A;  4MGH A;  2GNO A;  2LHG A;  2VDB B;  1MN3 A;  3SMP A;  3TWM A;  2C98 A;  2QCU A;  3GPP A;  5E6J A;  1XHB A;  2ERC A;  1OJL A;  2M5Z A;  3A45 A;  1A5T A;  2N35 A;  2FNA A;  3PVS A;  3SMS A;  4G4R A;  4MGI E;  3SAT A;  1XWI A;  1G71 A;  4B7G A;  2XEP A;  2D7G A;  3ZCB B;  2HWJ A;  3LVV A;  2CWB A;  2WSE F;  4DV2 M;  3RFW A;  3HHY A;  3GPX A;  1TDZ A;  1GLN A;  2YNM D;  3BBZ A;  4JI7 M;  2DWN A;  3H4J A;  2LWX A;  1ORY B;  5IZ7 D;  1IXS B;  3B74 A;  3SYL A;  3SAV A;  4JI0 M;  1R6B X;  2JZ1 A;  3EIE A;  3SHF A;  3SAR A;  1E9R A;  4FCW A;  2DAE A;  4GC5 A;  4WUR A;  5LMN M;  2KHH A;  1E9S A;  3DA1 A;  4OW0 A;  4R7G A;  4FWG A;  3U6S A;  1DO0 A;  1NV8 A;  4PD2 A;  2DXI A;  2H1R A;  1K3X A;  2HHH M;  3SBJ A;  3SAS A;  2C99 A;  3I4V A;  3T6P A;  1YLA A;  1PM5 A;  3HHW A;  3AL0 C;  4RKU F;  3UZU A;  5KPR A;  2RGH A;  2DEN A;  1TR8 A;  1XXH A;  1VEK A;  1GO5 A;  3M6A A;  3GRR A;  2BNK A;  4M9S A;  3GQ5 A;  4LJ4 A;  1RU3 A;  2JY6 B;  1R2Z A;  2WSF F;  4EIW A;  3LVW A;  1Q02 A;  4BBA A;  4JI1 M;  3GLG A;  2KRK A;  3M0E A;  5DNY A;  1N75 A;  5IT9 S;  1IFY A;  1K3W A;  3K92 A;  5ITX E;  1TH4 A;  1L8Q A;  4RF1 A;  5ITY A;  1JR3 D;  1SXJ E;  5KPZ A;  5EXP A;  2CRU A;  2BWE A;  4AW4 A;  4G4O A;  2FS1 A;  1YUB A;  2HCB A;  4RF0 A;  2VF7 A;  1WGN A;  1DGH B;  2K0B X;  2JUJ A;  2JY7 A;  3GRV A;  2DHR A;  3IG5 A;  2CHV A;  1HT2 E;  2X49 A;  3CF6 E;  1JR3 E;  3HX3 A;  1L2C A;  2W82 A;  3HKP A;  1N33 M;  4AKH A;  3ZH9 B;  2F5O A;  2AHM A;  1QZE A;  3QYB A;  4JXJ A;  3FYC A;  5FLX S;  2O25 A;  5IWA M;  2B3T A;  3C3E A;  2LVA A;  2ZTC A;  2XFT A;  4IBD A;  4WP2 A;  3W68 A;  3AOG A;  4XBO A;  1FJG M;  4LF8 M;  4I4L A;  1VQ1 A;  4QOZ C;  2EJS A;  3F92 A;  2UXD M;  1W5S A;  3U6L A;  4GRI A;  2ZM6 M;  2LVQ D;  3U60 A;  2CV2 A;  3SC3 A;  3U61 B;  1OFI A;  4F1I A;  1NY5 A;  1Z6T A;  3RGP A;  5KO3 A;  4XGI A;  4MB7 A;  4L8R C;  2NQ8 C;  4Y28 F;  4GMQ A;  3K9P A;  3VDU A;  5BPV A;  3GLI E;  2VQF M;  4LF9 M;  1N78 A;  1ZMU A;  3HHX A;  1LTM A;  3WHK A;  1TGU A;  4PT5 A;  3D8L A;  3HHZ A;  4KO8 A;  4DR5 M;  2R44 A;  2F4V M;  4DR7 M;  1PJT A;  3J81 S;  2RGO A;  5DYG A;  3GLG E;  1NNJ A;  3FE3 A;  2OOA A;  3E46 A;  2QQ8 A;  4UN2 B;  5DYI A;  5EXT A;  3KS8 A;  2YR0 A;  3ILK A;  1SXJ A;  3KDS E;  1HQY E;  1KYI A;  3FUU A;  4HL4 A;  1Y8G A;  2BWB A;  3DZD A;  4IJF A;  1GKI A;  3H4M A;  2R65 A;  2F5N A;  3HJS A;  2LVN C;  3MK6 A;  3FTD A;  2QBY A;  4LF7 M;  1XXH B;  4GHL A;  4M0W A;  3KOW E;  3KOX E;  2D7E A;  3U61 A;  1JB0 F;  2DAG A;  1NJF A;  3J2P B;  1K82 A;  4GKK M;  5F3W A;  3LW5 F;  3GLF B;  4FWH A;  1QUS A;  1UFZ A;  1EIJ A;  4LY6 A;  4Z8X A;  4MM3 B;  1P3Q Q;  3I01 M;  1TH3 A;  4G6Z A;  2Y0T A;  3FKE A;  3FTF A;  4G4N A;  4LGM A;  3LQR A;  2C9C A;  2R4E A;  4A3V B;  4NXM M;  2KZU A;  1H6U A;  2XH9 A;  1IN6 A;  2LBC A;  2QP9 X;  1XNQ M;  4CGY B;  3J80 S;  5EP4 A;  3U6O A;  4OVZ A;  3L29 A;  2UUA M;  3K2L A;  3MHV C;  1NV9 A;  3E4R A;  2Y20 A;  3EIH A;  3R8F A;  1Z5C A;  1XMQ M;  1HNW M;  2KNV A;  2GQF A;  1GVN A;  1TH2 A;  3KFU G;  1T3T A;  1QAO A;  2V6Z M;  4REZ A;  4PCZ A;  4FD2 A;  2JNH A;  7CAT A;  3L26 A;  3U6Q A;  2XZF A;  1IY0 A;  3GQ3 A;  2Z4S A;  1N34 M;  2KNA A;  2J7O A;  4L6V 6;  4LCB A;  2L7H A;  3HY5 A;  4M9X A;  3VK8 A;  1Z5A A;  2D7H A;  2R46 A;  1DO2 A;  2O5R A;  3UJN A;  3U5Z B;  1J09 A;  1PJI A;  4LZJ A;  2VII A;  4NL4 H;  3KSJ A;  4LGY A;  1NSF A;  1ZQ9 A;  2XFS A;  2XF3 A;  3GRU A;  1E94 E;  5FSW A;  1XMO M;  1L1Z A;  2CV0 A;  2H5X A;  4NOO B;  5KQ8 A;  4LJ6 A;  4OU7 A;  1HQC A;  1IY1 A;  1L1T A;  5GKN A;  1IBM M;  3KOY E;  4LF4 M;  4DR1 M;  1SXJ B;  1V92 A;  1TDH A;  3IEC A;  4KLN A;  1XC8 A;  2HL7 A;  4QHS A;  4LJ9 A;  2ZBK B;  2ZAM A;  2I7N A;  3U6M A;  3KW6 A;  3UMM A;  2KW0 A;  2DHY A;  3Q8X A;  4DUY M;  1WGL A;  1QZM A;  3VK7 A;  2YQZ A;  3NBX X;  4LJA A;  2CE7 A;  4I5S A;  4LF5 M;  4NSR A;  4DV1 M;  2HAK A;  3TWL A;  4LF6 M;  3K9O A;  3R9X B;  1PJS A;  1VEJ A;  3AFH A;  3NBI A;  4JN6 A;  1R5L A;  2R18 A;  2QSF X;  2Z4R A;  2QEN A;  1SXJ C;  1HNZ M;  1CUK A;  3JR4 A;  2L2D A;  3FRI A;  4DV4 M;  1DGF A;  4DUZ M;  1AIP C;  1OIZ A;  2APL A;  5FTN A;  1MU5 A;  4X64 M;  4IBI A;  2LH0 A;  2P5T A;  4OVZ B;  3TL4 X;  2WZJ A;  1QDT A;  2DNA A;  2MRO B;  5FTJ A;  1NVM A;  1Q3B A;  4QNM A;  3I04 M;  3GLI B;  3BXW A;  3FUW A;  3PXG A;  3VLF B;  4X65 M;  2F5Q A;  3VKG A;  5FTL A;  2BJV A;  1WIV A;  3FUX A;  4GIT A;  1C1K A;  4DR2 M;  3MMP A;  3C9P A;  2V1U A;  3L25 A;  2LNH C;  3A42 A;  2OOB A;  4IJE A;  1YE9 A;  2Z8Y M;  2MH8 A;  1D0K A;  4AKG A;  3U6P A;  2O01 F;  3E21 A;  1NO1 A;  3U5Z A;  1F4I A;  2XZU A;  2LTU A;  2Z7J A;  2M60 A;  3DFZ A;  1W5T A;  1ZMV A;  5IRE B;  2UUB M;  1I94 M;  1PRB A;  3HZJ A;  4B3M M;  2DZO B;  4L78 A;  4JI4 M;  4R71 A;  2XSZ D;  2KA6 B;  4AI6 A;  2QPA A;  2C96 A;  2CUZ A;  3VFD A;  1JQJ C;  1NNU C;  2WSC F;  2UXC M;  3FUT A;  1IXR C;  2CV1 A;  1XNR M;  1IN7 A;  4K0K M;  3LMM A;  1ZV1 A;  2KNZ A;  1QQW A;  2DWL A;  3HU2 A;  4AZF A;  2CHQ A;  3HU1 A;  2DVW B;  3C3D A;  3ZQJ A;  2QBY B;  5FTK A;  3CGW A;  4MGZ E;  5ITU A;  4LZZ A;  4D82 A;  1J5E M;  2F5P A;  2J5Y A;  3THG A;  2EUC A;  3W67 A;  3UK6 A;  2QZ4 A;  2KEB A;  4IIW A;  4IBK A;  1QAM A;  3GQ4 A;  1D0L A;  1G4A E;  3FUV A;  1DGG A;  4TUW A;  3T15 A;  2DAM A;  2K6B A;  4DV0 M;  1QVR A;  1OAO C;  2DZN B;  2FFJ A;  2DZL A;  4FW9 A;  1NJG A;  4GC9 A;  1TF0 B;  4G4Q A;  1DGH A;  4NRW A;  1V34 A;  2UUC M;  5EXS A;  5E26 A;  3J7A S;  1C7Y A;  2VF8 A;  3D8B A;  4ANR A;  4HEO A;  4LRT A;  3GRY A;  3T1H M;  5EP1 A;  3SFZ A;  2K9D A;  1T6O A;  2L4F A;  5H37 D;  5KPT A;  4DV3 M;  1IBK M;  2CEA A;  3TE6 A;  1QAN A;  1WJ7 A;  3V76 A;  2Z3X A;  1J7K A;  1Z5B A;  3W0F A;  4IBG A;  1Q3C A;  2DI0 A;  3LCU A;  2OQ4 A;  4CJ6 A;  3AV0 A;  2X4A A;  5ITR A;  3DOA A;  4Q7J A;  1IBL M;  1S3S A;  2DKL A;  1NHG C;  4NSO B;  5C1B A;  1N36 M;  4DR6 M;  4YHH M;  3FTC A;  1DGB A;  3J27 B;  1SG9 A;  3GP1 A;  4GHA A;  1N77 A;  2C9O A;  5KQD A;  2MR9 A;  1WR1 B;  2EO2 A;  2FH0 A;  2I7P A;  3VDP A;  5ITT A;  3SYK A;  4JI2 M;  2RKO A;  4I8O A;  3KP0 E;  1G8P A;  4IBE A;  4XK8 F;  4X66 M;  4MGK E;  3HJQ A;  3FTE A;  3KP1 E;  1Z59 A;  3M7G A;  4G3O A;  4M0D A;  4PDG A;  2JY8 A;  3GLG B;  4L16 A;  3CTW B;  1E32 A;  2Y21 A;  1BVS A;  2KDL A;  2RRU A;  1QAQ A;  2JY5 A;  5EP2 A;  1D2N A;  4GH9 A;  1UM8 A;  2L6O A;  4OX9 M;  5EQT A;  2QNJ A;  2C5R A;  3TQS A;  4JYA M;  1XXH E;  4AQY M;  3ZC7 B;  4CIS A;  4QHT A;  2L4E A;  4QNR A;  4DV5 M;  1OTR A;  4II7 A;  2OPF A;  2G5G X;  4HLQ A;  2A5Y B;  1D0M A;  1NY6 A;  3PNV A;  3C58 A;  3LCV B;  5ITX A;  2DAI A;  3TWK A;  3W0L B;  1I4W A;  1QYR A;  3PFI A;  3KXE C;  3AKZ A;  2K47 A;  4NXN M;  4B3S M;  3OTO M;  3QAU A;  1VEG A;  3RE8 A;  3L2A A;  1GL7 A;  3NWL A;  4AG5 A;  2F5S A;  3B7N A;  4RNA A;  1IN5 A;  4B08 A;  1VG5 A;  3B7Q A;  4JI8 M;  2EKK A;  4S12 A;  4JI5 M;  1X37 A;  1PGY A;  2CP8 A;  3L27 A;  1L2D A;  4JI3 M;  4LG2 A;  4D81 A;  2JA2 A;  4GKJ M;  1IN8 A;  3GLH A;  4GIP A;  4LFB M;  4CHT B;  2G3Q A;  5C18 A;  1ZMW A;  1OIP A;  1T43 A;  2LVP C;  2QHO B;  4B7H A;  3HGI A;  1EFU B;  1Q39 A;  4FCT A;  4Z6Y A;  1GJT A;  2XGN A;  4MGY E;  1IY2 A;  4PDI A;  3U60 B;  5EXX A;  2YFQ A;  2ZTD A;  4M9Z A;  2Q2E B;  4WW0 A;  1R7R A;  4FCV A;  3UGJ A;  1QDR A;  3E9S A;  3K8Z A;  4DV6 M;  2KXE A;  3AOE C;  4B7F A;  1HNX M;  1MJG M;  3HU3 A;  3Q8G A;  3IG8 A;  4IBB A;  3GLH E;  4KOD A;  2OO9 A;  2MJ5 B;  2L7I A;  2EA0 A;  5FTM A;  3IHP A;  2HKJ A;  4KT0 F;  2UU9 M;  1OKS A;  2J7N A;  3TPZ A;  2KRU A;  4LJ7 A;  5EJC A;  4P17 A;  1NHW C;  1GAB A;  3RGS A;  4LFA M;  5L8R F;  4YY3 M;  2R4J A;  3LQQ A;  3T38 A;  3QYE A;  5LMU M;  2Y0Q A;  3A46 A;  1GL6 A;  1N32 M;  1R4G A;  4LFC M;  4BLC A;  4NRV A;  1DV0 A;  1OFH A;  2LHC A;  4IBC A;  2LXE A;  2V1C A;  2R45 A;  3KOZ E;  3GLF A;  3JAM S;  3FRH A;  2JXN A;  3KVW A;  2DWZ B;  8CAT A;  4JV5 M;  3KS4 A;  1YSY A;  1KFV A;  4LJ8 A;  2E5L M;  2KZS A;  3CF2 A;  4QOS A;  2L09 A;  4W5W A;  1MX0 A;  1PJJ A;  5BR8 M;  1EE8 A;  1G59 A;  1G41 A;  1HJP A;  1TTE A;  2G8L A;  1JR3 A;  3U6C A;  3CF0 A;  4X62 M;  3I4Y A;  3VKH A;  4BB9 A;  4KHP M;  5JI3 E;  2CFO A;  1LV7 A;  1OAI A;  4LRS A;  4IBF A;  5ITQ A;  3GO8 A;  3SAU A;  3L28 A;  1PJQ A;  3GLI A;  2VQE M;  1AUA A;  2X8A A;  1HT1 E;  4L15 A;  3KSX A;  3JR5 A;  4I81 A;  3U6D A;  1IM2 A;  4GEW A;  3GPU A;  3SAW A;  5EP3 A;  2JP7 A; 
#chains in the Genus database with same CATH homology
 1IQP A;  4JI6 M;  2UXB M;  4FVM A;  4FWD A;  1R2Y A;  1IXZ A;  3PNY A;  2DWM A;  2XSZ A;  4ITQ A;  4AKI A;  4DR3 M;  3MJ5 A;  3BOS A;  3HWS A;  1ZAE A;  2ZAO A;  4R3D A;  2FOI C;  2ZAN A;  2CHG A;  3T1Y M;  3FD9 A;  3AJI B;  2BJW A;  1WXQ A;  3GPY A;  3J7B A;  2XLJ A;  4DV7 M;  4IBJ A;  3SHG B;  1VDD A;  3I51 A;  4DR4 M;  3GLH B;  3QWL A;  2FE8 A;  3B9P A;  5A2Q S;  3HJ8 A;  4ZPX A;  1G3I A;  3U6E A;  4B3R M;  1IN4 A;  1HR0 M;  4AG6 A;  3FYD A;  1KSF X;  1SXJ D;  4B3T M;  3AOE A;  1FNN A;  3WHL A;  2R62 A;  4D80 A;  4LJ5 A;  4MH0 E;  5JI2 E;  3K1J A;  1L2B A;  4P16 A;  4L4U A;  3A98 B;  4MGH A;  3SMP A;  3TWM A;  2C98 A;  2QCU A;  3GPP A;  5E6J A;  1XHB A;  2ERC A;  1OJL A;  2M5Z A;  3A45 A;  4G4R A;  2FNA A;  3PVS A;  3SMS A;  4MGI E;  3SAT A;  1XWI A;  4B7G A;  2XEP A;  2D7G A;  3ZCB B;  3LVV A;  4DV2 M;  3RFW A;  3HHY A;  3GPX A;  1TDZ A;  1GLN A;  2YNM D;  4JI7 M;  2DWN A;  2LWX A;  1ORY B;  5IZ7 D;  1IXS B;  3SAV A;  3SYL A;  4JI0 M;  1R6B X;  3EIE A;  3SHF A;  3SAR A;  1E9R A;  4FCW A;  4GC5 A;  4WUR A;  5LMN M;  3DA1 A;  1E9S A;  4OW0 A;  4R7G A;  4FWG A;  3U6S A;  1DO0 A;  4PD2 A;  2DXI A;  2H1R A;  1K3X A;  2HHH M;  3SBJ A;  3SAS A;  2C99 A;  3I4V A;  1PM5 A;  3HHW A;  3AL0 C;  3UZU A;  5KPR A;  2RGH A;  1XXH A;  3M6A A;  3GRR A;  2BNK A;  4M9S A;  3GQ5 A;  4LJ4 A;  1R2Z A;  4EIW A;  3LVW A;  4BBA A;  4JI1 M;  3GLG A;  2KRK A;  3M0E A;  5DNY A;  1N75 A;  5IT9 S;  1K3W A;  3K92 A;  5ITX E;  1TH4 A;  1L8Q A;  4RF1 A;  5ITY A;  1JR3 D;  1SXJ E;  5KPZ A;  5EXP A;  4AW4 A;  4G4O A;  1YUB A;  2HCB A;  4RF0 A;  1DGH B;  3GRV A;  3IG5 A;  2DHR A;  2CHV A;  1HT2 E;  2X49 A;  3CF6 E;  1L2C A;  2W82 A;  3HKP A;  1N33 M;  4AKH A;  3ZH9 B;  2F5O A;  2AHM A;  5FLX S;  4JXJ A;  3FYC A;  5IWA M;  2XFT A;  4IBD A;  3AOG A;  4XBO A;  1FJG M;  4LF8 M;  4I4L A;  4QOZ C;  2UXD M;  1W5S A;  3U6L A;  4GRI A;  2ZM6 M;  3U60 A;  2CV2 A;  3SC3 A;  3U61 B;  1OFI A;  1NY5 A;  1Z6T A;  3RGP A;  5KO3 A;  4XGI A;  4MB7 A;  4L8R C;  2NQ8 C;  4GMQ A;  5BPV A;  3VDU A;  4LF9 M;  2VQF M;  1N78 A;  3HHX A;  3WHK A;  1TGU A;  4PT5 A;  3D8L A;  3HHZ A;  4KO8 A;  4DR5 M;  2F4V M;  4DR7 M;  3J81 S;  2RGO A;  5DYG A;  1NNJ A;  5DYI A;  3KS8 A;  5EXT A;  2YR0 A;  3ILK A;  1SXJ A;  3KDS E;  1HQY E;  1KYI A;  3FUU A;  4HL4 A;  4IJF A;  3DZD A;  1GKI A;  3H4M A;  2R65 A;  2F5N A;  3HJS A;  3MK6 A;  3FTD A;  2QBY A;  4LF7 M;  1XXH B;  4GHL A;  4M0W A;  3KOW E;  3KOX E;  2D7E A;  3U61 A;  4GKK M;  1NJF A;  3J2P B;  1K82 A;  5F3W A;  3GLF B;  4FWH A;  4LY6 A;  4Z8X A;  4MM3 B;  1TH3 A;  4G6Z A;  2Y0T A;  3FKE A;  3FTF A;  4G4N A;  4LGM A;  3LQR A;  2C9C A;  2R4E A;  4A3V B;  4NXM M;  2KZU A;  1H6U A;  2XH9 A;  1IN6 A;  2QP9 X;  1XNQ M;  4CGY B;  3J80 S;  5EP4 A;  3U6O A;  4OVZ A;  3L29 A;  2UUA M;  3K2L A;  3MHV C;  3E4R A;  2Y20 A;  3EIH A;  3R8F A;  1Z5C A;  1XMQ M;  1HNW M;  1GVN A;  1TH2 A;  3KFU G;  1T3T A;  1QAO A;  2V6Z M;  4REZ A;  4PCZ A;  4FD2 A;  3L26 A;  7CAT A;  3U6Q A;  2XZF A;  1IY0 A;  3GQ3 A;  2Z4S A;  1N34 M;  2J7O A;  4LCB A;  2L7H A;  4M9X A;  3VK8 A;  1Z5A A;  2D7H A;  2O5R A;  1DO2 A;  2R46 A;  3UJN A;  3U5Z B;  1J09 A;  1PJI A;  4LZJ A;  2VII A;  4NL4 H;  3KSJ A;  4LGY A;  1NSF A;  1ZQ9 A;  2XFS A;  2XF3 A;  3GRU A;  1E94 E;  5FSW A;  1XMO M;  1L1Z A;  2CV0 A;  5KQ8 A;  4NOO B;  4LJ6 A;  4OU7 A;  1HQC A;  1IY1 A;  1L1T A;  5GKN A;  1IBM M;  3KOY E;  4LF4 M;  4DR1 M;  1SXJ B;  1TDH A;  4KLN A;  1XC8 A;  2HL7 A;  4QHS A;  4LJ9 A;  2ZBK B;  2ZAM A;  2I7N A;  3U6M A;  3KW6 A;  3UMM A;  2KW0 A;  3Q8X A;  4DUY M;  3VK7 A;  1QZM A;  2YQZ A;  4LJA A;  2CE7 A;  4I5S A;  4LF5 M;  4NSR A;  4DV1 M;  3TWL A;  4LF6 M;  3R9X B;  3AFH A;  3NBI A;  4JN6 A;  2R18 A;  2Z4R A;  2QEN A;  1SXJ C;  1HNZ M;  3JR4 A;  4DV4 M;  1DGF A;  4DUZ M;  5FTN A;  1MU5 A;  4X64 M;  4IBI A;  2LH0 A;  2P5T A;  4OVZ B;  3TL4 X;  5FTJ A;  1NVM A;  1Q3B A;  4QNM A;  3GLI B;  3PXG A;  3FUW A;  4X65 M;  3VLF B;  2F5Q A;  3VKG A;  5FTL A;  2BJV A;  3FUX A;  4GIT A;  1C1K A;  4DR2 M;  2V1U A;  3L25 A;  2LNH C;  3A42 A;  4IJE A;  1YE9 A;  4AKG A;  3U6P A;  3U5Z A;  2XZU A;  2Z7J A;  2M60 A;  3DFZ A;  1W5T A;  5IRE B;  2UUB M;  1I94 M;  4B3M M;  2DZO B;  4L78 A;  4JI4 M;  2XSZ D;  2KA6 B;  4AI6 A;  2QPA A;  2C96 A;  2CUZ A;  3VFD A;  1JQJ C;  1NNU C;  2UXC M;  3FUT A;  1IXR C;  2CV1 A;  1XNR M;  1IN7 A;  4K0K M;  3LMM A;  1QQW A;  2DWL A;  3HU2 A;  4AZF A;  2CHQ A;  3HU1 A;  2DVW B;  2QBY B;  5FTK A;  4MGZ E;  5ITU A;  4LZZ A;  4D82 A;  1J5E M;  2F5P A;  3THG A;  2EUC A;  3UK6 A;  2QZ4 A;  2KEB A;  4IIW A;  4IBK A;  1QAM A;  3GQ4 A;  1G4A E;  3FUV A;  1DGG A;  4TUW A;  3T15 A;  4DV0 M;  1QVR A;  2DZN B;  2FFJ A;  4FW9 A;  1NJG A;  4GC9 A;  4G4Q A;  1DGH A;  4NRW A;  2UUC M;  5EXS A;  5E26 A;  3J7A S;  3D8B A;  4LRT A;  3GRY A;  3T1H M;  5EP1 A;  3SFZ A;  5KPT A;  1IBK M;  5H37 D;  4DV3 M;  2CEA A;  3TE6 A;  1QAN A;  2Z3X A;  1J7K A;  1Z5B A;  3W0F A;  4IBG A;  1Q3C A;  2OQ4 A;  3AV0 A;  2X4A A;  5ITR A;  3DOA A;  1IBL M;  1S3S A;  1NHG C;  4NSO B;  5C1B A;  1N36 M;  4DR6 M;  4YHH M;  3FTC A;  1DGB A;  3J27 B;  3GP1 A;  4GHA A;  1N77 A;  2C9O A;  5KQD A;  2EO2 A;  2I7P A;  3VDP A;  5ITT A;  3SYK A;  4JI2 M;  2RKO A;  4I8O A;  3KP0 E;  1G8P A;  4IBE A;  4X66 M;  4MGK E;  3HJQ A;  3FTE A;  3KP1 E;  1Z59 A;  3M7G A;  4M0D A;  4PDG A;  3GLG B;  4L16 A;  3CTW B;  1E32 A;  2Y21 A;  1QAQ A;  5EP2 A;  1D2N A;  4GH9 A;  1UM8 A;  2L6O A;  4OX9 M;  5EQT A;  2C5R A;  3TQS A;  4JYA M;  4AQY M;  3ZC7 B;  4CIS A;  4QHT A;  4QNR A;  4DV5 M;  2OPF A;  4II7 A;  2G5G X;  4HLQ A;  2A5Y B;  1NY6 A;  3PNV A;  3C58 A;  5ITX A;  3TWK A;  3W0L B;  1I4W A;  1QYR A;  3PFI A;  3KXE C;  3AKZ A;  2K47 A;  4NXN M;  4B3S M;  3OTO M;  3QAU A;  3RE8 A;  2F5S A;  3L2A A;  1GL7 A;  3NWL A;  4AG5 A;  4RNA A;  1IN5 A;  4B08 A;  4JI8 M;  4S12 A;  4JI5 M;  1X37 A;  3L27 A;  1L2D A;  4JI3 M;  4LG2 A;  4D81 A;  2JA2 A;  4GKJ M;  1IN8 A;  3GLH A;  4GIP A;  4LFB M;  4CHT B;  5C18 A;  4B7H A;  3HGI A;  1Q39 A;  4FCT A;  4Z6Y A;  2XGN A;  4MGY E;  1IY2 A;  4PDI A;  3U60 B;  5EXX A;  2YFQ A;  4M9Z A;  2Q2E B;  4WW0 A;  1R7R A;  4FCV A;  3UGJ A;  3E9S A;  3K8Z A;  4DV6 M;  2KXE A;  3AOE C;  4B7F A;  1HNX M;  3HU3 A;  3IG8 A;  4IBB A;  4KOD A;  2L7I A;  2EA0 A;  5FTM A;  2HKJ A;  2UU9 M;  2J7N A;  3TPZ A;  2KRU A;  4LJ7 A;  5EJC A;  1NHW C;  3RGS A;  4LFA M;  4YY3 M;  2R4J A;  3LQQ A;  3T38 A;  5LMU M;  2Y0Q A;  3A46 A;  1GL6 A;  1N32 M;  4LFC M;  4BLC A;  4NRV A;  1OFH A;  4IBC A;  2LXE A;  2V1C A;  2R45 A;  3KOZ E;  3GLF A;  3JAM S;  3KVW A;  2DWZ B;  8CAT A;  4JV5 M;  3KS4 A;  1YSY A;  1KFV A;  4LJ8 A;  2E5L M;  2KZS A;  3CF2 A;  4QOS A;  2L09 A;  4W5W A;  1MX0 A;  1PJJ A;  5BR8 M;  1EE8 A;  1G59 A;  1G41 A;  3U6C A;  2G8L A;  1JR3 A;  3CF0 A;  4X62 M;  3I4Y A;  3VKH A;  4BB9 A;  4KHP M;  5JI3 E;  2CFO A;  1LV7 A;  4LRS A;  4IBF A;  5ITQ A;  3GO8 A;  3SAU A;  3L28 A;  3GLI A;  2VQE M;  2X8A A;  1HT1 E;  4L15 A;  3KSX A;  3JR5 A;  4I81 A;  3U6D A;  1IM2 A;  3GPU A;  3SAW A;  5EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...