3ZC7B

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
63
structure length
63
Chain Sequence
MVLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
total genus 25
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zc7B00
3SHGB 3ZC7B 3ZCBB
chains in the Genus database with same CATH superfamily
1NV9A 3CF2A 1PM5A 4LG2A 2Y0QA 3GQ4A 2KRKA 4M9XA 3SMPA 4B7HA 4OX9M 1R2YA 1YE9A 3GLHA 4MGIE 1Z5AA 2OPFA 3LVWA 4LJ5A 2KZUA 4B08A 2K47A 5H37D 1TH2A 1YUBA 4F1IA 1GL7A 2Y21A 3GRRA 1NNJA 3KDSE 4HL4A 1EIJA 1QAQA 2ZM6M 1QANA 2DZNB 2RRUA 1QUSA 3GPXA 4RF0A 2D7HA 4PDGA 1R2ZA 1HNZM 3VLFB 1XNRM 1D0MA 1LTMA 2KNZA 2KXEA 2W82A 1R5LA 2K9DA 3GLGA 4AW4A 4HLQA 4DV2M 2JWSA 2HKJA 2KHHA 3I01M 1NJGA 4D81A 4LY6A 5DYGA 4DR2M 2Z3XA 3KFUG 1V33A 2LTUA 2DWZB 3HWSA 3RE8A 4IBJA 4R7GA 4FCTA 3QAUA 3A46A 5LMUM 3NWLA 2VIIA 4IBEA 1E9RA 2YR0A 1YLAA 3U6MA 1WGLA 2LHCA 4MM3B 1DGFA 4K0KM 2R18A 2X49A 3U5ZA 2MGWA 4CHTB 1NO1A 4RF1A 2APLA 3CGWA 2VQEM 1TGUA 4QNRA 5JI3E 2CHQA 3C9PA 3LCVB 2DENA 3DZDA 5ITQA 2WSFF 3FTDA 1OKSA 1RU3A 3PNVA 1I94M 1QUTA 1IN8A 1FNNA 2ZTDA 4PT5A 2XLJA 3U6LA 2H1RA 3L27A 1JB0F 2D7GA 4LF9M 4B3RM 3FUWA 4LJAA 1IN6A 1E94E 3FUXA 4LJ8A 3E46A 1NV8A 2F4VM 4W5WA 5FTKA 3KS4A 2R65A 3PNYA 2CFOA 1WR1B 3ZC7B 5EP3A 2K6BA 3FD9A 4LJ9A 2YNMD 1R6BX 3QYBA 4LJ7A 1IFYA 2QNJA 2QENA 2JY7A 3LQQA 1GLNA 2EUCA 7CATA 5DNYA 1NVMA 4B7FA 5IWAM 3CF6E 2R62A 1QDTA 3NBXX 4Y28F 1DO0A 2JY8A 4HEOA 1GABA 1XHBA 1A5TA 5ITXA 5GKNA 4AG6A 1N33M 2KNVA 3AV0A 4BLCA 1DO2A 4M9SA 1Q3CA 3U6OA 4AQYM 2UUAM 3C3EA 2QSFX 5IREB 3SARA 1GO5A 4JN6A 4M9ZA 2DAIA 2BWEA 1QYRA 2ZANA 4D80A 2CV2A 1QAMA 3QWLA 4DR5M 2Q2EB 3U61A 2NQ8C 4BBAA 1EFUB 1J09A 1D2NA 5EP1A 3B74A 1NHGC 2FH0A 3KSXA 1SXJD 4DUYM 1IXSB 3JAMS 3C58A 2BWBA 2QCUA 3HKPA 4Z6YA 5L8RF 3U6SA 1T6OA 1AUAA 2EKFA 5KQ8A 3PFIA 1C1KA 1D0KA 4QHTA 1WHCA 4CJ6A 1IQPA 2LVAA 3T15A 1HJPA 5JI2E 4JI2M 1XXHA 2CHGA 1SXJC 4YHHM 3SATA 5EP2A 2CV0A 3AFHA 1OIZA 3FTEA 1XC8A 2LH0A 1EE8A 2JP7A 3TE6A 3L26A 2WSEF 4G4OA 4NRWA 4LFAM 4JXJA 3K9OA 3U60A 4S12A 1PJJA 4F2LA 4XGIA 3AKZA 3EIHA 2V6ZM 5BPVA 1HNXM 1DV0A 1E32A 2JXNA 3VDUA 2DVWB 2MROB 4D82A 4Z8XA 3HHYA 4JYAM 1JR3A 3HHWA 4GH9A 3T1YM 2P5TA 1NY5A 1N36M 3BXWA 3GRYA 2L4FA 2OQ4A 3GPYA 1GVNA 4LZZA 3KS8A 2L2DA 3ILKA 2C99A 5E26A 1IBKM 1PJIA 3W0FA 4IBIA 2E5LM 2JNHA 3KOWE 3J27B 3I04M 3K8ZA 4MGZE 5EXXA 3GLFE 3HU1A 4GKKM 2WZJA 2CHVA 4I8OA 4GHAA 3J7BA 1MJGM 3UJNA 5KQDA 4YY3M 1IY2A 1Z5CA 1Q02A 1R7RA 1SXJE 1WXQA 4M0DA 1ZAEA 1BVSA 3KOXE 4WP2A 2F5QA 3GLIE 2QQ8A 1JQJC 3KOYE 4JI5M 5ITRA 1NNUC 1V92A 1WGNA 2KNAA 3KXEC 4LJ6A 3HHZA 4IBKA 1VDLA 5LMNM 3SYKA 1GJTA 1IM2A 1TH3A 1VEJA 3FUUA 4DV4M 1N77A 2ZTCA 4LRSA 3M0EA 2GQFA 2KW0A 5FTMA 1GJSA 2KEBA 5A2QS 2OO9A 1C7YA 4X65M 2VDBB 4GEWA 3F92A 4LF5M 4IBCA 2DWMA 2Y20A 3BBZA 2LVPC 1Y8GA 3OTOM 2QBYB 1L1ZA 2FNAA 1MN3A 3GLGE 2FS1A 2JA2A 2ERCA 4DV0M 4L8RC 2XF3A 4KLNA 2XH9A 3BOSA 3HU2A 2X4AA 2VF8A 3I4VA 3T6PA 3WHLA 3SHGB 3V76A 4M0WA 1TDZA 4KHPM 2UXBM 2DNAA 2FE8A 5FSWA 3MJ5A 1Z6TA 3AOEC 4XBOA 3M6AA 3GLHE 4KODA 3A45A 3KP1E 2HWJA 5C1BA 2LWXA 4A3VB 4B3TM 4I81A 3GP1A 2L7HA 4BB9A 4FWHA 3GQ3A 1GL6A 4WURA 5ITTA 4R3DA 2Z8YM 3W0LB 2R6FA 1N75A 4II7A 1L2BA 2F5NA 2O25A 4X66M 4NXNM 3UMMA 1K82A 4AKHA 3H4MA 3MMPA 1PRBA 1IN5A 1T43A 2ZBKB 3K1JA 4FW9A 4IIWA 4NL4H 4QNMA 3AL0C 2O01F 2DWNA 3I51A 2DZLA 4MGKE 3NBIA 4JI6M 1DGBA 2UUCM 1ZMUA 1NY6A 1PJTA 1PJSA 1G3IA 1TDHA 4IJFA 4L15A 2CWBA 1TR8A 1G8PA 5EQTA 1YSYA 1CUKA 1P3QQ 2D7EA 2BJVA 3LVVA 1L1TA 2L4EA 4KO8A 2KA6B 4MGYE 3K2LA 3MHVC 2L7IA 2HCBA 2HAKA 1G59A 1R4GA 1S3SA 4CIZA 3Q8GA 4DR3M 4ITQA 2CV1A 3ZH9B 5F3WA 4MH0E 3DOAA 2C98A 3W67A 3GLFB 2JZ0A 3HGIA 3FYDA 3IG5A 3L29A 1F4IA 4G6ZA 2DZOB 3LQRA 4B7GA 1SXJB 2L6OA 3HHXA 4JI8M 1TF0B 2Z4RA 3B7ZA 4OVZB 2R4JA 4NSOB 4RKUF 1V34A 5DYIA 2EKKA 4FCVA 3TWKA 2K0BX 1QZMA 2LHGA 2LBCA 3KVWA 2N35A 3GLIB 3K9PA 2QP9X 4LGYA 3LW5F 2LXEA 1Z59A 1IBMM 3FYCA 2J7NA 1G41A 3HJ8A 5FLXS 3I4YA 1IN4A 3LMMA 1DGHB 2DXIA 2OOAA 4AZFA 3DFZA 1N34M 4DV6M 2BNKA 1NSFA 3A98B 4WW0A 4LCBA 4DV7M 4B3MM 1HT2E 5IZ7D 5ITYA 1OFHA 1VDDA 2C9CA 3J7AS 3SHFA 2GNOA 1IXSA 1MX0A 1JR3D 1H6UA 2BJWA 4GC9A 4JI0M 1XMQM 5FTJA 3TWMA 5ITXE 1HQYE 3B9PA 1XNQM 5IT9S 1KSFX 2EO2A 1Q3BA 4MB7A 4ANRA 4XK8F 3RFWA 2RGHA 4B3SM 4LF6M 2J5YA 3SYLA 2DHRA 3RGSA 3C3DA 3GRUA 4OW0A 3L25A 5FTNA 2XGNA 3IECA 1KYIA 1G71A 1WIVA 2QPAA 1UM8A 3SMSA 1VG5A 2M60A 3SC3A 1VQ1A 4Q7JA 5EJCA 4PD2A 3GLHB 2R4EA 4PCZA 3E21A 1SG9A 3FUTA 2LVNC 4JI4M 2MR9A 1W5TA 1G4AE 1XMOM 1Z5BA 2UUBM 1XXHE 2JY6B 3JR4A 3A42A 3EIEA 4DBGB 2XFTA 2JY5A 4IBBA 1AIPC 4EIWA 1TH4A 1QZEA 3B7QA 1L8QA 2RGOA 3GLGB 3L2AA 4P16A 5KO3A 3B89A 3GPUA 2XEPA 4GC5A 2HL7A 2L09A 2AHMA 2Y0TA 4KT0F 4GMQA 1PGYA 1KFVA 3GO8A 2DHYA 3HU3A 1ZMVA 3ZQJA 2CEAA 1XB2B 2LVOC 2YFQA 3SBJA 1JR3E 2C9OA 4AI6A 2R0IA 2CUZA 2F5PA 4GKJM 4L4UA 4DV3M 1E9SA 2XZUA 1QQWA 3IHPA 3SFZA 3IG8A 1J5EM 2EA0A 4I5SA 3VK8A 3SAUA 5C18A 1LV7A 3VFDA 3U5ZB 3TPZA 4IBDA 1ORYB 4LFCM 2QZ4A 1HT1E 3MK6A 2VQFM 3J2PB 4L78A 1OFIA 3RGPA 2XFSA 1I4WA 3E4RA 4LRTA 2OOBA 1MU5A 3H4JA 2VF7A 3L28A 4FWGA 5DFLA 2R46A 3J80S 1VEKA 2KDLA 4NRVA 4JI1M 3W68A 3KOZE 5BR8M 2R45A 1IY1A 2I7NA 1OQYA 2FFJA 3HJSA 1QVRA 2QBYA 3D8LA 3VDPA 4X62M 3FUVA 3B7NA 4IBGA 3AOEA 4IBFA 3T38A 2G8LA 4GITA 4LF8M 4QOZC 4FD2A 2RKOA 3KSJA 5FTLA 2UXCM 4DR6M 3FRHA 3FKEA 4DUZM 4JI3M 4RNAA 2ZAMA 2LNHC 1VEGA 4LJ4A 4DV5M 1IXZA 1HQCA 4FWDA 2KRUA 4QHSA 4LFBM 5E6JA 3HZJA 2QHOB 1IXRC 3FE3A 5KPTA 3WHKA 1FJGM 3DA1A 2I7PA 1IBLM 3CF0A 4AKGA 2V1CA 2G5GX 4G4QA 1ZQ9A 1D0LA 2LVQD 1XWIA 3PXGA 4GHLA 1PJQA 3U61B 3THGA 2EJSA 1NJFA 2CRUA 4NOOB 2M5ZA 3TL4X 5KPRA 8CATA 5EXTA 2DAMA 1L2DA 4LGMA 1K3WA 2UU9M 2DWLA 1N32M 5EXPA 1J7KA 4QOSA 2MH8A 3Q8XA 2F5SA 2HHHM 4IJEA 4DR7M 2CP8A 3PVSA 3LCUA 4LF7M 1OJLA 4I4LA 2FOIC 4G4RA 3R9XB 3VKGA 3SAVA 2B3TA 1GKIA 2MJ5B 3FRIA 1XXHB 3FTFA 2H5XA 4FCWA 3HY5A 4CGYB 1K3XA 1W5SA 4NSRA 1Q39A 2KZSA 5EP4A 4UN2B 3GLFA 3FTCA 2UXDM 1OTRA 3U60B 2V1UA 3D8BA 2J7OA 2O5RA 3U6EA 1T3TA 4AG5A 2C5RA 3AJIB 2A5YB 3CTWB 3TQSA 3UK6A 3JR5A 3R8FA 3HX3A 1SXJA 3GRVA 2R44A 4OVZA 3TWLA 3J81S 4DR1M 1ZMWA 1DGGA 3UGJA 4L6V6 4MGHA 3GLIA 1QDRA 3SAWA 3U6PA 1HNWM 2Z7JA 1NHWC 4REZA 4CISA 2XZFA 3AOGA 4GRIA 3U6CA 1IN7A 3HJQA 4LZJA 3U6DA 2G3QA 3VKHA 1DGHA 2CE7A 2YQZA 1HR0M 3SASA 4P17A 2XSZD 4AKIA 2DAGA 4DR4M 4G4NA 4FVMA 2DAEA 5KPZA 2XSZA 3KP0E 2WSCF 3GPPA 3GQ5A 5ITUA 3ZCBB 4G3OA 4JV5M 1X37A 2DKLA 4R71A 1QAOA 2ZAOA 2X8AA 1OAIA 4JI7M 4PDIA 1OIPA 1OAOC 1WJ7A 1IY0A 2JUJA 4NXMM 4L16A 3E9SA 1N78A 3U6QA 1UFZA 1ZV1A 4TUWA 1TTEA 2DAKA 3M7GA 4GIPA 3UZUA 4ZPXA 4X64M 2F5OA 3KW6A 5EXSA 4LF4M 3QYEA 2DI0A 4OU7A 4NC6A 2JZ1A 3T1HM 3K92A 2Z4SA 4DV1M 3VK7A 2C96A 1L2CA
chains in the Genus database with same CATH topology
3CF2A 1PM5A 4LG2A 2Y0QA 3GQ4A 2KRKA 4M9XA 3SMPA 4B7HA 4OX9M 1R2YA 1YE9A 3GLHA 4MGIE 1Z5AA 2OPFA 3LVWA 4LJ5A 2KZUA 4B08A 2K47A 5H37D 1TH2A 1YUBA 1GL7A 2Y21A 3GRRA 1NNJA 3KDSE 4HL4A 1QAQA 2ZM6M 1QANA 2DZNB 3GPXA 4RF0A 2D7HA 4PDGA 1R2ZA 1HNZM 3VLFB 1XNRM 2KXEA 2W82A 3GLGA 4AW4A 4HLQA 4DV2M 2HKJA 1NJGA 4D81A 4LY6A 5DYGA 4DR2M 2Z3XA 3KFUG 2DWZB 3HWSA 3RE8A 4IBJA 4R7GA 4FCTA 3QAUA 3A46A 5LMUM 3NWLA 2VIIA 4IBEA 1E9RA 2YR0A 3U6MA 4MM3B 4K0KM 1DGFA 2R18A 2X49A 3U5ZA 4CHTB 4RF1A 2VQEM 1TGUA 4QNRA 5JI3E 2CHQA 5ITQA 3DZDA 3FTDA 3PNVA 1I94M 1IN8A 1FNNA 4PT5A 2XLJA 3U6LA 2H1RA 3L27A 2D7GA 4LF9M 4B3RM 3FUWA 4LJAA 1IN6A 1E94E 3FUXA 4LJ8A 2F4VM 4W5WA 5FTKA 3KS4A 2R65A 3PNYA 2CFOA 3ZC7B 5EP3A 3FD9A 4LJ9A 2YNMD 1R6BX 4LJ7A 2QENA 3LQQA 1GLNA 2EUCA 7CATA 5DNYA 1NVMA 4B7FA 5IWAM 3CF6E 2R62A 1DO0A 1XHBA 5ITXA 5GKNA 4AG6A 1N33M 3AV0A 4BLCA 1DO2A 4M9SA 1Q3CA 3U6OA 4AQYM 2UUAM 5IREB 3SARA 4JN6A 4M9ZA 1QYRA 2ZANA 4D80A 2CV2A 1QAMA 3QWLA 4DR5M 2Q2EB 3U61A 2NQ8C 4BBAA 1J09A 1D2NA 5EP1A 1NHGC 3KSXA 1SXJD 4DUYM 1IXSB 3JAMS 3C58A 4Z6YA 2QCUA 3HKPA 3U6SA 5KQ8A 3PFIA 1C1KA 4QHTA 1IQPA 3T15A 5JI2E 4JI2M 1XXHA 2CHGA 1SXJC 4YHHM 3SATA 5EP2A 2CV0A 3AFHA 3FTEA 1XC8A 2LH0A 1EE8A 3L26A 3TE6A 4G4OA 4NRWA 4LFAM 4JXJA 3U60A 4S12A 1PJJA 3AKZA 4XGIA 3EIHA 2V6ZM 5BPVA 1HNXM 1E32A 3VDUA 2DVWB 4D82A 4Z8XA 3HHYA 4JYAM 1JR3A 3HHWA 4GH9A 3T1YM 2P5TA 1NY5A 1N36M 3GRYA 2OQ4A 3GPYA 1GVNA 4LZZA 3KS8A 3ILKA 5E26A 2C99A 1IBKM 1PJIA 3W0FA 4IBIA 2E5LM 3KOWE 3J27B 3K8ZA 4MGZE 5EXXA 3HU1A 4GKKM 2CHVA 4I8OA 4GHAA 3J7BA 3UJNA 5KQDA 4YY3M 1IY2A 1Z5CA 1R7RA 1SXJE 1WXQA 4M0DA 1ZAEA 3KOXE 2F5QA 1JQJC 3KOYE 4JI5M 5ITRA 1NNUC 3KXEC 4LJ6A 3HHZA 4IBKA 5LMNM 3SYKA 1IM2A 1TH3A 3FUUA 4DV4M 1N77A 4LRSA 3M0EA 2KW0A 5FTMA 2KEBA 5A2QS 4X65M 4LF5M 4IBCA 2DWMA 2Y20A 3OTOM 2QBYB 1L1ZA 2FNAA 2JA2A 2ERCA 4DV0M 4L8RC 2XF3A 4KLNA 2XH9A 3BOSA 3HU2A 2X4AA 3I4VA 3WHLA 3SHGB 4M0WA 1TDZA 4KHPM 2UXBM 5FSWA 2FE8A 3MJ5A 1Z6TA 3AOEC 4XBOA 3M6AA 4KODA 3A45A 3KP1E 5C1BA 2LWXA 4A3VB 4B3TM 4I81A 3GP1A 2L7HA 4BB9A 4FWHA 3GQ3A 1GL6A 4WURA 5ITTA 4R3DA 3W0LB 4II7A 1N75A 1L2BA 2F5NA 4X66M 4NXNM 3UMMA 1K82A 4AKHA 3H4MA 3K1JA 1IN5A 2ZBKB 4IIWA 4FW9A 4NL4H 4QNMA 3AL0C 2DWNA 3I51A 4MGKE 4JI6M 3NBIA 1DGBA 2UUCM 1NY6A 1G3IA 1TDHA 4IJFA 4L15A 1G8PA 5EQTA 1YSYA 2D7EA 2BJVA 3LVVA 1L1TA 4KO8A 2KA6B 4MGYE 3K2LA 3MHVC 2L7IA 2HCBA 1G59A 1S3SA 4ITQA 4DR3M 2CV1A 3ZH9B 5F3WA 4MH0E 3DOAA 2C98A 3GLFB 3HGIA 3FYDA 3IG5A 3L29A 4G6ZA 2DZOB 3LQRA 4B7GA 1SXJB 2L6OA 3HHXA 4JI8M 2Z4RA 4OVZB 2R4JA 4NSOB 5DYIA 3TWKA 4FCVA 3GLIB 1QZMA 3KVWA 4LGYA 2QP9X 1IBMM 2LXEA 1Z59A 3FYCA 2J7NA 1G41A 3HJ8A 5FLXS 3I4YA 1IN4A 3LMMA 1DGHB 2DXIA 4AZFA 3DFZA 1N34M 4DV6M 2BNKA 1NSFA 3A98B 4WW0A 4LCBA 4DV7M 4B3MM 1HT2E 5IZ7D 5ITYA 1OFHA 1VDDA 2C9CA 3J7AS 3SHFA 1MX0A 1JR3D 1H6UA 2BJWA 4GC9A 4JI0M 1XMQM 5FTJA 3TWMA 5ITXE 1HQYE 3B9PA 1XNQM 5IT9S 1KSFX 2EO2A 1Q3BA 4MB7A 3RFWA 2RGHA 4B3SM 4LF6M 3SYLA 2DHRA 3RGSA 3GRUA 4OW0A 3L25A 5FTNA 2XGNA 1KYIA 2QPAA 1UM8A 3SMSA 2M60A 3SC3A 5EJCA 4PD2A 3GLHB 2R4EA 4PCZA 3FUTA 4JI4M 1W5TA 1G4AE 1XMOM 1Z5BA 2UUBM 3JR4A 3A42A 3EIEA 2XFTA 4IBBA 4EIWA 1TH4A 1L8QA 2RGOA 3GLGB 3L2AA 4P16A 5KO3A 3GPUA 2XEPA 4GC5A 2HL7A 2L09A 2AHMA 2Y0TA 4GMQA 1KFVA 3GO8A 3HU3A 2CEAA 2YFQA 3SBJA 2C9OA 4AI6A 2CUZA 2F5PA 4GKJM 4L4UA 4DV3M 1E9SA 2XZUA 1QQWA 3SFZA 3IG8A 1J5EM 2EA0A 4I5SA 3VK8A 3SAUA 5C18A 1LV7A 3VFDA 3U5ZB 3TPZA 4IBDA 1ORYB 4LFCM 2QZ4A 1HT1E 3MK6A 2VQFM 3J2PB 4L78A 1OFIA 3RGPA 2XFSA 1I4WA 3E4RA 4LRTA 1MU5A 3L28A 4FWGA 3J80S 2R46A 4NRVA 4JI1M 3KOZE 5BR8M 2R45A 1IY1A 2I7NA 2FFJA 3HJSA 1QVRA 2QBYA 3D8LA 3VDPA 4X62M 3FUVA 4IBGA 4IBFA 3AOEA 3T38A 2G8LA 4GITA 4LF8M 4QOZC 4FD2A 2RKOA 3KSJA 5FTLA 2UXCM 4DR6M 3FKEA 4DUZM 4JI3M 4RNAA 2ZAMA 2LNHC 4LJ4A 4DV5M 1IXZA 1HQCA 4FWDA 2KRUA 4QHSA 4LFBM 5E6JA 1IXRC 5KPTA 3WHKA 1FJGM 3DA1A 2I7PA 1IBLM 3CF0A 4AKGA 2V1CA 2G5GX 4G4QA 1ZQ9A 3PXGA 4GHLA 1XWIA 3U61B 3THGA 5KPRA 1NJFA 4NOOB 2M5ZA 3TL4X 8CATA 5EXTA 1L2DA 4LGMA 1K3WA 2UU9M 2DWLA 1N32M 5EXPA 1J7KA 4QOSA 3Q8XA 2F5SA 2HHHM 4IJEA 4DR7M 3PVSA 4LF7M 1OJLA 4I4LA 2FOIC 4G4RA 3R9XB 3VKGA 3SAVA 1GKIA 1XXHB 3FTFA 4FCWA 4CGYB 1K3XA 1W5SA 4NSRA 1Q39A 2KZSA 5EP4A 3GLFA 3FTCA 2UXDM 3U60B 2V1UA 3D8BA 2J7OA 2O5RA 3U6EA 1T3TA 4AG5A 2C5RA 3AJIB 2A5YB 3CTWB 3TQSA 3UK6A 3JR5A 3R8FA 1SXJA 3GRVA 4OVZA 3TWLA 3J81S 4DR1M 1DGGA 3UGJA 4MGHA 3GLIA 1HNWM 3SAWA 3U6PA 2Z7JA 1NHWC 4REZA 4CISA 2XZFA 3AOGA 4GRIA 3U6CA 1IN7A 3HJQA 4LZJA 3U6DA 3VKHA 1DGHA 2CE7A 2YQZA 1HR0M 3SASA 2XSZD 4AKIA 4DR4M 4G4NA 4FVMA 5KPZA 2XSZA 3KP0E 3GQ5A 3GPPA 5ITUA 3ZCBB 4JV5M 1X37A 1QAOA 2ZAOA 2X8AA 4JI7M 4PDIA 1IY0A 4NXMM 4L16A 3E9SA 1N78A 3U6QA 4TUWA 3M7GA 4GIPA 3UZUA 4ZPXA 4X64M 2F5OA 3KW6A 5EXSA 4LF4M 4OU7A 3T1HM 3K92A 2Z4SA 4DV1M 3VK7A 2C96A 1L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZC7 B;  3ZCB B; 
#chains in the Genus database with same CATH topology
 1NV9 A;  3CF2 A;  1PM5 A;  4LG2 A;  2Y0Q A;  3GQ4 A;  2KRK A;  4M9X A;  3SMP A;  4B7H A;  4OX9 M;  1R2Y A;  1YE9 A;  3GLH A;  4MGI E;  1Z5A A;  2OPF A;  3LVW A;  4LJ5 A;  2KZU A;  4B08 A;  2K47 A;  5H37 D;  1TH2 A;  1YUB A;  4F1I A;  1GL7 A;  2Y21 A;  3GRR A;  1NNJ A;  3KDS E;  4HL4 A;  1EIJ A;  1QAQ A;  2ZM6 M;  1QAN A;  2DZN B;  2RRU A;  1QUS A;  3GPX A;  4RF0 A;  2D7H A;  4PDG A;  1R2Z A;  1HNZ M;  3VLF B;  1XNR M;  1D0M A;  1LTM A;  2KNZ A;  2KXE A;  2W82 A;  1R5L A;  2K9D A;  3GLG A;  4AW4 A;  4HLQ A;  4DV2 M;  2JWS A;  2HKJ A;  2KHH A;  3I01 M;  1NJG A;  4D81 A;  4LY6 A;  5DYG A;  4DR2 M;  2Z3X A;  3KFU G;  1V33 A;  2LTU A;  2DWZ B;  3HWS A;  3RE8 A;  4IBJ A;  4R7G A;  4FCT A;  3QAU A;  3A46 A;  5LMU M;  3NWL A;  2VII A;  4IBE A;  1E9R A;  2YR0 A;  1YLA A;  3U6M A;  1WGL A;  2LHC A;  4MM3 B;  1DGF A;  4K0K M;  2R18 A;  2X49 A;  3U5Z A;  2MGW A;  4CHT B;  1NO1 A;  4RF1 A;  2APL A;  3CGW A;  2VQE M;  1TGU A;  4QNR A;  5JI3 E;  2CHQ A;  3C9P A;  3LCV B;  2DEN A;  3DZD A;  5ITQ A;  2WSF F;  3FTD A;  1OKS A;  1RU3 A;  3PNV A;  1I94 M;  1QUT A;  1IN8 A;  1FNN A;  2ZTD A;  4PT5 A;  2XLJ A;  3U6L A;  2H1R A;  3L27 A;  1JB0 F;  2D7G A;  4LF9 M;  4B3R M;  3FUW A;  4LJA A;  1IN6 A;  1E94 E;  3FUX A;  4LJ8 A;  3E46 A;  1NV8 A;  2F4V M;  4W5W A;  5FTK A;  3KS4 A;  2R65 A;  3PNY A;  2CFO A;  1WR1 B;  3ZC7 B;  5EP3 A;  2K6B A;  3FD9 A;  4LJ9 A;  2YNM D;  1R6B X;  3QYB A;  4LJ7 A;  1IFY A;  2QNJ A;  2QEN A;  2JY7 A;  3LQQ A;  1GLN A;  2EUC A;  7CAT A;  5DNY A;  1NVM A;  4B7F A;  5IWA M;  3CF6 E;  2R62 A;  1QDT A;  3NBX X;  4Y28 F;  1DO0 A;  2JY8 A;  4HEO A;  1GAB A;  1XHB A;  1A5T A;  5ITX A;  5GKN A;  4AG6 A;  1N33 M;  2KNV A;  3AV0 A;  4BLC A;  1DO2 A;  4M9S A;  1Q3C A;  3U6O A;  4AQY M;  2UUA M;  3C3E A;  2QSF X;  5IRE B;  3SAR A;  1GO5 A;  4JN6 A;  4M9Z A;  2DAI A;  2BWE A;  1QYR A;  2ZAN A;  4D80 A;  2CV2 A;  1QAM A;  3QWL A;  4DR5 M;  2Q2E B;  3U61 A;  2NQ8 C;  4BBA A;  1EFU B;  1J09 A;  1D2N A;  5EP1 A;  3B74 A;  1NHG C;  2FH0 A;  3KSX A;  1SXJ D;  4DUY M;  1IXS B;  3JAM S;  3C58 A;  2BWB A;  2QCU A;  3HKP A;  4Z6Y A;  5L8R F;  3U6S A;  1T6O A;  1AUA A;  2EKF A;  5KQ8 A;  3PFI A;  1C1K A;  1D0K A;  4QHT A;  1WHC A;  4CJ6 A;  1IQP A;  2LVA A;  3T15 A;  1HJP A;  5JI2 E;  4JI2 M;  1XXH A;  2CHG A;  1SXJ C;  4YHH M;  3SAT A;  5EP2 A;  2CV0 A;  3AFH A;  1OIZ A;  3FTE A;  1XC8 A;  2LH0 A;  1EE8 A;  2JP7 A;  3TE6 A;  3L26 A;  2WSE F;  4G4O A;  4NRW A;  4LFA M;  4JXJ A;  3K9O A;  3U60 A;  4S12 A;  1PJJ A;  4F2L A;  4XGI A;  3AKZ A;  3EIH A;  2V6Z M;  5BPV A;  1HNX M;  1DV0 A;  1E32 A;  2JXN A;  3VDU A;  2DVW B;  2MRO B;  4D82 A;  4Z8X A;  3HHY A;  4JYA M;  1JR3 A;  3HHW A;  4GH9 A;  3T1Y M;  2P5T A;  1NY5 A;  1N36 M;  3BXW A;  3GRY A;  2L4F A;  2OQ4 A;  3GPY A;  1GVN A;  4LZZ A;  3KS8 A;  2L2D A;  3ILK A;  2C99 A;  5E26 A;  1IBK M;  1PJI A;  3W0F A;  4IBI A;  2E5L M;  2JNH A;  3KOW E;  3J27 B;  3I04 M;  3K8Z A;  4MGZ E;  5EXX A;  3GLF E;  3HU1 A;  4GKK M;  2WZJ A;  2CHV A;  4I8O A;  4GHA A;  3J7B A;  1MJG M;  3UJN A;  5KQD A;  4YY3 M;  1IY2 A;  1Z5C A;  1Q02 A;  1R7R A;  1SXJ E;  1WXQ A;  4M0D A;  1ZAE A;  1BVS A;  3KOX E;  4WP2 A;  2F5Q A;  3GLI E;  2QQ8 A;  1JQJ C;  3KOY E;  4JI5 M;  5ITR A;  1NNU C;  1V92 A;  1WGN A;  2KNA A;  3KXE C;  4LJ6 A;  3HHZ A;  4IBK A;  1VDL A;  5LMN M;  3SYK A;  1GJT A;  1IM2 A;  1TH3 A;  1VEJ A;  3FUU A;  4DV4 M;  1N77 A;  2ZTC A;  4LRS A;  3M0E A;  2GQF A;  2KW0 A;  5FTM A;  1GJS A;  2KEB A;  5A2Q S;  2OO9 A;  1C7Y A;  4X65 M;  2VDB B;  4GEW A;  3F92 A;  4LF5 M;  4IBC A;  2DWM A;  2Y20 A;  3BBZ A;  2LVP C;  1Y8G A;  3OTO M;  2QBY B;  1L1Z A;  2FNA A;  1MN3 A;  3GLG E;  2FS1 A;  2JA2 A;  2ERC A;  4DV0 M;  4L8R C;  2XF3 A;  4KLN A;  2XH9 A;  3BOS A;  3HU2 A;  2X4A A;  2VF8 A;  3I4V A;  3T6P A;  3WHL A;  3SHG B;  3V76 A;  4M0W A;  1TDZ A;  4KHP M;  2UXB M;  2DNA A;  2FE8 A;  5FSW A;  3MJ5 A;  1Z6T A;  3AOE C;  4XBO A;  3M6A A;  3GLH E;  4KOD A;  3A45 A;  3KP1 E;  2HWJ A;  5C1B A;  2LWX A;  4A3V B;  4B3T M;  4I81 A;  3GP1 A;  2L7H A;  4BB9 A;  4FWH A;  3GQ3 A;  1GL6 A;  4WUR A;  5ITT A;  4R3D A;  2Z8Y M;  3W0L B;  2R6F A;  1N75 A;  4II7 A;  1L2B A;  2F5N A;  2O25 A;  4X66 M;  4NXN M;  3UMM A;  1K82 A;  4AKH A;  3H4M A;  3MMP A;  1PRB A;  1IN5 A;  1T43 A;  2ZBK B;  3K1J A;  4FW9 A;  4IIW A;  4NL4 H;  4QNM A;  3AL0 C;  2O01 F;  2DWN A;  3I51 A;  2DZL A;  4MGK E;  3NBI A;  4JI6 M;  1DGB A;  2UUC M;  1ZMU A;  1NY6 A;  1PJT A;  1PJS A;  1G3I A;  1TDH A;  4IJF A;  4L15 A;  2CWB A;  1TR8 A;  1G8P A;  5EQT A;  1YSY A;  1CUK A;  1P3Q Q;  2D7E A;  2BJV A;  3LVV A;  1L1T A;  2L4E A;  4KO8 A;  2KA6 B;  4MGY E;  3K2L A;  3MHV C;  2L7I A;  2HCB A;  2HAK A;  1G59 A;  1R4G A;  1S3S A;  4CIZ A;  3Q8G A;  4DR3 M;  4ITQ A;  2CV1 A;  3ZH9 B;  5F3W A;  4MH0 E;  3DOA A;  2C98 A;  3W67 A;  3GLF B;  2JZ0 A;  3HGI A;  3FYD A;  3IG5 A;  3L29 A;  1F4I A;  4G6Z A;  2DZO B;  3LQR A;  4B7G A;  1SXJ B;  2L6O A;  3HHX A;  4JI8 M;  1TF0 B;  2Z4R A;  3B7Z A;  4OVZ B;  2R4J A;  4NSO B;  4RKU F;  1V34 A;  5DYI A;  2EKK A;  4FCV A;  3TWK A;  2K0B X;  1QZM A;  2LHG A;  2LBC A;  3KVW A;  2N35 A;  3GLI B;  3K9P A;  2QP9 X;  4LGY A;  3LW5 F;  2LXE A;  1Z59 A;  1IBM M;  3FYC A;  2J7N A;  1G41 A;  3HJ8 A;  5FLX S;  3I4Y A;  1IN4 A;  3LMM A;  1DGH B;  2DXI A;  2OOA A;  4AZF A;  3DFZ A;  1N34 M;  4DV6 M;  2BNK A;  1NSF A;  3A98 B;  4WW0 A;  4LCB A;  4DV7 M;  4B3M M;  1HT2 E;  5IZ7 D;  5ITY A;  1OFH A;  1VDD A;  2C9C A;  3J7A S;  3SHF A;  2GNO A;  1IXS A;  1MX0 A;  1JR3 D;  1H6U A;  2BJW A;  4GC9 A;  4JI0 M;  1XMQ M;  5FTJ A;  3TWM A;  5ITX E;  1HQY E;  3B9P A;  1XNQ M;  5IT9 S;  1KSF X;  2EO2 A;  1Q3B A;  4MB7 A;  4ANR A;  4XK8 F;  3RFW A;  2RGH A;  4B3S M;  4LF6 M;  2J5Y A;  3SYL A;  2DHR A;  3RGS A;  3C3D A;  3GRU A;  4OW0 A;  3L25 A;  5FTN A;  2XGN A;  3IEC A;  1KYI A;  1G71 A;  1WIV A;  2QPA A;  1UM8 A;  3SMS A;  1VG5 A;  2M60 A;  3SC3 A;  1VQ1 A;  4Q7J A;  5EJC A;  4PD2 A;  3GLH B;  2R4E A;  4PCZ A;  3E21 A;  1SG9 A;  3FUT A;  2LVN C;  4JI4 M;  2MR9 A;  1W5T A;  1G4A E;  1XMO M;  1Z5B A;  2UUB M;  1XXH E;  2JY6 B;  3JR4 A;  3A42 A;  3EIE A;  4DBG B;  2XFT A;  2JY5 A;  4IBB A;  1AIP C;  4EIW A;  1TH4 A;  1QZE A;  3B7Q A;  1L8Q A;  2RGO A;  3GLG B;  3L2A A;  4P16 A;  5KO3 A;  3B89 A;  3GPU A;  2XEP A;  4GC5 A;  2HL7 A;  2L09 A;  2AHM A;  2Y0T A;  4KT0 F;  4GMQ A;  1PGY A;  1KFV A;  3GO8 A;  2DHY A;  3HU3 A;  1ZMV A;  3ZQJ A;  2CEA A;  1XB2 B;  2LVO C;  2YFQ A;  3SBJ A;  1JR3 E;  2C9O A;  4AI6 A;  2R0I A;  2CUZ A;  2F5P A;  4GKJ M;  4L4U A;  4DV3 M;  1E9S A;  2XZU A;  1QQW A;  3IHP A;  3SFZ A;  3IG8 A;  1J5E M;  2EA0 A;  4I5S A;  3VK8 A;  3SAU A;  5C18 A;  1LV7 A;  3VFD A;  3U5Z B;  3TPZ A;  4IBD A;  1ORY B;  4LFC M;  2QZ4 A;  1HT1 E;  3MK6 A;  2VQF M;  3J2P B;  4L78 A;  1OFI A;  3RGP A;  2XFS A;  1I4W A;  3E4R A;  4LRT A;  2OOB A;  1MU5 A;  3H4J A;  2VF7 A;  3L28 A;  4FWG A;  5DFL A;  2R46 A;  3J80 S;  1VEK A;  2KDL A;  4NRV A;  4JI1 M;  3W68 A;  3KOZ E;  5BR8 M;  2R45 A;  1IY1 A;  2I7N A;  1OQY A;  2FFJ A;  3HJS A;  1QVR A;  2QBY A;  3D8L A;  3VDP A;  4X62 M;  3FUV A;  3B7N A;  4IBG A;  3AOE A;  4IBF A;  3T38 A;  2G8L A;  4GIT A;  4LF8 M;  4QOZ C;  4FD2 A;  2RKO A;  3KSJ A;  5FTL A;  2UXC M;  4DR6 M;  3FRH A;  3FKE A;  4DUZ M;  4JI3 M;  4RNA A;  2ZAM A;  2LNH C;  1VEG A;  4LJ4 A;  4DV5 M;  1IXZ A;  1HQC A;  4FWD A;  2KRU A;  4QHS A;  4LFB M;  5E6J A;  3HZJ A;  2QHO B;  1IXR C;  3FE3 A;  5KPT A;  3WHK A;  1FJG M;  3DA1 A;  2I7P A;  1IBL M;  3CF0 A;  4AKG A;  2V1C A;  2G5G X;  4G4Q A;  1ZQ9 A;  1D0L A;  2LVQ D;  1XWI A;  3PXG A;  4GHL A;  1PJQ A;  3U61 B;  3THG A;  2EJS A;  1NJF A;  2CRU A;  4NOO B;  2M5Z A;  3TL4 X;  5KPR A;  8CAT A;  5EXT A;  2DAM A;  1L2D A;  4LGM A;  1K3W A;  2UU9 M;  2DWL A;  1N32 M;  5EXP A;  1J7K A;  4QOS A;  2MH8 A;  3Q8X A;  2F5S A;  2HHH M;  4IJE A;  4DR7 M;  2CP8 A;  3PVS A;  3LCU A;  4LF7 M;  1OJL A;  4I4L A;  2FOI C;  4G4R A;  3R9X B;  3VKG A;  3SAV A;  2B3T A;  1GKI A;  2MJ5 B;  3FRI A;  1XXH B;  3FTF A;  2H5X A;  4FCW A;  3HY5 A;  4CGY B;  1K3X A;  1W5S A;  4NSR A;  1Q39 A;  2KZS A;  5EP4 A;  4UN2 B;  3GLF A;  3FTC A;  2UXD M;  1OTR A;  3U60 B;  2V1U A;  3D8B A;  2J7O A;  2O5R A;  3U6E A;  1T3T A;  4AG5 A;  2C5R A;  3AJI B;  2A5Y B;  3CTW B;  3TQS A;  3UK6 A;  3JR5 A;  3R8F A;  3HX3 A;  1SXJ A;  3GRV A;  2R44 A;  4OVZ A;  3TWL A;  3J81 S;  4DR1 M;  1ZMW A;  1DGG A;  3UGJ A;  4L6V 6;  4MGH A;  3GLI A;  1QDR A;  3SAW A;  3U6P A;  1HNW M;  2Z7J A;  1NHW C;  4REZ A;  4CIS A;  2XZF A;  3AOG A;  4GRI A;  3U6C A;  1IN7 A;  3HJQ A;  4LZJ A;  3U6D A;  2G3Q A;  3VKH A;  1DGH A;  2CE7 A;  2YQZ A;  1HR0 M;  3SAS A;  4P17 A;  2XSZ D;  4AKI A;  2DAG A;  4DR4 M;  4G4N A;  4FVM A;  2DAE A;  5KPZ A;  2XSZ A;  3KP0 E;  2WSC F;  3GPP A;  3GQ5 A;  5ITU A;  3ZCB B;  4G3O A;  4JV5 M;  1X37 A;  2DKL A;  4R71 A;  1QAO A;  2ZAO A;  2X8A A;  1OAI A;  4JI7 M;  4PDI A;  1OIP A;  1OAO C;  1WJ7 A;  1IY0 A;  2JUJ A;  4NXM M;  4L16 A;  3E9S A;  1N78 A;  3U6Q A;  1UFZ A;  1ZV1 A;  4TUW A;  1TTE A;  2DAK A;  3M7G A;  4GIP A;  3UZU A;  4ZPX A;  4X64 M;  2F5O A;  3KW6 A;  5EXS A;  4LF4 M;  3QYE A;  2DI0 A;  4OU7 A;  4NC6 A;  2JZ1 A;  3T1H M;  3K92 A;  2Z4S A;  4DV1 M;  3VK7 A;  2C96 A;  1L2C A; 
#chains in the Genus database with same CATH homology
 3CF2 A;  1PM5 A;  4LG2 A;  2Y0Q A;  3GQ4 A;  2KRK A;  4M9X A;  3SMP A;  4B7H A;  4OX9 M;  1R2Y A;  1YE9 A;  3GLH A;  4MGI E;  1Z5A A;  2OPF A;  3LVW A;  4LJ5 A;  2KZU A;  4B08 A;  2K47 A;  5H37 D;  1TH2 A;  1YUB A;  1GL7 A;  2Y21 A;  3GRR A;  1NNJ A;  3KDS E;  4HL4 A;  1QAQ A;  2ZM6 M;  1QAN A;  2DZN B;  3GPX A;  4RF0 A;  2D7H A;  4PDG A;  1R2Z A;  1HNZ M;  3VLF B;  1XNR M;  2KXE A;  2W82 A;  3GLG A;  4AW4 A;  4HLQ A;  4DV2 M;  2HKJ A;  1NJG A;  4D81 A;  4LY6 A;  5DYG A;  4DR2 M;  2Z3X A;  3KFU G;  2DWZ B;  3HWS A;  3RE8 A;  4IBJ A;  4R7G A;  4FCT A;  3QAU A;  3A46 A;  5LMU M;  3NWL A;  2VII A;  4IBE A;  1E9R A;  2YR0 A;  3U6M A;  4MM3 B;  4K0K M;  1DGF A;  2R18 A;  2X49 A;  3U5Z A;  4CHT B;  4RF1 A;  2VQE M;  1TGU A;  4QNR A;  5JI3 E;  2CHQ A;  5ITQ A;  3DZD A;  3FTD A;  3PNV A;  1I94 M;  1IN8 A;  1FNN A;  4PT5 A;  2XLJ A;  3U6L A;  2H1R A;  3L27 A;  2D7G A;  4LF9 M;  4B3R M;  3FUW A;  4LJA A;  1IN6 A;  1E94 E;  3FUX A;  4LJ8 A;  2F4V M;  4W5W A;  5FTK A;  3KS4 A;  2R65 A;  3PNY A;  2CFO A;  3ZC7 B;  5EP3 A;  3FD9 A;  4LJ9 A;  2YNM D;  1R6B X;  4LJ7 A;  2QEN A;  3LQQ A;  1GLN A;  2EUC A;  7CAT A;  5DNY A;  1NVM A;  4B7F A;  5IWA M;  3CF6 E;  2R62 A;  1DO0 A;  1XHB A;  5ITX A;  5GKN A;  4AG6 A;  1N33 M;  3AV0 A;  4BLC A;  1DO2 A;  4M9S A;  1Q3C A;  3U6O A;  4AQY M;  2UUA M;  5IRE B;  3SAR A;  4JN6 A;  4M9Z A;  1QYR A;  2ZAN A;  4D80 A;  2CV2 A;  1QAM A;  3QWL A;  4DR5 M;  2Q2E B;  3U61 A;  2NQ8 C;  4BBA A;  1J09 A;  1D2N A;  5EP1 A;  1NHG C;  3KSX A;  1SXJ D;  4DUY M;  1IXS B;  3JAM S;  3C58 A;  4Z6Y A;  2QCU A;  3HKP A;  3U6S A;  5KQ8 A;  3PFI A;  1C1K A;  4QHT A;  1IQP A;  3T15 A;  5JI2 E;  4JI2 M;  1XXH A;  2CHG A;  1SXJ C;  4YHH M;  3SAT A;  5EP2 A;  2CV0 A;  3AFH A;  3FTE A;  1XC8 A;  2LH0 A;  1EE8 A;  3L26 A;  3TE6 A;  4G4O A;  4NRW A;  4LFA M;  4JXJ A;  3U60 A;  4S12 A;  1PJJ A;  3AKZ A;  4XGI A;  3EIH A;  2V6Z M;  5BPV A;  1HNX M;  1E32 A;  3VDU A;  2DVW B;  4D82 A;  4Z8X A;  3HHY A;  4JYA M;  1JR3 A;  3HHW A;  4GH9 A;  3T1Y M;  2P5T A;  1NY5 A;  1N36 M;  3GRY A;  2OQ4 A;  3GPY A;  1GVN A;  4LZZ A;  3KS8 A;  3ILK A;  5E26 A;  2C99 A;  1IBK M;  1PJI A;  3W0F A;  4IBI A;  2E5L M;  3KOW E;  3J27 B;  3K8Z A;  4MGZ E;  5EXX A;  3HU1 A;  4GKK M;  2CHV A;  4I8O A;  4GHA A;  3J7B A;  3UJN A;  5KQD A;  4YY3 M;  1IY2 A;  1Z5C A;  1R7R A;  1SXJ E;  1WXQ A;  4M0D A;  1ZAE A;  3KOX E;  2F5Q A;  1JQJ C;  3KOY E;  4JI5 M;  5ITR A;  1NNU C;  3KXE C;  4LJ6 A;  3HHZ A;  4IBK A;  5LMN M;  3SYK A;  1IM2 A;  1TH3 A;  3FUU A;  4DV4 M;  1N77 A;  4LRS A;  3M0E A;  2KW0 A;  5FTM A;  2KEB A;  5A2Q S;  4X65 M;  4LF5 M;  4IBC A;  2DWM A;  2Y20 A;  3OTO M;  2QBY B;  1L1Z A;  2FNA A;  2JA2 A;  2ERC A;  4DV0 M;  4L8R C;  2XF3 A;  4KLN A;  2XH9 A;  3BOS A;  3HU2 A;  2X4A A;  3I4V A;  3WHL A;  3SHG B;  4M0W A;  1TDZ A;  4KHP M;  2UXB M;  5FSW A;  2FE8 A;  3MJ5 A;  1Z6T A;  3AOE C;  4XBO A;  3M6A A;  4KOD A;  3A45 A;  3KP1 E;  5C1B A;  2LWX A;  4A3V B;  4B3T M;  4I81 A;  3GP1 A;  2L7H A;  4BB9 A;  4FWH A;  3GQ3 A;  1GL6 A;  4WUR A;  5ITT A;  4R3D A;  3W0L B;  4II7 A;  1N75 A;  1L2B A;  2F5N A;  4X66 M;  4NXN M;  3UMM A;  1K82 A;  4AKH A;  3H4M A;  3K1J A;  1IN5 A;  2ZBK B;  4IIW A;  4FW9 A;  4NL4 H;  4QNM A;  3AL0 C;  2DWN A;  3I51 A;  4MGK E;  4JI6 M;  3NBI A;  1DGB A;  2UUC M;  1NY6 A;  1G3I A;  1TDH A;  4IJF A;  4L15 A;  1G8P A;  5EQT A;  1YSY A;  2D7E A;  2BJV A;  3LVV A;  1L1T A;  4KO8 A;  2KA6 B;  4MGY E;  3K2L A;  3MHV C;  2L7I A;  2HCB A;  1G59 A;  1S3S A;  4ITQ A;  4DR3 M;  2CV1 A;  3ZH9 B;  5F3W A;  4MH0 E;  3DOA A;  2C98 A;  3GLF B;  3HGI A;  3FYD A;  3IG5 A;  3L29 A;  4G6Z A;  2DZO B;  3LQR A;  4B7G A;  1SXJ B;  2L6O A;  3HHX A;  4JI8 M;  2Z4R A;  4OVZ B;  2R4J A;  4NSO B;  5DYI A;  3TWK A;  4FCV A;  3GLI B;  1QZM A;  3KVW A;  4LGY A;  2QP9 X;  1IBM M;  2LXE A;  1Z59 A;  3FYC A;  2J7N A;  1G41 A;  3HJ8 A;  5FLX S;  3I4Y A;  1IN4 A;  3LMM A;  1DGH B;  2DXI A;  4AZF A;  3DFZ A;  1N34 M;  4DV6 M;  2BNK A;  1NSF A;  3A98 B;  4WW0 A;  4LCB A;  4DV7 M;  4B3M M;  1HT2 E;  5IZ7 D;  5ITY A;  1OFH A;  1VDD A;  2C9C A;  3J7A S;  3SHF A;  1MX0 A;  1JR3 D;  1H6U A;  2BJW A;  4GC9 A;  4JI0 M;  1XMQ M;  5FTJ A;  3TWM A;  5ITX E;  1HQY E;  3B9P A;  1XNQ M;  5IT9 S;  1KSF X;  2EO2 A;  1Q3B A;  4MB7 A;  3RFW A;  2RGH A;  4B3S M;  4LF6 M;  3SYL A;  2DHR A;  3RGS A;  3GRU A;  4OW0 A;  3L25 A;  5FTN A;  2XGN A;  1KYI A;  2QPA A;  1UM8 A;  3SMS A;  2M60 A;  3SC3 A;  5EJC A;  4PD2 A;  3GLH B;  2R4E A;  4PCZ A;  3FUT A;  4JI4 M;  1W5T A;  1G4A E;  1XMO M;  1Z5B A;  2UUB M;  3JR4 A;  3A42 A;  3EIE A;  2XFT A;  4IBB A;  4EIW A;  1TH4 A;  1L8Q A;  2RGO A;  3GLG B;  3L2A A;  4P16 A;  5KO3 A;  3GPU A;  2XEP A;  4GC5 A;  2HL7 A;  2L09 A;  2AHM A;  2Y0T A;  4GMQ A;  1KFV A;  3GO8 A;  3HU3 A;  2CEA A;  2YFQ A;  3SBJ A;  2C9O A;  4AI6 A;  2CUZ A;  2F5P A;  4GKJ M;  4L4U A;  4DV3 M;  1E9S A;  2XZU A;  1QQW A;  3SFZ A;  3IG8 A;  1J5E M;  2EA0 A;  4I5S A;  3VK8 A;  3SAU A;  5C18 A;  1LV7 A;  3VFD A;  3U5Z B;  3TPZ A;  4IBD A;  1ORY B;  4LFC M;  2QZ4 A;  1HT1 E;  3MK6 A;  2VQF M;  3J2P B;  4L78 A;  1OFI A;  3RGP A;  2XFS A;  1I4W A;  3E4R A;  4LRT A;  1MU5 A;  3L28 A;  4FWG A;  3J80 S;  2R46 A;  4NRV A;  4JI1 M;  3KOZ E;  5BR8 M;  2R45 A;  1IY1 A;  2I7N A;  2FFJ A;  3HJS A;  1QVR A;  2QBY A;  3D8L A;  3VDP A;  4X62 M;  3FUV A;  4IBG A;  4IBF A;  3AOE A;  3T38 A;  2G8L A;  4GIT A;  4LF8 M;  4QOZ C;  4FD2 A;  2RKO A;  3KSJ A;  5FTL A;  2UXC M;  4DR6 M;  3FKE A;  4DUZ M;  4JI3 M;  4RNA A;  2ZAM A;  2LNH C;  4LJ4 A;  4DV5 M;  1IXZ A;  1HQC A;  4FWD A;  2KRU A;  4QHS A;  4LFB M;  5E6J A;  1IXR C;  5KPT A;  3WHK A;  1FJG M;  3DA1 A;  2I7P A;  1IBL M;  3CF0 A;  4AKG A;  2V1C A;  2G5G X;  4G4Q A;  1ZQ9 A;  3PXG A;  4GHL A;  1XWI A;  3U61 B;  3THG A;  5KPR A;  1NJF A;  4NOO B;  2M5Z A;  3TL4 X;  8CAT A;  5EXT A;  1L2D A;  4LGM A;  1K3W A;  2UU9 M;  2DWL A;  1N32 M;  5EXP A;  1J7K A;  4QOS A;  3Q8X A;  2F5S A;  2HHH M;  4IJE A;  4DR7 M;  3PVS A;  4LF7 M;  1OJL A;  4I4L A;  2FOI C;  4G4R A;  3R9X B;  3VKG A;  3SAV A;  1GKI A;  1XXH B;  3FTF A;  4FCW A;  4CGY B;  1K3X A;  1W5S A;  4NSR A;  1Q39 A;  2KZS A;  5EP4 A;  3GLF A;  3FTC A;  2UXD M;  3U60 B;  2V1U A;  3D8B A;  2J7O A;  2O5R A;  3U6E A;  1T3T A;  4AG5 A;  2C5R A;  3AJI B;  2A5Y B;  3CTW B;  3TQS A;  3UK6 A;  3JR5 A;  3R8F A;  1SXJ A;  3GRV A;  4OVZ A;  3TWL A;  3J81 S;  4DR1 M;  1DGG A;  3UGJ A;  4MGH A;  3GLI A;  1HNW M;  3SAW A;  3U6P A;  2Z7J A;  1NHW C;  4REZ A;  4CIS A;  2XZF A;  3AOG A;  4GRI A;  3U6C A;  1IN7 A;  3HJQ A;  4LZJ A;  3U6D A;  3VKH A;  1DGH A;  2CE7 A;  2YQZ A;  1HR0 M;  3SAS A;  2XSZ D;  4AKI A;  4DR4 M;  4G4N A;  4FVM A;  5KPZ A;  2XSZ A;  3KP0 E;  3GQ5 A;  3GPP A;  5ITU A;  3ZCB B;  4JV5 M;  1X37 A;  1QAO A;  2ZAO A;  2X8A A;  4JI7 M;  4PDI A;  1IY0 A;  4NXM M;  4L16 A;  3E9S A;  1N78 A;  3U6Q A;  4TUW A;  3M7G A;  4GIP A;  3UZU A;  4ZPX A;  4X64 M;  2F5O A;  3KW6 A;  5EXS A;  4LF4 M;  4OU7 A;  3T1H M;  3K92 A;  2Z4S A;  4DV1 M;  3VK7 A;  2C96 A;  1L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...