3ZC7B

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
63
structure length
63
Chain Sequence
MVLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
total genus 25
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zc7B00
3SHGB 3ZCBB 3ZC7B
chains in the Genus database with same CATH superfamily
3GLFE 2JY6B 4P16A 2JZ1A 2FE8A 4DV7M 4IBEA 4LF9M 1R6BX 5EQTA 1GL6A 4QHTA 1JR3E 2F5NA 1Q3BA 3U61A 5KPTA 2O25A 3TPZA 4JI0M 3SMPA 2KRKA 2Y0TA 3W0LB 2XFSA 4ITQA 1QUSA 3HKPA 1XC8A 1ZMVA 3K9OA 2C9OA 4OW0A 2K9DA 3CF0A 3HU3A 4LGYA 2C5RA 1P3QQ 1HJPA 1JB0F 4RF0A 3OTOM 1E9RA 1G8PA 4P17A 2KXEA 3GQ5A 3TE6A 1HQCA 3R8FA 4AI6A 2FOIC 4RF1A 4JI3M 5FTJA 1PJTA 4LZZA 1FJGM 1HNWM 3HHXA 4IBKA 4B7GA 3NBXX 4KODA 4NSRA 2F5OA 1XNQM 3ZQJA 1YSYA 2Y0QA 4M9XA 3HU2A 5ITYA 4LF5M 4YHHM 2CV2A 4IJEA 3LQQA 1IXSA 3FTDA 3B9PA 4LRTA 5DYGA 4CHTB 4UN2B 4JI5M 3HHYA 4IBDA 1XHBA 1VG5A 4Z6YA 5C18A 2CV0A 2UXDM 1NJGA 2DAIA 2V1CA 3I04M 1QQWA 4LJ9A 4CIZA 4JYAM 2G8LA 4RNAA 4R71A 5EXPA 1OTRA 1QAMA 3EIEA 3KP0E 1XNRM 2QENA 4IBGA 1CUKA 1DGBA 3HX3A 5JI3E 4IBJA 1QANA 4DR3M 3KOZE 1VEGA 1PJIA 4GKJM 5KQDA 2L4FA 1WXQA 1HR0M 4FWGA 3LCUA 1K82A 4LG2A 2HWJA 1R5LA 2DWNA 1LV7A 4G4QA 4G4NA 2VQEM 2H1RA 1G3IA 3J7BA 2XSZD 4NRVA 5EP2A 1N34M 3FE3A 1G71A 1QVRA 4WURA 4DUZM 3FUTA 4DR1M 2HAKA 1L2CA 1NV8A 1YE9A 4G4RA 4QNRA 5IREB 3PNVA 1W5TA 1EE8A 2CHGA 1SXJD 4GKKM 3U6QA 2KRUA 1K3WA 3KDSE 3GPPA 1ZMUA 4LFBM 2YNMD 2FFJA 1L1ZA 2L6OA 2R4EA 2GNOA 2UXCM 1I4WA 3W67A 3RGSA 2XZFA 3KVWA 2QP9X 4M9SA 4DR7M 1SXJC 1D0MA 2LH0A 2LVNC 2HHHM 4LCBA 2L09A 5FTMA 1DO2A 1OJLA 2LWXA 2C96A 5C1BA 1C7YA 2L7HA 1IBLM 5EXXA 1L2BA 2Z3XA 4B3RM 4I4LA 2WSFF 3A45A 4D81A 1IY2A 1GABA 3HJSA 5EJCA 3J80S 2V1UA 3SAUA 4L78A 3E46A 2YR0A 1GLNA 3ILKA 4IBFA 3RGPA 3VDPA 1R2ZA 1IXRC 3E21A 3TQSA 4X62M 2H5XA 4F1IA 4MGIE 2J7NA 3QYBA 2F5SA 2HKJA 1SXJB 1Z59A 1PJSA 2VF8A 3B7ZA 2OQ4A 3GLIB 1N78A 2CHVA 1UFZA 2F5PA 2QSFX 2Z7JA 1WIVA 4FCVA 1PM5A 4GIPA 4LF6M 4JXJA 3AJIB 3B89A 3KSXA 1NY6A 2OOBA 2L4EA 3C3EA 5FTLA 1R7RA 4JI7M 2FS1A 2LBCA 4B3SM 2ZM6M 3VKHA 4W5WA 4FCWA 3J81S 2VF7A 3M7GA 2DENA 4MM3B 1SXJA 3NWLA 3L28A 4JI8M 5GKNA 1OAIA 1TH4A 4DR2M 1WR1B 2BWEA 3SBJA 1PRBA 2DHRA 2DXIA 4NXNM 2LHCA 1T3TA 2X8AA 5JI2E 3AKZA 4M0DA 4PD2A 5EXTA 3U61B 3BOSA 1N32M 5BPVA 2MR9A 1NSFA 2F5QA 4S12A 4B3TM 4YY3M 4LJAA 4NRWA 5E26A 2Z4RA 2R44A 3AOGA 1Q3CA 3VFDA 4LJ4A 3U5ZB 3CF6E 1Y8GA 5FSWA 4PDIA 4QOZC 4LJ7A 3SAVA 5BR8M 2I7PA 1KSFX 5LMNM 3U6PA 4LF4M 4XK8F 4OVZB 3E4RA 4GMQA 1E9SA 3AFHA 1SXJE 1SG9A 7CATA 1DGHB 3FRIA 3KSJA 4DR5M 4LRSA 4KO8A 3GLIE 2R62A 3KXEC 1H6UA 4BLCA 4PT5A 3SATA 1IXSB 4X65M 3MJ5A 2XZUA 3U5ZA 1IBMM 3CTWB 1T6OA 2LVPC 5ITRA 4MGZE 3GQ4A 1TTEA 2LVQD 8CATA 1QZEA 1TDZA 2LTUA 4OVZA 4HEOA 3L29A 3LVWA 2R6FA 2QPAA 1DGHA 5EP3A 3L25A 3IHPA 2QCUA 1J7KA 3KOWE 4Z8XA 5DFLA 3E9SA 3GRRA 1DGFA 2KNAA 3FTEA 5LMUM 1IN4A 4DV5M 1QYRA 2QZ4A 1OFHA 2EA0A 1QAQA 3J27B 5IZ7D 2YQZA 1MJGM 2UUAM 3DZDA 2APLA 4FW9A 1MU5A 1GJTA 1MX0A 2K47A 3U6DA 4GHLA 3JAMS 3T6PA 3VLFB 2P5TA 3THGA 4L4UA 2M5ZA 2K6BA 1G4AE 4AKHA 1E94E 2KZSA 2JUJA 3HGIA 1Q02A 1LTMA 4GITA 3TWMA 2Q2EB 3GRUA 3HJQA 4LZJA 2DWLA 2UXBM 1EIJA 3M6AA 3PNYA 2YFQA 5KPZA 4L6V6 2Z4SA 3FTFA 1VEJA 2BJVA 3KOXE 1ZQ9A 3FYDA 3AV0A 3IG8A 2EJSA 1XB2B 3HJ8A 4LGMA 3SHGB 1NY5A 2R18A 5ITXA 3ZH9B 1R2YA 3C58A 1K3XA 2MGWA 3KW6A 4JV5M 1JQJC 3I4YA 4II7A 4B7FA 2BNKA 4MB7A 5EXSA 2CHQA 4L15A 4KT0F 4LJ8A 5ITTA 3GQ3A 1L8QA 1TH2A 1VEKA 3EIHA 3H4MA 5FLXS 2QBYA 3SYLA 1WGNA 4JI2M 4CGYB 3GRVA 4MH0E 4Y28F 3I4VA 4ZPXA 4G4OA 4JI4M 2CWBA 2MJ5B 3B7QA 1GKIA 4AZFA 3K2LA 1XXHA 4IJFA 4DV6M 4B3MM 3T15A 2A5YB 2ZBKB 2G3QA 4L8RC 4DV2M 2DKLA 1IN7A 2CUZA 2KHHA 4L16A 1PJJA 3SARA 4CISA 1QDTA 1KYIA 2DI0A 3GRYA 2Y21A 4Q7JA 2R45A 3UZUA 1QDRA 1IXZA 4NC6A 3GPXA 2FNAA 3LCVB 3UK6A 2NQ8C 2CE7A 4NOOB 3UGJA 5A2QS 4DR4M 4AKGA 4M9ZA 5IT9S 1YUBA 1NV9A 1NHGC 3A98B 3D8LA 1HQYE 2MH8A 3WHLA 2EUCA 1XWIA 3FTCA 2R0IA 1VDDA 4QNMA 5E6JA 4B08A 4LFAM 4GC5A 3GPYA 1J5EM 3U6LA 4B7HA 1OIPA 3VDUA 4IBCA 4MGKE 1Q39A 4DV0M 3CGWA 1WJ7A 1ZAEA 1NNUC 3W0FA 3VK7A 1N77A 1Z5BA 1V92A 1GL7A 1HT2E 2MROB 2N35A 3U6OA 1W5SA 2DAKA 2DWZB 3VK8A 1MN3A 3A46A 1PJQA 3GLGB 4HL4A 3KOYE 3I01M 1NO1A 1TGUA 2R65A 1D0KA 3BBZA 4I5SA 3TWLA 5KO3A 4JN6A 3B74A 4LF8M 2XGNA 3C3DA 1VQ1A 3L2AA 2BJWA 2OPFA 4AQYM 3LW5F 5ITUA 2LVOC 2DVWB 4D82A 2DAMA 3L27A 3UMMA 3GLFA 3TL4X 1L1TA 2M60A 3WHKA 3SFZA 1BVSA 1NHWC 3HHZA 1OAOC 2EKKA 3I51A 3Q8GA 2RGOA 3GLGA 3U6EA 2G5GX 3U60B 3SYKA 2VQFM 2JY5A 2KEBA 2VDBB 4IBIA 1ZV1A 3FUVA 3GLHB 2DHYA 3HU1A 1V34A 4LY6A 1E32A 3CF2A 5IWAM 2C98A 1IFYA 3DA1A 2B3TA 1XMOM 3PVSA 1I94M 4GEWA 2UUCM 3A42A 4PDGA 3J7AS 4IBBA 2D7GA 1OFIA 3DFZA 1QZMA 2EO2A 2XEPA 5DYIA 2HL7A 3QYEA 4GC9A 3RE8A 2ZTDA 3U60A 3GLHA 2L2DA 3GLGE 2XFTA 1FNNA 4AKIA 1RU3A 2V6ZM 2D7EA 1NVMA 1TR8A 3K8ZA 3KS8A 3FYCA 1OIZA 3SC3A 3AOEC 4ANRA 1IM2A 4XBOA 2R46A 4QOSA 4G3OA 4DUYM 1J09A 2DZNB 3FUUA 2UU9M 4I8OA 2DZOB 2ZTCA 4R7GA 4KLNA 2OO9A 5FTNA 3UJNA 2CV1A 1OQYA 1S3SA 2RGHA 3GLHE 3QAUA 2FH0A 2O01F 1GVNA 3W68A 5H37D 1NNJA 2UUBM 4DV4M 1D2NA 1WHCA 1QUTA 2QBYB 4FD2A 3FRHA 4I81A 4LFCM 3GO8A 3SMSA 2C9CA 2KDLA 3U6SA 2WSCF 2CFOA 4EIWA 1XXHB 1AUAA 3KS4A 2JA2A 1HNZM 1Z5AA 4RKUF 1IQPA 5EP1A 4D80A 1N75A 3AL0C 2CEAA 3PXGA 3T1HM 4M0WA 1TF0B 5L8RF 1ZMWA 3AOEA 3NBIA 2O5RA 3LMMA 2L7IA 2Z8YM 4AW4A 3KFUG 3ZC7B 1DV0A 1HT1E 4FWDA 4BBAA 4DV1M 3PFIA 4JI6M 1N36M 1G59A 3HHWA 2J5YA 1F4IA 1XMQM 1T43A 5F3WA 3R9XB 5KQ8A 1NJFA 3FD9A 3K9PA 3HWSA 3C9PA 3MHVC 5ITXE 2C99A 3F92A 3JR5A 1DGGA 3MK6A 2LNHC 1C1KA 1IBKM 4OX9M 2J7OA 4IIWA 4DR6M 2JZ0A 3HY5A 3K92A 3TWKA 1V33A 1Z5CA 3T1YM 3V76A 1YLAA 4OU7A 2LHGA 2OOAA 1IY1A 2JXNA 2RRUA 3FUWA 4WP2A 3FUXA 3LQRA 1TDHA 1JR3D 2K0BX 2WSEF 2ERCA 1R4GA 1EFUB 1UM8A 2JY7A 2QQ8A 4TUWA 2JNHA 1X37A 1TH3A 2AHMA 2LXEA 3DOAA 4AG5A 1G41A 2ZAOA 1XXHE 4GH9A 4JI1M 2Y20A 2GQFA 2X49A 3Q8XA 2D7HA 1IN8A 4WW0A 4AG6A 4F2LA 3GP1A 1IN6A 3BXWA 2I7NA 4NXMM 1QAOA 3ZCBB 4LJ6A 3D8BA 2CP8A 4DV3M 4QHSA 2RKOA 2KNZA 1AIPC 2XF3A 5DNYA 2DZLA 3M0EA 3SHFA 3GLFB 1GJSA 3L26A 2JWSA 3B7NA 4PCZA 3SASA 4NSOB 2F4VM 1PGYA 3U6CA 2HCBA 5KPRA 1VDLA 2E5LM 4MGYE 2EKFA 2DWMA 3VKGA 3IECA 3LVVA 2X4AA 2KA6B 4FCTA 4GRIA 4HLQA 4X64M 4KHPM 2XSZA 3RFWA 2KW0A 2XH9A 1WGLA 3SAWA 1D0LA 1ORYB 1N33M 4XGIA 1IN5A 1OKSA 1Z6TA 2R4JA 4DBGB 5EP4A 4X66M 4G6ZA 3FKEA 1DO0A 2WZJA 2DNAA 2QNJA 2DAGA 2KNVA 4FWHA 2LVAA 4FVMA 1JR3A 4LJ5A 2VIIA 3K1JA 3HZJA 3KP1E 4REZA 5FTKA 2QHOB 3T38A 4A3VB 3GPUA 1GO5A 3GLIA 1HNXM 2BWBA 5ITQA 1KFVA 3IG5A 3J2PB 4NL4H 3MMPA 2CRUA 2DAEA 4LF7M 4R3DA 2W82A 4GHAA 4BB9A 1IY0A 2JY8A 4K0KM 1A5TA 3H4JA 3QWLA 2ZANA 1L2DA 3JR4A 4CJ6A 2KZUA 2ZAMA 4MGHA 2XLJA 3U6MA 2JP7A
chains in the Genus database with same CATH topology
4P16A 2FE8A 4DV7M 4IBEA 4LF9M 1R6BX 5EQTA 1GL6A 4QHTA 2F5NA 1Q3BA 3U61A 5KPTA 3TPZA 4JI0M 3SMPA 2KRKA 2Y0TA 3W0LB 2XFSA 4ITQA 3HKPA 1XC8A 2C9OA 4OW0A 3CF0A 3HU3A 4LGYA 2C5RA 4RF0A 3OTOM 1E9RA 1G8PA 3R8FA 2KXEA 3GQ5A 3TE6A 1HQCA 4AI6A 2FOIC 4RF1A 4JI3M 5FTJA 4LZZA 1FJGM 1HNWM 3HHXA 4IBKA 4B7GA 4KODA 4NSRA 2F5OA 1XNQM 1YSYA 2Y0QA 4M9XA 3HU2A 5ITYA 4LF5M 4YHHM 2CV2A 4IJEA 3LQQA 3FTDA 3B9PA 4LRTA 5DYGA 4CHTB 4JI5M 3HHYA 4IBDA 1XHBA 4Z6YA 5C18A 2CV0A 2UXDM 1NJGA 2V1CA 4LJ9A 1QQWA 4JYAM 2G8LA 4RNAA 5EXPA 1QAMA 3EIEA 3KP0E 1XNRM 2QENA 4IBGA 5JI3E 1DGBA 4IBJA 1QANA 4DR3M 3KOZE 1PJIA 4GKJM 5KQDA 1WXQA 1HR0M 4FWGA 1K82A 4LG2A 2DWNA 1LV7A 4G4QA 4G4NA 2VQEM 2H1RA 1G3IA 3J7BA 2XSZD 4NRVA 5EP2A 1N34M 1QVRA 4WURA 4DUZM 3FUTA 4DR1M 1L2CA 1YE9A 4G4RA 4QNRA 5IREB 3PNVA 1W5TA 1EE8A 2CHGA 1SXJD 4GKKM 3U6QA 2KRUA 1K3WA 3KDSE 3GPPA 4LFBM 2YNMD 2FFJA 1L1ZA 2L6OA 2R4EA 2UXCM 1I4WA 3RGSA 2XZFA 3KVWA 2QP9X 4M9SA 4DR7M 1SXJC 2LH0A 2HHHM 4LCBA 2L09A 5FTMA 1DO2A 1OJLA 2LWXA 2C96A 5C1BA 2L7HA 1IBLM 5EXXA 1L2BA 2Z3XA 4B3RM 4I4LA 3A45A 4D81A 1IY2A 3HJSA 5EJCA 3J80S 2V1UA 3SAUA 4L78A 4IBFA 2YR0A 1GLNA 3ILKA 3RGPA 3VDPA 1R2ZA 1IXRC 3TQSA 4X62M 4MGIE 2J7NA 2F5SA 2HKJA 1SXJB 1Z59A 2OQ4A 3GLIB 1N78A 2CHVA 2F5PA 4FCVA 2Z7JA 1PM5A 4GIPA 4LF6M 4JXJA 3AJIB 3KSXA 1NY6A 5FTLA 1R7RA 4JI7M 4B3SM 2ZM6M 3VKHA 4W5WA 4FCWA 3J81S 3M7GA 4MM3B 1SXJA 3NWLA 3L28A 4JI8M 5GKNA 4DR2M 1TH4A 3SBJA 2DHRA 2DXIA 4NXNM 5JI2E 1T3TA 2X8AA 3AKZA 4M0DA 4PD2A 5EXTA 3U61B 3BOSA 1N32M 5BPVA 1NSFA 2F5QA 4S12A 4B3TM 4YY3M 4LJAA 4NRWA 5E26A 2Z4RA 3AOGA 3VFDA 1Q3CA 4LJ4A 3U5ZB 3CF6E 5FSWA 4PDIA 4QOZC 4LJ7A 3SAVA 5BR8M 2I7PA 1KSFX 5LMNM 3U6PA 4LF4M 4OVZB 3E4RA 4GMQA 1E9SA 3AFHA 1SXJE 7CATA 1DGHB 3KSJA 4DR5M 4LRSA 4KO8A 2R62A 3KXEC 1H6UA 4BLCA 4PT5A 3SATA 1IXSB 4X65M 3MJ5A 2XZUA 3U5ZA 1IBMM 3CTWB 5ITRA 4MGZE 3GQ4A 8CATA 1TDZA 4OVZA 3L29A 3LVWA 2QPAA 1DGHA 5EP3A 3L25A 2QCUA 1J7KA 3KOWE 4Z8XA 3E9SA 3GRRA 1DGFA 3FTEA 5LMUM 1IN4A 4DV5M 1QYRA 2QZ4A 1OFHA 2EA0A 1QAQA 3J27B 5IZ7D 2YQZA 2UUAM 3DZDA 4FW9A 1MU5A 1MX0A 2K47A 3U6DA 3JAMS 3VLFB 2P5TA 3THGA 4L4UA 2M5ZA 1G4AE 4AKHA 1E94E 2KZSA 3HGIA 3TWMA 4GITA 2DWLA 2Q2EB 3GRUA 3HJQA 4LZJA 2UXBM 3M6AA 3PNYA 2YFQA 5KPZA 2Z4SA 3FTFA 2BJVA 3KOXE 1ZQ9A 3FYDA 3AV0A 3IG8A 3SHGB 3HJ8A 5ITXA 4LGMA 1K3XA 1NY5A 2R18A 1R2YA 3ZH9B 4JV5M 3C58A 4GHLA 3KW6A 1JQJC 3I4YA 4II7A 4B7FA 2BNKA 4MB7A 5EXSA 2CHQA 4L15A 5ITTA 4LJ8A 3GQ3A 1L8QA 1TH2A 3EIHA 3H4MA 5FLXS 2QBYA 3SYLA 4JI2M 4CGYB 3GRVA 4MH0E 4ZPXA 3I4VA 4G4OA 4JI4M 4AZFA 1GKIA 3K2LA 1XXHA 4IJFA 4DV6M 4B3MM 3T15A 2A5YB 2ZBKB 4L8RC 4DV2M 1IN7A 2CUZA 4L16A 1PJJA 3SARA 4CISA 1KYIA 3GRYA 2Y21A 3UZUA 2R45A 1IXZA 3GPXA 2FNAA 3UK6A 5A2QS 2NQ8C 2CE7A 4NOOB 3UGJA 4DR4M 4AKGA 4M9ZA 5IT9S 1YUBA 1NHGC 3A98B 3D8LA 1HQYE 3WHLA 2EUCA 1XWIA 3FTCA 1VDDA 4QNMA 5E6JA 4B08A 4LFAM 4GC5A 3GPYA 1J5EM 3U6LA 4B7HA 3VDUA 4IBCA 4MGKE 1Q39A 4DV0M 1ZAEA 1NNUC 3W0FA 3VK7A 1N77A 1Z5BA 1GL7A 1HT2E 3U6OA 1W5SA 2DWZB 3VK8A 3A46A 3GLGB 4HL4A 3KOYE 1TGUA 2R65A 4I5SA 3TWLA 5KO3A 4JN6A 4LF8M 2XGNA 3L2AA 2BJWA 2OPFA 4AQYM 5ITUA 2DVWB 4D82A 3L27A 3UMMA 3GLFA 3TL4X 1L1TA 2M60A 3WHKA 3SFZA 1NHWC 3HHZA 3U6EA 3I51A 3GLGA 2RGOA 2G5GX 3U60B 3SYKA 2VQFM 2KEBA 4IBIA 3FUVA 3GLHB 3HU1A 4LY6A 1E32A 3CF2A 5IWAM 2C98A 3DA1A 1XMOM 1I94M 3PVSA 2UUCM 3A42A 4PDGA 3J7AS 4IBBA 2D7GA 1OFIA 3DFZA 1QZMA 2EO2A 2XEPA 5DYIA 2HL7A 4GC9A 3RE8A 3U60A 3GLHA 2XFTA 1FNNA 4AKIA 2V6ZM 2D7EA 1NVMA 3KS8A 3K8ZA 3FYCA 3SC3A 3AOEC 1IM2A 4XBOA 2R46A 4QOSA 4DUYM 1J09A 2DZNB 3FUUA 2UU9M 4I8OA 2DZOB 4R7GA 4KLNA 5FTNA 3UJNA 2CV1A 1S3SA 2RGHA 1NNJA 3QAUA 5H37D 2UUBM 1GVNA 4DV4M 1D2NA 2QBYB 4FD2A 4I81A 4LFCM 3GO8A 3SMSA 2C9CA 3U6SA 2CFOA 4EIWA 1XXHB 3KS4A 2JA2A 1HNZM 1Z5AA 1IQPA 5EP1A 4D80A 1N75A 3AL0C 2CEAA 3PXGA 3T1HM 4M0WA 3AOEA 3NBIA 2O5RA 3LMMA 2L7IA 4AW4A 3KFUG 3ZC7B 1HT1E 4FWDA 4BBAA 4DV1M 3PFIA 1N36M 1G59A 3HHWA 1XMQM 5F3WA 3R9XB 5KQ8A 1NJFA 3FD9A 3HWSA 3MHVC 5ITXE 2C99A 3JR5A 1DGGA 3MK6A 2LNHC 1C1KA 1IBKM 4OX9M 2J7OA 4IIWA 4DR6M 3K92A 3TWKA 1Z5CA 3T1YM 4OU7A 3FUWA 1IY1A 3FUXA 3LQRA 1TDHA 1JR3D 2ERCA 1UM8A 4TUWA 2LXEA 1X37A 1TH3A 2AHMA 3DOAA 4AG5A 1G41A 2ZAOA 4GH9A 4JI1M 2Y20A 2X49A 3Q8XA 2D7HA 1IN8A 4WW0A 4AG6A 3GP1A 1IN6A 2I7NA 4NXMM 1QAOA 3ZCBB 4LJ6A 3D8BA 4DV3M 4QHSA 2RKOA 2XF3A 5DNYA 3M0EA 3SHFA 3GLFB 3L26A 4PCZA 3SASA 4NSOB 2F4VM 3U6CA 2HCBA 5KPRA 2E5LM 4MGYE 2DWMA 3VKGA 3LVVA 2X4AA 2KA6B 4FCTA 4GRIA 4HLQA 4X64M 4KHPM 2XSZA 3RFWA 2KW0A 2XH9A 3SAWA 1ORYB 1N33M 4XGIA 1IN5A 1Z6TA 2R4JA 5EP4A 4X66M 4G6ZA 3FKEA 1DO0A 4FWHA 4FVMA 1JR3A 4LJ5A 2VIIA 3K1JA 3KP1E 4REZA 5FTKA 3T38A 4A3VB 3GPUA 4JI6M 3GLIA 1HNXM 5ITQA 1KFVA 3IG5A 3J2PB 4NL4H 4LF7M 4R3DA 2W82A 4GHAA 4BB9A 1IY0A 4K0KM 3QWLA 2ZANA 1L2DA 3JR4A 2KZUA 2ZAMA 4MGHA 2XLJA 3U6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZCB B;  3ZC7 B; 
#chains in the Genus database with same CATH topology
 3GLF E;  2JY6 B;  4P16 A;  2JZ1 A;  2FE8 A;  4DV7 M;  4IBE A;  4LF9 M;  1R6B X;  5EQT A;  1GL6 A;  4QHT A;  1JR3 E;  2F5N A;  1Q3B A;  3U61 A;  5KPT A;  2O25 A;  3TPZ A;  4JI0 M;  3SMP A;  2KRK A;  2Y0T A;  3W0L B;  2XFS A;  4ITQ A;  1QUS A;  3HKP A;  1XC8 A;  1ZMV A;  3K9O A;  2C9O A;  4OW0 A;  2K9D A;  3CF0 A;  3HU3 A;  4LGY A;  2C5R A;  1P3Q Q;  1HJP A;  1JB0 F;  4RF0 A;  3OTO M;  1E9R A;  1G8P A;  4P17 A;  2KXE A;  3GQ5 A;  3TE6 A;  1HQC A;  3R8F A;  4AI6 A;  2FOI C;  4RF1 A;  4JI3 M;  5FTJ A;  1PJT A;  4LZZ A;  1FJG M;  1HNW M;  3HHX A;  4IBK A;  4B7G A;  3NBX X;  4KOD A;  4NSR A;  2F5O A;  1XNQ M;  3ZQJ A;  1YSY A;  2Y0Q A;  4M9X A;  3HU2 A;  5ITY A;  4LF5 M;  4YHH M;  2CV2 A;  4IJE A;  3LQQ A;  1IXS A;  3FTD A;  3B9P A;  4LRT A;  5DYG A;  4CHT B;  4UN2 B;  4JI5 M;  3HHY A;  4IBD A;  1XHB A;  1VG5 A;  4Z6Y A;  5C18 A;  2CV0 A;  2UXD M;  1NJG A;  2DAI A;  2V1C A;  3I04 M;  1QQW A;  4LJ9 A;  4CIZ A;  4JYA M;  2G8L A;  4RNA A;  4R71 A;  5EXP A;  1OTR A;  1QAM A;  3EIE A;  3KP0 E;  1XNR M;  2QEN A;  4IBG A;  1CUK A;  1DGB A;  3HX3 A;  5JI3 E;  4IBJ A;  1QAN A;  4DR3 M;  3KOZ E;  1VEG A;  1PJI A;  4GKJ M;  5KQD A;  2L4F A;  1WXQ A;  1HR0 M;  4FWG A;  3LCU A;  1K82 A;  4LG2 A;  2HWJ A;  1R5L A;  2DWN A;  1LV7 A;  4G4Q A;  4G4N A;  2VQE M;  2H1R A;  1G3I A;  3J7B A;  2XSZ D;  4NRV A;  5EP2 A;  1N34 M;  3FE3 A;  1G71 A;  1QVR A;  4WUR A;  4DUZ M;  3FUT A;  4DR1 M;  2HAK A;  1L2C A;  1NV8 A;  1YE9 A;  4G4R A;  4QNR A;  5IRE B;  3PNV A;  1W5T A;  1EE8 A;  2CHG A;  1SXJ D;  4GKK M;  3U6Q A;  2KRU A;  1K3W A;  3KDS E;  3GPP A;  1ZMU A;  4LFB M;  2YNM D;  2FFJ A;  1L1Z A;  2L6O A;  2R4E A;  2GNO A;  2UXC M;  1I4W A;  3W67 A;  3RGS A;  2XZF A;  3KVW A;  2QP9 X;  4M9S A;  4DR7 M;  1SXJ C;  1D0M A;  2LH0 A;  2LVN C;  2HHH M;  4LCB A;  2L09 A;  5FTM A;  1DO2 A;  1OJL A;  2LWX A;  2C96 A;  5C1B A;  1C7Y A;  2L7H A;  1IBL M;  5EXX A;  1L2B A;  2Z3X A;  4B3R M;  4I4L A;  2WSF F;  3A45 A;  4D81 A;  1IY2 A;  1GAB A;  3HJS A;  5EJC A;  3J80 S;  2V1U A;  3SAU A;  4L78 A;  3E46 A;  2YR0 A;  1GLN A;  3ILK A;  4IBF A;  3RGP A;  3VDP A;  1R2Z A;  1IXR C;  3E21 A;  3TQS A;  4X62 M;  2H5X A;  4F1I A;  4MGI E;  2J7N A;  3QYB A;  2F5S A;  2HKJ A;  1SXJ B;  1Z59 A;  1PJS A;  2VF8 A;  3B7Z A;  2OQ4 A;  3GLI B;  1N78 A;  2CHV A;  1UFZ A;  2F5P A;  2QSF X;  2Z7J A;  1WIV A;  4FCV A;  1PM5 A;  4GIP A;  4LF6 M;  4JXJ A;  3AJI B;  3B89 A;  3KSX A;  1NY6 A;  2OOB A;  2L4E A;  3C3E A;  5FTL A;  1R7R A;  4JI7 M;  2FS1 A;  2LBC A;  4B3S M;  2ZM6 M;  3VKH A;  4W5W A;  4FCW A;  3J81 S;  2VF7 A;  3M7G A;  2DEN A;  4MM3 B;  1SXJ A;  3NWL A;  3L28 A;  4JI8 M;  5GKN A;  1OAI A;  1TH4 A;  4DR2 M;  1WR1 B;  2BWE A;  3SBJ A;  1PRB A;  2DHR A;  2DXI A;  4NXN M;  2LHC A;  1T3T A;  2X8A A;  5JI2 E;  3AKZ A;  4M0D A;  4PD2 A;  5EXT A;  3U61 B;  3BOS A;  1N32 M;  5BPV A;  2MR9 A;  1NSF A;  2F5Q A;  4S12 A;  4B3T M;  4YY3 M;  4LJA A;  4NRW A;  5E26 A;  2Z4R A;  2R44 A;  3AOG A;  1Q3C A;  3VFD A;  4LJ4 A;  3U5Z B;  3CF6 E;  1Y8G A;  5FSW A;  4PDI A;  4QOZ C;  4LJ7 A;  3SAV A;  5BR8 M;  2I7P A;  1KSF X;  5LMN M;  3U6P A;  4LF4 M;  4XK8 F;  4OVZ B;  3E4R A;  4GMQ A;  1E9S A;  3AFH A;  1SXJ E;  1SG9 A;  7CAT A;  1DGH B;  3FRI A;  3KSJ A;  4DR5 M;  4LRS A;  4KO8 A;  3GLI E;  2R62 A;  3KXE C;  1H6U A;  4BLC A;  4PT5 A;  3SAT A;  1IXS B;  4X65 M;  3MJ5 A;  2XZU A;  3U5Z A;  1IBM M;  3CTW B;  1T6O A;  2LVP C;  5ITR A;  4MGZ E;  3GQ4 A;  1TTE A;  2LVQ D;  8CAT A;  1QZE A;  1TDZ A;  2LTU A;  4OVZ A;  4HEO A;  3L29 A;  3LVW A;  2R6F A;  2QPA A;  1DGH A;  5EP3 A;  3L25 A;  3IHP A;  2QCU A;  1J7K A;  3KOW E;  4Z8X A;  5DFL A;  3E9S A;  3GRR A;  1DGF A;  2KNA A;  3FTE A;  5LMU M;  1IN4 A;  4DV5 M;  1QYR A;  2QZ4 A;  1OFH A;  2EA0 A;  1QAQ A;  3J27 B;  5IZ7 D;  2YQZ A;  1MJG M;  2UUA M;  3DZD A;  2APL A;  4FW9 A;  1MU5 A;  1GJT A;  1MX0 A;  2K47 A;  3U6D A;  4GHL A;  3JAM S;  3T6P A;  3VLF B;  2P5T A;  3THG A;  4L4U A;  2M5Z A;  2K6B A;  1G4A E;  4AKH A;  1E94 E;  2KZS A;  2JUJ A;  3HGI A;  1Q02 A;  1LTM A;  4GIT A;  3TWM A;  2Q2E B;  3GRU A;  3HJQ A;  4LZJ A;  2DWL A;  2UXB M;  1EIJ A;  3M6A A;  3PNY A;  2YFQ A;  5KPZ A;  4L6V 6;  2Z4S A;  3FTF A;  1VEJ A;  2BJV A;  3KOX E;  1ZQ9 A;  3FYD A;  3AV0 A;  3IG8 A;  2EJS A;  1XB2 B;  3HJ8 A;  4LGM A;  3SHG B;  1NY5 A;  2R18 A;  5ITX A;  3ZH9 B;  1R2Y A;  3C58 A;  1K3X A;  2MGW A;  3KW6 A;  4JV5 M;  1JQJ C;  3I4Y A;  4II7 A;  4B7F A;  2BNK A;  4MB7 A;  5EXS A;  2CHQ A;  4L15 A;  4KT0 F;  4LJ8 A;  5ITT A;  3GQ3 A;  1L8Q A;  1TH2 A;  1VEK A;  3EIH A;  3H4M A;  5FLX S;  2QBY A;  3SYL A;  1WGN A;  4JI2 M;  4CGY B;  3GRV A;  4MH0 E;  4Y28 F;  3I4V A;  4ZPX A;  4G4O A;  4JI4 M;  2CWB A;  2MJ5 B;  3B7Q A;  1GKI A;  4AZF A;  3K2L A;  1XXH A;  4IJF A;  4DV6 M;  4B3M M;  3T15 A;  2A5Y B;  2ZBK B;  2G3Q A;  4L8R C;  4DV2 M;  2DKL A;  1IN7 A;  2CUZ A;  2KHH A;  4L16 A;  1PJJ A;  3SAR A;  4CIS A;  1QDT A;  1KYI A;  2DI0 A;  3GRY A;  2Y21 A;  4Q7J A;  2R45 A;  3UZU A;  1QDR A;  1IXZ A;  4NC6 A;  3GPX A;  2FNA A;  3LCV B;  3UK6 A;  2NQ8 C;  2CE7 A;  4NOO B;  3UGJ A;  5A2Q S;  4DR4 M;  4AKG A;  4M9Z A;  5IT9 S;  1YUB A;  1NV9 A;  1NHG C;  3A98 B;  3D8L A;  1HQY E;  2MH8 A;  3WHL A;  2EUC A;  1XWI A;  3FTC A;  2R0I A;  1VDD A;  4QNM A;  5E6J A;  4B08 A;  4LFA M;  4GC5 A;  3GPY A;  1J5E M;  3U6L A;  4B7H A;  1OIP A;  3VDU A;  4IBC A;  4MGK E;  1Q39 A;  4DV0 M;  3CGW A;  1WJ7 A;  1ZAE A;  1NNU C;  3W0F A;  3VK7 A;  1N77 A;  1Z5B A;  1V92 A;  1GL7 A;  1HT2 E;  2MRO B;  2N35 A;  3U6O A;  1W5S A;  2DAK A;  2DWZ B;  3VK8 A;  1MN3 A;  3A46 A;  1PJQ A;  3GLG B;  4HL4 A;  3KOY E;  3I01 M;  1NO1 A;  1TGU A;  2R65 A;  1D0K A;  3BBZ A;  4I5S A;  3TWL A;  5KO3 A;  4JN6 A;  3B74 A;  4LF8 M;  2XGN A;  3C3D A;  1VQ1 A;  3L2A A;  2BJW A;  2OPF A;  4AQY M;  3LW5 F;  5ITU A;  2LVO C;  2DVW B;  4D82 A;  2DAM A;  3L27 A;  3UMM A;  3GLF A;  3TL4 X;  1L1T A;  2M60 A;  3WHK A;  3SFZ A;  1BVS A;  1NHW C;  3HHZ A;  1OAO C;  2EKK A;  3I51 A;  3Q8G A;  2RGO A;  3GLG A;  3U6E A;  2G5G X;  3U60 B;  3SYK A;  2VQF M;  2JY5 A;  2KEB A;  2VDB B;  4IBI A;  1ZV1 A;  3FUV A;  3GLH B;  2DHY A;  3HU1 A;  1V34 A;  4LY6 A;  1E32 A;  3CF2 A;  5IWA M;  2C98 A;  1IFY A;  3DA1 A;  2B3T A;  1XMO M;  3PVS A;  1I94 M;  4GEW A;  2UUC M;  3A42 A;  4PDG A;  3J7A S;  4IBB A;  2D7G A;  1OFI A;  3DFZ A;  1QZM A;  2EO2 A;  2XEP A;  5DYI A;  2HL7 A;  3QYE A;  4GC9 A;  3RE8 A;  2ZTD A;  3U60 A;  3GLH A;  2L2D A;  3GLG E;  2XFT A;  1FNN A;  4AKI A;  1RU3 A;  2V6Z M;  2D7E A;  1NVM A;  1TR8 A;  3K8Z A;  3KS8 A;  3FYC A;  1OIZ A;  3SC3 A;  3AOE C;  4ANR A;  1IM2 A;  4XBO A;  2R46 A;  4QOS A;  4G3O A;  4DUY M;  1J09 A;  2DZN B;  3FUU A;  2UU9 M;  4I8O A;  2DZO B;  2ZTC A;  4R7G A;  4KLN A;  2OO9 A;  5FTN A;  3UJN A;  2CV1 A;  1OQY A;  1S3S A;  2RGH A;  3GLH E;  3QAU A;  2FH0 A;  2O01 F;  1GVN A;  3W68 A;  5H37 D;  1NNJ A;  2UUB M;  4DV4 M;  1D2N A;  1WHC A;  1QUT A;  2QBY B;  4FD2 A;  3FRH A;  4I81 A;  4LFC M;  3GO8 A;  3SMS A;  2C9C A;  2KDL A;  3U6S A;  2WSC F;  2CFO A;  4EIW A;  1XXH B;  1AUA A;  3KS4 A;  2JA2 A;  1HNZ M;  1Z5A A;  4RKU F;  1IQP A;  5EP1 A;  4D80 A;  1N75 A;  3AL0 C;  2CEA A;  3PXG A;  3T1H M;  4M0W A;  1TF0 B;  5L8R F;  1ZMW A;  3AOE A;  3NBI A;  2O5R A;  3LMM A;  2L7I A;  2Z8Y M;  4AW4 A;  3KFU G;  3ZC7 B;  1DV0 A;  1HT1 E;  4FWD A;  4BBA A;  4DV1 M;  3PFI A;  4JI6 M;  1N36 M;  1G59 A;  3HHW A;  2J5Y A;  1F4I A;  1XMQ M;  1T43 A;  5F3W A;  3R9X B;  5KQ8 A;  1NJF A;  3FD9 A;  3K9P A;  3HWS A;  3C9P A;  3MHV C;  5ITX E;  2C99 A;  3F92 A;  3JR5 A;  1DGG A;  3MK6 A;  2LNH C;  1C1K A;  1IBK M;  4OX9 M;  2J7O A;  4IIW A;  4DR6 M;  2JZ0 A;  3HY5 A;  3K92 A;  3TWK A;  1V33 A;  1Z5C A;  3T1Y M;  3V76 A;  1YLA A;  4OU7 A;  2LHG A;  2OOA A;  1IY1 A;  2JXN A;  2RRU A;  3FUW A;  4WP2 A;  3FUX A;  3LQR A;  1TDH A;  1JR3 D;  2K0B X;  2WSE F;  2ERC A;  1R4G A;  1EFU B;  1UM8 A;  2JY7 A;  2QQ8 A;  4TUW A;  2JNH A;  1X37 A;  1TH3 A;  2AHM A;  2LXE A;  3DOA A;  4AG5 A;  1G41 A;  2ZAO A;  1XXH E;  4GH9 A;  4JI1 M;  2Y20 A;  2GQF A;  2X49 A;  3Q8X A;  2D7H A;  1IN8 A;  4WW0 A;  4AG6 A;  4F2L A;  3GP1 A;  1IN6 A;  3BXW A;  2I7N A;  4NXM M;  1QAO A;  3ZCB B;  4LJ6 A;  3D8B A;  2CP8 A;  4DV3 M;  4QHS A;  2RKO A;  2KNZ A;  1AIP C;  2XF3 A;  5DNY A;  2DZL A;  3M0E A;  3SHF A;  3GLF B;  1GJS A;  3L26 A;  2JWS A;  3B7N A;  4PCZ A;  3SAS A;  4NSO B;  2F4V M;  1PGY A;  3U6C A;  2HCB A;  5KPR A;  1VDL A;  2E5L M;  4MGY E;  2EKF A;  2DWM A;  3VKG A;  3IEC A;  3LVV A;  2X4A A;  2KA6 B;  4FCT A;  4GRI A;  4HLQ A;  4X64 M;  4KHP M;  2XSZ A;  3RFW A;  2KW0 A;  2XH9 A;  1WGL A;  3SAW A;  1D0L A;  1ORY B;  1N33 M;  4XGI A;  1IN5 A;  1OKS A;  1Z6T A;  2R4J A;  4DBG B;  5EP4 A;  4X66 M;  4G6Z A;  3FKE A;  1DO0 A;  2WZJ A;  2DNA A;  2QNJ A;  2DAG A;  2KNV A;  4FWH A;  2LVA A;  4FVM A;  1JR3 A;  4LJ5 A;  2VII A;  3K1J A;  3HZJ A;  3KP1 E;  4REZ A;  5FTK A;  2QHO B;  3T38 A;  4A3V B;  3GPU A;  1GO5 A;  3GLI A;  1HNX M;  2BWB A;  5ITQ A;  1KFV A;  3IG5 A;  3J2P B;  4NL4 H;  3MMP A;  2CRU A;  2DAE A;  4LF7 M;  4R3D A;  2W82 A;  4GHA A;  4BB9 A;  1IY0 A;  2JY8 A;  4K0K M;  1A5T A;  3H4J A;  3QWL A;  2ZAN A;  1L2D A;  3JR4 A;  4CJ6 A;  2KZU A;  2ZAM A;  4MGH A;  2XLJ A;  3U6M A;  2JP7 A; 
#chains in the Genus database with same CATH homology
 4P16 A;  2FE8 A;  4DV7 M;  4IBE A;  4LF9 M;  1R6B X;  5EQT A;  1GL6 A;  4QHT A;  2F5N A;  1Q3B A;  3U61 A;  5KPT A;  3TPZ A;  4JI0 M;  3SMP A;  2KRK A;  2Y0T A;  3W0L B;  2XFS A;  4ITQ A;  3HKP A;  1XC8 A;  2C9O A;  4OW0 A;  3CF0 A;  3HU3 A;  4LGY A;  2C5R A;  4RF0 A;  3OTO M;  1E9R A;  1G8P A;  3R8F A;  2KXE A;  3GQ5 A;  3TE6 A;  1HQC A;  4AI6 A;  2FOI C;  4RF1 A;  4JI3 M;  5FTJ A;  4LZZ A;  1FJG M;  1HNW M;  3HHX A;  4IBK A;  4B7G A;  4KOD A;  4NSR A;  2F5O A;  1XNQ M;  1YSY A;  2Y0Q A;  4M9X A;  3HU2 A;  5ITY A;  4LF5 M;  4YHH M;  2CV2 A;  4IJE A;  3LQQ A;  3FTD A;  3B9P A;  4LRT A;  5DYG A;  4CHT B;  4JI5 M;  3HHY A;  4IBD A;  1XHB A;  4Z6Y A;  5C18 A;  2CV0 A;  2UXD M;  1NJG A;  2V1C A;  4LJ9 A;  1QQW A;  4JYA M;  2G8L A;  4RNA A;  5EXP A;  1QAM A;  3EIE A;  3KP0 E;  1XNR M;  2QEN A;  4IBG A;  5JI3 E;  1DGB A;  4IBJ A;  1QAN A;  4DR3 M;  3KOZ E;  1PJI A;  4GKJ M;  5KQD A;  1WXQ A;  1HR0 M;  4FWG A;  1K82 A;  4LG2 A;  2DWN A;  1LV7 A;  4G4Q A;  4G4N A;  2VQE M;  2H1R A;  1G3I A;  3J7B A;  2XSZ D;  4NRV A;  5EP2 A;  1N34 M;  1QVR A;  4WUR A;  4DUZ M;  3FUT A;  4DR1 M;  1L2C A;  1YE9 A;  4G4R A;  4QNR A;  5IRE B;  3PNV A;  1W5T A;  1EE8 A;  2CHG A;  1SXJ D;  4GKK M;  3U6Q A;  2KRU A;  1K3W A;  3KDS E;  3GPP A;  4LFB M;  2YNM D;  2FFJ A;  1L1Z A;  2L6O A;  2R4E A;  2UXC M;  1I4W A;  3RGS A;  2XZF A;  3KVW A;  2QP9 X;  4M9S A;  4DR7 M;  1SXJ C;  2LH0 A;  2HHH M;  4LCB A;  2L09 A;  5FTM A;  1DO2 A;  1OJL A;  2LWX A;  2C96 A;  5C1B A;  2L7H A;  1IBL M;  5EXX A;  1L2B A;  2Z3X A;  4B3R M;  4I4L A;  3A45 A;  4D81 A;  1IY2 A;  3HJS A;  5EJC A;  3J80 S;  2V1U A;  3SAU A;  4L78 A;  4IBF A;  2YR0 A;  1GLN A;  3ILK A;  3RGP A;  3VDP A;  1R2Z A;  1IXR C;  3TQS A;  4X62 M;  4MGI E;  2J7N A;  2F5S A;  2HKJ A;  1SXJ B;  1Z59 A;  2OQ4 A;  3GLI B;  1N78 A;  2CHV A;  2F5P A;  4FCV A;  2Z7J A;  1PM5 A;  4GIP A;  4LF6 M;  4JXJ A;  3AJI B;  3KSX A;  1NY6 A;  5FTL A;  1R7R A;  4JI7 M;  4B3S M;  2ZM6 M;  3VKH A;  4W5W A;  4FCW A;  3J81 S;  3M7G A;  4MM3 B;  1SXJ A;  3NWL A;  3L28 A;  4JI8 M;  5GKN A;  4DR2 M;  1TH4 A;  3SBJ A;  2DHR A;  2DXI A;  4NXN M;  5JI2 E;  1T3T A;  2X8A A;  3AKZ A;  4M0D A;  4PD2 A;  5EXT A;  3U61 B;  3BOS A;  1N32 M;  5BPV A;  1NSF A;  2F5Q A;  4S12 A;  4B3T M;  4YY3 M;  4LJA A;  4NRW A;  5E26 A;  2Z4R A;  3AOG A;  3VFD A;  1Q3C A;  4LJ4 A;  3U5Z B;  3CF6 E;  5FSW A;  4PDI A;  4QOZ C;  4LJ7 A;  3SAV A;  5BR8 M;  2I7P A;  1KSF X;  5LMN M;  3U6P A;  4LF4 M;  4OVZ B;  3E4R A;  4GMQ A;  1E9S A;  3AFH A;  1SXJ E;  7CAT A;  1DGH B;  3KSJ A;  4DR5 M;  4LRS A;  4KO8 A;  2R62 A;  3KXE C;  1H6U A;  4BLC A;  4PT5 A;  3SAT A;  1IXS B;  4X65 M;  3MJ5 A;  2XZU A;  3U5Z A;  1IBM M;  3CTW B;  5ITR A;  4MGZ E;  3GQ4 A;  8CAT A;  1TDZ A;  4OVZ A;  3L29 A;  3LVW A;  2QPA A;  1DGH A;  5EP3 A;  3L25 A;  2QCU A;  1J7K A;  3KOW E;  4Z8X A;  3E9S A;  3GRR A;  1DGF A;  3FTE A;  5LMU M;  1IN4 A;  4DV5 M;  1QYR A;  2QZ4 A;  1OFH A;  2EA0 A;  1QAQ A;  3J27 B;  5IZ7 D;  2YQZ A;  2UUA M;  3DZD A;  4FW9 A;  1MU5 A;  1MX0 A;  2K47 A;  3U6D A;  3JAM S;  3VLF B;  2P5T A;  3THG A;  4L4U A;  2M5Z A;  1G4A E;  4AKH A;  1E94 E;  2KZS A;  3HGI A;  3TWM A;  4GIT A;  2DWL A;  2Q2E B;  3GRU A;  3HJQ A;  4LZJ A;  2UXB M;  3M6A A;  3PNY A;  2YFQ A;  5KPZ A;  2Z4S A;  3FTF A;  2BJV A;  3KOX E;  1ZQ9 A;  3FYD A;  3AV0 A;  3IG8 A;  3SHG B;  3HJ8 A;  5ITX A;  4LGM A;  1K3X A;  1NY5 A;  2R18 A;  1R2Y A;  3ZH9 B;  4JV5 M;  3C58 A;  4GHL A;  3KW6 A;  1JQJ C;  3I4Y A;  4II7 A;  4B7F A;  2BNK A;  4MB7 A;  5EXS A;  2CHQ A;  4L15 A;  5ITT A;  4LJ8 A;  3GQ3 A;  1L8Q A;  1TH2 A;  3EIH A;  3H4M A;  5FLX S;  2QBY A;  3SYL A;  4JI2 M;  4CGY B;  3GRV A;  4MH0 E;  4ZPX A;  3I4V A;  4G4O A;  4JI4 M;  4AZF A;  1GKI A;  3K2L A;  1XXH A;  4IJF A;  4DV6 M;  4B3M M;  3T15 A;  2A5Y B;  2ZBK B;  4L8R C;  4DV2 M;  1IN7 A;  2CUZ A;  4L16 A;  1PJJ A;  3SAR A;  4CIS A;  1KYI A;  3GRY A;  2Y21 A;  3UZU A;  2R45 A;  1IXZ A;  3GPX A;  2FNA A;  3UK6 A;  5A2Q S;  2NQ8 C;  2CE7 A;  4NOO B;  3UGJ A;  4DR4 M;  4AKG A;  4M9Z A;  5IT9 S;  1YUB A;  1NHG C;  3A98 B;  3D8L A;  1HQY E;  3WHL A;  2EUC A;  1XWI A;  3FTC A;  1VDD A;  4QNM A;  5E6J A;  4B08 A;  4LFA M;  4GC5 A;  3GPY A;  1J5E M;  3U6L A;  4B7H A;  3VDU A;  4IBC A;  4MGK E;  1Q39 A;  4DV0 M;  1ZAE A;  1NNU C;  3W0F A;  3VK7 A;  1N77 A;  1Z5B A;  1GL7 A;  1HT2 E;  3U6O A;  1W5S A;  2DWZ B;  3VK8 A;  3A46 A;  3GLG B;  4HL4 A;  3KOY E;  1TGU A;  2R65 A;  4I5S A;  3TWL A;  5KO3 A;  4JN6 A;  4LF8 M;  2XGN A;  3L2A A;  2BJW A;  2OPF A;  4AQY M;  5ITU A;  2DVW B;  4D82 A;  3L27 A;  3UMM A;  3GLF A;  3TL4 X;  1L1T A;  2M60 A;  3WHK A;  3SFZ A;  1NHW C;  3HHZ A;  3U6E A;  3I51 A;  3GLG A;  2RGO A;  2G5G X;  3U60 B;  3SYK A;  2VQF M;  2KEB A;  4IBI A;  3FUV A;  3GLH B;  3HU1 A;  4LY6 A;  1E32 A;  3CF2 A;  5IWA M;  2C98 A;  3DA1 A;  1XMO M;  1I94 M;  3PVS A;  2UUC M;  3A42 A;  4PDG A;  3J7A S;  4IBB A;  2D7G A;  1OFI A;  3DFZ A;  1QZM A;  2EO2 A;  2XEP A;  5DYI A;  2HL7 A;  4GC9 A;  3RE8 A;  3U60 A;  3GLH A;  2XFT A;  1FNN A;  4AKI A;  2V6Z M;  2D7E A;  1NVM A;  3KS8 A;  3K8Z A;  3FYC A;  3SC3 A;  3AOE C;  1IM2 A;  4XBO A;  2R46 A;  4QOS A;  4DUY M;  1J09 A;  2DZN B;  3FUU A;  2UU9 M;  4I8O A;  2DZO B;  4R7G A;  4KLN A;  5FTN A;  3UJN A;  2CV1 A;  1S3S A;  2RGH A;  1NNJ A;  3QAU A;  5H37 D;  2UUB M;  1GVN A;  4DV4 M;  1D2N A;  2QBY B;  4FD2 A;  4I81 A;  4LFC M;  3GO8 A;  3SMS A;  2C9C A;  3U6S A;  2CFO A;  4EIW A;  1XXH B;  3KS4 A;  2JA2 A;  1HNZ M;  1Z5A A;  1IQP A;  5EP1 A;  4D80 A;  1N75 A;  3AL0 C;  2CEA A;  3PXG A;  3T1H M;  4M0W A;  3AOE A;  3NBI A;  2O5R A;  3LMM A;  2L7I A;  4AW4 A;  3KFU G;  3ZC7 B;  1HT1 E;  4FWD A;  4BBA A;  4DV1 M;  3PFI A;  1N36 M;  1G59 A;  3HHW A;  1XMQ M;  5F3W A;  3R9X B;  5KQ8 A;  1NJF A;  3FD9 A;  3HWS A;  3MHV C;  5ITX E;  2C99 A;  3JR5 A;  1DGG A;  3MK6 A;  2LNH C;  1C1K A;  1IBK M;  4OX9 M;  2J7O A;  4IIW A;  4DR6 M;  3K92 A;  3TWK A;  1Z5C A;  3T1Y M;  4OU7 A;  3FUW A;  1IY1 A;  3FUX A;  3LQR A;  1TDH A;  1JR3 D;  2ERC A;  1UM8 A;  4TUW A;  2LXE A;  1X37 A;  1TH3 A;  2AHM A;  3DOA A;  4AG5 A;  1G41 A;  2ZAO A;  4GH9 A;  4JI1 M;  2Y20 A;  2X49 A;  3Q8X A;  2D7H A;  1IN8 A;  4WW0 A;  4AG6 A;  3GP1 A;  1IN6 A;  2I7N A;  4NXM M;  1QAO A;  3ZCB B;  4LJ6 A;  3D8B A;  4DV3 M;  4QHS A;  2RKO A;  2XF3 A;  5DNY A;  3M0E A;  3SHF A;  3GLF B;  3L26 A;  4PCZ A;  3SAS A;  4NSO B;  2F4V M;  3U6C A;  2HCB A;  5KPR A;  2E5L M;  4MGY E;  2DWM A;  3VKG A;  3LVV A;  2X4A A;  2KA6 B;  4FCT A;  4GRI A;  4HLQ A;  4X64 M;  4KHP M;  2XSZ A;  3RFW A;  2KW0 A;  2XH9 A;  3SAW A;  1ORY B;  1N33 M;  4XGI A;  1IN5 A;  1Z6T A;  2R4J A;  5EP4 A;  4X66 M;  4G6Z A;  3FKE A;  1DO0 A;  4FWH A;  4FVM A;  1JR3 A;  4LJ5 A;  2VII A;  3K1J A;  3KP1 E;  4REZ A;  5FTK A;  3T38 A;  4A3V B;  3GPU A;  4JI6 M;  3GLI A;  1HNX M;  5ITQ A;  1KFV A;  3IG5 A;  3J2P B;  4NL4 H;  4LF7 M;  4R3D A;  2W82 A;  4GHA A;  4BB9 A;  1IY0 A;  4K0K M;  3QWL A;  2ZAN A;  1L2D A;  3JR4 A;  2KZU A;  2ZAM A;  4MGH A;  2XLJ A;  3U6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...