2UUBM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uubM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uubM02
4X62M 3A46A 3U6DA 3VK7A 1K3WA 1TDHA 1FJGM 2HKJA 3DOAA 3J81S 4LF4M 4MB7A 2OQ4A 1R2YA 4JI4M 3SAVA 4LF5M 1L2CA 4G4QA 3JAMS 3U6OA 1NNJA 1N32M 1IBMM 5ITYA 2ZBKB 1HR0M 4NXMM 3T1YM 1Z5BA 2F5OA 2UU9M 3U6CA 2UXDM 1HNZM 3TWKA 4B3SM 4NRWA 3JR4A 4DR2M 3SAWA 4G4RA 2UUAM 1XNQM 2EA0A 3GQ4A 3GPUA 4GKKM 4PDGA 3TWMA 3GPPA 4NXNM 1EE8A 4DV5M 4CISA 5LMNM 4PD2A 5LMUM 4DV6M 1XMQM 1HNXM 1Q3CA 3GQ3A 4LF9M 3U6EA 4JV5M 5ITRA 1L2DA 1I94M 4JI1M 2F5NA 4AQYM 2F4VM 2UUCM 2VQFM 3T1HM 4B3TM 4X65M 4PDIA 4DV0M 4DV1M 1K3XA 2UXBM 3OTOM 2HHHM 2F5PA 4JI8M 1L2BA 5FLXS 4DV4M 1L1TA 4DUZM 4YHHM 3VK8A 1HNWM 1XC8A 2F5QA 4LFCM 4YY3M 4OX9M 4KHPM 5ITTA 4ITQA 4B3RM 4DR4M 4JI3M 1MU5A 4JYAM 4JI0M 1L1ZA 4DR1M 2UUBM 4K0KM 5IT9S 1MX0A 2Q2EB 5BR8M 4JI6M 4DR6M 4JI7M 4DUYM 1N33M 1IBKM 4DR5M 4JI5M 1XMOM 1PJIA 4LF7M 1R2ZA 1IBLM 1Z5AA 3A45A 4DV2M 3SASA 4G4NA 4DR7M 1Z5CA 4LF6M 3U6LA 5ITXA 4NRVA 4G4OA 3TWLA 4X66M 1J5EM 2E5LM 1Q3BA 3GP1A 3C58A 4LF8M 4DV7M 3GPXA 3GQ5A 3U6QA 1KFVA 3J7AS 3SATA 4GKJM 4LFBM 4DV3M 4X64M 3SBJA 1Z59A 1N36M 2F5SA 3JR5A 5IWAM 3J80S 4LFAM 3SARA 1XNRM 1PM5A 3U6PA 2VQEM 1K82A 3A42A 3U6MA 2XZFA 5A2QS 5ITUA 3SAUA 4DR3M 5ITXE 1N34M 4JI2M 2ZM6M 3U6SA 2UXCM 3W0FA 4PCZA 5ITQA 1TDZA 4B3MM 3GPYA 1Q39A 2OPFA 1PJJA 3GO8A 2XZUA
chains in the Genus database with same CATH superfamily
3A46A 2CUZA 1TDHA 2HCBA 4B7HA 1QQWA 2DENA 3J81S 1WGNA 4MB7A 1R2YA 3J2PB 2X8AA 4MGIE 1L2CA 1NV9A 1IN4A 2LVOC 4JN6A 5EP2A 1DGFA 1ZMVA 3KSXA 5EXSA 5ITYA 1IBMM 4MGHA 1HR0M 4NXMM 1HJPA 1QAOA 2JY8A 3E21A 3FRHA 3HJSA 2CV2A 3U6CA 2F5OA 1GJTA 4B3SM 2FNAA 4LRSA 3DFZA 2I7NA 4MM3B 1SXJA 1WXQA 4NRWA 2CHVA 3SAWA 4G4RA 2CHGA 3RE8A 2CRUA 2DZOB 3QYBA 3HZJA 2EA0A 5EP4A 3KS8A 4GKKM 3TWMA 4DV5M 1EE8A 4CISA 1GABA 3MK6A 1E94E 4IBGA 1TH3A 2DXIA 4HEOA 2O01F 4CHTB 2A5YB 2QPAA 4GC9A 3J7BA 3WHLA 5FTLA 1Q3CA 3GQ3A 4LF9M 3D8LA 4NSOB 1I94M 4B7GA 1G8PA 3NBIA 4MGYE 4BB9A 4AQYM 4TUWA 2F4VM 3T1HM 1QDRA 1AUAA 1D0KA 2AHMA 4DV1M 3KDSE 1IY2A 2VF8A 2X49A 2HHHM 1OFHA 2R6FA 3HHYA 3U5ZA 4PT5A 2JXNA 1L2BA 3CF6E 5FTJA 4P16A 5FLXS 2JY7A 4YHHM 4QHSA 5JI3E 1VDLA 2MJ5B 2V6ZM 2LVPC 4YY3M 4KHPM 4GEWA 4IBIA 5DYGA 3FTEA 3KFUG 3FTDA 3T15A 2XEPA 5DYIA 4W5WA 1QDTA 3SHGB 4LRTA 4JI0M 4K0KM 3I04M 3EIEA 4DR1M 3CF2A 3GLGA 1OQYA 3VLFB 5GKNA 3K9OA 3NWLA 5EP1A 3M6AA 1PJIA 4QHTA 5EQTA 1R2ZA 1IXSA 2R45A 4DV2M 3VKHA 1DGHB 1JQJC 2BNKA 4M0DA 2QQ8A 4RF0A 2LVQD 4LZJA 5ITXA 1NHGC 2BWBA 3K2LA 4G6ZA 2WSCF 4GH9A 1OTRA 1W5TA 4DV7M 1DO2A 2C9CA 3U61A 1DGGA 3J27B 1KFVA 2JP7A 2Z3XA 3M0EA 2MGWA 3F92A 3D8BA 1R6BX 4IBJA 3FTCA 1N36M 2F5SA 3JR5A 3HU3A 5IWAM 3KVWA 3IG5A 3J80S 3AOGA 3GLHB 4OVZB 3U6PA 3LVWA 3FD9A 1K82A 5C18A 1VG5A 3GLIE 3SAUA 4IIWA 1G3IA 3KOXE 3KOWE 2R44A 3UGJA 4AI6A 4OU7A 1N34M 3FRIA 4LJ5A 3R8FA 2Y0TA 2ZM6M 4S12A 3KOZE 2XGNA 2R4JA 3IHPA 1V34A 1Q39A 2KZSA 3L25A 5KO3A 3EIHA 2VDBB 4LJ9A 3HHZA 4NC6A 3U6DA 2RGHA 4L15A 5EP3A 1K3WA 1IM2A 1P3QQ 1A5TA 1QZEA 2HKJA 2J7NA 4AKHA 1TF0B 1UFZA 2DWZB 3U60B 3SAVA 2EKFA 1RU3A 3IG8A 2P5TA 4G4QA 4LJAA 3T1YM 1Z5BA 2UU9M 2FFJA 3SYKA 3W0LB 2C98A 2R4EA 2J5YA 3TWKA 2XF3A 3CF0A 4IBFA 2ERCA 2NQ8C 4DR2M 1GKIA 2KRUA 4NSRA 3L27A 4LJ4A 3HKPA 3LW5F 4LZZA 2DHYA 3SMSA 3QAUA 2KXEA 3VFDA 2D7EA 1N77A 4Z8XA 2L7IA 4NXNM 2FE8A 4GC5A 2JZ1A 2ZANA 4I81A 4PD2A 2KDLA 4DV6M 1XMQM 1HNXM 5C1BA 2QBYB 3LMMA 5FTMA 1XXHE 3U6EA 4GHLA 5ITRA 3UK6A 4JI1M 3UJNA 4L78A 1N75A 2KNZA 2WZJA 3B74A 2CEAA 3MJ5A 3L2AA 1TH2A 2Z7JA 4DBGB 2VQFM 4X65M 2R0IA 1K3XA 3H4MA 1GO5A 1T6OA 2KNAA 3KP0E 1FNNA 2I7PA 5KPTA 3PNYA 3E9SA 1PJTA 4B7FA 4DV4M 4FD2A 2KEBA 2B3TA 1IQPA 4KODA 2KNVA 3MMPA 2Y20A 1L1TA 2UXDM 3K92A 1DGHA 3K8ZA 5FTNA 4D80A 2EKKA 3K9PA 3V76A 5ITTA 2EO2A 2RRUA 4DR4M 4LY6A 4JI3M 1QANA 1MU5A 1GVNA 3KXEC 1GJSA 3L29A 2UUBM 1L1ZA 4FVMA 2L4FA 1MX0A 1UM8A 4B08A 2Q2EB 2EUCA 2CV1A 4JI7M 1N33M 4GIPA 1CUKA 1GL6A 1WGLA 3B7NA 3FUXA 3KW6A 4JI5M 4AKIA 3FKEA 3AKZA 4G4NA 3SASA 1OAIA 3FUTA 3GLFB 2H5XA 3GLIA 4NRVA 5IZ7D 4KT0F 3TWLA 1TH4A 4LGYA 1HQYE 1IY0A 2DHRA 2RKOA 4QOSA 1J5EM 2DWLA 4QNMA 7CATA 1Q3BA 3QYEA 4L6V6 3GP1A 1XHBA 2LVNC 4LGMA 3GLFE 1NVMA 3SHFA 2M5ZA 2V1UA 1IN7A 1QYRA 2JY6B 3E46A 1GL7A 1NHWC 4M9SA 1OFIA 2OO9A 1R5LA 2YNMD 4LFBM 2X4AA 4UN2B 2DNAA 3GRYA 4IBCA 1T3TA 2JUJA 1PGYA 1VEGA 1PRBA 4L16A 2DZNB 4LFAM 2O5RA 2L7HA 1OIPA 1ZMUA 3HWSA 2VQEM 3A42A 4RNAA 1EIJA 1V33A 5A2QS 3E4RA 3IECA 1NSFA 3QWLA 2G8LA 4QNRA 4R7GA 1ZAEA 2DAIA 2JZ0A 2C5RA 3RGSA 2UXCM 4PCZA 1TDZA 2KA6B 2QNJA 2L4EA 4AW4A 4D82A 2XFSA 4GKJM 4IBBA 1GLNA 2XZUA 3GRUA 2EJSA 1J09A 2QCUA 1V92A 3DOAA 4HL4A 4I8OA 1XXHA 1SXJB 2W82A 2OQ4A 1R4GA 4JI4M 4DR6M 4FWHA 2MH8A 3THGA 2DWNA 3JAMS 1N32M 1WIVA 1YUBA 2ZTCA 2ZBKB 4KO8A 4BBAA 4R3DA 1QUTA 2QBYA 3FUUA 3B89A 1HNZM 4IBDA 4IBKA 3RGPA 2LBCA 2DKLA 1IN6A 4CIZA 1OAOC 1TR8A 1XNQM 2UUAM 4XBOA 3GLHE 3AFHA 3MHVC 1QAMA 3GQ4A 3GPUA 3GPPA 4NOOB 3PXGA 5LMUM 4FCWA 1E9SA 3TPZA 2G5GX 3WHKA 4WP2A 3U5ZB 2CWBA 2R62A 2F5NA 2JNHA 2VF7A 2LNHC 2Z8YM 2UUCM 2L2DA 5L8RF 1JR3D 4B3TM 4XGIA 3B9PA 3DA1A 4PDIA 4DV0M 1S3SA 2DAMA 3UMMA 2HWJA 3R9XB 2LWXA 1JR3E 1E32A 3FTFA 4JI8M 2DAGA 5BPVA 1HNWM 3SMPA 3TQSA 5EXPA 3VK8A 1XC8A 2F5QA 3AV0A 4RF1A 1W5SA 2K0BX 3GLFA 5IREB 1R7RA 1IXSB 4FWGA 3FUWA 4Q7JA 5H37D 3LVVA 5FSWA 1F4IA 5EXTA 2QSFX 1H6UA 5IT9S 1G59A 2QENA 4JI6M 3KS4A 2GQFA 4NL4H 4FCTA 1XWIA 3BBZA 3ZH9B 4DR5M 2Z4RA 1XMOM 1LV7A 4LF7M 1IBLM 2FS1A 1Z5AA 2JY5A 3U61B 4DR7M 1PJSA 1Z5CA 1ZQ9A 4IJEA 3U6LA 4ZPXA 2Y21A 1IFYA 4AZFA 3M7GA 2MR9A 4MGZE 2QHOB 5EXXA 3DZDA 2DAKA 3AOEA 3Q8XA 2D7GA 4HLQA 5KPZA 3I01M 5E6JA 3SC3A 1NO1A 3HHWA 2CV0A 1VEJA 2LXEA 3BOSA 4I5SA 3J7AS 4A3VB 2ZTDA 2L09A 2J7OA 2OOBA 3HHXA 4GITA 1QZMA 1KSFX 3I51A 2DZLA 1IN5A 2CP8A 5KPRA 3SARA 1WR1B 3ILKA 3VKGA 4LJ7A 3KSJA 4Z6YA 2XZFA 4FCVA 1ORYB 4LJ6A 1JB0F 4DR3M 3HU2A 3FYCA 1X37A 1D0MA 1HQCA 2ZAMA 3W0FA 3GLHA 4XK8F 4OVZA 1IXRC 2XFTA 1VDDA 2OPFA 2N35A 1Q02A 3GO8A 4G4OA 1NJGA 4X62M 4LCBA 4AG6A 3FE3A 4MGKE 3VK7A 3B7ZA 4GHAA 4L8RC 1ZMWA 2CE7A 3RFWA 4CJ6A 2R65A 1FJGM 4QOZC 3GRVA 3CGWA 4REZA 3KOYE 1VQ1A 4P17A 4LF4M 4AKGA 2FH0A 2BJWA 3L26A 3HU1A 1NJFA 2DVWB 4LF5M 3I4YA 5DFLA 3ZC7B 4CGYB 3U6OA 1NNJA 2LHGA 1MJGM 2BWEA 2YR0A 5EJCA 3SFZA 2K6BA 2RGOA 1N78A 1WJ7A 3LQQA 3B7QA 4GRIA 4F1IA 3JR4A 1YSYA 2KHHA 1JR3A 1NY6A 2CHQA 3U60A 4FWDA 2L6OA 3AJIB 4IBEA 4F2LA 4PDGA 4Y28F 3VDPA 1DV0A 3C9PA 3GRRA 4AG5A 2XSZA 5LMNM 3HJ8A 1NNUC 5F3WA 3LCUA 2R46A 1XB2B 3ZQJA 3ZCBB 4JV5M 1L2DA 2XH9A 3HGIA 1PJQA 2DI0A 1Y8GA 2MROB 2QZ4A 4FW9A 1SXJD 4EIWA 3HJQA 3T38A 1OKSA 2KZUA 4M9XA 1G41A 1BVSA 1LTMA 2UXBM 1QAQA 1I4WA 3OTOM 4RKUF 3KP1E 3SYLA 2F5PA 1SXJE 2LVAA 1OIZA 2CFOA 3T6PA 1NV8A 1IN8A 2YFQA 4ANRA 4DUZM 2QP9X 2DWMA 1DO0A 3H4JA 4LFCM 3NBXX 1ZV1A 3PVSA 1VEKA 3VDUA 2KRKA 4OX9M 3W67A 3A98B 4ITQA 4B3RM 1G71A 4JYAM 1TTEA 2LTUA 1MN3A 2WSFF 4BLCA 3GLIB 1G4AE 2HAKA 2FOIC 5FTKA 1AIPC 3PNVA 1C7YA 5BR8M 1E9RA 5JI2E 4JXJA 1QUSA 3HY5A 3AL0C 1IY1A 2K47A 3AOEC 2V1CA 3HX3A 4DUYM 1IBKM 2LH0A 4IJFA 1J7KA 8CATA 3A45A 4OW0A 4LG2A 4L4UA 5KQDA 1YE9A 2JA2A 4D81A 2WSEF 4LF6M 1DGBA 1QVRA 2VIIA 3LQRA 4WURA 2APLA 3TL4X 3Q8GA 3PFIA 5DNYA 2O25A 1SG9A 4X66M 1D2NA 3TE6A 2KW0A 2LHCA 2E5LM 2XSZD 4M9ZA 2D7HA 4M0WA 3C58A 4LF8M 1EFUB 2YQZA 3FYDA 3GLGB 1L8QA 4II7A 1Z6TA 2H1RA 4MH0E 3CTWB 2Z4SA 1NY5A 3GPXA 3FUVA 3GQ5A 1HT2E 3U6QA 4R71A 4I4LA 1YLAA 3SATA 2R18A 1SXJC 2JWSA 3C3EA 5KQ8A 4X64M 2OOAA 4DV3M 3W68A 1TGUA 3BXWA 3SBJA 1Z59A 4LJ8A 2GNOA 2K9DA 3GLGE 3C3DA 2C96A 1XNRM 1PM5A 4KLNA 3L28A 2HL7A 4GMQA 1OJLA 3UZUA 2ZAOA 3U6MA 5E26A 2C99A 3LCVB 4G3OA 5ITUA 2C9OA 3K1JA 5ITXE 1T43A 2XLJA 1HT1E 1IXZA 2Y0QA 3I4VA 4JI2M 2G3QA 1XXHB 2BJVA 2M60A 3U6SA 5ITQA 1WHCA 3GPYA 4B3MM 2DAEA 1PJJA 1C1KA 4WW0A 1KYIA 1D0LA
chains in the Genus database with same CATH topology
3A46A 2CUZA 1TDHA 2HCBA 4B7HA 1QQWA 3J81S 4MB7A 1R2YA 3J2PB 2X8AA 4MGIE 1L2CA 1IN4A 5EP2A 4JN6A 1DGFA 3KSXA 1IBMM 5EXSA 5ITYA 4MGHA 1HR0M 4NXMM 1QAOA 3HJSA 2F5OA 2CV2A 3U6CA 4B3SM 2FNAA 4LRSA 3DFZA 2I7NA 4MM3B 1SXJA 1WXQA 4NRWA 2CHVA 3SAWA 4G4RA 2CHGA 3RE8A 2DZOB 2EA0A 3KS8A 5EP4A 4GKKM 3TWMA 4DV5M 1EE8A 4CISA 3MK6A 1E94E 4IBGA 1TH3A 2DXIA 4CHTB 2A5YB 2QPAA 4GC9A 3J7BA 3WHLA 5FTLA 1Q3CA 3GQ3A 4LF9M 3D8LA 4NSOB 1I94M 4B7GA 1G8PA 3NBIA 4MGYE 4BB9A 4AQYM 4TUWA 2F4VM 3T1HM 2AHMA 4DV1M 3KDSE 1IY2A 2X49A 2HHHM 1OFHA 3HHYA 3U5ZA 4PT5A 1L2BA 3CF6E 5FTJA 4P16A 5FLXS 4YHHM 4QHSA 5JI3E 2V6ZM 4YY3M 4KHPM 4IBIA 3FTEA 5DYGA 3KFUG 3FTDA 3T15A 2XEPA 5DYIA 4W5WA 3SHGB 4LRTA 4JI0M 4K0KM 4DR1M 3EIEA 3CF2A 3GLGA 3VLFB 5GKNA 3NWLA 5EP1A 3M6AA 1PJIA 4QHTA 5EQTA 1R2ZA 2R45A 4DV2M 3VKHA 1DGHB 1JQJC 2BNKA 4M0DA 4RF0A 5ITXA 4LZJA 1NHGC 3K2LA 4G6ZA 4GH9A 1W5TA 4DV7M 1DO2A 2C9CA 3U61A 1DGGA 3J27B 1KFVA 2Z3XA 3M0EA 3D8BA 1R6BX 4IBJA 3FTCA 1N36M 2F5SA 3JR5A 3HU3A 5IWAM 3KVWA 3IG5A 3J80S 3AOGA 3GLHB 4OVZB 3U6PA 3LVWA 3FD9A 1K82A 5C18A 3SAUA 4IIWA 1G3IA 3KOXE 3KOWE 3UGJA 4AI6A 4OU7A 1N34M 4LJ5A 3R8FA 2Y0TA 2ZM6M 4S12A 3KOZE 2XGNA 2R4JA 1Q39A 2KZSA 3L25A 5KO3A 3EIHA 4LJ9A 3HHZA 3U6DA 2RGHA 4L15A 5EP3A 1K3WA 1IM2A 2HKJA 2J7NA 4AKHA 2DWZB 3U60B 3SAVA 3IG8A 2P5TA 4G4QA 4LJAA 3T1YM 1Z5BA 2UU9M 2FFJA 3SYKA 3W0LB 2C98A 2R4EA 3TWKA 2UXDM 2XF3A 3CF0A 4IBFA 2ERCA 2NQ8C 4DR2M 1GKIA 2KRUA 4NSRA 3L27A 4LJ4A 3HKPA 4LZZA 3SMSA 3QAUA 2KXEA 3VFDA 2D7EA 1N77A 4Z8XA 2L7IA 4NXNM 2FE8A 4GC5A 2ZANA 4I81A 4PD2A 4DV6M 1XMQM 1HNXM 5C1BA 2QBYB 3LMMA 5FTMA 4GHLA 3U6EA 5ITRA 3UK6A 4JI1M 3UJNA 4L78A 1N75A 2CEAA 3MJ5A 3L2AA 1TH2A 2Z7JA 2VQFM 4X65M 1K3XA 3H4MA 3KP0E 1FNNA 2I7PA 5KPTA 3PNYA 3E9SA 4B7FA 4DV4M 4FD2A 2KEBA 1IQPA 4KODA 1L1TA 2Y20A 3K92A 1DGHA 3K8ZA 5FTNA 4D80A 5ITTA 2EO2A 4DR4M 4LY6A 4JI3M 1QANA 1MU5A 1GVNA 3KXEC 3L29A 2UUBM 1L1ZA 4FVMA 1MX0A 1UM8A 4B08A 2Q2EB 2EUCA 2CV1A 4JI7M 1N33M 4GIPA 1GL6A 3FUXA 3KW6A 4JI5M 4AKIA 3FKEA 3AKZA 4G4NA 3SASA 3FUTA 3GLFB 3GLIA 4NRVA 5IZ7D 3TWLA 1TH4A 4LGYA 1HQYE 1IY0A 2DHRA 2RKOA 4QOSA 1J5EM 2DWLA 4QNMA 7CATA 1Q3BA 3GP1A 1XHBA 4LGMA 1NVMA 3SHFA 2M5ZA 2V1UA 1IN7A 1QYRA 1GL7A 1NHWC 4M9SA 1OFIA 4LFBM 2YNMD 2X4AA 3GRYA 4IBCA 1T3TA 4L16A 2DZNB 4LFAM 2O5RA 2L7HA 3HWSA 2VQEM 3A42A 4RNAA 5A2QS 3E4RA 1NSFA 3QWLA 2G8LA 4QNRA 4R7GA 1ZAEA 2C5RA 3RGSA 2UXCM 4PCZA 1TDZA 2KA6B 4AW4A 4D82A 2XFSA 4GKJM 4IBBA 1GLNA 2XZUA 3GRUA 1J09A 2QCUA 3DOAA 4HL4A 4I8OA 1XXHA 1SXJB 2W82A 2OQ4A 4JI4M 4FWHA 3THGA 2DWNA 3JAMS 1N32M 1YUBA 2ZBKB 4KO8A 4BBAA 4R3DA 2QBYA 3FUUA 1HNZM 4IBDA 4IBKA 3RGPA 1IN6A 1XNQM 2UUAM 4XBOA 3AFHA 3MHVC 1QAMA 3GQ4A 3GPUA 3GPPA 4NOOB 3PXGA 5LMUM 4FCWA 1E9SA 3TPZA 2G5GX 3WHKA 3U5ZB 2R62A 2F5NA 2LNHC 2UUCM 1JR3D 4B3TM 4XGIA 3B9PA 3DA1A 4PDIA 4DV0M 1S3SA 3UMMA 3R9XB 2LWXA 1E32A 3FTFA 4JI8M 5BPVA 1HNWM 3SMPA 3TQSA 5EXPA 3VK8A 1XC8A 2F5QA 3AV0A 4RF1A 1W5SA 3GLFA 5IREB 1R7RA 1IXSB 4FWGA 3FUWA 5H37D 3LVVA 5FSWA 5EXTA 1H6UA 5IT9S 1G59A 2QENA 4JI6M 3KS4A 4NL4H 4FCTA 1XWIA 4DR5M 3ZH9B 2Z4RA 1XMOM 1LV7A 4LF7M 1IBLM 1Z5AA 3U61B 4DR7M 1Z5CA 1ZQ9A 4IJEA 3U6LA 4ZPXA 2Y21A 4AZFA 3M7GA 4MGZE 5EXXA 3DZDA 3AOEA 3Q8XA 2D7GA 4HLQA 5KPZA 5E6JA 3SC3A 3HHWA 2CV0A 2LXEA 3J7AS 3BOSA 4I5SA 4A3VB 2L09A 2J7OA 3HHXA 4GITA 1QZMA 1KSFX 3I51A 1IN5A 5KPRA 3SARA 3ILKA 3VKGA 4LJ7A 3KSJA 4Z6YA 2XZFA 4FCVA 1ORYB 4LJ6A 4DR3M 3HU2A 3FYCA 1X37A 1HQCA 2ZAMA 3W0FA 3GLHA 4OVZA 1IXRC 2XFTA 1VDDA 2OPFA 3GO8A 4G4OA 1NJGA 4X62M 4LCBA 4AG6A 4MGKE 3VK7A 4GHAA 4L8RC 2CE7A 3RFWA 1FJGM 2R65A 4QOZC 3GRVA 4REZA 4LF4M 3KOYE 4AKGA 3L26A 2BJWA 3HU1A 1NJFA 2DVWB 4LF5M 3I4YA 3U6OA 3ZC7B 4CGYB 1NNJA 5EJCA 2YR0A 3SFZA 2RGOA 1N78A 3LQQA 4GRIA 3JR4A 1YSYA 1JR3A 1NY6A 2CHQA 3U60A 4FWDA 2L6OA 3AJIB 4IBEA 4PDGA 3VDPA 3GRRA 4AG5A 2XSZA 5LMNM 3HJ8A 1NNUC 5F3WA 2R46A 3ZCBB 4JV5M 1L2DA 2XH9A 3HGIA 2QZ4A 4FW9A 1SXJD 4EIWA 3HJQA 3T38A 2KZUA 4M9XA 1G41A 2UXBM 1QAQA 1I4WA 3OTOM 3KP1E 3SYLA 2F5PA 1SXJE 2CFOA 1IN8A 2YFQA 4DUZM 2QP9X 2DWMA 1DO0A 4LFCM 3PVSA 3VDUA 2KRKA 4OX9M 3A98B 4ITQA 4B3RM 4JYAM 3GLIB 4BLCA 1G4AE 2FOIC 5FTKA 3PNVA 5BR8M 1E9RA 5JI2E 4JXJA 3AL0C 4DR6M 1IY1A 2K47A 3AOEC 2V1CA 4DUYM 1IBKM 2LH0A 4IJFA 1J7KA 8CATA 3A45A 4OW0A 4LG2A 4L4UA 5KQDA 1YE9A 2JA2A 4D81A 4LF6M 1DGBA 1QVRA 2VIIA 3LQRA 4WURA 3TL4X 3PFIA 5DNYA 4X66M 1D2NA 3TE6A 2KW0A 2E5LM 2XSZD 4M9ZA 2D7HA 4M0WA 3C58A 4LF8M 2YQZA 3FYDA 3GLGB 1L8QA 4II7A 1Z6TA 2H1RA 4MH0E 3CTWB 2Z4SA 1NY5A 3GPXA 3FUVA 3GQ5A 1HT2E 3U6QA 3SATA 4I4LA 2R18A 1SXJC 5KQ8A 4DV3M 4X64M 1TGUA 3SBJA 1Z59A 4LJ8A 2C96A 1XNRM 1PM5A 4KLNA 3L28A 2HL7A 4GMQA 1OJLA 3UZUA 2ZAOA 3U6MA 5E26A 2C99A 5ITUA 2C9OA 3K1JA 5ITXE 2XLJA 1HT1E 1IXZA 2Y0QA 3I4VA 4JI2M 1XXHB 2BJVA 2M60A 3U6SA 5ITQA 4B3MM 3GPYA 1PJJA 1C1KA 4WW0A 1KYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 M;  3A46 A;  3U6D A;  3VK7 A;  1K3W A;  1TDH A;  1FJG M;  2HKJ A;  3DOA A;  3J81 S;  4LF4 M;  4MB7 A;  2OQ4 A;  1R2Y A;  4JI4 M;  3SAV A;  4LF5 M;  1L2C A;  4G4Q A;  3JAM S;  3U6O A;  1NNJ A;  1N32 M;  1IBM M;  5ITY A;  2ZBK B;  1HR0 M;  4NXM M;  3T1Y M;  1Z5B A;  2F5O A;  2UU9 M;  3U6C A;  2UXD M;  1HNZ M;  3TWK A;  4B3S M;  4NRW A;  3JR4 A;  4DR2 M;  3SAW A;  4G4R A;  2UUA M;  1XNQ M;  2EA0 A;  3GQ4 A;  3GPU A;  4GKK M;  4PDG A;  3TWM A;  3GPP A;  4NXN M;  1EE8 A;  4DV5 M;  4CIS A;  5LMN M;  4PD2 A;  5LMU M;  4DV6 M;  1XMQ M;  1HNX M;  1Q3C A;  3GQ3 A;  4LF9 M;  3U6E A;  4JV5 M;  5ITR A;  1L2D A;  1I94 M;  4JI1 M;  2F5N A;  4AQY M;  2F4V M;  2UUC M;  2VQF M;  3T1H M;  4B3T M;  4X65 M;  4PDI A;  4DV0 M;  4DV1 M;  1K3X A;  2UXB M;  3OTO M;  2HHH M;  2F5P A;  4JI8 M;  1L2B A;  5FLX S;  4DV4 M;  1L1T A;  4DUZ M;  4YHH M;  3VK8 A;  1HNW M;  1XC8 A;  2F5Q A;  4LFC M;  4YY3 M;  4OX9 M;  4KHP M;  5ITT A;  4ITQ A;  4B3R M;  4DR4 M;  4JI3 M;  1MU5 A;  4JYA M;  4JI0 M;  1L1Z A;  4DR1 M;  2UUB M;  4K0K M;  5IT9 S;  1MX0 A;  2Q2E B;  5BR8 M;  4JI6 M;  4DR6 M;  4JI7 M;  4DUY M;  1N33 M;  1IBK M;  4DR5 M;  4JI5 M;  1XMO M;  1PJI A;  4LF7 M;  1R2Z A;  1IBL M;  1Z5A A;  3A45 A;  4DV2 M;  3SAS A;  4G4N A;  4DR7 M;  1Z5C A;  4LF6 M;  3U6L A;  5ITX A;  4NRV A;  4G4O A;  3TWL A;  4X66 M;  1J5E M;  2E5L M;  1Q3B A;  3GP1 A;  3C58 A;  4LF8 M;  4DV7 M;  3GPX A;  3GQ5 A;  3U6Q A;  1KFV A;  3J7A S;  3SAT A;  4GKJ M;  4LFB M;  4DV3 M;  4X64 M;  3SBJ A;  1Z59 A;  1N36 M;  2F5S A;  3JR5 A;  5IWA M;  3J80 S;  4LFA M;  3SAR A;  1XNR M;  1PM5 A;  3U6P A;  2VQE M;  1K82 A;  3A42 A;  3U6M A;  2XZF A;  5A2Q S;  5ITU A;  3SAU A;  4DR3 M;  5ITX E;  1N34 M;  4JI2 M;  2ZM6 M;  3U6S A;  2UXC M;  3W0F A;  4PCZ A;  5ITQ A;  1TDZ A;  4B3M M;  3GPY A;  1Q39 A;  2OPF A;  1PJJ A;  3GO8 A;  2XZU A; 
#chains in the Genus database with same CATH topology
 3A46 A;  2CUZ A;  1TDH A;  2HCB A;  4B7H A;  1QQW A;  2DEN A;  3J81 S;  1WGN A;  4MB7 A;  1R2Y A;  3J2P B;  2X8A A;  4MGI E;  1L2C A;  1NV9 A;  1IN4 A;  2LVO C;  4JN6 A;  5EP2 A;  1DGF A;  1ZMV A;  3KSX A;  5EXS A;  5ITY A;  1IBM M;  4MGH A;  1HR0 M;  4NXM M;  1HJP A;  1QAO A;  2JY8 A;  3E21 A;  3FRH A;  3HJS A;  2CV2 A;  3U6C A;  2F5O A;  1GJT A;  4B3S M;  2FNA A;  4LRS A;  3DFZ A;  2I7N A;  4MM3 B;  1SXJ A;  1WXQ A;  4NRW A;  2CHV A;  3SAW A;  4G4R A;  2CHG A;  3RE8 A;  2CRU A;  2DZO B;  3QYB A;  3HZJ A;  2EA0 A;  5EP4 A;  3KS8 A;  4GKK M;  3TWM A;  4DV5 M;  1EE8 A;  4CIS A;  1GAB A;  3MK6 A;  1E94 E;  4IBG A;  1TH3 A;  2DXI A;  4HEO A;  2O01 F;  4CHT B;  2A5Y B;  2QPA A;  4GC9 A;  3J7B A;  3WHL A;  5FTL A;  1Q3C A;  3GQ3 A;  4LF9 M;  3D8L A;  4NSO B;  1I94 M;  4B7G A;  1G8P A;  3NBI A;  4MGY E;  4BB9 A;  4AQY M;  4TUW A;  2F4V M;  3T1H M;  1QDR A;  1AUA A;  1D0K A;  2AHM A;  4DV1 M;  3KDS E;  1IY2 A;  2VF8 A;  2X49 A;  2HHH M;  1OFH A;  2R6F A;  3HHY A;  3U5Z A;  4PT5 A;  2JXN A;  1L2B A;  3CF6 E;  5FTJ A;  4P16 A;  5FLX S;  2JY7 A;  4YHH M;  4QHS A;  5JI3 E;  1VDL A;  2MJ5 B;  2V6Z M;  2LVP C;  4YY3 M;  4KHP M;  4GEW A;  4IBI A;  5DYG A;  3FTE A;  3KFU G;  3FTD A;  3T15 A;  2XEP A;  5DYI A;  4W5W A;  1QDT A;  3SHG B;  4LRT A;  4JI0 M;  4K0K M;  3I04 M;  3EIE A;  4DR1 M;  3CF2 A;  3GLG A;  1OQY A;  3VLF B;  5GKN A;  3K9O A;  3NWL A;  5EP1 A;  3M6A A;  1PJI A;  4QHT A;  5EQT A;  1R2Z A;  1IXS A;  2R45 A;  4DV2 M;  3VKH A;  1DGH B;  1JQJ C;  2BNK A;  4M0D A;  2QQ8 A;  4RF0 A;  2LVQ D;  4LZJ A;  5ITX A;  1NHG C;  2BWB A;  3K2L A;  4G6Z A;  2WSC F;  4GH9 A;  1OTR A;  1W5T A;  4DV7 M;  1DO2 A;  2C9C A;  3U61 A;  1DGG A;  3J27 B;  1KFV A;  2JP7 A;  2Z3X A;  3M0E A;  2MGW A;  3F92 A;  3D8B A;  1R6B X;  4IBJ A;  3FTC A;  1N36 M;  2F5S A;  3JR5 A;  3HU3 A;  5IWA M;  3KVW A;  3IG5 A;  3J80 S;  3AOG A;  3GLH B;  4OVZ B;  3U6P A;  3LVW A;  3FD9 A;  1K82 A;  5C18 A;  1VG5 A;  3GLI E;  3SAU A;  4IIW A;  1G3I A;  3KOX E;  3KOW E;  2R44 A;  3UGJ A;  4AI6 A;  4OU7 A;  1N34 M;  3FRI A;  4LJ5 A;  3R8F A;  2Y0T A;  2ZM6 M;  4S12 A;  3KOZ E;  2XGN A;  2R4J A;  3IHP A;  1V34 A;  1Q39 A;  2KZS A;  3L25 A;  5KO3 A;  3EIH A;  2VDB B;  4LJ9 A;  3HHZ A;  4NC6 A;  3U6D A;  2RGH A;  4L15 A;  5EP3 A;  1K3W A;  1IM2 A;  1P3Q Q;  1A5T A;  1QZE A;  2HKJ A;  2J7N A;  4AKH A;  1TF0 B;  1UFZ A;  2DWZ B;  3U60 B;  3SAV A;  2EKF A;  1RU3 A;  3IG8 A;  2P5T A;  4G4Q A;  4LJA A;  3T1Y M;  1Z5B A;  2UU9 M;  2FFJ A;  3SYK A;  3W0L B;  2C98 A;  2R4E A;  2J5Y A;  3TWK A;  2XF3 A;  3CF0 A;  4IBF A;  2ERC A;  2NQ8 C;  4DR2 M;  1GKI A;  2KRU A;  4NSR A;  3L27 A;  4LJ4 A;  3HKP A;  3LW5 F;  4LZZ A;  2DHY A;  3SMS A;  3QAU A;  2KXE A;  3VFD A;  2D7E A;  1N77 A;  4Z8X A;  2L7I A;  4NXN M;  2FE8 A;  4GC5 A;  2JZ1 A;  2ZAN A;  4I81 A;  4PD2 A;  2KDL A;  4DV6 M;  1XMQ M;  1HNX M;  5C1B A;  2QBY B;  3LMM A;  5FTM A;  1XXH E;  3U6E A;  4GHL A;  5ITR A;  3UK6 A;  4JI1 M;  3UJN A;  4L78 A;  1N75 A;  2KNZ A;  2WZJ A;  3B74 A;  2CEA A;  3MJ5 A;  3L2A A;  1TH2 A;  2Z7J A;  4DBG B;  2VQF M;  4X65 M;  2R0I A;  1K3X A;  3H4M A;  1GO5 A;  1T6O A;  2KNA A;  3KP0 E;  1FNN A;  2I7P A;  5KPT A;  3PNY A;  3E9S A;  1PJT A;  4B7F A;  4DV4 M;  4FD2 A;  2KEB A;  2B3T A;  1IQP A;  4KOD A;  2KNV A;  3MMP A;  2Y20 A;  1L1T A;  2UXD M;  3K92 A;  1DGH A;  3K8Z A;  5FTN A;  4D80 A;  2EKK A;  3K9P A;  3V76 A;  5ITT A;  2EO2 A;  2RRU A;  4DR4 M;  4LY6 A;  4JI3 M;  1QAN A;  1MU5 A;  1GVN A;  3KXE C;  1GJS A;  3L29 A;  2UUB M;  1L1Z A;  4FVM A;  2L4F A;  1MX0 A;  1UM8 A;  4B08 A;  2Q2E B;  2EUC A;  2CV1 A;  4JI7 M;  1N33 M;  4GIP A;  1CUK A;  1GL6 A;  1WGL A;  3B7N A;  3FUX A;  3KW6 A;  4JI5 M;  4AKI A;  3FKE A;  3AKZ A;  4G4N A;  3SAS A;  1OAI A;  3FUT A;  3GLF B;  2H5X A;  3GLI A;  4NRV A;  5IZ7 D;  4KT0 F;  3TWL A;  1TH4 A;  4LGY A;  1HQY E;  1IY0 A;  2DHR A;  2RKO A;  4QOS A;  1J5E M;  2DWL A;  4QNM A;  7CAT A;  1Q3B A;  3QYE A;  4L6V 6;  3GP1 A;  1XHB A;  2LVN C;  4LGM A;  3GLF E;  1NVM A;  3SHF A;  2M5Z A;  2V1U A;  1IN7 A;  1QYR A;  2JY6 B;  3E46 A;  1GL7 A;  1NHW C;  4M9S A;  1OFI A;  2OO9 A;  1R5L A;  2YNM D;  4LFB M;  2X4A A;  4UN2 B;  2DNA A;  3GRY A;  4IBC A;  1T3T A;  2JUJ A;  1PGY A;  1VEG A;  1PRB A;  4L16 A;  2DZN B;  4LFA M;  2O5R A;  2L7H A;  1OIP A;  1ZMU A;  3HWS A;  2VQE M;  3A42 A;  4RNA A;  1EIJ A;  1V33 A;  5A2Q S;  3E4R A;  3IEC A;  1NSF A;  3QWL A;  2G8L A;  4QNR A;  4R7G A;  1ZAE A;  2DAI A;  2JZ0 A;  2C5R A;  3RGS A;  2UXC M;  4PCZ A;  1TDZ A;  2KA6 B;  2QNJ A;  2L4E A;  4AW4 A;  4D82 A;  2XFS A;  4GKJ M;  4IBB A;  1GLN A;  2XZU A;  3GRU A;  2EJS A;  1J09 A;  2QCU A;  1V92 A;  3DOA A;  4HL4 A;  4I8O A;  1XXH A;  1SXJ B;  2W82 A;  2OQ4 A;  1R4G A;  4JI4 M;  4DR6 M;  4FWH A;  2MH8 A;  3THG A;  2DWN A;  3JAM S;  1N32 M;  1WIV A;  1YUB A;  2ZTC A;  2ZBK B;  4KO8 A;  4BBA A;  4R3D A;  1QUT A;  2QBY A;  3FUU A;  3B89 A;  1HNZ M;  4IBD A;  4IBK A;  3RGP A;  2LBC A;  2DKL A;  1IN6 A;  4CIZ A;  1OAO C;  1TR8 A;  1XNQ M;  2UUA M;  4XBO A;  3GLH E;  3AFH A;  3MHV C;  1QAM A;  3GQ4 A;  3GPU A;  3GPP A;  4NOO B;  3PXG A;  5LMU M;  4FCW A;  1E9S A;  3TPZ A;  2G5G X;  3WHK A;  4WP2 A;  3U5Z B;  2CWB A;  2R62 A;  2F5N A;  2JNH A;  2VF7 A;  2LNH C;  2Z8Y M;  2UUC M;  2L2D A;  5L8R F;  1JR3 D;  4B3T M;  4XGI A;  3B9P A;  3DA1 A;  4PDI A;  4DV0 M;  1S3S A;  2DAM A;  3UMM A;  2HWJ A;  3R9X B;  2LWX A;  1JR3 E;  1E32 A;  3FTF A;  4JI8 M;  2DAG A;  5BPV A;  1HNW M;  3SMP A;  3TQS A;  5EXP A;  3VK8 A;  1XC8 A;  2F5Q A;  3AV0 A;  4RF1 A;  1W5S A;  2K0B X;  3GLF A;  5IRE B;  1R7R A;  1IXS B;  4FWG A;  3FUW A;  4Q7J A;  5H37 D;  3LVV A;  5FSW A;  1F4I A;  5EXT A;  2QSF X;  1H6U A;  5IT9 S;  1G59 A;  2QEN A;  4JI6 M;  3KS4 A;  2GQF A;  4NL4 H;  4FCT A;  1XWI A;  3BBZ A;  3ZH9 B;  4DR5 M;  2Z4R A;  1XMO M;  1LV7 A;  4LF7 M;  1IBL M;  2FS1 A;  1Z5A A;  2JY5 A;  3U61 B;  4DR7 M;  1PJS A;  1Z5C A;  1ZQ9 A;  4IJE A;  3U6L A;  4ZPX A;  2Y21 A;  1IFY A;  4AZF A;  3M7G A;  2MR9 A;  4MGZ E;  2QHO B;  5EXX A;  3DZD A;  2DAK A;  3AOE A;  3Q8X A;  2D7G A;  4HLQ A;  5KPZ A;  3I01 M;  5E6J A;  3SC3 A;  1NO1 A;  3HHW A;  2CV0 A;  1VEJ A;  2LXE A;  3BOS A;  4I5S A;  3J7A S;  4A3V B;  2ZTD A;  2L09 A;  2J7O A;  2OOB A;  3HHX A;  4GIT A;  1QZM A;  1KSF X;  3I51 A;  2DZL A;  1IN5 A;  2CP8 A;  5KPR A;  3SAR A;  1WR1 B;  3ILK A;  3VKG A;  4LJ7 A;  3KSJ A;  4Z6Y A;  2XZF A;  4FCV A;  1ORY B;  4LJ6 A;  1JB0 F;  4DR3 M;  3HU2 A;  3FYC A;  1X37 A;  1D0M A;  1HQC A;  2ZAM A;  3W0F A;  3GLH A;  4XK8 F;  4OVZ A;  1IXR C;  2XFT A;  1VDD A;  2OPF A;  2N35 A;  1Q02 A;  3GO8 A;  4G4O A;  1NJG A;  4X62 M;  4LCB A;  4AG6 A;  3FE3 A;  4MGK E;  3VK7 A;  3B7Z A;  4GHA A;  4L8R C;  1ZMW A;  2CE7 A;  3RFW A;  4CJ6 A;  2R65 A;  1FJG M;  4QOZ C;  3GRV A;  3CGW A;  4REZ A;  3KOY E;  1VQ1 A;  4P17 A;  4LF4 M;  4AKG A;  2FH0 A;  2BJW A;  3L26 A;  3HU1 A;  1NJF A;  2DVW B;  4LF5 M;  3I4Y A;  5DFL A;  3ZC7 B;  4CGY B;  3U6O A;  1NNJ A;  2LHG A;  1MJG M;  2BWE A;  2YR0 A;  5EJC A;  3SFZ A;  2K6B A;  2RGO A;  1N78 A;  1WJ7 A;  3LQQ A;  3B7Q A;  4GRI A;  4F1I A;  3JR4 A;  1YSY A;  2KHH A;  1JR3 A;  1NY6 A;  2CHQ A;  3U60 A;  4FWD A;  2L6O A;  3AJI B;  4IBE A;  4F2L A;  4PDG A;  4Y28 F;  3VDP A;  1DV0 A;  3C9P A;  3GRR A;  4AG5 A;  2XSZ A;  5LMN M;  3HJ8 A;  1NNU C;  5F3W A;  3LCU A;  2R46 A;  1XB2 B;  3ZQJ A;  3ZCB B;  4JV5 M;  1L2D A;  2XH9 A;  3HGI A;  1PJQ A;  2DI0 A;  1Y8G A;  2MRO B;  2QZ4 A;  4FW9 A;  1SXJ D;  4EIW A;  3HJQ A;  3T38 A;  1OKS A;  2KZU A;  4M9X A;  1G41 A;  1BVS A;  1LTM A;  2UXB M;  1QAQ A;  1I4W A;  3OTO M;  4RKU F;  3KP1 E;  3SYL A;  2F5P A;  1SXJ E;  2LVA A;  1OIZ A;  2CFO A;  3T6P A;  1NV8 A;  1IN8 A;  2YFQ A;  4ANR A;  4DUZ M;  2QP9 X;  2DWM A;  1DO0 A;  3H4J A;  4LFC M;  3NBX X;  1ZV1 A;  3PVS A;  1VEK A;  3VDU A;  2KRK A;  4OX9 M;  3W67 A;  3A98 B;  4ITQ A;  4B3R M;  1G71 A;  4JYA M;  1TTE A;  2LTU A;  1MN3 A;  2WSF F;  4BLC A;  3GLI B;  1G4A E;  2HAK A;  2FOI C;  5FTK A;  1AIP C;  3PNV A;  1C7Y A;  5BR8 M;  1E9R A;  5JI2 E;  4JXJ A;  1QUS A;  3HY5 A;  3AL0 C;  1IY1 A;  2K47 A;  3AOE C;  2V1C A;  3HX3 A;  4DUY M;  1IBK M;  2LH0 A;  4IJF A;  1J7K A;  8CAT A;  3A45 A;  4OW0 A;  4LG2 A;  4L4U A;  5KQD A;  1YE9 A;  2JA2 A;  4D81 A;  2WSE F;  4LF6 M;  1DGB A;  1QVR A;  2VII A;  3LQR A;  4WUR A;  2APL A;  3TL4 X;  3Q8G A;  3PFI A;  5DNY A;  2O25 A;  1SG9 A;  4X66 M;  1D2N A;  3TE6 A;  2KW0 A;  2LHC A;  2E5L M;  2XSZ D;  4M9Z A;  2D7H A;  4M0W A;  3C58 A;  4LF8 M;  1EFU B;  2YQZ A;  3FYD A;  3GLG B;  1L8Q A;  4II7 A;  1Z6T A;  2H1R A;  4MH0 E;  3CTW B;  2Z4S A;  1NY5 A;  3GPX A;  3FUV A;  3GQ5 A;  1HT2 E;  3U6Q A;  4R71 A;  4I4L A;  1YLA A;  3SAT A;  2R18 A;  1SXJ C;  2JWS A;  3C3E A;  5KQ8 A;  4X64 M;  2OOA A;  4DV3 M;  3W68 A;  1TGU A;  3BXW A;  3SBJ A;  1Z59 A;  4LJ8 A;  2GNO A;  2K9D A;  3GLG E;  3C3D A;  2C96 A;  1XNR M;  1PM5 A;  4KLN A;  3L28 A;  2HL7 A;  4GMQ A;  1OJL A;  3UZU A;  2ZAO A;  3U6M A;  5E26 A;  2C99 A;  3LCV B;  4G3O A;  5ITU A;  2C9O A;  3K1J A;  5ITX E;  1T43 A;  2XLJ A;  1HT1 E;  1IXZ A;  2Y0Q A;  3I4V A;  4JI2 M;  2G3Q A;  1XXH B;  2BJV A;  2M60 A;  3U6S A;  5ITQ A;  1WHC A;  3GPY A;  4B3M M;  2DAE A;  1PJJ A;  1C1K A;  4WW0 A;  1KYI A;  1D0L A; 
#chains in the Genus database with same CATH homology
 3A46 A;  2CUZ A;  1TDH A;  2HCB A;  4B7H A;  1QQW A;  3J81 S;  4MB7 A;  1R2Y A;  3J2P B;  2X8A A;  4MGI E;  1L2C A;  1IN4 A;  5EP2 A;  4JN6 A;  1DGF A;  3KSX A;  1IBM M;  5EXS A;  5ITY A;  4MGH A;  1HR0 M;  4NXM M;  1QAO A;  3HJS A;  2F5O A;  2CV2 A;  3U6C A;  4B3S M;  2FNA A;  4LRS A;  3DFZ A;  2I7N A;  4MM3 B;  1SXJ A;  1WXQ A;  4NRW A;  2CHV A;  3SAW A;  4G4R A;  2CHG A;  3RE8 A;  2DZO B;  2EA0 A;  3KS8 A;  5EP4 A;  4GKK M;  3TWM A;  4DV5 M;  1EE8 A;  4CIS A;  3MK6 A;  1E94 E;  4IBG A;  1TH3 A;  2DXI A;  4CHT B;  2A5Y B;  2QPA A;  4GC9 A;  3J7B A;  3WHL A;  5FTL A;  1Q3C A;  3GQ3 A;  4LF9 M;  3D8L A;  4NSO B;  1I94 M;  4B7G A;  1G8P A;  3NBI A;  4MGY E;  4BB9 A;  4AQY M;  4TUW A;  2F4V M;  3T1H M;  2AHM A;  4DV1 M;  3KDS E;  1IY2 A;  2X49 A;  2HHH M;  1OFH A;  3HHY A;  3U5Z A;  4PT5 A;  1L2B A;  3CF6 E;  5FTJ A;  4P16 A;  5FLX S;  4YHH M;  4QHS A;  5JI3 E;  2V6Z M;  4YY3 M;  4KHP M;  4IBI A;  3FTE A;  5DYG A;  3KFU G;  3FTD A;  3T15 A;  2XEP A;  5DYI A;  4W5W A;  3SHG B;  4LRT A;  4JI0 M;  4K0K M;  4DR1 M;  3EIE A;  3CF2 A;  3GLG A;  3VLF B;  5GKN A;  3NWL A;  5EP1 A;  3M6A A;  1PJI A;  4QHT A;  5EQT A;  1R2Z A;  2R45 A;  4DV2 M;  3VKH A;  1DGH B;  1JQJ C;  2BNK A;  4M0D A;  4RF0 A;  5ITX A;  4LZJ A;  1NHG C;  3K2L A;  4G6Z A;  4GH9 A;  1W5T A;  4DV7 M;  1DO2 A;  2C9C A;  3U61 A;  1DGG A;  3J27 B;  1KFV A;  2Z3X A;  3M0E A;  3D8B A;  1R6B X;  4IBJ A;  3FTC A;  1N36 M;  2F5S A;  3JR5 A;  3HU3 A;  5IWA M;  3KVW A;  3IG5 A;  3J80 S;  3AOG A;  3GLH B;  4OVZ B;  3U6P A;  3LVW A;  3FD9 A;  1K82 A;  5C18 A;  3SAU A;  4IIW A;  1G3I A;  3KOX E;  3KOW E;  3UGJ A;  4AI6 A;  4OU7 A;  1N34 M;  4LJ5 A;  3R8F A;  2Y0T A;  2ZM6 M;  4S12 A;  3KOZ E;  2XGN A;  2R4J A;  1Q39 A;  2KZS A;  3L25 A;  5KO3 A;  3EIH A;  4LJ9 A;  3HHZ A;  3U6D A;  2RGH A;  4L15 A;  5EP3 A;  1K3W A;  1IM2 A;  2HKJ A;  2J7N A;  4AKH A;  2DWZ B;  3U60 B;  3SAV A;  3IG8 A;  2P5T A;  4G4Q A;  4LJA A;  3T1Y M;  1Z5B A;  2UU9 M;  2FFJ A;  3SYK A;  3W0L B;  2C98 A;  2R4E A;  3TWK A;  2UXD M;  2XF3 A;  3CF0 A;  4IBF A;  2ERC A;  2NQ8 C;  4DR2 M;  1GKI A;  2KRU A;  4NSR A;  3L27 A;  4LJ4 A;  3HKP A;  4LZZ A;  3SMS A;  3QAU A;  2KXE A;  3VFD A;  2D7E A;  1N77 A;  4Z8X A;  2L7I A;  4NXN M;  2FE8 A;  4GC5 A;  2ZAN A;  4I81 A;  4PD2 A;  4DV6 M;  1XMQ M;  1HNX M;  5C1B A;  2QBY B;  3LMM A;  5FTM A;  4GHL A;  3U6E A;  5ITR A;  3UK6 A;  4JI1 M;  3UJN A;  4L78 A;  1N75 A;  2CEA A;  3MJ5 A;  3L2A A;  1TH2 A;  2Z7J A;  2VQF M;  4X65 M;  1K3X A;  3H4M A;  3KP0 E;  1FNN A;  2I7P A;  5KPT A;  3PNY A;  3E9S A;  4B7F A;  4DV4 M;  4FD2 A;  2KEB A;  1IQP A;  4KOD A;  1L1T A;  2Y20 A;  3K92 A;  1DGH A;  3K8Z A;  5FTN A;  4D80 A;  5ITT A;  2EO2 A;  4DR4 M;  4LY6 A;  4JI3 M;  1QAN A;  1MU5 A;  1GVN A;  3KXE C;  3L29 A;  2UUB M;  1L1Z A;  4FVM A;  1MX0 A;  1UM8 A;  4B08 A;  2Q2E B;  2EUC A;  2CV1 A;  4JI7 M;  1N33 M;  4GIP A;  1GL6 A;  3FUX A;  3KW6 A;  4JI5 M;  4AKI A;  3FKE A;  3AKZ A;  4G4N A;  3SAS A;  3FUT A;  3GLF B;  3GLI A;  4NRV A;  5IZ7 D;  3TWL A;  1TH4 A;  4LGY A;  1HQY E;  1IY0 A;  2DHR A;  2RKO A;  4QOS A;  1J5E M;  2DWL A;  4QNM A;  7CAT A;  1Q3B A;  3GP1 A;  1XHB A;  4LGM A;  1NVM A;  3SHF A;  2M5Z A;  2V1U A;  1IN7 A;  1QYR A;  1GL7 A;  1NHW C;  4M9S A;  1OFI A;  4LFB M;  2YNM D;  2X4A A;  3GRY A;  4IBC A;  1T3T A;  4L16 A;  2DZN B;  4LFA M;  2O5R A;  2L7H A;  3HWS A;  2VQE M;  3A42 A;  4RNA A;  5A2Q S;  3E4R A;  1NSF A;  3QWL A;  2G8L A;  4QNR A;  4R7G A;  1ZAE A;  2C5R A;  3RGS A;  2UXC M;  4PCZ A;  1TDZ A;  2KA6 B;  4AW4 A;  4D82 A;  2XFS A;  4GKJ M;  4IBB A;  1GLN A;  2XZU A;  3GRU A;  1J09 A;  2QCU A;  3DOA A;  4HL4 A;  4I8O A;  1XXH A;  1SXJ B;  2W82 A;  2OQ4 A;  4JI4 M;  4FWH A;  3THG A;  2DWN A;  3JAM S;  1N32 M;  1YUB A;  2ZBK B;  4KO8 A;  4BBA A;  4R3D A;  2QBY A;  3FUU A;  1HNZ M;  4IBD A;  4IBK A;  3RGP A;  1IN6 A;  1XNQ M;  2UUA M;  4XBO A;  3AFH A;  3MHV C;  1QAM A;  3GQ4 A;  3GPU A;  3GPP A;  4NOO B;  3PXG A;  5LMU M;  4FCW A;  1E9S A;  3TPZ A;  2G5G X;  3WHK A;  3U5Z B;  2R62 A;  2F5N A;  2LNH C;  2UUC M;  1JR3 D;  4B3T M;  4XGI A;  3B9P A;  3DA1 A;  4PDI A;  4DV0 M;  1S3S A;  3UMM A;  3R9X B;  2LWX A;  1E32 A;  3FTF A;  4JI8 M;  5BPV A;  1HNW M;  3SMP A;  3TQS A;  5EXP A;  3VK8 A;  1XC8 A;  2F5Q A;  3AV0 A;  4RF1 A;  1W5S A;  3GLF A;  5IRE B;  1R7R A;  1IXS B;  4FWG A;  3FUW A;  5H37 D;  3LVV A;  5FSW A;  5EXT A;  1H6U A;  5IT9 S;  1G59 A;  2QEN A;  4JI6 M;  3KS4 A;  4NL4 H;  4FCT A;  1XWI A;  4DR5 M;  3ZH9 B;  2Z4R A;  1XMO M;  1LV7 A;  4LF7 M;  1IBL M;  1Z5A A;  3U61 B;  4DR7 M;  1Z5C A;  1ZQ9 A;  4IJE A;  3U6L A;  4ZPX A;  2Y21 A;  4AZF A;  3M7G A;  4MGZ E;  5EXX A;  3DZD A;  3AOE A;  3Q8X A;  2D7G A;  4HLQ A;  5KPZ A;  5E6J A;  3SC3 A;  3HHW A;  2CV0 A;  2LXE A;  3J7A S;  3BOS A;  4I5S A;  4A3V B;  2L09 A;  2J7O A;  3HHX A;  4GIT A;  1QZM A;  1KSF X;  3I51 A;  1IN5 A;  5KPR A;  3SAR A;  3ILK A;  3VKG A;  4LJ7 A;  3KSJ A;  4Z6Y A;  2XZF A;  4FCV A;  1ORY B;  4LJ6 A;  4DR3 M;  3HU2 A;  3FYC A;  1X37 A;  1HQC A;  2ZAM A;  3W0F A;  3GLH A;  4OVZ A;  1IXR C;  2XFT A;  1VDD A;  2OPF A;  3GO8 A;  4G4O A;  1NJG A;  4X62 M;  4LCB A;  4AG6 A;  4MGK E;  3VK7 A;  4GHA A;  4L8R C;  2CE7 A;  3RFW A;  1FJG M;  2R65 A;  4QOZ C;  3GRV A;  4REZ A;  4LF4 M;  3KOY E;  4AKG A;  3L26 A;  2BJW A;  3HU1 A;  1NJF A;  2DVW B;  4LF5 M;  3I4Y A;  3U6O A;  3ZC7 B;  4CGY B;  1NNJ A;  5EJC A;  2YR0 A;  3SFZ A;  2RGO A;  1N78 A;  3LQQ A;  4GRI A;  3JR4 A;  1YSY A;  1JR3 A;  1NY6 A;  2CHQ A;  3U60 A;  4FWD A;  2L6O A;  3AJI B;  4IBE A;  4PDG A;  3VDP A;  3GRR A;  4AG5 A;  2XSZ A;  5LMN M;  3HJ8 A;  1NNU C;  5F3W A;  2R46 A;  3ZCB B;  4JV5 M;  1L2D A;  2XH9 A;  3HGI A;  2QZ4 A;  4FW9 A;  1SXJ D;  4EIW A;  3HJQ A;  3T38 A;  2KZU A;  4M9X A;  1G41 A;  2UXB M;  1QAQ A;  1I4W A;  3OTO M;  3KP1 E;  3SYL A;  2F5P A;  1SXJ E;  2CFO A;  1IN8 A;  2YFQ A;  4DUZ M;  2QP9 X;  2DWM A;  1DO0 A;  4LFC M;  3PVS A;  3VDU A;  2KRK A;  4OX9 M;  3A98 B;  4ITQ A;  4B3R M;  4JYA M;  3GLI B;  4BLC A;  1G4A E;  2FOI C;  5FTK A;  3PNV A;  5BR8 M;  1E9R A;  5JI2 E;  4JXJ A;  3AL0 C;  4DR6 M;  1IY1 A;  2K47 A;  3AOE C;  2V1C A;  4DUY M;  1IBK M;  2LH0 A;  4IJF A;  1J7K A;  8CAT A;  3A45 A;  4OW0 A;  4LG2 A;  4L4U A;  5KQD A;  1YE9 A;  2JA2 A;  4D81 A;  4LF6 M;  1DGB A;  1QVR A;  2VII A;  3LQR A;  4WUR A;  3TL4 X;  3PFI A;  5DNY A;  4X66 M;  1D2N A;  3TE6 A;  2KW0 A;  2E5L M;  2XSZ D;  4M9Z A;  2D7H A;  4M0W A;  3C58 A;  4LF8 M;  2YQZ A;  3FYD A;  3GLG B;  1L8Q A;  4II7 A;  1Z6T A;  2H1R A;  4MH0 E;  3CTW B;  2Z4S A;  1NY5 A;  3GPX A;  3FUV A;  3GQ5 A;  1HT2 E;  3U6Q A;  3SAT A;  4I4L A;  2R18 A;  1SXJ C;  5KQ8 A;  4DV3 M;  4X64 M;  1TGU A;  3SBJ A;  1Z59 A;  4LJ8 A;  2C96 A;  1XNR M;  1PM5 A;  4KLN A;  3L28 A;  2HL7 A;  4GMQ A;  1OJL A;  3UZU A;  2ZAO A;  3U6M A;  5E26 A;  2C99 A;  5ITU A;  2C9O A;  3K1J A;  5ITX E;  2XLJ A;  1HT1 E;  1IXZ A;  2Y0Q A;  3I4V A;  4JI2 M;  1XXH B;  2BJV A;  2M60 A;  3U6S A;  5ITQ A;  4B3M M;  3GPY A;  1PJJ A;  1C1K A;  4WW0 A;  1KYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...