2UUBM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uubM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uubM02
1K3WA 4LF4M 1N32M 1K3XA 1XNQM 3J80S 5A2QS 4DR7M 4K0KM 3VK8A 2UU9M 4JI3M 5ITXE 4LF9M 4DV2M 1N34M 4NXMM 1N36M 4OX9M 4DV0M 1PJIA 2F4VM 2F5OA 3A45A 1TDHA 5ITUA 3U6MA 4B3RM 1HNZM 2UUBM 5ITTA 4X64M 2EA0A 4ITQA 5LMUM 1IBLM 1IBKM 1XC8A 5FLXS 3T1HM 1KFVA 1L1ZA 3GPPA 3SAVA 4GKKM 3A46A 4YY3M 1HNXM 3TWKA 4DV5M 2ZBKB 4DR3M 3U6SA 3VK7A 2XZUA 4DR1M 1I94M 3T1YM 4PD2A 4DUYM 3GQ4A 1MU5A 4X62M 4DV1M 2UUAM 3SBJA 4KHPM 1L2BA 3JAMS 5ITRA 2UUCM 1L2CA 2F5SA 1L2DA 3U6QA 3TWMA 3SASA 3SARA 2F5NA 4NXNM 1R2ZA 3TWLA 1NNJA 1MX0A 1IBMM 1Z5AA 1R2YA 1HNWM 4LFAM 1Q3BA 2XZFA 4JI0M 4DV3M 2HHHM 4G4QA 3C58A 1PM5A 4LF6M 4X65M 1L1TA 4X66M 5ITXA 1HR0M 3GPUA 4JI4M 4JI6M 4JI2M 1Z59A 1EE8A 1Q3CA 2ZM6M 3U6CA 2F5PA 4LFCM 4DR2M 1J5EM 4NRWA 1TDZA 3GP1A 1FJGM 3U6OA 1Q39A 3W0FA 3GPXA 5BR8M 4LF8M 4PDGA 2VQEM 4AQYM 5LMNM 1K82A 4DR4M 2UXDM 5IT9S 3U6DA 3U6LA 3DOAA 2F5QA 4G4OA 1N33M 5ITYA 4B3SM 4B3TM 3SATA 5ITQA 4PCZA 2OQ4A 4DV4M 5IWAM 4G4RA 3A42A 1XMOM 1PJJA 4CISA 3U6EA 1XNRM 4YHHM 3GO8A 4JI1M 4JI7M 4JI8M 2UXBM 4JV5M 3J81S 3GQ3A 2OPFA 4LF5M 3JR4A 1Z5CA 2VQFM 2HKJA 2E5LM 4DV6M 4MB7A 4JI5M 4DR6M 4GKJM 3SAUA 3GPYA 4LFBM 3SAWA 3U6PA 4DR5M 1XMQM 4PDIA 4DV7M 3J7AS 3OTOM 4LF7M 4B3MM 4JYAM 2Q2EB 2UXCM 3GQ5A 4NRVA 3JR5A 1Z5BA 4G4NA 4DUZM
chains in the Genus database with same CATH superfamily
1IN4A 3R8FA 4Z8XA 3VK8A 3AL0C 2AHMA 5EXXA 4JI3M 3TQSA 3PNVA 5ITXE 2O01F 2DVWB 4NXMM 3GLIE 4DV0M 2Y0TA 4GC9A 1NNUC 3MK6A 4EIWA 2QENA 3A45A 1RU3A 2B3TA 3K1JA 4Y28F 1GJTA 1AUAA 2C99A 2KHHA 4L16A 3T15A 2UUBM 5FTLA 2Z7JA 4IBJA 4XBOA 4ANRA 1W5TA 2JXNA 4LRTA 1SG9A 2MR9A 2LVPC 2HWJA 4M9ZA 1N78A 4GKKM 5FLXS 1L1ZA 3SAVA 4P16A 4L8RC 4QOZC 2L4FA 4CIZA 4DR3M 1DGHB 2QCUA 3VK7A 2KNAA 5FTJA 2J5YA 3KSXA 2VDBB 5KQ8A 3L27A 2WSCF 1NV9A 3AKZA 3MJ5A 4KLNA 3LQQA 4AW4A 5KPTA 1QAQA 2I7NA 3JAMS 1L2BA 3E46A 3I4YA 3THGA 1G8PA 4NSOB 2XLJA 3HU3A 1L2CA 1X37A 3KP0E 4XK8F 3U60A 2F5SA 1EFUB 4G6ZA 3SARA 2CUZA 1S3SA 4MM3B 2F5NA 4F2LA 3VKGA 2W82A 1Z5AA 2Z4SA 1HT1E 1WGNA 4PT5A 3NBIA 1E9RA 2MGWA 3U5ZB 4LJ9A 2G3QA 1NO1A 2M5ZA 1PM5A 3DZDA 1XXHA 2R44A 3GPUA 2DNAA 1Z59A 1Q3CA 1D0LA 2QNJA 1R7RA 2ZM6M 2MROB 2DZNB 2F5PA 2KEBA 1FJGM 1KSFX 3L2AA 2JY5A 3CGWA 5KPRA 3CF6E 1Q39A 3GPXA 5DYIA 3U6OA 1G59A 1NHWC 1YSYA 2R62A 4PDGA 2CWBA 2X49A 3AV0A 3L26A 3K8ZA 1YLAA 3U6DA 3HHXA 5KO3A 2C98A 5FTKA 2QBYB 3DA1A 2F5QA 3AOGA 2LVNC 2VF8A 2OO9A 1VDLA 3SATA 2NQ8C 5ITQA 2QBYA 3D8LA 4D82A 3A42A 4S12A 1HQCA 3HHYA 4CISA 1Y8GA 3TL4X 4REZA 1T3TA 3HJQA 3GO8A 2LBCA 4JI8M 1QZMA 3J81S 4IBFA 2LVOC 2G8LA 3KVWA 1TH2A 2JUJA 2K9DA 2BJVA 4FVMA 1R4GA 1TH3A 3MHVC 2FNAA 2CEAA 1JR3E 2E5LM 4DV6M 3WHKA 4MGKE 3GLFA 3SMSA 4GKJM 4HEOA 3SAUA 2FE8A 1J7KA 3SYLA 2FS1A 2D7GA 3U5ZA 1XMQM 4PDIA 1PJQA 4B08A 2J7NA 4LF7M 3HZJA 2QSFX 2UXCM 4NOOB 4B3MM 3SHFA 1Z5BA 4G4NA 2UUCM 2JY8A 2X4AA 1IN6A 3QAUA 2JY6B 4GIPA 5BPVA 3VKHA 1QYRA 4HLQA 5EP2A 1V33A 4B7FA 3A98B 2KZUA 3AOEA 2LXEA 4QHSA 1DGBA 4YY3M 4WURA 1OTRA 3RFWA 3Q8XA 2F4VM 1JR3D 1G4AE 5IZ7D 3B7QA 4BBAA 2DAKA 5ITUA 2ZTDA 3FUVA 4FCWA 2HAKA 2LVAA 1YUBA 3K92A 4UN2B 3ZQJA 4IBKA 1HNZM 4GHAA 4FWHA 2EA0A 1V92A 2C9OA 2OOBA 2MH8A 3CF0A 4I8OA 2R0IA 5LMUM 1KFVA 1YE9A 5JI2E 3DFZA 2KRUA 3T1HM 3PVSA 2KNZA 5EP1A 1GVNA 1VEKA 3SYKA 3PNYA 3W68A 1TGUA 2YNMD 4DBGB 3HGIA 3I4VA 1SXJE 2O25A 4IJFA 2CV2A 4AG6A 3AJIB 2XZUA 3FYDA 2GQFA 3GLFB 2KNVA 1NY5A 4L78A 3RE8A 3ZCBB 2R65A 2J7OA 4PD2A 4DUYM 1MN3A 3B89A 4G3OA 1W5SA 3GQ4A 1SXJA 4DV1M 3SBJA 2UUAM 3GLGE 2YR0A 3W0LB 2C9CA 2DAEA 2FFJA 4JN6A 4LJ4A 1OQYA 1IN8A 1WJ7A 3K9PA 1LV7A 3FUWA 3HY5A 4IBCA 5EP3A 3KXEC 4GH9A 3U6QA 3TWMA 2DZLA 2C96A 1GJSA 1V34A 2EKKA 3EIHA 1GKIA 4NXNM 1R2ZA 3GLIA 5FTNA 3UJNA 3GLHA 2X8AA 2YFQA 1XXHE 1UFZA 1DV0A 1Q3BA 2XZFA 2Y0QA 3D8BA 2HHHM 1N77A 1GLNA 1SXJD 1QAOA 2Z8YM 2R18A 3C58A 4X65M 1HR0M 4X66M 4JI6M 1J09A 1EE8A 2YQZA 2KW0A 4R7GA 3HHZA 2R6FA 3U6CA 1QUTA 4LFCM 2KZSA 1ZMWA 1NSFA 3GP1A 1TDZA 3FRIA 2V1UA 3LCUA 4B7GA 3SMPA 3VLFB 3HJSA 3SC3A 2VQEM 4AKHA 5H37D 5C18A 3QYEA 5EJCA 1E9SA 1N75A 1NV8A 2HL7A 4RF1A 4GHLA 3U6LA 3FTEA 2DKLA 2LWXA 3B74A 4I81A 3KOWE 3B7NA 1C7YA 3H4MA 4PCZA 4ZPXA 2XF3A 4G4RA 4LRSA 4AI6A 3TE6A 1HJPA 1VG5A 1G41A 2L09A 2QZ4A 3FE3A 3J2PB 3NBXX 4IBGA 4M0DA 4YHHM 3AOEC 2I7PA 4OU7A 1IXZA 3C3EA 1WIVA 3HHWA 1OJLA 1WXQA 2UXBM 1JB0F 1EIJA 3GQ3A 1OFHA 3I04M 3JR4A 4LF5M 2CP8A 1GL7A 4IBIA 1DGHA 5FSWA 1FNNA 2BWEA 3H4JA 5L8RF 1NJFA 4LGYA 2XFSA 4QNMA 1H6UA 4LFBM 2XSZD 2EKFA 3SAWA 2CHQA 2C5RA 3M6AA 5KQDA 3J7AS 2LHGA 4IBDA 3IHPA 1VEJA 2Q2EB 4CJ6A 2CV0A 3L28A 2FOIC 1ZAEA 3PFIA 2F5OA 3IECA 1XWIA 1ZMUA 2R4JA 4DUZM 4LF4M 3HU1A 3J80S 3KSJA 1NJGA 2DAGA 2LHCA 4LJ8A 4FCTA 4CGYB 3FTFA 4DR7M 4L6V6 4M9SA 2R45A 2V6ZM 4DV2M 3HJ8A 3LVVA 2R4EA 1HQYE 4OX9M 1QVRA 1QDRA 1IXRC 2JWSA 1TDHA 5C1BA 2DWMA 3U6MA 1C1KA 2L4EA 3QWLA 5ITTA 3MMPA 3KOXE 3GRUA 3L25A 5E26A 4NC6A 1IY1A 4Q7JA 3VDUA 1IBKM 1XC8A 1QAMA 3PXGA 2DWNA 3LQRA 4MGZE 3A46A 1R5LA 2EO2A 1HNXM 1QQWA 1UM8A 2ZBKB 3U6SA 4LZZA 2GNOA 1QUSA 3EIEA 2CE7A 2KXEA 2K0BX 4I5SA 1QANA 4IJEA 2MJ5B 5E6JA 3FTDA 2CFOA 3E9SA 2Z3XA 2KDLA 4X62M 1E94E 4KHPM 2JNHA 3KP1E 3FYCA 3M0EA 3U60B 3I01M 3GLHE 2WSFF 5GKNA 3SHGB 5ITRA 3BXWA 2LTUA 3VFDA 3CTWB 4WW0A 1IY0A 1L2DA 2EJSA 2WZJA 2QP9X 4FWGA 4MGIE 1IBMM 3TWLA 1NNJA 3FUUA 2XFTA 4IBBA 2BJWA 3K9OA 3UK6A 2RGOA 2HCBA 4IBEA 4RKUF 4JI0M 1R6BX 1SXJC 1E32A 4G4QA 4I4LA 5ITXA 4XGIA 4NSRA 4JI4M 4WP2A 3HWSA 4JI2M 3FUTA 4II7A 4P17A 4DR2M 2H5XA 2CHVA 3HX3A 2O5RA 3B9PA 3GRVA 3M7GA 4LZJA 1J5EM 4NRWA 4MGYE 3W0FA 4NL4H 5BR8M 1TTEA 3FUXA 4LF8M 4AQYM 5LMNM 1K82A 3W67A 2UXDM 5IT9S 2RKOA 2XH9A 3KW6A 3KFUG 1CUKA 1WHCA 1G71A 1BVSA 3I51A 2DZOB 1OAOC 2XEPA 4BB9A 1N33M 4B3SM 2VIIA 4LCBA 4DV4M 5IWAM 1PJJA 1VQ1A 4OVZA 3T6PA 2LNHC 1DGGA 1IY2A 2JP7A 4JI1M 3FTCA 3C9PA 1OFIA 4JI7M 4OVZB 8CATA 3ZC7B 4JV5M 1DO0A 3Q8GA 4LJ7A 4QNRA 1KYIA 2L2DA 5DFLA 1Z5CA 2HKJA 2QPAA 4GEWA 2L7HA 4MB7A 2DAIA 2L7IA 3E4RA 4QHTA 5JI3E 2ZTCA 1DGFA 3WHLA 2H1RA 1JQJC 4KT0F 1QDTA 5IREB 4DR5M 4DV7M 1VDDA 3OTOM 3KOZE 3LVWA 3RGPA 4JYAM 2DWZB 3KS4A 4GMQA 1XXHB 2ZAOA 5DYGA 2JZ0A 5F3WA 4RF0A 3JR5A 2P5TA 5EP4A 1K3WA 5KPZA 3V76A 3J7BA 3AFHA 1N32M 3UMMA 1K3XA 3BBZA 1XNQM 3FRHA 3UZUA 2ZANA 5A2QS 2JZ1A 1WGLA 4K0KM 1A5TA 4Z6YA 2UU9M 1D0MA 5EXPA 4LF9M 2ERCA 1N34M 1N36M 1I4WA 1PJIA 4GRIA 4MH0E 2K47A 1OAIA 4R3DA 1LTMA 4M9XA 4A3VB 4L4UA 1QZEA 4B3RM 2A5YB 1WR1B 4HL4A 3ZH9B 1IM2A 1Q02A 1ORYB 4X64M 4ITQA 5DNYA 4BLCA 3TPZA 1IBLM 1P3QQ 4W5WA 2N35A 3GPPA 3FD9A 4LJ6A 2VF7A 1PJTA 2EUCA 1DO2A 2XGNA 4GITA 3ILKA 1TR8A 3NWLA 4FCVA 3TWKA 4DV5M 2DHYA 2Z4RA 1ZV1A 3RGSA 2JY7A 1IN7A 4KODA 3HKPA 4MGHA 3UGJA 4DR1M 1I94M 3T1YM 1ZMVA 1D2NA 2D7HA 1MU5A 2M60A 1D0KA 3IG8A 4B7HA 2DXIA 1OIZA 2Y21A 2QHOB 3VDPA 3SASA 1G3IA 2QQ8A 1IXSB 1T6OA 3GLGA 3J27B 1MX0A 1OKSA 4QOSA 2DI0A 1R2YA 1HNWM 1VEGA 7CATA 2L6OA 2V1CA 3E21A 1IXSA 4LFAM 1XHBA 2CHGA 2RRUA 3GLIB 3QYBA 4AKGA 4DV3M 3C3DA 1T43A 3LW5F 3T38A 2D7EA 4LF6M 1L1TA 3KDSE 4LGMA 4F1IA 2G5GX 4LJAA 5EQTA 2BNKA 2KRKA 3BOSA 4M0WA 4KO8A 2ZAMA 2CV1A 3CF2A 1ZQ9A 2OOAA 2APLA 4IIWA 1NY6A 3SFZA 1F4IA 4AKIA 4DR4M 4D80A 4AZFA 1GO5A 1TH4A 1XB2B 3DOAA 5EXTA 3GRRA 1PGYA 3GLFE 4AG5A 4G4OA 2KA6B 5ITYA 4B3TM 4TUWA 2OQ4A 2XSZA 4R71A 1XMOM 3KS8A 3B7ZA 1SXJB 2LH0A 3U6EA 4RNAA 1XNRM 2DWLA 3HU2A 4FW9A 2WSEF 1IQPA 2LVQD 4FWDA 4D81A 1MJGM 3GRYA 2OPFA 2DAMA 2CRUA 4L15A 2JA2A 1NVMA 3LMMA 1TF0B 3IG5A 3LCVB 1PJSA 3GLGB 1GL6A 2VQFM 4OW0A 4LG2A 3GLHB 3K2LA 4JI5M 2BWBA 4FD2A 4DR6M 4LY6A 5EXSA 2DENA 2Y20A 3U61A 1GABA 4LJ5A 1IFYA 3GPYA 1L8QA 1HT2E 1NHGC 4CHTB 2RGHA 3R9XB 3F92A 3U6PA 4GC5A 1JR3A 5FTMA 3U61B 2K6BA 3KOYE 2FH0A 4JXJA 1IN5A 1Z6TA 3L29A 2DHRA 2R46A 3FKEA 3GQ5A 1AIPC 1OIPA 1PRBA 4NRVA
chains in the Genus database with same CATH topology
1IN4A 3R8FA 4Z8XA 3VK8A 3AL0C 2AHMA 5EXXA 4JI3M 3TQSA 3PNVA 5ITXE 2DVWB 4NXMM 4DV0M 2Y0TA 4GC9A 1NNUC 3MK6A 4EIWA 2QENA 3A45A 3K1JA 2C99A 4L16A 3T15A 2UUBM 5FTLA 2Z7JA 4IBJA 4XBOA 1W5TA 4LRTA 1N78A 4M9ZA 4GKKM 5FLXS 1L1ZA 3SAVA 4P16A 4L8RC 4QOZC 4DR3M 1DGHB 2QCUA 3VK7A 5FTJA 3KSXA 5KQ8A 3L27A 3AKZA 3MJ5A 4KLNA 3LQQA 4AW4A 5KPTA 1QAQA 2I7NA 3JAMS 1L2BA 3I4YA 3THGA 1G8PA 4NSOB 2XLJA 3HU3A 1L2CA 1X37A 3KP0E 3U60A 2F5SA 4G6ZA 3SARA 2CUZA 1S3SA 4MM3B 2F5NA 3VKGA 2W82A 1Z5AA 2Z4SA 1HT1E 4PT5A 3NBIA 1E9RA 3U5ZB 4LJ9A 2M5ZA 1PM5A 3DZDA 1XXHA 3GPUA 1Z59A 1Q3CA 2ZM6M 1R7RA 2F5PA 2DZNB 2KEBA 1FJGM 1KSFX 3L2AA 5KPRA 3CF6E 1Q39A 3GPXA 5DYIA 3U6OA 1G59A 1NHWC 1YSYA 2R62A 4PDGA 2X49A 3AV0A 3L26A 3K8ZA 3U6DA 3HHXA 5KO3A 2C98A 5FTKA 2QBYB 3DA1A 2F5QA 3AOGA 3SATA 2NQ8C 5ITQA 2QBYA 3D8LA 4D82A 3A42A 4S12A 1HQCA 3HHYA 4CISA 3TL4X 4REZA 1T3TA 3HJQA 3GO8A 4JI8M 1QZMA 3J81S 4IBFA 2G8LA 3KVWA 1TH2A 2BJVA 4FVMA 1TH3A 3MHVC 2FNAA 2CEAA 2E5LM 4DV6M 3WHKA 4MGKE 3GLFA 3SMSA 4GKJM 3SAUA 2FE8A 1J7KA 3SYLA 2D7GA 3U5ZA 1XMQM 4PDIA 4B08A 2J7NA 4LF7M 2UXCM 4NOOB 4B3MM 3SHFA 1Z5BA 4G4NA 2UUCM 2X4AA 1IN6A 3QAUA 5BPVA 4GIPA 3VKHA 1QYRA 4HLQA 5EP2A 4B7FA 3A98B 2KZUA 3AOEA 2LXEA 4QHSA 1DGBA 4WURA 3RFWA 2F4VM 3Q8XA 1JR3D 1G4AE 5IZ7D 4BBAA 5ITUA 3FUVA 4FCWA 3K92A 1YUBA 1HNZM 4IBKA 4GHAA 4FWHA 2EA0A 2C9OA 4I8OA 3CF0A 5LMUM 1KFVA 1YE9A 5JI2E 3DFZA 2KRUA 3T1HM 3PVSA 5EP1A 1GVNA 4YY3M 3SYKA 3PNYA 1TGUA 2YNMD 3HGIA 3I4VA 1SXJE 4IJFA 2CV2A 4AG6A 3AJIB 2XZUA 3FYDA 3GLFB 1NY5A 4L78A 3RE8A 3ZCBB 2R65A 2J7OA 4PD2A 4DUYM 3GQ4A 4DV1M 2UUAM 1W5SA 1SXJA 3SBJA 2YR0A 3W0LB 2C9CA 4JN6A 2FFJA 4LJ4A 1IN8A 1LV7A 3FUWA 4IBCA 5EP3A 3KXEC 4GH9A 3U6QA 3TWMA 2C96A 3EIHA 1GKIA 4NXNM 1R2ZA 3GLIA 5FTNA 3UJNA 3GLHA 2X8AA 2YFQA 1Q3BA 2XZFA 2Y0QA 3D8BA 2HHHM 1N77A 1GLNA 1SXJD 1QAOA 2R18A 3C58A 4X65M 1HR0M 4X66M 4JI6M 1J09A 1EE8A 2YQZA 2KW0A 4R7GA 3HHZA 3U6CA 4LFCM 2KZSA 1NSFA 3GP1A 1TDZA 2V1UA 4B7GA 3SMPA 3VLFB 3HJSA 3SC3A 2VQEM 4AKHA 5H37D 5C18A 5EJCA 1E9SA 1N75A 2HL7A 4GHLA 4RF1A 3U6LA 3FTEA 2LWXA 4I81A 3KOWE 3H4MA 4PCZA 4ZPXA 2XF3A 4G4RA 4LRSA 4AI6A 3TE6A 4M0DA 2L09A 1G41A 2QZ4A 4YHHM 3J2PB 4IBGA 3AOEC 2I7PA 4OU7A 1IXZA 2UXBM 3HHWA 1OJLA 1WXQA 3GQ3A 1OFHA 4LF5M 3JR4A 1GL7A 4IBIA 1DGHA 5FSWA 1FNNA 1NJFA 4LGYA 2XFSA 4QNMA 1H6UA 4LFBM 2XSZD 3SAWA 2C5RA 2CHQA 3M6AA 5KQDA 3J7AS 4IBDA 2Q2EB 2CV0A 3L28A 2FOIC 1ZAEA 3PFIA 2F5OA 1XWIA 4DUZM 2R4JA 4LF4M 3HU1A 3J80S 3KSJA 1NJGA 4LJ8A 4CGYB 3FTFA 4FCTA 4DR7M 4M9SA 2R45A 2V6ZM 4DV2M 3HJ8A 3LVVA 2R4EA 1HQYE 4OX9M 1QVRA 5C1BA 1IXRC 1TDHA 2DWMA 3U6MA 1C1KA 3QWLA 5ITTA 3KOXE 3GRUA 3L25A 5E26A 1IY1A 3VDUA 1IBKM 1XC8A 1QAMA 3PXGA 2DWNA 3LQRA 4MGZE 3A46A 2EO2A 1HNXM 1QQWA 1UM8A 2ZBKB 3U6SA 4LZZA 3EIEA 2CE7A 2KXEA 4I5SA 1QANA 4IJEA 5E6JA 3FTDA 2CFOA 3E9SA 2Z3XA 4X62M 1E94E 4KHPM 3KP1E 3FYCA 3M0EA 3U60B 3SHGB 5GKNA 5ITRA 3VFDA 3CTWB 4WW0A 1IY0A 1L2DA 2QP9X 4FWGA 4MGIE 1IBMM 3TWLA 1NNJA 3FUUA 2XFTA 4IBBA 2BJWA 3UK6A 2RGOA 2HCBA 4IBEA 4JI0M 1R6BX 1SXJC 1E32A 4G4QA 4I4LA 5ITXA 4XGIA 4NSRA 4JI4M 3HWSA 4JI2M 3FUTA 4II7A 4DR2M 1J5EM 2CHVA 4NRWA 2O5RA 3B9PA 3GRVA 3M7GA 4LZJA 4AKGA 4MGYE 3W0FA 4NL4H 5BR8M 4LF8M 3FUXA 4AQYM 5LMNM 1K82A 2UXDM 5IT9S 2RKOA 2XH9A 3KW6A 3KFUG 3I51A 2DZOB 4BB9A 2XEPA 1N33M 4B3SM 2VIIA 4LCBA 4DV4M 5IWAM 1PJJA 4OVZA 2LNHC 1DGGA 1IY2A 4JI1M 3FTCA 1OFIA 4JI7M 4OVZB 8CATA 3ZC7B 4JV5M 1DO0A 4QNRA 4LJ7A 1KYIA 1Z5CA 2HKJA 2QPAA 2L7HA 4MB7A 2L7IA 3E4RA 4QHTA 5JI3E 1DGFA 3WHLA 2H1RA 1JQJC 5IREB 4DR5M 4DV7M 1VDDA 3OTOM 3KOZE 3LVWA 3RGPA 4JYAM 2DWZB 3KS4A 4GMQA 1XXHB 2ZAOA 5DYGA 5F3WA 4RF0A 3JR5A 2P5TA 5EP4A 1K3WA 5KPZA 3J7BA 3AFHA 1N32M 3UMMA 1K3XA 1XNQM 3UZUA 2ZANA 5A2QS 4K0KM 4Z6YA 2UU9M 5EXPA 4LF9M 2ERCA 1N34M 1N36M 1I4WA 1PJIA 4GRIA 4MH0E 2K47A 4R3DA 4A3VB 4M9XA 4L4UA 4B3RM 2A5YB 4HL4A 3ZH9B 1IM2A 1ORYB 4X64M 4ITQA 5DNYA 4BLCA 3TPZA 1IBLM 4W5WA 3GPPA 3FD9A 4LJ6A 2EUCA 4GITA 1DO2A 2XGNA 3ILKA 3NWLA 4FCVA 3TWKA 4DV5M 2Z4RA 3RGSA 1IN7A 4KODA 3HKPA 4MGHA 3UGJA 4DR1M 1I94M 3T1YM 1D2NA 2D7HA 1MU5A 2M60A 3IG8A 4B7HA 2DXIA 2Y21A 3VDPA 3SASA 1G3IA 1IXSB 3GLGA 3J27B 1MX0A 4QOSA 1R2YA 1HNWM 7CATA 2L6OA 2V1CA 4LFAM 1XHBA 2CHGA 3GLIB 4DV3M 3T38A 2D7EA 4LF6M 1L1TA 3KDSE 4LGMA 2G5GX 4LJAA 5EQTA 2BNKA 2KRKA 3BOSA 4M0WA 4KO8A 2ZAMA 2CV1A 3CF2A 1ZQ9A 4IIWA 1NY6A 3SFZA 4AKIA 4DR4M 4D80A 4AZFA 1TH4A 3DOAA 5EXTA 3GRRA 4AG5A 4G4OA 2KA6B 5ITYA 4B3TM 4TUWA 2OQ4A 2XSZA 3KS8A 1XMOM 1SXJB 2LH0A 3U6EA 4RNAA 1XNRM 2DWLA 3HU2A 4FW9A 1IQPA 4FWDA 4D81A 3GRYA 2OPFA 4L15A 2JA2A 1NVMA 3LMMA 2VQFM 3IG5A 3GLGB 1GL6A 4OW0A 4LG2A 3GLHB 3K2LA 4JI5M 4DR6M 4FD2A 4LY6A 5EXSA 2Y20A 3U61A 4LJ5A 3GPYA 1L8QA 1HT2E 1NHGC 4CHTB 2RGHA 3R9XB 3U6PA 4GC5A 1JR3A 5FTMA 3U61B 3KOYE 4JXJA 1IN5A 1Z6TA 3L29A 2DHRA 2R46A 3FKEA 3GQ5A 4NRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3W A;  4LF4 M;  1N32 M;  1K3X A;  1XNQ M;  3J80 S;  5A2Q S;  4DR7 M;  4K0K M;  3VK8 A;  2UU9 M;  4JI3 M;  5ITX E;  4LF9 M;  4DV2 M;  1N34 M;  4NXM M;  1N36 M;  4OX9 M;  4DV0 M;  1PJI A;  2F4V M;  2F5O A;  3A45 A;  1TDH A;  5ITU A;  3U6M A;  4B3R M;  1HNZ M;  2UUB M;  5ITT A;  4X64 M;  2EA0 A;  4ITQ A;  5LMU M;  1IBL M;  1IBK M;  1XC8 A;  5FLX S;  3T1H M;  1KFV A;  1L1Z A;  3GPP A;  3SAV A;  4GKK M;  3A46 A;  4YY3 M;  1HNX M;  3TWK A;  4DV5 M;  2ZBK B;  4DR3 M;  3U6S A;  3VK7 A;  2XZU A;  4DR1 M;  1I94 M;  3T1Y M;  4PD2 A;  4DUY M;  3GQ4 A;  1MU5 A;  4X62 M;  4DV1 M;  2UUA M;  3SBJ A;  4KHP M;  1L2B A;  3JAM S;  5ITR A;  2UUC M;  1L2C A;  2F5S A;  1L2D A;  3U6Q A;  3TWM A;  3SAS A;  3SAR A;  2F5N A;  4NXN M;  1R2Z A;  3TWL A;  1NNJ A;  1MX0 A;  1IBM M;  1Z5A A;  1R2Y A;  1HNW M;  4LFA M;  1Q3B A;  2XZF A;  4JI0 M;  4DV3 M;  2HHH M;  4G4Q A;  3C58 A;  1PM5 A;  4LF6 M;  4X65 M;  1L1T A;  4X66 M;  5ITX A;  1HR0 M;  3GPU A;  4JI4 M;  4JI6 M;  4JI2 M;  1Z59 A;  1EE8 A;  1Q3C A;  2ZM6 M;  3U6C A;  2F5P A;  4LFC M;  4DR2 M;  1J5E M;  4NRW A;  1TDZ A;  3GP1 A;  1FJG M;  3U6O A;  1Q39 A;  3W0F A;  3GPX A;  5BR8 M;  4LF8 M;  4PDG A;  2VQE M;  4AQY M;  5LMN M;  1K82 A;  4DR4 M;  2UXD M;  5IT9 S;  3U6D A;  3U6L A;  3DOA A;  2F5Q A;  4G4O A;  1N33 M;  5ITY A;  4B3S M;  4B3T M;  3SAT A;  5ITQ A;  4PCZ A;  2OQ4 A;  4DV4 M;  5IWA M;  4G4R A;  3A42 A;  1XMO M;  1PJJ A;  4CIS A;  3U6E A;  1XNR M;  4YHH M;  3GO8 A;  4JI1 M;  4JI7 M;  4JI8 M;  2UXB M;  4JV5 M;  3J81 S;  3GQ3 A;  2OPF A;  4LF5 M;  3JR4 A;  1Z5C A;  2VQF M;  2HKJ A;  2E5L M;  4DV6 M;  4MB7 A;  4JI5 M;  4DR6 M;  4GKJ M;  3SAU A;  3GPY A;  4LFB M;  3SAW A;  3U6P A;  4DR5 M;  1XMQ M;  4PDI A;  4DV7 M;  3J7A S;  3OTO M;  4LF7 M;  4B3M M;  4JYA M;  2Q2E B;  2UXC M;  3GQ5 A;  4NRV A;  3JR5 A;  1Z5B A;  4G4N A;  4DUZ M; 
#chains in the Genus database with same CATH topology
 1IN4 A;  3R8F A;  4Z8X A;  3VK8 A;  3AL0 C;  2AHM A;  5EXX A;  4JI3 M;  3TQS A;  3PNV A;  5ITX E;  2O01 F;  2DVW B;  4NXM M;  3GLI E;  4DV0 M;  2Y0T A;  4GC9 A;  1NNU C;  3MK6 A;  4EIW A;  2QEN A;  3A45 A;  1RU3 A;  2B3T A;  3K1J A;  4Y28 F;  1GJT A;  1AUA A;  2C99 A;  2KHH A;  4L16 A;  3T15 A;  2UUB M;  5FTL A;  2Z7J A;  4IBJ A;  4XBO A;  4ANR A;  1W5T A;  2JXN A;  4LRT A;  1SG9 A;  2MR9 A;  2LVP C;  2HWJ A;  4M9Z A;  1N78 A;  4GKK M;  5FLX S;  1L1Z A;  3SAV A;  4P16 A;  4L8R C;  4QOZ C;  2L4F A;  4CIZ A;  4DR3 M;  1DGH B;  2QCU A;  3VK7 A;  2KNA A;  5FTJ A;  2J5Y A;  3KSX A;  2VDB B;  5KQ8 A;  3L27 A;  2WSC F;  1NV9 A;  3AKZ A;  3MJ5 A;  4KLN A;  3LQQ A;  4AW4 A;  5KPT A;  1QAQ A;  2I7N A;  3JAM S;  1L2B A;  3E46 A;  3I4Y A;  3THG A;  1G8P A;  4NSO B;  2XLJ A;  3HU3 A;  1L2C A;  1X37 A;  3KP0 E;  4XK8 F;  3U60 A;  2F5S A;  1EFU B;  4G6Z A;  3SAR A;  2CUZ A;  1S3S A;  4MM3 B;  2F5N A;  4F2L A;  3VKG A;  2W82 A;  1Z5A A;  2Z4S A;  1HT1 E;  1WGN A;  4PT5 A;  3NBI A;  1E9R A;  2MGW A;  3U5Z B;  4LJ9 A;  2G3Q A;  1NO1 A;  2M5Z A;  1PM5 A;  3DZD A;  1XXH A;  2R44 A;  3GPU A;  2DNA A;  1Z59 A;  1Q3C A;  1D0L A;  2QNJ A;  1R7R A;  2ZM6 M;  2MRO B;  2DZN B;  2F5P A;  2KEB A;  1FJG M;  1KSF X;  3L2A A;  2JY5 A;  3CGW A;  5KPR A;  3CF6 E;  1Q39 A;  3GPX A;  5DYI A;  3U6O A;  1G59 A;  1NHW C;  1YSY A;  2R62 A;  4PDG A;  2CWB A;  2X49 A;  3AV0 A;  3L26 A;  3K8Z A;  1YLA A;  3U6D A;  3HHX A;  5KO3 A;  2C98 A;  5FTK A;  2QBY B;  3DA1 A;  2F5Q A;  3AOG A;  2LVN C;  2VF8 A;  2OO9 A;  1VDL A;  3SAT A;  2NQ8 C;  5ITQ A;  2QBY A;  3D8L A;  4D82 A;  3A42 A;  4S12 A;  1HQC A;  3HHY A;  4CIS A;  1Y8G A;  3TL4 X;  4REZ A;  1T3T A;  3HJQ A;  3GO8 A;  2LBC A;  4JI8 M;  1QZM A;  3J81 S;  4IBF A;  2LVO C;  2G8L A;  3KVW A;  1TH2 A;  2JUJ A;  2K9D A;  2BJV A;  4FVM A;  1R4G A;  1TH3 A;  3MHV C;  2FNA A;  2CEA A;  1JR3 E;  2E5L M;  4DV6 M;  3WHK A;  4MGK E;  3GLF A;  3SMS A;  4GKJ M;  4HEO A;  3SAU A;  2FE8 A;  1J7K A;  3SYL A;  2FS1 A;  2D7G A;  3U5Z A;  1XMQ M;  4PDI A;  1PJQ A;  4B08 A;  2J7N A;  4LF7 M;  3HZJ A;  2QSF X;  2UXC M;  4NOO B;  4B3M M;  3SHF A;  1Z5B A;  4G4N A;  2UUC M;  2JY8 A;  2X4A A;  1IN6 A;  3QAU A;  2JY6 B;  4GIP A;  5BPV A;  3VKH A;  1QYR A;  4HLQ A;  5EP2 A;  1V33 A;  4B7F A;  3A98 B;  2KZU A;  3AOE A;  2LXE A;  4QHS A;  1DGB A;  4YY3 M;  4WUR A;  1OTR A;  3RFW A;  3Q8X A;  2F4V M;  1JR3 D;  1G4A E;  5IZ7 D;  3B7Q A;  4BBA A;  2DAK A;  5ITU A;  2ZTD A;  3FUV A;  4FCW A;  2HAK A;  2LVA A;  1YUB A;  3K92 A;  4UN2 B;  3ZQJ A;  4IBK A;  1HNZ M;  4GHA A;  4FWH A;  2EA0 A;  1V92 A;  2C9O A;  2OOB A;  2MH8 A;  3CF0 A;  4I8O A;  2R0I A;  5LMU M;  1KFV A;  1YE9 A;  5JI2 E;  3DFZ A;  2KRU A;  3T1H M;  3PVS A;  2KNZ A;  5EP1 A;  1GVN A;  1VEK A;  3SYK A;  3PNY A;  3W68 A;  1TGU A;  2YNM D;  4DBG B;  3HGI A;  3I4V A;  1SXJ E;  2O25 A;  4IJF A;  2CV2 A;  4AG6 A;  3AJI B;  2XZU A;  3FYD A;  2GQF A;  3GLF B;  2KNV A;  1NY5 A;  4L78 A;  3RE8 A;  3ZCB B;  2R65 A;  2J7O A;  4PD2 A;  4DUY M;  1MN3 A;  3B89 A;  4G3O A;  1W5S A;  3GQ4 A;  1SXJ A;  4DV1 M;  3SBJ A;  2UUA M;  3GLG E;  2YR0 A;  3W0L B;  2C9C A;  2DAE A;  2FFJ A;  4JN6 A;  4LJ4 A;  1OQY A;  1IN8 A;  1WJ7 A;  3K9P A;  1LV7 A;  3FUW A;  3HY5 A;  4IBC A;  5EP3 A;  3KXE C;  4GH9 A;  3U6Q A;  3TWM A;  2DZL A;  2C96 A;  1GJS A;  1V34 A;  2EKK A;  3EIH A;  1GKI A;  4NXN M;  1R2Z A;  3GLI A;  5FTN A;  3UJN A;  3GLH A;  2X8A A;  2YFQ A;  1XXH E;  1UFZ A;  1DV0 A;  1Q3B A;  2XZF A;  2Y0Q A;  3D8B A;  2HHH M;  1N77 A;  1GLN A;  1SXJ D;  1QAO A;  2Z8Y M;  2R18 A;  3C58 A;  4X65 M;  1HR0 M;  4X66 M;  4JI6 M;  1J09 A;  1EE8 A;  2YQZ A;  2KW0 A;  4R7G A;  3HHZ A;  2R6F A;  3U6C A;  1QUT A;  4LFC M;  2KZS A;  1ZMW A;  1NSF A;  3GP1 A;  1TDZ A;  3FRI A;  2V1U A;  3LCU A;  4B7G A;  3SMP A;  3VLF B;  3HJS A;  3SC3 A;  2VQE M;  4AKH A;  5H37 D;  5C18 A;  3QYE A;  5EJC A;  1E9S A;  1N75 A;  1NV8 A;  2HL7 A;  4RF1 A;  4GHL A;  3U6L A;  3FTE A;  2DKL A;  2LWX A;  3B74 A;  4I81 A;  3KOW E;  3B7N A;  1C7Y A;  3H4M A;  4PCZ A;  4ZPX A;  2XF3 A;  4G4R A;  4LRS A;  4AI6 A;  3TE6 A;  1HJP A;  1VG5 A;  1G41 A;  2L09 A;  2QZ4 A;  3FE3 A;  3J2P B;  3NBX X;  4IBG A;  4M0D A;  4YHH M;  3AOE C;  2I7P A;  4OU7 A;  1IXZ A;  3C3E A;  1WIV A;  3HHW A;  1OJL A;  1WXQ A;  2UXB M;  1JB0 F;  1EIJ A;  3GQ3 A;  1OFH A;  3I04 M;  3JR4 A;  4LF5 M;  2CP8 A;  1GL7 A;  4IBI A;  1DGH A;  5FSW A;  1FNN A;  2BWE A;  3H4J A;  5L8R F;  1NJF A;  4LGY A;  2XFS A;  4QNM A;  1H6U A;  4LFB M;  2XSZ D;  2EKF A;  3SAW A;  2CHQ A;  2C5R A;  3M6A A;  5KQD A;  3J7A S;  2LHG A;  4IBD A;  3IHP A;  1VEJ A;  2Q2E B;  4CJ6 A;  2CV0 A;  3L28 A;  2FOI C;  1ZAE A;  3PFI A;  2F5O A;  3IEC A;  1XWI A;  1ZMU A;  2R4J A;  4DUZ M;  4LF4 M;  3HU1 A;  3J80 S;  3KSJ A;  1NJG A;  2DAG A;  2LHC A;  4LJ8 A;  4FCT A;  4CGY B;  3FTF A;  4DR7 M;  4L6V 6;  4M9S A;  2R45 A;  2V6Z M;  4DV2 M;  3HJ8 A;  3LVV A;  2R4E A;  1HQY E;  4OX9 M;  1QVR A;  1QDR A;  1IXR C;  2JWS A;  1TDH A;  5C1B A;  2DWM A;  3U6M A;  1C1K A;  2L4E A;  3QWL A;  5ITT A;  3MMP A;  3KOX E;  3GRU A;  3L25 A;  5E26 A;  4NC6 A;  1IY1 A;  4Q7J A;  3VDU A;  1IBK M;  1XC8 A;  1QAM A;  3PXG A;  2DWN A;  3LQR A;  4MGZ E;  3A46 A;  1R5L A;  2EO2 A;  1HNX M;  1QQW A;  1UM8 A;  2ZBK B;  3U6S A;  4LZZ A;  2GNO A;  1QUS A;  3EIE A;  2CE7 A;  2KXE A;  2K0B X;  4I5S A;  1QAN A;  4IJE A;  2MJ5 B;  5E6J A;  3FTD A;  2CFO A;  3E9S A;  2Z3X A;  2KDL A;  4X62 M;  1E94 E;  4KHP M;  2JNH A;  3KP1 E;  3FYC A;  3M0E A;  3U60 B;  3I01 M;  3GLH E;  2WSF F;  5GKN A;  3SHG B;  5ITR A;  3BXW A;  2LTU A;  3VFD A;  3CTW B;  4WW0 A;  1IY0 A;  1L2D A;  2EJS A;  2WZJ A;  2QP9 X;  4FWG A;  4MGI E;  1IBM M;  3TWL A;  1NNJ A;  3FUU A;  2XFT A;  4IBB A;  2BJW A;  3K9O A;  3UK6 A;  2RGO A;  2HCB A;  4IBE A;  4RKU F;  4JI0 M;  1R6B X;  1SXJ C;  1E32 A;  4G4Q A;  4I4L A;  5ITX A;  4XGI A;  4NSR A;  4JI4 M;  4WP2 A;  3HWS A;  4JI2 M;  3FUT A;  4II7 A;  4P17 A;  4DR2 M;  2H5X A;  2CHV A;  3HX3 A;  2O5R A;  3B9P A;  3GRV A;  3M7G A;  4LZJ A;  1J5E M;  4NRW A;  4MGY E;  3W0F A;  4NL4 H;  5BR8 M;  1TTE A;  3FUX A;  4LF8 M;  4AQY M;  5LMN M;  1K82 A;  3W67 A;  2UXD M;  5IT9 S;  2RKO A;  2XH9 A;  3KW6 A;  3KFU G;  1CUK A;  1WHC A;  1G71 A;  1BVS A;  3I51 A;  2DZO B;  1OAO C;  2XEP A;  4BB9 A;  1N33 M;  4B3S M;  2VII A;  4LCB A;  4DV4 M;  5IWA M;  1PJJ A;  1VQ1 A;  4OVZ A;  3T6P A;  2LNH C;  1DGG A;  1IY2 A;  2JP7 A;  4JI1 M;  3FTC A;  3C9P A;  1OFI A;  4JI7 M;  4OVZ B;  8CAT A;  3ZC7 B;  4JV5 M;  1DO0 A;  3Q8G A;  4LJ7 A;  4QNR A;  1KYI A;  2L2D A;  5DFL A;  1Z5C A;  2HKJ A;  2QPA A;  4GEW A;  2L7H A;  4MB7 A;  2DAI A;  2L7I A;  3E4R A;  4QHT A;  5JI3 E;  2ZTC A;  1DGF A;  3WHL A;  2H1R A;  1JQJ C;  4KT0 F;  1QDT A;  5IRE B;  4DR5 M;  4DV7 M;  1VDD A;  3OTO M;  3KOZ E;  3LVW A;  3RGP A;  4JYA M;  2DWZ B;  3KS4 A;  4GMQ A;  1XXH B;  2ZAO A;  5DYG A;  2JZ0 A;  5F3W A;  4RF0 A;  3JR5 A;  2P5T A;  5EP4 A;  1K3W A;  5KPZ A;  3V76 A;  3J7B A;  3AFH A;  1N32 M;  3UMM A;  1K3X A;  3BBZ A;  1XNQ M;  3FRH A;  3UZU A;  2ZAN A;  5A2Q S;  2JZ1 A;  1WGL A;  4K0K M;  1A5T A;  4Z6Y A;  2UU9 M;  1D0M A;  5EXP A;  4LF9 M;  2ERC A;  1N34 M;  1N36 M;  1I4W A;  1PJI A;  4GRI A;  4MH0 E;  2K47 A;  1OAI A;  4R3D A;  1LTM A;  4M9X A;  4A3V B;  4L4U A;  1QZE A;  4B3R M;  2A5Y B;  1WR1 B;  4HL4 A;  3ZH9 B;  1IM2 A;  1Q02 A;  1ORY B;  4X64 M;  4ITQ A;  5DNY A;  4BLC A;  3TPZ A;  1IBL M;  1P3Q Q;  4W5W A;  2N35 A;  3GPP A;  3FD9 A;  4LJ6 A;  2VF7 A;  1PJT A;  2EUC A;  1DO2 A;  2XGN A;  4GIT A;  3ILK A;  1TR8 A;  3NWL A;  4FCV A;  3TWK A;  4DV5 M;  2DHY A;  2Z4R A;  1ZV1 A;  3RGS A;  2JY7 A;  1IN7 A;  4KOD A;  3HKP A;  4MGH A;  3UGJ A;  4DR1 M;  1I94 M;  3T1Y M;  1ZMV A;  1D2N A;  2D7H A;  1MU5 A;  2M60 A;  1D0K A;  3IG8 A;  4B7H A;  2DXI A;  1OIZ A;  2Y21 A;  2QHO B;  3VDP A;  3SAS A;  1G3I A;  2QQ8 A;  1IXS B;  1T6O A;  3GLG A;  3J27 B;  1MX0 A;  1OKS A;  4QOS A;  2DI0 A;  1R2Y A;  1HNW M;  1VEG A;  7CAT A;  2L6O A;  2V1C A;  3E21 A;  1IXS A;  4LFA M;  1XHB A;  2CHG A;  2RRU A;  3GLI B;  3QYB A;  4AKG A;  4DV3 M;  3C3D A;  1T43 A;  3LW5 F;  3T38 A;  2D7E A;  4LF6 M;  1L1T A;  3KDS E;  4LGM A;  4F1I A;  2G5G X;  4LJA A;  5EQT A;  2BNK A;  2KRK A;  3BOS A;  4M0W A;  4KO8 A;  2ZAM A;  2CV1 A;  3CF2 A;  1ZQ9 A;  2OOA A;  2APL A;  4IIW A;  1NY6 A;  3SFZ A;  1F4I A;  4AKI A;  4DR4 M;  4D80 A;  4AZF A;  1GO5 A;  1TH4 A;  1XB2 B;  3DOA A;  5EXT A;  3GRR A;  1PGY A;  3GLF E;  4AG5 A;  4G4O A;  2KA6 B;  5ITY A;  4B3T M;  4TUW A;  2OQ4 A;  2XSZ A;  4R71 A;  1XMO M;  3KS8 A;  3B7Z A;  1SXJ B;  2LH0 A;  3U6E A;  4RNA A;  1XNR M;  2DWL A;  3HU2 A;  4FW9 A;  2WSE F;  1IQP A;  2LVQ D;  4FWD A;  4D81 A;  1MJG M;  3GRY A;  2OPF A;  2DAM A;  2CRU A;  4L15 A;  2JA2 A;  1NVM A;  3LMM A;  1TF0 B;  3IG5 A;  3LCV B;  1PJS A;  3GLG B;  1GL6 A;  2VQF M;  4OW0 A;  4LG2 A;  3GLH B;  3K2L A;  4JI5 M;  2BWB A;  4FD2 A;  4DR6 M;  4LY6 A;  5EXS A;  2DEN A;  2Y20 A;  3U61 A;  1GAB A;  4LJ5 A;  1IFY A;  3GPY A;  1L8Q A;  1HT2 E;  1NHG C;  4CHT B;  2RGH A;  3R9X B;  3F92 A;  3U6P A;  4GC5 A;  1JR3 A;  5FTM A;  3U61 B;  2K6B A;  3KOY E;  2FH0 A;  4JXJ A;  1IN5 A;  1Z6T A;  3L29 A;  2DHR A;  2R46 A;  3FKE A;  3GQ5 A;  1AIP C;  1OIP A;  1PRB A;  4NRV A; 
#chains in the Genus database with same CATH homology
 1IN4 A;  3R8F A;  4Z8X A;  3VK8 A;  3AL0 C;  2AHM A;  5EXX A;  4JI3 M;  3TQS A;  3PNV A;  5ITX E;  2DVW B;  4NXM M;  4DV0 M;  2Y0T A;  4GC9 A;  1NNU C;  3MK6 A;  4EIW A;  2QEN A;  3A45 A;  3K1J A;  2C99 A;  4L16 A;  3T15 A;  2UUB M;  5FTL A;  2Z7J A;  4IBJ A;  4XBO A;  1W5T A;  4LRT A;  1N78 A;  4M9Z A;  4GKK M;  5FLX S;  1L1Z A;  3SAV A;  4P16 A;  4L8R C;  4QOZ C;  4DR3 M;  1DGH B;  2QCU A;  3VK7 A;  5FTJ A;  3KSX A;  5KQ8 A;  3L27 A;  3AKZ A;  3MJ5 A;  4KLN A;  3LQQ A;  4AW4 A;  5KPT A;  1QAQ A;  2I7N A;  3JAM S;  1L2B A;  3I4Y A;  3THG A;  1G8P A;  4NSO B;  2XLJ A;  3HU3 A;  1L2C A;  1X37 A;  3KP0 E;  3U60 A;  2F5S A;  4G6Z A;  3SAR A;  2CUZ A;  1S3S A;  4MM3 B;  2F5N A;  3VKG A;  2W82 A;  1Z5A A;  2Z4S A;  1HT1 E;  4PT5 A;  3NBI A;  1E9R A;  3U5Z B;  4LJ9 A;  2M5Z A;  1PM5 A;  3DZD A;  1XXH A;  3GPU A;  1Z59 A;  1Q3C A;  2ZM6 M;  1R7R A;  2F5P A;  2DZN B;  2KEB A;  1FJG M;  1KSF X;  3L2A A;  5KPR A;  3CF6 E;  1Q39 A;  3GPX A;  5DYI A;  3U6O A;  1G59 A;  1NHW C;  1YSY A;  2R62 A;  4PDG A;  2X49 A;  3AV0 A;  3L26 A;  3K8Z A;  3U6D A;  3HHX A;  5KO3 A;  2C98 A;  5FTK A;  2QBY B;  3DA1 A;  2F5Q A;  3AOG A;  3SAT A;  2NQ8 C;  5ITQ A;  2QBY A;  3D8L A;  4D82 A;  3A42 A;  4S12 A;  1HQC A;  3HHY A;  4CIS A;  3TL4 X;  4REZ A;  1T3T A;  3HJQ A;  3GO8 A;  4JI8 M;  1QZM A;  3J81 S;  4IBF A;  2G8L A;  3KVW A;  1TH2 A;  2BJV A;  4FVM A;  1TH3 A;  3MHV C;  2FNA A;  2CEA A;  2E5L M;  4DV6 M;  3WHK A;  4MGK E;  3GLF A;  3SMS A;  4GKJ M;  3SAU A;  2FE8 A;  1J7K A;  3SYL A;  2D7G A;  3U5Z A;  1XMQ M;  4PDI A;  4B08 A;  2J7N A;  4LF7 M;  2UXC M;  4NOO B;  4B3M M;  3SHF A;  1Z5B A;  4G4N A;  2UUC M;  2X4A A;  1IN6 A;  3QAU A;  5BPV A;  4GIP A;  3VKH A;  1QYR A;  4HLQ A;  5EP2 A;  4B7F A;  3A98 B;  2KZU A;  3AOE A;  2LXE A;  4QHS A;  1DGB A;  4WUR A;  3RFW A;  2F4V M;  3Q8X A;  1JR3 D;  1G4A E;  5IZ7 D;  4BBA A;  5ITU A;  3FUV A;  4FCW A;  3K92 A;  1YUB A;  1HNZ M;  4IBK A;  4GHA A;  4FWH A;  2EA0 A;  2C9O A;  4I8O A;  3CF0 A;  5LMU M;  1KFV A;  1YE9 A;  5JI2 E;  3DFZ A;  2KRU A;  3T1H M;  3PVS A;  5EP1 A;  1GVN A;  4YY3 M;  3SYK A;  3PNY A;  1TGU A;  2YNM D;  3HGI A;  3I4V A;  1SXJ E;  4IJF A;  2CV2 A;  4AG6 A;  3AJI B;  2XZU A;  3FYD A;  3GLF B;  1NY5 A;  4L78 A;  3RE8 A;  3ZCB B;  2R65 A;  2J7O A;  4PD2 A;  4DUY M;  3GQ4 A;  4DV1 M;  2UUA M;  1W5S A;  1SXJ A;  3SBJ A;  2YR0 A;  3W0L B;  2C9C A;  4JN6 A;  2FFJ A;  4LJ4 A;  1IN8 A;  1LV7 A;  3FUW A;  4IBC A;  5EP3 A;  3KXE C;  4GH9 A;  3U6Q A;  3TWM A;  2C96 A;  3EIH A;  1GKI A;  4NXN M;  1R2Z A;  3GLI A;  5FTN A;  3UJN A;  3GLH A;  2X8A A;  2YFQ A;  1Q3B A;  2XZF A;  2Y0Q A;  3D8B A;  2HHH M;  1N77 A;  1GLN A;  1SXJ D;  1QAO A;  2R18 A;  3C58 A;  4X65 M;  1HR0 M;  4X66 M;  4JI6 M;  1J09 A;  1EE8 A;  2YQZ A;  2KW0 A;  4R7G A;  3HHZ A;  3U6C A;  4LFC M;  2KZS A;  1NSF A;  3GP1 A;  1TDZ A;  2V1U A;  4B7G A;  3SMP A;  3VLF B;  3HJS A;  3SC3 A;  2VQE M;  4AKH A;  5H37 D;  5C18 A;  5EJC A;  1E9S A;  1N75 A;  2HL7 A;  4GHL A;  4RF1 A;  3U6L A;  3FTE A;  2LWX A;  4I81 A;  3KOW E;  3H4M A;  4PCZ A;  4ZPX A;  2XF3 A;  4G4R A;  4LRS A;  4AI6 A;  3TE6 A;  4M0D A;  2L09 A;  1G41 A;  2QZ4 A;  4YHH M;  3J2P B;  4IBG A;  3AOE C;  2I7P A;  4OU7 A;  1IXZ A;  2UXB M;  3HHW A;  1OJL A;  1WXQ A;  3GQ3 A;  1OFH A;  4LF5 M;  3JR4 A;  1GL7 A;  4IBI A;  1DGH A;  5FSW A;  1FNN A;  1NJF A;  4LGY A;  2XFS A;  4QNM A;  1H6U A;  4LFB M;  2XSZ D;  3SAW A;  2C5R A;  2CHQ A;  3M6A A;  5KQD A;  3J7A S;  4IBD A;  2Q2E B;  2CV0 A;  3L28 A;  2FOI C;  1ZAE A;  3PFI A;  2F5O A;  1XWI A;  4DUZ M;  2R4J A;  4LF4 M;  3HU1 A;  3J80 S;  3KSJ A;  1NJG A;  4LJ8 A;  4CGY B;  3FTF A;  4FCT A;  4DR7 M;  4M9S A;  2R45 A;  2V6Z M;  4DV2 M;  3HJ8 A;  3LVV A;  2R4E A;  1HQY E;  4OX9 M;  1QVR A;  5C1B A;  1IXR C;  1TDH A;  2DWM A;  3U6M A;  1C1K A;  3QWL A;  5ITT A;  3KOX E;  3GRU A;  3L25 A;  5E26 A;  1IY1 A;  3VDU A;  1IBK M;  1XC8 A;  1QAM A;  3PXG A;  2DWN A;  3LQR A;  4MGZ E;  3A46 A;  2EO2 A;  1HNX M;  1QQW A;  1UM8 A;  2ZBK B;  3U6S A;  4LZZ A;  3EIE A;  2CE7 A;  2KXE A;  4I5S A;  1QAN A;  4IJE A;  5E6J A;  3FTD A;  2CFO A;  3E9S A;  2Z3X A;  4X62 M;  1E94 E;  4KHP M;  3KP1 E;  3FYC A;  3M0E A;  3U60 B;  3SHG B;  5GKN A;  5ITR A;  3VFD A;  3CTW B;  4WW0 A;  1IY0 A;  1L2D A;  2QP9 X;  4FWG A;  4MGI E;  1IBM M;  3TWL A;  1NNJ A;  3FUU A;  2XFT A;  4IBB A;  2BJW A;  3UK6 A;  2RGO A;  2HCB A;  4IBE A;  4JI0 M;  1R6B X;  1SXJ C;  1E32 A;  4G4Q A;  4I4L A;  5ITX A;  4XGI A;  4NSR A;  4JI4 M;  3HWS A;  4JI2 M;  3FUT A;  4II7 A;  4DR2 M;  1J5E M;  2CHV A;  4NRW A;  2O5R A;  3B9P A;  3GRV A;  3M7G A;  4LZJ A;  4AKG A;  4MGY E;  3W0F A;  4NL4 H;  5BR8 M;  4LF8 M;  3FUX A;  4AQY M;  5LMN M;  1K82 A;  2UXD M;  5IT9 S;  2RKO A;  2XH9 A;  3KW6 A;  3KFU G;  3I51 A;  2DZO B;  4BB9 A;  2XEP A;  1N33 M;  4B3S M;  2VII A;  4LCB A;  4DV4 M;  5IWA M;  1PJJ A;  4OVZ A;  2LNH C;  1DGG A;  1IY2 A;  4JI1 M;  3FTC A;  1OFI A;  4JI7 M;  4OVZ B;  8CAT A;  3ZC7 B;  4JV5 M;  1DO0 A;  4QNR A;  4LJ7 A;  1KYI A;  1Z5C A;  2HKJ A;  2QPA A;  2L7H A;  4MB7 A;  2L7I A;  3E4R A;  4QHT A;  5JI3 E;  1DGF A;  3WHL A;  2H1R A;  1JQJ C;  5IRE B;  4DR5 M;  4DV7 M;  1VDD A;  3OTO M;  3KOZ E;  3LVW A;  3RGP A;  4JYA M;  2DWZ B;  3KS4 A;  4GMQ A;  1XXH B;  2ZAO A;  5DYG A;  5F3W A;  4RF0 A;  3JR5 A;  2P5T A;  5EP4 A;  1K3W A;  5KPZ A;  3J7B A;  3AFH A;  1N32 M;  3UMM A;  1K3X A;  1XNQ M;  3UZU A;  2ZAN A;  5A2Q S;  4K0K M;  4Z6Y A;  2UU9 M;  5EXP A;  4LF9 M;  2ERC A;  1N34 M;  1N36 M;  1I4W A;  1PJI A;  4GRI A;  4MH0 E;  2K47 A;  4R3D A;  4A3V B;  4M9X A;  4L4U A;  4B3R M;  2A5Y B;  4HL4 A;  3ZH9 B;  1IM2 A;  1ORY B;  4X64 M;  4ITQ A;  5DNY A;  4BLC A;  3TPZ A;  1IBL M;  4W5W A;  3GPP A;  3FD9 A;  4LJ6 A;  2EUC A;  4GIT A;  1DO2 A;  2XGN A;  3ILK A;  3NWL A;  4FCV A;  3TWK A;  4DV5 M;  2Z4R A;  3RGS A;  1IN7 A;  4KOD A;  3HKP A;  4MGH A;  3UGJ A;  4DR1 M;  1I94 M;  3T1Y M;  1D2N A;  2D7H A;  1MU5 A;  2M60 A;  3IG8 A;  4B7H A;  2DXI A;  2Y21 A;  3VDP A;  3SAS A;  1G3I A;  1IXS B;  3GLG A;  3J27 B;  1MX0 A;  4QOS A;  1R2Y A;  1HNW M;  7CAT A;  2L6O A;  2V1C A;  4LFA M;  1XHB A;  2CHG A;  3GLI B;  4DV3 M;  3T38 A;  2D7E A;  4LF6 M;  1L1T A;  3KDS E;  4LGM A;  2G5G X;  4LJA A;  5EQT A;  2BNK A;  2KRK A;  3BOS A;  4M0W A;  4KO8 A;  2ZAM A;  2CV1 A;  3CF2 A;  1ZQ9 A;  4IIW A;  1NY6 A;  3SFZ A;  4AKI A;  4DR4 M;  4D80 A;  4AZF A;  1TH4 A;  3DOA A;  5EXT A;  3GRR A;  4AG5 A;  4G4O A;  2KA6 B;  5ITY A;  4B3T M;  4TUW A;  2OQ4 A;  2XSZ A;  3KS8 A;  1XMO M;  1SXJ B;  2LH0 A;  3U6E A;  4RNA A;  1XNR M;  2DWL A;  3HU2 A;  4FW9 A;  1IQP A;  4FWD A;  4D81 A;  3GRY A;  2OPF A;  4L15 A;  2JA2 A;  1NVM A;  3LMM A;  2VQF M;  3IG5 A;  3GLG B;  1GL6 A;  4OW0 A;  4LG2 A;  3GLH B;  3K2L A;  4JI5 M;  4DR6 M;  4FD2 A;  4LY6 A;  5EXS A;  2Y20 A;  3U61 A;  4LJ5 A;  3GPY A;  1L8Q A;  1HT2 E;  1NHG C;  4CHT B;  2RGH A;  3R9X B;  3U6P A;  4GC5 A;  1JR3 A;  5FTM A;  3U61 B;  3KOY E;  4JXJ A;  1IN5 A;  1Z6T A;  3L29 A;  2DHR A;  2R46 A;  3FKE A;  3GQ5 A;  4NRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...