2UUBM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uubM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uubM02
1K82A 4DV6M 4JI1M 4JI4M 2UUAM 3U6LA 3W0FA 3GP1A 3GO8A 4JI3M 2F5OA 3TWMA 1PJJA 1PM5A 3SATA 4LFAM 2OPFA 3U6DA 4G4OA 4B3TM 1XNQM 2F4VM 1R2ZA 1N32M 4JI5M 1R2YA 2ZBKB 1L2CA 4B3MM 3J81S 3A42A 1MX0A 5IT9S 2VQEM 5ITTA 4KHPM 2XZUA 4B3RM 5ITXA 3OTOM 1J5EM 3GQ3A 4JYAM 4DV4M 1HNZM 1TDZA 5IWAM 1IBKM 1FJGM 3C58A 1L2DA 4G4RA 1HNXM 4PDIA 2UXBM 1K3WA 4LF6M 4DV3M 2Q2EB 2UXDM 3J80S 4DUZM 3A45A 4DR3M 4LF5M 4AQYM 2UUBM 1K3XA 5BR8M 5ITRA 2EA0A 5LMNM 4G4QA 4LF7M 4JV5M 1Q39A 4JI0M 1NNJA 5ITUA 4MB7A 4DV0M 1N34M 4YY3M 1Z5AA 1KFVA 2HKJA 3TWKA 2HHHM 4DR1M 3VK7A 1XMQM 4DV2M 4X62M 4PDGA 3T1HM 4LFBM 3SAUA 1XMOM 5ITQA 1I94M 3U6EA 2XZFA 2UUCM 4DV7M 1Z5BA 1L2BA 4JI7M 4NRVA 4B3SM 1XNRM 2F5NA 4JI2M 4G4NA 2F5QA 4OX9M 3DOAA 3GPYA 1MU5A 3SASA 4DR7M 3A46A 1HR0M 3U6PA 1EE8A 4PD2A 3U6CA 5A2QS 3VK8A 4LF8M 5FLXS 4NXNM 4DR2M 3SAWA 3GQ4A 1XC8A 3SARA 4LF4M 4PCZA 1N36M 2UXCM 4NRWA 3GPPA 2VQFM 3T1YM 4X66M 4JI8M 2UU9M 3GPUA 4LFCM 3SAVA 3U6SA 1IBMM 3JR4A 4X65M 1L1ZA 2F5SA 4ITQA 3JAMS 4GKKM 4DR5M 2E5LM 1TDHA 4K0KM 5LMUM 3GQ5A 4DR6M 4CISA 5ITXE 1HNWM 4DV5M 1Q3CA 4X64M 3U6MA 1N33M 4DV1M 4DUYM 5ITYA 3JR5A 1PJIA 4LF9M 3GPXA 2ZM6M 4DR4M 3TWLA 2OQ4A 3U6OA 1L1TA 2F5PA 4NXMM 3SBJA 1Z5CA 4YHHM 4JI6M 3U6QA 1Q3BA 4GKJM 1Z59A 1IBLM 3J7AS
chains in the Genus database with same CATH superfamily
2X8AA 3KXEC 1G3IA 1WIVA 2LTUA 2YR0A 2YQZA 2BJVA 2DI0A 3GLHA 3K92A 3L29A 4MGYE 1IXRC 4D80A 2UUAM 3LVWA 1GKIA 3GP1A 1HQCA 2KHHA 1H6UA 3U5ZA 4L4UA 1VEGA 3NWLA 1VEJA 4GEWA 4LFAM 4F1IA 4AKHA 4G4OA 1JR3E 3IECA 3FUTA 4I8OA 1R2ZA 2CHQA 2K0BX 4IJEA 3KDSE 3DFZA 1IY2A 2LH0A 2ZBKB 4XBOA 5KO3A 3HHZA 2D7EA 2FE8A 2NQ8C 2RKOA 4FWHA 4CJ6A 1OIZA 3GLIE 2XZUA 2BJWA 2LNHC 4FWDA 4REZA 3OTOM 3U61B 1J5EM 4JYAM 1HNZM 1IY0A 1MN3A 2XH9A 4CHTB 4D81A 4P16A 1L2DA 4ZPXA 4G4RA 2DAEA 1HNXM 2B3TA 4I81A 2G3QA 2UXBM 5EP1A 2FNAA 2JA2A 4BBAA 3FD9A 1IN7A 2UXDM 1BVSA 3D8LA 3GRYA 3J7BA 2D7HA 3A45A 3LVVA 4DR3M 4LF5M 3NBXX 2Y20A 4OU7A 1SXJE 1AIPC 1EFUB 2KRKA 1TTEA 5BR8M 2C99A 3C9PA 3KSXA 4G4QA 2JWSA 3HY5A 4LJAA 4MB7A 4CGYB 4YY3M 2HCBA 2HHHM 1YLAA 3WHLA 5KPRA 1IY1A 2L7HA 3KSJA 4FD2A 1CUKA 3VK7A 2DWNA 2KXEA 2CWBA 3L28A 3PNYA 3VFDA 3KFUG 4X62M 3T1HM 1UFZA 1ZV1A 4FCWA 1I94M 3VKHA 3SYLA 1DV0A 2J5YA 3GRRA 4LY6A 2JZ1A 3GLFB 3KW6A 1Z5BA 1L2BA 3Q8XA 4I5SA 2DHRA 2R18A 3IG5A 2KA6B 2LWXA 3CF6E 4G3OA 3SASA 4DR7M 2HL7A 4NSOB 3GLHE 4RNAA 4KLNA 3K9OA 3H4JA 3VK8A 4L16A 3E46A 1DO0A 4LZJA 3FKEA 2CHVA 2D7GA 2OOBA 2R62A 3HJQA 4EIWA 2UXCM 2XF3A 2CEAA 4FW9A 1G4AE 3VDUA 1Q02A 3W68A 2DXIA 1IN5A 2LVAA 1T6OA 4LG2A 3I51A 1C1KA 1QZEA 3AOGA 4GRIA 3SFZA 3VDPA 2V1CA 2Z4RA 1XXHA 3HHXA 4ITQA 3NBIA 4GKKM 2ZAOA 4AG6A 1E9SA 4K0KM 4M9XA 5LMUM 1IN8A 1HJPA 2R4JA 4M9ZA 3VKGA 1F4IA 2R4EA 1PJSA 3IG8A 1Q3CA 4R71A 5IZ7D 4X64M 4M0DA 3PFIA 3RGSA 4MGZE 3J2PB 4NSRA 2G5GX 2JUJA 1DGGA 3MMPA 3MJ5A 4OVZB 4WURA 4XGIA 2JNHA 2L4FA 4HL4A 1TH3A 2EKKA 5DYGA 1Q3BA 3TE6A 2KNVA 1Z59A 1OKSA 1NVMA 1OFIA 3J7AS 4GKJM 4M9SA 4DV6M 4JI4M 1NV8A 4HEOA 1L8QA 2C9CA 1DGFA 3H4MA 2LVQD 4LJ8A 3T6PA 2K9DA 4JI3M 5C1BA 5E26A 3TWMA 1PJJA 3U61A 3BOSA 5EXTA 2F4VM 5EQTA 2Y0QA 3E9SA 1GJSA 3KVWA 1N32M 2KNAA 1AUAA 1ORYB 3KOWE 4JI5M 1GL7A 1WJ7A 1NJGA 2BWBA 4FVMA 2EJSA 1L2CA 3J81S 3A42A 3GRUA 4IBEA 1OFHA 2EO2A 2ERCA 4KHPM 3B7ZA 4B3RM 5ITXA 2Z3XA 1PRBA 2QHOB 3GQ3A 3VLFB 2DWMA 2EKFA 2QENA 3FE3A 2J7NA 4GH9A 2LHGA 4FWGA 2FS1A 1IBKM 1MJGM 4FCTA 1EIJA 5FTNA 1XHBA 2G8LA 3FYDA 1V92A 4PDIA 2I7NA 2RGHA 4OW0A 1K3WA 4LF6M 5KQDA 2CV2A 4P17A 2L2DA 3K2LA 2HWJA 1GJTA 1TF0B 2L7IA 1QAMA 2KEBA 5BPVA 2EA0A 4JV5M 2R65A 4MM3B 3CGWA 1OIPA 3AKZA 1Q39A 1QANA 3MHVC 1WHCA 4QHSA 1NY5A 1J7KA 1XXHE 3UK6A 3GLFA 5DNYA 4DV0M 3SMPA 3SYKA 1KFVA 3TWKA 5FTKA 3ILKA 1YSYA 3L27A 3SMSA 1R6BX 2ZAMA 2R0IA 3FTCA 3Q8GA 1T3TA 3GRVA 3HU1A 3C3DA 1VEKA 3B74A 1XNRM 4B7GA 3AJIB 3K9PA 2F5NA 4MH0E 3ZQJA 1NSFA 3K8ZA 4G4NA 2F5QA 3KOZE 1DGHB 2XFSA 1MU5A 3DOAA 1TH2A 4KODA 3U6PA 4LCBA 3FTDA 1X37A 1QAQA 5FLXS 4NXNM 1IXSA 3SARA 2MR9A 2H5XA 1XC8A 2WSEF 4NRWA 3GPPA 2VQFM 1N77A 1LV7A 4GHAA 2Z4SA 2QP9X 4GC5A 4FCVA 2KZUA 5EXSA 2QBYA 4X65M 1WR1B 1ZMWA 4OVZA 1N78A 5EP4A 4MGKE 2LBCA 3BXWA 1R7RA 3JAMS 2JP7A 4DR5M 3AL0C 1TR8A 2CP8A 4CISA 1QAOA 3CF0A 5ITXE 4M0WA 3B89A 4TUWA 3E21A 4DV1M 3FUXA 4I4LA 1DGBA 4L15A 4GMQA 5C18A 2DZOB 2DZLA 1IXZA 4RF1A 4LF9M 2XEPA 3KS8A 4Y28F 2XLJA 4DR4M 1G8PA 2ZTCA 2F5PA 4NXMM 4UN2B 4LJ4A 3SBJA 3UJNA 3HHYA 4AKGA 2L4EA 1QYRA 1E9RA 1IBLM 1Y8GA 1K82A 4JI1M 1G71A 2CRUA 3U6LA 3KP0E 3I4VA 1UM8A 4JN6A 3GLFE 4AI6A 2V6ZM 1FNNA 2Y0TA 3C3EA 3FRIA 1VG5A 2MGWA 4F2LA 1PM5A 1TGUA 3SATA 2LVNC 2DHYA 1SG9A 1XNQM 5FTMA 2VF7A 1NV9A 3GLGA 1NJFA 2QNJA 1R2YA 2FOIC 4B3MM 1MX0A 2VQEM 2K47A 2RRUA 4R7GA 1NHWC 1KYIA 3LCVB 4DV4M 4ANRA 4QNMA 1OJLA 1V34A 5IWAM 3AFHA 2R6FA 1FJGM 4IBJA 3AOEC 1HQYE 1S3SA 1WXQA 1D0KA 3D8BA 2M5ZA 4IBDA 1Z6TA 2Q2EB 1N75A 2JXNA 4IBKA 4DV3M 7CATA 1QUTA 4AQYM 3QYBA 4AW4A 1G59A 5ITRA 5LMNM 1R4GA 3RE8A 4CIZA 3DA1A 4GITA 4LJ9A 1GL6A 1QDRA 3HJ8A 1IN6A 5F3WA 2M60A 4KO8A 2Z7JA 4S12A 1Z5AA 3M0EA 1NY6A 3KOXE 4LGYA 1NO1A 2O25A 1XMQM 1DGHA 3LW5F 5KPTA 3HKPA 4DV2M 3B7QA 4LZZA 4D82A 3SAUA 3FUUA 1PJTA 5ITQA 2XZFA 1XMOM 1KSFX 1D0LA 2H1RA 2XGNA 1QZMA 4II7A 1IN4A 2O5RA 1DO2A 1XWIA 3LQRA 3B9PA 1NNUC 3L26A 4WP2A 4NRVA 1NHGC 2DWZB 2K6BA 4JI7M 4JI2M 3U60B 1HT1E 5EP3A 2JY5A 3HJSA 3AV0A 4GC9A 3GPYA 2YFQA 1HR0M 4LJ5A 2XFTA 4QOSA 1EE8A 2MROB 1ZQ9A 4MGIE 3TPZA 1E32A 1XB2B 1XXHB 2KDLA 1WGNA 2JY6B 2APLA 4DR2M 3GQ4A 2KNZA 4PCZA 2N35A 4LF4M 3T1YM 2P5TA 4W5WA 3LCUA 3MK6A 3GLIB 1QVRA 3GLGE 3GPUA 3SC3A 2BNKA 4GIPA 3LQQA 1L1ZA 2F5SA 3HWSA 4QHTA 2DAMA 2L6OA 4DBGB 3L25A 3SHFA 1TDHA 2OOAA 1OQYA 2KZSA 1OAIA 2R46A 2DENA 1HNWM 3CTWB 4WW0A 4AKIA 5EJCA 3U6MA 2QSFX 1SXJB 4DUYM 1IFYA 3THGA 3M6AA 4LJ6A 2J7OA 2QCUA 5EXXA 5ITYA 3AOEA 2FH0A 1PJIA 2DKLA 3T38A 3V76A 1GABA 1JR3D 2GQFA 2Y21A 1YE9A 3IHPA 4IBIA 5E6JA 3ZCBB 1L1TA 4R3DA 2KRUA 1JQJC 3U6QA 2ZANA 4BB9A 4IBCA 2CHGA 2OO9A 2A5YB 1RU3A 2MH8A 2I7PA 4RKUF 3SHGB 1C7YA 3QWLA 2CV0A 5EXPA 1ZAEA 2VDBB 3E4RA 3W0FA 4RF0A 1WGLA 3QAUA 3GO8A 2F5OA 2MJ5B 3KOYE 4A3VB 3PXGA 2OPFA 4B7HA 3U6DA 4B3TM 4G6ZA 3EIEA 1SXJC 3HGIA 5FTJA 1W5SA 1T43A 3DZDA 4NOOB 3TQSA 5JI3E 2RGOA 1QUSA 2CUZA 3GLHB 3FYCA 2VIIA 1SXJD 5IT9S 1D2NA 4AZFA 2L09A 2XSZD 2C5RA 3U5ZB 3HX3A 5ITTA 5GKNA 4LGMA 3B7NA 4B08A 2C96A 2YNMD 8CATA 2QQ8A 1PGYA 1TDZA 1QQWA 3C58A 3ZC7B 1GVNA 3FRHA 4IIWA 3W0LB 3FTFA 3BBZA 3J80S 4LJ7A 4DUZM 5FTLA 2UUBM 4XK8F 3J27B 1I4WA 2LXEA 1K3XA 3FTEA 2X49A 3FUWA 2DNAA 5EP2A 4BLCA 5KPZA 5L8RF 2FFJA 4LF7M 3A98B 4JI0M 3ZH9B 1NNJA 3CF2A 5ITUA 3PVSA 2BWEA 3R9XB 1N34M 3HZJA 3I04M 2DZNB 2HKJA 2O01F 2WSCF 3FUVA 3PNVA 4NL4H 3U60A 2GNOA 4DR1M 1JR3A 4IBBA 3K1JA 5JI2E 4PDGA 4Z6YA 2V1UA 3HHWA 1P3QQ 4LFBM 3U6EA 1JB0F 2DAIA 2UUCM 1ZMVA 2AHMA 1VDLA 5DYIA 2C98A 3UGJA 3WHKA 4DV7M 1A5TA 1IXSB 1VQ1A 2R45A 3R8FA 3GLIA 4B3SM 1ZMUA 3KS4A 1W5TA 4Q7JA 1PJQA 3F92A 4L8RC 1GLNA 4OX9M 2CFOA 2LHCA 4L78A 5FSWA 3A46A 2QBYB 3M7GA 4PD2A 5IREB 4MGHA 1IQPA 3UMMA 5A2QS 5DFLA 3U6CA 4Z8XA 2DAGA 2VF8A 4LF8M 4QOZC 3SAWA 4JXJA 3EIHA 4B7FA 1N36M 1V33A 2X4AA 1R5LA 3LMMA 4NC6A 4QNRA 1TH4A 3RFWA 3TL4X 4X66M 4JI8M 2UU9M 4IJFA 1SXJA 2DWLA 4LFCM 3SAVA 1OAOC 2XSZA 3U6SA 2LVOC 1IBMM 1IM2A 3JR4A 2QZ4A 2CV1A 2WSFF 3KP1E 4KT0F 4IBFA 2LVPC 3I4YA 3W67A 2E5LM 2HAKA 1J09A 1OTRA 1YUBA 3L2AA 3GQ5A 4DR6M 2Z8YM 1GO5A 2DAKA 2DVWB 4L6V6 4DV5M 2EUCA 3QYEA 2JY8A 3HU3A 4PT5A 3T15A 1N33M 2JY7A 2QPAA 3UZUA 1D0MA 2CE7A 2R44A 3HU2A 1LTMA 5KQ8A 3JR5A 1VDDA 1QDTA 2KW0A 2W82A 3I01M 2WZJA 3GPXA 2JZ0A 4AG5A 2ZM6M 3TWLA 2C9OA 2OQ4A 3U6OA 4LRSA 4GHLA 3RGPA 1E94E 1Z5CA 5H37D 1HT2E 4YHHM 4JI6M 4HLQA 1G41A 2ZTDA 4LRTA 4IBGA 3GLGB
chains in the Genus database with same CATH topology
2X8AA 3KXEC 1G3IA 3L29A 2YR0A 2YQZA 2BJVA 3K92A 3GLHA 4D80A 4MGYE 1IXRC 2UUAM 3LVWA 1GKIA 3GP1A 1HQCA 1H6UA 3U5ZA 4L4UA 3NWLA 4AKHA 4LFAM 4G4OA 4I8OA 3FUTA 1R2ZA 2CHQA 4IJEA 3KDSE 3DFZA 1IY2A 2LH0A 2ZBKB 4XBOA 5KO3A 3HHZA 2D7EA 2FE8A 2NQ8C 2RKOA 4FWHA 2XZUA 2BJWA 2LNHC 4FWDA 4REZA 3OTOM 3U61B 1J5EM 4JYAM 1HNZM 1IY0A 2XH9A 4CHTB 4D81A 4P16A 1L2DA 4ZPXA 4G4RA 1HNXM 2UXBM 4I81A 5EP1A 2FNAA 2JA2A 4BBAA 3FD9A 1IN7A 2UXDM 3D8LA 3GRYA 3J7BA 2D7HA 3A45A 3LVVA 4DR3M 4LF5M 2Y20A 4OU7A 1SXJE 2KRKA 5BR8M 2C99A 3KSXA 4G4QA 4LJAA 4MB7A 4CGYB 4YY3M 2HCBA 2HHHM 3WHLA 5KPRA 1IY1A 2L7HA 3KSJA 4FD2A 3VK7A 2KXEA 3L28A 3PNYA 3VFDA 3KFUG 4X62M 3T1HM 4FCWA 1I94M 3VKHA 3SYLA 3GRRA 4LY6A 3GLFB 3KW6A 1Z5BA 1L2BA 3Q8XA 4I5SA 2DHRA 2R18A 3IG5A 2KA6B 2LWXA 3CF6E 3SASA 4DR7M 2HL7A 4NSOB 4RNAA 4KLNA 3VK8A 4L16A 1DO0A 4LZJA 3FKEA 2CHVA 2D7GA 2R62A 3HJQA 4EIWA 2UXCM 2XF3A 2CEAA 4FW9A 1G4AE 3VDUA 2DXIA 1IN5A 4LG2A 3I51A 1C1KA 3AOGA 4GRIA 3SFZA 3VDPA 2V1CA 2Z4RA 1XXHA 3HHXA 4ITQA 3NBIA 4GKKM 2ZAOA 4AG6A 1E9SA 4K0KM 4M9XA 5LMUM 1IN8A 4M9ZA 2R4JA 3VKGA 2R4EA 3IG8A 1Q3CA 5IZ7D 4X64M 4M0DA 3PFIA 3RGSA 4MGZE 3J2PB 4NSRA 2G5GX 4OVZB 1DGGA 4XGIA 3MJ5A 4WURA 4HL4A 1TH3A 5DYGA 1Q3BA 3TE6A 4GKJM 1Z59A 1NVMA 1OFIA 3J7AS 4M9SA 4DV6M 4JI4M 1L8QA 2C9CA 1DGFA 3H4MA 4LJ8A 4JI3M 5C1BA 5E26A 3TWMA 1PJJA 3U61A 3BOSA 5EXTA 2F4VM 5EQTA 2Y0QA 3E9SA 3KVWA 1N32M 1ORYB 3KOWE 4JI5M 1GL7A 4FVMA 1NJGA 1L2CA 3J81S 3A42A 3GRUA 4IBEA 1OFHA 2EO2A 2ERCA 4KHPM 4B3RM 5ITXA 2Z3XA 3GQ3A 3VLFB 2DWMA 2QENA 2J7NA 4GH9A 4FWGA 1IBKM 4FCTA 5FTNA 1XHBA 2G8LA 3FYDA 4PDIA 2I7NA 2RGHA 4OW0A 1K3WA 4LF6M 5KQDA 2CV2A 3K2LA 2L7IA 1QAMA 2KEBA 5BPVA 2EA0A 4JV5M 2R65A 4MM3B 3AKZA 1Q39A 1QANA 3MHVC 4QHSA 1NY5A 1J7KA 3UK6A 3GLFA 5DNYA 4DV0M 3SMPA 3SYKA 1KFVA 3TWKA 5FTKA 3ILKA 1YSYA 3L27A 3SMSA 1R6BX 2ZAMA 3FTCA 1T3TA 3GRVA 3HU1A 1XNRM 4B7GA 3AJIB 2F5NA 4MH0E 1NSFA 3K8ZA 4G4NA 2F5QA 3KOZE 1DGHB 2XFSA 1MU5A 3DOAA 1TH2A 4KODA 3U6PA 4LCBA 3FTDA 1X37A 1QAQA 5FLXS 4NXNM 3SARA 1XC8A 4NRWA 3GPPA 2VQFM 1N77A 1LV7A 4GHAA 2Z4SA 2QP9X 4GC5A 4FCVA 2KZUA 5EXSA 2QBYA 4X65M 1N78A 4OVZA 5EP4A 4MGKE 1R7RA 3JAMS 4DR5M 3AL0C 4CISA 1QAOA 3CF0A 5ITXE 4M0WA 4TUWA 4DV1M 3FUXA 4I4LA 1DGBA 4L15A 4GMQA 5C18A 2DZOB 1IXZA 4RF1A 4LF9M 2XEPA 3KS8A 2XLJA 4DR4M 1G8PA 2F5PA 4NXMM 4LJ4A 3SBJA 3UJNA 3HHYA 4AKGA 1E9RA 1QYRA 1IBLM 1K82A 4JI1M 3U6LA 3KP0E 3I4VA 1UM8A 4JN6A 4AI6A 2V6ZM 1FNNA 2Y0TA 1PM5A 3SATA 1TGUA 1XNQM 5FTMA 3GLGA 1NJFA 1R2YA 2FOIC 4B3MM 1MX0A 2VQEM 2K47A 4R7GA 1NHWC 1KYIA 4DV4M 4QNMA 1OJLA 5IWAM 3AFHA 1FJGM 4IBJA 3AOEC 1HQYE 1S3SA 1WXQA 4IBDA 3D8BA 2M5ZA 1Z6TA 2Q2EB 1N75A 4IBKA 4DV3M 7CATA 4AQYM 4AW4A 1G59A 5ITRA 5LMNM 3RE8A 3DA1A 4GITA 4LJ9A 1GL6A 3HJ8A 1IN6A 5F3WA 2M60A 4KO8A 2Z7JA 4S12A 1Z5AA 3M0EA 1NY6A 3KOXE 4LGYA 1XMQM 1DGHA 5KPTA 3HKPA 4DV2M 4LZZA 4D82A 3SAUA 3FUUA 5ITQA 1XMOM 2XZFA 2DWNA 1KSFX 2H1RA 2XGNA 4II7A 1QZMA 1IN4A 2O5RA 1DO2A 1XWIA 3LQRA 3B9PA 1NNUC 3L26A 4JI7M 4NRVA 1NHGC 2DWZB 4JI2M 3U60B 1HT1E 5EP3A 3HJSA 3AV0A 4GC9A 3GPYA 2YFQA 1HR0M 4LJ5A 2XFTA 4QOSA 1EE8A 1ZQ9A 4MGIE 3TPZA 1E32A 1XXHB 4DR2M 3GQ4A 4LF4M 4PCZA 3T1YM 2P5TA 4W5WA 3MK6A 3GLIB 1QVRA 3GPUA 3SC3A 2BNKA 4GIPA 3LQQA 1L1ZA 2F5SA 3HWSA 4QHTA 2L6OA 3L25A 3SHFA 1TDHA 2KZSA 2R46A 1HNWM 3CTWB 4WW0A 4AKIA 5EJCA 3U6MA 1SXJB 4DUYM 3THGA 3M6AA 4LJ6A 2J7OA 2QCUA 5EXXA 5ITYA 3AOEA 1PJIA 3T38A 1JR3D 2Y21A 1YE9A 5E6JA 4IBIA 3ZCBB 1L1TA 4R3DA 2KRUA 1JQJC 3U6QA 2ZANA 4BB9A 4IBCA 2CHGA 2A5YB 3SHGB 2I7PA 3QWLA 2CV0A 5EXPA 1ZAEA 3E4RA 3W0FA 4RF0A 3QAUA 3GO8A 2F5OA 3KOYE 4A3VB 3PXGA 2OPFA 4B7HA 3U6DA 4B3TM 4G6ZA 3EIEA 1SXJC 3HGIA 5FTJA 1W5SA 3DZDA 4NOOB 3TQSA 5JI3E 2RGOA 2CUZA 3GLHB 3FYCA 2VIIA 1SXJD 5IT9S 1D2NA 4AZFA 2L09A 2XSZD 2C5RA 3U5ZB 5ITTA 5GKNA 4LGMA 4B08A 2C96A 2YNMD 8CATA 1TDZA 1QQWA 3C58A 3ZC7B 1GVNA 4IIWA 3W0LB 3FTFA 3J80S 4LJ7A 4DUZM 5FTLA 2UUBM 3J27B 1I4WA 2LXEA 1K3XA 3FTEA 2X49A 3FUWA 5EP2A 4BLCA 5KPZA 4LF7M 2FFJA 3A98B 4JI0M 3ZH9B 1NNJA 3CF2A 5ITUA 3PVSA 1N34M 2DZNB 2HKJA 4NL4H 3FUVA 3PNVA 3U60A 4DR1M 1JR3A 4IBBA 3K1JA 5JI2E 4PDGA 4Z6YA 2V1UA 3HHWA 4LFBM 3U6EA 2UUCM 2AHMA 5DYIA 2C98A 3UGJA 3WHKA 4DV7M 1IXSB 3R8FA 2R45A 3GLIA 4B3SM 3KS4A 1W5TA 4L8RC 4OX9M 1GLNA 2CFOA 4L78A 3A46A 5FSWA 2QBYB 3M7GA 4PD2A 5IREB 4MGHA 1IQPA 3UMMA 5A2QS 3U6CA 4LF8M 4Z8XA 4QOZC 3SAWA 4JXJA 3EIHA 4B7FA 1N36M 2X4AA 3LMMA 4QNRA 1TH4A 3RFWA 3TL4X 4X66M 4JI8M 2UU9M 4IJFA 1SXJA 2DWLA 4LFCM 3SAVA 3U6SA 2XSZA 1IBMM 2CV1A 1IM2A 3JR4A 2QZ4A 3KP1E 4IBFA 3I4YA 2E5LM 1J09A 3L2AA 1YUBA 3GQ5A 4DR6M 2DVWB 4DV5M 2EUCA 4PT5A 3HU3A 3T15A 1N33M 2QPAA 3UZUA 2CE7A 3HU2A 5KQ8A 3JR5A 1VDDA 2KW0A 3GPXA 2W82A 4AG5A 2ZM6M 3TWLA 2C9OA 2OQ4A 3U6OA 4LRSA 4GHLA 3RGPA 1E94E 1Z5CA 5H37D 1HT2E 4YHHM 4JI6M 4HLQA 1G41A 4LRTA 3R9XB 4IBGA 3GLGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K82 A;  4DV6 M;  4JI1 M;  4JI4 M;  2UUA M;  3U6L A;  3W0F A;  3GP1 A;  3GO8 A;  4JI3 M;  2F5O A;  3TWM A;  1PJJ A;  1PM5 A;  3SAT A;  4LFA M;  2OPF A;  3U6D A;  4G4O A;  4B3T M;  1XNQ M;  2F4V M;  1R2Z A;  1N32 M;  4JI5 M;  1R2Y A;  2ZBK B;  1L2C A;  4B3M M;  3J81 S;  3A42 A;  1MX0 A;  5IT9 S;  2VQE M;  5ITT A;  4KHP M;  2XZU A;  4B3R M;  5ITX A;  3OTO M;  1J5E M;  3GQ3 A;  4JYA M;  4DV4 M;  1HNZ M;  1TDZ A;  5IWA M;  1IBK M;  1FJG M;  3C58 A;  1L2D A;  4G4R A;  1HNX M;  4PDI A;  2UXB M;  1K3W A;  4LF6 M;  4DV3 M;  2Q2E B;  2UXD M;  3J80 S;  4DUZ M;  3A45 A;  4DR3 M;  4LF5 M;  4AQY M;  2UUB M;  1K3X A;  5BR8 M;  5ITR A;  2EA0 A;  5LMN M;  4G4Q A;  4LF7 M;  4JV5 M;  1Q39 A;  4JI0 M;  1NNJ A;  5ITU A;  4MB7 A;  4DV0 M;  1N34 M;  4YY3 M;  1Z5A A;  1KFV A;  2HKJ A;  3TWK A;  2HHH M;  4DR1 M;  3VK7 A;  1XMQ M;  4DV2 M;  4X62 M;  4PDG A;  3T1H M;  4LFB M;  3SAU A;  1XMO M;  5ITQ A;  1I94 M;  3U6E A;  2XZF A;  2UUC M;  4DV7 M;  1Z5B A;  1L2B A;  4JI7 M;  4NRV A;  4B3S M;  1XNR M;  2F5N A;  4JI2 M;  4G4N A;  2F5Q A;  4OX9 M;  3DOA A;  3GPY A;  1MU5 A;  3SAS A;  4DR7 M;  3A46 A;  1HR0 M;  3U6P A;  1EE8 A;  4PD2 A;  3U6C A;  5A2Q S;  3VK8 A;  4LF8 M;  5FLX S;  4NXN M;  4DR2 M;  3SAW A;  3GQ4 A;  1XC8 A;  3SAR A;  4LF4 M;  4PCZ A;  1N36 M;  2UXC M;  4NRW A;  3GPP A;  2VQF M;  3T1Y M;  4X66 M;  4JI8 M;  2UU9 M;  3GPU A;  4LFC M;  3SAV A;  3U6S A;  1IBM M;  3JR4 A;  4X65 M;  1L1Z A;  2F5S A;  4ITQ A;  3JAM S;  4GKK M;  4DR5 M;  2E5L M;  1TDH A;  4K0K M;  5LMU M;  3GQ5 A;  4DR6 M;  4CIS A;  5ITX E;  1HNW M;  4DV5 M;  1Q3C A;  4X64 M;  3U6M A;  1N33 M;  4DV1 M;  4DUY M;  5ITY A;  3JR5 A;  1PJI A;  4LF9 M;  3GPX A;  2ZM6 M;  4DR4 M;  3TWL A;  2OQ4 A;  3U6O A;  1L1T A;  2F5P A;  4NXM M;  3SBJ A;  1Z5C A;  4YHH M;  4JI6 M;  3U6Q A;  1Q3B A;  4GKJ M;  1Z59 A;  1IBL M;  3J7A S; 
#chains in the Genus database with same CATH topology
 2X8A A;  3KXE C;  1G3I A;  1WIV A;  2LTU A;  2YR0 A;  2YQZ A;  2BJV A;  2DI0 A;  3GLH A;  3K92 A;  3L29 A;  4MGY E;  1IXR C;  4D80 A;  2UUA M;  3LVW A;  1GKI A;  3GP1 A;  1HQC A;  2KHH A;  1H6U A;  3U5Z A;  4L4U A;  1VEG A;  3NWL A;  1VEJ A;  4GEW A;  4LFA M;  4F1I A;  4AKH A;  4G4O A;  1JR3 E;  3IEC A;  3FUT A;  4I8O A;  1R2Z A;  2CHQ A;  2K0B X;  4IJE A;  3KDS E;  3DFZ A;  1IY2 A;  2LH0 A;  2ZBK B;  4XBO A;  5KO3 A;  3HHZ A;  2D7E A;  2FE8 A;  2NQ8 C;  2RKO A;  4FWH A;  4CJ6 A;  1OIZ A;  3GLI E;  2XZU A;  2BJW A;  2LNH C;  4FWD A;  4REZ A;  3OTO M;  3U61 B;  1J5E M;  4JYA M;  1HNZ M;  1IY0 A;  1MN3 A;  2XH9 A;  4CHT B;  4D81 A;  4P16 A;  1L2D A;  4ZPX A;  4G4R A;  2DAE A;  1HNX M;  2B3T A;  4I81 A;  2G3Q A;  2UXB M;  5EP1 A;  2FNA A;  2JA2 A;  4BBA A;  3FD9 A;  1IN7 A;  2UXD M;  1BVS A;  3D8L A;  3GRY A;  3J7B A;  2D7H A;  3A45 A;  3LVV A;  4DR3 M;  4LF5 M;  3NBX X;  2Y20 A;  4OU7 A;  1SXJ E;  1AIP C;  1EFU B;  2KRK A;  1TTE A;  5BR8 M;  2C99 A;  3C9P A;  3KSX A;  4G4Q A;  2JWS A;  3HY5 A;  4LJA A;  4MB7 A;  4CGY B;  4YY3 M;  2HCB A;  2HHH M;  1YLA A;  3WHL A;  5KPR A;  1IY1 A;  2L7H A;  3KSJ A;  4FD2 A;  1CUK A;  3VK7 A;  2DWN A;  2KXE A;  2CWB A;  3L28 A;  3PNY A;  3VFD A;  3KFU G;  4X62 M;  3T1H M;  1UFZ A;  1ZV1 A;  4FCW A;  1I94 M;  3VKH A;  3SYL A;  1DV0 A;  2J5Y A;  3GRR A;  4LY6 A;  2JZ1 A;  3GLF B;  3KW6 A;  1Z5B A;  1L2B A;  3Q8X A;  4I5S A;  2DHR A;  2R18 A;  3IG5 A;  2KA6 B;  2LWX A;  3CF6 E;  4G3O A;  3SAS A;  4DR7 M;  2HL7 A;  4NSO B;  3GLH E;  4RNA A;  4KLN A;  3K9O A;  3H4J A;  3VK8 A;  4L16 A;  3E46 A;  1DO0 A;  4LZJ A;  3FKE A;  2CHV A;  2D7G A;  2OOB A;  2R62 A;  3HJQ A;  4EIW A;  2UXC M;  2XF3 A;  2CEA A;  4FW9 A;  1G4A E;  3VDU A;  1Q02 A;  3W68 A;  2DXI A;  1IN5 A;  2LVA A;  1T6O A;  4LG2 A;  3I51 A;  1C1K A;  1QZE A;  3AOG A;  4GRI A;  3SFZ A;  3VDP A;  2V1C A;  2Z4R A;  1XXH A;  3HHX A;  4ITQ A;  3NBI A;  4GKK M;  2ZAO A;  4AG6 A;  1E9S A;  4K0K M;  4M9X A;  5LMU M;  1IN8 A;  1HJP A;  2R4J A;  4M9Z A;  3VKG A;  1F4I A;  2R4E A;  1PJS A;  3IG8 A;  1Q3C A;  4R71 A;  5IZ7 D;  4X64 M;  4M0D A;  3PFI A;  3RGS A;  4MGZ E;  3J2P B;  4NSR A;  2G5G X;  2JUJ A;  1DGG A;  3MMP A;  3MJ5 A;  4OVZ B;  4WUR A;  4XGI A;  2JNH A;  2L4F A;  4HL4 A;  1TH3 A;  2EKK A;  5DYG A;  1Q3B A;  3TE6 A;  2KNV A;  1Z59 A;  1OKS A;  1NVM A;  1OFI A;  3J7A S;  4GKJ M;  4M9S A;  4DV6 M;  4JI4 M;  1NV8 A;  4HEO A;  1L8Q A;  2C9C A;  1DGF A;  3H4M A;  2LVQ D;  4LJ8 A;  3T6P A;  2K9D A;  4JI3 M;  5C1B A;  5E26 A;  3TWM A;  1PJJ A;  3U61 A;  3BOS A;  5EXT A;  2F4V M;  5EQT A;  2Y0Q A;  3E9S A;  1GJS A;  3KVW A;  1N32 M;  2KNA A;  1AUA A;  1ORY B;  3KOW E;  4JI5 M;  1GL7 A;  1WJ7 A;  1NJG A;  2BWB A;  4FVM A;  2EJS A;  1L2C A;  3J81 S;  3A42 A;  3GRU A;  4IBE A;  1OFH A;  2EO2 A;  2ERC A;  4KHP M;  3B7Z A;  4B3R M;  5ITX A;  2Z3X A;  1PRB A;  2QHO B;  3GQ3 A;  3VLF B;  2DWM A;  2EKF A;  2QEN A;  3FE3 A;  2J7N A;  4GH9 A;  2LHG A;  4FWG A;  2FS1 A;  1IBK M;  1MJG M;  4FCT A;  1EIJ A;  5FTN A;  1XHB A;  2G8L A;  3FYD A;  1V92 A;  4PDI A;  2I7N A;  2RGH A;  4OW0 A;  1K3W A;  4LF6 M;  5KQD A;  2CV2 A;  4P17 A;  2L2D A;  3K2L A;  2HWJ A;  1GJT A;  1TF0 B;  2L7I A;  1QAM A;  2KEB A;  5BPV A;  2EA0 A;  4JV5 M;  2R65 A;  4MM3 B;  3CGW A;  1OIP A;  3AKZ A;  1Q39 A;  1QAN A;  3MHV C;  1WHC A;  4QHS A;  1NY5 A;  1J7K A;  1XXH E;  3UK6 A;  3GLF A;  5DNY A;  4DV0 M;  3SMP A;  3SYK A;  1KFV A;  3TWK A;  5FTK A;  3ILK A;  1YSY A;  3L27 A;  3SMS A;  1R6B X;  2ZAM A;  2R0I A;  3FTC A;  3Q8G A;  1T3T A;  3GRV A;  3HU1 A;  3C3D A;  1VEK A;  3B74 A;  1XNR M;  4B7G A;  3AJI B;  3K9P A;  2F5N A;  4MH0 E;  3ZQJ A;  1NSF A;  3K8Z A;  4G4N A;  2F5Q A;  3KOZ E;  1DGH B;  2XFS A;  1MU5 A;  3DOA A;  1TH2 A;  4KOD A;  3U6P A;  4LCB A;  3FTD A;  1X37 A;  1QAQ A;  5FLX S;  4NXN M;  1IXS A;  3SAR A;  2MR9 A;  2H5X A;  1XC8 A;  2WSE F;  4NRW A;  3GPP A;  2VQF M;  1N77 A;  1LV7 A;  4GHA A;  2Z4S A;  2QP9 X;  4GC5 A;  4FCV A;  2KZU A;  5EXS A;  2QBY A;  4X65 M;  1WR1 B;  1ZMW A;  4OVZ A;  1N78 A;  5EP4 A;  4MGK E;  2LBC A;  3BXW A;  1R7R A;  3JAM S;  2JP7 A;  4DR5 M;  3AL0 C;  1TR8 A;  2CP8 A;  4CIS A;  1QAO A;  3CF0 A;  5ITX E;  4M0W A;  3B89 A;  4TUW A;  3E21 A;  4DV1 M;  3FUX A;  4I4L A;  1DGB A;  4L15 A;  4GMQ A;  5C18 A;  2DZO B;  2DZL A;  1IXZ A;  4RF1 A;  4LF9 M;  2XEP A;  3KS8 A;  4Y28 F;  2XLJ A;  4DR4 M;  1G8P A;  2ZTC A;  2F5P A;  4NXM M;  4UN2 B;  4LJ4 A;  3SBJ A;  3UJN A;  3HHY A;  4AKG A;  2L4E A;  1QYR A;  1E9R A;  1IBL M;  1Y8G A;  1K82 A;  4JI1 M;  1G71 A;  2CRU A;  3U6L A;  3KP0 E;  3I4V A;  1UM8 A;  4JN6 A;  3GLF E;  4AI6 A;  2V6Z M;  1FNN A;  2Y0T A;  3C3E A;  3FRI A;  1VG5 A;  2MGW A;  4F2L A;  1PM5 A;  1TGU A;  3SAT A;  2LVN C;  2DHY A;  1SG9 A;  1XNQ M;  5FTM A;  2VF7 A;  1NV9 A;  3GLG A;  1NJF A;  2QNJ A;  1R2Y A;  2FOI C;  4B3M M;  1MX0 A;  2VQE M;  2K47 A;  2RRU A;  4R7G A;  1NHW C;  1KYI A;  3LCV B;  4DV4 M;  4ANR A;  4QNM A;  1OJL A;  1V34 A;  5IWA M;  3AFH A;  2R6F A;  1FJG M;  4IBJ A;  3AOE C;  1HQY E;  1S3S A;  1WXQ A;  1D0K A;  3D8B A;  2M5Z A;  4IBD A;  1Z6T A;  2Q2E B;  1N75 A;  2JXN A;  4IBK A;  4DV3 M;  7CAT A;  1QUT A;  4AQY M;  3QYB A;  4AW4 A;  1G59 A;  5ITR A;  5LMN M;  1R4G A;  3RE8 A;  4CIZ A;  3DA1 A;  4GIT A;  4LJ9 A;  1GL6 A;  1QDR A;  3HJ8 A;  1IN6 A;  5F3W A;  2M60 A;  4KO8 A;  2Z7J A;  4S12 A;  1Z5A A;  3M0E A;  1NY6 A;  3KOX E;  4LGY A;  1NO1 A;  2O25 A;  1XMQ M;  1DGH A;  3LW5 F;  5KPT A;  3HKP A;  4DV2 M;  3B7Q A;  4LZZ A;  4D82 A;  3SAU A;  3FUU A;  1PJT A;  5ITQ A;  2XZF A;  1XMO M;  1KSF X;  1D0L A;  2H1R A;  2XGN A;  1QZM A;  4II7 A;  1IN4 A;  2O5R A;  1DO2 A;  1XWI A;  3LQR A;  3B9P A;  1NNU C;  3L26 A;  4WP2 A;  4NRV A;  1NHG C;  2DWZ B;  2K6B A;  4JI7 M;  4JI2 M;  3U60 B;  1HT1 E;  5EP3 A;  2JY5 A;  3HJS A;  3AV0 A;  4GC9 A;  3GPY A;  2YFQ A;  1HR0 M;  4LJ5 A;  2XFT A;  4QOS A;  1EE8 A;  2MRO B;  1ZQ9 A;  4MGI E;  3TPZ A;  1E32 A;  1XB2 B;  1XXH B;  2KDL A;  1WGN A;  2JY6 B;  2APL A;  4DR2 M;  3GQ4 A;  2KNZ A;  4PCZ A;  2N35 A;  4LF4 M;  3T1Y M;  2P5T A;  4W5W A;  3LCU A;  3MK6 A;  3GLI B;  1QVR A;  3GLG E;  3GPU A;  3SC3 A;  2BNK A;  4GIP A;  3LQQ A;  1L1Z A;  2F5S A;  3HWS A;  4QHT A;  2DAM A;  2L6O A;  4DBG B;  3L25 A;  3SHF A;  1TDH A;  2OOA A;  1OQY A;  2KZS A;  1OAI A;  2R46 A;  2DEN A;  1HNW M;  3CTW B;  4WW0 A;  4AKI A;  5EJC A;  3U6M A;  2QSF X;  1SXJ B;  4DUY M;  1IFY A;  3THG A;  3M6A A;  4LJ6 A;  2J7O A;  2QCU A;  5EXX A;  5ITY A;  3AOE A;  2FH0 A;  1PJI A;  2DKL A;  3T38 A;  3V76 A;  1GAB A;  1JR3 D;  2GQF A;  2Y21 A;  1YE9 A;  3IHP A;  4IBI A;  5E6J A;  3ZCB B;  1L1T A;  4R3D A;  2KRU A;  1JQJ C;  3U6Q A;  2ZAN A;  4BB9 A;  4IBC A;  2CHG A;  2OO9 A;  2A5Y B;  1RU3 A;  2MH8 A;  2I7P A;  4RKU F;  3SHG B;  1C7Y A;  3QWL A;  2CV0 A;  5EXP A;  1ZAE A;  2VDB B;  3E4R A;  3W0F A;  4RF0 A;  1WGL A;  3QAU A;  3GO8 A;  2F5O A;  2MJ5 B;  3KOY E;  4A3V B;  3PXG A;  2OPF A;  4B7H A;  3U6D A;  4B3T M;  4G6Z A;  3EIE A;  1SXJ C;  3HGI A;  5FTJ A;  1W5S A;  1T43 A;  3DZD A;  4NOO B;  3TQS A;  5JI3 E;  2RGO A;  1QUS A;  2CUZ A;  3GLH B;  3FYC A;  2VII A;  1SXJ D;  5IT9 S;  1D2N A;  4AZF A;  2L09 A;  2XSZ D;  2C5R A;  3U5Z B;  3HX3 A;  5ITT A;  5GKN A;  4LGM A;  3B7N A;  4B08 A;  2C96 A;  2YNM D;  8CAT A;  2QQ8 A;  1PGY A;  1TDZ A;  1QQW A;  3C58 A;  3ZC7 B;  1GVN A;  3FRH A;  4IIW A;  3W0L B;  3FTF A;  3BBZ A;  3J80 S;  4LJ7 A;  4DUZ M;  5FTL A;  2UUB M;  4XK8 F;  3J27 B;  1I4W A;  2LXE A;  1K3X A;  3FTE A;  2X49 A;  3FUW A;  2DNA A;  5EP2 A;  4BLC A;  5KPZ A;  5L8R F;  2FFJ A;  4LF7 M;  3A98 B;  4JI0 M;  3ZH9 B;  1NNJ A;  3CF2 A;  5ITU A;  3PVS A;  2BWE A;  3R9X B;  1N34 M;  3HZJ A;  3I04 M;  2DZN B;  2HKJ A;  2O01 F;  2WSC F;  3FUV A;  3PNV A;  4NL4 H;  3U60 A;  2GNO A;  4DR1 M;  1JR3 A;  4IBB A;  3K1J A;  5JI2 E;  4PDG A;  4Z6Y A;  2V1U A;  3HHW A;  1P3Q Q;  4LFB M;  3U6E A;  1JB0 F;  2DAI A;  2UUC M;  1ZMV A;  2AHM A;  1VDL A;  5DYI A;  2C98 A;  3UGJ A;  3WHK A;  4DV7 M;  1A5T A;  1IXS B;  1VQ1 A;  2R45 A;  3R8F A;  3GLI A;  4B3S M;  1ZMU A;  3KS4 A;  1W5T A;  4Q7J A;  1PJQ A;  3F92 A;  4L8R C;  1GLN A;  4OX9 M;  2CFO A;  2LHC A;  4L78 A;  5FSW A;  3A46 A;  2QBY B;  3M7G A;  4PD2 A;  5IRE B;  4MGH A;  1IQP A;  3UMM A;  5A2Q S;  5DFL A;  3U6C A;  4Z8X A;  2DAG A;  2VF8 A;  4LF8 M;  4QOZ C;  3SAW A;  4JXJ A;  3EIH A;  4B7F A;  1N36 M;  1V33 A;  2X4A A;  1R5L A;  3LMM A;  4NC6 A;  4QNR A;  1TH4 A;  3RFW A;  3TL4 X;  4X66 M;  4JI8 M;  2UU9 M;  4IJF A;  1SXJ A;  2DWL A;  4LFC M;  3SAV A;  1OAO C;  2XSZ A;  3U6S A;  2LVO C;  1IBM M;  1IM2 A;  3JR4 A;  2QZ4 A;  2CV1 A;  2WSF F;  3KP1 E;  4KT0 F;  4IBF A;  2LVP C;  3I4Y A;  3W67 A;  2E5L M;  2HAK A;  1J09 A;  1OTR A;  1YUB A;  3L2A A;  3GQ5 A;  4DR6 M;  2Z8Y M;  1GO5 A;  2DAK A;  2DVW B;  4L6V 6;  4DV5 M;  2EUC A;  3QYE A;  2JY8 A;  3HU3 A;  4PT5 A;  3T15 A;  1N33 M;  2JY7 A;  2QPA A;  3UZU A;  1D0M A;  2CE7 A;  2R44 A;  3HU2 A;  1LTM A;  5KQ8 A;  3JR5 A;  1VDD A;  1QDT A;  2KW0 A;  2W82 A;  3I01 M;  2WZJ A;  3GPX A;  2JZ0 A;  4AG5 A;  2ZM6 M;  3TWL A;  2C9O A;  2OQ4 A;  3U6O A;  4LRS A;  4GHL A;  3RGP A;  1E94 E;  1Z5C A;  5H37 D;  1HT2 E;  4YHH M;  4JI6 M;  4HLQ A;  1G41 A;  2ZTD A;  4LRT A;  4IBG A;  3GLG B; 
#chains in the Genus database with same CATH homology
 2X8A A;  3KXE C;  1G3I A;  3L29 A;  2YR0 A;  2YQZ A;  2BJV A;  3K92 A;  3GLH A;  4D80 A;  4MGY E;  1IXR C;  2UUA M;  3LVW A;  1GKI A;  3GP1 A;  1HQC A;  1H6U A;  3U5Z A;  4L4U A;  3NWL A;  4AKH A;  4LFA M;  4G4O A;  4I8O A;  3FUT A;  1R2Z A;  2CHQ A;  4IJE A;  3KDS E;  3DFZ A;  1IY2 A;  2LH0 A;  2ZBK B;  4XBO A;  5KO3 A;  3HHZ A;  2D7E A;  2FE8 A;  2NQ8 C;  2RKO A;  4FWH A;  2XZU A;  2BJW A;  2LNH C;  4FWD A;  4REZ A;  3OTO M;  3U61 B;  1J5E M;  4JYA M;  1HNZ M;  1IY0 A;  2XH9 A;  4CHT B;  4D81 A;  4P16 A;  1L2D A;  4ZPX A;  4G4R A;  1HNX M;  2UXB M;  4I81 A;  5EP1 A;  2FNA A;  2JA2 A;  4BBA A;  3FD9 A;  1IN7 A;  2UXD M;  3D8L A;  3GRY A;  3J7B A;  2D7H A;  3A45 A;  3LVV A;  4DR3 M;  4LF5 M;  2Y20 A;  4OU7 A;  1SXJ E;  2KRK A;  5BR8 M;  2C99 A;  3KSX A;  4G4Q A;  4LJA A;  4MB7 A;  4CGY B;  4YY3 M;  2HCB A;  2HHH M;  3WHL A;  5KPR A;  1IY1 A;  2L7H A;  3KSJ A;  4FD2 A;  3VK7 A;  2KXE A;  3L28 A;  3PNY A;  3VFD A;  3KFU G;  4X62 M;  3T1H M;  4FCW A;  1I94 M;  3VKH A;  3SYL A;  3GRR A;  4LY6 A;  3GLF B;  3KW6 A;  1Z5B A;  1L2B A;  3Q8X A;  4I5S A;  2DHR A;  2R18 A;  3IG5 A;  2KA6 B;  2LWX A;  3CF6 E;  3SAS A;  4DR7 M;  2HL7 A;  4NSO B;  4RNA A;  4KLN A;  3VK8 A;  4L16 A;  1DO0 A;  4LZJ A;  3FKE A;  2CHV A;  2D7G A;  2R62 A;  3HJQ A;  4EIW A;  2UXC M;  2XF3 A;  2CEA A;  4FW9 A;  1G4A E;  3VDU A;  2DXI A;  1IN5 A;  4LG2 A;  3I51 A;  1C1K A;  3AOG A;  4GRI A;  3SFZ A;  3VDP A;  2V1C A;  2Z4R A;  1XXH A;  3HHX A;  4ITQ A;  3NBI A;  4GKK M;  2ZAO A;  4AG6 A;  1E9S A;  4K0K M;  4M9X A;  5LMU M;  1IN8 A;  4M9Z A;  2R4J A;  3VKG A;  2R4E A;  3IG8 A;  1Q3C A;  5IZ7 D;  4X64 M;  4M0D A;  3PFI A;  3RGS A;  4MGZ E;  3J2P B;  4NSR A;  2G5G X;  4OVZ B;  1DGG A;  4XGI A;  3MJ5 A;  4WUR A;  4HL4 A;  1TH3 A;  5DYG A;  1Q3B A;  3TE6 A;  4GKJ M;  1Z59 A;  1NVM A;  1OFI A;  3J7A S;  4M9S A;  4DV6 M;  4JI4 M;  1L8Q A;  2C9C A;  1DGF A;  3H4M A;  4LJ8 A;  4JI3 M;  5C1B A;  5E26 A;  3TWM A;  1PJJ A;  3U61 A;  3BOS A;  5EXT A;  2F4V M;  5EQT A;  2Y0Q A;  3E9S A;  3KVW A;  1N32 M;  1ORY B;  3KOW E;  4JI5 M;  1GL7 A;  4FVM A;  1NJG A;  1L2C A;  3J81 S;  3A42 A;  3GRU A;  4IBE A;  1OFH A;  2EO2 A;  2ERC A;  4KHP M;  4B3R M;  5ITX A;  2Z3X A;  3GQ3 A;  3VLF B;  2DWM A;  2QEN A;  2J7N A;  4GH9 A;  4FWG A;  1IBK M;  4FCT A;  5FTN A;  1XHB A;  2G8L A;  3FYD A;  4PDI A;  2I7N A;  2RGH A;  4OW0 A;  1K3W A;  4LF6 M;  5KQD A;  2CV2 A;  3K2L A;  2L7I A;  1QAM A;  2KEB A;  5BPV A;  2EA0 A;  4JV5 M;  2R65 A;  4MM3 B;  3AKZ A;  1Q39 A;  1QAN A;  3MHV C;  4QHS A;  1NY5 A;  1J7K A;  3UK6 A;  3GLF A;  5DNY A;  4DV0 M;  3SMP A;  3SYK A;  1KFV A;  3TWK A;  5FTK A;  3ILK A;  1YSY A;  3L27 A;  3SMS A;  1R6B X;  2ZAM A;  3FTC A;  1T3T A;  3GRV A;  3HU1 A;  1XNR M;  4B7G A;  3AJI B;  2F5N A;  4MH0 E;  1NSF A;  3K8Z A;  4G4N A;  2F5Q A;  3KOZ E;  1DGH B;  2XFS A;  1MU5 A;  3DOA A;  1TH2 A;  4KOD A;  3U6P A;  4LCB A;  3FTD A;  1X37 A;  1QAQ A;  5FLX S;  4NXN M;  3SAR A;  1XC8 A;  4NRW A;  3GPP A;  2VQF M;  1N77 A;  1LV7 A;  4GHA A;  2Z4S A;  2QP9 X;  4GC5 A;  4FCV A;  2KZU A;  5EXS A;  2QBY A;  4X65 M;  1N78 A;  4OVZ A;  5EP4 A;  4MGK E;  1R7R A;  3JAM S;  4DR5 M;  3AL0 C;  4CIS A;  1QAO A;  3CF0 A;  5ITX E;  4M0W A;  4TUW A;  4DV1 M;  3FUX A;  4I4L A;  1DGB A;  4L15 A;  4GMQ A;  5C18 A;  2DZO B;  1IXZ A;  4RF1 A;  4LF9 M;  2XEP A;  3KS8 A;  2XLJ A;  4DR4 M;  1G8P A;  2F5P A;  4NXM M;  4LJ4 A;  3SBJ A;  3UJN A;  3HHY A;  4AKG A;  1E9R A;  1QYR A;  1IBL M;  1K82 A;  4JI1 M;  3U6L A;  3KP0 E;  3I4V A;  1UM8 A;  4JN6 A;  4AI6 A;  2V6Z M;  1FNN A;  2Y0T A;  1PM5 A;  3SAT A;  1TGU A;  1XNQ M;  5FTM A;  3GLG A;  1NJF A;  1R2Y A;  2FOI C;  4B3M M;  1MX0 A;  2VQE M;  2K47 A;  4R7G A;  1NHW C;  1KYI A;  4DV4 M;  4QNM A;  1OJL A;  5IWA M;  3AFH A;  1FJG M;  4IBJ A;  3AOE C;  1HQY E;  1S3S A;  1WXQ A;  4IBD A;  3D8B A;  2M5Z A;  1Z6T A;  2Q2E B;  1N75 A;  4IBK A;  4DV3 M;  7CAT A;  4AQY M;  4AW4 A;  1G59 A;  5ITR A;  5LMN M;  3RE8 A;  3DA1 A;  4GIT A;  4LJ9 A;  1GL6 A;  3HJ8 A;  1IN6 A;  5F3W A;  2M60 A;  4KO8 A;  2Z7J A;  4S12 A;  1Z5A A;  3M0E A;  1NY6 A;  3KOX E;  4LGY A;  1XMQ M;  1DGH A;  5KPT A;  3HKP A;  4DV2 M;  4LZZ A;  4D82 A;  3SAU A;  3FUU A;  5ITQ A;  1XMO M;  2XZF A;  2DWN A;  1KSF X;  2H1R A;  2XGN A;  4II7 A;  1QZM A;  1IN4 A;  2O5R A;  1DO2 A;  1XWI A;  3LQR A;  3B9P A;  1NNU C;  3L26 A;  4JI7 M;  4NRV A;  1NHG C;  2DWZ B;  4JI2 M;  3U60 B;  1HT1 E;  5EP3 A;  3HJS A;  3AV0 A;  4GC9 A;  3GPY A;  2YFQ A;  1HR0 M;  4LJ5 A;  2XFT A;  4QOS A;  1EE8 A;  1ZQ9 A;  4MGI E;  3TPZ A;  1E32 A;  1XXH B;  4DR2 M;  3GQ4 A;  4LF4 M;  4PCZ A;  3T1Y M;  2P5T A;  4W5W A;  3MK6 A;  3GLI B;  1QVR A;  3GPU A;  3SC3 A;  2BNK A;  4GIP A;  3LQQ A;  1L1Z A;  2F5S A;  3HWS A;  4QHT A;  2L6O A;  3L25 A;  3SHF A;  1TDH A;  2KZS A;  2R46 A;  1HNW M;  3CTW B;  4WW0 A;  4AKI A;  5EJC A;  3U6M A;  1SXJ B;  4DUY M;  3THG A;  3M6A A;  4LJ6 A;  2J7O A;  2QCU A;  5EXX A;  5ITY A;  3AOE A;  1PJI A;  3T38 A;  1JR3 D;  2Y21 A;  1YE9 A;  5E6J A;  4IBI A;  3ZCB B;  1L1T A;  4R3D A;  2KRU A;  1JQJ C;  3U6Q A;  2ZAN A;  4BB9 A;  4IBC A;  2CHG A;  2A5Y B;  3SHG B;  2I7P A;  3QWL A;  2CV0 A;  5EXP A;  1ZAE A;  3E4R A;  3W0F A;  4RF0 A;  3QAU A;  3GO8 A;  2F5O A;  3KOY E;  4A3V B;  3PXG A;  2OPF A;  4B7H A;  3U6D A;  4B3T M;  4G6Z A;  3EIE A;  1SXJ C;  3HGI A;  5FTJ A;  1W5S A;  3DZD A;  4NOO B;  3TQS A;  5JI3 E;  2RGO A;  2CUZ A;  3GLH B;  3FYC A;  2VII A;  1SXJ D;  5IT9 S;  1D2N A;  4AZF A;  2L09 A;  2XSZ D;  2C5R A;  3U5Z B;  5ITT A;  5GKN A;  4LGM A;  4B08 A;  2C96 A;  2YNM D;  8CAT A;  1TDZ A;  1QQW A;  3C58 A;  3ZC7 B;  1GVN A;  4IIW A;  3W0L B;  3FTF A;  3J80 S;  4LJ7 A;  4DUZ M;  5FTL A;  2UUB M;  3J27 B;  1I4W A;  2LXE A;  1K3X A;  3FTE A;  2X49 A;  3FUW A;  5EP2 A;  4BLC A;  5KPZ A;  4LF7 M;  2FFJ A;  3A98 B;  4JI0 M;  3ZH9 B;  1NNJ A;  3CF2 A;  5ITU A;  3PVS A;  1N34 M;  2DZN B;  2HKJ A;  4NL4 H;  3FUV A;  3PNV A;  3U60 A;  4DR1 M;  1JR3 A;  4IBB A;  3K1J A;  5JI2 E;  4PDG A;  4Z6Y A;  2V1U A;  3HHW A;  4LFB M;  3U6E A;  2UUC M;  2AHM A;  5DYI A;  2C98 A;  3UGJ A;  3WHK A;  4DV7 M;  1IXS B;  3R8F A;  2R45 A;  3GLI A;  4B3S M;  3KS4 A;  1W5T A;  4L8R C;  4OX9 M;  1GLN A;  2CFO A;  4L78 A;  3A46 A;  5FSW A;  2QBY B;  3M7G A;  4PD2 A;  5IRE B;  4MGH A;  1IQP A;  3UMM A;  5A2Q S;  3U6C A;  4LF8 M;  4Z8X A;  4QOZ C;  3SAW A;  4JXJ A;  3EIH A;  4B7F A;  1N36 M;  2X4A A;  3LMM A;  4QNR A;  1TH4 A;  3RFW A;  3TL4 X;  4X66 M;  4JI8 M;  2UU9 M;  4IJF A;  1SXJ A;  2DWL A;  4LFC M;  3SAV A;  3U6S A;  2XSZ A;  1IBM M;  2CV1 A;  1IM2 A;  3JR4 A;  2QZ4 A;  3KP1 E;  4IBF A;  3I4Y A;  2E5L M;  1J09 A;  3L2A A;  1YUB A;  3GQ5 A;  4DR6 M;  2DVW B;  4DV5 M;  2EUC A;  4PT5 A;  3HU3 A;  3T15 A;  1N33 M;  2QPA A;  3UZU A;  2CE7 A;  3HU2 A;  5KQ8 A;  3JR5 A;  1VDD A;  2KW0 A;  3GPX A;  2W82 A;  4AG5 A;  2ZM6 M;  3TWL A;  2C9O A;  2OQ4 A;  3U6O A;  4LRS A;  4GHL A;  3RGP A;  1E94 E;  1Z5C A;  5H37 D;  1HT2 E;  4YHH M;  4JI6 M;  4HLQ A;  1G41 A;  4LRT A;  3R9X B;  4IBG A;  3GLG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...