3Q8XA

Structure of a toxin-antitoxin system bound to its substrate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
b'VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antidote of epsilon-zeta postsegregational killing system
publication title A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 35
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3q8xA00
3Q8XA 2P5TA 1GVNA
chains in the Genus database with same CATH superfamily
2MROB 2DAMA 1UFZA 4GIPA 1GO5A 1IFYA 5FTLA 4B7FA 1AUAA 4L15A 1V34A 2APLA 1I4WA 3LMMA 5ITUA 2C98A 2CWBA 1T3TA 4DR7M 2LNHC 7CATA 2YQZA 2C96A 3SMSA 1MX0A 3FKEA 4IBIA 3RGSA 5KPTA 3L26A 1Z5AA 2LBCA 1IN6A 5EXSA 4OW0A 1EFUB 3K9OA 3KP1E 4HEOA 2YR0A 2XH9A 1C7YA 2UUAM 3U60B 2UXBM 1E9RA 4JI0M 2F5NA 3LCUA 3FTEA 2DKLA 1JR3A 2KA6B 3NWLA 2P5TA 1WR1B 2KDLA 3IG8A 2R6FA 1XWIA 3JR5A 4JI8M 3K2LA 2BNKA 4DV7M 3R9XB 1ZAEA 1L1TA 3E21A 2DAKA 3KS8A 1UM8A 1R5LA 1NSFA 1Q39A 2CHGA 2DZLA 3HZJA 4M0WA 2J7NA 4DV5M 2FFJA 4AQYM 4OVZB 3TWKA 5DYGA 1XNQM 3HJ8A 2WZJA 3IECA 1IN5A 3L28A 2JWSA 2OO9A 4D80A 4F1IA 2KNVA 1K82A 1F4IA 3MMPA 2L4FA 2XSZA 3FUXA 2EUCA 3W68A 4DUYM 1WJ7A 1WHCA 5ITYA 4X66M 5FSWA 1AIPC 1K3XA 4Z8XA 2Z3XA 2OQ4A 4REZA 4NXNM 1LTMA 4IBBA 2ZAOA 4LGMA 4IBCA 1JB0F 4DV2M 1Q02A 2LHGA 1SG9A 3HU1A 1YLAA 2ZAMA 3FRHA 4FWHA 2I7NA 2F5QA 2DAGA 2CUZA 4WURA 1JR3D 3U6CA 4L78A 2O25A 2O5RA 3VDUA 3E9SA 4S12A 3KOXE 2MH8A 4LJ4A 3M6AA 3OTOM 1G3IA 1VDDA 3EIHA 2VF8A 4XK8F 4EIWA 3Q8GA 4DV4M 4JV5M 3RFWA 1GLNA 2FOIC 2JUJA 4DR5M 4LFBM 2KHHA 2DHYA 4BB9A 3GLHB 2CFOA 2JXNA 4P16A 3J7BA 2RKOA 4NC6A 2DHRA 4DV1M 4QOSA 3KOWE 1NO1A 1ZQ9A 3SAUA 2XF3A 2MGWA 3L27A 3QYBA 4KLNA 4PCZA 1NHGC 1TH3A 3TPZA 1QANA 3FYDA 3QAUA 3M7GA 3SHGB 1K3WA 4B3SM 3SATA 3GRYA 4GRIA 4LJAA 2UXCM 1L8QA 2E5LM 2B3TA 2XSZD 4HL4A 3C58A 4YY3M 4L8RC 3DZDA 2KNAA 4LF7M 3HWSA 4MGIE 1T43A 2K9DA 2V6ZM 4ANRA 1IN4A 3TQSA 4AG5A 5KO3A 3B7NA 2HAKA 3CF6E 5A2QS 2F4VM 2UUCM 4LRTA 3HJQA 2D7GA 1NV8A 3GQ4A 1DO0A 1DV0A 3C3DA 5DFLA 3A42A 4B7HA 4YHHM 4GHAA 4PT5A 3HX3A 3SASA 3KXEC 2KNZA 1NJGA 1DGFA 4M9ZA 3I4VA 2JY7A 1R2ZA 2KZUA 2R0IA 3UMMA 3SC3A 1KFVA 1N34M 4AG6A 1KSFX 2X8AA 3KW6A 4LRSA 4LGYA 1P3QQ 2MJ5B 4MGHA 2FE8A 3VK7A 1N32M 4PD2A 2HCBA 1SXJA 1WIVA 4IBJA 3CF0A 2G3QA 2QHOB 1EIJA 5FTJA 1NY5A 1DGGA 3GLFB 4LFAM 2KEBA 1H6UA 2JP7A 2XFSA 1BVSA 2ZANA 3BBZA 3RE8A 2EA0A 1WGNA 3PFIA 4GKJM 4CJ6A 1WGLA 2BWBA 1DO2A 4F2LA 1HR0M 3AOEC 3CGWA 2JZ1A 3LQRA 1VEKA 4GITA 4LZZA 2W82A 3E46A 4D82A 3GLGA 5EQTA 1XXHA 1Q3CA 2N35A 3NBXX 3QWLA 1NV9A 2RRUA 4OVZA 4JXJA 1HJPA 4KHPM 2LHCA 4LF4M 1Z59A 2XZFA 1IY0A 3KDSE 4CISA 3KFUG 3GLHE 8CATA 1MJGM 3IHPA 4GH9A 3U6EA 2LH0A 3T15A 1L1ZA 4FWGA 2CHVA 2EO2A 2Y0QA 1R6BX 4MGZE 1QUSA 4WP2A 2JY5A 4FCTA 3I01M 3AFHA 3ZQJA 2QNJA 2D7HA 1T6OA 1HQCA 2LVNC 3UGJA 1Z6TA 1OAOC 1SXJD 4MM3B 4I4LA 1DGBA 4LFCM 2Z4SA 5EP1A 3KOZE 2KXEA 3TL4X 1IM2A 4AZFA 1E32A 2F5OA 1QAMA 3MJ5A 4IBGA 4LF5M 2R18A 3KP0E 3FRIA 5BR8M 3SAWA 4X62M 2DI0A 1PJSA 3FTCA 2D7EA 3U6OA 1OIZA 4Z6YA 1X37A 4R7GA 5LMNM 2JNHA 3EIEA 3GLHA 2QENA 3T38A 3WHKA 1YUBA 4X65M 2KW0A 3LVVA 4OX9M 1NNUC 2HWJA 3WHLA 1ZMWA 4MGKE 1G4AE 3NBIA 3Q8XA 5EXTA 1XC8A 1IXZA 1HT1E 4M0DA 3U6QA 4G3OA 3GLIB 2ZTDA 4BLCA 2CP8A 4DV3M 1ZV1A 3GP1A 2Y21A 3FUTA 2Z4RA 1MN3A 2Z7JA 4G6ZA 5E6JA 4GC9A 3TWMA 2LWXA 2GNOA 4JN6A 4GHLA 4B3TM 4Y28F 5KPZA 4FW9A 2VQFM 5ITTA 1PJQA 1E9SA 4M9XA 3JAMS 2VQEM 2XLJA 1FNNA 1HNWM 1OAIA 1QUTA 1GL7A 2I7PA 3I4YA 1GVNA 1VDLA 1IY1A 1TDHA 2C9CA 3KVWA 3KS4A 4LJ8A 1OTRA 4OU7A 3GLFE 2R45A 2OOBA 4L6V6 1MU5A 2LVQD 3GRUA 1XHBA 2DAEA 4LJ5A 1PJIA 1TDZA 3U61A 4GEWA 4L16A 4LF9M 3U6LA 3UJNA 1GL6A 3T1HM 4CIZA 3U5ZB 1IQPA 2C9OA 4QHSA 4QNRA 5KQ8A 2CV1A 4JI4M 2LVAA 2K0BX 4DR2M 4JI5M 1N36M 2XGNA 3K9PA 2CE7A 4LJ7A 2QBYB 3C3EA 3FD9A 4IBFA 4R3DA 2WSFF 3DA1A 1Z5BA 2BJWA 3GO8A 1XNRM 3F92A 5EXPA 1OIPA 3FTDA 3SYLA 4A3VB 4LJ9A 2WSEF 3L29A 3D8BA 1ORYB 4QHTA 1DGHA 3CF2A 4DBGB 4NRVA 4P17A 2QPAA 5E26A 1S3SA 5ITQA 1IXSB 1D0LA 1R4GA 3KSJA 2C99A 4UN2B 4L4UA 3SMPA 4LF8M 3VFDA 1D0MA 1A5TA 2F5SA 4QNMA 2EKKA 3SYKA 3U6SA 3B89A 2KRKA 2QSFX 3PXGA 3FTFA 3B9PA 3CTWB 4IIWA 4D81A 1ZMVA 5H37D 4QOZC 3DFZA 3W0FA 1QQWA 5IREB 2BJVA 1J09A 5EP4A 4KT0F 3ZC7B 3GPXA 3BOSA 3HGIA 5FTKA 3HY5A 2R4JA 4AKIA 4B7GA 3GQ3A 1ZMUA 2RGHA 2QQ8A 4LF6M 2R62A 3T1YM 3J80S 4FD2A 4TUWA 1IBLM 4B08A 4WW0A 1IN8A 2DNAA 4PDGA 3H4JA 3MK6A 4MH0E 3U60A 1QAOA 4DUZM 2LXEA 2JY6B 3UZUA 3AOGA 2JY8A 5EXXA 3U6DA 2X4AA 3W67A 3GLIE 2DWZB 3HU3A 4MB7A 3ZCBB 1XMQM 1VG5A 2L6OA 2J5YA 4JI6M 4DV0M 2XZUA 3HJSA 3VKGA 3SBJA 4MGYE 5ITXE 2Y0TA 3JR4A 2DAIA 1QZEA 4NRWA 2ZBKB 2WSCF 2CV2A 1RU3A 4R71A 1G71A 2L2DA 4LCBA 1OQYA 2L7IA 5FTMA 4K0KM 3LVWA 2UUBM 2HHHM 3TWLA 4GMQA 4G4NA 1QZMA 2JA2A 3SAVA 2EKFA 4AKHA 3VLFB 3M0EA 4PDIA 2L09A 2OOAA 3I51A 1NVMA 1W5TA 2ERCA 2L4EA 1SXJC 2DENA 3GPYA 4DR6M 2O01F 2G5GX 2KRUA 3FE3A 2RGOA 5JI2E 3GLIA 3L2AA 4I5SA 4NXMM 4NSOB 3TE6A 4M9SA 3GRRA 2LVOC 3H4MA 4IJEA 2Q2EB 2XFTA 3ILKA 5KQDA 4KO8A 2R44A 2YFQA 3E4RA 1JQJC 2DZNB 4FCWA 5ITXA 3A98B 1N77A 1KYIA 4CGYB 2LVPC 1TGUA 3LCVB 4DR1M 4I8OA 4FCVA 3I04M 3HU2A 1QVRA 4LJ6A 3J7AS 4FWDA 3D8LA 5DNYA 4G4QA 2GQFA 1NJFA 1VQ1A 4NOOB 2UU9M 1SXJB 1HQYE 2K47A 2R4EA 4JI7M 4FVMA 1YSYA 3QYEA 2QP9X 1J7KA 2XEPA 3U5ZA 2LTUA 1V92A 2EJSA 3DOAA 3THGA 1PM5A 2DWLA 5JI3E 2Z8YM 4HLQA 1N33M 1PRBA 2DVWB 3FUUA 2QBYA 4LG2A 5L8RF 2HL7A 4ITQA 3A46A 5EJCA 5KPRA 1J5EM 3HHZA 3RGPA 1FJGM 3GLGB 3J81S 4DR4M 2Y20A 1XXHB 3HHWA 1W5SA 3V76A 3W0LB 1GJSA 1PGYA 1Y8GA 4NSRA 2H5XA 4JYAM 1OFHA 4NL4H 1D2NA 3J27B 4RKUF 1QDRA 2VF7A 1IXSA 3B7QA 3GRVA 2ZTCA 1L2BA 3MHVC 4IBKA 3VDPA 1OFIA 1L2CA 5EP3A 1G41A 4Q7JA 1G8PA 5ITRA 1TH2A 1TF0B 2X49A 2AHMA 1EE8A 4DV6M 2R46A 3HHXA 2QZ4A 4JI1M 4IBEA 1LV7A 3AJIB 4I81A 1QYRA 3FUVA 3PNYA 5EP2A 1IN7A 2FH0A 3K1JA 1Z5CA 1HNZM 4RNAA 2KZSA 3B7ZA 1HT2E 5IZ7D 2CEAA 1R2YA 4IBDA 2VDBB 4XBOA 5LMUM 1OJLA 1Q3BA 4JI2M 4LY6A 2M60A 2V1CA 2R65A 1VEGA 3SFZA 2C5RA 3HHYA 1IBMM 2F5PA 5GKNA 4AW4A 3GLFA 1QDTA 3BXWA 5IT9S 5FLXS 3A45A 1G59A 2DWNA 1XMOM 2HKJA 1VEJA 1XB2B 5DYIA 3GPUA 1QAQA 2OPFA 4G4OA 3U6PA 3R8FA 4DR3M 5FTNA 5C18A 4B3MM 3L25A 5F3WA 3K8ZA 4GC5A 4LZJA 3AL0C 2CRUA 4XGIA 4G4RA 1N78A 4GKKM 1N75A 2MR9A 3VK8A 4AKGA 3AV0A 5BPVA 1V33A 4RF0A 3PNVA 3VKHA 2CV0A 1GJTA 1SXJE 2V1UA 3KSXA 2FNAA 2CHQA 1TR8A 1NY6A 2BWEA 1GKIA 1PJTA 3SARA 3FYCA 2A5YB 2J7OA 4RF1A 2QCUA 3K92A 2DXIA 2M5ZA 3LW5F 3J2PB 1GABA 1OKSA 1C1KA 1R7RA 3AOEA 3KOYE 3U61B 1L2DA 1HNXM 2VIIA 1D0KA 3C9PA 4X64M 3B74A 3PVSA 2K6BA 3GLGE 1XXHE 1IXRC 3ZH9B 2NQ8C 3GQ5A 1NHWC 1YE9A 1IBKM 2YNMD 4ZPXA 3LQQA 3UK6A 1E94E 2H1RA 3T6PA 5C1BA 2DZOB 1TTEA 4KODA 1CUKA 2L7HA 1NNJA 4AI6A 4II7A 1DGHB 2UXDM 1TH4A 4B3RM 3FUWA 3U6MA 4CHTB 2G8LA 2JZ0A 3SHFA 4JI3M 4BBAA 3IG5A 4W5WA 1JR3E 5IWAM 1PJJA 2DWMA 3HKPA 2FS1A 2ZM6M 1I94M 3AKZA 1IY2A 4IJFA 3GPPA 1WXQA
chains in the Genus database with same CATH topology
4GIPA 5FTLA 4B7FA 4L15A 1I4WA 3LMMA 5ITUA 2C98A 1T3TA 4DR7M 2LNHC 7CATA 2YQZA 2C96A 3SMSA 1MX0A 3FKEA 4IBIA 3RGSA 5KPTA 3L26A 1Z5AA 1IN6A 5EXSA 4OW0A 3KP1E 2UUAM 2YR0A 2XH9A 3U60B 2UXBM 1E9RA 4JI0M 2F5NA 3FTEA 1JR3A 2KA6B 3NWLA 2P5TA 3IG8A 3JR5A 1XWIA 4JI8M 3K2LA 2BNKA 4DV7M 3R9XB 1ZAEA 1L1TA 3KS8A 1UM8A 1NSFA 1Q39A 2CHGA 4M0WA 2J7NA 4DV5M 2FFJA 4AQYM 4OVZB 3TWKA 5DYGA 1XNQM 3HJ8A 1IN5A 3L28A 4D80A 1K82A 2XSZA 3FUXA 2EUCA 4DUYM 5ITYA 4X66M 5FSWA 1K3XA 4Z8XA 2Z3XA 2OQ4A 4REZA 4NXNM 4IBBA 2ZAOA 4LGMA 4IBCA 4DV2M 3HU1A 2F5QA 2ZAMA 4FWHA 2I7NA 4WURA 2CUZA 1JR3D 3U6CA 4L78A 2O5RA 3VDUA 3E9SA 4S12A 3KOXE 4LJ4A 3M6AA 3OTOM 1G3IA 1VDDA 3EIHA 4EIWA 4DV4M 4JV5M 3RFWA 1GLNA 2FOIC 4DR5M 4LFBM 4BB9A 3GLHB 2CFOA 4P16A 3J7BA 2RKOA 4DV1M 2DHRA 4QOSA 3KOWE 1ZQ9A 3SAUA 2XF3A 3L27A 4PCZA 4KLNA 1NHGC 1TH3A 3TPZA 1QANA 3FYDA 3QAUA 3M7GA 3SHGB 1K3WA 4B3SM 3SATA 3GRYA 4GRIA 4LJAA 2UXCM 1L8QA 2E5LM 2XSZD 4HL4A 3C58A 4YY3M 4L8RC 3DZDA 4LF7M 3HWSA 4MGIE 2V6ZM 1IN4A 3TQSA 4AG5A 5KO3A 5A2QS 3CF6E 2F4VM 2UUCM 4LRTA 3HJQA 2D7GA 3GQ4A 1DO0A 3A42A 4B7HA 4YHHM 4GHAA 4PT5A 3SASA 3KXEC 1NJGA 1DGFA 4M9ZA 3I4VA 1R2ZA 2KZUA 3UMMA 3SC3A 1KFVA 1N34M 4AG6A 1KSFX 2X8AA 3KW6A 4LRSA 4LGYA 4MGHA 2FE8A 3VK7A 1N32M 4PD2A 2HCBA 1SXJA 4IBJA 3CF0A 5FTJA 1NY5A 1DGGA 3GLFB 4LFAM 2KEBA 1H6UA 2XFSA 2ZANA 2EA0A 3RE8A 3PFIA 4GKJM 1DO2A 1HR0M 3AOEC 3LQRA 4GITA 4LZZA 2W82A 4D82A 3GLGA 5EQTA 1XXHA 1Q3CA 3QWLA 4OVZA 4JXJA 4KHPM 4LF4M 1Z59A 2XZFA 1IY0A 3KDSE 4CISA 3KFUG 8CATA 3U6EA 4GH9A 2LH0A 3T15A 1L1ZA 4FWGA 2CHVA 2EO2A 2Y0QA 1R6BX 4MGZE 4FCTA 3AFHA 2D7HA 3UGJA 1HQCA 1Z6TA 1SXJD 4MM3B 4I4LA 1DGBA 4LFCM 2Z4SA 5EP1A 3KOZE 2KXEA 3TL4X 1IM2A 4AZFA 1E32A 2F5OA 1QAMA 3MJ5A 4IBGA 4LF5M 2R18A 3KP0E 5BR8M 3SAWA 4X62M 3FTCA 2D7EA 3U6OA 4Z6YA 1X37A 4R7GA 5LMNM 3EIEA 3GLHA 3T38A 2QENA 3WHKA 1YUBA 4X65M 2KW0A 3LVVA 4OX9M 1NNUC 3WHLA 4MGKE 1G4AE 3NBIA 3Q8XA 5EXTA 1XC8A 1HT1E 1IXZA 4M0DA 3U6QA 3GLIB 4BLCA 4DV3M 3GP1A 2Y21A 3FUTA 2Z4RA 5E6JA 2Z7JA 4G6ZA 4GC9A 3TWMA 2LWXA 4JN6A 4GHLA 4B3TM 5KPZA 4FW9A 2VQFM 5ITTA 4M9XA 1E9SA 3JAMS 2VQEM 2XLJA 1FNNA 1HNWM 2I7PA 1GL7A 3I4YA 1GVNA 2C9CA 1IY1A 1TDHA 4OU7A 3KVWA 3KS4A 4LJ8A 2R45A 1MU5A 3GRUA 1XHBA 4LJ5A 1PJIA 1TDZA 3U61A 4L16A 4LF9M 3U6LA 3UJNA 1GL6A 3T1HM 3U5ZB 1IQPA 2C9OA 4QHSA 4QNRA 5KQ8A 2CV1A 4JI4M 4JI5M 4DR2M 1N36M 2XGNA 2CE7A 4LJ7A 2QBYB 3FD9A 4IBFA 4R3DA 3DA1A 1Z5BA 2BJWA 3GO8A 1XNRM 5EXPA 3FTDA 3SYLA 4A3VB 4LJ9A 3L29A 3D8BA 1ORYB 4QHTA 1DGHA 3CF2A 4NRVA 2QPAA 5E26A 1S3SA 5ITQA 1IXSB 3KSJA 2C99A 4L4UA 3SMPA 4LF8M 3VFDA 2F5SA 4QNMA 3SYKA 3U6SA 2KRKA 3PXGA 3FTFA 3B9PA 3CTWB 4IIWA 4D81A 5H37D 4QOZC 3DFZA 3W0FA 1QQWA 5IREB 2BJVA 1J09A 5EP4A 3ZC7B 3GPXA 3BOSA 3HGIA 5FTKA 4AKIA 2R4JA 4B7GA 3GQ3A 4LF6M 2RGHA 2R62A 3T1YM 3J80S 4FD2A 4TUWA 1IBLM 4B08A 4WW0A 1IN8A 4PDGA 3MK6A 4MH0E 3U60A 1QAOA 4DUZM 2LXEA 3UZUA 3AOGA 5EXXA 3U6DA 2X4AA 2DWZB 3HU3A 4MB7A 3ZCBB 1XMQM 2L6OA 4JI6M 4DV0M 2XZUA 3HJSA 3VKGA 3SBJA 4MGYE 5ITXE 2Y0TA 3JR4A 4NRWA 2ZBKB 2CV2A 4LCBA 2L7IA 5FTMA 4K0KM 3LVWA 2UUBM 2HHHM 3TWLA 4GMQA 4G4NA 1QZMA 2JA2A 3SAVA 4AKHA 3VLFB 3M0EA 4PDIA 2L09A 3I51A 1NVMA 1W5TA 2ERCA 1SXJC 3GPYA 4DR6M 2G5GX 2KRUA 2RGOA 5JI2E 3GLIA 3L2AA 4I5SA 4NXMM 4NSOB 3TE6A 4M9SA 3GRRA 3H4MA 4IJEA 2Q2EB 2XFTA 3ILKA 5KQDA 4KO8A 2YFQA 3E4RA 1JQJC 2DZNB 4FCWA 5ITXA 3A98B 1N77A 1KYIA 4CGYB 1TGUA 4DR1M 4I8OA 4FCVA 3HU2A 1QVRA 4LJ6A 3J7AS 4FWDA 3D8LA 5DNYA 4G4QA 1NJFA 4NOOB 2UU9M 1SXJB 1HQYE 2K47A 2R4EA 4JI7M 4FVMA 1YSYA 2QP9X 1J7KA 2XEPA 3U5ZA 3THGA 1PM5A 3DOAA 2DWLA 5JI3E 4HLQA 1N33M 3FUUA 2DVWB 2QBYA 4LG2A 4ITQA 2HL7A 3A46A 5EJCA 5KPRA 1J5EM 3HHZA 3RGPA 1FJGM 3GLGB 3J81S 4DR4M 2Y20A 1XXHB 3HHWA 1W5SA 3W0LB 4NSRA 4JYAM 1OFHA 4NL4H 1D2NA 3J27B 3GRVA 1L2BA 3MHVC 4IBKA 3VDPA 1OFIA 1L2CA 5EP3A 1G41A 1G8PA 5ITRA 1TH2A 2X49A 2AHMA 1EE8A 4DV6M 2R46A 3HHXA 2QZ4A 4JI1M 4IBEA 1LV7A 3AJIB 4I81A 1QYRA 3FUVA 3PNYA 5EP2A 1IN7A 3K1JA 1Z5CA 1HNZM 4RNAA 2KZSA 1HT2E 5IZ7D 2CEAA 1R2YA 4IBDA 4XBOA 5LMUM 1OJLA 1Q3BA 4JI2M 4LY6A 2M60A 2V1CA 2R65A 3SFZA 2C5RA 3HHYA 1IBMM 2F5PA 5GKNA 4AW4A 3GLFA 5IT9S 5FLXS 3A45A 1G59A 2DWNA 1XMOM 2HKJA 3GPUA 3R8FA 5DYIA 2OPFA 1QAQA 4G4OA 3U6PA 4DR3M 5FTNA 5C18A 4B3MM 3L25A 5F3WA 3K8ZA 4GC5A 4LZJA 3AL0C 4XGIA 4G4RA 1N78A 4GKKM 1N75A 3VK8A 4AKGA 3AV0A 5BPVA 4RF0A 3PNVA 3VKHA 2CV0A 1SXJE 2V1UA 3KSXA 2CHQA 2FNAA 1NY6A 1GKIA 3SARA 3FYCA 2A5YB 2J7OA 4RF1A 2QCUA 3K92A 2DXIA 2M5ZA 3J2PB 1C1KA 1R7RA 3AOEA 3KOYE 3U61B 1L2DA 1HNXM 2VIIA 4X64M 3PVSA 1IXRC 3ZH9B 2NQ8C 3GQ5A 1NHWC 1YE9A 1IBKM 2YNMD 4ZPXA 3LQQA 3UK6A 1E94E 2H1RA 5C1BA 2DZOB 4KODA 1NNJA 2L7HA 4AI6A 4II7A 1DGHB 2UXDM 1TH4A 4B3RM 3FUWA 3U6MA 4CHTB 2G8LA 1PJJA 3SHFA 4JI3M 4BBAA 3IG5A 4W5WA 5IWAM 2DWMA 3HKPA 2ZM6M 1I94M 3AKZA 1IY2A 4IJFA 3GPPA 1WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  2P5T A;  1GVN A; 
#chains in the Genus database with same CATH topology
 2MRO B;  2DAM A;  1UFZ A;  4GIP A;  1GO5 A;  1IFY A;  5FTL A;  4B7F A;  1AUA A;  4L15 A;  1V34 A;  2APL A;  1I4W A;  3LMM A;  5ITU A;  2C98 A;  2CWB A;  1T3T A;  4DR7 M;  2LNH C;  7CAT A;  2YQZ A;  2C96 A;  3SMS A;  1MX0 A;  3FKE A;  4IBI A;  3RGS A;  5KPT A;  3L26 A;  1Z5A A;  2LBC A;  1IN6 A;  5EXS A;  4OW0 A;  1EFU B;  3K9O A;  3KP1 E;  4HEO A;  2YR0 A;  2XH9 A;  1C7Y A;  2UUA M;  3U60 B;  2UXB M;  1E9R A;  4JI0 M;  2F5N A;  3LCU A;  3FTE A;  2DKL A;  1JR3 A;  2KA6 B;  3NWL A;  2P5T A;  1WR1 B;  2KDL A;  3IG8 A;  2R6F A;  1XWI A;  3JR5 A;  4JI8 M;  3K2L A;  2BNK A;  4DV7 M;  3R9X B;  1ZAE A;  1L1T A;  3E21 A;  2DAK A;  3KS8 A;  1UM8 A;  1R5L A;  1NSF A;  1Q39 A;  2CHG A;  2DZL A;  3HZJ A;  4M0W A;  2J7N A;  4DV5 M;  2FFJ A;  4AQY M;  4OVZ B;  3TWK A;  5DYG A;  1XNQ M;  3HJ8 A;  2WZJ A;  3IEC A;  1IN5 A;  3L28 A;  2JWS A;  2OO9 A;  4D80 A;  4F1I A;  2KNV A;  1K82 A;  1F4I A;  3MMP A;  2L4F A;  2XSZ A;  3FUX A;  2EUC A;  3W68 A;  4DUY M;  1WJ7 A;  1WHC A;  5ITY A;  4X66 M;  5FSW A;  1AIP C;  1K3X A;  4Z8X A;  2Z3X A;  2OQ4 A;  4REZ A;  4NXN M;  1LTM A;  4IBB A;  2ZAO A;  4LGM A;  4IBC A;  1JB0 F;  4DV2 M;  1Q02 A;  2LHG A;  1SG9 A;  3HU1 A;  1YLA A;  2ZAM A;  3FRH A;  4FWH A;  2I7N A;  2F5Q A;  2DAG A;  2CUZ A;  4WUR A;  1JR3 D;  3U6C A;  4L78 A;  2O25 A;  2O5R A;  3VDU A;  3E9S A;  4S12 A;  3KOX E;  2MH8 A;  4LJ4 A;  3M6A A;  3OTO M;  1G3I A;  1VDD A;  3EIH A;  2VF8 A;  4XK8 F;  4EIW A;  3Q8G A;  4DV4 M;  4JV5 M;  3RFW A;  1GLN A;  2FOI C;  2JUJ A;  4DR5 M;  4LFB M;  2KHH A;  2DHY A;  4BB9 A;  3GLH B;  2CFO A;  2JXN A;  4P16 A;  3J7B A;  2RKO A;  4NC6 A;  2DHR A;  4DV1 M;  4QOS A;  3KOW E;  1NO1 A;  1ZQ9 A;  3SAU A;  2XF3 A;  2MGW A;  3L27 A;  3QYB A;  4KLN A;  4PCZ A;  1NHG C;  1TH3 A;  3TPZ A;  1QAN A;  3FYD A;  3QAU A;  3M7G A;  3SHG B;  1K3W A;  4B3S M;  3SAT A;  3GRY A;  4GRI A;  4LJA A;  2UXC M;  1L8Q A;  2E5L M;  2B3T A;  2XSZ D;  4HL4 A;  3C58 A;  4YY3 M;  4L8R C;  3DZD A;  2KNA A;  4LF7 M;  3HWS A;  4MGI E;  1T43 A;  2K9D A;  2V6Z M;  4ANR A;  1IN4 A;  3TQS A;  4AG5 A;  5KO3 A;  3B7N A;  2HAK A;  3CF6 E;  5A2Q S;  2F4V M;  2UUC M;  4LRT A;  3HJQ A;  2D7G A;  1NV8 A;  3GQ4 A;  1DO0 A;  1DV0 A;  3C3D A;  5DFL A;  3A42 A;  4B7H A;  4YHH M;  4GHA A;  4PT5 A;  3HX3 A;  3SAS A;  3KXE C;  2KNZ A;  1NJG A;  1DGF A;  4M9Z A;  3I4V A;  2JY7 A;  1R2Z A;  2KZU A;  2R0I A;  3UMM A;  3SC3 A;  1KFV A;  1N34 M;  4AG6 A;  1KSF X;  2X8A A;  3KW6 A;  4LRS A;  4LGY A;  1P3Q Q;  2MJ5 B;  4MGH A;  2FE8 A;  3VK7 A;  1N32 M;  4PD2 A;  2HCB A;  1SXJ A;  1WIV A;  4IBJ A;  3CF0 A;  2G3Q A;  2QHO B;  1EIJ A;  5FTJ A;  1NY5 A;  1DGG A;  3GLF B;  4LFA M;  2KEB A;  1H6U A;  2JP7 A;  2XFS A;  1BVS A;  2ZAN A;  3BBZ A;  3RE8 A;  2EA0 A;  1WGN A;  3PFI A;  4GKJ M;  4CJ6 A;  1WGL A;  2BWB A;  1DO2 A;  4F2L A;  1HR0 M;  3AOE C;  3CGW A;  2JZ1 A;  3LQR A;  1VEK A;  4GIT A;  4LZZ A;  2W82 A;  3E46 A;  4D82 A;  3GLG A;  5EQT A;  1XXH A;  1Q3C A;  2N35 A;  3NBX X;  3QWL A;  1NV9 A;  2RRU A;  4OVZ A;  4JXJ A;  1HJP A;  4KHP M;  2LHC A;  4LF4 M;  1Z59 A;  2XZF A;  1IY0 A;  3KDS E;  4CIS A;  3KFU G;  3GLH E;  8CAT A;  1MJG M;  3IHP A;  4GH9 A;  3U6E A;  2LH0 A;  3T15 A;  1L1Z A;  4FWG A;  2CHV A;  2EO2 A;  2Y0Q A;  1R6B X;  4MGZ E;  1QUS A;  4WP2 A;  2JY5 A;  4FCT A;  3I01 M;  3AFH A;  3ZQJ A;  2QNJ A;  2D7H A;  1T6O A;  1HQC A;  2LVN C;  3UGJ A;  1Z6T A;  1OAO C;  1SXJ D;  4MM3 B;  4I4L A;  1DGB A;  4LFC M;  2Z4S A;  5EP1 A;  3KOZ E;  2KXE A;  3TL4 X;  1IM2 A;  4AZF A;  1E32 A;  2F5O A;  1QAM A;  3MJ5 A;  4IBG A;  4LF5 M;  2R18 A;  3KP0 E;  3FRI A;  5BR8 M;  3SAW A;  4X62 M;  2DI0 A;  1PJS A;  3FTC A;  2D7E A;  3U6O A;  1OIZ A;  4Z6Y A;  1X37 A;  4R7G A;  5LMN M;  2JNH A;  3EIE A;  3GLH A;  2QEN A;  3T38 A;  3WHK A;  1YUB A;  4X65 M;  2KW0 A;  3LVV A;  4OX9 M;  1NNU C;  2HWJ A;  3WHL A;  1ZMW A;  4MGK E;  1G4A E;  3NBI A;  3Q8X A;  5EXT A;  1XC8 A;  1IXZ A;  1HT1 E;  4M0D A;  3U6Q A;  4G3O A;  3GLI B;  2ZTD A;  4BLC A;  2CP8 A;  4DV3 M;  1ZV1 A;  3GP1 A;  2Y21 A;  3FUT A;  2Z4R A;  1MN3 A;  2Z7J A;  4G6Z A;  5E6J A;  4GC9 A;  3TWM A;  2LWX A;  2GNO A;  4JN6 A;  4GHL A;  4B3T M;  4Y28 F;  5KPZ A;  4FW9 A;  2VQF M;  5ITT A;  1PJQ A;  1E9S A;  4M9X A;  3JAM S;  2VQE M;  2XLJ A;  1FNN A;  1HNW M;  1OAI A;  1QUT A;  1GL7 A;  2I7P A;  3I4Y A;  1GVN A;  1VDL A;  1IY1 A;  1TDH A;  2C9C A;  3KVW A;  3KS4 A;  4LJ8 A;  1OTR A;  4OU7 A;  3GLF E;  2R45 A;  2OOB A;  4L6V 6;  1MU5 A;  2LVQ D;  3GRU A;  1XHB A;  2DAE A;  4LJ5 A;  1PJI A;  1TDZ A;  3U61 A;  4GEW A;  4L16 A;  4LF9 M;  3U6L A;  3UJN A;  1GL6 A;  3T1H M;  4CIZ A;  3U5Z B;  1IQP A;  2C9O A;  4QHS A;  4QNR A;  5KQ8 A;  2CV1 A;  4JI4 M;  2LVA A;  2K0B X;  4DR2 M;  4JI5 M;  1N36 M;  2XGN A;  3K9P A;  2CE7 A;  4LJ7 A;  2QBY B;  3C3E A;  3FD9 A;  4IBF A;  4R3D A;  2WSF F;  3DA1 A;  1Z5B A;  2BJW A;  3GO8 A;  1XNR M;  3F92 A;  5EXP A;  1OIP A;  3FTD A;  3SYL A;  4A3V B;  4LJ9 A;  2WSE F;  3L29 A;  3D8B A;  1ORY B;  4QHT A;  1DGH A;  3CF2 A;  4DBG B;  4NRV A;  4P17 A;  2QPA A;  5E26 A;  1S3S A;  5ITQ A;  1IXS B;  1D0L A;  1R4G A;  3KSJ A;  2C99 A;  4UN2 B;  4L4U A;  3SMP A;  4LF8 M;  3VFD A;  1D0M A;  1A5T A;  2F5S A;  4QNM A;  2EKK A;  3SYK A;  3U6S A;  3B89 A;  2KRK A;  2QSF X;  3PXG A;  3FTF A;  3B9P A;  3CTW B;  4IIW A;  4D81 A;  1ZMV A;  5H37 D;  4QOZ C;  3DFZ A;  3W0F A;  1QQW A;  5IRE B;  2BJV A;  1J09 A;  5EP4 A;  4KT0 F;  3ZC7 B;  3GPX A;  3BOS A;  3HGI A;  5FTK A;  3HY5 A;  2R4J A;  4AKI A;  4B7G A;  3GQ3 A;  1ZMU A;  2RGH A;  2QQ8 A;  4LF6 M;  2R62 A;  3T1Y M;  3J80 S;  4FD2 A;  4TUW A;  1IBL M;  4B08 A;  4WW0 A;  1IN8 A;  2DNA A;  4PDG A;  3H4J A;  3MK6 A;  4MH0 E;  3U60 A;  1QAO A;  4DUZ M;  2LXE A;  2JY6 B;  3UZU A;  3AOG A;  2JY8 A;  5EXX A;  3U6D A;  2X4A A;  3W67 A;  3GLI E;  2DWZ B;  3HU3 A;  4MB7 A;  3ZCB B;  1XMQ M;  1VG5 A;  2L6O A;  2J5Y A;  4JI6 M;  4DV0 M;  2XZU A;  3HJS A;  3VKG A;  3SBJ A;  4MGY E;  5ITX E;  2Y0T A;  3JR4 A;  2DAI A;  1QZE A;  4NRW A;  2ZBK B;  2WSC F;  2CV2 A;  1RU3 A;  4R71 A;  1G71 A;  2L2D A;  4LCB A;  1OQY A;  2L7I A;  5FTM A;  4K0K M;  3LVW A;  2UUB M;  2HHH M;  3TWL A;  4GMQ A;  4G4N A;  1QZM A;  2JA2 A;  3SAV A;  2EKF A;  4AKH A;  3VLF B;  3M0E A;  4PDI A;  2L09 A;  2OOA A;  3I51 A;  1NVM A;  1W5T A;  2ERC A;  2L4E A;  1SXJ C;  2DEN A;  3GPY A;  4DR6 M;  2O01 F;  2G5G X;  2KRU A;  3FE3 A;  2RGO A;  5JI2 E;  3GLI A;  3L2A A;  4I5S A;  4NXM M;  4NSO B;  3TE6 A;  4M9S A;  3GRR A;  2LVO C;  3H4M A;  4IJE A;  2Q2E B;  2XFT A;  3ILK A;  5KQD A;  4KO8 A;  2R44 A;  2YFQ A;  3E4R A;  1JQJ C;  2DZN B;  4FCW A;  5ITX A;  3A98 B;  1N77 A;  1KYI A;  4CGY B;  2LVP C;  1TGU A;  3LCV B;  4DR1 M;  4I8O A;  4FCV A;  3I04 M;  3HU2 A;  1QVR A;  4LJ6 A;  3J7A S;  4FWD A;  3D8L A;  5DNY A;  4G4Q A;  2GQF A;  1NJF A;  1VQ1 A;  4NOO B;  2UU9 M;  1SXJ B;  1HQY E;  2K47 A;  2R4E A;  4JI7 M;  4FVM A;  1YSY A;  3QYE A;  2QP9 X;  1J7K A;  2XEP A;  3U5Z A;  2LTU A;  1V92 A;  2EJS A;  3DOA A;  3THG A;  1PM5 A;  2DWL A;  5JI3 E;  2Z8Y M;  4HLQ A;  1N33 M;  1PRB A;  2DVW B;  3FUU A;  2QBY A;  4LG2 A;  5L8R F;  2HL7 A;  4ITQ A;  3A46 A;  5EJC A;  5KPR A;  1J5E M;  3HHZ A;  3RGP A;  1FJG M;  3GLG B;  3J81 S;  4DR4 M;  2Y20 A;  1XXH B;  3HHW A;  1W5S A;  3V76 A;  3W0L B;  1GJS A;  1PGY A;  1Y8G A;  4NSR A;  2H5X A;  4JYA M;  1OFH A;  4NL4 H;  1D2N A;  3J27 B;  4RKU F;  1QDR A;  2VF7 A;  1IXS A;  3B7Q A;  3GRV A;  2ZTC A;  1L2B A;  3MHV C;  4IBK A;  3VDP A;  1OFI A;  1L2C A;  5EP3 A;  1G41 A;  4Q7J A;  1G8P A;  5ITR A;  1TH2 A;  1TF0 B;  2X49 A;  2AHM A;  1EE8 A;  4DV6 M;  2R46 A;  3HHX A;  2QZ4 A;  4JI1 M;  4IBE A;  1LV7 A;  3AJI B;  4I81 A;  1QYR A;  3FUV A;  3PNY A;  5EP2 A;  1IN7 A;  2FH0 A;  3K1J A;  1Z5C A;  1HNZ M;  4RNA A;  2KZS A;  3B7Z A;  1HT2 E;  5IZ7 D;  2CEA A;  1R2Y A;  4IBD A;  2VDB B;  4XBO A;  5LMU M;  1OJL A;  1Q3B A;  4JI2 M;  4LY6 A;  2M60 A;  2V1C A;  2R65 A;  1VEG A;  3SFZ A;  2C5R A;  3HHY A;  1IBM M;  2F5P A;  5GKN A;  4AW4 A;  3GLF A;  1QDT A;  3BXW A;  5IT9 S;  5FLX S;  3A45 A;  1G59 A;  2DWN A;  1XMO M;  2HKJ A;  1VEJ A;  1XB2 B;  5DYI A;  3GPU A;  1QAQ A;  2OPF A;  4G4O A;  3U6P A;  3R8F A;  4DR3 M;  5FTN A;  5C18 A;  4B3M M;  3L25 A;  5F3W A;  3K8Z A;  4GC5 A;  4LZJ A;  3AL0 C;  2CRU A;  4XGI A;  4G4R A;  1N78 A;  4GKK M;  1N75 A;  2MR9 A;  3VK8 A;  4AKG A;  3AV0 A;  5BPV A;  1V33 A;  4RF0 A;  3PNV A;  3VKH A;  2CV0 A;  1GJT A;  1SXJ E;  2V1U A;  3KSX A;  2FNA A;  2CHQ A;  1TR8 A;  1NY6 A;  2BWE A;  1GKI A;  1PJT A;  3SAR A;  3FYC A;  2A5Y B;  2J7O A;  4RF1 A;  2QCU A;  3K92 A;  2DXI A;  2M5Z A;  3LW5 F;  3J2P B;  1GAB A;  1OKS A;  1C1K A;  1R7R A;  3AOE A;  3KOY E;  3U61 B;  1L2D A;  1HNX M;  2VII A;  1D0K A;  3C9P A;  4X64 M;  3B74 A;  3PVS A;  2K6B A;  3GLG E;  1XXH E;  1IXR C;  3ZH9 B;  2NQ8 C;  3GQ5 A;  1NHW C;  1YE9 A;  1IBK M;  2YNM D;  4ZPX A;  3LQQ A;  3UK6 A;  1E94 E;  2H1R A;  3T6P A;  5C1B A;  2DZO B;  1TTE A;  4KOD A;  1CUK A;  2L7H A;  1NNJ A;  4AI6 A;  4II7 A;  1DGH B;  2UXD M;  1TH4 A;  4B3R M;  3FUW A;  3U6M A;  4CHT B;  2G8L A;  2JZ0 A;  3SHF A;  4JI3 M;  4BBA A;  3IG5 A;  4W5W A;  1JR3 E;  5IWA M;  1PJJ A;  2DWM A;  3HKP A;  2FS1 A;  2ZM6 M;  1I94 M;  3AKZ A;  1IY2 A;  4IJF A;  3GPP A;  1WXQ A; 
#chains in the Genus database with same CATH homology
 4GIP A;  5FTL A;  4B7F A;  4L15 A;  1I4W A;  3LMM A;  5ITU A;  2C98 A;  1T3T A;  4DR7 M;  2LNH C;  7CAT A;  2YQZ A;  2C96 A;  3SMS A;  1MX0 A;  3FKE A;  4IBI A;  3RGS A;  5KPT A;  3L26 A;  1Z5A A;  1IN6 A;  5EXS A;  4OW0 A;  3KP1 E;  2UUA M;  2YR0 A;  2XH9 A;  3U60 B;  2UXB M;  1E9R A;  4JI0 M;  2F5N A;  3FTE A;  1JR3 A;  2KA6 B;  3NWL A;  2P5T A;  3IG8 A;  3JR5 A;  1XWI A;  4JI8 M;  3K2L A;  2BNK A;  4DV7 M;  3R9X B;  1ZAE A;  1L1T A;  3KS8 A;  1UM8 A;  1NSF A;  1Q39 A;  2CHG A;  4M0W A;  2J7N A;  4DV5 M;  2FFJ A;  4AQY M;  4OVZ B;  3TWK A;  5DYG A;  1XNQ M;  3HJ8 A;  1IN5 A;  3L28 A;  4D80 A;  1K82 A;  2XSZ A;  3FUX A;  2EUC A;  4DUY M;  5ITY A;  4X66 M;  5FSW A;  1K3X A;  4Z8X A;  2Z3X A;  2OQ4 A;  4REZ A;  4NXN M;  4IBB A;  2ZAO A;  4LGM A;  4IBC A;  4DV2 M;  3HU1 A;  2F5Q A;  2ZAM A;  4FWH A;  2I7N A;  4WUR A;  2CUZ A;  1JR3 D;  3U6C A;  4L78 A;  2O5R A;  3VDU A;  3E9S A;  4S12 A;  3KOX E;  4LJ4 A;  3M6A A;  3OTO M;  1G3I A;  1VDD A;  3EIH A;  4EIW A;  4DV4 M;  4JV5 M;  3RFW A;  1GLN A;  2FOI C;  4DR5 M;  4LFB M;  4BB9 A;  3GLH B;  2CFO A;  4P16 A;  3J7B A;  2RKO A;  4DV1 M;  2DHR A;  4QOS A;  3KOW E;  1ZQ9 A;  3SAU A;  2XF3 A;  3L27 A;  4PCZ A;  4KLN A;  1NHG C;  1TH3 A;  3TPZ A;  1QAN A;  3FYD A;  3QAU A;  3M7G A;  3SHG B;  1K3W A;  4B3S M;  3SAT A;  3GRY A;  4GRI A;  4LJA A;  2UXC M;  1L8Q A;  2E5L M;  2XSZ D;  4HL4 A;  3C58 A;  4YY3 M;  4L8R C;  3DZD A;  4LF7 M;  3HWS A;  4MGI E;  2V6Z M;  1IN4 A;  3TQS A;  4AG5 A;  5KO3 A;  5A2Q S;  3CF6 E;  2F4V M;  2UUC M;  4LRT A;  3HJQ A;  2D7G A;  3GQ4 A;  1DO0 A;  3A42 A;  4B7H A;  4YHH M;  4GHA A;  4PT5 A;  3SAS A;  3KXE C;  1NJG A;  1DGF A;  4M9Z A;  3I4V A;  1R2Z A;  2KZU A;  3UMM A;  3SC3 A;  1KFV A;  1N34 M;  4AG6 A;  1KSF X;  2X8A A;  3KW6 A;  4LRS A;  4LGY A;  4MGH A;  2FE8 A;  3VK7 A;  1N32 M;  4PD2 A;  2HCB A;  1SXJ A;  4IBJ A;  3CF0 A;  5FTJ A;  1NY5 A;  1DGG A;  3GLF B;  4LFA M;  2KEB A;  1H6U A;  2XFS A;  2ZAN A;  2EA0 A;  3RE8 A;  3PFI A;  4GKJ M;  1DO2 A;  1HR0 M;  3AOE C;  3LQR A;  4GIT A;  4LZZ A;  2W82 A;  4D82 A;  3GLG A;  5EQT A;  1XXH A;  1Q3C A;  3QWL A;  4OVZ A;  4JXJ A;  4KHP M;  4LF4 M;  1Z59 A;  2XZF A;  1IY0 A;  3KDS E;  4CIS A;  3KFU G;  8CAT A;  3U6E A;  4GH9 A;  2LH0 A;  3T15 A;  1L1Z A;  4FWG A;  2CHV A;  2EO2 A;  2Y0Q A;  1R6B X;  4MGZ E;  4FCT A;  3AFH A;  2D7H A;  3UGJ A;  1HQC A;  1Z6T A;  1SXJ D;  4MM3 B;  4I4L A;  1DGB A;  4LFC M;  2Z4S A;  5EP1 A;  3KOZ E;  2KXE A;  3TL4 X;  1IM2 A;  4AZF A;  1E32 A;  2F5O A;  1QAM A;  3MJ5 A;  4IBG A;  4LF5 M;  2R18 A;  3KP0 E;  5BR8 M;  3SAW A;  4X62 M;  3FTC A;  2D7E A;  3U6O A;  4Z6Y A;  1X37 A;  4R7G A;  5LMN M;  3EIE A;  3GLH A;  3T38 A;  2QEN A;  3WHK A;  1YUB A;  4X65 M;  2KW0 A;  3LVV A;  4OX9 M;  1NNU C;  3WHL A;  4MGK E;  1G4A E;  3NBI A;  3Q8X A;  5EXT A;  1XC8 A;  1HT1 E;  1IXZ A;  4M0D A;  3U6Q A;  3GLI B;  4BLC A;  4DV3 M;  3GP1 A;  2Y21 A;  3FUT A;  2Z4R A;  5E6J A;  2Z7J A;  4G6Z A;  4GC9 A;  3TWM A;  2LWX A;  4JN6 A;  4GHL A;  4B3T M;  5KPZ A;  4FW9 A;  2VQF M;  5ITT A;  4M9X A;  1E9S A;  3JAM S;  2VQE M;  2XLJ A;  1FNN A;  1HNW M;  2I7P A;  1GL7 A;  3I4Y A;  1GVN A;  2C9C A;  1IY1 A;  1TDH A;  4OU7 A;  3KVW A;  3KS4 A;  4LJ8 A;  2R45 A;  1MU5 A;  3GRU A;  1XHB A;  4LJ5 A;  1PJI A;  1TDZ A;  3U61 A;  4L16 A;  4LF9 M;  3U6L A;  3UJN A;  1GL6 A;  3T1H M;  3U5Z B;  1IQP A;  2C9O A;  4QHS A;  4QNR A;  5KQ8 A;  2CV1 A;  4JI4 M;  4JI5 M;  4DR2 M;  1N36 M;  2XGN A;  2CE7 A;  4LJ7 A;  2QBY B;  3FD9 A;  4IBF A;  4R3D A;  3DA1 A;  1Z5B A;  2BJW A;  3GO8 A;  1XNR M;  5EXP A;  3FTD A;  3SYL A;  4A3V B;  4LJ9 A;  3L29 A;  3D8B A;  1ORY B;  4QHT A;  1DGH A;  3CF2 A;  4NRV A;  2QPA A;  5E26 A;  1S3S A;  5ITQ A;  1IXS B;  3KSJ A;  2C99 A;  4L4U A;  3SMP A;  4LF8 M;  3VFD A;  2F5S A;  4QNM A;  3SYK A;  3U6S A;  2KRK A;  3PXG A;  3FTF A;  3B9P A;  3CTW B;  4IIW A;  4D81 A;  5H37 D;  4QOZ C;  3DFZ A;  3W0F A;  1QQW A;  5IRE B;  2BJV A;  1J09 A;  5EP4 A;  3ZC7 B;  3GPX A;  3BOS A;  3HGI A;  5FTK A;  4AKI A;  2R4J A;  4B7G A;  3GQ3 A;  4LF6 M;  2RGH A;  2R62 A;  3T1Y M;  3J80 S;  4FD2 A;  4TUW A;  1IBL M;  4B08 A;  4WW0 A;  1IN8 A;  4PDG A;  3MK6 A;  4MH0 E;  3U60 A;  1QAO A;  4DUZ M;  2LXE A;  3UZU A;  3AOG A;  5EXX A;  3U6D A;  2X4A A;  2DWZ B;  3HU3 A;  4MB7 A;  3ZCB B;  1XMQ M;  2L6O A;  4JI6 M;  4DV0 M;  2XZU A;  3HJS A;  3VKG A;  3SBJ A;  4MGY E;  5ITX E;  2Y0T A;  3JR4 A;  4NRW A;  2ZBK B;  2CV2 A;  4LCB A;  2L7I A;  5FTM A;  4K0K M;  3LVW A;  2UUB M;  2HHH M;  3TWL A;  4GMQ A;  4G4N A;  1QZM A;  2JA2 A;  3SAV A;  4AKH A;  3VLF B;  3M0E A;  4PDI A;  2L09 A;  3I51 A;  1NVM A;  1W5T A;  2ERC A;  1SXJ C;  3GPY A;  4DR6 M;  2G5G X;  2KRU A;  2RGO A;  5JI2 E;  3GLI A;  3L2A A;  4I5S A;  4NXM M;  4NSO B;  3TE6 A;  4M9S A;  3GRR A;  3H4M A;  4IJE A;  2Q2E B;  2XFT A;  3ILK A;  5KQD A;  4KO8 A;  2YFQ A;  3E4R A;  1JQJ C;  2DZN B;  4FCW A;  5ITX A;  3A98 B;  1N77 A;  1KYI A;  4CGY B;  1TGU A;  4DR1 M;  4I8O A;  4FCV A;  3HU2 A;  1QVR A;  4LJ6 A;  3J7A S;  4FWD A;  3D8L A;  5DNY A;  4G4Q A;  1NJF A;  4NOO B;  2UU9 M;  1SXJ B;  1HQY E;  2K47 A;  2R4E A;  4JI7 M;  4FVM A;  1YSY A;  2QP9 X;  1J7K A;  2XEP A;  3U5Z A;  3THG A;  1PM5 A;  3DOA A;  2DWL A;  5JI3 E;  4HLQ A;  1N33 M;  3FUU A;  2DVW B;  2QBY A;  4LG2 A;  4ITQ A;  2HL7 A;  3A46 A;  5EJC A;  5KPR A;  1J5E M;  3HHZ A;  3RGP A;  1FJG M;  3GLG B;  3J81 S;  4DR4 M;  2Y20 A;  1XXH B;  3HHW A;  1W5S A;  3W0L B;  4NSR A;  4JYA M;  1OFH A;  4NL4 H;  1D2N A;  3J27 B;  3GRV A;  1L2B A;  3MHV C;  4IBK A;  3VDP A;  1OFI A;  1L2C A;  5EP3 A;  1G41 A;  1G8P A;  5ITR A;  1TH2 A;  2X49 A;  2AHM A;  1EE8 A;  4DV6 M;  2R46 A;  3HHX A;  2QZ4 A;  4JI1 M;  4IBE A;  1LV7 A;  3AJI B;  4I81 A;  1QYR A;  3FUV A;  3PNY A;  5EP2 A;  1IN7 A;  3K1J A;  1Z5C A;  1HNZ M;  4RNA A;  2KZS A;  1HT2 E;  5IZ7 D;  2CEA A;  1R2Y A;  4IBD A;  4XBO A;  5LMU M;  1OJL A;  1Q3B A;  4JI2 M;  4LY6 A;  2M60 A;  2V1C A;  2R65 A;  3SFZ A;  2C5R A;  3HHY A;  1IBM M;  2F5P A;  5GKN A;  4AW4 A;  3GLF A;  5IT9 S;  5FLX S;  3A45 A;  1G59 A;  2DWN A;  1XMO M;  2HKJ A;  3GPU A;  3R8F A;  5DYI A;  2OPF A;  1QAQ A;  4G4O A;  3U6P A;  4DR3 M;  5FTN A;  5C18 A;  4B3M M;  3L25 A;  5F3W A;  3K8Z A;  4GC5 A;  4LZJ A;  3AL0 C;  4XGI A;  4G4R A;  1N78 A;  4GKK M;  1N75 A;  3VK8 A;  4AKG A;  3AV0 A;  5BPV A;  4RF0 A;  3PNV A;  3VKH A;  2CV0 A;  1SXJ E;  2V1U A;  3KSX A;  2CHQ A;  2FNA A;  1NY6 A;  1GKI A;  3SAR A;  3FYC A;  2A5Y B;  2J7O A;  4RF1 A;  2QCU A;  3K92 A;  2DXI A;  2M5Z A;  3J2P B;  1C1K A;  1R7R A;  3AOE A;  3KOY E;  3U61 B;  1L2D A;  1HNX M;  2VII A;  4X64 M;  3PVS A;  1IXR C;  3ZH9 B;  2NQ8 C;  3GQ5 A;  1NHW C;  1YE9 A;  1IBK M;  2YNM D;  4ZPX A;  3LQQ A;  3UK6 A;  1E94 E;  2H1R A;  5C1B A;  2DZO B;  4KOD A;  1NNJ A;  2L7H A;  4AI6 A;  4II7 A;  1DGH B;  2UXD M;  1TH4 A;  4B3R M;  3FUW A;  3U6M A;  4CHT B;  2G8L A;  1PJJ A;  3SHF A;  4JI3 M;  4BBA A;  3IG5 A;  4W5W A;  5IWA M;  2DWM A;  3HKP A;  2ZM6 M;  1I94 M;  3AKZ A;  1IY2 A;  4IJF A;  3GPP A;  1WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...