3Q8XA

Structure of a toxin-antitoxin system bound to its substrate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Antidote of epsilon-zeta postsegregational killing system
publication title A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 35
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3q8xA00
3Q8XA 2P5TA 1GVNA
chains in the Genus database with same CATH superfamily
1S3SA 3B74A 1OIZA 1XWIA 2JY8A 4P17A 3R9XB 2XSZD 1IN5A 3SYKA 2JY7A 2Q2EB 2E5LM 2C5RA 2ERCA 3HJSA 2LVNC 2XH9A 1IBKM 4IBKA 2JWSA 1WIVA 1QAMA 3GLGB 3SMSA 1EE8A 1OIPA 4M9SA 5EP2A 4DR2M 1KYIA 2D7GA 2LNHC 2CV2A 1LTMA 3PFIA 2FH0A 1L2BA 3W68A 2XGNA 3I04M 2XLJA 5ITUA 1G71A 2EKKA 3FE3A 1PJQA 4DR7M 4RF1A 1DO2A 1MX0A 2DHYA 3LVWA 2J7NA 5IZ7D 3T15A 4DV2M 4JXJA 3FUTA 2R6FA 1XNRM 2BWBA 1SXJC 5JI3E 2F5OA 3D8BA 1GJTA 5BPVA 2XEPA 2WZJA 4G4RA 3FRHA 3JR5A 1C1KA 1OQYA 2CWBA 3K8ZA 3TWMA 1DV0A 3GLIE 3UZUA 2G5GX 2P5TA 4IJEA 4QOSA 1J5EM 2JXNA 1LV7A 1NHWC 2R45A 3L29A 1HR0M 3NBIA 1N34M 2UUBM 3FUWA 4DV1M 1NO1A 2YFQA 2F5NA 3CF0A 2HCBA 1VDDA 2DAMA 2Y0TA 3KS4A 4FCWA 1NV9A 3UJNA 1QQWA 2C9CA 4L4UA 3T6PA 4JI1M 1HQCA 4WURA 3MHVC 5FTKA 1XXHE 3AFHA 4M9XA 2V1UA 4NSOB 4RF0A 1K3XA 5ITQA 2CEAA 3EIHA 1OJLA 4MGKE 2DWMA 2DNAA 1T3TA 3FTDA 5FSWA 4AKHA 1R6BX 1G4AE 2G8LA 3AJIB 3GLIA 3SATA 1L2CA 2LWXA 3FTFA 4FCVA 1VQ1A 3L2AA 4FWHA 2LHCA 4NRVA 3TWLA 5L8RF 2VQEM 2LVAA 1PJTA 1WJ7A 3SHFA 1NSFA 4QHSA 4LRTA 4I4LA 1GL7A 2C99A 3LMMA 1HJPA 2KW0A 4X66M 1V92A 3GPPA 2VQFM 3QWLA 2JA2A 2EO2A 2X49A 4EIWA 4OU7A 1XXHB 4D81A 1RU3A 2F5SA 1SXJB 1IY1A 1GKIA 5LMUM 4GHAA 2VF7A 1XXHA 3HU1A 4WP2A 1E32A 1KSFX 1Z59A 2R4EA 1J7KA 1DGHB 1TF0B 3VLFB 1L1ZA 1YSYA 1VDLA 1XC8A 1DGHA 3A42A 1W5TA 3C3EA 4MGZE 3TQSA 1T6OA 4G3OA 4TUWA 3AOEA 3JR4A 4JI8M 3LVVA 3IECA 4RNAA 1ZAEA 3C58A 4PCZA 2BJVA 2DHRA 2L7IA 4X64M 3E46A 1OTRA 3K9OA 1N32M 4XGIA 1VG5A 1SG9A 3HY5A 3U6DA 4DV5M 1MN3A 3OTOM 3U60B 2QHOB 1TDZA 5KPRA 4AW4A 4MM3B 3GLHB 5FTJA 5FTLA 2CFOA 1HT1E 3VDPA 4X65M 5KQ8A 2B3TA 3EIEA 4R3DA 2XZFA 3PNYA 2DZOB 3V76A 1ORYB 4ITQA 3TPZA 3C9PA 4IBGA 4FD2A 4L78A 3MJ5A 2RGOA 3LQQA 4KLNA 4BLCA 1DO0A 5GKNA 5DFLA 1D0MA 4LF8M 3A45A 5KO3A 2FS1A 4LF5M 1ZQ9A 1OKSA 4B3RM 3KSXA 2LVQD 4L8RC 1Z5CA 4YY3M 1D0LA 2DAIA 1DGFA 1Z6TA 4DUZM 4JI3M 1NJFA 2C98A 4DR5M 1GL6A 1SXJD 2D7HA 4LJ9A 3UMMA 1NY6A 1ZMUA 3HJ8A 3SARA 4JI4M 2JZ0A 3H4JA 3ZQJA 2GNOA 1R5LA 2DI0A 1T43A 4LJ6A 1Q39A 3U6EA 2D7EA 3KOWE 1G8PA 2BNKA 2DAEA 3KDSE 4FCTA 4LJ5A 4GRIA 3BBZA 3KP1E 4HL4A 2KEBA 2LH0A 4QNMA 1UM8A 2RRUA 4DV0M 1IXRC 3DFZA 3HJQA 4IBDA 3U6OA 3ZCBB 2JY6B 3T1HM 1V33A 1IM2A 2L7HA 4MB7A 3GQ4A 1E9SA 3B7ZA 3GPYA 2O01F 5FTNA 2DXIA 3KS8A 2DENA 4B7HA 1E9RA 1QDRA 3B7QA 3GRUA 5EP1A 4L16A 4NL4H 4IBIA 1HNXM 2VIIA 1Q3CA 1ZV1A 3L25A 2L6OA 4UN2B 2ZAMA 1IBLM 3WHLA 1L2DA 3U6QA 3U6CA 3FUVA 2CHQA 4MGHA 4LZJA 8CATA 4X62M 3AOEC 5EJCA 3HGIA 3M6AA 3F92A 3H4MA 4FWDA 3B7NA 1J09A 1GJSA 5FTMA 4ANRA 1YLAA 1IXSA 2Y0QA 3FUXA 4Q7JA 4OX9M 2KNVA 3E9SA 3J27B 1WXQA 1IY0A 1QDTA 3SBJA 2I7NA 3CF6E 3GRVA 3RGSA 4Z8XA 4W5WA 5DYIA 4LY6A 3SHGB 1PJJA 4NXMM 1NHGC 3I51A 4LF6M 4GKJM 3FKEA 1W5SA 2HHHM 4JI2M 5EXTA 4B3MM 2QENA 1N77A 4F1IA 2V6ZM 2MGWA 2ZBKB 1KFVA 1NNJA 3GLIB 1TDHA 4DR3M 4CGYB 3IG5A 2W82A 1IN7A 3ZH9B 1OAIA 3QYBA 3KVWA 4G6ZA 3W0FA 2EUCA 1K82A 3J7BA 1AIPC 4AKIA 5E6JA 2UXCM 1QUTA 3LCUA 3KXEC 1XMOM 4LJ4A 3E21A 4MH0E 4GC9A 4IJFA 5EQTA 7CATA 4Z6YA 1IN6A 2GQFA 2RGHA 2UU9M 4GMQA 5EXSA 2KA6B 4LRSA 2RKOA 1TH4A 2M60A 4GEWA 1Q02A 4PT5A 1QANA 1QZMA 4A3VB 2XF3A 3T1YM 1Q3BA 5H37D 3GPXA 4FW9A 2CP8A 3J81S 3VK8A 1QUSA 2Z8YM 5ITRA 2FFJA 3BXWA 3I4VA 5FLXS 2UXBM 3DA1A 4M9ZA 4B7GA 1IFYA 2KZSA 3BOSA 2JP7A 2OOAA 4RKUF 3U6SA 2J7OA 3FTEA 3AV0A 2KZUA 1TR8A 3QYEA 1DGBA 3HHXA 4LF4M 1TH2A 2L2DA 1EFUB 3U61A 2JZ1A 4NC6A 1MJGM 3HHWA 3RFWA 3SMPA 5A2QS 4CISA 3NWLA 4QHTA 2YQZA 4LF9M 1OFIA 1XNQM 1JB0F 2XSZA 3IG8A 1OFHA 3Q8GA 2QQ8A 3HKPA 1F4IA 2ZTDA 3K92A 2QCUA 3R8FA 1G3IA 4JN6A 4NOOB 2OPFA 4AI6A 3KP0E 4R71A 1CUKA 1K3WA 2HKJA 3M7GA 2XFTA 1AUAA 1ZMVA 2X4AA 4S12A 5EXPA 2APLA 1IN4A 2C96A 2QPAA 3WHKA 1UFZA 2F4VM 3AL0C 4G4OA 1YE9A 2K6BA 3PXGA 2CRUA 3FD9A 1WGNA 4I81A 4KODA 5EXXA 2EKFA 4ZPXA 4LFAM 1GABA 1WGLA 2NQ8C 3HU2A 3L27A 4GHLA 1IY2A 3A46A 2AHMA 1NY5A 2HL7A 4G4QA 3SAWA 5IREB 3A98B 4AQYM 3FYDA 3MMPA 3SAVA 4JYAM 3PNVA 1I4WA 4M0WA 2H5XA 4CHTB 5LMNM 5EP4A 1L8QA 3HX3A 4OVZB 3HWSA 4JI7M 2V1CA 3C3DA 2XFSA 5E26A 4OVZA 1OAOC 5IT9S 1G41A 3GLGE 1VEJA 4LFBM 3B9PA 5KPTA 1N75A 5ITXE 2OQ4A 1R7RA 2CUZA 2LHGA 1HT2E 2X8AA 3GPUA 3U6LA 4LF7M 2HAKA 3KW6A 2BWEA 1PM5A 1NVMA 1V34A 3GP1A 4MGIE 1WR1B 4AG6A 4G4NA 1HNWM 1TGUA 4IBCA 4F2LA 3W0LB 3U6PA 2K47A 2KNAA 5ITTA 1G59A 3UGJA 1C7YA 2R62A 5IWAM 2QP9X 3B89A 3RE8A 3NBXX 4DV3M 1NJGA 1QYRA 1PJIA 1IBMM 1N36M 2R0IA 2MH8A 4PDGA 4AZFA 2F5QA 4LG2A 3SC3A 4LJAA 4B3SM 2K9DA 1ZMWA 4IBJA 2KHHA 4GKKM 3VFDA 3AKZA 1NNUC 3I01M 1DGGA 2UUAM 4OW0A 3VDUA 2VDBB 4NSRA 4FVMA 1HNZM 2K0BX 5KQDA 1D0KA 4LGMA 3K2LA 2QZ4A 2CHGA 4D80A 4AKGA 2EJSA 2I7PA 2Y20A 3HZJA 2DVWB 2R65A 3FUUA 4BB9A 3GLGA 2JNHA 5ITXA 1TTEA 4B7FA 4CIZA 4GC5A 2DAKA 2XZUA 1IXZA 3FTCA 2JY5A 4JI0M 1TH3A 3ZC7B 3LQRA 4Y28F 4HEOA 2QBYB 4KHPM 3KOYE 4JI6M 1IXSB 5C1BA 5JI2E 2ZM6M 3THGA 1E94E 2QSFX 1PGYA 2Z7JA 4LCBA 3CTWB 2KDLA 4P16A 2R18A 3ILKA 1R2YA 2DWLA 2QBYA 1IQPA 4DR4M 4LFCM 2G3QA 4IBBA 3SASA 1MU5A 1QVRA 2BJWA 2YR0A 3HU3A 1H6UA 4M0DA 4KT0F 1QAQA 3GQ3A 4QOZC 1FNNA 3VK7A 1JR3E 3VKGA 2O25A 4KO8A 3L26A 2CV1A 3J7AS 1NV8A 3Q8XA 4XK8F 3I4YA 2KNZA 4LJ7A 1VEGA 2KXEA 2HWJA 4D82A 1HQYE 1XB2B 2M5ZA 3J2PB 4I5SA 1R2ZA 2J5YA 3TWKA 3CGWA 4XBOA 3CF2A 4R7GA 5C18A 1EIJA 2Z4SA 4DR1M 3GLFE 5BR8M 2LTUA 3GRRA 1Z5AA 2Y21A 3GRYA 4MGYE 4JV5M 2FE8A 4DV7M 4LZZA 3K9PA 3T38A 4L15A 3RGPA 2KRKA 2QNJA 2DAGA 3DOAA 3SYLA 3UK6A 4PDIA 2Z3XA 3KOZE 1SXJE 4WW0A 4HLQA 3SAUA 2ZANA 1JQJC 2FOIC 2MJ5B 1JR3A 4NRWA 4K0KM 1FJGM 1QAOA 3K1JA 4B08A 2F5PA 2L4FA 2OOBA 4AG5A 5ITYA 3U61B 1YUBA 2H1RA 4I8OA 3TE6A 3GLFB 2UXDM 2A5YB 4LJ8A 3JAMS 3LW5F 3PVSA 4YHHM 1L1TA 2L4EA 2LVPC 4II7A 4QNRA 2WSCF 4IBFA 4BBAA 1PJSA 3GLFA 3U5ZB 4IIWA 3HHYA 3KSJA 4CJ6A 2LVOC 1Z5BA 5EP3A 2WSEF 3J80S 1BVSA 3U5ZA 2R44A 2MR9A 2CE7A 2R46A 1SXJA 3GLHE 3KFUG 1GVNA 4NXNM 4GIPA 1XMQM 2VF8A 1I94M 1N33M 2JUJA 2CHVA 2C9OA 4IBEA 2EA0A 3U6MA 1QZEA 4REZA 3MK6A 1D2NA 2ZAOA 3DZDA 3VKHA 2WSFF 1X37A 4DV6M 5F3WA 1IN8A 2LBCA 1Y8GA 5DYGA 4B3TM 3GO8A 5DNYA 5KPZA 2LXEA 2Z4RA 2MROB 1VEKA 3W67A 2O5RA 2YNMD 3FYCA 2DWZB 2ZTCA 4LGYA 2OO9A 1PRBA 2UUCM 2N35A 1P3QQ 3QAUA 4DR6M 3GQ5A 3L28A 4L6V6 2DWNA 1GLNA 1GO5A 1XHBA 4DBGB 2DZLA 3E4RA 1JR3D 3IHPA 2FNAA 4FWGA 1A5TA 3D8LA 2L09A 3KOXE 2DKLA 1R4GA 2KRUA 4GITA 3SFZA 3TL4X 2CV0A 3M0EA 3AOGA 3FRIA 2R4JA 4DUYM 4DV4M 3U60A 1N78A 3GLHA 4GH9A 4PD2A 3LCVB 3HHZA 4JI5M 2DZNB 1WHCA
chains in the Genus database with same CATH topology
1S3SA 1XWIA 3R9XB 2XSZD 1IN5A 3SYKA 2Q2EB 2E5LM 2C5RA 2ERCA 3HJSA 2XH9A 1IBKM 4IBKA 1QAMA 3GLGB 3SMSA 1EE8A 4M9SA 5EP2A 4DR2M 1KYIA 2D7GA 2LNHC 2CV2A 3PFIA 1L2BA 2XGNA 2XLJA 5ITUA 4DR7M 4RF1A 1DO2A 1MX0A 3LVWA 2J7NA 5IZ7D 3T15A 4DV2M 4JXJA 3FUTA 1XNRM 1SXJC 5JI3E 2F5OA 3D8BA 5BPVA 2XEPA 4G4RA 3JR5A 1C1KA 3K8ZA 3TWMA 3UZUA 2G5GX 2P5TA 4IJEA 4QOSA 1J5EM 1LV7A 1NHWC 2R45A 3L29A 1HR0M 3NBIA 1N34M 2UUBM 3FUWA 4DV1M 2YFQA 2F5NA 3CF0A 2HCBA 1VDDA 4FCWA 2Y0TA 3KS4A 3UJNA 1QQWA 2C9CA 4L4UA 4JI1M 1HQCA 4WURA 3MHVC 5FTKA 3AFHA 4M9XA 2V1UA 4NSOB 4RF0A 1K3XA 5ITQA 2CEAA 3EIHA 1OJLA 4MGKE 2DWMA 1T3TA 3FTDA 5FSWA 4AKHA 1R6BX 1G4AE 2G8LA 3AJIB 3GLIA 3SATA 1L2CA 2LWXA 3FTFA 4FCVA 3L2AA 4FWHA 4NRVA 3TWLA 2VQEM 3SHFA 1NSFA 4QHSA 4LRTA 4I4LA 1GL7A 2C99A 3LMMA 2KW0A 4X66M 3GPPA 2VQFM 3QWLA 2JA2A 2EO2A 2X49A 4EIWA 4OU7A 1XXHB 4D81A 2F5SA 1SXJB 1IY1A 1GKIA 5LMUM 1XXHA 3HU1A 1E32A 1KSFX 1Z59A 2R4EA 1J7KA 1DGHB 3VLFB 1L1ZA 1YSYA 1XC8A 3A42A 1DGHA 1W5TA 4MGZE 3TQSA 4TUWA 3AOEA 3JR4A 4JI8M 3LVVA 4RNAA 1ZAEA 3C58A 4PCZA 2BJVA 2DHRA 2L7IA 4X64M 1N32M 4XGIA 3U6DA 4DV5M 3OTOM 3U60B 1TDZA 5KPRA 4AW4A 4MM3B 3GLHB 5FTJA 5FTLA 2CFOA 1HT1E 3VDPA 4X65M 5KQ8A 3EIEA 4R3DA 2XZFA 3PNYA 2DZOB 1ORYB 4ITQA 3TPZA 4IBGA 4FD2A 4L78A 3MJ5A 2RGOA 3LQQA 4KLNA 4BLCA 1DO0A 5GKNA 4LF8M 3A45A 5KO3A 4LF5M 1ZQ9A 4B3RM 3KSXA 4L8RC 1Z5CA 4YY3M 1DGFA 1Z6TA 4DUZM 4JI3M 1NJFA 2C98A 4DR5M 1GL6A 1SXJD 2D7HA 4LJ9A 3UMMA 1NY6A 3HJ8A 3SARA 4JI4M 4LJ6A 1Q39A 3U6EA 2D7EA 3KOWE 1G8PA 2BNKA 3KDSE 4FCTA 4LJ5A 4GRIA 4HL4A 3KP1E 4QNMA 2KEBA 2LH0A 1UM8A 4DV0M 1IXRC 3DFZA 3HJQA 4IBDA 3U6OA 3ZCBB 3T1HM 1IM2A 2L7HA 4MB7A 3GQ4A 1E9SA 3GPYA 5FTNA 2DXIA 3KS8A 4B7HA 1E9RA 3GRUA 5EP1A 4L16A 4NL4H 4IBIA 1HNXM 2VIIA 1Q3CA 3L25A 2L6OA 2ZAMA 1IBLM 3WHLA 1L2DA 3U6QA 3U6CA 3FUVA 2CHQA 4MGHA 4LZJA 8CATA 4X62M 3AOEC 5EJCA 3HGIA 3M6AA 3H4MA 4FWDA 1J09A 5FTMA 2Y0QA 3FUXA 4OX9M 3E9SA 3J27B 1WXQA 1IY0A 3SBJA 2I7NA 3CF6E 3GRVA 3RGSA 4Z8XA 4W5WA 5DYIA 4LY6A 3SHGB 1PJJA 4NXMM 1NHGC 3I51A 4LF6M 4GKJM 3FKEA 1W5SA 2HHHM 4JI2M 5EXTA 4B3MM 2QENA 1N77A 2V6ZM 2ZBKB 1KFVA 1NNJA 3GLIB 1TDHA 4DR3M 4CGYB 3IG5A 2W82A 1IN7A 3ZH9B 3KVWA 4G6ZA 3W0FA 2EUCA 1K82A 3J7BA 4AKIA 5E6JA 2UXCM 3KXEC 1XMOM 4LJ4A 4MH0E 4GC9A 4IJFA 5EQTA 7CATA 4Z6YA 1IN6A 2RGHA 2UU9M 4GMQA 5EXSA 2KA6B 4LRSA 2RKOA 1TH4A 2M60A 4PT5A 1QANA 1QZMA 4A3VB 2XF3A 3T1YM 1Q3BA 5H37D 3GPXA 4FW9A 3J81S 3VK8A 5FLXS 5ITRA 2FFJA 3I4VA 2UXBM 3DA1A 4M9ZA 4B7GA 2KZSA 3BOSA 3U6SA 2J7OA 3FTEA 3AV0A 2KZUA 1DGBA 3HHXA 4LF4M 1TH2A 3U61A 3RFWA 5A2QS 3HHWA 3SMPA 4CISA 3NWLA 4QHTA 2YQZA 4LF9M 1OFIA 1XNQM 2XSZA 3IG8A 1OFHA 3HKPA 3K92A 2QCUA 3R8FA 1G3IA 4JN6A 4NOOB 2OPFA 4AI6A 3KP0E 1K3WA 2HKJA 3M7GA 2XFTA 2X4AA 4S12A 5EXPA 1IN4A 2C96A 2QPAA 3WHKA 2F4VM 3AL0C 4G4OA 1YE9A 3PXGA 3FD9A 4I81A 4KODA 5EXXA 4LFAM 4ZPXA 2NQ8C 3HU2A 3L27A 4GHLA 1IY2A 3A46A 2AHMA 1NY5A 2HL7A 4G4QA 3SAWA 5IREB 3A98B 4AQYM 3FYDA 3SAVA 4JYAM 3PNVA 1I4WA 4M0WA 4CHTB 5LMNM 5EP4A 1L8QA 4OVZB 3HWSA 4JI7M 2V1CA 2XFSA 5E26A 4OVZA 5IT9S 1G41A 4LFBM 3B9PA 5KPTA 1N75A 5ITXE 2OQ4A 1R7RA 2CUZA 1HT2E 2X8AA 3GPUA 3U6LA 4LF7M 3KW6A 1PM5A 1NVMA 3GP1A 4MGIE 4AG6A 4G4NA 1HNWM 1TGUA 4IBCA 3U6PA 3W0LB 2K47A 5ITTA 1G59A 3UGJA 2R62A 5IWAM 2QP9X 3RE8A 1PJIA 4DV3M 1NJGA 1QYRA 1IBMM 1N36M 4PDGA 4AZFA 2F5QA 4LG2A 3SC3A 4LJAA 4B3SM 4IBJA 4GKKM 3VFDA 3AKZA 1NNUC 1DGGA 2UUAM 4OW0A 3VDUA 4NSRA 4FVMA 1HNZM 5KQDA 4LGMA 3K2LA 2QZ4A 2CHGA 4D80A 4AKGA 2Y20A 2I7PA 2DVWB 2R65A 3FUUA 4BB9A 3GLGA 5ITXA 4B7FA 4GC5A 2XZUA 1IXZA 3FTCA 4JI0M 1TH3A 3ZC7B 3LQRA 2QBYB 4KHPM 3KOYE 4JI6M 1IXSB 5C1BA 5JI2E 2ZM6M 3THGA 1E94E 2Z7JA 2QBYA 4LCBA 3CTWB 4P16A 1R2YA 2R18A 3ILKA 2DWLA 1IQPA 4DR4M 4LFCM 3SASA 4IBBA 1MU5A 1QVRA 2BJWA 2YR0A 3HU3A 1H6UA 4M0DA 1QAQA 3GQ3A 4QOZC 1FNNA 3VK7A 3VKGA 4KO8A 3L26A 2CV1A 3J7AS 3Q8XA 3I4YA 4LJ7A 2KXEA 4D82A 1HQYE 2M5ZA 4I5SA 3J2PB 1R2ZA 3TWKA 4XBOA 3CF2A 4R7GA 5C18A 2Z4SA 4DR1M 5BR8M 3GRRA 1Z5AA 2Y21A 3GRYA 4MGYE 4JV5M 2FE8A 4DV7M 4LZZA 3T38A 4L15A 3RGPA 2KRKA 4PDIA 3DOAA 3SYLA 2Z3XA 3UK6A 3KOZE 1SXJE 4WW0A 4HLQA 3SAUA 2ZANA 1JQJC 2FOIC 1JR3A 4NRWA 4K0KM 1FJGM 1QAOA 3K1JA 4B08A 2F5PA 4AG5A 5ITYA 3U61B 1YUBA 2H1RA 4I8OA 3TE6A 3GLFB 2UXDM 2A5YB 4LJ8A 3JAMS 4YHHM 3PVSA 1L1TA 4II7A 4QNRA 4BBAA 3GLFA 4IBFA 3U5ZB 4IIWA 3HHYA 3KSJA 1Z5BA 5EP3A 3J80S 3U5ZA 2CE7A 2R46A 1SXJA 3KFUG 1GVNA 4NXNM 4GIPA 1XMQM 1N33M 1I94M 2CHVA 2C9OA 4IBEA 2EA0A 3U6MA 4REZA 3MK6A 1D2NA 2ZAOA 3DZDA 3VKHA 4DV6M 1X37A 5F3WA 1IN8A 5DYGA 4B3TM 3GO8A 5DNYA 5KPZA 2LXEA 2Z4RA 2O5RA 2YNMD 3FYCA 2DWZB 4LGYA 2UUCM 3QAUA 4DR6M 3GQ5A 3L28A 2DWNA 1GLNA 1XHBA 3E4RA 1JR3D 2FNAA 4FWGA 3D8LA 3KOXE 2L09A 3TL4X 3SFZA 2CV0A 2KRUA 4GITA 4GHAA 3M0EA 3AOGA 2R4JA 4DUYM 4DV4M 3U60A 1N78A 3GLHA 4GH9A 4PD2A 3HHZA 4JI5M 2DZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  2P5T A;  1GVN A; 
#chains in the Genus database with same CATH topology
 1S3S A;  3B74 A;  1OIZ A;  1XWI A;  2JY8 A;  4P17 A;  3R9X B;  2XSZ D;  1IN5 A;  3SYK A;  2JY7 A;  2Q2E B;  2E5L M;  2C5R A;  2ERC A;  3HJS A;  2LVN C;  2XH9 A;  1IBK M;  4IBK A;  2JWS A;  1WIV A;  1QAM A;  3GLG B;  3SMS A;  1EE8 A;  1OIP A;  4M9S A;  5EP2 A;  4DR2 M;  1KYI A;  2D7G A;  2LNH C;  2CV2 A;  1LTM A;  3PFI A;  2FH0 A;  1L2B A;  3W68 A;  2XGN A;  3I04 M;  2XLJ A;  5ITU A;  1G71 A;  2EKK A;  3FE3 A;  1PJQ A;  4DR7 M;  4RF1 A;  1DO2 A;  1MX0 A;  2DHY A;  3LVW A;  2J7N A;  5IZ7 D;  3T15 A;  4DV2 M;  4JXJ A;  3FUT A;  2R6F A;  1XNR M;  2BWB A;  1SXJ C;  5JI3 E;  2F5O A;  3D8B A;  1GJT A;  5BPV A;  2XEP A;  2WZJ A;  4G4R A;  3FRH A;  3JR5 A;  1C1K A;  1OQY A;  2CWB A;  3K8Z A;  3TWM A;  1DV0 A;  3GLI E;  3UZU A;  2G5G X;  2P5T A;  4IJE A;  4QOS A;  1J5E M;  2JXN A;  1LV7 A;  1NHW C;  2R45 A;  3L29 A;  1HR0 M;  3NBI A;  1N34 M;  2UUB M;  3FUW A;  4DV1 M;  1NO1 A;  2YFQ A;  2F5N A;  3CF0 A;  2HCB A;  1VDD A;  2DAM A;  2Y0T A;  3KS4 A;  4FCW A;  1NV9 A;  3UJN A;  1QQW A;  2C9C A;  4L4U A;  3T6P A;  4JI1 M;  1HQC A;  4WUR A;  3MHV C;  5FTK A;  1XXH E;  3AFH A;  4M9X A;  2V1U A;  4NSO B;  4RF0 A;  1K3X A;  5ITQ A;  2CEA A;  3EIH A;  1OJL A;  4MGK E;  2DWM A;  2DNA A;  1T3T A;  3FTD A;  5FSW A;  4AKH A;  1R6B X;  1G4A E;  2G8L A;  3AJI B;  3GLI A;  3SAT A;  1L2C A;  2LWX A;  3FTF A;  4FCV A;  1VQ1 A;  3L2A A;  4FWH A;  2LHC A;  4NRV A;  3TWL A;  5L8R F;  2VQE M;  2LVA A;  1PJT A;  1WJ7 A;  3SHF A;  1NSF A;  4QHS A;  4LRT A;  4I4L A;  1GL7 A;  2C99 A;  3LMM A;  1HJP A;  2KW0 A;  4X66 M;  1V92 A;  3GPP A;  2VQF M;  3QWL A;  2JA2 A;  2EO2 A;  2X49 A;  4EIW A;  4OU7 A;  1XXH B;  4D81 A;  1RU3 A;  2F5S A;  1SXJ B;  1IY1 A;  1GKI A;  5LMU M;  4GHA A;  2VF7 A;  1XXH A;  3HU1 A;  4WP2 A;  1E32 A;  1KSF X;  1Z59 A;  2R4E A;  1J7K A;  1DGH B;  1TF0 B;  3VLF B;  1L1Z A;  1YSY A;  1VDL A;  1XC8 A;  1DGH A;  3A42 A;  1W5T A;  3C3E A;  4MGZ E;  3TQS A;  1T6O A;  4G3O A;  4TUW A;  3AOE A;  3JR4 A;  4JI8 M;  3LVV A;  3IEC A;  4RNA A;  1ZAE A;  3C58 A;  4PCZ A;  2BJV A;  2DHR A;  2L7I A;  4X64 M;  3E46 A;  1OTR A;  3K9O A;  1N32 M;  4XGI A;  1VG5 A;  1SG9 A;  3HY5 A;  3U6D A;  4DV5 M;  1MN3 A;  3OTO M;  3U60 B;  2QHO B;  1TDZ A;  5KPR A;  4AW4 A;  4MM3 B;  3GLH B;  5FTJ A;  5FTL A;  2CFO A;  1HT1 E;  3VDP A;  4X65 M;  5KQ8 A;  2B3T A;  3EIE A;  4R3D A;  2XZF A;  3PNY A;  2DZO B;  3V76 A;  1ORY B;  4ITQ A;  3TPZ A;  3C9P A;  4IBG A;  4FD2 A;  4L78 A;  3MJ5 A;  2RGO A;  3LQQ A;  4KLN A;  4BLC A;  1DO0 A;  5GKN A;  5DFL A;  1D0M A;  4LF8 M;  3A45 A;  5KO3 A;  2FS1 A;  4LF5 M;  1ZQ9 A;  1OKS A;  4B3R M;  3KSX A;  2LVQ D;  4L8R C;  1Z5C A;  4YY3 M;  1D0L A;  2DAI A;  1DGF A;  1Z6T A;  4DUZ M;  4JI3 M;  1NJF A;  2C98 A;  4DR5 M;  1GL6 A;  1SXJ D;  2D7H A;  4LJ9 A;  3UMM A;  1NY6 A;  1ZMU A;  3HJ8 A;  3SAR A;  4JI4 M;  2JZ0 A;  3H4J A;  3ZQJ A;  2GNO A;  1R5L A;  2DI0 A;  1T43 A;  4LJ6 A;  1Q39 A;  3U6E A;  2D7E A;  3KOW E;  1G8P A;  2BNK A;  2DAE A;  3KDS E;  4FCT A;  4LJ5 A;  4GRI A;  3BBZ A;  3KP1 E;  4HL4 A;  2KEB A;  2LH0 A;  4QNM A;  1UM8 A;  2RRU A;  4DV0 M;  1IXR C;  3DFZ A;  3HJQ A;  4IBD A;  3U6O A;  3ZCB B;  2JY6 B;  3T1H M;  1V33 A;  1IM2 A;  2L7H A;  4MB7 A;  3GQ4 A;  1E9S A;  3B7Z A;  3GPY A;  2O01 F;  5FTN A;  2DXI A;  3KS8 A;  2DEN A;  4B7H A;  1E9R A;  1QDR A;  3B7Q A;  3GRU A;  5EP1 A;  4L16 A;  4NL4 H;  4IBI A;  1HNX M;  2VII A;  1Q3C A;  1ZV1 A;  3L25 A;  2L6O A;  4UN2 B;  2ZAM A;  1IBL M;  3WHL A;  1L2D A;  3U6Q A;  3U6C A;  3FUV A;  2CHQ A;  4MGH A;  4LZJ A;  8CAT A;  4X62 M;  3AOE C;  5EJC A;  3HGI A;  3M6A A;  3F92 A;  3H4M A;  4FWD A;  3B7N A;  1J09 A;  1GJS A;  5FTM A;  4ANR A;  1YLA A;  1IXS A;  2Y0Q A;  3FUX A;  4Q7J A;  4OX9 M;  2KNV A;  3E9S A;  3J27 B;  1WXQ A;  1IY0 A;  1QDT A;  3SBJ A;  2I7N A;  3CF6 E;  3GRV A;  3RGS A;  4Z8X A;  4W5W A;  5DYI A;  4LY6 A;  3SHG B;  1PJJ A;  4NXM M;  1NHG C;  3I51 A;  4LF6 M;  4GKJ M;  3FKE A;  1W5S A;  2HHH M;  4JI2 M;  5EXT A;  4B3M M;  2QEN A;  1N77 A;  4F1I A;  2V6Z M;  2MGW A;  2ZBK B;  1KFV A;  1NNJ A;  3GLI B;  1TDH A;  4DR3 M;  4CGY B;  3IG5 A;  2W82 A;  1IN7 A;  3ZH9 B;  1OAI A;  3QYB A;  3KVW A;  4G6Z A;  3W0F A;  2EUC A;  1K82 A;  3J7B A;  1AIP C;  4AKI A;  5E6J A;  2UXC M;  1QUT A;  3LCU A;  3KXE C;  1XMO M;  4LJ4 A;  3E21 A;  4MH0 E;  4GC9 A;  4IJF A;  5EQT A;  7CAT A;  4Z6Y A;  1IN6 A;  2GQF A;  2RGH A;  2UU9 M;  4GMQ A;  5EXS A;  2KA6 B;  4LRS A;  2RKO A;  1TH4 A;  2M60 A;  4GEW A;  1Q02 A;  4PT5 A;  1QAN A;  1QZM A;  4A3V B;  2XF3 A;  3T1Y M;  1Q3B A;  5H37 D;  3GPX A;  4FW9 A;  2CP8 A;  3J81 S;  3VK8 A;  1QUS A;  2Z8Y M;  5ITR A;  2FFJ A;  3BXW A;  3I4V A;  5FLX S;  2UXB M;  3DA1 A;  4M9Z A;  4B7G A;  1IFY A;  2KZS A;  3BOS A;  2JP7 A;  2OOA A;  4RKU F;  3U6S A;  2J7O A;  3FTE A;  3AV0 A;  2KZU A;  1TR8 A;  3QYE A;  1DGB A;  3HHX A;  4LF4 M;  1TH2 A;  2L2D A;  1EFU B;  3U61 A;  2JZ1 A;  4NC6 A;  1MJG M;  3HHW A;  3RFW A;  3SMP A;  5A2Q S;  4CIS A;  3NWL A;  4QHT A;  2YQZ A;  4LF9 M;  1OFI A;  1XNQ M;  1JB0 F;  2XSZ A;  3IG8 A;  1OFH A;  3Q8G A;  2QQ8 A;  3HKP A;  1F4I A;  2ZTD A;  3K92 A;  2QCU A;  3R8F A;  1G3I A;  4JN6 A;  4NOO B;  2OPF A;  4AI6 A;  3KP0 E;  4R71 A;  1CUK A;  1K3W A;  2HKJ A;  3M7G A;  2XFT A;  1AUA A;  1ZMV A;  2X4A A;  4S12 A;  5EXP A;  2APL A;  1IN4 A;  2C96 A;  2QPA A;  3WHK A;  1UFZ A;  2F4V M;  3AL0 C;  4G4O A;  1YE9 A;  2K6B A;  3PXG A;  2CRU A;  3FD9 A;  1WGN A;  4I81 A;  4KOD A;  5EXX A;  2EKF A;  4ZPX A;  4LFA M;  1GAB A;  1WGL A;  2NQ8 C;  3HU2 A;  3L27 A;  4GHL A;  1IY2 A;  3A46 A;  2AHM A;  1NY5 A;  2HL7 A;  4G4Q A;  3SAW A;  5IRE B;  3A98 B;  4AQY M;  3FYD A;  3MMP A;  3SAV A;  4JYA M;  3PNV A;  1I4W A;  4M0W A;  2H5X A;  4CHT B;  5LMN M;  5EP4 A;  1L8Q A;  3HX3 A;  4OVZ B;  3HWS A;  4JI7 M;  2V1C A;  3C3D A;  2XFS A;  5E26 A;  4OVZ A;  1OAO C;  5IT9 S;  1G41 A;  3GLG E;  1VEJ A;  4LFB M;  3B9P A;  5KPT A;  1N75 A;  5ITX E;  2OQ4 A;  1R7R A;  2CUZ A;  2LHG A;  1HT2 E;  2X8A A;  3GPU A;  3U6L A;  4LF7 M;  2HAK A;  3KW6 A;  2BWE A;  1PM5 A;  1NVM A;  1V34 A;  3GP1 A;  4MGI E;  1WR1 B;  4AG6 A;  4G4N A;  1HNW M;  1TGU A;  4IBC A;  4F2L A;  3W0L B;  3U6P A;  2K47 A;  2KNA A;  5ITT A;  1G59 A;  3UGJ A;  1C7Y A;  2R62 A;  5IWA M;  2QP9 X;  3B89 A;  3RE8 A;  3NBX X;  4DV3 M;  1NJG A;  1QYR A;  1PJI A;  1IBM M;  1N36 M;  2R0I A;  2MH8 A;  4PDG A;  4AZF A;  2F5Q A;  4LG2 A;  3SC3 A;  4LJA A;  4B3S M;  2K9D A;  1ZMW A;  4IBJ A;  2KHH A;  4GKK M;  3VFD A;  3AKZ A;  1NNU C;  3I01 M;  1DGG A;  2UUA M;  4OW0 A;  3VDU A;  2VDB B;  4NSR A;  4FVM A;  1HNZ M;  2K0B X;  5KQD A;  1D0K A;  4LGM A;  3K2L A;  2QZ4 A;  2CHG A;  4D80 A;  4AKG A;  2EJS A;  2I7P A;  2Y20 A;  3HZJ A;  2DVW B;  2R65 A;  3FUU A;  4BB9 A;  3GLG A;  2JNH A;  5ITX A;  1TTE A;  4B7F A;  4CIZ A;  4GC5 A;  2DAK A;  2XZU A;  1IXZ A;  3FTC A;  2JY5 A;  4JI0 M;  1TH3 A;  3ZC7 B;  3LQR A;  4Y28 F;  4HEO A;  2QBY B;  4KHP M;  3KOY E;  4JI6 M;  1IXS B;  5C1B A;  5JI2 E;  2ZM6 M;  3THG A;  1E94 E;  2QSF X;  1PGY A;  2Z7J A;  4LCB A;  3CTW B;  2KDL A;  4P16 A;  2R18 A;  3ILK A;  1R2Y A;  2DWL A;  2QBY A;  1IQP A;  4DR4 M;  4LFC M;  2G3Q A;  4IBB A;  3SAS A;  1MU5 A;  1QVR A;  2BJW A;  2YR0 A;  3HU3 A;  1H6U A;  4M0D A;  4KT0 F;  1QAQ A;  3GQ3 A;  4QOZ C;  1FNN A;  3VK7 A;  1JR3 E;  3VKG A;  2O25 A;  4KO8 A;  3L26 A;  2CV1 A;  3J7A S;  1NV8 A;  3Q8X A;  4XK8 F;  3I4Y A;  2KNZ A;  4LJ7 A;  1VEG A;  2KXE A;  2HWJ A;  4D82 A;  1HQY E;  1XB2 B;  2M5Z A;  3J2P B;  4I5S A;  1R2Z A;  2J5Y A;  3TWK A;  3CGW A;  4XBO A;  3CF2 A;  4R7G A;  5C18 A;  1EIJ A;  2Z4S A;  4DR1 M;  3GLF E;  5BR8 M;  2LTU A;  3GRR A;  1Z5A A;  2Y21 A;  3GRY A;  4MGY E;  4JV5 M;  2FE8 A;  4DV7 M;  4LZZ A;  3K9P A;  3T38 A;  4L15 A;  3RGP A;  2KRK A;  2QNJ A;  2DAG A;  3DOA A;  3SYL A;  3UK6 A;  4PDI A;  2Z3X A;  3KOZ E;  1SXJ E;  4WW0 A;  4HLQ A;  3SAU A;  2ZAN A;  1JQJ C;  2FOI C;  2MJ5 B;  1JR3 A;  4NRW A;  4K0K M;  1FJG M;  1QAO A;  3K1J A;  4B08 A;  2F5P A;  2L4F A;  2OOB A;  4AG5 A;  5ITY A;  3U61 B;  1YUB A;  2H1R A;  4I8O A;  3TE6 A;  3GLF B;  2UXD M;  2A5Y B;  4LJ8 A;  3JAM S;  3LW5 F;  3PVS A;  4YHH M;  1L1T A;  2L4E A;  2LVP C;  4II7 A;  4QNR A;  2WSC F;  4IBF A;  4BBA A;  1PJS A;  3GLF A;  3U5Z B;  4IIW A;  3HHY A;  3KSJ A;  4CJ6 A;  2LVO C;  1Z5B A;  5EP3 A;  2WSE F;  3J80 S;  1BVS A;  3U5Z A;  2R44 A;  2MR9 A;  2CE7 A;  2R46 A;  1SXJ A;  3GLH E;  3KFU G;  1GVN A;  4NXN M;  4GIP A;  1XMQ M;  2VF8 A;  1I94 M;  1N33 M;  2JUJ A;  2CHV A;  2C9O A;  4IBE A;  2EA0 A;  3U6M A;  1QZE A;  4REZ A;  3MK6 A;  1D2N A;  2ZAO A;  3DZD A;  3VKH A;  2WSF F;  1X37 A;  4DV6 M;  5F3W A;  1IN8 A;  2LBC A;  1Y8G A;  5DYG A;  4B3T M;  3GO8 A;  5DNY A;  5KPZ A;  2LXE A;  2Z4R A;  2MRO B;  1VEK A;  3W67 A;  2O5R A;  2YNM D;  3FYC A;  2DWZ B;  2ZTC A;  4LGY A;  2OO9 A;  1PRB A;  2UUC M;  2N35 A;  1P3Q Q;  3QAU A;  4DR6 M;  3GQ5 A;  3L28 A;  4L6V 6;  2DWN A;  1GLN A;  1GO5 A;  1XHB A;  4DBG B;  2DZL A;  3E4R A;  1JR3 D;  3IHP A;  2FNA A;  4FWG A;  1A5T A;  3D8L A;  2L09 A;  3KOX E;  2DKL A;  1R4G A;  2KRU A;  4GIT A;  3SFZ A;  3TL4 X;  2CV0 A;  3M0E A;  3AOG A;  3FRI A;  2R4J A;  4DUY M;  4DV4 M;  3U60 A;  1N78 A;  3GLH A;  4GH9 A;  4PD2 A;  3LCV B;  3HHZ A;  4JI5 M;  2DZN B;  1WHC A; 
#chains in the Genus database with same CATH homology
 1S3S A;  1XWI A;  3R9X B;  2XSZ D;  1IN5 A;  3SYK A;  2Q2E B;  2E5L M;  2C5R A;  2ERC A;  3HJS A;  2XH9 A;  1IBK M;  4IBK A;  1QAM A;  3GLG B;  3SMS A;  1EE8 A;  4M9S A;  5EP2 A;  4DR2 M;  1KYI A;  2D7G A;  2LNH C;  2CV2 A;  3PFI A;  1L2B A;  2XGN A;  2XLJ A;  5ITU A;  4DR7 M;  4RF1 A;  1DO2 A;  1MX0 A;  3LVW A;  2J7N A;  5IZ7 D;  3T15 A;  4DV2 M;  4JXJ A;  3FUT A;  1XNR M;  1SXJ C;  5JI3 E;  2F5O A;  3D8B A;  5BPV A;  2XEP A;  4G4R A;  3JR5 A;  1C1K A;  3K8Z A;  3TWM A;  3UZU A;  2G5G X;  2P5T A;  4IJE A;  4QOS A;  1J5E M;  1LV7 A;  1NHW C;  2R45 A;  3L29 A;  1HR0 M;  3NBI A;  1N34 M;  2UUB M;  3FUW A;  4DV1 M;  2YFQ A;  2F5N A;  3CF0 A;  2HCB A;  1VDD A;  4FCW A;  2Y0T A;  3KS4 A;  3UJN A;  1QQW A;  2C9C A;  4L4U A;  4JI1 M;  1HQC A;  4WUR A;  3MHV C;  5FTK A;  3AFH A;  4M9X A;  2V1U A;  4NSO B;  4RF0 A;  1K3X A;  5ITQ A;  2CEA A;  3EIH A;  1OJL A;  4MGK E;  2DWM A;  1T3T A;  3FTD A;  5FSW A;  4AKH A;  1R6B X;  1G4A E;  2G8L A;  3AJI B;  3GLI A;  3SAT A;  1L2C A;  2LWX A;  3FTF A;  4FCV A;  3L2A A;  4FWH A;  4NRV A;  3TWL A;  2VQE M;  3SHF A;  1NSF A;  4QHS A;  4LRT A;  4I4L A;  1GL7 A;  2C99 A;  3LMM A;  2KW0 A;  4X66 M;  3GPP A;  2VQF M;  3QWL A;  2JA2 A;  2EO2 A;  2X49 A;  4EIW A;  4OU7 A;  1XXH B;  4D81 A;  2F5S A;  1SXJ B;  1IY1 A;  1GKI A;  5LMU M;  1XXH A;  3HU1 A;  1E32 A;  1KSF X;  1Z59 A;  2R4E A;  1J7K A;  1DGH B;  3VLF B;  1L1Z A;  1YSY A;  1XC8 A;  3A42 A;  1DGH A;  1W5T A;  4MGZ E;  3TQS A;  4TUW A;  3AOE A;  3JR4 A;  4JI8 M;  3LVV A;  4RNA A;  1ZAE A;  3C58 A;  4PCZ A;  2BJV A;  2DHR A;  2L7I A;  4X64 M;  1N32 M;  4XGI A;  3U6D A;  4DV5 M;  3OTO M;  3U60 B;  1TDZ A;  5KPR A;  4AW4 A;  4MM3 B;  3GLH B;  5FTJ A;  5FTL A;  2CFO A;  1HT1 E;  3VDP A;  4X65 M;  5KQ8 A;  3EIE A;  4R3D A;  2XZF A;  3PNY A;  2DZO B;  1ORY B;  4ITQ A;  3TPZ A;  4IBG A;  4FD2 A;  4L78 A;  3MJ5 A;  2RGO A;  3LQQ A;  4KLN A;  4BLC A;  1DO0 A;  5GKN A;  4LF8 M;  3A45 A;  5KO3 A;  4LF5 M;  1ZQ9 A;  4B3R M;  3KSX A;  4L8R C;  1Z5C A;  4YY3 M;  1DGF A;  1Z6T A;  4DUZ M;  4JI3 M;  1NJF A;  2C98 A;  4DR5 M;  1GL6 A;  1SXJ D;  2D7H A;  4LJ9 A;  3UMM A;  1NY6 A;  3HJ8 A;  3SAR A;  4JI4 M;  4LJ6 A;  1Q39 A;  3U6E A;  2D7E A;  3KOW E;  1G8P A;  2BNK A;  3KDS E;  4FCT A;  4LJ5 A;  4GRI A;  4HL4 A;  3KP1 E;  4QNM A;  2KEB A;  2LH0 A;  1UM8 A;  4DV0 M;  1IXR C;  3DFZ A;  3HJQ A;  4IBD A;  3U6O A;  3ZCB B;  3T1H M;  1IM2 A;  2L7H A;  4MB7 A;  3GQ4 A;  1E9S A;  3GPY A;  5FTN A;  2DXI A;  3KS8 A;  4B7H A;  1E9R A;  3GRU A;  5EP1 A;  4L16 A;  4NL4 H;  4IBI A;  1HNX M;  2VII A;  1Q3C A;  3L25 A;  2L6O A;  2ZAM A;  1IBL M;  3WHL A;  1L2D A;  3U6Q A;  3U6C A;  3FUV A;  2CHQ A;  4MGH A;  4LZJ A;  8CAT A;  4X62 M;  3AOE C;  5EJC A;  3HGI A;  3M6A A;  3H4M A;  4FWD A;  1J09 A;  5FTM A;  2Y0Q A;  3FUX A;  4OX9 M;  3E9S A;  3J27 B;  1WXQ A;  1IY0 A;  3SBJ A;  2I7N A;  3CF6 E;  3GRV A;  3RGS A;  4Z8X A;  4W5W A;  5DYI A;  4LY6 A;  3SHG B;  1PJJ A;  4NXM M;  1NHG C;  3I51 A;  4LF6 M;  4GKJ M;  3FKE A;  1W5S A;  2HHH M;  4JI2 M;  5EXT A;  4B3M M;  2QEN A;  1N77 A;  2V6Z M;  2ZBK B;  1KFV A;  1NNJ A;  3GLI B;  1TDH A;  4DR3 M;  4CGY B;  3IG5 A;  2W82 A;  1IN7 A;  3ZH9 B;  3KVW A;  4G6Z A;  3W0F A;  2EUC A;  1K82 A;  3J7B A;  4AKI A;  5E6J A;  2UXC M;  3KXE C;  1XMO M;  4LJ4 A;  4MH0 E;  4GC9 A;  4IJF A;  5EQT A;  7CAT A;  4Z6Y A;  1IN6 A;  2RGH A;  2UU9 M;  4GMQ A;  5EXS A;  2KA6 B;  4LRS A;  2RKO A;  1TH4 A;  2M60 A;  4PT5 A;  1QAN A;  1QZM A;  4A3V B;  2XF3 A;  3T1Y M;  1Q3B A;  5H37 D;  3GPX A;  4FW9 A;  3J81 S;  3VK8 A;  5FLX S;  5ITR A;  2FFJ A;  3I4V A;  2UXB M;  3DA1 A;  4M9Z A;  4B7G A;  2KZS A;  3BOS A;  3U6S A;  2J7O A;  3FTE A;  3AV0 A;  2KZU A;  1DGB A;  3HHX A;  4LF4 M;  1TH2 A;  3U61 A;  3RFW A;  5A2Q S;  3HHW A;  3SMP A;  4CIS A;  3NWL A;  4QHT A;  2YQZ A;  4LF9 M;  1OFI A;  1XNQ M;  2XSZ A;  3IG8 A;  1OFH A;  3HKP A;  3K92 A;  2QCU A;  3R8F A;  1G3I A;  4JN6 A;  4NOO B;  2OPF A;  4AI6 A;  3KP0 E;  1K3W A;  2HKJ A;  3M7G A;  2XFT A;  2X4A A;  4S12 A;  5EXP A;  1IN4 A;  2C96 A;  2QPA A;  3WHK A;  2F4V M;  3AL0 C;  4G4O A;  1YE9 A;  3PXG A;  3FD9 A;  4I81 A;  4KOD A;  5EXX A;  4LFA M;  4ZPX A;  2NQ8 C;  3HU2 A;  3L27 A;  4GHL A;  1IY2 A;  3A46 A;  2AHM A;  1NY5 A;  2HL7 A;  4G4Q A;  3SAW A;  5IRE B;  3A98 B;  4AQY M;  3FYD A;  3SAV A;  4JYA M;  3PNV A;  1I4W A;  4M0W A;  4CHT B;  5LMN M;  5EP4 A;  1L8Q A;  4OVZ B;  3HWS A;  4JI7 M;  2V1C A;  2XFS A;  5E26 A;  4OVZ A;  5IT9 S;  1G41 A;  4LFB M;  3B9P A;  5KPT A;  1N75 A;  5ITX E;  2OQ4 A;  1R7R A;  2CUZ A;  1HT2 E;  2X8A A;  3GPU A;  3U6L A;  4LF7 M;  3KW6 A;  1PM5 A;  1NVM A;  3GP1 A;  4MGI E;  4AG6 A;  4G4N A;  1HNW M;  1TGU A;  4IBC A;  3U6P A;  3W0L B;  2K47 A;  5ITT A;  1G59 A;  3UGJ A;  2R62 A;  5IWA M;  2QP9 X;  3RE8 A;  1PJI A;  4DV3 M;  1NJG A;  1QYR A;  1IBM M;  1N36 M;  4PDG A;  4AZF A;  2F5Q A;  4LG2 A;  3SC3 A;  4LJA A;  4B3S M;  4IBJ A;  4GKK M;  3VFD A;  3AKZ A;  1NNU C;  1DGG A;  2UUA M;  4OW0 A;  3VDU A;  4NSR A;  4FVM A;  1HNZ M;  5KQD A;  4LGM A;  3K2L A;  2QZ4 A;  2CHG A;  4D80 A;  4AKG A;  2Y20 A;  2I7P A;  2DVW B;  2R65 A;  3FUU A;  4BB9 A;  3GLG A;  5ITX A;  4B7F A;  4GC5 A;  2XZU A;  1IXZ A;  3FTC A;  4JI0 M;  1TH3 A;  3ZC7 B;  3LQR A;  2QBY B;  4KHP M;  3KOY E;  4JI6 M;  1IXS B;  5C1B A;  5JI2 E;  2ZM6 M;  3THG A;  1E94 E;  2Z7J A;  2QBY A;  4LCB A;  3CTW B;  4P16 A;  1R2Y A;  2R18 A;  3ILK A;  2DWL A;  1IQP A;  4DR4 M;  4LFC M;  3SAS A;  4IBB A;  1MU5 A;  1QVR A;  2BJW A;  2YR0 A;  3HU3 A;  1H6U A;  4M0D A;  1QAQ A;  3GQ3 A;  4QOZ C;  1FNN A;  3VK7 A;  3VKG A;  4KO8 A;  3L26 A;  2CV1 A;  3J7A S;  3Q8X A;  3I4Y A;  4LJ7 A;  2KXE A;  4D82 A;  1HQY E;  2M5Z A;  4I5S A;  3J2P B;  1R2Z A;  3TWK A;  4XBO A;  3CF2 A;  4R7G A;  5C18 A;  2Z4S A;  4DR1 M;  5BR8 M;  3GRR A;  1Z5A A;  2Y21 A;  3GRY A;  4MGY E;  4JV5 M;  2FE8 A;  4DV7 M;  4LZZ A;  3T38 A;  4L15 A;  3RGP A;  2KRK A;  4PDI A;  3DOA A;  3SYL A;  2Z3X A;  3UK6 A;  3KOZ E;  1SXJ E;  4WW0 A;  4HLQ A;  3SAU A;  2ZAN A;  1JQJ C;  2FOI C;  1JR3 A;  4NRW A;  4K0K M;  1FJG M;  1QAO A;  3K1J A;  4B08 A;  2F5P A;  4AG5 A;  5ITY A;  3U61 B;  1YUB A;  2H1R A;  4I8O A;  3TE6 A;  3GLF B;  2UXD M;  2A5Y B;  4LJ8 A;  3JAM S;  4YHH M;  3PVS A;  1L1T A;  4II7 A;  4QNR A;  4BBA A;  3GLF A;  4IBF A;  3U5Z B;  4IIW A;  3HHY A;  3KSJ A;  1Z5B A;  5EP3 A;  3J80 S;  3U5Z A;  2CE7 A;  2R46 A;  1SXJ A;  3KFU G;  1GVN A;  4NXN M;  4GIP A;  1XMQ M;  1N33 M;  1I94 M;  2CHV A;  2C9O A;  4IBE A;  2EA0 A;  3U6M A;  4REZ A;  3MK6 A;  1D2N A;  2ZAO A;  3DZD A;  3VKH A;  4DV6 M;  1X37 A;  5F3W A;  1IN8 A;  5DYG A;  4B3T M;  3GO8 A;  5DNY A;  5KPZ A;  2LXE A;  2Z4R A;  2O5R A;  2YNM D;  3FYC A;  2DWZ B;  4LGY A;  2UUC M;  3QAU A;  4DR6 M;  3GQ5 A;  3L28 A;  2DWN A;  1GLN A;  1XHB A;  3E4R A;  1JR3 D;  2FNA A;  4FWG A;  3D8L A;  3KOX E;  2L09 A;  3TL4 X;  3SFZ A;  2CV0 A;  2KRU A;  4GIT A;  4GHA A;  3M0E A;  3AOG A;  2R4J A;  4DUY M;  4DV4 M;  3U60 A;  1N78 A;  3GLH A;  4GH9 A;  4PD2 A;  3HHZ A;  4JI5 M;  2DZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...