3Q8XA

Structure of a toxin-antitoxin system bound to its substrate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
b'VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antidote of epsilon-zeta postsegregational killing system
molecule tags Transferase
source organism Streptococcus pyogenes
publication title A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis.
pubmed doi rcsb
total genus 35
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3q8xA00
3Q8XA 1GVNA 2P5TA
chains in the Genus database with same CATH superfamily
3FE3A 1HR0M 4DV2M 1QAMA 3J7AS 2FNAA 2R62A 2UUCM 3KOZE 3U5ZA 3RGSA 2C99A 4GIPA 2R44A 4M9ZA 2K0BX 2HL7A 2ZANA 3RFWA 3I04M 1K3XA 1L1TA 3FTEA 4CIZA 3GLGB 4XBOA 4P16A 4DBGB 1GKIA 4QNRA 3GLHE 1PGYA 1SXJD 1YLAA 1V33A 2WSCF 3FTDA 3GRYA 2RRUA 2MJ5B 2QBYA 1G3IA 2QNJA 2VF7A 4RNAA 3BBZA 3FD9A 4ANRA 4JI8M 2LHGA 4LJ9A 1J5EM 3K9OA 3QWLA 1HQCA 2BWBA 1PJQA 3R9XB 1QUSA 4AZFA 2JA2A 1OKSA 3Q8GA 4QOSA 1JQJC 5FTNA 2WZJA 1XWIA 2DAMA 4A3VB 4UN2B 4Z8XA 4BB9A 3PNVA 1VDLA 1XXHE 4AKHA 1JR3A 3SMPA 3RE8A 4I4LA 1UM8A 3B89A 1EFUB 1XXHB 2XZUA 3E46A 4GC9A 3HHZA 3THGA 1DO0A 2GNOA 3WHLA 4LFAM 4JI3M 2DWLA 1IXSB 4GEWA 4IBBA 4YY3M 3Q8XA 3GRVA 4G6ZA 1TF0B 4QHSA 4X65M 3HZJA 3U6SA 3K9PA 2QBYB 4X66M 2VF8A 1IXSA 4PT5A 2OOBA 4CISA 1PM5A 1SG9A 1IXRC 2HHHM 1OJLA 1WXQA 2XH9A 3NWLA 4L8RC 2UUAM 4JXJA 5E6JA 1N32M 2ZM6M 2HKJA 2JP7A 5BPVA 4GH9A 1XHBA 4LJ5A 2CV2A 4B7FA 2ZTDA 4L4UA 1ZQ9A 2DVWB 4I5SA 2R45A 1SXJE 3VFDA 5EQTA 1YUBA 3T1HM 1G59A 4I8OA 3FUTA 4LRSA 2DZNB 4W5WA 5BR8M 3LVVA 3B7NA 5EP3A 5FTKA 2RKOA 2UXBM 3M6AA 1HNZM 4MGHA 1IN5A 3VDUA 4FWHA 2LXEA 3KP1E 4IBGA 1IN7A 1FNNA 4D81A 1DO2A 2L2DA 3DZDA 3J80S 2JY6B 1EIJA 4HEOA 3GLHB 4LJ7A 4JI7M 3U6MA 2KHHA 4K0KM 2CV1A 3GRRA 4DR3M 5ITXE 1QDRA 2G8LA 4IBCA 3HU2A 1OAOC 1I4WA 4HL4A 2Y0QA 4B08A 4AQYM 3IG8A 3LCVB 4B7GA 5KO3A 2L7HA 2EKFA 3E21A 1JR3E 3GQ4A 2CUZA 1R7RA 1ZMUA 2KNVA 2LTUA 3DFZA 2NQ8C 1QYRA 3LMMA 1JR3D 1MU5A 1ZAEA 5EP2A 4GC5A 2DHRA 3LCUA 4Q7JA 4FWDA 2XFTA 3DOAA 4MH0E 5E26A 2DWNA 1YE9A 2B3TA 3HGIA 2XGNA 1HNWM 5FTJA 4DV6M 2A5YB 3W68A 3NBIA 2KNZA 2VIIA 2JY5A 2VDBB 3TPZA 2I7PA 2ZTCA 2ZBKB 2X8AA 3GRUA 4FW9A 4JI2M 3LQQA 4NSRA 1J7KA 3NBXX 2F4VM 4G4OA 3C3DA 2FE8A 4AKGA 1ZMWA 3QYEA 3VK8A 4FCTA 1AIPC 4LGYA 3JAMS 4CGYB 2N35A 2OO9A 3TWMA 1IBKM 2K9DA 1ZMVA 4XGIA 1SXJA 1NY5A 5DYGA 2LH0A 1Q3BA 5F3WA 2KZUA 3H4MA 2J5YA 2LVQD 4IBJA 3E4RA 1H6UA 1OAIA 1VEKA 2L4EA 1NHWC 1XNQM 3HJQA 1XNRM 5IZ7D 2QHOB 3L2AA 3L29A 3GLGE 3FUUA 1L2CA 3FTCA 5FTLA 1NHGC 1QVRA 2WSEF 3FRHA 4G4QA 1QAQA 4WP2A 1Q02A 1V34A 5KQ8A 3VDPA 2R4JA 2EA0A 2E5LM 2I7NA 2H5XA 5H37D 3A98B 5L8RF 1R2YA 3SBJA 2YFQA 1F4IA 1Y8GA 4DUZM 4IBEA 4NC6A 4AKIA 5GKNA 3GLIA 1S3SA 3JR4A 3GPPA 3SC3A 2Y20A 2M5ZA 2P5TA 4KODA 4DR7M 4LZZA 1PJJA 1IQPA 1R4GA 1UFZA 1QANA 2DHYA 2MGWA 2L7IA 2V1CA 2J7OA 4G3OA 4FVMA 2G5GX 2JXNA 1EE8A 1OIPA 3KSJA 3U6QA 4G4RA 4NXMM 4B3RM 2UXCM 2O25A 3I51A 3SHFA 1YSYA 3PXGA 3D8LA 2LNHC 4M0WA 3FYDA 3ZC7B 1W5TA 4LJ6A 2MROB 2CRUA 1NY6A 2DWMA 3DA1A 2JY7A 2ERCA 1HNXM 2RGHA 4LFCM 2GQFA 2HAKA 3B9PA 3FUVA 3TQSA 1N78A 1XMQM 3KS8A 1XB2B 4DV7M 4F2LA 4MB7A 1QUTA 4M9XA 1IY0A 4LGMA 1TDZA 3UMMA 4DV1M 5DFLA 4DV4M 3CF6E 3TE6A 4QHTA 5EP4A 2W82A 2FFJA 2DZLA 3U6PA 3TWLA 3L27A 4MGYE 1IN4A 4LG2A 3KDSE 1ZV1A 4AG5A 1G41A 2LVOC 4L78A 1R2ZA 2Z8YM 1DV0A 3I01M 1J09A 2DKLA 3L28A 4RKUF 3KOYE 1HJPA 3KP0E 3W0FA 3GLGA 2VQFM 2R6FA 5EXPA 3JR5A 1MJGM 1QAOA 1N36M 4LF9M 3HHYA 2CHQA 7CATA 2K47A 2LVAA 1C7YA 2CFOA 2ZAOA 3B7QA 1D0KA 1KYIA 2R0IA 4PCZA 3U60B 4OX9M 1C1KA 2Y0TA 2H1RA 5IWAM 4B3MM 1TGUA 4DR1M 2KW0A 3AFHA 4L6V6 5ITYA 3AJIB 1QDTA 1BVSA 3KOXE 1NV9A 1WHCA 1SXJB 3FUXA 5C18A 2Z4SA 3W0LB 4MGIE 2LVPC 2JWSA 3T6PA 3A46A 1KFVA 4LF8M 2BNKA 2YQZA 1JB0F 2BJVA 2DAEA 2M60A 2RGOA 4DUYM 5ITQA 1GO5A 3GLIB 4DR4M 3U6OA 1TR8A 2MR9A 3KFUG 1I94M 1VEGA 1DGHA 3M0EA 2QZ4A 3VLFB 2JNHA 2YR0A 3MJ5A 4IBKA 5ITRA 3K8ZA 3K1JA 1XC8A 2KNAA 4NXNM 1D2NA 2CHGA 1N77A 3BOSA 4II7A 2K6BA 2Y21A 2QP9X 3CTWB 3ZH9B 3GPXA 5KPRA 4PDGA 4M0DA 5EXSA 2QCUA 2XLJA 3HHXA 4FCWA 4LJ4A 1GL7A 2EO2A 1L1ZA 2OOAA 2CWBA 2KDLA 3J7BA 4REZA 1QZMA 5EXXA 4JI4M 3I4YA 5JI3E 4IJEA 5DNYA 4DV3M 4GKKM 4LFBM 1DGFA 3GLIE 4JV5M 2OPFA 3B74A 3FRIA 1LV7A 4WURA 1V92A 2BWEA 2FS1A 3U61B 4IBIA 1WJ7A 1R5LA 1X37A 1L8QA 3J2PB 4IBDA 1OIZA 4P17A 3KVWA 2UU9M 2JZ0A 3A42A 1NJGA 3AOEA 4L15A 3UZUA 5FTMA 3GQ3A 3GLFE 1KSFX 5A2QS 3AL0C 4LF6M 2DZOB 2Z4RA 1GLNA 2L09A 8CATA 3GQ5A 3QYBA 2LHCA 2R65A 4OU7A 2J7NA 1G8PA 1GL6A 1NJFA 1R6BX 4WW0A 2F5QA 4OVZA 3PNYA 2KRKA 2QSFX 2CE7A 1GABA 3HHWA 2O5RA 4GMQA 4IBFA 4DV5M 1LTMA 3SAUA 3RGPA 2KEBA 4DR5M 2KZSA 4R7GA 4LF5M 3UK6A 2DNAA 1E32A 3B7ZA 3C58A 4JYAM 2Z3XA 5LMUM 1PRBA 4RF0A 4B3TM 4NSOB 3MHVC 4JI5M 1QZEA 4NRWA 4BBAA 2XFSA 4AW4A 3CGWA 3GLFB 4B3SM 5KPZA 3FKEA 1A5TA 2YNMD 3D8BA 2MH8A 3AV0A 3FTFA 3SFZA 1N34M 1IFYA 1MN3A 1L2BA 4LY6A 1OFIA 3HU3A 3TWKA 3GPYA 3U6EA 2ZAMA 3GO8A 1K82A 3C9PA 1TH3A 4CHTB 4BLCA 2KXEA 4EIWA 4IIWA 1D0MA 1TDHA 3E9SA 3HY5A 4X64M 1RU3A 3J81S 3FUWA 1T43A 4YHHM 3VKGA 2D7HA 4KHPM 5JI2E 4LCBA 2CEAA 3V76A 1OFHA 1GVNA 3L26A 3UJNA 5LMNM 3WHKA 3GLHA 1GJTA 4NOOB 3ZCBB 4Y28F 3PVSA 3VK7A 1NVMA 2G3QA 3ZQJA 4D80A 2C9CA 2KA6B 1IBMM 4OW0A 1OTRA 3HKPA 1IY2A 1N75A 2QPAA 3EIEA 2X4AA 2DXIA 2XSZA 1T3TA 5IREB 2F5SA 3W67A 1HT1E 3M7GA 4LF7M 4R71A 1TH2A 3KS4A 4QNMA 2XZFA 2C5RA 1QQWA 3C3EA 3OTOM 3EIHA 1IXZA 2R18A 3KSXA 3SYKA 4FD2A 3SATA 1XXHA 3T38A 1E94E 2WSFF 3KOWE 1FJGM 3U60A 4M9SA 4HLQA 1VEJA 4DV0M 3GP1A 1VDDA 4QOZC 2L6OA 2FOIC 3U6LA 3FYCA 3HJ8A 4B7HA 1AUAA 2R4EA 3HJSA 3LVWA 4OVZB 4Z6YA 4X62M 1WR1B 1IN6A 3J27B 4R3DA 4G4NA 1E9RA 3A45A 3MK6A 5ITTA 5EJCA 3BXWA 2JY8A 4DR6M 4LZJA 2Z7JA 4IJFA 2LBCA 2LVNC 3K92A 2EJSA 3T1YM 3LW5F 1NNJA 5DYIA 2L4FA 3VKHA 1IY1A 1G71A 3H4JA 4LF4M 2XF3A 4CJ6A 2DAIA 5EP1A 3GLFA 4JI1M 2DAGA 5KQDA 1Q3CA 3PFIA 1Z5BA 3SYLA 5ITUA 2CP8A 4AG6A 3K2LA 1Z5AA 1N33M 1NSFA 2FH0A 1E9SA 2AHMA 5C1BA 4JI6M 3HWSA 2HCBA 3HU1A 3QAUA 4FCVA 4D82A 2BJWA 1VQ1A 1WGNA 1TH4A 5FLXS 4ITQA 2CV0A 2JUJA 2APLA 2QENA 4JI0M 2V6ZM 4FWGA 2DI0A 4GHAA 4TUWA 3I4VA 4AI6A 2DENA 1PJTA 3KW6A 1D0LA 1NV8A 1Z59A 4GHLA 1IBLM 4MGZE 3AKZA 3LQRA 1VG5A 2DAKA 3ILKA 1P3QQ 2Q2EB 4XK8F 3T15A 1XMOM 1CUKA 1Q39A 2R46A 4S12A 1HQYE 4I81A 3F92A 2XEPA 4PDIA 1DGBA 1GJSA 4KO8A 3AOEC 3SAWA 2O01F 3U5ZB 4GKJM 3U6DA 3GPUA 1WIVA 3CF0A 3U6CA 5IT9S 2CHVA 4NRVA 2UXDM 3CF2A 3KXEC 4RF1A 2F5PA 1T6OA 1OQYA 2KRUA 2F5NA 2V1UA 1Z6TA 3MMPA 4GITA 4KT0F 4PD2A 4L16A 2LWXA 4LJ8A 2C9OA 2D7EA 3TL4X 3R8FA 2HWJA 1NO1A 1PJIA 2DWZB 2X49A 2EKKA 3IHPA 4F1IA 3IECA 4GRIA 2D7GA 1DGHB 3SMSA 1W5SA 1Z5CA 4KLNA 3HX3A 2C96A 3SARA 2JZ1A 4DR2M 1IM2A 2F5OA 1IN8A 2XSZD 1G4AE 1WGLA 4LJAA 5KPTA 2VQEM 3IG5A 2C98A 4MM3B 4ZPXA 3UGJA 4NL4H 1NNUC 2OQ4A 1HT2E 4MGKE 3AOGA 1ORYB 3U61A 5FSWA 3SAVA 1PJSA 1SXJC 2EUCA 1DGGA 5ITXA 5EXTA 4LRTA 1K3WA 1TTEA 1L2DA 4JN6A 3SHGB 2UUBM 3L25A 3SASA 1MX0A 2QQ8A
chains in the Genus database with same CATH topology
1HR0M 4DV2M 1QAMA 3J7AS 2FNAA 2R62A 2UUCM 3KOZE 3U5ZA 3RGSA 2C99A 4GIPA 4M9ZA 2HL7A 2ZANA 3RFWA 1K3XA 1L1TA 3FTEA 3GLGB 4XBOA 4P16A 1GKIA 4QNRA 1SXJD 3FTDA 3GRYA 2QBYA 1G3IA 4RNAA 3FD9A 4JI8M 4LJ9A 1J5EM 3QWLA 1HQCA 3R9XB 4AZFA 2JA2A 4QOSA 1JQJC 5FTNA 1XWIA 4A3VB 4Z8XA 4BB9A 3PNVA 4AKHA 1JR3A 3SMPA 3RE8A 4I4LA 1UM8A 1XXHB 2XZUA 4GC9A 3HHZA 3THGA 1DO0A 3WHLA 4LFAM 4JI3M 2DWLA 1IXSB 4IBBA 4YY3M 3Q8XA 3GRVA 4G6ZA 4QHSA 4X65M 3U6SA 2QBYB 4X66M 4PT5A 4CISA 1PM5A 1IXRC 2HHHM 1OJLA 1WXQA 2XH9A 3NWLA 4L8RC 2UUAM 4JXJA 5E6JA 1N32M 2ZM6M 2HKJA 5BPVA 4GH9A 1XHBA 4LJ5A 2CV2A 4B7FA 4L4UA 1ZQ9A 2DVWB 4I5SA 2R45A 1SXJE 3VFDA 5EQTA 1YUBA 3T1HM 1G59A 4I8OA 3FUTA 4LRSA 2DZNB 4W5WA 5BR8M 3LVVA 5EP3A 5FTKA 2RKOA 2UXBM 3M6AA 1HNZM 4MGHA 1IN5A 3VDUA 4FWHA 2LXEA 3KP1E 4IBGA 1IN7A 1FNNA 4D81A 1DO2A 3DZDA 3J80S 3GLHB 4LJ7A 4JI7M 3U6MA 4K0KM 2CV1A 3GRRA 4DR3M 5ITXE 2G8LA 4IBCA 3HU2A 4HL4A 1I4WA 4AQYM 2Y0QA 4B08A 3IG8A 4B7GA 5KO3A 2L7HA 3GQ4A 2CUZA 1R7RA 3DFZA 2NQ8C 1QYRA 3LMMA 1JR3D 1MU5A 1ZAEA 5EP2A 4GC5A 2DHRA 5E26A 4FWDA 2XFTA 3DOAA 4MH0E 2DWNA 1YE9A 3HGIA 2XGNA 1HNWM 5FTJA 4DV6M 2A5YB 3NBIA 2VIIA 3TPZA 2I7PA 2ZBKB 2X8AA 3GRUA 4FW9A 4JI2M 3LQQA 4NSRA 1J7KA 2F4VM 4G4OA 2FE8A 4AKGA 3VK8A 4FCTA 4LGYA 3JAMS 1IBKM 4CGYB 3TWMA 4XGIA 1SXJA 1NY5A 5DYGA 2LH0A 1Q3BA 5F3WA 2KZUA 3H4MA 4IBJA 3E4RA 1H6UA 1NHWC 1XNQM 3HJQA 1XNRM 5IZ7D 3L2AA 3L29A 3FUUA 1L2CA 3FTCA 5FTLA 1NHGC 1QVRA 4G4QA 1QAQA 5KQ8A 3VDPA 2R4JA 2EA0A 2E5LM 2I7NA 5H37D 3A98B 1R2YA 3SBJA 2YFQA 4DUZM 4IBEA 4AKIA 5GKNA 3GLIA 1S3SA 3JR4A 3GPPA 3SC3A 2Y20A 2M5ZA 2P5TA 4KODA 4DR7M 4LZZA 1PJJA 1IQPA 1QANA 2L7IA 2V1CA 2J7OA 4FVMA 2G5GX 1EE8A 3KSJA 3U6QA 4G4RA 4NXMM 4B3RM 2UXCM 3I51A 3SHFA 1YSYA 3PXGA 3D8LA 2LNHC 4M0WA 3FYDA 3ZC7B 1W5TA 4LJ6A 1NY6A 2DWMA 3DA1A 2ERCA 1HNXM 2RGHA 4LFCM 3B9PA 3TQSA 3FUVA 1N78A 1XMQM 3KS8A 4DV7M 4MB7A 4M9XA 1IY0A 4LGMA 1TDZA 3UMMA 4DV1M 4DV4M 3CF6E 3TE6A 4QHTA 5EP4A 2W82A 2FFJA 3U6PA 3TWLA 3L27A 4MGYE 1IN4A 4LG2A 3KDSE 4AG5A 1G41A 4L78A 1R2ZA 1J09A 3L28A 3KOYE 3KP0E 3W0FA 3GLGA 2VQFM 5EXPA 3JR5A 1QAOA 1N36M 4LF9M 3HHYA 2CHQA 7CATA 2K47A 2CFOA 2ZAOA 1KYIA 4PCZA 3U60B 4OX9M 1C1KA 2Y0TA 2H1RA 5IWAM 4B3MM 1TGUA 4DR1M 2KW0A 3AFHA 5ITYA 3AJIB 3KOXE 1SXJB 3FUXA 5C18A 2Z4SA 3W0LB 4MGIE 1KFVA 3A46A 4LF8M 2BNKA 2YQZA 2BJVA 2M60A 2RGOA 4DUYM 5ITQA 3GLIB 4DR4M 3U6OA 3KFUG 1I94M 1DGHA 3M0EA 2QZ4A 3VLFB 2YR0A 3MJ5A 4IBKA 5ITRA 3K8ZA 3K1JA 1XC8A 4NXNM 1D2NA 2CHGA 1N77A 3BOSA 4II7A 2Y21A 2QP9X 3CTWB 3ZH9B 3GPXA 5KPRA 4PDGA 4M0DA 5EXSA 2QCUA 2XLJA 3HHXA 4FCWA 4LJ4A 1GL7A 2EO2A 1L1ZA 3J7BA 4REZA 1QZMA 5EXXA 4JI4M 3I4YA 5JI3E 4IJEA 5DNYA 4DV3M 4GKKM 4LFBM 1DGFA 4JV5M 2OPFA 1LV7A 4WURA 3U61B 4IBIA 1X37A 1L8QA 3J2PB 4IBDA 2UU9M 3KVWA 3A42A 1NJGA 3AOEA 4L15A 3UZUA 5FTMA 3GQ3A 1KSFX 5A2QS 3AL0C 4LF6M 2DZOB 2Z4RA 1GLNA 2L09A 8CATA 3GQ5A 4OU7A 2R65A 1GL6A 1G8PA 1NJFA 2J7NA 1R6BX 4WW0A 2F5QA 4OVZA 3PNYA 2KRKA 2CE7A 3HHWA 2O5RA 4GMQA 4IBFA 4DV5M 3SAUA 3RGPA 2KEBA 4DR5M 2KZSA 4R7GA 4LF5M 3UK6A 1E32A 3C58A 4JYAM 2Z3XA 5LMUM 4B3TM 4RF0A 4NSOB 3MHVC 4JI5M 4NRWA 4BBAA 2XFSA 4AW4A 3GLFB 4B3SM 5KPZA 3FKEA 2YNMD 3D8BA 3AV0A 3FTFA 3SFZA 1N34M 1L2BA 4LY6A 1OFIA 3HU3A 3TWKA 3GPYA 3U6EA 2ZAMA 3GO8A 1K82A 1TH3A 4CHTB 4BLCA 2KXEA 4EIWA 4IIWA 1TDHA 3E9SA 3J81S 4X64M 3FUWA 4YHHM 3VKGA 2D7HA 4KHPM 5JI2E 4LCBA 2CEAA 1OFHA 1GVNA 3L26A 3UJNA 5LMNM 3WHKA 3GLHA 4NOOB 3ZCBB 3PVSA 3VK7A 1NVMA 4D80A 2C9CA 2KA6B 1IBMM 4OW0A 3HKPA 3EIEA 1IY2A 1N75A 2QPAA 2X4AA 2DXIA 2XSZA 1T3TA 5IREB 2F5SA 1HT1E 3M7GA 4LF7M 1TH2A 3KS4A 4QNMA 2XZFA 2C5RA 1QQWA 3OTOM 3EIHA 1IXZA 2R18A 3KSXA 3SYKA 4FD2A 3SATA 1XXHA 3T38A 1E94E 3KOWE 1FJGM 3U60A 4M9SA 4HLQA 4DV0M 3GP1A 1VDDA 4QOZC 2L6OA 2FOIC 3U6LA 3FYCA 3HJ8A 4B7HA 2R4EA 3HJSA 3LVWA 4OVZB 4Z6YA 4X62M 1IN6A 3J27B 4R3DA 4G4NA 1E9RA 3A45A 3MK6A 5ITTA 5EJCA 4DR6M 4LZJA 2Z7JA 4IJFA 3K92A 3T1YM 1NNJA 5DYIA 3VKHA 1IY1A 4LF4M 2XF3A 5EP1A 3GLFA 4JI1M 5KQDA 1Q3CA 3PFIA 1Z5BA 3SYLA 5ITUA 4AG6A 3K2LA 1Z5AA 1N33M 1NSFA 5C1BA 1E9SA 2AHMA 4JI6M 3HWSA 2HCBA 4FCVA 3HU1A 3QAUA 4D82A 2BJWA 1TH4A 5FLXS 4ITQA 2CV0A 2QENA 4JI0M 2V6ZM 4FWGA 4GHAA 4TUWA 3I4VA 4AI6A 3KW6A 1Z59A 4GHLA 1IBLM 4MGZE 3AKZA 3LQRA 3ILKA 2Q2EB 3T15A 1XMOM 1Q39A 2R46A 4S12A 1HQYE 4I81A 2XEPA 4PDIA 1DGBA 4KO8A 3AOEC 3SAWA 3U5ZB 4GKJM 3U6DA 3GPUA 3CF0A 5IT9S 3U6CA 2CHVA 4NRVA 2UXDM 3CF2A 3KXEC 4RF1A 2F5PA 2KRUA 2F5NA 2V1UA 1Z6TA 4GITA 4PD2A 4L16A 2LWXA 4LJ8A 2C9OA 2D7EA 3TL4X 3R8FA 1PJIA 2DWZB 2X49A 4GRIA 2D7GA 1DGHB 3SMSA 1W5SA 1Z5CA 4KLNA 2C96A 3SARA 4DR2M 1IM2A 2F5OA 1IN8A 2XSZD 1G4AE 5KPTA 4LJAA 2VQEM 3IG5A 2C98A 4MM3B 4ZPXA 3UGJA 4NL4H 1NNUC 2OQ4A 1HT2E 4MGKE 3AOGA 1ORYB 3U61A 5FSWA 3SAVA 1SXJC 2EUCA 1DGGA 5ITXA 5EXTA 4LRTA 1K3WA 1L2DA 4JN6A 3SHGB 2UUBM 3L25A 3SASA 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  1GVN A;  2P5T A; 
#chains in the Genus database with same CATH topology
 3FE3 A;  1HR0 M;  4DV2 M;  1QAM A;  3J7A S;  2FNA A;  2R62 A;  2UUC M;  3KOZ E;  3U5Z A;  3RGS A;  2C99 A;  4GIP A;  2R44 A;  4M9Z A;  2K0B X;  2HL7 A;  2ZAN A;  3RFW A;  3I04 M;  1K3X A;  1L1T A;  3FTE A;  4CIZ A;  3GLG B;  4XBO A;  4P16 A;  4DBG B;  1GKI A;  4QNR A;  3GLH E;  1PGY A;  1SXJ D;  1YLA A;  1V33 A;  2WSC F;  3FTD A;  3GRY A;  2RRU A;  2MJ5 B;  2QBY A;  1G3I A;  2QNJ A;  2VF7 A;  4RNA A;  3BBZ A;  3FD9 A;  4ANR A;  4JI8 M;  2LHG A;  4LJ9 A;  1J5E M;  3K9O A;  3QWL A;  1HQC A;  2BWB A;  1PJQ A;  3R9X B;  1QUS A;  4AZF A;  2JA2 A;  1OKS A;  3Q8G A;  4QOS A;  1JQJ C;  5FTN A;  2WZJ A;  1XWI A;  2DAM A;  4A3V B;  4UN2 B;  4Z8X A;  4BB9 A;  3PNV A;  1VDL A;  1XXH E;  4AKH A;  1JR3 A;  3SMP A;  3RE8 A;  4I4L A;  1UM8 A;  3B89 A;  1EFU B;  1XXH B;  2XZU A;  3E46 A;  4GC9 A;  3HHZ A;  3THG A;  1DO0 A;  2GNO A;  3WHL A;  4LFA M;  4JI3 M;  2DWL A;  1IXS B;  4GEW A;  4IBB A;  4YY3 M;  3Q8X A;  3GRV A;  4G6Z A;  1TF0 B;  4QHS A;  4X65 M;  3HZJ A;  3U6S A;  3K9P A;  2QBY B;  4X66 M;  2VF8 A;  1IXS A;  4PT5 A;  2OOB A;  4CIS A;  1PM5 A;  1SG9 A;  1IXR C;  2HHH M;  1OJL A;  1WXQ A;  2XH9 A;  3NWL A;  4L8R C;  2UUA M;  4JXJ A;  5E6J A;  1N32 M;  2ZM6 M;  2HKJ A;  2JP7 A;  5BPV A;  4GH9 A;  1XHB A;  4LJ5 A;  2CV2 A;  4B7F A;  2ZTD A;  4L4U A;  1ZQ9 A;  2DVW B;  4I5S A;  2R45 A;  1SXJ E;  3VFD A;  5EQT A;  1YUB A;  3T1H M;  1G59 A;  4I8O A;  3FUT A;  4LRS A;  2DZN B;  4W5W A;  5BR8 M;  3LVV A;  3B7N A;  5EP3 A;  5FTK A;  2RKO A;  2UXB M;  3M6A A;  1HNZ M;  4MGH A;  1IN5 A;  3VDU A;  4FWH A;  2LXE A;  3KP1 E;  4IBG A;  1IN7 A;  1FNN A;  4D81 A;  1DO2 A;  2L2D A;  3DZD A;  3J80 S;  2JY6 B;  1EIJ A;  4HEO A;  3GLH B;  4LJ7 A;  4JI7 M;  3U6M A;  2KHH A;  4K0K M;  2CV1 A;  3GRR A;  4DR3 M;  5ITX E;  1QDR A;  2G8L A;  4IBC A;  3HU2 A;  1OAO C;  1I4W A;  4HL4 A;  2Y0Q A;  4B08 A;  4AQY M;  3IG8 A;  3LCV B;  4B7G A;  5KO3 A;  2L7H A;  2EKF A;  3E21 A;  1JR3 E;  3GQ4 A;  2CUZ A;  1R7R A;  1ZMU A;  2KNV A;  2LTU A;  3DFZ A;  2NQ8 C;  1QYR A;  3LMM A;  1JR3 D;  1MU5 A;  1ZAE A;  5EP2 A;  4GC5 A;  2DHR A;  3LCU A;  4Q7J A;  4FWD A;  2XFT A;  3DOA A;  4MH0 E;  5E26 A;  2DWN A;  1YE9 A;  2B3T A;  3HGI A;  2XGN A;  1HNW M;  5FTJ A;  4DV6 M;  2A5Y B;  3W68 A;  3NBI A;  2KNZ A;  2VII A;  2JY5 A;  2VDB B;  3TPZ A;  2I7P A;  2ZTC A;  2ZBK B;  2X8A A;  3GRU A;  4FW9 A;  4JI2 M;  3LQQ A;  4NSR A;  1J7K A;  3NBX X;  2F4V M;  4G4O A;  3C3D A;  2FE8 A;  4AKG A;  1ZMW A;  3QYE A;  3VK8 A;  4FCT A;  1AIP C;  4LGY A;  3JAM S;  4CGY B;  2N35 A;  2OO9 A;  3TWM A;  1IBK M;  2K9D A;  1ZMV A;  4XGI A;  1SXJ A;  1NY5 A;  5DYG A;  2LH0 A;  1Q3B A;  5F3W A;  2KZU A;  3H4M A;  2J5Y A;  2LVQ D;  4IBJ A;  3E4R A;  1H6U A;  1OAI A;  1VEK A;  2L4E A;  1NHW C;  1XNQ M;  3HJQ A;  1XNR M;  5IZ7 D;  2QHO B;  3L2A A;  3L29 A;  3GLG E;  3FUU A;  1L2C A;  3FTC A;  5FTL A;  1NHG C;  1QVR A;  2WSE F;  3FRH A;  4G4Q A;  1QAQ A;  4WP2 A;  1Q02 A;  1V34 A;  5KQ8 A;  3VDP A;  2R4J A;  2EA0 A;  2E5L M;  2I7N A;  2H5X A;  5H37 D;  3A98 B;  5L8R F;  1R2Y A;  3SBJ A;  2YFQ A;  1F4I A;  1Y8G A;  4DUZ M;  4IBE A;  4NC6 A;  4AKI A;  5GKN A;  3GLI A;  1S3S A;  3JR4 A;  3GPP A;  3SC3 A;  2Y20 A;  2M5Z A;  2P5T A;  4KOD A;  4DR7 M;  4LZZ A;  1PJJ A;  1IQP A;  1R4G A;  1UFZ A;  1QAN A;  2DHY A;  2MGW A;  2L7I A;  2V1C A;  2J7O A;  4G3O A;  4FVM A;  2G5G X;  2JXN A;  1EE8 A;  1OIP A;  3KSJ A;  3U6Q A;  4G4R A;  4NXM M;  4B3R M;  2UXC M;  2O25 A;  3I51 A;  3SHF A;  1YSY A;  3PXG A;  3D8L A;  2LNH C;  4M0W A;  3FYD A;  3ZC7 B;  1W5T A;  4LJ6 A;  2MRO B;  2CRU A;  1NY6 A;  2DWM A;  3DA1 A;  2JY7 A;  2ERC A;  1HNX M;  2RGH A;  4LFC M;  2GQF A;  2HAK A;  3B9P A;  3FUV A;  3TQS A;  1N78 A;  1XMQ M;  3KS8 A;  1XB2 B;  4DV7 M;  4F2L A;  4MB7 A;  1QUT A;  4M9X A;  1IY0 A;  4LGM A;  1TDZ A;  3UMM A;  4DV1 M;  5DFL A;  4DV4 M;  3CF6 E;  3TE6 A;  4QHT A;  5EP4 A;  2W82 A;  2FFJ A;  2DZL A;  3U6P A;  3TWL A;  3L27 A;  4MGY E;  1IN4 A;  4LG2 A;  3KDS E;  1ZV1 A;  4AG5 A;  1G41 A;  2LVO C;  4L78 A;  1R2Z A;  2Z8Y M;  1DV0 A;  3I01 M;  1J09 A;  2DKL A;  3L28 A;  4RKU F;  3KOY E;  1HJP A;  3KP0 E;  3W0F A;  3GLG A;  2VQF M;  2R6F A;  5EXP A;  3JR5 A;  1MJG M;  1QAO A;  1N36 M;  4LF9 M;  3HHY A;  2CHQ A;  7CAT A;  2K47 A;  2LVA A;  1C7Y A;  2CFO A;  2ZAO A;  3B7Q A;  1D0K A;  1KYI A;  2R0I A;  4PCZ A;  3U60 B;  4OX9 M;  1C1K A;  2Y0T A;  2H1R A;  5IWA M;  4B3M M;  1TGU A;  4DR1 M;  2KW0 A;  3AFH A;  4L6V 6;  5ITY A;  3AJI B;  1QDT A;  1BVS A;  3KOX E;  1NV9 A;  1WHC A;  1SXJ B;  3FUX A;  5C18 A;  2Z4S A;  3W0L B;  4MGI E;  2LVP C;  2JWS A;  3T6P A;  3A46 A;  1KFV A;  4LF8 M;  2BNK A;  2YQZ A;  1JB0 F;  2BJV A;  2DAE A;  2M60 A;  2RGO A;  4DUY M;  5ITQ A;  1GO5 A;  3GLI B;  4DR4 M;  3U6O A;  1TR8 A;  2MR9 A;  3KFU G;  1I94 M;  1VEG A;  1DGH A;  3M0E A;  2QZ4 A;  3VLF B;  2JNH A;  2YR0 A;  3MJ5 A;  4IBK A;  5ITR A;  3K8Z A;  3K1J A;  1XC8 A;  2KNA A;  4NXN M;  1D2N A;  2CHG A;  1N77 A;  3BOS A;  4II7 A;  2K6B A;  2Y21 A;  2QP9 X;  3CTW B;  3ZH9 B;  3GPX A;  5KPR A;  4PDG A;  4M0D A;  5EXS A;  2QCU A;  2XLJ A;  3HHX A;  4FCW A;  4LJ4 A;  1GL7 A;  2EO2 A;  1L1Z A;  2OOA A;  2CWB A;  2KDL A;  3J7B A;  4REZ A;  1QZM A;  5EXX A;  4JI4 M;  3I4Y A;  5JI3 E;  4IJE A;  5DNY A;  4DV3 M;  4GKK M;  4LFB M;  1DGF A;  3GLI E;  4JV5 M;  2OPF A;  3B74 A;  3FRI A;  1LV7 A;  4WUR A;  1V92 A;  2BWE A;  2FS1 A;  3U61 B;  4IBI A;  1WJ7 A;  1R5L A;  1X37 A;  1L8Q A;  3J2P B;  4IBD A;  1OIZ A;  4P17 A;  3KVW A;  2UU9 M;  2JZ0 A;  3A42 A;  1NJG A;  3AOE A;  4L15 A;  3UZU A;  5FTM A;  3GQ3 A;  3GLF E;  1KSF X;  5A2Q S;  3AL0 C;  4LF6 M;  2DZO B;  2Z4R A;  1GLN A;  2L09 A;  8CAT A;  3GQ5 A;  3QYB A;  2LHC A;  2R65 A;  4OU7 A;  2J7N A;  1G8P A;  1GL6 A;  1NJF A;  1R6B X;  4WW0 A;  2F5Q A;  4OVZ A;  3PNY A;  2KRK A;  2QSF X;  2CE7 A;  1GAB A;  3HHW A;  2O5R A;  4GMQ A;  4IBF A;  4DV5 M;  1LTM A;  3SAU A;  3RGP A;  2KEB A;  4DR5 M;  2KZS A;  4R7G A;  4LF5 M;  3UK6 A;  2DNA A;  1E32 A;  3B7Z A;  3C58 A;  4JYA M;  2Z3X A;  5LMU M;  1PRB A;  4RF0 A;  4B3T M;  4NSO B;  3MHV C;  4JI5 M;  1QZE A;  4NRW A;  4BBA A;  2XFS A;  4AW4 A;  3CGW A;  3GLF B;  4B3S M;  5KPZ A;  3FKE A;  1A5T A;  2YNM D;  3D8B A;  2MH8 A;  3AV0 A;  3FTF A;  3SFZ A;  1N34 M;  1IFY A;  1MN3 A;  1L2B A;  4LY6 A;  1OFI A;  3HU3 A;  3TWK A;  3GPY A;  3U6E A;  2ZAM A;  3GO8 A;  1K82 A;  3C9P A;  1TH3 A;  4CHT B;  4BLC A;  2KXE A;  4EIW A;  4IIW A;  1D0M A;  1TDH A;  3E9S A;  3HY5 A;  4X64 M;  1RU3 A;  3J81 S;  3FUW A;  1T43 A;  4YHH M;  3VKG A;  2D7H A;  4KHP M;  5JI2 E;  4LCB A;  2CEA A;  3V76 A;  1OFH A;  1GVN A;  3L26 A;  3UJN A;  5LMN M;  3WHK A;  3GLH A;  1GJT A;  4NOO B;  3ZCB B;  4Y28 F;  3PVS A;  3VK7 A;  1NVM A;  2G3Q A;  3ZQJ A;  4D80 A;  2C9C A;  2KA6 B;  1IBM M;  4OW0 A;  1OTR A;  3HKP A;  1IY2 A;  1N75 A;  2QPA A;  3EIE A;  2X4A A;  2DXI A;  2XSZ A;  1T3T A;  5IRE B;  2F5S A;  3W67 A;  1HT1 E;  3M7G A;  4LF7 M;  4R71 A;  1TH2 A;  3KS4 A;  4QNM A;  2XZF A;  2C5R A;  1QQW A;  3C3E A;  3OTO M;  3EIH A;  1IXZ A;  2R18 A;  3KSX A;  3SYK A;  4FD2 A;  3SAT A;  1XXH A;  3T38 A;  1E94 E;  2WSF F;  3KOW E;  1FJG M;  3U60 A;  4M9S A;  4HLQ A;  1VEJ A;  4DV0 M;  3GP1 A;  1VDD A;  4QOZ C;  2L6O A;  2FOI C;  3U6L A;  3FYC A;  3HJ8 A;  4B7H A;  1AUA A;  2R4E A;  3HJS A;  3LVW A;  4OVZ B;  4Z6Y A;  4X62 M;  1WR1 B;  1IN6 A;  3J27 B;  4R3D A;  4G4N A;  1E9R A;  3A45 A;  3MK6 A;  5ITT A;  5EJC A;  3BXW A;  2JY8 A;  4DR6 M;  4LZJ A;  2Z7J A;  4IJF A;  2LBC A;  2LVN C;  3K92 A;  2EJS A;  3T1Y M;  3LW5 F;  1NNJ A;  5DYI A;  2L4F A;  3VKH A;  1IY1 A;  1G71 A;  3H4J A;  4LF4 M;  2XF3 A;  4CJ6 A;  2DAI A;  5EP1 A;  3GLF A;  4JI1 M;  2DAG A;  5KQD A;  1Q3C A;  3PFI A;  1Z5B A;  3SYL A;  5ITU A;  2CP8 A;  4AG6 A;  3K2L A;  1Z5A A;  1N33 M;  1NSF A;  2FH0 A;  1E9S A;  2AHM A;  5C1B A;  4JI6 M;  3HWS A;  2HCB A;  3HU1 A;  3QAU A;  4FCV A;  4D82 A;  2BJW A;  1VQ1 A;  1WGN A;  1TH4 A;  5FLX S;  4ITQ A;  2CV0 A;  2JUJ A;  2APL A;  2QEN A;  4JI0 M;  2V6Z M;  4FWG A;  2DI0 A;  4GHA A;  4TUW A;  3I4V A;  4AI6 A;  2DEN A;  1PJT A;  3KW6 A;  1D0L A;  1NV8 A;  1Z59 A;  4GHL A;  1IBL M;  4MGZ E;  3AKZ A;  3LQR A;  1VG5 A;  2DAK A;  3ILK A;  1P3Q Q;  2Q2E B;  4XK8 F;  3T15 A;  1XMO M;  1CUK A;  1Q39 A;  2R46 A;  4S12 A;  1HQY E;  4I81 A;  3F92 A;  2XEP A;  4PDI A;  1DGB A;  1GJS A;  4KO8 A;  3AOE C;  3SAW A;  2O01 F;  3U5Z B;  4GKJ M;  3U6D A;  3GPU A;  1WIV A;  3CF0 A;  3U6C A;  5IT9 S;  2CHV A;  4NRV A;  2UXD M;  3CF2 A;  3KXE C;  4RF1 A;  2F5P A;  1T6O A;  1OQY A;  2KRU A;  2F5N A;  2V1U A;  1Z6T A;  3MMP A;  4GIT A;  4KT0 F;  4PD2 A;  4L16 A;  2LWX A;  4LJ8 A;  2C9O A;  2D7E A;  3TL4 X;  3R8F A;  2HWJ A;  1NO1 A;  1PJI A;  2DWZ B;  2X49 A;  2EKK A;  3IHP A;  4F1I A;  3IEC A;  4GRI A;  2D7G A;  1DGH B;  3SMS A;  1W5S A;  1Z5C A;  4KLN A;  3HX3 A;  2C96 A;  3SAR A;  2JZ1 A;  4DR2 M;  1IM2 A;  2F5O A;  1IN8 A;  2XSZ D;  1G4A E;  1WGL A;  4LJA A;  5KPT A;  2VQE M;  3IG5 A;  2C98 A;  4MM3 B;  4ZPX A;  3UGJ A;  4NL4 H;  1NNU C;  2OQ4 A;  1HT2 E;  4MGK E;  3AOG A;  1ORY B;  3U61 A;  5FSW A;  3SAV A;  1PJS A;  1SXJ C;  2EUC A;  1DGG A;  5ITX A;  5EXT A;  4LRT A;  1K3W A;  1TTE A;  1L2D A;  4JN6 A;  3SHG B;  2UUB M;  3L25 A;  3SAS A;  1MX0 A;  2QQ8 A; 
#chains in the Genus database with same CATH homology
 1HR0 M;  4DV2 M;  1QAM A;  3J7A S;  2FNA A;  2R62 A;  2UUC M;  3KOZ E;  3U5Z A;  3RGS A;  2C99 A;  4GIP A;  4M9Z A;  2HL7 A;  2ZAN A;  3RFW A;  1K3X A;  1L1T A;  3FTE A;  3GLG B;  4XBO A;  4P16 A;  1GKI A;  4QNR A;  1SXJ D;  3FTD A;  3GRY A;  2QBY A;  1G3I A;  4RNA A;  3FD9 A;  4JI8 M;  4LJ9 A;  1J5E M;  3QWL A;  1HQC A;  3R9X B;  4AZF A;  2JA2 A;  4QOS A;  1JQJ C;  5FTN A;  1XWI A;  4A3V B;  4Z8X A;  4BB9 A;  3PNV A;  4AKH A;  1JR3 A;  3SMP A;  3RE8 A;  4I4L A;  1UM8 A;  1XXH B;  2XZU A;  4GC9 A;  3HHZ A;  3THG A;  1DO0 A;  3WHL A;  4LFA M;  4JI3 M;  2DWL A;  1IXS B;  4IBB A;  4YY3 M;  3Q8X A;  3GRV A;  4G6Z A;  4QHS A;  4X65 M;  3U6S A;  2QBY B;  4X66 M;  4PT5 A;  4CIS A;  1PM5 A;  1IXR C;  2HHH M;  1OJL A;  1WXQ A;  2XH9 A;  3NWL A;  4L8R C;  2UUA M;  4JXJ A;  5E6J A;  1N32 M;  2ZM6 M;  2HKJ A;  5BPV A;  4GH9 A;  1XHB A;  4LJ5 A;  2CV2 A;  4B7F A;  4L4U A;  1ZQ9 A;  2DVW B;  4I5S A;  2R45 A;  1SXJ E;  3VFD A;  5EQT A;  1YUB A;  3T1H M;  1G59 A;  4I8O A;  3FUT A;  4LRS A;  2DZN B;  4W5W A;  5BR8 M;  3LVV A;  5EP3 A;  5FTK A;  2RKO A;  2UXB M;  3M6A A;  1HNZ M;  4MGH A;  1IN5 A;  3VDU A;  4FWH A;  2LXE A;  3KP1 E;  4IBG A;  1IN7 A;  1FNN A;  4D81 A;  1DO2 A;  3DZD A;  3J80 S;  3GLH B;  4LJ7 A;  4JI7 M;  3U6M A;  4K0K M;  2CV1 A;  3GRR A;  4DR3 M;  5ITX E;  2G8L A;  4IBC A;  3HU2 A;  4HL4 A;  1I4W A;  4AQY M;  2Y0Q A;  4B08 A;  3IG8 A;  4B7G A;  5KO3 A;  2L7H A;  3GQ4 A;  2CUZ A;  1R7R A;  3DFZ A;  2NQ8 C;  1QYR A;  3LMM A;  1JR3 D;  1MU5 A;  1ZAE A;  5EP2 A;  4GC5 A;  2DHR A;  5E26 A;  4FWD A;  2XFT A;  3DOA A;  4MH0 E;  2DWN A;  1YE9 A;  3HGI A;  2XGN A;  1HNW M;  5FTJ A;  4DV6 M;  2A5Y B;  3NBI A;  2VII A;  3TPZ A;  2I7P A;  2ZBK B;  2X8A A;  3GRU A;  4FW9 A;  4JI2 M;  3LQQ A;  4NSR A;  1J7K A;  2F4V M;  4G4O A;  2FE8 A;  4AKG A;  3VK8 A;  4FCT A;  4LGY A;  3JAM S;  1IBK M;  4CGY B;  3TWM A;  4XGI A;  1SXJ A;  1NY5 A;  5DYG A;  2LH0 A;  1Q3B A;  5F3W A;  2KZU A;  3H4M A;  4IBJ A;  3E4R A;  1H6U A;  1NHW C;  1XNQ M;  3HJQ A;  1XNR M;  5IZ7 D;  3L2A A;  3L29 A;  3FUU A;  1L2C A;  3FTC A;  5FTL A;  1NHG C;  1QVR A;  4G4Q A;  1QAQ A;  5KQ8 A;  3VDP A;  2R4J A;  2EA0 A;  2E5L M;  2I7N A;  5H37 D;  3A98 B;  1R2Y A;  3SBJ A;  2YFQ A;  4DUZ M;  4IBE A;  4AKI A;  5GKN A;  3GLI A;  1S3S A;  3JR4 A;  3GPP A;  3SC3 A;  2Y20 A;  2M5Z A;  2P5T A;  4KOD A;  4DR7 M;  4LZZ A;  1PJJ A;  1IQP A;  1QAN A;  2L7I A;  2V1C A;  2J7O A;  4FVM A;  2G5G X;  1EE8 A;  3KSJ A;  3U6Q A;  4G4R A;  4NXM M;  4B3R M;  2UXC M;  3I51 A;  3SHF A;  1YSY A;  3PXG A;  3D8L A;  2LNH C;  4M0W A;  3FYD A;  3ZC7 B;  1W5T A;  4LJ6 A;  1NY6 A;  2DWM A;  3DA1 A;  2ERC A;  1HNX M;  2RGH A;  4LFC M;  3B9P A;  3TQS A;  3FUV A;  1N78 A;  1XMQ M;  3KS8 A;  4DV7 M;  4MB7 A;  4M9X A;  1IY0 A;  4LGM A;  1TDZ A;  3UMM A;  4DV1 M;  4DV4 M;  3CF6 E;  3TE6 A;  4QHT A;  5EP4 A;  2W82 A;  2FFJ A;  3U6P A;  3TWL A;  3L27 A;  4MGY E;  1IN4 A;  4LG2 A;  3KDS E;  4AG5 A;  1G41 A;  4L78 A;  1R2Z A;  1J09 A;  3L28 A;  3KOY E;  3KP0 E;  3W0F A;  3GLG A;  2VQF M;  5EXP A;  3JR5 A;  1QAO A;  1N36 M;  4LF9 M;  3HHY A;  2CHQ A;  7CAT A;  2K47 A;  2CFO A;  2ZAO A;  1KYI A;  4PCZ A;  3U60 B;  4OX9 M;  1C1K A;  2Y0T A;  2H1R A;  5IWA M;  4B3M M;  1TGU A;  4DR1 M;  2KW0 A;  3AFH A;  5ITY A;  3AJI B;  3KOX E;  1SXJ B;  3FUX A;  5C18 A;  2Z4S A;  3W0L B;  4MGI E;  1KFV A;  3A46 A;  4LF8 M;  2BNK A;  2YQZ A;  2BJV A;  2M60 A;  2RGO A;  4DUY M;  5ITQ A;  3GLI B;  4DR4 M;  3U6O A;  3KFU G;  1I94 M;  1DGH A;  3M0E A;  2QZ4 A;  3VLF B;  2YR0 A;  3MJ5 A;  4IBK A;  5ITR A;  3K8Z A;  3K1J A;  1XC8 A;  4NXN M;  1D2N A;  2CHG A;  1N77 A;  3BOS A;  4II7 A;  2Y21 A;  2QP9 X;  3CTW B;  3ZH9 B;  3GPX A;  5KPR A;  4PDG A;  4M0D A;  5EXS A;  2QCU A;  2XLJ A;  3HHX A;  4FCW A;  4LJ4 A;  1GL7 A;  2EO2 A;  1L1Z A;  3J7B A;  4REZ A;  1QZM A;  5EXX A;  4JI4 M;  3I4Y A;  5JI3 E;  4IJE A;  5DNY A;  4DV3 M;  4GKK M;  4LFB M;  1DGF A;  4JV5 M;  2OPF A;  1LV7 A;  4WUR A;  3U61 B;  4IBI A;  1X37 A;  1L8Q A;  3J2P B;  4IBD A;  2UU9 M;  3KVW A;  3A42 A;  1NJG A;  3AOE A;  4L15 A;  3UZU A;  5FTM A;  3GQ3 A;  1KSF X;  5A2Q S;  3AL0 C;  4LF6 M;  2DZO B;  2Z4R A;  1GLN A;  2L09 A;  8CAT A;  3GQ5 A;  4OU7 A;  2R65 A;  1GL6 A;  1G8P A;  1NJF A;  2J7N A;  1R6B X;  4WW0 A;  2F5Q A;  4OVZ A;  3PNY A;  2KRK A;  2CE7 A;  3HHW A;  2O5R A;  4GMQ A;  4IBF A;  4DV5 M;  3SAU A;  3RGP A;  2KEB A;  4DR5 M;  2KZS A;  4R7G A;  4LF5 M;  3UK6 A;  1E32 A;  3C58 A;  4JYA M;  2Z3X A;  5LMU M;  4B3T M;  4RF0 A;  4NSO B;  3MHV C;  4JI5 M;  4NRW A;  4BBA A;  2XFS A;  4AW4 A;  3GLF B;  4B3S M;  5KPZ A;  3FKE A;  2YNM D;  3D8B A;  3AV0 A;  3FTF A;  3SFZ A;  1N34 M;  1L2B A;  4LY6 A;  1OFI A;  3HU3 A;  3TWK A;  3GPY A;  3U6E A;  2ZAM A;  3GO8 A;  1K82 A;  1TH3 A;  4CHT B;  4BLC A;  2KXE A;  4EIW A;  4IIW A;  1TDH A;  3E9S A;  3J81 S;  4X64 M;  3FUW A;  4YHH M;  3VKG A;  2D7H A;  4KHP M;  5JI2 E;  4LCB A;  2CEA A;  1OFH A;  1GVN A;  3L26 A;  3UJN A;  5LMN M;  3WHK A;  3GLH A;  4NOO B;  3ZCB B;  3PVS A;  3VK7 A;  1NVM A;  4D80 A;  2C9C A;  2KA6 B;  1IBM M;  4OW0 A;  3HKP A;  3EIE A;  1IY2 A;  1N75 A;  2QPA A;  2X4A A;  2DXI A;  2XSZ A;  1T3T A;  5IRE B;  2F5S A;  1HT1 E;  3M7G A;  4LF7 M;  1TH2 A;  3KS4 A;  4QNM A;  2XZF A;  2C5R A;  1QQW A;  3OTO M;  3EIH A;  1IXZ A;  2R18 A;  3KSX A;  3SYK A;  4FD2 A;  3SAT A;  1XXH A;  3T38 A;  1E94 E;  3KOW E;  1FJG M;  3U60 A;  4M9S A;  4HLQ A;  4DV0 M;  3GP1 A;  1VDD A;  4QOZ C;  2L6O A;  2FOI C;  3U6L A;  3FYC A;  3HJ8 A;  4B7H A;  2R4E A;  3HJS A;  3LVW A;  4OVZ B;  4Z6Y A;  4X62 M;  1IN6 A;  3J27 B;  4R3D A;  4G4N A;  1E9R A;  3A45 A;  3MK6 A;  5ITT A;  5EJC A;  4DR6 M;  4LZJ A;  2Z7J A;  4IJF A;  3K92 A;  3T1Y M;  1NNJ A;  5DYI A;  3VKH A;  1IY1 A;  4LF4 M;  2XF3 A;  5EP1 A;  3GLF A;  4JI1 M;  5KQD A;  1Q3C A;  3PFI A;  1Z5B A;  3SYL A;  5ITU A;  4AG6 A;  3K2L A;  1Z5A A;  1N33 M;  1NSF A;  5C1B A;  1E9S A;  2AHM A;  4JI6 M;  3HWS A;  2HCB A;  4FCV A;  3HU1 A;  3QAU A;  4D82 A;  2BJW A;  1TH4 A;  5FLX S;  4ITQ A;  2CV0 A;  2QEN A;  4JI0 M;  2V6Z M;  4FWG A;  4GHA A;  4TUW A;  3I4V A;  4AI6 A;  3KW6 A;  1Z59 A;  4GHL A;  1IBL M;  4MGZ E;  3AKZ A;  3LQR A;  3ILK A;  2Q2E B;  3T15 A;  1XMO M;  1Q39 A;  2R46 A;  4S12 A;  1HQY E;  4I81 A;  2XEP A;  4PDI A;  1DGB A;  4KO8 A;  3AOE C;  3SAW A;  3U5Z B;  4GKJ M;  3U6D A;  3GPU A;  3CF0 A;  5IT9 S;  3U6C A;  2CHV A;  4NRV A;  2UXD M;  3CF2 A;  3KXE C;  4RF1 A;  2F5P A;  2KRU A;  2F5N A;  2V1U A;  1Z6T A;  4GIT A;  4PD2 A;  4L16 A;  2LWX A;  4LJ8 A;  2C9O A;  2D7E A;  3TL4 X;  3R8F A;  1PJI A;  2DWZ B;  2X49 A;  4GRI A;  2D7G A;  1DGH B;  3SMS A;  1W5S A;  1Z5C A;  4KLN A;  2C96 A;  3SAR A;  4DR2 M;  1IM2 A;  2F5O A;  1IN8 A;  2XSZ D;  1G4A E;  5KPT A;  4LJA A;  2VQE M;  3IG5 A;  2C98 A;  4MM3 B;  4ZPX A;  3UGJ A;  4NL4 H;  1NNU C;  2OQ4 A;  1HT2 E;  4MGK E;  3AOG A;  1ORY B;  3U61 A;  5FSW A;  3SAV A;  1SXJ C;  2EUC A;  1DGG A;  5ITX A;  5EXT A;  4LRT A;  1K3W A;  1L2D A;  4JN6 A;  3SHG B;  2UUB M;  3L25 A;  3SAS A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...