3Q8XA

Structure of a toxin-antitoxin system bound to its substrate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
molecule keywords Antidote of epsilon-zeta postsegregational killing system
total genus 35
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3q8xA00
3Q8XA 2P5TA 1GVNA
chains in the Genus database with same CATH superfamily
3U60B 3T38A 2HL7A 4G6ZA 1DGGA 3KOZE 3W67A 2KRUA 4XGIA 2GNOA 2RKOA 2W82A 3BBZA 4IBIA 1XXHE 2KHHA 1V33A 3EIHA 3FTDA 1D2NA 1QZEA 2GQFA 2HCBA 1XXHB 2ZTCA 3SBJA 3H4MA 1SXJC 1Z5BA 2Z8YM 4PT5A 1ZMWA 3A42A 1QANA 3KW6A 1N78A 1IBKM 1J09A 2VDBB 1Q02A 3MHVC 3FTCA 3K92A 4M9XA 3L29A 3Q8XA 4RKUF 1IN8A 2F5QA 5KO3A 3FE3A 1Z5AA 4PDIA 1HT2E 4JI5M 3HGIA 3PNYA 4B7HA 1WHCA 1T6OA 3FUXA 1TH3A 5E26A 1XMOM 2E5LM 4LJ7A 4IBBA 2R4EA 3LCVB 2OQ4A 3VK8A 2O5RA 4GC9A 3GP1A 2QBYA 2QQ8A 3CF2A 3MK6A 4F2LA 3DFZA 1HNWM 4KHPM 2XFTA 1G41A 3B7ZA 4CHTB 4G4RA 4MB7A 2Y0TA 1VQ1A 4II7A 3VDUA 4DR2M 4R3DA 3U6DA 2VF8A 1Q39A 2JZ0A 2V1CA 1TDHA 1SXJD 3KVWA 4DV1M 4LJ4A 1WJ7A 3PNVA 1IY2A 3L27A 3U6LA 2R44A 3LQQA 1MN3A 1E9SA 4IJFA 4LF7M 1QVRA 4L16A 5ITTA 3TQSA 4JXJA 1UM8A 2L7HA 4LJAA 4GHAA 1N36M 1ZV1A 2R0IA 4CJ6A 1V92A 1XXHA 4DR5M 1NY6A 1TGUA 2CUZA 4ZPXA 3VK7A 3GPUA 3GLGB 3GLGE 1GLNA 3QYBA 1G4AE 4Z8XA 1IBLM 1BVSA 3RE8A 2JXNA 3E9SA 7CATA 4OW0A 2O25A 4OU7A 1ZMUA 1NJGA 3LVWA 2XLJA 4L8RC 3H4JA 3B74A 3I4YA 2OPFA 1E32A 3JR5A 2DZOB 4AI6A 4MGYE 3J80S 5C18A 2DVWB 2CE7A 3MMPA 1FJGM 3GLIA 1L1TA 4IBFA 1IN6A 3VKGA 4JI6M 2DZLA 2R46A 3LMMA 5GKNA 3T15A 2BWEA 2OO9A 1QZMA 3E46A 3U6PA 3HU1A 5KQ8A 2WSFF 3KS4A 4GHLA 1DO0A 1NHGC 3KOWE 5F3WA 1R2ZA 1JB0F 1NV8A 1WGNA 4DR4M 4XBOA 3Q8GA 1L8QA 5ITYA 5KQDA 2CV2A 4G3OA 4DR7M 2O01F 2EKFA 3KXEC 4JN6A 4IIWA 2Z3XA 3HJSA 3VDPA 4NSOB 2DHYA 5KPTA 1JR3E 2QHOB 5DYGA 1AUAA 2CV1A 2QNJA 4GITA 1ORYB 5FTLA 3GO8A 3J27B 4JI7M 4REZA 3HY5A 1R5LA 4KO8A 1HQYE 2EO2A 2EUCA 4G4OA 3FUWA 3B9PA 2L2DA 3DOAA 4W5WA 3K9OA 3LQRA 4DV5M 1IM2A 2P5TA 4AKGA 3CF6E 3U60A 3SYLA 1IXSA 5IT9S 4P17A 2LVPC 5KPZA 1HNZM 2C9OA 2K0BX 4FCVA 2EKKA 1HR0M 1T3TA 4B7FA 1V34A 1D0MA 3D8LA 3KFUG 4DR6M 1DGFA 3SAVA 1TH4A 3SYKA 2JP7A 3C3EA 1TH2A 2CWBA 3KOXE 2UUAM 1OFIA 4X62M 4FWGA 1Z59A 2Y21A 4PDGA 4IJEA 2LBCA 3FKEA 4LCBA 1GO5A 4DV7M 2DXIA 1JR3A 3AOEA 1NNUC 3B7QA 3I04M 3GQ5A 3DA1A 4AKHA 2L6OA 4G4QA 3GLIB 1HQCA 4M9SA 3OTOM 1W5SA 3GQ4A 4QOSA 3I01M 1PJTA 2L7IA 3HKPA 2UU9M 1XNQM 4I4LA 1T43A 2VF7A 5LMUM 2KEBA 2M60A 1R4GA 4IBJA 3FUVA 3SMSA 3B89A 3L26A 5IWAM 3L25A 3NWLA 3SAUA 2CHQA 4M0DA 3LCUA 1NJFA 2HWJA 3J81S 2B3TA 2JUJA 3HHXA 5EXTA 4DV4M 2CEAA 2XF3A 3TPZA 2CV0A 3VKHA 3UK6A 5EXPA 3W68A 4I8OA 1LV7A 2YQZA 4LF6M 3SHGB 1IXRC 4F1IA 3U61B 1TDZA 2XSZD 2RGHA 2A5YB 4D81A 4IBGA 4WURA 5EP2A 4LFAM 4A3VB 4GKKM 2R18A 3HHWA 2KW0A 1IXZA 1IN7A 1G8PA 3KSXA 5FTNA 2R6FA 4IBEA 1YSYA 3IG8A 4DUZM 3L2AA 5JI3E 4I81A 3GQ3A 1C1KA 4GKJM 2ZANA 3J7AS 4OX9M 1D0LA 1A5TA 2CFOA 1VDDA 1HNXM 1I94M 1VG5A 1ZMVA 4DR3M 4LY6A 3KOYE 1GJTA 4JI2M 1NVMA 3PXGA 2DZNB 2BJWA 4X64M 1OJLA 4D82A 3HU2A 1JR3D 3IECA 2C5RA 4X65M 2ZTDA 3FD9A 4KLNA 2LXEA 2MH8A 4LF5M 3HHZA 1DGHA 4FVMA 3E21A 1IQPA 4FD2A 2ZAOA 3SC3A 2XGNA 4WW0A 2DWMA 2V6ZM 4BBAA 5EP4A 4JI1M 4OVZB 4Y28F 3JR4A 3KS8A 1Q3BA 4GRIA 2J7OA 1NV9A 2WSCF 4LF9M 2KZUA 1GL6A 1IY0A 3UJNA 2XFSA 3AOEC 3B7NA 4D80A 2KRKA 3U61A 1QUTA 4I5SA 3BXWA 4RNAA 1VEJA 2JZ1A 3GLFB 1PJQA 1VDLA 2K9DA 2YFQA 3M7GA 2BWBA 2Z4SA 4FCTA 5DFLA 5EXSA 3GPXA 2WSEF 1E9RA 2LNHC 2BNKA 4R71A 3BOSA 4L15A 2D7HA 3KDSE 4NOOB 2L09A 2DWNA 2R45A 4WP2A 1KSFX 2EA0A 3KP0E 3GLFA 1R2YA 2X8AA 2C96A 1QDRA 4QHTA 3PVSA 1SG9A 2R65A 4NXMM 1Y8GA 2OOAA 2QCUA 1NY5A 3HZJA 3GLHB 4IBCA 1MX0A 2LWXA 4DV6M 4PCZA 1Z6TA 1ZQ9A 3HU3A 2DWZB 4GIPA 2D7GA 4S12A 4Q7JA 4X66M 4L78A 3AL0C 2C99A 3CGWA 4LGMA 1LTMA 5ITUA 3GRYA 5E6JA 2XZFA 2C9CA 5ITXA 2N35A 2KA6B 2WZJA 3GLHE 1R6BX 4M9ZA 3AKZA 2JY7A 1CUKA 1IN4A 5EJCA 1K82A 2LHGA 2K47A 4NRVA 3IHPA 5FLXS 3KP1E 5IREB 2VIIA 8CATA 5H37D 3TWMA 3QAUA 3FRHA 3FYCA 1DV0A 1J5EM 1FNNA 3GRRA 3VFDA 4QNMA 2MROB 1OTRA 2UXDM 3LVVA 2FNAA 3ZH9B 4ANRA 3U6QA 2QENA 2X4AA 1IY1A 3D8BA 1NNJA 3NBIA 2BJVA 4M0WA 1UFZA 1N33M 3FUUA 2JY6B 1N77A 1DGBA 1G59A 4XK8F 4DR1M 3U5ZA 2CP8A 2LVQD 4LJ8A 4LJ6A 4CISA 1H6UA 2MJ5B 3THGA 4LFBM 5IZ7D 2FOIC 2LHCA 3T6PA 1QAQA 3A46A 2VQFM 2DKLA 3UZUA 2DNAA 2UUBM 2XSZA 4NSRA 5ITXE 4QOZC 2UXCM 1TR8A 3GPYA 3SASA 2EJSA 2G3QA 4JI0M 2Q2EB 3NBXX 1YUBA 1SXJB 2CHGA 2DHRA 4GMQA 4NL4H 3RGPA 3TWLA 4CGYB 3U6MA 4B3TM 2XEPA 2JA2A 1YLAA 2FH0A 3QYEA 1KFVA 1XC8A 1OAIA 4MGKE 2YNMD 2KDLA 4B3MM 2AHMA 5EQTA 1WR1B 4LF8M 3TL4X 5FTJA 4Z6YA 1SXJE 2RGOA 4MGZE 2LVNC 3PFIA 2J7NA 1VEGA 2LVOC 4NRWA 1R7RA 4LG2A 1OKSA 4KT0F 2C98A 3WHLA 4TUWA 3FRIA 1PJSA 2F4VM 1XHBA 2FE8A 2KNZA 1PRBA 2ERCA 4HL4A 1DGHB 2CHVA 2D7EA 3HX3A 1L2CA 4CIZA 2QBYB 1IFYA 3CF0A 1Z5CA 4AQYM 3J2PB 4GC5A 3KSJA 3ZCBB 1EIJA 1HT1E 4YY3M 2M5ZA 3A98B 1Q3CA 1G71A 5BR8M 1TF0B 2G8LA 4NC6A 4QHSA 2MR9A 2XH9A 3SMPA 3CTWB 3T1YM 3C9PA 4K0KM 3U6SA 1YE9A 2LTUA 2I7NA 4DV3M 4LZZA 2ZM6M 2VQEM 3U5ZB 5DYIA 4LJ9A 5EP1A 2F5PA 2DAGA 3HJ8A 2APLA 1MU5A 4HEOA 4LJ5A 4AG6A 3C58A 5ITRA 1N32M 2R62A 4IBKA 3W0LB 4B3RM 1PM5A 2KNAA 3U6OA 3FTEA 3UGJA 2RRUA 1QYRA 1N34M 2LH0A 1D0KA 4LFCM 4UN2B 5EXXA 2ZBKB 4LRTA 2JWSA 2UUCM 3ZQJA 2MGWA 1J7KA 1QQWA 3FUTA 2HHHM 4KODA 4ITQA 4FWDA 1QAOA 2R4JA 1IBMM 3GLHA 3EIEA 1OAOC 2DAMA 4FW9A 3HWSA 2QP9X 3FTFA 2QZ4A 3GPPA 1GL7A 2I7PA 3M0EA 1L1ZA 5LMNM 4MGIE 2QPAA 3J7BA 2F5OA 1GABA 1GVNA 4JI8M 2H5XA 1VEKA 2F5SA 1JQJC 4HLQA 3U6CA 1K3WA 4B08A 4LGYA 1EFUB 1ZAEA 3AFHA 2NQ8C 4NXNM 2KNVA 3GLFE 4DUYM 1K3XA 3SATA 1TTEA 2XZUA 3LW5F 3K1JA 1QAMA 5FTKA 1OIZA 4B3SM 1X37A 5FSWA 4MGHA 4FCWA 2JNHA 4AG5A 4R7GA 2Z7JA 5BPVA 3SHFA 4L4UA 2Y0QA 4DV2M 1OFHA 4YHHM 5ITQA 2Y20A 3HJQA 2J5YA 3R8FA 2FFJA 2FS1A 3IG5A 3K9PA 1QUSA 3AJIB 3I51A 2H1RA 3MJ5A 1GKIA 1IXSB 2UXBM 3K8ZA 4MM3B 1G3IA 4DBGB 2K6BA 3U6EA 1QDTA 3C3DA 5C1BA 3DZDA 3RGSA 1NSFA 3AOGA 4LZJA 4BLCA 1AIPC 4PD2A 1SXJA 3L28A 4RF0A 3GRUA 3GLGA 5DNYA 4QNRA 4P16A 3FYDA 1IN5A 3E4RA 3TWKA 1EE8A 2Z4RA 3K2LA 4AKIA 5KPRA 2CRUA 2YR0A 3RFWA 1NHWC 4LRSA 1MJGM 3V76A 3ZC7B 1XB2B 3I4VA 2G5GX 3HHYA 1XNRM 3QWLA 2X49A 1F4IA 2LVAA 4GEWA 1L2DA 2F5NA 1KYIA 3WHKA 4EIWA 2L4EA 3A45A 4OVZA 3W0FA 4DV0M 2DENA 5L8RF 1NO1A 1PGYA 2OOBA 3GRVA 3SAWA 5FTMA 1HJPA 4JI3M 1L2BA 1E94E 4GH9A 3R9XB 1RU3A 2V1UA 2KZSA 1PJJA 4AW4A 3UMMA 1XWIA 1S3SA 3M6AA 4FWHA 4RF1A 3T1HM 4G4NA 3JAMS 2HKJA 3TE6A 2DAKA 4BB9A 4LF4M 1WXQA 1P3QQ 2JY8A 2JY5A 4B7GA 3SFZA 3SARA 4MH0E 3GLIE 2L4FA 1C7YA 1GJSA 1W5TA 2DI0A 2ZAMA 4JV5M 1WGLA 2DAEA 3AV0A 4JYAM 5JI2E 5A2QS 1XMQM 2KXEA 3VLFB 2DAIA 1WIVA 1OIPA 4JI4M 1DO2A 3ILKA 1OQYA 5EP3A 1N75A 2QSFX 3F92A 1I4WA 2HAKA 4L6V6 4AZFA 2DWLA 4IBDA 1PJIA
chains in the Genus database with same CATH topology
3U60B 3T38A 2HL7A 4G6ZA 1DGGA 3KOZE 2KRUA 4XGIA 2RKOA 2W82A 4IBIA 3EIHA 3FTDA 1D2NA 2HCBA 1XXHB 3SBJA 3H4MA 1SXJC 1Z5BA 4PT5A 3A42A 1QANA 3KW6A 1N78A 1IBKM 1J09A 3MHVC 3FTCA 3K92A 4M9XA 3L29A 3Q8XA 1IN8A 2F5QA 5KO3A 1Z5AA 4PDIA 1HT2E 4JI5M 3HGIA 3PNYA 4B7HA 2E5LM 3FUXA 1XMOM 1TH3A 5E26A 4LJ7A 4IBBA 2R4EA 2OQ4A 3VK8A 2O5RA 4GC9A 3GP1A 2QBYA 3MK6A 3CF2A 1HNWM 4KHPM 3DFZA 2XFTA 1G41A 4CHTB 4G4RA 4MB7A 2Y0TA 4II7A 3VDUA 4DR2M 4R3DA 3U6DA 1Q39A 2V1CA 4DV1M 1TDHA 1SXJD 3KVWA 4LJ4A 3PNVA 1IY2A 3L27A 3U6LA 3LQQA 1E9SA 4IJFA 4LF7M 1QVRA 4L16A 5ITTA 3TQSA 4JXJA 1UM8A 2L7HA 4LJAA 4GHAA 1N36M 1XXHA 4DR5M 1NY6A 1TGUA 2CUZA 4ZPXA 3VK7A 3GPUA 3GLGB 1GLNA 1G4AE 4Z8XA 1IBLM 3RE8A 3E9SA 7CATA 4OW0A 4OU7A 3LVWA 1NJGA 2XLJA 4L8RC 3I4YA 2OPFA 1E32A 3JR5A 2DZOB 4AI6A 4MGYE 3J80S 5C18A 2DVWB 2CE7A 1FJGM 3GLIA 1L1TA 4IBFA 1IN6A 3VKGA 4JI6M 2R46A 3LMMA 5GKNA 3T15A 1QZMA 3U6PA 3HU1A 5KQ8A 4GHLA 3KS4A 1DO0A 1NHGC 3KOWE 5F3WA 1R2ZA 4DR4M 4XBOA 5ITYA 1L8QA 5KQDA 2CV2A 4DR7M 2Z3XA 3KXEC 4JN6A 4IIWA 3HJSA 3VDPA 4NSOB 5KPTA 5DYGA 2CV1A 4GITA 1ORYB 5FTLA 3GO8A 3J27B 4JI7M 4REZA 4KO8A 4G4OA 1HQYE 2EO2A 2EUCA 3FUWA 3B9PA 3DOAA 4W5WA 3LQRA 4DV5M 1IM2A 2P5TA 4AKGA 3CF6E 3U60A 3SYLA 5IT9S 5KPZA 1HNZM 2C9OA 4FCVA 1HR0M 1T3TA 4B7FA 3D8LA 3KFUG 4DR6M 1DGFA 3SAVA 1TH4A 3SYKA 1TH2A 3KOXE 2UUAM 1OFIA 4X62M 4FWGA 1Z59A 2Y21A 4PDGA 4IJEA 3FKEA 4LCBA 4DV7M 2DXIA 1JR3A 3AOEA 1NNUC 3GQ5A 3DA1A 4AKHA 2L6OA 4G4QA 3GLIB 1HQCA 4M9SA 3OTOM 1W5SA 3GQ4A 4QOSA 2L7IA 3HKPA 2UU9M 1XNQM 4I4LA 5LMUM 2KEBA 2M60A 4IBJA 3FUVA 3SMSA 3L26A 5IWAM 3L25A 3NWLA 3SAUA 2CHQA 4M0DA 1NJFA 3J81S 3HHXA 5EXTA 4DV4M 2CEAA 2XF3A 3TPZA 2CV0A 3VKHA 3UK6A 5EXPA 4I8OA 1LV7A 2YQZA 4LF6M 3SHGB 1IXRC 3U61B 1TDZA 2XSZD 2RGHA 2A5YB 4D81A 4IBGA 4WURA 5EP2A 4LFAM 4A3VB 4GKKM 2R18A 3HHWA 2KW0A 1IXZA 1IN7A 1G8PA 3KSXA 5FTNA 4IBEA 1YSYA 3IG8A 4DUZM 3L2AA 5JI3E 4I81A 3GQ3A 1C1KA 4GKJM 2ZANA 3J7AS 4OX9M 2CFOA 1VDDA 1HNXM 1I94M 4DR3M 4LY6A 3KOYE 4JI2M 1NVMA 3PXGA 2DZNB 2BJWA 4X64M 1OJLA 4D82A 3HU2A 1JR3D 2C5RA 4X65M 3FD9A 4KLNA 2LXEA 4LF5M 3HHZA 1DGHA 4FVMA 1IQPA 4FD2A 2ZAOA 3SC3A 2XGNA 4WW0A 2DWMA 2V6ZM 4BBAA 5EP4A 4JI1M 4OVZB 3KS8A 3JR4A 1Q3BA 4GRIA 2J7OA 4LF9M 2KZUA 1GL6A 1IY0A 3UJNA 2XFSA 3AOEC 3U61A 4D80A 2KRKA 4I5SA 4RNAA 3GLFB 2YFQA 3M7GA 4FCTA 5EXSA 2Z4SA 3GPXA 1E9RA 2LNHC 2BNKA 3BOSA 4L15A 2D7HA 3KDSE 4NOOB 2L09A 2DWNA 2R45A 2EA0A 1KSFX 3KP0E 3GLFA 1R2YA 2X8AA 2C96A 4QHTA 3PVSA 2R65A 4NXMM 2QCUA 1NY5A 3GLHB 4IBCA 1MX0A 2LWXA 4DV6M 4PCZA 1Z6TA 1ZQ9A 3HU3A 2DWZB 4GIPA 2D7GA 4S12A 4X66M 3AL0C 4L78A 2C99A 4LGMA 5ITUA 3GRYA 5E6JA 2XZFA 2C9CA 5ITXA 2KA6B 3AKZA 1R6BX 4M9ZA 5EJCA 1IN4A 1K82A 2K47A 4NRVA 5FLXS 3KP1E 5IREB 2VIIA 8CATA 5H37D 3TWMA 3QAUA 3FYCA 1J5EM 1FNNA 3GRRA 3VFDA 4QNMA 2UXDM 3LVVA 2FNAA 3ZH9B 3U6QA 1NNJA 2QENA 2X4AA 1IY1A 3D8BA 3NBIA 2BJVA 4M0WA 1N33M 3FUUA 1N77A 1DGBA 1G59A 4DR1M 3U5ZA 4LJ8A 4LJ6A 4CISA 1H6UA 3THGA 4LFBM 5IZ7D 2FOIC 1QAQA 3A46A 2VQFM 3UZUA 2UUBM 2XSZA 4NSRA 5ITXE 4QOZC 2UXCM 3GPYA 3SASA 4JI0M 2Q2EB 1YUBA 1SXJB 2CHGA 2DHRA 4GMQA 4NL4H 3RGPA 3TWLA 4CGYB 3U6MA 4B3TM 2XEPA 2JA2A 1KFVA 1XC8A 4MGKE 2YNMD 4B3MM 2AHMA 5EQTA 4LF8M 3TL4X 5FTJA 4Z6YA 1SXJE 2RGOA 4MGZE 3PFIA 2J7NA 4NRWA 1R7RA 4LG2A 2C98A 3WHLA 4TUWA 2F4VM 1XHBA 2FE8A 2ERCA 4HL4A 1DGHB 2CHVA 2D7EA 1L2CA 2QBYB 3CF0A 1Z5CA 4AQYM 3J2PB 4GC5A 3KSJA 3ZCBB 1HT1E 4YY3M 2M5ZA 3A98B 1Q3CA 5BR8M 2G8LA 4QHSA 2XH9A 3T1YM 3SMPA 3CTWB 4K0KM 3U6SA 1YE9A 4DV3M 2I7NA 4LZZA 2ZM6M 2VQEM 3U5ZB 5DYIA 4LJ9A 5EP1A 2F5PA 3HJ8A 3C58A 1MU5A 4LJ5A 4AG6A 5ITRA 1N32M 2R62A 4IBKA 3W0LB 4B3RM 1PM5A 3U6OA 3FTEA 3UGJA 1QYRA 1N34M 2LH0A 4LFCM 5EXXA 2ZBKB 4LRTA 2UUCM 1J7KA 1QQWA 3FUTA 2HHHM 4KODA 4ITQA 4FWDA 1QAOA 2R4JA 1IBMM 3GLHA 3EIEA 4FW9A 3HWSA 2QP9X 3FTFA 2QZ4A 3GPPA 1GL7A 2I7PA 3M0EA 1L1ZA 5LMNM 4MGIE 2QPAA 3J7BA 2F5OA 1GVNA 4JI8M 2F5SA 1JQJC 4HLQA 3U6CA 1K3WA 4B08A 4LGYA 1ZAEA 3AFHA 2NQ8C 4NXNM 4DUYM 1K3XA 3SATA 2XZUA 3K1JA 1QAMA 5FTKA 4B3SM 1X37A 5FSWA 4MGHA 4FCWA 4AG5A 4R7GA 2Z7JA 5BPVA 3SHFA 4L4UA 2Y0QA 4DV2M 1OFHA 4YHHM 5ITQA 2Y20A 3HJQA 3R8FA 2FFJA 3IG5A 3AJIB 3I51A 2H1RA 3MJ5A 1GKIA 1IXSB 2UXBM 3K8ZA 4MM3B 1G3IA 3U6EA 5C1BA 3DZDA 3RGSA 1NSFA 3AOGA 4LZJA 4BLCA 4PD2A 1SXJA 3L28A 4RF0A 3GRUA 3GLGA 5DNYA 4QNRA 4P16A 3FYDA 1IN5A 3E4RA 3TWKA 1EE8A 2Z4RA 3K2LA 4AKIA 5KPRA 2YR0A 3RFWA 1NHWC 4LRSA 3ZC7B 3I4VA 2G5GX 3HHYA 1XNRM 3QWLA 2X49A 1L2DA 2F5NA 1KYIA 3WHKA 4EIWA 3A45A 4OVZA 3W0FA 4DV0M 3GRVA 3SAWA 5FTMA 4JI3M 1L2BA 1E94E 4GH9A 3R9XB 2V1UA 2KZSA 1PJJA 4AW4A 3UMMA 1XWIA 1S3SA 3M6AA 4FWHA 4RF1A 3T1HM 4G4NA 3JAMS 2HKJA 3TE6A 4BB9A 4LF4M 1WXQA 4B7GA 3SFZA 3SARA 4MH0E 1W5TA 2ZAMA 4JV5M 4JYAM 3AV0A 5JI2E 5A2QS 1XMQM 2KXEA 3VLFB 4JI4M 1DO2A 3ILKA 5EP3A 1N75A 1I4WA 2DWLA 4AZFA 4IBDA 1PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  2P5T A;  1GVN A; 
#chains in the Genus database with same CATH topology
 3U60 B;  3T38 A;  2HL7 A;  4G6Z A;  1DGG A;  3KOZ E;  3W67 A;  2KRU A;  4XGI A;  2GNO A;  2RKO A;  2W82 A;  3BBZ A;  4IBI A;  1XXH E;  2KHH A;  1V33 A;  3EIH A;  3FTD A;  1D2N A;  1QZE A;  2GQF A;  2HCB A;  1XXH B;  2ZTC A;  3SBJ A;  3H4M A;  1SXJ C;  1Z5B A;  2Z8Y M;  4PT5 A;  1ZMW A;  3A42 A;  1QAN A;  3KW6 A;  1N78 A;  1IBK M;  1J09 A;  2VDB B;  1Q02 A;  3MHV C;  3FTC A;  3K92 A;  4M9X A;  3L29 A;  3Q8X A;  4RKU F;  1IN8 A;  2F5Q A;  5KO3 A;  3FE3 A;  1Z5A A;  4PDI A;  1HT2 E;  4JI5 M;  3HGI A;  3PNY A;  4B7H A;  1WHC A;  1T6O A;  3FUX A;  1TH3 A;  5E26 A;  1XMO M;  2E5L M;  4LJ7 A;  4IBB A;  2R4E A;  3LCV B;  2OQ4 A;  3VK8 A;  2O5R A;  4GC9 A;  3GP1 A;  2QBY A;  2QQ8 A;  3CF2 A;  3MK6 A;  4F2L A;  3DFZ A;  1HNW M;  4KHP M;  2XFT A;  1G41 A;  3B7Z A;  4CHT B;  4G4R A;  4MB7 A;  2Y0T A;  1VQ1 A;  4II7 A;  3VDU A;  4DR2 M;  4R3D A;  3U6D A;  2VF8 A;  1Q39 A;  2JZ0 A;  2V1C A;  1TDH A;  1SXJ D;  3KVW A;  4DV1 M;  4LJ4 A;  1WJ7 A;  3PNV A;  1IY2 A;  3L27 A;  3U6L A;  2R44 A;  3LQQ A;  1MN3 A;  1E9S A;  4IJF A;  4LF7 M;  1QVR A;  4L16 A;  5ITT A;  3TQS A;  4JXJ A;  1UM8 A;  2L7H A;  4LJA A;  4GHA A;  1N36 M;  1ZV1 A;  2R0I A;  4CJ6 A;  1V92 A;  1XXH A;  4DR5 M;  1NY6 A;  1TGU A;  2CUZ A;  4ZPX A;  3VK7 A;  3GPU A;  3GLG B;  3GLG E;  1GLN A;  3QYB A;  1G4A E;  4Z8X A;  1IBL M;  1BVS A;  3RE8 A;  2JXN A;  3E9S A;  7CAT A;  4OW0 A;  2O25 A;  4OU7 A;  1ZMU A;  1NJG A;  3LVW A;  2XLJ A;  4L8R C;  3H4J A;  3B74 A;  3I4Y A;  2OPF A;  1E32 A;  3JR5 A;  2DZO B;  4AI6 A;  4MGY E;  3J80 S;  5C18 A;  2DVW B;  2CE7 A;  3MMP A;  1FJG M;  3GLI A;  1L1T A;  4IBF A;  1IN6 A;  3VKG A;  4JI6 M;  2DZL A;  2R46 A;  3LMM A;  5GKN A;  3T15 A;  2BWE A;  2OO9 A;  1QZM A;  3E46 A;  3U6P A;  3HU1 A;  5KQ8 A;  2WSF F;  3KS4 A;  4GHL A;  1DO0 A;  1NHG C;  3KOW E;  5F3W A;  1R2Z A;  1JB0 F;  1NV8 A;  1WGN A;  4DR4 M;  4XBO A;  3Q8G A;  1L8Q A;  5ITY A;  5KQD A;  2CV2 A;  4G3O A;  4DR7 M;  2O01 F;  2EKF A;  3KXE C;  4JN6 A;  4IIW A;  2Z3X A;  3HJS A;  3VDP A;  4NSO B;  2DHY A;  5KPT A;  1JR3 E;  2QHO B;  5DYG A;  1AUA A;  2CV1 A;  2QNJ A;  4GIT A;  1ORY B;  5FTL A;  3GO8 A;  3J27 B;  4JI7 M;  4REZ A;  3HY5 A;  1R5L A;  4KO8 A;  1HQY E;  2EO2 A;  2EUC A;  4G4O A;  3FUW A;  3B9P A;  2L2D A;  3DOA A;  4W5W A;  3K9O A;  3LQR A;  4DV5 M;  1IM2 A;  2P5T A;  4AKG A;  3CF6 E;  3U60 A;  3SYL A;  1IXS A;  5IT9 S;  4P17 A;  2LVP C;  5KPZ A;  1HNZ M;  2C9O A;  2K0B X;  4FCV A;  2EKK A;  1HR0 M;  1T3T A;  4B7F A;  1V34 A;  1D0M A;  3D8L A;  3KFU G;  4DR6 M;  1DGF A;  3SAV A;  1TH4 A;  3SYK A;  2JP7 A;  3C3E A;  1TH2 A;  2CWB A;  3KOX E;  2UUA M;  1OFI A;  4X62 M;  4FWG A;  1Z59 A;  2Y21 A;  4PDG A;  4IJE A;  2LBC A;  3FKE A;  4LCB A;  1GO5 A;  4DV7 M;  2DXI A;  1JR3 A;  3AOE A;  1NNU C;  3B7Q A;  3I04 M;  3GQ5 A;  3DA1 A;  4AKH A;  2L6O A;  4G4Q A;  3GLI B;  1HQC A;  4M9S A;  3OTO M;  1W5S A;  3GQ4 A;  4QOS A;  3I01 M;  1PJT A;  2L7I A;  3HKP A;  2UU9 M;  1XNQ M;  4I4L A;  1T43 A;  2VF7 A;  5LMU M;  2KEB A;  2M60 A;  1R4G A;  4IBJ A;  3FUV A;  3SMS A;  3B89 A;  3L26 A;  5IWA M;  3L25 A;  3NWL A;  3SAU A;  2CHQ A;  4M0D A;  3LCU A;  1NJF A;  2HWJ A;  3J81 S;  2B3T A;  2JUJ A;  3HHX A;  5EXT A;  4DV4 M;  2CEA A;  2XF3 A;  3TPZ A;  2CV0 A;  3VKH A;  3UK6 A;  5EXP A;  3W68 A;  4I8O A;  1LV7 A;  2YQZ A;  4LF6 M;  3SHG B;  1IXR C;  4F1I A;  3U61 B;  1TDZ A;  2XSZ D;  2RGH A;  2A5Y B;  4D81 A;  4IBG A;  4WUR A;  5EP2 A;  4LFA M;  4A3V B;  4GKK M;  2R18 A;  3HHW A;  2KW0 A;  1IXZ A;  1IN7 A;  1G8P A;  3KSX A;  5FTN A;  2R6F A;  4IBE A;  1YSY A;  3IG8 A;  4DUZ M;  3L2A A;  5JI3 E;  4I81 A;  3GQ3 A;  1C1K A;  4GKJ M;  2ZAN A;  3J7A S;  4OX9 M;  1D0L A;  1A5T A;  2CFO A;  1VDD A;  1HNX M;  1I94 M;  1VG5 A;  1ZMV A;  4DR3 M;  4LY6 A;  3KOY E;  1GJT A;  4JI2 M;  1NVM A;  3PXG A;  2DZN B;  2BJW A;  4X64 M;  1OJL A;  4D82 A;  3HU2 A;  1JR3 D;  3IEC A;  2C5R A;  4X65 M;  2ZTD A;  3FD9 A;  4KLN A;  2LXE A;  2MH8 A;  4LF5 M;  3HHZ A;  1DGH A;  4FVM A;  3E21 A;  1IQP A;  4FD2 A;  2ZAO A;  3SC3 A;  2XGN A;  4WW0 A;  2DWM A;  2V6Z M;  4BBA A;  5EP4 A;  4JI1 M;  4OVZ B;  4Y28 F;  3JR4 A;  3KS8 A;  1Q3B A;  4GRI A;  2J7O A;  1NV9 A;  2WSC F;  4LF9 M;  2KZU A;  1GL6 A;  1IY0 A;  3UJN A;  2XFS A;  3AOE C;  3B7N A;  4D80 A;  2KRK A;  3U61 A;  1QUT A;  4I5S A;  3BXW A;  4RNA A;  1VEJ A;  2JZ1 A;  3GLF B;  1PJQ A;  1VDL A;  2K9D A;  2YFQ A;  3M7G A;  2BWB A;  2Z4S A;  4FCT A;  5DFL A;  5EXS A;  3GPX A;  2WSE F;  1E9R A;  2LNH C;  2BNK A;  4R71 A;  3BOS A;  4L15 A;  2D7H A;  3KDS E;  4NOO B;  2L09 A;  2DWN A;  2R45 A;  4WP2 A;  1KSF X;  2EA0 A;  3KP0 E;  3GLF A;  1R2Y A;  2X8A A;  2C96 A;  1QDR A;  4QHT A;  3PVS A;  1SG9 A;  2R65 A;  4NXM M;  1Y8G A;  2OOA A;  2QCU A;  1NY5 A;  3HZJ A;  3GLH B;  4IBC A;  1MX0 A;  2LWX A;  4DV6 M;  4PCZ A;  1Z6T A;  1ZQ9 A;  3HU3 A;  2DWZ B;  4GIP A;  2D7G A;  4S12 A;  4Q7J A;  4X66 M;  4L78 A;  3AL0 C;  2C99 A;  3CGW A;  4LGM A;  1LTM A;  5ITU A;  3GRY A;  5E6J A;  2XZF A;  2C9C A;  5ITX A;  2N35 A;  2KA6 B;  2WZJ A;  3GLH E;  1R6B X;  4M9Z A;  3AKZ A;  2JY7 A;  1CUK A;  1IN4 A;  5EJC A;  1K82 A;  2LHG A;  2K47 A;  4NRV A;  3IHP A;  5FLX S;  3KP1 E;  5IRE B;  2VII A;  8CAT A;  5H37 D;  3TWM A;  3QAU A;  3FRH A;  3FYC A;  1DV0 A;  1J5E M;  1FNN A;  3GRR A;  3VFD A;  4QNM A;  2MRO B;  1OTR A;  2UXD M;  3LVV A;  2FNA A;  3ZH9 B;  4ANR A;  3U6Q A;  2QEN A;  2X4A A;  1IY1 A;  3D8B A;  1NNJ A;  3NBI A;  2BJV A;  4M0W A;  1UFZ A;  1N33 M;  3FUU A;  2JY6 B;  1N77 A;  1DGB A;  1G59 A;  4XK8 F;  4DR1 M;  3U5Z A;  2CP8 A;  2LVQ D;  4LJ8 A;  4LJ6 A;  4CIS A;  1H6U A;  2MJ5 B;  3THG A;  4LFB M;  5IZ7 D;  2FOI C;  2LHC A;  3T6P A;  1QAQ A;  3A46 A;  2VQF M;  2DKL A;  3UZU A;  2DNA A;  2UUB M;  2XSZ A;  4NSR A;  5ITX E;  4QOZ C;  2UXC M;  1TR8 A;  3GPY A;  3SAS A;  2EJS A;  2G3Q A;  4JI0 M;  2Q2E B;  3NBX X;  1YUB A;  1SXJ B;  2CHG A;  2DHR A;  4GMQ A;  4NL4 H;  3RGP A;  3TWL A;  4CGY B;  3U6M A;  4B3T M;  2XEP A;  2JA2 A;  1YLA A;  2FH0 A;  3QYE A;  1KFV A;  1XC8 A;  1OAI A;  4MGK E;  2YNM D;  2KDL A;  4B3M M;  2AHM A;  5EQT A;  1WR1 B;  4LF8 M;  3TL4 X;  5FTJ A;  4Z6Y A;  1SXJ E;  2RGO A;  4MGZ E;  2LVN C;  3PFI A;  2J7N A;  1VEG A;  2LVO C;  4NRW A;  1R7R A;  4LG2 A;  1OKS A;  4KT0 F;  2C98 A;  3WHL A;  4TUW A;  3FRI A;  1PJS A;  2F4V M;  1XHB A;  2FE8 A;  2KNZ A;  1PRB A;  2ERC A;  4HL4 A;  1DGH B;  2CHV A;  2D7E A;  3HX3 A;  1L2C A;  4CIZ A;  2QBY B;  1IFY A;  3CF0 A;  1Z5C A;  4AQY M;  3J2P B;  4GC5 A;  3KSJ A;  3ZCB B;  1EIJ A;  1HT1 E;  4YY3 M;  2M5Z A;  3A98 B;  1Q3C A;  1G71 A;  5BR8 M;  1TF0 B;  2G8L A;  4NC6 A;  4QHS A;  2MR9 A;  2XH9 A;  3SMP A;  3CTW B;  3T1Y M;  3C9P A;  4K0K M;  3U6S A;  1YE9 A;  2LTU A;  2I7N A;  4DV3 M;  4LZZ A;  2ZM6 M;  2VQE M;  3U5Z B;  5DYI A;  4LJ9 A;  5EP1 A;  2F5P A;  2DAG A;  3HJ8 A;  2APL A;  1MU5 A;  4HEO A;  4LJ5 A;  4AG6 A;  3C58 A;  5ITR A;  1N32 M;  2R62 A;  4IBK A;  3W0L B;  4B3R M;  1PM5 A;  2KNA A;  3U6O A;  3FTE A;  3UGJ A;  2RRU A;  1QYR A;  1N34 M;  2LH0 A;  1D0K A;  4LFC M;  4UN2 B;  5EXX A;  2ZBK B;  4LRT A;  2JWS A;  2UUC M;  3ZQJ A;  2MGW A;  1J7K A;  1QQW A;  3FUT A;  2HHH M;  4KOD A;  4ITQ A;  4FWD A;  1QAO A;  2R4J A;  1IBM M;  3GLH A;  3EIE A;  1OAO C;  2DAM A;  4FW9 A;  3HWS A;  2QP9 X;  3FTF A;  2QZ4 A;  3GPP A;  1GL7 A;  2I7P A;  3M0E A;  1L1Z A;  5LMN M;  4MGI E;  2QPA A;  3J7B A;  2F5O A;  1GAB A;  1GVN A;  4JI8 M;  2H5X A;  1VEK A;  2F5S A;  1JQJ C;  4HLQ A;  3U6C A;  1K3W A;  4B08 A;  4LGY A;  1EFU B;  1ZAE A;  3AFH A;  2NQ8 C;  4NXN M;  2KNV A;  3GLF E;  4DUY M;  1K3X A;  3SAT A;  1TTE A;  2XZU A;  3LW5 F;  3K1J A;  1QAM A;  5FTK A;  1OIZ A;  4B3S M;  1X37 A;  5FSW A;  4MGH A;  4FCW A;  2JNH A;  4AG5 A;  4R7G A;  2Z7J A;  5BPV A;  3SHF A;  4L4U A;  2Y0Q A;  4DV2 M;  1OFH A;  4YHH M;  5ITQ A;  2Y20 A;  3HJQ A;  2J5Y A;  3R8F A;  2FFJ A;  2FS1 A;  3IG5 A;  3K9P A;  1QUS A;  3AJI B;  3I51 A;  2H1R A;  3MJ5 A;  1GKI A;  1IXS B;  2UXB M;  3K8Z A;  4MM3 B;  1G3I A;  4DBG B;  2K6B A;  3U6E A;  1QDT A;  3C3D A;  5C1B A;  3DZD A;  3RGS A;  1NSF A;  3AOG A;  4LZJ A;  4BLC A;  1AIP C;  4PD2 A;  1SXJ A;  3L28 A;  4RF0 A;  3GRU A;  3GLG A;  5DNY A;  4QNR A;  4P16 A;  3FYD A;  1IN5 A;  3E4R A;  3TWK A;  1EE8 A;  2Z4R A;  3K2L A;  4AKI A;  5KPR A;  2CRU A;  2YR0 A;  3RFW A;  1NHW C;  4LRS A;  1MJG M;  3V76 A;  3ZC7 B;  1XB2 B;  3I4V A;  2G5G X;  3HHY A;  1XNR M;  3QWL A;  2X49 A;  1F4I A;  2LVA A;  4GEW A;  1L2D A;  2F5N A;  1KYI A;  3WHK A;  4EIW A;  2L4E A;  3A45 A;  4OVZ A;  3W0F A;  4DV0 M;  2DEN A;  5L8R F;  1NO1 A;  1PGY A;  2OOB A;  3GRV A;  3SAW A;  5FTM A;  1HJP A;  4JI3 M;  1L2B A;  1E94 E;  4GH9 A;  3R9X B;  1RU3 A;  2V1U A;  2KZS A;  1PJJ A;  4AW4 A;  3UMM A;  1XWI A;  1S3S A;  3M6A A;  4FWH A;  4RF1 A;  3T1H M;  4G4N A;  3JAM S;  2HKJ A;  3TE6 A;  2DAK A;  4BB9 A;  4LF4 M;  1WXQ A;  1P3Q Q;  2JY8 A;  2JY5 A;  4B7G A;  3SFZ A;  3SAR A;  4MH0 E;  3GLI E;  2L4F A;  1C7Y A;  1GJS A;  1W5T A;  2DI0 A;  2ZAM A;  4JV5 M;  1WGL A;  2DAE A;  3AV0 A;  4JYA M;  5JI2 E;  5A2Q S;  1XMQ M;  2KXE A;  3VLF B;  2DAI A;  1WIV A;  1OIP A;  4JI4 M;  1DO2 A;  3ILK A;  1OQY A;  5EP3 A;  1N75 A;  2QSF X;  3F92 A;  1I4W A;  2HAK A;  4L6V 6;  4AZF A;  2DWL A;  4IBD A;  1PJI A; 
#chains in the Genus database with same CATH homology
 3U60 B;  3T38 A;  2HL7 A;  4G6Z A;  1DGG A;  3KOZ E;  2KRU A;  4XGI A;  2RKO A;  2W82 A;  4IBI A;  3EIH A;  3FTD A;  1D2N A;  2HCB A;  1XXH B;  3SBJ A;  3H4M A;  1SXJ C;  1Z5B A;  4PT5 A;  3A42 A;  1QAN A;  3KW6 A;  1N78 A;  1IBK M;  1J09 A;  3MHV C;  3FTC A;  3K92 A;  4M9X A;  3L29 A;  3Q8X A;  1IN8 A;  2F5Q A;  5KO3 A;  1Z5A A;  4PDI A;  1HT2 E;  4JI5 M;  3HGI A;  3PNY A;  4B7H A;  2E5L M;  3FUX A;  1XMO M;  1TH3 A;  5E26 A;  4LJ7 A;  4IBB A;  2R4E A;  2OQ4 A;  3VK8 A;  2O5R A;  4GC9 A;  3GP1 A;  2QBY A;  3MK6 A;  3CF2 A;  1HNW M;  4KHP M;  3DFZ A;  2XFT A;  1G41 A;  4CHT B;  4G4R A;  4MB7 A;  2Y0T A;  4II7 A;  3VDU A;  4DR2 M;  4R3D A;  3U6D A;  1Q39 A;  2V1C A;  4DV1 M;  1TDH A;  1SXJ D;  3KVW A;  4LJ4 A;  3PNV A;  1IY2 A;  3L27 A;  3U6L A;  3LQQ A;  1E9S A;  4IJF A;  4LF7 M;  1QVR A;  4L16 A;  5ITT A;  3TQS A;  4JXJ A;  1UM8 A;  2L7H A;  4LJA A;  4GHA A;  1N36 M;  1XXH A;  4DR5 M;  1NY6 A;  1TGU A;  2CUZ A;  4ZPX A;  3VK7 A;  3GPU A;  3GLG B;  1GLN A;  1G4A E;  4Z8X A;  1IBL M;  3RE8 A;  3E9S A;  7CAT A;  4OW0 A;  4OU7 A;  3LVW A;  1NJG A;  2XLJ A;  4L8R C;  3I4Y A;  2OPF A;  1E32 A;  3JR5 A;  2DZO B;  4AI6 A;  4MGY E;  3J80 S;  5C18 A;  2DVW B;  2CE7 A;  1FJG M;  3GLI A;  1L1T A;  4IBF A;  1IN6 A;  3VKG A;  4JI6 M;  2R46 A;  3LMM A;  5GKN A;  3T15 A;  1QZM A;  3U6P A;  3HU1 A;  5KQ8 A;  4GHL A;  3KS4 A;  1DO0 A;  1NHG C;  3KOW E;  5F3W A;  1R2Z A;  4DR4 M;  4XBO A;  5ITY A;  1L8Q A;  5KQD A;  2CV2 A;  4DR7 M;  2Z3X A;  3KXE C;  4JN6 A;  4IIW A;  3HJS A;  3VDP A;  4NSO B;  5KPT A;  5DYG A;  2CV1 A;  4GIT A;  1ORY B;  5FTL A;  3GO8 A;  3J27 B;  4JI7 M;  4REZ A;  4KO8 A;  4G4O A;  1HQY E;  2EO2 A;  2EUC A;  3FUW A;  3B9P A;  3DOA A;  4W5W A;  3LQR A;  4DV5 M;  1IM2 A;  2P5T A;  4AKG A;  3CF6 E;  3U60 A;  3SYL A;  5IT9 S;  5KPZ A;  1HNZ M;  2C9O A;  4FCV A;  1HR0 M;  1T3T A;  4B7F A;  3D8L A;  3KFU G;  4DR6 M;  1DGF A;  3SAV A;  1TH4 A;  3SYK A;  1TH2 A;  3KOX E;  2UUA M;  1OFI A;  4X62 M;  4FWG A;  1Z59 A;  2Y21 A;  4PDG A;  4IJE A;  3FKE A;  4LCB A;  4DV7 M;  2DXI A;  1JR3 A;  3AOE A;  1NNU C;  3GQ5 A;  3DA1 A;  4AKH A;  2L6O A;  4G4Q A;  3GLI B;  1HQC A;  4M9S A;  3OTO M;  1W5S A;  3GQ4 A;  4QOS A;  2L7I A;  3HKP A;  2UU9 M;  1XNQ M;  4I4L A;  5LMU M;  2KEB A;  2M60 A;  4IBJ A;  3FUV A;  3SMS A;  3L26 A;  5IWA M;  3L25 A;  3NWL A;  3SAU A;  2CHQ A;  4M0D A;  1NJF A;  3J81 S;  3HHX A;  5EXT A;  4DV4 M;  2CEA A;  2XF3 A;  3TPZ A;  2CV0 A;  3VKH A;  3UK6 A;  5EXP A;  4I8O A;  1LV7 A;  2YQZ A;  4LF6 M;  3SHG B;  1IXR C;  3U61 B;  1TDZ A;  2XSZ D;  2RGH A;  2A5Y B;  4D81 A;  4IBG A;  4WUR A;  5EP2 A;  4LFA M;  4A3V B;  4GKK M;  2R18 A;  3HHW A;  2KW0 A;  1IXZ A;  1IN7 A;  1G8P A;  3KSX A;  5FTN A;  4IBE A;  1YSY A;  3IG8 A;  4DUZ M;  3L2A A;  5JI3 E;  4I81 A;  3GQ3 A;  1C1K A;  4GKJ M;  2ZAN A;  3J7A S;  4OX9 M;  2CFO A;  1VDD A;  1HNX M;  1I94 M;  4DR3 M;  4LY6 A;  3KOY E;  4JI2 M;  1NVM A;  3PXG A;  2DZN B;  2BJW A;  4X64 M;  1OJL A;  4D82 A;  3HU2 A;  1JR3 D;  2C5R A;  4X65 M;  3FD9 A;  4KLN A;  2LXE A;  4LF5 M;  3HHZ A;  1DGH A;  4FVM A;  1IQP A;  4FD2 A;  2ZAO A;  3SC3 A;  2XGN A;  4WW0 A;  2DWM A;  2V6Z M;  4BBA A;  5EP4 A;  4JI1 M;  4OVZ B;  3KS8 A;  3JR4 A;  1Q3B A;  4GRI A;  2J7O A;  4LF9 M;  2KZU A;  1GL6 A;  1IY0 A;  3UJN A;  2XFS A;  3AOE C;  3U61 A;  4D80 A;  2KRK A;  4I5S A;  4RNA A;  3GLF B;  2YFQ A;  3M7G A;  4FCT A;  5EXS A;  2Z4S A;  3GPX A;  1E9R A;  2LNH C;  2BNK A;  3BOS A;  4L15 A;  2D7H A;  3KDS E;  4NOO B;  2L09 A;  2DWN A;  2R45 A;  2EA0 A;  1KSF X;  3KP0 E;  3GLF A;  1R2Y A;  2X8A A;  2C96 A;  4QHT A;  3PVS A;  2R65 A;  4NXM M;  2QCU A;  1NY5 A;  3GLH B;  4IBC A;  1MX0 A;  2LWX A;  4DV6 M;  4PCZ A;  1Z6T A;  1ZQ9 A;  3HU3 A;  2DWZ B;  4GIP A;  2D7G A;  4S12 A;  4X66 M;  3AL0 C;  4L78 A;  2C99 A;  4LGM A;  5ITU A;  3GRY A;  5E6J A;  2XZF A;  2C9C A;  5ITX A;  2KA6 B;  3AKZ A;  1R6B X;  4M9Z A;  5EJC A;  1IN4 A;  1K82 A;  2K47 A;  4NRV A;  5FLX S;  3KP1 E;  5IRE B;  2VII A;  8CAT A;  5H37 D;  3TWM A;  3QAU A;  3FYC A;  1J5E M;  1FNN A;  3GRR A;  3VFD A;  4QNM A;  2UXD M;  3LVV A;  2FNA A;  3ZH9 B;  3U6Q A;  1NNJ A;  2QEN A;  2X4A A;  1IY1 A;  3D8B A;  3NBI A;  2BJV A;  4M0W A;  1N33 M;  3FUU A;  1N77 A;  1DGB A;  1G59 A;  4DR1 M;  3U5Z A;  4LJ8 A;  4LJ6 A;  4CIS A;  1H6U A;  3THG A;  4LFB M;  5IZ7 D;  2FOI C;  1QAQ A;  3A46 A;  2VQF M;  3UZU A;  2UUB M;  2XSZ A;  4NSR A;  5ITX E;  4QOZ C;  2UXC M;  3GPY A;  3SAS A;  4JI0 M;  2Q2E B;  1YUB A;  1SXJ B;  2CHG A;  2DHR A;  4GMQ A;  4NL4 H;  3RGP A;  3TWL A;  4CGY B;  3U6M A;  4B3T M;  2XEP A;  2JA2 A;  1KFV A;  1XC8 A;  4MGK E;  2YNM D;  4B3M M;  2AHM A;  5EQT A;  4LF8 M;  3TL4 X;  5FTJ A;  4Z6Y A;  1SXJ E;  2RGO A;  4MGZ E;  3PFI A;  2J7N A;  4NRW A;  1R7R A;  4LG2 A;  2C98 A;  3WHL A;  4TUW A;  2F4V M;  1XHB A;  2FE8 A;  2ERC A;  4HL4 A;  1DGH B;  2CHV A;  2D7E A;  1L2C A;  2QBY B;  3CF0 A;  1Z5C A;  4AQY M;  3J2P B;  4GC5 A;  3KSJ A;  3ZCB B;  1HT1 E;  4YY3 M;  2M5Z A;  3A98 B;  1Q3C A;  5BR8 M;  2G8L A;  4QHS A;  2XH9 A;  3T1Y M;  3SMP A;  3CTW B;  4K0K M;  3U6S A;  1YE9 A;  4DV3 M;  2I7N A;  4LZZ A;  2ZM6 M;  2VQE M;  3U5Z B;  5DYI A;  4LJ9 A;  5EP1 A;  2F5P A;  3HJ8 A;  3C58 A;  1MU5 A;  4LJ5 A;  4AG6 A;  5ITR A;  1N32 M;  2R62 A;  4IBK A;  3W0L B;  4B3R M;  1PM5 A;  3U6O A;  3FTE A;  3UGJ A;  1QYR A;  1N34 M;  2LH0 A;  4LFC M;  5EXX A;  2ZBK B;  4LRT A;  2UUC M;  1J7K A;  1QQW A;  3FUT A;  2HHH M;  4KOD A;  4ITQ A;  4FWD A;  1QAO A;  2R4J A;  1IBM M;  3GLH A;  3EIE A;  4FW9 A;  3HWS A;  2QP9 X;  3FTF A;  2QZ4 A;  3GPP A;  1GL7 A;  2I7P A;  3M0E A;  1L1Z A;  5LMN M;  4MGI E;  2QPA A;  3J7B A;  2F5O A;  1GVN A;  4JI8 M;  2F5S A;  1JQJ C;  4HLQ A;  3U6C A;  1K3W A;  4B08 A;  4LGY A;  1ZAE A;  3AFH A;  2NQ8 C;  4NXN M;  4DUY M;  1K3X A;  3SAT A;  2XZU A;  3K1J A;  1QAM A;  5FTK A;  4B3S M;  1X37 A;  5FSW A;  4MGH A;  4FCW A;  4AG5 A;  4R7G A;  2Z7J A;  5BPV A;  3SHF A;  4L4U A;  2Y0Q A;  4DV2 M;  1OFH A;  4YHH M;  5ITQ A;  2Y20 A;  3HJQ A;  3R8F A;  2FFJ A;  3IG5 A;  3AJI B;  3I51 A;  2H1R A;  3MJ5 A;  1GKI A;  1IXS B;  2UXB M;  3K8Z A;  4MM3 B;  1G3I A;  3U6E A;  5C1B A;  3DZD A;  3RGS A;  1NSF A;  3AOG A;  4LZJ A;  4BLC A;  4PD2 A;  1SXJ A;  3L28 A;  4RF0 A;  3GRU A;  3GLG A;  5DNY A;  4QNR A;  4P16 A;  3FYD A;  1IN5 A;  3E4R A;  3TWK A;  1EE8 A;  2Z4R A;  3K2L A;  4AKI A;  5KPR A;  2YR0 A;  3RFW A;  1NHW C;  4LRS A;  3ZC7 B;  3I4V A;  2G5G X;  3HHY A;  1XNR M;  3QWL A;  2X49 A;  1L2D A;  2F5N A;  1KYI A;  3WHK A;  4EIW A;  3A45 A;  4OVZ A;  3W0F A;  4DV0 M;  3GRV A;  3SAW A;  5FTM A;  4JI3 M;  1L2B A;  1E94 E;  4GH9 A;  3R9X B;  2V1U A;  2KZS A;  1PJJ A;  4AW4 A;  3UMM A;  1XWI A;  1S3S A;  3M6A A;  4FWH A;  4RF1 A;  3T1H M;  4G4N A;  3JAM S;  2HKJ A;  3TE6 A;  4BB9 A;  4LF4 M;  1WXQ A;  4B7G A;  3SFZ A;  3SAR A;  4MH0 E;  1W5T A;  2ZAM A;  4JV5 M;  4JYA M;  3AV0 A;  5JI2 E;  5A2Q S;  1XMQ M;  2KXE A;  3VLF B;  4JI4 M;  1DO2 A;  3ILK A;  5EP3 A;  1N75 A;  1I4W A;  2DWL A;  4AZF A;  4IBD A;  1PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...