3Q8XA

Structure of a toxin-antitoxin system bound to its substrate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
85
structure length
85
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antidote of epsilon-zeta postsegregational killing system
publication title A novel mechanism of programmed cell death in bacteria by toxin-antitoxin systems corrupts peptidoglycan synthesis.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 35
structure length 85
sequence length 85
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3q8xA00
2P5TA 1GVNA 3Q8XA
chains in the Genus database with same CATH superfamily
3B9PA 2G5GX 2J7NA 2I7PA 1XXHA 5ITQA 2KZSA 1Z59A 3QYEA 4WP2A 3GO8A 2LNHC 3QYBA 3GQ4A 2BJVA 2CRUA 2J7OA 2KXEA 3HKPA 2DI0A 2ZAMA 1HNWM 4HLQA 4MGZE 4CJ6A 3GLGA 1H6UA 1NO1A 4GH9A 3GRVA 1WR1B 3CGWA 2G3QA 2L6OA 2O01F 3THGA 3HJQA 1C7YA 3HJSA 3NBXX 4B3MM 3D8BA 1WHCA 4KLNA 3KOYE 3T15A 4DUZM 1L2DA 1R4GA 1XHBA 3K1JA 3A45A 2DVWB 5DYIA 4KODA 1V34A 1IY1A 4CGYB 4OVZB 3M0EA 4CHTB 3L2AA 3GPPA 3U6QA 2NQ8C 3C58A 3AOEA 3U5ZA 4QOSA 2JXNA 5IZ7D 2HKJA 4DV1M 4Y28F 1NVMA 2BJWA 3I4VA 2XSZD 1DO2A 3KS4A 4AKHA 4BLCA 1R2YA 2EKFA 4LRSA 1IY2A 5EXPA 4OX9M 5F3WA 1R2ZA 3RFWA 1G3IA 3TWMA 3U61A 4LZJA 4LG2A 4NL4H 5LMUM 4G6ZA 2YR0A 3HWSA 5DNYA 1QAMA 2RKOA 3ILKA 2JWSA 3B7ZA 2HL7A 4L78A 5EP1A 2EUCA 5BPVA 3J80S 3D8LA 5IREB 4Z8XA 2UUCM 3PNYA 1L1ZA 3CF2A 1K3XA 5ITRA 1X37A 3M7GA 3HGIA 1JR3E 4AQYM 4DR5M 3GLIE 4K0KM 3ZQJA 4PDGA 3U6OA 1JR3A 1L8QA 1TR8A 3QWLA 3GLIA 2OPFA 2QHOB 4FCVA 4LZZA 3U6PA 3KOXE 3C3EA 1HQYE 3CF0A 3HZJA 3HU1A 3U6SA 4G4NA 4LCBA 2C98A 1P3QQ 5IT9S 1ZV1A 3NBIA 3J7BA 1KYIA 4I81A 1OFIA 3FRHA 4I8OA 2EJSA 4M9XA 1NNJA 1HNXM 3UGJA 3KSXA 4UN2B 4P16A 3C3DA 1BVSA 4DV3M 2DZOB 1OIPA 3GLHE 4HEOA 3JAMS 3SAWA 1WJ7A 2M60A 3K2LA 4LJ9A 3AOEC 4Z6YA 4JI0M 4LJ7A 4MGKE 1ZMVA 5ITTA 1IY0A 1GLNA 2Y20A 1G8PA 1GABA 3GLFB 1RU3A 1LV7A 2KNAA 2Z3XA 3W68A 5FTLA 2YNMD 3E9SA 3L26A 2R46A 2WSEF 4CIZA 2V1CA 1E32A 2QBYA 1GVNA 1DGBA 1N77A 1QQWA 2KA6B 1IXZA 5KQ8A 1IBMM 4LJ5A 3EIEA 1GL6A 2DWZB 1UFZA 2H5XA 2JY5A 2BWBA 5BR8M 2VQEM 1VDLA 4L16A 3U6DA 4B3RM 1IFYA 2FFJA 4GKJM 2ZAOA 1ZAEA 2Z4SA 2XGNA 2CEAA 2OOBA 3FTDA 3Q8XA 4MH0E 3EIHA 3JR5A 2JUJA 2VDBB 2UUBM 1DV0A 4NC6A 2DHYA 1HT2E 4QHSA 4FD2A 3SBJA 1IBKM 3T6PA 1IBLM 2DAIA 3FE3A 3VLFB 1PJIA 2C96A 2Y21A 3VFDA 1K82A 3AL0C 4ANRA 3SYKA 2DAKA 4NXMM 4X62M 1OJLA 4LRTA 4ZPXA 2LVQD 2QCUA 4DV2M 4DBGB 3SAVA 4QHTA 4DV5M 3V76A 2F5PA 1QVRA 3R8FA 3E46A 4L4UA 3KOZE 1KSFX 2MGWA 4IBJA 2JY6B 3JR4A 2RGHA 1XNQM 2C5RA 3VK8A 3A42A 1I4WA 4ITQA 3VDPA 1PGYA 5FTKA 3CTWB 5EP3A 1D0KA 4M9ZA 2CUZA 3PNVA 3GLGE 2XZUA 1HJPA 3KVWA 1IM2A 4MGIE 2D7GA 1AIPC 1Y8GA 2RRUA 5ITYA 2ZANA 3FUTA 4XK8F 3HHXA 4NXNM 4F1IA 4R71A 4QOZC 4PD2A 1QDRA 1G71A 2CHVA 2JY7A 3UMMA 2QENA 2RGOA 3HHYA 2KEBA 4GC5A 1QAQA 4MGYE 4LGMA 3UJNA 2LHCA 2HHHM 2C99A 4AI6A 4LJ6A 2Q2EB 2DWLA 3SASA 2L7HA 4CISA 1NSFA 3K8ZA 4QNRA 1YSYA 3RGPA 4IBBA 4AW4A 1MJGM 2DKLA 1IQPA 3TPZA 1R7RA 4LF8M 1D0MA 2Z4RA 1LTMA 4HL4A 3SYLA 5A2QS 3FD9A 3IHPA 3FKEA 2JY8A 2K47A 1N34M 3MMPA 3KFUG 3VKHA 2M5ZA 4B3SM 3H4JA 2HCBA 3MK6A 7CATA 1N33M 4G3OA 4AKGA 2LHGA 5JI3E 2R4EA 2LWXA 1R5LA 3K9OA 2R65A 4OW0A 4FCWA 2YFQA 4GITA 3U60B 3ZH9B 2DAGA 1E94E 1V33A 1TH3A 4PCZA 2R0IA 1FNNA 3GRUA 2KNVA 3KDSE 1D0LA 4DV7M 4DR3M 3OTOM 4AZFA 1W5SA 3U6EA 2KHHA 2WSFF 4W5WA 4FCTA 1IN5A 1WXQA 2LTUA 2R62A 3AFHA 1JB0F 4BBAA 2F5OA 1OFHA 3LCVB 5IWAM 4IBFA 2R45A 3PFIA 1GL7A 1NJFA 2KZUA 1NY6A 3AV0A 3RGSA 4LY6A 5KPTA 1J5EM 2FS1A 3KSJA 2R44A 1PJQA 2OO9A 2LVPC 2MJ5B 1N36M 4WW0A 2EKKA 3VDUA 4TUWA 2X4AA 2DAMA 4DV6M 1HQCA 5FLXS 2XSZA 3B74A 2XLJA 4JI7M 4OU7A 2D7HA 1DGGA 4IBGA 5KPRA 1TGUA 1SXJE 5FTJA 4G4OA 5EP2A 4D82A 2LVNC 2XF3A 3SFZA 1SXJA 1EIJA 2XZFA 3VKGA 3L29A 2BWEA 2CFOA 4NSOB 4LF5M 3L25A 2AHMA 1QUSA 1NHGC 2P5TA 5EXSA 2R18A 2OOAA 2HWJA 2F5SA 3KW6A 4IBDA 3W67A 4M0DA 2LXEA 4D80A 4LF7M 3HU2A 2B3TA 3GLHB 3ZCBB 1N78A 1DGHB 3LW5F 4LFCM 3SMSA 4X66M 4X64M 3W0LB 3J27B 1J09A 1YE9A 2KDLA 3MJ5A 4GIPA 3KOWE 4JI3M 1NV8A 4AG6A 1NV9A 1IXSA 4M0WA 5C18A 3GLFA 2KRUA 1NNUC 3Q8GA 5EQTA 1GO5A 4JXJA 2CE7A 4RNAA 2KNZA 1XNRM 3BOSA 2XFSA 4JV5M 1J7KA 2KW0A 3T38A 1L1TA 4JI1M 3HJ8A 1OIZA 4GEWA 2UUAM 4XBOA 3DA1A 3LCUA 1XC8A 2VQFM 2L2DA 1TDHA 3MHVC 3DOAA 1QAOA 1WGNA 3BBZA 2DWMA 4I4LA 2DXIA 4GMQA 1EFUB 1SG9A 3R9XB 2QZ4A 1PRBA 4GC9A 4LF4M 4JI2M 4AKIA 3ZC7B 2CV1A 4FVMA 3LQRA 2E5LM 1PJTA 3HX3A 2UU9M 4I5SA 2ZM6M 1VDDA 3FUVA 1DGFA 2HAKA 2CV2A 3TWKA 4R7GA 3C9PA 4KO8A 1HR0M 2L4FA 2DHRA 2X8AA 3A98B 3GPUA 1SXJC 4BB9A 5KQDA 3K92A 2QSFX 1MU5A 4KT0F 4QNMA 1T3TA 2CP8A 1XXHB 1Q39A 2Z7JA 5E26A 3SMPA 1VEKA 3GQ5A 3LMMA 2CV0A 2LH0A 1W5TA 3T1HM 3SARA 2VF8A 4GHAA 3L28A 1PJSA 2N35A 2XFTA 3GLGB 1OAIA 2QPAA 1L2BA 3SATA 3J81S 1IN6A 1F4IA 2FOIC 2K9DA 2KRKA 4DR4M 4YY3M 2OQ4A 1PJJA 5H37D 1GJSA 1OTRA 2FH0A 4MGHA 1IN7A 2LVAA 3TWLA 4JI5M 1G4AE 4GKKM 3TL4X 4DR6M 4P17A 3UK6A 1E9RA 2L09A 4RF0A 4XGIA 4B7GA 1S3SA 8CATA 5ITXE 2X49A 4RKUF 1NJGA 3GPYA 2JA2A 4WURA 3KP0E 5ITXA 1XWIA 2UXDM 4FWGA 4X65M 1K3WA 4IJFA 3I04M 4NRVA 3U5ZB 5E6JA 2ZTCA 1GKIA 4B08A 4GHLA 4OVZA 1T6OA 2VIIA 4JI8M 5EXXA 2R6FA 2WSCF 3GRYA 3GP1A 3B89A 2K6BA 2MH8A 1DO0A 2J5YA 3VK7A 2CWBA 2LBCA 3IG8A 1ZMWA 3FTEA 3IECA 2H1RA 4FW9A 1NHWC 1IXRC 3I01M 1NY5A 2D7EA 2F5NA 3U61B 3RE8A 3CF6E 4MM3B 3U60A 1JR3D 2A5YB 2V6ZM 1AUAA 4G4QA 3FTCA 4LF9M 3U6LA 1D2NA 3SAUA 1Z5AA 3LVWA 2QP9X 3FYCA 5EJCA 1I94M 4B3TM 4LFAM 5KO3A 1T43A 2JP7A 5GKNA 1MX0A 4F2LA 1SXJD 3K9PA 5DYGA 1OAOC 4FWDA 4EIWA 4DR2M 1V92A 4B7FA 2Y0TA 4IJEA 1QANA 3GQ3A 4LF6M 2C9CA 2WZJA 4IBIA 2CHQA 2Z8YM 3KP1E 4JI6M 4L6V6 1QDTA 4KHPM 3FUUA 2O5RA 2R4JA 1ZQ9A 2YQZA 3E21A 3FUWA 2JZ0A 3FYDA 3PXGA 4B7HA 3GLIB 1HT1E 1QUTA 2MROB 1VEGA 2DZLA 3H4MA 1TTEA 3I51A 1L2CA 4JI4M 4MB7A 5L8RF 3UZUA 1YUBA 2W82A 1Z5BA 4FWHA 3A46A 5DFLA 1Z5CA 1FJGM 3HHWA 1TH2A 3AJIB 4A3VB 2L7IA 1SXJB 3AOGA 2BNKA 4II7A 2JZ1A 4M9SA 4RF1A 1PM5A 3U6MA 1TF0B 1XMOM 4JN6A 2I7NA 3BXWA 2XEPA 5ITUA 1WGLA 3LQQA 3U6CA 3FRIA 2G8LA 3LVVA 2ZTDA 3TQSA 3J7AS 3I4YA 2DNAA 1C1KA 3B7QA 4S12A 3E4RA 3TE6A 1Q3CA 4AG5A 2FE8A 1VEJA 3F92A 3GLFE 2DZNB 2O25A 3B7NA 3SC3A 1E9SA 1JQJC 5FSWA 2XH9A 2QBYB 3KXEC 1QZEA 1MN3A 2L4EA 4IBEA 4R3DA 2QQ8A 3W0FA 4PDIA 1OKSA 1Q02A 1ORYB 3GLHA 2FNAA 1DGHA 2EO2A 2C9OA 1EE8A 1OQYA 1N75A 2APLA 4LJ4A 3HY5A 1TDZA 2DWNA 4Q7JA 5EXTA 1IXSB 2GNOA 2QNJA 4D81A 4DR7M 2K0BX 2F4VM 4JYAM 5C1BA 3GRRA 3L27A 3SHFA 3T1YM 4IIWA 3PVSA 2LVOC 4GRIA 4NOOB 4DV4M 3QAUA 2UXCM 1UM8A 2EA0A 1QZMA 5JI2E 4DV0M 2JNHA 2ERCA 3GPXA 2VF7A 2MR9A 2ZBKB 2DENA 4IBKA 4DR1M 4YHHM 1KFVA 4L8RC 5FTMA 2UXBM 2F5QA 3WHKA 1ZMUA 4NRWA 1TH4A 1R6BX 3DFZA 3FTFA 5KPZA 4G4RA 3KS8A 1WIVA 1IN8A 1Z6TA 2V1UA 1HNZM 1G59A 1IN4A 1N32M 4LFBM 3J2PB 2Y0QA 2GQFA 1A5TA 1XMQM 4LJAA 1VQ1A 5FTNA 4PT5A 1CUKA 3AKZA 4DUYM 4L15A 3HHZA 3FUXA 3M6AA 4LJ8A 1VG5A 1GJTA 2DAEA 1G41A 1YLAA 3NWLA 1QYRA 5LMNM 4NSRA 3DZDA 4REZA 3HU3A 3WHLA 4IBCA 1XB2B 1Q3BA 2CHGA 5EP4A 1XXHE 3SHGB 4LGYA 3IG5A
chains in the Genus database with same CATH topology
3B9PA 2G5GX 2J7NA 2I7PA 1XXHA 5ITQA 2KZSA 1Z59A 3GO8A 2LNHC 3GQ4A 2BJVA 2J7OA 2KXEA 3HKPA 2ZAMA 1HNWM 4HLQA 4MGZE 3GLGA 1H6UA 4GH9A 3GRVA 2L6OA 3THGA 3HJQA 3HJSA 4B3MM 3D8BA 4KLNA 3KOYE 3T15A 4DUZM 1L2DA 1XHBA 3K1JA 3A45A 2DVWB 5DYIA 4KODA 1IY1A 4CGYB 4OVZB 3M0EA 4CHTB 3L2AA 3GPPA 3U6QA 2NQ8C 3C58A 3AOEA 3U5ZA 4QOSA 5IZ7D 2HKJA 4DV1M 1NVMA 2BJWA 3I4VA 2XSZD 1DO2A 3KS4A 4AKHA 4BLCA 1R2YA 4LRSA 1IY2A 5EXPA 4OX9M 5F3WA 1R2ZA 3RFWA 1G3IA 3TWMA 3U61A 4LZJA 4LG2A 4NL4H 5LMUM 4G6ZA 2YR0A 3HWSA 5DNYA 1QAMA 2RKOA 3ILKA 2HL7A 4L78A 5EP1A 2EUCA 5BPVA 3J80S 3D8LA 5IREB 4Z8XA 2UUCM 3PNYA 1L1ZA 3CF2A 1K3XA 5ITRA 1X37A 3M7GA 3HGIA 4AQYM 4DR5M 4K0KM 4PDGA 3U6OA 1JR3A 1L8QA 3QWLA 3GLIA 2OPFA 4FCVA 4LZZA 3U6PA 3KOXE 1HQYE 3CF0A 3HU1A 3U6SA 4G4NA 4LCBA 2C98A 5IT9S 3NBIA 4AKGA 3J7BA 1KYIA 4I81A 1OFIA 4I8OA 4M9XA 1NNJA 1HNXM 3UGJA 3KSXA 4P16A 4DV3M 2DZOB 3JAMS 3SAWA 2M60A 3K2LA 4LJ9A 3AOEC 4Z6YA 4JI0M 4LJ7A 4MGKE 5ITTA 1IY0A 1GLNA 2Y20A 1G8PA 3GLFB 2Z3XA 1LV7A 5FTLA 2YNMD 3E9SA 3L26A 2R46A 2V1CA 1E32A 2QBYA 1GVNA 1DGBA 1N77A 1QQWA 2KA6B 1IXZA 5KQ8A 1IBMM 4LJ5A 3EIEA 1GL6A 2DWZB 2VQEM 2CV1A 5BR8M 3U6DA 4L16A 4B3RM 2FFJA 4GKJM 2ZAOA 1ZAEA 2Z4SA 2XGNA 2CEAA 4MH0E 3FTDA 3Q8XA 3JR5A 3EIHA 2UUBM 1HT2E 4QHSA 4FD2A 3SBJA 1IBKM 1IBLM 3VLFB 1PJIA 2C96A 2Y21A 3VFDA 1K82A 3AL0C 3SYKA 4NXMM 4X62M 1OJLA 4LRTA 4ZPXA 2QCUA 4DV2M 3SAVA 4QHTA 4DV5M 2F5PA 1QVRA 3R8FA 4L4UA 3KOZE 1KSFX 3JR4A 4IBJA 1XNQM 2RGHA 2C5RA 3VK8A 3A42A 1I4WA 4ITQA 3VDPA 5FTKA 3CTWB 5EP3A 4M9ZA 2CUZA 3PNVA 2XZUA 3KVWA 4MGIE 1IM2A 2D7GA 5ITYA 2ZANA 3FUTA 4QOZC 3HHXA 4NXNM 4PD2A 2CHVA 3UMMA 2QENA 2RGOA 3HHYA 2KEBA 4GC5A 1QAQA 4MGYE 4LGMA 3UJNA 2HHHM 2C99A 4AI6A 4LJ6A 2Q2EB 2DWLA 3SASA 2L7HA 4CISA 1NSFA 3K8ZA 4QNRA 1YSYA 3RGPA 4IBBA 4AW4A 1IQPA 3TPZA 1R7RA 4LF8M 2Z4RA 4HL4A 3SYLA 5A2QS 3FD9A 3FKEA 2K47A 1N34M 3KFUG 3VKHA 2M5ZA 4B3SM 2HCBA 3MK6A 7CATA 1N33M 5JI3E 2R4EA 2LWXA 2R65A 4OW0A 4FCWA 2YFQA 4GITA 3U60B 3ZH9B 1E94E 1TH3A 4PCZA 3KDSE 1FNNA 3GRUA 4DR3M 4DV7M 3OTOM 4AZFA 1W5SA 3U6EA 4W5WA 4FCTA 1IN5A 1WXQA 2R62A 4BBAA 3AFHA 2F5OA 1OFHA 5IWAM 4IBFA 2R45A 3PFIA 1GL7A 1NJFA 2KZUA 1NY6A 3AV0A 3RGSA 4LY6A 5KPTA 1J5EM 3KSJA 1N36M 4WW0A 3VDUA 4TUWA 2X4AA 4DV6M 1HQCA 5FLXS 2XSZA 2XLJA 4JI7M 4OU7A 2D7HA 1DGGA 4IBGA 5KPRA 1TGUA 1SXJE 5FTJA 4G4OA 5EP2A 4D82A 2XF3A 3SFZA 1SXJA 2XZFA 3VKGA 3L29A 2CFOA 4NSOB 4LF5M 3L25A 2AHMA 1NHGC 2P5TA 5EXSA 2R18A 2F5SA 3KW6A 4IBDA 4M0DA 2LXEA 4D80A 4LF7M 3HU2A 1N78A 3GLHB 3ZCBB 1DGHB 4LFCM 3SMSA 4X66M 4X64M 3W0LB 3J27B 1J09A 1YE9A 3MJ5A 4GIPA 3KOWE 4JI3M 4AG6A 3GLFA 4M0WA 5C18A 2KRUA 1NNUC 5EQTA 4JXJA 2CE7A 4RNAA 1XNRM 3BOSA 2XFSA 4JV5M 1J7KA 2KW0A 3T38A 1L1TA 4JI1M 3HJ8A 2UUAM 4XBOA 3DA1A 1XC8A 2VQFM 1TDHA 3MHVC 3DOAA 1QAOA 2DWMA 4I4LA 2DXIA 4GMQA 3R9XB 2QZ4A 4GC9A 4LF4M 4JI2M 4AKIA 3ZC7B 4FVMA 3LQRA 2E5LM 2UU9M 4I5SA 2ZM6M 1VDDA 3FUVA 1DGFA 2CV2A 3TWKA 4R7GA 4KO8A 1HR0M 2X8AA 2DHRA 3GPUA 3A98B 1SXJC 4BB9A 5KQDA 3K92A 1MU5A 4QNMA 1T3TA 1XXHB 1Q39A 2Z7JA 5E26A 3SMPA 3GQ5A 3LMMA 2CV0A 2LH0A 1W5TA 3T1HM 3SARA 4GHAA 3L28A 2XFTA 3GLGB 2QPAA 1L2BA 3SATA 3J81S 1IN6A 2FOIC 2KRKA 4DR4M 4YY3M 2OQ4A 1PJJA 5H37D 4MGHA 1IN7A 3TWLA 4JI5M 1G4AE 4GKKM 3TL4X 4DR6M 3UK6A 1E9RA 2L09A 4RF0A 4XGIA 4B7GA 1S3SA 8CATA 5ITXE 2X49A 1NJGA 3GPYA 2JA2A 4WURA 3KP0E 5ITXA 1XWIA 2UXDM 4FWGA 4X65M 4IJFA 4NRVA 3U5ZB 5E6JA 1GKIA 4B08A 4GHLA 4OVZA 2VIIA 4JI8M 5EXXA 3GRYA 3GP1A 1DO0A 3VK7A 3FTEA 3IG8A 2H1RA 4FW9A 1NHWC 1IXRC 1NY5A 2D7EA 2F5NA 3U61B 3RE8A 3CF6E 4MM3B 3U60A 1JR3D 2A5YB 2V6ZM 4G4QA 3FTCA 4LF9M 3U6LA 1D2NA 3SAUA 1Z5AA 3LVWA 2QP9X 3FYCA 5EJCA 1I94M 4B3TM 4LFAM 5KO3A 5GKNA 1MX0A 1SXJD 5DYGA 4FWDA 4EIWA 4DR2M 4B7FA 2Y0TA 4IJEA 1QANA 3GQ3A 4LF6M 2C9CA 4IBIA 2CHQA 3KP1E 4JI6M 4KHPM 3FUUA 2O5RA 2R4JA 1ZQ9A 2YQZA 3FUWA 3FYDA 3PXGA 4B7HA 3GLIB 1K3WA 1HT1E 3I51A 4JI4M 3H4MA 1L2CA 4MB7A 3UZUA 1YUBA 2W82A 1Z5BA 4FWHA 3A46A 1Z5CA 1FJGM 3HHWA 1TH2A 3AJIB 4A3VB 2L7IA 1SXJB 3AOGA 2BNKA 4II7A 4RF1A 4M9SA 1PM5A 3U6MA 1XMOM 4JN6A 2I7NA 5ITUA 2XEPA 3LQQA 3U6CA 2G8LA 3LVVA 3TQSA 3J7AS 3I4YA 1C1KA 4S12A 3E4RA 3TE6A 1Q3CA 4AG5A 2FE8A 2DZNB 3SC3A 1E9SA 1JQJC 5FSWA 2XH9A 2QBYB 3KXEC 4IBEA 4R3DA 3W0FA 4PDIA 1ORYB 3GLHA 2FNAA 1DGHA 2EO2A 2C9OA 1EE8A 4LJ4A 1N75A 1TDZA 2DWNA 5EXTA 4DR7M 1IXSB 4D81A 4JYAM 2F4VM 5C1BA 3GRRA 3L27A 3SHFA 3T1YM 4IIWA 3PVSA 4GRIA 4NOOB 4DV4M 3QAUA 2UXCM 1UM8A 2EA0A 1QZMA 5JI2E 4DV0M 2ERCA 3GPXA 2ZBKB 4IBKA 4DR1M 4YHHM 1KFVA 4L8RC 5FTMA 2UXBM 2F5QA 3WHKA 4NRWA 3FTFA 1TH4A 1R6BX 3DFZA 3KS8A 5KPZA 4G4RA 1IN8A 1Z6TA 2V1UA 1HNZM 1G59A 1IN4A 1N32M 4LFBM 3J2PB 2Y0QA 1XMQM 4LJAA 5FTNA 4PT5A 3AKZA 4DUYM 4L15A 3HHZA 3FUXA 3M6AA 4LJ8A 1G41A 3NWLA 1QYRA 5LMNM 4NSRA 3DZDA 4REZA 3HU3A 3WHLA 4IBCA 1Q3BA 2CHGA 5EP4A 3SHGB 4LGYA 3IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5T A;  1GVN A;  3Q8X A; 
#chains in the Genus database with same CATH topology
 3B9P A;  2G5G X;  2J7N A;  2I7P A;  1XXH A;  5ITQ A;  2KZS A;  1Z59 A;  3QYE A;  4WP2 A;  3GO8 A;  2LNH C;  3QYB A;  3GQ4 A;  2BJV A;  2CRU A;  2J7O A;  2KXE A;  3HKP A;  2DI0 A;  2ZAM A;  1HNW M;  4HLQ A;  4MGZ E;  4CJ6 A;  3GLG A;  1H6U A;  1NO1 A;  4GH9 A;  3GRV A;  1WR1 B;  3CGW A;  2G3Q A;  2L6O A;  2O01 F;  3THG A;  3HJQ A;  1C7Y A;  3HJS A;  3NBX X;  4B3M M;  3D8B A;  1WHC A;  4KLN A;  3KOY E;  3T15 A;  4DUZ M;  1L2D A;  1R4G A;  1XHB A;  3K1J A;  3A45 A;  2DVW B;  5DYI A;  4KOD A;  1V34 A;  1IY1 A;  4CGY B;  4OVZ B;  3M0E A;  4CHT B;  3L2A A;  3GPP A;  3U6Q A;  2NQ8 C;  3C58 A;  3AOE A;  3U5Z A;  4QOS A;  2JXN A;  5IZ7 D;  2HKJ A;  4DV1 M;  4Y28 F;  1NVM A;  2BJW A;  3I4V A;  2XSZ D;  1DO2 A;  3KS4 A;  4AKH A;  4BLC A;  1R2Y A;  2EKF A;  4LRS A;  1IY2 A;  5EXP A;  4OX9 M;  5F3W A;  1R2Z A;  3RFW A;  1G3I A;  3TWM A;  3U61 A;  4LZJ A;  4LG2 A;  4NL4 H;  5LMU M;  4G6Z A;  2YR0 A;  3HWS A;  5DNY A;  1QAM A;  2RKO A;  3ILK A;  2JWS A;  3B7Z A;  2HL7 A;  4L78 A;  5EP1 A;  2EUC A;  5BPV A;  3J80 S;  3D8L A;  5IRE B;  4Z8X A;  2UUC M;  3PNY A;  1L1Z A;  3CF2 A;  1K3X A;  5ITR A;  1X37 A;  3M7G A;  3HGI A;  1JR3 E;  4AQY M;  4DR5 M;  3GLI E;  4K0K M;  3ZQJ A;  4PDG A;  3U6O A;  1JR3 A;  1L8Q A;  1TR8 A;  3QWL A;  3GLI A;  2OPF A;  2QHO B;  4FCV A;  4LZZ A;  3U6P A;  3KOX E;  3C3E A;  1HQY E;  3CF0 A;  3HZJ A;  3HU1 A;  3U6S A;  4G4N A;  4LCB A;  2C98 A;  1P3Q Q;  5IT9 S;  1ZV1 A;  3NBI A;  3J7B A;  1KYI A;  4I81 A;  1OFI A;  3FRH A;  4I8O A;  2EJS A;  4M9X A;  1NNJ A;  1HNX M;  3UGJ A;  3KSX A;  4UN2 B;  4P16 A;  3C3D A;  1BVS A;  4DV3 M;  2DZO B;  1OIP A;  3GLH E;  4HEO A;  3JAM S;  3SAW A;  1WJ7 A;  2M60 A;  3K2L A;  4LJ9 A;  3AOE C;  4Z6Y A;  4JI0 M;  4LJ7 A;  4MGK E;  1ZMV A;  5ITT A;  1IY0 A;  1GLN A;  2Y20 A;  1G8P A;  1GAB A;  3GLF B;  1RU3 A;  1LV7 A;  2KNA A;  2Z3X A;  3W68 A;  5FTL A;  2YNM D;  3E9S A;  3L26 A;  2R46 A;  2WSE F;  4CIZ A;  2V1C A;  1E32 A;  2QBY A;  1GVN A;  1DGB A;  1N77 A;  1QQW A;  2KA6 B;  1IXZ A;  5KQ8 A;  1IBM M;  4LJ5 A;  3EIE A;  1GL6 A;  2DWZ B;  1UFZ A;  2H5X A;  2JY5 A;  2BWB A;  5BR8 M;  2VQE M;  1VDL A;  4L16 A;  3U6D A;  4B3R M;  1IFY A;  2FFJ A;  4GKJ M;  2ZAO A;  1ZAE A;  2Z4S A;  2XGN A;  2CEA A;  2OOB A;  3FTD A;  3Q8X A;  4MH0 E;  3EIH A;  3JR5 A;  2JUJ A;  2VDB B;  2UUB M;  1DV0 A;  4NC6 A;  2DHY A;  1HT2 E;  4QHS A;  4FD2 A;  3SBJ A;  1IBK M;  3T6P A;  1IBL M;  2DAI A;  3FE3 A;  3VLF B;  1PJI A;  2C96 A;  2Y21 A;  3VFD A;  1K82 A;  3AL0 C;  4ANR A;  3SYK A;  2DAK A;  4NXM M;  4X62 M;  1OJL A;  4LRT A;  4ZPX A;  2LVQ D;  2QCU A;  4DV2 M;  4DBG B;  3SAV A;  4QHT A;  4DV5 M;  3V76 A;  2F5P A;  1QVR A;  3R8F A;  3E46 A;  4L4U A;  3KOZ E;  1KSF X;  2MGW A;  4IBJ A;  2JY6 B;  3JR4 A;  2RGH A;  1XNQ M;  2C5R A;  3VK8 A;  3A42 A;  1I4W A;  4ITQ A;  3VDP A;  1PGY A;  5FTK A;  3CTW B;  5EP3 A;  1D0K A;  4M9Z A;  2CUZ A;  3PNV A;  3GLG E;  2XZU A;  1HJP A;  3KVW A;  1IM2 A;  4MGI E;  2D7G A;  1AIP C;  1Y8G A;  2RRU A;  5ITY A;  2ZAN A;  3FUT A;  4XK8 F;  3HHX A;  4NXN M;  4F1I A;  4R71 A;  4QOZ C;  4PD2 A;  1QDR A;  1G71 A;  2CHV A;  2JY7 A;  3UMM A;  2QEN A;  2RGO A;  3HHY A;  2KEB A;  4GC5 A;  1QAQ A;  4MGY E;  4LGM A;  3UJN A;  2LHC A;  2HHH M;  2C99 A;  4AI6 A;  4LJ6 A;  2Q2E B;  2DWL A;  3SAS A;  2L7H A;  4CIS A;  1NSF A;  3K8Z A;  4QNR A;  1YSY A;  3RGP A;  4IBB A;  4AW4 A;  1MJG M;  2DKL A;  1IQP A;  3TPZ A;  1R7R A;  4LF8 M;  1D0M A;  2Z4R A;  1LTM A;  4HL4 A;  3SYL A;  5A2Q S;  3FD9 A;  3IHP A;  3FKE A;  2JY8 A;  2K47 A;  1N34 M;  3MMP A;  3KFU G;  3VKH A;  2M5Z A;  4B3S M;  3H4J A;  2HCB A;  3MK6 A;  7CAT A;  1N33 M;  4G3O A;  4AKG A;  2LHG A;  5JI3 E;  2R4E A;  2LWX A;  1R5L A;  3K9O A;  2R65 A;  4OW0 A;  4FCW A;  2YFQ A;  4GIT A;  3U60 B;  3ZH9 B;  2DAG A;  1E94 E;  1V33 A;  1TH3 A;  4PCZ A;  2R0I A;  1FNN A;  3GRU A;  2KNV A;  3KDS E;  1D0L A;  4DV7 M;  4DR3 M;  3OTO M;  4AZF A;  1W5S A;  3U6E A;  2KHH A;  2WSF F;  4W5W A;  4FCT A;  1IN5 A;  1WXQ A;  2LTU A;  2R62 A;  3AFH A;  1JB0 F;  4BBA A;  2F5O A;  1OFH A;  3LCV B;  5IWA M;  4IBF A;  2R45 A;  3PFI A;  1GL7 A;  1NJF A;  2KZU A;  1NY6 A;  3AV0 A;  3RGS A;  4LY6 A;  5KPT A;  1J5E M;  2FS1 A;  3KSJ A;  2R44 A;  1PJQ A;  2OO9 A;  2LVP C;  2MJ5 B;  1N36 M;  4WW0 A;  2EKK A;  3VDU A;  4TUW A;  2X4A A;  2DAM A;  4DV6 M;  1HQC A;  5FLX S;  2XSZ A;  3B74 A;  2XLJ A;  4JI7 M;  4OU7 A;  2D7H A;  1DGG A;  4IBG A;  5KPR A;  1TGU A;  1SXJ E;  5FTJ A;  4G4O A;  5EP2 A;  4D82 A;  2LVN C;  2XF3 A;  3SFZ A;  1SXJ A;  1EIJ A;  2XZF A;  3VKG A;  3L29 A;  2BWE A;  2CFO A;  4NSO B;  4LF5 M;  3L25 A;  2AHM A;  1QUS A;  1NHG C;  2P5T A;  5EXS A;  2R18 A;  2OOA A;  2HWJ A;  2F5S A;  3KW6 A;  4IBD A;  3W67 A;  4M0D A;  2LXE A;  4D80 A;  4LF7 M;  3HU2 A;  2B3T A;  3GLH B;  3ZCB B;  1N78 A;  1DGH B;  3LW5 F;  4LFC M;  3SMS A;  4X66 M;  4X64 M;  3W0L B;  3J27 B;  1J09 A;  1YE9 A;  2KDL A;  3MJ5 A;  4GIP A;  3KOW E;  4JI3 M;  1NV8 A;  4AG6 A;  1NV9 A;  1IXS A;  4M0W A;  5C18 A;  3GLF A;  2KRU A;  1NNU C;  3Q8G A;  5EQT A;  1GO5 A;  4JXJ A;  2CE7 A;  4RNA A;  2KNZ A;  1XNR M;  3BOS A;  2XFS A;  4JV5 M;  1J7K A;  2KW0 A;  3T38 A;  1L1T A;  4JI1 M;  3HJ8 A;  1OIZ A;  4GEW A;  2UUA M;  4XBO A;  3DA1 A;  3LCU A;  1XC8 A;  2VQF M;  2L2D A;  1TDH A;  3MHV C;  3DOA A;  1QAO A;  1WGN A;  3BBZ A;  2DWM A;  4I4L A;  2DXI A;  4GMQ A;  1EFU B;  1SG9 A;  3R9X B;  2QZ4 A;  1PRB A;  4GC9 A;  4LF4 M;  4JI2 M;  4AKI A;  3ZC7 B;  2CV1 A;  4FVM A;  3LQR A;  2E5L M;  1PJT A;  3HX3 A;  2UU9 M;  4I5S A;  2ZM6 M;  1VDD A;  3FUV A;  1DGF A;  2HAK A;  2CV2 A;  3TWK A;  4R7G A;  3C9P A;  4KO8 A;  1HR0 M;  2L4F A;  2DHR A;  2X8A A;  3A98 B;  3GPU A;  1SXJ C;  4BB9 A;  5KQD A;  3K92 A;  2QSF X;  1MU5 A;  4KT0 F;  4QNM A;  1T3T A;  2CP8 A;  1XXH B;  1Q39 A;  2Z7J A;  5E26 A;  3SMP A;  1VEK A;  3GQ5 A;  3LMM A;  2CV0 A;  2LH0 A;  1W5T A;  3T1H M;  3SAR A;  2VF8 A;  4GHA A;  3L28 A;  1PJS A;  2N35 A;  2XFT A;  3GLG B;  1OAI A;  2QPA A;  1L2B A;  3SAT A;  3J81 S;  1IN6 A;  1F4I A;  2FOI C;  2K9D A;  2KRK A;  4DR4 M;  4YY3 M;  2OQ4 A;  1PJJ A;  5H37 D;  1GJS A;  1OTR A;  2FH0 A;  4MGH A;  1IN7 A;  2LVA A;  3TWL A;  4JI5 M;  1G4A E;  4GKK M;  3TL4 X;  4DR6 M;  4P17 A;  3UK6 A;  1E9R A;  2L09 A;  4RF0 A;  4XGI A;  4B7G A;  1S3S A;  8CAT A;  5ITX E;  2X49 A;  4RKU F;  1NJG A;  3GPY A;  2JA2 A;  4WUR A;  3KP0 E;  5ITX A;  1XWI A;  2UXD M;  4FWG A;  4X65 M;  1K3W A;  4IJF A;  3I04 M;  4NRV A;  3U5Z B;  5E6J A;  2ZTC A;  1GKI A;  4B08 A;  4GHL A;  4OVZ A;  1T6O A;  2VII A;  4JI8 M;  5EXX A;  2R6F A;  2WSC F;  3GRY A;  3GP1 A;  3B89 A;  2K6B A;  2MH8 A;  1DO0 A;  2J5Y A;  3VK7 A;  2CWB A;  2LBC A;  3IG8 A;  1ZMW A;  3FTE A;  3IEC A;  2H1R A;  4FW9 A;  1NHW C;  1IXR C;  3I01 M;  1NY5 A;  2D7E A;  2F5N A;  3U61 B;  3RE8 A;  3CF6 E;  4MM3 B;  3U60 A;  1JR3 D;  2A5Y B;  2V6Z M;  1AUA A;  4G4Q A;  3FTC A;  4LF9 M;  3U6L A;  1D2N A;  3SAU A;  1Z5A A;  3LVW A;  2QP9 X;  3FYC A;  5EJC A;  1I94 M;  4B3T M;  4LFA M;  5KO3 A;  1T43 A;  2JP7 A;  5GKN A;  1MX0 A;  4F2L A;  1SXJ D;  3K9P A;  5DYG A;  1OAO C;  4FWD A;  4EIW A;  4DR2 M;  1V92 A;  4B7F A;  2Y0T A;  4IJE A;  1QAN A;  3GQ3 A;  4LF6 M;  2C9C A;  2WZJ A;  4IBI A;  2CHQ A;  2Z8Y M;  3KP1 E;  4JI6 M;  4L6V 6;  1QDT A;  4KHP M;  3FUU A;  2O5R A;  2R4J A;  1ZQ9 A;  2YQZ A;  3E21 A;  3FUW A;  2JZ0 A;  3FYD A;  3PXG A;  4B7H A;  3GLI B;  1HT1 E;  1QUT A;  2MRO B;  1VEG A;  2DZL A;  3H4M A;  1TTE A;  3I51 A;  1L2C A;  4JI4 M;  4MB7 A;  5L8R F;  3UZU A;  1YUB A;  2W82 A;  1Z5B A;  4FWH A;  3A46 A;  5DFL A;  1Z5C A;  1FJG M;  3HHW A;  1TH2 A;  3AJI B;  4A3V B;  2L7I A;  1SXJ B;  3AOG A;  2BNK A;  4II7 A;  2JZ1 A;  4M9S A;  4RF1 A;  1PM5 A;  3U6M A;  1TF0 B;  1XMO M;  4JN6 A;  2I7N A;  3BXW A;  2XEP A;  5ITU A;  1WGL A;  3LQQ A;  3U6C A;  3FRI A;  2G8L A;  3LVV A;  2ZTD A;  3TQS A;  3J7A S;  3I4Y A;  2DNA A;  1C1K A;  3B7Q A;  4S12 A;  3E4R A;  3TE6 A;  1Q3C A;  4AG5 A;  2FE8 A;  1VEJ A;  3F92 A;  3GLF E;  2DZN B;  2O25 A;  3B7N A;  3SC3 A;  1E9S A;  1JQJ C;  5FSW A;  2XH9 A;  2QBY B;  3KXE C;  1QZE A;  1MN3 A;  2L4E A;  4IBE A;  4R3D A;  2QQ8 A;  3W0F A;  4PDI A;  1OKS A;  1Q02 A;  1ORY B;  3GLH A;  2FNA A;  1DGH A;  2EO2 A;  2C9O A;  1EE8 A;  1OQY A;  1N75 A;  2APL A;  4LJ4 A;  3HY5 A;  1TDZ A;  2DWN A;  4Q7J A;  5EXT A;  1IXS B;  2GNO A;  2QNJ A;  4D81 A;  4DR7 M;  2K0B X;  2F4V M;  4JYA M;  5C1B A;  3GRR A;  3L27 A;  3SHF A;  3T1Y M;  4IIW A;  3PVS A;  2LVO C;  4GRI A;  4NOO B;  4DV4 M;  3QAU A;  2UXC M;  1UM8 A;  2EA0 A;  1QZM A;  5JI2 E;  4DV0 M;  2JNH A;  2ERC A;  3GPX A;  2VF7 A;  2MR9 A;  2ZBK B;  2DEN A;  4IBK A;  4DR1 M;  4YHH M;  1KFV A;  4L8R C;  5FTM A;  2UXB M;  2F5Q A;  3WHK A;  1ZMU A;  4NRW A;  1TH4 A;  1R6B X;  3DFZ A;  3FTF A;  5KPZ A;  4G4R A;  3KS8 A;  1WIV A;  1IN8 A;  1Z6T A;  2V1U A;  1HNZ M;  1G59 A;  1IN4 A;  1N32 M;  4LFB M;  3J2P B;  2Y0Q A;  2GQF A;  1A5T A;  1XMQ M;  4LJA A;  1VQ1 A;  5FTN A;  4PT5 A;  1CUK A;  3AKZ A;  4DUY M;  4L15 A;  3HHZ A;  3FUX A;  3M6A A;  4LJ8 A;  1VG5 A;  1GJT A;  2DAE A;  1G41 A;  1YLA A;  3NWL A;  1QYR A;  5LMN M;  4NSR A;  3DZD A;  4REZ A;  3HU3 A;  3WHL A;  4IBC A;  1XB2 B;  1Q3B A;  2CHG A;  5EP4 A;  1XXH E;  3SHG B;  4LGY A;  3IG5 A; 
#chains in the Genus database with same CATH homology
 3B9P A;  2G5G X;  2J7N A;  2I7P A;  1XXH A;  5ITQ A;  2KZS A;  1Z59 A;  3GO8 A;  2LNH C;  3GQ4 A;  2BJV A;  2J7O A;  2KXE A;  3HKP A;  2ZAM A;  1HNW M;  4HLQ A;  4MGZ E;  3GLG A;  1H6U A;  4GH9 A;  3GRV A;  2L6O A;  3THG A;  3HJQ A;  3HJS A;  4B3M M;  3D8B A;  4KLN A;  3KOY E;  3T15 A;  4DUZ M;  1L2D A;  1XHB A;  3K1J A;  3A45 A;  2DVW B;  5DYI A;  4KOD A;  1IY1 A;  4CGY B;  4OVZ B;  3M0E A;  4CHT B;  3L2A A;  3GPP A;  3U6Q A;  2NQ8 C;  3C58 A;  3AOE A;  3U5Z A;  4QOS A;  5IZ7 D;  2HKJ A;  4DV1 M;  1NVM A;  2BJW A;  3I4V A;  2XSZ D;  1DO2 A;  3KS4 A;  4AKH A;  4BLC A;  1R2Y A;  4LRS A;  1IY2 A;  5EXP A;  4OX9 M;  5F3W A;  1R2Z A;  3RFW A;  1G3I A;  3TWM A;  3U61 A;  4LZJ A;  4LG2 A;  4NL4 H;  5LMU M;  4G6Z A;  2YR0 A;  3HWS A;  5DNY A;  1QAM A;  2RKO A;  3ILK A;  2HL7 A;  4L78 A;  5EP1 A;  2EUC A;  5BPV A;  3J80 S;  3D8L A;  5IRE B;  4Z8X A;  2UUC M;  3PNY A;  1L1Z A;  3CF2 A;  1K3X A;  5ITR A;  1X37 A;  3M7G A;  3HGI A;  4AQY M;  4DR5 M;  4K0K M;  4PDG A;  3U6O A;  1JR3 A;  1L8Q A;  3QWL A;  3GLI A;  2OPF A;  4FCV A;  4LZZ A;  3U6P A;  3KOX E;  1HQY E;  3CF0 A;  3HU1 A;  3U6S A;  4G4N A;  4LCB A;  2C98 A;  5IT9 S;  3NBI A;  4AKG A;  3J7B A;  1KYI A;  4I81 A;  1OFI A;  4I8O A;  4M9X A;  1NNJ A;  1HNX M;  3UGJ A;  3KSX A;  4P16 A;  4DV3 M;  2DZO B;  3JAM S;  3SAW A;  2M60 A;  3K2L A;  4LJ9 A;  3AOE C;  4Z6Y A;  4JI0 M;  4LJ7 A;  4MGK E;  5ITT A;  1IY0 A;  1GLN A;  2Y20 A;  1G8P A;  3GLF B;  2Z3X A;  1LV7 A;  5FTL A;  2YNM D;  3E9S A;  3L26 A;  2R46 A;  2V1C A;  1E32 A;  2QBY A;  1GVN A;  1DGB A;  1N77 A;  1QQW A;  2KA6 B;  1IXZ A;  5KQ8 A;  1IBM M;  4LJ5 A;  3EIE A;  1GL6 A;  2DWZ B;  2VQE M;  2CV1 A;  5BR8 M;  3U6D A;  4L16 A;  4B3R M;  2FFJ A;  4GKJ M;  2ZAO A;  1ZAE A;  2Z4S A;  2XGN A;  2CEA A;  4MH0 E;  3FTD A;  3Q8X A;  3JR5 A;  3EIH A;  2UUB M;  1HT2 E;  4QHS A;  4FD2 A;  3SBJ A;  1IBK M;  1IBL M;  3VLF B;  1PJI A;  2C96 A;  2Y21 A;  3VFD A;  1K82 A;  3AL0 C;  3SYK A;  4NXM M;  4X62 M;  1OJL A;  4LRT A;  4ZPX A;  2QCU A;  4DV2 M;  3SAV A;  4QHT A;  4DV5 M;  2F5P A;  1QVR A;  3R8F A;  4L4U A;  3KOZ E;  1KSF X;  3JR4 A;  4IBJ A;  1XNQ M;  2RGH A;  2C5R A;  3VK8 A;  3A42 A;  1I4W A;  4ITQ A;  3VDP A;  5FTK A;  3CTW B;  5EP3 A;  4M9Z A;  2CUZ A;  3PNV A;  2XZU A;  3KVW A;  4MGI E;  1IM2 A;  2D7G A;  5ITY A;  2ZAN A;  3FUT A;  4QOZ C;  3HHX A;  4NXN M;  4PD2 A;  2CHV A;  3UMM A;  2QEN A;  2RGO A;  3HHY A;  2KEB A;  4GC5 A;  1QAQ A;  4MGY E;  4LGM A;  3UJN A;  2HHH M;  2C99 A;  4AI6 A;  4LJ6 A;  2Q2E B;  2DWL A;  3SAS A;  2L7H A;  4CIS A;  1NSF A;  3K8Z A;  4QNR A;  1YSY A;  3RGP A;  4IBB A;  4AW4 A;  1IQP A;  3TPZ A;  1R7R A;  4LF8 M;  2Z4R A;  4HL4 A;  3SYL A;  5A2Q S;  3FD9 A;  3FKE A;  2K47 A;  1N34 M;  3KFU G;  3VKH A;  2M5Z A;  4B3S M;  2HCB A;  3MK6 A;  7CAT A;  1N33 M;  5JI3 E;  2R4E A;  2LWX A;  2R65 A;  4OW0 A;  4FCW A;  2YFQ A;  4GIT A;  3U60 B;  3ZH9 B;  1E94 E;  1TH3 A;  4PCZ A;  3KDS E;  1FNN A;  3GRU A;  4DR3 M;  4DV7 M;  3OTO M;  4AZF A;  1W5S A;  3U6E A;  4W5W A;  4FCT A;  1IN5 A;  1WXQ A;  2R62 A;  4BBA A;  3AFH A;  2F5O A;  1OFH A;  5IWA M;  4IBF A;  2R45 A;  3PFI A;  1GL7 A;  1NJF A;  2KZU A;  1NY6 A;  3AV0 A;  3RGS A;  4LY6 A;  5KPT A;  1J5E M;  3KSJ A;  1N36 M;  4WW0 A;  3VDU A;  4TUW A;  2X4A A;  4DV6 M;  1HQC A;  5FLX S;  2XSZ A;  2XLJ A;  4JI7 M;  4OU7 A;  2D7H A;  1DGG A;  4IBG A;  5KPR A;  1TGU A;  1SXJ E;  5FTJ A;  4G4O A;  5EP2 A;  4D82 A;  2XF3 A;  3SFZ A;  1SXJ A;  2XZF A;  3VKG A;  3L29 A;  2CFO A;  4NSO B;  4LF5 M;  3L25 A;  2AHM A;  1NHG C;  2P5T A;  5EXS A;  2R18 A;  2F5S A;  3KW6 A;  4IBD A;  4M0D A;  2LXE A;  4D80 A;  4LF7 M;  3HU2 A;  1N78 A;  3GLH B;  3ZCB B;  1DGH B;  4LFC M;  3SMS A;  4X66 M;  4X64 M;  3W0L B;  3J27 B;  1J09 A;  1YE9 A;  3MJ5 A;  4GIP A;  3KOW E;  4JI3 M;  4AG6 A;  3GLF A;  4M0W A;  5C18 A;  2KRU A;  1NNU C;  5EQT A;  4JXJ A;  2CE7 A;  4RNA A;  1XNR M;  3BOS A;  2XFS A;  4JV5 M;  1J7K A;  2KW0 A;  3T38 A;  1L1T A;  4JI1 M;  3HJ8 A;  2UUA M;  4XBO A;  3DA1 A;  1XC8 A;  2VQF M;  1TDH A;  3MHV C;  3DOA A;  1QAO A;  2DWM A;  4I4L A;  2DXI A;  4GMQ A;  3R9X B;  2QZ4 A;  4GC9 A;  4LF4 M;  4JI2 M;  4AKI A;  3ZC7 B;  4FVM A;  3LQR A;  2E5L M;  2UU9 M;  4I5S A;  2ZM6 M;  1VDD A;  3FUV A;  1DGF A;  2CV2 A;  3TWK A;  4R7G A;  4KO8 A;  1HR0 M;  2X8A A;  2DHR A;  3GPU A;  3A98 B;  1SXJ C;  4BB9 A;  5KQD A;  3K92 A;  1MU5 A;  4QNM A;  1T3T A;  1XXH B;  1Q39 A;  2Z7J A;  5E26 A;  3SMP A;  3GQ5 A;  3LMM A;  2CV0 A;  2LH0 A;  1W5T A;  3T1H M;  3SAR A;  4GHA A;  3L28 A;  2XFT A;  3GLG B;  2QPA A;  1L2B A;  3SAT A;  3J81 S;  1IN6 A;  2FOI C;  2KRK A;  4DR4 M;  4YY3 M;  2OQ4 A;  1PJJ A;  5H37 D;  4MGH A;  1IN7 A;  3TWL A;  4JI5 M;  1G4A E;  4GKK M;  3TL4 X;  4DR6 M;  3UK6 A;  1E9R A;  2L09 A;  4RF0 A;  4XGI A;  4B7G A;  1S3S A;  8CAT A;  5ITX E;  2X49 A;  1NJG A;  3GPY A;  2JA2 A;  4WUR A;  3KP0 E;  5ITX A;  1XWI A;  2UXD M;  4FWG A;  4X65 M;  4IJF A;  4NRV A;  3U5Z B;  5E6J A;  1GKI A;  4B08 A;  4GHL A;  4OVZ A;  2VII A;  4JI8 M;  5EXX A;  3GRY A;  3GP1 A;  1DO0 A;  3VK7 A;  3FTE A;  3IG8 A;  2H1R A;  4FW9 A;  1NHW C;  1IXR C;  1NY5 A;  2D7E A;  2F5N A;  3U61 B;  3RE8 A;  3CF6 E;  4MM3 B;  3U60 A;  1JR3 D;  2A5Y B;  2V6Z M;  4G4Q A;  3FTC A;  4LF9 M;  3U6L A;  1D2N A;  3SAU A;  1Z5A A;  3LVW A;  2QP9 X;  3FYC A;  5EJC A;  1I94 M;  4B3T M;  4LFA M;  5KO3 A;  5GKN A;  1MX0 A;  1SXJ D;  5DYG A;  4FWD A;  4EIW A;  4DR2 M;  4B7F A;  2Y0T A;  4IJE A;  1QAN A;  3GQ3 A;  4LF6 M;  2C9C A;  4IBI A;  2CHQ A;  3KP1 E;  4JI6 M;  4KHP M;  3FUU A;  2O5R A;  2R4J A;  1ZQ9 A;  2YQZ A;  3FUW A;  3FYD A;  3PXG A;  4B7H A;  3GLI B;  1K3W A;  1HT1 E;  3I51 A;  4JI4 M;  3H4M A;  1L2C A;  4MB7 A;  3UZU A;  1YUB A;  2W82 A;  1Z5B A;  4FWH A;  3A46 A;  1Z5C A;  1FJG M;  3HHW A;  1TH2 A;  3AJI B;  4A3V B;  2L7I A;  1SXJ B;  3AOG A;  2BNK A;  4II7 A;  4RF1 A;  4M9S A;  1PM5 A;  3U6M A;  1XMO M;  4JN6 A;  2I7N A;  5ITU A;  2XEP A;  3LQQ A;  3U6C A;  2G8L A;  3LVV A;  3TQS A;  3J7A S;  3I4Y A;  1C1K A;  4S12 A;  3E4R A;  3TE6 A;  1Q3C A;  4AG5 A;  2FE8 A;  2DZN B;  3SC3 A;  1E9S A;  1JQJ C;  5FSW A;  2XH9 A;  2QBY B;  3KXE C;  4IBE A;  4R3D A;  3W0F A;  4PDI A;  1ORY B;  3GLH A;  2FNA A;  1DGH A;  2EO2 A;  2C9O A;  1EE8 A;  4LJ4 A;  1N75 A;  1TDZ A;  2DWN A;  5EXT A;  4DR7 M;  1IXS B;  4D81 A;  4JYA M;  2F4V M;  5C1B A;  3GRR A;  3L27 A;  3SHF A;  3T1Y M;  4IIW A;  3PVS A;  4GRI A;  4NOO B;  4DV4 M;  3QAU A;  2UXC M;  1UM8 A;  2EA0 A;  1QZM A;  5JI2 E;  4DV0 M;  2ERC A;  3GPX A;  2ZBK B;  4IBK A;  4DR1 M;  4YHH M;  1KFV A;  4L8R C;  5FTM A;  2UXB M;  2F5Q A;  3WHK A;  4NRW A;  3FTF A;  1TH4 A;  1R6B X;  3DFZ A;  3KS8 A;  5KPZ A;  4G4R A;  1IN8 A;  1Z6T A;  2V1U A;  1HNZ M;  1G59 A;  1IN4 A;  1N32 M;  4LFB M;  3J2P B;  2Y0Q A;  1XMQ M;  4LJA A;  5FTN A;  4PT5 A;  3AKZ A;  4DUY M;  4L15 A;  3HHZ A;  3FUX A;  3M6A A;  4LJ8 A;  1G41 A;  3NWL A;  1QYR A;  5LMN M;  4NSR A;  3DZD A;  4REZ A;  3HU3 A;  3WHL A;  4IBC A;  1Q3B A;  2CHG A;  5EP4 A;  3SHG B;  4LGY A;  3IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...