4DR4M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr4M02
4DR2M 4JI0M 4JI1M 3TWKA 3GO8A 4DR5M 3GQ3A 3JR5A 3GP1A 4JI2M 1IBKM 4PDGA 3A46A 4G4NA 2UUBM 1Q3CA 3SASA 5IT9S 2ZM6M 4AQYM 1XMOM 1L2DA 4DV1M 5LMNM 4X65M 3A42A 2UXDM 1MX0A 2F4VM 1Z59A 1XMQM 2F5NA 4OX9M 1MU5A 1PJJA 4G4RA 2OPFA 4KHPM 2UUCM 4JI4M 1N34M 1IBMM 1Z5CA 4LF9M 3SARA 3JR4A 1L1TA 4LF7M 2OQ4A 1TDHA 3U6EA 4DUZM 1HNXM 5ITTA 4DR1M 3U6DA 1TDZA 3TWMA 4DR3M 1K3WA 4DR6M 4LF8M 1KFVA 4JI6M 1XNQM 3JAMS 5ITRA 3A45A 1J5EM 4CISA 4PD2A 4LFAM 4DV7M 4B3RM 4LFBM 4JI7M 3GPUA 4LF6M 1HNZM 1NNJA 4DV5M 4NRVA 4B3MM 4MB7A 4LF5M 5LMUM 4NRWA 1N36M 2XZUA 2F5PA 1Z5AA 3J81S 1EE8A 5BR8M 3U6CA 3VK7A 4JI5M 2Q2EB 3U6LA 4DR7M 2VQEM 5A2QS 1K3XA 1XC8A 1I94M 1PM5A 5FLXS 3J80S 4DV4M 4JYAM 4NXNM 4JI8M 4GKKM 3SBJA 4GKJM 1PJIA 4PCZA 3U6SA 4DV0M 3GPYA 4G4OA 1FJGM 1N33M 1K82A 4DV2M 2UU9M 4X64M 3TWLA 1N32M 2F5SA 1R2ZA 3U6QA 1Q3BA 2F5OA 3GPPA 3U6MA 3DOAA 3GQ5A 1Z5BA 2EA0A 3C58A 5ITXA 3SAVA 4B3SM 4K0KM 5ITQA 4ITQA 2XZFA 3J7AS 2E5LM 4DV6M 5ITXE 4B3TM 4X62M 1R2YA 3T1YM 3SATA 4YHHM 2HKJA 4LF4M 4DUYM 4JI3M 1XNRM 4DV3M 3SAUA 3U6PA 1IBLM 4LFCM 3OTOM 3W0FA 3SAWA 1HNWM 3GQ4A 2HHHM 1Q39A 3T1HM 4PDIA 4G4QA 4JV5M 4X66M 2UUAM 2VQFM 3VK8A 4YY3M 1L2BA 1L2CA 5ITYA 4NXMM 1L1ZA 5IWAM 2F5QA 5ITUA 3U6OA 2UXBM 2UXCM 2ZBKB 1HR0M 3GPXA 4DR4M
chains in the Genus database with same CATH superfamily
1VEGA 1SXJB 2ZTDA 2CV1A 4DR5M 3GQ3A 1IN4A 3JR5A 3B7NA 1IXZA 2CHVA 1L8QA 2I7PA 3HKPA 1E32A 3HWSA 5GKNA 2LVPC 1PJQA 3MJ5A 4RF0A 1UM8A 2GNOA 1OIZA 4BLCA 3M7GA 2B3TA 4FWDA 2R65A 3T6PA 1OQYA 1R7RA 3K92A 2BWBA 4WURA 3LCUA 3HU2A 3UK6A 2DAEA 1VQ1A 2DZLA 2JA2A 5EQTA 5DNYA 2BJWA 1IXSB 3QAUA 4JI4M 4RNAA 2OOAA 2H5XA 3GLGE 2CV0A 1TDHA 4FWHA 5C18A 3U6DA 1TF0B 3FUXA 4DR3M 1K3WA 4DR6M 2XH9A 1PJTA 2DAIA 4REZA 5EP4A 2OO9A 1IFYA 3LW5F 4FVMA 2LNHC 2Y0TA 4CGYB 1IY0A 1NJFA 2LTUA 2EKKA 3FE3A 4LFBM 3ILKA 4NL4H 3LQQA 3J27B 3KDSE 4NSOB 4MGHA 1WR1B 4RF1A 4DV5M 4NRVA 5DYIA 1XXHA 4KODA 2QZ4A 3CF0A 3HGIA 1IN8A 1DO0A 1PJSA 2KZSA 2RKOA 2I7NA 3K2LA 3KW6A 1T43A 3SFZA 5LMUM 1N36M 1EE8A 2LVAA 3QYEA 3U6CA 3U60A 2DZNB 2JWSA 4QNRA 5KQ8A 1KSFX 1PGYA 1IN5A 2XSZD 4XGIA 2QPAA 4IIWA 1QANA 3B7ZA 2JY7A 1QZEA 3DFZA 4WW0A 1AUAA 4CHTB 4NXNM 3KSXA 2DNAA 1TTEA 1NJGA 3GLHA 4GC5A 4L6V6 4LJ5A 5EXTA 1WJ7A 5EXSA 3U6SA 4AKGA 1OAOC 2FS1A 1V34A 3AOEA 2ERCA 3F92A 3PNYA 2DZOB 2OOBA 4MM3B 4Z8XA 1TH2A 3HHYA 2R46A 4X64M 1NNUC 1DGHA 2Z3XA 3TPZA 4R3DA 2FH0A 2BWEA 3Q8XA 2LVNC 3U6MA 2KZUA 1WGLA 5E26A 4GIPA 3GLFE 3W68A 2K0BX 2CUZA 3T15A 1SG9A 4MGZE 4LJ6A 4MGKE 4B3SM 4K0KM 2E5LM 4ZPXA 2FNAA 1H6UA 5ITXE 2H1RA 2L7HA 4B3TM 1E9SA 2DENA 3CF6E 4GMQA 4B7GA 4DUYM 3GRUA 2HCBA 3U6PA 2MROB 1IBLM 2VF7A 2RRUA 3OTOM 3I4YA 1Y8GA 4AKHA 1D0LA 3LMMA 3GQ4A 3FUVA 5H37D 4QHSA 5KO3A 4PDIA 2QSFX 1DGGA 3SHGB 3L26A 3KP1E 3KP0E 3VFDA 2UUAM 4AG6A 4IBEA 1VEKA 2DXIA 2K47A 1L1ZA 2LH0A 4NXMM 3K1JA 2UXBM 2UXCM 2ZBKB 3FUTA 1I4WA 4DR2M 4JI0M 2A5YB 1KYIA 2LHGA 1OTRA 5BPVA 1SXJA 3GP1A 1IBKM 5DFLA 3A46A 4F2LA 2R45A 2ZM6M 2XFSA 1XMOM 2UXDM 4DV1M 4X65M 3SMSA 3ZH9B 1GL7A 8CATA 1XMQM 1SXJC 1CUKA 4DBGB 3CTWB 2F5NA 3FTEA 1MU5A 4TUWA 1XHBA 2J5YA 2JY6B 4G4RA 4IBKA 3NBIA 1BVSA 2UUCM 2FFJA 2X49A 5FTMA 1Z5CA 3FTFA 1QAMA 1G4AE 2K6BA 2N35A 1IXSA 2YFQA 3QYBA 4P16A 3W0LB 3HY5A 1L1TA 3THGA 1J7KA 2QQ8A 4M9ZA 5ITTA 3RGPA 3TWMA 1TH3A 3HX3A 3U61B 1VDDA 1XNQM 4WP2A 2QCUA 4PD2A 2L2DA 3MMPA 3VDPA 1ZMVA 3E46A 4L15A 1ZMUA 1GL6A 2KNZA 1OFIA 3C3DA 3Q8GA 4MH0E 3HHZA 1VDLA 2M5ZA 4M0DA 1HJPA 2JY8A 2C98A 3BBZA 3LVWA 4L16A 2KDLA 4LF5M 3WHKA 3KOYE 3J81S 1XXHE 2D7HA 1RU3A 3J2PB 4FCWA 1GJTA 3VKHA 3VK7A 2BJVA 1QAOA 5KPTA 4GRIA 2Q2EB 4DR7M 2Y21A 2VQEM 4L4UA 5FTLA 1K3XA 1XC8A 3TL4X 3C3EA 2DHRA 2KA6B 4JYAM 3KS4A 3H4MA 2LXEA 7CATA 4PCZA 1C1KA 4GHLA 3K8ZA 4F1IA 3K9PA 3UMMA 3GRVA 4DV0M 1FJGM 3GLHE 1G71A 2UU9M 4L78A 4FCTA 3KSJA 1N32M 1JR3D 3GLIA 3U6QA 3T38A 4FD2A 3FTCA 2XSZA 5L8RF 2CP8A 3DOAA 3GQ5A 1OFHA 5FTJA 4Y28F 3D8LA 2EA0A 1DGBA 4I4LA 4B7HA 1NHGC 3B89A 4GITA 4I8OA 5FTKA 3SAVA 1ZMWA 3I51A 1J09A 4GC9A 2AHMA 4AKIA 2KRKA 3J7AS 1AIPC 2DI0A 1N77A 4GHAA 2KEBA 4LF4M 2BNKA 3E21A 4DV3M 3D8BA 3KS8A 1W5TA 2G5GX 3QWLA 2JXNA 1S3SA 4IJFA 4OU7A 1HNWM 1QZMA 4XBOA 3T1HM 4BBAA 3PXGA 1YLAA 2KHHA 3TE6A 3ZC7B 4JXJA 5C1BA 2R62A 1C7YA 4YY3M 3L27A 5ITYA 2P5TA 5IWAM 3HHWA 4IBFA 2EJSA 3U6OA 2JY5A 1NSFA 5EP3A 3EIEA 3GPXA 3I04M 4DR4M 3PFIA 1P3QQ 2HWJA 4JI1M 4L8RC 3TWKA 3GO8A 2DVWB 5FTNA 3U5ZB 2ZAOA 4QNMA 4XK8F 1NV9A 4JI2M 4G3OA 1HT1E 4PDGA 2UUBM 1Q3CA 2EKFA 3SASA 1SXJE 1MJGM 4ANRA 5IT9S 4AQYM 5LMNM 1D2NA 4MGIE 1MX0A 4UN2B 2F4VM 3W67A 2MH8A 3GLGB 4LRSA 1TR8A 2L09A 3M0EA 3AL0C 3WHLA 1HT2E 1OAIA 2V1CA 2L4FA 1PJJA 1OIPA 4KHPM 5IREB 1NY5A 2DAMA 2Z4SA 5EP1A 3EIHA 3L29A 3FKEA 4LJ8A 3IECA 2DWZB 3KOXE 3JR4A 4LF7M 1IQPA 3AJIB 3K9OA 3DZDA 1IY1A 2L4EA 3HJSA 4DUZM 4DR1M 3U6EA 4IBBA 4LY6A 2XEPA 2X4AA 1EIJA 4GEWA 3HZJA 1KFVA 4JI6M 4NOOB 1WXQA 3JAMS 4CISA 1GABA 1J5EM 3U61A 2ZTCA 3SMPA 3FUUA 1ZV1A 4QOSA 3CGWA 5F3WA 2MR9A 2QHOB 2O5RA 4JI7M 2VDBB 3I4VA 5KPZA 3GPUA 3CF2A 1NNJA 2ZAMA 2DWMA 3SC3A 4B3MM 1QUSA 1DGFA 2Z4RA 4A3VB 5IZ7D 1GO5A 4IBGA 4NRWA 2XZUA 1NY6A 4CJ6A 3GRRA 5BR8M 3IG8A 3FRHA 3MK6A 2QBYB 1ORYB 2KNAA 1QDRA 1WIVA 2J7NA 1MN3A 5DYGA 3U6LA 2V6ZM 1I94M 4LZJA 5FLXS 3J80S 2LBCA 2RGOA 1D0KA 2KW0A 4JI8M 3KXEC 3H4JA 3SBJA 1PJIA 4GKJM 4LGYA 3L28A 1G3IA 3AOGA 3GPYA 1QVRA 1XB2B 2XF3A 4B7FA 1W5SA 1V33A 3IHPA 4IBCA 1N33M 1N78A 2J7OA 3VLFB 3E4RA 1K82A 4DV2M 1R5LA 4LZZA 1XWIA 3FYDA 1TH4A 2CEAA 4IJEA 3TWLA 2F5SA 5JI3E 3GLFB 1R2ZA 4B08A 3UZUA 2LVQD 4AW4A 1QYRA 2O25A 3SYKA 1IY2A 2F5OA 1A5TA 2C9OA 3V76A 4D81A 3GLIE 1G59A 3DA1A 4RKUF 2YNMD 2R4EA 2C99A 4OW0A 2R6FA 3HU1A 2WSFF 1Q02A 1IN6A 2XFTA 2DWLA 5ITQA 3SYLA 4AG5A 3KFUG 4EIWA 4X62M 3SATA 2VF8A 2HKJA 4YHHM 4KO8A 1UFZA 2DWNA 4IBIA 1R6BX 2O01F 3AFHA 5EP2A 4JI3M 1WGNA 5KQDA 3HJ8A 1JR3A 4Q7JA 4CIZA 4LFCM 3LQRA 1LTMA 2G3QA 1G41A 2VIIA 3W0FA 3FUWA 1Z6TA 2HL7A 4MGYE 1EFUB 2C9CA 2WSEF 4LJAA 1GLNA 4IBJA 2FE8A 1GVNA 4JV5M 1YE9A 2LWXA 3ZCBB 3LVVA 4D80A 1L2CA 4OVZB 2CE7A 2FOIC 2MGWA 2F5QA 5JI2E 3A98B 3BXWA 1TGUA 2XLJA 4FW9A 3ZQJA 1HR0M 2DAKA 1N75A 4GH9A 5EJCA 5FSWA 2V1UA 3L2AA 5KPRA 3PNVA 3B7QA 3E9SA 5E6JA 2QP9X 4PT5A 1GKIA 4G4NA 3U5ZA 1DV0A 4S12A 2DHYA 4M9XA 2JZ0A 1L2DA 2JZ1A 3A42A 3B9PA 4I5SA 1Z59A 2DKLA 2LHCA 3FTDA 2Z7JA 2Y0QA 4LJ4A 2LVOC 4OX9M 1IM2A 2KNVA 3B74A 4IBDA 2OPFA 3UJNA 3MHVC 3GLGA 5EXXA 4G6ZA 4QHTA 2M60A 1N34M 1IBMM 3BOSA 2R4JA 3HHXA 4LF9M 1G8PA 2R0IA 3L25A 3AKZA 2OQ4A 4R71A 1NVMA 2C96A 1HNXM 1TDZA 2CHQA 4LF8M 2CRUA 3C9PA 4KLNA 2MJ5B 2WSCF 3A45A 3IG5A 4LJ9A 5ITRA 3VKGA 1QUTA 4LFAM 3UGJA 4DV7M 4B3RM 3GRYA 1QQWA 4HEOA 1ZAEA 1XXHB 4LF6M 1HNZM 4LCBA 2DAGA 3GLIB 4QOZC 1PRBA 1JQJC 1WHCA 4MB7A 3FD9A 1NHWC 4FWGA 1LV7A 3AOEC 2Y20A 3R8FA 1ZQ9A 3U60B 2F5PA 3SARA 1Z5AA 3KVWA 4Z6YA 1E94E 2JP7A 4HL4A 3M6AA 2R44A 4JI5M 3FRIA 4LG2A 2WZJA 2YQZA 2CV2A 2JNHA 2QBYA 2X8AA 2L7IA 2YR0A 3NBXX 3RGSA 1PM5A 1IXRC 4DV4M 4LGMA 3GLHB 2XGNA 3KOWE 1F4IA 2K9DA 4GKKM 2EUCA 1JB0F 2R18A 3VDUA 2L6OA 2Z8YM 4G4OA 3TQSA 1VG5A 2NQ8C 4W5WA 2C5RA 5EXPA 1YUBA 2CHGA 1DGHB 3RE8A 2GQFA 3HU3A 3RFWA 4AZFA 4M0WA 1DO2A 1OKSA 2RGHA 4AI6A 2QENA 1Q3BA 3GLFA 3PVSA 4JN6A 3GPPA 1NO1A 2KRUA 1E9RA 1OJLA 3AV0A 1Z5BA 4D82A 2APLA 4LRTA 4NC6A 1R4GA 2EO2A 1QAQA 3C58A 1FNNA 5ITXA 4P17A 1GJSA 2G8LA 1IN7A 1YSYA 1D0MA 2D7EA 3LCVB 4ITQA 2XZFA 4DV6M 1VEJA 1R2YA 3FYCA 4BB9A 2ZANA 3T1YM 1T6OA 2QNJA 1HQYE 4HLQA 4M9SA 1SXJD 3J7BA 3SAUA 1XNRM 1T3TA 1V92A 2CFOA 2D7GA 3SHFA 2JUJA 3SAWA 3R9XB 4FCVA 1JR3E 1NV8A 1Q39A 3KOZE 2HHHM 3HJQA 4G4QA 3NWLA 1X37A 4II7A 3I01M 2HAKA 1QDTA 4X66M 2VQFM 2W82A 3VK8A 4NSRA 1L2BA 4R7GA 4I81A 2CWBA 5ITUA 4LJ7A 4OVZA 2KXEA 4KT0F 5A2QS 1HQCA
chains in the Genus database with same CATH topology
1SXJB 2CV1A 4DR5M 3GQ3A 1IN4A 3JR5A 1IXZA 2CHVA 1L8QA 2I7PA 3HKPA 1E32A 3HWSA 5GKNA 3MJ5A 4RF0A 1UM8A 4BLCA 3M7GA 4FWDA 2R65A 1R7RA 3K92A 4WURA 3HU2A 3UK6A 2JA2A 5EQTA 5DNYA 2BJWA 1IXSB 3QAUA 4JI4M 4RNAA 2CV0A 1TDHA 4FWHA 5C18A 3U6DA 3FUXA 4DR3M 1K3WA 4DR6M 2XH9A 4REZA 5EP4A 4FVMA 2LNHC 2Y0TA 4CGYB 1IY0A 1NJFA 4LFBM 3ILKA 4NL4H 3LQQA 3J27B 3KDSE 4NSOB 4MGHA 4RF1A 4DV5M 4NRVA 5DYIA 1XXHA 4KODA 2QZ4A 3CF0A 3HGIA 1IN8A 1DO0A 2RKOA 2KZSA 3SFZA 2I7NA 3K2LA 3KW6A 5LMUM 1N36M 1EE8A 3U6CA 3U60A 2DZNB 4QNRA 5KQ8A 1KSFX 1IN5A 2XSZD 4XGIA 2QPAA 4IIWA 1QANA 4WW0A 3DFZA 4CHTB 4NXNM 3KSXA 1NJGA 3GLHA 4GC5A 4LJ5A 5EXTA 3U6SA 5EXSA 4AKGA 3AOEA 2ERCA 3PNYA 2DZOB 4Z8XA 4MM3B 3HHYA 1TH2A 2R46A 4X64M 1NNUC 1DGHA 2Z3XA 3TPZA 4R3DA 3Q8XA 3U6MA 2KZUA 5E26A 4GIPA 2CUZA 3T15A 4MGZE 4LJ6A 4MGKE 4B3SM 4K0KM 2E5LM 4ZPXA 2FNAA 1H6UA 5ITXE 2H1RA 2L7HA 4B3TM 1E9SA 3CF6E 4GMQA 4B7GA 4DUYM 3GRUA 2HCBA 3U6PA 1IBLM 3OTOM 3I4YA 4AKHA 3LMMA 3GQ4A 3FUVA 5H37D 4QHSA 5KO3A 4PDIA 1DGGA 3SHGB 3L26A 3KP1E 3KP0E 3VFDA 2UUAM 4AG6A 4IBEA 2DXIA 2K47A 1L1ZA 2LH0A 4NXMM 3K1JA 2UXBM 2UXCM 2ZBKB 3FUTA 1I4WA 4DR2M 4JI0M 2A5YB 1KYIA 5BPVA 1SXJA 3GP1A 1IBKM 3A46A 2R45A 2ZM6M 2XFSA 1XMOM 2UXDM 4DV1M 4X65M 3SMSA 3ZH9B 1GL7A 8CATA 1XMQM 1SXJC 2F5NA 3CTWB 3FTEA 1MU5A 4TUWA 1XHBA 4G4RA 4IBKA 3NBIA 2UUCM 2FFJA 2X49A 5FTMA 1Z5CA 3FTFA 1QAMA 1G4AE 2YFQA 4P16A 3W0LB 1L1TA 3SARA 3THGA 1J7KA 4M9ZA 5ITTA 3RGPA 3TWMA 1TH3A 3U61B 1VDDA 1XNQM 2QCUA 4PD2A 3VDPA 4L15A 4MH0E 1GL6A 1OFIA 3HHZA 2M5ZA 4M0DA 2C98A 3LVWA 4L16A 4LF5M 3WHKA 3KOYE 3J81S 2D7HA 3J2PB 4FCWA 3VKHA 3VK7A 2BJVA 1QAOA 5KPTA 4GRIA 2Q2EB 4DR7M 2Y21A 2VQEM 4L4UA 5FTLA 1K3XA 1XC8A 3TL4X 2DHRA 2KA6B 4JYAM 3KS4A 3H4MA 2LXEA 7CATA 4PCZA 1C1KA 4GHLA 3K8ZA 3UMMA 3GRVA 4DV0M 1FJGM 2UU9M 4L78A 4FCTA 3KSJA 1N32M 1JR3D 3GLIA 3U6QA 3T38A 4FD2A 3FTCA 2XSZA 3DOAA 3GQ5A 1OFHA 5FTJA 3D8LA 2EA0A 1DGBA 4I4LA 4B7HA 1NHGC 4GITA 4I8OA 5FTKA 3SAVA 3I51A 1J09A 4GC9A 2AHMA 4AKIA 2KRKA 3J7AS 1N77A 4GHAA 2KEBA 4LF4M 2BNKA 4DV3M 3D8BA 3KS8A 1W5TA 2G5GX 3QWLA 1S3SA 4IJFA 4OU7A 1HNWM 1QZMA 4XBOA 3T1HM 4BBAA 3PXGA 3TE6A 3ZC7B 4JXJA 5C1BA 2R62A 4YY3M 3L27A 5ITYA 2P5TA 5IWAM 3HHWA 4IBFA 3U6OA 5EP3A 1NSFA 3EIEA 3GPXA 4DR4M 3PFIA 4JI1M 4L8RC 3TWKA 3GO8A 2DVWB 5FTNA 3U5ZB 2ZAOA 4QNMA 4JI2M 1HT1E 4PDGA 2UUBM 1Q3CA 3SASA 1SXJE 5IT9S 4AQYM 5LMNM 1D2NA 4MGIE 1MX0A 2F4VM 3GLGB 4LRSA 2L09A 3M0EA 3WHLA 1HT2E 2V1CA 1PJJA 4KHPM 5IREB 1NY5A 2Z4SA 5EP1A 3EIHA 3L29A 3FKEA 4LJ8A 2DWZB 3KOXE 3JR4A 4LF7M 1IQPA 3AJIB 3DZDA 1IY1A 3HJSA 4DUZM 4DR1M 3U6EA 4IBBA 4LY6A 2XEPA 2X4AA 1KFVA 4JI6M 4NOOB 1WXQA 3JAMS 4CISA 1J5EM 3U61A 3SMPA 3FUUA 4QOSA 5F3WA 2O5RA 4JI7M 3I4VA 5KPZA 3GPUA 3CF2A 1NNJA 2ZAMA 2DWMA 3SC3A 4B3MM 1DGFA 2Z4RA 4A3VB 5IZ7D 4IBGA 4NRWA 2XZUA 1NY6A 3GRRA 5BR8M 3IG8A 2QBYB 3MK6A 1ORYB 2J7NA 5DYGA 3U6LA 2V6ZM 1I94M 4LZJA 5FLXS 3J80S 2RGOA 2KW0A 4JI8M 3KXEC 3SBJA 4GKJM 1PJIA 4LGYA 3L28A 1G3IA 3AOGA 3GPYA 1QVRA 2XF3A 4B7FA 1N33M 1W5SA 1N78A 4IBCA 2J7OA 3VLFB 3E4RA 1K82A 4DV2M 4LZZA 1XWIA 3FYDA 1TH4A 2CEAA 4IJEA 3TWLA 2F5SA 5JI3E 3GLFB 1R2ZA 4B08A 3UZUA 4AW4A 1QYRA 3SYKA 1IY2A 2F5OA 2C9OA 4D81A 1G59A 3DA1A 2YNMD 2R4EA 2C99A 4OW0A 3HU1A 2DWLA 2XFTA 1IN6A 5ITQA 3SYLA 4AG5A 3KFUG 4EIWA 4X62M 3SATA 4YHHM 2HKJA 4KO8A 2DWNA 4IBIA 1R6BX 3AFHA 5EP2A 4JI3M 5KQDA 3HJ8A 1JR3A 4LFCM 3LQRA 2VIIA 3W0FA 1G41A 3FUWA 1Z6TA 2HL7A 4MGYE 2C9CA 4LJAA 1GLNA 4IBJA 2FE8A 1GVNA 4JV5M 1YE9A 2LWXA 3ZCBB 3LVVA 4D80A 1L2CA 4OVZB 2CE7A 2FOIC 2F5QA 5JI2E 3A98B 1TGUA 2XLJA 4FW9A 1HR0M 1N75A 4GH9A 5EJCA 5FSWA 2V1UA 3L2AA 5KPRA 3PNVA 3E9SA 5E6JA 2QP9X 4PT5A 1GKIA 4G4NA 3U5ZA 4S12A 4M9XA 1L2DA 3A42A 3B9PA 4I5SA 1Z59A 3FTDA 2Z7JA 2Y0QA 4LJ4A 4OX9M 1IM2A 4IBDA 2OPFA 3UJNA 3MHVC 3GLGA 5EXXA 4G6ZA 4QHTA 2M60A 1N34M 1IBMM 3BOSA 2R4JA 3HHXA 4LF9M 1G8PA 3L25A 3AKZA 2OQ4A 1NVMA 2C96A 1HNXM 1TDZA 2CHQA 4LF8M 4KLNA 3VKGA 3IG5A 3A45A 4LJ9A 5ITRA 4LFAM 3UGJA 4DV7M 4B3RM 3GRYA 1QQWA 1ZAEA 1XXHB 4LF6M 1HNZM 4LCBA 3GLIB 4QOZC 1JQJC 4MB7A 3FD9A 1NHWC 4FWGA 1LV7A 3AOEC 2Y20A 3R8FA 1ZQ9A 3U60B 2F5PA 1Z5AA 3KVWA 4Z6YA 1E94E 4HL4A 3M6AA 4JI5M 4LG2A 2YQZA 2CV2A 2QBYA 2X8AA 2L7IA 2YR0A 3RGSA 1PM5A 1IXRC 4DV4M 4LGMA 3GLHB 2XGNA 3KOWE 4GKKM 2EUCA 2R18A 3VDUA 2L6OA 4G4OA 3TQSA 2NQ8C 4W5WA 2C5RA 5EXPA 1YUBA 2CHGA 1DGHB 3RE8A 3HU3A 3RFWA 4AZFA 4M0WA 1DO2A 2RGHA 4AI6A 2QENA 1Q3BA 3GLFA 3PVSA 4JN6A 3GPPA 2KRUA 1E9RA 1OJLA 3AV0A 1Z5BA 4D82A 4LRTA 2EO2A 1QAQA 3C58A 1FNNA 5ITXA 2G8LA 1IN7A 1YSYA 2D7EA 4ITQA 2XZFA 4DV6M 1R2YA 3FYCA 4BB9A 2ZANA 3T1YM 1HQYE 4HLQA 4M9SA 3J7BA 1SXJD 3SAUA 1XNRM 1T3TA 3AL0C 2CFOA 2D7GA 3SHFA 3SAWA 3R9XB 4FCVA 3KOZE 1Q39A 2HHHM 3HJQA 4G4QA 3NWLA 1X37A 4II7A 4X66M 2VQFM 2W82A 3VK8A 4NSRA 1L2BA 4R7GA 4I81A 5ITUA 4LJ7A 4OVZA 2KXEA 5A2QS 1HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 M;  4JI0 M;  4JI1 M;  3TWK A;  3GO8 A;  4DR5 M;  3GQ3 A;  3JR5 A;  3GP1 A;  4JI2 M;  1IBK M;  4PDG A;  3A46 A;  4G4N A;  2UUB M;  1Q3C A;  3SAS A;  5IT9 S;  2ZM6 M;  4AQY M;  1XMO M;  1L2D A;  4DV1 M;  5LMN M;  4X65 M;  3A42 A;  2UXD M;  1MX0 A;  2F4V M;  1Z59 A;  1XMQ M;  2F5N A;  4OX9 M;  1MU5 A;  1PJJ A;  4G4R A;  2OPF A;  4KHP M;  2UUC M;  4JI4 M;  1N34 M;  1IBM M;  1Z5C A;  4LF9 M;  3SAR A;  3JR4 A;  1L1T A;  4LF7 M;  2OQ4 A;  1TDH A;  3U6E A;  4DUZ M;  1HNX M;  5ITT A;  4DR1 M;  3U6D A;  1TDZ A;  3TWM A;  4DR3 M;  1K3W A;  4DR6 M;  4LF8 M;  1KFV A;  4JI6 M;  1XNQ M;  3JAM S;  5ITR A;  3A45 A;  1J5E M;  4CIS A;  4PD2 A;  4LFA M;  4DV7 M;  4B3R M;  4LFB M;  4JI7 M;  3GPU A;  4LF6 M;  1HNZ M;  1NNJ A;  4DV5 M;  4NRV A;  4B3M M;  4MB7 A;  4LF5 M;  5LMU M;  4NRW A;  1N36 M;  2XZU A;  2F5P A;  1Z5A A;  3J81 S;  1EE8 A;  5BR8 M;  3U6C A;  3VK7 A;  4JI5 M;  2Q2E B;  3U6L A;  4DR7 M;  2VQE M;  5A2Q S;  1K3X A;  1XC8 A;  1I94 M;  1PM5 A;  5FLX S;  3J80 S;  4DV4 M;  4JYA M;  4NXN M;  4JI8 M;  4GKK M;  3SBJ A;  4GKJ M;  1PJI A;  4PCZ A;  3U6S A;  4DV0 M;  3GPY A;  4G4O A;  1FJG M;  1N33 M;  1K82 A;  4DV2 M;  2UU9 M;  4X64 M;  3TWL A;  1N32 M;  2F5S A;  1R2Z A;  3U6Q A;  1Q3B A;  2F5O A;  3GPP A;  3U6M A;  3DOA A;  3GQ5 A;  1Z5B A;  2EA0 A;  3C58 A;  5ITX A;  3SAV A;  4B3S M;  4K0K M;  5ITQ A;  4ITQ A;  2XZF A;  3J7A S;  2E5L M;  4DV6 M;  5ITX E;  4B3T M;  4X62 M;  1R2Y A;  3T1Y M;  3SAT A;  4YHH M;  2HKJ A;  4LF4 M;  4DUY M;  4JI3 M;  1XNR M;  4DV3 M;  3SAU A;  3U6P A;  1IBL M;  4LFC M;  3OTO M;  3W0F A;  3SAW A;  1HNW M;  3GQ4 A;  2HHH M;  1Q39 A;  3T1H M;  4PDI A;  4G4Q A;  4JV5 M;  4X66 M;  2UUA M;  2VQF M;  3VK8 A;  4YY3 M;  1L2B A;  1L2C A;  5ITY A;  4NXM M;  1L1Z A;  5IWA M;  2F5Q A;  5ITU A;  3U6O A;  2UXB M;  2UXC M;  2ZBK B;  1HR0 M;  3GPX A;  4DR4 M; 
#chains in the Genus database with same CATH topology
 1VEG A;  1SXJ B;  2ZTD A;  2CV1 A;  4DR5 M;  3GQ3 A;  1IN4 A;  3JR5 A;  3B7N A;  1IXZ A;  2CHV A;  1L8Q A;  2I7P A;  3HKP A;  1E32 A;  3HWS A;  5GKN A;  2LVP C;  1PJQ A;  3MJ5 A;  4RF0 A;  1UM8 A;  2GNO A;  1OIZ A;  4BLC A;  3M7G A;  2B3T A;  4FWD A;  2R65 A;  3T6P A;  1OQY A;  1R7R A;  3K92 A;  2BWB A;  4WUR A;  3LCU A;  3HU2 A;  3UK6 A;  2DAE A;  1VQ1 A;  2DZL A;  2JA2 A;  5EQT A;  5DNY A;  2BJW A;  1IXS B;  3QAU A;  4JI4 M;  4RNA A;  2OOA A;  2H5X A;  3GLG E;  2CV0 A;  1TDH A;  4FWH A;  5C18 A;  3U6D A;  1TF0 B;  3FUX A;  4DR3 M;  1K3W A;  4DR6 M;  2XH9 A;  1PJT A;  2DAI A;  4REZ A;  5EP4 A;  2OO9 A;  1IFY A;  3LW5 F;  4FVM A;  2LNH C;  2Y0T A;  4CGY B;  1IY0 A;  1NJF A;  2LTU A;  2EKK A;  3FE3 A;  4LFB M;  3ILK A;  4NL4 H;  3LQQ A;  3J27 B;  3KDS E;  4NSO B;  4MGH A;  1WR1 B;  4RF1 A;  4DV5 M;  4NRV A;  5DYI A;  1XXH A;  4KOD A;  2QZ4 A;  3CF0 A;  3HGI A;  1IN8 A;  1DO0 A;  1PJS A;  2KZS A;  2RKO A;  2I7N A;  3K2L A;  3KW6 A;  1T43 A;  3SFZ A;  5LMU M;  1N36 M;  1EE8 A;  2LVA A;  3QYE A;  3U6C A;  3U60 A;  2DZN B;  2JWS A;  4QNR A;  5KQ8 A;  1KSF X;  1PGY A;  1IN5 A;  2XSZ D;  4XGI A;  2QPA A;  4IIW A;  1QAN A;  3B7Z A;  2JY7 A;  1QZE A;  3DFZ A;  4WW0 A;  1AUA A;  4CHT B;  4NXN M;  3KSX A;  2DNA A;  1TTE A;  1NJG A;  3GLH A;  4GC5 A;  4L6V 6;  4LJ5 A;  5EXT A;  1WJ7 A;  5EXS A;  3U6S A;  4AKG A;  1OAO C;  2FS1 A;  1V34 A;  3AOE A;  2ERC A;  3F92 A;  3PNY A;  2DZO B;  2OOB A;  4MM3 B;  4Z8X A;  1TH2 A;  3HHY A;  2R46 A;  4X64 M;  1NNU C;  1DGH A;  2Z3X A;  3TPZ A;  4R3D A;  2FH0 A;  2BWE A;  3Q8X A;  2LVN C;  3U6M A;  2KZU A;  1WGL A;  5E26 A;  4GIP A;  3GLF E;  3W68 A;  2K0B X;  2CUZ A;  3T15 A;  1SG9 A;  4MGZ E;  4LJ6 A;  4MGK E;  4B3S M;  4K0K M;  2E5L M;  4ZPX A;  2FNA A;  1H6U A;  5ITX E;  2H1R A;  2L7H A;  4B3T M;  1E9S A;  2DEN A;  3CF6 E;  4GMQ A;  4B7G A;  4DUY M;  3GRU A;  2HCB A;  3U6P A;  2MRO B;  1IBL M;  2VF7 A;  2RRU A;  3OTO M;  3I4Y A;  1Y8G A;  4AKH A;  1D0L A;  3LMM A;  3GQ4 A;  3FUV A;  5H37 D;  4QHS A;  5KO3 A;  4PDI A;  2QSF X;  1DGG A;  3SHG B;  3L26 A;  3KP1 E;  3KP0 E;  3VFD A;  2UUA M;  4AG6 A;  4IBE A;  1VEK A;  2DXI A;  2K47 A;  1L1Z A;  2LH0 A;  4NXM M;  3K1J A;  2UXB M;  2UXC M;  2ZBK B;  3FUT A;  1I4W A;  4DR2 M;  4JI0 M;  2A5Y B;  1KYI A;  2LHG A;  1OTR A;  5BPV A;  1SXJ A;  3GP1 A;  1IBK M;  5DFL A;  3A46 A;  4F2L A;  2R45 A;  2ZM6 M;  2XFS A;  1XMO M;  2UXD M;  4DV1 M;  4X65 M;  3SMS A;  3ZH9 B;  1GL7 A;  8CAT A;  1XMQ M;  1SXJ C;  1CUK A;  4DBG B;  3CTW B;  2F5N A;  3FTE A;  1MU5 A;  4TUW A;  1XHB A;  2J5Y A;  2JY6 B;  4G4R A;  4IBK A;  3NBI A;  1BVS A;  2UUC M;  2FFJ A;  2X49 A;  5FTM A;  1Z5C A;  3FTF A;  1QAM A;  1G4A E;  2K6B A;  2N35 A;  1IXS A;  2YFQ A;  3QYB A;  4P16 A;  3W0L B;  3HY5 A;  1L1T A;  3THG A;  1J7K A;  2QQ8 A;  4M9Z A;  5ITT A;  3RGP A;  3TWM A;  1TH3 A;  3HX3 A;  3U61 B;  1VDD A;  1XNQ M;  4WP2 A;  2QCU A;  4PD2 A;  2L2D A;  3MMP A;  3VDP A;  1ZMV A;  3E46 A;  4L15 A;  1ZMU A;  1GL6 A;  2KNZ A;  1OFI A;  3C3D A;  3Q8G A;  4MH0 E;  3HHZ A;  1VDL A;  2M5Z A;  4M0D A;  1HJP A;  2JY8 A;  2C98 A;  3BBZ A;  3LVW A;  4L16 A;  2KDL A;  4LF5 M;  3WHK A;  3KOY E;  3J81 S;  1XXH E;  2D7H A;  1RU3 A;  3J2P B;  4FCW A;  1GJT A;  3VKH A;  3VK7 A;  2BJV A;  1QAO A;  5KPT A;  4GRI A;  2Q2E B;  4DR7 M;  2Y21 A;  2VQE M;  4L4U A;  5FTL A;  1K3X A;  1XC8 A;  3TL4 X;  3C3E A;  2DHR A;  2KA6 B;  4JYA M;  3KS4 A;  3H4M A;  2LXE A;  7CAT A;  4PCZ A;  1C1K A;  4GHL A;  3K8Z A;  4F1I A;  3K9P A;  3UMM A;  3GRV A;  4DV0 M;  1FJG M;  3GLH E;  1G71 A;  2UU9 M;  4L78 A;  4FCT A;  3KSJ A;  1N32 M;  1JR3 D;  3GLI A;  3U6Q A;  3T38 A;  4FD2 A;  3FTC A;  2XSZ A;  5L8R F;  2CP8 A;  3DOA A;  3GQ5 A;  1OFH A;  5FTJ A;  4Y28 F;  3D8L A;  2EA0 A;  1DGB A;  4I4L A;  4B7H A;  1NHG C;  3B89 A;  4GIT A;  4I8O A;  5FTK A;  3SAV A;  1ZMW A;  3I51 A;  1J09 A;  4GC9 A;  2AHM A;  4AKI A;  2KRK A;  3J7A S;  1AIP C;  2DI0 A;  1N77 A;  4GHA A;  2KEB A;  4LF4 M;  2BNK A;  3E21 A;  4DV3 M;  3D8B A;  3KS8 A;  1W5T A;  2G5G X;  3QWL A;  2JXN A;  1S3S A;  4IJF A;  4OU7 A;  1HNW M;  1QZM A;  4XBO A;  3T1H M;  4BBA A;  3PXG A;  1YLA A;  2KHH A;  3TE6 A;  3ZC7 B;  4JXJ A;  5C1B A;  2R62 A;  1C7Y A;  4YY3 M;  3L27 A;  5ITY A;  2P5T A;  5IWA M;  3HHW A;  4IBF A;  2EJS A;  3U6O A;  2JY5 A;  1NSF A;  5EP3 A;  3EIE A;  3GPX A;  3I04 M;  4DR4 M;  3PFI A;  1P3Q Q;  2HWJ A;  4JI1 M;  4L8R C;  3TWK A;  3GO8 A;  2DVW B;  5FTN A;  3U5Z B;  2ZAO A;  4QNM A;  4XK8 F;  1NV9 A;  4JI2 M;  4G3O A;  1HT1 E;  4PDG A;  2UUB M;  1Q3C A;  2EKF A;  3SAS A;  1SXJ E;  1MJG M;  4ANR A;  5IT9 S;  4AQY M;  5LMN M;  1D2N A;  4MGI E;  1MX0 A;  4UN2 B;  2F4V M;  3W67 A;  2MH8 A;  3GLG B;  4LRS A;  1TR8 A;  2L09 A;  3M0E A;  3AL0 C;  3WHL A;  1HT2 E;  1OAI A;  2V1C A;  2L4F A;  1PJJ A;  1OIP A;  4KHP M;  5IRE B;  1NY5 A;  2DAM A;  2Z4S A;  5EP1 A;  3EIH A;  3L29 A;  3FKE A;  4LJ8 A;  3IEC A;  2DWZ B;  3KOX E;  3JR4 A;  4LF7 M;  1IQP A;  3AJI B;  3K9O A;  3DZD A;  1IY1 A;  2L4E A;  3HJS A;  4DUZ M;  4DR1 M;  3U6E A;  4IBB A;  4LY6 A;  2XEP A;  2X4A A;  1EIJ A;  4GEW A;  3HZJ A;  1KFV A;  4JI6 M;  4NOO B;  1WXQ A;  3JAM S;  4CIS A;  1GAB A;  1J5E M;  3U61 A;  2ZTC A;  3SMP A;  3FUU A;  1ZV1 A;  4QOS A;  3CGW A;  5F3W A;  2MR9 A;  2QHO B;  2O5R A;  4JI7 M;  2VDB B;  3I4V A;  5KPZ A;  3GPU A;  3CF2 A;  1NNJ A;  2ZAM A;  2DWM A;  3SC3 A;  4B3M M;  1QUS A;  1DGF A;  2Z4R A;  4A3V B;  5IZ7 D;  1GO5 A;  4IBG A;  4NRW A;  2XZU A;  1NY6 A;  4CJ6 A;  3GRR A;  5BR8 M;  3IG8 A;  3FRH A;  3MK6 A;  2QBY B;  1ORY B;  2KNA A;  1QDR A;  1WIV A;  2J7N A;  1MN3 A;  5DYG A;  3U6L A;  2V6Z M;  1I94 M;  4LZJ A;  5FLX S;  3J80 S;  2LBC A;  2RGO A;  1D0K A;  2KW0 A;  4JI8 M;  3KXE C;  3H4J A;  3SBJ A;  1PJI A;  4GKJ M;  4LGY A;  3L28 A;  1G3I A;  3AOG A;  3GPY A;  1QVR A;  1XB2 B;  2XF3 A;  4B7F A;  1W5S A;  1V33 A;  3IHP A;  4IBC A;  1N33 M;  1N78 A;  2J7O A;  3VLF B;  3E4R A;  1K82 A;  4DV2 M;  1R5L A;  4LZZ A;  1XWI A;  3FYD A;  1TH4 A;  2CEA A;  4IJE A;  3TWL A;  2F5S A;  5JI3 E;  3GLF B;  1R2Z A;  4B08 A;  3UZU A;  2LVQ D;  4AW4 A;  1QYR A;  2O25 A;  3SYK A;  1IY2 A;  2F5O A;  1A5T A;  2C9O A;  3V76 A;  4D81 A;  3GLI E;  1G59 A;  3DA1 A;  4RKU F;  2YNM D;  2R4E A;  2C99 A;  4OW0 A;  2R6F A;  3HU1 A;  2WSF F;  1Q02 A;  1IN6 A;  2XFT A;  2DWL A;  5ITQ A;  3SYL A;  4AG5 A;  3KFU G;  4EIW A;  4X62 M;  3SAT A;  2VF8 A;  2HKJ A;  4YHH M;  4KO8 A;  1UFZ A;  2DWN A;  4IBI A;  1R6B X;  2O01 F;  3AFH A;  5EP2 A;  4JI3 M;  1WGN A;  5KQD A;  3HJ8 A;  1JR3 A;  4Q7J A;  4CIZ A;  4LFC M;  3LQR A;  1LTM A;  2G3Q A;  1G41 A;  2VII A;  3W0F A;  3FUW A;  1Z6T A;  2HL7 A;  4MGY E;  1EFU B;  2C9C A;  2WSE F;  4LJA A;  1GLN A;  4IBJ A;  2FE8 A;  1GVN A;  4JV5 M;  1YE9 A;  2LWX A;  3ZCB B;  3LVV A;  4D80 A;  1L2C A;  4OVZ B;  2CE7 A;  2FOI C;  2MGW A;  2F5Q A;  5JI2 E;  3A98 B;  3BXW A;  1TGU A;  2XLJ A;  4FW9 A;  3ZQJ A;  1HR0 M;  2DAK A;  1N75 A;  4GH9 A;  5EJC A;  5FSW A;  2V1U A;  3L2A A;  5KPR A;  3PNV A;  3B7Q A;  3E9S A;  5E6J A;  2QP9 X;  4PT5 A;  1GKI A;  4G4N A;  3U5Z A;  1DV0 A;  4S12 A;  2DHY A;  4M9X A;  2JZ0 A;  1L2D A;  2JZ1 A;  3A42 A;  3B9P A;  4I5S A;  1Z59 A;  2DKL A;  2LHC A;  3FTD A;  2Z7J A;  2Y0Q A;  4LJ4 A;  2LVO C;  4OX9 M;  1IM2 A;  2KNV A;  3B74 A;  4IBD A;  2OPF A;  3UJN A;  3MHV C;  3GLG A;  5EXX A;  4G6Z A;  4QHT A;  2M60 A;  1N34 M;  1IBM M;  3BOS A;  2R4J A;  3HHX A;  4LF9 M;  1G8P A;  2R0I A;  3L25 A;  3AKZ A;  2OQ4 A;  4R71 A;  1NVM A;  2C96 A;  1HNX M;  1TDZ A;  2CHQ A;  4LF8 M;  2CRU A;  3C9P A;  4KLN A;  2MJ5 B;  2WSC F;  3A45 A;  3IG5 A;  4LJ9 A;  5ITR A;  3VKG A;  1QUT A;  4LFA M;  3UGJ A;  4DV7 M;  4B3R M;  3GRY A;  1QQW A;  4HEO A;  1ZAE A;  1XXH B;  4LF6 M;  1HNZ M;  4LCB A;  2DAG A;  3GLI B;  4QOZ C;  1PRB A;  1JQJ C;  1WHC A;  4MB7 A;  3FD9 A;  1NHW C;  4FWG A;  1LV7 A;  3AOE C;  2Y20 A;  3R8F A;  1ZQ9 A;  3U60 B;  2F5P A;  3SAR A;  1Z5A A;  3KVW A;  4Z6Y A;  1E94 E;  2JP7 A;  4HL4 A;  3M6A A;  2R44 A;  4JI5 M;  3FRI A;  4LG2 A;  2WZJ A;  2YQZ A;  2CV2 A;  2JNH A;  2QBY A;  2X8A A;  2L7I A;  2YR0 A;  3NBX X;  3RGS A;  1PM5 A;  1IXR C;  4DV4 M;  4LGM A;  3GLH B;  2XGN A;  3KOW E;  1F4I A;  2K9D A;  4GKK M;  2EUC A;  1JB0 F;  2R18 A;  3VDU A;  2L6O A;  2Z8Y M;  4G4O A;  3TQS A;  1VG5 A;  2NQ8 C;  4W5W A;  2C5R A;  5EXP A;  1YUB A;  2CHG A;  1DGH B;  3RE8 A;  2GQF A;  3HU3 A;  3RFW A;  4AZF A;  4M0W A;  1DO2 A;  1OKS A;  2RGH A;  4AI6 A;  2QEN A;  1Q3B A;  3GLF A;  3PVS A;  4JN6 A;  3GPP A;  1NO1 A;  2KRU A;  1E9R A;  1OJL A;  3AV0 A;  1Z5B A;  4D82 A;  2APL A;  4LRT A;  4NC6 A;  1R4G A;  2EO2 A;  1QAQ A;  3C58 A;  1FNN A;  5ITX A;  4P17 A;  1GJS A;  2G8L A;  1IN7 A;  1YSY A;  1D0M A;  2D7E A;  3LCV B;  4ITQ A;  2XZF A;  4DV6 M;  1VEJ A;  1R2Y A;  3FYC A;  4BB9 A;  2ZAN A;  3T1Y M;  1T6O A;  2QNJ A;  1HQY E;  4HLQ A;  4M9S A;  1SXJ D;  3J7B A;  3SAU A;  1XNR M;  1T3T A;  1V92 A;  2CFO A;  2D7G A;  3SHF A;  2JUJ A;  3SAW A;  3R9X B;  4FCV A;  1JR3 E;  1NV8 A;  1Q39 A;  3KOZ E;  2HHH M;  3HJQ A;  4G4Q A;  3NWL A;  1X37 A;  4II7 A;  3I01 M;  2HAK A;  1QDT A;  4X66 M;  2VQF M;  2W82 A;  3VK8 A;  4NSR A;  1L2B A;  4R7G A;  4I81 A;  2CWB A;  5ITU A;  4LJ7 A;  4OVZ A;  2KXE A;  4KT0 F;  5A2Q S;  1HQC A; 
#chains in the Genus database with same CATH homology
 1SXJ B;  2CV1 A;  4DR5 M;  3GQ3 A;  1IN4 A;  3JR5 A;  1IXZ A;  2CHV A;  1L8Q A;  2I7P A;  3HKP A;  1E32 A;  3HWS A;  5GKN A;  3MJ5 A;  4RF0 A;  1UM8 A;  4BLC A;  3M7G A;  4FWD A;  2R65 A;  1R7R A;  3K92 A;  4WUR A;  3HU2 A;  3UK6 A;  2JA2 A;  5EQT A;  5DNY A;  2BJW A;  1IXS B;  3QAU A;  4JI4 M;  4RNA A;  2CV0 A;  1TDH A;  4FWH A;  5C18 A;  3U6D A;  3FUX A;  4DR3 M;  1K3W A;  4DR6 M;  2XH9 A;  4REZ A;  5EP4 A;  4FVM A;  2LNH C;  2Y0T A;  4CGY B;  1IY0 A;  1NJF A;  4LFB M;  3ILK A;  4NL4 H;  3LQQ A;  3J27 B;  3KDS E;  4NSO B;  4MGH A;  4RF1 A;  4DV5 M;  4NRV A;  5DYI A;  1XXH A;  4KOD A;  2QZ4 A;  3CF0 A;  3HGI A;  1IN8 A;  1DO0 A;  2RKO A;  2KZS A;  3SFZ A;  2I7N A;  3K2L A;  3KW6 A;  5LMU M;  1N36 M;  1EE8 A;  3U6C A;  3U60 A;  2DZN B;  4QNR A;  5KQ8 A;  1KSF X;  1IN5 A;  2XSZ D;  4XGI A;  2QPA A;  4IIW A;  1QAN A;  4WW0 A;  3DFZ A;  4CHT B;  4NXN M;  3KSX A;  1NJG A;  3GLH A;  4GC5 A;  4LJ5 A;  5EXT A;  3U6S A;  5EXS A;  4AKG A;  3AOE A;  2ERC A;  3PNY A;  2DZO B;  4Z8X A;  4MM3 B;  3HHY A;  1TH2 A;  2R46 A;  4X64 M;  1NNU C;  1DGH A;  2Z3X A;  3TPZ A;  4R3D A;  3Q8X A;  3U6M A;  2KZU A;  5E26 A;  4GIP A;  2CUZ A;  3T15 A;  4MGZ E;  4LJ6 A;  4MGK E;  4B3S M;  4K0K M;  2E5L M;  4ZPX A;  2FNA A;  1H6U A;  5ITX E;  2H1R A;  2L7H A;  4B3T M;  1E9S A;  3CF6 E;  4GMQ A;  4B7G A;  4DUY M;  3GRU A;  2HCB A;  3U6P A;  1IBL M;  3OTO M;  3I4Y A;  4AKH A;  3LMM A;  3GQ4 A;  3FUV A;  5H37 D;  4QHS A;  5KO3 A;  4PDI A;  1DGG A;  3SHG B;  3L26 A;  3KP1 E;  3KP0 E;  3VFD A;  2UUA M;  4AG6 A;  4IBE A;  2DXI A;  2K47 A;  1L1Z A;  2LH0 A;  4NXM M;  3K1J A;  2UXB M;  2UXC M;  2ZBK B;  3FUT A;  1I4W A;  4DR2 M;  4JI0 M;  2A5Y B;  1KYI A;  5BPV A;  1SXJ A;  3GP1 A;  1IBK M;  3A46 A;  2R45 A;  2ZM6 M;  2XFS A;  1XMO M;  2UXD M;  4DV1 M;  4X65 M;  3SMS A;  3ZH9 B;  1GL7 A;  8CAT A;  1XMQ M;  1SXJ C;  2F5N A;  3CTW B;  3FTE A;  1MU5 A;  4TUW A;  1XHB A;  4G4R A;  4IBK A;  3NBI A;  2UUC M;  2FFJ A;  2X49 A;  5FTM A;  1Z5C A;  3FTF A;  1QAM A;  1G4A E;  2YFQ A;  4P16 A;  3W0L B;  1L1T A;  3SAR A;  3THG A;  1J7K A;  4M9Z A;  5ITT A;  3RGP A;  3TWM A;  1TH3 A;  3U61 B;  1VDD A;  1XNQ M;  2QCU A;  4PD2 A;  3VDP A;  4L15 A;  4MH0 E;  1GL6 A;  1OFI A;  3HHZ A;  2M5Z A;  4M0D A;  2C98 A;  3LVW A;  4L16 A;  4LF5 M;  3WHK A;  3KOY E;  3J81 S;  2D7H A;  3J2P B;  4FCW A;  3VKH A;  3VK7 A;  2BJV A;  1QAO A;  5KPT A;  4GRI A;  2Q2E B;  4DR7 M;  2Y21 A;  2VQE M;  4L4U A;  5FTL A;  1K3X A;  1XC8 A;  3TL4 X;  2DHR A;  2KA6 B;  4JYA M;  3KS4 A;  3H4M A;  2LXE A;  7CAT A;  4PCZ A;  1C1K A;  4GHL A;  3K8Z A;  3UMM A;  3GRV A;  4DV0 M;  1FJG M;  2UU9 M;  4L78 A;  4FCT A;  3KSJ A;  1N32 M;  1JR3 D;  3GLI A;  3U6Q A;  3T38 A;  4FD2 A;  3FTC A;  2XSZ A;  3DOA A;  3GQ5 A;  1OFH A;  5FTJ A;  3D8L A;  2EA0 A;  1DGB A;  4I4L A;  4B7H A;  1NHG C;  4GIT A;  4I8O A;  5FTK A;  3SAV A;  3I51 A;  1J09 A;  4GC9 A;  2AHM A;  4AKI A;  2KRK A;  3J7A S;  1N77 A;  4GHA A;  2KEB A;  4LF4 M;  2BNK A;  4DV3 M;  3D8B A;  3KS8 A;  1W5T A;  2G5G X;  3QWL A;  1S3S A;  4IJF A;  4OU7 A;  1HNW M;  1QZM A;  4XBO A;  3T1H M;  4BBA A;  3PXG A;  3TE6 A;  3ZC7 B;  4JXJ A;  5C1B A;  2R62 A;  4YY3 M;  3L27 A;  5ITY A;  2P5T A;  5IWA M;  3HHW A;  4IBF A;  3U6O A;  5EP3 A;  1NSF A;  3EIE A;  3GPX A;  4DR4 M;  3PFI A;  4JI1 M;  4L8R C;  3TWK A;  3GO8 A;  2DVW B;  5FTN A;  3U5Z B;  2ZAO A;  4QNM A;  4JI2 M;  1HT1 E;  4PDG A;  2UUB M;  1Q3C A;  3SAS A;  1SXJ E;  5IT9 S;  4AQY M;  5LMN M;  1D2N A;  4MGI E;  1MX0 A;  2F4V M;  3GLG B;  4LRS A;  2L09 A;  3M0E A;  3WHL A;  1HT2 E;  2V1C A;  1PJJ A;  4KHP M;  5IRE B;  1NY5 A;  2Z4S A;  5EP1 A;  3EIH A;  3L29 A;  3FKE A;  4LJ8 A;  2DWZ B;  3KOX E;  3JR4 A;  4LF7 M;  1IQP A;  3AJI B;  3DZD A;  1IY1 A;  3HJS A;  4DUZ M;  4DR1 M;  3U6E A;  4IBB A;  4LY6 A;  2XEP A;  2X4A A;  1KFV A;  4JI6 M;  4NOO B;  1WXQ A;  3JAM S;  4CIS A;  1J5E M;  3U61 A;  3SMP A;  3FUU A;  4QOS A;  5F3W A;  2O5R A;  4JI7 M;  3I4V A;  5KPZ A;  3GPU A;  3CF2 A;  1NNJ A;  2ZAM A;  2DWM A;  3SC3 A;  4B3M M;  1DGF A;  2Z4R A;  4A3V B;  5IZ7 D;  4IBG A;  4NRW A;  2XZU A;  1NY6 A;  3GRR A;  5BR8 M;  3IG8 A;  2QBY B;  3MK6 A;  1ORY B;  2J7N A;  5DYG A;  3U6L A;  2V6Z M;  1I94 M;  4LZJ A;  5FLX S;  3J80 S;  2RGO A;  2KW0 A;  4JI8 M;  3KXE C;  3SBJ A;  4GKJ M;  1PJI A;  4LGY A;  3L28 A;  1G3I A;  3AOG A;  3GPY A;  1QVR A;  2XF3 A;  4B7F A;  1N33 M;  1W5S A;  1N78 A;  4IBC A;  2J7O A;  3VLF B;  3E4R A;  1K82 A;  4DV2 M;  4LZZ A;  1XWI A;  3FYD A;  1TH4 A;  2CEA A;  4IJE A;  3TWL A;  2F5S A;  5JI3 E;  3GLF B;  1R2Z A;  4B08 A;  3UZU A;  4AW4 A;  1QYR A;  3SYK A;  1IY2 A;  2F5O A;  2C9O A;  4D81 A;  1G59 A;  3DA1 A;  2YNM D;  2R4E A;  2C99 A;  4OW0 A;  3HU1 A;  2DWL A;  2XFT A;  1IN6 A;  5ITQ A;  3SYL A;  4AG5 A;  3KFU G;  4EIW A;  4X62 M;  3SAT A;  4YHH M;  2HKJ A;  4KO8 A;  2DWN A;  4IBI A;  1R6B X;  3AFH A;  5EP2 A;  4JI3 M;  5KQD A;  3HJ8 A;  1JR3 A;  4LFC M;  3LQR A;  2VII A;  3W0F A;  1G41 A;  3FUW A;  1Z6T A;  2HL7 A;  4MGY E;  2C9C A;  4LJA A;  1GLN A;  4IBJ A;  2FE8 A;  1GVN A;  4JV5 M;  1YE9 A;  2LWX A;  3ZCB B;  3LVV A;  4D80 A;  1L2C A;  4OVZ B;  2CE7 A;  2FOI C;  2F5Q A;  5JI2 E;  3A98 B;  1TGU A;  2XLJ A;  4FW9 A;  1HR0 M;  1N75 A;  4GH9 A;  5EJC A;  5FSW A;  2V1U A;  3L2A A;  5KPR A;  3PNV A;  3E9S A;  5E6J A;  2QP9 X;  4PT5 A;  1GKI A;  4G4N A;  3U5Z A;  4S12 A;  4M9X A;  1L2D A;  3A42 A;  3B9P A;  4I5S A;  1Z59 A;  3FTD A;  2Z7J A;  2Y0Q A;  4LJ4 A;  4OX9 M;  1IM2 A;  4IBD A;  2OPF A;  3UJN A;  3MHV C;  3GLG A;  5EXX A;  4G6Z A;  4QHT A;  2M60 A;  1N34 M;  1IBM M;  3BOS A;  2R4J A;  3HHX A;  4LF9 M;  1G8P A;  3L25 A;  3AKZ A;  2OQ4 A;  1NVM A;  2C96 A;  1HNX M;  1TDZ A;  2CHQ A;  4LF8 M;  4KLN A;  3VKG A;  3IG5 A;  3A45 A;  4LJ9 A;  5ITR A;  4LFA M;  3UGJ A;  4DV7 M;  4B3R M;  3GRY A;  1QQW A;  1ZAE A;  1XXH B;  4LF6 M;  1HNZ M;  4LCB A;  3GLI B;  4QOZ C;  1JQJ C;  4MB7 A;  3FD9 A;  1NHW C;  4FWG A;  1LV7 A;  3AOE C;  2Y20 A;  3R8F A;  1ZQ9 A;  3U60 B;  2F5P A;  1Z5A A;  3KVW A;  4Z6Y A;  1E94 E;  4HL4 A;  3M6A A;  4JI5 M;  4LG2 A;  2YQZ A;  2CV2 A;  2QBY A;  2X8A A;  2L7I A;  2YR0 A;  3RGS A;  1PM5 A;  1IXR C;  4DV4 M;  4LGM A;  3GLH B;  2XGN A;  3KOW E;  4GKK M;  2EUC A;  2R18 A;  3VDU A;  2L6O A;  4G4O A;  3TQS A;  2NQ8 C;  4W5W A;  2C5R A;  5EXP A;  1YUB A;  2CHG A;  1DGH B;  3RE8 A;  3HU3 A;  3RFW A;  4AZF A;  4M0W A;  1DO2 A;  2RGH A;  4AI6 A;  2QEN A;  1Q3B A;  3GLF A;  3PVS A;  4JN6 A;  3GPP A;  2KRU A;  1E9R A;  1OJL A;  3AV0 A;  1Z5B A;  4D82 A;  4LRT A;  2EO2 A;  1QAQ A;  3C58 A;  1FNN A;  5ITX A;  2G8L A;  1IN7 A;  1YSY A;  2D7E A;  4ITQ A;  2XZF A;  4DV6 M;  1R2Y A;  3FYC A;  4BB9 A;  2ZAN A;  3T1Y M;  1HQY E;  4HLQ A;  4M9S A;  3J7B A;  1SXJ D;  3SAU A;  1XNR M;  1T3T A;  3AL0 C;  2CFO A;  2D7G A;  3SHF A;  3SAW A;  3R9X B;  4FCV A;  3KOZ E;  1Q39 A;  2HHH M;  3HJQ A;  4G4Q A;  3NWL A;  1X37 A;  4II7 A;  4X66 M;  2VQF M;  2W82 A;  3VK8 A;  4NSR A;  1L2B A;  4R7G A;  4I81 A;  5ITU A;  4LJ7 A;  4OVZ A;  2KXE A;  5A2Q S;  1HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...