4DR4M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr4M02
1Q3CA 3GQ3A 3SAVA 1PM5A 3GQ4A 5LMUM 5IWAM 1L2BA 4DR5M 1HNWM 3T1HM 1HNZM 1K3XA 4JI8M 2XZUA 3J7AS 4GKJM 2F5OA 3SATA 2UU9M 4LF8M 5FLXS 1Z5CA 4G4NA 1PJIA 3SARA 1XNQM 1Q3BA 3U6MA 3VK8A 3J81S 1MU5A 4LF7M 2OQ4A 4MB7A 2OPFA 1IBMM 5ITXE 2F5PA 2XZFA 4PD2A 4G4QA 1R2ZA 3GPXA 5ITQA 2Q2EB 1K3WA 4KHPM 3SBJA 1TDZA 3T1YM 3U6OA 1IBLM 4B3SM 1Z5BA 3SASA 4B3RM 4DR2M 4DR7M 2ZBKB 3GPYA 3U6PA 4PCZA 3JAMS 5A2QS 1N34M 1XNRM 4DV2M 4YHHM 1L1TA 2F5NA 4JV5M 4G4RA 4DR4M 4NXNM 5ITYA 4DV1M 2UUCM 3C58A 4DUYM 4DV7M 4JI1M 4LF5M 3J80S 4OX9M 4JI6M 4K0KM 4DR6M 4NXMM 3A45A 4DR3M 3U6EA 1R2YA 3GPUA 1Z59A 4ITQA 1L2DA 1PJJA 4DR1M 4JI2M 3DOAA 4LF6M 3A42A 5ITUA 1NNJA 2HHHM 1K82A 3VK7A 4LFCM 4CISA 2UXBM 3SAUA 1IBKM 2HKJA 2UUAM 5ITRA 4LF9M 3A46A 4GKKM 4LFBM 1XC8A 2F5QA 4JI7M 4DV3M 3W0FA 2UXCM 1Q39A 2ZM6M 2F4VM 4JYAM 4JI0M 2F5SA 3OTOM 3GP1A 2EA0A 1N32M 2VQFM 3U6QA 1N33M 3U6CA 1L1ZA 5LMNM 4B3MM 2VQEM 2UUBM 1FJGM 1HR0M 4X65M 1XMOM 4PDIA 4AQYM 4NRVA 1L2CA 1EE8A 3TWKA 4X64M 1I94M 4LFAM 4B3TM 3GO8A 1Z5AA 5ITXA 3GQ5A 4DV6M 3U6DA 5IT9S 4YY3M 4JI4M 4JI5M 4NRWA 3TWMA 4X62M 3JR5A 1TDHA 4DV4M 4G4OA 3TWLA 1XMQM 1N36M 5ITTA 4LF4M 1KFVA 4JI3M 1MX0A 3GPPA 3JR4A 3U6SA 2E5LM 3U6LA 5BR8M 4DV0M 4DUZM 4DV5M 4X66M 1J5EM 3SAWA 1HNXM 4PDGA 2UXDM
chains in the Genus database with same CATH superfamily
3GQ3A 2C9OA 3CF0A 3FRHA 1VDLA 3GQ4A 1G8PA 3HGIA 4MM3B 4IJEA 1ZMVA 4DR5M 1WJ7A 1HNZM 4TUWA 2ZAMA 4GHAA 3QYBA 3MJ5A 2KEBA 4B08A 4LF8M 2H1RA 1I4WA 4L16A 2VDBB 2KNAA 1NJFA 4IBIA 1IN4A 4FWHA 4W5WA 1Q3BA 4CHTB 2KZSA 4L4UA 1C1KA 1VEGA 1DGHA 1IN5A 1OTRA 4MB7A 2Y0QA 1TTEA 2FFJA 1D0LA 4FWGA 4LZJA 2LH0A 2QQ8A 4KHPM 5KQ8A 3K2LA 3KXEC 2CP8A 3U61B 3KP1E 3C3DA 2FNAA 4Y28F 1IBLM 4B3SM 1Z5BA 1DGHB 4DR7M 1HT1E 2D7GA 4DR2M 1XXHE 2QBYA 5EP4A 3JAMS 2JP7A 1XNRM 3LMMA 2F5NA 4XBOA 4G4RA 4DR4M 4NXNM 2CHQA 1XHBA 1P3QQ 4HEOA 3C58A 4DUYM 4DV7M 2CHVA 4LY6A 3SC3A 2LWXA 1A5TA 4I4LA 5FTMA 3T6PA 2X49A 4JI6M 4K0KM 2QCUA 1G71A 5FTLA 1DGFA 5F3WA 4DR6M 3HX3A 3PNVA 3KSXA 4DR3M 3U6EA 3GPUA 2KXEA 5IREB 2QBYB 1ZQ9A 1QYRA 3HU1A 3HU2A 4IBKA 3SYLA 1PJJA 2QHOB 4IBGA 2C5RA 3FYDA 3LCUA 3WHKA 3R9XB 3I01M 3KOYE 3PVSA 3H4MA 4L15A 3TPZA 3GRUA 1IBKM 2XGNA 2R6FA 5KPRA 3MMPA 4LF9M 2CHGA 3SMPA 2F5QA 1QDTA 3WHLA 2KW0A 3B89A 2D7EA 4WP2A 3THGA 2DI0A 4CJ6A 3ZH9B 1JR3D 2ZM6M 4UN2B 1PJSA 3L27A 2V1UA 3F92A 3FUXA 3GLGE 1MJGM 4JYAM 1LTMA 4JI0M 2EJSA 2ERCA 4R3DA 3GP1A 3PNYA 2VQFM 4BLCA 1E9SA 2K6BA 1L1ZA 2VQEM 1GVNA 3GLHE 3GLHB 4D82A 3HJ8A 3TWKA 3PFIA 2BJVA 5H37D 1JR3E 2HAKA 4LFAM 2EKFA 3KS4A 5KPTA 4B3TM 1IFYA 3U6DA 1D0MA 2QSFX 4QNMA 2LVQD 3KS8A 1DV0A 3K1JA 1TDHA 1XMQM 1N36M 2RRUA 4LJAA 3JR4A 4JN6A 1Q02A 4GH9A 5BR8M 2R18A 4DUZM 2DXIA 2R44A 3VKHA 4DV5M 4RF0A 1J5EM 5IZ7D 3BBZA 4KODA 2EUCA 4M9XA 1TH3A 4M9ZA 2O5RA 4F1IA 2YNMD 2ZTDA 4NSRA 2I7PA 5IWAM 5LMUM 2VF8A 3B7QA 1H6UA 2MH8A 3M6AA 4NL4H 5EQTA 4IJFA 1HNWM 4D81A 1QQWA 3KOXE 3QYEA 1NJGA 2DZNB 4QHSA 3Q8GA 2XZUA 1N77A 3FUVA 1NVMA 1GL6A 2Y20A 2VIIA 3RGSA 4GIPA 1RU3A 4LJ4A 5FLXS 1Z5CA 4G4NA 1PJIA 3GLIB 3GLIE 5EXPA 2I7NA 1NY6A 1YUBA 3VK8A 2QP9X 1X37A 2K9DA 2R46A 1UM8A 2DWLA 2GNOA 3BOSA 2XFSA 3D8BA 2OPFA 2F5PA 2DAEA 3ILKA 4FCVA 3RE8A 2XZFA 2D7HA 1Z6TA 2G8LA 2K0BX 5DYGA 1V34A 1T43A 4GEWA 1R2ZA 5JI2E 3I4YA 3GPXA 2R65A 3J7BA 2Q2EB 5ITQA 1K3WA 4WURA 1OKSA 3U6OA 4M9SA 3LCVB 1XB2B 1VG5A 2CFOA 4P17A 4Z6YA 1GL7A 1GJSA 1MN3A 1NV8A 2M60A 3SASA 3VDUA 4B3RM 2ZBKB 2MJ5B 2O01F 3HKPA 2KZUA 1T6OA 4FWDA 3FKEA 2LHCA 4AG6A 1PRBA 2JUJA 4FCWA 4OW0A 2JA2A 4YHHM 4DV2M 4B7GA 1L1TA 1YLAA 4JV5M 2BJWA 1LV7A 1T3TA 2XEPA 4I8OA 2NQ8C 4IBJA 4JI1M 5FTKA 4NC6A 1G41A 4OX9M 3FTFA 4P16A 2JY7A 2P5TA 2V1CA 2M5ZA 2X4AA 3KDSE 2XSZA 2QPAA 4ITQA 1NY5A 3QAUA 2V6ZM 2DAKA 3DZDA 4JI2M 2A5YB 2RKOA 1UFZA 1OJLA 5ITUA 1NNJA 3VK7A 2RGHA 4CISA 4HLQA 2UXBM 1IXZA 1IN6A 5ITRA 2OOBA 3A46A 4LFBM 2MR9A 2O25A 2EKKA 2CV1A 4RKUF 3W0FA 3B9PA 1Q39A 3LQRA 1OFIA 4FCTA 3FD9A 5FTJA 3L29A 3AKZA 5JI3E 1WGLA 4MGIE 1NV9A 5KQDA 1J7KA 4GC5A 1N32M 4LJ8A 1YSYA 3U6QA 1N33M 2GQFA 4B3MM 2L4EA 2B3TA 3W67A 3HHXA 4GITA 3U5ZA 5E26A 1TR8A 3J27B 4RF1A 4X65M 4AQYM 1L2CA 1EE8A 1I94M 3HJQA 3KP0E 1L8QA 3L25A 1E94E 3K8ZA 4IBCA 2KNZA 4L8RC 5ITXA 3GQ5A 4DV6M 5IT9S 4YY3M 2DAMA 3LVVA 3EIHA 3R8FA 2L6OA 2JY8A 5EP1A 4IIWA 2FE8A 4LF4M 3GRVA 3HY5A 2AHMA 2WZJA 3GPPA 1OAOC 2DWNA 2LHGA 3U6LA 2Z8YM 3KOWE 4DV0M 1XWIA 4A3VB 4AZFA 4FVMA 2EO2A 1AIPC 4IBFA 3A98B 3U60A 1IY1A 3DFZA 3B74A 3UJNA 1SXJC 2KDLA 3M0EA 7CATA 1NO1A 2XFTA 1C7YA 3ZQJA 1SG9A 2DZOB 2J7OA 3SHGB 3KFUG 2WSEF 3AFHA 1K3XA 4JI8M 3J7AS 1IQPA 1PJTA 4GKJM 3AL0C 1WIVA 2FOIC 3U60B 3SATA 3RGPA 3GRYA 1FNNA 2W82A 2HCBA 2C9CA 3SHFA 1QDRA 3SARA 2XF3A 3U6MA 4OU7A 1OFHA 1TH2A 1E32A 2JY5A 2N35A 4QHTA 5GKNA 2VF7A 3J81S 2JNHA 1Y8GA 3T38A 2DNAA 4LF7M 1IBMM 2FS1A 1QANA 3Q8XA 4QNRA 1KSFX 4II7A 1N78A 4G4QA 4KT0F 1R5LA 1NSFA 2Z7JA 2KRKA 3MK6A 3L2AA 2C99A 1PGYA 2Z4SA 2CEAA 4MGZE 4AG5A 1HT2E 1SXJA 4AKIA 1QVRA 2JY6B 3ZCBB 3GPYA 3IECA 4PCZA 3CF2A 3FE3A 2L4FA 3E4RA 3FUWA 4L6V6 3KSJA 2QNJA 2BNKA 3GLFA 4BBAA 2DHRA 4Q7JA 4LCBA 3FUTA 2KRUA 2L7IA 4KLNA 3AOEC 2DAGA 3TE6A 2Z3XA 1QUSA 4I81A 3J80S 4BB9A 3I04M 1SXJB 4LJ6A 2LVOC 5EJCA 4NXMM 1NNUC 1N75A 3W68A 4AI6A 5KPZA 1Z59A 2WSCF 2FH0A 4M0WA 1VQ1A 1ZAEA 3IHPA 4KO8A 1PJQA 3K9OA 4MH0E 5EXSA 4LRTA 3DOAA 4R71A 3GLFB 1ZMWA 1YE9A 4ANRA 1GO5A 3A42A 1OIPA 2HHHM 2R0IA 3KW6A 2XLJA 4MGYE 4LGYA 2LXEA 1EFUB 3FTDA 4MGKE 2HWJA 1R4GA 2R62A 3NBXX 4G6ZA 4PT5A 4XGIA 5DYIA 1OIZA 2L7HA 4GKKM 2KA6B 4I5SA 4XK8F 4DV3M 3D8LA 2CV2A 1ZMUA 4IBDA 3GRRA 1R6BX 3L28A 1IN8A 2F4VM 1AUAA 4LJ9A 1QAMA 1IXRC 2EA0A 3AJIB 1QZMA 1QAOA 1GABA 3KVWA 3W0LB 4NOOB 3U6CA 1HQYE 4WW0A 3NWLA 2BWBA 4M0DA 1FJGM 1OQYA 3AOEA 2JWSA 3T15A 2XSZD 4NRVA 4PDIA 1XMOM 2ZAOA 4GMQA 1BVSA 3GO8A 1Z5AA 1E9RA 3AOGA 3MHVC 4CGYB 4JI4M 4NRWA 3EIEA 3HWSA 4X62M 2YFQA 1G3IA 2DAIA 3C3EA 3LVWA 4G3OA 3JR5A 4GC9A 2HL7A 3LQQA 1MX0A 2E5LM 1TF0B 3KOZE 3U61A 1DGGA 1G4AE 4LJ7A 2J7NA 2K47A 2R4EA 2QENA 3AV0A 3TQSA 4MGHA 2APLA 4X66M 2MROB 2OO9A 4FW9A 3SAWA 1EIJA 1ZV1A 1R7RA 1XXHA 3DA1A 1HNXM 4PDGA 3FTCA 3RFWA 2UXDM 2J5YA 1GKIA 1Q3CA 2DHYA 3B7ZA 3SAVA 4LRSA 5C1BA 1J09A 1VDDA 1W5SA 2JXNA 1PM5A 3VLFB 3SYKA 3L26A 3FYCA 3HJSA 3K9PA 1L2BA 2LBCA 4Z8XA 3T1HM 2DWMA 3UMMA 1XXHB 3FUUA 4AW4A 3I51A 5EXXA 2F5OA 2UU9M 1QAQA 2KHHA 2DENA 3TL4X 3U5ZB 3CGWA 2MGWA 1XNQM 2ZANA 4AKGA 5E6JA 1IM2A 2R4JA 4REZA 1NHWC 1QUTA 3ZC7B 1MU5A 4LG2A 3FRIA 3CF6E 2OQ4A 2G5GX 3IG5A 5ITXE 1GLNA 3SMSA 4PD2A 3FTEA 2KNVA 2H5XA 3QWLA 1GJTA 1DO0A 1S3SA 2CE7A 2DWZB 4HL4A 5C18A 5L8RF 2CWBA 1DGBA 2CUZA 3GLGA 3SBJA 3T1YM 1TDZA 3IG8A 2Y0TA 4DBGB 2BWEA 2QZ4A 3K92A 3H4JA 3CTWB 3U6PA 1QZEA 1TH4A 3GLHA 5A2QS 1N34M 2ZTCA 2JZ0A 2OOAA 1JR3A 4QOZC 5ITYA 4DV1M 4GRIA 2UUCM 3GLGB 3UGJA 3HU3A 2LNHC 4LF5M 1V33A 3BXWA 2Z4RA 1WR1B 2WSFF 2L09A 5DNYA 2R45A 3A45A 1D2NA 1R2YA 1OAIA 1L2DA 2X8AA 3V76A 4IBBA 4DR1M 4LF6M 4JXJA 3HHWA 3LW5F 4S12A 1K82A 4LFCM 4B7FA 1V92A 4OVZA 4ZPXA 5EP3A 3SAUA 1SXJD 2HKJA 2UUAM 2C96A 1DO2A 4LJ5A 5FSWA 2C98A 3J2PB 1XC8A 3C9PA 4NSOB 3HHZA 4JI7M 3VKGA 2L2DA 2UXCM 3UZUA 2LVPC 4QOSA 4LZZA 1TGUA 3HZJA 4D80A 4F2LA 1HJPA 8CATA 1W5TA 3NBIA 4AKHA 3HHYA 5EP2A 2CV0A 2LVAA 1NHGC 1CUKA 3I4VA 3E46A 2F5SA 3OTOM 1G59A 4OVZB 2DZLA 5BPVA 1SXJE 5LMNM 1JB0F 2JZ1A 1IY0A 2UUBM 4LGMA 1HR0M 3GLIA 2LVNC 3SFZA 4L78A 4X64M 4GHLA 3M7GA 1F4IA 3GLFE 1KYIA 1WHCA 2DKLA 3VDPA 4EIWA 5DFLA 2YQZA 1D0KA 1WXQA 1IN7A 1WGNA 1IXSA 3E21A 4JI5M 2YR0A 4FD2A 3TWMA 2LTUA 1IY2A 4G4OA 4DV4M 3TWLA 3B7NA 5ITTA 1VEKA 1KFVA 5FTNA 4JI3M 3U6SA 2DVWB 4B7HA 2RGOA 1ORYB 3E9SA 3UK6A 3VFDA 4CIZA 5KO3A 4R7GA 1VEJA 4IBEA 1JQJC 3PXGA 1IXSB 1HQCA 2CRUA 2XH9A 4RNAA 5EXTA 2G3QA 2Y21A
chains in the Genus database with same CATH topology
3GQ3A 2C9OA 3CF0A 3GQ4A 1G8PA 3HGIA 4MM3B 4IJEA 4DR5M 1HNZM 4TUWA 2ZAMA 4GHAA 3MJ5A 2KEBA 4B08A 4LF8M 2H1RA 1I4WA 4L16A 4IBIA 1NJFA 1IN4A 4FWHA 4W5WA 1Q3BA 4CHTB 2KZSA 4L4UA 1C1KA 1DGHA 1IN5A 4MB7A 2Y0QA 2FFJA 4FWGA 4LZJA 2LH0A 4KHPM 5KQ8A 3K2LA 3KXEC 3U61B 3KP1E 2FNAA 1IBLM 4B3SM 1Z5BA 1DGHB 4DR7M 1HT1E 2D7GA 4DR2M 2QBYA 5EP4A 3JAMS 1XNRM 3LMMA 2F5NA 4XBOA 4G4RA 4DR4M 4NXNM 2CHQA 1XHBA 3C58A 4DUYM 4DV7M 2CHVA 4LY6A 3SC3A 2LWXA 4I4LA 5FTMA 2X49A 4JI6M 4K0KM 2QCUA 5FTLA 4DR6M 1DGFA 5F3WA 3PNVA 4DR3M 3KSXA 3U6EA 2QBYB 3GPUA 2KXEA 5IREB 1ZQ9A 1QYRA 3HU1A 3HU2A 4IBKA 3SYLA 1PJJA 4IBGA 2C5RA 3FYDA 3WHKA 3R9XB 3KOYE 3PVSA 3H4MA 4L15A 3TPZA 3GRUA 1IBKM 2XGNA 5KPRA 4LF9M 2CHGA 3SMPA 2F5QA 3WHLA 2KW0A 3THGA 2D7EA 3ZH9B 1JR3D 2ZM6M 3L27A 2V1UA 3FUXA 4JYAM 4JI0M 2ERCA 4R3DA 3GP1A 3PNYA 2VQFM 4BLCA 1E9SA 1L1ZA 2VQEM 1GVNA 3GLHB 4D82A 3HJ8A 3TWKA 3PFIA 2BJVA 5H37D 4LFAM 3KS4A 5KPTA 4B3TM 3U6DA 4QNMA 3KS8A 3K1JA 1TDHA 1XMQM 1N36M 4LJAA 3JR4A 4JN6A 4GH9A 5BR8M 2R18A 4DUZM 2DXIA 3VKHA 4DV5M 4RF0A 1J5EM 5IZ7D 4KODA 2EUCA 4M9XA 1TH3A 4M9ZA 2O5RA 2YNMD 4NSRA 2I7PA 5IWAM 5LMUM 1H6UA 3M6AA 4NL4H 5EQTA 4IJFA 1HNWM 4D81A 1QQWA 3KOXE 1NJGA 2DZNB 4QHSA 2XZUA 1N77A 3FUVA 1NVMA 1GL6A 2Y20A 2VIIA 3RGSA 4GIPA 4LJ4A 5FLXS 1Z5CA 4G4NA 1PJIA 3GLIB 5EXPA 2I7NA 1NY6A 1YUBA 3VK8A 2QP9X 1X37A 2R46A 1UM8A 2DWLA 3D8BA 3BOSA 2XFSA 2OPFA 2F5PA 3ILKA 4FCVA 3RE8A 2XZFA 2D7HA 1Z6TA 2G8LA 5DYGA 1R2ZA 5JI2E 3I4YA 3GPXA 2R65A 3J7BA 2Q2EB 5ITQA 1K3WA 4WURA 3U6OA 4M9SA 2CFOA 4Z6YA 1GL7A 2M60A 3SASA 3VDUA 4B3RM 2ZBKB 3HKPA 4FWDA 2KZUA 3FKEA 4AG6A 4OW0A 4YHHM 4FCWA 4DV2M 2JA2A 1L1TA 4JV5M 4B7GA 2BJWA 1LV7A 1T3TA 2XEPA 4I8OA 2NQ8C 4IBJA 4JI1M 5FTKA 1G41A 4OX9M 3FTFA 4P16A 2P5TA 2V1CA 2M5ZA 2X4AA 3KDSE 2XSZA 2QPAA 4ITQA 1NY5A 3QAUA 2V6ZM 3DZDA 4JI2M 2A5YB 2RKOA 1OJLA 5ITUA 1NNJA 3VK7A 2RGHA 4CISA 4HLQA 2UXBM 1IXZA 1IN6A 5ITRA 3A46A 4LFBM 2CV1A 3W0FA 3B9PA 1Q39A 3LQRA 1OFIA 4FCTA 3FD9A 5FTJA 3L29A 3AKZA 5JI3E 4MGIE 5KQDA 1J7KA 4GC5A 1N32M 4LJ8A 1YSYA 3U6QA 1N33M 4B3MM 3HHXA 4GITA 3U5ZA 5E26A 3J27B 4RF1A 4X65M 4AQYM 1L2CA 1EE8A 1I94M 3HJQA 3KP0E 1L8QA 3L25A 1E94E 3K8ZA 4IBCA 4L8RC 5ITXA 3GQ5A 4DV6M 5IT9S 4YY3M 3LVVA 3EIHA 3R8FA 2L6OA 5EP1A 4IIWA 2FE8A 4LF4M 3GRVA 2AHMA 3GPPA 2DWNA 3U6LA 3KOWE 4DV0M 1XWIA 4A3VB 4AZFA 4FVMA 2EO2A 4IBFA 3A98B 3U60A 1IY1A 3DFZA 3UJNA 1SXJC 7CATA 3M0EA 2XFTA 2J7OA 2DZOB 3SHGB 3KFUG 3AFHA 1K3XA 4JI8M 3J7AS 1IQPA 4GKJM 3AL0C 3U60B 2FOIC 3SATA 3RGPA 3GRYA 1FNNA 2W82A 2HCBA 2C9CA 3SHFA 3SARA 2XF3A 3U6MA 4OU7A 1OFHA 1TH2A 1E32A 4QHTA 5GKNA 3J81S 3T38A 4LF7M 1IBMM 3Q8XA 1QANA 4QNRA 1KSFX 4II7A 1N78A 4G4QA 1NSFA 2Z7JA 2KRKA 3MK6A 3L2AA 2C99A 2Z4SA 2CEAA 4MGZE 4AG5A 1HT2E 1SXJA 4AKIA 1QVRA 3ZCBB 3GPYA 4PCZA 3CF2A 3E4RA 3FUWA 3KSJA 2BNKA 3GLFA 4BBAA 2DHRA 4LCBA 3FUTA 2KRUA 2L7IA 4KLNA 3AOEC 3TE6A 2Z3XA 4I81A 3J80S 4BB9A 1SXJB 4LJ6A 5EJCA 4NXMM 1NNUC 1N75A 4AI6A 5KPZA 1Z59A 4MH0E 4M0WA 1ZAEA 4KO8A 5EXSA 4LRTA 3DOAA 3GLFB 1YE9A 3A42A 2HHHM 2XLJA 3KW6A 4MGYE 4LGYA 2LXEA 3FTDA 4MGKE 2R62A 4G6ZA 4XGIA 4PT5A 5DYIA 4GKKM 2L7HA 2KA6B 4I5SA 4DV3M 3D8LA 2CV2A 4IBDA 3GRRA 1R6BX 3L28A 1IN8A 2F4VM 4LJ9A 1QAMA 1IXRC 2EA0A 3AJIB 1QZMA 1QAOA 3KVWA 3W0LB 4NOOB 3U6CA 1HQYE 4WW0A 3NWLA 1FJGM 4M0DA 3AOEA 3T15A 4PDIA 1XMOM 2XSZD 4NRVA 2ZAOA 4GMQA 3GO8A 1Z5AA 1E9RA 3AOGA 3MHVC 4CGYB 4JI4M 4NRWA 3EIEA 3HWSA 4X62M 2YFQA 1G3IA 3JR5A 3LVWA 4GC9A 2HL7A 3LQQA 1MX0A 2E5LM 3KOZE 3U61A 1DGGA 1G4AE 4LJ7A 2J7NA 2K47A 2R4EA 2QENA 3AV0A 3TQSA 4MGHA 4X66M 4FW9A 3SAWA 1R7RA 1XXHA 3DA1A 1HNXM 4PDGA 3FTCA 3RFWA 2UXDM 1GKIA 1Q3CA 3SAVA 4LRSA 5C1BA 1J09A 1VDDA 1W5SA 1PM5A 3VLFB 3SYKA 3L26A 3FYCA 3HJSA 1L2BA 4Z8XA 3T1HM 2DWMA 3UMMA 1XXHB 3FUUA 4AW4A 3I51A 5EXXA 2F5OA 2UU9M 1QAQA 3TL4X 3U5ZB 4AKGA 1XNQM 2ZANA 5E6JA 1IM2A 2R4JA 4REZA 1NHWC 3ZC7B 1MU5A 4LG2A 3CF6E 2OQ4A 2G5GX 3IG5A 5ITXE 1GLNA 3SMSA 4PD2A 3FTEA 3QWLA 1S3SA 1DO0A 2CE7A 2DWZB 4HL4A 5C18A 1DGBA 2CUZA 3GLGA 3SBJA 3T1YM 1TDZA 3IG8A 2Y0TA 2QZ4A 3K92A 3CTWB 3U6PA 1TH4A 3GLHA 5A2QS 1N34M 1JR3A 4QOZC 5ITYA 4DV1M 4GRIA 2UUCM 3GLGB 3UGJA 3HU3A 2LNHC 4LF5M 2Z4RA 5DNYA 2L09A 2R45A 3A45A 1D2NA 1R2YA 1L2DA 2X8AA 4IBBA 4DR1M 4LF6M 4JXJA 3HHWA 4S12A 1K82A 4LFCM 4B7FA 4OVZA 4ZPXA 5EP3A 3SAUA 1SXJD 2HKJA 2UUAM 2C96A 1DO2A 4LJ5A 5FSWA 2C98A 3J2PB 1XC8A 4NSOB 3HHZA 4JI7M 3VKGA 2UXCM 3UZUA 4QOSA 4LZZA 1TGUA 4D80A 8CATA 4AKHA 1W5TA 3NBIA 3HHYA 5EP2A 2CV0A 1NHGC 3I4VA 2F5SA 3OTOM 1G59A 4OVZB 5BPVA 1SXJE 5LMNM 1IY0A 2UUBM 4LGMA 1HR0M 3GLIA 3SFZA 4L78A 4X64M 4GHLA 3M7GA 1KYIA 3VDPA 4EIWA 2YQZA 1WXQA 1IN7A 4JI5M 2YR0A 4FD2A 3TWMA 1IY2A 4G4OA 4DV4M 3TWLA 5ITTA 1KFVA 5FTNA 4JI3M 3U6SA 2DVWB 4B7HA 2RGOA 1ORYB 3E9SA 3UK6A 3VFDA 5KO3A 4R7GA 4IBEA 3PXGA 1JQJC 1IXSB 1HQCA 2XH9A 4RNAA 5EXTA 2Y21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3C A;  3GQ3 A;  3SAV A;  1PM5 A;  3GQ4 A;  5LMU M;  5IWA M;  1L2B A;  4DR5 M;  1HNW M;  3T1H M;  1HNZ M;  1K3X A;  4JI8 M;  2XZU A;  3J7A S;  4GKJ M;  2F5O A;  3SAT A;  2UU9 M;  4LF8 M;  5FLX S;  1Z5C A;  4G4N A;  1PJI A;  3SAR A;  1XNQ M;  1Q3B A;  3U6M A;  3VK8 A;  3J81 S;  1MU5 A;  4LF7 M;  2OQ4 A;  4MB7 A;  2OPF A;  1IBM M;  5ITX E;  2F5P A;  2XZF A;  4PD2 A;  4G4Q A;  1R2Z A;  3GPX A;  5ITQ A;  2Q2E B;  1K3W A;  4KHP M;  3SBJ A;  1TDZ A;  3T1Y M;  3U6O A;  1IBL M;  4B3S M;  1Z5B A;  3SAS A;  4B3R M;  4DR2 M;  4DR7 M;  2ZBK B;  3GPY A;  3U6P A;  4PCZ A;  3JAM S;  5A2Q S;  1N34 M;  1XNR M;  4DV2 M;  4YHH M;  1L1T A;  2F5N A;  4JV5 M;  4G4R A;  4DR4 M;  4NXN M;  5ITY A;  4DV1 M;  2UUC M;  3C58 A;  4DUY M;  4DV7 M;  4JI1 M;  4LF5 M;  3J80 S;  4OX9 M;  4JI6 M;  4K0K M;  4DR6 M;  4NXM M;  3A45 A;  4DR3 M;  3U6E A;  1R2Y A;  3GPU A;  1Z59 A;  4ITQ A;  1L2D A;  1PJJ A;  4DR1 M;  4JI2 M;  3DOA A;  4LF6 M;  3A42 A;  5ITU A;  1NNJ A;  2HHH M;  1K82 A;  3VK7 A;  4LFC M;  4CIS A;  2UXB M;  3SAU A;  1IBK M;  2HKJ A;  2UUA M;  5ITR A;  4LF9 M;  3A46 A;  4GKK M;  4LFB M;  1XC8 A;  2F5Q A;  4JI7 M;  4DV3 M;  3W0F A;  2UXC M;  1Q39 A;  2ZM6 M;  2F4V M;  4JYA M;  4JI0 M;  2F5S A;  3OTO M;  3GP1 A;  2EA0 A;  1N32 M;  2VQF M;  3U6Q A;  1N33 M;  3U6C A;  1L1Z A;  5LMN M;  4B3M M;  2VQE M;  2UUB M;  1FJG M;  1HR0 M;  4X65 M;  1XMO M;  4PDI A;  4AQY M;  4NRV A;  1L2C A;  1EE8 A;  3TWK A;  4X64 M;  1I94 M;  4LFA M;  4B3T M;  3GO8 A;  1Z5A A;  5ITX A;  3GQ5 A;  4DV6 M;  3U6D A;  5IT9 S;  4YY3 M;  4JI4 M;  4JI5 M;  4NRW A;  3TWM A;  4X62 M;  3JR5 A;  1TDH A;  4DV4 M;  4G4O A;  3TWL A;  1XMQ M;  1N36 M;  5ITT A;  4LF4 M;  1KFV A;  4JI3 M;  1MX0 A;  3GPP A;  3JR4 A;  3U6S A;  2E5L M;  3U6L A;  5BR8 M;  4DV0 M;  4DUZ M;  4DV5 M;  4X66 M;  1J5E M;  3SAW A;  1HNX M;  4PDG A;  2UXD M; 
#chains in the Genus database with same CATH topology
 3GQ3 A;  2C9O A;  3CF0 A;  3FRH A;  1VDL A;  3GQ4 A;  1G8P A;  3HGI A;  4MM3 B;  4IJE A;  1ZMV A;  4DR5 M;  1WJ7 A;  1HNZ M;  4TUW A;  2ZAM A;  4GHA A;  3QYB A;  3MJ5 A;  2KEB A;  4B08 A;  4LF8 M;  2H1R A;  1I4W A;  4L16 A;  2VDB B;  2KNA A;  1NJF A;  4IBI A;  1IN4 A;  4FWH A;  4W5W A;  1Q3B A;  4CHT B;  2KZS A;  4L4U A;  1C1K A;  1VEG A;  1DGH A;  1IN5 A;  1OTR A;  4MB7 A;  2Y0Q A;  1TTE A;  2FFJ A;  1D0L A;  4FWG A;  4LZJ A;  2LH0 A;  2QQ8 A;  4KHP M;  5KQ8 A;  3K2L A;  3KXE C;  2CP8 A;  3U61 B;  3KP1 E;  3C3D A;  2FNA A;  4Y28 F;  1IBL M;  4B3S M;  1Z5B A;  1DGH B;  4DR7 M;  1HT1 E;  2D7G A;  4DR2 M;  1XXH E;  2QBY A;  5EP4 A;  3JAM S;  2JP7 A;  1XNR M;  3LMM A;  2F5N A;  4XBO A;  4G4R A;  4DR4 M;  4NXN M;  2CHQ A;  1XHB A;  1P3Q Q;  4HEO A;  3C58 A;  4DUY M;  4DV7 M;  2CHV A;  4LY6 A;  3SC3 A;  2LWX A;  1A5T A;  4I4L A;  5FTM A;  3T6P A;  2X49 A;  4JI6 M;  4K0K M;  2QCU A;  1G71 A;  5FTL A;  1DGF A;  5F3W A;  4DR6 M;  3HX3 A;  3PNV A;  3KSX A;  4DR3 M;  3U6E A;  3GPU A;  2KXE A;  5IRE B;  2QBY B;  1ZQ9 A;  1QYR A;  3HU1 A;  3HU2 A;  4IBK A;  3SYL A;  1PJJ A;  2QHO B;  4IBG A;  2C5R A;  3FYD A;  3LCU A;  3WHK A;  3R9X B;  3I01 M;  3KOY E;  3PVS A;  3H4M A;  4L15 A;  3TPZ A;  3GRU A;  1IBK M;  2XGN A;  2R6F A;  5KPR A;  3MMP A;  4LF9 M;  2CHG A;  3SMP A;  2F5Q A;  1QDT A;  3WHL A;  2KW0 A;  3B89 A;  2D7E A;  4WP2 A;  3THG A;  2DI0 A;  4CJ6 A;  3ZH9 B;  1JR3 D;  2ZM6 M;  4UN2 B;  1PJS A;  3L27 A;  2V1U A;  3F92 A;  3FUX A;  3GLG E;  1MJG M;  4JYA M;  1LTM A;  4JI0 M;  2EJS A;  2ERC A;  4R3D A;  3GP1 A;  3PNY A;  2VQF M;  4BLC A;  1E9S A;  2K6B A;  1L1Z A;  2VQE M;  1GVN A;  3GLH E;  3GLH B;  4D82 A;  3HJ8 A;  3TWK A;  3PFI A;  2BJV A;  5H37 D;  1JR3 E;  2HAK A;  4LFA M;  2EKF A;  3KS4 A;  5KPT A;  4B3T M;  1IFY A;  3U6D A;  1D0M A;  2QSF X;  4QNM A;  2LVQ D;  3KS8 A;  1DV0 A;  3K1J A;  1TDH A;  1XMQ M;  1N36 M;  2RRU A;  4LJA A;  3JR4 A;  4JN6 A;  1Q02 A;  4GH9 A;  5BR8 M;  2R18 A;  4DUZ M;  2DXI A;  2R44 A;  3VKH A;  4DV5 M;  4RF0 A;  1J5E M;  5IZ7 D;  3BBZ A;  4KOD A;  2EUC A;  4M9X A;  1TH3 A;  4M9Z A;  2O5R A;  4F1I A;  2YNM D;  2ZTD A;  4NSR A;  2I7P A;  5IWA M;  5LMU M;  2VF8 A;  3B7Q A;  1H6U A;  2MH8 A;  3M6A A;  4NL4 H;  5EQT A;  4IJF A;  1HNW M;  4D81 A;  1QQW A;  3KOX E;  3QYE A;  1NJG A;  2DZN B;  4QHS A;  3Q8G A;  2XZU A;  1N77 A;  3FUV A;  1NVM A;  1GL6 A;  2Y20 A;  2VII A;  3RGS A;  4GIP A;  1RU3 A;  4LJ4 A;  5FLX S;  1Z5C A;  4G4N A;  1PJI A;  3GLI B;  3GLI E;  5EXP A;  2I7N A;  1NY6 A;  1YUB A;  3VK8 A;  2QP9 X;  1X37 A;  2K9D A;  2R46 A;  1UM8 A;  2DWL A;  2GNO A;  3BOS A;  2XFS A;  3D8B A;  2OPF A;  2F5P A;  2DAE A;  3ILK A;  4FCV A;  3RE8 A;  2XZF A;  2D7H A;  1Z6T A;  2G8L A;  2K0B X;  5DYG A;  1V34 A;  1T43 A;  4GEW A;  1R2Z A;  5JI2 E;  3I4Y A;  3GPX A;  2R65 A;  3J7B A;  2Q2E B;  5ITQ A;  1K3W A;  4WUR A;  1OKS A;  3U6O A;  4M9S A;  3LCV B;  1XB2 B;  1VG5 A;  2CFO A;  4P17 A;  4Z6Y A;  1GL7 A;  1GJS A;  1MN3 A;  1NV8 A;  2M60 A;  3SAS A;  3VDU A;  4B3R M;  2ZBK B;  2MJ5 B;  2O01 F;  3HKP A;  2KZU A;  1T6O A;  4FWD A;  3FKE A;  2LHC A;  4AG6 A;  1PRB A;  2JUJ A;  4FCW A;  4OW0 A;  2JA2 A;  4YHH M;  4DV2 M;  4B7G A;  1L1T A;  1YLA A;  4JV5 M;  2BJW A;  1LV7 A;  1T3T A;  2XEP A;  4I8O A;  2NQ8 C;  4IBJ A;  4JI1 M;  5FTK A;  4NC6 A;  1G41 A;  4OX9 M;  3FTF A;  4P16 A;  2JY7 A;  2P5T A;  2V1C A;  2M5Z A;  2X4A A;  3KDS E;  2XSZ A;  2QPA A;  4ITQ A;  1NY5 A;  3QAU A;  2V6Z M;  2DAK A;  3DZD A;  4JI2 M;  2A5Y B;  2RKO A;  1UFZ A;  1OJL A;  5ITU A;  1NNJ A;  3VK7 A;  2RGH A;  4CIS A;  4HLQ A;  2UXB M;  1IXZ A;  1IN6 A;  5ITR A;  2OOB A;  3A46 A;  4LFB M;  2MR9 A;  2O25 A;  2EKK A;  2CV1 A;  4RKU F;  3W0F A;  3B9P A;  1Q39 A;  3LQR A;  1OFI A;  4FCT A;  3FD9 A;  5FTJ A;  3L29 A;  3AKZ A;  5JI3 E;  1WGL A;  4MGI E;  1NV9 A;  5KQD A;  1J7K A;  4GC5 A;  1N32 M;  4LJ8 A;  1YSY A;  3U6Q A;  1N33 M;  2GQF A;  4B3M M;  2L4E A;  2B3T A;  3W67 A;  3HHX A;  4GIT A;  3U5Z A;  5E26 A;  1TR8 A;  3J27 B;  4RF1 A;  4X65 M;  4AQY M;  1L2C A;  1EE8 A;  1I94 M;  3HJQ A;  3KP0 E;  1L8Q A;  3L25 A;  1E94 E;  3K8Z A;  4IBC A;  2KNZ A;  4L8R C;  5ITX A;  3GQ5 A;  4DV6 M;  5IT9 S;  4YY3 M;  2DAM A;  3LVV A;  3EIH A;  3R8F A;  2L6O A;  2JY8 A;  5EP1 A;  4IIW A;  2FE8 A;  4LF4 M;  3GRV A;  3HY5 A;  2AHM A;  2WZJ A;  3GPP A;  1OAO C;  2DWN A;  2LHG A;  3U6L A;  2Z8Y M;  3KOW E;  4DV0 M;  1XWI A;  4A3V B;  4AZF A;  4FVM A;  2EO2 A;  1AIP C;  4IBF A;  3A98 B;  3U60 A;  1IY1 A;  3DFZ A;  3B74 A;  3UJN A;  1SXJ C;  2KDL A;  3M0E A;  7CAT A;  1NO1 A;  2XFT A;  1C7Y A;  3ZQJ A;  1SG9 A;  2DZO B;  2J7O A;  3SHG B;  3KFU G;  2WSE F;  3AFH A;  1K3X A;  4JI8 M;  3J7A S;  1IQP A;  1PJT A;  4GKJ M;  3AL0 C;  1WIV A;  2FOI C;  3U60 B;  3SAT A;  3RGP A;  3GRY A;  1FNN A;  2W82 A;  2HCB A;  2C9C A;  3SHF A;  1QDR A;  3SAR A;  2XF3 A;  3U6M A;  4OU7 A;  1OFH A;  1TH2 A;  1E32 A;  2JY5 A;  2N35 A;  4QHT A;  5GKN A;  2VF7 A;  3J81 S;  2JNH A;  1Y8G A;  3T38 A;  2DNA A;  4LF7 M;  1IBM M;  2FS1 A;  1QAN A;  3Q8X A;  4QNR A;  1KSF X;  4II7 A;  1N78 A;  4G4Q A;  4KT0 F;  1R5L A;  1NSF A;  2Z7J A;  2KRK A;  3MK6 A;  3L2A A;  2C99 A;  1PGY A;  2Z4S A;  2CEA A;  4MGZ E;  4AG5 A;  1HT2 E;  1SXJ A;  4AKI A;  1QVR A;  2JY6 B;  3ZCB B;  3GPY A;  3IEC A;  4PCZ A;  3CF2 A;  3FE3 A;  2L4F A;  3E4R A;  3FUW A;  4L6V 6;  3KSJ A;  2QNJ A;  2BNK A;  3GLF A;  4BBA A;  2DHR A;  4Q7J A;  4LCB A;  3FUT A;  2KRU A;  2L7I A;  4KLN A;  3AOE C;  2DAG A;  3TE6 A;  2Z3X A;  1QUS A;  4I81 A;  3J80 S;  4BB9 A;  3I04 M;  1SXJ B;  4LJ6 A;  2LVO C;  5EJC A;  4NXM M;  1NNU C;  1N75 A;  3W68 A;  4AI6 A;  5KPZ A;  1Z59 A;  2WSC F;  2FH0 A;  4M0W A;  1VQ1 A;  1ZAE A;  3IHP A;  4KO8 A;  1PJQ A;  3K9O A;  4MH0 E;  5EXS A;  4LRT A;  3DOA A;  4R71 A;  3GLF B;  1ZMW A;  1YE9 A;  4ANR A;  1GO5 A;  3A42 A;  1OIP A;  2HHH M;  2R0I A;  3KW6 A;  2XLJ A;  4MGY E;  4LGY A;  2LXE A;  1EFU B;  3FTD A;  4MGK E;  2HWJ A;  1R4G A;  2R62 A;  3NBX X;  4G6Z A;  4PT5 A;  4XGI A;  5DYI A;  1OIZ A;  2L7H A;  4GKK M;  2KA6 B;  4I5S A;  4XK8 F;  4DV3 M;  3D8L A;  2CV2 A;  1ZMU A;  4IBD A;  3GRR A;  1R6B X;  3L28 A;  1IN8 A;  2F4V M;  1AUA A;  4LJ9 A;  1QAM A;  1IXR C;  2EA0 A;  3AJI B;  1QZM A;  1QAO A;  1GAB A;  3KVW A;  3W0L B;  4NOO B;  3U6C A;  1HQY E;  4WW0 A;  3NWL A;  2BWB A;  4M0D A;  1FJG M;  1OQY A;  3AOE A;  2JWS A;  3T15 A;  2XSZ D;  4NRV A;  4PDI A;  1XMO M;  2ZAO A;  4GMQ A;  1BVS A;  3GO8 A;  1Z5A A;  1E9R A;  3AOG A;  3MHV C;  4CGY B;  4JI4 M;  4NRW A;  3EIE A;  3HWS A;  4X62 M;  2YFQ A;  1G3I A;  2DAI A;  3C3E A;  3LVW A;  4G3O A;  3JR5 A;  4GC9 A;  2HL7 A;  3LQQ A;  1MX0 A;  2E5L M;  1TF0 B;  3KOZ E;  3U61 A;  1DGG A;  1G4A E;  4LJ7 A;  2J7N A;  2K47 A;  2R4E A;  2QEN A;  3AV0 A;  3TQS A;  4MGH A;  2APL A;  4X66 M;  2MRO B;  2OO9 A;  4FW9 A;  3SAW A;  1EIJ A;  1ZV1 A;  1R7R A;  1XXH A;  3DA1 A;  1HNX M;  4PDG A;  3FTC A;  3RFW A;  2UXD M;  2J5Y A;  1GKI A;  1Q3C A;  2DHY A;  3B7Z A;  3SAV A;  4LRS A;  5C1B A;  1J09 A;  1VDD A;  1W5S A;  2JXN A;  1PM5 A;  3VLF B;  3SYK A;  3L26 A;  3FYC A;  3HJS A;  3K9P A;  1L2B A;  2LBC A;  4Z8X A;  3T1H M;  2DWM A;  3UMM A;  1XXH B;  3FUU A;  4AW4 A;  3I51 A;  5EXX A;  2F5O A;  2UU9 M;  1QAQ A;  2KHH A;  2DEN A;  3TL4 X;  3U5Z B;  3CGW A;  2MGW A;  1XNQ M;  2ZAN A;  4AKG A;  5E6J A;  1IM2 A;  2R4J A;  4REZ A;  1NHW C;  1QUT A;  3ZC7 B;  1MU5 A;  4LG2 A;  3FRI A;  3CF6 E;  2OQ4 A;  2G5G X;  3IG5 A;  5ITX E;  1GLN A;  3SMS A;  4PD2 A;  3FTE A;  2KNV A;  2H5X A;  3QWL A;  1GJT A;  1DO0 A;  1S3S A;  2CE7 A;  2DWZ B;  4HL4 A;  5C18 A;  5L8R F;  2CWB A;  1DGB A;  2CUZ A;  3GLG A;  3SBJ A;  3T1Y M;  1TDZ A;  3IG8 A;  2Y0T A;  4DBG B;  2BWE A;  2QZ4 A;  3K92 A;  3H4J A;  3CTW B;  3U6P A;  1QZE A;  1TH4 A;  3GLH A;  5A2Q S;  1N34 M;  2ZTC A;  2JZ0 A;  2OOA A;  1JR3 A;  4QOZ C;  5ITY A;  4DV1 M;  4GRI A;  2UUC M;  3GLG B;  3UGJ A;  3HU3 A;  2LNH C;  4LF5 M;  1V33 A;  3BXW A;  2Z4R A;  1WR1 B;  2WSF F;  2L09 A;  5DNY A;  2R45 A;  3A45 A;  1D2N A;  1R2Y A;  1OAI A;  1L2D A;  2X8A A;  3V76 A;  4IBB A;  4DR1 M;  4LF6 M;  4JXJ A;  3HHW A;  3LW5 F;  4S12 A;  1K82 A;  4LFC M;  4B7F A;  1V92 A;  4OVZ A;  4ZPX A;  5EP3 A;  3SAU A;  1SXJ D;  2HKJ A;  2UUA M;  2C96 A;  1DO2 A;  4LJ5 A;  5FSW A;  2C98 A;  3J2P B;  1XC8 A;  3C9P A;  4NSO B;  3HHZ A;  4JI7 M;  3VKG A;  2L2D A;  2UXC M;  3UZU A;  2LVP C;  4QOS A;  4LZZ A;  1TGU A;  3HZJ A;  4D80 A;  4F2L A;  1HJP A;  8CAT A;  1W5T A;  3NBI A;  4AKH A;  3HHY A;  5EP2 A;  2CV0 A;  2LVA A;  1NHG C;  1CUK A;  3I4V A;  3E46 A;  2F5S A;  3OTO M;  1G59 A;  4OVZ B;  2DZL A;  5BPV A;  1SXJ E;  5LMN M;  1JB0 F;  2JZ1 A;  1IY0 A;  2UUB M;  4LGM A;  1HR0 M;  3GLI A;  2LVN C;  3SFZ A;  4L78 A;  4X64 M;  4GHL A;  3M7G A;  1F4I A;  3GLF E;  1KYI A;  1WHC A;  2DKL A;  3VDP A;  4EIW A;  5DFL A;  2YQZ A;  1D0K A;  1WXQ A;  1IN7 A;  1WGN A;  1IXS A;  3E21 A;  4JI5 M;  2YR0 A;  4FD2 A;  3TWM A;  2LTU A;  1IY2 A;  4G4O A;  4DV4 M;  3TWL A;  3B7N A;  5ITT A;  1VEK A;  1KFV A;  5FTN A;  4JI3 M;  3U6S A;  2DVW B;  4B7H A;  2RGO A;  1ORY B;  3E9S A;  3UK6 A;  3VFD A;  4CIZ A;  5KO3 A;  4R7G A;  1VEJ A;  4IBE A;  1JQJ C;  3PXG A;  1IXS B;  1HQC A;  2CRU A;  2XH9 A;  4RNA A;  5EXT A;  2G3Q A;  2Y21 A; 
#chains in the Genus database with same CATH homology
 3GQ3 A;  2C9O A;  3CF0 A;  3GQ4 A;  1G8P A;  3HGI A;  4MM3 B;  4IJE A;  4DR5 M;  1HNZ M;  4TUW A;  2ZAM A;  4GHA A;  3MJ5 A;  2KEB A;  4B08 A;  4LF8 M;  2H1R A;  1I4W A;  4L16 A;  4IBI A;  1NJF A;  1IN4 A;  4FWH A;  4W5W A;  1Q3B A;  4CHT B;  2KZS A;  4L4U A;  1C1K A;  1DGH A;  1IN5 A;  4MB7 A;  2Y0Q A;  2FFJ A;  4FWG A;  4LZJ A;  2LH0 A;  4KHP M;  5KQ8 A;  3K2L A;  3KXE C;  3U61 B;  3KP1 E;  2FNA A;  1IBL M;  4B3S M;  1Z5B A;  1DGH B;  4DR7 M;  1HT1 E;  2D7G A;  4DR2 M;  2QBY A;  5EP4 A;  3JAM S;  1XNR M;  3LMM A;  2F5N A;  4XBO A;  4G4R A;  4DR4 M;  4NXN M;  2CHQ A;  1XHB A;  3C58 A;  4DUY M;  4DV7 M;  2CHV A;  4LY6 A;  3SC3 A;  2LWX A;  4I4L A;  5FTM A;  2X49 A;  4JI6 M;  4K0K M;  2QCU A;  5FTL A;  4DR6 M;  1DGF A;  5F3W A;  3PNV A;  4DR3 M;  3KSX A;  3U6E A;  2QBY B;  3GPU A;  2KXE A;  5IRE B;  1ZQ9 A;  1QYR A;  3HU1 A;  3HU2 A;  4IBK A;  3SYL A;  1PJJ A;  4IBG A;  2C5R A;  3FYD A;  3WHK A;  3R9X B;  3KOY E;  3PVS A;  3H4M A;  4L15 A;  3TPZ A;  3GRU A;  1IBK M;  2XGN A;  5KPR A;  4LF9 M;  2CHG A;  3SMP A;  2F5Q A;  3WHL A;  2KW0 A;  3THG A;  2D7E A;  3ZH9 B;  1JR3 D;  2ZM6 M;  3L27 A;  2V1U A;  3FUX A;  4JYA M;  4JI0 M;  2ERC A;  4R3D A;  3GP1 A;  3PNY A;  2VQF M;  4BLC A;  1E9S A;  1L1Z A;  2VQE M;  1GVN A;  3GLH B;  4D82 A;  3HJ8 A;  3TWK A;  3PFI A;  2BJV A;  5H37 D;  4LFA M;  3KS4 A;  5KPT A;  4B3T M;  3U6D A;  4QNM A;  3KS8 A;  3K1J A;  1TDH A;  1XMQ M;  1N36 M;  4LJA A;  3JR4 A;  4JN6 A;  4GH9 A;  5BR8 M;  2R18 A;  4DUZ M;  2DXI A;  3VKH A;  4DV5 M;  4RF0 A;  1J5E M;  5IZ7 D;  4KOD A;  2EUC A;  4M9X A;  1TH3 A;  4M9Z A;  2O5R A;  2YNM D;  4NSR A;  2I7P A;  5IWA M;  5LMU M;  1H6U A;  3M6A A;  4NL4 H;  5EQT A;  4IJF A;  1HNW M;  4D81 A;  1QQW A;  3KOX E;  1NJG A;  2DZN B;  4QHS A;  2XZU A;  1N77 A;  3FUV A;  1NVM A;  1GL6 A;  2Y20 A;  2VII A;  3RGS A;  4GIP A;  4LJ4 A;  5FLX S;  1Z5C A;  4G4N A;  1PJI A;  3GLI B;  5EXP A;  2I7N A;  1NY6 A;  1YUB A;  3VK8 A;  2QP9 X;  1X37 A;  2R46 A;  1UM8 A;  2DWL A;  3D8B A;  3BOS A;  2XFS A;  2OPF A;  2F5P A;  3ILK A;  4FCV A;  3RE8 A;  2XZF A;  2D7H A;  1Z6T A;  2G8L A;  5DYG A;  1R2Z A;  5JI2 E;  3I4Y A;  3GPX A;  2R65 A;  3J7B A;  2Q2E B;  5ITQ A;  1K3W A;  4WUR A;  3U6O A;  4M9S A;  2CFO A;  4Z6Y A;  1GL7 A;  2M60 A;  3SAS A;  3VDU A;  4B3R M;  2ZBK B;  3HKP A;  4FWD A;  2KZU A;  3FKE A;  4AG6 A;  4OW0 A;  4YHH M;  4FCW A;  4DV2 M;  2JA2 A;  1L1T A;  4JV5 M;  4B7G A;  2BJW A;  1LV7 A;  1T3T A;  2XEP A;  4I8O A;  2NQ8 C;  4IBJ A;  4JI1 M;  5FTK A;  1G41 A;  4OX9 M;  3FTF A;  4P16 A;  2P5T A;  2V1C A;  2M5Z A;  2X4A A;  3KDS E;  2XSZ A;  2QPA A;  4ITQ A;  1NY5 A;  3QAU A;  2V6Z M;  3DZD A;  4JI2 M;  2A5Y B;  2RKO A;  1OJL A;  5ITU A;  1NNJ A;  3VK7 A;  2RGH A;  4CIS A;  4HLQ A;  2UXB M;  1IXZ A;  1IN6 A;  5ITR A;  3A46 A;  4LFB M;  2CV1 A;  3W0F A;  3B9P A;  1Q39 A;  3LQR A;  1OFI A;  4FCT A;  3FD9 A;  5FTJ A;  3L29 A;  3AKZ A;  5JI3 E;  4MGI E;  5KQD A;  1J7K A;  4GC5 A;  1N32 M;  4LJ8 A;  1YSY A;  3U6Q A;  1N33 M;  4B3M M;  3HHX A;  4GIT A;  3U5Z A;  5E26 A;  3J27 B;  4RF1 A;  4X65 M;  4AQY M;  1L2C A;  1EE8 A;  1I94 M;  3HJQ A;  3KP0 E;  1L8Q A;  3L25 A;  1E94 E;  3K8Z A;  4IBC A;  4L8R C;  5ITX A;  3GQ5 A;  4DV6 M;  5IT9 S;  4YY3 M;  3LVV A;  3EIH A;  3R8F A;  2L6O A;  5EP1 A;  4IIW A;  2FE8 A;  4LF4 M;  3GRV A;  2AHM A;  3GPP A;  2DWN A;  3U6L A;  3KOW E;  4DV0 M;  1XWI A;  4A3V B;  4AZF A;  4FVM A;  2EO2 A;  4IBF A;  3A98 B;  3U60 A;  1IY1 A;  3DFZ A;  3UJN A;  1SXJ C;  7CAT A;  3M0E A;  2XFT A;  2J7O A;  2DZO B;  3SHG B;  3KFU G;  3AFH A;  1K3X A;  4JI8 M;  3J7A S;  1IQP A;  4GKJ M;  3AL0 C;  3U60 B;  2FOI C;  3SAT A;  3RGP A;  3GRY A;  1FNN A;  2W82 A;  2HCB A;  2C9C A;  3SHF A;  3SAR A;  2XF3 A;  3U6M A;  4OU7 A;  1OFH A;  1TH2 A;  1E32 A;  4QHT A;  5GKN A;  3J81 S;  3T38 A;  4LF7 M;  1IBM M;  3Q8X A;  1QAN A;  4QNR A;  1KSF X;  4II7 A;  1N78 A;  4G4Q A;  1NSF A;  2Z7J A;  2KRK A;  3MK6 A;  3L2A A;  2C99 A;  2Z4S A;  2CEA A;  4MGZ E;  4AG5 A;  1HT2 E;  1SXJ A;  4AKI A;  1QVR A;  3ZCB B;  3GPY A;  4PCZ A;  3CF2 A;  3E4R A;  3FUW A;  3KSJ A;  2BNK A;  3GLF A;  4BBA A;  2DHR A;  4LCB A;  3FUT A;  2KRU A;  2L7I A;  4KLN A;  3AOE C;  3TE6 A;  2Z3X A;  4I81 A;  3J80 S;  4BB9 A;  1SXJ B;  4LJ6 A;  5EJC A;  4NXM M;  1NNU C;  1N75 A;  4AI6 A;  5KPZ A;  1Z59 A;  4MH0 E;  4M0W A;  1ZAE A;  4KO8 A;  5EXS A;  4LRT A;  3DOA A;  3GLF B;  1YE9 A;  3A42 A;  2HHH M;  2XLJ A;  3KW6 A;  4MGY E;  4LGY A;  2LXE A;  3FTD A;  4MGK E;  2R62 A;  4G6Z A;  4XGI A;  4PT5 A;  5DYI A;  4GKK M;  2L7H A;  2KA6 B;  4I5S A;  4DV3 M;  3D8L A;  2CV2 A;  4IBD A;  3GRR A;  1R6B X;  3L28 A;  1IN8 A;  2F4V M;  4LJ9 A;  1QAM A;  1IXR C;  2EA0 A;  3AJI B;  1QZM A;  1QAO A;  3KVW A;  3W0L B;  4NOO B;  3U6C A;  1HQY E;  4WW0 A;  3NWL A;  1FJG M;  4M0D A;  3AOE A;  3T15 A;  4PDI A;  1XMO M;  2XSZ D;  4NRV A;  2ZAO A;  4GMQ A;  3GO8 A;  1Z5A A;  1E9R A;  3AOG A;  3MHV C;  4CGY B;  4JI4 M;  4NRW A;  3EIE A;  3HWS A;  4X62 M;  2YFQ A;  1G3I A;  3JR5 A;  3LVW A;  4GC9 A;  2HL7 A;  3LQQ A;  1MX0 A;  2E5L M;  3KOZ E;  3U61 A;  1DGG A;  1G4A E;  4LJ7 A;  2J7N A;  2K47 A;  2R4E A;  2QEN A;  3AV0 A;  3TQS A;  4MGH A;  4X66 M;  4FW9 A;  3SAW A;  1R7R A;  1XXH A;  3DA1 A;  1HNX M;  4PDG A;  3FTC A;  3RFW A;  2UXD M;  1GKI A;  1Q3C A;  3SAV A;  4LRS A;  5C1B A;  1J09 A;  1VDD A;  1W5S A;  1PM5 A;  3VLF B;  3SYK A;  3L26 A;  3FYC A;  3HJS A;  1L2B A;  4Z8X A;  3T1H M;  2DWM A;  3UMM A;  1XXH B;  3FUU A;  4AW4 A;  3I51 A;  5EXX A;  2F5O A;  2UU9 M;  1QAQ A;  3TL4 X;  3U5Z B;  4AKG A;  1XNQ M;  2ZAN A;  5E6J A;  1IM2 A;  2R4J A;  4REZ A;  1NHW C;  3ZC7 B;  1MU5 A;  4LG2 A;  3CF6 E;  2OQ4 A;  2G5G X;  3IG5 A;  5ITX E;  1GLN A;  3SMS A;  4PD2 A;  3FTE A;  3QWL A;  1S3S A;  1DO0 A;  2CE7 A;  2DWZ B;  4HL4 A;  5C18 A;  1DGB A;  2CUZ A;  3GLG A;  3SBJ A;  3T1Y M;  1TDZ A;  3IG8 A;  2Y0T A;  2QZ4 A;  3K92 A;  3CTW B;  3U6P A;  1TH4 A;  3GLH A;  5A2Q S;  1N34 M;  1JR3 A;  4QOZ C;  5ITY A;  4DV1 M;  4GRI A;  2UUC M;  3GLG B;  3UGJ A;  3HU3 A;  2LNH C;  4LF5 M;  2Z4R A;  5DNY A;  2L09 A;  2R45 A;  3A45 A;  1D2N A;  1R2Y A;  1L2D A;  2X8A A;  4IBB A;  4DR1 M;  4LF6 M;  4JXJ A;  3HHW A;  4S12 A;  1K82 A;  4LFC M;  4B7F A;  4OVZ A;  4ZPX A;  5EP3 A;  3SAU A;  1SXJ D;  2HKJ A;  2UUA M;  2C96 A;  1DO2 A;  4LJ5 A;  5FSW A;  2C98 A;  3J2P B;  1XC8 A;  4NSO B;  3HHZ A;  4JI7 M;  3VKG A;  2UXC M;  3UZU A;  4QOS A;  4LZZ A;  1TGU A;  4D80 A;  8CAT A;  4AKH A;  1W5T A;  3NBI A;  3HHY A;  5EP2 A;  2CV0 A;  1NHG C;  3I4V A;  2F5S A;  3OTO M;  1G59 A;  4OVZ B;  5BPV A;  1SXJ E;  5LMN M;  1IY0 A;  2UUB M;  4LGM A;  1HR0 M;  3GLI A;  3SFZ A;  4L78 A;  4X64 M;  4GHL A;  3M7G A;  1KYI A;  3VDP A;  4EIW A;  2YQZ A;  1WXQ A;  1IN7 A;  4JI5 M;  2YR0 A;  4FD2 A;  3TWM A;  1IY2 A;  4G4O A;  4DV4 M;  3TWL A;  5ITT A;  1KFV A;  5FTN A;  4JI3 M;  3U6S A;  2DVW B;  4B7H A;  2RGO A;  1ORY B;  3E9S A;  3UK6 A;  3VFD A;  5KO3 A;  4R7G A;  4IBE A;  3PXG A;  1JQJ C;  1IXS B;  1HQC A;  2XH9 A;  4RNA A;  5EXT A;  2Y21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...