4DR4M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr4M02
4JYAM 2F5SA 4B3MM 5A2QS 2XZFA 3A46A 4LF6M 1Z5AA 5ITTA 4X62M 4MB7A 2OPFA 5LMNM 4X64M 3T1YM 4JI5M 3GQ4A 4DR1M 3U6PA 1J5EM 2UXDM 4LF5M 2HKJA 3OTOM 2VQEM 5IWAM 4PDIA 4G4RA 1I94M 2UU9M 1HNWM 2F4VM 4K0KM 1MU5A 1PJIA 2UXBM 5ITQA 2UUBM 5ITUA 1L2DA 4LF7M 2F5OA 1XNQM 2E5LM 3SASA 5ITXE 4G4OA 4DR2M 4ITQA 3W0FA 1N36M 2EA0A 3GP1A 4GKKM 4B3SM 4DR5M 1PM5A 4DR3M 4DV6M 4X65M 3SBJA 1HR0M 3JR4A 4DV1M 5BR8M 4B3RM 2UXCM 3TWKA 4YY3M 1K82A 1L1ZA 1L2BA 4DR6M 1N33M 5ITYA 2HHHM 3U6CA 5IT9S 4OX9M 4NXMM 3U6QA 4DV3M 1HNZM 3SAVA 1L2CA 3J81S 3VK8A 1HNXM 4KHPM 2ZM6M 3U6LA 4PD2A 3J80S 4DV5M 1R2YA 1Z5BA 3U6DA 4LFAM 1TDHA 1XMOM 1Q3BA 4CISA 2F5PA 1Z5CA 1IBKM 4LF9M 1FJGM 1R2ZA 4X66M 3SAUA 1XC8A 4JI4M 3T1HM 5ITRA 1Q39A 5LMUM 2ZBKB 3U6SA 3DOAA 4B3TM 3JR5A 4YHHM 4DUYM 4DUZM 3GPXA 1XMQM 3VK7A 3GPPA 4DV7M 1K3XA 2F5NA 3C58A 4JV5M 2Q2EB 4LFCM 4DV0M 1KFVA 2XZUA 4JI1M 5ITXA 3TWMA 4AQYM 4G4QA 4DR4M 3JAMS 3GPYA 1N32M 1XNRM 4NRWA 3J7AS 4JI3M 4NRVA 4G4NA 4JI7M 4GKJM 2UUCM 4DR7M 1L1TA 3GO8A 1MX0A 4JI0M 3U6MA 1Z59A 4PDGA 3GQ5A 4LF4M 4JI2M 3GQ3A 1Q3CA 3SATA 5FLXS 1EE8A 2VQFM 3U6OA 1NNJA 4LF8M 3GPUA 2F5QA 3U6EA 1TDZA 3A45A 4JI8M 4DV2M 3A42A 2OQ4A 4DV4M 4PCZA 1K3WA 2UUAM 4NXNM 1PJJA 4LFBM 3SAWA 3SARA 3TWLA 1IBLM 1IBMM 1N34M 4JI6M
chains in the Genus database with same CATH superfamily
3HHWA 4JYAM 2RGHA 1NNUC 2HWJA 4LRSA 5A2QS 1NV8A 3UZUA 2LWXA 1OKSA 1Z5AA 3L28A 4X62M 4MB7A 2OPFA 4X64M 3B74A 3GLGA 1QVRA 4NL4H 3T1YM 3GLIB 2MJ5B 2I7NA 3WHLA 2LVPC 3U6PA 2UXDM 1TH3A 4LF5M 3HKPA 2HKJA 5FTMA 3FRHA 3OTOM 1MN3A 1GVNA 2A5YB 3B7NA 2JP7A 4K0KM 2DI0A 1MU5A 2K47A 2L4EA 2D7HA 4RF1A 4I5SA 4FVMA 4WP2A 3GLIE 1LV7A 3U5ZA 2UUBM 1L2DA 1E32A 2XF3A 3KDSE 2YFQA 4KODA 3FUVA 4G4OA 4IBCA 4GKKM 1FNNA 3HX3A 1WR1B 1PM5A 2CP8A 5JI3E 4DV6M 2LHGA 3KSXA 4OVZB 3CF2A 3CF6E 3U61A 3M7GA 2WSCF 4LGMA 4LJ5A 1IN5A 1QDTA 3PFIA 4L78A 1QAQA 3IG8A 4CIZA 1JB0F 2YQZA 3H4MA 3TWKA 3GRVA 1MJGM 3CTWB 2WSEF 2WSFF 1L1ZA 3VDPA 3W68A 4JN6A 5EQTA 1HT1E 5E26A 5IT9S 2L7IA 4MGHA 1DV0A 3RFWA 4B7HA 1WIVA 3AKZA 2C96A 2ZAOA 1JR3D 1R2YA 1Z5BA 5KQDA 2LVAA 1IM2A 1TDHA 1Q3BA 1XMOM 3AL0C 4LCBA 3M0EA 2JNHA 1HQCA 4P17A 4HL4A 3SYKA 1XC8A 3T1HM 2R46A 3I4YA 3GLGE 2DNAA 2ZBKB 4M9XA 3U6SA 2VIIA 4L4UA 2QHOB 4GIPA 1SXJA 4GRIA 3JR5A 3KS8A 1IFYA 3GPXA 2J5YA 1E9SA 3VK7A 4LJ7A 2JXNA 1DGHB 4S12A 1K3XA 3K9PA 3VKGA 1X37A 2Q2EB 1SXJC 4LZZA 2I7PA 2XZUA 3SYLA 2H5XA 1IN8A 5ITXA 2DHYA 3QAUA 4IBBA 3GLFA 2XGNA 3JAMS 1VEJA 3GPYA 3D8BA 1N32M 4B08A 2Z8YM 4LJ4A 3SMSA 2BJWA 2DAIA 4FWHA 3LCUA 4RNAA 1IN4A 2H1RA 4DR7M 1L1TA 3VLFB 4IBJA 3PVSA 3GO8A 1N78A 2FFJA 4JI0M 1QAOA 3ZCBB 5DNYA 4PDGA 2DZLA 2CHQA 3GQ5A 1Q3CA 4GHLA 1G8PA 1XWIA 2KW0A 1L8QA 5KPRA 1S3SA 2UUAM 3DZDA 3LVVA 4WW0A 3UJNA 3FUTA 5DYIA 2B3TA 4Z8XA 4LFBM 4M0WA 4KO8A 4B7GA 1PJTA 2EUCA 3F92A 4A3VB 4GH9A 4W5WA 1QUTA 2VF8A 4B3MM 2DWNA 2R0IA 1H6UA 2LXEA 2DVWB 2HL7A 3GLHA 3Q8GA 4JXJA 4KLNA 4R7GA 1V92A 5ITTA 5LMNM 3HU2A 3TL4X 4JI5M 4II7A 4AG5A 1OIPA 1SG9A 4Q7JA 4MM3B 3FTFA 3Q8XA 4PDIA 2Y21A 3KSJA 4GHAA 4IBDA 5FTNA 1SXJD 1WGLA 3GRUA 3MK6A 4OVZA 4QHTA 1HNWM 2L7HA 4GMQA 5C1BA 2D7EA 5EXTA 3KXEC 4LF7M 1IXRC 3SMPA 2VDBB 5EXSA 2HAKA 4IBEA 3NBIA 5ITXE 2JZ0A 3QYBA 3GP1A 3B89A 4EIWA 3KOWE 4DR5M 4B3SM 2CHVA 4X65M 2WZJA 3FTCA 2J7NA 3HZJA 4R3DA 1QYRA 1J09A 1IQPA 2R4JA 2LBCA 1GL6A 2JY8A 1EIJA 1R4GA 1WHCA 1DO2A 2CWBA 1W5SA 4DV1M 5BR8M 5F3WA 2R45A 1G4AE 1K82A 1L2BA 2DAKA 5ITYA 2HHHM 3U6CA 4AZFA 3HJSA 4NXMM 3ZQJA 3U6QA 4DV3M 2V1CA 3UK6A 3VK8A 1R5LA 2QNJA 3GLHB 3CGWA 3J80S 4AKIA 2LNHC 3U6DA 2NQ8C 3J7BA 2JA2A 2C9CA 2CV2A 1XXHB 4OW0A 4HEOA 1DGHA 4TUWA 1IXZA 1TR8A 4M9SA 3AV0A 4LY6A 1NO1A 3IHPA 5EXPA 3GRRA 3GLHE 2KNZA 3W67A 1R2ZA 1G71A 3EIHA 3SAUA 1FJGM 2KHHA 1HT2E 3IECA 3H4JA 4RF0A 5ITRA 1XXHE 5LMUM 2QPAA 3GRYA 3C9PA 3KFUG 3SHGB 1I4WA 2DWZB 4IJFA 2FS1A 4B3TM 3HGIA 1QUSA 2GQFA 4QNMA 4YHHM 2XSZA 3AJIB 1WGNA 4DUYM 5IREB 4DUZM 1DO0A 1CUKA 4NC6A 4DV7M 2QBYA 2L4FA 4LFCM 2N35A 4DV0M 2R65A 3B7ZA 3T38A 1J7KA 2FNAA 4DR4M 3NBXX 3FUWA 4MGYE 2AHMA 2Z7JA 3KP0E 2CFOA 3KW6A 3PNVA 3R9XB 1VDLA 4G4NA 4JI7M 3LQQA 4KT0F 4FCTA 1QQWA 1G3IA 4LGYA 3DA1A 2ZTCA 4R71A 3U6MA 3MMPA 1Q02A 1ZMVA 1NHWC 2LH0A 2YNMD 4LF4M 1V33A 2EKFA 1EE8A 3U6OA 2QQ8A 1NNJA 4Z6YA 3GPUA 3FTDA 3A45A 4BLCA 5JI2E 4DV2M 3A42A 4FD2A 4QHSA 4PCZA 1UM8A 4CJ6A 4NXNM 4L8RC 2KZSA 1NY6A 4IBKA 2FH0A 3SAWA 2R4EA 3I04M 3R8FA 1GJSA 4MGKE 1VEGA 1DGFA 4MGIE 4JI6M 4AKGA 1NJGA 1LTMA 1WXQA 3C3EA 3K2LA 3QYEA 1WJ7A 3A46A 2DENA 1NJFA 5KPTA 5FTJA 2CV1A 2DHRA 2QBYB 3A98B 3FUXA 1Y8GA 4M9ZA 3C3DA 3TPZA 1UFZA 3GQ4A 3RE8A 1NY5A 4GC9A 4L16A 4UN2B 4G4RA 1I94M 2O5RA 2XSZD 2Y20A 1PJIA 1ZV1A 4GITA 4RKUF 1IXSB 3L27A 5ITUA 2C5RA 1XNQM 2E5LM 3I01M 3HWSA 1TGUA 5KPZA 3SASA 2DWMA 4ITQA 3AOGA 4XBOA 1N36M 3SC3A 1ZMUA 3ILKA 1OAOC 4DR3M 2ERCA 1XHBA 2QP9X 3I51A 3NWLA 2DZNB 4IBIA 4ZPXA 1T6OA 3SBJA 2DWLA 4G3OA 1D0MA 3TE6A 2DKLA 1VQ1A 1N75A 3EIEA 3I4VA 4LRTA 5EP1A 1A5TA 1XXHA 3JR4A 2BWBA 2KNVA 2LVOC 2XFTA 2OOAA 5BPVA 4YY3M 2UXCM 3KOZE 4DR6M 2LHCA 1TTEA 3FKEA 4OX9M 2MH8A 1OFHA 1D0KA 3SAVA 1L2CA 3J81S 1G59A 1HNXM 4KHPM 1EFUB 1NHGC 1KYIA 3E4RA 3FUUA 3L29A 2ZM6M 3U6LA 4DV5M 4LFAM 1P3QQ 1TH2A 3FYCA 2MR9A 2F5PA 5FSWA 1Z5CA 1ZAEA 4LF9M 3MHVC 3J2PB 3FTEA 2QSFX 2K6BA 2RGOA 3HY5A 3VDUA 5FTLA 4JI4M 3KOYE 2R6FA 3HJQA 4XK8F 3U60B 4NSRA 2L2DA 3FE3A 3CF0A 3DOAA 4I8OA 1VEKA 2DXIA 2DZOB 1IY0A 2KDLA 4HLQA 3RGSA 3T15A 1E9RA 4Y28F 1JR3A 1TH4A 1PRBA 1T43A 1HQYE 3QWLA 3BOSA 3C58A 4JV5M 3L25A 3V76A 5H37D 2QCUA 1RU3A 3LCVB 4REZA 1OIZA 4JI1M 4AI6A 4AQYM 5KQ8A 1D0LA 1JQJC 1QAMA 2R62A 4G4QA 4F1IA 4AG6A 3J7AS 3E9SA 2VF7A 3BXWA 4JI3M 3TQSA 2KA6B 5EP2A 1QZEA 2Z3XA 3MJ5A 3K9OA 2FE8A 2Z4SA 2CRUA 4NSOB 1IN6A 4I4LA 4P16A 3GQ3A 3LQRA 2VQFM 2DAGA 3L2AA 2JWSA 2F5QA 1T3TA 2XEPA 4G6ZA 3U6EA 1TDZA 2YR0A 1XB2B 4DV4M 4FCVA 1OAIA 4M0DA 1HJPA 2CEAA 3PXGA 2G5GX 2X4AA 3KS4A 4IBGA 4MGZE 3DFZA 2KEBA 1GL7A 2LVNC 1IBLM 2Y0QA 2JZ1A 1VG5A 4GKJM 1ZQ9A 5IZ7D 2R18A 2UXBM 2F5SA 5DFLA 2KNAA 4DBGB 2XZFA 2BNKA 3HHZA 4IBFA 2C9OA 2CE7A 1IXSA 8CATA 4LF6M 2Z4RA 3HJ8A 3K1JA 3BBZA 1N77A 3E46A 3VKHA 1KSFX 4DR1M 1VDDA 5EXXA 1J5EM 1OTRA 1NSFA 1C1KA 3IG5A 3M6AA 5EP4A 4BB9A 5IWAM 2VQEM 2UU9M 3FYDA 1GKIA 1JR3E 2KRKA 3AOEA 3J27B 2F4VM 1C7YA 3UMMA 1GLNA 4AW4A 1ZMWA 4BBAA 3FD9A 3HU1A 3T6PA 5ITQA 2OOBA 2F5OA 4D80A 1V34A 3GLGB 1OFIA 2QENA 3AOEC 4DR2M 3HHXA 3KVWA 3W0FA 4QOSA 2GNOA 1AUAA 2EA0A 2L09A 4LJ9A 1NVMA 4LJAA 4WURA 1QZMA 1Z6TA 3D8LA 2ZANA 3K92A 1D2NA 1F4IA 1DGGA 2JY5A 2XFSA 3L26A 5EP3A 3U5ZB 3B7QA 1DGBA 1BVSA 2L6OA 2R44A 2ZAMA 1HR0M 3WHKA 1QDRA 4L15A 4B3RM 4LJ6A 2W82A 4CGYB 1YLAA 5DYGA 1N33M 2OO9A 3SHFA 1OQYA 1IN7A 1YE9A 2APLA 2EJSA 5FTKA 3HHYA 3U60A 1HNZM 4GC5A 2RRUA 1W5TA 2V1UA 2G8LA 4IIWA 2KZUA 2XLJA 4LG2A 3U61B 4FWGA 4PD2A 1E94E 3LVWA 2M5ZA 1R7RA 2MGWA 4LZJA 4CHTB 4CISA 2C98A 5GKNA 4QOZC 3UGJA 3E21A 1IBKM 2G3QA 3THGA 4D82A 2KXEA 4X66M 5KO3A 1TF0B 2K0BX 2C99A 1YUBA 1NV9A 1Q39A 1QANA 5C18A 2QZ4A 3SFZA 2J7OA 4NOOB 1ORYB 2O25A 2KRUA 3RGPA 1GO5A 4MH0E 1XMQM 1AIPC 3AFHA 3GPPA 1GABA 2LTUA 2EO2A 2MROB 4L6V6 7CATA 2ZTDA 2DAMA 2X49A 2F5NA 1IY1A 1G41A 3GLIA 4FWDA 1R6BX 1KFVA 2HCBA 3ZC7B 3B9PA 2Y0TA 2CUZA 2EKKA 2V6ZM 1YSYA 4LJ8A 3ZH9B 3TWMA 3LW5F 4B7FA 1SXJB 3VFDA 3FRIA 1XNRM 4FCWA 4NRWA 2JY7A 3K8ZA 5L8RF 4IJEA 2CHGA 4I81A 2CV0A 2K9DA 4NRVA 1IY2A 4GEWA 2UUCM 2RKOA 3HU3A 2XH9A 4PT5A 4QNRA 3KOXE 2FOIC 4F2LA 1PJQA 2P5TA 1MX0A 1SXJE 2O01F 4XGIA 4OU7A 1Z59A 2M60A 4D81A 4JI2M 1PJSA 2JY6B 3GLFB 3SATA 5FLXS 1OJLA 2DAEA 4LF8M 2D7GA 2LVQD 5EJCA 4JI8M 4AKHA 2OQ4A 2JUJA 1K3WA 3W0LB 2BWEA 4FW9A 2BJVA 3PNYA 1PJJA 2X8AA 1GJTA 3KP1E 3GLFE 3SARA 3TWLA 1PGYA 3LMMA 5E6JA 1IBMM 1N34M 4ANRA
chains in the Genus database with same CATH topology
3HHWA 4JYAM 2RGHA 1NNUC 4LRSA 5A2QS 3UZUA 2LWXA 1Z5AA 3L28A 4X62M 4MB7A 2OPFA 4X64M 3GLGA 1QVRA 4NL4H 3T1YM 3GLIB 3WHLA 2I7NA 3U6PA 2UXDM 1TH3A 4LF5M 3HKPA 2HKJA 5FTMA 3OTOM 1GVNA 2A5YB 4K0KM 1MU5A 2K47A 3U5ZA 2D7HA 4RF1A 4I5SA 4FVMA 1LV7A 2UUBM 1L2DA 1E32A 2XF3A 3KDSE 2YFQA 4KODA 3FUVA 4G4OA 4IBCA 4GKKM 1FNNA 1PM5A 5JI3E 4DV6M 3KSXA 4OVZB 3CF2A 3CF6E 3U61A 3M7GA 4LGMA 4LJ5A 1IN5A 3PFIA 4L78A 1QAQA 3IG8A 2YQZA 3H4MA 3TWKA 3GRVA 3CTWB 1L1ZA 3VDPA 4JN6A 5EQTA 1HT1E 5E26A 5IT9S 2L7IA 4MGHA 3RFWA 4B7HA 3AKZA 2C96A 2ZAOA 1JR3D 1R2YA 1Z5BA 5KQDA 1IM2A 1TDHA 1Q3BA 1XMOM 3AL0C 4LCBA 3M0EA 1HQCA 4HL4A 3SYKA 1XC8A 3T1HM 2R46A 3I4YA 2ZBKB 4M9XA 3U6SA 2VIIA 4L4UA 4GIPA 1SXJA 4GRIA 3JR5A 3KS8A 3GPXA 1E9SA 3VK7A 4LJ7A 1DGHB 4S12A 1K3XA 3VKGA 1X37A 2Q2EB 1SXJC 4LZZA 2I7PA 2XZUA 3SYLA 1IN8A 5ITXA 3QAUA 4IBBA 3GLFA 2XGNA 3JAMS 3GPYA 3D8BA 1N32M 4B08A 4LJ4A 3SMSA 2BJWA 4FWHA 4RNAA 1IN4A 2H1RA 4DR7M 1L1TA 3VLFB 4IBJA 3PVSA 3GO8A 1N78A 2FFJA 4JI0M 1QAOA 3ZCBB 5DNYA 4PDGA 2CHQA 3GQ5A 1Q3CA 4GHLA 1G8PA 1XWIA 2KW0A 1L8QA 5KPRA 1S3SA 2UUAM 3DZDA 3LVVA 4WW0A 3UJNA 3FUTA 5DYIA 4Z8XA 4LFBM 4M0WA 4KO8A 4B7GA 2EUCA 4A3VB 4GH9A 4W5WA 4B3MM 2DWNA 1H6UA 2LXEA 2DVWB 2HL7A 3GLHA 4JXJA 4KLNA 4R7GA 5ITTA 5LMNM 3HU2A 3TL4X 4JI5M 4II7A 4AG5A 4MM3B 3FTFA 3Q8XA 4PDIA 2Y21A 3KSJA 4GHAA 4IBDA 5FTNA 1SXJD 3GRUA 3MK6A 4OVZA 4QHTA 1HNWM 2L7HA 4GMQA 5C1BA 2D7EA 5EXTA 3KXEC 4LF7M 1IXRC 3SMPA 5EXSA 4IBEA 3NBIA 5ITXE 3GP1A 4EIWA 3KOWE 4DR5M 4B3SM 2CHVA 4X65M 3FTCA 2J7NA 4R3DA 1QYRA 1J09A 1IQPA 2R4JA 1GL6A 1DO2A 1W5SA 4DV1M 5BR8M 5F3WA 2R45A 1G4AE 1K82A 1L2BA 5ITYA 2HHHM 3U6CA 4AZFA 3HJSA 4NXMM 3U6QA 4DV3M 2V1CA 3UK6A 3VK8A 3GLHB 3J80S 4AKIA 2LNHC 3U6DA 2NQ8C 3J7BA 2JA2A 2C9CA 2CV2A 1XXHB 4OW0A 1DGHA 4TUWA 1IXZA 4M9SA 3AV0A 4LY6A 5EXPA 3GRRA 1FJGM 1R2ZA 3EIHA 3SAUA 1HT2E 4RF0A 5ITRA 5LMUM 2QPAA 3GRYA 3KFUG 3SHGB 1I4WA 2DWZB 4IJFA 4B3TM 3HGIA 4QNMA 4YHHM 2XSZA 3AJIB 4DUYM 4DUZM 5IREB 1DO0A 4DV7M 2QBYA 4LFCM 4DV0M 2R65A 3T38A 1J7KA 2FNAA 4DR4M 4MGYE 3FUWA 2AHMA 2Z7JA 3KP0E 2CFOA 3KW6A 3PNVA 3R9XB 4G4NA 4JI7M 3LQQA 4FCTA 1QQWA 1G3IA 4LGYA 3DA1A 3U6MA 2LH0A 1NHWC 2YNMD 4LF4M 1EE8A 3U6OA 1NNJA 4Z6YA 3GPUA 3FTDA 3A45A 4BLCA 5JI2E 4DV2M 3A42A 4FD2A 4QHSA 4PCZA 1UM8A 4NXNM 4L8RC 2KZSA 1NY6A 4IBKA 3SAWA 2R4EA 3R8FA 4AKGA 4MGKE 1DGFA 4MGIE 4JI6M 1NJGA 3K2LA 1WXQA 3A46A 1NJFA 5KPTA 5FTJA 2CV1A 2DHRA 2QBYB 3A98B 3FUXA 4M9ZA 3TPZA 3GQ4A 3RE8A 1NY5A 4GC9A 4L16A 4G4RA 1I94M 2O5RA 2XSZD 2Y20A 1PJIA 4GITA 1IXSB 3L27A 5ITUA 2C5RA 1XNQM 2E5LM 5KPZA 3HWSA 1TGUA 3SASA 2DWMA 4ITQA 3AOGA 4XBOA 1N36M 3SC3A 3ILKA 4DR3M 2ERCA 1XHBA 2QP9X 3I51A 3NWLA 2DZNB 4IBIA 4ZPXA 3SBJA 2DWLA 3TE6A 3EIEA 1N75A 4LRTA 3I4VA 5EP1A 1XXHA 3JR4A 2XFTA 5BPVA 2UXCM 4YY3M 3KOZE 4DR6M 3FKEA 4OX9M 1OFHA 3SAVA 1L2CA 3J81S 1G59A 1HNXM 4KHPM 1NHGC 3L29A 1KYIA 3E4RA 3FUUA 2ZM6M 3U6LA 4DV5M 4LFAM 1TH2A 3FYCA 2F5PA 5FSWA 1Z5CA 1ZAEA 4LF9M 3MHVC 3J2PB 3FTEA 2RGOA 3VDUA 4JI4M 5FTLA 3KOYE 3HJQA 3U60B 4NSRA 3CF0A 3DOAA 4I8OA 2DXIA 2DZOB 1IY0A 4HLQA 3RGSA 3T15A 1E9RA 1JR3A 1TH4A 3QWLA 1HQYE 3BOSA 3C58A 4JV5M 3L25A 5H37D 2QCUA 4REZA 4JI1M 4AI6A 4AQYM 5KQ8A 1QAMA 1JQJC 2R62A 4G4QA 4AG6A 3J7AS 3E9SA 4JI3M 3TQSA 2KA6B 5EP2A 2Z3XA 3MJ5A 2FE8A 2Z4SA 4NSOB 1IN6A 4I4LA 4P16A 3GQ3A 3LQRA 2VQFM 3L2AA 2F5QA 1T3TA 2XEPA 4G6ZA 3U6EA 1TDZA 2YR0A 4DV4M 4FCVA 4M0DA 3PXGA 2CEAA 2G5GX 2X4AA 3KS4A 4IBGA 4MGZE 3DFZA 2KEBA 1GL7A 1IBLM 2Y0QA 4GKJM 2UXBM 1ZQ9A 5IZ7D 2R18A 2F5SA 2XZFA 2BNKA 3HHZA 4IBFA 2C9OA 2CE7A 8CATA 4LF6M 2Z4RA 3HJ8A 3K1JA 1N77A 3VKHA 1KSFX 4DR1M 1VDDA 5EXXA 1J5EM 1NSFA 1C1KA 3IG5A 3M6AA 5EP4A 4BB9A 5IWAM 2VQEM 2UU9M 3FYDA 1GKIA 2KRKA 3AOEA 3J27B 2F4VM 3UMMA 1GLNA 4AW4A 4BBAA 3FD9A 3HU1A 5ITQA 2F5OA 4D80A 3GLGB 1OFIA 2QENA 3AOEC 4DR2M 3HHXA 3KVWA 3W0FA 4QOSA 2EA0A 2L09A 4LJ9A 1NVMA 4LJAA 4WURA 1QZMA 1Z6TA 3D8LA 2ZANA 3K92A 1D2NA 1DGGA 2XFSA 3L26A 5EP3A 3U5ZB 1DGBA 2ZAMA 2L6OA 1HR0M 3WHKA 4L15A 4B3RM 4LJ6A 2W82A 4CGYB 1N33M 5DYGA 3SHFA 1IN7A 1YE9A 5FTKA 3HHYA 3U60A 1HNZM 4GC5A 4LG2A 1W5TA 2V1UA 2G8LA 4IIWA 2KZUA 2XLJA 3U61B 4FWGA 4PD2A 1E94E 3LVWA 2M5ZA 1R7RA 4LZJA 4CHTB 4CISA 2C98A 5GKNA 4QOZC 3UGJA 1IBKM 3THGA 4D82A 2KXEA 4X66M 5KO3A 2C99A 1YUBA 1Q39A 1QANA 5C18A 2QZ4A 3SFZA 2J7OA 4NOOB 1ORYB 2KRUA 3RGPA 4MH0E 1XMQM 3AFHA 3GPPA 2EO2A 7CATA 2X49A 2F5NA 1IY1A 1G41A 3GLIA 4FWDA 1R6BX 1KFVA 2HCBA 3ZC7B 3B9PA 2Y0TA 2CUZA 2V6ZM 1YSYA 4LJ8A 3ZH9B 3TWMA 4B7FA 1SXJB 3VFDA 1XNRM 4FCWA 4NRWA 3K8ZA 4IJEA 2CHGA 4I81A 2CV0A 4NRVA 1IY2A 2UUCM 2RKOA 3HU3A 2XH9A 4PT5A 4QNRA 3KOXE 2FOIC 2P5TA 1MX0A 1SXJE 4XGIA 4OU7A 1Z59A 2M60A 4D81A 4JI2M 3GLFB 3SATA 5FLXS 1OJLA 4LF8M 2D7GA 5EJCA 4JI8M 4AKHA 2OQ4A 1K3WA 3W0LB 4FW9A 2BJVA 3PNYA 1PJJA 2X8AA 3KP1E 3SARA 3TWLA 3LMMA 5E6JA 1IBMM 1N34M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA M;  2F5S A;  4B3M M;  5A2Q S;  2XZF A;  3A46 A;  4LF6 M;  1Z5A A;  5ITT A;  4X62 M;  4MB7 A;  2OPF A;  5LMN M;  4X64 M;  3T1Y M;  4JI5 M;  3GQ4 A;  4DR1 M;  3U6P A;  1J5E M;  2UXD M;  4LF5 M;  2HKJ A;  3OTO M;  2VQE M;  5IWA M;  4PDI A;  4G4R A;  1I94 M;  2UU9 M;  1HNW M;  2F4V M;  4K0K M;  1MU5 A;  1PJI A;  2UXB M;  5ITQ A;  2UUB M;  5ITU A;  1L2D A;  4LF7 M;  2F5O A;  1XNQ M;  2E5L M;  3SAS A;  5ITX E;  4G4O A;  4DR2 M;  4ITQ A;  3W0F A;  1N36 M;  2EA0 A;  3GP1 A;  4GKK M;  4B3S M;  4DR5 M;  1PM5 A;  4DR3 M;  4DV6 M;  4X65 M;  3SBJ A;  1HR0 M;  3JR4 A;  4DV1 M;  5BR8 M;  4B3R M;  2UXC M;  3TWK A;  4YY3 M;  1K82 A;  1L1Z A;  1L2B A;  4DR6 M;  1N33 M;  5ITY A;  2HHH M;  3U6C A;  5IT9 S;  4OX9 M;  4NXM M;  3U6Q A;  4DV3 M;  1HNZ M;  3SAV A;  1L2C A;  3J81 S;  3VK8 A;  1HNX M;  4KHP M;  2ZM6 M;  3U6L A;  4PD2 A;  3J80 S;  4DV5 M;  1R2Y A;  1Z5B A;  3U6D A;  4LFA M;  1TDH A;  1XMO M;  1Q3B A;  4CIS A;  2F5P A;  1Z5C A;  1IBK M;  4LF9 M;  1FJG M;  1R2Z A;  4X66 M;  3SAU A;  1XC8 A;  4JI4 M;  3T1H M;  5ITR A;  1Q39 A;  5LMU M;  2ZBK B;  3U6S A;  3DOA A;  4B3T M;  3JR5 A;  4YHH M;  4DUY M;  4DUZ M;  3GPX A;  1XMQ M;  3VK7 A;  3GPP A;  4DV7 M;  1K3X A;  2F5N A;  3C58 A;  4JV5 M;  2Q2E B;  4LFC M;  4DV0 M;  1KFV A;  2XZU A;  4JI1 M;  5ITX A;  3TWM A;  4AQY M;  4G4Q A;  4DR4 M;  3JAM S;  3GPY A;  1N32 M;  1XNR M;  4NRW A;  3J7A S;  4JI3 M;  4NRV A;  4G4N A;  4JI7 M;  4GKJ M;  2UUC M;  4DR7 M;  1L1T A;  3GO8 A;  1MX0 A;  4JI0 M;  3U6M A;  1Z59 A;  4PDG A;  3GQ5 A;  4LF4 M;  4JI2 M;  3GQ3 A;  1Q3C A;  3SAT A;  5FLX S;  1EE8 A;  2VQF M;  3U6O A;  1NNJ A;  4LF8 M;  3GPU A;  2F5Q A;  3U6E A;  1TDZ A;  3A45 A;  4JI8 M;  4DV2 M;  3A42 A;  2OQ4 A;  4DV4 M;  4PCZ A;  1K3W A;  2UUA M;  4NXN M;  1PJJ A;  4LFB M;  3SAW A;  3SAR A;  3TWL A;  1IBL M;  1IBM M;  1N34 M;  4JI6 M; 
#chains in the Genus database with same CATH topology
 3HHW A;  4JYA M;  2RGH A;  1NNU C;  2HWJ A;  4LRS A;  5A2Q S;  1NV8 A;  3UZU A;  2LWX A;  1OKS A;  1Z5A A;  3L28 A;  4X62 M;  4MB7 A;  2OPF A;  4X64 M;  3B74 A;  3GLG A;  1QVR A;  4NL4 H;  3T1Y M;  3GLI B;  2MJ5 B;  2I7N A;  3WHL A;  2LVP C;  3U6P A;  2UXD M;  1TH3 A;  4LF5 M;  3HKP A;  2HKJ A;  5FTM A;  3FRH A;  3OTO M;  1MN3 A;  1GVN A;  2A5Y B;  3B7N A;  2JP7 A;  4K0K M;  2DI0 A;  1MU5 A;  2K47 A;  2L4E A;  2D7H A;  4RF1 A;  4I5S A;  4FVM A;  4WP2 A;  3GLI E;  1LV7 A;  3U5Z A;  2UUB M;  1L2D A;  1E32 A;  2XF3 A;  3KDS E;  2YFQ A;  4KOD A;  3FUV A;  4G4O A;  4IBC A;  4GKK M;  1FNN A;  3HX3 A;  1WR1 B;  1PM5 A;  2CP8 A;  5JI3 E;  4DV6 M;  2LHG A;  3KSX A;  4OVZ B;  3CF2 A;  3CF6 E;  3U61 A;  3M7G A;  2WSC F;  4LGM A;  4LJ5 A;  1IN5 A;  1QDT A;  3PFI A;  4L78 A;  1QAQ A;  3IG8 A;  4CIZ A;  1JB0 F;  2YQZ A;  3H4M A;  3TWK A;  3GRV A;  1MJG M;  3CTW B;  2WSE F;  2WSF F;  1L1Z A;  3VDP A;  3W68 A;  4JN6 A;  5EQT A;  1HT1 E;  5E26 A;  5IT9 S;  2L7I A;  4MGH A;  1DV0 A;  3RFW A;  4B7H A;  1WIV A;  3AKZ A;  2C96 A;  2ZAO A;  1JR3 D;  1R2Y A;  1Z5B A;  5KQD A;  2LVA A;  1IM2 A;  1TDH A;  1Q3B A;  1XMO M;  3AL0 C;  4LCB A;  3M0E A;  2JNH A;  1HQC A;  4P17 A;  4HL4 A;  3SYK A;  1XC8 A;  3T1H M;  2R46 A;  3I4Y A;  3GLG E;  2DNA A;  2ZBK B;  4M9X A;  3U6S A;  2VII A;  4L4U A;  2QHO B;  4GIP A;  1SXJ A;  4GRI A;  3JR5 A;  3KS8 A;  1IFY A;  3GPX A;  2J5Y A;  1E9S A;  3VK7 A;  4LJ7 A;  2JXN A;  1DGH B;  4S12 A;  1K3X A;  3K9P A;  3VKG A;  1X37 A;  2Q2E B;  1SXJ C;  4LZZ A;  2I7P A;  2XZU A;  3SYL A;  2H5X A;  1IN8 A;  5ITX A;  2DHY A;  3QAU A;  4IBB A;  3GLF A;  2XGN A;  3JAM S;  1VEJ A;  3GPY A;  3D8B A;  1N32 M;  4B08 A;  2Z8Y M;  4LJ4 A;  3SMS A;  2BJW A;  2DAI A;  4FWH A;  3LCU A;  4RNA A;  1IN4 A;  2H1R A;  4DR7 M;  1L1T A;  3VLF B;  4IBJ A;  3PVS A;  3GO8 A;  1N78 A;  2FFJ A;  4JI0 M;  1QAO A;  3ZCB B;  5DNY A;  4PDG A;  2DZL A;  2CHQ A;  3GQ5 A;  1Q3C A;  4GHL A;  1G8P A;  1XWI A;  2KW0 A;  1L8Q A;  5KPR A;  1S3S A;  2UUA M;  3DZD A;  3LVV A;  4WW0 A;  3UJN A;  3FUT A;  5DYI A;  2B3T A;  4Z8X A;  4LFB M;  4M0W A;  4KO8 A;  4B7G A;  1PJT A;  2EUC A;  3F92 A;  4A3V B;  4GH9 A;  4W5W A;  1QUT A;  2VF8 A;  4B3M M;  2DWN A;  2R0I A;  1H6U A;  2LXE A;  2DVW B;  2HL7 A;  3GLH A;  3Q8G A;  4JXJ A;  4KLN A;  4R7G A;  1V92 A;  5ITT A;  5LMN M;  3HU2 A;  3TL4 X;  4JI5 M;  4II7 A;  4AG5 A;  1OIP A;  1SG9 A;  4Q7J A;  4MM3 B;  3FTF A;  3Q8X A;  4PDI A;  2Y21 A;  3KSJ A;  4GHA A;  4IBD A;  5FTN A;  1SXJ D;  1WGL A;  3GRU A;  3MK6 A;  4OVZ A;  4QHT A;  1HNW M;  2L7H A;  4GMQ A;  5C1B A;  2D7E A;  5EXT A;  3KXE C;  4LF7 M;  1IXR C;  3SMP A;  2VDB B;  5EXS A;  2HAK A;  4IBE A;  3NBI A;  5ITX E;  2JZ0 A;  3QYB A;  3GP1 A;  3B89 A;  4EIW A;  3KOW E;  4DR5 M;  4B3S M;  2CHV A;  4X65 M;  2WZJ A;  3FTC A;  2J7N A;  3HZJ A;  4R3D A;  1QYR A;  1J09 A;  1IQP A;  2R4J A;  2LBC A;  1GL6 A;  2JY8 A;  1EIJ A;  1R4G A;  1WHC A;  1DO2 A;  2CWB A;  1W5S A;  4DV1 M;  5BR8 M;  5F3W A;  2R45 A;  1G4A E;  1K82 A;  1L2B A;  2DAK A;  5ITY A;  2HHH M;  3U6C A;  4AZF A;  3HJS A;  4NXM M;  3ZQJ A;  3U6Q A;  4DV3 M;  2V1C A;  3UK6 A;  3VK8 A;  1R5L A;  2QNJ A;  3GLH B;  3CGW A;  3J80 S;  4AKI A;  2LNH C;  3U6D A;  2NQ8 C;  3J7B A;  2JA2 A;  2C9C A;  2CV2 A;  1XXH B;  4OW0 A;  4HEO A;  1DGH A;  4TUW A;  1IXZ A;  1TR8 A;  4M9S A;  3AV0 A;  4LY6 A;  1NO1 A;  3IHP A;  5EXP A;  3GRR A;  3GLH E;  2KNZ A;  3W67 A;  1R2Z A;  1G71 A;  3EIH A;  3SAU A;  1FJG M;  2KHH A;  1HT2 E;  3IEC A;  3H4J A;  4RF0 A;  5ITR A;  1XXH E;  5LMU M;  2QPA A;  3GRY A;  3C9P A;  3KFU G;  3SHG B;  1I4W A;  2DWZ B;  4IJF A;  2FS1 A;  4B3T M;  3HGI A;  1QUS A;  2GQF A;  4QNM A;  4YHH M;  2XSZ A;  3AJI B;  1WGN A;  4DUY M;  5IRE B;  4DUZ M;  1DO0 A;  1CUK A;  4NC6 A;  4DV7 M;  2QBY A;  2L4F A;  4LFC M;  2N35 A;  4DV0 M;  2R65 A;  3B7Z A;  3T38 A;  1J7K A;  2FNA A;  4DR4 M;  3NBX X;  3FUW A;  4MGY E;  2AHM A;  2Z7J A;  3KP0 E;  2CFO A;  3KW6 A;  3PNV A;  3R9X B;  1VDL A;  4G4N A;  4JI7 M;  3LQQ A;  4KT0 F;  4FCT A;  1QQW A;  1G3I A;  4LGY A;  3DA1 A;  2ZTC A;  4R71 A;  3U6M A;  3MMP A;  1Q02 A;  1ZMV A;  1NHW C;  2LH0 A;  2YNM D;  4LF4 M;  1V33 A;  2EKF A;  1EE8 A;  3U6O A;  2QQ8 A;  1NNJ A;  4Z6Y A;  3GPU A;  3FTD A;  3A45 A;  4BLC A;  5JI2 E;  4DV2 M;  3A42 A;  4FD2 A;  4QHS A;  4PCZ A;  1UM8 A;  4CJ6 A;  4NXN M;  4L8R C;  2KZS A;  1NY6 A;  4IBK A;  2FH0 A;  3SAW A;  2R4E A;  3I04 M;  3R8F A;  1GJS A;  4MGK E;  1VEG A;  1DGF A;  4MGI E;  4JI6 M;  4AKG A;  1NJG A;  1LTM A;  1WXQ A;  3C3E A;  3K2L A;  3QYE A;  1WJ7 A;  3A46 A;  2DEN A;  1NJF A;  5KPT A;  5FTJ A;  2CV1 A;  2DHR A;  2QBY B;  3A98 B;  3FUX A;  1Y8G A;  4M9Z A;  3C3D A;  3TPZ A;  1UFZ A;  3GQ4 A;  3RE8 A;  1NY5 A;  4GC9 A;  4L16 A;  4UN2 B;  4G4R A;  1I94 M;  2O5R A;  2XSZ D;  2Y20 A;  1PJI A;  1ZV1 A;  4GIT A;  4RKU F;  1IXS B;  3L27 A;  5ITU A;  2C5R A;  1XNQ M;  2E5L M;  3I01 M;  3HWS A;  1TGU A;  5KPZ A;  3SAS A;  2DWM A;  4ITQ A;  3AOG A;  4XBO A;  1N36 M;  3SC3 A;  1ZMU A;  3ILK A;  1OAO C;  4DR3 M;  2ERC A;  1XHB A;  2QP9 X;  3I51 A;  3NWL A;  2DZN B;  4IBI A;  4ZPX A;  1T6O A;  3SBJ A;  2DWL A;  4G3O A;  1D0M A;  3TE6 A;  2DKL A;  1VQ1 A;  1N75 A;  3EIE A;  3I4V A;  4LRT A;  5EP1 A;  1A5T A;  1XXH A;  3JR4 A;  2BWB A;  2KNV A;  2LVO C;  2XFT A;  2OOA A;  5BPV A;  4YY3 M;  2UXC M;  3KOZ E;  4DR6 M;  2LHC A;  1TTE A;  3FKE A;  4OX9 M;  2MH8 A;  1OFH A;  1D0K A;  3SAV A;  1L2C A;  3J81 S;  1G59 A;  1HNX M;  4KHP M;  1EFU B;  1NHG C;  1KYI A;  3E4R A;  3FUU A;  3L29 A;  2ZM6 M;  3U6L A;  4DV5 M;  4LFA M;  1P3Q Q;  1TH2 A;  3FYC A;  2MR9 A;  2F5P A;  5FSW A;  1Z5C A;  1ZAE A;  4LF9 M;  3MHV C;  3J2P B;  3FTE A;  2QSF X;  2K6B A;  2RGO A;  3HY5 A;  3VDU A;  5FTL A;  4JI4 M;  3KOY E;  2R6F A;  3HJQ A;  4XK8 F;  3U60 B;  4NSR A;  2L2D A;  3FE3 A;  3CF0 A;  3DOA A;  4I8O A;  1VEK A;  2DXI A;  2DZO B;  1IY0 A;  2KDL A;  4HLQ A;  3RGS A;  3T15 A;  1E9R A;  4Y28 F;  1JR3 A;  1TH4 A;  1PRB A;  1T43 A;  1HQY E;  3QWL A;  3BOS A;  3C58 A;  4JV5 M;  3L25 A;  3V76 A;  5H37 D;  2QCU A;  1RU3 A;  3LCV B;  4REZ A;  1OIZ A;  4JI1 M;  4AI6 A;  4AQY M;  5KQ8 A;  1D0L A;  1JQJ C;  1QAM A;  2R62 A;  4G4Q A;  4F1I A;  4AG6 A;  3J7A S;  3E9S A;  2VF7 A;  3BXW A;  4JI3 M;  3TQS A;  2KA6 B;  5EP2 A;  1QZE A;  2Z3X A;  3MJ5 A;  3K9O A;  2FE8 A;  2Z4S A;  2CRU A;  4NSO B;  1IN6 A;  4I4L A;  4P16 A;  3GQ3 A;  3LQR A;  2VQF M;  2DAG A;  3L2A A;  2JWS A;  2F5Q A;  1T3T A;  2XEP A;  4G6Z A;  3U6E A;  1TDZ A;  2YR0 A;  1XB2 B;  4DV4 M;  4FCV A;  1OAI A;  4M0D A;  1HJP A;  2CEA A;  3PXG A;  2G5G X;  2X4A A;  3KS4 A;  4IBG A;  4MGZ E;  3DFZ A;  2KEB A;  1GL7 A;  2LVN C;  1IBL M;  2Y0Q A;  2JZ1 A;  1VG5 A;  4GKJ M;  1ZQ9 A;  5IZ7 D;  2R18 A;  2UXB M;  2F5S A;  5DFL A;  2KNA A;  4DBG B;  2XZF A;  2BNK A;  3HHZ A;  4IBF A;  2C9O A;  2CE7 A;  1IXS A;  8CAT A;  4LF6 M;  2Z4R A;  3HJ8 A;  3K1J A;  3BBZ A;  1N77 A;  3E46 A;  3VKH A;  1KSF X;  4DR1 M;  1VDD A;  5EXX A;  1J5E M;  1OTR A;  1NSF A;  1C1K A;  3IG5 A;  3M6A A;  5EP4 A;  4BB9 A;  5IWA M;  2VQE M;  2UU9 M;  3FYD A;  1GKI A;  1JR3 E;  2KRK A;  3AOE A;  3J27 B;  2F4V M;  1C7Y A;  3UMM A;  1GLN A;  4AW4 A;  1ZMW A;  4BBA A;  3FD9 A;  3HU1 A;  3T6P A;  5ITQ A;  2OOB A;  2F5O A;  4D80 A;  1V34 A;  3GLG B;  1OFI A;  2QEN A;  3AOE C;  4DR2 M;  3HHX A;  3KVW A;  3W0F A;  4QOS A;  2GNO A;  1AUA A;  2EA0 A;  2L09 A;  4LJ9 A;  1NVM A;  4LJA A;  4WUR A;  1QZM A;  1Z6T A;  3D8L A;  2ZAN A;  3K92 A;  1D2N A;  1F4I A;  1DGG A;  2JY5 A;  2XFS A;  3L26 A;  5EP3 A;  3U5Z B;  3B7Q A;  1DGB A;  1BVS A;  2L6O A;  2R44 A;  2ZAM A;  1HR0 M;  3WHK A;  1QDR A;  4L15 A;  4B3R M;  4LJ6 A;  2W82 A;  4CGY B;  1YLA A;  5DYG A;  1N33 M;  2OO9 A;  3SHF A;  1OQY A;  1IN7 A;  1YE9 A;  2APL A;  2EJS A;  5FTK A;  3HHY A;  3U60 A;  1HNZ M;  4GC5 A;  2RRU A;  1W5T A;  2V1U A;  2G8L A;  4IIW A;  2KZU A;  2XLJ A;  4LG2 A;  3U61 B;  4FWG A;  4PD2 A;  1E94 E;  3LVW A;  2M5Z A;  1R7R A;  2MGW A;  4LZJ A;  4CHT B;  4CIS A;  2C98 A;  5GKN A;  4QOZ C;  3UGJ A;  3E21 A;  1IBK M;  2G3Q A;  3THG A;  4D82 A;  2KXE A;  4X66 M;  5KO3 A;  1TF0 B;  2K0B X;  2C99 A;  1YUB A;  1NV9 A;  1Q39 A;  1QAN A;  5C18 A;  2QZ4 A;  3SFZ A;  2J7O A;  4NOO B;  1ORY B;  2O25 A;  2KRU A;  3RGP A;  1GO5 A;  4MH0 E;  1XMQ M;  1AIP C;  3AFH A;  3GPP A;  1GAB A;  2LTU A;  2EO2 A;  2MRO B;  4L6V 6;  7CAT A;  2ZTD A;  2DAM A;  2X49 A;  2F5N A;  1IY1 A;  1G41 A;  3GLI A;  4FWD A;  1R6B X;  1KFV A;  2HCB A;  3ZC7 B;  3B9P A;  2Y0T A;  2CUZ A;  2EKK A;  2V6Z M;  1YSY A;  4LJ8 A;  3ZH9 B;  3TWM A;  3LW5 F;  4B7F A;  1SXJ B;  3VFD A;  3FRI A;  1XNR M;  4FCW A;  4NRW A;  2JY7 A;  3K8Z A;  5L8R F;  4IJE A;  2CHG A;  4I81 A;  2CV0 A;  2K9D A;  4NRV A;  1IY2 A;  4GEW A;  2UUC M;  2RKO A;  3HU3 A;  2XH9 A;  4PT5 A;  4QNR A;  3KOX E;  2FOI C;  4F2L A;  1PJQ A;  2P5T A;  1MX0 A;  1SXJ E;  2O01 F;  4XGI A;  4OU7 A;  1Z59 A;  2M60 A;  4D81 A;  4JI2 M;  1PJS A;  2JY6 B;  3GLF B;  3SAT A;  5FLX S;  1OJL A;  2DAE A;  4LF8 M;  2D7G A;  2LVQ D;  5EJC A;  4JI8 M;  4AKH A;  2OQ4 A;  2JUJ A;  1K3W A;  3W0L B;  2BWE A;  4FW9 A;  2BJV A;  3PNY A;  1PJJ A;  2X8A A;  1GJT A;  3KP1 E;  3GLF E;  3SAR A;  3TWL A;  1PGY A;  3LMM A;  5E6J A;  1IBM M;  1N34 M;  4ANR A; 
#chains in the Genus database with same CATH homology
 3HHW A;  4JYA M;  2RGH A;  1NNU C;  4LRS A;  5A2Q S;  3UZU A;  2LWX A;  1Z5A A;  3L28 A;  4X62 M;  4MB7 A;  2OPF A;  4X64 M;  3GLG A;  1QVR A;  4NL4 H;  3T1Y M;  3GLI B;  3WHL A;  2I7N A;  3U6P A;  2UXD M;  1TH3 A;  4LF5 M;  3HKP A;  2HKJ A;  5FTM A;  3OTO M;  1GVN A;  2A5Y B;  4K0K M;  1MU5 A;  2K47 A;  3U5Z A;  2D7H A;  4RF1 A;  4I5S A;  4FVM A;  1LV7 A;  2UUB M;  1L2D A;  1E32 A;  2XF3 A;  3KDS E;  2YFQ A;  4KOD A;  3FUV A;  4G4O A;  4IBC A;  4GKK M;  1FNN A;  1PM5 A;  5JI3 E;  4DV6 M;  3KSX A;  4OVZ B;  3CF2 A;  3CF6 E;  3U61 A;  3M7G A;  4LGM A;  4LJ5 A;  1IN5 A;  3PFI A;  4L78 A;  1QAQ A;  3IG8 A;  2YQZ A;  3H4M A;  3TWK A;  3GRV A;  3CTW B;  1L1Z A;  3VDP A;  4JN6 A;  5EQT A;  1HT1 E;  5E26 A;  5IT9 S;  2L7I A;  4MGH A;  3RFW A;  4B7H A;  3AKZ A;  2C96 A;  2ZAO A;  1JR3 D;  1R2Y A;  1Z5B A;  5KQD A;  1IM2 A;  1TDH A;  1Q3B A;  1XMO M;  3AL0 C;  4LCB A;  3M0E A;  1HQC A;  4HL4 A;  3SYK A;  1XC8 A;  3T1H M;  2R46 A;  3I4Y A;  2ZBK B;  4M9X A;  3U6S A;  2VII A;  4L4U A;  4GIP A;  1SXJ A;  4GRI A;  3JR5 A;  3KS8 A;  3GPX A;  1E9S A;  3VK7 A;  4LJ7 A;  1DGH B;  4S12 A;  1K3X A;  3VKG A;  1X37 A;  2Q2E B;  1SXJ C;  4LZZ A;  2I7P A;  2XZU A;  3SYL A;  1IN8 A;  5ITX A;  3QAU A;  4IBB A;  3GLF A;  2XGN A;  3JAM S;  3GPY A;  3D8B A;  1N32 M;  4B08 A;  4LJ4 A;  3SMS A;  2BJW A;  4FWH A;  4RNA A;  1IN4 A;  2H1R A;  4DR7 M;  1L1T A;  3VLF B;  4IBJ A;  3PVS A;  3GO8 A;  1N78 A;  2FFJ A;  4JI0 M;  1QAO A;  3ZCB B;  5DNY A;  4PDG A;  2CHQ A;  3GQ5 A;  1Q3C A;  4GHL A;  1G8P A;  1XWI A;  2KW0 A;  1L8Q A;  5KPR A;  1S3S A;  2UUA M;  3DZD A;  3LVV A;  4WW0 A;  3UJN A;  3FUT A;  5DYI A;  4Z8X A;  4LFB M;  4M0W A;  4KO8 A;  4B7G A;  2EUC A;  4A3V B;  4GH9 A;  4W5W A;  4B3M M;  2DWN A;  1H6U A;  2LXE A;  2DVW B;  2HL7 A;  3GLH A;  4JXJ A;  4KLN A;  4R7G A;  5ITT A;  5LMN M;  3HU2 A;  3TL4 X;  4JI5 M;  4II7 A;  4AG5 A;  4MM3 B;  3FTF A;  3Q8X A;  4PDI A;  2Y21 A;  3KSJ A;  4GHA A;  4IBD A;  5FTN A;  1SXJ D;  3GRU A;  3MK6 A;  4OVZ A;  4QHT A;  1HNW M;  2L7H A;  4GMQ A;  5C1B A;  2D7E A;  5EXT A;  3KXE C;  4LF7 M;  1IXR C;  3SMP A;  5EXS A;  4IBE A;  3NBI A;  5ITX E;  3GP1 A;  4EIW A;  3KOW E;  4DR5 M;  4B3S M;  2CHV A;  4X65 M;  3FTC A;  2J7N A;  4R3D A;  1QYR A;  1J09 A;  1IQP A;  2R4J A;  1GL6 A;  1DO2 A;  1W5S A;  4DV1 M;  5BR8 M;  5F3W A;  2R45 A;  1G4A E;  1K82 A;  1L2B A;  5ITY A;  2HHH M;  3U6C A;  4AZF A;  3HJS A;  4NXM M;  3U6Q A;  4DV3 M;  2V1C A;  3UK6 A;  3VK8 A;  3GLH B;  3J80 S;  4AKI A;  2LNH C;  3U6D A;  2NQ8 C;  3J7B A;  2JA2 A;  2C9C A;  2CV2 A;  1XXH B;  4OW0 A;  1DGH A;  4TUW A;  1IXZ A;  4M9S A;  3AV0 A;  4LY6 A;  5EXP A;  3GRR A;  1FJG M;  1R2Z A;  3EIH A;  3SAU A;  1HT2 E;  4RF0 A;  5ITR A;  5LMU M;  2QPA A;  3GRY A;  3KFU G;  3SHG B;  1I4W A;  2DWZ B;  4IJF A;  4B3T M;  3HGI A;  4QNM A;  4YHH M;  2XSZ A;  3AJI B;  4DUY M;  4DUZ M;  5IRE B;  1DO0 A;  4DV7 M;  2QBY A;  4LFC M;  4DV0 M;  2R65 A;  3T38 A;  1J7K A;  2FNA A;  4DR4 M;  4MGY E;  3FUW A;  2AHM A;  2Z7J A;  3KP0 E;  2CFO A;  3KW6 A;  3PNV A;  3R9X B;  4G4N A;  4JI7 M;  3LQQ A;  4FCT A;  1QQW A;  1G3I A;  4LGY A;  3DA1 A;  3U6M A;  2LH0 A;  1NHW C;  2YNM D;  4LF4 M;  1EE8 A;  3U6O A;  1NNJ A;  4Z6Y A;  3GPU A;  3FTD A;  3A45 A;  4BLC A;  5JI2 E;  4DV2 M;  3A42 A;  4FD2 A;  4QHS A;  4PCZ A;  1UM8 A;  4NXN M;  4L8R C;  2KZS A;  1NY6 A;  4IBK A;  3SAW A;  2R4E A;  3R8F A;  4AKG A;  4MGK E;  1DGF A;  4MGI E;  4JI6 M;  1NJG A;  3K2L A;  1WXQ A;  3A46 A;  1NJF A;  5KPT A;  5FTJ A;  2CV1 A;  2DHR A;  2QBY B;  3A98 B;  3FUX A;  4M9Z A;  3TPZ A;  3GQ4 A;  3RE8 A;  1NY5 A;  4GC9 A;  4L16 A;  4G4R A;  1I94 M;  2O5R A;  2XSZ D;  2Y20 A;  1PJI A;  4GIT A;  1IXS B;  3L27 A;  5ITU A;  2C5R A;  1XNQ M;  2E5L M;  5KPZ A;  3HWS A;  1TGU A;  3SAS A;  2DWM A;  4ITQ A;  3AOG A;  4XBO A;  1N36 M;  3SC3 A;  3ILK A;  4DR3 M;  2ERC A;  1XHB A;  2QP9 X;  3I51 A;  3NWL A;  2DZN B;  4IBI A;  4ZPX A;  3SBJ A;  2DWL A;  3TE6 A;  3EIE A;  1N75 A;  4LRT A;  3I4V A;  5EP1 A;  1XXH A;  3JR4 A;  2XFT A;  5BPV A;  2UXC M;  4YY3 M;  3KOZ E;  4DR6 M;  3FKE A;  4OX9 M;  1OFH A;  3SAV A;  1L2C A;  3J81 S;  1G59 A;  1HNX M;  4KHP M;  1NHG C;  3L29 A;  1KYI A;  3E4R A;  3FUU A;  2ZM6 M;  3U6L A;  4DV5 M;  4LFA M;  1TH2 A;  3FYC A;  2F5P A;  5FSW A;  1Z5C A;  1ZAE A;  4LF9 M;  3MHV C;  3J2P B;  3FTE A;  2RGO A;  3VDU A;  4JI4 M;  5FTL A;  3KOY E;  3HJQ A;  3U60 B;  4NSR A;  3CF0 A;  3DOA A;  4I8O A;  2DXI A;  2DZO B;  1IY0 A;  4HLQ A;  3RGS A;  3T15 A;  1E9R A;  1JR3 A;  1TH4 A;  3QWL A;  1HQY E;  3BOS A;  3C58 A;  4JV5 M;  3L25 A;  5H37 D;  2QCU A;  4REZ A;  4JI1 M;  4AI6 A;  4AQY M;  5KQ8 A;  1QAM A;  1JQJ C;  2R62 A;  4G4Q A;  4AG6 A;  3J7A S;  3E9S A;  4JI3 M;  3TQS A;  2KA6 B;  5EP2 A;  2Z3X A;  3MJ5 A;  2FE8 A;  2Z4S A;  4NSO B;  1IN6 A;  4I4L A;  4P16 A;  3GQ3 A;  3LQR A;  2VQF M;  3L2A A;  2F5Q A;  1T3T A;  2XEP A;  4G6Z A;  3U6E A;  1TDZ A;  2YR0 A;  4DV4 M;  4FCV A;  4M0D A;  3PXG A;  2CEA A;  2G5G X;  2X4A A;  3KS4 A;  4IBG A;  4MGZ E;  3DFZ A;  2KEB A;  1GL7 A;  1IBL M;  2Y0Q A;  4GKJ M;  2UXB M;  1ZQ9 A;  5IZ7 D;  2R18 A;  2F5S A;  2XZF A;  2BNK A;  3HHZ A;  4IBF A;  2C9O A;  2CE7 A;  8CAT A;  4LF6 M;  2Z4R A;  3HJ8 A;  3K1J A;  1N77 A;  3VKH A;  1KSF X;  4DR1 M;  1VDD A;  5EXX A;  1J5E M;  1NSF A;  1C1K A;  3IG5 A;  3M6A A;  5EP4 A;  4BB9 A;  5IWA M;  2VQE M;  2UU9 M;  3FYD A;  1GKI A;  2KRK A;  3AOE A;  3J27 B;  2F4V M;  3UMM A;  1GLN A;  4AW4 A;  4BBA A;  3FD9 A;  3HU1 A;  5ITQ A;  2F5O A;  4D80 A;  3GLG B;  1OFI A;  2QEN A;  3AOE C;  4DR2 M;  3HHX A;  3KVW A;  3W0F A;  4QOS A;  2EA0 A;  2L09 A;  4LJ9 A;  1NVM A;  4LJA A;  4WUR A;  1QZM A;  1Z6T A;  3D8L A;  2ZAN A;  3K92 A;  1D2N A;  1DGG A;  2XFS A;  3L26 A;  5EP3 A;  3U5Z B;  1DGB A;  2ZAM A;  2L6O A;  1HR0 M;  3WHK A;  4L15 A;  4B3R M;  4LJ6 A;  2W82 A;  4CGY B;  1N33 M;  5DYG A;  3SHF A;  1IN7 A;  1YE9 A;  5FTK A;  3HHY A;  3U60 A;  1HNZ M;  4GC5 A;  4LG2 A;  1W5T A;  2V1U A;  2G8L A;  4IIW A;  2KZU A;  2XLJ A;  3U61 B;  4FWG A;  4PD2 A;  1E94 E;  3LVW A;  2M5Z A;  1R7R A;  4LZJ A;  4CHT B;  4CIS A;  2C98 A;  5GKN A;  4QOZ C;  3UGJ A;  1IBK M;  3THG A;  4D82 A;  2KXE A;  4X66 M;  5KO3 A;  2C99 A;  1YUB A;  1Q39 A;  1QAN A;  5C18 A;  2QZ4 A;  3SFZ A;  2J7O A;  4NOO B;  1ORY B;  2KRU A;  3RGP A;  4MH0 E;  1XMQ M;  3AFH A;  3GPP A;  2EO2 A;  7CAT A;  2X49 A;  2F5N A;  1IY1 A;  1G41 A;  3GLI A;  4FWD A;  1R6B X;  1KFV A;  2HCB A;  3ZC7 B;  3B9P A;  2Y0T A;  2CUZ A;  2V6Z M;  1YSY A;  4LJ8 A;  3ZH9 B;  3TWM A;  4B7F A;  1SXJ B;  3VFD A;  1XNR M;  4FCW A;  4NRW A;  3K8Z A;  4IJE A;  2CHG A;  4I81 A;  2CV0 A;  4NRV A;  1IY2 A;  2UUC M;  2RKO A;  3HU3 A;  2XH9 A;  4PT5 A;  4QNR A;  3KOX E;  2FOI C;  2P5T A;  1MX0 A;  1SXJ E;  4XGI A;  4OU7 A;  1Z59 A;  2M60 A;  4D81 A;  4JI2 M;  3GLF B;  3SAT A;  5FLX S;  1OJL A;  4LF8 M;  2D7G A;  5EJC A;  4JI8 M;  4AKH A;  2OQ4 A;  1K3W A;  3W0L B;  4FW9 A;  2BJV A;  3PNY A;  1PJJ A;  2X8A A;  3KP1 E;  3SAR A;  3TWL A;  3LMM A;  5E6J A;  1IBM M;  1N34 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...