1P3QQ

Mechanism of ubiquitin recognition by the cue domain of vps9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
45
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAASGPCVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 45
sequence length 47
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
2EJSA 2L2DA 3FE3A 2JY8A 1IM2A 1VEGA 1VQ1A 2JY7A 1WGNA 3MMPA 1DO2A 1WHCA 1MN3A 1QZEA 1NV8A 1G3IA 1OKSA 2HWJA 1A5TA 1OAIA 3GLIE 2JP7A 2G3QA 1HJPA 2WZJA 1KYIA 4HEOA 2ZTDA 5JI2E 3LCUA 1HT1E 2KNAA 2LVPC 1R4GA 2LTUA 1E94E 1T43A 2JY6B 1NV9A 2MROB 1WJ7A 2JUJA 1C7YA 1AIPC 2DKLA 1JR3E 3IECA 2CP8A 4GEWA 1HQYE 4F2LA 1XXHE 1P3QQ 1SG9A 1WR1B 4R71A 2JNHA 3K9OA 3GLHE 1HT2E 2KNZA 2QHOB 2K9DA 1ZMWA 2DZLA 2ZTCA 2O25A 3B89A 3T6PA 1GO5A 1G41A 2H5XA 1Y8GA 1EFUB 2QSFX 2DENA 1WGLA 2R0IA 1TR8A 4UN2B 1VDLA 2JY5A 2BWEA 1VG5A 1ZMUA 1DV0A 3IHPA 1CUKA 2B3TA 3F92A 2QNJA 1XB2B 1OQYA 2HAKA 2KHHA 2KNVA 2DAGA 4G3OA 2LVOC 2DAIA 2K0BX 3BBZA 2DNAA 3FRHA 1ZMVA 1Q02A 2DI0A 1ZV1A 3E21A 1UFZA 1OTRA 2DAMA 2JZ1A 2CWBA 2L4EA 1F4IA 1DO0A 2BWBA 2MJ5B 4WP2A 2OOBA 3GLFE 2MR9A 2DAKA 1BVSA 2LVNC 4Q7JA 3GLGE 2EKFA 2LBCA 3H4JA 2L4FA 1YLAA 4F1IA 1PGYA 2RRUA 3LCVB 3E46A 1VEKA 2LVQD 2DAEA 1G4AE 2EKKA 2JZ0A 2MGWA 1TTEA 1IFYA 1IXSA 2LVAA 1V92A 1T6OA 1VEJA 5DFLA 2DHYA 3FRIA 4DBGB 2OO9A 3K9PA 2OOAA 1WIVA
chains in the Genus database with same CATH superfamily
1JQJC 2XSZD 3FE3A 1GKIA 1IM2A 1VEGA 2L6OA 1FJGM 3GRRA 1YSYA 1SXJC 1IBLM 1QZEA 2I7PA 1OJLA 4NOOB 2CRUA 4LFCM 3FKEA 1W5TA 3GO8A 1A5TA 2DVWB 2R4JA 1YE9A 2EO2A 1Z5BA 2DXIA 3W67A 3DA1A 3TWMA 5FTNA 2C96A 5EP4A 4L78A 4ZPXA 2JUJA 3FUWA 1C7YA 1DGFA 2KDLA 1KFVA 4KLNA 2AHMA 3ZCBB 2CP8A 3U6CA 1IY0A 2P5TA 5E26A 3VK8A 4DR3M 3KFUG 1NJGA 1WR1B 4R71A 3K9OA 3L28A 3VFDA 2A5YB 3IG5A 4DR5M 3QWLA 3A42A 5FLXS 3L2AA 2FS1A 4OVZB 1HNWM 1AUAA 4LJAA 3B89A 2E5LM 4LZJA 3U6LA 1QDRA 4GRIA 5EXTA 3FUVA 3D8LA 1PJJA 1NJFA 3KOZE 1IY2A 1VDLA 4FW9A 1VG5A 5IREB 4DV5M 1D0LA 2CFOA 3BOSA 1DV0A 3IHPA 4X62M 1NO1A 5A2QS 2F5PA 3J81S 4KHPM 2Q2EB 3OTOM 1OQYA 4WURA 2KHHA 3KP1E 3AOGA 2KNVA 4X64M 1IN5A 2K0BX 3FUTA 3PXGA 3U6QA 1QAOA 3AFHA 4IBJA 4CHTB 3TQSA 4CIZA 2VF8A 3FTFA 2DI0A 2KEBA 4RF1A 2KRKA 4AG6A 3JR5A 3CF0A 1I4WA 3E21A 3HY5A 4B7FA 3HHWA 3PFIA 3JAMS 2DAMA 2MH8A 2QQ8A 2J7NA 3U6EA 1DO0A 2G5GX 4M9XA 4HL4A 2XSZA 1DGHB 5DYIA 4DUZM 3HU3A 5EXPA 4WP2A 3QYBA 4DV2M 1E9RA 2BNKA 4MGHA 5LMUM 2H1RA 3GLFE 3BXWA 3HJSA 4R3DA 1G71A 2MR9A 3HU1A 4YY3M 2LVNC 4Q7JA 4AQYM 2QBYB 2YQZA 1XXHA 2EA0A 1N75A 2XFTA 3HU2A 3I4YA 2Z8YM 3FUUA 3SYKA 4B3MM 2R18A 4GKJM 3GLHA 2CEAA 5DYGA 4ITQA 3DOAA 3HHXA 1NY5A 4GC9A 4IBBA 1GL6A 2VIIA 2JWSA 4CGYB 4G6ZA 2JZ0A 1IQPA 3R8FA 1R2YA 3HHYA 1IXSA 2RGHA 5BPVA 1IY1A 3A45A 4JI6M 2LH0A 4LJ9A 3K2LA 1PJIA 2OO9A 5EP2A 1Z5AA 2F5SA 3J7BA 4PD2A 4LGYA 3GP1A 2Y20A 4IBFA 3J2PB 2CHGA 5KPZA 2Z7JA 2F5QA 1HR0M 4LG2A 1OFIA 3U6OA 3EIHA 4LFAM 4R7GA 3W68A 2R65A 4LJ5A 4Z6YA 3VK7A 1MN3A 3CF6E 2XLJA 1QDTA 4BB9A 3VKGA 4MH0E 5E6JA 1SXJD 2C99A 2VDBB 4X66M 4B7GA 4II7A 3HKPA 4OU7A 2Y21A 1N34M 4GHLA 5JI2E 2XF3A 2ZTDA 3SHGB 4DR6M 4B08A 1HT1E 3SARA 5IT9S 3HZJA 3VLFB 3K92A 5FTLA 2QCUA 1QYRA 1T43A 4IBIA 2JY6B 3I04M 2NQ8C 4L4UA 3RFWA 1N78A 1GVNA 1AIPC 2X8AA 3GLGB 1G8PA 1QUSA 2XZUA 4FWDA 3LQQA 2KZSA 3WHKA 3J7AS 1R5LA 4IBGA 5L8RF 2CHVA 4X65M 1XXHE 1P3QQ 4PCZA 4QOZC 4MB7A 2XGNA 2JNHA 1IXRC 3LW5F 5ITRA 3GLHE 2G8LA 3MJ5A 3NBIA 2XFSA 3UZUA 2QHOB 2VQEM 1N32M 1L8QA 2K6BA 2QZ4A 3B7QA 4M9ZA 4LFBM 1H6UA 2OQ4A 3T6PA 3GRYA 3GRVA 2UUBM 8CATA 4L6V6 4DR1M 2Y0TA 1WGLA 1LTMA 1TR8A 1XXHB 4LF8M 4IBDA 5FTMA 4IJFA 3UMMA 4NSOB 3GLHB 3B9PA 1R7RA 3TPZA 5ITYA 3GLFA 3THGA 2Z4RA 2KXEA 1HQCA 2B3TA 4I8OA 1XNQM 3FD9A 4M0DA 2QNJA 5EP1A 1J7KA 2HKJA 3C9PA 2R45A 2LWXA 5EJCA 3V76A 2O5RA 2LHCA 1V34A 2DAIA 2LVOC 4LRTA 5FSWA 3BBZA 5EXXA 3WHLA 5IWAM 4B3RM 4MGIE 5FTKA 4G4RA 4PDIA 1Q02A 1X37A 1XNRM 1K3XA 1Z59A 1TH3A 1PJQA 1I94M 2DHRA 1OTRA 2V1CA 3KOXE 4DV4M 4AKIA 3U61B 4TUWA 1IN4A 1F4IA 4KO8A 1OAOC 5F3WA 3K1JA 2R46A 4JXJA 3LQRA 1TF0B 1JR3A 2DAKA 2Z4SA 3TWLA 2ZBKB 4IBEA 2C9CA 4KT0F 2EKFA 3KXEC 1IN8A 3H4JA 3U6PA 2L4FA 1L1TA 1YLAA 1IN6A 1R2ZA 3HJQA 2RRUA 2K47A 7CATA 1SXJA 1G59A 3E46A 3KVWA 2LVQD 5IZ7D 3GQ5A 4QNRA 1G4AE 2F4VM 2MGWA 3QAUA 3KDSE 1QZMA 4LF9M 3D8BA 3U60A 1T6OA 1QVRA 2C9OA 3Q8GA 4AZFA 5EXSA 3NWLA 4FWHA 1PJSA 2J5YA 4B7HA 4K0KM 3KS4A 3K9PA 4RKUF 4FD2A 2R4EA 1XC8A 1WIVA 3CGWA 4ANRA 2DWMA 2EJSA 2L2DA 4JI2M 3JR4A 2JY8A 3FTDA 4GIPA 1MX0A 1QUTA 2JY7A 1IN7A 5KPRA 3MMPA 2RGOA 4DR4M 3FTCA 4LJ8A 5GKNA 4JI4M 1DO2A 2QPAA 1WHCA 3CF2A 4KODA 4GH9A 2OPFA 2CV0A 4CISA 1NV8A 1G3IA 1VDDA 2V6ZM 4YHHM 2FE8A 2HWJA 1DGGA 5LMNM 1QAMA 2CE7A 2JA2A 4JI7M 4FVMA 3SMSA 1OFHA 1OAIA 3GLIE 3T15A 5C18A 4PT5A 1L1ZA 2JP7A 2DZNB 1HJPA 1XHBA 1KYIA 1OIZA 2G3QA 3B7ZA 3GRUA 3I4VA 4AW4A 4BLCA 3RGPA 2XZFA 4JYAM 2R44A 2LVPC 4GHAA 4OW0A 1E94E 3GLFB 4LY6A 3CTWB 1NV9A 1EE8A 1Q3CA 3ZC7B 2DKLA 4AI6A 4IJEA 5EQTA 1JR3E 3IECA 1R6BX 4JV5M 2C98A 3SAUA 4F2LA 2M60A 5ITTA 4S12A 1SG9A 4LZZA 1JR3D 3MHVC 3L27A 3B74A 2KNZA 5ITXA 1SXJE 2K9DA 1WXQA 1QAQA 2VF7A 2XEPA 1K82A 4LF6M 1ZMWA 4G4NA 4G4QA 1NSFA 1YUBA 2YNMD 4GMQA 1TH4A 3SC3A 1MU5A 2FFJA 1GO5A 1G41A 3U6MA 1NNJA 3E4RA 1XMQM 2Y0QA 3M0EA 4LJ7A 4OVZA 2ZM6M 2KW0A 1D0MA 4PDGA 2R0IA 3Q8XA 3T1YM 2HL7A 4GC5A 4RF0A 4UN2B 2FOIC 2JY5A 2BWEA 4LRSA 4QOSA 4A3VB 1S3SA 3UJNA 4GITA 1J09A 3KS8A 3E9SA 1JB0F 4I81A 1CUKA 4NSRA 5KO3A 3T1HM 3MK6A 1NHWC 1XB2B 4NC6A 2HAKA 3SHFA 2DAGA 2L7HA 4QHSA 2HCBA 4XK8F 3C3EA 3U60B 1L2BA 1LV7A 3RE8A 3DFZA 3RGSA 2O01F 3SBJA 4LF4M 1ZV1A 4QNMA 1UFZA 2DWLA 4JI1M 4LJ4A 2JZ1A 2CWBA 2GNOA 3FYDA 3PNVA 1V33A 1W5SA 2L09A 4WW0A 2BWBA 3VDPA 3GQ4A 2GQFA 3IG8A 4EIWA 1Q3BA 3LVWA 4AG5A 4CJ6A 3U6DA 3UGJA 1BVSA 1DGHA 2X49A 4B3SM 3KOWE 1E32A 3C58A 4MM3B 5ITQA 3SAVA 1PGYA 1T3TA 4DR7M 4NL4H 1Q39A 5ITXE 1L2DA 3LCVB 2QBYA 1GJTA 1IXSB 3ZQJA 1D2NA 1VEKA 3PNYA 4I5SA 2BJWA 2DAEA 5BR8M 2EKKA 3B7NA 1NVMA 1TTEA 1MJGM 5JI3E 1IFYA 3GLIA 2D7HA 2LVAA 3NBXX 5KQDA 1TDHA 1V92A 4JN6A 3SASA 3TE6A 4MGZE 4GKKM 1N33M 1NHGC 4REZA 3LVVA 1IBKM 3SFZA 1DGBA 2APLA 2DHYA 3PVSA 4DBGB 3AOEA 4M9SA 2OOAA 1QANA 3W0FA 4LF5M 4XBOA 1XWIA 2N35A 2ZAMA 4RNAA 1VQ1A 3GPPA 5EP3A 1HNXM 2DZOB 2UUAM 1C1KA 1WGNA 4D81A 2BJVA 3J27B 2CV1A 4NXNM 1OKSA 2ZAOA 2WSEF 1Z5CA 3A98B 5FTJA 2D7GA 4XGIA 2XH9A 1PRBA 2WZJA 2VQFM 4I4LA 4D80A 2J7OA 3KW6A 3C3DA 4HEOA 1N36M 3FUXA 2YR0A 2Z3XA 3LCUA 2F5NA 4OX9M 2KNAA 3VDUA 1R4GA 3I01M 3HX3A 4DV7M 2LTUA 1L2CA 4FCWA 3HGIA 4LCBA 2MROB 1WJ7A 4FCTA 3U5ZA 3M7GA 4JI8M 3GQ3A 3H4MA 3KSJA 2F5OA 3L29A 1FNNA 1QQWA 4GEWA 3T38A 1GLNA 5KPTA 3GPXA 3R9XB 1HQYE 1IBMM 2I7NA 3LMMA 3GLGA 5ITUA 2UXBM 1RU3A 4BBAA 1OIPA 3M6AA 3UK6A 4LGMA 4JI5M 1PJTA 2R62A 1TGUA 3AKZA 1UM8A 3SMPA 2DZLA 1XMOM 4P16A 5C1BA 2ZTCA 2X4AA 2O25A 2FNAA 3SATA 3QYEA 2H5XA 1E9SA 4D82A 1Y8GA 3SAWA 4NRVA 3W0LB 1EFUB 1GL7A 3DZDA 2QSFX 2DENA 4IBCA 3HHZA 3TWKA 2UXCM 1IXZA 4L8RC 4NXMM 5DNYA 1ZMUA 1J5EM 3KSXA 4JI0M 4FCVA 4IBKA 2WSCF 1ZQ9A 3EIEA 2CHQA 4M0WA 3F92A 2RKOA 3HJ8A 2UU9M 4L16A 3VKHA 5H37D 1K3WA 2W82A 2L7IA 2V1UA 3GLIB 3KP0E 4G3OA 4L15A 4Z8XA 2CV2A 2KRUA 3FTEA 2DNAA 3FRHA 4MGKE 2KZUA 1GJSA 1ZMVA 2QENA 3L25A 3A46A 1PM5A 2HHHM 3K8ZA 4B3TM 2CUZA 2M5ZA 1N77A 2DWZB 3TL4X 2D7EA 2L4EA 4W5WA 1TH2A 2MJ5B 4NRWA 4QHTA 4LJ6A 2OOBA 2ZANA 3J80S 3FYCA 4FWGA 2KA6B 3U61A 1ORYB 3U6SA 2JXNA 1KSFX 4DR2M 2UXDM 2YFQA 1EIJA 4AKHA 2EUCA 3GLGE 1SXJB 4DV1M 2LBCA 5KQ8A 1Z6TA 4DV3M 4JI3M 2UUCM 4Y28F 4F1IA 1TDZA 2FH0A 4G4OA 2QP9X 2R6FA 2C5RA 1GABA 4IIWA 3KOYE 1HNZM 4DV0M 3AL0C 3HWSA 1NY6A 2WSFF 3ZH9B 4LF7M 3U5ZB 2LXEA 1D0KA 2LHGA 3AOEC 4HLQA 4P17A 2LNHC 4DV6M 2DWNA 1VEJA 4MGYE 3AJIB 3L26A 3ILKA 3I51A 5DFLA 3SYLA 3GPYA 3GPUA 3AV0A 3FRIA 4AKGA 1NNUC 2ERCA 1ZAEA 4DUYM 1HT2E
chains in the Genus database with same CATH topology
2EJSA 2L2DA 3FE3A 2JY8A 1IM2A 1VEGA 1VQ1A 2JY7A 1WGNA 3MMPA 1DO2A 1WHCA 1MN3A 1QZEA 1NV8A 1G3IA 1OKSA 2HWJA 1A5TA 1OAIA 3GLIE 2JP7A 2G3QA 1HJPA 2WZJA 1KYIA 4HEOA 2ZTDA 5JI2E 3LCUA 1HT1E 2KNAA 2LVPC 1R4GA 2LTUA 1E94E 1T43A 2JY6B 1NV9A 2MROB 1WJ7A 2JUJA 1C7YA 1AIPC 2DKLA 1JR3E 3IECA 2CP8A 4GEWA 1HQYE 4F2LA 1XXHE 1P3QQ 1SG9A 1WR1B 4R71A 2JNHA 3K9OA 3GLHE 1HT2E 2KNZA 2QHOB 2K9DA 1ZMWA 2DZLA 2ZTCA 2O25A 3B89A 3T6PA 1GO5A 1G41A 2H5XA 1Y8GA 1EFUB 2QSFX 2DENA 1WGLA 2R0IA 1TR8A 4UN2B 1VDLA 2JY5A 2BWEA 1VG5A 1ZMUA 1DV0A 3IHPA 1CUKA 2B3TA 3F92A 2QNJA 1XB2B 1OQYA 2HAKA 2KHHA 2KNVA 2DAGA 4G3OA 2LVOC 2DAIA 2K0BX 3BBZA 2DNAA 3FRHA 1ZMVA 1Q02A 2DI0A 1ZV1A 3E21A 1UFZA 1OTRA 2DAMA 2JZ1A 2CWBA 2L4EA 1F4IA 1DO0A 2BWBA 2MJ5B 4WP2A 2OOBA 3GLFE 2MR9A 2DAKA 1BVSA 2LVNC 4Q7JA 3GLGE 2EKFA 2LBCA 3H4JA 2L4FA 1YLAA 4F1IA 1PGYA 2RRUA 3LCVB 3E46A 1VEKA 2LVQD 2DAEA 1G4AE 2EKKA 2JZ0A 2MGWA 1TTEA 1IFYA 1IXSA 2LVAA 1V92A 1T6OA 1VEJA 5DFLA 2DHYA 3FRIA 4DBGB 2OO9A 3K9PA 2OOAA 1WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJS A;  2L2D A;  3FE3 A;  2JY8 A;  1IM2 A;  1VEG A;  1VQ1 A;  2JY7 A;  1WGN A;  3MMP A;  1DO2 A;  1WHC A;  1MN3 A;  1QZE A;  1NV8 A;  1G3I A;  1OKS A;  2HWJ A;  1A5T A;  1OAI A;  3GLI E;  2JP7 A;  2G3Q A;  1HJP A;  2WZJ A;  1KYI A;  4HEO A;  2ZTD A;  5JI2 E;  3LCU A;  1HT1 E;  2KNA A;  2LVP C;  1R4G A;  2LTU A;  1E94 E;  1T43 A;  2JY6 B;  1NV9 A;  2MRO B;  1WJ7 A;  2JUJ A;  1C7Y A;  1AIP C;  2DKL A;  1JR3 E;  3IEC A;  2CP8 A;  4GEW A;  1HQY E;  4F2L A;  1XXH E;  1P3Q Q;  1SG9 A;  1WR1 B;  4R71 A;  2JNH A;  3K9O A;  3GLH E;  1HT2 E;  2KNZ A;  2QHO B;  2K9D A;  1ZMW A;  2DZL A;  2ZTC A;  2O25 A;  3B89 A;  3T6P A;  1GO5 A;  1G41 A;  2H5X A;  1Y8G A;  1EFU B;  2QSF X;  2DEN A;  1WGL A;  2R0I A;  1TR8 A;  4UN2 B;  1VDL A;  2JY5 A;  2BWE A;  1VG5 A;  1ZMU A;  1DV0 A;  3IHP A;  1CUK A;  2B3T A;  3F92 A;  2QNJ A;  1XB2 B;  1OQY A;  2HAK A;  2KHH A;  2KNV A;  2DAG A;  4G3O A;  2LVO C;  2DAI A;  2K0B X;  3BBZ A;  2DNA A;  3FRH A;  1ZMV A;  1Q02 A;  2DI0 A;  1ZV1 A;  3E21 A;  1UFZ A;  1OTR A;  2DAM A;  2JZ1 A;  2CWB A;  2L4E A;  1F4I A;  1DO0 A;  2BWB A;  2MJ5 B;  4WP2 A;  2OOB A;  3GLF E;  2MR9 A;  2DAK A;  1BVS A;  2LVN C;  4Q7J A;  3GLG E;  2EKF A;  2LBC A;  3H4J A;  2L4F A;  1YLA A;  4F1I A;  1PGY A;  2RRU A;  3LCV B;  3E46 A;  1VEK A;  2LVQ D;  2DAE A;  1G4A E;  2EKK A;  2JZ0 A;  2MGW A;  1TTE A;  1IFY A;  1IXS A;  2LVA A;  1V92 A;  1T6O A;  1VEJ A;  5DFL A;  2DHY A;  3FRI A;  4DBG B;  2OO9 A;  3K9P A;  2OOA A;  1WIV A; 
#chains in the Genus database with same CATH topology
 1JQJ C;  2XSZ D;  3FE3 A;  1GKI A;  1IM2 A;  1VEG A;  2L6O A;  1FJG M;  3GRR A;  1YSY A;  1SXJ C;  1IBL M;  1QZE A;  2I7P A;  1OJL A;  4NOO B;  2CRU A;  4LFC M;  3FKE A;  1W5T A;  3GO8 A;  1A5T A;  2DVW B;  2R4J A;  1YE9 A;  2EO2 A;  1Z5B A;  2DXI A;  3W67 A;  3DA1 A;  3TWM A;  5FTN A;  2C96 A;  5EP4 A;  4L78 A;  4ZPX A;  2JUJ A;  3FUW A;  1C7Y A;  1DGF A;  2KDL A;  1KFV A;  4KLN A;  2AHM A;  3ZCB B;  2CP8 A;  3U6C A;  1IY0 A;  2P5T A;  5E26 A;  3VK8 A;  4DR3 M;  3KFU G;  1NJG A;  1WR1 B;  4R71 A;  3K9O A;  3L28 A;  3VFD A;  2A5Y B;  3IG5 A;  4DR5 M;  3QWL A;  3A42 A;  5FLX S;  3L2A A;  2FS1 A;  4OVZ B;  1HNW M;  1AUA A;  4LJA A;  3B89 A;  2E5L M;  4LZJ A;  3U6L A;  1QDR A;  4GRI A;  5EXT A;  3FUV A;  3D8L A;  1PJJ A;  1NJF A;  3KOZ E;  1IY2 A;  1VDL A;  4FW9 A;  1VG5 A;  5IRE B;  4DV5 M;  1D0L A;  2CFO A;  3BOS A;  1DV0 A;  3IHP A;  4X62 M;  1NO1 A;  5A2Q S;  2F5P A;  3J81 S;  4KHP M;  2Q2E B;  3OTO M;  1OQY A;  4WUR A;  2KHH A;  3KP1 E;  3AOG A;  2KNV A;  4X64 M;  1IN5 A;  2K0B X;  3FUT A;  3PXG A;  3U6Q A;  1QAO A;  3AFH A;  4IBJ A;  4CHT B;  3TQS A;  4CIZ A;  2VF8 A;  3FTF A;  2DI0 A;  2KEB A;  4RF1 A;  2KRK A;  4AG6 A;  3JR5 A;  3CF0 A;  1I4W A;  3E21 A;  3HY5 A;  4B7F A;  3HHW A;  3PFI A;  3JAM S;  2DAM A;  2MH8 A;  2QQ8 A;  2J7N A;  3U6E A;  1DO0 A;  2G5G X;  4M9X A;  4HL4 A;  2XSZ A;  1DGH B;  5DYI A;  4DUZ M;  3HU3 A;  5EXP A;  4WP2 A;  3QYB A;  4DV2 M;  1E9R A;  2BNK A;  4MGH A;  5LMU M;  2H1R A;  3GLF E;  3BXW A;  3HJS A;  4R3D A;  1G71 A;  2MR9 A;  3HU1 A;  4YY3 M;  2LVN C;  4Q7J A;  4AQY M;  2QBY B;  2YQZ A;  1XXH A;  2EA0 A;  1N75 A;  2XFT A;  3HU2 A;  3I4Y A;  2Z8Y M;  3FUU A;  3SYK A;  4B3M M;  2R18 A;  4GKJ M;  3GLH A;  2CEA A;  5DYG A;  4ITQ A;  3DOA A;  3HHX A;  1NY5 A;  4GC9 A;  4IBB A;  1GL6 A;  2VII A;  2JWS A;  4CGY B;  4G6Z A;  2JZ0 A;  1IQP A;  3R8F A;  1R2Y A;  3HHY A;  1IXS A;  2RGH A;  5BPV A;  1IY1 A;  3A45 A;  4JI6 M;  2LH0 A;  4LJ9 A;  3K2L A;  1PJI A;  2OO9 A;  5EP2 A;  1Z5A A;  2F5S A;  3J7B A;  4PD2 A;  4LGY A;  3GP1 A;  2Y20 A;  4IBF A;  3J2P B;  2CHG A;  5KPZ A;  2Z7J A;  2F5Q A;  1HR0 M;  4LG2 A;  1OFI A;  3U6O A;  3EIH A;  4LFA M;  4R7G A;  3W68 A;  2R65 A;  4LJ5 A;  4Z6Y A;  3VK7 A;  1MN3 A;  3CF6 E;  2XLJ A;  1QDT A;  4BB9 A;  3VKG A;  4MH0 E;  5E6J A;  1SXJ D;  2C99 A;  2VDB B;  4X66 M;  4B7G A;  4II7 A;  3HKP A;  4OU7 A;  2Y21 A;  1N34 M;  4GHL A;  5JI2 E;  2XF3 A;  2ZTD A;  3SHG B;  4DR6 M;  4B08 A;  1HT1 E;  3SAR A;  5IT9 S;  3HZJ A;  3VLF B;  3K92 A;  5FTL A;  2QCU A;  1QYR A;  1T43 A;  4IBI A;  2JY6 B;  3I04 M;  2NQ8 C;  4L4U A;  3RFW A;  1N78 A;  1GVN A;  1AIP C;  2X8A A;  3GLG B;  1G8P A;  1QUS A;  2XZU A;  4FWD A;  3LQQ A;  2KZS A;  3WHK A;  3J7A S;  1R5L A;  4IBG A;  5L8R F;  2CHV A;  4X65 M;  1XXH E;  1P3Q Q;  4PCZ A;  4QOZ C;  4MB7 A;  2XGN A;  2JNH A;  1IXR C;  3LW5 F;  5ITR A;  3GLH E;  2G8L A;  3MJ5 A;  3NBI A;  2XFS A;  3UZU A;  2QHO B;  2VQE M;  1N32 M;  1L8Q A;  2K6B A;  2QZ4 A;  3B7Q A;  4M9Z A;  4LFB M;  1H6U A;  2OQ4 A;  3T6P A;  3GRY A;  3GRV A;  2UUB M;  8CAT A;  4L6V 6;  4DR1 M;  2Y0T A;  1WGL A;  1LTM A;  1TR8 A;  1XXH B;  4LF8 M;  4IBD A;  5FTM A;  4IJF A;  3UMM A;  4NSO B;  3GLH B;  3B9P A;  1R7R A;  3TPZ A;  5ITY A;  3GLF A;  3THG A;  2Z4R A;  2KXE A;  1HQC A;  2B3T A;  4I8O A;  1XNQ M;  3FD9 A;  4M0D A;  2QNJ A;  5EP1 A;  1J7K A;  2HKJ A;  3C9P A;  2R45 A;  2LWX A;  5EJC A;  3V76 A;  2O5R A;  2LHC A;  1V34 A;  2DAI A;  2LVO C;  4LRT A;  5FSW A;  3BBZ A;  5EXX A;  3WHL A;  5IWA M;  4B3R M;  4MGI E;  5FTK A;  4G4R A;  4PDI A;  1Q02 A;  1X37 A;  1XNR M;  1K3X A;  1Z59 A;  1TH3 A;  1PJQ A;  1I94 M;  2DHR A;  1OTR A;  2V1C A;  3KOX E;  4DV4 M;  4AKI A;  3U61 B;  4TUW A;  1IN4 A;  1F4I A;  4KO8 A;  1OAO C;  5F3W A;  3K1J A;  2R46 A;  4JXJ A;  3LQR A;  1TF0 B;  1JR3 A;  2DAK A;  2Z4S A;  3TWL A;  2ZBK B;  4IBE A;  2C9C A;  4KT0 F;  2EKF A;  3KXE C;  1IN8 A;  3H4J A;  3U6P A;  2L4F A;  1L1T A;  1YLA A;  1IN6 A;  1R2Z A;  3HJQ A;  2RRU A;  2K47 A;  7CAT A;  1SXJ A;  1G59 A;  3E46 A;  3KVW A;  2LVQ D;  5IZ7 D;  3GQ5 A;  4QNR A;  1G4A E;  2F4V M;  2MGW A;  3QAU A;  3KDS E;  1QZM A;  4LF9 M;  3D8B A;  3U60 A;  1T6O A;  1QVR A;  2C9O A;  3Q8G A;  4AZF A;  5EXS A;  3NWL A;  4FWH A;  1PJS A;  2J5Y A;  4B7H A;  4K0K M;  3KS4 A;  3K9P A;  4RKU F;  4FD2 A;  2R4E A;  1XC8 A;  1WIV A;  3CGW A;  4ANR A;  2DWM A;  2EJS A;  2L2D A;  4JI2 M;  3JR4 A;  2JY8 A;  3FTD A;  4GIP A;  1MX0 A;  1QUT A;  2JY7 A;  1IN7 A;  5KPR A;  3MMP A;  2RGO A;  4DR4 M;  3FTC A;  4LJ8 A;  5GKN A;  4JI4 M;  1DO2 A;  2QPA A;  1WHC A;  3CF2 A;  4KOD A;  4GH9 A;  2OPF A;  2CV0 A;  4CIS A;  1NV8 A;  1G3I A;  1VDD A;  2V6Z M;  4YHH M;  2FE8 A;  2HWJ A;  1DGG A;  5LMN M;  1QAM A;  2CE7 A;  2JA2 A;  4JI7 M;  4FVM A;  3SMS A;  1OFH A;  1OAI A;  3GLI E;  3T15 A;  5C18 A;  4PT5 A;  1L1Z A;  2JP7 A;  2DZN B;  1HJP A;  1XHB A;  1KYI A;  1OIZ A;  2G3Q A;  3B7Z A;  3GRU A;  3I4V A;  4AW4 A;  4BLC A;  3RGP A;  2XZF A;  4JYA M;  2R44 A;  2LVP C;  4GHA A;  4OW0 A;  1E94 E;  3GLF B;  4LY6 A;  3CTW B;  1NV9 A;  1EE8 A;  1Q3C A;  3ZC7 B;  2DKL A;  4AI6 A;  4IJE A;  5EQT A;  1JR3 E;  3IEC A;  1R6B X;  4JV5 M;  2C98 A;  3SAU A;  4F2L A;  2M60 A;  5ITT A;  4S12 A;  1SG9 A;  4LZZ A;  1JR3 D;  3MHV C;  3L27 A;  3B74 A;  2KNZ A;  5ITX A;  1SXJ E;  2K9D A;  1WXQ A;  1QAQ A;  2VF7 A;  2XEP A;  1K82 A;  4LF6 M;  1ZMW A;  4G4N A;  4G4Q A;  1NSF A;  1YUB A;  2YNM D;  4GMQ A;  1TH4 A;  3SC3 A;  1MU5 A;  2FFJ A;  1GO5 A;  1G41 A;  3U6M A;  1NNJ A;  3E4R A;  1XMQ M;  2Y0Q A;  3M0E A;  4LJ7 A;  4OVZ A;  2ZM6 M;  2KW0 A;  1D0M A;  4PDG A;  2R0I A;  3Q8X A;  3T1Y M;  2HL7 A;  4GC5 A;  4RF0 A;  4UN2 B;  2FOI C;  2JY5 A;  2BWE A;  4LRS A;  4QOS A;  4A3V B;  1S3S A;  3UJN A;  4GIT A;  1J09 A;  3KS8 A;  3E9S A;  1JB0 F;  4I81 A;  1CUK A;  4NSR A;  5KO3 A;  3T1H M;  3MK6 A;  1NHW C;  1XB2 B;  4NC6 A;  2HAK A;  3SHF A;  2DAG A;  2L7H A;  4QHS A;  2HCB A;  4XK8 F;  3C3E A;  3U60 B;  1L2B A;  1LV7 A;  3RE8 A;  3DFZ A;  3RGS A;  2O01 F;  3SBJ A;  4LF4 M;  1ZV1 A;  4QNM A;  1UFZ A;  2DWL A;  4JI1 M;  4LJ4 A;  2JZ1 A;  2CWB A;  2GNO A;  3FYD A;  3PNV A;  1V33 A;  1W5S A;  2L09 A;  4WW0 A;  2BWB A;  3VDP A;  3GQ4 A;  2GQF A;  3IG8 A;  4EIW A;  1Q3B A;  3LVW A;  4AG5 A;  4CJ6 A;  3U6D A;  3UGJ A;  1BVS A;  1DGH A;  2X49 A;  4B3S M;  3KOW E;  1E32 A;  3C58 A;  4MM3 B;  5ITQ A;  3SAV A;  1PGY A;  1T3T A;  4DR7 M;  4NL4 H;  1Q39 A;  5ITX E;  1L2D A;  3LCV B;  2QBY A;  1GJT A;  1IXS B;  3ZQJ A;  1D2N A;  1VEK A;  3PNY A;  4I5S A;  2BJW A;  2DAE A;  5BR8 M;  2EKK A;  3B7N A;  1NVM A;  1TTE A;  1MJG M;  5JI3 E;  1IFY A;  3GLI A;  2D7H A;  2LVA A;  3NBX X;  5KQD A;  1TDH A;  1V92 A;  4JN6 A;  3SAS A;  3TE6 A;  4MGZ E;  4GKK M;  1N33 M;  1NHG C;  4REZ A;  3LVV A;  1IBK M;  3SFZ A;  1DGB A;  2APL A;  2DHY A;  3PVS A;  4DBG B;  3AOE A;  4M9S A;  2OOA A;  1QAN A;  3W0F A;  4LF5 M;  4XBO A;  1XWI A;  2N35 A;  2ZAM A;  4RNA A;  1VQ1 A;  3GPP A;  5EP3 A;  1HNX M;  2DZO B;  2UUA M;  1C1K A;  1WGN A;  4D81 A;  2BJV A;  3J27 B;  2CV1 A;  4NXN M;  1OKS A;  2ZAO A;  2WSE F;  1Z5C A;  3A98 B;  5FTJ A;  2D7G A;  4XGI A;  2XH9 A;  1PRB A;  2WZJ A;  2VQF M;  4I4L A;  4D80 A;  2J7O A;  3KW6 A;  3C3D A;  4HEO A;  1N36 M;  3FUX A;  2YR0 A;  2Z3X A;  3LCU A;  2F5N A;  4OX9 M;  2KNA A;  3VDU A;  1R4G A;  3I01 M;  3HX3 A;  4DV7 M;  2LTU A;  1L2C A;  4FCW A;  3HGI A;  4LCB A;  2MRO B;  1WJ7 A;  4FCT A;  3U5Z A;  3M7G A;  4JI8 M;  3GQ3 A;  3H4M A;  3KSJ A;  2F5O A;  3L29 A;  1FNN A;  1QQW A;  4GEW A;  3T38 A;  1GLN A;  5KPT A;  3GPX A;  3R9X B;  1HQY E;  1IBM M;  2I7N A;  3LMM A;  3GLG A;  5ITU A;  2UXB M;  1RU3 A;  4BBA A;  1OIP A;  3M6A A;  3UK6 A;  4LGM A;  4JI5 M;  1PJT A;  2R62 A;  1TGU A;  3AKZ A;  1UM8 A;  3SMP A;  2DZL A;  1XMO M;  4P16 A;  5C1B A;  2ZTC A;  2X4A A;  2O25 A;  2FNA A;  3SAT A;  3QYE A;  2H5X A;  1E9S A;  4D82 A;  1Y8G A;  3SAW A;  4NRV A;  3W0L B;  1EFU B;  1GL7 A;  3DZD A;  2QSF X;  2DEN A;  4IBC A;  3HHZ A;  3TWK A;  2UXC M;  1IXZ A;  4L8R C;  4NXM M;  5DNY A;  1ZMU A;  1J5E M;  3KSX A;  4JI0 M;  4FCV A;  4IBK A;  2WSC F;  1ZQ9 A;  3EIE A;  2CHQ A;  4M0W A;  3F92 A;  2RKO A;  3HJ8 A;  2UU9 M;  4L16 A;  3VKH A;  5H37 D;  1K3W A;  2W82 A;  2L7I A;  2V1U A;  3GLI B;  3KP0 E;  4G3O A;  4L15 A;  4Z8X A;  2CV2 A;  2KRU A;  3FTE A;  2DNA A;  3FRH A;  4MGK E;  2KZU A;  1GJS A;  1ZMV A;  2QEN A;  3L25 A;  3A46 A;  1PM5 A;  2HHH M;  3K8Z A;  4B3T M;  2CUZ A;  2M5Z A;  1N77 A;  2DWZ B;  3TL4 X;  2D7E A;  2L4E A;  4W5W A;  1TH2 A;  2MJ5 B;  4NRW A;  4QHT A;  4LJ6 A;  2OOB A;  2ZAN A;  3J80 S;  3FYC A;  4FWG A;  2KA6 B;  3U61 A;  1ORY B;  3U6S A;  2JXN A;  1KSF X;  4DR2 M;  2UXD M;  2YFQ A;  1EIJ A;  4AKH A;  2EUC A;  3GLG E;  1SXJ B;  4DV1 M;  2LBC A;  5KQ8 A;  1Z6T A;  4DV3 M;  4JI3 M;  2UUC M;  4Y28 F;  4F1I A;  1TDZ A;  2FH0 A;  4G4O A;  2QP9 X;  2R6F A;  2C5R A;  1GAB A;  4IIW A;  3KOY E;  1HNZ M;  4DV0 M;  3AL0 C;  3HWS A;  1NY6 A;  2WSF F;  3ZH9 B;  4LF7 M;  3U5Z B;  2LXE A;  1D0K A;  2LHG A;  3AOE C;  4HLQ A;  4P17 A;  2LNH C;  4DV6 M;  2DWN A;  1VEJ A;  4MGY E;  3AJI B;  3L26 A;  3ILK A;  3I51 A;  5DFL A;  3SYL A;  3GPY A;  3GPU A;  3AV0 A;  3FRI A;  4AKG A;  1NNU C;  2ERC A;  1ZAE A;  4DUY M;  1HT2 E; 
#chains in the Genus database with same CATH homology
 2EJS A;  2L2D A;  3FE3 A;  2JY8 A;  1IM2 A;  1VEG A;  1VQ1 A;  2JY7 A;  1WGN A;  3MMP A;  1DO2 A;  1WHC A;  1MN3 A;  1QZE A;  1NV8 A;  1G3I A;  1OKS A;  2HWJ A;  1A5T A;  1OAI A;  3GLI E;  2JP7 A;  2G3Q A;  1HJP A;  2WZJ A;  1KYI A;  4HEO A;  2ZTD A;  5JI2 E;  3LCU A;  1HT1 E;  2KNA A;  2LVP C;  1R4G A;  2LTU A;  1E94 E;  1T43 A;  2JY6 B;  1NV9 A;  2MRO B;  1WJ7 A;  2JUJ A;  1C7Y A;  1AIP C;  2DKL A;  1JR3 E;  3IEC A;  2CP8 A;  4GEW A;  1HQY E;  4F2L A;  1XXH E;  1P3Q Q;  1SG9 A;  1WR1 B;  4R71 A;  2JNH A;  3K9O A;  3GLH E;  1HT2 E;  2KNZ A;  2QHO B;  2K9D A;  1ZMW A;  2DZL A;  2ZTC A;  2O25 A;  3B89 A;  3T6P A;  1GO5 A;  1G41 A;  2H5X A;  1Y8G A;  1EFU B;  2QSF X;  2DEN A;  1WGL A;  2R0I A;  1TR8 A;  4UN2 B;  1VDL A;  2JY5 A;  2BWE A;  1VG5 A;  1ZMU A;  1DV0 A;  3IHP A;  1CUK A;  2B3T A;  3F92 A;  2QNJ A;  1XB2 B;  1OQY A;  2HAK A;  2KHH A;  2KNV A;  2DAG A;  4G3O A;  2LVO C;  2DAI A;  2K0B X;  3BBZ A;  2DNA A;  3FRH A;  1ZMV A;  1Q02 A;  2DI0 A;  1ZV1 A;  3E21 A;  1UFZ A;  1OTR A;  2DAM A;  2JZ1 A;  2CWB A;  2L4E A;  1F4I A;  1DO0 A;  2BWB A;  2MJ5 B;  4WP2 A;  2OOB A;  3GLF E;  2MR9 A;  2DAK A;  1BVS A;  2LVN C;  4Q7J A;  3GLG E;  2EKF A;  2LBC A;  3H4J A;  2L4F A;  1YLA A;  4F1I A;  1PGY A;  2RRU A;  3LCV B;  3E46 A;  1VEK A;  2LVQ D;  2DAE A;  1G4A E;  2EKK A;  2JZ0 A;  2MGW A;  1TTE A;  1IFY A;  1IXS A;  2LVA A;  1V92 A;  1T6O A;  1VEJ A;  5DFL A;  2DHY A;  3FRI A;  4DBG B;  2OO9 A;  3K9P A;  2OOA A;  1WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...