1P3QQ

Mechanism of ubiquitin recognition by the cue domain of vps9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
45
Chain Sequence
b'SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAASGPCVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 13
structure length 45
sequence length 47
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
2LVQD 2OOAA 2JUJA 2BWEA 1ZV1A 1NV8A 3MMPA 4HEOA 2DAMA 1G3IA 1WGLA 1TR8A 1WGNA 2JY8A 2KNVA 1ZMVA 1HT2E 1WJ7A 1JR3E 3FRHA 2QHOB 3LCVB 1DO2A 2DHYA 2MGWA 1ZMUA 1R4GA 1VG5A 1VQ1A 1HJPA 2JY6B 1OTRA 2R0IA 2WZJA 3B89A 2DAKA 4F1IA 2JY5A 3F92A 1P3QQ 2LVAA 2L4EA 2ZTDA 4GEWA 1T6OA 1VEJA 1HQYE 1G4AE 1NV9A 2OOBA 3T6PA 2MROB 3IECA 1XXHE 3K9OA 4R71A 1TTEA 2MR9A 2K0BX 3GLGE 4F2LA 2JNHA 1VEKA 2KNZA 2QSFX 1SG9A 2CP8A 3FE3A 1WHCA 2RRUA 1OAIA 1GO5A 1KYIA 1V92A 2DZLA 2O25A 1VEGA 4WP2A 4G3OA 2G3QA 2K9DA 2DENA 1DO0A 1G41A 1Y8GA 3GLIE 1UFZA 2JZ0A 1CUKA 3E21A 3IHPA 1IM2A 2DI0A 3LCUA 5JI2E 2DKLA 2BWBA 2JY7A 1OKSA 3E46A 1XB2B 2HWJA 3BBZA 2LTUA 2LVNC 2KNAA 1HT1E 1Q02A 2ZTCA 1PGYA 2CWBA 1C7YA 1WR1B 1BVSA 3GLFE 2L4FA 2OO9A 1IXSA 3GLHE 5DFLA 4Q7JA 2DNAA 2QNJA 1WIVA 2LVOC 2L2DA 2EJSA 4DBGB 1E94E 2LBCA 2DAGA 2HAKA 1VDLA 1MN3A 3H4JA 1AIPC 2JP7A 2DAEA 3K9PA 1A5TA 2B3TA 1F4IA 2MJ5B 3FRIA 4UN2B 1OQYA 2H5XA 1DV0A 2DAIA 1EFUB 1YLAA 2EKFA 2LVPC 1T43A 1ZMWA 1QZEA 2JZ1A 2EKKA 1IFYA 2KHHA
chains in the Genus database with same CATH superfamily
3GRYA 5FTMA 3QWLA 1QUTA 1ZV1A 4QNMA 4I81A 3MMPA 1Z5CA 1Z6TA 1GLNA 3GP1A 2WSFF 4IBGA 3LVVA 1G3IA 1QDRA 3AJIB 3HU2A 4Z8XA 3M7GA 4A3VB 4OU7A 4DR2M 3RGPA 2KNVA 1G59A 1RU3A 4PDGA 4P17A 4AQYM 4M0DA 3GPUA 4FD2A 4CISA 3PXGA 3I01M 3HU3A 2QQ8A 3KSXA 4D81A 1L1ZA 2F5QA 1TDZA 2Q2EB 3HKPA 3L2AA 2JY6B 4Y28F 5KPRA 1SXJC 1QYRA 2R0IA 3SAWA 5E6JA 3L27A 2DAKA 2I7PA 1YSYA 2KRUA 3GRUA 2UUAM 4LGMA 5FTNA 4TUWA 1P3QQ 2LVAA 3SFZA 1DGHA 1PJJA 1HNXM 2BNKA 4BB9A 5EP1A 5EP3A 1IN4A 4PCZA 1TH3A 1GJSA 3J27B 2L7HA 1NV9A 2ERCA 3B7ZA 4NOOB 2MROB 3HHZA 4DV6M 3KVWA 2YQZA 3GQ3A 4HL4A 2MR9A 3VDUA 1IN6A 2HCBA 2JNHA 2KNZA 2F5NA 4NC6A 1J5EM 2FH0A 2D7EA 3VKHA 1XMQM 2QSFX 1I94M 5BR8M 3FTFA 3FE3A 1NSFA 1E32A 3VK7A 2XZUA 3GLIB 4JI6M 3AOGA 3KDSE 2RKOA 1IXSB 2J5YA 1IXRC 1JB0F 1NO1A 3KXEC 1E9RA 4WURA 2R6FA 1HNZM 1IY0A 1V34A 4CJ6A 2KA6B 4IIWA 3SARA 3J2PB 1UM8A 2FFJA 1MX0A 1ZAEA 3GRRA 3IHPA 3CF2A 4XGIA 3UMMA 4DR7M 3FUTA 3JR5A 1NVMA 2DKLA 2BWBA 4PD2A 1SXJA 2R44A 3FUWA 1PJIA 2CV0A 1XB2B 2HWJA 3BBZA 2UUCM 2LHGA 4KLNA 3HHWA 3VDPA 2Y0QA 1IXZA 2VIIA 3U6MA 4DV7M 3LQQA 4AI6A 4KO8A 1WR1B 2KZUA 3HWSA 3KW6A 4JI4M 4LJ8A 2YR0A 5E26A 3HJ8A 4NSOB 2V1UA 2L4FA 2FNAA 3AOEC 3CGWA 4GIPA 3T38A 4IJEA 4KT0F 5DFLA 4OVZA 2QBYB 2XH9A 2DNAA 2QP9X 4IBEA 4LRSA 3JAMS 4GKKM 3C58A 4X66M 4RKUF 2HAKA 1VDLA 2ZBKB 8CATA 4JI0M 3GPXA 1MN3A 1DGFA 3C3EA 2O5RA 5EP2A 3TPZA 4XK8F 4X65M 2QPAA 1K82A 1HQCA 2C9CA 4R3DA 5GKNA 2D7HA 3HY5A 2DHRA 3FRIA 1IY1A 2R65A 3KS4A 4GITA 4LZZA 5KPTA 1L2BA 3ILKA 1ORYB 3FUUA 2H5XA 1DV0A 4B3SM 2EKFA 4GHAA 3SAVA 2V6ZM 4LF5M 1TDHA 1N34M 2VF7A 1XMOM 3LQRA 2JZ1A 2KXEA 2QZ4A 1IFYA 5EQTA 3PNYA 2ZAOA 1WGLA 2WSCF 4FWHA 1E9SA 4NL4H 3RGSA 2O01F 1OFHA 4JI8M 1HT2E 4LFBM 2QHOB 1N77A 1DO2A 1DGGA 2XLJA 2M5ZA 1LTMA 3HJSA 3PVSA 3QYEA 2HHHM 3MJ5A 5IZ7D 4B3TM 4JI1M 4L6V6 4LFAM 4M9XA 3TWLA 1N33M 1HJPA 3RE8A 1L2DA 4D82A 3SMPA 1R5LA 3BXWA 3HGIA 2WZJA 5ITRA 3MHVC 2JA2A 1QDTA 1XXHB 1JR3D 2R18A 2CV2A 2JY5A 3AOEA 5FLXS 3D8LA 3F92A 4HLQA 1GJTA 4LJ4A 3BOSA 2VF8A 3HX3A 3GLGB 5EJCA 1PRBA 3VLFB 3L25A 1T3TA 1TH2A 4ITQA 1T6OA 2MH8A 4I8OA 3GQ4A 2DZOB 1Z5BA 3JR4A 1G4AE 3AFHA 4NXMM 2R46A 4LGYA 3KOZE 1PM5A 4B7HA 3IECA 2XSZA 1IBLM 3K9OA 4R71A 1FJGM 1TTEA 4GC5A 3M6AA 4FCWA 1R2ZA 3T1YM 2F5OA 2APLA 2Z8YM 3FUVA 2DWLA 4M0WA 2KZSA 1NNUC 1NY5A 4MM3B 2RRUA 2OQ4A 1NNJA 4G6ZA 3M0EA 2CE7A 2DWZB 4AKHA 2EA0A 1OAIA 5EXSA 1GO5A 5IT9S 4MGKE 3GPPA 2UXBM 3NWLA 1V92A 4X64M 3U6LA 3SATA 4DUZM 2DZLA 5EXPA 2E5LM 1VEGA 3FTDA 3KP0E 3NBIA 1NHGC 4IBJA 4WP2A 4CHTB 1H6UA 1PJSA 4LG2A 4AKGA 3PFIA 4D80A 1FNNA 2FE8A 1IBKM 4B7FA 2K9DA 3D8BA 4LJ6A 1G41A 4GMQA 2FS1A 1UFZA 4LJ5A 4WW0A 3E21A 3VFDA 2DI0A 3GLIE 4DUYM 3U61B 4JI3M 1QQWA 2XFTA 2JY7A 4LCBA 5JI2E 4YY3M 5IREB 2F4VM 1N78A 3E46A 2Z3XA 3U5ZB 4LF8M 5H37D 2LVNC 1XHBA 4GKJM 5FTKA 1TF0B 3U60B 4GH9A 2DZNB 4NRVA 4L15A 2ZTCA 1PGYA 4AW4A 3SMSA 1GABA 1D0MA 1VDDA 3AKZA 4DV5M 4DR1M 3GLFE 3SYKA 2W82A 3DFZA 5DNYA 3TWMA 4LZJA 2Y20A 3UZUA 3HZJA 2L7IA 2XGNA 1QZMA 4Q7JA 2CFOA 2QCUA 3DOAA 4ZPXA 4ANRA 1WIVA 2LVOC 2HL7A 2CEAA 1TGUA 2X4AA 1LV7A 2EJSA 5KO3A 3HHXA 2DVWB 3W0FA 4JI7M 1GKIA 3U6CA 3GLFB 4DV0M 1NJFA 4DR4M 5ITUA 3SYLA 3EIEA 3C9PA 1W5TA 2MJ5B 2D7GA 4CIZA 4UN2B 5KQ8A 2UXDM 2A5YB 2ZANA 1OQYA 1QVRA 3GO8A 4B3RM 3SBJA 5KQDA 3LVWA 1EFUB 1T43A 1JR3A 2XZFA 1QZEA 4IBIA 2OOAA 3FTCA 2JUJA 2BWEA 2YFQA 3EIHA 4FW9A 4QOSA 3SHGB 4B3MM 3L29A 2DAMA 2ZAMA 1OIPA 1Z5AA 2KW0A 2DWNA 1TR8A 1WGNA 4S12A 1K3XA 1WJ7A 2DXIA 3I51A 2K47A 1JR3E 3FRHA 4L78A 2DHYA 2MGWA 2J7OA 3A46A 1ZMUA 1R4GA 3SASA 3FYCA 2DWMA 4II7A 1J7KA 4OW0A 5ITXA 1VQ1A 3TL4X 5LMNM 2BJWA 2VQFM 1OTRA 5C18A 3WHLA 1XXHA 3B89A 4R7GA 3ZC7B 1R2YA 4F1IA 3GRVA 2M60A 3KOYE 3MK6A 3KS8A 4AG5A 4DR6M 5IWAM 3GLGA 3HU1A 2ZTDA 3U6SA 1L2CA 1J09A 1TH4A 4GEWA 1QUSA 3J80S 3W67A 2KDLA 4M9ZA 1Q3CA 1VEJA 3FYDA 5ITXE 3T6PA 4X62M 4W5WA 1XXHE 3PNVA 2NQ8C 3SHFA 1C1KA 4NXNM 2Y21A 4YHHM 4DR5M 1L1TA 4OX9M 3WHKA 4LF7M 4QOZC 3GLGE 4F2LA 4IBCA 3U6DA 3K2LA 4AG6A 4M9SA 4JI5M 1IQPA 1MJGM 2LXEA 5FTJA 2R4JA 3KOWE 4MGYE 3I04M 1SG9A 2CP8A 1G8PA 1WHCA 2Z7JA 3B7QA 4IBKA 4IJFA 4RNAA 4L8RC 2C9OA 2ZM6M 1HNWM 2P5TA 3ZH9B 5KPZA 4RF0A 3U6EA 1HR0M 5DYGA 1X37A 3TWKA 1XWIA 4OVZB 2O25A 2N35A 2I7NA 3CF6E 5A2QS 1NJGA 1R7RA 1IN7A 2YNMD 2Z4SA 5C1BA 1N36M 4L16A 1Z59A 2DENA 3U6OA 2JZ0A 3U61A 3Q8XA 1PJTA 3LCUA 3GLHB 1SXJD 5LMUM 2Y0TA 2GQFA 3LMMA 4QHTA 7CATA 1I4WA 4JYAM 2LTUA 4FWGA 3U60A 2KEBA 2KNAA 1HT1E 2WSEF 3CTWB 3K92A 2EUCA 1YUBA 4FCVA 2G5GX 3GLIA 3I4VA 1QANA 5EXXA 1IXSA 1XC8A 4NSRA 3UGJA 1EIJA 4EIWA 3KFUG 2K6BA 2QENA 3J7AS 1ZQ9A 3K1JA 2L2DA 2CHQA 4IBBA 2C98A 4I4LA 1QAQA 1E94E 1GL6A 2DAGA 2L6OA 1WXQA 4GHLA 3GLFA 3H4JA 3B74A 3H4MA 1AIPC 1NY6A 2JP7A 2DAEA 3E9SA 4AZFA 2JWSA 3K9PA 4DV1M 1A5TA 4MGIE 2UUBM 1V33A 2B3TA 1F4IA 3T1HM 2VDBB 2FOIC 2CUZA 2DAIA 1G71A 3FKEA 2LVPC 2GNOA 3J7BA 4LY6A 3U6QA 2KRKA 2R62A 2RGHA 3TQSA 2EKKA 4MB7A 5FSWA 2KHHA 2LVQD 5L8RF 4JV5M 4XBOA 3V76A 2HKJA 3FUXA 4RF1A 1NV8A 2RGOA 4FWDA 4HEOA 1NHWC 1GVNA 1OJLA 2EO2A 3GPYA 3A45A 4PDIA 1OFIA 2JY8A 4B7GA 1ZMVA 3KP1E 5DYIA 2CHGA 3L26A 2QBYA 1N32M 3LCVB 4PT5A 2XEPA 4QHSA 3CF0A 4DV2M 1VG5A 1Q39A 3ZCBB 2XFSA 3ZQJA 2R45A 1OIZA 3L28A 4CGYB 4JI2M 4JXJA 3R9XB 4G4RA 3E4RA 3Q8GA 4MGZE 4KHPM 1MU5A 1DGBA 2C96A 2L4EA 1DGHB 2VQEM 4B08A 3IG5A 1K3WA 3NBXX 2R4EA 4LJ7A 5FTLA 1GL7A 1HQYE 2OOBA 2H1RA 2L09A 2XSZD 2CV1A 3RFWA 3AL0C 3R8FA 4MH0E 1IY2A 1XNQM 1JQJC 3TE6A 2K0BX 3GQ5A 3LW5F 4BLCA 1W5SA 3J81S 4G4OA 1VEKA 3W0LB 1XNRM 5BPVA 1IBMM 5JI3E 2CHVA 2X49A 4KODA 4LJAA 4JN6A 3KOXE 2UU9M 1YE9A 3SAUA 3QAUA 4REZA 2J7NA 3DZDA 1L8QA 4Z6YA 3C3DA 3UK6A 2LHCA 1KYIA 1SXJE 2LH0A 2V1CA 4GRIA 4LF4M 1IN8A 1IN5A 1R6BX 3THGA 3OTOM 4K0KM 4P16A 3AV0A 3U6PA 1N75A 3KSJA 4G3OA 4IBFA 5EP4A 3VKGA 3I4YA 2AHMA 2G3QA 3SC3A 4AKIA 5ITQA 1D0KA 1DO0A 4LF9M 1Y8GA 4BBAA 5F3WA 2UXCM 1CUKA 1IM2A 3GLHA 1KSFX 1QAOA 3T15A 3W68A 1KFVA 1OKSA 3B9PA 1SXJB 4GC9A 5EXTA 1Q3BA 3VK8A 2G8LA 2JXNA 1EE8A 3A42A 4LFCM 1Q02A 1C7YA 1D0LA 2BJVA 2CWBA 2XF3A 5ITTA 3FD9A 1BVSA 3FTEA 4DV3M 2F5SA 4FCTA 2OO9A 3QYBA 4QNRA 3GLHE 1D2NA 3A98B 4I5SA 4DV4M 2CRUA 2LWXA 4G4QA 2QNJA 2OPFA 4DBGB 4LRTA 2C99A 3UJNA 2LBCA 1OAOC 4NRWA 3B7NA 3HJQA 4L4UA 1S3SA 4G4NA 1QAMA 4FVMA 4LJ9A 4MGHA 1PJQA 4IBDA 5ITYA 3U5ZA 4DR3M 3DA1A 2Z4RA 3HHYA 1YLAA 2LNHC 4LF6M 2X8AA 1ZMWA 2C5RA 1AUAA 3K8ZA 3IG8A 2F5PA
chains in the Genus database with same CATH topology
2LVQD 2OOAA 2JUJA 2BWEA 1ZV1A 1NV8A 3MMPA 4HEOA 2DAMA 1G3IA 1WGLA 1TR8A 1WGNA 2JY8A 2KNVA 1ZMVA 1HT2E 1WJ7A 1JR3E 3FRHA 2QHOB 3LCVB 1DO2A 2DHYA 2MGWA 1ZMUA 1R4GA 1VG5A 1VQ1A 1HJPA 2JY6B 1OTRA 2R0IA 2WZJA 3B89A 2DAKA 4F1IA 2JY5A 3F92A 1P3QQ 2LVAA 2L4EA 2ZTDA 4GEWA 1T6OA 1VEJA 1HQYE 1G4AE 1NV9A 2OOBA 3T6PA 2MROB 3IECA 1XXHE 3K9OA 4R71A 1TTEA 2MR9A 2K0BX 3GLGE 4F2LA 2JNHA 1VEKA 2KNZA 2QSFX 1SG9A 2CP8A 3FE3A 1WHCA 2RRUA 1OAIA 1GO5A 1KYIA 1V92A 2DZLA 2O25A 1VEGA 4WP2A 4G3OA 2G3QA 2K9DA 2DENA 1DO0A 1G41A 1Y8GA 3GLIE 1UFZA 2JZ0A 1CUKA 3E21A 3IHPA 1IM2A 2DI0A 3LCUA 5JI2E 2DKLA 2BWBA 2JY7A 1OKSA 3E46A 1XB2B 2HWJA 3BBZA 2LTUA 2LVNC 2KNAA 1HT1E 1Q02A 2ZTCA 1PGYA 2CWBA 1C7YA 1WR1B 1BVSA 3GLFE 2L4FA 2OO9A 1IXSA 3GLHE 5DFLA 4Q7JA 2DNAA 2QNJA 1WIVA 2LVOC 2L2DA 2EJSA 4DBGB 1E94E 2LBCA 2DAGA 2HAKA 1VDLA 1MN3A 3H4JA 1AIPC 2JP7A 2DAEA 3K9PA 1A5TA 2B3TA 1F4IA 2MJ5B 3FRIA 4UN2B 1OQYA 2H5XA 1DV0A 2DAIA 1EFUB 1YLAA 2EKFA 2LVPC 1T43A 1ZMWA 1QZEA 2JZ1A 2EKKA 1IFYA 2KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ D;  2OOA A;  2JUJ A;  2BWE A;  1ZV1 A;  1NV8 A;  3MMP A;  4HEO A;  2DAM A;  1G3I A;  1WGL A;  1TR8 A;  1WGN A;  2JY8 A;  2KNV A;  1ZMV A;  1HT2 E;  1WJ7 A;  1JR3 E;  3FRH A;  2QHO B;  3LCV B;  1DO2 A;  2DHY A;  2MGW A;  1ZMU A;  1R4G A;  1VG5 A;  1VQ1 A;  1HJP A;  2JY6 B;  1OTR A;  2R0I A;  2WZJ A;  3B89 A;  2DAK A;  4F1I A;  2JY5 A;  3F92 A;  1P3Q Q;  2LVA A;  2L4E A;  2ZTD A;  4GEW A;  1T6O A;  1VEJ A;  1HQY E;  1G4A E;  1NV9 A;  2OOB A;  3T6P A;  2MRO B;  3IEC A;  1XXH E;  3K9O A;  4R71 A;  1TTE A;  2MR9 A;  2K0B X;  3GLG E;  4F2L A;  2JNH A;  1VEK A;  2KNZ A;  2QSF X;  1SG9 A;  2CP8 A;  3FE3 A;  1WHC A;  2RRU A;  1OAI A;  1GO5 A;  1KYI A;  1V92 A;  2DZL A;  2O25 A;  1VEG A;  4WP2 A;  4G3O A;  2G3Q A;  2K9D A;  2DEN A;  1DO0 A;  1G41 A;  1Y8G A;  3GLI E;  1UFZ A;  2JZ0 A;  1CUK A;  3E21 A;  3IHP A;  1IM2 A;  2DI0 A;  3LCU A;  5JI2 E;  2DKL A;  2BWB A;  2JY7 A;  1OKS A;  3E46 A;  1XB2 B;  2HWJ A;  3BBZ A;  2LTU A;  2LVN C;  2KNA A;  1HT1 E;  1Q02 A;  2ZTC A;  1PGY A;  2CWB A;  1C7Y A;  1WR1 B;  1BVS A;  3GLF E;  2L4F A;  2OO9 A;  1IXS A;  3GLH E;  5DFL A;  4Q7J A;  2DNA A;  2QNJ A;  1WIV A;  2LVO C;  2L2D A;  2EJS A;  4DBG B;  1E94 E;  2LBC A;  2DAG A;  2HAK A;  1VDL A;  1MN3 A;  3H4J A;  1AIP C;  2JP7 A;  2DAE A;  3K9P A;  1A5T A;  2B3T A;  1F4I A;  2MJ5 B;  3FRI A;  4UN2 B;  1OQY A;  2H5X A;  1DV0 A;  2DAI A;  1EFU B;  1YLA A;  2EKF A;  2LVP C;  1T43 A;  1ZMW A;  1QZE A;  2JZ1 A;  2EKK A;  1IFY A;  2KHH A; 
#chains in the Genus database with same CATH topology
 3GRY A;  5FTM A;  3QWL A;  1QUT A;  1ZV1 A;  4QNM A;  4I81 A;  3MMP A;  1Z5C A;  1Z6T A;  1GLN A;  3GP1 A;  2WSF F;  4IBG A;  3LVV A;  1G3I A;  1QDR A;  3AJI B;  3HU2 A;  4Z8X A;  3M7G A;  4A3V B;  4OU7 A;  4DR2 M;  3RGP A;  2KNV A;  1G59 A;  1RU3 A;  4PDG A;  4P17 A;  4AQY M;  4M0D A;  3GPU A;  4FD2 A;  4CIS A;  3PXG A;  3I01 M;  3HU3 A;  2QQ8 A;  3KSX A;  4D81 A;  1L1Z A;  2F5Q A;  1TDZ A;  2Q2E B;  3HKP A;  3L2A A;  2JY6 B;  4Y28 F;  5KPR A;  1SXJ C;  1QYR A;  2R0I A;  3SAW A;  5E6J A;  3L27 A;  2DAK A;  2I7P A;  1YSY A;  2KRU A;  3GRU A;  2UUA M;  4LGM A;  5FTN A;  4TUW A;  1P3Q Q;  2LVA A;  3SFZ A;  1DGH A;  1PJJ A;  1HNX M;  2BNK A;  4BB9 A;  5EP1 A;  5EP3 A;  1IN4 A;  4PCZ A;  1TH3 A;  1GJS A;  3J27 B;  2L7H A;  1NV9 A;  2ERC A;  3B7Z A;  4NOO B;  2MRO B;  3HHZ A;  4DV6 M;  3KVW A;  2YQZ A;  3GQ3 A;  4HL4 A;  2MR9 A;  3VDU A;  1IN6 A;  2HCB A;  2JNH A;  2KNZ A;  2F5N A;  4NC6 A;  1J5E M;  2FH0 A;  2D7E A;  3VKH A;  1XMQ M;  2QSF X;  1I94 M;  5BR8 M;  3FTF A;  3FE3 A;  1NSF A;  1E32 A;  3VK7 A;  2XZU A;  3GLI B;  4JI6 M;  3AOG A;  3KDS E;  2RKO A;  1IXS B;  2J5Y A;  1IXR C;  1JB0 F;  1NO1 A;  3KXE C;  1E9R A;  4WUR A;  2R6F A;  1HNZ M;  1IY0 A;  1V34 A;  4CJ6 A;  2KA6 B;  4IIW A;  3SAR A;  3J2P B;  1UM8 A;  2FFJ A;  1MX0 A;  1ZAE A;  3GRR A;  3IHP A;  3CF2 A;  4XGI A;  3UMM A;  4DR7 M;  3FUT A;  3JR5 A;  1NVM A;  2DKL A;  2BWB A;  4PD2 A;  1SXJ A;  2R44 A;  3FUW A;  1PJI A;  2CV0 A;  1XB2 B;  2HWJ A;  3BBZ A;  2UUC M;  2LHG A;  4KLN A;  3HHW A;  3VDP A;  2Y0Q A;  1IXZ A;  2VII A;  3U6M A;  4DV7 M;  3LQQ A;  4AI6 A;  4KO8 A;  1WR1 B;  2KZU A;  3HWS A;  3KW6 A;  4JI4 M;  4LJ8 A;  2YR0 A;  5E26 A;  3HJ8 A;  4NSO B;  2V1U A;  2L4F A;  2FNA A;  3AOE C;  3CGW A;  4GIP A;  3T38 A;  4IJE A;  4KT0 F;  5DFL A;  4OVZ A;  2QBY B;  2XH9 A;  2DNA A;  2QP9 X;  4IBE A;  4LRS A;  3JAM S;  4GKK M;  3C58 A;  4X66 M;  4RKU F;  2HAK A;  1VDL A;  2ZBK B;  8CAT A;  4JI0 M;  3GPX A;  1MN3 A;  1DGF A;  3C3E A;  2O5R A;  5EP2 A;  3TPZ A;  4XK8 F;  4X65 M;  2QPA A;  1K82 A;  1HQC A;  2C9C A;  4R3D A;  5GKN A;  2D7H A;  3HY5 A;  2DHR A;  3FRI A;  1IY1 A;  2R65 A;  3KS4 A;  4GIT A;  4LZZ A;  5KPT A;  1L2B A;  3ILK A;  1ORY B;  3FUU A;  2H5X A;  1DV0 A;  4B3S M;  2EKF A;  4GHA A;  3SAV A;  2V6Z M;  4LF5 M;  1TDH A;  1N34 M;  2VF7 A;  1XMO M;  3LQR A;  2JZ1 A;  2KXE A;  2QZ4 A;  1IFY A;  5EQT A;  3PNY A;  2ZAO A;  1WGL A;  2WSC F;  4FWH A;  1E9S A;  4NL4 H;  3RGS A;  2O01 F;  1OFH A;  4JI8 M;  1HT2 E;  4LFB M;  2QHO B;  1N77 A;  1DO2 A;  1DGG A;  2XLJ A;  2M5Z A;  1LTM A;  3HJS A;  3PVS A;  3QYE A;  2HHH M;  3MJ5 A;  5IZ7 D;  4B3T M;  4JI1 M;  4L6V 6;  4LFA M;  4M9X A;  3TWL A;  1N33 M;  1HJP A;  3RE8 A;  1L2D A;  4D82 A;  3SMP A;  1R5L A;  3BXW A;  3HGI A;  2WZJ A;  5ITR A;  3MHV C;  2JA2 A;  1QDT A;  1XXH B;  1JR3 D;  2R18 A;  2CV2 A;  2JY5 A;  3AOE A;  5FLX S;  3D8L A;  3F92 A;  4HLQ A;  1GJT A;  4LJ4 A;  3BOS A;  2VF8 A;  3HX3 A;  3GLG B;  5EJC A;  1PRB A;  3VLF B;  3L25 A;  1T3T A;  1TH2 A;  4ITQ A;  1T6O A;  2MH8 A;  4I8O A;  3GQ4 A;  2DZO B;  1Z5B A;  3JR4 A;  1G4A E;  3AFH A;  4NXM M;  2R46 A;  4LGY A;  3KOZ E;  1PM5 A;  4B7H A;  3IEC A;  2XSZ A;  1IBL M;  3K9O A;  4R71 A;  1FJG M;  1TTE A;  4GC5 A;  3M6A A;  4FCW A;  1R2Z A;  3T1Y M;  2F5O A;  2APL A;  2Z8Y M;  3FUV A;  2DWL A;  4M0W A;  2KZS A;  1NNU C;  1NY5 A;  4MM3 B;  2RRU A;  2OQ4 A;  1NNJ A;  4G6Z A;  3M0E A;  2CE7 A;  2DWZ B;  4AKH A;  2EA0 A;  1OAI A;  5EXS A;  1GO5 A;  5IT9 S;  4MGK E;  3GPP A;  2UXB M;  3NWL A;  1V92 A;  4X64 M;  3U6L A;  3SAT A;  4DUZ M;  2DZL A;  5EXP A;  2E5L M;  1VEG A;  3FTD A;  3KP0 E;  3NBI A;  1NHG C;  4IBJ A;  4WP2 A;  4CHT B;  1H6U A;  1PJS A;  4LG2 A;  4AKG A;  3PFI A;  4D80 A;  1FNN A;  2FE8 A;  1IBK M;  4B7F A;  2K9D A;  3D8B A;  4LJ6 A;  1G41 A;  4GMQ A;  2FS1 A;  1UFZ A;  4LJ5 A;  4WW0 A;  3E21 A;  3VFD A;  2DI0 A;  3GLI E;  4DUY M;  3U61 B;  4JI3 M;  1QQW A;  2XFT A;  2JY7 A;  4LCB A;  5JI2 E;  4YY3 M;  5IRE B;  2F4V M;  1N78 A;  3E46 A;  2Z3X A;  3U5Z B;  4LF8 M;  5H37 D;  2LVN C;  1XHB A;  4GKJ M;  5FTK A;  1TF0 B;  3U60 B;  4GH9 A;  2DZN B;  4NRV A;  4L15 A;  2ZTC A;  1PGY A;  4AW4 A;  3SMS A;  1GAB A;  1D0M A;  1VDD A;  3AKZ A;  4DV5 M;  4DR1 M;  3GLF E;  3SYK A;  2W82 A;  3DFZ A;  5DNY A;  3TWM A;  4LZJ A;  2Y20 A;  3UZU A;  3HZJ A;  2L7I A;  2XGN A;  1QZM A;  4Q7J A;  2CFO A;  2QCU A;  3DOA A;  4ZPX A;  4ANR A;  1WIV A;  2LVO C;  2HL7 A;  2CEA A;  1TGU A;  2X4A A;  1LV7 A;  2EJS A;  5KO3 A;  3HHX A;  2DVW B;  3W0F A;  4JI7 M;  1GKI A;  3U6C A;  3GLF B;  4DV0 M;  1NJF A;  4DR4 M;  5ITU A;  3SYL A;  3EIE A;  3C9P A;  1W5T A;  2MJ5 B;  2D7G A;  4CIZ A;  4UN2 B;  5KQ8 A;  2UXD M;  2A5Y B;  2ZAN A;  1OQY A;  1QVR A;  3GO8 A;  4B3R M;  3SBJ A;  5KQD A;  3LVW A;  1EFU B;  1T43 A;  1JR3 A;  2XZF A;  1QZE A;  4IBI A;  2OOA A;  3FTC A;  2JUJ A;  2BWE A;  2YFQ A;  3EIH A;  4FW9 A;  4QOS A;  3SHG B;  4B3M M;  3L29 A;  2DAM A;  2ZAM A;  1OIP A;  1Z5A A;  2KW0 A;  2DWN A;  1TR8 A;  1WGN A;  4S12 A;  1K3X A;  1WJ7 A;  2DXI A;  3I51 A;  2K47 A;  1JR3 E;  3FRH A;  4L78 A;  2DHY A;  2MGW A;  2J7O A;  3A46 A;  1ZMU A;  1R4G A;  3SAS A;  3FYC A;  2DWM A;  4II7 A;  1J7K A;  4OW0 A;  5ITX A;  1VQ1 A;  3TL4 X;  5LMN M;  2BJW A;  2VQF M;  1OTR A;  5C18 A;  3WHL A;  1XXH A;  3B89 A;  4R7G A;  3ZC7 B;  1R2Y A;  4F1I A;  3GRV A;  2M60 A;  3KOY E;  3MK6 A;  3KS8 A;  4AG5 A;  4DR6 M;  5IWA M;  3GLG A;  3HU1 A;  2ZTD A;  3U6S A;  1L2C A;  1J09 A;  1TH4 A;  4GEW A;  1QUS A;  3J80 S;  3W67 A;  2KDL A;  4M9Z A;  1Q3C A;  1VEJ A;  3FYD A;  5ITX E;  3T6P A;  4X62 M;  4W5W A;  1XXH E;  3PNV A;  2NQ8 C;  3SHF A;  1C1K A;  4NXN M;  2Y21 A;  4YHH M;  4DR5 M;  1L1T A;  4OX9 M;  3WHK A;  4LF7 M;  4QOZ C;  3GLG E;  4F2L A;  4IBC A;  3U6D A;  3K2L A;  4AG6 A;  4M9S A;  4JI5 M;  1IQP A;  1MJG M;  2LXE A;  5FTJ A;  2R4J A;  3KOW E;  4MGY E;  3I04 M;  1SG9 A;  2CP8 A;  1G8P A;  1WHC A;  2Z7J A;  3B7Q A;  4IBK A;  4IJF A;  4RNA A;  4L8R C;  2C9O A;  2ZM6 M;  1HNW M;  2P5T A;  3ZH9 B;  5KPZ A;  4RF0 A;  3U6E A;  1HR0 M;  5DYG A;  1X37 A;  3TWK A;  1XWI A;  4OVZ B;  2O25 A;  2N35 A;  2I7N A;  3CF6 E;  5A2Q S;  1NJG A;  1R7R A;  1IN7 A;  2YNM D;  2Z4S A;  5C1B A;  1N36 M;  4L16 A;  1Z59 A;  2DEN A;  3U6O A;  2JZ0 A;  3U61 A;  3Q8X A;  1PJT A;  3LCU A;  3GLH B;  1SXJ D;  5LMU M;  2Y0T A;  2GQF A;  3LMM A;  4QHT A;  7CAT A;  1I4W A;  4JYA M;  2LTU A;  4FWG A;  3U60 A;  2KEB A;  2KNA A;  1HT1 E;  2WSE F;  3CTW B;  3K92 A;  2EUC A;  1YUB A;  4FCV A;  2G5G X;  3GLI A;  3I4V A;  1QAN A;  5EXX A;  1IXS A;  1XC8 A;  4NSR A;  3UGJ A;  1EIJ A;  4EIW A;  3KFU G;  2K6B A;  2QEN A;  3J7A S;  1ZQ9 A;  3K1J A;  2L2D A;  2CHQ A;  4IBB A;  2C98 A;  4I4L A;  1QAQ A;  1E94 E;  1GL6 A;  2DAG A;  2L6O A;  1WXQ A;  4GHL A;  3GLF A;  3H4J A;  3B74 A;  3H4M A;  1AIP C;  1NY6 A;  2JP7 A;  2DAE A;  3E9S A;  4AZF A;  2JWS A;  3K9P A;  4DV1 M;  1A5T A;  4MGI E;  2UUB M;  1V33 A;  2B3T A;  1F4I A;  3T1H M;  2VDB B;  2FOI C;  2CUZ A;  2DAI A;  1G71 A;  3FKE A;  2LVP C;  2GNO A;  3J7B A;  4LY6 A;  3U6Q A;  2KRK A;  2R62 A;  2RGH A;  3TQS A;  2EKK A;  4MB7 A;  5FSW A;  2KHH A;  2LVQ D;  5L8R F;  4JV5 M;  4XBO A;  3V76 A;  2HKJ A;  3FUX A;  4RF1 A;  1NV8 A;  2RGO A;  4FWD A;  4HEO A;  1NHW C;  1GVN A;  1OJL A;  2EO2 A;  3GPY A;  3A45 A;  4PDI A;  1OFI A;  2JY8 A;  4B7G A;  1ZMV A;  3KP1 E;  5DYI A;  2CHG A;  3L26 A;  2QBY A;  1N32 M;  3LCV B;  4PT5 A;  2XEP A;  4QHS A;  3CF0 A;  4DV2 M;  1VG5 A;  1Q39 A;  3ZCB B;  2XFS A;  3ZQJ A;  2R45 A;  1OIZ A;  3L28 A;  4CGY B;  4JI2 M;  4JXJ A;  3R9X B;  4G4R A;  3E4R A;  3Q8G A;  4MGZ E;  4KHP M;  1MU5 A;  1DGB A;  2C96 A;  2L4E A;  1DGH B;  2VQE M;  4B08 A;  3IG5 A;  1K3W A;  3NBX X;  2R4E A;  4LJ7 A;  5FTL A;  1GL7 A;  1HQY E;  2OOB A;  2H1R A;  2L09 A;  2XSZ D;  2CV1 A;  3RFW A;  3AL0 C;  3R8F A;  4MH0 E;  1IY2 A;  1XNQ M;  1JQJ C;  3TE6 A;  2K0B X;  3GQ5 A;  3LW5 F;  4BLC A;  1W5S A;  3J81 S;  4G4O A;  1VEK A;  3W0L B;  1XNR M;  5BPV A;  1IBM M;  5JI3 E;  2CHV A;  2X49 A;  4KOD A;  4LJA A;  4JN6 A;  3KOX E;  2UU9 M;  1YE9 A;  3SAU A;  3QAU A;  4REZ A;  2J7N A;  3DZD A;  1L8Q A;  4Z6Y A;  3C3D A;  3UK6 A;  2LHC A;  1KYI A;  1SXJ E;  2LH0 A;  2V1C A;  4GRI A;  4LF4 M;  1IN8 A;  1IN5 A;  1R6B X;  3THG A;  3OTO M;  4K0K M;  4P16 A;  3AV0 A;  3U6P A;  1N75 A;  3KSJ A;  4G3O A;  4IBF A;  5EP4 A;  3VKG A;  3I4Y A;  2AHM A;  2G3Q A;  3SC3 A;  4AKI A;  5ITQ A;  1D0K A;  1DO0 A;  4LF9 M;  1Y8G A;  4BBA A;  5F3W A;  2UXC M;  1CUK A;  1IM2 A;  3GLH A;  1KSF X;  1QAO A;  3T15 A;  3W68 A;  1KFV A;  1OKS A;  3B9P A;  1SXJ B;  4GC9 A;  5EXT A;  1Q3B A;  3VK8 A;  2G8L A;  2JXN A;  1EE8 A;  3A42 A;  4LFC M;  1Q02 A;  1C7Y A;  1D0L A;  2BJV A;  2CWB A;  2XF3 A;  5ITT A;  3FD9 A;  1BVS A;  3FTE A;  4DV3 M;  2F5S A;  4FCT A;  2OO9 A;  3QYB A;  4QNR A;  3GLH E;  1D2N A;  3A98 B;  4I5S A;  4DV4 M;  2CRU A;  2LWX A;  4G4Q A;  2QNJ A;  2OPF A;  4DBG B;  4LRT A;  2C99 A;  3UJN A;  2LBC A;  1OAO C;  4NRW A;  3B7N A;  3HJQ A;  4L4U A;  1S3S A;  4G4N A;  1QAM A;  4FVM A;  4LJ9 A;  4MGH A;  1PJQ A;  4IBD A;  5ITY A;  3U5Z A;  4DR3 M;  3DA1 A;  2Z4R A;  3HHY A;  1YLA A;  2LNH C;  4LF6 M;  2X8A A;  1ZMW A;  2C5R A;  1AUA A;  3K8Z A;  3IG8 A;  2F5P A; 
#chains in the Genus database with same CATH homology
 2LVQ D;  2OOA A;  2JUJ A;  2BWE A;  1ZV1 A;  1NV8 A;  3MMP A;  4HEO A;  2DAM A;  1G3I A;  1WGL A;  1TR8 A;  1WGN A;  2JY8 A;  2KNV A;  1ZMV A;  1HT2 E;  1WJ7 A;  1JR3 E;  3FRH A;  2QHO B;  3LCV B;  1DO2 A;  2DHY A;  2MGW A;  1ZMU A;  1R4G A;  1VG5 A;  1VQ1 A;  1HJP A;  2JY6 B;  1OTR A;  2R0I A;  2WZJ A;  3B89 A;  2DAK A;  4F1I A;  2JY5 A;  3F92 A;  1P3Q Q;  2LVA A;  2L4E A;  2ZTD A;  4GEW A;  1T6O A;  1VEJ A;  1HQY E;  1G4A E;  1NV9 A;  2OOB A;  3T6P A;  2MRO B;  3IEC A;  1XXH E;  3K9O A;  4R71 A;  1TTE A;  2MR9 A;  2K0B X;  3GLG E;  4F2L A;  2JNH A;  1VEK A;  2KNZ A;  2QSF X;  1SG9 A;  2CP8 A;  3FE3 A;  1WHC A;  2RRU A;  1OAI A;  1GO5 A;  1KYI A;  1V92 A;  2DZL A;  2O25 A;  1VEG A;  4WP2 A;  4G3O A;  2G3Q A;  2K9D A;  2DEN A;  1DO0 A;  1G41 A;  1Y8G A;  3GLI E;  1UFZ A;  2JZ0 A;  1CUK A;  3E21 A;  3IHP A;  1IM2 A;  2DI0 A;  3LCU A;  5JI2 E;  2DKL A;  2BWB A;  2JY7 A;  1OKS A;  3E46 A;  1XB2 B;  2HWJ A;  3BBZ A;  2LTU A;  2LVN C;  2KNA A;  1HT1 E;  1Q02 A;  2ZTC A;  1PGY A;  2CWB A;  1C7Y A;  1WR1 B;  1BVS A;  3GLF E;  2L4F A;  2OO9 A;  1IXS A;  3GLH E;  5DFL A;  4Q7J A;  2DNA A;  2QNJ A;  1WIV A;  2LVO C;  2L2D A;  2EJS A;  4DBG B;  1E94 E;  2LBC A;  2DAG A;  2HAK A;  1VDL A;  1MN3 A;  3H4J A;  1AIP C;  2JP7 A;  2DAE A;  3K9P A;  1A5T A;  2B3T A;  1F4I A;  2MJ5 B;  3FRI A;  4UN2 B;  1OQY A;  2H5X A;  1DV0 A;  2DAI A;  1EFU B;  1YLA A;  2EKF A;  2LVP C;  1T43 A;  1ZMW A;  1QZE A;  2JZ1 A;  2EKK A;  1IFY A;  2KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...