1P3QQ

Mechanism of ubiquitin recognition by the cue domain of vps9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
45
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAASGPCVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Vacuolar protein sorting-associated protein VPS9
total genus 13
structure length 45
sequence length 47
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
3K9OA 5DFLA 1GO5A 3E46A 2DAMA 2MR9A 2DI0A 2JZ0A 3T6PA 3GLGE 1T6OA 3GLIE 4F2LA 2MGWA 1OTRA 3IECA 1PGYA 2R0IA 2OOBA 4DBGB 1NV9A 1CUKA 2HWJA 2LVAA 3H4JA 2BWBA 2LBCA 2LVOC 2QNJA 2EKKA 2MJ5B 2KHHA 2ZTCA 3B89A 1IXSA 2O25A 3GLHE 1WR1B 1JR3E 1DV0A 2H5XA 3FRHA 2MROB 3FE3A 1G41A 1HJPA 1IFYA 2K0BX 1P3QQ 1QZEA 2BWEA 1AIPC 2DAKA 2JZ1A 2DNAA 1EFUB 1DO0A 4HEOA 2QHOB 3IHPA 2OO9A 1VG5A 2DAEA 1G3IA 2JY5A 2HAKA 2JY6B 1OAIA 1UFZA 2RRUA 2B3TA 1NV8A 2DKLA 2WZJA 1ZMWA 2LTUA 2LVPC 3E21A 3LCUA 1HT1E 2KNAA 1VEKA 4UN2B 2DZLA 3FRIA 1VEGA 4G3OA 1TR8A 4F1IA 2JUJA 1HQYE 3BBZA 1Q02A 1WHCA 2DHYA 1OKSA 2K9DA 1ZMVA 1VEJA 4Q7JA 2G3QA 3GLFE 2EJSA 2JNHA 1TTEA 2L4FA 1WGLA 2QSFX 1OQYA 2CWBA 1SG9A 2DENA 2KNVA 1KYIA 1DO2A 1IM2A 4WP2A 1WGNA 1T43A 1V92A 1YLAA 1G4AE 1XB2B 2OOAA 4R71A 2ZTDA 2CP8A 3LCVB 3K9PA 1BVSA 1XXHE 1MN3A 5JI2E 1A5TA 1Y8GA 2JP7A 3F92A 3MMPA 2EKFA 1ZV1A 2KNZA 2LVQD 4GEWA 1ZMUA 1F4IA 2JY7A 1E94E 1VDLA 2DAGA 2L4EA 2L2DA 1WIVA 1WJ7A 1R4GA 1HT2E 2JY8A 1VQ1A 1C7YA 2DAIA 2LVNC
chains in the Genus database with same CATH superfamily
5KQDA 2I7NA 4PCZA 1Z59A 4EIWA 1E9SA 4AKIA 5JI3E 2LH0A 1IBMM 3A46A 3FTCA 2VIIA 5KPTA 2XH9A 3LQQA 2UUCM 4F2LA 1PJIA 1OFHA 3TWKA 1OTRA 1EE8A 1PGYA 2HCBA 4FWHA 2K6BA 4OW0A 3U6SA 1NV9A 1OIZA 4QOSA 3K92A 1L1ZA 1CUKA 1R5LA 2R45A 2BWBA 3U6CA 1TDZA 2QENA 2KZUA 2A5YB 3HX3A 2CHVA 1QZMA 3GLGA 4P16A 5ITYA 2VF7A 1S3SA 2ZTCA 4NRVA 4RKUF 1YSYA 3HU3A 3HGIA 1YUBA 3KSXA 5BR8M 1IY0A 3NWLA 2WSFF 5IZ7D 1K82A 1VDDA 4JI5M 1HNWM 3U60B 3SHGB 4DR1M 1XWIA 2MROB 3FE3A 4L16A 2JA2A 1YE9A 2D7HA 1TDHA 2L7IA 4PD2A 5KQ8A 3U61B 2DAKA 1AIPC 1IXZA 1GVNA 3KOYE 2JZ1A 2EUCA 2DNAA 5ITUA 1Q3BA 4LJ9A 3KFUG 1DO0A 4LJAA 2QHOB 1TGUA 4FWGA 2JY5A 2M5ZA 3HZJA 1QDRA 2N35A 3SAVA 3AOEA 2UUAM 1GJTA 2AHMA 2R6FA 2F5QA 4JI7M 2ZBKB 2EA0A 3H4MA 4LF8M 4MH0E 4W5WA 1IN8A 2X8AA 5EJCA 3DZDA 2Z4SA 4LJ6A 4LJ7A 1HT1E 2KNAA 4FW9A 4G4OA 1VEKA 3LMMA 3VDPA 4BLCA 1TR8A 4BB9A 4DR4M 4FD2A 5IT9S 3FYCA 1QVRA 1D2NA 1XNRM 3DFZA 3ZC7B 1OKSA 2KW0A 2YQZA 2ZAOA 4GMQA 4QOZC 2UXBM 2NQ8C 3B7NA 2F5SA 1Z5AA 3GLFE 4IBIA 2L4FA 2QSFX 1WGLA 4FVMA 4LF6M 3VKHA 1SG9A 2YNMD 2DENA 3RE8A 4Z8XA 1DO2A 3TL4X 1T3TA 3QWLA 4MGYE 2CRUA 2QZ4A 1T43A 3FTFA 4IBDA 4KLNA 4GKKM 3DOAA 3MHVC 4L6V6 1XB2B 4I5SA 2QCUA 3BXWA 2O5RA 2XF3A 4B08A 5EXPA 2QP9X 4X66M 2XSZA 4R71A 4OX9M 2Y0TA 3LCVB 4B3MM 1V34A 2VQEM 4XGIA 5KPRA 4DUZM 1PM5A 1FJGM 2UXDM 3SC3A 1NNUC 4NOOB 3TQSA 3B74A 3THGA 4JYAM 1X37A 2L7HA 3GLGB 1A5TA 1MX0A 1Y8GA 2Q2EB 4KHPM 2UU9M 3VFDA 2Z4RA 4FCTA 3GQ5A 4M0DA 1JB0F 1GL6A 4NSOB 2K47A 4PDIA 1MJGM 2LNHC 2XGNA 2Y0QA 2DAGA 4CJ6A 4JV5M 1N33M 3UJNA 2UUBM 2RGOA 3I04M 5F3WA 1QUSA 3FTEA 3JR4A 4LG2A 4CHTB 2JWSA 1VQ1A 4AG5A 2DAIA 1C7YA 3GLIA 5EP4A 1NO1A 4MM3B 4LRSA 1AUAA 1MU5A 1KFVA 4GIPA 3HHWA 4LJ5A 2DAMA 2MR9A 2V6ZM 2DVWB 3T6PA 3GLGE 2DZNB 1SXJE 3K2LA 1G8PA 4GC9A 3GLIE 1IBKM 1Z6TA 4XBOA 4DV5M 2R65A 2R0IA 1QAQA 1J5EM 1SXJB 3HU1A 3I4YA 4DBGB 3FKEA 7CATA 2HWJA 4JN6A 4CIZA 1IN4A 4Z6YA 4HLQA 3KP0E 3R9XB 2M60A 2MJ5B 2RKOA 4L8RC 4MGZE 1IXSA 3JR5A 2HL7A 3R8FA 3LQRA 3SMSA 4TUWA 4QNRA 1XHBA 1JR3E 1WXQA 3HJ8A 3RGSA 1GABA 3PFIA 2QQ8A 3UGJA 2P5TA 4ZPXA 4LFAM 3UMMA 4G4RA 1NHGC 1TH2A 4NC6A 1IY1A 1QAOA 3D8BA 4IBEA 2C5RA 2BWEA 5GKNA 3J7AS 1LTMA 4M9XA 3QYEA 2XZUA 3HY5A 1GJSA 3Q8GA 2RGHA 2LWXA 5KO3A 1H6UA 2FE8A 4LRTA 2HAKA 1QYRA 4FWDA 1JQJC 1UFZA 2R46A 4HL4A 4IBKA 4ANRA 3ZQJA 5A2QS 4L15A 4G4NA 3IG5A 1E9RA 1OFIA 3U5ZB 2V1CA 2XFTA 3I4VA 3E21A 4DR5M 4LGMA 4M0WA 2CV2A 2HKJA 3LCUA 4P17A 3HJQA 3UZUA 1W5TA 2J7OA 2DXIA 2KRKA 2DZLA 3FRIA 1VEGA 1HR0M 4LZJA 2QPAA 4YY3M 4MGKE 3GLFB 3BBZA 1Q02A 2DHYA 5EXXA 5IWAM 2X4AA 4BBAA 1IQPA 1VEJA 4DR7M 5LMUM 2G3QA 1TTEA 2GNOA 2D7EA 4M9SA 4YHHM 2CWBA 4JXJA 4OU7A 1N75A 1NY6A 4LF5M 1EIJA 3GQ4A 3L27A 4LJ8A 5EQTA 1W5SA 3CF2A 3T1YM 2ZAMA 3HKPA 4K0KM 4D81A 1K3WA 4NXMM 2I7PA 1YLAA 2YFQA 4LF7M 4LFBM 4IBBA 3L29A 3KSJA 3AV0A 4L4UA 2ZANA 3TWLA 1N32M 3K9PA 5L8RF 1BVSA 3HU2A 4DV3M 1DGHA 2L6OA 2Y20A 5LMNM 3W0LB 5EXTA 4IJFA 3SFZA 2FS1A 2JP7A 3W68A 4AKHA 1J7KA 2C98A 4IJEA 5EP1A 1QAMA 2APLA 4D80A 2LVQD 3GQ3A 1N77A 3AOEC 1E94E 3SYKA 3SARA 4NL4H 4PT5A 5EP2A 1Z5CA 2WSCF 1JR3A 4JI6M 3CF0A 5FTNA 2L09A 1GO5A 2DWMA 3B9PA 4DR3M 2XFSA 3FUTA 3E46A 3QYBA 8CATA 4B7FA 3FD9A 2DWLA 2F5OA 1T6OA 4LF9M 4CGYB 5ITRA 4LCBA 1IXRC 1NJFA 3B7ZA 4IIWA 5FTMA 2MGWA 1D0LA 3C3DA 2V1UA 4RNAA 3E9SA 2BJVA 4DUYM 4Y28F 3EIEA 2LVAA 5KPZA 3H4JA 3AOGA 3GRUA 1Q39A 2C99A 2LBCA 4I4LA 2QNJA 2EKKA 4QHSA 4RF1A 4S12A 1L2CA 5E6JA 2F5NA 1NHWC 1XC8A 2KHHA 3KOWE 4X62M 2CUZA 5FTKA 2KDLA 2O25A 1NSFA 3GLHE 4X64M 4GITA 1XXHA 4II7A 1PJTA 4QHTA 3KVWA 2H5XA 2X49A 3J80S 3FRHA 1G59A 3J2PB 2FFJA 4KO8A 1I4WA 2K0BX 4LGYA 2FH0A 3KOXE 3GLHA 3I01M 2DWNA 3U6OA 3L2AA 2J7NA 3L28A 2VF8A 2YR0A 2CFOA 2GQFA 3WHKA 3IHPA 2OO9A 3VLFB 3SASA 5BPVA 2DAEA 2KZSA 2F4VM 3V76A 3U6LA 4CISA 2RRUA 2B3TA 4AI6A 1HQCA 2LXEA 1DGBA 1IXSB 1ZQ9A 2KXEA 4LY6A 2DKLA 3Q8XA 2ZM6M 2WZJA 1ZMWA 2D7GA 2LTUA 2JXNA 3HHYA 2H1RA 3ZCBB 2BNKA 2Y21A 5EXSA 1KSFX 2KA6B 2Z8YM 1N34M 1LV7A 3J81S 3MK6A 3L25A 4G3OA 2J5YA 2XSZD 4F1IA 3GLFA 2CHGA 4DV1M 5C1BA 1N78A 4AZFA 1HQYE 3A45A 4DR6M 4DV7M 1TH4A 3K1JA 3LVVA 2EJSA 2JNHA 3FUVA 3EIHA 5ITXA 1OQYA 2R62A 3HHZA 5FTLA 4IBGA 1IM2A 3HJSA 4KODA 1WGNA 1I94M 4QNMA 5E26A 4MB7A 2CE7A 1V92A 1SXJD 2LHCA 2EO2A 3T1HM 1PJQA 3GRRA 4AQYM 3U60A 4DV6M 1QDTA 2CP8A 3T38A 1L8QA 4L78A 1XXHE 1MN3A 5FTJA 5JI2E 3AL0C 3KDSE 2OPFA 4WURA 2VQFM 3MMPA 3GLHB 3KS8A 1N36M 2W82A 3GRVA 2QBYB 1ZV1A 2FOIC 3RFWA 1OIPA 1L2DA 4LJ4A 3BOSA 1ZMUA 1F4IA 3FUXA 4A3VB 4R3DA 1ORYB 4JI8M 1UM8A 2L2DA 1WIVA 4REZA 3OTOM 1R4GA 3C3EA 1TH3A 3AFHA 3M0EA 4B3SM 3HHXA 5DNYA 4GH9A 4NSRA 4MGHA 3K9OA 3LW5F 5DFLA 4FCVA 2XZFA 3C58A 3A42A 4IBJA 3W0FA 3KP1E 2DI0A 1PRBA 2JZ0A 2R4EA 3C9PA 3U6DA 3PXGA 3SHFA 1IY2A 3WHLA 3B7QA 3L26A 1HNXM 4GC5A 1R2YA 2HHHM 2C9CA 3DA1A 4XK8F 4GHLA 3IECA 4DV4M 1L2BA 4I81A 1IN7A 5EP3A 2OOBA 3I51A 1OAOC 3FYDA 4I8OA 3GPPA 3GLIB 1RU3A 3GP1A 4JI4M 2R4JA 3KOZE 3PNVA 3SBJA 2Z3XA 2Z7JA 3U6MA 2DHRA 3SMPA 2LVOC 2G5GX 3ILKA 1QANA 1V33A 3K8ZA 5DYGA 3GPUA 4B7HA 3NBIA 2G8LA 1IN5A 3B89A 3CTWB 3HWSA 4RF0A 3AKZA 4R7GA 4NRWA 1NY5A 1WR1B 1XMOM 2QBYA 1J09A 3U5ZA 1DGGA 2CEAA 3SATA 1DV0A 3M7GA 4G6ZA 3U61A 1D0KA 1G41A 4IBCA 1IN6A 1HJPA 4LZZA 1IFYA 1HNZM 3MJ5A 1P3QQ 1QZEA 2KRUA 5ITXE 3AJIB 1ZAEA 4NXNM 3FUWA 4WW0A 1OJLA 2CV1A 3NBXX 5FSWA 1EFUB 4IBFA 4HEOA 1DGHB 5C18A 1VG5A 2KEBA 3UK6A 4OVZB 1G3IA 2VDBB 1G71A 1XXHB 1TF0B 2JY6B 1OAIA 3IG8A 2CHQA 3TE6A 3A98B 3U6QA 1IBLM 3GPXA 1XMQM 1NV8A 4ITQA 3SYLA 1FNNA 4JI3M 4DV2M 1Z5BA 1R7RA 3CGWA 2LVPC 5H37D 1Q3CA 3VK8A 2O01F 4MGIE 3SAWA 1GL7A 4UN2B 3U6PA 3TPZA 2C9OA 1GKIA 3T15A 3VKGA 2JUJA 3VDUA 3W67A 1PJSA 1WHCA 3PVSA 2K9DA 1ZMVA 3FUUA 3GPYA 2DZOB 4Q7JA 1SXJA 1E32A 4KT0F 4B3TM 4X65M 2CV0A 2MH8A 4OVZA 1SXJC 2E5LM 2KNVA 1KYIA 3GRYA 3LVWA 2OQ4A 1NJGA 2R44A 1NNJA 2DWZB 4WP2A 3D8LA 1K3XA 3SAUA 4LFCM 1G4AE 3KS4A 2ERCA 3VK7A 2OOAA 3PNYA 4AKGA 3TWMA 2BJWA 3FTDA 1XNQM 4D82A 1NVMA 4GKJM 3KW6A 2ZTDA 4B3RM 3M6AA 1JR3D 3JAMS 4G4QA 4JI1M 4DV0M 5DYIA 1L1TA 4JI0M 2WSEF 2LHGA 3J27B 4GRIA 3KXEC 2UXCM 4PDGA 3F92A 5FLXS 2FNAA 4LF4M 2F5PA 4B7GA 3U6EA 4GHAA 2EKFA 2R18A 3E4RA 1DGFA 2KNZA 4FCWA 4GEWA 1R2ZA 3J7BA 2XLJA 2JY7A 1VDLA 3RGPA 4AG6A 3CF6E 1PJJA 1QUTA 4DR2M 2L4EA 3ZH9B 5IREB 1D0MA 2C96A 4M9ZA 4JI2M 1WJ7A 5ITQA 1QQWA 1C1KA 1GLNA 5ITTA 1R6BX 2XEPA 1HT2E 2JY8A 3QAUA 4AW4A 2LVNC 3GO8A
chains in the Genus database with same CATH topology
3K9OA 5DFLA 1GO5A 3E46A 2DAMA 2MR9A 2DI0A 2JZ0A 3T6PA 3GLGE 1T6OA 3GLIE 4F2LA 2MGWA 1OTRA 3IECA 1PGYA 2R0IA 2OOBA 4DBGB 1NV9A 1CUKA 2HWJA 2LVAA 3H4JA 2BWBA 2LBCA 2LVOC 2QNJA 2EKKA 2MJ5B 2KHHA 2ZTCA 3B89A 1IXSA 2O25A 3GLHE 1WR1B 1JR3E 1DV0A 2H5XA 3FRHA 2MROB 3FE3A 1G41A 1HJPA 1IFYA 2K0BX 1P3QQ 1QZEA 2BWEA 1AIPC 2DAKA 2JZ1A 2DNAA 1EFUB 1DO0A 4HEOA 2QHOB 3IHPA 2OO9A 1VG5A 2DAEA 1G3IA 2JY5A 2HAKA 2JY6B 1OAIA 1UFZA 2RRUA 2B3TA 1NV8A 2DKLA 2WZJA 1ZMWA 2LTUA 2LVPC 3E21A 3LCUA 1HT1E 2KNAA 1VEKA 4UN2B 2DZLA 3FRIA 1VEGA 4G3OA 1TR8A 4F1IA 2JUJA 1HQYE 3BBZA 1Q02A 1WHCA 2DHYA 1OKSA 2K9DA 1ZMVA 1VEJA 4Q7JA 2G3QA 3GLFE 2EJSA 2JNHA 1TTEA 2L4FA 1WGLA 2QSFX 1OQYA 2CWBA 1SG9A 2DENA 2KNVA 1KYIA 1DO2A 1IM2A 4WP2A 1WGNA 1T43A 1V92A 1YLAA 1G4AE 1XB2B 2OOAA 4R71A 2ZTDA 2CP8A 3LCVB 3K9PA 1BVSA 1XXHE 1MN3A 5JI2E 1A5TA 1Y8GA 2JP7A 3F92A 3MMPA 2EKFA 1ZV1A 2KNZA 2LVQD 4GEWA 1ZMUA 1F4IA 2JY7A 1E94E 1VDLA 2DAGA 2L4EA 2L2DA 1WIVA 1WJ7A 1R4GA 1HT2E 2JY8A 1VQ1A 1C7YA 2DAIA 2LVNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O A;  5DFL A;  1GO5 A;  3E46 A;  2DAM A;  2MR9 A;  2DI0 A;  2JZ0 A;  3T6P A;  3GLG E;  1T6O A;  3GLI E;  4F2L A;  2MGW A;  1OTR A;  3IEC A;  1PGY A;  2R0I A;  2OOB A;  4DBG B;  1NV9 A;  1CUK A;  2HWJ A;  2LVA A;  3H4J A;  2BWB A;  2LBC A;  2LVO C;  2QNJ A;  2EKK A;  2MJ5 B;  2KHH A;  2ZTC A;  3B89 A;  1IXS A;  2O25 A;  3GLH E;  1WR1 B;  1JR3 E;  1DV0 A;  2H5X A;  3FRH A;  2MRO B;  3FE3 A;  1G41 A;  1HJP A;  1IFY A;  2K0B X;  1P3Q Q;  1QZE A;  2BWE A;  1AIP C;  2DAK A;  2JZ1 A;  2DNA A;  1EFU B;  1DO0 A;  4HEO A;  2QHO B;  3IHP A;  2OO9 A;  1VG5 A;  2DAE A;  1G3I A;  2JY5 A;  2HAK A;  2JY6 B;  1OAI A;  1UFZ A;  2RRU A;  2B3T A;  1NV8 A;  2DKL A;  2WZJ A;  1ZMW A;  2LTU A;  2LVP C;  3E21 A;  3LCU A;  1HT1 E;  2KNA A;  1VEK A;  4UN2 B;  2DZL A;  3FRI A;  1VEG A;  4G3O A;  1TR8 A;  4F1I A;  2JUJ A;  1HQY E;  3BBZ A;  1Q02 A;  1WHC A;  2DHY A;  1OKS A;  2K9D A;  1ZMV A;  1VEJ A;  4Q7J A;  2G3Q A;  3GLF E;  2EJS A;  2JNH A;  1TTE A;  2L4F A;  1WGL A;  2QSF X;  1OQY A;  2CWB A;  1SG9 A;  2DEN A;  2KNV A;  1KYI A;  1DO2 A;  1IM2 A;  4WP2 A;  1WGN A;  1T43 A;  1V92 A;  1YLA A;  1G4A E;  1XB2 B;  2OOA A;  4R71 A;  2ZTD A;  2CP8 A;  3LCV B;  3K9P A;  1BVS A;  1XXH E;  1MN3 A;  5JI2 E;  1A5T A;  1Y8G A;  2JP7 A;  3F92 A;  3MMP A;  2EKF A;  1ZV1 A;  2KNZ A;  2LVQ D;  4GEW A;  1ZMU A;  1F4I A;  2JY7 A;  1E94 E;  1VDL A;  2DAG A;  2L4E A;  2L2D A;  1WIV A;  1WJ7 A;  1R4G A;  1HT2 E;  2JY8 A;  1VQ1 A;  1C7Y A;  2DAI A;  2LVN C; 
#chains in the Genus database with same CATH topology
 5KQD A;  2I7N A;  4PCZ A;  1Z59 A;  4EIW A;  1E9S A;  4AKI A;  5JI3 E;  2LH0 A;  1IBM M;  3A46 A;  3FTC A;  2VII A;  5KPT A;  2XH9 A;  3LQQ A;  2UUC M;  4F2L A;  1PJI A;  1OFH A;  3TWK A;  1OTR A;  1EE8 A;  1PGY A;  2HCB A;  4FWH A;  2K6B A;  4OW0 A;  3U6S A;  1NV9 A;  1OIZ A;  4QOS A;  3K92 A;  1L1Z A;  1CUK A;  1R5L A;  2R45 A;  2BWB A;  3U6C A;  1TDZ A;  2QEN A;  2KZU A;  2A5Y B;  3HX3 A;  2CHV A;  1QZM A;  3GLG A;  4P16 A;  5ITY A;  2VF7 A;  1S3S A;  2ZTC A;  4NRV A;  4RKU F;  1YSY A;  3HU3 A;  3HGI A;  1YUB A;  3KSX A;  5BR8 M;  1IY0 A;  3NWL A;  2WSF F;  5IZ7 D;  1K82 A;  1VDD A;  4JI5 M;  1HNW M;  3U60 B;  3SHG B;  4DR1 M;  1XWI A;  2MRO B;  3FE3 A;  4L16 A;  2JA2 A;  1YE9 A;  2D7H A;  1TDH A;  2L7I A;  4PD2 A;  5KQ8 A;  3U61 B;  2DAK A;  1AIP C;  1IXZ A;  1GVN A;  3KOY E;  2JZ1 A;  2EUC A;  2DNA A;  5ITU A;  1Q3B A;  4LJ9 A;  3KFU G;  1DO0 A;  4LJA A;  2QHO B;  1TGU A;  4FWG A;  2JY5 A;  2M5Z A;  3HZJ A;  1QDR A;  2N35 A;  3SAV A;  3AOE A;  2UUA M;  1GJT A;  2AHM A;  2R6F A;  2F5Q A;  4JI7 M;  2ZBK B;  2EA0 A;  3H4M A;  4LF8 M;  4MH0 E;  4W5W A;  1IN8 A;  2X8A A;  5EJC A;  3DZD A;  2Z4S A;  4LJ6 A;  4LJ7 A;  1HT1 E;  2KNA A;  4FW9 A;  4G4O A;  1VEK A;  3LMM A;  3VDP A;  4BLC A;  1TR8 A;  4BB9 A;  4DR4 M;  4FD2 A;  5IT9 S;  3FYC A;  1QVR A;  1D2N A;  1XNR M;  3DFZ A;  3ZC7 B;  1OKS A;  2KW0 A;  2YQZ A;  2ZAO A;  4GMQ A;  4QOZ C;  2UXB M;  2NQ8 C;  3B7N A;  2F5S A;  1Z5A A;  3GLF E;  4IBI A;  2L4F A;  2QSF X;  1WGL A;  4FVM A;  4LF6 M;  3VKH A;  1SG9 A;  2YNM D;  2DEN A;  3RE8 A;  4Z8X A;  1DO2 A;  3TL4 X;  1T3T A;  3QWL A;  4MGY E;  2CRU A;  2QZ4 A;  1T43 A;  3FTF A;  4IBD A;  4KLN A;  4GKK M;  3DOA A;  3MHV C;  4L6V 6;  1XB2 B;  4I5S A;  2QCU A;  3BXW A;  2O5R A;  2XF3 A;  4B08 A;  5EXP A;  2QP9 X;  4X66 M;  2XSZ A;  4R71 A;  4OX9 M;  2Y0T A;  3LCV B;  4B3M M;  1V34 A;  2VQE M;  4XGI A;  5KPR A;  4DUZ M;  1PM5 A;  1FJG M;  2UXD M;  3SC3 A;  1NNU C;  4NOO B;  3TQS A;  3B74 A;  3THG A;  4JYA M;  1X37 A;  2L7H A;  3GLG B;  1A5T A;  1MX0 A;  1Y8G A;  2Q2E B;  4KHP M;  2UU9 M;  3VFD A;  2Z4R A;  4FCT A;  3GQ5 A;  4M0D A;  1JB0 F;  1GL6 A;  4NSO B;  2K47 A;  4PDI A;  1MJG M;  2LNH C;  2XGN A;  2Y0Q A;  2DAG A;  4CJ6 A;  4JV5 M;  1N33 M;  3UJN A;  2UUB M;  2RGO A;  3I04 M;  5F3W A;  1QUS A;  3FTE A;  3JR4 A;  4LG2 A;  4CHT B;  2JWS A;  1VQ1 A;  4AG5 A;  2DAI A;  1C7Y A;  3GLI A;  5EP4 A;  1NO1 A;  4MM3 B;  4LRS A;  1AUA A;  1MU5 A;  1KFV A;  4GIP A;  3HHW A;  4LJ5 A;  2DAM A;  2MR9 A;  2V6Z M;  2DVW B;  3T6P A;  3GLG E;  2DZN B;  1SXJ E;  3K2L A;  1G8P A;  4GC9 A;  3GLI E;  1IBK M;  1Z6T A;  4XBO A;  4DV5 M;  2R65 A;  2R0I A;  1QAQ A;  1J5E M;  1SXJ B;  3HU1 A;  3I4Y A;  4DBG B;  3FKE A;  7CAT A;  2HWJ A;  4JN6 A;  4CIZ A;  1IN4 A;  4Z6Y A;  4HLQ A;  3KP0 E;  3R9X B;  2M60 A;  2MJ5 B;  2RKO A;  4L8R C;  4MGZ E;  1IXS A;  3JR5 A;  2HL7 A;  3R8F A;  3LQR A;  3SMS A;  4TUW A;  4QNR A;  1XHB A;  1JR3 E;  1WXQ A;  3HJ8 A;  3RGS A;  1GAB A;  3PFI A;  2QQ8 A;  3UGJ A;  2P5T A;  4ZPX A;  4LFA M;  3UMM A;  4G4R A;  1NHG C;  1TH2 A;  4NC6 A;  1IY1 A;  1QAO A;  3D8B A;  4IBE A;  2C5R A;  2BWE A;  5GKN A;  3J7A S;  1LTM A;  4M9X A;  3QYE A;  2XZU A;  3HY5 A;  1GJS A;  3Q8G A;  2RGH A;  2LWX A;  5KO3 A;  1H6U A;  2FE8 A;  4LRT A;  2HAK A;  1QYR A;  4FWD A;  1JQJ C;  1UFZ A;  2R46 A;  4HL4 A;  4IBK A;  4ANR A;  3ZQJ A;  5A2Q S;  4L15 A;  4G4N A;  3IG5 A;  1E9R A;  1OFI A;  3U5Z B;  2V1C A;  2XFT A;  3I4V A;  3E21 A;  4DR5 M;  4LGM A;  4M0W A;  2CV2 A;  2HKJ A;  3LCU A;  4P17 A;  3HJQ A;  3UZU A;  1W5T A;  2J7O A;  2DXI A;  2KRK A;  2DZL A;  3FRI A;  1VEG A;  1HR0 M;  4LZJ A;  2QPA A;  4YY3 M;  4MGK E;  3GLF B;  3BBZ A;  1Q02 A;  2DHY A;  5EXX A;  5IWA M;  2X4A A;  4BBA A;  1IQP A;  1VEJ A;  4DR7 M;  5LMU M;  2G3Q A;  1TTE A;  2GNO A;  2D7E A;  4M9S A;  4YHH M;  2CWB A;  4JXJ A;  4OU7 A;  1N75 A;  1NY6 A;  4LF5 M;  1EIJ A;  3GQ4 A;  3L27 A;  4LJ8 A;  5EQT A;  1W5S A;  3CF2 A;  3T1Y M;  2ZAM A;  3HKP A;  4K0K M;  4D81 A;  1K3W A;  4NXM M;  2I7P A;  1YLA A;  2YFQ A;  4LF7 M;  4LFB M;  4IBB A;  3L29 A;  3KSJ A;  3AV0 A;  4L4U A;  2ZAN A;  3TWL A;  1N32 M;  3K9P A;  5L8R F;  1BVS A;  3HU2 A;  4DV3 M;  1DGH A;  2L6O A;  2Y20 A;  5LMN M;  3W0L B;  5EXT A;  4IJF A;  3SFZ A;  2FS1 A;  2JP7 A;  3W68 A;  4AKH A;  1J7K A;  2C98 A;  4IJE A;  5EP1 A;  1QAM A;  2APL A;  4D80 A;  2LVQ D;  3GQ3 A;  1N77 A;  3AOE C;  1E94 E;  3SYK A;  3SAR A;  4NL4 H;  4PT5 A;  5EP2 A;  1Z5C A;  2WSC F;  1JR3 A;  4JI6 M;  3CF0 A;  5FTN A;  2L09 A;  1GO5 A;  2DWM A;  3B9P A;  4DR3 M;  2XFS A;  3FUT A;  3E46 A;  3QYB A;  8CAT A;  4B7F A;  3FD9 A;  2DWL A;  2F5O A;  1T6O A;  4LF9 M;  4CGY B;  5ITR A;  4LCB A;  1IXR C;  1NJF A;  3B7Z A;  4IIW A;  5FTM A;  2MGW A;  1D0L A;  3C3D A;  2V1U A;  4RNA A;  3E9S A;  2BJV A;  4DUY M;  4Y28 F;  3EIE A;  2LVA A;  5KPZ A;  3H4J A;  3AOG A;  3GRU A;  1Q39 A;  2C99 A;  2LBC A;  4I4L A;  2QNJ A;  2EKK A;  4QHS A;  4RF1 A;  4S12 A;  1L2C A;  5E6J A;  2F5N A;  1NHW C;  1XC8 A;  2KHH A;  3KOW E;  4X62 M;  2CUZ A;  5FTK A;  2KDL A;  2O25 A;  1NSF A;  3GLH E;  4X64 M;  4GIT A;  1XXH A;  4II7 A;  1PJT A;  4QHT A;  3KVW A;  2H5X A;  2X49 A;  3J80 S;  3FRH A;  1G59 A;  3J2P B;  2FFJ A;  4KO8 A;  1I4W A;  2K0B X;  4LGY A;  2FH0 A;  3KOX E;  3GLH A;  3I01 M;  2DWN A;  3U6O A;  3L2A A;  2J7N A;  3L28 A;  2VF8 A;  2YR0 A;  2CFO A;  2GQF A;  3WHK A;  3IHP A;  2OO9 A;  3VLF B;  3SAS A;  5BPV A;  2DAE A;  2KZS A;  2F4V M;  3V76 A;  3U6L A;  4CIS A;  2RRU A;  2B3T A;  4AI6 A;  1HQC A;  2LXE A;  1DGB A;  1IXS B;  1ZQ9 A;  2KXE A;  4LY6 A;  2DKL A;  3Q8X A;  2ZM6 M;  2WZJ A;  1ZMW A;  2D7G A;  2LTU A;  2JXN A;  3HHY A;  2H1R A;  3ZCB B;  2BNK A;  2Y21 A;  5EXS A;  1KSF X;  2KA6 B;  2Z8Y M;  1N34 M;  1LV7 A;  3J81 S;  3MK6 A;  3L25 A;  4G3O A;  2J5Y A;  2XSZ D;  4F1I A;  3GLF A;  2CHG A;  4DV1 M;  5C1B A;  1N78 A;  4AZF A;  1HQY E;  3A45 A;  4DR6 M;  4DV7 M;  1TH4 A;  3K1J A;  3LVV A;  2EJS A;  2JNH A;  3FUV A;  3EIH A;  5ITX A;  1OQY A;  2R62 A;  3HHZ A;  5FTL A;  4IBG A;  1IM2 A;  3HJS A;  4KOD A;  1WGN A;  1I94 M;  4QNM A;  5E26 A;  4MB7 A;  2CE7 A;  1V92 A;  1SXJ D;  2LHC A;  2EO2 A;  3T1H M;  1PJQ A;  3GRR A;  4AQY M;  3U60 A;  4DV6 M;  1QDT A;  2CP8 A;  3T38 A;  1L8Q A;  4L78 A;  1XXH E;  1MN3 A;  5FTJ A;  5JI2 E;  3AL0 C;  3KDS E;  2OPF A;  4WUR A;  2VQF M;  3MMP A;  3GLH B;  3KS8 A;  1N36 M;  2W82 A;  3GRV A;  2QBY B;  1ZV1 A;  2FOI C;  3RFW A;  1OIP A;  1L2D A;  4LJ4 A;  3BOS A;  1ZMU A;  1F4I A;  3FUX A;  4A3V B;  4R3D A;  1ORY B;  4JI8 M;  1UM8 A;  2L2D A;  1WIV A;  4REZ A;  3OTO M;  1R4G A;  3C3E A;  1TH3 A;  3AFH A;  3M0E A;  4B3S M;  3HHX A;  5DNY A;  4GH9 A;  4NSR A;  4MGH A;  3K9O A;  3LW5 F;  5DFL A;  4FCV A;  2XZF A;  3C58 A;  3A42 A;  4IBJ A;  3W0F A;  3KP1 E;  2DI0 A;  1PRB A;  2JZ0 A;  2R4E A;  3C9P A;  3U6D A;  3PXG A;  3SHF A;  1IY2 A;  3WHL A;  3B7Q A;  3L26 A;  1HNX M;  4GC5 A;  1R2Y A;  2HHH M;  2C9C A;  3DA1 A;  4XK8 F;  4GHL A;  3IEC A;  4DV4 M;  1L2B A;  4I81 A;  1IN7 A;  5EP3 A;  2OOB A;  3I51 A;  1OAO C;  3FYD A;  4I8O A;  3GPP A;  3GLI B;  1RU3 A;  3GP1 A;  4JI4 M;  2R4J A;  3KOZ E;  3PNV A;  3SBJ A;  2Z3X A;  2Z7J A;  3U6M A;  2DHR A;  3SMP A;  2LVO C;  2G5G X;  3ILK A;  1QAN A;  1V33 A;  3K8Z A;  5DYG A;  3GPU A;  4B7H A;  3NBI A;  2G8L A;  1IN5 A;  3B89 A;  3CTW B;  3HWS A;  4RF0 A;  3AKZ A;  4R7G A;  4NRW A;  1NY5 A;  1WR1 B;  1XMO M;  2QBY A;  1J09 A;  3U5Z A;  1DGG A;  2CEA A;  3SAT A;  1DV0 A;  3M7G A;  4G6Z A;  3U61 A;  1D0K A;  1G41 A;  4IBC A;  1IN6 A;  1HJP A;  4LZZ A;  1IFY A;  1HNZ M;  3MJ5 A;  1P3Q Q;  1QZE A;  2KRU A;  5ITX E;  3AJI B;  1ZAE A;  4NXN M;  3FUW A;  4WW0 A;  1OJL A;  2CV1 A;  3NBX X;  5FSW A;  1EFU B;  4IBF A;  4HEO A;  1DGH B;  5C18 A;  1VG5 A;  2KEB A;  3UK6 A;  4OVZ B;  1G3I A;  2VDB B;  1G71 A;  1XXH B;  1TF0 B;  2JY6 B;  1OAI A;  3IG8 A;  2CHQ A;  3TE6 A;  3A98 B;  3U6Q A;  1IBL M;  3GPX A;  1XMQ M;  1NV8 A;  4ITQ A;  3SYL A;  1FNN A;  4JI3 M;  4DV2 M;  1Z5B A;  1R7R A;  3CGW A;  2LVP C;  5H37 D;  1Q3C A;  3VK8 A;  2O01 F;  4MGI E;  3SAW A;  1GL7 A;  4UN2 B;  3U6P A;  3TPZ A;  2C9O A;  1GKI A;  3T15 A;  3VKG A;  2JUJ A;  3VDU A;  3W67 A;  1PJS A;  1WHC A;  3PVS A;  2K9D A;  1ZMV A;  3FUU A;  3GPY A;  2DZO B;  4Q7J A;  1SXJ A;  1E32 A;  4KT0 F;  4B3T M;  4X65 M;  2CV0 A;  2MH8 A;  4OVZ A;  1SXJ C;  2E5L M;  2KNV A;  1KYI A;  3GRY A;  3LVW A;  2OQ4 A;  1NJG A;  2R44 A;  1NNJ A;  2DWZ B;  4WP2 A;  3D8L A;  1K3X A;  3SAU A;  4LFC M;  1G4A E;  3KS4 A;  2ERC A;  3VK7 A;  2OOA A;  3PNY A;  4AKG A;  3TWM A;  2BJW A;  3FTD A;  1XNQ M;  4D82 A;  1NVM A;  4GKJ M;  3KW6 A;  2ZTD A;  4B3R M;  3M6A A;  1JR3 D;  3JAM S;  4G4Q A;  4JI1 M;  4DV0 M;  5DYI A;  1L1T A;  4JI0 M;  2WSE F;  2LHG A;  3J27 B;  4GRI A;  3KXE C;  2UXC M;  4PDG A;  3F92 A;  5FLX S;  2FNA A;  4LF4 M;  2F5P A;  4B7G A;  3U6E A;  4GHA A;  2EKF A;  2R18 A;  3E4R A;  1DGF A;  2KNZ A;  4FCW A;  4GEW A;  1R2Z A;  3J7B A;  2XLJ A;  2JY7 A;  1VDL A;  3RGP A;  4AG6 A;  3CF6 E;  1PJJ A;  1QUT A;  4DR2 M;  2L4E A;  3ZH9 B;  5IRE B;  1D0M A;  2C96 A;  4M9Z A;  4JI2 M;  1WJ7 A;  5ITQ A;  1QQW A;  1C1K A;  1GLN A;  5ITT A;  1R6B X;  2XEP A;  1HT2 E;  2JY8 A;  3QAU A;  4AW4 A;  2LVN C;  3GO8 A; 
#chains in the Genus database with same CATH homology
 3K9O A;  5DFL A;  1GO5 A;  3E46 A;  2DAM A;  2MR9 A;  2DI0 A;  2JZ0 A;  3T6P A;  3GLG E;  1T6O A;  3GLI E;  4F2L A;  2MGW A;  1OTR A;  3IEC A;  1PGY A;  2R0I A;  2OOB A;  4DBG B;  1NV9 A;  1CUK A;  2HWJ A;  2LVA A;  3H4J A;  2BWB A;  2LBC A;  2LVO C;  2QNJ A;  2EKK A;  2MJ5 B;  2KHH A;  2ZTC A;  3B89 A;  1IXS A;  2O25 A;  3GLH E;  1WR1 B;  1JR3 E;  1DV0 A;  2H5X A;  3FRH A;  2MRO B;  3FE3 A;  1G41 A;  1HJP A;  1IFY A;  2K0B X;  1P3Q Q;  1QZE A;  2BWE A;  1AIP C;  2DAK A;  2JZ1 A;  2DNA A;  1EFU B;  1DO0 A;  4HEO A;  2QHO B;  3IHP A;  2OO9 A;  1VG5 A;  2DAE A;  1G3I A;  2JY5 A;  2HAK A;  2JY6 B;  1OAI A;  1UFZ A;  2RRU A;  2B3T A;  1NV8 A;  2DKL A;  2WZJ A;  1ZMW A;  2LTU A;  2LVP C;  3E21 A;  3LCU A;  1HT1 E;  2KNA A;  1VEK A;  4UN2 B;  2DZL A;  3FRI A;  1VEG A;  4G3O A;  1TR8 A;  4F1I A;  2JUJ A;  1HQY E;  3BBZ A;  1Q02 A;  1WHC A;  2DHY A;  1OKS A;  2K9D A;  1ZMV A;  1VEJ A;  4Q7J A;  2G3Q A;  3GLF E;  2EJS A;  2JNH A;  1TTE A;  2L4F A;  1WGL A;  2QSF X;  1OQY A;  2CWB A;  1SG9 A;  2DEN A;  2KNV A;  1KYI A;  1DO2 A;  1IM2 A;  4WP2 A;  1WGN A;  1T43 A;  1V92 A;  1YLA A;  1G4A E;  1XB2 B;  2OOA A;  4R71 A;  2ZTD A;  2CP8 A;  3LCV B;  3K9P A;  1BVS A;  1XXH E;  1MN3 A;  5JI2 E;  1A5T A;  1Y8G A;  2JP7 A;  3F92 A;  3MMP A;  2EKF A;  1ZV1 A;  2KNZ A;  2LVQ D;  4GEW A;  1ZMU A;  1F4I A;  2JY7 A;  1E94 E;  1VDL A;  2DAG A;  2L4E A;  2L2D A;  1WIV A;  1WJ7 A;  1R4G A;  1HT2 E;  2JY8 A;  1VQ1 A;  1C7Y A;  2DAI A;  2LVN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...