1P3QQ

Mechanism of ubiquitin recognition by the cue domain of vps9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
45
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAASGPCVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Vacuolar protein sorting-associated protein VPS9
total genus 13
structure length 45
sequence length 47
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
1WJ7A 4GEWA 1IFYA 1NV8A 2H5XA 2KNZA 2DI0A 1IM2A 1DO0A 1G41A 2JY7A 2G3QA 2EKFA 1VG5A 2EJSA 1AIPC 1V92A 1WGNA 2ZTDA 4F2LA 3GLFE 2LVAA 2B3TA 3BBZA 3F92A 1TR8A 2L4FA 1GO5A 2L2DA 1OKSA 4UN2B 4DBGB 2MR9A 1XB2B 2DAEA 1DO2A 2DENA 2JZ0A 4WP2A 1MN3A 2DZLA 2JY6B 2WZJA 5JI2E 1HT2E 1XXHE 3LCUA 2OOBA 2K0BX 1C7YA 3GLHE 2ZTCA 2JP7A 2K9DA 4F1IA 1NV9A 4R71A 3FRHA 2HWJA 1VEGA 3E21A 2JZ1A 2CP8A 2DAMA 3IECA 1BVSA 1VDLA 2DHYA 3LCVB 1KYIA 1ZV1A 4Q7JA 1JR3E 1T6OA 1IXSA 2DAIA 1OQYA 3K9OA 1R4GA 2BWBA 3FE3A 2QNJA 2RRUA 1OAIA 1G3IA 2JUJA 2O25A 4HEOA 2JY5A 1SG9A 1CUKA 1F4IA 1ZMVA 2LVNC 1T43A 3FRIA 2JY8A 1PGYA 2JNHA 1HT1E 2QHOB 2LVQD 3GLIE 2KNAA 2MROB 2LTUA 1OTRA 2MGWA 1HQYE 3MMPA 1UFZA 5DFLA 3H4JA 2L4EA 3IHPA 2QSFX 2HAKA 1VEJA 2MJ5B 1WIVA 2DAGA 1QZEA 1ZMUA 2EKKA 3GLGE 3B89A 2BWEA 1EFUB 3E46A 1WR1B 1Q02A 2DNAA 2R0IA 2DAKA 4G3OA 2OO9A 2KNVA 1G4AE 1Y8GA 1P3QQ 2CWBA 1E94E 2OOAA 1VEKA 2LVPC 2KHHA 3K9PA 1HJPA 1VQ1A 2LBCA 2DKLA 1WHCA 1ZMWA 1A5TA 1TTEA 1DV0A 1YLAA 2LVOC 1WGLA 3T6PA
chains in the Genus database with same CATH superfamily
3W68A 3ZH9B 1IFYA 3VKHA 3L27A 4D81A 2Z7JA 1N34M 1IM2A 1QUSA 1DO0A 2VIIA 1L2DA 2VF7A 1L2CA 1L1ZA 1VG5A 1D0KA 3K92A 2K47A 2QBYB 1GVNA 1Z6TA 2ZTDA 3VK8A 4S12A 3GPPA 1GO5A 1QAOA 3K2LA 2D7HA 2F5SA 2GNOA 2L2DA 5ITYA 2R6FA 2APLA 4LRSA 4UN2B 3RFWA 1PJJA 3KS8A 4DBGB 3SC3A 4MB7A 1KSFX 1XB2B 2D7EA 4LF6M 4NRWA 2JZ0A 1YE9A 2YNMD 4GC9A 4QHSA 3UMMA 2WZJA 4X66M 1HT2E 3FTEA 4NL4H 1H6UA 3LCUA 2F4VM 1PJIA 3KXEC 5IZ7D 5FTNA 1OFHA 2L09A 1VDDA 3GLHE 3NBXX 4KO8A 4B7HA 1HNXM 2JP7A 2OQ4A 2K9DA 3J7BA 4DV1M 1NV9A 3FTDA 3CF6E 3FRHA 3I04M 4M0WA 4G4OA 3L25A 3GO8A 3V76A 1VEGA 2XFTA 1IBLM 5EXSA 3GRRA 4JV5M 2FH0A 2CP8A 4XBOA 3IECA 3VDUA 1Q39A 3PNVA 1DGHA 2UU9M 3R9XB 4DV2M 4OU7A 2DHRA 2BJWA 1NNJA 3DOAA 1R4GA 4OW0A 3HU3A 1UM8A 4OVZB 1OAIA 1G3IA 2O25A 3B7QA 2Y20A 4GMQA 4IIWA 2KA6B 2JY5A 2C98A 3H4MA 4NRVA 2QENA 3U6MA 1F4IA 1ZMVA 3GRVA 4DV0M 4CISA 2KRUA 1D0LA 1E32A 4MH0E 5EXXA 4TUWA 4CGYB 1HT1E 4LJ8A 2LVQD 4KHPM 1AUAA 4XK8F 3E4RA 4X62M 1L8QA 3MK6A 5KPZA 3C3DA 4B3MM 4K0KM 5ITTA 1UFZA 3B7ZA 3HZJA 3UK6A 1N33M 1SXJB 3E9SA 4JI4M 3H4JA 2UXBM 5ITUA 3W0LB 4I4LA 5C1BA 2JWSA 3HJ8A 3HY5A 2HAKA 1R7RA 3T15A 3FUWA 1TDHA 1S3SA 1WXQA 2DAGA 4L15A 2EKKA 1JQJC 3GRYA 4BBAA 3A98B 4LFAM 1EFUB 3E46A 3HHYA 3JR4A 4HL4A 1WR1B 1Q02A 1IBKM 3KOWE 3T38A 2I7PA 3W0FA 5LMNM 4LF5M 4XGIA 4LJ4A 5EXTA 1E94E 1VEKA 3IG5A 2V1UA 2KHHA 4FWHA 1XNQM 3EIHA 2MH8A 3KDSE 4DUZM 2DWLA 2KXEA 4QOSA 1ZMWA 5ITXA 3GLIB 4LF9M 1A5TA 3SYKA 3LQQA 1YLAA 2CUZA 1ZQ9A 3KS4A 1WGLA 1V34A 3NWLA 3PFIA 3B7NA 3RGPA 1WJ7A 3J27B 5KPRA 1DGHB 2D7GA 1NV8A 2KNZA 1XWIA 3HKPA 3PVSA 1R2YA 1I4WA 1QVRA 4R7GA 3SBJA 2G3QA 3ZQJA 2EKFA 2XEPA 5DYGA 1J7KA 2EJSA 4IBIA 4ANRA 1HNWM 2L7HA 1NO1A 2J5YA 1WGNA 3KP1E 2ZAOA 4AG6A 2LVAA 4F2LA 4LFCM 3GQ5A 4QNMA 4I5SA 3U5ZA 4A3VB 1OJLA 2L4FA 4LJ9A 3OTOM 3DFZA 2RGHA 3LVWA 3HJSA 4PDGA 1Q3BA 2C96A 3FTFA 4FVMA 3DZDA 3KW6A 1W5SA 2WSCF 2V6ZM 1QANA 1IN8A 4P17A 1MN3A 2JY6B 1KFVA 1IY0A 1XXHE 3SFZA 1MX0A 3GP1A 5E26A 2OOBA 1IXZA 2K0BX 2QZ4A 2P5TA 3M7GA 4GKJM 5KPTA 2UXDM 2R62A 1OIPA 3AKZA 2KW0A 4LY6A 1J5EM 4B3RM 8CATA 2HWJA 2WSFF 1RU3A 4X64M 3ILKA 4JI8M 1NVMA 1L2BA 4IBGA 4KT0F 4L8RC 5KO3A 3L2AA 2M5ZA 4L4UA 3RGSA 4JI6M 1GJSA 4GHLA 4NSRA 1DGFA 1W5TA 2DXIA 1IN4A 2R65A 2DHYA 4Q7JA 3C3EA 1PJQA 4DR4M 3R8FA 5F3WA 1T6OA 4LFBM 4AKGA 2DAIA 1OQYA 1YUBA 1IN7A 1N77A 1OIZA 1TH2A 3JR5A 3SAVA 1C1KA 2QNJA 1IN5A 2L6OA 2RRUA 4FD2A 4FCWA 4HEOA 4RNAA 2FOIC 3I01M 2DVWB 4ZPXA 3A45A 1QUTA 1G71A 3M0EA 3GRUA 2BNKA 3IG8A 2CV2A 4MGIE 1PJSA 1K3WA 4X65M 1GJTA 3GLIE 4IBBA 3HU1A 1N36M 1Z5BA 2MROB 3KP0E 1SXJD 3FTCA 4KODA 3U6DA 2MGWA 4DV4M 3MMPA 1IBMM 4JI2M 1HQCA 3KOXE 2EO2A 3T1HM 5DFLA 1NY5A 3GLFA 4FWDA 4FCTA 1NNUC 1DGBA 2CHGA 4GHAA 2MJ5B 4Z6YA 4JI1M 3J7AS 1XHBA 2W82A 4JXJA 2LWXA 1IQPA 4IBEA 4NSOB 4L78A 4IJFA 3D8BA 5GKNA 4JYAM 2Z4SA 4G3OA 4QHTA 5KQDA 1SXJE 2KNVA 1Y8GA 2ZANA 2CWBA 3LW5F 4M0DA 2CHVA 3L29A 1MU5A 2YR0A 3K9PA 1PM5A 2QBYA 1HJPA 2RGOA 3GPXA 3HGIA 1XXHB 2WSEF 4Z8XA 4JI5M 2LBCA 1TDZA 1WHCA 2F5OA 4IBDA 1N78A 2QCUA 5KQ8A 4L6V6 1QAMA 2LVOC 2X8AA 4LJ7A 2RKOA 1K82A 3HHXA 3T6PA 7CATA 3KSJA 4GEWA 3SYLA 1NHGC 1OAOC 3AFHA 5EXPA 2H5XA 4L16A 3GPYA 2O5RA 3SAUA 4NC6A 1DGGA 4I81A 2HCBA 3FUUA 2JY7A 2YFQA 4GITA 1Z5CA 3VKGA 4OVZA 4DR5M 4B08A 4LZZA 2Z4RA 2G5GX 5L8RF 3T1YM 2CFOA 2R45A 1TR8A 3U5ZB 1XC8A 2KZSA 4NOOB 3KFUG 3KVWA 2UUAM 1OKSA 1NJFA 3L28A 3UZUA 4BLCA 4LF8M 1NSFA 5BR8M 2MR9A 1Z59A 3J81S 4G4QA 4DR2M 1G59A 4AKHA 5EP3A 4WP2A 2DZNB 1XNRM 2DZLA 4LGMA 3AOGA 5JI2E 3QWLA 4G4NA 2CHQA 1JR3D 1TGUA 3SHFA 5EQTA 4B7FA 1MJGM 4IBCA 3RE8A 1IXSB 2VF8A 4CIZA 1C7YA 2E5LM 4NXMM 5EP1A 3K1JA 2EUCA 4DR1M 4AI6A 2ZTCA 1IN6A 4D80A 1GL6A 3WHKA 4F1IA 1D2NA 2FS1A 4GIPA 2R18A 2ZAMA 3AOEA 4AW4A 3KSXA 5H37D 2G8LA 3TQSA 3GLGA 4EIWA 2VDBB 4RF0A 3A42A 4MGYE 2VQFM 3U6OA 2DAMA 4IJEA 1BVSA 4ITQA 2CEAA 3U61B 3LCVB 3U6PA 1KYIA 3SARA 4M9ZA 1JR3E 2CE7A 3BXWA 3GLHB 2F5PA 4QOZC 3A46A 1Z5AA 3CTWB 3K9OA 2KZUA 5IREB 2GQFA 4KLNA 5FTLA 2BWBA 2XZUA 3FE3A 2ERCA 3B74A 1IY1A 1Q3CA 2LXEA 1TH4A 2JUJA 4DV7M 2CV0A 1PJTA 1EE8A 4RF1A 3J80S 1SG9A 1CUKA 2XZFA 1TH3A 2LVNC 3GQ4A 1T43A 3FRIA 4AQYM 3TE6A 4LGYA 2C5RA 4RKUF 1PGYA 2YQZA 3MHVC 2QHOB 3K8ZA 3Q8XA 2KNAA 5A2QS 4DR6M 1JR3A 2LTUA 3SHGB 3UJNA 4R3DA 3GQ3A 1XXHA 4PT5A 1HQYE 2FE8A 3BOSA 2V1CA 3QAUA 4LJAA 5JI3E 3GPUA 3UGJA 2L4EA 3I4VA 2QSFX 2ZM6M 3W67A 2R4EA 1HR0M 1R5LA 1VEJA 4QNRA 1FNNA 5E6JA 2UUBM 1R2ZA 2J7OA 1WIVA 3VLFB 1QDRA 2O01F 3SMPA 1QZEA 1ZMUA 2OPFA 3VFDA 4P16A 3U60B 2JA2A 3HU2A 4D82A 1GL7A 2R0IA 2DAKA 4JI3M 4JI7M 1QZMA 3C58A 2OO9A 2X49A 2UXCM 1G4AE 4IBKA 4DR3M 2HHHM 1K3XA 1P3QQ 3B9PA 1HNZM 2X4AA 2OOAA 1QYRA 3TWKA 1E9SA 2XLJA 2LVPC 3AOEC 3DA1A 3FUTA 4MM3B 2LNHC 2KRKA 1QDTA 5IWAM 4MGKE 4G6ZA 2F5QA 2DKLA 4DR7M 4MGHA 3U6SA 1I94M 1TTEA 4LF7M 2QPAA 2DWNA 2NQ8C 2XSZD 2DZOB 4GC5A 3Q8GA 3CF0A 3KOZE 4M9XA 4YHHM 2R44A 1X37A 2Y0QA 3NBIA 2DI0A 5LMUM 1QQWA 5DYIA 4BB9A 3THGA 1G41A 2KEBA 4DV3M 3SATA 2C99A 1XMOM 1AIPC 1V92A 4MGZE 4LF4M 2CV1A 4FW9A 1R6BX 3GLFE 1YSYA 3I51A 3SAWA 2LH0A 2B3TA 2CRUA 3BBZA 3LMMA 4LJ5A 3F92A 4M9SA 4CJ6A 3U6LA 1N75A 3JAMS 3FYDA 3QYEA 2C9OA 2JXNA 2VQEM 4GRIA 1ORYB 3HHWA 3VK7A 2DAEA 1DO2A 3C9PA 3SMSA 1E9RA 2L7IA 2DENA 5C18A 3GLHA 5EJCA 4CHTB 3HX3A 4LRTA 3TPZA 3U6EA 1SXJA 3U60A 2M60A 3EIEA 1IY2A 2DWMA 3SASA 2AHMA 4AKIA 4DV6M 2Q2EB 4OX9M 5EP2A 3QYBA 4PCZA 5FTJA 2UUCM 4IBFA 2DWZB 3TWLA 4JI0M 4R71A 3U6CA 5FTMA 1FJGM 3KOYE 1GKIA 2XSZA 5FLXS 3GLGB 4LG2A 1OFIA 4Y28F 1PRBA 1GLNA 3E21A 4REZA 5DNYA 2JZ1A 3CF2A 3HHZA 2Z8YM 3MJ5A 1NHWC 2C9CA 1VDLA 1NY6A 4B7GA 3GLFB 4WW0A 2K6BA 1ZV1A 5ITQA 4G4RA 2J7NA 1IXSA 4B3TM 1ZAEA 2XGNA 1IXRC 1JB0F 2I7NA 2LHGA 2A5YB 2Y21A 4W5WA 5IT9S 2KDLA 3WHLA 4NXNM 3M6AA 1V33A 3CGWA 3FYCA 2BJVA 4GKKM 1EIJA 3U6QA 2Z3XA 1G8PA 2HL7A 1QAQA 2JY8A 3AL0C 4DUYM 2JNHA 4PD2A 4AZFA 2XFSA 3ZCBB 5EP4A 1L1TA 3U61A 1TF0B 2N35A 1OTRA 5FTKA 1LTMA 3LQRA 2H1RA 4PDIA 4B3SM 3TL4X 5ITRA 2R4JA 3FUXA 3FD9A 3HWSA 2XH9A 4JN6A 3IHPA 3L26A 4GH9A 3FUVA 3J2PB 4IBJA 4HLQA 5BPVA 1LV7A 3ZC7B 3AV0A 1T3TA 4LZJA 2F5NA 2QP9X 3I4YA 3GLGE 3B89A 2EA0A 1D0MA 2XF3A 4FCVA 3FKEA 2BWEA 3PXGA 3AJIB 3HJQA 1NJGA 2DNAA 1SXJC 5FSWA 5ITXE 4WURA 4II7A 4AG5A 1N32M 2FFJA 3PNYA 3TWMA 4LCBA 2HKJA 2LHCA 2ZBKB 2R46A 3VDPA 1VQ1A 4YY3M 4I8OA 3GLIA 2Y0TA 4LJ6A 1DV0A 2FNAA 3D8LA 4FWGA 3LVVA 2QQ8A 1XMQM 1GABA 4DV5M 1J09A
chains in the Genus database with same CATH topology
1WJ7A 4GEWA 1IFYA 1NV8A 2H5XA 2KNZA 2DI0A 1IM2A 1DO0A 1G41A 2JY7A 2G3QA 2EKFA 1VG5A 2EJSA 1AIPC 1V92A 1WGNA 2ZTDA 4F2LA 3GLFE 2LVAA 2B3TA 3BBZA 3F92A 1TR8A 2L4FA 1GO5A 2L2DA 1OKSA 4UN2B 4DBGB 2MR9A 1XB2B 2DAEA 1DO2A 2DENA 2JZ0A 4WP2A 1MN3A 2DZLA 2JY6B 2WZJA 5JI2E 1HT2E 1XXHE 3LCUA 2OOBA 2K0BX 1C7YA 3GLHE 2ZTCA 2JP7A 2K9DA 4F1IA 1NV9A 4R71A 3FRHA 2HWJA 1VEGA 3E21A 2JZ1A 2CP8A 2DAMA 3IECA 1BVSA 1VDLA 2DHYA 3LCVB 1KYIA 1ZV1A 4Q7JA 1JR3E 1T6OA 1IXSA 2DAIA 1OQYA 3K9OA 1R4GA 2BWBA 3FE3A 2QNJA 2RRUA 1OAIA 1G3IA 2JUJA 2O25A 4HEOA 2JY5A 1SG9A 1CUKA 1F4IA 1ZMVA 2LVNC 1T43A 3FRIA 2JY8A 1PGYA 2JNHA 1HT1E 2QHOB 2LVQD 3GLIE 2KNAA 2MROB 2LTUA 1OTRA 2MGWA 1HQYE 3MMPA 1UFZA 5DFLA 3H4JA 2L4EA 3IHPA 2QSFX 2HAKA 1VEJA 2MJ5B 1WIVA 2DAGA 1QZEA 1ZMUA 2EKKA 3GLGE 3B89A 2BWEA 1EFUB 3E46A 1WR1B 1Q02A 2DNAA 2R0IA 2DAKA 4G3OA 2OO9A 2KNVA 1G4AE 1Y8GA 1P3QQ 2CWBA 1E94E 2OOAA 1VEKA 2LVPC 2KHHA 3K9PA 1HJPA 1VQ1A 2LBCA 2DKLA 1WHCA 1ZMWA 1A5TA 1TTEA 1DV0A 1YLAA 2LVOC 1WGLA 3T6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ7 A;  4GEW A;  1IFY A;  1NV8 A;  2H5X A;  2KNZ A;  2DI0 A;  1IM2 A;  1DO0 A;  1G41 A;  2JY7 A;  2G3Q A;  2EKF A;  1VG5 A;  2EJS A;  1AIP C;  1V92 A;  1WGN A;  2ZTD A;  4F2L A;  3GLF E;  2LVA A;  2B3T A;  3BBZ A;  3F92 A;  1TR8 A;  2L4F A;  1GO5 A;  2L2D A;  1OKS A;  4UN2 B;  4DBG B;  2MR9 A;  1XB2 B;  2DAE A;  1DO2 A;  2DEN A;  2JZ0 A;  4WP2 A;  1MN3 A;  2DZL A;  2JY6 B;  2WZJ A;  5JI2 E;  1HT2 E;  1XXH E;  3LCU A;  2OOB A;  2K0B X;  1C7Y A;  3GLH E;  2ZTC A;  2JP7 A;  2K9D A;  4F1I A;  1NV9 A;  4R71 A;  3FRH A;  2HWJ A;  1VEG A;  3E21 A;  2JZ1 A;  2CP8 A;  2DAM A;  3IEC A;  1BVS A;  1VDL A;  2DHY A;  3LCV B;  1KYI A;  1ZV1 A;  4Q7J A;  1JR3 E;  1T6O A;  1IXS A;  2DAI A;  1OQY A;  3K9O A;  1R4G A;  2BWB A;  3FE3 A;  2QNJ A;  2RRU A;  1OAI A;  1G3I A;  2JUJ A;  2O25 A;  4HEO A;  2JY5 A;  1SG9 A;  1CUK A;  1F4I A;  1ZMV A;  2LVN C;  1T43 A;  3FRI A;  2JY8 A;  1PGY A;  2JNH A;  1HT1 E;  2QHO B;  2LVQ D;  3GLI E;  2KNA A;  2MRO B;  2LTU A;  1OTR A;  2MGW A;  1HQY E;  3MMP A;  1UFZ A;  5DFL A;  3H4J A;  2L4E A;  3IHP A;  2QSF X;  2HAK A;  1VEJ A;  2MJ5 B;  1WIV A;  2DAG A;  1QZE A;  1ZMU A;  2EKK A;  3GLG E;  3B89 A;  2BWE A;  1EFU B;  3E46 A;  1WR1 B;  1Q02 A;  2DNA A;  2R0I A;  2DAK A;  4G3O A;  2OO9 A;  2KNV A;  1G4A E;  1Y8G A;  1P3Q Q;  2CWB A;  1E94 E;  2OOA A;  1VEK A;  2LVP C;  2KHH A;  3K9P A;  1HJP A;  1VQ1 A;  2LBC A;  2DKL A;  1WHC A;  1ZMW A;  1A5T A;  1TTE A;  1DV0 A;  1YLA A;  2LVO C;  1WGL A;  3T6P A; 
#chains in the Genus database with same CATH topology
 3W68 A;  3ZH9 B;  1IFY A;  3VKH A;  3L27 A;  4D81 A;  2Z7J A;  1N34 M;  1IM2 A;  1QUS A;  1DO0 A;  2VII A;  1L2D A;  2VF7 A;  1L2C A;  1L1Z A;  1VG5 A;  1D0K A;  3K92 A;  2K47 A;  2QBY B;  1GVN A;  1Z6T A;  2ZTD A;  3VK8 A;  4S12 A;  3GPP A;  1GO5 A;  1QAO A;  3K2L A;  2D7H A;  2F5S A;  2GNO A;  2L2D A;  5ITY A;  2R6F A;  2APL A;  4LRS A;  4UN2 B;  3RFW A;  1PJJ A;  3KS8 A;  4DBG B;  3SC3 A;  4MB7 A;  1KSF X;  1XB2 B;  2D7E A;  4LF6 M;  4NRW A;  2JZ0 A;  1YE9 A;  2YNM D;  4GC9 A;  4QHS A;  3UMM A;  2WZJ A;  4X66 M;  1HT2 E;  3FTE A;  4NL4 H;  1H6U A;  3LCU A;  2F4V M;  1PJI A;  3KXE C;  5IZ7 D;  5FTN A;  1OFH A;  2L09 A;  1VDD A;  3GLH E;  3NBX X;  4KO8 A;  4B7H A;  1HNX M;  2JP7 A;  2OQ4 A;  2K9D A;  3J7B A;  4DV1 M;  1NV9 A;  3FTD A;  3CF6 E;  3FRH A;  3I04 M;  4M0W A;  4G4O A;  3L25 A;  3GO8 A;  3V76 A;  1VEG A;  2XFT A;  1IBL M;  5EXS A;  3GRR A;  4JV5 M;  2FH0 A;  2CP8 A;  4XBO A;  3IEC A;  3VDU A;  1Q39 A;  3PNV A;  1DGH A;  2UU9 M;  3R9X B;  4DV2 M;  4OU7 A;  2DHR A;  2BJW A;  1NNJ A;  3DOA A;  1R4G A;  4OW0 A;  3HU3 A;  1UM8 A;  4OVZ B;  1OAI A;  1G3I A;  2O25 A;  3B7Q A;  2Y20 A;  4GMQ A;  4IIW A;  2KA6 B;  2JY5 A;  2C98 A;  3H4M A;  4NRV A;  2QEN A;  3U6M A;  1F4I A;  1ZMV A;  3GRV A;  4DV0 M;  4CIS A;  2KRU A;  1D0L A;  1E32 A;  4MH0 E;  5EXX A;  4TUW A;  4CGY B;  1HT1 E;  4LJ8 A;  2LVQ D;  4KHP M;  1AUA A;  4XK8 F;  3E4R A;  4X62 M;  1L8Q A;  3MK6 A;  5KPZ A;  3C3D A;  4B3M M;  4K0K M;  5ITT A;  1UFZ A;  3B7Z A;  3HZJ A;  3UK6 A;  1N33 M;  1SXJ B;  3E9S A;  4JI4 M;  3H4J A;  2UXB M;  5ITU A;  3W0L B;  4I4L A;  5C1B A;  2JWS A;  3HJ8 A;  3HY5 A;  2HAK A;  1R7R A;  3T15 A;  3FUW A;  1TDH A;  1S3S A;  1WXQ A;  2DAG A;  4L15 A;  2EKK A;  1JQJ C;  3GRY A;  4BBA A;  3A98 B;  4LFA M;  1EFU B;  3E46 A;  3HHY A;  3JR4 A;  4HL4 A;  1WR1 B;  1Q02 A;  1IBK M;  3KOW E;  3T38 A;  2I7P A;  3W0F A;  5LMN M;  4LF5 M;  4XGI A;  4LJ4 A;  5EXT A;  1E94 E;  1VEK A;  3IG5 A;  2V1U A;  2KHH A;  4FWH A;  1XNQ M;  3EIH A;  2MH8 A;  3KDS E;  4DUZ M;  2DWL A;  2KXE A;  4QOS A;  1ZMW A;  5ITX A;  3GLI B;  4LF9 M;  1A5T A;  3SYK A;  3LQQ A;  1YLA A;  2CUZ A;  1ZQ9 A;  3KS4 A;  1WGL A;  1V34 A;  3NWL A;  3PFI A;  3B7N A;  3RGP A;  1WJ7 A;  3J27 B;  5KPR A;  1DGH B;  2D7G A;  1NV8 A;  2KNZ A;  1XWI A;  3HKP A;  3PVS A;  1R2Y A;  1I4W A;  1QVR A;  4R7G A;  3SBJ A;  2G3Q A;  3ZQJ A;  2EKF A;  2XEP A;  5DYG A;  1J7K A;  2EJS A;  4IBI A;  4ANR A;  1HNW M;  2L7H A;  1NO1 A;  2J5Y A;  1WGN A;  3KP1 E;  2ZAO A;  4AG6 A;  2LVA A;  4F2L A;  4LFC M;  3GQ5 A;  4QNM A;  4I5S A;  3U5Z A;  4A3V B;  1OJL A;  2L4F A;  4LJ9 A;  3OTO M;  3DFZ A;  2RGH A;  3LVW A;  3HJS A;  4PDG A;  1Q3B A;  2C96 A;  3FTF A;  4FVM A;  3DZD A;  3KW6 A;  1W5S A;  2WSC F;  2V6Z M;  1QAN A;  1IN8 A;  4P17 A;  1MN3 A;  2JY6 B;  1KFV A;  1IY0 A;  1XXH E;  3SFZ A;  1MX0 A;  3GP1 A;  5E26 A;  2OOB A;  1IXZ A;  2K0B X;  2QZ4 A;  2P5T A;  3M7G A;  4GKJ M;  5KPT A;  2UXD M;  2R62 A;  1OIP A;  3AKZ A;  2KW0 A;  4LY6 A;  1J5E M;  4B3R M;  8CAT A;  2HWJ A;  2WSF F;  1RU3 A;  4X64 M;  3ILK A;  4JI8 M;  1NVM A;  1L2B A;  4IBG A;  4KT0 F;  4L8R C;  5KO3 A;  3L2A A;  2M5Z A;  4L4U A;  3RGS A;  4JI6 M;  1GJS A;  4GHL A;  4NSR A;  1DGF A;  1W5T A;  2DXI A;  1IN4 A;  2R65 A;  2DHY A;  4Q7J A;  3C3E A;  1PJQ A;  4DR4 M;  3R8F A;  5F3W A;  1T6O A;  4LFB M;  4AKG A;  2DAI A;  1OQY A;  1YUB A;  1IN7 A;  1N77 A;  1OIZ A;  1TH2 A;  3JR5 A;  3SAV A;  1C1K A;  2QNJ A;  1IN5 A;  2L6O A;  2RRU A;  4FD2 A;  4FCW A;  4HEO A;  4RNA A;  2FOI C;  3I01 M;  2DVW B;  4ZPX A;  3A45 A;  1QUT A;  1G71 A;  3M0E A;  3GRU A;  2BNK A;  3IG8 A;  2CV2 A;  4MGI E;  1PJS A;  1K3W A;  4X65 M;  1GJT A;  3GLI E;  4IBB A;  3HU1 A;  1N36 M;  1Z5B A;  2MRO B;  3KP0 E;  1SXJ D;  3FTC A;  4KOD A;  3U6D A;  2MGW A;  4DV4 M;  3MMP A;  1IBM M;  4JI2 M;  1HQC A;  3KOX E;  2EO2 A;  3T1H M;  5DFL A;  1NY5 A;  3GLF A;  4FWD A;  4FCT A;  1NNU C;  1DGB A;  2CHG A;  4GHA A;  2MJ5 B;  4Z6Y A;  4JI1 M;  3J7A S;  1XHB A;  2W82 A;  4JXJ A;  2LWX A;  1IQP A;  4IBE A;  4NSO B;  4L78 A;  4IJF A;  3D8B A;  5GKN A;  4JYA M;  2Z4S A;  4G3O A;  4QHT A;  5KQD A;  1SXJ E;  2KNV A;  1Y8G A;  2ZAN A;  2CWB A;  3LW5 F;  4M0D A;  2CHV A;  3L29 A;  1MU5 A;  2YR0 A;  3K9P A;  1PM5 A;  2QBY A;  1HJP A;  2RGO A;  3GPX A;  3HGI A;  1XXH B;  2WSE F;  4Z8X A;  4JI5 M;  2LBC A;  1TDZ A;  1WHC A;  2F5O A;  4IBD A;  1N78 A;  2QCU A;  5KQ8 A;  4L6V 6;  1QAM A;  2LVO C;  2X8A A;  4LJ7 A;  2RKO A;  1K82 A;  3HHX A;  3T6P A;  7CAT A;  3KSJ A;  4GEW A;  3SYL A;  1NHG C;  1OAO C;  3AFH A;  5EXP A;  2H5X A;  4L16 A;  3GPY A;  2O5R A;  3SAU A;  4NC6 A;  1DGG A;  4I81 A;  2HCB A;  3FUU A;  2JY7 A;  2YFQ A;  4GIT A;  1Z5C A;  3VKG A;  4OVZ A;  4DR5 M;  4B08 A;  4LZZ A;  2Z4R A;  2G5G X;  5L8R F;  3T1Y M;  2CFO A;  2R45 A;  1TR8 A;  3U5Z B;  1XC8 A;  2KZS A;  4NOO B;  3KFU G;  3KVW A;  2UUA M;  1OKS A;  1NJF A;  3L28 A;  3UZU A;  4BLC A;  4LF8 M;  1NSF A;  5BR8 M;  2MR9 A;  1Z59 A;  3J81 S;  4G4Q A;  4DR2 M;  1G59 A;  4AKH A;  5EP3 A;  4WP2 A;  2DZN B;  1XNR M;  2DZL A;  4LGM A;  3AOG A;  5JI2 E;  3QWL A;  4G4N A;  2CHQ A;  1JR3 D;  1TGU A;  3SHF A;  5EQT A;  4B7F A;  1MJG M;  4IBC A;  3RE8 A;  1IXS B;  2VF8 A;  4CIZ A;  1C7Y A;  2E5L M;  4NXM M;  5EP1 A;  3K1J A;  2EUC A;  4DR1 M;  4AI6 A;  2ZTC A;  1IN6 A;  4D80 A;  1GL6 A;  3WHK A;  4F1I A;  1D2N A;  2FS1 A;  4GIP A;  2R18 A;  2ZAM A;  3AOE A;  4AW4 A;  3KSX A;  5H37 D;  2G8L A;  3TQS A;  3GLG A;  4EIW A;  2VDB B;  4RF0 A;  3A42 A;  4MGY E;  2VQF M;  3U6O A;  2DAM A;  4IJE A;  1BVS A;  4ITQ A;  2CEA A;  3U61 B;  3LCV B;  3U6P A;  1KYI A;  3SAR A;  4M9Z A;  1JR3 E;  2CE7 A;  3BXW A;  3GLH B;  2F5P A;  4QOZ C;  3A46 A;  1Z5A A;  3CTW B;  3K9O A;  2KZU A;  5IRE B;  2GQF A;  4KLN A;  5FTL A;  2BWB A;  2XZU A;  3FE3 A;  2ERC A;  3B74 A;  1IY1 A;  1Q3C A;  2LXE A;  1TH4 A;  2JUJ A;  4DV7 M;  2CV0 A;  1PJT A;  1EE8 A;  4RF1 A;  3J80 S;  1SG9 A;  1CUK A;  2XZF A;  1TH3 A;  2LVN C;  3GQ4 A;  1T43 A;  3FRI A;  4AQY M;  3TE6 A;  4LGY A;  2C5R A;  4RKU F;  1PGY A;  2YQZ A;  3MHV C;  2QHO B;  3K8Z A;  3Q8X A;  2KNA A;  5A2Q S;  4DR6 M;  1JR3 A;  2LTU A;  3SHG B;  3UJN A;  4R3D A;  3GQ3 A;  1XXH A;  4PT5 A;  1HQY E;  2FE8 A;  3BOS A;  2V1C A;  3QAU A;  4LJA A;  5JI3 E;  3GPU A;  3UGJ A;  2L4E A;  3I4V A;  2QSF X;  2ZM6 M;  3W67 A;  2R4E A;  1HR0 M;  1R5L A;  1VEJ A;  4QNR A;  1FNN A;  5E6J A;  2UUB M;  1R2Z A;  2J7O A;  1WIV A;  3VLF B;  1QDR A;  2O01 F;  3SMP A;  1QZE A;  1ZMU A;  2OPF A;  3VFD A;  4P16 A;  3U60 B;  2JA2 A;  3HU2 A;  4D82 A;  1GL7 A;  2R0I A;  2DAK A;  4JI3 M;  4JI7 M;  1QZM A;  3C58 A;  2OO9 A;  2X49 A;  2UXC M;  1G4A E;  4IBK A;  4DR3 M;  2HHH M;  1K3X A;  1P3Q Q;  3B9P A;  1HNZ M;  2X4A A;  2OOA A;  1QYR A;  3TWK A;  1E9S A;  2XLJ A;  2LVP C;  3AOE C;  3DA1 A;  3FUT A;  4MM3 B;  2LNH C;  2KRK A;  1QDT A;  5IWA M;  4MGK E;  4G6Z A;  2F5Q A;  2DKL A;  4DR7 M;  4MGH A;  3U6S A;  1I94 M;  1TTE A;  4LF7 M;  2QPA A;  2DWN A;  2NQ8 C;  2XSZ D;  2DZO B;  4GC5 A;  3Q8G A;  3CF0 A;  3KOZ E;  4M9X A;  4YHH M;  2R44 A;  1X37 A;  2Y0Q A;  3NBI A;  2DI0 A;  5LMU M;  1QQW A;  5DYI A;  4BB9 A;  3THG A;  1G41 A;  2KEB A;  4DV3 M;  3SAT A;  2C99 A;  1XMO M;  1AIP C;  1V92 A;  4MGZ E;  4LF4 M;  2CV1 A;  4FW9 A;  1R6B X;  3GLF E;  1YSY A;  3I51 A;  3SAW A;  2LH0 A;  2B3T A;  2CRU A;  3BBZ A;  3LMM A;  4LJ5 A;  3F92 A;  4M9S A;  4CJ6 A;  3U6L A;  1N75 A;  3JAM S;  3FYD A;  3QYE A;  2C9O A;  2JXN A;  2VQE M;  4GRI A;  1ORY B;  3HHW A;  3VK7 A;  2DAE A;  1DO2 A;  3C9P A;  3SMS A;  1E9R A;  2L7I A;  2DEN A;  5C18 A;  3GLH A;  5EJC A;  4CHT B;  3HX3 A;  4LRT A;  3TPZ A;  3U6E A;  1SXJ A;  3U60 A;  2M60 A;  3EIE A;  1IY2 A;  2DWM A;  3SAS A;  2AHM A;  4AKI A;  4DV6 M;  2Q2E B;  4OX9 M;  5EP2 A;  3QYB A;  4PCZ A;  5FTJ A;  2UUC M;  4IBF A;  2DWZ B;  3TWL A;  4JI0 M;  4R71 A;  3U6C A;  5FTM A;  1FJG M;  3KOY E;  1GKI A;  2XSZ A;  5FLX S;  3GLG B;  4LG2 A;  1OFI A;  4Y28 F;  1PRB A;  1GLN A;  3E21 A;  4REZ A;  5DNY A;  2JZ1 A;  3CF2 A;  3HHZ A;  2Z8Y M;  3MJ5 A;  1NHW C;  2C9C A;  1VDL A;  1NY6 A;  4B7G A;  3GLF B;  4WW0 A;  2K6B A;  1ZV1 A;  5ITQ A;  4G4R A;  2J7N A;  1IXS A;  4B3T M;  1ZAE A;  2XGN A;  1IXR C;  1JB0 F;  2I7N A;  2LHG A;  2A5Y B;  2Y21 A;  4W5W A;  5IT9 S;  2KDL A;  3WHL A;  4NXN M;  3M6A A;  1V33 A;  3CGW A;  3FYC A;  2BJV A;  4GKK M;  1EIJ A;  3U6Q A;  2Z3X A;  1G8P A;  2HL7 A;  1QAQ A;  2JY8 A;  3AL0 C;  4DUY M;  2JNH A;  4PD2 A;  4AZF A;  2XFS A;  3ZCB B;  5EP4 A;  1L1T A;  3U61 A;  1TF0 B;  2N35 A;  1OTR A;  5FTK A;  1LTM A;  3LQR A;  2H1R A;  4PDI A;  4B3S M;  3TL4 X;  5ITR A;  2R4J A;  3FUX A;  3FD9 A;  3HWS A;  2XH9 A;  4JN6 A;  3IHP A;  3L26 A;  4GH9 A;  3FUV A;  3J2P B;  4IBJ A;  4HLQ A;  5BPV A;  1LV7 A;  3ZC7 B;  3AV0 A;  1T3T A;  4LZJ A;  2F5N A;  2QP9 X;  3I4Y A;  3GLG E;  3B89 A;  2EA0 A;  1D0M A;  2XF3 A;  4FCV A;  3FKE A;  2BWE A;  3PXG A;  3AJI B;  3HJQ A;  1NJG A;  2DNA A;  1SXJ C;  5FSW A;  5ITX E;  4WUR A;  4II7 A;  4AG5 A;  1N32 M;  2FFJ A;  3PNY A;  3TWM A;  4LCB A;  2HKJ A;  2LHC A;  2ZBK B;  2R46 A;  3VDP A;  1VQ1 A;  4YY3 M;  4I8O A;  3GLI A;  2Y0T A;  4LJ6 A;  1DV0 A;  2FNA A;  3D8L A;  4FWG A;  3LVV A;  2QQ8 A;  1XMQ M;  1GAB A;  4DV5 M;  1J09 A; 
#chains in the Genus database with same CATH homology
 1WJ7 A;  4GEW A;  1IFY A;  1NV8 A;  2H5X A;  2KNZ A;  2DI0 A;  1IM2 A;  1DO0 A;  1G41 A;  2JY7 A;  2G3Q A;  2EKF A;  1VG5 A;  2EJS A;  1AIP C;  1V92 A;  1WGN A;  2ZTD A;  4F2L A;  3GLF E;  2LVA A;  2B3T A;  3BBZ A;  3F92 A;  1TR8 A;  2L4F A;  1GO5 A;  2L2D A;  1OKS A;  4UN2 B;  4DBG B;  2MR9 A;  1XB2 B;  2DAE A;  1DO2 A;  2DEN A;  2JZ0 A;  4WP2 A;  1MN3 A;  2DZL A;  2JY6 B;  2WZJ A;  5JI2 E;  1HT2 E;  1XXH E;  3LCU A;  2OOB A;  2K0B X;  1C7Y A;  3GLH E;  2ZTC A;  2JP7 A;  2K9D A;  4F1I A;  1NV9 A;  4R71 A;  3FRH A;  2HWJ A;  1VEG A;  3E21 A;  2JZ1 A;  2CP8 A;  2DAM A;  3IEC A;  1BVS A;  1VDL A;  2DHY A;  3LCV B;  1KYI A;  1ZV1 A;  4Q7J A;  1JR3 E;  1T6O A;  1IXS A;  2DAI A;  1OQY A;  3K9O A;  1R4G A;  2BWB A;  3FE3 A;  2QNJ A;  2RRU A;  1OAI A;  1G3I A;  2JUJ A;  2O25 A;  4HEO A;  2JY5 A;  1SG9 A;  1CUK A;  1F4I A;  1ZMV A;  2LVN C;  1T43 A;  3FRI A;  2JY8 A;  1PGY A;  2JNH A;  1HT1 E;  2QHO B;  2LVQ D;  3GLI E;  2KNA A;  2MRO B;  2LTU A;  1OTR A;  2MGW A;  1HQY E;  3MMP A;  1UFZ A;  5DFL A;  3H4J A;  2L4E A;  3IHP A;  2QSF X;  2HAK A;  1VEJ A;  2MJ5 B;  1WIV A;  2DAG A;  1QZE A;  1ZMU A;  2EKK A;  3GLG E;  3B89 A;  2BWE A;  1EFU B;  3E46 A;  1WR1 B;  1Q02 A;  2DNA A;  2R0I A;  2DAK A;  4G3O A;  2OO9 A;  2KNV A;  1G4A E;  1Y8G A;  1P3Q Q;  2CWB A;  1E94 E;  2OOA A;  1VEK A;  2LVP C;  2KHH A;  3K9P A;  1HJP A;  1VQ1 A;  2LBC A;  2DKL A;  1WHC A;  1ZMW A;  1A5T A;  1TTE A;  1DV0 A;  1YLA A;  2LVO C;  1WGL A;  3T6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...