1P3QQ

Mechanism of ubiquitin recognition by the cue domain of vps9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
45
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAASGPCVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 13
structure length 45
sequence length 47
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
1ZMUA 1HJPA 1G4AE 1DO0A 4UN2B 1WHCA 1JR3E 2JY7A 1CUKA 2OOBA 2L4FA 2EJSA 4HEOA 2CP8A 1Y8GA 2HAKA 1DV0A 1E94E 1V92A 1T43A 4F2LA 3FRHA 3K9OA 1SG9A 1VEKA 2QHOB 1HT1E 1AIPC 1YLAA 1IXSA 1MN3A 1A5TA 3IECA 4G3OA 2DAIA 1TR8A 1G41A 1WGNA 2K9DA 3LCVB 1VQ1A 1KYIA 1WIVA 1QZEA 2O25A 2BWEA 2MJ5B 1G3IA 2DNAA 3GLIE 5JI2E 3MMPA 1DO2A 1ZMVA 2KNAA 2DAGA 4GEWA 2EKFA 2JY8A 1VDLA 2JNHA 4WP2A 2R0IA 2JY6B 1OKSA 3F92A 1F4IA 3E46A 2L2DA 1HT2E 3FE3A 2LVOC 2ZTDA 1NV9A 2MGWA 4DBGB 2DAEA 2CWBA 2DI0A 2QNJA 1XXHE 1Q02A 1UFZA 2DKLA 2RRUA 1P3QQ 1T6OA 3IHPA 2L4EA 2MROB 2OOAA 3T6PA 2LBCA 3H4JA 1WJ7A 1OTRA 2DAKA 1R4GA 2K0BX 1ZV1A 3E21A 1WGLA 1ZMWA 2HWJA 3GLHE 2JUJA 2LVPC 2KNZA 2LVNC 2DZLA 1IM2A 2LVAA 2MR9A 1EFUB 1WR1B 1XB2B 2H5XA 2EKKA 2KNVA 2BWBA 4F1IA 3B89A 2KHHA 1TTEA 1IFYA 2JZ0A 2JP7A 2QSFX 4Q7JA 1GO5A 2LTUA 1VEGA 2OO9A 1OAIA 5DFLA 1BVSA 2DAMA 1VG5A 2JZ1A 1C7YA 3LCUA 2DENA 2WZJA 1OQYA 3GLFE 3K9PA 3BBZA 2G3QA 3FRIA 3GLGE 2JY5A 1VEJA 2B3TA 1NV8A 1PGYA 2LVQD 2DHYA 4R71A 2ZTCA 1HQYE
chains in the Genus database with same CATH superfamily
2CRUA 1NO1A 2DZNB 1WHCA 3QAUA 4NRVA 4JI5M 2EJSA 1R7RA 4HEOA 4JI0M 3U6SA 3U6DA 4NOOB 2CP8A 2HAKA 3AV0A 3KOYE 3QYEA 3V76A 2JXNA 1D0LA 4QOSA 1T43A 3U6QA 1HNZM 1QAMA 2R46A 2WSEF 3KSXA 4G6ZA 1LTMA 4I5SA 4B7GA 1JB0F 5ITXE 3QWLA 3VLFB 3U6MA 2EUCA 4RF0A 4G3OA 1A5TA 1GABA 4D80A 1G71A 2K9DA 2FOIC 1L8QA 3AKZA 3GLIA 4L6V6 3SHFA 5LMNM 3TE6A 3DFZA 7CATA 2O25A 4DV5M 3W0FA 3T1HM 2UXDM 3UK6A 5JI2E 3MMPA 2C9OA 1OAOC 5E26A 5EXTA 2Z4SA 3C3EA 4JI1M 1ZMVA 2KNAA 3HU2A 3VDUA 3GPYA 3CGWA 2MH8A 1DGBA 2JY8A 1VDLA 2BJWA 4DV7M 4LJ4A 2UUAM 1W5SA 4LF5M 4NXMM 1N32M 3E46A 2X49A 2C96A 1HT2E 3FE3A 3E9SA 2YFQA 3HHWA 5E6JA 5KPRA 3B7NA 2ZBKB 3EIHA 4R3DA 4DR2M 4WW0A 1L2BA 2UU9M 3KS8A 4NRWA 3T15A 4JI3M 4DBGB 4B08A 4DR5M 3B9PA 2CWBA 2DI0A 5EJCA 1IY2A 1QQWA 1J09A 2R62A 4GMQA 1UFZA 3CF0A 3SMPA 2R6FA 8CATA 4XK8F 1PJIA 4LG2A 1RU3A 4DV3M 2UUBM 3SYKA 2QBYA 2BJVA 3T6PA 1MU5A 2KDLA 4L4UA 3JAMS 3GLFB 4REZA 4BLCA 3C58A 2CV2A 1E9SA 3FTEA 4QHTA 1ZV1A 3GLFA 3A98B 2FH0A 3E21A 2Z3XA 2QP9X 1ZAEA 4LJ7A 1FNNA 2JUJA 4X64M 2F4VM 1QUSA 2LVNC 2DZLA 3HHZA 4LF9M 3R9XB 4JYAM 2RKOA 1QYRA 5EQTA 4MB7A 2MR9A 4QNMA 1Q39A 3FTCA 2D7HA 4JXJA 5BR8M 4I8OA 1NJGA 2V1CA 2EKKA 4K0KM 3U6PA 2BWBA 2F5QA 1HNWM 1IFYA 2QQ8A 2QSFX 4Q7JA 5IZ7D 4AKHA 3K92A 1E32A 3TWLA 3A46A 2JZ1A 4MGHA 4DR6M 2A5YB 3LCUA 5DYGA 5EP4A 2J7OA 2DENA 2WZJA 3NWLA 1YE9A 2L6OA 1N75A 1IBKM 1XNQM 1XMOM 2YQZA 1LV7A 2QPAA 1IBLM 4IBEA 4HLQA 1OIZA 1PGYA 4DV2M 2DHYA 2L7IA 1Z5BA 2ZTCA 2C98A 1D0MA 2CHVA 4KT0F 5C18A 1H6UA 1HQYE 2CE7A 2LHCA 1ZMUA 3GPPA 1HJPA 2V6ZM 1DO0A 3DA1A 3VKHA 4B3TM 4GKJM 3KW6A 3BOSA 4WURA 1FJGM 4M0DA 1Y8GA 2J5YA 1EE8A 2N35A 4GH9A 3SHGB 4QOZC 1E94E 1V92A 1DV0A 4S12A 4MM3B 1XXHB 2KZUA 1N77A 3CTWB 1N34M 4B3RM 1SG9A 3AJIB 2QHOB 2G8LA 5EXSA 5ITUA 1AIPC 2J7NA 1Z59A 1XXHA 1SXJD 1MN3A 3PNYA 3IECA 4LJ6A 2XZFA 1NJFA 1TR8A 4LFAM 5ITYA 4MGZE 1WGNA 2VIIA 1VQ1A 5FSWA 2F5NA 2W82A 3PNVA 2RGOA 2BWEA 1G3IA 3GLHB 3R8FA 3GLIE 1NY5A 1ZQ9A 3GRYA 4B3SM 4LZJA 1DO2A 2DZOB 2M60A 2ZANA 4AG6A 3GLHA 1AUAA 2LWXA 2EKFA 2JNHA 4ZPXA 2R0IA 2DWZB 4LGYA 1OKSA 4A3VB 3I4VA 2L2DA 3RGSA 3A45A 2KRKA 1WXQA 4GC9A 4YY3M 3ZH9B 4AQYM 5FTMA 1N78A 1R2YA 2ZTDA 4Y28F 2LXEA 3U6OA 3VK8A 4AW4A 4RKUF 4KO8A 5H37D 3KP1E 4IBFA 3KVWA 3PFIA 2VF7A 3H4MA 3FKEA 3HJQA 2QNJA 2HL7A 4IJFA 2DKLA 1SXJB 3AFHA 3FTDA 2DXIA 1UM8A 5EP3A 5IT9S 1PM5A 1IN5A 3IHPA 2L4EA 2MROB 2OOAA 3VFDA 3GQ3A 4FCTA 1SXJA 2LBCA 2R65A 1WJ7A 1V33A 2Z7JA 3H4JA 1OTRA 5FTNA 3UGJA 2XLJA 1OJLA 5DNYA 5L8RF 4LRSA 1R4GA 2DWMA 1PJSA 1GLNA 2JA2A 2CV1A 5A2QS 2RGHA 4AKIA 1IQPA 1QANA 1ZMWA 4B7FA 4B3MM 4FVMA 1QAOA 3SMSA 1TDHA 1Z5CA 4GRIA 3KP0E 2KNZA 4CHTB 3DOAA 4G4QA 2M5ZA 4JI7M 3HU1A 2XH9A 2FE8A 4PDIA 4HL4A 2HHHM 4FW9A 1G59A 1DGGA 1XB2B 3AOEA 3QYBA 1MJGM 2L7HA 3GRVA 4FCWA 1J5EM 4F1IA 4KODA 4FWDA 4LFBM 2JZ0A 1GO5A 1OFIA 2LTUA 5ITXA 2OO9A 4LJ5A 3SAVA 2DWLA 4QHSA 5DFLA 1L2CA 2DAMA 2DVWB 2NQ8C 3L27A 4OU7A 3GQ5A 1XHBA 2GNOA 4L78A 3K8ZA 2C99A 1OQYA 2KA6B 1NY6A 3E4RA 2F5SA 5C1BA 2Y21A 3AOGA 5ITQA 3AL0C 4MGKE 3HZJA 1OIPA 4YHHM 4FCVA 4LY6A 3GLGE 4LF6M 2B3TA 2LVQD 4M9XA 1NHGC 3VKGA 3B7QA 4JV5M 3UZUA 4NSOB 2KRUA 2X4AA 4UN2B 1I4WA 2XFSA 3RFWA 1JR3E 1W5TA 3GQ4A 3M0EA 4G4RA 2L4FA 4GITA 4MGYE 4IBIA 3KSJA 1QUTA 3A42A 3ZC7B 2KEBA 4X62M 4F2LA 4IJEA 3VDPA 3U61B 1IN6A 3HJ8A 3L2AA 4NXNM 4CISA 2VDBB 1HR0M 3W0LB 3U61A 4EIWA 4IBCA 2DAIA 1G41A 2C5RA 3L26A 1IN8A 1GJTA 3GPUA 5EXPA 2KW0A 3MJ5A 1DGFA 4IBJA 4JI4M 4GHLA 2ZAMA 2DNAA 2GQFA 1Q3CA 4IBDA 2XSZD 3SAWA 3TQSA 1KFVA 1Z5AA 3CF2A 2WSCF 3TL4X 3TWKA 5FLXS 3WHLA 1IXRC 1GL6A 2DAGA 1J7KA 4Z6YA 1K82A 4DR4M 3SAUA 2CFOA 3GO8A 1Q3BA 1MX0A 1NNJA 3BXWA 1XNRM 2V1UA 1NV9A 3W68A 2MGWA 3M6AA 2YNMD 3L28A 3SYLA 2O01F 2R18A 2R44A 4FD2A 4DR7M 2VF8A 4LGMA 3HWSA 3I4YA 2F5OA 4M0WA 3B74A 2RRUA 1Q02A 1SXJC 3WHKA 5IWAM 2ZM6M 1OFHA 1P3QQ 3LMMA 3FTFA 4DUZM 1IN4A 1IN7A 3THGA 3GP1A 4DV0M 3J81S 2FS1A 1ORYB 1IY1A 4OVZB 2D7GA 3ZQJA 5KO3A 2HCBA 3MK6A 1TH2A 4I81A 1PRBA 2X8AA 3GRUA 3MHVC 4OVZA 5DYIA 4D81A 2O5RA 3PVSA 3RGPA 3U60B 2XEPA 4M9ZA 3NBIA 2JWSA 2XSZA 1D0KA 1X37A 1GJSA 5F3WA 2LVPC 1TH4A 2LNHC 4LCBA 3D8BA 4NL4H 5ITRA 2F5PA 3AOEC 5FTKA 1IM2A 3LVWA 2LVAA 2P5TA 3J80S 1GKIA 1XC8A 3NBXX 3FUVA 3LW5F 4ANRA 1WR1B 2XGNA 5FTLA 3U6EA 3J2PB 3JR5A 4ITQA 2KNVA 1QDRA 3K2LA 3K1JA 2L09A 1TTEA 4P16A 4BB9A 2DHRA 2H1RA 2JP7A 5EP2A 1N36M 3SATA 1TH3A 2R45A 1VEGA 3HHXA 1OAIA 2CUZA 1HQCA 1IXZA 4RNAA 3M7GA 4DV6M 4GHAA 3L25A 4G4OA 3I01M 2FNAA 3ZCBB 3Q8GA 4PDGA 4TUWA 2VQEM 2QZ4A 2XFTA 3HY5A 3GLIB 5ITTA 3GLFE 3FYCA 3K9PA 3KXEC 3BBZA 3SC3A 3GPXA 4DR3M 1I94M 4XGIA 3UJNA 1TGUA 3PXGA 3FRIA 5EP1A 3LQRA 2JY5A 1QAQA 1L1TA 3U5ZB 2ERCA 3U6LA 4X65M 3D8LA 3KS4A 4B7HA 3RE8A 4DV1M 1L2DA 4LF7M 4AI6A 1G4AE 4CJ6A 2D7EA 3I51A 3U5ZA 2JY7A 1CUKA 2BNKA 2OOBA 3Q8XA 2AHMA 1R2ZA 1KSFX 4IBGA 4LJ8A 1NSFA 4AG5A 4DV4M 3IG8A 1QVRA 3CF6E 5FTJA 1R6BX 3C3DA 3FRHA 1IXSB 1QZMA 3K9OA 3KDSE 4LZZA 4LF4M 1N33M 1VEKA 4I4LA 4IBKA 1HT1E 2I7PA 4Z8XA 1YLAA 4DUYM 1IXSA 1XWIA 2KXEA 1DGHB 1PJQA 3J7BA 4FWGA 1IBMM 2QBYB 4MH0E 2YR0A 3LCVB 1NHWC 3FUTA 4G4NA 4D82A 1KYIA 1IY0A 1WIVA 1QZEA 1DGHA 2K47A 4M9SA 4XBOA 3HHYA 2MJ5B 1NVMA 5IREB 4R7GA 1TF0B 3FUUA 2OPFA 3SBJA 3VK7A 1GVNA 4GC5A 2Q2EB 1GL7A 2HKJA 3SARA 2WSFF 1T3TA 4AZFA 4L16A 4NSRA 2UXCM 3T1YM 3HGIA 2C9CA 4BBAA 3U6CA 2ZAOA 4GEWA 4KLNA 3LVVA 4WP2A 2JY6B 3F92A 1F4IA 2G5GX 1JR3D 2LHGA 3B7ZA 3HKPA 4LJ9A 4L8RC 3KOWE 1HNXM 3C9PA 2LVOC 4L15A 4QNRA 3DZDA 2CV0A 2UUCM 3SFZA 4JN6A 2DAEA 1R5LA 2KZSA 4LFCM 4OW0A 4LJAA 4P17A 2QENA 3KOXE 3LQQA 4CIZA 2OQ4A 1EIJA 4IBBA 2CHGA 1XXHE 3TPZA 3JR4A 2VQFM 3UMMA 2Z4RA 1XMQM 3SASA 4AKGA 4X66M 1T6OA 4PCZA 3W67A 2I7NA 1YSYA 3FD9A 1Z6TA 4DR1M 1G8PA 4W5WA 1K3WA 2Y20A 3FUXA 2EO2A 3L29A 2DAKA 2CHQA 2XF3A 3ILKA 4FWHA 2EA0A 1TDZA 2K0BX 5JI3E 3GLGB 3HX3A 1PJTA 4RF1A 1JQJC 2Y0TA 5EXXA 5GKNA 1WGLA 2HWJA 3GLHE 1K3XA 3HU3A 3TWMA 2LH0A 3KFUG 4LRTA 3GLGA 4JI2M 1QDTA 2Y0QA 1S3SA 2APLA 2QCUA 2R4EA 4CGYB 1VDDA 1L1ZA 2R4JA 4GIPA 1JR3A 5KQ8A 4LF8M 1EFUB 1PJJA 2XZUA 2DWNA 4II7A 2H5XA 1D2NA 1YUBA 3GRRA 3B89A 5LMUM 2KHHA 3IG5A 4PT5A 3FYDA 4PD2A 5KPTA 5KPZA 2E5LM 4JI8M 3OTOM 1E9RA 3EIEA 1BVSA 1SXJE 3J27B 4OX9M 1VG5A 3FUWA 3KOZE 1C7YA 3T38A 2CEAA 5BPVA 1C1KA 1NNUC 4GKKM 3J7AS 2G3QA 3U60A 2UXBM 4IIWA 5KQDA 4JI6M 4MGIE 1VEJA 2Z8YM 1NV8A 4R71A 4NC6A 3I04M 3HJSA 4KHPM 2K6BA 2FFJA 1V34A
chains in the Genus database with same CATH topology
1ZMUA 1HJPA 1G4AE 1DO0A 4UN2B 1WHCA 1JR3E 2JY7A 1CUKA 2OOBA 2L4FA 2EJSA 4HEOA 2CP8A 1Y8GA 2HAKA 1DV0A 1E94E 1V92A 1T43A 4F2LA 3FRHA 3K9OA 1SG9A 1VEKA 2QHOB 1HT1E 1AIPC 1YLAA 1IXSA 1MN3A 1A5TA 3IECA 4G3OA 2DAIA 1TR8A 1G41A 1WGNA 2K9DA 3LCVB 1VQ1A 1KYIA 1WIVA 1QZEA 2O25A 2BWEA 2MJ5B 1G3IA 2DNAA 3GLIE 5JI2E 3MMPA 1DO2A 1ZMVA 2KNAA 2DAGA 4GEWA 2EKFA 2JY8A 1VDLA 2JNHA 4WP2A 2R0IA 2JY6B 1OKSA 3F92A 1F4IA 3E46A 2L2DA 1HT2E 3FE3A 2LVOC 2ZTDA 1NV9A 2MGWA 4DBGB 2DAEA 2CWBA 2DI0A 2QNJA 1XXHE 1Q02A 1UFZA 2DKLA 2RRUA 1P3QQ 1T6OA 3IHPA 2L4EA 2MROB 2OOAA 3T6PA 2LBCA 3H4JA 1WJ7A 1OTRA 2DAKA 1R4GA 2K0BX 1ZV1A 3E21A 1WGLA 1ZMWA 2HWJA 3GLHE 2JUJA 2LVPC 2KNZA 2LVNC 2DZLA 1IM2A 2LVAA 2MR9A 1EFUB 1WR1B 1XB2B 2H5XA 2EKKA 2KNVA 2BWBA 4F1IA 3B89A 2KHHA 1TTEA 1IFYA 2JZ0A 2JP7A 2QSFX 4Q7JA 1GO5A 2LTUA 1VEGA 2OO9A 1OAIA 5DFLA 1BVSA 2DAMA 1VG5A 2JZ1A 1C7YA 3LCUA 2DENA 2WZJA 1OQYA 3GLFE 3K9PA 3BBZA 2G3QA 3FRIA 3GLGE 2JY5A 1VEJA 2B3TA 1NV8A 1PGYA 2LVQD 2DHYA 4R71A 2ZTCA 1HQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMU A;  1HJP A;  1G4A E;  1DO0 A;  4UN2 B;  1WHC A;  1JR3 E;  2JY7 A;  1CUK A;  2OOB A;  2L4F A;  2EJS A;  4HEO A;  2CP8 A;  1Y8G A;  2HAK A;  1DV0 A;  1E94 E;  1V92 A;  1T43 A;  4F2L A;  3FRH A;  3K9O A;  1SG9 A;  1VEK A;  2QHO B;  1HT1 E;  1AIP C;  1YLA A;  1IXS A;  1MN3 A;  1A5T A;  3IEC A;  4G3O A;  2DAI A;  1TR8 A;  1G41 A;  1WGN A;  2K9D A;  3LCV B;  1VQ1 A;  1KYI A;  1WIV A;  1QZE A;  2O25 A;  2BWE A;  2MJ5 B;  1G3I A;  2DNA A;  3GLI E;  5JI2 E;  3MMP A;  1DO2 A;  1ZMV A;  2KNA A;  2DAG A;  4GEW A;  2EKF A;  2JY8 A;  1VDL A;  2JNH A;  4WP2 A;  2R0I A;  2JY6 B;  1OKS A;  3F92 A;  1F4I A;  3E46 A;  2L2D A;  1HT2 E;  3FE3 A;  2LVO C;  2ZTD A;  1NV9 A;  2MGW A;  4DBG B;  2DAE A;  2CWB A;  2DI0 A;  2QNJ A;  1XXH E;  1Q02 A;  1UFZ A;  2DKL A;  2RRU A;  1P3Q Q;  1T6O A;  3IHP A;  2L4E A;  2MRO B;  2OOA A;  3T6P A;  2LBC A;  3H4J A;  1WJ7 A;  1OTR A;  2DAK A;  1R4G A;  2K0B X;  1ZV1 A;  3E21 A;  1WGL A;  1ZMW A;  2HWJ A;  3GLH E;  2JUJ A;  2LVP C;  2KNZ A;  2LVN C;  2DZL A;  1IM2 A;  2LVA A;  2MR9 A;  1EFU B;  1WR1 B;  1XB2 B;  2H5X A;  2EKK A;  2KNV A;  2BWB A;  4F1I A;  3B89 A;  2KHH A;  1TTE A;  1IFY A;  2JZ0 A;  2JP7 A;  2QSF X;  4Q7J A;  1GO5 A;  2LTU A;  1VEG A;  2OO9 A;  1OAI A;  5DFL A;  1BVS A;  2DAM A;  1VG5 A;  2JZ1 A;  1C7Y A;  3LCU A;  2DEN A;  2WZJ A;  1OQY A;  3GLF E;  3K9P A;  3BBZ A;  2G3Q A;  3FRI A;  3GLG E;  2JY5 A;  1VEJ A;  2B3T A;  1NV8 A;  1PGY A;  2LVQ D;  2DHY A;  4R71 A;  2ZTC A;  1HQY E; 
#chains in the Genus database with same CATH topology
 2CRU A;  1NO1 A;  2DZN B;  1WHC A;  3QAU A;  4NRV A;  4JI5 M;  2EJS A;  1R7R A;  4HEO A;  4JI0 M;  3U6S A;  3U6D A;  4NOO B;  2CP8 A;  2HAK A;  3AV0 A;  3KOY E;  3QYE A;  3V76 A;  2JXN A;  1D0L A;  4QOS A;  1T43 A;  3U6Q A;  1HNZ M;  1QAM A;  2R46 A;  2WSE F;  3KSX A;  4G6Z A;  1LTM A;  4I5S A;  4B7G A;  1JB0 F;  5ITX E;  3QWL A;  3VLF B;  3U6M A;  2EUC A;  4RF0 A;  4G3O A;  1A5T A;  1GAB A;  4D80 A;  1G71 A;  2K9D A;  2FOI C;  1L8Q A;  3AKZ A;  3GLI A;  4L6V 6;  3SHF A;  5LMN M;  3TE6 A;  3DFZ A;  7CAT A;  2O25 A;  4DV5 M;  3W0F A;  3T1H M;  2UXD M;  3UK6 A;  5JI2 E;  3MMP A;  2C9O A;  1OAO C;  5E26 A;  5EXT A;  2Z4S A;  3C3E A;  4JI1 M;  1ZMV A;  2KNA A;  3HU2 A;  3VDU A;  3GPY A;  3CGW A;  2MH8 A;  1DGB A;  2JY8 A;  1VDL A;  2BJW A;  4DV7 M;  4LJ4 A;  2UUA M;  1W5S A;  4LF5 M;  4NXM M;  1N32 M;  3E46 A;  2X49 A;  2C96 A;  1HT2 E;  3FE3 A;  3E9S A;  2YFQ A;  3HHW A;  5E6J A;  5KPR A;  3B7N A;  2ZBK B;  3EIH A;  4R3D A;  4DR2 M;  4WW0 A;  1L2B A;  2UU9 M;  3KS8 A;  4NRW A;  3T15 A;  4JI3 M;  4DBG B;  4B08 A;  4DR5 M;  3B9P A;  2CWB A;  2DI0 A;  5EJC A;  1IY2 A;  1QQW A;  1J09 A;  2R62 A;  4GMQ A;  1UFZ A;  3CF0 A;  3SMP A;  2R6F A;  8CAT A;  4XK8 F;  1PJI A;  4LG2 A;  1RU3 A;  4DV3 M;  2UUB M;  3SYK A;  2QBY A;  2BJV A;  3T6P A;  1MU5 A;  2KDL A;  4L4U A;  3JAM S;  3GLF B;  4REZ A;  4BLC A;  3C58 A;  2CV2 A;  1E9S A;  3FTE A;  4QHT A;  1ZV1 A;  3GLF A;  3A98 B;  2FH0 A;  3E21 A;  2Z3X A;  2QP9 X;  1ZAE A;  4LJ7 A;  1FNN A;  2JUJ A;  4X64 M;  2F4V M;  1QUS A;  2LVN C;  2DZL A;  3HHZ A;  4LF9 M;  3R9X B;  4JYA M;  2RKO A;  1QYR A;  5EQT A;  4MB7 A;  2MR9 A;  4QNM A;  1Q39 A;  3FTC A;  2D7H A;  4JXJ A;  5BR8 M;  4I8O A;  1NJG A;  2V1C A;  2EKK A;  4K0K M;  3U6P A;  2BWB A;  2F5Q A;  1HNW M;  1IFY A;  2QQ8 A;  2QSF X;  4Q7J A;  5IZ7 D;  4AKH A;  3K92 A;  1E32 A;  3TWL A;  3A46 A;  2JZ1 A;  4MGH A;  4DR6 M;  2A5Y B;  3LCU A;  5DYG A;  5EP4 A;  2J7O A;  2DEN A;  2WZJ A;  3NWL A;  1YE9 A;  2L6O A;  1N75 A;  1IBK M;  1XNQ M;  1XMO M;  2YQZ A;  1LV7 A;  2QPA A;  1IBL M;  4IBE A;  4HLQ A;  1OIZ A;  1PGY A;  4DV2 M;  2DHY A;  2L7I A;  1Z5B A;  2ZTC A;  2C98 A;  1D0M A;  2CHV A;  4KT0 F;  5C18 A;  1H6U A;  1HQY E;  2CE7 A;  2LHC A;  1ZMU A;  3GPP A;  1HJP A;  2V6Z M;  1DO0 A;  3DA1 A;  3VKH A;  4B3T M;  4GKJ M;  3KW6 A;  3BOS A;  4WUR A;  1FJG M;  4M0D A;  1Y8G A;  2J5Y A;  1EE8 A;  2N35 A;  4GH9 A;  3SHG B;  4QOZ C;  1E94 E;  1V92 A;  1DV0 A;  4S12 A;  4MM3 B;  1XXH B;  2KZU A;  1N77 A;  3CTW B;  1N34 M;  4B3R M;  1SG9 A;  3AJI B;  2QHO B;  2G8L A;  5EXS A;  5ITU A;  1AIP C;  2J7N A;  1Z59 A;  1XXH A;  1SXJ D;  1MN3 A;  3PNY A;  3IEC A;  4LJ6 A;  2XZF A;  1NJF A;  1TR8 A;  4LFA M;  5ITY A;  4MGZ E;  1WGN A;  2VII A;  1VQ1 A;  5FSW A;  2F5N A;  2W82 A;  3PNV A;  2RGO A;  2BWE A;  1G3I A;  3GLH B;  3R8F A;  3GLI E;  1NY5 A;  1ZQ9 A;  3GRY A;  4B3S M;  4LZJ A;  1DO2 A;  2DZO B;  2M60 A;  2ZAN A;  4AG6 A;  3GLH A;  1AUA A;  2LWX A;  2EKF A;  2JNH A;  4ZPX A;  2R0I A;  2DWZ B;  4LGY A;  1OKS A;  4A3V B;  3I4V A;  2L2D A;  3RGS A;  3A45 A;  2KRK A;  1WXQ A;  4GC9 A;  4YY3 M;  3ZH9 B;  4AQY M;  5FTM A;  1N78 A;  1R2Y A;  2ZTD A;  4Y28 F;  2LXE A;  3U6O A;  3VK8 A;  4AW4 A;  4RKU F;  4KO8 A;  5H37 D;  3KP1 E;  4IBF A;  3KVW A;  3PFI A;  2VF7 A;  3H4M A;  3FKE A;  3HJQ A;  2QNJ A;  2HL7 A;  4IJF A;  2DKL A;  1SXJ B;  3AFH A;  3FTD A;  2DXI A;  1UM8 A;  5EP3 A;  5IT9 S;  1PM5 A;  1IN5 A;  3IHP A;  2L4E A;  2MRO B;  2OOA A;  3VFD A;  3GQ3 A;  4FCT A;  1SXJ A;  2LBC A;  2R65 A;  1WJ7 A;  1V33 A;  2Z7J A;  3H4J A;  1OTR A;  5FTN A;  3UGJ A;  2XLJ A;  1OJL A;  5DNY A;  5L8R F;  4LRS A;  1R4G A;  2DWM A;  1PJS A;  1GLN A;  2JA2 A;  2CV1 A;  5A2Q S;  2RGH A;  4AKI A;  1IQP A;  1QAN A;  1ZMW A;  4B7F A;  4B3M M;  4FVM A;  1QAO A;  3SMS A;  1TDH A;  1Z5C A;  4GRI A;  3KP0 E;  2KNZ A;  4CHT B;  3DOA A;  4G4Q A;  2M5Z A;  4JI7 M;  3HU1 A;  2XH9 A;  2FE8 A;  4PDI A;  4HL4 A;  2HHH M;  4FW9 A;  1G59 A;  1DGG A;  1XB2 B;  3AOE A;  3QYB A;  1MJG M;  2L7H A;  3GRV A;  4FCW A;  1J5E M;  4F1I A;  4KOD A;  4FWD A;  4LFB M;  2JZ0 A;  1GO5 A;  1OFI A;  2LTU A;  5ITX A;  2OO9 A;  4LJ5 A;  3SAV A;  2DWL A;  4QHS A;  5DFL A;  1L2C A;  2DAM A;  2DVW B;  2NQ8 C;  3L27 A;  4OU7 A;  3GQ5 A;  1XHB A;  2GNO A;  4L78 A;  3K8Z A;  2C99 A;  1OQY A;  2KA6 B;  1NY6 A;  3E4R A;  2F5S A;  5C1B A;  2Y21 A;  3AOG A;  5ITQ A;  3AL0 C;  4MGK E;  3HZJ A;  1OIP A;  4YHH M;  4FCV A;  4LY6 A;  3GLG E;  4LF6 M;  2B3T A;  2LVQ D;  4M9X A;  1NHG C;  3VKG A;  3B7Q A;  4JV5 M;  3UZU A;  4NSO B;  2KRU A;  2X4A A;  4UN2 B;  1I4W A;  2XFS A;  3RFW A;  1JR3 E;  1W5T A;  3GQ4 A;  3M0E A;  4G4R A;  2L4F A;  4GIT A;  4MGY E;  4IBI A;  3KSJ A;  1QUT A;  3A42 A;  3ZC7 B;  2KEB A;  4X62 M;  4F2L A;  4IJE A;  3VDP A;  3U61 B;  1IN6 A;  3HJ8 A;  3L2A A;  4NXN M;  4CIS A;  2VDB B;  1HR0 M;  3W0L B;  3U61 A;  4EIW A;  4IBC A;  2DAI A;  1G41 A;  2C5R A;  3L26 A;  1IN8 A;  1GJT A;  3GPU A;  5EXP A;  2KW0 A;  3MJ5 A;  1DGF A;  4IBJ A;  4JI4 M;  4GHL A;  2ZAM A;  2DNA A;  2GQF A;  1Q3C A;  4IBD A;  2XSZ D;  3SAW A;  3TQS A;  1KFV A;  1Z5A A;  3CF2 A;  2WSC F;  3TL4 X;  3TWK A;  5FLX S;  3WHL A;  1IXR C;  1GL6 A;  2DAG A;  1J7K A;  4Z6Y A;  1K82 A;  4DR4 M;  3SAU A;  2CFO A;  3GO8 A;  1Q3B A;  1MX0 A;  1NNJ A;  3BXW A;  1XNR M;  2V1U A;  1NV9 A;  3W68 A;  2MGW A;  3M6A A;  2YNM D;  3L28 A;  3SYL A;  2O01 F;  2R18 A;  2R44 A;  4FD2 A;  4DR7 M;  2VF8 A;  4LGM A;  3HWS A;  3I4Y A;  2F5O A;  4M0W A;  3B74 A;  2RRU A;  1Q02 A;  1SXJ C;  3WHK A;  5IWA M;  2ZM6 M;  1OFH A;  1P3Q Q;  3LMM A;  3FTF A;  4DUZ M;  1IN4 A;  1IN7 A;  3THG A;  3GP1 A;  4DV0 M;  3J81 S;  2FS1 A;  1ORY B;  1IY1 A;  4OVZ B;  2D7G A;  3ZQJ A;  5KO3 A;  2HCB A;  3MK6 A;  1TH2 A;  4I81 A;  1PRB A;  2X8A A;  3GRU A;  3MHV C;  4OVZ A;  5DYI A;  4D81 A;  2O5R A;  3PVS A;  3RGP A;  3U60 B;  2XEP A;  4M9Z A;  3NBI A;  2JWS A;  2XSZ A;  1D0K A;  1X37 A;  1GJS A;  5F3W A;  2LVP C;  1TH4 A;  2LNH C;  4LCB A;  3D8B A;  4NL4 H;  5ITR A;  2F5P A;  3AOE C;  5FTK A;  1IM2 A;  3LVW A;  2LVA A;  2P5T A;  3J80 S;  1GKI A;  1XC8 A;  3NBX X;  3FUV A;  3LW5 F;  4ANR A;  1WR1 B;  2XGN A;  5FTL A;  3U6E A;  3J2P B;  3JR5 A;  4ITQ A;  2KNV A;  1QDR A;  3K2L A;  3K1J A;  2L09 A;  1TTE A;  4P16 A;  4BB9 A;  2DHR A;  2H1R A;  2JP7 A;  5EP2 A;  1N36 M;  3SAT A;  1TH3 A;  2R45 A;  1VEG A;  3HHX A;  1OAI A;  2CUZ A;  1HQC A;  1IXZ A;  4RNA A;  3M7G A;  4DV6 M;  4GHA A;  3L25 A;  4G4O A;  3I01 M;  2FNA A;  3ZCB B;  3Q8G A;  4PDG A;  4TUW A;  2VQE M;  2QZ4 A;  2XFT A;  3HY5 A;  3GLI B;  5ITT A;  3GLF E;  3FYC A;  3K9P A;  3KXE C;  3BBZ A;  3SC3 A;  3GPX A;  4DR3 M;  1I94 M;  4XGI A;  3UJN A;  1TGU A;  3PXG A;  3FRI A;  5EP1 A;  3LQR A;  2JY5 A;  1QAQ A;  1L1T A;  3U5Z B;  2ERC A;  3U6L A;  4X65 M;  3D8L A;  3KS4 A;  4B7H A;  3RE8 A;  4DV1 M;  1L2D A;  4LF7 M;  4AI6 A;  1G4A E;  4CJ6 A;  2D7E A;  3I51 A;  3U5Z A;  2JY7 A;  1CUK A;  2BNK A;  2OOB A;  3Q8X A;  2AHM A;  1R2Z A;  1KSF X;  4IBG A;  4LJ8 A;  1NSF A;  4AG5 A;  4DV4 M;  3IG8 A;  1QVR A;  3CF6 E;  5FTJ A;  1R6B X;  3C3D A;  3FRH A;  1IXS B;  1QZM A;  3K9O A;  3KDS E;  4LZZ A;  4LF4 M;  1N33 M;  1VEK A;  4I4L A;  4IBK A;  1HT1 E;  2I7P A;  4Z8X A;  1YLA A;  4DUY M;  1IXS A;  1XWI A;  2KXE A;  1DGH B;  1PJQ A;  3J7B A;  4FWG A;  1IBM M;  2QBY B;  4MH0 E;  2YR0 A;  3LCV B;  1NHW C;  3FUT A;  4G4N A;  4D82 A;  1KYI A;  1IY0 A;  1WIV A;  1QZE A;  1DGH A;  2K47 A;  4M9S A;  4XBO A;  3HHY A;  2MJ5 B;  1NVM A;  5IRE B;  4R7G A;  1TF0 B;  3FUU A;  2OPF A;  3SBJ A;  3VK7 A;  1GVN A;  4GC5 A;  2Q2E B;  1GL7 A;  2HKJ A;  3SAR A;  2WSF F;  1T3T A;  4AZF A;  4L16 A;  4NSR A;  2UXC M;  3T1Y M;  3HGI A;  2C9C A;  4BBA A;  3U6C A;  2ZAO A;  4GEW A;  4KLN A;  3LVV A;  4WP2 A;  2JY6 B;  3F92 A;  1F4I A;  2G5G X;  1JR3 D;  2LHG A;  3B7Z A;  3HKP A;  4LJ9 A;  4L8R C;  3KOW E;  1HNX M;  3C9P A;  2LVO C;  4L15 A;  4QNR A;  3DZD A;  2CV0 A;  2UUC M;  3SFZ A;  4JN6 A;  2DAE A;  1R5L A;  2KZS A;  4LFC M;  4OW0 A;  4LJA A;  4P17 A;  2QEN A;  3KOX E;  3LQQ A;  4CIZ A;  2OQ4 A;  1EIJ A;  4IBB A;  2CHG A;  1XXH E;  3TPZ A;  3JR4 A;  2VQF M;  3UMM A;  2Z4R A;  1XMQ M;  3SAS A;  4AKG A;  4X66 M;  1T6O A;  4PCZ A;  3W67 A;  2I7N A;  1YSY A;  3FD9 A;  1Z6T A;  4DR1 M;  1G8P A;  4W5W A;  1K3W A;  2Y20 A;  3FUX A;  2EO2 A;  3L29 A;  2DAK A;  2CHQ A;  2XF3 A;  3ILK A;  4FWH A;  2EA0 A;  1TDZ A;  2K0B X;  5JI3 E;  3GLG B;  3HX3 A;  1PJT A;  4RF1 A;  1JQJ C;  2Y0T A;  5EXX A;  5GKN A;  1WGL A;  2HWJ A;  3GLH E;  1K3X A;  3HU3 A;  3TWM A;  2LH0 A;  3KFU G;  4LRT A;  3GLG A;  4JI2 M;  1QDT A;  2Y0Q A;  1S3S A;  2APL A;  2QCU A;  2R4E A;  4CGY B;  1VDD A;  1L1Z A;  2R4J A;  4GIP A;  1JR3 A;  5KQ8 A;  4LF8 M;  1EFU B;  1PJJ A;  2XZU A;  2DWN A;  4II7 A;  2H5X A;  1D2N A;  1YUB A;  3GRR A;  3B89 A;  5LMU M;  2KHH A;  3IG5 A;  4PT5 A;  3FYD A;  4PD2 A;  5KPT A;  5KPZ A;  2E5L M;  4JI8 M;  3OTO M;  1E9R A;  3EIE A;  1BVS A;  1SXJ E;  3J27 B;  4OX9 M;  1VG5 A;  3FUW A;  3KOZ E;  1C7Y A;  3T38 A;  2CEA A;  5BPV A;  1C1K A;  1NNU C;  4GKK M;  3J7A S;  2G3Q A;  3U60 A;  2UXB M;  4IIW A;  5KQD A;  4JI6 M;  4MGI E;  1VEJ A;  2Z8Y M;  1NV8 A;  4R71 A;  4NC6 A;  3I04 M;  3HJS A;  4KHP M;  2K6B A;  2FFJ A;  1V34 A; 
#chains in the Genus database with same CATH homology
 1ZMU A;  1HJP A;  1G4A E;  1DO0 A;  4UN2 B;  1WHC A;  1JR3 E;  2JY7 A;  1CUK A;  2OOB A;  2L4F A;  2EJS A;  4HEO A;  2CP8 A;  1Y8G A;  2HAK A;  1DV0 A;  1E94 E;  1V92 A;  1T43 A;  4F2L A;  3FRH A;  3K9O A;  1SG9 A;  1VEK A;  2QHO B;  1HT1 E;  1AIP C;  1YLA A;  1IXS A;  1MN3 A;  1A5T A;  3IEC A;  4G3O A;  2DAI A;  1TR8 A;  1G41 A;  1WGN A;  2K9D A;  3LCV B;  1VQ1 A;  1KYI A;  1WIV A;  1QZE A;  2O25 A;  2BWE A;  2MJ5 B;  1G3I A;  2DNA A;  3GLI E;  5JI2 E;  3MMP A;  1DO2 A;  1ZMV A;  2KNA A;  2DAG A;  4GEW A;  2EKF A;  2JY8 A;  1VDL A;  2JNH A;  4WP2 A;  2R0I A;  2JY6 B;  1OKS A;  3F92 A;  1F4I A;  3E46 A;  2L2D A;  1HT2 E;  3FE3 A;  2LVO C;  2ZTD A;  1NV9 A;  2MGW A;  4DBG B;  2DAE A;  2CWB A;  2DI0 A;  2QNJ A;  1XXH E;  1Q02 A;  1UFZ A;  2DKL A;  2RRU A;  1P3Q Q;  1T6O A;  3IHP A;  2L4E A;  2MRO B;  2OOA A;  3T6P A;  2LBC A;  3H4J A;  1WJ7 A;  1OTR A;  2DAK A;  1R4G A;  2K0B X;  1ZV1 A;  3E21 A;  1WGL A;  1ZMW A;  2HWJ A;  3GLH E;  2JUJ A;  2LVP C;  2KNZ A;  2LVN C;  2DZL A;  1IM2 A;  2LVA A;  2MR9 A;  1EFU B;  1WR1 B;  1XB2 B;  2H5X A;  2EKK A;  2KNV A;  2BWB A;  4F1I A;  3B89 A;  2KHH A;  1TTE A;  1IFY A;  2JZ0 A;  2JP7 A;  2QSF X;  4Q7J A;  1GO5 A;  2LTU A;  1VEG A;  2OO9 A;  1OAI A;  5DFL A;  1BVS A;  2DAM A;  1VG5 A;  2JZ1 A;  1C7Y A;  3LCU A;  2DEN A;  2WZJ A;  1OQY A;  3GLF E;  3K9P A;  3BBZ A;  2G3Q A;  3FRI A;  3GLG E;  2JY5 A;  1VEJ A;  2B3T A;  1NV8 A;  1PGY A;  2LVQ D;  2DHY A;  4R71 A;  2ZTC A;  1HQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...