4DR3M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr3M02
4LF9M 3A46A 4LF5M 3GP1A 1PJIA 4LF6M 3J7AS 4MB7A 5ITYA 4JI0M 3GQ4A 3VK8A 4KHPM 4GKKM 1Z5BA 4X64M 3W0FA 3SASA 1XMQM 2UXDM 4LFCM 3U6CA 4DR5M 2UUBM 4NRWA 1N36M 1L2DA 1K3XA 1MX0A 4B3TM 4JI8M 1K82A 4DR6M 4DR4M 2OQ4A 2F5NA 4CISA 4DV7M 4NXNM 4G4QA 1L1TA 1HR0M 4K0KM 1IBLM 4DV4M 1Q39A 3JAMS 3U6MA 4X66M 5ITXE 1L2CA 5IWAM 1XNQM 4OX9M 1Z5AA 3J80S 4B3SM 4JI3M 4DV6M 3SAWA 3A42A 1XC8A 1MU5A 4G4RA 2XZFA 2F5PA 2UUCM 2F5OA 2Q2EB 5ITQA 4DR1M 3U6QA 1R2ZA 2UU9M 1K3WA 4DV0M 3SBJA 3SAUA 3GPPA 4DV5M 3U6LA 4JI5M 4PDGA 1PJJA 3U6SA 2F5QA 3U6EA 4DUYM 5IT9S 3JR4A 3GO8A 2VQFM 1TDZA 2UXBM 2EA0A 1TDHA 3TWKA 3U6DA 1Q3CA 5BR8M 4AQYM 1EE8A 4YY3M 5ITUA 2ZM6M 2F5SA 1N32M 3GPXA 5ITTA 3TWLA 1HNXM 2F4VM 4DR7M 1NNJA 3DOAA 4G4NA 4PCZA 5FLXS 4X65M 3J81S 3GPYA 4YHHM 4LFAM 4DV1M 3GQ5A 1IBKM 1FJGM 4DV3M 1IBMM 4JI1M 3VK7A 1HNWM 4JI6M 5LMUM 4B3MM 5ITXA 2OPFA 4DR2M 3SARA 4JI7M 3T1HM 1PM5A 3TWMA 1N33M 3SATA 3U6OA 4JV5M 1L1ZA 3OTOM 4ITQA 3SAVA 1Z59A 3GPUA 4LFBM 2E5LM 2HKJA 3JR5A 4DV2M 1Z5CA 4DR3M 5A2QS 4B3RM 1KFVA 4LF8M 3T1YM 5LMNM 4NXMM 4LF4M 4PD2A 4NRVA 4LF7M 4PDIA 4X62M 3U6PA 3GQ3A 1I94M 1J5EM 4DUZM 1HNZM 4G4OA 4JYAM 2UXCM 4GKJM 2HHHM 1Q3BA 4JI2M 2VQEM 5ITRA 1R2YA 1XNRM 2ZBKB 1L2BA 4JI4M 1XMOM 1N34M 2UUAM 3A45A 2XZUA 3C58A
chains in the Genus database with same CATH superfamily
3RGSA 4L16A 3UK6A 3A46A 1QZMA 1KSFX 4LF5M 2JY8A 4I81A 1GO5A 1TH3A 4MB7A 4R71A 3E46A 3HHXA 1ZMUA 3HKPA 8CATA 4QHSA 4LJ8A 3J7BA 4MGHA 1OQYA 2DHRA 2R4JA 2D7EA 1H6UA 2C9CA 2CE7A 2R62A 3HZJA 2DHYA 2YFQA 3I4VA 2UXDM 1HQCA 4NOOB 3W67A 3AJIB 7CATA 4LG2A 4LJAA 1QAMA 2OQ4A 2F5NA 2XF3A 3HY5A 3LMMA 5EXXA 2KZUA 3V76A 4ANRA 1TH4A 4GHLA 1KYIA 2DVWB 3QWLA 3QYEA 1V34A 4XK8F 5DYIA 4QOSA 4X66M 3JAMS 3GLIA 3U6MA 2C5RA 1L2CA 3Q8XA 3WHLA 4GITA 1IN5A 2LVAA 3KW6A 1Z5AA 1JQJC 1D0MA 1OAOC 1VEJA 4JN6A 5DYGA 2M5ZA 1S3SA 4FCTA 3U60B 3A42A 4FCWA 1XC8A 4IBDA 1JR3A 2F5PA 4D81A 5EP2A 2H5XA 2MROB 3LW5F 2KHHA 2QBYA 2C98A 1J7KA 4DR1M 2UU9M 4RKUF 3IG5A 3ZC7B 1L8QA 1UM8A 2VDBB 3SYLA 3SAUA 1QZEA 4TUWA 3GPPA 1E32A 4RF0A 4PDGA 1YSYA 3HHWA 1QANA 3GO8A 2VQFM 1TDZA 4LGYA 2UXBM 3KOWE 2EA0A 3HHZA 4L6V6 3NBXX 1QYRA 3KOXE 5BR8M 1OIPA 2CHQA 2NQ8C 2XEPA 3B9PA 3GPXA 1NHWC 2VIIA 4Y28F 2CHGA 2M60A 2WSFF 2ZTDA 4DR7M 4CGYB 4OW0A 4LJ4A 3DOAA 3AOGA 4FW9A 5EP4A 4QOZC 3C9PA 1JR3D 4NC6A 2V1UA 4LFAM 3M0EA 1IBMM 1PJQA 2N35A 3H4JA 3VK7A 2R18A 1VG5A 2JXNA 2LVPC 2YR0A 3AOEC 4EIWA 2J5YA 2KDLA 2QHOB 4LCBA 1NJFA 4A3VB 3K92A 3T1HM 2DNAA 3CF6E 3FTEA 4JV5M 2DAIA 4ITQA 3HGIA 3VDPA 4B7GA 4W5WA 2KNAA 3GPUA 2DWZB 1RU3A 4P16A 2E5LM 2DXIA 2HKJA 2FE8A 5KO3A 4R7GA 4AKGA 3IG8A 4MGYE 4M9XA 1OKSA 4HLQA 1DGHB 3LVWA 3FUUA 2KRKA 4OU7A 1W5SA 3PVSA 4LF8M 3LCVB 4LJ9A 3SMSA 2L4FA 5LMNM 4R3DA 3GLIE 2CV0A 2Z8YM 4RF1A 4FWHA 2LBCA 3U6PA 3LVVA 5L8RF 4LJ7A 4DUZM 5E6JA 3HU3A 3FUTA 4P17A 5FTNA 1G59A 4Z8XA 4IBIA 2DAEA 2JY6B 5DNYA 2LNHC 3D8BA 5ITRA 1OIZA 4WP2A 1XNRM 4G3OA 1R6BX 4FD2A 3HJ8A 1XMOM 1N34M 3IECA 1E9SA 2EKFA 3C58A 3U61A 2Y20A 3DZDA 4LF9M 1HJPA 2B3TA 3E21A 1R7RA 3TQSA 3GP1A 1PJIA 1XXHB 2ERCA 4IBGA 3GRYA 2QCUA 4M0WA 5ITYA 3SHGB 1A5TA 2LH0A 4FVMA 3KFUG 1YUBA 1V33A 4BB9A 1E9RA 2JWSA 2KW0A 4MGIE 2QBYB 2DAKA 1F4IA 2XLJA 2LHCA 3GLFB 3L25A 2G8LA 5IZ7D 2LTUA 5EJCA 3K9PA 4GH9A 3PXGA 3W0FA 5KPTA 4LFCM 4M9ZA 4I8OA 5EXTA 2UUBM 5EXSA 1MX0A 3D8LA 4B08A 4JI8M 1K82A 4DR6M 3UJNA 1TF0B 3R8FA 1BVSA 1IXSA 1MJGM 4CISA 4DV7M 1GJTA 4QNMA 2RGOA 2K6BA 1UFZA 2RGHA 3WHKA 4BBAA 1PRBA 2LVNC 1Q39A 1SG9A 1E94E 4IBEA 3GLHA 2G5GX 2JNHA 5JI2E 5KPRA 5FTMA 3LQRA 4NSOB 4B3SM 2YQZA 2EO2A 1SXJB 3SAWA 1GJSA 2QQ8A 1GL6A 1QAOA 2EJSA 2L7IA 3TPZA 4G4RA 2XZFA 3FUXA 2R44A 2KXEA 3K8ZA 1QVRA 2WSEF 5FSWA 3U6QA 2O5RA 1ORYB 1NNUC 4REZA 3U5ZB 2QENA 4UN2B 4F1IA 4AG5A 3MK6A 3U6SA 3U6EA 1IY0A 5IT9S 3W0LB 4FCVA 4IJEA 5FTLA 1G3IA 1TDHA 2QSFX 3TWKA 4G6ZA 4FWDA 2KNVA 2F5SA 1AUAA 5BPVA 3BBZA 3ILKA 4L4UA 4KLNA 4LRTA 2WZJA 2CP8A 3R9XB 2Z7JA 4AG6A 2FH0A 3B89A 4PCZA 2CHVA 2QPAA 1GLNA 4YHHM 2JY7A 4LJ6A 2DI0A 3FYCA 5DFLA 3UZUA 4MGKE 2KA6B 3QYBA 2DAGA 3DA1A 5LMUM 4B3MM 2OPFA 3SARA 5JI3E 4GEWA 5EXPA 2XH9A 3U6OA 4GMQA 1WR1B 2HAKA 3OTOM 2Y0TA 1GL7A 1QUTA 1IXZA 1OAIA 4LZZA 2RKOA 2BNKA 4KODA 3FRIA 1NV9A 5FTJA 4GHAA 5A2QS 3HU2A 2K0BX 3AKZA 1NO1A 1VDDA 2DWLA 1NSFA 1KFVA 3CF2A 1R5LA 3T1YM 1VEGA 4LF4M 2XFSA 4JXJA 3GLGA 4PD2A 1IN6A 4BLCA 3GLHE 2GNOA 1IY1A 2VF8A 3GRVA 4LF7M 3K2LA 1I94M 2GQFA 1PJTA 1TH2A 3GQ3A 1OFHA 4WURA 4GKJM 3EIEA 4L15A 1IFYA 1IN8A 4IJFA 1Q3BA 1WGNA 3SMPA 2DWNA 3HJSA 2VQEM 4JI2M 1LTMA 1R2YA 2V6ZM 2XSZA 1Z6TA 2ZBKB 5KQDA 4AKIA 3M7GA 3HHYA 2Y0QA 3KSXA 1QAQA 3A45A 3KDSE 4LGMA 3J27B 4LRSA 1D0KA 2JUJA 2QZ4A 3EIHA 1NHGC 4LF6M 2HL7A 2V1CA 3FE3A 4L8RC 2X49A 2QP9X 3RFWA 3H4MA 4JI0M 3GQ4A 3VK8A 4KHPM 2OO9A 4NL4H 4RNAA 3B74A 4WW0A 1DO0A 3PNYA 3BOSA 1OJLA 1Z5BA 2L6OA 4X64M 3SASA 1NY5A 2JA2A 1WHCA 2DENA 1W5TA 3U6CA 3HWSA 1N36M 1ZAEA 2ZAOA 1K3XA 1L2DA 4B3TM 1T3TA 3BXWA 3C3DA 3T6PA 4Z6YA 4DR4M 2ZTCA 2JY5A 3ZQJA 3KS4A 1L1TA 2XSZD 1HR0M 3KVWA 3A98B 3L28A 4K0KM 1IBLM 4AW4A 1R4GA 3GLIB 3VKGA 5IWAM 1Q02A 4CIZA 1P3QQ 1G71A 2JP7A 3F92A 3I04M 2LVOC 2R46A 3J80S 1G4AE 2Z3XA 4DV6M 4B7HA 2X4AA 2L2DA 1WJ7A 4M9SA 1SXJC 2RRUA 3U60A 4OVZA 2L7HA 1ZV1A 2MJ5B 2DZLA 2O01F 2Q2EB 2O25A 1HT2E 1VEKA 1R2ZA 4DV0M 3MJ5A 1MN3A 1N77A 4AZFA 3GLGE 4DV5M 3E9SA 3U6LA 1VQ1A 4JI5M 3L26A 3LCUA 2CRUA 1IXRC 4F2LA 2CV1A 1QDRA 3U6DA 2LWXA 1Q3CA 2QNJA 4YY3M 2ZM6M 1N32M 3TWLA 1HNXM 1Y8GA 3HJQA 4MGZE 1NNJA 3ZH9B 5E26A 3I01M 3I4YA 1IM2A 3KP1E 5FLXS 3J81S 3GPYA 3ZCBB 3GQ5A 5F3WA 1FJGM 2CUZA 2I7PA 2XGNA 4AKHA 2LVQD 1HNWM 4KO8A 4JI6M 1C1KA 3FUWA 3NBIA 5ITXA 2I7NA 4JI7M 3K9OA 2JZ1A 4IBKA 3SATA 3FUVA 4IBCA 3TL4X 3VDUA 3SAVA 2BWBA 1Z59A 1EIJA 2P5TA 1J09A 3KXEC 2G3QA 4IIWA 2DWMA 2BJVA 5KQ8A 4DR3M 1DGHA 1NV8A 2CWBA 2DZNB 4NXMM 2KEBA 1LV7A 1XHBA 2C9OA 4I5SA 4NRVA 2XFTA 4CHTB 3HX3A 2UXCM 4MH0E 1J5EM 1QDTA 5C1BA 2BWEA 4JYAM 3SHFA 3FYDA 5EQTA 2JZ0A 2ZAMA 2FFJA 3FRHA 1VDLA 3AOEA 3B7ZA 4IBBA 3C3EA 3KSJA 3RGPA 1L2BA 2AHMA 3PFIA 1WXQA 3VKHA 1IN4A 3U61B 4LY6A 2XZUA 1NJGA 1JB0F 1HT1E 3HU1A 3RE8A 3VLFB 1I4WA 4I4LA 2D7GA 2J7OA 3KP0E 1WGLA 3SYKA 1PJSA 3UMMA 4L78A 1NVMA 2DAMA 2H1RA 2R0IA 3AV0A 1XXHA 2HCBA 2MH8A 2HWJA 4GC9A 3FD9A 4HL4A 4OVZB 4CJ6A 3J7AS 1HQYE 2KRUA 2L4EA 1YE9A 3CGWA 2LHGA 3GLFA 4GKKM 1GABA 1XMQM 2D7HA 4NSRA 3J2PB 5H37D 4DR5M 1IN7A 4NRWA 3MHVC 4IBFA 1T43A 1XWIA 3SC3A 1IXSB 2FOIC 3L2AA 3MMPA 4DBGB 4GIPA 4GC5A 4NXNM 4G4QA 5EP1A 3KS8A 2EUCA 1ZQ9A 4DV4M 5ITXE 1EFUB 1TGUA 2Z4SA 3GLHB 1XNQM 4OX9M 5FTKA 2VF7A 2X8AA 2J7NA 1ZMVA 2K9DA 3FTDA 4JI3M 1V92A 4D82A 3AFHA 1SXJA 3PNVA 3SFZA 1MU5A 4IBJA 1QUSA 3KOZE 2UUCM 2F5OA 2K47A 3L27A 5ITQA 4LJ5A 2LXEA 1ZMWA 1IY2A 3FTFA 2BJWA 1K3WA 1QQWA 1N75A 3SBJA 1N78A 4PT5A 3U5ZA 2FNAA 4KT0F 1NY6A 3DFZA 2DZOB 1PJJA 2F5QA 4DUYM 2OOAA 3JR4A 3T15A 2CV2A 2Y21A 3CF0A 2KNZA 1DO2A 4AQYM 2R45A 1EE8A 2CEAA 5ITUA 1GVNA 3IHPA 5ITTA 2W82A 2YNMD 3QAUA 5EP3A 2Z4RA 3THGA 2F4VM 5IREB 2C99A 4XBOA 1WIVA 4G4NA 1X37A 1TTEA 1SXJD 4X65M 2MR9A 1D2NA 1G8PA 1CUKA 3FKEA 4MM3B 3GRUA 3W68A 3AL0C 2C96A 1XXHE 1IBKM 4DV1M 4AI6A 1G41A 1GKIA 4DV3M 4JI1M 3E4RA 4FWGA 4Q7JA 1DGBA 1JR3E 1YLAA 3GRRA 4XGIA 3B7NA 3UGJA 4DR2M 3TE6A 3GLFE 1PM5A 1IQPA 1D0LA 1PGYA 4QHTA 1DGFA 3TWMA 1N33M 1T6OA 1L1ZA 2FS1A 2WSCF 1XB2B 3LQQA 5KPZA 3CTWB 3FTCA 4LFBM 2APLA 3JR5A 4QNRA 4DV2M 1Z5CA 1C7YA 3B7QA 4B3RM 3T38A 4II7A 5GKNA 1OFIA 1DGGA 3M6AA 3GLGB 3I51A 2R4EA 4HEOA 4GRIA 1DV0A 2MGWA 2A5YB 2OOBA 3K1JA 3L29A 4LZJA 4ZPXA 4PDIA 4X62M 2DKLA 1HNZM 1TR8A 4G4OA 4D80A 2EKKA 3NWLA 3VFDA 5C18A 1SXJE 4B7FA 2HHHM 4S12A 2CFOA 1FNNA 1AIPC 3Q8GA 2ZANA 2KZSA 2R6FA 3KOYE 4JI4M 1OTRA 2R65A 2UUAM 2L09A 4M0DA
chains in the Genus database with same CATH topology
3RGSA 4L16A 3UK6A 3A46A 1QZMA 1KSFX 4LF5M 4I81A 1TH3A 4MB7A 3HHXA 3HKPA 8CATA 4QHSA 4LJ8A 3J7BA 4MGHA 2DHRA 2R4JA 2D7EA 1H6UA 2C9CA 2CE7A 2R62A 3I4VA 2YFQA 2UXDM 1HQCA 4NOOB 3AJIB 7CATA 4LG2A 4LJAA 1QAMA 2OQ4A 2F5NA 2XF3A 3LMMA 5EXXA 2KZUA 1TH4A 4GHLA 1KYIA 2DVWB 3QWLA 5DYIA 3JAMS 4QOSA 4X66M 3GLIA 3U6MA 2C5RA 1L2CA 3Q8XA 3WHLA 4GITA 1IN5A 3KW6A 1Z5AA 1JQJC 4JN6A 5DYGA 2M5ZA 1S3SA 4FCTA 3U60B 3A42A 4FCWA 1XC8A 4IBDA 1JR3A 2F5PA 4D81A 5EP2A 2QBYA 2C98A 1J7KA 4DR1M 2UU9M 3IG5A 3ZC7B 1L8QA 1UM8A 3SYLA 3SAUA 4TUWA 3GPPA 1E32A 4RF0A 4PDGA 1YSYA 3HHWA 1QANA 3GO8A 2VQFM 1TDZA 4LGYA 2UXBM 3KOWE 2EA0A 3HHZA 1QYRA 3KOXE 5BR8M 2CHQA 2NQ8C 2XEPA 3B9PA 3GPXA 1NHWC 2VIIA 2CHGA 2M60A 4DR7M 4CGYB 4OW0A 4LJ4A 3DOAA 3AOGA 4FW9A 5EP4A 4QOZC 1JR3D 2V1UA 4LFAM 3M0EA 1IBMM 3VK7A 2R18A 2YR0A 4EIWA 3AOEC 4LCBA 1NJFA 4A3VB 3K92A 3T1HM 3CF6E 3FTEA 4JV5M 4ITQA 3HGIA 3VDPA 4B7GA 4W5WA 3GPUA 2DWZB 4P16A 2E5LM 2DXIA 2HKJA 2FE8A 5KO3A 4R7GA 4AKGA 3IG8A 4MGYE 4M9XA 4HLQA 1DGHB 3LVWA 3FUUA 2KRKA 4OU7A 1W5SA 3PVSA 4LF8M 4LJ9A 3SMSA 5LMNM 4R3DA 2CV0A 4RF1A 4FWHA 3U6PA 3LVVA 4LJ7A 4DUZM 5E6JA 3HU3A 3FUTA 5FTNA 1G59A 4Z8XA 4IBIA 5DNYA 2LNHC 3D8BA 5ITRA 1XNRM 1R6BX 4FD2A 3HJ8A 1XMOM 1N34M 1E9SA 3U61A 3C58A 2Y20A 3DZDA 4LF9M 1R7RA 3TQSA 3GP1A 1PJIA 1XXHB 2ERCA 4IBGA 3GRYA 2QCUA 4M0WA 5ITYA 3SHGB 2LH0A 4FVMA 3KFUG 1YUBA 4BB9A 1E9RA 2KW0A 4MGIE 2QBYB 2XLJA 3L25A 3GLFB 2G8LA 5IZ7D 5EJCA 4GH9A 3PXGA 3W0FA 5KPTA 4LFCM 4M9ZA 4I8OA 5EXTA 2UUBM 5EXSA 1MX0A 3D8LA 4B08A 4JI8M 1K82A 4DR6M 3UJNA 3R8FA 4CISA 4DV7M 4QNMA 2RGOA 2RGHA 3WHKA 4BBAA 1Q39A 1E94E 4IBEA 3GLHA 2G5GX 5JI2E 5KPRA 5FTMA 3LQRA 4NSOB 4B3SM 2YQZA 2EO2A 1SXJB 3SAWA 1GL6A 1QAOA 2L7IA 3TPZA 4G4RA 2XZFA 3FUXA 2KXEA 3K8ZA 1QVRA 3U6QA 5FSWA 2O5RA 1ORYB 1NNUC 4REZA 3U5ZB 2QENA 4AG5A 3MK6A 3U6SA 3U6EA 1IY0A 5IT9S 3W0LB 4FCVA 4IJEA 5FTLA 1G3IA 1TDHA 3TWKA 4G6ZA 4FWDA 2F5SA 5BPVA 3ILKA 4L4UA 4KLNA 4LRTA 3R9XB 2Z7JA 4AG6A 4PCZA 2CHVA 2QPAA 1GLNA 4YHHM 4LJ6A 3FYCA 3UZUA 4MGKE 2KA6B 3DA1A 5LMUM 4B3MM 2OPFA 3SARA 5JI3E 5EXPA 2XH9A 3U6OA 4GMQA 3OTOM 2Y0TA 1GL7A 1IXZA 4LZZA 2RKOA 2BNKA 4KODA 5FTJA 4GHAA 5A2QS 3HU2A 3AKZA 2DWLA 1VDDA 1NSFA 1KFVA 3CF2A 3T1YM 4LF4M 2XFSA 4JXJA 3GLGA 4PD2A 1IN6A 4BLCA 4AKIA 1IY1A 3GRVA 4LF7M 3K2LA 1I94M 3GQ3A 1TH2A 1OFHA 4WURA 4GKJM 3EIEA 4L15A 1IN8A 4IJFA 1Q3BA 3SMPA 2DWNA 4JI2M 3HJSA 2VQEM 1R2YA 2V6ZM 2XSZA 1Z6TA 2ZBKB 5KQDA 3M7GA 3HHYA 2Y0QA 3KSXA 1QAQA 3A45A 3KDSE 4LGMA 3J27B 4LRSA 2QZ4A 3EIHA 1NHGC 4LF6M 2HL7A 2V1CA 4L8RC 2X49A 2QP9X 3RFWA 3H4MA 4JI0M 3GQ4A 3VK8A 4KHPM 4NL4H 4RNAA 4WW0A 1DO0A 3PNYA 3BOSA 1OJLA 1Z5BA 2L6OA 4X64M 3SASA 1NY5A 2JA2A 1W5TA 3U6CA 3HWSA 1N36M 1ZAEA 2ZAOA 1K3XA 1L2DA 4B3TM 1T3TA 4Z6YA 4DR4M 3KS4A 1L1TA 2XSZD 1HR0M 3KVWA 3A98B 3L28A 4K0KM 1IBLM 4AW4A 3GLIB 3VKGA 5IWAM 2R46A 3J80S 1G4AE 2Z3XA 4DV6M 4B7HA 2X4AA 4M9SA 1SXJC 3U60A 4OVZA 2L7HA 2Q2EB 1HT2E 1R2ZA 4DV0M 3MJ5A 1N77A 4AZFA 4DV5M 3E9SA 3U6LA 4JI5M 3L26A 1IXRC 2CV1A 3U6DA 2LWXA 1Q3CA 4YY3M 2ZM6M 1N32M 3TWLA 1HNXM 3HJQA 4MGZE 1NNJA 3ZH9B 5E26A 3I4YA 1IM2A 3KP1E 5FLXS 3J81S 3GPYA 3ZCBB 3GQ5A 5F3WA 1FJGM 2CUZA 2I7PA 2XGNA 4AKHA 1HNWM 4KO8A 4JI6M 1C1KA 3FUWA 3NBIA 5ITXA 2I7NA 4JI7M 4IBKA 3SATA 3FUVA 4IBCA 3TL4X 3VDUA 3SAVA 1Z59A 2P5TA 1J09A 3KXEC 4IIWA 2DWMA 2BJVA 5KQ8A 4DR3M 1DGHA 2DZNB 4NXMM 2KEBA 1LV7A 1XHBA 2C9OA 4I5SA 4NRVA 2XFTA 4CHTB 2UXCM 4MH0E 1J5EM 5C1BA 4JYAM 3SHFA 3FYDA 5EQTA 2ZAMA 2FFJA 3AOEA 4IBBA 3KSJA 3RGPA 1L2BA 2AHMA 3PFIA 1WXQA 3VKHA 1IN4A 3U61B 4LY6A 2XZUA 1NJGA 1HT1E 3HU1A 3RE8A 3VLFB 1I4WA 4I4LA 2D7GA 2J7OA 3KP0E 3SYKA 3UMMA 4L78A 1NVMA 2H1RA 3AV0A 1XXHA 2HCBA 4GC9A 3J7AS 3FD9A 4HL4A 4OVZB 1HQYE 2KRUA 1YE9A 3GLFA 4GKKM 1XMQM 2D7HA 4NSRA 3J2PB 5H37D 4DR5M 1IN7A 4NRWA 3MHVC 4IBFA 1XWIA 3SC3A 1IXSB 2FOIC 3L2AA 4GIPA 4GC5A 4NXNM 4G4QA 5EP1A 3KS8A 2EUCA 1ZQ9A 4DV4M 5ITXE 1TGUA 2Z4SA 3GLHB 1XNQM 4OX9M 5FTKA 2X8AA 2J7NA 3FTDA 4JI3M 4D82A 3AFHA 1SXJA 3PNVA 3SFZA 1MU5A 4IBJA 2UUCM 3KOZE 2F5OA 2K47A 3L27A 5ITQA 4LJ5A 2LXEA 3FTFA 1IY2A 2BJWA 1K3WA 1QQWA 1N75A 3SBJA 1N78A 4PT5A 3U5ZA 2FNAA 1NY6A 3DFZA 2DZOB 1PJJA 2F5QA 4DUYM 3JR4A 3T15A 2CV2A 2Y21A 3CF0A 1DO2A 4AQYM 2R45A 1EE8A 2CEAA 5ITUA 1GVNA 5ITTA 2W82A 2YNMD 3QAUA 5EP3A 2Z4RA 3THGA 2F4VM 5IREB 2C99A 4XBOA 4G4NA 1X37A 1SXJD 4X65M 4MM3B 1D2NA 1G8PA 3FKEA 3AL0C 3GRUA 4AI6A 2C96A 1IBKM 4DV1M 1G41A 1GKIA 4DV3M 4JI1M 3E4RA 4FWGA 1DGBA 3GRRA 4XGIA 3UGJA 4DR2M 3TE6A 1PM5A 1IQPA 4QHTA 1DGFA 3TWMA 1N33M 1L1ZA 3LQQA 5KPZA 3CTWB 3FTCA 4LFBM 3JR5A 4QNRA 4DV2M 1Z5CA 4B3RM 3T38A 4II7A 5GKNA 1OFIA 1DGGA 3M6AA 3GLGB 3I51A 2R4EA 4GRIA 4LZJA 2A5YB 3K1JA 3L29A 4ZPXA 4PDIA 4X62M 1HNZM 4G4OA 4D80A 3NWLA 3VFDA 5C18A 1SXJE 4B7FA 2HHHM 4S12A 2CFOA 1FNNA 2ZANA 2KZSA 3KOYE 4JI4M 2R65A 2UUAM 2L09A 4M0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 M;  3A46 A;  4LF5 M;  3GP1 A;  1PJI A;  4LF6 M;  3J7A S;  4MB7 A;  5ITY A;  4JI0 M;  3GQ4 A;  3VK8 A;  4KHP M;  4GKK M;  1Z5B A;  4X64 M;  3W0F A;  3SAS A;  1XMQ M;  2UXD M;  4LFC M;  3U6C A;  4DR5 M;  2UUB M;  4NRW A;  1N36 M;  1L2D A;  1K3X A;  1MX0 A;  4B3T M;  4JI8 M;  1K82 A;  4DR6 M;  4DR4 M;  2OQ4 A;  2F5N A;  4CIS A;  4DV7 M;  4NXN M;  4G4Q A;  1L1T A;  1HR0 M;  4K0K M;  1IBL M;  4DV4 M;  1Q39 A;  3JAM S;  3U6M A;  4X66 M;  5ITX E;  1L2C A;  5IWA M;  1XNQ M;  4OX9 M;  1Z5A A;  3J80 S;  4B3S M;  4JI3 M;  4DV6 M;  3SAW A;  3A42 A;  1XC8 A;  1MU5 A;  4G4R A;  2XZF A;  2F5P A;  2UUC M;  2F5O A;  2Q2E B;  5ITQ A;  4DR1 M;  3U6Q A;  1R2Z A;  2UU9 M;  1K3W A;  4DV0 M;  3SBJ A;  3SAU A;  3GPP A;  4DV5 M;  3U6L A;  4JI5 M;  4PDG A;  1PJJ A;  3U6S A;  2F5Q A;  3U6E A;  4DUY M;  5IT9 S;  3JR4 A;  3GO8 A;  2VQF M;  1TDZ A;  2UXB M;  2EA0 A;  1TDH A;  3TWK A;  3U6D A;  1Q3C A;  5BR8 M;  4AQY M;  1EE8 A;  4YY3 M;  5ITU A;  2ZM6 M;  2F5S A;  1N32 M;  3GPX A;  5ITT A;  3TWL A;  1HNX M;  2F4V M;  4DR7 M;  1NNJ A;  3DOA A;  4G4N A;  4PCZ A;  5FLX S;  4X65 M;  3J81 S;  3GPY A;  4YHH M;  4LFA M;  4DV1 M;  3GQ5 A;  1IBK M;  1FJG M;  4DV3 M;  1IBM M;  4JI1 M;  3VK7 A;  1HNW M;  4JI6 M;  5LMU M;  4B3M M;  5ITX A;  2OPF A;  4DR2 M;  3SAR A;  4JI7 M;  3T1H M;  1PM5 A;  3TWM A;  1N33 M;  3SAT A;  3U6O A;  4JV5 M;  1L1Z A;  3OTO M;  4ITQ A;  3SAV A;  1Z59 A;  3GPU A;  4LFB M;  2E5L M;  2HKJ A;  3JR5 A;  4DV2 M;  1Z5C A;  4DR3 M;  5A2Q S;  4B3R M;  1KFV A;  4LF8 M;  3T1Y M;  5LMN M;  4NXM M;  4LF4 M;  4PD2 A;  4NRV A;  4LF7 M;  4PDI A;  4X62 M;  3U6P A;  3GQ3 A;  1I94 M;  1J5E M;  4DUZ M;  1HNZ M;  4G4O A;  4JYA M;  2UXC M;  4GKJ M;  2HHH M;  1Q3B A;  4JI2 M;  2VQE M;  5ITR A;  1R2Y A;  1XNR M;  2ZBK B;  1L2B A;  4JI4 M;  1XMO M;  1N34 M;  2UUA M;  3A45 A;  2XZU A;  3C58 A; 
#chains in the Genus database with same CATH topology
 3RGS A;  4L16 A;  3UK6 A;  3A46 A;  1QZM A;  1KSF X;  4LF5 M;  2JY8 A;  4I81 A;  1GO5 A;  1TH3 A;  4MB7 A;  4R71 A;  3E46 A;  3HHX A;  1ZMU A;  3HKP A;  8CAT A;  4QHS A;  4LJ8 A;  3J7B A;  4MGH A;  1OQY A;  2DHR A;  2R4J A;  2D7E A;  1H6U A;  2C9C A;  2CE7 A;  2R62 A;  3HZJ A;  2DHY A;  2YFQ A;  3I4V A;  2UXD M;  1HQC A;  4NOO B;  3W67 A;  3AJI B;  7CAT A;  4LG2 A;  4LJA A;  1QAM A;  2OQ4 A;  2F5N A;  2XF3 A;  3HY5 A;  3LMM A;  5EXX A;  2KZU A;  3V76 A;  4ANR A;  1TH4 A;  4GHL A;  1KYI A;  2DVW B;  3QWL A;  3QYE A;  1V34 A;  4XK8 F;  5DYI A;  4QOS A;  4X66 M;  3JAM S;  3GLI A;  3U6M A;  2C5R A;  1L2C A;  3Q8X A;  3WHL A;  4GIT A;  1IN5 A;  2LVA A;  3KW6 A;  1Z5A A;  1JQJ C;  1D0M A;  1OAO C;  1VEJ A;  4JN6 A;  5DYG A;  2M5Z A;  1S3S A;  4FCT A;  3U60 B;  3A42 A;  4FCW A;  1XC8 A;  4IBD A;  1JR3 A;  2F5P A;  4D81 A;  5EP2 A;  2H5X A;  2MRO B;  3LW5 F;  2KHH A;  2QBY A;  2C98 A;  1J7K A;  4DR1 M;  2UU9 M;  4RKU F;  3IG5 A;  3ZC7 B;  1L8Q A;  1UM8 A;  2VDB B;  3SYL A;  3SAU A;  1QZE A;  4TUW A;  3GPP A;  1E32 A;  4RF0 A;  4PDG A;  1YSY A;  3HHW A;  1QAN A;  3GO8 A;  2VQF M;  1TDZ A;  4LGY A;  2UXB M;  3KOW E;  2EA0 A;  3HHZ A;  4L6V 6;  3NBX X;  1QYR A;  3KOX E;  5BR8 M;  1OIP A;  2CHQ A;  2NQ8 C;  2XEP A;  3B9P A;  3GPX A;  1NHW C;  2VII A;  4Y28 F;  2CHG A;  2M60 A;  2WSF F;  2ZTD A;  4DR7 M;  4CGY B;  4OW0 A;  4LJ4 A;  3DOA A;  3AOG A;  4FW9 A;  5EP4 A;  4QOZ C;  3C9P A;  1JR3 D;  4NC6 A;  2V1U A;  4LFA M;  3M0E A;  1IBM M;  1PJQ A;  2N35 A;  3H4J A;  3VK7 A;  2R18 A;  1VG5 A;  2JXN A;  2LVP C;  2YR0 A;  3AOE C;  4EIW A;  2J5Y A;  2KDL A;  2QHO B;  4LCB A;  1NJF A;  4A3V B;  3K92 A;  3T1H M;  2DNA A;  3CF6 E;  3FTE A;  4JV5 M;  2DAI A;  4ITQ A;  3HGI A;  3VDP A;  4B7G A;  4W5W A;  2KNA A;  3GPU A;  2DWZ B;  1RU3 A;  4P16 A;  2E5L M;  2DXI A;  2HKJ A;  2FE8 A;  5KO3 A;  4R7G A;  4AKG A;  3IG8 A;  4MGY E;  4M9X A;  1OKS A;  4HLQ A;  1DGH B;  3LVW A;  3FUU A;  2KRK A;  4OU7 A;  1W5S A;  3PVS A;  4LF8 M;  3LCV B;  4LJ9 A;  3SMS A;  2L4F A;  5LMN M;  4R3D A;  3GLI E;  2CV0 A;  2Z8Y M;  4RF1 A;  4FWH A;  2LBC A;  3U6P A;  3LVV A;  5L8R F;  4LJ7 A;  4DUZ M;  5E6J A;  3HU3 A;  3FUT A;  4P17 A;  5FTN A;  1G59 A;  4Z8X A;  4IBI A;  2DAE A;  2JY6 B;  5DNY A;  2LNH C;  3D8B A;  5ITR A;  1OIZ A;  4WP2 A;  1XNR M;  4G3O A;  1R6B X;  4FD2 A;  3HJ8 A;  1XMO M;  1N34 M;  3IEC A;  1E9S A;  2EKF A;  3C58 A;  3U61 A;  2Y20 A;  3DZD A;  4LF9 M;  1HJP A;  2B3T A;  3E21 A;  1R7R A;  3TQS A;  3GP1 A;  1PJI A;  1XXH B;  2ERC A;  4IBG A;  3GRY A;  2QCU A;  4M0W A;  5ITY A;  3SHG B;  1A5T A;  2LH0 A;  4FVM A;  3KFU G;  1YUB A;  1V33 A;  4BB9 A;  1E9R A;  2JWS A;  2KW0 A;  4MGI E;  2QBY B;  2DAK A;  1F4I A;  2XLJ A;  2LHC A;  3GLF B;  3L25 A;  2G8L A;  5IZ7 D;  2LTU A;  5EJC A;  3K9P A;  4GH9 A;  3PXG A;  3W0F A;  5KPT A;  4LFC M;  4M9Z A;  4I8O A;  5EXT A;  2UUB M;  5EXS A;  1MX0 A;  3D8L A;  4B08 A;  4JI8 M;  1K82 A;  4DR6 M;  3UJN A;  1TF0 B;  3R8F A;  1BVS A;  1IXS A;  1MJG M;  4CIS A;  4DV7 M;  1GJT A;  4QNM A;  2RGO A;  2K6B A;  1UFZ A;  2RGH A;  3WHK A;  4BBA A;  1PRB A;  2LVN C;  1Q39 A;  1SG9 A;  1E94 E;  4IBE A;  3GLH A;  2G5G X;  2JNH A;  5JI2 E;  5KPR A;  5FTM A;  3LQR A;  4NSO B;  4B3S M;  2YQZ A;  2EO2 A;  1SXJ B;  3SAW A;  1GJS A;  2QQ8 A;  1GL6 A;  1QAO A;  2EJS A;  2L7I A;  3TPZ A;  4G4R A;  2XZF A;  3FUX A;  2R44 A;  2KXE A;  3K8Z A;  1QVR A;  2WSE F;  5FSW A;  3U6Q A;  2O5R A;  1ORY B;  1NNU C;  4REZ A;  3U5Z B;  2QEN A;  4UN2 B;  4F1I A;  4AG5 A;  3MK6 A;  3U6S A;  3U6E A;  1IY0 A;  5IT9 S;  3W0L B;  4FCV A;  4IJE A;  5FTL A;  1G3I A;  1TDH A;  2QSF X;  3TWK A;  4G6Z A;  4FWD A;  2KNV A;  2F5S A;  1AUA A;  5BPV A;  3BBZ A;  3ILK A;  4L4U A;  4KLN A;  4LRT A;  2WZJ A;  2CP8 A;  3R9X B;  2Z7J A;  4AG6 A;  2FH0 A;  3B89 A;  4PCZ A;  2CHV A;  2QPA A;  1GLN A;  4YHH M;  2JY7 A;  4LJ6 A;  2DI0 A;  3FYC A;  5DFL A;  3UZU A;  4MGK E;  2KA6 B;  3QYB A;  2DAG A;  3DA1 A;  5LMU M;  4B3M M;  2OPF A;  3SAR A;  5JI3 E;  4GEW A;  5EXP A;  2XH9 A;  3U6O A;  4GMQ A;  1WR1 B;  2HAK A;  3OTO M;  2Y0T A;  1GL7 A;  1QUT A;  1IXZ A;  1OAI A;  4LZZ A;  2RKO A;  2BNK A;  4KOD A;  3FRI A;  1NV9 A;  5FTJ A;  4GHA A;  5A2Q S;  3HU2 A;  2K0B X;  3AKZ A;  1NO1 A;  1VDD A;  2DWL A;  1NSF A;  1KFV A;  3CF2 A;  1R5L A;  3T1Y M;  1VEG A;  4LF4 M;  2XFS A;  4JXJ A;  3GLG A;  4PD2 A;  1IN6 A;  4BLC A;  3GLH E;  2GNO A;  1IY1 A;  2VF8 A;  3GRV A;  4LF7 M;  3K2L A;  1I94 M;  2GQF A;  1PJT A;  1TH2 A;  3GQ3 A;  1OFH A;  4WUR A;  4GKJ M;  3EIE A;  4L15 A;  1IFY A;  1IN8 A;  4IJF A;  1Q3B A;  1WGN A;  3SMP A;  2DWN A;  3HJS A;  2VQE M;  4JI2 M;  1LTM A;  1R2Y A;  2V6Z M;  2XSZ A;  1Z6T A;  2ZBK B;  5KQD A;  4AKI A;  3M7G A;  3HHY A;  2Y0Q A;  3KSX A;  1QAQ A;  3A45 A;  3KDS E;  4LGM A;  3J27 B;  4LRS A;  1D0K A;  2JUJ A;  2QZ4 A;  3EIH A;  1NHG C;  4LF6 M;  2HL7 A;  2V1C A;  3FE3 A;  4L8R C;  2X49 A;  2QP9 X;  3RFW A;  3H4M A;  4JI0 M;  3GQ4 A;  3VK8 A;  4KHP M;  2OO9 A;  4NL4 H;  4RNA A;  3B74 A;  4WW0 A;  1DO0 A;  3PNY A;  3BOS A;  1OJL A;  1Z5B A;  2L6O A;  4X64 M;  3SAS A;  1NY5 A;  2JA2 A;  1WHC A;  2DEN A;  1W5T A;  3U6C A;  3HWS A;  1N36 M;  1ZAE A;  2ZAO A;  1K3X A;  1L2D A;  4B3T M;  1T3T A;  3BXW A;  3C3D A;  3T6P A;  4Z6Y A;  4DR4 M;  2ZTC A;  2JY5 A;  3ZQJ A;  3KS4 A;  1L1T A;  2XSZ D;  1HR0 M;  3KVW A;  3A98 B;  3L28 A;  4K0K M;  1IBL M;  4AW4 A;  1R4G A;  3GLI B;  3VKG A;  5IWA M;  1Q02 A;  4CIZ A;  1P3Q Q;  1G71 A;  2JP7 A;  3F92 A;  3I04 M;  2LVO C;  2R46 A;  3J80 S;  1G4A E;  2Z3X A;  4DV6 M;  4B7H A;  2X4A A;  2L2D A;  1WJ7 A;  4M9S A;  1SXJ C;  2RRU A;  3U60 A;  4OVZ A;  2L7H A;  1ZV1 A;  2MJ5 B;  2DZL A;  2O01 F;  2Q2E B;  2O25 A;  1HT2 E;  1VEK A;  1R2Z A;  4DV0 M;  3MJ5 A;  1MN3 A;  1N77 A;  4AZF A;  3GLG E;  4DV5 M;  3E9S A;  3U6L A;  1VQ1 A;  4JI5 M;  3L26 A;  3LCU A;  2CRU A;  1IXR C;  4F2L A;  2CV1 A;  1QDR A;  3U6D A;  2LWX A;  1Q3C A;  2QNJ A;  4YY3 M;  2ZM6 M;  1N32 M;  3TWL A;  1HNX M;  1Y8G A;  3HJQ A;  4MGZ E;  1NNJ A;  3ZH9 B;  5E26 A;  3I01 M;  3I4Y A;  1IM2 A;  3KP1 E;  5FLX S;  3J81 S;  3GPY A;  3ZCB B;  3GQ5 A;  5F3W A;  1FJG M;  2CUZ A;  2I7P A;  2XGN A;  4AKH A;  2LVQ D;  1HNW M;  4KO8 A;  4JI6 M;  1C1K A;  3FUW A;  3NBI A;  5ITX A;  2I7N A;  4JI7 M;  3K9O A;  2JZ1 A;  4IBK A;  3SAT A;  3FUV A;  4IBC A;  3TL4 X;  3VDU A;  3SAV A;  2BWB A;  1Z59 A;  1EIJ A;  2P5T A;  1J09 A;  3KXE C;  2G3Q A;  4IIW A;  2DWM A;  2BJV A;  5KQ8 A;  4DR3 M;  1DGH A;  1NV8 A;  2CWB A;  2DZN B;  4NXM M;  2KEB A;  1LV7 A;  1XHB A;  2C9O A;  4I5S A;  4NRV A;  2XFT A;  4CHT B;  3HX3 A;  2UXC M;  4MH0 E;  1J5E M;  1QDT A;  5C1B A;  2BWE A;  4JYA M;  3SHF A;  3FYD A;  5EQT A;  2JZ0 A;  2ZAM A;  2FFJ A;  3FRH A;  1VDL A;  3AOE A;  3B7Z A;  4IBB A;  3C3E A;  3KSJ A;  3RGP A;  1L2B A;  2AHM A;  3PFI A;  1WXQ A;  3VKH A;  1IN4 A;  3U61 B;  4LY6 A;  2XZU A;  1NJG A;  1JB0 F;  1HT1 E;  3HU1 A;  3RE8 A;  3VLF B;  1I4W A;  4I4L A;  2D7G A;  2J7O A;  3KP0 E;  1WGL A;  3SYK A;  1PJS A;  3UMM A;  4L78 A;  1NVM A;  2DAM A;  2H1R A;  2R0I A;  3AV0 A;  1XXH A;  2HCB A;  2MH8 A;  2HWJ A;  4GC9 A;  3FD9 A;  4HL4 A;  4OVZ B;  4CJ6 A;  3J7A S;  1HQY E;  2KRU A;  2L4E A;  1YE9 A;  3CGW A;  2LHG A;  3GLF A;  4GKK M;  1GAB A;  1XMQ M;  2D7H A;  4NSR A;  3J2P B;  5H37 D;  4DR5 M;  1IN7 A;  4NRW A;  3MHV C;  4IBF A;  1T43 A;  1XWI A;  3SC3 A;  1IXS B;  2FOI C;  3L2A A;  3MMP A;  4DBG B;  4GIP A;  4GC5 A;  4NXN M;  4G4Q A;  5EP1 A;  3KS8 A;  2EUC A;  1ZQ9 A;  4DV4 M;  5ITX E;  1EFU B;  1TGU A;  2Z4S A;  3GLH B;  1XNQ M;  4OX9 M;  5FTK A;  2VF7 A;  2X8A A;  2J7N A;  1ZMV A;  2K9D A;  3FTD A;  4JI3 M;  1V92 A;  4D82 A;  3AFH A;  1SXJ A;  3PNV A;  3SFZ A;  1MU5 A;  4IBJ A;  1QUS A;  3KOZ E;  2UUC M;  2F5O A;  2K47 A;  3L27 A;  5ITQ A;  4LJ5 A;  2LXE A;  1ZMW A;  1IY2 A;  3FTF A;  2BJW A;  1K3W A;  1QQW A;  1N75 A;  3SBJ A;  1N78 A;  4PT5 A;  3U5Z A;  2FNA A;  4KT0 F;  1NY6 A;  3DFZ A;  2DZO B;  1PJJ A;  2F5Q A;  4DUY M;  2OOA A;  3JR4 A;  3T15 A;  2CV2 A;  2Y21 A;  3CF0 A;  2KNZ A;  1DO2 A;  4AQY M;  2R45 A;  1EE8 A;  2CEA A;  5ITU A;  1GVN A;  3IHP A;  5ITT A;  2W82 A;  2YNM D;  3QAU A;  5EP3 A;  2Z4R A;  3THG A;  2F4V M;  5IRE B;  2C99 A;  4XBO A;  1WIV A;  4G4N A;  1X37 A;  1TTE A;  1SXJ D;  4X65 M;  2MR9 A;  1D2N A;  1G8P A;  1CUK A;  3FKE A;  4MM3 B;  3GRU A;  3W68 A;  3AL0 C;  2C96 A;  1XXH E;  1IBK M;  4DV1 M;  4AI6 A;  1G41 A;  1GKI A;  4DV3 M;  4JI1 M;  3E4R A;  4FWG A;  4Q7J A;  1DGB A;  1JR3 E;  1YLA A;  3GRR A;  4XGI A;  3B7N A;  3UGJ A;  4DR2 M;  3TE6 A;  3GLF E;  1PM5 A;  1IQP A;  1D0L A;  1PGY A;  4QHT A;  1DGF A;  3TWM A;  1N33 M;  1T6O A;  1L1Z A;  2FS1 A;  2WSC F;  1XB2 B;  3LQQ A;  5KPZ A;  3CTW B;  3FTC A;  4LFB M;  2APL A;  3JR5 A;  4QNR A;  4DV2 M;  1Z5C A;  1C7Y A;  3B7Q A;  4B3R M;  3T38 A;  4II7 A;  5GKN A;  1OFI A;  1DGG A;  3M6A A;  3GLG B;  3I51 A;  2R4E A;  4HEO A;  4GRI A;  1DV0 A;  2MGW A;  2A5Y B;  2OOB A;  3K1J A;  3L29 A;  4LZJ A;  4ZPX A;  4PDI A;  4X62 M;  2DKL A;  1HNZ M;  1TR8 A;  4G4O A;  4D80 A;  2EKK A;  3NWL A;  3VFD A;  5C18 A;  1SXJ E;  4B7F A;  2HHH M;  4S12 A;  2CFO A;  1FNN A;  1AIP C;  3Q8G A;  2ZAN A;  2KZS A;  2R6F A;  3KOY E;  4JI4 M;  1OTR A;  2R65 A;  2UUA M;  2L09 A;  4M0D A; 
#chains in the Genus database with same CATH homology
 3RGS A;  4L16 A;  3UK6 A;  3A46 A;  1QZM A;  1KSF X;  4LF5 M;  4I81 A;  1TH3 A;  4MB7 A;  3HHX A;  3HKP A;  8CAT A;  4QHS A;  4LJ8 A;  3J7B A;  4MGH A;  2DHR A;  2R4J A;  2D7E A;  1H6U A;  2C9C A;  2CE7 A;  2R62 A;  3I4V A;  2YFQ A;  2UXD M;  1HQC A;  4NOO B;  3AJI B;  7CAT A;  4LG2 A;  4LJA A;  1QAM A;  2OQ4 A;  2F5N A;  2XF3 A;  3LMM A;  5EXX A;  2KZU A;  1TH4 A;  4GHL A;  1KYI A;  2DVW B;  3QWL A;  5DYI A;  3JAM S;  4QOS A;  4X66 M;  3GLI A;  3U6M A;  2C5R A;  1L2C A;  3Q8X A;  3WHL A;  4GIT A;  1IN5 A;  3KW6 A;  1Z5A A;  1JQJ C;  4JN6 A;  5DYG A;  2M5Z A;  1S3S A;  4FCT A;  3U60 B;  3A42 A;  4FCW A;  1XC8 A;  4IBD A;  1JR3 A;  2F5P A;  4D81 A;  5EP2 A;  2QBY A;  2C98 A;  1J7K A;  4DR1 M;  2UU9 M;  3IG5 A;  3ZC7 B;  1L8Q A;  1UM8 A;  3SYL A;  3SAU A;  4TUW A;  3GPP A;  1E32 A;  4RF0 A;  4PDG A;  1YSY A;  3HHW A;  1QAN A;  3GO8 A;  2VQF M;  1TDZ A;  4LGY A;  2UXB M;  3KOW E;  2EA0 A;  3HHZ A;  1QYR A;  3KOX E;  5BR8 M;  2CHQ A;  2NQ8 C;  2XEP A;  3B9P A;  3GPX A;  1NHW C;  2VII A;  2CHG A;  2M60 A;  4DR7 M;  4CGY B;  4OW0 A;  4LJ4 A;  3DOA A;  3AOG A;  4FW9 A;  5EP4 A;  4QOZ C;  1JR3 D;  2V1U A;  4LFA M;  3M0E A;  1IBM M;  3VK7 A;  2R18 A;  2YR0 A;  4EIW A;  3AOE C;  4LCB A;  1NJF A;  4A3V B;  3K92 A;  3T1H M;  3CF6 E;  3FTE A;  4JV5 M;  4ITQ A;  3HGI A;  3VDP A;  4B7G A;  4W5W A;  3GPU A;  2DWZ B;  4P16 A;  2E5L M;  2DXI A;  2HKJ A;  2FE8 A;  5KO3 A;  4R7G A;  4AKG A;  3IG8 A;  4MGY E;  4M9X A;  4HLQ A;  1DGH B;  3LVW A;  3FUU A;  2KRK A;  4OU7 A;  1W5S A;  3PVS A;  4LF8 M;  4LJ9 A;  3SMS A;  5LMN M;  4R3D A;  2CV0 A;  4RF1 A;  4FWH A;  3U6P A;  3LVV A;  4LJ7 A;  4DUZ M;  5E6J A;  3HU3 A;  3FUT A;  5FTN A;  1G59 A;  4Z8X A;  4IBI A;  5DNY A;  2LNH C;  3D8B A;  5ITR A;  1XNR M;  1R6B X;  4FD2 A;  3HJ8 A;  1XMO M;  1N34 M;  1E9S A;  3U61 A;  3C58 A;  2Y20 A;  3DZD A;  4LF9 M;  1R7R A;  3TQS A;  3GP1 A;  1PJI A;  1XXH B;  2ERC A;  4IBG A;  3GRY A;  2QCU A;  4M0W A;  5ITY A;  3SHG B;  2LH0 A;  4FVM A;  3KFU G;  1YUB A;  4BB9 A;  1E9R A;  2KW0 A;  4MGI E;  2QBY B;  2XLJ A;  3L25 A;  3GLF B;  2G8L A;  5IZ7 D;  5EJC A;  4GH9 A;  3PXG A;  3W0F A;  5KPT A;  4LFC M;  4M9Z A;  4I8O A;  5EXT A;  2UUB M;  5EXS A;  1MX0 A;  3D8L A;  4B08 A;  4JI8 M;  1K82 A;  4DR6 M;  3UJN A;  3R8F A;  4CIS A;  4DV7 M;  4QNM A;  2RGO A;  2RGH A;  3WHK A;  4BBA A;  1Q39 A;  1E94 E;  4IBE A;  3GLH A;  2G5G X;  5JI2 E;  5KPR A;  5FTM A;  3LQR A;  4NSO B;  4B3S M;  2YQZ A;  2EO2 A;  1SXJ B;  3SAW A;  1GL6 A;  1QAO A;  2L7I A;  3TPZ A;  4G4R A;  2XZF A;  3FUX A;  2KXE A;  3K8Z A;  1QVR A;  3U6Q A;  5FSW A;  2O5R A;  1ORY B;  1NNU C;  4REZ A;  3U5Z B;  2QEN A;  4AG5 A;  3MK6 A;  3U6S A;  3U6E A;  1IY0 A;  5IT9 S;  3W0L B;  4FCV A;  4IJE A;  5FTL A;  1G3I A;  1TDH A;  3TWK A;  4G6Z A;  4FWD A;  2F5S A;  5BPV A;  3ILK A;  4L4U A;  4KLN A;  4LRT A;  3R9X B;  2Z7J A;  4AG6 A;  4PCZ A;  2CHV A;  2QPA A;  1GLN A;  4YHH M;  4LJ6 A;  3FYC A;  3UZU A;  4MGK E;  2KA6 B;  3DA1 A;  5LMU M;  4B3M M;  2OPF A;  3SAR A;  5JI3 E;  5EXP A;  2XH9 A;  3U6O A;  4GMQ A;  3OTO M;  2Y0T A;  1GL7 A;  1IXZ A;  4LZZ A;  2RKO A;  2BNK A;  4KOD A;  5FTJ A;  4GHA A;  5A2Q S;  3HU2 A;  3AKZ A;  2DWL A;  1VDD A;  1NSF A;  1KFV A;  3CF2 A;  3T1Y M;  4LF4 M;  2XFS A;  4JXJ A;  3GLG A;  4PD2 A;  1IN6 A;  4BLC A;  4AKI A;  1IY1 A;  3GRV A;  4LF7 M;  3K2L A;  1I94 M;  3GQ3 A;  1TH2 A;  1OFH A;  4WUR A;  4GKJ M;  3EIE A;  4L15 A;  1IN8 A;  4IJF A;  1Q3B A;  3SMP A;  2DWN A;  4JI2 M;  3HJS A;  2VQE M;  1R2Y A;  2V6Z M;  2XSZ A;  1Z6T A;  2ZBK B;  5KQD A;  3M7G A;  3HHY A;  2Y0Q A;  3KSX A;  1QAQ A;  3A45 A;  3KDS E;  4LGM A;  3J27 B;  4LRS A;  2QZ4 A;  3EIH A;  1NHG C;  4LF6 M;  2HL7 A;  2V1C A;  4L8R C;  2X49 A;  2QP9 X;  3RFW A;  3H4M A;  4JI0 M;  3GQ4 A;  3VK8 A;  4KHP M;  4NL4 H;  4RNA A;  4WW0 A;  1DO0 A;  3PNY A;  3BOS A;  1OJL A;  1Z5B A;  2L6O A;  4X64 M;  3SAS A;  1NY5 A;  2JA2 A;  1W5T A;  3U6C A;  3HWS A;  1N36 M;  1ZAE A;  2ZAO A;  1K3X A;  1L2D A;  4B3T M;  1T3T A;  4Z6Y A;  4DR4 M;  3KS4 A;  1L1T A;  2XSZ D;  1HR0 M;  3KVW A;  3A98 B;  3L28 A;  4K0K M;  1IBL M;  4AW4 A;  3GLI B;  3VKG A;  5IWA M;  2R46 A;  3J80 S;  1G4A E;  2Z3X A;  4DV6 M;  4B7H A;  2X4A A;  4M9S A;  1SXJ C;  3U60 A;  4OVZ A;  2L7H A;  2Q2E B;  1HT2 E;  1R2Z A;  4DV0 M;  3MJ5 A;  1N77 A;  4AZF A;  4DV5 M;  3E9S A;  3U6L A;  4JI5 M;  3L26 A;  1IXR C;  2CV1 A;  3U6D A;  2LWX A;  1Q3C A;  4YY3 M;  2ZM6 M;  1N32 M;  3TWL A;  1HNX M;  3HJQ A;  4MGZ E;  1NNJ A;  3ZH9 B;  5E26 A;  3I4Y A;  1IM2 A;  3KP1 E;  5FLX S;  3J81 S;  3GPY A;  3ZCB B;  3GQ5 A;  5F3W A;  1FJG M;  2CUZ A;  2I7P A;  2XGN A;  4AKH A;  1HNW M;  4KO8 A;  4JI6 M;  1C1K A;  3FUW A;  3NBI A;  5ITX A;  2I7N A;  4JI7 M;  4IBK A;  3SAT A;  3FUV A;  4IBC A;  3TL4 X;  3VDU A;  3SAV A;  1Z59 A;  2P5T A;  1J09 A;  3KXE C;  4IIW A;  2DWM A;  2BJV A;  5KQ8 A;  4DR3 M;  1DGH A;  2DZN B;  4NXM M;  2KEB A;  1LV7 A;  1XHB A;  2C9O A;  4I5S A;  4NRV A;  2XFT A;  4CHT B;  2UXC M;  4MH0 E;  1J5E M;  5C1B A;  4JYA M;  3SHF A;  3FYD A;  5EQT A;  2ZAM A;  2FFJ A;  3AOE A;  4IBB A;  3KSJ A;  3RGP A;  1L2B A;  2AHM A;  3PFI A;  1WXQ A;  3VKH A;  1IN4 A;  3U61 B;  4LY6 A;  2XZU A;  1NJG A;  1HT1 E;  3HU1 A;  3RE8 A;  3VLF B;  1I4W A;  4I4L A;  2D7G A;  2J7O A;  3KP0 E;  3SYK A;  3UMM A;  4L78 A;  1NVM A;  2H1R A;  3AV0 A;  1XXH A;  2HCB A;  4GC9 A;  3J7A S;  3FD9 A;  4HL4 A;  4OVZ B;  1HQY E;  2KRU A;  1YE9 A;  3GLF A;  4GKK M;  1XMQ M;  2D7H A;  4NSR A;  3J2P B;  5H37 D;  4DR5 M;  1IN7 A;  4NRW A;  3MHV C;  4IBF A;  1XWI A;  3SC3 A;  1IXS B;  2FOI C;  3L2A A;  4GIP A;  4GC5 A;  4NXN M;  4G4Q A;  5EP1 A;  3KS8 A;  2EUC A;  1ZQ9 A;  4DV4 M;  5ITX E;  1TGU A;  2Z4S A;  3GLH B;  1XNQ M;  4OX9 M;  5FTK A;  2X8A A;  2J7N A;  3FTD A;  4JI3 M;  4D82 A;  3AFH A;  1SXJ A;  3PNV A;  3SFZ A;  1MU5 A;  4IBJ A;  2UUC M;  3KOZ E;  2F5O A;  2K47 A;  3L27 A;  5ITQ A;  4LJ5 A;  2LXE A;  3FTF A;  1IY2 A;  2BJW A;  1K3W A;  1QQW A;  1N75 A;  3SBJ A;  1N78 A;  4PT5 A;  3U5Z A;  2FNA A;  1NY6 A;  3DFZ A;  2DZO B;  1PJJ A;  2F5Q A;  4DUY M;  3JR4 A;  3T15 A;  2CV2 A;  2Y21 A;  3CF0 A;  1DO2 A;  4AQY M;  2R45 A;  1EE8 A;  2CEA A;  5ITU A;  1GVN A;  5ITT A;  2W82 A;  2YNM D;  3QAU A;  5EP3 A;  2Z4R A;  3THG A;  2F4V M;  5IRE B;  2C99 A;  4XBO A;  4G4N A;  1X37 A;  1SXJ D;  4X65 M;  4MM3 B;  1D2N A;  1G8P A;  3FKE A;  3AL0 C;  3GRU A;  4AI6 A;  2C96 A;  1IBK M;  4DV1 M;  1G41 A;  1GKI A;  4DV3 M;  4JI1 M;  3E4R A;  4FWG A;  1DGB A;  3GRR A;  4XGI A;  3UGJ A;  4DR2 M;  3TE6 A;  1PM5 A;  1IQP A;  4QHT A;  1DGF A;  3TWM A;  1N33 M;  1L1Z A;  3LQQ A;  5KPZ A;  3CTW B;  3FTC A;  4LFB M;  3JR5 A;  4QNR A;  4DV2 M;  1Z5C A;  4B3R M;  3T38 A;  4II7 A;  5GKN A;  1OFI A;  1DGG A;  3M6A A;  3GLG B;  3I51 A;  2R4E A;  4GRI A;  4LZJ A;  2A5Y B;  3K1J A;  3L29 A;  4ZPX A;  4PDI A;  4X62 M;  1HNZ M;  4G4O A;  4D80 A;  3NWL A;  3VFD A;  5C18 A;  1SXJ E;  4B7F A;  2HHH M;  4S12 A;  2CFO A;  1FNN A;  2ZAN A;  2KZS A;  3KOY E;  4JI4 M;  2R65 A;  2UUA M;  2L09 A;  4M0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...