4DR3M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr3M02
5LMUM 4PCZA 2F5OA 3SBJA 3SAVA 4DR6M 4LF4M 3U6PA 4LFBM 4DUYM 3SARA 2VQEM 4DR1M 3U6DA 1HNXM 1NNJA 3GPPA 4DV5M 4JI5M 4PD2A 4GKKM 1N33M 4LF8M 1KFVA 1MU5A 4DV3M 1Q39A 4DUZM 3TWMA 1R2ZA 3GPUA 4G4NA 4JI2M 2ZM6M 5IWAM 3GQ3A 3GQ5A 4G4RA 4DV0M 4LF9M 1PM5A 3A45A 1TDZA 4JV5M 1Z5CA 2Q2EB 3A46A 1IBKM 4KHPM 3U6MA 3DOAA 1HNWM 5ITXE 4G4QA 4B3RM 5BR8M 1IBMM 2ZBKB 1XNQM 1Q3BA 2VQFM 1Z5BA 1K3XA 5A2QS 4DV1M 5ITTA 5LMNM 4AQYM 1N36M 5ITYA 1N34M 2XZUA 1TDHA 3SAWA 1I94M 3GPXA 3JR4A 4OX9M 4PDIA 1XMOM 4JI3M 3GPYA 2XZFA 4DR4M 3VK8A 4B3MM 3U6QA 2HKJA 4X66M 4YY3M 5ITRA 4JI6M 3GQ4A 1Q3CA 4X64M 4ITQA 1L1ZA 4GKJM 2F5PA 3JR5A 2F5SA 3SAUA 1Z59A 2UXCM 4JI0M 3JAMS 1Z5AA 2UUCM 3A42A 1J5EM 2OPFA 1FJGM 4NXMM 4B3SM 3T1YM 3VK7A 1XMQM 3J80S 3U6EA 1HNZM 4LFCM 2F5QA 1XNRM 5IT9S 3J81S 4YHHM 3U6SA 4PDGA 1R2YA 4DV6M 4X62M 4JI7M 2UUBM 3TWKA 4NRVA 3GP1A 2UXBM 4MB7A 2UUAM 1L2BA 4G4OA 1PJJA 4JI8M 2OQ4A 4DR5M 4DR3M 4NXNM 3OTOM 5ITXA 5FLXS 2UU9M 4JYAM 1L2CA 1K82A 4DR2M 4NRWA 4B3TM 1L1TA 1L2DA 1XC8A 2E5LM 1K3WA 4X65M 3GO8A 3SATA 2HHHM 3TWLA 4JI1M 5ITQA 3U6LA 4DR7M 3SASA 2F5NA 4DV7M 1PJIA 4DV2M 4LF6M 3U6CA 1IBLM 4LF5M 5ITUA 3C58A 1EE8A 4LF7M 3W0FA 2EA0A 4JI4M 1HR0M 1N32M 2UXDM 1MX0A 4DV4M 4K0KM 3T1HM 3J7AS 4LFAM 2F4VM 4CISA 3U6OA
chains in the Genus database with same CATH superfamily
2KEBA 1IM2A 1ZMVA 1IY0A 4L6V6 4LJAA 4LRSA 1JR3D 4DR6M 3GLHB 1R7RA 2LBCA 3IG8A 1TH4A 2DVWB 2XLJA 3SARA 4QOSA 3QWLA 1MJGM 2QENA 4DR1M 1G41A 4G3OA 1QANA 2QQ8A 4PD2A 4TUWA 3LCVB 3MJ5A 2L7IA 4FWHA 3U5ZA 4IBFA 4LF8M 3B7NA 4IBBA 1KFVA 3A98B 4LJ4A 2Z4RA 3LCUA 4I5SA 4DUZM 2FE8A 3TWMA 1R2ZA 2RGHA 4JI2M 5IWAM 3GQ3A 3RFWA 4M9SA 4HL4A 2K9DA 2R0IA 2Q2EB 2ZTCA 3A46A 3RGPA 4KLNA 4LGMA 5DYIA 4G4QA 4B3RM 1IBMM 2LNHC 2R44A 3IG5A 4S12A 1TTEA 1Q3BA 5KPTA 1XXHA 1VEGA 1MN3A 5FTNA 4DV1M 1TH2A 1D0MA 5ITTA 4KODA 2JY6B 3LQQA 5KQ8A 2Y0QA 2EO2A 4HEOA 5ITYA 3FRHA 3GLHA 3HHXA 4CHTB 4LG2A 3ZQJA 1IY2A 4IBEA 1I94M 3GPXA 2ZTDA 1KSFX 3JR4A 3UMMA 1OFIA 2YR0A 2CV2A 1D2NA 4FVMA 4IBIA 4L4UA 2MR9A 4DBGB 4Z6YA 4B3MM 5GKNA 4CJ6A 2JP7A 2X8AA 3U6QA 3UJNA 2H5XA 2YNMD 3K8ZA 2LVPC 4MH0E 5ITRA 1QUSA 1P3QQ 1L1ZA 4GKJM 3B9PA 2LWXA 2ZAMA 4GHLA 2QPAA 4FCVA 3JAMS 2RRUA 3IECA 3K2LA 2QSFX 3A42A 1YLAA 2OPFA 2LXEA 5KQDA 1FJGM 2CV0A 1XMQM 3I4VA 1XNRM 3U6EA 4LFCM 3VLFB 2QCUA 1JR3A 3U6SA 1F4IA 3AOGA 4JI7M 1OIPA 1WXQA 3WHKA 4B08A 2G5GX 2KDLA 2FS1A 2CFOA 3U61B 2UXBM 2MROB 1L2BA 1R6BX 2J7OA 2CE7A 3KP0E 3HY5A 3L28A 4BBAA 4JI8M 2FOIC 4DR5M 4MGKE 2K0BX 1J7KA 3ZC7B 3M7GA 4LY6A 4L16A 1NO1A 2BNKA 3AV0A 1OAOC 4NRWA 5FTLA 1L1TA 2DXIA 1IY1A 1GO5A 4QHTA 4I4LA 1Z6TA 4X65M 3AOEC 2HCBA 2F5NA 4XBOA 3SFZA 2CRUA 2Z7JA 4XK8F 3VFDA 2G3QA 4AZFA 2LVQD 3W0FA 1QDTA 2LVOC 2C96A 3NWLA 1HR0M 1N32M 2UXDM 3MK6A 4EIWA 1OAIA 2EKFA 3KSJA 3VKGA 2XFTA 3HU2A 1L8QA 3KXEC 2LHGA 3F92A 4GRIA 3B89A 1FNNA 2JUJA 2F4VM 1E9RA 2MGWA 4GC5A 1N78A 4PCZA 3I04M 2F5OA 1KYIA 3SBJA 1H6UA 2WSCF 4LF4M 4FWGA 2JZ1A 4LFBM 2DWMA 3M0EA 3U5ZB 3U6DA 3E4RA 3KOXE 3GPPA 2DAKA 4JI5M 1OIZA 3DA1A 4QOZC 1JQJC 2M5ZA 4GKKM 1N33M 4P17A 5L8RF 3QYEA 3C3EA 2D7GA 2KRKA 3R8FA 4GITA 1OTRA 1UM8A 1D0KA 1GVNA 4OU7A 3GPUA 2BJWA 3SMSA 4DV0M 2JA2A 2LTUA 4G4RA 4LF9M 1PM5A 3A45A 1DGBA 1TDZA 4R7GA 3FTEA 1E9SA 4JV5M 1Z5CA 3PNVA 1NY6A 3EIEA 2EJSA 1T3TA 3L2AA 3LQRA 2MJ5B 1DO2A 1A5TA 4M9ZA 1OKSA 5BR8M 4IIWA 4GIPA 1IXRC 1Z5BA 2CHVA 2CHQA 5LMNM 4AQYM 3QAUA 4REZA 1QUTA 1N36M 3SYLA 1NHWC 2RGOA 1GJSA 4IBGA 2DENA 3EIHA 2EUCA 1N34M 1PJTA 2XZUA 3KP1E 4HLQA 3SAWA 4MGYE 1WJ7A 3HU1A 1QAMA 1YSYA 5C1BA 3LVVA 2DZLA 3IHPA 1XMOM 2KXEA 4JI3M 2XZFA 1JR3E 1TF0B 3HJQA 2BJVA 3VK8A 3U60B 3WHLA 3GLIA 2HKJA 3SHFA 3VDPA 4JI6M 4WW0A 1IN6A 3PXGA 2CWBA 5EQTA 3L27A 3PFIA 5KPRA 2DI0A 4Y28F 3TPZA 2R4JA 3JR5A 1Z59A 2UXCM 2Y20A 4JI0M 1HQCA 2DAEA 2KNAA 1D0LA 2KNVA 3PNYA 4RF1A 2EKKA 3UGJA 2X4AA 2OO9A 4GMQA 1GL6A 3K92A 3MMPA 4KT0F 1OFHA 3J80S 4I81A 3KS4A 1AIPC 3CTWB 4YHHM 2CP8A 4PDGA 1GJTA 2BWEA 3QYBA 4DV6M 5H37D 1DV0A 5DNYA 4LJ5A 2UUAM 3KVWA 1GABA 1YE9A 2APLA 1XHBA 5E6JA 1PJJA 1IXZA 4PT5A 1PJSA 3TL4X 1ZQ9A 1VQ1A 4DR3M 2OOAA 4RF0A 3H4MA 3U60A 5FLXS 3AOEA 3LVWA 3FRIA 4D81A 2UU9M 1K82A 3HWSA 5EXTA 4ANRA 3HJSA 1X37A 2CV1A 4GC9A 2Z4SA 1YUBA 1K3WA 3GO8A 2DWZB 1ZMWA 1PRBA 4A3VB 4GEWA 2L6OA 1NNUC 5ITQA 1QQWA 2KRUA 3GLFA 3U6LA 3FTDA 4DV7M 3CF0A 1ORYB 1PJIA 4LF6M 2JWSA 3NBIA 3U6CA 4OW0A 4LF5M 5IZ7D 1IN5A 3GRYA 2KZUA 3C58A 1NVMA 1EIJA 4WP2A 1SXJC 4II7A 3T15A 4JI4M 8CATA 1G71A 5EJCA 1C7YA 4NSOB 2C98A 3T1HM 2DWLA 2C9OA 2D7HA 2LH0A 1WHCA 2QZ4A 4NOOB 3UZUA 4AKGA 3KOWE 2L7HA 3GRRA 4MGHA 3SAVA 5EP1A 3B7QA 4RKUF 1QAOA 5JI2E 3B7ZA 4M9XA 2C99A 3FYCA 2QBYB 4NL4H 2VQEM 3NBXX 2VDBB 4L78A 2R46A 5EXSA 4CGYB 2DWNA 3Q8XA 3L26A 3KSXA 3GLGA 3HGIA 4FWDA 2K6BA 3ZH9B 3RE8A 3KFUG 2B3TA 2Y21A 1JB0F 1Q39A 1I4WA 2KW0A 1XB2B 2WSEF 1IXSA 2AHMA 3BBZA 3GQ5A 3CF6E 2ZANA 2V1UA 3FTFA 2R65A 3K1JA 4G6ZA 4QHSA 1IBKM 1SXJD 2M60A 3GLIE 3U6MA 4CIZA 1PGYA 2GQFA 4MGIE 5ITXE 1N75A 2ZBKB 3FUWA 1QAQA 2OOBA 1W5TA 3FE3A 4M0DA 3DFZA 3SHGB 2VQFM 4FCWA 4LZJA 3ZCBB 3GRVA 1R4GA 1LTMA 2L4EA 2QBYA 2R18A 5KO3A 2XEPA 1TDHA 3MHVC 1NV8A 3GLIB 5C18A 4PDIA 3GPYA 2X49A 4FW9A 4DR4M 1WGLA 2JXNA 1IN7A 4B7GA 1T6OA 5FSWA 3I01M 4F1IA 2J7NA 1QDRA 3L29A 3C3DA 3FUTA 4XGIA 3HU3A 4B7FA 1VDLA 2XGNA 1Q3CA 4X64M 5EXXA 4ITQA 3Q8GA 3TE6A 1ZV1A 4OVZA 3BOSA 3W0LB 3SAUA 3AL0C 2WZJA 3KOYE 1Z5AA 2UUCM 4JXJA 4AKHA 1ZMUA 4NXMM 1GLNA 2CEAA 3T1YM 4AG6A 2V1CA 3E46A 4QNMA 3J81S 1HJPA 2CHGA 3HX3A 4P16A 1R2YA 3T38A 3UK6A 3GLFE 2UUBM 3D8LA 3TWKA 2DHYA 1IN4A 2VIIA 2L09A 4Z8XA 4G4OA 2JY8A 2Z8YM 2KHHA 3BXWA 4KO8A 3HJ8A 2Y0TA 3VDUA 4NXNM 4MM3B 5ITXA 3OTOM 1PJQA 4JYAM 4IBDA 4DR2M 1G8PA 1L2DA 2HWJA 3GLFB 2YFQA 2R45A 1HQYE 3K9OA 4IBCA 1G4AE 1NJFA 1OQYA 2NQ8C 2HHHM 1SXJA 2DKLA 2QNJA 3FUVA 3KOZE 4I8OA 2H1RA 4Q7JA 4UN2B 3SASA 3SC3A 4DR7M 4AI6A 2R6FA 2RKOA 4DV2M 4IJEA 1IBLM 4RNAA 5ITUA 1NY5A 4FCTA 4AW4A 1EE8A 4LF7M 2DHRA 2DZOB 3E9SA 4AG5A 3AKZA 1MX0A 3GLGE 2YQZA 4GH9A 1HT1E 3FKEA 4K0KM 3J7AS 2P5TA 2FH0A 4LFAM 1GL7A 1G3IA 4LGYA 4LJ6A 5FTKA 1IFYA 1DGGA 5LMUM 4LJ8A 3FTCA 3RGSA 3FUUA 1E94E 3W68A 5FTMA 1DGFA 3U6PA 2DAGA 1CUKA 2ZAOA 3T6PA 4DUYM 2ERCA 1HNXM 3GLGB 4IBJA 1NNJA 2QHOB 4DV5M 2I7PA 3FYDA 3SYKA 2Z3XA 4GHAA 1IXSB 3HHZA 1V34A 3CF2A 3H4JA 5JI3E 1NSFA 1MU5A 1TH3A 1VDDA 2O5RA 4BB9A 4D82A 4DV3M 5F3WA 1IN8A 2WSFF 2XSZD 1DGHB 1NV9A 3HKPA 3E21A 3J27B 3SMPA 2ZM6M 4G4NA 1J09A 4R71A 1VEKA 2DAMA 2R62A 4FD2A 5EP4A 4KHPM 2LVAA 1S3SA 2L4FA 2FFJA 3DOAA 1WIVA 3I51A 4JN6A 1HNWM 1XNQM 1V92A 2BWBA 4L8RC 1Y8GA 4W5WA 5A2QS 1K3XA 4F2LA 3J2PB 3AFHA 3CGWA 4LJ7A 4IJFA 2JZ0A 2KZSA 1SG9A 2V6ZM 2QP9X 3C9PA 1T43A 1VEJA 2VF8A 1R5LA 4LRTA 4MGZE 3THGA 1DO0A 4OX9M 4D80A 1VG5A 1NJGA 4LJ9A 1GKIA 1WGNA 3LW5F 2HAKA 2XF3A 4BLCA 4X66M 1XWIA 4OVZB 4YY3M 4CISA 1HT2E 3KDSE 4AKIA 3GQ4A 2VF7A 3HHWA 2L2DA 1RU3A 1BVSA 1DGHA 1QVRA 1ZAEA 4NC6A 5EP2A 1EFUB 2F5PA 2C5RA 2F5SA 4IBKA 3LMMA 3PVSA 1UFZA 2J5YA 2N35A 1TGUA 1J5EM 4LCBA 2O25A 3M6AA 1Q02A 2W82A 3VKHA 4ZPXA 2C9CA 4B3SM 3VK7A 2XFSA 1HNZM 2F5QA 1TR8A 5BPVA 1IQPA 5E26A 2FNAA 3W67A 3R9XB 5IT9S 1C1KA 3GRUA 3K9PA 1SXJE 4X62M 2JNHA 5FTJA 3I4YA 1WR1B 1AUAA 2I7NA 1LV7A 4L15A 4NRVA 3GP1A 4MB7A 2O01F 2MH8A 1W5SA 2GNOA 3KW6A 2OQ4A 2HL7A 1V33A 1QYRA 3U61A 4R3DA 2LHCA 1QZEA 5DFLA 2KNZA 2JY5A 7CATA 2LVNC 3L25A 3TQSA 5KPZA 1L2CA 2G8LA 1QZMA 2XSZA 3FD9A 3FUXA 4WURA 3HHYA 4B3TM 1SXJB 1XC8A 4QNRA 2DNAA 2E5LM 2XH9A 3SATA 5DYGA 3TWLA 1XXHE 1N77A 4JI1M 3DZDA 5EXPA 3J7BA 3AJIB 2DAIA 2CUZA 1NHGC 2DZNB 3GLHE 3D8BA 2R4EA 2EA0A 1G59A 1OJLA 2JY7A 2KA6B 3ILKA 4DV4M 1E32A 5IREB 3HZJA 4B7HA 4LZZA 3KS8A 2A5YB 2D7EA 3B74A 2K47A 4M0WA 4NSRA 5EP3A 3V76A 1XXHB 3U6OA
chains in the Genus database with same CATH topology
2KEBA 1IM2A 1IY0A 4LJAA 4LRSA 1JR3D 4DR6M 3GLHB 1R7RA 3IG8A 1TH4A 2DVWB 2XLJA 3SARA 4QOSA 3QWLA 4DR1M 2QENA 1G41A 1QANA 4PD2A 4TUWA 3MJ5A 2L7IA 4FWHA 3U5ZA 4IBFA 4LF8M 4IBBA 1KFVA 3A98B 4LJ4A 2Z4RA 4I5SA 4DUZM 2FE8A 3TWMA 1R2ZA 2RGHA 4JI2M 5IWAM 3GQ3A 3RFWA 4M9SA 4HL4A 2Q2EB 3A46A 3RGPA 4KLNA 4LGMA 5DYIA 4G4QA 4B3RM 1IBMM 2LNHC 4S12A 3IG5A 1Q3BA 5KPTA 1XXHA 5FTNA 4DV1M 1TH2A 5ITTA 4KODA 3LQQA 5KQ8A 2Y0QA 2EO2A 5ITYA 3GLHA 3HHXA 4CHTB 4LG2A 1IY2A 4IBEA 1I94M 3GPXA 1KSFX 3JR4A 3UMMA 1OFIA 2YR0A 2CV2A 1D2NA 4FVMA 4IBIA 4L4UA 4Z6YA 4B3MM 5GKNA 3U6QA 2X8AA 3UJNA 2YNMD 3K8ZA 5ITRA 4MH0E 1L1ZA 4GKJM 3B9PA 2LWXA 2ZAMA 4GHLA 2QPAA 4FCVA 3JAMS 3K2LA 3A42A 2OPFA 2LXEA 5KQDA 1FJGM 2CV0A 1XMQM 3I4VA 1XNRM 3U6EA 4LFCM 3VLFB 2QCUA 1JR3A 3U6SA 3AOGA 4JI7M 1WXQA 3WHKA 4B08A 2G5GX 2CFOA 3U61B 2UXBM 1L2BA 1R6BX 2J7OA 2CE7A 3KP0E 3L28A 4BBAA 4JI8M 2FOIC 4DR5M 4MGKE 1J7KA 3ZC7B 3M7GA 4LY6A 4L16A 2BNKA 3AV0A 4NRWA 5FTLA 1L1TA 2DXIA 1IY1A 4QHTA 4I4LA 1Z6TA 4X65M 3AOEC 2HCBA 2F5NA 4XBOA 3SFZA 2Z7JA 3VFDA 4AZFA 3W0FA 2UXDM 3NWLA 2C96A 1HR0M 1N32M 3MK6A 4EIWA 3VKGA 3KSJA 2XFTA 3HU2A 1L8QA 3KXEC 4GRIA 1FNNA 2F4VM 1E9RA 4GC5A 1N78A 4PCZA 2F5OA 1KYIA 3SBJA 1H6UA 4LF4M 4FWGA 4LFBM 2DWMA 3M0EA 3U5ZB 3U6DA 3E4RA 3KOXE 3GPPA 4JI5M 3DA1A 4QOZC 1JQJC 2M5ZA 4GKKM 1N33M 2D7GA 2KRKA 3R8FA 4GITA 1UM8A 1GVNA 4OU7A 3GPUA 2BJWA 3SMSA 4DV0M 2JA2A 4G4RA 4LF9M 1PM5A 3A45A 1DGBA 1TDZA 4R7GA 3FTEA 1E9SA 4JV5M 1Z5CA 3PNVA 1NY6A 3EIEA 3L2AA 1T3TA 3LQRA 1DO2A 4M9ZA 5BR8M 4IIWA 4GIPA 1IXRC 1Z5BA 2CHVA 2CHQA 5LMNM 4AQYM 3QAUA 4REZA 1N36M 3SYLA 1NHWC 2RGOA 4IBGA 3EIHA 2EUCA 1N34M 2XZUA 3KP1E 4HLQA 3SAWA 4MGYE 3HU1A 1QAMA 1YSYA 5C1BA 3LVVA 3KS8A 1XMOM 2KXEA 4JI3M 2XZFA 3HJQA 2BJVA 3VK8A 3U60B 3WHLA 3GLIA 2HKJA 3SHFA 3VDPA 4JI6M 4WW0A 1IN6A 3PXGA 5EQTA 3L27A 3PFIA 5KPRA 3TPZA 2R4JA 3JR5A 1Z59A 2UXCM 2Y20A 4JI0M 1HQCA 4RF1A 3PNYA 3UGJA 2X4AA 4GMQA 1GL6A 3K92A 1OFHA 3J80S 4I81A 3KS4A 3CTWB 4YHHM 4PDGA 4DV6M 5H37D 5DNYA 4LJ5A 2UUAM 3KVWA 1YE9A 1XHBA 5E6JA 1PJJA 1IXZA 4PT5A 3TL4X 1ZQ9A 4DR3M 4RF0A 3H4MA 3U60A 5FLXS 3AOEA 3LVWA 4D81A 2UU9M 1K82A 3HWSA 5EXTA 3HJSA 1X37A 2CV1A 4GC9A 2Z4SA 1YUBA 1K3WA 3GO8A 2DWZB 4A3VB 2L6OA 1NNUC 5ITQA 1QQWA 2KRUA 3GLFA 3U6LA 3FTDA 4DV7M 3CF0A 1ORYB 1PJIA 4LF6M 3NBIA 3U6CA 4OW0A 4LF5M 5IZ7D 1IN5A 3GRYA 2KZUA 3C58A 1NVMA 1SXJC 4II7A 3T15A 4JI4M 8CATA 5EJCA 4NSOB 2C98A 3T1HM 2DWLA 2C9OA 2D7HA 2LH0A 4NOOB 2QZ4A 3UZUA 4AKGA 3KOWE 2L7HA 3GRRA 4MGHA 3SAVA 5EP1A 1QAOA 5JI2E 4M9XA 2QBYB 2C99A 3FYCA 4NL4H 2VQEM 4L78A 2R46A 5EXSA 4CGYB 2DWNA 3Q8XA 3L26A 3KSXA 3GLGA 3HGIA 4FWDA 3ZH9B 3KFUG 3RE8A 2Y21A 1Q39A 1I4WA 2KW0A 2V1UA 2AHMA 3GQ5A 3CF6E 2ZANA 3FTFA 2R65A 3K1JA 4G6ZA 4QHSA 1IBKM 1SXJD 2M60A 3U6MA 4MGIE 5ITXE 1N75A 2ZBKB 3FUWA 1QAQA 4M0DA 1W5TA 3SHGB 2VQFM 3DFZA 4FCWA 4LZJA 3ZCBB 3GRVA 2QBYA 2R18A 5KO3A 2XEPA 1TDHA 3MHVC 3GLIB 5C18A 4PDIA 3GPYA 2X49A 4FW9A 4DR4M 1IN7A 4B7GA 5FSWA 2J7NA 3L29A 3FUTA 4XGIA 3HU3A 4B7FA 2XGNA 1Q3CA 4X64M 5EXXA 4ITQA 3TE6A 4OVZA 3BOSA 3W0LB 3SAUA 3AL0C 3KOYE 1Z5AA 2UUCM 4JXJA 4AKHA 4NXMM 1GLNA 2CEAA 3T1YM 4AG6A 2V1CA 4QNMA 3J81S 2CHGA 4P16A 1R2YA 3T38A 3UK6A 2UUBM 3D8LA 3TWKA 1IN4A 2VIIA 2L09A 4Z8XA 4G4OA 4KO8A 3HJ8A 2Y0TA 3VDUA 4NXNM 4MM3B 5ITXA 3OTOM 4JYAM 4IBDA 4DR2M 1G8PA 1L2DA 3GLFB 2YFQA 2R45A 1HQYE 4IBCA 1G4AE 1NJFA 2NQ8C 2HHHM 1SXJA 3KOZE 3FUVA 4I8OA 2H1RA 4DR7M 3SASA 3SC3A 4AI6A 2RKOA 4DV2M 4IJEA 1IBLM 4RNAA 5ITUA 1NY5A 4FCTA 4AW4A 1EE8A 4LF7M 2DHRA 2DZOB 3E9SA 4AG5A 3AKZA 1MX0A 2YQZA 4GH9A 1HT1E 3FKEA 4K0KM 3J7AS 2P5TA 4LFAM 1GL7A 1G3IA 4LGYA 4LJ6A 5FTKA 1DGGA 5LMUM 4LJ8A 3FTCA 3RGSA 3FUUA 1E94E 5FTMA 1DGFA 3U6PA 2ZAOA 4DUYM 2ERCA 1HNXM 3GLGB 4IBJA 1NNJA 4DV5M 2I7PA 3FYDA 3SYKA 2Z3XA 4GHAA 1IXSB 3HHZA 3CF2A 5JI3E 1NSFA 1MU5A 1TH3A 1VDDA 2O5RA 4BB9A 4D82A 4DV3M 5F3WA 1IN8A 2XSZD 1DGHB 3HKPA 3J27B 3SMPA 2ZM6M 4G4NA 1J09A 2R62A 5EP4A 4FD2A 4KHPM 1S3SA 3DOAA 2FFJA 3I51A 4JN6A 1HNWM 1XNQM 4L8RC 4W5WA 1K3XA 5A2QS 3J2PB 3AFHA 4LJ7A 4IJFA 2KZSA 2V6ZM 2QP9X 4LRTA 4MGZE 3THGA 1DO0A 4OX9M 4D80A 1NJGA 4LJ9A 1GKIA 2XF3A 4BLCA 4X66M 1XWIA 4OVZB 4YY3M 4CISA 1HT2E 3KDSE 4AKIA 3GQ4A 3HHWA 1DGHA 1QVRA 1ZAEA 5EP2A 2F5PA 2C5RA 2F5SA 4IBKA 3LMMA 3PVSA 1TGUA 1J5EM 4LCBA 3VKHA 3M6AA 2W82A 4ZPXA 2C9CA 4B3SM 3VK7A 2XFSA 1HNZM 2F5QA 5BPVA 5IT9S 1IQPA 5E26A 2FNAA 3R9XB 1C1KA 3GRUA 1SXJE 4X62M 5FTJA 3I4YA 2I7NA 1LV7A 4L15A 4NRVA 3GP1A 4MB7A 1W5SA 3KW6A 2OQ4A 2HL7A 1QYRA 3U61A 4R3DA 7CATA 3L25A 3TQSA 5KPZA 1L2CA 2G8LA 1QZMA 2XSZA 3FD9A 3FUXA 4WURA 3HHYA 4B3TM 1SXJB 1XC8A 4QNRA 2E5LM 2XH9A 3SATA 5DYGA 3TWLA 1N77A 4JI1M 3DZDA 5EXPA 3J7BA 3AJIB 2CUZA 1NHGC 2DZNB 3D8BA 2R4EA 2EA0A 1G59A 1OJLA 2KA6B 3ILKA 4DV4M 1E32A 5IREB 4B7HA 4LZZA 2A5YB 2D7EA 2K47A 4M0WA 4NSRA 5EP3A 1XXHB 3U6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU M;  4PCZ A;  2F5O A;  3SBJ A;  3SAV A;  4DR6 M;  4LF4 M;  3U6P A;  4LFB M;  4DUY M;  3SAR A;  2VQE M;  4DR1 M;  3U6D A;  1HNX M;  1NNJ A;  3GPP A;  4DV5 M;  4JI5 M;  4PD2 A;  4GKK M;  1N33 M;  4LF8 M;  1KFV A;  1MU5 A;  4DV3 M;  1Q39 A;  4DUZ M;  3TWM A;  1R2Z A;  3GPU A;  4G4N A;  4JI2 M;  2ZM6 M;  5IWA M;  3GQ3 A;  3GQ5 A;  4G4R A;  4DV0 M;  4LF9 M;  1PM5 A;  3A45 A;  1TDZ A;  4JV5 M;  1Z5C A;  2Q2E B;  3A46 A;  1IBK M;  4KHP M;  3U6M A;  3DOA A;  1HNW M;  5ITX E;  4G4Q A;  4B3R M;  5BR8 M;  1IBM M;  2ZBK B;  1XNQ M;  1Q3B A;  2VQF M;  1Z5B A;  1K3X A;  5A2Q S;  4DV1 M;  5ITT A;  5LMN M;  4AQY M;  1N36 M;  5ITY A;  1N34 M;  2XZU A;  1TDH A;  3SAW A;  1I94 M;  3GPX A;  3JR4 A;  4OX9 M;  4PDI A;  1XMO M;  4JI3 M;  3GPY A;  2XZF A;  4DR4 M;  3VK8 A;  4B3M M;  3U6Q A;  2HKJ A;  4X66 M;  4YY3 M;  5ITR A;  4JI6 M;  3GQ4 A;  1Q3C A;  4X64 M;  4ITQ A;  1L1Z A;  4GKJ M;  2F5P A;  3JR5 A;  2F5S A;  3SAU A;  1Z59 A;  2UXC M;  4JI0 M;  3JAM S;  1Z5A A;  2UUC M;  3A42 A;  1J5E M;  2OPF A;  1FJG M;  4NXM M;  4B3S M;  3T1Y M;  3VK7 A;  1XMQ M;  3J80 S;  3U6E A;  1HNZ M;  4LFC M;  2F5Q A;  1XNR M;  5IT9 S;  3J81 S;  4YHH M;  3U6S A;  4PDG A;  1R2Y A;  4DV6 M;  4X62 M;  4JI7 M;  2UUB M;  3TWK A;  4NRV A;  3GP1 A;  2UXB M;  4MB7 A;  2UUA M;  1L2B A;  4G4O A;  1PJJ A;  4JI8 M;  2OQ4 A;  4DR5 M;  4DR3 M;  4NXN M;  3OTO M;  5ITX A;  5FLX S;  2UU9 M;  4JYA M;  1L2C A;  1K82 A;  4DR2 M;  4NRW A;  4B3T M;  1L1T A;  1L2D A;  1XC8 A;  2E5L M;  1K3W A;  4X65 M;  3GO8 A;  3SAT A;  2HHH M;  3TWL A;  4JI1 M;  5ITQ A;  3U6L A;  4DR7 M;  3SAS A;  2F5N A;  4DV7 M;  1PJI A;  4DV2 M;  4LF6 M;  3U6C A;  1IBL M;  4LF5 M;  5ITU A;  3C58 A;  1EE8 A;  4LF7 M;  3W0F A;  2EA0 A;  4JI4 M;  1HR0 M;  1N32 M;  2UXD M;  1MX0 A;  4DV4 M;  4K0K M;  3T1H M;  3J7A S;  4LFA M;  2F4V M;  4CIS A;  3U6O A; 
#chains in the Genus database with same CATH topology
 2KEB A;  1IM2 A;  1ZMV A;  1IY0 A;  4L6V 6;  4LJA A;  4LRS A;  1JR3 D;  4DR6 M;  3GLH B;  1R7R A;  2LBC A;  3IG8 A;  1TH4 A;  2DVW B;  2XLJ A;  3SAR A;  4QOS A;  3QWL A;  1MJG M;  2QEN A;  4DR1 M;  1G41 A;  4G3O A;  1QAN A;  2QQ8 A;  4PD2 A;  4TUW A;  3LCV B;  3MJ5 A;  2L7I A;  4FWH A;  3U5Z A;  4IBF A;  4LF8 M;  3B7N A;  4IBB A;  1KFV A;  3A98 B;  4LJ4 A;  2Z4R A;  3LCU A;  4I5S A;  4DUZ M;  2FE8 A;  3TWM A;  1R2Z A;  2RGH A;  4JI2 M;  5IWA M;  3GQ3 A;  3RFW A;  4M9S A;  4HL4 A;  2K9D A;  2R0I A;  2Q2E B;  2ZTC A;  3A46 A;  3RGP A;  4KLN A;  4LGM A;  5DYI A;  4G4Q A;  4B3R M;  1IBM M;  2LNH C;  2R44 A;  3IG5 A;  4S12 A;  1TTE A;  1Q3B A;  5KPT A;  1XXH A;  1VEG A;  1MN3 A;  5FTN A;  4DV1 M;  1TH2 A;  1D0M A;  5ITT A;  4KOD A;  2JY6 B;  3LQQ A;  5KQ8 A;  2Y0Q A;  2EO2 A;  4HEO A;  5ITY A;  3FRH A;  3GLH A;  3HHX A;  4CHT B;  4LG2 A;  3ZQJ A;  1IY2 A;  4IBE A;  1I94 M;  3GPX A;  2ZTD A;  1KSF X;  3JR4 A;  3UMM A;  1OFI A;  2YR0 A;  2CV2 A;  1D2N A;  4FVM A;  4IBI A;  4L4U A;  2MR9 A;  4DBG B;  4Z6Y A;  4B3M M;  5GKN A;  4CJ6 A;  2JP7 A;  2X8A A;  3U6Q A;  3UJN A;  2H5X A;  2YNM D;  3K8Z A;  2LVP C;  4MH0 E;  5ITR A;  1QUS A;  1P3Q Q;  1L1Z A;  4GKJ M;  3B9P A;  2LWX A;  2ZAM A;  4GHL A;  2QPA A;  4FCV A;  3JAM S;  2RRU A;  3IEC A;  3K2L A;  2QSF X;  3A42 A;  1YLA A;  2OPF A;  2LXE A;  5KQD A;  1FJG M;  2CV0 A;  1XMQ M;  3I4V A;  1XNR M;  3U6E A;  4LFC M;  3VLF B;  2QCU A;  1JR3 A;  3U6S A;  1F4I A;  3AOG A;  4JI7 M;  1OIP A;  1WXQ A;  3WHK A;  4B08 A;  2G5G X;  2KDL A;  2FS1 A;  2CFO A;  3U61 B;  2UXB M;  2MRO B;  1L2B A;  1R6B X;  2J7O A;  2CE7 A;  3KP0 E;  3HY5 A;  3L28 A;  4BBA A;  4JI8 M;  2FOI C;  4DR5 M;  4MGK E;  2K0B X;  1J7K A;  3ZC7 B;  3M7G A;  4LY6 A;  4L16 A;  1NO1 A;  2BNK A;  3AV0 A;  1OAO C;  4NRW A;  5FTL A;  1L1T A;  2DXI A;  1IY1 A;  1GO5 A;  4QHT A;  4I4L A;  1Z6T A;  4X65 M;  3AOE C;  2HCB A;  2F5N A;  4XBO A;  3SFZ A;  2CRU A;  2Z7J A;  4XK8 F;  3VFD A;  2G3Q A;  4AZF A;  2LVQ D;  3W0F A;  1QDT A;  2LVO C;  2C96 A;  3NWL A;  1HR0 M;  1N32 M;  2UXD M;  3MK6 A;  4EIW A;  1OAI A;  2EKF A;  3KSJ A;  3VKG A;  2XFT A;  3HU2 A;  1L8Q A;  3KXE C;  2LHG A;  3F92 A;  4GRI A;  3B89 A;  1FNN A;  2JUJ A;  2F4V M;  1E9R A;  2MGW A;  4GC5 A;  1N78 A;  4PCZ A;  3I04 M;  2F5O A;  1KYI A;  3SBJ A;  1H6U A;  2WSC F;  4LF4 M;  4FWG A;  2JZ1 A;  4LFB M;  2DWM A;  3M0E A;  3U5Z B;  3U6D A;  3E4R A;  3KOX E;  3GPP A;  2DAK A;  4JI5 M;  1OIZ A;  3DA1 A;  4QOZ C;  1JQJ C;  2M5Z A;  4GKK M;  1N33 M;  4P17 A;  5L8R F;  3QYE A;  3C3E A;  2D7G A;  2KRK A;  3R8F A;  4GIT A;  1OTR A;  1UM8 A;  1D0K A;  1GVN A;  4OU7 A;  3GPU A;  2BJW A;  3SMS A;  4DV0 M;  2JA2 A;  2LTU A;  4G4R A;  4LF9 M;  1PM5 A;  3A45 A;  1DGB A;  1TDZ A;  4R7G A;  3FTE A;  1E9S A;  4JV5 M;  1Z5C A;  3PNV A;  1NY6 A;  3EIE A;  2EJS A;  1T3T A;  3L2A A;  3LQR A;  2MJ5 B;  1DO2 A;  1A5T A;  4M9Z A;  1OKS A;  5BR8 M;  4IIW A;  4GIP A;  1IXR C;  1Z5B A;  2CHV A;  2CHQ A;  5LMN M;  4AQY M;  3QAU A;  4REZ A;  1QUT A;  1N36 M;  3SYL A;  1NHW C;  2RGO A;  1GJS A;  4IBG A;  2DEN A;  3EIH A;  2EUC A;  1N34 M;  1PJT A;  2XZU A;  3KP1 E;  4HLQ A;  3SAW A;  4MGY E;  1WJ7 A;  3HU1 A;  1QAM A;  1YSY A;  5C1B A;  3LVV A;  2DZL A;  3IHP A;  1XMO M;  2KXE A;  4JI3 M;  2XZF A;  1JR3 E;  1TF0 B;  3HJQ A;  2BJV A;  3VK8 A;  3U60 B;  3WHL A;  3GLI A;  2HKJ A;  3SHF A;  3VDP A;  4JI6 M;  4WW0 A;  1IN6 A;  3PXG A;  2CWB A;  5EQT A;  3L27 A;  3PFI A;  5KPR A;  2DI0 A;  4Y28 F;  3TPZ A;  2R4J A;  3JR5 A;  1Z59 A;  2UXC M;  2Y20 A;  4JI0 M;  1HQC A;  2DAE A;  2KNA A;  1D0L A;  2KNV A;  3PNY A;  4RF1 A;  2EKK A;  3UGJ A;  2X4A A;  2OO9 A;  4GMQ A;  1GL6 A;  3K92 A;  3MMP A;  4KT0 F;  1OFH A;  3J80 S;  4I81 A;  3KS4 A;  1AIP C;  3CTW B;  4YHH M;  2CP8 A;  4PDG A;  1GJT A;  2BWE A;  3QYB A;  4DV6 M;  5H37 D;  1DV0 A;  5DNY A;  4LJ5 A;  2UUA M;  3KVW A;  1GAB A;  1YE9 A;  2APL A;  1XHB A;  5E6J A;  1PJJ A;  1IXZ A;  4PT5 A;  1PJS A;  3TL4 X;  1ZQ9 A;  1VQ1 A;  4DR3 M;  2OOA A;  4RF0 A;  3H4M A;  3U60 A;  5FLX S;  3AOE A;  3LVW A;  3FRI A;  4D81 A;  2UU9 M;  1K82 A;  3HWS A;  5EXT A;  4ANR A;  3HJS A;  1X37 A;  2CV1 A;  4GC9 A;  2Z4S A;  1YUB A;  1K3W A;  3GO8 A;  2DWZ B;  1ZMW A;  1PRB A;  4A3V B;  4GEW A;  2L6O A;  1NNU C;  5ITQ A;  1QQW A;  2KRU A;  3GLF A;  3U6L A;  3FTD A;  4DV7 M;  3CF0 A;  1ORY B;  1PJI A;  4LF6 M;  2JWS A;  3NBI A;  3U6C A;  4OW0 A;  4LF5 M;  5IZ7 D;  1IN5 A;  3GRY A;  2KZU A;  3C58 A;  1NVM A;  1EIJ A;  4WP2 A;  1SXJ C;  4II7 A;  3T15 A;  4JI4 M;  8CAT A;  1G71 A;  5EJC A;  1C7Y A;  4NSO B;  2C98 A;  3T1H M;  2DWL A;  2C9O A;  2D7H A;  2LH0 A;  1WHC A;  2QZ4 A;  4NOO B;  3UZU A;  4AKG A;  3KOW E;  2L7H A;  3GRR A;  4MGH A;  3SAV A;  5EP1 A;  3B7Q A;  4RKU F;  1QAO A;  5JI2 E;  3B7Z A;  4M9X A;  2C99 A;  3FYC A;  2QBY B;  4NL4 H;  2VQE M;  3NBX X;  2VDB B;  4L78 A;  2R46 A;  5EXS A;  4CGY B;  2DWN A;  3Q8X A;  3L26 A;  3KSX A;  3GLG A;  3HGI A;  4FWD A;  2K6B A;  3ZH9 B;  3RE8 A;  3KFU G;  2B3T A;  2Y21 A;  1JB0 F;  1Q39 A;  1I4W A;  2KW0 A;  1XB2 B;  2WSE F;  1IXS A;  2AHM A;  3BBZ A;  3GQ5 A;  3CF6 E;  2ZAN A;  2V1U A;  3FTF A;  2R65 A;  3K1J A;  4G6Z A;  4QHS A;  1IBK M;  1SXJ D;  2M60 A;  3GLI E;  3U6M A;  4CIZ A;  1PGY A;  2GQF A;  4MGI E;  5ITX E;  1N75 A;  2ZBK B;  3FUW A;  1QAQ A;  2OOB A;  1W5T A;  3FE3 A;  4M0D A;  3DFZ A;  3SHG B;  2VQF M;  4FCW A;  4LZJ A;  3ZCB B;  3GRV A;  1R4G A;  1LTM A;  2L4E A;  2QBY A;  2R18 A;  5KO3 A;  2XEP A;  1TDH A;  3MHV C;  1NV8 A;  3GLI B;  5C18 A;  4PDI A;  3GPY A;  2X49 A;  4FW9 A;  4DR4 M;  1WGL A;  2JXN A;  1IN7 A;  4B7G A;  1T6O A;  5FSW A;  3I01 M;  4F1I A;  2J7N A;  1QDR A;  3L29 A;  3C3D A;  3FUT A;  4XGI A;  3HU3 A;  4B7F A;  1VDL A;  2XGN A;  1Q3C A;  4X64 M;  5EXX A;  4ITQ A;  3Q8G A;  3TE6 A;  1ZV1 A;  4OVZ A;  3BOS A;  3W0L B;  3SAU A;  3AL0 C;  2WZJ A;  3KOY E;  1Z5A A;  2UUC M;  4JXJ A;  4AKH A;  1ZMU A;  4NXM M;  1GLN A;  2CEA A;  3T1Y M;  4AG6 A;  2V1C A;  3E46 A;  4QNM A;  3J81 S;  1HJP A;  2CHG A;  3HX3 A;  4P16 A;  1R2Y A;  3T38 A;  3UK6 A;  3GLF E;  2UUB M;  3D8L A;  3TWK A;  2DHY A;  1IN4 A;  2VII A;  2L09 A;  4Z8X A;  4G4O A;  2JY8 A;  2Z8Y M;  2KHH A;  3BXW A;  4KO8 A;  3HJ8 A;  2Y0T A;  3VDU A;  4NXN M;  4MM3 B;  5ITX A;  3OTO M;  1PJQ A;  4JYA M;  4IBD A;  4DR2 M;  1G8P A;  1L2D A;  2HWJ A;  3GLF B;  2YFQ A;  2R45 A;  1HQY E;  3K9O A;  4IBC A;  1G4A E;  1NJF A;  1OQY A;  2NQ8 C;  2HHH M;  1SXJ A;  2DKL A;  2QNJ A;  3FUV A;  3KOZ E;  4I8O A;  2H1R A;  4Q7J A;  4UN2 B;  3SAS A;  3SC3 A;  4DR7 M;  4AI6 A;  2R6F A;  2RKO A;  4DV2 M;  4IJE A;  1IBL M;  4RNA A;  5ITU A;  1NY5 A;  4FCT A;  4AW4 A;  1EE8 A;  4LF7 M;  2DHR A;  2DZO B;  3E9S A;  4AG5 A;  3AKZ A;  1MX0 A;  3GLG E;  2YQZ A;  4GH9 A;  1HT1 E;  3FKE A;  4K0K M;  3J7A S;  2P5T A;  2FH0 A;  4LFA M;  1GL7 A;  1G3I A;  4LGY A;  4LJ6 A;  5FTK A;  1IFY A;  1DGG A;  5LMU M;  4LJ8 A;  3FTC A;  3RGS A;  3FUU A;  1E94 E;  3W68 A;  5FTM A;  1DGF A;  3U6P A;  2DAG A;  1CUK A;  2ZAO A;  3T6P A;  4DUY M;  2ERC A;  1HNX M;  3GLG B;  4IBJ A;  1NNJ A;  2QHO B;  4DV5 M;  2I7P A;  3FYD A;  3SYK A;  2Z3X A;  4GHA A;  1IXS B;  3HHZ A;  1V34 A;  3CF2 A;  3H4J A;  5JI3 E;  1NSF A;  1MU5 A;  1TH3 A;  1VDD A;  2O5R A;  4BB9 A;  4D82 A;  4DV3 M;  5F3W A;  1IN8 A;  2WSF F;  2XSZ D;  1DGH B;  1NV9 A;  3HKP A;  3E21 A;  3J27 B;  3SMP A;  2ZM6 M;  4G4N A;  1J09 A;  4R71 A;  1VEK A;  2DAM A;  2R62 A;  4FD2 A;  5EP4 A;  4KHP M;  2LVA A;  1S3S A;  2L4F A;  2FFJ A;  3DOA A;  1WIV A;  3I51 A;  4JN6 A;  1HNW M;  1XNQ M;  1V92 A;  2BWB A;  4L8R C;  1Y8G A;  4W5W A;  5A2Q S;  1K3X A;  4F2L A;  3J2P B;  3AFH A;  3CGW A;  4LJ7 A;  4IJF A;  2JZ0 A;  2KZS A;  1SG9 A;  2V6Z M;  2QP9 X;  3C9P A;  1T43 A;  1VEJ A;  2VF8 A;  1R5L A;  4LRT A;  4MGZ E;  3THG A;  1DO0 A;  4OX9 M;  4D80 A;  1VG5 A;  1NJG A;  4LJ9 A;  1GKI A;  1WGN A;  3LW5 F;  2HAK A;  2XF3 A;  4BLC A;  4X66 M;  1XWI A;  4OVZ B;  4YY3 M;  4CIS A;  1HT2 E;  3KDS E;  4AKI A;  3GQ4 A;  2VF7 A;  3HHW A;  2L2D A;  1RU3 A;  1BVS A;  1DGH A;  1QVR A;  1ZAE A;  4NC6 A;  5EP2 A;  1EFU B;  2F5P A;  2C5R A;  2F5S A;  4IBK A;  3LMM A;  3PVS A;  1UFZ A;  2J5Y A;  2N35 A;  1TGU A;  1J5E M;  4LCB A;  2O25 A;  3M6A A;  1Q02 A;  2W82 A;  3VKH A;  4ZPX A;  2C9C A;  4B3S M;  3VK7 A;  2XFS A;  1HNZ M;  2F5Q A;  1TR8 A;  5BPV A;  1IQP A;  5E26 A;  2FNA A;  3W67 A;  3R9X B;  5IT9 S;  1C1K A;  3GRU A;  3K9P A;  1SXJ E;  4X62 M;  2JNH A;  5FTJ A;  3I4Y A;  1WR1 B;  1AUA A;  2I7N A;  1LV7 A;  4L15 A;  4NRV A;  3GP1 A;  4MB7 A;  2O01 F;  2MH8 A;  1W5S A;  2GNO A;  3KW6 A;  2OQ4 A;  2HL7 A;  1V33 A;  1QYR A;  3U61 A;  4R3D A;  2LHC A;  1QZE A;  5DFL A;  2KNZ A;  2JY5 A;  7CAT A;  2LVN C;  3L25 A;  3TQS A;  5KPZ A;  1L2C A;  2G8L A;  1QZM A;  2XSZ A;  3FD9 A;  3FUX A;  4WUR A;  3HHY A;  4B3T M;  1SXJ B;  1XC8 A;  4QNR A;  2DNA A;  2E5L M;  2XH9 A;  3SAT A;  5DYG A;  3TWL A;  1XXH E;  1N77 A;  4JI1 M;  3DZD A;  5EXP A;  3J7B A;  3AJI B;  2DAI A;  2CUZ A;  1NHG C;  2DZN B;  3GLH E;  3D8B A;  2R4E A;  2EA0 A;  1G59 A;  1OJL A;  2JY7 A;  2KA6 B;  3ILK A;  4DV4 M;  1E32 A;  5IRE B;  3HZJ A;  4B7H A;  4LZZ A;  3KS8 A;  2A5Y B;  2D7E A;  3B74 A;  2K47 A;  4M0W A;  4NSR A;  5EP3 A;  3V76 A;  1XXH B;  3U6O A; 
#chains in the Genus database with same CATH homology
 2KEB A;  1IM2 A;  1IY0 A;  4LJA A;  4LRS A;  1JR3 D;  4DR6 M;  3GLH B;  1R7R A;  3IG8 A;  1TH4 A;  2DVW B;  2XLJ A;  3SAR A;  4QOS A;  3QWL A;  4DR1 M;  2QEN A;  1G41 A;  1QAN A;  4PD2 A;  4TUW A;  3MJ5 A;  2L7I A;  4FWH A;  3U5Z A;  4IBF A;  4LF8 M;  4IBB A;  1KFV A;  3A98 B;  4LJ4 A;  2Z4R A;  4I5S A;  4DUZ M;  2FE8 A;  3TWM A;  1R2Z A;  2RGH A;  4JI2 M;  5IWA M;  3GQ3 A;  3RFW A;  4M9S A;  4HL4 A;  2Q2E B;  3A46 A;  3RGP A;  4KLN A;  4LGM A;  5DYI A;  4G4Q A;  4B3R M;  1IBM M;  2LNH C;  4S12 A;  3IG5 A;  1Q3B A;  5KPT A;  1XXH A;  5FTN A;  4DV1 M;  1TH2 A;  5ITT A;  4KOD A;  3LQQ A;  5KQ8 A;  2Y0Q A;  2EO2 A;  5ITY A;  3GLH A;  3HHX A;  4CHT B;  4LG2 A;  1IY2 A;  4IBE A;  1I94 M;  3GPX A;  1KSF X;  3JR4 A;  3UMM A;  1OFI A;  2YR0 A;  2CV2 A;  1D2N A;  4FVM A;  4IBI A;  4L4U A;  4Z6Y A;  4B3M M;  5GKN A;  3U6Q A;  2X8A A;  3UJN A;  2YNM D;  3K8Z A;  5ITR A;  4MH0 E;  1L1Z A;  4GKJ M;  3B9P A;  2LWX A;  2ZAM A;  4GHL A;  2QPA A;  4FCV A;  3JAM S;  3K2L A;  3A42 A;  2OPF A;  2LXE A;  5KQD A;  1FJG M;  2CV0 A;  1XMQ M;  3I4V A;  1XNR M;  3U6E A;  4LFC M;  3VLF B;  2QCU A;  1JR3 A;  3U6S A;  3AOG A;  4JI7 M;  1WXQ A;  3WHK A;  4B08 A;  2G5G X;  2CFO A;  3U61 B;  2UXB M;  1L2B A;  1R6B X;  2J7O A;  2CE7 A;  3KP0 E;  3L28 A;  4BBA A;  4JI8 M;  2FOI C;  4DR5 M;  4MGK E;  1J7K A;  3ZC7 B;  3M7G A;  4LY6 A;  4L16 A;  2BNK A;  3AV0 A;  4NRW A;  5FTL A;  1L1T A;  2DXI A;  1IY1 A;  4QHT A;  4I4L A;  1Z6T A;  4X65 M;  3AOE C;  2HCB A;  2F5N A;  4XBO A;  3SFZ A;  2Z7J A;  3VFD A;  4AZF A;  3W0F A;  2UXD M;  3NWL A;  2C96 A;  1HR0 M;  1N32 M;  3MK6 A;  4EIW A;  3VKG A;  3KSJ A;  2XFT A;  3HU2 A;  1L8Q A;  3KXE C;  4GRI A;  1FNN A;  2F4V M;  1E9R A;  4GC5 A;  1N78 A;  4PCZ A;  2F5O A;  1KYI A;  3SBJ A;  1H6U A;  4LF4 M;  4FWG A;  4LFB M;  2DWM A;  3M0E A;  3U5Z B;  3U6D A;  3E4R A;  3KOX E;  3GPP A;  4JI5 M;  3DA1 A;  4QOZ C;  1JQJ C;  2M5Z A;  4GKK M;  1N33 M;  2D7G A;  2KRK A;  3R8F A;  4GIT A;  1UM8 A;  1GVN A;  4OU7 A;  3GPU A;  2BJW A;  3SMS A;  4DV0 M;  2JA2 A;  4G4R A;  4LF9 M;  1PM5 A;  3A45 A;  1DGB A;  1TDZ A;  4R7G A;  3FTE A;  1E9S A;  4JV5 M;  1Z5C A;  3PNV A;  1NY6 A;  3EIE A;  3L2A A;  1T3T A;  3LQR A;  1DO2 A;  4M9Z A;  5BR8 M;  4IIW A;  4GIP A;  1IXR C;  1Z5B A;  2CHV A;  2CHQ A;  5LMN M;  4AQY M;  3QAU A;  4REZ A;  1N36 M;  3SYL A;  1NHW C;  2RGO A;  4IBG A;  3EIH A;  2EUC A;  1N34 M;  2XZU A;  3KP1 E;  4HLQ A;  3SAW A;  4MGY E;  3HU1 A;  1QAM A;  1YSY A;  5C1B A;  3LVV A;  3KS8 A;  1XMO M;  2KXE A;  4JI3 M;  2XZF A;  3HJQ A;  2BJV A;  3VK8 A;  3U60 B;  3WHL A;  3GLI A;  2HKJ A;  3SHF A;  3VDP A;  4JI6 M;  4WW0 A;  1IN6 A;  3PXG A;  5EQT A;  3L27 A;  3PFI A;  5KPR A;  3TPZ A;  2R4J A;  3JR5 A;  1Z59 A;  2UXC M;  2Y20 A;  4JI0 M;  1HQC A;  4RF1 A;  3PNY A;  3UGJ A;  2X4A A;  4GMQ A;  1GL6 A;  3K92 A;  1OFH A;  3J80 S;  4I81 A;  3KS4 A;  3CTW B;  4YHH M;  4PDG A;  4DV6 M;  5H37 D;  5DNY A;  4LJ5 A;  2UUA M;  3KVW A;  1YE9 A;  1XHB A;  5E6J A;  1PJJ A;  1IXZ A;  4PT5 A;  3TL4 X;  1ZQ9 A;  4DR3 M;  4RF0 A;  3H4M A;  3U60 A;  5FLX S;  3AOE A;  3LVW A;  4D81 A;  2UU9 M;  1K82 A;  3HWS A;  5EXT A;  3HJS A;  1X37 A;  2CV1 A;  4GC9 A;  2Z4S A;  1YUB A;  1K3W A;  3GO8 A;  2DWZ B;  4A3V B;  2L6O A;  1NNU C;  5ITQ A;  1QQW A;  2KRU A;  3GLF A;  3U6L A;  3FTD A;  4DV7 M;  3CF0 A;  1ORY B;  1PJI A;  4LF6 M;  3NBI A;  3U6C A;  4OW0 A;  4LF5 M;  5IZ7 D;  1IN5 A;  3GRY A;  2KZU A;  3C58 A;  1NVM A;  1SXJ C;  4II7 A;  3T15 A;  4JI4 M;  8CAT A;  5EJC A;  4NSO B;  2C98 A;  3T1H M;  2DWL A;  2C9O A;  2D7H A;  2LH0 A;  4NOO B;  2QZ4 A;  3UZU A;  4AKG A;  3KOW E;  2L7H A;  3GRR A;  4MGH A;  3SAV A;  5EP1 A;  1QAO A;  5JI2 E;  4M9X A;  2QBY B;  2C99 A;  3FYC A;  4NL4 H;  2VQE M;  4L78 A;  2R46 A;  5EXS A;  4CGY B;  2DWN A;  3Q8X A;  3L26 A;  3KSX A;  3GLG A;  3HGI A;  4FWD A;  3ZH9 B;  3KFU G;  3RE8 A;  2Y21 A;  1Q39 A;  1I4W A;  2KW0 A;  2V1U A;  2AHM A;  3GQ5 A;  3CF6 E;  2ZAN A;  3FTF A;  2R65 A;  3K1J A;  4G6Z A;  4QHS A;  1IBK M;  1SXJ D;  2M60 A;  3U6M A;  4MGI E;  5ITX E;  1N75 A;  2ZBK B;  3FUW A;  1QAQ A;  4M0D A;  1W5T A;  3SHG B;  2VQF M;  3DFZ A;  4FCW A;  4LZJ A;  3ZCB B;  3GRV A;  2QBY A;  2R18 A;  5KO3 A;  2XEP A;  1TDH A;  3MHV C;  3GLI B;  5C18 A;  4PDI A;  3GPY A;  2X49 A;  4FW9 A;  4DR4 M;  1IN7 A;  4B7G A;  5FSW A;  2J7N A;  3L29 A;  3FUT A;  4XGI A;  3HU3 A;  4B7F A;  2XGN A;  1Q3C A;  4X64 M;  5EXX A;  4ITQ A;  3TE6 A;  4OVZ A;  3BOS A;  3W0L B;  3SAU A;  3AL0 C;  3KOY E;  1Z5A A;  2UUC M;  4JXJ A;  4AKH A;  4NXM M;  1GLN A;  2CEA A;  3T1Y M;  4AG6 A;  2V1C A;  4QNM A;  3J81 S;  2CHG A;  4P16 A;  1R2Y A;  3T38 A;  3UK6 A;  2UUB M;  3D8L A;  3TWK A;  1IN4 A;  2VII A;  2L09 A;  4Z8X A;  4G4O A;  4KO8 A;  3HJ8 A;  2Y0T A;  3VDU A;  4NXN M;  4MM3 B;  5ITX A;  3OTO M;  4JYA M;  4IBD A;  4DR2 M;  1G8P A;  1L2D A;  3GLF B;  2YFQ A;  2R45 A;  1HQY E;  4IBC A;  1G4A E;  1NJF A;  2NQ8 C;  2HHH M;  1SXJ A;  3KOZ E;  3FUV A;  4I8O A;  2H1R A;  4DR7 M;  3SAS A;  3SC3 A;  4AI6 A;  2RKO A;  4DV2 M;  4IJE A;  1IBL M;  4RNA A;  5ITU A;  1NY5 A;  4FCT A;  4AW4 A;  1EE8 A;  4LF7 M;  2DHR A;  2DZO B;  3E9S A;  4AG5 A;  3AKZ A;  1MX0 A;  2YQZ A;  4GH9 A;  1HT1 E;  3FKE A;  4K0K M;  3J7A S;  2P5T A;  4LFA M;  1GL7 A;  1G3I A;  4LGY A;  4LJ6 A;  5FTK A;  1DGG A;  5LMU M;  4LJ8 A;  3FTC A;  3RGS A;  3FUU A;  1E94 E;  5FTM A;  1DGF A;  3U6P A;  2ZAO A;  4DUY M;  2ERC A;  1HNX M;  3GLG B;  4IBJ A;  1NNJ A;  4DV5 M;  2I7P A;  3FYD A;  3SYK A;  2Z3X A;  4GHA A;  1IXS B;  3HHZ A;  3CF2 A;  5JI3 E;  1NSF A;  1MU5 A;  1TH3 A;  1VDD A;  2O5R A;  4BB9 A;  4D82 A;  4DV3 M;  5F3W A;  1IN8 A;  2XSZ D;  1DGH B;  3HKP A;  3J27 B;  3SMP A;  2ZM6 M;  4G4N A;  1J09 A;  2R62 A;  5EP4 A;  4FD2 A;  4KHP M;  1S3S A;  3DOA A;  2FFJ A;  3I51 A;  4JN6 A;  1HNW M;  1XNQ M;  4L8R C;  4W5W A;  1K3X A;  5A2Q S;  3J2P B;  3AFH A;  4LJ7 A;  4IJF A;  2KZS A;  2V6Z M;  2QP9 X;  4LRT A;  4MGZ E;  3THG A;  1DO0 A;  4OX9 M;  4D80 A;  1NJG A;  4LJ9 A;  1GKI A;  2XF3 A;  4BLC A;  4X66 M;  1XWI A;  4OVZ B;  4YY3 M;  4CIS A;  1HT2 E;  3KDS E;  4AKI A;  3GQ4 A;  3HHW A;  1DGH A;  1QVR A;  1ZAE A;  5EP2 A;  2F5P A;  2C5R A;  2F5S A;  4IBK A;  3LMM A;  3PVS A;  1TGU A;  1J5E M;  4LCB A;  3VKH A;  3M6A A;  2W82 A;  4ZPX A;  2C9C A;  4B3S M;  3VK7 A;  2XFS A;  1HNZ M;  2F5Q A;  5BPV A;  5IT9 S;  1IQP A;  5E26 A;  2FNA A;  3R9X B;  1C1K A;  3GRU A;  1SXJ E;  4X62 M;  5FTJ A;  3I4Y A;  2I7N A;  1LV7 A;  4L15 A;  4NRV A;  3GP1 A;  4MB7 A;  1W5S A;  3KW6 A;  2OQ4 A;  2HL7 A;  1QYR A;  3U61 A;  4R3D A;  7CAT A;  3L25 A;  3TQS A;  5KPZ A;  1L2C A;  2G8L A;  1QZM A;  2XSZ A;  3FD9 A;  3FUX A;  4WUR A;  3HHY A;  4B3T M;  1SXJ B;  1XC8 A;  4QNR A;  2E5L M;  2XH9 A;  3SAT A;  5DYG A;  3TWL A;  1N77 A;  4JI1 M;  3DZD A;  5EXP A;  3J7B A;  3AJI B;  2CUZ A;  1NHG C;  2DZN B;  3D8B A;  2R4E A;  2EA0 A;  1G59 A;  1OJL A;  2KA6 B;  3ILK A;  4DV4 M;  1E32 A;  5IRE B;  4B7H A;  4LZZ A;  2A5Y B;  2D7E A;  2K47 A;  4M0W A;  4NSR A;  5EP3 A;  1XXH B;  3U6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...