2LVQD

Gp78cue domain bound to the proximal ubiquitin of k48-linked diubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 16
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvqD00
1WHCA 2CP8A 2L2DA 2OOBA 3GLIE 1JR3E 3IHPA 2LVPC 3E21A 3H4JA 2QNJA 1XB2B 4F2LA 1CUKA 2MROB 3FRHA 1ZMUA 3LCVB 1PGYA 3MMPA 2B3TA 4WP2A 3GLFE 3T6PA 2HAKA 2K0BX 3GLHE 2DI0A 2MGWA 1OTRA 1ZV1A 2HWJA 1AIPC 1TTEA 1E94E 2JP7A 2KNZA 1IFYA 2DNAA 2G3QA 4F1IA 1VDLA 3K9OA 1WR1B 3GLGE 1HQYE 1DO2A 2RRUA 1YLAA 1TR8A 1Q02A 2DAGA 2KNVA 1DO0A 1UFZA 3F92A 4UN2B 1VQ1A 2MJ5B 2OOAA 1OQYA 2EKFA 2ZTCA 2JZ1A 1G41A 2JY8A 1A5TA 2LVAA 1ZMVA 1F4IA 1T6OA 1MN3A 1HT1E 4R71A 5DFLA 4DBGB 3B89A 2DZLA 2EJSA 1KYIA 3FRIA 4GEWA 1IM2A 2DENA 2KNAA 2JY5A 1HT2E 2DAIA 2K9DA 1VG5A 2H5XA 1QZEA 2BWBA 2OO9A 3E46A 1OAIA 2DKLA 2QHOB 1G3IA 4Q7JA 1EFUB 1VEGA 2JY6B 2CWBA 2JZ0A 2EKKA 2LVQD 2DHYA 1T43A 1P3QQ 1BVSA 2JUJA 2QSFX 1HJPA 1WGLA 2L4EA 2LTUA 2L4FA 2LVOC 1NV8A 1Y8GA 2JY7A 3IECA 1C7YA 1G4AE 2WZJA 4HEOA 1WGNA 1OKSA 2DAEA 2DAKA 1SG9A 1NV9A 3BBZA 1GO5A 3K9PA 2KHHA 3FE3A 1WJ7A 1VEKA 1XXHE 1VEJA 1V92A 2LVNC 1IXSA 4G3OA 5JI2E 1WIVA 2MR9A 1ZMWA 2R0IA 1R4GA 2LBCA 2ZTDA 2JNHA 2O25A 3LCUA 2BWEA 1DV0A 2DAMA
chains in the Genus database with same CATH superfamily
1L1ZA 3FTFA 3U61A 2CE7A 2L7HA 2L2DA 5FTKA 3SMSA 4I81A 1JR3E 3KOYE 2L6OA 1N36M 5BPVA 2LVPC 1IBKM 5ITXE 3L2AA 3KSXA 2L7IA 3H4MA 1K3WA 2QNJA 3SARA 1XB2B 2X49A 1D0LA 1HQCA 1N75A 2MH8A 3KS4A 1N32M 5FTMA 3FD9A 3U60B 3DFZA 4F2LA 2V1CA 3FRHA 3CGWA 4IBFA 1AUAA 3JR5A 3SHGB 5F3WA 4DV7M 1XMOM 4IJFA 2B3TA 1J5EM 5ITXA 3A98B 5EJCA 3GO8A 2KZUA 4S12A 3GQ4A 4G4OA 2HWJA 2Z4SA 2RGOA 4G4NA 4LF8M 1PRBA 1E94E 2C98A 1HNWM 1QAOA 5E26A 1L2BA 4AI6A 4CJ6A 4D81A 2G3QA 3V76A 3HU1A 5IWAM 5IT9S 3K9OA 1V33A 1SXJD 2WSFF 1S3SA 4JI6M 1Q3BA 5DYIA 3K92A 4JI0M 2HCBA 2R62A 1Q02A 4XK8F 3NBXX 3C9PA 2DAGA 4NL4H 3QYBA 3FTEA 2F5SA 2DHRA 3RFWA 3SATA 1L1TA 3ZC7B 4LG2A 2DWNA 2JA2A 2R45A 3U6QA 3PXGA 2OOAA 5KO3A 1OQYA 4DR6M 4A3VB 4AG5A 2JZ1A 1NNUC 2O01F 2JY8A 1QUTA 3FUTA 3LVWA 4X64M 3KP1E 4RNAA 2Z3XA 2ERCA 1MN3A 1HT1E 4AKIA 4NRVA 4PDIA 4NSRA 3GPXA 3UGJA 3IG5A 2DENA 1KFVA 4CISA 3KS8A 3UJNA 4DUYM 2D7EA 2UXBM 2DAIA 3GQ3A 3E46A 4AW4A 4B7FA 1K82A 3R9XB 2QHOB 2QPAA 4AKHA 1IN7A 2YQZA 2HHHM 2JZ0A 4QNRA 1I94M 2JXNA 2ZAMA 5L8RF 3R8FA 4L8RC 2DHYA 1TH2A 2QZ4A 1RU3A 4M9ZA 2XH9A 1R5LA 1V34A 3HGIA 3A45A 3SYLA 3LVVA 5KPRA 2JY7A 2UUAM 2M60A 3J7AS 1C7YA 5IREB 3PNYA 2WZJA 4KLNA 4HEOA 1WGNA 3U5ZA 4B3RM 1OKSA 2DWLA 3FKEA 1EE8A 2KHHA 3NBIA 4FW9A 2NQ8C 1VDDA 1Z6TA 1VEJA 2KRUA 2QP9X 2Y20A 3SYKA 3U6LA 2LXEA 3HU2A 3RGSA 2RKOA 1NHGC 3AV0A 2MR9A 2UUCM 4JI1M 4P16A 4IBCA 4GH9A 4KHPM 3SFZA 4X62M 3GLFB 2JNHA 2O25A 4L78A 5ITQA 3H4JA 2D7HA 5EXSA 4KO8A 4GITA 4Z6YA 4RKUF 4JI8M 4JI5M 2XEPA 2DZNB 4M0WA 1N34M 1FNNA 3GLIE 4WW0A 3GRUA 1QZMA 1GJSA 2P5TA 2XZUA 3GLGB 4NXNM 3SMPA 4LZJA 4ANRA 4BBAA 1CUKA 4LFCM 1IBMM 4MGIE 3FUWA 4DR5M 4OX9M 2UXCM 5EXPA 2QBYB 1PJTA 1LV7A 4CHTB 1XMQM 2HAKA 1SXJB 3TE6A 2DI0A 2MGWA 4DV4M 4DV2M 1OFHA 3U6SA 3B7QA 1YE9A 2DWZB 3E4RA 3PNVA 4QNMA 4MGHA 3L26A 3U6EA 4MM3B 4XBOA 3VK8A 2KNZA 4M9SA 1QANA 3W0LB 4LF4M 1Z59A 2DNAA 2EO2A 1GABA 2VIIA 3I4VA 2X4AA 2EUCA 3CF6E 4RF1A 4LGYA 4MGZE 1HQYE 4LCBA 1DO2A 4IIWA 1YLAA 1QDRA 3GP1A 4DV1M 1H6UA 3GPPA 3W0FA 3HWSA 2BJVA 3FYCA 5EQTA 3UK6A 2C96A 1DGGA 1NVMA 2CRUA 2LNHC 1DGBA 4OW0A 5IZ7D 3TWMA 3VDUA 4GKKM 2MJ5B 4G4QA 1JR3A 3PFIA 3U60A 3LMMA 3HJQA 1QQWA 1TGUA 4OU7A 4PDGA 2K47A 3U6DA 4B3TM 3FTDA 1G41A 2FFJA 4AG6A 4R71A 3T15A 1C1KA 5DFLA 1E9RA 2CV0A 3B89A 1OIZA 4GRIA 3U6CA 2DZLA 2EJSA 3DZDA 3L28A 5DYGA 4FWGA 3DOAA 1QYRA 4GEWA 3AOGA 2V1UA 5FLXS 3B9PA 3M0EA 3CF2A 2KNAA 2JY5A 4DV3M 2APLA 1VG5A 2K9DA 1QZEA 4L4UA 2BWBA 2OO9A 2O5RA 4L6V6 2ZANA 1IXSB 5KPZA 3U6PA 1L2DA 3K8ZA 2DVWB 3SBJA 3U6MA 2VF8A 2EKKA 2KEBA 2R4JA 2G5GX 1T43A 1P3QQ 2D7GA 1BVSA 3W67A 4EIWA 2F5QA 4GIPA 1GKIA 1XNRM 2JUJA 3WHLA 1IBLM 4B08A 4IBIA 1TH4A 1WGLA 2WSEF 4LZZA 1IQPA 2R65A 2LTUA 3BOSA 5KPTA 2DZOB 2J7NA 1KSFX 2BJWA 1HNZM 3GRVA 1G4AE 3HU3A 4LJ7A 4QOZC 1NY5A 3I4YA 3C3EA 4X65M 4BB9A 2DAEA 4IBEA 4LFAM 2GNOA 5EXTA 1NV9A 1Z5CA 2QQ8A 1Q39A 3KOWE 1E9SA 2BNKA 4GC5A 4PD2A 4LF9M 1D2NA 1MU5A 3ZQJA 2KA6B 2KZSA 2F4VM 2V6ZM 2Y0QA 4M9XA 4LGMA 4R3DA 4P17A 3UMMA 3THGA 1V92A 2CEAA 4IBBA 4QHSA 2H1RA 5JI2E 1ZQ9A 2FOIC 3JAMS 3L27A 2C99A 3LQQA 2F5OA 1WIVA 4AKGA 1TF0B 1NY6A 2AHMA 1FJGM 2LBCA 1DGFA 4LY6A 3T1YM 2R44A 4FD2A 2KXEA 3VLFB 1E32A 3LCUA 3GLHB 3TPZA 3HJSA 3FUXA 1DV0A 2DAMA 1XNQM 1WHCA 3EIEA 3I04M 4NSOB 3D8LA 5C18A 5KQ8A 1NO1A 3SAVA 1PJJA 2UUBM 4HL4A 4JYAM 4GHLA 1EIJA 1R7RA 5EP1A 1MJGM 2YR0A 4IBGA 4I5SA 5GKNA 2CHGA 3E21A 3WHKA 1QAQA 3C58A 3D8BA 2OQ4A 1R2YA 5FTLA 1NJGA 3ZCBB 2HKJA 3ZH9B 2MROB 4LJ5A 5EXXA 1QAMA 1ZMUA 2FE8A 3MJ5A 4NXMM 3MMPA 3VKGA 3L25A 5LMUM 3GLFE 3T6PA 4FWHA 4MGKE 2KW0A 4W5WA 3TWLA 1TDZA 2F5NA 4JI3M 1ZV1A 4B7GA 4LF5M 1R2ZA 1AIPC 1D0MA 3ILKA 3RE8A 4B3SM 4JI4M 1IFYA 2R18A 3GLFA 4DR7M 4JN6A 1DGHB 3PVSA 3UZUA 4DR1M 3FTCA 1VDLA 1WR1B 4KODA 4Y28F 3GLGE 2VQFM 3MHVC 3CTWB 4OVZB 3KP0E 2FNAA 3QWLA 2KNVA 5BR8M 5ITYA 1DO0A 5H37D 3HY5A 4FWDA 4JI7M 4YY3M 1UFZA 3F92A 4UN2B 1SXJE 3GLGA 1VQ1A 3GLIA 4I4LA 1NHWC 4XGIA 3HHXA 1J09A 4GHAA 5ITUA 4MGYE 2C5RA 5FTJA 2QBYA 3TL4X 2ZTCA 3GPUA 1SXJC 1Z5AA 3AOEA 1OAOC 1IY0A 1ZAEA 3J2PB 1A5TA 2J7OA 1ZMVA 1SXJA 1N77A 5DNYA 3B74A 4FVMA 2XFTA 3A42A 5C1BA 2KRKA 1GLNA 2E5LM 1KYIA 3EIHA 2OPFA 1IM2A 2Z7JA 2Y21A 2A5YB 3I01M 4REZA 5FSWA 3SASA 2H5XA 2ZBKB 2XSZD 3K1JA 3LW5F 2LHCA 1OAIA 2DKLA 3KFUG 1GVNA 1G3IA 1IN4A 1EFUB 1NSFA 1IN5A 1VEGA 1XWIA 2JY6B 3HX3A 4Q7JA 4LJ4A 3FUVA 1J7KA 3E9SA 2C9OA 2N35A 4PT5A 2UU9M 1PM5A 1G59A 4DR4M 1XXHB 2CHVA 2LHGA 3SAWA 5EP3A 3W68A 2I7PA 3KXEC 3Q8GA 3TWKA 1HJPA 3U61B 4TUWA 4DR2M 1XC8A 2L4FA 2LVOC 4LF7M 1PJSA 3HHWA 3IECA 1L8QA 3AJIB 1NJFA 1TH3A 4GMQA 5E6JA 1PJIA 1NNJA 1OFIA 2EA0A 1IN6A 3KDSE 3VK7A 3OTOM 2VDBB 2CV1A 1I4WA 4D80A 4II7A 2DAKA 3BBZA 4IBDA 3K9PA 4RF0A 1R6BX 4K0KM 3FE3A 1WJ7A 4DV6M 3TQSA 2UXDM 3HHZA 4JI2M 1JB0F 1IY1A 3HHYA 1X37A 4G3OA 1IXSA 2C9CA 4DR3M 3J81S 2CUZA 2KDLA 1GL7A 4LJ8A 2K6BA 3FUUA 7CATA 2BWEA 3M6AA 2HL7A 1W5TA 2CP8A 3J7BA 2DWMA 2OOBA 4YHHM 4JV5M 4QHTA 2XF3A 2YNMD 3B7NA 3GRRA 3IHPA 2Q2EB 4I8OA 4IBKA 3KOXE 3U6OA 4BLCA 4CIZA 2R46A 3J27B 1Q3CA 4DV5M 3L29A 3LCVB 1PGYA 1XHBA 1MX0A 4WP2A 4AQYM 3GPYA 2VF7A 4GC9A 4NOOB 3GLHE 1OTRA 4LJAA 1HNXM 1PJQA 4FCWA 1JR3D 2Y0TA 2CFOA 3QYEA 3JR4A 1QUSA 2ZAOA 1TTEA 2JP7A 3IG8A 1G71A 2XLJA 4F1IA 3GLHA 2GQFA 4LJ6A 4B7HA 3C3DA 2R6FA 4G6ZA 1N78A 2CV2A 2RRUA 1TR8A 2DXIA 2X8AA 4LRTA 3RGPA 4LFBM 3K2LA 2W82A 3HKPA 3FYDA 1G8PA 2QENA 4Z8XA 3KSJA 3J80S 2XFSA 4B3MM 2XZFA 5KQDA 4DV0M 3AKZA 1IXRC 4L16A 2EKFA 3CF0A 4IJEA 5ITRA 3NWLA 3BXWA 3DA1A 1N33M 1WXQA 2LVAA 2G8LA 4QOSA 2Z8YM 1F4IA 1T6OA 1YUBA 3KOZE 4DBGB 4FCTA 3U5ZB 4ZPXA 2FH0A 1IY2A 2L09A 2XSZA 2LWXA 2YFQA 3FRIA 3M7GA 4LRSA 4M0DA 5EP4A 5FTNA 4G4RA 4JXJA 3GQ5A 1JQJC 5ITTA 1DGHA 2J5YA 3QAUA 8CATA 1K3XA 4MH0E 1HT2E 1D0KA 4R7GA 4L15A 4OVZA 2RGHA 1IN8A 2CWBA 3SHFA 1OIPA 4HLQA 1GJTA 4FCVA 3AFHA 1GL6A 2LVQD 3VKHA 2Z4RA 3SAUA 1HR0M 3GRYA 3HZJA 2XGNA 1Z5BA 4DUZM 1TDHA 3AOEC 2JWSA 2QSFX 2WSCF 3SC3A 2F5PA 3B7ZA 3T38A 2L4EA 1QDTA 3A46A 1OJLA 1NV8A 1Y8GA 5EP2A 4MB7A 4D82A 3AL0C 3I51A 5JI3E 2QCUA 2VQEM 4KT0F 4X66M 2M5ZA 5LMNM 4WURA 1SG9A 1W5SA 1QVRA 3HJ8A 1L2CA 1GO5A 2ZM6M 3GLIB 4CGYB 3VFDA 1IXZA 1VEKA 1XXHE 1LTMA 4LF6M 1T3TA 2LVNC 3KW6A 4AZFA 4GKJM 4PCZA 4NC6A 4ITQA 2LH0A 2FS1A 3LQRA 4NRWA 1UM8A 5A2QS 3T1HM 4LJ9A 4IBJA 1ZMWA 1ORYB 3KVWA 3Q8XA 2R0IA 1R4GA 2ZTDA 2CHQA 3VDPA 1YSYA 2R4EA 1XXHA 2I7NA 3MK6A 2K0BX
chains in the Genus database with same CATH topology
1WHCA 2CP8A 2L2DA 2OOBA 3GLIE 1JR3E 3IHPA 2LVPC 3E21A 3H4JA 2QNJA 1XB2B 4F2LA 1CUKA 2MROB 3FRHA 1ZMUA 3LCVB 1PGYA 3MMPA 2B3TA 4WP2A 3GLFE 3T6PA 2HAKA 2K0BX 3GLHE 2DI0A 2MGWA 1OTRA 1ZV1A 2HWJA 1AIPC 1TTEA 1E94E 2JP7A 2KNZA 1IFYA 2DNAA 2G3QA 4F1IA 1VDLA 3K9OA 1WR1B 3GLGE 1HQYE 1DO2A 2RRUA 1YLAA 1TR8A 1Q02A 2DAGA 2KNVA 1DO0A 1UFZA 3F92A 4UN2B 1VQ1A 2MJ5B 2OOAA 1OQYA 2EKFA 2ZTCA 2JZ1A 1G41A 2JY8A 1A5TA 2LVAA 1ZMVA 1F4IA 1T6OA 1MN3A 1HT1E 4R71A 5DFLA 4DBGB 3B89A 2DZLA 2EJSA 1KYIA 3FRIA 4GEWA 1IM2A 2DENA 2KNAA 2JY5A 1HT2E 2DAIA 2K9DA 1VG5A 2H5XA 1QZEA 2BWBA 2OO9A 3E46A 1OAIA 2DKLA 2QHOB 1G3IA 4Q7JA 1EFUB 1VEGA 2JY6B 2CWBA 2JZ0A 2EKKA 2LVQD 2DHYA 1T43A 1P3QQ 1BVSA 2JUJA 2QSFX 1HJPA 1WGLA 2L4EA 2LTUA 2L4FA 2LVOC 1NV8A 1Y8GA 2JY7A 3IECA 1C7YA 1G4AE 2WZJA 4HEOA 1WGNA 1OKSA 2DAEA 2DAKA 1SG9A 1NV9A 3BBZA 1GO5A 3K9PA 2KHHA 3FE3A 1WJ7A 1VEKA 1XXHE 1VEJA 1V92A 2LVNC 1IXSA 4G3OA 5JI2E 1WIVA 2MR9A 1ZMWA 2R0IA 1R4GA 2LBCA 2ZTDA 2JNHA 2O25A 3LCUA 2BWEA 1DV0A 2DAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHC A;  2CP8 A;  2L2D A;  2OOB A;  3GLI E;  1JR3 E;  3IHP A;  2LVP C;  3E21 A;  3H4J A;  2QNJ A;  1XB2 B;  4F2L A;  1CUK A;  2MRO B;  3FRH A;  1ZMU A;  3LCV B;  1PGY A;  3MMP A;  2B3T A;  4WP2 A;  3GLF E;  3T6P A;  2HAK A;  2K0B X;  3GLH E;  2DI0 A;  2MGW A;  1OTR A;  1ZV1 A;  2HWJ A;  1AIP C;  1TTE A;  1E94 E;  2JP7 A;  2KNZ A;  1IFY A;  2DNA A;  2G3Q A;  4F1I A;  1VDL A;  3K9O A;  1WR1 B;  3GLG E;  1HQY E;  1DO2 A;  2RRU A;  1YLA A;  1TR8 A;  1Q02 A;  2DAG A;  2KNV A;  1DO0 A;  1UFZ A;  3F92 A;  4UN2 B;  1VQ1 A;  2MJ5 B;  2OOA A;  1OQY A;  2EKF A;  2ZTC A;  2JZ1 A;  1G41 A;  2JY8 A;  1A5T A;  2LVA A;  1ZMV A;  1F4I A;  1T6O A;  1MN3 A;  1HT1 E;  4R71 A;  5DFL A;  4DBG B;  3B89 A;  2DZL A;  2EJS A;  1KYI A;  3FRI A;  4GEW A;  1IM2 A;  2DEN A;  2KNA A;  2JY5 A;  1HT2 E;  2DAI A;  2K9D A;  1VG5 A;  2H5X A;  1QZE A;  2BWB A;  2OO9 A;  3E46 A;  1OAI A;  2DKL A;  2QHO B;  1G3I A;  4Q7J A;  1EFU B;  1VEG A;  2JY6 B;  2CWB A;  2JZ0 A;  2EKK A;  2LVQ D;  2DHY A;  1T43 A;  1P3Q Q;  1BVS A;  2JUJ A;  2QSF X;  1HJP A;  1WGL A;  2L4E A;  2LTU A;  2L4F A;  2LVO C;  1NV8 A;  1Y8G A;  2JY7 A;  3IEC A;  1C7Y A;  1G4A E;  2WZJ A;  4HEO A;  1WGN A;  1OKS A;  2DAE A;  2DAK A;  1SG9 A;  1NV9 A;  3BBZ A;  1GO5 A;  3K9P A;  2KHH A;  3FE3 A;  1WJ7 A;  1VEK A;  1XXH E;  1VEJ A;  1V92 A;  2LVN C;  1IXS A;  4G3O A;  5JI2 E;  1WIV A;  2MR9 A;  1ZMW A;  2R0I A;  1R4G A;  2LBC A;  2ZTD A;  2JNH A;  2O25 A;  3LCU A;  2BWE A;  1DV0 A;  2DAM A; 
#chains in the Genus database with same CATH topology
 1L1Z A;  3FTF A;  3U61 A;  2CE7 A;  2L7H A;  2L2D A;  5FTK A;  3SMS A;  4I81 A;  1JR3 E;  3KOY E;  2L6O A;  1N36 M;  5BPV A;  2LVP C;  1IBK M;  5ITX E;  3L2A A;  3KSX A;  2L7I A;  3H4M A;  1K3W A;  2QNJ A;  3SAR A;  1XB2 B;  2X49 A;  1D0L A;  1HQC A;  1N75 A;  2MH8 A;  3KS4 A;  1N32 M;  5FTM A;  3FD9 A;  3U60 B;  3DFZ A;  4F2L A;  2V1C A;  3FRH A;  3CGW A;  4IBF A;  1AUA A;  3JR5 A;  3SHG B;  5F3W A;  4DV7 M;  1XMO M;  4IJF A;  2B3T A;  1J5E M;  5ITX A;  3A98 B;  5EJC A;  3GO8 A;  2KZU A;  4S12 A;  3GQ4 A;  4G4O A;  2HWJ A;  2Z4S A;  2RGO A;  4G4N A;  4LF8 M;  1PRB A;  1E94 E;  2C98 A;  1HNW M;  1QAO A;  5E26 A;  1L2B A;  4AI6 A;  4CJ6 A;  4D81 A;  2G3Q A;  3V76 A;  3HU1 A;  5IWA M;  5IT9 S;  3K9O A;  1V33 A;  1SXJ D;  2WSF F;  1S3S A;  4JI6 M;  1Q3B A;  5DYI A;  3K92 A;  4JI0 M;  2HCB A;  2R62 A;  1Q02 A;  4XK8 F;  3NBX X;  3C9P A;  2DAG A;  4NL4 H;  3QYB A;  3FTE A;  2F5S A;  2DHR A;  3RFW A;  3SAT A;  1L1T A;  3ZC7 B;  4LG2 A;  2DWN A;  2JA2 A;  2R45 A;  3U6Q A;  3PXG A;  2OOA A;  5KO3 A;  1OQY A;  4DR6 M;  4A3V B;  4AG5 A;  2JZ1 A;  1NNU C;  2O01 F;  2JY8 A;  1QUT A;  3FUT A;  3LVW A;  4X64 M;  3KP1 E;  4RNA A;  2Z3X A;  2ERC A;  1MN3 A;  1HT1 E;  4AKI A;  4NRV A;  4PDI A;  4NSR A;  3GPX A;  3UGJ A;  3IG5 A;  2DEN A;  1KFV A;  4CIS A;  3KS8 A;  3UJN A;  4DUY M;  2D7E A;  2UXB M;  2DAI A;  3GQ3 A;  3E46 A;  4AW4 A;  4B7F A;  1K82 A;  3R9X B;  2QHO B;  2QPA A;  4AKH A;  1IN7 A;  2YQZ A;  2HHH M;  2JZ0 A;  4QNR A;  1I94 M;  2JXN A;  2ZAM A;  5L8R F;  3R8F A;  4L8R C;  2DHY A;  1TH2 A;  2QZ4 A;  1RU3 A;  4M9Z A;  2XH9 A;  1R5L A;  1V34 A;  3HGI A;  3A45 A;  3SYL A;  3LVV A;  5KPR A;  2JY7 A;  2UUA M;  2M60 A;  3J7A S;  1C7Y A;  5IRE B;  3PNY A;  2WZJ A;  4KLN A;  4HEO A;  1WGN A;  3U5Z A;  4B3R M;  1OKS A;  2DWL A;  3FKE A;  1EE8 A;  2KHH A;  3NBI A;  4FW9 A;  2NQ8 C;  1VDD A;  1Z6T A;  1VEJ A;  2KRU A;  2QP9 X;  2Y20 A;  3SYK A;  3U6L A;  2LXE A;  3HU2 A;  3RGS A;  2RKO A;  1NHG C;  3AV0 A;  2MR9 A;  2UUC M;  4JI1 M;  4P16 A;  4IBC A;  4GH9 A;  4KHP M;  3SFZ A;  4X62 M;  3GLF B;  2JNH A;  2O25 A;  4L78 A;  5ITQ A;  3H4J A;  2D7H A;  5EXS A;  4KO8 A;  4GIT A;  4Z6Y A;  4RKU F;  4JI8 M;  4JI5 M;  2XEP A;  2DZN B;  4M0W A;  1N34 M;  1FNN A;  3GLI E;  4WW0 A;  3GRU A;  1QZM A;  1GJS A;  2P5T A;  2XZU A;  3GLG B;  4NXN M;  3SMP A;  4LZJ A;  4ANR A;  4BBA A;  1CUK A;  4LFC M;  1IBM M;  4MGI E;  3FUW A;  4DR5 M;  4OX9 M;  2UXC M;  5EXP A;  2QBY B;  1PJT A;  1LV7 A;  4CHT B;  1XMQ M;  2HAK A;  1SXJ B;  3TE6 A;  2DI0 A;  2MGW A;  4DV4 M;  4DV2 M;  1OFH A;  3U6S A;  3B7Q A;  1YE9 A;  2DWZ B;  3E4R A;  3PNV A;  4QNM A;  4MGH A;  3L26 A;  3U6E A;  4MM3 B;  4XBO A;  3VK8 A;  2KNZ A;  4M9S A;  1QAN A;  3W0L B;  4LF4 M;  1Z59 A;  2DNA A;  2EO2 A;  1GAB A;  2VII A;  3I4V A;  2X4A A;  2EUC A;  3CF6 E;  4RF1 A;  4LGY A;  4MGZ E;  1HQY E;  4LCB A;  1DO2 A;  4IIW A;  1YLA A;  1QDR A;  3GP1 A;  4DV1 M;  1H6U A;  3GPP A;  3W0F A;  3HWS A;  2BJV A;  3FYC A;  5EQT A;  3UK6 A;  2C96 A;  1DGG A;  1NVM A;  2CRU A;  2LNH C;  1DGB A;  4OW0 A;  5IZ7 D;  3TWM A;  3VDU A;  4GKK M;  2MJ5 B;  4G4Q A;  1JR3 A;  3PFI A;  3U60 A;  3LMM A;  3HJQ A;  1QQW A;  1TGU A;  4OU7 A;  4PDG A;  2K47 A;  3U6D A;  4B3T M;  3FTD A;  1G41 A;  2FFJ A;  4AG6 A;  4R71 A;  3T15 A;  1C1K A;  5DFL A;  1E9R A;  2CV0 A;  3B89 A;  1OIZ A;  4GRI A;  3U6C A;  2DZL A;  2EJS A;  3DZD A;  3L28 A;  5DYG A;  4FWG A;  3DOA A;  1QYR A;  4GEW A;  3AOG A;  2V1U A;  5FLX S;  3B9P A;  3M0E A;  3CF2 A;  2KNA A;  2JY5 A;  4DV3 M;  2APL A;  1VG5 A;  2K9D A;  1QZE A;  4L4U A;  2BWB A;  2OO9 A;  2O5R A;  4L6V 6;  2ZAN A;  1IXS B;  5KPZ A;  3U6P A;  1L2D A;  3K8Z A;  2DVW B;  3SBJ A;  3U6M A;  2VF8 A;  2EKK A;  2KEB A;  2R4J A;  2G5G X;  1T43 A;  1P3Q Q;  2D7G A;  1BVS A;  3W67 A;  4EIW A;  2F5Q A;  4GIP A;  1GKI A;  1XNR M;  2JUJ A;  3WHL A;  1IBL M;  4B08 A;  4IBI A;  1TH4 A;  1WGL A;  2WSE F;  4LZZ A;  1IQP A;  2R65 A;  2LTU A;  3BOS A;  5KPT A;  2DZO B;  2J7N A;  1KSF X;  2BJW A;  1HNZ M;  3GRV A;  1G4A E;  3HU3 A;  4LJ7 A;  4QOZ C;  1NY5 A;  3I4Y A;  3C3E A;  4X65 M;  4BB9 A;  2DAE A;  4IBE A;  4LFA M;  2GNO A;  5EXT A;  1NV9 A;  1Z5C A;  2QQ8 A;  1Q39 A;  3KOW E;  1E9S A;  2BNK A;  4GC5 A;  4PD2 A;  4LF9 M;  1D2N A;  1MU5 A;  3ZQJ A;  2KA6 B;  2KZS A;  2F4V M;  2V6Z M;  2Y0Q A;  4M9X A;  4LGM A;  4R3D A;  4P17 A;  3UMM A;  3THG A;  1V92 A;  2CEA A;  4IBB A;  4QHS A;  2H1R A;  5JI2 E;  1ZQ9 A;  2FOI C;  3JAM S;  3L27 A;  2C99 A;  3LQQ A;  2F5O A;  1WIV A;  4AKG A;  1TF0 B;  1NY6 A;  2AHM A;  1FJG M;  2LBC A;  1DGF A;  4LY6 A;  3T1Y M;  2R44 A;  4FD2 A;  2KXE A;  3VLF B;  1E32 A;  3LCU A;  3GLH B;  3TPZ A;  3HJS A;  3FUX A;  1DV0 A;  2DAM A;  1XNQ M;  1WHC A;  3EIE A;  3I04 M;  4NSO B;  3D8L A;  5C18 A;  5KQ8 A;  1NO1 A;  3SAV A;  1PJJ A;  2UUB M;  4HL4 A;  4JYA M;  4GHL A;  1EIJ A;  1R7R A;  5EP1 A;  1MJG M;  2YR0 A;  4IBG A;  4I5S A;  5GKN A;  2CHG A;  3E21 A;  3WHK A;  1QAQ A;  3C58 A;  3D8B A;  2OQ4 A;  1R2Y A;  5FTL A;  1NJG A;  3ZCB B;  2HKJ A;  3ZH9 B;  2MRO B;  4LJ5 A;  5EXX A;  1QAM A;  1ZMU A;  2FE8 A;  3MJ5 A;  4NXM M;  3MMP A;  3VKG A;  3L25 A;  5LMU M;  3GLF E;  3T6P A;  4FWH A;  4MGK E;  2KW0 A;  4W5W A;  3TWL A;  1TDZ A;  2F5N A;  4JI3 M;  1ZV1 A;  4B7G A;  4LF5 M;  1R2Z A;  1AIP C;  1D0M A;  3ILK A;  3RE8 A;  4B3S M;  4JI4 M;  1IFY A;  2R18 A;  3GLF A;  4DR7 M;  4JN6 A;  1DGH B;  3PVS A;  3UZU A;  4DR1 M;  3FTC A;  1VDL A;  1WR1 B;  4KOD A;  4Y28 F;  3GLG E;  2VQF M;  3MHV C;  3CTW B;  4OVZ B;  3KP0 E;  2FNA A;  3QWL A;  2KNV A;  5BR8 M;  5ITY A;  1DO0 A;  5H37 D;  3HY5 A;  4FWD A;  4JI7 M;  4YY3 M;  1UFZ A;  3F92 A;  4UN2 B;  1SXJ E;  3GLG A;  1VQ1 A;  3GLI A;  4I4L A;  1NHW C;  4XGI A;  3HHX A;  1J09 A;  4GHA A;  5ITU A;  4MGY E;  2C5R A;  5FTJ A;  2QBY A;  3TL4 X;  2ZTC A;  3GPU A;  1SXJ C;  1Z5A A;  3AOE A;  1OAO C;  1IY0 A;  1ZAE A;  3J2P B;  1A5T A;  2J7O A;  1ZMV A;  1SXJ A;  1N77 A;  5DNY A;  3B74 A;  4FVM A;  2XFT A;  3A42 A;  5C1B A;  2KRK A;  1GLN A;  2E5L M;  1KYI A;  3EIH A;  2OPF A;  1IM2 A;  2Z7J A;  2Y21 A;  2A5Y B;  3I01 M;  4REZ A;  5FSW A;  3SAS A;  2H5X A;  2ZBK B;  2XSZ D;  3K1J A;  3LW5 F;  2LHC A;  1OAI A;  2DKL A;  3KFU G;  1GVN A;  1G3I A;  1IN4 A;  1EFU B;  1NSF A;  1IN5 A;  1VEG A;  1XWI A;  2JY6 B;  3HX3 A;  4Q7J A;  4LJ4 A;  3FUV A;  1J7K A;  3E9S A;  2C9O A;  2N35 A;  4PT5 A;  2UU9 M;  1PM5 A;  1G59 A;  4DR4 M;  1XXH B;  2CHV A;  2LHG A;  3SAW A;  5EP3 A;  3W68 A;  2I7P A;  3KXE C;  3Q8G A;  3TWK A;  1HJP A;  3U61 B;  4TUW A;  4DR2 M;  1XC8 A;  2L4F A;  2LVO C;  4LF7 M;  1PJS A;  3HHW A;  3IEC A;  1L8Q A;  3AJI B;  1NJF A;  1TH3 A;  4GMQ A;  5E6J A;  1PJI A;  1NNJ A;  1OFI A;  2EA0 A;  1IN6 A;  3KDS E;  3VK7 A;  3OTO M;  2VDB B;  2CV1 A;  1I4W A;  4D80 A;  4II7 A;  2DAK A;  3BBZ A;  4IBD A;  3K9P A;  4RF0 A;  1R6B X;  4K0K M;  3FE3 A;  1WJ7 A;  4DV6 M;  3TQS A;  2UXD M;  3HHZ A;  4JI2 M;  1JB0 F;  1IY1 A;  3HHY A;  1X37 A;  4G3O A;  1IXS A;  2C9C A;  4DR3 M;  3J81 S;  2CUZ A;  2KDL A;  1GL7 A;  4LJ8 A;  2K6B A;  3FUU A;  7CAT A;  2BWE A;  3M6A A;  2HL7 A;  1W5T A;  2CP8 A;  3J7B A;  2DWM A;  2OOB A;  4YHH M;  4JV5 M;  4QHT A;  2XF3 A;  2YNM D;  3B7N A;  3GRR A;  3IHP A;  2Q2E B;  4I8O A;  4IBK A;  3KOX E;  3U6O A;  4BLC A;  4CIZ A;  2R46 A;  3J27 B;  1Q3C A;  4DV5 M;  3L29 A;  3LCV B;  1PGY A;  1XHB A;  1MX0 A;  4WP2 A;  4AQY M;  3GPY A;  2VF7 A;  4GC9 A;  4NOO B;  3GLH E;  1OTR A;  4LJA A;  1HNX M;  1PJQ A;  4FCW A;  1JR3 D;  2Y0T A;  2CFO A;  3QYE A;  3JR4 A;  1QUS A;  2ZAO A;  1TTE A;  2JP7 A;  3IG8 A;  1G71 A;  2XLJ A;  4F1I A;  3GLH A;  2GQF A;  4LJ6 A;  4B7H A;  3C3D A;  2R6F A;  4G6Z A;  1N78 A;  2CV2 A;  2RRU A;  1TR8 A;  2DXI A;  2X8A A;  4LRT A;  3RGP A;  4LFB M;  3K2L A;  2W82 A;  3HKP A;  3FYD A;  1G8P A;  2QEN A;  4Z8X A;  3KSJ A;  3J80 S;  2XFS A;  4B3M M;  2XZF A;  5KQD A;  4DV0 M;  3AKZ A;  1IXR C;  4L16 A;  2EKF A;  3CF0 A;  4IJE A;  5ITR A;  3NWL A;  3BXW A;  3DA1 A;  1N33 M;  1WXQ A;  2LVA A;  2G8L A;  4QOS A;  2Z8Y M;  1F4I A;  1T6O A;  1YUB A;  3KOZ E;  4DBG B;  4FCT A;  3U5Z B;  4ZPX A;  2FH0 A;  1IY2 A;  2L09 A;  2XSZ A;  2LWX A;  2YFQ A;  3FRI A;  3M7G A;  4LRS A;  4M0D A;  5EP4 A;  5FTN A;  4G4R A;  4JXJ A;  3GQ5 A;  1JQJ C;  5ITT A;  1DGH A;  2J5Y A;  3QAU A;  8CAT A;  1K3X A;  4MH0 E;  1HT2 E;  1D0K A;  4R7G A;  4L15 A;  4OVZ A;  2RGH A;  1IN8 A;  2CWB A;  3SHF A;  1OIP A;  4HLQ A;  1GJT A;  4FCV A;  3AFH A;  1GL6 A;  2LVQ D;  3VKH A;  2Z4R A;  3SAU A;  1HR0 M;  3GRY A;  3HZJ A;  2XGN A;  1Z5B A;  4DUZ M;  1TDH A;  3AOE C;  2JWS A;  2QSF X;  2WSC F;  3SC3 A;  2F5P A;  3B7Z A;  3T38 A;  2L4E A;  1QDT A;  3A46 A;  1OJL A;  1NV8 A;  1Y8G A;  5EP2 A;  4MB7 A;  4D82 A;  3AL0 C;  3I51 A;  5JI3 E;  2QCU A;  2VQE M;  4KT0 F;  4X66 M;  2M5Z A;  5LMN M;  4WUR A;  1SG9 A;  1W5S A;  1QVR A;  3HJ8 A;  1L2C A;  1GO5 A;  2ZM6 M;  3GLI B;  4CGY B;  3VFD A;  1IXZ A;  1VEK A;  1XXH E;  1LTM A;  4LF6 M;  1T3T A;  2LVN C;  3KW6 A;  4AZF A;  4GKJ M;  4PCZ A;  4NC6 A;  4ITQ A;  2LH0 A;  2FS1 A;  3LQR A;  4NRW A;  1UM8 A;  5A2Q S;  3T1H M;  4LJ9 A;  4IBJ A;  1ZMW A;  1ORY B;  3KVW A;  3Q8X A;  2R0I A;  1R4G A;  2ZTD A;  2CHQ A;  3VDP A;  1YSY A;  2R4E A;  1XXH A;  2I7N A;  3MK6 A;  2K0B X; 
#chains in the Genus database with same CATH homology
 1WHC A;  2CP8 A;  2L2D A;  2OOB A;  3GLI E;  1JR3 E;  3IHP A;  2LVP C;  3E21 A;  3H4J A;  2QNJ A;  1XB2 B;  4F2L A;  1CUK A;  2MRO B;  3FRH A;  1ZMU A;  3LCV B;  1PGY A;  3MMP A;  2B3T A;  4WP2 A;  3GLF E;  3T6P A;  2HAK A;  2K0B X;  3GLH E;  2DI0 A;  2MGW A;  1OTR A;  1ZV1 A;  2HWJ A;  1AIP C;  1TTE A;  1E94 E;  2JP7 A;  2KNZ A;  1IFY A;  2DNA A;  2G3Q A;  4F1I A;  1VDL A;  3K9O A;  1WR1 B;  3GLG E;  1HQY E;  1DO2 A;  2RRU A;  1YLA A;  1TR8 A;  1Q02 A;  2DAG A;  2KNV A;  1DO0 A;  1UFZ A;  3F92 A;  4UN2 B;  1VQ1 A;  2MJ5 B;  2OOA A;  1OQY A;  2EKF A;  2ZTC A;  2JZ1 A;  1G41 A;  2JY8 A;  1A5T A;  2LVA A;  1ZMV A;  1F4I A;  1T6O A;  1MN3 A;  1HT1 E;  4R71 A;  5DFL A;  4DBG B;  3B89 A;  2DZL A;  2EJS A;  1KYI A;  3FRI A;  4GEW A;  1IM2 A;  2DEN A;  2KNA A;  2JY5 A;  1HT2 E;  2DAI A;  2K9D A;  1VG5 A;  2H5X A;  1QZE A;  2BWB A;  2OO9 A;  3E46 A;  1OAI A;  2DKL A;  2QHO B;  1G3I A;  4Q7J A;  1EFU B;  1VEG A;  2JY6 B;  2CWB A;  2JZ0 A;  2EKK A;  2LVQ D;  2DHY A;  1T43 A;  1P3Q Q;  1BVS A;  2JUJ A;  2QSF X;  1HJP A;  1WGL A;  2L4E A;  2LTU A;  2L4F A;  2LVO C;  1NV8 A;  1Y8G A;  2JY7 A;  3IEC A;  1C7Y A;  1G4A E;  2WZJ A;  4HEO A;  1WGN A;  1OKS A;  2DAE A;  2DAK A;  1SG9 A;  1NV9 A;  3BBZ A;  1GO5 A;  3K9P A;  2KHH A;  3FE3 A;  1WJ7 A;  1VEK A;  1XXH E;  1VEJ A;  1V92 A;  2LVN C;  1IXS A;  4G3O A;  5JI2 E;  1WIV A;  2MR9 A;  1ZMW A;  2R0I A;  1R4G A;  2LBC A;  2ZTD A;  2JNH A;  2O25 A;  3LCU A;  2BWE A;  1DV0 A;  2DAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...