2LVQD

Gp78cue domain bound to the proximal ubiquitin of k48-linked diubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 16
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvqD00
2DAIA 2JZ0A 3LCUA 2OOAA 1VEJA 2L4EA 3GLFE 1C7YA 2LBCA 3E21A 2BWEA 1AIPC 1QZEA 1E94E 2OO9A 1TR8A 3MMPA 1SG9A 1OQYA 2DAGA 2DKLA 2EKFA 1ZMVA 2EKKA 2G3QA 2O25A 2QNJA 2JY5A 3IECA 1G4AE 1VEGA 3GLGE 2DNAA 2DAMA 2DENA 1TTEA 2MROB 2RRUA 4F1IA 2LVOC 2CP8A 2KNAA 2DZLA 1HJPA 4Q7JA 1IM2A 1EFUB 1V92A 1PGYA 2LVNC 1DO2A 2K9DA 3T6PA 2K0BX 3FE3A 1F4IA 1IFYA 3IHPA 4WP2A 1BVSA 2QSFX 2JUJA 1HT2E 2JP7A 1T43A 2JZ1A 4F2LA 2KNVA 2H5XA 1HT1E 1A5TA 2L2DA 3K9OA 1R4GA 2DHYA 2ZTCA 2CWBA 2MGWA 1DO0A 3GLIE 2KHHA 1ZV1A 3GLHE 1VEKA 2JY6B 4DBGB 1WJ7A 2WZJA 1ZMWA 1VDLA 1XXHE 3H4JA 5DFLA 2JY8A 1VQ1A 2EJSA 2MJ5B 2R0IA 1KYIA 1WIVA 3LCVB 5JI2E 2JNHA 2HAKA 2HWJA 2LVPC 4UN2B 1G41A 1HQYE 2ZTDA 1IXSA 1OAIA 3E46A 2DI0A 2LVQD 2DAEA 2BWBA 1MN3A 1P3QQ 1UFZA 3FRHA 1Q02A 2KNZA 2L4FA 1JR3E 1ZMUA 1WGNA 1VG5A 1NV9A 4HEOA 3F92A 3K9PA 1XB2B 1T6OA 1WHCA 2DAKA 1NV8A 2LVAA 1WR1B 3FRIA 1OTRA 2LTUA 1DV0A 2OOBA 3BBZA 2JY7A 1GO5A 1G3IA 4GEWA 1OKSA 1Y8GA 2QHOB 2B3TA 4G3OA 3B89A 4R71A 1WGLA 2MR9A 1YLAA 1CUKA
chains in the Genus database with same CATH superfamily
2R6FA 3TWMA 1Z5BA 4DV0M 2M5ZA 1SXJC 1W5SA 2OOAA 1NHGC 1YE9A 2YFQA 4LJ8A 3J80S 4D81A 3C3DA 3VFDA 2CV2A 3R9XB 4GIPA 3GLFE 2R4EA 2A5YB 4XBOA 1HR0M 1PM5A 3ILKA 1LTMA 2K6BA 2DVWB 4RNAA 4B08A 1PRBA 2Z8YM 2CHVA 3ZC7B 4LF6M 3H4MA 1G8PA 3PVSA 3D8LA 1QQWA 2EKFA 3R8FA 4FCVA 2RGOA 2EKKA 4B3TM 2G3QA 4QNMA 1QANA 1Q3CA 2O25A 2QNJA 3AL0C 3HGIA 1GABA 5KPRA 3HWSA 3BXWA 5ITXA 3CF6E 3FKEA 1YUBA 4QNRA 3U6DA 2FOIC 1TTEA 2MROB 2RRUA 2DWMA 4L8RC 3VKGA 2YNMD 2CP8A 2KNAA 4YHHM 4JXJA 3M0EA 4M9XA 2DZLA 5DNYA 5C18A 5ITRA 1H6UA 3TL4X 1EFUB 3J7BA 1V92A 4LF9M 1V34A 1OAOC 1PGYA 1DGGA 4IBDA 4LCBA 1DO2A 4MGZE 1Z5CA 3HHXA 3T1YM 2CV0A 2Q2EB 1X37A 4WP2A 2H1RA 2QSFX 1Q39A 2QQ8A 1HT2E 4LF8M 1IY0A 1T43A 2CHGA 2JZ1A 2KNVA 1R2YA 4QOZC 1GLNA 1A5TA 3BOSA 2ZM6M 4ANRA 1QYRA 2YQZA 3GO8A 3GQ3A 4DR4M 1J09A 2UXBM 1R4GA 3JR4A 2FFJA 4B7GA 4EIWA 4NL4H 2CWBA 2MGWA 2LNHC 3HU1A 2I7PA 3AOEC 3LQRA 3IG8A 4JI4M 3U6SA 4G4RA 3A46A 3U60B 4JI8M 2ZAOA 1XC8A 2VQEM 3GP1A 1DGFA 4GKJM 3U5ZB 4JI1M 3U61A 3VKHA 4CGYB 1XXHE 4JN6A 4LJ4A 2F5PA 1GL7A 2EJSA 2R45A 3PFIA 1WIVA 1GJSA 1E9SA 1T3TA 2X4AA 3LCVB 2E5LM 2F5NA 5KPTA 1IXZA 2HAKA 4FCWA 2DZOB 4RF1A 4UN2B 3SAVA 5EP1A 1G41A 3HHWA 1N36M 3CF2A 2K47A 3SMPA 3UZUA 4WW0A 4PDGA 3I4YA 7CATA 1N78A 1QAMA 3I04M 2W82A 1NJGA 2BWBA 3QYEA 1D0LA 1QUTA 2VDBB 5LMUM 1K3WA 1UFZA 5KPZA 1Q02A 1S3SA 1K3XA 4DUZM 1R7RA 1YSYA 2WSFF 3QYBA 1D0KA 4CHTB 3F92A 3GLHA 5EP2A 3PNVA 4A3VB 5KQ8A 4DR2M 1DGHA 1JR3A 2VF7A 3OTOM 4G4OA 2Y21A 4DUYM 2L09A 5F3WA 3A98B 1R5LA 4LFCM 3KP0E 2UUBM 3SHGB 3DOAA 2LVAA 3KS4A 4DV3M 3T38A 4AKIA 2XF3A 3SMSA 1L2DA 3U6PA 2J5YA 3U61B 2HHHM 1OFIA 5ITQA 2X49A 1Y8GA 3L25A 1NO1A 2WSCF 4FW9A 3W0LB 5LMNM 1MX0A 3B89A 3FUUA 4NC6A 5FLXS 1OJLA 3AKZA 1YLAA 4KT0F 3W67A 1XNRM 1NJFA 4LG2A 1IN6A 5EXPA 2CEAA 4W5WA 2F5OA 3M6AA 4DV1M 2DWZB 4IBFA 1N33M 3KOXE 3Q8GA 5DYGA 4LGYA 1R2ZA 3TWLA 5EXXA 2BWEA 1PJSA 1QZEA 1E94E 4FCTA 2M60A 4JI6M 2X8AA 1XWIA 3NBIA 1PJJA 3DZDA 1NVMA 1OIZA 3LMMA 3GLGB 3U6LA 4L4UA 1OQYA 3LW5F 1DGHB 1VDDA 2DKLA 3JAMS 1HNZM 4Z8XA 3RE8A 3GQ5A 4IJEA 2KXEA 4GRIA 3U6QA 4AI6A 2UU9M 1ZAEA 2JY5A 3IECA 3FUTA 3VK8A 5ITYA 4MM3B 4JI0M 4L16A 3GLGE 2GNOA 3FUVA 4DR6M 1TGUA 3FD9A 4AZFA 4DV6M 5EJCA 3SFZA 1SXJB 4IBCA 2DHRA 1IXSB 2I7NA 2FS1A 2FNAA 4Q7JA 5IREB 4DR3M 4R7GA 2UUCM 1F4IA 2K9DA 5EP3A 3VLFB 3HJ8A 1BVSA 3EIHA 3GLIB 1SXJE 4FWGA 2R46A 4L15A 3QAUA 3EIEA 1Z6TA 4F2LA 4GMQA 1HT1E 3I01M 3UMMA 3U6EA 2CV1A 1SXJD 2L2DA 3K9OA 4M9ZA 5JI3E 3FTEA 2NQ8C 2XSZD 3AJIB 2ZTCA 1D2NA 3GLIE 4QHTA 4YY3M 3T15A 2HCBA 2XGNA 4IIWA 3PXGA 4LRSA 3VK7A 2YR0A 1ZV1A 1JB0F 2QBYB 4CJ6A 2EUCA 2L7HA 1EE8A 4DBGB 3WHLA 2MH8A 1WJ7A 1LV7A 2ZANA 3THGA 4DV7M 3GRYA 4CIZA 3GPPA 3W0FA 4L78A 3C58A 1IN4A 3WHKA 1L2BA 1TH3A 3V76A 1NHWC 1XXHA 5KQDA 4I81A 5EXSA 2KW0A 3ZQJA 4FVMA 2UXDM 3RGSA 1UM8A 1I4WA 1KFVA 4BLCA 3HHYA 4NXMM 4LFBM 2XLJA 1OAIA 3KVWA 4G4NA 2C5RA 4GITA 3LQQA 3SYKA 2DWLA 4I5SA 2LVQD 4LJ9A 1GL6A 3K92A 2DAEA 4WURA 4KHPM 3AV0A 3GRVA 4QOSA 1G71A 3D8BA 3FRHA 3RGPA 2D7EA 1XMQM 3E4RA 3TQSA 5ITUA 3KSJA 4I4LA 4NSOB 2XFSA 2WSEF 2BNKA 1PJTA 3J27B 1I94M 4JYAM 3UK6A 1WHCA 2XZFA 4OVZA 1NV8A 1IQPA 5IWAM 1OTRA 2FH0A 3UGJA 2RGHA 3L27A 1GO5A 2UUAM 1G3IA 2LWXA 2QHOB 1G59A 3TWKA 5ITXE 2UXCM 4JI5M 4R71A 1WGLA 4OW0A 2V1CA 5EP4A 5ITTA 5EXTA 1CUKA 4KODA 3HU3A 2XEPA 2JZ0A 4XGIA 4AW4A 1OIPA 2QZ4A 2JA2A 3LCUA 2L4EA 2LHGA 2DZNB 2Z4SA 4NXNM 1DGBA 4LZJA 3U6CA 4B7HA 5BR8M 2P5TA 3B9PA 3LVVA 1C7YA 4B3SM 3MMPA 3C3EA 3GPXA 1L1ZA 3FUWA 4NSRA 2V6ZM 4P17A 2R62A 4RKUF 5E6JA 3SYLA 1GKIA 3FTFA 1HNXM 4AG5A 2C96A 4LF4M 1IXRC 1SG9A 2JWSA 1L8QA 4GKKM 2DAGA 4RF0A 1GVNA 2Y0QA 3J2PB 3NBXX 4LF5M 2N35A 4R3DA 3SARA 3CF0A 2XFTA 1G4AE 4MB7A 3B74A 2HKJA 3KW6A 4QHSA 5FTMA 2DENA 4IBJA 2CFOA 2LVOC 1KSFX 2DWNA 2CUZA 2J7OA 3K8ZA 1HJPA 4LY6A 4ITQA 1IM2A 4DV4M 4CISA 5FTLA 1IN8A 2QCUA 3MHVC 3MK6A 3T6PA 3GLFA 1W5TA 3FE3A 1IFYA 1QVRA 3IHPA 3SATA 1NY5A 2C98A 2C9OA 1IY2A 2Z7JA 2CRUA 3JR5A 1IBKM 3GLHB 2GQFA 3KDSE 1XMOM 2O01F 2XZUA 3B7NA 1HNWM 3L2AA 1NNUC 1DO0A 5IZ7D 4X64M 2Z4RA 3A45A 2ERCA 2LH0A 3FYCA 3SAWA 2KHHA 4MGKE 3GLHE 1TF0B 1TH2A 4M9SA 3CTWB 1VEKA 3FUXA 4X66M 4M0WA 2WZJA 3GPYA 4NRVA 1QAQA 1NY6A 1VDLA 1JR3D 2O5RA 2F4VM 4DR5M 2QPAA 2MJ5B 1RU3A 5JI2E 4LFAM 1JQJC 3KOZE 4B3MM 1R6BX 2LVPC 4GHAA 4DR7M 4GH9A 4PDIA 1HQYE 3HKPA 3AOGA 2ZTDA 3NWLA 2KRKA 3E46A 1PJIA 3KOYE 2R44A 2ZAMA 4I8OA 2DI0A 4IJFA 3SHFA 4HLQA 3DA1A 2XH9A 1D0MA 4KO8A 3W68A 4L6V6 2HL7A 5L8RF 5A2QS 3GPUA 3HHZA 1P3QQ 2QP9X 4B7FA 2G8LA 3DFZA 4D80A 1IN5A 4S12A 1V33A 3U6MA 1IBLM 1Z59A 1FNNA 2L4FA 2VF8A 2KZSA 1ZMUA 4DV2M 2CHQA 3SAUA 1N75A 1VG5A 4HEOA 2R4JA 5FTKA 1C1KA 1L1TA 4Y28F 1Q3BA 3HZJA 4LGMA 1N34M 1OFHA 4LJ6A 1J5EM 3AOEA 3A42A 2BJWA 2D7HA 3U60A 1HQCA 1TH4A 1DV0A 2OOBA 4DR1M 3BBZA 1QUSA 1Z5AA 2JY7A 2Z3XA 3Q8XA 4GEWA 3VDPA 3GQ4A 1N32M 3KXEC 4AQYM 3U5ZA 3CGWA 2B3TA 2C9CA 3M7GA 4FWHA 4LF7M 3SBJA 3T1HM 2LXEA 1E32A 2DAIA 1MJGM 3FTCA 1IBMM 3B7QA 4LJAA 2F5QA 1VEJA 3K2LA 4IBEA 4ZPXA 4FWDA 3HU2A 2J7NA 2LBCA 3E21A 4REZA 1J7KA 4X65M 1AIPC 2OO9A 1L2CA 1TR8A 2L7IA 3LVWA 1TDZA 1MU5A 4NOOB 2ZBKB 2QENA 3I4VA 1XNQM 1ZMVA 4II7A 2G5GX 4PCZA 4M0DA 4IBIA 1XXHB 3VDUA 4NRWA 1VEGA 3ZH9B 2KRUA 3HJQA 2BJVA 2DNAA 2DAMA 4FD2A 2L6OA 2KDLA 3FTDA 4P16A 2Y0TA 4F1IA 3L28A 3KSXA 2D7GA 3GRRA 4G6ZA 3GRUA 3KP1E 1AUAA 2LVNC 2R65A 3HX3A 4PT5A 2K0BX 3PNYA 1XHBA 3B7ZA 3HJSA 4GHLA 4TUWA 2JUJA 2JP7A 2EA0A 5IT9S 1EIJA 2CE7A 2FE8A 3HY5A 3KOWE 8CATA 2H5XA 1IN7A 5FTJA 4AKHA 2V1UA 2C99A 4IBBA 1FJGM 2DHYA 4JI7M 4OVZB 3L29A 2EO2A 3L26A 4HL4A 4JI2M 4BBAA 2APLA 5FSWA 4LJ5A 4LRTA 2Y20A 3IG5A 4KLNA 1WXQA 2JY6B 3GLGA 4BB9A 4GC9A 1QDRA 4JI3M 1NSFA 3MJ5A 2KA6B 5C1BA 1ZMWA 1QAOA 3J7AS 1K82A 3K1JA 3H4JA 3ZCBB 2DXIA 4B3RM 5DFLA 2OPFA 1VQ1A 1NNJA 5EQTA 2R0IA 4X62M 1KYIA 4MGIE 4D82A 4MGHA 2JNHA 1IY1A 2HWJA 3UJNA 3J81S 3U6OA 1SXJA 4G4QA 2RKOA 2XSZA 1IXSA 3AFHA 2F5SA 1QDTA 1E9RA 3KS8A 4DV5M 3TE6A 3RFWA 1GJTA 1MN3A 3SASA 4PD2A 4K0KM 1N77A 3GLIA 5GKNA 1TDHA 2JXNA 2KNZA 1ORYB 1JR3E 4LZZA 4JV5M 1WGNA 5FTNA 5H37D 1NV9A 5KO3A 3K9PA 4IBKA 2VIIA 1XB2B 3QWLA 4OX9M 1T6OA 3C9PA 2DAKA 3FYDA 1WR1B 3FRIA 5BPVA 4OU7A 2OQ4A 4AKGA 4MGYE 5E26A 4XK8F 4IBGA 2R18A 2LTUA 3TPZA 1ZQ9A 2QBYA 5DYIA 4Z6YA 3KFUG 3E9SA 1OKSA 3I51A 2AHMA 2VQFM 1QZMA 4GC5A 2KZUA 4AG6A 4G3OA 3SC3A 2MR9A 3GLFB 4LJ7A 2KEBA 2LHCA 1PJQA 4MH0E 2JY8A
chains in the Genus database with same CATH topology
2DAIA 2JZ0A 3LCUA 2OOAA 1VEJA 2L4EA 3GLFE 1C7YA 2LBCA 3E21A 2BWEA 1AIPC 1QZEA 1E94E 2OO9A 1TR8A 3MMPA 1SG9A 1OQYA 2DAGA 2DKLA 2EKFA 1ZMVA 2EKKA 2G3QA 2O25A 2QNJA 2JY5A 3IECA 1G4AE 1VEGA 3GLGE 2DNAA 2DAMA 2DENA 1TTEA 2MROB 2RRUA 4F1IA 2LVOC 2CP8A 2KNAA 2DZLA 1HJPA 4Q7JA 1IM2A 1EFUB 1V92A 1PGYA 2LVNC 1DO2A 2K9DA 3T6PA 2K0BX 3FE3A 1F4IA 1IFYA 3IHPA 4WP2A 1BVSA 2QSFX 2JUJA 1HT2E 2JP7A 1T43A 2JZ1A 4F2LA 2KNVA 2H5XA 1HT1E 1A5TA 2L2DA 3K9OA 1R4GA 2DHYA 2ZTCA 2CWBA 2MGWA 1DO0A 3GLIE 2KHHA 1ZV1A 3GLHE 1VEKA 2JY6B 4DBGB 1WJ7A 2WZJA 1ZMWA 1VDLA 1XXHE 3H4JA 5DFLA 2JY8A 1VQ1A 2EJSA 2MJ5B 2R0IA 1KYIA 1WIVA 3LCVB 5JI2E 2JNHA 2HAKA 2HWJA 2LVPC 4UN2B 1G41A 1HQYE 2ZTDA 1IXSA 1OAIA 3E46A 2DI0A 2LVQD 2DAEA 2BWBA 1MN3A 1P3QQ 1UFZA 3FRHA 1Q02A 2KNZA 2L4FA 1JR3E 1ZMUA 1WGNA 1VG5A 1NV9A 4HEOA 3F92A 3K9PA 1XB2B 1T6OA 1WHCA 2DAKA 1NV8A 2LVAA 1WR1B 3FRIA 1OTRA 2LTUA 1DV0A 2OOBA 3BBZA 2JY7A 1GO5A 1G3IA 4GEWA 1OKSA 1Y8GA 2QHOB 2B3TA 4G3OA 3B89A 4R71A 1WGLA 2MR9A 1YLAA 1CUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAI A;  2JZ0 A;  3LCU A;  2OOA A;  1VEJ A;  2L4E A;  3GLF E;  1C7Y A;  2LBC A;  3E21 A;  2BWE A;  1AIP C;  1QZE A;  1E94 E;  2OO9 A;  1TR8 A;  3MMP A;  1SG9 A;  1OQY A;  2DAG A;  2DKL A;  2EKF A;  1ZMV A;  2EKK A;  2G3Q A;  2O25 A;  2QNJ A;  2JY5 A;  3IEC A;  1G4A E;  1VEG A;  3GLG E;  2DNA A;  2DAM A;  2DEN A;  1TTE A;  2MRO B;  2RRU A;  4F1I A;  2LVO C;  2CP8 A;  2KNA A;  2DZL A;  1HJP A;  4Q7J A;  1IM2 A;  1EFU B;  1V92 A;  1PGY A;  2LVN C;  1DO2 A;  2K9D A;  3T6P A;  2K0B X;  3FE3 A;  1F4I A;  1IFY A;  3IHP A;  4WP2 A;  1BVS A;  2QSF X;  2JUJ A;  1HT2 E;  2JP7 A;  1T43 A;  2JZ1 A;  4F2L A;  2KNV A;  2H5X A;  1HT1 E;  1A5T A;  2L2D A;  3K9O A;  1R4G A;  2DHY A;  2ZTC A;  2CWB A;  2MGW A;  1DO0 A;  3GLI E;  2KHH A;  1ZV1 A;  3GLH E;  1VEK A;  2JY6 B;  4DBG B;  1WJ7 A;  2WZJ A;  1ZMW A;  1VDL A;  1XXH E;  3H4J A;  5DFL A;  2JY8 A;  1VQ1 A;  2EJS A;  2MJ5 B;  2R0I A;  1KYI A;  1WIV A;  3LCV B;  5JI2 E;  2JNH A;  2HAK A;  2HWJ A;  2LVP C;  4UN2 B;  1G41 A;  1HQY E;  2ZTD A;  1IXS A;  1OAI A;  3E46 A;  2DI0 A;  2LVQ D;  2DAE A;  2BWB A;  1MN3 A;  1P3Q Q;  1UFZ A;  3FRH A;  1Q02 A;  2KNZ A;  2L4F A;  1JR3 E;  1ZMU A;  1WGN A;  1VG5 A;  1NV9 A;  4HEO A;  3F92 A;  3K9P A;  1XB2 B;  1T6O A;  1WHC A;  2DAK A;  1NV8 A;  2LVA A;  1WR1 B;  3FRI A;  1OTR A;  2LTU A;  1DV0 A;  2OOB A;  3BBZ A;  2JY7 A;  1GO5 A;  1G3I A;  4GEW A;  1OKS A;  1Y8G A;  2QHO B;  2B3T A;  4G3O A;  3B89 A;  4R71 A;  1WGL A;  2MR9 A;  1YLA A;  1CUK A; 
#chains in the Genus database with same CATH topology
 2R6F A;  3TWM A;  1Z5B A;  4DV0 M;  2M5Z A;  1SXJ C;  1W5S A;  2OOA A;  1NHG C;  1YE9 A;  2YFQ A;  4LJ8 A;  3J80 S;  4D81 A;  3C3D A;  3VFD A;  2CV2 A;  3R9X B;  4GIP A;  3GLF E;  2R4E A;  2A5Y B;  4XBO A;  1HR0 M;  1PM5 A;  3ILK A;  1LTM A;  2K6B A;  2DVW B;  4RNA A;  4B08 A;  1PRB A;  2Z8Y M;  2CHV A;  3ZC7 B;  4LF6 M;  3H4M A;  1G8P A;  3PVS A;  3D8L A;  1QQW A;  2EKF A;  3R8F A;  4FCV A;  2RGO A;  2EKK A;  4B3T M;  2G3Q A;  4QNM A;  1QAN A;  1Q3C A;  2O25 A;  2QNJ A;  3AL0 C;  3HGI A;  1GAB A;  5KPR A;  3HWS A;  3BXW A;  5ITX A;  3CF6 E;  3FKE A;  1YUB A;  4QNR A;  3U6D A;  2FOI C;  1TTE A;  2MRO B;  2RRU A;  2DWM A;  4L8R C;  3VKG A;  2YNM D;  2CP8 A;  2KNA A;  4YHH M;  4JXJ A;  3M0E A;  4M9X A;  2DZL A;  5DNY A;  5C18 A;  5ITR A;  1H6U A;  3TL4 X;  1EFU B;  3J7B A;  1V92 A;  4LF9 M;  1V34 A;  1OAO C;  1PGY A;  1DGG A;  4IBD A;  4LCB A;  1DO2 A;  4MGZ E;  1Z5C A;  3HHX A;  3T1Y M;  2CV0 A;  2Q2E B;  1X37 A;  4WP2 A;  2H1R A;  2QSF X;  1Q39 A;  2QQ8 A;  1HT2 E;  4LF8 M;  1IY0 A;  1T43 A;  2CHG A;  2JZ1 A;  2KNV A;  1R2Y A;  4QOZ C;  1GLN A;  1A5T A;  3BOS A;  2ZM6 M;  4ANR A;  1QYR A;  2YQZ A;  3GO8 A;  3GQ3 A;  4DR4 M;  1J09 A;  2UXB M;  1R4G A;  3JR4 A;  2FFJ A;  4B7G A;  4EIW A;  4NL4 H;  2CWB A;  2MGW A;  2LNH C;  3HU1 A;  2I7P A;  3AOE C;  3LQR A;  3IG8 A;  4JI4 M;  3U6S A;  4G4R A;  3A46 A;  3U60 B;  4JI8 M;  2ZAO A;  1XC8 A;  2VQE M;  3GP1 A;  1DGF A;  4GKJ M;  3U5Z B;  4JI1 M;  3U61 A;  3VKH A;  4CGY B;  1XXH E;  4JN6 A;  4LJ4 A;  2F5P A;  1GL7 A;  2EJS A;  2R45 A;  3PFI A;  1WIV A;  1GJS A;  1E9S A;  1T3T A;  2X4A A;  3LCV B;  2E5L M;  2F5N A;  5KPT A;  1IXZ A;  2HAK A;  4FCW A;  2DZO B;  4RF1 A;  4UN2 B;  3SAV A;  5EP1 A;  1G41 A;  3HHW A;  1N36 M;  3CF2 A;  2K47 A;  3SMP A;  3UZU A;  4WW0 A;  4PDG A;  3I4Y A;  7CAT A;  1N78 A;  1QAM A;  3I04 M;  2W82 A;  1NJG A;  2BWB A;  3QYE A;  1D0L A;  1QUT A;  2VDB B;  5LMU M;  1K3W A;  1UFZ A;  5KPZ A;  1Q02 A;  1S3S A;  1K3X A;  4DUZ M;  1R7R A;  1YSY A;  2WSF F;  3QYB A;  1D0K A;  4CHT B;  3F92 A;  3GLH A;  5EP2 A;  3PNV A;  4A3V B;  5KQ8 A;  4DR2 M;  1DGH A;  1JR3 A;  2VF7 A;  3OTO M;  4G4O A;  2Y21 A;  4DUY M;  2L09 A;  5F3W A;  3A98 B;  1R5L A;  4LFC M;  3KP0 E;  2UUB M;  3SHG B;  3DOA A;  2LVA A;  3KS4 A;  4DV3 M;  3T38 A;  4AKI A;  2XF3 A;  3SMS A;  1L2D A;  3U6P A;  2J5Y A;  3U61 B;  2HHH M;  1OFI A;  5ITQ A;  2X49 A;  1Y8G A;  3L25 A;  1NO1 A;  2WSC F;  4FW9 A;  3W0L B;  5LMN M;  1MX0 A;  3B89 A;  3FUU A;  4NC6 A;  5FLX S;  1OJL A;  3AKZ A;  1YLA A;  4KT0 F;  3W67 A;  1XNR M;  1NJF A;  4LG2 A;  1IN6 A;  5EXP A;  2CEA A;  4W5W A;  2F5O A;  3M6A A;  4DV1 M;  2DWZ B;  4IBF A;  1N33 M;  3KOX E;  3Q8G A;  5DYG A;  4LGY A;  1R2Z A;  3TWL A;  5EXX A;  2BWE A;  1PJS A;  1QZE A;  1E94 E;  4FCT A;  2M60 A;  4JI6 M;  2X8A A;  1XWI A;  3NBI A;  1PJJ A;  3DZD A;  1NVM A;  1OIZ A;  3LMM A;  3GLG B;  3U6L A;  4L4U A;  1OQY A;  3LW5 F;  1DGH B;  1VDD A;  2DKL A;  3JAM S;  1HNZ M;  4Z8X A;  3RE8 A;  3GQ5 A;  4IJE A;  2KXE A;  4GRI A;  3U6Q A;  4AI6 A;  2UU9 M;  1ZAE A;  2JY5 A;  3IEC A;  3FUT A;  3VK8 A;  5ITY A;  4MM3 B;  4JI0 M;  4L16 A;  3GLG E;  2GNO A;  3FUV A;  4DR6 M;  1TGU A;  3FD9 A;  4AZF A;  4DV6 M;  5EJC A;  3SFZ A;  1SXJ B;  4IBC A;  2DHR A;  1IXS B;  2I7N A;  2FS1 A;  2FNA A;  4Q7J A;  5IRE B;  4DR3 M;  4R7G A;  2UUC M;  1F4I A;  2K9D A;  5EP3 A;  3VLF B;  3HJ8 A;  1BVS A;  3EIH A;  3GLI B;  1SXJ E;  4FWG A;  2R46 A;  4L15 A;  3QAU A;  3EIE A;  1Z6T A;  4F2L A;  4GMQ A;  1HT1 E;  3I01 M;  3UMM A;  3U6E A;  2CV1 A;  1SXJ D;  2L2D A;  3K9O A;  4M9Z A;  5JI3 E;  3FTE A;  2NQ8 C;  2XSZ D;  3AJI B;  2ZTC A;  1D2N A;  3GLI E;  4QHT A;  4YY3 M;  3T15 A;  2HCB A;  2XGN A;  4IIW A;  3PXG A;  4LRS A;  3VK7 A;  2YR0 A;  1ZV1 A;  1JB0 F;  2QBY B;  4CJ6 A;  2EUC A;  2L7H A;  1EE8 A;  4DBG B;  3WHL A;  2MH8 A;  1WJ7 A;  1LV7 A;  2ZAN A;  3THG A;  4DV7 M;  3GRY A;  4CIZ A;  3GPP A;  3W0F A;  4L78 A;  3C58 A;  1IN4 A;  3WHK A;  1L2B A;  1TH3 A;  3V76 A;  1NHW C;  1XXH A;  5KQD A;  4I81 A;  5EXS A;  2KW0 A;  3ZQJ A;  4FVM A;  2UXD M;  3RGS A;  1UM8 A;  1I4W A;  1KFV A;  4BLC A;  3HHY A;  4NXM M;  4LFB M;  2XLJ A;  1OAI A;  3KVW A;  4G4N A;  2C5R A;  4GIT A;  3LQQ A;  3SYK A;  2DWL A;  4I5S A;  2LVQ D;  4LJ9 A;  1GL6 A;  3K92 A;  2DAE A;  4WUR A;  4KHP M;  3AV0 A;  3GRV A;  4QOS A;  1G71 A;  3D8B A;  3FRH A;  3RGP A;  2D7E A;  1XMQ M;  3E4R A;  3TQS A;  5ITU A;  3KSJ A;  4I4L A;  4NSO B;  2XFS A;  2WSE F;  2BNK A;  1PJT A;  3J27 B;  1I94 M;  4JYA M;  3UK6 A;  1WHC A;  2XZF A;  4OVZ A;  1NV8 A;  1IQP A;  5IWA M;  1OTR A;  2FH0 A;  3UGJ A;  2RGH A;  3L27 A;  1GO5 A;  2UUA M;  1G3I A;  2LWX A;  2QHO B;  1G59 A;  3TWK A;  5ITX E;  2UXC M;  4JI5 M;  4R71 A;  1WGL A;  4OW0 A;  2V1C A;  5EP4 A;  5ITT A;  5EXT A;  1CUK A;  4KOD A;  3HU3 A;  2XEP A;  2JZ0 A;  4XGI A;  4AW4 A;  1OIP A;  2QZ4 A;  2JA2 A;  3LCU A;  2L4E A;  2LHG A;  2DZN B;  2Z4S A;  4NXN M;  1DGB A;  4LZJ A;  3U6C A;  4B7H A;  5BR8 M;  2P5T A;  3B9P A;  3LVV A;  1C7Y A;  4B3S M;  3MMP A;  3C3E A;  3GPX A;  1L1Z A;  3FUW A;  4NSR A;  2V6Z M;  4P17 A;  2R62 A;  4RKU F;  5E6J A;  3SYL A;  1GKI A;  3FTF A;  1HNX M;  4AG5 A;  2C96 A;  4LF4 M;  1IXR C;  1SG9 A;  2JWS A;  1L8Q A;  4GKK M;  2DAG A;  4RF0 A;  1GVN A;  2Y0Q A;  3J2P B;  3NBX X;  4LF5 M;  2N35 A;  4R3D A;  3SAR A;  3CF0 A;  2XFT A;  1G4A E;  4MB7 A;  3B74 A;  2HKJ A;  3KW6 A;  4QHS A;  5FTM A;  2DEN A;  4IBJ A;  2CFO A;  2LVO C;  1KSF X;  2DWN A;  2CUZ A;  2J7O A;  3K8Z A;  1HJP A;  4LY6 A;  4ITQ A;  1IM2 A;  4DV4 M;  4CIS A;  5FTL A;  1IN8 A;  2QCU A;  3MHV C;  3MK6 A;  3T6P A;  3GLF A;  1W5T A;  3FE3 A;  1IFY A;  1QVR A;  3IHP A;  3SAT A;  1NY5 A;  2C98 A;  2C9O A;  1IY2 A;  2Z7J A;  2CRU A;  3JR5 A;  1IBK M;  3GLH B;  2GQF A;  3KDS E;  1XMO M;  2O01 F;  2XZU A;  3B7N A;  1HNW M;  3L2A A;  1NNU C;  1DO0 A;  5IZ7 D;  4X64 M;  2Z4R A;  3A45 A;  2ERC A;  2LH0 A;  3FYC A;  3SAW A;  2KHH A;  4MGK E;  3GLH E;  1TF0 B;  1TH2 A;  4M9S A;  3CTW B;  1VEK A;  3FUX A;  4X66 M;  4M0W A;  2WZJ A;  3GPY A;  4NRV A;  1QAQ A;  1NY6 A;  1VDL A;  1JR3 D;  2O5R A;  2F4V M;  4DR5 M;  2QPA A;  2MJ5 B;  1RU3 A;  5JI2 E;  4LFA M;  1JQJ C;  3KOZ E;  4B3M M;  1R6B X;  2LVP C;  4GHA A;  4DR7 M;  4GH9 A;  4PDI A;  1HQY E;  3HKP A;  3AOG A;  2ZTD A;  3NWL A;  2KRK A;  3E46 A;  1PJI A;  3KOY E;  2R44 A;  2ZAM A;  4I8O A;  2DI0 A;  4IJF A;  3SHF A;  4HLQ A;  3DA1 A;  2XH9 A;  1D0M A;  4KO8 A;  3W68 A;  4L6V 6;  2HL7 A;  5L8R F;  5A2Q S;  3GPU A;  3HHZ A;  1P3Q Q;  2QP9 X;  4B7F A;  2G8L A;  3DFZ A;  4D80 A;  1IN5 A;  4S12 A;  1V33 A;  3U6M A;  1IBL M;  1Z59 A;  1FNN A;  2L4F A;  2VF8 A;  2KZS A;  1ZMU A;  4DV2 M;  2CHQ A;  3SAU A;  1N75 A;  1VG5 A;  4HEO A;  2R4J A;  5FTK A;  1C1K A;  1L1T A;  4Y28 F;  1Q3B A;  3HZJ A;  4LGM A;  1N34 M;  1OFH A;  4LJ6 A;  1J5E M;  3AOE A;  3A42 A;  2BJW A;  2D7H A;  3U60 A;  1HQC A;  1TH4 A;  1DV0 A;  2OOB A;  4DR1 M;  3BBZ A;  1QUS A;  1Z5A A;  2JY7 A;  2Z3X A;  3Q8X A;  4GEW A;  3VDP A;  3GQ4 A;  1N32 M;  3KXE C;  4AQY M;  3U5Z A;  3CGW A;  2B3T A;  2C9C A;  3M7G A;  4FWH A;  4LF7 M;  3SBJ A;  3T1H M;  2LXE A;  1E32 A;  2DAI A;  1MJG M;  3FTC A;  1IBM M;  3B7Q A;  4LJA A;  2F5Q A;  1VEJ A;  3K2L A;  4IBE A;  4ZPX A;  4FWD A;  3HU2 A;  2J7N A;  2LBC A;  3E21 A;  4REZ A;  1J7K A;  4X65 M;  1AIP C;  2OO9 A;  1L2C A;  1TR8 A;  2L7I A;  3LVW A;  1TDZ A;  1MU5 A;  4NOO B;  2ZBK B;  2QEN A;  3I4V A;  1XNQ M;  1ZMV A;  4II7 A;  2G5G X;  4PCZ A;  4M0D A;  4IBI A;  1XXH B;  3VDU A;  4NRW A;  1VEG A;  3ZH9 B;  2KRU A;  3HJQ A;  2BJV A;  2DNA A;  2DAM A;  4FD2 A;  2L6O A;  2KDL A;  3FTD A;  4P16 A;  2Y0T A;  4F1I A;  3L28 A;  3KSX A;  2D7G A;  3GRR A;  4G6Z A;  3GRU A;  3KP1 E;  1AUA A;  2LVN C;  2R65 A;  3HX3 A;  4PT5 A;  2K0B X;  3PNY A;  1XHB A;  3B7Z A;  3HJS A;  4GHL A;  4TUW A;  2JUJ A;  2JP7 A;  2EA0 A;  5IT9 S;  1EIJ A;  2CE7 A;  2FE8 A;  3HY5 A;  3KOW E;  8CAT A;  2H5X A;  1IN7 A;  5FTJ A;  4AKH A;  2V1U A;  2C99 A;  4IBB A;  1FJG M;  2DHY A;  4JI7 M;  4OVZ B;  3L29 A;  2EO2 A;  3L26 A;  4HL4 A;  4JI2 M;  4BBA A;  2APL A;  5FSW A;  4LJ5 A;  4LRT A;  2Y20 A;  3IG5 A;  4KLN A;  1WXQ A;  2JY6 B;  3GLG A;  4BB9 A;  4GC9 A;  1QDR A;  4JI3 M;  1NSF A;  3MJ5 A;  2KA6 B;  5C1B A;  1ZMW A;  1QAO A;  3J7A S;  1K82 A;  3K1J A;  3H4J A;  3ZCB B;  2DXI A;  4B3R M;  5DFL A;  2OPF A;  1VQ1 A;  1NNJ A;  5EQT A;  2R0I A;  4X62 M;  1KYI A;  4MGI E;  4D82 A;  4MGH A;  2JNH A;  1IY1 A;  2HWJ A;  3UJN A;  3J81 S;  3U6O A;  1SXJ A;  4G4Q A;  2RKO A;  2XSZ A;  1IXS A;  3AFH A;  2F5S A;  1QDT A;  1E9R A;  3KS8 A;  4DV5 M;  3TE6 A;  3RFW A;  1GJT A;  1MN3 A;  3SAS A;  4PD2 A;  4K0K M;  1N77 A;  3GLI A;  5GKN A;  1TDH A;  2JXN A;  2KNZ A;  1ORY B;  1JR3 E;  4LZZ A;  4JV5 M;  1WGN A;  5FTN A;  5H37 D;  1NV9 A;  5KO3 A;  3K9P A;  4IBK A;  2VII A;  1XB2 B;  3QWL A;  4OX9 M;  1T6O A;  3C9P A;  2DAK A;  3FYD A;  1WR1 B;  3FRI A;  5BPV A;  4OU7 A;  2OQ4 A;  4AKG A;  4MGY E;  5E26 A;  4XK8 F;  4IBG A;  2R18 A;  2LTU A;  3TPZ A;  1ZQ9 A;  2QBY A;  5DYI A;  4Z6Y A;  3KFU G;  3E9S A;  1OKS A;  3I51 A;  2AHM A;  2VQF M;  1QZM A;  4GC5 A;  2KZU A;  4AG6 A;  4G3O A;  3SC3 A;  2MR9 A;  3GLF B;  4LJ7 A;  2KEB A;  2LHC A;  1PJQ A;  4MH0 E;  2JY8 A; 
#chains in the Genus database with same CATH homology
 2DAI A;  2JZ0 A;  3LCU A;  2OOA A;  1VEJ A;  2L4E A;  3GLF E;  1C7Y A;  2LBC A;  3E21 A;  2BWE A;  1AIP C;  1QZE A;  1E94 E;  2OO9 A;  1TR8 A;  3MMP A;  1SG9 A;  1OQY A;  2DAG A;  2DKL A;  2EKF A;  1ZMV A;  2EKK A;  2G3Q A;  2O25 A;  2QNJ A;  2JY5 A;  3IEC A;  1G4A E;  1VEG A;  3GLG E;  2DNA A;  2DAM A;  2DEN A;  1TTE A;  2MRO B;  2RRU A;  4F1I A;  2LVO C;  2CP8 A;  2KNA A;  2DZL A;  1HJP A;  4Q7J A;  1IM2 A;  1EFU B;  1V92 A;  1PGY A;  2LVN C;  1DO2 A;  2K9D A;  3T6P A;  2K0B X;  3FE3 A;  1F4I A;  1IFY A;  3IHP A;  4WP2 A;  1BVS A;  2QSF X;  2JUJ A;  1HT2 E;  2JP7 A;  1T43 A;  2JZ1 A;  4F2L A;  2KNV A;  2H5X A;  1HT1 E;  1A5T A;  2L2D A;  3K9O A;  1R4G A;  2DHY A;  2ZTC A;  2CWB A;  2MGW A;  1DO0 A;  3GLI E;  2KHH A;  1ZV1 A;  3GLH E;  1VEK A;  2JY6 B;  4DBG B;  1WJ7 A;  2WZJ A;  1ZMW A;  1VDL A;  1XXH E;  3H4J A;  5DFL A;  2JY8 A;  1VQ1 A;  2EJS A;  2MJ5 B;  2R0I A;  1KYI A;  1WIV A;  3LCV B;  5JI2 E;  2JNH A;  2HAK A;  2HWJ A;  2LVP C;  4UN2 B;  1G41 A;  1HQY E;  2ZTD A;  1IXS A;  1OAI A;  3E46 A;  2DI0 A;  2LVQ D;  2DAE A;  2BWB A;  1MN3 A;  1P3Q Q;  1UFZ A;  3FRH A;  1Q02 A;  2KNZ A;  2L4F A;  1JR3 E;  1ZMU A;  1WGN A;  1VG5 A;  1NV9 A;  4HEO A;  3F92 A;  3K9P A;  1XB2 B;  1T6O A;  1WHC A;  2DAK A;  1NV8 A;  2LVA A;  1WR1 B;  3FRI A;  1OTR A;  2LTU A;  1DV0 A;  2OOB A;  3BBZ A;  2JY7 A;  1GO5 A;  1G3I A;  4GEW A;  1OKS A;  1Y8G A;  2QHO B;  2B3T A;  4G3O A;  3B89 A;  4R71 A;  1WGL A;  2MR9 A;  1YLA A;  1CUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...