2LVQD

Gp78cue domain bound to the proximal ubiquitin of k48-linked diubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
b'SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
molecule tags Signaling protein/ligase
source organism Homo sapiens
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
total genus 16
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvqD00
2JZ1A 3FRIA 2K0BX 1OKSA 3IHPA 1KYIA 3E21A 1ZMUA 2R0IA 2QNJA 2BWBA 3H4JA 1XXHE 1NV8A 2DNAA 2JY5A 2KNAA 2MGWA 1C7YA 3F92A 2JY6B 1UFZA 2B3TA 2EJSA 2G3QA 1G3IA 4UN2B 2ZTDA 1E94E 3K9OA 1EFUB 2RRUA 2WZJA 1JR3E 2JUJA 1WGLA 2KNVA 4Q7JA 2LVNC 2QSFX 3E46A 1XB2B 1VDLA 2DENA 1HT1E 2K9DA 1ZMWA 1IM2A 2DKLA 3K9PA 1CUKA 1Y8GA 1VEJA 2DI0A 2H5XA 2QHOB 2L4EA 2L4FA 3LCVB 1P3QQ 1GO5A 1OQYA 2HAKA 2DAKA 2JNHA 3B89A 1WIVA 2LVOC 1F4IA 1DO2A 2DAIA 4DBGB 2DAGA 1R4GA 3GLHE 1Q02A 1HT2E 2O25A 1DO0A 2DAMA 2CWBA 2EKKA 2OO9A 1SG9A 2KNZA 3FRHA 1NV9A 1BVSA 1VEGA 2LVAA 4G3OA 1PGYA 1VQ1A 1ZV1A 2CP8A 2MROB 2MJ5B 1WJ7A 5DFLA 1G4AE 4WP2A 2EKFA 1DV0A 1G41A 1OTRA 2JY7A 2JY8A 1OAIA 3IECA 3LCUA 1IFYA 2MR9A 2LTUA 3T6PA 1TTEA 1WGNA 1A5TA 2L2DA 4R71A 2OOBA 1YLAA 2DAEA 2DZLA 2JP7A 2LVPC 4HEOA 2JZ0A 1AIPC 3GLFE 2OOAA 2HWJA 2BWEA 1HQYE 1VG5A 5JI2E 1T43A 2LVQD 2KHHA 1MN3A 1TR8A 1WR1B 3GLGE 1T6OA 4F1IA 1QZEA 3GLIE 1V92A 2LBCA 1ZMVA 3MMPA 4GEWA 1WHCA 3BBZA 1IXSA 1VEKA 3FE3A 2DHYA 4F2LA 1HJPA 2ZTCA
chains in the Genus database with same CATH superfamily
2JZ1A 1OKSA 2KXEA 4CISA 2LWXA 1IXZA 1ZMUA 4YHHM 3TL4X 2WSCF 4JI5M 2L7HA 3CF6E 2QNJA 2BWBA 2UXDM 1HNZM 1D2NA 1TDHA 3AOGA 1L8QA 1E9SA 3FUVA 2JY5A 4I8OA 4BBAA 3LQQA 2CHGA 1QANA 4KODA 3JAMS 4WW0A 1GL7A 4PDIA 3FUWA 3A45A 2WSFF 1JQJC 4XGIA 4PD2A 4UN2B 1IY0A 2W82A 4KO8A 3GPPA 3THGA 4KT0F 3HHYA 1NHWC 3FTDA 1D0LA 4BLCA 1PJIA 5IWAM 2Z4RA 4IJEA 1LV7A 1MU5A 1WGLA 1QZMA 3HHWA 1T3TA 3KOXE 3J7BA 4R3DA 2KNVA 3KW6A 3HX3A 3HWSA 3V76A 5BR8M 2EUCA 5KPRA 1D0KA 3GRVA 4I81A 2YNMD 4B3RM 3SYLA 1IN4A 2RKOA 4NC6A 4AQYM 4LJ8A 4LF5M 4MGZE 3GQ5A 2A5YB 1ZMWA 3IG8A 4GRIA 2QCUA 1YSYA 1IM2A 2DKLA 2R18A 5ITYA 3UZUA 3W0FA 1IXSB 3EIHA 3U60A 2DI0A 4GHLA 2L4FA 3ZQJA 4JV5M 2JNHA 2WSEF 5EXPA 1VDDA 3B9PA 3KS4A 4G4NA 2LVOC 4GMQA 4LG2A 5FTKA 2I7PA 3TPZA 3QAUA 3B7QA 1HT2E 4DR4M 4NL4H 4CIZA 3MHVC 4DR3M 3T15A 1TDZA 2OO9A 2KRKA 2Y20A 1GABA 2ZAOA 2C98A 2FFJA 1NY6A 2KW0A 1I94M 2CUZA 1BVSA 2OPFA 1QAMA 2UUCM 2CV1A 1ZV1A 5E26A 1Q39A 2OQ4A 1XC8A 1QYRA 4II7A 3GP1A 1L2DA 3HHZA 5IT9S 1XWIA 2F4VM 2EKFA 2H1RA 3WHLA 1DGBA 2XFSA 2C9OA 5KQDA 1R2ZA 2F5OA 4DUYM 4AG6A 3IECA 1IFYA 4W5WA 4X64M 3U6SA 5EXXA 4LRSA 2MR9A 2LTUA 2G5GX 2FS1A 1DGFA 2CEAA 4FW9A 3TE6A 1R6BX 2DAEA 2NQ8C 2ZANA 3FUTA 1IN8A 3J27B 2X4AA 4GIPA 3FKEA 2N35A 2FNAA 1VG5A 4IBEA 3T1YM 1R2YA 3D8LA 5KQ8A 4LGYA 4G6ZA 1IY2A 3GLGE 4AKGA 3K8ZA 4B7FA 4JI6M 4NSOB 1K82A 3W67A 1IN7A 2R6FA 3I04M 3K2LA 1JB0F 1I4WA 2K47A 1PJQA 4FCWA 1VEKA 1NY5A 1OAOC 3PFIA 4LJ4A 4FVMA 3T1HM 1QQWA 2UUAM 4I4LA 2KZUA 3A98B 1SXJA 3FRIA 2K0BX 4IBGA 3I51A 1KYIA 3E21A 2BNKA 3LVWA 4L6V6 2R0IA 4IBJA 3SASA 4LF4M 4OU7A 1XXHE 1QAQA 4IBCA 4IBIA 4LJ5A 1J7KA 1HR0M 1NV8A 2F5SA 4JYAM 4JI0M 1QUSA 4PDGA 4AKIA 2R62A 5ITUA 2C99A 3F92A 5E6JA 1Z59A 4NRVA 1GJSA 2C9CA 2B3TA 4GHAA 1ZQ9A 3DFZA 1G3IA 2DZOB 1FNNA 2RGHA 4NSRA 4IBKA 4QNRA 1K3WA 4K0KM 1E94E 5ITXE 3GQ3A 5LMNM 1EFUB 2DWNA 2YR0A 3I4YA 3B7ZA 3NBXX 1MJGM 3R8FA 1EE8A 4LJ9A 3SMSA 2XEPA 2KEBA 3E46A 1TH3A 3KOWE 4DV4M 3U6QA 3SAWA 2HKJA 5ITTA 3M0EA 1SXJB 2UUBM 4MGHA 1Z5CA 4NOOB 3KDSE 2CRUA 3GRUA 1HNWM 4QNMA 3SARA 3BOSA 2JXNA 1SXJE 1KSFX 2Z8YM 1QVRA 3PNYA 4QOSA 2L09A 3GLHA 1IN6A 1OQYA 2HAKA 3KOZE 2DAKA 3SC3A 3B89A 2G8LA 2F5QA 4WURA 5C18A 3FTFA 1F4IA 4DBGB 4CHTB 3U6MA 5EP2A 2DAGA 1R4GA 2XH9A 4PT5A 3QYEA 3L27A 4GITA 3CF0A 4JI4M 4NXNM 5DNYA 2P5TA 2KDLA 3FTEA 1L2CA 3KP1E 3A46A 3GLGA 3SFZA 2APLA 2ZBKB 1NV9A 4YY3M 3GLHB 3SBJA 1ORYB 2LVAA 4OW0A 1Q3BA 5ITRA 2HCBA 2KRUA 2R46A 2MJ5B 4FWGA 3GLFA 5DFLA 4FD2A 4A3VB 1TGUA 1IBMM 4KHPM 5EP4A 4GH9A 4REZA 2JY7A 1KFVA 1PJSA 2V6ZM 3AJIB 3W68A 1C1KA 4EIWA 3UK6A 2Y0QA 3U5ZB 1OAIA 3SHFA 5C1BA 2DWLA 3HHXA 4FCVA 4JI7M 1WGNA 4JXJA 2L6OA 3WHKA 2ERCA 2LVPC 2DZNB 3I01M 4M0DA 1AIPC 2M5ZA 3GLIA 4IJFA 3MJ5A 3FTCA 5F3WA 2VF7A 4LFAM 3RFWA 1T43A 1GVNA 2VF8A 3FUUA 3LQRA 2KHHA 1TR8A 1WR1B 4MM3B 4MGIE 3VK8A 4F1IA 1NHGC 4DV1M 2Z7JA 4M9SA 3NWLA 3MK6A 4D82A 2R4JA 2F5PA 2DWMA 4GC9A 4G4QA 1N33M 1JR3D 1JR3A 3U60B 3BBZA 1IXSA 1W5SA 3JR4A 1L1TA 1N36M 1S3SA 2XGNA 1PRBA 2O5RA 4F2LA 3R9XB 3QWLA 3IHPA 4CGYB 3J7AS 1TH2A 2DVWB 3ZH9B 3K1JA 3UJNA 1MX0A 1W5TA 2QENA 3JR5A 2QZ4A 2J7OA 3AKZA 4B3SM 2LH0A 4RF0A 1GJTA 2QBYB 3KSJA 2VQFM 5DYGA 4ANRA 4L15A 2DNAA 4CJ6A 1NJFA 2KZSA 2CHVA 2MGWA 5FLXS 1C7YA 3KS8A 2JY6B 4IBFA 2VQEM 4B3MM 1AUAA 3ILKA 2J5YA 2EJSA 2Y0TA 1X37A 1J09A 1N75A 3HU2A 4G4RA 3ZC7B 2F5NA 3UGJA 4JI3M 3HGIA 1K3XA 2RRUA 2WZJA 3RE8A 1JR3E 2LHGA 4FWDA 2JUJA 1TH4A 3Q8GA 3IG5A 3SHGB 4L4UA 4Z8XA 3T38A 2UXBM 2QQ8A 4D80A 3KP0E 3FUXA 1IBLM 3CTWB 2EO2A 4JI1M 4DV0M 2LVNC 2QSFX 4FCTA 1XNRM 1XB2B 3HJQA 2XZUA 1DGHB 1VDLA 2DENA 2Y21A 3J2PB 4DV5M 3KXEC 1R5LA 3HU1A 4D81A 2BJWA 2JWSA 3E9SA 1GKIA 3RGPA 3K92A 4OVZB 1E32A 2O01F 3VLFB 2XLJA 3SMPA 3OTOM 1Y8GA 3GPXA 5FTNA 4GKKM 1VEJA 2YQZA 3J80S 2H5XA 3H4MA 2R44A 4Z6YA 5L8RF 2L4EA 4B3TM 1N32M 1P3QQ 2XSZA 4L78A 1FJGM 4BB9A 3GQ4A 2R4EA 3A42A 2XFTA 4G4OA 3TWKA 1DO2A 2D7HA 3C3EA 4RKUF 1SXJD 2GQFA 2O25A 1DO0A 1G59A 2M60A 3AV0A 1DGHA 2R65A 4LY6A 3AL0C 5ITQA 1DGGA 1QAOA 1J5EM 1D0MA 4TUWA 4AG5A 4P17A 3E4RA 1VEGA 5EP1A 3PVSA 4M9ZA 2QBYA 1QUTA 3FD9A 1PJJA 1PGYA 3UMMA 3RGSA 5A2QS 2MROB 1YE9A 2UU9M 1EIJA 3KOYE 1WJ7A 2I7NA 3TQSA 1IY1A 3DOAA 4IBDA 4WP2A 5IZ7D 2EA0A 4GKJM 1OTRA 4HL4A 5H37D 4L8RC 3DA1A 4I5SA 2X49A 3GLIB 3U6PA 5KO3A 1Z6TA 4LF6M 3SAVA 4KLNA 3GPUA 3T6PA 1N34M 3KFUG 3VDPA 3KSXA 2FOIC 2L2DA 2X8AA 1Z5AA 2K6BA 1YLAA 2JP7A 2OOBA 5JI3E 3GLFE 3M7GA 2C5RA 4LF8M 2AHMA 2VDBB 3M6AA 3HJ8A 3HJSA 3NBIA 2QP9X 4X62M 3C58A 1V34A 4ITQA 4JI2M 4LJAA 1MN3A 4DR6M 1NNUC 1IBKM 1Q3CA 1QZEA 4JN6A 3SYKA 3GLFB 2LBCA 2LXEA 1LTMA 1ZMVA 4DR5M 4AI6A 3MMPA 1IXRC 3LVVA 4LF7M 3D8BA 5KPTA 1WHCA 2ZM6M 2CFOA 2JA2A 5EXSA 3L25A 2CHQA 4LFCM 4QHSA 3GLGB 4LF9M 1GLNA 4LJ7A 5ITXA 2DHYA 1NVMA 2ZTCA 3FYDA 3W0LB 1G71A 4LGMA 2LNHC 2HL7A 3L28A 5FTLA 4R7GA 1PJTA 4NRWA 3U6EA 4ZPXA 3SATA 2UXCM 2XSZD 3H4JA 1HJPA 1NNJA 1QDTA 3QYBA 3KVWA 5KPZA 3U6OA 2KNAA 2GNOA 1XXHA 3B74A 3U5ZA 4OX9M 1UFZA 3AOEC 4LRTA 1OFHA 3LMMA 4AW4A 3HKPA 3EIEA 4S12A 1HNXM 2G3QA 2V1UA 3AFHA 1YUBA 1OFIA 2ZTDA 4LCBA 2VIIA 1HQCA 1NO1A 3K9OA 8CATA 1IQPA 1XHBA 3L2AA 2C96A 4GC5A 4XK8F 2HHHM 2DXIA 3U61A 4MB7A 3ZCBB 3Q8XA 1XMOM 4M0WA 4LFBM 1WXQA 4DR2M 4Q7JA 3C3DA 5IREB 3L26A 4B7HA 2D7GA 3VKGA 1HT1E 2K9DA 1IN5A 2FH0A 4QHTA 3VDUA 1TF0B 4L16A 4P16A 3U6LA 3K9PA 2CV2A 1CUKA 2MH8A 1GL6A 4RF1A 2QHOB 4DR7M 3BXWA 1L2BA 1XNQM 5LMUM 3LCVB 1GO5A 1N78A 4X65M 2DWZB 1SXJC 2BJVA 2V1CA 4Y28F 1PM5A 1WIVA 2R45A 4RNAA 2DAIA 4AKHA 3GLHE 2Z3XA 1Q02A 2ZAMA 2DAMA 5EJCA 1NSFA 2CWBA 2EKKA 1OJLA 1XMQM 3J81S 3GRRA 1L1ZA 2QPAA 3AOEA 1SG9A 3I4VA 4FWHA 2KNZA 3FRHA 3HY5A 3VKHA 2D7EA 3C9PA 3CF2A 5GKNA 3U6CA 3VK7A 4G3OA 2CP8A 1V33A 1VQ1A 4AZFA 1RU3A 4DV6M 3GPYA 1OIPA 2LHCA 1G4AE 5FTMA 4PCZA 2RGOA 1DV0A 2DHRA 4XBOA 1G41A 1QDRA 3TWMA 3VFDA 1NJGA 4LZJA 3LW5F 2J7NA 2JY8A 4NXMM 3LCUA 3TWLA 1E9RA 3SAUA 3PXGA 2FE8A 4QOZC 1OIZA 1TTEA 4M9XA 1H6UA 2XF3A 4IIWA 1A5TA 1G8PA 5DYIA 4LJ6A 4R71A 3U61B 2XZFA 2DZLA 4HEOA 5FTJA 4MGYE 2JZ0A 1Z5BA 2HWJA 2OOAA 7CATA 2CV0A 2BWEA 4HLQA 2Q2EB 1HQYE 3HZJA 5JI2E 4DV7M 5EP3A 3GRYA 4DUZM 2LVQD 2YFQA 5EQTA 4MH0E 5BPVA 1T6OA 3FYCA 3GLIE 3CGWA 4JI8M 1V92A 2L7IA 4X66M 3U6DA 5FSWA 4IBBA 4DR1M 3HU3A 1N77A 3L29A 2KA6B 4GEWA 1XXHB 2E5LM 4LZZA 3PNVA 2Z4SA 3B7NA 4B08A 4B7GA 4DV2M 1UM8A 4MGKE 5EXTA 3FE3A 4DV3M 3GO8A 3DZDA 1ZAEA 4OVZA 2CE7A 1R7RA
chains in the Genus database with same CATH topology
2JZ1A 3FRIA 2K0BX 1OKSA 3IHPA 1KYIA 3E21A 1ZMUA 2R0IA 2QNJA 2BWBA 3H4JA 1XXHE 1NV8A 2DNAA 2JY5A 2KNAA 2MGWA 1C7YA 3F92A 2JY6B 1UFZA 2B3TA 2EJSA 2G3QA 1G3IA 4UN2B 2ZTDA 1E94E 3K9OA 1EFUB 2RRUA 2WZJA 1JR3E 2JUJA 1WGLA 2KNVA 4Q7JA 2LVNC 2QSFX 3E46A 1XB2B 1VDLA 2DENA 1HT1E 2K9DA 1ZMWA 1IM2A 2DKLA 3K9PA 1CUKA 1Y8GA 1VEJA 2DI0A 2H5XA 2QHOB 2L4EA 2L4FA 3LCVB 1P3QQ 1GO5A 1OQYA 2HAKA 2DAKA 2JNHA 3B89A 1WIVA 2LVOC 1F4IA 1DO2A 2DAIA 4DBGB 2DAGA 1R4GA 3GLHE 1Q02A 1HT2E 2O25A 1DO0A 2DAMA 2CWBA 2EKKA 2OO9A 1SG9A 2KNZA 3FRHA 1NV9A 1BVSA 1VEGA 2LVAA 4G3OA 1PGYA 1VQ1A 1ZV1A 2CP8A 2MROB 2MJ5B 1WJ7A 5DFLA 1G4AE 4WP2A 2EKFA 1DV0A 1G41A 1OTRA 2JY7A 2JY8A 1OAIA 3IECA 3LCUA 1IFYA 2MR9A 2LTUA 3T6PA 1TTEA 1WGNA 1A5TA 2L2DA 4R71A 2OOBA 1YLAA 2DAEA 2DZLA 2JP7A 2LVPC 4HEOA 2JZ0A 1AIPC 3GLFE 2OOAA 2HWJA 2BWEA 1HQYE 1VG5A 5JI2E 1T43A 2LVQD 2KHHA 1MN3A 1TR8A 1WR1B 3GLGE 1T6OA 4F1IA 1QZEA 3GLIE 1V92A 2LBCA 1ZMVA 3MMPA 4GEWA 1WHCA 3BBZA 1IXSA 1VEKA 3FE3A 2DHYA 4F2LA 1HJPA 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZ1 A;  3FRI A;  2K0B X;  1OKS A;  3IHP A;  1KYI A;  3E21 A;  1ZMU A;  2R0I A;  2QNJ A;  2BWB A;  3H4J A;  1XXH E;  1NV8 A;  2DNA A;  2JY5 A;  2KNA A;  2MGW A;  1C7Y A;  3F92 A;  2JY6 B;  1UFZ A;  2B3T A;  2EJS A;  2G3Q A;  1G3I A;  4UN2 B;  2ZTD A;  1E94 E;  3K9O A;  1EFU B;  2RRU A;  2WZJ A;  1JR3 E;  2JUJ A;  1WGL A;  2KNV A;  4Q7J A;  2LVN C;  2QSF X;  3E46 A;  1XB2 B;  1VDL A;  2DEN A;  1HT1 E;  2K9D A;  1ZMW A;  1IM2 A;  2DKL A;  3K9P A;  1CUK A;  1Y8G A;  1VEJ A;  2DI0 A;  2H5X A;  2QHO B;  2L4E A;  2L4F A;  3LCV B;  1P3Q Q;  1GO5 A;  1OQY A;  2HAK A;  2DAK A;  2JNH A;  3B89 A;  1WIV A;  2LVO C;  1F4I A;  1DO2 A;  2DAI A;  4DBG B;  2DAG A;  1R4G A;  3GLH E;  1Q02 A;  1HT2 E;  2O25 A;  1DO0 A;  2DAM A;  2CWB A;  2EKK A;  2OO9 A;  1SG9 A;  2KNZ A;  3FRH A;  1NV9 A;  1BVS A;  1VEG A;  2LVA A;  4G3O A;  1PGY A;  1VQ1 A;  1ZV1 A;  2CP8 A;  2MRO B;  2MJ5 B;  1WJ7 A;  5DFL A;  1G4A E;  4WP2 A;  2EKF A;  1DV0 A;  1G41 A;  1OTR A;  2JY7 A;  2JY8 A;  1OAI A;  3IEC A;  3LCU A;  1IFY A;  2MR9 A;  2LTU A;  3T6P A;  1TTE A;  1WGN A;  1A5T A;  2L2D A;  4R71 A;  2OOB A;  1YLA A;  2DAE A;  2DZL A;  2JP7 A;  2LVP C;  4HEO A;  2JZ0 A;  1AIP C;  3GLF E;  2OOA A;  2HWJ A;  2BWE A;  1HQY E;  1VG5 A;  5JI2 E;  1T43 A;  2LVQ D;  2KHH A;  1MN3 A;  1TR8 A;  1WR1 B;  3GLG E;  1T6O A;  4F1I A;  1QZE A;  3GLI E;  1V92 A;  2LBC A;  1ZMV A;  3MMP A;  4GEW A;  1WHC A;  3BBZ A;  1IXS A;  1VEK A;  3FE3 A;  2DHY A;  4F2L A;  1HJP A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 2JZ1 A;  1OKS A;  2KXE A;  4CIS A;  2LWX A;  1IXZ A;  1ZMU A;  4YHH M;  3TL4 X;  2WSC F;  4JI5 M;  2L7H A;  3CF6 E;  2QNJ A;  2BWB A;  2UXD M;  1HNZ M;  1D2N A;  1TDH A;  3AOG A;  1L8Q A;  1E9S A;  3FUV A;  2JY5 A;  4I8O A;  4BBA A;  3LQQ A;  2CHG A;  1QAN A;  4KOD A;  3JAM S;  4WW0 A;  1GL7 A;  4PDI A;  3FUW A;  3A45 A;  2WSF F;  1JQJ C;  4XGI A;  4PD2 A;  4UN2 B;  1IY0 A;  2W82 A;  4KO8 A;  3GPP A;  3THG A;  4KT0 F;  3HHY A;  1NHW C;  3FTD A;  1D0L A;  4BLC A;  1PJI A;  5IWA M;  2Z4R A;  4IJE A;  1LV7 A;  1MU5 A;  1WGL A;  1QZM A;  3HHW A;  1T3T A;  3KOX E;  3J7B A;  4R3D A;  2KNV A;  3KW6 A;  3HX3 A;  3HWS A;  3V76 A;  5BR8 M;  2EUC A;  5KPR A;  1D0K A;  3GRV A;  4I81 A;  2YNM D;  4B3R M;  3SYL A;  1IN4 A;  2RKO A;  4NC6 A;  4AQY M;  4LJ8 A;  4LF5 M;  4MGZ E;  3GQ5 A;  2A5Y B;  1ZMW A;  3IG8 A;  4GRI A;  2QCU A;  1YSY A;  1IM2 A;  2DKL A;  2R18 A;  5ITY A;  3UZU A;  3W0F A;  1IXS B;  3EIH A;  3U60 A;  2DI0 A;  4GHL A;  2L4F A;  3ZQJ A;  4JV5 M;  2JNH A;  2WSE F;  5EXP A;  1VDD A;  3B9P A;  3KS4 A;  4G4N A;  2LVO C;  4GMQ A;  4LG2 A;  5FTK A;  2I7P A;  3TPZ A;  3QAU A;  3B7Q A;  1HT2 E;  4DR4 M;  4NL4 H;  4CIZ A;  3MHV C;  4DR3 M;  3T15 A;  1TDZ A;  2OO9 A;  2KRK A;  2Y20 A;  1GAB A;  2ZAO A;  2C98 A;  2FFJ A;  1NY6 A;  2KW0 A;  1I94 M;  2CUZ A;  1BVS A;  2OPF A;  1QAM A;  2UUC M;  2CV1 A;  1ZV1 A;  5E26 A;  1Q39 A;  2OQ4 A;  1XC8 A;  1QYR A;  4II7 A;  3GP1 A;  1L2D A;  3HHZ A;  5IT9 S;  1XWI A;  2F4V M;  2EKF A;  2H1R A;  3WHL A;  1DGB A;  2XFS A;  2C9O A;  5KQD A;  1R2Z A;  2F5O A;  4DUY M;  4AG6 A;  3IEC A;  1IFY A;  4W5W A;  4X64 M;  3U6S A;  5EXX A;  4LRS A;  2MR9 A;  2LTU A;  2G5G X;  2FS1 A;  1DGF A;  2CEA A;  4FW9 A;  3TE6 A;  1R6B X;  2DAE A;  2NQ8 C;  2ZAN A;  3FUT A;  1IN8 A;  3J27 B;  2X4A A;  4GIP A;  3FKE A;  2N35 A;  2FNA A;  1VG5 A;  4IBE A;  3T1Y M;  1R2Y A;  3D8L A;  5KQ8 A;  4LGY A;  4G6Z A;  1IY2 A;  3GLG E;  4AKG A;  3K8Z A;  4B7F A;  4JI6 M;  4NSO B;  1K82 A;  3W67 A;  1IN7 A;  2R6F A;  3I04 M;  3K2L A;  1JB0 F;  1I4W A;  2K47 A;  1PJQ A;  4FCW A;  1VEK A;  1NY5 A;  1OAO C;  3PFI A;  4LJ4 A;  4FVM A;  3T1H M;  1QQW A;  2UUA M;  4I4L A;  2KZU A;  3A98 B;  1SXJ A;  3FRI A;  2K0B X;  4IBG A;  3I51 A;  1KYI A;  3E21 A;  2BNK A;  3LVW A;  4L6V 6;  2R0I A;  4IBJ A;  3SAS A;  4LF4 M;  4OU7 A;  1XXH E;  1QAQ A;  4IBC A;  4IBI A;  4LJ5 A;  1J7K A;  1HR0 M;  1NV8 A;  2F5S A;  4JYA M;  4JI0 M;  1QUS A;  4PDG A;  4AKI A;  2R62 A;  5ITU A;  2C99 A;  3F92 A;  5E6J A;  1Z59 A;  4NRV A;  1GJS A;  2C9C A;  2B3T A;  4GHA A;  1ZQ9 A;  3DFZ A;  1G3I A;  2DZO B;  1FNN A;  2RGH A;  4NSR A;  4IBK A;  4QNR A;  1K3W A;  4K0K M;  1E94 E;  5ITX E;  3GQ3 A;  5LMN M;  1EFU B;  2DWN A;  2YR0 A;  3I4Y A;  3B7Z A;  3NBX X;  1MJG M;  3R8F A;  1EE8 A;  4LJ9 A;  3SMS A;  2XEP A;  2KEB A;  3E46 A;  1TH3 A;  3KOW E;  4DV4 M;  3U6Q A;  3SAW A;  2HKJ A;  5ITT A;  3M0E A;  1SXJ B;  2UUB M;  4MGH A;  1Z5C A;  4NOO B;  3KDS E;  2CRU A;  3GRU A;  1HNW M;  4QNM A;  3SAR A;  3BOS A;  2JXN A;  1SXJ E;  1KSF X;  2Z8Y M;  1QVR A;  3PNY A;  4QOS A;  2L09 A;  3GLH A;  1IN6 A;  1OQY A;  2HAK A;  3KOZ E;  2DAK A;  3SC3 A;  3B89 A;  2G8L A;  2F5Q A;  4WUR A;  5C18 A;  3FTF A;  1F4I A;  4DBG B;  4CHT B;  3U6M A;  5EP2 A;  2DAG A;  1R4G A;  2XH9 A;  4PT5 A;  3QYE A;  3L27 A;  4GIT A;  3CF0 A;  4JI4 M;  4NXN M;  5DNY A;  2P5T A;  2KDL A;  3FTE A;  1L2C A;  3KP1 E;  3A46 A;  3GLG A;  3SFZ A;  2APL A;  2ZBK B;  1NV9 A;  4YY3 M;  3GLH B;  3SBJ A;  1ORY B;  2LVA A;  4OW0 A;  1Q3B A;  5ITR A;  2HCB A;  2KRU A;  2R46 A;  2MJ5 B;  4FWG A;  3GLF A;  5DFL A;  4FD2 A;  4A3V B;  1TGU A;  1IBM M;  4KHP M;  5EP4 A;  4GH9 A;  4REZ A;  2JY7 A;  1KFV A;  1PJS A;  2V6Z M;  3AJI B;  3W68 A;  1C1K A;  4EIW A;  3UK6 A;  2Y0Q A;  3U5Z B;  1OAI A;  3SHF A;  5C1B A;  2DWL A;  3HHX A;  4FCV A;  4JI7 M;  1WGN A;  4JXJ A;  2L6O A;  3WHK A;  2ERC A;  2LVP C;  2DZN B;  3I01 M;  4M0D A;  1AIP C;  2M5Z A;  3GLI A;  4IJF A;  3MJ5 A;  3FTC A;  5F3W A;  2VF7 A;  4LFA M;  3RFW A;  1T43 A;  1GVN A;  2VF8 A;  3FUU A;  3LQR A;  2KHH A;  1TR8 A;  1WR1 B;  4MM3 B;  4MGI E;  3VK8 A;  4F1I A;  1NHG C;  4DV1 M;  2Z7J A;  4M9S A;  3NWL A;  3MK6 A;  4D82 A;  2R4J A;  2F5P A;  2DWM A;  4GC9 A;  4G4Q A;  1N33 M;  1JR3 D;  1JR3 A;  3U60 B;  3BBZ A;  1IXS A;  1W5S A;  3JR4 A;  1L1T A;  1N36 M;  1S3S A;  2XGN A;  1PRB A;  2O5R A;  4F2L A;  3R9X B;  3QWL A;  3IHP A;  4CGY B;  3J7A S;  1TH2 A;  2DVW B;  3ZH9 B;  3K1J A;  3UJN A;  1MX0 A;  1W5T A;  2QEN A;  3JR5 A;  2QZ4 A;  2J7O A;  3AKZ A;  4B3S M;  2LH0 A;  4RF0 A;  1GJT A;  2QBY B;  3KSJ A;  2VQF M;  5DYG A;  4ANR A;  4L15 A;  2DNA A;  4CJ6 A;  1NJF A;  2KZS A;  2CHV A;  2MGW A;  5FLX S;  1C7Y A;  3KS8 A;  2JY6 B;  4IBF A;  2VQE M;  4B3M M;  1AUA A;  3ILK A;  2J5Y A;  2EJS A;  2Y0T A;  1X37 A;  1J09 A;  1N75 A;  3HU2 A;  4G4R A;  3ZC7 B;  2F5N A;  3UGJ A;  4JI3 M;  3HGI A;  1K3X A;  2RRU A;  2WZJ A;  3RE8 A;  1JR3 E;  2LHG A;  4FWD A;  2JUJ A;  1TH4 A;  3Q8G A;  3IG5 A;  3SHG B;  4L4U A;  4Z8X A;  3T38 A;  2UXB M;  2QQ8 A;  4D80 A;  3KP0 E;  3FUX A;  1IBL M;  3CTW B;  2EO2 A;  4JI1 M;  4DV0 M;  2LVN C;  2QSF X;  4FCT A;  1XNR M;  1XB2 B;  3HJQ A;  2XZU A;  1DGH B;  1VDL A;  2DEN A;  2Y21 A;  3J2P B;  4DV5 M;  3KXE C;  1R5L A;  3HU1 A;  4D81 A;  2BJW A;  2JWS A;  3E9S A;  1GKI A;  3RGP A;  3K92 A;  4OVZ B;  1E32 A;  2O01 F;  3VLF B;  2XLJ A;  3SMP A;  3OTO M;  1Y8G A;  3GPX A;  5FTN A;  4GKK M;  1VEJ A;  2YQZ A;  3J80 S;  2H5X A;  3H4M A;  2R44 A;  4Z6Y A;  5L8R F;  2L4E A;  4B3T M;  1N32 M;  1P3Q Q;  2XSZ A;  4L78 A;  1FJG M;  4BB9 A;  3GQ4 A;  2R4E A;  3A42 A;  2XFT A;  4G4O A;  3TWK A;  1DO2 A;  2D7H A;  3C3E A;  4RKU F;  1SXJ D;  2GQF A;  2O25 A;  1DO0 A;  1G59 A;  2M60 A;  3AV0 A;  1DGH A;  2R65 A;  4LY6 A;  3AL0 C;  5ITQ A;  1DGG A;  1QAO A;  1J5E M;  1D0M A;  4TUW A;  4AG5 A;  4P17 A;  3E4R A;  1VEG A;  5EP1 A;  3PVS A;  4M9Z A;  2QBY A;  1QUT A;  3FD9 A;  1PJJ A;  1PGY A;  3UMM A;  3RGS A;  5A2Q S;  2MRO B;  1YE9 A;  2UU9 M;  1EIJ A;  3KOY E;  1WJ7 A;  2I7N A;  3TQS A;  1IY1 A;  3DOA A;  4IBD A;  4WP2 A;  5IZ7 D;  2EA0 A;  4GKJ M;  1OTR A;  4HL4 A;  5H37 D;  4L8R C;  3DA1 A;  4I5S A;  2X49 A;  3GLI B;  3U6P A;  5KO3 A;  1Z6T A;  4LF6 M;  3SAV A;  4KLN A;  3GPU A;  3T6P A;  1N34 M;  3KFU G;  3VDP A;  3KSX A;  2FOI C;  2L2D A;  2X8A A;  1Z5A A;  2K6B A;  1YLA A;  2JP7 A;  2OOB A;  5JI3 E;  3GLF E;  3M7G A;  2C5R A;  4LF8 M;  2AHM A;  2VDB B;  3M6A A;  3HJ8 A;  3HJS A;  3NBI A;  2QP9 X;  4X62 M;  3C58 A;  1V34 A;  4ITQ A;  4JI2 M;  4LJA A;  1MN3 A;  4DR6 M;  1NNU C;  1IBK M;  1Q3C A;  1QZE A;  4JN6 A;  3SYK A;  3GLF B;  2LBC A;  2LXE A;  1LTM A;  1ZMV A;  4DR5 M;  4AI6 A;  3MMP A;  1IXR C;  3LVV A;  4LF7 M;  3D8B A;  5KPT A;  1WHC A;  2ZM6 M;  2CFO A;  2JA2 A;  5EXS A;  3L25 A;  2CHQ A;  4LFC M;  4QHS A;  3GLG B;  4LF9 M;  1GLN A;  4LJ7 A;  5ITX A;  2DHY A;  1NVM A;  2ZTC A;  3FYD A;  3W0L B;  1G71 A;  4LGM A;  2LNH C;  2HL7 A;  3L28 A;  5FTL A;  4R7G A;  1PJT A;  4NRW A;  3U6E A;  4ZPX A;  3SAT A;  2UXC M;  2XSZ D;  3H4J A;  1HJP A;  1NNJ A;  1QDT A;  3QYB A;  3KVW A;  5KPZ A;  3U6O A;  2KNA A;  2GNO A;  1XXH A;  3B74 A;  3U5Z A;  4OX9 M;  1UFZ A;  3AOE C;  4LRT A;  1OFH A;  3LMM A;  4AW4 A;  3HKP A;  3EIE A;  4S12 A;  1HNX M;  2G3Q A;  2V1U A;  3AFH A;  1YUB A;  1OFI A;  2ZTD A;  4LCB A;  2VII A;  1HQC A;  1NO1 A;  3K9O A;  8CAT A;  1IQP A;  1XHB A;  3L2A A;  2C96 A;  4GC5 A;  4XK8 F;  2HHH M;  2DXI A;  3U61 A;  4MB7 A;  3ZCB B;  3Q8X A;  1XMO M;  4M0W A;  4LFB M;  1WXQ A;  4DR2 M;  4Q7J A;  3C3D A;  5IRE B;  3L26 A;  4B7H A;  2D7G A;  3VKG A;  1HT1 E;  2K9D A;  1IN5 A;  2FH0 A;  4QHT A;  3VDU A;  1TF0 B;  4L16 A;  4P16 A;  3U6L A;  3K9P A;  2CV2 A;  1CUK A;  2MH8 A;  1GL6 A;  4RF1 A;  2QHO B;  4DR7 M;  3BXW A;  1L2B A;  1XNQ M;  5LMU M;  3LCV B;  1GO5 A;  1N78 A;  4X65 M;  2DWZ B;  1SXJ C;  2BJV A;  2V1C A;  4Y28 F;  1PM5 A;  1WIV A;  2R45 A;  4RNA A;  2DAI A;  4AKH A;  3GLH E;  2Z3X A;  1Q02 A;  2ZAM A;  2DAM A;  5EJC A;  1NSF A;  2CWB A;  2EKK A;  1OJL A;  1XMQ M;  3J81 S;  3GRR A;  1L1Z A;  2QPA A;  3AOE A;  1SG9 A;  3I4V A;  4FWH A;  2KNZ A;  3FRH A;  3HY5 A;  3VKH A;  2D7E A;  3C9P A;  3CF2 A;  5GKN A;  3U6C A;  3VK7 A;  4G3O A;  2CP8 A;  1V33 A;  1VQ1 A;  4AZF A;  1RU3 A;  4DV6 M;  3GPY A;  1OIP A;  2LHC A;  1G4A E;  5FTM A;  4PCZ A;  2RGO A;  1DV0 A;  2DHR A;  4XBO A;  1G41 A;  1QDR A;  3TWM A;  3VFD A;  1NJG A;  4LZJ A;  3LW5 F;  2J7N A;  2JY8 A;  4NXM M;  3LCU A;  3TWL A;  1E9R A;  3SAU A;  3PXG A;  2FE8 A;  4QOZ C;  1OIZ A;  1TTE A;  4M9X A;  1H6U A;  2XF3 A;  4IIW A;  1A5T A;  1G8P A;  5DYI A;  4LJ6 A;  4R71 A;  3U61 B;  2XZF A;  2DZL A;  4HEO A;  5FTJ A;  4MGY E;  2JZ0 A;  1Z5B A;  2HWJ A;  2OOA A;  7CAT A;  2CV0 A;  2BWE A;  4HLQ A;  2Q2E B;  1HQY E;  3HZJ A;  5JI2 E;  4DV7 M;  5EP3 A;  3GRY A;  4DUZ M;  2LVQ D;  2YFQ A;  5EQT A;  4MH0 E;  5BPV A;  1T6O A;  3FYC A;  3GLI E;  3CGW A;  4JI8 M;  1V92 A;  2L7I A;  4X66 M;  3U6D A;  5FSW A;  4IBB A;  4DR1 M;  3HU3 A;  1N77 A;  3L29 A;  2KA6 B;  4GEW A;  1XXH B;  2E5L M;  4LZZ A;  3PNV A;  2Z4S A;  3B7N A;  4B08 A;  4B7G A;  4DV2 M;  1UM8 A;  4MGK E;  5EXT A;  3FE3 A;  4DV3 M;  3GO8 A;  3DZD A;  1ZAE A;  4OVZ A;  2CE7 A;  1R7R A; 
#chains in the Genus database with same CATH homology
 2JZ1 A;  3FRI A;  2K0B X;  1OKS A;  3IHP A;  1KYI A;  3E21 A;  1ZMU A;  2R0I A;  2QNJ A;  2BWB A;  3H4J A;  1XXH E;  1NV8 A;  2DNA A;  2JY5 A;  2KNA A;  2MGW A;  1C7Y A;  3F92 A;  2JY6 B;  1UFZ A;  2B3T A;  2EJS A;  2G3Q A;  1G3I A;  4UN2 B;  2ZTD A;  1E94 E;  3K9O A;  1EFU B;  2RRU A;  2WZJ A;  1JR3 E;  2JUJ A;  1WGL A;  2KNV A;  4Q7J A;  2LVN C;  2QSF X;  3E46 A;  1XB2 B;  1VDL A;  2DEN A;  1HT1 E;  2K9D A;  1ZMW A;  1IM2 A;  2DKL A;  3K9P A;  1CUK A;  1Y8G A;  1VEJ A;  2DI0 A;  2H5X A;  2QHO B;  2L4E A;  2L4F A;  3LCV B;  1P3Q Q;  1GO5 A;  1OQY A;  2HAK A;  2DAK A;  2JNH A;  3B89 A;  1WIV A;  2LVO C;  1F4I A;  1DO2 A;  2DAI A;  4DBG B;  2DAG A;  1R4G A;  3GLH E;  1Q02 A;  1HT2 E;  2O25 A;  1DO0 A;  2DAM A;  2CWB A;  2EKK A;  2OO9 A;  1SG9 A;  2KNZ A;  3FRH A;  1NV9 A;  1BVS A;  1VEG A;  2LVA A;  4G3O A;  1PGY A;  1VQ1 A;  1ZV1 A;  2CP8 A;  2MRO B;  2MJ5 B;  1WJ7 A;  5DFL A;  1G4A E;  4WP2 A;  2EKF A;  1DV0 A;  1G41 A;  1OTR A;  2JY7 A;  2JY8 A;  1OAI A;  3IEC A;  3LCU A;  1IFY A;  2MR9 A;  2LTU A;  3T6P A;  1TTE A;  1WGN A;  1A5T A;  2L2D A;  4R71 A;  2OOB A;  1YLA A;  2DAE A;  2DZL A;  2JP7 A;  2LVP C;  4HEO A;  2JZ0 A;  1AIP C;  3GLF E;  2OOA A;  2HWJ A;  2BWE A;  1HQY E;  1VG5 A;  5JI2 E;  1T43 A;  2LVQ D;  2KHH A;  1MN3 A;  1TR8 A;  1WR1 B;  3GLG E;  1T6O A;  4F1I A;  1QZE A;  3GLI E;  1V92 A;  2LBC A;  1ZMV A;  3MMP A;  4GEW A;  1WHC A;  3BBZ A;  1IXS A;  1VEK A;  3FE3 A;  2DHY A;  4F2L A;  1HJP A;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...