2LVQD

Gp78cue domain bound to the proximal ubiquitin of k48-linked diubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
molecule keywords Ubiquitin
total genus 16
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvqD00
4Q7JA 1C7YA 4DBGB 1JR3E 3K9PA 1OKSA 2JY7A 2EKKA 3IHPA 3FE3A 1OAIA 2LVAA 4G3OA 1VEKA 1ZMUA 2JUJA 1WR1B 2H5XA 1NV9A 1Y8GA 1GO5A 3LCVB 2QHOB 2DI0A 2KNZA 2DAMA 1HJPA 1UFZA 5JI2E 1T6OA 1VDLA 1XB2B 2KHHA 4F1IA 2EJSA 1G41A 3E46A 2DKLA 2HAKA 2G3QA 3FRIA 2DENA 5DFLA 2B3TA 1AIPC 1G4AE 1Q02A 1WJ7A 3GLFE 1F4IA 1P3QQ 1ZV1A 3LCUA 1DO0A 1WGNA 1OQYA 2HWJA 2JZ0A 4WP2A 4F2LA 1ZMVA 2OO9A 3BBZA 2LTUA 2JNHA 2BWEA 1DV0A 2JY5A 2DAGA 2JP7A 3GLHE 2MGWA 1VQ1A 2MROB 3B89A 2O25A 3F92A 1VG5A 4UN2B 1HT1E 1IM2A 1WIVA 2K0BX 1MN3A 2DNAA 1TR8A 1BVSA 1DO2A 2RRUA 1EFUB 2ZTDA 3GLIE 2LBCA 2ZTCA 2LVPC 1VEJA 2KNVA 1KYIA 1OTRA 2DAIA 1YLAA 2DAKA 1XXHE 2CP8A 3K9OA 3H4JA 1QZEA 1WHCA 2BWBA 2DZLA 1G3IA 2JY8A 2LVOC 2L2DA 1VEGA 1ZMWA 1TTEA 2L4EA 2QSFX 3T6PA 1CUKA 1R4GA 1A5TA 1NV8A 3GLGE 2MJ5B 1SG9A 2EKFA 4GEWA 1HQYE 2JY6B 1IXSA 1E94E 2LVNC 2LVQD 1WGLA 2OOAA 3MMPA 2KNAA 1HT2E 2QNJA 3IECA 2L4FA 2CWBA 1PGYA 2K9DA 2OOBA 2DAEA 2JZ1A 1V92A 2MR9A 4R71A 4HEOA 2R0IA 3E21A 1T43A 1IFYA 2WZJA 3FRHA 2DHYA
chains in the Genus database with same CATH superfamily
1C7YA 1JR3E 2R44A 2KDLA 3KOYE 3K9PA 4PD2A 3VDUA 4GH9A 5EXXA 3IHPA 4FCWA 3LVVA 5IZ7D 2QBYB 2CRUA 3HX3A 4MGZE 4A3VB 2XZFA 4IBBA 2JUJA 1WR1B 3T1YM 1MU5A 2VQFM 3KS4A 4GMQA 2F5PA 3K92A 4NSOB 2EUCA 3JR4A 3QYBA 1AUAA 1QZMA 1QDTA 3FTDA 4NRVA 1GKIA 4M9ZA 1EIJA 5L8RF 3GRYA 2HL7A 2LWXA 2WSEF 5EJCA 1OIZA 3GLGA 2LH0A 4REZA 4GC9A 3U6EA 4ZPXA 1QAMA 3U6SA 4IBJA 1XB2B 2EJSA 1G41A 3K2LA 3NWLA 3UMMA 3SMPA 1ZAEA 1QQWA 2G3QA 2P5TA 2K47A 1MJGM 2D7GA 5DFLA 3THGA 1NY6A 1KFVA 3FUXA 4JI3M 3GLIB 3FYDA 1AIPC 3VFDA 1R2YA 4IBFA 1QUTA 3HY5A 3LVWA 3U60A 2N35A 4NXNM 3H4MA 3UJNA 3GLHA 4AQYM 1P3QQ 2ZANA 4QNMA 1PM5A 4YY3M 3ZC7B 2XGNA 3C3DA 2CV1A 1DO0A 3U6DA 1GL6A 2EO2A 4NSRA 2HWJA 2L7HA 2OO9A 2VF8A 3BBZA 4M9SA 2CHQA 4GC5A 2JNHA 4D81A 3U60B 3GPPA 2R4EA 3GRRA 2L7IA 4FWGA 4M9XA 3WHKA 2QBYA 5FTLA 2Y0TA 3AJIB 3GLIA 2F5OA 1N33M 3B7ZA 1G8PA 4FW9A 4DV0M 4AKGA 2HKJA 1Z5AA 2MGWA 3J7BA 2FFJA 1YUBA 2O25A 2I7NA 3VK7A 3GQ3A 4ITQA 4DUYM 2J7NA 5LMNM 1IM2A 3HU2A 1WIVA 2CEAA 3JR5A 2J5YA 3R8FA 2HHHM 3NBXX 4DR3M 4I4LA 2X49A 1BVSA 1HQCA 3SYKA 1GJTA 2C9CA 2DVWB 2QP9X 1D0MA 3HKPA 3LW5F 3C58A 3SBJA 4MH0E 1KYIA 1OTRA 4LFAM 1YLAA 2XSZD 3E4RA 2CP8A 3PNVA 5ITTA 2JXNA 3K9OA 3HHZA 1QZEA 3U61A 2I7PA 4XK8F 2E5LM 4JI5M 2LVOC 2L2DA 1ZMWA 1TTEA 2L4EA 1ZQ9A 2RGHA 4L4UA 3KSXA 4IIWA 4G4RA 4D82A 5IT9S 3SFZA 4II7A 4GHAA 1WGLA 3GRUA 1DGBA 4JI0M 2Z4SA 1IBLM 3TL4X 3SARA 1TDZA 1X37A 2DHRA 2CWBA 3TWKA 3M0EA 5H37D 2QQ8A 2JZ1A 5EXPA 2CUZA 2QZ4A 4LJAA 1DGHB 4AG5A 3IG8A 4B3MM 3D8LA 2FE8A 2QPAA 5EP3A 1T43A 3KS8A 2F5QA 4IBDA 1QAQA 4WURA 3KXEC 5KPRA 1IFYA 2WZJA 3B7QA 4Q7JA 5EP1A 3A45A 3FUUA 3FTCA 3HJ8A 1OKSA 2KZSA 4QHTA 5ITXA 3U6LA 1PJJA 1FNNA 4M0WA 1K3XA 3BOSA 4Z8XA 2MH8A 2DWMA 2UXDM 4AKIA 4FCTA 3L29A 2LHCA 3CGWA 1N32M 4YHHM 4I8OA 5ITUA 2H1RA 2QHOB 3C3EA 5E6JA 2X4AA 3J81S 1Z6TA 3VK8A 2F4VM 4LJ8A 3UGJA 1GABA 3GQ5A 2F5SA 1S3SA 1UFZA 4DR1M 3HHYA 2C9OA 1NNUC 4F1IA 1JQJC 2LXEA 3PXGA 4DV6M 2LHGA 3T38A 1L2BA 5KO3A 4S12A 1G59A 4AI6A 3W67A 1XXHA 3LQRA 1NY5A 1N36M 1OFIA 1UM8A 4B3SM 2UUCM 4PT5A 1Q02A 1GL7A 3GLFE 2UU9M 1N78A 3SHFA 2O01F 1F4IA 3SYLA 1PJSA 2YNMD 5FTJA 1XMQM 3ZCBB 2NQ8C 2XZUA 1I94M 1HNWM 1G71A 1OQYA 2BJWA 4DV7M 1ZMVA 2GQFA 5A2QS 1NJGA 1NVMA 4AZFA 1IN8A 5EP2A 7CATA 5FLXS 3KW6A 2C5RA 4NL4H 2VIIA 2D7EA 1XHBA 4X62M 2Z3XA 4DR4M 4AW4A 1Q3CA 4BB9A 3L26A 3Q8XA 1SXJB 1V34A 2YR0A 3GLGB 1NHWC 4NRWA 4JYAM 3BXWA 3ZQJA 1VG5A 1HT1E 2KA6B 1YE9A 4KODA 3I04M 4XGIA 2K0BX 1L2DA 4G6ZA 2DNAA 3I4VA 3UZUA 5FTKA 2QCUA 2DXIA 3FUWA 4GHLA 4DV2M 4LF4M 2ZAOA 2G8LA 1EFUB 4BBAA 2FH0A 4RNAA 4LRSA 4JI8M 3U6PA 1XC8A 2JA2A 4HLQA 1QYRA 2KNVA 2UUAM 1XXHE 3A46A 2CHVA 2KRUA 3A98B 1OIPA 3KDSE 3GP1A 2XF3A 1WHCA 5DYIA 4PCZA 2DZLA 1IXSB 4B7HA 5GKNA 4LJ4A 3MK6A 4OVZB 2R62A 5KPZA 1IBKM 2YFQA 4WW0A 1CUKA 1W5SA 4MGYE 4DR2M 2CV0A 4CISA 1A5TA 4LFCM 2XFTA 1NV8A 4OW0A 2EKFA 2Y21A 3M7GA 3W0FA 1IXSA 2DWZB 4LRTA 1IN7A 4FD2A 3SC3A 3CTWB 2XFSA 2LVQD 3HU3A 4FWDA 1T3TA 1NO1A 5EP4A 2OOAA 2XLJA 4I81A 1TH3A 4M0DA 5EXSA 3J80S 2V1UA 4LF6M 1R7RA 2DAEA 2R45A 3QWLA 5ITYA 1L1ZA 4IJFA 2D7HA 1QDRA 2MR9A 1XNRM 4CGYB 1Q3BA 3RFWA 2VDBB 4LGMA 3FYCA 1IXZA 3FRHA 2DHYA 1NSFA 1TF0B 3MHVC 3VLFB 2C96A 2JY7A 3C9PA 4QNRA 2EKKA 3I51A 3M6AA 2M5ZA 5F3WA 1N77A 1JR3D 1OAIA 4QOZC 3CF0A 1VEKA 3FUVA 4G3OA 3ZH9B 4QHSA 4X66M 3U5ZA 4K0KM 1TDHA 3EIHA 3HU1A 2H5XA 2ZAMA 5FSWA 1HR0M 2DWLA 4OX9M 1E32A 5DNYA 1Z5CA 3U6OA 4JI1M 4DV3M 1QUSA 4NXMM 1SXJC 1Y8GA 3KP1E 4KLNA 1PJTA 3QYEA 4LY6A 1R2ZA 5IREB 1KSFX 1IBMM 2O5RA 4MM3B 2XH9A 1WXQA 3MJ5A 5JI2E 4G4QA 4NC6A 3TWMA 2W82A 4L78A 1VDLA 2KHHA 2Z8YM 1XXHB 3E46A 4IJEA 2OQ4A 4FCVA 2A5YB 3QAUA 2XEPA 2YQZA 5BR8M 3SATA 3FRIA 2V1CA 2R6FA 4L8RC 3KFUG 2KZUA 1D2NA 4P16A 2Q2EB 2LNHC 3CF2A 3W68A 4JI6M 1JR3A 1IXRC 3FUTA 5LMUM 1R5LA 2BNKA 3KSJA 1SXJE 4EIWA 3VKHA 3B74A 4OVZA 3K8ZA 2Z7JA 2BWEA 4AG6A 1JB0F 3L27A 1DV0A 2APLA 2FS1A 1R6BX 4JI4M 3RGPA 3L25A 3EIEA 3J2PB 3K1JA 3AOEC 4LJ7A 3GQ4A 1PJQA 2JP7A 3W0LB 3IG5A 1VQ1A 3I4YA 2OPFA 2ERCA 3RGSA 3F92A 4DR5M 2KEBA 4UN2B 5KPTA 3R9XB 3DOAA 1L1TA 1Z59A 1C1KA 3AV0A 4PDGA 3GLFB 3TE6A 1TR8A 1YSYA 4DR7M 2KXEA 5ITXE 2V6ZM 1TH4A 3L2AA 2LBCA 2QENA 2RKOA 3KOXE 2ZTCA 4LCBA 1K82A 2DWNA 4KHPM 3GO8A 1DGFA 1Z5BA 2DAKA 1HNZM 1MX0A 2G5GX 3H4JA 5C18A 2R46A 4CHTB 1QANA 4LZJA 5DYGA 2R18A 4GKJM 2KRKA 2RGOA 4LZZA 2JY8A 4JV5M 4L15A 3LMMA 1TGUA 1N75A 2UXBM 1W5TA 5IWAM 3CF6E 2MJ5B 3B9PA 2Y0QA 4GEWA 4P17A 4B08A 1HQYE 2JY6B 3KP0E 1NHGC 1DGGA 3TWLA 1XNQM 1IQPA 1E94E 3GRVA 3MMPA 2KNAA 2QNJA 1HT2E 3IECA 2L4FA 1PRBA 3PVSA 2C98A 4R3DA 4DV4M 2K9DA 4DV5M 3AFHA 1K3WA 4B7FA 1V92A 4LF8M 2DZOB 4HEOA 4I5SA 3E21A 5EXTA 4Z6YA 1FJGM 4G4OA 1OAOC 1Q39A 1QVRA 4MB7A 4IBKA 4IBIA 3RE8A 2VQEM 1LV7A 1E9SA 4LFBM 1GJSA 3KVWA 2BJVA 2X8AA 5JI3E 4DBGB 5C1BA 1D0LA 2AHMA 4RF0A 3FE3A 4LJ9A 2LVAA 2VF7A 4CIZA 1IY2A 1ZMUA 2ZBKB 4RF1A 3HJSA 5BPVA 1NV9A 3V76A 4X65M 3U5ZB 1IN5A 3GPUA 4QOSA 2R65A 3TQSA 2CHGA 1IY0A 3WHLA 4B3TM 5FTMA 1L2CA 1GO5A 3HHWA 4OU7A 3D8BA 2EA0A 3FTFA 3LCVB 4D80A 2DI0A 2KNZA 3B7NA 2CFOA 2DAMA 3DFZA 4JN6A 4DV1M 3AOEA 1H6UA 2Z4RA 3LQQA 4LJ6A 4BLCA 1HJPA 3PNYA 3SAVA 2Y20A 4LF7M 4LG2A 3U6QA 1T6OA 4LGYA 3U6MA 4JI2M 1SXJD 3J7AS 4KT0F 1XMOM 2CE7A 3KOWE 1J5EM 3HHXA 2DKLA 2UXCM 2HAKA 2M60A 2DENA 2F5NA 3DA1A 4L6V6 3HJQA 1E9RA 2B3TA 1I4WA 1IY1A 3FKEA 4MGKE 1G4AE 4X64M 3I01M 1WJ7A 2XSZA 4JXJA 4FWHA 3ILKA 4G4NA 3UK6A 3Q8GA 1ZV1A 1XWIA 3SMSA 2ZM6M 4PDIA 3LCUA 3J27B 1OFHA 1WGNA 2JZ0A 2FOIC 4WP2A 4F2LA 1GLNA 2GNOA 2HCBA 5KQ8A 3HWSA 2LTUA 2WSCF 5ITRA 2KW0A 3SHGB 2J7OA 5ITQA 3SAUA 3T15A 1J09A 2JY5A 2DAGA 1D0KA 3FTEA 3SAWA 3GLHE 4L16A 8CATA 3AOGA 2MROB 4LF5M 3SASA 4DR6M 3B89A 5E26A 5EQTA 1PJIA 4W5WA 3GPXA 1SXJA 4B7GA 3U6CA 4XBOA 1QAOA 1MN3A 1NJFA 3VDPA 2DZNB 4LF9M 4ANRA 1DO2A 3L28A 2RRUA 4HL4A 2ZTDA 4LJ5A 4MGHA 3GLIE 4JI7M 2C99A 3NBIA 2CV2A 3E9SA 2K6BA 2LVPC 1VEJA 4TUWA 1NNJA 2DAIA 3JAMS 1HNXM 4IBGA 4CJ6A 4R7GA 4GKKM 2BWBA 3GPYA 1EE8A 4RKUF 1LTMA 3GLFA 1G3IA 3FD9A 2L6OA 3HGIA 3KOZE 4AKHA 1VEGA 3A42A 2QSFX 3T6PA 1R4GA 3U61B 2JWSA 2L09A 3GLGE 1N34M 4NOOB 1SG9A 3DZDA 3GLHB 1J7KA 3VKGA 1VDDA 3TPZA 4Y28F 2LVNC 4GITA 4MGIE 2WSFF 1IN4A 1IN6A 1V33A 3T1HM 1DGHA 1PGYA 3AL0C 2OOBA 1RU3A 1ORYB 4DUZM 4B3RM 4R71A 4IBCA 1TH2A 2R0IA 1L8QA 3PFIA 4GRIA 3OTOM 2FNAA 5FTNA 4GIPA 3AKZA 1GVNA 1OJLA 4KO8A 5KQDA 3HZJA 4FVMA 2UUBM 2R4JA 4IBEA
chains in the Genus database with same CATH topology
4Q7JA 1C7YA 4DBGB 1JR3E 3K9PA 1OKSA 2JY7A 2EKKA 3IHPA 3FE3A 1OAIA 2LVAA 4G3OA 1VEKA 1ZMUA 2JUJA 1WR1B 2H5XA 1NV9A 1Y8GA 1GO5A 3LCVB 2QHOB 2DI0A 2KNZA 2DAMA 1HJPA 1UFZA 5JI2E 1T6OA 1VDLA 1XB2B 2KHHA 4F1IA 2EJSA 1G41A 3E46A 2DKLA 2HAKA 2G3QA 3FRIA 2DENA 5DFLA 2B3TA 1AIPC 1G4AE 1Q02A 1WJ7A 3GLFE 1F4IA 1P3QQ 1ZV1A 3LCUA 1DO0A 1WGNA 1OQYA 2HWJA 2JZ0A 4WP2A 4F2LA 1ZMVA 2OO9A 3BBZA 2LTUA 2JNHA 2BWEA 1DV0A 2JY5A 2DAGA 2JP7A 3GLHE 2MGWA 1VQ1A 2MROB 3B89A 2O25A 3F92A 1VG5A 4UN2B 1HT1E 1IM2A 1WIVA 2K0BX 1MN3A 2DNAA 1TR8A 1BVSA 1DO2A 2RRUA 1EFUB 2ZTDA 3GLIE 2LBCA 2ZTCA 2LVPC 1VEJA 2KNVA 1KYIA 1OTRA 2DAIA 1YLAA 2DAKA 1XXHE 2CP8A 3K9OA 3H4JA 1QZEA 1WHCA 2BWBA 2DZLA 1G3IA 2JY8A 2LVOC 2L2DA 1VEGA 1ZMWA 1TTEA 2L4EA 2QSFX 3T6PA 1CUKA 1R4GA 1A5TA 1NV8A 3GLGE 2MJ5B 1SG9A 2EKFA 4GEWA 1HQYE 2JY6B 1IXSA 1E94E 2LVNC 2LVQD 1WGLA 2OOAA 3MMPA 2KNAA 1HT2E 2QNJA 3IECA 2L4FA 2CWBA 1PGYA 2K9DA 2OOBA 2DAEA 2JZ1A 1V92A 2MR9A 4R71A 4HEOA 2R0IA 3E21A 1T43A 1IFYA 2WZJA 3FRHA 2DHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q7J A;  1C7Y A;  4DBG B;  1JR3 E;  3K9P A;  1OKS A;  2JY7 A;  2EKK A;  3IHP A;  3FE3 A;  1OAI A;  2LVA A;  4G3O A;  1VEK A;  1ZMU A;  2JUJ A;  1WR1 B;  2H5X A;  1NV9 A;  1Y8G A;  1GO5 A;  3LCV B;  2QHO B;  2DI0 A;  2KNZ A;  2DAM A;  1HJP A;  1UFZ A;  5JI2 E;  1T6O A;  1VDL A;  1XB2 B;  2KHH A;  4F1I A;  2EJS A;  1G41 A;  3E46 A;  2DKL A;  2HAK A;  2G3Q A;  3FRI A;  2DEN A;  5DFL A;  2B3T A;  1AIP C;  1G4A E;  1Q02 A;  1WJ7 A;  3GLF E;  1F4I A;  1P3Q Q;  1ZV1 A;  3LCU A;  1DO0 A;  1WGN A;  1OQY A;  2HWJ A;  2JZ0 A;  4WP2 A;  4F2L A;  1ZMV A;  2OO9 A;  3BBZ A;  2LTU A;  2JNH A;  2BWE A;  1DV0 A;  2JY5 A;  2DAG A;  2JP7 A;  3GLH E;  2MGW A;  1VQ1 A;  2MRO B;  3B89 A;  2O25 A;  3F92 A;  1VG5 A;  4UN2 B;  1HT1 E;  1IM2 A;  1WIV A;  2K0B X;  1MN3 A;  2DNA A;  1TR8 A;  1BVS A;  1DO2 A;  2RRU A;  1EFU B;  2ZTD A;  3GLI E;  2LBC A;  2ZTC A;  2LVP C;  1VEJ A;  2KNV A;  1KYI A;  1OTR A;  2DAI A;  1YLA A;  2DAK A;  1XXH E;  2CP8 A;  3K9O A;  3H4J A;  1QZE A;  1WHC A;  2BWB A;  2DZL A;  1G3I A;  2JY8 A;  2LVO C;  2L2D A;  1VEG A;  1ZMW A;  1TTE A;  2L4E A;  2QSF X;  3T6P A;  1CUK A;  1R4G A;  1A5T A;  1NV8 A;  3GLG E;  2MJ5 B;  1SG9 A;  2EKF A;  4GEW A;  1HQY E;  2JY6 B;  1IXS A;  1E94 E;  2LVN C;  2LVQ D;  1WGL A;  2OOA A;  3MMP A;  2KNA A;  1HT2 E;  2QNJ A;  3IEC A;  2L4F A;  2CWB A;  1PGY A;  2K9D A;  2OOB A;  2DAE A;  2JZ1 A;  1V92 A;  2MR9 A;  4R71 A;  4HEO A;  2R0I A;  3E21 A;  1T43 A;  1IFY A;  2WZJ A;  3FRH A;  2DHY A; 
#chains in the Genus database with same CATH topology
 1C7Y A;  1JR3 E;  2R44 A;  2KDL A;  3KOY E;  3K9P A;  4PD2 A;  3VDU A;  4GH9 A;  5EXX A;  3IHP A;  4FCW A;  3LVV A;  5IZ7 D;  2QBY B;  2CRU A;  3HX3 A;  4MGZ E;  4A3V B;  2XZF A;  4IBB A;  2JUJ A;  1WR1 B;  3T1Y M;  1MU5 A;  2VQF M;  3KS4 A;  4GMQ A;  2F5P A;  3K92 A;  4NSO B;  2EUC A;  3JR4 A;  3QYB A;  1AUA A;  1QZM A;  1QDT A;  3FTD A;  4NRV A;  1GKI A;  4M9Z A;  1EIJ A;  5L8R F;  3GRY A;  2HL7 A;  2LWX A;  2WSE F;  5EJC A;  1OIZ A;  3GLG A;  2LH0 A;  4REZ A;  4GC9 A;  3U6E A;  4ZPX A;  1QAM A;  3U6S A;  4IBJ A;  1XB2 B;  2EJS A;  1G41 A;  3K2L A;  3NWL A;  3UMM A;  3SMP A;  1ZAE A;  1QQW A;  2G3Q A;  2P5T A;  2K47 A;  1MJG M;  2D7G A;  5DFL A;  3THG A;  1NY6 A;  1KFV A;  3FUX A;  4JI3 M;  3GLI B;  3FYD A;  1AIP C;  3VFD A;  1R2Y A;  4IBF A;  1QUT A;  3HY5 A;  3LVW A;  3U60 A;  2N35 A;  4NXN M;  3H4M A;  3UJN A;  3GLH A;  4AQY M;  1P3Q Q;  2ZAN A;  4QNM A;  1PM5 A;  4YY3 M;  3ZC7 B;  2XGN A;  3C3D A;  2CV1 A;  1DO0 A;  3U6D A;  1GL6 A;  2EO2 A;  4NSR A;  2HWJ A;  2L7H A;  2OO9 A;  2VF8 A;  3BBZ A;  4M9S A;  2CHQ A;  4GC5 A;  2JNH A;  4D81 A;  3U60 B;  3GPP A;  2R4E A;  3GRR A;  2L7I A;  4FWG A;  4M9X A;  3WHK A;  2QBY A;  5FTL A;  2Y0T A;  3AJI B;  3GLI A;  2F5O A;  1N33 M;  3B7Z A;  1G8P A;  4FW9 A;  4DV0 M;  4AKG A;  2HKJ A;  1Z5A A;  2MGW A;  3J7B A;  2FFJ A;  1YUB A;  2O25 A;  2I7N A;  3VK7 A;  3GQ3 A;  4ITQ A;  4DUY M;  2J7N A;  5LMN M;  1IM2 A;  3HU2 A;  1WIV A;  2CEA A;  3JR5 A;  2J5Y A;  3R8F A;  2HHH M;  3NBX X;  4DR3 M;  4I4L A;  2X49 A;  1BVS A;  1HQC A;  3SYK A;  1GJT A;  2C9C A;  2DVW B;  2QP9 X;  1D0M A;  3HKP A;  3LW5 F;  3C58 A;  3SBJ A;  4MH0 E;  1KYI A;  1OTR A;  4LFA M;  1YLA A;  2XSZ D;  3E4R A;  2CP8 A;  3PNV A;  5ITT A;  2JXN A;  3K9O A;  3HHZ A;  1QZE A;  3U61 A;  2I7P A;  4XK8 F;  2E5L M;  4JI5 M;  2LVO C;  2L2D A;  1ZMW A;  1TTE A;  2L4E A;  1ZQ9 A;  2RGH A;  4L4U A;  3KSX A;  4IIW A;  4G4R A;  4D82 A;  5IT9 S;  3SFZ A;  4II7 A;  4GHA A;  1WGL A;  3GRU A;  1DGB A;  4JI0 M;  2Z4S A;  1IBL M;  3TL4 X;  3SAR A;  1TDZ A;  1X37 A;  2DHR A;  2CWB A;  3TWK A;  3M0E A;  5H37 D;  2QQ8 A;  2JZ1 A;  5EXP A;  2CUZ A;  2QZ4 A;  4LJA A;  1DGH B;  4AG5 A;  3IG8 A;  4B3M M;  3D8L A;  2FE8 A;  2QPA A;  5EP3 A;  1T43 A;  3KS8 A;  2F5Q A;  4IBD A;  1QAQ A;  4WUR A;  3KXE C;  5KPR A;  1IFY A;  2WZJ A;  3B7Q A;  4Q7J A;  5EP1 A;  3A45 A;  3FUU A;  3FTC A;  3HJ8 A;  1OKS A;  2KZS A;  4QHT A;  5ITX A;  3U6L A;  1PJJ A;  1FNN A;  4M0W A;  1K3X A;  3BOS A;  4Z8X A;  2MH8 A;  2DWM A;  2UXD M;  4AKI A;  4FCT A;  3L29 A;  2LHC A;  3CGW A;  1N32 M;  4YHH M;  4I8O A;  5ITU A;  2H1R A;  2QHO B;  3C3E A;  5E6J A;  2X4A A;  3J81 S;  1Z6T A;  3VK8 A;  2F4V M;  4LJ8 A;  3UGJ A;  1GAB A;  3GQ5 A;  2F5S A;  1S3S A;  1UFZ A;  4DR1 M;  3HHY A;  2C9O A;  1NNU C;  4F1I A;  1JQJ C;  2LXE A;  3PXG A;  4DV6 M;  2LHG A;  3T38 A;  1L2B A;  5KO3 A;  4S12 A;  1G59 A;  4AI6 A;  3W67 A;  1XXH A;  3LQR A;  1NY5 A;  1N36 M;  1OFI A;  1UM8 A;  4B3S M;  2UUC M;  4PT5 A;  1Q02 A;  1GL7 A;  3GLF E;  2UU9 M;  1N78 A;  3SHF A;  2O01 F;  1F4I A;  3SYL A;  1PJS A;  2YNM D;  5FTJ A;  1XMQ M;  3ZCB B;  2NQ8 C;  2XZU A;  1I94 M;  1HNW M;  1G71 A;  1OQY A;  2BJW A;  4DV7 M;  1ZMV A;  2GQF A;  5A2Q S;  1NJG A;  1NVM A;  4AZF A;  1IN8 A;  5EP2 A;  7CAT A;  5FLX S;  3KW6 A;  2C5R A;  4NL4 H;  2VII A;  2D7E A;  1XHB A;  4X62 M;  2Z3X A;  4DR4 M;  4AW4 A;  1Q3C A;  4BB9 A;  3L26 A;  3Q8X A;  1SXJ B;  1V34 A;  2YR0 A;  3GLG B;  1NHW C;  4NRW A;  4JYA M;  3BXW A;  3ZQJ A;  1VG5 A;  1HT1 E;  2KA6 B;  1YE9 A;  4KOD A;  3I04 M;  4XGI A;  2K0B X;  1L2D A;  4G6Z A;  2DNA A;  3I4V A;  3UZU A;  5FTK A;  2QCU A;  2DXI A;  3FUW A;  4GHL A;  4DV2 M;  4LF4 M;  2ZAO A;  2G8L A;  1EFU B;  4BBA A;  2FH0 A;  4RNA A;  4LRS A;  4JI8 M;  3U6P A;  1XC8 A;  2JA2 A;  4HLQ A;  1QYR A;  2KNV A;  2UUA M;  1XXH E;  3A46 A;  2CHV A;  2KRU A;  3A98 B;  1OIP A;  3KDS E;  3GP1 A;  2XF3 A;  1WHC A;  5DYI A;  4PCZ A;  2DZL A;  1IXS B;  4B7H A;  5GKN A;  4LJ4 A;  3MK6 A;  4OVZ B;  2R62 A;  5KPZ A;  1IBK M;  2YFQ A;  4WW0 A;  1CUK A;  1W5S A;  4MGY E;  4DR2 M;  2CV0 A;  4CIS A;  1A5T A;  4LFC M;  2XFT A;  1NV8 A;  4OW0 A;  2EKF A;  2Y21 A;  3M7G A;  3W0F A;  1IXS A;  2DWZ B;  4LRT A;  1IN7 A;  4FD2 A;  3SC3 A;  3CTW B;  2XFS A;  2LVQ D;  3HU3 A;  4FWD A;  1T3T A;  1NO1 A;  5EP4 A;  2OOA A;  2XLJ A;  4I81 A;  1TH3 A;  4M0D A;  5EXS A;  3J80 S;  2V1U A;  4LF6 M;  1R7R A;  2DAE A;  2R45 A;  3QWL A;  5ITY A;  1L1Z A;  4IJF A;  2D7H A;  1QDR A;  2MR9 A;  1XNR M;  4CGY B;  1Q3B A;  3RFW A;  2VDB B;  4LGM A;  3FYC A;  1IXZ A;  3FRH A;  2DHY A;  1NSF A;  1TF0 B;  3MHV C;  3VLF B;  2C96 A;  2JY7 A;  3C9P A;  4QNR A;  2EKK A;  3I51 A;  3M6A A;  2M5Z A;  5F3W A;  1N77 A;  1JR3 D;  1OAI A;  4QOZ C;  3CF0 A;  1VEK A;  3FUV A;  4G3O A;  3ZH9 B;  4QHS A;  4X66 M;  3U5Z A;  4K0K M;  1TDH A;  3EIH A;  3HU1 A;  2H5X A;  2ZAM A;  5FSW A;  1HR0 M;  2DWL A;  4OX9 M;  1E32 A;  5DNY A;  1Z5C A;  3U6O A;  4JI1 M;  4DV3 M;  1QUS A;  4NXM M;  1SXJ C;  1Y8G A;  3KP1 E;  4KLN A;  1PJT A;  3QYE A;  4LY6 A;  1R2Z A;  5IRE B;  1KSF X;  1IBM M;  2O5R A;  4MM3 B;  2XH9 A;  1WXQ A;  3MJ5 A;  5JI2 E;  4G4Q A;  4NC6 A;  3TWM A;  2W82 A;  4L78 A;  1VDL A;  2KHH A;  2Z8Y M;  1XXH B;  3E46 A;  4IJE A;  2OQ4 A;  4FCV A;  2A5Y B;  3QAU A;  2XEP A;  2YQZ A;  5BR8 M;  3SAT A;  3FRI A;  2V1C A;  2R6F A;  4L8R C;  3KFU G;  2KZU A;  1D2N A;  4P16 A;  2Q2E B;  2LNH C;  3CF2 A;  3W68 A;  4JI6 M;  1JR3 A;  1IXR C;  3FUT A;  5LMU M;  1R5L A;  2BNK A;  3KSJ A;  1SXJ E;  4EIW A;  3VKH A;  3B74 A;  4OVZ A;  3K8Z A;  2Z7J A;  2BWE A;  4AG6 A;  1JB0 F;  3L27 A;  1DV0 A;  2APL A;  2FS1 A;  1R6B X;  4JI4 M;  3RGP A;  3L25 A;  3EIE A;  3J2P B;  3K1J A;  3AOE C;  4LJ7 A;  3GQ4 A;  1PJQ A;  2JP7 A;  3W0L B;  3IG5 A;  1VQ1 A;  3I4Y A;  2OPF A;  2ERC A;  3RGS A;  3F92 A;  4DR5 M;  2KEB A;  4UN2 B;  5KPT A;  3R9X B;  3DOA A;  1L1T A;  1Z59 A;  1C1K A;  3AV0 A;  4PDG A;  3GLF B;  3TE6 A;  1TR8 A;  1YSY A;  4DR7 M;  2KXE A;  5ITX E;  2V6Z M;  1TH4 A;  3L2A A;  2LBC A;  2QEN A;  2RKO A;  3KOX E;  2ZTC A;  4LCB A;  1K82 A;  2DWN A;  4KHP M;  3GO8 A;  1DGF A;  1Z5B A;  2DAK A;  1HNZ M;  1MX0 A;  2G5G X;  3H4J A;  5C18 A;  2R46 A;  4CHT B;  1QAN A;  4LZJ A;  5DYG A;  2R18 A;  4GKJ M;  2KRK A;  2RGO A;  4LZZ A;  2JY8 A;  4JV5 M;  4L15 A;  3LMM A;  1TGU A;  1N75 A;  2UXB M;  1W5T A;  5IWA M;  3CF6 E;  2MJ5 B;  3B9P A;  2Y0Q A;  4GEW A;  4P17 A;  4B08 A;  1HQY E;  2JY6 B;  3KP0 E;  1NHG C;  1DGG A;  3TWL A;  1XNQ M;  1IQP A;  1E94 E;  3GRV A;  3MMP A;  2KNA A;  2QNJ A;  1HT2 E;  3IEC A;  2L4F A;  1PRB A;  3PVS A;  2C98 A;  4R3D A;  4DV4 M;  2K9D A;  4DV5 M;  3AFH A;  1K3W A;  4B7F A;  1V92 A;  4LF8 M;  2DZO B;  4HEO A;  4I5S A;  3E21 A;  5EXT A;  4Z6Y A;  1FJG M;  4G4O A;  1OAO C;  1Q39 A;  1QVR A;  4MB7 A;  4IBK A;  4IBI A;  3RE8 A;  2VQE M;  1LV7 A;  1E9S A;  4LFB M;  1GJS A;  3KVW A;  2BJV A;  2X8A A;  5JI3 E;  4DBG B;  5C1B A;  1D0L A;  2AHM A;  4RF0 A;  3FE3 A;  4LJ9 A;  2LVA A;  2VF7 A;  4CIZ A;  1IY2 A;  1ZMU A;  2ZBK B;  4RF1 A;  3HJS A;  5BPV A;  1NV9 A;  3V76 A;  4X65 M;  3U5Z B;  1IN5 A;  3GPU A;  4QOS A;  2R65 A;  3TQS A;  2CHG A;  1IY0 A;  3WHL A;  4B3T M;  5FTM A;  1L2C A;  1GO5 A;  3HHW A;  4OU7 A;  3D8B A;  2EA0 A;  3FTF A;  3LCV B;  4D80 A;  2DI0 A;  2KNZ A;  3B7N A;  2CFO A;  2DAM A;  3DFZ A;  4JN6 A;  4DV1 M;  3AOE A;  1H6U A;  2Z4R A;  3LQQ A;  4LJ6 A;  4BLC A;  1HJP A;  3PNY A;  3SAV A;  2Y20 A;  4LF7 M;  4LG2 A;  3U6Q A;  1T6O A;  4LGY A;  3U6M A;  4JI2 M;  1SXJ D;  3J7A S;  4KT0 F;  1XMO M;  2CE7 A;  3KOW E;  1J5E M;  3HHX A;  2DKL A;  2UXC M;  2HAK A;  2M60 A;  2DEN A;  2F5N A;  3DA1 A;  4L6V 6;  3HJQ A;  1E9R A;  2B3T A;  1I4W A;  1IY1 A;  3FKE A;  4MGK E;  1G4A E;  4X64 M;  3I01 M;  1WJ7 A;  2XSZ A;  4JXJ A;  4FWH A;  3ILK A;  4G4N A;  3UK6 A;  3Q8G A;  1ZV1 A;  1XWI A;  3SMS A;  2ZM6 M;  4PDI A;  3LCU A;  3J27 B;  1OFH A;  1WGN A;  2JZ0 A;  2FOI C;  4WP2 A;  4F2L A;  1GLN A;  2GNO A;  2HCB A;  5KQ8 A;  3HWS A;  2LTU A;  2WSC F;  5ITR A;  2KW0 A;  3SHG B;  2J7O A;  5ITQ A;  3SAU A;  3T15 A;  1J09 A;  2JY5 A;  2DAG A;  1D0K A;  3FTE A;  3SAW A;  3GLH E;  4L16 A;  8CAT A;  3AOG A;  2MRO B;  4LF5 M;  3SAS A;  4DR6 M;  3B89 A;  5E26 A;  5EQT A;  1PJI A;  4W5W A;  3GPX A;  1SXJ A;  4B7G A;  3U6C A;  4XBO A;  1QAO A;  1MN3 A;  1NJF A;  3VDP A;  2DZN B;  4LF9 M;  4ANR A;  1DO2 A;  3L28 A;  2RRU A;  4HL4 A;  2ZTD A;  4LJ5 A;  4MGH A;  3GLI E;  4JI7 M;  2C99 A;  3NBI A;  2CV2 A;  3E9S A;  2K6B A;  2LVP C;  1VEJ A;  4TUW A;  1NNJ A;  2DAI A;  3JAM S;  1HNX M;  4IBG A;  4CJ6 A;  4R7G A;  4GKK M;  2BWB A;  3GPY A;  1EE8 A;  4RKU F;  1LTM A;  3GLF A;  1G3I A;  3FD9 A;  2L6O A;  3HGI A;  3KOZ E;  4AKH A;  1VEG A;  3A42 A;  2QSF X;  3T6P A;  1R4G A;  3U61 B;  2JWS A;  2L09 A;  3GLG E;  1N34 M;  4NOO B;  1SG9 A;  3DZD A;  3GLH B;  1J7K A;  3VKG A;  1VDD A;  3TPZ A;  4Y28 F;  2LVN C;  4GIT A;  4MGI E;  2WSF F;  1IN4 A;  1IN6 A;  1V33 A;  3T1H M;  1DGH A;  1PGY A;  3AL0 C;  2OOB A;  1RU3 A;  1ORY B;  4DUZ M;  4B3R M;  4R71 A;  4IBC A;  1TH2 A;  2R0I A;  1L8Q A;  3PFI A;  4GRI A;  3OTO M;  2FNA A;  5FTN A;  4GIP A;  3AKZ A;  1GVN A;  1OJL A;  4KO8 A;  5KQD A;  3HZJ A;  4FVM A;  2UUB M;  2R4J A;  4IBE A; 
#chains in the Genus database with same CATH homology
 4Q7J A;  1C7Y A;  4DBG B;  1JR3 E;  3K9P A;  1OKS A;  2JY7 A;  2EKK A;  3IHP A;  3FE3 A;  1OAI A;  2LVA A;  4G3O A;  1VEK A;  1ZMU A;  2JUJ A;  1WR1 B;  2H5X A;  1NV9 A;  1Y8G A;  1GO5 A;  3LCV B;  2QHO B;  2DI0 A;  2KNZ A;  2DAM A;  1HJP A;  1UFZ A;  5JI2 E;  1T6O A;  1VDL A;  1XB2 B;  2KHH A;  4F1I A;  2EJS A;  1G41 A;  3E46 A;  2DKL A;  2HAK A;  2G3Q A;  3FRI A;  2DEN A;  5DFL A;  2B3T A;  1AIP C;  1G4A E;  1Q02 A;  1WJ7 A;  3GLF E;  1F4I A;  1P3Q Q;  1ZV1 A;  3LCU A;  1DO0 A;  1WGN A;  1OQY A;  2HWJ A;  2JZ0 A;  4WP2 A;  4F2L A;  1ZMV A;  2OO9 A;  3BBZ A;  2LTU A;  2JNH A;  2BWE A;  1DV0 A;  2JY5 A;  2DAG A;  2JP7 A;  3GLH E;  2MGW A;  1VQ1 A;  2MRO B;  3B89 A;  2O25 A;  3F92 A;  1VG5 A;  4UN2 B;  1HT1 E;  1IM2 A;  1WIV A;  2K0B X;  1MN3 A;  2DNA A;  1TR8 A;  1BVS A;  1DO2 A;  2RRU A;  1EFU B;  2ZTD A;  3GLI E;  2LBC A;  2ZTC A;  2LVP C;  1VEJ A;  2KNV A;  1KYI A;  1OTR A;  2DAI A;  1YLA A;  2DAK A;  1XXH E;  2CP8 A;  3K9O A;  3H4J A;  1QZE A;  1WHC A;  2BWB A;  2DZL A;  1G3I A;  2JY8 A;  2LVO C;  2L2D A;  1VEG A;  1ZMW A;  1TTE A;  2L4E A;  2QSF X;  3T6P A;  1CUK A;  1R4G A;  1A5T A;  1NV8 A;  3GLG E;  2MJ5 B;  1SG9 A;  2EKF A;  4GEW A;  1HQY E;  2JY6 B;  1IXS A;  1E94 E;  2LVN C;  2LVQ D;  1WGL A;  2OOA A;  3MMP A;  2KNA A;  1HT2 E;  2QNJ A;  3IEC A;  2L4F A;  2CWB A;  1PGY A;  2K9D A;  2OOB A;  2DAE A;  2JZ1 A;  1V92 A;  2MR9 A;  4R71 A;  4HEO A;  2R0I A;  3E21 A;  1T43 A;  1IFY A;  2WZJ A;  3FRH A;  2DHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...