2LVQD

Gp78cue domain bound to the proximal ubiquitin of k48-linked diubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/ligase
molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvqD00
2OO9A 2WZJA 1IXSA 1TTEA 2LBCA 2L2DA 2JNHA 2KNZA 3FRHA 1HT1E 1BVSA 2L4FA 3FRIA 2QSFX 1GO5A 2DAKA 3MMPA 2LTUA 1ZMWA 1WGLA 1Y8GA 3IHPA 2JY7A 1ZMUA 1V92A 1T6OA 4R71A 5DFLA 1KYIA 2LVOC 2JP7A 4Q7JA 1WGNA 2QHOB 2DAGA 2DI0A 1OTRA 2CP8A 2MGWA 2O25A 4G3OA 2LVQD 3H4JA 1HJPA 1HT2E 4HEOA 3E21A 1G41A 3GLFE 1XXHE 1DO0A 2LVPC 2ZTDA 1OAIA 3BBZA 1HQYE 2JY8A 2EJSA 1Q02A 4F2LA 1VEGA 2DAEA 1WIVA 2MR9A 3IECA 1MN3A 3E46A 1TR8A 1P3QQ 1T43A 1JR3E 1CUKA 2BWBA 2JY5A 2K0BX 2RRUA 1UFZA 2JUJA 1SG9A 1ZMVA 3GLGE 2HAKA 1PGYA 1NV9A 1VEJA 2DZLA 2G3QA 2LVAA 5JI2E 2B3TA 4DBGB 2CWBA 1VQ1A 3LCUA 1WHCA 3K9PA 1YLAA 2JY6B 1A5TA 1G3IA 1DO2A 2QNJA 3K9OA 2EKFA 1F4IA 1VEKA 2OOAA 3GLHE 3F92A 1AIPC 2OOBA 2JZ1A 2DKLA 1VDLA 1ZV1A 3FE3A 1C7YA 1XB2B 1VG5A 2EKKA 2DNAA 2L4EA 2KNAA 2H5XA 1EFUB 2KHHA 1G4AE 3B89A 4WP2A 1WJ7A 2MJ5B 3T6PA 1OQYA 1DV0A 3LCVB 1OKSA 1WR1B 2DENA 2JZ0A 1QZEA 2DAIA 1R4GA 1NV8A 4F1IA 1E94E 4UN2B 1IM2A 2DHYA 2BWEA 2HWJA 1IFYA 4GEWA 2R0IA 2K9DA 2MROB 2LVNC 2DAMA 2KNVA 3GLIE 2ZTCA
chains in the Genus database with same CATH superfamily
3U6OA 1IN4A 2V6ZM 2C9OA 5E26A 4MH0E 3J81S 3FUTA 3LQQA 2LBCA 4JXJA 4LJ7A 3SATA 4LF7M 1I4WA 2L2DA 1D0MA 2X8AA 3GLIB 4IBGA 4L8RC 2EO2A 3D8BA 2R65A 3SC3A 3FTCA 2JA2A 1IY0A 1ZMWA 2VF7A 1Y8GA 2XF3A 3LMMA 2BNKA 2JY7A 4IIWA 4L4UA 4LZZA 4MGYE 4NC6A 4QHSA 3A98B 1V92A 2DZOB 4AG5A 1T6OA 3GPPA 3NBXX 3VDPA 4R71A 1NY6A 3KFUG 4FCVA 4ITQA 2G8LA 4L78A 2KZUA 3PXGA 1WGNA 4X64M 3V76A 4JN6A 3AOEC 3SYLA 1OTRA 2CUZA 2ZBKB 2QZ4A 3U6EA 3FKEA 3SFZA 3I51A 3AOEA 1DGHA 5F3WA 2CV0A 3HKPA 3KOXE 1HJPA 4HEOA 3L2AA 4GH9A 5IWAM 1G41A 3QYEA 1QANA 1V33A 1DO0A 2LVPC 4LF5M 3AKZA 1OAIA 3KXEC 3SBJA 2MH8A 3HU2A 3L28A 4FCTA 1R7RA 1GJSA 3IG5A 1J7KA 4MGZE 4QNRA 1Z59A 5DNYA 1Q39A 1NNJA 2DAEA 2UUAM 2MR9A 3HHYA 1JR3D 1TDHA 3SYKA 3VKGA 1NNUC 3E46A 3L26A 1T43A 1H6UA 1J5EM 1CUKA 2LHCA 2BWBA 1Z5BA 2EUCA 3SMPA 4JI2M 1Z6TA 3FTEA 1D0KA 3VK7A 5ITQA 3T1YM 2LNHC 1SG9A 4CHTB 3A42A 4LF8M 2UUBM 2HAKA 2DXIA 1NHGC 1IXSB 2DWZB 4GMQA 2DZLA 1NV9A 4DV2M 2UU9M 2KZSA 3W68A 5JI2E 3VFDA 2X49A 3K9PA 2Y20A 1A5TA 4DV3M 4WURA 5EJCA 2FFJA 4CISA 2BJVA 2VQEM 2OOAA 2YNMD 4BB9A 2OPFA 2D7GA 1HR0M 2JWSA 5IREB 4GHLA 1AIPC 2J5YA 2A5YB 4R3DA 2DKLA 1IXZA 3FE3A 2M60A 3DA1A 2BJWA 2KW0A 3KSXA 2CFOA 2HCBA 4DV5M 3VKHA 2XZFA 1EFUB 3HZJA 2W82A 1Q3CA 1VDDA 3ZQJA 4PCZA 3JR4A 4JI1M 4GKKM 3DFZA 4DR3M 4GRIA 2R45A 1LTMA 5FTMA 4D82A 1G8PA 1R5LA 2K6BA 2FE8A 2KDLA 3HGIA 3LCVB 1SXJB 1XC8A 1WR1B 1XXHA 1L1TA 2JZ0A 4GIPA 1IBLM 4AKHA 3GPXA 2FS1A 3QWLA 4IBIA 3LVVA 4KT0F 4B7HA 1XNQM 3AL0C 3GRUA 3TPZA 5EP4A 2DHYA 3PFIA 1N36M 2C98A 2HWJA 1QVRA 1J09A 2R0IA 4RF1A 5EP3A 2LVNC 4DR5M 1HNWM 1N77A 1QDTA 2GQFA 1OAOC 2XH9A 1TH3A 2OO9A 1XWIA 3K2LA 3UJNA 3SASA 1PJIA 3A45A 2CV2A 4EIWA 3SARA 3AV0A 5LMUM 2Y0QA 5FTKA 1ZAEA 1D0LA 2KNZA 3C9PA 1HT1E 1NY5A 2C5RA 2CE7A 2YQZA 1GLNA 2FOIC 3WHLA 2QSFX 4M9ZA 3AOGA 1G71A 2WSEF 2XFTA 2VQFM 4QHTA 1N34M 3HHXA 3NWLA 1WGLA 1C1KA 1DGBA 1ZMUA 4W5WA 2J7NA 2D7HA 2L09A 2RGHA 5DYGA 3VK8A 2N35A 4IJFA 1KYIA 4LFAM 2LVOC 3GRRA 2ERCA 5IZ7D 4DR6M 4LJ4A 3ZH9B 4S12A 2DAGA 4JI4M 2DWNA 3K8ZA 3OTOM 4HL4A 2CP8A 1XMQM 2X4AA 3E9SA 3FUXA 5EXSA 5ITXA 3THGA 5EXTA 3HHZA 3U6QA 2QP9X 1QDRA 2XFSA 1HT2E 4CIZA 1R6BX 1W5TA 3B7ZA 3E21A 4JI7M 2KA6B 1XXHE 3U60B 1NVMA 5EP2A 2ZANA 1IN7A 2ZTDA 2DWMA 1NHWC 3U5ZA 4JI8M 3A46A 4FD2A 3BBZA 4ZPXA 3LQRA 2CHQA 2J7OA 2F5SA 4PDGA 3HHWA 1OIZA 4BLCA 2QCUA 3D8LA 4XGIA 4F2LA 4LFBM 1VEGA 3KW6A 4XK8F 3IECA 4L16A 3C58A 1TR8A 4IBEA 1QYRA 3NBIA 2XLJA 2ZM6M 4BBAA 1MJGM 2R6FA 2JY5A 3ILKA 4I4LA 4DR2M 2CRUA 2O01F 2RRUA 2K47A 1KSFX 1GABA 4M9XA 1UM8A 3U6MA 5C18A 2CEAA 4JYAM 2CV1A 1L1ZA 3PNYA 5IT9S 2XSZA 2B3TA 2M5ZA 2R62A 4K0KM 4NRVA 1Z5CA 4WW0A 1YLAA 1G3IA 4LFCM 3GPYA 4JI3M 3U6CA 3FYCA 1ZQ9A 4LZJA 3SHGB 2QNJA 4I5SA 2XEPA 4LJ5A 1MU5A 1F4IA 2KEBA 3SMSA 2Z8YM 3F92A 2OOBA 4IBFA 5KQDA 2JZ1A 1NJGA 1QQWA 5ITXE 2WSFF 1VDLA 1ZV1A 2XSZD 3J7AS 3FUVA 2DVWB 1W5SA 3SAWA 2H5XA 2KHHA 3B89A 4KO8A 4WP2A 3B7QA 3TL4X 1YUBA 2KXEA 4LGYA 5FTJA 3U61A 2VDBB 1IBKM 2V1UA 4AI6A 4PDIA 4G6ZA 1OKSA 3GO8A 4M9SA 1QUSA 3GLFA 4OVZA 4NOOB 3DZDA 3HWSA 4QNMA 4Z6YA 2F5QA 3J80S 1R4GA 3K1JA 1XHBA 2HKJA 4M0DA 1NV8A 4F1IA 1KFVA 4UN2B 3SAVA 1R2YA 5KPTA 3Q8GA 4KLNA 1IN8A 2MROB 3I01M 4CGYB 4X62M 2Q2EB 1OFIA 3CTWB 4MGKE 4Y28F 3GQ4A 2F5NA 1PJJA 3T38A 5KPRA 1IY1A 1JB0F 1TDZA 1EIJA 3GLHB 1PJQA 1V34A 2WZJA 3KVWA 4IBJA 1T3TA 4KHPM 2Z3XA 1GVNA 4FW9A 5FSWA 1SXJA 2LXEA 3FRHA 4LF4M 1N78A 3T15A 2L4FA 3FRIA 1GO5A 4NSOB 3GLGA 5C1BA 1YE9A 4LJ9A 3MMPA 2LTUA 1L2DA 4M0WA 5BPVA 2H1RA 4Z8XA 4DV6M 2XGNA 3SAUA 3IG8A 2JP7A 3JAMS 2Z7JA 3I4VA 3J7BA 3RGSA 2GNOA 4AQYM 2QHOB 2FH0A 3KOWE 3RFWA 3R9XB 2CHGA 4B3MM 2MGWA 4B3TM 2JXNA 3QYBA 1HNZM 3B74A 4FVMA 3U6SA 4AKGA 1Q3BA 4ANRA 1N33M 4G4NA 3CF0A 3MK6A 5ITYA 3GLFE 1HNXM 5FTLA 1L2CA 1OIPA 1QAQA 2C99A 3I4YA 2JY8A 4B3SM 2EJSA 5EQTA 1IY2A 3B7NA 1Q02A 2CHVA 1E32A 3QAUA 1XXHB 3GQ5A 4HLQA 2FNAA 2QBYA 1PRBA 1PJSA 1IXRC 4AKIA 1WIVA 2DZNB 2L7HA 4LRTA 4RF0A 4NXMM 4OX9M 1P3QQ 4NSRA 1R2ZA 2KRUA 1ORYB 4I8OA 4FCWA 4B7FA 1SXJE 4GITA 2VIIA 2YR0A 5ITRA 4DV1M 1ZMVA 4FWGA 3MJ5A 3GLIA 3GLGE 2R4JA 1K82A 4QOSA 1PGYA 2P5TA 3JR5A 1E9RA 3VLFB 3FUUA 1TF0B 2HHHM 4DBGB 2CWBA 2QPAA 1VQ1A 3HX3A 4MM3B 2APLA 1QAOA 4AZFA 4OU7A 3C3EA 4I81A 4LRSA 4NXNM 4DR7M 2F5PA 2RKOA 2O5RA 4PD2A 4R7GA 3EIEA 1AUAA 1YSYA 2DHRA 1N32M 4G4OA 1FJGM 2RGOA 2DWLA 1IN6A 5EP1A 1C7YA 1XB2B 1VG5A 3U6DA 2L4EA 2UXDM 1TGUA 4RNAA 2ZAOA 4RKUF 2KNAA 2UXCM 1G4AE 3FTDA 1L8QA 5KPZA 4DR1M 1XNRM 1HQCA 2MJ5B 1FNNA 3T6PA 4JI0M 4FWHA 4G4RA 3ZCBB 2E5LM 2QENA 1WXQA 3FTFA 4NRWA 2DENA 4QOZC 4CJ6A 1TH4A 3TQSA 3Q8XA 1QZMA 2DAIA 2WSCF 3GRVA 1E94E 3GRYA 2EA0A 4IBCA 3E4RA 7CATA 3KP0E 3KOZE 3L27A 4II7A 4LF6M 5E6JA 2UUCM 2C96A 4P16A 1PM5A 3KS8A 2K9DA 2R46A 4IJEA 4AG6A 4KODA 5LMNM 4LG2A 1XMOM 2R18A 1IQPA 1JQJC 1OJLA 2LHGA 2R4EA 3CF6E 3GLIE 4DV0M 2ZTCA 4MGHA 1JR3A 1DGGA 4LY6A 3VDUA 5L8RF 1IXSA 1TTEA 4B08A 3BOSA 1DGHB 2G5GX 2JNHA 2L7IA 5GKNA 3UK6A 4D80A 4JV5M 2YFQA 4YHHM 2Z4SA 3UMMA 1BVSA 3GP1A 3HJQA 4OW0A 1NSFA 1PJTA 2DAKA 3HU1A 2R44A 2V1CA 4NL4H 3GQ3A 3IHPA 3J2PB 1QUTA 3FYDA 4DV7M 3TE6A 3AJIB 2Z4RA 4LCBA 2VF8A 3HY5A 4LGMA 4AW4A 3K92A 3LW5F 1DGFA 2F5OA 4P17A 2Y21A 5DFLA 3U6LA 4LJAA 1TH2A 3HJ8A 4IBKA 2AHMA 4Q7JA 1I94M 3AFHA 4PT5A 2I7PA 3U5ZB 1GJTA 3KDSE 3C3DA 4GC9A 4B3RM 4DR4M 3FD9A 5JI3E 2DI0A 3EIHA 5BR8M 2UXBM 3GLHA 2O25A 4G3OA 2LVQD 1L2BA 1Z5AA 4L6V6 3W0FA 3H4JA 1SXJC 3KP1E 3ZC7B 4D81A 2OQ4A 5H37D 5A2QS 3TWKA 3U61B 1K3WA 1X37A 2LWXA 4DUZM 1HQYE 3J27B 4TUWA 3T1HM 3PNVA 3HU3A 4GC5A 2C9CA 1G59A 5KQ8A 3RGPA 1NO1A 3GLFB 4OVZB 3TWLA 1E9SA 2L6OA 2NQ8C 5EXXA 2D7EA 8CATA 3L25A 3UGJA 1S3SA 5DYIA 1MN3A 4YY3M 1IBMM 1JR3E 1GL7A 3M6AA 3LVWA 3KSJA 4B7GA 2K0BX 4DUYM 1SXJD 4G4QA 1RU3A 4IBBA 3SHFA 4LF9M 4L15A 1UFZA 2JUJA 3PVSA 4LJ8A 5KO3A 2Y0TA 4X66M 1LV7A 4GKJM 4MB7A 3KS4A 3GPUA 3H4MA 3BXWA 1VEJA 2G3QA 2LVAA 4FWDA 3CF2A 1N75A 3B9PA 3I04M 3TWMA 4JI6M 3LCUA 5FLXS 1WHCA 2JY6B 1DO2A 3GLGB 3M7GA 4IBDA 2XZUA 3RE8A 3K9OA 2EKFA 1IN5A 2ZAMA 1OFHA 2F4VM 4DV4M 4A3VB 4LJ6A 1VEKA 1GL6A 3WHKA 2QQ8A 3GLHE 3L29A 3R8FA 3M0EA 3CGWA 3HJSA 2DNAA 2EKKA 4JI5M 1WJ7A 3U60A 2HL7A 4MGIE 2KRKA 1OQYA 3W67A 2I7NA 1QAMA 1EE8A 3UZUA 1DV0A 5FTNA 1GKIA 1K3XA 5ITTA 1QZEA 4REZA 1IM2A 3FUWA 2QBYB 1NJFA 2BWEA 3DOAA 1IFYA 4GEWA 5EXPA 1D2NA 3U6PA 1MX0A 3KOYE 3MHVC 3W0LB 2DAMA 5ITUA 4X65M 2KNVA 4XBOA 4GHAA 2LH0A
chains in the Genus database with same CATH topology
2OO9A 2WZJA 1IXSA 1TTEA 2LBCA 2L2DA 2JNHA 2KNZA 3FRHA 1HT1E 1BVSA 2L4FA 3FRIA 2QSFX 1GO5A 2DAKA 3MMPA 2LTUA 1ZMWA 1WGLA 1Y8GA 3IHPA 2JY7A 1ZMUA 1V92A 1T6OA 4R71A 5DFLA 1KYIA 2LVOC 2JP7A 4Q7JA 1WGNA 2QHOB 2DAGA 2DI0A 1OTRA 2CP8A 2MGWA 2O25A 4G3OA 2LVQD 3H4JA 1HJPA 1HT2E 4HEOA 3E21A 1G41A 3GLFE 1XXHE 1DO0A 2LVPC 2ZTDA 1OAIA 3BBZA 1HQYE 2JY8A 2EJSA 1Q02A 4F2LA 1VEGA 2DAEA 1WIVA 2MR9A 3IECA 1MN3A 3E46A 1TR8A 1P3QQ 1T43A 1JR3E 1CUKA 2BWBA 2JY5A 2K0BX 2RRUA 1UFZA 2JUJA 1SG9A 1ZMVA 3GLGE 2HAKA 1PGYA 1NV9A 1VEJA 2DZLA 2G3QA 2LVAA 5JI2E 2B3TA 4DBGB 2CWBA 1VQ1A 3LCUA 1WHCA 3K9PA 1YLAA 2JY6B 1A5TA 1G3IA 1DO2A 2QNJA 3K9OA 2EKFA 1F4IA 1VEKA 2OOAA 3GLHE 3F92A 1AIPC 2OOBA 2JZ1A 2DKLA 1VDLA 1ZV1A 3FE3A 1C7YA 1XB2B 1VG5A 2EKKA 2DNAA 2L4EA 2KNAA 2H5XA 1EFUB 2KHHA 1G4AE 3B89A 4WP2A 1WJ7A 2MJ5B 3T6PA 1OQYA 1DV0A 3LCVB 1OKSA 1WR1B 2DENA 2JZ0A 1QZEA 2DAIA 1R4GA 1NV8A 4F1IA 1E94E 4UN2B 1IM2A 2DHYA 2BWEA 2HWJA 1IFYA 4GEWA 2R0IA 2K9DA 2MROB 2LVNC 2DAMA 2KNVA 3GLIE 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OO9 A;  2WZJ A;  1IXS A;  1TTE A;  2LBC A;  2L2D A;  2JNH A;  2KNZ A;  3FRH A;  1HT1 E;  1BVS A;  2L4F A;  3FRI A;  2QSF X;  1GO5 A;  2DAK A;  3MMP A;  2LTU A;  1ZMW A;  1WGL A;  1Y8G A;  3IHP A;  2JY7 A;  1ZMU A;  1V92 A;  1T6O A;  4R71 A;  5DFL A;  1KYI A;  2LVO C;  2JP7 A;  4Q7J A;  1WGN A;  2QHO B;  2DAG A;  2DI0 A;  1OTR A;  2CP8 A;  2MGW A;  2O25 A;  4G3O A;  2LVQ D;  3H4J A;  1HJP A;  1HT2 E;  4HEO A;  3E21 A;  1G41 A;  3GLF E;  1XXH E;  1DO0 A;  2LVP C;  2ZTD A;  1OAI A;  3BBZ A;  1HQY E;  2JY8 A;  2EJS A;  1Q02 A;  4F2L A;  1VEG A;  2DAE A;  1WIV A;  2MR9 A;  3IEC A;  1MN3 A;  3E46 A;  1TR8 A;  1P3Q Q;  1T43 A;  1JR3 E;  1CUK A;  2BWB A;  2JY5 A;  2K0B X;  2RRU A;  1UFZ A;  2JUJ A;  1SG9 A;  1ZMV A;  3GLG E;  2HAK A;  1PGY A;  1NV9 A;  1VEJ A;  2DZL A;  2G3Q A;  2LVA A;  5JI2 E;  2B3T A;  4DBG B;  2CWB A;  1VQ1 A;  3LCU A;  1WHC A;  3K9P A;  1YLA A;  2JY6 B;  1A5T A;  1G3I A;  1DO2 A;  2QNJ A;  3K9O A;  2EKF A;  1F4I A;  1VEK A;  2OOA A;  3GLH E;  3F92 A;  1AIP C;  2OOB A;  2JZ1 A;  2DKL A;  1VDL A;  1ZV1 A;  3FE3 A;  1C7Y A;  1XB2 B;  1VG5 A;  2EKK A;  2DNA A;  2L4E A;  2KNA A;  2H5X A;  1EFU B;  2KHH A;  1G4A E;  3B89 A;  4WP2 A;  1WJ7 A;  2MJ5 B;  3T6P A;  1OQY A;  1DV0 A;  3LCV B;  1OKS A;  1WR1 B;  2DEN A;  2JZ0 A;  1QZE A;  2DAI A;  1R4G A;  1NV8 A;  4F1I A;  1E94 E;  4UN2 B;  1IM2 A;  2DHY A;  2BWE A;  2HWJ A;  1IFY A;  4GEW A;  2R0I A;  2K9D A;  2MRO B;  2LVN C;  2DAM A;  2KNV A;  3GLI E;  2ZTC A; 
#chains in the Genus database with same CATH topology
 3U6O A;  1IN4 A;  2V6Z M;  2C9O A;  5E26 A;  4MH0 E;  3J81 S;  3FUT A;  3LQQ A;  2LBC A;  4JXJ A;  4LJ7 A;  3SAT A;  4LF7 M;  1I4W A;  2L2D A;  1D0M A;  2X8A A;  3GLI B;  4IBG A;  4L8R C;  2EO2 A;  3D8B A;  2R65 A;  3SC3 A;  3FTC A;  2JA2 A;  1IY0 A;  1ZMW A;  2VF7 A;  1Y8G A;  2XF3 A;  3LMM A;  2BNK A;  2JY7 A;  4IIW A;  4L4U A;  4LZZ A;  4MGY E;  4NC6 A;  4QHS A;  3A98 B;  1V92 A;  2DZO B;  4AG5 A;  1T6O A;  3GPP A;  3NBX X;  3VDP A;  4R71 A;  1NY6 A;  3KFU G;  4FCV A;  4ITQ A;  2G8L A;  4L78 A;  2KZU A;  3PXG A;  1WGN A;  4X64 M;  3V76 A;  4JN6 A;  3AOE C;  3SYL A;  1OTR A;  2CUZ A;  2ZBK B;  2QZ4 A;  3U6E A;  3FKE A;  3SFZ A;  3I51 A;  3AOE A;  1DGH A;  5F3W A;  2CV0 A;  3HKP A;  3KOX E;  1HJP A;  4HEO A;  3L2A A;  4GH9 A;  5IWA M;  1G41 A;  3QYE A;  1QAN A;  1V33 A;  1DO0 A;  2LVP C;  4LF5 M;  3AKZ A;  1OAI A;  3KXE C;  3SBJ A;  2MH8 A;  3HU2 A;  3L28 A;  4FCT A;  1R7R A;  1GJS A;  3IG5 A;  1J7K A;  4MGZ E;  4QNR A;  1Z59 A;  5DNY A;  1Q39 A;  1NNJ A;  2DAE A;  2UUA M;  2MR9 A;  3HHY A;  1JR3 D;  1TDH A;  3SYK A;  3VKG A;  1NNU C;  3E46 A;  3L26 A;  1T43 A;  1H6U A;  1J5E M;  1CUK A;  2LHC A;  2BWB A;  1Z5B A;  2EUC A;  3SMP A;  4JI2 M;  1Z6T A;  3FTE A;  1D0K A;  3VK7 A;  5ITQ A;  3T1Y M;  2LNH C;  1SG9 A;  4CHT B;  3A42 A;  4LF8 M;  2UUB M;  2HAK A;  2DXI A;  1NHG C;  1IXS B;  2DWZ B;  4GMQ A;  2DZL A;  1NV9 A;  4DV2 M;  2UU9 M;  2KZS A;  3W68 A;  5JI2 E;  3VFD A;  2X49 A;  3K9P A;  2Y20 A;  1A5T A;  4DV3 M;  4WUR A;  5EJC A;  2FFJ A;  4CIS A;  2BJV A;  2VQE M;  2OOA A;  2YNM D;  4BB9 A;  2OPF A;  2D7G A;  1HR0 M;  2JWS A;  5IRE B;  4GHL A;  1AIP C;  2J5Y A;  2A5Y B;  4R3D A;  2DKL A;  1IXZ A;  3FE3 A;  2M60 A;  3DA1 A;  2BJW A;  2KW0 A;  3KSX A;  2CFO A;  2HCB A;  4DV5 M;  3VKH A;  2XZF A;  1EFU B;  3HZJ A;  2W82 A;  1Q3C A;  1VDD A;  3ZQJ A;  4PCZ A;  3JR4 A;  4JI1 M;  4GKK M;  3DFZ A;  4DR3 M;  4GRI A;  2R45 A;  1LTM A;  5FTM A;  4D82 A;  1G8P A;  1R5L A;  2K6B A;  2FE8 A;  2KDL A;  3HGI A;  3LCV B;  1SXJ B;  1XC8 A;  1WR1 B;  1XXH A;  1L1T A;  2JZ0 A;  4GIP A;  1IBL M;  4AKH A;  3GPX A;  2FS1 A;  3QWL A;  4IBI A;  3LVV A;  4KT0 F;  4B7H A;  1XNQ M;  3AL0 C;  3GRU A;  3TPZ A;  5EP4 A;  2DHY A;  3PFI A;  1N36 M;  2C98 A;  2HWJ A;  1QVR A;  1J09 A;  2R0I A;  4RF1 A;  5EP3 A;  2LVN C;  4DR5 M;  1HNW M;  1N77 A;  1QDT A;  2GQF A;  1OAO C;  2XH9 A;  1TH3 A;  2OO9 A;  1XWI A;  3K2L A;  3UJN A;  3SAS A;  1PJI A;  3A45 A;  2CV2 A;  4EIW A;  3SAR A;  3AV0 A;  5LMU M;  2Y0Q A;  5FTK A;  1ZAE A;  1D0L A;  2KNZ A;  3C9P A;  1HT1 E;  1NY5 A;  2C5R A;  2CE7 A;  2YQZ A;  1GLN A;  2FOI C;  3WHL A;  2QSF X;  4M9Z A;  3AOG A;  1G71 A;  2WSE F;  2XFT A;  2VQF M;  4QHT A;  1N34 M;  3HHX A;  3NWL A;  1WGL A;  1C1K A;  1DGB A;  1ZMU A;  4W5W A;  2J7N A;  2D7H A;  2L09 A;  2RGH A;  5DYG A;  3VK8 A;  2N35 A;  4IJF A;  1KYI A;  4LFA M;  2LVO C;  3GRR A;  2ERC A;  5IZ7 D;  4DR6 M;  4LJ4 A;  3ZH9 B;  4S12 A;  2DAG A;  4JI4 M;  2DWN A;  3K8Z A;  3OTO M;  4HL4 A;  2CP8 A;  1XMQ M;  2X4A A;  3E9S A;  3FUX A;  5EXS A;  5ITX A;  3THG A;  5EXT A;  3HHZ A;  3U6Q A;  2QP9 X;  1QDR A;  2XFS A;  1HT2 E;  4CIZ A;  1R6B X;  1W5T A;  3B7Z A;  3E21 A;  4JI7 M;  2KA6 B;  1XXH E;  3U60 B;  1NVM A;  5EP2 A;  2ZAN A;  1IN7 A;  2ZTD A;  2DWM A;  1NHW C;  3U5Z A;  4JI8 M;  3A46 A;  4FD2 A;  3BBZ A;  4ZPX A;  3LQR A;  2CHQ A;  2J7O A;  2F5S A;  4PDG A;  3HHW A;  1OIZ A;  4BLC A;  2QCU A;  3D8L A;  4XGI A;  4F2L A;  4LFB M;  1VEG A;  3KW6 A;  4XK8 F;  3IEC A;  4L16 A;  3C58 A;  1TR8 A;  4IBE A;  1QYR A;  3NBI A;  2XLJ A;  2ZM6 M;  4BBA A;  1MJG M;  2R6F A;  2JY5 A;  3ILK A;  4I4L A;  4DR2 M;  2CRU A;  2O01 F;  2RRU A;  2K47 A;  1KSF X;  1GAB A;  4M9X A;  1UM8 A;  3U6M A;  5C18 A;  2CEA A;  4JYA M;  2CV1 A;  1L1Z A;  3PNY A;  5IT9 S;  2XSZ A;  2B3T A;  2M5Z A;  2R62 A;  4K0K M;  4NRV A;  1Z5C A;  4WW0 A;  1YLA A;  1G3I A;  4LFC M;  3GPY A;  4JI3 M;  3U6C A;  3FYC A;  1ZQ9 A;  4LZJ A;  3SHG B;  2QNJ A;  4I5S A;  2XEP A;  4LJ5 A;  1MU5 A;  1F4I A;  2KEB A;  3SMS A;  2Z8Y M;  3F92 A;  2OOB A;  4IBF A;  5KQD A;  2JZ1 A;  1NJG A;  1QQW A;  5ITX E;  2WSF F;  1VDL A;  1ZV1 A;  2XSZ D;  3J7A S;  3FUV A;  2DVW B;  1W5S A;  3SAW A;  2H5X A;  2KHH A;  3B89 A;  4KO8 A;  4WP2 A;  3B7Q A;  3TL4 X;  1YUB A;  2KXE A;  4LGY A;  5FTJ A;  3U61 A;  2VDB B;  1IBK M;  2V1U A;  4AI6 A;  4PDI A;  4G6Z A;  1OKS A;  3GO8 A;  4M9S A;  1QUS A;  3GLF A;  4OVZ A;  4NOO B;  3DZD A;  3HWS A;  4QNM A;  4Z6Y A;  2F5Q A;  3J80 S;  1R4G A;  3K1J A;  1XHB A;  2HKJ A;  4M0D A;  1NV8 A;  4F1I A;  1KFV A;  4UN2 B;  3SAV A;  1R2Y A;  5KPT A;  3Q8G A;  4KLN A;  1IN8 A;  2MRO B;  3I01 M;  4CGY B;  4X62 M;  2Q2E B;  1OFI A;  3CTW B;  4MGK E;  4Y28 F;  3GQ4 A;  2F5N A;  1PJJ A;  3T38 A;  5KPR A;  1IY1 A;  1JB0 F;  1TDZ A;  1EIJ A;  3GLH B;  1PJQ A;  1V34 A;  2WZJ A;  3KVW A;  4IBJ A;  1T3T A;  4KHP M;  2Z3X A;  1GVN A;  4FW9 A;  5FSW A;  1SXJ A;  2LXE A;  3FRH A;  4LF4 M;  1N78 A;  3T15 A;  2L4F A;  3FRI A;  1GO5 A;  4NSO B;  3GLG A;  5C1B A;  1YE9 A;  4LJ9 A;  3MMP A;  2LTU A;  1L2D A;  4M0W A;  5BPV A;  2H1R A;  4Z8X A;  4DV6 M;  2XGN A;  3SAU A;  3IG8 A;  2JP7 A;  3JAM S;  2Z7J A;  3I4V A;  3J7B A;  3RGS A;  2GNO A;  4AQY M;  2QHO B;  2FH0 A;  3KOW E;  3RFW A;  3R9X B;  2CHG A;  4B3M M;  2MGW A;  4B3T M;  2JXN A;  3QYB A;  1HNZ M;  3B74 A;  4FVM A;  3U6S A;  4AKG A;  1Q3B A;  4ANR A;  1N33 M;  4G4N A;  3CF0 A;  3MK6 A;  5ITY A;  3GLF E;  1HNX M;  5FTL A;  1L2C A;  1OIP A;  1QAQ A;  2C99 A;  3I4Y A;  2JY8 A;  4B3S M;  2EJS A;  5EQT A;  1IY2 A;  3B7N A;  1Q02 A;  2CHV A;  1E32 A;  3QAU A;  1XXH B;  3GQ5 A;  4HLQ A;  2FNA A;  2QBY A;  1PRB A;  1PJS A;  1IXR C;  4AKI A;  1WIV A;  2DZN B;  2L7H A;  4LRT A;  4RF0 A;  4NXM M;  4OX9 M;  1P3Q Q;  4NSR A;  1R2Z A;  2KRU A;  1ORY B;  4I8O A;  4FCW A;  4B7F A;  1SXJ E;  4GIT A;  2VII A;  2YR0 A;  5ITR A;  4DV1 M;  1ZMV A;  4FWG A;  3MJ5 A;  3GLI A;  3GLG E;  2R4J A;  1K82 A;  4QOS A;  1PGY A;  2P5T A;  3JR5 A;  1E9R A;  3VLF B;  3FUU A;  1TF0 B;  2HHH M;  4DBG B;  2CWB A;  2QPA A;  1VQ1 A;  3HX3 A;  4MM3 B;  2APL A;  1QAO A;  4AZF A;  4OU7 A;  3C3E A;  4I81 A;  4LRS A;  4NXN M;  4DR7 M;  2F5P A;  2RKO A;  2O5R A;  4PD2 A;  4R7G A;  3EIE A;  1AUA A;  1YSY A;  2DHR A;  1N32 M;  4G4O A;  1FJG M;  2RGO A;  2DWL A;  1IN6 A;  5EP1 A;  1C7Y A;  1XB2 B;  1VG5 A;  3U6D A;  2L4E A;  2UXD M;  1TGU A;  4RNA A;  2ZAO A;  4RKU F;  2KNA A;  2UXC M;  1G4A E;  3FTD A;  1L8Q A;  5KPZ A;  4DR1 M;  1XNR M;  1HQC A;  2MJ5 B;  1FNN A;  3T6P A;  4JI0 M;  4FWH A;  4G4R A;  3ZCB B;  2E5L M;  2QEN A;  1WXQ A;  3FTF A;  4NRW A;  2DEN A;  4QOZ C;  4CJ6 A;  1TH4 A;  3TQS A;  3Q8X A;  1QZM A;  2DAI A;  2WSC F;  3GRV A;  1E94 E;  3GRY A;  2EA0 A;  4IBC A;  3E4R A;  7CAT A;  3KP0 E;  3KOZ E;  3L27 A;  4II7 A;  4LF6 M;  5E6J A;  2UUC M;  2C96 A;  4P16 A;  1PM5 A;  3KS8 A;  2K9D A;  2R46 A;  4IJE A;  4AG6 A;  4KOD A;  5LMN M;  4LG2 A;  1XMO M;  2R18 A;  1IQP A;  1JQJ C;  1OJL A;  2LHG A;  2R4E A;  3CF6 E;  3GLI E;  4DV0 M;  2ZTC A;  4MGH A;  1JR3 A;  1DGG A;  4LY6 A;  3VDU A;  5L8R F;  1IXS A;  1TTE A;  4B08 A;  3BOS A;  1DGH B;  2G5G X;  2JNH A;  2L7I A;  5GKN A;  3UK6 A;  4D80 A;  4JV5 M;  2YFQ A;  4YHH M;  2Z4S A;  3UMM A;  1BVS A;  3GP1 A;  3HJQ A;  4OW0 A;  1NSF A;  1PJT A;  2DAK A;  3HU1 A;  2R44 A;  2V1C A;  4NL4 H;  3GQ3 A;  3IHP A;  3J2P B;  1QUT A;  3FYD A;  4DV7 M;  3TE6 A;  3AJI B;  2Z4R A;  4LCB A;  2VF8 A;  3HY5 A;  4LGM A;  4AW4 A;  3K92 A;  3LW5 F;  1DGF A;  2F5O A;  4P17 A;  2Y21 A;  5DFL A;  3U6L A;  4LJA A;  1TH2 A;  3HJ8 A;  4IBK A;  2AHM A;  4Q7J A;  1I94 M;  3AFH A;  4PT5 A;  2I7P A;  3U5Z B;  1GJT A;  3KDS E;  3C3D A;  4GC9 A;  4B3R M;  4DR4 M;  3FD9 A;  5JI3 E;  2DI0 A;  3EIH A;  5BR8 M;  2UXB M;  3GLH A;  2O25 A;  4G3O A;  2LVQ D;  1L2B A;  1Z5A A;  4L6V 6;  3W0F A;  3H4J A;  1SXJ C;  3KP1 E;  3ZC7 B;  4D81 A;  2OQ4 A;  5H37 D;  5A2Q S;  3TWK A;  3U61 B;  1K3W A;  1X37 A;  2LWX A;  4DUZ M;  1HQY E;  3J27 B;  4TUW A;  3T1H M;  3PNV A;  3HU3 A;  4GC5 A;  2C9C A;  1G59 A;  5KQ8 A;  3RGP A;  1NO1 A;  3GLF B;  4OVZ B;  3TWL A;  1E9S A;  2L6O A;  2NQ8 C;  5EXX A;  2D7E A;  8CAT A;  3L25 A;  3UGJ A;  1S3S A;  5DYI A;  1MN3 A;  4YY3 M;  1IBM M;  1JR3 E;  1GL7 A;  3M6A A;  3LVW A;  3KSJ A;  4B7G A;  2K0B X;  4DUY M;  1SXJ D;  4G4Q A;  1RU3 A;  4IBB A;  3SHF A;  4LF9 M;  4L15 A;  1UFZ A;  2JUJ A;  3PVS A;  4LJ8 A;  5KO3 A;  2Y0T A;  4X66 M;  1LV7 A;  4GKJ M;  4MB7 A;  3KS4 A;  3GPU A;  3H4M A;  3BXW A;  1VEJ A;  2G3Q A;  2LVA A;  4FWD A;  3CF2 A;  1N75 A;  3B9P A;  3I04 M;  3TWM A;  4JI6 M;  3LCU A;  5FLX S;  1WHC A;  2JY6 B;  1DO2 A;  3GLG B;  3M7G A;  4IBD A;  2XZU A;  3RE8 A;  3K9O A;  2EKF A;  1IN5 A;  2ZAM A;  1OFH A;  2F4V M;  4DV4 M;  4A3V B;  4LJ6 A;  1VEK A;  1GL6 A;  3WHK A;  2QQ8 A;  3GLH E;  3L29 A;  3R8F A;  3M0E A;  3CGW A;  3HJS A;  2DNA A;  2EKK A;  4JI5 M;  1WJ7 A;  3U60 A;  2HL7 A;  4MGI E;  2KRK A;  1OQY A;  3W67 A;  2I7N A;  1QAM A;  1EE8 A;  3UZU A;  1DV0 A;  5FTN A;  1GKI A;  1K3X A;  5ITT A;  1QZE A;  4REZ A;  1IM2 A;  3FUW A;  2QBY B;  1NJF A;  2BWE A;  3DOA A;  1IFY A;  4GEW A;  5EXP A;  1D2N A;  3U6P A;  1MX0 A;  3KOY E;  3MHV C;  3W0L B;  2DAM A;  5ITU A;  4X65 M;  2KNV A;  4XBO A;  4GHA A;  2LH0 A; 
#chains in the Genus database with same CATH homology
 2OO9 A;  2WZJ A;  1IXS A;  1TTE A;  2LBC A;  2L2D A;  2JNH A;  2KNZ A;  3FRH A;  1HT1 E;  1BVS A;  2L4F A;  3FRI A;  2QSF X;  1GO5 A;  2DAK A;  3MMP A;  2LTU A;  1ZMW A;  1WGL A;  1Y8G A;  3IHP A;  2JY7 A;  1ZMU A;  1V92 A;  1T6O A;  4R71 A;  5DFL A;  1KYI A;  2LVO C;  2JP7 A;  4Q7J A;  1WGN A;  2QHO B;  2DAG A;  2DI0 A;  1OTR A;  2CP8 A;  2MGW A;  2O25 A;  4G3O A;  2LVQ D;  3H4J A;  1HJP A;  1HT2 E;  4HEO A;  3E21 A;  1G41 A;  3GLF E;  1XXH E;  1DO0 A;  2LVP C;  2ZTD A;  1OAI A;  3BBZ A;  1HQY E;  2JY8 A;  2EJS A;  1Q02 A;  4F2L A;  1VEG A;  2DAE A;  1WIV A;  2MR9 A;  3IEC A;  1MN3 A;  3E46 A;  1TR8 A;  1P3Q Q;  1T43 A;  1JR3 E;  1CUK A;  2BWB A;  2JY5 A;  2K0B X;  2RRU A;  1UFZ A;  2JUJ A;  1SG9 A;  1ZMV A;  3GLG E;  2HAK A;  1PGY A;  1NV9 A;  1VEJ A;  2DZL A;  2G3Q A;  2LVA A;  5JI2 E;  2B3T A;  4DBG B;  2CWB A;  1VQ1 A;  3LCU A;  1WHC A;  3K9P A;  1YLA A;  2JY6 B;  1A5T A;  1G3I A;  1DO2 A;  2QNJ A;  3K9O A;  2EKF A;  1F4I A;  1VEK A;  2OOA A;  3GLH E;  3F92 A;  1AIP C;  2OOB A;  2JZ1 A;  2DKL A;  1VDL A;  1ZV1 A;  3FE3 A;  1C7Y A;  1XB2 B;  1VG5 A;  2EKK A;  2DNA A;  2L4E A;  2KNA A;  2H5X A;  1EFU B;  2KHH A;  1G4A E;  3B89 A;  4WP2 A;  1WJ7 A;  2MJ5 B;  3T6P A;  1OQY A;  1DV0 A;  3LCV B;  1OKS A;  1WR1 B;  2DEN A;  2JZ0 A;  1QZE A;  2DAI A;  1R4G A;  1NV8 A;  4F1I A;  1E94 E;  4UN2 B;  1IM2 A;  2DHY A;  2BWE A;  2HWJ A;  1IFY A;  4GEW A;  2R0I A;  2K9D A;  2MRO B;  2LVN C;  2DAM A;  2KNV A;  3GLI E;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...