1NSFA

D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
KPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR
publication title Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Protein transport
total genus 84
structure length 247
sequence length 247
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nsfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nsfA01
4BFTA 1E0JA 2QBYA 3UMSA 1UM8A 3FB4A 3WP0A 1B0UA 2OXRA 3BE4A 4D0LB 3QIAA 3B1ZA 4DKXA 3EWSA 1GRNA 1QHYA 4FINA 4O2RA 4ZO4A 3TMKA 3TVDA 1Q20A 4P4TA 3B1YA 4Z54A 1M34E 1U8AA 4CVNA 3B60A 4EPVA 4K81B 4L9SA 4M1TA 2GESA 2QT1A 1II8A 2G77B 3GJ6A 3H86A 4NMMA 3M6AA 3LW7A 1EGAA 3EARA 3LXRA 3OIUA 1ZAKA 4PSAA 1W49A 5EXXA 2YC4C 5K8TA 3CRQA 1E9SA 1ZIOA 5FPSA 4JMPA 1U99A 1PJRA 3AF1A 4JSYA 3Q9LA 2WSMA 2X1VA 3NIBA 4M1WA 4TYPA 5AUOB 3ASYA 5H1YA 4S35A 3SS8A 1QHHA 2C95A 1IHUA 3ZIAD 4QFMA 1VTKA 3ZH9B 3KJGA 1DADA 3C7KA 3SQWA 1OKKA 2NG1A 5DISB 1ZD8A 1KMHA 3KZ1E 3S1AB 2Q3FA 1HY3A 2DR3A 4H1VA 4KU4A 1LW7A 4HZUB 3RAPR 2B8TA 2KRKA 1G17A 2NTYC 3Q72A 2RB4A 4I1VA 1W1WA 4PZYA 3SJAA 4W5WA 4NCHA 1FOEB 4KI0A 4A36A 2IWHA 3NKVA 1MO4A 4LPSA 3R9IA 2NO7A 1GWNA 4U02A 3KW6A 3I4LA 1ZUNB 5BQ5A 1GITA 2O8EB 3RRZA 1L8QA 4FWHA 3M0EA 1BMFA 4ZDIA 1FX0B 3QPWA 4Z1MA 4HB0A 3SZRA 2OO7A 4NZYA 1YU9A 3CR8A 3DZ8A 4EQ6B 2FFQA 4Q1FA 121PA 3FYHA 3TUIC 4UNPA 3OIYA 1Q12A 2GZAA 1NRJB 3CRW1 5SZJA 2FG5A 2FPLA 1D2EA 2PH1A 3DVLA 2TMKA 5B2ZA 4D80A 3RSLA 1JBKA 4WVFA 4M9QA 2GJ8A 1Z6AA 2IWRA 3BJIC 2F9MA 4QBFA 2ZRLA 3SHFA 3PUXA 2WAYA 5D3QA 2FNAA 1QHXA 1R2QA 2O52A 3MMPA 4EPRA 3U6KA 3ICEA 1W46A 4RZXA 5DH9A 1P60A 5GVSA 4NE2A 4NHOA 3HR7A 2BMDA 4XTCS 3QXCA 1UKYA 1X8JA 2F9LA 2CL7X 2HCJB 3K0FB 3TR0A 2YVUA 4A1FA 5FBRB 5P21A 4ASUD 4FMDB 4UNNA 3O8DA 1G16A 1FUUA 3QXJA 4TSFD 1X37A 1ZU4A 4XWKA 1AZSC 2KE5A 2J0VA 1KTVA 4PFSA 4F4IA 2AWOA 2QU8A 1IBRA 1ONBA 2OESA 2W6JD 1RRPA 4D0GA 2FX3A 1CIPA 2GK7A 3EZFA 3JZMA 3D3QA 4TYYA 1QZMA 4KFRA 1XJCA 3A1UA 3E5HA 1NG9A 3EA5A 4OI4A 4ZKDA 2ODWA 4TLEA 4ITRC 3WP1B 5JS8A 4OL0A 4N0DA 2DFKB 5EE1A 4Z8XA 5C18A 1HEIA 4D2IA 2OAP1 2W0SA 1US8B 4OI0A 4E09A 1ZRHA 5AUPB 1KO7A 2ANCA 2W00A 4QG7A 1ODFA 3VAAA 5EP4A 3I5YA 2CLSA 4NTZA 3LVRE 4HZUA 4CEIB 1IXSB 2V1UA 1VHTA 4M21A 3TQCA 4DB2A 2VBCA 1AJEA 1DO0A 2CCKA 4M9SA 3VQTA 3CBQA 1A2KC 4OHVA 3ZVMA 4US2R 4Q00A 4H9GA 4PAMA 4BFUA 2JLVA 4GT1A 5GJBA 3VR3A 1EFHA 4RY2A 3TSZA 3WMGA 4DJTA 1MRSA 3EC2A 2PEZA 2O8EA 1NN5A 2CK3A 4P4SB 4UNRA 1W44A 2ZSAA 3RWMB 1FX0A 4JSTA 1PLLA 4IOMA 2BM0A 4Y0VA 1D5CA 1SVWA 1JXMA 3HR8A 2WJIA 2GJKA 3EXAA 4RZ2A 4EQ6A 2EVWX 2JJ1D 4Q4HB 1OXUA 2AFHE 5M04A 1CEEA 2H57A 1WDTA 5JLJA 1CF4A 2BBOA 5JJKA 1ZNWA 4FIDA 4K8OA 2E87A 4JL8A 4KO8A 2WIBA 1RZ3A 2BV3A 5JI2E 5DLQC 5EZ6B 1AGPA 2GWHA 2WAXA 2XAUA 1OFUX 2V7QA 3SOPA 2JLYA 5EP2A 1ZVQA 4JBXA 4RD2A 1D9XA 3VR5A 2DB3A 3A8TA 1DPFA 1KNXA 4S2EA 2WKPA 2H5EA 2VSOA 2VIIA 1LF5A 1A4RA 1E96A 2EQBA 5GJWC 4QJ4A 1Q44A 1F5NA 1OW3B 1GRRA 3IQXA 4L16A 1XMVA 1T5LA 4MRRA 4Q1AA 5HCNA 3QBVA 1HE8B 1GKUB 1R5BA 4X8OA 2ZPTX 1ZNYA 3VLFB 3A4LA 3LX8A 2WSSA 3IO3A 4NYJQ 5BW8A 2VF8A 1ESMA 1HUQA 1NVUQ 3F3YA 4I4LA 5GJCA 3THOA 2A5YB 4GSYA 1OH6A 2BIFA 2DZOB 2P0EA 3IUYA 1F48A 2GETA 4Q4LA 3BFXA 2WOOA 2FF7A 3K70B 2GCPA 2G88A 3IHLA 3LLMA 4OK5A 1U98A 1XPOA 4MKFA 3TNFA 2J7PA 1T3HA 4LRSA 3R8FA 1IOZA 2ZRFA 5FPYA 4HAVA 1KO4A 1UBCA 1W7AA 4LV8B 3AVXA 1FL9A 1US8A 2ZRMA 3A36A 3OEEA 2CMKA 4Q9KA 3LDAA 1Q21A 1KY3A 3RLFA 4AYWA 4PHGA 2PT7A 3BRWD 1XXHE 4PPFA 1X8KA 2IA5A 4UNSA 2ZU6A 4G5RA 1E79D 5GVRA 4CEIA 3WHKA 2ZUCA 3UG7A 5IK2D 5H70A 1XTRA 1R10A 4DLZA 3RS4A 4BRUA 1S9HA 4A2PA 2LKDA 5JWOA 4A8JB 1KI2A 1OHHD 3P27A 4G5SA 3RWOA 1Y3AA 4IDHA 3PR1A 3T1TA 3LW8A 3Q85A 1PV4A 4LJ4A 1N5LA 2MSDB 3SBEA 2JGNA 2N1BA 5CITA 4NU0A 1MO5A 2IYWA 3BB4A 3CF0A 2OBLA 2C98A 2OEPA 4XJXA 2ZRBA 5FFMA 4Q4HA 2HXSA 4LHXA 4CEHB 3IIMA 1SVIA 4IXMA 3SJBA 1XZPA 2ZM5A 4DLUA 1G5PA 3ONWA 1Z0AA 4V02A 5BWMA 4J0QA 5JZVA 1E94E 2ZI4A 2I1QA 4I1OA 3KQHA 1OFIA 4QM7A 3NC1C 3BD9A 4UJ5A 3PENA 3IIJA 4DCNA 4BQSA 3EIQA 1G3UA 1BIFA 2GA8A 3CNNA 1YZLA 4WXPA 4DSNA 2IYYA 3PXGA 3QVVA 4GRAA 1RVDA 1Q1EA 2IT1A 4PSKA 5JRZA 1VHLA 4QHTA 1G291 3BGWA 3AUXA 1LNZA 3IEVA 4YMSA 3CRRA 3VHXA 4KITB 3LX5A 1JJVA 2PLFA 3VKWA 4FD2A 1AS0A 3DDCA 4TL7A 5FUXA 4D0NA 4JVMA 3PUWA 1EX7A 2D4HA 2X8AA 5FL7D 5KNDA 1GAJA 2PEYA 4KFTA 4R2IA 2WWGA 3QG5A 1QRAA 3ZQJA 3VKHA 1KDTA 2WHXA 1Z6GA 2XX3A 4Q7KA 4L15A 1BYIA 2IF0A 1HT2E 4HSEA 4F92B 3IDQA 2QL6A 2IC5A 1COWA 4FW9A 2XSZA 1KSGA 1KI7A 2J46A 3MWLA 1DVRA 3UPUA 3Q5DA 3X1ZA 1EFUA 5JS7A 2GEUA 4EKDA 4X8LA 2PCJA 4FMCF 2N46A 3LLUA 3A4MA 3A6PC 2ZE8A 3CH4B 2RKOA 2XB2A 5HCIA 2JDID 3K8YA 1MOZA 1SKQA 2FH5B 5HE8A 4GDFA 1YRAA 4IJMA 4A8JA 4BFVA 1G8GA 2QPOA 1WBDA 4PAOA 3SFZA 1NVVQ 4PC3A 3SI7A 4B3XA 3R9XA 1KDOA 1VCOA 1AZTA 1WCV1 2Q0HA 1IY2A 1UKVY 1GL6A 1YZGA 2CBZA 2CCGA 1E2NA 4FWGA 1XJQA 3DKVA 4ZDJA 4A0RA 2AKAB 4R98A 2VQSA 2GCNA 1E2EA 5FBLB 2A5JA 2QP3A 2KI5A 2RGNC 1QVAA 1I4LD 3LBHA 3W3AA 4WBSA 3P26A 1NY6A 1W0KD 2I3BA 2VHUA 1I2DA 3B5JA 4B43A 1XMSA 2R6DA 1VYUA 4CEHA 2PLRA 4ACAA 4JKIA 1OB5A 2GXAA 3SYKA 1AN0A 4HLCA 3CPEA 1PUIA 2ODEA 1E0KA 4HLUA 1E9FA 1RW4A 5CDFE 3CUEF 1IXRC 2ATXA 4MYCA 1T91A 4N1AA 3QY0A 521PA 4B73A 3B1WA 3LWNA 5C46F 1X8LA 3K9NA 2J0QA 2H92A 4EFNA 1E9BA 1P7CA 3NHAA 4LX0A 4DSOA 1L4YA 2ZE5A 2GXUA 3QF4A 4OQNA 1KZ7B 2QTFA 3UWKA 4CIDA 5JFGA 1PLJA 4LV5B 2C9CA 4OHWA 2W6IA 3T12A 2ZJBA 1KDPA 4HAUA 2ZRIA 4A3VB 1E1QA 2OE2A 2CE7A 5JI3E 1CR4A 4Q7LA 2NO6A 4BRWA 1CJVC 4PPGA 1FMJA 4CEJB 2VH5R 2CCJA 4M53A 4TMVA 4ESVA 1IN5A 4US0R 2XNSA 3DO6A 1N5IA 1KHTA 3ND9A 2EWVA 4DIDA 2P2LA 3PV0A 1N5JA 4PPQA 5DIFA 3IO5A 2IS1A 2ERXA 4FMCB 4HZIA 3LNCA 2K5UA 4Q4JB 2O8CA 1Y63A 4QRHA 2WZQA 3TE6A 3EPHA 4W5HA 2QM8A 3V4RA 1P2UA 1W4RA 4IVQA 3K70C 4RCYA 1CBUA 4KYIB 3W6NA 4IDQA 1F2UB 2VP4A 4DLYA 3I5XA 2AK2A 2J7KA 1TTTA 2YNMA 1I4DD 1S8FA 1YRBA 2KBFA 2ZS9A 4MGKR 3ZD6A 1SXJA 3B8HA 4GI7A 3VR2A 2QGZA 1KI4A 3LA6A 2WM9B 2OZEA 4HB2A 4CW7A 4TMTA 721PA 1R4AA 4DLVA 4TQUS 1IONA 2F7SA 2VP6A 4LBWA 2QEQA 2IYUA 3MHVC 2FFBA 3OAAD 1JXOA 4RKEA 2ZYWX 1LFDB 4NYIQ 3G5UA 2A5GA 4GZMA 3KJEA 3BWDD 5G53C 4IRUB 3AF2A 2X77A 4PZZA 3MRSA 4JZKA 2G0TA 1NMXA 3ASZA 3KFXA 4JVNA 4Q47A 3RS5A 4LCBA 3B9PA 3KX2A 2OCAA 2VEDA 2RAPA 2WWHA 1QHIA 4MA4A 2QY9A 3HPRA 4G1UC 3HP1A 1LS1A 2GK6A 3I8XA 3L82B 4A6PA 1B23P 1YZUA 4F91B 1E2MA 2GF9A 1NN1A 3BH6A 4B3BA 2QRZA 3C5HA 3CKLA 1E4YA 1UEIA 2WJHA 3QF7A 2ZUDA 3E70C 5GJVC 1TQ4A 1DAIA 5JSZB 2ZUBA 2QBYB 4HLUC 2XB4A 2XEXA 4ZI3A 1WQ1R 4FXPA 2EU8A 3UWOA 4RCZA 2RCNA 1G64A 5FPKA 4I1SA 1OJLA 1E2GA 5JHHB 3LH5A 1DEKA 2IXGA 2JA1A 5DE3A 1PVOA 4Q01A 3CNLA 1NJFA 4BEJA 1NKTA 2PBRA 4QGFA 4DVGA 2A3RA 4BZQA 2GTPA 2ODBA 3REFA 1NN0A 3W8NA 4TMZA 1CU1A 1HQCA 3P1JA 5J4KA 2ZANA 1EX6A 1ZC3A 4A0GA 1TF5A 5C2JB 1Z6TA 2GKSA 5FPTA 3AVWA 2WV9A 2G1KA 2YOHA 4GOXA 2OXCA 1S3SA 4EDHA 4RKFA 1JQJC 2V6ZM 2FOLA 2FU5C 3QENA 1XPRA 1FTSA 2NOAA 4CEJA 4HLQB 3ICQB 2J5XA 1N2CE 3EX7C 5JHGB 3W9YA 4UJ3A 2Q9CA 3LRPA 2ZRJA 5E4FA 4FWTA 3MJHA 1G3QA 2XTZA 2J41A 3EASA 1ZBDA 4YMUA 3FVQA 4Q5IA 1OXTA 5AUQA 4LI0A 5LB2A 3K0SA 4RFSB 4A15A 5CK4A 2JJ2A 2DWZB 5G3YA 3D31A 2QI9C 1FPMA 2IEZA 2B92A 2WIAA 2ZYTX 1UEJA 3K09A 2FZLA 2RMKA 2BJVA 2ZROA 1KKLA 3C4JA 2J0UB 1N25A 1CJUC 1F2UA 2VSXA 3QNUA 5DI3B 3I8SA 5EUMA 1DG3A 3MWKA 1J99A 2WMNB 3NEYA 2P65A 4Q19A 4XD7A 4KAXA 3RS0A 1P75A 3O47A 2HEIA 3EIEA 3BORA 1T6NA 2FA9A 3KTAA 2YV5A 1G3IA 4L9WA 1WBBA 4YMWA 3RABA 3CX8A 3NH6A 4URVR 2OCBA 4DT1B 2OLJA 1KI3A 1FFHA 4UKDA 1OLOA 1Z07A 3GEHA 4BFWA 4CRWB 5FUWA 3ADBA 2VSFA 3FMOB 2HLDD 4TL9A 2R6CA 4LYJA 4AYTA 5UKDA 1DAGA 1T3SA 1ZU5A 1FMLA 4O3MA 2BVNA 3REGA 1VG0B 1YQTA 3SJZA 3K0EA 4ON9A 3G82C 3X1WA 4X8MA 3NTUA 4BPBA 1QHSA 2A5FA 2QTVB 4GITA 4DIEA 3ZIAA 3WNCA 1FNNA 4P32A 2BMFA 6Q21A 3WRYC 1M7BA 3VKGA 1NF3A 2W58A 3T35A 2O0KA 1H65A 4LGMA 3DKPA 4DLSA 5FTNA 4MDEA 1MO3A 2QMEA 3ZQ6A 2JLUA 1R6BX 4DCSA 1ZM2A 4BLOA 3T1QA 3QKRB 5JSZA 4OK6A 1W0JD 4US1R 1RJ9B 1XCPA 3TIFA 3IILA 4LOAA 3HYRA 221PA 2O0JA 2O5VA 4MUBA 3ZVRA 2C03A 1R0YA 1XWIA 3NXSA 4GPTA 5CYOA 4TQAA 1R8QA 1GTVA 3QXSA 4M1YA 4JLOA 3CX6A 2YJTD 2OG2A 4XWAA 1AM4D 1KIMA 1CULC 5BYKA 2AWNA 2RGGA 3TH5A 1P5ZB 3KQNA 1A1VA 1I2MA 2FZ4A 4PR0A 4DZZA 2HT6A 2WKQA 2ZITA 4LJ5A 4I99A 1G3MA 5FOTA 1KK2A 1M1YE 1NMYA 1EFTA 3IQWA 2WWWA 2NZJA 3AF4A 4QHYA 1E69A 3RVBA 1GDDA 3AKYA 3CNOA 4YQFA 2V3CC 4POAA 4FMDF 4Q03A 5G3ZA 1BOFA 1Q1QA 2ZQ5A 2Q3MA 1U9IC 2IUUA 4B2IA 3T5GA 2GBLC 1NI3A 2ZSFA 4JLPA 1CJMA 3LO5A 3KXLA 4QXAA 3B82A 1CJTC 4PX9A 2DFTA 4RFSA 2JIZA 3U3JA 2V4ZA 4R9UC 3I72A 3C16C 3B2EA 2UZ3A 3L2OB 1CR1A 1UADA 3QEOA 1RC8A 4AKEA 3CF2A 3K09C 3AP3A 4GMXA 2AR7A 2QAGB 2J0UA 4MH0R 5DI3A 3T1OA 2P67A 3K9LA 2BBTA 5EE5B 4IFEA 1U8ZA 4AWXA 2VLIA 4LZZA 3I1FA 4KV9A 2XXAB 3UATA 1RRFA 3AVYA 2JLRA 4ASUA 1RRCA 4MRSA 1ZUIA 3EZ7A 3NBXX 4TLAA 4AD8A 1X1SA 2QG6A 4HAWA 2FFAA 2QPTA 2BEKA 3C5CA 3CWQA 4URWR 4TZ6A 2EFGA 2RGXA 3ZS8A 2VP9A 1AS2A 1W4BA 1Z0IA 2W6JA 4FN5A 4CZ2A 4CGZA 4DT1A 4A4DA 2BDTA 2BBWA 1P9WA 4LRTA 1XZQA 3K53A 4D4JA 4Z51A 1X3SA 1KK0A 2EFEB 2D2EA 4URZR 4XVUA 5JWRA 4JLNA 1XXHB 3HU1A 3FFBA 3QKSB 4B74A 4D4KA 1MT0A 1CXZA 3EW9A 3TUJC 1JAIA 1E0AA 3AJIB 1LF0A 1R8SA 2QT0A 3DOEA 4JL6A 5CJPA 4QBHA 4TMXA 3AVUA 5KU1A 2YWEA 1KJZA 1E2KA 1N6HA 3Q7PA 3B9QA 5FR2A 3V4FA 4YMVA 4ZV4A 3AVQA 2KSQA 3GD7A 5DNYB 3QKUA 2OUKA 3O8BA 1G7TA 4XVRA 2GAAA 4Q48A 3K0CC 4G5GA 2CL6X 4B33A 2DVWB 1KI8A 3T15A 4B44A 3KUDA 4QL3A 3RRMA 3ZZUA 3QKRA 1G20E 4G0NA 3O8CA 3IPYA 5FTKA 1A7JA 1OFTA 1RJ9A 5HTKA 2ZR7A 3WBJA 4PC7A 1P9RA 2V6JA 4D4MA 3B13B 3LQRA 1RE0A 3H2YA 5E7MA 3K9GA 1SVMA 4DEXA 5KSZA 1FTNA 2PZEA 3W5IA 2WJJA 3BAFA 4MGZR 1CS4C 1NL3A 2CL0X 1KKMA 1ESNA 3CIOA 5JBQA 4TQ9A 1J7KA 5TARA 2P5TB 1UFQA 3MG9A 4AK9A 1MABB 1E2JA 4Q9HA 3H84A 3VTKA 2JJ1A 3DMDA 1Z3IX 4WXRA 4A2WA 2GNOA 4LHWA 4DDWA 1TQDA 5ANRB 4RZUA 3K1JA 4PO9A 4V0ME 1EG7A 4DLTA 4B2PA 1M7HA 1IN8A 3VNUA 1TL7C 4PO1A 4C2TA 2C78A 1YVDA 2X2EA 3M1IA 4C0LA 1VG8A 3FKSD 5EP1A 4KFUA 3IBYA 5HE9A 1F6BA 5EXPA 1Z0KA 2IHBA 3N2IA 2ORVA 5AJYA 1S4QA 4B47A 5FI0B 4BASA 4XIGS 1CLUA 1KAOA 2QAGA 1S9DA 4OQXA 2ORWA 4MRVA 1W5TA 3X1XA 4FWDA 1Q22A 1XTQA 4NCNA 2GF0A 2XXAA 1DS6A 1XD9A 4AY2A 1EXMA 2ZRCA 2D7CA 2OFOA 3W34A 2YWFA 1HH4A 4DUGD 1XP8A 1JEEA 3H4MA 4M2LA 2CHQA 1G8YA 1U0HC 3ADDA 1U0JA 4Q1EA 1OIXA 1U0LA 4MYUA 4A92A 4EJSB 2J87A 1H8ED 1QDEA 5G40A 4EPTA 4F7WA 2C9OA 2I4IA 5FTMA 3U7GA 4X8HA 1M74A 1XXHA 3QKSA 3RDPA 1E2IA 4XWOA 3OZXA 1JR3D 2FPMA 3U7FB 4Q21A 2A7QA 2P5SA 1NVXQ 3EZ6A 2F43B 3MUFA 3Q7QA 1S1CA 3PEYA 1TUEA 3U3KA 1TF2A 1FP7A 4RSGA 3D8BA 5CK5A 2FGJA 2XOKD 1ANKA 4C0HA 1VCIA 4EUNA 3ZVNA 1Z06A 4W5JA 3OESA 2EFDB 4FI3C 3CM0A 2X19A 2MMCA 3AQ4A 1W5SA 4YXWD 2WTUA 5EE9A 3IIKA 1W36C 3C15C 2OSBA 1AK2A 1E79A 4XOIA 3VU9B 5AWFC 3ADCA 1JR3E 1GFIA 2YHSA 3QXHA 1S0UA 5IK2A 2HYIC 2REOA 4F4CA 1YZNA 2WOJA 1AGRA 3WMFA 1ZNXA 5DN6D 5DO9A 1XJ0A 3W3ZB 4M9ZA 3KQLA 1GSIA 5B30A 3CZPA 4NDZA 1YZKA 2IYSA 1UKEA 1LS6A 1KO1A 1H8HD 4URUR 3NC0C 4PPNA 1E1RD 2V9PA 4AG6A 3GLGE 3MFYA 4LJYA 1VYVA 2Q9AA 1X86B 2UKDA 1MABA 4HAZA 4JLDA 4DSTA 3THYA 2HF9A 1JALA 4LHYA 3THWA 4HYYA 3AP1A 3NBYC 1NVWQ 4C0KA 5LDDC 5E7JA 2IXEA 4YDSA 4DCUA 1Q3TA 2BJWA 3PEUA 3QXXA 4DCVA 3AGQA 4PANA 3QSYA 2JASA 2PZGA 5HZHA 2GJ9A 3QJYA 2ZAOA 2AXPA 4NYMQ 2ZJZA 2DHRA 3EPJA 2IUSA 2ZRDA 3BB1A 2DYKA 2NPFA 1KYIA 3GLIA 3B78A 2HF8A 2AHOA 5CB8A 2EWWA 5SZKB 4YONB 1Z29A 4D26A 2ZRGA 1P62B 1SZPA 5BN3A 1IJFA 3BOSA 1Q0UA 1VIYA 2JEOA 3LY5A 2W83A 4QNMA 1P2VA 1ZIPA 2EFCB 2ZJ8A 3J81k 1HE1C 1KSJA 3KUCA 1T0HB 2XJ4A 5J5CA 1Z0JA 3TAUA 4EAQA 1TNDA 5IRCD 1VIAA 1TQ6A 1WP9A 2P6NA 1KNQA 3ADKA 3PVSA 3GJ0A 5IDVA 4YDHB 4NYJR 1E9EA 5FL7A 2DWQA 4EJSA 4TTPA 1QVRA 2ZU0C 5H68A 3QE0A 2J9RA 2ZJAA 3FE2A 2ZYVX 4OQFA 5LB4A 3UANA 3DPUA 4OK3A 3SQXA 1G6HA 2J1LA 5FOXA 1DBSA 2ZETA 2WSSD 5TMPA 1ZNZA 2DFNA 2F43A 1G7RA 3BXZA 3DZDA 3R9WA 2WVJA 4I1UA 2OM2A 3B6EA 3VX4A 1T5IA 3GLHE 1XEWY 4L5BA 4E22A 3H1TA 5EE0A 4O2LA 2BMJA 3DMNA 4GMDA 2G6BA 3PEWA 3QF4B 1UKZA 5D3MB 1M7GA 2R44A 1RYFA 3VU9A 4K46A 3TRFA 5K8IA 2JDIA 1ZP6A 3HYTA 2IYVA 3FDIA 3TLXA 4AYXA 4M4SA 3A1SA 3X1DA 3QOFA 3EPLA 2ZEJA 1TEXA 1N5KA 1VMAA 1OYYA 1W2HA 3E1SA 1VECA 4TLCA 3GLIE 4JLJA 4RD3A 2FMXA 2QUZA 5CDFA 3WRXC 1KI6B 4BFYA 1X1RA 1NLZA 2J3EA 1IN4A 4MGIR 2F1HA 4XSHA 1II0A 3WNBA 1WA5A 2O8CB 3OE7D 4YLGA 4KYUA 4FMBB 3HU3A 4LJ7A 2FWRA 4LJAA 5FH9A 1W0KA 2XZLA 1GKIA 5CYPA 2N42A 3BS4A 4LC1A 4M8NE 1G8PA 1GL9B 2ZRAA 4QGAA 3OHMA 4C3ZA 1FZQA 2O8FB 2WBLC 2Z83A 1OXSC 2OBMA 1F3OA 4M1KA 5FBVB 3FKQA 1SXJB 1P3JA 3FMIA 4TN1A 1K6MA 2QE7D 4BLTA 2W2TA 3VX3A 5ELXA 5C1BA 4DLWA 4LSGA 4PC6A 3Q8XB 3GLFE 3PJRA 1IJEA 3A1WA 2XZOA 1DOAA 2PMDA 3A4NA 3MAAC 2B21A 3B7GA 5KNCA 2MSCB 3GEEA 3U4QA 5TXGA 3U44B 1CRPA 1ZM4A 5F3WB 4ABYA 4V0OA 2XGJA 5L3SB 3IEUA 4ILEA 1VKJA 2E9SA 5KTYA 1Z0FA 1I4TD 4RD4A 1SHKA 1RIFA 2CNWD 3TKLA 1R0XA 3G0HA 4JVSB 4Q9LA 1RKBA 1J70A 1JQLB 1Z0DA 4BLPA 3THXB 1YR7A 5AR1A 2OCPA 3FFAA 2JAQA 1NSTA 2J45A 2ZE6A 3RHFA 3VNVA 3KQKA 3P20A 2ASEA 3AH8A 4OYHA 4LWZA 4H1UA 2IS4A 1HA3A 5KOYA 2GDJA 3GJ4A 3JZAA 2ZJYA 5FOUA 5FR1A 2H16A 2IS2A 1GZSA 2HCBA 2OLKA 2H8KA 3BH0A 2ZIAA 2IUTA 3AV0B 3SYLA 2BEJA 4OQLA 3K70D 1O3YA 4B3DA 3CLVA 3KJIA 5D3MA 1TF7A 4JKYA 4A2QA 3I92A 1DAFA 4LJ8A 4C0QC 4DXAA 4TT3D 1UAAA 2OCYC 2IYRA 4YMTA 4XH9B 1KJWA 1U81A 2GEVA 3NEJA 4Q1CA 4R7ZA 4DLRA 5JJIA 4O0MA 5LD2B 1NVMA 1ELOA 1JI0A 2RGCA 3OAAA 5J4LA 4Q9JA 1NVVR 1NG1A 2DCUA 1IM2A 5CB6A 5F9HA 2IS6A 3WXMA 1S2MA 3ZJYA 1KI6A 1XNJA 5TDHA 3KKQA 5FOVA 2RGAA 3KDSE 1DE0A 3N70A 1MR3F 3W8RA 2YOGA 2WJGA 3KQUA 2IYZA 4EPWA 1EWRA 2R6GA 4WZBE 2KWIA 4HLDA 3CPJB 5JCPA 1GNPA 1G9XA 3P32A 1EFRD 4R2HA 3VR1A 1PZNA 4Q4AB 3SHWA 3A1VA 2O8FA 4TYNA 1N0WA 5EQTA 4KSBA 4U7DA 2G9NA 4G5QA 4QHSA 1G7SA 1QBKC 3FMPB 3KTAB 3U60B 2P3SA 3MWYW 4IOLA 3OFND 3DHWC 4HAYA 3CH5A 4BLQA 4MUAA 4OKSA 5HKKD 1FW6A 1UDXA 4MKHA 4ZIRA 3I61A 4L4UA 1Q1BA 2G83A 4Q7JB 1OXVA 5AJVB 1ZD9A 2YZ2A 4TWZA 3L0SA 3NBZC 2GILA 4IDOA 4A8JC 2WWYA 2FEMA 3GFOA 4LHZA 3QI2A 2KBEA 3U44A 4CF7A 4U00A 1KSFX 1Z08A 2GXQA 5CM9C 1TADA 1FQKA 2V55B 5L3SA 1R5NA 3RRNA 3VMFA 2Q3HA 2PCLA 3GFTA 4KODA 4N3NA 2WWIA 3SC3A 4BZPA 5B58C 3UXMA 1UPTA 2IEYA 4CDGA 3BIFA 1QZXA 2MSEB 1FUKA 3GP8A 5FPHA 4UXHA 5KYKA 3THXA 1XTIA 1OH7A 1SHZA 2AFIE 3Q5EA 1XMJA 2RHMA 3HWSA 1U2RA 2ZSDA 2CLCX 3TSWA 5GADl 2FSIA 3WNDA 2ATVA 1JJ7A 3LXXA 3T34A 3FOZA 4NL4H 1Z5ZA 2GVZC 2NO0A 4PHHA 2XNDD 5E7IA 4TL6A 3NH9A 1ZCBA 2YWGA 4OJKA 1QF9A 3ND8A 1J2JA 1Q57A 1MV5A 3LQQA 3OEHD 5IF9A 4KXFB 1XD8A 5B64A 2UVQA 5DI9A 1SVLA 3C41J 2GHIA 1A5TA 1KZGB 1ZM7A 2D74A 1R0ZA 2A78A 2LKCA 2QTHA 3PIRA 3QEJA 1N6PA 4BFXA 1E2FA 5J40A 3RC3A 5DHAA 2C9YA 1G7CA 2HLDA 4NP6A 1HURA 2IF2A 1TU3A 1T9HA 2RGDA 4RFVA 5F98A 2ZR0A 2QP4A 4NYIR 4NKRA 1P2SA 2GXSA 5CLQA 1LVGA 1N6LA 4LC0A 5FBWB 3IGFA 1YZTA 1ZUHA 4E5UA 3IPXA 4IOJA 1J90A 3C14C 3FTQA 5E95A 2H1LA 3CB4A 1OE0A 4QJ5A 1CR2A 4C0BA 3E2IA 4C0JA 2VRWA 1KI9A 3H0KA 2HJVA 3GJ8A 4Q4AA 3WMEA 2HDNB 4PO8A 4RVCA 5L8VA 5KSOA 1W0JA 4V03A 1G1MA 1M6NA 5JRJA 2QSYA 1SXJC 4BE7B 3I62A 1GKYA 2QN6A 4PSVA 3UG6A 4A82A 1RYHA 4HDQB 4OHYA 4Q9IA 3QKTA 4ESHA 2NPIA 1SGWA 4DEYA 1NNEA 2ERYA 2R62A 2BHRA 1NIPA 4BGDA 4BECA 5J47A 2AXNA 4KLNA 2FSHA 2BM1A 1GNRA 5F2EA 1L7VC 4AIIA 2DZNB 5AJWA 5LPNA 1JR6A 3PITA 4JS0A 4D25A 1UBGA 2FN4A 2IYXA 4RD0A 2G0NA 2WPDD 3QG1A 2ZS7A 1W4AA 3P4XA 4ZPXA 1NLFA 4MYTA 4JLBA 4DWJA 2J0SA 1Z6XA 4GFDA 1R7RA 3BC1A 4JBYA 1XTKA 3R8CA 4A6XA 1Z47A 1WE2A 5DHFA 5AJZA 2GJAA 2F1JA 2NO9A 3CX7A 4OHXA 2A9KA 1FNMA 2JLSA 2ZI3A 1E6CA 1U90A 2HXYA 2UZIR 1G8FA 1E4VA 4KSCA 2Z5FA 4FWIB 2VP2A 2R6FA 1O87A 3RANA 1S1MA 1CKEA 2CE2X 4EFMA 5J4HA 1DO2A 2PX0A 3AB3A 3KXKA 4TMKA 4RJLA 3TUZC 4PQRA 2AN9A 4PHFA 1WRBA 3RNLA 2P6UA 1GILA 1TU4A 4JL5A 4NPHA 4CT5A 4KBFA 3WBKA 1OIVA 1U8YA 4V0NA 1T4GA 2BKEA 1T0JB 2LWIA 3QPVA 4TTQA 4V0LA 1AA9A 1XX6A 4U5XA 3CO5A 3TVTA 1XPUA 5LD2C 4MYHA 1Z2AA 4N0EA 2R65A 1XB2A 4KFSA 2XZPA 2ZSBA 1OH8A 2VYFA 2B7CA 5A0FA 4WIAA 5E3HA 5SZHB 1YR9A 2NQ2C 1VCMA 3P4YA 3RSOA 8OHMA 4ACBA 4RD6A 3LD9A 1YHNA 2V54A 4WAUA 1E2HA 2IX3A 1ETUA 1E2DA 2ORIA 3A1TA 1JPJA 1M8PA 3EWAA 1W47A 4IDPA 2C99A 4Q1DA 4ZKEA 3BFKA 3ZZTA 4Q02A 1Z6YA 2ZVQX 3U61B 3FMFA 3GJXC 4M0LA 1N6OA 5AJXA 2F55A 5IT5A 3FGNA 3AGPA 3AM1A 3K9HA 3GLGB 3BERA 3CF6R 3KFVA 4KJZA 2HUPA 2OFXA 5KSYA 1KO8A 1DAMA 3NDBB 1NBMD 2CVFA 5FI1B 4IW3B 4TSFA 4GNKA 1SKYE 2RGEA 4HUQB 4P0TA 3EA0A 1QHGA 4V0MA 4B3CA 1LB1B 5B57C 3AUYA 2REBA 3AKEA 1T3LA 5KSPA 1HQYE 2GVDC 2EYUA 1CTQA 1KI1A 4C0AC 1S3GA 1KAGA 2B8WA 1E98A 5EE3A 1XDBA 4NBSA 2BKUA 4DDVA 1YJ5A 2CDNA 4MRNA 4C30A 3N2EA 5KDOA 1NSFA 1K5DA 1NBME 4WA7A 4LJ6A 4JIMA 1DARA 621PA 1OXXK 1JECA 4QBGB 3CRVA 3U7EB 1ZW6A 2PJRA 3VR4A 4Q1BA 2IHYA 1G19A 5DYIA 5EZ5A 4OBEA 4BFZA 1TAGA 3V9PA 3FKSA 1TQ2A 2DPXA 4KHZA 4NCIA 3WY9A 2W0MA 3X1YA 2CJWB 2FDCA 2A30A 3EPKA 4QBIA 3VHLB 1NN3A 4AKHA 5L3VA 1XEXB 1OKKD 1SULA 5CM8B 1N6IA 3LBNA 1ZJ6A 2JIZD 2P6RA 2IK8A 2FPKA 4IVPA 4W9MC 2CXXA 1GG2A 2C77A 3ETLA 1AQYA 4JN6A 2VHJA 4JLVA 2YINC 3T5DA 4DUGA 1KGDA 1D9ZA 2WJVA 1AQUA 1AKYA 2ZREA 1E9DA 4IFBA 3RYTC 2WKRA 3ZDQA 1C9KA 2VA8A 3F5FA 4QGHA 3THYB 3GLHB 2ZI6A 3AF3A 3KB2A 3THWB 4B75A 1BMFD 4LY6A 1H8EA 4Z1MD 1UBEA 2VP0A 3MCAA 1OFHA 1E9AA 1VPLA 2ZRHA 4URXR 1GUAA 2BCGY 1EK0A 1JR3A 1E99A 1GRQA 2AK3A 2XTMA 3CONA 2JLWA 4GOJA 3PUZA 1DAKA 2LCFA 1E9RA 4P3YA 4HDCA 3TQFA 3BH7A 1JB1A 3SJCA 3SFVA 1ZMXA 3TK1A 2XOKA 4EPYA 4ZCMA 4KCGA 4R71A 3GLIB 2QQ0A 1XD2B 1XEWX 4YXWA 1P6XA 1XF9A 2C5LA 5KPJA 2FFHA 2FJUA 1OV4A 3DM9B 4GP7A 2AL7A 2R2AA 3TGPA 3GLGA 2NMVA 4CYMA 1HTWA 3KL4A 2DWOA 1L4UA 3VFDA 3EC1A 2C96A 4LBYA 4MRPA 4BZXA 4D81A 1BYUA 5DN6A 4GL2A 1W36D 1R0WA 3S1AA 4HUQA 1G8HA 2F6RA 3GJ3A 1E3MA 3JVVA 4M1MA 1XTSA 2G3YA 1A2BA 3F0TA 2Z4SA 1H8HA 2ANBA 3QBTA 1E1RA 2QZ4A 5JECA 4ZDWA 1QG4A 1D2MA 4RZ3A 5FTJA 3U2QA 4QKQA 3U7HB 1YE8A 3ZLJA 2ZS8A 5KO2A 5A4JA 2IBMA 1ZYUA 5H8WA 4M1OA 3GLFB 4NCJA 5KPDA 2O0HA 5TV2A 3FHCB 3F8TA 2F1IA 4LYFA 1N6RA 3QQ5A 3TAHA 1XCGB 1KJYA 1W4CA 3ZYCA 1G18A 1GOTA 3HDTA 1IQPA 2DBYA 2NZ8A 1CR0A 3PCRB 1BO6A 2CJWA 421PA 1Z8FA 4DSUA 4TL8A 5K8UA 4ZCIA 1G5RA 5JEDA 5AK0A 1XEXA 1Z28A 2DFLA 4OJQA 1OYWA 3AVOA 1OHHA 1XTJA 4UQOA 3SDZA 2CHGA 2IYQA 3NG1A 2JLXA 4AKGA 1X6VA 1DAEA 1N0VC 4LBZA 4B34A 3W6OA 5TB5A 3ZVLA 1WMSA 5CJ2A 3UIEA 2AKYA 3UK6A 4OI1A 2O8BB 4MGYR 1KY2A 4YC7A 1G6OA 2R9VA 3PQCA 3K0FA 3KKOA 3GLHA 1KSHA 3X2SA 3U3OA 2PJZA 5EUQB 3T61A 2CK3D 2IYLD 5A5GA 2GAOA 4BEBA 1J8YF 1T8TA 3A58B 4LUCA 1RRGA 1EWQA 4GOKA 3KKNA 1HT1E 3EIHA 1BS1A 4D82A 1GP2A 1PLKA 4HI0E 1G41A 1E32A 4FCTA 1TX4B 2R8RA 3JVUA 3U3RA 2MMGA 4GP6A 3PUVA 4RD1A 3GJ5A 5SZIA 5EXTA 3EZ2A 3KXIA 3I32A 2OHFA 4B32A 4P33A 1ZCAA 1UF9A 5C4MA 3NDPA 4TMWA 2X2FA 1VG9B 1YKSA 3AF0A 3AKCA 4XVQA 2KJQA 1F60A 4AI6A 2XITA 4OI2A 1W48A 5KUTA 2QP9X 3SBDA 1XD2A 4Z8YA 4Q7MB 4DC9A 1KOFA 2V7QD 2ODNA 1ZM3A 1FP6A 1OPXA 2QAGC 3L0PA 3NBFA 4JLKA 4G5OA 5LBIA 3U4QB 4LPKA 2F3TA 3TJZA 1Z22A 4DB4A 1WXQA 4FCWA 3WHLA 1LTQA 2GZHA 1Q3HA 2VL7A 4ZI2A 2O8DB 2ZRNA 1XCMA 2ZVPX 3ZGXA 1JAHA 4G3XA 2ONJA 1OSNA 1FQJA 3MLEA 3MWJA 2C8VA 2GCOB 3R7WB 2H17A 2QROA 2RHDA 1MH1A 3OE7A 5FL3A 4WZAE 2XTNA 1GNQA 2QNRA 5JWHA 2QORA 4P4SA 1NMZA 2VHTA 3CW2A 3GLFA 3PG5A 3NVAA 2QMOA 2VHCA 3UMFA 2NGRA 4URYR 3GCGA 3M4YA 2YWHA 3Q3JB 2RGNA 2BBSA 2D62A 4NH0A 3AVPA 3DEFA 2OILA 1AS3A 3OIWA 4NYMR 4PTLA 4XSGA 4WOPA 2J7PD 1G5TA 2QE7A 1Z83A 4DHEA 1YR6A 3SYNA 1TPZA 2FSGA 2J59A 3MJRA 4OQMA 3KB1A 4ZDKA 5L3QB 3A37A 1JEDA 3OEED 2AX4A 4DBLC 2IYTA 2HT1A 2ZYUX 4LYHA 1TMKA 2ZJOA 1K5GA 3I3SR 2QM7A 2VO1A 4IEIA 1N3BA 2OAQ1 2Z6VA 2JLQA 4QGGA 3PEVA 4LDJA 4P31A 5CLLA 4QC2A 2QQEA 2FGKA 2O8BA 2AD5A 2ZJ2A 2ZSEA 2EYQA 3PFIA 3BFVA 4LHVA 4C9BA 1OB2A 3B85A 4TLBA 2CNWA 4KVGA 5BYJA 3TSOA 1R5OA 3EAQA 4B3FX 1XU4A 2QMHA 2JATA 4HB4A 3W5JA 4EIWA 1W2GA 2WWFA 5C4GB 1C4OA 2IL1A 1IN6A 2RGBA 2WWXA 3I73A 3HPQA 5FUYA 1IY0A 3B1VA 2PL3A 4IHQA 2V1XA 2A2ZA 4JJKA 1YR8A 2H7VA 1F2TB 2IW3A 3IKJA 3SNHA 5FTLA 2DWPA 5HZKA 2CEAA 4ZIRB 4L8GA 2B7BA 1SVKA 1WF3A 1E2PA 5G41A 3UKDA 4PQYA 3KKMA 4Y0AA 2G1JA 1RPZA 2FEOA 2GEDA 1Z2CA 4DLXA 5K8LA 3C8UA 1WB9A 4MKIA 4C2UA 4PQFA 4V0KA 4TT3A 3CRMA 1UDWA 3DOFA 2ZRPA 4LV6A 3FHOA 4HUTA 4LK2A 1Q1ZA 2RH5A 1G4AE 1MO6A 2R6AA 1PUJA 2O8DA 4JYCA 4B6EA 5AUNB 4I81A 2QA5A 5HR5A 4B2LA 2FSFA 1IN7A 3KKPA 3MSXA 3OF5A 1KO5A 4ARZB 4C7OB 3U3MA 4EJSC 2GCOA 5JEEA 1N0UA 2VF7A 1XMIA 2ONKA 5FOSA 1S96A 4UNQA 3R7WA 3LAWA 4JT4A 1XBTA 2CLDX 4LBVA 4M1SA 2AD1A 2ZI9A 1D2NA 4KBGA 3AVVA 2YKGA 2V8OA 1OT3A 3O8RA 1TUIA 3EG5A 1EFRA 4TZ0A 4Q18A 1JNYA 3GPLA 1QG2A 5JCZA 4JLMA 5FBQB 5TY0A 4B6FA 3U5ZB 3QVUA 2W2VA 3TBKA 3BB3A 3TW4A 4B3GA 1COWD 2XSZD 3HU2A 4PAQA 4NCKA 3OFNA 3ZZ0A 1L2TA 3D6TB 3L0OA 5HKKA 1M2OB 2OT3B 4MQBA 4ZCLA 5L3QA 3HJNA 3W90A 3FPAA 1BKDR 2EW1A 2F1RA 1ZC4A 3TR5A 3CPHA 4BLRA 1NKSA 1D8TA 1QHNA 1V43A 2OFWA 5IHPA 1E2LA 2JLZA 1IY1A 2IXFA 5BN4A 1AIPA 1EFCA 3AEZA 2Z43A 3IHWA 3SU8A 3LVQE 2YYZA 3QUSA 1P2TA 1Z63A 1NY5A 3AKDA 4QJ3A 1P72A 3AP2A 2ZRKA 4HAXA 1OIWA 3ZS9A 4LYAA 1KK1A 1ZM9A 2YC2C 4M9XA 1DAHA 3W6PA 1E2QA 1C1KA 2Q9BA 1AKEA 2VP5A 2YOFA 2H18A 1E0SA 1LY1A 2JJ8A 1DG1G 1II9A 4GZLA 4NONA 4UXJA 1XFAA 2XNDA 5BXQC 3SEAA 1F2TA 2PT5A 2PZFA 3U6BA 1VYTA 3ZD7A 2JCSA 2QRNA 1SQ5A 2E1RA 2Y8EA 3LBIA 4PZLA 2PMKA 3T1VA 2D06A 4II7A 3RS3A 3VR6A 1KDRA 4F4JA 2KB0A 3SE0A 2QENA 3OEHA 4QOSA 4AURA 4BFSA 3LV8A 4AC9A 1NJGA 4IKEA 3SN6A 3MGCA 5J4VA 3GMTA 1DTSA 4EFLA 4MDFA 5EP3A 5DGXA 4JYBA 4GBMA 3MD0A 2FE4A 2HV8A 2W6ID 1ZINA 1UBFA 2WMOB 1BH2A 1E1QD 1E9CA 4D6PA 2ZR9A 3NWJA 1NP6A 4ARZA 2CVHA 4KLZA 1T8UA 4PHTA 4C7OA 3K0AB 4IEEA 1UJ2A 2HJGA 1N6NA 3BBPA 3DM5A 2BOVA 2VTKA 4FCVA 2Q21A 4LJ9A 1SKYB 2EFHB 2GZDA 2Z4RA 5KHOC 3ECCA 2V6IA 4MKGA 4A0HA 2CHVA 3GEIA 4AG5A 2OV2A 3RS7A 1GL7A 4PC1A 4M22A 2F3RA 4IVRA 1SVSA 1G3RA 5KDLA 3SR0A 3RC8A 2C04A 2FV8A 3N5CA 3R20A 5BN5A 4HB3A 4HEJA 4BWYA 1V5WA 1OH5A 1ZD1A 2ZAMA 1GIAA 2NIPA 4EPXA 4O25A 2L0XA 4UXIA 5KDDA 1KMQA 3FHTA 3L8ZA 4P4UA 3OIVA 4BLSA 4JVLA 4OHZA 2VHQA 2C2HA 1GVNB 1P4SA 2OBNA 2BCJQ 1U94A 1VDZA 3L43A 1SXJD 4TYWA 4HDOB 2ZJ5A 1N6KA 1OF1A 4PC2A 4A0FA 1SVOA 4B76A 821PA 3AVTA 4IXNA 4A9AA 2Q6TA 1CP2A 2D2FA 1XRJA 3NHBA 3KJHA 3WYAA 3QPUA 4C0SA 5J4YA 1II8B 4JBWA 4WW0A 2REXB 2WJYA 2QMUA 2WPDA 4KVAA 4Q66C 2ZTSA 5DSZA 5JJLA 1VG1A 4DCTA 4AKIA 5EXSA 5F9FA 1SXJE 4IDNA 1P73A 1C1YA 1NIJA 2XJ9A 1G21E 1NLYA 3L8YA 4B71A 4CT4B 5JMTA 1QHHB 1U9IA 2GBLA 5KNBA 2GJSA 3CR7A 2QPAA 1CRQA 1RFLA 2ZI7A 3IBGA 3LFUA 1P61B 2QGNA 4JJZA 4F93B 1DELA 1YZQA 1CJKC 1LV7A 4QM6A 1IAQA 1J8MF 4Q4JA 4E03A 2NO1A 1KMHB 1JPNA 3DL0A 3RS2A 3CWZA 3WYFA 4E07A 3GFPA 5EJEA 1KK3A 5HPYB 2QSZA 1GM5A 4LRWA 2ECKA 2QAJA 1HYQA 1MKYA 3V00A 1MRNA 2PX3A 4XTRA 4HATA 2BC9A 3GQBA 1A82A 3T06B 4D4LA 2VPPA 2D7DA 5FUVA 5CIQA 4DDUA 2HYDA 4MITA 4B48A 3L0IB 4B35A 3BK7A 1VCNA 2Z0MA 3WYGA 2B6HA 5L3RA 3GJ7A 1P9NA 4C4PA 2ZXUA 1XEFA 3RRYA 3K0AA 4QNRA 2W2XA 2WICA 2SHKA 4BUJA 1EESA 3CZQA 4DDTA 4PXAA 2BWJA 2A5DA 3EZ9A 4ERNA 5DYGA 5CIWA 4TYQA 2ZI5A 4G01B 2GRJA 3B1XA 4IOKA 5FOWA 3TW8B 3UMRA 4JLAA 5TVKA 2JJ2D 2D3WA 4TLDA 4JT2A 3FWYA 3PUYA 4W7SA 1K8RA 2BMEA 1D6JA 1IXZA 4TTRA 1TEVA 4F38A 1HV8A 3K0CA 1NBMA 4WZ6A 1W36B 3D7MA 2DY1A 2ZE7A 2I1VB 4DRZA 1G4UR 4XD7D
chains in the Genus database with same CATH superfamily
2VDUE 3SKXA 3G49A 3ASVA 5LZ8A 4KNYA 3ND7A 2DPYA 1AKNA 2WQZA 1PSZA 2I55A 2XI4A 4DV5M 2IFTA 5HDQA 1W49A 4KO2S 2PSFA 2VI5A 5H1YA 2QYHA 3CUVA 2N1MA 3SS8A 4P16A 3ZIAD 3KJGA 3GNTA 2OGUA 3VVLA 5DISB 1MTZA 2IDJA 1FDUA 1M6VB 1UAYA 3PKJA 3MK31 1I80A 3WYCA 4XDZA 3R0VA 3DFMA 4D8XA 4PIMA 3W5UA 3QM1A 5SZJA 2FG5A 2FPLA 3OM8A 3JRXA 3HYSA 2IWRA 3PLNA 3GMSA 4QBFA 4GDMA 5D3QA 3MJFA 3LYLA 4MW0A 4F72A 1JHXA 4DV6M 2FP4B 3HR7A 1JGTA 4EEZA 5FFNA 4IIXA 5IM5A 3V4ZA 2QN9A 4MW7A 1VKHA 1TTPB 1FFDA 4GMQA 1RRPA 2TYSB 3DYBA 4MYRA 2DWUA 3OUTA 3H1PA 1A50B 2DCMA 5IEBA 4P7FA 4C87A 4RHCA 2OAP1 1AKQA 3DF7A 4B4UA 2UYCA 2QVXX 3LVRE 5HA5A 3TQCA 3H5OA 3OOSA 3RJ5A 1SUEA 1RXSA 3ZWOA 1RMTA 3W5BA 3ZVMA 3H8SA 2PRIA 3K5HA 4QUIA 2J9FA 2O8EA 2CK3A 3WSVA 3O74A 3C7CB 4IOMA 4NEHB 4Q9DA 5LP1A 3OICA 1M3SA 4OJTA 3KG2A 1RBYA 3ZTTA 5JYBA 2OD2A 5EZ6B 3T6PA 4L0DA 2R97A 4CCYA 4HNAB 2JH9A 1DPFA 4GL4A 2W6QA 4UVDA 4MV0A 1F5NA 4Q1AA 3QBVA 2FPIA 3GHYA 5AOAA 3I2IA 4F06A 4MVJA 2P62A 4MWSA 4S05A 3A3PA 3ZE9A 4L95C 2YVAA 3L93A 4M55A 3K70B 1V8OA 1UZUA 1NDHA 4L4XA 1YJ8A 4NBUA 2G0AA 1KY3A 3BRWD 3KYIB 1IXSA 3I0NA 2L4FA 5KYNA 5H70A 3SZUA 4H0CA 2LKDA 1YONA 2BMAA 5K2MA 2C9ZA 1KOJA 3GUCA 5JPIA 3IP3A 3W5VA 3D3WA 4DV2M 5H5JA 2PWYA 3SSNA 1DWOA 3RBZA 3ZE2B 4DLUA 4V02A 4MVJG 1TFRA 5EXDA 3PENA 1G3UA 3EUAA 1CUVA 5AK4A 3CNNA 2I1LA 2HQBA 3TPZA 3QH4A 5FF9A 4QHTA 1X7HA 5E6RB 4HL6A 2L6OA 3CEHA 5ILOA 1JIKA 3DDCA 1SIUA 4UPVA 2RKWA 4KFTA 4DAOA 1GDTA 1KDTA 2PIDA 5I5GA 4NSNA 2IF0A 3SDSA 3Q5DA 4LNUB 2BGWA 3GFRA 4EKDA 3DC7A 4KQJA 4I3GA 3A4MA 1FFXB 2M32A 5CDYA 3DTNA 5KB3A 4II2A 4LFCM 1AHNA 1WCV1 2WVHA 1IY2A 3JY6A 5GGXA 3K1AB 4GI2A 1T0UA 2P9TA 5FBLB 2QP3A 1Y7IA 4CEHA 1VYUA 2E37A 3N6VA 4RM3A 5JNWA 4WD3A 2RI1A 1ZL2A 4MW5A 3VC7A 4M0KA 3HKDB 1X8LA 3GA0A 4RC9A 5GY7A 3F5SA 1KBOA 4QOGA 1E1QA 3T1HB 5JI3E 5COBA 1USWA 4NC6A 2XNSA 3K5WA 3ITKA 4R7GA 1WR1B 4EVSA 1VLJA 2A9QA 3IBFA 2Q5QA 1FYVA 4J91A 3I04A 1SUDA 1AH2A 1I4DD 2PFKA 2WNHA 4W1RA 3ORQA 2WM9B 2P4UA 2IYUA 3Q87B 4AICA 1LFDB 4IRUB 4YP9A 3NKLA 5KVQA 2V5AA 1T10A 2Q3DA 1LRLA 1QYDA 3B9PA 1NXTA 1A88A 3NT2A 4IIHA 2EO2A 1OILA 4DQ0A 5ALLA 2J31A 5H9VA 3PIIA 1V3UA 1FBNA 4JLSA 2G1AA 2IQ5A 2A6PA 4TMZA 5J4KA 4ALLA 1Y34E 1QRSA 4QYIB 2R6JA 2BGNA 2VXYA 2BELA 2WKWA 2VTVA 3CH7A 5AK6A 3PQ5A 2O1XA 4G65A 3CNBA 4XFDA 2DWZB 1HTTA 5ALEA 4MUNA 1YULA 1FPMA 4NS1A 1L4GA 4MUMA 2FZLA 3I8SA 2G1UA 2W6OA 1I6WA 1LGYA 1PVDA 4O8ZA 1CRZA 4JI8M 1SU7A 5ITXE 2FSUA 3RABA 3HUEA 1KI3A 2PANA 3GEHA 3L7OA 2XUKA 3NO4A 1CHDA 3SAUA 1PGNA 2XT9A 5KWVA 1YQTA 5TVGA 1JU9A 1K9VF 1ZKMA 4RNDB 5ECYA 3LQFA 3UAYA 5ALTA 3HRHA 3PE6A 3T1QA 1TIPA 1B7GO 5CVUA 5H80A 3M70A 1QF6A 4TQAA 1R8QA 5CGZA 4JGGA 3RFTA 2YJTD 4O4LB 4NVRA 2RGGA 4PYOA 4WXYB 2WKQA 1G5QA 4HVCA 2ZWIA 2ZPAA 4EKEA 1FS5A 2A59A 1I2ZA 4MVJF 2JIZA 4R9UC 2UZ3A 1OAOA 1MQAA 1Y7HA 2Z2KA 3AP3A 2AR7A 3I23A 5AJUA 1I6LA 3UATA 3FNRA 3LBFA 5DVZA 1W2WB 3GUVA 5TEVA 4DR3B 2Q2NA 5JSQA 5CH8A 3K53A 1X3SA 3S99A 3A05A 4R84A 3HU1A 1BNCA 4MJ7A 1RWWA 1NR7A 3TUJC 2IZ1A 5F21A 5FR2A 4CCYB 4RIIA 2OUKA 1UBTS 3U6QA 1DDOA 1QAOA 2WMYA 3WNZA 1KJJA 2F9FA 3T15A 1JMKC 3ZZUA 5MFPA 2X22A 3FYTA 4K9KA 1YIOA 3SNKA 1P9RA 4OYYA 2PJDA 4NECA 4NPAA 1SCQA 3BAFA 3ZJ4A 1JEOA 3IKLA 3ZDZB 5CX1A 3EBOA 1WHSA 1G8KA 3DMDA 1MNAA 1QFXA 1AA6A 5ENVA 4PO9A 3ZLUA 3H83A 4PLWA 3F6EX 4IBOA 4EVQA 4KFUA 5LDGA 2VSNA 1MA3A 5BN3B 3L1IA 2MCFA 1DS6A 1CQZA 1T9CA 1J7JA 3EJWA 2LIPA 4MICA 4GRIA 2IXTA 1H8ED 3TLEA 5FTMA 1G9SA 1M74A 1XXHA 2LBPA 4E2ZA 1WUTA 3U7FB 2DY0A 3KP0E 1NVXQ 3Q7QA 3PEYA 1K2WA 4DR2B 2EX0A 1ANKA 3JQFC 2BHSA 1W5SA 4YXWD 2DT5A 4NQZA 1O95A 2TMDA 3F6YA 4BLCA 1NHWA 3RC2A 1WB5A 4NDAA 2B61A 3SCZA 1HPLA 1U2EA 4UBLA 1O6FA 4JLDA 1QGUB 1L5VA 1XQYA 5THKA 3KJNA 2PZGA 3BB1A 2B20A 3A27A 3ZE0B 3OMLA 3RYIA 1RPNA 2VT6A 1VIYA 2JEOA 1XHBA 2V5UA 4NXNB 3WOHA 3TIXB 4LZOA 2P6NA 2QYSA 4Q3DA 3QE2A 3PQFA 2ZJAA 5ABPA 1LVHA 4IUBS 5TMPA 4AY5A 3VKUA 1G7RA 3IP6A 2OOBA 3NRCA 1KYYA 1XEWY 4XYGA 2C3UA 1CYDA 3NS7A 2IHZA 2QJWA 5EUCA 2XGMA 4C76A 2Q45A 3O9VA 3NWOA 4RD3A 3IPRA 1YK1A 2XEDA 5ESDA 4YLGA 4OU5A 3IE1A 3GEMA 5HZGA 2N42A 3AHCA 4JH0A 3N58A 1LBTA 3N0XA 3DAOA 5ELXA 1PEAA 3DMTA 5JASA 2YIDA 3ED1A 4R31A 2FN9A 3GEEA 2X49A 2HJ9A 2E9SA 3U80A 4IJ6A 4BLPA 3VNVA 2IS4A 1HA3A 1YL7A 3UB2A 3ELDA 5FADA 1UANA 3HBJA 5ITRA 4P8RA 2IGTA 3S6JA 4C0QC 2ZT7A 4QYWA 3PXBA 4QGSA 2F5QA 3UMVA 4MKZA 4UHCA 3OU6A 5DM4A 5A5VA 4P9NA 2FPRA 3GLTA 5FLEX 2IS6A 1YMQA 1XNJA 5AHWA 2RGAA 4UVEA 1IOLA 4L7VA 1TYBE 4XQGA 2O8FA 3HLKA 3IJEB 1PJ3A 3OH8A 3GG2A 3CLSD 3DHWC 1RQPA 1LV8A 3A3KA 3B7QA 1Z33A 4FHZA 5AVXA 1KSFX 3A1FA 1TEHA 4N3NA 5KYYB 1SUAA 2GBCA 1KMCA 5JH7B 1J1UA 1T1RA 5CEJA 2AFIE 3E22B 2WSCF 5AO9A 3TSWA 1A5ZA 4KXVA 4EECA 3ICOA 3KKEA 2Z3ZA 5DNVA 5PNTA 1L5LA 1H2AS 5BSHA 4EMBA 3LQQA 4ENPA 1TO1E 1XD8A 2A78A 2AVDA 1R0ZA 2HFJA 3GMDA 2EKFA 3AWDA 5I8ZA 4DXDA 4P5EA 4B9AA 1QLJA 1KAHA 4LF9B 4I50A 3U4HA 2XCSB 5DLYA 3RSQA 3ZDXB 1JSZA 1BHO1 1UBLS 2QSYA 1TM3E 3R7DA 3E9QA 2VVTA 2O2GA 5ALXA 2R62A 2XUJA 4C6TA 4BGDA 3QZUA 3FZEA 3LE8A 5B3KA 3E3MA 1ECFA 5AJWA 4ZI5A 5FEUA 2FN4A 4HWTA 4FSDA 4OD0A 4DWJA 3SIPA 4JODA 3BC1A 3KOWA 3R8CA 3D5TA 2F1JA 3E9NA 3TRHA 2ZUTA 2PY6A 2GN1A 1DCKA 1O87A 4UEJA 2M1ZA 5J4HA 1X13A 3KXKA 1NHGC 4YJ3A 3PE3A 2P9YA 1YA4A 2CN1A 4NPHA 3RK1A 2A1IA 3OQHA 1PJJA 4NESA 2JFUA 3EZNA 2PWPA 1H9AA 4BB9A 3V1MA 1W47A 1KR5A 1LDBA 5CDHA 4JYMA 3HB4X 1Z6YA 4M0LA 1N6OA 1THGA 4RE5A 2D59A 1NBMD 4DIOA 2NWQA 2C2ZA 3B7WA 3T94A 4P0TA 2KRUA 3O2NA 2Y9PB 5BVGA 3WADA 2UU9B 4UD2A 2VHXA 2EYUA 4C0AC 3PRYA 1S2LA 3Q15C 2E5LB 4OLBA 4JD5A 2RK4A 621PA 1JECA 1L5QA 3J7BA 4G1CA 3WC4A 1P2FA 3FKSA 2DPXA 4KHZA 3WY9A 4BAUA 2W0MA 1SWWA 1ZGZA 4D42A 1MG5A 2COKA 4W9MC 4RLQA 3ZEAA 4MLPA 4JLVA 5JALA 2PH3A 1QK5A 4EYGA 4QNNA 3ZDQA 1WNTA 4U6SA 3OIDA 4B75A 1BMFD 3UYKA 3MCAA 3UJ6A 4URXR 2PRZA 1MRZA 3IP5A 1DAKA 5JCJA 1C81A 1A2OA 3U4GA 3JATB 3TTSA 1ZGBA 4BNGA 1XF9A 1RQGA 5WRFA 3EXHB 5COQA 4D81A 3R0IA 3OCCA 1SHJA 4XVHA 4EJ6A 1QG4A 4KN9S 1YE8A 3LDFA 2VHZA 4AZ0B 3NX4A 3D4IA 2OQ2A 4J16C 2FW9A 5LQDA 3NOOA 5FORA 3MUEA 4TL8A 4ZCIA 1N32M 4NLLA 4FGWA 3SDZA 2E2WA 3O4GA 3K92A 1C3XA 5JSKA 5D84A 4YC7A 3M4NA 4BNYA 2EP8A 3ZU2A 1BW9A 5K99A 1C7JA 1NW9B 3AEYA 3V1KA 4BP8A 4B32A 4RDHA 3NW9A 1EKXA 4HYQA 2V45A 1E1CA 1XJWA 4BNMA 1SQ0A 3TDKA 1KKUA 5FX2A 2P9GA 5LLSA 3K2BA 5TMDA 4L0MA 3EIXA 4JZYA 2VYQA 4HJRA 3KYDB 4DRXA 4HEQA 4D9JA 5FL3A 4ZYVA 2X8JB 4P7JA 1AV6A 3ZJ5A 3EHEA 3JWPA 1TZ2A 2QLLA 1UFVA 1X7XA 4MYSA 4XSGA 5JD4A 1TQHA 4DA9A 2VJDA 3AESB 4JJAA 5KTPA 4NZZA 2VO1A 3ZDCA 4XJTA 2JKZA 2HIMA 4P31A 4IO1A 4CHTA 2ZJ2A 2EYQA 1ZHHA 1JSXA 3WKBA 3O4HA 1TKRA 1W2GA 2CSUA 4L8RC 3SZGA 3WWDA 3WQHA 1TT5B 1JKIA 2B7BA 1TA4A 3UGKA 1I9CA 5CAEB 4DLXA 1ZW1A 1S2GA 4I50F 4IJVA 1JAXA 1MO6A 5M7EA 3I39X 2FSFA 3ZDDA 4LF8B 4C7OB 3OJXA 4IQ0A 2PTGA 4P5PA 3PQ4A 2NU6B 1XBTA 3RU9A 2AD1A 3PPYA 1DGQA 3AVVA 2H1HA 3NATA 5B4TA 3QU9A 5FOQA 1REQB 5I9SA 2JGAA 4YALA 1NX6A 1Q77A 4F6LA 3BHIA 4EG0A 4DWWA 3KETA 1TOAA 3BICA 1NKSA 4YY3B 1J5EM 3KPUA 3FSGD 4ZRNA 2YYZA 1NY5A 4YJ3F 4C78A 3ZIUA 2P91A 2IE0A 4LYAA 3HCPA 3B6ZA 1AQLA 3W5DA 2YC2C 3PHBE 2NT3A 1YB2A 4TSKA 2O7RA 4WKOA 4PZLA 3FM9A 3OM1A 4DMKA 3T1VA 2R2GA 3DXYA 3VZSA 2V7PA 3AF5A 1FCJA 5EP3A 4BNKA 5DGXA 1D1SA 3IR6A 4EQZA 4ZYXA 5A06A 5FJJA 1NU6A 2JFQA 1N6NA 4AZVA 1T9BA 4HJXA 4QDXA 4CMGA 3VDUA 4ZYWA 1TAUA 4QA9A 2OOSA 1GL7A 2L17A 3SR0A 4HB3A 5JQWA 3U5ZA 2ZAMA 1LLCA 3SMQA 4BO2A 4LSWA 4IZIA 5LKRA 1R0BA 5K3AA 4HGOA 4RS3A 4RWEA 3RU7A 3KJHA 2PT9A 1ZK0A 2WJYA 5DSZA 4GXTA 2AV6A 3DWGA 3Q7RA 3FDZA 4V2UA 3HVRA 3IBGA 3FCXA 4IMRA 4KWHA 1IAQA 1J8MF 1ZOOA 1R9GA 2YJ5A 1N2SA 2ZCJA 2EJVA 5HPYB 4DWVA 4LRWA 2ECKA 3EGEA 1H9CA 2IYAA 1CFJA 4LY0A 1VCNA 2XODA 4XM2A 3KHUA 4D02A 1VBMA 2J67A 1D2CA 3OFKA 1KOGA 1MGPA 3TW8B 3H5VA 2H1WA 3MYYA 2UXDM 3U3XA 1JSRA 1P7ZA 4EGAA 3T9EA 3WNVA 2EFYA 3PPIA 4EG6A 2PZ8A 2ZE7A 1AHIA 3WP0A 1GTJ1 3QXGA 3U6DA 3D0OA 1U8AA 2C4KA 3CX4A 2ZJ3A 2PX5A 3KSAC 3AJAA 1BN7A 2K6BA 4JSYA 2X1VA 1HE3A 1TZCA 3ZH9B 5LA6A 4UDOA 4W63A 2C7PA 3SQLA 3MD9A 2CLKB 3KJFA 3OWOA 4D4IA 3RAPR 4D9MA 3TCXB 4I1VA 5AVYA 1V1RB 3J81A 2FZGA 3FPHA 4FWHA 1Z7BA 2ABWA 1ZFNA 3I3OA 4E7OA 1Z73A 5ENZA 3NIGB 1MHTA 3DVLA 4JP8A 8CATA 4WVFA 1QQ7A 2RB5A 3AR5A 3SHFA 5F3RA 2YVUA 2DH6A 1O94C 4S1PA 5YASA 1BW9B 2J0VA 5MDHA 3FYSA 5CVTA 4BKRA 1RYZA 2YBDA 4PLFA 2DFKB 4MQLA 5C18A 2AMYA 3KQTA 3TMYA 2JCYA 1DRWA 1US8B 2OORA 4RKRA 5AUPB 2W00A 5EP4A 3UF0A 2Y1OA 4HN2A 2ZIEA 3TSZA 1N2BA 3TZQA 3BMQB 2PD6A 4PZPA 1OLUA 3TFQA 2ZGVA 1YDWA 4CQNA 1X7XB 2BBOA 1HNWM 1ZNWA 3L2AA 5EMJA 1ZVVA 2BV3A 3FPFA 2HGZA 7REQA 5DTRA 3PGLA 4LMBA 4ZQEA 2CT8A 2AFRA 5HJ5A 4KXNA 3IQXA 4YK7A 5HCNA 1HC7A 5CT6A 4RMNA 2BEWA 7GPBA 4LAFA 4FMPA 4MP3A 2UUPA 4IIJB 1E2BA 3I9V6 1CUGA 2PX4A 3BTOA 3HI6A 4X85A 2INGX 3SZMA 2W6NA 1VPDA 2RC5A 1Y9JA 3U6CA 4G5RA 5AVZA 4CEIA 3UG7A 4HF7A 5LQRA 4AL4A 1S9HA 3N1UA 3RWOA 4H4DA 3UHPA 1WDWB 4XCQA 4IDHA 3T1TA 1E1DA 4CHGA 2JGNA 1V16A 4MJXA 5EHNA 3OEWA 2VBIA 1ONSA 1O4VA 3FR7A 5CVEA 5EJCA 5F35A 2KHHA 4PX2A 1YZLA 3PXGA 1NF9A 1M5TA 3F7OA 1Z5NA 1L6IA 3ZQJA 3ZLTA 3VKHA 3JR4A 3ZV7A 2MIIA 3F78A 2EP7A 2I8CA 1EUZA 5E3IA 4F3YA 2MR9A 3ONNA 4YWHA 1JWBB 2ERCA 2JFPA 2DAEA 4PNEA 4G9EA 4X20A 1IEQA 2D7EA 3FOBA 5EKTA 2D7HA 1EAYA 2OXTA 2A9FA 4Z2YA 1RWPA 1HM5A 1AE1A 3W3AA 4B43A 3AYXB 3BIJA 3U49A 5B7GA 4DJDC 4YEDA 1IXRC 4FUQA 2BM9A 4I8DA 3EMBA 5DHRA 5C46F 1G63A 2H92A 1LZKA 3CV3A 1P7CA 4RIHA 2D1TA 2JFGA 3KXDA 4P3XA 1QYRA 4PLCA 1Q0SA 3QVGA 1EHIA 1TAHA 1ESCA 4NOOB 4PPGA 5ARBA 5HSGA 4ESVA 1JDJA 2XNCA 2PQ0A 4HDNA 2ODQA 4I5DA 3RC1A 1PR6A 4Y2SA 1EQAA 3EPHA 2JD2A 2WFAA 2XDAA 2VP4A 1LSJA 4X61A 4FC7A 2C5RA 5LA6F 4LXUA 2YV2A 4GI7A 3LA6A 1IFYA 2YHUA 2AI2A 4KR2A 4LBWA 1ZUWA 3PTZA 3GVCA 1YI8A 5K6AC 5ISMA 3DMPA 4FVMA 4B0OA 1V26A 3ROPA 3TD6A 1NJ1A 4JKOA 5L4SA 2AQ8A 1LS1A 4A6PA 2GF9A 4CLHA 3QF7A 1JFVA 3BXHA 2FG7C 4M76B 1IZZA 2MYTA 1BRTA 1RFGE 1RQRA 1EPUA 3ZNQA 2ODBA 4KXQA 2X7HA 4PONA 3AVWA 1Z7GA 3KB8A 2YOHA 2OXCA 4G4IA 1UXGA 4EDFA 5KOIA 3EGIA 2QN7A 2NO4A 3NKFA 2IZ0A 4IWYA 1SB9A 5B55A 3D31A 2QZSA 4EX6A 2ZYTX 4ARUA 4KQ6A 2ZROA 3C4JA 5C51B 5CB0A 3QYEA 2F3QA 4HBZA 1P75A 4P3PA 2FA9A 4BNUA 1ZD2P 3PPXA 4D1YA 4DT1B 3NORA 4INJA 2VSFA 1W581 1T9GR 2AT1A 2XYRA 1R3DA 4ON9A 1E7SA 3OTOM 4BPBA 4OLJA 1OX4A 3JYQA 4OREX 3T35A 4MHSA 1GXSB 3LDGA 2CLIB 2EZ4A 1RBMA 3O75A 1RJ9B 4TTAA 3DQZA 4CODB 4UBIA 2A9VA 1VJ0A 1TE2A 3FNGA 4PNPA 2I3DA 4OHCA 2AN5A 2QRJA 4CM4B 2PL1A 4QEZA 1P1IA 4JVOA 1E3WB 2JF0A 4JI0B 1ZSYA 3IYLW 1KZ6A 4IIYA 1W35A 3IDFA 4UM7A 5C3MA 2Q6IA 1SBHA 1YZYA 2OFFA 2BBTA 5M3BA 5DBGA 1RRCA 1DUSA 2H3EA 4B3HA 1RWBA 2EC5A 2H1FA 3T99A 1YGPA 2EFGA 2V3WA 3GLQA 4KO4S 1IUKA 3LECA 1NUTA 1CQJA 3KUKA 4CM7A 3C1OA 4D4JA 4P36A 1X7WA 5T4FA 3L0DA 2ZIUB 3BQ9A 2NNWB 3QU7A 3WGIA 1IVYA 3B9QA 2WABA 3V4FA 7REQB 4F84A 1UWLA 3EEIA 3LPLA 1BWQA 3KUDA 5DM60 3L3BA 1F9EA 3OQBA 1WIVA 4M46A 2CUTA 3B13B 4Q4DA 3K9GA 1MZVA 3MWFA 3BSFA 2B34A 1UJ6A 4MGZR 1NL3A 3D3NA 1DRKA 2BEWB 1B0ZA 1RLJA 1JS1X 1NRWA 1LVUA 5IREB 2E4AA 4N5DA 1U0FA 5JBNA 3IVAA 3DXFA 3RU3A 5KINB 3KJZA 3I9FA 5AJYA 1O97C 4RTPA 1N36M 3NCTA 4EB6A 2BGTA 2OFOA 5DT9A 2AS0A 2PA3A 4Y2QA 1XP8A 4M2LA 2Q6OA 3SGLA 3QYJA 1G5IA 4FEGA 4QT0A 1CNFA 1UBRS 4RX1A 4XWOA 1JKMA 2GFIA 3A7EA 4EHBA 4HQ0A 3CGGA 4F8EA 3MINA 3T5PA 3ONVA 1T36B 1H66A 4GW3A 5ED0A 5AWFC 5JTUA 3MTQA 4B7UA 3MCTA 1E1RD 1E64A 1GQSA 3BXGA 1VP9A 2I3AA 3MFYA 3GXBA 1A9SA 2PXCA 3GMIA 1I2BA 1R4ZA 4QSMA 1NVWQ 3VO9A 3NHYA 1K7FB 3FBGA 4RVSA 5ECGC 2EL9A 2GJ9A 3SXUB 1UK9A 2GNAA 1AD2A 3A46A 3SS7X 1DUVG 1Z29A 3I01A 3L6UA 1PQPA 1GQOA 3U1BA 5K03A 4GKKM 1P2VA 1CUUA 5K0EA 2AF3C 3BGSA 4I9UA 3R6DA 1TQ6A 4C4AA 3HM2A 3FTEA 3TIGA 1E9EA 1C4XA 1GNLA 3EXIA 3OURA 1PU2A 4MR9B 2DFNA 3LX4A 5H4HA 2ZULA 3M2TA 5B58T 3Q4GA 4GMDA 4C5CA 3SYMA 1QUFA 2GM5A 3ZNOA 2LHCA 3RTAA 1C0LA 5CH3A 3FZNA 3G59A 5ESWA 5LIRA 4UOEA 2AOXA 4AYXA 3JV7A 3WB9A 1EB8A 1W2HA 2ZBQA 4HDNB 4Y2GA 4JI7M 3ESQA 1WA5A 3JPYA 5JDIA 1NVFA 2YY7A 3HU3A 3MJSA 4OQDA 1G8PA 5MN6A 4E1VA 3WRVA 2JHAA 1P3JA 3TZHA 4WLFA 3RVLA 2FRDA 3PNVA 4GH9A 1D7AA 4FYJA 1DOAA 1CFZA 2B21A 2DUMA 4LXQA 5TXGA 4ENRA 2C29D 3N7AA 5KTYA 3H5NA 2FR0A 1HSOA 1DXQA 3ZCUA 4GOMD 4M7OA 5TE9A 1SBTA 3KQKA 1UC9A 4MRMB 1Z3CA 4KMMA 1SURA 4J1QA 4BO0A 1E58A 1Q11A 2PN1A 1T1GA 2VATA 2FTKE 3KR1A 1M0SA 3OAAA 3AHEA 1VMEA 3O83A 3IXQA 1TUBB 3KKQA 5FOVA 1RAFA 2FWPA 3O8OB 2H7YA 3SHWA 4B4VA 5A9RA 2WSIA 4WBXC 4YFVA 4DGQA 4Q4CA 4IOLA 2E49A 2FN3A 1KC3A 4QQ8A 1FFSA 3ILKA 1DWPA 3UH1A 3HBMA 1QVVA 4MAFA 4DJEC 2AYYA 5B58C 1ZOSA 4JI5M 3GP8A 5FPHA 3LGAA 2CLCX 4XB6B 3JQ6A 3H11A 1G6KA 1FPQA 4IJFA 2D0DA 5L3ZA 4CWAA 4G0UA 1E2FA 5LN1A 4B4DA 3TF5A 1PV2A 4NABA 4CGYB 3B7PA 5F98A 1KEEB 3T8YA 2QP4A 1USUA 3BJEA 5CLQA 1P9LA 4LC0A 1DRVA 1N6LA 4TV9B 1CHNA 3SSOA 1BMTA 3FTQA 4GQBA 4PBSA 4AZSA 3E2IA 3JD0A 4RVCA 2QY6A 1CETA 2CVQA 2ZCUA 2GDZA 2Q29A 4MI3A 1CQJB 2W8ZA 4LW8A 3E8MA 3ROTA 4INAA 4JSRA 3GHHA 1YQUA 3LHKA 3O38A 2VC2B 4MYTA 4KN5A 4RGBA 1MUUA 2W98A 3OVMA 1B2RA 1D04A 1OBHA 3JQ8A 3RANA 3CEPB 1KAQA 1ODTC 2QTRA 3I53A 4JN6B 4RJLA 4Y1RB 1JZTA 2ES4A 1UPBA 2J9YB 4MYHA 4N18A 4KFSA 5BMVB 1S2DA 2JHCA 4RD6A 5B3AA 1H6UA 1BVRA 1JEAA 4COOA 9GPBA 1JA0A 4OVZB 4EB6B 1KEWA 3GLGB 2C8JA 1RM0A 2D1RA 4MB2A 4YI5A 4HUQB 2XR1A 5JJCA 1GPLA 1YJAA 1M0EA 1PNOA 2AEMA 2B8WA 1Q83A 3AFNA 2BKUA 1YJ5A 1K5DA 1XDSA 2PJRA 3FWKA 4AT1A 2QT9A 1E8NA 2FR8C 3GJRA 4HYTA 4IX1A 5CVJA 4AKHA 1H94A 2P9QA 2FMHA 1OKKD 5K20A 4IAOA 2P6RA 1CF2O 3IDSA 3ESYA 4OYRA 2PMWB 3TSYA 1AQUA 4G86A 3HA2A 2ZI6A 1I33A 3L46A 4YRPA 3BDAA 1E9AA 1EHYA 2ZRHA 3ID6C 2QN8A 2AK3A 1ND6A 1E9RA 3ENQA 3SF8B 2DT8A 3LHIA 4HDRB 4HH4A 5D1NA 4ARVA 4GPEA 4I4TA 5A2QA 1Z75A 5AXAA 3EC1A 2HSZA 1C2YA 3I6QA 4Y9UA 3TMAA 1K3FA 1MQ9A 1JIJA 3AMVA 1XTSA 4IIFA 2MROB 4L8VA 3KT3A 3UB3A 4IZ6A 3IVGA 3NDIA 2GPBA 4RQAA 4ROSA 1JILA 3B5EA 3DUFA 1L7MA 4RVGA 1QG6A 1NJ5A 4X71A 1CR0A 4IDAA 1HYBA 1JQKA 1YKGA 1XTJA 4N40A 4EY3A 1NNJA 1PI3A 1WMSA 4CLEA 1C3EA 4TS3A 2CFSA 3PQCA 3AY0A 3EEOA 1T2UA 3KKNA 3LP5A 2R8RA 3T3HA 2SKEA 4P33A 1UT8A 3ROEA 4EBBA 3QBDA 2ODNA 1FP6A 1QP0A 2GZHA 3GZJA 2WG1A 1OX5A 4LOKA 2GPTA 2ARKA 3R3SA 5IVDA 3IIIA 1GNQA 1FQWA 4P4SA 3CW2A 2CXRA 4X65M 1PJIA 2QX6A 1N2IA 1TJ4A 3FBWA 4OQMA 7YASA 1P7WA 3HV2A 4IEIA 5BN4B 2BEUB 4CDMA 2VYVD 4JXXA 4WDQA 2BFFB 2CNWA 3TSOA 5IX8A 4EI9A 3KLBA 3BHJA 3CKYA 1FU7A 3W5HA 1XU4A 1CZKA 1T5HX 5MN4A 3BM5A 2FZWA 2EJCA 2VQFM 1WF3A 5IJ9B 2AOWA 2HNKA 2A14A 1SG0A 3H97A 4WZBA 5AKYA 3MCZA 4E12A 2P6MA 2O8DA 2NUAB 5IDQA 1KO5A 3MERA 4V0RA 4ARZB 4KUEA 5GGYA 1VHDA 4KRGA 2D7GA 4ALIA 4LBVA 4XQEA 5CU7A 2MR6A 3H11B 4NBRA 3QMVA 2FWJA 9LDBA 4K0KB 4OQQA 3LLVA 2RHCA 3BKXA 4B3GA 4K28A 1FDVA 1KDVA 3DEZA 4UDYX 4G67A 2JD0A 1E2LA 1IY1A 3AEZA 4L02A 3SU8A 2ZYGA 3QUSA 4GLLA 5KHLB 3JASA 4G8CA 3GT7A 5AIAA 1DG1G 1EM8B 1K4KA 2VR1A 3D59A 2IDKA 1L5FA 1Z4QA 3QTLA 3SE0A 5KIAA 5ICSA 2XUOA 4FZVA 1S3IA 1J2EA 1WCIA 1ZOPA 4IUDS 2FE4A 3R3ZA 3K0AB 4IEEA 1DJQA 5ALSA 4LJ9A 2GZDA 4CKEB 1V71A 3RSFA 1P31A 3RS7A 1CF9A 3RC8A 3M9XA 1R5LA 1ZD1A 4EJ2A 1JT2A 4HQNA 3S81A 1YCGA 3T3EA 2EX4A 1V11A 4TYWA 1FS6A 2A7XA 3AVTA 5ALGA 2E85A 2XZDA 1YDFA 1U9ZA 3V7NA 2QMUA 4FT2A 1IIRA 4E3ZA 1OLXA 4QOHA 2VJOA 2ZI7A 1SUCA 4ND1A 2QGNA 1DELA 1XALA 1T5SA 4Q4JA 2RG7A 4QVGA 3PK0A 4HMPA 1DKRA 1K7SN 1RPAA 4ZQCB 3X2EA 3NVKI 4I4TF 1XROA 1EFPA 4UEQA 3REQA 4B35A 4GSLA 3BK7A 4TUYA 3MHTA 5EJ8A 4R9RA 2QQ5A 2O3RA 1GU1A 1TFUA 4D9HA 4BNIA 4I19A 2FETA 2Y1FA 1JIVA 4HBGA 3DBLA 4DMUB 3WLTA 4QRDA 4FOPA 3K0CA 1QO0D 4Q3NA 1HDZA 1YTLA 4R8MA 4EHDA 4DR4M 1EBFA 3IA7A 3TLZA 4WJLA 5KAPA 2A1TS 4NV3A 1DQZA 2WY2D 3EARA 3A14A 1OC4A 2ZLBA 4AQYB 1NNI1 3NWEA 2WSMA 3GI1A 2O3UA 1QFYA 4I4TB 4OG2A 3CFYA 3LOQA 2JY5A 3IELA 1K3TA 2KHZA 5D1HA 4YTEA 1E6MA 5LJLA 4KU4A 1RLIA 1HF3A 2J9FB 3CZRA 2W22A 2E4XA 4C3OB 1O6BA 2O8EB 3K6RA 4YGYA 1IZ9A 1OFUA 3AWIA 2WB2A 3JAWA 2FFQA 1P17A 3LRXA 3PNSA 3P2MA 4JJ4A 3TOXA 3ZW9A 3J80A 2BSAA 5F1KA 2J4CA 4M36A 2F9MA 3M81A 3PUXA 1QP4A 3K15A 3I2HA 4RZXA 1NAIA 1FUUA 2FPIB 4D0GA 4KDFA 4WKNA 1U6JA 1NFFA 3EZFA 3JZMA 5HKOA 1QZMA 5EZQA 5ELMA 2ZUVA 5ITQA 2HWXA 4OTZA 3OPMA 1I6MA 2PVSA 4NTZA 1BCSA 1ZITA 4RULA 1IXSB 3FPBA 5IT4A 1TM4E 1A2KC 4OHVA 3HO6A 5E7QA 4YAWA 3GJTA 3VR3A 4IR7A 1SZCA 4DCPA 1MRSA 5G1OA 4NAHA 4P4SB 5SICE 3VZPA 1M5UA 1L7EA 3D3WB 2I62A 1VSTA 2EVWX 1AUOA 1V95A 2QIOA 1RAHA 4F2LA 2WLTA 2O1WA 3NVMB 2FQQA 3DE5X 5DN9A 2XMRA 4IM7A 1X19A 3GFBA 2N35A 1XDUA 4OJYA 4RLHA 3G9UA 4WZAA 1ID8A 4E46A 4YP7A 2BYTA 5FEMA 1T8PA 4PGMA 2Y1XA 3S2GA 4L16A 1T3TA 2X5KO 3OOJA 1GNTA 3A98B 4TRJA 1T35A 4U4AA 4P2GA 1EFLA 3AG5A 4BZWA 1BE1A 3I9V1 4OK5A 1Q7GA 5KJCA 1I7NA 3HXPA 4MDYA 2F48A 3ORYA 3TQFA 3LKZA 3IVMA 1X8KA 2IA5A 3L1HA 5GVRA 2P9FA 3E1KA 1HOXA 4C4XA 1KI2A 1Y3AA 4C3VA 4WFJA 5GAJA 5ARCA 3W4KA 4QLBA 2P9CA 2WHRA 1DT3A 4O4JA 2OBLA 1HZJA 3PJEA 2IW1A 4D79A 4XFKA 2HXSA 3ABQB 4CEHB 2B1GA 4JJ6A 1G5PA 1Z0AA 2KS6A 4G4SO 4HX5A 1E94E 3CC8A 1VRWA 1M1XB 4BQSA 4FS8A 3EZYA 3U19A 2PS9A 3JASB 3E5MA 4FFVA 3FF1A 1DXYA 3L4BA 4YMSA 3UTDA 3VHXA 5DHQA 3LX5A 1RBZA 2X8AA 1H2YA 3WAKA 3RAFC 4K9QA 1GQRA 4FZRA 1KSGA 1XRQA 1FJGB 4CL3A 1Z37A 5D8DA 1E1LA 3GRUA 3KB6A 4Z6KA 1KRXA 3NB0A 2JDID 1JQ3A 1WIWA 4PNZA 4CG1A 3FBTA 2FEKA 3SI7A 5A3QA 3QSGA 4Z49A 5C31A 1F4IA 1UKVY 3R6LA 1GL6A 1A0OA 2OCKA 3MPUA 2AKAB 3OKCA 3DCYA 4TUYF 4WNAA 3UOAB 4R01A 1W0KD 2FOIC 1QAQA 4JI4M 1AZLA 1U2QA 1BX0A 4G1MB 1Q3BA 2D8MA 2I5PO 2QX4A 3LX6A 2XWJI 4RABA 5TQVA 1U8CB 5AICA 1KJNA 2XQKA 2W2MA 5FV4A 4JQSA 3VZDA 2VH5R 1AOXA 1M2VA 3FOEC 1Z2EA 4LKOA 5FQNA 1KHTA 1GO2A 1V96A 1OYOA 2WRZA 3QEMA 4GYWA 4G4NA 2QDKA 3ESRA 4Q4JB 4CTNA 2AHMA 1DAOA 1BXKA 4IVNA 1GNVA 2ECPA 1SXJA 1KI4A 2VWPA 4TMTA 1GGNA 1U31A 2C61A 4TQUS 2WHQA 2PGAA 1YQ9A 3ZDFA 3ZK7A 3KL2A 4ZMBA 2DC1A 3AR7A 1RCFA 3AR3A 5KQSA 2FRXA 2VZEA 5HX7A 2GZMA 1HDOA 4K9DA 4LCBA 3HSYA 3I8OA 4ZT3A 3IC5A 2UZ1A 4ZANA 2WJHA 1TQ4A 4HLUC 1F4LA 2VZ9A 1IG3A 4CFYA 4CNQA 2RCNA 5FPKA 1LXCA 4FFWA 4N03A 2GTPA 1NN0A 4OXQA 2ZANA 5C2JB 3V3KA