1NSFA

D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
KPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR
publication title Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP.
pubmed doi rcsb
source organism Cricetulus griseus
total genus 84
structure length 247
sequence length 247
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nsfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nsfA01
3REGA 1TAGA 2WWHA 4ON9A 4M22A 4F91B 2IC5A 1AGRA 5AJVB 2ZXUA 4C9BA 1CR4A 1XMVA 2JLVA 2FSFA 1A82A 1OW3B 1X6VA 5EXTA 3CKLA 1X1RA 2WICA 1M8PA 2QU8A 2ZQ5A 1VYUA 4IOKA 1XF9A 1SXJC 1XXHB 3R8FA 4QM6A 4DB2A 2CMKA 1E2KA 2OHFA 2R6GA 4A8JC 4RCYA 2CLDX 1OYYA 5J4KA 2ZSDA 2GEDA 4KFSA 2OO7A 2W6JA 3BXZA 3K0CA 2VHCA 3BFXA 5IF9A 2WWIA 3FFBA 3SYNA 1RFLA 3A8TA 1W7AA 1JEEA 4HI0E 2BV3A 3CRW1 4TYQA 5BYJA 2OZEA 1ZD9A 3K0AB 3OESA 2HCJB 1GWNA 1S9HA 4NCNA 3TK1A 1J70A 4PO8A 1ZU4A 3T1VA 1RJ9B 1E9DA 2J1LA 4RD2A 4P31A 1DS6A 1NG1A 1WA5A 1NKSA 3DO6A 3LWNA 4LRTA 3EASA 3PEYA 1HT1E 3QENA 3Q85A 4V0KA 4II7A 1VHLA 4Z1MD 2FSGA 3QKSA 2IUUA 4JL6A 2ZROA 4GBMA 2ZJ2A 2GAOA 4Q4JB 2ONJA 1GL7A 2UZIR 4R2IA 4U5XA 4OI1A 2ATXA 2REBA 1LTQA 2ZRBA 1KY2A 2PJZA 3AKDA 2PJRA 5JWOA 1ZAKA 1G19A 3QKRB 2RB4A 4PR0A 2D7DA 2O8DA 3E5HA 2QP4A 3MRSA 3P20A 4M1WA 4Q4HB 3B2EA 5ELXA 4YONB 1ZM7A 4CW7A 4JLKA 2IS2A 5AJWA 4AIIA 4TQUS 4BLPA 5J4LA 1XTKA 1P9RA 5JRJA 1UKVY 2XTMA 1DAIA 4A36A 3LW7A 1MO5A 4ERNA 1E2NA 4IJMA 1XEXA 4UXJA 2LKCA 2YOHA 3LH5A 3DL0A 3GFPA 3T5DA 3AUYA 3EZ9A 4GSYA 1Z28A 1AIPA 1OH8A 1IN4A 5EUQB 5EZ5A 3I73A 1JNYA 3TR5A 1H65A 3X1WA 3GJ4A 4PAMA 4H9GA 2ATVA 2P2LA 2WWFA 3W5IA 4AD8A 2W2XA 1Z3IX 3T1QA 3N2EA 2XTNA 1ESNA 4B44A 4HLUA 2QEQA 4HB3A 4NHOA 1IY2A 2GESA 4DSTA 3O8RA 2WWYA 1GRNA 2FEMA 2PCJA 2CK3D 1P7CA 3R8CA 3MJRA 1HT2E 2C03A 1J8YF 1E79A 2EFGA 3IDQA 1O87A 1JI0A 3U61B 1WP9A 3QOFA 2DFTA 1GRRA 3PCRB 3LVRE 3AVXA 2IUSA 3AVTA 3OIVA 1S1CA 4HB2A 3PIRA 2FOLA 1CTQA 1ZNZA 4QJ4A 5GJWC 5JZVA 3LXXA 4B48A 1JQLB 2PT7A 1AS2A 3EAQA 3KXIA 3P26A 3AP1A 1OXXK 4PFSA 4RZUA 2GJAA 3B9PA 4CIDA 3C5CA 1MO6A 4DSNA 1VHTA 3KUCA 2OESA 2C99A 1DAEA 2G1JA 5FTNA 4Q4AA 4LUCA 1SVIA 2ZRFA 2BHRA 2A5GA 3QXSA 5DO9A 1SVKA 4LJ4A 4ACAA 1EGAA 4DIDA 1RYHA 2RGNA 1NVVQ 2IS4A 3FHCB 3LVQE 1II0A 2PBRA 1G16A 3QKUA 2KWIA 3AKYA 2GXQA 4ZDIA 4GZMA 1VG9B 1W0JD 3C5HA 5IHPA 1W36C 3KKOA 4MDEA 1GDDA 4MYHA 2Q3MA 4D6PA 3PEUA 2NGRA 4OK3A 2GJ8A 2V7QA 1HE8B 3WP1B 4BLRA 1NY5A 1T91A 1W4RA 1E6CA 5CYPA 2ODWA 5CJPA 4DDUA 1SVWA 4R7ZA 3MJHA 5DN6D 4OHZA 2QPTA 4FWHA 1EK0A 1ZW6A 2LKDA 2DCUA 4JLAA 1JQJC 2QA5A 2JJ1D 5KHOC 2RGNC 3OE7D 3SBEA 3B1YA 4PZLA 3D3QA 4L9WA 2AHOA 5FR2A 2ZAOA 3S1AA 5TXGA 3ZD7A 1W36B 1MR3F 4UNSA 5AUPB 4AY2A 1G7RA 2GJSA 2OBLA 1OFIA 2AR7A 1RRPA 2JEOA 4BLSA 4BZXA 4I81A 2QBYB 1HYQA 2WWGA 3EXAA 1DEKA 4PC2A 3BH6A 1MABB 1EFHA 3OIYA 2YC2C 2QSYA 4V0NA 1NBMD 4HEJA 4IFEA 5BW8A 3ZH9B 3VX4A 2FZLA 3OEHD 3VR3A 2CL7X 1M34E 1AKEA 3EIEA 3CRMA 5E95A 3LQRA 1GL6A 4OJQA 3FKQA 1FMLA 1ZNXA 2QY9A 2WPDD 4CEJB 1VMAA 4MITA 1XX6A 3TLXA 1D6JA 3U7HB 1PJRA 4LJAA 2ORVA 1WBBA 2WOJA 2CVFA 4M2LA 1OIVA 1JR6A 4H1UA 4BEJA 1X86B 2XJ9A 2ZRKA 3OFND 3EA5A 3LX8A 5BYKA 4MGZR 1E99A 4YMWA 5EE0A 3BJIC 3DOFA 2VP6A 4A3VB 3A1VA 3THOA 5AJYA 2QL6A 3X1ZA 1W44A 2P6RA 1US8B 5DSZA 4B2IA 1P2UA 5JRZA 1X37A 3SOPA 2O8FB 1MH1A 4PC3A 2KB0A 1QF9A 2MMGA 3DKVA 3E1SA 4DLZA 1KMHA 1GKIA 3O8BA 1FTNA 3VAAA 4D4LA 2GCOA 2ZM5A 1YZGA 2CDNA 2RGGA 2VHUA 3U4QA 4LK2A 1MO3A 1GNRA 2BVNA 1CJTC 4B33A 4UNNA 1NG9A 4US1R 1Z06A 2W83A 2WIAA 2ZJBA 1CJVC 4TZ6A 5G3ZA 4WBSA 3WYFA 4L5BA 2WV9A 4GRAA 5FUYA 1FP6A 4AYWA 4CDGA 2A78A 3M1IA 4P4SB 4LJ9A 3I72A 2V9PA 4QHYA 2A5YB 2HF8A 4BGDA 2G3YA 3K9NA 3NBYC 1A5TA 5KNBA 1NMYA 1ZD8A 5CYOA 4PPNA 3BBPA 1E0SA 3NXSA 4IVPA 1NN5A 1WBDA 3CR8A 4GMDA 4JKYA 1ZYUA 2JGNA 1IHUA 3LAWA 2ZETA 3WY9A 2QP3A 1M1YE 2RGBA 2DWPA 1DAGA 1UAAA 1KY3A 4Q66C 4HAXA 3TBKA 3CRVA 1NF3A 3PUYA 4WZBE 5JCPA 1G20E 5BN4A 2CL6X 2WOOA 3A4MA 3EW9A 4JLJA 4TYNA 2JLYA 3PQCA 4A82A 4YMTA 3QI2A 4JSTA 1X3SA 2ZS7A 4HB4A 1GZSA 1YJ5A 1A7JA 1XNJA 1ZC4A 2P5SA 1KK1A 3CPEA 4JL8A 2I3BA 4JYCA 1G5RA 4ASUD 3AH8A 5IK2D 1XPOA 2XXAA 1XU4A 3W6OA 3FE2A 1Z0DA 4M1TA 3ZVLA 2ASEA 3B5JA 4PAOA 3BGWA 1VCNA 3EPLA 3SQXA 1XFAA 1Y63A 2EW1A 4Z1MA 1E2QA 5FPHA 2XAUA 4IDOA 3OIWA 621PA 4Q01A 1FTSA 5EP3A 3CW2A 1YVDA 2JLRA 1M7BA 3P27A 3BH0A 2ERXA 4D4MA 1JXOA 4DSUA 4YQFA 4FI3C 1E2FA 4NTZA 3WNCA 3IEUA 4N3NA 1EFCA 2KBFA 3PXGA 4MRSA 3J81k 1E1RD 1KAOA 3FMPB 1TU4A 5KSPA 3T1OA 3U7EB 4DLVA 4NYIQ 3R9IA 4F7WA 4Q18A 3KTAB 2VYFA 4G5RA 2DB3A 4WZ6A 1UEJA 2AX4A 1G64A 4HUQB 2GXUA 1OKKA 2F1RA 3WMFA 3VR5A 5A5GA 2R65A 1XBTA 3A58B 1NP6A 4LYAA 3U6KA 721PA 3W90A 3X1YA 2C98A 4OQMA 4RD6A 3LLUA 1ZNYA 2JASA 1PVOA 3UMRA 1KI9A 3U6BA 2GJ9A 4A0RA 3RAPR 1U94A 2ZRJA 4YMUA 1VYTA 4DLRA 3QXXA 4QRHA 4YLGA 3QBTA 2CK3A 3VNVA 1HE1C 3IO5A 2R6DA 2ZE8A 1J99A 1U98A 2ZRPA 3AF3A 3QPVA 4DCVA 5J4YA 3WRXC 3AVYA 5JJKA 3VNUA 1ZBDA 3RWMB 2ZIAA 4NPHA 2OCBA 3I1FA 2ZSBA 2VP4A 2FDCA 3IEVA 5CITA 2J0UB 4B3FX 1CXZA 2J7PD 4C0SA 4YXWD 4QM7A 3QUSA 5L3QA 4IHQA 1ZRHA 2BCJQ 3A1SA 2FG5A 1NVWQ 3IHWA 5FUVA 4Q00A 2J41A 1DELA 1KKMA 4PC7A 3ZDQA 4LJ6A 2C96A 1OT3A 4Q9HA 5KSZA 4BRUA 5FTLA 4I1UA 2QT0A 1RZ3A 4GOJA 3DDCA 4GPTA 3BS4A 4PANA 1IN5A 1P72A 1W4CA 3LD9A 3VLFB 4TN1A 2R6CA 1YR6A 4XWAA 2QRNA 4B3GA 4KODA 5B64A 1S9DA 1Z6AA 4NYMR 3TE6A 3QNUA 2ZR0A 2RHDA 3BIFA 3NC0C 3KFXA 1F2UB 4BFVA 2NO9A 2W2TA 4UKDA 3RC3A 3NDBB 4HZUB 3FOZA 2ZRDA 3WHKA 3QQ5A 1W0JA 4BRWA 5DHAA 3JVVA 2AN9A 4B3XA 1OXUA 3CF6R 3VHXA 4EFMA 4DDTA 2RGDA 3UPUA 2J7KA 2ERYA 4S35A 4UNPA 1DE0A 1UFQA 1XP8A 1YZNA 3Q7PA 5DLQC 4F4CA 2BMJA 2IXFA 3QVUA 2EU8A 3HU3A 3CH4B 4RCZA 3ZVRA 3GLFA 1KKLA 5DN6A 3ZZUA 3CF0A 2EFDB 3Q7QA 3LO5A 1XEFA 1U99A 1BMFA 4JSYA 4EFLA 5B57C 1IOZA 2ZI3A 3SYLA 3JVUA 2BWJA 4IXMA 1NLZA 4OQFA 1I2DA 4FINA 1WRBA 2ZSEA 1PZNA 1U8AA 2QZ4A 3A6PC 2FNAA 5HTKA 2F43B 1FNMA 4QNMA 4I1SA 4AKHA 1CR0A 1KZGB 2P67A 1XEWX 2G83A 5K8LA 2XNDD 4EPTA 1XMIA 4I1VA 4DEYA 1Z29A 3RS2A 3VFDA 1QG2A 3THWB 4EDHA 1NBMA 3BFVA 3I4LA 4A9AA 4FW9A 4MRPA 1KZ7B 5FPYA 3P4YA 4K81B 5GVSA 4QJ5A 1XZQA 1P5ZB 5J4HA 2WKRA 2FWRA 4G3XA 5G53C 4EAQA 2HLDD 4M21A 1ZM9A 4Z51A 1MRNA 2GXAA 4ESHA 2ZYWX 3OFNA 3LV8A 2V6ZM 4K46A 3ICQB 2RGXA 2ORWA 1OFTA 1YR9A 3EPKA 3UG7A 4Y0VA 4LV8B 5J40A 1OXSC 2IX3A 2XTZA 3H0KA 1E2JA 3U7GA 3F5FA 2I1QA 3PUVA 2XOKD 2Z43A 3MFYA 5CM9C 4NYJQ 5C4GB 3WNDA 1G3QA 2FV8A 4NH0A 2OILA 4JKIA 4C2TA 1S1MA 4NE2A 3GFTA 3MWKA 4JMPA 3QG5A 3I5YA 1G8PA 1Z6YA 3HU1A 1T5LA 2BM1A 4MKFA 4P4UA 4RD4A 4W7SA 1UBEA 2O8CA 3K8YA 1XCGB 5FH9A 3WNBA 2VSXA 3CWQA 4PSKA 3PUXA 4O2LA 4CEHA 2ZR7A 5D3MB 4PTLA 2UZ3A 2C2HA 2FFAA 5JECA 2B92A 3R9WA 1H8EA 1CR1A 3EPHA 1T0JB 1XD8A 2PT5A 4DEXA 2A30A 4ACBA 5DGXA 2FFBA 2AWOA 4WIAA 3SFZA 2GCNA 3THYA 3LBHA 3FB4A 3L82B 2QMHA 4BZPA 2E1RA 3AF1A 4PO9A 1F48A 3Q3JB 4WA7A 1LF0A 5EXPA 2BMFA 2FPLA 1Z6TA 2NOAA 1OH5A 4AKGA 4D82A 2R44A 4P4TA 4EPYA 4DCUA 5JS7A 4R71A 1P75A 4OBEA 3HR8A 4D0LB 2GCPA 3SS8A 2AXPA 4D81A 4DBLC 1Z2CA 4RSGA 1AS0A 3U44B 3KKNA 1A2BA 3FPAA 4JLNA 2GZHA 1FX0B 5E3HA 3H84A 4TMXA 1IXSB 2ZEJA 5CM8B 1HTWA 1EESA 3RS5A 3CLVA 3IIKA 2GNOA 1U9IC 4RZ2A 2ZREA 4BECA 1UJ2A 1TF7A 1OXTA 4ASUA 1WMSA 5EXXA 1TEXA 3CBQA 4A92A 4EQ6B 4LCBA 1VYVA 1OSNA 2D2FA 2RCNA 1W1WA 4C3ZA 4TQAA 1L4YA 5FOUA 1S0UA 2DYKA 1XTSA 2HT6A 4R2HA 1KJZA 4MKGA 2G88A 2GDJA 2EYUA 4DLSA 4IXNA 1XXHA 4URVR 4KU4A 2JLUA 1R0XA 2V1UA 4JLBA 4B6EA 3NH6A 4L4UA 4KHZA 3DKPA 1KO8A 3RWOA 3T1TA 4P3YA 1I2MA 2GAAA 3WXMA 1VCIA 1CBUA 4G0NA 4DT1B 3CX7A 3CRRA 1E1RA 3TH5A 3K0AA 1DAMA 2ZUDA 1NSTA 4K8OA 1RJ9A 1X8LA 2VP5A 4KI0A 2AKAB 3LQQA 3FMIA 2OT3B 5KYKA 2TMKA 3SNHA 2C5LA 1ZINA 4LSGA 4RD0A 4Q1BA 4A8JA 2QE7D 3AVOA 2WJJA 4M0LA 2IYTA 3PG5A 2ZYVX 1IY1A 4ABYA 1Q44A 4Q4JA 1WB9A 1SHKA 2WSMA 4GFDA 4GDFA 1HY3A 1E1QA 221PA 3KB1A 3AVQA 3G5UA 4LI0A 2DPXA 3REFA 4DRZA 3JZAA 1GAJA 3ONWA 1II9A 5M04A 2QNRA 1S3SA 2N1BA 4MGKR 4PZZA 4Q4HA 3TVTA 1R7RA 3EWSA 1C4OA 2IF0A 4D0NA 4E09A 4Y0AA 2ODEA 4JN6A 3MWLA 3QVVA 4OYHA 1TX4B 2ZRCA 1JR3E 2H8KA 2WVJA 3FFAA 4GITA 1OFUX 2GXSA 3MAAC 1M6NA 4AG5A 3QXCA 1B23P 5E7MA 1T9HA 1U0JA 2CCJA 2V4ZA 2GILA 4ZDJA 3OIUA 2J7PA 4M1YA 1T0HB 4XVUA 2CLSA 2PMDA 4IOJA 3MHVC 1E2DA 5B2ZA 5KSOA 5HR5A 3A1TA 1TQDA 5KTYA 1N6PA 1OHHD 2CNWD 2X1VA 3U2QA 1Z0AA 3ASZA 4CT4B 1NI3A 2IYQA 4RFSB 1F2TB 3I8SA 4LBVA 2DR3A 3SJCA 2XZLA 5H70A 3C7KA 2R62A 3MMPA 1N0VC 1RYFA 2J0SA 2MSDB 3T34A 1CLUA 2Q6TA 3A4LA 1Z2AA 2BJWA 2QTVB 2ZJZA 3V4RA 5AJZA 5CK5A 4I99A 3LX5A 3HDTA 2WJYA 1U90A 3B9QA 4A0HA 1P6XA 3SR0A 1LY1A 1KDTA 4C30A 2J59A 2DVWB 2XZPA 3ZIAD 1GKYA 1W2GA 1GKUB 2R8RA 3BD9A 4NCIA 1KMQA 3U3MA 1G6OA 4UNQA 2QSZA 1AZTA 1NKTA 4OJKA 4IVRA 3ZLJA 5JSZB 2AWNA 2JJ2A 1Z8FA 3A1UA 3R7WB 2BBTA 1P2TA 2QAGB 1K5DA 1P73A 2BC9A 4Q48A 4NL4H 5SZJA 4NKRA 1VTKA 2PX0A 1IXRC 4LC0A 4O0MA 4PQFA 1P60A 5KDOA 1J8MF 4Q1EA 4PAQA 3EA0A 5IRCD 4Z8YA 1GVNB 1R5BA 4QBHA 3EC2A 1AJEA 1DVRA 3TJZA 4J0QA 4QGHA 3T12A 4CGZA 2F1IA 4DB4A 2W6ID 4KLZA 5CDFE 3L0IB 2ZU0C 3ZGXA 4GMXA 4IEEA 1C1YA 4G1UC 2YC4C 1R8QA 3U3KA 2VPPA 4PHFA 4F92B 1XCPA 3PR1A 3TSZA 3AGPA 4TSFA 1JJ7A 3P32A 4URUR 1QDEA 4OK5A 1GFIA 4KV9A 2WHXA 1Z0KA 1ZCBA 3I92A 3KJIA 2YHSA 3BERA 4JVLA 2V6JA 1OB2A 5DI3A 5HKKD 1Q0UA 2ZE7A 2JA1A 5JI2E 4LV5B 4QC2A 3Q5DA 2IHBA 3B82A 3LDAA 4M9QA 1TMKA 2EQBA 2A5DA 1KSGA 4KYUA 3GJ6A 3D6TB 2PZGA 4LYHA 4WZAE 2NG1A 1TF5A 2DWOA 1WQ1R 2FZ4A 3K0FA 1H8HA 1FW6A 4IOMA 4DLTA 2XOKA 2QBYA 2NO6A 4LRSA 1N0UA 2E87A 4MKHA 2ZJ5A 1VG1A 1MABA 4HAZA 3MUFA 3KDSE 4ZDWA 1ZUHA 4LYJA 3SFVA 4IRUB 2I1VB 1NVXQ 1KO4A 1AKYA 2J45A 4RD3A 5LB4A 3FMFA 4PHTA 3QF7A 4MYUA 4PPQA 3BB1A 5G40A 5JS8A 4CEJA 2CE7A 4OHVA 1UADA 1Z07A 1E9CA 2Z83A 3IO3A 4TMVA 3WBKA 5KNCA 1W0KA 3AKEA 4GOKA 2RMKA 2ECKA 3RVBA 1KGDA 3L8YA 4JIMA 4C0JA 4TYYA 2XSZA 3CRQA 5H1YA 3P1JA 2GK6A 4B32A 4TTRA 4OHXA 1IM2A 2PLRA 2O0KA 2O0HA 3TMKA 4TQ9A 1OIWA 2OAP1 3KB2A 4A6PA 4LHVA 1W5SA 1US8A 3UWOA 2OFXA 3EZ7A 2EYQA 3IBYA 4UQOA 2QQEA 4HDCA 1P4SA 4RJLA 1DG3A 1DOAA 4D25A 4FIDA 3A37A 1T6NA 5FOVA 3ETLA 4DC9A 3T35A 1Q1QA 3MGCA 1BH2A 1Q3TA 4V03A 4LJ5A 3BAFA 3EZFA 2X19A 3BE4A 1E2GA 3CPHA 1E2EA 4OQNA 1S4QA 1G8FA 1EX7A 3UXMA 3BOSA 1KTVA 2C04A 4FXPA 3I8XA 1F5NA 2JIZD 2FN4A 1YHNA 3B13B 2A5JA 4TT3A 1FQJA 1COWD 5CIWA 3W8NA 2CBZA 1N25A 1QHNA 1ODFA 2BIFA 4IDHA 4LZZA 4MQBA 4Q9LA 3ZS9A 1UBGA 2A2ZA 3X1DA 2H7VA 4ZKDA 3THXB 4O25A 1SKYE 1KHTA 2P3SA 2B7CA 3DHWC 4S2EA 3ADCA 3SJAA 4URYR 2C8VA 4KYIB 1NY6A 3MWYW 4URWR 2G9NA 4EJSB 2N46A 2P5TB 4DUGD 1G18A 5DIFA 1GILA 3HWSA 2BBOA 3QXJA 2YWGA 5JWHA 2K5UA 4QXAA 1YRBA 1QHIA 3UIEA 3GJ8A 2PCLA 3ZZ0A 3IUYA 4IDPA 1CJUC 1XEWY 4KLNA 1A1VA 1MT0A 1E9RA 2FU5C 4XVQA 4Z8XA 4BZQA 1RPZA 4F38A 3EG5A 3VR1A 4Q1AA 3M4YA 3NVAA 5AK0A 4OQLA 1KO5A 2LCFA 3BWDD 3CB4A 3SDZA 3GJ5A 2QE7A 3NHBA 4WXRA 1RRFA 3DPUA 3RLFA 3GCGA 3SN6A 4FMCB 5CLQA 1GM5A 2BEJA 3TIFA 1JB1A 1N6NA 2GETA 1RC8A 1T8UA 4C0KA 4BFSA 1E0JA 2IYYA 3VKHA 2RHMA 1KI7A 3HU2A 5DYIA 3K9LA 5SZHB 2HF9A 4DDVA 5F9FA 3IQWA 4C0HA 3IILA 1TADA 3AUXA 1EFRD 1QHYA 1NL3A 4PHGA 2QGZA 3ZYCA 4BLTA 4QGFA 5JJIA 5FL3A 3ZZTA 1YRAA 3LW8A 3RRNA 1XPRA 4PQRA 4FCWA 1YR8A 1AM4D 3CZPA 3KXKA 3ECCA 3SHFA 4F93B 4B74A 4Q03A 1MO4A 1N5KA 1OXVA 4TTPA 4Q5IA 3KTAA 4Q1CA 2CHVA 1UDWA 4TL6A 2QP9X 2QORA 2BBSA 1G291 4FMBB 4HSEA 4HUQA 2OEPA 5GADl 3G0HA 4LBWA 1AA9A 3PUWA 2FGKA 4D0GA 2KE5A 4HB0A 1ZJ6A 2ZS8A 2OCYC 1Z6GA 2HDNB 3C4JA 3I62A 3IKJA 3FMOB 3W8RA 1NVMA 1G8GA 1NVUQ 1ZM3A 1IBRA 3QY0A 4QNRA 1OHHA 4OK6A 2ZUCA 5EZ6B 3LNCA 5FUXA 1RIFA 2R6AA 3GJXC 2QGNA 3C41J 2O0JA 1G4AE 5L3RA 2ZE5A 2D74A 1GP2A 3WBJA 3AQ4A 1SVSA 4GT1A 1W2HA 1XB2A 4Q19A 1LV7A 2BM0A 1KI4A 1NVVR 1W4AA 4LPKA 5FPKA 2H92A 4Q9JA 4ZIRB 1NRJB 4D26A 1ETUA 2RAPA 5JBQA 1XTQA 3NEYA 2BKUA 4A1FA 5IT5A 2J0VA 2FSHA 2J0UA 1O3YA 4YC7A 2KRKA 5F9HA 5FFMA 4DDWA 3PVSA 2JLSA 1NMZA 5LB2A 3UWKA 3ZVMA 4QHTA 2ZPTX 3RRYA 3GLFE 1FUKA 1NLFA 2F3RA 4EFNA 4KJZA 4DKXA 5SZKB 4V0OA 1CU1A 1II8B 4XSHA 3WRYC 2PMKA 3NH9A 5EJEA 4PSVA 4A15A 1CEEA 1XJCA 1BS1A 1E9BA 1R10A 2W0MA 1ESMA 1G1MA 2CVHA 2ZRAA 1Q22A 2W6IA 1HEIA 3HYRA 2HT1A 2VSOA 1UBCA 2YOFA 3CPJB 4DCNA 1F2UA 2YV5A 3PFIA 1Z22A 3CF2A 3BB3A 3CX6A 5IDVA 4HZUA 1GIAA 2ZI5A 4IVQA 1GITA 4AI6A 2QMOA 4POAA 2REXB 5CK4A 1GL9B 2GWHA 5B58C 1HV8A 3ZVNA 2GZDA 5AUQA 1FL9A 2HJGA 2HYDA 4LRWA 3V00A 2P6UA 4PXAA 3AF2A 4LJYA 1TPZA 3IGFA 3KQNA 4A6XA 2QT1A 4W5WA 5JEDA 5FL7D 2OFWA 4PPGA 3W6PA 1OB5A 3H2YA 2WJGA 2B7BA 1R8SA 2I4IA 4MRVA 1RE0A 3HR7A 3TQCA 3PV0A 1BOFA 1UDXA 1KO1A 3UMFA 2FA9A 2IEZA 2XZOA 3GLIE 1DPFA 4G5SA 1Q1ZA 5ANRB 2WTUA 1OYWA 2ONKA 4N0EA 4UXIA 2ZJYA 3ND9A 2IWRA 2F43A 1ZUNB 2FMXA 1TF2A 4YMVA 5JHGB 4TMKA 3QSYA 1ZM2A 3KX2A 5GJCA 2X2EA 2V55B 1D8TA 1FOEB 1U0LA 2VRWA 2W6JD 2IYRA 1E0KA 3ZJYA 2ZR9A 4BFWA 1E3MA 2EFEB 3N70A 3RS0A 1I4DD 1SVMA 3AGQA 2PH1A 1B0UA 4NP6A 4C7OB 2IS6A 1ZM4A 1HURA 4JVNA 5FI0B 3LXRA 3X1XA 5FBRB 3M0EA 1KK3A 3C14C 1TL7C 2CJWA 2GBLC 5TARA 2ZSFA 4GZLA 3NWJA 2DY1A 1UKYA 2IYUA 3ZQ6A 4R9UC 1EWQA 2O8EB 2WJIA 2IWHA 1DBSA 3TUIC 3G82C 1TNDA 4B75A 4E22A 1D9XA 5EE1A 1GG2A 1SKQA 1R2QA 2YOGA 2ZRHA 3RABA 2F1JA 2X8AA 2XITA 2ZU6A 4KFTA 5DI9A 1PUJA 2NPFA 2WWXA 6Q21A 1IY0A 1OFHA 1N3BA 2VHJA 3OEED 4Q7MB 4ZI2A 3VR4A 3W5JA 3KQLA 2NO7A 3T06B 3AM1A 2JJ1A 3OE7A 4LGMA 1E32A 1KSHA 1D2EA 2J87A 2XX3A 2JLWA 3BRWD 2O8BB 3GP8A 2ZE6A 1FNNA 4TZ0A 5FBVB 2HYIC 2JLQA 2ZJOA 1NNEA 1ZMXA 4V0MA 3H1TA 4JBYA 5EUMA 2YNMA 3GLGE 1C9KA 1JBKA 4B3BA 4OI4A 1F60A 2DBYA 2ZVPX 4DZZA 5KPJA 2ZRGA 2Z5FA 1EG7A 1MRSA 1M7GA 3I32A 3AP2A 2EWWA 3OEHA 2OUKA 5EP1A 4ZPXA 3C8UA 1RW4A 2AFHE 3DM5A 3DVLA 4KBGA 2IHYA 1L8QA 5DYGA 3CZQA 4Z54A 2WPDA 1W49A 4Q21A 4C0BA 3NIBA 4QG7A 4G5QA 1N5IA 1IN7A 3QE0A 5FOXA 5J5CA 2GHIA 3TKLA 5HCIA 2B8WA 4DUGA 4NCKA 4JL5A 1U2RA 4HYYA 4LC1A 4QOSA 5F2EA 1A2KC 3U44A 2IYXA 4PO1A 4YDSA 1E79D 1FX0A 1LW7A 1UKZA 4JLOA 1XTJA 4LHYA 3FTQA 4LPSA 1JR3D 2DWQA 2MSCB 5JMTA 3A1WA 3ZD6A 4NYIR 1OF1A 5G3YA 5KPDA 4Q9IA 2WJVA 4B35A 1VKJA 2G0TA 1GNPA 4EQ6A 1SXJE 4AG6A 2HV8A 521PA 2H1LA 3KJGA 4MKIA 1ZP6A 5FOWA 4DIEA 1K8RA 4DLUA 4JJKA 1S2MA 1E2PA 3TUZC 3LY5A 1KI3A 5FBLB 1VG8A 2FEOA 2Q9AA 1QHHB 4DWJA 1CRPA 4TMZA 1ZNWA 3GLFB 2H18A 4B43A 1E9SA 2GF0A 5EE5B 4DSOA 2AL7A 1Q20A 1U8YA 3T61A 1G3RA 1KI6B 1N2CE 5E7IA 1N5JA 1EWRA 1R5OA 3GLHA 4E03A 1U9IA 4JBWA 2D06A 5FI1B 4U7DA 4OHYA 3L0OA 2RKOA 3PENA 1EFRA 4XTCS 2UKDA 3B78A 1P2SA 1OLOA 1X1SA 4IOLA 2F55A 4DT1A 1QRAA 2RGAA 1VCOA 2FX3A 4B47A 3NHAA 3VQTA 3W3AA 4LBZA 2Q0HA 4TMTA 4AKEA 5C46F 4GP6A 3TW8B 4AKIA 5KNDA 3OHMA 2ZRNA 3LFUA 3ICEA 4PHHA 2VL7A 3VKGA 2HUPA 2ZTSA 4ARZB 4M8NE 4HAUA 1RKBA 4F4IA 2Z6VA 3RHFA 2XEXA 4X8HA 4U00A 2QRZA 4FWIB 3H86A 5L3SB 5DH9A 5FOSA 1AZSC 2XJ4A 3HP1A 5JLJA 5IK2A 3KW6A 1V5WA 2F6RA 3B85A 4KBFA 4KCGA 4LHWA 4TLDA 2A7QA 1HUQA 2J9RA 4QFMA 2ZI4A 1ZUIA 3BH7A 3GLIB 1Y3AA 2VP0A 3LA6A 4JLDA 1VG0B 3KQHA 4MRNA 2WAYA 3L2OB 4KO8A 3CO5A 2YJTD 4UJ5A 5JI3E 1KDRA 1WXQA 2VHTA 5JCZA 4QBIA 1HH4A 2C9OA 1KJYA 1UM8A 1CJKC 3RS7A 2D3WA 3FKSD 3H4MA 5EQTA 1E2LA 3PUZA 4GP7A 3GJ3A 4HATA 1NIPA 4DCTA 2WJHA 1KSJA 1IQPA 3NBZC 1Z0JA 1L4UA 4LOAA 3B1VA 4RD1A 4KSCA 3LBNA 3QF4B 2OSBA 5FPTA 4CEIB 2UVQA 4P32A 4M9XA 4RFSA 2X2FA 1F2TA 1PLJA 1VIYA 3HPRA 4UJ3A 3EARA 5J4VA 3CM0A 5AWFC 1AK2A 2QMEA 2RGCA 4HAWA 2GTPA 4QGAA 4P0TA 1E9AA 5HE9A 3K09A 1J2JA 2PX3A 2LWIA 1WF3A 2VQSA 1NJGA 4XVRA 2D7CA 1KO7A 1CRQA 2CCKA 3QKRA 2D2EA 1T8TA 3TQFA 4DHEA 3HPQA 4BFXA 1NLYA 1KSFX 3EC1A 4Q7JB 1TUIA 4CRWB 4US0R 3GPLA 5A0FA 4BEBA 4URXR 5L8VA 2JAQA 1FPMA 3KKQA 5JSZA 3BFKA 4A2PA 4ZV4A 5C2JB 1TQ2A 2R6FA 2QAGA 5CB6A 2J0QA 5TB5A 5FL7A 5HPYB 3K70B 5BQ5A 3TW4A 1E94E 1IJFA 2BMDA 3GLGB 2IYLD 5FR1A 4MGYR 4C0AC 1E98A 3K09C 1VECA 4JLPA 3KQKA 1DAFA 2WKPA 4YXWA 2OAQ1 2ZAMA 1QVAA 3B7GA 3VU9B 1QHSA 2BEKA 2F3TA 4WVFA 1Z83A 4CZ2A 1LNZA 3ZQJA 1U0HC 5TDHA 4QBFA 1VPLA 4C2UA 2VBCA 4LBYA 4V0LA 4GNKA 4NYJR 1RRCA 1XD2B 5JFGA 2QAGC 4XH9B 1IXZA 4ITRC 2FGJA 3QG1A 4ZKEA 2V8OA 5C18A 2WMOB 4W9MC 1IONA 4P33A 1KDOA 1JPNA 4CYMA 3QIAA 1Z6XA 4JS0A 4D80A 2AKYA 3N5CA 5BN5A 4BFZA 1KDPA 2NIPA 3KKPA 1ZD1A 4KAXA 1SXJB 1EX6A 4RZ3A 5EE3A 4XOIA 1YZTA 3LLMA 1ZC3A 4A8JB 3RRZA 3GJ0A 1QZXA 3CNLA 3EWAA 1G17A 4FMCF 3PJRA 3SBDA 2WBLC 3K0CC 4TL8A 3ADKA 2OBNA 3D31A 3OEEA 4IEIA 3Q5EA 2BOVA 5G41A 1VDZA 2GVZC 3RSLA 2ZJAA 4IKEA 1ZU5A 1ZIPA 2V6IA 5FTMA 3DOEA 3N2IA 5UKDA 4A4DA 4HDQB 1J7KA 1GNQA 2VLIA 4AYXA 1E4VA 1Z63A 2BJVA 1KI8A 1T3SA 4M9ZA 3NBFA 1M2OB 5D3QA 5TV2A 4EIWA 2IS1A 4HAVA 1Q1BA 2FPKA 5DE3A 1OE0A 4AYTA 4LY6A 1QHXA 3U5ZB 2XNDA 4KVGA 4TMWA 2OV2A 3DMDA 2Z4RA 1OKKD 2Q3FA 1C1KA 5BN3A 5LD2C 2YINC 2ZJ8A 3IPXA 2KBEA 2FE4A 2AK3A 5LBIA 4XD7D 4MUAA 4KXFB 2X77A 1LVGA 4FMDF 2QUZA 3NBXX 1N6IA 2PEZA 3GMTA 1YU9A 3GEEA 4TLBA 1P2VA 2ANBA 2HLDA 2WSSD 4URZR 2ODNA 1G7CA 2OXRA 5FBWB 3RS3A 3WMEA 4B6FA 5GJBA 3QKSB 4M53A 4BE7B 1WCV1 4BWYA 1G3MA 1E2HA 5F98A 1SVLA 5LD2B 3DEFA 4MDFA 3I5XA 3VX3A 1Q1EA 2V54A 4QL3A 4FWGA 1JR3A 5EE9A 3CX8A 5KOYA 4GL2A 1TU3A 2MSEB 3CIOA 3GEIA 2OCAA 5HZKA 1IJEA 3T15A 1KAGA 2O8DB 1E9EA 1M74A 3P4XA 1QVRA 4E07A 3K1JA 1KI1A 3LBIA 4OL0A 4AK9A 1KJWA 5TVKA 1FUUA 1TQ4A 2ZANA 2HXSA 4LJ8A 3GQBA 2EFHB 3ND8A 3O8DA 2IUTA 3F0TA 4HLUC 3THXA 4B2LA 4DVGA 4UNRA 3MWJA 1DG1G 3GFOA 1G21E 4M9SA 1U8ZA 2C9CA 1XEXB 2VHQA 4G5GA 4H1VA 4YMSA 1KK0A 4EJSA 4M1OA 2ZI7A 1G8HA 1YZUA 4PPFA 2WIBA 2DWZB 1HQYE 2XNSA 4O2RA 3TSOA 4A2QA 1E0AA 4NBSA 3E70C 1JJVA 2OLKA 3F8TA 3L0SA 1ONBA 3NDPA 1JECA 4Q4LA 5CB8A 4XWOA 2CLCX 1N6KA 2JLZA 1KI2A 3B1WA 3PEVA 1JALA 2EWVA 2O8FA 1AS3A 1OV4A 4G5OA 2P65A 4NCHA 4US2R 2IA5A 3U3JA 4LX0A 3GEHA 1Z08A 2Q3HA 3CNOA 1NMXA 4BFTA 3KKMA 1PLKA 2KI5A 1YZQA 2CCGA 2JLXA 1T5IA 1AGPA 4HLCA 4EJSC 1XMSA 1FQKA 5DI3B 2H5EA 4X8MA 5K8IA 3IQXA 1N6HA 1NN1A 4RZXA 4TLEA 2YWFA 2CE2X 1BMFD 3NG1A 4P4SA 2QPOA 5KU1A 3R20A 3BC1A 1GOTA 3VR6A 2QM7A 1DTSA 4TYPA 4WAUA 5CLLA 1G9XA 2DFNA 1S8FA 1X8JA 3WMGA 1MV5A 5CDFA 2VH5R 3K0FB 4LHXA 4MH0R 1XPUA 1YKSA 1LS6A 4NDZA 4QJ3A 4MA4A 4QHSA 3B1XA 1OJLA 2VO1A 2DHRA 3OAAD 1G3IA 4LJ7A 4Q4AB 2ODBA 4Q1FA 2HXYA 1W46A 1DAKA 3FKSA 5CIQA 4A0GA 2GK7A 3AF4A 4FD2A 2A5FA 3EZ6A 1F6BA 4KVAA 1G5PA 3KXLA 3MCAA 4UXHA 5A4JA 4Q47A 1Z0FA 3Q8XB 4MGIR 3NC1C 2C95A 3KL4A 3MLEA 5H8WA 3TAUA 3CWZA 1SZPA 1MKYA 3SC3A 2FSIA 1YQTA 4D4JA 2QTHA 1D2NA 5TMPA 1D5CA 3QKTA 2BBWA 4EPVA 1N5LA 3A4NA 1DAHA 2GZAA 3MSXA 3UMSA 1E4YA 4LWZA 4OHWA 1XZPA 4XIGS 1CP2A 1W5TA 1E96A 3QBVA 1R0YA 1G4UR 5HE8A 3KQUA 4XSGA 1LF5A 3B6EA 4V02A 1A4RA 1YZLA 821PA 2JJ8A 1SULA 5JHHB 2BKEA 4MYTA 1F3OA 1XTRA 4N1AA 3W34A 4CVNA 5K8UA 2IL1A 2C77A 4ZIRA 4N0DA 5HCNA 1QBKC 1RVDA 4EPWA 5F3WB 2F1HA 1G5TA 5E4FA 3KZ1E 2Q9BA 2CEAA 2VTKA 3RNLA 1AQUA 1Q21A 1UF9A 3S1AB 1NJFA 4NYMQ 3Q72A 2OXCA 1BO6A 1OH7A 3B1ZA 2QM8A 1X8KA 4ZO4A 3UK6A 2QAJA 2P6NA 1P62B 3Q9LA 4B73A 3TAHA 1XTIA 4M1SA 1KK2A 1P61B 2VF8A 4AC9A 4CT5A 4ZCLA 3CUEF 1OPXA 4KSBA 4AURA 5HZHA 1E2IA 3SJBA 3VMFA 1II8A 1XDBA 2OG2A 2YZ2A 2FFHA 1H8ED 4DLWA 4ZDKA 1CR2A 3KJEA 3AP3A 3DZ8A 3EZ2A 2QENA 1IAQA 2VP9A 2XB4A 4TTQA 4FMDB 4TLAA 3CNNA 3VHLB 1YE8A 4QGGA 4PC1A 1N6RA 1ELOA 2C9YA 3QXHA 2DFKB 3AB3A 3L8ZA 2H57A 2DZOB 3HYTA 3IBGA 4GOXA 1DO2A 1QHGA 1EFTA 2CNWA 1S96A 2WM9B 2WWWA 3EIQA 3HJNA 4NU0A 4CF7A 2IYWA 1CIPA 2BMEA 2YWEA 4BPBA 1NN3A 3I61A 3U60B 3D8BA 5KUTA 1JAIA 3IIJA 2FF7A 2NQ2C 2ORIA 3ADBA 2W2VA 4HDOB 2FJUA 4EUNA 4PX9A 2PLFA 4E5UA 3EIHA 3K70D 1ZIOA 2IXGA 3V9PA 3ZIAA 4BUJA 4TYWA 2OFOA 1PV4A 1KMHB 2GCOB 1SVOA 3VR2A 4QBGB 2CHQA 2GA8A 1GUAA 3U4QB 1DARA 4YDHB 4XJXA 3TR0A 4TL7A 1R5NA 3FGNA 1T3LA 4OI0A 3FHOA 3QEJA 3QJYA 1Q57A 2JDID 3IIMA 1HQCA 3V4FA 1Z47A 4JJZA 1KOFA 3PEWA 4Q7LA 3TGPA 1BYUA 4JT4A 1Q3HA 4OI2A 4B76A 4ZCIA 4B3CA 2IXEA 1K5GA 4MRRA 1S3GA 1DO0A 1NSFA 4NMMA 2D4HA 1W48A 1D2MA 1ANKA 2ZI9A 4RVCA 4C7OA 2NPIA 2EFCB 1TQ6A 1UBFA 4V0ME 5DISB 2HEIA 2O52A 3QPUA 4L8GA 1UEIA 3K0SA 2QG6A 4M1KA 2W58A 2O8EA 2Z0MA 1SXJD 3MG9A 2G1KA 2WMNB 1GRQA 1RRGA 1G3UA 1NBME 4B71A 5GVRA 2C78A 2H17A 2P0EA 3BORA 1V43A 3DZDA 1P9WA 1XRJA 2MMCA 4XD7A 2REOA 2VF7A 4ZI3A 2IT1A 5KDLA 2ZITA 5HKKA 4Q7KA 1E1QD 4BASA 4HUTA 2XXAB 2A9KA 2PL3A 4JVMA 2XGJA 4JZKA 4LV6A 1M7HA 2PZEA 3SU8A 2WSSA 3ADDA 421PA 2GBLA 3SQWA 3L43A 2GEVA 4BFUA 4FN5A 1SGWA 1ZCAA 5JEEA 2O8BA 4ILEA 2V3CC 1SKYB 2PEYA 2AD5A 3KJHA 3RS4A 3BB4A 5AUOB 4TWZA 3UATA 5LPNA 2QTFA 2G6BA 2NMVA 3AVVA 3C15C 2WKQA 2G0NA 3BK7A 3AVUA 1CF4A 4C4PA 2J46A 8OHMA 3THWA 1BIFA 3C16C 2WZQA 3OF5A 3WP0A 2VIIA 4IW3B 2OBMA 2QI9C 4QKQA 4DLYA 1N0WA 4KITB 2Q9CA 3PITA 3A36A 3AVWA 1JXMA 2NO1A 4BQSA 1CULC 2GVDC 2QN6A 3RANA 4DCSA 4LYFA 4FWTA 2GRJA 4HLQB 4DXAA 5C4MA 3KUDA 3GLHE 4OQXA 4TL9A 1BYIA 2HCBA 3F3YA 4LHZA 2QROA 1P9NA 1Z0IA 2Q21A 1NN0A 2QMUA 2YVUA 2ZUBA 4XWKA 1XMJA 1TEVA 3NTUA 5B30A 4BLOA 1SHZA 2ANCA 2E9SA 3WYGA 1IN6A 1HA3A 4L15A 4G01B 1OH6A 1XJQA 4I1OA 4MYCA 3EX7C 5JWRA 3X2SA 1ZVQA 2NO0A 2YKGA 5FTJA 5C1BA 2WAXA 1E9FA 3NKVA 3RSOA 2IYZA 4GI7A 4ZCMA 1PLLA 3MD0A 2B6HA 4B3DA 3O8CA 2IEYA 1KNXA 2VA8A 2JJ2D 2BCGY 2ZRIA 1R0WA 1QHHA 4Q1DA 5FPSA 1EXMA 2FFQA 4W5JA 1N6LA 5SZIA 2XB2A 5D3MA 2R2AA 2JIZA 3SZRA 5GJVC 4M4SA 2ZYTX 4NCJA 4U02A 4L16A 1JEDA 1XWIA 1KI6A 1COWA 4I4LA 2SHKA 4L9SA 1TUEA 1KIMA 3TVDA 5L3QB 4JT2A 4KFUA 1FMJA 2OLJA 5KO2A 2V1XA 2ZI6A 1G8YA 3K9GA 3OZXA 3WYAA 1XXHE 4C0LA 3WHLA 2CL0X 2J5XA 4F4JA 2L0XA 3IHLA 2A3RA 4IFBA 3AEZA 4PSAA 4Q02A 1D9ZA 2DFLA 2IK8A 2D62A 4WXPA 1VIAA 3D7MA 2PZFA 3SHWA 4TSFD 3EPJA 3O47A 3OAAA 1CKEA 1BKDR 4LDJA 1CS4C 3B60A 3CONA 4ARZA 3FVQA 4O3MA 4OKSA 3AVPA 2Y8EA 3CR7A 2AD1A 1PUIA 2YYZA 2KJQA 3TSWA 5KDDA 4D4KA 3UG6A 3NEJA 4HZIA 1XJ0A 5J47A 5L3SA 2CJWB 2JCSA 4A0FA 2EVWX 2N42A 4DJTA 4AWXA 4JYBA 3GD7A 1R6BX 1W4BA 2AXNA 1K6MA 3R9XA 1YR7A 2AFIE 2NTYC 4C0QC 4FCVA 3GLIA 2GJKA 2FPMA 3SJZA 1E69A 2ZRMA 3LRPA 4JVSB 3TRFA 1UKEA 1W36D 3RYTC 3VKWA 3UKDA 1H8HD 2IYSA 4B34A 2NZ8A 2RGEA 5AUNB 4MUBA 5JJLA 2GKSA 3SI7A 3K53A 2YWHA 1MOZA 3RRMA 4IDNA 4EKDA 2CHGA 2F9MA 2ZVQX 4EPRA 5FTKA 1AN0A 1TTTA 3KFVA 1G41A 4KFRA 3TNFA 1LB1B 2BDTA 1LS1A 4RFVA 2FH5B 3U3OA 1Q12A 1P3JA 3AF0A 2AK2A 2KSQA 2IBMA 2ZYUX 5K8TA 4PZYA 3SE0A 1WE2A 3W3ZB 1CJMA 3I3SR 4BLQA 1R4AA 1I4LD 5AR1A 2R9VA 3K9HA 3QF4A 5TY0A 2GEUA 2VP2A 4CEIA 3ZS8A 1W0KD 3CH5A 2F7SA 1NIJA 5CJ2A 3M6AA 5E7JA 2V7QD 2W0SA 2XSZD 4FCTA 4EPXA 3U7FB 5P21A 4A2WA 1T4GA 4WW0A 3DM9B 4NZYA 2J3EA 3L0PA 4JBXA 1G7SA 3K0EA 1EFUA 4RY2A 5LDDC 2QPAA 5FBQB 1UPTA 4WOPA 1YZKA 4Q9KA 2G77B 2DZNB 3SEAA 4NONA 3UANA 1XCMA 2OE2A 3FYHA 2ZS9A 1WDTA 4BFYA 3RC8A 1AQYA 1QG4A 3FDIA 3FHTA 3B8HA 4JLVA 2IW3A 5BWMA 1E2MA 1XD9A 1FZQA 3QPWA 4IDQA 3AJIB 3GLGA 2ZRLA 1DADA 4X8OA 4TT3D 1OIXA 4JLMA 4TLCA 3U3RA 4PC6A 5DNYB 2VSFA 2O8CB 2GF9A 2OM2A 4RKEA 5FUWA 3VU9A 3E2IA 1LFDB 1KYIA 1G6HA 1I4TD 2B8TA 4DLXA 3W6NA 4CEHB 2QQ0A 5H68A 2O5VA 2CXXA 1JAHA 1FP7A 1T3HA 2JDIA 3GJ7A 3QEOA 1GTVA 1GSIA 4PQYA 5EXSA 2JATA 3RDPA 1L7VC 4HAYA 4FWDA 5EP2A 1XD2A 3IPYA 3W9YA 3GLHB 1VCMA 3THYB 5KSYA 5L3VA 2Z4SA 2B21A 3K70C 2OCPA 5DHFA 4ESVA 2H16A 5FOTA 2RH5A 1N6OA 1W47A 2F9LA 2HJVA 2IYVA 1IN8A 5AJXA 1QZMA 2VEDA 4X8LA 5EP4A 1R0ZA 3SYKA 3TUJC 3T5GA 4W5HA 1SXJA 3FWYA 4R98A 3AV0B 3VTKA 4XTRA 2IF2A 2NZJA 1U81A 1KNQA 5BXQC 3R7WA 1FFHA 2ZSAA 3JZMA 4B2PA 2W00A 3AKCA 3ASYA 1J90A 1L2TA 1G7TA 1JPJA 4M1MA 1SQ5A 3DMNA 4HLDA 4D2IA 4RKFA 1Z5ZA 121PA
chains in the Genus database with same CATH superfamily
4I8XA 4NXMB 2Z9DA 2FSFA 4Z7OB 3GVHA 4Z4QA 7REQA 2VUHB 1OX5A 1Z4MA 2OHFA 2KYRA 3FPBA 3B5IA 4K1XA 3ZWOA 3U0BA 2ZSDA 2D1TA 1XYYA 2WWIA 3FFBA 1W7AA 2PS0A 1NOKA 1I1QB 1E9DA 1K7XB 4P31A 1FCJA 1WG8A 1QORA 4KRGA 2IUUA 4RK4A 3PFNA 2ONJA 1ZR2A 4HVCA 5K99A 1RCTE 2RHGB 1G19A 4U7WA 3UJ9A 3B74A 5CYGA 3FPKA 4YONB 1VB5A 2FQQA 4IPTA 1Z36A 3B52X 2FQYA 3DL0A 4LXYA 3HXTA 1Z28A 4CL3A 2YL2A 3H3XA 2ATVA 2OSVA 2AS0A 3VC2A 4UU7A 4NHOA 1H6BA 1T9ZA 3R8CA 4E13A 3U61B 1CLEA 2FQWA 5J23A 3GFBA 4JI6M 5BT8A 4UBMA 2NVWA 1IY9A 3UF0A 3PIRA 1PU2A 4RK1A 1CUEA 3UV7A 4FNAA 4GHWA 4DQXA 4BZZA 1A7UA 5JAOA 4DRYA 4GIBA 5DX8A 5AXDA 3A6DA 3ZK7A 2V7UA 2C4HA 1KZ4A 1VI5A 4KNWA 4HGRA 4GI5A 2VOJA 3RU9A 3GPYA 3E46A 3IKMB 2NUTB 4OQ4A 5COQA 2SNIE 4AJOA 2FOIA 4B08A 3QLEA 2CVZA 2Y21A 1PKXA 4UHBA 4UVDA 3HDVA 4PN3A 3TCKA 2R7AA 2VDLB 1T0IA 1W36B 3LVVA 1U2TA 3QRWA 2QBYB 3GZ4A 3EXAA 4BMSA 2DLDA 1KWGA 2YC2C 4DDHA 4OREX 1UFRA 1JZSA 1M34E 2H0RA 4OHFA 3TEFA 2JHFA 4CEJB 1FVHA 2AXEA 3U7RA 5TRTA 2YCLA 3EQZA 2ZRKA 4KWEA 1PAUA 3OX4A 5BYKA 3NHJA 4AS3A 1LTMA 3TLKA 2BGMA 1AO0A 1C1DA 2BMVA 2Y92A 1P5FA 2Y1FA 1NZDA 3EJWA 3THGA 1XVLA 3OMWA 2BELA 4JA2A 3SYMA 1JG6A 4D4LA 5ICGA 4XWWA 2IEDA 2QY6A 4US1R 1XFDA 1CJVC 3BKXA 2AF4C 3DDZX 5G1NA 2OQ4A 1TO1E 1AUOA 2G3YA 5KNBA 4C01A 3CVUA 10MHA 4M7WA 4OPMA 2JXNA 2DWPA 3WXBA 2P0YA 3PFWO 4FONA 2W8BB 4Y0NA 2VZ9A 4J94A 1OGIA 1D1SA 1XNQM 2I3BA 3L7DA 4DCMA 1CEXA 1IG0A 1XFAA 2EJCA 1FK8A 2VAVA 4TTTS 3LZ6A 1ATIA 4FR5A 4OB6A 1GA4A 3DFMA 3FOFC 5GP1A 1E2FA 3IAM1 2OP0A 2Z3WA 4DLVA 4Y18A 3NHYA 2HY7A 2G4VA 2E5LM 3H42B 4TXLA 4YV7A 4I36A 721PA 4Q16A 2XQGA 1NVMB 4GKAA 1RD4A 2PWAA 2JASA 4CF5A 3QWAA 3RAPR 2RH9B 3C7DB 2EATA 1J99A 3KLPX 1N7HA 2N47A 3KLBA 5DCWA 1RHUA 4G9GA 5CEJA 1ORDA 2Q5EA 2J7PD 1WO8A 1YHYA 3WQHA 5L3QA 5JADA 1Y8AA 4RWZA 3VPBA 4YJ3F 2O19A 4I1UA 1K6IA 3A27A 1NW6A 3VLFB 3MD9A 2F64A 3HE3A 4IGEA 2RHDA 3NC0C 3KFXA 2W2TA 3RARA 1QFJA 3UJ6A 3OP1A 1IN1A 1K9VF 4G8JA 4S35A 4AFNA 4J49A 2VRBA 4X91A 2HRDA 3UUGA 3Q7QA 3JTMA 2VJQA 3C3AA 3WGGA 1ZZEA 4JP3A 1AO3A 2F43B 5LQDA 4KXUA 3K2LA 3G0GA 3WOVA 3TNYA 3R0IA 3A6GA 4K81B 4GECA 4ZZIA 1UJCA 5FYDA 1BVUA 4JUAA 4L6CA 2D54A 4Y2RA 1U5BA 3U7GA 2P7HA 4X7BA 3MWKA 1Z6YA 4TYMA 4UUNA 4ZN6A 2XB8A 4EH1A 1U7UA 3PLNA 2Q4EA 3QX7A 2P9JA 3EPHA 4HN4B 5JSYA 3SFZA 4ES6A 4M83A 5DOZA 2X13A 2YDYA 4DCUA 4HWRA 4H1TA 1U2QA 3HR8A 4JWTA 1YFKA 2YS7A 3LLSA 4JC4A 3CUUA 3MEQA 2ZEJA 4K9QA 2HDOA 2ZREA 2J4FA 2XFTA 1NM5C 4EQ6B 1XCLA 2XQVA 5EJ8A 1KMMA 3EF3A 3ESDA 1A8IA 1XXHA 4I9GA 4N7MA 4E88A 4QWMA 3BZBA 4BKPA 3A42A 5E1OA 3F6YA 1WV1A 5D86A 1JTEA 1ADGA 4QOFA 1FYVA 2I9PA 1KMIY 1Y1KE 4KNVA 1H9BA 4ZCQA 4AWAA 3KKEA 4C4OA 1WP4A 2QNRA 3DAPA 1PZHA 3PE3A 2IF0A 5D1NA 4BY9E 3KYJB 4CI9A 3FFAA 3N28A 1PT7A 1OFUX 4WZZA 2GXSA 5D1HA 3ZCTA 5FFNA 4KAFA 3DH0A 2GILA 3OIUA 3CINA 4IV5A 2PMDA 5KTYA 3LWDA 2H85A 3I2JA 2DTXA 4BVBA 1WPXA 1JVSA 4LBVA 2QTGA 3NO4A 2DR3A 1E6LA 3GFSA 4COOA 1I3KA 2J3KA 1AQIA 3V1YA 2ZTLA 3U3MA 2ZCJA 3GEGA 1KFBB 1QYRA 3WGMA 3PCTA 1K2VN 1R3UA 4EVSA 5IRCD 4RZIA 7GPBA 4DB4A 4KLZA 4HN2A 1JMYA 3K0BA 2A57A 3CY6A 3L6OO 3GT7A 3UFBA 2WHXA 1ZCBA 2EKBA 4MCJA 2G9RA 5DI3A 3KO8A 1L5HB 2A5DA 2VZEA 4M86A 4EUEA 3F90A 3GJ6A 1NE2A 2PZGA 4KQHA 1MVNA 4P3KA 2C7PA 4LRSA 3HNOA 4EBFA 4TRMA 4IQGA 1N1MA 4G86A 3P4UA 3GRPA 3PIDA 1T5OA 2QWXA 2BDEA 2G40A 1VE9A 1HKHA 4FW8A 3BA1A 3GPPA 3RE1A 1LBSA 4A6PA 3R7AA 4YCJA 4DADA 1T6NA 3GAMA 1Q1QA 3LQ4A 3EZFA 3FBWA 1E2GA 4RDXA 1Z7EA 1BRMA 4FILA 1LA2A 1COWD 3W8NA 1UBLS 1UBHS 2GPTA 3GQBB 3X1DA 4MCIA 1VJ0A 3CUWA 3NUZA 2P5TB 4V3CA 1PL6A 3JASA 2WUVA 3IAS6 2C20A 5GM1A 5DXFA 4U2KA 4IVNA 4XVQA 5EJGA 1GARA 2IEGA 1QS0A 3DPUA 4MJXA 4QYWA 2OTCA 3TO5A 2IYYA 1KI7A 3G49A 5EIWA 2JHCA 4BBPA 3AUXA 3AEQA 2CWWA 4QGFA 3DDUA 1D6SA 4PQRA 1AM4D 3CZPA 3SHFA 2G63A 5C5IA 4IDGA 2L09A 4PX5A 2PXHA 2AMLA 1PQYA 3LX4A 3W8RA 2J9FA 5B37A 1F8YA 1V8BA 4PEVA 2A67A 5FUXA 2EJSA 4BQFA 3IXLA 4AZFA 2TMDA 2WE7A 1NVVR 3H5WA 1UZAA 3KDAA 4Q9JA 4E4RA 4EY3A 4D26A 1ETUA 1JH8A 5ILOA 2QHXA 4IXWA 4H7EA 1NMZA 1PJ3A 5BOSA 4JCOA 1NQUA 1XSEA 4YRPA 1MZPA 3WRXA 1DGHA 1T8WA 5G1PA 1BCRA 1WXXA 2R46A 1CF2O 1JFLA 2DOKA 4FNOA 3CF2A 2HMAA 1FJHA 3W5VA 1T9DA 3AEYA 5JDIA 1VJTA 2TRSB 3RGPA 5KU7A 2IQIA 4J43A 3MXOA 5JEDA 1E7QA 3NHLA 1R6AA 1KFJB 3GLIE 4ARBA 1DPFA 3UT6A 1OYWA 3RM3A 1CSEE 2XUDA 3EZLA 4J1SA 4A5SA 1ZUNB 4EGFA 2F3SA 4QXRA 1ZM2A 3OPVA 1OVGA 4HRYA 1RQRA 3W8FA 1XDZA 5I51A 1U0LA 5T5QA 4M46A 3AGQA 1TKBA 1USGA 3D6JA 2UXDM 3SG0A 5J2TA 2NAFA 1YR1A 5G2OA 2BUBA 2O8EB 3OTHA 3G82C 2I22A 1IC6A 1KOGA 2X8AA 4KFTA 1N3BA 4D9JA 2JJ1A 1V5GA 4ZI7B 16PKA 1YRWA 3JVEA 3SKVA 4RLHA 5FBVB 3T0FA 4DBZA 2BR4A 1C9KA 4IHAA 1ZLXA 2ZVPX 1J21A 3NVMB 1EG7A 4E5NA 2YJ3A 1UT6A 1TYBE 3K6RA 4DMRA 1ODTC 5IAJA 4DLNA 4CN9A 5HCIA 4NCKA 1Q74A 2DI0A 1I0IA 2VHWA 1PFVA 5ICFA 4YCSA 2BFEA 2W90A 1KI3A 3HJHA 4DWJA 3CTMA 2IELA 4BN4A 1ZNQO 1LC0A 2B3DA 4AO6A 4HDKB 3V8QA 2VT3A 1FSGA 2Q5JA 1J07A 3NHAA 1PJAA 3AX6A 3UFXA 4FQ7A 3H18A 2VL7A 3VKGA 3FDZA 2PL1A 4YWJA 4ETMA 3INGA 1LWOA 5L3SB 5IK2A 1FXUA 1K5PA 4NS1A 1H05A 1NYRA 3A4YA 3FYUA 3ZLTA 1DIOB 4JQOA 3SP1A 1HH4A 2C9OA 1E3SA 1OLSA 4OFWA 1FYFA 3ROTA 1WTCA 1PZXA 5ITZA 3EY9A 5FPTA 2PSSA 4FFDA 4YPOA 4BBJA 1RNLA 1J2JA 5L6MB 1IBKB 4UE6A 2OZLA 3TQFA 1SH7A 2QRGA 1BDMA 4URXR 4Z49A 2P4SA 3QNWA 1ECPA 3VK8A 5FL7A 4U9HS 1WXHA 3LU1A 3RT7A 4QAJA 4DJDC 2V97A 2QVZX 3FNRA 3OQNA 3ZCUA 1C4KA 4C2UA 2VBCA 1JQDA 3URMA 4L57A 3S55A 1M8GA 1U7XA 5TX7A 1QZZA 1YIDA 1QNLA 2IPNA 4X9XA 1JWBB 1P0QA 3FVTA 3IVXA 4KAXA 2HU8A 4DMUB 3AC0A 5KOJB 1QZTA 2XWJI 3U4AA 3ADKA 4P3XA 3Q5EA 3TB6A 5G41A 4BJ1A 1OX6A 1ZIPA 3DOEA 3S7ZA 4A4DA 3ZNOA 2WG2A 1M2OB 4EIWA 5DE3A 4LY6A 2YUIA 1OI3A 3OIGA 2ZKLA 3PDUA 4L78A 4EG0A 2VQ6A 4HOYA 4PCLA 4G56A 1RE1A 4NFYA 4ENPA 3UK7A 2VA9A 1IWPB 3A9CA 4NSRA 3P71T 3AXTA 4X6LA 2FWPA 1K8YB 4NMXB 5F98A 3K35A 3I5XA 5DX1A 3ZLUA 1AZWA 2VWQA 2MSEB 4CLRA 3H8WA 3C39A 4H6VA 1G21E 4Q3DA 2WA2A 4FOOA 1CWUA 4JGIA 1UK8A 1OWPA 3V4VB 2E4UA 1DZ3A 4U1RA 5JALA 3ESYA 1ZN9A 2CLCX 3SMPA 5ALLA 2IA5A 2XNKA 2C07A 2ESRA 3H6HA 3HSYA 2IVZA 2VXCA 3IUJA 3I0MA 3NOQA 5ITTA 2B5OA 2OV1A 1P0MA 1RI2A 2QM7A 4RDHA 4KGDA 2CUKA 4IMJB 2QMZA 4NOOB 2VO1A 1G3IA 1HSOA 2ODBA 1JN0A 3HP7A 3STTA 3FKSA 3L25A 4PRYA 3MLEA 1ST3A 3A05A 1VHWA 3ILVA 2JK0A 3WLRA 3OU6A 5K8CA 4DR1B 1Z68A 4YRIA 1KP2A 1SHUX 3BRQA 5CEFA 4W5QA 1CY7A 4D9IA 2QI9F 1RVDA 5IJAA 4AZSA 3S1AB 1Q21A 3N2NA 2V98A 4Y2XA 3QLJA 1F06A 5D7NA 4WFQA 1MJNA 4L7VA 4KSBA 3SJBA 1N2XA 5CR9A 4DIMA 2YZ2A 4LKRA 4A16A 1I5EA 3Q2OA 2VNIA 5HILA 2C84A 3PSHA 3HGMA 2XB4A 4FMDB 3NR2A 1C3LA 1NXXA 2IP4A 2QG9A 3OJ0A 3PHBE 3IMFA 1OREA 1CIPA 2BMEA 2AW5A 3D8BA 1IHOA 4M1QA 5K0TA 4TYWA 1Y9DA 1PV4A 2W11A 1SVOA 1QIEA 1QIFA 5FV7A 1QX3A 4HNRA 3CCBA 5JZBA 2Q7DA 1BWPA 3EHEA 1XVUA 1IVSA 2W82A 2QTRA 5K0LA 3S27A 1ISJA 1QX4A 2X23A 1TM4E 2NU9B 5LM3A 2J33A 3KOXE 2XVYA 1GAQA 1VHJA 3LDFA 5LDHA 2VF7A 3SJ7A 2WDZA 4LWPA 1P7PA 2XXAB 2YBEA 4LV6A 1SWVA 4BFUA 2OCLA 4WCFB 4ZO9A 3PA8A 2L69A 1OZAA 2MTBA 5ALFA 5LPNA 1ARZA 1U9ZA 2QMQA 1ISIA 5IANA 1NFRA 3PX2A 3HKEB 2VK2A 1XN4A 2EG9A 1J8FA 3FPSA 1ZAEA 3GLHE 3T6KA 1P9NA 3PUIA 3OMXA 2Y1DA 1AKMA 1WJGA 2JY6B 1KNXA 2PRYA 3GY0A 3HB1A 5FPSA 3ZHXA 2BHTA 2J31A 4QO8A 2BWBA 4JASB 2SHKA 1TEZA 5LZ2A 5I9LA 1FRNA 4KFUA 2C0QA 4U6QA 2ZI6A 1Q7CA 4XPZA 2UUAM 1L3IA 1O9GA 4RHXA 4UBOA 5L45A 3G1TA 1VPDA 1GUDA 3DLHA 3TFQA 3WIOA 5B36A 4GU5A 3VHXB 4WGFA 1YNOA 4HEA1 3H4IA 4NAHA 2JAXA 1H8HD 3NOOA 5EKUA 2NVUB 1YL7A 3HEAA 3RRMA 2ZVQX 4O4LA 3S5JA 4OHKA 3PXBA 2BZGA 1HL3A 4BLQA 5AHRA 4PZAA 3QF4A 8ABPA 6NULA 2VHZA 3TCNA 4PM4A 2XODA 5E7JA 4B4DA 4UE3S 1KP3A 2A59A 4AJIA 2VDVE 3ICOA 2D6FA 2HJ9A 3P0FA 2DZNB 1U2SA 3KYDA 1NVTA 3FYHA 5IZ7D 4O5OA 4Y1FA 4YCBA 2NSHA 3QPCA 5FWAA 4EG7A 4UEKA 4REQB 4KSYA 3KETA 5HJ7A 1LSUA 2KZUA 2JHAA 3E4DA 4CCSA 2FRXA 1JSXA 1YVRA 5LZ8A 5BMVF 2DHYA 1GABA 1UEXC 1WHSA 3KQQA 1YDWA 4LE1A 3Q6NA 3PNMA 5ALTA 3BXXA 3TSCA 1YAJA 1V8DA 3N0XA 4MVJG 5C37A 1ZK1A 3GDFA 5BNTA 4R98A 4KTVE 2FPPA 4PCUA 2ZSAA 2KLBA 4ESEA 4B2PA 3AKCA 4B6RA 4BPRA 4HQNA 3JZIA 1GR1A 4A6EA 1DDGA 1PHRA 2AC2A 4JODA 1NXPA 1A82A 1EQ2A 3WYEA 4PS0A 3EIUA 2R6GA 1ST2A 2COUA 3BTSA 2NXEA 5IF9A 1Y9JA 3FOCA 2JFQA 1U5CA 1J70A 2J1LA 2D0PB 4WE3A 2YHIB 3R7NA 4II7A 4ZOEA 1VJ5A 2ZJ2A 4OI1A 3UJBA 2J6CA 3JAMA 2FQ1A 5BWCA 3E5HA 3P20A 3V4SA 5AT1A 3A31A 1N2ZA 4ZQEA 1DAIA 1IUKA 5AKEA 2PU7A 3T3GA 4CL8A 2IH4A 1Z18A 3TR5A 2EP7A 4H9GA 5JVDB 2V1CA 4XX1A 3TDMA 4OMCA 4HLUA 3HS3A 1HX7A 1P7CA 4KWTA 2C03A 1MQ9A 2WNHA 3MGBA 3ESAA 3QMMA 2R1VA 1PDVA 3V1MA 4JITA 3TWOA 4DR3B 2ROQA 3TD9A 3I53A 1MAHA 3AVTA 3M2PA 1C9YA 4MB7A 2PT7A 3KXIA 3EIOA 4RJTA 3EQ6A 2F62A 3PNVA 2DM6A 5JMPA 4NG5A 2DUNA 5DNUA 3KE9A 1KZHA 3U4DA 5HSGA 1JSCA 4YI5A 1EGAA 4DIUA 4R54A 1CK4A 1Q6ZA 4FTWA 1PD0A 3IESA 3NYQA 1AOXA 5EWJA 2B4AA 1SCBA 4K86A 4TPKA 1KZ9A 2XB6A 5M2QA 1PS0A 1E6CA 1BC5A 1UIRA 4DA9A 2O2EA 5F3WA 3SBEA 2XKBA 5FR2A 3FLBA 2GB4A 2AQ8A 4UNSA 3AEUA 4AY2A 5IJ9B 1QJCA 4IP0A 4U7TB 2KNVA 3G2LA 1E4OA 4MVWA 5IXJA 4XA8A 1U7WA 3LBAA 2L4EA 1OT5A 2FZLA 1WUKS 3N39C 2I2AA 1P7YA 2QY9A 5KCMA 3DA1A 2ORVA 2WUFA 4C6RA 3B2NA 1PQWA 2AEEA 1ESEA 4GL4A 1T2UA 4I55F 4OBWA 4URFA 1Z2OX 1JQBA 4P2GA 3I2GA 2X58A 4JI8B 4X41A 4BKQA 2LWXA 2BVNA 1KFEB 3I23A 4G3OA 1QKIA 1Z06A 3U4CA 2C3MA 4WBSA 1NV9A 3S81A 5K03A 2A0KA 4BGDA 4IUDS 1NMYA 4J75A 1E60A 4CMIB 4IVPA 1D4FA 3WY9A 2Q7OE 4FUTA 2BZ1A 5BV2P 1EI9A 5BORA 1NF3A 5K1ZA 4LJKA 3FHLA 2XDWA 4A82A 5IN5A 1X3SA 2I3ZA 2P5SA 4QSHA 4D4HA 1RWOA 1CERA 4Z1MA 3SKYA 1FTSA 4ED9A 1E58A 3A28A 3WJAA 2BGJA 1LGYA 3DBRA 3BTUA 3L46A 5K3SA 1BN7A 2IPAB 1TAHA 3S28A 2N75A 2IHTA 1RAIA 3QTLA 2P2DA 1U0TA 4GC9A 1DXQA 2XMBA 4LXHA 5D2CA 1R6UA 3H1EA 3JAWA 4B6JA 5DM70 3QBTA 3IO5A 2R6DA 4IDBA 1JDPA 4C43A 2HRQA 3ZC3A 3AVYA 2G76A 5K0ZA 5H4HA 4IZIA 3GMSA 4M99A 1JEQB 4NR0A 1TKAA 3DDCA 1NT4A 4HD8A 4XRGA 3IAXA 2ES4A 2WILA 3D3KA 1IBCA 2Y27A 1SHJA 5ALNA 4QUIA 4C7KA 2RGDA 1V2HE 4PDIA 1OAOA 2EFDB 4ZXFA 5FAKA 3ZVKA 2JH9A 4PN7A 3I9V1 4CIXA 5EEGA 4IM7A 1FNMA 2Q27A 1Y8ZA 3UB2A 2Z6QA 4EVRA 4FNMA 4RHUA 2FG6C 5E8RA 4I8DA 3PFBA 4H18A 1P5ZB 2WSFF 1BZYA 1I1NA 3F1LA 4IBIA 3REQB 3ZKAA 1GJTA 1SELA 5C4GB 1QONA 2GEBA 2FV8A 3B3AA 2ZVJA 3GFTA 3QG5A 3VR5H 3HZRA 1Y81A 3I5YA 4DV3M 1VMIA 2O8CA 4ZD6A 4XM1A 3WLSA 5JSFA 4LJSA 4BQEA 2XA2A 1JTFA 1HLGA 1A0OA 4WA7A 1DL5A 4OAQA 4NZNA 4YRQA 3JWIA 4C3UA 2NLOA 4ATNA 2WW8A 2GNOA 4OMDA 1WMSA 3CBQA 2LRHA 3I6YA 5AM5A 3G9TA 3JQAB 2R4EA 3JALB 4DSZA 1L4YA 2DYKA 5JY6A 1DC5A 4IXNA 4D8VA 3K1AA 3DO5A 5AVYA 4DUZM 4P3YA 2YHAA 1IPHA 1CBUA 5JBIA 2BI7A 1E1RA 4K8OA 2C2OA 1A95A 3OETA 2OT3B 3ECSA 3SNHA 3CZAA 4IWNA 3TLGA 1BE0A 3NRCA 1ZD4A 1ZH8A 1AHHA 1IXYA 4IIBA 2ODPA 1QO7A 2ZIFA 4N54A 1SK8A 1LTHR 1YCHA 3EWSA 4ZJPA 2UUOA 3Q98A 5T3UA 2H8KA 4GITA 1M6NA 4YACA 2CCJA 2V4ZA 3PCXA 4R1NA 5GV8A 3NFYA 4YR9A 4DC0A 5LNK1 5EWMA 2GX6A 1JHOA 5H70A 4S12A 5AI0A 1V11A 1KQPA 3F5MA 5IVPA 2O1SA 2XECA 4PQFA 1NAHA 2DG2A 1GJSA 2H00A 5TPWA 1MB4A 3TFOA 3GI1A 1JLKA 2VPPA 4AJKA 1JIQA 3TSZA 4WXHA 3LWZA 4F6RB 2E82A 4NG4A 1LJUA 4WNYA 5BN5B 1TMKA 4B3JA 4QUKA 2WUEA 1TK9A 4LSWA 1JMKC 1CC1S 3C3JA 2P41A 1FFXB 4IUYA 1KO4A 4UM7A 4PHTA 4WBNA 1IBMB 1UADA 2YFQA 1E9CA 5BQ3A 1FY2A 2WJPA 1UBJS 5KHLB 3T5PA 3TMKA 4KB5A 1US8A 3WSTA 4HDCA 4AX8A 5IT9A 3FNGA 2VJPA 3SS7X 2I33A 1O96A 1S4QA 1N3IA 3C87A 1ZWKA 3DEZA 5AOCA 3V6LA 3RIHA 1QE3A 2BHNA 1GJRA 1R0RE 3THXB 2Q4BA 1UKBA 5A62A 1DCMA 3C43A 4UUBA 1FDIA 1SUFA 4LOLA 4J29A 4YP0A 1QSGA 3ZZ0A 1QCZA 4TTJA 4K9OA 3VH3A 3ZK8A 3NVAA 2JHPA 2JF0A 3CQ9A 1HFWA 3CB4A 4R84A 4C29A 3GJ5A 2NXCA 4UMDA 3TIFA 1RC8A 2PTGA 1E0JA 3OCXA 4C78A 2HF9A 3EXHB 5JJIA 1HNZB 2DULA 3KXKA 4Q03A 3IVAA 3ZDEA 4TVSA 3KTAA 3ZWYA 4FMBB 4H6PA 3G7NA 2FPGA 3AV3A 1GEEA 4ND1A 5DLPA 2YR0A 1J5XA 5T67A 3C4JA 2I87A 1SIWA 4RIHA 1JU3A 1U28A 5TGDA 3O4FA 1TH4A 1MF7A 1MHTA 4NEGA 1T2DA 1XTQA 1GFWA 1R0LA 4DMLA 2QAIA 4GUAA 2Y6UA 4K9LA 3HUDA 4UHCA 5EJEA 1D0LA 3TZQA 5LBUA 2G9QA 3TZEA 4C14A 1V8OA 2ZRAA 3EGDA 1NGSA 1PGQA 3U9TA 1Z22A 4Q3KA 4X1KA 1GZUA 3IODA 2FW0A 4NCAA 1TJYA 3T7DA 1V5IA 3AF2A 2QT1A 2BEUB 3B38A 3H2YA 3PBKA 4TTSA 4KNYA 3C6QA 1BHO1 4LFAM 2FA9A 2IEZA 4OO3A 2NO4A 2ONKA 3QSYA 1D2CA 4MVJA 2YY7A 4BFWA 4HGYA 4WZBA 3ROZA 4Q3BA 2EFEB 1G20A 1NE7A 3ZBTA 3M5WA 2XLCA 3GPXA 3KSDO 1AT1A 2A33A 4GOLD 5EJCA 5A7FA 5G0SA 1HM5A 3S2FA 2DSNA 4QFDA 4W63A 1OWNA 3HVIA 4FHFA 1SQ0A 1QC5B 5EIBC 3GF4A 6Q21A 4TS4A 3WNVA 3RK4A 3SQDA 3E8XA 1J0EA 2UYCA 4F12A 2ZJOA 3U6SA 4ICIA 3E5RA 4AMBA 1THGA 4L75A 4UASA 3P0EA 3JRXA 2C58A 4JI4B 4B09A 2Q2OA 2J4CA 3UWDA 3GGDA 1TJ5A 3MUOA 2PUHA 1X7GA 2YNMC 1E79D 2J5YA 1AE1A 3ZDRA 4LPSA 3FSGD 3I04M 2J6IA 2V7EA 1RJFA 2NYVA 1WEHA 5T8KC 2XKAA 1QTQA 4I4CA 5CRIA 4KMRA 4J4BA 5EIHA 3PENA 1EFRA 4GKBA 1XHFA 1DQZA 3TAXA 2ECFA 4AKIA 5KNDA 3OHMA 1T9AA 4XQGA 3E2PA 4YUWA 4AMGA 2HUPA 3J27B 1RKBA 4F4IA 4Y6OA 5KMGA 4E30A 3M3HA 3PPIA 1IHDA 3NOXA 4R16A 3GGCA 4KO8A 3CO5A 4UJ5A 4ZYUA 4QBIA 1OZ0A 3OI7A 1TVMA 3EQ2A 3PUZA 3VR3D 3GJ3A 4XIIA 5E7QA 2ZAIA 4YR7A 1XZIA 5CA1B 1HT0A 4GC5A 3O8QB 1PW5A 1V33A 4G1EB 3EARA 3KZOA 5C8YB 1IZ0A 3QKRA 4HV4A 4PO3X 5L8VA 1MB3A 4YI3A 5IAEA 5TB5A 3K70B 2HPAA 3TW4A 4XUCA 3CV3A 4JEIA 1QHSA 2Q2EB 5JFGA 4XH9B 1IXZA 1WZCA 4G4SO 5JPDA 1DTEA 1MX5A 1M1NA 5A02A 1ZCJA 3SAUA 3VYTB 4W8OA 4ZYXA 2QRUA 3ORYA 2PR2A 4MMYB 1AXRA 1EYZA 2P91A 3W3AH 2XW6A 2HPHA 1DJNA 5DMXA 2BJVA 3LT1A 4LDNA 5BN3A 3WI7A 3GJYA 3NS7A 4G1VA 1H2YA 4ENRA 4J4TA 1UXGA 5CVDA 1Z7YA 3RCBA 1TDZA 2PEZA 4E51A 4KUGA 5AVJA 2BM9A 4GL2A 1VIMA 1XZKA 2P9EA 1QANA 5BWOA 4BO3A 1KJWA 5TVKA 3STXA 1T2VA 4MUKA 4B2LA 3B6JA 3VYSB 4NV0A 3F96A 2XCSB 5L40A 4F3KA 2QNJA 1EIZA 1ECLA 4Y6SA 1JT2A 2NU6B 3ZNPA 4IZHA 4JUIA 2B78A 3EGEA 4US2R 2IGTA 3O9MA 4I1IA 1N9ZA 1VL1A 1K6XA 3C1UA 3NJRA 2VQFB 4RZXA 1Z7GA 3KSMA 1EFPB 1ECFA 1ZISA 4EHAA 5CLLA 3ZI7A 3D6VA 2VH5R 3K0FB 1LS6A 4O1IA 4LJ7A 1E1DA 2AJTA 2ETVA 3RYHA 1A9XB 1ZXBA 1H5NA 4R05A 1J0BA 3D4BA 1IBLB 4DG8A 3FTEA 4EPVA 4NRWA 3JXEA 4WZAA 3JATB 1MAAA 1YZLA 3H9JA 3VPFA 3I39X 4N0DA 5HCNA 2C5AA 4W8HA 1UMDB 3OP4A 1VBKA 3VTFA 2RK4A 3CN7A 2OBBA 1K82A 3ACCA 5DK6A 5KYVA 2VF8A 1KK2A 1YI1A 5C51B 1OPXA 4UAJA 4KHPM 4PYJA 4HWPA 1SBCA 3DZ8A 2QENA 3F71A 4U3JA 2X8JA 5KWIA 4QFBA 1N6RA 1FRFS 4JBLA 5KZMB 2XCQA 1E3WB 3EEFA 4YUAA 2YMMA 3UN1A 2VAMA 1BXRA 3ES9A 5KUTA 4LY3A 2D7JA 1Z8DA 1H4SA 1LNSA 2W7TA 2XWPA 2Y0TA 4QBGB 2Q62A 3U4QB 3WWZA 2P9FA 1WLYA 1JW9B 3WFZA 4Q7QA 2IXDA 1SA0B 2J4DA 4BVEA 2OO9A 1JFVA 5AVQA 2B2CA 3N76A 1JZQA 3WNQA 2D2XA 4JLUA 1U3TA 1RQPA 3JQPA 5JD4A 2FMHA 1FFSA 3IBSA 2XE4A 1X9IA 2MMCA 4XPIA 3KP1E 4WOKA 3WGHA 3L6BA 3L6CA 4ZVLA 3A25A 2GEVA 1S02A 3JYPA 5AUOB 1MX1A 4TWZA 1B43A 1BFKA 2QTFA 3AVVA 4HEHA 3ZLVA 2KXEA 1LBIA 3C16C 4HPJB 3PITA 1TMOA 4C2BA 3TIXB 4DUPA 2REQB 2GRJA 3SMSA 2XVMA 2DUJA 5CVTA 3F3YA 4RAOA 2X1HA 3EX7C 4O29A 3RVJA 4YWHA 5FTJA 1L5OA 2A7XA 3V8MA 1H1LA 2ZAYA 3SPXA 4L5JA 2FFQA 2I6TA 1NPDA 5D3MA 3SZRA 5GJVC 1W5BA 4X71A 4NCJA 4U02A 4RF5A 2R00C 1T13A 3TVDA 1EGMB 3N0TA 2FUG1 2YN4A 3PDCA 5IW8A 3A4VA 3UO8B 2I54A 4P83A 1CKEA 3KOMA 3S5UA 1N5OX 3CR7A 4RY9A 1HFJA 4Z1OA 3GD7A 3ANNA 4JVSB 3HDQA 1OFUA 2X0EA 3TPFA 5E6RA 3K53A 1QXSA 2C1ZA 3X0DA 3KFVA 4C08A 4BNDB 2B1QA 1Q12A 2AZDA 2RBEA 1D2RA 4P5EA 3S2GA 2IIPA 5JBNA 2FVYA 2H5IA 4FC7A 2V7PA 4NJMB 2I6FA 1L0BA 3D0OA 4CEIA 3ZS8A 4IZOA 3HJGA 4KWHA 4L73A 2W0SA 1WW8A 4LGCA 3LC1O 1UPTA 4Q7JA 1J2YA 1NPTO 4FE3A 3W67A 1NBIA 3ABIA 3TOCA 5H9WA 2VSFA 3M89A 1IWOA 3CT6A 3TNLA 4PQGA 3W9YA 1Z5WA 1ZWLA 2LD4A 3HB7A 4DV0M 1RSZA 4I4IA 1VE7A 3GRUA 1TO6A 1R0ZA 1K89A 3T5GA 3AV0B 4XTRA 3HYNA 4RCVA 1FFHA 1H3NA 5CA0F 1SCAA 1L4FA 4JLSA 2H63A 2A0XA 1IOVA 2Y1CA 1P2BA 3GUUA 2D4AA 2IC5A 1XP5A 2JLVA 3UQYS 1PFUA 3CKLA 2ZQ5A 1C14A 4QLAA 4TV9F 1EX9A 3S44A 1E2KA 1FC0A 1XMOB 3R6GA 2H54A 3UAVA 4F6CA 2I34A 2OHXA 3CRW1 4NCNA 5FYQA 1ZU4A 3T1VA 3D7SA 3AJRA 2W2NA 4UHHA 3CZ9A 3DO6A 3HB0A 1HT1E 3PEYA 3C4QA 5KYNA 1VSBA 2IYOA 4MV4A 3GLRA 1V9LA 4D5GA 3WWYA 2D7DA 1CUAA 4JLKA 1GTL1 5CDHA 4WN9B 4BLPA 4AJEA 4JN6B 1JX6A 4ZEWA 3BJRA 4UXJA 2YOHA 1I3LA 2WYWA 1EUYA 1V9SA 3ESBA 2K6BA 5I7AA 3W5IA 3U1TA 5JUWA 4DIOA 1XJWA 4B44A 3BHNA 8GPBA 1HT2E 3BF8A 1H23A 1J8YF 2CHEA 2BGUA 2DFTA 3MBKA 1GRRA 3PCRB 4HVAA 3LC0A 3VSAA 2FW7A 3TIGA 5C32A 3L92A 3OBIA 1XTTA 3FJOA 1Q1GA 4ZYLA 3OZCA 1OR8A 2ZW9A 4IBKA 3RLIA 2A58A 3F8SA 2F90A 3ZWBA 4Q4AA 1JR2A 2WD7B 4URHA 3QNMA 2SECE 3TQIA 4DMFA 3DOAA 2JGDB 3C5HA 5IHPA 5JFOA 2JGMA 1HRKA 1GSHA 3RVKA 4KIFA 5ULLA 2LKDA 1ZW6A 1XJ5A 3F4BA 3DYIA 2ADMA 3B1YA 3D3QA 1ULHA 3PUKA 4J76A 3TW0A 3L07A 1O97D 3N8IA 1BXGB 4V0NA 3CLRD 2EBUA 3LQRA 1ZNXA 3TLXA 1PJRA 4OGWA 3H97A 4BEJA 4J0KA 5GTDA 1OYVA 3F6CA 3KQVA 2WHPA 5ALJA 3GWGA 2AN1A 4MR9B 4QYXA 2P6RA 3PUHA 5DSZA 1DDIA 4NQZA 2D5LA 1MX0A 2MSNA 2Q6IA 4Z0HO 5G3ZA 3ZQ4A 5LXTF 1QZEA 3LM8A 4RV4A 5H82A 1UFOA 4GMDA 1KRHA 1KPGA 2JY8A 3OCJA 5BN4A 4UHKA 3QI2A 2ZS7A 2WJ4A 1TTHA 4ASUD 3FE2A 4C3OB 1SY7A 2A1TS 3HCAA 1VCNA 1UOOA 2DQKA 3EPLA 2FUEA 5FUQA 2VUIB 3DO8A 1N1DA 2I29A 3OCYA 4YS6A 4EY7A 4LNUA 4PVDA 1Z5OA 2M5ZA 3FMPB 3R9IA 2W2KB 4Z9BA 4HLQA 1HOXA 2XXBA 5FORA 1U1CA 2I0FA 1VFPA 3W4IA 3B1JA 1X1TA 1WSAA 2PXCA 3U6BA 2CXQA 3V8RA 4RX1A 3WYCA 1NDQA 3LQ2A 2JFBA 1Q91A 3E1KA 3N05A 4ERXA 3ZDCA 4EI7A 4JC5A 5ABPA 1JFRA 1R2ZA 4L3WA 1M34B 3RTGA 4Q9HA 1FF9A 3IV6A 1YFZA 1JEJA 4BWVA 2OGSA 3S2UA 5IWAB 5B64A 5KVVA 4C4SA 1DSSG 3IUNA 4QOJA 1Z5PA 3KUKA 4O33A 4B3XA 3T4EA 3CH7A 2YXPX 1RZUA 3MWEA 4F4CA 3EMKA 2WB4A 4MS1B 4GI3A 3ZY3A 3HU3A 3O0DA 2OK8A 3OZFA 1LJ8A 3ZZUA 5LP1A 4JI0B 4EJ2A 5DW0A 4F46A 6ABPA 5AKKA 1GAWA 1P4GA 2XE7A 4AKHA 4EPTA 4MWOA 3GNTA 3EGWA 5FPYA 2DF8A 3TLEA 1IEXA 1EFVA 2V45A 5AM4A 4ZMBA 4Z51A 1L9KA 4QQRA 1OFTA 4EG4A 4DV4M 2YWJA 3F5FA 3ZHTA 1J22A 5I5EA 1JH9A 2Q0SA 4P4UA 2XA9A 3OQOA 2HMSA 4RU1A 1O03A 4EL5A 2VSXA 1V71A 2QIPA 4ZVNA 1QYDA 2L17A 4K3UA 2QT9A 3WQSB 3DBLB 3MILA 4M76B 3AQIA 1E7MA 5EYPA 2AXPA 2ARKA 3FN4A 3AW9A 4RPIA 3DPSA 4UCQA 3RS5A 5T64A 1SOUA 4V38A 1XC8A 5DDIP 1DBPA 3TTWA 1VYVA 1FBTA 4H6WA 4L07A