1NSFA

D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
KPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Protein transport
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR
total genus 84
structure length 247
sequence length 247
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nsfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nsfA01
4GFDA 3PUZA 1G6HA 1Z0JA 4XH9B 1SVSA 2C95A 4R71A 1Z08A 1Z07A 3AKYA 2D4HA 4KFSA 1IHUA 3K0SA 1M2OB 3SR0A 4MKIA 4I1OA 5J4YA 2A5FA 1R5OA 2O52A 2IS2A 2I1VB 2FOLA 3PUVA 2HF9A 2FU5C 3SN6A 4PPGA 4TSFD 5H68A 3AB3A 2GK7A 4A0GA 2B8TA 3HYRA 1MV5A 4WZAE 3NBFA 2FSHA 1E2MA 4C0JA 1WRBA 4D4KA 3GEEA 4HAUA 4FI3C 4IEEA 2MMCA 4GITA 4YMVA 4CEJA 1W0JA 1DO2A 4NDZA 1ELOA 1D2MA 5AUPB 3L0IB 1MABA 1CR0A 1DG1G 4YXWA 3QSYA 2YYZA 3SZRA 2ZI5A 1G5RA 3H0KA 3GJ6A 1NL3A 2R2AA 2BM0A 4MRSA 1Q3HA 1XJQA 3PIRA 3CX6A 2A30A 2IEYA 3OEHD 3QF4A 4DB2A 4I4LA 2N46A 3NHAA 4HB4A 3K70C 4II7A 4CYMA 2IYZA 2A78A 3CRVA 3CLVA 2ZS7A 5AR1A 1UBFA 4AK9A 2ODEA 2V9PA 1GKYA 2W83A 1U94A 1GILA 3OHMA 2RGXA 3VR4A 5JCPA 1AS0A 4PAOA 2IWHA 1E98A 3C5HA 4MDEA 2F3TA 2XTNA 1RPZA 4A6PA 1DG3A 3TVDA 1JJVA 2XSZD 1T4GA 5FOVA 3LVRE 2AD1A 1H8HD 2HLDA 2CLCX 3OIVA 1OB2A 4QNRA 1KKMA 2EYUA 4R9UC 3EIEA 2NO0A 2V8OA 2ZE6A 4RKFA 4OHYA 1NJFA 1EWRA 4D0GA 5CM9C 1A5TA 4AYXA 4Q4HA 2OLJA 4J0QA 4TLAA 3OZXA 3QXHA 1GRQA 4W5HA 2QRZA 2E87A 3MFYA 3MWYW 3QKTA 3R8CA 1T3SA 3CF0A 4TQAA 3A58B 3MJHA 3N2EA 1N5KA 1E1QD 3BB1A 3DOEA 3BH6A 4MQBA 5FBQB 1AZSC 4DLVA 4LV5B 3DKVA 3THXB 1Z29A 1XWIA 1LVGA 4AYTA 2FV8A 1W0JD 4A2PA 1JQJC 2QGNA 4JLNA 4Q7MB 3DMNA 5CK5A 1YR6A 2R6DA 4C4PA 1SKYB 2ZI3A 2WIBA 3WY9A 4BFSA 3NTUA 5AJXA 3DM5A 1LY1A 2XOKA 3EWSA 2CCKA 4M1WA 4XWAA 4FWTA 1HYQA 3P4YA 2KB0A 3F0TA 3CPJB 4NCJA 2IHBA 5CITA 1OJLA 4LHWA 1JEEA 5SZHB 1GDDA 1SZPA 3RS2A 1IN6A 2WWFA 4JLKA 4QGFA 5DGXA 2O8BA 4OQNA 4NU0A 4RD6A 3TQFA 2X77A 3T34A 2PX0A 4KV9A 1L2TA 4TL9A 1TQ2A 5EUMA 4O2RA 2WAXA 2WPDD 2ZU6A 1X8LA 1UKVY 5HKKA 2BVNA 4WXPA 4M1OA 1UAAA 2IUUA 1CTQA 4EQ6B 1MABB 2QT0A 1ZD8A 1N5JA 4KCGA 3ZIAD 4M21A 3THOA 5LPNA 2HV8A 1GL6A 3FFAA 3LBHA 4MGKR 1OKKD 1PVOA 1FX0A 2OEPA 3NEYA 3ADKA 4FWGA 4ITRC 4QBIA 4US2R 1HT2E 3THWB 3ZZTA 2A5JA 4PO8A 1XP8A 4NYJQ 3TSWA 4L4UA 4OK3A 3RS5A 4DVGA 1CKEA 5FPYA 3BOSA 4HDOB 4D82A 1EX7A 1MRSA 2FMXA 1U8AA 4TLEA 1JR6A 3RC3A 2X2EA 2GTPA 2WVJA 1PLJA 4RFSB 4RD0A 3EW9A 3CR7A 1R8QA 4G1UC 2OT3B 1CRPA 5JECA 4LBVA 2CL7X 1UBGA 2GJAA 3IHLA 3IEVA 2QRNA 4KFRA 5CJ2A 3VX4A 3V9PA 1N25A 1D9ZA 5AUQA 1HUQA 2WWGA 1W36C 1G19A 3EPLA 1E9RA 5BW8A 2C99A 4JLMA 3LBIA 4JL8A 5FBWB 1SVLA 1M7GA 2CXXA 2RGNC 4FWHA 4NBSA 2ODBA 2Z0MA 1E2JA 3BE4A 3THYB 4P31A 3LO5A 1OKKA 4TTPA 1OFUX 3CPHA 2WWYA 1BKDR 2ZJZA 1E9BA 2J7PA 2ZSAA 2AL7A 3ZIAA 3ICQB 1E4YA 1P7CA 2G6BA 2PJZA 5DI9A 4LYJA 4F91B 1KDRA 2HDNB 1G8YA 2IHYA 1U8ZA 2ORIA 3IUYA 4LC1A 4ZDWA 3DVLA 2O8FA 1G3UA 1ZCAA 2VH5R 4DUGD 1T9HA 1WE2A 3BS4A 3IEUA 4DCUA 1KNXA 3U61B 3GJ3A 1KI7A 1QHSA 3TNFA 1VKJA 3AVTA 3QBTA 2JLZA 1NMZA 1OFIA 2HCBA 1Z28A 1W44A 3HR7A 4QRHA 3FOZA 4OQMA 4KLNA 1JAHA 3VR5A 1Q21A 4CEIB 1RJ9A 1FP7A 5JHGB 1T91A 1R8SA 4TLDA 4AG5A 2GEVA 1L4YA 4YDHB 5KNCA 1F3OA 3GFOA 5KHOC 3RANA 2W0SA 2OXCA 3ZVLA 1U0HC 1NVXQ 1KTVA 4BFZA 1G7TA 4FN5A 4Q4AA 5CDFA 1G3MA 2XZOA 3Q5DA 2RCNA 2DWZB 1C9KA 1GAJA 1Z6TA 2GHIA 3KW6A 1S96A 4RD3A 2WBLC 1E0SA 1IAQA 3QBVA 4NCNA 2ZRGA 2QP9X 1DAIA 1BMFA 3GLIE 3GJ8A 4LHYA 4TSFA 1UBCA 3LQRA 3C5CA 2WWHA 4IRUB 3EWAA 4ZDKA 4R98A 4OJQA 3T06B 2O8BB 4HDQB 2ERXA 4I1VA 4BGDA 1E2NA 5CK4A 5JJLA 1T3LA 1KDPA 5KTYA 2XZLA 4MRVA 4JKIA 5AUNB 1AIPA 3KKPA 4X8MA 2QN6A 2W58A 5AJVB 4U02A 3NVAA 2IW3A 4OL0A 2EW1A 3IIKA 4UJ3A 3GLHB 2QUZA 4DIEA 2V54A 3E1SA 1A2BA 2CHQA 1N5LA 3GJ4A 3LVQE 4X8LA 4GDFA 1XPUA 4ESHA 1E0KA 4RD1A 2F9MA 4A0HA 3B9PA 4JLPA 2HF8A 2ZS8A 1XBTA 1G4UR 1FOEB 1OHHD 3C7KA 4HDCA 4C0BA 3BB3A 1KZGB 3KTAB 1W47A 1KK2A 1PUJA 4LDJA 2XGJA 3MWLA 1HH4A 3QXXA 2KBFA 1R7RA 5G41A 1KI6A 2NG1A 1R10A 4NYIR 2D06A 3AJIB 4XVQA 1P2SA 2X1VA 4PQRA 2NPFA 3LLUA 1HQCA 2WJHA 1DAGA 1A4RA 4DRZA 4URYR 5DISB 1P9NA 4FMDF 8OHMA 4D0NA 1OT3A 4Q4JB 1SVMA 1II8A 3LH5A 2C2HA 2AD5A 4HLCA 4TL7A 5SZIA 1OXUA 5HPYB 5FOWA 2QNRA 3TW8B 2FSFA 1YKSA 3PITA 4PO1A 5LDDC 2JASA 2V3CC 4HB2A 4L5BA 3VQTA 4KU4A 2JJ1A 2Q3MA 3MGCA 2ATXA 3JZMA 1RE0A 2ZROA 2JLYA 1K6MA 3W6NA 3IBGA 4M4SA 3A1TA 5JRJA 3SJBA 3FMPB 1G8HA 3KZ1E 1G20E 2QU8A 1Q1EA 5CM8B 3V4RA 2PMKA 2WICA 3LNCA 3HPQA 1IN4A 3B1WA 3AGPA 1GKIA 4BECA 3AH8A 4LJ6A 1WXQA 2CK3D 2LWIA 3HYTA 1Z47A 4AYWA 4F7WA 4G5GA 4NYIQ 1P61B 1ZUNB 3C14C 2QMUA 2V55B 4MRRA 1E2QA 3GLGB 1P2TA 2GEUA 3MJRA 1ZM4A 4X8OA 2ZM5A 1TTTA 5B57C 3L2OB 3EAQA 2WWWA 3BFXA 4Q47A 4RVCA 1VHTA 2DFTA 2EWVA 1EG7A 4RCYA 3RAPR 1JR3D 4G5RA 5BYKA 4XIGS 1W46A 4B47A 3AP1A 3X1DA 1EFUA 1GNQA 2A9KA 3CF6R 4MRNA 3DEFA 2DCUA 5F9FA 2W2XA 4RZ3A 4NONA 2PZGA 3WMFA 4FMDB 4OHZA 2VHUA 3VKWA 3SYNA 1IXSB 3QI2A 2ZRCA 4ARZB 2JAQA 2VBCA 5TXGA 2VEDA 3UG7A 1KO1A 2ZRMA 3ZS9A 4A4DA 3A37A 3AVUA 3A1UA 1Q0UA 4B3XA 4M0LA 1OLOA 2YOFA 1DVRA 2KBEA 2VF8A 1IBRA 1IN7A 1M34E 2WJJA 4BZXA 2J46A 3ONWA 2QMHA 2GCOA 2ZRLA 2CHVA 2OV2A 2ZJ8A 3ASZA 4LJYA 4MGYR 2JGNA 4Q9JA 3W6PA 3REGA 3ZJYA 1FX0B 1XMJA 3GP8A 1NVUQ 3AM1A 2V7QA 3A4NA 1G8FA 2ANBA 3RRZA 2JIZD 2LKCA 721PA 3ECCA 1M7HA 4BEJA 3UWOA 3WBJA 4I81A 2ZAMA 1BYIA 2J0SA 3KQUA 4QBHA 3HWSA 5JEDA 4LCBA 5DN6A 4CVNA 3SHWA 5IDVA 2H92A 2ZYTX 4IKEA 4OQFA 4XD7D 4RFVA 4W5WA 4LHXA 2PJRA 2UZIR 3W3AA 4F4IA 3WXMA 3I61A 1A82A 4NYJR 3P1JA 5FUVA 3PJRA 2WZQA 1U90A 2H1LA 5FTNA 5E7MA 2O8DA 1MO3A 4DDUA 3MWJA 3OEED 1ZNXA 1WB9A 1GOTA 2A5DA 2V6IA 1T8UA 3TIFA 1P4SA 3CF2A 1DADA 3ZH9B 1JR3A 2C8VA 1VCIA 1QZXA 3V00A 1AA9A 2F7SA 4V0KA 1LF0A 1N6OA 4PHTA 2REBA 3C15C 2A5YB 3N2IA 3Q3JB 1NG9A 1IQPA 3ZYCA 4KI0A 2B92A 4C0HA 2YKGA 1BS1A 2V4ZA 2D2FA 1S3SA 3KJIA 4GZMA 2VHQA 2H57A 3DZDA 3ZQ6A 4QGGA 1KI9A 4QBFA 1ZBDA 5E7IA 2VP6A 2QPAA 4LJ5A 421PA 4HZIA 1OH6A 1YE8A 3IDQA 3RLFA 3QVVA 5GVRA 3H1TA 4M1TA 2VLIA 2MMGA 1TUIA 1QG4A 4Z8YA 1SXJD 3IHWA 4LBWA 2ZUCA 4BLRA 1JNYA 3AF2A 3W3ZB 4Z51A 1KI4A 4DLWA 3BWDD 1RRCA 2MSEB 4AC9A 1S1MA 2OZEA 3ETLA 4HUQA 5J4VA 1S9DA 5D3QA 1P5ZB 2J45A 4Q4LA 3ZGXA 3LA6A 1BIFA 1XCMA 2QSYA 2XB4A 3K0CC 1RJ9B 4JLOA 4CF7A 5L3SB 3QKSB 4BLPA 3U7HB 2GETA 1R5BA 1U99A 1MRNA 2P6NA 1VYVA 5JI2E 2F43B 2GAAA 2J1LA 1XPRA 3C16C 4F93B 4GOXA 1SVOA 4YC7A 1IXZA 2J59A 3C8UA 3W6OA 3GLGA 3H86A 1MT0A 3QPUA 1PLKA 4KYIB 5JJKA 3GLGE 1U2RA 1RVDA 5E3HA 1KAOA 3FKSA 1OFHA 5CYPA 2LCFA 2XAUA 4CEIA 1TUEA 2W6ID 4D2IA 3T12A 2NO6A 4Q4HB 4WXRA 4X8HA 2GCOB 3BIFA 1VG8A 1QBKC 1QF9A 3NG1A 5H8WA 1IM2A 4JSYA 1II0A 1CJTC 2FG5A 1W36B 3AUXA 4RZ2A 3B1ZA 5FPTA 5EXXA 4CRWB 2Z6VA 4B34A 3KKMA 3FMFA 3FHTA 1UKEA 2AN9A 1O3YA 5IK2A 4GRAA 2ZE7A 3LXRA 1FUUA 1E99A 2FGKA 5EJEA 1WMSA 1Q1ZA 2G0NA 4IHQA 5JMTA 4LJ9A 2YC4C 3J81k 5JJIA 2C98A 2RGDA 4DDVA 4DBLC 2ZRKA 1Q57A 5CLLA 2Q3FA 1OH8A 4QL3A 1PJRA 4Q5IA 5DH9A 3RYTC 4MKGA 3LWNA 4NCIA 2QE7D 4LSGA 3B1VA 2IWRA 1T6NA 4Q9IA 2AXNA 2OESA 3GFPA 4H1UA 2AK3A 2F1JA 4U7DA 1R5NA 1P72A 2QM8A 4QNMA 1EX6A 2OAQ1 3IPXA 4IDNA 4M2LA 3R20A 1D5CA 2XXAA 2NGRA 4BQSA 1XMSA 1YR8A 2NO9A 2WKQA 2JCSA 4PZZA 2OAP1 3IO3A 2ONJA 3EZ6A 3R9IA 5HR5A 4JLDA 1D2NA 5DHAA 4EAQA 3K9GA 4ZCIA 1KAGA 1KOFA 3WP1B 1E1QA 5K8UA 2VP4A 2Z5FA 4HAWA 1B23P 4LGMA 1X6VA 3W9YA 1WCV1 4PC6A 4PZLA 2C5LA 4KBFA 2ZU0C 3BK7A 1A1VA 1U0JA 4CGZA 4V0NA 1OF1A 3CWQA 4NP6A 5FH9A 2O8CB 1CP2A 4MUBA 2ZJBA 5KU1A 2D3WA 4ZI3A 4NCHA 1IJFA 5FOSA 3DKPA 3QKRA 3GJ0A 5DNYB 2K5UA 2N1BA 3JZAA 4P4UA 1KO7A 5FL3A 1LW7A 1ZU5A 3LD9A 3U2QA 4RZXA 3H4MA 1YZGA 1OYWA 1RYHA 4B2IA 1XMIA 4ESVA 4JVLA 4JJKA 1II8B 2PBRA 4A92A 1XTSA 1VCMA 2R6CA 3GJXC 3CPEA 3K0AA 4ZO4A 4PSKA 4B2PA 4B44A 3TK1A 221PA 3JVVA 1HTWA 3U3MA 2FE4A 3E2IA 4OK5A 2C9CA 2W6JD 3CW2A 5D3MA 2J7KA 2B7BA 4RCZA 1T0HB 3OFNA 2QE7A 3BC1A 4FIDA 4XJXA 2C03A 2EWWA 4UNPA 2ZAOA 3K70D 3A1SA 2WPDA 2ZUBA 3QIAA 1SKQA 1N0VC 2KSQA 5EE5B 3T35A 1UPTA 3THYA 2IYYA 4E5UA 2WSMA 2CLSA 4QGAA 3VR1A 2REXB 2JLRA 2ZJOA 3T1QA 4TYWA 2H17A 2KWIA 4JJZA 5DI3B 1V43A 1HY3A 4PSAA 5E95A 4PHGA 1G17A 4WOPA 1TEVA 4DHEA 3QY0A 4ARZA 3TUJC 1GL7A 3C4JA 4DLZA 1XNJA 2G83A 5KNDA 3U7FB 1M8PA 2H8KA 3B6EA 3O8DA 4BFYA 3K70B 2OXRA 3A1WA 2JEOA 1VCNA 4C2UA 3TE6A 1HV8A 1L4UA 3QE0A 1DAMA 3OF5A 2BMJA 4BFUA 1E2HA 1WP9A 1D2EA 3LAWA 4DLSA 1WF3A 2ZI7A 3I8XA 5BN3A 1Q44A 4AKHA 4BEBA 3K8YA 1ZM7A 1GWNA 4ZIRA 1IOZA 3QVUA 4NH0A 2P0EA 1E2EA 4KITB 4PX9A 1XZPA 2EVWX 3PENA 2R44A 4G3XA 4Q4AB 2FPMA 1NLZA 3I3SR 2P2LA 1KJYA 4IOLA 1RFLA 2ZVQX 3RSOA 4C3ZA 1OB5A 2RHMA 1F2TB 2R62A 1UEIA 1XJCA 2QAJA 5TY0A 1GRNA 4GZLA 1VECA 3W90A 3RRNA 4TYQA 5J4HA 2WOJA 1VYUA 1L8QA 1FPMA 1UKYA 4DLUA 4AWXA 4DUGA 4UNNA 2FFBA 2C9YA 3BH7A 1OIWA 3WNBA 3WMEA 4PTLA 5DHFA 1F5NA 4B6EA 2ZANA 1K8RA 2YZ2A 1F2UA 1FL9A 3K0FB 1E9AA 1W1WA 5FR2A 4EFLA 1I2DA 2BBSA 2SHKA 3ZDQA 4DDTA 3CNOA 3AVOA 1TPZA 2G77B 3KB2A 1IY0A 4DLTA 1Z0IA 2GBLC 5C18A 4DDWA 1Z8FA 1JBKA 2C9OA 2DFKB 3EASA 4HB3A 1XXHE 4PC2A 4BZQA 1G7SA 1ZRHA 1TAGA 3BERA 4TT3D 1E2IA 4EUNA 3VR6A 3D3QA 4B43A 1R4AA 3HU1A 2PMDA 2IL1A 1BYUA 4QGHA 4ZKEA 5J40A 5DYGA 4S2EA 2G9NA 4FCVA 2GJKA 2GZAA 2JLQA 3FMIA 5D3MB 4GPTA 3UG6A 2G1JA 3P4XA 5L3QB 2NZJA 3FB4A 5P21A 4HUQB 3K0EA 3AUYA 1DELA 4P0TA 2XOKD 4I1UA 1FTNA 4EPVA 4M22A 1GKUB 3FMOB 3T15A 1WDTA 5IRCD 5CIWA 4C0AC 2EFCB 3I1FA 1E2PA 3QNUA 4FMCF 1H8HA 3CZPA 4KO8A 2H7VA 3ADDA 5ELXA 5DI3A 4LJAA 3F8TA 5EQTA 3LDAA 1EWQA 1IY1A 4A2QA 4ON9A 5JCZA 4AG6A 5JS8A 5FI0B 1ZJ6A 4HZUB 1WQ1R 2PZEA 1N6NA 2CL6X 4Q1AA 2FA9A 2R65A 1TF2A 2FGJA 4OHXA 2GXSA 3AVXA 4HLDA 3NH9A 2ATVA 4TMVA 2J9RA 5IK2D 1UM8A 2GVDC 1W48A 3I8SA 2BC9A 2CNWA 3HR8A 5HZKA 1AGPA 4L16A 4B71A 4IDHA 4IVRA 1QHYA 1CR1A 5EXTA 2FSGA 3CR8A 2DVWB 1NBMA 2GILA 2Q9AA 4NMMA 4GMXA 1GVNB 2HYIC 4YMWA 2RGEA 5EE1A 2W2VA 2GF0A 5GJWC 1II9A 4AKGA 3D7MA 1CRQA 4POAA 5HCIA 2AWNA 4US0R 1NSTA 1E9CA 3MLEA 1M6NA 4KXFB 1Q1BA 4K81B 3W5IA 1W5SA 4OJKA 3JVUA 4PAQA 4C0KA 2YWFA 3DL0A 3L8ZA 1X37A 4ZPXA 3K9LA 2ONKA 3FPAA 3PG5A 1X1SA 2D74A 1VG9B 5L3SA 1QRAA 2G88A 1F2UB 4JYBA 4DJTA 4PQFA 3IILA 3QKSA 1NSFA 1EFRA 4GP6A 4KVAA 4R2IA 4JYCA 4WBSA 2VPPA 4ASUA 2TMKA 4D4LA 1MO4A 3WMGA 5GJVC 3PR1A 5B30A 2C77A 5FTMA 1N6KA 5CJPA 5AJWA 4JVNA 5E7JA 1OFTA 2ZRBA 3BFVA 3CX7A 4UXHA 2ECKA 2BBWA 2FDCA 4FINA 1E2FA 1W2GA 2CCJA 3CRQA 2KE5A 3UWKA 1NI3A 1XTJA 1N0UA 4DCVA 1XPOA 4IOJA 3KKQA 3ASYA 3LFUA 4E03A 5IF9A 3Q72A 4TLCA 4ZCLA 3SQXA 4LV8B 2OFXA 2AFIE 1YZUA 1S9HA 4XWOA 1EGAA 3RS7A 1P6XA 3VMFA 2GJ9A 3THWA 2Y8EA 1GTVA 4DSOA 4FW9A 1UFQA 4Y0VA 3PV0A 1OE0A 4HATA 5GJBA 4E07A 1XU4A 2CK3A 2W2TA 1GNPA 4NL4H 4MYUA 1Z6YA 3SS8A 3UXMA 3FYHA 3RHFA 4C7OB 1E9DA 3B9QA 1SVKA 2DFNA 2QQ0A 4NZYA 3I32A 4BFXA 1Z0DA 1P73A 1ZD9A 5KSYA 3O8CA 4A8JB 2CE7A 2PT7A 2O8DB 5CLQA 4LYHA 4R7ZA 3MUFA 4U00A 3VX3A 1VIYA 1RZ3A 3KUDA 2DBYA 4G01B 1Z0KA 2HUPA 4D4MA 2FX3A 2ZRAA 5JI3E 4EIWA 1GRRA 3U3JA 4FWIB 4TMTA 1CR2A 2H16A 2OCBA 3EPJA 1W7AA 2J0UA 3FVQA 2QG6A 4GI7A 1FP6A 4YMSA 5JWOA 2J0VA 3SJAA 2R8RA 3GLIA 1T3HA 1G41A 2FJUA 1NN5A 3WRYC 1ODFA 4JL5A 3QF7A 5KDDA 3Q5EA 4Q9HA 2CEAA 5KUTA 4H9GA 1E9SA 3BAFA 2OILA 3DDCA 1F6BA 1N6PA 3D6TB 5KOYA 2B7CA 3U3KA 2F55A 2GWHA 3H2YA 3AEZA 1OIXA 2WWIA 3QEJA 2HXYA 2DYKA 4TMXA 3IIMA 3IPYA 2A3RA 1KHTA 1Z22A 4JMPA 1ETUA 1AS2A 3ND8A 4CT5A 3DPUA 5JSZA 2DR3A 2RGCA 4RSGA 3P26A 4AY2A 3PUXA 2IS6A 2CVHA 2O8EA 2ZYUX 5KPJA 3NBZC 2ZRNA 4C30A 2GVZC 3B1YA 1VHLA 1T8TA 5JWHA 1HT1E 1L7VC 3A1VA 2V6JA 2IYXA 3E70C 1CBUA 2JATA 3TVTA 4MGIR 2XTZA 3SJCA 2H5EA 4UNSA 2V1XA 4H1VA 2RGGA 3FE2A 5FL7A 4BFWA 4QC2A 4YQFA 1TX4B 3A8TA 2IS1A 2I3BA 4XOIA 4PC7A 3PEVA 3NKVA 3QKUA 4DLXA 1W4CA 4JBYA 3RS0A 2N42A 4KJZA 2RGNA 4OQLA 1KIMA 1Z6XA 1E2DA 4I1SA 5HKKD 3DZ8A 5B2ZA 4JS0A 2QY9A 1S0UA 3LRPA 3SBEA 4Z1MA 3M6AA 1XD9A 2YHSA 4TTQA 4UXJA 2EFHB 3T61A 4ABYA 2XZPA 4EPTA 4LPKA 1Y3AA 3UK6A 1P3JA 4G5SA 2RMKA 4BLTA 5L3VA 3MHVC 3GD7A 2ZSEA 2VP5A 4A9AA 4EJSC 4PO9A 2O0KA 3CH5A 4OI0A 2QPOA 1UBEA 2IYLD 2XJ9A 1Z5ZA 2J7PD 2OE2A 4XD7A 3VR3A 1MH1A 2IYQA 4NPHA 1AQUA 5BYJA 1HA3A 2IYWA 1KYIA 5E4FA 3CNLA 3KQHA 3NH6A 2ZVPX 2V1UA 3MAAC 2CLDX 2PCLA 2FZ4A 2W6JA 4DLYA 5FUWA 4A3VB 2QTVB 4C0SA 4MYTA 4C2TA 2NMVA 4HLUC 1XB2A 2FPKA 2G0TA 4MH0R 1AKEA 3P27A 3Q85A 3VR2A 2J41A 3AVVA 1ESNA 3T1TA 1OXXK 1KK1A 1R0WA 4GBMA 3AVQA 1GIAA 4IVQA 4LYFA 3CX8A 1JI0A 4MYHA 5H70A 2VP2A 5G3ZA 5F9HA 4C7OA 4WW0A 2ZR9A 3VNVA 1AZTA 2J0UB 2QA5A 2WIAA 3Q7PA 1W4AA 2QQEA 4DWJA 2YVUA 3OE7A 4M1YA 4NHOA 1SHZA 2ZPTX 5AJZA 4BPBA 2I4IA 1DAFA 2QTFA 3QQ5A 4IFEA 4D0LB 4NCKA 5C46F 2GJ8A 1E2KA 3KXIA 2VSFA 1N0WA 4P3YA 3M1IA 4IVPA 5EE3A 5C4MA 2JLUA 3W34A 4OHVA 1YR9A 3GJ7A 4B2LA 4QBGB 5BXQC 1EFCA 4HZUA 1GITA 3MD0A 5KYKA 2AXPA 1E96A 3I73A 2O8CA 2AK2A 3ZZ0A 4LYAA 2Q6TA 2YWEA 5CB6A 4QHTA 3HU2A 1AM4D 4GL2A 2QBYB 4B3CA 1XRJA 5KDOA 3LQQA 4WZ6A 1AS3A 4L9WA 2YWGA 3WYAA 2ANCA 3BFKA 1KDTA 1C1YA 1ZUIA 5G40A 2XEXA 2IC5A 2DHRA 3IBYA 1G3IA 1R0ZA 5FTKA 1XTIA 4B74A 3KQNA 3LW7A 4QM7A 4XVRA 1ZVQA 2OCPA 3MWKA 2IEZA 3QXSA 5HE8A 1AK2A 2ZSBA 2FF7A 1QZMA 3U4QB 1FUKA 1ZMXA 4URZR 3OAAA 4DZZA 4DT1B 1GSIA 3FKQA 2A7QA 3OIUA 2AHOA 2CBZA 1W0KA 2WTUA 4IDOA 4HLUA 5DN6D 1KGDA 2WV9A 2RGAA 3KB1A 1KO5A 4OI2A 3W5JA 5BN4A 1GNRA 3B2EA 2GBLA 2WKPA 3DO6A 3LY5A 1E1RA 1XD8A 2QZ4A 1KO4A 2O0HA 4A82A 1IN5A 1KJZA 1ZUHA 3MSXA 4TLBA 4ZV4A 3KJGA 2NTYC 2FEMA 3A4MA 1QVRA 4Q00A 4N0EA 5LD2C 1COWA 2GA8A 5TMPA 1VDZA 1PUIA 2HT1A 1SXJE 5J4LA 1XEXB 1U9IA 2Z43A 5C1BA 4ERNA 4ILEA 5DSZA 1JXMA 4G5QA 2HCJB 4TMWA 4BFTA 1NG1A 3QENA 2VA8A 4YDSA 2YWHA 4B32A 3CONA 2FEOA 2GXAA 1FNMA 4OKSA 1SGWA 3ZQJA 5HZHA 1XJ0A 1CU1A 2OBNA 3L0SA 2IUSA 4KLZA 4Q01A 2HJGA 4WA7A 5FTLA 4N0DA 2D2EA 4UNRA 2DY1A 2PZFA 4RZUA 2IX3A 1NIJA 2JA1A 4BLSA 3P20A 4MKFA 1GUAA 3GJ5A 3KFXA 1M1YE 3QPWA 3SQWA 1RW4A 1G9XA 4DCTA 2GNOA 1VG1A 5JRZA 1N2CE 2GF9A 4EDHA 1NP6A 2EYQA 2Z83A 1RC8A 2UVQA 3CH4B 3TSOA 2IA5A 4EFMA 1F2TA 5FBRB 1XFAA 4JLJA 1DPFA 3OFND 3ZVRA 1R6BX 2B6HA 2J87A 5KSOA 4P4TA 1Z0AA 2GXQA 2IBMA 4LY6A 4W5JA 1FQKA 3VHLB 4HSEA 2JLSA 2QGZA 1P60A 1C4OA 3GLFE 2IS4A 1FFHA 3CO5A 4YXWD 4JL6A 4YLGA 3VLFB 1ZC3A 2OHFA 3K9HA 3GLHA 4BASA 5DYIA 5HTKA 2VF7A 4GNKA 4V0LA 3V4FA 3M4YA 2QROA 2ZR0A 4KSCA 1R0YA 2QM7A 1GG2A 1CEEA 4XTRA 1OH7A 1NVMA 1C1KA 4DEXA 3CB4A 3KFVA 3AV0B 1QHIA 1FNNA 4PXAA 2V6ZM 3KTAA 1NLYA 2OO7A 3SOPA 2ZRFA 2X8AA 1W49A 1JAIA 5K8TA 2A5GA 2RHDA 4D6PA 3NWJA 4LZZA 1KK3A 1KI6B 3KQKA 2OLKA 4RD4A 2NO7A 1OXSC 4JLBA 2PH1A 1E1RD 1N3BA 3EG5A 1BMFD 2ZITA 3GQBA 3I4LA 1QVAA 1CJKC 5EZ6B 3CUEF 4MRPA 5G53C 4ZDIA 4URWR 1P2VA 3G82C 3B85A 3BRWD 2O8EB 5EP3A 4KFUA 4P32A 4JKYA 2ZRIA 3QJYA 4PFSA 4TL8A 4P4SB 1OYYA 1XEXA 4C9BA 2V7QD 3K09A 4QG7A 3U4QA 2P65A 3H84A 3TH5A 4F4JA 1UKZA 1QHNA 1Q12A 1Q20A 3B82A 1Q3TA 3NXSA 1T5LA 4A8JC 1IONA 2JIZA 3U3OA 3SU8A 2H18A 2PL3A 4KSBA 4DXAA 5J5CA 5EP1A 1XX6A 2P6UA 4LX0A 3AVWA 4B3FX 3BGWA 3QUSA 5TVKA 3T5DA 4LRSA 1SVIA 2PLRA 4NYMR 3PUWA 1MO6A 1R2QA 1H65A 4EKDA 2ZS9A 3L0PA 4D80A 4QHYA 4FCTA 1XTRA 3I72A 4W7SA 3IGFA 1G7RA 3FHCB 3TR5A 1S2MA 4AIIA 5IT5A 4O2LA 1KJWA 1NN0A 3TR0A 2FPLA 3TQCA 2AKYA 3VU9B 2WJGA 4AKIA 4BRUA 1ZNZA 1JJ7A 1XZQA 4C0QC 2PLFA 1JPJA 3NEJA 2IYRA 4TQ9A 3OIWA 1SVWA 2JJ8A 5A5GA 2O8FB 2FZLA 1YZQA 1Z2CA 4PHHA 4PSVA 5JSZB 2PCJA 3U6BA 3AF0A 3KXLA 2HT6A 3PVSA 3B8HA 2AWOA 3IO5A 2BJVA 2JLWA 3BORA 4TWZA 3UMSA 1J70A 2F9LA 4PC3A 1S3GA 2RH5A 4B35A 5IHPA 1N6LA 2FFHA 3NDPA 2CNWD 4IXMA 4IDQA 3ZZUA 4E09A 1YR7A 1AGRA 4URVR 3CRRA 2ZI9A 4YONB 4TMKA 4D81A 2ZI6A 2BMFA 4KAXA 3NBYC 5LBIA 3O8RA 2BMDA 2BIFA 2EFDB 3OEEA 4CZ2A 2NQ2C 4JZKA 2WSSA 3EX7C 4DSTA 3WHLA 3WYFA 2C78A 3QXCA 3OESA 5CDFE 3RWOA 1DEKA 4Z54A 1COWD 3OIYA 3EIQA 4NYMQ 4DSUA 5BN5A 1E4VA 1XEFA 2QL6A 1VMAA 4FWDA 1VTKA 4D25A 2XNSA 1YHNA 3BJIC 1X8JA 3S1AA 5FOXA 4LJ4A 2IF0A 4DEYA 3QKRB 3RVBA 3MCAA 2ZUDA 1YU9A 1FMJA 2AX4A 3AF3A 4A6XA 2HXSA 3K53A 5AUOB 3CM0A 4IXNA 3R9WA 4ZKDA 3U7GA 4Q21A 4AKEA 1OXTA 2QBYA 3T5GA 1WBBA 5DLQC 1VCOA 2GRJA 3U5ZB 3FHOA 3FKSD 1SQ5A 1P2UA 1U8YA 5H1YA 4EFNA 1KMQA 2DZNB 2QI9C 1N6RA 2GCPA 4M9XA 2CDNA 3OEHA 4LOAA 3THXA 2AKAB 1DAKA 1BH2A 2J3EA 5SZJA 2NO1A 2GJSA 2ZJAA 3EZ7A 2UKDA 3AVPA 2OBLA 1XXHB 4K46A 4TZ6A 1CS4C 1NKTA 2Q21A 1ANKA 1FMLA 1Z6GA 3FWYA 5UKDA 3E5HA 4M8NE 4O3MA 1T0JB 3GMTA 3G5UA 3GLHE 1EXMA 2Q9BA 3ICEA 2ZYWX 2QPTA 2C04A 4Q9LA 2QT1A 3Q8XB 3GLFA 1M7BA 1YRBA 2P67A 4JVMA 2F1IA 4FXPA 1KI3A 2D7CA 1S8FA 4MYCA 1Z2AA 2IF2A 1SULA 1E3MA 4JVSB 5C2JB 1LNZA 5A0FA 4DC9A 1Z0FA 5K8IA 1QHHB 1E69A 1DE0A 2XTMA 4KFTA 4Q18A 4NE2A 4HYYA 1XD2B 4HI0E 4B33A 4ASUD 4Q03A 2VL7A 3X1WA 4Q1CA 4S35A 4PHFA 1G3QA 4JBWA 3VKGA 2ORVA 4Q4JA 2YOHA 4OI1A 3ZS8A 2BBTA 5EE9A 4AURA 4EPWA 3M0EA 4RKEA 3PQCA 2HEIA 3CIOA 2L0XA 3UMRA 5FR1A 4IOKA 3ADBA 1CXZA 2EU8A 2ODNA 2RB4A 3HU3A 2OCYC 3SEAA 4ZIRB 1Z63A 1TF7A 2D7DA 2R6AA 4FMBB 2P5TB 2QP4A 4RY2A 1I4DD 4PZYA 1CULC 1E6CA 2ZYVX 2VHJA 1E79D 4QFMA 3U7EB 4FCWA 1W4BA 1G1MA 1TF5A 3LW8A 4JIMA 4ACBA 5HE9A 1DAHA 1TU3A 4TYPA 2JLVA 2PX3A 3IKJA 4PPQA 2IK8A 3SJZA 3UMFA 4B75A 4DT1A 3HP1A 5GADl 4F38A 2ZE5A 2MSDB 4JLVA 2PEZA 2GZHA 1KY3A 2GCNA 4DIDA 1CJVC 4F4CA 2FWRA 1RRGA 4Q48A 3C41J 2RGBA 4MA4A 4V03A 3UKDA 1KSGA 4JN6A 2BM1A 1G5PA 1RKBA 4CDGA 3GPLA 1MKYA 5JZVA 2YV5A 1PLLA 1FQJA 5TARA 4YMTA 5TDHA 2DWOA 2CE2X 1EFHA 4HLQB 3X1XA 1NLFA 4BE7B 1KSFX 5EZ5A 2ZJ2A 1J7KA 2BCJQ 3WP0A 5KSZA 3SE0A 1NVVR 1E94E 1ZIPA 2BEJA 3B13B 4Q1FA 3AF1A 4M9SA 4PAMA 1YZKA 4EPYA 3W8NA 4MKHA 4N1AA 3TMKA 3EA0A 5FTJA 1ZAKA 4P33A 3U44B 1LS6A 4Q1DA 1KMHB 3LXXA 2NOAA 1NY5A 5EXPA 1LS1A 2O5VA 4A0FA 5L8VA 3RC8A 1NIPA 2CL0X 4BLQA 2GKSA 2VIIA 1ZNYA 4LC0A 1TEXA 2QTHA 2DWQA 4HAYA 5AWFC 4QM6A 3ZD6A 2OCAA 1DTSA 2WM9B 4IFBA 4WZBE 2R9VA 2JJ2A 2R6GA 2ZSDA 4UXIA 2ZREA 5KO2A 1O87A 2EFGA 3B78A 6Q21A 3LLMA 2X19A 2YNMA 1B0UA 4QXAA 3TUZC 1OV4A 1XD2A 3VTKA 2A2ZA 2OUKA 1JECA 2EFEB 3EPKA 2ZRJA 5FBVB 2QORA 1G16A 4FMCB 2P5SA 1KI2A 4V0MA 4V0ME 4IEIA 4PQYA 1U0LA 1XCPA 3KKOA 5BWMA 5EP4A 1E0JA 1P62B 1U98A 3AP3A 3F5FA 2ZETA 2BEKA 1JPNA 2BMEA 1KY2A 4LV6A 5LB4A 4QJ3A 2PEYA 2Q0HA 4KYUA 2IXEA 1NY6A 4BZPA 1GM5A 3L82B 2DFLA 2Q3HA 3SHFA 3F3YA 4BLOA 3SFZA 2IT1A 2Q9CA 3T1VA 1NNEA 1N5IA 3TGPA 3SNHA 5B64A 2QSZA 2WJIA 1KZ7B 3MMPA 1E0AA 1DS6A 2NIPA 2ZEJA 1CF4A 4KODA 2CJWB 4O25A 1P9RA 2IXFA 3CRMA 3WYGA 3QEOA 2QP3A 2XX3A 4LBYA 1YQTA 2ZIAA 3AKEA 1ESMA 1G8GA 2JDID 2WJVA 1SXJB 1NF3A 2C96A 3SC3A 1UF9A 4B6FA 1H8ED 5FUYA 5JLJA 1E32A 5HCNA 1AN0A 4BWYA 2BDTA 4GMDA 5AJYA 621PA 1Q22A 3U3RA 1G64A 2OBMA 4UQOA 4Y0AA 5FBLB 3SYKA 1XEWY 3KL4A 2GDJA 5KNBA 4WIAA 3ND9A 4EPRA 1QDEA 2CMKA 3RS3A 1LFDB 4HEJA 4L15A 4GOJA 4HAXA 2F3RA 1UJ2A 4ACAA 4B3DA 3TRFA 1Z6AA 3BBPA 3Q7QA 1W5TA 5KPDA 3PXGA 1OXVA 4JT2A 4URXR 2E9SA 3UANA 1G4AE 2BHRA 1FW6A 2YJTD 2B21A 3GFTA 4HB0A 1OSNA 1XMVA 2JJ2D 3S1AB 4XTCS 2YOGA 3KKNA 4OBEA 4A2WA 4N3NA 4IW3B 1MOZA 2YC2C 5EP2A 2KJQA 1WA5A 5JWRA 3EARA 4GP7A 1XEWX 4U5XA 1QHXA 1W2HA 2QAGC 1XDBA 3WHKA 2PT5A 3NBXX 3QXJA 4NTZA 1XCGB 1HE8B 2XNDD 4C0LA 3PUYA 3X1YA 1JALA 4KBGA 1ZINA 1VPLA 1YZNA 3N5CA 5FPSA 3UIEA 3R8FA 2FFAA 5TB5A 4Q02A 4A8JA 1JEDA 1MR3F 4EJSA 3L43A 5K8LA 5AK0A 2QMEA 2BJWA 1ZC4A 3HPRA 3U44A 1GFIA 4LRTA 1ZW6A 1T5IA 4OI4A 2R6FA 2G1KA 3AP2A 3EZFA 4Q7LA 3WBKA 2P6RA 2BV3A 1NMXA 2QMOA 1TQ6A 4Q1BA 2DPXA 2I1QA 2BKEA 2VP0A 2ZRHA 4JSTA 4KVGA 4ZCMA 2GEDA 5CB8A 1IXRC 1HEIA 2NZ8A 4M53A 3REFA 1XTKA 3NHBA 2XXAB 2OG2A 1W0KD 1ZM3A 4LBZA 2ZJYA 2OFWA 3UPUA 4CEHA 4TN1A 3GLIB 1G18A 1DOAA 3FGNA 1US8B 2VRWA 2WOOA 5EE0A 2HJVA 1YJ5A 4JBXA 4Q7JB 1S1CA 1XXHA 1QHHA 1EESA 1AKYA 4B73A 1F60A 3B1XA 3BB4A 3U60B 1BO6A 2FN4A 2XJ4A 3GCGA 4Q66C 3CZQA 1AQYA 1FZQA 4V02A 4EQ6A 2XSZA 1VYTA 4TZ0A 1ZD1A 1E2GA 3QG5A 4PPFA 4CT4B 5L3QA 4CW7A 4LPSA 2ASEA 2F6RA 4EPXA 3I5XA 4RJLA 3IQXA 4V0OA 2XB2A 5ANRB 3EC2A 4GOKA 3TLXA 1CR4A 1TMKA 3UATA 3MRSA 1X1RA 3QF4B 4A36A 3WNCA 2VO1A 1UDXA 1VG0B 5EUQB 4LJ8A 4E22A 2QAGA 3FDIA 3KJEA 1E9EA 2IXGA 3D8BA 2ORWA 3AF4A 1P75A 3K0CA 4DSNA 4JLAA 4P4SA 3KJHA 4FD2A 4XVUA 3W8RA 5JEEA 4Q9KA 2XITA 1SHKA 2BOVA 1Z3IX 3LBNA 1ZU4A 4A0RA 4PANA 821PA 4QKQA 1DAEA 2ZQ5A 4PPNA 4Q19A 2IYVA 1NRJB 2EQBA 5FI1B 3U6KA 1A7JA 1R0XA 3K0AB 1J8YF 3ZVNA 1V5WA 5M04A 3G0HA 3CRW1 1TNDA 4M9ZA 3CWZA 2F1RA 1KO8A 3PFIA 1NJGA 1U81A 4LUCA 2MSCB 1QHGA 2P3SA 4DLRA 3EPHA 1DO0A 2XNDA 4QHSA 2GZDA 3HJNA 3RSLA 1JR3E 1W36D 2ZJ5A 2IUTA 2F1HA 5J4KA 1LF5A 4L8GA 3O47A 4GSYA 4BFVA 1J2JA 3DHWC 2REOA 4M9QA 4CEJB 5KSPA 4AD8A 1KKLA 1Z06A 4TYYA 4OQXA 2ZRPA 3NIBA 4TT3A 1RRFA 3NDBB 3VU9A 4EJSB 2ZTSA 5BQ5A 1ONBA 1ZM2A 4XSHA 1ZCBA 1NBME 3EA5A 5A4JA 5SZKB 4M1SA 3KDSE 1LTQA 1AJEA 3WNDA 3I5YA 3O8BA 1U9IC 4YMUA 121PA 4OK6A 2RAPA 4I99A 3KQLA 4DB4A 4KHZA 4MITA 2VTKA 4G0NA 1W4RA 3IQWA 4HUTA 1GL9B 3AVYA 4D4JA 1N6HA 2WJYA 3Q9LA 3VFDA 2QEQA 2W0MA 3BH0A 4CIDA 2QENA 2JJ1D 3QG1A 4F92B 2AFHE 5CIQA 4B48A 4LK2A 4UKDA 3N70A 1YZTA 2F43A 4PC1A 1X3SA 2WMNB 1SKYE 2IYUA 2B8WA 5FL7D 4DKXA 5DO9A 1KMHA 5GJCA 3VAAA 1Z83A 4UNQA 4WVFA 3CKLA 3ZLJA 1A2KC 3DM9B 1HE1C 1EFTA 4AI6A 1S4QA 4QOSA 1DARA 1TQ4A 2CVFA 4TMZA 1XTQA 5FOTA 5GVSA 1VIAA 3BXZA 1IN8A 4TL6A 1J99A 1Y63A 1TU4A 3SDZA 4HAVA 5C4GB 4Q7KA 4BUJA 1ZYUA 2GESA 2AR7A 3K0FA 1E79A 2X2FA 1I2MA 1KI1A 1OPXA 3X1ZA 1H8EA 1HQYE 3P32A 2DZOB 1NN3A 1G7CA 1NBMD 2JDIA 3TUIC 2VQSA 1IJEA 2ZR7A 3VHXA 3A6PC 1FTSA 2G3YA 1UDWA 1K5DA 1SXJC 1J90A 1NMYA 1J8MF 4Z1MD 1EK0A 3T1OA 4QJ5A 1E9FA 4D26A 3RS4A 4QJ4A 2NPIA 3KX2A 2IYSA 3FFBA 5JHHB 4A1FA 4ZI2A 3SBDA 4PR0A 3TAUA 5FPHA 3RDPA 2GAOA 3GLFB 2LKDA 5LB2A 2BBOA 1Q1QA 2ZRDA 3R7WA 1D6JA 1MO5A 1CJMA 1OW3B 2VSXA 3GEIA 2FFQA 3AQ4A 1E2LA 2BCGY 4O0MA 3RNLA 5J47A 5KDLA 3TW4A 5F2EA 4XWKA 4JT4A 2ZE8A 4LHZA 3KUCA 2JLXA 3RABA 3MG9A 1KNQA 3RWMB 2HLDD 5F3WB 3NC0C 3PCRB 3QPVA 4W9MC 3A4LA 5LD2B 1G6OA 1DBSA 3VNUA 4RFSA 4HAZA 1QG2A 4UJ5A 1D8TA 4Q1EA 3X2SA 3ZVMA 1KDOA 1X8KA 1OH5A 1YZLA 3K1JA 4RD2A 3WRXC 5FPKA 4TQUS 3TBKA 3K09C 5EXSA 1NVVQ 4IJMA 3EIHA 1HURA 3NC1C 4LHVA 3I62A 1ZNWA 4IOMA 4LRWA 4OYHA 521PA 3K9NA 3D31A 2FSIA 3DOFA 1NKSA 3AKCA 4LI0A 1ZP6A 5JFGA 4K8OA 3OE7D 4B76A 2WKRA 4G5OA 1GZSA 1UEJA 3LX8A 4OHWA 4URUR 4DCSA 3VKHA 3RRMA 4BRWA 4DCNA 2VP9A 3DMDA 3HDTA 1WBDA 1X86B 3GEHA 4LJ7A 4GT1A 1I4TD 3LX5A 4M1KA 5CYOA 4Z8XA 2CJWA 3PEUA 2WSSD 3TKLA 2ZXUA 3R9XA 4R2HA 4B3BA 5F98A 4MDFA 2OSBA 3I92A 3SI7A 2W00A 5G3YA 1GP2A 3IIJA 2DB3A 2VSOA 1PV4A 4US1R 4XSGA 1ZM9A 1KI8A 1SXJA 2KI5A 2CHGA 2OFOA 3ADCA 2OM2A 1CIPA 3B7GA 3RRYA 5L3RA 1CJUC 1BOFA 1RRPA 1LB1B 1JXOA 2FH5B 1LV7A 2WMOB 2RKOA 2YINC 3CNNA 3A36A 2UZ3A 2VHTA 2O0JA 4MGZR 2CCGA 2IYTA 2BKUA 3BD9A 1YVDA 1G21E 1K5GA 1OHHA 4LWZA 1OIVA 1KSJA 3OAAD 2ODWA 3QOFA 2J5XA 5FUXA 1TL7C 3L0OA 3AKDA 4IDPA 1NVWQ 1G3RA 1F48A 1IY2A 1ZIOA 3FTQA 4L9SA 5B58C 4CEHB 4M1MA 4NKRA 3B5JA 3TJZA 2WAYA 1N6IA 4WAUA 2FNAA 1XF9A 1JQLB 3CBQA 1PZNA 2VYFA 1RIFA 2HYDA 5JS7A 2VHCA 2D62A 2ERYA 2E1RA 1G291 3L8YA 3PEYA 2Z4RA 1CLUA 5FFMA 1JB1A 2WHXA 3EZ9A 1G5TA 2GK6A 2W6IA 2J0QA 4B3GA 3KXKA 4TTRA 3AGQA 2Z4SA 5DE3A 4TYNA 1RYFA 1YRAA 3EXAA 3ZD7A 1D9XA 1P9WA 3R7WB 1TADA 2BWJA 2WWXA 1US8A 1KSHA 3B60A 3SFVA 1G8PA 3PEWA 1TQDA 2QAGB 1I4LD 4ZDJA 3EZ2A 2KRKA 5TV2A 2GXUA 3TAHA 3TSZA 1NN1A 3EC1A 1EFRD 2DWPA 3LV8A 3SYLA 5DIFA 5JBQA 2ZI4A 4A15A 5FOUA 2ZSFA 1UADA 1KK0A 4MUAA 1M74A
chains in the Genus database with same CATH superfamily
5EMKA 4NZNA 1Q50A 2R4UA 1P7WA 2WIGA 2J6IA 4XARA 1K7XB 3M6VA 5EESA 2C88A 2R47A 5L4SA 1SVSA 2C95A 4JC8A 4MQ5A 1Q1GA 1H6CA 5EJAA 5AVKA 1IHUA 5GWXA 2PKWA 3TVYA 4GIBA 1ORVA 1LQTA 3KYIB 3P5SA 4HUJA 3SR0A 4AAYA 1MC1A 2A5FA 3JVEA 3KC2A 3PT5A 4WNCA 2I1VB 2FOLA 3PUVA 3G7NA 3QMPA 4KE8A 2IS2A 2HF9A 5AUNB 2FU5C 4RBNA 3G5AA 5CVVA 2VAVA 5EJIA 3IUJA 3L26A 3F3KA 1PWZA 4PPGA 4PZPA 2QNJA 4YWJA 2OCIA 4KBYA 2GK3A 3H5TA 4LJSA 2FMIA 1ZPDA 1BKSB 1SU7A 1IOLA 4LOJA 4E03A 4PDIA 1V6SA 1W88B 2VJYA 3NBFA 2H65A 1DQZA 4X44A 4JI7M 5F51A 3VDNB 1OQAA 2YX1A 1MX3A 4D4KA 2V7GA 3QFTA 4FYMA 2JARA 2YRWA 4GITA 2P91A 2D1RA 3K8ZA 5D1NA 3A1CA 3FDZB 3G0OA 3EXFB 4RTLA 5AVVA 3M5DA 3OO1A 2Z6AA 1D2MA 2AG1A 1S89A 2C58A 1QLHA 3ZWAA 1M0EA 4ZYYA 2QVZX 5ITWA 3ZWYA 1T0BA 2IXBA 4K0RA 1QDUA 1MORA 2EZ4A 3D6FA 3HY4A 3JYQA 4LYEA 1V6CA 4OH7A 3SKYA 1NL3A 3C70A 2BRUA 1DKOA 4WZAA 5EG5A 2A30A 4UULA 4Z0NA 4X3PA 4CQMD 2N46A 1GCGA 4E08A 1U7TA 4F12A 2PX8A 1BHO1 4LNAA 4WXHA 4JI0B 1XYVA 4BNYA 2IYZA 2QZ9A 3PD0A 4H7HA 5DK6A 2A78A 3IBTA 3CLVA 3RJ9A 2DAPA 3NHJA 5HBGA 4CIWA 4QUGA 5HUHA 2XYGA 5G0VA 3RU3A 4ER7A 4ZZ1A 5KWEA 2ODEA 2UUAM 2HSZA 1WUIS 4K9PA 2G5TA 4NV3A 4QWMA 5CCDA 1Y81A 3D9QX 5KYGA 1PS9A 4W5RA 4BNKA 2F3TA 2XTNA 1Y9DA 4MDEA 4LF7M 2RFLA 1J0DA 4QVKA 3B51X 3L1HA 3R6GA 4DV5M 3HJQA 1QUFA 1JDJA 2D8MA 1T4GA 2XGGA 5FOVA 3V9AA 2KHZA 3HKEB 2E3JA 1H8HD 1S2IA 2Z09A 3BZUA 3OIVA 2NUBA 4FB5A 3IUNA 2EYUA 5KJCA 1RYYA 4R9UC 3V4OA 3WL3A 3EIEA 1KVTA 2FR8A 2V8OA 4IG9A 3L0BA 3KU4A 3TIIA 2OHJA 5LZ2A 4OHYA 1F1BA 4REQB 1TM3E 3O93A 4WNAB 3WGLA 4LFBB 2CHFA 5E3IA 5IWAB 1PW7A 3SEZA 5DNAA 3PJGA 2QR2A 4HN9A 2N47A 3GJRA 3REQB 4CJXA 4FSDA 3UT0A 2TMYA 2PSJA 1KFBB 3CF0A 1F9AA 5AP9A 1NC1A 2J9GA 1LQ2A 3MJHA 3ORRA 3OUZA 2DLNA 3BB1A 3DOUA 3EVFA 1GUBA 2C4TA 1FE8A 2AMVA 5FBQB 3LT2A 4AROA 1E92A 1VE7A 3ODGA 2WUDA 4WKCA 4JJGA 1ZUNA 3CE9A 4R1TA 2CB0A 5J5VA 3A9SA 4G81A 1JXAA 3UFBA 2HCFA 3BRQA 2FP4B 1Z18A 3GO4A 4JLNA 5DULA 4RHEA 1H05A 5CK5A 3PQ3A 1PK7A 5F1YA 1XLWA 5FWXB 3KPWA 2C2MA 2CF5A 2FLVA 2R6DA 3H13A 4IQGA 3P94A 1F2VA 1UC8A 3FX2A 3NTUA 4BFSA 4RE6A 5CB4F 3F7TA 1W4ZA 2R8OA 4J3FA 4Z1OA 2XOKA 1EBBA 4PD2A 4QT4A 3CPJB 1RKXA 2EFJA 2YXEA 3I2FA 5KZMB 3DHEA 5SZHB 2Q29A 3D0KA 1SZPA 3RS2A 1XIVA 3FOWA 4CKXA 2NN3C 4UC0A 1U7PA 2CXRA 4JLKA 2CUNA 4QGFA 5KX5B 1ZSVA 4RD6A 1ZH4A 5KYVA 5CFZA 1L2TA 4RKWA 1U9ZA 1GCUA 4A3SA 5LP1A 4LHSA 2O5EA 1EX9A 1GZ3A 4Y1GA 1N2CB 2EKKA 3F5MA 1JFVA 1KZ9A 3FH0A 4WWHA 2ONZA 1Z5BA 3M3HA 4N3AA 1PSWA 1ORDA 2BVNA 3VJKA 5CIYA 2C7RA 1QYRA 3WJ7A 5AHKA 3U6QA 5EPOA 3WYBA 1FIUA 3JAKA 4GKVA 1VDMA 2NUTA 3WIEA 1ZD8A 1N5JA 2A94A 2OGWA 3BGSA 1Y82A 3PC2A 5JZBA 1TH4A 1W75A 5LPNA 4D9MA 1T4MA 2HV8A 4MGKR 4QU9A 4DQUA 5FDFA 1OKKD 2PGAA 1QH1A 3ADKA 4CNBA 2XGSA 2X8JB 4A8HA 3OQHA 3UN1A 5BV8A 2D7HA 3OTIA 2I3DA 3TRKA 4EW1A 4ZK6A 4BCCA 4P7JA 5JD3A 4UCXA 1TVMA 1Y3CE 5AVRA 4YMIA 1UCFA 4PYKA 1FNBA 5JNVA 4D82A 1EX7A 2WJWA 1U8AA 4TWRA 4TLEA 2AFIA 1SU4A 4PLGA 5D84A 1PLJA 3F67A 4RD0A 1T9GR 3EW9A 4UZEA 1U0TA 3CR7A 3R9XB 1R8QA 4P98A 3RGWS 3S29A 3ZCQA 2UYOA 3AR8A 4UTOA 5JATA 2DUJA 1V9CA 3RS9A 2FHPA 3E3AA 3IHLA 5CJ2A 5B55A 2R8EA 1TJ3A 4UNIA 4J8PA 4ZVVA 3LA8A 3O73A 1G19A 5JS2A 5CU7A 1E9RA 3UV7A 3EPLA 2ZSJA 3GJQA 5DDIP 1NWCA 2P4QA 3QOYA 1ZW1A 2NUPA 4IIXA 6CHYA 2I67A 3WLIA 3TZBA 5CA1A 1WDWB 3RYCA 4DUZB 2AG6A 4DV2M 3IE0A 3WKBA 2F5PA 4O5OA 1K27A 3Q2IA 3B52X 2D1YA 3SCZA 5KWJA 2G1AA 2V7UA 5CVUA 4L5IA 5E1DA 3KSXA 3UZUA 1E4YA 3GNSA 3W8DA 4XJVA 3ICQB 4QPCA 4LYJA 1Z12A 1KPIA 5EWLB 2HDNB 3H5OA 3IUYA 1U8ZA 2M32A 2P78A 2Q6VA 4LVOA 1CUVA 5KWVA 2ZCUA 5EHQA 2XFTA 3D6HA 5CYGA 4IBJA 1JDPA 3DE6X 2Y1WA 2P40A 4X6YA 2DBZA 2YIJA 1KI7A 3MLAA 4L85A 1UANA 1J49A 3NHUA 4UU1A 4JIGA 3AVTA 1NMZA 1OFIA 3T41A 1W44A 3HR7A 3LX4A 3DZBA 4JYPA 4M7PA 4KLNA 4OQMA 2QRHA 1MFPA 1U7XA 2E48A 2UZAA 3PTLA 3MCZA 4EGSA 4MHTA 1RKQA 1VZ3A 1PJAA 4KT0F 1R8SA 1UFRA 4CGYB 1IULA 2WUWE 3HC7A 4PG6A 4AG5A 3NALA 1X7YA 1L4YA 4YDHB 5LA6B 3OPYB 3VPGA 5KNCA 2FZCA 3JQGA 1VIDA 1WCIB 4IH9A 4P3OA 3OQIA 2KS6A 1ZH0A 3IAHA 3K2EA 1U0HC 4ECAA 1DBQA 1NVXQ 1UR5A 1R3DA 5CT6A 2XUPA 4FN5A 2HHLA 3ZU5A 1T2VA 3SLRA 2RCNA 4REZA 1Z6TA 2DWZB 3O8OA 3KPUA 3KW6A 2GZ3A 1SUAA 4UCWA 5B53A 5I47A 3R41A 5IHXA 3QBVA 3R74A 4NCNA 5KSWB 3W8EA 2QP9X 4ZZ0A 4ETMA 1BMFA 1PL7A 3S4YA 4DREA 2AFHA 4LHYA 1J42A 3BCHA 3OY7A 2SECE 4TSFA 3LQRA 3TLEA 1ZLYA 5KTPA 3TLJA 1DJMA 3QPCA 4OM7A 2WWHA 4IRUB 2YJNA 2OECA 4Z9FA 4JR2A 1LXCA 3MCWA 4R98A 3WGUA 2ERXA 1NVTA 5BOSB 1QP7A 1E2NA 1Z13A 3QPBA 1T3LA 3HJAA 5TGZA 4XK8F 5JJLA 4I0WB 5LZ4A 4UPDA 4X8MA 3HBAA 5AJVB 4U02A 4FOPA 2IW3A 4BFLA 4IJVA 4JK3A 4ZTZB 3R0IA 1XLTC 3D6UA 3STHA 2QUZA 1OQYA 3ONFA 4EY3A 3TBHA 1A2BA 1KH2A 4X9XA 4GDFA 3LVQE 5F76A 1Q1NA 3NHLA 3P9PA 1PQWA 5CXSA 5JYBA 1N75A 1UP6A 2PVPA 1YAHA 3DEAA 4HK4A 1JTFA 4PCLA 1ACMA 3B9PA 4JLPA 2HF8A 4EMSA 1L2CA 3FLMA 3RRXA 1XBTA 2AW3A 2P2YA 1OHHD 1C30A 3SARA 3RFCA 2WTNA 2BZGA 4C7MA 2X86A 2W2PA 3L01A 4HDCA 5IC4A 1R4GA 1G8JA 1UXGA 3BZBA 3N0TA 3R5KA 4JJ7A 5JC1A 4BWGA 4MVJG 1AA6A 1LBHA 4WGGA 1HH4A 3IQHX 4L74A 3VU8A 2R1TB 3H83A 4NYIR 1C8LA 1P2SA 1Z8HA 2RKBA 1PZMA 4PZDA 1HQCA 2JHAA 4LHEA 1WP4A 5KYUA 4IMPA 3NTVA 3ITEA 2IUYA 4RY0A 1U2PA 4OAPA 3RIXA 3GLQA 5T57A 1QCDA 3RVOA 5KOJB 3EZLA 3D0RA 4Q4JB 4Y7CA 4JEUA 4GF5A 4HDRA 1IPFA 5CPBA 2PJDA 3SS7X 3WRVA 4EVQA 3X2EA 4KR3A 4TL7A 1JDBC 3H1FA 1LBTA 2C5FA 4WY5A 3K7EA 4AY6A 1N0IA 1QGYA 5FOWA 4GYJA 2ZAGA 1SH7A 1RHRA 1VMDA 3TW8B 4UTPA 4ZAXA 1KHHA 1YKSA 5C8XA 5LDDC 4YUZA 4Q37A 2V3CC 5EHXA 3RFUA 2H63A 2R11A 4J7AA 2O2IA 3BTOA 5EVJA 1YDGA 3LBFA 3UTCA 3VYSB 5FV4A 4FYJA 5CURA 1W35A 2GN8A 2VJPA 3PZBA 3AFHA 5JMWA 4B6QA 4FM9A 3OQNA 3GZJA 1ODTC 3FOCA 3JZMA 2JLYA 2EJSA 1P7ZA 4M4SA 2L7HA 3A1TA 2P8JA 3PRHA 3V97A 4TTVA 1QPZA 3FMPB 2WNSA 2Q6IA 3I4VA 1N2SA 4U7GA 1VHWA 3V48A 1Z4JA 4W82A 2CF6A 4KIJA 3AZPA 2O57A 2FX2A 2F4VM 4DS3A 4EY4A 1PFYA 2WICA 3HP7A 2IXTA 2XE7A 4LDNA 4AZTA 1GKIA 3LYLA 3HYTA 1WXQA 1EIZA 4AN1A 2O7VA 5DNUA 4LFBM 2IZ7A 4MJ7A 4Y67A 1ECGA 1NASA 3MT9A 3LHDA 4MRRA 3C9PA 4J0JA 4OMUA 2UYCA 3QUTA 5I3ZA 5D6OA 2W5UA 3NTRA 3Q12A 1P2TA 1AKNA 2GEUA 1ZM4A 4LMAA 1K4KA 1BXKA 2HNKA 3I2IA 3BGVA 4ENWA 4O6VA 2AF4C 2RHJA 1EG7A 1D0IA 5CFRA 2Z6UA 3TCKA 4RU1A 1P39A 3FXAA 3I0NA 1LBSA 3NQ41 4GI5A 4RCYA 2XDYA 3RAPR 3TWKA 2DWLA 1Q0LA 1HNZM 1YT5A 4XIGS 5BYKA 4B47A 4QFBA 3U7JA 3W4JA 4RGQA 4MWTA 5JAQA 3CF6R 4MPTA 3GQVA 4X0EA 2B94A 5EL0A 2YWCA 2W2XA 1CRLA 2ID4A 3VZCA 3NCHA 4TTIA 3A3NA 4FMDB 1EVLA 3JAMS 4RGYA 3QWBA 4KQJA 4AZWA 2R4JA 3HM9A 5J2UA 4NV1A 4ZOLA 1MJGM 1IXSB 5BSRA 2OZLB 2ZRCA 3JD3A 3UCFA 5TXGA 1MT3A 5K9ZA 3K2IA 2YXLA 1I51A 4A4DA 1E5XA 4J1NA 3I2HA 4B3XA 2J9XB 1KE2A 3EA4A 4YTEA 3N2GA 4XCQA 4BP3A 2F59A 1EAYA 1M34E 2CKDA 2B4RO 3WC4A 3WSWA 3PFNA 1JAYA 5ITXE 2G4VA 3ONWA 1Y7PA 2IPOA 2QMHA 3TKYA 2ZRLA 3HFSA 4Z4EA 3KSZO 1XMJA 3FPLA 5J5AA 4F4DA 1EE1A 4U2EA 3X2FA 2IH4A 1PHPA 1ZEMA 2JKZA 4S1TA 1Y8QA 2GPBA 1N2IA 3GFSA 3WBJA 2QRVB 4QBHA 3GN2A 3WQBA 3DZKA 1FW8A 1ATIA 4LCBA 2AR0A 2BH9A 3NUQA 5FFNA 4CVNA 1GTMA 2H92A 2ZYTX 5DHPA 1Q92A 1WGNA 2HCRA 3FW1A 3SQMA 1V16A 5HFAA 1ZGGA 2XMBA 3WXMA 3I61A 1A82A 2EW2A 2I78A 1AE1A 3RFWA 5FTNA 3AQIA 1FF9A 2JLBA 4DDUA 2JD1A 3TTUA 3NNSA 4GYKA 1F8FA 2I5PO 1YI0A 2FWBA 4NNJA 1WB9A 3DD5A 1T10A 2ZBVA 4EFKA 1S3FA 5KHLB 1GOTA 2PQ6A 2YH2A 4M9RA 2A5DA 1HNWM 1T8UA 2V6IA 4FDMA 4HQ6A 3CF2A 4UVEA 3TIFA 1DADA 5CCBA 2VQEB 1Y6JA 3FF4A 1QFZA 1OWMA 3RWBA 3PQ2A 3WSVA 1VCIA 3WWDA 5CFOA 5L9AA 4UTXA 3SFTA 1E7QA 1MA0A 5BSKA 4B4WA 3DB1A 3AX6A 3KXPA 2WJZB 2P2GA 2REBA 3C15C 2A5YB 3L5KA 1VPVA 5G0UA 3U62A 3WL4A 4G5FA 1IQPA 3EXIB 2F1OA 2YKGA 1BS1A 1DGGA 1GPKA 3WIDA 2D2FA 4ESEA 3KJIA 1RMTA 2VHQA 3DZDA 1OPRA 4IV8A 1KI9A 4L07A 4G4RA 3RM3A 3WB9A 4ECEA 2PUFA 3OC0A 4I3HA 5K8JB 3FZYA 1OH6A 1YE8A 3IDQA 4R31A 3LYUA 1R2YA 5E2AA 5TIIA 1XKQA 3QVVA 3H1TA 4M1TA 2BFWA 1MC5A 1ABFA 1PTJC 1TUIA 1V71A 1J2UA 2MMGA 2VLIA 5EHIA 2QT9A 4HDNA 2BUAA 1NHGC 1XNHA 2AW5A 2DULA 3B1FA 4TKMA 4DLWA 5T3UA 4AC9A 1KC3A 4H77A 4HVCA 5NLLA 4CNQA 2RC6A 3OU2A 4UE2A 2H2WA 3I52A 1DWOA 1IJBA 1S9DA 2RD2A 5CA1B 5DV9A 2LIPA 3ZE0B 2FQQA 3TRJA 3FPKA 4HAIA 4Z6KA 3ZGXA 1BIFA 5KKCA 1DSSG 1PEKE 2K87A 1WZEA 2XB4A 3G2OA 3K0CC 4HH1A 1RJ9B 4D57A 1WUTA 4JROA 5ALUA 2PE5A 3N59A 2HL6A 4NXNM 3Q3EA 3QKSB 2P3LA 4QOFA 2IDMA 3WV5A 3G85A 2LUOA 1XPRA 5I9MA 2ZG6A 3MOIA 1SVOA 1WM1A 3RRFA 4JB0A 3W6OA 3WGHA 3L40A 5L4NA 2BR3A 1MT0A 3UM9A 1N32B 3EIUA 4M0PA 1A88A 2YN4A 1E8NA 1JTEA 3O92A 4ZN6A 2QWXA 3L06A 4GLFA 3E9CA 1AUPA 3L4BC 1GTRA 3BXEA 1T34A 1I7NA 4JUCA 3KVWA 2JFYA 5IXSA 2C5EA 3PRJA 2NO6A 3JPWA 5FKJA 4XGRA 2GCOB 4YAFA 1B42A 1QF9A 1RBYA 2A59A 4I4TF 3SEQA 5H8WA 4OVKA 4JSYA 1II0A 2G7ZA 3DUFA 4NH4A 4AP6A 5T7BA 3MPOA 4CRWB 5EXXA 1I01A 3E81A 1Y4UA 1VLMA 1TO1E 4U7FA 2P79A 2GKOA 2Z6VA 3FMFA 1V34A 3FHTA 2AN9A 3KOWE 3LOPA 3R24A 5IK2A 4AY3A 3OTOB 3IA7A 3H9BA 1H3NA 1PJQA 2FGKA 4LY9A 1MX1A 2VJOA 4FFPA 3H9CA 4C7VA 2B4YA 1Q1ZA 1S2OA 4MYDA 5H83A 5JMTA 5K20A 2WM2A 4DV2B 4MYSA 5JJIA 2PLWA 2FEWB 4O33A 3NDIA 2KNZA 2YV4A 3ZLUA 4I1RA 5CX4A 1UFKA 4FVTA 5CLLA 1Q57A 2CDBA 3TLKA 3SOZA 3WLKX 3LT0A 3TCNA 2EL9A 3PYXA 1V2HE 4QL3A 1B76A 2GOYA 3IB3A 3ZWDA 2NLOA 2X6QA 4YRCA 3A1DA 2I2FA 4G1BA 2C3OA 4NCIA 5A06A 4LSGA 3B1VA 1T6NA 1M1YB 4D5EA 1Z7GA 2AK3A 3C3BA 3ZQ4A 4I9NA 4U7DA 1R5NA 1P72A 2QM8A 3R5FA 1EX6A 3OUUA 4WOKA 2G9RA 1D5CA 2QR5A 3R20A 8GPBA 3NGMA 1DKLA 1W5FA 1CZRA 2NGRA 3AXSA 3JD4A 3MT8A 3QE2A 2WKQA 3DOCA 3KSJA 2YHIB 4GPZA 5ICSA 2R46A 4GBGA 2OAP1 4MVWA 1G5FA 2AQ8A 5FRDA 2ONJA 3EZ6A 3ZI7A 4KXNA 5HR5A 1AB6A 3Q88A 2VRNA 4RLFA 5F35A 3NBUA 1KOFA 3ZV5A 3DC7A 1JDBB 4DQKA 3DTVD 4MLPA 4FT4A 1XVVA 5K8UA 3LHSA 3PYLA 1ESZA 4HVTA 2XXJA 1CP3A 3T4EA 2YVLA 3VYVA 4GWKA 4DNOA 5CA0F 1B23P 3E35A 3X0DA 1U2GA 5DPMA 1Q19A 2Y0EA 4PZLA 1YBAA 3IERA 3TG8A 4KBFA 1AKTA 1ECCA 2ZBDA 4LXGA 1UC4B 4R0NA 2XCUA 4FFDA 1HQKA 1Y7HA 4J0IA 5FH9A 2O8CB 2ZJBA 4M8SA 4NK4A 2D3WA 3FBTA 4UDYX 5A6SB 1E1LA 5AJTA 1HQDA 2VYVA 3EUWA 1J8FA 4BY9E 3DKPA 3QKRA 3IDSA 1BS2A 2A1TS 4JI8B 3O8QB 1E64A 2ZCVA 4U6NA 1IUPA 3DA8A 4PIMA 4WINA 4XXHA 5DEOA 2OXTA 5CNKA 1DMSA 1YZHA 3LD9A 1ZU5A 2YZGA 2Z1DA 2HA7A 3U2QA 3DWEX 2C54A 2HQSA 2PSFA 3H4MA 4Q39A 5H3HA 5K6TA 4ESVA 1XMIA 4ES6A 1Q0RA 3MIZA 2WT8A 1WVGA 3MLBA 1TM1E 3JR7A 2VDNB 4B3SB 4XI9A 1LDMA 1U5BA 1T2CA 3ZXSA 4BE9A 1VCMA 4YQZA 3N1UA 1X80B 3P9YA 4YV7A 1J1UA 3CPEA 1YVUA 5TQ2A 1KE1A 5L8RF 3GGPA 1W1IA 5FD8A 2WLSA 1HTWA 4AUNA 4YPVA 1I7PA 1LSOA 2PPLA 2QLMA 4MVYA 2BYTA 1FSPA 2W6JD 1OI2A 5GKNA 4XPIB 3B36A 2CUTA 3DFUA 5D3MA 5ELMA 3WB2A 1NSYA 3IPAA 2QN2A 1BCRA 2EWWA 4CF3A 1KWKA 1QV7A 2ZULA 3A1SA 1P0QA 2WPDA 4FGLA 2G1PA 4TUWA 2ZUBA 3QIAA 1JJFA 1P5HA 1ZXXA 3IAAA 4P0QB 5EE5B 4MUNA 4D96A 1QBGA 2H48A 5ILQA 5DYNA 4HKTA 2H6EA 4UVIA 5T4EA 3HGQA 1UBKS 3PUJA 3E8MA 4DBGB 3JQFA 4DUYB 4F9TA 3JVIA 5HRUA 1JXQA 1B6RA 2H17A 5DI3B 2C5RA 1HY3A 3B3GA 3KQMA 4PHGA 5E95A 5FPPA 2G5CA 1G17A 3L1IA 3MMXA 1R37A 3QY0A 4G4JA 4IILA 3RTGA 3WWCA 1Z5WA 3V32A 3AL3A 5A9RA 3HHWA 1RZUA 3TUJC 2RHLA 3QJGA 1XTTA 1XNJA 2CXQA 1QK3A 2MR5A 2P5UA 3N75A 2WAAA 1IK6A 1VE5A 2IIBA 3B6EA 3OY2A 3O8DA 1B8PA 2CD9A 3K70B 1IU9A 3A1WA 1I0LA 3TE6A 1IZ8A 3FY4A 4MI6A 3G2MA 3OF5A 1IC6A 4K6MA 2WYWA 1WP9A 1G20A 4DLSA 4CQLA 1PFUA 2WTMA 1T6YA 3MUEA 4IICA 4RKYA 4IIUA 4LQ4A 5DT9A 1VI5A 2VXCA 3RBZA 4OJYA 3HXLA 4PLVA 2QZJA 1RZVA 3K8OE 4PLCA 4BEBA 1ULUA 2YNMD 3FSGD 1ZM7A 3NV7A 1GWNA 1XHLA 4NRDA 9LDTA 5GZ3A 3HVIA 2Q4DA 1EAMA 3OLZA 3RVNA 3J81A 2UUAB 1E2EA 3ES9A 4MVJF 1YB7A 2QPLA 2VNJA 4U3JB 3PENA 1L7OA 3W1WA 2DRIA 2UUOA 1L7QA 3G7UA 4Q4AB 4WSOA 2FPMA 3UCXA 1PX2A 3I3SR 1KJYA 3E18A 3PQFA 2ZVQX 4MCAA 4CCSA 1TA0A 2RHMA 1F2TB 1UEIA 3ETJA 3LYHA 1DC7A 1QO0A 1GRNA 3U7RA 5IAAA 1NZFA 3W90A 1JIIA 2OOAA 2WOJA 3SLGA 5J4HA 4PTYA 3ZZ1A 2G9QA 3J2PB 3T9BA 1EB8A 2OLEA 3HV0A 4RPCA 3DMRA 4D3DA 1ZHHA 5A5EA 1EVIA 2C2GA 4RDIA 4D45A 5JJ5A 1RI5A 2JAWA 2X4AA 1DJQA 3HU5A 3P45A 3P9QA 4TT8A 5DHFA 4AYXA 4BNXA 1L5OA 3UO8B 1BDBA 1JQ5A 3T52A 2C7OA 1ESCA 4EFLA 1RYZA 3NHWA 1JG3A 3NDJA 4BJ1A 1EDBA 1MTOA 2BELA 1I2DA 2SHKA 1PJLA 2XUHA 4LOLA 1TPZA 3T5AA 2G77B 1S8OA 1VL6A 3NRCA 4DLTA 1Z0IA 1SZJG 2OCKA 5C18A 2OO9A 3EQZA 4RH1A 1ZAYA 3G9XA 3RFFA 4B85A 4TXNA 1Z25A 3AW9A 4PC2A 2PO7A 4EDFA 5JNRA 4RX1A 3WE7A 2QTWB 2XF2A 2HTFA 3BERA 3IXQA 3PHGA 1L5WA 4MR7B 2WYVA 4TT3D 3ROGA 4V39A 4EUNA 4UM8B 1NM5A 2WIFA 3K0BA 2P62A 1ZUD1 2OD9A 3O6VA 5J40A 4ZKEA 4QTTB 4S2EA 2GZAA 3FMIA 3LPMA 5KI6A 1F7UA 4W5QA 2PXHA 4HQFA 2VPWA 5BQXA 3M81A 4HUQB 4OB8A 2ZIWB 2PUAA 2ZTDA 4F3TA 1KF0A 4EPVA 3F97A 4M22A 1WDTA 1UBSB 2IIQA 2PU7A 3CT6A 4IMIB 1CSEE 3I9FA 4TSKA 1T36B 2JZ0A 1K82A 1DWUA 2XECA 2WSYB 1E2PA 3I1FA 3OH8A 3QFFA 4IJUA 4KQ1A 1V11A 4J3NA 4DAEA 3IPCA 4LF9B 3K6KA 2H7VA 4ZMRA 3W5AA 3CT4A 2WFMA 3ADDA 3WYEA 3F8TA 1NTRA 3C74A 4Y2XA 3RVKA 2OWDA 2O2ZA 5J2UF 3LDAA 3IUPA 4B3TB 1C50A 1BMQA 2AA3A 1A9XB 1X2EA 4KW7A 4MV9A 4ON9A 2KXEA 4PBTA 4A2QA 1EYZA 4E7OA 2PZEA 3CLHA 5JQWA 3QVKA 4Q1AA 2FA9A 3H8SA 2G9ZA 3GEGA 1SUBA 3KPYA 4X60A 3UB3A 3AW8A 2ATVA 2C00A 4TMVA 1U7HA 1MU0A 4G41A 2GVDC 3HO6A 3OP4A 4G8JA 4YLEA 2KLHA 2QUAA 1CZUA 3HR8A 4PFKA 5FBHA 1H9AA 1FLDA 1AGPA 4IHJB 4L16A 2PZMA 2NUTB 4AZSA 3WK5A 2CXPA 1TW2A 3N0WA 1XHBA 1JH9A 1YB6A 4NC6A 1FRVA 2W11A 4P80A 4I55F 2EF1A 4RM3A 4CIAA 3PICA 3H0CA 5TGDA 1BXGB 2Q9AA 3MWDB 3OIDA 1R74A 4GMXA 1GVNB 4N65A 4C4YA 2DPGA 4DV4B 4HYQA 2R66A 2HX1A 1E3IA 3C7TA 1C4XA 1JHVA 1R16A 3H17A 3WO0A 3H4JA 1ISIA 1CR6A 2AWNA 3ZJ4A 3AG5A 4J4TA 3WRWA 5KBYA 3GT7A 3L77A 2L69A 2DP4E 4W8HA 4KXFB 1Q1BA 2L42A 4LFAB 4AB1A 1PJ3A 3MS4A 4OEHA 4XFDA 2BKLA 1WULS 4F5ZA 3G5LA 4RHFA 2XNHA 1YS6A 4IIBA 3K9LA 4RWEA 2ONKA 3RU2A 2GFIA 2IU0A 3ZE9A 1DZ3A 3HBNA 4DR7M 4DG5A 4FZ5A 1KZHA 1JIVA 3DEKA 2ZKIA 4LN1A 1VG9B 5ALVA 4JYBA 3LUPA 4DJTA 4YQEA 3TL2A 1ADGA 3D1LA 3P9RA 4K9KA 3ADOA 1WB4A 4G2TA 4ASUA 2TMKA 3WMGA 2FE1A 1KA9H 1ZG3A 3PR1A 2ASVA 5GJVC 5CFPA 1H1DA 2NUAB 1H4VB 1PQ4A 1GO2A 2RE8A 2GBPA 2HOQA 2O0LA 1JFFB 4AT1A 4AY5A 4ZEOA 2ECKA 4OU7A 2WHYA 5IMSA 5JCJA 2AZTA 2B1JA 3QVWA 4EHJA 4F2WA 5AVXA 1NBWB 1ODJA 3DT6A 3UWKA 3O2JA 3GXOA 3E6AA 2PBZA 3JQFC 4M1ZA 4YCMA 3T7SA 1XPOA 3AY7A 4KIGA 1EE2A 1EG2A 1YOVA 2C0PA 2GZSA 3KEGA 2XVZA 1D6NA 3QVGB 4DLPA 1TUBB 5BNWA 5LMUB 2UZ0A 3L0CA 2OFXA 4LV8B 1S9HA 1EGAA 2ZM6M 1L6IA 3DXZA 3RS7A 2PR2A 2M6KA 3ZJVA 3THWA 1S8AA 2HU7A 2YL2A 4L4YA 5JR3A 3Q8KA 3D64A 2HWUA 3PV0A 5E6SB 3QYBA 2JNHA 4HATA 3U7QB 3WIVA 4Y6PA 3QUBA 1M83A 1OT5A 2W2TA 1GNPA 4Z7OB 3HSYA 4KAAA 5F78A 1H2ZA 3LMKA 1X9HA 4BJ6A 4MB7A 1UQUA 1BVRA 1ZY2A 1P45A 1HTBA 4JU8A 1U7UA 3PKZA 4I3FA 2GPNA 4BFXA 1Z5NA 1DEHA 2HSWA 3DS8A 5KSYA 1XRMA 4PYNA 5CLGA 3O8CA 3LWBA 4EYGA 2Z5GA 4B4UA 3SAUA 1V7PC 2JI6A 4CN8A 1TH2A 2QV7A 4F4HA 2PO5A 3ABRB 5MF6A 5CG2A 3KUDA 5JH7F 2OOKA 3RIEA 4LRYA 1OXKB 1MXFA 4JR1A 1C3EA 4AMVA 3QY9A 3MAGA 2PGDA 1BD3A 1RT9A 2WHEA 5JI3E 4KXVA 4MQMA 4Q3LA 1J2TA 1Z5VA 5JCJD 5DU2A 4BLUA 2ZAYA 1BEZA 4GZ5A 1CR2A 2OCBA 2R8BA 2ZBRA 3K32A 4RK5A 4X66M 3KHKA 3WNQA 1FVHA 2JFPA 5AW4A 4WXRA 1T5HX 5J58A 3S2IA 4ZYTA 5TJ9A 3FVQA 5JWOA 4KNWA 1H69A 1SCNE 2J0VA 1I2ZA 2R1ZA 1XZNA 2X3YA 2JFHA 3NIGB 3SJAA 1I6WA 3G2IA 1G41A 4G5XA 3IHKA 1M75A 1ODFA 1V7ZA 3QF7A 4HS9A 4JL5A 3TSAA 4BO5A 4UFPA 4YRGA 5KDDA 1KAQA 4IIVA 4IX9A 3VDMA 4DWWA 5KUTA 4KQWA 2NT4A 5L4LA 4RF3A 1F6BA 1N6PA 4EVIA 4OXKA 4WZAB 1YE9A 1X1AA 4N40A 3AUKA 1XTBA 2GWHA 3ENKA 3U81A 3WGKA 2F55A 2J3IA 3EULA 4GBED 3R0XA 5DF1A 1ZBQA 3KOZA 1AS2A 4CT5A 1UMDB 1L0BA 1NW4A 3S2GA 3GA7A 4F1JA 5C5EA 1D07A 1ZL0A 4P3KA 2EIHA 1WX1A 2V03A 3P26A 4NFHA 4OJNA 4RSGA 4AY2A 2FPWA 3EXEA 2XKAA 2YS6A 5I7VA 1CW2B 5SYAA 1MD9A 2GBIA 2YVAA 3DP7A 1SY7A 4C30A 2GVZC 3DDHA 1ISJA 3GARA 3O82A 5ALLA 3WLLA 1CBUA 1P4AA 4D3YA 3QHPA 2WI8A 2ZR8A 2RGGA 2B5WA 3M6MD 3A8TA 3LDUA 3DAOA 2E4WA 4DQVA 3AERB 4HGYA 5DNVA 3KSUA 4K6HA 1VLHA 1XELA 3NCTA 5ABPA 3QKUA 4DLXA 1W4CA 3RS0A 2VS1A 3MT7A 4TROA 4W9NC 4X91A 2HBRA 3KPVA 3O4RA 4RW0A 2HR1A 3CLTC 2H5JA 4KG7A 1V39A 5B2ZA 3X43A 3UBMA 2QY9A 3JTEA 4QDTA 1FEZA 4Y9RA 1MQ8B 1DPGA 1P1JA 1FSZA 2PUWA 2EFHB 3JD2A 1ORRA 1I4OA 2JA2A 1EEXB 2VJKA 5IREB 4RJKA 5ALGA 2YICA 5B3LA 2A0WA 4XUGB 4NRVA 3H11A 4BRSA 3U6LA 1ORHA 4UE6A 2I33A 4C4SA 2POCA 2J9YB 4BNWA 4DPKA 4DUYM 4I9FA 5L3VA 3VHQA 2HJRA 2ACWA 3BHIA 2ZUVA 4X00A 3B2QA 4XD7A 3RYHA 1MH1A 1PK8A 3FMVA 4NPHA 4P3NA 1CUDA 5K3EA 5DHUA 3AXTA 5BYJA 5LYJB 3OCJA 1M8GA 5ITZA 1KYIA 3NH6A 2P7HA 3MAAC 2GUWA 3NHYA 5JS6A 2CLDX 4DR5B 4N39A 3PC4A 3VR0A 1DWPA 2WYUA 3BTUA 3T1YM 3SX4A 4DLYA 1NLUA 2GCGA 4PINA 4W6QA 4MYTA 2QMQA 1H0RA 4HLUC 2JY7A 2FPKA 3K0KA 4MB6A 4QO8A 3V1UA 2V7XA 3P27A 2ADMA 1N4AA 1XN1A 3VR2A 4A7PA 3PXCX 1FFGA 2PM8A 3D7LA 3GVIA 4OA8A 3DV0A 3T1TA 4HH3C 3ACDA 1XQVA 4LXUA 5IARA 1GIAA 3MIIA 2VHYA 3BWMA 1J4AA 1SUIA 2VP2A 4HWRA 5KYXB 1ADYA 3DPIA 1JA1A 1P2DA 2J0UB 3GG9A 4Z9YA 1KFEB 3D7SA 5C3MA 3TO5A 2W6PA 2YVUA 4NHOA 3GO8A 4PWYA 3SVTA 4YDRA 4BQPA 5HUJA 2QTGA 5AJZA 1Y3IA 1DAFA 4IBOA 2OK8A 3QQ5A 3QLJA 4IFEA 3V7WA 2VPYA 2GN4A 1E2KA 4ND6A 3LPCA 2X0NA 4IVPA 5C4MA 4AF7A 4FGWA 3WKAA 1G55A 1OILA 3GJ7A 2J9ZB 4OXQA 4QBGB 4H6WA 1IBLM 1EFCA 3MD0A 1QQWA 1USKA 3DL7A 3GLTA 4JP3A 2Q8QA 3S0JA 4X6UA 5IABA 2AK2A 3WFZA 2BFAA 2NZ2A 1EFVA 4QHTA 2Q2WA 3HU2A 1DIAA 2A9RA 1ZZEA 2RK3A 4MUMA 4XX1A 5A3VA 3GA0A 5JH7B 3MF4A 3EDCA 3UGJA 1LTMA 3F7OA 3H9EO 4PU0A 3C5VA 3HLTA 4WZ6A 4BQNA 4BVEA 1T36A 2C3YA 2GLXA 2FPRA 4UDXX 5C1IA 3RVMA 1N9GB 4E1AA 4OHMA 1C4KA 5ALYA 1KAHA 3IBYA 5K0ZA 1TC2A 1YACA 1ISMA 3OZ7A 2FJ0A 2A9QA 4NBUA 1SB9A 1P44A 1CUYA 1M76A 1A9XA 3SYMA 4F0JA 4WLFA 2Z3WA 1XQ1A 2BLLA 4QXMA 4UMVA 2OCPA 1O6CA 3QMVA 4MV3A 2YIDA 3TEJA 3WQRA 3U4QB 5ICFA 1ZI8A 2QKYA 4I1PA 1SOUA 3I0ZA 4CCYB 2BNKA 4K40A 2E5LM 2PZKA 2CBZA 3EXHA 4FKBA 2GUGA 3IV6A 4TN5A 4EG8A 1XZFA 1ZMBA 2A3NA 5K03A 3OEWA 2RGAA 5CEEA 1YRYE 2GJ4A 2P2ZA 1X7GA 2XQKA 3VPSA 2W6QA 1GNRA 3F5DA 3B2EA 5KC8A 4B31A 7YASA 1E1RA 5DLPA 2QZ4A 1KO4A 4ONEA 2P9YA 1IN5A 1KJZA 2A9JA 1NYQA 1Y7TA 2P8SA 3ELUA 3H5WA 3KD3A 4OHPA 3UK1A 4ZV4A 5F1OA 3HBFA 3A4MA 2FEMA 4WK2B