1NSFA

D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
KPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR
publication title Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Protein transport
total genus 84
structure length 247
sequence length 247
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nsfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nsfA01
4DKXA 4M21A 4LRSA 4PPFA 1YR7A 2QSYA 3EW9A 2XEXA 1ZNYA 4ZO4A 1DO0A 1OXVA 3TNFA 1FW6A 4MDFA 2XB2A 3B5JA 2FEOA 4X8MA 3VMFA 3LD9A 2JATA 2AWOA 1E2KA 3K70B 4DJTA 2BWJA 2NTYC 4PR0A 2XZPA 4F92B 3LQQA 3N2IA 4OYHA 3DZ8A 4A0HA 5KPJA 2V8OA 4PC6A 1NNEA 5GJWC 3THYB 3THWB 3SJZA 3FHTA 4IFBA 1UFQA 1PUIA 1YRBA 4ABYA 5F9HA 3Q7PA 4OHYA 4Q1EA 1AK2A 4NHOA 1EFRA 1E1RD 4L15A 1AZTA 2OFOA 3QIAA 4B32A 1PV4A 2WWXA 3BERA 3C4JA 5EE9A 1R5BA 2H17A 3OAAD 4RZXA 4ITRC 1CULC 4U5XA 4IOJA 3T1OA 4DCTA 1EWQA 2ASEA 1R8QA 3E2IA 3AVYA 2JLXA 2A3RA 4XWKA 3BD9A 2EVWX 2H57A 4URVR 1E98A 1ZW6A 1NF3A 2OFWA 2WICA 2CVFA 5L3SA 4B43A 3NH6A 4D0GA 4JL8A 2EFGA 2RGCA 1CR0A 2CXXA 4DT1B 1E6CA 5FPTA 5KSYA 2BM0A 2BKEA 3KJHA 5FI1B 2BEKA 1JXOA 2PCJA 1GKIA 2V6IA 1NLFA 4C0KA 4O3MA 2A2ZA 2O0KA 2V6ZM 1E2FA 2WAYA 4O2RA 3BOSA 4PO9A 2AXPA 4QGHA 4UXIA 2QTHA 821PA 1IXZA 4M9QA 4TLAA 3ZIAD 5DGXA 5FPSA 1NVXQ 1VCIA 3RRNA 3QXJA 2R65A 4QJ4A 4LGMA 4Q1AA 3RC8A 1CJKC 5TMPA 3THYA 1DAMA 3THWA 2VP2A 1M2OB 2FU5C 1FL9A 3C14C 3O8RA 2DFKB 2BC9A 4LJ6A 2JLUA 2Z4SA 4B2PA 3PG5A 4MYTA 1MO3A 4B3BA 2WIBA 1KJWA 3SJCA 2RKOA 4FMBB 1E79D 5GJBA 4FIDA 1IXSB 1DAIA 4P4TA 4G01B 5J4KA 1KO7A 5EP1A 3OEHD 2GXUA 1EFHA 3D8BA 2OCBA 5FBLB 1M7BA 4WOPA 3DMNA 1D2EA 4Q9IA 1R4AA 1NN0A 2F55A 1NVVR 4HATA 4NDZA 1OXSC 3A1UA 4DT1A 2OE2A 4NMMA 1Z0IA 5IK2D 1OV4A 3LBNA 2ATXA 3OEED 2QAGC 5EXPA 1E9EA 1HUQA 2GF9A 2JJ2A 4LJ7A 2X8AA 4ON9A 3LX5A 2HT1A 3FKSD 1W36C 1VHLA 1AS2A 5JEDA 4FWGA 2W6JD 2XX3A 1COWD 1GVNB 1T5IA 3FE2A 1T4GA 2BBOA 4QFMA 3TGPA 1XJ0A 4PZYA 1IY2A 2C98A 2DWQA 2NZJA 3OFND 2AKAB 3BB3A 1P4SA 3ICQB 1G8GA 4DCSA 4IDQA 4OHVA 3EPLA 1XWIA 4TQUS 4NU0A 2X2FA 2VSXA 1P7CA 4GRAA 1G3RA 1Z0AA 1NVMA 2QI9C 2VRWA 1VCOA 2ZSAA 1QF9A 521PA 2FGJA 5EP4A 2CL6X 4N1AA 4D0NA 5BXQC 1Z0KA 2JCSA 2Z5FA 4ZDWA 5JRJA 5JI2E 5HKKD 4DIDA 4NE2A 2R6AA 1TMKA 2GTPA 1J8MF 1GAJA 3LXXA 4BFUA 1NIJA 4TLEA 4KU4A 4H9GA 2IK8A 5DLQC 3D3QA 2P3SA 4LYHA 5TV2A 1OIVA 3PUVA 3R9WA 2JGNA 3AF4A 1J70A 2IEZA 2W6IA 3EG5A 1YRAA 2VHCA 2WJHA 3SU8A 4FWTA 3L8ZA 1RZ3A 4FCTA 2C04A 2NO9A 3A1VA 3LVQE 4AIIA 4LCBA 3U2QA 2FE4A 2V7QD 3F5FA 4P4UA 5GADl 3MWLA 1D9XA 1JB1A 4D4JA 2NO6A 4ZI3A 2GCPA 1KI6B 4FI3C 2QE7A 2IWHA 1X8KA 4ZCIA 2NOAA 3KTAB 1E2DA 5BN3A 1M8PA 3HWSA 4D4MA 1Q12A 5EZ5A 3NHBA 2ZR0A 3IQWA 1G64A 1M7GA 4JKIA 3B1VA 1Q22A 3P4XA 3QKRB 3TW4A 1ZUNB 2NPIA 1NVWQ 2VSOA 4JL5A 5P21A 4BZPA 2QUZA 2FFQA 2O8EB 4KBGA 3HR8A 4LPKA 3U7GA 1QBKC 3LW7A 4FW9A 2YYZA 1TQDA 4HUQB 4JLBA 1O3YA 3U44B 3CNNA 3WRXC 4BLQA 3L0IB 2ZS9A 2KI5A 3U60B 3GJ4A 3U3RA 4GZMA 1YHNA 3BIFA 3ECCA 1LV7A 1DAHA 2KBEA 1A82A 5HCIA 3O8CA 1CTQA 1YZLA 3MD0A 1UBGA 5FOTA 4LSGA 4RD4A 121PA 3IUYA 3A36A 2R6GA 4DB4A 1P75A 5DYIA 3BRWD 3SEAA 2QPOA 5B2ZA 4L9WA 3HR7A 4NCJA 1ZD9A 4B76A 4M1WA 1E2NA 1SGWA 2ZJAA 1K5GA 3FFAA 1EFTA 1J90A 4JBWA 1K8RA 2FV8A 3AH8A 3MG9A 1JQJC 1KI6A 4ZV4A 1IN7A 2HF9A 3KTAA 4M22A 5F9FA 4X8OA 1S2MA 4LV5B 3RVBA 4ZCLA 1FFHA 2ZSFA 2IEYA 2ZS8A 3NVAA 3PITA 3AVXA 721PA 1G18A 5C4MA 1KTVA 1AIPA 3FHOA 5IDVA 4F4CA 2CLDX 4LV8B 4KFUA 2XNDD 2A9KA 5UKDA 1UEJA 3IIMA 4IDNA 3ICEA 3TUIC 3KX2A 1S1CA 2O8EA 5CB8A 3RANA 4HUQA 5KNDA 4RD3A 1YJ5A 1KI7A 3CRQA 4JVSB 5L3RA 4A2PA 1EX7A 3B9PA 3PUZA 5LD2C 4B48A 5CJ2A 1KMHB 2CCGA 4JMPA 2QPAA 2ZJYA 2DYKA 4GNKA 4HLUC 1U90A 4M1SA 4MRSA 4DLTA 5FBQB 2BJVA 1EWRA 4JKYA 1KAGA 3W5IA 2GJ9A 4BQSA 2FSHA 1IHUA 1OFIA 4KSBA 4M9ZA 3K53A 3K0EA 1KO1A 1VIYA 2WMNB 5DSZA 4MYUA 2WPDA 1XJCA 2KBFA 1P3JA 1BH2A 1JXMA 1SULA 1E2IA 2ZJ2A 2Q21A 2PJRA 3VR1A 3VR4A 1XU4A 1YVDA 4XD7A 3J81k 3RRMA 5IRCD 1E4YA 4Q7LA 3B1WA 2WSMA 4GSYA 3EPHA 2XTZA 1OHHD 1XTQA 1Q0UA 3NEYA 3SYNA 1SHKA 5FR1A 3ZVNA 2GEDA 3ASZA 4I1UA 3FDIA 3IO3A 1QHHA 3HJNA 1KSJA 4PHFA 2F3RA 1VKJA 5DISB 3X1XA 1Z29A 3CRVA 4L4UA 2F1HA 3JVVA 3RSLA 1M1YE 4M2LA 4BLSA 3KJEA 1D5CA 1CS4C 1XX6A 4HAZA 4OJKA 2RCNA 4XH9B 5D3MA 1ETUA 4Z51A 4ZKDA 1P62B 2WWFA 2KSQA 1RRGA 3C41J 2W0MA 4CVNA 1CBUA 3A1WA 1U8YA 5FPHA 4LJ5A 3TUJC 1XMIA 4A6XA 1E9AA 1U0JA 2ZI9A 3NBXX 3MWYW 1G5TA 2J0SA 1AGRA 1S0UA 3RSOA 2JJ8A 4GPTA 5HZHA 4A0RA 3VR6A 1E69A 1N0WA 4DSNA 1L8QA 2PZGA 1GILA 1R0ZA 4TLBA 1RC8A 2PJZA 4IEIA 4LPSA 1KGDA 3SR0A 4C0AC 5FR2A 2ZUBA 3TR0A 3U6KA 1D9ZA 3DM9B 2JDID 4OI4A 5FFMA 2O52A 4B34A 1JEEA 2X77A 1NN5A 1P60A 1O87A 1ZIPA 5B57C 1IY1A 2QSZA 4JS0A 5CIQA 4WZAE 5FUWA 5DIFA 1Z07A 3GJ0A 5IK2A 2HYIC 5FTKA 1QVRA 2WJIA 5FOVA 3GEHA 1E2MA 3FKSA 1OLOA 4HUTA 3HPQA 1SKQA 1P9RA 1PLJA 1YKSA 2W6JA 2BMDA 4OL0A 5AUOB 2DZNB 2L0XA 1XDBA 3BFXA 1RRFA 3PFIA 1T91A 4HDCA 5HZKA 3OFNA 4GMDA 2D74A 1J99A 4C9BA 4TMZA 3T1VA 4DSOA 2RH5A 3TQFA 2ZM5A 4HDOB 3KQLA 2OUKA 1XP8A 1EFRD 1SXJC 1T3HA 2LKDA 2RB4A 1CJVC 2PT7A 2ZRFA 3AB3A 3IPXA 4DWJA 3IHWA 3KQKA 1B0UA 3DZDA 2J0QA 4PAMA 1KDTA 1PLLA 4UNSA 4QRHA 1ZM3A 2OBNA 5JS7A 2YHSA 4P31A 2C77A 3WYFA 3ZS8A 3AF3A 5M04A 3LV8A 1XJQA 2ZRBA 3K09A 3ZQJA 4Q66C 4UNNA 1CP2A 1XD9A 2DFTA 4V0LA 2J1LA 3IPYA 4CF7A 5FL3A 1T8UA 3LDAA 3BK7A 5A4JA 1MO4A 4TMVA 2RGXA 3C5HA 2IUSA 2O8BB 2ZI5A 3CONA 2I1QA 1NN1A 4RFVA 2ZRJA 4URUR 4XVRA 4QL3A 4PX9A 4C30A 4TYWA 4A82A 1BIFA 5K8IA 4Q21A 4HZUB 2IYSA 3B1XA 1ZMXA 4AK9A 3PR1A 4TL8A 4B75A 3R9XA 6Q21A 4PHTA 4KVGA 1CF4A 2FEMA 1XXHB 1XEWY 1WXQA 3KFVA 1UDXA 1KNXA 4IOLA 3KB2A 2F43B 1RRPA 1NSFA 2DZOB 3SS8A 4MRNA 4R2HA 5HE9A 1E2PA 4XOIA 4ZDIA 2Z0MA 2UVQA 3O8DA 1KI3A 1ZM2A 3SE0A 3GPLA 4DDUA 1LW7A 3TVTA 4BPBA 3CLVA 4FMDB 1EESA 1VIAA 5EE1A 1S9DA 3UK6A 1OYWA 3GEEA 3JZMA 1DAEA 1G6OA 5F98A 1EX6A 1KYIA 4MRRA 4BLTA 5JZVA 1E3MA 5CB6A 2IA5A 1UM8A 2RGAA 3ADDA 2F9MA 1S96A 5KSZA 3B13B 2CDNA 1JQLB 2GNOA 3I61A 4YMTA 1K6MA 3HU2A 2ZRNA 2VLIA 3WNBA 5HCNA 2LCFA 3AVQA 3L0PA 2ODBA 1ANKA 2C78A 2O8DB 3CW2A 1FQKA 1L7VC 4QM6A 3LQRA 4OQXA 1SVMA 4U7DA 2ODEA 3VKHA 3WNDA 5EP3A 1E94E 2JJ2D 1Z6YA 1XNJA 3OHMA 621PA 2YOGA 3R7WA 1SVSA 4QHSA 4F4IA 3UIEA 4DCNA 4HZUA 1CEEA 3W90A 1W1WA 1N6NA 2YKGA 2Q6TA 1KJYA 5E3HA 2HXYA 3RS7A 2BVNA 1PVOA 3AGPA 1CLUA 1QZXA 2RHDA 3ZD7A 2AHOA 3IIKA 1XXHA 5TB5A 1ZM4A 3EA0A 5CK4A 1ZD8A 2XNDA 1E0KA 4YLGA 1R8SA 3ZZTA 4YMUA 4ESHA 3QBVA 1G41A 3EZ7A 5JBQA 1D2NA 3VTKA 4LX0A 3W5JA 1X3SA 5GVSA 1YZKA 4XTRA 1G6HA 2CCJA 3AGQA 4JLNA 1GSIA 1TUEA 2PX0A 4IFEA 1BYIA 1JR3A 3SBDA 2P6NA 2CK3D 4HAUA 4IVRA 3AF2A 4G5QA 2QAGB 1Q1BA 2IF0A 2QA5A 3QEJA 2HDNB 4JJZA 2AXNA 3KUCA 4IDPA 1IAQA 4HYYA 1YQTA 5IT5A 1T3LA 3FMIA 2QENA 2WJYA 3VFDA 4JLOA 5CYPA 3WBJA 4LJAA 2A5DA 1BMFA 1GKYA 2QGNA 4O2LA 4P0TA 1X8JA 4GOXA 4GP7A 2O8DA 1H65A 2CHGA 4TL6A 4DLZA 5AJXA 1LS6A 1YU9A 3BH6A 2D2EA 4HDQB 5H1YA 2W2TA 2QT1A 3AVVA 3R8FA 1KO5A 3KZ1E 3RNLA 1ZRHA 3NH9A 3LAWA 4OKSA 2WOJA 4LZZA 2B8WA 4FCVA 1A2BA 4LHZA 3BFVA 4JT4A 5BYKA 4F38A 1S1MA 1E2HA 4A92A 4LI0A 4NYJR 2RAPA 3QKUA 3FMOB 4NYMR 3T5DA 2QP4A 3RC3A 1FOEB 4YDHB 4RZUA 2OG2A 3TR5A 3VNUA 4KSCA 3I4LA 5KSOA 1XD8A 4DDWA 4DDVA 1RPZA 2GK7A 2EFCB 2W2XA 4OI2A 1XTIA 1NVVQ 5DO9A 1A1VA 1CR4A 1LVGA 2REXB 4ESVA 4WVFA 1Q3HA 4I1VA 5CK5A 1IQPA 3U3MA 5JEEA 2KWIA 5L8VA 4CRWB 2DVWB 4BRWA 4JSTA 2UKDA 4ZDKA 2ZYWX 3FHCB 2TMKA 4NBSA 1E2QA 3MRSA 5DI9A 1E0SA 3VX3A 4MDEA 5CLQA 2AK3A 2DPXA 3PIRA 5EE5B 5EXTA 4NH0A 1HURA 2QEQA 4NCKA 1G16A 5SZKB 3SOPA 3EZ2A 4PSKA 1HYQA 1ZUIA 2NO0A 4NTZA 3AUXA 5TARA 2GRJA 4E07A 2EFDB 2IYLD 4FD2A 1G291 2N42A 4PHHA 2FFBA 4JT2A 2BEJA 4Q1FA 4URYR 3RDPA 2WVJA 4FCWA 4DSTA 4LJYA 3ZS9A 3B1YA 2IS6A 1NBMD 1RVDA 4HEJA 2V6JA 4DBLC 3QUSA 3QSYA 2IYWA 2FJUA 1DADA 2C95A 4ZDJA 1YZGA 3WBKA 4WZ6A 3PUWA 4B6FA 1OPXA 1D2MA 1GNQA 2GZAA 3W8RA 4TMTA 3REFA 2FZ4A 1OH6A 1OFHA 2QQEA 3NG1A 1N0VC 1RYHA 4LJ4A 1OYYA 2ZRLA 2JIZD 4KHZA 3WHKA 2WPDD 5DI3A 1SKYB 2R62A 5KPDA 4XD7D 4DZZA 4L5BA 5FBRB 1VECA 3BB1A 3T06B 2QU8A 4MYHA 4GZLA 3R9IA 1KY2A 3LO5A 3X1ZA 3RLFA 3B6EA 5LB4A 2QZ4A 1E9DA 1MT0A 4QGFA 4BASA 3U3OA 2O5VA 1OH7A 3SC3A 2FG5A 2O8FA 1XZPA 3AQ4A 3DM5A 5LD2B 2PCLA 4IDHA 2ZPTX 1QHSA 3P4YA 4GOKA 3SYLA 2ZE7A 1Q1ZA 4MKHA 5AWFC 4AKHA 2C9OA 1NMZA 5E7MA 2XOKA 2WHXA 3NWJA 4F93B 1GZSA 5DYGA 2B8TA 3LWNA 4W5JA 3WMFA 3N70A 2JASA 3MUFA 1LB1B 1Z6TA 3LBHA 3A1SA 3VR3A 3TMKA 3TQCA 5SZHB 1IONA 4TLDA 5JWHA 3DEFA 1XTJA 3AKDA 3CBQA 2CLCX 3GFPA 2FGKA 3BBPA 4CT5A 2G83A 2VBCA 4NZYA 1JJVA 1F60A 3P26A 1OB2A 2R6FA 1UBFA 4JLJA 2VO1A 5BW8A 2IX3A 3X1WA 4GL2A 1JAHA 2GAOA 1YR6A 3IEVA 1GG2A 1IN4A 1J8YF 1TEVA 2ECKA 1I4LD 1R2QA 1JPNA 3BE4A 2XXAB 4NCNA 3QJYA 3ZVLA 3TW8B 2OILA 4D26A 5FOSA 2ONJA 2BOVA 1G9XA 1WDTA 2C96A 1KI4A 2MMGA 1JPJA 4DCUA 3LXRA 4Q02A 5AK0A 2G6BA 5FBWB 5JCPA 2VH5R 4V0NA 3I8SA 2BIFA 4MUAA 4U02A 3EARA 4DHEA 4R9UC 1SQ5A 4IOMA 5D3QA 3W9YA 2Z4RA 2OAQ1 3U7HB 3V4RA 3Q3JB 2ZYUX 3T1TA 1R6BX 1R7RA 2ODNA 3HYTA 1L2TA 3GLIB 1HT2E 1DTSA 4WA7A 1TF7A 4HLUA 3ZLJA 4MUBA 4A3VB 1W49A 4IXMA 4JIMA 3BS4A 2XITA 2J3EA 2JJ1A 4JLKA 2Z83A 3L0SA 3CZQA 1E9BA 3KQUA 2HXSA 2W2VA 4A36A 1D6JA 2WM9B 4C4PA 1Z63A 1E0AA 1II0A 3CPEA 1SVLA 4KFSA 2MSCB 1CJTC 2QNRA 3L82B 1OXXK 4HZIA 4JSYA 1M6NA 2V1UA 4F7WA 1NKSA 3M6AA 3EXAA 1KDRA 4GP6A 5AUNB 1XPOA 3GJ3A 5E7IA 4MGZR 4XSGA 2ZVPX 4Q9KA 4KBFA 3K0CC 1XRJA 2IYUA 4YDSA 4BUJA 2PLRA 3OESA 2ZUDA 2XAUA 4EAQA 2AX4A 2KB0A 2CK3A 2CL0X 2EYQA 2H5EA 4EFLA 2ZI7A 2IS2A 1F3OA 4W5WA 1G5PA 1N6HA 4OI1A 2PMKA 2XXAA 3K9GA 3P1JA 3CX6A 3L43A 4DLYA 4ARZB 3NDBB 1LF5A 1MO6A 3IO5A 3WMEA 4MRVA 1N6OA 1R5OA 3W6PA 3EIHA 2VF8A 4C0BA 2J5XA 1X1SA 3R8CA 2DBYA 2RGNC 1ZYUA 4B47A 1XPRA 4AURA 4M9SA 2LWIA 2OEPA 5B58C 2JLRA 1L4YA 3K0FB 1X1RA 1I4TD 1X6VA 2WSSA 3MGCA 3EAQA 2OFXA 3B7GA 1EXMA 1MH1A 3AVOA 1MRSA 3OIWA 4Z8YA 3I5YA 3LA6A 4QM7A 1WBDA 1UKYA 4WW0A 1W0KA 1U99A 2EYUA 2HJVA 3GLIA 5EE0A 4IEEA 2ZS7A 3PUYA 3QVVA 3OIUA 5JJIA 2ZSDA 5AUPB 1SXJB 3F8TA 1E4VA 2N46A 2IL1A 3A4NA 4KLNA 1TX4B 2QAJA 2V4ZA 3IILA 4URZR 1LY1A 1NL3A 3FPAA 3QG1A 3QPUA 3AVWA 1VCNA 3N5CA 2IHYA 4Q9JA 1AZSC 1CJUC 1IM2A 3EIEA 5JSZB 1IJFA 2G1KA 3I1FA 4O25A 2ZUCA 4X8LA 1TAGA 4PAQA 2ANCA 1I2DA 4G5GA 1QZMA 4TQAA 1N6RA 3FWYA 2CVHA 1XMSA 1II8B 3VX4A 3CWZA 1DPFA 3G0HA 4TQ9A 2QORA 4LC0A 3GLFB 3V9PA 2CBZA 1TNDA 1F2UB 1WQ1R 1MABB 4JZKA 2X19A 2VP0A 5EQTA 3DDCA 1RE0A 3ASYA 4IW3B 4ARZA 1IN8A 2I4IA 2QGZA 3ADKA 4AYTA 3F0TA 3QKTA 2ZRKA 3EWSA 3D31A 3CF2A 2DWOA 4L8GA 5FPKA 3K70C 2GK6A 4GOJA 3K0FA 1TF5A 1U2RA 1KSGA 2FZLA 4ZCMA 3CRW1 3B82A 3FMFA 1Q44A 4I81A 1AQYA 3MFYA 1QHHB 1YZUA 2FA9A 2HV8A 3ZJYA 1EFCA 3C7KA 3H1TA 2PZFA 4TMXA 4EFMA 2ZAOA 4XSHA 1SXJA 2IYVA 2RGBA 5G3YA 4BLRA 2F1IA 5CDFE 3M4YA 3MHVC 2IYYA 5D3MB 2NZ8A 2G0TA 1XTKA 1NBMA 3L0OA 3QEOA 4QBGB 5JSZA 1G4UR 1Z28A 2VP4A 1VHTA 3DPUA 1KHTA 1N5IA 4ILEA 5ANRB 3RABA 1FUUA 1KI2A 2OCYC 1CR2A 1VDZA 2ORVA 2FSIA 5EE3A 2JEOA 3ND9A 3IQXA 3U3KA 3RS0A 3FB4A 5B64A 1FP7A 2VEDA 4JJKA 1II8A 2ZETA 2QMUA 3WRYC 2DR3A 4II7A 5KO2A 4KYUA 1JR3D 5DHAA 5SZJA 3ZGXA 2AD1A 3QENA 3GLFA 1Q3TA 3A6PC 4US1R 1T0JB 2JIZA 1S8FA 2CE2X 3L2OB 1F2UA 2IYXA 3M1IA 1MABA 3RS3A 4URWR 5KDOA 2QRNA 1H8HA 1FX0B 2P6UA 4M1TA 3M0EA 1IJEA 3IIJA 5C2JB 2OT3B 3UWKA 4DSUA 5C18A 1BMFD 2Q9AA 5AJZA 1UJ2A 1T5LA 4S35A 2F3TA 4V02A 4TZ0A 1NSTA 2FFHA 4B71A 4PZZA 2D62A 1Z3IX 1G7SA 4Q5IA 4ASUD 2AKYA 1IY0A 4Q9HA 5FBVB 2IS1A 4M1OA 5CIWA 2BV3A 4BEJA 1BOFA 1M34E 1QHNA 2NG1A 1HEIA 4TN1A 3I5XA 4IDOA 1KI1A 1XTRA 1C1KA 2KRKA 1KSFX 3W6OA 2IUTA 1W2HA 1MKYA 4PQYA 4AD8A 4B33A 4PPNA 1ZP6A 1II9A 4Q4HA 4DUGA 3KL4A 1HY3A 3W8NA 2ZJ5A 4JVLA 1JECA 1F48A 2ZRGA 2ZITA 3ADBA 4PSAA 4D80A 3U7FB 3WXMA 3KXKA 3LLUA 3GCGA 1G8YA 3ETLA 3IGFA 4OBEA 2ZRHA 2GBLC 2C99A 1AN0A 1W0JA 4RZ3A 4HB4A 4KI0A 4W5HA 1PJRA 2NGRA 1G7CA 1Q20A 2ONKA 4XVQA 3MJRA 3THXB 4D6PA 1GKUB 2XTMA 4KITB 2XZLA 4IJMA 5BQ5A 2H7VA 4PC1A 1AS0A 4IKEA 3TK1A 2VTKA 1W36D 1FX0A 1JBKA 2A7QA 3T61A 1NI3A 3AVPA 1N25A 1E2EA 5JI3E 4AWXA 2CMKA 2OSBA 1VG0B 3SHFA 5JHHB 1ESMA 4X8HA 2R2AA 1LS1A 1ZIOA 2IS4A 1M74A 3BH7A 3BB4A 1OKKA 1KZGB 1P9WA 3G5UA 4JLPA 4LBWA 1N6PA 1OIXA 4R7ZA 2G3YA 3Q8XB 1WBBA 1GRRA 1XXHE 1MV5A 4FMCB 3T1QA 1YZNA 1JNYA 1G17A 3IHLA 4L16A 3SN6A 4BLPA 1AJEA 2IXEA 3B78A 5LBIA 3PQCA 3TSWA 4QGAA 1U81A 3SBEA 1F5NA 1XPUA 2W83A 3Q5DA 2J45A 5CM8B 3VHLB 5TY0A 1DG3A 2PL3A 3CKLA 4K46A 4I1OA 4DDTA 4IXNA 1GRNA 1OIWA 1JR3E 2ZR9A 3C16C 1XB2A 2WWGA 4DLXA 3T34A 2ANBA 4RD0A 5E7JA 1SVOA 2ERXA 1JI0A 3BAFA 1S3SA 1W4AA 4H1VA 3AF0A 3THXA 2G77B 1W7AA 1Z0JA 1T6NA 2KE5A 3P20A 2WZQA 4Q4AB 5HPYB 4Q1CA 1XMJA 2FMXA 2YV5A 5EXSA 2QROA 4BFTA 4EJSC 4C0JA 2J41A 5LDDC 1DBSA 3I92A 2H16A 3TSZA 2DWZB 3GLGA 2J7PD 4Q4LA 3DOEA 4RY2A 4B2IA 1G3MA 1KO4A 3CZPA 1TADA 1NKTA 3OE7A 4NYJQ 2Q9BA 4FWHA 2D3WA 2EFEB 1E2LA 1U8AA 1E0JA 2FPKA 3QF4B 4NYMQ 2BDTA 4Q7MB 5H68A 4B6EA 2DB3A 5EZ6B 4MGKR 3WP1B 1WA5A 3R7WB 4KJZA 4HLQB 3E70C 4BFVA 1JEDA 2VHQA 4EPWA 1BYUA 3LLMA 2B7CA 2ZI3A 2PZEA 1RJ9B 5JRZA 4UNPA 3E1SA 2PT5A 2ZAMA 2XOKD 1CJMA 4FMDF 3NBYC 4P4SB 4Q1DA 2G9NA 4B73A 1NN3A 3L8YA 1YR9A 2ZRPA 3OIYA 3T35A 4AYWA 2ZYVX 1Q1EA 4Y0VA 2BCJQ 2W58A 4UNRA 3SJBA 1HA3A 3K1JA 4TZ6A 4ZI2A 5B30A 1ZC4A 4V03A 4TYNA 1VG1A 2IYTA 3PEWA 3PVSA 2C03A 3T15A 2CJWA 1G3QA 2QN6A 1ZAKA 2Q3HA 4A0GA 1IOZA 3JVUA 4JBYA 5CM9C 2ZJZA 1J7KA 3MSXA 1XZQA 4A8JC 1XTSA 3AUYA 1TU3A 4Q4AA 4DVGA 3QXXA 1P2TA 1EK0A 3KB1A 2H92A 4MKGA 5JMTA 1DOAA 1MRNA 4TT3D 1Z2CA 3GP8A 2YJTD 2WKRA 1NIPA 3CF6R 1Z83A 1Z0DA 1RW4A 5FTJA 3LNCA 1VPLA 1TTTA 1GUAA 1RYFA 2MMCA 3CH4B 3QPVA 4US2R 3EZFA 1XMVA 3LW8A 4EPXA 5DNYB 2BBSA 2ZJBA 3FKQA 4YXWD 1HQCA 3QF4A 1XEFA 3PXGA 3UWOA 4MGYR 1C1YA 4NPHA 5BN4A 3X1YA 1NLYA 4MITA 3CRRA 1KDPA 4LHVA 4TYQA 1TL7C 2A30A 2ZVQX 2PEYA 1DAGA 2ZROA 3MWJA 4QG7A 4NCIA 1BKDR 1RJ9A 1M7HA 2P0EA 3AKCA 4Q18A 2QQ0A 3CX8A 5JCZA 1VYTA 2J87A 4P4SA 2JJ1D 3EASA 4YMVA 2PBRA 2VP6A 2GVDC 5GVRA 2H1LA 4Q00A 4NONA 2XNSA 3HPRA 2BCGY 4DCVA 2ZI4A 2GXQA 4NYIR 1NY5A 1FP6A 1E9SA 1YZTA 5EUQB 1Q57A 1OE0A 1RIFA 3RS5A 2J46A 2A5YB 3AVTA 2ZRMA 1OB5A 1BS1A 1AA9A 4YC7A 1DEKA 2J59A 1IBRA 2YWGA 2QRZA 2YC4C 1NP6A 4MH0R 3BJIC 1Z6AA 2OO7A 1NMXA 1N5LA 2ZEJA 3HU1A 3SZRA 1L4UA 2HF8A 2PLFA 2FH5B 5KSPA 4RSGA 3WP0A 4RVCA 5TDHA 2B7BA 4UKDA 2C2HA 1P61B 3FFBA 2P5SA 1W36B 1QG2A 3GLHB 1W44A 4QC2A 2OLKA 4B3GA 4RKFA 2N1BA 5EXXA 1Q21A 1GITA 2AD5A 4TTQA 4AI6A 1EGAA 2GEVA 3GQBA 2V9PA 2WSSD 2NPFA 2IXGA 2ZE8A 1HH4A 2OLJA 4MYCA 2GESA 4A4DA 4ASUA 1FZQA 3WNCA 4D0LB 3ZVRA 1XBTA 4C2UA 4P33A 3LVRE 2GCOB 5EJEA 3B8HA 5J4LA 1W0KD 2ZTSA 4G5SA 2IYQA 1N6IA 5FOUA 3A4LA 2OESA 1U94A 4V0MA 1AM4D 2P2LA 2K5UA 3UXMA 4QKQA 1KOFA 2AN9A 2JLYA 3OF5A 2AFIE 1R5NA 2IHBA 3FTQA 3JZAA 1FTNA 1BO6A 1RFLA 4PZLA 2YNMA 1DELA 4D4KA 1U9IC 1US8B 4EDHA 5EP2A 3I3SR 1P72A 1QHIA 3DMDA 4NCHA 4JYCA 3KW6A 1G20E 1YR8A 2OZEA 4EUNA 1DS6A 2HCJB 1CKEA 2A5FA 2WV9A 1VMAA 2GJKA 1SKYE 3I32A 2GHIA 3O47A 1UAAA 2XSZD 2VP5A 2OAP1 4TYYA 4TTRA 4DLWA 3GD7A 2ERYA 1XCMA 1ZNXA 4DLVA 5DI3B 3AEZA 4CT4B 1N3BA 3Q7QA 3GLHA 5L3QB 2CEAA 5K8LA 4UJ5A 1GDDA 3MWKA 3QOFA 4MKFA 1N5JA 1RKBA 2ORIA 3B60A 2QMEA 3CH5A 4OQMA 2BBWA 2GWHA 3W3ZB 3MJHA 4P3YA 2HEIA 4M1MA 5DH9A 3LFUA 3GJ7A 4IVPA 1W4CA 5HTKA 2GCOA 1UF9A 2IUUA 4QHTA 5AJWA 2OBLA 2O8FB 3KKNA 3QY0A 4CEJB 4NL4H 8OHMA 1SXJD 1MOZA 3ZYCA 4HAVA 5KOYA 2RMKA 2WJGA 3K0CA 5C1BA 4LDJA 2QP3A 3DO6A 1R0YA 4PSVA 3FGNA 1US8A 3RAPR 1GWNA 2ZXUA 2ZU6A 4RD1A 4DB2A 4OK5A 4QOSA 4OI0A 2WKQA 1N2CE 3K8YA 221PA 1A5TA 3VNVA 3QXSA 1FMJA 1AQUA 1HE1C 1C4OA 3WYAA 3LX8A 1E1QA 2RGNA 4WXRA 3VR2A 1A2KC 2PH1A 3Q5EA 1DG1G 4FWIB 2ZANA 4Q19A 2GETA 4BZXA 1ZJ6A 1HE8B 1ZBDA 5FTLA 3CIOA 5DN6D 2PEZA 5EUMA 3HP1A 3U4QB 3EIQA 4PC2A 1H8HD 1QHGA 4FWDA 1T8TA 2ZJ8A 3REGA 4LK2A 1UKEA 5L3QA 4LHYA 1FNNA 1SVKA 5JWOA 4M8NE 1MO5A 2J7PA 3ONWA 4HLCA 4US0R 2CNWD 4UJ3A 2B92A 2GXSA 4WBSA 4D2IA 3BFKA 4JLAA 4N3NA 3NHAA 4DC9A 3GLIE 1IXRC 3QNUA 4FINA 1KY3A 4KXFB 4XWOA 4HAYA 4L9SA 1R0WA 3KFXA 1DVRA 4EIWA 2ZREA 3KKPA 4PHGA 3SQWA 4KV9A 4AC9A 4BWYA 4CEJA 1UDWA 2ZRIA 5IF9A 1ZC3A 4C0HA 1UBCA 4ACBA 5FTMA 4LBVA 2YOHA 1ZM9A 4LUCA 3X1DA 4TL9A 3ZDQA 1FMLA 2QL6A 2O0HA 5GJVC 3CM0A 5BN5A 3VU9B 1E32A 2NO1A 1OSNA 4DUGD 4JL6A 4HB3A 3K0AA 3I72A 3Q72A 5FUYA 3OZXA 1LTQA 3GFTA 3W3AA 1SHZA 2HYDA 1K5DA 2CL7X 3Q85A 1GFIA 1Z22A 4YONB 1W0JD 3NXSA 4EFNA 1I4DD 1OXUA 2JLQA 3FVQA 3KKQA 1XEWX 1WP9A 1Z8FA 1UADA 1VG9B 4Z1MA 2IBMA 1W4RA 1P9NA 3T12A 3H4MA 1Y3AA 3AP3A 4PC7A 4I1SA 4URXR 1OH8A 4B3FX 4Q01A 4TT3A 3U4QA 2HLDD 3EA5A 2QMHA 2X2EA 4J0QA 1GRQA 4B3XA 3V00A 4C0LA 2OBMA 5LB2A 3TH5A 1SZPA 1UPTA 4GI7A 4JVNA 1F2TB 1XCGB 2AK2A 1TEXA 3CR8A 4HAWA 1PLKA 3ZZUA 5JWRA 2QMOA 1KIMA 4LRTA 1OKKD 3U5ZB 2R9VA 1T0HB 1ZNWA 2DCUA 3LY5A 3NC0C 1SXJE 4HI0E 4YXWA 3VKGA 1W5TA 4C3ZA 3KKOA 2D7CA 1Z6GA 4Z54A 1KNQA 1ZU4A 1NBME 2HJGA 1EG7A 5J4YA 5FUXA 3SFVA 3IEUA 2GZHA 2VA8A 4RZ2A 3VR5A 5CLLA 1S4QA 3KKMA 3UMSA 2ZSEA 5J5CA 1SVWA 1KMQA 1E9FA 4ZIRB 2QBYB 3A4MA 4MQBA 3VU9A 4KCGA 3AKYA 3RS4A 3QE0A 2SHKA 4GITA 4G3XA 1TQ6A 5C46F 4R2IA 3B2EA 3KJIA 2ZRCA 1NY6A 3GLFE 3MLEA 4IRUB 4LJ9A 1AKEA 1JALA 5JS8A 3AM1A 1GL9B 3TAHA 3HYRA 2QT0A 4Q7JB 2RHMA 2BKUA 1GIAA 1VYVA 2YVUA 3SYKA 2OCAA 4XTCS 4RFSB 3R20A 4YMWA 4D81A 4IOKA 3O8BA 4JBXA 1Z5ZA 1G5RA 2P65A 1GTVA 1JAIA 1TUIA 4R98A 1ZNZA 1GNPA 2KJQA 2IYRA 2XZOA 1Z47A 1QG4A 1HV8A 4MKIA 1W2GA 2IWRA 4I4LA 3ZQ6A 1JR6A 2PX3A 5FOWA 4GT1A 2JLWA 2EW1A 4PPGA 1ODFA 5KUTA 2HT6A 3LRPA 1F2TA 4CEHB 2C9CA 2XTNA 3BGWA 4Z8XA 2EU8A 3OE7D 4B2LA 4O0MA 4QHYA 2H8KA 4PQFA 4D82A 1WRBA 4RCYA 3RWMB 4B3DA 4TYPA 1TF2A 3SNHA 4N0EA 4RD6A 3SJAA 4DLRA 4RJLA 2GBLA 1ELOA 1ZVQA 3KDSE 2YWHA 2QM7A 1H8EA 2YINC 4QBFA 4DLSA 3EPKA 3P32A 4ZIRA 2DFNA 2QBYA 3S1AB 1LFDB 2VL7A 2GXAA 2J0UB 1G7RA 4LRWA 2FN4A 2QP9X 2QG6A 2YZ2A 5HE8A 4KAXA 3CUEF 4LV6A 2R6CA 4NP6A 4QJ3A 3MAAC 1KI9A 3K9NA 4EJSB 2O8CB 1SVIA 2AR7A 2FSFA 2PMDA 3PCRB 4PAOA 3K9HA 1FUKA 1X8LA 1T3SA 2EWWA 3UG7A 4EPRA 5FL7A 3UPUA 3DVLA 5CYOA 1KJZA 3SFZA 4RFSA 5LPNA 4BFZA 1ZD1A 2ZJOA 2FF7A 4LBZA 4F91B 2FOLA 5DHFA 1WMSA 3PEYA 4OK6A 2XSZA 2AWNA 2C5LA 4PFSA 5FOXA 4NKRA 2DHRA 1TU4A 2LKCA 4POAA 3KUDA 2P67A 4LBYA 2ZI6A 1YZQA 5FTNA 3U6BA 1HQYE 3GJXC 4A9AA 4Q47A 1XD2B 4EKDA 4UNQA 3A1TA 2BMFA 4AG6A 5BWMA 4ZPXA 3WHLA 3DL0A 4KLZA 3TRFA 4B44A 4XIGS 4CEHA 4DIEA 3TJZA 3V4FA 3AVUA 1CIPA 2DY1A 2OHFA 2V1XA 4LHXA 2V55B 3A37A 3VAAA 3MMPA 3WYGA 4PTLA 3A58B 3EWAA 3UG6A 3D7MA 1YE8A 3GMTA 5F2EA 3THOA 1VG8A 1C9KA 1OW3B 3AJIB 1OXTA 1QRAA 2OXRA 4JVMA 4C0SA 4MA4A 4OHWA 4D4LA 3NBZC 2WWWA 3X2SA 2FNAA 2D2FA 3E5HA 1KDOA 3ZZ0A 4CIDA 5J4HA 1XF9A 3S1AA 4HLDA 3GJ6A 2ZSBA 1DARA 4A2QA 4A8JB 2J0UA 2ZE5A 5TXGA 3EZ6A 4XVUA 4OQNA 4JN6A 4N0DA 5J4VA 1TQ2A 4Q4HB 1WCV1 1LF0A 3F3YA 5AJVB 4HAXA 5BYJA 2WWHA 1G3IA 4EJSA 2O8CA 2QM8A 3CF0A 4G1UC 2GAAA 3PUXA 1G8PA 2W0SA 2YC2C 4OQLA 4Y0AA 4LOAA 2ZQ5A 2E9SA 2Y8EA 2BJWA 3QXCA 4Q03A 2B6HA 2XB4A 4BGDA 3GLGE 3QKRA 2J0VA 1G1MA 4BFXA 4KODA 1R0XA 2JAQA 3CRMA 4LYFA 4C0QC 4UXHA 2F1JA 3DKVA 3I8XA 4RCZA 5CJPA 1P2VA 5DN6A 5TVKA 3RRYA 3CR7A 1NJGA 1XD2A 2GCNA 2JLSA 2G88A 3G82C 4A6PA 2D7DA 3OIVA 3U3JA 3TAUA 3U44A 1DAFA 1N6KA 1NRJB 3U61B 1KK3A 2CNWA 5G40A 1V43A 2AFHE 3ZD6A 1QVAA 3QI2A 3C15C 4TTPA 1E1RA 2OV2A 4IVQA 4G0NA 4TSFD 1QHXA 2ZE6A 2F9LA 3DKPA 4CEIB 1TPZA 4Q4JB 1B23P 3KJGA 4ACAA 4LJ8A 4DEXA 3OAAA 3VKWA 4BFWA 3EX7C 5KHOC 4YQFA 1E2GA 2MSDB 2Q0HA 5CITA 2E1RA 3KQHA 1U0LA 2ORWA 4WAUA 3B1ZA 5C4GB 2D06A 4A8JA 2GJAA 1NG1A 3BC1A 4CGZA 3H84A 5JFGA 4PO1A 4KVAA 1G3UA 2XJ4A 2VF7A 2GVZC 2H18A 3BH0A 2BM1A 4E22A 1OFUX 2GEUA 3LBIA 2VHTA 4M0LA 1KK2A 1ZU5A 5FPYA 1ZCBA 2A5GA 3W6NA 4UQOA 2GF0A 1R10A 4Q7KA 3ZVMA 3ZIAA 4A1FA 5FH9A 5DE3A 4B3CA 1ZINA 2V3CC 4MRPA 1PZNA 4Q48A 2HLDA 1X86B 2FFAA 4JLVA 4XJXA 4R71A 1EFUA 2NMVA 4FMCF 3UATA 5A5GA 2I3BA 4LYAA 3IBGA 2A78A 3VLFB 1Z06A 2GZDA 421PA 1GNRA 3GLGB 2IW3A 4IHQA 5H70A 3UMFA 5K8UA 2EQBA 4BFSA 4AY2A 2VPPA 5JJLA 1KMHA 3ZH9B 4CZ2A 2CE7A 2REOA 1E99A 4AKEA 2OCPA 4CEIA 1Z2AA 3N2EA 1E79A 3GFOA 4MGIR 4NYIQ 4Q4JA 3UMRA 1NLZA 1S3GA 1G19A 2GJSA 3OEHA 3PV0A 2NQ2C 4JLMA 2QY9A 1ESNA 1U0HC 3K9LA 2J7KA 4HSEA 1CR1A 2VHUA 3NEJA 2GDJA 4EPTA 1QDEA 1IN5A 1X37A 2ZYTX 1LNZA 1KSHA 1UEIA 2F6RA 3PEVA 1U8ZA 2J9RA 2FPLA 2HCBA 4WIAA 1UBEA 1RRCA 3RRZA 4M9XA 5J47A 2DFLA 4RD2A 1E96A 2ZR7A 4OK3A 2Q9CA 3OEEA 4PO8A 1OJLA 2ZIAA 3VQTA 2JLZA 3DHWC 1KO8A 2WOOA 3CB4A 3Q9LA 3BORA 4I99A 2CJWB 1KKMA 4KYIB 1E1QD 2Q3MA 1COWA 3PEUA 4C2TA 3CWQA 4E09A 4D25A 3TE6A 1P73A 3DOFA 4M53A 4XWAA 4ERNA 2GILA 1V5WA 3IDQA 2WKPA 3QBTA 3TUZC 2Z43A 1Z6XA 3A8TA 4CYMA 5CDFA 4HB2A 4FXPA 4M1KA 5G53C 1XEXB 4Q1BA 1E9CA 4AG5A 3PENA 1P2UA 4P32A 5JJKA 3C8UA 2IT1A 3GJ8A 3HU3A 1NVUQ 4CW7A 4QNRA 4V0ME 1G8FA 1UKZA 5HKKA 1NG9A 1U9IA 1CRQA 1WB9A 1P2SA 1W5SA 3EC2A 4K8OA 1A4RA 2WJJA 3QG5A 3CX7A 2FSGA 4V0OA 4G5RA 4DXAA 4PPQA 5ELXA 3K0SA 1KK1A 5L3VA 3NBFA 2FDCA 4C7OB 2XJ9A 4U00A 4BFYA 3TSOA 3CNLA 2WMOB 5KDLA 2FPMA 1P5ZB 4ZKEA 2CLSA 3QPWA 3T5GA 2G1JA 4BRUA 1GM5A 5G3ZA 1CU1A 2V7QA 5A0FA 2ZU0C 2VYFA 3FMPB 2V54A 3AP1A 2R6DA 4TL7A 4OHZA 1WF3A 2EFHB 3RWOA 3KQNA 3RHFA 3I62A 3P27A 4LWZA 4GFDA 3TLXA 2WJVA 3NDPA 4F4JA 1VTKA 5FI0B 3GLHE 1E2JA 4A2WA 4Z1MD 4AKGA 1VYUA 3K70D 4M4SA 4B35A 1GL6A 2BMEA 1W4BA 4GBMA 4E03A 2X1VA 2REBA 1FPMA 1AS3A 2C8VA 4BEBA 5J40A 3ND8A 4GMXA 1XEXA 4LY6A 3CNOA 4M1YA 4EQ6B 3AF1A 3PJRA 1D8TA 5FUVA 2P5TB 4BLOA 2Q3FA 3CPJB 1KK0A 1DE0A 4QNMA 4DLUA 3GEIA 1KKLA 1J2JA 1Q1QA 2OXCA 3BXZA 3I73A 4A15A 1G21E 5H8WA 2Z6VA 5AR1A 5KYKA 4B74A 4LC1A 5SZIA 3FOZA 1KI8A 2WWIA 1DO2A 2UZ3A 1A7JA 5JECA 2A5JA 3AKEA 3AV0B 3UKDA 4C7OA 4OHXA 4HB0A 2VSFA 5KNBA 2YWFA 2VIIA 1E9RA 5G41A 5JLJA 4PANA 1Z0FA 1TQ4A 4PQRA 4A0FA 2ZRAA 3SHWA 2O8BA 5AJYA 4E5UA 1W46A 1OF1A 2RGEA 2VHJA 4S2EA 5F3WB 2E87A 1IN6A 1T9HA 2GKSA 3NTUA 4BZQA 2NO7A 2ODWA 3EC1A 3GJ5A 1CXZA 1ZUHA 2VQSA 4K81B 4JYBA 2R8RA 2FWRA 1AKYA 3CO5A 4W9MC 1N6LA 2WWYA 4Q9LA 1P6XA 4WZBE 4DRZA 2BBTA 4JLDA 3WY9A 3HDTA 1NJFA 4KFRA 3MCAA 4PXAA 1FTSA 2P6RA 3U7EB 3H86A 2F43A 1GL7A 3QKSB 1OT3A 4EPYA 1ZCAA 4LHWA 3IBYA 4EQ6A 3EPJA 2R44A 2RGGA 2ATVA 3WMGA 3ADCA 4H1UA 1AGPA 1MR3F 1W48A 2VP9A 2JLVA 2EWVA 1OH5A 2UZIR 4OJQA 3VHXA 1G7TA 4V0KA 4TSFA 1KZ7B 5IHPA 2RGDA 1G8HA 2BMJA 3SDZA 2WTUA 1FNMA 2W00A 3IKJA 2OM2A 5E95A 2JA1A 4BECA 3LH5A 1ONBA 1UKVY 3UANA 2XGJA 1S9HA 3C5CA 1H8ED 2W6ID 4QXAA 2FX3A 2O0JA 3QXHA 2ZRDA 3H2YA 5KTYA 2WIAA 3NIBA 5E4FA 4EPVA 1U98A 4GDFA 1PUJA 2CHVA 1DAKA 2YWEA 4KFTA 3QF7A 5K8TA 1FQJA 2AL7A 1OHHA 1N5KA 3NKVA 4TWZA 5AUQA 1HT1E 1GP2A 1W47A 3B9QA 1VCMA 2QE7D 5KNCA 2I1VB 4AKIA 2WBLC 1Y63A 2IF2A 3K09C 2CHQA 5FL7D 5GJCA 1G4AE 1WE2A 5KDDA 4YMSA 1KAOA 3RYTC 3EZ9A 2QTFA 1QHYA 4QGGA 1JJ7A 4UXJA 2GJ8A 3AP2A 3KXLA 3QVUA 4QJ5A 4TMKA 2D4HA 3TKLA 1HTWA 2MSEB 2QPTA 4BE7B 4KO8A 3TIFA 3SQXA 1F6BA 3D6TB 1Z08A 3QKSA 4QBHA 4TLCA 4RKEA 1OFTA 3FYHA 2F7SA 3QQ5A 4FN5A 2C9YA 2QTVB 2HUPA 4AYXA 2IC5A 3KXIA 4WXPA 1GOTA 3SI7A 3B85A 4W7SA 5JHGB 2QAGA 3W34A 1CRPA 4LYJA 2NIPA 2YOFA 2IYZA 2F1RA 2G0NA 4DEYA 1N0UA 2CCKA 4PC3A 4G5OA 3BWDD 4CDGA 5KU1A 2JDIA 3TBKA 1ZM7A 3TVDA 3CPHA 4OQFA 2WAXA 3H0KA 2BHRA 5L3SB 2GA8A 2B21A 1XCPA 2IXFA 5HR5A 3K0AB 3RS2A 1I2MA 3NC1C 4TMWA 4QBIA 2DWPA 1XFAA 1NMYA
chains in the Genus database with same CATH superfamily
4LRSA 3WE7A 2RGOA 1DL5A 3B5JA 3HKCA 4EG4A 1QRRA 3JQPA 1T9GR 1F8XA 2BWJA 1U28A 2WY2D 4RTJA 5NLLA 4IFBA 1IUNA 2JAWA 1E1RD 1Y5RA 1ULZA 4R84A 4YROA 1NX6A 3I2GA 1U6KA 3PPYA 3VVBA 2EVWX 3RB8A 4ALJA 4JL8A 5B1DA 1C3XA 5JVDA 3IG5A 2WAYA 5JAUA 2AXPA 5TIIA 5F2OA 3NT4A 4LGMA 3ZVKA 2OGTA 2DFKB 3NRBA 4NE7A 2VSQA 3MJ5A 3SJCA 2E4VA 1CHNA 4KQGA 4L2IA 3FKJA 5ALHA 2J0EA 5H81A 1Z0IA 2E5LB 2X8AA 5IYZB 2EGUA 1BDIA 4P7JA 4BVBA 4ND2A 2BBOA 5KTRA 3PTLA 1OYOA 3ICQB 3GV0A 4HRAA 3AR2A 1ILEA 1G3RA 2EW2A 1V8ZA 3PGLA 4RNDB 3UJCA 1BFKA 4RPCA 1QMGA 2EF1A 1VJCA 3D43A 1IXSA 2ZW9A 4KU4A 1NULA 4LYHA 5TV2A 2G1PA 2H52A 3I6ZA 3HZJA 3SS7X 1RM3A 4KN9S 4P4UA 4ZT4A 3ES9A 2HKIA 2BM9A 2XUGA 2IWHA 1E2DA 2I54A 2OAGA 2OZPA 1G64A 5IAGA 1ZL0A 1C0IA 4NAHA 4F6RB 3STYA 3TRHA 4JLBA 1E0DA 5K0CA 1UANA 1QFZA 3DZGA 3ZCPA 3BHMA 1UBGA 3MJCA 4LSGA 5L4LA 3L4EA 4NBTA 4OMFG 3OUTA 4LF9M 2JCBA 3CG4A 1JT2A 3OM1A 1J90A 2ZYSA 1C1DA 1BDMA 3AH8A 3RC1A 2XVYA 5AKXA 3KTAA 5TX7A 4YGXB 2XNDD 2ECOA 4LFBB 1V3VA 4N3AA 5LD2C 2PR2A 1MPXA 2WJ6A 1M2GA 1KAGA 5FCDA 4KSBA 4NZZA 1KVSA 3JQQA 1JKIA 1HXHA 4ZYWA 2Q21A 3NCHA 3OFKA 1ABBA 3PBKA 3C3XA 5D6OA 3QVKA 2QTLA 3C2QA 4L6AA 4BOYA 2FDXA 1YMUA 3FDIA 4GI5A 1GZHB 5EIBC 5B1HA 1YB4A 1BXGA 3BHJA 3VKFA 5IEBA 3C41J 2P9TA 1X1BA 4RF4A 2PGOA 4M0FA 4GPTA 1CQXA 1E69A 1W6RA 2RDMA 1RC8A 4RTMA 1HYGA 2NUPB 5A3QA 3U6KA 1XMQM 1A77A 2V6GA 3DM9B 5BSKA 2Q8PA 2H59A 4BNZA 5ICEA 1PP4A 4JS0A 4WZAE 3IPRA 4LRYA 1QORA 3TG8A 1WY5A 2DHQA 3ZJVA 2GBIA 3KQSA 5HKOA 1WGNA 1FA9A 1TTQB 3PXAA 4I14A 1XR3A 4FM9A 3R9XB 3EGXA 4C9BA 1Z2NX 3BDAA 4RWEA 1T3HA 1H3EA 3KQKA 4PAMA 3L7AA 5BR8B 3ZQJA 4UNNA 1XD9A 4AJ1A 1LZKA 3SMVA 1XZMA 2WD7B 2R5WA 2ZI5A 1T0BA 1CUVA 3GAZA 3S40A 2R0IA 2OQ2A 4YRNA 4AJLA 4WEQA 4Q21A 3ISTA 1GPBA 3C3YA 4WVLA 1OI2A 4HJRA 1Q95A 1DMRA 4KAJA 1XXHB 2QYSA 4A26A 4ISCA 2RHGB 4JNCA 1NI4B 4JK3A 3PJEA 4Z9XA 4TWAA 5DOVA 3H18A 4BIIA 1OYWA 1DWPA 4HCJA 2ZKLA 3GPCA 3C9PA 3P5SA 3QYEA 1E3MA 1QZZA 1ND6A 4U0JA 4BVFA 1O5TA 1G55A 2GNOA 2VDRB 1MO2A 2C78A 2F5OA 1AKWA 4B3RB 4PGAA 5EP3A 4GRIA 2QB5A 1F20A 1TO2E 3WL6A 3AIIA 4EITA 4YMUA 1S2OA 3GHYA 5JBQA 2RE8A 1K0FA 3G1WA 3KQQA 4JLNA 1TUEA 3TMAA 3HHPA 4J1NA 2P6NA 2VDNB 3ZUGA 2JHCA 4Q3AA 1OASA 3KUCA 3OM9A 4Z4CA 3K1YA 1LS6A 1E1KA 2W2TA 1A5BB 2WYUA 1DFHA 4TUYB 3J2PB 4MS4A 2R87A 2BH2A 1S1MA 3R3WA 2ZCJA 2ROQA 5KTOA 3SX4A 5FWXB 3IBTA 3OQNA 5FADA 4NOJA 4D8TA 2E6UX 1ZMUA 4ESVA 2Q5JA 2JUJA 1MG5A 3G0BA 1EYZA 2YMLA 2JD1A 4ZDKA 3OG9A 4N48A 4G3OA 3TR6A 1A9YA 2I80A 2R7LA 1L7RA 1GPNA 3DOHA 3S3TA 4QDOA 3AB7A 1PW7A 2O3QA 4MQFA 2O7SA 4FCWA 5JXIA 3FPHA 1L1RA 4HEJA 1N7JA 5CFQA 4WZ6A 3Q3CA 2DKNA 2WE8A 4MUKA 1J20A 3L1HA 5DRTA 4W63A 1BVSA 2PXHA 1C9JA 3F7OA 1AMOA 2Q50A 4YDRA 4X62M 1EP1B 4MV5A 3RAEC 3BB1A 5HXAA 2QU8A 4ZC8A 2C4HA 3E3MA 4C5CA 3FLEA 1EUDB 1KMMA 3DM5A 3N74A 4KOAA 3UJ7A 2I4MA 3BUSA 5KI6A 1I9GA 4RK5A 2XOKA 1DJPA 5BQOA 4POOA 1ZW1A 2AMYA 2N75A 1YKFA 3E4RA 1RBYA 2JASA 3MUFA 4CV0A 3TQCA 2EBFX 3LM8A 1UFOA 1WTCA 1L6RA 3NYWA 1UBFA 3ITKA 1N9ZA 3JAMA 2VBFA 1V95A 1PWHA 4NCNA 1N57A 1FFDA 1BVHA 4HVTA 5AK0A 1Z4OA 5JCPA 1Z6ZA 3EARA 1V3TA 2QTGA 2YXNA 4AQYM 4B6RA 2ZTVA 4A36A 1YBAA 2ECQA 1YS6A 2MSCB 1X0VA 2VCEA 2V1UA 1QKJA 4R8MA 1H9CA 2X8LA 1M73E 2VTBB 2H7YA 3ER9A 5E7IA 4XSGA 3VU0A 1RQ7A 5C8VA 1XRJA 1Z59A 4HGZA 3IT1A 2L09A 2X9LA 3U3ZA 3OO0A 2P1RA 5CNKA 1Q2XA 1QYDA 4RF1A 3EIHA 1X1SA 1VJRA 4MB7A 1X7DA 3M83A 1X6VA 4G67A 1MH1A 2W5UA 3WGLA 1W0KA 3P0FA 1HKHA 4URZR 1LFAA 1QM5A 1AZSC 1IM2A 1B93A 4QOFA 5HSGA 4PAQA 4WJZA 2EX1A 3K0BA 4ZAFA 1E7YA 4EI2A 3WQQA 3DFIA 4TXLA 3E03A 4RSHA 4M8LA 3ST7A 3F0TA 1EI9A 2X1LA 1QFSA 2EL9A 2A6PA 2GK6A 1CRZA 2F5SA 2AOWA 1YZUA 2IYNA 1AXRA 3M4YA 3HN7A 3ESZA 3WL8A 4R1TA 2VP4A 2VJNA 5ANRB 1DIRA 2UUPA 5BV2P 3I9MA 1RHKA 3ED5A 4NZNA 2DR3A 3QQPA 2Q3JA 3NP7A 2AD1A 3D6JA 2HZBA 4NBLA 1R8JA 3MM4A 3SEQA 2CSXA 4OLFA 5CIWA 1KI1A 1RKQA 3O1IC 3HKBA 1R3DA 3D1JA 5I8ZA 2ZRGA 4TV8F 2Y1OA 4R2MA 3ESRA 4JOBA 1Y8QB 4MV7A 3ZWWA 1W0JA 1ENOA 4LZWA 3O4FA 4MH0E 2AI3A 4ND1A 3GGPA 4IIBA 1E5XA 2GEKA 4JI3B 1E2EA 4X8HA 3T99A 3MMSA 2FPGA 3BB4A 3TLBA 3RVJA 1JNYA 2GYVA 2AR0A 1U2GC 1R74A 4QGAA 1F5NA 1OX4B 2AJLI 5KAPA 4HRXA 4OXKA 1XNRB 1TVMA 3C16C 1XB2A 4DDMA 3W2EA 4RD0A 2ERXA 3VU3A 2H2HA 1W4AA 2PGAA 4WK2B 3EDYA 4C0JA 1DBSA 3NIWA 4ZODA 1JHRA 3HB5X 5GONF 4NESA 3BD8A 3HXLA 3QX3A 5FP0A 2EFJA 4JOCA 2XNHA 2VPXA 2OKCA 4BFVA 1RJ9B 2QVGA 4UNPA 5ERGB 2IH5A 4NX2A 1KTIA 3IJRA 2DFVA 1GNSA 2AUTA 4FVTA 1BQEA 4TYNA 2C03A 4ZVQA 5D7BA 4H0FA 3I5MA 4IUBS 1YB7A 1D0KA 5ALQA 1MRNA 3KVNA 4X6YA 4EHBA 2WKRA 1CS0A 2CYCA 3A27A 1TT5A 3LNCA 5FT9A 5B6PA 1VPLA 4YO7A 5CB4F 1BDJA 3E0XA 5ENDA 1P4HA 4B6OA 1RI1A 3FOFC 3UWOA 1C1YA 3X1YA 2A30A 1Z5UA 2QV7A 4FZRA 3RU3A 5CDGA 4CQLA 3D0OA 3ICPA 2H1LA 5FYDA 3DHVA 1Y33E 4OX9B 4FN4A 2PK3A 4IHKA 2XWQA 2R25B 3GYGA 4YC7A 4JQCA 2HF8A 4R1SA 3MTEA 2UUAB 1WUIS 2P5SA 4ONEA 5LXTF 3R44A 1JQ5A 1DAOA 2G9UA 4HS4A 4JV5M 2NM0A 1QAOA 4MYCA 4HAOA 4EYOA 5BSTA 3IBSA 5HM6A 2OV6A 3GOQA 1K7XB 1SIOA 3HDQA 1OGIA 2VUHB 4UFNA 3GJSA 1YR8A 3AL3A 4I5IA 4D8XA 4H6XA 1UBTS 3EOAI 4D6YA 5DI3B 3DMFA 2W82A 2COEA 4CG2A 1C9MA 1QE5A 3L1KA 1QGAA 4M98A 2PTGA 4AP6A 2FY8A 2JY8A 1M1XB 1UF9A 3UAWA 4X6UA 2X9GA 2OO9A 2OV3A 4I5GA 2Z30A 4JA2A 4HAVA 4B3SM 2PS0A 2RMKA 1ICEA 4P2GA 1QUTA 3DO6A 4DA8A 2CHEA 3JYQA 2OHJA 4OYLA 2QR5A 4H15A 3WYAA 3LRTA 5I7OA 4JI5M 5BQXA 2HNAA 2Z5VA 2CW5A 3AM4A 1GGKA 3WL5A 4MVWA 1K2VN 4Z7OB 2EG9A 2YWXA 1U3UA 2OXTA 4JLAA 4XWOA 1AB5A 4J0EA 4EIWA 2ZRIA 4EA8A 5KTMA 2HHLA 3X1DA 7CATA 4HB3A 1IFXA 2H1VA 1LTQA 2BFWA 3KSZO 4C4RA 1Z22A 2PKRA 4GDMA 2HMSA 1XEWX 4QDZA 3ORRA 1P91A 3IAUA 3OJCA 4LMPA 4IHJB 1NQAO 2VUIB 4B7FA 4MB2A 2QUBA 2WU1A 5A9TA 2GJ4A 1EP3B 5BUQA 1BMDA 4B3XA 3IP6A 4N3BA 1EM8A 3ZU6A 3CR8A 3FBTA 4RA9B 5L7YA 4YXWA 4CCSA 3KQWA 1W5TA 3PYMA 2CUKA 4MQ5A 4JXXA 1L2BA 1E5LA 1L6IA 4IZHA 3K2BA 2DM6A 1NPTO 4MQBA 4WASA 2LTAA 4GITA 4LDRA 5I3ZA 3WZMA 1DXQA 3SBXA 3GLFE 3MLEA 4CKZA 1GU1A 4LJ9A 1JALA 1UP6A 3U40A 3UF0A 4X66B 2QT0A 5AXAA 3SYKA 1C7IA 3O8BA 3W6ZA 5KX5B 3RBXA 4ZJUA 4YAFA 2KJQA 4H4DA 2PX3A 3AR6A 1UK8A 4PPGA 4UFOA 2HT6A 1JNXX 3KQVA 5HRCA 1CFZA 2XMQA 5AICA 3L41A 1DP4A 4A16A 3JTEA 4DRXA 5A3VA 1PZMA 4ZIRA 2XCIA 4OTZA 2VL7A 3HXPA 2QG6A 3IDOA 3CUEF 2R6CA 2B1RA 3OIDA 1SVIA 1NW7A 4JT8A 2UUBM 3Q7RA 3RC9A 2WIFA 1P3Y1 1LDYA 2VDOB 2G5CA 2DHRA 2DPHA 4KAFA 3GJXC 4XB2A 4ZPXA 1UODA 2OV1A 3A58B 5AO9A 3THOA 2YV4A 3U7QB 5JH7A 1T2DA 3OCYA 3H3JA 3KEGA 5TXGA 4ZAZA 3C8DA 4Q4HB 2ZTDA 4E2WA 5BYJA 4EJSA 2QM8A 4P81A 2FW6A 1PEAA 3EH2A 1IN1A 2BYTA 2YUIA 4FX2A 3HS3A 1K7CA 5EWLB 1GEEA 5ALSA 5BNWA 4I5FA 4MX8A 3R7AA 3U49A 1KK3A 5G40A 1DRWA 2LRHA 4IVQA 1AN9A 4P4LA 4PQGA 4HADA 2MSDB 2V7GA 3QHPA 3B1ZA 2BEUA 5LA6B 4DMFA 1GN9A 2IUYA 2HN9A 3CPSA 5CUQA 1OJ7A 2OHOA 4M0LA 4WESB 3LZDA 4YP5A 2QXTA 2F8TA 2QJTA 4MRPA 2NP7A 3UATA 3DCIA 1VPTA 3GO8A 3U61A 2IW3A 1KMHA 3KKKA 3ZW7A 3SX0A 4CEIA 1GV0A 4KW7A 3C6ZA 3D8HA 1PDOA 1JG7A 3M2TA 1WOMA 1UZAA 4B6JA 1IIRA 1QC5A 2G70A 1C2TA 3T4UA 2I3DA 1Y8ZA 2AF4C 3E9ZA 4CTJA 2FPSA 4UD2A 1JUDA 5A6VA 5TEVA 4E09A 3RRBA 4B4OA 4D25A 3DOFA 2GILA 3H5NA 2P1ZA 2C7BA 2EDCA 4X3OA 4G4OA 5AVTA 3SEFA 2QYHA 3MWFA 1TDHA 3FA2A 4L57A 1IWOA 3EC2A 4BEWA 3K6SA 4C7OB 4CLOA 4U00A 4A8HA 2A14A 3KQTA 1XTTA 1ZKDA 4GR9A 4CIWA 3FYUB 4KWTA 4DIOA 3W3AD 2XUIA 3IX7A 4E70A 3KD3A 5FI0B 3GLHE 5ALVA 1TIKA 2R7AA 5EJ7A 1DGHB 2AHRA 1JTFA 3RUDA 4PZEA 2TMGA 5CB0A 5DM70 5MN6A 5I7SA 2GD6A 5E9AA 1XHBA 3WWEA 1U2ZA 5JECA 4QREA 4DQDA 3BRWA 2B99A 1Y6GA 1A97A 3DP7A 4A0FA 1R0SA 3QHQA 1MX9A 3ZGLA 4E5UA 2K6BA 4BUCA 2JXNA 3NTXA 2B34A 4OU5A 2FJ0A 4NU6A 1EWKA 1W8DA 2UUOA 2VQSA 1C3OA 4FBLA 3NT2A 4JYBA 4L4YA 1SUEA 2D0IA 1KQ3A 4K28A 2EV9A 2AYXA 4RENA 4ZYZA 1HPLA 3U7EB 3J7AS 3RFUA 3UBMA 3H9JA 2VZ0A 4H1UA 1NMSA 4BMPB 4P17A 2VC2B 4DMKA 3NFRA 5AI8A 2VDWB 4UAJA 3SVTA 3N1UA 1JQ3A 4OMUA 1GYPA 1QCZA 1SC1A 4PWZA 4GC9A 3R74A 1FDVA 2W6OA 1H0HA 1DKNA 5JAZA 5THQA 5GOZA 4UHDA 1HTWA 1X9IA 1F6BA 5CVDA 1EK6A 4GI2A 1BXRA 2F7SA 3IAM1 2D5CA 4MQUA 1NFQA 3FYDA 3MIZA 4GF5A 4RDXA 2W70A 5JHGB 3ZE9A 1RQRA 3ZE8A 3LBYA 4RQAA 2JDIA 2R1UA 5DBFA 4RPIA 2JGJA 4BS9A 1XFAA 4L7VA 2L7HA 1CNMA 3K9WA 3TNFA 5A1JA 3RYIB 4H7FA 4WHMA 4Q39A 4QOJA 1O2DA 2WT9A 3DDUA 2H2IA 2GHQA 1EFRA 4RDHA 1IZYA 2JIDA 4Z7QB 5AM1A 5D5QA 4ITRC 3PR2B 1ATZA 1R2ZA 2XRZA 1MJNA 4KIGA 4IIDA 4O2AF 4I5DA 1U0EA 5KEIA 3NO4A 2W7TA 2NU9A 1UL1X 4EUFA 4X85A 2XHEA 821PA 1MN3A 1XYGA 4YHBA 2XKJE 5I4CA 4LXIA 2XW6A 3T95A 5IWCA 1X1AA 4UE6A 5JNRA 2X3FA 3DEHA 2O3TA 4G2NA 2VQFB 3GA7A 1O94D 1ZNQO 3TLEA 1A1SA 4LNAA 4UUAA 1DX4A 2FAXA 3OEHD 2X22A 3O21A 4QBTA 2Q4RA 5CVTA 1JZSA 1P18A 2XMDA 4WI1A 1DBIA 4QUAA 1WDMA 1C80A 4KVFA 2IELA 4CN9A 1D1QA 3AW8A 1Y7LA 3JWIA 1XJ0A 2D1QA 1JG2A 1G8GA 1RZUA 2X0JA 3FUTA 4E7OA 1Q92A 1Z33A 4I36A 2G5PA 1OIVA 1Y3HA 1NGSA 1ZJJA 4FWTA 3L8ZA 3C8HA 4OD0A 2HTFA 4XCXA 4EKEA 3U2QA 4L51A 3M81A 4DR2M 2CZQA 5CCBA 3SVLA 4TYMA 2FSPA 5DTMA 1M8PA 4WKBA 1TCVA 4N41A 3ZY2A 2V9ZA 3KVRA 1M7GA 1Q22A 3C45A 1ZUNB 2DHCA 3U44B 4IV8A 2C2ZA 3UHFA 4Z4GA 1A82A 3EGEA 5FOTA 3IUYA 3SEAA 1ECCA 2ID9A 2O54A 2QUAA 1K5GA 4ZMSA 4ZAYA 2NSDA 1DRUA 4FDUA 4B79A 3HTXA 1S2MA 1E66A 3A25A 4KC0A 2ZS8A 3NVAA 2BP7A 1XQ1A 5C4MA 3TUIC 1CK4A 1Y8RB 3ZKAA 1X14A 1DGGA 4EKGA 1F0YA 3OE5A 5KKAA 4B85A 1QH8A 1L1ZA 3IOCA 1UMKA 2XLCA 1NW4A 2E21A 2GK4A 3OETA 3HSYA 4YBRA 5EWJB 4Z9YA 1TE2A 2YXBA 3ZE6A 4NOOB 1KSJA 4PHFA 3N2LA 3ZDBA 3KJEA 2ZJ0A 1CS4C 4PFQA 4AICA 1HZZA 5FPHA 1WVMA 1XMIA 2ZI9A 4QDJA 1AGRA 2E5LM 1N0WA 1C4KA 5JCJA 4IFTA 1TCUA 4CHTA 4L9AA 4F71A 5DYNA 4LPSA 1EPUA 1SY7A 3TR0A 2DPLA 1EE1A 1Y3CE 3RBZA 2C3PA 5B57C 3IAS1 3QY9A 1SUCA 4UPEA 5C7IO 2PXXA 4GEWA 4KYTA 1E2MA 3LL7A 2J31A 3KXDA 1MB4A 3EXFB 4HUTA 4CCYA 4X63A 3ZDFA 3TQFA 5AH0A 2LGJA 1CJVC 2PT7A 1ESDA 2WHPB 3L6UA 2QTTA 4EATA 4QAJA 4PBRA 4H1HA 1RQPA 4QTYA 3TXXA 3AJRA 3R24A 4IICA 1ULTA 3K09A 1CP2A 3CF4A 1A4IA 5FL3A 5CA0A 3SSMA 4CM9A 1AD2A 4HD8A 2IUSA 2POQX 4ZI7F 3KUXA 4R1LA 2MJLA 3ZCRA 3TNYA 1H6UA 2XIJA 1KNXA 4QXMA 5A7GA 2PJUA 2Y27A 4IOLA 4P82A 1PR4A 1TJ5A 1HORA 3WNQA 1U8FO 2UVQA 4EW2A 4YV1A 3DO8A 3D64A 1MA3A 1VIAA 3AERB 3W77A 1VYHA 3F3SA 1SC9A 5A9SA 2UVPA 2IA5A 4JBGA 4Y6OA 1NNLA 2PX5A 2C7QA 5ISMA 2VLIA 2Q2QA 5JD4A 2IEAA 3AIKA 4V2UA 1ZPDA 1FQKA 4DMUB 5EUCA 3R7WA 1OFVA 1CEEA 4LTDA 3LKZA 4CNBA 4X91A 1E0KA 2OPFA 4GPD1 3KCNA 1G59A 1YZKA 5HJEA 3RYHB 4G0PA 1LRKA 2Y66A 2WFLA 4BMVA 4HAUA 3EXG1 2XKKA 3FD8A 2ZXFA 4JJZA 5IT5A 2ZDGA 4F4UA 4IGAA 3RU9A 1IBLM 4DNXA 3A4TA 1H65A 3R0JA 4IFIA 1V6CA 4HDQB 3TN7A 1KO5A 4FGSA 2XDQA 4EG6A 3ZHXA 1E2HA 4NYJR 2EFCB 5K4GA 1JJBA 1NVFA 1RKUA 4Q37A 1U2PA 1Y9EA 4W7HA 4G6ZA 4BKPA 1DDOA 2TMKA 2W2QA 1NVAA 3KXPA 3KP1E 2EQAA 4AROA 1YONA 4NTZA 2QX7A 3IXQA 3ETDA 5I7FA 3BG5A 3DOJA 3TPCA 2JGDA 3CEAA 4CL3A 4GKKB 1F8UA 4FEGA 4DCJA 1KR5A 2IYWA 3BFPA 3WBKA 3N2ZB 2DAMA 4U2KA 4OFWA 1BJTA 2DC1A 2ST1A 2JIZD 4M38A 1NXQA 2H2AA 2QRJA 3UGQA 4CTNA 4U5QA 5ILQA 4BY9E 2ZJFA 3VYVA 5DHTA 5JSQA 4MYHA 4XIFA 3R9IA 3SC2A 1BU5A 2ZCUA 4IYRA 1XZPA 3OOEA 5CLJA 2NV0A 4XOUA 4MKHA 2PX8A 4C2AA 2H06A 3ZC3A 2B8TA 3FNQA 1J4AA 2JFPA 2HGZA 2WR8A 4O4HF 2PUWA 4BP9A 3H99A 4DR3B 2IV7A 2PGXA 1G20A 1VCHA 2EUCA 1J8YF 1XIVA 2ONJA 1FJXA 1WDTA 2GPJA 1KF0A 4HP8A 3AESB 1Z25A 4TTJA 3RYCA 1V5EA 4N01A 3HYTA 1L2TA 3VZBA 4EG5A 4J0HA 1IZ0A 2Z83A 3KQUA 1D6JA 3IKMB 5FPQA 1M6NA 1AO3A 3EXAA 5AI4A 3UAZA 1WULS 5E9JA 3JASB 3ULKA 4E1BA 2CL0X 2UYQA 4W5WA 4ARZB 4MRVA 4PAWA 4DFDA 3BA6A 1X1CA 1HQDA 2QD4A 1SCQA 3KLMX 2EYUA 5CT9A 1DXYA 2CKDA 5AUPB 2IL1A 4X45A 1L5HA 3AVWA 3QPUA 5ICCA 4DYDA 5CBPB 4EYKA 2FW0A 2OOBA 5LBTA 3VX4A 1DPFA 3OOYA 1KEEB 3GLFB 1WXEA 3PXXA 3UW3A 2W9XA 4J6EA 2ENWA 3PX3A 3CF2A 5FTWA 1PNVA 2BGUA 3AW9A 4RH1A 3C3CA 1U2RA 2CLMB 2FZLA 1PD0A 1EZ1A 3U31A 4CLRA 1EUZA 4EFMA 3E7WA 1KARA 1SXJA 3KWMA 4AY4A 5DNDA 1LBHA 3GNTA 1P0FA 4M8SA 2W8BA 1TLLA 2Y71A 2GHTA 3HO8A 3EIWA 5SZJA 4DADA 3A6PC 3TZCA 1WOYA 1ECBA 4ALLA 4IJ5A 5AJZA 4RBNA 4E2ZA 4Q3LA 1SXGA 2F3TA 4TZ0A 4FHDA 5FLKA 4PZZA 4ASUD 5FORA 1XTRA 3EUAA 3E21A 2DTXA 4C4ZA 1W2HA 4PQYA 4G9GA 4B33A 4YECA 2YNMD 5L45A 4D80A 2AQKA 4JUBA 5AKHA 2WSBA 2GBLC 1NLUA 2C99A 1E60A 2WILA 5JAIA 1MN6A 3M4NA 2ONKA 4XVQA 3DAFA 5JW6A 1FLVA 3N28A 4B9AA 3CF4G 2IHUA 3OZSA 3MJEA 4INAA 1NI3A 4ES6A 1TB4A 3LUBA 4WQMA 4B40A 1HC7A 1WBBA 1RDFA 2G09A 4BLPA 2IXEA 4CKEA 3KYBA 2GNPA 5CP8A 1B8UA 2Q7OE 1RU3A 3KKEA 3FAKA 3N76A 1QIGA 2AG0A 2OXIA 1XELA 3KOWA 2DWZB 1QLWA 4Z3OA 1VG5A 4NYJQ 4CGZA 4BB0A 2BE7A 2FPKA 2W43A 2V98A 1YMQA 5K0ZA 1HT3A 3E9YA 7ABPA 3FPBA 2XE7A 4B73A 3L8YA 4RVSA 1O54A 2ZYVX 4Y0VA 1Y9DA 2BKVA 4MB6A 3K1JA 3T15A 5DP1A 2Q3HA 3JVUA 4Y2XA 1P31A 3AUYA 5K0EA 1PGYA 1C2YA 2Y0DA 4IEFB 4EB6B 5D51S 3E9DA 2DQ4A 5K4HA 1XLTA 2HO4A 4G84A 5AXCA 4S12A 5DK6A 3SXUA 3II6X 3HCRA 5F5LA 3AIOA 4KYVA 2JAUA 3I2HA 2J87A 3MQFA 1CUKA 2Q3LA 4OYRA 3VZQA 2GVDC 4NYIR 1FP6A 5TQ2A 4EARA 1AA9A 3FUXA 1IBRA 2A9OA 1N4AA 2Q2EB 2C2HA 5LP6B 3GLHB 4B3GA 3KWLA 2G4LA 2QG9A 4J0CA 5DNYA 1JYSA 1BG6A 3AG6A 3K6RA 1YZYA 1T9CA 2WSSD 2NPFA 1CZUA 4CL2A 3ZVRA 2C0CA 4B3IA 1THMA 4NRWA 4GC5A 4OM7A 3WLQA 3HBNA 5C31A 4RKYA 2W4IA 1KOFA 1C8KA 2EKBA 5ALYA 1KC1A 2CXOA 3O84A 3I3SR 2COUA 3O2QB 4EUNA 1Y1SA 3WWOA 5IZ7D 1I6LA 1RLJA 4UHKA 2HJ9A 2ERYA 4DQVA 3BULA 2LXEA 3WQRA 4W1SA 1T36B 3ONNA 2IDKA 4BP1A 4QHTA 1R5JA 3GPUA 2DJIA 1JSRA 1MOZA 1IJKA 5KTTA 4CIVA 4DB2A 5D85A 4OI0A 4U2CA 4I8DA 1HE1C 1TZJA 2X6RA 3LLVA 3MQ2A 4WXRA 3QWLA 1HE8B 3OCVA 3AYXB 4LQDA 1SVKA 3LUAA 4H4EA 1OAOC 4DC9A 1S6YA 5KYXA 3G9TA 1ZC3A 4C0HA 4X94A 3Q4GA 5CTJA 3FRHA 5AHKA 4C21A 2BGLA 1E8NA 2ZIGA 3PE3A 1OXUA 2IHZA 5B1EA 4L5CA 5KYYA 4I3FA 1BQ4A 4L95C 4Q01A 3TFWA 1T8WA 5LB2A 1HTBA 2FMUA 4OX9M 2COKA 1N5RA 5CX1A 4I50B 1PFWA 5FUMA 4MROA 4RZ2A 3VR5A 2ZSEA 4DIBA 1B73A 5E9WA 4BTLA 1EVQA 2EJUA 3MB5A 2RHWA 3VC2A 1LDMA 3J27B 2WZBA 3AETA 4JC8A 3T5CA 5I4IA 4DAEA 3IUPA 1J8QA 2FRVA 3ZQ6A 1LI5A 1F2TA 3N58A 1BC5A 5JXWA 2I2FA 1RXWA 3GN1A 3OKAA 3HV0A 2Q2VA 5I9LA 4N0EA 1BJKA 3AHHA 3OLZA 4QOHA 4YT2A 2YZKA 2QM7A 4DGQA 3S1AB 4B08A 4J7UA 1G7RA 5EYPB 2DMRA 3G2PA 3K9NA 1PR9A 3VSBA 3TQQA 1X8LA 2EWWA 3DVLA 4WKNA 2VYVA 3V1KA 3QFHA 4ZRDA 3B38A 4O08A 4ZOLF 4NKRA 2IIBA 1KZ1A 3NTOA 4GX2A 5BWMA 2MU1A 5D8DA 4DLLA 3V4FA 2DY1A 2OHFA 4FHZA 2I65A 3JSXA 3BMXA 1LC0A 1WEKA 3A70A 4YIHA 4JVMA 4LZLA 2REQB 2BGWA 4RXUA 3EDRA 2IYEA 1ZA2A 1HE3A 4LG1A 4KNVA 5J4VA 1L4KA 2Y0QA 4R40A 1MOQA 3N8IA 4BMXA 1E3LA 1NJ6A 4U1RA 5A4IS 3GARA 1U3FA 3U9TA 2C4VA 3V34A 3RH0A 2IDJA 2HIGA 3K20A 2QN2A 2BGIA 1PSWA 1QUEA 1NRJB 1TMOA 2AFHE 4ARSA 4TSFD 4G0NA 4PWYA 5A3RA 4ZK6A 5CURA 1E9VA 3UK7A 4B83A 4E5VA 2IZZA 3D4NA 4IBCA 3AFNA 4MLCA 4MLPA 2I0FA 2Z6QA 3UTCA 2OOSA 4YAKA 1UDBA 3COWA 3HI4A 3LECA 1R10A 3ZWDA 4ZO8A 1PZNA 3U9SA 1QCCA 2OGUA 1XZJA 2EQBA 1SXPA 3WIDA 2XMZA 1QK5A 3DEKA 3OSZA 4X66M 1RFGE 4NYIQ 4MGIR 4HMPA 3BWYA 3RJZA 3WJAA 1S2NA 5DNVA 3NC4A 2OB1A 3AEQA 4QRIA 5JC8A 2AG1A 2D7JA 3A1FA 3UJPA 4Z0PA 2GERA 4IIUA 4EHNA 4KYIB 4C2TA 2BFFB 3NUZA 4UOQA 4NHEA 1PX0A 4FXPA 3RUHA 3TFQA 4KWEA 5HKKA 1NG9A 1X7ZA 2JNHA 1PR5A 3LPAA 3TSOA 1R15A 1I7LA 3CNLA 1KC3A 5C7OO 3T5GA 3DEYX 1NQUA 3GDWA 5HDBB 3KQNA 4LWZA 4TTTS 5LYJB 4AY6A 4A2WA 2PY6A 5DZSA 2C8VA 2NVUB 2RHLA 3GR6A 4LY6A 1XVUA 4OIFA 3FCXA 1KAEA 5F7JA 2NPOA 5ITZB 3W5AA 2B4YA 2WWIA 1A7JA 1ZH6A 3PHJA 3BBZA 3KVOA 1Z7BA 1O94C 1E9RA 5JXGA 5B4VA 5J5VA 3UO8B 4NC6A 3GMIA 3CRZA 5AJYA 1YWGO 3FWKA 4IDCA 3RTCA 1N3IA 3EC1A 5DWQA 3EDMA 4RKQA 1IQUA 1S4MA 3G9ZA 3T3DA 5AKIA 1NJFA 4PXAA 4XYLA 4JHXA 1AKRA 1RE1A 2JLVA 1QGDA 3A6KA 1SD2A 2DHEA 3SK0A 1M8JA 1I5EA 3RVDA 3CLTC 5E4FA 1U98A 1GFWA 3OTGA 3ZV4A 5AXBA 1RC0A 5KNCA 4JYPA 4Y3UA 3G89A 3ETEA 3RYTC 4HGPA 1WIVA 1JJ7A 3C3PA 3TKLA 2XB6A 4KO8A 1PEYA 4AMYA 1B3BA 1X7GA 1N1GA 2B78A 4EJFA 4FN5A 3HBMA 2QNJA 2HUPA 4F2HA 1HM5A 3VSAA 4PC3A 4G5OA 3TLGB 5FWNA 3VPXA 2IXFA 1TLFA 1JHDA 5A4KA 1QP4A 4LYGA 4QSMA 2HUNA 3EW9A 2XEXA 4ZO4A 4RS3A 1E7MA 3N2IA 4OYHA 4C78A 4XIIA 3THWB 4CMAA 3R4VA 2ID8A 3H5AA 2GD0A 3B36A 1X1QA 1MGPA 3SIPA 3BERA 1R5BA 3OAAD 1Z39A 4LVOA 2JLXA 1GABA 3NOQA 1RJEA 2H57A 1ZW6A 1EFPA 3A46A 5DLDA 1TKBA 3HNRA 3ZJ5A 2HJHA 2G25A 2PQ2A 1L1FA 1E2FA 4O2RA 3Q0TA 4QGHA 4BNXA 2ACWA 2DAGA 4Q7EA 6AT1A 2DWMA 1CDEA 3LUPA 3THYA 2PMFA 2FU5C 3O8RA 1UJ5A 3OJEA 5KC9A 3RFFA 4FIDA 4J03A 4D9FA 2BTOA 4GQIA 2OCBA 5AK6A 4Y6RA 3BXPA 4WOPA 4N82A 3DMNA 2O2DA 1R4AA 4CMCA 1A9RA 4UU0A 4NMMA 2GF9A 1QIJA 1KEVA 2FRDA 1ZJ5A 2ZT6A 4KZKA 4E11A 1T4MA 1F7VA 3GAFA 2FR8C 2CP8A 4PCVA 1GUFA 4XAQA 3S5UA 4ZU1X 2MYNA 4LSWA 4HS9A 1A96A 4MZDA 1QF9A 1Z0KA 3CVJA 4ZDWA 4QOGA 2R6AA 2GTPA 5K20A 3FOBA 3FVWA 5GP1A 5EOVA 2PUHA 1WPQA 4RSMA 4AIIA 3MBOA 2AE2A 5CNMA 4GH5A 1L3IA 1Z4QA 2PZBA 4FI3C 4LAFA 3PEFA 1XV5A 3GW8A 5HW0A 3RVSA 4JEHA 1NXSA 1NUSA 2PUAA 1TO6A 5JPIA 4EJMA 1VSBA 1QBKC 4FW9A 4I66A 4EGQA 3GGOA 3TIGA 3C70A 4NBUA 1BCSA 3BWMA 3ECCA 3A4VA 4RTKA 3LPLA 3EEIA 3CBGA 4MVJA 1YZLA 3HZRA 1IEQA 2V7XA 2A84A 4J75A 2QPOA 1ZD9A 1E61A 3RWBA 5JZMA 1GCAA 3C39A 4OH7A 1OA1A 1XF1A 2GSDA 1TUBB 1U8UA 3H5IA 4G07A 3FTPA 3ANMA 3D2BA 1PR1A 3PQDA 5IDVA 4LV8B 3FPCA 1QHEA 5UKDA 3ICEA 1UQRA 3R5FA 4ZAWA 5AYVA 2CXNA 3CRQA 5JZ9A 1B76A 4B48A 4NNPA 5CJ2A 2QJOA 2ZJYA 4GNKA 3V80A 2H5JA 2BJVA 1CE8B 1VIYA 2YW2A 3B48A 3URMA 1EUYA 1NFRA 3VR1A 4EY8A 3VR4A 1FMFA 4Q7LA 4KH0A 5JFTA 3CNHA 3HCOA 1Q0UA 2VQ3A 3P9CA 1CZHA 1QHHA 4CV3A 5AVRA 1KYWA 2A35A 4IQ4A 4X93A 2D0PB 3O74A 3KSAC 1MU0A 1ZK1A 1UFZA 2G4VA 1WQ3A 4DV3M 4KACA 1GPMA 3EQZA 2ZUBA 3VNQA 4JOSA 2CLLB 2NZ2A 2F3UA 2HRCA 4BWFB 1XKQA 3MJSA 2Y76A 3FKSA 3HPQA 4AS2A 1MAAA 1XWFA 3HLYA 1EQAA 3GRPA 4W99A 4NCAA 1Y0BA 1XQWA 5EJFA 1B0UA 3BX1A 4UNSA 2QOEA 3HJRA 1SM4A 4Q66C 4V0LA 3IPYA 4ZN6A 3VUEA 1HKUA 3HFJA 3T7KA 5E1DA 3OZVA 4URUR 3W2HA 4C7KA 2E6KA 3GPBA 3T7CA 4HGNA 1QQ6A 3B2NA 4TL8A 1D0SA 3RRJA 3WK8A 4TQGA 4XR9A 3UM9A 4HG2A 4GEGA 5ITUA 5BT8A 1NSFA 2DZOB 2H1RA 4H3SA 3O8DA 3SE0A 2ZBVA 5L8RF 3DCYA 4UCFA 1DAEA 1G6OA 4F04A 4MRRA 2LIPA 3CTPA 1VZ2A 4UPDA 1CEXA 4AO7A 5HCNA 5HF6A 1SKUA 4KQJA 3I52A 4OKNA