1NSFA

D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
247
Chain Sequence
KPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Protein transport
molecule keywords N-ETHYLMALEIMIDE SENSITIVE FACTOR
total genus 84
structure length 247
sequence length 247
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nsfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nsfA01
1QHHB 4YC7A 1VKJA 1NKTA 1G17A 3VR1A 2G9NA 2IA5A 4ZCLA 5K8UA 5JWOA 4LYFA 4UNPA 5IF9A 1YZNA 1T8TA 1II9A 2CBZA 4D26A 4HATA 4FN5A 5K8TA 1E1RD 2XTZA 2H16A 2BDTA 4URWR 1E2QA 2IYRA 2P6UA 3P4XA 3LDAA 4CEHB 4CRWB 2J46A 4EQ6B 4G5OA 4DLRA 3DM5A 3K70C 3FYHA 5FBVB 4M0LA 4JLOA 5JZVA 3R8CA 2JLYA 3CPJB 2IYZA 5H68A 4AK9A 4M1MA 1EWQA 2VHTA 2OXRA 2ZPTX 4W5WA 4C7OB 4EPWA 4KSCA 1PLKA 3TSWA 1W7AA 5B64A 1KSJA 4L9SA 2VBCA 1NN0A 1XD2B 1E9RA 3AKEA 1WBBA 4FW9A 2OG2A 1NLYA 2XSZD 4KBGA 2F9LA 4D81A 3HYTA 3A58B 5K8IA 4I1VA 4NYIQ 1G6OA 4LHXA 2RH5A 1WRBA 1W46A 4Z1MA 1KI2A 1N0VC 1HURA 2QPOA 3FWYA 4A0GA 4M4SA 1GILA 1WDTA 1ZIOA 4F4IA 2GXUA 2GCOA 2J7KA 2IXEA 1YR8A 4A92A 1NG1A 3RSOA 5JEDA 2JLWA 4MRRA 3ADBA 4YLGA 2O8FB 4P0TA 5L3SA 4G01B 2O8BB 2Q6TA 3V4RA 2O5VA 2DVWB 4C0SA 3KKOA 5B30A 5J4LA 2VSOA 2DYKA 1E9EA 4B75A 5IHPA 2IW3A 2ZI4A 3U7EB 4EPYA 1NRJB 2FX3A 3E70C 4KYIB 3U4QA 4LC1A 2WKPA 2OAQ1 3PVSA 3EG5A 2YYZA 3A6PC 4IFEA 2QBYA 4DHEA 3VHLB 1N5IA 4EJSB 5EE0A 5FBQB 1KMHA 1G5RA 1XEFA 3AUXA 1CJKC 3D3QA 2CLCX 3QEOA 3WRXC 4WZAE 3IEVA 4AYWA 3THYA 2J0SA 3HDTA 4B73A 1G5PA 5DI3B 3NBFA 4K8OA 3OEHA 1CULC 4PPNA 5UKDA 3L8YA 4H9GA 4OI4A 2PBRA 4PO8A 4RVCA 3K9GA 1N2CE 1GRNA 2X19A 5FH9A 3IBGA 3FPAA 2GA8A 1F48A 1UEJA 1UKEA 3FMFA 1OH5A 3AP3A 2GBLA 1Z3IX 5D3MA 4XIGS 4JJZA 1VHTA 4KITB 5LD2C 3MG9A 3WNBA 3FTQA 2EQBA 4OKSA 4A3VB 4DC9A 2FGJA 4BFWA 5HPYB 1IJEA 1AS0A 4HAZA 1F2UB 3M4YA 4H1UA 3T1QA 4ZDJA 3AF0A 1M74A 4EUNA 1XTSA 5EP3A 2XEXA 1W4AA 2RCNA 4LPKA 3MAAC 3B7GA 4HAUA 4J0QA 1F5NA 1G3QA 1E4YA 2GF0A 1ZCBA 3DO6A 4P31A 2IX3A 1SHKA 1VCIA 2AN9A 4PSAA 1K5DA 1Q21A 4M1WA 3WP1B 4C0QC 1X6VA 2V7QA 3BFKA 2A78A 1X1RA 5CK4A 1UPTA 4YMWA 2VA8A 1KTVA 4Q4AA 4TQUS 4D6PA 5A4JA 3OIVA 2BM0A 4O25A 3LD9A 4JLJA 2GVDC 1HA3A 4A0RA 3KQUA 1E2KA 4BLOA 1ZINA 4ZV4A 4B48A 4BFZA 4B74A 1U8ZA 2RGAA 5HZKA 4GDFA 1GP2A 2VP9A 3BB4A 3IO3A 3KDSE 4DRZA 2C9YA 4FMDB 5C1BA 4QGAA 4FCTA 2YWEA 4PPFA 4WA7A 4Q4HA 1KO5A 1OFTA 1OFUX 3AV0B 4ZO4A 1CR0A 4WOPA 3TRFA 3THXB 2XXAB 3LX5A 3NDPA 1E2EA 3FKSD 1FQJA 2YNMA 4BEJA 2WIBA 4Q4JA 1SVLA 3GLGE 3IQWA 3SI7A 2R6CA 2GJSA 5AUQA 2NMVA 1A2BA 4WZBE 5J47A 5FBLB 5G41A 3UG6A 4NCIA 1CBUA 2O8EB 4PHFA 3T1TA 2FFAA 2TMKA 1N5LA 3WYGA 3NBXX 4L8GA 2DFNA 4GPTA 5F3WB 4ZI3A 1AKYA 2V7QD 5JS8A 1P9NA 1O87A 1DADA 2WPDD 1KK2A 2J59A 2UZ3A 4G1UC 3ZDQA 4O3MA 2PX3A 1X1SA 2RHMA 5LBIA 5C18A 3BRWD 4GNKA 4NCKA 4URYR 3GLFB 2QORA 3LW7A 1UM8A 1W2HA 4LJ9A 2HDNB 4FMCF 4HLUA 4V0LA 4HB2A 3AKYA 2O8EA 3B1WA 1NF3A 1UJ2A 3PCRB 4II7A 5CIQA 4QNRA 3KTAB 2PT7A 5JSZA 4RJLA 3L0IB 4RFSA 4D4LA 4DCSA 4B33A 4HAYA 2CEAA 3NBYC 4IW3B 1FX0A 1KI4A 2WTUA 2AK3A 3TKLA 4EFMA 1Z6TA 4AWXA 2BIFA 2VHUA 4NDZA 4TLEA 2AKAB 1XCGB 2CHQA 4DDUA 3RABA 3DHWC 2C04A 1XX6A 3KB1A 2O0JA 3PJRA 1P2SA 3B82A 5GJVC 5KDLA 3R9WA 2GNOA 4GP6A 4OQNA 4RD1A 2Q21A 4B35A 2XZPA 2YOHA 2GVZC 3AB3A 3LLUA 3MRSA 2DZOB 4DSOA 4IVPA 5L3VA 1UKYA 1OHHD 3NWJA 2A30A 2D74A 1W47A 4R98A 3LX8A 1NN3A 4UNQA 1KIMA 2X1VA 4LX0A 4B3CA 2CL0X 1VCMA 1WMSA 2WWIA 3ZLJA 2R44A 2MSDB 4E09A 4LYHA 1G6HA 3SE0A 1NBME 4F92B 2RHDA 1CJVC 2BVNA 2F6RA 2BMDA 1JJ7A 4A8JB 4L4UA 1E2DA 1E1QD 1T9HA 1X86B 3G5UA 4BQSA 1SVWA 2XSZA 2FEMA 4L16A 4PHTA 1ZBDA 4GZMA 4P33A 1VMAA 2OCYC 3U7HB 3BH7A 1HEIA 4V0OA 4BFTA 5CYPA 1RRGA 1RC8A 1T91A 5KOYA 1XCPA 3ONWA 3FHTA 2G83A 2HYDA 3GEIA 1LY1A 4BFUA 1SXJE 1ZD1A 1NSFA 2FG5A 5KO2A 1H8ED 2AXPA 3R7WB 5AJWA 4AKEA 3I8XA 4HZUB 1Q22A 2BV3A 4PC2A 2Z6VA 1P60A 3QF7A 3KJIA 3I4LA 1W44A 4NTZA 1KDPA 1P73A 3ZJYA 2I3BA 4LJ4A 2E1RA 1PLLA 2A5JA 2VEDA 2JJ2D 4EJSA 2ZI3A 1GNPA 4B3FX 2KSQA 1Q1ZA 1OXUA 5DN6D 4XTCS 2VSFA 3CRRA 3X2SA 4QOSA 3A36A 4XVQA 1Q0UA 3IEUA 3RS3A 2PZEA 4O2LA 1CR4A 3KUCA 3THWB 1G291 1IAQA 1OXSC 2CK3D 4NL4H 1CLUA 2VF7A 4DLYA 3EW9A 1H8EA 2WPDA 4P4TA 1G64A 3QF4B 5P21A 5E7MA 3RANA 2V4ZA 3EPHA 2IS1A 4JL8A 2R2AA 1VYTA 3IIMA 3ZZ0A 1N6NA 4HUQA 2F1JA 1ANKA 2VLIA 4LV8B 5KU1A 2ZRDA 5JSZB 3PUZA 1YE8A 4XD7A 2HCJB 2FZLA 2F9MA 3LQRA 4NE2A 5HCIA 1XZPA 1OIVA 4DBLC 2GAOA 1XD2A 1XB2A 3L0OA 4W5HA 4GOXA 4ZCIA 3CX7A 2HLDA 3B1XA 4JYBA 4CF7A 3A1VA 5KDOA 2WVJA 4DT1B 1IY0A 2D7CA 4QRHA 3LA6A 2OCPA 3GLFA 2C77A 4JLBA 4Z8XA 2ORVA 2DHRA 1WA5A 2ZE6A 4TYQA 2J0UB 5F2EA 4MRPA 3SU8A 1G7RA 2C5LA 1J90A 2VPPA 3UG7A 1N6IA 4KO8A 1NVVR 1XP8A 3IBYA 1ZU5A 5AJXA 4RKEA 3WXMA 3EX7C 4PC6A 2XB2A 3VR5A 1B0UA 1Z83A 2OO7A 3IGFA 3NHAA 2XNSA 2REBA 3M6AA 3WP0A 4OBEA 1ODFA 3DEFA 3VKHA 1PV4A 1MABA 2IYWA 4Z8YA 2PJZA 5DO9A 2CL6X 4F38A 3CBQA 3WMFA 2YKGA 1E2GA 4NONA 1LTQA 1VHLA 3CF2A 3C14C 4URXR 3Q85A 1E0KA 2OFXA 2P2LA 1DBSA 1E0SA 3NEJA 3QENA 4Q4JB 2QUZA 4R71A 1KZ7B 3QXJA 2V6IA 4IDPA 4M1YA 4XTRA 5E7IA 2ZS7A 2R62A 3GLIB 2BCJQ 1EK0A 4WBSA 1ZIPA 4Q4HB 2BBWA 3K9LA 3A8TA 4N3NA 3U5ZB 4RCYA 1OB5A 1OE0A 3REGA 3VAAA 4PHHA 5BWMA 2ZJ2A 3X1YA 3T1VA 3NTUA 4IRUB 3AVTA 1AJEA 4ESVA 3OIUA 2PL3A 4CT4B 2DB3A 4IOJA 2C8VA 1ONBA 4WAUA 2BBTA 3H84A 2ZROA 2FNAA 2ZRHA 2OILA 4NP6A 1NN5A 3DZDA 1K5GA 5JI3E 3GJ3A 5HTKA 5CDFA 3SJCA 3A4NA 2QP3A 3Q5DA 1G21E 1K6MA 1NIJA 4TSFA 4JSTA 4D80A 3OFNA 3HPQA 2YOFA 3UWKA 4EPRA 1DARA 3KKPA 3RS2A 3PUWA 1B23P 1IY1A 4Q9KA 4Q1DA 1N5JA 2IYUA 1FQKA 4TTRA 4NH0A 5L3QA 2QT0A 3TVDA 4DB4A 5CB8A 4RSGA 5KNDA 2V54A 3OIWA 1XEWX 2PEYA 1KI6A 3CR8A 2P5TB 4IDOA 1E0AA 3EIEA 1LB1B 3CF0A 4C0KA 5KNCA 2V6ZM 3GJ8A 4PFSA 8OHMA 2RGBA 1AIPA 2JIZA 2FZ4A 4KODA 3K8YA 2J9RA 2OLKA 3K0SA 2WWGA 4PX9A 4XSHA 3ICEA 2QM7A 5JRJA 1U9IC 5FPTA 4MKGA 3GLFE 1R4AA 1NKSA 5EXPA 1SVSA 4GITA 3Q7PA 1JB1A 1N3BA 1OKKA 1J8YF 1R5BA 2J0UA 2JATA 2GJ9A 4LV6A 1M6NA 1R8SA 3I72A 1ZM7A 3RS4A 2JLXA 3W6OA 5GVSA 2C98A 3AJIB 3OAAD 1HQCA 3NHBA 2EYUA 1OW3B 4JT4A 1W0KD 1Z07A 3AF3A 1HYQA 1JR3A 5C4GB 4B6FA 3IDQA 1G41A 1E9SA 1S9DA 3NVAA 3CM0A 3DL0A 3MWJA 4BZXA 2YHSA 1EFRA 2DWQA 3ZIAD 3TGPA 3JVVA 2ORWA 4RD0A 2ZUDA 2BEJA 3KW6A 1Z29A 2BMFA 3VFDA 3ECCA 3QQ5A 4GOJA 3B78A 4LOAA 2ZRBA 2WWFA 2OBNA 1E6CA 3VQTA 1IN6A 4OK6A 5SZIA 2JLRA 5FL7D 1Y3AA 3THWA 1VCOA 1BYUA 1FUUA 3K9NA 3Q5EA 5DN6A 1KJYA 3PEWA 2GXSA 2FH5B 4P3YA 4TN1A 3A1WA 2BC9A 1D9ZA 1OT3A 2ODEA 4R9UC 3VTKA 2BMJA 5JHHB 4TMVA 3BB3A 1XFAA 3N2EA 4QC2A 5HKKD 1QBKC 1P61B 1R8QA 3AP2A 2W6IA 4MDEA 3CPEA 2AFHE 5TB5A 4AIIA 4DZZA 3B9PA 5FTMA 2B6HA 1XTRA 5FTJA 5JJKA 1S1CA 2RB4A 3KJGA 3T12A 3FFAA 3O8CA 4PZLA 5FBWB 2QG6A 1IY2A 3KTAA 2VQSA 5JJIA 4EAQA 5EXXA 1OYWA 4JZKA 5AJYA 2H17A 4LYAA 1EFTA 3B9QA 3DVLA 3MWKA 3PEVA 4KFUA 2GTPA 4PR0A 2HT1A 5L8VA 4FMDF 3I73A 2IS2A 1JECA 1E1QA 1CKEA 3CUEF 3QE0A 4RKFA 2X77A 1L4UA 3FGNA 3K0EA 1YR9A 3D8BA 1U8AA 2D2EA 4FWIB 4DSTA 1TQ2A 2IS6A 1JALA 3K70D 3GQBA 4FWTA 1ZUIA 2DCUA 2FFBA 2A2ZA 3C5HA 1RJ9B 3UMSA 1NMXA 2YC2C 4F93B 3CB4A 3EWAA 4IXMA 4IDNA 3UMFA 5HZHA 1DAKA 2CJWA 1OHHA 3KXLA 4KI0A 3HPRA 3ND9A 1UBGA 3RNLA 1N0UA 2ERXA 4ARZB 4ZPXA 4OQLA 1TADA 2AL7A 3BBPA 2QNRA 1DO2A 1HV8A 3CNOA 5LD2B 1U99A 1ZM4A 2GCPA 3VU9B 4XWKA 1ESMA 4PZZA 4Q9HA 4US2R 4YONB 1KNXA 1UFQA 3HYRA 4CDGA 1EGAA 1JQJC 3QUSA 4Q5IA 1Z28A 2CNWD 2E87A 3TAHA 4JVNA 4DVGA 1MO6A 4QBIA 4KCGA 1KOFA 4MGIR 1IN8A 1U0HC 1N5KA 3KUDA 2ATVA 5KYKA 2FDCA 4DEXA 4G5GA 4UXHA 2W0SA 4JBWA 4AG5A 1P9RA 1JNYA 2UVQA 1BYIA 5ELXA 1E9AA 2W00A 1PZNA 2ASEA 4Q00A 4LRTA 1P62B 1KI6B 2IT1A 3H2YA 3RLFA 4LBZA 1D2EA 3Q3JB 3I92A 2QL6A 3CH5A 4C0JA 3SFZA 1MRNA 3EA5A 5TXGA 2WAYA 4M9XA 1MT0A 4XJXA 4AG6A 1T5IA 1RKBA 1VPLA 5DSZA 3WBJA 3FKQA 3R9XA 4JVSB 1W36D 3SDZA 4GOKA 3K0CC 4HAWA 2ZRFA 2QEQA 2JJ8A 4X8MA 2P3SA 4W5JA 3KZ1E 4MITA 1P75A 4HDQB 4Q1CA 3REFA 1I4DD 1MOZA 1II8A 1ZYUA 2A5FA 2HF9A 4DKXA 2G1KA 4DT1A 2AHOA 5C46F 2FOLA 821PA 2W2XA 1XEWY 2IF0A 2V3CC 1GITA 3PITA 4UQOA 1S8FA 2G77B 3SZRA 4CT5A 3A1UA 1Q1BA 2OEPA 2DWOA 1XWIA 4EPXA 2IEYA 2MSCB 5AUNB 1KO4A 3LY5A 1M8PA 1ETUA 2OUKA 4RY2A 4HLDA 4Q66C 3WBKA 4A9AA 1XXHE 1P6XA 4IEEA 3T61A 3QXXA 2N42A 1Q57A 1JAHA 1IONA 1NJGA 2J0VA 2BCGY 5GJWC 1Y63A 2ZSFA 1EX6A 3SJAA 4JS0A 3SC3A 1AS2A 2FE4A 1DELA 1K8RA 3KB2A 4Q21A 1KSHA 2PLFA 2NTYC 4E5UA 5CM8B 1RVDA 2GZDA 4QJ5A 5EUQB 2ANBA 1F2TB 4C2TA 2Q9BA 4PAMA 4B3XA 5L3QB 1NLFA 4NYMQ 4DCTA 1GTVA 2VP2A 2ZRKA 4V0MA 2QRZA 1MKYA 1X37A 2D06A 2NPIA 2DZNB 2H7VA 1RRPA 3VNUA 4OL0A 3W8NA 1KSFX 3LBIA 4C4PA 4PO9A 3T34A 1QHGA 1I4LD 3QBTA 2AR7A 3TK1A 3NXSA 1W0KA 3AF4A 1EX7A 1R5OA 2B7BA 3RC3A 3CRVA 1HQYE 3H86A 1VYVA 1QG2A 3ASYA 4OQMA 4RZ3A 3B2EA 2WIAA 2J0QA 2FPLA 3CRMA 4HYYA 4JKYA 2FF7A 1VG9B 1NY6A 1AA9A 1WQ1R 4AY2A 1SVOA 1SXJC 4RCZA 3TIFA 2C96A 2CCJA 2OM2A 2G0NA 4BE7B 621PA 1J2JA 4TL7A 3CIOA 3EPKA 3QPUA 2GESA 1Q20A 1G3RA 2RGEA 4TT3A 4OI0A 1ZMXA 1A82A 1XTKA 3SNHA 2V1XA 4UNNA 3NG1A 4QGGA 5CM9C 1DG1G 3DKPA 1QZMA 5JS7A 1TTTA 3A37A 3PIRA 2WM9B 2QA5A 2ZJBA 2J87A 5JFGA 4D25A 5DE3A 4DLVA 1S96A 3B13B 3FMIA 3L8ZA 1TX4B 2QROA 2Q9AA 2ODBA 5AJVB 3ZS8A 1FMLA 4I1SA 3FFBA 5DH9A 2J1LA 1L8QA 2AWOA 1ZW6A 2FSHA 1SXJD 4MYCA 1YR6A 2C9CA 2NO1A 3QNUA 3QOFA 2O8FA 2GJAA 4IFBA 4HAXA 4PQRA 5KSPA 5KDDA 2QMEA 2VTKA 3EZ7A 1VG0B 2ZREA 5KUTA 2EWWA 1G8FA 4GMDA 4FCVA 1DAHA 3ZVLA 1E2IA 5EQTA 3QJYA 3K0FA 2GZHA 3B85A 2C78A 1FZQA 1ZUHA 5J5CA 4MKHA 3PQCA 2GJ8A 3ZS9A 4ASUA 3SQXA 4TQAA 1L2TA 3LLMA 5E7JA 2XTNA 3FMOB 4L15A 4Y0AA 2CL7X 2XGJA 3EZ6A 2PCJA 3T15A 2P67A 1KJWA 1ZCAA 1FOEB 1ZNXA 4Q1BA 1G8HA 4TL9A 3P20A 3ZH9B 1OH6A 4G3XA 3ZZTA 2X8AA 4B34A 5BN3A 2IS4A 3K0AB 1RPZA 1XNJA 4BZQA 2J7PA 1XCMA 2CHVA 1E1RA 1FTSA 3U7GA 1YU9A 1AGPA 5GVRA 4WW0A 5EE3A 3BWDD 2FFQA 3BB1A 5DI9A 1AK2A 2WJGA 4QKQA 1EWRA 2ZRNA 4PSKA 5FOTA 4MUBA 4Q48A 4FINA 1KYIA 4KSBA 4XVRA 5BQ5A 2IL1A 3RS0A 1GAJA 3SHWA 3WYFA 2QN6A 2CMKA 2ZU0C 2AWNA 3CZPA 2GEVA 4Z51A 4PC7A 1HE8B 3OESA 4URVR 3CWQA 4PAQA 1GG2A 3B60A 2FU5C 3TVTA 3MWYW 5CB6A 4G0NA 3TAUA 3I8SA 3F0TA 1YZGA 4Q1EA 4IOKA 2JLQA 5SZHB 4Z1MD 1YZQA 5EE1A 2GRJA 2R6DA 3B6EA 4JMPA 3D7MA 2QM8A 3AUYA 1YRAA 2EWVA 3NKVA 4TYYA 1DAMA 4TLDA 5H1YA 3PXGA 1Q1QA 4DUGD 1TU3A 3PFIA 3LV8A 4M22A 3EPLA 4MDFA 4DLTA 2AK2A 4MRNA 1G19A 5IT5A 1G8GA 1NL3A 1HUQA 5G53C 1H65A 2QP9X 5EZ6B 1WCV1 2YWHA 2DWZB 4GBMA 5CITA 3AKCA 4P4SB 2O8CA 3UANA 4LJAA 3NC1C 2VH5R 2N1BA 1MO3A 3BJIC 4PZYA 4EFLA 5D3QA 4B47A 1QHNA 1OV4A 4E03A 1TNDA 4MYHA 3TUIC 2Q0HA 1TPZA 4QGHA 4BLRA 2NOAA 3X1ZA 2ZUBA 4IDQA 4FXPA 3THOA 3DZ8A 3VNVA 1COWD 2LKDA 1N0WA 3TW4A 2BWJA 4RZXA 2QMUA 4RD6A 3FHOA 4PTLA 5J4HA 2ZR9A 1EG7A 3FE2A 1PUIA 3EIHA 1KDOA 4US0R 4HDOB 2XXAA 4Q1AA 1DPFA 1GL7A 3K9HA 4JLKA 2QPTA 3KFVA 4LBWA 1WB9A 1VIAA 1YHNA 1GWNA 4TYWA 5DYIA 3X1WA 3ZGXA 3CR7A 3SS8A 5FTKA 1XD8A 2ZSAA 4HB0A 1KSGA 2K5UA 3RS5A 3BE4A 3U3MA 4B71A 4BGDA 2R9VA 3RC8A 5GADl 2VYFA 2OBLA 1CRQA 2D3WA 2ZETA 4JLVA 2QRNA 3P26A 4US1R 2QPAA 1E2PA 1KO1A 4IOMA 1SVKA 4YDHB 4A1FA 5JCPA 4M21A 1MO5A 1V5WA 2FFHA 1TUIA 2CE2X 3AVYA 2JJ1A 5KSZA 3THXA 5C2JB 2C03A 1Z0FA 4P32A 2GCNA 4NYIR 1ZM9A 1H8HD 2BHRA 4RFVA 4Q9LA 2ZEJA 1G18A 1JAIA 3I1FA 4HDCA 4NYJR 3RWMB 4QNMA 1U81A 4ABYA 1KO8A 3N2IA 1WBDA 1MH1A 1KKMA 4UNSA 2GAAA 3EPJA 4DEYA 2WMOB 1TQ4A 4QGFA 1YZTA 2Z5FA 1E9DA 1GRRA 3L82B 4FD2A 2ZRIA 3GP8A 4OQXA 4OHYA 3NDBB 3FOZA 4UJ3A 3W34A 4KVGA 2XZOA 3AM1A 4A82A 4M1KA 1XZQA 4C0LA 5DI3A 3BD9A 3QKUA 1IXRC 2F1IA 2HXYA 4KFRA 2FPKA 4C7OA 5FOSA 3HWSA 1P3JA 1CS4C 2FA9A 1P72A 1U98A 1JEDA 4YMUA 1UDWA 4HAVA 1G7SA 4V0ME 1GRQA 2YJTD 3RWOA 4BLSA 2GXAA 1LF5A 5DISB 3CX6A 1P2TA 1TEVA 3ASZA 2XNDD 2XTMA 4FI3C 4HUQB 2H1LA 1U2RA 4OHZA 1ZM2A 2BJWA 3QXSA 1FL9A 2IC5A 2ZSDA 1E99A 3RYTC 4PHGA 3AGPA 1BO6A 1VG1A 2F1HA 4GT1A 1DS6A 3A4MA 2NZJA 1E3MA 2J7PD 3W8RA 4NBSA 1R0WA 5L3SB 2PT5A 5CJ2A 3RRZA 5EP1A 4ZCMA 4N0EA 4KV9A 5JLJA 3R7WA 3LBHA 4RZ2A 1MV5A 1DVRA 1YZUA 2G0TA 2O52A 1N6KA 1US8B 3QKSA 4PAOA 4TMWA 5BN5A 1BMFA 2WJHA 2R6AA 2GBLC 4BZPA 1KY2A 1GZSA 4P4UA 4R2HA 121PA 3T1OA 2V1UA 1NIPA 1MO4A 2ZE8A 3CZQA 1ZD8A 4DLSA 1G4AE 4XSGA 5DHFA 1IXZA 1GVNB 2F55A 1A1VA 1KI7A 2VHCA 4ACAA 2F43A 4PQYA 1XTQA 5JI2E 1M7BA 2ZSEA 1E79D 2CVFA 3DOEA 4JVMA 1BS1A 3MHVC 1GKUB 4G5SA 3TSOA 1T3SA 3GEEA 2MMGA 4I81A 1Z2AA 1WF3A 2W2TA 1J8MF 521PA 3MFYA 1SKYE 1XPRA 2RGXA 4DXAA 2X2FA 4ARZA 1G7TA 2Q3HA 3PG5A 2VHQA 2ZVPX 2WJVA 3ZD7A 4FWHA 1E9CA 2CJWB 3IPXA 1VIYA 3IHLA 4DSNA 3QEJA 3HJNA 1W36B 4FCWA 2V55B 1UEIA 1W5TA 3VR2A 3IHWA 2ZYWX 2GDJA 4BLQA 4I1OA 2CXXA 4PPGA 3FB4A 5CYOA 3AVXA 1FTNA 3SJBA 4TYNA 2RAPA 3U3KA 5FUWA 5H8WA 4S2EA 4NYJQ 2ZRGA 4BFVA 3AH8A 3SN6A 1KAOA 4UJ5A 1N6HA 3ZVNA 1I4TD 3NH9A 2A9KA 4KLZA 1OIWA 2W6JA 3R20A 3CPHA 4ITRC 3SOPA 1XPUA 1SGWA 3EXAA 4IDHA 1UBCA 1IOZA 2NG1A 3ZQ6A 3NC0C 4TTQA 4NHOA 1JBKA 3BOSA 1Z6GA 4LSGA 4YXWA 2IWHA 1HT2E 1JR3E 4LJ7A 2JLUA 2CLDX 1S0UA 4TZ6A 4TYPA 1OXVA 2QENA 3IQXA 3QXHA 1OF1A 3GJ5A 1MABB 2VP5A 4M9ZA 1W48A 4XWAA 1TF2A 3LW8A 3SYNA 5JHGB 1NLZA 1J7KA 1PUJA 2WSSD 4ESHA 4A8JC 2ZITA 5TY0A 2JAQA 3U44A 5AUPB 2XOKD 1AKEA 1SKQA 1KHTA 5LB2A 2JJ2A 2PH1A 2XNDA 1UF9A 4U5XA 2FSGA 3BXZA 5FFMA 2AD1A 3M1IA 2NO7A 2P65A 3CWZA 3OE7A 5FI1B 1T0HB 1CJMA 5FPHA 2CVHA 4IKEA 1OYYA 3V9PA 2NZ8A 3HP1A 1Q3TA 4BEBA 1IN5A 2PLRA 3DKVA 5CJPA 1KI8A 3LAWA 3QVUA 2P6NA 3OEED 1CR2A 1E69A 2R8RA 2OBMA 4GZLA 2QQEA 3QG5A 1XTIA 1R6BX 3BORA 3MLEA 1OFHA 4JL5A 4S35A 4BFSA 1KDRA 3A4LA 4QL3A 4ZIRB 2ORIA 4PSVA 1ZC4A 2REOA 3N70A 4KFTA 2JLVA 3UXMA 4JBXA 4B2PA 2QT1A 2C2HA 3ETLA 4Q18A 1Z0AA 1S4QA 5HCNA 3L43A 4HSEA 4JL6A 2ZJ5A 4YDSA 1IXSB 3BAFA 2JDIA 4OJKA 1TL7C 2ZTSA 1VYUA 2ODWA 4TLBA 2YINC 3RHFA 4B6EA 1JPJA 1XEXB 3Q9LA 2F3TA 2P6RA 1LFDB 5JBQA 1UADA 1G9XA 2W83A 4BFYA 1EFHA 5M04A 3OE7D 1RYHA 3BERA 4IHQA 1N6RA 4EDHA 2ZRPA 3U60B 5KHOC 2QSZA 3P32A 2JGNA 1RW4A 3RSLA 4TLCA 4TT3D 1W4BA 3NH6A 4IVQA 4Q7MB 4AURA 4QHTA 4MGZR 1J99A 1QDEA 2B92A 4R7ZA 1E32A 1Z6XA 4LPSA 5G3YA 1KI3A 1R5NA 1IQPA 3KJHA 4G5QA 2O8CB 1XEXA 1XMVA 1D2MA 1SXJB 4Q7KA 1E0JA 3U3RA 3L0SA 5KPJA 1DO0A 3LVQE 1F2UA 5TMPA 1FP7A 4TWZA 2WKQA 1NNEA 3BIFA 1T5LA 3AVQA 4NZYA 3IIKA 1NN1A 1W4CA 2VP6A 3TUZC 2Q9CA 1P2UA 5EZ5A 3SJZA 4RD2A 2RGCA 3U6BA 3C7KA 1CTQA 1YR7A 2PJRA 2G6BA 4A8JA 4DSUA 4Q01A 4MRVA 1CU1A 1GSIA 1WE2A 4IVRA 1GL6A 1CJUC 2RGDA 3GLHE 1RE0A 3OEEA 4AKGA 5DYGA 3QVVA 2KJQA 1CF4A 3LO5A 2I1QA 3GJ6A 2KB0A 2ZS8A 1GIAA 3C8UA 1ZJ6A 5SZKB 1XF9A 2KI5A 2J41A 1KMHB 2YC4C 1WP9A 4WXRA 2QBYB 1NVXQ 1JPNA 1AZTA 2ZYUX 1N6OA 2IUUA 3UPUA 1JR6A 3G0HA 1VCNA 3QI2A 1D8TA 5AR1A 4Q7LA 3MMPA 5FUXA 4IOLA 2V6JA 2GCOB 1FPMA 1AQUA 2OAP1 1G3UA 4BLTA 3T06B 4ILEA 3O8BA 1T6NA 4NCHA 721PA 2WBLC 1EXMA 3M0EA 4HB3A 3C4JA 5JJLA 1CRPA 1TU4A 3S1AB 4M1OA 3ZZUA 4AI6A 2PX0A 1NVMA 3FMPB 3KXIA 5E4FA 2BMEA 4JLMA 1CEEA 1TEXA 4OHXA 3KKQA 3FDIA 3IILA 4NMMA 4UXIA 3CRQA 2D7DA 2HUPA 4MRSA 4TMXA 5J4KA 3VKWA 1W4RA 1N25A 4LHYA 4OJQA 3TR0A 1X8JA 3GJ7A 1P2VA 3GJ0A 1OH7A 3BC1A 1DOAA 1P5ZB 3VU9A 2DBYA 4D4KA 1NY5A 1AM4D 4IXNA 2ANCA 4NCJA 3LFUA 3WYAA 4EKDA 4EPVA 1HT1E 4HLUC 5B2ZA 1F60A 4Q47A 3OIYA 2ZJYA 1JJVA 2OSBA 2JJ1D 4CEHA 2RGNC 2F3RA 4Y0VA 4LWZA 4WXPA 5FL3A 3KFXA 3B8HA 3F8TA 2O8DB 2KBEA 1U94A 1T3HA 1O3YA 5BYKA 2GF9A 1JXOA 4JLAA 1SVIA 3SEAA 1NBMA 3VLFB 5JCZA 3WMEA 1MRSA 2A5GA 2QAGA 4KJZA 1KO7A 4AKIA 2QE7A 3GLHA 4QFMA 4LYJA 4CW7A 1F3OA 2Q3FA 3K09C 1XU4A 3UIEA 3W5JA 1QHHA 2RGGA 2EYQA 1G3IA 1LVGA 3ADDA 1UKVY 3KL4A 1KDTA 1KJZA 1RRCA 5EXTA 3GPLA 3BGWA 4GRAA 3MGCA 3P27A 2H18A 3KX2A 1PLJA 1QHSA 5ANRB 2QMHA 2HJVA 4LHVA 5B58C 4KLNA 4UKDA 2B8WA 2B8TA 3C16C 1L4YA 2OLJA 3PEYA 1YJ5A 1GDDA 2Z0MA 3ZD6A 1EESA 1US8A 3QKSB 3LBNA 3UKDA 4KBFA 2JIZD 4CVNA 2REXB 4A2PA 1W49A 1T8UA 2KWIA 2OT3B 3O8RA 1D2NA 4D0LB 2XJ9A 1W0JA 3TJZA 3SYLA 3ICQB 1ZP6A 3TW8B 3KJEA 4M1SA 4BECA 4XWOA 2BOVA 1KZGB 4PANA 3TR5A 1ZUNB 4KFSA 4QG7A 3T5DA 2DFKB 3QG1A 2I4IA 4B2IA 4YMSA 1H8HA 1D5CA 3F5FA 2FV8A 4FMBB 2HV8A 5JEEA 5DLQC 3SYKA 1NVUQ 4F4CA 1QVRA 4ON9A 4U00A 4A6XA 3KQNA 5GJBA 4TMTA 5J4VA 1XMSA 5A5GA 2N46A 4CIDA 1EFCA 4FWDA 3IO5A 5AUOB 2L0XA 1BKDR 1YRBA 4E22A 4AD8A 3GD7A 5EE9A 1LS1A 5FBRB 4WVFA 2ZU6A 1XMJA 1G8PA 2BJVA 2JA1A 4Q19A 2WV9A 3WHLA 2ZAOA 1YQTA 2BKEA 3CRW1 5LPNA 4POAA 1ZD9A 5FUVA 4MKFA 2WSMA 4JKIA 4TL8A 2WJYA 1Z0KA 3O47A 3I5XA 1IBRA 1NJFA 1E2JA 4DCNA 4CEIA 1T3LA 4RFSB 1AZSC 3IUYA 3I32A 2CNWA 2YWGA 2QAGB 2ZYTX 3AVUA 3GLGA 3DDCA 1OJLA 1LS6A 3OF5A 1KMQA 2RMKA 4KVAA 3VR4A 4BRUA 2HF8A 3E5HA 4JVLA 4XVUA 1Z6YA 4MYTA 3W3ZB 4DJTA 2PZGA 4M9SA 4GL2A 2GJKA 5AJZA 5IDVA 4HEJA 4A36A 1QHYA 2NO0A 2ZJOA 3ND8A 2IYXA 1YVDA 2ZR0A 2GWHA 2D62A 2GK7A 4GFDA 4U7DA 4CYMA 2A5YB 2GK6A 1DEKA 3BFXA 4LK2A 3QXCA 3TH5A 4B3GA 2JDID 3TLXA 2ZRMA 4JLNA 4PPQA 2CDNA 1W0JD 3E2IA 5BXQC 2YOGA 3KQHA 4MH0R 2KE5A 1M34E 1KKLA 3VR3A 1KAGA 2ZRJA 2C99A 5LDDC 3EASA 3E1SA 3K1JA 1PJRA 4I1UA 1XTJA 1GKYA 5KNBA 4BPBA 4CGZA 2ZVQX 2NO9A 4W7SA 4XD7D 3CNNA 5D3MB 3QPWA 3IKJA 2CLSA 4QHYA 1Z47A 4KXFB 2QQ0A 2HCBA 2BBOA 1Q12A 2CCGA 2O0KA 4EIWA 2CHGA 2FN4A 1E79A 1QVAA 3KXKA 5DGXA 3VMFA 2V9PA 3OZXA 2IYVA 4OK3A 3P4YA 3L0PA 3UATA 4FMCB 3T5GA 2A7QA 3ZYCA 5EJEA 3SBEA 1E9BA 3LWNA 4A6PA 3Q8XB 4GSYA 4OHWA 1NP6A 2E9SA 4B3BA 2ZI7A 2IF2A 3B1VA 4JYCA 4QJ4A 2W6ID 3THYB 4GMXA 3FVQA 2BM1A 2Y8EA 3MD0A 4NKRA 4D0GA 1SZPA 1RRFA 2ZE7A 2WSSA 2QP4A 2XITA 1TUEA 3EWSA 1NBMD 4B32A 2ECKA 2YVUA 3NBZC 3U7FB 4CEJA 4MKIA 3W9YA 221PA 1G7CA 2ZJ8A 4CEJB 2NQ2C 2A3RA 2WKRA 3H1TA 4ZKDA 2IXFA 4A4DA 1ELOA 3TE6A 1U0JA 1R10A 1S3SA 2IYYA 2NIPA 3EZ2A 4MA4A 1Z63A 1ZNYA 1RJ9A 3C5CA 1IJFA 2FPMA 3R9IA 1NG9A 3N5CA 4OI1A 4HZUA 4YXWD 1F6BA 1ZNWA 4P4SA 3X1DA 4HLQB 1GNQA 2GETA 6Q21A 4MGKR 5FOVA 5A0FA 1TF5A 4QM6A 1FNMA 2QZ4A 1E2MA 1KNQA 3GMTA 1II0A 3BH6A 2GHIA 1A2KC 1AQYA 4RZUA 5JMTA 5DNYB 2ZI9A 1S9HA 3AP1A 2R6GA 4BLPA 2ZANA 2ZJZA 3R8FA 4N0DA 4DCVA 3AF1A 3AVWA 2R65A 1NMZA 2JASA 1XXHA 4YMVA 2J45A 1LNZA 4QM7A 1TMKA 2J3EA 3MCAA 1UBFA 3UWOA 2DWPA 2KRKA 5C4MA 2IWRA 1Z0IA 1E94E 2ZRLA 1OFIA 2LCFA 4LJ5A 2FJUA 3QSYA 3B5JA 1XMIA 4D82A 4MQBA 2MMCA 1U8YA 3EZFA 5EP4A 2OZEA 1I2DA 5EXSA 2PCLA 1CR1A 3KKMA 2JLZA 5CK5A 1S1MA 4PXAA 3QBVA 1XJQA 4V0KA 4URUR 2QI9C 1X3SA 5SZJA 4KHZA 2O0HA 4EQ6A 1CP2A 2WZQA 5FOUA 3I62A 1KGDA 1ZM3A 3BK7A 3P1JA 4DIDA 3CO5A 4NU0A 5EP2A 5J40A 3JZMA 1HY3A 2JEOA 4JT2A 4X8LA 3PV0A 5F9HA 1SQ5A 3CH4B 2Z83A 1N6PA 4NCNA 2O8BA 4OHVA 1OXTA 4ZKEA 4JIMA 4NPHA 3JZAA 2J5XA 1GL9B 3SQWA 1Q44A 1TAGA 1UBEA 3FKSA 3RRYA 4CZ2A 4O0MA 2GILA 3GJ4A 4U02A 2X2EA 5H70A 5FR1A 4LI0A 4ZIRA 1A5TA 2HJGA 4DIEA 3K53A 4X8OA 4BWYA 3K0FB 1OB2A 4Q4LA 3AVPA 2OHFA 4ASUD 1HE1C 1BMFD 2EW1A 5HKKA 1LF0A 1L7VC 4FWGA 3GFPA 2XJ4A 2QU8A 3EA0A 2W2VA 4LBYA 1JEEA 4RD3A 2HEIA 5EE5B 1CXZA 1S3GA 3C41J 4B44A 1N6LA 1X8LA 4A0HA 3AKDA 4LJ6A 1A4RA 4IJMA 3SFVA 4LGMA 1SXJA 4UXJA 5AWFC 4LRWA 3WRYC 4OQFA 4QBFA 2QSYA 1Z0DA 3U44B 1U90A 3IIJA 2ZIAA 5CDFE 2H57A 2MSEB 5HE8A 1FP6A 3W90A 3AEZA 2ZYVX 4OI2A 4OYHA 4UNRA 5FPKA 4KYUA 1EFRD 1NMYA 4F91B 3D31A 4AYTA 1NSTA 4JLDA 2W0MA 1UDXA 2QGNA 4C3ZA 2Z4RA 3AVVA 1ZAKA 2EFHB 4CEIB 2I1VB 2ZI6A 4A2QA 4QBHA 5KPDA 1DAGA 3HU2A 2Q3MA 4LHZA 3TNFA 1E96A 2QTFA 2VL7A 3PR1A 5FPYA 2XZLA 4X8HA 2YZ2A 4ERNA 1MR3F 2DFLA 3K0CA 3ADKA 3VKGA 1J70A 2Z4SA 4QXAA 2EFCB 4O2RA 4B2LA 2Z43A 4AC9A 1OKKD 3TUJC 1NVVQ 4DUGA 4ZI2A 1G5TA 1EFUA 3GLIE 3NIBA 2BBSA 3LXRA 3U6KA 1FX0B 3TBKA 1Z22A 1DG3A 2H5EA 4MGYR 1OSNA 1R0XA 3U61B 1G8YA 3U2QA 1KY3A 2ZRAA 2GEDA 4DLZA 3RVBA 1Q3HA 5FR2A 4TL6A 1M2OB 3GLIA 2P5SA 4K46A 4MYUA 1VECA 4M53A 2D2FA 2ODNA 2ZSBA 2O8DA 3CW2A 4QJ3A 2ZAMA 4JSYA 3RRMA 4LDJA 1P9WA 1D6JA 3TQFA 2P0EA 1NVWQ 3EC2A 4GI7A 2IEZA 5DHAA 1DAIA 1VDZA 5FOXA 4BASA 5HR5A 2ONKA 5JWRA 1G20E 3CONA 1KI9A 1KK0A 3TMKA 4Q1FA 4PQFA 1JXMA 1R0YA 2XB4A 4C9BA 2VP0A 3I61A 2QY9A 1XJCA 3NEYA 2IYLD 4YMTA 2IHYA 2PZFA 3KQKA 4BFXA 1Z06A 3GLGB 2PMKA 2C95A 1UAAA 1M7HA 4AKHA 5J4YA 2VF8A 5FOWA 1KK3A 2QMOA 4Q7JB 4DLWA 2NPFA 4C30A 3KKNA 3OEHD 1ZNZA 2LKCA 1C9KA 3PUVA 4C0HA 2DFTA 2H92A 4JBYA 2W6JD 5E3HA 4M9QA 2WJJA 3S1AA 5BYJA 3BFVA 3G82C 3LQQA 4QHSA 2AFIE 3U3OA 5KSOA 4XH9B 4LBVA 3QY0A 4PC1A 3AVOA 1XRJA 2PEZA 4HLCA 2JLSA 4HB4A 2CE7A 3UK6A 1KI1A 3U4QB 1VTKA 4IEIA 1Q1EA 2FGKA 5BN4A 1HTWA 2CCKA 2IUTA 4LJ8A 2F1RA 5FL7A 5LB4A 4A2WA 3B1YA 1E2HA 1II8B 1W1WA 3T35A 5E95A 4WIAA 1R2QA 1BH2A 3K0AA 3W5IA 4URZR 4Q4AB 1AS3A 2VP4A 3RDPA 5G40A 1T4GA 3QKRB 1V43A 4C2UA 3ZIAA 4LC0A 3WHKA 3HR8A 2D4HA 3I3SR 4HI0E 5FTNA 4Q9IA 3U3JA 1GKIA 2XOKA 1ZC3A 2IYQA 2A5DA 4AYXA 1KK1A 1Z5ZA 3EIQA 1JR3D 1DAEA 1C1YA 1IN4A 1XDBA 2G1JA 2OESA 2LWIA 3AQ4A 2IBMA 1M7GA 3ZVRA 2DY1A 4HUTA 1E2LA 3EC1A 2AX4A 2WWHA 5F98A 4C0AC 1VG8A 2OFOA 3ZQJA 3H0KA 4D4MA 1OXXK 4PO1A 3K70B 1W2GA 2ZUCA 3LH5A 2KBFA 3F3YA 3WNCA 2WJIA 1FW6A 3JVUA 4GP7A 2IK8A 2UZIR 4DWJA 3PUXA 2ZXUA 1SHZA 1SKYB 1C1KA 2QAJA 2IXGA 1CIPA 2ATXA 1A7JA 3DOFA 3LXXA 2F43B 3K09A 4EPTA 3B1ZA 3MWLA 1XXHB 1E9FA 1WXQA 2IUSA 2OE2A 3GFTA 2WWXA 3MUFA 5IRCD 3OHMA 2EFEB 5TARA 1SULA 1OH8A 3LRPA 4B3DA 5B57C 1OLOA 2QAGC 4V03A 4TQ9A 2ZR7A 1E4VA 2WOOA 2EFGA 4Q9JA 3H4MA 2YWFA 4KU4A 1P4SA 5JRZA 3GFOA 2HXSA 2FSFA 1GOTA 5EUMA 2EFDB 1XD9A 2BKUA 2JCSA 2QGZA 3QIAA 1IHUA 1DAFA 2VHJA 3WMGA 3FHCB 3CF6R 1ZU4A 4DB2A 2GXQA 4LV5B 1E2FA 3GCGA 4ZDWA 1IN7A 5TV2A 2GEUA 3HR7A 4OK5A 4Z54A 4DLUA 5IK2D 1Z08A 1TQ6A 2XX3A 1Z6AA 2OCAA 2FMXA 3WNDA 4MUAA 1DE0A 1GM5A 1QHIA 4LHWA 5KTYA 3HU3A 5F9FA 2W58A 4LUCA 1CJTC 3L2OB 4WZ6A 1W5SA 5TVKA 2YV5A 4N1AA 5CLQA 1E98A 2ZJAA 2H8KA 5HE9A 4Q03A 2DR3A 3EARA 1QG4A 1QF9A 2AXNA 4YQFA 4M1TA 2HYIC 1QZXA 1Z0JA 1Z8FA 3CNLA 4DCUA 4DDWA 2C9OA 3IPYA 1HH4A 4DLXA 4W9MC 2B21A 4LY6A 2WHXA 4EFNA 1OIXA 2VRWA 1GFIA 1XPOA 4D0NA 1FMJA 1T0JB 4LRSA 1LV7A 2FSIA 5G3ZA 1YZKA 4LCBA 3RAPR 2WWYA 1XBTA 1F2TA 3PEUA 1RFLA 3I5YA 4TMKA 3Q7QA 1UKZA 4TTPA 4A15A 3WY9A 1G4UR 2QE7D 4DDVA 4V0NA 5DIFA 2OV2A 1R7RA 2R6FA 2AD5A 5CIWA 5CLLA 1SVMA 1Z2CA 3RS7A 3VR6A 3EZ9A 1QHXA 4C0BA 4QBGB 4H1VA 4L5BA 2WMNB 4D2IA 1ESNA 1AGRA 1RYFA 4PC3A 2ERYA 2WICA 4L9WA 1YKSA 4LZZA 1OPXA 3UMRA 3QKRA 2G3YA 5KSYA 2IYSA 4I4LA 5JECA 421PA 5GJCA 3PUYA 4K81B 1AN0A 2RGNA 1JQLB 4M2LA 3RRNA 1M1YE 1RIFA 4TSFD 2HLDD 1IM2A 1E2NA 2BEKA 4BRWA 4B43A 2ZE5A 3OFND 1FFHA 2EU8A 2QTVB 4TZ0A 1RZ3A 5K8LA 3ADCA 1U9IA 1GUAA 3SBDA 4JN6A 2OXCA 3V00A 3Q72A 2GZAA 3SHFA 3PENA 3BH0A 1ZRHA 4NYMR 1XJ0A 4TLAA 3SR0A 5BW8A 2WAXA 3ZVMA 1LW7A 2IHBA 4G5RA 1TQDA 4F4JA 3TSZA 3DMDA 4HZIA 4LJYA 3CX8A 3OAAA 4V02A 2G88A 3X1XA 2F7SA 2WOJA 1PVOA 2DPXA 5FPSA 1R0ZA 3VX3A 3W6NA 2OCBA 3QF4A 4ZDIA 4BUJA 3CLVA 5FI0B 2NO6A 4E07A 3DM9B 5IK2A 1YZLA 2VSXA 3MJHA 3DPUA 2B7CA 4KAXA 3MSXA 3LVRE 4F7WA 5FUYA 2NGRA 3J81k 3W6PA 2ZM5A 1GNRA 1COWA 5L3RA 2ZQ5A 1ZVQA 3LNCA 1FNNA 3MJRA 1W36C 1BOFA 1C4OA 2ZRCA 1I2MA 2OFWA 3GJXC 3C15C 2IYTA 3O8DA 1G16A 1DTSA 2PMDA 4M8NE 3KQLA 3DMNA 1P7CA 2FEOA 1BIFA 2SHKA 3QPVA 1QRAA 4I99A 4ACBA 5JWHA 3A1TA 3V4FA 4D4JA 4JLPA 1S2MA 5TDHA 4XOIA 1U0LA 2UKDA 1G1MA 3AGQA 3VX4A 4ZDKA 2QTHA 2ZI5A 1D9XA 2V8OA 4RD4A 1FUKA 3CKLA 3VHXA 5FTLA 3HU1A 2HT6A 1G3MA 4JJKA 4B76A 4R2IA 3QKTA 4EJSC 1NI3A 1X8KA 1JI0A 2FWRA 1TF7A 3GEHA 2AKYA 2XAUA 3GLHB 3BS4A 4Q02A 4A0FA 3TQCA 2RKOA 5AK0A 4FIDA 4DDTA 3AF2A 2ONJA 2VIIA 3EAQA 3W3AA 3A1SA 2ZS9A 2VO1A 2EVWX 3D6TB 2GKSA 2CK3A 4TMZA 2WWWA
chains in the Genus database with same CATH superfamily
1OAIA 1BHSA 4B6OA 3GZNB 2QD2A 4ZCLA 1E8DA 5TF4A 1OZGA 4AZTA 4EYQA 5JWOA 5L4NA 1IWPB 4GBJA 3RFFA 3U5TA 5GIPE 4EY5A 3TRKA 1C3VA 1NT4A 4O4JF 3KHUA 1CDDA 4YP1A 1PJZA 1EMDA 3VDRA 2JY5A 1QMPA 1U0BB 3PJGA 4NFYA 4XEHA 1SZCA 5B3LA 1U4OA 3ZE9A 2BDTA 1XXLA 3KHKA 5BUQA 2IYRA 1BVRA 1FYFA 3P4XA 1HETA 1EK2A 2ODAA 2BI8A 3FBWA 3S2EA 1QR6A 4CRWB 2PYDA 2B3DA 3DM5A 1JQKA 2NZWA 3FYHA 5FBVB 4JLOA 2ZM6B 1PP4A 2ZG6A 4OAPA 4R2KA 4RDHA 4JP8A 3VVBA 1HDOA 2X0JA 3UWMA 1V1JA 3RYFA 4EJMA 3TTSA 2PKYX 4AK9A 5HUHA 2VHTA 2WI8A 4R5HA 4I50B 2EGGA 5LM3A 2VBCA 1XD2B 3GDWA 4MW4A 1WBBA 5FWAA 4EHIA 1M0EA 3LYHA 3W5AA 2F9LA 4GQAA 3SWWA 3DZHA 3LY7A 1KFVA 4QNNA 4UREA 1PU2A 2UUBB 2PK3A 3Q0EA 1KI2A 1N0VC 4Z1MA 3RHZA 1GILA 1Y6QA 4EKYA 3IL2A 2GXUA 2IZ0A 1ZPDA 2IXEA 3HADA 4QUBA 5IAEA 1NG1A 5DTQA 3OI7A 1WSAA 3RYFB 2JLWA 1XK7A 1AKQA 3ADBA 2O8FB 4P0TA 1H1TA 3GX1A 3JZFA 2QAIA 4DNFA 4ENQA 4Y30A 3D2BA 2OK8A 5B30A 2PGOA 5I9LA 3PL5A 3MOGA 3P9PA 1DBWA 2QRUA 4XB2A 5IHPA 3V2GA 5HCUA 2X8JB 3U7EB 4DIOA 1NRJB 3E70C 1B15A 4PYJA 1YI8A 2OXFA 3KT3A 3QHPA 5E0OA 4CF6A 4INZA 1T1IA 5DW3A 2IOQA 3ONVA 3WMWA 2J48A 2G5GX 3MZ0A 3NYWA 2ILTA 3LDGA 4IFEA 1O03A 2V8BA 4WE3A 5EIOA 4ZZ3A 4D3YA 1G5RA 2CVZA 1N7JA 5G0SA 1X7GA 3OURA 3NPMA 3WRVA 1XEFA 5CNKA 2ZIGA 1U5AA 3D3QA 2CLCX 4RHFA 4WZAE 2R00A 4AYWA 2O50A 2EJVA 3OZVA 2DSTA 3HDTA 4KPUA 1G5PA 3QJGA 2M9MA 5FCDA 4X6UA 1MX3A 4FTWA 3L06A 2XDWA 4O63O 2C5RA 3T7RA 3QE4A 1FU4A 4O08A 5KS2A 2ST1A 5NLLA 4DXHA 4PIPA 2UU9M 2R97A 4L4ZA 4YQZA 4MLCA 4O2BB 1C9EA 1GV0A 1KETA 1FUYB 1YUNA 2X19A 2B94A 3FPAA 3A26A 2ISSD 3IBGA 3PQ2A 4HKTA 4WCFB 4BOYA 1F48A 1UEJA 1VL5A 1OAOC 3QZUA 2D1QA 2GBLA 1E1LA 2PD3A 2WSLA 3VRHA 1E7WA 1MJFA 1MTOA 4XIGS 4MLZA 5JY6A 1JEQB 1IPHA 5EEGA 3CG4A 3DMFA 3FTQA 4OKSA 3VH3A 2ZTMA 1MC5A 3LQ1A 1QE5A 3MTEA 3NOXA 3UHOA 3FNGA 1IJEA 4HAZA 1F2UB 4F1WA 4FE4A 1LLUA 4AJHA 3T1QA 1JMKC 3AF0A 1M74A 4BBZA 1E2BA 2PJDA 5BV8A 2C5AA 2WE8A 2HQOA 2XOEA 1JDUA 3EQ9A 4LPKA 3DMPA 3R9XB 1YTLA 3OEYA 1F5NA 4WXYB 3THXB 4P31A 4RF5A 3HB5X 4MINA 4Y6QA 1QVZA 2GTHA 1K5DA 4M55A 4M1WA 2OKCA 2O20A 3NEPX 1T26A 2R0IA 3COJA 2V7QA 2Y4NA 3FYUB 1Y9AA 4WHMA 4WP2A 5B37A 4YT5A 4Y7CA 1FRZA 4YMWA 3HCWA 3W4KA 1V7ZA 2O8NA 5A4JA 2WYOA 2BKXA 2BM0A 1Z5BA 3GMSA 3KEOA 4CIWA 4D8WA 5KQRA 4JD5A 1VMIA 3OCYA 1ZINA 2AMFA 4N5NA 1X9GA 1I9GA 1YT5A 1ZMWA 1U8ZA 3ROTA 3KT8A 3OPYA 4MX8A 3PT9A 1KORA 3OE4A 4K1LA 3KDSE 3CCCA 1LNQA 4A10A 3DV2A 2C9YA 3H5RA 4DSAA 1QYVA 5AXCA 4QGAA 4U7HA 3VC1A 4X7PA 1CUKA 3H97A 3D3KA 4NBWA 3TFQA 2O5EA 4H08A 4C01A 4YJ2F 1IUKA 1XMPA 1OFTA 2IX9A 3AV0B 4PYIA 3HHXA 1CR0A 1QK4A 4I4TB 16PKA 4TUYA 4ZO4A 5BT9A 2AI3A 1R9JA 1E2EA 3B7WA 4ZQBA 3S1SA 2XXAB 1FQJA 2YNMA 4BEJA 2E55A 1EQUA 3GLGE 1WB4A 3I4CA 1MGOA 4K9QA 4Q4JA 4ZYYA 4YP5A 4HZGA 1WMAA 2EOAA 4NESA 4P53A 2B1RA 1GGEA 4G3OA 2PRYA 5DLYA 4B7AA 4FVTA 4DRYA 5J47A 1OLSB 1W19A 2WZBA 5FBLB 5G41A 1L5NA 5M34A 3IKMB 1H2WA 3USES 4NCIA 5KNCD 3U4HA 4PHFA 2GO7A 4BCCA 3T1TA 2TMKA 2KM1A 3A9SA 1ID8A 1RDFA 4RENA 2WJAA 4MV1A 3J27B 4ZI3A 1AKYA 4FB5A 5JS8A 1C7YA 4L8RC 3SF8A 3WKCA 1O87A 4H0CA 4B7CA 4B3SM 2UZ3A 5EIXA 4O3MA 2AOWA 5LBIA 2PWYA 1GTRA 4GAEA 5C18A 4AG3A 2DKOA 2IHTA 1JQ3A 4GNKA 2Z2JA 1ID1A 4OIFA 4WLEA 1NBOA 5ADWA 1EIWA 4HWOA 2ZB7A 1W2HA 1AA6A 3EISA 1XR3A 4AFNA 1EVZA 4HLUA 4FMCF 4ZU6X 4BMYA 4K8RB 1A4UA 4HB2A 3NHYA 5CFRA 1NE2A 2ACWA 5CBKA 4XUDA 1N75A 1YS6A 3DO8A 5TQ2A 4AZ0A 2O8EA 1UJ2A 3PCRB 2QR5A 3JQRA 4OJMX 1W9MA 3MT7A 4BO6A 2GERA 4X3CA 1X0XA 3IHPA 3BZWA 3KQMA 3KTAB 4D9HA 3FTFA 1JHAA 1PK7A 4H31A 4M1QA 3MT9A 4E5KA 3UMBA 1FX0A 3C3WA 1LVUA 3C1TA 2WTUA 4HWTA 4TWIA 3TKLA 3PXBA 2B0JA 3KCNA 1FPQA 4UPVA 1PL6A 4TLEA 1HNWB 2AKAB 3TCKA 4OHUA 4PS0A 2WKWA 3SASA 4D57A 1N7GA 4NATA 1KRHA 2RKWA 2C04A 2I22A 3AHJA 1XX6A 2QD4A 1JFRA 4XUGB 3M6VA 2NXJA 4ZYVA 2GYVA 3B82A 5KDLA 3KQOA 4PN3A 5KEIA 3R9WA 1DQRA 2GNOA 4OQNA 3IAM6 5FNVB 1MAVA 3TLAA 2GPTA 2XZPA 5I3CA 1XLTA 2GO1A 3QBEA 3ESAA 2D0OB 3LXMA 2DZOB 4UDNA 5DTRA 4ZV7A 4KQ9A 5HOEA 1AV7A 1W47A 3KSMA 3LX8A 2PSJA 4XX0A 1KIMA 2X1VA 3OY7A 1JIIA 3SHGB 4QYIB 3ZLJA 2K2QB 3K4HA 2E85A 2R44A 4PD2A 3M33A 2HQRA 2X3YA 3ZZMA 5KVVA 1T3ZA 5JJ5A 3JWPA 4KN6A 4P82A 5ARDA 4FDTA 5JSKA 3F92A 2RHDA 3IHTA 4PAWA 3NDIA 1EI9A 2BMDA 2Z2XA 3DEAA 1E1QD 4WA8A 2D3TA 1XRRA 1EFPB 4CM9A 2O2XA 1H5UA 3QYJA 5BSUA 2XECA 4DUPA 5K01A 3G89A 1MW8X 3EK2A 1M76A 1EUYA 1J24A 3ZXUB 2DAMA 1UQUA 1WULS 1ZBDA 3U7HB 3BH7A 3IP5A 2DY0A 4V0OA 1EM8A 4C5AA 1Z5VA 1KKUA 5KOYA 3P9ZA 1RC8A 3ONWA 2G83A 3G2NA 1L5YA 1CUCA 1SXJE 5TMBA 1NSFA 2FG5A 4DMRA 5KO2A 5A6VA 3TGWA 3TLGA 1JKIA 5DYYA 3I8XA 2P9GA 1DKUA 1CC1S 2JK0A 3U4DA 1R2ZA 2I7DA 3TWKA 3FZGA 4BP9A 4EY3A 1TVMA 1H2XA 2YZGA 3QF7A 2JHAA 3I4LA 3KJIA 5SV2A 5L7WA 1G6KA 1QIHA 3SC6A 3LC1O 2KX7A 3D8TA 3J80A 1U7DA 2E1RA 1PLLA 3LWBA 3QQPA 3K2QA 3UHJA 3LY9A 4YUAA 1YA8A 2A5JA 3A25A 4V1CB 1DX9A 2JJ2D 4EJSA 3L2AA 1GSOA 2ZI3A 3E9MA 5KTKA 5L51A 2C7OA 3LF1A 1BMQA 2VPTA 4GMHA 4IMRA 1AQLA 1C80A 3L41A 4UM9D 3I04A 4G8JA 3U81A 1T13A 4XTCS 4PF1A 5KYUB 1FS5A 3QFTA 5J2TA 2JIRA 2EZ9A 3HDQA 4DNXA 2JAWA 2FZGA 4ESHA 3VJRA 1Q0UA 2P5UA 3LQKA 3AEYA 2WU4A 1CB0A 3L07A 2PZEA 4W5TA 3THWB 1AXGA 3RREA 3IP3A 4YR7A 1A95A 4AUNA 2PX2A 5JVDF 3PGLA 3EW9A 3C7DB 4KO4S 3JD1A 1MXFA 1X1TA 3JQPA 3T7KA 4F4IA 3NP7A 4R1QA 1V8DA 5K3OA 2V4ZA 1N2BA 2E49A 5CVDA 4C43A 3L9XA 1Y5NA 4JL8A 1N57A 1VYTA 3FIUA 4MW2A 3ZZ0A 4AMVA 2L4FA 1N6NA 4HUQA 3QY9A 3N5KA 1YTUA 2CNOA 3BCRA 2FSPA 4LV8B 1PQYA 2HRBA 2Q41A 2ZRDA 5DEIA 2AYYA 2RARA 4QXQA 1KZ1A 1RYBA 4RXMA 2F9MA 1FSPA 3L8DA 4YJHB 3GWZA 4POOA 1U3VA 4O4JA 1Y1TA 4E5NA 4UDOA 2WUVA 2H1IA 4W5HA 4B6QA 5AM3A 8ABPA 3MWGA 3EF3A 4GOXA 3ZV7A 4ZCIA 1DMSA 1FRVA 3CX7A 3G2JA 3VUEA 2HLDA 4L02A 4JYBA 2BGIA 2BFCB 2BDUA 2QG4A 1W8DA 4F06A 3SFTA 1RXCA 1IY0A 1YBFA 4FI3F 4HDRA 4PS1A 2OCPA 3E8MA 1RLOA 2K9DA 3GLFA 2EHJA 2XUJA 4OGWA 3WADA 4C88A 5KHAA 2OOAA 2PX8A 1SUPA 2CNLA 2YVAA 2EZ8A 3T1HM 4HPJB 1SOMA 4MUMA 4MRPA 1G7RA 4O4LB 4PY2A 5F2EA 2VPPA 2YJZA 4KO8A 2BMAA 3RGGA 5AJXA 2XB2A 3FPCA 1V48A 1YR3A 1TDJA 2CY0A 3OQ1A 3PPXA 4QGBA 1Z83A 2FETA 3IJEB 4WI1A 3PDWA 1DHTA 2ADMA 1KU6A 4H3SA 8LDHA 3BN3A 4HNHA 4NDAA 3WLAA 4LQLA 3ZXYA 4LWOA 3L8GA 3VKHA 2VDRB 3P0HA 2VSQA 1MABA 2YWRA 1VL6A 1N36M 3CUVA 4I5FA 3ZLBA 4DADA 3ZCSA 2HA0A 2PJZA 4ZT5A 4YRDA 3VR4D 3HGQA 3CBQA 4R9NA 1LSUA 4LRXA 3C24A 3JWEA 5CT5A 1QQ7A 5CW1A 4ZYZA 1V1RB 4JUIA 3TEFA 1YJBA 5HS6A 3HHYA 4URXR 2OFXA 3NEJA 3OPMA 1E0SA 3QENA 4EMTA 3HKPA 1Q1GA 1QGDA 4ZMSA 1AK9A 4DV4M 1KZ7B 3QXJA 4JC4A 3ZN2A 5E7IA 5BNZA 3U4MA 3MS2A 2R62A 3HBFA 4KXYA 5TT0A 3C39A 1UFVA 1K9SA 4HVAA 1HRDA 1ZIPA 2QM0A 2WJPA 3A8TA 3ZD8A 3U5ZB 2YCLA 1OE0A 3GDGA 3VAAA 4RTNA 3EFEA 3EJ6A 3X1YA 4IRUB 1AJEA 5U1PA 5BRNA 1XYYA 5KB3A 4CT4B 1KQGA 1M0WA 1L9XA 4H16A 1C9DB 3DGFC 4ZZ0A 1TJ3A 2ISQA 4KTVE 3GRRA 2A5LA 3PRJA 5BUZA 3DZDA 1K4KA 5DK4A 5HTKA 2DKFA 3AFHA 2G1AA 1NX9A 2BEVA 1G21E 1L7EA 2QVZX 4HDNA 5EAIA 4LMRA 4X20B 4GI2A 3UWKA 1VMDA 2OXTA 3PUWA 3D3NA 1DC7A 3KDPA 4Q9KA 4Q1DA 3W3AH 3A7EA 2IYUA 3FLBA 4QIHA 4UE3S 1H2EA 2QT0A 3NWOA 3H16A 1YLAA 4C3UA 2PSDA 3EIUA 1XEWX 2PEYA 2XA9A 2QQ8A 3KB8A 3KE9A 4L8LA 3LLVA 1DRWA 4IDOA 5ARCA 4C0KA 3O82A 2V6ZM 4KLRA 5DMHA 2JXNA 1AIPA 1P17A 2FZ4A 4NG5A 4CWAA 3OFVA 4PGHA 3K0SA 4JGIA 4PX9A 3ENQA 3KEMA 5E2BA 2DXIA 3ICEA 1U9IC 5EWJA 4MKGA 3BIXA 2GZRA 1BSVA 3NTQA 4EJ0A 5IVKA 3RTAA 5EXPA 1NE7A 1SVSA 1ZHFA 3WB0A 1U2PA 3Q7PA 4HP8A 1RQXA 2W6MA 1OKKA 1J8YF 1R5BA 2I80A 4UTXA 2GJ9A 1GSHA 4LV6A 3NHSA 3W1WA 2EL9A 3RS4A 5J43A 3GIWA 3W6OA 2UUAM 2I4RA 3A70A 1MB4A 1EP1B 3U31A 2CSXA 4EUSA 2EZUA 3AJIB 2W48A 2QM3A 4X64M 4MB7A 4JT4A 2P9QA 1W0KD 4Q16A 1FK8A 1SUEA 3QLVA 5C4GB 1VXOA 1L5HA 1V6AA 4B6FA 1N34B 2ZWVA 4ML3A 1E9SA 4NRVA 4FVMA 1P2DA 1LD3A 1PGNA 1NOKA 1S9DA 1XU7A 2BHSA 2X2PA 3DL0A 3EODA 3OX4A 4YN3A 3A42A 1EFRA 3ZIAD 3PNMA 1DNPA 1WKCA 3K0BA 1JJBA 5E9AA 1UWVA 1J2EA 3EW7A 3MWDB 3RT7A 4JGGA 2AUTA 3EXG2 4MK4A 4LOAA 1N1DA 3FUVA 1E77A 3MMSA 3UMGA 5HKOA 4JHXA 2OBNA 1E6CA 4OL9A 4DARA 4Q7QA 3MIZA 2FR0A 2C59A 2HHJA 4B6PA 1F7UA 1X7WB 3K8ZA 1FUUA 3K9NA 3Q5EA 5GONA 3RRBA 1KZ4A 4DV7B 2IEGA 4TN1A 1WUKS 2HD4A 3D0OA 3ROEA 4E2WA 2H2IA 4DM7A 1BCRA 4E3WA 3GIDA 2Y05A 3IOCA 5BV2P 1ZLYA 4D8UA 4CKEB 2WNIA 3N6XA 5JHHB 4TMVA 3NM5A 3N2EA 3V7WA 1L5HB 1QBKC 3C6ZA 1RCTE 4YRNA 4IBOA 3I83A 3MUOA 2AFHE 2G1UA 3G1UA 1WSWA 2FWAA 2HLHA 2JCYA 1RRMA 3CE6A 3HJGA 4QYWA 3M2PA 4DZZA 2EW8A 3OA0A 5HK8A 5B1SA 1XTRA 5FTJA 5JJKA 4FBMA 1Y8GA 5BV0A 1JHQA 3KJGA 1EKXA 2H1OA 1A3CA 2AH5A 4B85A 1IY2A 3V5NA 3O8LA 1TQHA 4Q39A 5JJIA 3EZGA 1X7ZA 1ISHA 2OBYA 1OYWA 4REZA 1F4IA 4JZKA 4CKEA 3JALA 4ZT6A 1UK8A 2AFHA 3PEVA 3KSAC 1TKCA 2C9ZA 1QV6A 2HJRA 2EBUA 4XQGA 2OP0A 1FDTA 2N35A 3MCVA 3BMQA 8ADHA 4FMDF 1QRDA 2IS2A 3GO4A 3W2IA 1JECA 1E1QA 4D92A 1CKEA 1R6XA 4IDBA 5K2OA 4F5WA 3QYAA 3H0EA 3BVPA 3BXXA 3D8BA 4QUGA 2D2EA 4DSTA 1U0FA 2FMUA 4WQMA 3NXKA 4RWZA 4XM0A 1JALA 4H1TA 1XZJA 3ABOB 3T94A 4AO8A 4KHPB 3GQBA 2VUSA 2C4UA 2CDAA 1DQPA 2VJMA 1ZUIA 2J6CA 3RVOA 3C5HA 1K9VF 1Y42X 2YC2C 4D9NA 2VK2A 3VZPA 2MSKA 2Z3ZA 2I6UA 3PYXA 4FGSA 4IDNA 4RIFA 4QYIA 1XSEA 4ZT2A 4Z3DA 3UCEA 4AIRA 2G6TA 2H2AA 5IT4A 4WCFC 1OHHA 1PJAA 1CERA 1UBGA 5FQNA 1G1AA 1H6BA 4IGIA 5K0GA 2AL7A 4XLZA 2D5IA 3UJDA 1BA2A 3CNOA 3KOMA 4CDNA 2V5AA 5LD2B 4XWKA 1ZM4A 3VU9B 4FDLA 1Q7RA 4M38A 2AZMA 1TD9A 2I71A 4KC0A 1ZRMA 2QTTA 2DJIA 1XALA 4YONB 1QKJA 3WGGA 2QVLA 1UJ5A 4PZUA 5DNVA 1LDNA 1EGAA 1Y34E 1H6DA 2PQ2A 3PDIA 2CNWD 4WOBA 4DVGA 3CIFA 4H2DA 3FTPA 2OAEA 3G2PA 3UJHA 4KCGA 1KOFA 2ID4A 3RGPA 1IN8A 1U0HC 4JQYA 4O4IB 3D6AA 2KRUA 3S2IA 4DIMA 3SAWA 3KUDA 5KYKA 2OK7A 4DREA 2BFEB 2LIVA 1Q0PA 3N74A 2XODA 3FCYA 4UXHA 1M34B 1PS9A 1TYZA 2B4AA 2W0SA 5EJGA 4MH0E 3TNYA 3WL3A 4DUYM 2CYAA 3IUEA 4QJIA 5K8CA 4NC9A 4U3JB 2XHEA 3V4ZA 5E38A 1E9AA 2W00A 1OLUA 2A58A 2ORED 5ECYA 1F0KA 3B6ZA 1CYEA 3I4VA 2IY7A 1HDZA 4RVOA 1DQSA 2FP4B 2FUCA 1UBLS 4Q00A 1P62B 2IT1A 3ZCUA 1C9JA 2PX6A 4LS3A 1D2EA 5LXTA 4AMZA 1BRTA 2V1CA 2JC3A 1P81A 2QL6A 4DM3A 3SFZA 5ITYA 1D4ZA 2AC7A 2FPPB 1A5ZA 1C8BA 4WOKA 1TTPB 4CM8A 3NOVA 2HQ1A 4PV7A 4CM5A 2HBQA 5DSZA 2QLJA 1NQ5A 3WHPA 3GPCA 4JVSB 4KO2S 4H7FA 3SDZA 5HSGA 3C85A 1NGSA 3KPUA 5D6NA 3ZGOA 3FLEA 2QS9A 1TD1A 2XEDA 3L02A 4MITA 2XBUA 2J3LA 2XCQA 5IXSA 1GO5A 4ZARA 5C8YB 6ADHA 3DL7A 4ZOEA 3DBRB 1E1CA 4F9GA 2HF9A 5SY6A 1ZK4A 3NWLA 1A98A 1Z82A 2J3IA 4DKXA 4DT1A 2AHOA 3LW5F 1RPTA 2FOLA 1UJ6A 1LLDA 1TJYA 1ILWA 1UMDA 2WQZA 3N2GB 4MW6A 2V3CC 3AIMA 1NYLA 4QU0A 3GT4A 1XZAA 2NUTB 4UQOA 4XRGA 3HNOA 4JI1M 3IPRA 4LAFA 4TVKA 4EH1A 2LRHA 2WVGA 1M5RA 4M7PA 3DZJA 4WY5A 3IQGX 5ELLA 1F9AA 4QRDA 2MJ5B 5ELMA 3NJ4A 2HMYB 1RI3A 1T24A 4R9RA 2PWAA 3EGOA 2XZDA 4KRGA 4DMMA 1ETUA 2OUKA 4MWGA 4AZFA 3UO8B 4HLDA 2PRKA 5CG2A 1OIPA 5BPVA 3BXWA 1MAHA 3LMKA 5J1TB 4A9AA 4OLHA 2QUKA 1XXHE 9LDBA 1Z4NA 3E7FA 1SH7A 4OPMA 1JVBA 3STUA 1LBEA 2VK4A 1OPRA 1QCDA 5KAPA 3AONB 3HXLA 3QXXA 2N42A 4HVTA 1JAHA 3E61A 1ADCA 3EBPA 4FDMA 2J0VA 3QI7A 1QQ6A 1J1UA 1JQDA 2BLNA 2CLOB 2NQ8C 3N2KA 1V35A 2ZSFA 4ZYUA 1QO0A 1SCUA 1Z6PA 3SJAA 5LKAA 1JYSA 3FPJA 4F3RA 1N3YA 3EXEB 2GZ3A 4L7VA 4L28A 4UFOA 4TWRA 2W2OA 4XCQA 5HMLA 2J3JA 4Q21A 5ICEA 3CTMA 3JTEA 4QBKA 2XMBA 1N8TA 4L8YA 2GZDA 3VDQA 4U2EA 4C89A 2ANBA 2QG9A 2O25A 1F2TB 1HLFA 4IZ6A 3U60A 2H1CA 2AFRA 4G0PA 4DLNA 5CFZA 4KZPA 1EDEA 4HBZA 4COKA 5CFOA 4OXXA 4B87A 4F2WA 2TECE 4FSHA 1ESCA 4TS1A 1I7NA 3EUAA 3WQBA 1HFJA 2QR2A 4QOJA 2D06A 1CY6A 2LXNA 5KCZA 3R76A 2OORC 2ZAGA 2W70A 3REQA 1KSFX 4QYTA 3GBPA 4N39A 1BWQA 3NANA 1QHGA 4JOBA 1NX6A 2WD7B 3AF4A 1CQWA 1JEQA 3EC7A 3IEPA 2Z5LA 3LHFA 1ZD3A 3H17A 1GDTA 3KYBA 4NV1A 3H86A 5HFAA 1KU0A 4CR6A 1NVTA 3PHCA 3SZUA 3QVXA 3VYRB 3OQHA 4GG1A 2PMBA 5KAMA 1GSAA 4UUMA 4UU8A 1VG9B 5EXEA 1RWKA 1S8AA 4JLWA 4RMHA 3G7SA 3RTBA 3ZHTA 5LZ5A 2GQFA 1SVOA 5EWLA 3LMMA 3EG9A 3F47A 1M2JA 2NU7A 1U2GA 2OM6A 3CHYA 3HZOA 5SYAA 1OFGA 4UD6A 3STHA 621PA 1Y1PA 3CIOA 2F90A 2CHEA 3AJAA 4EA8A 1TYCA 1Q20A 5HX7A 4MMYB 3U0BA 2RGEA 1NPTO 4MHSA 4TT3A 2BTQB 1GFSA 2AB0A 5KQDA 2A4MA 1XTKA 1JDNA 2CKMA 3ETDA 4JH0A 3SYTA 1CVRA 3O03A 4UM9B 2PFSA 3WL4A 1TW3A 1U7WA 1NDUA 1DG1G 1T4MA 3DKPA 1QZMA 1ZJ4A 4YACA 3WGUA 3B6IA 3A37A 2FQWA 5JFGA 2Q1SA 2LBCA 2HRRA 2I29A 2VPQA 3AY6A 5ITXE 4ZYXA 1QM5A 1I1NA 1UAYA 1OTXA 5DASA 1NW7A 1M1YB 2J08A 2VDQB 4MW9A 3STWA 2VLBA 3B6MA 4PONA 5AJVB 2CMFA 1FMLA 2OV4A 5DH9A 1EHYA 1XV5A 2QSUA 5I7EA 5D87A 1ZW6A 2FSHA 1KJIA 1V33A 3CBGA 4MYSA 1YR6A 2BISA 4ABTA 4OJNA 5ALSA 1LRLA 1UXKA 2ZT8A 4CLDA 2O8FA 1ZKMA 1UL1X 2XT0A 3P0JA 3TF5A 4NI5A 5FLKA 3FOEC 2QMEA 1Q83A 5B53A 3EZ7A 5IYZB 1A8IA 5DCYA 3AG6A 3IDOA 3WB1A 2YMLA 1DV2A 3ZVLA 1DWUA 2GKOA 3RBAA 1KRXA 1E2IA 3IJRA 1Y1LA 2NVUA 3QJYA 4PPYA 3EGDB 4KUEA 1M66A 1N2GA 3K0FA 2VWGA 3GK3A 2Y1WA 4XUCA 1A9XB 4MKHA 2GJ8A 4MZDA 5ALUA 2ZR8A 3B9RA 4QOGA 5IVIA 3ROGA 4GGPA 2NU9B 4J2OA 3LLMA 1PG5A 1WLSA 2XTNA 2V7EA 1Z59A 3T15A 1H5NA 4IJQA 5EXDA 5H9WA 1XZIA 1ZCAA 1ZNXA 3OZCA 4DV6M 2OBXA 2DG2A 1XMOB 4Q1BA 4N7MA 4FZRA 4LGYA 2FAXA 1FQOA 5AI4A 3FN4A 5E6RA 2IS4A 1FTGA 4KYVA 1I0LA 1T8SA 2VYVA 1RPZA 2FOIA 1RXEA 2YXNA 4DBLE 2J7PA 4KMMA 4NZMA 2EFJA 4AVYA 2XFTA 1I80A 3G2LA 3UFXA 4BNYA 3E46A 3OPVA 4REMA 3TKAA 5F78A 1AGPA 3H1PA 2NSYA 3DMYA 5EE3A 3ZBPA 4A2CA 3OZRA 4KIUA 2X8BA 2FFQA 2JFOA 5DI9A 4TV8B 1GAXA 1JEOA 1L5QA 2ACVA 3STXA 4EHHA 5CDUA 3DV0A 4NRWA 4A0SA 4N48A 1NXVA 3B3FA 5ISMA 1P0PA 1WXHA 2QZSA 3VVCA 4XVRA 4GE3A 4OFBA 4BUZA 4JP5A 1RAGA 3BBLA 2XE8A 4LDRA 2ZU0C 2AWNA 3KHSA 1C9YA 3V1NA 3FX2A 2FU5C 3TVTA 1ADFA 2ZYGA 1DGQA 4LXIA 3AZOA 5CA0A 5EN4A 3I8SA 3ZDBA 1YZGA 4Q1EA 4IOKA 1KC3A 5SZHB 4C6RA 1QGUB 3DP7A 2V7PA 3M81A 4L85A 2QZJA 2R6DA 3B6EA 2DWCA 2UYQA 3D7MA 4Q3BA 1YRAA 1ZAEA 2OGZA 3AB7A 4Y9DA 3IMFA 4HEA1 2B25A 3PRYA 1PAUA 4Z1OA 5KYYA 5H1YA 3S27A 3WKBA 2HSWA 3L5KA 4DUGD 5K4HA 1O5TA 3PA8A 3LV8A 1F8UA 4M0PA 4D9MA 4MDFA 4DLTA 1Y4UA 2PRIA 1CS0B 2XUPA 2AK2A 3CKMA 4DA7A 1G19A 5KJEA 3JYNA 5JS6A 5ALHA 5IT5A 3GAZA 1GTL1 2P5TA 2EFYA 2BAGA 2Q7XA 5C1OA 2VP3A 2PUCA 1L5FA 2B99A 3V1KA 1SR8A 3FYUA 5I7OA 3AKCA 2AQHA 1Q3BA 4J3FA 4QODA 1KMMA 2IEDA 3K8QA 4GHWA 2FCRA 1LI4A 3FNFA 4Y6PA 3UANA 4DBVO 4BRZA 4ZANA 3IDSA 3EDOA 1LEHA 3MGBA 3DXZA 4PZYA 3WQRA 4ARIA 1LTMA 4B47A 1OV4A 5JAMA 3JRWA 4MYHA 5AKHA 2Q0HA 4QGHA 3X1ZA 5A5VA 4QGSA 3VDPA 4QREA 3HVKA 3RS8A 3THOA 3DZ8A 3IBCA 3TTXA 4LRTB 2FMTA 4AJJA 3FYTA 1U3FA 2VNAA 4Q15A 4RD6A 4JI5B 4MLPA 5HIAA 5J4HA 1QZEA 1NFQA 1XLVA 1PRYA 3BL5A 5IZCA 1X1QA 3PFFA 3CVOA 3FE2A 1PUIA 3EIHA 3PK0A 4HO1X 1WMEA 2ZIVB 5EIFA 4HDOB 3R3ZA 2XXAA 1DPFA 3ASVA 1WIWA 3GLQA 3OECA 1MT3A 2B20A 3K9HA 3OQPA 3AR4A 1V9SA 2QPTA 3NZEA 4F4UA 3KJNA 4LBWA 4GR9A 1VIAA 1WB9A 4DR7M 1B0AA 2Q9UA 1LK7A 4I55A 1IIRA 1NT2A 2HNAA 1U1DA 3SS8A 1KSGA 4DJEC 4B3RB 3HJ8A 3STVA 3RS5A 5FUMA 1MNAA 1P0FA 4B71A 3TRJA 3LPDA 1H9BA 2R9VA 1XKTA 2QSJA 4HDSA 1QFZA 4LGVA 3PI7A 3GPBA 3BXFA 1DJQA 4FYJA 3S68A 3FH0A 1CRQA 4NY1A 2JH9A 3HKCB 2R68A 3LPMA 3V32A 3HMQA 5IEJA 1BJRE 2CN1A 1SCIA 4PXSA 1CV2A 4WINA 4Z4HA 4LECA 1JYFA 2P79A 3WFJA 4RIGA 1KO1A 4AWAA 4QAQA 1NPYA 3CGWA 2VBIA 1PWXA 2CP8A 4NC6A 5LU8A 2TMDA 5TIIA 3SM3A 2O4UX 4UFPA 2CE2X 3RODA 1C7ZA 2JJ1A 5KSZA 3N05A 4JGBA 3K2EA 1KJNA 4KQKA 4LNUB 5C2JB 4PLFA 4XCVA 2DQYA 1ISIA 2HSEA 2MT9A 2GCNA 4MI9A 2QTBA 2C2BA 1BN6A 4P86A 5A3RA 3TWMA 1TCAA 2BHRA 2ZBUA 3MQ2A 5KYNA 1UZUA 2W6QA 3K4PA 3PFCA 1THTA 2J33A 4MVJE 2GPSA 1G18A 4ABYA 4HDCA 1O6BA 3LP6A 4QNMA 1KO8A 3HZHA 3N2IA 4Y6LA 1MH1A 1B41A 1KKMA 3NPAA 2G71A 5PGMA 3RIYA 2FP3A 1C7IA 3T5MA 1LTKA 1D1PA 1TQ4A 1YVUA 2WMOB 1EFKA 1X8XA 1YZTA 3ABQB 3IIEA 1BN7A 3HGMA 4UZEA 4HTAA 1E9DA 1GRRA 3TZ6A 5KYYB 3ZE2B 4JUAA 1ECCA 1OR8A 1VFNA 4KDRA 2VF4X 2GM5A 2JFXA 4XQ0A 4X64B 2UUOA 1EUQA 4EYSA 4P7BA 3FOZA 3W34A 3C5VA 3TM5A 3IMGA 4OSOA 1RMTA 3L25A 4XR4A 3BTVA 2BFFB 1FFGA 1ZOPA 2AN1A 4IIJA 4C0LA 2WT8A 1MVNA 2XYPA 2AHMA 1OWOA 2XUFA 3EVBA 4X3PA 4CLOA 2ATIA 5FBKA 2TMYA 2HXYA 2ZIXB 3FIJA 3HCRA 3NAZA 3KKEA 4G8CA 3OX1A 5K6TA 5FOSA 3HWSA 4OGGA 1P3JA 1M34A 2MSLA 1R5LA 2NXNA 4UUAA 1P72A 1RP1A 2X23A 4MWBA 4DR5M 3A2MA 1UDWA 4P7KA 1ZH8A 3I1JA 3PGXA 4V0ME 4IPTA 4BLSA 1DRVA 3B1JA 3QV2A 2GXAA 2GM4A 3NWEA 7AT1A 1LF5A 4Q3LA 1RR6A 2C5BA 3RYHA 5BSKA 3CX6A 4DAEA 4P83A 3HZJA 2XTMA 5CP8A 3OU7A 4FI3C 3L4KA 3HBJA 1TDHA 4S04A 1U2RA 3QPBA 1HWYA 4KEAA 3FTCA 1FL9A 2ZSDA 1E99A 3GJYA 3U9TA 2BGKA 1N1GA 3DBRA 1PYOA 2YXPX 4H18A 2VHYA 3AGPA 4M0MA 4YRJA 5L45A 5ULLA 1SHTX 2I4MA 4BV8A 1PGYA 4GO1A 3WHIA 2P40A 1E3MA 1F2VA 3W8RA 3V8VA 1R0WA 2PT5A 2XQJA 4ENSA 2HKIA 1E1NA 3GP1A 4R3DA 1CUDA 4JQSA 3PQFA 5EP1A 4NSNA 3CG0A 4ZAXA 2XRYA 4D9BA 1IBKB 1CZNA 4J0GA 4EEKA 1LBIA 3I2FA 4Q3CA 1XKQA 4C4OA 3CTWB 4MS1A 3HKDA 1EFLA 3LBHA 3I28A 3M9WA 2A9FA 4NCXA 1YFKA 2Y0QA 3JS5A 3QKSA 1UBMS 1QRRA 2WJHA 3DW3X 1ZONA 5TGDA 1XA3A 2O2SA 2QB5A 3WGIA 121PA 1HDCA 1HMPA 3BK1A 1NIPA 5ALZA 5LMUM 1BX1A 3DMGA 3M4ZA 1PI3A 3MUNA 4EHNA 1UMBA 5KNBD 1P45A 2VTBA 2F55A 4BC1A 1G4AE 1L8LA 1IXZA 3CVJA 3V6LA 2Q49A 4ACAA 2AZTA 1Z2OX 3ITDA 4PQYA 5JI2E 2ZSEA 1EBUA 5AO9A 4DDHA 4GRDA 3QFHA 2IW1A 1GFZA 2R84A 3E7WA 3AHHA 3AIKA 4G5SA 2YS7A 4RHYA 4DR1M 2BUAA 2FQYA 2N0SA 3TSOA 1KWGA 2ZZMA 2H4ZA 1LTHR 3P9YA 1B74A 2YIJA 4QTXA 2W2TA 3IOBA 4FZVA 4WKCA 1VB5A 5IXJA 1TUBB 1MZVA 2R96A 4J43A 2H1RA 1MVOA 2F3QA 1Z5OA 2RGXA 1PT9A 2BFAA 3ZW7A 1U8TA 4ZO6A 5E8RA 2ZUWA 4ARZA 1G7TA 1B93A 4QD3A 3W7AA 4YCLA 2WJVA 3KWLA 4WFJA 3LOPA 4IJKA 3UF0A 4ZGGA 4CLRB 1RYEA 1VIYA 1HDGO 1L0BA 3QEJA 4QFCA 3FCUB 5BQFA 1W1UA 4JA2A 5AW2A 4RHTA 3VR5H 3VR2A 2VQEM 4O4LF 2CD9A 4QARA 2IIBA 1ZGZA 3DVQX 2XUOA 2P69A 3E9RA 4QT0A 3FB4A 1PR6A 1YBHA 4FP9A 4MR8A 5CYOA 3DCIA 3FVVA 3R6TA 3SJBA 4KXMA 1CT9A 3LVWA 1XN4A 4S2EA 2AV6A 4CCWA 4DV0M 2VZ0A 2C9MA 4X0EA 1X1CA 4HGRA 1ZH6A 5A4DA 3IAHA 3TXYA 4JODA 1WWKA 1VKRA 4BX9A 4Y1RB 1S2IA 1YC2A 1RLIA 4QASA 3TCNA 4ZPJA 1WEKA 1U3DA 4ZD6A 1QB7A 2Q3EA 1X7ZB 5ALVA 3R20A 4HLNA 3NUZA 2HEGA 4WFKA 1DBIA 3CPHA 2H5IA 5JCOA 3HFSA 2QN8A 1O7JA 5DLPA 1X42A 2JH3A 3SS9X 2UYYA 3V3KA 2NG1A 4K6HA 3S4YA 4TTQA 3MBKA 2F48A 3FRIA 1GAWA