3HHXA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhxA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhxA02
1DLQA 3LKTM 3HGIA 3PCGM 3LMXM 3LMXA 2BURB 1TMXA 3HJ8A 3I4YA 2BUVB 3LKTA 2BURA 1DLMA 1EOAA 1YKPA 3MI1A 2PCDA 3HHYA 4WHSA 3O6RA 1YKLA 4WHPB 3T63A 1YKOA 3PCBM 3PCNM 3PCJM 3PCNA 4WHSB 4WHRF 3PCJA 4WHRA 1EO2A 1YKMA 3T63M 2BUUA 1DMHA 3PCLA 4WHOD 3PCHM 4ILVA 4WHRB 2BUQB 1EO9A 4WHPA 3LXVM 1YKMB 3PCKM 2BUUB 2BV0B 3T67M 2BUTB 3N9TA 3PCIA 3TH1A 4ILTA 3PCCA 3PCDM 3I51A 3PCDA 3PCCM 3HKPA 2BUWB 2BV0A 1EOAB 1YKPB 4WHQA 1YKLB 3MV6M 3MV6A 1YKNA 2BUWA 3MV4M 1EOCA 1YKOB 4WHQB 3PCFA 2PCDM 3PCEA 2AZQA 3PCEM 3O32A 1EO2B 3HJQA 1YKKA 1YKNB 3MI5A 3MFLA 3PCAA 3PCMM 2BOYA 3PCBA 3O5UA 2BUMB 2BUXB 2BUQA 3PCGA 2BUYA 1EOBA 3MFLM 3PCMA 3HJSA 2BUTA 3LXVA 2BUYB 3MI1M 2BUVA 3O6JA 3PCLM 3PCHA 2XSUA 4WHOA 1S9AA 1EOCB 2XSVA 2XSRA 3T67A 3PCIM 1YKKB 5TD3A 1DLTA 4WHOB 4WHPD 2BUZB 2BUMA 2BUXA 3PCFM 3PCKA 1EOBB 3I4VA 3MI5M 3PCAM 4WHSD 3HHXA 2BUZA 1EO9B 3MV4A
chains in the Genus database with same CATH superfamily
4KLNA 1DLQA 1EE8A 1WXQA 4YHHM 3J2PB 1IBLM 3L25A 3LMXA 1VEJA 2LVAA 4GC5A 1N77A 1T43A 3AFHA 4CHTB 1TGUA 3B7NA 4ITQA 4JI1M 3UJNA 2APLA 2K47A 2LXEA 2R18A 4QNMA 3D8BA 5EJCA 2JP7A 4LFBM 2GQFA 2N35A 2RKOA 2OQ4A 2ZBKB 4I4LA 1ZMWA 3OTOM 3O6RA 2D7GA 3PXGA 3H4MA 3W0LB 1WHCA 2Y21A 1GO5A 5DYIA 1ZMVA 2DAKA 4GH9A 2C96A 8CATA 4NRWA 4FCTA 1SXJB 2V6ZM 2VDBB 4OW0A 2KRUA 3AL0C 3PCJM 3PCNA 2Z4SA 2C98A 2Y0TA 4YY3M 2CP8A 4LJAA 3U60A 1YLAA 3B9PA 1XXHA 2QHOB 3U6MA 1DGHB 2QBYB 2VQEM 2B3TA 4W5WA 3SHFA 2EKFA 4B7FA 4DV3M 5EXPA 3U61A 4M0DA 3PCHM 4WHOD 4ILVA 3IG8A 1T3TA 1S3SA 3DFZA 3GP1A 4RF0A 1KFVA 4JI6M 1W5TA 1C1KA 3K92A 1L1ZA 4IBFA 4CIZA 3T67M 2C9OA 4XBOA 2BUTB 2DENA 2VIIA 5DFLA 4F2LA 2R4JA 4LGYA 3GLIB 2EA0A 3PCCA 2DNAA 3A46A 4R3DA 2BUWB 2BV0A 3LCUA 3H4JA 3LCVB 4KODA 5LMUM 5ITRA 4JYAM 3MK6A 2LVQD 2Q2EB 1DMHA 2YFQA 3UK6A 4B7HA 4MGYE 1K3WA 3FTCA 2CV0A 3LQQA 1OFHA 3M7GA 4CJ6A 4EIWA 1LV7A 3TWKA 4LJ5A 2LBCA 1R2YA 1YKOB 3SC3A 1J09A 4CISA 3FE3A 3PCEA 3W68A 4DR1M 2W82A 2C9CA 1YKNB 3K9OA 1WGLA 2CE7A 3HU3A 3FRIA 4OX9M 3PCMM 2BOYA 5E26A 2XZUA 3FTFA 3O5UA 4IBEA 3RE8A 1N78A 1TH2A 2JWSA 2A5YB 1G59A 4FD2A 3PCGA 3VK7A 4PDGA 2F4VM 4AKHA 2DZLA 3E46A 3K2LA 3HZJA 2HAKA 4LZZA 4L78A 3ZH9B 1TF0B 2EJSA 3CTWB 4GIPA 4WURA 3PNVA 5ITUA 1XC8A 1IQPA 3L29A 1KSFX 1FJGM 2F5QA 3M6AA 3HU1A 2DHRA 4LJ8A 2BUYB 4S12A 3GO8A 4QOZC 1GL6A 1IN4A 3MI1M 1NHWC 1V33A 2V1CA 4G4RA 3T1YM 2BUVA 2J7NA 3O6JA 2C5RA 3PCLM 4I8OA 1Z5BA 2O25A 4JI2M 3IHPA 3GRVA 1CUKA 2C99A 2L4EA 3PCHA 2CRUA 3SYLA 1XB2B 3LMMA 1S9AA 5ITTA 1PGYA 1L2BA 3PCIM 1YKKB 5TD3A 3FUVA 4PCZA 2M60A 3U5ZA 5KPTA 2BUZB 2JA2A 4WW0A 4DV4M 3SYKA 4LFCM 3PCKA 4IJEA 2LHGA 3I01M 3K9PA 3F92A 5EXSA 5ITXA 1SG9A 2WSCF 4G3OA 4NSOB 4DBGB 2O01F 3MI5M 3AV0A 4B3RM 4GITA 2I7PA 2F5NA 1EO9B 4L16A 1DO0A 3GLGE 4PD2A 1K3XA 2L4FA 3NBXX 1NV8A 2UUCM 3LMXM 3PCGM 2BURB 5E6JA 1PJIA 1HT2E 1QANA 1EFUB 1G3IA 3HJ8A 4OVZB 4BLCA 1F4IA 3KOWE 3SHGB 1Q3CA 2FNAA 5JI2E 3LKTA 1QAQA 1Z5AA 1IXZA 2CHQA 3FUWA 3HHYA 5L8RF 1G41A 3D8LA 4X62M 1VEGA 4D81A 3JR4A 1C7YA 1TR8A 1YKLA 2KNAA 3GLHB 4RF1A 1J5EM 4CGYB 2DXIA 3GPYA 1YE9A 3PCBM 2I7NA 4LF9M 1OAIA 4LY6A 3PCNM 4WHSB 1I4WA 4ZPXA 4MB7A 3SAVA 2BJWA 2LVPC 4WHRA 4L15A 3Q8GA 2V1UA 2XH9A 3SAWA 2LWXA 3FRHA 2CV1A 4FCWA 2ZANA 3SATA 2KW0A 3GLFB 3KOYE 5BPVA 2D7HA 1Z5CA 3KS4A 5FTMA 4GKKM 2Z7JA 3LKTM 3PCLA 4IBKA 3SMSA 5C1BA 2XSZA 3GLFE 1PM5A 1GABA 4G4NA 2BUQB 1YKMB 3SBJA 1WGNA 3PCKM 3T38A 2BUUB 4M9SA 1UFZA 1XHBA 4QHTA 4IIWA 1A5TA 3TWMA 3HWSA 3L27A 4UN2B 3VKGA 2EKKA 1ZQ9A 4ILTA 4II7A 4REZA 2G8LA 2RRUA 1HT1E 1OQYA 1D0MA 4M0WA 1VQ1A 3IECA 3B7QA 3PCCM 1IXRC 1R4GA 2G3QA 3E9SA 3R8FA 2K9DA 4DR3M 1IN7A 3HHZA 4Z6YA 3U6OA 4DR7M 3KSJA 3CF6E 3GLGB 1GJSA 2X8AA 1HR0M 1HNWM 2H1RA 3MV6A 3HU2A 4WHQB 2ZTDA 5F3WA 3PCFA 2KA6B 3I04M 4DR4M 1GKIA 3PCEM 3Q8XA 1XXHB 1QAMA 3KXEC 4GC9A 3MFLA 1RU3A 1PJSA 2LH0A 3BXWA 4Z8XA 4LF7M 4Y28F 3PCBA 2KNVA 2BUMB 2BUXB 4LFAM 2OOAA 4MGIE 2CV2A 2DZOB 3E21A 4JI5M 3W0FA 4QHSA 4FW9A 2QENA 3GPPA 2EO2A 1EOBA 4Q7JA 3KDSE 4BBAA 2QSFX 2BUTA 2FH0A 3EIEA 2R46A 1DGBA 4JN6A 3LXVA 4FVMA 1R6BX 4LF5M 1V92A 4GKJM 4TUWA 3T6PA 3K1JA 3V76A 3GPUA 3WHLA 1JQJC 2CHVA 4NL4H 4AKIA 1N32M 1MX0A 4X64M 4NRVA 4FWHA 3A42A 2BJVA 4NC6A 3UZUA 2LVOC 3MHVC 1QUTA 3KOZE 4RNAA 2QQ8A 2M5ZA 1X37A 1VDDA 2KXEA 2R62A 2E5LM 4FWGA 2DWNA 1N75A 1DLTA 4WHOB 4GRIA 4L8RC 1H6UA 4P16A 3GLFA 1ZAEA 4WHPD 3ZQJA 1IN5A 2JNHA 4P17A 1OJLA 5KPZA 1IBMM 1Q3BA 1I94M 4LF8M 2KNZA 1JR3A 2WSFF 2FE8A 1L8QA 4I5SA 4WHSD 1JB0F 2K0BX 4GMQA 3EIHA 4DV6M 3PCAA 2XEPA 2XLJA 2KHHA 1DGGA 3MV4A 4WHPB 4MM3B 4AZFA 2J5YA 4PT5A 3CF0A 3SARA 2DI0A 1AUAA 1NHGC 1P3QQ 2JY8A 2HKJA 1BVSA 3BBZA 3HX3A 1Z59A 4LJ9A 3SMPA 2XFTA 4DUZM 1TMXA 4AKGA 2FOIC 1VDLA 3I4YA 5EP4A 3L26A 1K82A 5KPRA 2DVWB 2BUVB 2YQZA 2ZTCA 2FFJA 3DZDA 2L09A 4I81A 3L2AA 3GLHE 1IXSA 2LHCA 5A2QS 1EOAA 3W67A 1YKPA 1AIPC 1SXJA 3VLFB 2PCDA 4WHSA 1IN8A 1OKSA 4AW4A 4KT0F 2O5RA 1MJGM 3FUTA 2MJ5B 2QBYA 1DGHA 2QCUA 5EP1A 1PRBA 2NQ8C 7CATA 1IM2A 4WHRF 3JAMS 3T63M 3NWLA 3NBIA 4HLQA 4AG5A 2K6BA 1EO2A 2JZ0A 2L6OA 5BR8M 2KDLA 3GQ5A 1NY5A 1XNQM 2UXDM 5IZ7D 3THGA 3DOAA 4ANRA 3FD9A 1HNZM 1GLNA 2DZNB 1EO9A 4LCBA 1D0LA 4XK8F 5FTKA 4IBIA 1QYRA 1QZEA 4B3MM 3TQSA 2BV0B 2R6FA 3N9TA 4OVZA 3AOEA 2LTUA 3LQRA 1NJGA 3TH1A 1Y8GA 5DNYA 1OTRA 4HL4A 2QNJA 4B3TM 3I51A 3PCDM 1QDTA 1L2DA 2BNKA 3C3EA 1KYIA 2KZUA 3FTDA 3R9XB 1YKLB 4IBDA 2HCBA 2HL7A 3MV6M 1PJQA 2BWBA 3A45A 1WJ7A 1YKNA 5FTLA 3FUUA 2BUWA 3MV4M 1EOCA 3SFZA 2PCDM 1N34M 3LVWA 5EXTA 2AZQA 3O32A 3PNYA 1L1TA 3MI5A 1OIZA 1HQCA 3PFIA 3ZC7B 4DV1M 4OU7A 1E94E 2R65A 3TWLA 1E9RA 4X65M 2BUQA 1YUBA 2XZFA 5DYGA 2L2DA 1PJJA 4GHLA 1TDHA 1NNUC 2VF7A 4LZJA 1NY6A 2DAGA 2BUYA 3J27B 2L7HA 4DV7M 1DV0A 5JI3E 2UUAM 3PCMA 2Y20A 3UMMA 4DV2M 2AHMA 1IY0A 3DA1A 4F1IA 2D7EA 5KQDA 2JY5A 2X4AA 1SXJC 5FTNA 1IBKM 4L4UA 4DUYM 1GL7A 2HHHM 2DAIA 3GRRA 1D0KA 3HHWA 4LJ4A 4DV0M 4M9ZA 4KO8A 2DHYA 5KO3A 4QOSA 3U6PA 2XGNA 1SXJD 1HNXM 4AQYM 4AI6A 1XNRM 3GLGA 2MROB 1T6OA 3RGSA 4NSRA 1QVRA 2JY6B 1XWIA 3U5ZB 5EQTA 1Q02A 1NJFA 1PJTA 4LJ6A 5EP3A 2MH8A 3K8ZA 2KEBA 1TH4A 2LNHC 1L2CA 3KS8A 4L6V6 3U60B 2RGHA 4MGKE 3J7AS 2BUMA 2BUXA 1MU5A 1GVNA 1N33M 3U6DA 1HJPA 1W5SA 3I4VA 3B89A 3FKEA 3U6QA 2DAMA 3U61B 2L7IA 3QAUA 4DR2M 2XFSA 4DR5M 2BUZA 4M9XA 1NVMA 1WR1B 1ZMUA 2DKLA 4HEOA 4LGMA 3J81S 4G4QA 3HGIA 3C3DA 4XGIA 3C58A 3KVWA 2FS1A 2MGWA 2R45A 5FSWA 3KP1E 2WZJA 4G6ZA 4B7GA 3QYEA 1IY2A 4WP2A 4R71A 2BWEA 2H5XA 1NNJA 2UUBM 2UU9M 5IREB 4D82A 3GLIA 2DWLA 3GLHA 3U6CA 5C18A 2BURA 1OIPA 1V34A 4IBJA 2OOBA 4FCVA 4JI7M 1DLMA 3MI1A 2JY7A 1TDZA 2WSEF 3T63A 4LF4M 2JZ1A 3TE6A 3VDPA 2JXNA 4R7GA 1Z6TA 3SASA 5GKNA 4LG2A 1QAOA 1XMOM 4LRSA 4NXMM 1YKOA 4KHPM 2F5PA 2DWMA 3SAUA 4B3SM 1MN3A 3PCJA 3PVSA 2CWBA 4K0KM 3AOGA 3VKHA 2F5SA 3TL4X 2CUZA 4X66M 3FUXA 4LRTA 3J80S 2Y0QA 3A98B 1YKMA 4DV5M 3T1HM 1FNNA 1JR3D 1HQYE 1G4AE 1OAOC 1R5LA 1XXHE 2DWZB 2DAEA 4LF6M 2BUUA 3U6LA 1VEKA 3GQ3A 4WHRB 5FTJA 2KZSA 4D80A 4WHPA 4NXNM 1QUSA 2LVNC 1G8PA 3CF2A 3LXVM 3BOSA 4JXJA 4IBGA 3RGPA 4GEWA 1DO2A 5H37D 1QQWA 5ITXE 3RFWA 3PCIA 5ITQA 5EP2A 2R0IA 1IN6A 3AJIB 3B74A 3FYCA 4FWDA 1ORYB 4QNRA 1E32A 3KOXE 5ITYA 3T15A 3U6EA 4JI3M 2R4EA 3HKPA 3IG5A 3PCDA 3QYBA 3GLIE 1J7KA 1IXSB 3ZCBB 3KFUG 1EOAB 1YKPB 4WHQA 2X49A 3KSXA 3LVVA 4MGZE 1NV9A 2YR0A 3AKZA 1N36M 3C9PA 3U6SA 1Q39A 3CGWA 2OO9A 3TPZA 3FTEA 1R2ZA 4JI8M 4JI4M 2CHGA 1QDRA 3HJQA 1NSFA 4B08A 2OPFA 2F5OA 1EO2B 2VF8A 3LW5F 1YKKA 1OFIA 2UXCM 4GHAA 3AOEC 1R7RA 2P5TA 1ZV1A 3GRYA 2XSZD 2QPAA 4JI0M 2UXBM 3L28A 1DGFA 1IFYA 2Z4RA 1LTMA 3MFLM 2VQFM 3HJSA 1VG5A 2ZAMA 3QWLA 1NO1A 2Z8YM 3FYDA 1SXJE 3B7ZA 1D2NA 2R44A 2ZM6M 2ZAOA 2MR9A 5IT9S 2CEAA 1TH3A 1WIVA 4PDIA 3VFDA 2HWJA 1JR3E 2YNMD 4A3VB 4MH0E 5KQ8A 4G4OA 3VDUA 5IWAM 2XSUA 1YSYA 3MMPA 4NOOB 4AG6A 4WHOA 3J7BA 3VK8A 1EOCB 4JV5M 2QZ4A 5FLXS 2CFOA 1TTEA 3GRUA 2G5GX 4LJ7A 3GPXA 2JUJA 2XSVA 2XSRA 2ERCA 3T67A 1E9SA 3ILKA 5EXXA 4MGHA 3GQ4A 4RKUF 2GNOA 3JR5A 1XMQM 2KRKA 4DR6M 1G71A 4IJFA 1QZMA 3MJ5A 2RGOA 3WHKA 1IY1A 4IBCA 4BB9A 5LMNM 1GJTA 4IBBA 2Z3XA 1EIJA 3PCFM 3UGJA 2XF3A 3KP0E 2EUCA 3KW6A 1EOBB 2QP9X 3PCAM 3HHXA 2J7OA 3E4RA 3HY5A 3M0EA 1UM8A
chains in the Genus database with same CATH topology
4KLNA 1DLQA 1EE8A 1WXQA 4YHHM 3J2PB 1IBLM 3L25A 3LMXA 4GC5A 1N77A 3AFHA 4CHTB 1TGUA 4JI1M 4ITQA 3UJNA 2K47A 2LXEA 2R18A 4QNMA 3D8BA 5EJCA 4LFBM 2RKOA 2OQ4A 2ZBKB 4I4LA 3OTOM 3O6RA 2D7GA 3PXGA 3H4MA 3W0LB 2Y21A 5DYIA 4GH9A 2C96A 8CATA 4NRWA 4FCTA 1SXJB 2V6ZM 3AL0C 4OW0A 2KRUA 3PCJM 3PCNA 4WHSB 2Z4SA 2C98A 2Y0TA 4YY3M 4LJAA 3U60A 3B9PA 1XXHA 2QBYB 3U6MA 1DGHB 2VQEM 4W5WA 3SHFA 4B7FA 4DV3M 5EXPA 3U61A 4M0DA 3PCHM 4WHOD 4ILVA 3IG8A 1T3TA 1S3SA 3DFZA 3GP1A 4RF0A 1KFVA 4JI6M 1W5TA 1C1KA 3K92A 1L1ZA 4IBFA 3T67M 2C9OA 4XBOA 2BUTB 2EA0A 2VIIA 3GLIB 2R4JA 4LGYA 3PCCA 3A46A 4R3DA 2BUWB 2BV0A 4KODA 5LMUM 5ITRA 4JYAM 3MK6A 2Q2EB 1DMHA 2YFQA 3UK6A 4B7HA 4MGYE 1K3WA 3FTCA 2CV0A 3LQQA 1OFHA 3M7GA 4EIWA 1LV7A 3TWKA 4LJ5A 1R2YA 1YKOB 3SC3A 1J09A 4CISA 3PCEA 4DR1M 2W82A 2C9CA 1YKNB 2CE7A 3HU3A 4OX9M 3PCMM 2BOYA 5E26A 2XZUA 3FTFA 3O5UA 4IBEA 3RE8A 1N78A 1TH2A 2A5YB 1G59A 4FD2A 3PCGA 3VK7A 4PDGA 2F4VM 4AKHA 3K2LA 2XZFA 4LZZA 4L78A 3ZH9B 3CTWB 4GIPA 5ITUA 1XC8A 4WURA 3PNVA 4JI8M 1IQPA 3L29A 1KSFX 1FJGM 2F5QA 3M6AA 3HU1A 2DHRA 4LJ8A 2BUYB 4S12A 3GO8A 4QOZC 1GL6A 1IN4A 3MI1M 1NHWC 2V1CA 4G4RA 3T1YM 2BUVA 2J7NA 3O6JA 2C5RA 3PCLM 4I8OA 1Z5BA 4JI2M 3GRVA 2C99A 3PCHA 3SYLA 3LMMA 1S9AA 5ITTA 1L2BA 3PCIM 1YKKB 5TD3A 3FUVA 4PCZA 2M60A 3U5ZA 5KPTA 2BUZB 2JA2A 4WW0A 4DV4M 3SYKA 4LFCM 3PCKA 4IJEA 3GQ4A 5EXSA 5ITXA 4NSOB 3MI5M 3AV0A 4B3RM 4GITA 2I7PA 2F5NA 1EO9B 4L16A 1DO0A 4PD2A 1K3XA 3PCGM 2UUCM 3LMXM 2BURB 5E6JA 1PJIA 1HT2E 1QANA 1G3IA 4OVZB 3HJ8A 4BLCA 3KOWE 3SHGB 1Q3CA 2FNAA 5JI2E 3LKTA 1QAQA 1Z5AA 1IXZA 2CHQA 3FUWA 3HHYA 4X62M 1G41A 3D8LA 4D81A 3JR4A 1YKLA 3GLHB 4RF1A 1J5EM 4CGYB 2DXIA 3GPYA 1YE9A 3PCBM 2I7NA 4LF9M 3PCNM 4LY6A 1I4WA 4ZPXA 4MB7A 3SAVA 2BJWA 4WHRA 4L15A 2V1UA 2XH9A 3SAWA 2LWXA 2CV1A 4FCWA 2ZANA 3SATA 2KW0A 3GLFB 3KOYE 5BPVA 2D7HA 1Z5CA 3KS4A 5FTMA 4GKKM 2Z7JA 3PCLA 4IBKA 3SMSA 5C1BA 2XSZA 1PM5A 2BUQB 4G4NA 1YKMB 3PCKM 3T38A 2BUUB 4M9SA 1XHBA 4QHTA 4IIWA 3TWMA 3HWSA 3L27A 3VKGA 1ZQ9A 4ILTA 4II7A 4REZA 2G8LA 3PCCM 1HT1E 4M0WA 1IXRC 3E9SA 3R8FA 4DR3M 1IN7A 3HHZA 4Z6YA 3U6OA 4DR7M 3KSJA 3CF6E 3GLGB 3MV6A 2X8AA 1HR0M 1HNWM 2H1RA 3HU2A 4WHQB 5F3WA 3PCFA 2KA6B 4DR4M 1GKIA 3PCEM 3Q8XA 1XXHB 1QAMA 3KXEC 4GC9A 3MFLA 2LH0A 4LF7M 4Z8XA 3PCBA 2BUMB 2BUXB 4LFAM 4MGIE 2CV2A 2DZOB 4JI5M 3W0FA 4QHSA 4FW9A 2QENA 3GPPA 2EO2A 1EOBA 3KDSE 4BBAA 2BUTA 3EIEA 2R46A 1DGBA 4JN6A 3LXVA 4FVMA 1R6BX 4LF5M 4GKJM 4TUWA 3K1JA 3GPUA 3WHLA 1JQJC 2CHVA 4NL4H 4AKIA 1N32M 1MX0A 4X64M 4NRVA 4FWHA 3A42A 2BJVA 3UZUA 3MHVC 3KOZE 4RNAA 2M5ZA 1X37A 1VDDA 2KXEA 2R62A 2E5LM 4FWGA 2DWNA 1N75A 1DLTA 4WHOB 4GRIA 4L8RC 1H6UA 4P16A 3GLFA 1ZAEA 4WHPD 5KPZA 1IN5A 1OJLA 1IBMM 1Q3BA 1I94M 4LF8M 1JR3A 2FE8A 1L8QA 4I5SA 4WHSD 4DV6M 4GMQA 3EIHA 2XEPA 2XLJA 1DGGA 3MV4A 4WHPB 4MM3B 4AZFA 4PT5A 3CF0A 3SARA 1NHGC 4LJ9A 2HKJA 3SMPA 1Z59A 2XFTA 4DUZM 1TMXA 4AKGA 2FOIC 5EP4A 3I4YA 1K82A 3L26A 5KPRA 2DVWB 2BUVB 2YQZA 2FFJA 3DZDA 2L09A 4I81A 3L2AA 5A2QS 1EOAA 1YKPA 1SXJA 3VLFB 2PCDA 4WHSA 1IN8A 4AW4A 2O5RA 3FUTA 2QBYA 1DGHA 2QCUA 5EP1A 2NQ8C 7CATA 1IM2A 4WHRF 3JAMS 3NWLA 3NBIA 4HLQA 4AG5A 1EO2A 2L6OA 5BR8M 3GQ5A 1NY5A 1XNQM 2UXDM 5IZ7D 3THGA 3DOAA 1HNZM 3FD9A 1EO9A 1GLNA 2DZNB 4LCBA 5FTKA 4IBIA 1QYRA 4B3MM 3TQSA 2BV0B 3N9TA 4OVZA 3AOEA 3LQRA 1NJGA 3TH1A 5DNYA 4HL4A 4B3TM 3PCDM 3I51A 1L2DA 2BNKA 1KYIA 2KZUA 3FTDA 3R9XB 1YKLB 4IBDA 2HCBA 2HL7A 3MV6M 3A45A 1YKNA 5FTLA 3FUUA 2BUWA 3MV4M 1EOCA 3SFZA 2PCDM 1N34M 3LVWA 5EXTA 2AZQA 3O32A 3PNYA 1L1TA 3MI5A 1HQCA 3PFIA 3ZC7B 4DV1M 4OU7A 1E94E 2R65A 3TWLA 1E9RA 4X65M 2BUQA 1YUBA 5DYGA 1PJJA 4GHLA 1TDHA 1NNUC 4LZJA 1NY6A 2BUYA 3J27B 2L7HA 4DV7M 5JI3E 2UUAM 3PCMA 2Y20A 3UMMA 4DV2M 2AHMA 1IY0A 3DA1A 2D7EA 5KQDA 2X4AA 1SXJC 5FTNA 1IBKM 4L4UA 4DUYM 1GL7A 2HHHM 3GRRA 3HHWA 4LJ4A 4DV0M 4M9ZA 4KO8A 5KO3A 4QOSA 3U6PA 2XGNA 1SXJD 1HNXM 4AQYM 4AI6A 1XNRM 3GLGA 3RGSA 4NSRA 1QVRA 1XWIA 3U5ZB 5EQTA 1NJFA 4LJ6A 5EP3A 3K8ZA 2KEBA 1TH4A 2LNHC 1L2CA 3KS8A 3U60B 2RGHA 4MGKE 3J7AS 2BUMA 2BUXA 1MU5A 1GVNA 1N33M 3U6DA 1W5SA 3I4VA 3FKEA 3U6QA 3U61B 2L7IA 3QAUA 4DR2M 2XFSA 4DR5M 2BUZA 4M9XA 1NVMA 4G4QA 1EOBB 3J81S 4LGMA 3LKTM 3HGIA 4XGIA 3C58A 3KVWA 2R45A 5FSWA 3KP1E 4G6ZA 4B7GA 1IY2A 2UU9M 1NNJA 2UUBM 5IREB 4D82A 3GLIA 2DWLA 3GLHA 3U6CA 5C18A 2BURA 4IBJA 1DLMA 4FCVA 4JI7M 3MI1A 1TDZA 3T63A 4LF4M 3TE6A 3VDPA 3SASA 4R7GA 1Z6TA 5GKNA 4LG2A 1QAOA 1XMOM 4LRSA 4NXMM 1YKOA 4KHPM 2F5PA 2DWMA 3SAUA 4B3SM 3PCJA 3PVSA 4K0KM 3AOGA 3VKHA 2F5SA 3TL4X 2CUZA 4X66M 3FUXA 4LRTA 3J80S 2Y0QA 3A98B 1YKMA 4DV5M 3T1HM 1FNNA 1JR3D 1HQYE 1G4AE 4LF6M 2DWZB 2BUUA 3T63M 3U6LA 3GQ3A 4WHRB 5FTJA 2KZSA 4D80A 4WHPA 4NXNM 1G8PA 3CF2A 3LXVM 3BOSA 4JXJA 4IBGA 3RGPA 1DO2A 5H37D 1QQWA 5ITXE 3RFWA 3PCIA 5ITQA 5EP2A 1IN6A 3AJIB 4FWDA 3FYCA 4QNRA 1ORYB 5ITYA 1E32A 3KOXE 3T15A 3U6EA 3SBJA 4JI3M 2R4EA 3HKPA 3IG5A 3PCDA 3KFUG 1J7KA 1IXSB 3ZCBB 1EOAB 1YKPB 4WHQA 2X49A 3KSXA 3LVVA 4MGZE 2YR0A 3AKZA 1N36M 3U6SA 1Q39A 3TPZA 3FTEA 1R2ZA 4JI4M 2CHGA 1EO2B 3HJQA 1NSFA 4B08A 2OPFA 2F5OA 1YKKA 3PCAA 1OFIA 2UXCM 4GHAA 3AOEC 1R7RA 2P5TA 3GRYA 2XSZD 2QPAA 4JI0M 2UXBM 3L28A 1DGFA 2Z4RA 3MFLM 2VQFM 3HJSA 2ZAMA 3QWLA 3FYDA 1SXJE 2ZM6M 1D2NA 2ZAOA 5IT9S 2CEAA 1TH3A 4PDIA 3VFDA 2YNMD 4A3VB 4MH0E 5KQ8A 4G4OA 3VDUA 5IWAM 2XSUA 1YSYA 4NOOB 4AG6A 4WHOA 3J7BA 3VK8A 1EOCB 4JV5M 2QZ4A 5FLXS 2CFOA 3GRUA 4LJ7A 2G5GX 3GPXA 2XSVA 2XSRA 2ERCA 3T67A 1E9SA 3ILKA 5EXXA 4MGHA 3JR5A 4DR6M 1XMQM 2KRKA 4IJFA 1QZMA 3MJ5A 2RGOA 3WHKA 1IY1A 4IBCA 4BB9A 5LMNM 4IBBA 3PCFM 2Z3XA 3UGJA 2XF3A 3KP0E 2EUCA 3KW6A 2QP9X 3PCAM 3HHXA 2J7OA 3E4RA 3M0EA 1UM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLQ A;  3LKT M;  3HGI A;  3PCG M;  3LMX M;  3LMX A;  2BUR B;  1TMX A;  3HJ8 A;  3I4Y A;  2BUV B;  3LKT A;  2BUR A;  1DLM A;  1EOA A;  1YKP A;  3MI1 A;  2PCD A;  3HHY A;  4WHS A;  3O6R A;  1YKL A;  4WHP B;  3T63 A;  1YKO A;  3PCB M;  3PCN M;  3PCJ M;  3PCN A;  4WHS B;  4WHR F;  3PCJ A;  4WHR A;  1EO2 A;  1YKM A;  3T63 M;  2BUU A;  1DMH A;  3PCL A;  4WHO D;  3PCH M;  4ILV A;  4WHR B;  2BUQ B;  1EO9 A;  4WHP A;  3LXV M;  1YKM B;  3PCK M;  2BUU B;  2BV0 B;  3T67 M;  2BUT B;  3N9T A;  3PCI A;  3TH1 A;  4ILT A;  3PCC A;  3PCD M;  3I51 A;  3PCD A;  3PCC M;  3HKP A;  2BUW B;  2BV0 A;  1EOA B;  1YKP B;  4WHQ A;  1YKL B;  3MV6 M;  3MV6 A;  1YKN A;  2BUW A;  3MV4 M;  1EOC A;  1YKO B;  4WHQ B;  3PCF A;  2PCD M;  3PCE A;  2AZQ A;  3PCE M;  3O32 A;  1EO2 B;  3HJQ A;  1YKK A;  1YKN B;  3MI5 A;  3MFL A;  3PCA A;  3PCM M;  2BOY A;  3PCB A;  3O5U A;  2BUM B;  2BUX B;  2BUQ A;  3PCG A;  2BUY A;  1EOB A;  3MFL M;  3PCM A;  3HJS A;  2BUT A;  3LXV A;  2BUY B;  3MI1 M;  2BUV A;  3O6J A;  3PCL M;  3PCH A;  2XSU A;  4WHO A;  1S9A A;  1EOC B;  2XSV A;  2XSR A;  3T67 A;  3PCI M;  1YKK B;  5TD3 A;  1DLT A;  4WHO B;  4WHP D;  2BUZ B;  2BUM A;  2BUX A;  3PCF M;  3PCK A;  1EOB B;  3I4V A;  3MI5 M;  3PCA M;  4WHS D;  3HHX A;  2BUZ A;  1EO9 B;  3MV4 A; 
#chains in the Genus database with same CATH topology
 4KLN A;  1DLQ A;  1EE8 A;  1WXQ A;  4YHH M;  3J2P B;  1IBL M;  3L25 A;  3LMX A;  1VEJ A;  2LVA A;  4GC5 A;  1N77 A;  1T43 A;  3AFH A;  4CHT B;  1TGU A;  3B7N A;  4ITQ A;  4JI1 M;  3UJN A;  2APL A;  2K47 A;  2LXE A;  2R18 A;  4QNM A;  3D8B A;  5EJC A;  2JP7 A;  4LFB M;  2GQF A;  2N35 A;  2RKO A;  2OQ4 A;  2ZBK B;  4I4L A;  1ZMW A;  3OTO M;  3O6R A;  2D7G A;  3PXG A;  3H4M A;  3W0L B;  1WHC A;  2Y21 A;  1GO5 A;  5DYI A;  1ZMV A;  2DAK A;  4GH9 A;  2C96 A;  8CAT A;  4NRW A;  4FCT A;  1SXJ B;  2V6Z M;  2VDB B;  4OW0 A;  2KRU A;  3AL0 C;  3PCJ M;  3PCN A;  2Z4S A;  2C98 A;  2Y0T A;  4YY3 M;  2CP8 A;  4LJA A;  3U60 A;  1YLA A;  3B9P A;  1XXH A;  2QHO B;  3U6M A;  1DGH B;  2QBY B;  2VQE M;  2B3T A;  4W5W A;  3SHF A;  2EKF A;  4B7F A;  4DV3 M;  5EXP A;  3U61 A;  4M0D A;  3PCH M;  4WHO D;  4ILV A;  3IG8 A;  1T3T A;  1S3S A;  3DFZ A;  3GP1 A;  4RF0 A;  1KFV A;  4JI6 M;  1W5T A;  1C1K A;  3K92 A;  1L1Z A;  4IBF A;  4CIZ A;  3T67 M;  2C9O A;  4XBO A;  2BUT B;  2DEN A;  2VII A;  5DFL A;  4F2L A;  2R4J A;  4LGY A;  3GLI B;  2EA0 A;  3PCC A;  2DNA A;  3A46 A;  4R3D A;  2BUW B;  2BV0 A;  3LCU A;  3H4J A;  3LCV B;  4KOD A;  5LMU M;  5ITR A;  4JYA M;  3MK6 A;  2LVQ D;  2Q2E B;  1DMH A;  2YFQ A;  3UK6 A;  4B7H A;  4MGY E;  1K3W A;  3FTC A;  2CV0 A;  3LQQ A;  1OFH A;  3M7G A;  4CJ6 A;  4EIW A;  1LV7 A;  3TWK A;  4LJ5 A;  2LBC A;  1R2Y A;  1YKO B;  3SC3 A;  1J09 A;  4CIS A;  3FE3 A;  3PCE A;  3W68 A;  4DR1 M;  2W82 A;  2C9C A;  1YKN B;  3K9O A;  1WGL A;  2CE7 A;  3HU3 A;  3FRI A;  4OX9 M;  3PCM M;  2BOY A;  5E26 A;  2XZU A;  3FTF A;  3O5U A;  4IBE A;  3RE8 A;  1N78 A;  1TH2 A;  2JWS A;  2A5Y B;  1G59 A;  4FD2 A;  3PCG A;  3VK7 A;  4PDG A;  2F4V M;  4AKH A;  2DZL A;  3E46 A;  3K2L A;  3HZJ A;  2HAK A;  4LZZ A;  4L78 A;  3ZH9 B;  1TF0 B;  2EJS A;  3CTW B;  4GIP A;  4WUR A;  3PNV A;  5ITU A;  1XC8 A;  1IQP A;  3L29 A;  1KSF X;  1FJG M;  2F5Q A;  3M6A A;  3HU1 A;  2DHR A;  4LJ8 A;  2BUY B;  4S12 A;  3GO8 A;  4QOZ C;  1GL6 A;  1IN4 A;  3MI1 M;  1NHW C;  1V33 A;  2V1C A;  4G4R A;  3T1Y M;  2BUV A;  2J7N A;  3O6J A;  2C5R A;  3PCL M;  4I8O A;  1Z5B A;  2O25 A;  4JI2 M;  3IHP A;  3GRV A;  1CUK A;  2C99 A;  2L4E A;  3PCH A;  2CRU A;  3SYL A;  1XB2 B;  3LMM A;  1S9A A;  5ITT A;  1PGY A;  1L2B A;  3PCI M;  1YKK B;  5TD3 A;  3FUV A;  4PCZ A;  2M60 A;  3U5Z A;  5KPT A;  2BUZ B;  2JA2 A;  4WW0 A;  4DV4 M;  3SYK A;  4LFC M;  3PCK A;  4IJE A;  2LHG A;  3I01 M;  3K9P A;  3F92 A;  5EXS A;  5ITX A;  1SG9 A;  2WSC F;  4G3O A;  4NSO B;  4DBG B;  2O01 F;  3MI5 M;  3AV0 A;  4B3R M;  4GIT A;  2I7P A;  2F5N A;  1EO9 B;  4L16 A;  1DO0 A;  3GLG E;  4PD2 A;  1K3X A;  2L4F A;  3NBX X;  1NV8 A;  2UUC M;  3LMX M;  3PCG M;  2BUR B;  5E6J A;  1PJI A;  1HT2 E;  1QAN A;  1EFU B;  1G3I A;  3HJ8 A;  4OVZ B;  4BLC A;  1F4I A;  3KOW E;  3SHG B;  1Q3C A;  2FNA A;  5JI2 E;  3LKT A;  1QAQ A;  1Z5A A;  1IXZ A;  2CHQ A;  3FUW A;  3HHY A;  5L8R F;  1G41 A;  3D8L A;  4X62 M;  1VEG A;  4D81 A;  3JR4 A;  1C7Y A;  1TR8 A;  1YKL A;  2KNA A;  3GLH B;  4RF1 A;  1J5E M;  4CGY B;  2DXI A;  3GPY A;  1YE9 A;  3PCB M;  2I7N A;  4LF9 M;  1OAI A;  4LY6 A;  3PCN M;  4WHS B;  1I4W A;  4ZPX A;  4MB7 A;  3SAV A;  2BJW A;  2LVP C;  4WHR A;  4L15 A;  3Q8G A;  2V1U A;  2XH9 A;  3SAW A;  2LWX A;  3FRH A;  2CV1 A;  4FCW A;  2ZAN A;  3SAT A;  2KW0 A;  3GLF B;  3KOY E;  5BPV A;  2D7H A;  1Z5C A;  3KS4 A;  5FTM A;  4GKK M;  2Z7J A;  3LKT M;  3PCL A;  4IBK A;  3SMS A;  5C1B A;  2XSZ A;  3GLF E;  1PM5 A;  1GAB A;  4G4N A;  2BUQ B;  1YKM B;  3SBJ A;  1WGN A;  3PCK M;  3T38 A;  2BUU B;  4M9S A;  1UFZ A;  1XHB A;  4QHT A;  4IIW A;  1A5T A;  3TWM A;  3HWS A;  3L27 A;  4UN2 B;  3VKG A;  2EKK A;  1ZQ9 A;  4ILT A;  4II7 A;  4REZ A;  2G8L A;  2RRU A;  1HT1 E;  1OQY A;  1D0M A;  4M0W A;  1VQ1 A;  3IEC A;  3B7Q A;  3PCC M;  1IXR C;  1R4G A;  2G3Q A;  3E9S A;  3R8F A;  2K9D A;  4DR3 M;  1IN7 A;  3HHZ A;  4Z6Y A;  3U6O A;  4DR7 M;  3KSJ A;  3CF6 E;  3GLG B;  1GJS A;  2X8A A;  1HR0 M;  1HNW M;  2H1R A;  3MV6 A;  3HU2 A;  4WHQ B;  2ZTD A;  5F3W A;  3PCF A;  2KA6 B;  3I04 M;  4DR4 M;  1GKI A;  3PCE M;  3Q8X A;  1XXH B;  1QAM A;  3KXE C;  4GC9 A;  3MFL A;  1RU3 A;  1PJS A;  2LH0 A;  3BXW A;  4Z8X A;  4LF7 M;  4Y28 F;  3PCB A;  2KNV A;  2BUM B;  2BUX B;  4LFA M;  2OOA A;  4MGI E;  2CV2 A;  2DZO B;  3E21 A;  4JI5 M;  3W0F A;  4QHS A;  4FW9 A;  2QEN A;  3GPP A;  2EO2 A;  1EOB A;  4Q7J A;  3KDS E;  4BBA A;  2QSF X;  2BUT A;  2FH0 A;  3EIE A;  2R46 A;  1DGB A;  4JN6 A;  3LXV A;  4FVM A;  1R6B X;  4LF5 M;  1V92 A;  4GKJ M;  4TUW A;  3T6P A;  3K1J A;  3V76 A;  3GPU A;  3WHL A;  1JQJ C;  2CHV A;  4NL4 H;  4AKI A;  1N32 M;  1MX0 A;  4X64 M;  4NRV A;  4FWH A;  3A42 A;  2BJV A;  4NC6 A;  3UZU A;  2LVO C;  3MHV C;  1QUT A;  3KOZ E;  4RNA A;  2QQ8 A;  2M5Z A;  1X37 A;  1VDD A;  2KXE A;  2R62 A;  2E5L M;  4FWG A;  2DWN A;  1N75 A;  1DLT A;  4WHO B;  4GRI A;  4L8R C;  1H6U A;  4P16 A;  3GLF A;  1ZAE A;  4WHP D;  3ZQJ A;  1IN5 A;  2JNH A;  4P17 A;  1OJL A;  5KPZ A;  1IBM M;  1Q3B A;  1I94 M;  4LF8 M;  2KNZ A;  1JR3 A;  2WSF F;  2FE8 A;  1L8Q A;  4I5S A;  4WHS D;  1JB0 F;  2K0B X;  4GMQ A;  3EIH A;  4DV6 M;  3PCA A;  2XEP A;  2XLJ A;  2KHH A;  1DGG A;  3MV4 A;  4WHP B;  4MM3 B;  4AZF A;  2J5Y A;  4PT5 A;  3CF0 A;  3SAR A;  2DI0 A;  1AUA A;  1NHG C;  1P3Q Q;  2JY8 A;  2HKJ A;  1BVS A;  3BBZ A;  3HX3 A;  1Z59 A;  4LJ9 A;  3SMP A;  2XFT A;  4DUZ M;  1TMX A;  4AKG A;  2FOI C;  1VDL A;  3I4Y A;  5EP4 A;  3L26 A;  1K82 A;  5KPR A;  2DVW B;  2BUV B;  2YQZ A;  2ZTC A;  2FFJ A;  3DZD A;  2L09 A;  4I81 A;  3L2A A;  3GLH E;  1IXS A;  2LHC A;  5A2Q S;  1EOA A;  3W67 A;  1YKP A;  1AIP C;  1SXJ A;  3VLF B;  2PCD A;  4WHS A;  1IN8 A;  1OKS A;  4AW4 A;  4KT0 F;  2O5R A;  1MJG M;  3FUT A;  2MJ5 B;  2QBY A;  1DGH A;  2QCU A;  5EP1 A;  1PRB A;  2NQ8 C;  7CAT A;  1IM2 A;  4WHR F;  3JAM S;  3T63 M;  3NWL A;  3NBI A;  4HLQ A;  4AG5 A;  2K6B A;  1EO2 A;  2JZ0 A;  2L6O A;  5BR8 M;  2KDL A;  3GQ5 A;  1NY5 A;  1XNQ M;  2UXD M;  5IZ7 D;  3THG A;  3DOA A;  4ANR A;  3FD9 A;  1HNZ M;  1GLN A;  2DZN B;  1EO9 A;  4LCB A;  1D0L A;  4XK8 F;  5FTK A;  4IBI A;  1QYR A;  1QZE A;  4B3M M;  3TQS A;  2BV0 B;  2R6F A;  3N9T A;  4OVZ A;  3AOE A;  2LTU A;  3LQR A;  1NJG A;  3TH1 A;  1Y8G A;  5DNY A;  1OTR A;  4HL4 A;  2QNJ A;  4B3T M;  3I51 A;  3PCD M;  1QDT A;  1L2D A;  2BNK A;  3C3E A;  1KYI A;  2KZU A;  3FTD A;  3R9X B;  1YKL B;  4IBD A;  2HCB A;  2HL7 A;  3MV6 M;  1PJQ A;  2BWB A;  3A45 A;  1WJ7 A;  1YKN A;  5FTL A;  3FUU A;  2BUW A;  3MV4 M;  1EOC A;  3SFZ A;  2PCD M;  1N34 M;  3LVW A;  5EXT A;  2AZQ A;  3O32 A;  3PNY A;  1L1T A;  3MI5 A;  1OIZ A;  1HQC A;  3PFI A;  3ZC7 B;  4DV1 M;  4OU7 A;  1E94 E;  2R65 A;  3TWL A;  1E9R A;  4X65 M;  2BUQ A;  1YUB A;  2XZF A;  5DYG A;  2L2D A;  1PJJ A;  4GHL A;  1TDH A;  1NNU C;  2VF7 A;  4LZJ A;  1NY6 A;  2DAG A;  2BUY A;  3J27 B;  2L7H A;  4DV7 M;  1DV0 A;  5JI3 E;  2UUA M;  3PCM A;  2Y20 A;  3UMM A;  4DV2 M;  2AHM A;  1IY0 A;  3DA1 A;  4F1I A;  2D7E A;  5KQD A;  2JY5 A;  2X4A A;  1SXJ C;  5FTN A;  1IBK M;  4L4U A;  4DUY M;  1GL7 A;  2HHH M;  2DAI A;  3GRR A;  1D0K A;  3HHW A;  4LJ4 A;  4DV0 M;  4M9Z A;  4KO8 A;  2DHY A;  5KO3 A;  4QOS A;  3U6P A;  2XGN A;  1SXJ D;  1HNX M;  4AQY M;  4AI6 A;  1XNR M;  3GLG A;  2MRO B;  1T6O A;  3RGS A;  4NSR A;  1QVR A;  2JY6 B;  1XWI A;  3U5Z B;  5EQT A;  1Q02 A;  1NJF A;  1PJT A;  4LJ6 A;  5EP3 A;  2MH8 A;  3K8Z A;  2KEB A;  1TH4 A;  2LNH C;  1L2C A;  3KS8 A;  4L6V 6;  3U60 B;  2RGH A;  4MGK E;  3J7A S;  2BUM A;  2BUX A;  1MU5 A;  1GVN A;  1N33 M;  3U6D A;  1HJP A;  1W5S A;  3I4V A;  3B89 A;  3FKE A;  3U6Q A;  2DAM A;  3U61 B;  2L7I A;  3QAU A;  4DR2 M;  2XFS A;  4DR5 M;  2BUZ A;  4M9X A;  1NVM A;  1WR1 B;  1ZMU A;  2DKL A;  4HEO A;  4LGM A;  3J81 S;  4G4Q A;  3HGI A;  3C3D A;  4XGI A;  3C58 A;  3KVW A;  2FS1 A;  2MGW A;  2R45 A;  5FSW A;  3KP1 E;  2WZJ A;  4G6Z A;  4B7G A;  3QYE A;  1IY2 A;  4WP2 A;  4R71 A;  2BWE A;  2H5X A;  1NNJ A;  2UUB M;  2UU9 M;  5IRE B;  4D82 A;  3GLI A;  2DWL A;  3GLH A;  3U6C A;  5C18 A;  2BUR A;  1OIP A;  1V34 A;  4IBJ A;  2OOB A;  4FCV A;  4JI7 M;  1DLM A;  3MI1 A;  2JY7 A;  1TDZ A;  2WSE F;  3T63 A;  4LF4 M;  2JZ1 A;  3TE6 A;  3VDP A;  2JXN A;  4R7G A;  1Z6T A;  3SAS A;  5GKN A;  4LG2 A;  1QAO A;  1XMO M;  4LRS A;  4NXM M;  1YKO A;  4KHP M;  2F5P A;  2DWM A;  3SAU A;  4B3S M;  1MN3 A;  3PCJ A;  3PVS A;  2CWB A;  4K0K M;  3AOG A;  3VKH A;  2F5S A;  3TL4 X;  2CUZ A;  4X66 M;  3FUX A;  4LRT A;  3J80 S;  2Y0Q A;  3A98 B;  1YKM A;  4DV5 M;  3T1H M;  1FNN A;  1JR3 D;  1HQY E;  1G4A E;  1OAO C;  1R5L A;  1XXH E;  2DWZ B;  2DAE A;  4LF6 M;  2BUU A;  3U6L A;  1VEK A;  3GQ3 A;  4WHR B;  5FTJ A;  2KZS A;  4D80 A;  4WHP A;  4NXN M;  1QUS A;  2LVN C;  1G8P A;  3CF2 A;  3LXV M;  3BOS A;  4JXJ A;  4IBG A;  3RGP A;  4GEW A;  1DO2 A;  5H37 D;  1QQW A;  5ITX E;  3RFW A;  3PCI A;  5ITQ A;  5EP2 A;  2R0I A;  1IN6 A;  3AJI B;  3B74 A;  3FYC A;  4FWD A;  1ORY B;  4QNR A;  1E32 A;  3KOX E;  5ITY A;  3T15 A;  3U6E A;  4JI3 M;  2R4E A;  3HKP A;  3IG5 A;  3PCD A;  3QYB A;  3GLI E;  1J7K A;  1IXS B;  3ZCB B;  3KFU G;  1EOA B;  1YKP B;  4WHQ A;  2X49 A;  3KSX A;  3LVV A;  4MGZ E;  1NV9 A;  2YR0 A;  3AKZ A;  1N36 M;  3C9P A;  3U6S A;  1Q39 A;  3CGW A;  2OO9 A;  3TPZ A;  3FTE A;  1R2Z A;  4JI8 M;  4JI4 M;  2CHG A;  1QDR A;  3HJQ A;  1NSF A;  4B08 A;  2OPF A;  2F5O A;  1EO2 B;  2VF8 A;  3LW5 F;  1YKK A;  1OFI A;  2UXC M;  4GHA A;  3AOE C;  1R7R A;  2P5T A;  1ZV1 A;  3GRY A;  2XSZ D;  2QPA A;  4JI0 M;  2UXB M;  3L28 A;  1DGF A;  1IFY A;  2Z4R A;  1LTM A;  3MFL M;  2VQF M;  3HJS A;  1VG5 A;  2ZAM A;  3QWL A;  1NO1 A;  2Z8Y M;  3FYD A;  1SXJ E;  3B7Z A;  1D2N A;  2R44 A;  2ZM6 M;  2ZAO A;  2MR9 A;  5IT9 S;  2CEA A;  1TH3 A;  1WIV A;  4PDI A;  3VFD A;  2HWJ A;  1JR3 E;  2YNM D;  4A3V B;  4MH0 E;  5KQ8 A;  4G4O A;  3VDU A;  5IWA M;  2XSU A;  1YSY A;  3MMP A;  4NOO B;  4AG6 A;  4WHO A;  3J7B A;  3VK8 A;  1EOC B;  4JV5 M;  2QZ4 A;  5FLX S;  2CFO A;  1TTE A;  3GRU A;  2G5G X;  4LJ7 A;  3GPX A;  2JUJ A;  2XSV A;  2XSR A;  2ERC A;  3T67 A;  1E9S A;  3ILK A;  5EXX A;  4MGH A;  3GQ4 A;  4RKU F;  2GNO A;  3JR5 A;  1XMQ M;  2KRK A;  4DR6 M;  1G71 A;  4IJF A;  1QZM A;  3MJ5 A;  2RGO A;  3WHK A;  1IY1 A;  4IBC A;  4BB9 A;  5LMN M;  1GJT A;  4IBB A;  2Z3X A;  1EIJ A;  3PCF M;  3UGJ A;  2XF3 A;  3KP0 E;  2EUC A;  3KW6 A;  1EOB B;  2QP9 X;  3PCA M;  3HHX A;  2J7O A;  3E4R A;  3HY5 A;  3M0E A;  1UM8 A; 
#chains in the Genus database with same CATH homology
 4KLN A;  1DLQ A;  1EE8 A;  1WXQ A;  4YHH M;  3J2P B;  1IBL M;  3L25 A;  3LMX A;  4GC5 A;  1N77 A;  3AFH A;  4CHT B;  1TGU A;  4JI1 M;  4ITQ A;  3UJN A;  2K47 A;  2LXE A;  2R18 A;  4QNM A;  3D8B A;  5EJC A;  4LFB M;  2RKO A;  2OQ4 A;  2ZBK B;  4I4L A;  3OTO M;  3O6R A;  2D7G A;  3PXG A;  3H4M A;  3W0L B;  2Y21 A;  5DYI A;  4GH9 A;  2C96 A;  8CAT A;  4NRW A;  4FCT A;  1SXJ B;  2V6Z M;  3AL0 C;  4OW0 A;  2KRU A;  3PCJ M;  3PCN A;  4WHS B;  2Z4S A;  2C98 A;  2Y0T A;  4YY3 M;  4LJA A;  3U60 A;  3B9P A;  1XXH A;  2QBY B;  3U6M A;  1DGH B;  2VQE M;  4W5W A;  3SHF A;  4B7F A;  4DV3 M;  5EXP A;  3U61 A;  4M0D A;  3PCH M;  4WHO D;  4ILV A;  3IG8 A;  1T3T A;  1S3S A;  3DFZ A;  3GP1 A;  4RF0 A;  1KFV A;  4JI6 M;  1W5T A;  1C1K A;  3K92 A;  1L1Z A;  4IBF A;  3T67 M;  2C9O A;  4XBO A;  2BUT B;  2EA0 A;  2VII A;  3GLI B;  2R4J A;  4LGY A;  3PCC A;  3A46 A;  4R3D A;  2BUW B;  2BV0 A;  4KOD A;  5LMU M;  5ITR A;  4JYA M;  3MK6 A;  2Q2E B;  1DMH A;  2YFQ A;  3UK6 A;  4B7H A;  4MGY E;  1K3W A;  3FTC A;  2CV0 A;  3LQQ A;  1OFH A;  3M7G A;  4EIW A;  1LV7 A;  3TWK A;  4LJ5 A;  1R2Y A;  1YKO B;  3SC3 A;  1J09 A;  4CIS A;  3PCE A;  4DR1 M;  2W82 A;  2C9C A;  1YKN B;  2CE7 A;  3HU3 A;  4OX9 M;  3PCM M;  2BOY A;  5E26 A;  2XZU A;  3FTF A;  3O5U A;  4IBE A;  3RE8 A;  1N78 A;  1TH2 A;  2A5Y B;  1G59 A;  4FD2 A;  3PCG A;  3VK7 A;  4PDG A;  2F4V M;  4AKH A;  3K2L A;  2XZF A;  4LZZ A;  4L78 A;  3ZH9 B;  3CTW B;  4GIP A;  5ITU A;  1XC8 A;  4WUR A;  3PNV A;  4JI8 M;  1IQP A;  3L29 A;  1KSF X;  1FJG M;  2F5Q A;  3M6A A;  3HU1 A;  2DHR A;  4LJ8 A;  2BUY B;  4S12 A;  3GO8 A;  4QOZ C;  1GL6 A;  1IN4 A;  3MI1 M;  1NHW C;  2V1C A;  4G4R A;  3T1Y M;  2BUV A;  2J7N A;  3O6J A;  2C5R A;  3PCL M;  4I8O A;  1Z5B A;  4JI2 M;  3GRV A;  2C99 A;  3PCH A;  3SYL A;  3LMM A;  1S9A A;  5ITT A;  1L2B A;  3PCI M;  1YKK B;  5TD3 A;  3FUV A;  4PCZ A;  2M60 A;  3U5Z A;  5KPT A;  2BUZ B;  2JA2 A;  4WW0 A;  4DV4 M;  3SYK A;  4LFC M;  3PCK A;  4IJE A;  3GQ4 A;  5EXS A;  5ITX A;  4NSO B;  3MI5 M;  3AV0 A;  4B3R M;  4GIT A;  2I7P A;  2F5N A;  1EO9 B;  4L16 A;  1DO0 A;  4PD2 A;  1K3X A;  3PCG M;  2UUC M;  3LMX M;  2BUR B;  5E6J A;  1PJI A;  1HT2 E;  1QAN A;  1G3I A;  4OVZ B;  3HJ8 A;  4BLC A;  3KOW E;  3SHG B;  1Q3C A;  2FNA A;  5JI2 E;  3LKT A;  1QAQ A;  1Z5A A;  1IXZ A;  2CHQ A;  3FUW A;  3HHY A;  4X62 M;  1G41 A;  3D8L A;  4D81 A;  3JR4 A;  1YKL A;  3GLH B;  4RF1 A;  1J5E M;  4CGY B;  2DXI A;  3GPY A;  1YE9 A;  3PCB M;  2I7N A;  4LF9 M;  3PCN M;  4LY6 A;  1I4W A;  4ZPX A;  4MB7 A;  3SAV A;  2BJW A;  4WHR A;  4L15 A;  2V1U A;  2XH9 A;  3SAW A;  2LWX A;  2CV1 A;  4FCW A;  2ZAN A;  3SAT A;  2KW0 A;  3GLF B;  3KOY E;  5BPV A;  2D7H A;  1Z5C A;  3KS4 A;  5FTM A;  4GKK M;  2Z7J A;  3PCL A;  4IBK A;  3SMS A;  5C1B A;  2XSZ A;  1PM5 A;  2BUQ B;  4G4N A;  1YKM B;  3PCK M;  3T38 A;  2BUU B;  4M9S A;  1XHB A;  4QHT A;  4IIW A;  3TWM A;  3HWS A;  3L27 A;  3VKG A;  1ZQ9 A;  4ILT A;  4II7 A;  4REZ A;  2G8L A;  3PCC M;  1HT1 E;  4M0W A;  1IXR C;  3E9S A;  3R8F A;  4DR3 M;  1IN7 A;  3HHZ A;  4Z6Y A;  3U6O A;  4DR7 M;  3KSJ A;  3CF6 E;  3GLG B;  3MV6 A;  2X8A A;  1HR0 M;  1HNW M;  2H1R A;  3HU2 A;  4WHQ B;  5F3W A;  3PCF A;  2KA6 B;  4DR4 M;  1GKI A;  3PCE M;  3Q8X A;  1XXH B;  1QAM A;  3KXE C;  4GC9 A;  3MFL A;  2LH0 A;  4LF7 M;  4Z8X A;  3PCB A;  2BUM B;  2BUX B;  4LFA M;  4MGI E;  2CV2 A;  2DZO B;  4JI5 M;  3W0F A;  4QHS A;  4FW9 A;  2QEN A;  3GPP A;  2EO2 A;  1EOB A;  3KDS E;  4BBA A;  2BUT A;  3EIE A;  2R46 A;  1DGB A;  4JN6 A;  3LXV A;  4FVM A;  1R6B X;  4LF5 M;  4GKJ M;  4TUW A;  3K1J A;  3GPU A;  3WHL A;  1JQJ C;  2CHV A;  4NL4 H;  4AKI A;  1N32 M;  1MX0 A;  4X64 M;  4NRV A;  4FWH A;  3A42 A;  2BJV A;  3UZU A;  3MHV C;  3KOZ E;  4RNA A;  2M5Z A;  1X37 A;  1VDD A;  2KXE A;  2R62 A;  2E5L M;  4FWG A;  2DWN A;  1N75 A;  1DLT A;  4WHO B;  4GRI A;  4L8R C;  1H6U A;  4P16 A;  3GLF A;  1ZAE A;  4WHP D;  5KPZ A;  1IN5 A;  1OJL A;  1IBM M;  1Q3B A;  1I94 M;  4LF8 M;  1JR3 A;  2FE8 A;  1L8Q A;  4I5S A;  4WHS D;  4DV6 M;  4GMQ A;  3EIH A;  2XEP A;  2XLJ A;  1DGG A;  3MV4 A;  4WHP B;  4MM3 B;  4AZF A;  4PT5 A;  3CF0 A;  3SAR A;  1NHG C;  4LJ9 A;  2HKJ A;  3SMP A;  1Z59 A;  2XFT A;  4DUZ M;  1TMX A;  4AKG A;  2FOI C;  5EP4 A;  3I4Y A;  1K82 A;  3L26 A;  5KPR A;  2DVW B;  2BUV B;  2YQZ A;  2FFJ A;  3DZD A;  2L09 A;  4I81 A;  3L2A A;  5A2Q S;  1EOA A;  1YKP A;  1SXJ A;  3VLF B;  2PCD A;  4WHS A;  1IN8 A;  4AW4 A;  2O5R A;  3FUT A;  2QBY A;  1DGH A;  2QCU A;  5EP1 A;  2NQ8 C;  7CAT A;  1IM2 A;  4WHR F;  3JAM S;  3NWL A;  3NBI A;  4HLQ A;  4AG5 A;  1EO2 A;  2L6O A;  5BR8 M;  3GQ5 A;  1NY5 A;  1XNQ M;  2UXD M;  5IZ7 D;  3THG A;  3DOA A;  1HNZ M;  3FD9 A;  1EO9 A;  1GLN A;  2DZN B;  4LCB A;  5FTK A;  4IBI A;  1QYR A;  4B3M M;  3TQS A;  2BV0 B;  3N9T A;  4OVZ A;  3AOE A;  3LQR A;  1NJG A;  3TH1 A;  5DNY A;  4HL4 A;  4B3T M;  3PCD M;  3I51 A;  1L2D A;  2BNK A;  1KYI A;  2KZU A;  3FTD A;  3R9X B;  1YKL B;  4IBD A;  2HCB A;  2HL7 A;  3MV6 M;  3A45 A;  1YKN A;  5FTL A;  3FUU A;  2BUW A;  3MV4 M;  1EOC A;  3SFZ A;  2PCD M;  1N34 M;  3LVW A;  5EXT A;  2AZQ A;  3O32 A;  3PNY A;  1L1T A;  3MI5 A;  1HQC A;  3PFI A;  3ZC7 B;  4DV1 M;  4OU7 A;  1E94 E;  2R65 A;  3TWL A;  1E9R A;  4X65 M;  2BUQ A;  1YUB A;  5DYG A;  1PJJ A;  4GHL A;  1TDH A;  1NNU C;  4LZJ A;  1NY6 A;  2BUY A;  3J27 B;  2L7H A;  4DV7 M;  5JI3 E;  2UUA M;  3PCM A;  2Y20 A;  3UMM A;  4DV2 M;  2AHM A;  1IY0 A;  3DA1 A;  2D7E A;  5KQD A;  2X4A A;  1SXJ C;  5FTN A;  1IBK M;  4L4U A;  4DUY M;  1GL7 A;  2HHH M;  3GRR A;  3HHW A;  4LJ4 A;  4DV0 M;  4M9Z A;  4KO8 A;  5KO3 A;  4QOS A;  3U6P A;  2XGN A;  1SXJ D;  1HNX M;  4AQY M;  4AI6 A;  1XNR M;  3GLG A;  3RGS A;  4NSR A;  1QVR A;  1XWI A;  3U5Z B;  5EQT A;  1NJF A;  4LJ6 A;  5EP3 A;  3K8Z A;  2KEB A;  1TH4 A;  2LNH C;  1L2C A;  3KS8 A;  3U60 B;  2RGH A;  4MGK E;  3J7A S;  2BUM A;  2BUX A;  1MU5 A;  1GVN A;  1N33 M;  3U6D A;  1W5S A;  3I4V A;  3FKE A;  3U6Q A;  3U61 B;  2L7I A;  3QAU A;  4DR2 M;  2XFS A;  4DR5 M;  2BUZ A;  4M9X A;  1NVM A;  4G4Q A;  1EOB B;  3J81 S;  4LGM A;  3LKT M;  3HGI A;  4XGI A;  3C58 A;  3KVW A;  2R45 A;  5FSW A;  3KP1 E;  4G6Z A;  4B7G A;  1IY2 A;  2UU9 M;  1NNJ A;  2UUB M;  5IRE B;  4D82 A;  3GLI A;  2DWL A;  3GLH A;  3U6C A;  5C18 A;  2BUR A;  4IBJ A;  1DLM A;  4FCV A;  4JI7 M;  3MI1 A;  1TDZ A;  3T63 A;  4LF4 M;  3TE6 A;  3VDP A;  3SAS A;  4R7G A;  1Z6T A;  5GKN A;  4LG2 A;  1QAO A;  1XMO M;  4LRS A;  4NXM M;  1YKO A;  4KHP M;  2F5P A;  2DWM A;  3SAU A;  4B3S M;  3PCJ A;  3PVS A;  4K0K M;  3AOG A;  3VKH A;  2F5S A;  3TL4 X;  2CUZ A;  4X66 M;  3FUX A;  4LRT A;  3J80 S;  2Y0Q A;  3A98 B;  1YKM A;  4DV5 M;  3T1H M;  1FNN A;  1JR3 D;  1HQY E;  1G4A E;  4LF6 M;  2DWZ B;  2BUU A;  3T63 M;  3U6L A;  3GQ3 A;  4WHR B;  5FTJ A;  2KZS A;  4D80 A;  4WHP A;  4NXN M;  1G8P A;  3CF2 A;  3LXV M;  3BOS A;  4JXJ A;  4IBG A;  3RGP A;  1DO2 A;  5H37 D;  1QQW A;  5ITX E;  3RFW A;  3PCI A;  5ITQ A;  5EP2 A;  1IN6 A;  3AJI B;  4FWD A;  3FYC A;  4QNR A;  1ORY B;  5ITY A;  1E32 A;  3KOX E;  3T15 A;  3U6E A;  3SBJ A;  4JI3 M;  2R4E A;  3HKP A;  3IG5 A;  3PCD A;  3KFU G;  1J7K A;  1IXS B;  3ZCB B;  1EOA B;  1YKP B;  4WHQ A;  2X49 A;  3KSX A;  3LVV A;  4MGZ E;  2YR0 A;  3AKZ A;  1N36 M;  3U6S A;  1Q39 A;  3TPZ A;  3FTE A;  1R2Z A;  4JI4 M;  2CHG A;  1EO2 B;  3HJQ A;  1NSF A;  4B08 A;  2OPF A;  2F5O A;  1YKK A;  3PCA A;  1OFI A;  2UXC M;  4GHA A;  3AOE C;  1R7R A;  2P5T A;  3GRY A;  2XSZ D;  2QPA A;  4JI0 M;  2UXB M;  3L28 A;  1DGF A;  2Z4R A;  3MFL M;  2VQF M;  3HJS A;  2ZAM A;  3QWL A;  3FYD A;  1SXJ E;  2ZM6 M;  1D2N A;  2ZAO A;  5IT9 S;  2CEA A;  1TH3 A;  4PDI A;  3VFD A;  2YNM D;  4A3V B;  4MH0 E;  5KQ8 A;  4G4O A;  3VDU A;  5IWA M;  2XSU A;  1YSY A;  4NOO B;  4AG6 A;  4WHO A;  3J7B A;  3VK8 A;  1EOC B;  4JV5 M;  2QZ4 A;  5FLX S;  2CFO A;  3GRU A;  4LJ7 A;  2G5G X;  3GPX A;  2XSV A;  2XSR A;  2ERC A;  3T67 A;  1E9S A;  3ILK A;  5EXX A;  4MGH A;  3JR5 A;  4DR6 M;  1XMQ M;  2KRK A;  4IJF A;  1QZM A;  3MJ5 A;  2RGO A;  3WHK A;  1IY1 A;  4IBC A;  4BB9 A;  5LMN M;  4IBB A;  3PCF M;  2Z3X A;  3UGJ A;  2XF3 A;  3KP0 E;  2EUC A;  3KW6 A;  2QP9 X;  3PCA M;  3HHX A;  2J7O A;  3E4R A;  3M0E A;  1UM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...