3HHXA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhxA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhxA02
2BUWA 3N9TA 3LMXM 3PCCA 2BUQB 3PCHM 3LXVA 2BUZA 1EO2A 3HGIA 1S9AA 1YKLA 3PCDM 3PCBM 1YKOB 1YKMA 3T67M 2BUQA 5TD3A 1EOBB 3PCEM 3MI5M 2BUZB 3PCKA 1EO2B 3LKTA 3PCGA 4WHPA 1YKPB 3PCNA 4WHQB 2BUXA 4WHOA 3MFLA 3PCCM 3T63A 3HJQA 1YKMB 2PCDM 4ILVA 1EOCB 3LXVM 1EOBA 4WHPD 4WHOD 3PCLA 3PCIM 3PCMA 3HJSA 3HHXA 3HKPA 1YKPA 3MV6A 4WHPB 4WHQA 3O5UA 2BUXB 4WHOB 1EOCA 4WHSD 3PCKM 2BUTA 3PCJA 1TMXA 3LKTM 3PCGM 3O6JA 3PCNM 4WHSB 3T63M 3PCHA 2BV0B 3HJ8A 3PCLM 1DLQA 2BUTB 3PCFA 1EOAB 3PCAA 1EO9B 3MV6M 3PCDA 2BOYA 1DMHA 3HHYA 4WHSA 2XSUA 2BURB 2XSRA 2BV0A 3O32A 4WHRB 3I4VA 1YKKA 2BUVA 1EOAA 3MV4A 1EO9A 3I4YA 3MI1A 2BUMB 3I51A 4WHRF 1YKNB 2BUUA 3MFLM 2PCDA 3LMXA 2BURA 4WHRA 3PCFM 3PCIA 1YKKB 2BUVB 3PCMM 3PCAM 2BUYB 2BUMA 2BUWB 1YKNA 3PCBA 3TH1A 1DLTA 2BUUB 3T67A 3PCEA 3PCJM 4ILTA 3MI5A 3MV4M 2AZQA 2XSVA 1DLMA 2BUYA 3O6RA 1YKLB 3MI1M 1YKOA
chains in the Genus database with same CATH superfamily
4G3OA 3GPXA 3VKGA 1GVNA 4I5SA 4WP2A 5ITXE 3L2AA 3PCCA 1XC8A 4X66M 1CUKA 5FLXS 1GKIA 2XSZA 2UUCM 3BXWA 2VF8A 3NWLA 1S9AA 2I7NA 2L4EA 1E9RA 2L2DA 3C3DA 3LCUA 4B7HA 1IBLM 1WGLA 1L2CA 3UJNA 3RE8A 3HU2A 2UUAM 2G5GX 3I04M 2UXBM 3H4MA 2R4EA 3T67M 2XH9A 3GLGE 5C18A 3PCEM 2B3TA 3SC3A 5EJCA 3SBJA 3T1YM 1XXHE 3SMPA 3QYBA 4IJEA 2V6ZM 3GLIB 4LJ9A 5ITRA 4JYAM 3A42A 4OU7A 3PCNA 4YHHM 3THGA 2BUXA 4WHOA 1OKSA 3J2PB 3T15A 2QBYB 3LQQA 3LXVM 4WHPD 5A2QS 1IY0A 2QP9X 2DHYA 4GMQA 4LJ4A 1L2BA 1KYIA 4LJ8A 3KOYE 4XBOA 4MM3B 1YKPA 2DENA 1QUSA 5KPZA 4WHQA 1QUTA 2Y0QA 2BUXB 2NQ8C 1OAIA 1VEGA 2KNZA 4FWDA 5FTMA 3PXGA 1EOCA 1E32A 1PGYA 2L7HA 3PCKM 3J7BA 3PCJA 3E4RA 5F3WA 1TMXA 3KS8A 3AKZA 1XHBA 4DV0M 2JWSA 2L09A 1K3XA 2D7GA 4IIWA 2CV1A 1IN6A 2CRUA 1JR3E 4QOZC 1N75A 2DAEA 1PRBA 5DYIA 4FCWA 2RRUA 2C99A 3RFWA 3T63M 2DWLA 1OJLA 1QZEA 1XMQM 1Q39A 3KDSE 3HJ8A 1WGNA 4RKUF 3PCLM 4ZPXA 3ZQJA 2EUCA 3D8LA 5JI2E 1EOAB 1G4AE 3EIHA 3QYEA 1MJGM 2ZTDA 3HWSA 3GQ5A 2DWMA 4HEOA 2GQFA 2FS1A 1KFVA 2BOYA 3MV6M 4WHSA 3C3EA 4M0DA 3SMSA 4IBGA 4IBDA 4R7GA 1NY6A 2UUBM 2XSRA 4R3DA 2N35A 2OQ4A 3SAVA 5EXTA 3T63A 1OAOC 4HL4A 3I4VA 2EA0A 4AG6A 4JI2M 1YKKA 1DGGA 1D0KA 2KZSA 2XFSA 3AL0C 3AV0A 5KO3A 3I4YA 4OX9M 1ORYB 1X37A 3I51A 4FCTA 4IBCA 4D80A 1IM2A 1TH3A 4JI8M 4WHOB 2LVNC 7CATA 1DO0A 3FUVA 3I01M 4II7A 2EKKA 2R0IA 4RF0A 5KQ8A 1Z59A 2Z8YM 2K6BA 4DR2M 2J7OA 3GRRA 1HR0M 1R7RA 4NSRA 2O25A 1YKKB 1IY1A 4W5WA 3SHFA 4QNMA 2ERCA 2WZJA 3PCAM 2OOAA 3PCMM 1GJSA 2JY7A 2Z4SA 3B9PA 3BOSA 2F4VM 1WIVA 4GH9A 4D82A 3LQRA 3PCBA 2OPFA 4L6V6 3ZC7B 3M6AA 1E94E 1TGUA 4IBFA 4WW0A 3GLFB 3CF0A 1PJQA 1W5TA 5FTLA 1SXJC 3PVSA 1SXJB 4BB9A 1T43A 2JY5A 3KSXA 3SYKA 4NXMM 4ILTA 3E9SA 3U61A 2R65A 2OO9A 4M9ZA 5ITUA 1YKLB 3KS4A 1T6OA 1P3QQ 2WSCF 2BUWA 4LJ7A 1EFUB 1Z5CA 2HWJA 3KXEC 3L25A 3LMXM 1QANA 4GHAA 1ZAEA 3GPPA 2UXCM 3J80S 2BUQB 3W68A 4B7FA 1DV0A 4FW9A 3U6QA 4NOOB 4L16A 2QQ8A 2A5YB 4G4OA 1EO2A 3K92A 1E9SA 3FTDA 1C1KA 3R9XB 1VEJA 4JXJA 3U61B 4IJFA 1GL7A 4A3VB 2DXIA 1PJSA 2QENA 2F5PA 1N34M 1VEKA 2G8LA 2BJVA 4QOSA 3KFUG 1TF0B 3T38A 4LGYA 4DV4M 3U60B 2F5NA 4KHPM 1DGBA 2YR0A 3AFHA 3VFDA 4AKIA 1EOBB 5TD3A 4PDIA 3GQ4A 4LF7M 2DI0A 1NSFA 1A5TA 4G4NA 3FTFA 1EO2B 2JA2A 4M9SA 1HNXM 2E5LM 3CF2A 2DAKA 3AOGA 3JR5A 1G59A 2KNAA 2EJSA 3B7NA 3KSJA 3GO8A 1Z6TA 2PCDM 3W0LB 4L15A 1DGHB 4PDGA 3FUXA 1IN5A 1J7KA 3K8ZA 3CF6E 4PD2A 2HHHM 3PCMA 2RKOA 2RGHA 2BWEA 4M9XA 1WJ7A 3GLIA 2LVQD 3TWKA 3SATA 2Y0TA 4HLQA 4LF5M 1V33A 2VQFM 3VK7A 1DO2A 2DAGA 2JY8A 1LTMA 4XK8F 2QBYA 3IG5A 2LHCA 1SG9A 1MX0A 1G3IA 4LGMA 4Q7JA 3RGSA 3PNVA 4RNAA 4WHSD 4KLNA 1QZMA 4GKKM 1VDLA 1PJJA 4PT5A 4LF4M 3LKTM 2FOIC 3KOWE 4ANRA 4LFCM 3PCGM 2P5TA 4UN2B 2F5SA 4DR6M 3UK6A 2XFTA 2KRKA 2GNOA 3U5ZB 1MN3A 1QAQA 4AKHA 8CATA 1IQPA 1YSYA 5FTJA 2XGNA 1IBMM 4GHLA 2KNVA 3SYLA 4JI7M 4I8OA 2VIIA 5C1BA 1JR3D 3LMMA 5E6JA 4FD2A 3MMPA 4K0KM 3QWLA 3J81S 3GQ3A 3HHYA 2OOBA 3K1JA 4LCBA 4JI5M 2BURB 2DHRA 2R6FA 1IN4A 1G41A 1L1TA 3O32A 2EKFA 4MGIE 2LTUA 1PJTA 1LV7A 1ZQ9A 1MU5A 2XLJA 3J27B 2KA6B 1QQWA 1NNUC 2FFJA 3FUWA 4LY6A 1XMOM 1EOAA 3MV4A 1VG5A 1K3WA 5IWAM 3HHZA 5EP1A 2O5RA 4DBGB 2JNHA 3MI1A 1V92A 4MH0E 4R71A 4WHRF 3GLFE 2CP8A 2PCDA 5DNYA 1SXJE 2ZBKB 4LF8M 2CV0A 3J7AS 3UZUA 2JP7A 2LVOC 3GRYA 3PCFM 4B08A 4X62M 1N77A 4FCVA 2ZTCA 3TWLA 3FTEA 2BUYB 3Q8GA 3VK8A 1EE8A 2X4AA 1L1ZA 3SFZA 3JAMS 2R45A 1OIZA 2VDBB 4GRIA 1NVMA 5DFLA 3TL4X 4FVMA 1DLTA 3HY5A 3K9OA 3H4JA 2LH0A 4DR5M 3T67A 3GPYA 3U6PA 2DZNB 3PCEA 1AUAA 4LFBM 4G6ZA 3GRUA 4LRTA 3WHLA 3FRHA 1K82A 4L78A 2DWZB 2C96A 5L8RF 1Q02A 4DV6M 2UXDM 1GO5A 1IFYA 2Y20A 2VQEM 2CHVA 1H6UA 3LCVB 4IBIA 1QAOA 2ZAOA 3KVWA 1T3TA 3GLFA 1PM5A 1DGFA 2LBCA 3LXVA 3PCHM 2BUZA 4B3TM 1SXJA 3IECA 1NNJA 2ZM6M 4LF9M 2Z7JA 1I4WA 5EP4A 2H5XA 3W0FA 1YKLA 2CHQA 3CTWB 2XSZD 2UU9M 5FTNA 4DV2M 3B7QA 2MROB 3FKEA 4PCZA 2Z4RA 1N32M 2BUQA 1XNQM 2V1CA 2FE8A 4REZA 3MI5M 2QPAA 2BUZB 2F5OA 3PCKA 3RGPA 1IXSA 3AOEC 4IBBA 1TH2A 2WSEF 3OTOM 1EIJA 4WHPA 4LJ5A 1L2DA 3PCCM 4AKGA 4IBEA 2APLA 1TDHA 3U60A 1IN7A 2JZ0A 3DZDA 3KOXE 1ZMWA 3GLHB 3LW5F 3QAUA 1EOBA 1NY5A 4ILVA 1QYRA 1N78A 2CWBA 1S3SA 2MGWA 3UMMA 1HQCA 4WHOD 3C9PA 3PCLA 4P16A 2KEBA 2DVWB 5EXSA 3GLIE 1Z5AA 2MR9A 3HJSA 1IXSB 3LVWA 1KSFX 2YNMD 3SHGB 4I81A 3VKHA 3HKPA 1D2NA 1HNZM 3KP0E 3MV6A 1RU3A 2R44A 4B3MM 3NBXX 4LG2A 4WHPB 5ITTA 1R6BX 2O01F 2Q2EB 2L4FA 2ZANA 2XZFA 1R2YA 1L8QA 3T6PA 1DGHA 2K47A 4YY3M 1OIPA 3GPUA 1R2ZA 4CISA 1Y8GA 5DYGA 3FYCA 4TUWA 3KW6A 3L28A 3HU3A 3DFZA 2KW0A 3E21A 3L29A 4JV5M 3PCNM 1YUBA 3A98B 3FD9A 4JI3M 4CHTB 3TPZA 1UM8A 3CGWA 2JUJA 1TTEA 3M0EA 4QHTA 2BV0B 3PCHA 3MI1M 1D0LA 3D8BA 1R4GA 1IY2A 5KPRA 4GC5A 4B7GA 4AG5A 2DZOB 3PNYA 1FNNA 1NV9A 2K0BX 2LVAA 1JQJC 2DAMA 2HKJA 3L26A 4DR3M 3FUTA 2DWNA 1IXRC 4G4RA 1EO9B 3U5ZA 1DMHA 3PCAA 3MK6A 4X65M 4LF6M 1Q3CA 4CJ6A 5IREB 1NHWC 1QVRA 3FE3A 4RF1A 2J7NA 4XGIA 4WHRB 1NO1A 4LRSA 2JZ1A 4JN6A 3L27A 3ZCBB 2QNJA 4GEWA 4WURA 3TWMA 3HU1A 3Q8XA 3V76A 4LJAA 2LWXA 2KHHA 2DNAA 2BUMB 5BPVA 2DZLA 3NBIA 1OQYA 3VDPA 1G8PA 4L8RC 2J5YA 1YKNB 3MFLM 4NL4H 3LMXA 1J09A 3GP1A 2BURA 4P17A 2KXEA 4KO8A 2R4JA 1BVSA 2DKLA 2CHGA 4MGKE 2C5RA 1SXJD 1JB0F 3PFIA 2C9OA 5JI3E 2Z3XA 2F5QA 4ITQA 3U6OA 2AHMA 2ZAMA 3FRIA 4NC6A 2FH0A 3U6CA 1PJIA 1OTRA 2L7IA 4LZJA 2KRUA 5ITYA 2QCUA 2I7PA 3F92A 1ZMUA 1I94M 4MGYE 2AZQA 2XSVA 2BUYA 4G4QA 2M60A 2VF7A 3TQSA 1J5EM 1YKOA 4L4UA 5ITQA 4DV7M 3N9TA 2BWBA 3HZJA 5GKNA 5ITXA 2CE7A 3FTCA 3TE6A 4CGYB 1GLNA 3A46A 5FTKA 3U6MA 2CUZA 2LNHC 3HGIA 1HJPA 1TR8A 2Y21A 1OFHA 1HT2E 4DV3M 1XNRM 4LZZA 3IG8A 1Q3BA 3LVVA 3ZH9B 4Z6YA 4FWHA 3PCBM 3PCDM 1UFZA 2BNKA 3GLHE 1YKMA 2XEPA 1YKOB 1C7YA 4QNRA 5KPTA 4AQYM 3U6LA 4F1IA 4CIZA 3GLGA 1TH4A 3K9PA 4LJ6A 3EIEA 1XB2B 4EIWA 3W67A 1FJGM 2YQZA 3HHWA 3A45A 1XXHA 5FSWA 3LKTA 1N36M 3PCGA 4I4LA 2EO2A 3R8FA 1YKPB 1NJGA 4MGZE 2CEAA 2LVPC 3ILKA 4WHQB 3MFLA 3HJQA 4DR4M 1YKMB 1YLAA 5EXXA 3K2LA 1EOCB 1GJTA 3DA1A 4QHSA 1IN8A 2R18A 4X64M 4NRWA 3GLGB 4GITA 3MJ5A 1GL6A 4GKJM 3PCIM 4NXNM 1WXQA 5EP2A 3U6DA 1XXHB 2HAKA 3AOEA 2CFOA 3HHXA 5LMNM 1HT1E 4S12A 3IHPA 2C98A 4M0WA 5E26A 1VDDA 4GIPA 3VDUA 3WHKA 4BLCA 5BR8M 3O5UA 3SASA 3GLHA 2G3QA 1GABA 2WSFF 4Z8XA 4JI0M 2BUTA 5H37D 5KQDA 3B74A 4NSOB 5IZ7D 4B3SM 3O6JA 3BBZA 2QZ4A 1ZV1A 3JR4A 2BUTB 4WHSB 1JR3A 2X49A 2V1UA 2L6OA 1NHGC 2D7EA 3UGJA 2HL7A 1D0MA 5EP3A 4AW4A 1IXZA 4F2LA 2R62A 3HX3A 4MGHA 1XWIA 4GC9A 2JXNA 4KODA 1AIPC 2KDLA 4DR1M 1DLQA 3B89A 3PCFA 2KZUA 4OVZA 4D81A 4JI4M 1F4IA 3PCDA 4NRVA 1QDTA 1V34A 1QAMA 3FUUA 2CV2A 4AI6A 3MHVC 4BBAA 2XSUA 3T1HM 2JY6B 4FWGA 2RGOA 2XF3A 2XZUA 3SAUA 1TDZA 4DR7M 2BV0A 3U6SA 4IBJA 3VLFB 2R46A 1N33M 2LHGA 2BUVA 2FNAA 1VQ1A 3SARA 1WR1B 3FYDA 1EO9A 3AJIB 5EXPA 4OVZB 4B3RM 5LMUM 4KT0F 2C9CA 3E46A 1OFIA 2H1RA 3KP1E 2DAIA 2BUUA 2D7HA 1R5LA 1W5SA 4DV1M 4WHRA 4LFAM 1Z5BA 3PCIA 2W82A 4MB7A 2BUVB 4IBKA 2MJ5B 1IBKM 5IT9S 2K9DA 3GRVA 4JI6M 4AZFA 1WHCA 2BUMA 2BUWB 2LXEA 4Y28F 1YKNA 3U6EA 3C58A 2X8AA 2MH8A 3TH1A 2QSFX 4JI1M 5EQTA 3KOZE 2BUUB 3B7ZA 4DV5M 3M7GA 1NV8A 1QDRA 4DUZM 3PCJM 2BJWA 2QHOB 2HCBA 3MI5A 3MV4M 2YFQA 4OW0A 4DUYM 2M5ZA 1HNWM 1DLMA 1NJFA 3DOAA 3O6RA 1ZMVA 3SAWA 1HQYE 1YE9A 1G71A
chains in the Genus database with same CATH topology
3GPXA 3VKGA 1GVNA 4I5SA 5ITXE 3L2AA 3PCCA 1XC8A 4X66M 5FLXS 1GKIA 2XSZA 2UUCM 3NWLA 1S9AA 2I7NA 1E9RA 1IBLM 4B7HA 2UUAM 1L2CA 3UJNA 3RE8A 3HU2A 2G5GX 2UXBM 3H4MA 2R4EA 3T67M 2XH9A 5C18A 3PCEM 3SC3A 5EJCA 3SBJA 3T1YM 3SMPA 4IJEA 2V6ZM 3GLIB 4LJ9A 5ITRA 4JYAM 3A42A 4OU7A 3PCNA 4YHHM 3THGA 2BUXA 4WHOA 3J2PB 3T15A 2QBYB 3LQQA 3LXVM 4WHPD 5A2QS 1IY0A 2QP9X 4GMQA 4LJ4A 1L2BA 1KYIA 4LJ8A 3KOYE 4XBOA 4MM3B 1YKPA 5KPZA 4WHQA 2Y0QA 2BUXB 2NQ8C 4FWDA 1EOCA 3PXGA 4WHOB 5FTMA 1E32A 2L7HA 3PCKM 3J7BA 3PCJA 3E4RA 5F3WA 1TMXA 3KS8A 3AKZA 1XHBA 4DV0M 1K3XA 2L09A 2D7GA 4IIWA 2CV1A 1IN6A 4QOZC 1N75A 5DYIA 4FCWA 2C99A 3RFWA 3T63M 2DWLA 1OJLA 1XMQM 1Q39A 3KDSE 3HJ8A 3PCLM 4ZPXA 2EUCA 3D8LA 5JI2E 1EOAB 1G4AE 3EIHA 3GQ5A 3HWSA 3MV6M 2DWMA 2BOYA 1KFVA 4WHSA 4M0DA 3SMSA 4IBGA 4IBDA 4R7GA 1NY6A 2UUBM 2XSRA 4R3DA 2OQ4A 3SAVA 5EXTA 4HL4A 3I4VA 2EA0A 4AG6A 4JI2M 1YKKA 1DGGA 2KZSA 2XFSA 3AL0C 3AV0A 5KO3A 3I4YA 4OX9M 1ORYB 1X37A 3I51A 4FCTA 4IBCA 4D80A 1IM2A 1TH3A 4JI8M 7CATA 1DO0A 3FUVA 4II7A 5KQ8A 4RF0A 1HR0M 1Z59A 4DR2M 2J7OA 3GRRA 1R7RA 4NSRA 1YKKB 1IY1A 4W5WA 3SHFA 4QNMA 2ERCA 3PCAM 3PCMM 3B9PA 2Z4SA 3BOSA 2F4VM 4GH9A 4D82A 3LQRA 3PCBA 2OPFA 3ZC7B 3M6AA 1E94E 1TGUA 4IBFA 4WW0A 3GLFB 3CF0A 1W5TA 5FTLA 1SXJC 3PVSA 1SXJB 4BB9A 3KSXA 3SYKA 4NXMM 4ILTA 3E9SA 3U61A 2R65A 5ITUA 4M9ZA 1YKLB 3KS4A 2BUWA 4LJ7A 3L25A 1Z5CA 3KXEC 3LMXM 1QANA 4GHAA 1ZAEA 3GPPA 2UXCM 3J80S 2BUQB 4B7FA 4FW9A 3U6QA 4NOOB 4L16A 4G4OA 2A5YB 1EO2A 3K92A 1E9SA 3FTDA 1C1KA 3R9XB 4JXJA 3U61B 4IJFA 1GL7A 4A3VB 2DXIA 2QENA 2F5PA 1N34M 2G8LA 2BJVA 4QOSA 3KFUG 3T38A 4DV4M 4LGYA 3U60B 4KHPM 2F5NA 1DGBA 2YR0A 3AFHA 3VFDA 4AKIA 1EOBB 5TD3A 4PDIA 3GQ4A 4LF7M 1NSFA 3FTFA 4G4NA 1EO2B 2JA2A 4M9SA 1HNXM 2E5LM 3CF2A 3AOGA 3JR5A 1G59A 3KSJA 3GO8A 1Z6TA 2PCDM 3W0LB 4L15A 1DGHB 4PDGA 3FUXA 1IN5A 1J7KA 3K8ZA 3CF6E 4PD2A 2HHHM 3PCMA 2RKOA 2RGHA 4M9XA 3GLIA 4LF5M 3TWKA 3SATA 2Y0TA 4HLQA 2VQFM 3VK7A 1DO2A 2QBYA 3IG5A 1MX0A 1G3IA 4LGMA 3RGSA 3PNVA 4RNAA 4WHSD 4KLNA 1QZMA 4GKKM 1PJJA 4PT5A 4LF4M 3LKTM 2FOIC 3KOWE 4LFCM 3PCGM 2P5TA 2F5SA 4DR6M 3UK6A 2XFTA 2KRKA 3U5ZB 1QAQA 4AKHA 8CATA 1IQPA 1YSYA 5FTJA 2XGNA 1IBMM 4GHLA 3SYLA 4JI7M 4I8OA 2VIIA 5C1BA 1JR3D 3LMMA 5E6JA 4FD2A 4K0KM 3QWLA 3J81S 3GQ3A 3HHYA 3K1JA 4LCBA 4JI5M 2BURB 2DHRA 1L1TA 1IN4A 1G41A 3O32A 4MGIE 1LV7A 1ZQ9A 1MU5A 2XLJA 3J27B 2KA6B 1QQWA 1NNUC 2FFJA 3FUWA 4LY6A 1XMOM 1EOAA 3MV4A 1K3WA 5IWAM 3HHZA 5EP1A 2O5RA 3MI1A 4MH0E 4WHRF 2PCDA 5DNYA 1SXJE 2ZBKB 4LF8M 2CV0A 3J7AS 3UZUA 3GRYA 3PCFM 4B08A 4X62M 1N77A 4FCVA 3TWLA 3FTEA 2BUYB 3VK8A 1EE8A 2X4AA 1L1ZA 3SFZA 3JAMS 2R45A 4GRIA 1NVMA 3TL4X 4FVMA 1DLTA 4DR5M 2LH0A 3T67A 3GPYA 3U6PA 2DZNB 3PCEA 4LFBM 4G6ZA 3GRUA 4LRTA 3WHLA 1K82A 4L78A 2DWZB 2C96A 2UXDM 4DV6M 2Y20A 2VQEM 2CHVA 1H6UA 4IBIA 1QAOA 2ZAOA 3KVWA 1T3TA 3GLFA 1PM5A 1DGFA 3LXVA 3PCHM 2BUZA 4B3TM 1SXJA 1NNJA 4LF9M 2ZM6M 2Z7JA 1I4WA 5EP4A 3W0FA 1YKLA 2CHQA 3CTWB 2XSZD 2UU9M 5FTNA 4DV2M 3FKEA 4PCZA 2Z4RA 1N32M 2BUQA 1XNQM 2V1CA 2FE8A 4REZA 3MI5M 2QPAA 2BUZB 2F5OA 3PCKA 3RGPA 3AOEC 4IBBA 1TH2A 3OTOM 4WHPA 4LJ5A 1L2DA 3PCCM 4AKGA 4IBEA 3T63A 1TDHA 3U60A 1IN7A 3DZDA 4ILVA 3KOXE 3GLHB 3QAUA 1EOBA 1NY5A 1QYRA 1N78A 1S3SA 4WHOD 3UMMA 1HQCA 3PCLA 4P16A 2KEBA 2DVWB 5EXSA 1Z5AA 3HJSA 3LVWA 1IXSB 1KSFX 2YNMD 3SHGB 4I81A 3VKHA 3HKPA 1D2NA 1HNZM 3KP0E 3MV6A 4B3MM 4LG2A 4WHPB 5ITTA 1R6BX 2Q2EB 2XZFA 2ZANA 1R2YA 1L8QA 4YY3M 1DGHA 2K47A 3GPUA 1R2ZA 4CISA 5DYGA 3FYCA 4TUWA 3KW6A 3L28A 3HU3A 3DFZA 2KW0A 3L29A 4JV5M 3PCNM 1YUBA 3A98B 3FD9A 4JI3M 4CHTB 3TPZA 1UM8A 3PCHA 3M0EA 4QHTA 2BV0B 3MI1M 3D8BA 1IY2A 5KPRA 4GC5A 4B7GA 4AG5A 2DZOB 3PNYA 1FNNA 3L26A 4DR3M 2DWNA 1JQJC 2HKJA 3PCAA 1EO9B 3FUTA 1IXRC 4G4RA 3U5ZA 1DMHA 3MK6A 4X65M 4LF6M 1Q3CA 5IREB 1NHWC 1QVRA 4RF1A 2J7NA 4XGIA 4WHRB 4LRSA 4JN6A 3L27A 3ZCBB 4WURA 3TWMA 3HU1A 3Q8XA 4LJAA 2LWXA 2BUMB 5BPVA 3NBIA 3VDPA 1G8PA 4L8RC 1YKNB 3MFLM 4NL4H 3LMXA 1J09A 3GP1A 2BURA 2KXEA 4KO8A 2R4JA 2CHGA 4MGKE 2C5RA 1SXJD 3PFIA 2C9OA 5JI3E 2Z3XA 2F5QA 4ITQA 3U6OA 2AHMA 2ZAMA 3U6CA 1PJIA 2L7IA 4LZJA 2KRUA 5ITYA 2QCUA 2I7PA 1I94M 2AZQA 4MGYE 2XSVA 2BUYA 4G4QA 2M60A 3TQSA 1J5EM 1YKOA 4L4UA 5ITQA 4DV7M 3N9TA 5GKNA 5ITXA 2CE7A 3FTCA 3TE6A 4CGYB 1GLNA 3A46A 5FTKA 3U6MA 2CUZA 2LNHC 3HGIA 2Y21A 1OFHA 1HT2E 4DV3M 1XNRM 4LZZA 3IG8A 1Q3BA 3LVVA 3ZH9B 4Z6YA 4FWHA 3PCBM 3PCDM 2BNKA 1YKOB 1YKMA 2XEPA 4QNRA 5KPTA 4AQYM 3U6LA 3GLGA 1TH4A 4LJ6A 3EIEA 1FJGM 4EIWA 2YQZA 3HHWA 3A45A 1XXHA 5FSWA 3LKTA 1N36M 3PCGA 4I4LA 2EO2A 3R8FA 1YKPB 1NJGA 4MGZE 2CEAA 3ILKA 4WHQB 3MFLA 3HJQA 4DR4M 1YKMB 5EXXA 3K2LA 1EOCB 3DA1A 4QHSA 1IN8A 2R18A 4X64M 4NRWA 3GLGB 4GITA 3MJ5A 1GL6A 4GKJM 3PCIM 4NXNM 1WXQA 5EP2A 3U6DA 1XXHB 3AOEA 3HHXA 2CFOA 5LMNM 1HT1E 4S12A 4M0WA 2C98A 3WHKA 5E26A 1VDDA 4GIPA 3VDUA 4BLCA 5BR8M 3O5UA 3SASA 3GLHA 2BUTA 4Z8XA 4JI0M 5H37D 5KQDA 4NSOB 5IZ7D 4B3SM 3O6JA 2QZ4A 3JR4A 4WHSB 1JR3A 2X49A 2V1UA 2L6OA 1NHGC 2D7EA 3UGJA 2HL7A 5EP3A 4AW4A 1IXZA 2R62A 4MGHA 1DLQA 1XWIA 4GC9A 2BUTB 4KODA 3PCFA 4DR1M 2KZUA 4OVZA 4D81A 4JI4M 3PCDA 4NRVA 1QAMA 3FUUA 2CV2A 4AI6A 3MHVC 4BBAA 2XSUA 3T1HM 4FWGA 2RGOA 2XF3A 2XZUA 3SAUA 1TDZA 4DR7M 2BV0A 3U6SA 4IBJA 3VLFB 2R46A 1N33M 2BUVA 2FNAA 3SARA 3FYDA 1EO9A 3AJIB 5EXPA 4OVZB 4B3RM 5LMUM 2C9CA 1OFIA 2H1RA 3KP1E 2BUUA 2D7HA 1W5SA 4DV1M 4WHRA 4LFAM 1Z5BA 3PCIA 2W82A 4MB7A 2BUVB 4IBKA 1IBKM 5IT9S 3GRVA 4JI6M 4AZFA 2BUMA 2BUWB 2LXEA 1YKNA 3U6EA 3C58A 2X8AA 3TH1A 4JI1M 5EQTA 3KOZE 2BUUB 4DV5M 3M7GA 4DUZM 3PCJM 2BJWA 2HCBA 3MI5A 3MV4M 2YFQA 4OW0A 4DUYM 2M5ZA 1HNWM 1DLMA 1NJFA 3DOAA 3O6RA 3SAWA 1HQYE 1YE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUW A;  3N9T A;  3LMX M;  3PCC A;  2BUQ B;  3PCH M;  3LXV A;  2BUZ A;  1EO2 A;  3HGI A;  1S9A A;  1YKL A;  3PCD M;  3PCB M;  1YKO B;  1YKM A;  3T67 M;  2BUQ A;  5TD3 A;  1EOB B;  3PCE M;  3MI5 M;  2BUZ B;  3PCK A;  1EO2 B;  3LKT A;  3PCG A;  4WHP A;  1YKP B;  3PCN A;  4WHQ B;  2BUX A;  4WHO A;  3MFL A;  3PCC M;  3T63 A;  3HJQ A;  1YKM B;  2PCD M;  4ILV A;  1EOC B;  3LXV M;  1EOB A;  4WHP D;  4WHO D;  3PCL A;  3PCI M;  3PCM A;  3HJS A;  3HHX A;  3HKP A;  1YKP A;  3MV6 A;  4WHP B;  4WHQ A;  3O5U A;  2BUX B;  4WHO B;  1EOC A;  4WHS D;  3PCK M;  2BUT A;  3PCJ A;  1TMX A;  3LKT M;  3PCG M;  3O6J A;  3PCN M;  4WHS B;  3T63 M;  3PCH A;  2BV0 B;  3HJ8 A;  3PCL M;  1DLQ A;  2BUT B;  3PCF A;  1EOA B;  3PCA A;  1EO9 B;  3MV6 M;  3PCD A;  2BOY A;  1DMH A;  3HHY A;  4WHS A;  2XSU A;  2BUR B;  2XSR A;  2BV0 A;  3O32 A;  4WHR B;  3I4V A;  1YKK A;  2BUV A;  1EOA A;  3MV4 A;  1EO9 A;  3I4Y A;  3MI1 A;  2BUM B;  3I51 A;  4WHR F;  1YKN B;  2BUU A;  3MFL M;  2PCD A;  3LMX A;  2BUR A;  4WHR A;  3PCF M;  3PCI A;  1YKK B;  2BUV B;  3PCM M;  3PCA M;  2BUY B;  2BUM A;  2BUW B;  1YKN A;  3PCB A;  3TH1 A;  1DLT A;  2BUU B;  3T67 A;  3PCE A;  3PCJ M;  4ILT A;  3MI5 A;  3MV4 M;  2AZQ A;  2XSV A;  1DLM A;  2BUY A;  3O6R A;  1YKL B;  3MI1 M;  1YKO A; 
#chains in the Genus database with same CATH topology
 4G3O A;  3GPX A;  3VKG A;  1GVN A;  4I5S A;  4WP2 A;  5ITX E;  3L2A A;  3PCC A;  1XC8 A;  4X66 M;  1CUK A;  5FLX S;  1GKI A;  2XSZ A;  2UUC M;  3BXW A;  2VF8 A;  3NWL A;  1S9A A;  2I7N A;  2L4E A;  1E9R A;  2L2D A;  3C3D A;  3LCU A;  4B7H A;  1IBL M;  1WGL A;  1L2C A;  3UJN A;  3RE8 A;  3HU2 A;  2UUA M;  2G5G X;  3I04 M;  2UXB M;  3H4M A;  2R4E A;  3T67 M;  2XH9 A;  3GLG E;  5C18 A;  3PCE M;  2B3T A;  3SC3 A;  5EJC A;  3SBJ A;  3T1Y M;  1XXH E;  3SMP A;  3QYB A;  4IJE A;  2V6Z M;  3GLI B;  4LJ9 A;  5ITR A;  4JYA M;  3A42 A;  4OU7 A;  3PCN A;  4YHH M;  3THG A;  2BUX A;  4WHO A;  1OKS A;  3J2P B;  3T15 A;  2QBY B;  3LQQ A;  3LXV M;  4WHP D;  5A2Q S;  1IY0 A;  2QP9 X;  2DHY A;  4GMQ A;  4LJ4 A;  1L2B A;  1KYI A;  4LJ8 A;  3KOY E;  4XBO A;  4MM3 B;  1YKP A;  2DEN A;  1QUS A;  5KPZ A;  4WHQ A;  1QUT A;  2Y0Q A;  2BUX B;  2NQ8 C;  1OAI A;  1VEG A;  2KNZ A;  4FWD A;  5FTM A;  3PXG A;  1EOC A;  1E32 A;  1PGY A;  2L7H A;  3PCK M;  3J7B A;  3PCJ A;  3E4R A;  5F3W A;  1TMX A;  3KS8 A;  3AKZ A;  1XHB A;  4DV0 M;  2JWS A;  2L09 A;  1K3X A;  2D7G A;  4IIW A;  2CV1 A;  1IN6 A;  2CRU A;  1JR3 E;  4QOZ C;  1N75 A;  2DAE A;  1PRB A;  5DYI A;  4FCW A;  2RRU A;  2C99 A;  3RFW A;  3T63 M;  2DWL A;  1OJL A;  1QZE A;  1XMQ M;  1Q39 A;  3KDS E;  3HJ8 A;  1WGN A;  4RKU F;  3PCL M;  4ZPX A;  3ZQJ A;  2EUC A;  3D8L A;  5JI2 E;  1EOA B;  1G4A E;  3EIH A;  3QYE A;  1MJG M;  2ZTD A;  3HWS A;  3GQ5 A;  2DWM A;  4HEO A;  2GQF A;  2FS1 A;  1KFV A;  2BOY A;  3MV6 M;  4WHS A;  3C3E A;  4M0D A;  3SMS A;  4IBG A;  4IBD A;  4R7G A;  1NY6 A;  2UUB M;  2XSR A;  4R3D A;  2N35 A;  2OQ4 A;  3SAV A;  5EXT A;  3T63 A;  1OAO C;  4HL4 A;  3I4V A;  2EA0 A;  4AG6 A;  4JI2 M;  1YKK A;  1DGG A;  1D0K A;  2KZS A;  2XFS A;  3AL0 C;  3AV0 A;  5KO3 A;  3I4Y A;  4OX9 M;  1ORY B;  1X37 A;  3I51 A;  4FCT A;  4IBC A;  4D80 A;  1IM2 A;  1TH3 A;  4JI8 M;  4WHO B;  2LVN C;  7CAT A;  1DO0 A;  3FUV A;  3I01 M;  4II7 A;  2EKK A;  2R0I A;  4RF0 A;  5KQ8 A;  1Z59 A;  2Z8Y M;  2K6B A;  4DR2 M;  2J7O A;  3GRR A;  1HR0 M;  1R7R A;  4NSR A;  2O25 A;  1YKK B;  1IY1 A;  4W5W A;  3SHF A;  4QNM A;  2ERC A;  2WZJ A;  3PCA M;  2OOA A;  3PCM M;  1GJS A;  2JY7 A;  2Z4S A;  3B9P A;  3BOS A;  2F4V M;  1WIV A;  4GH9 A;  4D82 A;  3LQR A;  3PCB A;  2OPF A;  4L6V 6;  3ZC7 B;  3M6A A;  1E94 E;  1TGU A;  4IBF A;  4WW0 A;  3GLF B;  3CF0 A;  1PJQ A;  1W5T A;  5FTL A;  1SXJ C;  3PVS A;  1SXJ B;  4BB9 A;  1T43 A;  2JY5 A;  3KSX A;  3SYK A;  4NXM M;  4ILT A;  3E9S A;  3U61 A;  2R65 A;  2OO9 A;  4M9Z A;  5ITU A;  1YKL B;  3KS4 A;  1T6O A;  1P3Q Q;  2WSC F;  2BUW A;  4LJ7 A;  1EFU B;  1Z5C A;  2HWJ A;  3KXE C;  3L25 A;  3LMX M;  1QAN A;  4GHA A;  1ZAE A;  3GPP A;  2UXC M;  3J80 S;  2BUQ B;  3W68 A;  4B7F A;  1DV0 A;  4FW9 A;  3U6Q A;  4NOO B;  4L16 A;  2QQ8 A;  2A5Y B;  4G4O A;  1EO2 A;  3K92 A;  1E9S A;  3FTD A;  1C1K A;  3R9X B;  1VEJ A;  4JXJ A;  3U61 B;  4IJF A;  1GL7 A;  4A3V B;  2DXI A;  1PJS A;  2QEN A;  2F5P A;  1N34 M;  1VEK A;  2G8L A;  2BJV A;  4QOS A;  3KFU G;  1TF0 B;  3T38 A;  4LGY A;  4DV4 M;  3U60 B;  2F5N A;  4KHP M;  1DGB A;  2YR0 A;  3AFH A;  3VFD A;  4AKI A;  1EOB B;  5TD3 A;  4PDI A;  3GQ4 A;  4LF7 M;  2DI0 A;  1NSF A;  1A5T A;  4G4N A;  3FTF A;  1EO2 B;  2JA2 A;  4M9S A;  1HNX M;  2E5L M;  3CF2 A;  2DAK A;  3AOG A;  3JR5 A;  1G59 A;  2KNA A;  2EJS A;  3B7N A;  3KSJ A;  3GO8 A;  1Z6T A;  2PCD M;  3W0L B;  4L15 A;  1DGH B;  4PDG A;  3FUX A;  1IN5 A;  1J7K A;  3K8Z A;  3CF6 E;  4PD2 A;  2HHH M;  3PCM A;  2RKO A;  2RGH A;  2BWE A;  4M9X A;  1WJ7 A;  3GLI A;  2LVQ D;  3TWK A;  3SAT A;  2Y0T A;  4HLQ A;  4LF5 M;  1V33 A;  2VQF M;  3VK7 A;  1DO2 A;  2DAG A;  2JY8 A;  1LTM A;  4XK8 F;  2QBY A;  3IG5 A;  2LHC A;  1SG9 A;  1MX0 A;  1G3I A;  4LGM A;  4Q7J A;  3RGS A;  3PNV A;  4RNA A;  4WHS D;  4KLN A;  1QZM A;  4GKK M;  1VDL A;  1PJJ A;  4PT5 A;  4LF4 M;  3LKT M;  2FOI C;  3KOW E;  4ANR A;  4LFC M;  3PCG M;  2P5T A;  4UN2 B;  2F5S A;  4DR6 M;  3UK6 A;  2XFT A;  2KRK A;  2GNO A;  3U5Z B;  1MN3 A;  1QAQ A;  4AKH A;  8CAT A;  1IQP A;  1YSY A;  5FTJ A;  2XGN A;  1IBM M;  4GHL A;  2KNV A;  3SYL A;  4JI7 M;  4I8O A;  2VII A;  5C1B A;  1JR3 D;  3LMM A;  5E6J A;  4FD2 A;  3MMP A;  4K0K M;  3QWL A;  3J81 S;  3GQ3 A;  3HHY A;  2OOB A;  3K1J A;  4LCB A;  4JI5 M;  2BUR B;  2DHR A;  2R6F A;  1IN4 A;  1G41 A;  1L1T A;  3O32 A;  2EKF A;  4MGI E;  2LTU A;  1PJT A;  1LV7 A;  1ZQ9 A;  1MU5 A;  2XLJ A;  3J27 B;  2KA6 B;  1QQW A;  1NNU C;  2FFJ A;  3FUW A;  4LY6 A;  1XMO M;  1EOA A;  3MV4 A;  1VG5 A;  1K3W A;  5IWA M;  3HHZ A;  5EP1 A;  2O5R A;  4DBG B;  2JNH A;  3MI1 A;  1V92 A;  4MH0 E;  4R71 A;  4WHR F;  3GLF E;  2CP8 A;  2PCD A;  5DNY A;  1SXJ E;  2ZBK B;  4LF8 M;  2CV0 A;  3J7A S;  3UZU A;  2JP7 A;  2LVO C;  3GRY A;  3PCF M;  4B08 A;  4X62 M;  1N77 A;  4FCV A;  2ZTC A;  3TWL A;  3FTE A;  2BUY B;  3Q8G A;  3VK8 A;  1EE8 A;  2X4A A;  1L1Z A;  3SFZ A;  3JAM S;  2R45 A;  1OIZ A;  2VDB B;  4GRI A;  1NVM A;  5DFL A;  3TL4 X;  4FVM A;  1DLT A;  3HY5 A;  3K9O A;  3H4J A;  2LH0 A;  4DR5 M;  3T67 A;  3GPY A;  3U6P A;  2DZN B;  3PCE A;  1AUA A;  4LFB M;  4G6Z A;  3GRU A;  4LRT A;  3WHL A;  3FRH A;  1K82 A;  4L78 A;  2DWZ B;  2C96 A;  5L8R F;  1Q02 A;  4DV6 M;  2UXD M;  1GO5 A;  1IFY A;  2Y20 A;  2VQE M;  2CHV A;  1H6U A;  3LCV B;  4IBI A;  1QAO A;  2ZAO A;  3KVW A;  1T3T A;  3GLF A;  1PM5 A;  1DGF A;  2LBC A;  3LXV A;  3PCH M;  2BUZ A;  4B3T M;  1SXJ A;  3IEC A;  1NNJ A;  2ZM6 M;  4LF9 M;  2Z7J A;  1I4W A;  5EP4 A;  2H5X A;  3W0F A;  1YKL A;  2CHQ A;  3CTW B;  2XSZ D;  2UU9 M;  5FTN A;  4DV2 M;  3B7Q A;  2MRO B;  3FKE A;  4PCZ A;  2Z4R A;  1N32 M;  2BUQ A;  1XNQ M;  2V1C A;  2FE8 A;  4REZ A;  3MI5 M;  2QPA A;  2BUZ B;  2F5O A;  3PCK A;  3RGP A;  1IXS A;  3AOE C;  4IBB A;  1TH2 A;  2WSE F;  3OTO M;  1EIJ A;  4WHP A;  4LJ5 A;  1L2D A;  3PCC M;  4AKG A;  4IBE A;  2APL A;  1TDH A;  3U60 A;  1IN7 A;  2JZ0 A;  3DZD A;  3KOX E;  1ZMW A;  3GLH B;  3LW5 F;  3QAU A;  1EOB A;  1NY5 A;  4ILV A;  1QYR A;  1N78 A;  2CWB A;  1S3S A;  2MGW A;  3UMM A;  1HQC A;  4WHO D;  3C9P A;  3PCL A;  4P16 A;  2KEB A;  2DVW B;  5EXS A;  3GLI E;  1Z5A A;  2MR9 A;  3HJS A;  1IXS B;  3LVW A;  1KSF X;  2YNM D;  3SHG B;  4I81 A;  3VKH A;  3HKP A;  1D2N A;  1HNZ M;  3KP0 E;  3MV6 A;  1RU3 A;  2R44 A;  4B3M M;  3NBX X;  4LG2 A;  4WHP B;  5ITT A;  1R6B X;  2O01 F;  2Q2E B;  2L4F A;  2ZAN A;  2XZF A;  1R2Y A;  1L8Q A;  3T6P A;  1DGH A;  2K47 A;  4YY3 M;  1OIP A;  3GPU A;  1R2Z A;  4CIS A;  1Y8G A;  5DYG A;  3FYC A;  4TUW A;  3KW6 A;  3L28 A;  3HU3 A;  3DFZ A;  2KW0 A;  3E21 A;  3L29 A;  4JV5 M;  3PCN M;  1YUB A;  3A98 B;  3FD9 A;  4JI3 M;  4CHT B;  3TPZ A;  1UM8 A;  3CGW A;  2JUJ A;  1TTE A;  3M0E A;  4QHT A;  2BV0 B;  3PCH A;  3MI1 M;  1D0L A;  3D8B A;  1R4G A;  1IY2 A;  5KPR A;  4GC5 A;  4B7G A;  4AG5 A;  2DZO B;  3PNY A;  1FNN A;  1NV9 A;  2K0B X;  2LVA A;  1JQJ C;  2DAM A;  2HKJ A;  3L26 A;  4DR3 M;  3FUT A;  2DWN A;  1IXR C;  4G4R A;  1EO9 B;  3U5Z A;  1DMH A;  3PCA A;  3MK6 A;  4X65 M;  4LF6 M;  1Q3C A;  4CJ6 A;  5IRE B;  1NHW C;  1QVR A;  3FE3 A;  4RF1 A;  2J7N A;  4XGI A;  4WHR B;  1NO1 A;  4LRS A;  2JZ1 A;  4JN6 A;  3L27 A;  3ZCB B;  2QNJ A;  4GEW A;  4WUR A;  3TWM A;  3HU1 A;  3Q8X A;  3V76 A;  4LJA A;  2LWX A;  2KHH A;  2DNA A;  2BUM B;  5BPV A;  2DZL A;  3NBI A;  1OQY A;  3VDP A;  1G8P A;  4L8R C;  2J5Y A;  1YKN B;  3MFL M;  4NL4 H;  3LMX A;  1J09 A;  3GP1 A;  2BUR A;  4P17 A;  2KXE A;  4KO8 A;  2R4J A;  1BVS A;  2DKL A;  2CHG A;  4MGK E;  2C5R A;  1SXJ D;  1JB0 F;  3PFI A;  2C9O A;  5JI3 E;  2Z3X A;  2F5Q A;  4ITQ A;  3U6O A;  2AHM A;  2ZAM A;  3FRI A;  4NC6 A;  2FH0 A;  3U6C A;  1PJI A;  1OTR A;  2L7I A;  4LZJ A;  2KRU A;  5ITY A;  2QCU A;  2I7P A;  3F92 A;  1ZMU A;  1I94 M;  4MGY E;  2AZQ A;  2XSV A;  2BUY A;  4G4Q A;  2M60 A;  2VF7 A;  3TQS A;  1J5E M;  1YKO A;  4L4U A;  5ITQ A;  4DV7 M;  3N9T A;  2BWB A;  3HZJ A;  5GKN A;  5ITX A;  2CE7 A;  3FTC A;  3TE6 A;  4CGY B;  1GLN A;  3A46 A;  5FTK A;  3U6M A;  2CUZ A;  2LNH C;  3HGI A;  1HJP A;  1TR8 A;  2Y21 A;  1OFH A;  1HT2 E;  4DV3 M;  1XNR M;  4LZZ A;  3IG8 A;  1Q3B A;  3LVV A;  3ZH9 B;  4Z6Y A;  4FWH A;  3PCB M;  3PCD M;  1UFZ A;  2BNK A;  3GLH E;  1YKM A;  2XEP A;  1YKO B;  1C7Y A;  4QNR A;  5KPT A;  4AQY M;  3U6L A;  4F1I A;  4CIZ A;  3GLG A;  1TH4 A;  3K9P A;  4LJ6 A;  3EIE A;  1XB2 B;  4EIW A;  3W67 A;  1FJG M;  2YQZ A;  3HHW A;  3A45 A;  1XXH A;  5FSW A;  3LKT A;  1N36 M;  3PCG A;  4I4L A;  2EO2 A;  3R8F A;  1YKP B;  1NJG A;  4MGZ E;  2CEA A;  2LVP C;  3ILK A;  4WHQ B;  3MFL A;  3HJQ A;  4DR4 M;  1YKM B;  1YLA A;  5EXX A;  3K2L A;  1EOC B;  1GJT A;  3DA1 A;  4QHS A;  1IN8 A;  2R18 A;  4X64 M;  4NRW A;  3GLG B;  4GIT A;  3MJ5 A;  1GL6 A;  4GKJ M;  3PCI M;  4NXN M;  1WXQ A;  5EP2 A;  3U6D A;  1XXH B;  2HAK A;  3AOE A;  2CFO A;  3HHX A;  5LMN M;  1HT1 E;  4S12 A;  3IHP A;  2C98 A;  4M0W A;  5E26 A;  1VDD A;  4GIP A;  3VDU A;  3WHK A;  4BLC A;  5BR8 M;  3O5U A;  3SAS A;  3GLH A;  2G3Q A;  1GAB A;  2WSF F;  4Z8X A;  4JI0 M;  2BUT A;  5H37 D;  5KQD A;  3B74 A;  4NSO B;  5IZ7 D;  4B3S M;  3O6J A;  3BBZ A;  2QZ4 A;  1ZV1 A;  3JR4 A;  2BUT B;  4WHS B;  1JR3 A;  2X49 A;  2V1U A;  2L6O A;  1NHG C;  2D7E A;  3UGJ A;  2HL7 A;  1D0M A;  5EP3 A;  4AW4 A;  1IXZ A;  4F2L A;  2R62 A;  3HX3 A;  4MGH A;  1XWI A;  4GC9 A;  2JXN A;  4KOD A;  1AIP C;  2KDL A;  4DR1 M;  1DLQ A;  3B89 A;  3PCF A;  2KZU A;  4OVZ A;  4D81 A;  4JI4 M;  1F4I A;  3PCD A;  4NRV A;  1QDT A;  1V34 A;  1QAM A;  3FUU A;  2CV2 A;  4AI6 A;  3MHV C;  4BBA A;  2XSU A;  3T1H M;  2JY6 B;  4FWG A;  2RGO A;  2XF3 A;  2XZU A;  3SAU A;  1TDZ A;  4DR7 M;  2BV0 A;  3U6S A;  4IBJ A;  3VLF B;  2R46 A;  1N33 M;  2LHG A;  2BUV A;  2FNA A;  1VQ1 A;  3SAR A;  1WR1 B;  3FYD A;  1EO9 A;  3AJI B;  5EXP A;  4OVZ B;  4B3R M;  5LMU M;  4KT0 F;  2C9C A;  3E46 A;  1OFI A;  2H1R A;  3KP1 E;  2DAI A;  2BUU A;  2D7H A;  1R5L A;  1W5S A;  4DV1 M;  4WHR A;  4LFA M;  1Z5B A;  3PCI A;  2W82 A;  4MB7 A;  2BUV B;  4IBK A;  2MJ5 B;  1IBK M;  5IT9 S;  2K9D A;  3GRV A;  4JI6 M;  4AZF A;  1WHC A;  2BUM A;  2BUW B;  2LXE A;  4Y28 F;  1YKN A;  3U6E A;  3C58 A;  2X8A A;  2MH8 A;  3TH1 A;  2QSF X;  4JI1 M;  5EQT A;  3KOZ E;  2BUU B;  3B7Z A;  4DV5 M;  3M7G A;  1NV8 A;  1QDR A;  4DUZ M;  3PCJ M;  2BJW A;  2QHO B;  2HCB A;  3MI5 A;  3MV4 M;  2YFQ A;  4OW0 A;  4DUY M;  2M5Z A;  1HNW M;  1DLM A;  1NJF A;  3DOA A;  3O6R A;  1ZMV A;  3SAW A;  1HQY E;  1YE9 A;  1G71 A; 
#chains in the Genus database with same CATH homology
 3GPX A;  3VKG A;  1GVN A;  4I5S A;  5ITX E;  3L2A A;  3PCC A;  1XC8 A;  4X66 M;  5FLX S;  1GKI A;  2XSZ A;  2UUC M;  3NWL A;  1S9A A;  2I7N A;  1E9R A;  1IBL M;  4B7H A;  2UUA M;  1L2C A;  3UJN A;  3RE8 A;  3HU2 A;  2G5G X;  2UXB M;  3H4M A;  2R4E A;  3T67 M;  2XH9 A;  5C18 A;  3PCE M;  3SC3 A;  5EJC A;  3SBJ A;  3T1Y M;  3SMP A;  4IJE A;  2V6Z M;  3GLI B;  4LJ9 A;  5ITR A;  4JYA M;  3A42 A;  4OU7 A;  3PCN A;  4YHH M;  3THG A;  2BUX A;  4WHO A;  3J2P B;  3T15 A;  2QBY B;  3LQQ A;  3LXV M;  4WHP D;  5A2Q S;  1IY0 A;  2QP9 X;  4GMQ A;  4LJ4 A;  1L2B A;  1KYI A;  4LJ8 A;  3KOY E;  4XBO A;  4MM3 B;  1YKP A;  5KPZ A;  4WHQ A;  2Y0Q A;  2BUX B;  2NQ8 C;  4FWD A;  1EOC A;  3PXG A;  4WHO B;  5FTM A;  1E32 A;  2L7H A;  3PCK M;  3J7B A;  3PCJ A;  3E4R A;  5F3W A;  1TMX A;  3KS8 A;  3AKZ A;  1XHB A;  4DV0 M;  1K3X A;  2L09 A;  2D7G A;  4IIW A;  2CV1 A;  1IN6 A;  4QOZ C;  1N75 A;  5DYI A;  4FCW A;  2C99 A;  3RFW A;  3T63 M;  2DWL A;  1OJL A;  1XMQ M;  1Q39 A;  3KDS E;  3HJ8 A;  3PCL M;  4ZPX A;  2EUC A;  3D8L A;  5JI2 E;  1EOA B;  1G4A E;  3EIH A;  3GQ5 A;  3HWS A;  3MV6 M;  2DWM A;  2BOY A;  1KFV A;  4WHS A;  4M0D A;  3SMS A;  4IBG A;  4IBD A;  4R7G A;  1NY6 A;  2UUB M;  2XSR A;  4R3D A;  2OQ4 A;  3SAV A;  5EXT A;  4HL4 A;  3I4V A;  2EA0 A;  4AG6 A;  4JI2 M;  1YKK A;  1DGG A;  2KZS A;  2XFS A;  3AL0 C;  3AV0 A;  5KO3 A;  3I4Y A;  4OX9 M;  1ORY B;  1X37 A;  3I51 A;  4FCT A;  4IBC A;  4D80 A;  1IM2 A;  1TH3 A;  4JI8 M;  7CAT A;  1DO0 A;  3FUV A;  4II7 A;  5KQ8 A;  4RF0 A;  1HR0 M;  1Z59 A;  4DR2 M;  2J7O A;  3GRR A;  1R7R A;  4NSR A;  1YKK B;  1IY1 A;  4W5W A;  3SHF A;  4QNM A;  2ERC A;  3PCA M;  3PCM M;  3B9P A;  2Z4S A;  3BOS A;  2F4V M;  4GH9 A;  4D82 A;  3LQR A;  3PCB A;  2OPF A;  3ZC7 B;  3M6A A;  1E94 E;  1TGU A;  4IBF A;  4WW0 A;  3GLF B;  3CF0 A;  1W5T A;  5FTL A;  1SXJ C;  3PVS A;  1SXJ B;  4BB9 A;  3KSX A;  3SYK A;  4NXM M;  4ILT A;  3E9S A;  3U61 A;  2R65 A;  5ITU A;  4M9Z A;  1YKL B;  3KS4 A;  2BUW A;  4LJ7 A;  3L25 A;  1Z5C A;  3KXE C;  3LMX M;  1QAN A;  4GHA A;  1ZAE A;  3GPP A;  2UXC M;  3J80 S;  2BUQ B;  4B7F A;  4FW9 A;  3U6Q A;  4NOO B;  4L16 A;  4G4O A;  2A5Y B;  1EO2 A;  3K92 A;  1E9S A;  3FTD A;  1C1K A;  3R9X B;  4JXJ A;  3U61 B;  4IJF A;  1GL7 A;  4A3V B;  2DXI A;  2QEN A;  2F5P A;  1N34 M;  2G8L A;  2BJV A;  4QOS A;  3KFU G;  3T38 A;  4DV4 M;  4LGY A;  3U60 B;  4KHP M;  2F5N A;  1DGB A;  2YR0 A;  3AFH A;  3VFD A;  4AKI A;  1EOB B;  5TD3 A;  4PDI A;  3GQ4 A;  4LF7 M;  1NSF A;  3FTF A;  4G4N A;  1EO2 B;  2JA2 A;  4M9S A;  1HNX M;  2E5L M;  3CF2 A;  3AOG A;  3JR5 A;  1G59 A;  3KSJ A;  3GO8 A;  1Z6T A;  2PCD M;  3W0L B;  4L15 A;  1DGH B;  4PDG A;  3FUX A;  1IN5 A;  1J7K A;  3K8Z A;  3CF6 E;  4PD2 A;  2HHH M;  3PCM A;  2RKO A;  2RGH A;  4M9X A;  3GLI A;  4LF5 M;  3TWK A;  3SAT A;  2Y0T A;  4HLQ A;  2VQF M;  3VK7 A;  1DO2 A;  2QBY A;  3IG5 A;  1MX0 A;  1G3I A;  4LGM A;  3RGS A;  3PNV A;  4RNA A;  4WHS D;  4KLN A;  1QZM A;  4GKK M;  1PJJ A;  4PT5 A;  4LF4 M;  3LKT M;  2FOI C;  3KOW E;  4LFC M;  3PCG M;  2P5T A;  2F5S A;  4DR6 M;  3UK6 A;  2XFT A;  2KRK A;  3U5Z B;  1QAQ A;  4AKH A;  8CAT A;  1IQP A;  1YSY A;  5FTJ A;  2XGN A;  1IBM M;  4GHL A;  3SYL A;  4JI7 M;  4I8O A;  2VII A;  5C1B A;  1JR3 D;  3LMM A;  5E6J A;  4FD2 A;  4K0K M;  3QWL A;  3J81 S;  3GQ3 A;  3HHY A;  3K1J A;  4LCB A;  4JI5 M;  2BUR B;  2DHR A;  1L1T A;  1IN4 A;  1G41 A;  3O32 A;  4MGI E;  1LV7 A;  1ZQ9 A;  1MU5 A;  2XLJ A;  3J27 B;  2KA6 B;  1QQW A;  1NNU C;  2FFJ A;  3FUW A;  4LY6 A;  1XMO M;  1EOA A;  3MV4 A;  1K3W A;  5IWA M;  3HHZ A;  5EP1 A;  2O5R A;  3MI1 A;  4MH0 E;  4WHR F;  2PCD A;  5DNY A;  1SXJ E;  2ZBK B;  4LF8 M;  2CV0 A;  3J7A S;  3UZU A;  3GRY A;  3PCF M;  4B08 A;  4X62 M;  1N77 A;  4FCV A;  3TWL A;  3FTE A;  2BUY B;  3VK8 A;  1EE8 A;  2X4A A;  1L1Z A;  3SFZ A;  3JAM S;  2R45 A;  4GRI A;  1NVM A;  3TL4 X;  4FVM A;  1DLT A;  4DR5 M;  2LH0 A;  3T67 A;  3GPY A;  3U6P A;  2DZN B;  3PCE A;  4LFB M;  4G6Z A;  3GRU A;  4LRT A;  3WHL A;  1K82 A;  4L78 A;  2DWZ B;  2C96 A;  2UXD M;  4DV6 M;  2Y20 A;  2VQE M;  2CHV A;  1H6U A;  4IBI A;  1QAO A;  2ZAO A;  3KVW A;  1T3T A;  3GLF A;  1PM5 A;  1DGF A;  3LXV A;  3PCH M;  2BUZ A;  4B3T M;  1SXJ A;  1NNJ A;  4LF9 M;  2ZM6 M;  2Z7J A;  1I4W A;  5EP4 A;  3W0F A;  1YKL A;  2CHQ A;  3CTW B;  2XSZ D;  2UU9 M;  5FTN A;  4DV2 M;  3FKE A;  4PCZ A;  2Z4R A;  1N32 M;  2BUQ A;  1XNQ M;  2V1C A;  2FE8 A;  4REZ A;  3MI5 M;  2QPA A;  2BUZ B;  2F5O A;  3PCK A;  3RGP A;  3AOE C;  4IBB A;  1TH2 A;  3OTO M;  4WHP A;  4LJ5 A;  1L2D A;  3PCC M;  4AKG A;  4IBE A;  3T63 A;  1TDH A;  3U60 A;  1IN7 A;  3DZD A;  4ILV A;  3KOX E;  3GLH B;  3QAU A;  1EOB A;  1NY5 A;  1QYR A;  1N78 A;  1S3S A;  4WHO D;  3UMM A;  1HQC A;  3PCL A;  4P16 A;  2KEB A;  2DVW B;  5EXS A;  1Z5A A;  3HJS A;  3LVW A;  1IXS B;  1KSF X;  2YNM D;  3SHG B;  4I81 A;  3VKH A;  3HKP A;  1D2N A;  1HNZ M;  3KP0 E;  3MV6 A;  4B3M M;  4LG2 A;  4WHP B;  5ITT A;  1R6B X;  2Q2E B;  2XZF A;  2ZAN A;  1R2Y A;  1L8Q A;  4YY3 M;  1DGH A;  2K47 A;  3GPU A;  1R2Z A;  4CIS A;  5DYG A;  3FYC A;  4TUW A;  3KW6 A;  3L28 A;  3HU3 A;  3DFZ A;  2KW0 A;  3L29 A;  4JV5 M;  3PCN M;  1YUB A;  3A98 B;  3FD9 A;  4JI3 M;  4CHT B;  3TPZ A;  1UM8 A;  3PCH A;  3M0E A;  4QHT A;  2BV0 B;  3MI1 M;  3D8B A;  1IY2 A;  5KPR A;  4GC5 A;  4B7G A;  4AG5 A;  2DZO B;  3PNY A;  1FNN A;  3L26 A;  4DR3 M;  2DWN A;  1JQJ C;  2HKJ A;  3PCA A;  1EO9 B;  3FUT A;  1IXR C;  4G4R A;  3U5Z A;  1DMH A;  3MK6 A;  4X65 M;  4LF6 M;  1Q3C A;  5IRE B;  1NHW C;  1QVR A;  4RF1 A;  2J7N A;  4XGI A;  4WHR B;  4LRS A;  4JN6 A;  3L27 A;  3ZCB B;  4WUR A;  3TWM A;  3HU1 A;  3Q8X A;  4LJA A;  2LWX A;  2BUM B;  5BPV A;  3NBI A;  3VDP A;  1G8P A;  4L8R C;  1YKN B;  3MFL M;  4NL4 H;  3LMX A;  1J09 A;  3GP1 A;  2BUR A;  2KXE A;  4KO8 A;  2R4J A;  2CHG A;  4MGK E;  2C5R A;  1SXJ D;  3PFI A;  2C9O A;  5JI3 E;  2Z3X A;  2F5Q A;  4ITQ A;  3U6O A;  2AHM A;  2ZAM A;  3U6C A;  1PJI A;  2L7I A;  4LZJ A;  2KRU A;  5ITY A;  2QCU A;  2I7P A;  1I94 M;  2AZQ A;  4MGY E;  2XSV A;  2BUY A;  4G4Q A;  2M60 A;  3TQS A;  1J5E M;  1YKO A;  4L4U A;  5ITQ A;  4DV7 M;  3N9T A;  5GKN A;  5ITX A;  2CE7 A;  3FTC A;  3TE6 A;  4CGY B;  1GLN A;  3A46 A;  5FTK A;  3U6M A;  2CUZ A;  2LNH C;  3HGI A;  2Y21 A;  1OFH A;  1HT2 E;  4DV3 M;  1XNR M;  4LZZ A;  3IG8 A;  1Q3B A;  3LVV A;  3ZH9 B;  4Z6Y A;  4FWH A;  3PCB M;  3PCD M;  2BNK A;  1YKO B;  1YKM A;  2XEP A;  4QNR A;  5KPT A;  4AQY M;  3U6L A;  3GLG A;  1TH4 A;  4LJ6 A;  3EIE A;  1FJG M;  4EIW A;  2YQZ A;  3HHW A;  3A45 A;  1XXH A;  5FSW A;  3LKT A;  1N36 M;  3PCG A;  4I4L A;  2EO2 A;  3R8F A;  1YKP B;  1NJG A;  4MGZ E;  2CEA A;  3ILK A;  4WHQ B;  3MFL A;  3HJQ A;  4DR4 M;  1YKM B;  5EXX A;  3K2L A;  1EOC B;  3DA1 A;  4QHS A;  1IN8 A;  2R18 A;  4X64 M;  4NRW A;  3GLG B;  4GIT A;  3MJ5 A;  1GL6 A;  4GKJ M;  3PCI M;  4NXN M;  1WXQ A;  5EP2 A;  3U6D A;  1XXH B;  3AOE A;  3HHX A;  2CFO A;  5LMN M;  1HT1 E;  4S12 A;  4M0W A;  2C98 A;  3WHK A;  5E26 A;  1VDD A;  4GIP A;  3VDU A;  4BLC A;  5BR8 M;  3O5U A;  3SAS A;  3GLH A;  2BUT A;  4Z8X A;  4JI0 M;  5H37 D;  5KQD A;  4NSO B;  5IZ7 D;  4B3S M;  3O6J A;  2QZ4 A;  3JR4 A;  4WHS B;  1JR3 A;  2X49 A;  2V1U A;  2L6O A;  1NHG C;  2D7E A;  3UGJ A;  2HL7 A;  5EP3 A;  4AW4 A;  1IXZ A;  2R62 A;  4MGH A;  1DLQ A;  1XWI A;  4GC9 A;  2BUT B;  4KOD A;  3PCF A;  4DR1 M;  2KZU A;  4OVZ A;  4D81 A;  4JI4 M;  3PCD A;  4NRV A;  1QAM A;  3FUU A;  2CV2 A;  4AI6 A;  3MHV C;  4BBA A;  2XSU A;  3T1H M;  4FWG A;  2RGO A;  2XF3 A;  2XZU A;  3SAU A;  1TDZ A;  4DR7 M;  2BV0 A;  3U6S A;  4IBJ A;  3VLF B;  2R46 A;  1N33 M;  2BUV A;  2FNA A;  3SAR A;  3FYD A;  1EO9 A;  3AJI B;  5EXP A;  4OVZ B;  4B3R M;  5LMU M;  2C9C A;  1OFI A;  2H1R A;  3KP1 E;  2BUU A;  2D7H A;  1W5S A;  4DV1 M;  4WHR A;  4LFA M;  1Z5B A;  3PCI A;  2W82 A;  4MB7 A;  2BUV B;  4IBK A;  1IBK M;  5IT9 S;  3GRV A;  4JI6 M;  4AZF A;  2BUM A;  2BUW B;  2LXE A;  1YKN A;  3U6E A;  3C58 A;  2X8A A;  3TH1 A;  4JI1 M;  5EQT A;  3KOZ E;  2BUU B;  4DV5 M;  3M7G A;  4DUZ M;  3PCJ M;  2BJW A;  2HCB A;  3MI5 A;  3MV4 M;  2YFQ A;  4OW0 A;  4DUY M;  2M5Z A;  1HNW M;  1DLM A;  1NJF A;  3DOA A;  3O6R A;  3SAW A;  1HQY E;  1YE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...