3HHXA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
b'ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhxA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhxA02
4WHPA 3T67A 2BOYA 1DLQA 3PCFM 3PCIM 3HHXA 2AZQA 3PCJA 2BUQB 3MI5M 3PCFA 3PCIA 1YKMA 1YKNA 2PCDM 1YKOA 1DLTA 4WHRA 2PCDA 3PCAM 1DLMA 2BUVA 2BURA 2BUZA 1EO9A 3I51A 4WHOD 3PCAA 3PCHM 3TH1A 1EOAA 3PCDM 3N9TA 1EO2B 3PCEM 4WHSB 3O6RA 2BUUA 4WHPB 3MI1M 3PCEA 3MI1A 1YKLA 1YKMB 1EOBA 3MI5A 1YKNB 2BUMA 3PCBM 2BUTA 4ILVA 4WHOA 1YKOB 4WHRB 2BUWA 3PCBA 3O5UA 2BUVB 2BURB 4ILTA 1EOCA 2BUZB 3HJSA 1EO9B 3PCLM 2BV0A 4WHRF 1EOAB 1YKPA 1YKKA 3PCHA 3MFLM 3PCLA 3MV4M 3PCDA 2BUUB 3T63M 3MFLA 3O6JA 2BUXA 3HKPA 4WHQA 4WHQB 3T63A 3PCKM 1YKLB 3PCGM 2XSUA 1EOBB 3PCKA 3PCMM 3PCCA 2BUMB 3LMXM 3PCGA 2BUTB 3LXVM 4WHOB 3HJ8A 3PCMA 2BUWB 1S9AA 3LXVA 3PCJM 5TD3A 1EOCB 2XSRA 2BV0B 4WHSD 2BUQA 3LKTM 3MV6M 1YKPB 1YKKB 4WHPD 1TMXA 3LKTA 3MV6A 2BUYA 3MV4A 3HHYA 2BUYB 2BUXB 3PCNM 3I4VA 2XSVA 3PCNA 3I4YA 1DMHA 3PCCM 3O32A 3T67M 1EO2A 4WHSA 3HGIA 3LMXA 3HJQA
chains in the Genus database with same CATH superfamily
4PD2A 3FE3A 2QQ8A 3FUTA 1D0MA 4R71A 2MH8A 3BXWA 3L2AA 2VQFM 3PCFM 1SXJC 2QENA 3FTCA 3J27B 3HHXA 3GLIE 2DWMA 4NXMM 4AKGA 3R9XB 2Q2EB 2A5YB 2BUQB 3MI5M 1V33A 3PCIA 1JR3A 1VQ1A 1NV9A 3LVVA 3U6DA 4RF1A 2F5NA 2ZTCA 2J7NA 4YHHM 3FD9A 2MGWA 2BWEA 2DWNA 1D2NA 2KNZA 2YFQA 1OIPA 1UFZA 1Z59A 3AOGA 1V34A 3GO8A 1YKOA 4MGKE 4WHRA 2F5PA 5DYGA 3W0LB 2PCDA 3K9OA 2BURA 4IBCA 2XSUA 1WGNA 2QZ4A 5FLXS 4LF7M 4LZJA 4WHOD 1L8QA 4DR7M 3BBZA 3C9PA 3VK7A 3PCDM 1VG5A 5EXTA 2FOIC 5IZ7D 3ILKA 3RGSA 4GKKM 2L4EA 1QAMA 2V1CA 1X37A 3KXEC 4KLNA 3O6RA 2I7PA 2F5OA 4WHPB 2L7IA 4F1IA 2V6ZM 3KVWA 3WHKA 3PCEA 2O01F 3KOXE 4NXNM 3H4JA 3C3EA 3K8ZA 2J5YA 4JI4M 2WSFF 3GLFA 3SHGB 1AIPC 1DGHA 4QNMA 2MR9A 4LF6M 1EOBA 3GLFB 3U6LA 2BJWA 2VF7A 2LXEA 4M9SA 4HLQA 2DAMA 2D7GA 5EQTA 3PXGA 3OTOM 1N33M 3PCLA 3E9SA 2EUCA 5EP2A 1W5SA 5GKNA 4M9XA 2XF3A 2BUWA 4RNAA 4DUYM 2R62A 2UXCM 1R6BX 3O5UA 2UUBM 3A45A 5EXSA 2JZ0A 5ITXE 3IG8A 4LJ5A 2L4FA 3HJSA 1EO9B 3KOWE 4WHRF 3U5ZA 3R8FA 1HR0M 2KRUA 1XNRM 2L2DA 3D8BA 4L15A 3SARA 3T1HM 3W67A 1YKKA 1HQYE 2AHMA 4G3OA 3VKGA 2XH9A 1IXSB 5EP3A 2JNHA 1IN6A 4LJ6A 4DBGB 8CATA 4YY3M 4JI6M 4WP2A 4GKJM 4LJ4A 2BUXA 3V76A 3CTWB 2DAGA 1OIZA 2KZUA 3LQQA 4P16A 2HL7A 4LY6A 2R4JA 3L26A 2F5QA 3T63A 1ZQ9A 3C3DA 4QNRA 2GNOA 3TWLA 2DZOB 2CHVA 4MGIE 3SAVA 3PCGM 3U60A 2L6OA 1IN5A 1QVRA 4X62M 2KNVA 4LGYA 1GO5A 5E26A 5LMUM 3LXVM 4WHOB 2DXIA 3HJ8A 2LHCA 2QBYB 3PCMA 1TR8A 1S9AA 4AG5A 4DR2M 5TD3A 1YSYA 1C1KA 1VEGA 1QAQA 3SYLA 4WHSD 3KS4A 5FTJA 3LKTM 4LCBA 2FE8A 1OAOC 2C98A 3B7NA 1ZMUA 3SMPA 3UMMA 3CGWA 4Z6YA 4RF0A 3T1YM 2CV2A 3KP0E 3K2LA 3SHFA 1IXRC 1NO1A 5BR8M 2B3TA 3FKEA 4BBAA 3MV6A 2BUYA 4M0WA 2BUYB 1HT1E 5C1BA 3PCNM 4EIWA 3I4VA 4AKIA 1WIVA 1KFVA 1EIJA 5KPRA 3A98B 2LHGA 4GH9A 2FFJA 4FWGA 4LRTA 4ZPXA 1QUSA 1XMOM 4I5SA 3PCCM 4L78A 2XSZA 2Y20A 4IBJA 3VDUA 1TH3A 2C99A 3GRUA 3T67M 4NRVA 4LF5M 3GRVA 3HGIA 2FNAA 3LMXA 2CWBA 3HJQA 3DFZA 3F92A 3SASA 4Q7JA 3GRRA 4JI2M 1XC8A 4L8RC 3KP1E 3PCJA 2LVOC 1PJTA 1EE8A 2MROB 4IBDA 2YQZA 1W5TA 3GLHE 4R7GA 3LQRA 5LMNM 1DO2A 1YKMA 4DV6M 1XNQM 3C58A 3GPUA 2LNHC 3B74A 3U6CA 1DLTA 1NY5A 3B7QA 4CHTB 2APLA 3SMSA 2Z3XA 3M6AA 2F5SA 1GJSA 2QHOB 2D7HA 2VDBB 4IJFA 4LRSA 2XZUA 2JXNA 3FTEA 3UGJA 1ORYB 2O5RA 4DV3M 3PCAA 4B7FA 3TH1A 1EOAA 5EXXA 4RKUF 3N9TA 1MJGM 2KDLA 4WHSB 2K0BX 3GLHA 1N75A 3E4RA 3GPPA 3SATA 4FWHA 1R7RA 3ZC7B 2OO9A 1Q39A 2K47A 3L25A 1F4IA 4IIWA 1QDTA 3MI1A 3QYBA 2CFOA 2O25A 3DA1A 1YKLA 4P17A 4GMQA 3T38A 2XFTA 3K1JA 4D82A 2DVWB 4DR5M 3PCBM 1VDLA 5ITUA 1WGLA 2BUTA 1TTEA 4B08A 1L1TA 1G41A 1QDRA 1R5LA 2Z8YM 3LMMA 4CGYB 1J09A 1QYRA 4S12A 4JI1M 1YKOB 4WHRB 2KRKA 4II7A 4LFAM 1T3TA 3UK6A 4IBEA 1XB2B 2BURB 1IM2A 4LJ8A 1G71A 1GLNA 7CATA 4B3SM 1EOCA 2BUVA 1V92A 2OPFA 3GLIA 3U6QA 4JI8M 4OX9M 3PCLM 2VQEM 1XWIA 3GLIB 1D0LA 2LWXA 3W0FA 1N32M 4NC6A 1AUAA 4IBFA 3GLGE 4DR4M 2YR0A 1A5TA 5EP1A 2BJVA 2KEBA 4KO8A 1T6OA 2BNKA 2JY6B 4LF8M 3HKPA 3VKHA 3MFLA 4REZA 3DZDA 3Q8XA 3CF2A 3AKZA 3PCKM 3GP1A 4GHAA 2UXDM 3ZH9B 4KODA 3FTFA 1DGHB 1XXHE 2G5GX 2R0IA 2CHGA 1NJFA 2DZLA 1IFYA 1EOBB 4R3DA 2DAIA 3J2PB 4M9ZA 4PDIA 1UM8A 3ZQJA 3LMXM 4MB7A 2CV1A 2JY5A 3GQ3A 4L4UA 4AI6A 1SXJE 2BUWB 3HU2A 2CUZA 2QPAA 4FD2A 3GLGA 2G8LA 3PCJM 2XSZD 1D0KA 4GHLA 1SG9A 2XSRA 1LTMA 1ZMWA 4JN6A 2RKOA 3U5ZB 3W68A 1YKKB 1VDDA 2KA6B 2LH0A 1TMXA 5IWAM 1XXHA 2R4EA 1Z6TA 3J7BA 5EJCA 1R4GA 2DHRA 5DFLA 3HHYA 1DGFA 3VLFB 2BUXB 3FRIA 4LFBM 1KYIA 1RU3A 2DWZB 4IBBA 2EKFA 2OOAA 4DUZM 1J7KA 5ITXA 1FJGM 1NSFA 3U60B 3HX3A 2V1UA 3GRYA 1WJ7A 3FRHA 1JQJC 1IY2A 5BPVA 4B3RM 2KNAA 3NBIA 1EO2A 5A2QS 2CV0A 1MX0A 2JP7A 4IBKA 3KDSE 4AG6A 5C18A 4ITQA 1YE9A 2BOYA 4DV2M 2DENA 2JZ1A 4GC9A 3SC3A 4LG2A 3PNYA 3PCIM 1GL6A 3NBXX 2AZQA 1IQPA 4LJAA 3EIEA 3WHLA 5IREB 1N78A 1OTRA 3MK6A 1TF0B 5ITRA 2C5RA 3PCFA 1VEKA 1Z5CA 2H5XA 4UN2B 1YKNA 3I04M 3KS8A 4GEWA 3L29A 4OVZA 5FSWA 3U6MA 2PCDM 4MH0E 4MGYE 4HL4A 3K92A 5JI3E 4OU7A 1WXQA 1IY1A 1JR3D 2GQFA 1EFUB 1OKSA 2DNAA 2VIIA 4L6V6 3UJNA 1L2CA 4JYAM 2JWSA 4TUWA 2BWBA 2KXEA 2C9OA 3MJ5A 1G3IA 2P5TA 1NHWC 4FCTA 4MM3B 1OFHA 3VDPA 4AZFA 2BUZA 2M60A 3JAMS 4GC5A 3UZUA 3JR5A 1H6UA 4DR1M 2NQ8C 4DV0M 4CIZA 2MJ5B 2CHQA 1NVMA 4X66M 5JI2E 2Z7JA 4G4OA 4KT0F 4IBIA 4LGMA 2HWJA 3PCEM 2H1RA 4PT5A 2Y0TA 3M0EA 1XMQM 1HJPA 3MHVC 4IJEA 2BUUA 3AL0C 2UUCM 3HU1A 2LVNC 1TGUA 2RRUA 1NV8A 4X65M 2ZAMA 2UU9M 2XFSA 1OQYA 1G59A 4GIPA 3SAWA 1TH2A 3FUUA 3FYCA 4FVMA 3HHZA 1YKMB 2Z4SA 2BUMA 1K3XA 2LTUA 2E5LM 1OAIA 1R2YA 2R45A 1YUBA 3HZJA 1E32A 2UUAM 2DAEA 2QP9X 4B7HA 4CJ6A 4I4LA 3JR4A 1NNJA 1Z5AA 3SFZA 4LZZA 4FWDA 4FCWA 4ILTA 3IG5A 2C96A 2X49A 2BV0A 4JI7M 3E21A 1ZV1A 1I4WA 3D8LA 3IHPA 5DYIA 1GKIA 1EOAB 2WZJA 3VFDA 1YKPA 2I7NA 3NWLA 4JI0M 3PCHA 1IBKM 1HNXM 2HCBA 1P3QQ 3GLHB 4QHTA 5ITQA 4LF4M 2QSFX 4AKHA 3T63M 4DR6M 2DKLA 4D80A 1DO0A 5IT9S 1OFIA 1QQWA 2Y21A 1DGGA 1T43A 4QHSA 2QCUA 3FYDA 3BOSA 1G8PA 3CF0A 4B7GA 1YKLB 4GRIA 4QOSA 1MU5A 4MGZE 3L27A 2ZM6M 2C9CA 1PM5A 3PCMM 1NY6A 2G3QA 1PJJA 3PCGA 2BUTB 4MGHA 3SAUA 1IY0A 3PFIA 4W5WA 3A42A 2LVAA 3SYKA 1GVNA 4XK8F 3GQ5A 1L2DA 3B89A 3LXVA 1QUTA 2OQ4A 1HT2E 2WSEF 1EOCB 5FTLA 3KFUG 2EO2A 2X8AA 3CF6E 4XBOA 2BUQA 1J5EM 2EJSA 1Q3CA 3MV6M 2JY7A 1BVSA 4WW0A 1Q02A 2FS1A 3QYEA 4DV1M 3LKTA 3E46A 2W82A 2EA0A 4F2LA 3U6EA 3MV4A 1PRBA 4DR3M 3A46A 3THGA 1K3WA 2QNJA 4XGIA 3MMPA 3PNVA 1C7YA 5L8RF 2L7HA 2XSVA 4PCZA 1S3SA 2XGNA 2ZBKB 3GLFE 4LJ7A 2Y0QA 2UXBM 3PCNA 3I4YA 3RGPA 1Y8GA 2K6BA 5ITYA 3KOYE 2KHHA 1DMHA 2YNMD 3TQSA 4Y28F 1HQCA 3AFHA 1HNZM 4BLCA 3RFWA 3HWSA 1IN4A 3FUVA 3U61A 2R46A 1GABA 3O32A 2FH0A 3PCCA 4WHPA 3U61B 3T67A 3GLGB 2D7EA 5KQ8A 1I94M 1DLQA 1MN3A 2XLJA 3GPXA 5FTKA 4B3TM 3GQ4A 4LF9M 4JI5M 2HKJA 5H37D 1QZMA 3VK8A 1IXZA 2DHYA 1PGYA 3AOEA 1Z5BA 2WSCF 4ANRA 2RGHA 4OW0A 1YLAA 2K9DA 1FNNA 1XXHB 1XHBA 5DNYA 1HNWM 3TL4X 4G4RA 5FTMA 1KSFX 4CISA 1SXJA 2JUJA 1N36M 3PCAM 2OOBA 1DLMA 1SXJB 4X64M 1WHCA 1DV0A 1QZEA 2CRUA 1EO9A 1G4AE 3I51A 1ZAEA 3TWKA 5F3WA 3PCHM 1PJSA 4FW9A 4G4QA 1NNUC 3AJIB 1L2BA 3B7ZA 1EO2B 2J7OA 1IXSA 1JB0F 3ZCBB 5EXPA 3QWLA 4I81A 4I8OA 5FTNA 3MI1M 1CUKA 2DAKA 3M7GA 3T6PA 4A3VB 1Q3BA 2CP8A 4Z8XA 4G6ZA 3SBJA 3I01M 4JV5M 1OJLA 5KQDA 3KW6A 2HAKA 3J80S 3TPZA 2X4AA 3H4MA 2CE7A 1YKNB 3MI5A 2R65A 4OVZB 4ILVA 4WHOA 2LVQD 2R18A 2R6FA 3IECA 3J7AS 2QBYA 1K82A 1QAOA 2XEPA 3PCBA 2CEAA 4NL4H 1TH4A 4NSOB 4B3MM 2BUVB 3FTDA 2BUZB 2R44A 4KHPM 3LCUA 3U6SA 5EP4A 1NJGA 4NRWA 4K0KM 5ITTA 2Z4RA 3KSJA 2JY8A 1E9SA 3EIHA 3HHWA 5E6JA 3U6OA 4WURA 3MFLM 2N35A 4LFCM 3MV4M 3PCDA 2BUUB 4JXJA 4BB9A 3KSXA 4AW4A 2HHHM 1GL7A 2ZTDA 3O6JA 2LVPC 3FUWA 4LJ9A 3GPYA 4WHQA 1N77A 5KPZA 4WHQB 3LVWA 2XZFA 1IBMM 2LBCA 1VEJA 3LCVB 4QOZC 2DZNB 4M0DA 1E94E 4NSRA 3PCKA 1ZMVA 4DV5M 2BUMB 4G4NA 4PDGA 3B9PA 1IN7A 1R2ZA 3K9PA 3U6PA 3KOZE 2VF8A 1LV7A 4JI3M 2DWLA 1DGBA 2M5ZA 3T15A 2ZAOA 3DOAA 2ERCA 2BV0B 2KZSA 1TDZA 3PVSA 3TWMA 3LW5F 3Q8GA 1YKPB 4WHPD 1WR1B 1N34M 1PJQA 4D81A 5KO3A 3L28A 4NOOB 3QAUA 4L16A 2JA2A 4IBGA 4FCVA 4DV7M 3HY5A 1E9RA 3FUXA 1JR3E 4HEOA 5KPTA 1TDHA 1QANA 2KW0A 2DI0A 4DV4M 4AQYM 1IN8A 2RGOA 3HU3A 1L1ZA 2L09A 2EKKA 3J81S 2F4VM 4GITA 1PJIA 1SXJD 3AOEC 3AV0A 1NHGC 3TE6A 4WHSA 3RE8A 1GJTA 2ZANA 1IBLM
chains in the Genus database with same CATH topology
4PD2A 3FUTA 2VQFM 3L2AA 3PCFM 1SXJC 2QENA 3FTCA 3J27B 3HHXA 2DWMA 4AKGA 4NXMM 3R9XB 2Q2EB 2A5YB 2BUQB 3MI5M 3PCIA 1JR3A 3LVVA 3U6DA 4RF1A 2F5NA 2J7NA 4YHHM 3FD9A 2DWNA 1D2NA 2YFQA 3AOGA 1Z59A 1YKOA 3GO8A 4MGKE 4WHRA 2F5PA 5DYGA 3W0LB 2PCDA 2BURA 4IBCA 2QZ4A 5FLXS 4LF7M 4LZJA 4WHOD 1L8QA 4DR7M 3VK7A 3PCDM 5EXTA 2FOIC 5IZ7D 3ILKA 3RGSA 4GKKM 3O6RA 1QAMA 2V1CA 1X37A 3KXEC 4KLNA 2I7PA 2F5OA 4WHPB 2L7IA 3PCEA 2V6ZM 3KVWA 3WHKA 3KOXE 4NXNM 3K8ZA 4JI4M 3GLFA 3SHGB 1DGHA 4QNMA 4LF6M 1EOBA 3GLFB 3U6LA 2BJWA 1N33M 2LXEA 4M9SA 4HLQA 5EQTA 2D7GA 3PXGA 3OTOM 3VKGA 3PCLA 3E9SA 2EUCA 5EP2A 1W5SA 5GKNA 4M9XA 2XF3A 2BUWA 4RNAA 4DUYM 2R62A 2UXCM 1R6BX 3O5UA 2UUBM 3A45A 5EXSA 5ITXE 3IG8A 4LJ5A 3HJSA 1EO9B 3KOWE 4WHRF 3U5ZA 3R8FA 1HR0M 2KRUA 1XNRM 3D8BA 4L15A 3SARA 3T1HM 1YKKA 1HQYE 2AHMA 2XH9A 1IXSB 5EP3A 4LJ6A 1IN6A 4YY3M 4JI6M 8CATA 4GKJM 4LJ4A 2BUXA 3CTWB 2KZUA 3LQQA 4P16A 2HL7A 4LY6A 2R4JA 3L26A 2F5QA 3T63A 1ZQ9A 4QNRA 3TWLA 2DZOB 2CHVA 4MGIE 3SAVA 3PCGM 3U60A 2L6OA 1IN5A 1QVRA 4X62M 4LGYA 5E26A 5LMUM 3LXVM 4WHOB 2DXIA 3HJ8A 2QBYB 3PCMA 1S9AA 4AG5A 4DR2M 5TD3A 1YSYA 1C1KA 1QAQA 3SYLA 4WHSD 3KS4A 5FTJA 3LKTM 4LCBA 2FE8A 3SMPA 2C98A 3UMMA 3T1YM 1K3WA 2CV2A 4Z6YA 4RF0A 3KP0E 3K2LA 3SHFA 1IXRC 5BR8M 3FKEA 4BBAA 3MV6A 2BUYA 4M0WA 2BUYB 1HT1E 5C1BA 3PCNM 4EIWA 3I4VA 4AKIA 1KFVA 5KPRA 3A98B 4GH9A 2FFJA 4FWGA 4LRTA 4ZPXA 1XMOM 4I5SA 3PCCM 4L78A 2XSZA 2Y20A 4IBJA 3VDUA 1TH3A 2C99A 3GRUA 3T67M 4NRVA 4LF5M 3GRVA 3HGIA 2FNAA 3LMXA 3HJQA 3DFZA 3SASA 3GRRA 4JI2M 1XC8A 4L8RC 3KP1E 3PCJA 1EE8A 4IBDA 2YQZA 1W5TA 4R7GA 5LMNM 3LQRA 1YKMA 1DO2A 4DV6M 1XNQM 3C58A 3GPUA 2LNHC 3U6CA 1DLTA 1NY5A 4CHTB 3SMSA 2Z3XA 3M6AA 2F5SA 2D7HA 4LRSA 4IJFA 2XZUA 3FTEA 3UGJA 1ORYB 2O5RA 4DV3M 3PCAA 4B7FA 3TH1A 1EOAA 5EXXA 3N9TA 4WHSB 3GLHA 1N75A 3E4RA 3GPPA 3SATA 4FWHA 1R7RA 3ZC7B 1Q39A 2K47A 3L25A 4IIWA 3MI1A 2CFOA 3DA1A 1YKLA 4GMQA 3T38A 2XFTA 3K1JA 4D82A 2DVWB 4DR5M 3PCBM 5ITUA 2BUTA 4B08A 1L1TA 1G41A 3LMMA 4CGYB 1YKOB 4JI1M 1J09A 1QYRA 4S12A 4WHRB 2KRKA 4II7A 4LFAM 1T3TA 3UK6A 4IBEA 2BURB 1IM2A 4LJ8A 1GLNA 7CATA 4B3SM 1EOCA 2BUVA 2OPFA 3GLIA 3U6QA 4JI8M 4OX9M 3PCLM 2VQEM 1XWIA 3GLIB 1N32M 2LWXA 3W0FA 4IBFA 4DR4M 2YR0A 5EP1A 2BJVA 2KEBA 4KO8A 2BNKA 4LF8M 3VKHA 3MFLA 3HKPA 4REZA 3DZDA 3Q8XA 3CF2A 3AKZA 3PCKM 3GP1A 4GHAA 2UXDM 3ZH9B 4KODA 3FTFA 1DGHB 2G5GX 2XSUA 2CHGA 1NJFA 1EOBB 4R3DA 3J2PB 4M9ZA 4PDIA 1UM8A 3LMXM 4MB7A 2CV1A 3GQ3A 4L4UA 4AI6A 1SXJE 2BUWB 3HU2A 2CUZA 2QPAA 4FD2A 3GLGA 2G8LA 3PCJM 2XSZD 4GHLA 2XSRA 4JN6A 3U5ZB 2RKOA 1YKKB 1VDDA 2KA6B 2LH0A 1TMXA 5IWAM 1XXHA 2R4EA 1Z6TA 3J7BA 5EJCA 2DHRA 3HHYA 1DGFA 3VLFB 2BUXB 4LFBM 1KYIA 2DWZB 4IBBA 4DUZM 1J7KA 5ITXA 1FJGM 1NSFA 3U60B 2V1UA 3GRYA 4B3RM 1JQJC 1IY2A 5BPVA 3NBIA 1EO2A 5A2QS 2CV0A 1MX0A 4IBKA 3KDSE 4AG6A 5C18A 4ITQA 1YE9A 2BOYA 4DV2M 4GC9A 3SC3A 4LG2A 3PNYA 3PCIM 1GL6A 2AZQA 1IQPA 4LJAA 3EIEA 3WHLA 5IREB 1N78A 3MK6A 5ITRA 2C5RA 3PCFA 1Z5CA 1YKNA 3KS8A 4OVZA 3L29A 5FSWA 2PCDM 3U6MA 4MH0E 4MGYE 4HL4A 3K92A 5JI3E 4OU7A 1WXQA 1IY1A 1JR3D 3UJNA 4JYAM 2VIIA 1L2CA 4TUWA 4MM3B 2KXEA 2C9OA 3MJ5A 1G3IA 2P5TA 1NHWC 4FCTA 3VDPA 1OFHA 4AZFA 2BUZA 2M60A 3JAMS 4GC5A 3UZUA 3JR5A 1H6UA 4DR1M 2NQ8C 4DV0M 2CHQA 1NVMA 4X66M 5JI2E 2Z7JA 4G4OA 3PCEM 4IBIA 4LGMA 2H1RA 4PT5A 2Y0TA 3M0EA 1XMQM 2BUUA 3MHVC 4IJEA 3AL0C 2UUCM 3HU1A 1TGUA 4X65M 2ZAMA 2UU9M 2XFSA 1G59A 4GIPA 3SAWA 1TH2A 3FUUA 3FYCA 4FVMA 3HHZA 1YKMB 2Z4SA 2BUMA 1K3XA 2E5LM 1R2YA 2R45A 1YUBA 1E32A 2UUAM 2QP9X 4B7HA 3JR4A 4I4LA 1NNJA 1Z5AA 3SFZA 4LZZA 4FWDA 4FCWA 4ILTA 3IG5A 2C96A 2X49A 2BV0A 4JI7M 1I4WA 3D8LA 1EOAB 5DYIA 1GKIA 1YKPA 3VFDA 3PCHA 2I7NA 3NWLA 4JI0M 1IBKM 1HNXM 2HCBA 3GLHB 5ITQA 4QHTA 4LF4M 4AKHA 3T63M 4DR6M 4D80A 1DO0A 5IT9S 1OFIA 1QQWA 2Y21A 1DGGA 4QHSA 2QCUA 3FYDA 3BOSA 1G8PA 3CF0A 4B7GA 1YKLB 4GRIA 4QOSA 1MU5A 4MGZE 3L27A 2ZM6M 2C9CA 1PM5A 3PCMM 1NY6A 1PJJA 3PCGA 2BUTB 4MGHA 3SAUA 1IY0A 3PFIA 4W5WA 3A42A 3SYKA 1GVNA 3GQ5A 1L2DA 3LXVA 2OQ4A 1HT2E 1EOCB 5FTLA 3KFUG 2EO2A 2X8AA 3CF6E 4XBOA 2BUQA 1J5EM 1Q3CA 3MV6M 4WW0A 4DV1M 3LKTA 2W82A 2EA0A 3U6EA 3MV4A 4DR3M 3A46A 3THGA 4XGIA 3PNVA 2XSVA 2L7HA 4PCZA 1S3SA 2XGNA 2ZBKB 3PCNA 4LJ7A 2Y0QA 2UXBM 3I4YA 3RGPA 5ITYA 3KOYE 1DMHA 2YNMD 3TQSA 1HQCA 3AFHA 1HNZM 4BLCA 3RFWA 3HWSA 1IN4A 3FUVA 3U61A 2R46A 3PCCA 3O32A 4WHPA 3U61B 3T67A 3GLGB 2D7EA 5KQ8A 1I94M 1DLQA 2XLJA 3GPXA 5FTKA 4B3TM 3GQ4A 4LF9M 4JI5M 2HKJA 5H37D 1QZMA 3VK8A 1IXZA 3AOEA 1Z5BA 2RGHA 4OW0A 1FNNA 1XXHB 1XHBA 5DNYA 1HNWM 3TL4X 4G4RA 5FTMA 1KSFX 4CISA 1SXJA 1N36M 3PCAM 1DLMA 1SXJB 4X64M 1EO9A 1G4AE 3I51A 1ZAEA 3TWKA 5F3WA 3PCHM 4FW9A 4G4QA 1NNUC 3AJIB 1L2BA 1EO2B 2J7OA 3ZCBB 5EXPA 3QWLA 4I81A 4I8OA 5FTNA 3MI1M 4A3VB 3M7GA 1Q3BA 4Z8XA 4G6ZA 3SBJA 4JV5M 1OJLA 5KQDA 3KW6A 3J80S 3TPZA 1YKNB 2X4AA 3H4MA 2CE7A 3MI5A 2R65A 4OVZB 4ILVA 4WHOA 2R18A 3J7AS 2QBYA 1K82A 1QAOA 2XEPA 3PCBA 2CEAA 4NL4H 1TH4A 4NSOB 4B3MM 2BUVB 3FTDA 2BUZB 4KHPM 3U6SA 5EP4A 1NJGA 4NRWA 4K0KM 5ITTA 2Z4RA 3KSJA 5E6JA 1E9SA 3EIHA 3HHWA 3MFLM 3U6OA 4WURA 3MV4M 3PCDA 4LFCM 2BUUB 4JXJA 4BB9A 3KSXA 4AW4A 2HHHM 1GL7A 3O6JA 4LJ9A 3FUWA 3GPYA 4WHQA 1N77A 5KPZA 4WHQB 3LVWA 2XZFA 1IBMM 4QOZC 2DZNB 4M0DA 1E94E 4NSRA 3PCKA 4DV5M 2BUMB 4G4NA 4PDGA 3B9PA 1IN7A 1R2ZA 3U6PA 3KOZE 1LV7A 4JI3M 2DWLA 1DGBA 2M5ZA 3T15A 2ZAOA 3DOAA 2ERCA 2BV0B 2KZSA 1TDZA 3PVSA 3TWMA 1YKPB 4WHPD 1N34M 4D81A 5KO3A 3L28A 4NOOB 3QAUA 4L16A 2JA2A 4IBGA 4FCVA 4DV7M 1E9RA 3FUXA 5KPTA 1TDHA 1QANA 2KW0A 4DV4M 4AQYM 1IN8A 2RGOA 3HU3A 1L1ZA 2L09A 3J81S 2F4VM 4GITA 1PJIA 1SXJD 3AOEC 3AV0A 1NHGC 3TE6A 4WHSA 3RE8A 2ZANA 1IBLM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHP A;  3T67 A;  2BOY A;  1DLQ A;  3PCF M;  3PCI M;  3HHX A;  2AZQ A;  3PCJ A;  2BUQ B;  3MI5 M;  3PCF A;  3PCI A;  1YKM A;  1YKN A;  2PCD M;  1YKO A;  1DLT A;  4WHR A;  2PCD A;  3PCA M;  1DLM A;  2BUV A;  2BUR A;  2BUZ A;  1EO9 A;  3I51 A;  4WHO D;  3PCA A;  3PCH M;  3TH1 A;  1EOA A;  3PCD M;  3N9T A;  1EO2 B;  3PCE M;  4WHS B;  3O6R A;  2BUU A;  4WHP B;  3MI1 M;  3PCE A;  3MI1 A;  1YKL A;  1YKM B;  1EOB A;  3MI5 A;  1YKN B;  2BUM A;  3PCB M;  2BUT A;  4ILV A;  4WHO A;  1YKO B;  4WHR B;  2BUW A;  3PCB A;  3O5U A;  2BUV B;  2BUR B;  4ILT A;  1EOC A;  2BUZ B;  3HJS A;  1EO9 B;  3PCL M;  2BV0 A;  4WHR F;  1EOA B;  1YKP A;  1YKK A;  3PCH A;  3MFL M;  3PCL A;  3MV4 M;  3PCD A;  2BUU B;  3T63 M;  3MFL A;  3O6J A;  2BUX A;  3HKP A;  4WHQ A;  4WHQ B;  3T63 A;  3PCK M;  1YKL B;  3PCG M;  2XSU A;  1EOB B;  3PCK A;  3PCM M;  3PCC A;  2BUM B;  3LMX M;  3PCG A;  2BUT B;  3LXV M;  4WHO B;  3HJ8 A;  3PCM A;  2BUW B;  1S9A A;  3LXV A;  3PCJ M;  5TD3 A;  1EOC B;  2XSR A;  2BV0 B;  4WHS D;  2BUQ A;  3LKT M;  3MV6 M;  1YKP B;  1YKK B;  4WHP D;  1TMX A;  3LKT A;  3MV6 A;  2BUY A;  3MV4 A;  3HHY A;  2BUY B;  2BUX B;  3PCN M;  3I4V A;  2XSV A;  3PCN A;  3I4Y A;  1DMH A;  3PCC M;  3O32 A;  3T67 M;  1EO2 A;  4WHS A;  3HGI A;  3LMX A;  3HJQ A; 
#chains in the Genus database with same CATH topology
 4PD2 A;  3FE3 A;  2QQ8 A;  3FUT A;  1D0M A;  4R71 A;  2MH8 A;  3BXW A;  3L2A A;  2VQF M;  3PCF M;  1SXJ C;  2QEN A;  3FTC A;  3J27 B;  3HHX A;  3GLI E;  2DWM A;  4NXM M;  4AKG A;  3R9X B;  2Q2E B;  2A5Y B;  2BUQ B;  3MI5 M;  1V33 A;  3PCI A;  1JR3 A;  1VQ1 A;  1NV9 A;  3LVV A;  3U6D A;  4RF1 A;  2F5N A;  2ZTC A;  2J7N A;  4YHH M;  3FD9 A;  2MGW A;  2BWE A;  2DWN A;  1D2N A;  2KNZ A;  2YFQ A;  1OIP A;  1UFZ A;  1Z59 A;  3AOG A;  1V34 A;  3GO8 A;  1YKO A;  4MGK E;  4WHR A;  2F5P A;  5DYG A;  3W0L B;  2PCD A;  3K9O A;  2BUR A;  4IBC A;  2XSU A;  1WGN A;  2QZ4 A;  5FLX S;  4LF7 M;  4LZJ A;  4WHO D;  1L8Q A;  4DR7 M;  3BBZ A;  3C9P A;  3VK7 A;  3PCD M;  1VG5 A;  5EXT A;  2FOI C;  5IZ7 D;  3ILK A;  3RGS A;  4GKK M;  2L4E A;  1QAM A;  2V1C A;  1X37 A;  3KXE C;  4KLN A;  3O6R A;  2I7P A;  2F5O A;  4WHP B;  2L7I A;  4F1I A;  2V6Z M;  3KVW A;  3WHK A;  3PCE A;  2O01 F;  3KOX E;  4NXN M;  3H4J A;  3C3E A;  3K8Z A;  2J5Y A;  4JI4 M;  2WSF F;  3GLF A;  3SHG B;  1AIP C;  1DGH A;  4QNM A;  2MR9 A;  4LF6 M;  1EOB A;  3GLF B;  3U6L A;  2BJW A;  2VF7 A;  2LXE A;  4M9S A;  4HLQ A;  2DAM A;  2D7G A;  5EQT A;  3PXG A;  3OTO M;  1N33 M;  3PCL A;  3E9S A;  2EUC A;  5EP2 A;  1W5S A;  5GKN A;  4M9X A;  2XF3 A;  2BUW A;  4RNA A;  4DUY M;  2R62 A;  2UXC M;  1R6B X;  3O5U A;  2UUB M;  3A45 A;  5EXS A;  2JZ0 A;  5ITX E;  3IG8 A;  4LJ5 A;  2L4F A;  3HJS A;  1EO9 B;  3KOW E;  4WHR F;  3U5Z A;  3R8F A;  1HR0 M;  2KRU A;  1XNR M;  2L2D A;  3D8B A;  4L15 A;  3SAR A;  3T1H M;  3W67 A;  1YKK A;  1HQY E;  2AHM A;  4G3O A;  3VKG A;  2XH9 A;  1IXS B;  5EP3 A;  2JNH A;  1IN6 A;  4LJ6 A;  4DBG B;  8CAT A;  4YY3 M;  4JI6 M;  4WP2 A;  4GKJ M;  4LJ4 A;  2BUX A;  3V76 A;  3CTW B;  2DAG A;  1OIZ A;  2KZU A;  3LQQ A;  4P16 A;  2HL7 A;  4LY6 A;  2R4J A;  3L26 A;  2F5Q A;  3T63 A;  1ZQ9 A;  3C3D A;  4QNR A;  2GNO A;  3TWL A;  2DZO B;  2CHV A;  4MGI E;  3SAV A;  3PCG M;  3U60 A;  2L6O A;  1IN5 A;  1QVR A;  4X62 M;  2KNV A;  4LGY A;  1GO5 A;  5E26 A;  5LMU M;  3LXV M;  4WHO B;  2DXI A;  3HJ8 A;  2LHC A;  2QBY B;  3PCM A;  1TR8 A;  1S9A A;  4AG5 A;  4DR2 M;  5TD3 A;  1YSY A;  1C1K A;  1VEG A;  1QAQ A;  3SYL A;  4WHS D;  3KS4 A;  5FTJ A;  3LKT M;  4LCB A;  2FE8 A;  1OAO C;  2C98 A;  3B7N A;  1ZMU A;  3SMP A;  3UMM A;  3CGW A;  4Z6Y A;  4RF0 A;  3T1Y M;  2CV2 A;  3KP0 E;  3K2L A;  3SHF A;  1IXR C;  1NO1 A;  5BR8 M;  2B3T A;  3FKE A;  4BBA A;  3MV6 A;  2BUY A;  4M0W A;  2BUY B;  1HT1 E;  5C1B A;  3PCN M;  4EIW A;  3I4V A;  4AKI A;  1WIV A;  1KFV A;  1EIJ A;  5KPR A;  3A98 B;  2LHG A;  4GH9 A;  2FFJ A;  4FWG A;  4LRT A;  4ZPX A;  1QUS A;  1XMO M;  4I5S A;  3PCC M;  4L78 A;  2XSZ A;  2Y20 A;  4IBJ A;  3VDU A;  1TH3 A;  2C99 A;  3GRU A;  3T67 M;  4NRV A;  4LF5 M;  3GRV A;  3HGI A;  2FNA A;  3LMX A;  2CWB A;  3HJQ A;  3DFZ A;  3F92 A;  3SAS A;  4Q7J A;  3GRR A;  4JI2 M;  1XC8 A;  4L8R C;  3KP1 E;  3PCJ A;  2LVO C;  1PJT A;  1EE8 A;  2MRO B;  4IBD A;  2YQZ A;  1W5T A;  3GLH E;  4R7G A;  3LQR A;  5LMN M;  1DO2 A;  1YKM A;  4DV6 M;  1XNQ M;  3C58 A;  3GPU A;  2LNH C;  3B74 A;  3U6C A;  1DLT A;  1NY5 A;  3B7Q A;  4CHT B;  2APL A;  3SMS A;  2Z3X A;  3M6A A;  2F5S A;  1GJS A;  2QHO B;  2D7H A;  2VDB B;  4IJF A;  4LRS A;  2XZU A;  2JXN A;  3FTE A;  3UGJ A;  1ORY B;  2O5R A;  4DV3 M;  3PCA A;  4B7F A;  3TH1 A;  1EOA A;  5EXX A;  4RKU F;  3N9T A;  1MJG M;  2KDL A;  4WHS B;  2K0B X;  3GLH A;  1N75 A;  3E4R A;  3GPP A;  3SAT A;  4FWH A;  1R7R A;  3ZC7 B;  2OO9 A;  1Q39 A;  2K47 A;  3L25 A;  1F4I A;  4IIW A;  1QDT A;  3MI1 A;  3QYB A;  2CFO A;  2O25 A;  3DA1 A;  1YKL A;  4P17 A;  4GMQ A;  3T38 A;  2XFT A;  3K1J A;  4D82 A;  2DVW B;  4DR5 M;  3PCB M;  1VDL A;  5ITU A;  1WGL A;  2BUT A;  1TTE A;  4B08 A;  1L1T A;  1G41 A;  1QDR A;  1R5L A;  2Z8Y M;  3LMM A;  4CGY B;  1J09 A;  1QYR A;  4S12 A;  4JI1 M;  1YKO B;  4WHR B;  2KRK A;  4II7 A;  4LFA M;  1T3T A;  3UK6 A;  4IBE A;  1XB2 B;  2BUR B;  1IM2 A;  4LJ8 A;  1G71 A;  1GLN A;  7CAT A;  4B3S M;  1EOC A;  2BUV A;  1V92 A;  2OPF A;  3GLI A;  3U6Q A;  4JI8 M;  4OX9 M;  3PCL M;  2VQE M;  1XWI A;  3GLI B;  1D0L A;  2LWX A;  3W0F A;  1N32 M;  4NC6 A;  1AUA A;  4IBF A;  3GLG E;  4DR4 M;  2YR0 A;  1A5T A;  5EP1 A;  2BJV A;  2KEB A;  4KO8 A;  1T6O A;  2BNK A;  2JY6 B;  4LF8 M;  3HKP A;  3VKH A;  3MFL A;  4REZ A;  3DZD A;  3Q8X A;  3CF2 A;  3AKZ A;  3PCK M;  3GP1 A;  4GHA A;  2UXD M;  3ZH9 B;  4KOD A;  3FTF A;  1DGH B;  1XXH E;  2G5G X;  2R0I A;  2CHG A;  1NJF A;  2DZL A;  1IFY A;  1EOB B;  4R3D A;  2DAI A;  3J2P B;  4M9Z A;  4PDI A;  1UM8 A;  3ZQJ A;  3LMX M;  4MB7 A;  2CV1 A;  2JY5 A;  3GQ3 A;  4L4U A;  4AI6 A;  1SXJ E;  2BUW B;  3HU2 A;  2CUZ A;  2QPA A;  4FD2 A;  3GLG A;  2G8L A;  3PCJ M;  2XSZ D;  1D0K A;  4GHL A;  1SG9 A;  2XSR A;  1LTM A;  1ZMW A;  4JN6 A;  2RKO A;  3U5Z B;  3W68 A;  1YKK B;  1VDD A;  2KA6 B;  2LH0 A;  1TMX A;  5IWA M;  1XXH A;  2R4E A;  1Z6T A;  3J7B A;  5EJC A;  1R4G A;  2DHR A;  5DFL A;  3HHY A;  1DGF A;  3VLF B;  2BUX B;  3FRI A;  4LFB M;  1KYI A;  1RU3 A;  2DWZ B;  4IBB A;  2EKF A;  2OOA A;  4DUZ M;  1J7K A;  5ITX A;  1FJG M;  1NSF A;  3U60 B;  3HX3 A;  2V1U A;  3GRY A;  1WJ7 A;  3FRH A;  1JQJ C;  1IY2 A;  5BPV A;  4B3R M;  2KNA A;  3NBI A;  1EO2 A;  5A2Q S;  2CV0 A;  1MX0 A;  2JP7 A;  4IBK A;  3KDS E;  4AG6 A;  5C18 A;  4ITQ A;  1YE9 A;  2BOY A;  4DV2 M;  2DEN A;  2JZ1 A;  4GC9 A;  3SC3 A;  4LG2 A;  3PNY A;  3PCI M;  1GL6 A;  3NBX X;  2AZQ A;  1IQP A;  4LJA A;  3EIE A;  3WHL A;  5IRE B;  1N78 A;  1OTR A;  3MK6 A;  1TF0 B;  5ITR A;  2C5R A;  3PCF A;  1VEK A;  1Z5C A;  2H5X A;  4UN2 B;  1YKN A;  3I04 M;  3KS8 A;  4GEW A;  3L29 A;  4OVZ A;  5FSW A;  3U6M A;  2PCD M;  4MH0 E;  4MGY E;  4HL4 A;  3K92 A;  5JI3 E;  4OU7 A;  1WXQ A;  1IY1 A;  1JR3 D;  2GQF A;  1EFU B;  1OKS A;  2DNA A;  2VII A;  4L6V 6;  3UJN A;  1L2C A;  4JYA M;  2JWS A;  4TUW A;  2BWB A;  2KXE A;  2C9O A;  3MJ5 A;  1G3I A;  2P5T A;  1NHW C;  4FCT A;  4MM3 B;  1OFH A;  3VDP A;  4AZF A;  2BUZ A;  2M60 A;  3JAM S;  4GC5 A;  3UZU A;  3JR5 A;  1H6U A;  4DR1 M;  2NQ8 C;  4DV0 M;  4CIZ A;  2MJ5 B;  2CHQ A;  1NVM A;  4X66 M;  5JI2 E;  2Z7J A;  4G4O A;  4KT0 F;  4IBI A;  4LGM A;  2HWJ A;  3PCE M;  2H1R A;  4PT5 A;  2Y0T A;  3M0E A;  1XMQ M;  1HJP A;  3MHV C;  4IJE A;  2BUU A;  3AL0 C;  2UUC M;  3HU1 A;  2LVN C;  1TGU A;  2RRU A;  1NV8 A;  4X65 M;  2ZAM A;  2UU9 M;  2XFS A;  1OQY A;  1G59 A;  4GIP A;  3SAW A;  1TH2 A;  3FUU A;  3FYC A;  4FVM A;  3HHZ A;  1YKM B;  2Z4S A;  2BUM A;  1K3X A;  2LTU A;  2E5L M;  1OAI A;  1R2Y A;  2R45 A;  1YUB A;  3HZJ A;  1E32 A;  2UUA M;  2DAE A;  2QP9 X;  4B7H A;  4CJ6 A;  4I4L A;  3JR4 A;  1NNJ A;  1Z5A A;  3SFZ A;  4LZZ A;  4FWD A;  4FCW A;  4ILT A;  3IG5 A;  2C96 A;  2X49 A;  2BV0 A;  4JI7 M;  3E21 A;  1ZV1 A;  1I4W A;  3D8L A;  3IHP A;  5DYI A;  1GKI A;  1EOA B;  2WZJ A;  3VFD A;  1YKP A;  2I7N A;  3NWL A;  4JI0 M;  3PCH A;  1IBK M;  1HNX M;  2HCB A;  1P3Q Q;  3GLH B;  4QHT A;  5ITQ A;  4LF4 M;  2QSF X;  4AKH A;  3T63 M;  4DR6 M;  2DKL A;  4D80 A;  1DO0 A;  5IT9 S;  1OFI A;  1QQW A;  2Y21 A;  1DGG A;  1T43 A;  4QHS A;  2QCU A;  3FYD A;  3BOS A;  1G8P A;  3CF0 A;  4B7G A;  1YKL B;  4GRI A;  4QOS A;  1MU5 A;  4MGZ E;  3L27 A;  2ZM6 M;  2C9C A;  1PM5 A;  3PCM M;  1NY6 A;  2G3Q A;  1PJJ A;  3PCG A;  2BUT B;  4MGH A;  3SAU A;  1IY0 A;  3PFI A;  4W5W A;  3A42 A;  2LVA A;  3SYK A;  1GVN A;  4XK8 F;  3GQ5 A;  1L2D A;  3B89 A;  3LXV A;  1QUT A;  2OQ4 A;  1HT2 E;  2WSE F;  1EOC B;  5FTL A;  3KFU G;  2EO2 A;  2X8A A;  3CF6 E;  4XBO A;  2BUQ A;  1J5E M;  2EJS A;  1Q3C A;  3MV6 M;  2JY7 A;  1BVS A;  4WW0 A;  1Q02 A;  2FS1 A;  3QYE A;  4DV1 M;  3LKT A;  3E46 A;  2W82 A;  2EA0 A;  4F2L A;  3U6E A;  3MV4 A;  1PRB A;  4DR3 M;  3A46 A;  3THG A;  1K3W A;  2QNJ A;  4XGI A;  3MMP A;  3PNV A;  1C7Y A;  5L8R F;  2L7H A;  2XSV A;  4PCZ A;  1S3S A;  2XGN A;  2ZBK B;  3GLF E;  4LJ7 A;  2Y0Q A;  2UXB M;  3PCN A;  3I4Y A;  3RGP A;  1Y8G A;  2K6B A;  5ITY A;  3KOY E;  2KHH A;  1DMH A;  2YNM D;  3TQS A;  4Y28 F;  1HQC A;  3AFH A;  1HNZ M;  4BLC A;  3RFW A;  3HWS A;  1IN4 A;  3FUV A;  3U61 A;  2R46 A;  1GAB A;  3O32 A;  2FH0 A;  3PCC A;  4WHP A;  3U61 B;  3T67 A;  3GLG B;  2D7E A;  5KQ8 A;  1I94 M;  1DLQ A;  1MN3 A;  2XLJ A;  3GPX A;  5FTK A;  4B3T M;  3GQ4 A;  4LF9 M;  4JI5 M;  2HKJ A;  5H37 D;  1QZM A;  3VK8 A;  1IXZ A;  2DHY A;  1PGY A;  3AOE A;  1Z5B A;  2WSC F;  4ANR A;  2RGH A;  4OW0 A;  1YLA A;  2K9D A;  1FNN A;  1XXH B;  1XHB A;  5DNY A;  1HNW M;  3TL4 X;  4G4R A;  5FTM A;  1KSF X;  4CIS A;  1SXJ A;  2JUJ A;  1N36 M;  3PCA M;  2OOB A;  1DLM A;  1SXJ B;  4X64 M;  1WHC A;  1DV0 A;  1QZE A;  2CRU A;  1EO9 A;  1G4A E;  3I51 A;  1ZAE A;  3TWK A;  5F3W A;  3PCH M;  1PJS A;  4FW9 A;  4G4Q A;  1NNU C;  3AJI B;  1L2B A;  3B7Z A;  1EO2 B;  2J7O A;  1IXS A;  1JB0 F;  3ZCB B;  5EXP A;  3QWL A;  4I81 A;  4I8O A;  5FTN A;  3MI1 M;  1CUK A;  2DAK A;  3M7G A;  3T6P A;  4A3V B;  1Q3B A;  2CP8 A;  4Z8X A;  4G6Z A;  3SBJ A;  3I01 M;  4JV5 M;  1OJL A;  5KQD A;  3KW6 A;  2HAK A;  3J80 S;  3TPZ A;  2X4A A;  3H4M A;  2CE7 A;  1YKN B;  3MI5 A;  2R65 A;  4OVZ B;  4ILV A;  4WHO A;  2LVQ D;  2R18 A;  2R6F A;  3IEC A;  3J7A S;  2QBY A;  1K82 A;  1QAO A;  2XEP A;  3PCB A;  2CEA A;  4NL4 H;  1TH4 A;  4NSO B;  4B3M M;  2BUV B;  3FTD A;  2BUZ B;  2R44 A;  4KHP M;  3LCU A;  3U6S A;  5EP4 A;  1NJG A;  4NRW A;  4K0K M;  5ITT A;  2Z4R A;  3KSJ A;  2JY8 A;  1E9S A;  3EIH A;  3HHW A;  5E6J A;  3U6O A;  4WUR A;  3MFL M;  2N35 A;  4LFC M;  3MV4 M;  3PCD A;  2BUU B;  4JXJ A;  4BB9 A;  3KSX A;  4AW4 A;  2HHH M;  1GL7 A;  2ZTD A;  3O6J A;  2LVP C;  3FUW A;  4LJ9 A;  3GPY A;  4WHQ A;  1N77 A;  5KPZ A;  4WHQ B;  3LVW A;  2XZF A;  1IBM M;  2LBC A;  1VEJ A;  3LCV B;  4QOZ C;  2DZN B;  4M0D A;  1E94 E;  4NSR A;  3PCK A;  1ZMV A;  4DV5 M;  2BUM B;  4G4N A;  4PDG A;  3B9P A;  1IN7 A;  1R2Z A;  3K9P A;  3U6P A;  3KOZ E;  2VF8 A;  1LV7 A;  4JI3 M;  2DWL A;  1DGB A;  2M5Z A;  3T15 A;  2ZAO A;  3DOA A;  2ERC A;  2BV0 B;  2KZS A;  1TDZ A;  3PVS A;  3TWM A;  3LW5 F;  3Q8G A;  1YKP B;  4WHP D;  1WR1 B;  1N34 M;  1PJQ A;  4D81 A;  5KO3 A;  3L28 A;  4NOO B;  3QAU A;  4L16 A;  2JA2 A;  4IBG A;  4FCV A;  4DV7 M;  3HY5 A;  1E9R A;  3FUX A;  1JR3 E;  4HEO A;  5KPT A;  1TDH A;  1QAN A;  2KW0 A;  2DI0 A;  4DV4 M;  4AQY M;  1IN8 A;  2RGO A;  3HU3 A;  1L1Z A;  2L09 A;  2EKK A;  3J81 S;  2F4V M;  4GIT A;  1PJI A;  1SXJ D;  3AOE C;  3AV0 A;  1NHG C;  3TE6 A;  4WHS A;  3RE8 A;  1GJT A;  2ZAN A;  1IBL M; 
#chains in the Genus database with same CATH homology
 4PD2 A;  3FUT A;  2VQF M;  3L2A A;  3PCF M;  1SXJ C;  2QEN A;  3FTC A;  3J27 B;  3HHX A;  2DWM A;  4AKG A;  4NXM M;  3R9X B;  2Q2E B;  2A5Y B;  2BUQ B;  3MI5 M;  3PCI A;  1JR3 A;  3LVV A;  3U6D A;  4RF1 A;  2F5N A;  2J7N A;  4YHH M;  3FD9 A;  2DWN A;  1D2N A;  2YFQ A;  3AOG A;  1Z59 A;  1YKO A;  3GO8 A;  4MGK E;  4WHR A;  2F5P A;  5DYG A;  3W0L B;  2PCD A;  2BUR A;  4IBC A;  2QZ4 A;  5FLX S;  4LF7 M;  4LZJ A;  4WHO D;  1L8Q A;  4DR7 M;  3VK7 A;  3PCD M;  5EXT A;  2FOI C;  5IZ7 D;  3ILK A;  3RGS A;  4GKK M;  3O6R A;  1QAM A;  2V1C A;  1X37 A;  3KXE C;  4KLN A;  2I7P A;  2F5O A;  4WHP B;  2L7I A;  3PCE A;  2V6Z M;  3KVW A;  3WHK A;  3KOX E;  4NXN M;  3K8Z A;  4JI4 M;  3GLF A;  3SHG B;  1DGH A;  4QNM A;  4LF6 M;  1EOB A;  3GLF B;  3U6L A;  2BJW A;  1N33 M;  2LXE A;  4M9S A;  4HLQ A;  5EQT A;  2D7G A;  3PXG A;  3OTO M;  3VKG A;  3PCL A;  3E9S A;  2EUC A;  5EP2 A;  1W5S A;  5GKN A;  4M9X A;  2XF3 A;  2BUW A;  4RNA A;  4DUY M;  2R62 A;  2UXC M;  1R6B X;  3O5U A;  2UUB M;  3A45 A;  5EXS A;  5ITX E;  3IG8 A;  4LJ5 A;  3HJS A;  1EO9 B;  3KOW E;  4WHR F;  3U5Z A;  3R8F A;  1HR0 M;  2KRU A;  1XNR M;  3D8B A;  4L15 A;  3SAR A;  3T1H M;  1YKK A;  1HQY E;  2AHM A;  2XH9 A;  1IXS B;  5EP3 A;  4LJ6 A;  1IN6 A;  4YY3 M;  4JI6 M;  8CAT A;  4GKJ M;  4LJ4 A;  2BUX A;  3CTW B;  2KZU A;  3LQQ A;  4P16 A;  2HL7 A;  4LY6 A;  2R4J A;  3L26 A;  2F5Q A;  3T63 A;  1ZQ9 A;  4QNR A;  3TWL A;  2DZO B;  2CHV A;  4MGI E;  3SAV A;  3PCG M;  3U60 A;  2L6O A;  1IN5 A;  1QVR A;  4X62 M;  4LGY A;  5E26 A;  5LMU M;  3LXV M;  4WHO B;  2DXI A;  3HJ8 A;  2QBY B;  3PCM A;  1S9A A;  4AG5 A;  4DR2 M;  5TD3 A;  1YSY A;  1C1K A;  1QAQ A;  3SYL A;  4WHS D;  3KS4 A;  5FTJ A;  3LKT M;  4LCB A;  2FE8 A;  3SMP A;  2C98 A;  3UMM A;  3T1Y M;  1K3W A;  2CV2 A;  4Z6Y A;  4RF0 A;  3KP0 E;  3K2L A;  3SHF A;  1IXR C;  5BR8 M;  3FKE A;  4BBA A;  3MV6 A;  2BUY A;  4M0W A;  2BUY B;  1HT1 E;  5C1B A;  3PCN M;  4EIW A;  3I4V A;  4AKI A;  1KFV A;  5KPR A;  3A98 B;  4GH9 A;  2FFJ A;  4FWG A;  4LRT A;  4ZPX A;  1XMO M;  4I5S A;  3PCC M;  4L78 A;  2XSZ A;  2Y20 A;  4IBJ A;  3VDU A;  1TH3 A;  2C99 A;  3GRU A;  3T67 M;  4NRV A;  4LF5 M;  3GRV A;  3HGI A;  2FNA A;  3LMX A;  3HJQ A;  3DFZ A;  3SAS A;  3GRR A;  4JI2 M;  1XC8 A;  4L8R C;  3KP1 E;  3PCJ A;  1EE8 A;  4IBD A;  2YQZ A;  1W5T A;  4R7G A;  5LMN M;  3LQR A;  1YKM A;  1DO2 A;  4DV6 M;  1XNQ M;  3C58 A;  3GPU A;  2LNH C;  3U6C A;  1DLT A;  1NY5 A;  4CHT B;  3SMS A;  2Z3X A;  3M6A A;  2F5S A;  2D7H A;  4LRS A;  4IJF A;  2XZU A;  3FTE A;  3UGJ A;  1ORY B;  2O5R A;  4DV3 M;  3PCA A;  4B7F A;  3TH1 A;  1EOA A;  5EXX A;  3N9T A;  4WHS B;  3GLH A;  1N75 A;  3E4R A;  3GPP A;  3SAT A;  4FWH A;  1R7R A;  3ZC7 B;  1Q39 A;  2K47 A;  3L25 A;  4IIW A;  3MI1 A;  2CFO A;  3DA1 A;  1YKL A;  4GMQ A;  3T38 A;  2XFT A;  3K1J A;  4D82 A;  2DVW B;  4DR5 M;  3PCB M;  5ITU A;  2BUT A;  4B08 A;  1L1T A;  1G41 A;  3LMM A;  4CGY B;  1YKO B;  4JI1 M;  1J09 A;  1QYR A;  4S12 A;  4WHR B;  2KRK A;  4II7 A;  4LFA M;  1T3T A;  3UK6 A;  4IBE A;  2BUR B;  1IM2 A;  4LJ8 A;  1GLN A;  7CAT A;  4B3S M;  1EOC A;  2BUV A;  2OPF A;  3GLI A;  3U6Q A;  4JI8 M;  4OX9 M;  3PCL M;  2VQE M;  1XWI A;  3GLI B;  1N32 M;  2LWX A;  3W0F A;  4IBF A;  4DR4 M;  2YR0 A;  5EP1 A;  2BJV A;  2KEB A;  4KO8 A;  2BNK A;  4LF8 M;  3VKH A;  3MFL A;  3HKP A;  4REZ A;  3DZD A;  3Q8X A;  3CF2 A;  3AKZ A;  3PCK M;  3GP1 A;  4GHA A;  2UXD M;  3ZH9 B;  4KOD A;  3FTF A;  1DGH B;  2G5G X;  2XSU A;  2CHG A;  1NJF A;  1EOB B;  4R3D A;  3J2P B;  4M9Z A;  4PDI A;  1UM8 A;  3LMX M;  4MB7 A;  2CV1 A;  3GQ3 A;  4L4U A;  4AI6 A;  1SXJ E;  2BUW B;  3HU2 A;  2CUZ A;  2QPA A;  4FD2 A;  3GLG A;  2G8L A;  3PCJ M;  2XSZ D;  4GHL A;  2XSR A;  4JN6 A;  3U5Z B;  2RKO A;  1YKK B;  1VDD A;  2KA6 B;  2LH0 A;  1TMX A;  5IWA M;  1XXH A;  2R4E A;  1Z6T A;  3J7B A;  5EJC A;  2DHR A;  3HHY A;  1DGF A;  3VLF B;  2BUX B;  4LFB M;  1KYI A;  2DWZ B;  4IBB A;  4DUZ M;  1J7K A;  5ITX A;  1FJG M;  1NSF A;  3U60 B;  2V1U A;  3GRY A;  4B3R M;  1JQJ C;  1IY2 A;  5BPV A;  3NBI A;  1EO2 A;  5A2Q S;  2CV0 A;  1MX0 A;  4IBK A;  3KDS E;  4AG6 A;  5C18 A;  4ITQ A;  1YE9 A;  2BOY A;  4DV2 M;  4GC9 A;  3SC3 A;  4LG2 A;  3PNY A;  3PCI M;  1GL6 A;  2AZQ A;  1IQP A;  4LJA A;  3EIE A;  3WHL A;  5IRE B;  1N78 A;  3MK6 A;  5ITR A;  2C5R A;  3PCF A;  1Z5C A;  1YKN A;  3KS8 A;  4OVZ A;  3L29 A;  5FSW A;  2PCD M;  3U6M A;  4MH0 E;  4MGY E;  4HL4 A;  3K92 A;  5JI3 E;  4OU7 A;  1WXQ A;  1IY1 A;  1JR3 D;  3UJN A;  4JYA M;  2VII A;  1L2C A;  4TUW A;  4MM3 B;  2KXE A;  2C9O A;  3MJ5 A;  1G3I A;  2P5T A;  1NHW C;  4FCT A;  3VDP A;  1OFH A;  4AZF A;  2BUZ A;  2M60 A;  3JAM S;  4GC5 A;  3UZU A;  3JR5 A;  1H6U A;  4DR1 M;  2NQ8 C;  4DV0 M;  2CHQ A;  1NVM A;  4X66 M;  5JI2 E;  2Z7J A;  4G4O A;  3PCE M;  4IBI A;  4LGM A;  2H1R A;  4PT5 A;  2Y0T A;  3M0E A;  1XMQ M;  2BUU A;  3MHV C;  4IJE A;  3AL0 C;  2UUC M;  3HU1 A;  1TGU A;  4X65 M;  2ZAM A;  2UU9 M;  2XFS A;  1G59 A;  4GIP A;  3SAW A;  1TH2 A;  3FUU A;  3FYC A;  4FVM A;  3HHZ A;  1YKM B;  2Z4S A;  2BUM A;  1K3X A;  2E5L M;  1R2Y A;  2R45 A;  1YUB A;  1E32 A;  2UUA M;  2QP9 X;  4B7H A;  3JR4 A;  4I4L A;  1NNJ A;  1Z5A A;  3SFZ A;  4LZZ A;  4FWD A;  4FCW A;  4ILT A;  3IG5 A;  2C96 A;  2X49 A;  2BV0 A;  4JI7 M;  1I4W A;  3D8L A;  1EOA B;  5DYI A;  1GKI A;  1YKP A;  3VFD A;  3PCH A;  2I7N A;  3NWL A;  4JI0 M;  1IBK M;  1HNX M;  2HCB A;  3GLH B;  5ITQ A;  4QHT A;  4LF4 M;  4AKH A;  3T63 M;  4DR6 M;  4D80 A;  1DO0 A;  5IT9 S;  1OFI A;  1QQW A;  2Y21 A;  1DGG A;  4QHS A;  2QCU A;  3FYD A;  3BOS A;  1G8P A;  3CF0 A;  4B7G A;  1YKL B;  4GRI A;  4QOS A;  1MU5 A;  4MGZ E;  3L27 A;  2ZM6 M;  2C9C A;  1PM5 A;  3PCM M;  1NY6 A;  1PJJ A;  3PCG A;  2BUT B;  4MGH A;  3SAU A;  1IY0 A;  3PFI A;  4W5W A;  3A42 A;  3SYK A;  1GVN A;  3GQ5 A;  1L2D A;  3LXV A;  2OQ4 A;  1HT2 E;  1EOC B;  5FTL A;  3KFU G;  2EO2 A;  2X8A A;  3CF6 E;  4XBO A;  2BUQ A;  1J5E M;  1Q3C A;  3MV6 M;  4WW0 A;  4DV1 M;  3LKT A;  2W82 A;  2EA0 A;  3U6E A;  3MV4 A;  4DR3 M;  3A46 A;  3THG A;  4XGI A;  3PNV A;  2XSV A;  2L7H A;  4PCZ A;  1S3S A;  2XGN A;  2ZBK B;  3PCN A;  4LJ7 A;  2Y0Q A;  2UXB M;  3I4Y A;  3RGP A;  5ITY A;  3KOY E;  1DMH A;  2YNM D;  3TQS A;  1HQC A;  3AFH A;  1HNZ M;  4BLC A;  3RFW A;  3HWS A;  1IN4 A;  3FUV A;  3U61 A;  2R46 A;  3PCC A;  3O32 A;  4WHP A;  3U61 B;  3T67 A;  3GLG B;  2D7E A;  5KQ8 A;  1I94 M;  1DLQ A;  2XLJ A;  3GPX A;  5FTK A;  4B3T M;  3GQ4 A;  4LF9 M;  4JI5 M;  2HKJ A;  5H37 D;  1QZM A;  3VK8 A;  1IXZ A;  3AOE A;  1Z5B A;  2RGH A;  4OW0 A;  1FNN A;  1XXH B;  1XHB A;  5DNY A;  1HNW M;  3TL4 X;  4G4R A;  5FTM A;  1KSF X;  4CIS A;  1SXJ A;  1N36 M;  3PCA M;  1DLM A;  1SXJ B;  4X64 M;  1EO9 A;  1G4A E;  3I51 A;  1ZAE A;  3TWK A;  5F3W A;  3PCH M;  4FW9 A;  4G4Q A;  1NNU C;  3AJI B;  1L2B A;  1EO2 B;  2J7O A;  3ZCB B;  5EXP A;  3QWL A;  4I81 A;  4I8O A;  5FTN A;  3MI1 M;  4A3V B;  3M7G A;  1Q3B A;  4Z8X A;  4G6Z A;  3SBJ A;  4JV5 M;  1OJL A;  5KQD A;  3KW6 A;  3J80 S;  3TPZ A;  1YKN B;  2X4A A;  3H4M A;  2CE7 A;  3MI5 A;  2R65 A;  4OVZ B;  4ILV A;  4WHO A;  2R18 A;  3J7A S;  2QBY A;  1K82 A;  1QAO A;  2XEP A;  3PCB A;  2CEA A;  4NL4 H;  1TH4 A;  4NSO B;  4B3M M;  2BUV B;  3FTD A;  2BUZ B;  4KHP M;  3U6S A;  5EP4 A;  1NJG A;  4NRW A;  4K0K M;  5ITT A;  2Z4R A;  3KSJ A;  5E6J A;  1E9S A;  3EIH A;  3HHW A;  3MFL M;  3U6O A;  4WUR A;  3MV4 M;  3PCD A;  4LFC M;  2BUU B;  4JXJ A;  4BB9 A;  3KSX A;  4AW4 A;  2HHH M;  1GL7 A;  3O6J A;  4LJ9 A;  3FUW A;  3GPY A;  4WHQ A;  1N77 A;  5KPZ A;  4WHQ B;  3LVW A;  2XZF A;  1IBM M;  4QOZ C;  2DZN B;  4M0D A;  1E94 E;  4NSR A;  3PCK A;  4DV5 M;  2BUM B;  4G4N A;  4PDG A;  3B9P A;  1IN7 A;  1R2Z A;  3U6P A;  3KOZ E;  1LV7 A;  4JI3 M;  2DWL A;  1DGB A;  2M5Z A;  3T15 A;  2ZAO A;  3DOA A;  2ERC A;  2BV0 B;  2KZS A;  1TDZ A;  3PVS A;  3TWM A;  1YKP B;  4WHP D;  1N34 M;  4D81 A;  5KO3 A;  3L28 A;  4NOO B;  3QAU A;  4L16 A;  2JA2 A;  4IBG A;  4FCV A;  4DV7 M;  1E9R A;  3FUX A;  5KPT A;  1TDH A;  1QAN A;  2KW0 A;  4DV4 M;  4AQY M;  1IN8 A;  2RGO A;  3HU3 A;  1L1Z A;  2L09 A;  3J81 S;  2F4V M;  4GIT A;  1PJI A;  1SXJ D;  3AOE C;  3AV0 A;  1NHG C;  3TE6 A;  4WHS A;  3RE8 A;  2ZAN A;  1IBL M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...