3HHXA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhxA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhxA02
3PCIM 3LMXM 3LXVA 4WHQA 3MI5A 2BUTA 2BUZB 3PCHA 3T63A 1YKPA 4WHPB 3HKPA 2BUVB 1YKKB 3PCMM 3PCBA 2BUUA 3PCKA 2BV0B 4WHSB 4WHRF 2BOYA 1YKOB 3PCEA 2BUMB 3PCNM 3LKTA 3I4VA 1YKNA 4WHOA 3LKTM 2AZQA 2BUYB 3MI1A 1YKLA 3HJQA 3N9TA 2XSUA 4ILVA 1EO9B 1EOBA 1EOAA 2BURA 3LXVM 3MI5M 3HHXA 3PCHM 3T63M 2XSVA 2BUWB 3PCBM 3PCKM 3HGIA 1EO2B 2PCDA 3PCGA 3HHYA 3T67A 2BUXB 2BUZA 3PCLA 3PCEM 4WHRB 4WHPA 1DLTA 3TH1A 2BUVA 1YKKA 2BV0A 3MI1M 3HJSA 4WHSA 3MFLA 4WHOD 3MV6A 2XSRA 4WHOB 3PCCA 1EOCB 3MV6M 2BUMA 2BUQB 3PCFA 1DMHA 3MV4A 3PCAA 1YKMB 3O6RA 2BUYA 5TD3A 3PCDA 3I51A 4WHQB 3PCJA 2BUTB 1EO9A 1YKPB 2BUUB 2PCDM 3PCIA 3PCGM 3T67M 3PCLM 2BUWA 1YKNB 4WHPD 4ILTA 3PCMA 1EO2A 1TMXA 3MFLM 3O5UA 1YKOA 3PCCM 2BUXA 1S9AA 1YKLB 4WHSD 1DLQA 4WHRA 3PCFM 3O6JA 1DLMA 3MV4M 3PCAM 3PCNA 3HJ8A 3PCDM 1EOBB 1EOAB 2BURB 3I4YA 1EOCA 3PCJM 2BUQA 3O32A 1YKMA 3LMXA
chains in the Genus database with same CATH superfamily
5KPRA 3GO8A 5LMNM 2KRKA 1H6UA 1DGHA 5FTLA 4LF6M 4GRIA 3R9XB 3E4RA 7CATA 3LXVA 1OAIA 4L16A 2WSEF 3K1JA 2G5GX 4REZA 1XMQM 4RNAA 3PCHA 3GQ5A 1G41A 4G4NA 4WHPB 3HU1A 4LJAA 1EFUB 2BUVB 3B7NA 1Z6TA 4B08A 4Z6YA 4KLNA 4CHTB 2HHHM 1N78A 4FW9A 1AIPC 4NRVA 3TWLA 2MH8A 4JI5M 1J5EM 4AW4A 1IN8A 1VEKA 4GHAA 1G8PA 2G3QA 3I4VA 4B3SM 2UUAM 2XGNA 3SMPA 1QUSA 2ZTCA 4KO8A 1DGBA 1QDRA 4QNRA 4B7HA 3TWMA 3ZH9B 2UU9M 2BUYB 3MI1A 1GKIA 4DUYM 3L26A 2CE7A 3D8LA 1HQCA 2C9CA 2F5SA 4G4QA 4LF8M 1TF0B 1VDLA 4P17A 1R2YA 1HNZM 1N36M 4XGIA 2XZUA 1NV9A 3U6QA 2R6FA 1EOBA 5EP3A 2BURA 1N77A 2JUJA 3HHXA 3A46A 1OAOC 1SXJE 4Y28F 1PJIA 1IXZA 3GLFA 2I7NA 2LTUA 2XSVA 1E32A 2MROB 5JI3E 4K0KM 2ZAMA 2E5LM 1GLNA 2BUWB 4GIPA 1XNQM 4X66M 1IQPA 3L28A 4JYAM 1EO2B 5IWAM 3BXWA 5ITQA 2D7HA 1DO0A 2K9DA 4B3MM 3AOEA 2OO9A 5ITXE 4LF4M 2UXDM 4JI4M 1NNUC 3LVVA 2CEAA 4FVMA 1VEJA 4IBFA 1IN5A 4LJ7A 3HJSA 4L15A 3GLHA 1AUAA 2XF3A 4R7GA 3U6DA 5IT9S 3MHVC 3MFLA 2NQ8C 1SXJB 1XMOM 1HJPA 1QANA 3U60A 1L1TA 2WSFF 1EOCB 3PCCA 1A5TA 4LCBA 3LQQA 3IECA 3K2LA 4JV5M 1DMHA 3PCFA 2R45A 4WURA 3PCAA 2L2DA 1T6OA 2G8LA 3C3EA 2LXEA 4LF7M 3FTDA 1DGHB 2JZ1A 2BJVA 2VF7A 3CF6E 3FYCA 5EQTA 2VDBB 3HU3A 3KSXA 3PCJA 3WHKA 2O01F 2Q2EB 5LMUM 2DZOB 2Y0TA 4LJ8A 2DAKA 4RKUF 3SHFA 4MH0E 2QPAA 3SAUA 1VG5A 1XXHA 2F5QA 1Z5BA 3J2PB 3PCGM 3H4JA 2LBCA 1LV7A 2L09A 1ORYB 1NY5A 3FRHA 3PCLM 4WHRA 3H4MA 1WJ7A 1QQWA 3GLFE 5E26A 3KVWA 4PD2A 3KP1E 5BR8M 3VK7A 1FJGM 3ZCBB 4CISA 5KO3A 1PJJA 2EA0A 2JA2A 4DR4M 4CGYB 2AHMA 4WHSD 3JR5A 2QBYA 1YLAA 5DNYA 4IBDA 1TH4A 3O6JA 2OOAA 4QOSA 3HX3A 1OIZA 4LGYA 3PFIA 2KXEA 2CV2A 1D2NA 2KZSA 2A5YB 3QYBA 3FTCA 2KHHA 2C98A 1EOBB 5DFLA 1OFHA 2BURB 3GLHE 2KDLA 3GLGA 2APLA 3LQRA 3UGJA 2W82A 1IBKM 3GLFB 4L4UA 4IBEA 2JZ0A 1TH3A 4EIWA 4NXMM 1YKMA 4ILVA 3QAUA 1TR8A 3PCIM 2K0BX 1ZMVA 2C99A 3IG8A 4AG6A 1F4IA 1D0LA 3KP0E 3B74A 5FTJA 4A3VB 3B9PA 4OX9M 2LVNC 3T63A 1ZMUA 2VQFM 1K3WA 1QUTA 3SMSA 4GKKM 3PCMM 3J81S 4GEWA 3PCBA 1XXHE 2Z8YM 4I5SA 2LHGA 2DXIA 2LHCA 3GLHB 2DENA 4RF0A 3K92A 4LF5M 2X4AA 4LG2A 4LZJA 2K47A 3U60B 1WHCA 3JR4A 1QYRA 3UMMA 3MMPA 4LGMA 1XB2B 4AI6A 2LH0A 2AZQA 1J7KA 1DV0A 1ZQ9A 4ZPXA 4DV4M 3MI1M 3THGA 4FWDA 2FOIC 5C18A 4XBOA 3U6LA 1IY1A 3B7ZA 3NWLA 3AFHA 2J7OA 4D82A 1DO2A 1XXHB 3LCUA 5ITXA 3MI5M 2L4EA 3FKEA 4GITA 2R4JA 2DAIA 4II7A 3GLGE 3D8BA 3VKHA 4MGIE 1Q3BA 1CUKA 2B3TA 2QSFX 3L2AA 4IJFA 4B3RM 1EIJA 3PCKM 1QDTA 4D81A 3C58A 3W67A 3TE6A 2PCDA 4M0WA 4IBJA 1VQ1A 5H37D 5DYGA 4GH9A 2OPFA 4P16A 4G3OA 2BUZA 2QBYB 3PCEM 1QAMA 4AQYM 2OQ4A 3FYDA 5GKNA 4B3TM 2EO2A 2M5ZA 1SG9A 2WSCF 3AOEC 3AV0A 5KPTA 2FNAA 2LWXA 2JY5A 4WHOD 1ZV1A 1TH2A 2DZLA 4LJ5A 1MJGM 4NSRA 2ERCA 3GRYA 4JI3M 3GLGB 4W5WA 3U6EA 1GJSA 2H5XA 3MV4A 2DNAA 3MJ5A 1XNRM 1Z59A 1YKMB 1QAOA 1V92A 3U6OA 1N32M 4I4LA 3PCDA 1E9RA 4AG5A 3CTWB 1WR1B 3LW5F 2R62A 2R65A 2Y0QA 3FE3A 3FRIA 3FUWA 3NBIA 2EKKA 4DV3M 2L7HA 2EKFA 4MGYE 4YHHM 4IBGA 3VK8A 4MM3B 2Z3XA 1IXSA 1R6BX 4RF1A 3C9PA 4FCWA 4F1IA 3U6PA 2VQEM 2CRUA 4L8RC 1ZAEA 2P5TA 2UXCM 3T67M 1MX0A 3U61A 3TQSA 5BPVA 2ZANA 3T15A 2DAEA 3C3DA 4PDIA 1LTMA 1K82A 1NHGC 4ITQA 1NO1A 4X62M 4WHPD 2D7EA 4LFBM 3O5UA 1D0MA 3PNYA 1L2BA 4JI6M 3SFZA 4NXNM 3T1HM 5ITYA 1Y8GA 1L1ZA 1HNWM 2C96A 4AKGA 2ZTDA 4OU7A 2X8AA 1GL6A 1IY2A 3VDPA 2XEPA 3W68A 2XZFA 2FE8A 3SBJA 4MGKE 1PRBA 3I04M 2O5RA 3GLIE 2L7IA 1P3QQ 3TPZA 4D80A 3K9OA 3UZUA 2DKLA 2KNAA 1JR3D 3GRUA 3HGIA 4LRTA 3LMXA 2QP9X 1JQJC 2H1RA 4HL4A 1QZEA 1R7RA 3QWLA 3K8ZA 1GJTA 3RE8A 4B7FA 3VDUA 3L27A 1C7YA 2EUCA 2BUTA 2BUZB 2XFTA 3R8FA 1YKPA 2Y20A 4IBKA 3PNVA 3W0LB 2MJ5B 4LJ6A 3KOZE 3HHZA 4S12A 1MU5A 1OTRA 1NHWC 2JY8A 2RRUA 2DWZB 3GRRA 3ZC7B 1R2ZA 5FLXS 2KEBA 2DZNB 1IBLM 1DGFA 1NJGA 1QVRA 3ZQJA 4YY3M 2V1UA 3BBZA 3DOAA 1HT1E 2JNHA 2QCUA 3WHLA 4AZFA 1YKOB 3PCNM 3FUXA 1Q02A 2BNKA 4KT0F 3HZJA 5FTMA 1UFZA 4NL4H 3GRVA 2R18A 2DHYA 1X37A 4LJ4A 2LNHC 5JI2E 3KFUG 2QQ8A 1ZMWA 3BOSA 4JI0M 3AKZA 4JI7M 1YKLA 1SXJC 5L8RF 1L2DA 4IBIA 1G59A 1OJLA 2RGOA 2XSUA 1NY6A 2FFJA 3KOXE 2OOBA 3A45A 1TDHA 2QHOB 4M9ZA 1R4GA 1IXSB 3LXVM 3TWKA 1IY0A 4M0DA 2KZUA 5EP4A 2V6ZM 3GPPA 3U61B 4LZZA 3PCHM 1EE8A 1W5TA 2DVWB 2ZBKB 3KDSE 1V34A 1S3SA 2ZM6M 1JR3A 2MGWA 1D0KA 2DI0A 4QNMA 1BVSA 1PGYA 3J7BA 3GP1A 1YUBA 2L6OA 2DWLA 3PCGA 3KOWE 4BB9A 4CIZA 3CF2A 4DV1M 3PCLA 3UJNA 1WXQA 3CGWA 3M7GA 1DLTA 2GNOA 4L6V6 3U6SA 5KQDA 1VEGA 3SARA 1YKKA 4R71A 1J09A 3E46A 2O25A 3VFDA 4NC6A 4JI8M 1NV8A 2BJWA 2HWJA 1NJFA 4OW0A 4PCZA 4WHSA 5EXPA 1OKSA 4IIWA 3MV6A 2KW0A 2XSRA 4WHOB 4QHTA 4GC5A 1N75A 3VLFB 2LVAA 3SHGB 2QNJA 1IM2A 3KW6A 4M9SA 4JI1M 1I94M 1WGNA 4HEOA 2I7PA 1T3TA 4JI2M 1GO5A 4MGHA 2BV0A 1V33A 3I51A 4DR5M 4WP2A 3Q8GA 3IHPA 2BUTB 3J80S 5F3WA 4FD2A 1Q39A 1EO9A 2R0IA 1YKPB 4B7GA 2HKJA 3SATA 2DHRA 4FCTA 1HQYE 1C1KA 3NBXX 4DV6M 2CFOA 5DYIA 3RFWA 3T38A 5C1BA 4DR2M 3PCIA 1TGUA 3FUVA 4LY6A 2WZJA 4GKJM 4MGZE 2CV0A 1KFVA 3VKGA 3U5ZA 3SYKA 1JR3E 1YSYA 3CF0A 3PCMA 2XSZD 3GLIA 1QAQA 1TMXA 3MFLM 3J27B 4JN6A 1YKOA 1RU3A 3QYEA 4UN2B 3PCCM 1E94E 3TL4X 3L25A 2GQFA 4LRSA 5IREB 4M9XA 1PM5A 1DLQA 1S9AA 1YKLB 4Q7JA 2J7NA 1PJQA 3PCFM 1HR0M 1DLMA 1KSFX 3PCAM 2N35A 3A42A 4MB7A 4DUZM 1N34M 5KQ8A 3HJ8A 2UXBM 4ANRA 2Z7JA 3B7QA 4FCVA 5FTNA 5E6JA 1L8QA 4FWHA 1GABA 5EXTA 2R4EA 3I4YA 4DR7M 2QZ4A 3PCJM 3T6PA 4LFAM 3GQ3A 2BUQA 3EIEA 3M6AA 1IXRC 2HCBA 4DR3M 2YNMD 2M60A 3KXEC 1K3XA 2K6BA 4NRWA 2CP8A 1W5SA 2HAKA 3M0EA 1R5LA 2Z4RA 4JXJA 3T1YM 3LMXM 3MI5A 4WHQA 3B89A 2R44A 5EXSA 4OVZA 2YQZA 3E9SA 2XLJA 4DR1M 3PVSA 3GQ4A 4AKIA 3DA1A 4KHPM 2LVOC 1YE9A 3HKPA 1G4AE 1IFYA 1FNNA 1YKKB 1IN6A 1NNJA 1IN7A 1HT2E 2VIIA 3HY5A 2XFSA 1L2CA 4LFCM 2BUUA 2BV0B 3PCKA 2F5NA 2C9OA 4WHSB 4WHRF 4IBCA 3U6MA 2FS1A 4DR6M 2BOYA 5IZ7D 3K9PA 4GHLA 3PCEA 2XH9A 2BUMB 3HWSA 4KODA 4DV7M 3LKTA 1YKNA 2D7GA 4WHOA 2CHGA 2QENA 2XSZA 2DWMA 2EJSA 2UUBM 5EP2A 3FUTA 3GPYA 3JAMS 3FUUA 3HJQA 4X64M 2C5RA 3N9TA 3RGPA 3F92A 5FSWA 1I4WA 3KSJA 1Z5AA 2KNVA 4DV2M 1EO9B 2YFQA 3HHWA 2DAMA 1EOAA 4WW0A 3J7AS 3AOGA 4L78A 5EJCA 2CHQA 2Z4SA 1UM8A 3MK6A 3T63M 3SASA 4IJEA 3LCVB 2DAGA 2DWNA 3SYLA 3U5ZB 3PCBM 5ITTA 2MR9A 1IBMM 1NVMA 3GLIB 3A98B 1T43A 2KNZA 4I81A 4PT5A 3HHYA 8CATA 2CV1A 2BUXB 3T67A 3V76A 2KRUA 4NOOB 1OQYA 4FWGA 4WHRB 2FH0A 4WHPA 3TH1A 2BUVA 2J5YA 4G6ZA 1TDZA 2F5PA 3W0FA 4CJ6A 2L4FA 4LJ9A 2RKOA 3LKTM 1SXJD 1JB0F 2LVPC 1XHBA 3I01M 3PXGA 4G4RA 4NSOB 2R46A 2BWEA 2VF8A 3KOYE 3MV6M 3Q8XA 4LF9M 2BUQB 4DBGB 4G4OA 4PDGA 1OFIA 3LMMA 4BLCA 2V1CA 5ITRA 3SAVA 3O6RA 2BUYA 5TD3A 4X65M 2Y21A 4BBAA 4Z8XA 3HU2A 4WHQB 2RGHA 3SC3A 4QOZC 4OVZB 1Q3CA 3IG5A 4HLQA 4R3DA 5EXXA 1IN4A 2YR0A 3SAWA 2JY6B 1DGGA 3EIHA 3U6CA 3KS8A 1GL7A 4GC9A 2BUUB 2PCDM 3DZDA 1GVNA 4F2LA 3GPXA 3L29A 3LVWA 5FTKA 3KS4A 2BWBA 1MN3A 4GMQA 2HL7A 3DFZA 3FTEA 2BUWA 2BUXA 1XWIA 1YKNB 1G3IA 1WGLA 3FTFA 4ILTA 2CUZA 1EO2A 1PJSA 3FD9A 3ILKA 5ITUA 1WIVA 1VDDA 2UUCM 1KYIA 2F4VM 2CWBA 3RGSA 1N33M 2JY7A 3E21A 4DV0M 1TTEA 3MV4M 3AJIB 4IBBA 1XC8A 1HNXM 2CHVA 3PCNA 2JWSA 3UK6A 5A2QS 2JXNA 2BUMA 3AL0C 3PCDM 4AKHA 5KPZA 1EOAB 1E9SA 1Z5CA 1SXJA 1OIPA 4I8OA 4DV5M 4QHSA 2F5OA 1EOCA 2ZAOA 5EP1A 4TUWA 2JP7A 1PJTA 2X49A 4XK8F 3OTOM 3O32A 1NSFA 1QZMA 2KA6B 1G71A 3GPUA 2LVQD
chains in the Genus database with same CATH topology
5KPRA 3GO8A 5LMNM 2KRKA 1H6UA 1DGHA 5FTLA 4LF6M 4GRIA 3R9XB 3E4RA 7CATA 3LXVA 4L16A 1XMQM 3K1JA 2G5GX 4REZA 4RNAA 3PCHA 3GQ5A 1G41A 4G4NA 4WHPB 3HU1A 4LJAA 2BUVB 1Z6TA 4B08A 4Z6YA 4KLNA 4CHTB 2HHHM 1N78A 4FW9A 4NRVA 3TWLA 4JI5M 1J5EM 4AW4A 1IN8A 4GHAA 1G8PA 3I4VA 4B3SM 2UUAM 2XGNA 3SMPA 3TWMA 4KO8A 4B7HA 1DGBA 2BUYB 4QNRA 3LKTM 2UU9M 3ZH9B 3MI1A 1GKIA 4DUYM 3L26A 2CE7A 3D8LA 1HQCA 2C9CA 2F5SA 4LF8M 1R2YA 1HNZM 1N36M 4XGIA 2XZUA 3U6QA 1EOBA 5EP3A 2BURA 1N77A 3A46A 3HHXA 1SXJE 1PJIA 1IXZA 3GLFA 2I7NA 2XSVA 1E32A 5JI3E 4K0KM 2ZAMA 2E5LM 1GLNA 2BUWB 4GIPA 1XNQM 4X66M 1IQPA 3L28A 4JYAM 1EO2B 5IWAM 5ITQA 2D7HA 1DO0A 4B3MM 3AOEA 5ITXE 4LF4M 2UXDM 4JI4M 1NNUC 3LVVA 2CEAA 4FVMA 4IBFA 1IN5A 4LJ7A 3HJSA 4L15A 3GLHA 4R7GA 2XF3A 3U6DA 5IT9S 3MFLA 3MHVC 2NQ8C 1SXJB 1XMOM 1QANA 3U60A 1L1TA 1EOCB 3PCCA 4LCBA 3LQQA 3PCFA 3K2LA 4JV5M 1DMHA 2R45A 4WURA 3PCAA 2G8LA 2LXEA 4LF7M 3FTDA 1DGHB 2BJVA 3CF6E 3FYCA 5EQTA 3HU3A 3KSXA 3PCJA 3WHKA 2Q2EB 5LMUM 2DZOB 2Y0TA 4LJ8A 3SHFA 4MH0E 2QPAA 3SAUA 1XXHA 2F5QA 1Z5BA 3J2PB 3PCGM 1LV7A 2L09A 1ORYB 1NY5A 3PCLM 3H4MA 1QQWA 5E26A 3KVWA 4PD2A 3KP1E 5BR8M 3VK7A 1FJGM 3ZCBB 4CISA 5KO3A 1PJJA 2EA0A 2JA2A 4DR4M 4CGYB 2AHMA 4WHSD 3JR5A 2QBYA 5DNYA 4IBDA 1TH4A 3O6JA 4QOSA 4LGYA 3PFIA 2KXEA 2CV2A 1D2NA 2KZSA 2A5YB 1EOBB 3FTCA 2BURB 2C98A 1OFHA 3GLGA 3LQRA 3UGJA 2W82A 1IBKM 3GLFB 4L4UA 4IBEA 1TH3A 4EIWA 4NXMM 1YKMA 4ILVA 3QAUA 3PCIM 2C99A 3IG8A 4AG6A 3KP0E 5FTJA 4A3VB 3B9PA 4OX9M 3T63A 2VQFM 1K3WA 3SMSA 4GKKM 3PCMM 3J81S 3PCBA 4I5SA 2DXIA 4LF5M 3GLHB 4RF0A 4LG2A 3K92A 2X4AA 4LZJA 2K47A 3U60B 3JR4A 1QYRA 3UMMA 4LGMA 4AI6A 2LH0A 2AZQA 1J7KA 1ZQ9A 4ZPXA 4DV4M 3THGA 4FWDA 2FOIC 5C18A 4XBOA 3U6LA 1IY1A 3NWLA 3AFHA 2J7OA 4D82A 1DO2A 1XXHB 5ITXA 3MI5M 3FKEA 4GITA 2R4JA 4II7A 3D8BA 3VKHA 4MGIE 1Q3BA 4IJFA 3PCKM 3L2AA 4B3RM 3C58A 4D81A 3TE6A 2PCDA 4M0WA 4IBJA 2OPFA 5H37D 5DYGA 4GH9A 4P16A 2BUZA 2QBYB 3PCEM 1QAMA 4AQYM 2OQ4A 3FYDA 5GKNA 4B3TM 2EO2A 2M5ZA 3AOEC 3AV0A 5KPTA 2FNAA 2LWXA 4WHOD 1TH2A 4LJ5A 4NSRA 4JI3M 2ERCA 3GRYA 3GLGB 3U6EA 4W5WA 3MV4A 3MJ5A 1XNRM 1Z59A 1YKMB 1QAOA 1N32M 3U6OA 4I4LA 3PCDA 1E9RA 4AG5A 3CTWB 4G4QA 3NBIA 2R62A 2R65A 2Y0QA 3FUWA 4DV3M 2L7HA 4MGYE 4YHHM 4IBGA 3VK8A 4MM3B 2Z3XA 1R6BX 4RF1A 4FCWA 3U6PA 2UXCM 2VQEM 4L8RC 1ZAEA 2P5TA 3T67M 1MX0A 3U61A 3TQSA 5BPVA 2ZANA 3T15A 4PDIA 1K82A 4ITQA 1NHGC 4X62M 4WHPD 2D7EA 4LFBM 3O5UA 3PNYA 1L2BA 4JI6M 3SFZA 4NXNM 3T1HM 5ITYA 1L1ZA 1HNWM 2C96A 4AKGA 4OU7A 2X8AA 1GL6A 1IY2A 3VDPA 2XEPA 2XZFA 2FE8A 3SBJA 4MGKE 2O5RA 2L7IA 4D80A 3TPZA 3UZUA 1JR3D 3GRUA 3HGIA 4LRTA 3LMXA 2QP9X 1JQJC 2H1RA 4HL4A 1R7RA 3QWLA 3K8ZA 3RE8A 4B7FA 3VDUA 3L27A 2EUCA 2BUTA 2BUZB 2XFTA 3R8FA 1YKPA 2Y20A 4IBKA 3PNVA 3W0LB 4LJ6A 3HHZA 3KOZE 4S12A 1MU5A 1NHWC 2DWZB 3GRRA 3ZC7B 1R2ZA 5FLXS 2KEBA 2DZNB 1IBLM 1DGFA 1NJGA 1QVRA 2V1UA 4YY3M 3WHLA 3DOAA 1HT1E 4AZFA 2QCUA 1YKOB 3PCNM 3FUXA 2BNKA 5FTMA 4NL4H 3GRVA 2R18A 1X37A 4LJ4A 2LNHC 5JI2E 3KFUG 3BOSA 4JI0M 3AKZA 4JI7M 1YKLA 1SXJC 1L2DA 4IBIA 1G59A 1OJLA 2RGOA 2XSUA 1NY6A 2FFJA 3KOXE 3A45A 1TDHA 4M9ZA 1IXSB 3LXVM 3TWKA 1IY0A 4M0DA 2KZUA 5EP4A 2V6ZM 3GPPA 3U61B 4LZZA 3PCHM 1EE8A 1W5TA 2DVWB 2ZBKB 3KDSE 1S3SA 2ZM6M 1JR3A 4QNMA 3J7BA 3GP1A 1YUBA 2L6OA 2DWLA 3PCGA 3KOWE 4BB9A 3CF2A 4DV1M 3PCLA 3UJNA 1WXQA 3M7GA 1DLTA 3SARA 3U6SA 5KQDA 1YKKA 1J09A 2BV0A 3VFDA 4JI8M 3MI1M 4WHSA 2BJWA 4PCZA 1NJFA 4OW0A 5EXPA 4IIWA 3MV6A 2KW0A 2XSRA 4WHOB 4QHTA 4GC5A 1N75A 3VLFB 3SHGB 4JI1M 3KW6A 1IM2A 4M9SA 2BUMA 1I94M 2I7PA 1T3TA 4JI2M 4MGHA 3I51A 4DR5M 2BUTB 3J80S 5F3WA 4FD2A 1Q39A 1EO9A 1YKPB 4B7GA 2HKJA 3SATA 2DHRA 4FCTA 1HQYE 1C1KA 4DV6M 2CFOA 5DYIA 3RFWA 3T38A 5C1BA 4DR2M 3PCIA 1TGUA 3FUVA 4LY6A 4GKJM 4MGZE 2CV0A 1KFVA 3VKGA 3U5ZA 3SYKA 1YSYA 3CF0A 3PCMA 2XSZD 3GLIA 1QAQA 1TMXA 3MFLM 3J27B 4JN6A 1YKOA 3PCCM 1E94E 3TL4X 3L25A 5IREB 4LRSA 1PM5A 4M9XA 1DLQA 1S9AA 1YKLB 4WHRA 2J7NA 3PCFM 1HR0M 1DLMA 1KSFX 3PCAM 3A42A 4MB7A 4DUZM 1N34M 5KQ8A 3HJ8A 2UXBM 2Z7JA 4FCVA 5FTNA 5E6JA 1L8QA 4FWHA 5EXTA 2R4EA 3I4YA 4DR7M 2QZ4A 3PCJM 3GQ3A 4LFAM 2BUQA 3EIEA 3M6AA 1IXRC 2HCBA 4DR3M 2YNMD 2M60A 3KXEC 1K3XA 4NRWA 1W5SA 3T1YM 3M0EA 2Z4RA 4JXJA 3LMXM 4WHQA 3MI5A 5EXSA 4OVZA 2YQZA 3E9SA 2XLJA 4DR1M 3PVSA 3GQ4A 4AKIA 3DA1A 4KHPM 1YE9A 3HKPA 1G4AE 1YKKB 1FNNA 1IN6A 1NNJA 1IN7A 1HT2E 2VIIA 1L2CA 2XFSA 4LFCM 2BUUA 2BV0B 3PCKA 4WHSB 2F5NA 2C9OA 4WHRF 4IBCA 3U6MA 4DR6M 2BOYA 5IZ7D 4GHLA 3PCEA 2XH9A 2BUMB 3HWSA 4KODA 4DV7M 3LKTA 1YKNA 2D7GA 4WHOA 2CHGA 2QENA 2XSZA 2DWMA 2UUBM 5EP2A 3FUTA 3GPYA 3JAMS 3FUUA 3HJQA 4X64M 2C5RA 3N9TA 3RGPA 5FSWA 1I4WA 3KSJA 1Z5AA 4DV2M 1EO9B 2YFQA 3HHWA 1EOAA 4WW0A 3J7AS 3AOGA 4L78A 5EJCA 2CHQA 2Z4SA 1UM8A 3MK6A 3T63M 3SASA 4IJEA 2DWNA 3SYLA 3U5ZB 3PCBM 5ITTA 1IBMM 1NVMA 3GLIB 3A98B 4I81A 4PT5A 3HHYA 8CATA 2CV1A 2BUXB 3T67A 4WHRB 2KRUA 4NOOB 4FWGA 4WHPA 3TH1A 2BUVA 4G6ZA 1TDZA 2F5PA 3W0FA 4LJ9A 2RKOA 1SXJD 1XHBA 3PXGA 4G4RA 4NSOB 2R46A 3KOYE 3MV6M 3Q8XA 4LF9M 2BUQB 4G4OA 4PDGA 1OFIA 3LMMA 4BLCA 2V1CA 5ITRA 3SAVA 3O6RA 2BUYA 5TD3A 4X65M 2Y21A 4BBAA 4Z8XA 3HU2A 4WHQB 2RGHA 3SC3A 4QOZC 4OVZB 1Q3CA 3IG5A 4HLQA 4R3DA 5EXXA 1IN4A 2YR0A 3SAWA 1DGGA 3EIHA 3U6CA 3KS8A 1GL7A 4GC9A 2BUUB 2PCDM 3DZDA 1GVNA 3GPXA 3L29A 3LVWA 5FTKA 3KS4A 4GMQA 2HL7A 3DFZA 3FTEA 2BUWA 2BUXA 1XWIA 1YKNB 1G3IA 3FTFA 4ILTA 2CUZA 1EO2A 3FD9A 3ILKA 5ITUA 1VDDA 2UUCM 1KYIA 2F4VM 3RGSA 1N33M 4DV0M 3MV4M 3AJIB 4IBBA 1XC8A 1HNXM 2CHVA 3PCNA 3UK6A 5A2QS 3AL0C 3PCDM 4AKHA 5KPZA 1EOAB 1E9SA 1Z5CA 1SXJA 4I8OA 4DV5M 1EOCA 4QHSA 2F5OA 2ZAOA 5EP1A 4TUWA 2X49A 3OTOM 3O32A 1NSFA 1QZMA 2KA6B 3GPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCI M;  3LMX M;  3LXV A;  4WHQ A;  3MI5 A;  2BUT A;  2BUZ B;  3PCH A;  3T63 A;  1YKP A;  4WHP B;  3HKP A;  2BUV B;  1YKK B;  3PCM M;  3PCB A;  2BUU A;  3PCK A;  2BV0 B;  4WHS B;  4WHR F;  2BOY A;  1YKO B;  3PCE A;  2BUM B;  3PCN M;  3LKT A;  3I4V A;  1YKN A;  4WHO A;  3LKT M;  2AZQ A;  2BUY B;  3MI1 A;  1YKL A;  3HJQ A;  3N9T A;  2XSU A;  4ILV A;  1EO9 B;  1EOB A;  1EOA A;  2BUR A;  3LXV M;  3MI5 M;  3HHX A;  3PCH M;  3T63 M;  2XSV A;  2BUW B;  3PCB M;  3PCK M;  3HGI A;  1EO2 B;  2PCD A;  3PCG A;  3HHY A;  3T67 A;  2BUX B;  2BUZ A;  3PCL A;  3PCE M;  4WHR B;  4WHP A;  1DLT A;  3TH1 A;  2BUV A;  1YKK A;  2BV0 A;  3MI1 M;  3HJS A;  4WHS A;  3MFL A;  4WHO D;  3MV6 A;  2XSR A;  4WHO B;  3PCC A;  1EOC B;  3MV6 M;  2BUM A;  2BUQ B;  3PCF A;  1DMH A;  3MV4 A;  3PCA A;  1YKM B;  3O6R A;  2BUY A;  5TD3 A;  3PCD A;  3I51 A;  4WHQ B;  3PCJ A;  2BUT B;  1EO9 A;  1YKP B;  2BUU B;  2PCD M;  3PCI A;  3PCG M;  3T67 M;  3PCL M;  2BUW A;  1YKN B;  4WHP D;  4ILT A;  3PCM A;  1EO2 A;  1TMX A;  3MFL M;  3O5U A;  1YKO A;  3PCC M;  2BUX A;  1S9A A;  1YKL B;  4WHS D;  1DLQ A;  4WHR A;  3PCF M;  3O6J A;  1DLM A;  3MV4 M;  3PCA M;  3PCN A;  3HJ8 A;  3PCD M;  1EOB B;  1EOA B;  2BUR B;  3I4Y A;  1EOC A;  3PCJ M;  2BUQ A;  3O32 A;  1YKM A;  3LMX A; 
#chains in the Genus database with same CATH topology
 5KPR A;  3GO8 A;  5LMN M;  2KRK A;  1H6U A;  1DGH A;  5FTL A;  4LF6 M;  4GRI A;  3R9X B;  3E4R A;  7CAT A;  3LXV A;  1OAI A;  4L16 A;  2WSE F;  3K1J A;  2G5G X;  4REZ A;  1XMQ M;  4RNA A;  3PCH A;  3GQ5 A;  1G41 A;  4G4N A;  4WHP B;  3HU1 A;  4LJA A;  1EFU B;  2BUV B;  3B7N A;  1Z6T A;  4B08 A;  4Z6Y A;  4KLN A;  4CHT B;  2HHH M;  1N78 A;  4FW9 A;  1AIP C;  4NRV A;  3TWL A;  2MH8 A;  4JI5 M;  1J5E M;  4AW4 A;  1IN8 A;  1VEK A;  4GHA A;  1G8P A;  2G3Q A;  3I4V A;  4B3S M;  2UUA M;  2XGN A;  3SMP A;  1QUS A;  2ZTC A;  4KO8 A;  1DGB A;  1QDR A;  4QNR A;  4B7H A;  3TWM A;  3ZH9 B;  2UU9 M;  2BUY B;  3MI1 A;  1GKI A;  4DUY M;  3L26 A;  2CE7 A;  3D8L A;  1HQC A;  2C9C A;  2F5S A;  4G4Q A;  4LF8 M;  1TF0 B;  1VDL A;  4P17 A;  1R2Y A;  1HNZ M;  1N36 M;  4XGI A;  2XZU A;  1NV9 A;  3U6Q A;  2R6F A;  1EOB A;  5EP3 A;  2BUR A;  1N77 A;  2JUJ A;  3HHX A;  3A46 A;  1OAO C;  1SXJ E;  4Y28 F;  1PJI A;  1IXZ A;  3GLF A;  2I7N A;  2LTU A;  2XSV A;  1E32 A;  2MRO B;  5JI3 E;  4K0K M;  2ZAM A;  2E5L M;  1GLN A;  2BUW B;  4GIP A;  1XNQ M;  4X66 M;  1IQP A;  3L28 A;  4JYA M;  1EO2 B;  5IWA M;  3BXW A;  5ITQ A;  2D7H A;  1DO0 A;  2K9D A;  4B3M M;  3AOE A;  2OO9 A;  5ITX E;  4LF4 M;  2UXD M;  4JI4 M;  1NNU C;  3LVV A;  2CEA A;  4FVM A;  1VEJ A;  4IBF A;  1IN5 A;  4LJ7 A;  3HJS A;  4L15 A;  3GLH A;  1AUA A;  2XF3 A;  4R7G A;  3U6D A;  5IT9 S;  3MHV C;  3MFL A;  2NQ8 C;  1SXJ B;  1XMO M;  1HJP A;  1QAN A;  3U60 A;  1L1T A;  2WSF F;  1EOC B;  3PCC A;  1A5T A;  4LCB A;  3LQQ A;  3IEC A;  3K2L A;  4JV5 M;  1DMH A;  3PCF A;  2R45 A;  4WUR A;  3PCA A;  2L2D A;  1T6O A;  2G8L A;  3C3E A;  2LXE A;  4LF7 M;  3FTD A;  1DGH B;  2JZ1 A;  2BJV A;  2VF7 A;  3CF6 E;  3FYC A;  5EQT A;  2VDB B;  3HU3 A;  3KSX A;  3PCJ A;  3WHK A;  2O01 F;  2Q2E B;  5LMU M;  2DZO B;  2Y0T A;  4LJ8 A;  2DAK A;  4RKU F;  3SHF A;  4MH0 E;  2QPA A;  3SAU A;  1VG5 A;  1XXH A;  2F5Q A;  1Z5B A;  3J2P B;  3PCG M;  3H4J A;  2LBC A;  1LV7 A;  2L09 A;  1ORY B;  1NY5 A;  3FRH A;  3PCL M;  4WHR A;  3H4M A;  1WJ7 A;  1QQW A;  3GLF E;  5E26 A;  3KVW A;  4PD2 A;  3KP1 E;  5BR8 M;  3VK7 A;  1FJG M;  3ZCB B;  4CIS A;  5KO3 A;  1PJJ A;  2EA0 A;  2JA2 A;  4DR4 M;  4CGY B;  2AHM A;  4WHS D;  3JR5 A;  2QBY A;  1YLA A;  5DNY A;  4IBD A;  1TH4 A;  3O6J A;  2OOA A;  4QOS A;  3HX3 A;  1OIZ A;  4LGY A;  3PFI A;  2KXE A;  2CV2 A;  1D2N A;  2KZS A;  2A5Y B;  3QYB A;  3FTC A;  2KHH A;  2C98 A;  1EOB B;  5DFL A;  1OFH A;  2BUR B;  3GLH E;  2KDL A;  3GLG A;  2APL A;  3LQR A;  3UGJ A;  2W82 A;  1IBK M;  3GLF B;  4L4U A;  4IBE A;  2JZ0 A;  1TH3 A;  4EIW A;  4NXM M;  1YKM A;  4ILV A;  3QAU A;  1TR8 A;  3PCI M;  2K0B X;  1ZMV A;  2C99 A;  3IG8 A;  4AG6 A;  1F4I A;  1D0L A;  3KP0 E;  3B74 A;  5FTJ A;  4A3V B;  3B9P A;  4OX9 M;  2LVN C;  3T63 A;  1ZMU A;  2VQF M;  1K3W A;  1QUT A;  3SMS A;  4GKK M;  3PCM M;  3J81 S;  4GEW A;  3PCB A;  1XXH E;  2Z8Y M;  4I5S A;  2LHG A;  2DXI A;  2LHC A;  3GLH B;  2DEN A;  4RF0 A;  3K92 A;  4LF5 M;  2X4A A;  4LG2 A;  4LZJ A;  2K47 A;  3U60 B;  1WHC A;  3JR4 A;  1QYR A;  3UMM A;  3MMP A;  4LGM A;  1XB2 B;  4AI6 A;  2LH0 A;  2AZQ A;  1J7K A;  1DV0 A;  1ZQ9 A;  4ZPX A;  4DV4 M;  3MI1 M;  3THG A;  4FWD A;  2FOI C;  5C18 A;  4XBO A;  3U6L A;  1IY1 A;  3B7Z A;  3NWL A;  3AFH A;  2J7O A;  4D82 A;  1DO2 A;  1XXH B;  3LCU A;  5ITX A;  3MI5 M;  2L4E A;  3FKE A;  4GIT A;  2R4J A;  2DAI A;  4II7 A;  3GLG E;  3D8B A;  3VKH A;  4MGI E;  1Q3B A;  1CUK A;  2B3T A;  2QSF X;  3L2A A;  4IJF A;  4B3R M;  1EIJ A;  3PCK M;  1QDT A;  4D81 A;  3C58 A;  3W67 A;  3TE6 A;  2PCD A;  4M0W A;  4IBJ A;  1VQ1 A;  5H37 D;  5DYG A;  4GH9 A;  2OPF A;  4P16 A;  4G3O A;  2BUZ A;  2QBY B;  3PCE M;  1QAM A;  4AQY M;  2OQ4 A;  3FYD A;  5GKN A;  4B3T M;  2EO2 A;  2M5Z A;  1SG9 A;  2WSC F;  3AOE C;  3AV0 A;  5KPT A;  2FNA A;  2LWX A;  2JY5 A;  4WHO D;  1ZV1 A;  1TH2 A;  2DZL A;  4LJ5 A;  1MJG M;  4NSR A;  2ERC A;  3GRY A;  4JI3 M;  3GLG B;  4W5W A;  3U6E A;  1GJS A;  2H5X A;  3MV4 A;  2DNA A;  3MJ5 A;  1XNR M;  1Z59 A;  1YKM B;  1QAO A;  1V92 A;  3U6O A;  1N32 M;  4I4L A;  3PCD A;  1E9R A;  4AG5 A;  3CTW B;  1WR1 B;  3LW5 F;  2R62 A;  2R65 A;  2Y0Q A;  3FE3 A;  3FRI A;  3FUW A;  3NBI A;  2EKK A;  4DV3 M;  2L7H A;  2EKF A;  4MGY E;  4YHH M;  4IBG A;  3VK8 A;  4MM3 B;  2Z3X A;  1IXS A;  1R6B X;  4RF1 A;  3C9P A;  4FCW A;  4F1I A;  3U6P A;  2VQE M;  2CRU A;  4L8R C;  1ZAE A;  2P5T A;  2UXC M;  3T67 M;  1MX0 A;  3U61 A;  3TQS A;  5BPV A;  2ZAN A;  3T15 A;  2DAE A;  3C3D A;  4PDI A;  1LTM A;  1K82 A;  1NHG C;  4ITQ A;  1NO1 A;  4X62 M;  4WHP D;  2D7E A;  4LFB M;  3O5U A;  1D0M A;  3PNY A;  1L2B A;  4JI6 M;  3SFZ A;  4NXN M;  3T1H M;  5ITY A;  1Y8G A;  1L1Z A;  1HNW M;  2C96 A;  4AKG A;  2ZTD A;  4OU7 A;  2X8A A;  1GL6 A;  1IY2 A;  3VDP A;  2XEP A;  3W68 A;  2XZF A;  2FE8 A;  3SBJ A;  4MGK E;  1PRB A;  3I04 M;  2O5R A;  3GLI E;  2L7I A;  1P3Q Q;  3TPZ A;  4D80 A;  3K9O A;  3UZU A;  2DKL A;  2KNA A;  1JR3 D;  3GRU A;  3HGI A;  4LRT A;  3LMX A;  2QP9 X;  1JQJ C;  2H1R A;  4HL4 A;  1QZE A;  1R7R A;  3QWL A;  3K8Z A;  1GJT A;  3RE8 A;  4B7F A;  3VDU A;  3L27 A;  1C7Y A;  2EUC A;  2BUT A;  2BUZ B;  2XFT A;  3R8F A;  1YKP A;  2Y20 A;  4IBK A;  3PNV A;  3W0L B;  2MJ5 B;  4LJ6 A;  3KOZ E;  3HHZ A;  4S12 A;  1MU5 A;  1OTR A;  1NHW C;  2JY8 A;  2RRU A;  2DWZ B;  3GRR A;  3ZC7 B;  1R2Z A;  5FLX S;  2KEB A;  2DZN B;  1IBL M;  1DGF A;  1NJG A;  1QVR A;  3ZQJ A;  4YY3 M;  2V1U A;  3BBZ A;  3DOA A;  1HT1 E;  2JNH A;  2QCU A;  3WHL A;  4AZF A;  1YKO B;  3PCN M;  3FUX A;  1Q02 A;  2BNK A;  4KT0 F;  3HZJ A;  5FTM A;  1UFZ A;  4NL4 H;  3GRV A;  2R18 A;  2DHY A;  1X37 A;  4LJ4 A;  2LNH C;  5JI2 E;  3KFU G;  2QQ8 A;  1ZMW A;  3BOS A;  4JI0 M;  3AKZ A;  4JI7 M;  1YKL A;  1SXJ C;  5L8R F;  1L2D A;  4IBI A;  1G59 A;  1OJL A;  2RGO A;  2XSU A;  1NY6 A;  2FFJ A;  3KOX E;  2OOB A;  3A45 A;  1TDH A;  2QHO B;  4M9Z A;  1R4G A;  1IXS B;  3LXV M;  3TWK A;  1IY0 A;  4M0D A;  2KZU A;  5EP4 A;  2V6Z M;  3GPP A;  3U61 B;  4LZZ A;  3PCH M;  1EE8 A;  1W5T A;  2DVW B;  2ZBK B;  3KDS E;  1V34 A;  1S3S A;  2ZM6 M;  1JR3 A;  2MGW A;  1D0K A;  2DI0 A;  4QNM A;  1BVS A;  1PGY A;  3J7B A;  3GP1 A;  1YUB A;  2L6O A;  2DWL A;  3PCG A;  3KOW E;  4BB9 A;  4CIZ A;  3CF2 A;  4DV1 M;  3PCL A;  3UJN A;  1WXQ A;  3CGW A;  3M7G A;  1DLT A;  2GNO A;  4L6V 6;  3U6S A;  5KQD A;  1VEG A;  3SAR A;  1YKK A;  4R71 A;  1J09 A;  3E46 A;  2O25 A;  3VFD A;  4NC6 A;  4JI8 M;  1NV8 A;  2BJW A;  2HWJ A;  1NJF A;  4OW0 A;  4PCZ A;  4WHS A;  5EXP A;  1OKS A;  4IIW A;  3MV6 A;  2KW0 A;  2XSR A;  4WHO B;  4QHT A;  4GC5 A;  1N75 A;  3VLF B;  2LVA A;  3SHG B;  2QNJ A;  1IM2 A;  3KW6 A;  4M9S A;  4JI1 M;  1I94 M;  1WGN A;  4HEO A;  2I7P A;  1T3T A;  4JI2 M;  1GO5 A;  4MGH A;  2BV0 A;  1V33 A;  3I51 A;  4DR5 M;  4WP2 A;  3Q8G A;  3IHP A;  2BUT B;  3J80 S;  5F3W A;  4FD2 A;  1Q39 A;  1EO9 A;  2R0I A;  1YKP B;  4B7G A;  2HKJ A;  3SAT A;  2DHR A;  4FCT A;  1HQY E;  1C1K A;  3NBX X;  4DV6 M;  2CFO A;  5DYI A;  3RFW A;  3T38 A;  5C1B A;  4DR2 M;  3PCI A;  1TGU A;  3FUV A;  4LY6 A;  2WZJ A;  4GKJ M;  4MGZ E;  2CV0 A;  1KFV A;  3VKG A;  3U5Z A;  3SYK A;  1JR3 E;  1YSY A;  3CF0 A;  3PCM A;  2XSZ D;  3GLI A;  1QAQ A;  1TMX A;  3MFL M;  3J27 B;  4JN6 A;  1YKO A;  1RU3 A;  3QYE A;  4UN2 B;  3PCC M;  1E94 E;  3TL4 X;  3L25 A;  2GQF A;  4LRS A;  5IRE B;  4M9X A;  1PM5 A;  1DLQ A;  1S9A A;  1YKL B;  4Q7J A;  2J7N A;  1PJQ A;  3PCF M;  1HR0 M;  1DLM A;  1KSF X;  3PCA M;  2N35 A;  3A42 A;  4MB7 A;  4DUZ M;  1N34 M;  5KQ8 A;  3HJ8 A;  2UXB M;  4ANR A;  2Z7J A;  3B7Q A;  4FCV A;  5FTN A;  5E6J A;  1L8Q A;  4FWH A;  1GAB A;  5EXT A;  2R4E A;  3I4Y A;  4DR7 M;  2QZ4 A;  3PCJ M;  3T6P A;  4LFA M;  3GQ3 A;  2BUQ A;  3EIE A;  3M6A A;  1IXR C;  2HCB A;  4DR3 M;  2YNM D;  2M60 A;  3KXE C;  1K3X A;  2K6B A;  4NRW A;  2CP8 A;  1W5S A;  2HAK A;  3M0E A;  1R5L A;  2Z4R A;  4JXJ A;  3T1Y M;  3LMX M;  3MI5 A;  4WHQ A;  3B89 A;  2R44 A;  5EXS A;  4OVZ A;  2YQZ A;  3E9S A;  2XLJ A;  4DR1 M;  3PVS A;  3GQ4 A;  4AKI A;  3DA1 A;  4KHP M;  2LVO C;  1YE9 A;  3HKP A;  1G4A E;  1IFY A;  1FNN A;  1YKK B;  1IN6 A;  1NNJ A;  1IN7 A;  1HT2 E;  2VII A;  3HY5 A;  2XFS A;  1L2C A;  4LFC M;  2BUU A;  2BV0 B;  3PCK A;  2F5N A;  2C9O A;  4WHS B;  4WHR F;  4IBC A;  3U6M A;  2FS1 A;  4DR6 M;  2BOY A;  5IZ7 D;  3K9P A;  4GHL A;  3PCE A;  2XH9 A;  2BUM B;  3HWS A;  4KOD A;  4DV7 M;  3LKT A;  1YKN A;  2D7G A;  4WHO A;  2CHG A;  2QEN A;  2XSZ A;  2DWM A;  2EJS A;  2UUB M;  5EP2 A;  3FUT A;  3GPY A;  3JAM S;  3FUU A;  3HJQ A;  4X64 M;  2C5R A;  3N9T A;  3RGP A;  3F92 A;  5FSW A;  1I4W A;  3KSJ A;  1Z5A A;  2KNV A;  4DV2 M;  1EO9 B;  2YFQ A;  3HHW A;  2DAM A;  1EOA A;  4WW0 A;  3J7A S;  3AOG A;  4L78 A;  5EJC A;  2CHQ A;  2Z4S A;  1UM8 A;  3MK6 A;  3T63 M;  3SAS A;  4IJE A;  3LCV B;  2DAG A;  2DWN A;  3SYL A;  3U5Z B;  3PCB M;  5ITT A;  2MR9 A;  1IBM M;  1NVM A;  3GLI B;  3A98 B;  1T43 A;  2KNZ A;  4I81 A;  4PT5 A;  3HHY A;  8CAT A;  2CV1 A;  2BUX B;  3T67 A;  3V76 A;  2KRU A;  4NOO B;  1OQY A;  4FWG A;  4WHR B;  2FH0 A;  4WHP A;  3TH1 A;  2BUV A;  2J5Y A;  4G6Z A;  1TDZ A;  2F5P A;  3W0F A;  4CJ6 A;  2L4F A;  4LJ9 A;  2RKO A;  3LKT M;  1SXJ D;  1JB0 F;  2LVP C;  1XHB A;  3I01 M;  3PXG A;  4G4R A;  4NSO B;  2R46 A;  2BWE A;  2VF8 A;  3KOY E;  3MV6 M;  3Q8X A;  4LF9 M;  2BUQ B;  4DBG B;  4G4O A;  4PDG A;  1OFI A;  3LMM A;  4BLC A;  2V1C A;  5ITR A;  3SAV A;  3O6R A;  2BUY A;  5TD3 A;  4X65 M;  2Y21 A;  4BBA A;  4Z8X A;  3HU2 A;  4WHQ B;  2RGH A;  3SC3 A;  4QOZ C;  4OVZ B;  1Q3C A;  3IG5 A;  4HLQ A;  4R3D A;  5EXX A;  1IN4 A;  2YR0 A;  3SAW A;  2JY6 B;  1DGG A;  3EIH A;  3U6C A;  3KS8 A;  1GL7 A;  4GC9 A;  2BUU B;  2PCD M;  3DZD A;  1GVN A;  4F2L A;  3GPX A;  3L29 A;  3LVW A;  5FTK A;  3KS4 A;  2BWB A;  1MN3 A;  4GMQ A;  2HL7 A;  3DFZ A;  3FTE A;  2BUW A;  2BUX A;  1XWI A;  1YKN B;  1G3I A;  1WGL A;  3FTF A;  4ILT A;  2CUZ A;  1EO2 A;  1PJS A;  3FD9 A;  3ILK A;  5ITU A;  1WIV A;  1VDD A;  2UUC M;  1KYI A;  2F4V M;  2CWB A;  3RGS A;  1N33 M;  2JY7 A;  3E21 A;  4DV0 M;  1TTE A;  3MV4 M;  3AJI B;  4IBB A;  1XC8 A;  1HNX M;  2CHV A;  3PCN A;  2JWS A;  3UK6 A;  5A2Q S;  2JXN A;  2BUM A;  3AL0 C;  3PCD M;  4AKH A;  5KPZ A;  1EOA B;  1E9S A;  1Z5C A;  1SXJ A;  1OIP A;  4I8O A;  4DV5 M;  4QHS A;  2F5O A;  1EOC A;  2ZAO A;  5EP1 A;  4TUW A;  2JP7 A;  1PJT A;  2X49 A;  4XK8 F;  3OTO M;  3O32 A;  1NSF A;  1QZM A;  2KA6 B;  1G71 A;  3GPU A;  2LVQ D; 
#chains in the Genus database with same CATH homology
 5KPR A;  3GO8 A;  5LMN M;  2KRK A;  1H6U A;  1DGH A;  5FTL A;  4LF6 M;  4GRI A;  3R9X B;  3E4R A;  7CAT A;  3LXV A;  4L16 A;  1XMQ M;  3K1J A;  2G5G X;  4REZ A;  4RNA A;  3PCH A;  3GQ5 A;  1G41 A;  4G4N A;  4WHP B;  3HU1 A;  4LJA A;  2BUV B;  1Z6T A;  4B08 A;  4Z6Y A;  4KLN A;  4CHT B;  2HHH M;  1N78 A;  4FW9 A;  4NRV A;  3TWL A;  4JI5 M;  1J5E M;  4AW4 A;  1IN8 A;  4GHA A;  1G8P A;  3I4V A;  4B3S M;  2UUA M;  2XGN A;  3SMP A;  3TWM A;  4KO8 A;  4B7H A;  1DGB A;  2BUY B;  4QNR A;  3LKT M;  2UU9 M;  3ZH9 B;  3MI1 A;  1GKI A;  4DUY M;  3L26 A;  2CE7 A;  3D8L A;  1HQC A;  2C9C A;  2F5S A;  4LF8 M;  1R2Y A;  1HNZ M;  1N36 M;  4XGI A;  2XZU A;  3U6Q A;  1EOB A;  5EP3 A;  2BUR A;  1N77 A;  3A46 A;  3HHX A;  1SXJ E;  1PJI A;  1IXZ A;  3GLF A;  2I7N A;  2XSV A;  1E32 A;  5JI3 E;  4K0K M;  2ZAM A;  2E5L M;  1GLN A;  2BUW B;  4GIP A;  1XNQ M;  4X66 M;  1IQP A;  3L28 A;  4JYA M;  1EO2 B;  5IWA M;  5ITQ A;  2D7H A;  1DO0 A;  4B3M M;  3AOE A;  5ITX E;  4LF4 M;  2UXD M;  4JI4 M;  1NNU C;  3LVV A;  2CEA A;  4FVM A;  4IBF A;  1IN5 A;  4LJ7 A;  3HJS A;  4L15 A;  3GLH A;  4R7G A;  2XF3 A;  3U6D A;  5IT9 S;  3MFL A;  3MHV C;  2NQ8 C;  1SXJ B;  1XMO M;  1QAN A;  3U60 A;  1L1T A;  1EOC B;  3PCC A;  4LCB A;  3LQQ A;  3PCF A;  3K2L A;  4JV5 M;  1DMH A;  2R45 A;  4WUR A;  3PCA A;  2G8L A;  2LXE A;  4LF7 M;  3FTD A;  1DGH B;  2BJV A;  3CF6 E;  3FYC A;  5EQT A;  3HU3 A;  3KSX A;  3PCJ A;  3WHK A;  2Q2E B;  5LMU M;  2DZO B;  2Y0T A;  4LJ8 A;  3SHF A;  4MH0 E;  2QPA A;  3SAU A;  1XXH A;  2F5Q A;  1Z5B A;  3J2P B;  3PCG M;  1LV7 A;  2L09 A;  1ORY B;  1NY5 A;  3PCL M;  3H4M A;  1QQW A;  5E26 A;  3KVW A;  4PD2 A;  3KP1 E;  5BR8 M;  3VK7 A;  1FJG M;  3ZCB B;  4CIS A;  5KO3 A;  1PJJ A;  2EA0 A;  2JA2 A;  4DR4 M;  4CGY B;  2AHM A;  4WHS D;  3JR5 A;  2QBY A;  5DNY A;  4IBD A;  1TH4 A;  3O6J A;  4QOS A;  4LGY A;  3PFI A;  2KXE A;  2CV2 A;  1D2N A;  2KZS A;  2A5Y B;  1EOB B;  3FTC A;  2BUR B;  2C98 A;  1OFH A;  3GLG A;  3LQR A;  3UGJ A;  2W82 A;  1IBK M;  3GLF B;  4L4U A;  4IBE A;  1TH3 A;  4EIW A;  4NXM M;  1YKM A;  4ILV A;  3QAU A;  3PCI M;  2C99 A;  3IG8 A;  4AG6 A;  3KP0 E;  5FTJ A;  4A3V B;  3B9P A;  4OX9 M;  3T63 A;  2VQF M;  1K3W A;  3SMS A;  4GKK M;  3PCM M;  3J81 S;  3PCB A;  4I5S A;  2DXI A;  4LF5 M;  3GLH B;  4RF0 A;  4LG2 A;  3K92 A;  2X4A A;  4LZJ A;  2K47 A;  3U60 B;  3JR4 A;  1QYR A;  3UMM A;  4LGM A;  4AI6 A;  2LH0 A;  2AZQ A;  1J7K A;  1ZQ9 A;  4ZPX A;  4DV4 M;  3THG A;  4FWD A;  2FOI C;  5C18 A;  4XBO A;  3U6L A;  1IY1 A;  3NWL A;  3AFH A;  2J7O A;  4D82 A;  1DO2 A;  1XXH B;  5ITX A;  3MI5 M;  3FKE A;  4GIT A;  2R4J A;  4II7 A;  3D8B A;  3VKH A;  4MGI E;  1Q3B A;  4IJF A;  3PCK M;  3L2A A;  4B3R M;  3C58 A;  4D81 A;  3TE6 A;  2PCD A;  4M0W A;  4IBJ A;  2OPF A;  5H37 D;  5DYG A;  4GH9 A;  4P16 A;  2BUZ A;  2QBY B;  3PCE M;  1QAM A;  4AQY M;  2OQ4 A;  3FYD A;  5GKN A;  4B3T M;  2EO2 A;  2M5Z A;  3AOE C;  3AV0 A;  5KPT A;  2FNA A;  2LWX A;  4WHO D;  1TH2 A;  4LJ5 A;  4NSR A;  4JI3 M;  2ERC A;  3GRY A;  3GLG B;  3U6E A;  4W5W A;  3MV4 A;  3MJ5 A;  1XNR M;  1Z59 A;  1YKM B;  1QAO A;  1N32 M;  3U6O A;  4I4L A;  3PCD A;  1E9R A;  4AG5 A;  3CTW B;  4G4Q A;  3NBI A;  2R62 A;  2R65 A;  2Y0Q A;  3FUW A;  4DV3 M;  2L7H A;  4MGY E;  4YHH M;  4IBG A;  3VK8 A;  4MM3 B;  2Z3X A;  1R6B X;  4RF1 A;  4FCW A;  3U6P A;  2UXC M;  2VQE M;  4L8R C;  1ZAE A;  2P5T A;  3T67 M;  1MX0 A;  3U61 A;  3TQS A;  5BPV A;  2ZAN A;  3T15 A;  4PDI A;  1K82 A;  4ITQ A;  1NHG C;  4X62 M;  4WHP D;  2D7E A;  4LFB M;  3O5U A;  3PNY A;  1L2B A;  4JI6 M;  3SFZ A;  4NXN M;  3T1H M;  5ITY A;  1L1Z A;  1HNW M;  2C96 A;  4AKG A;  4OU7 A;  2X8A A;  1GL6 A;  1IY2 A;  3VDP A;  2XEP A;  2XZF A;  2FE8 A;  3SBJ A;  4MGK E;  2O5R A;  2L7I A;  4D80 A;  3TPZ A;  3UZU A;  1JR3 D;  3GRU A;  3HGI A;  4LRT A;  3LMX A;  2QP9 X;  1JQJ C;  2H1R A;  4HL4 A;  1R7R A;  3QWL A;  3K8Z A;  3RE8 A;  4B7F A;  3VDU A;  3L27 A;  2EUC A;  2BUT A;  2BUZ B;  2XFT A;  3R8F A;  1YKP A;  2Y20 A;  4IBK A;  3PNV A;  3W0L B;  4LJ6 A;  3HHZ A;  3KOZ E;  4S12 A;  1MU5 A;  1NHW C;  2DWZ B;  3GRR A;  3ZC7 B;  1R2Z A;  5FLX S;  2KEB A;  2DZN B;  1IBL M;  1DGF A;  1NJG A;  1QVR A;  2V1U A;  4YY3 M;  3WHL A;  3DOA A;  1HT1 E;  4AZF A;  2QCU A;  1YKO B;  3PCN M;  3FUX A;  2BNK A;  5FTM A;  4NL4 H;  3GRV A;  2R18 A;  1X37 A;  4LJ4 A;  2LNH C;  5JI2 E;  3KFU G;  3BOS A;  4JI0 M;  3AKZ A;  4JI7 M;  1YKL A;  1SXJ C;  1L2D A;  4IBI A;  1G59 A;  1OJL A;  2RGO A;  2XSU A;  1NY6 A;  2FFJ A;  3KOX E;  3A45 A;  1TDH A;  4M9Z A;  1IXS B;  3LXV M;  3TWK A;  1IY0 A;  4M0D A;  2KZU A;  5EP4 A;  2V6Z M;  3GPP A;  3U61 B;  4LZZ A;  3PCH M;  1EE8 A;  1W5T A;  2DVW B;  2ZBK B;  3KDS E;  1S3S A;  2ZM6 M;  1JR3 A;  4QNM A;  3J7B A;  3GP1 A;  1YUB A;  2L6O A;  2DWL A;  3PCG A;  3KOW E;  4BB9 A;  3CF2 A;  4DV1 M;  3PCL A;  3UJN A;  1WXQ A;  3M7G A;  1DLT A;  3SAR A;  3U6S A;  5KQD A;  1YKK A;  1J09 A;  2BV0 A;  3VFD A;  4JI8 M;  3MI1 M;  4WHS A;  2BJW A;  4PCZ A;  1NJF A;  4OW0 A;  5EXP A;  4IIW A;  3MV6 A;  2KW0 A;  2XSR A;  4WHO B;  4QHT A;  4GC5 A;  1N75 A;  3VLF B;  3SHG B;  4JI1 M;  3KW6 A;  1IM2 A;  4M9S A;  2BUM A;  1I94 M;  2I7P A;  1T3T A;  4JI2 M;  4MGH A;  3I51 A;  4DR5 M;  2BUT B;  3J80 S;  5F3W A;  4FD2 A;  1Q39 A;  1EO9 A;  1YKP B;  4B7G A;  2HKJ A;  3SAT A;  2DHR A;  4FCT A;  1HQY E;  1C1K A;  4DV6 M;  2CFO A;  5DYI A;  3RFW A;  3T38 A;  5C1B A;  4DR2 M;  3PCI A;  1TGU A;  3FUV A;  4LY6 A;  4GKJ M;  4MGZ E;  2CV0 A;  1KFV A;  3VKG A;  3U5Z A;  3SYK A;  1YSY A;  3CF0 A;  3PCM A;  2XSZ D;  3GLI A;  1QAQ A;  1TMX A;  3MFL M;  3J27 B;  4JN6 A;  1YKO A;  3PCC M;  1E94 E;  3TL4 X;  3L25 A;  5IRE B;  4LRS A;  1PM5 A;  4M9X A;  1DLQ A;  1S9A A;  1YKL B;  4WHR A;  2J7N A;  3PCF M;  1HR0 M;  1DLM A;  1KSF X;  3PCA M;  3A42 A;  4MB7 A;  4DUZ M;  1N34 M;  5KQ8 A;  3HJ8 A;  2UXB M;  2Z7J A;  4FCV A;  5FTN A;  5E6J A;  1L8Q A;  4FWH A;  5EXT A;  2R4E A;  3I4Y A;  4DR7 M;  2QZ4 A;  3PCJ M;  3GQ3 A;  4LFA M;  2BUQ A;  3EIE A;  3M6A A;  1IXR C;  2HCB A;  4DR3 M;  2YNM D;  2M60 A;  3KXE C;  1K3X A;  4NRW A;  1W5S A;  3T1Y M;  3M0E A;  2Z4R A;  4JXJ A;  3LMX M;  4WHQ A;  3MI5 A;  5EXS A;  4OVZ A;  2YQZ A;  3E9S A;  2XLJ A;  4DR1 M;  3PVS A;  3GQ4 A;  4AKI A;  3DA1 A;  4KHP M;  1YE9 A;  3HKP A;  1G4A E;  1YKK B;  1FNN A;  1IN6 A;  1NNJ A;  1IN7 A;  1HT2 E;  2VII A;  1L2C A;  2XFS A;  4LFC M;  2BUU A;  2BV0 B;  3PCK A;  4WHS B;  2F5N A;  2C9O A;  4WHR F;  4IBC A;  3U6M A;  4DR6 M;  2BOY A;  5IZ7 D;  4GHL A;  3PCE A;  2XH9 A;  2BUM B;  3HWS A;  4KOD A;  4DV7 M;  3LKT A;  1YKN A;  2D7G A;  4WHO A;  2CHG A;  2QEN A;  2XSZ A;  2DWM A;  2UUB M;  5EP2 A;  3FUT A;  3GPY A;  3JAM S;  3FUU A;  3HJQ A;  4X64 M;  2C5R A;  3N9T A;  3RGP A;  5FSW A;  1I4W A;  3KSJ A;  1Z5A A;  4DV2 M;  1EO9 B;  2YFQ A;  3HHW A;  1EOA A;  4WW0 A;  3J7A S;  3AOG A;  4L78 A;  5EJC A;  2CHQ A;  2Z4S A;  1UM8 A;  3MK6 A;  3T63 M;  3SAS A;  4IJE A;  2DWN A;  3SYL A;  3U5Z B;  3PCB M;  5ITT A;  1IBM M;  1NVM A;  3GLI B;  3A98 B;  4I81 A;  4PT5 A;  3HHY A;  8CAT A;  2CV1 A;  2BUX B;  3T67 A;  4WHR B;  2KRU A;  4NOO B;  4FWG A;  4WHP A;  3TH1 A;  2BUV A;  4G6Z A;  1TDZ A;  2F5P A;  3W0F A;  4LJ9 A;  2RKO A;  1SXJ D;  1XHB A;  3PXG A;  4G4R A;  4NSO B;  2R46 A;  3KOY E;  3MV6 M;  3Q8X A;  4LF9 M;  2BUQ B;  4G4O A;  4PDG A;  1OFI A;  3LMM A;  4BLC A;  2V1C A;  5ITR A;  3SAV A;  3O6R A;  2BUY A;  5TD3 A;  4X65 M;  2Y21 A;  4BBA A;  4Z8X A;  3HU2 A;  4WHQ B;  2RGH A;  3SC3 A;  4QOZ C;  4OVZ B;  1Q3C A;  3IG5 A;  4HLQ A;  4R3D A;  5EXX A;  1IN4 A;  2YR0 A;  3SAW A;  1DGG A;  3EIH A;  3U6C A;  3KS8 A;  1GL7 A;  4GC9 A;  2BUU B;  2PCD M;  3DZD A;  1GVN A;  3GPX A;  3L29 A;  3LVW A;  5FTK A;  3KS4 A;  4GMQ A;  2HL7 A;  3DFZ A;  3FTE A;  2BUW A;  2BUX A;  1XWI A;  1YKN B;  1G3I A;  3FTF A;  4ILT A;  2CUZ A;  1EO2 A;  3FD9 A;  3ILK A;  5ITU A;  1VDD A;  2UUC M;  1KYI A;  2F4V M;  3RGS A;  1N33 M;  4DV0 M;  3MV4 M;  3AJI B;  4IBB A;  1XC8 A;  1HNX M;  2CHV A;  3PCN A;  3UK6 A;  5A2Q S;  3AL0 C;  3PCD M;  4AKH A;  5KPZ A;  1EOA B;  1E9S A;  1Z5C A;  1SXJ A;  4I8O A;  4DV5 M;  1EOC A;  4QHS A;  2F5O A;  2ZAO A;  5EP1 A;  4TUW A;  2X49 A;  3OTO M;  3O32 A;  1NSF A;  1QZM A;  2KA6 B;  3GPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...