3HHXA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhxA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhxA02
1YKNB 2BUQB 3PCFM 3MI1M 3PCMA 2BUVB 4WHOD 3PCJA 3MV6A 2BOYA 3PCNM 3HJ8A 2BUYB 4WHQA 3O6JA 4WHSD 2BUXA 4WHRF 3HJSA 1YKPA 3PCGM 3MI5A 4WHOB 2BUMA 1YKMA 3N9TA 1EO9B 1YKLA 2BV0B 3PCAA 1DMHA 4WHPB 2XSRA 3HHYA 1YKKA 2BUWA 3HHXA 3MFLA 3PCCM 1EOCB 2BUUA 3LMXM 1YKNA 2BUQA 2BURB 3PCBM 1DLMA 3PCLA 3MV4A 3PCDM 1EO2B 3PCEM 1DLQA 4WHRB 4WHPD 3T67M 2BUZA 2BUTA 3O5UA 3PCGA 3PCKM 3PCHM 1EOAB 3I51A 2PCDA 4WHOA 4ILTA 3LKTM 3PCIA 2AZQA 3PCAM 3T63M 3PCMM 3LXVA 3PCJM 4WHSA 3MV6M 3PCFA 3MI1A 3I4YA 3O6RA 4WHQB 2BUVA 1EOBB 2BUXB 1YKPB 3TH1A 3PCNA 2XSVA 3HKPA 1S9AA 1YKMB 3MI5M 2BUYA 4WHRA 1YKLB 3I4VA 1TMXA 1EOAA 1YKKB 1YKOB 1EO9A 3MFLM 2BUUB 2BV0A 5TD3A 4WHPA 3O32A 3PCCA 4ILVA 3HJQA 3LMXA 1EOCA 3PCLM 3MV4M 2BUZB 3PCBA 2BURA 2BUTB 3HGIA 1EOBA 3PCDA 3PCEA 2BUMB 1EO2A 3T67A 2PCDM 1DLTA 3PCIM 3PCKA 3PCHA 2XSUA 2BUWB 3LKTA 4WHSB 3LXVM 1YKOA 3T63A
chains in the Genus database with same CATH superfamily
1NHWC 4NL4H 3GO8A 1KFVA 2BUQB 2ZTCA 2LBCA 4DR2M 1CUKA 2RRUA 1XMQM 1PJQA 4DUZM 4OW0A 2BOYA 4PT5A 1TDZA 4W5WA 1Z6TA 4R7GA 4DV3M 5KPZA 3FUVA 2F5PA 1T6OA 4IBEA 1DGHA 1WXQA 2JWSA 1HQCA 1N75A 1NJGA 3HJSA 3SAWA 3MI5A 2DENA 5KPTA 5DFLA 3NBIA 3KSXA 3N9TA 4RF1A 3RE8A 3EIHA 1QDTA 1XXHB 5FLXS 3SATA 3GLHB 2MJ5B 3KOWE 2JY8A 2KDLA 2XSZD 4JXJA 4M0DA 1DMHA 1V33A 3U5ZA 4WHPB 1PJTA 2KRKA 2LVOC 3HHYA 3VK7A 3KVWA 2D7GA 2WSEF 1G71A 2QSFX 3TWLA 4NSOB 1MN3A 1Q3BA 4FW9A 4NRVA 3THGA 2Q2EB 3MJ5A 2KNVA 4JYAM 2DZNB 3GQ5A 3SARA 1YKNA 3M0EA 1OKSA 1KYIA 3PCBM 4M9ZA 3BXWA 4IJFA 2G5GX 3CTWB 3A98B 4QNMA 3SC3A 4BBAA 3GLGA 2RGOA 3PCEM 1EO2B 3A46A 1P3QQ 4AG5A 4WHPD 1XHBA 2KRUA 5KQ8A 5JI2E 3VK8A 2BUTA 2BUZA 4LRTA 2YQZA 4MGKE 3W67A 3GP1A 2F5OA 1IN4A 3PCHM 3I51A 3W0FA 4XBOA 3HWSA 1NNJA 1G41A 1WIVA 3V76A 3PCIA 1QAQA 2L7IA 4L8RC 4I8OA 1NV8A 1QZEA 1NNUC 3JR5A 1DGBA 4LF8M 2HCBA 4LCBA 1L2DA 2F5NA 1OIZA 3GLFA 1IY2A 3HU3A 3L28A 3SMPA 3GPUA 1IN5A 5GKNA 2UXBM 2OQ4A 2R0IA 3MV6M 3GPPA 2Y0TA 1Y8GA 2OO9A 1UFZA 3B7QA 4LJ4A 4LJAA 2XZUA 1FJGM 2D7EA 3TQSA 4WHQB 4Z6YA 4BB9A 1ZMVA 4DV5M 1YKPB 2JUJA 3K1JA 3PCNA 2R18A 2XSZA 1A5TA 1GLNA 4D80A 4DR3M 4S12A 1L2BA 1IY1A 2Y20A 2QBYB 4WHRA 5ITQA 4PDIA 1HR0M 5EXSA 1IBMM 5EXXA 1YKLB 4G4RA 3LCUA 3JAMS 1D2NA 4R3DA 4WURA 2MGWA 3GRRA 1W5TA 5ITUA 1EOAA 1DGFA 2FNAA 1YKKB 3GLGE 1TH4A 1ZMUA 2WZJA 3C3EA 1TMXA 1XXHA 3MFLM 3GLHA 4IIWA 3VLFB 1IBLM 4AI6A 2M60A 2BUUB 3BBZA 1TDHA 2XLJA 4F1IA 4MH0E 4WHPA 4DR5M 1X37A 4LF6M 3HU2A 3PCCA 2HAKA 3KSJA 5EP2A 2CE7A 2CHGA 2LHGA 3AV0A 3WHLA 3U6MA 1Z59A 1NSFA 2VDBB 3CF0A 4IBBA 4AKHA 2EA0A 3MV4M 4GRIA 1DO2A 1DGHB 3K8ZA 1KSFX 4P17A 2NQ8C 5IREB 3UZUA 3KP0E 3GLFE 1QAMA 3PNYA 1XC8A 1NY5A 1GABA 3TPZA 2KNZA 2XH9A 4D81A 4DV0M 2CEAA 3PCDA 1K82A 1EO2A 4AG6A 2PCDM 3B9PA 1Q3CA 3KW6A 2DWMA 2ZTDA 2VQFM 2W82A 4GKJM 2OOAA 1OIPA 2YR0A 4LJ9A 3L2AA 3LCVB 2P5TA 1L1ZA 4QNRA 4IBDA 2XSUA 1ZMWA 2K9DA 2X49A 2R4JA 4CGYB 2C9CA 3LXVM 1E94E 2BWBA 4KODA 1V92A 3NBXX 3VKGA 1YKOA 3OTOM 3PCAA 3T63A 2EUCA 1YKNB 3PCFM 4L15A 3PCMA 2BUVB 2KZSA 4QOSA 4OX9M 3SBJA 2K0BX 5KO3A 3PCJA 1YSYA 3RFWA 3C58A 2X4AA 2JZ1A 2DZOB 1IN7A 2BUYB 2ZAOA 4L4UA 4LZZA 1XXHE 1H6UA 2K47A 3GLHE 3H4JA 4WW0A 3T1YM 4WHQA 1R7RA 4NRWA 3FUWA 2VF8A 2DHYA 3BOSA 5EP3A 3SYKA 4DR1M 1YKPA 3K2LA 1GJSA 4I81A 4MB7A 3VDUA 4DV7M 2BUMA 3CF6E 4FWHA 4KLNA 2I7NA 2QBYA 1EO9B 3E46A 4B3SM 3FTEA 1YKLA 3KOZE 4B7FA 4KT0F 3SFZA 2YNMD 1Z5CA 4FCVA 3U6DA 1YKKA 7CATA 2JY7A 3HHXA 2QZ4A 4LY6A 1EOCB 4FVMA 1R2ZA 1QZMA 2QENA 2BUUA 1LV7A 3LMXM 3E9SA 4BLCA 1ZAEA 4B3RM 3T15A 5LMUM 3PVSA 5EXPA 4I4LA 1DLMA 1C1KA 3DOAA 4L6V6 4WHRB 2HL7A 3U6CA 4GKKM 2BJWA 4LF9M 3T67M 5F3WA 1Z5AA 3O5UA 3SASA 2RGHA 1DV0A 3L27A 3PCKM 3KXEC 4L78A 1K3WA 1EOAB 1D0LA 5IWAM 2Y21A 2KA6B 2MROB 4ILTA 3HX3A 3L29A 3LW5F 2AZQA 1GL7A 1VDLA 2JA2A 1T3TA 3IECA 4EIWA 3MK6A 3U6SA 4G6ZA 2UXDM 1AUAA 3GQ4A 2UU9M 2WSFF 3U61B 1EFUB 1VDDA 1FNNA 3U6EA 4AKGA 3B7NA 1TGUA 1QDRA 1OFIA 1WJ7A 1LTMA 3MMPA 2V6ZM 3GQ3A 4B08A 2BUVA 1WGNA 2EKFA 2QQ8A 2XF3A 3J80S 4JI3M 5KPRA 5DNYA 3U6QA 2LVQD 2BUXB 2R44A 2XSVA 3HKPA 3NWLA 1QUTA 4Q7JA 3L25A 1E32A 1JB0F 1HQYE 4A3VB 3A42A 4L16A 3W68A 2BUYA 1SXJC 1IY0A 2V1UA 1TH2A 3IG8A 2APLA 4LF7M 1AIPC 2ZANA 4G4OA 4LG2A 3R9XB 4G4QA 1NV9A 3RGPA 1QUSA 2AHMA 2CHVA 1YE9A 3M6AA 3WHKA 4X64M 3J81S 1PJJA 1YKOB 1EO9A 1W5SA 3J7BA 2H5XA 3F92A 4QOZC 5TD3A 1VG5A 4HL4A 4IBFA 2JXNA 5FTLA 1K3XA 5ITYA 1J7KA 3O32A 3HY5A 1DO0A 2OPFA 2Z4RA 4Y28F 1R2YA 4JI4M 4LF4M 1EOCA 3PCLM 3FE3A 4KHPM 4ZPXA 3SMSA 4PCZA 3C9PA 3J2PB 3QYEA 3PCBA 3HGIA 3SHGB 8CATA 5DYIA 1EOBA 2LH0A 4OVZB 2C99A 2JP7A 2X8AA 3E4RA 3K92A 2BUMB 1IXRC 1SG9A 2BNKA 3PCEA 2KZUA 3GRYA 2D7HA 3TE6A 3LQRA 2FE8A 3T1HM 3KS4A 4RNAA 1D0MA 3PCHA 3QWLA 2LNHC 4CHTB 5C18A 4IBGA 1L8QA 2DXIA 5LMNM 2C98A 3E21A 5EP1A 3ZQJA 4WHSB 1WGLA 2UUBM 2KW0A 4IBJA 2ERCA 2JZ0A 2Z7JA 3U6PA 2XZFA 3MI1M 4CIZA 2Z8YM 3AJIB 4I5SA 4LRSA 2F5QA 2E5LM 4WHOD 1N77A 3KOYE 4B3TM 4OU7A 4AKIA 5ITTA 2CFOA 3MV6A 3IHPA 4GEWA 1G59A 4LGYA 3U61A 4M9XA 2QNJA 4GITA 3SYLA 1GJTA 1I4WA 3AOGA 3B89A 3LVWA 4YHHM 1TR8A 1XNQM 2C9OA 3J7AS 2BUXA 4RF0A 4WHSD 4WHRF 3FTFA 1NO1A 2MR9A 2O01F 3GRUA 1R6BX 2H1RA 3CF2A 4R71A 2XEPA 5E26A 4MGYE 4KO8A 2DWLA 2QCUA 3EIEA 2BV0B 2LVPC 4G4NA 1XB2B 1ZQ9A 4HEOA 2L7HA 1QVRA 1E9SA 2LXEA 5C1BA 3MFLA 3D8LA 1HT2E 1J5EM 2I7PA 2M5ZA 2GNOA 3QYBA 1XWIA 4GH9A 3LMMA 1JR3D 3LQQA 3HHZA 3U60B 4NOOB 3SAVA 2QHOB 1Z5BA 2KEBA 4MGZE 4LFAM 3LVVA 5KQDA 4GHLA 1N78A 3MV4A 1VEKA 3AKZA 1NJFA 4B7HA 3IG5A 3VDPA 3FD9A 1IXSB 1N36M 4CJ6A 2R65A 5BR8M 4OVZA 2CV2A 1RU3A 4JI6M 2PCDA 4FCWA 4WHOA 1OAOC 3FRIA 4JN6A 2CV0A 2UUAM 4FWDA 1HNXM 3LKTM 1EIJA 2DAKA 1IBKM 3Q8GA 1G4AE 1XMOM 5BPVA 4FWGA 1PM5A 3LXVA 4NC6A 3T38A 5IT9S 4WHSA 2J7NA 3D8BA 1N32M 3PCFA 3AOEC 2DI0A 3I4YA 4NSRA 4XK8F 2MH8A 2LTUA 2K6BA 4B3MM 2ZAMA 1HNZM 3O6RA 4GMQA 3PNVA 1EOBB 1QQWA 4G3OA 3TH1A 3GPYA 3FUXA 4B7GA 3GLIB 4DV1M 1YKMB 4JV5M 3MI5M 2QPAA 1TF0B 2GQFA 1TH3A 1ZV1A 4MM3B 3I4VA 4IBCA 4X66M 3KS8A 2ZM6M 4P16A 1G3IA 2CP8A 1PJIA 3FKEA 1JR3A 3TWMA 2JY5A 4X65M 2F4VM 1SXJB 3DA1A 2BV0A 2G8LA 4Z8XA 3A45A 1E9RA 1OQYA 2KXEA 4LFBM 2R62A 3FTCA 1HT1E 2HWJA 5ITXA 3TL4X 2DZLA 2L4EA 2F5SA 1R4GA 1IN8A 3B74A 3HJQA 3LMXA 1C7YA 1BVSA 2FOIC 3UJNA 1GKIA 4DUYM 1IN6A 4PD2A 3U60A 3I01M 1IFYA 3T6PA 2Z4SA 1SXJD 4DR7M 3T67A 3ZCBB 3UGJA 1DLTA 3PCIM 2J7OA 5FTKA 3DZDA 3AOEA 2EJSA 5L8RF 1IXSA 1N34M 3PCKA 2DAGA 4XGIA 4GHAA 5ITRA 4JI7M 1QANA 3PXGA 2C5RA 1L1TA 4II7A 4DV6M 4UN2B 2DWNA 2XGNA 3JR4A 2VF7A 3FUTA 4LZJA 1Q39A 1QYRA 1HJPA 1VEGA 3FTDA 3PCNM 4QHSA 3HJ8A 1JR3E 2L2DA 3PFIA 1N33M 2BJVA 4JI2M 1J09A 4LJ5A 2CV1A 4ANRA 3SAUA 3O6JA 4AW4A 2DAMA 1GO5A 2DAIA 2LVAA 2OOBA 2EKKA 4AZFA 3PCGM 3K9OA 4WHOB 3GLIA 2FH0A 2DNAA 1YKMA 4HLQA 3HHWA 5ITXE 1NVMA 3W0LB 1I94M 3KFUG 1OJLA 1YUBA 4NXMM 1VEJA 1PGYA 3VKHA 1JQJC 2CHQA 2FFJA 4LJ8A 2XSRA 4LGMA 1MJGM 5EP4A 2R4EA 4DR4M 5EQTA 2BUWA 4GIPA 4QHTA 4JI5M 1ORYB 1Q02A 3FYCA 3PCCM 4DV2M 4LJ7A 1L2CA 2KNAA 2CWBA 2O25A 3ZC7B 2XFSA 3CGWA 3FUUA 1SXJA 2XFTA 5JI3E 2BUQA 2BURB 1S3SA 5IZ7D 2WSCF 1QAOA 1R5LA 5EJCA 4F2LA 4CISA 3PCLA 4RKUF 1PJSA 3U6LA 2R46A 3PCDM 1DLQA 4AQYM 2O5RA 4REZA 4FD2A 1UM8A 1IM2A 4ITQA 3PCGA 1YLAA 4GC9A 1DGGA 1GL6A 3B7ZA 2LHCA 4MGHA 3RGSA 3TWKA 3H4MA 1OTRA 3PCAM 3T63M 4X62M 2DVWB 2UXCM 5DYGA 2R6FA 2L09A 3FYDA 3HZJA 3GPXA 3PCMM 2L4FA 4TUWA 4IJEA 3QAUA 4JI8M 3PCJM 2N35A 3C3DA 4IBKA 3GLIE 1F4IA 1GVNA 3KOXE 3MI1A 3AL0C 1OFHA 2DAEA 1G8PA 3L26A 1D0KA 2CUZA 3ILKA 3I04M 1OAIA 3MHVC 2LWXA 3R8FA 4JI1M 3HU1A 1IQPA 3VFDA 5E6JA 1XNRM 1IXZA 1S9AA 2G3QA 1MU5A 1EE8A 2J5YA 3SHFA 2HKJA 4JI0M 2A5YB 1SXJE 3K9PA 3U5ZB 2RKOA 2JNHA 4GC5A 3AFHA 5FSWA 4DV4M 2C96A 3M7GA 1NHGC 4DR6M 4NXNM 2VQEM 2EO2A 2R45A 3DFZA 2YFQA 2JY6B 2LVNC 1MX0A 2KHHA 2DHRA 1PRBA 1WR1B 3GRVA 4WP2A 2B3TA 5FTNA 3UK6A 3KP1E 2DWZB 4FCTA 4MGIE 2Y0QA 3GLGB 5H37D 4IBIA 5FTMA 4ILVA 1TTEA 2ZBKB 4M9SA 2HHHM 4YY3M 4PDGA 2Z3XA 3U6OA 4LF5M 2BUTB 2BURA 2BUZB 1V34A 4D82A 2V1CA 5A2QS 3J27B 3Q8XA 1HNWM 5EXTA 1NY6A 2VIIA 4M0WA 3KDSE 1T43A 1WHCA 1VQ1A 2L6OA 2BWEA 2QP9X 4LFCM 5FTJA 2UUCM 4K0KM 3GLFB 2DKLA 4LJ6A 2BUWB 3UMMA 3LKTA 4DBGB 2CRUA 3FRHA 3ZH9B 2FS1A
chains in the Genus database with same CATH topology
1NHWC 4NL4H 3GO8A 1KFVA 2BUQB 4DR2M 1XMQM 4DUZM 4OW0A 2BOYA 4PT5A 1TDZA 4W5WA 1Z6TA 4R7GA 4DV3M 5KPZA 3FUVA 2F5PA 4IBEA 1DGHA 1WXQA 3SAWA 1HQCA 1N75A 1NJGA 3HJSA 3MI5A 5KPTA 3NBIA 3KSXA 3N9TA 4RF1A 3RE8A 3EIHA 1XXHB 5FLXS 3SATA 3GLHB 3KOWE 4JXJA 2XSZD 4M0DA 1DMHA 3U5ZA 4WHPB 3HHYA 2KRKA 3VK7A 3KVWA 2D7GA 3TWLA 4NSOB 1Q3BA 4FW9A 4NRVA 3THGA 2Q2EB 3MJ5A 4JYAM 2DZNB 3GQ5A 3SARA 1YKNA 3M0EA 1KYIA 3PCBM 4M9ZA 4IJFA 2G5GX 3CTWB 3A98B 4QNMA 3SC3A 4BBAA 3GLGA 2RGOA 3PCEM 1EO2B 3A46A 4AG5A 4WHPD 1XHBA 2KRUA 5KQ8A 5JI2E 3VK8A 2BUTA 2BUZA 4LRTA 2YQZA 4MGKE 3GP1A 2F5OA 1IN4A 3PCHM 3I51A 3W0FA 4XBOA 3HWSA 1NNJA 1G41A 3PCIA 1QAQA 2L7IA 4L8RC 4I8OA 1NNUC 3JR5A 1DGBA 4LF8M 2HCBA 4LCBA 1L2DA 2F5NA 3GLFA 1IY2A 3HU3A 3L28A 3SMPA 3GPUA 1IN5A 5GKNA 2UXBM 2OQ4A 3MV6M 3GPPA 2Y0TA 4LJ4A 4LJAA 2XZUA 1FJGM 2D7EA 3TQSA 4WHQB 4Z6YA 4BB9A 4DV5M 1YKPB 3K1JA 3PCNA 2R18A 2XSZA 4D80A 1GLNA 4DR3M 4S12A 1L2BA 1IY1A 2Y20A 2QBYB 4WHRA 5ITQA 4PDIA 1HR0M 5EXSA 1IBMM 5EXXA 1YKLB 4G4RA 3JAMS 1D2NA 4R3DA 4WURA 3GRRA 1W5TA 5ITUA 1EOAA 1DGFA 2FNAA 1YKKB 1TH4A 1XXHA 3MFLM 3GLHA 4IIWA 3VLFB 1IBLM 4AI6A 2M60A 2BUUB 1TDHA 2XLJA 4MH0E 4WHPA 4DR5M 1X37A 4LF6M 3HU2A 3PCCA 3KSJA 5EP2A 2CE7A 2CHGA 3AV0A 3WHLA 3U6MA 1Z59A 1NSFA 4IBBA 3CF0A 4AKHA 3MV4M 2EA0A 4GRIA 1DO2A 1DGHB 3K8ZA 1KSFX 5IREB 2NQ8C 3UZUA 1XC8A 3KP0E 1QAMA 3PNYA 1NY5A 3TPZA 4D81A 2XH9A 3PCDA 4DV0M 2CEAA 1K82A 1EO2A 4AG6A 2PCDM 3B9PA 1Q3CA 3KW6A 2DWMA 2VQFM 2W82A 4GKJM 2YR0A 4LJ9A 3L2AA 2P5TA 1L1ZA 4QNRA 4IBDA 2XSUA 2X49A 2R4JA 4CGYB 2C9CA 3LXVM 1E94E 4KODA 1YKOA 3PCAA 3VKGA 3T63A 3OTOM 2EUCA 1YKNB 3PCFM 4L15A 3PCMA 2BUVB 2KZSA 4QOSA 4OX9M 3SBJA 5KO3A 3PCJA 1YSYA 3RFWA 3C58A 2X4AA 2DZOB 1IN7A 2BUYB 2ZAOA 4L4UA 4LZZA 1H6UA 2K47A 4WW0A 3T1YM 4WHQA 1R7RA 4NRWA 3FUWA 3SYKA 3BOSA 5EP3A 1YKPA 4DR1M 3K2LA 4I81A 4MB7A 3VDUA 4DV7M 2BUMA 3CF6E 4FWHA 4KLNA 2I7NA 2QBYA 1EO9B 4B3SM 3FTEA 1YKLA 3KOZE 4B7FA 3SFZA 2YNMD 1Z5CA 4FCVA 3U6DA 1YKKA 7CATA 3HHXA 4LY6A 2QZ4A 1EOCB 4FVMA 1R2ZA 1QZMA 2QENA 2BUUA 1LV7A 3LMXM 3E9SA 4BLCA 1ZAEA 4B3RM 3T15A 5LMUM 3PVSA 5EXPA 4I4LA 1DLMA 1C1KA 3DOAA 4WHRB 2HL7A 3U6CA 4GKKM 2BJWA 4LF9M 3T67M 5F3WA 1Z5AA 3O5UA 3SASA 2RGHA 3L27A 3PCKM 3KXEC 4L78A 1K3WA 1EOAB 5IWAM 2Y21A 2KA6B 4ILTA 3L29A 2AZQA 1GL7A 2JA2A 1T3TA 4EIWA 3MK6A 3U6SA 4G6ZA 2UXDM 3GQ4A 2UU9M 3U61B 1VDDA 1FNNA 3U6EA 4AKGA 1TGUA 1OFIA 2V6ZM 3GQ3A 4B08A 2BUVA 3J80S 4JI3M 3U6QA 2XF3A 5KPRA 5DNYA 2BUXB 2XSVA 3HKPA 3NWLA 3L25A 1E32A 1HQYE 2BUYA 4A3VB 3A42A 4L16A 1SXJC 1IY0A 2V1UA 1TH2A 3IG8A 4LF7M 2ZANA 4G4OA 4LG2A 3R9XB 4G4QA 3RGPA 1TMXA 2AHMA 2CHVA 3M6AA 1YE9A 3WHKA 4X64M 3J81S 1PJJA 1YKOB 1EO9A 1W5SA 3J7BA 4QOZC 5TD3A 4IBFA 4HL4A 5FTLA 1K3XA 5ITYA 1J7KA 3O32A 1DO0A 2OPFA 2Z4RA 1R2YA 4JI4M 4LF4M 1EOCA 3PCLM 4KHPM 4ZPXA 3SMSA 4PCZA 3PCBA 3J2PB 3HGIA 3SHGB 8CATA 5DYIA 1EOBA 2LH0A 4OVZB 2C99A 2X8AA 3E4RA 3K92A 2BUMB 3PCEA 1IXRC 2BNKA 2KZUA 3GRYA 2D7HA 3TE6A 3LQRA 2FE8A 3T1HM 3KS4A 4RNAA 3PCHA 3QWLA 2LNHC 4CHTB 5C18A 4IBGA 1L8QA 2DXIA 5LMNM 2C98A 4WHSB 5EP1A 2UUBM 2KW0A 4IBJA 2Z7JA 2ERCA 3U6PA 2XZFA 3MI1M 4I5SA 3AJIB 4LRSA 2F5QA 2E5LM 4WHOD 1N77A 3KOYE 4B3TM 4OU7A 4AKIA 5ITTA 2CFOA 3MV6A 1G59A 4LGYA 3U61A 4M9XA 3SYLA 4GITA 1I4WA 3AOGA 3LVWA 4YHHM 1XNQM 2C9OA 3J7AS 2BUXA 4RF0A 4WHSD 4WHRF 3FTFA 3GRUA 1R6BX 2H1RA 3CF2A 2XEPA 5E26A 4MGYE 4KO8A 2DWLA 2QCUA 3EIEA 2BV0B 4G4NA 1ZQ9A 2L7HA 1QVRA 1E9SA 2LXEA 5C1BA 3MFLA 3D8LA 1HT2E 1J5EM 2I7PA 2M5ZA 1XWIA 4GH9A 3LMMA 1JR3D 3LQQA 3HHZA 3U60B 4NOOB 3SAVA 1Z5BA 2KEBA 4MGZE 4LFAM 3LVVA 5KQDA 4GHLA 1N78A 3MV4A 3AKZA 1NJFA 4B7HA 3IG5A 3VDPA 3FD9A 1IXSB 1N36M 2R65A 5BR8M 4OVZA 2CV2A 4JI6M 2PCDA 4FCWA 4WHOA 4JN6A 2CV0A 2UUAM 3LKTM 4FWDA 1HNXM 1IBKM 1G4AE 1XMOM 5BPVA 4FWGA 1PM5A 3LXVA 3T38A 5IT9S 4WHSA 2J7NA 3D8BA 1N32M 3PCFA 3AOEC 4NSRA 3I4YA 3O6RA 4B3MM 2ZAMA 1HNZM 4GMQA 3PNVA 1EOBB 1QQWA 3TH1A 3GPYA 3FUXA 4B7GA 3GLIB 4DV1M 1YKMB 4JV5M 3MI5M 2QPAA 1TH3A 4MM3B 3I4VA 4IBCA 4X66M 3KS8A 2ZM6M 4P16A 1G3IA 1PJIA 3FKEA 1JR3A 3TWMA 2BV0A 4X65M 2F4VM 1SXJB 3DA1A 2G8LA 4Z8XA 3A45A 1E9RA 2KXEA 4LFBM 2R62A 3FTCA 1HT1E 2F5SA 5ITXA 3TL4X 3HJQA 1IN8A 3LMXA 2FOIC 3UJNA 1GKIA 4DUYM 1IN6A 4PD2A 3U60A 2Z4SA 1SXJD 4DR7M 3T67A 3ZCBB 3UGJA 1DLTA 3PCIM 2J7OA 5FTKA 3DZDA 3AOEA 3PCKA 1N34M 4XGIA 4GHAA 5ITRA 4JI7M 1QANA 3PXGA 2C5RA 1L1TA 4II7A 4DV6M 2DWNA 2XGNA 3JR4A 4LZJA 3FUTA 1Q39A 1QYRA 3FTDA 3PCNM 4QHSA 3HJ8A 1N33M 3PFIA 2BJVA 4JI2M 1J09A 4LJ5A 2CV1A 3SAUA 3O6JA 4AW4A 3PCGM 4AZFA 4WHOB 3GLIA 1YKMA 4HLQA 3HHWA 5ITXE 1NVMA 3W0LB 1I94M 3KFUG 1OJLA 1YUBA 4NXMM 3VKHA 1JQJC 2CHQA 2FFJA 4LJ8A 2XSRA 4LGMA 5EP4A 2R4EA 4DR4M 5EQTA 2BUWA 4GIPA 4QHTA 4JI5M 1ORYB 3FYCA 3PCCM 4DV2M 4LJ7A 1L2CA 3ZC7B 2XFSA 3FUUA 2BUQA 1SXJA 2XFTA 5JI3E 2BURB 1S3SA 5IZ7D 1QAOA 5EJCA 4CISA 3PCLA 3U6LA 3PCDM 2R46A 1DLQA 4AQYM 2O5RA 4REZA 4FD2A 1UM8A 1IM2A 4ITQA 3PCGA 4GC9A 4MGHA 1DGGA 1GL6A 3RGSA 3TWKA 3H4MA 3PCAM 3T63M 4X62M 2DVWB 2UXCM 5DYGA 2L09A 3FYDA 3GPXA 3PCMM 4TUWA 4IJEA 3QAUA 4JI8M 3PCJM 4IBKA 1GVNA 3KOXE 3MI1A 3AL0C 1OFHA 1G8PA 3L26A 2CUZA 3ILKA 3MHVC 2LWXA 3R8FA 4JI1M 3HU1A 1IQPA 3VFDA 5E6JA 1XNRM 1IXZA 1S9AA 1MU5A 1EE8A 3SHFA 2HKJA 4JI0M 2A5YB 1SXJE 3U5ZB 2RKOA 4GC5A 3AFHA 5FSWA 4DV4M 2C96A 3M7GA 1NHGC 4DR6M 4NXNM 2VQEM 2EO2A 2R45A 3DFZA 2YFQA 1MX0A 2DHRA 3GRVA 5FTNA 3UK6A 3KP1E 2DWZB 4FCTA 4MGIE 2Y0QA 3GLGB 5H37D 4IBIA 5FTMA 4ILVA 2ZBKB 4M9SA 2HHHM 4YY3M 4PDGA 2Z3XA 3U6OA 4LF5M 2BUTB 2BURA 2BUZB 4D82A 2V1CA 5A2QS 3J27B 3Q8XA 1HNWM 5EXTA 1NY6A 2VIIA 4M0WA 3KDSE 2QP9X 2L6OA 4LFCM 5FTJA 2UUCM 4K0KM 3GLFB 4LJ6A 2BUWB 3UMMA 3LKTA 3ZH9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKN B;  2BUQ B;  3PCF M;  3MI1 M;  3PCM A;  2BUV B;  4WHO D;  3PCJ A;  3MV6 A;  2BOY A;  3PCN M;  3HJ8 A;  2BUY B;  4WHQ A;  3O6J A;  4WHS D;  2BUX A;  4WHR F;  3HJS A;  1YKP A;  3PCG M;  3MI5 A;  4WHO B;  2BUM A;  1YKM A;  3N9T A;  1EO9 B;  1YKL A;  2BV0 B;  3PCA A;  1DMH A;  4WHP B;  2XSR A;  3HHY A;  1YKK A;  2BUW A;  3HHX A;  3MFL A;  3PCC M;  1EOC B;  2BUU A;  3LMX M;  1YKN A;  2BUQ A;  2BUR B;  3PCB M;  1DLM A;  3PCL A;  3MV4 A;  3PCD M;  1EO2 B;  3PCE M;  1DLQ A;  4WHR B;  4WHP D;  3T67 M;  2BUZ A;  2BUT A;  3O5U A;  3PCG A;  3PCK M;  3PCH M;  1EOA B;  3I51 A;  2PCD A;  4WHO A;  4ILT A;  3LKT M;  3PCI A;  2AZQ A;  3PCA M;  3T63 M;  3PCM M;  3LXV A;  3PCJ M;  4WHS A;  3MV6 M;  3PCF A;  3MI1 A;  3I4Y A;  3O6R A;  4WHQ B;  2BUV A;  1EOB B;  2BUX B;  1YKP B;  3TH1 A;  3PCN A;  2XSV A;  3HKP A;  1S9A A;  1YKM B;  3MI5 M;  2BUY A;  4WHR A;  1YKL B;  3I4V A;  1TMX A;  1EOA A;  1YKK B;  1YKO B;  1EO9 A;  3MFL M;  2BUU B;  2BV0 A;  5TD3 A;  4WHP A;  3O32 A;  3PCC A;  4ILV A;  3HJQ A;  3LMX A;  1EOC A;  3PCL M;  3MV4 M;  2BUZ B;  3PCB A;  2BUR A;  2BUT B;  3HGI A;  1EOB A;  3PCD A;  3PCE A;  2BUM B;  1EO2 A;  3T67 A;  2PCD M;  1DLT A;  3PCI M;  3PCK A;  3PCH A;  2XSU A;  2BUW B;  3LKT A;  4WHS B;  3LXV M;  1YKO A;  3T63 A; 
#chains in the Genus database with same CATH topology
 1NHW C;  4NL4 H;  3GO8 A;  1KFV A;  2BUQ B;  2ZTC A;  2LBC A;  4DR2 M;  1CUK A;  2RRU A;  1XMQ M;  1PJQ A;  4DUZ M;  4OW0 A;  2BOY A;  4PT5 A;  1TDZ A;  4W5W A;  1Z6T A;  4R7G A;  4DV3 M;  5KPZ A;  3FUV A;  2F5P A;  1T6O A;  4IBE A;  1DGH A;  1WXQ A;  2JWS A;  1HQC A;  1N75 A;  1NJG A;  3HJS A;  3SAW A;  3MI5 A;  2DEN A;  5KPT A;  5DFL A;  3NBI A;  3KSX A;  3N9T A;  4RF1 A;  3RE8 A;  3EIH A;  1QDT A;  1XXH B;  5FLX S;  3SAT A;  3GLH B;  2MJ5 B;  3KOW E;  2JY8 A;  2KDL A;  2XSZ D;  4JXJ A;  4M0D A;  1DMH A;  1V33 A;  3U5Z A;  4WHP B;  1PJT A;  2KRK A;  2LVO C;  3HHY A;  3VK7 A;  3KVW A;  2D7G A;  2WSE F;  1G71 A;  2QSF X;  3TWL A;  4NSO B;  1MN3 A;  1Q3B A;  4FW9 A;  4NRV A;  3THG A;  2Q2E B;  3MJ5 A;  2KNV A;  4JYA M;  2DZN B;  3GQ5 A;  3SAR A;  1YKN A;  3M0E A;  1OKS A;  1KYI A;  3PCB M;  4M9Z A;  3BXW A;  4IJF A;  2G5G X;  3CTW B;  3A98 B;  4QNM A;  3SC3 A;  4BBA A;  3GLG A;  2RGO A;  3PCE M;  1EO2 B;  3A46 A;  1P3Q Q;  4AG5 A;  4WHP D;  1XHB A;  2KRU A;  5KQ8 A;  5JI2 E;  3VK8 A;  2BUT A;  2BUZ A;  4LRT A;  2YQZ A;  4MGK E;  3W67 A;  3GP1 A;  2F5O A;  1IN4 A;  3PCH M;  3I51 A;  3W0F A;  4XBO A;  3HWS A;  1NNJ A;  1G41 A;  1WIV A;  3V76 A;  3PCI A;  1QAQ A;  2L7I A;  4L8R C;  4I8O A;  1NV8 A;  1QZE A;  1NNU C;  3JR5 A;  1DGB A;  4LF8 M;  2HCB A;  4LCB A;  1L2D A;  2F5N A;  1OIZ A;  3GLF A;  1IY2 A;  3HU3 A;  3L28 A;  3SMP A;  3GPU A;  1IN5 A;  5GKN A;  2UXB M;  2OQ4 A;  2R0I A;  3MV6 M;  3GPP A;  2Y0T A;  1Y8G A;  2OO9 A;  1UFZ A;  3B7Q A;  4LJ4 A;  4LJA A;  2XZU A;  1FJG M;  2D7E A;  3TQS A;  4WHQ B;  4Z6Y A;  4BB9 A;  1ZMV A;  4DV5 M;  1YKP B;  2JUJ A;  3K1J A;  3PCN A;  2R18 A;  2XSZ A;  1A5T A;  1GLN A;  4D80 A;  4DR3 M;  4S12 A;  1L2B A;  1IY1 A;  2Y20 A;  2QBY B;  4WHR A;  5ITQ A;  4PDI A;  1HR0 M;  5EXS A;  1IBM M;  5EXX A;  1YKL B;  4G4R A;  3LCU A;  3JAM S;  1D2N A;  4R3D A;  4WUR A;  2MGW A;  3GRR A;  1W5T A;  5ITU A;  1EOA A;  1DGF A;  2FNA A;  1YKK B;  3GLG E;  1TH4 A;  1ZMU A;  2WZJ A;  3C3E A;  1TMX A;  1XXH A;  3MFL M;  3GLH A;  4IIW A;  3VLF B;  1IBL M;  4AI6 A;  2M60 A;  2BUU B;  3BBZ A;  1TDH A;  2XLJ A;  4F1I A;  4MH0 E;  4WHP A;  4DR5 M;  1X37 A;  4LF6 M;  3HU2 A;  3PCC A;  2HAK A;  3KSJ A;  5EP2 A;  2CE7 A;  2CHG A;  2LHG A;  3AV0 A;  3WHL A;  3U6M A;  1Z59 A;  1NSF A;  2VDB B;  3CF0 A;  4IBB A;  4AKH A;  2EA0 A;  3MV4 M;  4GRI A;  1DO2 A;  1DGH B;  3K8Z A;  1KSF X;  4P17 A;  2NQ8 C;  5IRE B;  3UZU A;  3KP0 E;  3GLF E;  1QAM A;  3PNY A;  1XC8 A;  1NY5 A;  1GAB A;  3TPZ A;  2KNZ A;  2XH9 A;  4D81 A;  4DV0 M;  2CEA A;  3PCD A;  1K82 A;  1EO2 A;  4AG6 A;  2PCD M;  3B9P A;  1Q3C A;  3KW6 A;  2DWM A;  2ZTD A;  2VQF M;  2W82 A;  4GKJ M;  2OOA A;  1OIP A;  2YR0 A;  4LJ9 A;  3L2A A;  3LCV B;  2P5T A;  1L1Z A;  4QNR A;  4IBD A;  2XSU A;  1ZMW A;  2K9D A;  2X49 A;  2R4J A;  4CGY B;  2C9C A;  3LXV M;  1E94 E;  2BWB A;  4KOD A;  1V92 A;  3NBX X;  3VKG A;  1YKO A;  3OTO M;  3PCA A;  3T63 A;  2EUC A;  1YKN B;  3PCF M;  4L15 A;  3PCM A;  2BUV B;  2KZS A;  4QOS A;  4OX9 M;  3SBJ A;  2K0B X;  5KO3 A;  3PCJ A;  1YSY A;  3RFW A;  3C58 A;  2X4A A;  2JZ1 A;  2DZO B;  1IN7 A;  2BUY B;  2ZAO A;  4L4U A;  4LZZ A;  1XXH E;  1H6U A;  2K47 A;  3GLH E;  3H4J A;  4WW0 A;  3T1Y M;  4WHQ A;  1R7R A;  4NRW A;  3FUW A;  2VF8 A;  2DHY A;  3BOS A;  5EP3 A;  3SYK A;  4DR1 M;  1YKP A;  3K2L A;  1GJS A;  4I81 A;  4MB7 A;  3VDU A;  4DV7 M;  2BUM A;  3CF6 E;  4FWH A;  4KLN A;  2I7N A;  2QBY A;  1EO9 B;  3E46 A;  4B3S M;  3FTE A;  1YKL A;  3KOZ E;  4B7F A;  4KT0 F;  3SFZ A;  2YNM D;  1Z5C A;  4FCV A;  3U6D A;  1YKK A;  7CAT A;  2JY7 A;  3HHX A;  2QZ4 A;  4LY6 A;  1EOC B;  4FVM A;  1R2Z A;  1QZM A;  2QEN A;  2BUU A;  1LV7 A;  3LMX M;  3E9S A;  4BLC A;  1ZAE A;  4B3R M;  3T15 A;  5LMU M;  3PVS A;  5EXP A;  4I4L A;  1DLM A;  1C1K A;  3DOA A;  4L6V 6;  4WHR B;  2HL7 A;  3U6C A;  4GKK M;  2BJW A;  4LF9 M;  3T67 M;  5F3W A;  1Z5A A;  3O5U A;  3SAS A;  2RGH A;  1DV0 A;  3L27 A;  3PCK M;  3KXE C;  4L78 A;  1K3W A;  1EOA B;  1D0L A;  5IWA M;  2Y21 A;  2KA6 B;  2MRO B;  4ILT A;  3HX3 A;  3L29 A;  3LW5 F;  2AZQ A;  1GL7 A;  1VDL A;  2JA2 A;  1T3T A;  3IEC A;  4EIW A;  3MK6 A;  3U6S A;  4G6Z A;  2UXD M;  1AUA A;  3GQ4 A;  2UU9 M;  2WSF F;  3U61 B;  1EFU B;  1VDD A;  1FNN A;  3U6E A;  4AKG A;  3B7N A;  1TGU A;  1QDR A;  1OFI A;  1WJ7 A;  1LTM A;  3MMP A;  2V6Z M;  3GQ3 A;  4B08 A;  2BUV A;  1WGN A;  2EKF A;  2QQ8 A;  2XF3 A;  3J80 S;  4JI3 M;  5KPR A;  5DNY A;  3U6Q A;  2LVQ D;  2BUX B;  2R44 A;  2XSV A;  3HKP A;  3NWL A;  1QUT A;  4Q7J A;  3L25 A;  1E32 A;  1JB0 F;  1HQY E;  4A3V B;  3A42 A;  4L16 A;  3W68 A;  2BUY A;  1SXJ C;  1IY0 A;  2V1U A;  1TH2 A;  3IG8 A;  2APL A;  4LF7 M;  1AIP C;  2ZAN A;  4G4O A;  4LG2 A;  3R9X B;  4G4Q A;  1NV9 A;  3RGP A;  1QUS A;  2AHM A;  2CHV A;  1YE9 A;  3M6A A;  3WHK A;  4X64 M;  3J81 S;  1PJJ A;  1YKO B;  1EO9 A;  1W5S A;  3J7B A;  2H5X A;  3F92 A;  4QOZ C;  5TD3 A;  1VG5 A;  4HL4 A;  4IBF A;  2JXN A;  5FTL A;  1K3X A;  5ITY A;  1J7K A;  3O32 A;  3HY5 A;  1DO0 A;  2OPF A;  2Z4R A;  4Y28 F;  1R2Y A;  4JI4 M;  4LF4 M;  1EOC A;  3PCL M;  3FE3 A;  4KHP M;  4ZPX A;  3SMS A;  4PCZ A;  3C9P A;  3J2P B;  3QYE A;  3PCB A;  3HGI A;  3SHG B;  8CAT A;  5DYI A;  1EOB A;  2LH0 A;  4OVZ B;  2C99 A;  2JP7 A;  2X8A A;  3E4R A;  3K92 A;  2BUM B;  1IXR C;  1SG9 A;  2BNK A;  3PCE A;  2KZU A;  3GRY A;  2D7H A;  3TE6 A;  3LQR A;  2FE8 A;  3T1H M;  3KS4 A;  4RNA A;  1D0M A;  3PCH A;  3QWL A;  2LNH C;  4CHT B;  5C18 A;  4IBG A;  1L8Q A;  2DXI A;  5LMN M;  2C98 A;  3E21 A;  5EP1 A;  3ZQJ A;  4WHS B;  1WGL A;  2UUB M;  2KW0 A;  4IBJ A;  2ERC A;  2JZ0 A;  2Z7J A;  3U6P A;  2XZF A;  3MI1 M;  4CIZ A;  2Z8Y M;  3AJI B;  4I5S A;  4LRS A;  2F5Q A;  2E5L M;  4WHO D;  1N77 A;  3KOY E;  4B3T M;  4OU7 A;  4AKI A;  5ITT A;  2CFO A;  3MV6 A;  3IHP A;  4GEW A;  1G59 A;  4LGY A;  3U61 A;  4M9X A;  2QNJ A;  4GIT A;  3SYL A;  1GJT A;  1I4W A;  3AOG A;  3B89 A;  3LVW A;  4YHH M;  1TR8 A;  1XNQ M;  2C9O A;  3J7A S;  2BUX A;  4RF0 A;  4WHS D;  4WHR F;  3FTF A;  1NO1 A;  2MR9 A;  2O01 F;  3GRU A;  1R6B X;  2H1R A;  3CF2 A;  4R71 A;  2XEP A;  5E26 A;  4MGY E;  4KO8 A;  2DWL A;  2QCU A;  3EIE A;  2BV0 B;  2LVP C;  4G4N A;  1XB2 B;  1ZQ9 A;  4HEO A;  2L7H A;  1QVR A;  1E9S A;  2LXE A;  5C1B A;  3MFL A;  3D8L A;  1HT2 E;  1J5E M;  2I7P A;  2M5Z A;  2GNO A;  3QYB A;  1XWI A;  4GH9 A;  3LMM A;  1JR3 D;  3LQQ A;  3HHZ A;  3U60 B;  4NOO B;  3SAV A;  2QHO B;  1Z5B A;  2KEB A;  4MGZ E;  4LFA M;  3LVV A;  5KQD A;  4GHL A;  1N78 A;  3MV4 A;  1VEK A;  3AKZ A;  1NJF A;  4B7H A;  3IG5 A;  3VDP A;  3FD9 A;  1IXS B;  1N36 M;  4CJ6 A;  2R65 A;  5BR8 M;  4OVZ A;  2CV2 A;  1RU3 A;  4JI6 M;  2PCD A;  4FCW A;  4WHO A;  1OAO C;  3FRI A;  4JN6 A;  2CV0 A;  2UUA M;  4FWD A;  1HNX M;  3LKT M;  1EIJ A;  2DAK A;  1IBK M;  3Q8G A;  1G4A E;  1XMO M;  5BPV A;  4FWG A;  1PM5 A;  3LXV A;  4NC6 A;  3T38 A;  5IT9 S;  4WHS A;  2J7N A;  3D8B A;  1N32 M;  3PCF A;  3AOE C;  2DI0 A;  3I4Y A;  4NSR A;  4XK8 F;  2MH8 A;  2LTU A;  2K6B A;  4B3M M;  2ZAM A;  1HNZ M;  3O6R A;  4GMQ A;  3PNV A;  1EOB B;  1QQW A;  4G3O A;  3TH1 A;  3GPY A;  3FUX A;  4B7G A;  3GLI B;  4DV1 M;  1YKM B;  4JV5 M;  3MI5 M;  2QPA A;  1TF0 B;  2GQF A;  1TH3 A;  1ZV1 A;  4MM3 B;  3I4V A;  4IBC A;  4X66 M;  3KS8 A;  2ZM6 M;  4P16 A;  1G3I A;  2CP8 A;  1PJI A;  3FKE A;  1JR3 A;  3TWM A;  2JY5 A;  4X65 M;  2F4V M;  1SXJ B;  3DA1 A;  2BV0 A;  2G8L A;  4Z8X A;  3A45 A;  1E9R A;  1OQY A;  2KXE A;  4LFB M;  2R62 A;  3FTC A;  1HT1 E;  2HWJ A;  5ITX A;  3TL4 X;  2DZL A;  2L4E A;  2F5S A;  1R4G A;  1IN8 A;  3B74 A;  3HJQ A;  3LMX A;  1C7Y A;  1BVS A;  2FOI C;  3UJN A;  1GKI A;  4DUY M;  1IN6 A;  4PD2 A;  3U60 A;  3I01 M;  1IFY A;  3T6P A;  2Z4S A;  1SXJ D;  4DR7 M;  3T67 A;  3ZCB B;  3UGJ A;  1DLT A;  3PCI M;  2J7O A;  5FTK A;  3DZD A;  3AOE A;  2EJS A;  5L8R F;  1IXS A;  1N34 M;  3PCK A;  2DAG A;  4XGI A;  4GHA A;  5ITR A;  4JI7 M;  1QAN A;  3PXG A;  2C5R A;  1L1T A;  4II7 A;  4DV6 M;  4UN2 B;  2DWN A;  2XGN A;  3JR4 A;  2VF7 A;  3FUT A;  4LZJ A;  1Q39 A;  1QYR A;  1HJP A;  1VEG A;  3FTD A;  3PCN M;  4QHS A;  3HJ8 A;  1JR3 E;  2L2D A;  3PFI A;  1N33 M;  2BJV A;  4JI2 M;  1J09 A;  4LJ5 A;  2CV1 A;  4ANR A;  3SAU A;  3O6J A;  4AW4 A;  2DAM A;  1GO5 A;  2DAI A;  2LVA A;  2OOB A;  2EKK A;  4AZF A;  3PCG M;  3K9O A;  4WHO B;  3GLI A;  2FH0 A;  2DNA A;  1YKM A;  4HLQ A;  3HHW A;  5ITX E;  1NVM A;  3W0L B;  1I94 M;  3KFU G;  1OJL A;  1YUB A;  4NXM M;  1VEJ A;  1PGY A;  3VKH A;  1JQJ C;  2CHQ A;  2FFJ A;  4LJ8 A;  2XSR A;  4LGM A;  1MJG M;  5EP4 A;  2R4E A;  4DR4 M;  5EQT A;  2BUW A;  4GIP A;  4QHT A;  4JI5 M;  1ORY B;  1Q02 A;  3FYC A;  3PCC M;  4DV2 M;  4LJ7 A;  1L2C A;  2KNA A;  2CWB A;  2O25 A;  3ZC7 B;  2XFS A;  3CGW A;  3FUU A;  1SXJ A;  2XFT A;  5JI3 E;  2BUQ A;  2BUR B;  1S3S A;  5IZ7 D;  2WSC F;  1QAO A;  1R5L A;  5EJC A;  4F2L A;  4CIS A;  3PCL A;  4RKU F;  1PJS A;  3U6L A;  2R46 A;  3PCD M;  1DLQ A;  4AQY M;  2O5R A;  4REZ A;  4FD2 A;  1UM8 A;  1IM2 A;  4ITQ A;  3PCG A;  1YLA A;  4GC9 A;  1DGG A;  1GL6 A;  3B7Z A;  2LHC A;  4MGH A;  3RGS A;  3TWK A;  3H4M A;  1OTR A;  3PCA M;  3T63 M;  4X62 M;  2DVW B;  2UXC M;  5DYG A;  2R6F A;  2L09 A;  3FYD A;  3HZJ A;  3GPX A;  3PCM M;  2L4F A;  4TUW A;  4IJE A;  3QAU A;  4JI8 M;  3PCJ M;  2N35 A;  3C3D A;  4IBK A;  3GLI E;  1F4I A;  1GVN A;  3KOX E;  3MI1 A;  3AL0 C;  1OFH A;  2DAE A;  1G8P A;  3L26 A;  1D0K A;  2CUZ A;  3ILK A;  3I04 M;  1OAI A;  3MHV C;  2LWX A;  3R8F A;  4JI1 M;  3HU1 A;  1IQP A;  3VFD A;  5E6J A;  1XNR M;  1IXZ A;  1S9A A;  2G3Q A;  1MU5 A;  1EE8 A;  2J5Y A;  3SHF A;  2HKJ A;  4JI0 M;  2A5Y B;  1SXJ E;  3K9P A;  3U5Z B;  2RKO A;  2JNH A;  4GC5 A;  3AFH A;  5FSW A;  4DV4 M;  2C96 A;  3M7G A;  1NHG C;  4DR6 M;  4NXN M;  2VQE M;  2EO2 A;  2R45 A;  3DFZ A;  2YFQ A;  2JY6 B;  2LVN C;  1MX0 A;  2KHH A;  2DHR A;  1PRB A;  1WR1 B;  3GRV A;  4WP2 A;  2B3T A;  5FTN A;  3UK6 A;  3KP1 E;  2DWZ B;  4FCT A;  4MGI E;  2Y0Q A;  3GLG B;  5H37 D;  4IBI A;  5FTM A;  4ILV A;  1TTE A;  2ZBK B;  4M9S A;  2HHH M;  4YY3 M;  4PDG A;  2Z3X A;  3U6O A;  4LF5 M;  2BUT B;  2BUR A;  2BUZ B;  1V34 A;  4D82 A;  2V1C A;  5A2Q S;  3J27 B;  3Q8X A;  1HNW M;  5EXT A;  1NY6 A;  2VII A;  4M0W A;  3KDS E;  1T43 A;  1WHC A;  1VQ1 A;  2L6O A;  2BWE A;  2QP9 X;  4LFC M;  5FTJ A;  2UUC M;  4K0K M;  3GLF B;  2DKL A;  4LJ6 A;  2BUW B;  3UMM A;  3LKT A;  4DBG B;  2CRU A;  3FRH A;  3ZH9 B;  2FS1 A; 
#chains in the Genus database with same CATH homology
 1NHW C;  4NL4 H;  3GO8 A;  1KFV A;  2BUQ B;  4DR2 M;  1XMQ M;  4DUZ M;  4OW0 A;  2BOY A;  4PT5 A;  1TDZ A;  4W5W A;  1Z6T A;  4R7G A;  4DV3 M;  5KPZ A;  3FUV A;  2F5P A;  4IBE A;  1DGH A;  1WXQ A;  3SAW A;  1HQC A;  1N75 A;  1NJG A;  3HJS A;  3MI5 A;  5KPT A;  3NBI A;  3KSX A;  3N9T A;  4RF1 A;  3RE8 A;  3EIH A;  1XXH B;  5FLX S;  3SAT A;  3GLH B;  3KOW E;  4JXJ A;  2XSZ D;  4M0D A;  1DMH A;  3U5Z A;  4WHP B;  3HHY A;  2KRK A;  3VK7 A;  3KVW A;  2D7G A;  3TWL A;  4NSO B;  1Q3B A;  4FW9 A;  4NRV A;  3THG A;  2Q2E B;  3MJ5 A;  4JYA M;  2DZN B;  3GQ5 A;  3SAR A;  1YKN A;  3M0E A;  1KYI A;  3PCB M;  4M9Z A;  4IJF A;  2G5G X;  3CTW B;  3A98 B;  4QNM A;  3SC3 A;  4BBA A;  3GLG A;  2RGO A;  3PCE M;  1EO2 B;  3A46 A;  4AG5 A;  4WHP D;  1XHB A;  2KRU A;  5KQ8 A;  5JI2 E;  3VK8 A;  2BUT A;  2BUZ A;  4LRT A;  2YQZ A;  4MGK E;  3GP1 A;  2F5O A;  1IN4 A;  3PCH M;  3I51 A;  3W0F A;  4XBO A;  3HWS A;  1NNJ A;  1G41 A;  3PCI A;  1QAQ A;  2L7I A;  4L8R C;  4I8O A;  1NNU C;  3JR5 A;  1DGB A;  4LF8 M;  2HCB A;  4LCB A;  1L2D A;  2F5N A;  3GLF A;  1IY2 A;  3HU3 A;  3L28 A;  3SMP A;  3GPU A;  1IN5 A;  5GKN A;  2UXB M;  2OQ4 A;  3MV6 M;  3GPP A;  2Y0T A;  4LJ4 A;  4LJA A;  2XZU A;  1FJG M;  2D7E A;  3TQS A;  4WHQ B;  4Z6Y A;  4BB9 A;  4DV5 M;  1YKP B;  3K1J A;  3PCN A;  2R18 A;  2XSZ A;  4D80 A;  1GLN A;  4DR3 M;  4S12 A;  1L2B A;  1IY1 A;  2Y20 A;  2QBY B;  4WHR A;  5ITQ A;  4PDI A;  1HR0 M;  5EXS A;  1IBM M;  5EXX A;  1YKL B;  4G4R A;  3JAM S;  1D2N A;  4R3D A;  4WUR A;  3GRR A;  1W5T A;  5ITU A;  1EOA A;  1DGF A;  2FNA A;  1YKK B;  1TH4 A;  1XXH A;  3MFL M;  3GLH A;  4IIW A;  3VLF B;  1IBL M;  4AI6 A;  2M60 A;  2BUU B;  1TDH A;  2XLJ A;  4MH0 E;  4WHP A;  4DR5 M;  1X37 A;  4LF6 M;  3HU2 A;  3PCC A;  3KSJ A;  5EP2 A;  2CE7 A;  2CHG A;  3AV0 A;  3WHL A;  3U6M A;  1Z59 A;  1NSF A;  4IBB A;  3CF0 A;  4AKH A;  3MV4 M;  2EA0 A;  4GRI A;  1DO2 A;  1DGH B;  3K8Z A;  1KSF X;  5IRE B;  2NQ8 C;  3UZU A;  1XC8 A;  3KP0 E;  1QAM A;  3PNY A;  1NY5 A;  3TPZ A;  4D81 A;  2XH9 A;  3PCD A;  4DV0 M;  2CEA A;  1K82 A;  1EO2 A;  4AG6 A;  2PCD M;  3B9P A;  1Q3C A;  3KW6 A;  2DWM A;  2VQF M;  2W82 A;  4GKJ M;  2YR0 A;  4LJ9 A;  3L2A A;  2P5T A;  1L1Z A;  4QNR A;  4IBD A;  2XSU A;  2X49 A;  2R4J A;  4CGY B;  2C9C A;  3LXV M;  1E94 E;  4KOD A;  1YKO A;  3PCA A;  3VKG A;  3T63 A;  3OTO M;  2EUC A;  1YKN B;  3PCF M;  4L15 A;  3PCM A;  2BUV B;  2KZS A;  4QOS A;  4OX9 M;  3SBJ A;  5KO3 A;  3PCJ A;  1YSY A;  3RFW A;  3C58 A;  2X4A A;  2DZO B;  1IN7 A;  2BUY B;  2ZAO A;  4L4U A;  4LZZ A;  1H6U A;  2K47 A;  4WW0 A;  3T1Y M;  4WHQ A;  1R7R A;  4NRW A;  3FUW A;  3SYK A;  3BOS A;  5EP3 A;  1YKP A;  4DR1 M;  3K2L A;  4I81 A;  4MB7 A;  3VDU A;  4DV7 M;  2BUM A;  3CF6 E;  4FWH A;  4KLN A;  2I7N A;  2QBY A;  1EO9 B;  4B3S M;  3FTE A;  1YKL A;  3KOZ E;  4B7F A;  3SFZ A;  2YNM D;  1Z5C A;  4FCV A;  3U6D A;  1YKK A;  7CAT A;  3HHX A;  4LY6 A;  2QZ4 A;  1EOC B;  4FVM A;  1R2Z A;  1QZM A;  2QEN A;  2BUU A;  1LV7 A;  3LMX M;  3E9S A;  4BLC A;  1ZAE A;  4B3R M;  3T15 A;  5LMU M;  3PVS A;  5EXP A;  4I4L A;  1DLM A;  1C1K A;  3DOA A;  4WHR B;  2HL7 A;  3U6C A;  4GKK M;  2BJW A;  4LF9 M;  3T67 M;  5F3W A;  1Z5A A;  3O5U A;  3SAS A;  2RGH A;  3L27 A;  3PCK M;  3KXE C;  4L78 A;  1K3W A;  1EOA B;  5IWA M;  2Y21 A;  2KA6 B;  4ILT A;  3L29 A;  2AZQ A;  1GL7 A;  2JA2 A;  1T3T A;  4EIW A;  3MK6 A;  3U6S A;  4G6Z A;  2UXD M;  3GQ4 A;  2UU9 M;  3U61 B;  1VDD A;  1FNN A;  3U6E A;  4AKG A;  1TGU A;  1OFI A;  2V6Z M;  3GQ3 A;  4B08 A;  2BUV A;  3J80 S;  4JI3 M;  3U6Q A;  2XF3 A;  5KPR A;  5DNY A;  2BUX B;  2XSV A;  3HKP A;  3NWL A;  3L25 A;  1E32 A;  1HQY E;  2BUY A;  4A3V B;  3A42 A;  4L16 A;  1SXJ C;  1IY0 A;  2V1U A;  1TH2 A;  3IG8 A;  4LF7 M;  2ZAN A;  4G4O A;  4LG2 A;  3R9X B;  4G4Q A;  3RGP A;  1TMX A;  2AHM A;  2CHV A;  3M6A A;  1YE9 A;  3WHK A;  4X64 M;  3J81 S;  1PJJ A;  1YKO B;  1EO9 A;  1W5S A;  3J7B A;  4QOZ C;  5TD3 A;  4IBF A;  4HL4 A;  5FTL A;  1K3X A;  5ITY A;  1J7K A;  3O32 A;  1DO0 A;  2OPF A;  2Z4R A;  1R2Y A;  4JI4 M;  4LF4 M;  1EOC A;  3PCL M;  4KHP M;  4ZPX A;  3SMS A;  4PCZ A;  3PCB A;  3J2P B;  3HGI A;  3SHG B;  8CAT A;  5DYI A;  1EOB A;  2LH0 A;  4OVZ B;  2C99 A;  2X8A A;  3E4R A;  3K92 A;  2BUM B;  3PCE A;  1IXR C;  2BNK A;  2KZU A;  3GRY A;  2D7H A;  3TE6 A;  3LQR A;  2FE8 A;  3T1H M;  3KS4 A;  4RNA A;  3PCH A;  3QWL A;  2LNH C;  4CHT B;  5C18 A;  4IBG A;  1L8Q A;  2DXI A;  5LMN M;  2C98 A;  4WHS B;  5EP1 A;  2UUB M;  2KW0 A;  4IBJ A;  2Z7J A;  2ERC A;  3U6P A;  2XZF A;  3MI1 M;  4I5S A;  3AJI B;  4LRS A;  2F5Q A;  2E5L M;  4WHO D;  1N77 A;  3KOY E;  4B3T M;  4OU7 A;  4AKI A;  5ITT A;  2CFO A;  3MV6 A;  1G59 A;  4LGY A;  3U61 A;  4M9X A;  3SYL A;  4GIT A;  1I4W A;  3AOG A;  3LVW A;  4YHH M;  1XNQ M;  2C9O A;  3J7A S;  2BUX A;  4RF0 A;  4WHS D;  4WHR F;  3FTF A;  3GRU A;  1R6B X;  2H1R A;  3CF2 A;  2XEP A;  5E26 A;  4MGY E;  4KO8 A;  2DWL A;  2QCU A;  3EIE A;  2BV0 B;  4G4N A;  1ZQ9 A;  2L7H A;  1QVR A;  1E9S A;  2LXE A;  5C1B A;  3MFL A;  3D8L A;  1HT2 E;  1J5E M;  2I7P A;  2M5Z A;  1XWI A;  4GH9 A;  3LMM A;  1JR3 D;  3LQQ A;  3HHZ A;  3U60 B;  4NOO B;  3SAV A;  1Z5B A;  2KEB A;  4MGZ E;  4LFA M;  3LVV A;  5KQD A;  4GHL A;  1N78 A;  3MV4 A;  3AKZ A;  1NJF A;  4B7H A;  3IG5 A;  3VDP A;  3FD9 A;  1IXS B;  1N36 M;  2R65 A;  5BR8 M;  4OVZ A;  2CV2 A;  4JI6 M;  2PCD A;  4FCW A;  4WHO A;  4JN6 A;  2CV0 A;  2UUA M;  3LKT M;  4FWD A;  1HNX M;  1IBK M;  1G4A E;  1XMO M;  5BPV A;  4FWG A;  1PM5 A;  3LXV A;  3T38 A;  5IT9 S;  4WHS A;  2J7N A;  3D8B A;  1N32 M;  3PCF A;  3AOE C;  4NSR A;  3I4Y A;  3O6R A;  4B3M M;  2ZAM A;  1HNZ M;  4GMQ A;  3PNV A;  1EOB B;  1QQW A;  3TH1 A;  3GPY A;  3FUX A;  4B7G A;  3GLI B;  4DV1 M;  1YKM B;  4JV5 M;  3MI5 M;  2QPA A;  1TH3 A;  4MM3 B;  3I4V A;  4IBC A;  4X66 M;  3KS8 A;  2ZM6 M;  4P16 A;  1G3I A;  1PJI A;  3FKE A;  1JR3 A;  3TWM A;  2BV0 A;  4X65 M;  2F4V M;  1SXJ B;  3DA1 A;  2G8L A;  4Z8X A;  3A45 A;  1E9R A;  2KXE A;  4LFB M;  2R62 A;  3FTC A;  1HT1 E;  2F5S A;  5ITX A;  3TL4 X;  3HJQ A;  1IN8 A;  3LMX A;  2FOI C;  3UJN A;  1GKI A;  4DUY M;  1IN6 A;  4PD2 A;  3U60 A;  2Z4S A;  1SXJ D;  4DR7 M;  3T67 A;  3ZCB B;  3UGJ A;  1DLT A;  3PCI M;  2J7O A;  5FTK A;  3DZD A;  3AOE A;  3PCK A;  1N34 M;  4XGI A;  4GHA A;  5ITR A;  4JI7 M;  1QAN A;  3PXG A;  2C5R A;  1L1T A;  4II7 A;  4DV6 M;  2DWN A;  2XGN A;  3JR4 A;  4LZJ A;  3FUT A;  1Q39 A;  1QYR A;  3FTD A;  3PCN M;  4QHS A;  3HJ8 A;  1N33 M;  3PFI A;  2BJV A;  4JI2 M;  1J09 A;  4LJ5 A;  2CV1 A;  3SAU A;  3O6J A;  4AW4 A;  3PCG M;  4AZF A;  4WHO B;  3GLI A;  1YKM A;  4HLQ A;  3HHW A;  5ITX E;  1NVM A;  3W0L B;  1I94 M;  3KFU G;  1OJL A;  1YUB A;  4NXM M;  3VKH A;  1JQJ C;  2CHQ A;  2FFJ A;  4LJ8 A;  2XSR A;  4LGM A;  5EP4 A;  2R4E A;  4DR4 M;  5EQT A;  2BUW A;  4GIP A;  4QHT A;  4JI5 M;  1ORY B;  3FYC A;  3PCC M;  4DV2 M;  4LJ7 A;  1L2C A;  3ZC7 B;  2XFS A;  3FUU A;  2BUQ A;  1SXJ A;  2XFT A;  5JI3 E;  2BUR B;  1S3S A;  5IZ7 D;  1QAO A;  5EJC A;  4CIS A;  3PCL A;  3U6L A;  3PCD M;  2R46 A;  1DLQ A;  4AQY M;  2O5R A;  4REZ A;  4FD2 A;  1UM8 A;  1IM2 A;  4ITQ A;  3PCG A;  4GC9 A;  4MGH A;  1DGG A;  1GL6 A;  3RGS A;  3TWK A;  3H4M A;  3PCA M;  3T63 M;  4X62 M;  2DVW B;  2UXC M;  5DYG A;  2L09 A;  3FYD A;  3GPX A;  3PCM M;  4TUW A;  4IJE A;  3QAU A;  4JI8 M;  3PCJ M;  4IBK A;  1GVN A;  3KOX E;  3MI1 A;  3AL0 C;  1OFH A;  1G8P A;  3L26 A;  2CUZ A;  3ILK A;  3MHV C;  2LWX A;  3R8F A;  4JI1 M;  3HU1 A;  1IQP A;  3VFD A;  5E6J A;  1XNR M;  1IXZ A;  1S9A A;  1MU5 A;  1EE8 A;  3SHF A;  2HKJ A;  4JI0 M;  2A5Y B;  1SXJ E;  3U5Z B;  2RKO A;  4GC5 A;  3AFH A;  5FSW A;  4DV4 M;  2C96 A;  3M7G A;  1NHG C;  4DR6 M;  4NXN M;  2VQE M;  2EO2 A;  2R45 A;  3DFZ A;  2YFQ A;  1MX0 A;  2DHR A;  3GRV A;  5FTN A;  3UK6 A;  3KP1 E;  2DWZ B;  4FCT A;  4MGI E;  2Y0Q A;  3GLG B;  5H37 D;  4IBI A;  5FTM A;  4ILV A;  2ZBK B;  4M9S A;  2HHH M;  4YY3 M;  4PDG A;  2Z3X A;  3U6O A;  4LF5 M;  2BUT B;  2BUR A;  2BUZ B;  4D82 A;  2V1C A;  5A2Q S;  3J27 B;  3Q8X A;  1HNW M;  5EXT A;  1NY6 A;  2VII A;  4M0W A;  3KDS E;  2QP9 X;  2L6O A;  4LFC M;  5FTJ A;  2UUC M;  4K0K M;  3GLF B;  4LJ6 A;  2BUW B;  3UMM A;  3LKT A;  3ZH9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...